1FD6A

Delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fd6A00
1MHHE 2N7JA 1MVKA 1PGAA 1YMHE 1YNTE 1K53A 2KWDA 1JMLA 2ONQA 4D2KA 1MPEA 4HKZE 2QMTA 2QSDA 4IKGA 5HI1A 1P7EA 1P7FA 1K50A 2GB1A 5HFYA 5BMGA 1D4BA 1XCQL 1K51A 2ON8A 1KH0A 4OZAA 4IOIE 2NMQA 2I2YA 1EM7A 2JZPA 2JXTA 1PGBA 2LUMA 2OEDA 1HEZE 1HZ5A 1K52A 2PW9A 1PGXA 5BMIA 1XF5L 1IBXA 2KACA 1F2RC 1ZXHA 1F2RI 2KDMA 3V3XA 2IGDA 1C9FA 2IGHA 2RMMA 1Q10A 1XCTL 2ZW0A 5HG2A 4OZBA 2K0PA 1QKZA 2IGGA 2JSVX 2JU6X 4MACA 3UI3A 2N9LA 2RPVA 5HHDG 2LGIA 1FCCC 1GB1A 4KGTA 2ZW1A 3GB1A 1UWXA 2EELA 1IBXB 3FILA 4HJGE 4KGRA 2KN4A 2J52A 2N9KA 3MP9A 1IGDA 2GI9A 4KGSA 1FCLA 1IGCA 2LHDA 1FD6A 2PTLA 5JXVA 5BMHA 1HZ6A 2PLPA 2KQ4X 3FILB 2J53A 4OZCA 4WH4A 2JWUA 2LHEA 4GLSC 1GB4A 1MHXA 1MI0A 2I38A
chains in the Genus database with same CATH superfamily
1MVKA 2PPHA 1KTKA 4RGMA 3ALBA 5DPTA 1WGYA 1YJJA 3AM9A 3KLSX 3L10B 1Q0WB 2KQ7A 1E7VA 2WS3B 2M17A 1KM7A 2CR5A 5BMGA 1I35A 1V9JA 1F52A 5J17A 2BGFA 2DAJA 1TKEA 2KOXA 3QWZB 1JW9D 2JVCA 2DWQA 1N63A 2KTRA 1FNWA 1WGKA 2PE9A 3FC4A 1C4AA 2LXCA 2CU3A 1V1OA 1IBXA 4HDOA 3WAMA 2PJHA 2ZVNA 2G1EA 1YQBA 4PYZA 3RNCC 1VZ6A 2E3TA 3Q8BA 2IGGA 2LXAA 2JSVX 3ZRFA 1CQVA 2JU6X 3WANA 2YVCA 3CMMB 1LFDA 4G11A 1Y56A 2G45B 1TIFA 3Q14C 1SEBD 2L7RA 2K9XA 1FXTB 1JRPA 2FCMA 3EECA 1F0ZA 1IBXB 1P9DU 1TYGB 2Y3AA 3VXWA 1FCLA 1IGDA 1VCBA 1XLNA 3KH0A 1IGCA 3P2BA 1D5XC 2K8BA 4ZYSA 2HD5B 1SB3C 2KQ4X 5D94A 4F1SA 2MBHA 2J53A 2OOBB 1QF6A 2C60A 1ZE3D 5HKHA 2KMAA 2FE8A 2BPSA 4URKA 2WQYB 1WSPA 2FUHB 2KYWA 4F8CB 4PS3A 4CYEA 2BB6A 1FIQA 4WWOA 1XCQL 3OG5A 1IUEA 1C1YB 2AWTA 1G6JA 1KH0A 2EMTA 2N9PC 3APFA 4HXDA 4A6QA 2NMQA 1C78A 1R4NB 4ZOHC 2I2YA 1MJDA 1VJKA 2QHOA 1SF0A 4ANWA 3VTVA 1KF6B 4W9HA 1QLBB 1F2RI 1FXIA 4DK5A 3ZTCA 3P42A 4LJOB 4PT5A 2M56B 3SDLC 3V05A 3TIXA 4P6VF 3VVWB 3PVLA 2RDHA 1I4XA 2LVOA 2XEWA 4FBJB 3FAHA 1QILA 5LXHA 4ANXA 1VDVA 3L17A 3Q3OC 3GOEA 2KQSA 3ENEA 4M01A 4J3OD 1OEYJ 4LTUA 2MEKA 3QAQA 1XLOA 4GOCA 3W1YA 2FBWB 4KIKA 1PQSA 4X57B 3AE5B 1TY0A 5GXGB 2PE6B 3FILA 3MFGA 2KN4A 4DHZB 2PVGC 3A9KA 4US9A 1JROA 4YWGG 5CHWA 3WIMA 2V3SA 3U8ZA 3U52E 4C4VA 3H7PA 3SD5A 2KXJA 2PMVA 2K6DB 2XBBC 2FIDA 5IAAC 2NTTA 5D7GA 1MG8A 2CJNA 4MT5A 4MGZE 2WYQA 1MHHE 1UGJA 3BVMA 1YNTE 2NPTA 4XWTA 1V2YA 4QAYA 2N7EA 3I9V1 1QQRA 4H2AA 3ZGZA 4K7UA 1NVID 1WGRA 2K6QA 3M63B 1N6ZA 1RRBA 2WXPA 2WXLA 4WURA 3T9LA 3AEGB 4JIOU 3ML9A 4ZHPA 2DYMA 2KX3A 3C0RB 2OJRA 1ZDVA 3B2FA 3Q3NC 3U2SC 2DYBA 3A1QB 1Q5WB 1WYWB 3ZIMA 5BYRA 3A9KB 3A4RA 1J7CA 4K3CA 2K22A 1J8CA 2GOWA 3UQBA 1FEHA 2JZ3B 1QOFA 3AEFB 4KIKB 5HG2A 2BS4B 2BWES 1OQQA 2K0PA 4MDKE 5IN7A 2JWZA 3HUIA 3Q3FA 3E56A 3JSVB 1WFYA 1E8XA 1VLBA 2HDEA 3RT3B 3QIJA 4P1BC 2LMCA 1DOXA 3NVYA 1L4DB 1WJ4A 2M8SA 5DPRA 4K81A 3H6NA 2ZW1A 4OVZA 1I4PA 5FK9C 3L0WB 1UWXA 4JQWC 3AULA 1R4MI 3W1SA 4BKGA 1TY2A 1KLGD 2LJ5A 3B08A 2KMCA 1NENB 4USAA 3T3NA 3NZUA 5D3DA 1BXTA 1KJTA 3X0WA 2ZNVC 3Q3JA 1Z5SB 3T3OA 2EKEC 2JWUA 2IO0B 4AWJA 3HIZA 4REZA 2WP9B 3PSEB 3R3MA 3UIPB 3U7ZA 4BKTA 1WH3A 1C76A 3ZXVA 4ASWC 4JLCA 2ONQA 3N30A 3NOBA 3JSVA 3PHXB 4EZLA 3SR6A 1ESFA 4FULA 1TS4A 2MJ3A 3PZ8A 1EU4A 4DXAB 4ARIA 4OZAA 4JWUC 2ZVOA 3MC9A 3BVGA 3CSFA 2D3CA 4EE2A 1PGBA 4PK1A 1XLPA 1ZKHA 5BMIA 4HPLB 1XF5L 2VRRB 3CSTA 5CX3A 4NPNA 4GDKB 3N1ZC 3ZW3A 2FAZA 1C9FA 1SJHD 2RMMA 4TQ1A 1BUIC 3ZUNA 2DENB 2JT4B 5J2RA 3IT6B 5C2TB 3EFCA 4NQLB 2AL3A 2M4NA 3I5JC 3RULA 2V9HA 1EO6A 1FM0D 2WXFA 4MH8A 3VUYA 2LGIA 2Z8LA 3QC8B 3S2AA 2QILA 1EWCA 2Z0EB 3PO0A 3ONSA 1E10A 3RZWC 1AWDA 1V6EA 2N9EB 5AEKB 1V5TA 2DBYA 2LJIA 1MG4A 1UELA 4GDLA 3NVWA 3B0AA 2GI9A 4KGSA 1IPGA 3BYYB 4KKJA 1LO5D 1IP9A 1WM3A 2W55A 2BWFA 1JCKB 2GBJA 4N58A 4W9GA 2V4IB 4WH4A 3R7QA 3Q8EA 1TT5B 2NBWB 2C5LC 4MJSA 1YN3A 1WX9A 3VUXA 4KSLC 1VZ8A 3PV1A 2MBEA 3IAS1 1E0ZA 3VAWA 2K8CA 1M4VA 1T6BX 4II3B 1RFKA 2UU7A 3Q8CA 1LQBA 2DHZA 3N9YC 3O65B 4S0RA 1JMLA 3EFUA 4W9CA 3R8BA 1J7BA 1WE6A 1E5WA 1E6EB 1NEKB 3DPDA 3RFZB 3KUZA 1WX8A 5BYSA 3AH7A 3R2IA 5IOIA 3L16A 3ZXRA 2ICIA 4XWWA 4K7SA 2MJDA 3LB8C 4NZLB 5L83A 1WE7A 1AW7A 2WNMA 4BBNC 4BKSA 1DOYA 4B9KA 2HJ8A 1D5ZC 2MX2A 4JL9A 3PTFC 4WJNA 1YJ1A 5IO9A 2WXHA 4PYUA 3ECIA 3CIRB 4EUTA 2LRWA 3Q6BA 3BK1A 3A33B 4LNFA 4ZDVA 5G2NA 1UBQA 4OZBA 5EDSA 3L54A 3VFKA 3DBHI 4LK0M 2IY0B 3P63A 2VH2A 2W9NA 3UI3A 2WXJA 3B2GA 2HTHA 3W2DA 3MJWA 1GB1A 2JF5A 4XX5A 4R3DA 3I3TB 1RFAA 1FRDA 4HLEA 2L0TA 4IM2A 3MP9A 3APCA 4RF1A 3T8MA 1WRIA 4MELA 2QEJC 3NS1A 3FILB 5DPWA 3DBRI 2WXRA 4HCNB 4OZCA 3HM3A 3ZVVA 4GLSC 2D10A 4BAXA 3RN9C 2D3BA 3PRPB 3L08A 1N61A 4MM3B 5E6NA 1PGAA 1KLUD 1TKGA 3IAM1 4MGYE 3H7SA 4WWPA 1A5RA 3EA6A 4YXDB 1FNUA 1P98A 4EKUA 2A4ZA 3NZSA 3ZLZA 2V4LA 4IWQA 3TEYA 3IVFA 5AZFA 2MJEA 2BF8B 1L4ZB 3PLVA 1JRUA 2LD9A 2MBBB 3KYCD 3QCAA 2D3AA 3V6EB 1EUVB 3AU4A 3VH4B 1ZXIA 1XT9B 4ANUA 1ZP0B 2XNAC 5EE9A 3AE8B 4HVBA 1I4HA 1PDXA 1WX7A 4KV2A 4DBGA 2V0GA 3N1YC 2LGYA 2O6VD 2Z0DB 3UQAA 3N3KB 4W9JA 1E90A 2J0KA 2KWCA 1V81A 4L2YA 2JPHA 1L0YB 4JWSC 1K8RB 1SE4A 2J0MA 2QC8A 2N4FA 4MJSB 2KJHB 1KRHA 1D3ZA 1L0XB 2O2VB 2WXIA 4TV3A 2WXQA 1EU3A 1HZ6A 1S3SG 2MBQA 3E9SA 1WJ6A 3O13A 2HE7A 2K25A 2CHZA 3DVGY 2R2OA 2KC1A 4E74A 1YJIA 1YN4A 1T5XD 3VRBB 1P3QU 2JRHA 3P4PB 3AEAB 2Q5WD 3CF6E 3NVVA 4E3CA 2WXMA 5HI1A 1ZW7A 1WY8A 4GDKA 2VH1A 3AEEB 2WU5B 4WAFA 2ZZPB 3NHEB 4TQ0A 2UYZB 1WGGA 3KUDB 1WIAA 5C23A 1PYWD 2L8JA 2DYOA 3NUHB 4O1NA 4LDTB 3ZJVA 2MRPA 1V8CA 2INPE 4W9FA 4WAAA 3RNGC 2RDBC 1JALA 3ZRCA 4UDUC 1HA5A 3V3XA 1XCTL 2FCSA 3KQ4A 1B1ZA 4CO7A 2KMMA 3N20C 2OJWA 1TBEA 3BK2A 1D6EC 2K8HA 4WIPA 1ZUD2 2KTFA 3AV8A 5HHDG 1YX6B 3N1XC 1E8ZA 4ZRQA 1UD7A 3IHPC 1YIWA 3WCQA 3PREA 5BYQA 3Q3MC 3IXSA 3L13A 4KZCA 3HRDD 3SEBA 2LVPA 1FXAA 3EUB2 1GJZA 3RD2A 3VHTC 4YTMB 2WDTB 3ZNGC 4RF0A 3H8HA 3TUOA 5IP4D 2JYEA 2YEPF 1JWAD 1QT9A 4MSQB 4EOYA 4ZRKA 2M19A 3URYA 2ZPNA 2C7NB 4NNJB 4W9KA 2DX5B 1FFVA 4P7IA 2OHFA 2KFJA 4FN2A 3TEWA 1B9RA 2FIFA 2W3RA 2KVRA 1YOVB 3IFWB 2E6XA 3PT2B 5EE3A 4IWOA 5LLIA 4B0MA 1TTNA 3OWEB 3B1LX 2V3PA 3M95A 4FXCA 4AUQC 4EZJA 4LLGM 5BO4B 3I57A 1EM7A 2JXTA 1I4QA 2JUOA 4J6IA 1HEZE 4XE0A 2PIAA 1PGXA 1WF9A 2CS4A 2KACA 3TEZA 2GBNA 3SHQA 2YLMA 2D2QA 1SXTA 2WX1A 2FCNA 3BIID 3N32A 3PRZA 1LXDA 3RUIB 2JZZA 2YEPB 1WXMA 2RPVA 4ITKA 4US8A 4MSMB 4KGTA 1SGHA 3AEDB 2KWUB 2CKHB 1JWUD 1E8WA 4KVGB 4GB9A 3X23A 2WX0A 2QIEB 3HVZA 2W54A 2XK5B 3A9JB 4EZKA 4OVUA 3A1QA 5H8YE 2MCNB 4GU2A 4L23A 2KJRA 2LGDA 4HWIB 2BVCA 5H92C 1MHXA 3UINB 4LJPB 4FJVB 2I38A 3SFDB 2DNFA 3NVZA 2IYDB 4G50A 3AE7B 2X38A 3PZDA 2ZNVB 1NI2A 4XDDA 3ZJUA 4ANVA 4HKZE 4Q2JA 4TUUA 1P1AA 2LUEA 2WXGA 2JYTA 4C00A 5FR6A 2PKOA 3BY4B 4NJ7A 4RMAA 4W9DA 1TS5A 2GLSA 1T0YA 5JZEB 1D5MC 4GXBA 4C4VB 2LWPA 1QOGA 1K52A 4BKSD 2FUG1 1CJEA 3VR9B 1QOBA 3DVGX 3VDZA 3SU8X 4AJWA 2DZKA 1TS3A 4IM0A 3LXFA 2J4XA 1SIJA 2C9WB 2G4SA 3TL5A 1GC7A 4MH0E 2C7MB 5J18A 2BYEA 2MHJA 2MWSB 1YN5A 2XN9C 3V60A 2KK8A 3PPAA 4MGKE 4OVVA 1UH6A 4A8XC 2GBMA 3B9JA 3Q69A 1UZXB 4YL8A 1CZPA 1RAXA 4NJ6A 3DHHC 3QARA 2N9KA 3R2TA 4JGHB 5EE0A 5JXVA 3ZKJC 2DAFA 5BMHA 2Y5CA 4DHJB 4W9IA 3VTWA 4RNAA 3WAPA 5MPOA 1QOAA 4B6WA 1GB4A 4NQKE 1ENFA 3GP7A 3NS8A 3DBSA 3VH3B 1WMHA 1R4NI 3EC8A 3U30A 3W1SC 4IC7B 3TMPB 2BS3B 2H89B 3VR8B 1WR6E 1TS2A 4KDLB 2LEKA 4AP4C 1HE8A 2J0JA 3DQVA 1JWBD 1T3QA 3HK0A 4AQ7A 5D2MB 4MM3A 2CU1A 2QDFA 3BINA 4I6LB 2GB1A 2AQ3B 3RMKC 1HTOA 1HQRD 5KHQA 4DDID 1VD2A 3RI7C 4K3BA 3WALA 3ZTDA 4HPMB 2L76A 2XK5A 4IG7B 4WJQA 3M3JA 3QX1A 4IDIA 2L05A 1M94A 1F2RC 4A3PA 1H8CA 1WXSA 1ZXHA 3APDA 3AN1A 1Y8RC 1E9MA 3U7DA 2MP2A 4N9F4 1V49A 1FFUA 3RZFA 2G3QB 5TR5A 1NYRA 2R61A 4P1CC 3GZNI 2BQQA 4ZRIA 5E6PA 5CHFA 2Y5PA 2INDC 1RYJA 5AZHA 4FHJA 4M8MA 5LNK1 1ZOYB 2KVZA 4CHKA 4NY0A 3IT4B 2RPQA 4HJGE 2WXOA 1ISNA 5G5GA 4K1RB 2BBCA 1DGJA 2EMSA 2CJOA 1T0QC 2L32A 1GG3A 3ZNZB 4C7YA 2O2VA 4HJKA 3IG3A 3MC0B 4BFRA 1J0GA 4OW0A 1WWTA 4A55A 2LGSA 1ET9A 3DVNV 2WDQB 4E71A 1XLQA 2JRIB 1KFYB 1DOIA 4TSSA 3TCAA 3JW0X 4GMVA 4WQMA 4HROA 1XQQA 4MGIE 2L1AA 2NS5A 4D2KA 1EWYC 2KWVB 2N1WA 1I7HA 4DWFA 2M1MA 4DXFA 2AX5A 4NAWA 2FNJB 2M0AA 3BWUD 4HRSA 2O6VB 3WA0A 2HJ1A 3BZDB 4IM3A 1AARA 4KZ0A 2KJ6A 4DHZE 2IO2B 2KANA 1GUAB 1OEYA 2IO1B 4RFBA 1ZGUB 2IY1B 5G55A 1UBIA 1XXGA 2ZW0A 4XC2A 1TGZB 2DZJA 4W9LA 4NJCA 1X1MA 3PS6A 4LDTD 4XYCA 2RGFA 2GRIA 2NPTB 2N9LA 3BVZA 3WAOA 3ABVB 3QJZA 4YTPB 1ZPSA 1R4MB 2GBRA 3Q8FA 2MP2B 2EELA 4ICUA 4A20A 4YSZB 2IDYA 4DDGD 1T0RC 3V62A 3IBEA 1FD6A 4GSWA 2PTLA 4IW0A 4PS7A 3AE9B 3P4RB 3OAWA 5E6JA 1R7SA 1P0RA 4AS1A 1YQ3B 4N59A 3MHSD 1L6VA 5GMVA 3D32A 3DBLB 5D3IB 3GE3C 3AU5A 2GMIC 5AUIA 4GN1A 2KT7A 3RCZA 3P4SB 2AQ1B 2WWZA 3HVDA 2J42A 1V97A 3QHTA 5HFYA 1KLVA 1WMHB 1FRRA 2AQ2B 3OLMD 4AOFA 2C7HA 3TJPA 1GPXA 2BS2B 2LUMA 1WXQA 2LASA 3DBHB 3V6CB 2KTRB 1HZ5A 1NYQA 3ZQ4A 2PW9A 2I1KA 3ZO5B 3DCGA 4TKNA 2BB5A 3EGRA 2Z59B 3ZNID 1FPYA 1V5OA 2UWQA 1N60A 2KDMA 3HHMA 2AYOB 2DLBA 1C79A 4L1BA 1Z2MA 1UUPA 4DXGA 2CHXA 1WR1A 4I6PA 3EHVA 4MACA 1OQYA 1SBBB 2IJ0A 1FCCC 4F7ZA 2KZRA 4FLHA 3GZNB 4KDIC 3H9DA 2IBIB 2G9HD 5I4DA 2NBVB 2J52A 2BYVE 1RWSA 4OHJA 2MH7A 5CTRC 4M02A 2MSED 2D07B 4ZRPA 4RGTA 2DZIA 3TSSA 3M62B 4GDLB 2RDGA 1STEA 4G0NB 4G3XB 2GBKA 2KD0A 1PFDA 4XDCA 3QK0A 3ZDTA 1S1QB 2K39A 1L7YA 2MA9B 1OGWA 1YX5B 1GAQB 3LDZE 2B76B 3P1MA 5T8IA 1MPEA 4BBNF 3U4EG 3P4QB 3VTUA 4FJYA 2TSSA 1P7EA 5KHOA 5E6OA 1K50A 3OJ3A 1WM2A 4YSYB 3R66C 3H7PB 3MHZA 2LVQA 3UF8A 1PUTA 1E7UA 2KAJA 1AYFA 2A5UA 2KKCA 1XD3B 4BZAA 3MJ5A 1SJED 1WJNA 3RPFC 4C7ZA 3A9JA 2O6VA 2KDFB 4ZRJA 3ZDMC 1NBFC 3HM6X 1JWMD 2FCQA 2I1JA 2KLGA 1EF1A 2KDBA 3PZ7A 2NCNA 1NDDA 2EKIA 2SAKA 1UF0A 4EEWA 2V1YA 1F9JA 3ETRA 2DZMA 2JX5A 1UGMA 1N5XA 2MBOA 1GC6A 2D5GA 4LNNA 3SFEB 2NR2A 3FKYA 3AMZA 3RNAC 4DHJD 2L00B 1ACCA 3K9OB 2RD0A 2VZKB 5C1ZA 3R7RA 3UGBB 4HK2A 2BT6A 3CWIA 1E8YA 4XZ4A 4FADA 1I4GA 2PLPA 1SE2A 2N0SB 2LHEA 3I63C 3J9CA 2REXA 2LRUA 1YD8U 4JX1C 2AEHA 3DBRB 2BW2A 1RLFA 2D11A 2N7JA 1J7AA 1WGHA 5G5HA 1L5PA 5AZGA 3V61A 4A3OA 3ZYYX 4LNOA 3QA8A 2WU2B 4LNKA 2KN5A 2QMTA 3AECB 1I4RA 3AE6B 3ZJTA 1P7FA 1LGRA 4HDQA 2MLBA 3DVNU 4WQOB 1Q1OA 3RYTA 1V86A 3NJTA 2LFIA 3MC8A 1FMAD 2LI5A 4P16A 1J19A 5FKAC 4JPSA 3KWLA 2WLBA 2OEDA 3RNFC 2RR9A 2MW5A 2H88B 5DPSA 4A90A 1VRAB 4DQOC 2BKRB 2WGSA 3JVZX 4C56C 3PRMB 2N1VA 2ZJDA 3VRAB 3LJ3A 2AL6A 1IYFA 4FA6A 2IGDA 4B95A 2IGHA 5JH5C 4YT0B 2KHWB 1HTQA 1QKZA 2G4DB 3DWMA 3AE1B 3RNEC 3KWVA 2KC2A 1BMLC 3AE2B 1SIFA 4IWPA 3LYYA 1WRDB 1OFFA 4I6NB 1N62A 2LGXA 4LCDE 2L0FA 4KGRA 2LHDA 3NY5A 4HKQA 3AI5A 4HPPA 3KUCB 1U4AA 3PHWB 5FR3A 1OQRA 4K7WA 3GE8C 4CQNA 2X8XX 2IZVB 3PLUA 1YQ4B 2INNE 2JXXA 2BKFA 2NTSA 3W9CB 3AB5A 3Q2AC 2MQJA 1YMHE 1TKYA 1WZ3A 1C3TA 2ZPYA 2PEAA 3KW5B 5TSSA 2CHWA 5IKCM 2ZCBA 5CHVC 1C4CA 2K5PA 4II2B 2JY6A 1LM8B 4XGAB 2WXKA 2WHIA 3NZ3A 1H4RA 4HCPB 2N7DA 4NAMA 1I42A 4LNIA 4ICVA 1XO3A 1ROEA 4RGNA 3TEXA 3QQ8B 3DDCB 1QZEA 1C4PA 2NBUA 2WDVB 1WI0A 4B0EA 4FHKA 5JHBA 1UWMA 2JZPA 5EE1A 1WZ0A 2ASQA 2KDIA 1T0SC 3DBLI 1TJEA 2INCC 4JE3B 4MEMA 1SSNA 1WGDA 1HXYD 2N9XA 1MFWA 1V1PA 4KSKC 3AE3B 4BOZB 4N6EB 5DCNA 2KX0A 2BTEA 1CMXB 5LXIB 1NI3A 4YSXB 4RH6A 3MTNB 3JYUA 4WWMA 4S17A 4RM9A 3GB1A 3AE4B 2QCZA 2LZ6A 4HEA1 1E7PB 3Q8AA 2KNBA 2PVOD 2KFKB 2IPKD 4M0WB 1VR9A 3DHGC 1GNUA 4WWNA 4ACFA 3NRZA 1VZ7A 1C77A 2R2QA 1AN8A 3GS2A 3DHIC 2BYFA 1N5WA 4A9AA 2KO3A 3UIOB 1WYGA 2V3NA 2JQRB 2QJLA 1A70A 4FJZA 1F77A 1L0VB 1SE9A 4GGQA 2L83A 2L52A 2D3GA 4RCOA 1TZ1A 1F1HA 3A4SC 2SEBD 1K53A 2B3AA 2KWDA 2ZCCA 3KVFB 4BVUC 4RGOS 5IA7A 1L2NA 5D6JB 3AEBB 1EF5A 2QSDA 1WJUA 4IKGA 1XEEA 1ZDXA 1SE3A 4BOSC 4IUMB 4YTNB 3VUWA 1D4BA 4TMAB 1DYQA 1K51A 4WJOA 2NVUI 2ON8A 4IOIE 3OJ4B 4KX6B 2IO3B 1GOZA 3TBLD 2K3UA 4EFOA 1L6UA 2HTME 1KOTA 3VQIA 2RSUA 3C19A 3RNBC 4M00A 5C3JB 2VZKD 3DOWA 2KFKA 2KLCA 3AXCA 2M0XA 4C80A 1JWSD 3ZNHB 5JHAA 3DWGC 1Q10A 2BYTA 5L95C 1FNVA 4PS8A 4M8NA 1BT0A 4AJYB 3W5VB 4WJPA 3PGEA 3C8YA 4RM8A 1V80A 2WXNA 4W9EA 1V1PB 1OTRB 4GIVA 3L4PA 1RM6C 2W82A 1CK1A 1JQ4A 4ARCA 3NG0A 2L3ZA 1UNSA 2WDRB 3BYTB 1FO4A 1WXAA 4ZYNA 2J7QB 3H1UA 2ACZB 5AUKA 1WXVA 2K1FA 4ZHOA 3ML8A 2ZEQA 3W5UB 4M0WA 2KDEB 3KYDD 1TZOA 1MI0A 1ET6A 2Y5BB 4NAWB 3K9PB 4KKIA 2W3SA
chains in the Genus database with same CATH topology
1M4VA 1T6BX 1MVKA 1KTKA 1RFKA 3AE7B 3NVZA 3Q8CA 2X38A 3N9YC 1JMLA 1GAQB 4RGMA 2B76B 3P1MA 4XDDA 5T8IA 3ZJUA 1MPEA 1YJJA 3R8BA 1J7BA 4HKZE 3U4EG 4Q2JA 3AM9A 3P4QB 3KLSX 1E6EB 1NEKB 3RFZB 5BYSA 2TSSA 1P7EA 2WS3B 3AH7A 2WXGA 2JYTA 3R2IA 1K50A 2PKOA 2ICIA 5BMGA 4XWWA 2MJDA 3LB8C 4NZLB 1AW7A 2WNMA 4YSYB 1TS5A 3MHZA 1DOYA 1TKEA 1PUTA 1D5MC 2KAJA 1AYFA 1D5ZC 1JW9D 3MJ5A 2DWQA 1N63A 1QOGA 1SJED 1FNWA 1WGKA 1K52A 3FC4A 3RPFC 4C7ZA 1C4AA 2WXHA 2FUG1 1CJEA 2CU3A 3CIRB 1V1OA 1IBXA 3VR9B 1QOBA 3BK1A 2G1EA 1JWMD 1TS3A 3LXFA 1VZ6A 2J4XA 1SIJA 2E3TA 4OZBA 3Q8BA 3PZ7A 2EKIA 2IGGA 2SAKA 4LK0M 2JSVX 3P63A 1CQVA 2JU6X 1VZ8A 3ETRA 2XN9C 1YN5A 3UI3A 2JX5A 2WXJA 4A8XC 3B2GA 1Y56A 1N5XA 3B9JA 2D5GA 3SFEB 3Q69A 3W2DA 1GB1A 3AMZA 1SEBD 2K9XA 4R3DA 1CZPA 1JRPA 1ACCA 1F0ZA 1IBXB 1TYGB 1FRDA 2Y3AA 2N9KA 2VZKB 3MP9A 1IGDA 4RF1A 1FCLA 1XLNA 1IGCA 1D5XC 4ZYSA 3R2TA 2BT6A 5EE0A 5JXVA 3CWIA 5BMHA 2Y5CA 1WRIA 1I4GA 1SB3C 2QEJC 2PLPA 2KQ4X 3NS1A 3FILB 1SE2A 2J53A 1QF6A 2N0SB 2WXRA 4OZCA 1ZE3D 4RNAA 2LHEA 3J9CA 5MPOA 1QOAA 4GLSC 1GB4A 1ENFA 4JX1C 3GP7A 2BW2A 2N7JA 1J7AA 2BS3B 1N61A 2FE8A 4MM3B 1PGAA 2H89B 3VR8B 5G5HA 1L5PA 1KLUD 1TKGA 2WQYB 3ZYYX 1TS2A 3IAM1 2LEKA 2WU2B 1WSPA 3EA6A 4YXDB 1FNUA 1JWBD 1T3QA 4AQ7A 2QMTA 3AECB 1I4RA 3AE6B 3ZJTA 1P7FA 2BB6A 2GB1A 1FIQA 3TEYA 1XCQL 1IUEA 2MJEA 2AQ3B 1L4ZB 1KH0A 4A6QA 2NMQA 2LFIA 1C78A 1HQRD 1FMAD 4ZOHC 2I2YA 4P16A 1VJKA 5FKAC 4JPSA 3KWLA 1ZXIA 1SF0A 2WLBA 2OEDA 1ZP0B 2H88B 1KF6B 2XNAC 4A90A 1VRAB 4IDIA 4DQOC 1QLBB 1F2RC 5EE9A 3AE8B 1ZXHA 1F2RI 3AN1A 4C56C 1FXIA 1I4HA 3VRAB 1PDXA 3P42A 4PT5A 2M56B 3V05A 1E9MA 2IGDA 2IGHA 4P6VF 2V0GA 2RDHA 1I4XA 1FFUA 4YT0B 3FAHA 1QILA 1VDVA 1QKZA 1NYRA 2R61A 4J3OD 3DWMA 3AE1B 2Y5PA 3KWVA 4L2YA 1RYJA 4LTUA 1L0YB 2MEKA 4JWSC 1XLOA 1BMLC 3AE2B 1SE4A 2FBWB 3LYYA 1OFFA 3SFDB 5LNK1 1ZOYB 3AE5B 1N62A 1TY0A 5GXGB 1KRHA 3FILA 3IT4B 3MFGA 4HJGE 1L0XB 2WXOA 4KGRA 2KN4A 2PVGC 5G5GA 4US9A 2WXIA 1JROA 2LHDA 2BBCA 1DGJA 4YWGG 2CJOA 2L32A 4HKQA 2WXQA 1EU3A 1HZ6A 3U52E 4C7YA 2PMVA 3E9SA 5FR3A 1OQRA 3O13A 3MC0B 2NTTA 5D7GA 4CQNA 1YQ4B 2INNE 1YJIA 2CJNA 4OW0A 1WWTA 4A55A 4MT5A 1YN4A 2NTSA 1ET9A 1T5XD 1MHHE 2WDQB 1UGJA 1XLQA 3AB5A 3VRBB 3W9CB 3BVMA 1KFYB 1DOIA 1YMHE 1YNTE 1TKYA 4TSSA 4XWTA 3P4PB 3AEAB 5TSSA 4WQMA 2Q5WD 4HROA 3I9V1 1QQRA 4H2AA 3ZGZA 2L1AA 1NVID 1C4CA 2K5PA 4D2KA 3NVVA 1EWYC 2WXKA 3NZ3A 2WXMA 2WXPA 4NAMA 5HI1A 2WXLA 4WURA 1I7HA 3AEGB 4DXFA 2AX5A 1XO3A 1ROEA 4RGNA 3TEXA 3AEEB 2WU5B 2M0AA 3BWUD 4HRSA 4WAFA 1C4PA 2WDVB 4B0EA 4TQ0A 4ZHPA 2DYMA 1UWMA 3BZDB 2JZPA 1ZDVA 1PYWD 2DYOA 3B2FA 5EE1A 3NUHB 3U2SC 4RFBA 4O1NA 3ZJVA 1V8CA 5BYRA 2INPE 1J7CA 2K22A 1XXGA 1JALA 1TJEA 4JE3B 4UDUC 1FEHA 1HA5A 1SSNA 3V3XA 1HXYD 1QOFA 2ZW0A 1XCTL 3AEFB 3KQ4A 5HG2A 2BS4B 1B1ZA 1OQQA 1V1PA 2K0PA 2KMMA 4NJCA 3AE3B 3HUIA 3E56A 1VLBA 3BK2A 4N6EB 1D6EC 2HDEA 4WIPA 2BTEA 1ZUD2 2GRIA 2LMCA 1NI3A 2N9LA 3BVZA 3AV8A 5HHDG 4YSXB 4RH6A 1DOXA 3NVYA 3ABVB 1L4DB 4WWMA 2ZW1A 4YTPB 1ZPSA 3GB1A 3AE4B 4ZRQA 4HEA1 4OVZA 1I4PA 3Q8FA 1E7PB 3Q8AA 5FK9C 3WCQA 5BYQA 1UWXA 2EELA 2PVOD 3IXSA 2IPKD 4YSZB 3SEBA 3HRDD 3W1SA 1VR9A 2IDYA 1TY2A 1FXAA 3NRZA 3EUB2 1KLGD 1VZ7A 1FD6A 1C77A 1AN8A 1NENB 3GS2A 4USAA 2PTLA 3T3NA 5D3DA 1N5WA 1BXTA 4A9AA 4YTMB 4RF0A 3H8HA 3AE9B 3TUOA 3P4RB 5E6JA 1R7SA 2JYEA 3T3OA 2YEPF 1WYGA 4AS1A 1YQ3B 2JQRB 2JWUA 1JWAD 1QT9A 2QJLA 1A70A 2V3NA 4N59A 1F77A 1L0VB 2M19A 1L6VA 2L83A 3URYA 2L52A 4RCOA 4REZA 2WP9B 5D3IB 2SEBD 1FFVA 1K53A 3U7ZA 2KWDA 5AUIA 4RGOS 1C76A 2OHFA 3TEWA 1B9RA 2W3RA 2ONQA 3P4SB 2AQ1B 3HVDA 3AEBB 2QSDA 4IKGA 1XEEA 2E6XA 5EE3A 3SR6A 2J42A 1ZDXA 1ESFA 1SE3A 1TS4A 1V97A 2MJ3A 4B0MA 4YTNB 3PZ8A 5HFYA 3OWEB 1D4BA 1EU4A 4TMAB 1FRRA 1DYQA 1K51A 2AQ2B 2V3PA 4ARIA 4FXCA 2ON8A 4OZAA 4IOIE 4LLGM 4JWUC 4KX6B 3BVGA 1GOZA 3I57A 2K3UA 1L6UA 1EM7A 4EE2A 2HTME 2JXTA 2BS2B 1GPXA 1PGBA 2LUMA 1I4QA 1WXQA 3VQIA 1XLPA 1HEZE 1HZ5A 1NYQA 4XE0A 5C3JB 3ZQ4A 2PW9A 2VZKD 2PIAA 1PGXA 5BMIA 1XF5L 2BB5A 2KACA 3EGRA 3TEZA 1N60A 4C80A 1JWSD 4GDKB 2KDMA 1C9FA 1SJHD 3DWGC 2RMMA 1Q10A 4TQ1A 1SXTA 2BYTA 1BUIC 2DLBA 1C79A 4L1BA 3BIID 1FNVA 3IT6B 1UUPA 4DXGA 5C2TB 1FM0D 4MACA 3W5VB 2YEPB 2WXFA 4MH8A 3C8YA 2RPVA 2WXNA 4ITKA 1SBBB 1V1PB 2IJ0A 4US8A 2LGIA 1FCCC 2Z8LA 4KGTA 3L4PA 3AEDB 1RM6C 2QILA 1EWCA 2W82A 3PO0A 1CK1A 1JQ4A 1E10A 4ARCA 1AWDA 1JWUD 2G9HD 2DBYA 2LJIA 5I4DA 2QIEB 3HVZA 2W54A 2J52A 3NVWA 1UNSA 1RWSA 2GI9A 2WDRB 2MH7A 4KGSA 3BYTB 4OHJA 1FO4A 3BYYB 4KKJA 1LO5D 4XDCA 2W55A 4ZRPA 4RGTA 5H8YE 3TSSA 2ACZB 1JCKB 5AUKA 4GDLB 4L23A 4N58A 2RDGA 2V4IB 4ZHOA 1STEA 4WH4A 3Q8EA 3W5UB 4M0WA 1YN3A 5H92C 1MHXA 1TZOA 1MI0A 1ET6A 4NAWB 1PFDA 2I38A 4KKIA 3IAS1 2W3SA 1E0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHH E;  2N7J A;  1MVK A;  1PGA A;  1YMH E;  1YNT E;  1K53 A;  2KWD A;  1JML A;  2ONQ A;  4D2K A;  1MPE A;  4HKZ E;  2QMT A;  2QSD A;  4IKG A;  5HI1 A;  1P7E A;  1P7F A;  1K50 A;  2GB1 A;  5HFY A;  5BMG A;  1D4B A;  1XCQ L;  1K51 A;  2ON8 A;  1KH0 A;  4OZA A;  4IOI E;  2NMQ A;  2I2Y A;  1EM7 A;  2JZP A;  2JXT A;  1PGB A;  2LUM A;  2OED A;  1HEZ E;  1HZ5 A;  1K52 A;  2PW9 A;  1PGX A;  5BMI A;  1XF5 L;  1IBX A;  2KAC A;  1F2R C;  1ZXH A;  1F2R I;  2KDM A;  3V3X A;  2IGD A;  1C9F A;  2IGH A;  2RMM A;  1Q10 A;  1XCT L;  2ZW0 A;  5HG2 A;  4OZB A;  2K0P A;  1QKZ A;  2IGG A;  2JSV X;  2JU6 X;  4MAC A;  3UI3 A;  2N9L A;  2RPV A;  5HHD G;  2LGI A;  1FCC C;  1GB1 A;  4KGT A;  2ZW1 A;  3GB1 A;  1UWX A;  2EEL A;  1IBX B;  3FIL A;  4HJG E;  4KGR A;  2KN4 A;  2J52 A;  2N9K A;  3MP9 A;  1IGD A;  2GI9 A;  4KGS A;  1FCL A;  1IGC A;  2LHD A;  1FD6 A;  2PTL A;  5JXV A;  5BMH A;  1HZ6 A;  2PLP A;  2KQ4 X;  3FIL B;  2J53 A;  4OZC A;  4WH4 A;  2JWU A;  2LHE A;  4GLS C;  1GB4 A;  1MHX A;  1MI0 A;  2I38 A; 
#chains in the Genus database with same CATH topology
 1MVK A;  2PPH A;  1KTK A;  4RGM A;  3ALB A;  5DPT A;  1WGY A;  1YJJ A;  3AM9 A;  3KLS X;  3L10 B;  1Q0W B;  2KQ7 A;  1E7V A;  2WS3 B;  2M17 A;  1KM7 A;  2CR5 A;  5BMG A;  1I35 A;  1V9J A;  1F52 A;  5J17 A;  2BGF A;  2DAJ A;  1TKE A;  2KOX A;  3QWZ B;  1JW9 D;  2JVC A;  2DWQ A;  1N63 A;  2KTR A;  1FNW A;  1WGK A;  2PE9 A;  3FC4 A;  1C4A A;  2LXC A;  2CU3 A;  1V1O A;  1IBX A;  4HDO A;  3WAM A;  2PJH A;  2ZVN A;  2G1E A;  1YQB A;  4PYZ A;  3RNC C;  1VZ6 A;  2E3T A;  3Q8B A;  2IGG A;  2LXA A;  2JSV X;  3ZRF A;  1CQV A;  2JU6 X;  3WAN A;  2YVC A;  3CMM B;  1LFD A;  4G11 A;  1Y56 A;  2G45 B;  1TIF A;  3Q14 C;  1SEB D;  2L7R A;  2K9X A;  1FXT B;  1JRP A;  2FCM A;  3EEC A;  1F0Z A;  1IBX B;  1P9D U;  1TYG B;  2Y3A A;  3VXW A;  1FCL A;  1IGD A;  1VCB A;  1XLN A;  3KH0 A;  1IGC A;  3P2B A;  1D5X C;  2K8B A;  4ZYS A;  2HD5 B;  1SB3 C;  2KQ4 X;  5D94 A;  4F1S A;  2MBH A;  2J53 A;  2OOB B;  1QF6 A;  2C60 A;  1ZE3 D;  5HKH A;  2KMA A;  2FE8 A;  2BPS A;  4URK A;  2WQY B;  1WSP A;  2FUH B;  2KYW A;  4F8C B;  4PS3 A;  4CYE A;  2BB6 A;  1FIQ A;  4WWO A;  1XCQ L;  3OG5 A;  1IUE A;  1C1Y B;  2AWT A;  1G6J A;  1KH0 A;  2EMT A;  2N9P C;  3APF A;  4HXD A;  4A6Q A;  2NMQ A;  1C78 A;  1R4N B;  4ZOH C;  2I2Y A;  1MJD A;  1VJK A;  2QHO A;  1SF0 A;  4ANW A;  3VTV A;  1KF6 B;  4W9H A;  1QLB B;  1F2R I;  1FXI A;  4DK5 A;  3ZTC A;  3P42 A;  4LJO B;  4PT5 A;  2M56 B;  3SDL C;  3V05 A;  3TIX A;  4P6V F;  3VVW B;  3PVL A;  2RDH A;  1I4X A;  2LVO A;  2XEW A;  4FBJ B;  3FAH A;  1QIL A;  5LXH A;  4ANX A;  1VDV A;  3L17 A;  3Q3O C;  3GOE A;  2KQS A;  3ENE A;  4M01 A;  4J3O D;  1OEY J;  4LTU A;  2MEK A;  3QAQ A;  1XLO A;  4GOC A;  3W1Y A;  2FBW B;  4KIK A;  1PQS A;  4X57 B;  3AE5 B;  1TY0 A;  5GXG B;  2PE6 B;  3FIL A;  3MFG A;  2KN4 A;  4DHZ B;  2PVG C;  3A9K A;  4US9 A;  1JRO A;  4YWG G;  5CHW A;  3WIM A;  2V3S A;  3U8Z A;  3U52 E;  4C4V A;  3H7P A;  3SD5 A;  2KXJ A;  2PMV A;  2K6D B;  2XBB C;  2FID A;  5IAA C;  2NTT A;  5D7G A;  1MG8 A;  2CJN A;  4MT5 A;  4MGZ E;  2WYQ A;  1MHH E;  1UGJ A;  3BVM A;  1YNT E;  2NPT A;  4XWT A;  1V2Y A;  4QAY A;  2N7E A;  3I9V 1;  1QQR A;  4H2A A;  3ZGZ A;  4K7U A;  1NVI D;  1WGR A;  2K6Q A;  3M63 B;  1N6Z A;  1RRB A;  2WXP A;  2WXL A;  4WUR A;  3T9L A;  3AEG B;  4JIO U;  3ML9 A;  4ZHP A;  2DYM A;  2KX3 A;  3C0R B;  2OJR A;  1ZDV A;  3B2F A;  3Q3N C;  3U2S C;  2DYB A;  3A1Q B;  1Q5W B;  1WYW B;  3ZIM A;  5BYR A;  3A9K B;  3A4R A;  1J7C A;  4K3C A;  2K22 A;  1J8C A;  2GOW A;  3UQB A;  1FEH A;  2JZ3 B;  1QOF A;  3AEF B;  4KIK B;  5HG2 A;  2BS4 B;  2BWE S;  1OQQ A;  2K0P A;  4MDK E;  5IN7 A;  2JWZ A;  3HUI A;  3Q3F A;  3E56 A;  3JSV B;  1WFY A;  1E8X A;  1VLB A;  2HDE A;  3RT3 B;  3QIJ A;  4P1B C;  2LMC A;  1DOX A;  3NVY A;  1L4D B;  1WJ4 A;  2M8S A;  5DPR A;  4K81 A;  3H6N A;  2ZW1 A;  4OVZ A;  1I4P A;  5FK9 C;  3L0W B;  1UWX A;  4JQW C;  3AUL A;  1R4M I;  3W1S A;  4BKG A;  1TY2 A;  1KLG D;  2LJ5 A;  3B08 A;  2KMC A;  1NEN B;  4USA A;  3T3N A;  3NZU A;  5D3D A;  1BXT A;  1KJT A;  3X0W A;  2ZNV C;  3Q3J A;  1Z5S B;  3T3O A;  2EKE C;  2JWU A;  2IO0 B;  4AWJ A;  3HIZ A;  4REZ A;  2WP9 B;  3PSE B;  3R3M A;  3UIP B;  3U7Z A;  4BKT A;  1WH3 A;  1C76 A;  3ZXV A;  4ASW C;  4JLC A;  2ONQ A;  3N30 A;  3NOB A;  3JSV A;  3PHX B;  4EZL A;  3SR6 A;  1ESF A;  4FUL A;  1TS4 A;  2MJ3 A;  3PZ8 A;  1EU4 A;  4DXA B;  4ARI A;  4OZA A;  4JWU C;  2ZVO A;  3MC9 A;  3BVG A;  3CSF A;  2D3C A;  4EE2 A;  1PGB A;  4PK1 A;  1XLP A;  1ZKH A;  5BMI A;  4HPL B;  1XF5 L;  2VRR B;  3CST A;  5CX3 A;  4NPN A;  4GDK B;  3N1Z C;  3ZW3 A;  2FAZ A;  1C9F A;  1SJH D;  2RMM A;  4TQ1 A;  1BUI C;  3ZUN A;  2DEN B;  2JT4 B;  5J2R A;  3IT6 B;  5C2T B;  3EFC A;  4NQL B;  2AL3 A;  2M4N A;  3I5J C;  3RUL A;  2V9H A;  1EO6 A;  1FM0 D;  2WXF A;  4MH8 A;  3VUY A;  2LGI A;  2Z8L A;  3QC8 B;  3S2A A;  2QIL A;  1EWC A;  2Z0E B;  3PO0 A;  3ONS A;  1E10 A;  3RZW C;  1AWD A;  1V6E A;  2N9E B;  5AEK B;  1V5T A;  2DBY A;  2LJI A;  1MG4 A;  1UEL A;  4GDL A;  3NVW A;  3B0A A;  2GI9 A;  4KGS A;  1IPG A;  3BYY B;  4KKJ A;  1LO5 D;  1IP9 A;  1WM3 A;  2W55 A;  2BWF A;  1JCK B;  2GBJ A;  4N58 A;  4W9G A;  2V4I B;  4WH4 A;  3R7Q A;  3Q8E A;  1TT5 B;  2NBW B;  2C5L C;  4MJS A;  1YN3 A;  1WX9 A;  3VUX A;  4KSL C;  1VZ8 A;  3PV1 A;  2MBE A;  3IAS 1;  1E0Z A;  3VAW A;  2K8C A;  1M4V A;  1T6B X;  4II3 B;  1RFK A;  2UU7 A;  3Q8C A;  1LQB A;  2DHZ A;  3N9Y C;  3O65 B;  4S0R A;  1JML A;  3EFU A;  4W9C A;  3R8B A;  1J7B A;  1WE6 A;  1E5W A;  1E6E B;  1NEK B;  3DPD A;  3RFZ B;  3KUZ A;  1WX8 A;  5BYS A;  3AH7 A;  3R2I A;  5IOI A;  3L16 A;  3ZXR A;  2ICI A;  4XWW A;  4K7S A;  2MJD A;  3LB8 C;  4NZL B;  5L83 A;  1WE7 A;  1AW7 A;  2WNM A;  4BBN C;  4BKS A;  1DOY A;  4B9K A;  2HJ8 A;  1D5Z C;  2MX2 A;  4JL9 A;  3PTF C;  4WJN A;  1YJ1 A;  5IO9 A;  2WXH A;  4PYU A;  3ECI A;  3CIR B;  4EUT A;  2LRW A;  3Q6B A;  3BK1 A;  3A33 B;  4LNF A;  4ZDV A;  5G2N A;  1UBQ A;  4OZB A;  5EDS A;  3L54 A;  3VFK A;  3DBH I;  4LK0 M;  2IY0 B;  3P63 A;  2VH2 A;  2W9N A;  3UI3 A;  2WXJ A;  3B2G A;  2HTH A;  3W2D A;  3MJW A;  1GB1 A;  2JF5 A;  4XX5 A;  4R3D A;  3I3T B;  1RFA A;  1FRD A;  4HLE A;  2L0T A;  4IM2 A;  3MP9 A;  3APC A;  4RF1 A;  3T8M A;  1WRI A;  4MEL A;  2QEJ C;  3NS1 A;  3FIL B;  5DPW A;  3DBR I;  2WXR A;  4HCN B;  4OZC A;  3HM3 A;  3ZVV A;  4GLS C;  2D10 A;  4BAX A;  3RN9 C;  2D3B A;  3PRP B;  3L08 A;  1N61 A;  4MM3 B;  5E6N A;  1PGA A;  1KLU D;  1TKG A;  3IAM 1;  4MGY E;  3H7S A;  4WWP A;  1A5R A;  3EA6 A;  4YXD B;  1FNU A;  1P98 A;  4EKU A;  2A4Z A;  3NZS A;  3ZLZ A;  2V4L A;  4IWQ A;  3TEY A;  3IVF A;  5AZF A;  2MJE A;  2BF8 B;  1L4Z B;  3PLV A;  1JRU A;  2LD9 A;  2MBB B;  3KYC D;  3QCA A;  2D3A A;  3V6E B;  1EUV B;  3AU4 A;  3VH4 B;  1ZXI A;  1XT9 B;  4ANU A;  1ZP0 B;  2XNA C;  5EE9 A;  3AE8 B;  4HVB A;  1I4H A;  1PDX A;  1WX7 A;  4KV2 A;  4DBG A;  2V0G A;  3N1Y C;  2LGY A;  2O6V D;  2Z0D B;  3UQA A;  3N3K B;  4W9J A;  1E90 A;  2J0K A;  2KWC A;  1V81 A;  4L2Y A;  2JPH A;  1L0Y B;  4JWS C;  1K8R B;  1SE4 A;  2J0M A;  2QC8 A;  2N4F A;  4MJS B;  2KJH B;  1KRH A;  1D3Z A;  1L0X B;  2O2V B;  2WXI A;  4TV3 A;  2WXQ A;  1EU3 A;  1HZ6 A;  1S3S G;  2MBQ A;  3E9S A;  1WJ6 A;  3O13 A;  2HE7 A;  2K25 A;  2CHZ A;  3DVG Y;  2R2O A;  2KC1 A;  4E74 A;  1YJI A;  1YN4 A;  1T5X D;  3VRB B;  1P3Q U;  2JRH A;  3P4P B;  3AEA B;  2Q5W D;  3CF6 E;  3NVV A;  4E3C A;  2WXM A;  5HI1 A;  1ZW7 A;  1WY8 A;  4GDK A;  2VH1 A;  3AEE B;  2WU5 B;  4WAF A;  2ZZP B;  3NHE B;  4TQ0 A;  2UYZ B;  1WGG A;  3KUD B;  1WIA A;  5C23 A;  1PYW D;  2L8J A;  2DYO A;  3NUH B;  4O1N A;  4LDT B;  3ZJV A;  2MRP A;  1V8C A;  2INP E;  4W9F A;  4WAA A;  3RNG C;  2RDB C;  1JAL A;  3ZRC A;  4UDU C;  1HA5 A;  3V3X A;  1XCT L;  2FCS A;  3KQ4 A;  1B1Z A;  4CO7 A;  2KMM A;  3N20 C;  2OJW A;  1TBE A;  3BK2 A;  1D6E C;  2K8H A;  4WIP A;  1ZUD 2;  2KTF A;  3AV8 A;  5HHD G;  1YX6 B;  3N1X C;  1E8Z A;  4ZRQ A;  1UD7 A;  3IHP C;  1YIW A;  3WCQ A;  3PRE A;  5BYQ A;  3Q3M C;  3IXS A;  3L13 A;  4KZC A;  3HRD D;  3SEB A;  2LVP A;  1FXA A;  3EUB 2;  1GJZ A;  3RD2 A;  3VHT C;  4YTM B;  2WDT B;  3ZNG C;  4RF0 A;  3H8H A;  3TUO A;  5IP4 D;  2JYE A;  2YEP F;  1JWA D;  1QT9 A;  4MSQ B;  4EOY A;  4ZRK A;  2M19 A;  3URY A;  2ZPN A;  2C7N B;  4NNJ B;  4W9K A;  2DX5 B;  1FFV A;  4P7I A;  2OHF A;  2KFJ A;  4FN2 A;  3TEW A;  1B9R A;  2FIF A;  2W3R A;  2KVR A;  1YOV B;  3IFW B;  2E6X A;  3PT2 B;  5EE3 A;  4IWO A;  5LLI A;  4B0M A;  1TTN A;  3OWE B;  3B1L X;  2V3P A;  3M95 A;  4FXC A;  4AUQ C;  4EZJ A;  4LLG M;  5BO4 B;  3I57 A;  1EM7 A;  2JXT A;  1I4Q A;  2JUO A;  4J6I A;  1HEZ E;  4XE0 A;  2PIA A;  1PGX A;  1WF9 A;  2CS4 A;  2KAC A;  3TEZ A;  2GBN A;  3SHQ A;  2YLM A;  2D2Q A;  1SXT A;  2WX1 A;  2FCN A;  3BII D;  3N32 A;  3PRZ A;  1LXD A;  3RUI B;  2JZZ A;  2YEP B;  1WXM A;  2RPV A;  4ITK A;  4US8 A;  4MSM B;  4KGT A;  1SGH A;  3AED B;  2KWU B;  2CKH B;  1JWU D;  1E8W A;  4KVG B;  4GB9 A;  3X23 A;  2WX0 A;  2QIE B;  3HVZ A;  2W54 A;  2XK5 B;  3A9J B;  4EZK A;  4OVU A;  3A1Q A;  5H8Y E;  2MCN B;  4GU2 A;  4L23 A;  2KJR A;  2LGD A;  4HWI B;  2BVC A;  5H92 C;  1MHX A;  3UIN B;  4LJP B;  4FJV B;  2I38 A;  3SFD B;  2DNF A;  3NVZ A;  2IYD B;  4G50 A;  3AE7 B;  2X38 A;  3PZD A;  2ZNV B;  1NI2 A;  4XDD A;  3ZJU A;  4ANV A;  4HKZ E;  4Q2J A;  4TUU A;  1P1A A;  2LUE A;  2WXG A;  2JYT A;  4C00 A;  5FR6 A;  2PKO A;  3BY4 B;  4NJ7 A;  4RMA A;  4W9D A;  1TS5 A;  2GLS A;  1T0Y A;  5JZE B;  1D5M C;  4GXB A;  4C4V B;  2LWP A;  1QOG A;  1K52 A;  4BKS D;  2FUG 1;  1CJE A;  3VR9 B;  1QOB A;  3DVG X;  3VDZ A;  3SU8 X;  4AJW A;  2DZK A;  1TS3 A;  4IM0 A;  3LXF A;  2J4X A;  1SIJ A;  2C9W B;  2G4S A;  3TL5 A;  1GC7 A;  4MH0 E;  2C7M B;  5J18 A;  2BYE A;  2MHJ A;  2MWS B;  1YN5 A;  2XN9 C;  3V60 A;  2KK8 A;  3PPA A;  4MGK E;  4OVV A;  1UH6 A;  4A8X C;  2GBM A;  3B9J A;  3Q69 A;  1UZX B;  4YL8 A;  1CZP A;  1RAX A;  4NJ6 A;  3DHH C;  3QAR A;  2N9K A;  3R2T A;  4JGH B;  5EE0 A;  5JXV A;  3ZKJ C;  2DAF A;  5BMH A;  2Y5C A;  4DHJ B;  4W9I A;  3VTW A;  4RNA A;  3WAP A;  5MPO A;  1QOA A;  4B6W A;  1GB4 A;  4NQK E;  1ENF A;  3GP7 A;  3NS8 A;  3DBS A;  3VH3 B;  1WMH A;  1R4N I;  3EC8 A;  3U30 A;  3W1S C;  4IC7 B;  3TMP B;  2BS3 B;  2H89 B;  3VR8 B;  1WR6 E;  1TS2 A;  4KDL B;  2LEK A;  4AP4 C;  1HE8 A;  2J0J A;  3DQV A;  1JWB D;  1T3Q A;  3HK0 A;  4AQ7 A;  5D2M B;  4MM3 A;  2CU1 A;  2QDF A;  3BIN A;  4I6L B;  2GB1 A;  2AQ3 B;  3RMK C;  1HTO A;  1HQR D;  5KHQ A;  4DDI D;  1VD2 A;  3RI7 C;  4K3B A;  3WAL A;  3ZTD A;  4HPM B;  2L76 A;  2XK5 A;  4IG7 B;  4WJQ A;  3M3J A;  3QX1 A;  4IDI A;  2L05 A;  1M94 A;  1F2R C;  4A3P A;  1H8C A;  1WXS A;  1ZXH A;  3APD A;  3AN1 A;  1Y8R C;  1E9M A;  3U7D A;  2MP2 A;  4N9F 4;  1V49 A;  1FFU A;  3RZF A;  2G3Q B;  5TR5 A;  1NYR A;  2R61 A;  4P1C C;  3GZN I;  2BQQ A;  4ZRI A;  5E6P A;  5CHF A;  2Y5P A;  2IND C;  1RYJ A;  5AZH A;  4FHJ A;  4M8M A;  5LNK 1;  1ZOY B;  2KVZ A;  4CHK A;  4NY0 A;  3IT4 B;  2RPQ A;  4HJG E;  2WXO A;  1ISN A;  5G5G A;  4K1R B;  2BBC A;  1DGJ A;  2EMS A;  2CJO A;  1T0Q C;  2L32 A;  1GG3 A;  3ZNZ B;  4C7Y A;  2O2V A;  4HJK A;  3IG3 A;  3MC0 B;  4BFR A;  1J0G A;  4OW0 A;  1WWT A;  4A55 A;  2LGS A;  1ET9 A;  3DVN V;  2WDQ B;  4E71 A;  1XLQ A;  2JRI B;  1KFY B;  1DOI A;  4TSS A;  3TCA A;  3JW0 X;  4GMV A;  4WQM A;  4HRO A;  1XQQ A;  4MGI E;  2L1A A;  2NS5 A;  4D2K A;  1EWY C;  2KWV B;  2N1W A;  1I7H A;  4DWF A;  2M1M A;  4DXF A;  2AX5 A;  4NAW A;  2FNJ B;  2M0A A;  3BWU D;  4HRS A;  2O6V B;  3WA0 A;  2HJ1 A;  3BZD B;  4IM3 A;  1AAR A;  4KZ0 A;  2KJ6 A;  4DHZ E;  2IO2 B;  2KAN A;  1GUA B;  1OEY A;  2IO1 B;  4RFB A;  1ZGU B;  2IY1 B;  5G55 A;  1UBI A;  1XXG A;  2ZW0 A;  4XC2 A;  1TGZ B;  2DZJ A;  4W9L A;  4NJC A;  1X1M A;  3PS6 A;  4LDT D;  4XYC A;  2RGF A;  2GRI A;  2NPT B;  2N9L A;  3BVZ A;  3WAO A;  3ABV B;  3QJZ A;  4YTP B;  1ZPS A;  1R4M B;  2GBR A;  3Q8F A;  2MP2 B;  2EEL A;  4ICU A;  4A20 A;  4YSZ B;  2IDY A;  4DDG D;  1T0R C;  3V62 A;  3IBE A;  1FD6 A;  4GSW A;  2PTL A;  4IW0 A;  4PS7 A;  3AE9 B;  3P4R B;  3OAW A;  5E6J A;  1R7S A;  1P0R A;  4AS1 A;  1YQ3 B;  4N59 A;  3MHS D;  1L6V A;  5GMV A;  3D32 A;  3DBL B;  5D3I B;  3GE3 C;  3AU5 A;  2GMI C;  5AUI A;  4GN1 A;  2KT7 A;  3RCZ A;  3P4S B;  2AQ1 B;  2WWZ A;  3HVD A;  2J42 A;  1V97 A;  3QHT A;  5HFY A;  1KLV A;  1WMH B;  1FRR A;  2AQ2 B;  3OLM D;  4AOF A;  2C7H A;  3TJP A;  1GPX A;  2BS2 B;  2LUM A;  1WXQ A;  2LAS A;  3DBH B;  3V6C B;  2KTR B;  1HZ5 A;  1NYQ A;  3ZQ4 A;  2PW9 A;  2I1K A;  3ZO5 B;  3DCG A;  4TKN A;  2BB5 A;  3EGR A;  2Z59 B;  3ZNI D;  1FPY A;  1V5O A;  2UWQ A;  1N60 A;  2KDM A;  3HHM A;  2AYO B;  2DLB A;  1C79 A;  4L1B A;  1Z2M A;  1UUP A;  4DXG A;  2CHX A;  1WR1 A;  4I6P A;  3EHV A;  4MAC A;  1OQY A;  1SBB B;  2IJ0 A;  1FCC C;  4F7Z A;  2KZR A;  4FLH A;  3GZN B;  4KDI C;  3H9D A;  2IBI B;  2G9H D;  5I4D A;  2NBV B;  2J52 A;  2BYV E;  1RWS A;  4OHJ A;  2MH7 A;  5CTR C;  4M02 A;  2MSE D;  2D07 B;  4ZRP A;  4RGT A;  2DZI A;  3TSS A;  3M62 B;  4GDL B;  2RDG A;  1STE A;  4G0N B;  4G3X B;  2GBK A;  2KD0 A;  1PFD A;  4XDC A;  3QK0 A;  3ZDT A;  1S1Q B;  2K39 A;  1L7Y A;  2MA9 B;  1OGW A;  1YX5 B;  1GAQ B;  3LDZ E;  2B76 B;  3P1M A;  5T8I A;  1MPE A;  4BBN F;  3U4E G;  3P4Q B;  3VTU A;  4FJY A;  2TSS A;  1P7E A;  5KHO A;  5E6O A;  1K50 A;  3OJ3 A;  1WM2 A;  4YSY B;  3R66 C;  3H7P B;  3MHZ A;  2LVQ A;  3UF8 A;  1PUT A;  1E7U A;  2KAJ A;  1AYF A;  2A5U A;  2KKC A;  1XD3 B;  4BZA A;  3MJ5 A;  1SJE D;  1WJN A;  3RPF C;  4C7Z A;  3A9J A;  2O6V A;  2KDF B;  4ZRJ A;  3ZDM C;  1NBF C;  3HM6 X;  1JWM D;  2FCQ A;  2I1J A;  2KLG A;  1EF1 A;  2KDB A;  3PZ7 A;  2NCN A;  1NDD A;  2EKI A;  2SAK A;  1UF0 A;  4EEW A;  2V1Y A;  1F9J A;  3ETR A;  2DZM A;  2JX5 A;  1UGM A;  1N5X A;  2MBO A;  1GC6 A;  2D5G A;  4LNN A;  3SFE B;  2NR2 A;  3FKY A;  3AMZ A;  3RNA C;  4DHJ D;  2L00 B;  1ACC A;  3K9O B;  2RD0 A;  2VZK B;  5C1Z A;  3R7R A;  3UGB B;  4HK2 A;  2BT6 A;  3CWI A;  1E8Y A;  4XZ4 A;  4FAD A;  1I4G A;  2PLP A;  1SE2 A;  2N0S B;  2LHE A;  3I63 C;  3J9C A;  2REX A;  2LRU A;  1YD8 U;  4JX1 C;  2AEH A;  3DBR B;  2BW2 A;  1RLF A;  2D11 A;  2N7J A;  1J7A A;  1WGH A;  5G5H A;  1L5P A;  5AZG A;  3V61 A;  4A3O A;  3ZYY X;  4LNO A;  3QA8 A;  2WU2 B;  4LNK A;  2KN5 A;  2QMT A;  3AEC B;  1I4R A;  3AE6 B;  3ZJT A;  1P7F A;  1LGR A;  4HDQ A;  2MLB A;  3DVN U;  4WQO B;  1Q1O A;  3RYT A;  1V86 A;  3NJT A;  2LFI A;  3MC8 A;  1FMA D;  2LI5 A;  4P16 A;  1J19 A;  5FKA C;  4JPS A;  3KWL A;  2WLB A;  2OED A;  3RNF C;  2RR9 A;  2MW5 A;  2H88 B;  5DPS A;  4A90 A;  1VRA B;  4DQO C;  2BKR B;  2WGS A;  3JVZ X;  4C56 C;  3PRM B;  2N1V A;  2ZJD A;  3VRA B;  3LJ3 A;  2AL6 A;  1IYF A;  4FA6 A;  2IGD A;  4B95 A;  2IGH A;  5JH5 C;  4YT0 B;  2KHW B;  1HTQ A;  1QKZ A;  2G4D B;  3DWM A;  3AE1 B;  3RNE C;  3KWV A;  2KC2 A;  1BML C;  3AE2 B;  1SIF A;  4IWP A;  3LYY A;  1WRD B;  1OFF A;  4I6N B;  1N62 A;  2LGX A;  4LCD E;  2L0F A;  4KGR A;  2LHD A;  3NY5 A;  4HKQ A;  3AI5 A;  4HPP A;  3KUC B;  1U4A A;  3PHW B;  5FR3 A;  1OQR A;  4K7W A;  3GE8 C;  4CQN A;  2X8X X;  2IZV B;  3PLU A;  1YQ4 B;  2INN E;  2JXX A;  2BKF A;  2NTS A;  3W9C B;  3AB5 A;  3Q2A C;  2MQJ A;  1YMH E;  1TKY A;  1WZ3 A;  1C3T A;  2ZPY A;  2PEA A;  3KW5 B;  5TSS A;  2CHW A;  5IKC M;  2ZCB A;  5CHV C;  1C4C A;  2K5P A;  4II2 B;  2JY6 A;  1LM8 B;  4XGA B;  2WXK A;  2WHI A;  3NZ3 A;  1H4R A;  4HCP B;  2N7D A;  4NAM A;  1I42 A;  4LNI A;  4ICV A;  1XO3 A;  1ROE A;  4RGN A;  3TEX A;  3QQ8 B;  3DDC B;  1QZE A;  1C4P A;  2NBU A;  2WDV B;  1WI0 A;  4B0E A;  4FHK A;  5JHB A;  1UWM A;  2JZP A;  5EE1 A;  1WZ0 A;  2ASQ A;  2KDI A;  1T0S C;  3DBL I;  1TJE A;  2INC C;  4JE3 B;  4MEM A;  1SSN A;  1WGD A;  1HXY D;  2N9X A;  1MFW A;  1V1P A;  4KSK C;  3AE3 B;  4BOZ B;  4N6E B;  5DCN A;  2KX0 A;  2BTE A;  1CMX B;  5LXI B;  1NI3 A;  4YSX B;  4RH6 A;  3MTN B;  3JYU A;  4WWM A;  4S17 A;  4RM9 A;  3GB1 A;  3AE4 B;  2QCZ A;  2LZ6 A;  4HEA 1;  1E7P B;  3Q8A A;  2KNB A;  2PVO D;  2KFK B;  2IPK D;  4M0W B;  1VR9 A;  3DHG C;  1GNU A;  4WWN A;  4ACF A;  3NRZ A;  1VZ7 A;  1C77 A;  2R2Q A;  1AN8 A;  3GS2 A;  3DHI C;  2BYF A;  1N5W A;  4A9A A;  2KO3 A;  3UIO B;  1WYG A;  2V3N A;  2JQR B;  2QJL A;  1A70 A;  4FJZ A;  1F77 A;  1L0V B;  1SE9 A;  4GGQ A;  2L83 A;  2L52 A;  2D3G A;  4RCO A;  1TZ1 A;  1F1H A;  3A4S C;  2SEB D;  1K53 A;  2B3A A;  2KWD A;  2ZCC A;  3KVF B;  4BVU C;  4RGO S;  5IA7 A;  1L2N A;  5D6J B;  3AEB B;  1EF5 A;  2QSD A;  1WJU A;  4IKG A;  1XEE A;  1ZDX A;  1SE3 A;  4BOS C;  4IUM B;  4YTN B;  3VUW A;  1D4B A;  4TMA B;  1DYQ A;  1K51 A;  4WJO A;  2NVU I;  2ON8 A;  4IOI E;  3OJ4 B;  4KX6 B;  2IO3 B;  1GOZ A;  3TBL D;  2K3U A;  4EFO A;  1L6U A;  2HTM E;  1KOT A;  3VQI A;  2RSU A;  3C19 A;  3RNB C;  4M00 A;  5C3J B;  2VZK D;  3DOW A;  2KFK A;  2KLC A;  3AXC A;  2M0X A;  4C80 A;  1JWS D;  3ZNH B;  5JHA A;  3DWG C;  1Q10 A;  2BYT A;  5L95 C;  1FNV A;  4PS8 A;  4M8N A;  1BT0 A;  4AJY B;  3W5V B;  4WJP A;  3PGE A;  3C8Y A;  4RM8 A;  1V80 A;  2WXN A;  4W9E A;  1V1P B;  1OTR B;  4GIV A;  3L4P A;  1RM6 C;  2W82 A;  1CK1 A;  1JQ4 A;  4ARC A;  3NG0 A;  2L3Z A;  1UNS A;  2WDR B;  3BYT B;  1FO4 A;  1WXA A;  4ZYN A;  2J7Q B;  3H1U A;  2ACZ B;  5AUK A;  1WXV A;  2K1F A;  4ZHO A;  3ML8 A;  2ZEQ A;  3W5U B;  4M0W A;  2KDE B;  3KYD D;  1TZO A;  1MI0 A;  1ET6 A;  2Y5B B;  4NAW B;  3K9P B;  4KKI A;  2W3S A; 
#chains in the Genus database with same CATH homology
 1M4V A;  1T6B X;  1MVK A;  1KTK A;  1RFK A;  3AE7 B;  3NVZ A;  3Q8C A;  2X38 A;  3N9Y C;  1JML A;  1GAQ B;  4RGM A;  2B76 B;  3P1M A;  4XDD A;  5T8I A;  3ZJU A;  1MPE A;  1YJJ A;  3R8B A;  1J7B A;  4HKZ E;  3U4E G;  4Q2J A;  3AM9 A;  3P4Q B;  3KLS X;  1E6E B;  1NEK B;  3RFZ B;  5BYS A;  2TSS A;  1P7E A;  2WS3 B;  3AH7 A;  2WXG A;  2JYT A;  3R2I A;  1K50 A;  2PKO A;  2ICI A;  5BMG A;  4XWW A;  2MJD A;  3LB8 C;  4NZL B;  1AW7 A;  2WNM A;  4YSY B;  1TS5 A;  3MHZ A;  1DOY A;  1TKE A;  1PUT A;  1D5M C;  2KAJ A;  1AYF A;  1D5Z C;  1JW9 D;  3MJ5 A;  2DWQ A;  1N63 A;  1QOG A;  1SJE D;  1FNW A;  1WGK A;  1K52 A;  3FC4 A;  3RPF C;  4C7Z A;  1C4A A;  2WXH A;  2FUG 1;  1CJE A;  2CU3 A;  3CIR B;  1V1O A;  1IBX A;  3VR9 B;  1QOB A;  3BK1 A;  2G1E A;  1JWM D;  1TS3 A;  3LXF A;  1VZ6 A;  2J4X A;  1SIJ A;  2E3T A;  4OZB A;  3Q8B A;  3PZ7 A;  2EKI A;  2IGG A;  2SAK A;  4LK0 M;  2JSV X;  3P63 A;  1CQV A;  2JU6 X;  1VZ8 A;  3ETR A;  2XN9 C;  1YN5 A;  3UI3 A;  2JX5 A;  2WXJ A;  4A8X C;  3B2G A;  1Y56 A;  1N5X A;  3B9J A;  2D5G A;  3SFE B;  3Q69 A;  3W2D A;  1GB1 A;  3AMZ A;  1SEB D;  2K9X A;  4R3D A;  1CZP A;  1JRP A;  1ACC A;  1F0Z A;  1IBX B;  1TYG B;  1FRD A;  2Y3A A;  2N9K A;  2VZK B;  3MP9 A;  1IGD A;  4RF1 A;  1FCL A;  1XLN A;  1IGC A;  1D5X C;  4ZYS A;  3R2T A;  2BT6 A;  5EE0 A;  5JXV A;  3CWI A;  5BMH A;  2Y5C A;  1WRI A;  1I4G A;  1SB3 C;  2QEJ C;  2PLP A;  2KQ4 X;  3NS1 A;  3FIL B;  1SE2 A;  2J53 A;  1QF6 A;  2N0S B;  2WXR A;  4OZC A;  1ZE3 D;  4RNA A;  2LHE A;  3J9C A;  5MPO A;  1QOA A;  4GLS C;  1GB4 A;  1ENF A;  4JX1 C;  3GP7 A;  2BW2 A;  2N7J A;  1J7A A;  2BS3 B;  1N61 A;  2FE8 A;  4MM3 B;  1PGA A;  2H89 B;  3VR8 B;  5G5H A;  1L5P A;  1KLU D;  1TKG A;  2WQY B;  3ZYY X;  1TS2 A;  3IAM 1;  2LEK A;  2WU2 B;  1WSP A;  3EA6 A;  4YXD B;  1FNU A;  1JWB D;  1T3Q A;  4AQ7 A;  2QMT A;  3AEC B;  1I4R A;  3AE6 B;  3ZJT A;  1P7F A;  2BB6 A;  2GB1 A;  1FIQ A;  3TEY A;  1XCQ L;  1IUE A;  2MJE A;  2AQ3 B;  1L4Z B;  1KH0 A;  4A6Q A;  2NMQ A;  2LFI A;  1C78 A;  1HQR D;  1FMA D;  4ZOH C;  2I2Y A;  4P16 A;  1VJK A;  5FKA C;  4JPS A;  3KWL A;  1ZXI A;  1SF0 A;  2WLB A;  2OED A;  1ZP0 B;  2H88 B;  1KF6 B;  2XNA C;  4A90 A;  1VRA B;  4IDI A;  4DQO C;  1QLB B;  1F2R C;  5EE9 A;  3AE8 B;  1ZXH A;  1F2R I;  3AN1 A;  4C56 C;  1FXI A;  1I4H A;  3VRA B;  1PDX A;  3P42 A;  4PT5 A;  2M56 B;  3V05 A;  1E9M A;  2IGD A;  2IGH A;  4P6V F;  2V0G A;  2RDH A;  1I4X A;  1FFU A;  4YT0 B;  3FAH A;  1QIL A;  1VDV A;  1QKZ A;  1NYR A;  2R61 A;  4J3O D;  3DWM A;  3AE1 B;  2Y5P A;  3KWV A;  4L2Y A;  1RYJ A;  4LTU A;  1L0Y B;  2MEK A;  4JWS C;  1XLO A;  1BML C;  3AE2 B;  1SE4 A;  2FBW B;  3LYY A;  1OFF A;  3SFD B;  5LNK 1;  1ZOY B;  3AE5 B;  1N62 A;  1TY0 A;  5GXG B;  1KRH A;  3FIL A;  3IT4 B;  3MFG A;  4HJG E;  1L0X B;  2WXO A;  4KGR A;  2KN4 A;  2PVG C;  5G5G A;  4US9 A;  2WXI A;  1JRO A;  2LHD A;  2BBC A;  1DGJ A;  4YWG G;  2CJO A;  2L32 A;  4HKQ A;  2WXQ A;  1EU3 A;  1HZ6 A;  3U52 E;  4C7Y A;  2PMV A;  3E9S A;  5FR3 A;  1OQR A;  3O13 A;  3MC0 B;  2NTT A;  5D7G A;  4CQN A;  1YQ4 B;  2INN E;  1YJI A;  2CJN A;  4OW0 A;  1WWT A;  4A55 A;  4MT5 A;  1YN4 A;  2NTS A;  1ET9 A;  1T5X D;  1MHH E;  2WDQ B;  1UGJ A;  1XLQ A;  3AB5 A;  3VRB B;  3W9C B;  3BVM A;  1KFY B;  1DOI A;  1YMH E;  1YNT E;  1TKY A;  4TSS A;  4XWT A;  3P4P B;  3AEA B;  5TSS A;  4WQM A;  2Q5W D;  4HRO A;  3I9V 1;  1QQR A;  4H2A A;  3ZGZ A;  2L1A A;  1NVI D;  1C4C A;  2K5P A;  4D2K A;  3NVV A;  1EWY C;  2WXK A;  3NZ3 A;  2WXM A;  2WXP A;  4NAM A;  5HI1 A;  2WXL A;  4WUR A;  1I7H A;  3AEG B;  4DXF A;  2AX5 A;  1XO3 A;  1ROE A;  4RGN A;  3TEX A;  3AEE B;  2WU5 B;  2M0A A;  3BWU D;  4HRS A;  4WAF A;  1C4P A;  2WDV B;  4B0E A;  4TQ0 A;  4ZHP A;  2DYM A;  1UWM A;  3BZD B;  2JZP A;  1ZDV A;  1PYW D;  2DYO A;  3B2F A;  5EE1 A;  3NUH B;  3U2S C;  4RFB A;  4O1N A;  3ZJV A;  1V8C A;  5BYR A;  2INP E;  1J7C A;  2K22 A;  1XXG A;  1JAL A;  1TJE A;  4JE3 B;  4UDU C;  1FEH A;  1HA5 A;  1SSN A;  3V3X A;  1HXY D;  1QOF A;  2ZW0 A;  1XCT L;  3AEF B;  3KQ4 A;  5HG2 A;  2BS4 B;  1B1Z A;  1OQQ A;  1V1P A;  2K0P A;  2KMM A;  4NJC A;  3AE3 B;  3HUI A;  3E56 A;  1VLB A;  3BK2 A;  4N6E B;  1D6E C;  2HDE A;  4WIP A;  2BTE A;  1ZUD 2;  2GRI A;  2LMC A;  1NI3 A;  2N9L A;  3BVZ A;  3AV8 A;  5HHD G;  4YSX B;  4RH6 A;  1DOX A;  3NVY A;  3ABV B;  1L4D B;  4WWM A;  2ZW1 A;  4YTP B;  1ZPS A;  3GB1 A;  3AE4 B;  4ZRQ A;  4HEA 1;  4OVZ A;  1I4P A;  3Q8F A;  1E7P B;  3Q8A A;  5FK9 C;  3WCQ A;  5BYQ A;  1UWX A;  2EEL A;  2PVO D;  3IXS A;  2IPK D;  4YSZ B;  3SEB A;  3HRD D;  3W1S A;  1VR9 A;  2IDY A;  1TY2 A;  1FXA A;  3NRZ A;  3EUB 2;  1KLG D;  1VZ7 A;  1FD6 A;  1C77 A;  1AN8 A;  1NEN B;  3GS2 A;  4USA A;  2PTL A;  3T3N A;  5D3D A;  1N5W A;  1BXT A;  4A9A A;  4YTM B;  4RF0 A;  3H8H A;  3AE9 B;  3TUO A;  3P4R B;  5E6J A;  1R7S A;  2JYE A;  3T3O A;  2YEP F;  1WYG A;  4AS1 A;  1YQ3 B;  2JQR B;  2JWU A;  1JWA D;  1QT9 A;  2QJL A;  1A70 A;  2V3N A;  4N59 A;  1F77 A;  1L0V B;  2M19 A;  1L6V A;  2L83 A;  3URY A;  2L52 A;  4RCO A;  4REZ A;  2WP9 B;  5D3I B;  2SEB D;  1FFV A;  1K53 A;  3U7Z A;  2KWD A;  5AUI A;  4RGO S;  1C76 A;  2OHF A;  3TEW A;  1B9R A;  2W3R A;  2ONQ A;  3P4S B;  2AQ1 B;  3HVD A;  3AEB B;  2QSD A;  4IKG A;  1XEE A;  2E6X A;  5EE3 A;  3SR6 A;  2J42 A;  1ZDX A;  1ESF A;  1SE3 A;  1TS4 A;  1V97 A;  2MJ3 A;  4B0M A;  4YTN B;  3PZ8 A;  5HFY A;  3OWE B;  1D4B A;  1EU4 A;  4TMA B;  1FRR A;  1DYQ A;  1K51 A;  2AQ2 B;  2V3P A;  4ARI A;  4FXC A;  2ON8 A;  4OZA A;  4IOI E;  4LLG M;  4JWU C;  4KX6 B;  3BVG A;  1GOZ A;  3I57 A;  2K3U A;  1L6U A;  1EM7 A;  4EE2 A;  2HTM E;  2JXT A;  2BS2 B;  1GPX A;  1PGB A;  2LUM A;  1I4Q A;  1WXQ A;  3VQI A;  1XLP A;  1HEZ E;  1HZ5 A;  1NYQ A;  4XE0 A;  5C3J B;  3ZQ4 A;  2PW9 A;  2VZK D;  2PIA A;  1PGX A;  5BMI A;  1XF5 L;  2BB5 A;  2KAC A;  3EGR A;  3TEZ A;  1N60 A;  4C80 A;  1JWS D;  4GDK B;  2KDM A;  1C9F A;  1SJH D;  3DWG C;  2RMM A;  1Q10 A;  4TQ1 A;  1SXT A;  2BYT A;  1BUI C;  2DLB A;  1C79 A;  4L1B A;  3BII D;  1FNV A;  3IT6 B;  1UUP A;  4DXG A;  5C2T B;  1FM0 D;  4MAC A;  3W5V B;  2YEP B;  2WXF A;  4MH8 A;  3C8Y A;  2RPV A;  2WXN A;  4ITK A;  1SBB B;  1V1P B;  2IJ0 A;  4US8 A;  2LGI A;  1FCC C;  2Z8L A;  4KGT A;  3L4P A;  3AED B;  1RM6 C;  2QIL A;  1EWC A;  2W82 A;  3PO0 A;  1CK1 A;  1JQ4 A;  1E10 A;  4ARC A;  1AWD A;  1JWU D;  2G9H D;  2DBY A;  2LJI A;  5I4D A;  2QIE B;  3HVZ A;  2W54 A;  2J52 A;  3NVW A;  1UNS A;  1RWS A;  2GI9 A;  2WDR B;  2MH7 A;  4KGS A;  3BYT B;  4OHJ A;  1FO4 A;  3BYY B;  4KKJ A;  1LO5 D;  4XDC A;  2W55 A;  4ZRP A;  4RGT A;  5H8Y E;  3TSS A;  2ACZ B;  1JCK B;  5AUK A;  4GDL B;  4L23 A;  4N58 A;  2RDG A;  2V4I B;  4ZHO A;  1STE A;  4WH4 A;  3Q8E A;  3W5U B;  4M0W A;  1YN3 A;  5H92 C;  1MHX A;  1TZO A;  1MI0 A;  1ET6 A;  4NAW B;  1PFD A;  2I38 A;  4KKI A;  3IAS 1;  2W3S A;  1E0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...