1FD6A

Delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fd6A00
1PGAA 1JMLA 1PGXA 1FCLA 2I2YA 1GB1A 1K51A 2JWUA 2NMQA 2N9LA 5JXVA 2KN4A 1XCTL 2PW9A 1K50A 4KGTA 1HEZE 1IBXB 1HZ6A 1D4BA 1MVKA 2IGHA 2JXTA 2ZW0A 3FILA 2PTLA 2I38A 2EELA 2ON8A 1UWXA 2OEDA 2LUMA 2KQ4X 1FD6A 4GLSC 4OZCA 1K52A 1IGCA 1QKZA 2ONQA 2QMTA 1Q10A 1P7FA 3V3XA 1P7EA 5HHDG 2LGIA 3GB1A 2N7JA 2J53A 2JU6X 5HI1A 5BMHA 1HZ5A 2RMMA 1F2RI 4KGRA 1MHHE 4WH4A 1YMHE 4HKZE 3UI3A 1FCCC 2KWDA 4HJGE 5HFYA 3MP9A 4MACA 1MPEA 1ZXHA 1GB4A 1XCQL 3FILB 1IBXA 5HG2A 5BMGA 2PLPA 2IGGA 1MHXA 2J52A 1MI0A 4IKGA 1PGBA 5BMIA 2ZW1A 2LHDA 4OZBA 4OZAA 2GI9A 2JSVX 4D2KA 1C9FA 4IOIE 2QSDA 2IGDA 1F2RC 1EM7A 2KDMA 2KACA 2RPVA 1K53A 2LHEA 1KH0A 2GB1A 2JZPA 4KGSA 1XF5L 1YNTE 2N9KA 2K0PA 1IGDA
chains in the Genus database with same CATH superfamily
2Y5BB 4IWOA 2ZNVC 2AEHA 1C1YB 2Z0EB 3EC8A 3BK1A 3DWGC 5DPWA 4KKIA 1SE4A 1YN5A 2FCMA 4A8XC 3V05A 3Q14C 1P1AA 3CIRB 2JXTA 3M62B 3R3MA 2ON8A 2KFJA 3B08A 3I3TB 3CF6E 1V5TA 2K6DB 2KOXA 3APCA 1K52A 3AEEB 2DZMA 4ANUA 3ETRA 3VDZA 2Z8LA 2IO1B 3H8HA 3RZWC 4F1SA 3CWIA 4RGNA 2KLGA 3AB5A 4H2AA 5HI1A 2JU6X 2WXMA 2IBIB 1BMLC 2D3GA 3ONSA 1EF5A 2JYTA 4MJSB 2KDFB 2ZNVB 1WJNA 2WX0A 4YT0B 1VCBA 1CQVA 2JRHA 3UQAA 4W9CA 4FADA 3DPDA 2IGGA 2SAKA 3S2AA 3NVWA 2JVCA 1XLPA 1RFAA 4Q2JA 2KFKA 1F2RC 3DHGC 1JWMD 5AZGA 2KX3A 1Z5SB 3DHHC 2RPVA 3MHSD 1T0RC 1NVID 2VZKD 2KMCA 3X0WA 2AWTA 2KWVB 1C77A 2C5LC 4LDTD 1PQSA 3Q8AA 1JMLA 1I4RA 4JPSA 1KLUD 1KTKA 3VUWA 3MC8A 2I2YA 4WQMA 1P3QU 2KD0A 4P6VF 4MJSA 1SIJA 1XCTL 1ZDXA 5FR3A 1TS2A 3NJTA 2PW9A 1WH3A 3A9JB 4ZRIA 2M4NA 3QC8B 1STEA 3SHQA 3ZQ4A 4GOCA 1ZOYB 2HD5B 1FEHA 2EELA 4BFRA 3ALBA 2LUMA 1IPGA 4LNIA 4NAWB 4YWGG 2R2OA 3HRDD 4DK5A 2IJ0A 4BKTA 1J7BA 3BZDB 1IUEA 3PTFC 3BYYB 3VAWA 1Q10A 1L0VB 1WY8A 3PREA 4FULA 1ACCA 4ZRKA 5HHDG 5J17A 3PO0A 1B9RA 4YL8A 4ANXA 3P4RB 3RZFA 2WXOA 2WU2B 4KSLC 2Y5CA 2MBOA 1FO4A 4LLGM 3AE3B 1C4AA 1WR6E 3OAWA 3EHVA 3KH0A 1XCQL 3UGBB 4DXAB 1A70A 3SU8X 3VR9B 3IT6B 4US9A 3AE4B 3ML8A 2LRUA 3H7PB 5GXGB 1RAXA 1UGJA 1T5XD 4NAWA 4IOIE 4M8NA 1I4GA 4MH0E 1UGMA 3URYA 3Q3JA 3U4EG 2BYVE 1I4XA 2PE6B 2K5PA 1KF6B 3GS2A 2BS2B 1L4DB 2V3SA 1WMHA 2O2VB 3QWZB 1RLFA 2DENB 1YN3A 1XLOA 1WGHA 4HLEA 4I6NB 2K39A 5D3IB 4TQ0A 1E8YA 1FCLA 5C1ZA 3LB8C 3M63B 3P4SB 2KN4A 3PGEA 4W9GA 3AU4A 4KV2A 3RNFC 3DBSA 2AYOB 1HEZE 4KZCA 2CHZA 4BKSA 1N61A 5AEKB 3AMZA 1HZ6A 1MVKA 1YJJA 2L32A 5E6JA 4ICUA 1WGYA 2GOWA 2QJLA 4IC7B 3R2IA 3H7PA 2WP9B 4K7SA 2M1MA 1WXQA 2LVQA 2KKCA 2XK5B 3ZUNA 3BY4B 1KJTA 2FUHB 2LXCA 2J42A 2D3CA 1ZP0B 3DBHI 3IAS1 3N32A 3GB1A 5CTRC 1TYGB 4YSZB 2YEPB 2Z0DB 2ZPYA 4EZLA 4BVUC 4MH8A 1HZ5A 3JVZX 4HXDA 4XWWA 1E7VA 4EEWA 3QQ8B 1WFYA 2KZRA 2L7RA 1FRRA 1IP9A 3ZDMC 4G3XB 3AE6B 4XC2A 2FBWB 4WAAA 3ZLZA 1R4NI 1R4MB 4TKNA 3WCQA 2L0FA 2V3NA 3R66C 3TL5A 2OJRA 3HIZA 2BGFA 2G1EA 4MGZE 1K53A 2LHEA 4L1BA 3KYDD 5AUIA 3ZDTA 2K0PA 2VRRB 2SEBD 4R3DA 2N4FA 4LNOA 1CZPA 3OG5A 2B76B 2BS4B 5TSSA 4CYEA 1ENFA 3N3KB 2GBJA 3RN9C 1VLBA 1D3ZA 4NPNA 2RGFA 4P1CC 2A4ZA 4URKA 1GAQB 4HCPB 2BB5A 1FFVA 2KO3A 4M0WB 5AUKA 3BWUD 1T0SC 1FXTB 1D5XC 3HK0A 1I42A 3OJ3A 3Q69A 5C23A 1VJKA 2IY0B 2K8HA 4FJVB 1CMXB 3KYCD 2LGIA 4RF0A 4W9EA 1U4AA 2WDRB 2W54A 5EDSA 2K6QA 3L13A 5EE0A 5BMHA 2BYFA 2LVPA 4WH4A 4IG7B 3QAQA 1WE6A 4DXGA 2I1JA 3T9LA 3MP9A 3ZNHB 4DXFA 1PUTA 4A55A 5IAAC 2MJ3A 3LDZE 3DBLI 5CHFA 2N9EB 4ANWA 2NCNA 3H1UA 4E3CA 1CJEA 2CJNA 4XWTA 2V0GA 3L54A 4LDTB 2FIFA 3Q3NC 4M0WA 2LD9A 1N62A 4NQKE 1HTQA 2RR9A 1KH0A 4K3BA 2BYTA 3H6NA 4KGSA 3WALA 2NS5A 2KJRA 3UQBA 2YLMA 4IM3A 4AS1A 1UBQA 1UH6A 1WSPA 4EUTA 1QZEA 5KHOA 5AZHA 2FAZA 3HUIA 3AEBB 1KOTA 3V60A 1KRHA 3AN1A 3FKYA 4C80A 3ZRFA 2JUOA 2NPTB 3IFWB 2ZW0A 3DBRB 1V9JA 1GC7A 1H4RA 1K8RB 4RM9A 4BKGA 2UYZB 5LXHA 3DQVA 5EE1A 3ZO5B 2LZ6A 2X8XX 2WDTB 4XDDA 2KTFA 1DOIA 4ITKA 1L0YB 2E6XA 2LGYA 3WANA 3Q8BA 1NDDA 1P7FA 3PLUA 4GXBA 2KWUB 3DVGX 4RGTA 2KHWB 2WXJA 3CMMB 2J53A 2WU5B 4P7IA 4HJKA 3WA0A 2DYOA 2KWDA 1C79A 3BVGA 2G9HD 5EE9A 2G3QB 3DOWA 3VFKA 3C19A 1GB4A 3NOBA 3Q2AC 2NPTA 1D5ZC 1UBIA 5L95C 1DGJA 2C7HA 3H7SA 3VR8B 3EA6A 1PGBA 1A5RA 3PLVA 3VTUA 2RSUA 4GB9A 4IM0A 2KDMA 3RNCC 5JHAA 2DZKA 1FMAD 2JT4B 2KJHB 2WXQA 4XYCA 2JF5A 1P0RA 3EECA 3L17A 3I9V1 3RCZA 1XXGA 4LTUA 3L4PA 1PGXA 1QOGA 3ZTCA 3Q8FA 1MFWA 5BO4B 3RI7C 2NMQA 3NZSA 3SFDB 1OTRB 2M56B 2N9LA 1V86A 3OWEB 5DCNA 1LM8B 3TEZA 2IYDB 2N1VA 4NJ6A 3ZXRA 3MC9A 5L83A 2WGSA 5CHWA 4AOFA 4LNNA 3QX1A 1CK1A 1QOAA 2ZCBA 3L16A 1SGHA 2YVCA 1WXMA 4GGQA 1QF6A 2LFIA 3MJWA 1JALA 2KANA 1C3TA 2QEJC 3K9PB 2KT7A 3V3XA 1D5MC 4K1RB 4EOYA 4FJYA 1QQRA 1HTOA 2BWES 1DOXA 3VRBB 4K7UA 2V4IB 2RMMA 3C0RB 4O1NA 4FA6A 1TZ1A 3ENEA 2KFKB 3TMPB 4X57B 2WX1A 2MA9B 2GRIA 3IHPC 3W9CB 3A33B 5D6JB 4FXCA 2IY1B 2BQQA 3FILB 3PSEB 4OW0A 1GG3A 5D2MB 4AWJA 3TUOA 4IKGA 4KIKB 1UUPA 4WQOB 3GZNB 4MGIE 2Z59B 2BF8B 4B0EA 3AE1B 1F1HA 2E3TA 2HJ8A 3BVMA 4M00A 1TT5B 1L2NA 3PRZA 4WAFA 3AE8B 4LK0M 3AM9A 2XN9C 2DNFA 4FLHA 4RF1A 2DWQA 2WS3B 3HHMA 4FN2A 4K81A 4RFBA 3L08A 2LXAA 3PZ7A 4RGOS 4DDGD 3V6CB 1EWCA 2INCC 4QAYA 2MJDA 2PVGC 5JXVA 1J0GA 2V9HA 3Q3OC 1N60A 1C78A 1NBFC 1DOYA 1JW9D 3FILA 1RYJA 5G55A 1I4HA 3TEXA 4EZJA 2OEDA 4KIKA 3B1LX 3ZKJC 1NI3A 1WJ4A 3MC0B 2N7EA 2KMAA 4MSQB 1FNUA 2LGXA 3P1MA 1Y56A 2W55A 1V49A 3RULA 1MG4A 3TEYA 3W5VB 2GBRA 2LJ5A 2LGSA 2QIEB 3ZJTA 2WQYB 3B2GA 4B6WA 3VQIA 3D32A 3VUYA 2XNAC 5GMVA 4FHKA 1FM0D 2O6VD 1FCCC 3B9JA 1F52A 1UWMA 2HE7A 4L23A 4ARCA 2JXXA 2IO3B 2VH2A 3AEDB 4N58A 4B95A 2KAJA 4C4VB 4AJWA 1WMHB 2KC2A 5TR5A 3NRZA 2QC8A 2W82A 4ZRJA 2L05A 2XEWA 3N1ZC 2L83A 3U7DA 2MBQA 4IWPA 1V1OA 1WE7A 4BOSC 2C7MB 4XDCA 1OGWA 2D5GA 1YX5B 3NHEB 2WWZA 2K8BA 1GOZA 4G0NB 1WF9A 2V1YA 1XF5L 3QA8A 2OHFA 1WWTA 2C9WB 4KDLB 4S0RA 2INDC 3RNAC 4F7ZA 2KXJA 1GB1A 1T0QC 4A20A 2L00B 2PEAA 1OQQA 1WJUA 4KGTA 1TS4A 3BVZA 3L10B 1JWAD 1L7YA 4C4VA 2IGHA 3DDCB 4EFOA 1M4VA 4G50A 2DX5B 1NEKB 2ZVNA 3ZRCA 1TY2A 2ONQA 3BINA 3NZUA 3TJPA 4AP4C 5IOIA 1Q0WB 3AU5A 4BOZB 1LGRA 5D7GA 5CHVC 3AE7B 3QCAA 2NTTA 5IKCM 3E56A 3N1YC 3QJZA 1JWBD 3KUCB 1ZDVA 2OJWA 4LNFA 3NS1A 1FPYA 1YMHE 1V2YA 1OEYJ 2M0AA 3ZVVA 1QLBB 1VD2A 2ZEQA 1TZOA 3I57A 1PDXA 3I63C 3A4SC 4IM2A 4XE0A 4MM3B 1JRUA 2MP2B 2FE8A 3EGRA 1WR1A 1T3QA 3AI5A 5BMIA 2GI9A 2DBYA 2K25A 1B1ZA 5DPRA 2Y3AA 2MBBB 4JWUC 4WWPA 2J0JA 2OOBB 3M95A 1E0ZA 1ROEA 2HDEA 2J0MA 3AH7A 1YNTE 1SF0A 3NVZA 1WI0A 1PGAA 2GMIC 1RFKA 5JH5C 2DYBA 4JL9A 1V1PB 4BZAA 1TJEA 2I1KA 1KLGD 1TY0A 1TS3A 4A9AA 4HCNB 2LASA 2AL6A 2GBNA 2WNMA 4FHJA 2I38A 4MM3A 1TS5A 2MP2A 3P63A 1SJED 4KX6B 1I35A 3DBHB 3AEFB 5BYRA 2ZVOA 3B2FA 3VH4B 4OZCA 1SBBB 3RD2A 2Y5PA 1FRDA 5C3JB 1WGKA 1WRIA 3GE3C 1XEEA 4E71A 3DWMA 4PS8A 3V61A 2GLSA 2IZVB 1JCKB 4REZA 4I6LB 4NZLB 1RRBA 5G5GA 4M02A 2EMSA 1YQ4B 5LNK1 1VRAB 3AV8A 4KGRA 3GP7A 3PHXB 5G2NA 2AQ3B 2IO2B 1V1PA 3IT4B 3JSVB 2LMCA 1R4NB 1MPEA 1AARA 1EWYC 2CHWA 5BMGA 1L5PA 3R7QA 1TBEA 4P1BC 4ASWC 3GE8C 2MLBA 4KDIC 2PKOA 1WXAA 4PYZA 1HQRD 3QHTA 4MSMB 1SE3A 2NBWB 5LXIB 4NJ7A 3VHTC 5EE3A 2JQRB 5E6OA 5E6PA 1GNUA 3KWVA 4M01A 2BT6A 3AE9B 1E8WA 1VZ7A 1YOVB 3UINB 2JYEA 1JWSD 2VZKB 2J4XA 3W2DA 1BT0A 1EU4A 2R2QA 1EO6A 5H8YE 1WRDB 3U7ZA 4AQ7A 3J9CA 3SR6A 1YD8U 4WWNA 3JSVA 1K50A 4EZKA 2L1AA 2KX0A 1KFYB 1D4BA 3AECB 2KN5A 2KJ6A 4J3OD 3VH3B 4HVBA 2LI5A 1Y8RC 1J7AA 4S17A 3QARA 2DAFA 4GLSC 1WGGA 3W1SC 1VZ6A 1IGCA 2FCNA 3R8BA 1F9JA 1L6VA 3KVFB 3TSSA 4HKQA 5FKAC 3Q6BA 1YQ3B 4ICVA 1WGRA 1EUVB 5T8IA 2D3BA 1EU3A 2LEKA 5IP4D 3MJ5A 1TKEA 2N7JA 1SJHD 5CX3A 1GUAB 4GDKB 3AXCA 2FIDA 3DBLB 1WM3A 4WURA 1TTNA 2ZZPB 4CQNA 2FUG1 2X38A 4MACA 2INNE 2DYMA 2ZJDA 4CO7A 1UD7A 4GMVA 5DPTA 1DYQA 3AEAB 2JZZA 4W9DA 2MJEA 1ET9A 1EF1A 4ZYSA 2JSVX 1X1MA 1BUIC 2PVOD 4G11A 4HDOA 2KDBA 4P16A 4DHJD 1J19A 1NYRA 3LXFA 4N59A 1HXYD 2N9PC 2O6VA 1FNVA 2D07B 4JE3B 1VZ8A 1NYQA 2DZIA 4HDQA 4WWMA 3ZGZA 1OFFA 3PVLA 1RM6C 5C2TB 2ACZB 4GDKA 2LVOA 2GBMA 1XO3A 2JWUA 3T8MA 2MX2A 4YSXB 1JROA 3HVZA 2BBCA 1ET6A 2LJIA 1I7HA 1V97A 4BBNF 4C7ZA 1V8CA 2H88B 4GIVA 3IAM1 3VVWB 4JLCA 1N5XA 2VH1A 4WWOA 2QMTA 4WIPA 4FJZA 4HROA 3W1SA 2PPHA 3RNGC 4B9KA 2DZJA 1XT9B 3DCGA 1E8ZA 2BW2A 2JY6A 3HM3A 4TUUA 1I4PA 3N30A 1ISNA 3EFUA 2G45B 3MTNB 4K7WA 4J6IA 3APFA 4RCOA 4AJYB 3GOEA 3HM6X 1SB3C 2PMVA 3B0AA 3VXWA 2FCSA 4K3CA 2L0TA 4MGYE 3CSTA 1Z2MA 2KWCA 3ZW3A 1V80A 4TSSA 3T3OA 2FCQA 4RNAA 2RD0A 3KLSX 1MHXA 4II2B 2M19A 1C4CA 3JYUA 1JWUD 3AE5B 1KM7A 4FBJB 1ZKHA 3UIPB 1GJZA 4ZRQA 4WJPA 1YQBA 1UELA 2K3UA 4WJNA 3ZYYX 3QIJA 4W9KA 4OVUA 3PV1A 2MH7A 4W9FA 1G6JA 2RDBC 1UZXB 3N20C 4PS3A 3RMKC 2UU7A 1TGZB 1VDVA 3RPFC 3IBEA 4RH6A 2NR2A 4B0MA 3U30A 1IBXB 2EKEC 4TQ1A 1NENB 4HEA1 1YJIA 3BIID 3KW5B 1UF0A 2KQ7A 4LCDE 1FNWA 2WXHA 1FIQA 2R61A 5MPOA 2DLBA 2V3PA 4IUMB 2MRPA 3IG3A 5JZEB 2LUEA 2MBHA 5DPSA 3PRMB 2LWPA 2WYQA 1XD3B 1GPXA 3WAOA 4NJCA 2M8SA 3DVNU 3LJ3A 1F2RI 1MHHE 4JX1C 2BWFA 1WJ6A 4HKZE 4XX5A 1QILA 5G5HA 2PE9A 1ZXHA 4N9F4 4KVGB 4WJOA 5H92C 1IBXA 1QOBA 2KVZA 2PLPA 1S1QB 4OHJA 1ESFA 2L3ZA 4A3OA 2RPQA 4RM8A 4OZBA 4IW0A 4CHKA 2KDEB 3DVGY 1R7SA 4RGMA 4KSKC 5BYQA 2K9XA 3PS6A 3SDLC 2KC1A 4DDID 1EM7A 1HE8A 3VTVA 4NQLB 1D6EC 1SE2A 2XBBC 4PS7A 1HA5A 3JW0X 3UIOB 1ZW7A 4IWQA 3I5JC 4LJPB 3FAHA 1IGDA 4USAA 3AEGB 1YX6B 3P42A 1YIWA 2RDGA 2KK8A 2D11A 4OVVA 2WXKA 1K51A 1OQYA 3ZTDA 3RT3B 3MFGA 1M94A 1N63A 4US8A 3CSFA 4YSYB 2BTEA 2ZCCA 4YTMB 2LGDA 3A1QB 4A90A 3KWLA 3IXSA 4ARIA 3ML9A 1P98A 4DBGA 4GSWA 4II3B 1UWXA 2WXNA 5D3DA 2EKIA 4HPLB 4GU2A 3AE2B 5IO9A 3UF8A 3PPAA 5J18A 2N7DA 3A9KB 2PJHA 4TV3A 1P7EA 3A9JA 2Q5WD 2DHZA 2L8JA 3PRPB 5FK9C 1OQRA 1L6UA 4F8CB 4C7YA 4ZRPA 1L4ZB 1TKGA 5HKHA 1C4PA 1AN8A 3HVDA 3TBLD 3VRAB 2INPE 3UI3A 3MHZA 1FFUA 4KZ0A 4TMAB 4JGHB 4DHJB 3K9OB 3ZNID 1RWSA 1N5WA 4ZOHC 3A1QA 1AWDA 3SEBA 1E7PB 4XZ4A 3RFZB 5HG2A 4XGAB 2H89B 2IO0B 3A4RA 3FC4A 4HWIB 1MI0A 4JWSC 4GN1A 2LHDA 2L76A 2MEKA 3TCAA 1N6ZA 4D2KA 2QDFA 4GDLB 2JPHA 1WXSA 1MJDA 4HPPA 2L52A 2KACA 1XLQA 3AULA 2QCZA 2MHJA 5FR6A 3A9KA 1R4MI 2FNJB 2N0SB 4NNJB 2ASQA 3E9SA 3OLMD 2BYEA 1V81A 5BYSA 3U8ZA 4A3PA 4PYUA 2TSSA 3Q3MC 2KLCA 3NG0A 5LLIA 1E6EB 4EKUA 3NVVA 5E6NA 2K8CA 2KQSA 5D94A 1ZGUB 1J8CA 4ACFA 2N1WA 1LXDA 2CS4A 2O2VA 4HRSA 3O65B 2AL3A 2D2QA 3KQ4A 3Q8CA 3APDA 4PK1A 4DWFA 3W5UB 1TIFA 3LYYA 1Q1OA 3V62A 4GDLA 2KMMA 3KUDB 2MBEA 4L2YA 3VUXA 4HK2A 4OVZA 3PT2B 1WYWB 1ZUD2 1TKYA 3OJ4B 1WX9A 3VTWA 1JQ4A 3V6EB 4ZHPA 3SFEB 2CU1A 2CJOA 3IVFA 2NTSA 2XK5A 1XLNA 1E5WA 2WXLA 2BS3B 2AQ1B 2MQJA 3N9YC 2MCNB 4NY0A 2JWZA 2IDYA 3N1XC 3NZ3A 3H9DA 1QOFA 2ZW1A 4OZAA 1E9MA 1H8CA 4MELA 4ZHOA 1C9FA 1C76A 4YTPB 2N9XA 4KKJA 4EE2A 3L0WB 5JHBA 2GB1A 2UWQA 1AYFA 3ZNZB 2BPSA 4C56C 2J7QB 2ZPNA 4BBNC 1WX8A 1E8XA 3C8YA 1WM2A 1ZE3D 4RMAA 3RYTA 3EUB2 2YEPF 2JX5A 4MGKE 2C60A 3R7RA 2BKRB 2QILA 3PZDA 1L0XB 2V4LA 2PTLA 1LQBA 4W9HA 3ZNGC 2KQ4X 3KUZA 3TEWA 2AX5A 1FD6A 2K1FA 2HJ1A 1T0YA 1QT9A 2CHXA 4M8MA 2A5UA 4LJOB 1QKZA 2WDVB 3DBRI 3ZJVA 1FXAA 3ECIA 1JRPA 4UDUC 5IA7A 3ZIMA 2WXGA 2D10A 1BXTA 3X23A 1P9DU 2CU3A 3BYTB 1V5OA 4MEMA 1WZ3A 2WXPA 1WYGA 5J2RA 1Q5WB 2BVCA 2M17A 2W3SA 1LFDA 3PZ8A 3M3JA 4MT5A 1IYFA 3RNBC 2KNBA 1V6EA 3DHIC 2O6VB 1PYWD 2BKFA 3NY5A 2WDQB 4YTNB 2HTHA 3P4PB 1UNSA 1E7UA 2MW5A 2NBVB 4I6PA 2M0XA 1KLVA 2ICIA 3U2SC 2BB6A 2REXA 1XQQA 2QSDA 3WAMA 3WIMA 1ZPSA 2IGDA 4BKSD 4YXDB 1WGDA 1SSNA 1WIAA 4W9IA 1F77A 1WZ0A 1VR9A 2KDIA 4ZDVA 2WXFA 3SD5A 2WLBA 4JIOU 3NS8A 2N9KA 4DQOC 1S3SG 3ABVB 1GC6A 2GBKA 1YN4A 1FXIA 2KTRB 1J7CA 2PIAA 2W9NA 2WHIA 2KVRA 4C00A 3R2TA 3QK0A 2IPKD 4HPMB 3Q3FA 4N6EB 4BAXA 3P2BA 4ZYNA 3DVNV 4PT5A 4DHZB 3WAPA 3PHWB 3W1YA 5IN7A 3BK2A 1PFDA 1SXTA 4MDKE 3TIXA 1SE9A 5I4DA 4DHZE 2LRWA 2MWSB 1AW7A 4IDIA 2W3RA 4E74A 2JRIB 1T6BX 4A6QA 2EMTA 2NBUA 2C7NB 1E90A 1YJ1A 3NUHB 3EFCA 2AQ2B 4AUQC 1E10A 3T3NA 2KTRA 2D3AA 1WX7A 1LO5D 2G4SA 4W9JA 4NAMA 4HJGE 2NVUI 5HFYA 5KHQA 2WXIA 1F0ZA 1MG8A 2DAJA 4ANVA 2B3AA 2RDHA 4W9LA 2K22A 2KYWA 1NI2A 4JQWC 2JZ3B 3O13A 2J0KA 4LNKA 1ZXIA 2CKHB 2J52A 5AZFA 3Q8EA 2HTME 3ZJUA 3U52E 1SEBD 1SIFA 2CR5A 3RUIB 3NVYA 2QHOA 3P4QB 1WXVA 2WXRA 2JZPA 1OEYA 3GZNI 2MSED 1I4QA 4WJQA 2G4DB 3RNEC 3ZXVA
chains in the Genus database with same CATH topology
1PGAA 1WSPA 3AEGB 4USAA 3P42A 2RDGA 1RFKA 3BK1A 3DWGC 3HUIA 2WXKA 3AEBB 1K51A 1V1PB 1TJEA 4KKIA 1SE4A 1KLGD 1TY0A 1YN5A 3MFGA 1KRHA 1N63A 3AN1A 3V05A 4YSYB 4A8XC 1TS3A 4A9AA 4US8A 2BTEA 4YTMB 4C80A 4A90A 3KWLA 3IXSA 4ARIA 2WNMA 3CIRB 2JXTA 2ZW0A 2I38A 1TS5A 2ON8A 3P63A 1UWXA 2WXNA 5D3DA 1SJED 4KX6B 5BYRA 3AEFB 3B2FA 2EKIA 4OZCA 5EE1A 1K52A 1SBBB 2Y5PA 3AE2B 1FRDA 3AEEB 5C3JB 4XDDA 1WGKA 1WRIA 1DOIA 4ITKA 1L0YB 1XEEA 2E6XA 3DWMA 3ETRA 3Q8BA 1P7FA 1P7EA 2Z8LA 3H8HA 1JCKB 2Q5WD 4REZA 4NZLB 4RGTA 3CWIA 4RGNA 5G5GA 3AB5A 2WXJA 4H2AA 1YQ4B 5FK9C 1OQRA 1L6UA 2J53A 2JU6X 2WXMA 5HI1A 4C7YA 1VRAB 2WU5B 3AV8A 4ZRPA 5LNK1 1L4ZB 1TKGA 3GP7A 4KGRA 1C4PA 1AN8A 1BMLC 3HVDA 2DYOA 3VRAB 2AQ3B 2JYTA 2INPE 3UI3A 2KWDA 3MHZA 1V1PA 4YT0B 1C79A 1FFUA 3IT4B 2LMCA 1CQVA 3BVGA 2G9HD 5EE9A 1MPEA 4TMAB 1RWSA 1N5WA 1EWYC 1GB4A 4ZOHC 1AWDA 3SEBA 1D5ZC 1E7PB 3RFZB 5HG2A 5BMGA 1L5PA 1DGJA 3VR8B 2H89B 2IGGA 3EA6A 2SAKA 3FC4A 1MI0A 4JWSC 1PGBA 2LHDA 3NVWA 2MEKA 4D2KA 2PKOA 1XLPA 4GDLB 4Q2JA 1HQRD 1F2RC 1SE3A 1JWMD 2KDMA 2L52A 2KACA 1XLQA 2RPVA 5EE3A 1NVID 2JQRB 2VZKD 3KWVA 1FMAD 2N0SB 2WXQA 1C77A 3E9SA 2BT6A 3AE9B 1VZ7A 5BYSA 2JYEA 3I9V1 1JWSD 2VZKB 1XXGA 4LTUA 3L4PA 1JMLA 1I4RA 2J4XA 3Q8AA 3W2DA 4JPSA 1EU4A 1PGXA 1KLUD 2TSSA 1KTKA 1QOGA 2I2YA 3Q8FA 5H8YE 1E6EB 4WQMA 3NVVA 2NMQA 3SFDB 3U7ZA 2M56B 4P6VF 4AQ7A 2N9LA 3OWEB 3J9CA 1SIJA 3SR6A 1XCTL 1ZDXA 5FR3A 1TS2A 2PW9A 1K50A 3TEZA 2L1AA 1KFYB 1D4BA 3AECB 1STEA 4HRSA 3ZQ4A 1ZOYB 4J3OD 1FEHA 3KQ4A 2EELA 3Q8CA 1J7AA 2LUMA 1CK1A 3W5UB 4NAWB 4YWGG 1QOAA 3HRDD 4GLSC 3LYYA 1VZ6A 1IGCA 2IJ0A 2KMMA 1J7BA 3BZDB 3R8BA 1IUEA 1L6VA 2LFIA 3BYYB 4L2YA 1QF6A 1JALA 2QEJC 1Q10A 4OVZA 1L0VB 3TSSA 4HKQA 5FKAC 3V3XA 1D5MC 1ZUD2 1ACCA 1YQ3B 1TKYA 5HHDG 5T8IA 1QQRA 1EU3A 3PO0A 1B9RA 2LEKA 3MJ5A 1TKEA 2N7JA 1DOXA 1SJHD 3P4RB 3VRBB 1JQ4A 2V4IB 4ZHPA 3SFEB 4GDKB 2CJOA 2RMMA 2WXOA 2WU2B 4O1NA 2NTSA 1XLNA 4WURA 2GRIA 2WXLA 2Y5CA 4CQNA 3W9CB 4LLGM 2FUG1 1FO4A 3AE3B 2X38A 4MACA 1C4AA 2BS3B 2INNE 2AQ1B 2DYMA 1XCQL 4FXCA 3N9YC 3FILB 2IDYA 4OW0A 1A70A 1DYQA 3AEAB 3NZ3A 3VR9B 3IT6B 4US9A 1QOFA 2MJEA 3AE4B 4IKGA 1ET9A 5GXGB 3TUOA 1UUPA 1UGJA 2ZW1A 4ZYSA 4OZAA 1E9MA 2JSVX 1T5XD 4B0EA 1BUIC 3AE1B 2PVOD 4IOIE 4ZHOA 1C9FA 1I4GA 2E3TA 1C76A 3BVMA 4YTPB 4P16A 3URYA 3U4EG 1I4XA 4KKJA 1NYRA 4WAFA 3LXFA 3AE8B 4EE2A 4LK0M 4N59A 1HXYD 3AM9A 2GB1A 2K5PA 1KF6B 2XN9C 3GS2A 2BS2B 1AYFA 4RF1A 1L4DB 1FNVA 2DWQA 2WS3B 4C56C 4RFBA 4JE3B 1YN3A 1XLOA 1VZ8A 1NYQA 3PZ7A 4RGOS 5D3IB 3C8YA 4WWMA 3ZGZA 1EWCA 1OFFA 4TQ0A 1RM6C 5C2TB 2MJDA 1FCLA 2ACZB 1ZE3D 1XO3A 2PVGC 2JWUA 4YSXB 3LB8C 3EUB2 1JROA 2YEPF 3HVZA 2BBCA 2JX5A 5JXVA 1ET6A 3P4SB 2KN4A 2LJIA 1I7HA 1V97A 2QILA 1N60A 4C7ZA 1HEZE 1C78A 1N61A 3AMZA 1L0XB 1HZ6A 1DOYA 1V8CA 1MVKA 1JW9D 3FILA 2PTLA 1RYJA 2H88B 1YJJA 1I4HA 2L32A 5E6JA 3TEXA 2OEDA 2QJLA 2KQ4X 3IAM1 3TEWA 3R2IA 2AX5A 1FD6A 2WP9B 1QT9A 1NI3A 1WXQA 1N5XA 3MC0B 1QKZA 2WDVB 3ZJVA 1FXAA 2QMTA 4WIPA 4HROA 1FNUA 1JRPA 3W1SA 3P1MA 2J42A 1Y56A 2W55A 4UDUC 2WXGA 1BXTA 1ZP0B 3IAS1 3TEYA 3W5VB 2BW2A 3GB1A 1TYGB 2CU3A 3BYTB 2QIEB 3ZJTA 2WQYB 1I4PA 2WXPA 1WYGA 3B2GA 4YSZB 2YEPB 2W3SA 3VQIA 4MH8A 1HZ5A 4RCOA 2XNAC 1SB3C 4XWWA 2PMVA 1FM0D 3PZ8A 1FCCC 3B9JA 1UWMA 1FRRA 4L23A 4MT5A 4ARCA 3AEDB 4N58A 2KAJA 1PYWD 2WDQB 4TSSA 4YTNB 3T3OA 3P4PB 1UNSA 4RNAA 3AE6B 3NRZA 3KLSX 2W82A 1MHXA 2FBWB 2L83A 2M19A 1C4CA 3WCQA 1JWUD 3AE5B 2V3NA 4ZRQA 2ICIA 1V1OA 3U2SC 2BB6A 2QSDA 1ZPSA 2IGDA 4YXDB 2G1EA 4XDCA 1SSNA 2D5GA 2K3UA 1K53A 2LHEA 1F77A 4L1BA 3ZYYX 1VR9A 2WXFA 2WLBA 1GOZA 5AUIA 2MH7A 1XF5L 2OHFA 2N9KA 4DQOC 2K0PA 3ABVB 2SEBD 1WWTA 4R3DA 1YN4A 1FXIA 1VDVA 3RPFC 4RH6A 1GB1A 1CZPA 1J7CA 2PIAA 2B76B 2BS4B 5TSSA 1ENFA 3R2TA 1OQQA 4B0MA 4KGTA 1TS4A 1VLBA 3BVZA 2IPKD 1JWAD 1IBXB 4N6EB 4TQ1A 1NENB 2IGHA 4HEA1 1YJIA 3BIID 4PT5A 1GAQB 1FNWA 2BB5A 2WXHA 1M4VA 1FIQA 1FFVA 3BK2A 2R61A 5MPOA 1PFDA 1NEKB 2DLBA 2V3PA 5AUKA 3BWUD 1TY2A 2ONQA 1D5XC 1SXTA 3Q69A 5I4DA 1VJKA 1AW7A 4IDIA 2W3RA 5D7GA 3AE7B 2LGIA 1T6BX 2NTTA 4RF0A 4A6QA 1GPXA 3E56A 1JWBD 2WDRB 2W54A 1ZDVA 3NUHB 4NJCA 3NS1A 5EE0A 5BMHA 2AQ2B 1E10A 1F2RI 1MHHE 4WH4A 3T3NA 1YMHE 1LO5D 4JX1C 4DXGA 4HKZE 2M0AA 4NAMA 4HJGE 5HFYA 1QILA 3MP9A 2WXIA 1QLBB 4DXFA 5G5HA 1F0ZA 1PUTA 1TZOA 1ZXHA 3I57A 1PDXA 4A55A 5H92C 2RDHA 1IBXA 2MJ3A 2K22A 1QOBA 4XE0A 4MM3B 2PLPA 3O13A 4OHJA 1ESFA 1ZXIA 2FE8A 3EGRA 2J52A 1T3QA 5BMIA 3Q8EA 2HTME 4OZBA 1CJEA 2CJNA 4XWTA 2GI9A 2V0GA 3ZJUA 1R7SA 4RGMA 5BYQA 2DBYA 2K9XA 1SEBD 4M0WA 3U52E 3NVYA 1B1ZA 1EM7A 1N62A 3P4QB 2Y3AA 4JWUC 1D6EC 1SE2A 2WXRA 1KH0A 2JZPA 2BYTA 1HA5A 4KGSA 1E0ZA 1ROEA 2HDEA 3FAHA 1I4QA 3AH7A 1YNTE 4AS1A 1SF0A 3NVZA 1IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGA A;  1JML A;  1PGX A;  1FCL A;  2I2Y A;  1GB1 A;  1K51 A;  2JWU A;  2NMQ A;  2N9L A;  5JXV A;  2KN4 A;  1XCT L;  2PW9 A;  1K50 A;  4KGT A;  1HEZ E;  1IBX B;  1HZ6 A;  1D4B A;  1MVK A;  2IGH A;  2JXT A;  2ZW0 A;  3FIL A;  2PTL A;  2I38 A;  2EEL A;  2ON8 A;  1UWX A;  2OED A;  2LUM A;  2KQ4 X;  1FD6 A;  4GLS C;  4OZC A;  1K52 A;  1IGC A;  1QKZ A;  2ONQ A;  2QMT A;  1Q10 A;  1P7F A;  3V3X A;  1P7E A;  5HHD G;  2LGI A;  3GB1 A;  2N7J A;  2J53 A;  2JU6 X;  5HI1 A;  5BMH A;  1HZ5 A;  2RMM A;  1F2R I;  4KGR A;  1MHH E;  4WH4 A;  1YMH E;  4HKZ E;  3UI3 A;  1FCC C;  2KWD A;  4HJG E;  5HFY A;  3MP9 A;  4MAC A;  1MPE A;  1ZXH A;  1GB4 A;  1XCQ L;  3FIL B;  1IBX A;  5HG2 A;  5BMG A;  2PLP A;  2IGG A;  1MHX A;  2J52 A;  1MI0 A;  4IKG A;  1PGB A;  5BMI A;  2ZW1 A;  2LHD A;  4OZB A;  4OZA A;  2GI9 A;  2JSV X;  4D2K A;  1C9F A;  4IOI E;  2QSD A;  2IGD A;  1F2R C;  1EM7 A;  2KDM A;  2KAC A;  2RPV A;  1K53 A;  2LHE A;  1KH0 A;  2GB1 A;  2JZP A;  4KGS A;  1XF5 L;  1YNT E;  2N9K A;  2K0P A;  1IGD A; 
#chains in the Genus database with same CATH topology
 2Y5B B;  4IWO A;  2ZNV C;  2AEH A;  1C1Y B;  2Z0E B;  3EC8 A;  3BK1 A;  3DWG C;  5DPW A;  4KKI A;  1SE4 A;  1YN5 A;  2FCM A;  4A8X C;  3V05 A;  3Q14 C;  1P1A A;  3CIR B;  2JXT A;  3M62 B;  3R3M A;  2ON8 A;  2KFJ A;  3B08 A;  3I3T B;  3CF6 E;  1V5T A;  2K6D B;  2KOX A;  3APC A;  1K52 A;  3AEE B;  2DZM A;  4ANU A;  3ETR A;  3VDZ A;  2Z8L A;  2IO1 B;  3H8H A;  3RZW C;  4F1S A;  3CWI A;  4RGN A;  2KLG A;  3AB5 A;  4H2A A;  5HI1 A;  2JU6 X;  2WXM A;  2IBI B;  1BML C;  2D3G A;  3ONS A;  1EF5 A;  2JYT A;  4MJS B;  2KDF B;  2ZNV B;  1WJN A;  2WX0 A;  4YT0 B;  1VCB A;  1CQV A;  2JRH A;  3UQA A;  4W9C A;  4FAD A;  3DPD A;  2IGG A;  2SAK A;  3S2A A;  3NVW A;  2JVC A;  1XLP A;  1RFA A;  4Q2J A;  2KFK A;  1F2R C;  3DHG C;  1JWM D;  5AZG A;  2KX3 A;  1Z5S B;  3DHH C;  2RPV A;  3MHS D;  1T0R C;  1NVI D;  2VZK D;  2KMC A;  3X0W A;  2AWT A;  2KWV B;  1C77 A;  2C5L C;  4LDT D;  1PQS A;  3Q8A A;  1JML A;  1I4R A;  4JPS A;  1KLU D;  1KTK A;  3VUW A;  3MC8 A;  2I2Y A;  4WQM A;  1P3Q U;  2KD0 A;  4P6V F;  4MJS A;  1SIJ A;  1XCT L;  1ZDX A;  5FR3 A;  1TS2 A;  3NJT A;  2PW9 A;  1WH3 A;  3A9J B;  4ZRI A;  2M4N A;  3QC8 B;  1STE A;  3SHQ A;  3ZQ4 A;  4GOC A;  1ZOY B;  2HD5 B;  1FEH A;  2EEL A;  4BFR A;  3ALB A;  2LUM A;  1IPG A;  4LNI A;  4NAW B;  4YWG G;  2R2O A;  3HRD D;  4DK5 A;  2IJ0 A;  4BKT A;  1J7B A;  3BZD B;  1IUE A;  3PTF C;  3BYY B;  3VAW A;  1Q10 A;  1L0V B;  1WY8 A;  3PRE A;  4FUL A;  1ACC A;  4ZRK A;  5HHD G;  5J17 A;  3PO0 A;  1B9R A;  4YL8 A;  4ANX A;  3P4R B;  3RZF A;  2WXO A;  2WU2 B;  4KSL C;  2Y5C A;  2MBO A;  1FO4 A;  4LLG M;  3AE3 B;  1C4A A;  1WR6 E;  3OAW A;  3EHV A;  3KH0 A;  1XCQ L;  3UGB B;  4DXA B;  1A70 A;  3SU8 X;  3VR9 B;  3IT6 B;  4US9 A;  3AE4 B;  3ML8 A;  2LRU A;  3H7P B;  5GXG B;  1RAX A;  1UGJ A;  1T5X D;  4NAW A;  4IOI E;  4M8N A;  1I4G A;  4MH0 E;  1UGM A;  3URY A;  3Q3J A;  3U4E G;  2BYV E;  1I4X A;  2PE6 B;  2K5P A;  1KF6 B;  3GS2 A;  2BS2 B;  1L4D B;  2V3S A;  1WMH A;  2O2V B;  3QWZ B;  1RLF A;  2DEN B;  1YN3 A;  1XLO A;  1WGH A;  4HLE A;  4I6N B;  2K39 A;  5D3I B;  4TQ0 A;  1E8Y A;  1FCL A;  5C1Z A;  3LB8 C;  3M63 B;  3P4S B;  2KN4 A;  3PGE A;  4W9G A;  3AU4 A;  4KV2 A;  3RNF C;  3DBS A;  2AYO B;  1HEZ E;  4KZC A;  2CHZ A;  4BKS A;  1N61 A;  5AEK B;  3AMZ A;  1HZ6 A;  1MVK A;  1YJJ A;  2L32 A;  5E6J A;  4ICU A;  1WGY A;  2GOW A;  2QJL A;  4IC7 B;  3R2I A;  3H7P A;  2WP9 B;  4K7S A;  2M1M A;  1WXQ A;  2LVQ A;  2KKC A;  2XK5 B;  3ZUN A;  3BY4 B;  1KJT A;  2FUH B;  2LXC A;  2J42 A;  2D3C A;  1ZP0 B;  3DBH I;  3IAS 1;  3N32 A;  3GB1 A;  5CTR C;  1TYG B;  4YSZ B;  2YEP B;  2Z0D B;  2ZPY A;  4EZL A;  4BVU C;  4MH8 A;  1HZ5 A;  3JVZ X;  4HXD A;  4XWW A;  1E7V A;  4EEW A;  3QQ8 B;  1WFY A;  2KZR A;  2L7R A;  1FRR A;  1IP9 A;  3ZDM C;  4G3X B;  3AE6 B;  4XC2 A;  2FBW B;  4WAA A;  3ZLZ A;  1R4N I;  1R4M B;  4TKN A;  3WCQ A;  2L0F A;  2V3N A;  3R66 C;  3TL5 A;  2OJR A;  3HIZ A;  2BGF A;  2G1E A;  4MGZ E;  1K53 A;  2LHE A;  4L1B A;  3KYD D;  5AUI A;  3ZDT A;  2K0P A;  2VRR B;  2SEB D;  4R3D A;  2N4F A;  4LNO A;  1CZP A;  3OG5 A;  2B76 B;  2BS4 B;  5TSS A;  4CYE A;  1ENF A;  3N3K B;  2GBJ A;  3RN9 C;  1VLB A;  1D3Z A;  4NPN A;  2RGF A;  4P1C C;  2A4Z A;  4URK A;  1GAQ B;  4HCP B;  2BB5 A;  1FFV A;  2KO3 A;  4M0W B;  5AUK A;  3BWU D;  1T0S C;  1FXT B;  1D5X C;  3HK0 A;  1I42 A;  3OJ3 A;  3Q69 A;  5C23 A;  1VJK A;  2IY0 B;  2K8H A;  4FJV B;  1CMX B;  3KYC D;  2LGI A;  4RF0 A;  4W9E A;  1U4A A;  2WDR B;  2W54 A;  5EDS A;  2K6Q A;  3L13 A;  5EE0 A;  5BMH A;  2BYF A;  2LVP A;  4WH4 A;  4IG7 B;  3QAQ A;  1WE6 A;  4DXG A;  2I1J A;  3T9L A;  3MP9 A;  3ZNH B;  4DXF A;  1PUT A;  4A55 A;  5IAA C;  2MJ3 A;  3LDZ E;  3DBL I;  5CHF A;  2N9E B;  4ANW A;  2NCN A;  3H1U A;  4E3C A;  1CJE A;  2CJN A;  4XWT A;  2V0G A;  3L54 A;  4LDT B;  2FIF A;  3Q3N C;  4M0W A;  2LD9 A;  1N62 A;  4NQK E;  1HTQ A;  2RR9 A;  1KH0 A;  4K3B A;  2BYT A;  3H6N A;  4KGS A;  3WAL A;  2NS5 A;  2KJR A;  3UQB A;  2YLM A;  4IM3 A;  4AS1 A;  1UBQ A;  1UH6 A;  1WSP A;  4EUT A;  1QZE A;  5KHO A;  5AZH A;  2FAZ A;  3HUI A;  3AEB B;  1KOT A;  3V60 A;  1KRH A;  3AN1 A;  3FKY A;  4C80 A;  3ZRF A;  2JUO A;  2NPT B;  3IFW B;  2ZW0 A;  3DBR B;  1V9J A;  1GC7 A;  1H4R A;  1K8R B;  4RM9 A;  4BKG A;  2UYZ B;  5LXH A;  3DQV A;  5EE1 A;  3ZO5 B;  2LZ6 A;  2X8X X;  2WDT B;  4XDD A;  2KTF A;  1DOI A;  4ITK A;  1L0Y B;  2E6X A;  2LGY A;  3WAN A;  3Q8B A;  1NDD A;  1P7F A;  3PLU A;  4GXB A;  2KWU B;  3DVG X;  4RGT A;  2KHW B;  2WXJ A;  3CMM B;  2J53 A;  2WU5 B;  4P7I A;  4HJK A;  3WA0 A;  2DYO A;  2KWD A;  1C79 A;  3BVG A;  2G9H D;  5EE9 A;  2G3Q B;  3DOW A;  3VFK A;  3C19 A;  1GB4 A;  3NOB A;  3Q2A C;  2NPT A;  1D5Z C;  1UBI A;  5L95 C;  1DGJ A;  2C7H A;  3H7S A;  3VR8 B;  3EA6 A;  1PGB A;  1A5R A;  3PLV A;  3VTU A;  2RSU A;  4GB9 A;  4IM0 A;  2KDM A;  3RNC C;  5JHA A;  2DZK A;  1FMA D;  2JT4 B;  2KJH B;  2WXQ A;  4XYC A;  2JF5 A;  1P0R A;  3EEC A;  3L17 A;  3I9V 1;  3RCZ A;  1XXG A;  4LTU A;  3L4P A;  1PGX A;  1QOG A;  3ZTC A;  3Q8F A;  1MFW A;  5BO4 B;  3RI7 C;  2NMQ A;  3NZS A;  3SFD B;  1OTR B;  2M56 B;  2N9L A;  1V86 A;  3OWE B;  5DCN A;  1LM8 B;  3TEZ A;  2IYD B;  2N1V A;  4NJ6 A;  3ZXR A;  3MC9 A;  5L83 A;  2WGS A;  5CHW A;  4AOF A;  4LNN A;  3QX1 A;  1CK1 A;  1QOA A;  2ZCB A;  3L16 A;  1SGH A;  2YVC A;  1WXM A;  4GGQ A;  1QF6 A;  2LFI A;  3MJW A;  1JAL A;  2KAN A;  1C3T A;  2QEJ C;  3K9P B;  2KT7 A;  3V3X A;  1D5M C;  4K1R B;  4EOY A;  4FJY A;  1QQR A;  1HTO A;  2BWE S;  1DOX A;  3VRB B;  4K7U A;  2V4I B;  2RMM A;  3C0R B;  4O1N A;  4FA6 A;  1TZ1 A;  3ENE A;  2KFK B;  3TMP B;  4X57 B;  2WX1 A;  2MA9 B;  2GRI A;  3IHP C;  3W9C B;  3A33 B;  5D6J B;  4FXC A;  2IY1 B;  2BQQ A;  3FIL B;  3PSE B;  4OW0 A;  1GG3 A;  5D2M B;  4AWJ A;  3TUO A;  4IKG A;  4KIK B;  1UUP A;  4WQO B;  3GZN B;  4MGI E;  2Z59 B;  2BF8 B;  4B0E A;  3AE1 B;  1F1H A;  2E3T A;  2HJ8 A;  3BVM A;  4M00 A;  1TT5 B;  1L2N A;  3PRZ A;  4WAF A;  3AE8 B;  4LK0 M;  3AM9 A;  2XN9 C;  2DNF A;  4FLH A;  4RF1 A;  2DWQ A;  2WS3 B;  3HHM A;  4FN2 A;  4K81 A;  4RFB A;  3L08 A;  2LXA A;  3PZ7 A;  4RGO S;  4DDG D;  3V6C B;  1EWC A;  2INC C;  4QAY A;  2MJD A;  2PVG C;  5JXV A;  1J0G A;  2V9H A;  3Q3O C;  1N60 A;  1C78 A;  1NBF C;  1DOY A;  1JW9 D;  3FIL A;  1RYJ A;  5G55 A;  1I4H A;  3TEX A;  4EZJ A;  2OED A;  4KIK A;  3B1L X;  3ZKJ C;  1NI3 A;  1WJ4 A;  3MC0 B;  2N7E A;  2KMA A;  4MSQ B;  1FNU A;  2LGX A;  3P1M A;  1Y56 A;  2W55 A;  1V49 A;  3RUL A;  1MG4 A;  3TEY A;  3W5V B;  2GBR A;  2LJ5 A;  2LGS A;  2QIE B;  3ZJT A;  2WQY B;  3B2G A;  4B6W A;  3VQI A;  3D32 A;  3VUY A;  2XNA C;  5GMV A;  4FHK A;  1FM0 D;  2O6V D;  1FCC C;  3B9J A;  1F52 A;  1UWM A;  2HE7 A;  4L23 A;  4ARC A;  2JXX A;  2IO3 B;  2VH2 A;  3AED B;  4N58 A;  4B95 A;  2KAJ A;  4C4V B;  4AJW A;  1WMH B;  2KC2 A;  5TR5 A;  3NRZ A;  2QC8 A;  2W82 A;  4ZRJ A;  2L05 A;  2XEW A;  3N1Z C;  2L83 A;  3U7D A;  2MBQ A;  4IWP A;  1V1O A;  1WE7 A;  4BOS C;  2C7M B;  4XDC A;  1OGW A;  2D5G A;  1YX5 B;  3NHE B;  2WWZ A;  2K8B A;  1GOZ A;  4G0N B;  1WF9 A;  2V1Y A;  1XF5 L;  3QA8 A;  2OHF A;  1WWT A;  2C9W B;  4KDL B;  4S0R A;  2IND C;  3RNA C;  4F7Z A;  2KXJ A;  1GB1 A;  1T0Q C;  4A20 A;  2L00 B;  2PEA A;  1OQQ A;  1WJU A;  4KGT A;  1TS4 A;  3BVZ A;  3L10 B;  1JWA D;  1L7Y A;  4C4V A;  2IGH A;  3DDC B;  4EFO A;  1M4V A;  4G50 A;  2DX5 B;  1NEK B;  2ZVN A;  3ZRC A;  1TY2 A;  2ONQ A;  3BIN A;  3NZU A;  3TJP A;  4AP4 C;  5IOI A;  1Q0W B;  3AU5 A;  4BOZ B;  1LGR A;  5D7G A;  5CHV C;  3AE7 B;  3QCA A;  2NTT A;  5IKC M;  3E56 A;  3N1Y C;  3QJZ A;  1JWB D;  3KUC B;  1ZDV A;  2OJW A;  4LNF A;  3NS1 A;  1FPY A;  1YMH E;  1V2Y A;  1OEY J;  2M0A A;  3ZVV A;  1QLB B;  1VD2 A;  2ZEQ A;  1TZO A;  3I57 A;  1PDX A;  3I63 C;  3A4S C;  4IM2 A;  4XE0 A;  4MM3 B;  1JRU A;  2MP2 B;  2FE8 A;  3EGR A;  1WR1 A;  1T3Q A;  3AI5 A;  5BMI A;  2GI9 A;  2DBY A;  2K25 A;  1B1Z A;  5DPR A;  2Y3A A;  2MBB B;  4JWU C;  4WWP A;  2J0J A;  2OOB B;  3M95 A;  1E0Z A;  1ROE A;  2HDE A;  2J0M A;  3AH7 A;  1YNT E;  1SF0 A;  3NVZ A;  1WI0 A;  1PGA A;  2GMI C;  1RFK A;  5JH5 C;  2DYB A;  4JL9 A;  1V1P B;  4BZA A;  1TJE A;  2I1K A;  1KLG D;  1TY0 A;  1TS3 A;  4A9A A;  4HCN B;  2LAS A;  2AL6 A;  2GBN A;  2WNM A;  4FHJ A;  2I38 A;  4MM3 A;  1TS5 A;  2MP2 A;  3P63 A;  1SJE D;  4KX6 B;  1I35 A;  3DBH B;  3AEF B;  5BYR A;  2ZVO A;  3B2F A;  3VH4 B;  4OZC A;  1SBB B;  3RD2 A;  2Y5P A;  1FRD A;  5C3J B;  1WGK A;  1WRI A;  3GE3 C;  1XEE A;  4E71 A;  3DWM A;  4PS8 A;  3V61 A;  2GLS A;  2IZV B;  1JCK B;  4REZ A;  4I6L B;  4NZL B;  1RRB A;  5G5G A;  4M02 A;  2EMS A;  1YQ4 B;  5LNK 1;  1VRA B;  3AV8 A;  4KGR A;  3GP7 A;  3PHX B;  5G2N A;  2AQ3 B;  2IO2 B;  1V1P A;  3IT4 B;  3JSV B;  2LMC A;  1R4N B;  1MPE A;  1AAR A;  1EWY C;  2CHW A;  5BMG A;  1L5P A;  3R7Q A;  1TBE A;  4P1B C;  4ASW C;  3GE8 C;  2MLB A;  4KDI C;  2PKO A;  1WXA A;  4PYZ A;  1HQR D;  3QHT A;  4MSM B;  1SE3 A;  2NBW B;  5LXI B;  4NJ7 A;  3VHT C;  5EE3 A;  2JQR B;  5E6O A;  5E6P A;  1GNU A;  3KWV A;  4M01 A;  2BT6 A;  3AE9 B;  1E8W A;  1VZ7 A;  1YOV B;  3UIN B;  2JYE A;  1JWS D;  2VZK B;  2J4X A;  3W2D A;  1BT0 A;  1EU4 A;  2R2Q A;  1EO6 A;  5H8Y E;  1WRD B;  3U7Z A;  4AQ7 A;  3J9C A;  3SR6 A;  1YD8 U;  4WWN A;  3JSV A;  1K50 A;  4EZK A;  2L1A A;  2KX0 A;  1KFY B;  1D4B A;  3AEC B;  2KN5 A;  2KJ6 A;  4J3O D;  3VH3 B;  4HVB A;  2LI5 A;  1Y8R C;  1J7A A;  4S17 A;  3QAR A;  2DAF A;  4GLS C;  1WGG A;  3W1S C;  1VZ6 A;  1IGC A;  2FCN A;  3R8B A;  1F9J A;  1L6V A;  3KVF B;  3TSS A;  4HKQ A;  5FKA C;  3Q6B A;  1YQ3 B;  4ICV A;  1WGR A;  1EUV B;  5T8I A;  2D3B A;  1EU3 A;  2LEK A;  5IP4 D;  3MJ5 A;  1TKE A;  2N7J A;  1SJH D;  5CX3 A;  1GUA B;  4GDK B;  3AXC A;  2FID A;  3DBL B;  1WM3 A;  4WUR A;  1TTN A;  2ZZP B;  4CQN A;  2FUG 1;  2X38 A;  4MAC A;  2INN E;  2DYM A;  2ZJD A;  4CO7 A;  1UD7 A;  4GMV A;  5DPT A;  1DYQ A;  3AEA B;  2JZZ A;  4W9D A;  2MJE A;  1ET9 A;  1EF1 A;  4ZYS A;  2JSV X;  1X1M A;  1BUI C;  2PVO D;  4G11 A;  4HDO A;  2KDB A;  4P16 A;  4DHJ D;  1J19 A;  1NYR A;  3LXF A;  4N59 A;  1HXY D;  2N9P C;  2O6V A;  1FNV A;  2D07 B;  4JE3 B;  1VZ8 A;  1NYQ A;  2DZI A;  4HDQ A;  4WWM A;  3ZGZ A;  1OFF A;  3PVL A;  1RM6 C;  5C2T B;  2ACZ B;  4GDK A;  2LVO A;  2GBM A;  1XO3 A;  2JWU A;  3T8M A;  2MX2 A;  4YSX B;  1JRO A;  3HVZ A;  2BBC A;  1ET6 A;  2LJI A;  1I7H A;  1V97 A;  4BBN F;  4C7Z A;  1V8C A;  2H88 B;  4GIV A;  3IAM 1;  3VVW B;  4JLC A;  1N5X A;  2VH1 A;  4WWO A;  2QMT A;  4WIP A;  4FJZ A;  4HRO A;  3W1S A;  2PPH A;  3RNG C;  4B9K A;  2DZJ A;  1XT9 B;  3DCG A;  1E8Z A;  2BW2 A;  2JY6 A;  3HM3 A;  4TUU A;  1I4P A;  3N30 A;  1ISN A;  3EFU A;  2G45 B;  3MTN B;  4K7W A;  4J6I A;  3APF A;  4RCO A;  4AJY B;  3GOE A;  3HM6 X;  1SB3 C;  2PMV A;  3B0A A;  3VXW A;  2FCS A;  4K3C A;  2L0T A;  4MGY E;  3CST A;  1Z2M A;  2KWC A;  3ZW3 A;  1V80 A;  4TSS A;  3T3O A;  2FCQ A;  4RNA A;  2RD0 A;  3KLS X;  1MHX A;  4II2 B;  2M19 A;  1C4C A;  3JYU A;  1JWU D;  3AE5 B;  1KM7 A;  4FBJ B;  1ZKH A;  3UIP B;  1GJZ A;  4ZRQ A;  4WJP A;  1YQB A;  1UEL A;  2K3U A;  4WJN A;  3ZYY X;  3QIJ A;  4W9K A;  4OVU A;  3PV1 A;  2MH7 A;  4W9F A;  1G6J A;  2RDB C;  1UZX B;  3N20 C;  4PS3 A;  3RMK C;  2UU7 A;  1TGZ B;  1VDV A;  3RPF C;  3IBE A;  4RH6 A;  2NR2 A;  4B0M A;  3U30 A;  1IBX B;  2EKE C;  4TQ1 A;  1NEN B;  4HEA 1;  1YJI A;  3BII D;  3KW5 B;  1UF0 A;  2KQ7 A;  4LCD E;  1FNW A;  2WXH A;  1FIQ A;  2R61 A;  5MPO A;  2DLB A;  2V3P A;  4IUM B;  2MRP A;  3IG3 A;  5JZE B;  2LUE A;  2MBH A;  5DPS A;  3PRM B;  2LWP A;  2WYQ A;  1XD3 B;  1GPX A;  3WAO A;  4NJC A;  2M8S A;  3DVN U;  3LJ3 A;  1F2R I;  1MHH E;  4JX1 C;  2BWF A;  1WJ6 A;  4HKZ E;  4XX5 A;  1QIL A;  5G5H A;  2PE9 A;  1ZXH A;  4N9F 4;  4KVG B;  4WJO A;  5H92 C;  1IBX A;  1QOB A;  2KVZ A;  2PLP A;  1S1Q B;  4OHJ A;  1ESF A;  2L3Z A;  4A3O A;  2RPQ A;  4RM8 A;  4OZB A;  4IW0 A;  4CHK A;  2KDE B;  3DVG Y;  1R7S A;  4RGM A;  4KSK C;  5BYQ A;  2K9X A;  3PS6 A;  3SDL C;  2KC1 A;  4DDI D;  1EM7 A;  1HE8 A;  3VTV A;  4NQL B;  1D6E C;  1SE2 A;  2XBB C;  4PS7 A;  1HA5 A;  3JW0 X;  3UIO B;  1ZW7 A;  4IWQ A;  3I5J C;  4LJP B;  3FAH A;  1IGD A;  4USA A;  3AEG B;  1YX6 B;  3P42 A;  1YIW A;  2RDG A;  2KK8 A;  2D11 A;  4OVV A;  2WXK A;  1K51 A;  1OQY A;  3ZTD A;  3RT3 B;  3MFG A;  1M94 A;  1N63 A;  4US8 A;  3CSF A;  4YSY B;  2BTE A;  2ZCC A;  4YTM B;  2LGD A;  3A1Q B;  4A90 A;  3KWL A;  3IXS A;  4ARI A;  3ML9 A;  1P98 A;  4DBG A;  4GSW A;  4II3 B;  1UWX A;  2WXN A;  5D3D A;  2EKI A;  4HPL B;  4GU2 A;  3AE2 B;  5IO9 A;  3UF8 A;  3PPA A;  5J18 A;  2N7D A;  3A9K B;  2PJH A;  4TV3 A;  1P7E A;  3A9J A;  2Q5W D;  2DHZ A;  2L8J A;  3PRP B;  5FK9 C;  1OQR A;  1L6U A;  4F8C B;  4C7Y A;  4ZRP A;  1L4Z B;  1TKG A;  5HKH A;  1C4P A;  1AN8 A;  3HVD A;  3TBL D;  3VRA B;  2INP E;  3UI3 A;  3MHZ A;  1FFU A;  4KZ0 A;  4TMA B;  4JGH B;  4DHJ B;  3K9O B;  3ZNI D;  1RWS A;  1N5W A;  4ZOH C;  3A1Q A;  1AWD A;  3SEB A;  1E7P B;  4XZ4 A;  3RFZ B;  5HG2 A;  4XGA B;  2H89 B;  2IO0 B;  3A4R A;  3FC4 A;  4HWI B;  1MI0 A;  4JWS C;  4GN1 A;  2LHD A;  2L76 A;  2MEK A;  3TCA A;  1N6Z A;  4D2K A;  2QDF A;  4GDL B;  2JPH A;  1WXS A;  1MJD A;  4HPP A;  2L52 A;  2KAC A;  1XLQ A;  3AUL A;  2QCZ A;  2MHJ A;  5FR6 A;  3A9K A;  1R4M I;  2FNJ B;  2N0S B;  4NNJ B;  2ASQ A;  3E9S A;  3OLM D;  2BYE A;  1V81 A;  5BYS A;  3U8Z A;  4A3P A;  4PYU A;  2TSS A;  3Q3M C;  2KLC A;  3NG0 A;  5LLI A;  1E6E B;  4EKU A;  3NVV A;  5E6N A;  2K8C A;  2KQS A;  5D94 A;  1ZGU B;  1J8C A;  4ACF A;  2N1W A;  1LXD A;  2CS4 A;  2O2V A;  4HRS A;  3O65 B;  2AL3 A;  2D2Q A;  3KQ4 A;  3Q8C A;  3APD A;  4PK1 A;  4DWF A;  3W5U B;  1TIF A;  3LYY A;  1Q1O A;  3V62 A;  4GDL A;  2KMM A;  3KUD B;  2MBE A;  4L2Y A;  3VUX A;  4HK2 A;  4OVZ A;  3PT2 B;  1WYW B;  1ZUD 2;  1TKY A;  3OJ4 B;  1WX9 A;  3VTW A;  1JQ4 A;  3V6E B;  4ZHP A;  3SFE B;  2CU1 A;  2CJO A;  3IVF A;  2NTS A;  2XK5 A;  1XLN A;  1E5W A;  2WXL A;  2BS3 B;  2AQ1 B;  2MQJ A;  3N9Y C;  2MCN B;  4NY0 A;  2JWZ A;  2IDY A;  3N1X C;  3NZ3 A;  3H9D A;  1QOF A;  2ZW1 A;  4OZA A;  1E9M A;  1H8C A;  4MEL A;  4ZHO A;  1C9F A;  1C76 A;  4YTP B;  2N9X A;  4KKJ A;  4EE2 A;  3L0W B;  5JHB A;  2GB1 A;  2UWQ A;  1AYF A;  3ZNZ B;  2BPS A;  4C56 C;  2J7Q B;  2ZPN A;  4BBN C;  1WX8 A;  1E8X A;  3C8Y A;  1WM2 A;  1ZE3 D;  4RMA A;  3RYT A;  3EUB 2;  2YEP F;  2JX5 A;  4MGK E;  2C60 A;  3R7R A;  2BKR B;  2QIL A;  3PZD A;  1L0X B;  2V4L A;  2PTL A;  1LQB A;  4W9H A;  3ZNG C;  2KQ4 X;  3KUZ A;  3TEW A;  2AX5 A;  1FD6 A;  2K1F A;  2HJ1 A;  1T0Y A;  1QT9 A;  2CHX A;  4M8M A;  2A5U A;  4LJO B;  1QKZ A;  2WDV B;  3DBR I;  3ZJV A;  1FXA A;  3ECI A;  1JRP A;  4UDU C;  5IA7 A;  3ZIM A;  2WXG A;  2D10 A;  1BXT A;  3X23 A;  1P9D U;  2CU3 A;  3BYT B;  1V5O A;  4MEM A;  1WZ3 A;  2WXP A;  1WYG A;  5J2R A;  1Q5W B;  2BVC A;  2M17 A;  2W3S A;  1LFD A;  3PZ8 A;  3M3J A;  4MT5 A;  1IYF A;  3RNB C;  2KNB A;  1V6E A;  3DHI C;  2O6V B;  1PYW D;  2BKF A;  3NY5 A;  2WDQ B;  4YTN B;  2HTH A;  3P4P B;  1UNS A;  1E7U A;  2MW5 A;  2NBV B;  4I6P A;  2M0X A;  1KLV A;  2ICI A;  3U2S C;  2BB6 A;  2REX A;  1XQQ A;  2QSD A;  3WAM A;  3WIM A;  1ZPS A;  2IGD A;  4BKS D;  4YXD B;  1WGD A;  1SSN A;  1WIA A;  4W9I A;  1F77 A;  1WZ0 A;  1VR9 A;  2KDI A;  4ZDV A;  2WXF A;  3SD5 A;  2WLB A;  4JIO U;  3NS8 A;  2N9K A;  4DQO C;  1S3S G;  3ABV B;  1GC6 A;  2GBK A;  1YN4 A;  1FXI A;  2KTR B;  1J7C A;  2PIA A;  2W9N A;  2WHI A;  2KVR A;  4C00 A;  3R2T A;  3QK0 A;  2IPK D;  4HPM B;  3Q3F A;  4N6E B;  4BAX A;  3P2B A;  4ZYN A;  3DVN V;  4PT5 A;  4DHZ B;  3WAP A;  3PHW B;  3W1Y A;  5IN7 A;  3BK2 A;  1PFD A;  1SXT A;  4MDK E;  3TIX A;  1SE9 A;  5I4D A;  4DHZ E;  2LRW A;  2MWS B;  1AW7 A;  4IDI A;  2W3R A;  4E74 A;  2JRI B;  1T6B X;  4A6Q A;  2EMT A;  2NBU A;  2C7N B;  1E90 A;  1YJ1 A;  3NUH B;  3EFC A;  2AQ2 B;  4AUQ C;  1E10 A;  3T3N A;  2KTR A;  2D3A A;  1WX7 A;  1LO5 D;  2G4S A;  4W9J A;  4NAM A;  4HJG E;  2NVU I;  5HFY A;  5KHQ A;  2WXI A;  1F0Z A;  1MG8 A;  2DAJ A;  4ANV A;  2B3A A;  2RDH A;  4W9L A;  2K22 A;  2KYW A;  1NI2 A;  4JQW C;  2JZ3 B;  3O13 A;  2J0K A;  4LNK A;  1ZXI A;  2CKH B;  2J52 A;  5AZF A;  3Q8E A;  2HTM E;  3ZJU A;  3U52 E;  1SEB D;  1SIF A;  2CR5 A;  3RUI B;  3NVY A;  2QHO A;  3P4Q B;  1WXV A;  2WXR A;  2JZP A;  1OEY A;  3GZN I;  2MSE D;  1I4Q A;  4WJQ A;  2G4D B;  3RNE C;  3ZXV A; 
#chains in the Genus database with same CATH homology
 1PGA A;  1WSP A;  3AEG B;  4USA A;  3P42 A;  2RDG A;  1RFK A;  3BK1 A;  3DWG C;  3HUI A;  2WXK A;  3AEB B;  1K51 A;  1V1P B;  1TJE A;  4KKI A;  1SE4 A;  1KLG D;  1TY0 A;  1YN5 A;  3MFG A;  1KRH A;  1N63 A;  3AN1 A;  3V05 A;  4YSY B;  4A8X C;  1TS3 A;  4A9A A;  4US8 A;  2BTE A;  4YTM B;  4C80 A;  4A90 A;  3KWL A;  3IXS A;  4ARI A;  2WNM A;  3CIR B;  2JXT A;  2ZW0 A;  2I38 A;  1TS5 A;  2ON8 A;  3P63 A;  1UWX A;  2WXN A;  5D3D A;  1SJE D;  4KX6 B;  5BYR A;  3AEF B;  3B2F A;  2EKI A;  4OZC A;  5EE1 A;  1K52 A;  1SBB B;  2Y5P A;  3AE2 B;  1FRD A;  3AEE B;  5C3J B;  4XDD A;  1WGK A;  1WRI A;  1DOI A;  4ITK A;  1L0Y B;  1XEE A;  2E6X A;  3DWM A;  3ETR A;  3Q8B A;  1P7F A;  1P7E A;  2Z8L A;  3H8H A;  1JCK B;  2Q5W D;  4REZ A;  4NZL B;  4RGT A;  3CWI A;  4RGN A;  5G5G A;  3AB5 A;  2WXJ A;  4H2A A;  1YQ4 B;  5FK9 C;  1OQR A;  1L6U A;  2J53 A;  2JU6 X;  2WXM A;  5HI1 A;  4C7Y A;  1VRA B;  2WU5 B;  3AV8 A;  4ZRP A;  5LNK 1;  1L4Z B;  1TKG A;  3GP7 A;  4KGR A;  1C4P A;  1AN8 A;  1BML C;  3HVD A;  2DYO A;  3VRA B;  2AQ3 B;  2JYT A;  2INP E;  3UI3 A;  2KWD A;  3MHZ A;  1V1P A;  4YT0 B;  1C79 A;  1FFU A;  3IT4 B;  2LMC A;  1CQV A;  3BVG A;  2G9H D;  5EE9 A;  1MPE A;  4TMA B;  1RWS A;  1N5W A;  1EWY C;  1GB4 A;  4ZOH C;  1AWD A;  3SEB A;  1D5Z C;  1E7P B;  3RFZ B;  5HG2 A;  5BMG A;  1L5P A;  1DGJ A;  3VR8 B;  2H89 B;  2IGG A;  3EA6 A;  2SAK A;  3FC4 A;  1MI0 A;  4JWS C;  1PGB A;  2LHD A;  3NVW A;  2MEK A;  4D2K A;  2PKO A;  1XLP A;  4GDL B;  4Q2J A;  1HQR D;  1F2R C;  1SE3 A;  1JWM D;  2KDM A;  2L52 A;  2KAC A;  1XLQ A;  2RPV A;  5EE3 A;  1NVI D;  2JQR B;  2VZK D;  3KWV A;  1FMA D;  2N0S B;  2WXQ A;  1C77 A;  3E9S A;  2BT6 A;  3AE9 B;  1VZ7 A;  5BYS A;  2JYE A;  3I9V 1;  1JWS D;  2VZK B;  1XXG A;  4LTU A;  3L4P A;  1JML A;  1I4R A;  2J4X A;  3Q8A A;  3W2D A;  4JPS A;  1EU4 A;  1PGX A;  1KLU D;  2TSS A;  1KTK A;  1QOG A;  2I2Y A;  3Q8F A;  5H8Y E;  1E6E B;  4WQM A;  3NVV A;  2NMQ A;  3SFD B;  3U7Z A;  2M56 B;  4P6V F;  4AQ7 A;  2N9L A;  3OWE B;  3J9C A;  1SIJ A;  3SR6 A;  1XCT L;  1ZDX A;  5FR3 A;  1TS2 A;  2PW9 A;  1K50 A;  3TEZ A;  2L1A A;  1KFY B;  1D4B A;  3AEC B;  1STE A;  4HRS A;  3ZQ4 A;  1ZOY B;  4J3O D;  1FEH A;  3KQ4 A;  2EEL A;  3Q8C A;  1J7A A;  2LUM A;  1CK1 A;  3W5U B;  4NAW B;  4YWG G;  1QOA A;  3HRD D;  4GLS C;  3LYY A;  1VZ6 A;  1IGC A;  2IJ0 A;  2KMM A;  1J7B A;  3BZD B;  3R8B A;  1IUE A;  1L6V A;  2LFI A;  3BYY B;  4L2Y A;  1QF6 A;  1JAL A;  2QEJ C;  1Q10 A;  4OVZ A;  1L0V B;  3TSS A;  4HKQ A;  5FKA C;  3V3X A;  1D5M C;  1ZUD 2;  1ACC A;  1YQ3 B;  1TKY A;  5HHD G;  5T8I A;  1QQR A;  1EU3 A;  3PO0 A;  1B9R A;  2LEK A;  3MJ5 A;  1TKE A;  2N7J A;  1DOX A;  1SJH D;  3P4R B;  3VRB B;  1JQ4 A;  2V4I B;  4ZHP A;  3SFE B;  4GDK B;  2CJO A;  2RMM A;  2WXO A;  2WU2 B;  4O1N A;  2NTS A;  1XLN A;  4WUR A;  2GRI A;  2WXL A;  2Y5C A;  4CQN A;  3W9C B;  4LLG M;  2FUG 1;  1FO4 A;  3AE3 B;  2X38 A;  4MAC A;  1C4A A;  2BS3 B;  2INN E;  2AQ1 B;  2DYM A;  1XCQ L;  4FXC A;  3N9Y C;  3FIL B;  2IDY A;  4OW0 A;  1A70 A;  1DYQ A;  3AEA B;  3NZ3 A;  3VR9 B;  3IT6 B;  4US9 A;  1QOF A;  2MJE A;  3AE4 B;  4IKG A;  1ET9 A;  5GXG B;  3TUO A;  1UUP A;  1UGJ A;  2ZW1 A;  4ZYS A;  4OZA A;  1E9M A;  2JSV X;  1T5X D;  4B0E A;  1BUI C;  3AE1 B;  2PVO D;  4IOI E;  4ZHO A;  1C9F A;  1I4G A;  2E3T A;  1C76 A;  3BVM A;  4YTP B;  4P16 A;  3URY A;  3U4E G;  1I4X A;  4KKJ A;  1NYR A;  4WAF A;  3LXF A;  3AE8 B;  4EE2 A;  4LK0 M;  4N59 A;  1HXY D;  3AM9 A;  2GB1 A;  2K5P A;  1KF6 B;  2XN9 C;  3GS2 A;  2BS2 B;  1AYF A;  4RF1 A;  1L4D B;  1FNV A;  2DWQ A;  2WS3 B;  4C56 C;  4RFB A;  4JE3 B;  1YN3 A;  1XLO A;  1VZ8 A;  1NYQ A;  3PZ7 A;  4RGO S;  5D3I B;  3C8Y A;  4WWM A;  3ZGZ A;  1EWC A;  1OFF A;  4TQ0 A;  1RM6 C;  5C2T B;  2MJD A;  1FCL A;  2ACZ B;  1ZE3 D;  1XO3 A;  2PVG C;  2JWU A;  4YSX B;  3LB8 C;  3EUB 2;  1JRO A;  2YEP F;  3HVZ A;  2BBC A;  2JX5 A;  5JXV A;  1ET6 A;  3P4S B;  2KN4 A;  2LJI A;  1I7H A;  1V97 A;  2QIL A;  1N60 A;  4C7Z A;  1HEZ E;  1C78 A;  1N61 A;  3AMZ A;  1L0X B;  1HZ6 A;  1DOY A;  1V8C A;  1MVK A;  1JW9 D;  3FIL A;  2PTL A;  1RYJ A;  2H88 B;  1YJJ A;  1I4H A;  2L32 A;  5E6J A;  3TEX A;  2OED A;  2QJL A;  2KQ4 X;  3IAM 1;  3TEW A;  3R2I A;  2AX5 A;  1FD6 A;  2WP9 B;  1QT9 A;  1NI3 A;  1WXQ A;  1N5X A;  3MC0 B;  1QKZ A;  2WDV B;  3ZJV A;  1FXA A;  2QMT A;  4WIP A;  4HRO A;  1FNU A;  1JRP A;  3W1S A;  3P1M A;  2J42 A;  1Y56 A;  2W55 A;  4UDU C;  2WXG A;  1BXT A;  1ZP0 B;  3IAS 1;  3TEY A;  3W5V B;  2BW2 A;  3GB1 A;  1TYG B;  2CU3 A;  3BYT B;  2QIE B;  3ZJT A;  2WQY B;  1I4P A;  2WXP A;  1WYG A;  3B2G A;  4YSZ B;  2YEP B;  2W3S A;  3VQI A;  4MH8 A;  1HZ5 A;  4RCO A;  2XNA C;  1SB3 C;  4XWW A;  2PMV A;  1FM0 D;  3PZ8 A;  1FCC C;  3B9J A;  1UWM A;  1FRR A;  4L23 A;  4MT5 A;  4ARC A;  3AED B;  4N58 A;  2KAJ A;  1PYW D;  2WDQ B;  4TSS A;  4YTN B;  3T3O A;  3P4P B;  1UNS A;  4RNA A;  3AE6 B;  3NRZ A;  3KLS X;  2W82 A;  1MHX A;  2FBW B;  2L83 A;  2M19 A;  1C4C A;  3WCQ A;  1JWU D;  3AE5 B;  2V3N A;  4ZRQ A;  2ICI A;  1V1O A;  3U2S C;  2BB6 A;  2QSD A;  1ZPS A;  2IGD A;  4YXD B;  2G1E A;  4XDC A;  1SSN A;  2D5G A;  2K3U A;  1K53 A;  2LHE A;  1F77 A;  4L1B A;  3ZYY X;  1VR9 A;  2WXF A;  2WLB A;  1GOZ A;  5AUI A;  2MH7 A;  1XF5 L;  2OHF A;  2N9K A;  4DQO C;  2K0P A;  3ABV B;  2SEB D;  1WWT A;  4R3D A;  1YN4 A;  1FXI A;  1VDV A;  3RPF C;  4RH6 A;  1GB1 A;  1CZP A;  1J7C A;  2PIA A;  2B76 B;  2BS4 B;  5TSS A;  1ENF A;  3R2T A;  1OQQ A;  4B0M A;  4KGT A;  1TS4 A;  1VLB A;  3BVZ A;  2IPK D;  1JWA D;  1IBX B;  4N6E B;  4TQ1 A;  1NEN B;  2IGH A;  4HEA 1;  1YJI A;  3BII D;  4PT5 A;  1GAQ B;  1FNW A;  2BB5 A;  2WXH A;  1M4V A;  1FIQ A;  1FFV A;  3BK2 A;  2R61 A;  5MPO A;  1PFD A;  1NEK B;  2DLB A;  2V3P A;  5AUK A;  3BWU D;  1TY2 A;  2ONQ A;  1D5X C;  1SXT A;  3Q69 A;  5I4D A;  1VJK A;  1AW7 A;  4IDI A;  2W3R A;  5D7G A;  3AE7 B;  2LGI A;  1T6B X;  2NTT A;  4RF0 A;  4A6Q A;  1GPX A;  3E56 A;  1JWB D;  2WDR B;  2W54 A;  1ZDV A;  3NUH B;  4NJC A;  3NS1 A;  5EE0 A;  5BMH A;  2AQ2 B;  1E10 A;  1F2R I;  1MHH E;  4WH4 A;  3T3N A;  1YMH E;  1LO5 D;  4JX1 C;  4DXG A;  4HKZ E;  2M0A A;  4NAM A;  4HJG E;  5HFY A;  1QIL A;  3MP9 A;  2WXI A;  1QLB B;  4DXF A;  5G5H A;  1F0Z A;  1PUT A;  1TZO A;  1ZXH A;  3I57 A;  1PDX A;  4A55 A;  5H92 C;  2RDH A;  1IBX A;  2MJ3 A;  2K22 A;  1QOB A;  4XE0 A;  4MM3 B;  2PLP A;  3O13 A;  4OHJ A;  1ESF A;  1ZXI A;  2FE8 A;  3EGR A;  2J52 A;  1T3Q A;  5BMI A;  3Q8E A;  2HTM E;  4OZB A;  1CJE A;  2CJN A;  4XWT A;  2GI9 A;  2V0G A;  3ZJU A;  1R7S A;  4RGM A;  5BYQ A;  2DBY A;  2K9X A;  1SEB D;  4M0W A;  3U52 E;  3NVY A;  1B1Z A;  1EM7 A;  1N62 A;  3P4Q B;  2Y3A A;  4JWU C;  1D6E C;  1SE2 A;  2WXR A;  1KH0 A;  2JZP A;  2BYT A;  1HA5 A;  4KGS A;  1E0Z A;  1ROE A;  2HDE A;  3FAH A;  1I4Q A;  3AH7 A;  1YNT E;  4AS1 A;  1SF0 A;  3NVZ A;  1IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...