1FD6A

Delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MTTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fd6A00
1IGCA 3FILA 3MP9A 1GB4A 4WH4A 2PLPA 4IKGA 1EM7A 1FCLA 2KQ4X 2IGGA 4GLSC 2LUMA 2NMQA 2ONQA 2PW9A 1F2RC 2ZW0A 1P7EA 2I2YA 1ZXHA 5HI1A 1YNTE 1MPEA 2KWDA 2JXTA 2KACA 4D2KA 4HKZE 1HEZE 1XCTL 3UI3A 2KDMA 5BMIA 2N7JA 2QSDA 4KGTA 1IBXB 4KGSA 1PGAA 5HG2A 2K0PA 4OZCA 1K52A 5HHDG 1HZ6A 1P7FA 2J53A 1C9FA 2QMTA 5JXVA 2ZW1A 1XF5L 2IGHA 1K50A 2JSVX 2J52A 1MHHE 1K53A 3FILB 5BMGA 4KGRA 1XCQL 1KH0A 1IGDA 2ON8A 1FD6A 2RPVA 2N9LA 2JZPA 1GB1A 1QKZA 2KN4A 2JU6X 2PTLA 1MI0A 2OEDA 2JWUA 1MVKA 2IGDA 4MACA 4IOIE 1PGXA 2LGIA 1HZ5A 1F2RI 1IBXA 4OZAA 3V3XA 1MHXA 4HJGE 4OZBA 2LHEA 1Q10A 1UWXA 1FCCC 2RMMA 2I38A 1D4BA 1YMHE 2GB1A 2LHDA 5BMHA 5HFYA 1K51A 2EELA 1JMLA 3GB1A 2N9KA 1PGBA 2GI9A
chains in the Genus database with same CATH superfamily
4KDIC 3Q8AA 5CX3A 1FFUA 3VTVA 1UUPA 1VLBA 1XQQA 3NVWA 3P1MA 3PHXB 2KQ4X 1FCLA 5HKHA 1XLNA 2DX5B 4ZHPA 3ZRFA 4GDLB 1PUTA 1EU3A 2V4IB 2LXCA 4KZCA 5IO9A 2K6DB 2KACA 4II3B 2LWPA 2W3RA 4WJPA 4MELA 1EWCA 2D10A 3SFDB 3A33B 4BFRA 1TBEA 4YT0B 3U52E 1ET6A 3BK1A 3MHZA 2WXJA 4DHZE 1WM2A 2SEBD 1QOAA 4XZ4A 4LNFA 1RFAA 1V6EA 2W55A 4E71A 1K50A 3HVDA 3IG3A 1SEBD 2M1MA 1G6JA 2W9NA 1OGWA 3HK0A 4HXDA 2BVCA 2KFKA 1Q5WB 3DWMA 3PS6A 4DQOC 3I9V1 3VTUA 5IN7A 4YXDB 1D5MC 3DBLI 1V8CA 2L1AA 4M00A 1RFKA 2PMVA 1WMHA 2IGDA 2Y5PA 3N1YC 3NZ3A 1BXTA 3BWUD 1WR6E 1L6UA 1UZXB 2BPSA 2XEWA 1MHXA 2FCMA 4MGYE 4OZBA 2LHEA 4MSMB 2ZJDA 3PZ7A 4JQWC 2J4XA 2L0FA 1NDDA 1UBQA 2GB1A 2INPE 3PV1A 2JF5A 3IXSA 3RUIB 1GB4A 1WR1A 4JIOU 4ICVA 3IVFA 1FIQA 1TIFA 4K3CA 3ZNHB 3AB5A 2KXJA 1TS3A 4ZYNA 2BTEA 1STEA 4KKIA 1E0ZA 1F2RC 1NBFC 1FO4A 4DHJD 4WJOA 3IT4B 1JRPA 4EEWA 2ZCCA 3DVGX 1ROEA 1LM8B 3AE1B 4LDTD 4RGTA 5AEKB 4E3CA 5E6NA 5FR6A 3AE2B 3T9LA 4EZJA 5J17A 4WWOA 5L83A 1DGJA 1K52A 3W1SC 5IOIA 1YJJA 1C9FA 2QMTA 1GJZA 1WSPA 4NJ6A 1UGMA 2GBMA 5E6JA 3DBLB 2YLMA 3TL5A 3IHPC 2X8XX 1N5WA 2WQYB 2FUHB 2V3PA 4A90A 4FULA 1J19A 4RFBA 2KLCA 2LXAA 4W9GA 4K3BA 1K53A 1KTKA 2BB6A 3L08A 1WXAA 4AWJA 3ZXRA 1E8ZA 1T0QC 2KKCA 2DYBA 4N59A 3DOWA 3TBLD 1V5TA 4NZLB 4M0WA 2WU2B 3WALA 3B2GA 3Q3NC 4TQ0A 2WXKA 5J18A 2LGIA 3CSTA 4K81A 1L4ZB 4MGZE 4LCDE 1I4QA 3I63C 4S0RA 3NVVA 5FKAC 1JALA 1WXQA 3JW0X 4MH8A 4BZAA 2AQ3B 1F1HA 3KWLA 4BKTA 2LVQA 3AEGB 3VFKA 1PQSA 3WANA 2WWZA 2MCNB 1N60A 2KFKB 1GOZA 4Q2JA 3JSVA 3PTFC 3AE4B 5EE9A 4B6WA 4RCOA 4NY0A 3TCAA 3Q8FA 2VRRB 1KLVA 1WX9A 1XCTL 1WMHB 5LXIB 3I5JC 2KDMA 1E8XA 2N1WA 3ZRCA 1WGYA 2JRHA 2OOBB 2JZZA 4C00A 4KX6B 1VCBA 3ZTCA 2K8CA 1Y56A 4C7YA 3AEBB 3DBRI 1D5ZC 2BS2B 4ZYSA 2L05A 3M3JA 1M94A 2AWTA 1I4PA 3CSFA 1XCQL 2OJWA 2D5GA 5DPWA 2MBHA 2DYOA 2JU6X 2N1VA 1MI0A 1WYWB 4F8CB 2KO3A 3URYA 2JWUA 4YSZB 3RFZB 3HUIA 2WS3B 1YN3A 4HKQA 4DXFA 1TTNA 4XDCA 1YN4A 3ZJTA 3PO0A 3AULA 2UWQA 1S3SG 3RD2A 2GOWA 4BBNF 4F1SA 1WRIA 3LJ3A 5D94A 4XWWA 1L6VA 1GNUA 4LNOA 3HHMA 4C56C 3ZNID 3PRMB 3QARA 1SSNA 2CU3A 2MBOA 1LQBA 2WDTB 4A9AA 3OWEB 2K22A 2LGXA 2FCSA 3T3OA 4WH4A 2PLPA 3KH0A 1QZEA 3ABVB 1T0YA 4MEMA 3K9PB 2LI5A 5FK9C 1FNWA 1XD3B 4FHJA 2GBNA 1YJ1A 2ZPYA 3DVNV 2E3TA 4G50A 3L0WB 5D7GA 2JXTA 5JZEB 1P0RA 3DBRB 4M0WB 3H8HA 4HCNB 5BYRA 2JPHA 2KD0A 4IWQA 3TMPB 2KWVB 1YJIA 3QHTA 5LLIA 2QSDA 1WRDB 4KGSA 5AZGA 2ZPNA 4X57B 2WDRB 1WM3A 2MA9B 3R66C 1TZ1A 4P7IA 4ZRIA 3TJPA 4TUUA 4W9DA 2IGHA 4K7WA 1DOIA 1NEKB 1BT0A 5EE1A 1WY8A 1TS4A 1NI2A 1XT9B 2KLGA 2J0MA 4WQMA 2KQSA 3CIRB 1OQYA 2M0AA 3BYYB 1VDVA 2W54A 3RI7C 3VDZA 4KSKC 3H1UA 2WXRA 2JWZA 1A5RA 2QCZA 4CO7A 1ZXIA 3RPFC 1WE6A 5G2NA 2TSSA 2CS4A 3Q8BA 4OVVA 2KTRA 3X0WA 3RYTA 1IPGA 3HRDD 3QC8B 1D4BA 4B95A 2X38A 3BVGA 3EC8A 2J7QB 2L76A 2N9KA 3NRZA 2KDIA 4HPLB 2AYOB 2WXMA 1EU4A 2RDBC 3U8ZA 4PS7A 1ZUD2 4IWOA 1P7EA 3R2TA 4NJCA 1DOYA 3PLVA 5H8YE 1SIJA 1WF9A 3ZNGC 4HKZE 2MRPA 2KK8A 2XN9C 2CJOA 3VXWA 3B0AA 1TKEA 3ZVVA 3NS8A 1IUEA 1VZ7A 4ZRJA 5BO4B 2N7JA 1R7SA 3GZNB 2NBWB 2NS5A 2J53A 5JXVA 2NTSA 3V60A 5IA7A 2OHFA 4AUQC 3VUWA 1KRHA 4HK2A 1C4AA 2DENB 3IAS1 2MJEA 2IY0B 2WXGA 1VJKA 2ON8A 1I42A 1JWMD 2NBUA 2K8HA 1NENB 1UBIA 4W9CA 1EF1A 4DDID 3N30A 3FAHA 2IJ0A 3NJTA 1P9DU 2K8BA 4MACA 5BYSA 4TMAB 1M4VA 1RLFA 4M02A 4US8A 4DXGA 4XC2A 2C7NB 4JWUC 2DZJA 4RH6A 4XWTA 3V61A 1IP9A 5G5GA 4HVBA 1QOGA 4WWPA 4YSXB 3AEEB 4ITKA 3HM3A 2GRIA 2VH1A 4A55A 3AEFB 1ISNA 3MFGA 1UF0A 2DNFA 2KWUB 3L54A 4N6EB 1V49A 2PW9A 4IM3A 3RNGC 1MPEA 5E6OA 4D2KA 2Q5WD 4II2B 3PZDA 2N0SB 1AW7A 1R4NB 3Q8EA 1L0XB 4ARCA 2WX0A 1B9RA 2KTRB 2O2VA 4MDKE 2J0JA 2D11A 2ACZB 1E5WA 2ASQA 1I7HA 1XF5L 4JWSC 2IZVB 2JSVX 4M8MA 4E74A 1NVID 1OTRB 4LNNA 2LMCA 3QAQA 3AE5B 5AZHA 3CF6E 1FPYA 2G4DB 2MLBA 1WJ4A 3V05A 1CMXB 5T8IA 1CJEA 1XO3A 3DBSA 4ZRKA 3S2AA 3VR8B 4NJ7A 1KM7A 4KDLB 1RM6C 3WA0A 1HZ5A 1AWDA 4XYCA 4LJOB 3EFCA 3CMMB 4M01A 4PS8A 4YWGG 3WCQA 4EZLA 4NPNA 2RPQA 4GIVA 1FCCC 4YTMB 1KLGD 1ESFA 1QT9A 3T3NA 4LNIA 3O13A 1FXIA 1UWMA 4LNKA 3ZNZB 3KUCB 1KLUD 1F52A 1FEHA 2JVCA 1YX5B 3WAPA 1E10A 1WXSA 1K51A 1JMLA 3FILA 2BQQA 2BS3B 3QJZA 3Q3JA 3EHVA 4PT5A 3L13A 2K1FA 3T8MA 3L4PA 3M95A 4AJYB 5DPTA 2V1YA 3PVLA 1JRUA 2MEKA 1H4RA 3DCGA 1TGZB 4A3OA 1WZ0A 3P42A 4HEA1 4HJKA 1LO5D 3W1SA 2R2QA 1HA5A 5E6PA 3HM6X 3AE8B 1D6EC 4HPPA 3B9JA 1RYJA 1SIFA 4HRSA 3VH4B 4O1NA 1TKYA 4USAA 2KHWB 2KDEB 1VZ8A 4KSLC 3HIZA 3KUZA 2KX0A 3M62B 2GBJA 3PRPB 5KHOA 3Q3OC 2PJHA 1TS5A 2BYEA 3M63B 1C79A 3ZTDA 2Z8LA 1QQRA 3NHEB 2AL3A 1E7PB 4WAAA 4HLEA 4CQNA 4A20A 3A4RA 1CK1A 4P1BC 1GC7A 4G0NB 1OFFA 5AUKA 4A8XC 4FA6A 5I4DA 1C4PA 3SEBA 3ZLZA 1F2RI 2D3BA 2LVPA 2WHIA 4DBGA 3C19A 2MQJA 3AM9A 3EFUA 3O65B 2IDYA 4GB9A 4N9F4 1YIWA 4PK1A 2A4ZA 2HJ8A 4C4VA 2QIEB 3V6CB 3VQIA 2DBYA 1SE9A 2LHDA 3KYCD 3VRAB 1D3ZA 3R8BA 3GP7A 2G1EA 3PLUA 2XK5A 2FUG1 3A4SC 4KIKA 1XLPA 1UH6A 3RT3B 3W2DA 2YVCA 2KN5A 2DZMA 2INDC 5IP4D 1Z2MA 3UQBA 1V5OA 3L16A 2CKHB 2FAZA 2IO0B 3SD5A 3QA8A 2FIFA 3VVWB 4WWNA 2Y3AA 1GPXA 1WFYA 1F9JA 2Y5CA 2ZVNA 1EF5A 1N62A 4EFOA 2I1KA 3RN9C 1N63A 2JT4B 3N20C 5J2RA 2JUOA 1V1PA 2LUEA 4KGTA 1ET9A 2L7RA 1TYGB 2V3NA 1ENFA 2BGFA 4GGQA 2ZW1A 1VD2A 4MT5A 1MG4A 1HXYD 2WXNA 2NVUI 4A6QA 1H8CA 2DLBA 3JYUA 1ZKHA 3FILB 2KC2A 3RNCC 4AP4C 4IWPA 3U7ZA 1IGDA 2R2OA 2WX1A 1T0RC 1V9JA 2QJLA 1E8WA 3IBEA 4WIPA 3NG0A 2V0GA 1J8CA 2RGFA 3W5VB 2BWES 2L83A 2V3SA 4REZA 2J0KA 3NZUA 3UQAA 1IBXA 3OJ3A 4OZAA 3V3XA 3TEZA 1Q1OA 2V9HA 1Q10A 5GXGB 2MHJA 3ZJUA 2KMMA 3AECB 4M8NA 5CHVC 3NVYA 4G3XB 2KDFB 2INNE 5GMVA 3SU8X 4DDGD 2QILA 1DOXA 1EUVB 1FXTB 1L7YA 1U4AA 4OVZA 5HFYA 4ZRQA 3DDCB 4JL9A 4BKGA 2WXPA 1KFYB 4F7ZA 3VTWA 4I6PA 4MH0E 1Z5SB 2IGGA 4WWMA 4PYUA 3EGRA 2ZW0A 2K6QA 2EKIA 1R4MB 5HI1A 1YNTE 3QCAA 1FRRA 2PE6B 5BYQA 3H7PA 3U4EG 2Z0EB 4ANXA 1F77A 2HE7A 2LGYA 2J42A 3UI3A 3JVZX 2WYQA 3EECA 2JQRB 3LDZE 4NNJB 1C3TA 1JW9D 1N61A 2N7EA 4L23A 5CHWA 4DHZB 2WXFA 2CHZA 4JLCA 2KQ7A 2QC8A 1HZ6A 1F0ZA 4XGAB 3BVZA 2MBQA 2MBBB 1TS2A 4C4VB 1KOTA 1AARA 2JY6A 3VAWA 4FXCA 3PRZA 3KVFB 1E9MA 3MTNB 3Q14C 2XK5B 1E8YA 3A9JA 4KIKB 4C80A 3QX1A 3GS2A 2WP9B 2LEKA 4WURA 3BZDB 3AI5A 2FBWB 1V86A 1I4RA 1SJED 1QLBB 2EMTA 2OEDA 4WQOB 3C8YA 3WAOA 2LGSA 3MC8A 1SE2A 5DPRA 2ZVOA 4ARIA 3V6EB 5JHBA 4BVUC 1TJEA 5L95C 3I57A 4W9EA 3AE7B 2G4SA 3VUYA 3GZNI 3DBHI 3PPAA 2Z0DB 4J6IA 1SE3A 4K7SA 3H7SA 5D3IB 4KV2A 2RMMA 1QF6A 4WAFA 3JSVB 3FC4A 2NPTA 3NVZA 4RGOS 3WIMA 4KVGB 1PGBA 5H92C 4H2AA 2BF8B 3MJ5A 1WZ3A 3NOBA 2G9HD 2R61A 2D3GA 3E9SA 4OVUA 3RULA 1WXMA 2DHZA 2KWDA 3KLSX 5FR3A 4XE0A 4ANWA 2BYFA 1ZOYB 4GDLA 1NI3A 1IBXB 1C1YB 5HHDG 3PREA 2BW2A 2WDQB 2WU5B 4FJZA 2PKOA 1DYQA 3Q6BA 2LD9A 3ECIA 4TQ1A 4ANVA 4YSYB 1MHHE 2N7DA 1FMAD 2UYZB 1TZOA 3PHWB 3VR9B 3VHTC 5CTRC 3U7DA 2ZZPB 3P63A 4NQKE 3DBHB 3R7RA 3AEAB 1MG8A 2PTLA 2WXIA 3ALBA 4NQLB 1L4DB 1MVKA 3TIXA 5D2MB 1D5XC 1R4NI 2QDFA 4FBJB 3P2BA 4B0MA 3RMKC 2INCC 2LASA 1XXGA 3BY4B 3P4PB 2WXLA 1NYRA 3UINB 3QIJA 1BUIC 5EE0A 2FCQA 3SHQA 2I38A 3APCA 1YMHE 2W82A 2B3AA 3KUDB 3BYTB 3MJWA 1FM0D 1WH3A 1IGCA 2PE9A 2LZ6A 3B08A 2BB5A 4P16A 3Q2AC 2KJRA 1EM7A 3ZUNA 3APFA 2RDHA 2BS4B 1CZPA 1FXAA 1LXDA 1HQRD 3A9JB 3DQVA 2K3UA 2YEPF 3HVZA 3VH3B 1FNVA 3ML9A 2PEAA 1E7VA 2HDEA 4MGKE 3IAM1 1GUAB 2NTTA 4PS3A 3W1YA 2PVOD 2WXHA 5LNK1 2A5UA 1XEEA 1SF0A 3TSSA 1UD7A 4OZCA 1J0GA 4TKNA 2C9WB 1WX8A 2YEPB 2K5PA 3AV8A 4NAMA 1BMLC 2LRUA 1QOBA 2IY1B 2L0TA 3AXCA 3IT6B 3N1XC 2D2QA 3A1QA 4W9KA 2NPTB 2AQ2B 3B2FA 1V80A 5BMGA 3ONSA 4GXBA 4BOSC 2KVRA 2JX5A 4GOCA 4JPSA 5DCNA 3W5UB 2WXOA 3W9CB 3LB8C 2CJNA 1T6BX 3N1ZC 2JYTA 4IW0A 1SB3C 4GN1A 2NCNA 1VZ6A 4KKJA 3AN1A 1JROA 5JH5C 1XLQA 4RNAA 1T5XD 2L52A 3AE3B 2JZ3B 3N3KB 2V4LA 3TEWA 2RR9A 1B1ZA 2DWQA 2BWFA 4DXAB 4URKA 1L0VB 4HROA 3RNAC 1WWTA 2OJRA 4LLGM 2IO1B 4NAWA 2N9XA 4W9JA 2MH7A 1JWAD 1TY2A 5IAAC 3MP9A 3ZGZA 3TEYA 1FNUA 5LXHA 3RNEC 3NUHB 1V97A 3ZXVA 2E6XA 3UIPB 1MFWA 1YQBA 2N9PC 2I2YA 1WJ6A 1ZXHA 3AMZA 4LJPB 4EE2A 2VZKB 1HEZE 1KJTA 4EKUA 3I3TB 3P4QB 1YOVB 4BAXA 2FCNA 4IM0A 1PGAA 5HG2A 2LJIA 1YQ4B 1WXVA 3FKYA 2XBBC 5C3JB 3AU4A 3MC0B 1GC6A 3A9KA 3APDA 2QEJC 3DPDA 1N6ZA 1AYFA 1ZDVA 4PYZA 2M56B 1WGRA 2J52A 1Q0WB 4MSQB 5AZFA 2MX2A 3K9OB 3RZFA 4QAYA 5CHFA 3ETRA 4MGIE 3RNFC 4AQ7A 2AEHA 2LJ5A 4KGRA 4GDKA 4FHKA 4UDUC 1VR9A 2O6VA 1SE4A 5KHQA 4G11A 1GB1A 1QKZA 4CHKA 4IC7B 3U2SC 3IFWB 1SXTA 2C7HA 3ZQ4A 5C1ZA 2G45B 4BKSA 1L0YB 3L17A 2PVGC 3AE6B 4HJGE 2IYDB 2VH2A 1IYFA 3J9CA 1UWXA 1ACCA 2NBVB 4RM9A 5AUIA 1WE7A 3Q3FA 3NS1A 3H6NA 1LFDA 2MP2A 3CWIA 2HTHA 3E56A 5BMHA 4TSSA 3BK2A 4ANUA 3WAMA 2MJ3A 3ML8A 1RAXA 1UNSA 4IKGA 4ICUA 1QILA 1A70A 3A1QB 4YTNB 2KFJA 2Y5BB 3R3MA 2MW5A 1ZW7A 4YL8A 2Z59B 1TT5B 4W9IA 4AOFA 3DWGC 3B1LX 1JWBD 1P3QU 2L00B 1S1QB 4B9KA 2O2VB 4C7ZA 4TV3A 4MJSA 3UGBB 2KVZA 1ZE3D 3RCZA 1J7BA 1I4HA 3P4SB 4EOYA 2JRIB 2K25A 1V1OA 2IO2B 3L10B 4IDIA 5BMIA 1T3QA 1UGJA 4ZOHC 4HDQA 1V81A 4FADA 5MPOA 1WX7A 1E90A 3KYDD 2ICIA 1GAQB 3MC9A 2IO3B 2KMAA 5D3DA 1ZGUB 4GMVA 2AQ1B 4NAWB 2HJ1A 5TSSA 2IPKD 1SGHA 1X1MA 1UELA 2BBCA 4HDOA 1Y8RC 2SAKA 2FIDA 2K9XA 1KH0A 2BKRB 4ASWC 3BINA 4MM3A 2KZRA 1WGKA 2RPVA 1R4MI 2N9LA 4BBNC 3LYYA 4RGNA 1SJHD 4AS1A 2PPHA 4WJQA 2CU1A 3ZJVA 4GSWA 2DYMA 1MJDA 5G5HA 4W9FA 2KDBA 2M8SA 4W9HA 1YN5A 4FJYA 3C0RB 3RNBC 2MBEA 1C4CA 1I4XA 2I1JA 5JHAA 2CHWA 4JGHB 4RMAA 2EMSA 4L1BA 1RRBA 3QWZB 1OEYA 3A9KB 1P7FA 2WGSA 1QOFA 1PFDA 3MHSD 3QK0A 1K8RB 1WYGA 4I6NB 4RF1A 2BYVE 3ZYYX 3PT2B 2ONQA 3SFEB 2PIAA 2L3ZA 3DVNU 4GDKB 4N58A 3SDLC 2LGDA 2O6VB 1N5XA 2KANA 3DHHC 2N4FA 3VUXA 2UU7A 1P1AA 2DZIA 2WLBA 1WIAA 4ZDVA 3U30A 3KQ4A 4LK0M 1WJNA 4RGMA 5IKCM 2AL6A 2JYEA 1JQ4A 4BOZB 4ZRPA 2HD5B 4I6LB 3UIOB 2VZKD 2FE8A 2MP2B 2D3AA 3QQ8B 2KMCA 4GU2A 3R7QA 3OG5A 4HPMB 1RWSA 4FJVB 1JWSD 2GBKA 3AU5A 4IOIE 3DHIC 4K7UA 1PGXA 4JE3B 2XNAC 1OQQA 4MJSB 1J7AA 3DHGC 2BKFA 2D07B 1T0SC 2REXA 1WJUA 2KX3A 1E6EB 1TY0A 4LTUA 1P98A 4EUTA 1HE8A 2KOXA 3TUOA 3H9DA 3UF8A 3ZW3A 5TR5A 4L2YA 3NY5A 2GI9A 2DAFA 4EZKA 1TKGA 3GOEA 2RD0A 2RDGA 1NYQA 4OW0A 2AX5A 2JXXA 3KW5B 4GLSC 2LUMA 2LVOA 1C77A 1V1PB 2H88B 1GG3A 4MM3B 2ZCBA 3BVMA 4ZHOA 3BIID 2DZKA 1PYWD 2ZNVC 2LRWA 2GMIC 3ENEA 2GBRA 2KT7A 1VRAB 1SBBB 1AN8A 3AE9B 2W3SA 3GE3C 5C2TB 3AH7A 3OAWA 4IUMB 3N32A 4WJNA 3ZDTA 4R3DA 3OJ4B 1YD8U 2WNMA 1EWYC 3VRBB 2BYTA 1WI0A 2KNBA 1V2YA 3OLMD 2KJ6A 4CYEA 3PGEA 5DPSA 1WGDA 5C23A 3Q69A 2CHXA 1FD6A 2LFIA 1FFVA 2EKEC 3KWVA 2KN4A 4XDDA 3ZIMA 1I35A 2N9EB 1C78A 1CQVA 2K39A 2KTFA 2M4NA 3P4RB 4OHJA 1HTQA 2FNJB 1WGGA 3V62A 2C60A 4DHJB 2MJDA 1HTOA 2DAJA 4B0EA 2H89B 2M0XA 2M17A 1KF6B 1ZP0B 5EE3A 3H7PB 1L2NA 4LDTB 4RF0A 2G3QB 4DK5A 2BT6A 2WXQA 2NMQA 4US9A 3TEXA 4ACFA 1YQ3B 4YTPB 1OEYJ 4A3PA 3GE8C 4RM8A 1WGHA 5D6JB 2ZEQA 3PZ8A 3X23A 4AJWA 4P6VF 1ZDXA 5G55A 4FLHA 2D3CA 3AEDB 3PSEB 2K0PA 2IBIB 3ZO5B 4JX1C 2KC1A 1E7UA 2O6VD 2ZNVB 3N9YC 5EDSA 1OQRA 3Q3MC 2L8JA 4S17A 2L32A 3ZKJC 4J3OD 3RZWC 4W9LA 3NZSA 4BKSD 2WDVB 1LGRA 3EUB2 2QHOA 1EO6A 2JZPA 2C5LC 2KAJA 1J7CA 4HCPB 4IG7B 2C7MB 4DWFA 4FN2A 1ZPSA 2B76B 4KZ0A 2KJHB 4XX5A 2KYWA 1YX6B 3DVGY 2KWCA 1PDXA 3ZDMC 2CR5A 1C76A 2M19A 3R2IA 2MWSB 1I4GA 1JCKB 3D32A 2MSED 4K1RB 1FRDA 3Q8CA 4IM2A 3SR6A 2RSUA 3EA6A 1L5PA 2NR2A 1JWUD 4P1CC 2HTME 3LXFA 4HWIB 1XLOA 2GLSA 2EELA 3GB1A
chains in the Genus database with same CATH topology
3Q8AA 1FFUA 1UNSA 1UUPA 4IKGA 1QILA 1VLBA 1A70A 2WXMA 1EU4A 4YTNB 3NVWA 3P1MA 1FCLA 1ZUD2 2IGGA 2KQ4X 4WWMA 3EGRA 1XLNA 4ZHPA 2ZW0A 4GDLB 1P7EA 3R2TA 4NJCA 1PUTA 2EKIA 1EU3A 1DOYA 5HI1A 2V4IB 5H8YE 3DWGC 1YNTE 1JWBD 1SIJA 1FRRA 5BYQA 2KACA 3U4EG 4HKZE 4C7ZA 2XN9C 1F77A 2W3RA 2CJOA 1ZE3D 1TKEA 1J7BA 1EWCA 2J42A 3UI3A 1I4HA 3SFDB 3P4SB 1IUEA 1V1OA 1VZ7A 2JQRB 4IDIA 5BMIA 2N7JA 1T3QA 1UGJA 4ZOHC 1JW9D 1N61A 4L23A 4YT0B 1R7SA 3U52E 1ET6A 3BK1A 2WXFA 3MHZA 5MPOA 2WXJA 2ICIA 1HZ6A 2J53A 1F0ZA 2SEBD 1QOAA 1GAQB 3BVZA 5JXVA 2NTSA 1TS2A 5D3DA 2W55A 2AQ1B 2OHFA 4NAWB 1K50A 3HVDA 1SEBD 5TSSA 2IPKD 4FXCA 1KRHA 2BBCA 1E9MA 1C4AA 3IAS1 2SAKA 2MJEA 3DWMA 4C80A 4DQOC 2K9XA 2WXGA 3GS2A 1KH0A 2WP9B 2LEKA 4WURA 1VJKA 3BZDB 2ON8A 3I9V1 1WGKA 1JWMD 1D5MC 2FBWB 2N9LA 1I4RA 2RPVA 3LYYA 1NENB 4RGNA 1SJHD 1SJED 1QLBB 3FAHA 4AS1A 1V8CA 2IJ0A 2L1AA 2OEDA 1RFKA 3C8YA 2PMVA 3ZJVA 4MACA 2IGDA 2Y5PA 1SE2A 4TMAB 2DYMA 5BYSA 5G5HA 1M4VA 3NZ3A 4ARIA 1BXTA 3BWUD 4US8A 1TJEA 1L6UA 4DXGA 3I57A 1MHXA 3AE7B 1YN5A 4JWUC 4OZBA 2LHEA 4RH6A 1C4CA 1I4XA 3PZ7A 1SE3A 4XWTA 5D3IB 2J4XA 5G5GA 2RMMA 1QF6A 4WAFA 1QOGA 4YSXB 3AEEB 4L1BA 4ITKA 2GB1A 3FC4A 2INPE 3GB1A 3NVZA 4RGOS 2GRIA 3IXSA 1P7FA 1PGBA 1GB4A 1QOFA 1PFDA 5H92C 4A55A 4H2AA 3AEFB 1FIQA 3MFGA 1WYGA 3AB5A 3MJ5A 1TS3A 4RF1A 2G9HD 2R61A 2BTEA 3ZYYX 1STEA 4KKIA 4N6EB 1E0ZA 2ONQA 2PW9A 3SFEB 2PIAA 1F2RC 3E9SA 4GDKB 4N58A 1FO4A 1N5XA 3IT4B 1MPEA 2KWDA 1JRPA 4D2KA 3KLSX 2Q5WD 2WLBA 2N0SB 1ROEA 1AW7A 5FR3A 3AE1B 4XE0A 3Q8EA 1L0XB 4ARCA 3KQ4A 1ZOYB 4RGTA 4LK0M 3AE2B 1NI3A 1IBXB 4RGMA 1B9RA 1DGJA 1K52A 5HHDG 2BW2A 2WDQB 2JYEA 1YJJA 1JQ4A 1C9FA 2WU5B 2QMTA 1WSPA 2ACZB 2PKOA 1DYQA 5E6JA 4ZRPA 1I7HA 1XF5L 4TQ1A 4JWSC 2VZKD 2JSVX 4YSYB 1N5WA 2WQYB 2FE8A 1MHHE 2V3PA 1NVID 4A90A 1FMAD 4RFBA 1TZOA 2LMCA 1K53A 1KTKA 2BB6A 3VR9B 3AE5B 3P63A 4N59A 1RWSA 3V05A 3AEAB 4NZLB 4M0WA 5T8IA 1CJEA 1JWSD 2PTLA 2WXIA 1L4DB 2WU2B 1XO3A 3B2GA 1MVKA 3VR8B 4IOIE 2WXKA 4TQ0A 1D5XC 1PGXA 1RM6C 4JE3B 2LGIA 1HZ5A 2XNAC 1AWDA 4B0MA 1OQQA 1J7AA 1XXGA 1L4ZB 4YWGG 3P4PB 1I4QA 3WCQA 2WXLA 1NYRA 1FCCC 1E6EB 4YTMB 1KLGD 1TY0A 1BUIC 1ESFA 1QT9A 4LTUA 3T3NA 5EE0A 3NVVA 5FKAC 3O13A 1JALA 1WXQA 1FXIA 2I38A 3TUOA 1YMHE 1UWMA 2W82A 4MH8A 1KLUD 2AQ3B 1FEHA 3BYTB 1E10A 4L2YA 3KWLA 1K51A 1JMLA 1FM0D 2GI9A 1IGCA 3FILA 3AEGB 2BB5A 4P16A 2BS3B 1TKGA 2RDGA 1EM7A 1NYQA 4OW0A 1N60A 1GOZA 2AX5A 4PT5A 2RDHA 4Q2JA 2BS4B 1CZPA 1FXAA 2LUMA 4GLSC 1HQRD 1C77A 3L4PA 1V1PB 2H88B 3AE4B 2K3UA 2YEPF 3HVZA 5EE9A 4MM3B 1FNVA 4RCOA 2MEKA 3BVMA 2HDEA 4ZHOA 3Q8FA 3BIID 3IAM1 2NTTA 3P42A 4HEA1 1LO5D 1PYWD 1XCTL 3W1SA 2PVOD 1HA5A 2WXHA 5LNK1 2KDMA 3AE8B 1D6EC 1VRAB 1XEEA 1SF0A 3TSSA 1SBBB 1AN8A 4OZCA 3AE9B 2W3SA 3B9JA 1RYJA 3AH7A 5C2TB 4HRSA 4KX6B 4O1NA 1TKYA 2YEPB 4USAA 1Y56A 4C7YA 3AEBB 4R3DA 2K5PA 1VZ8A 1D5ZC 3AV8A 4NAMA 1BMLC 2WNMA 2BS2B 1EWYC 3VRBB 1QOBA 2BYTA 3IT6B 4ZYSA 1TS5A 2AQ2B 3B2FA 5BMGA 1C79A 1I4PA 1XCQL 2JX5A 4JPSA 3W5UB 2Z8LA 1QQRA 3Q69A 2WXOA 1FD6A 3W9CB 3LB8C 2CJNA 1E7PB 2D5GA 2LFIA 1FFVA 4CQNA 3KWVA 2KN4A 1T6BX 2DYOA 2JU6X 4XDDA 1CK1A 2JYTA 1SB3C 1MI0A 4KKJA 1VZ6A 3URYA 2JWUA 4YSZB 1OFFA 3RFZB 3AN1A 1JROA 3HUIA 5AUKA 4A8XC 2WS3B 1YN3A 5I4DA 4DXFA 1C4PA 1C78A 4HKQA 4XDCA 1YN4A 1CQVA 1XLQA 3SEBA 4RNAA 3ZJTA 1T5XD 3PO0A 2L52A 3AE3B 1F2RI 1WRIA 3P4RB 3TEWA 4OHJA 1B1ZA 2DWQA 4XWWA 1L0VB 4HROA 1L6VA 3AM9A 2IDYA 1WWTA 4C56C 4LLGM 2MJDA 2QIEB 3VQIA 2DBYA 1SSNA 2CU3A 1JWAD 2MH7A 4B0EA 2LHDA 2H89B 3VRAB 3R8BA 1TY2A 3GP7A 4A9AA 2G1EA 2K22A 3OWEB 2FUG1 1KF6B 3MP9A 1ZP0B 3T3OA 3ZGZA 5EE3A 4WH4A 3TEYA 1XLPA 2PLPA 4RF0A 1FNUA 3W2DA 3ABVB 3NUHB 1V97A 2BT6A 5FK9C 1FNWA 2WXQA 2E6XA 2NMQA 4US9A 3TEXA 1YQ3B 4YTPB 1ZXHA 3AMZA 4YXDB 2I2YA 2E3TA 2Y3AA 1GPXA 3PZ8A 5D7GA 2Y5CA 4EE2A 2JXTA 2VZKB 3H8HA 4P6VF 1HEZE 1N62A 1ZDXA 5BYRA 1N63A 3P4QB 1YJIA 3AEDB 1V1PA 2QSDA 4KGTA 4KGSA 1PGAA 1ET9A 2LJIA 2K0PA 5HG2A 1YQ4B 1TYGB 2V3NA 4JX1C 1ENFA 5C3JB 2WDRB 3MC0B 2QEJC 2ZW1A 1AYFA 4MT5A 1ZDVA 3N9YC 2IGHA 1HXYD 2M56B 1OQRA 1DOIA 2J52A 2WXNA 1NEKB 2L32A 5EE1A 1TS4A 4A6QA 4J3OD 2DLBA 3ETRA 4AQ7A 3FILB 2WDVB 3EUB2 4KGRA 3U7ZA 4WQMA 1IGDA 3CIRB 4UDUC 1VR9A 2M0AA 3BYYB 1SE4A 1VDVA 2JZPA 2KAJA 1J7CA 2W54A 1GB1A 1QKZA 2QJLA 1ZPSA 3U2SC 2B76B 4WIPA 1SXTA 2V0GA 2WXRA 3ZQ4A 3W5VB 2L83A 1ZXIA 1L0YB 1PDXA 4REZA 3RPFC 1C76A 2M19A 3R2IA 1IBXA 4OZAA 1I4GA 2TSSA 3V3XA 1JCKB 2PVGC 3AE6B 4HJGE 1FRDA 3TEZA 3Q8CA 3Q8BA 3SR6A 1Q10A 3EA6A 3J9CA 1UWXA 1ACCA 1L5PA 5GXGB 3ZJUA 2KMMA 1JWUD 5AUIA 3AECB 2HTME 3HRDD 3NVYA 3NS1A 2INNE 1D4BA 2QILA 2X38A 3BVGA 1DOXA 3CWIA 3LXFA 3E56A 5BMHA 4TSSA 3BK2A 1XLOA 4OVZA 4ZRQA 5HFYA 2MJ3A 2EELA 2WXPA 2N9KA 1KFYB 3NRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGC A;  3FIL A;  3MP9 A;  1GB4 A;  4WH4 A;  2PLP A;  4IKG A;  1EM7 A;  1FCL A;  2KQ4 X;  2IGG A;  4GLS C;  2LUM A;  2NMQ A;  2ONQ A;  2PW9 A;  1F2R C;  2ZW0 A;  1P7E A;  2I2Y A;  1ZXH A;  5HI1 A;  1YNT E;  1MPE A;  2KWD A;  2JXT A;  2KAC A;  4D2K A;  4HKZ E;  1HEZ E;  1XCT L;  3UI3 A;  2KDM A;  5BMI A;  2N7J A;  2QSD A;  4KGT A;  1IBX B;  4KGS A;  1PGA A;  5HG2 A;  2K0P A;  4OZC A;  1K52 A;  5HHD G;  1HZ6 A;  1P7F A;  2J53 A;  1C9F A;  2QMT A;  5JXV A;  2ZW1 A;  1XF5 L;  2IGH A;  1K50 A;  2JSV X;  2J52 A;  1MHH E;  1K53 A;  3FIL B;  5BMG A;  4KGR A;  1XCQ L;  1KH0 A;  1IGD A;  2ON8 A;  1FD6 A;  2RPV A;  2N9L A;  2JZP A;  1GB1 A;  1QKZ A;  2KN4 A;  2JU6 X;  2PTL A;  1MI0 A;  2OED A;  2JWU A;  1MVK A;  2IGD A;  4MAC A;  4IOI E;  1PGX A;  2LGI A;  1HZ5 A;  1F2R I;  1IBX A;  4OZA A;  3V3X A;  1MHX A;  4HJG E;  4OZB A;  2LHE A;  1Q10 A;  1UWX A;  1FCC C;  2RMM A;  2I38 A;  1D4B A;  1YMH E;  2GB1 A;  2LHD A;  5BMH A;  5HFY A;  1K51 A;  2EEL A;  1JML A;  3GB1 A;  2N9K A;  1PGB A;  2GI9 A; 
#chains in the Genus database with same CATH topology
 4KDI C;  3Q8A A;  5CX3 A;  1FFU A;  3VTV A;  1UUP A;  1VLB A;  1XQQ A;  3NVW A;  3P1M A;  3PHX B;  2KQ4 X;  1FCL A;  5HKH A;  1XLN A;  2DX5 B;  4ZHP A;  3ZRF A;  4GDL B;  1PUT A;  1EU3 A;  2V4I B;  2LXC A;  4KZC A;  5IO9 A;  2K6D B;  2KAC A;  4II3 B;  2LWP A;  2W3R A;  4WJP A;  4MEL A;  1EWC A;  2D10 A;  3SFD B;  3A33 B;  4BFR A;  1TBE A;  4YT0 B;  3U52 E;  1ET6 A;  3BK1 A;  3MHZ A;  2WXJ A;  4DHZ E;  1WM2 A;  2SEB D;  1QOA A;  4XZ4 A;  4LNF A;  1RFA A;  1V6E A;  2W55 A;  4E71 A;  1K50 A;  3HVD A;  3IG3 A;  1SEB D;  2M1M A;  1G6J A;  2W9N A;  1OGW A;  3HK0 A;  4HXD A;  2BVC A;  2KFK A;  1Q5W B;  3DWM A;  3PS6 A;  4DQO C;  3I9V 1;  3VTU A;  5IN7 A;  4YXD B;  1D5M C;  3DBL I;  1V8C A;  2L1A A;  4M00 A;  1RFK A;  2PMV A;  1WMH A;  2IGD A;  2Y5P A;  3N1Y C;  3NZ3 A;  1BXT A;  3BWU D;  1WR6 E;  1L6U A;  1UZX B;  2BPS A;  2XEW A;  1MHX A;  2FCM A;  4MGY E;  4OZB A;  2LHE A;  4MSM B;  2ZJD A;  3PZ7 A;  4JQW C;  2J4X A;  2L0F A;  1NDD A;  1UBQ A;  2GB1 A;  2INP E;  3PV1 A;  2JF5 A;  3IXS A;  3RUI B;  1GB4 A;  1WR1 A;  4JIO U;  4ICV A;  3IVF A;  1FIQ A;  1TIF A;  4K3C A;  3ZNH B;  3AB5 A;  2KXJ A;  1TS3 A;  4ZYN A;  2BTE A;  1STE A;  4KKI A;  1E0Z A;  1F2R C;  1NBF C;  1FO4 A;  4DHJ D;  4WJO A;  3IT4 B;  1JRP A;  4EEW A;  2ZCC A;  3DVG X;  1ROE A;  1LM8 B;  3AE1 B;  4LDT D;  4RGT A;  5AEK B;  4E3C A;  5E6N A;  5FR6 A;  3AE2 B;  3T9L A;  4EZJ A;  5J17 A;  4WWO A;  5L83 A;  1DGJ A;  1K52 A;  3W1S C;  5IOI A;  1YJJ A;  1C9F A;  2QMT A;  1GJZ A;  1WSP A;  4NJ6 A;  1UGM A;  2GBM A;  5E6J A;  3DBL B;  2YLM A;  3TL5 A;  3IHP C;  2X8X X;  1N5W A;  2WQY B;  2FUH B;  2V3P A;  4A90 A;  4FUL A;  1J19 A;  4RFB A;  2KLC A;  2LXA A;  4W9G A;  4K3B A;  1K53 A;  1KTK A;  2BB6 A;  3L08 A;  1WXA A;  4AWJ A;  3ZXR A;  1E8Z A;  1T0Q C;  2KKC A;  2DYB A;  4N59 A;  3DOW A;  3TBL D;  1V5T A;  4NZL B;  4M0W A;  2WU2 B;  3WAL A;  3B2G A;  3Q3N C;  4TQ0 A;  2WXK A;  5J18 A;  2LGI A;  3CST A;  4K81 A;  1L4Z B;  4MGZ E;  4LCD E;  1I4Q A;  3I63 C;  4S0R A;  3NVV A;  5FKA C;  1JAL A;  1WXQ A;  3JW0 X;  4MH8 A;  4BZA A;  2AQ3 B;  1F1H A;  3KWL A;  4BKT A;  2LVQ A;  3AEG B;  3VFK A;  1PQS A;  3WAN A;  2WWZ A;  2MCN B;  1N60 A;  2KFK B;  1GOZ A;  4Q2J A;  3JSV A;  3PTF C;  3AE4 B;  5EE9 A;  4B6W A;  4RCO A;  4NY0 A;  3TCA A;  3Q8F A;  2VRR B;  1KLV A;  1WX9 A;  1XCT L;  1WMH B;  5LXI B;  3I5J C;  2KDM A;  1E8X A;  2N1W A;  3ZRC A;  1WGY A;  2JRH A;  2OOB B;  2JZZ A;  4C00 A;  4KX6 B;  1VCB A;  3ZTC A;  2K8C A;  1Y56 A;  4C7Y A;  3AEB B;  3DBR I;  1D5Z C;  2BS2 B;  4ZYS A;  2L05 A;  3M3J A;  1M94 A;  2AWT A;  1I4P A;  3CSF A;  1XCQ L;  2OJW A;  2D5G A;  5DPW A;  2MBH A;  2DYO A;  2JU6 X;  2N1V A;  1MI0 A;  1WYW B;  4F8C B;  2KO3 A;  3URY A;  2JWU A;  4YSZ B;  3RFZ B;  3HUI A;  2WS3 B;  1YN3 A;  4HKQ A;  4DXF A;  1TTN A;  4XDC A;  1YN4 A;  3ZJT A;  3PO0 A;  3AUL A;  2UWQ A;  1S3S G;  3RD2 A;  2GOW A;  4BBN F;  4F1S A;  1WRI A;  3LJ3 A;  5D94 A;  4XWW A;  1L6V A;  1GNU A;  4LNO A;  3HHM A;  4C56 C;  3ZNI D;  3PRM B;  3QAR A;  1SSN A;  2CU3 A;  2MBO A;  1LQB A;  2WDT B;  4A9A A;  3OWE B;  2K22 A;  2LGX A;  2FCS A;  3T3O A;  4WH4 A;  2PLP A;  3KH0 A;  1QZE A;  3ABV B;  1T0Y A;  4MEM A;  3K9P B;  2LI5 A;  5FK9 C;  1FNW A;  1XD3 B;  4FHJ A;  2GBN A;  1YJ1 A;  2ZPY A;  3DVN V;  2E3T A;  4G50 A;  3L0W B;  5D7G A;  2JXT A;  5JZE B;  1P0R A;  3DBR B;  4M0W B;  3H8H A;  4HCN B;  5BYR A;  2JPH A;  2KD0 A;  4IWQ A;  3TMP B;  2KWV B;  1YJI A;  3QHT A;  5LLI A;  2QSD A;  1WRD B;  4KGS A;  5AZG A;  2ZPN A;  4X57 B;  2WDR B;  1WM3 A;  2MA9 B;  3R66 C;  1TZ1 A;  4P7I A;  4ZRI A;  3TJP A;  4TUU A;  4W9D A;  2IGH A;  4K7W A;  1DOI A;  1NEK B;  1BT0 A;  5EE1 A;  1WY8 A;  1TS4 A;  1NI2 A;  1XT9 B;  2KLG A;  2J0M A;  4WQM A;  2KQS A;  3CIR B;  1OQY A;  2M0A A;  3BYY B;  1VDV A;  2W54 A;  3RI7 C;  3VDZ A;  4KSK C;  3H1U A;  2WXR A;  2JWZ A;  1A5R A;  2QCZ A;  4CO7 A;  1ZXI A;  3RPF C;  1WE6 A;  5G2N A;  2TSS A;  2CS4 A;  3Q8B A;  4OVV A;  2KTR A;  3X0W A;  3RYT A;  1IPG A;  3HRD D;  3QC8 B;  1D4B A;  4B95 A;  2X38 A;  3BVG A;  3EC8 A;  2J7Q B;  2L76 A;  2N9K A;  3NRZ A;  2KDI A;  4HPL B;  2AYO B;  2WXM A;  1EU4 A;  2RDB C;  3U8Z A;  4PS7 A;  1ZUD 2;  4IWO A;  1P7E A;  3R2T A;  4NJC A;  1DOY A;  3PLV A;  5H8Y E;  1SIJ A;  1WF9 A;  3ZNG C;  4HKZ E;  2MRP A;  2KK8 A;  2XN9 C;  2CJO A;  3VXW A;  3B0A A;  1TKE A;  3ZVV A;  3NS8 A;  1IUE A;  1VZ7 A;  4ZRJ A;  5BO4 B;  2N7J A;  1R7S A;  3GZN B;  2NBW B;  2NS5 A;  2J53 A;  5JXV A;  2NTS A;  3V60 A;  5IA7 A;  2OHF A;  4AUQ C;  3VUW A;  1KRH A;  4HK2 A;  1C4A A;  2DEN B;  3IAS 1;  2MJE A;  2IY0 B;  2WXG A;  1VJK A;  2ON8 A;  1I42 A;  1JWM D;  2NBU A;  2K8H A;  1NEN B;  1UBI A;  4W9C A;  1EF1 A;  4DDI D;  3N30 A;  3FAH A;  2IJ0 A;  3NJT A;  1P9D U;  2K8B A;  4MAC A;  5BYS A;  4TMA B;  1M4V A;  1RLF A;  4M02 A;  4US8 A;  4DXG A;  4XC2 A;  2C7N B;  4JWU C;  2DZJ A;  4RH6 A;  4XWT A;  3V61 A;  1IP9 A;  5G5G A;  4HVB A;  1QOG A;  4WWP A;  4YSX B;  3AEE B;  4ITK A;  3HM3 A;  2GRI A;  2VH1 A;  4A55 A;  3AEF B;  1ISN A;  3MFG A;  1UF0 A;  2DNF A;  2KWU B;  3L54 A;  4N6E B;  1V49 A;  2PW9 A;  4IM3 A;  3RNG C;  1MPE A;  5E6O A;  4D2K A;  2Q5W D;  4II2 B;  3PZD A;  2N0S B;  1AW7 A;  1R4N B;  3Q8E A;  1L0X B;  4ARC A;  2WX0 A;  1B9R A;  2KTR B;  2O2V A;  4MDK E;  2J0J A;  2D11 A;  2ACZ B;  1E5W A;  2ASQ A;  1I7H A;  1XF5 L;  4JWS C;  2IZV B;  2JSV X;  4M8M A;  4E74 A;  1NVI D;  1OTR B;  4LNN A;  2LMC A;  3QAQ A;  3AE5 B;  5AZH A;  3CF6 E;  1FPY A;  2G4D B;  2MLB A;  1WJ4 A;  3V05 A;  1CMX B;  5T8I A;  1CJE A;  1XO3 A;  3DBS A;  4ZRK A;  3S2A A;  3VR8 B;  4NJ7 A;  1KM7 A;  4KDL B;  1RM6 C;  3WA0 A;  1HZ5 A;  1AWD A;  4XYC A;  4LJO B;  3EFC A;  3CMM B;  4M01 A;  4PS8 A;  4YWG G;  3WCQ A;  4EZL A;  4NPN A;  2RPQ A;  4GIV A;  1FCC C;  4YTM B;  1KLG D;  1ESF A;  1QT9 A;  3T3N A;  4LNI A;  3O13 A;  1FXI A;  1UWM A;  4LNK A;  3ZNZ B;  3KUC B;  1KLU D;  1F52 A;  1FEH A;  2JVC A;  1YX5 B;  3WAP A;  1E10 A;  1WXS A;  1K51 A;  1JML A;  3FIL A;  2BQQ A;  2BS3 B;  3QJZ A;  3Q3J A;  3EHV A;  4PT5 A;  3L13 A;  2K1F A;  3T8M A;  3L4P A;  3M95 A;  4AJY B;  5DPT A;  2V1Y A;  3PVL A;  1JRU A;  2MEK A;  1H4R A;  3DCG A;  1TGZ B;  4A3O A;  1WZ0 A;  3P42 A;  4HEA 1;  4HJK A;  1LO5 D;  3W1S A;  2R2Q A;  1HA5 A;  5E6P A;  3HM6 X;  3AE8 B;  1D6E C;  4HPP A;  3B9J A;  1RYJ A;  1SIF A;  4HRS A;  3VH4 B;  4O1N A;  1TKY A;  4USA A;  2KHW B;  2KDE B;  1VZ8 A;  4KSL C;  3HIZ A;  3KUZ A;  2KX0 A;  3M62 B;  2GBJ A;  3PRP B;  5KHO A;  3Q3O C;  2PJH A;  1TS5 A;  2BYE A;  3M63 B;  1C79 A;  3ZTD A;  2Z8L A;  1QQR A;  3NHE B;  2AL3 A;  1E7P B;  4WAA A;  4HLE A;  4CQN A;  4A20 A;  3A4R A;  1CK1 A;  4P1B C;  1GC7 A;  4G0N B;  1OFF A;  5AUK A;  4A8X C;  4FA6 A;  5I4D A;  1C4P A;  3SEB A;  3ZLZ A;  1F2R I;  2D3B A;  2LVP A;  2WHI A;  4DBG A;  3C19 A;  2MQJ A;  3AM9 A;  3EFU A;  3O65 B;  2IDY A;  4GB9 A;  4N9F 4;  1YIW A;  4PK1 A;  2A4Z A;  2HJ8 A;  4C4V A;  2QIE B;  3V6C B;  3VQI A;  2DBY A;  1SE9 A;  2LHD A;  3KYC D;  3VRA B;  1D3Z A;  3R8B A;  3GP7 A;  2G1E A;  3PLU A;  2XK5 A;  2FUG 1;  3A4S C;  4KIK A;  1XLP A;  1UH6 A;  3RT3 B;  3W2D A;  2YVC A;  2KN5 A;  2DZM A;  2IND C;  5IP4 D;  1Z2M A;  3UQB A;  1V5O A;  3L16 A;  2CKH B;  2FAZ A;  2IO0 B;  3SD5 A;  3QA8 A;  2FIF A;  3VVW B;  4WWN A;  2Y3A A;  1GPX A;  1WFY A;  1F9J A;  2Y5C A;  2ZVN A;  1EF5 A;  1N62 A;  4EFO A;  2I1K A;  3RN9 C;  1N63 A;  2JT4 B;  3N20 C;  5J2R A;  2JUO A;  1V1P A;  2LUE A;  4KGT A;  1ET9 A;  2L7R A;  1TYG B;  2V3N A;  1ENF A;  2BGF A;  4GGQ A;  2ZW1 A;  1VD2 A;  4MT5 A;  1MG4 A;  1HXY D;  2WXN A;  2NVU I;  4A6Q A;  1H8C A;  2DLB A;  3JYU A;  1ZKH A;  3FIL B;  2KC2 A;  3RNC C;  4AP4 C;  4IWP A;  3U7Z A;  1IGD A;  2R2O A;  2WX1 A;  1T0R C;  1V9J A;  2QJL A;  1E8W A;  3IBE A;  4WIP A;  3NG0 A;  2V0G A;  1J8C A;  2RGF A;  3W5V B;  2BWE S;  2L83 A;  2V3S A;  4REZ A;  2J0K A;  3NZU A;  3UQA A;  1IBX A;  3OJ3 A;  4OZA A;  3V3X A;  3TEZ A;  1Q1O A;  2V9H A;  1Q10 A;  5GXG B;  2MHJ A;  3ZJU A;  2KMM A;  3AEC B;  4M8N A;  5CHV C;  3NVY A;  4G3X B;  2KDF B;  2INN E;  5GMV A;  3SU8 X;  4DDG D;  2QIL A;  1DOX A;  1EUV B;  1FXT B;  1L7Y A;  1U4A A;  4OVZ A;  5HFY A;  4ZRQ A;  3DDC B;  4JL9 A;  4BKG A;  2WXP A;  1KFY B;  4F7Z A;  3VTW A;  4I6P A;  4MH0 E;  1Z5S B;  2IGG A;  4WWM A;  4PYU A;  3EGR A;  2ZW0 A;  2K6Q A;  2EKI A;  1R4M B;  5HI1 A;  1YNT E;  3QCA A;  1FRR A;  2PE6 B;  5BYQ A;  3H7P A;  3U4E G;  2Z0E B;  4ANX A;  1F77 A;  2HE7 A;  2LGY A;  2J42 A;  3UI3 A;  3JVZ X;  2WYQ A;  3EEC A;  2JQR B;  3LDZ E;  4NNJ B;  1C3T A;  1JW9 D;  1N61 A;  2N7E A;  4L23 A;  5CHW A;  4DHZ B;  2WXF A;  2CHZ A;  4JLC A;  2KQ7 A;  2QC8 A;  1HZ6 A;  1F0Z A;  4XGA B;  3BVZ A;  2MBQ A;  2MBB B;  1TS2 A;  4C4V B;  1KOT A;  1AAR A;  2JY6 A;  3VAW A;  4FXC A;  3PRZ A;  3KVF B;  1E9M A;  3MTN B;  3Q14 C;  2XK5 B;  1E8Y A;  3A9J A;  4KIK B;  4C80 A;  3QX1 A;  3GS2 A;  2WP9 B;  2LEK A;  4WUR A;  3BZD B;  3AI5 A;  2FBW B;  1V86 A;  1I4R A;  1SJE D;  1QLB B;  2EMT A;  2OED A;  4WQO B;  3C8Y A;  3WAO A;  2LGS A;  3MC8 A;  1SE2 A;  5DPR A;  2ZVO A;  4ARI A;  3V6E B;  5JHB A;  4BVU C;  1TJE A;  5L95 C;  3I57 A;  4W9E A;  3AE7 B;  2G4S A;  3VUY A;  3GZN I;  3DBH I;  3PPA A;  2Z0D B;  4J6I A;  1SE3 A;  4K7S A;  3H7S A;  5D3I B;  4KV2 A;  2RMM A;  1QF6 A;  4WAF A;  3JSV B;  3FC4 A;  2NPT A;  3NVZ A;  4RGO S;  3WIM A;  4KVG B;  1PGB A;  5H92 C;  4H2A A;  2BF8 B;  3MJ5 A;  1WZ3 A;  3NOB A;  2G9H D;  2R61 A;  2D3G A;  3E9S A;  4OVU A;  3RUL A;  1WXM A;  2DHZ A;  2KWD A;  3KLS X;  5FR3 A;  4XE0 A;  4ANW A;  2BYF A;  1ZOY B;  4GDL A;  1NI3 A;  1IBX B;  1C1Y B;  5HHD G;  3PRE A;  2BW2 A;  2WDQ B;  2WU5 B;  4FJZ A;  2PKO A;  1DYQ A;  3Q6B A;  2LD9 A;  3ECI A;  4TQ1 A;  4ANV A;  4YSY B;  1MHH E;  2N7D A;  1FMA D;  2UYZ B;  1TZO A;  3PHW B;  3VR9 B;  3VHT C;  5CTR C;  3U7D A;  2ZZP B;  3P63 A;  4NQK E;  3DBH B;  3R7R A;  3AEA B;  1MG8 A;  2PTL A;  2WXI A;  3ALB A;  4NQL B;  1L4D B;  1MVK A;  3TIX A;  5D2M B;  1D5X C;  1R4N I;  2QDF A;  4FBJ B;  3P2B A;  4B0M A;  3RMK C;  2INC C;  2LAS A;  1XXG A;  3BY4 B;  3P4P B;  2WXL A;  1NYR A;  3UIN B;  3QIJ A;  1BUI C;  5EE0 A;  2FCQ A;  3SHQ A;  2I38 A;  3APC A;  1YMH E;  2W82 A;  2B3A A;  3KUD B;  3BYT B;  3MJW A;  1FM0 D;  1WH3 A;  1IGC A;  2PE9 A;  2LZ6 A;  3B08 A;  2BB5 A;  4P16 A;  3Q2A C;  2KJR A;  1EM7 A;  3ZUN A;  3APF A;  2RDH A;  2BS4 B;  1CZP A;  1FXA A;  1LXD A;  1HQR D;  3A9J B;  3DQV A;  2K3U A;  2YEP F;  3HVZ A;  3VH3 B;  1FNV A;  3ML9 A;  2PEA A;  1E7V A;  2HDE A;  4MGK E;  3IAM 1;  1GUA B;  2NTT A;  4PS3 A;  3W1Y A;  2PVO D;  2WXH A;  5LNK 1;  2A5U A;  1XEE A;  1SF0 A;  3TSS A;  1UD7 A;  4OZC A;  1J0G A;  4TKN A;  2C9W B;  1WX8 A;  2YEP B;  2K5P A;  3AV8 A;  4NAM A;  1BML C;  2LRU A;  1QOB A;  2IY1 B;  2L0T A;  3AXC A;  3IT6 B;  3N1X C;  2D2Q A;  3A1Q A;  4W9K A;  2NPT B;  2AQ2 B;  3B2F A;  1V80 A;  5BMG A;  3ONS A;  4GXB A;  4BOS C;  2KVR A;  2JX5 A;  4GOC A;  4JPS A;  5DCN A;  3W5U B;  2WXO A;  3W9C B;  3LB8 C;  2CJN A;  1T6B X;  3N1Z C;  2JYT A;  4IW0 A;  1SB3 C;  4GN1 A;  2NCN A;  1VZ6 A;  4KKJ A;  3AN1 A;  1JRO A;  5JH5 C;  1XLQ A;  4RNA A;  1T5X D;  2L52 A;  3AE3 B;  2JZ3 B;  3N3K B;  2V4L A;  3TEW A;  2RR9 A;  1B1Z A;  2DWQ A;  2BWF A;  4DXA B;  4URK A;  1L0V B;  4HRO A;  3RNA C;  1WWT A;  2OJR A;  4LLG M;  2IO1 B;  4NAW A;  2N9X A;  4W9J A;  2MH7 A;  1JWA D;  1TY2 A;  5IAA C;  3MP9 A;  3ZGZ A;  3TEY A;  1FNU A;  5LXH A;  3RNE C;  3NUH B;  1V97 A;  3ZXV A;  2E6X A;  3UIP B;  1MFW A;  1YQB A;  2N9P C;  2I2Y A;  1WJ6 A;  1ZXH A;  3AMZ A;  4LJP B;  4EE2 A;  2VZK B;  1HEZ E;  1KJT A;  4EKU A;  3I3T B;  3P4Q B;  1YOV B;  4BAX A;  2FCN A;  4IM0 A;  1PGA A;  5HG2 A;  2LJI A;  1YQ4 B;  1WXV A;  3FKY A;  2XBB C;  5C3J B;  3AU4 A;  3MC0 B;  1GC6 A;  3A9K A;  3APD A;  2QEJ C;  3DPD A;  1N6Z A;  1AYF A;  1ZDV A;  4PYZ A;  2M56 B;  1WGR A;  2J52 A;  1Q0W B;  4MSQ B;  5AZF A;  2MX2 A;  3K9O B;  3RZF A;  4QAY A;  5CHF A;  3ETR A;  4MGI E;  3RNF C;  4AQ7 A;  2AEH A;  2LJ5 A;  4KGR A;  4GDK A;  4FHK A;  4UDU C;  1VR9 A;  2O6V A;  1SE4 A;  5KHQ A;  4G11 A;  1GB1 A;  1QKZ A;  4CHK A;  4IC7 B;  3U2S C;  3IFW B;  1SXT A;  2C7H A;  3ZQ4 A;  5C1Z A;  2G45 B;  4BKS A;  1L0Y B;  3L17 A;  2PVG C;  3AE6 B;  4HJG E;  2IYD B;  2VH2 A;  1IYF A;  3J9C A;  1UWX A;  1ACC A;  2NBV B;  4RM9 A;  5AUI A;  1WE7 A;  3Q3F A;  3NS1 A;  3H6N A;  1LFD A;  2MP2 A;  3CWI A;  2HTH A;  3E56 A;  5BMH A;  4TSS A;  3BK2 A;  4ANU A;  3WAM A;  2MJ3 A;  3ML8 A;  1RAX A;  1UNS A;  4IKG A;  4ICU A;  1QIL A;  1A70 A;  3A1Q B;  4YTN B;  2KFJ A;  2Y5B B;  3R3M A;  2MW5 A;  1ZW7 A;  4YL8 A;  2Z59 B;  1TT5 B;  4W9I A;  4AOF A;  3DWG C;  3B1L X;  1JWB D;  1P3Q U;  2L00 B;  1S1Q B;  4B9K A;  2O2V B;  4C7Z A;  4TV3 A;  4MJS A;  3UGB B;  2KVZ A;  1ZE3 D;  3RCZ A;  1J7B A;  1I4H A;  3P4S B;  4EOY A;  2JRI B;  2K25 A;  1V1O A;  2IO2 B;  3L10 B;  4IDI A;  5BMI A;  1T3Q A;  1UGJ A;  4ZOH C;  4HDQ A;  1V81 A;  4FAD A;  5MPO A;  1WX7 A;  1E90 A;  3KYD D;  2ICI A;  1GAQ B;  3MC9 A;  2IO3 B;  2KMA A;  5D3D A;  1ZGU B;  4GMV A;  2AQ1 B;  4NAW B;  2HJ1 A;  5TSS A;  2IPK D;  1SGH A;  1X1M A;  1UEL A;  2BBC A;  4HDO A;  1Y8R C;  2SAK A;  2FID A;  2K9X A;  1KH0 A;  2BKR B;  4ASW C;  3BIN A;  4MM3 A;  2KZR A;  1WGK A;  2RPV A;  1R4M I;  2N9L A;  4BBN C;  3LYY A;  4RGN A;  1SJH D;  4AS1 A;  2PPH A;  4WJQ A;  2CU1 A;  3ZJV A;  4GSW A;  2DYM A;  1MJD A;  5G5H A;  4W9F A;  2KDB A;  2M8S A;  4W9H A;  1YN5 A;  4FJY A;  3C0R B;  3RNB C;  2MBE A;  1C4C A;  1I4X A;  2I1J A;  5JHA A;  2CHW A;  4JGH B;  4RMA A;  2EMS A;  4L1B A;  1RRB A;  3QWZ B;  1OEY A;  3A9K B;  1P7F A;  2WGS A;  1QOF A;  1PFD A;  3MHS D;  3QK0 A;  1K8R B;  1WYG A;  4I6N B;  4RF1 A;  2BYV E;  3ZYY X;  3PT2 B;  2ONQ A;  3SFE B;  2PIA A;  2L3Z A;  3DVN U;  4GDK B;  4N58 A;  3SDL C;  2LGD A;  2O6V B;  1N5X A;  2KAN A;  3DHH C;  2N4F A;  3VUX A;  2UU7 A;  1P1A A;  2DZI A;  2WLB A;  1WIA A;  4ZDV A;  3U30 A;  3KQ4 A;  4LK0 M;  1WJN A;  4RGM A;  5IKC M;  2AL6 A;  2JYE A;  1JQ4 A;  4BOZ B;  4ZRP A;  2HD5 B;  4I6L B;  3UIO B;  2VZK D;  2FE8 A;  2MP2 B;  2D3A A;  3QQ8 B;  2KMC A;  4GU2 A;  3R7Q A;  3OG5 A;  4HPM B;  1RWS A;  4FJV B;  1JWS D;  2GBK A;  3AU5 A;  4IOI E;  3DHI C;  4K7U A;  1PGX A;  4JE3 B;  2XNA C;  1OQQ A;  4MJS B;  1J7A A;  3DHG C;  2BKF A;  2D07 B;  1T0S C;  2REX A;  1WJU A;  2KX3 A;  1E6E B;  1TY0 A;  4LTU A;  1P98 A;  4EUT A;  1HE8 A;  2KOX A;  3TUO A;  3H9D A;  3UF8 A;  3ZW3 A;  5TR5 A;  4L2Y A;  3NY5 A;  2GI9 A;  2DAF A;  4EZK A;  1TKG A;  3GOE A;  2RD0 A;  2RDG A;  1NYQ A;  4OW0 A;  2AX5 A;  2JXX A;  3KW5 B;  4GLS C;  2LUM A;  2LVO A;  1C77 A;  1V1P B;  2H88 B;  1GG3 A;  4MM3 B;  2ZCB A;  3BVM A;  4ZHO A;  3BII D;  2DZK A;  1PYW D;  2ZNV C;  2LRW A;  2GMI C;  3ENE A;  2GBR A;  2KT7 A;  1VRA B;  1SBB B;  1AN8 A;  3AE9 B;  2W3S A;  3GE3 C;  5C2T B;  3AH7 A;  3OAW A;  4IUM B;  3N32 A;  4WJN A;  3ZDT A;  4R3D A;  3OJ4 B;  1YD8 U;  2WNM A;  1EWY C;  3VRB B;  2BYT A;  1WI0 A;  2KNB A;  1V2Y A;  3OLM D;  2KJ6 A;  4CYE A;  3PGE A;  5DPS A;  1WGD A;  5C23 A;  3Q69 A;  2CHX A;  1FD6 A;  2LFI A;  1FFV A;  2EKE C;  3KWV A;  2KN4 A;  4XDD A;  3ZIM A;  1I35 A;  2N9E B;  1C78 A;  1CQV A;  2K39 A;  2KTF A;  2M4N A;  3P4R B;  4OHJ A;  1HTQ A;  2FNJ B;  1WGG A;  3V62 A;  2C60 A;  4DHJ B;  2MJD A;  1HTO A;  2DAJ A;  4B0E A;  2H89 B;  2M0X A;  2M17 A;  1KF6 B;  1ZP0 B;  5EE3 A;  3H7P B;  1L2N A;  4LDT B;  4RF0 A;  2G3Q B;  4DK5 A;  2BT6 A;  2WXQ A;  2NMQ A;  4US9 A;  3TEX A;  4ACF A;  1YQ3 B;  4YTP B;  1OEY J;  4A3P A;  3GE8 C;  4RM8 A;  1WGH A;  5D6J B;  2ZEQ A;  3PZ8 A;  3X23 A;  4AJW A;  4P6V F;  1ZDX A;  5G55 A;  4FLH A;  2D3C A;  3AED B;  3PSE B;  2K0P A;  2IBI B;  3ZO5 B;  4JX1 C;  2KC1 A;  1E7U A;  2O6V D;  2ZNV B;  3N9Y C;  5EDS A;  1OQR A;  3Q3M C;  2L8J A;  4S17 A;  2L32 A;  3ZKJ C;  4J3O D;  3RZW C;  4W9L A;  3NZS A;  4BKS D;  2WDV B;  1LGR A;  3EUB 2;  2QHO A;  1EO6 A;  2JZP A;  2C5L C;  2KAJ A;  1J7C A;  4HCP B;  4IG7 B;  2C7M B;  4DWF A;  4FN2 A;  1ZPS A;  2B76 B;  4KZ0 A;  2KJH B;  4XX5 A;  2KYW A;  1YX6 B;  3DVG Y;  2KWC A;  1PDX A;  3ZDM C;  2CR5 A;  1C76 A;  2M19 A;  3R2I A;  2MWS B;  1I4G A;  1JCK B;  3D32 A;  2MSE D;  4K1R B;  1FRD A;  3Q8C A;  4IM2 A;  3SR6 A;  2RSU A;  3EA6 A;  1L5P A;  2NR2 A;  1JWU D;  4P1C C;  2HTM E;  3LXF A;  4HWI B;  1XLO A;  2GLS A;  2EEL A;  3GB1 A; 
#chains in the Genus database with same CATH homology
 3Q8A A;  1FFU A;  1UNS A;  1UUP A;  4IKG A;  1QIL A;  1VLB A;  1A70 A;  2WXM A;  1EU4 A;  4YTN B;  3NVW A;  3P1M A;  1FCL A;  1ZUD 2;  2IGG A;  2KQ4 X;  4WWM A;  3EGR A;  1XLN A;  4ZHP A;  2ZW0 A;  4GDL B;  1P7E A;  3R2T A;  4NJC A;  1PUT A;  2EKI A;  1EU3 A;  1DOY A;  5HI1 A;  2V4I B;  5H8Y E;  3DWG C;  1YNT E;  1JWB D;  1SIJ A;  1FRR A;  5BYQ A;  2KAC A;  3U4E G;  4HKZ E;  4C7Z A;  2XN9 C;  1F77 A;  2W3R A;  2CJO A;  1ZE3 D;  1TKE A;  1J7B A;  1EWC A;  2J42 A;  3UI3 A;  1I4H A;  3SFD B;  3P4S B;  1IUE A;  1V1O A;  1VZ7 A;  2JQR B;  4IDI A;  5BMI A;  2N7J A;  1T3Q A;  1UGJ A;  4ZOH C;  1JW9 D;  1N61 A;  4L23 A;  4YT0 B;  1R7S A;  3U52 E;  1ET6 A;  3BK1 A;  2WXF A;  3MHZ A;  5MPO A;  2WXJ A;  2ICI A;  1HZ6 A;  2J53 A;  1F0Z A;  2SEB D;  1QOA A;  1GAQ B;  3BVZ A;  5JXV A;  2NTS A;  1TS2 A;  5D3D A;  2W55 A;  2AQ1 B;  2OHF A;  4NAW B;  1K50 A;  3HVD A;  1SEB D;  5TSS A;  2IPK D;  4FXC A;  1KRH A;  2BBC A;  1E9M A;  1C4A A;  3IAS 1;  2SAK A;  2MJE A;  3DWM A;  4C80 A;  4DQO C;  2K9X A;  2WXG A;  3GS2 A;  1KH0 A;  2WP9 B;  2LEK A;  4WUR A;  1VJK A;  3BZD B;  2ON8 A;  3I9V 1;  1WGK A;  1JWM D;  1D5M C;  2FBW B;  2N9L A;  1I4R A;  2RPV A;  3LYY A;  1NEN B;  4RGN A;  1SJH D;  1SJE D;  1QLB B;  3FAH A;  4AS1 A;  1V8C A;  2IJ0 A;  2L1A A;  2OED A;  1RFK A;  3C8Y A;  2PMV A;  3ZJV A;  4MAC A;  2IGD A;  2Y5P A;  1SE2 A;  4TMA B;  2DYM A;  5BYS A;  5G5H A;  1M4V A;  3NZ3 A;  4ARI A;  1BXT A;  3BWU D;  4US8 A;  1TJE A;  1L6U A;  4DXG A;  3I57 A;  1MHX A;  3AE7 B;  1YN5 A;  4JWU C;  4OZB A;  2LHE A;  4RH6 A;  1C4C A;  1I4X A;  3PZ7 A;  1SE3 A;  4XWT A;  5D3I B;  2J4X A;  5G5G A;  2RMM A;  1QF6 A;  4WAF A;  1QOG A;  4YSX B;  3AEE B;  4L1B A;  4ITK A;  2GB1 A;  3FC4 A;  2INP E;  3GB1 A;  3NVZ A;  4RGO S;  2GRI A;  3IXS A;  1P7F A;  1PGB A;  1GB4 A;  1QOF A;  1PFD A;  5H92 C;  4A55 A;  4H2A A;  3AEF B;  1FIQ A;  3MFG A;  1WYG A;  3AB5 A;  3MJ5 A;  1TS3 A;  4RF1 A;  2G9H D;  2R61 A;  2BTE A;  3ZYY X;  1STE A;  4KKI A;  4N6E B;  1E0Z A;  2ONQ A;  2PW9 A;  3SFE B;  2PIA A;  1F2R C;  3E9S A;  4GDK B;  4N58 A;  1FO4 A;  1N5X A;  3IT4 B;  1MPE A;  2KWD A;  1JRP A;  4D2K A;  3KLS X;  2Q5W D;  2WLB A;  2N0S B;  1ROE A;  1AW7 A;  5FR3 A;  3AE1 B;  4XE0 A;  3Q8E A;  1L0X B;  4ARC A;  3KQ4 A;  1ZOY B;  4RGT A;  4LK0 M;  3AE2 B;  1NI3 A;  1IBX B;  4RGM A;  1B9R A;  1DGJ A;  1K52 A;  5HHD G;  2BW2 A;  2WDQ B;  2JYE A;  1YJJ A;  1JQ4 A;  1C9F A;  2WU5 B;  2QMT A;  1WSP A;  2ACZ B;  2PKO A;  1DYQ A;  5E6J A;  4ZRP A;  1I7H A;  1XF5 L;  4TQ1 A;  4JWS C;  2VZK D;  2JSV X;  4YSY B;  1N5W A;  2WQY B;  2FE8 A;  1MHH E;  2V3P A;  1NVI D;  4A90 A;  1FMA D;  4RFB A;  1TZO A;  2LMC A;  1K53 A;  1KTK A;  2BB6 A;  3VR9 B;  3AE5 B;  3P63 A;  4N59 A;  1RWS A;  3V05 A;  3AEA B;  4NZL B;  4M0W A;  5T8I A;  1CJE A;  1JWS D;  2PTL A;  2WXI A;  1L4D B;  2WU2 B;  1XO3 A;  3B2G A;  1MVK A;  3VR8 B;  4IOI E;  2WXK A;  4TQ0 A;  1D5X C;  1PGX A;  1RM6 C;  4JE3 B;  2LGI A;  1HZ5 A;  2XNA C;  1AWD A;  4B0M A;  1OQQ A;  1J7A A;  1XXG A;  1L4Z B;  4YWG G;  3P4P B;  1I4Q A;  3WCQ A;  2WXL A;  1NYR A;  1FCC C;  1E6E B;  4YTM B;  1KLG D;  1TY0 A;  1BUI C;  1ESF A;  1QT9 A;  4LTU A;  3T3N A;  5EE0 A;  3NVV A;  5FKA C;  3O13 A;  1JAL A;  1WXQ A;  1FXI A;  2I38 A;  3TUO A;  1YMH E;  1UWM A;  2W82 A;  4MH8 A;  1KLU D;  2AQ3 B;  1FEH A;  3BYT B;  1E10 A;  4L2Y A;  3KWL A;  1K51 A;  1JML A;  1FM0 D;  2GI9 A;  1IGC A;  3FIL A;  3AEG B;  2BB5 A;  4P16 A;  2BS3 B;  1TKG A;  2RDG A;  1EM7 A;  1NYQ A;  4OW0 A;  1N60 A;  1GOZ A;  2AX5 A;  4PT5 A;  2RDH A;  4Q2J A;  2BS4 B;  1CZP A;  1FXA A;  2LUM A;  4GLS C;  1HQR D;  1C77 A;  3L4P A;  1V1P B;  2H88 B;  3AE4 B;  2K3U A;  2YEP F;  3HVZ A;  5EE9 A;  4MM3 B;  1FNV A;  4RCO A;  2MEK A;  3BVM A;  2HDE A;  4ZHO A;  3Q8F A;  3BII D;  3IAM 1;  2NTT A;  3P42 A;  4HEA 1;  1LO5 D;  1PYW D;  1XCT L;  3W1S A;  2PVO D;  1HA5 A;  2WXH A;  5LNK 1;  2KDM A;  3AE8 B;  1D6E C;  1VRA B;  1XEE A;  1SF0 A;  3TSS A;  1SBB B;  1AN8 A;  4OZC A;  3AE9 B;  2W3S A;  3B9J A;  1RYJ A;  3AH7 A;  5C2T B;  4HRS A;  4KX6 B;  4O1N A;  1TKY A;  2YEP B;  4USA A;  1Y56 A;  4C7Y A;  3AEB B;  4R3D A;  2K5P A;  1VZ8 A;  1D5Z C;  3AV8 A;  4NAM A;  1BML C;  2WNM A;  2BS2 B;  1EWY C;  3VRB B;  1QOB A;  2BYT A;  3IT6 B;  4ZYS A;  1TS5 A;  2AQ2 B;  3B2F A;  5BMG A;  1C79 A;  1I4P A;  1XCQ L;  2JX5 A;  4JPS A;  3W5U B;  2Z8L A;  1QQR A;  3Q69 A;  2WXO A;  1FD6 A;  3W9C B;  3LB8 C;  2CJN A;  1E7P B;  2D5G A;  2LFI A;  1FFV A;  4CQN A;  3KWV A;  2KN4 A;  1T6B X;  2DYO A;  2JU6 X;  4XDD A;  1CK1 A;  2JYT A;  1SB3 C;  1MI0 A;  4KKJ A;  1VZ6 A;  3URY A;  2JWU A;  4YSZ B;  1OFF A;  3RFZ B;  3AN1 A;  1JRO A;  3HUI A;  5AUK A;  4A8X C;  2WS3 B;  1YN3 A;  5I4D A;  4DXF A;  1C4P A;  1C78 A;  4HKQ A;  4XDC A;  1YN4 A;  1CQV A;  1XLQ A;  3SEB A;  4RNA A;  3ZJT A;  1T5X D;  3PO0 A;  2L52 A;  3AE3 B;  1F2R I;  1WRI A;  3P4R B;  3TEW A;  4OHJ A;  1B1Z A;  2DWQ A;  4XWW A;  1L0V B;  4HRO A;  1L6V A;  3AM9 A;  2IDY A;  1WWT A;  4C56 C;  4LLG M;  2MJD A;  2QIE B;  3VQI A;  2DBY A;  1SSN A;  2CU3 A;  1JWA D;  2MH7 A;  4B0E A;  2LHD A;  2H89 B;  3VRA B;  3R8B A;  1TY2 A;  3GP7 A;  4A9A A;  2G1E A;  2K22 A;  3OWE B;  2FUG 1;  1KF6 B;  3MP9 A;  1ZP0 B;  3T3O A;  3ZGZ A;  5EE3 A;  4WH4 A;  3TEY A;  1XLP A;  2PLP A;  4RF0 A;  1FNU A;  3W2D A;  3ABV B;  3NUH B;  1V97 A;  2BT6 A;  5FK9 C;  1FNW A;  2WXQ A;  2E6X A;  2NMQ A;  4US9 A;  3TEX A;  1YQ3 B;  4YTP B;  1ZXH A;  3AMZ A;  4YXD B;  2I2Y A;  2E3T A;  2Y3A A;  1GPX A;  3PZ8 A;  5D7G A;  2Y5C A;  4EE2 A;  2JXT A;  2VZK B;  3H8H A;  4P6V F;  1HEZ E;  1N62 A;  1ZDX A;  5BYR A;  1N63 A;  3P4Q B;  1YJI A;  3AED B;  1V1P A;  2QSD A;  4KGT A;  4KGS A;  1PGA A;  1ET9 A;  2LJI A;  2K0P A;  5HG2 A;  1YQ4 B;  1TYG B;  2V3N A;  4JX1 C;  1ENF A;  5C3J B;  2WDR B;  3MC0 B;  2QEJ C;  2ZW1 A;  1AYF A;  4MT5 A;  1ZDV A;  3N9Y C;  2IGH A;  1HXY D;  2M56 B;  1OQR A;  1DOI A;  2J52 A;  2WXN A;  1NEK B;  2L32 A;  5EE1 A;  1TS4 A;  4A6Q A;  4J3O D;  2DLB A;  3ETR A;  4AQ7 A;  3FIL B;  2WDV B;  3EUB 2;  4KGR A;  3U7Z A;  4WQM A;  1IGD A;  3CIR B;  4UDU C;  1VR9 A;  2M0A A;  3BYY B;  1SE4 A;  1VDV A;  2JZP A;  2KAJ A;  1J7C A;  2W54 A;  1GB1 A;  1QKZ A;  2QJL A;  1ZPS A;  3U2S C;  2B76 B;  4WIP A;  1SXT A;  2V0G A;  2WXR A;  3ZQ4 A;  3W5V B;  2L83 A;  1ZXI A;  1L0Y B;  1PDX A;  4REZ A;  3RPF C;  1C76 A;  2M19 A;  3R2I A;  1IBX A;  4OZA A;  1I4G A;  2TSS A;  3V3X A;  1JCK B;  2PVG C;  3AE6 B;  4HJG E;  1FRD A;  3TEZ A;  3Q8C A;  3Q8B A;  3SR6 A;  1Q10 A;  3EA6 A;  3J9C A;  1UWX A;  1ACC A;  1L5P A;  5GXG B;  3ZJU A;  2KMM A;  1JWU D;  5AUI A;  3AEC B;  2HTM E;  3HRD D;  3NVY A;  3NS1 A;  2INN E;  1D4B A;  2QIL A;  2X38 A;  3BVG A;  1DOX A;  3CWI A;  3LXF A;  3E56 A;  5BMH A;  4TSS A;  3BK2 A;  1XLO A;  4OVZ A;  4ZRQ A;  5HFY A;  2MJ3 A;  2EEL A;  2WXP A;  2N9K A;  1KFY B;  3NRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...