1FD6A

Delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fd6A00
1XCQL 1XF5L 2IGDA 1IGDA 3GB1A 4IOIE 1KH0A 2N9KA 1GB4A 2J52A 2LHDA 2LUMA 1D4BA 1IBXA 2OEDA 1MHXA 2I2YA 2PW9A 1K53A 4KGSA 5HHDG 5BMIA 1C9FA 1XCTL 4WH4A 2JZPA 3UI3A 2QMTA 1PGBA 1FD6A 4MACA 2JSVX 2KN4A 2QSDA 5BMHA 2KWDA 1QKZA 1HZ5A 2PTLA 4KGTA 1YMHE 2ZW1A 2JU6X 2LGIA 2IGHA 2K0PA 1K52A 1GB1A 1IGCA 4KGRA 2I38A 1EM7A 2IGGA 1JMLA 2ONQA 2KQ4X 1HZ6A 4HJGE 4D2KA 2ZW0A 1FCCC 1F2RC 1K50A 1P7EA 2JXTA 5BMGA 2PLPA 1ZXHA 1MI0A 1Q10A 2N7JA 2N9LA 1PGAA 3V3XA 5HFYA 1MPEA 2JWUA 4GLSC 2GB1A 2LHEA 5HI1A 2ON8A 1YNTE 3FILA 2RMMA 2KDMA 4HKZE 1K51A 2RPVA 1P7FA 4IKGA 1MHHE 2NMQA 1HEZE 2KACA 4OZCA 5JXVA 3FILB 2J53A 5HG2A 4OZAA 4OZBA 1FCLA 2EELA 1F2RI 1MVKA 1PGXA 1IBXB 1UWXA 3MP9A 2GI9A
chains in the Genus database with same CATH superfamily
3MHSD 1YJJA 3QA8A 5C2TB 4HCNB 5T8IA 2D3AA 4BZAA 1WH3A 4EEWA 3VR8B 2NTTA 1D4BA 2IO1B 4OHJA 1VJKA 2MJEA 1JWSD 2N0SB 4RGTA 2RDBC 1E7UA 1DOXA 3C19A 1IP9A 3KYDD 1L4ZB 1C4CA 1OGWA 1TZOA 1LFDA 3R7QA 3DOWA 5DPSA 2Q5WD 2GBJA 1NENB 2JZPA 2Y5CA 3AE7B 3CIRB 2DYOA 4CYEA 3L0WB 2LJ5A 3L08A 2HTME 4GGQA 4PS7A 4JIOU 3ZKJC 3KW5B 5TR5A 4OVVA 2LVOA 2J0KA 3CSTA 3PPAA 2PTLA 4ARCA 3ZJUA 2D5GA 1PYWD 4KGRA 3P4RB 3A4SC 1NVID 3VXWA 5IP4D 1JMLA 4NJ7A 4XDCA 1HZ6A 2HDEA 2NCNA 2UYZB 5C1ZA 4D2KA 1WZ3A 4L1BA 3AEBB 4OVZA 1DGJA 4A6QA 4ZRIA 4YXDB 4YT0B 2WXHA 2A4ZA 2N9LA 3NHEB 1WXAA 2BWFA 4FULA 5IA7A 1FMAD 2KC2A 5HI1A 4IM2A 5J17A 4BKSD 2ON8A 4EZJA 1UZXB 3N20C 2KTRA 3NY5A 1N5XA 4B95A 1FCLA 2W82A 1F2RI 5EE9A 1YQ4B 3PRMB 1PGXA 2ACZB 1UF0A 2KTRB 1CZPA 1XCQL 1I7HA 3AE3B 4XX5A 2ZCCA 4NQKE 2NS5A 1P1AA 2C60A 2IBIB 3A1QA 2GOWA 1RWSA 2V4IB 1JROA 4KV2A 3CF6E 3A1QB 1FNWA 5IOIA 1D5ZC 1N63A 4J3OD 1S3SG 1TY0A 4YTMB 2DLBA 3W9CB 2WXIA 1RLFA 1JWMD 2GBNA 3AM9A 2D3BA 1VCBA 4PS3A 3LJ3A 2IJ0A 2DZKA 2KVZA 3PRPB 1I4XA 1CK1A 2IGGA 3QARA 3L17A 4TMAB 1UBQA 4A9AA 3CWIA 2LGSA 1WI0A 1VZ6A 1K50A 1QILA 3P42A 2M56B 5J2RA 1JRUA 1N5WA 1WM2A 3U4EG 2LVQA 2MJDA 3AE9B 4AWJA 1OTRB 4AUQC 4TKNA 1G6JA 1NDDA 4WJQA 4HRSA 2RMMA 2XNAC 1YN5A 2KC1A 3EC8A 3EFUA 4B0MA 3V05A 2RPVA 4IWPA 2WXGA 1RRBA 4OZCA 3AEEB 2ZZPB 4YTPB 1XEEA 1E8YA 2PEAA 2HTHA 3VFKA 3PHXB 4E74A 1QOBA 3ONSA 3ZNGC 4W9EA 1L4DB 3AEGB 2BKFA 4IWOA 3HUIA 2N9KA 3H6NA 1GB4A 4Q2JA 3B9JA 4MGIE 1QQRA 2ZPNA 3X23A 5CHFA 3DBHI 4FHKA 3GE8C 2KMAA 1UGJA 4DHZB 3Q2AC 1RYJA 2L8JA 4GB9A 2DAJA 1D3ZA 1I4RA 4JLCA 2JVCA 2INCC 5BMHA 1L5PA 1HE8A 3EFCA 1WGDA 2D07B 5GXGB 1YQ3B 5H92C 2D2QA 1IGCA 3NUHB 2I38A 2XN9C 4EUTA 4LNOA 4P6VF 5GMVA 2LUEA 1E9MA 2KQ4X 3Q3FA 2MX2A 3U52E 1TS3A 3OLMD 2QIEB 2NPTA 4DXAB 4ZDVA 3W1SA 2JQRB 3DBLB 1B1ZA 2MH7A 3V3XA 3IT4B 4GXBA 2JWUA 3UINB 3TEYA 4GLSC 3RYTA 1WE6A 4A8XC 1WR1A 1YX6B 5C23A 3ZYYX 1GNUA 2M4NA 3KWLA 4II2B 2FAZA 4E71A 2CKHB 3VTUA 1TS2A 2NMQA 2M1MA 3EECA 2J53A 2AX5A 4ZYNA 2MBEA 4NPNA 5D3DA 1VR9A 2HD5B 3MJ5A 1T5XD 2WQYB 1JQ4A 1YN3A 2KDFB 2VZKD 2IGDA 4US9A 2WS3B 4ICUA 2LUMA 1XLPA 3VR9B 1V5TA 2UU7A 3ZLZA 2KD0A 1KM7A 2MW5A 3Q8CA 5BYQA 1FFVA 4AQ7A 1XLNA 5LLIA 3Q69A 5BMIA 4W9IA 3K9OB 4BVUC 2LRWA 3GE3C 5D3IB 2CHXA 3ZGZA 3NS8A 5EE3A 5G5GA 1E8XA 2WX1A 1FIQA 2KWCA 3IBEA 3V6EB 3KLSX 4YSZB 2IGHA 3RZWC 1FEHA 1C79A 5JZEB 4G0NB 1K52A 4IM0A 3TSSA 3DWGC 1U4AA 1M4VA 3NRZA 4ZRKA 1WGYA 4WJOA 3P4QB 4RGMA 1V80A 3NZUA 3BVZA 3H9DA 4K7SA 3BVGA 1MI0A 2KVRA 2KT7A 4ITKA 3DQVA 3PHWB 1A5RA 2WWZA 4E3CA 2LD9A 1E8WA 1R4NB 3H8HA 2KWVB 3L54A 1KJTA 2HJ8A 1N62A 1JRPA 4MM3A 2WDTB 4RM8A 2ZEQA 2C9WB 1PFDA 2FCNA 2DWQA 4MM3B 4NZLB 4BKSA 4W9LA 4CO7A 3Q8FA 3VTVA 2KTFA 1ZKHA 4W9JA 3Q6BA 1E10A 3I63C 4BAXA 1DOIA 1NI3A 1SGHA 3QCAA 2PPHA 5BO4B 5KHOA 2K39A 3IXSA 4XDDA 4I6PA 1WZ0A 2LHDA 3DBRI 4X57B 2J4XA 4W9HA 2ZPYA 1WR6E 4TQ1A 3B2GA 4XE0A 1WX7A 2JT4B 1XT9B 5HHDG 2L32A 3FAHA 4MH0E 5FR3A 5IAAC 1RFKA 1R4MI 2IDYA 1H4RA 1CQVA 3RNAC 1FD6A 4PYUA 4M02A 2R61A 2JSVX 1YJIA 1UD7A 1I4HA 3NOBA 4DDGD 3SHQA 4M00A 1C4PA 2BYTA 1ENFA 2XK5A 2LXCA 1GJZA 2L7RA 4W9CA 2BYEA 4HROA 1FO4A 1XO3A 1V49A 2K3UA 3OJ3A 2NBUA 2XK5B 4MGKE 4PYZA 1GPXA 4ARIA 3I9V1 1QOFA 4XGAB 1MJDA 1WMHA 1JCKB 1WRDB 4WQMA 2FE8A 3AEDB 5D7GA 2KO3A 3AE8B 1WJNA 1P9DU 4FXCA 5CHVC 3DBRB 3DCGA 2LHEA 2KZRA 3RD2A 3ZRFA 2V1YA 3Q3NC 1LO5D 1T6BX 1AYFA 4HPMB 1NEKB 3T3OA 1XD3B 3NVZA 5G2NA 2WXMA 3PREA 4WURA 1GG3A 1WSPA 4JWUC 1JALA 3VQIA 1IBXB 1UELA 2M19A 1KTKA 2QDFA 2GRIA 4O1NA 3PZDA 3M95A 4DHJD 3PTFC 3GB1A 3DVGY 2AYOB 1E6EB 4GOCA 2YEPB 3P1MA 3DHHC 3APCA 1Y8RC 4YL8A 3L16A 3BZDB 4G50A 2K6QA 3N1YC 2W9NA 2FUG1 5DCNA 4W9FA 2QEJC 3BK1A 2JYEA 1WGGA 2AL3A 3ZNZB 3RNCC 2LGDA 2KN4A 1E8ZA 2FCQA 3R8BA 2PMVA 4EZKA 2EKEC 2KWDA 3Q3MC 2J0JA 3X0WA 3BIID 5E6OA 3TUOA 1WGHA 4ZRQA 1DOYA 3PGEA 2AQ3B 1LXDA 2BB5A 2BPSA 1L0YB 1ZPSA 2I1JA 2ONQA 1ET6A 4QAYA 2LVPA 1WWTA 3D32A 4JWSC 3R66C 4LK0M 1FCCC 1ZW7A 2DZMA 4AJYB 5KHQA 3QHTA 1V9JA 2OOBB 2N1VA 2K8CA 5FKAC 3TEZA 4P7IA 2JZ3B 4RNAA 3KUDB 4WWPA 4KIKA 1SBBB 2KDMA 3T3NA 3I57A 4HJKA 1T3QA 4MGZE 1Q5WB 3QQ8B 3TBLD 2RPQA 2PVGC 4A90A 1ZOYB 3VUWA 2AL6A 2H89B 3DWMA 4KIKB 5D94A 2GMIC 2MBHA 2JX5A 3IHPC 2QJLA 4NJ6A 3GZNI 1P98A 1WYGA 2GI9A 3TL5A 1JWUD 3PRZA 2KDBA 4FBJB 1P0RA 2DX5B 2CJOA 2CJNA 4S0RA 1GUAB 3P63A 1JWAD 4WWMA 3KWVA 1N6ZA 3BWUD 2PW9A 2YVCA 1QOGA 1VRAB 4LNFA 4RM9A 1X1MA 1C9FA 1XCTL 3UI3A 1UWMA 4B9KA 3ZTDA 1WXMA 1HQRD 2WXOA 3HK0A 2DENB 4J6IA 2XBBC 2VZKB 1WE7A 1RM6C 4RGOS 1ET9A 2L00B 1HZ5A 4KGTA 3ZNHB 2YLMA 1TYGB 1TY2A 1RFAA 2K8BA 2WDVB 3ZDMC 3A9KA 4MGYE 4KKJA 2Z0DB 2O6VD 4EOYA 2EMTA 2LWPA 4XYCA 1F2RC 4N9F4 2B76B 2DZJA 3A9KB 4B0EA 2ASQA 3GP7A 3N3KB 2MBBB 2KOXA 2NTSA 1SF0A 1AARA 3V62A 1AWDA 2K9XA 4L23A 2WXQA 3HVDA 2QCZA 4NNJB 4JPSA 4OW0A 3MC0B 2LZ6A 2N9EB 1TT5B 2V3NA 3HIZA 1J7AA 2LI5A 1MHHE 3TMPB 4KKIA 5AZGA 3W5VB 5G55A 2WXKA 1EF5A 2M17A 2WU2B 2K1FA 3OG5A 1PDXA 3O13A 3QIJA 5BYSA 1DYQA 2KDIA 4GMVA 3T9LA 4GDKA 1E5WA 2CR5A 2WX0A 4K3CA 3ZJVA 1UBIA 3H7SA 1GOZA 4C7YA 3FKYA 2SAKA 2L1AA 2WDRB 3LB8C 2V9HA 4IG7B 4GDKB 1AW7A 2DNFA 1K53A 3NJTA 2INNE 1ACCA 1TKGA 4BBNF 1OQQA 1XLOA 3C0RB 3PVLA 5D2MB 2G3QB 1K8RB 2BB6A 3NS1A 1QKZA 3TCAA 4US8A 2ZW1A 4C80A 4ANWA 1JWBD 1D5XC 4BKGA 2W3SA 1OQYA 3OAWA 2G4SA 2DHZA 1C1YB 1UUPA 5IO9A 2IO2B 2WGSA 4DK5A 3DBSA 4F8CB 1P7EA 1T0RC 2OJWA 1Q10A 1Q1OA 4BBNC 4ZHPA 2ZJDA 2KHWB 1TIFA 2KLCA 1H8CA 4M8NA 4FJZA 2C7HA 2K5PA 2A5UA 2N7DA 2DBYA 3W1SC 1L7YA 3UGBB 4LNIA 5EDSA 4XZ4A 4AP4C 3I5JC 1WGKA 3PS6A 1TTNA 2M0AA 3ZIMA 2LRUA 4IC7B 1QT9A 3WANA 1VZ7A 3PZ7A 2W55A 2INDC 2WXFA 2V4LA 3DBHB 1SB3C 2VRRB 3RNBC 1I42A 1SJHD 4TUUA 3EUB2 4IOIE 1OEYJ 2FIDA 2GBRA 1WY8A 2ZNVB 4BFRA 1V6EA 2J42A 4NAWB 4W9KA 4LJOB 2I2YA 3B1LX 4KVGB 1GAQB 1QOAA 4MEMA 4C7ZA 1A70A 4ANUA 1P3QU 1D5MC 2MHJA 4ASWC 4DXGA 3ML8A 4EFOA 4LDTD 3DVNV 1FFUA 2BTEA 4HXDA 2WDQB 4AJWA 4DWFA 4CHKA 5TSSA 4DHJB 2N7EA 5FR6A 4HDQA 1V1PA 5L83A 2WHIA 3BYYB 3NZSA 3L10B 1KRHA 2JUOA 2LEKA 3RMKC 1V1PB 4LNNA 4HWIB 4A3PA 1BT0A 3AU5A 3APFA 1JW9D 3WAOA 1FXAA 3CMMB 3KH0A 2D11A 3TIXA 4HVBA 3IT6B 2BYFA 4AS1A 2V3SA 3L13A 2GB1A 5J18A 3RT3B 1L0VB 2Z59B 3KUCB 2KX0A 3MHZA 2K25A 3ZRCA 4FJYA 2IZVB 1QZEA 2BS2B 4HPLB 2RDGA 1HEZE 2MRPA 1J0GA 2NR2A 4MDKE 3S2AA 3SFEB 2MJ3A 3ETRA 1WGRA 4N58A 2JRHA 4GDLA 2JRIB 5AEKB 1SE2A 1RAXA 1N61A 4A3OA 4EE2A 3JW0X 3RI7C 4GDLB 2OEDA 4MSQB 1EO6A 3ABVB 3RULA 2RGFA 3WALA 4USAA 4BOSC 1MHXA 3ZXRA 5LXHA 3U7DA 2L76A 4CQNA 4RCOA 1TJEA 4XWTA 3ALBA 2WLBA 3NZ3A 2W54A 2QSDA 1OFFA 3PLUA 2BBCA 4RGNA 3W5UB 3VH4B 4HLEA 1F0ZA 3ZO5B 1YJ1A 2KFJA 4LNKA 4FADA 4ZRJA 3OJ4B 1V1OA 2D3CA 2MLBA 3IAS1 1EM7A 1EWYC 1C76A 3Q8EA 2LXAA 2HE7A 1SIJA 3IG3A 2FCMA 2C7NB 3LXFA 2LJIA 3VH3B 4ZHOA 2KQ7A 3UQAA 2BW2A 1EWCA 2JXTA 3DHGC 4WWNA 1S1QB 4TQ0A 3K9PB 4ANVA 3VVWB 5H8YE 2MCNB 1ZGUB 4YWGG 2O6VA 1YNTE 2E3TA 4FHJA 3VAWA 2MSED 2G1EA 1WYWB 1SE9A 1WXVA 1WRIA 1P7FA 2O6VB 3MJWA 4M0WA 4HEA1 4JL9A 1CJEA 3AXCA 2CHWA 4FLHA 4M0WB 1EUVB 2Y3AA 1L2NA 1I35A 1GC7A 1E90A 2QC8A 3E56A 2KJHB 1ROEA 1R4MB 1YIWA 2AQ1B 1IBXA 3MC8A 1PQSA 2MP2A 4W9GA 2H88B 2Z0EB 4MH8A 1SSNA 4JX1C 3HVZA 3ZTCA 4IW0A 2MP2B 3QX1A 3AE1B 5G5HA 4FJVB 1UGMA 3N30A 3UQBA 3ZNID 1I4GA 1TS4A 4RFBA 3VHTC 4G11A 2BS4B 4GSWA 4K7WA 4YTNB 5AZHA 1YQBA 2N1WA 3VUYA 4L2YA 3AI5A 1WJUA 3SU8X 1V2YA 3AN1A 3TEXA 1KLGD 2EMSA 2ICIA 4FN2A 3VRBB 1PUTA 2PKOA 2MQJA 1VZ8A 3VUXA 2D3GA 2BYVE 2JZZA 3ZJTA 5JHAA 5AUIA 1ZXHA 1SEBD 2L0FA 5D6JB 2N7JA 2BS3B 1MPEA 3QK0A 2FNJB 2L3ZA 1WX8A 3QJZA 2KN5A 4C4VB 4IWQA 2J0MA 1WJ4A 2KMMA 2Y5PA 2JXXA 1GC6A 4ZYSA 4N6EB 1EU4A 3RCZA 2RD0A 4MT5A 3RNGC 4K81A 1IPGA 3DHIC 5JXVA 3ML9A 1NYRA 3LDZE 4FA6A 4H2AA 4M01A 4BKTA 3P2BA 3OWEB 4IM3A 2IO3B 4KDLB 1Q0WB 4REZA 3SD5A 2PE9A 3KVFB 3DDCB 1BXTA 1YD8U 3DVGX 2M8SA 1XF5L 2MA9B 3ZQ4A 1WIAA 5DPTA 5E6NA 1FPYA 4IUMB 3SFDB 3DVNU 5EE0A 2X8XX 5I4DA 1EF1A 3L4PA 4JGHB 3P4SB 4II3B 2NVUI 1HTQA 5LXIB 1TKYA 1FNUA 3URYA 4GN1A 3IAM1 4KSKC 5LNK1 4F7ZA 3N32A 1KOTA 2JU6X 2HJ1A 3Q14C 3BK2A 1QF6A 1YX5B 2BQQA 3AEFB 2QILA 1R7SA 1WX9A 3PO0A 3P4PB 5JH5C 2KLGA 3NVYA 1HXYD 3PV1A 4LDTB 2OJRA 5E6PA 3ZUNA 3HM3A 2R2OA 5BMGA 2V3PA 1F1HA 4LCDE 4W9DA 1FRDA 4I6LB 4DDID 2M0XA 2KXJA 1VLBA 1N60A 2KK8A 3APDA 3GZNB 3FC4A 4KZ0A 4PS8A 1OEYA 2R2QA 3ZDTA 3QWZB 2IPKD 4HCPB 4OZBA 4YSYB 2KNBA 2WP9B 3SDLC 1ISNA 3BY4B 3MP9A 4DQOC 1J8CA 3A9JA 3UF8A 3U2SC 3ZVVA 2JY6A 2LMCA 1SE4A 4A55A 1IGDA 1TKEA 1BUIC 1KH0A 1TBEA 2J52A 3A9JB 1C78A 2Z8LA 4LTUA 2L05A 3AE2B 4KGSA 2WXPA 2AQ2B 4M8MA 1CMXB 3HHMA 3AH7A 1AN8A 2DYBA 2KMCA 3B08A 2QMTA 2IYDB 4A20A 1PGBA 1Z5SB 2VH2A 3HRDD 4WJNA 1L6VA 2L0TA 1C4AA 1OQRA 1NYQA 2BKRB 3M63B 4HKQA 4XC2A 1YMHE 1V97A 4K1RB 2DZIA 4C56C 4F1SA 3W2DA 2DAFA 1ZDVA 4K7UA 2K6DB 1F77A 3WIMA 4XWWA 4GIVA 3RFZB 1ZDXA 3EA6A 3RPFC 2PLPA 1STEA 3VTWA 3GS2A 1E0ZA 3UIPB 4WWOA 1T0YA 2WYQA 2AEHA 3B2FA 1ZXIA 1IUEA 3JSVA 3FILA 2CHZA 4NAMA 4P1CC 4RF0A 1XQQA 3DBLI 4RMAA 2G45B 1V8CA 4YSXB 1UH6A 1FXTB 5AUKA 1YN4A 1HTOA 1YOVB 2C7MB 2KACA 3JSVB 3FILB 1L0XB 4LJPB 5HG2A 4OZAA 3KQ4A 5AZFA 4G3XB 2EELA 3BINA 4DHZE 2INPE 3N1XC 3RUIB 1IYFA 1SE3A 1V81A 3AU4A 2I1KA 2KQSA 3MFGA 2B3AA 2WNMA 2UWQA 1E7VA 3BVMA 1ZUD2 2NBVB 1KLVA 4P16A 3DPDA 2J7QB 4LLGM 3WA0A 4HDOA 3Q8AA 2BWES 1V86A 1ZE3D 2IO0B 1FRRA 2ZNVC 4ANXA 3AEAB 3A33B 5CHWA 1WF9A 2KX3A 4NAWA 2MWSB 2WXNA 5FK9C 3M3JA 2N9XA 3N1ZC 4MACA 2L83A 3B0AA 3J9CA 2WXRA 2RSUA 2KANA 2X38A 3WAMA 2RDHA 3H7PA 4I6NB 4KZCA 1XLQA 2NBWB 3V61A 2NPTB 1GB1A 2JF5A 3E9SA 5DPRA 1KFYB 3BYTB 3JVZX 3H7PB 2GLSA 3U7ZA 3RNEC 4DBGA 2G9HD 2N9PC 4HJGE 3N9YC 4S17A 1KF6B 2SEBD 3ENEA 1LM8B 2WU5B 1KLUD 1VD2A 2BT6A 5MPOA 1E7PB 1NBFC 3AV8A 4C00A 2AWTA 2KFKA 4NJCA 1B9RA 4WQOB 1I4QA 2W3RA 2BGFA 3EHVA 4P1BC 1T0SC 3ZW3A 3MTNB 1WJ6A 2KFKB 3R7RA 5IKCM 1K51A 3RZFA 1NI2A 4RH6A 5IN7A 3AE4B 3RNFC 2KJRA 2REXA 2PIAA 3KUZA 3NVVA 1R4NI 4B6WA 4EZLA 3TEWA 3I3TB 3U30A 4HPPA 4JE3B 1FM0D 3EGRA 1WFYA 4NQLB 2BF8B 4URKA 4NY0A 1Z2MA 5L95C 4PK1A 3R2TA 3A4RA 1D6EC 2K8HA 1ZP0B 2JYTA 3SR6A 3TJPA 2EKIA 5JHBA 1WXQA 4WH4A 3RN9C 4ACFA 5DPWA 4MJSA 1TS5A 2V0GA 1XXGA 1SXTA 1EU3A 3ECIA 3V60A 3AECB 4EKUA 4TSSA 4MJSB 3SEBA 1C3TA 4WJPA 1C77A 2FUHB 2PVOD 2K0PA 2KWUB 2WXJA 2L52A 3QC8B 2LGXA 5E6JA 1V5OA 3W1YA 1SIFA 4TV3A 1J7BA 3PZ8A 3NVWA 3PT2B 3ZXVA 3LYYA 4OVUA 3AE5B 2ZW0A 1FXIA 1HA5A 1LGRA 2KYWA 1F52A 2MEKA 3Q8BA 2KKCA 1L6UA 2ZCBA 3AB5A 1T0QC 1VDVA 5CX3A 3H1UA 4RF1A 1QLBB 3KYCD 2CU1A 2PE6B 3VRAB 2KDEB 2VH1A 2TSSA 2LASA 1TZ1A 3UIOB 4WAAA 4K3BA 3PSEB 2IY0B 1UNSA 3Q3OC 2KAJA 4HK2A 3AULA 4KX6B 3R2IA 3CSFA 3WAPA 4MSMB 3R3MA 2FCSA 2YEPF 2KJ6A 2WXLA 3AMZA 4ICVA 3C8YA 1F9JA 2RR9A 2CS4A 2K22A 2D10A 1J19A 1FNVA 3NG0A 4AOFA 2ZVNA 2G4DB 2LFIA 1SJED 3HM6X 5BYRA 2Y5BB 2O2VA 4N59A 3JYUA 3T8MA 2CU3A 3V6CB 2JPHA 1BMLC 2O2VB 3QAQA 2LGIA 3M62B 1WMHB 2MBOA 3PLVA 2JWZA 4UDUC 4ZOHC 5CTRC 4PT5A 3GOEA 4ZRPA 1LQBA 2FBWB 2LGYA 4GU2A 2DYMA 5HKHA 3IFWB 3MC9A 4JQWC 3VDZA 2E6XA 2IY1B 1WXSA 2OHFA 2XEWA 4KSLC 1J7CA 4IDIA 1I4PA 1TGZB 1PGAA 2N4FA 1MFWA 4WAFA 5HFYA 1Y56A 2ZVOA 3O65B 1WM3A 3U8ZA 3WCQA 5C3JB 4BOZB 4R3DA 2MBQA 1MG8A 1M94A 2GBMA 1MG4A 2GBKA 4HKZE 2QHOA 4IKGA 2PJHA 4KDIC 3Q3JA 4MELA 4C4VA 1MVKA 4WIPA 1ESFA 2FIFA 1UWXA 5EE1A 2BVCA 3AE6B 3IVFA 4DXFA 2C5LC
chains in the Genus database with same CATH topology
1E10A 1SB3C 1DOIA 2LMCA 1NI3A 1YJJA 5C2TB 1SE4A 5T8IA 4A55A 1SJHD 1IGDA 3EUB2 3IXSA 4XDDA 1TKEA 1BUIC 1KH0A 4IOIE 3VR8B 2NTTA 2J52A 2LHDA 1D4BA 4OHJA 1VJKA 2MJEA 1JWSD 2N0SB 4RGTA 1C78A 2Z8LA 2J42A 4NAWB 2J4XA 1DOXA 2I2YA 4TQ1A 3B2GA 1L4ZB 1GAQB 1QOAA 4LTUA 4XE0A 1C4CA 4C7ZA 3AE2B 4KGSA 2WXPA 5HHDG 1A70A 1TZOA 2L32A 2AQ2B 1D5MC 3FAHA 5FR3A 4DXGA 1RFKA 2IDYA 3AH7A 1AN8A 2Q5WD 2JZPA 1NENB 2Y5CA 2QMTA 3AE7B 1CQVA 1FFUA 1PGBA 3CIRB 2BTEA 2WDQB 3HRDD 2DYOA 1FD6A 2R61A 1L6VA 2HTME 2JSVX 5TSSA 1YJIA 1I4HA 1C4AA 1OQRA 1NYQA 1V1PA 4HKQA 1C4PA 3BYYB 2BYTA 1ENFA 2PTLA 1KRHA 1YMHE 1V97A 4ARCA 3ZJUA 2D5GA 1PYWD 1FO4A 4HROA 2LEKA 4KGRA 1XO3A 4C56C 3P4RB 1V1PB 2K3UA 1NVID 1GPXA 4ARIA 3W2DA 1JMLA 3I9V1 4XDCA 1HZ6A 1ZDVA 1QOFA 2HDEA 4D2KA 1JW9D 4XWWA 1F77A 4L1BA 3AEBB 3RFZB 1JCKB 1ZDXA 4OVZA 1DGJA 1FXAA 3EA6A 4WQMA 2FE8A 4A6QA 3AEDB 4YXDB 4YT0B 3RPFC 2PLPA 5D7GA 1STEA 2WXHA 3AE8B 2N9LA 3GS2A 3IT6B 4AS1A 1E0ZA 4FXCA 1FMAD 2GB1A 2LHEA 1L0VB 5HI1A 3B2FA 1ZXIA 1LO5D 2ON8A 1IUEA 1T6BX 1AYFA 3FILA 4NAMA 4RF0A 3MHZA 1NEKB 1V8CA 4YSXB 3T3OA 2BS2B 5AUKA 1YN4A 3NVZA 2RDGA 1HEZE 2WXMA 2KACA 3FILB 1L0XB 5HG2A 4OZAA 4WURA 3KQ4A 1WSPA 1N5XA 4JWUC 1JALA 3VQIA 1FCLA 3SFEB 2W82A 2EELA 1F2RI 5EE9A 2INPE 1YQ4B 2MJ3A 1PGXA 2ACZB 3ETRA 1IBXB 1SE3A 2M19A 1KTKA 4N58A 2GRIA 4O1NA 1CZPA 1XCQL 1I7HA 3AE3B 1SE2A 3MFGA 1N61A 3GB1A 2WNMA 4EE2A 1E6EB 3BVMA 4GDLB 1ZUD2 1RWSA 4P16A 2V4IB 2OEDA 2YEPB 1JROA 3P1MA 3ABVB 4LLGM 4USAA 3Q8AA 1MHXA 1ZE3D 3BZDB 1FRRA 4CQNA 4RCOA 1TJEA 1FNWA 3AEAB 2FUG1 2QEJC 1D5ZC 1N63A 4XWTA 3BK1A 2JYEA 4J3OD 2WLBA 3NZ3A 1TY0A 4YTMB 2DLBA 2WXNA 2W54A 5FK9C 4MACA 2KN4A 3W9CB 2L83A 2QSDA 3J9CA 2WXIA 1JWMD 2WXRA 3R8BA 1OFFA 2BBCA 3AM9A 2PMVA 2X38A 4RGNA 3W5UB 1F0ZA 2KWDA 2RDHA 1XLQA 3BIID 3TUOA 2IJ0A 1V1OA 4ZRQA 1DOYA 1GB1A 2AQ3B 3IAS1 3E9SA 1I4XA 1KFYB 1CK1A 3BYTB 1EM7A 2BB5A 2IGGA 1EWYC 1C76A 4TMAB 3U7ZA 3Q8EA 1SIJA 1L0YB 1ZPSA 2G9HD 2ONQA 1ET6A 4A9AA 3LXFA 2LJIA 3CWIA 4HJGE 1WWTA 4ZHOA 3N9YC 4JWSC 1VZ6A 2BW2A 4LK0M 1FCCC 1EWCA 1K50A 1KF6B 1QILA 2SEBD 2JXTA 3P42A 2WU5B 1KLUD 4TQ0A 2BT6A 5MPOA 2M56B 1E7PB 1N5WA 5H8YE 3AV8A 3U4EG 4NJCA 2MJDA 5FKAC 3AE9B 1B9RA 4YWGG 1I4QA 2W3RA 3TEZA 4RNAA 1YNTE 2E3TA 4HRSA 1SBBB 2KDMA 2RMMA 2XNAC 3T3NA 1YN5A 2G1EA 3I57A 1T3QA 4B0MA 3V05A 1WRIA 1K51A 2RPVA 1P7FA 2PVGC 2WXGA 4A90A 4M0WA 4HEA1 4RH6A 1ZOYB 3AE4B 2H89B 4OZCA 3DWMA 3AEEB 1CJEA 2PIAA 2JX5A 4YTPB 1XEEA 2QJLA 3NVVA 2Y3AA 3TEWA 1QOBA 2GI9A 1WYGA 4JE3B 1FM0D 1JWUD 1L4DB 3AEGB 3EGRA 3E56A 1ROEA 2CJOA 2CJNA 3HUIA 2N9KA 1GB4A 4Q2JA 3B9JA 1QQRA 2AQ1B 1IBXA 3P63A 2H88B 1JWAD 4WWMA 3KWVA 4MH8A 3R2TA 3BWUD 1D6EC 1SSNA 2PW9A 4JX1C 1QOGA 3HVZA 1VRAB 1UGJA 1ZP0B 2JYTA 3SR6A 2EKIA 3AE1B 1RYJA 5G5HA 1WXQA 1C9FA 1XCTL 4WH4A 3UI3A 2V0GA 1TS5A 1I4RA 1UWMA 1XXGA 1HQRD 1SXTA 2WXOA 1I4GA 1EU3A 2VZKB 1TS4A 3AECB 4RFBA 2BS4B 5BMHA 1L5PA 1RM6C 4RGOS 1ET9A 4TSSA 3SEBA 4YTNB 1HZ5A 5GXGB 1YQ3B 1C77A 4KGTA 5H92C 2PVOD 2K0PA 1TYGB 2WXJA 2L52A 1IGCA 3NUHB 4L2YA 1TY2A 2I38A 2WDVB 2XN9C 5E6JA 4P6VF 3AN1A 3TEXA 4KKJA 1J7BA 3PZ8A 1KLGD 1E9MA 3NVWA 2KQ4X 3LYYA 3U52E 1TS3A 2ICIA 3AE5B 2ZW0A 3VRBB 1FXIA 1PUTA 2QIEB 2PKOA 1HA5A 1VZ8A 1F2RC 3W1SA 2B76B 2JQRB 2MEKA 4B0EA 3Q8BA 1L6UA 3ZJTA 3AB5A 5AUIA 1B1ZA 1VDVA 1ZXHA 3GP7A 1SEBD 2N7JA 2BS3B 2MH7A 3V3XA 2NTSA 1MPEA 1SF0A 3IT4B 4RF1A 1AWDA 2K9XA 4L23A 1QLBB 2JWUA 2WXQA 3TEYA 3HVDA 4GLSC 4A8XC 4JPSA 4OW0A 3MC0B 3VRAB 3ZYYX 2KMMA 2Y5PA 2TSSA 2V3NA 4ZYSA 3KWLA 4N6EB 1J7AA 1EU4A 1MHHE 4KKIA 4MT5A 1TS2A 2NMQA 3W5VB 5JXVA 2J53A 1UNSA 1NYRA 2AX5A 2WXKA 2KAJA 2WU2B 4H2AA 5D3DA 1VR9A 4KX6B 3R2IA 3MJ5A 3OWEB 1T5XD 2WQYB 4REZA 1JQ4A 1PDXA 3O13A 5BYSA 1YN3A 1BXTA 1DYQA 2YEPF 2VZKD 1XF5L 2IGDA 4US9A 2WXLA 3AMZA 2WS3B 2LUMA 3C8YA 3ZJVA 1XLPA 3VR9B 1GOZA 3ZQ4A 4C7YA 2K22A 2SAKA 2L1AA 2WDRB 3LB8C 4GDKB 1AW7A 1FNVA 1K53A 3Q8CA 5BYQA 3SFDB 5EE0A 1FFVA 5I4DA 4AQ7A 1XLNA 3L4PA 2INNE 2LFIA 3Q69A 5BMIA 1ACCA 1TKGA 1SJED 1OQQA 3P4SB 5BYRA 1TKYA 4N59A 5D3IB 3ZGZA 5EE3A 5G5GA 1XLOA 1FNUA 3URYA 2BB6A 2CU3A 3IAM1 3NS1A 1FIQA 5LNK1 1QKZA 1BMLC 4US8A 3KLSX 2ZW1A 4C80A 2JU6X 1JWBD 2IGHA 2LGIA 4YSZB 1D5XC 3BK2A 1FEHA 1C79A 2W3SA 1K52A 1QF6A 3AEFB 2QILA 3DWGC 4UDUC 1M4VA 3TSSA 1R7SA 3PO0A 3NRZA 4ZOHC 3P4PB 1UUPA 4PT5A 4ZRPA 2FBWB 3NVYA 1HXYD 2DYMA 2E6XA 3P4QB 4RGMA 3BVZA 2OHFA 1P7EA 5BMGA 1J7CA 2V3PA 3BVGA 4IDIA 1MI0A 1I4PA 1Q10A 1PGAA 4ZHPA 4ITKA 5HFYA 4WAFA 1Y56A 1FRDA 3WCQA 1VLBA 5C3JB 1N60A 2K5PA 4R3DA 2DBYA 3H8HA 3FC4A 4HKZE 1N62A 1JRPA 4IKGA 1WGKA 2M0AA 2IPKD 4OZBA 4YSYB 1QT9A 2WP9B 1PFDA 1MVKA 1VZ7A 3PZ7A 2DWQA 4MM3B 4NZLB 1ESFA 4WIPA 1UWXA 3MP9A 5EE1A 2W55A 3AE6B 4DQOC 2WXFA 4DXFA 3Q8FA 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCQ L;  1XF5 L;  2IGD A;  1IGD A;  3GB1 A;  4IOI E;  1KH0 A;  2N9K A;  1GB4 A;  2J52 A;  2LHD A;  2LUM A;  1D4B A;  1IBX A;  2OED A;  1MHX A;  2I2Y A;  2PW9 A;  1K53 A;  4KGS A;  5HHD G;  5BMI A;  1C9F A;  1XCT L;  4WH4 A;  2JZP A;  3UI3 A;  2QMT A;  1PGB A;  1FD6 A;  4MAC A;  2JSV X;  2KN4 A;  2QSD A;  5BMH A;  2KWD A;  1QKZ A;  1HZ5 A;  2PTL A;  4KGT A;  1YMH E;  2ZW1 A;  2JU6 X;  2LGI A;  2IGH A;  2K0P A;  1K52 A;  1GB1 A;  1IGC A;  4KGR A;  2I38 A;  1EM7 A;  2IGG A;  1JML A;  2ONQ A;  2KQ4 X;  1HZ6 A;  4HJG E;  4D2K A;  2ZW0 A;  1FCC C;  1F2R C;  1K50 A;  1P7E A;  2JXT A;  5BMG A;  2PLP A;  1ZXH A;  1MI0 A;  1Q10 A;  2N7J A;  2N9L A;  1PGA A;  3V3X A;  5HFY A;  1MPE A;  2JWU A;  4GLS C;  2GB1 A;  2LHE A;  5HI1 A;  2ON8 A;  1YNT E;  3FIL A;  2RMM A;  2KDM A;  4HKZ E;  1K51 A;  2RPV A;  1P7F A;  4IKG A;  1MHH E;  2NMQ A;  1HEZ E;  2KAC A;  4OZC A;  5JXV A;  3FIL B;  2J53 A;  5HG2 A;  4OZA A;  4OZB A;  1FCL A;  2EEL A;  1F2R I;  1MVK A;  1PGX A;  1IBX B;  1UWX A;  3MP9 A;  2GI9 A; 
#chains in the Genus database with same CATH topology
 3MHS D;  1YJJ A;  3QA8 A;  5C2T B;  4HCN B;  5T8I A;  2D3A A;  4BZA A;  1WH3 A;  4EEW A;  3VR8 B;  2NTT A;  1D4B A;  2IO1 B;  4OHJ A;  1VJK A;  2MJE A;  1JWS D;  2N0S B;  4RGT A;  2RDB C;  1E7U A;  1DOX A;  3C19 A;  1IP9 A;  3KYD D;  1L4Z B;  1C4C A;  1OGW A;  1TZO A;  1LFD A;  3R7Q A;  3DOW A;  5DPS A;  2Q5W D;  2GBJ A;  1NEN B;  2JZP A;  2Y5C A;  3AE7 B;  3CIR B;  2DYO A;  4CYE A;  3L0W B;  2LJ5 A;  3L08 A;  2HTM E;  4GGQ A;  4PS7 A;  4JIO U;  3ZKJ C;  3KW5 B;  5TR5 A;  4OVV A;  2LVO A;  2J0K A;  3CST A;  3PPA A;  2PTL A;  4ARC A;  3ZJU A;  2D5G A;  1PYW D;  4KGR A;  3P4R B;  3A4S C;  1NVI D;  3VXW A;  5IP4 D;  1JML A;  4NJ7 A;  4XDC A;  1HZ6 A;  2HDE A;  2NCN A;  2UYZ B;  5C1Z A;  4D2K A;  1WZ3 A;  4L1B A;  3AEB B;  4OVZ A;  1DGJ A;  4A6Q A;  4ZRI A;  4YXD B;  4YT0 B;  2WXH A;  2A4Z A;  2N9L A;  3NHE B;  1WXA A;  2BWF A;  4FUL A;  5IA7 A;  1FMA D;  2KC2 A;  5HI1 A;  4IM2 A;  5J17 A;  4BKS D;  2ON8 A;  4EZJ A;  1UZX B;  3N20 C;  2KTR A;  3NY5 A;  1N5X A;  4B95 A;  1FCL A;  2W82 A;  1F2R I;  5EE9 A;  1YQ4 B;  3PRM B;  1PGX A;  2ACZ B;  1UF0 A;  2KTR B;  1CZP A;  1XCQ L;  1I7H A;  3AE3 B;  4XX5 A;  2ZCC A;  4NQK E;  2NS5 A;  1P1A A;  2C60 A;  2IBI B;  3A1Q A;  2GOW A;  1RWS A;  2V4I B;  1JRO A;  4KV2 A;  3CF6 E;  3A1Q B;  1FNW A;  5IOI A;  1D5Z C;  1N63 A;  4J3O D;  1S3S G;  1TY0 A;  4YTM B;  2DLB A;  3W9C B;  2WXI A;  1RLF A;  1JWM D;  2GBN A;  3AM9 A;  2D3B A;  1VCB A;  4PS3 A;  3LJ3 A;  2IJ0 A;  2DZK A;  2KVZ A;  3PRP B;  1I4X A;  1CK1 A;  2IGG A;  3QAR A;  3L17 A;  4TMA B;  1UBQ A;  4A9A A;  3CWI A;  2LGS A;  1WI0 A;  1VZ6 A;  1K50 A;  1QIL A;  3P42 A;  2M56 B;  5J2R A;  1JRU A;  1N5W A;  1WM2 A;  3U4E G;  2LVQ A;  2MJD A;  3AE9 B;  4AWJ A;  1OTR B;  4AUQ C;  4TKN A;  1G6J A;  1NDD A;  4WJQ A;  4HRS A;  2RMM A;  2XNA C;  1YN5 A;  2KC1 A;  3EC8 A;  3EFU A;  4B0M A;  3V05 A;  2RPV A;  4IWP A;  2WXG A;  1RRB A;  4OZC A;  3AEE B;  2ZZP B;  4YTP B;  1XEE A;  1E8Y A;  2PEA A;  2HTH A;  3VFK A;  3PHX B;  4E74 A;  1QOB A;  3ONS A;  3ZNG C;  4W9E A;  1L4D B;  3AEG B;  2BKF A;  4IWO A;  3HUI A;  2N9K A;  3H6N A;  1GB4 A;  4Q2J A;  3B9J A;  4MGI E;  1QQR A;  2ZPN A;  3X23 A;  5CHF A;  3DBH I;  4FHK A;  3GE8 C;  2KMA A;  1UGJ A;  4DHZ B;  3Q2A C;  1RYJ A;  2L8J A;  4GB9 A;  2DAJ A;  1D3Z A;  1I4R A;  4JLC A;  2JVC A;  2INC C;  5BMH A;  1L5P A;  1HE8 A;  3EFC A;  1WGD A;  2D07 B;  5GXG B;  1YQ3 B;  5H92 C;  2D2Q A;  1IGC A;  3NUH B;  2I38 A;  2XN9 C;  4EUT A;  4LNO A;  4P6V F;  5GMV A;  2LUE A;  1E9M A;  2KQ4 X;  3Q3F A;  2MX2 A;  3U52 E;  1TS3 A;  3OLM D;  2QIE B;  2NPT A;  4DXA B;  4ZDV A;  3W1S A;  2JQR B;  3DBL B;  1B1Z A;  2MH7 A;  3V3X A;  3IT4 B;  4GXB A;  2JWU A;  3UIN B;  3TEY A;  4GLS C;  3RYT A;  1WE6 A;  4A8X C;  1WR1 A;  1YX6 B;  5C23 A;  3ZYY X;  1GNU A;  2M4N A;  3KWL A;  4II2 B;  2FAZ A;  4E71 A;  2CKH B;  3VTU A;  1TS2 A;  2NMQ A;  2M1M A;  3EEC A;  2J53 A;  2AX5 A;  4ZYN A;  2MBE A;  4NPN A;  5D3D A;  1VR9 A;  2HD5 B;  3MJ5 A;  1T5X D;  2WQY B;  1JQ4 A;  1YN3 A;  2KDF B;  2VZK D;  2IGD A;  4US9 A;  2WS3 B;  4ICU A;  2LUM A;  1XLP A;  3VR9 B;  1V5T A;  2UU7 A;  3ZLZ A;  2KD0 A;  1KM7 A;  2MW5 A;  3Q8C A;  5BYQ A;  1FFV A;  4AQ7 A;  1XLN A;  5LLI A;  3Q69 A;  5BMI A;  4W9I A;  3K9O B;  4BVU C;  2LRW A;  3GE3 C;  5D3I B;  2CHX A;  3ZGZ A;  3NS8 A;  5EE3 A;  5G5G A;  1E8X A;  2WX1 A;  1FIQ A;  2KWC A;  3IBE A;  3V6E B;  3KLS X;  4YSZ B;  2IGH A;  3RZW C;  1FEH A;  1C79 A;  5JZE B;  4G0N B;  1K52 A;  4IM0 A;  3TSS A;  3DWG C;  1U4A A;  1M4V A;  3NRZ A;  4ZRK A;  1WGY A;  4WJO A;  3P4Q B;  4RGM A;  1V80 A;  3NZU A;  3BVZ A;  3H9D A;  4K7S A;  3BVG A;  1MI0 A;  2KVR A;  2KT7 A;  4ITK A;  3DQV A;  3PHW B;  1A5R A;  2WWZ A;  4E3C A;  2LD9 A;  1E8W A;  1R4N B;  3H8H A;  2KWV B;  3L54 A;  1KJT A;  2HJ8 A;  1N62 A;  1JRP A;  4MM3 A;  2WDT B;  4RM8 A;  2ZEQ A;  2C9W B;  1PFD A;  2FCN A;  2DWQ A;  4MM3 B;  4NZL B;  4BKS A;  4W9L A;  4CO7 A;  3Q8F A;  3VTV A;  2KTF A;  1ZKH A;  4W9J A;  3Q6B A;  1E10 A;  3I63 C;  4BAX A;  1DOI A;  1NI3 A;  1SGH A;  3QCA A;  2PPH A;  5BO4 B;  5KHO A;  2K39 A;  3IXS A;  4XDD A;  4I6P A;  1WZ0 A;  2LHD A;  3DBR I;  4X57 B;  2J4X A;  4W9H A;  2ZPY A;  1WR6 E;  4TQ1 A;  3B2G A;  4XE0 A;  1WX7 A;  2JT4 B;  1XT9 B;  5HHD G;  2L32 A;  3FAH A;  4MH0 E;  5FR3 A;  5IAA C;  1RFK A;  1R4M I;  2IDY A;  1H4R A;  1CQV A;  3RNA C;  1FD6 A;  4PYU A;  4M02 A;  2R61 A;  2JSV X;  1YJI A;  1UD7 A;  1I4H A;  3NOB A;  4DDG D;  3SHQ A;  4M00 A;  1C4P A;  2BYT A;  1ENF A;  2XK5 A;  2LXC A;  1GJZ A;  2L7R A;  4W9C A;  2BYE A;  4HRO A;  1FO4 A;  1XO3 A;  1V49 A;  2K3U A;  3OJ3 A;  2NBU A;  2XK5 B;  4MGK E;  4PYZ A;  1GPX A;  4ARI A;  3I9V 1;  1QOF A;  4XGA B;  1MJD A;  1WMH A;  1JCK B;  1WRD B;  4WQM A;  2FE8 A;  3AED B;  5D7G A;  2KO3 A;  3AE8 B;  1WJN A;  1P9D U;  4FXC A;  5CHV C;  3DBR B;  3DCG A;  2LHE A;  2KZR A;  3RD2 A;  3ZRF A;  2V1Y A;  3Q3N C;  1LO5 D;  1T6B X;  1AYF A;  4HPM B;  1NEK B;  3T3O A;  1XD3 B;  3NVZ A;  5G2N A;  2WXM A;  3PRE A;  4WUR A;  1GG3 A;  1WSP A;  4JWU C;  1JAL A;  3VQI A;  1IBX B;  1UEL A;  2M19 A;  1KTK A;  2QDF A;  2GRI A;  4O1N A;  3PZD A;  3M95 A;  4DHJ D;  3PTF C;  3GB1 A;  3DVG Y;  2AYO B;  1E6E B;  4GOC A;  2YEP B;  3P1M A;  3DHH C;  3APC A;  1Y8R C;  4YL8 A;  3L16 A;  3BZD B;  4G50 A;  2K6Q A;  3N1Y C;  2W9N A;  2FUG 1;  5DCN A;  4W9F A;  2QEJ C;  3BK1 A;  2JYE A;  1WGG A;  2AL3 A;  3ZNZ B;  3RNC C;  2LGD A;  2KN4 A;  1E8Z A;  2FCQ A;  3R8B A;  2PMV A;  4EZK A;  2EKE C;  2KWD A;  3Q3M C;  2J0J A;  3X0W A;  3BII D;  5E6O A;  3TUO A;  1WGH A;  4ZRQ A;  1DOY A;  3PGE A;  2AQ3 B;  1LXD A;  2BB5 A;  2BPS A;  1L0Y B;  1ZPS A;  2I1J A;  2ONQ A;  1ET6 A;  4QAY A;  2LVP A;  1WWT A;  3D32 A;  4JWS C;  3R66 C;  4LK0 M;  1FCC C;  1ZW7 A;  2DZM A;  4AJY B;  5KHQ A;  3QHT A;  1V9J A;  2OOB B;  2N1V A;  2K8C A;  5FKA C;  3TEZ A;  4P7I A;  2JZ3 B;  4RNA A;  3KUD B;  4WWP A;  4KIK A;  1SBB B;  2KDM A;  3T3N A;  3I57 A;  4HJK A;  1T3Q A;  4MGZ E;  1Q5W B;  3QQ8 B;  3TBL D;  2RPQ A;  2PVG C;  4A90 A;  1ZOY B;  3VUW A;  2AL6 A;  2H89 B;  3DWM A;  4KIK B;  5D94 A;  2GMI C;  2MBH A;  2JX5 A;  3IHP C;  2QJL A;  4NJ6 A;  3GZN I;  1P98 A;  1WYG A;  2GI9 A;  3TL5 A;  1JWU D;  3PRZ A;  2KDB A;  4FBJ B;  1P0R A;  2DX5 B;  2CJO A;  2CJN A;  4S0R A;  1GUA B;  3P63 A;  1JWA D;  4WWM A;  3KWV A;  1N6Z A;  3BWU D;  2PW9 A;  2YVC A;  1QOG A;  1VRA B;  4LNF A;  4RM9 A;  1X1M A;  1C9F A;  1XCT L;  3UI3 A;  1UWM A;  4B9K A;  3ZTD A;  1WXM A;  1HQR D;  2WXO A;  3HK0 A;  2DEN B;  4J6I A;  2XBB C;  2VZK B;  1WE7 A;  1RM6 C;  4RGO S;  1ET9 A;  2L00 B;  1HZ5 A;  4KGT A;  3ZNH B;  2YLM A;  1TYG B;  1TY2 A;  1RFA A;  2K8B A;  2WDV B;  3ZDM C;  3A9K A;  4MGY E;  4KKJ A;  2Z0D B;  2O6V D;  4EOY A;  2EMT A;  2LWP A;  4XYC A;  1F2R C;  4N9F 4;  2B76 B;  2DZJ A;  3A9K B;  4B0E A;  2ASQ A;  3GP7 A;  3N3K B;  2MBB B;  2KOX A;  2NTS A;  1SF0 A;  1AAR A;  3V62 A;  1AWD A;  2K9X A;  4L23 A;  2WXQ A;  3HVD A;  2QCZ A;  4NNJ B;  4JPS A;  4OW0 A;  3MC0 B;  2LZ6 A;  2N9E B;  1TT5 B;  2V3N A;  3HIZ A;  1J7A A;  2LI5 A;  1MHH E;  3TMP B;  4KKI A;  5AZG A;  3W5V B;  5G55 A;  2WXK A;  1EF5 A;  2M17 A;  2WU2 B;  2K1F A;  3OG5 A;  1PDX A;  3O13 A;  3QIJ A;  5BYS A;  1DYQ A;  2KDI A;  4GMV A;  3T9L A;  4GDK A;  1E5W A;  2CR5 A;  2WX0 A;  4K3C A;  3ZJV A;  1UBI A;  3H7S A;  1GOZ A;  4C7Y A;  3FKY A;  2SAK A;  2L1A A;  2WDR B;  3LB8 C;  2V9H A;  4IG7 B;  4GDK B;  1AW7 A;  2DNF A;  1K53 A;  3NJT A;  2INN E;  1ACC A;  1TKG A;  4BBN F;  1OQQ A;  1XLO A;  3C0R B;  3PVL A;  5D2M B;  2G3Q B;  1K8R B;  2BB6 A;  3NS1 A;  1QKZ A;  3TCA A;  4US8 A;  2ZW1 A;  4C80 A;  4ANW A;  1JWB D;  1D5X C;  4BKG A;  2W3S A;  1OQY A;  3OAW A;  2G4S A;  2DHZ A;  1C1Y B;  1UUP A;  5IO9 A;  2IO2 B;  2WGS A;  4DK5 A;  3DBS A;  4F8C B;  1P7E A;  1T0R C;  2OJW A;  1Q10 A;  1Q1O A;  4BBN C;  4ZHP A;  2ZJD A;  2KHW B;  1TIF A;  2KLC A;  1H8C A;  4M8N A;  4FJZ A;  2C7H A;  2K5P A;  2A5U A;  2N7D A;  2DBY A;  3W1S C;  1L7Y A;  3UGB B;  4LNI A;  5EDS A;  4XZ4 A;  4AP4 C;  3I5J C;  1WGK A;  3PS6 A;  1TTN A;  2M0A A;  3ZIM A;  2LRU A;  4IC7 B;  1QT9 A;  3WAN A;  1VZ7 A;  3PZ7 A;  2W55 A;  2IND C;  2WXF A;  2V4L A;  3DBH B;  1SB3 C;  2VRR B;  3RNB C;  1I42 A;  1SJH D;  4TUU A;  3EUB 2;  4IOI E;  1OEY J;  2FID A;  2GBR A;  1WY8 A;  2ZNV B;  4BFR A;  1V6E A;  2J42 A;  4NAW B;  4W9K A;  4LJO B;  2I2Y A;  3B1L X;  4KVG B;  1GAQ B;  1QOA A;  4MEM A;  4C7Z A;  1A70 A;  4ANU A;  1P3Q U;  1D5M C;  2MHJ A;  4ASW C;  4DXG A;  3ML8 A;  4EFO A;  4LDT D;  3DVN V;  1FFU A;  2BTE A;  4HXD A;  2WDQ B;  4AJW A;  4DWF A;  4CHK A;  5TSS A;  4DHJ B;  2N7E A;  5FR6 A;  4HDQ A;  1V1P A;  5L83 A;  2WHI A;  3BYY B;  3NZS A;  3L10 B;  1KRH A;  2JUO A;  2LEK A;  3RMK C;  1V1P B;  4LNN A;  4HWI B;  4A3P A;  1BT0 A;  3AU5 A;  3APF A;  1JW9 D;  3WAO A;  1FXA A;  3CMM B;  3KH0 A;  2D11 A;  3TIX A;  4HVB A;  3IT6 B;  2BYF A;  4AS1 A;  2V3S A;  3L13 A;  2GB1 A;  5J18 A;  3RT3 B;  1L0V B;  2Z59 B;  3KUC B;  2KX0 A;  3MHZ A;  2K25 A;  3ZRC A;  4FJY A;  2IZV B;  1QZE A;  2BS2 B;  4HPL B;  2RDG A;  1HEZ E;  2MRP A;  1J0G A;  2NR2 A;  4MDK E;  3S2A A;  3SFE B;  2MJ3 A;  3ETR A;  1WGR A;  4N58 A;  2JRH A;  4GDL A;  2JRI B;  5AEK B;  1SE2 A;  1RAX A;  1N61 A;  4A3O A;  4EE2 A;  3JW0 X;  3RI7 C;  4GDL B;  2OED A;  4MSQ B;  1EO6 A;  3ABV B;  3RUL A;  2RGF A;  3WAL A;  4USA A;  4BOS C;  1MHX A;  3ZXR A;  5LXH A;  3U7D A;  2L76 A;  4CQN A;  4RCO A;  1TJE A;  4XWT A;  3ALB A;  2WLB A;  3NZ3 A;  2W54 A;  2QSD A;  1OFF A;  3PLU A;  2BBC A;  4RGN A;  3W5U B;  3VH4 B;  4HLE A;  1F0Z A;  3ZO5 B;  1YJ1 A;  2KFJ A;  4LNK A;  4FAD A;  4ZRJ A;  3OJ4 B;  1V1O A;  2D3C A;  2MLB A;  3IAS 1;  1EM7 A;  1EWY C;  1C76 A;  3Q8E A;  2LXA A;  2HE7 A;  1SIJ A;  3IG3 A;  2FCM A;  2C7N B;  3LXF A;  2LJI A;  3VH3 B;  4ZHO A;  2KQ7 A;  3UQA A;  2BW2 A;  1EWC A;  2JXT A;  3DHG C;  4WWN A;  1S1Q B;  4TQ0 A;  3K9P B;  4ANV A;  3VVW B;  5H8Y E;  2MCN B;  1ZGU B;  4YWG G;  2O6V A;  1YNT E;  2E3T A;  4FHJ A;  3VAW A;  2MSE D;  2G1E A;  1WYW B;  1SE9 A;  1WXV A;  1WRI A;  1P7F A;  2O6V B;  3MJW A;  4M0W A;  4HEA 1;  4JL9 A;  1CJE A;  3AXC A;  2CHW A;  4FLH A;  4M0W B;  1EUV B;  2Y3A A;  1L2N A;  1I35 A;  1GC7 A;  1E90 A;  2QC8 A;  3E56 A;  2KJH B;  1ROE A;  1R4M B;  1YIW A;  2AQ1 B;  1IBX A;  3MC8 A;  1PQS A;  2MP2 A;  4W9G A;  2H88 B;  2Z0E B;  4MH8 A;  1SSN A;  4JX1 C;  3HVZ A;  3ZTC A;  4IW0 A;  2MP2 B;  3QX1 A;  3AE1 B;  5G5H A;  4FJV B;  1UGM A;  3N30 A;  3UQB A;  3ZNI D;  1I4G A;  1TS4 A;  4RFB A;  3VHT C;  4G11 A;  2BS4 B;  4GSW A;  4K7W A;  4YTN B;  5AZH A;  1YQB A;  2N1W A;  3VUY A;  4L2Y A;  3AI5 A;  1WJU A;  3SU8 X;  1V2Y A;  3AN1 A;  3TEX A;  1KLG D;  2EMS A;  2ICI A;  4FN2 A;  3VRB B;  1PUT A;  2PKO A;  2MQJ A;  1VZ8 A;  3VUX A;  2D3G A;  2BYV E;  2JZZ A;  3ZJT A;  5JHA A;  5AUI A;  1ZXH A;  1SEB D;  2L0F A;  5D6J B;  2N7J A;  2BS3 B;  1MPE A;  3QK0 A;  2FNJ B;  2L3Z A;  1WX8 A;  3QJZ A;  2KN5 A;  4C4V B;  4IWQ A;  2J0M A;  1WJ4 A;  2KMM A;  2Y5P A;  2JXX A;  1GC6 A;  4ZYS A;  4N6E B;  1EU4 A;  3RCZ A;  2RD0 A;  4MT5 A;  3RNG C;  4K81 A;  1IPG A;  3DHI C;  5JXV A;  3ML9 A;  1NYR A;  3LDZ E;  4FA6 A;  4H2A A;  4M01 A;  4BKT A;  3P2B A;  3OWE B;  4IM3 A;  2IO3 B;  4KDL B;  1Q0W B;  4REZ A;  3SD5 A;  2PE9 A;  3KVF B;  3DDC B;  1BXT A;  1YD8 U;  3DVG X;  2M8S A;  1XF5 L;  2MA9 B;  3ZQ4 A;  1WIA A;  5DPT A;  5E6N A;  1FPY A;  4IUM B;  3SFD B;  3DVN U;  5EE0 A;  2X8X X;  5I4D A;  1EF1 A;  3L4P A;  4JGH B;  3P4S B;  4II3 B;  2NVU I;  1HTQ A;  5LXI B;  1TKY A;  1FNU A;  3URY A;  4GN1 A;  3IAM 1;  4KSK C;  5LNK 1;  4F7Z A;  3N32 A;  1KOT A;  2JU6 X;  2HJ1 A;  3Q14 C;  3BK2 A;  1QF6 A;  1YX5 B;  2BQQ A;  3AEF B;  2QIL A;  1R7S A;  1WX9 A;  3PO0 A;  3P4P B;  5JH5 C;  2KLG A;  3NVY A;  1HXY D;  3PV1 A;  4LDT B;  2OJR A;  5E6P A;  3ZUN A;  3HM3 A;  2R2O A;  5BMG A;  2V3P A;  1F1H A;  4LCD E;  4W9D A;  1FRD A;  4I6L B;  4DDI D;  2M0X A;  2KXJ A;  1VLB A;  1N60 A;  2KK8 A;  3APD A;  3GZN B;  3FC4 A;  4KZ0 A;  4PS8 A;  1OEY A;  2R2Q A;  3ZDT A;  3QWZ B;  2IPK D;  4HCP B;  4OZB A;  4YSY B;  2KNB A;  2WP9 B;  3SDL C;  1ISN A;  3BY4 B;  3MP9 A;  4DQO C;  1J8C A;  3A9J A;  3UF8 A;  3U2S C;  3ZVV A;  2JY6 A;  2LMC A;  1SE4 A;  4A55 A;  1IGD A;  1TKE A;  1BUI C;  1KH0 A;  1TBE A;  2J52 A;  3A9J B;  1C78 A;  2Z8L A;  4LTU A;  2L05 A;  3AE2 B;  4KGS A;  2WXP A;  2AQ2 B;  4M8M A;  1CMX B;  3HHM A;  3AH7 A;  1AN8 A;  2DYB A;  2KMC A;  3B08 A;  2QMT A;  2IYD B;  4A20 A;  1PGB A;  1Z5S B;  2VH2 A;  3HRD D;  4WJN A;  1L6V A;  2L0T A;  1C4A A;  1OQR A;  1NYQ A;  2BKR B;  3M63 B;  4HKQ A;  4XC2 A;  1YMH E;  1V97 A;  4K1R B;  2DZI A;  4C56 C;  4F1S A;  3W2D A;  2DAF A;  1ZDV A;  4K7U A;  2K6D B;  1F77 A;  3WIM A;  4XWW A;  4GIV A;  3RFZ B;  1ZDX A;  3EA6 A;  3RPF C;  2PLP A;  1STE A;  3VTW A;  3GS2 A;  1E0Z A;  3UIP B;  4WWO A;  1T0Y A;  2WYQ A;  2AEH A;  3B2F A;  1ZXI A;  1IUE A;  3JSV A;  3FIL A;  2CHZ A;  4NAM A;  4P1C C;  4RF0 A;  1XQQ A;  3DBL I;  4RMA A;  2G45 B;  1V8C A;  4YSX B;  1UH6 A;  1FXT B;  5AUK A;  1YN4 A;  1HTO A;  1YOV B;  2C7M B;  2KAC A;  3JSV B;  3FIL B;  1L0X B;  4LJP B;  5HG2 A;  4OZA A;  3KQ4 A;  5AZF A;  4G3X B;  2EEL A;  3BIN A;  4DHZ E;  2INP E;  3N1X C;  3RUI B;  1IYF A;  1SE3 A;  1V81 A;  3AU4 A;  2I1K A;  2KQS A;  3MFG A;  2B3A A;  2WNM A;  2UWQ A;  1E7V A;  3BVM A;  1ZUD 2;  2NBV B;  1KLV A;  4P16 A;  3DPD A;  2J7Q B;  4LLG M;  3WA0 A;  4HDO A;  3Q8A A;  2BWE S;  1V86 A;  1ZE3 D;  2IO0 B;  1FRR A;  2ZNV C;  4ANX A;  3AEA B;  3A33 B;  5CHW A;  1WF9 A;  2KX3 A;  4NAW A;  2MWS B;  2WXN A;  5FK9 C;  3M3J A;  2N9X A;  3N1Z C;  4MAC A;  2L83 A;  3B0A A;  3J9C A;  2WXR A;  2RSU A;  2KAN A;  2X38 A;  3WAM A;  2RDH A;  3H7P A;  4I6N B;  4KZC A;  1XLQ A;  2NBW B;  3V61 A;  2NPT B;  1GB1 A;  2JF5 A;  3E9S A;  5DPR A;  1KFY B;  3BYT B;  3JVZ X;  3H7P B;  2GLS A;  3U7Z A;  3RNE C;  4DBG A;  2G9H D;  2N9P C;  4HJG E;  3N9Y C;  4S17 A;  1KF6 B;  2SEB D;  3ENE A;  1LM8 B;  2WU5 B;  1KLU D;  1VD2 A;  2BT6 A;  5MPO A;  1E7P B;  1NBF C;  3AV8 A;  4C00 A;  2AWT A;  2KFK A;  4NJC A;  1B9R A;  4WQO B;  1I4Q A;  2W3R A;  2BGF A;  3EHV A;  4P1B C;  1T0S C;  3ZW3 A;  3MTN B;  1WJ6 A;  2KFK B;  3R7R A;  5IKC M;  1K51 A;  3RZF A;  1NI2 A;  4RH6 A;  5IN7 A;  3AE4 B;  3RNF C;  2KJR A;  2REX A;  2PIA A;  3KUZ A;  3NVV A;  1R4N I;  4B6W A;  4EZL A;  3TEW A;  3I3T B;  3U30 A;  4HPP A;  4JE3 B;  1FM0 D;  3EGR A;  1WFY A;  4NQL B;  2BF8 B;  4URK A;  4NY0 A;  1Z2M A;  5L95 C;  4PK1 A;  3R2T A;  3A4R A;  1D6E C;  2K8H A;  1ZP0 B;  2JYT A;  3SR6 A;  3TJP A;  2EKI A;  5JHB A;  1WXQ A;  4WH4 A;  3RN9 C;  4ACF A;  5DPW A;  4MJS A;  1TS5 A;  2V0G A;  1XXG A;  1SXT A;  1EU3 A;  3ECI A;  3V60 A;  3AEC B;  4EKU A;  4TSS A;  4MJS B;  3SEB A;  1C3T A;  4WJP A;  1C77 A;  2FUH B;  2PVO D;  2K0P A;  2KWU B;  2WXJ A;  2L52 A;  3QC8 B;  2LGX A;  5E6J A;  1V5O A;  3W1Y A;  1SIF A;  4TV3 A;  1J7B A;  3PZ8 A;  3NVW A;  3PT2 B;  3ZXV A;  3LYY A;  4OVU A;  3AE5 B;  2ZW0 A;  1FXI A;  1HA5 A;  1LGR A;  2KYW A;  1F52 A;  2MEK A;  3Q8B A;  2KKC A;  1L6U A;  2ZCB A;  3AB5 A;  1T0Q C;  1VDV A;  5CX3 A;  3H1U A;  4RF1 A;  1QLB B;  3KYC D;  2CU1 A;  2PE6 B;  3VRA B;  2KDE B;  2VH1 A;  2TSS A;  2LAS A;  1TZ1 A;  3UIO B;  4WAA A;  4K3B A;  3PSE B;  2IY0 B;  1UNS A;  3Q3O C;  2KAJ A;  4HK2 A;  3AUL A;  4KX6 B;  3R2I A;  3CSF A;  3WAP A;  4MSM B;  3R3M A;  2FCS A;  2YEP F;  2KJ6 A;  2WXL A;  3AMZ A;  4ICV A;  3C8Y A;  1F9J A;  2RR9 A;  2CS4 A;  2K22 A;  2D10 A;  1J19 A;  1FNV A;  3NG0 A;  4AOF A;  2ZVN A;  2G4D B;  2LFI A;  1SJE D;  3HM6 X;  5BYR A;  2Y5B B;  2O2V A;  4N59 A;  3JYU A;  3T8M A;  2CU3 A;  3V6C B;  2JPH A;  1BML C;  2O2V B;  3QAQ A;  2LGI A;  3M62 B;  1WMH B;  2MBO A;  3PLV A;  2JWZ A;  4UDU C;  4ZOH C;  5CTR C;  4PT5 A;  3GOE A;  4ZRP A;  1LQB A;  2FBW B;  2LGY A;  4GU2 A;  2DYM A;  5HKH A;  3IFW B;  3MC9 A;  4JQW C;  3VDZ A;  2E6X A;  2IY1 B;  1WXS A;  2OHF A;  2XEW A;  4KSL C;  1J7C A;  4IDI A;  1I4P A;  1TGZ B;  1PGA A;  2N4F A;  1MFW A;  4WAF A;  5HFY A;  1Y56 A;  2ZVO A;  3O65 B;  1WM3 A;  3U8Z A;  3WCQ A;  5C3J B;  4BOZ B;  4R3D A;  2MBQ A;  1MG8 A;  1M94 A;  2GBM A;  1MG4 A;  2GBK A;  4HKZ E;  2QHO A;  4IKG A;  2PJH A;  4KDI C;  3Q3J A;  4MEL A;  4C4V A;  1MVK A;  4WIP A;  1ESF A;  2FIF A;  1UWX A;  5EE1 A;  2BVC A;  3AE6 B;  3IVF A;  4DXF A;  2C5L C; 
#chains in the Genus database with same CATH homology
 1E10 A;  1SB3 C;  1DOI A;  2LMC A;  1NI3 A;  1YJJ A;  5C2T B;  1SE4 A;  5T8I A;  4A55 A;  1SJH D;  1IGD A;  3EUB 2;  3IXS A;  4XDD A;  1TKE A;  1BUI C;  1KH0 A;  4IOI E;  3VR8 B;  2NTT A;  2J52 A;  2LHD A;  1D4B A;  4OHJ A;  1VJK A;  2MJE A;  1JWS D;  2N0S B;  4RGT A;  1C78 A;  2Z8L A;  2J42 A;  4NAW B;  2J4X A;  1DOX A;  2I2Y A;  4TQ1 A;  3B2G A;  1L4Z B;  1GAQ B;  1QOA A;  4LTU A;  4XE0 A;  1C4C A;  4C7Z A;  3AE2 B;  4KGS A;  2WXP A;  5HHD G;  1A70 A;  1TZO A;  2L32 A;  2AQ2 B;  1D5M C;  3FAH A;  5FR3 A;  4DXG A;  1RFK A;  2IDY A;  3AH7 A;  1AN8 A;  2Q5W D;  2JZP A;  1NEN B;  2Y5C A;  2QMT A;  3AE7 B;  1CQV A;  1FFU A;  1PGB A;  3CIR B;  2BTE A;  2WDQ B;  3HRD D;  2DYO A;  1FD6 A;  2R61 A;  1L6V A;  2HTM E;  2JSV X;  5TSS A;  1YJI A;  1I4H A;  1C4A A;  1OQR A;  1NYQ A;  1V1P A;  4HKQ A;  1C4P A;  3BYY B;  2BYT A;  1ENF A;  2PTL A;  1KRH A;  1YMH E;  1V97 A;  4ARC A;  3ZJU A;  2D5G A;  1PYW D;  1FO4 A;  4HRO A;  2LEK A;  4KGR A;  1XO3 A;  4C56 C;  3P4R B;  1V1P B;  2K3U A;  1NVI D;  1GPX A;  4ARI A;  3W2D A;  1JML A;  3I9V 1;  4XDC A;  1HZ6 A;  1ZDV A;  1QOF A;  2HDE A;  4D2K A;  1JW9 D;  4XWW A;  1F77 A;  4L1B A;  3AEB B;  3RFZ B;  1JCK B;  1ZDX A;  4OVZ A;  1DGJ A;  1FXA A;  3EA6 A;  4WQM A;  2FE8 A;  4A6Q A;  3AED B;  4YXD B;  4YT0 B;  3RPF C;  2PLP A;  5D7G A;  1STE A;  2WXH A;  3AE8 B;  2N9L A;  3GS2 A;  3IT6 B;  4AS1 A;  1E0Z A;  4FXC A;  1FMA D;  2GB1 A;  2LHE A;  1L0V B;  5HI1 A;  3B2F A;  1ZXI A;  1LO5 D;  2ON8 A;  1IUE A;  1T6B X;  1AYF A;  3FIL A;  4NAM A;  4RF0 A;  3MHZ A;  1NEK B;  1V8C A;  4YSX B;  3T3O A;  2BS2 B;  5AUK A;  1YN4 A;  3NVZ A;  2RDG A;  1HEZ E;  2WXM A;  2KAC A;  3FIL B;  1L0X B;  5HG2 A;  4OZA A;  4WUR A;  3KQ4 A;  1WSP A;  1N5X A;  4JWU C;  1JAL A;  3VQI A;  1FCL A;  3SFE B;  2W82 A;  2EEL A;  1F2R I;  5EE9 A;  2INP E;  1YQ4 B;  2MJ3 A;  1PGX A;  2ACZ B;  3ETR A;  1IBX B;  1SE3 A;  2M19 A;  1KTK A;  4N58 A;  2GRI A;  4O1N A;  1CZP A;  1XCQ L;  1I7H A;  3AE3 B;  1SE2 A;  3MFG A;  1N61 A;  3GB1 A;  2WNM A;  4EE2 A;  1E6E B;  3BVM A;  4GDL B;  1ZUD 2;  1RWS A;  4P16 A;  2V4I B;  2OED A;  2YEP B;  1JRO A;  3P1M A;  3ABV B;  4LLG M;  4USA A;  3Q8A A;  1MHX A;  1ZE3 D;  3BZD B;  1FRR A;  4CQN A;  4RCO A;  1TJE A;  1FNW A;  3AEA B;  2FUG 1;  2QEJ C;  1D5Z C;  1N63 A;  4XWT A;  3BK1 A;  2JYE A;  4J3O D;  2WLB A;  3NZ3 A;  1TY0 A;  4YTM B;  2DLB A;  2WXN A;  2W54 A;  5FK9 C;  4MAC A;  2KN4 A;  3W9C B;  2L83 A;  2QSD A;  3J9C A;  2WXI A;  1JWM D;  2WXR A;  3R8B A;  1OFF A;  2BBC A;  3AM9 A;  2PMV A;  2X38 A;  4RGN A;  3W5U B;  1F0Z A;  2KWD A;  2RDH A;  1XLQ A;  3BII D;  3TUO A;  2IJ0 A;  1V1O A;  4ZRQ A;  1DOY A;  1GB1 A;  2AQ3 B;  3IAS 1;  3E9S A;  1I4X A;  1KFY B;  1CK1 A;  3BYT B;  1EM7 A;  2BB5 A;  2IGG A;  1EWY C;  1C76 A;  4TMA B;  3U7Z A;  3Q8E A;  1SIJ A;  1L0Y B;  1ZPS A;  2G9H D;  2ONQ A;  1ET6 A;  4A9A A;  3LXF A;  2LJI A;  3CWI A;  4HJG E;  1WWT A;  4ZHO A;  3N9Y C;  4JWS C;  1VZ6 A;  2BW2 A;  4LK0 M;  1FCC C;  1EWC A;  1K50 A;  1KF6 B;  1QIL A;  2SEB D;  2JXT A;  3P42 A;  2WU5 B;  1KLU D;  4TQ0 A;  2BT6 A;  5MPO A;  2M56 B;  1E7P B;  1N5W A;  5H8Y E;  3AV8 A;  3U4E G;  4NJC A;  2MJD A;  5FKA C;  3AE9 B;  1B9R A;  4YWG G;  1I4Q A;  2W3R A;  3TEZ A;  4RNA A;  1YNT E;  2E3T A;  4HRS A;  1SBB B;  2KDM A;  2RMM A;  2XNA C;  3T3N A;  1YN5 A;  2G1E A;  3I57 A;  1T3Q A;  4B0M A;  3V05 A;  1WRI A;  1K51 A;  2RPV A;  1P7F A;  2PVG C;  2WXG A;  4A90 A;  4M0W A;  4HEA 1;  4RH6 A;  1ZOY B;  3AE4 B;  2H89 B;  4OZC A;  3DWM A;  3AEE B;  1CJE A;  2PIA A;  2JX5 A;  4YTP B;  1XEE A;  2QJL A;  3NVV A;  2Y3A A;  3TEW A;  1QOB A;  2GI9 A;  1WYG A;  4JE3 B;  1FM0 D;  1JWU D;  1L4D B;  3AEG B;  3EGR A;  3E56 A;  1ROE A;  2CJO A;  2CJN A;  3HUI A;  2N9K A;  1GB4 A;  4Q2J A;  3B9J A;  1QQR A;  2AQ1 B;  1IBX A;  3P63 A;  2H88 B;  1JWA D;  4WWM A;  3KWV A;  4MH8 A;  3R2T A;  3BWU D;  1D6E C;  1SSN A;  2PW9 A;  4JX1 C;  1QOG A;  3HVZ A;  1VRA B;  1UGJ A;  1ZP0 B;  2JYT A;  3SR6 A;  2EKI A;  3AE1 B;  1RYJ A;  5G5H A;  1WXQ A;  1C9F A;  1XCT L;  4WH4 A;  3UI3 A;  2V0G A;  1TS5 A;  1I4R A;  1UWM A;  1XXG A;  1HQR D;  1SXT A;  2WXO A;  1I4G A;  1EU3 A;  2VZK B;  1TS4 A;  3AEC B;  4RFB A;  2BS4 B;  5BMH A;  1L5P A;  1RM6 C;  4RGO S;  1ET9 A;  4TSS A;  3SEB A;  4YTN B;  1HZ5 A;  5GXG B;  1YQ3 B;  1C77 A;  4KGT A;  5H92 C;  2PVO D;  2K0P A;  1TYG B;  2WXJ A;  2L52 A;  1IGC A;  3NUH B;  4L2Y A;  1TY2 A;  2I38 A;  2WDV B;  2XN9 C;  5E6J A;  4P6V F;  3AN1 A;  3TEX A;  4KKJ A;  1J7B A;  3PZ8 A;  1KLG D;  1E9M A;  3NVW A;  2KQ4 X;  3LYY A;  3U52 E;  1TS3 A;  2ICI A;  3AE5 B;  2ZW0 A;  3VRB B;  1FXI A;  1PUT A;  2QIE B;  2PKO A;  1HA5 A;  1VZ8 A;  1F2R C;  3W1S A;  2B76 B;  2JQR B;  2MEK A;  4B0E A;  3Q8B A;  1L6U A;  3ZJT A;  3AB5 A;  5AUI A;  1B1Z A;  1VDV A;  1ZXH A;  3GP7 A;  1SEB D;  2N7J A;  2BS3 B;  2MH7 A;  3V3X A;  2NTS A;  1MPE A;  1SF0 A;  3IT4 B;  4RF1 A;  1AWD A;  2K9X A;  4L23 A;  1QLB B;  2JWU A;  2WXQ A;  3TEY A;  3HVD A;  4GLS C;  4A8X C;  4JPS A;  4OW0 A;  3MC0 B;  3VRA B;  3ZYY X;  2KMM A;  2Y5P A;  2TSS A;  2V3N A;  4ZYS A;  3KWL A;  4N6E B;  1J7A A;  1EU4 A;  1MHH E;  4KKI A;  4MT5 A;  1TS2 A;  2NMQ A;  3W5V B;  5JXV A;  2J53 A;  1UNS A;  1NYR A;  2AX5 A;  2WXK A;  2KAJ A;  2WU2 B;  4H2A A;  5D3D A;  1VR9 A;  4KX6 B;  3R2I A;  3MJ5 A;  3OWE B;  1T5X D;  2WQY B;  4REZ A;  1JQ4 A;  1PDX A;  3O13 A;  5BYS A;  1YN3 A;  1BXT A;  1DYQ A;  2YEP F;  2VZK D;  1XF5 L;  2IGD A;  4US9 A;  2WXL A;  3AMZ A;  2WS3 B;  2LUM A;  3C8Y A;  3ZJV A;  1XLP A;  3VR9 B;  1GOZ A;  3ZQ4 A;  4C7Y A;  2K22 A;  2SAK A;  2L1A A;  2WDR B;  3LB8 C;  4GDK B;  1AW7 A;  1FNV A;  1K53 A;  3Q8C A;  5BYQ A;  3SFD B;  5EE0 A;  1FFV A;  5I4D A;  4AQ7 A;  1XLN A;  3L4P A;  2INN E;  2LFI A;  3Q69 A;  5BMI A;  1ACC A;  1TKG A;  1SJE D;  1OQQ A;  3P4S B;  5BYR A;  1TKY A;  4N59 A;  5D3I B;  3ZGZ A;  5EE3 A;  5G5G A;  1XLO A;  1FNU A;  3URY A;  2BB6 A;  2CU3 A;  3IAM 1;  3NS1 A;  1FIQ A;  5LNK 1;  1QKZ A;  1BML C;  4US8 A;  3KLS X;  2ZW1 A;  4C80 A;  2JU6 X;  1JWB D;  2IGH A;  2LGI A;  4YSZ B;  1D5X C;  3BK2 A;  1FEH A;  1C79 A;  2W3S A;  1K52 A;  1QF6 A;  3AEF B;  2QIL A;  3DWG C;  4UDU C;  1M4V A;  3TSS A;  1R7S A;  3PO0 A;  3NRZ A;  4ZOH C;  3P4P B;  1UUP A;  4PT5 A;  4ZRP A;  2FBW B;  3NVY A;  1HXY D;  2DYM A;  2E6X A;  3P4Q B;  4RGM A;  3BVZ A;  2OHF A;  1P7E A;  5BMG A;  1J7C A;  2V3P A;  3BVG A;  4IDI A;  1MI0 A;  1I4P A;  1Q10 A;  1PGA A;  4ZHP A;  4ITK A;  5HFY A;  4WAF A;  1Y56 A;  1FRD A;  3WCQ A;  1VLB A;  5C3J B;  1N60 A;  2K5P A;  4R3D A;  2DBY A;  3H8H A;  3FC4 A;  4HKZ E;  1N62 A;  1JRP A;  4IKG A;  1WGK A;  2M0A A;  2IPK D;  4OZB A;  4YSY B;  1QT9 A;  2WP9 B;  1PFD A;  1MVK A;  1VZ7 A;  3PZ7 A;  2DWQ A;  4MM3 B;  4NZL B;  1ESF A;  4WIP A;  1UWX A;  3MP9 A;  5EE1 A;  2W55 A;  3AE6 B;  4DQO C;  2WXF A;  4DXF A;  3Q8F A;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...