3M63B

Crystal structure of ufd2 in complex with the ubiquitin-like (ubl) domain of dsk2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/protein binding
molecule keywords Ubiquitin conjugation factor E4
publication title The yeast E4 ubiquitin ligase Ufd2 interacts with the ubiquitin-like domains of Rad23 and Dsk2 via a novel and distinct ubiquitin-like binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m63B00
4BFRA 4I6PA 1FXTB 3HIZA 2CHXA 1WZ3A 2DZIA 4G0NB 2JRHA 3W1YA 3GZNI 4ANVA 4MELA 4BOSC 4NNJB 5BO4B 2D11A 2HJ8A 2K6QA 5JHAA 2GBJA 2FIDA 4HXDA 2LVOA 1E5WA 4IWPA 2L3ZA 1EF1A 2C5LC 3VHTC 3UF8A 3K9PB 3PRPB 4JL9A 1YD8U 5CTRC 3Q3JA 3ZNHB 2KDFB 2LXCA 1RLFA 3L16A 3IHPC 2G45B 3TMPB 3X23A 4EUTA 4ICUA 3RYTA 3R7QA 2BYFA 4OVUA 4BKTA 4M8NA 4KZCA 1OEYA 5IAAC 2KOXA 2CHWA 4XZ4A 2MCNB 2JZZA 2LGDA 2KMCA 2DYMA 3DBHI 4HCPB 1R4NI 2ZZPB 1WJUA 2GBRA 2KFJA 4J6IA 2HTHA 4XC2A 3WANA 2DAFA 4XX5A 2LVPA 4PS7A 1GJZA 4DHZB 2ZJDA 3JVZX 1I42A 5JH5C 4JQWC 2ZVOA 3KUZA 4KSLC 1V5TA 2AEHA 4FADA 4DDID 2DENB 3PLVA 4NPNA 2FCMA 4ZDVA 4DHJB 1WJ6A 1M94A 3QQ8B 1U4AA 2N9EB 3U30A 2PEAA 1VD2A 4B9KA 2K6DB 1GG3A 2MLBA 3NY5A 1KM7A 3OLMD 2XBBC 1Z2MA 3NZSA 4NY0A 2V1YA 2HD5B 2D3GA 4FULA 1GNUA 4PYUA 4BKSD 2NBUA 4P7IA 2DZMA 1T0YA 2LJ5A 3TL5A 4IM3A 1ISNA 1EF5A 3C0RB 3PZDA 4BKSA 1H4RA 4OVVA 3ZDMC 1Q0WB 4DWFA 2IY1B 4HK2A 1KLVA 1P98A 2KWVB 4FBJB 1AARA 1Q5WB 1E8ZA 2GBMA 4FA6A 4A3PA 1E90A 1YX6B 3B08A 2N9PC 2PPHA 3QIJA 4ZRIA 3A9JB 3A9JA 3PSEB 4FN2A 3ZTDA 1TGZB 4AP4C 2L05A 5L95C 1OGWA 3UIPB 2CHZA 2G4SA 2J0MA 2MBEA 3L0WB 5E6OA 2IO1B 4TQ0A 2BPSA 2GBKA 4BBNC 1OQYA 3ZNZB 4GGQA 2YVCA 2KHWB 2KC2A 3VUYA 1NDDA 1YQBA 3H7PB 3H7PA 2KTRB 4WQOB 2Y5BB 2KTRA 2DZKA 2KXJA 2Z0EB 3M62B 1E8WA 4MEMA 1GUAB 3ZIMA 2KJRA 1IYFA 3NS8A 2EKEC 5E6NA 2GOWA 1V49A 4NQLB 2DX5B 3TCAA 2N4FA 1WGGA 4FHJA 3AU4A 2AYOB 3VQIA 2NCNA 3VTWA 4GU2A 3KH0A 1LM8B 3A1QB 4I6NB 3A1QA 3O65B 1WZ0A 2BKRB 3QC8B 2JXXA 2PE6B 3QAQA 4FJYA 2DZJA 2JF5A 4CO7A 4GSWA 3L54A 5GMVA 3HM6X 1RAXA 2JT4B 2KJHB 2K8CA 3H9DA 3ENEA 4YL8A 5G2NA 4TKNA 3WAPA 1L7YA 1XQQA 2L7RA 3HK0A 3OAWA 3V60A 1LFDA 5CHFA 5AZGA 2M4NA 1WFYA 2XEWA 3KVFB 4RM9A 2IZVB 2CKHB 4LJOB 1YX5B 5FR6A 2KLGA 2N9XA 2FUHB 1WGRA 1YIWA 2GMIC 3PT2B 4GIVA 2G4DB 2K25A 5C23A 3R66C 2KQ7A 3U8ZA 3ECIA 3QWZB 2BYEA 2M8SA 3ZRFA 2KJ6A 4N9F4 3R3MA 4A20A 4W9GA 2FCSA 3ZO5B 2GBNA 2M0XA 4E74A 4GDKB 2D2QA 4WAAA 4WWPA 4GDKA 3RUIB 3N3KB 3ZRCA 1RRBA 4M0WB 2LI5A 5E6PA 2ZPYA 3MJWA 4AJYB 3ZDTA 3V6CB 4II3B 4FJZA 3RZWC 2O2VB 2J7QB 3AI5A 3PREA 2O2VA 2IYDB 5LXHA 4BBNF 5LXIB 4HWIB 1BT0A 4ANXA 1V5OA 2N7DA 1KJTA 2L0FA 1UH6A 4JIOU 3AULA 4NQKE 3RD2A 3VTUA 2KX0A 2V3SA 4KV2A 1WX9A 3ONSA 2AL6A 3LDZE 2WX1A 2EMTA 3VH3B 1J19A 3QCAA 1D3ZA 3D32A 2KFKB 3A33B 1WF9A 2KFKA 4F1SA 2FIFA 2C9WB 1WXMA 2CU1A 3QHTA 4PS8A 4BKGA 5DPTA 1WXSA 2LZ6A 3ALBA 4DHJD 2B3AA 1SE9A 4ICVA 3MHSD 2NBWB 3EFUA 2KC1A 3T8MA 5IA7A 3L17A 3PV1A 2J0JA 1V80A 3IFWB 5J2RA 4HCNB 1UBQA 2A4ZA 3K9OB 4IWOA 2KWCA 2LVQA 3VVWB 2JVCA 2C7HA 4AJWA 2G3QB 4AOFA 5J17A 2IO0B 2PJHA 5JHBA 2REXA 3PPAA 1WY8A 2LRWA 2DAJA 2KK8A 4HJKA 1WJNA 2RD0A 1WJ4A 2NPTB 4K7UA 2NPTA 1C1YB 4MSQB 1QZEA 2KLCA 3DVGX 5C1ZA 2BWFA 2N7EA 4W9FA 1WE7A 3VXWA 3SU8X 4M8MA 4MGKE 3M3JA 2R2OA 3RT3B 3IG3A 3VH4B 2FAZA 4IG7B 3H7SA 4B6WA 2KDIA 2MBBB 3PTFC 4K7SA 2LGXA 4HPMB 1V9JA 3W1SC 1WGHA 2K8BA 2D10A 2FNJB 2IO3B 2KTFA 4KDLB 2EMSA 3NZUA 2CR5A 3B0AA 4GDLB 4GDLA 1WR6E 3CSFA 1WI0A 2YLMA 5TR5A 1H8CA 3MTNB 3VFKA 1GC7A 4DBGA 2LASA 4TV3A 4URKA 5CHWA 3DDCB 4FJVB 3IBEA 2RGFA 4DXAB 1V6EA 1WR1A 3DBSA 1ZGUB 4IM2A 4EFOA 4KDIC 4KZ0A 2K1FA 3N32A 1WGYA 4LDTD 2LWPA 5G55A 1WMHB 4W9EA 3W1SA 1WMHA 1ZW7A 5D2MB 1P3QU 2W9NA 3T9LA 4EEWA 2NBVB 2UYZB 2ZCBA 3VUXA 4LDTB 3V62A 1XD3B 4W9LA 3QX1A 2BKFA 4WJPA 4GMVA 1KOTA 2JWZA 4MGZE 2LRUA 3PLUA 3L13A 4X57B 3WAOA 4K1RB 5AEKB 3HHMA 3JYUA 4E3CA 4W9CA 1NI2A 1WYWB 3LJ3A 3PS6A 2VRRB 3UQBA 4NJ6A 1EUVB 1RFAA 3KYCD 3BINA 2JY6A 2MSED 2UWQA 4IW0A 4HDQA 3I3TB 4EZLA 1WRDB 3EECA 2JUOA 2DYBA 1J8CA 3VDZA 4LCDE 1F9JA 2K8HA 2C7MB 1G6JA 1UGMA 5D6JB 1E8YA 2BF8B 1X1MA 2I1KA 4W9DA 4ANWA 1E7VA 1WM3A 1E7UA 3H6NA 2WYQA 2WX0A 2KNBA 2ZEQA 3VAWA 1SGHA 4DDGD 3RCZA 3ZVVA 1UD7A 2BYVE 3M95A 3OJ4B 4NAWB 2WWZA 4BOZB 4NAWA 2LUEA 1UELA 3H1UA 4PYZA 2NR2A 3JSVB 3TIXA 3APDA 3JSVA 3APCA 2ZCCA 3V61A 4MDKE 2MBHA 3PRMB 3BY4B 4MSMB 1WIAA 3ZKJC 1K8RB 4AUQC 2A5UA 5J18A 1S1QB 4MH0E 1J0GA 1VCBA 1MG8A 3EHVA 3AU5A 4IC7B 3A4RA 4WJNA 1SIFA 4TUUA 4WJOA 2KN5A 3ZUNA 4F7ZA 2DHZA 2QHOA 2MP2B 1V2YA 1OTRB 1TZ1A 2M17A 2MP2A 5AZFA 1A5RA 4K81A 3SHQA 4F8CB 4MGIE 2MRPA 1LQBA 4GN1A 2L76A 1Q1OA 3DQVA 2C60A 2O6VD 4II2B 2MW5A 5DCNA 1Y8RC 3ZTCA 4PS3A 2IBIB 4EKUA 1UBIA 3QARA 3L10B 5CHVC 4EZJA 4ZRJA 2O6VB 4RMAA 2O6VA 4WWOA 4FHKA 5CX3A 5DPSA 2MA9B 4EOYA 3DPDA 3QJZA 2OOBB 3X0WA 1P1AA 3ZW3A 4BVUC 2C7NB 3JW0X 3L08A 4I6LB 4W9IA 1E8XA 3TBLD 5D7GA 1LXDA 2IO2B 2KANA 1IPGA 3WALA 1ZKHA 4EZKA 1XT9B 4WWNA 3APFA 2LXAA 2OJRA 3KUDB 2ZVNA 3ML9A 3A9KB 2M1MA 3A9KA 3CMMB 4GOCA 5DPRA 2KDEB 2V4LA 1WH3A 2J0KA 3KYDD 2MQJA 3S2AA 3IVFA 5KHQA 2MX2A 4HLEA 3UQAA 4E71A 2RSUA 1V86A 1CMXB 1EO6A 1JRUA 2DYOA 2MWSB 3DVNU 4IM0A 4KVGB 2LGYA 2KDBA 3SDLC 4HVBA 1WM2A 3GOEA 1HE8A 5D94A 3OJ3A 4GB9A 5LLIA 5HKHA 2HE7A 3VUWA 5JZEB 1L2NA 1GC6A 2ZPNA 3UGBB 3N30A 3DVNV 2BGFA 2KD0A 3PVLA 3CF6E 2KQSA 3PRZA 3PGEA 4JGHB 3DOWA 3ZNGC 1C3TA 3Q3FA 1UZXB 3KUCB 4HDOA 1TBEA 2KO3A 2KX3A 3NHEB 2KWUB 4G11A 2BWES 3PHWB 4A3OA 2XK5B 5L83A 2JPHA 2XK5A 1Z5SB 2WDTB 5DPWA 3AXCA 2KKCA 1R4MI 2NVUI 4IWQA 4HPLB 3NOBA 4TQ1A 2FCQA 2AWTA 2KMAA 1YJ1A 2D07B 2L0TA 2CS4A 3B1LX 3VTVA 1NBFC 3ZNID 4ASWC 4AWJA 4G50A 4DHZE 3QK0A 2KVRA 4CHKA 3DBRI 5AZHA 3RULA 3TJPA 3WAMA 2Z59B 4B95A 3CSTA 1WX8A 3P2BA 3HM3A 4W9KA 3V6EB 2N1WA 3RZFA 3UINB 2FCNA 4IUMB 3ZLZA 2K39A 2ASQA 3R7RA 2ZNVC 2PE9A 3UIOB 1PQSA 4RM8A 3DVGY 1IP9A 3KW5B 2R2QA 3ML8A 1WXVA 3WIMA 4ZRKA 2N1VA 4LJPB 4MJSB 2MBQA 2AL3A 4K7WA 4MJSA 4ZYNA 2RPQA 2KZRA 3M63B 1WE6A 2JRIB 2I1JA 2LD9A 3EC8A 1WXAA 3SD5A 2JZ3B 3DBLI 4ANUA 2RR9A 4GXBA 1S3SG 1V81A 2L00B 3QA8A 4G3XB 3U7DA 4FLHA 2IY0B 2L8JA 2ZNVB 4W9JA 1OEYJ 2NS5A 2Z0DB 4CYEA 4MM3A 3A4SC 1P9DU 3PHXB 5EDSA 1I35A 4KIKB 1TTNA 4MGYE 4KIKA 4WJQA 3WA0A 4JLCA 4DK5A 3DCGA 1WX7A 5KHOA 1WGDA 4KSKC 2MBOA 1P0RA 4NJ7A 4W9HA
chains in the Genus database with same CATH superfamily
2WGSA 4ARIA 4BFRA 4I6PA 5EE9A 2X38A 1WZ3A 3ZQ4A 4ANVA 3GZNI 4NZLB 2D11A 5JXVA 2FIDA 4HXDA 1LO5D 1EWYC 1EF1A 2K3UA 3VHTC 1M4VA 2X8XX 1YD8U 5CTRC 2LXCA 2NTTA 1N62A 3AE8B 3TMPB 4FXCA 1IGDA 4BKTA 2YEPF 1FNVA 1JWBD 4KZCA 2CHWA 2DBYA 2LGDA 3DBHI 4HCPB 3BVMA 2GBRA 4J6IA 2WXPA 3WANA 4DHZB 4M00A 4NJCA 3GB1A 1YN5A 2INDC 1TY0A 3KUZA 2B76B 4HROA 2DENB 4ZDVA 2VZKB 1M94A 3QQ8B 2BW2A 2NTSA 1KM7A 3Q8BA 3NZSA 2GRIA 4BKSD 2M19A 2NBUA 3AEGB 3TL5A 2BVCA 4IM3A 1ISNA 4DWFA 2IY1B 1AARA 2GBMA 2BQQA 2D5GA 1E90A 4ZRIA 1C78A 1SJHD 1N5WA 3UIPB 4D2KA 2CHZA 2MBEA 3HUIA 3ZNZB 1PGBA 2YVCA 2KHWB 5EE1A 3Q8AA 1NDDA 1YQBA 2DZKA 2KXJA 4MEMA 1E8WA 4Q2JA 2KJRA 1IYFA 1N61A 5E6NA 5BYRA 3AM9A 2DX5B 3IAM1 2N4FA 4FHJA 2AYOB 3VQIA 3VTWA 3KH0A 3MJ5A 1WZ0A 5H92C 2DZJA 4MT5A 4GSWA 1ENFA 5GMVA 3HM6X 1RAXA 2JT4B 1E6EB 5TSSA 4XDCA 3I57A 1V8CA 1L7YA 3V60A 5CHFA 5AZGA 2JYTA 2XEWA 4LJOB 3WCQA 2MJEA 2N9XA 2FUHB 1YIWA 3VR8B 2K25A 2WHIA 5C23A 2KQ7A 3NG0A 1YJIA 3ECIA 3QWZB 3C19A 3ZRFA 4N9F4 4RGTA 3R3MA 4A20A 1N5XA 2FCSA 3W2DA 2M0XA 4KGTA 2D2QA 4RGNA 1RRBA 4M0WB 2LI5A 4M0WA 4AJYB 4FJZA 1TS3A 5LXHA 4BBNF 4HWIB 1BT0A 4ANXA 2L0FA 3AULA 1HZ5A 3VTUA 1HQRD 2AL6A 1PGAA 2MEKA 1D3ZA 1JWUD 4PS8A 1JW9D 1PUTA 2OHFA 3HVDA 1SE9A 1YQ4B 1QOGA 3T8MA 1V80A 3T3NA 1UBQA 2A4ZA 3BVZA 3SFEB 2JVCA 2H88B 3P4QB 2LRWA 3NVYA 1WJ4A 3V3XA 3B2FA 4KX6B 2KLCA 3V05A 1KRHA 3IT4B 3E56A 2PMVA 3RT3B 4K3BA 4IG7B 4B6WA 3E9SA 3SFDB 3PTFC 4K7SA 2GB1A 4HPMB 2KWDA 4BZAA 2FNJB 1TKEA 1SXTA 5BYQA 5TR5A 2LASA 2QDFA 4BAXA 2V4IB 2LHEA 1DGJA 5G55A 2KAJA 5D2MB 1P3QU 4RH6A 4LDTB 4B0MA 3DWGC 1C77A 3QX1A 2BKFA 2LRUA 3L13A 1D5ZC 1NI2A 2LGIA 3PS6A 2W3RA 1EUVB 1RFAA 4RGMA 2MJ3A 3KYCD 1Y56A 2E3TA 3GZNB 4HDQA 5IOIA 1WRDB 2DYBA 3VDZA 2C7MB 2Y5CA 4REZA 3I9V1 1UGMA 1G6JA 1E7VA 3O13A 3VAWA 3P4RB 3RCZA 1UD7A 3N1ZC 4NAWB 5BYSA 4NAWA 2LUEA 1UELA 4PYZA 1L4DB 3JSVB 3JSVA 5AUIA 3BY4B 4LNFA 1FFUA 1YN4A 2WXFA 4MH0E 1QKZA 1JRPA 2DHZA 2MP2B 5AZFA 2M17A 2MP2A 4K81A 3SHQA 1LQBA 1F77A 2O6VD 4II2B 1Y8RC 3QARA 4RMAA 4FHKA 5CX3A 1JALA 1SB3C 2C7NB 2K5PA 3WALA 1IPGA 2FBWB 4YTPB 4WWNA 3KUDB 3ML9A 1UNSA 4GOCA 2EELA 1TS5A 5DPRA 2INCC 2MQJA 3S2AA 3IVFA 1K52A 1FCCC 1TJEA 1JRUA 4KVGB 2V0GA 2W54A 4IKGA 3GOEA 2LEKA 2WS3B 5HKHA 1ESFA 2ZPNA 3RFZB 3AE6B 3MC8A 3PRZA 1C4PA 1YOVB 3ZNGC 1UZXB 1XLPA 4HDOA 3NHEB 1EU4A 2KWUB 2BWES 2HJ1A 3PHWB 1TS2A 3PZ8A 2XK5B 4A3OA 2IGGA 2XK5A 4YTNB 2PLPA 3FAHA 1PYWD 1R4MI 4YSYB 4HJGE 1Q10A 3RNFC 3NOBA 5FKAC 4TQ1A 1I7HA 2KMAA 3B1LX 3AB5A 4DHZE 3QK0A 2WXNA 3VR9B 2KMMA 5D3DA 1WX8A 2BBCA 3ZLZA 2K39A 2OEDA 1XF5L 3RNEC 4RM8A 1IP9A 3ML8A 4AS1A 1WXVA 3AE1B 4ZRKA 1FEHA 4LJPB 4MJSB 1VR9A 2MBQA 4MJSA 2WXKA 2RPQA 1KFYB 1T0RC 2KZRA 4ACFA 2RR9A 1WSPA 5HHDG 4PK1A 2WXJA 4CYEA 4MM3B 4MM3A 4P1BC 1TTNA 1FPYA 3BYTB 1I4XA 1HXYD 3HIZA 2INNE 3W1YA 4MELA 4NNJB 4B0EA 2K6QA 4XDDA 5JHAA 4US9A 2GBJA 3P4PB 1E5WA 3J9CA 2BB6A 3UF8A 4WQMA 3Q3JA 3ZNHB 4ICUA 1EM7A 4OVUA 5IAAC 4XZ4A 5BMGA 1WXQA 1XO3A 1R4NI 2TSSA 4HEA1 1FCLA 1WJUA 4CQNA 2DAFA 4XX5A 1QILA 2LVPA 1GJZA 1HTOA 3JVZX 1I42A 5JH5C 4JQWC 3TSSA 1CZPA 4KSLC 2AEHA 4FADA 4DDID 3PLVA 1RM6C 3IT6B 2WLBA 1NI3A 2PEAA 2K6DB 1GG3A 3TEYA 2SEBD 3OLMD 2XBBC 1XCTL 2WP9B 3Q3MC 1GNUA 1ROEA 4PYUA 4A6QA 4RCOA 3W9CB 1EF5A 2NMQA 1H4RA 4C00A 4OW0A 4JWUC 3NUHB 2IDYA 4FA6A 1YX6B 3B08A 4PT5A 5EE0A 4AP4C 5L95C 1OGWA 1BXTA 4TQ0A 4BBNC 1OQYA 3N1YC 1MVKA 3H7PB 3H7PA 3GS2A 1GUAB 2XN9C 3NS8A 2EKEC 3TCAA 3AU4A 3FILB 3FILA 4I6NB 2PE6B 4FJYA 4CO7A 4RGOS 1K53A 3ETRA 2KJHB 4GLSC 4YL8A 3ENEA 3WAPA 1KLUD 3BIID 3HK0A 1YNTE 1GAQB 1AWDA 2CKHB 4JWSC 1YX5B 3NVVA 2KLGA 1EU3A 2GMIC 3PT2B 2FUG1 2L32A 1QT9A 2HTME 3U4EG 1PDXA 3ZO5B 4E74A 3P1MA 4GDKB 4GDKA 1PFDA 3ZRCA 2ICIA 1L0YB 4II3B 2WXGA 1QOFA 2BT6A 2N7DA 1UH6A 2KX0A 4L2YA 2JU6X 3ONSA 2WX1A 1J19A 2KFKB 2N9LA 3NVWA 2KFKA 4F1SA 2MHJA 1LGRA 1FO4A 5DPTA 4DHJD 3EGRA 3CWIA 3EFUA 3RMKC 2KC1A 3ZYYX 2DWQA 1N6ZA 3L17A 3IFWB 4HCNB 1I4GA 3TEZA 4IWOA 2KWCA 4AJWA 2G3QB 2IO0B 2PJHA 2QSDA 1WJNA 2RD0A 2NPTB 2EKIA 2NPTA 4OZBA 1P7EA 3AE2B 4C80A 3DVGX 2BWFA 3AN1A 3VXWA 4M8MA 4MGKE 2R2OA 3VH4B 3VRBB 2OJWA 2MBBB 2LHDA 3N1XC 1C9FA 1V9JA 1AN8A 1GB1A 2IO3B 1V1OA 4ZOHC 1RFKA 2QCZA 3DWMA 4S17A 3BYYB 4GDLB 2ZW0A 4GDLA 2YLMA 1H8CA 3AEAB 1NEKB 4FJVB 3IBEA 1MJDA 3DBSA 1ZGUB 4EFOA 4KDIC 4KZ0A 2LWPA 3RNCC 4WURA 3T9LA 2DNFA 2UYZB 1ET9A 3V62A 1RWSA 4NAMA 4GMVA 4MH8A 5H8YE 2JWZA 4MGZE 3PLUA 3WAOA 4W9CA 2BB5A 3UQBA 2VRRB 2IGDA 3BK1A 4NJ6A 2BYTA 1QOAA 2JY6A 2MSED 2UWQA 3U7ZA 2JUOA 3AEDB 1J8CA 2N0SB 3AE9B 4MACA 2I1KA 1WM3A 4YT0B 3H6NA 1FXAA 1JMLA 2BYVE 3OJ4B 2W3SA 3H1UA 3OG5A 3TIXA 2MBHA 1KF6B 1WIAA 4LNKA 1S1QB 1SE3A 5J18A 1VCBA 3EHVA 1D5MC 4WJOA 1FM0D 3Q8CA 1A5RA 1FRRA 4F8CB 2JWUA 3EFCA 3MC0B 1Q1OA 2ZW1A 1UGJA 2KVZA 1STEA 2MW5A 2IBIB 1UBIA 2V3PA 4EZJA 5D3IB 3DPDA 3QJZA 4ZHOA 2DLBA 5IO9A 4ITKA 3JW0X 3W5UB 3TBLD 5D7GA 1LXDA 3MP9A 2M56B 2ZVNA 4YXDB 3Q3NC 3KYDD 4HLEA 3UQAA 4E71A 3DHHC 1V86A 1EO6A 3DVNU 2LGYA 3DBRB 3P42A 1WM2A 3ZXRA 2WU2B 4GB9A 1TKGA 1UUPA 1C79A 3DVNV 2KD0A 3CIRB 3PVLA 1VJKA 1R7SA 3CF6E 3SEBA 1D5XC 1C3TA 3KWVA 3KUCB 4HPPA 1XLOA 3H8HA 2WDTB 2INPE 4HPLB 2AWTA 4ASWC 3Q69A 4RFBA 1NBFC 2KVRA 4CHKA 1F2RC 5AZHA 3RULA 3WAMA 1TIFA 2Z59B 2IJ0A 3P2BA 3N20C 4M01A 2N1WA 3UINB 1UWXA 3HVZA 4C7YA 4XWWA 3Q14C 5IP4D 2WXHA 1B9RA 1V97A 2YEPB 3IAS1 2I1JA 2CJOA 3EC8A 1WXAA 2JZ3B 3DBLI 1S3SG 4FLHA 4W9JA 2NS5A 2Z0DB 1QOBA 3A4SC 4A8XC 3PHXB 5EDSA 4LNNA 1QF6A 4KIKB 4MGYE 4KIKA 3BZDB 2AQ1B 3DBHB 4HRSA 1SIJA 4KSKC 2MBOA 1SF0A 4WH4A 1FXTB 2CHXA 2DZIA 4G0NB 2JRHA 3Q8FA 4LNOA 3MFGA 1K50A 2LVOA 3VRAB 2C5LC 4YSXB 1I4QA 4DQOC 2KDFB 3Q2AC 2QJLA 3L16A 2QIEB 4USAA 2QEJC 3X23A 1C4CA 4EUTA 2QILA 3R7QA 3NZ3A 1WYGA 1L0XB 3BWUD 2JX5A 2KMCA 2KFJA 3DHIC 4OVZA 4PS7A 1XLNA 2ZJDA 3RNBC 2VZKD 2ZVOA 1V5TA 1MHHE 2WXOA 4NPNA 2FCMA 3EA6A 4DHJB 4OHJA 2N9EB 1N63A 3U30A 1FMAD 1HZ6A 3NY5A 3AEBB 4KKJA 3RPFC 4NY0A 2V1YA 2HD5B 4JX1C 2D3GA 4HKQA 1HA5A 4P7IA 2LJ5A 3C0RB 4BKSA 2RMMA 3ZDMC 4HK2A 1P98A 2KWVB 4FBJB 1E8ZA 1E7PB 3ZGZA 2N9PC 2PPHA 2V9HA 1NVID 3QIJA 3A9JB 3A9JA 4FN2A 3ZTDA 2L05A 1JWAD 2BS4B 2G4SA 2J0MA 4A9AA 2K0PA 2BPSA 1C76A 1SSNA 4GGQA 1KTKA 1FNUA 3VUYA 3GP7A 4ZYSA 2KTRB 4WQOB 2KTRA 3M62B 4C7ZA 3ZIMA 1GOZA 4EE2A 2GOWA 4KGSA 1V49A 4US8A 2PVGC 2V3NA 4GU2A 1LM8B 1WRIA 4N58A 4ZRQA 3O65B 2WXIA 3QC8B 2JXXA 1XXGA 3L4PA 3QAQA 3L54A 4YTMB 4HKZE 4O1NA 1VZ8A 2Z8LA 3TEWA 2K8CA 3H9DA 5G2NA 1XQQA 2L7RA 4JPSA 1SE4A 4XGAB 2D3AA 1YQ3B 4LLGM 5FR6A 3Q6BA 2G4DB 3U8ZA 3R66C 2IGHA 2R61A 1AW7A 1T0QC 2M8SA 2KJ6A 3C8YA 5IN7A 1F2RI 2GBNA 4WAAA 4L1BA 1UF0A 2BTEA 3MJWA 4WIPA 2SAKA 4DXGA 1TS4A 2J7QB 2O2VB 3AI5A 2O2VA 3PREA 5LXIB 2IPKD 2PVOD 4JIOU 3RD2A 2V3SA 1WX9A 2K9XA 2WNMA 2FIFA 4H2AA 2C9WB 2CU1A 3QHTA 2J53A 5C3JB 2BS3B 1WXSA 2B3AA 1ZDXA 4C4VB 1BMLC 3MHSD 4C4VA 2NBWB 3BVGA 3GE3C 5IA7A 3TUOA 2CJNA 1N60A 3K9OB 4ARCA 2LVQA 3VVWB 3AV8A 5J17A 3ZJUA 2G1EA 3PPAA 2KK8A 4HJKA 4K7UA 4N59A 1C1YB 2N7EA 4W9FA 3SU8X 2FAZA 3H7SA 2KYWA 2LGXA 3W1SC 1WGHA 2K8BA 2KTFA 3U2SC 4OZAA 1WR6E 1XLQA 2WDQB 4IDIA 3VFKA 4DBGA 4TV3A 4URKA 1YJJA 2E6XA 1NYRA 1V6EA 4IM2A 3N32A 1WGYA 4LDTD 4WAFA 1WMHB 3LXFA 3AE5B 1WMHA 1ZW7A 1ZXHA 2NBVB 1JQ4A 2ZCBA 3VUXA 1XD3B 4W9LA 1KOTA 2KDMA 4K1RB 1ACCA 4E3CA 5G5GA 3BINA 5IKCM 3I3TB 1CJEA 3EECA 4J3OD 2K8HA 2L1AA 5D6JB 2BF8B 4W9DA 2QMTA 2WYQA 2KNBA 2ZEQA 1J7BA 4DDGD 4BOZB 3ZVVA 3M95A 3EUB2 4IOIE 2NR2A 4K3CA 1MPEA 3MC9A 2ZCCA 4MDKE 1DYQA 1K8RB 2J42A 3B9JA 2A5UA 1MG4A 1WGKA 1J0GA 1IUEA 3AU5A 4IC7B 2AQ3B 4WJNA 2RDGA 1SIFA 3ZUNA 2QHOA 1V2YA 1OTRB 2J4XA 4MGIE 2L76A 5G5HA 2WU5B 3ZTCA 5DCNA 2D3BA 4JE3B 2KN4A 2O6VB 2O6VA 2MA9B 4EOYA 2OOBB 3X0WA 5HG2A 4I6LB 2IO2B 1ZKHA 1XT9B 3APFA 2OJRA 2M1MA 3CMMB 1XCQL 1R4MB 3AEEB 2V4LA 2J0KA 4C56C 1T6BX 2LUMA 2RSUA 1JWSD 1CMXB 4IM0A 2KDBA 3SDLC 1HE8A 3OJ3A 5JZEB 2HE7A 2ON8A 2Y3AA 1L2NA 3UGBB 3N30A 3NVZA 3P4SB 2BGFA 3NS1A 1F0ZA 3PGEA 4JGHB 3DOWA 3Q3FA 2KT7A 1TBEA 5GXGB 5L83A 2JPHA 3AECB 5DPWA 3AXCA 3HRDD 2NVUI 3PO0A 2FCQA 4EKUA 4AWJA 2ACZB 4G50A 1KLGD 3TJPA 2N7JA 4B95A 2WQYB 3CSTA 3HM3A 3RZFA 2FCNA 2ASQA 2WDVB 3FKYA 3R7RA 2ZNVC 2PE9A 3UIOB 3RNAC 4XYCA 2H89B 3KW5B 2JXTA 2WXMA 2N1VA 1WE6A 1ET6A 2LD9A 1SJED 4GXBA 4A55A 1V81A 2L00B 3U7DA 2L83A 3DHGC 1L0VB 1OEYJ 1K51A 1I35A 1J7CA 4JLCA 4DK5A 3DCGA 5KHOA 1WGDA 1R4NB 1UWMA 4NJ7A 4W9HA 1JWMD 1VZ6A 3UI3A 5E6JA 2PIAA 3AEFB 4BOSC 3ZJTA 5BO4B 2HJ8A 2UU7A 4LNIA 4ZRPA 4IWPA 2L3ZA 2PKOA 2JSVX 2MH7A 2JYEA 3K9PB 3MHZA 3NJTA 3PRPB 4JL9A 2WXQA 1DOYA 3R2IA 1FRDA 5MPOA 3N9YC 1F52A 1RLFA 2N9KA 1FNWA 3IHPC 2G45B 5LNK1 3RYTA 2BYFA 3IXSA 4M8NA 4TSSA 1OEYA 3Q3OC 2KOXA 2MCNB 2JZZA 2DYMA 2ZZPB 3T3OA 1I4PA 2HTHA 4XC2A 2ONQA 1ZP0B 1ZPSA 1E10A 1SBBB 4P16A 1J7AA 4S0RA 2LGSA 1WJ6A 1U4AA 1VD2A 4B9KA 2MLBA 4R3DA 4TMAB 4M02A 3RI7C 1Z2MA 1OFFA 3ABVB 4FULA 2DZMA 5FR3A 1T0YA 3PZDA 2RPVA 4OVVA 1FD6A 1Q0WB 4UDUC 1KLVA 1HEZE 1Q5WB 4A3PA 2PTLA 1I4HA 2Y5PA 3PSEB 1TGZB 3L0WB 5E6OA 2IO1B 2GBKA 5C2TB 1XEEA 1HTQA 2KC2A 4YSZB 1I4RA 4XWTA 2Y5BB 2Z0EB 1QLBB 4XE0A 5HFYA 2PW9A 1JCKB 4NQLB 4ZHPA 1WGGA 3GE8C 5I4DA 2NCNA 3A1QB 3A1QA 4OZCA 2BKRB 4LTUA 1EWCA 1VLBA 2JF5A 3W5VB 2XNAC 3KQ4A 4RF1A 1FIQA 1NYQA 3B2GA 4TKNA 3I5JC 3OAWA 2LFIA 1JROA 1LFDA 2M4NA 1WFYA 4RM9A 3KVFB 5FK9C 2IZVB 3AE7B 2W82A 1WGRA 2VH2A 4GIVA 4L23A 3PZ7A 4WWMA 2BYEA 5BMHA 1FXIA 4LK0M 2J52A 4W9GA 4KKIA 4WWPA 3RUIB 3N3KB 1T3QA 5E6PA 2ZPYA 4KGRA 2MJDA 1E0ZA 3ZDTA 3V6CB 2QC8A 3RN9C 4YWGG 3RZWC 2IYDB 1ZOYB 1V5OA 1KJTA 1D6EC 4NQKE 4RNAA 3TEXA 4KV2A 1A70A 2WXRA 3LDZE 3VH3B 2EMTA 3QCAA 3D32A 1ZXIA 3A33B 1WF9A 1MHXA 1WXMA 4BKGA 2LZ6A 3ALBA 4ICVA 1CK1A 2GLSA 3PV1A 2J0JA 5J2RA 1TKYA 2WXLA 2C7HA 4AOFA 5JHBA 2REXA 5BMIA 1WY8A 2DAJA 2KQ4X 1F1HA 3FC4A 4MSQB 1QZEA 2RDBC 5C1ZA 1WE7A 1ZE3D 4QAYA 3M3JA 3IG3A 3KLSX 2KDIA 1BUIC 2FE8A 3URYA 2KACA 2D10A 4KDLB 1TYGB 3AE4B 2EMSA 3NZUA 2CR5A 3B0AA 3CSFA 1WI0A 3MTNB 1TZOA 1DOIA 1GC7A 5CHWA 3DDCB 3OWEB 2RGFA 4DXAB 1WR1A 2K1FA 4A90A 1KH0A 2G9HD 4W9EA 3W1SA 2W9NA 4EEWA 1NENB 4WJPA 1VRAB 1MI0A 5AEKB 4X57B 3HHMA 3JYUA 1WYWB 3LJ3A 4DXFA 1OQQA 1L6UA 4IW0A 4EZLA 1E9MA 2L52A 2K22A 4LCDE 1F9JA 1C4AA 1SE2A 1E8YA 1T5XD 1X1MA 3AH7A 3SR6A 4ANWA 1YMHE 1E7UA 2WX0A 2W55A 1SGHA 5AUKA 3AMZA 2WWZA 1IGCA 2BS2B 2LJIA 5HI1A 4AQ7A 1DOXA 1D4BA 1YN3A 3APDA 3V61A 3APCA 4MSMB 3PRMB 3ZKJC 3LYYA 4AUQC 2M0AA 2CU3A 2I38A 1RYJA 1MG8A 3A4RA 3R8BA 4TUUA 4F7ZA 2KN5A 1TZ1A 2MRPA 4GN1A 3DQVA 4P1CC 2C60A 3LB8C 4PS3A 3L10B 5CHVC 4ZRJA 4WWOA 1FFVA 5DPSA 1ZUD2 2RDHA 2I2YA 1P1AA 3ZW3A 4BVUC 2AQ2B 1P7FA 5EE3A 1WWTA 1L4ZB 3L08A 4W9IA 1E8XA 1B1ZA 2KANA 1SEBD 4EZKA 1TT5B 1IBXB 2JQRB 1IBXA 2LXAA 3A9KB 3I63C 3A9KA 4P6VF 3P63A 2KDEB 1WH3A 1T0SC 1V1PB 2MX2A 5KHQA 1V1PA 2DYOA 2MWSB 4HVBA 3ZXVA 5D94A 3U52E 5LLIA 2HDEA 3VUWA 1GC6A 1QQRA 1L6VA 1ZDVA 1GB4A 2KQSA 2VH1A 1CQVA 1OQRA 4G11A 2KO3A 2KX3A 4N6EB 3ZJVA 1MFWA 1Z5SB 2Q5WD 3AE3B 3DBLB 2WDRB 2KKCA 3BK2A 4IWQA 3VTVA 1YJ1A 2D07B 2L0TA 2CS4A 3ZNID 3DBRI 1TY2A 1L5PA 4W9KA 3V6EB 1GPXA 4IUMB 2D3CA 1PGXA 1PQSA 2AX5A 3DVGY 2R2QA 3WIMA 3Q8EA 2AL3A 2JZPA 4K7WA 4ZYNA 3M63B 2GI9A 2LMCA 2JRIB 3SD5A 4ANUA 4G3XB 3QA8A 2IY0B 2L8JA 2ZNVB 3KWLA 3R2TA 4RF0A 1P9DU 5T8IA 1VZ7A 4WJQA 3WA0A 1WX7A 3NRZA 1VDVA 3RNGC 1P0RA 1AYFA
chains in the Genus database with same CATH topology
4BFRA 4I6PA 1FXTB 3HIZA 2CHXA 1WZ3A 2DZIA 4G0NB 2JRHA 3W1YA 3GZNI 4ANVA 4MELA 4BOSC 4NNJB 5BO4B 2D11A 2HJ8A 2K6QA 5JHAA 2GBJA 2FIDA 4HXDA 2LVOA 1E5WA 4IWPA 2L3ZA 1EF1A 2C5LC 3VHTC 3UF8A 3K9PB 3PRPB 4JL9A 1YD8U 5CTRC 3Q3JA 3ZNHB 2KDFB 2LXCA 1RLFA 3L16A 3IHPC 2G45B 3TMPB 3X23A 4EUTA 4ICUA 3RYTA 3R7QA 2BYFA 4OVUA 4BKTA 4M8NA 4KZCA 1OEYA 5IAAC 2KOXA 2CHWA 4XZ4A 2MCNB 2JZZA 2LGDA 2KMCA 2DYMA 3DBHI 4HCPB 1R4NI 2ZZPB 1WJUA 2GBRA 2KFJA 4J6IA 2HTHA 4XC2A 3WANA 2DAFA 4XX5A 2LVPA 4PS7A 1GJZA 4DHZB 2ZJDA 3JVZX 1I42A 5JH5C 4JQWC 2ZVOA 3KUZA 4KSLC 1V5TA 2AEHA 4FADA 4DDID 2DENB 3PLVA 4NPNA 2FCMA 4ZDVA 4DHJB 1WJ6A 1M94A 3QQ8B 1U4AA 2N9EB 3U30A 2PEAA 1VD2A 4B9KA 2K6DB 1GG3A 2MLBA 3NY5A 1KM7A 3OLMD 2XBBC 1Z2MA 3NZSA 4NY0A 2V1YA 2HD5B 2D3GA 4FULA 1GNUA 4PYUA 4BKSD 2NBUA 4P7IA 2DZMA 1T0YA 2LJ5A 3TL5A 4IM3A 1ISNA 1EF5A 3C0RB 3PZDA 4BKSA 1H4RA 4OVVA 3ZDMC 1Q0WB 4DWFA 2IY1B 4HK2A 1KLVA 1P98A 2KWVB 4FBJB 1AARA 1Q5WB 1E8ZA 2GBMA 4FA6A 4A3PA 1E90A 1YX6B 3B08A 2N9PC 2PPHA 3QIJA 4ZRIA 3A9JB 3A9JA 3PSEB 4FN2A 3ZTDA 1TGZB 4AP4C 2L05A 5L95C 1OGWA 3UIPB 2CHZA 2G4SA 2J0MA 2MBEA 3L0WB 5E6OA 2IO1B 4TQ0A 2BPSA 2GBKA 4BBNC 1OQYA 3ZNZB 4GGQA 2YVCA 2KHWB 2KC2A 3VUYA 1NDDA 1YQBA 3H7PB 3H7PA 2KTRB 4WQOB 2Y5BB 2KTRA 2DZKA 2KXJA 2Z0EB 3M62B 1E8WA 4MEMA 1GUAB 3ZIMA 2KJRA 1IYFA 3NS8A 2EKEC 5E6NA 2GOWA 1V49A 4NQLB 2DX5B 3TCAA 2N4FA 1WGGA 4FHJA 3AU4A 2AYOB 3VQIA 2NCNA 3VTWA 4GU2A 3KH0A 1LM8B 3A1QB 4I6NB 3A1QA 3O65B 1WZ0A 2BKRB 3QC8B 2JXXA 2PE6B 3QAQA 4FJYA 2DZJA 2JF5A 4CO7A 4GSWA 3L54A 5GMVA 3HM6X 1RAXA 2JT4B 2KJHB 2K8CA 3H9DA 3ENEA 4YL8A 5G2NA 4TKNA 3WAPA 1L7YA 1XQQA 2L7RA 3HK0A 3OAWA 3V60A 1LFDA 5CHFA 5AZGA 2M4NA 1WFYA 2XEWA 3KVFB 4RM9A 2IZVB 2CKHB 4LJOB 1YX5B 5FR6A 2KLGA 2N9XA 2FUHB 1WGRA 1YIWA 2GMIC 3PT2B 4GIVA 2G4DB 2K25A 5C23A 3R66C 2KQ7A 3U8ZA 3ECIA 3QWZB 2BYEA 2M8SA 3ZRFA 2KJ6A 4N9F4 3R3MA 4A20A 4W9GA 2FCSA 3ZO5B 2GBNA 2M0XA 4E74A 4GDKB 2D2QA 4WAAA 4WWPA 4GDKA 3RUIB 3N3KB 3ZRCA 1RRBA 4M0WB 2LI5A 5E6PA 2ZPYA 3MJWA 4AJYB 3ZDTA 3V6CB 4II3B 4FJZA 3RZWC 2O2VB 2J7QB 3AI5A 3PREA 2O2VA 2IYDB 5LXHA 4BBNF 5LXIB 4HWIB 1BT0A 4ANXA 1V5OA 2N7DA 1KJTA 2L0FA 1UH6A 4JIOU 3AULA 4NQKE 3RD2A 3VTUA 2KX0A 2V3SA 4KV2A 1WX9A 3ONSA 2AL6A 3LDZE 2WX1A 2EMTA 3VH3B 1J19A 3QCAA 1D3ZA 3D32A 2KFKB 3A33B 1WF9A 2KFKA 4F1SA 2FIFA 2C9WB 1WXMA 2CU1A 3QHTA 4PS8A 4BKGA 5DPTA 1WXSA 2LZ6A 3ALBA 4DHJD 2B3AA 1SE9A 4ICVA 3MHSD 2NBWB 3EFUA 2KC1A 3T8MA 5IA7A 3L17A 3PV1A 2J0JA 1V80A 3IFWB 5J2RA 4HCNB 1UBQA 2A4ZA 3K9OB 4IWOA 2KWCA 2LVQA 3VVWB 2JVCA 2C7HA 4AJWA 2G3QB 4AOFA 5J17A 2IO0B 2PJHA 5JHBA 2REXA 3PPAA 1WY8A 2LRWA 2DAJA 2KK8A 4HJKA 1WJNA 2RD0A 1WJ4A 2NPTB 4K7UA 2NPTA 1C1YB 4MSQB 1QZEA 2KLCA 3DVGX 5C1ZA 2BWFA 2N7EA 4W9FA 1WE7A 3VXWA 3SU8X 4M8MA 4MGKE 3M3JA 2R2OA 3RT3B 3IG3A 3VH4B 2FAZA 4IG7B 3H7SA 4B6WA 2KDIA 2MBBB 3PTFC 4K7SA 2LGXA 4HPMB 1V9JA 3W1SC 1WGHA 2K8BA 2D10A 2FNJB 2IO3B 2KTFA 4KDLB 2EMSA 3NZUA 2CR5A 3B0AA 4GDLB 4GDLA 1WR6E 3CSFA 1WI0A 2YLMA 5TR5A 1H8CA 3MTNB 3VFKA 1GC7A 4DBGA 2LASA 4TV3A 4URKA 5CHWA 3DDCB 4FJVB 3IBEA 2RGFA 4DXAB 1V6EA 1WR1A 3DBSA 1ZGUB 4IM2A 4EFOA 4KDIC 4KZ0A 2K1FA 3N32A 1WGYA 4LDTD 2LWPA 5G55A 1WMHB 4W9EA 3W1SA 1WMHA 1ZW7A 5D2MB 1P3QU 2W9NA 3T9LA 4EEWA 2NBVB 2UYZB 2ZCBA 3VUXA 4LDTB 3V62A 1XD3B 4W9LA 3QX1A 2BKFA 4WJPA 4GMVA 1KOTA 2JWZA 4MGZE 2LRUA 3PLUA 3L13A 4X57B 3WAOA 4K1RB 5AEKB 3HHMA 3JYUA 4E3CA 4W9CA 1NI2A 1WYWB 3LJ3A 3PS6A 2VRRB 3UQBA 4NJ6A 1EUVB 1RFAA 3KYCD 3BINA 2JY6A 2MSED 2UWQA 4IW0A 4HDQA 3I3TB 4EZLA 1WRDB 3EECA 2JUOA 2DYBA 1J8CA 3VDZA 4LCDE 1F9JA 2K8HA 2C7MB 1G6JA 1UGMA 5D6JB 1E8YA 2BF8B 1X1MA 2I1KA 4W9DA 4ANWA 1E7VA 1WM3A 1E7UA 3H6NA 2WYQA 2WX0A 2KNBA 2ZEQA 3VAWA 1SGHA 4DDGD 3RCZA 3ZVVA 1UD7A 2BYVE 3M95A 3OJ4B 4NAWB 2WWZA 4BOZB 4NAWA 2LUEA 1UELA 3H1UA 4PYZA 2NR2A 3JSVB 3TIXA 3APDA 3JSVA 3APCA 2ZCCA 3V61A 4MDKE 2MBHA 3PRMB 3BY4B 4MSMB 1WIAA 3ZKJC 1K8RB 4AUQC 2A5UA 5J18A 1S1QB 4MH0E 1J0GA 1VCBA 1MG8A 3EHVA 3AU5A 4IC7B 3A4RA 4WJNA 1SIFA 4TUUA 4WJOA 2KN5A 3ZUNA 4F7ZA 2DHZA 2QHOA 2MP2B 1V2YA 1OTRB 1TZ1A 2M17A 2MP2A 5AZFA 1A5RA 4K81A 3SHQA 4F8CB 4MGIE 2MRPA 1LQBA 4GN1A 2L76A 1Q1OA 3DQVA 2C60A 2O6VD 4II2B 2MW5A 5DCNA 1Y8RC 3ZTCA 4PS3A 2IBIB 4EKUA 1UBIA 3QARA 3L10B 5CHVC 4EZJA 4ZRJA 2O6VB 4RMAA 2O6VA 4WWOA 4FHKA 5CX3A 5DPSA 2MA9B 4EOYA 3DPDA 3QJZA 2OOBB 3X0WA 1P1AA 3ZW3A 4BVUC 2C7NB 3JW0X 3L08A 4I6LB 4W9IA 1E8XA 3TBLD 5D7GA 1LXDA 2IO2B 2KANA 1IPGA 3WALA 1ZKHA 4EZKA 1XT9B 4WWNA 3APFA 2LXAA 2OJRA 3KUDB 2ZVNA 3ML9A 3A9KB 2M1MA 3A9KA 3CMMB 4GOCA 5DPRA 2KDEB 2V4LA 1WH3A 2J0KA 3KYDD 2MQJA 3S2AA 3IVFA 5KHQA 2MX2A 4HLEA 3UQAA 4E71A 2RSUA 1V86A 1CMXB 1EO6A 1JRUA 2DYOA 2MWSB 3DVNU 4IM0A 4KVGB 2LGYA 2KDBA 3SDLC 4HVBA 1WM2A 3GOEA 1HE8A 5D94A 3OJ3A 4GB9A 5LLIA 5HKHA 2HE7A 3VUWA 5JZEB 1L2NA 1GC6A 2ZPNA 3UGBB 3N30A 3DVNV 2BGFA 2KD0A 3PVLA 3CF6E 2KQSA 3PRZA 3PGEA 4JGHB 3DOWA 3ZNGC 1C3TA 3Q3FA 1UZXB 3KUCB 4HDOA 1TBEA 2KO3A 2KX3A 3NHEB 2KWUB 4G11A 2BWES 3PHWB 4A3OA 2XK5B 5L83A 2JPHA 2XK5A 1Z5SB 2WDTB 5DPWA 3AXCA 2KKCA 1R4MI 2NVUI 4IWQA 4HPLB 3NOBA 4TQ1A 2FCQA 2AWTA 2KMAA 1YJ1A 2D07B 2L0TA 2CS4A 3B1LX 3VTVA 1NBFC 3ZNID 4ASWC 4AWJA 4G50A 4DHZE 3QK0A 2KVRA 4CHKA 3DBRI 5AZHA 3RULA 3TJPA 3WAMA 2Z59B 4B95A 3CSTA 1WX8A 3P2BA 3HM3A 4W9KA 3V6EB 2N1WA 3RZFA 3UINB 2FCNA 4IUMB 3ZLZA 2K39A 2ASQA 3R7RA 2ZNVC 2PE9A 3UIOB 1PQSA 4RM8A 3DVGY 1IP9A 3KW5B 2R2QA 3ML8A 1WXVA 3WIMA 4ZRKA 2N1VA 4LJPB 4MJSB 2MBQA 2AL3A 4K7WA 4MJSA 4ZYNA 2RPQA 2KZRA 3M63B 1WE6A 2JRIB 2I1JA 2LD9A 3EC8A 1WXAA 3SD5A 2JZ3B 3DBLI 4ANUA 2RR9A 4GXBA 1S3SG 1V81A 2L00B 3QA8A 4G3XB 3U7DA 4FLHA 2IY0B 2L8JA 2ZNVB 4W9JA 1OEYJ 2NS5A 2Z0DB 4CYEA 4MM3A 3A4SC 1P9DU 3PHXB 5EDSA 1I35A 4KIKB 1TTNA 4MGYE 4KIKA 4WJQA 3WA0A 4JLCA 4DK5A 3DCGA 1WX7A 5KHOA 1WGDA 4KSKC 2MBOA 1P0RA 4NJ7A 4W9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BFR A;  4I6P A;  1FXT B;  3HIZ A;  2CHX A;  1WZ3 A;  2DZI A;  4G0N B;  2JRH A;  3W1Y A;  3GZN I;  4ANV A;  4MEL A;  4BOS C;  4NNJ B;  5BO4 B;  2D11 A;  2HJ8 A;  2K6Q A;  5JHA A;  2GBJ A;  2FID A;  4HXD A;  2LVO A;  1E5W A;  4IWP A;  2L3Z A;  1EF1 A;  2C5L C;  3VHT C;  3UF8 A;  3K9P B;  3PRP B;  4JL9 A;  1YD8 U;  5CTR C;  3Q3J A;  3ZNH B;  2KDF B;  2LXC A;  1RLF A;  3L16 A;  3IHP C;  2G45 B;  3TMP B;  3X23 A;  4EUT A;  4ICU A;  3RYT A;  3R7Q A;  2BYF A;  4OVU A;  4BKT A;  4M8N A;  4KZC A;  1OEY A;  5IAA C;  2KOX A;  2CHW A;  4XZ4 A;  2MCN B;  2JZZ A;  2LGD A;  2KMC A;  2DYM A;  3DBH I;  4HCP B;  1R4N I;  2ZZP B;  1WJU A;  2GBR A;  2KFJ A;  4J6I A;  2HTH A;  4XC2 A;  3WAN A;  2DAF A;  4XX5 A;  2LVP A;  4PS7 A;  1GJZ A;  4DHZ B;  2ZJD A;  3JVZ X;  1I42 A;  5JH5 C;  4JQW C;  2ZVO A;  3KUZ A;  4KSL C;  1V5T A;  2AEH A;  4FAD A;  4DDI D;  2DEN B;  3PLV A;  4NPN A;  2FCM A;  4ZDV A;  4DHJ B;  1WJ6 A;  1M94 A;  3QQ8 B;  1U4A A;  2N9E B;  3U30 A;  2PEA A;  1VD2 A;  4B9K A;  2K6D B;  1GG3 A;  2MLB A;  3NY5 A;  1KM7 A;  3OLM D;  2XBB C;  1Z2M A;  3NZS A;  4NY0 A;  2V1Y A;  2HD5 B;  2D3G A;  4FUL A;  1GNU A;  4PYU A;  4BKS D;  2NBU A;  4P7I A;  2DZM A;  1T0Y A;  2LJ5 A;  3TL5 A;  4IM3 A;  1ISN A;  1EF5 A;  3C0R B;  3PZD A;  4BKS A;  1H4R A;  4OVV A;  3ZDM C;  1Q0W B;  4DWF A;  2IY1 B;  4HK2 A;  1KLV A;  1P98 A;  2KWV B;  4FBJ B;  1AAR A;  1Q5W B;  1E8Z A;  2GBM A;  4FA6 A;  4A3P A;  1E90 A;  1YX6 B;  3B08 A;  2N9P C;  2PPH A;  3QIJ A;  4ZRI A;  3A9J B;  3A9J A;  3PSE B;  4FN2 A;  3ZTD A;  1TGZ B;  4AP4 C;  2L05 A;  5L95 C;  1OGW A;  3UIP B;  2CHZ A;  2G4S A;  2J0M A;  2MBE A;  3L0W B;  5E6O A;  2IO1 B;  4TQ0 A;  2BPS A;  2GBK A;  4BBN C;  1OQY A;  3ZNZ B;  4GGQ A;  2YVC A;  2KHW B;  2KC2 A;  3VUY A;  1NDD A;  1YQB A;  3H7P B;  3H7P A;  2KTR B;  4WQO B;  2Y5B B;  2KTR A;  2DZK A;  2KXJ A;  2Z0E B;  3M62 B;  1E8W A;  4MEM A;  1GUA B;  3ZIM A;  2KJR A;  1IYF A;  3NS8 A;  2EKE C;  5E6N A;  2GOW A;  1V49 A;  4NQL B;  2DX5 B;  3TCA A;  2N4F A;  1WGG A;  4FHJ A;  3AU4 A;  2AYO B;  3VQI A;  2NCN A;  3VTW A;  4GU2 A;  3KH0 A;  1LM8 B;  3A1Q B;  4I6N B;  3A1Q A;  3O65 B;  1WZ0 A;  2BKR B;  3QC8 B;  2JXX A;  2PE6 B;  3QAQ A;  4FJY A;  2DZJ A;  2JF5 A;  4CO7 A;  4GSW A;  3L54 A;  5GMV A;  3HM6 X;  1RAX A;  2JT4 B;  2KJH B;  2K8C A;  3H9D A;  3ENE A;  4YL8 A;  5G2N A;  4TKN A;  3WAP A;  1L7Y A;  1XQQ A;  2L7R A;  3HK0 A;  3OAW A;  3V60 A;  1LFD A;  5CHF A;  5AZG A;  2M4N A;  1WFY A;  2XEW A;  3KVF B;  4RM9 A;  2IZV B;  2CKH B;  4LJO B;  1YX5 B;  5FR6 A;  2KLG A;  2N9X A;  2FUH B;  1WGR A;  1YIW A;  2GMI C;  3PT2 B;  4GIV A;  2G4D B;  2K25 A;  5C23 A;  3R66 C;  2KQ7 A;  3U8Z A;  3ECI A;  3QWZ B;  2BYE A;  2M8S A;  3ZRF A;  2KJ6 A;  4N9F 4;  3R3M A;  4A20 A;  4W9G A;  2FCS A;  3ZO5 B;  2GBN A;  2M0X A;  4E74 A;  4GDK B;  2D2Q A;  4WAA A;  4WWP A;  4GDK A;  3RUI B;  3N3K B;  3ZRC A;  1RRB A;  4M0W B;  2LI5 A;  5E6P A;  2ZPY A;  3MJW A;  4AJY B;  3ZDT A;  3V6C B;  4II3 B;  4FJZ A;  3RZW C;  2O2V B;  2J7Q B;  3AI5 A;  3PRE A;  2O2V A;  2IYD B;  5LXH A;  4BBN F;  5LXI B;  4HWI B;  1BT0 A;  4ANX A;  1V5O A;  2N7D A;  1KJT A;  2L0F A;  1UH6 A;  4JIO U;  3AUL A;  4NQK E;  3RD2 A;  3VTU A;  2KX0 A;  2V3S A;  4KV2 A;  1WX9 A;  3ONS A;  2AL6 A;  3LDZ E;  2WX1 A;  2EMT A;  3VH3 B;  1J19 A;  3QCA A;  1D3Z A;  3D32 A;  2KFK B;  3A33 B;  1WF9 A;  2KFK A;  4F1S A;  2FIF A;  2C9W B;  1WXM A;  2CU1 A;  3QHT A;  4PS8 A;  4BKG A;  5DPT A;  1WXS A;  2LZ6 A;  3ALB A;  4DHJ D;  2B3A A;  1SE9 A;  4ICV A;  3MHS D;  2NBW B;  3EFU A;  2KC1 A;  3T8M A;  5IA7 A;  3L17 A;  3PV1 A;  2J0J A;  1V80 A;  3IFW B;  5J2R A;  4HCN B;  1UBQ A;  2A4Z A;  3K9O B;  4IWO A;  2KWC A;  2LVQ A;  3VVW B;  2JVC A;  2C7H A;  4AJW A;  2G3Q B;  4AOF A;  5J17 A;  2IO0 B;  2PJH A;  5JHB A;  2REX A;  3PPA A;  1WY8 A;  2LRW A;  2DAJ A;  2KK8 A;  4HJK A;  1WJN A;  2RD0 A;  1WJ4 A;  2NPT B;  4K7U A;  2NPT A;  1C1Y B;  4MSQ B;  1QZE A;  2KLC A;  3DVG X;  5C1Z A;  2BWF A;  2N7E A;  4W9F A;  1WE7 A;  3VXW A;  3SU8 X;  4M8M A;  4MGK E;  3M3J A;  2R2O A;  3RT3 B;  3IG3 A;  3VH4 B;  2FAZ A;  4IG7 B;  3H7S A;  4B6W A;  2KDI A;  2MBB B;  3PTF C;  4K7S A;  2LGX A;  4HPM B;  1V9J A;  3W1S C;  1WGH A;  2K8B A;  2D10 A;  2FNJ B;  2IO3 B;  2KTF A;  4KDL B;  2EMS A;  3NZU A;  2CR5 A;  3B0A A;  4GDL B;  4GDL A;  1WR6 E;  3CSF A;  1WI0 A;  2YLM A;  5TR5 A;  1H8C A;  3MTN B;  3VFK A;  1GC7 A;  4DBG A;  2LAS A;  4TV3 A;  4URK A;  5CHW A;  3DDC B;  4FJV B;  3IBE A;  2RGF A;  4DXA B;  1V6E A;  1WR1 A;  3DBS A;  1ZGU B;  4IM2 A;  4EFO A;  4KDI C;  4KZ0 A;  2K1F A;  3N32 A;  1WGY A;  4LDT D;  2LWP A;  5G55 A;  1WMH B;  4W9E A;  3W1S A;  1WMH A;  1ZW7 A;  5D2M B;  1P3Q U;  2W9N A;  3T9L A;  4EEW A;  2NBV B;  2UYZ B;  2ZCB A;  3VUX A;  4LDT B;  3V62 A;  1XD3 B;  4W9L A;  3QX1 A;  2BKF A;  4WJP A;  4GMV A;  1KOT A;  2JWZ A;  4MGZ E;  2LRU A;  3PLU A;  3L13 A;  4X57 B;  3WAO A;  4K1R B;  5AEK B;  3HHM A;  3JYU A;  4E3C A;  4W9C A;  1NI2 A;  1WYW B;  3LJ3 A;  3PS6 A;  2VRR B;  3UQB A;  4NJ6 A;  1EUV B;  1RFA A;  3KYC D;  3BIN A;  2JY6 A;  2MSE D;  2UWQ A;  4IW0 A;  4HDQ A;  3I3T B;  4EZL A;  1WRD B;  3EEC A;  2JUO A;  2DYB A;  1J8C A;  3VDZ A;  4LCD E;  1F9J A;  2K8H A;  2C7M B;  1G6J A;  1UGM A;  5D6J B;  1E8Y A;  2BF8 B;  1X1M A;  2I1K A;  4W9D A;  4ANW A;  1E7V A;  1WM3 A;  1E7U A;  3H6N A;  2WYQ A;  2WX0 A;  2KNB A;  2ZEQ A;  3VAW A;  1SGH A;  4DDG D;  3RCZ A;  3ZVV A;  1UD7 A;  2BYV E;  3M95 A;  3OJ4 B;  4NAW B;  2WWZ A;  4BOZ B;  4NAW A;  2LUE A;  1UEL A;  3H1U A;  4PYZ A;  2NR2 A;  3JSV B;  3TIX A;  3APD A;  3JSV A;  3APC A;  2ZCC A;  3V61 A;  4MDK E;  2MBH A;  3PRM B;  3BY4 B;  4MSM B;  1WIA A;  3ZKJ C;  1K8R B;  4AUQ C;  2A5U A;  5J18 A;  1S1Q B;  4MH0 E;  1J0G A;  1VCB A;  1MG8 A;  3EHV A;  3AU5 A;  4IC7 B;  3A4R A;  4WJN A;  1SIF A;  4TUU A;  4WJO A;  2KN5 A;  3ZUN A;  4F7Z A;  2DHZ A;  2QHO A;  2MP2 B;  1V2Y A;  1OTR B;  1TZ1 A;  2M17 A;  2MP2 A;  5AZF A;  1A5R A;  4K81 A;  3SHQ A;  4F8C B;  4MGI E;  2MRP A;  1LQB A;  4GN1 A;  2L76 A;  1Q1O A;  3DQV A;  2C60 A;  2O6V D;  4II2 B;  2MW5 A;  5DCN A;  1Y8R C;  3ZTC A;  4PS3 A;  2IBI B;  4EKU A;  1UBI A;  3QAR A;  3L10 B;  5CHV C;  4EZJ A;  4ZRJ A;  2O6V B;  4RMA A;  2O6V A;  4WWO A;  4FHK A;  5CX3 A;  5DPS A;  2MA9 B;  4EOY A;  3DPD A;  3QJZ A;  2OOB B;  3X0W A;  1P1A A;  3ZW3 A;  4BVU C;  2C7N B;  3JW0 X;  3L08 A;  4I6L B;  4W9I A;  1E8X A;  3TBL D;  5D7G A;  1LXD A;  2IO2 B;  2KAN A;  1IPG A;  3WAL A;  1ZKH A;  4EZK A;  1XT9 B;  4WWN A;  3APF A;  2LXA A;  2OJR A;  3KUD B;  2ZVN A;  3ML9 A;  3A9K B;  2M1M A;  3A9K A;  3CMM B;  4GOC A;  5DPR A;  2KDE B;  2V4L A;  1WH3 A;  2J0K A;  3KYD D;  2MQJ A;  3S2A A;  3IVF A;  5KHQ A;  2MX2 A;  4HLE A;  3UQA A;  4E71 A;  2RSU A;  1V86 A;  1CMX B;  1EO6 A;  1JRU A;  2DYO A;  2MWS B;  3DVN U;  4IM0 A;  4KVG B;  2LGY A;  2KDB A;  3SDL C;  4HVB A;  1WM2 A;  3GOE A;  1HE8 A;  5D94 A;  3OJ3 A;  4GB9 A;  5LLI A;  5HKH A;  2HE7 A;  3VUW A;  5JZE B;  1L2N A;  1GC6 A;  2ZPN A;  3UGB B;  3N30 A;  3DVN V;  2BGF A;  2KD0 A;  3PVL A;  3CF6 E;  2KQS A;  3PRZ A;  3PGE A;  4JGH B;  3DOW A;  3ZNG C;  1C3T A;  3Q3F A;  1UZX B;  3KUC B;  4HDO A;  1TBE A;  2KO3 A;  2KX3 A;  3NHE B;  2KWU B;  4G11 A;  2BWE S;  3PHW B;  4A3O A;  2XK5 B;  5L83 A;  2JPH A;  2XK5 A;  1Z5S B;  2WDT B;  5DPW A;  3AXC A;  2KKC A;  1R4M I;  2NVU I;  4IWQ A;  4HPL B;  3NOB A;  4TQ1 A;  2FCQ A;  2AWT A;  2KMA A;  1YJ1 A;  2D07 B;  2L0T A;  2CS4 A;  3B1L X;  3VTV A;  1NBF C;  3ZNI D;  4ASW C;  4AWJ A;  4G50 A;  4DHZ E;  3QK0 A;  2KVR A;  4CHK A;  3DBR I;  5AZH A;  3RUL A;  3TJP A;  3WAM A;  2Z59 B;  4B95 A;  3CST A;  1WX8 A;  3P2B A;  3HM3 A;  4W9K A;  3V6E B;  2N1W A;  3RZF A;  3UIN B;  2FCN A;  4IUM B;  3ZLZ A;  2K39 A;  2ASQ A;  3R7R A;  2ZNV C;  2PE9 A;  3UIO B;  1PQS A;  4RM8 A;  3DVG Y;  1IP9 A;  3KW5 B;  2R2Q A;  3ML8 A;  1WXV A;  3WIM A;  4ZRK A;  2N1V A;  4LJP B;  4MJS B;  2MBQ A;  2AL3 A;  4K7W A;  4MJS A;  4ZYN A;  2RPQ A;  2KZR A;  3M63 B;  1WE6 A;  2JRI B;  2I1J A;  2LD9 A;  3EC8 A;  1WXA A;  3SD5 A;  2JZ3 B;  3DBL I;  4ANU A;  2RR9 A;  4GXB A;  1S3S G;  1V81 A;  2L00 B;  3QA8 A;  4G3X B;  3U7D A;  4FLH A;  2IY0 B;  2L8J A;  2ZNV B;  4W9J A;  1OEY J;  2NS5 A;  2Z0D B;  4CYE A;  4MM3 A;  3A4S C;  1P9D U;  3PHX B;  5EDS A;  1I35 A;  4KIK B;  1TTN A;  4MGY E;  4KIK A;  4WJQ A;  3WA0 A;  4JLC A;  4DK5 A;  3DCG A;  1WX7 A;  5KHO A;  1WGD A;  4KSK C;  2MBO A;  1P0R A;  4NJ7 A;  4W9H A; 
#chains in the Genus database with same CATH topology
 2WGS A;  4ARI A;  4BFR A;  4I6P A;  5EE9 A;  2X38 A;  1WZ3 A;  3ZQ4 A;  4ANV A;  3GZN I;  4NZL B;  2D11 A;  5JXV A;  2FID A;  4HXD A;  1LO5 D;  1EWY C;  1EF1 A;  2K3U A;  3VHT C;  1M4V A;  2X8X X;  1YD8 U;  5CTR C;  2LXC A;  2NTT A;  1N62 A;  3AE8 B;  3TMP B;  4FXC A;  1IGD A;  4BKT A;  2YEP F;  1FNV A;  1JWB D;  4KZC A;  2CHW A;  2DBY A;  2LGD A;  3DBH I;  4HCP B;  3BVM A;  2GBR A;  4J6I A;  2WXP A;  3WAN A;  4DHZ B;  4M00 A;  4NJC A;  3GB1 A;  1YN5 A;  2IND C;  1TY0 A;  3KUZ A;  2B76 B;  4HRO A;  2DEN B;  4ZDV A;  2VZK B;  1M94 A;  3QQ8 B;  2BW2 A;  2NTS A;  1KM7 A;  3Q8B A;  3NZS A;  2GRI A;  4BKS D;  2M19 A;  2NBU A;  3AEG B;  3TL5 A;  2BVC A;  4IM3 A;  1ISN A;  4DWF A;  2IY1 B;  1AAR A;  2GBM A;  2BQQ A;  2D5G A;  1E90 A;  4ZRI A;  1C78 A;  1SJH D;  1N5W A;  3UIP B;  4D2K A;  2CHZ A;  2MBE A;  3HUI A;  3ZNZ B;  1PGB A;  2YVC A;  2KHW B;  5EE1 A;  3Q8A A;  1NDD A;  1YQB A;  2DZK A;  2KXJ A;  4MEM A;  1E8W A;  4Q2J A;  2KJR A;  1IYF A;  1N61 A;  5E6N A;  5BYR A;  3AM9 A;  2DX5 B;  3IAM 1;  2N4F A;  4FHJ A;  2AYO B;  3VQI A;  3VTW A;  3KH0 A;  3MJ5 A;  1WZ0 A;  5H92 C;  2DZJ A;  4MT5 A;  4GSW A;  1ENF A;  5GMV A;  3HM6 X;  1RAX A;  2JT4 B;  1E6E B;  5TSS A;  4XDC A;  3I57 A;  1V8C A;  1L7Y A;  3V60 A;  5CHF A;  5AZG A;  2JYT A;  2XEW A;  4LJO B;  3WCQ A;  2MJE A;  2N9X A;  2FUH B;  1YIW A;  3VR8 B;  2K25 A;  2WHI A;  5C23 A;  2KQ7 A;  3NG0 A;  1YJI A;  3ECI A;  3QWZ B;  3C19 A;  3ZRF A;  4N9F 4;  4RGT A;  3R3M A;  4A20 A;  1N5X A;  2FCS A;  3W2D A;  2M0X A;  4KGT A;  2D2Q A;  4RGN A;  1RRB A;  4M0W B;  2LI5 A;  4M0W A;  4AJY B;  4FJZ A;  1TS3 A;  5LXH A;  4BBN F;  4HWI B;  1BT0 A;  4ANX A;  2L0F A;  3AUL A;  1HZ5 A;  3VTU A;  1HQR D;  2AL6 A;  1PGA A;  2MEK A;  1D3Z A;  1JWU D;  4PS8 A;  1JW9 D;  1PUT A;  2OHF A;  3HVD A;  1SE9 A;  1YQ4 B;  1QOG A;  3T8M A;  1V80 A;  3T3N A;  1UBQ A;  2A4Z A;  3BVZ A;  3SFE B;  2JVC A;  2H88 B;  3P4Q B;  2LRW A;  3NVY A;  1WJ4 A;  3V3X A;  3B2F A;  4KX6 B;  2KLC A;  3V05 A;  1KRH A;  3IT4 B;  3E56 A;  2PMV A;  3RT3 B;  4K3B A;  4IG7 B;  4B6W A;  3E9S A;  3SFD B;  3PTF C;  4K7S A;  2GB1 A;  4HPM B;  2KWD A;  4BZA A;  2FNJ B;  1TKE A;  1SXT A;  5BYQ A;  5TR5 A;  2LAS A;  2QDF A;  4BAX A;  2V4I B;  2LHE A;  1DGJ A;  5G55 A;  2KAJ A;  5D2M B;  1P3Q U;  4RH6 A;  4LDT B;  4B0M A;  3DWG C;  1C77 A;  3QX1 A;  2BKF A;  2LRU A;  3L13 A;  1D5Z C;  1NI2 A;  2LGI A;  3PS6 A;  2W3R A;  1EUV B;  1RFA A;  4RGM A;  2MJ3 A;  3KYC D;  1Y56 A;  2E3T A;  3GZN B;  4HDQ A;  5IOI A;  1WRD B;  2DYB A;  3VDZ A;  2C7M B;  2Y5C A;  4REZ A;  3I9V 1;  1UGM A;  1G6J A;  1E7V A;  3O13 A;  3VAW A;  3P4R B;  3RCZ A;  1UD7 A;  3N1Z C;  4NAW B;  5BYS A;  4NAW A;  2LUE A;  1UEL A;  4PYZ A;  1L4D B;  3JSV B;  3JSV A;  5AUI A;  3BY4 B;  4LNF A;  1FFU A;  1YN4 A;  2WXF A;  4MH0 E;  1QKZ A;  1JRP A;  2DHZ A;  2MP2 B;  5AZF A;  2M17 A;  2MP2 A;  4K81 A;  3SHQ A;  1LQB A;  1F77 A;  2O6V D;  4II2 B;  1Y8R C;  3QAR A;  4RMA A;  4FHK A;  5CX3 A;  1JAL A;  1SB3 C;  2C7N B;  2K5P A;  3WAL A;  1IPG A;  2FBW B;  4YTP B;  4WWN A;  3KUD B;  3ML9 A;  1UNS A;  4GOC A;  2EEL A;  1TS5 A;  5DPR A;  2INC C;  2MQJ A;  3S2A A;  3IVF A;  1K52 A;  1FCC C;  1TJE A;  1JRU A;  4KVG B;  2V0G A;  2W54 A;  4IKG A;  3GOE A;  2LEK A;  2WS3 B;  5HKH A;  1ESF A;  2ZPN A;  3RFZ B;  3AE6 B;  3MC8 A;  3PRZ A;  1C4P A;  1YOV B;  3ZNG C;  1UZX B;  1XLP A;  4HDO A;  3NHE B;  1EU4 A;  2KWU B;  2BWE S;  2HJ1 A;  3PHW B;  1TS2 A;  3PZ8 A;  2XK5 B;  4A3O A;  2IGG A;  2XK5 A;  4YTN B;  2PLP A;  3FAH A;  1PYW D;  1R4M I;  4YSY B;  4HJG E;  1Q10 A;  3RNF C;  3NOB A;  5FKA C;  4TQ1 A;  1I7H A;  2KMA A;  3B1L X;  3AB5 A;  4DHZ E;  3QK0 A;  2WXN A;  3VR9 B;  2KMM A;  5D3D A;  1WX8 A;  2BBC A;  3ZLZ A;  2K39 A;  2OED A;  1XF5 L;  3RNE C;  4RM8 A;  1IP9 A;  3ML8 A;  4AS1 A;  1WXV A;  3AE1 B;  4ZRK A;  1FEH A;  4LJP B;  4MJS B;  1VR9 A;  2MBQ A;  4MJS A;  2WXK A;  2RPQ A;  1KFY B;  1T0R C;  2KZR A;  4ACF A;  2RR9 A;  1WSP A;  5HHD G;  4PK1 A;  2WXJ A;  4CYE A;  4MM3 B;  4MM3 A;  4P1B C;  1TTN A;  1FPY A;  3BYT B;  1I4X A;  1HXY D;  3HIZ A;  2INN E;  3W1Y A;  4MEL A;  4NNJ B;  4B0E A;  2K6Q A;  4XDD A;  5JHA A;  4US9 A;  2GBJ A;  3P4P B;  1E5W A;  3J9C A;  2BB6 A;  3UF8 A;  4WQM A;  3Q3J A;  3ZNH B;  4ICU A;  1EM7 A;  4OVU A;  5IAA C;  4XZ4 A;  5BMG A;  1WXQ A;  1XO3 A;  1R4N I;  2TSS A;  4HEA 1;  1FCL A;  1WJU A;  4CQN A;  2DAF A;  4XX5 A;  1QIL A;  2LVP A;  1GJZ A;  1HTO A;  3JVZ X;  1I42 A;  5JH5 C;  4JQW C;  3TSS A;  1CZP A;  4KSL C;  2AEH A;  4FAD A;  4DDI D;  3PLV A;  1RM6 C;  3IT6 B;  2WLB A;  1NI3 A;  2PEA A;  2K6D B;  1GG3 A;  3TEY A;  2SEB D;  3OLM D;  2XBB C;  1XCT L;  2WP9 B;  3Q3M C;  1GNU A;  1ROE A;  4PYU A;  4A6Q A;  4RCO A;  3W9C B;  1EF5 A;  2NMQ A;  1H4R A;  4C00 A;  4OW0 A;  4JWU C;  3NUH B;  2IDY A;  4FA6 A;  1YX6 B;  3B08 A;  4PT5 A;  5EE0 A;  4AP4 C;  5L95 C;  1OGW A;  1BXT A;  4TQ0 A;  4BBN C;  1OQY A;  3N1Y C;  1MVK A;  3H7P B;  3H7P A;  3GS2 A;  1GUA B;  2XN9 C;  3NS8 A;  2EKE C;  3TCA A;  3AU4 A;  3FIL B;  3FIL A;  4I6N B;  2PE6 B;  4FJY A;  4CO7 A;  4RGO S;  1K53 A;  3ETR A;  2KJH B;  4GLS C;  4YL8 A;  3ENE A;  3WAP A;  1KLU D;  3BII D;  3HK0 A;  1YNT E;  1GAQ B;  1AWD A;  2CKH B;  4JWS C;  1YX5 B;  3NVV A;  2KLG A;  1EU3 A;  2GMI C;  3PT2 B;  2FUG 1;  2L32 A;  1QT9 A;  2HTM E;  3U4E G;  1PDX A;  3ZO5 B;  4E74 A;  3P1M A;  4GDK B;  4GDK A;  1PFD A;  3ZRC A;  2ICI A;  1L0Y B;  4II3 B;  2WXG A;  1QOF A;  2BT6 A;  2N7D A;  1UH6 A;  2KX0 A;  4L2Y A;  2JU6 X;  3ONS A;  2WX1 A;  1J19 A;  2KFK B;  2N9L A;  3NVW A;  2KFK A;  4F1S A;  2MHJ A;  1LGR A;  1FO4 A;  5DPT A;  4DHJ D;  3EGR A;  3CWI A;  3EFU A;  3RMK C;  2KC1 A;  3ZYY X;  2DWQ A;  1N6Z A;  3L17 A;  3IFW B;  4HCN B;  1I4G A;  3TEZ A;  4IWO A;  2KWC A;  4AJW A;  2G3Q B;  2IO0 B;  2PJH A;  2QSD A;  1WJN A;  2RD0 A;  2NPT B;  2EKI A;  2NPT A;  4OZB A;  1P7E A;  3AE2 B;  4C80 A;  3DVG X;  2BWF A;  3AN1 A;  3VXW A;  4M8M A;  4MGK E;  2R2O A;  3VH4 B;  3VRB B;  2OJW A;  2MBB B;  2LHD A;  3N1X C;  1C9F A;  1V9J A;  1AN8 A;  1GB1 A;  2IO3 B;  1V1O A;  4ZOH C;  1RFK A;  2QCZ A;  3DWM A;  4S17 A;  3BYY B;  4GDL B;  2ZW0 A;  4GDL A;  2YLM A;  1H8C A;  3AEA B;  1NEK B;  4FJV B;  3IBE A;  1MJD A;  3DBS A;  1ZGU B;  4EFO A;  4KDI C;  4KZ0 A;  2LWP A;  3RNC C;  4WUR A;  3T9L A;  2DNF A;  2UYZ B;  1ET9 A;  3V62 A;  1RWS A;  4NAM A;  4GMV A;  4MH8 A;  5H8Y E;  2JWZ A;  4MGZ E;  3PLU A;  3WAO A;  4W9C A;  2BB5 A;  3UQB A;  2VRR B;  2IGD A;  3BK1 A;  4NJ6 A;  2BYT A;  1QOA A;  2JY6 A;  2MSE D;  2UWQ A;  3U7Z A;  2JUO A;  3AED B;  1J8C A;  2N0S B;  3AE9 B;  4MAC A;  2I1K A;  1WM3 A;  4YT0 B;  3H6N A;  1FXA A;  1JML A;  2BYV E;  3OJ4 B;  2W3S A;  3H1U A;  3OG5 A;  3TIX A;  2MBH A;  1KF6 B;  1WIA A;  4LNK A;  1S1Q B;  1SE3 A;  5J18 A;  1VCB A;  3EHV A;  1D5M C;  4WJO A;  1FM0 D;  3Q8C A;  1A5R A;  1FRR A;  4F8C B;  2JWU A;  3EFC A;  3MC0 B;  1Q1O A;  2ZW1 A;  1UGJ A;  2KVZ A;  1STE A;  2MW5 A;  2IBI B;  1UBI A;  2V3P A;  4EZJ A;  5D3I B;  3DPD A;  3QJZ A;  4ZHO A;  2DLB A;  5IO9 A;  4ITK A;  3JW0 X;  3W5U B;  3TBL D;  5D7G A;  1LXD A;  3MP9 A;  2M56 B;  2ZVN A;  4YXD B;  3Q3N C;  3KYD D;  4HLE A;  3UQA A;  4E71 A;  3DHH C;  1V86 A;  1EO6 A;  3DVN U;  2LGY A;  3DBR B;  3P42 A;  1WM2 A;  3ZXR A;  2WU2 B;  4GB9 A;  1TKG A;  1UUP A;  1C79 A;  3DVN V;  2KD0 A;  3CIR B;  3PVL A;  1VJK A;  1R7S A;  3CF6 E;  3SEB A;  1D5X C;  1C3T A;  3KWV A;  3KUC B;  4HPP A;  1XLO A;  3H8H A;  2WDT B;  2INP E;  4HPL B;  2AWT A;  4ASW C;  3Q69 A;  4RFB A;  1NBF C;  2KVR A;  4CHK A;  1F2R C;  5AZH A;  3RUL A;  3WAM A;  1TIF A;  2Z59 B;  2IJ0 A;  3P2B A;  3N20 C;  4M01 A;  2N1W A;  3UIN B;  1UWX A;  3HVZ A;  4C7Y A;  4XWW A;  3Q14 C;  5IP4 D;  2WXH A;  1B9R A;  1V97 A;  2YEP B;  3IAS 1;  2I1J A;  2CJO A;  3EC8 A;  1WXA A;  2JZ3 B;  3DBL I;  1S3S G;  4FLH A;  4W9J A;  2NS5 A;  2Z0D B;  1QOB A;  3A4S C;  4A8X C;  3PHX B;  5EDS A;  4LNN A;  1QF6 A;  4KIK B;  4MGY E;  4KIK A;  3BZD B;  2AQ1 B;  3DBH B;  4HRS A;  1SIJ A;  4KSK C;  2MBO A;  1SF0 A;  4WH4 A;  1FXT B;  2CHX A;  2DZI A;  4G0N B;  2JRH A;  3Q8F A;  4LNO A;  3MFG A;  1K50 A;  2LVO A;  3VRA B;  2C5L C;  4YSX B;  1I4Q A;  4DQO C;  2KDF B;  3Q2A C;  2QJL A;  3L16 A;  2QIE B;  4USA A;  2QEJ C;  3X23 A;  1C4C A;  4EUT A;  2QIL A;  3R7Q A;  3NZ3 A;  1WYG A;  1L0X B;  3BWU D;  2JX5 A;  2KMC A;  2KFJ A;  3DHI C;  4OVZ A;  4PS7 A;  1XLN A;  2ZJD A;  3RNB C;  2VZK D;  2ZVO A;  1V5T A;  1MHH E;  2WXO A;  4NPN A;  2FCM A;  3EA6 A;  4DHJ B;  4OHJ A;  2N9E B;  1N63 A;  3U30 A;  1FMA D;  1HZ6 A;  3NY5 A;  3AEB B;  4KKJ A;  3RPF C;  4NY0 A;  2V1Y A;  2HD5 B;  4JX1 C;  2D3G A;  4HKQ A;  1HA5 A;  4P7I A;  2LJ5 A;  3C0R B;  4BKS A;  2RMM A;  3ZDM C;  4HK2 A;  1P98 A;  2KWV B;  4FBJ B;  1E8Z A;  1E7P B;  3ZGZ A;  2N9P C;  2PPH A;  2V9H A;  1NVI D;  3QIJ A;  3A9J B;  3A9J A;  4FN2 A;  3ZTD A;  2L05 A;  1JWA D;  2BS4 B;  2G4S A;  2J0M A;  4A9A A;  2K0P A;  2BPS A;  1C76 A;  1SSN A;  4GGQ A;  1KTK A;  1FNU A;  3VUY A;  3GP7 A;  4ZYS A;  2KTR B;  4WQO B;  2KTR A;  3M62 B;  4C7Z A;  3ZIM A;  1GOZ A;  4EE2 A;  2GOW A;  4KGS A;  1V49 A;  4US8 A;  2PVG C;  2V3N A;  4GU2 A;  1LM8 B;  1WRI A;  4N58 A;  4ZRQ A;  3O65 B;  2WXI A;  3QC8 B;  2JXX A;  1XXG A;  3L4P A;  3QAQ A;  3L54 A;  4YTM B;  4HKZ E;  4O1N A;  1VZ8 A;  2Z8L A;  3TEW A;  2K8C A;  3H9D A;  5G2N A;  1XQQ A;  2L7R A;  4JPS A;  1SE4 A;  4XGA B;  2D3A A;  1YQ3 B;  4LLG M;  5FR6 A;  3Q6B A;  2G4D B;  3U8Z A;  3R66 C;  2IGH A;  2R61 A;  1AW7 A;  1T0Q C;  2M8S A;  2KJ6 A;  3C8Y A;  5IN7 A;  1F2R I;  2GBN A;  4WAA A;  4L1B A;  1UF0 A;  2BTE A;  3MJW A;  4WIP A;  2SAK A;  4DXG A;  1TS4 A;  2J7Q B;  2O2V B;  3AI5 A;  2O2V A;  3PRE A;  5LXI B;  2IPK D;  2PVO D;  4JIO U;  3RD2 A;  2V3S A;  1WX9 A;  2K9X A;  2WNM A;  2FIF A;  4H2A A;  2C9W B;  2CU1 A;  3QHT A;  2J53 A;  5C3J B;  2BS3 B;  1WXS A;  2B3A A;  1ZDX A;  4C4V B;  1BML C;  3MHS D;  4C4V A;  2NBW B;  3BVG A;  3GE3 C;  5IA7 A;  3TUO A;  2CJN A;  1N60 A;  3K9O B;  4ARC A;  2LVQ A;  3VVW B;  3AV8 A;  5J17 A;  3ZJU A;  2G1E A;  3PPA A;  2KK8 A;  4HJK A;  4K7U A;  4N59 A;  1C1Y B;  2N7E A;  4W9F A;  3SU8 X;  2FAZ A;  3H7S A;  2KYW A;  2LGX A;  3W1S C;  1WGH A;  2K8B A;  2KTF A;  3U2S C;  4OZA A;  1WR6 E;  1XLQ A;  2WDQ B;  4IDI A;  3VFK A;  4DBG A;  4TV3 A;  4URK A;  1YJJ A;  2E6X A;  1NYR A;  1V6E A;  4IM2 A;  3N32 A;  1WGY A;  4LDT D;  4WAF A;  1WMH B;  3LXF A;  3AE5 B;  1WMH A;  1ZW7 A;  1ZXH A;  2NBV B;  1JQ4 A;  2ZCB A;  3VUX A;  1XD3 B;  4W9L A;  1KOT A;  2KDM A;  4K1R B;  1ACC A;  4E3C A;  5G5G A;  3BIN A;  5IKC M;  3I3T B;  1CJE A;  3EEC A;  4J3O D;  2K8H A;  2L1A A;  5D6J B;  2BF8 B;  4W9D A;  2QMT A;  2WYQ A;  2KNB A;  2ZEQ A;  1J7B A;  4DDG D;  4BOZ B;  3ZVV A;  3M95 A;  3EUB 2;  4IOI E;  2NR2 A;  4K3C A;  1MPE A;  3MC9 A;  2ZCC A;  4MDK E;  1DYQ A;  1K8R B;  2J42 A;  3B9J A;  2A5U A;  1MG4 A;  1WGK A;  1J0G A;  1IUE A;  3AU5 A;  4IC7 B;  2AQ3 B;  4WJN A;  2RDG A;  1SIF A;  3ZUN A;  2QHO A;  1V2Y A;  1OTR B;  2J4X A;  4MGI E;  2L76 A;  5G5H A;  2WU5 B;  3ZTC A;  5DCN A;  2D3B A;  4JE3 B;  2KN4 A;  2O6V B;  2O6V A;  2MA9 B;  4EOY A;  2OOB B;  3X0W A;  5HG2 A;  4I6L B;  2IO2 B;  1ZKH A;  1XT9 B;  3APF A;  2OJR A;  2M1M A;  3CMM B;  1XCQ L;  1R4M B;  3AEE B;  2V4L A;  2J0K A;  4C56 C;  1T6B X;  2LUM A;  2RSU A;  1JWS D;  1CMX B;  4IM0 A;  2KDB A;  3SDL C;  1HE8 A;  3OJ3 A;  5JZE B;  2HE7 A;  2ON8 A;  2Y3A A;  1L2N A;  3UGB B;  3N30 A;  3NVZ A;  3P4S B;  2BGF A;  3NS1 A;  1F0Z A;  3PGE A;  4JGH B;  3DOW A;  3Q3F A;  2KT7 A;  1TBE A;  5GXG B;  5L83 A;  2JPH A;  3AEC B;  5DPW A;  3AXC A;  3HRD D;  2NVU I;  3PO0 A;  2FCQ A;  4EKU A;  4AWJ A;  2ACZ B;  4G50 A;  1KLG D;  3TJP A;  2N7J A;  4B95 A;  2WQY B;  3CST A;  3HM3 A;  3RZF A;  2FCN A;  2ASQ A;  2WDV B;  3FKY A;  3R7R A;  2ZNV C;  2PE9 A;  3UIO B;  3RNA C;  4XYC A;  2H89 B;  3KW5 B;  2JXT A;  2WXM A;  2N1V A;  1WE6 A;  1ET6 A;  2LD9 A;  1SJE D;  4GXB A;  4A55 A;  1V81 A;  2L00 B;  3U7D A;  2L83 A;  3DHG C;  1L0V B;  1OEY J;  1K51 A;  1I35 A;  1J7C A;  4JLC A;  4DK5 A;  3DCG A;  5KHO A;  1WGD A;  1R4N B;  1UWM A;  4NJ7 A;  4W9H A;  1JWM D;  1VZ6 A;  3UI3 A;  5E6J A;  2PIA A;  3AEF B;  4BOS C;  3ZJT A;  5BO4 B;  2HJ8 A;  2UU7 A;  4LNI A;  4ZRP A;  4IWP A;  2L3Z A;  2PKO A;  2JSV X;  2MH7 A;  2JYE A;  3K9P B;  3MHZ A;  3NJT A;  3PRP B;  4JL9 A;  2WXQ A;  1DOY A;  3R2I A;  1FRD A;  5MPO A;  3N9Y C;  1F52 A;  1RLF A;  2N9K A;  1FNW A;  3IHP C;  2G45 B;  5LNK 1;  3RYT A;  2BYF A;  3IXS A;  4M8N A;  4TSS A;  1OEY A;  3Q3O C;  2KOX A;  2MCN B;  2JZZ A;  2DYM A;  2ZZP B;  3T3O A;  1I4P A;  2HTH A;  4XC2 A;  2ONQ A;  1ZP0 B;  1ZPS A;  1E10 A;  1SBB B;  4P16 A;  1J7A A;  4S0R A;  2LGS A;  1WJ6 A;  1U4A A;  1VD2 A;  4B9K A;  2MLB A;  4R3D A;  4TMA B;  4M02 A;  3RI7 C;  1Z2M A;  1OFF A;  3ABV B;  4FUL A;  2DZM A;  5FR3 A;  1T0Y A;  3PZD A;  2RPV A;  4OVV A;  1FD6 A;  1Q0W B;  4UDU C;  1KLV A;  1HEZ E;  1Q5W B;  4A3P A;  2PTL A;  1I4H A;  2Y5P A;  3PSE B;  1TGZ B;  3L0W B;  5E6O A;  2IO1 B;  2GBK A;  5C2T B;  1XEE A;  1HTQ A;  2KC2 A;  4YSZ B;  1I4R A;  4XWT A;  2Y5B B;  2Z0E B;  1QLB B;  4XE0 A;  5HFY A;  2PW9 A;  1JCK B;  4NQL B;  4ZHP A;  1WGG A;  3GE8 C;  5I4D A;  2NCN A;  3A1Q B;  3A1Q A;  4OZC A;  2BKR B;  4LTU A;  1EWC A;  1VLB A;  2JF5 A;  3W5V B;  2XNA C;  3KQ4 A;  4RF1 A;  1FIQ A;  1NYQ A;  3B2G A;  4TKN A;  3I5J C;  3OAW A;  2LFI A;  1JRO A;  1LFD A;  2M4N A;  1WFY A;  4RM9 A;  3KVF B;  5FK9 C;  2IZV B;  3AE7 B;  2W82 A;  1WGR A;  2VH2 A;  4GIV A;  4L23 A;  3PZ7 A;  4WWM A;  2BYE A;  5BMH A;  1FXI A;  4LK0 M;  2J52 A;  4W9G A;  4KKI A;  4WWP A;  3RUI B;  3N3K B;  1T3Q A;  5E6P A;  2ZPY A;  4KGR A;  2MJD A;  1E0Z A;  3ZDT A;  3V6C B;  2QC8 A;  3RN9 C;  4YWG G;  3RZW C;  2IYD B;  1ZOY B;  1V5O A;  1KJT A;  1D6E C;  4NQK E;  4RNA A;  3TEX A;  4KV2 A;  1A70 A;  2WXR A;  3LDZ E;  3VH3 B;  2EMT A;  3QCA A;  3D32 A;  1ZXI A;  3A33 B;  1WF9 A;  1MHX A;  1WXM A;  4BKG A;  2LZ6 A;  3ALB A;  4ICV A;  1CK1 A;  2GLS A;  3PV1 A;  2J0J A;  5J2R A;  1TKY A;  2WXL A;  2C7H A;  4AOF A;  5JHB A;  2REX A;  5BMI A;  1WY8 A;  2DAJ A;  2KQ4 X;  1F1H A;  3FC4 A;  4MSQ B;  1QZE A;  2RDB C;  5C1Z A;  1WE7 A;  1ZE3 D;  4QAY A;  3M3J A;  3IG3 A;  3KLS X;  2KDI A;  1BUI C;  2FE8 A;  3URY A;  2KAC A;  2D10 A;  4KDL B;  1TYG B;  3AE4 B;  2EMS A;  3NZU A;  2CR5 A;  3B0A A;  3CSF A;  1WI0 A;  3MTN B;  1TZO A;  1DOI A;  1GC7 A;  5CHW A;  3DDC B;  3OWE B;  2RGF A;  4DXA B;  1WR1 A;  2K1F A;  4A90 A;  1KH0 A;  2G9H D;  4W9E A;  3W1S A;  2W9N A;  4EEW A;  1NEN B;  4WJP A;  1VRA B;  1MI0 A;  5AEK B;  4X57 B;  3HHM A;  3JYU A;  1WYW B;  3LJ3 A;  4DXF A;  1OQQ A;  1L6U A;  4IW0 A;  4EZL A;  1E9M A;  2L52 A;  2K22 A;  4LCD E;  1F9J A;  1C4A A;  1SE2 A;  1E8Y A;  1T5X D;  1X1M A;  3AH7 A;  3SR6 A;  4ANW A;  1YMH E;  1E7U A;  2WX0 A;  2W55 A;  1SGH A;  5AUK A;  3AMZ A;  2WWZ A;  1IGC A;  2BS2 B;  2LJI A;  5HI1 A;  4AQ7 A;  1DOX A;  1D4B A;  1YN3 A;  3APD A;  3V61 A;  3APC A;  4MSM B;  3PRM B;  3ZKJ C;  3LYY A;  4AUQ C;  2M0A A;  2CU3 A;  2I38 A;  1RYJ A;  1MG8 A;  3A4R A;  3R8B A;  4TUU A;  4F7Z A;  2KN5 A;  1TZ1 A;  2MRP A;  4GN1 A;  3DQV A;  4P1C C;  2C60 A;  3LB8 C;  4PS3 A;  3L10 B;  5CHV C;  4ZRJ A;  4WWO A;  1FFV A;  5DPS A;  1ZUD 2;  2RDH A;  2I2Y A;  1P1A A;  3ZW3 A;  4BVU C;  2AQ2 B;  1P7F A;  5EE3 A;  1WWT A;  1L4Z B;  3L08 A;  4W9I A;  1E8X A;  1B1Z A;  2KAN A;  1SEB D;  4EZK A;  1TT5 B;  1IBX B;  2JQR B;  1IBX A;  2LXA A;  3A9K B;  3I63 C;  3A9K A;  4P6V F;  3P63 A;  2KDE B;  1WH3 A;  1T0S C;  1V1P B;  2MX2 A;  5KHQ A;  1V1P A;  2DYO A;  2MWS B;  4HVB A;  3ZXV A;  5D94 A;  3U52 E;  5LLI A;  2HDE A;  3VUW A;  1GC6 A;  1QQR A;  1L6V A;  1ZDV A;  1GB4 A;  2KQS A;  2VH1 A;  1CQV A;  1OQR A;  4G11 A;  2KO3 A;  2KX3 A;  4N6E B;  3ZJV A;  1MFW A;  1Z5S B;  2Q5W D;  3AE3 B;  3DBL B;  2WDR B;  2KKC A;  3BK2 A;  4IWQ A;  3VTV A;  1YJ1 A;  2D07 B;  2L0T A;  2CS4 A;  3ZNI D;  3DBR I;  1TY2 A;  1L5P A;  4W9K A;  3V6E B;  1GPX A;  4IUM B;  2D3C A;  1PGX A;  1PQS A;  2AX5 A;  3DVG Y;  2R2Q A;  3WIM A;  3Q8E A;  2AL3 A;  2JZP A;  4K7W A;  4ZYN A;  3M63 B;  2GI9 A;  2LMC A;  2JRI B;  3SD5 A;  4ANU A;  4G3X B;  3QA8 A;  2IY0 B;  2L8J A;  2ZNV B;  3KWL A;  3R2T A;  4RF0 A;  1P9D U;  5T8I A;  1VZ7 A;  4WJQ A;  3WA0 A;  1WX7 A;  3NRZ A;  1VDV A;  3RNG C;  1P0R A;  1AYF A; 
#chains in the Genus database with same CATH homology
 4BFR A;  4I6P A;  1FXT B;  3HIZ A;  2CHX A;  1WZ3 A;  2DZI A;  4G0N B;  2JRH A;  3W1Y A;  3GZN I;  4ANV A;  4MEL A;  4BOS C;  4NNJ B;  5BO4 B;  2D11 A;  2HJ8 A;  2K6Q A;  5JHA A;  2GBJ A;  2FID A;  4HXD A;  2LVO A;  1E5W A;  4IWP A;  2L3Z A;  1EF1 A;  2C5L C;  3VHT C;  3UF8 A;  3K9P B;  3PRP B;  4JL9 A;  1YD8 U;  5CTR C;  3Q3J A;  3ZNH B;  2KDF B;  2LXC A;  1RLF A;  3L16 A;  3IHP C;  2G45 B;  3TMP B;  3X23 A;  4EUT A;  4ICU A;  3RYT A;  3R7Q A;  2BYF A;  4OVU A;  4BKT A;  4M8N A;  4KZC A;  1OEY A;  5IAA C;  2KOX A;  2CHW A;  4XZ4 A;  2MCN B;  2JZZ A;  2LGD A;  2KMC A;  2DYM A;  3DBH I;  4HCP B;  1R4N I;  2ZZP B;  1WJU A;  2GBR A;  2KFJ A;  4J6I A;  2HTH A;  4XC2 A;  3WAN A;  2DAF A;  4XX5 A;  2LVP A;  4PS7 A;  1GJZ A;  4DHZ B;  2ZJD A;  3JVZ X;  1I42 A;  5JH5 C;  4JQW C;  2ZVO A;  3KUZ A;  4KSL C;  1V5T A;  2AEH A;  4FAD A;  4DDI D;  2DEN B;  3PLV A;  4NPN A;  2FCM A;  4ZDV A;  4DHJ B;  1WJ6 A;  1M94 A;  3QQ8 B;  1U4A A;  2N9E B;  3U30 A;  2PEA A;  1VD2 A;  4B9K A;  2K6D B;  1GG3 A;  2MLB A;  3NY5 A;  1KM7 A;  3OLM D;  2XBB C;  1Z2M A;  3NZS A;  4NY0 A;  2V1Y A;  2HD5 B;  2D3G A;  4FUL A;  1GNU A;  4PYU A;  4BKS D;  2NBU A;  4P7I A;  2DZM A;  1T0Y A;  2LJ5 A;  3TL5 A;  4IM3 A;  1ISN A;  1EF5 A;  3C0R B;  3PZD A;  4BKS A;  1H4R A;  4OVV A;  3ZDM C;  1Q0W B;  4DWF A;  2IY1 B;  4HK2 A;  1KLV A;  1P98 A;  2KWV B;  4FBJ B;  1AAR A;  1Q5W B;  1E8Z A;  2GBM A;  4FA6 A;  4A3P A;  1E90 A;  1YX6 B;  3B08 A;  2N9P C;  2PPH A;  3QIJ A;  4ZRI A;  3A9J B;  3A9J A;  3PSE B;  4FN2 A;  3ZTD A;  1TGZ B;  4AP4 C;  2L05 A;  5L95 C;  1OGW A;  3UIP B;  2CHZ A;  2G4S A;  2J0M A;  2MBE A;  3L0W B;  5E6O A;  2IO1 B;  4TQ0 A;  2BPS A;  2GBK A;  4BBN C;  1OQY A;  3ZNZ B;  4GGQ A;  2YVC A;  2KHW B;  2KC2 A;  3VUY A;  1NDD A;  1YQB A;  3H7P B;  3H7P A;  2KTR B;  4WQO B;  2Y5B B;  2KTR A;  2DZK A;  2KXJ A;  2Z0E B;  3M62 B;  1E8W A;  4MEM A;  1GUA B;  3ZIM A;  2KJR A;  1IYF A;  3NS8 A;  2EKE C;  5E6N A;  2GOW A;  1V49 A;  4NQL B;  2DX5 B;  3TCA A;  2N4F A;  1WGG A;  4FHJ A;  3AU4 A;  2AYO B;  3VQI A;  2NCN A;  3VTW A;  4GU2 A;  3KH0 A;  1LM8 B;  3A1Q B;  4I6N B;  3A1Q A;  3O65 B;  1WZ0 A;  2BKR B;  3QC8 B;  2JXX A;  2PE6 B;  3QAQ A;  4FJY A;  2DZJ A;  2JF5 A;  4CO7 A;  4GSW A;  3L54 A;  5GMV A;  3HM6 X;  1RAX A;  2JT4 B;  2KJH B;  2K8C A;  3H9D A;  3ENE A;  4YL8 A;  5G2N A;  4TKN A;  3WAP A;  1L7Y A;  1XQQ A;  2L7R A;  3HK0 A;  3OAW A;  3V60 A;  1LFD A;  5CHF A;  5AZG A;  2M4N A;  1WFY A;  2XEW A;  3KVF B;  4RM9 A;  2IZV B;  2CKH B;  4LJO B;  1YX5 B;  5FR6 A;  2KLG A;  2N9X A;  2FUH B;  1WGR A;  1YIW A;  2GMI C;  3PT2 B;  4GIV A;  2G4D B;  2K25 A;  5C23 A;  3R66 C;  2KQ7 A;  3U8Z A;  3ECI A;  3QWZ B;  2BYE A;  2M8S A;  3ZRF A;  2KJ6 A;  4N9F 4;  3R3M A;  4A20 A;  4W9G A;  2FCS A;  3ZO5 B;  2GBN A;  2M0X A;  4E74 A;  4GDK B;  2D2Q A;  4WAA A;  4WWP A;  4GDK A;  3RUI B;  3N3K B;  3ZRC A;  1RRB A;  4M0W B;  2LI5 A;  5E6P A;  2ZPY A;  3MJW A;  4AJY B;  3ZDT A;  3V6C B;  4II3 B;  4FJZ A;  3RZW C;  2O2V B;  2J7Q B;  3AI5 A;  3PRE A;  2O2V A;  2IYD B;  5LXH A;  4BBN F;  5LXI B;  4HWI B;  1BT0 A;  4ANX A;  1V5O A;  2N7D A;  1KJT A;  2L0F A;  1UH6 A;  4JIO U;  3AUL A;  4NQK E;  3RD2 A;  3VTU A;  2KX0 A;  2V3S A;  4KV2 A;  1WX9 A;  3ONS A;  2AL6 A;  3LDZ E;  2WX1 A;  2EMT A;  3VH3 B;  1J19 A;  3QCA A;  1D3Z A;  3D32 A;  2KFK B;  3A33 B;  1WF9 A;  2KFK A;  4F1S A;  2FIF A;  2C9W B;  1WXM A;  2CU1 A;  3QHT A;  4PS8 A;  4BKG A;  5DPT A;  1WXS A;  2LZ6 A;  3ALB A;  4DHJ D;  2B3A A;  1SE9 A;  4ICV A;  3MHS D;  2NBW B;  3EFU A;  2KC1 A;  3T8M A;  5IA7 A;  3L17 A;  3PV1 A;  2J0J A;  1V80 A;  3IFW B;  5J2R A;  4HCN B;  1UBQ A;  2A4Z A;  3K9O B;  4IWO A;  2KWC A;  2LVQ A;  3VVW B;  2JVC A;  2C7H A;  4AJW A;  2G3Q B;  4AOF A;  5J17 A;  2IO0 B;  2PJH A;  5JHB A;  2REX A;  3PPA A;  1WY8 A;  2LRW A;  2DAJ A;  2KK8 A;  4HJK A;  1WJN A;  2RD0 A;  1WJ4 A;  2NPT B;  4K7U A;  2NPT A;  1C1Y B;  4MSQ B;  1QZE A;  2KLC A;  3DVG X;  5C1Z A;  2BWF A;  2N7E A;  4W9F A;  1WE7 A;  3VXW A;  3SU8 X;  4M8M A;  4MGK E;  3M3J A;  2R2O A;  3RT3 B;  3IG3 A;  3VH4 B;  2FAZ A;  4IG7 B;  3H7S A;  4B6W A;  2KDI A;  2MBB B;  3PTF C;  4K7S A;  2LGX A;  4HPM B;  1V9J A;  3W1S C;  1WGH A;  2K8B A;  2D10 A;  2FNJ B;  2IO3 B;  2KTF A;  4KDL B;  2EMS A;  3NZU A;  2CR5 A;  3B0A A;  4GDL B;  4GDL A;  1WR6 E;  3CSF A;  1WI0 A;  2YLM A;  5TR5 A;  1H8C A;  3MTN B;  3VFK A;  1GC7 A;  4DBG A;  2LAS A;  4TV3 A;  4URK A;  5CHW A;  3DDC B;  4FJV B;  3IBE A;  2RGF A;  4DXA B;  1V6E A;  1WR1 A;  3DBS A;  1ZGU B;  4IM2 A;  4EFO A;  4KDI C;  4KZ0 A;  2K1F A;  3N32 A;  1WGY A;  4LDT D;  2LWP A;  5G55 A;  1WMH B;  4W9E A;  3W1S A;  1WMH A;  1ZW7 A;  5D2M B;  1P3Q U;  2W9N A;  3T9L A;  4EEW A;  2NBV B;  2UYZ B;  2ZCB A;  3VUX A;  4LDT B;  3V62 A;  1XD3 B;  4W9L A;  3QX1 A;  2BKF A;  4WJP A;  4GMV A;  1KOT A;  2JWZ A;  4MGZ E;  2LRU A;  3PLU A;  3L13 A;  4X57 B;  3WAO A;  4K1R B;  5AEK B;  3HHM A;  3JYU A;  4E3C A;  4W9C A;  1NI2 A;  1WYW B;  3LJ3 A;  3PS6 A;  2VRR B;  3UQB A;  4NJ6 A;  1EUV B;  1RFA A;  3KYC D;  3BIN A;  2JY6 A;  2MSE D;  2UWQ A;  4IW0 A;  4HDQ A;  3I3T B;  4EZL A;  1WRD B;  3EEC A;  2JUO A;  2DYB A;  1J8C A;  3VDZ A;  4LCD E;  1F9J A;  2K8H A;  2C7M B;  1G6J A;  1UGM A;  5D6J B;  1E8Y A;  2BF8 B;  1X1M A;  2I1K A;  4W9D A;  4ANW A;  1E7V A;  1WM3 A;  1E7U A;  3H6N A;  2WYQ A;  2WX0 A;  2KNB A;  2ZEQ A;  3VAW A;  1SGH A;  4DDG D;  3RCZ A;  3ZVV A;  1UD7 A;  2BYV E;  3M95 A;  3OJ4 B;  4NAW B;  2WWZ A;  4BOZ B;  4NAW A;  2LUE A;  1UEL A;  3H1U A;  4PYZ A;  2NR2 A;  3JSV B;  3TIX A;  3APD A;  3JSV A;  3APC A;  2ZCC A;  3V61 A;  4MDK E;  2MBH A;  3PRM B;  3BY4 B;  4MSM B;  1WIA A;  3ZKJ C;  1K8R B;  4AUQ C;  2A5U A;  5J18 A;  1S1Q B;  4MH0 E;  1J0G A;  1VCB A;  1MG8 A;  3EHV A;  3AU5 A;  4IC7 B;  3A4R A;  4WJN A;  1SIF A;  4TUU A;  4WJO A;  2KN5 A;  3ZUN A;  4F7Z A;  2DHZ A;  2QHO A;  2MP2 B;  1V2Y A;  1OTR B;  1TZ1 A;  2M17 A;  2MP2 A;  5AZF A;  1A5R A;  4K81 A;  3SHQ A;  4F8C B;  4MGI E;  2MRP A;  1LQB A;  4GN1 A;  2L76 A;  1Q1O A;  3DQV A;  2C60 A;  2O6V D;  4II2 B;  2MW5 A;  5DCN A;  1Y8R C;  3ZTC A;  4PS3 A;  2IBI B;  4EKU A;  1UBI A;  3QAR A;  3L10 B;  5CHV C;  4EZJ A;  4ZRJ A;  2O6V B;  4RMA A;  2O6V A;  4WWO A;  4FHK A;  5CX3 A;  5DPS A;  2MA9 B;  4EOY A;  3DPD A;  3QJZ A;  2OOB B;  3X0W A;  1P1A A;  3ZW3 A;  4BVU C;  2C7N B;  3JW0 X;  3L08 A;  4I6L B;  4W9I A;  1E8X A;  3TBL D;  5D7G A;  1LXD A;  2IO2 B;  2KAN A;  1IPG A;  3WAL A;  1ZKH A;  4EZK A;  1XT9 B;  4WWN A;  3APF A;  2LXA A;  2OJR A;  3KUD B;  2ZVN A;  3ML9 A;  3A9K B;  2M1M A;  3A9K A;  3CMM B;  4GOC A;  5DPR A;  2KDE B;  2V4L A;  1WH3 A;  2J0K A;  3KYD D;  2MQJ A;  3S2A A;  3IVF A;  5KHQ A;  2MX2 A;  4HLE A;  3UQA A;  4E71 A;  2RSU A;  1V86 A;  1CMX B;  1EO6 A;  1JRU A;  2DYO A;  2MWS B;  3DVN U;  4IM0 A;  4KVG B;  2LGY A;  2KDB A;  3SDL C;  4HVB A;  1WM2 A;  3GOE A;  1HE8 A;  5D94 A;  3OJ3 A;  4GB9 A;  5LLI A;  5HKH A;  2HE7 A;  3VUW A;  5JZE B;  1L2N A;  1GC6 A;  2ZPN A;  3UGB B;  3N30 A;  3DVN V;  2BGF A;  2KD0 A;  3PVL A;  3CF6 E;  2KQS A;  3PRZ A;  3PGE A;  4JGH B;  3DOW A;  3ZNG C;  1C3T A;  3Q3F A;  1UZX B;  3KUC B;  4HDO A;  1TBE A;  2KO3 A;  2KX3 A;  3NHE B;  2KWU B;  4G11 A;  2BWE S;  3PHW B;  4A3O A;  2XK5 B;  5L83 A;  2JPH A;  2XK5 A;  1Z5S B;  2WDT B;  5DPW A;  3AXC A;  2KKC A;  1R4M I;  2NVU I;  4IWQ A;  4HPL B;  3NOB A;  4TQ1 A;  2FCQ A;  2AWT A;  2KMA A;  1YJ1 A;  2D07 B;  2L0T A;  2CS4 A;  3B1L X;  3VTV A;  1NBF C;  3ZNI D;  4ASW C;  4AWJ A;  4G50 A;  4DHZ E;  3QK0 A;  2KVR A;  4CHK A;  3DBR I;  5AZH A;  3RUL A;  3TJP A;  3WAM A;  2Z59 B;  4B95 A;  3CST A;  1WX8 A;  3P2B A;  3HM3 A;  4W9K A;  3V6E B;  2N1W A;  3RZF A;  3UIN B;  2FCN A;  4IUM B;  3ZLZ A;  2K39 A;  2ASQ A;  3R7R A;  2ZNV C;  2PE9 A;  3UIO B;  1PQS A;  4RM8 A;  3DVG Y;  1IP9 A;  3KW5 B;  2R2Q A;  3ML8 A;  1WXV A;  3WIM A;  4ZRK A;  2N1V A;  4LJP B;  4MJS B;  2MBQ A;  2AL3 A;  4K7W A;  4MJS A;  4ZYN A;  2RPQ A;  2KZR A;  3M63 B;  1WE6 A;  2JRI B;  2I1J A;  2LD9 A;  3EC8 A;  1WXA A;  3SD5 A;  2JZ3 B;  3DBL I;  4ANU A;  2RR9 A;  4GXB A;  1S3S G;  1V81 A;  2L00 B;  3QA8 A;  4G3X B;  3U7D A;  4FLH A;  2IY0 B;  2L8J A;  2ZNV B;  4W9J A;  1OEY J;  2NS5 A;  2Z0D B;  4CYE A;  4MM3 A;  3A4S C;  1P9D U;  3PHX B;  5EDS A;  1I35 A;  4KIK B;  1TTN A;  4MGY E;  4KIK A;  4WJQ A;  3WA0 A;  4JLC A;  4DK5 A;  3DCG A;  1WX7 A;  5KHO A;  1WGD A;  4KSK C;  2MBO A;  1P0R A;  4NJ7 A;  4W9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...