1FD6A

Delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fd6A00
2KACA 1UWXA 2JU6X 1ZXHA 4IKGA 1MHXA 4OZBA 5BMGA 3V3XA 1MHHE 1IBXA 2JXTA 2PLPA 1GB4A 1FCCC 2JZPA 5HHDG 1YMHE 1KH0A 2QMTA 1C9FA 4WH4A 1HZ5A 1F2RI 2N9LA 2KWDA 2GI9A 1PGXA 1JMLA 4IOIE 1MI0A 2KDMA 1K53A 4GLSC 2ZW0A 1MPEA 2LHEA 2J53A 1K50A 4D2KA 1PGAA 1IGCA 5HI1A 3FILB 1FCLA 4KGTA 1MVKA 2I2YA 1P7FA 2LUMA 1HZ6A 1XCQL 1PGBA 1D4BA 5BMIA 2PTLA 1XCTL 1IGDA 5HFYA 2I38A 5HG2A 4HJGE 3UI3A 1K52A 2PW9A 4HKZE 2QSDA 3FILA 3MP9A 1GB1A 1YNTE 2LHDA 2KN4A 4KGSA 2EELA 2JSVX 4KGRA 2N9KA 1P7EA 2LGIA 1Q10A 1QKZA 1XF5L 1EM7A 2GB1A 2N7JA 2IGGA 1IBXB 1HEZE 1FD6A 2IGDA 2ONQA 2IGHA 2JWUA 3GB1A 2ON8A 2K0PA 5JXVA 2J52A 2OEDA 1K51A 2KQ4X 2RMMA 2RPVA 4OZAA 2ZW1A 4OZCA 1F2RC 4MACA 2NMQA 5BMHA
chains in the Genus database with same CATH superfamily
5BYSA 5E6OA 1AWDA 3NUHB 1WZ0A 5GXGB 4ARCA 2LUEA 2PLPA 1YX5B 2DZIA 3BYYB 1WJ4A 4HPPA 2YEPF 3IAM1 5D3DA 1V80A 1JWUD 2QMTA 4AOFA 3QJZA 3RYTA 5J17A 4GGQA 2BTEA 3H7SA 3M63B 3N9YC 4I6NB 5AUIA 1RFAA 2XK5B 1SGHA 2WXJA 2RDBC 3APCA 2VRRB 2K8HA 1R4MB 2MJEA 4OVVA 1RRBA 4FHJA 1J7AA 2KDBA 3Q14C 3PRZA 3PO0A 1P7FA 3QA8A 4PS3A 1R7SA 2DZKA 2IO3B 4W9HA 1STEA 1G6JA 5FK9C 2DNFA 2Y5PA 4ICVA 2RSUA 4IC7B 5AZHA 1DOXA 3NZSA 1OQRA 1ZE3D 1E7VA 2QSDA 4HKZE 4ZRQA 1VD2A 1DOIA 4US9A 4K81A 2LHDA 1WR6E 1E7UA 4KGSA 2YVCA 1I7HA 3AE2B 3H9DA 2GRIA 2G3QB 4WWPA 1JWSD 1N60A 2MA9B 4DXGA 2V0GA 4RH6A 1S3SG 3DPDA 2N0SB 2L32A 2AL3A 3AE4B 3LXFA 2YEPB 2BF8B 4NJCA 1R4NB 4G50A 2MW5A 3KVFB 4XGAB 1KRHA 3N30A 2MHJA 4ANUA 4C7ZA 2L3ZA 2AQ2B 2WNMA 3NVYA 5IN7A 1TY2A 4MJSB 3QWZB 1RFKA 5TSSA 3ZTDA 2KT7A 2NS5A 4KSKC 2ACZB 3EHVA 5HKHA 1L0XB 3JSVA 2QILA 1WJNA 4FJYA 3DCGA 1YMHE 2Z59B 4N6EB 2HTME 2IO1B 3Q8AA 2LI5A 4WJOA 5AZGA 5FKAC 2OOBB 3VH4B 1IYFA 1MJDA 3W5VB 4C7YA 1VZ7A 3B2FA 2KANA 1JQ4A 3PREA 2MRPA 3L08A 4A55A 4EZKA 3EECA 1N61A 3I5JC 2V9HA 3PZ7A 1WM2A 2XN9C 2W54A 2Z8LA 1QQRA 3ZIMA 2WXPA 1HZ6A 3IVFA 2LRWA 1XCTL 1J7CA 1FRDA 1E10A 3DBHI 1I4QA 4LDTD 3VUYA 4EZLA 2JQRB 2NTTA 1UUPA 2GMIC 4GU2A 2JUOA 1CJEA 2KN4A 1YQBA 3KUDB 1XLNA 2JYEA 3M3JA 5IA7A 5EDSA 2LWPA 3Q69A 4ZYNA 4S0RA 3AEEB 3C0RB 3DBSA 3PPAA 5EE3A 2N7JA 5CHWA 1I4XA 1IBXB 4FADA 2DBYA 4OVUA 3ZNGC 4BZAA 3N32A 4DK5A 1ZW7A 1XEEA 5IOIA 3KWLA 2K0PA 4P1CC 3L13A 3AM9A 4DDGD 1YN4A 2WS3B 4ICUA 3Q8EA 1KLGD 3I57A 1ZXHA 4K1RB 2BQQA 1U4AA 5BYRA 2K5PA 2ZNVC 1GB4A 3IAS1 4PS7A 3ECIA 2UYZB 4MM3B 3WIMA 3ZNZB 2CJNA 4W9KA 3KUZA 4IM2A 4YTMB 1V1PB 3HVZA 4PK1A 3P4RB 1MPEA 4EEWA 2K1FA 4W9DA 4XWWA 2N1VA 1IGCA 4MGZE 2V4IB 3W9CB 2Y5CA 1NBFC 4TMAB 2WGSA 4YSZB 2KX3A 4C4VA 3GE8C 2KDEB 1RYJA 4RFBA 1PUTA 3TJPA 4YSYB 2M56B 3DVNU 2HD5B 4OHJA 3AI5A 3VTWA 2NTSA 1KLUD 4L23A 2A5UA 2GBKA 3AMZA 5D7GA 3WAMA 4FULA 3Q3MC 1Q1OA 2EMTA 4ZRKA 3UQAA 3MC9A 3SDLC 2MLBA 4DHZE 3HM3A 3JYUA 1OGWA 3BK2A 3CMMB 1CMXB 1E8YA 4CO7A 2AEHA 3DBLI 1WYGA 2KNBA 1HEZE 1C4AA 2ONQA 2NCNA 2RR9A 4TKNA 2FCMA 4WAFA 2MBQA 2IDYA 5JXVA 2XEWA 1C4CA 4DQOC 5FR6A 2LZ6A 3PLVA 2WHIA 3R3MA 4GMVA 4OZBA 1OEYJ 2VZKB 3U4EG 4JQWC 1OTRB 1HA5A 3GP7A 2O2VB 4MEMA 2FIDA 2L7RA 2INDC 1E90A 2GI9A 2YLMA 3P4SB 1XLQA 3JVZX 5C23A 3V6EB 3AE9B 2JF5A 4X57B 3PZDA 2E3TA 1C1YB 2BYFA 2JPHA 3B9JA 2JZ3B 1IPGA 3H7PB 4TV3A 2QC8A 1L4ZB 2KD0A 3Q6BA 1QOBA 3V62A 3A9JB 1Z2MA 2W3RA 5HG2A 4HXDA 1JALA 4HPMB 5L83A 1JRUA 3I9V1 1WMHA 3RMKC 1JCKB 1L2NA 2KLGA 1SJHD 3ZXVA 1T5XD 3P1MA 4PS8A 4M00A 3CF6E 2LXAA 3RPFC 4IUMB 2LGYA 3V05A 4XDDA 2ZCCA 2HJ1A 5CHFA 1TIFA 2M1MA 2MEKA 2W55A 3R7RA 2IYDB 5FR3A 3DWGC 2QCZA 1E0ZA 1XD3B 4CQNA 1HTOA 1S1QB 4HKQA 4BVUC 4P7IA 2KLCA 3U30A 3J9CA 4MACA 2D11A 1VZ8A 5BMGA 3V3XA 2J0JA 3ZYYX 1RLFA 3N20C 4WAAA 4M0WA 1OQQA 2JZPA 1EUVB 4AJYB 2CU3A 1VR9A 1D3ZA 3K9PB 3HIZA 1C9FA 3APDA 1FFVA 2FCNA 4BKSA 2ZJDA 4FA6A 1ZUD2 4EKUA 1ROEA 4LNNA 4MJSA 2KDMA 4BBNC 2KVZA 1WZ3A 4GLSC 2WDQB 2PEAA 2N9PC 3RNCC 1WE7A 4ANVA 1ZOYB 5CX3A 4NZLB 3RZWC 3UINB 2WXLA 3ALBA 3ZLZA 2KWUB 2KTRB 4DHJB 2D3GA 1P0RA 2IY0B 3BWUD 3HHMA 2KK8A 5KHOA 3L10B 1SE9A 3BK1A 5BMIA 2WP9B 2LEKA 3NOBA 4YWGG 3ZXRA 3BVZA 5HFYA 1NEKB 5JH5C 3UI3A 4K7SA 4ZOHC 2KHWB 1WR1A 4BFRA 1M94A 4KDLB 5T8IA 5AZFA 1UH6A 3L17A 3IT4B 5IO9A 4ZYSA 1L4DB 3L4PA 4HPLB 2V1YA 1L5PA 1ZDVA 4MGIE 4K3CA 4LNKA 2KQSA 3UF8A 4QAYA 2CR5A 3OLMD 3HUIA 1V49A 2G45B 1EU3A 4TUUA 4OW0A 1FD6A 2L1AA 4LNIA 1C78A 1VLBA 4B0EA 4NNJB 3IFWB 4HVBA 2LFIA 4FJVB 2LMCA 3FKYA 2IJ0A 1E8WA 4MGYE 5LXIB 3AEBB 2XNAC 1T3QA 2DAJA 3L0WB 3IBEA 4BOSC 3KH0A 2CU1A 3ZJTA 2KFKA 2BYVE 1UWXA 4B95A 1WE6A 3MC8A 3TEXA 1IBXA 3WAOA 2DWQA 3NZUA 1WIAA 4A6QA 1DGJA 1GC7A 3U7ZA 2MSED 3GE3C 3ENEA 3TBLD 1SE3A 1TS3A 1L7YA 1FNUA 1HZ5A 3M95A 2ZPYA 4FBJB 1LM8B 1P1AA 3SD5A 4US8A 1SE4A 4RF0A 3Q8FA 1UWMA 3DHIC 4W9FA 1XQQA 2V3SA 2LHEA 1TGZB 4D2KA 1ACCA 3TEYA 1WXQA 3KW5B 4ZRIA 1GOZA 3PHXB 4MM3A 5BYQA 3NVWA 3W1YA 1YN5A 3VRAB 3VAWA 3TEWA 1M4VA 3N1YC 3ZTCA 2LVPA 2KWCA 3A4SC 1EWYC 2BS3B 3AU5A 1QLBB 1V1PA 2PTLA 4JLCA 4HK2A 1IGDA 3LYYA 2Y5BB 3P4QB 1TS4A 2JX5A 1C79A 4NQKE 2KC1A 4MT5A 1TT5B 3GS2A 4ANXA 1F0ZA 3TEZA 4WIPA 3BZDB 3ZNID 3AEAB 4WJNA 1WYWB 3WCQA 2KJHB 4IG7B 2N9KA 3MC0B 2VZKD 2PKOA 4RGMA 5CHVC 2M17A 4EZJA 1I35A 3CSTA 3QAQA 2IGGA 1GUAB 4GDKB 4ASWC 4C80A 2CHWA 2IGDA 1V86A 3SU8X 2IGHA 3AXCA 2LGXA 1OQYA 2IY1B 1UF0A 2ZPNA 5D3IB 1LXDA 2C60A 2I1KA 3A33B 2ZW1A 2L0FA 1GNUA 3PTFC 2DZMA 2K8CA 2INCC 3AEFB 2VH2A 1UGJA 3QARA 1HQRD 2BB5A 1F9JA 2WU5B 3E56A 4RM8A 1ZPSA 3CSFA 3MHSD 1YJJA 4BKGA 2JXXA 2N7EA 3VUXA 2KMCA 5J18A 2K39A 4HRSA 3BVGA 2V3NA 4FXCA 3ZRFA 2KKCA 2WXQA 4BOZB 3FILB 2X38A 2MJ3A 4KGTA 2XBBC 2AL6A 3ZKJC 1JW9D 1D5ZC 4KX6B 1HXYD 3KQ4A 1E7PB 1TKYA 3VRBB 3OG5A 2JRHA 4NY0A 3AU4A 2V4LA 2C9WB 4EUTA 3R66C 3LB8C 3X23A 2L00B 1GB1A 1YNTE 3ONSA 2WU2B 1WRDB 2O6VB 3A9JA 1P7EA 3ETRA 5C2TB 1Q10A 4KIKA 3KYDD 2BPSA 1SIFA 2L83A 2MBBB 4YTNB 5CTRC 2K8BA 2M8SA 1KFYB 1V97A 3H8HA 2JWUA 1H4RA 1FXTB 4IWQA 2H88B 3AECB 4B6WA 3PRMB 4XZ4A 4RGNA 2HE7A 1C77A 2JY6A 2K25A 2BB6A 4W9IA 4F8CB 2JU6X 2KN5A 2Z0DB 5C3JB 2LGDA 2LGSA 2DLBA 2MBHA 2FCQA 2B76B 4DHJD 4IM3A 1Y56A 2RD0A 2LVQA 2ZNVB 2RPQA 3NVVA 2NPTB 2N9LA 4G11A 4WWOA 2JYTA 3Q8CA 2BWFA 3B0AA 5TR5A 3WAPA 1K53A 4B9KA 3PV1A 3RZFA 2KC2A 1P9DU 1K50A 2NBWB 4XE0A 3VUWA 1NYRA 1SE2A 1WGYA 2CKHB 3TL5A 1XLOA 1KTKA 2I2YA 2HJ8A 1GAQB 1RWSA 1WGRA 1XCQL 2M19A 2MQJA 1J8CA 1D4BA 3ZW3A 3RNFC 2L52A 3N3KB 2KJ6A 1GPXA 2H89B 1WSPA 1Z5SB 4EE2A 3T9LA 3VR9B 2KTRA 3VH3B 1KLVA 4MSMB 1PDXA 5E6JA 1BUIC 4NAWB 3FAHA 1KM7A 3WA0A 2J4XA 2W3SA 3PGEA 3P2BA 2C7HA 4KZ0A 4KSLC 3ZJVA 4NJ7A 3RFZB 2PIAA 2N4FA 2J52A 1EF5A 3HM6X 2QDFA 1V81A 3NVZA 4GB9A 4KKIA 4PYUA 1Y8RC 2BYTA 2REXA 2MWSB 1T0SC 2IO2B 4DDID 4HJKA 3AE8B 2QHOA 5AEKB 3DDCB 4JGHB 4A3PA 1FCCC 1TZ1A 3QC8B 3W1SA 2KMAA 4E3CA 1UZXB 1XXGA 2CS4A 4XC2A 3LDZE 1T0YA 3HK0A 4N9F4 3AN1A 4M8NA 2G1EA 2SAKA 3NRZA 2DAFA 1FEHA 3RNAC 4MGKE 4LLGM 4WQOB 3UIPB 2FAZA 1NI2A 3DBHB 5JHAA 2X8XX 2OJWA 3SHQA 3HRDD 3EGRA 2GBMA 1F77A 4LK0M 1PGBA 4UDUC 3NG0A 1E8ZA 4JE3B 3RN9C 3ML8A 2I38A 2DX5B 1ESFA 1K52A 3A1QB 2M0XA 1EF1A 2KMMA 3WALA 2INPE 2JVCA 4II2B 1QZEA 1KOTA 4BBNF 1V8CA 4EOYA 1FIQA 5DPSA 4NAMA 1KF6B 2EKEC 2PE6B 3NS1A 4OVZA 2FUHB 1TBEA 1E9MA 1F1HA 1TY0A 2XK5A 1XF5L 3ZGZA 2WXGA 1I42A 5EE1A 1TJEA 2R2QA 4HROA 2ZVOA 3A9KB 3I63C 3DWMA 4MDKE 2HDEA 1NYQA 1WXVA 3GZNI 4NPNA 5DCNA 3DBRI 4BAXA 2WDTB 3B2GA 2DZJA 2MCNB 1Q5WB 2KACA 1CZPA 2FCSA 1I4GA 4GDKA 3BINA 1FPYA 1V9JA 2BWES 1AW7A 4TQ1A 4A90A 4RGTA 1LO5D 4WH4A 3ZJUA 1AYFA 3EC8A 4WWMA 1L0VB 1GG3A 3VHTC 4JL9A 3P4PB 1CK1A 2ZW0A 4FJZA 2FE8A 2J42A 3PT2B 1FCLA 2Z0EB 2O6VD 3NHEB 1HE8A 1UNSA 1LFDA 3I3TB 2Q5WD 5G5HA 4LNFA 5DPWA 2LJIA 3QK0A 1R4MI 2JZZA 1YN3A 2ICIA 3VFKA 3P42A 2ZZPB 1PFDA 3TUOA 4HLEA 1J7BA 3ZNHB 4PYZA 4JWUC 1J0GA 2PW9A 4LTUA 3FILA 3MP9A 1WY8A 3O13A 3W2DA 2D2QA 1E6EB 4URKA 2BS2B 2D3BA 3DBLB 4WURA 4F1SA 1ET6A 4WQMA 3NS8A 1FXIA 3SEBA 3N1XC 3VTUA 3KLSX 1A70A 2KAJA 3Q3JA 3T3NA 2K6DB 2KDIA 2OEDA 1K51A 3V61A 2KYWA 2O6VA 5LLIA 2BVCA 4J6IA 2NMQA 1IP9A 5BMHA 4YT0B 2D07B 1MHHE 2K3UA 4P1BC 2CHZA 1A5RA 2KWVB 1PQSA 3BY4B 2V3PA 4YXDB 2GBJA 1XT9B 1F2RI 1RM6C 4A3OA 2KWDA 4W9JA 3MJ5A 2FBWB 4IOIE 3ZDMC 5LNK1 2PPHA 4J3OD 3IT6B 4HDQA 3MHZA 1GC6A 3NZ3A 5D6JB 1JWMD 1PGAA 3VXWA 1YJ1A 2BKFA 2L76A 3TSSA 2G9HD 2DENB 1N5WA 2BW2A 5AUKA 5DPTA 2NPTA 1SEBD 1ZGUB 4JPSA 2MX2A 2WQYB 2LUMA 3B1LX 3AE1B 4LJOB 2SEBD 3RT3B 2G4DB 3M62B 4HJGE 3E9SA 4ZRJA 4USAA 1DYQA 3DBRB 3OAWA 4HCNB 2JT4B 2BT6A 4YTPB 2FUG1 1WX9A 2BS4B 4FN2A 2WXOA 3DVNV 1DOYA 2C7NB 2EELA 2KVRA 4BKTA 2JSVX 1YQ4B 2I1JA 4M01A 1WGDA 5LXHA 1NENB 2LGIA 2EMSA 2L0TA 1D5MC 5BO4B 3R7QA 4RF1A 4YSXB 2NBVB 3EFUA 1TZOA 3V6CB 4GDLB 3MTNB 1NI3A 4DXFA 1EU4A 1V5TA 3DVGY 4PT5A 1FNWA 1Q0WB 4B0MA 3GB1A 2ON8A 5IKCM 3Q3NC 4E74A 4K7WA 2MBOA 2W82A 4NAWA 2RPVA 4OZAA 2EKIA 3AH7A 2NR2A 1MHXA 3RNEC 1YX6B 2JXTA 1MFWA 3GOEA 1P98A 2KQ7A 4I6LB 4KDIC 3X0WA 1WMHB 2KOXA 4RM9A 1X1MA 3BIID 4ZHOA 1FRRA 2WYQA 4G3XB 2INNE 2PVOD 3D32A 1QT9A 3NJTA 4IM0A 4KVGB 1MI0A 3QHTA 4ZRPA 1QILA 3CIRB 5E6PA 2LRUA 3UQBA 3TMPB 3DOWA 3CWIA 2BBCA 4REZA 1YJIA 1V1OA 3ML9A 4GXBA 3AE7B 2MP2B 1YIWA 1V5OA 2WDRB 3ABVB 4W9GA 3URYA 2WXFA 4W9LA 3HVDA 3SR6A 2K22A 3PSEB 1FFUA 2NBUA 2K9XA 1H8CA 4LNOA 2N1WA 4GN1A 4ANWA 4I6PA 4M0WB 2DYOA 1L6VA 1MG4A 2O2VA 1VRAB 2GOWA 2WX0A 3AE3B 2JWZA 4IWOA 5EE9A 1NDDA 1EWCA 1TS5A 4HWIB 1WGHA 1SXTA 2BGFA 2D10A 1SBBB 3A1QA 2D3AA 2ZEQA 4LCDE 1C4PA 5E6NA 4RCOA 4A8XC 3TIXA 3H7PA 1WGKA 4KV2A 2WXNA 4KKJA 2AWTA 2RMMA 2FIFA 3SFEB 4OZCA 2DHZA 1F2RC 4CHKA 4G0NB 3PZ8A 3RULA 1UD7A 2R61A 5G55A 1JWAD 1ZKHA 4XDCA 4ACFA 1ENFA 3N1ZC 3JW0X 1RAXA 3A9KA 3PLUA 3ZVVA 5HHDG 3OJ4B 3VDZA 2IO0B 3TCAA 1LGRA 4N59A 1I4PA 1VDVA 2N9XA 1TS2A 1PGXA 2JRIB 3UGBB 2OHFA 1P3QU 2B3AA 4O1NA 2J53A 2Y3AA 4JX1C 2ZVNA 2A4ZA 1E5WA 3KWVA 2KX0A 3L16A 1QOFA 1B9RA 4ARIA 5H8YE 4DXAB 4M8MA 2KFJA 4XX5A 1I4RA 2J0MA 2MJDA 3APFA 3V60A 2KFKB 3RNBC 1N6ZA 2QEJC 1SB3C 3RNGC 2KO3A 1HTQA 2RDHA 4RNAA 2UU7A 3MFGA 4Q2JA 5L95C 1CQVA 3ZDTA 1WWTA 3KUCB 3H1UA 2BKRB 1N63A 4GOCA 1UELA 1L6UA 3DHHC 2DYMA 3DVGX 2PJHA 1C76A 2WX1A 3AEDB 1BXTA 2L8JA 2LD9A 3EA6A 3LJ3A 4MH0E 4A9AA 4MELA 5G2NA 4F7ZA 3C8YA 3EFCA 2WXMA 2UWQA 3AE6B 1TKGA 4WJQA 3ZUNA 2PVGC 3WANA 2WDVB 3VTVA 4S17A 1IUEA 3Q8BA 4XWTA 1N5XA 1KH0A 2ZCBA 5I4DA 1D5XC 4IDIA 1UBQA 1WXSA 1SSNA 1JMLA 3U52E 4HCPB 2D5GA 3PHWB 4M02A 1AARA 1K8RB 3QQ8B 5IP4D 1J19A 1FM0D 2KTFA 1D6EC 1MVKA 3AULA 5H92C 1WI0A 2GLSA 4L1BA 1FNVA 1WM3A 3BVMA 4AQ7A 3IXSA 3AE5B 2J7QB 4AUQC 4NQLB 4K3BA 5MPOA 1XO3A 1WRIA 3DHGC 3O65B 5EE0A 2C7MB 3KYCD 3PS6A 1GJZA 3ZQ4A 2N9EB 1SIJA 2J0KA 3U7DA 3L54A 3AEGB 2LJ5A 2QJLA 1JRPA 4A20A 1ISNA 1EO6A 1T6BX 3RUIB 1ET9A 4DHZB 2HTHA 3C19A 3QIJA 4HEA1 2AQ1B 2C5LC 5KHQA 4IW0A 2GBNA 1FO4A 3S2AA 1B1ZA 1QF6A 5JHBA 2NVUI 1I4HA 1WXAA 1AN8A 3JSVB 1SF0A 2WXHA 1ZXIA 4WWNA 4TQ0A 2M0AA 1E8XA 3R2IA 2N7DA 4EFOA 4E71A 4P6VF 1KJTA 2AX5A 4C56C 1WJUA 4II3B 2IPKD 3QCAA 4W9EA 1WF9A 4DWFA 4IKGA 3DQVA 2WLBA 4GDLA 2G4SA 2RDGA 2CHXA 1WX8A 3SFDB 1NVID 2L05A 1XLPA 2KZRA 4IWPA 4FLHA 2R2OA 2FNJB 4LJPB 4GIVA 2PMVA 2OJRA 1FMAD 3U2SC 1UGMA 1QOGA 2KXJA 4KIKB 3W5UB 1TYGB 4AWJA 2KDFB 3R8BA 4R3DA 4ITKA 3VQIA 1OEYA 4N58A 4BKSD 2LXCA 1L0YB 3R2TA 4C00A 3A4RA 5G5GA 3RI7C 2KJRA 1YD8U 1ZP0B 3T3OA 2IBIB 3OWEB 5C1ZA 1WH3A 3H6NA 3EUB2 1V6EA 2MP2A 4TSSA 5DPRA 2GBRA 4YL8A 2RGFA 1C3TA 2VH1A 3FC4A 3AV8A 2D3CA 5D2MB 4MSQB 1QKZA 1V2YA 5J2RA 1BMLC 3Q2AC 2GB1A 2MH7A 2W9NA 1F52A 1UBIA 3QX1A 3U8ZA 4H2AA 3AB5A 4CYEA 2AYOB 3T8MA 1OFFA 3P63A 4LDTB 4NJ6A 5JZEB 1PYWD 4ZDVA 1JROA 3PVLA 2IZVB 2WXIA 2KQ4X 1WFYA 5GMVA 4DBGA 3VVWB 3IHPC 5D94A 1T0RC 2LVOA 2PE9A 3Q3FA 4JWSC 3VR8B 4ZHPA 2LASA 3IG3A 2BYEA 1QOAA 2WWZA 1VJKA 2QIEB 4K7UA 1R4NI 1WJ6A 1LQBA 4KZCA 4C4VB 4RMAA 1TKEA 4XYCA 3PRPB 1YOVB 3B08A 1VZ6A 4MH8A 2TSSA 2M4NA 3BYTB 5HI1A 3NY5A 2CJOA 4AS1A 3OJ3A 4GSWA 1N62A 2K6QA 1VCBA 4AP4C 1TTNA 3Q3OC 4RGOS 4JIOU 1T0QC 1BT0A 1WX7A 2MBEA 1JWBD 3MJWA 1YQ3B 2WXKA 3K9OB 4HDOA 3UIOB 2DYBA 4L2YA 3RCZA 3ZRCA 4P16A 4W9CA 5IAAC 1MG8A 4KGRA 3RD2A 4AJWA 1EM7A 3GZNB 1SJED 3W1SC 4FHKA 1WXMA 2AQ3B 1WGGA 1ZDXA 2ASQA 2WXRA 1FXAA 4WJPA 2E6XA 3ZO5B
chains in the Genus database with same CATH topology
1VZ8A 3PZ8A 5BMGA 5BYSA 2R61A 1AWDA 1JWAD 3V3XA 3NUHB 5GXGB 3ZYYX 4XDCA 4ARCA 1ENFA 3AE8B 2PLPA 4M0WA 1OQQA 3BYYB 1FCCC 2JZPA 5HHDG 2YEPF 3IAM1 2CU3A 1VR9A 5D3DA 3W1SA 1JWUD 2QMTA 1C9FA 4N59A 1XXGA 1I4PA 1VDVA 1FFVA 2BTEA 3N9YC 1ZUD2 1ROEA 1TS2A 1PGXA 5AUIA 2KDMA 3AN1A 2OHFA 2G1EA 2SAKA 4GLSC 2WDQB 3NRZA 2WXJA 4O1NA 2J53A 2Y3AA 4JX1C 1FEHA 3KWVA 1ZOYB 4NZLB 4LLGM 1QOFA 1B9RA 4ARIA 2MJEA 5H8YE 2WXLA 1J7AA 3PO0A 1I4RA 1P7FA 2MJDA 3BWUD 1R7SA 3HRDD 3EGRA 1F77A 4LK0M 3BK1A 1PGBA 4UDUC 5BMIA 2WP9B 2LEKA 4JE3B 4YWGG 1STEA 3BVZA 5FK9C 5HFYA 2I38A 1NEKB 2Y5PA 3UI3A 1ESFA 4ZOHC 1K52A 1DOXA 2KMMA 1OQRA 1ZE3D 4HKZE 2QSDA 4ZRQA 5T8IA 2INPE 2QEJC 1DOIA 4US9A 1V8CA 1FIQA 3IT4B 4ZYSA 2LHDA 1L4DB 4NAMA 3L4PA 4KGSA 1KF6B 1I7HA 1SB3C 3NS1A 4OVZA 1L5PA 3AE2B 1ZDVA 2GRIA 1JWSD 1N60A 2RDHA 4DXGA 4RNAA 2V0GA 4RH6A 1E9MA 1TY0A 3MFGA 4Q2JA 1XF5L 2N0SB 2WXGA 1CQVA 3ZGZA 2L32A 1WWTA 5EE1A 3AE4B 1TJEA 3LXFA 2YEPB 3HUIA 4NJCA 4HROA 1EU3A 4OW0A 1N63A 1FD6A 2L1AA 1C78A 1VLBA 3DWMA 4B0EA 2HDEA 1NYQA 2LFIA 2LMCA 1L6UA 2DYMA 2IJ0A 1C76A 1KRHA 3AEDB 3AEBB 2XNAC 1BXTA 1T3QA 4C7ZA 3EA6A 3B2GA 4A9AA 2AQ2B 2WNMA 3NVYA 1TY2A 3ZJTA 3C8YA 2WXMA 3AE6B 2KACA 1TKGA 1UWXA 1CZPA 1RFKA 5TSSA 2PVGC 3TEXA 1I4GA 1IBXA 2DWQA 2ACZB 4A6QA 1DGJA 3U7ZA 2WDVB 1L0XB 1IUEA 2QILA 3Q8BA 1AW7A 4TQ1A 4XWTA 1N5XA 4A90A 1YMHE 1KH0A 4RGTA 1SE3A 1LO5D 1TS3A 5I4DA 4N6EB 4WH4A 3ZJUA 1FNUA 1AYFA 1HZ5A 1D5XC 4IDIA 2HTME 3Q8AA 4WWMA 1L0VB 1SSNA 5FKAC 1JMLA 3U52E 2D5GA 3W5VB 4US8A 1SE4A 3P4PB 4RF0A 3Q8FA 4C7YA 1VZ7A 1UWMA 3B2FA 1JQ4A 1CK1A 2ZW0A 2LHEA 4D2KA 1ACCA 3TEYA 1WXQA 2FE8A 4A55A 1GOZA 1N61A 1FM0D 2J42A 5BYQA 1FCLA 3PZ7A 3NVWA 1D6EC 1UNSA 1YN5A 2XN9C 1MVKA 2W54A 5H92C 2Z8LA 1QQRA 2WXPA 3VRAB 3TEWA 1M4VA 2Q5WD 4L1BA 5G5HA 1HZ6A 1EWYC 1FNVA 2LJIA 2BS3B 3BVMA 4AQ7A 1QLBB 1V1PA 1YN3A 2ICIA 2PTLA 1XCTL 3AE5B 1J7CA 1FRDA 1IGDA 3IXSA 3LYYA 3P42A 3P4QB 1PFDA 1TS4A 3TUOA 1E10A 1I4QA 5MPOA 2JX5A 1C79A 1XO3A 2JQRB 1WRIA 1J7BA 2NTTA 4JWUC 2PW9A 5EE0A 4MT5A 4LTUA 1UUPA 3ZQ4A 1SIJA 3FILA 3MP9A 3AEGB 3GS2A 2QJLA 1F0ZA 3O13A 1JRPA 3W2DA 1CJEA 3TEZA 2KN4A 1E6EB 2BS2B 4WIPA 3BZDB 4WURA 3AEAB 1T6BX 1XLNA 3WCQA 2JYEA 1ET6A 1ET9A 4WQMA 2N9KA 1FXIA 3SEBA 3MC0B 3Q69A 4HEA1 2AQ1B 2VZKD 3KLSX 2PKOA 4RGMA 3AEEB 1FO4A 5EE3A 2N7JA 1B1ZA 1QF6A 2IGGA 1I4XA 4GDKB 1IBXB 1A70A 2DBYA 1I4HA 4C80A 2IGDA 2KAJA 1AN8A 1SF0A 3T3NA 2WXHA 1XEEA 1ZXIA 2IGHA 4TQ0A 2M0AA 3KWLA 2K0PA 3AM9A 5D3IB 1YN4A 1K51A 2OEDA 3R2IA 2WS3B 4P6VF 2AX5A 2ZW1A 4C56C 2IPKD 2NMQA 3Q8EA 1KLGD 5BMHA 3I57A 4YT0B 1ZXHA 4IKGA 2WLBA 1MHHE 2K3UA 3AEFB 5BYRA 2RDGA 2K5PA 1UGJA 1HQRD 2BB5A 3SFDB 1GB4A 2V3PA 3IAS1 1NVID 4YXDB 2WU5B 3E56A 1XLPA 4MM3B 1ZPSA 1YJJA 2CJNA 1F2RI 2PMVA 1RM6C 1FMAD 3U2SC 2KWDA 3MJ5A 2FBWB 4HRSA 1QOGA 4IOIE 4YTMB 3BVGA 5LNK1 4J3OD 1V1PB 2V3NA 3IT6B 3W5UB 3HVZA 3MHZA 3P4RB 1MPEA 4FXCA 3NZ3A 1TYGB 1JWMD 2WXQA 1PGAA 3R8BA 4R3DA 3TSSA 4ITKA 2G9HD 3VQIA 4N58A 4XWWA 1IGCA 3FILB 1N5WA 1L0YB 2X38A 3R2TA 2V4IB 2MJ3A 4KGTA 2BW2A 5AUKA 3W9CB 2Y5CA 1SEBD 4TMAB 4JPSA 4YSZB 1JW9D 1D5ZC 4KX6B 5G5GA 2WQYB 1HXYD 1ZP0B 2LUMA 3KQ4A 3T3OA 1E7PB 1RYJA 3AE1B 3OWEB 1TKYA 4RFBA 1PUTA 3VRBB 2SEBD 4YSYB 3EUB2 2M56B 4HJGE 3E9SA 4OHJA 4USAA 1DYQA 3LB8C 4TSSA 2BT6A 2NTSA 4YTPB 1KLUD 2FUG1 4L23A 2BS4B 2WXOA 3AMZA 5D7GA 1GB1A 3FC4A 1YNTE 3AV8A 1DOYA 2EELA 2WU2B 2JSVX 1YQ4B 1NENB 1P7EA 2LGIA 3ETRA 5C2TB 1D5MC 1Q10A 1QKZA 4RF1A 3BK2A 4YSXB 2L83A 1TZOA 1BMLC 1WYGA 2GB1A 4GDLB 4YTNB 2MH7A 4H2AA 3AB5A 1HEZE 1C4AA 1OFFA 1NI3A 2ONQA 3P63A 4DXFA 1EU4A 1KFYB 1V97A 1FNWA 4PT5A 4WAFA 3H8HA 2IDYA 2JWUA 1PYWD 3GB1A 2ON8A 4B0MA 5JXVA 1JROA 2H88B 2WXIA 3AECB 2KQ4X 2W82A 2RPVA 4OZAA 4RGNA 1C4CA 1C77A 4DQOC 2BB6A 2EKIA 3AH7A 4JWSC 2JU6X 4OZBA 1MHXA 3VR8B 5C3JB 2VZKB 2JXTA 4ZHPA 3U4EG 2DLBA 2B76B 1HA5A 3GP7A 1Y56A 1QOAA 3BIID 4ZHOA 1FRRA 1VJKA 2QIEB 3NVVA 2INNE 2PVOD 2N9LA 1QT9A 2JYTA 2GI9A 3Q8CA 1MI0A 3P4SB 1XLQA 1QILA 4ZRPA 3CIRB 3AE9B 1TKEA 1K53A 3CWIA 2BBCA 4REZA 1YJIA 1V1OA 1K50A 3AE7B 1VZ6A 2E3TA 4MH8A 4XE0A 2TSSA 3BYTB 2WDRB 3B9JA 3ABVB 5HI1A 2CJOA 4AS1A 1NYRA 1SE2A 1N62A 1XLOA 1KTKA 3URYA 2I2YA 1L4ZB 1GAQB 2WXFA 1RWSA 3HVDA 1QOBA 3SR6A 2K22A 1XCQL 2M19A 1FFUA 1D4BA 2K9XA 4RGOS 2L52A 2W3RA 5HG2A 1JWBD 1JALA 2H89B 1GPXA 1WSPA 4EE2A 3I9V1 1YQ3B 2DYOA 1JCKB 2WXKA 3VR9B 1L6VA 4L2YA 1SJHD 1T5XD 1VRAB 4P16A 3P1MA 3AE3B 1PDXA 5E6JA 4KGRA 5EE9A 1BUIC 4NAWB 3FAHA 1EWCA 1TS5A 3RPFC 2J4XA 2W3SA 1EM7A 3V05A 4XDDA 1SXTA 1SBBB 1SJED 3ZJVA 1C4PA 2AQ3B 1ZDXA 2MEKA 2W55A 4RCOA 4A8XC 5FR3A 2WXRA 3DWGC 1E0ZA 3RFZB 4CQNA 1FXAA 1WGKA 2PIAA 2WXNA 4KKJA 2J52A 4HKQA 3NVZA 4KKIA 2RMMA 2BYTA 3SFEB 4OZCA 1F2RC 2E6XA 3J9CA 4MACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAC A;  1UWX A;  2JU6 X;  1ZXH A;  4IKG A;  1MHX A;  4OZB A;  5BMG A;  3V3X A;  1MHH E;  1IBX A;  2JXT A;  2PLP A;  1GB4 A;  1FCC C;  2JZP A;  5HHD G;  1YMH E;  1KH0 A;  2QMT A;  1C9F A;  4WH4 A;  1HZ5 A;  1F2R I;  2N9L A;  2KWD A;  2GI9 A;  1PGX A;  1JML A;  4IOI E;  1MI0 A;  2KDM A;  1K53 A;  4GLS C;  2ZW0 A;  1MPE A;  2LHE A;  2J53 A;  1K50 A;  4D2K A;  1PGA A;  1IGC A;  5HI1 A;  3FIL B;  1FCL A;  4KGT A;  1MVK A;  2I2Y A;  1P7F A;  2LUM A;  1HZ6 A;  1XCQ L;  1PGB A;  1D4B A;  5BMI A;  2PTL A;  1XCT L;  1IGD A;  5HFY A;  2I38 A;  5HG2 A;  4HJG E;  3UI3 A;  1K52 A;  2PW9 A;  4HKZ E;  2QSD A;  3FIL A;  3MP9 A;  1GB1 A;  1YNT E;  2LHD A;  2KN4 A;  4KGS A;  2EEL A;  2JSV X;  4KGR A;  2N9K A;  1P7E A;  2LGI A;  1Q10 A;  1QKZ A;  1XF5 L;  1EM7 A;  2GB1 A;  2N7J A;  2IGG A;  1IBX B;  1HEZ E;  1FD6 A;  2IGD A;  2ONQ A;  2IGH A;  2JWU A;  3GB1 A;  2ON8 A;  2K0P A;  5JXV A;  2J52 A;  2OED A;  1K51 A;  2KQ4 X;  2RMM A;  2RPV A;  4OZA A;  2ZW1 A;  4OZC A;  1F2R C;  4MAC A;  2NMQ A;  5BMH A; 
#chains in the Genus database with same CATH topology
 5BYS A;  5E6O A;  1AWD A;  3NUH B;  1WZ0 A;  5GXG B;  4ARC A;  2LUE A;  2PLP A;  1YX5 B;  2DZI A;  3BYY B;  1WJ4 A;  4HPP A;  2YEP F;  3IAM 1;  5D3D A;  1V80 A;  1JWU D;  2QMT A;  4AOF A;  3QJZ A;  3RYT A;  5J17 A;  4GGQ A;  2BTE A;  3H7S A;  3M63 B;  3N9Y C;  4I6N B;  5AUI A;  1RFA A;  2XK5 B;  1SGH A;  2WXJ A;  2RDB C;  3APC A;  2VRR B;  2K8H A;  1R4M B;  2MJE A;  4OVV A;  1RRB A;  4FHJ A;  1J7A A;  2KDB A;  3Q14 C;  3PRZ A;  3PO0 A;  1P7F A;  3QA8 A;  4PS3 A;  1R7S A;  2DZK A;  2IO3 B;  4W9H A;  1STE A;  1G6J A;  5FK9 C;  2DNF A;  2Y5P A;  4ICV A;  2RSU A;  4IC7 B;  5AZH A;  1DOX A;  3NZS A;  1OQR A;  1ZE3 D;  1E7V A;  2QSD A;  4HKZ E;  4ZRQ A;  1VD2 A;  1DOI A;  4US9 A;  4K81 A;  2LHD A;  1WR6 E;  1E7U A;  4KGS A;  2YVC A;  1I7H A;  3AE2 B;  3H9D A;  2GRI A;  2G3Q B;  4WWP A;  1JWS D;  1N60 A;  2MA9 B;  4DXG A;  2V0G A;  4RH6 A;  1S3S G;  3DPD A;  2N0S B;  2L32 A;  2AL3 A;  3AE4 B;  3LXF A;  2YEP B;  2BF8 B;  4NJC A;  1R4N B;  4G50 A;  2MW5 A;  3KVF B;  4XGA B;  1KRH A;  3N30 A;  2MHJ A;  4ANU A;  4C7Z A;  2L3Z A;  2AQ2 B;  2WNM A;  3NVY A;  5IN7 A;  1TY2 A;  4MJS B;  3QWZ B;  1RFK A;  5TSS A;  3ZTD A;  2KT7 A;  2NS5 A;  4KSK C;  2ACZ B;  3EHV A;  5HKH A;  1L0X B;  3JSV A;  2QIL A;  1WJN A;  4FJY A;  3DCG A;  1YMH E;  2Z59 B;  4N6E B;  2HTM E;  2IO1 B;  3Q8A A;  2LI5 A;  4WJO A;  5AZG A;  5FKA C;  2OOB B;  3VH4 B;  1IYF A;  1MJD A;  3W5V B;  4C7Y A;  1VZ7 A;  3B2F A;  2KAN A;  1JQ4 A;  3PRE A;  2MRP A;  3L08 A;  4A55 A;  4EZK A;  3EEC A;  1N61 A;  3I5J C;  2V9H A;  3PZ7 A;  1WM2 A;  2XN9 C;  2W54 A;  2Z8L A;  1QQR A;  3ZIM A;  2WXP A;  1HZ6 A;  3IVF A;  2LRW A;  1XCT L;  1J7C A;  1FRD A;  1E10 A;  3DBH I;  1I4Q A;  4LDT D;  3VUY A;  4EZL A;  2JQR B;  2NTT A;  1UUP A;  2GMI C;  4GU2 A;  2JUO A;  1CJE A;  2KN4 A;  1YQB A;  3KUD B;  1XLN A;  2JYE A;  3M3J A;  5IA7 A;  5EDS A;  2LWP A;  3Q69 A;  4ZYN A;  4S0R A;  3AEE B;  3C0R B;  3DBS A;  3PPA A;  5EE3 A;  2N7J A;  5CHW A;  1I4X A;  1IBX B;  4FAD A;  2DBY A;  4OVU A;  3ZNG C;  4BZA A;  3N32 A;  4DK5 A;  1ZW7 A;  1XEE A;  5IOI A;  3KWL A;  2K0P A;  4P1C C;  3L13 A;  3AM9 A;  4DDG D;  1YN4 A;  2WS3 B;  4ICU A;  3Q8E A;  1KLG D;  3I57 A;  1ZXH A;  4K1R B;  2BQQ A;  1U4A A;  5BYR A;  2K5P A;  2ZNV C;  1GB4 A;  3IAS 1;  4PS7 A;  3ECI A;  2UYZ B;  4MM3 B;  3WIM A;  3ZNZ B;  2CJN A;  4W9K A;  3KUZ A;  4IM2 A;  4YTM B;  1V1P B;  3HVZ A;  4PK1 A;  3P4R B;  1MPE A;  4EEW A;  2K1F A;  4W9D A;  4XWW A;  2N1V A;  1IGC A;  4MGZ E;  2V4I B;  3W9C B;  2Y5C A;  1NBF C;  4TMA B;  2WGS A;  4YSZ B;  2KX3 A;  4C4V A;  3GE8 C;  2KDE B;  1RYJ A;  4RFB A;  1PUT A;  3TJP A;  4YSY B;  2M56 B;  3DVN U;  2HD5 B;  4OHJ A;  3AI5 A;  3VTW A;  2NTS A;  1KLU D;  4L23 A;  2A5U A;  2GBK A;  3AMZ A;  5D7G A;  3WAM A;  4FUL A;  3Q3M C;  1Q1O A;  2EMT A;  4ZRK A;  3UQA A;  3MC9 A;  3SDL C;  2MLB A;  4DHZ E;  3HM3 A;  3JYU A;  1OGW A;  3BK2 A;  3CMM B;  1CMX B;  1E8Y A;  4CO7 A;  2AEH A;  3DBL I;  1WYG A;  2KNB A;  1HEZ E;  1C4A A;  2ONQ A;  2NCN A;  2RR9 A;  4TKN A;  2FCM A;  4WAF A;  2MBQ A;  2IDY A;  5JXV A;  2XEW A;  1C4C A;  4DQO C;  5FR6 A;  2LZ6 A;  3PLV A;  2WHI A;  3R3M A;  4GMV A;  4OZB A;  1OEY J;  2VZK B;  3U4E G;  4JQW C;  1OTR B;  1HA5 A;  3GP7 A;  2O2V B;  4MEM A;  2FID A;  2L7R A;  2IND C;  1E90 A;  2GI9 A;  2YLM A;  3P4S B;  1XLQ A;  3JVZ X;  5C23 A;  3V6E B;  3AE9 B;  2JF5 A;  4X57 B;  3PZD A;  2E3T A;  1C1Y B;  2BYF A;  2JPH A;  3B9J A;  2JZ3 B;  1IPG A;  3H7P B;  4TV3 A;  2QC8 A;  1L4Z B;  2KD0 A;  3Q6B A;  1QOB A;  3V62 A;  3A9J B;  1Z2M A;  2W3R A;  5HG2 A;  4HXD A;  1JAL A;  4HPM B;  5L83 A;  1JRU A;  3I9V 1;  1WMH A;  3RMK C;  1JCK B;  1L2N A;  2KLG A;  1SJH D;  3ZXV A;  1T5X D;  3P1M A;  4PS8 A;  4M00 A;  3CF6 E;  2LXA A;  3RPF C;  4IUM B;  2LGY A;  3V05 A;  4XDD A;  2ZCC A;  2HJ1 A;  5CHF A;  1TIF A;  2M1M A;  2MEK A;  2W55 A;  3R7R A;  2IYD B;  5FR3 A;  3DWG C;  2QCZ A;  1E0Z A;  1XD3 B;  4CQN A;  1HTO A;  1S1Q B;  4HKQ A;  4BVU C;  4P7I A;  2KLC A;  3U30 A;  3J9C A;  4MAC A;  2D11 A;  1VZ8 A;  5BMG A;  3V3X A;  2J0J A;  3ZYY X;  1RLF A;  3N20 C;  4WAA A;  4M0W A;  1OQQ A;  2JZP A;  1EUV B;  4AJY B;  2CU3 A;  1VR9 A;  1D3Z A;  3K9P B;  3HIZ A;  1C9F A;  3APD A;  1FFV A;  2FCN A;  4BKS A;  2ZJD A;  4FA6 A;  1ZUD 2;  4EKU A;  1ROE A;  4LNN A;  4MJS A;  2KDM A;  4BBN C;  2KVZ A;  1WZ3 A;  4GLS C;  2WDQ B;  2PEA A;  2N9P C;  3RNC C;  1WE7 A;  4ANV A;  1ZOY B;  5CX3 A;  4NZL B;  3RZW C;  3UIN B;  2WXL A;  3ALB A;  3ZLZ A;  2KWU B;  2KTR B;  4DHJ B;  2D3G A;  1P0R A;  2IY0 B;  3BWU D;  3HHM A;  2KK8 A;  5KHO A;  3L10 B;  1SE9 A;  3BK1 A;  5BMI A;  2WP9 B;  2LEK A;  3NOB A;  4YWG G;  3ZXR A;  3BVZ A;  5HFY A;  1NEK B;  5JH5 C;  3UI3 A;  4K7S A;  4ZOH C;  2KHW B;  1WR1 A;  4BFR A;  1M94 A;  4KDL B;  5T8I A;  5AZF A;  1UH6 A;  3L17 A;  3IT4 B;  5IO9 A;  4ZYS A;  1L4D B;  3L4P A;  4HPL B;  2V1Y A;  1L5P A;  1ZDV A;  4MGI E;  4K3C A;  4LNK A;  2KQS A;  3UF8 A;  4QAY A;  2CR5 A;  3OLM D;  3HUI A;  1V49 A;  2G45 B;  1EU3 A;  4TUU A;  4OW0 A;  1FD6 A;  2L1A A;  4LNI A;  1C78 A;  1VLB A;  4B0E A;  4NNJ B;  3IFW B;  4HVB A;  2LFI A;  4FJV B;  2LMC A;  3FKY A;  2IJ0 A;  1E8W A;  4MGY E;  5LXI B;  3AEB B;  2XNA C;  1T3Q A;  2DAJ A;  3L0W B;  3IBE A;  4BOS C;  3KH0 A;  2CU1 A;  3ZJT A;  2KFK A;  2BYV E;  1UWX A;  4B95 A;  1WE6 A;  3MC8 A;  3TEX A;  1IBX A;  3WAO A;  2DWQ A;  3NZU A;  1WIA A;  4A6Q A;  1DGJ A;  1GC7 A;  3U7Z A;  2MSE D;  3GE3 C;  3ENE A;  3TBL D;  1SE3 A;  1TS3 A;  1L7Y A;  1FNU A;  1HZ5 A;  3M95 A;  2ZPY A;  4FBJ B;  1LM8 B;  1P1A A;  3SD5 A;  4US8 A;  1SE4 A;  4RF0 A;  3Q8F A;  1UWM A;  3DHI C;  4W9F A;  1XQQ A;  2V3S A;  2LHE A;  1TGZ B;  4D2K A;  1ACC A;  3TEY A;  1WXQ A;  3KW5 B;  4ZRI A;  1GOZ A;  3PHX B;  4MM3 A;  5BYQ A;  3NVW A;  3W1Y A;  1YN5 A;  3VRA B;  3VAW A;  3TEW A;  1M4V A;  3N1Y C;  3ZTC A;  2LVP A;  2KWC A;  3A4S C;  1EWY C;  2BS3 B;  3AU5 A;  1QLB B;  1V1P A;  2PTL A;  4JLC A;  4HK2 A;  1IGD A;  3LYY A;  2Y5B B;  3P4Q B;  1TS4 A;  2JX5 A;  1C79 A;  4NQK E;  2KC1 A;  4MT5 A;  1TT5 B;  3GS2 A;  4ANX A;  1F0Z A;  3TEZ A;  4WIP A;  3BZD B;  3ZNI D;  3AEA B;  4WJN A;  1WYW B;  3WCQ A;  2KJH B;  4IG7 B;  2N9K A;  3MC0 B;  2VZK D;  2PKO A;  4RGM A;  5CHV C;  2M17 A;  4EZJ A;  1I35 A;  3CST A;  3QAQ A;  2IGG A;  1GUA B;  4GDK B;  4ASW C;  4C80 A;  2CHW A;  2IGD A;  1V86 A;  3SU8 X;  2IGH A;  3AXC A;  2LGX A;  1OQY A;  2IY1 B;  1UF0 A;  2ZPN A;  5D3I B;  1LXD A;  2C60 A;  2I1K A;  3A33 B;  2ZW1 A;  2L0F A;  1GNU A;  3PTF C;  2DZM A;  2K8C A;  2INC C;  3AEF B;  2VH2 A;  1UGJ A;  3QAR A;  1HQR D;  2BB5 A;  1F9J A;  2WU5 B;  3E56 A;  4RM8 A;  1ZPS A;  3CSF A;  3MHS D;  1YJJ A;  4BKG A;  2JXX A;  2N7E A;  3VUX A;  2KMC A;  5J18 A;  2K39 A;  4HRS A;  3BVG A;  2V3N A;  4FXC A;  3ZRF A;  2KKC A;  2WXQ A;  4BOZ B;  3FIL B;  2X38 A;  2MJ3 A;  4KGT A;  2XBB C;  2AL6 A;  3ZKJ C;  1JW9 D;  1D5Z C;  4KX6 B;  1HXY D;  3KQ4 A;  1E7P B;  1TKY A;  3VRB B;  3OG5 A;  2JRH A;  4NY0 A;  3AU4 A;  2V4L A;  2C9W B;  4EUT A;  3R66 C;  3LB8 C;  3X23 A;  2L00 B;  1GB1 A;  1YNT E;  3ONS A;  2WU2 B;  1WRD B;  2O6V B;  3A9J A;  1P7E A;  3ETR A;  5C2T B;  1Q10 A;  4KIK A;  3KYD D;  2BPS A;  1SIF A;  2L83 A;  2MBB B;  4YTN B;  5CTR C;  2K8B A;  2M8S A;  1KFY B;  1V97 A;  3H8H A;  2JWU A;  1H4R A;  1FXT B;  4IWQ A;  2H88 B;  3AEC B;  4B6W A;  3PRM B;  4XZ4 A;  4RGN A;  2HE7 A;  1C77 A;  2JY6 A;  2K25 A;  2BB6 A;  4W9I A;  4F8C B;  2JU6 X;  2KN5 A;  2Z0D B;  5C3J B;  2LGD A;  2LGS A;  2DLB A;  2MBH A;  2FCQ A;  2B76 B;  4DHJ D;  4IM3 A;  1Y56 A;  2RD0 A;  2LVQ A;  2ZNV B;  2RPQ A;  3NVV A;  2NPT B;  2N9L A;  4G11 A;  4WWO A;  2JYT A;  3Q8C A;  2BWF A;  3B0A A;  5TR5 A;  3WAP A;  1K53 A;  4B9K A;  3PV1 A;  3RZF A;  2KC2 A;  1P9D U;  1K50 A;  2NBW B;  4XE0 A;  3VUW A;  1NYR A;  1SE2 A;  1WGY A;  2CKH B;  3TL5 A;  1XLO A;  1KTK A;  2I2Y A;  2HJ8 A;  1GAQ B;  1RWS A;  1WGR A;  1XCQ L;  2M19 A;  2MQJ A;  1J8C A;  1D4B A;  3ZW3 A;  3RNF C;  2L52 A;  3N3K B;  2KJ6 A;  1GPX A;  2H89 B;  1WSP A;  1Z5S B;  4EE2 A;  3T9L A;  3VR9 B;  2KTR A;  3VH3 B;  1KLV A;  4MSM B;  1PDX A;  5E6J A;  1BUI C;  4NAW B;  3FAH A;  1KM7 A;  3WA0 A;  2J4X A;  2W3S A;  3PGE A;  3P2B A;  2C7H A;  4KZ0 A;  4KSL C;  3ZJV A;  4NJ7 A;  3RFZ B;  2PIA A;  2N4F A;  2J52 A;  1EF5 A;  3HM6 X;  2QDF A;  1V81 A;  3NVZ A;  4GB9 A;  4KKI A;  4PYU A;  1Y8R C;  2BYT A;  2REX A;  2MWS B;  1T0S C;  2IO2 B;  4DDI D;  4HJK A;  3AE8 B;  2QHO A;  5AEK B;  3DDC B;  4JGH B;  4A3P A;  1FCC C;  1TZ1 A;  3QC8 B;  3W1S A;  2KMA A;  4E3C A;  1UZX B;  1XXG A;  2CS4 A;  4XC2 A;  3LDZ E;  1T0Y A;  3HK0 A;  4N9F 4;  3AN1 A;  4M8N A;  2G1E A;  2SAK A;  3NRZ A;  2DAF A;  1FEH A;  3RNA C;  4MGK E;  4LLG M;  4WQO B;  3UIP B;  2FAZ A;  1NI2 A;  3DBH B;  5JHA A;  2X8X X;  2OJW A;  3SHQ A;  3HRD D;  3EGR A;  2GBM A;  1F77 A;  4LK0 M;  1PGB A;  4UDU C;  3NG0 A;  1E8Z A;  4JE3 B;  3RN9 C;  3ML8 A;  2I38 A;  2DX5 B;  1ESF A;  1K52 A;  3A1Q B;  2M0X A;  1EF1 A;  2KMM A;  3WAL A;  2INP E;  2JVC A;  4II2 B;  1QZE A;  1KOT A;  4BBN F;  1V8C A;  4EOY A;  1FIQ A;  5DPS A;  4NAM A;  1KF6 B;  2EKE C;  2PE6 B;  3NS1 A;  4OVZ A;  2FUH B;  1TBE A;  1E9M A;  1F1H A;  1TY0 A;  2XK5 A;  1XF5 L;  3ZGZ A;  2WXG A;  1I42 A;  5EE1 A;  1TJE A;  2R2Q A;  4HRO A;  2ZVO A;  3A9K B;  3I63 C;  3DWM A;  4MDK E;  2HDE A;  1NYQ A;  1WXV A;  3GZN I;  4NPN A;  5DCN A;  3DBR I;  4BAX A;  2WDT B;  3B2G A;  2DZJ A;  2MCN B;  1Q5W B;  2KAC A;  1CZP A;  2FCS A;  1I4G A;  4GDK A;  3BIN A;  1FPY A;  1V9J A;  2BWE S;  1AW7 A;  4TQ1 A;  4A90 A;  4RGT A;  1LO5 D;  4WH4 A;  3ZJU A;  1AYF A;  3EC8 A;  4WWM A;  1L0V B;  1GG3 A;  3VHT C;  4JL9 A;  3P4P B;  1CK1 A;  2ZW0 A;  4FJZ A;  2FE8 A;  2J42 A;  3PT2 B;  1FCL A;  2Z0E B;  2O6V D;  3NHE B;  1HE8 A;  1UNS A;  1LFD A;  3I3T B;  2Q5W D;  5G5H A;  4LNF A;  5DPW A;  2LJI A;  3QK0 A;  1R4M I;  2JZZ A;  1YN3 A;  2ICI A;  3VFK A;  3P42 A;  2ZZP B;  1PFD A;  3TUO A;  4HLE A;  1J7B A;  3ZNH B;  4PYZ A;  4JWU C;  1J0G A;  2PW9 A;  4LTU A;  3FIL A;  3MP9 A;  1WY8 A;  3O13 A;  3W2D A;  2D2Q A;  1E6E B;  4URK A;  2BS2 B;  2D3B A;  3DBL B;  4WUR A;  4F1S A;  1ET6 A;  4WQM A;  3NS8 A;  1FXI A;  3SEB A;  3N1X C;  3VTU A;  3KLS X;  1A70 A;  2KAJ A;  3Q3J A;  3T3N A;  2K6D B;  2KDI A;  2OED A;  1K51 A;  3V61 A;  2KYW A;  2O6V A;  5LLI A;  2BVC A;  4J6I A;  2NMQ A;  1IP9 A;  5BMH A;  4YT0 B;  2D07 B;  1MHH E;  2K3U A;  4P1B C;  2CHZ A;  1A5R A;  2KWV B;  1PQS A;  3BY4 B;  2V3P A;  4YXD B;  2GBJ A;  1XT9 B;  1F2R I;  1RM6 C;  4A3O A;  2KWD A;  4W9J A;  3MJ5 A;  2FBW B;  4IOI E;  3ZDM C;  5LNK 1;  2PPH A;  4J3O D;  3IT6 B;  4HDQ A;  3MHZ A;  1GC6 A;  3NZ3 A;  5D6J B;  1JWM D;  1PGA A;  3VXW A;  1YJ1 A;  2BKF A;  2L76 A;  3TSS A;  2G9H D;  2DEN B;  1N5W A;  2BW2 A;  5AUK A;  5DPT A;  2NPT A;  1SEB D;  1ZGU B;  4JPS A;  2MX2 A;  2WQY B;  2LUM A;  3B1L X;  3AE1 B;  4LJO B;  2SEB D;  3RT3 B;  2G4D B;  3M62 B;  4HJG E;  3E9S A;  4ZRJ A;  4USA A;  1DYQ A;  3DBR B;  3OAW A;  4HCN B;  2JT4 B;  2BT6 A;  4YTP B;  2FUG 1;  1WX9 A;  2BS4 B;  4FN2 A;  2WXO A;  3DVN V;  1DOY A;  2C7N B;  2EEL A;  2KVR A;  4BKT A;  2JSV X;  1YQ4 B;  2I1J A;  4M01 A;  1WGD A;  5LXH A;  1NEN B;  2LGI A;  2EMS A;  2L0T A;  1D5M C;  5BO4 B;  3R7Q A;  4RF1 A;  4YSX B;  2NBV B;  3EFU A;  1TZO A;  3V6C B;  4GDL B;  3MTN B;  1NI3 A;  4DXF A;  1EU4 A;  1V5T A;  3DVG Y;  4PT5 A;  1FNW A;  1Q0W B;  4B0M A;  3GB1 A;  2ON8 A;  5IKC M;  3Q3N C;  4E74 A;  4K7W A;  2MBO A;  2W82 A;  4NAW A;  2RPV A;  4OZA A;  2EKI A;  3AH7 A;  2NR2 A;  1MHX A;  3RNE C;  1YX6 B;  2JXT A;  1MFW A;  3GOE A;  1P98 A;  2KQ7 A;  4I6L B;  4KDI C;  3X0W A;  1WMH B;  2KOX A;  4RM9 A;  1X1M A;  3BII D;  4ZHO A;  1FRR A;  2WYQ A;  4G3X B;  2INN E;  2PVO D;  3D32 A;  1QT9 A;  3NJT A;  4IM0 A;  4KVG B;  1MI0 A;  3QHT A;  4ZRP A;  1QIL A;  3CIR B;  5E6P A;  2LRU A;  3UQB A;  3TMP B;  3DOW A;  3CWI A;  2BBC A;  4REZ A;  1YJI A;  1V1O A;  3ML9 A;  4GXB A;  3AE7 B;  2MP2 B;  1YIW A;  1V5O A;  2WDR B;  3ABV B;  4W9G A;  3URY A;  2WXF A;  4W9L A;  3HVD A;  3SR6 A;  2K22 A;  3PSE B;  1FFU A;  2NBU A;  2K9X A;  1H8C A;  4LNO A;  2N1W A;  4GN1 A;  4ANW A;  4I6P A;  4M0W B;  2DYO A;  1L6V A;  1MG4 A;  2O2V A;  1VRA B;  2GOW A;  2WX0 A;  3AE3 B;  2JWZ A;  4IWO A;  5EE9 A;  1NDD A;  1EWC A;  1TS5 A;  4HWI B;  1WGH A;  1SXT A;  2BGF A;  2D10 A;  1SBB B;  3A1Q A;  2D3A A;  2ZEQ A;  4LCD E;  1C4P A;  5E6N A;  4RCO A;  4A8X C;  3TIX A;  3H7P A;  1WGK A;  4KV2 A;  2WXN A;  4KKJ A;  2AWT A;  2RMM A;  2FIF A;  3SFE B;  4OZC A;  2DHZ A;  1F2R C;  4CHK A;  4G0N B;  3PZ8 A;  3RUL A;  1UD7 A;  2R61 A;  5G55 A;  1JWA D;  1ZKH A;  4XDC A;  4ACF A;  1ENF A;  3N1Z C;  3JW0 X;  1RAX A;  3A9K A;  3PLU A;  3ZVV A;  5HHD G;  3OJ4 B;  3VDZ A;  2IO0 B;  3TCA A;  1LGR A;  4N59 A;  1I4P A;  1VDV A;  2N9X A;  1TS2 A;  1PGX A;  2JRI B;  3UGB B;  2OHF A;  1P3Q U;  2B3A A;  4O1N A;  2J53 A;  2Y3A A;  4JX1 C;  2ZVN A;  2A4Z A;  1E5W A;  3KWV A;  2KX0 A;  3L16 A;  1QOF A;  1B9R A;  4ARI A;  5H8Y E;  4DXA B;  4M8M A;  2KFJ A;  4XX5 A;  1I4R A;  2J0M A;  2MJD A;  3APF A;  3V60 A;  2KFK B;  3RNB C;  1N6Z A;  2QEJ C;  1SB3 C;  3RNG C;  2KO3 A;  1HTQ A;  2RDH A;  4RNA A;  2UU7 A;  3MFG A;  4Q2J A;  5L95 C;  1CQV A;  3ZDT A;  1WWT A;  3KUC B;  3H1U A;  2BKR B;  1N63 A;  4GOC A;  1UEL A;  1L6U A;  3DHH C;  2DYM A;  3DVG X;  2PJH A;  1C76 A;  2WX1 A;  3AED B;  1BXT A;  2L8J A;  2LD9 A;  3EA6 A;  3LJ3 A;  4MH0 E;  4A9A A;  4MEL A;  5G2N A;  4F7Z A;  3C8Y A;  3EFC A;  2WXM A;  2UWQ A;  3AE6 B;  1TKG A;  4WJQ A;  3ZUN A;  2PVG C;  3WAN A;  2WDV B;  3VTV A;  4S17 A;  1IUE A;  3Q8B A;  4XWT A;  1N5X A;  1KH0 A;  2ZCB A;  5I4D A;  1D5X C;  4IDI A;  1UBQ A;  1WXS A;  1SSN A;  1JML A;  3U52 E;  4HCP B;  2D5G A;  3PHW B;  4M02 A;  1AAR A;  1K8R B;  3QQ8 B;  5IP4 D;  1J19 A;  1FM0 D;  2KTF A;  1D6E C;  1MVK A;  3AUL A;  5H92 C;  1WI0 A;  2GLS A;  4L1B A;  1FNV A;  1WM3 A;  3BVM A;  4AQ7 A;  3IXS A;  3AE5 B;  2J7Q B;  4AUQ C;  4NQL B;  4K3B A;  5MPO A;  1XO3 A;  1WRI A;  3DHG C;  3O65 B;  5EE0 A;  2C7M B;  3KYC D;  3PS6 A;  1GJZ A;  3ZQ4 A;  2N9E B;  1SIJ A;  2J0K A;  3U7D A;  3L54 A;  3AEG B;  2LJ5 A;  2QJL A;  1JRP A;  4A20 A;  1ISN A;  1EO6 A;  1T6B X;  3RUI B;  1ET9 A;  4DHZ B;  2HTH A;  3C19 A;  3QIJ A;  4HEA 1;  2AQ1 B;  2C5L C;  5KHQ A;  4IW0 A;  2GBN A;  1FO4 A;  3S2A A;  1B1Z A;  1QF6 A;  5JHB A;  2NVU I;  1I4H A;  1WXA A;  1AN8 A;  3JSV B;  1SF0 A;  2WXH A;  1ZXI A;  4WWN A;  4TQ0 A;  2M0A A;  1E8X A;  3R2I A;  2N7D A;  4EFO A;  4E71 A;  4P6V F;  1KJT A;  2AX5 A;  4C56 C;  1WJU A;  4II3 B;  2IPK D;  3QCA A;  4W9E A;  1WF9 A;  4DWF A;  4IKG A;  3DQV A;  2WLB A;  4GDL A;  2G4S A;  2RDG A;  2CHX A;  1WX8 A;  3SFD B;  1NVI D;  2L05 A;  1XLP A;  2KZR A;  4IWP A;  4FLH A;  2R2O A;  2FNJ B;  4LJP B;  4GIV A;  2PMV A;  2OJR A;  1FMA D;  3U2S C;  1UGM A;  1QOG A;  2KXJ A;  4KIK B;  3W5U B;  1TYG B;  4AWJ A;  2KDF B;  3R8B A;  4R3D A;  4ITK A;  3VQI A;  1OEY A;  4N58 A;  4BKS D;  2LXC A;  1L0Y B;  3R2T A;  4C00 A;  3A4R A;  5G5G A;  3RI7 C;  2KJR A;  1YD8 U;  1ZP0 B;  3T3O A;  2IBI B;  3OWE B;  5C1Z A;  1WH3 A;  3H6N A;  3EUB 2;  1V6E A;  2MP2 A;  4TSS A;  5DPR A;  2GBR A;  4YL8 A;  2RGF A;  1C3T A;  2VH1 A;  3FC4 A;  3AV8 A;  2D3C A;  5D2M B;  4MSQ B;  1QKZ A;  1V2Y A;  5J2R A;  1BML C;  3Q2A C;  2GB1 A;  2MH7 A;  2W9N A;  1F52 A;  1UBI A;  3QX1 A;  3U8Z A;  4H2A A;  3AB5 A;  4CYE A;  2AYO B;  3T8M A;  1OFF A;  3P63 A;  4LDT B;  4NJ6 A;  5JZE B;  1PYW D;  4ZDV A;  1JRO A;  3PVL A;  2IZV B;  2WXI A;  2KQ4 X;  1WFY A;  5GMV A;  4DBG A;  3VVW B;  3IHP C;  5D94 A;  1T0R C;  2LVO A;  2PE9 A;  3Q3F A;  4JWS C;  3VR8 B;  4ZHP A;  2LAS A;  3IG3 A;  2BYE A;  1QOA A;  2WWZ A;  1VJK A;  2QIE B;  4K7U A;  1R4N I;  1WJ6 A;  1LQB A;  4KZC A;  4C4V B;  4RMA A;  1TKE A;  4XYC A;  3PRP B;  1YOV B;  3B08 A;  1VZ6 A;  4MH8 A;  2TSS A;  2M4N A;  3BYT B;  5HI1 A;  3NY5 A;  2CJO A;  4AS1 A;  3OJ3 A;  4GSW A;  1N62 A;  2K6Q A;  1VCB A;  4AP4 C;  1TTN A;  3Q3O C;  4RGO S;  4JIO U;  1T0Q C;  1BT0 A;  1WX7 A;  2MBE A;  1JWB D;  3MJW A;  1YQ3 B;  2WXK A;  3K9O B;  4HDO A;  3UIO B;  2DYB A;  4L2Y A;  3RCZ A;  3ZRC A;  4P16 A;  4W9C A;  5IAA C;  1MG8 A;  4KGR A;  3RD2 A;  4AJW A;  1EM7 A;  3GZN B;  1SJE D;  3W1S C;  4FHK A;  1WXM A;  2AQ3 B;  1WGG A;  1ZDX A;  2ASQ A;  2WXR A;  1FXA A;  4WJP A;  2E6X A;  3ZO5 B; 
#chains in the Genus database with same CATH homology
 1VZ8 A;  3PZ8 A;  5BMG A;  5BYS A;  2R61 A;  1AWD A;  1JWA D;  3V3X A;  3NUH B;  5GXG B;  3ZYY X;  4XDC A;  4ARC A;  1ENF A;  3AE8 B;  2PLP A;  4M0W A;  1OQQ A;  3BYY B;  1FCC C;  2JZP A;  5HHD G;  2YEP F;  3IAM 1;  2CU3 A;  1VR9 A;  5D3D A;  3W1S A;  1JWU D;  2QMT A;  1C9F A;  4N59 A;  1XXG A;  1I4P A;  1VDV A;  1FFV A;  2BTE A;  3N9Y C;  1ZUD 2;  1ROE A;  1TS2 A;  1PGX A;  5AUI A;  2KDM A;  3AN1 A;  2OHF A;  2G1E A;  2SAK A;  4GLS C;  2WDQ B;  3NRZ A;  2WXJ A;  4O1N A;  2J53 A;  2Y3A A;  4JX1 C;  1FEH A;  3KWV A;  1ZOY B;  4NZL B;  4LLG M;  1QOF A;  1B9R A;  4ARI A;  2MJE A;  5H8Y E;  2WXL A;  1J7A A;  3PO0 A;  1I4R A;  1P7F A;  2MJD A;  3BWU D;  1R7S A;  3HRD D;  3EGR A;  1F77 A;  4LK0 M;  3BK1 A;  1PGB A;  4UDU C;  5BMI A;  2WP9 B;  2LEK A;  4JE3 B;  4YWG G;  1STE A;  3BVZ A;  5FK9 C;  5HFY A;  2I38 A;  1NEK B;  2Y5P A;  3UI3 A;  1ESF A;  4ZOH C;  1K52 A;  1DOX A;  2KMM A;  1OQR A;  1ZE3 D;  4HKZ E;  2QSD A;  4ZRQ A;  5T8I A;  2INP E;  2QEJ C;  1DOI A;  4US9 A;  1V8C A;  1FIQ A;  3IT4 B;  4ZYS A;  2LHD A;  1L4D B;  4NAM A;  3L4P A;  4KGS A;  1KF6 B;  1I7H A;  1SB3 C;  3NS1 A;  4OVZ A;  1L5P A;  3AE2 B;  1ZDV A;  2GRI A;  1JWS D;  1N60 A;  2RDH A;  4DXG A;  4RNA A;  2V0G A;  4RH6 A;  1E9M A;  1TY0 A;  3MFG A;  4Q2J A;  1XF5 L;  2N0S B;  2WXG A;  1CQV A;  3ZGZ A;  2L32 A;  1WWT A;  5EE1 A;  3AE4 B;  1TJE A;  3LXF A;  2YEP B;  3HUI A;  4NJC A;  4HRO A;  1EU3 A;  4OW0 A;  1N63 A;  1FD6 A;  2L1A A;  1C78 A;  1VLB A;  3DWM A;  4B0E A;  2HDE A;  1NYQ A;  2LFI A;  2LMC A;  1L6U A;  2DYM A;  2IJ0 A;  1C76 A;  1KRH A;  3AED B;  3AEB B;  2XNA C;  1BXT A;  1T3Q A;  4C7Z A;  3EA6 A;  3B2G A;  4A9A A;  2AQ2 B;  2WNM A;  3NVY A;  1TY2 A;  3ZJT A;  3C8Y A;  2WXM A;  3AE6 B;  2KAC A;  1TKG A;  1UWX A;  1CZP A;  1RFK A;  5TSS A;  2PVG C;  3TEX A;  1I4G A;  1IBX A;  2DWQ A;  2ACZ B;  4A6Q A;  1DGJ A;  3U7Z A;  2WDV B;  1L0X B;  1IUE A;  2QIL A;  3Q8B A;  1AW7 A;  4TQ1 A;  4XWT A;  1N5X A;  4A90 A;  1YMH E;  1KH0 A;  4RGT A;  1SE3 A;  1LO5 D;  1TS3 A;  5I4D A;  4N6E B;  4WH4 A;  3ZJU A;  1FNU A;  1AYF A;  1HZ5 A;  1D5X C;  4IDI A;  2HTM E;  3Q8A A;  4WWM A;  1L0V B;  1SSN A;  5FKA C;  1JML A;  3U52 E;  2D5G A;  3W5V B;  4US8 A;  1SE4 A;  3P4P B;  4RF0 A;  3Q8F A;  4C7Y A;  1VZ7 A;  1UWM A;  3B2F A;  1JQ4 A;  1CK1 A;  2ZW0 A;  2LHE A;  4D2K A;  1ACC A;  3TEY A;  1WXQ A;  2FE8 A;  4A55 A;  1GOZ A;  1N61 A;  1FM0 D;  2J42 A;  5BYQ A;  1FCL A;  3PZ7 A;  3NVW A;  1D6E C;  1UNS A;  1YN5 A;  2XN9 C;  1MVK A;  2W54 A;  5H92 C;  2Z8L A;  1QQR A;  2WXP A;  3VRA B;  3TEW A;  1M4V A;  2Q5W D;  4L1B A;  5G5H A;  1HZ6 A;  1EWY C;  1FNV A;  2LJI A;  2BS3 B;  3BVM A;  4AQ7 A;  1QLB B;  1V1P A;  1YN3 A;  2ICI A;  2PTL A;  1XCT L;  3AE5 B;  1J7C A;  1FRD A;  1IGD A;  3IXS A;  3LYY A;  3P42 A;  3P4Q B;  1PFD A;  1TS4 A;  3TUO A;  1E10 A;  1I4Q A;  5MPO A;  2JX5 A;  1C79 A;  1XO3 A;  2JQR B;  1WRI A;  1J7B A;  2NTT A;  4JWU C;  2PW9 A;  5EE0 A;  4MT5 A;  4LTU A;  1UUP A;  3ZQ4 A;  1SIJ A;  3FIL A;  3MP9 A;  3AEG B;  3GS2 A;  2QJL A;  1F0Z A;  3O13 A;  1JRP A;  3W2D A;  1CJE A;  3TEZ A;  2KN4 A;  1E6E B;  2BS2 B;  4WIP A;  3BZD B;  4WUR A;  3AEA B;  1T6B X;  1XLN A;  3WCQ A;  2JYE A;  1ET6 A;  1ET9 A;  4WQM A;  2N9K A;  1FXI A;  3SEB A;  3MC0 B;  3Q69 A;  4HEA 1;  2AQ1 B;  2VZK D;  3KLS X;  2PKO A;  4RGM A;  3AEE B;  1FO4 A;  5EE3 A;  2N7J A;  1B1Z A;  1QF6 A;  2IGG A;  1I4X A;  4GDK B;  1IBX B;  1A70 A;  2DBY A;  1I4H A;  4C80 A;  2IGD A;  2KAJ A;  1AN8 A;  1SF0 A;  3T3N A;  2WXH A;  1XEE A;  1ZXI A;  2IGH A;  4TQ0 A;  2M0A A;  3KWL A;  2K0P A;  3AM9 A;  5D3I B;  1YN4 A;  1K51 A;  2OED A;  3R2I A;  2WS3 B;  4P6V F;  2AX5 A;  2ZW1 A;  4C56 C;  2IPK D;  2NMQ A;  3Q8E A;  1KLG D;  5BMH A;  3I57 A;  4YT0 B;  1ZXH A;  4IKG A;  2WLB A;  1MHH E;  2K3U A;  3AEF B;  5BYR A;  2RDG A;  2K5P A;  1UGJ A;  1HQR D;  2BB5 A;  3SFD B;  1GB4 A;  2V3P A;  3IAS 1;  1NVI D;  4YXD B;  2WU5 B;  3E56 A;  1XLP A;  4MM3 B;  1ZPS A;  1YJJ A;  2CJN A;  1F2R I;  2PMV A;  1RM6 C;  1FMA D;  3U2S C;  2KWD A;  3MJ5 A;  2FBW B;  4HRS A;  1QOG A;  4IOI E;  4YTM B;  3BVG A;  5LNK 1;  4J3O D;  1V1P B;  2V3N A;  3IT6 B;  3W5U B;  3HVZ A;  3MHZ A;  3P4R B;  1MPE A;  4FXC A;  3NZ3 A;  1TYG B;  1JWM D;  2WXQ A;  1PGA A;  3R8B A;  4R3D A;  3TSS A;  4ITK A;  2G9H D;  3VQI A;  4N58 A;  4XWW A;  1IGC A;  3FIL B;  1N5W A;  1L0Y B;  2X38 A;  3R2T A;  2V4I B;  2MJ3 A;  4KGT A;  2BW2 A;  5AUK A;  3W9C B;  2Y5C A;  1SEB D;  4TMA B;  4JPS A;  4YSZ B;  1JW9 D;  1D5Z C;  4KX6 B;  5G5G A;  2WQY B;  1HXY D;  1ZP0 B;  2LUM A;  3KQ4 A;  3T3O A;  1E7P B;  1RYJ A;  3AE1 B;  3OWE B;  1TKY A;  4RFB A;  1PUT A;  3VRB B;  2SEB D;  4YSY B;  3EUB 2;  2M56 B;  4HJG E;  3E9S A;  4OHJ A;  4USA A;  1DYQ A;  3LB8 C;  4TSS A;  2BT6 A;  2NTS A;  4YTP B;  1KLU D;  2FUG 1;  4L23 A;  2BS4 B;  2WXO A;  3AMZ A;  5D7G A;  1GB1 A;  3FC4 A;  1YNT E;  3AV8 A;  1DOY A;  2EEL A;  2WU2 B;  2JSV X;  1YQ4 B;  1NEN B;  1P7E A;  2LGI A;  3ETR A;  5C2T B;  1D5M C;  1Q10 A;  1QKZ A;  4RF1 A;  3BK2 A;  4YSX B;  2L83 A;  1TZO A;  1BML C;  1WYG A;  2GB1 A;  4GDL B;  4YTN B;  2MH7 A;  4H2A A;  3AB5 A;  1HEZ E;  1C4A A;  1OFF A;  1NI3 A;  2ONQ A;  3P63 A;  4DXF A;  1EU4 A;  1KFY B;  1V97 A;  1FNW A;  4PT5 A;  4WAF A;  3H8H A;  2IDY A;  2JWU A;  1PYW D;  3GB1 A;  2ON8 A;  4B0M A;  5JXV A;  1JRO A;  2H88 B;  2WXI A;  3AEC B;  2KQ4 X;  2W82 A;  2RPV A;  4OZA A;  4RGN A;  1C4C A;  1C77 A;  4DQO C;  2BB6 A;  2EKI A;  3AH7 A;  4JWS C;  2JU6 X;  4OZB A;  1MHX A;  3VR8 B;  5C3J B;  2VZK B;  2JXT A;  4ZHP A;  3U4E G;  2DLB A;  2B76 B;  1HA5 A;  3GP7 A;  1Y56 A;  1QOA A;  3BII D;  4ZHO A;  1FRR A;  1VJK A;  2QIE B;  3NVV A;  2INN E;  2PVO D;  2N9L A;  1QT9 A;  2JYT A;  2GI9 A;  3Q8C A;  1MI0 A;  3P4S B;  1XLQ A;  1QIL A;  4ZRP A;  3CIR B;  3AE9 B;  1TKE A;  1K53 A;  3CWI A;  2BBC A;  4REZ A;  1YJI A;  1V1O A;  1K50 A;  3AE7 B;  1VZ6 A;  2E3T A;  4MH8 A;  4XE0 A;  2TSS A;  3BYT B;  2WDR B;  3B9J A;  3ABV B;  5HI1 A;  2CJO A;  4AS1 A;  1NYR A;  1SE2 A;  1N62 A;  1XLO A;  1KTK A;  3URY A;  2I2Y A;  1L4Z B;  1GAQ B;  2WXF A;  1RWS A;  3HVD A;  1QOB A;  3SR6 A;  2K22 A;  1XCQ L;  2M19 A;  1FFU A;  1D4B A;  2K9X A;  4RGO S;  2L52 A;  2W3R A;  5HG2 A;  1JWB D;  1JAL A;  2H89 B;  1GPX A;  1WSP A;  4EE2 A;  3I9V 1;  1YQ3 B;  2DYO A;  1JCK B;  2WXK A;  3VR9 B;  1L6V A;  4L2Y A;  1SJH D;  1T5X D;  1VRA B;  4P16 A;  3P1M A;  3AE3 B;  1PDX A;  5E6J A;  4KGR A;  5EE9 A;  1BUI C;  4NAW B;  3FAH A;  1EWC A;  1TS5 A;  3RPF C;  2J4X A;  2W3S A;  1EM7 A;  3V05 A;  4XDD A;  1SXT A;  1SBB B;  1SJE D;  3ZJV A;  1C4P A;  2AQ3 B;  1ZDX A;  2MEK A;  2W55 A;  4RCO A;  4A8X C;  5FR3 A;  2WXR A;  3DWG C;  1E0Z A;  3RFZ B;  4CQN A;  1FXA A;  1WGK A;  2PIA A;  2WXN A;  4KKJ A;  2J52 A;  4HKQ A;  3NVZ A;  4KKI A;  2RMM A;  2BYT A;  3SFE B;  4OZC A;  1F2R C;  2E6X A;  3J9C A;  4MAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...