3PV1A

Crystal structure of the usp15 dusp-ubl domains
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
215
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structural variability of the ubiquitin specific protease DUSP-UBL double domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 215
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pv1A02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3pv1A01
1Z5SB 3W1SA 2LVQA 2ZPYA 1TGZB 2HJ8A 2PJHA 3QARA 4I6PA 3VTVA 3DBHI 2DZJA 2KJHB 3PPAA 3UIOB 1XD3B 2BKFA 2NPTB 1WGGA 5JH5C 3LJ3A 3PLUA 1GJZA 2N7DA 2KVRA 1WJ4A 4ANUA 2JY6A 2N4FA 3KW5B 3R3MA 1I42A 1WH3A 2WYQA 1Y8RC 3PSEB 2KDIA 1E8ZA 1V6EA 1WXSA 1YIWA 1ZKHA 3JVZX 4MH0E 3ONSA 4DDID 1UD7A 2ZNVB 2GBMA 4K7WA 1WGRA 3IHPC 2LASA 3QAQA 5LXHA 2O6VA 4W9CA 4GIVA 5IAAC 4FADA 4FA6A 3PGEA 2J7QB 3DOWA 2BWFA 1RLFA 2XBBC 1IYFA 4G0NB 3V6EB 1C1YB 2L8JA 2ZVOA 4PS3A 4FHJA 2FNJB 4GB9A 4LDTD 4WJOA 3PT2B 3W1YA 2N7EA 2K8CA 1UH6A 1GC6A 4AWJA 1K8RB 1YQBA 2AL3A 2K1FA 1WGDA 3PZDA 4MM3A 2JF5A 4NQKE 4W9JA 3IFWB 4M0WB 3QC8B 3X23A 2WWZA 1UELA 2CU1A 2KWVB 1C3TA 1SGHA 1J19A 1YX6B 1EUVB 3WAMA 4KVGB 4EKUA 3VDZA 3H6NA 2KD0A 4MGKE 4MGIE 4WWNA 4GDKA 3M3JA 1E8XA 3VUXA 2ZEQA 3M63B 3SHQA 2KHWB 1V49A 2VRRB 2FCSA 4JLCA 4NNJB 5D6JB 4PS7A 2M8SA 5LLIA 2MSED 1J0GA 3OJ4B 1V5OA 1WM2A 3A9KB 2OOBB 1ZGUB 4IWQA 2PE9A 3RZWC 4W9KA 3V62A 3DDCB 2K25A 3V6CB 2C7NB 1XT9B 3UF8A 4HDQA 4KZCA 2J0KA 4ICVA 4XZ4A 1OGWA 4N9F4 5EDSA 1ZW7A 4MGZE 2K8HA 2MLBA 3KYCD 3A4SC 3JSVA 4TQ1A 3Q3FA 3MJWA 1UGMA 3B1LX 2MCNB 1WGHA 3L0WB 4ZYNA 3NZUA 3H9DA 3L10B 2IYDB 3WA0A 3HM3A 2D07B 1EF1A 3ZRFA 4B95A 2V3SA 4HDOA 4M8MA 5E6NA 2KFJA 2DAJA 2FIDA 2ZZPB 4OVUA 2KJRA 1I35A 4J6IA 2LVPA 2FCNA 4AP4C 1V2YA 3R66C 2ZJDA 2UWQA 4XX5A 4MELA 2L76A 2KNBA 4HCNB 2DZMA 3AULA 3R7RA 4BOSC 2R2QA 3DCGA 5DPRA 2AL6A 2CHWA 4G3XB 3Q3JA 3HHMA 2KWCA 1WGYA 2RR9A 3APCA 1OQYA 2BPSA 3H7PA 3HM6X 2FCQA 3JYUA 3L08A 3U7DA 4F1SA 2PE6B 5DPWA 4EZLA 5JZEB 4IM2A 4DHZE 1P3QU 4ZRIA 4KZ0A 1V81A 1X1MA 2KTRB 2AYOB 2K6QA 4MJSA 2JWZA 2WX1A 3CF6E 2KLGA 4B9KA 1LFDA 4IW0A 2LZ6A 3JSVB 3N3KB 3VXWA 2HTHA 4AJYB 4TKNA 4BKSD 3RZFA 4JQWC 5JHAA 2L3ZA 3KVFB 2DENB 1WFYA 2EMSA 4KIKB 1WX8A 2PEAA 3QHTA 4DBGA 2WDTB 1E8YA 2HD5B 2C7HA 2O2VA 4F7ZA 3B08A 1L7YA 3TMPB 3VH4B 4W9EA 2JRIB 2RGFA 4IWPA 3AI5A 4EEWA 4XC2A 2JUOA 2CHZA 4KSLC 1RFAA 2MP2B 2MW5A 3W1SC 1HE8A 4GDLA 5D7GA 4CYEA 4AOFA 2JPHA 2IO0B 4G11A 4DDGD 2DYMA 4KDIC 2KFKA 2Y5BB 2KKCA 4K1RB 4W9HA 3R7QA 4IWOA 4HLEA 1YJ1A 4OVVA 4PS8A 1WZ0A 3HIZA 1CMXB 3EHVA 1E8WA 2AWTA 5J18A 4BKTA 2HE7A 3A33B 2NBWB 4KDLB 4IC7B 2RPQA 4W9FA 1P98A 2IO2B 4AJWA 3BINA 2M4NA 4II3B 3VTWA 4B6WA 4MGYE 4KV2A 2FAZA 5D2MB 1TBEA 2C60A 3DVGY 2MBQA 3EFUA 4FJYA 3RUIB 4I6NB 1SIFA 3WIMA 3QCAA 2D10A 1U4AA 2DAFA 3PLVA 1VCBA 1KLVA 2LUEA 1YX5B 3ZIMA 4GOCA 4K7SA 3TBLD 2MX2A 5TR5A 2CR5A 3NOBA 4F8CB 4E71A 2J0JA 2M0XA 2O2VB 1E5WA 3IVFA 3ZKJC 2L0FA 1OEYA 3A1QB 1GG3A 3UIPB 4A3PA 4NAWA 2DYBA 3QWZB 1V5TA 2BGFA 2K8BA 4ASWC 4DXAB 5DCNA 4X57B 2G3QB 2N1VA 4ZRJA 2DZIA 2CS4A 3SD5A 2WX0A 2NR2A 2O6VD 2R2OA 1V80A 2BYEA 2FCMA 3RD2A 2ZVNA 3ZDTA 1E7UA 5C1ZA 3QX1A 2A4ZA 1WYWB 2K6DB 2RD0A 5C23A 2L00B 3NHEB 4M8NA 4BFRA 2KLCA 2D11A 1Z2MA 2V4LA 3K9OB 2PPHA 4RMAA 4MEMA 4ICUA 3DVNU 2KTFA 3APDA 2LWPA 2GBJA 4HCPB 4KSKC 2BF8B 3NS8A 4HPMB 4EUTA 1SE9A 1MG8A 2O6VB 2XK5A 5G55A 1TZ1A 3ZUNA 1WXVA 3IBEA 4MDKE 5J2RA 4TV3A 2BYVE 1WJNA 4II2B 3SU8X 3S2AA 3OAWA 4LJOB 4WJQA 3VH3B 4GGQA 3EC8A 3QQ8B 4NAWB 2KDBA 2KQSA 3I3TB 3ZLZA 1VD2A 1RAXA 4ZRKA 1WMHA 4NY0A 1S3SG 4PYUA 3D32A 4G50A 2KDEB 1EF5A 2MWSB 3U8ZA 3KUZA 4CO7A 1KM7A 4DWFA 4W9DA 3ZTDA 3GZNI 1WIAA 1UBQA 1P0RA 2V1YA 2NVUI 3DBRI 1W6VA 4GDKB 2DYOA 2FIFA 3EECA 3UQBA 2BKRB 4HK2A 5FR6A 3WALA 1E7VA 3IG3A 3K9PB 1V9JA 1WXMA 2AEHA 2CKHB 4MSMB 3OLMD 5D94A 5HKHA 3VVWB 2KWUB 2LXCA 3VUYA 1WR6E 3AU4A 4P7IA 3PTFC 1WZ3A 2KDFB 1Q1OA 3A9JA 2JT4B 4HWIB 2CHXA 3A4RA 3CSTA 3L17A 5CHVC 2JRHA 2GBNA 4BVUC 2GBKA 5KHOA 3UINB 4WAAA 3L54A 1WE7A 3TIXA 3DBLI 2YVCA 2KANA 1RRBA 2G4SA 3KYDD 2IO1B 2I1JA 4LCDE 5CHFA 3DPDA 4FULA 4E74A 5IA7A 3DVNV 4GMVA 2IY0B 2MRPA 4FJVB 4GXBA 3AXCA 5J17A 3H1UA 5CTRC 2LD9A 3ZNID 4BKSA 2N9PC 3P2BA 2KO3A 5G2NA 2M17A 1WJ6A 3KUCB 4BOZB 1L2NA 4DHJB 2NPTA 1LM8B 1WM3A 4JIOU 1P1AA 1LXDA 4WWOA 2LJ5A 1NI2A 3JW0X 5BO4B 5AZGA 1UZXB 2DHZA 1FXTB 5AZFA 3HK0A 2JXXA 4HPLB 4ANWA 2D2QA 3ALBA 2LGXA 2KZRA 1S1QB 1NBFC 3BY4B 5E6PA 1UBIA 3RYTA 2JZZA 2Z0EB 4K81A 3TJPA 3H7PB 3QJZA 2DZKA 3QA8A 2LRWA 2W9NA 2I1KA 3L13A 1J8CA 4EFOA 3PHWB 1IPGA 4MJSB 1WE6A 5L95C 5DPSA 2KX3A 4MSQB 3LDZE 2QHOA 2B3AA 3NZSA 3L16A 4PYZA 3X0WA 2KK8A 4WJNA 5AEKB 3APFA 4E3CA 4EZJA 2IY1B 3NY5A 3UQAA 1Q5WB 2XEWA 1QZEA 3WAPA 3WANA 4DHZB 2A5UA 3V61A 2GOWA 2LI5A 2NBVB 3ZNHB 2LGYA 2KN5A 4FHKA 3LMNA 2LXAA 3GOEA 4GDLB 3VQIA 2L0TA 4WJPA 2N1WA 2Z59B 4GU2A 1P9DU 4JL9A 3VFKA 5JHBA 2KFKB 4ANXA 4RM9A 2KOXA 5L83A 3SDLC 2LGDA 1E90A 2GMIC 2IZVB 3RULA 3A9KA 1D3ZA 4HXDA 4LJPB 3UGBB 4I6LB 2C9WB 2G45B 1Q0WB 4NPNA 4A20A 2JVCA 3U30A 2MQJA 4NJ6A 4HJKA 3ZVVA 1IP9A 3KUDB 3ENEA 1V86A 4K7UA 3ZNGC 1A5RA 3DVGX 2MBEA 2C7MB 3N32A 1BT0A 1WXAA 4NJ7A 4WQOB 5E6OA 3V60A 2DX5B 4YL8A 3PRPB 1R4NI 2KJ6A 2G4DB 4DK5A 5CX3A 3PRMB 1WF9A 3ZDMC 1PQSA 3PS6A 4BBNC 4FN2A 1EO6A 3VHTC 4HVBA 1H4RA 2ZCCA 2BWES 1WRDB 2K39A 2UYZB 3OJ3A 4LDTB 2LRUA 4TQ0A 3ZRCA 3PV1A 2ZPNA 2MA9B 3VUWA 2L05A 1WX9A 4AUQC 2L7RA 4IUMB 3H7SA 3DBSA 2KXJA 2YLMA 2ZCBA 4FLHA 4IM0A 4ZDVA 1NDDA 3PVLA 4FBJB 2BYFA 2KMAA 2KTRA 3CMMB 3ZTCA 3ECIA 2MBOA 1GNUA 2MBBB 2N9XA 3PHXB 2EMTA 4JGHB 4TUUA 5DPTA 4DHJD 2KC2A 2IBIB 1LQBA 2LVOA 2GBRA 2KC1A 2ASQA 2XK5B 3M95A 4KIKA 4A3OA 4ANVA 1KOTA 3RCZA 3KH0A 2IO3B 4FJZA 4W9LA 3MHSD 4BBNF 3PRZA 1WX7A 2RSUA 4RM8A 1XQQA 1OTRB 1T0YA 1WI0A 2N9EB 1AARA 2MP2A 2Z0DB 3ZW3A 1WR1A 3N30A 1WMHB 4WWPA 3DQVA 1KJTA 3ML9A 4W9GA 1GC7A 1TTNA 2NCNA 1WJUA 3PREA 3B0AA 4IM3A 2NBUA 2C5LC 4CHKA 2JZ3B 1WY8A 2KMCA 3T9LA 1G6JA 4EZKA 2M1MA 4NQLB 2J0MA 4W9IA 1ISNA 2NS5A 5CHWA 3RT3B 2EKEC 4EOYA 1YD8U 2OJRA 4GSWA 4BKGA 5AZHA 2ZNVC 3VTUA 3ZO5B 4GN1A 1R4MI 2FUHB 1M94A 3T8MA 2D3GA 3A9JB 2KX0A 3VAWA 2REXA 3MTNB 1H8CA 2MBHA 1F9JA 3ZNZB 3A1QA 3QK0A 5KHQA 4IG7B 5LXIB 1OEYJ 3M62B 3ML8A 3WAOA 1GUAB 3C0RB 1JRUA 5GMVA 3TL5A 3AU5A 4URKA 3O65B 3CSFA 2KQ7A 3QIJA 3TCAA
chains in the Genus database with same CATH superfamily
3W1SA 3EGRA 1JW9D 2JWUA 4UDUC 1C78A 3QARA 3AN1A 4I6PA 2BKFA 2NPTB 1N61A 3T3OA 1GJZA 2N7DA 3AE1B 1WJ4A 4ANUA 3ZJUA 5D3IB 4OZCA 4DQOC 4OZBA 1NYQA 1E8ZA 1YIWA 2JSVX 3PZ7A 4K7WA 1WGRA 2ACZB 4P16A 1JWUD 5LXHA 2O6VA 3AE4B 5IAAC 4FA6A 3PGEA 3DOWA 2XBBC 3SR6A 4G0NB 2ZVOA 3E9SA 3NG0A 2N7EA 1FFVA 1YQBA 2WWZA 1OQRA 2MHJA 2G9HD 3VDZA 4WWNA 3Q8AA 4RF0A 1MJDA 3VUXA 3NVYA 2KHWB 3C19A 4B0EA 1V1PA 1V8CA 2VRRB 2FCSA 1TS4A 4JLCA 2RDHA 1L0VB 1JQ4A 1OFFA 2KYWA 3A9KB 2OOBB 3HUIA 4IWQA 1NEKB 2K25A 2C7NB 4RF1A 2LGSA 4KZCA 3PZ8A 2ZW1A 4TQ1A 1K52A 2LGIA 3R2TA 4HEA1 3MJWA 1UGMA 3B1LX 1N6ZA 4OVZA 2W55A 3HVDA 3IT6B 1YJIA 3TEWA 4OVUA 2KJRA 2KQ4X 2W82A 5C2TB 3P4SB 1XF5L 2KNBA 4S0RA 2N9KA 2CJOA 2R2QA 2CHWA 3ZRFA 3JYUA 1I35A 4F1SA 3L08A 2FCQA 1HQRD 3RNGC 4DHZE 3N9YC 4KZ0A 1FM0D 1JCKB 2D3AA 3NZ3A 4B9KA 3KQ4A 3JSVB 3VXWA 2HTHA 3CWIA 3KVFB 1T0RC 1WFYA 2WXHA 1WX8A 1E8YA 2C7HA 4F7ZA 3B08A 1L7YA 3VH4B 4IWPA 4XC2A 4KSLC 3W1SC 1HE8A 2JPHA 1EWCA 1TZOA 4W9HA 2Y3AA 2Y5BB 2KKCA 4HLEA 2OEDA 1YJ1A 4PS8A 2BS3B 4ZHPA 1E8WA 3PO0A 5J18A 2IGDA 2INCC 4HKQA 4W9FA 1P98A 2IO2B 4AJWA 2BQQA 4MGYE 1UF0A 3Q3MC 2W3SA 4LNNA 3BZDB 3PLVA 1VCBA 1KLVA 2J0JA 2L0FA 4NAWA 2WXIA 2DYBA 3QWZB 1V5TA 4DXAB 1Y56A 4X57B 2CS4A 1UGJA 2WX0A 2N0SB 2O6VD 1DGJA 2R2OA 2NTSA 3DWMA 5C1ZA 3QX1A 2JZPA 1L0YB 1QT9A 1T0SC 2K6DB 2RD0A 2WXQA 2D11A 2V4LA 4TSSA 1L4DB 2JYTA 4MEMA 2M0AA 2KTFA 3APDA 4XGAB 2ZW0A 4KSKC 4HPMB 1QOFA 1SE9A 2O6VB 1TZ1A 1WXVA 3IBEA 4TV3A 2BYVE 1J7CA 2K5PA 4LJOB 3VH3B 4GGQA 3EC8A 2KDBA 2WU5B 1R7SA 4ZRKA 1S3SG 4PYUA 2MWSB 4DWFA 1DOIA 3GZNI 1WIAA 3DBRI 3N1XC 3EECA 2BKRB 3O13A 1N63A 4LTUA 3WALA 1E7VA 1V1PB 1FMAD 3ZYYX 2LXCA 3FILA 4IOIE 1WR6E 2KDFB 3R8BA 3A9JA 2CHXA 2WQYB 3NS1A 1WE7A 3TIXA 2YVCA 1AYFA 5IA7A 1FD6A 2IY0B 4FJVB 4GXBA 5LNK1 1SBBB 5CTRC 5G2NA 2R61A 2WDRB 4JIOU 1WM3A 1N62A 4WWOA 1SSNA 2LJ5A 3AH7A 2PLPA 1FCCC 1UWMA 2DHZA 2QJLA 1FXTB 3HK0A 4ANWA 4HPLB 2ON8A 2LMCA 3W5VB 3GB1A 1MI0A 4EFOA 1IPGA 1ZPSA 3BVZA 2XNAC 5DPSA 1AW7A 1MG4A 4WJNA 1TIFA 1Q5WB 1L6UA 4XDCA 4DHZB 2GOWA 3ZNHB 4FHKA 3LMNA 5FK9C 2LXAA 3VQIA 3RPFC 2E3TA 3GZNB 4WJPA 2N1WA 1P9DU 1SEBD 3DBRB 1EU3A 4XWTA 2FBWB 2BB5A 3AEFB 3RN9C 1VJKA 2G45B 1F2RI 2FUG1 3NJTA 2MQJA 4NJ6A 2PKOA 3HRDD 2QMTA 1D5XC 1V86A 2AX5A 1F77A 4NJ7A 1R4NI 3BVGA 1JWAD 1WF9A 1KTKA 2WDQB 4FN2A 1EO6A 3VHTC 1E6EB 2ZCCA 2BWES 1BMLC 4L2YA 1TT5B 3ZRCA 3AE2B 3VUWA 3SFEB 4IUMB 2LUMA 4FLHA 4IM0A 3VRAB 4FBJB 2BYFA 4DXFA 3DHGC 1HA5A 2KMAA 2V3PA 3Q8FA 3CMMB 3ZTCA 2K22A 2MBBB 1PGAA 1F2RC 5DPTA 1V97A 4ANVA 3IT4B 3RCZA 3AE8B 4FJZA 1C9FA 1WX7A 2LHEA 3AECB 3ZW3A 2Y5PA 3TUOA 5G5GA 2PVOD 1P7EA 1J7BA 4W9GA 5FKAC 4C4VA 1VDVA 2JZ3B 1WY8A 3T9LA 1G6JA 4YSYB 4LNOA 1ISNA 3RT3B 1YD8U 4BKGA 3AEDB 4C7YA 5AZHA 3VTUA 1T0QC 3FILB 2FE8A 3ZO5B 3T8MA 3A9JB 2KX0A 3MHZA 3MTNB 4M00A 2N9LA 3A1QA 3M62B 1HXYD 5BMHA 3O65B 4YWGG 3GP7A 1KFYB 1R4NB 2PJHA 3N20C 1L5PA 2DZJA 2JQRB 2KJHB 3PPAA 4RGMA 1XD3B 1QKZA 3LJ3A 3PLUA 1YNTE 1QQRA 3KW5B 3R3MA 2JX5A 1V6EA 1WXSA 1PGXA 3JVZX 4MH0E 4DDID 1ZP0B 2RDBC 4FADA 3AV8A 2J7QB 1RLFA 1IYFA 3V6EB 1I4RA 4XWWA 3MC0B 2BW2A 2FNJB 3LYYA 1I4PA 2PTLA 3IAS1 1K8RB 2AL3A 2K1FA 4W9JA 2HJ1A 4JE3B 4NQKE 3IFWB 2CU1A 2KWVB 1C3TA 1SGHA 4EKUA 4EE2A 4MGKE 4GDKA 3DHHC 2ZEQA 2QEJC 1V49A 1ET6A 2M8SA 4KGTA 2MSED 2YEPF 1C4AA 1WM2A 3U7ZA 2DBYA 1ZGUB 3V62A 4W9KA 3Q3NC 4LK0M 3UF8A 4HDQA 4MGZE 2MLBA 3KYCD 3ZGZA 3A4SC 3JSVA 1YN5A 1MFWA 3H9DA 1JALA 3WA0A 2D07B 4M8MA 4NJCA 1XEEA 2KFJA 2FIDA 2ZZPB 2WGSA 3R66C 2ZJDA 1IGDA 4XX5A 4MELA 2L76A 2BTEA 4N58A 3V3XA 2DZMA 3R7RA 4BOSC 5DPRA 2AL6A 3Q3JA 3HHMA 2KWCA 3X23A 2RR9A 3U7DA 1OQYA 2BPSA 3H7PA 1C79A 2WXRA 5JZEB 3AM9A 2WU2B 1XLOA 4H2AA 1X1MA 5BYQA 2JWZA 4XDDA 2EELA 3EUB2 1LFDA 4AJYB 4BKSD 5JHAA 1SF0A 1I4HA 2EMSA 1D4BA 2WDTB 1PFDA 3TMPB 4W9EA 2RGFA 3AI5A 4EEWA 1RFAA 2MW5A 2QIEB 5HHDG 2AQ3B 4GDLA 2PMVA 2VH1A 4KDIC 2KFKA 4C4VB 2SEBD 1TS5A 1CMXB 1RWSA 3BK2A 2WXGA 2DWQA 4IC7B 1MHXA 3BINA 4RCOA 4II3B 4B6WA 3VTWA 1VZ7A 4KV2A 1TBEA 2C60A 3I57A 3WIMA 3DHIC 4HRSA 2DAFA 5IP4D 5EE0A 2K3UA 4GOCA 1YJJA 1YMHE 4F8CB 3IVFA 2O2VB 3ZKJC 3A1QB 2OJWA 2K8BA 4ASWC 4PT5A 3RNEC 1PUTA 4C00A 2ZVNA 3ZDTA 2B76B 1TJEA 1C77A 1CQVA 1FPYA 4ICUA 3DVNU 1TKGA 2KDMA 2KN4A 3NS8A 2BVCA 5E6JA 1MG8A 2XK5A 1K51A 4MDKE 4KKIA 4II2B 1TYGB 2PW9A 2KQSA 3I3TB 4L23A 4FXCA 1IGCA 1DYQA 4G50A 5G5HA 3U8ZA 3KUZA 1KM7A 1RM6C 1UBQA 1P0RA 2V1YA 2WLBA 1A70A 3P63A 4REZA 4GDKB 3UQBA 5HG2A 4HK2A 3BIID 1SIJA 4MSMB 4NZLB 3VVWB 3TSSA 2BS2B 1WZ3A 1SE2A 2L32A 3A4RA 3L17A 4YSZB 5KHOA 4WAAA 2WS3B 3L54A 1RRBA 4ITKA 2IO1B 2I1JA 2LD9A 2N9PC 4A9AA 4DHJB 1LM8B 3R2IA 2KT7A 2IPKD 1ZXHA 1QF6A 5AZGA 3UI3A 5AZFA 4RGTA 2LGXA 1UNSA 1NBFC 3RYTA 1UBIA 2JZZA 2Z0EB 4M01A 3H7PB 1EWYC 3QJZA 1F52A 4WAFA 5I4DA 3QA8A 2W9NA 2I1KA 3PHWB 2WXJA 1WE6A 1EM7A 2KX3A 4MSQB 2B3AA 4K3BA 4PYZA 4C80A 4M0WA 2IY1B 3NY5A 1UWXA 3WAPA 3WANA 2A5UA 3Q6BA 1JROA 2LGYA 2J42A 2KN5A 3GOEA 4ACFA 1GAQB 4GDLB 2L0TA 1FXAA 3VFKA 2KFKB 5L83A 4RM9A 2CU3A 3SDLC 3W2DA 3Q69A 1SXTA 1E90A 3RULA 1D5MC 2IZVB 5IKCM 1ZUD2 2MJEA 4HXDA 2WXPA 1VZ8A 4YTNB 2C9WB 4NPNA 4A20A 5JXVA 4OZAA 1XCTL 3RMKC 1OQQA 2MEKA 2W3RA 3AMZA 1TKEA 2GI9A 1A5RA 3DVGX 2SAKA 2JU6X 4ZHOA 3N32A 4WQOB 2DX5B 3ETRA 1FXIA 3Q2AC 1H4RA 3OJ3A 2UYZB 4LDTB 3PV1A 2ZPNA 2MA9B 2L05A 1WX9A 4AUQC 1L4ZB 3FAHA 3H7SA 2M56B 3DBSA 2KXJA 5BYRA 2QC8A 5FR3A 2KTRA 4MACA 2MBOA 3RNBC 3CIRB 1JWBD 2IBIB 2KC2A 3RNCC 2GBRA 2XK5B 3M95A 4KIKA 2TSSA 1YN3A 3SEBA 2IO3B 3MHSD 3PRZA 1XQQA 1OTRB 1WI0A 2MP2A 1RYJA 4AS1A 3DQVA 1KJTA 1XCQL 2WDVB 3ML9A 3IXSA 2GB1A 3PREA 3B0AA 2C5LC 4ZRQA 2WXKA 1C4CA 4W9IA 5CHWA 4EOYA 1TY0A 2ZNVC 2REXA 2BBCA 1H8CA 3ZNZB 3QK0A 5KHQA 3ML8A 3C0RB 1JRUA 4URKA 2KJ6A 3QIJA 2LVQA 2I2YA 2ZPYA 2HJ8A 1DOXA 3ZXRA 3UIOB 1WGGA 2E6XA 1VZ6A 1Y8RC 3PSEB 3NVZA 5BYSA 1DOYA 1UD7A 4L1BA 2ZNVB 3IHPC 4W9CA 4GIVA 2BWFA 3DWGC 3KWVA 1SJHD 2L8JA 4PS3A 4GB9A 1PGBA 3PT2B 1UH6A 3TEXA 4AWJA 1IUEA 2JF5A 3NRZA 4M0WB 3QC8B 1UELA 4C7ZA 1ZDXA 1J19A 1YX6B 1EUVB 5BMIA 1L0XB 2KD0A 1I4QA 3RI7C 2KAJA 1NI3A 3MFGA 3SHQA 4NNJB 4PS7A 5LLIA 1J0GA 3OJ4B 3AE9B 1V5OA 3N1ZC 4HJGE 3DDCB 3V6CB 1XT9B 4XE0A 4ICVA 5EDSA 1OGWA 1T5XD 1ZW7A 2K8HA 4JWUC 3LXFA 1FNUA 2MCNB 1E9MA 4ZYNA 3NZUA 3L10B 2IYDB 5E6NA 1TS3A 2FCNA 4JWSC 4AP4C 1V2YA 1E7PB 3P1MA 3AULA 1ENFA 4G3XB 1WGYA 2Z8LA 4CQNA 4EZLA 4IM2A 1P3QU 5H8YE 1V81A 2L52A 2KTRB 2AYOB 2D3CA 4MJSA 2WX1A 1CK1A 1GB1A 4IW0A 1K50A 1LO5D 3B9JA 1E0ZA 1K53A 3RZFA 3ZJVA 4JQWC 2L3ZA 4KIKB 1E10A 2O2VA 2JRIB 2JUOA 2MP2B 4CYEA 4AOFA 2IO0B 4DDGD 3TEZA 3R7QA 4OVVA 1WZ0A 3EHVA 4HKZE 2AWTA 1SE4A 1QLBB 3A33B 4KDLB 1FEHA 2RPQA 2QCZA 3Q8CA 2M4NA 4A6QA 3DVGY 2VZKD 3EFUA 1SIFA 3ABVB 1U4AA 1ZOYB 1YX5B 4K7SA 2M19A 2MX2A 2K9XA 2M0XA 1E5WA 1T3QA 1QOAA 1GG3A 4A3PA 2BGFA 5DCNA 2G3QB 4ZRJA 2DZIA 2NR2A 1WSPA 1WGKA 1V80A 1FFUA 2VZKB 2BYEA 4N59A 2FCMA 3RD2A 1E7UA 1CJEA 1WYWB 4Q2JA 5C23A 2L00B 2HTME 4M8NA 5TSSA 4BFRA 3K9OB 1Z2MA 4C56C 4RMAA 4HCPB 1F1HA 4EUTA 3FC4A 1ZDVA 3ZUNA 3EFCA 4A55A 5J2RA 3SU8X 1YQ4B 3QQ8B 4HPPA 3ZLZA 1B1ZA 4US8A 4CO7A 4A90A 4W9DA 2ICIA 3ZTDA 1W6VA 3IAM1 5FR6A 1PYWD 3IG3A 1WXMA 2CKHB 5HKHA 3OLMD 1N5WA 2MH7A 5D94A 2KWUB 2RMMA 3I9V1 3AU4A 3PTFC 5BMGA 3AEGB 3CSTA 3OG5A 2GBNA 4BVUC 4WWMA 2GBKA 2HDEA 1YOVB 1VRAB 3DBLI 2KANA 4TMAB 3V05A 4JX1C 4LCDE 5CHFA 4E74A 2V3NA 4GMVA 2MRPA 3AXCA 5HI1A 1ZXIA 2KWDA 3ZNID 2IDYA 1L2NA 2KO3A 1SJED 1WJ6A 3KUCB 4K3CA 2J53A 4KGSA 1TS2A 1P1AA 1LXDA 2MJ3A 2JXXA 3ALBA 1D6EC 1S1QB 2KZRA 3BY4B 4ARCA 4RFBA 2KMMA 1AWDA 1IBXA 3L13A 1J8CA 4MJSB 4HROA 1SB3C 1UUPA 4WH4A 3NZSA 2KK8A 5AEKB 3APFA 4EZJA 3UQAA 1SE3A 2XEWA 1QZEA 2LI5A 2NBVB 2WXMA 3NVWA 4JL9A 2CJNA 3URYA 4ANXA 2KOXA 2LGDA 3BWUD 2WXLA 3MC9A 2BB6A 1D5ZC 1JMLA 1LGRA 1D3ZA 3UGBB 1C4PA 4I6LB 4YXDB 3GS2A 3U52E 1KLUD 3Q8BA 1BUIC 4QAYA 2W54A 3N1YC 3ZVVA 3FKYA 3J9CA 3DBLB 2C7MB 5E6OA 5IO9A 1YQ3B 1L6VA 4YL8A 4US9A 1XLNA 4DK5A 3PRMB 3ZXVA 3ZDMC 1PQSA 3PS6A 4BBNC 2DLBA 4ARIA 1FNWA 4HVBA 1WRDB 4WQMA 5EE3A 3W9CB 1NENB 1GNUA 3VRBB 1NVID 2N9XA 3PHXB 4JGHB 3C8YA 3I63C 4DHJD 4YTPB 3Q3OC 2KC1A 2LHDA 2MJDA 2NTTA 4W9LA 4BBNF 2RSUA 3U2SC 1JRPA 1MPEA 1T0YA 3KWLA 1BXTA 3KLSX 2N9EB 1AARA 4ZOHC 2VH2A 4XYCA 4N6EB 4LNKA 3Q14C 4WIPA 1TTNA 2NCNA 4ZYSA 1YN4A 2NBUA 2KMCA 4JPSA 2M1MA 3EA6A 4NQLB 4P6VF 3AEEB 2OJRA 4J3OD 1R4MI 1KLGD 2FUHB 4YTMB 5T8IA 2WXNA 2MBHA 1F9JA 3MP9A 4IG7B 4S17A 3WAOA 5GMVA 3AU5A 3CSFA 1KF6B 2KQ7A 3TCAA 1Z5SB 2X8XX 2INNE 1TGZB 1J7AA 3VTVA 3DBHI 5JH5C 2KVRA 4MH8A 2V0GA 4YT0B 1XO3A 2AQ2B 2JY6A 2N4FA 2IGHA 5GXGB 1I42A 1WH3A 2WYQA 2KDIA 1M4VA 4BAXA 1ZKHA 1HEZE 2WXFA 3ONSA 2IGGA 2GBMA 5MPOA 1VR9A 2LASA 3QAQA 1ET9A 3NVVA 1IBXB 3GE3C 1C1YB 2RPVA 3MC8A 4FHJA 4LDTD 4WJOA 3W1YA 1VLBA 2K8CA 1GC6A 3VR8B 4MM3A 1WGDA 3PZDA 1CZPA 4KGRA 1FRRA 4B0MA 3WAMA 4KVGB 3H6NA 4MGIE 3M3JA 1E8XA 2WNMA 4LNIA 3M63B 5D6JB 3E56A 3I5JC 2PE9A 3RZWC 1V1OA 2WP9B 1WXQA 1R4MB 2UU7A 2J0KA 3P4PB 4GLSC 4XZ4A 4N9F4 2J52A 2GLSA 2JXTA 3Q3FA 1WGHA 3L0WB 2NMQA 1WYGA 3HM3A 1JWMD 4MT5A 1EF1A 4B95A 2V3SA 4HDOA 2KACA 1GPXA 2DAJA 1JWSD 4J6IA 2LVPA 3DBHB 2UWQA 4HCNB 3DCGA 1FO4A 5L95C 2EKIA 3APCA 3HM6X 5DPWA 2PE6B 4OHJA 3AB5A 4ZRIA 3RNAC 1P7FA 2K6QA 3CF6E 2KLGA 2L1AA 2LZ6A 3N3KB 4TKNA 1MVKA 2DENB 3GE8C 2PEAA 3QHTA 4DBGA 2BS4B 2HD5B 1WWTA 4NAMA 2CHZA 5HFYA 1XXGA 3OWEB 3B2FA 5D7GA 4G11A 2DYMA 3AE3B 4K1RB 4IWOA 3ZQ4A 5D3DA 3HIZA 2H89B 4BKTA 2HE7A 2JYEA 3BYTB 2NBWB 4IKGA 3MJ5A 1FRDA 1FIQA 4LLGM 3P4RB 2QILA 2FAZA 5D2MB 3AE7B 4FJYA 3RUIB 2MBQA 4I6NB 2L83A 3QCAA 2D10A 3HVZA 1HTQA 2LUEA 3ZIMA 3TBLD 5TR5A 2CR5A 1KRHA 3NOBA 4E71A 1OEYA 2G1EA 3UIPB 2D3BA 2N1VA 3SD5A 3RFZB 2LJIA 3WCQA 1FCLA 4WURA 2A4ZA 3NHEB 2KLCA 2DNFA 2PPHA 3B2GA 3T3NA 2QDFA 4P1CC 2LWPA 2GBJA 1Q10A 2BF8B 1C76A 5G55A 2K0PA 1WJNA 3S2AA 1NYRA 3AE5B 1AN8A 3OAWA 4WJQA 4NAWB 1QILA 4IDIA 1XLPA 1VD2A 1RAXA 1WMHA 4NY0A 3U4EG 4O1NA 1HZ6A 3D32A 4MM3B 2KDEB 1EF5A 4P1BC 2BYTA 3SFDB 3BVMA 2NVUI 2WHIA 2DYOA 2FIFA 5EE9A 1ZE3D 3K9PB 1V9JA 2AEHA 3P42A 3VUYA 2V9HA 4P7IA 4RGOS 5H92C 1Q1OA 2JT4B 4HWIB 4RH6A 5CHVC 2JRHA 5EE1A 1STEA 1XLQA 3UINB 4RNAA 1PDXA 1ROEA 2G4SA 2I38A 3KYDD 3DPDA 4FULA 3DVNV 2QSDA 4R3DA 1GB4A 5J17A 3H1UA 3H8HA 3P2BA 2D5GA 4BKSA 2M17A 4BOZB 2NPTA 5AUIA 1WRIA 4PK1A 1B9RA 1NI2A 3JW0X 5BO4B 1UZXB 1QOGA 1HZ5A 2D2QA 2N7JA 5E6PA 2WXOA 4K81A 3TJPA 3AE6B 2DZKA 2LRWA 1I4GA 2INDC 1ACCA 1TKYA 2LEKA 3RNFC 4A8XC 2Q5WD 4RGNA 1EU4A 3LDZE 2QHOA 3L16A 3X0WA 3AEBB 2X38A 4E3CA 5C3JB 1I4XA 3V61A 1T6BX 2LFIA 1RFKA 2Z59B 4GU2A 5JHBA 1N60A 3AEAB 2GMIC 1ESFA 1MHHE 3A9KA 5IN7A 4LJPB 2OHFA 4D2KA 1Q0WB 2JVCA 3U30A 5IOIA 4HJKA 2PVGC 1IP9A 3KUDB 3W5UB 4M02A 3ENEA 4K7UA 3ZNGC 2MBEA 3LB8C 1BT0A 1WXAA 2INPE 2ONQA 3V60A 2Y5CA 3PRPB 2G4DB 5CX3A 4LNFA 2J4XA 2K39A 1GOZA 2LRUA 4TQ0A 2KVZA 2H88B 3Q8EA 2XN9C 1HTOA 2L7RA 3TEYA 2YLMA 2ZCBA 4ZDVA 3L4PA 1NDDA 3PVLA 1KH0A 1QOBA 2YEPB 3ECIA 4YSXB 2EMTA 4BZAA 4TUUA 1FNVA 1LQBA 2LVOA 1N5XA 2V4IB 2ASQA 4A3OA 1F0ZA 1KOTA 2PIAA 3KH0A 4USAA 2RDGA 4RM8A 3ZJTA 2Z0DB 1WR1A 3N30A 1WMHB 4WWPA 3NUHB 4DXGA 4OW0A 1GC7A 1WJUA 4ZRPA 4IM3A 4CHKA 4EZKA 4KX6B 2J0MA 2BT6A 2NS5A 2EKEC 1TY2A 4GSWA 1I7HA 5AUKA 3BK1A 4GN1A 2AQ1B 3P4QB 1M94A 2D3GA 3VAWA 3VR9B 2IJ0A 2GRIA 3BYYB 5LXIB 1OEYJ 1GUAB 3TL5A 4AQ7A 4KKJA
chains in the Genus database with same CATH topology
1Z5SB 3W1SA 2LVQA 2ZPYA 1TGZB 2HJ8A 2PJHA 3QARA 4I6PA 3VTVA 3DBHI 2DZJA 2KJHB 3PPAA 3UIOB 1XD3B 2BKFA 2NPTB 1WGGA 5JH5C 3LJ3A 3PLUA 1GJZA 2N7DA 2KVRA 1WJ4A 4ANUA 2JY6A 2N4FA 3KW5B 3R3MA 1I42A 1WH3A 2WYQA 1Y8RC 3PSEB 2KDIA 1E8ZA 1V6EA 1WXSA 1YIWA 1ZKHA 3JVZX 4MH0E 3ONSA 4DDID 1UD7A 2ZNVB 2GBMA 4K7WA 1WGRA 3IHPC 2LASA 3QAQA 5LXHA 2O6VA 4W9CA 4GIVA 5IAAC 4FADA 4FA6A 3PGEA 2J7QB 3DOWA 2BWFA 1RLFA 2XBBC 1IYFA 4G0NB 3V6EB 1C1YB 2L8JA 2ZVOA 4PS3A 4FHJA 2FNJB 4GB9A 4LDTD 4WJOA 3PT2B 3W1YA 2N7EA 2K8CA 1UH6A 1GC6A 4AWJA 1K8RB 1YQBA 2AL3A 2K1FA 1WGDA 3PZDA 4MM3A 2JF5A 4NQKE 4W9JA 3IFWB 4M0WB 3QC8B 3X23A 2WWZA 1UELA 2CU1A 2KWVB 1C3TA 1SGHA 1J19A 1YX6B 1EUVB 3WAMA 4KVGB 4EKUA 3VDZA 3H6NA 2KD0A 4MGKE 4MGIE 4WWNA 4GDKA 3M3JA 1E8XA 3VUXA 2ZEQA 3M63B 3SHQA 2KHWB 1V49A 2VRRB 2FCSA 4JLCA 4NNJB 5D6JB 4PS7A 2M8SA 5LLIA 2MSED 1J0GA 3OJ4B 1V5OA 1WM2A 3A9KB 2OOBB 1ZGUB 4IWQA 2PE9A 3RZWC 4W9KA 3V62A 3DDCB 2K25A 3V6CB 2C7NB 1XT9B 3UF8A 4HDQA 4KZCA 2J0KA 4ICVA 4XZ4A 1OGWA 4N9F4 5EDSA 1ZW7A 4MGZE 2K8HA 2MLBA 3KYCD 3A4SC 3JSVA 4TQ1A 3Q3FA 3MJWA 1UGMA 3B1LX 2MCNB 1WGHA 3L0WB 4ZYNA 3NZUA 3H9DA 3L10B 2IYDB 3WA0A 3HM3A 2D07B 1EF1A 3ZRFA 4B95A 2V3SA 4HDOA 4M8MA 5E6NA 2KFJA 2DAJA 2FIDA 2ZZPB 4OVUA 2KJRA 1I35A 4J6IA 2LVPA 2FCNA 4AP4C 1V2YA 3R66C 2ZJDA 2UWQA 4XX5A 4MELA 2L76A 2KNBA 4HCNB 2DZMA 3AULA 3R7RA 4BOSC 2R2QA 3DCGA 5DPRA 2AL6A 2CHWA 4G3XB 3Q3JA 3HHMA 2KWCA 1WGYA 2RR9A 3APCA 1OQYA 2BPSA 3H7PA 3HM6X 2FCQA 3JYUA 3L08A 3U7DA 4F1SA 2PE6B 5DPWA 4EZLA 5JZEB 4IM2A 4DHZE 1P3QU 4ZRIA 4KZ0A 1V81A 1X1MA 2KTRB 2AYOB 2K6QA 4MJSA 2JWZA 2WX1A 3CF6E 2KLGA 4B9KA 1LFDA 4IW0A 2LZ6A 3JSVB 3N3KB 3VXWA 2HTHA 4AJYB 4TKNA 4BKSD 3RZFA 4JQWC 5JHAA 2L3ZA 3KVFB 2DENB 1WFYA 2EMSA 4KIKB 1WX8A 2PEAA 3QHTA 4DBGA 2WDTB 1E8YA 2HD5B 2C7HA 2O2VA 4F7ZA 3B08A 1L7YA 3TMPB 3VH4B 4W9EA 2JRIB 2RGFA 4IWPA 3AI5A 4EEWA 4XC2A 2JUOA 2CHZA 4KSLC 1RFAA 2MP2B 2MW5A 3W1SC 1HE8A 4GDLA 5D7GA 4CYEA 4AOFA 2JPHA 2IO0B 4G11A 4DDGD 2DYMA 4KDIC 2KFKA 2Y5BB 2KKCA 4K1RB 4W9HA 3R7QA 4IWOA 4HLEA 1YJ1A 4OVVA 4PS8A 1WZ0A 3HIZA 1CMXB 3EHVA 1E8WA 2AWTA 5J18A 4BKTA 2HE7A 3A33B 2NBWB 4KDLB 4IC7B 2RPQA 4W9FA 1P98A 2IO2B 4AJWA 3BINA 2M4NA 4II3B 3VTWA 4B6WA 4MGYE 4KV2A 2FAZA 5D2MB 1TBEA 2C60A 3DVGY 2MBQA 3EFUA 4FJYA 3RUIB 4I6NB 1SIFA 3WIMA 3QCAA 2D10A 1U4AA 2DAFA 3PLVA 1VCBA 1KLVA 2LUEA 1YX5B 3ZIMA 4GOCA 4K7SA 3TBLD 2MX2A 5TR5A 2CR5A 3NOBA 4F8CB 4E71A 2J0JA 2M0XA 2O2VB 1E5WA 3IVFA 3ZKJC 2L0FA 1OEYA 3A1QB 1GG3A 3UIPB 4A3PA 4NAWA 2DYBA 3QWZB 1V5TA 2BGFA 2K8BA 4ASWC 4DXAB 5DCNA 4X57B 2G3QB 2N1VA 4ZRJA 2DZIA 2CS4A 3SD5A 2WX0A 2NR2A 2O6VD 2R2OA 1V80A 2BYEA 2FCMA 3RD2A 2ZVNA 3ZDTA 1E7UA 5C1ZA 3QX1A 2A4ZA 1WYWB 2K6DB 2RD0A 5C23A 2L00B 3NHEB 4M8NA 4BFRA 2KLCA 2D11A 1Z2MA 2V4LA 3K9OB 2PPHA 4RMAA 4MEMA 4ICUA 3DVNU 2KTFA 3APDA 2LWPA 2GBJA 4HCPB 4KSKC 2BF8B 3NS8A 4HPMB 4EUTA 1SE9A 1MG8A 2O6VB 2XK5A 5G55A 1TZ1A 3ZUNA 1WXVA 3IBEA 4MDKE 5J2RA 4TV3A 2BYVE 1WJNA 4II2B 3SU8X 3S2AA 3OAWA 4LJOB 4WJQA 3VH3B 4GGQA 3EC8A 3QQ8B 4NAWB 2KDBA 2KQSA 3I3TB 3ZLZA 1VD2A 1RAXA 4ZRKA 1WMHA 4NY0A 1S3SG 4PYUA 3D32A 4G50A 2KDEB 1EF5A 2MWSB 3U8ZA 3KUZA 4CO7A 1KM7A 4DWFA 4W9DA 3ZTDA 3GZNI 1WIAA 1UBQA 1P0RA 2V1YA 2NVUI 3DBRI 1W6VA 4GDKB 2DYOA 2FIFA 3EECA 3UQBA 2BKRB 4HK2A 5FR6A 3WALA 1E7VA 3IG3A 3K9PB 1V9JA 1WXMA 2AEHA 2CKHB 4MSMB 3OLMD 5D94A 5HKHA 3VVWB 2KWUB 2LXCA 3VUYA 1WR6E 3AU4A 4P7IA 3PTFC 1WZ3A 2KDFB 1Q1OA 3A9JA 2JT4B 4HWIB 2CHXA 3A4RA 3CSTA 3L17A 5CHVC 2JRHA 2GBNA 4BVUC 2GBKA 5KHOA 3UINB 4WAAA 3L54A 1WE7A 3TIXA 3DBLI 2YVCA 2KANA 1RRBA 2G4SA 3KYDD 2IO1B 2I1JA 4LCDE 5CHFA 3DPDA 4FULA 4E74A 5IA7A 3DVNV 4GMVA 2IY0B 2MRPA 4FJVB 4GXBA 3AXCA 5J17A 3H1UA 5CTRC 2LD9A 3ZNID 4BKSA 2N9PC 3P2BA 2KO3A 5G2NA 2M17A 1WJ6A 3KUCB 4BOZB 1L2NA 4DHJB 2NPTA 1LM8B 1WM3A 4JIOU 1P1AA 1LXDA 4WWOA 2LJ5A 1NI2A 3JW0X 5BO4B 5AZGA 1UZXB 2DHZA 1FXTB 5AZFA 3HK0A 2JXXA 4HPLB 4ANWA 2D2QA 3ALBA 2LGXA 2KZRA 1S1QB 1NBFC 3BY4B 5E6PA 1UBIA 3RYTA 2JZZA 2Z0EB 4K81A 3TJPA 3H7PB 3QJZA 2DZKA 3QA8A 2LRWA 2W9NA 2I1KA 3L13A 1J8CA 4EFOA 3PHWB 1IPGA 4MJSB 1WE6A 5L95C 5DPSA 2KX3A 4MSQB 3LDZE 2QHOA 2B3AA 3NZSA 3L16A 4PYZA 3X0WA 2KK8A 4WJNA 5AEKB 3APFA 4E3CA 4EZJA 2IY1B 3NY5A 3UQAA 1Q5WB 2XEWA 1QZEA 3WAPA 3WANA 4DHZB 2A5UA 3V61A 2GOWA 2LI5A 2NBVB 3ZNHB 2LGYA 2KN5A 4FHKA 3LMNA 2LXAA 3GOEA 4GDLB 3VQIA 2L0TA 4WJPA 2N1WA 2Z59B 4GU2A 1P9DU 4JL9A 3VFKA 5JHBA 2KFKB 4ANXA 4RM9A 2KOXA 5L83A 3SDLC 2LGDA 1E90A 2GMIC 2IZVB 3RULA 3A9KA 1D3ZA 4HXDA 4LJPB 3UGBB 4I6LB 2C9WB 2G45B 1Q0WB 4NPNA 4A20A 2JVCA 3U30A 2MQJA 4NJ6A 4HJKA 3ZVVA 1IP9A 3KUDB 3ENEA 1V86A 4K7UA 3ZNGC 1A5RA 3DVGX 2MBEA 2C7MB 3N32A 1BT0A 1WXAA 4NJ7A 4WQOB 5E6OA 3V60A 2DX5B 4YL8A 3PRPB 1R4NI 2KJ6A 2G4DB 4DK5A 5CX3A 3PRMB 1WF9A 3ZDMC 1PQSA 3PS6A 4BBNC 4FN2A 1EO6A 3VHTC 4HVBA 1H4RA 2ZCCA 2BWES 1WRDB 2K39A 2UYZB 3OJ3A 4LDTB 2LRUA 4TQ0A 3ZRCA 3PV1A 2ZPNA 2MA9B 3VUWA 2L05A 1WX9A 4AUQC 2L7RA 4IUMB 3H7SA 3DBSA 2KXJA 2YLMA 2ZCBA 4FLHA 4IM0A 4ZDVA 1NDDA 3PVLA 4FBJB 2BYFA 2KMAA 2KTRA 3CMMB 3ZTCA 3ECIA 2MBOA 1GNUA 2MBBB 2N9XA 3PHXB 2EMTA 4JGHB 4TUUA 5DPTA 4DHJD 2KC2A 2IBIB 1LQBA 2LVOA 2GBRA 2KC1A 2ASQA 2XK5B 3M95A 4KIKA 4A3OA 4ANVA 1KOTA 3RCZA 3KH0A 2IO3B 4FJZA 4W9LA 3MHSD 4BBNF 3PRZA 1WX7A 2RSUA 4RM8A 1XQQA 1OTRB 1T0YA 1WI0A 2N9EB 1AARA 2MP2A 2Z0DB 3ZW3A 1WR1A 3N30A 1WMHB 4WWPA 3DQVA 1KJTA 3ML9A 4W9GA 1GC7A 1TTNA 2NCNA 1WJUA 3PREA 3B0AA 4IM3A 2NBUA 2C5LC 4CHKA 2JZ3B 1WY8A 2KMCA 3T9LA 1G6JA 4EZKA 2M1MA 4NQLB 2J0MA 4W9IA 1ISNA 2NS5A 5CHWA 3RT3B 2EKEC 4EOYA 1YD8U 2OJRA 4GSWA 4BKGA 5AZHA 2ZNVC 3VTUA 3ZO5B 4GN1A 1R4MI 2FUHB 1M94A 3T8MA 2D3GA 3A9JB 2KX0A 3VAWA 2REXA 3MTNB 1H8CA 2MBHA 1F9JA 3ZNZB 3A1QA 3QK0A 5KHQA 4IG7B 5LXIB 1OEYJ 3M62B 3ML8A 3WAOA 1GUAB 3C0RB 1JRUA 5GMVA 3TL5A 3AU5A 4URKA 3O65B 3CSFA 2KQ7A 3QIJA 3TCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S B;  3W1S A;  2LVQ A;  2ZPY A;  1TGZ B;  2HJ8 A;  2PJH A;  3QAR A;  4I6P A;  3VTV A;  3DBH I;  2DZJ A;  2KJH B;  3PPA A;  3UIO B;  1XD3 B;  2BKF A;  2NPT B;  1WGG A;  5JH5 C;  3LJ3 A;  3PLU A;  1GJZ A;  2N7D A;  2KVR A;  1WJ4 A;  4ANU A;  2JY6 A;  2N4F A;  3KW5 B;  3R3M A;  1I42 A;  1WH3 A;  2WYQ A;  1Y8R C;  3PSE B;  2KDI A;  1E8Z A;  1V6E A;  1WXS A;  1YIW A;  1ZKH A;  3JVZ X;  4MH0 E;  3ONS A;  4DDI D;  1UD7 A;  2ZNV B;  2GBM A;  4K7W A;  1WGR A;  3IHP C;  2LAS A;  3QAQ A;  5LXH A;  2O6V A;  4W9C A;  4GIV A;  5IAA C;  4FAD A;  4FA6 A;  3PGE A;  2J7Q B;  3DOW A;  2BWF A;  1RLF A;  2XBB C;  1IYF A;  4G0N B;  3V6E B;  1C1Y B;  2L8J A;  2ZVO A;  4PS3 A;  4FHJ A;  2FNJ B;  4GB9 A;  4LDT D;  4WJO A;  3PT2 B;  3W1Y A;  2N7E A;  2K8C A;  1UH6 A;  1GC6 A;  4AWJ A;  1K8R B;  1YQB A;  2AL3 A;  2K1F A;  1WGD A;  3PZD A;  4MM3 A;  2JF5 A;  4NQK E;  4W9J A;  3IFW B;  4M0W B;  3QC8 B;  3X23 A;  2WWZ A;  1UEL A;  2CU1 A;  2KWV B;  1C3T A;  1SGH A;  1J19 A;  1YX6 B;  1EUV B;  3WAM A;  4KVG B;  4EKU A;  3VDZ A;  3H6N A;  2KD0 A;  4MGK E;  4MGI E;  4WWN A;  4GDK A;  3M3J A;  1E8X A;  3VUX A;  2ZEQ A;  3M63 B;  3SHQ A;  2KHW B;  1V49 A;  2VRR B;  2FCS A;  4JLC A;  4NNJ B;  5D6J B;  4PS7 A;  2M8S A;  5LLI A;  2MSE D;  1J0G A;  3OJ4 B;  1V5O A;  1WM2 A;  3A9K B;  2OOB B;  1ZGU B;  4IWQ A;  2PE9 A;  3RZW C;  4W9K A;  3V62 A;  3DDC B;  2K25 A;  3V6C B;  2C7N B;  1XT9 B;  3UF8 A;  4HDQ A;  4KZC A;  2J0K A;  4ICV A;  4XZ4 A;  1OGW A;  4N9F 4;  5EDS A;  1ZW7 A;  4MGZ E;  2K8H A;  2MLB A;  3KYC D;  3A4S C;  3JSV A;  4TQ1 A;  3Q3F A;  3MJW A;  1UGM A;  3B1L X;  2MCN B;  1WGH A;  3L0W B;  4ZYN A;  3NZU A;  3H9D A;  3L10 B;  2IYD B;  3WA0 A;  3HM3 A;  2D07 B;  1EF1 A;  3ZRF A;  4B95 A;  2V3S A;  4HDO A;  4M8M A;  5E6N A;  2KFJ A;  2DAJ A;  2FID A;  2ZZP B;  4OVU A;  2KJR A;  1I35 A;  4J6I A;  2LVP A;  2FCN A;  4AP4 C;  1V2Y A;  3R66 C;  2ZJD A;  2UWQ A;  4XX5 A;  4MEL A;  2L76 A;  2KNB A;  4HCN B;  2DZM A;  3AUL A;  3R7R A;  4BOS C;  2R2Q A;  3DCG A;  5DPR A;  2AL6 A;  2CHW A;  4G3X B;  3Q3J A;  3HHM A;  2KWC A;  1WGY A;  2RR9 A;  3APC A;  1OQY A;  2BPS A;  3H7P A;  3HM6 X;  2FCQ A;  3JYU A;  3L08 A;  3U7D A;  4F1S A;  2PE6 B;  5DPW A;  4EZL A;  5JZE B;  4IM2 A;  4DHZ E;  1P3Q U;  4ZRI A;  4KZ0 A;  1V81 A;  1X1M A;  2KTR B;  2AYO B;  2K6Q A;  4MJS A;  2JWZ A;  2WX1 A;  3CF6 E;  2KLG A;  4B9K A;  1LFD A;  4IW0 A;  2LZ6 A;  3JSV B;  3N3K B;  3VXW A;  2HTH A;  4AJY B;  4TKN A;  4BKS D;  3RZF A;  4JQW C;  5JHA A;  2L3Z A;  3KVF B;  2DEN B;  1WFY A;  2EMS A;  4KIK B;  1WX8 A;  2PEA A;  3QHT A;  4DBG A;  2WDT B;  1E8Y A;  2HD5 B;  2C7H A;  2O2V A;  4F7Z A;  3B08 A;  1L7Y A;  3TMP B;  3VH4 B;  4W9E A;  2JRI B;  2RGF A;  4IWP A;  3AI5 A;  4EEW A;  4XC2 A;  2JUO A;  2CHZ A;  4KSL C;  1RFA A;  2MP2 B;  2MW5 A;  3W1S C;  1HE8 A;  4GDL A;  5D7G A;  4CYE A;  4AOF A;  2JPH A;  2IO0 B;  4G11 A;  4DDG D;  2DYM A;  4KDI C;  2KFK A;  2Y5B B;  2KKC A;  4K1R B;  4W9H A;  3R7Q A;  4IWO A;  4HLE A;  1YJ1 A;  4OVV A;  4PS8 A;  1WZ0 A;  3HIZ A;  1CMX B;  3EHV A;  1E8W A;  2AWT A;  5J18 A;  4BKT A;  2HE7 A;  3A33 B;  2NBW B;  4KDL B;  4IC7 B;  2RPQ A;  4W9F A;  1P98 A;  2IO2 B;  4AJW A;  3BIN A;  2M4N A;  4II3 B;  3VTW A;  4B6W A;  4MGY E;  4KV2 A;  2FAZ A;  5D2M B;  1TBE A;  2C60 A;  3DVG Y;  2MBQ A;  3EFU A;  4FJY A;  3RUI B;  4I6N B;  1SIF A;  3WIM A;  3QCA A;  2D10 A;  1U4A A;  2DAF A;  3PLV A;  1VCB A;  1KLV A;  2LUE A;  1YX5 B;  3ZIM A;  4GOC A;  4K7S A;  3TBL D;  2MX2 A;  5TR5 A;  2CR5 A;  3NOB A;  4F8C B;  4E71 A;  2J0J A;  2M0X A;  2O2V B;  1E5W A;  3IVF A;  3ZKJ C;  2L0F A;  1OEY A;  3A1Q B;  1GG3 A;  3UIP B;  4A3P A;  4NAW A;  2DYB A;  3QWZ B;  1V5T A;  2BGF A;  2K8B A;  4ASW C;  4DXA B;  5DCN A;  4X57 B;  2G3Q B;  2N1V A;  4ZRJ A;  2DZI A;  2CS4 A;  3SD5 A;  2WX0 A;  2NR2 A;  2O6V D;  2R2O A;  1V80 A;  2BYE A;  2FCM A;  3RD2 A;  2ZVN A;  3ZDT A;  1E7U A;  5C1Z A;  3QX1 A;  2A4Z A;  1WYW B;  2K6D B;  2RD0 A;  5C23 A;  2L00 B;  3NHE B;  4M8N A;  4BFR A;  2KLC A;  2D11 A;  1Z2M A;  2V4L A;  3K9O B;  2PPH A;  4RMA A;  4MEM A;  4ICU A;  3DVN U;  2KTF A;  3APD A;  2LWP A;  2GBJ A;  4HCP B;  4KSK C;  2BF8 B;  3NS8 A;  4HPM B;  4EUT A;  1SE9 A;  1MG8 A;  2O6V B;  2XK5 A;  5G55 A;  1TZ1 A;  3ZUN A;  1WXV A;  3IBE A;  4MDK E;  5J2R A;  4TV3 A;  2BYV E;  1WJN A;  4II2 B;  3SU8 X;  3S2A A;  3OAW A;  4LJO B;  4WJQ A;  3VH3 B;  4GGQ A;  3EC8 A;  3QQ8 B;  4NAW B;  2KDB A;  2KQS A;  3I3T B;  3ZLZ A;  1VD2 A;  1RAX A;  4ZRK A;  1WMH A;  4NY0 A;  1S3S G;  4PYU A;  3D32 A;  4G50 A;  2KDE B;  1EF5 A;  2MWS B;  3U8Z A;  3KUZ A;  4CO7 A;  1KM7 A;  4DWF A;  4W9D A;  3ZTD A;  3GZN I;  1WIA A;  1UBQ A;  1P0R A;  2V1Y A;  2NVU I;  3DBR I;  1W6V A;  4GDK B;  2DYO A;  2FIF A;  3EEC A;  3UQB A;  2BKR B;  4HK2 A;  5FR6 A;  3WAL A;  1E7V A;  3IG3 A;  3K9P B;  1V9J A;  1WXM A;  2AEH A;  2CKH B;  4MSM B;  3OLM D;  5D94 A;  5HKH A;  3VVW B;  2KWU B;  2LXC A;  3VUY A;  1WR6 E;  3AU4 A;  4P7I A;  3PTF C;  1WZ3 A;  2KDF B;  1Q1O A;  3A9J A;  2JT4 B;  4HWI B;  2CHX A;  3A4R A;  3CST A;  3L17 A;  5CHV C;  2JRH A;  2GBN A;  4BVU C;  2GBK A;  5KHO A;  3UIN B;  4WAA A;  3L54 A;  1WE7 A;  3TIX A;  3DBL I;  2YVC A;  2KAN A;  1RRB A;  2G4S A;  3KYD D;  2IO1 B;  2I1J A;  4LCD E;  5CHF A;  3DPD A;  4FUL A;  4E74 A;  5IA7 A;  3DVN V;  4GMV A;  2IY0 B;  2MRP A;  4FJV B;  4GXB A;  3AXC A;  5J17 A;  3H1U A;  5CTR C;  2LD9 A;  3ZNI D;  4BKS A;  2N9P C;  3P2B A;  2KO3 A;  5G2N A;  2M17 A;  1WJ6 A;  3KUC B;  4BOZ B;  1L2N A;  4DHJ B;  2NPT A;  1LM8 B;  1WM3 A;  4JIO U;  1P1A A;  1LXD A;  4WWO A;  2LJ5 A;  1NI2 A;  3JW0 X;  5BO4 B;  5AZG A;  1UZX B;  2DHZ A;  1FXT B;  5AZF A;  3HK0 A;  2JXX A;  4HPL B;  4ANW A;  2D2Q A;  3ALB A;  2LGX A;  2KZR A;  1S1Q B;  1NBF C;  3BY4 B;  5E6P A;  1UBI A;  3RYT A;  2JZZ A;  2Z0E B;  4K81 A;  3TJP A;  3H7P B;  3QJZ A;  2DZK A;  3QA8 A;  2LRW A;  2W9N A;  2I1K A;  3L13 A;  1J8C A;  4EFO A;  3PHW B;  1IPG A;  4MJS B;  1WE6 A;  5L95 C;  5DPS A;  2KX3 A;  4MSQ B;  3LDZ E;  2QHO A;  2B3A A;  3NZS A;  3L16 A;  4PYZ A;  3X0W A;  2KK8 A;  4WJN A;  5AEK B;  3APF A;  4E3C A;  4EZJ A;  2IY1 B;  3NY5 A;  3UQA A;  1Q5W B;  2XEW A;  1QZE A;  3WAP A;  3WAN A;  4DHZ B;  2A5U A;  3V61 A;  2GOW A;  2LI5 A;  2NBV B;  3ZNH B;  2LGY A;  2KN5 A;  4FHK A;  3LMN A;  2LXA A;  3GOE A;  4GDL B;  3VQI A;  2L0T A;  4WJP A;  2N1W A;  2Z59 B;  4GU2 A;  1P9D U;  4JL9 A;  3VFK A;  5JHB A;  2KFK B;  4ANX A;  4RM9 A;  2KOX A;  5L83 A;  3SDL C;  2LGD A;  1E90 A;  2GMI C;  2IZV B;  3RUL A;  3A9K A;  1D3Z A;  4HXD A;  4LJP B;  3UGB B;  4I6L B;  2C9W B;  2G45 B;  1Q0W B;  4NPN A;  4A20 A;  2JVC A;  3U30 A;  2MQJ A;  4NJ6 A;  4HJK A;  3ZVV A;  1IP9 A;  3KUD B;  3ENE A;  1V86 A;  4K7U A;  3ZNG C;  1A5R A;  3DVG X;  2MBE A;  2C7M B;  3N32 A;  1BT0 A;  1WXA A;  4NJ7 A;  4WQO B;  5E6O A;  3V60 A;  2DX5 B;  4YL8 A;  3PRP B;  1R4N I;  2KJ6 A;  2G4D B;  4DK5 A;  5CX3 A;  3PRM B;  1WF9 A;  3ZDM C;  1PQS A;  3PS6 A;  4BBN C;  4FN2 A;  1EO6 A;  3VHT C;  4HVB A;  1H4R A;  2ZCC A;  2BWE S;  1WRD B;  2K39 A;  2UYZ B;  3OJ3 A;  4LDT B;  2LRU A;  4TQ0 A;  3ZRC A;  3PV1 A;  2ZPN A;  2MA9 B;  3VUW A;  2L05 A;  1WX9 A;  4AUQ C;  2L7R A;  4IUM B;  3H7S A;  3DBS A;  2KXJ A;  2YLM A;  2ZCB A;  4FLH A;  4IM0 A;  4ZDV A;  1NDD A;  3PVL A;  4FBJ B;  2BYF A;  2KMA A;  2KTR A;  3CMM B;  3ZTC A;  3ECI A;  2MBO A;  1GNU A;  2MBB B;  2N9X A;  3PHX B;  2EMT A;  4JGH B;  4TUU A;  5DPT A;  4DHJ D;  2KC2 A;  2IBI B;  1LQB A;  2LVO A;  2GBR A;  2KC1 A;  2ASQ A;  2XK5 B;  3M95 A;  4KIK A;  4A3O A;  4ANV A;  1KOT A;  3RCZ A;  3KH0 A;  2IO3 B;  4FJZ A;  4W9L A;  3MHS D;  4BBN F;  3PRZ A;  1WX7 A;  2RSU A;  4RM8 A;  1XQQ A;  1OTR B;  1T0Y A;  1WI0 A;  2N9E B;  1AAR A;  2MP2 A;  2Z0D B;  3ZW3 A;  1WR1 A;  3N30 A;  1WMH B;  4WWP A;  3DQV A;  1KJT A;  3ML9 A;  4W9G A;  1GC7 A;  1TTN A;  2NCN A;  1WJU A;  3PRE A;  3B0A A;  4IM3 A;  2NBU A;  2C5L C;  4CHK A;  2JZ3 B;  1WY8 A;  2KMC A;  3T9L A;  1G6J A;  4EZK A;  2M1M A;  4NQL B;  2J0M A;  4W9I A;  1ISN A;  2NS5 A;  5CHW A;  3RT3 B;  2EKE C;  4EOY A;  1YD8 U;  2OJR A;  4GSW A;  4BKG A;  5AZH A;  2ZNV C;  3VTU A;  3ZO5 B;  4GN1 A;  1R4M I;  2FUH B;  1M94 A;  3T8M A;  2D3G A;  3A9J B;  2KX0 A;  3VAW A;  2REX A;  3MTN B;  1H8C A;  2MBH A;  1F9J A;  3ZNZ B;  3A1Q A;  3QK0 A;  5KHQ A;  4IG7 B;  5LXI B;  1OEY J;  3M62 B;  3ML8 A;  3WAO A;  1GUA B;  3C0R B;  1JRU A;  5GMV A;  3TL5 A;  3AU5 A;  4URK A;  3O65 B;  3CSF A;  2KQ7 A;  3QIJ A;  3TCA A; 
#chains in the Genus database with same CATH topology
 3W1S A;  3EGR A;  1JW9 D;  2JWU A;  4UDU C;  1C78 A;  3QAR A;  3AN1 A;  4I6P A;  2BKF A;  2NPT B;  1N61 A;  3T3O A;  1GJZ A;  2N7D A;  3AE1 B;  1WJ4 A;  4ANU A;  3ZJU A;  5D3I B;  4OZC A;  4DQO C;  4OZB A;  1NYQ A;  1E8Z A;  1YIW A;  2JSV X;  3PZ7 A;  4K7W A;  1WGR A;  2ACZ B;  4P16 A;  1JWU D;  5LXH A;  2O6V A;  3AE4 B;  5IAA C;  4FA6 A;  3PGE A;  3DOW A;  2XBB C;  3SR6 A;  4G0N B;  2ZVO A;  3E9S A;  3NG0 A;  2N7E A;  1FFV A;  1YQB A;  2WWZ A;  1OQR A;  2MHJ A;  2G9H D;  3VDZ A;  4WWN A;  3Q8A A;  4RF0 A;  1MJD A;  3VUX A;  3NVY A;  2KHW B;  3C19 A;  4B0E A;  1V1P A;  1V8C A;  2VRR B;  2FCS A;  1TS4 A;  4JLC A;  2RDH A;  1L0V B;  1JQ4 A;  1OFF A;  2KYW A;  3A9K B;  2OOB B;  3HUI A;  4IWQ A;  1NEK B;  2K25 A;  2C7N B;  4RF1 A;  2LGS A;  4KZC A;  3PZ8 A;  2ZW1 A;  4TQ1 A;  1K52 A;  2LGI A;  3R2T A;  4HEA 1;  3MJW A;  1UGM A;  3B1L X;  1N6Z A;  4OVZ A;  2W55 A;  3HVD A;  3IT6 B;  1YJI A;  3TEW A;  4OVU A;  2KJR A;  2KQ4 X;  2W82 A;  5C2T B;  3P4S B;  1XF5 L;  2KNB A;  4S0R A;  2N9K A;  2CJO A;  2R2Q A;  2CHW A;  3ZRF A;  3JYU A;  1I35 A;  4F1S A;  3L08 A;  2FCQ A;  1HQR D;  3RNG C;  4DHZ E;  3N9Y C;  4KZ0 A;  1FM0 D;  1JCK B;  2D3A A;  3NZ3 A;  4B9K A;  3KQ4 A;  3JSV B;  3VXW A;  2HTH A;  3CWI A;  3KVF B;  1T0R C;  1WFY A;  2WXH A;  1WX8 A;  1E8Y A;  2C7H A;  4F7Z A;  3B08 A;  1L7Y A;  3VH4 B;  4IWP A;  4XC2 A;  4KSL C;  3W1S C;  1HE8 A;  2JPH A;  1EWC A;  1TZO A;  4W9H A;  2Y3A A;  2Y5B B;  2KKC A;  4HLE A;  2OED A;  1YJ1 A;  4PS8 A;  2BS3 B;  4ZHP A;  1E8W A;  3PO0 A;  5J18 A;  2IGD A;  2INC C;  4HKQ A;  4W9F A;  1P98 A;  2IO2 B;  4AJW A;  2BQQ A;  4MGY E;  1UF0 A;  3Q3M C;  2W3S A;  4LNN A;  3BZD B;  3PLV A;  1VCB A;  1KLV A;  2J0J A;  2L0F A;  4NAW A;  2WXI A;  2DYB A;  3QWZ B;  1V5T A;  4DXA B;  1Y56 A;  4X57 B;  2CS4 A;  1UGJ A;  2WX0 A;  2N0S B;  2O6V D;  1DGJ A;  2R2O A;  2NTS A;  3DWM A;  5C1Z A;  3QX1 A;  2JZP A;  1L0Y B;  1QT9 A;  1T0S C;  2K6D B;  2RD0 A;  2WXQ A;  2D11 A;  2V4L A;  4TSS A;  1L4D B;  2JYT A;  4MEM A;  2M0A A;  2KTF A;  3APD A;  4XGA B;  2ZW0 A;  4KSK C;  4HPM B;  1QOF A;  1SE9 A;  2O6V B;  1TZ1 A;  1WXV A;  3IBE A;  4TV3 A;  2BYV E;  1J7C A;  2K5P A;  4LJO B;  3VH3 B;  4GGQ A;  3EC8 A;  2KDB A;  2WU5 B;  1R7S A;  4ZRK A;  1S3S G;  4PYU A;  2MWS B;  4DWF A;  1DOI A;  3GZN I;  1WIA A;  3DBR I;  3N1X C;  3EEC A;  2BKR B;  3O13 A;  1N63 A;  4LTU A;  3WAL A;  1E7V A;  1V1P B;  1FMA D;  3ZYY X;  2LXC A;  3FIL A;  4IOI E;  1WR6 E;  2KDF B;  3R8B A;  3A9J A;  2CHX A;  2WQY B;  3NS1 A;  1WE7 A;  3TIX A;  2YVC A;  1AYF A;  5IA7 A;  1FD6 A;  2IY0 B;  4FJV B;  4GXB A;  5LNK 1;  1SBB B;  5CTR C;  5G2N A;  2R61 A;  2WDR B;  4JIO U;  1WM3 A;  1N62 A;  4WWO A;  1SSN A;  2LJ5 A;  3AH7 A;  2PLP A;  1FCC C;  1UWM A;  2DHZ A;  2QJL A;  1FXT B;  3HK0 A;  4ANW A;  4HPL B;  2ON8 A;  2LMC A;  3W5V B;  3GB1 A;  1MI0 A;  4EFO A;  1IPG A;  1ZPS A;  3BVZ A;  2XNA C;  5DPS A;  1AW7 A;  1MG4 A;  4WJN A;  1TIF A;  1Q5W B;  1L6U A;  4XDC A;  4DHZ B;  2GOW A;  3ZNH B;  4FHK A;  3LMN A;  5FK9 C;  2LXA A;  3VQI A;  3RPF C;  2E3T A;  3GZN B;  4WJP A;  2N1W A;  1P9D U;  1SEB D;  3DBR B;  1EU3 A;  4XWT A;  2FBW B;  2BB5 A;  3AEF B;  3RN9 C;  1VJK A;  2G45 B;  1F2R I;  2FUG 1;  3NJT A;  2MQJ A;  4NJ6 A;  2PKO A;  3HRD D;  2QMT A;  1D5X C;  1V86 A;  2AX5 A;  1F77 A;  4NJ7 A;  1R4N I;  3BVG A;  1JWA D;  1WF9 A;  1KTK A;  2WDQ B;  4FN2 A;  1EO6 A;  3VHT C;  1E6E B;  2ZCC A;  2BWE S;  1BML C;  4L2Y A;  1TT5 B;  3ZRC A;  3AE2 B;  3VUW A;  3SFE B;  4IUM B;  2LUM A;  4FLH A;  4IM0 A;  3VRA B;  4FBJ B;  2BYF A;  4DXF A;  3DHG C;  1HA5 A;  2KMA A;  2V3P A;  3Q8F A;  3CMM B;  3ZTC A;  2K22 A;  2MBB B;  1PGA A;  1F2R C;  5DPT A;  1V97 A;  4ANV A;  3IT4 B;  3RCZ A;  3AE8 B;  4FJZ A;  1C9F A;  1WX7 A;  2LHE A;  3AEC B;  3ZW3 A;  2Y5P A;  3TUO A;  5G5G A;  2PVO D;  1P7E A;  1J7B A;  4W9G A;  5FKA C;  4C4V A;  1VDV A;  2JZ3 B;  1WY8 A;  3T9L A;  1G6J A;  4YSY B;  4LNO A;  1ISN A;  3RT3 B;  1YD8 U;  4BKG A;  3AED B;  4C7Y A;  5AZH A;  3VTU A;  1T0Q C;  3FIL B;  2FE8 A;  3ZO5 B;  3T8M A;  3A9J B;  2KX0 A;  3MHZ A;  3MTN B;  4M00 A;  2N9L A;  3A1Q A;  3M62 B;  1HXY D;  5BMH A;  3O65 B;  4YWG G;  3GP7 A;  1KFY B;  1R4N B;  2PJH A;  3N20 C;  1L5P A;  2DZJ A;  2JQR B;  2KJH B;  3PPA A;  4RGM A;  1XD3 B;  1QKZ A;  3LJ3 A;  3PLU A;  1YNT E;  1QQR A;  3KW5 B;  3R3M A;  2JX5 A;  1V6E A;  1WXS A;  1PGX A;  3JVZ X;  4MH0 E;  4DDI D;  1ZP0 B;  2RDB C;  4FAD A;  3AV8 A;  2J7Q B;  1RLF A;  1IYF A;  3V6E B;  1I4R A;  4XWW A;  3MC0 B;  2BW2 A;  2FNJ B;  3LYY A;  1I4P A;  2PTL A;  3IAS 1;  1K8R B;  2AL3 A;  2K1F A;  4W9J A;  2HJ1 A;  4JE3 B;  4NQK E;  3IFW B;  2CU1 A;  2KWV B;  1C3T A;  1SGH A;  4EKU A;  4EE2 A;  4MGK E;  4GDK A;  3DHH C;  2ZEQ A;  2QEJ C;  1V49 A;  1ET6 A;  2M8S A;  4KGT A;  2MSE D;  2YEP F;  1C4A A;  1WM2 A;  3U7Z A;  2DBY A;  1ZGU B;  3V62 A;  4W9K A;  3Q3N C;  4LK0 M;  3UF8 A;  4HDQ A;  4MGZ E;  2MLB A;  3KYC D;  3ZGZ A;  3A4S C;  3JSV A;  1YN5 A;  1MFW A;  3H9D A;  1JAL A;  3WA0 A;  2D07 B;  4M8M A;  4NJC A;  1XEE A;  2KFJ A;  2FID A;  2ZZP B;  2WGS A;  3R66 C;  2ZJD A;  1IGD A;  4XX5 A;  4MEL A;  2L76 A;  2BTE A;  4N58 A;  3V3X A;  2DZM A;  3R7R A;  4BOS C;  5DPR A;  2AL6 A;  3Q3J A;  3HHM A;  2KWC A;  3X23 A;  2RR9 A;  3U7D A;  1OQY A;  2BPS A;  3H7P A;  1C79 A;  2WXR A;  5JZE B;  3AM9 A;  2WU2 B;  1XLO A;  4H2A A;  1X1M A;  5BYQ A;  2JWZ A;  4XDD A;  2EEL A;  3EUB 2;  1LFD A;  4AJY B;  4BKS D;  5JHA A;  1SF0 A;  1I4H A;  2EMS A;  1D4B A;  2WDT B;  1PFD A;  3TMP B;  4W9E A;  2RGF A;  3AI5 A;  4EEW A;  1RFA A;  2MW5 A;  2QIE B;  5HHD G;  2AQ3 B;  4GDL A;  2PMV A;  2VH1 A;  4KDI C;  2KFK A;  4C4V B;  2SEB D;  1TS5 A;  1CMX B;  1RWS A;  3BK2 A;  2WXG A;  2DWQ A;  4IC7 B;  1MHX A;  3BIN A;  4RCO A;  4II3 B;  4B6W A;  3VTW A;  1VZ7 A;  4KV2 A;  1TBE A;  2C60 A;  3I57 A;  3WIM A;  3DHI C;  4HRS A;  2DAF A;  5IP4 D;  5EE0 A;  2K3U A;  4GOC A;  1YJJ A;  1YMH E;  4F8C B;  3IVF A;  2O2V B;  3ZKJ C;  3A1Q B;  2OJW A;  2K8B A;  4ASW C;  4PT5 A;  3RNE C;  1PUT A;  4C00 A;  2ZVN A;  3ZDT A;  2B76 B;  1TJE A;  1C77 A;  1CQV A;  1FPY A;  4ICU A;  3DVN U;  1TKG A;  2KDM A;  2KN4 A;  3NS8 A;  2BVC A;  5E6J A;  1MG8 A;  2XK5 A;  1K51 A;  4MDK E;  4KKI A;  4II2 B;  1TYG B;  2PW9 A;  2KQS A;  3I3T B;  4L23 A;  4FXC A;  1IGC A;  1DYQ A;  4G50 A;  5G5H A;  3U8Z A;  3KUZ A;  1KM7 A;  1RM6 C;  1UBQ A;  1P0R A;  2V1Y A;  2WLB A;  1A70 A;  3P63 A;  4REZ A;  4GDK B;  3UQB A;  5HG2 A;  4HK2 A;  3BII D;  1SIJ A;  4MSM B;  4NZL B;  3VVW B;  3TSS A;  2BS2 B;  1WZ3 A;  1SE2 A;  2L32 A;  3A4R A;  3L17 A;  4YSZ B;  5KHO A;  4WAA A;  2WS3 B;  3L54 A;  1RRB A;  4ITK A;  2IO1 B;  2I1J A;  2LD9 A;  2N9P C;  4A9A A;  4DHJ B;  1LM8 B;  3R2I A;  2KT7 A;  2IPK D;  1ZXH A;  1QF6 A;  5AZG A;  3UI3 A;  5AZF A;  4RGT A;  2LGX A;  1UNS A;  1NBF C;  3RYT A;  1UBI A;  2JZZ A;  2Z0E B;  4M01 A;  3H7P B;  1EWY C;  3QJZ A;  1F52 A;  4WAF A;  5I4D A;  3QA8 A;  2W9N A;  2I1K A;  3PHW B;  2WXJ A;  1WE6 A;  1EM7 A;  2KX3 A;  4MSQ B;  2B3A A;  4K3B A;  4PYZ A;  4C80 A;  4M0W A;  2IY1 B;  3NY5 A;  1UWX A;  3WAP A;  3WAN A;  2A5U A;  3Q6B A;  1JRO A;  2LGY A;  2J42 A;  2KN5 A;  3GOE A;  4ACF A;  1GAQ B;  4GDL B;  2L0T A;  1FXA A;  3VFK A;  2KFK B;  5L83 A;  4RM9 A;  2CU3 A;  3SDL C;  3W2D A;  3Q69 A;  1SXT A;  1E90 A;  3RUL A;  1D5M C;  2IZV B;  5IKC M;  1ZUD 2;  2MJE A;  4HXD A;  2WXP A;  1VZ8 A;  4YTN B;  2C9W B;  4NPN A;  4A20 A;  5JXV A;  4OZA A;  1XCT L;  3RMK C;  1OQQ A;  2MEK A;  2W3R A;  3AMZ A;  1TKE A;  2GI9 A;  1A5R A;  3DVG X;  2SAK A;  2JU6 X;  4ZHO A;  3N32 A;  4WQO B;  2DX5 B;  3ETR A;  1FXI A;  3Q2A C;  1H4R A;  3OJ3 A;  2UYZ B;  4LDT B;  3PV1 A;  2ZPN A;  2MA9 B;  2L05 A;  1WX9 A;  4AUQ C;  1L4Z B;  3FAH A;  3H7S A;  2M56 B;  3DBS A;  2KXJ A;  5BYR A;  2QC8 A;  5FR3 A;  2KTR A;  4MAC A;  2MBO A;  3RNB C;  3CIR B;  1JWB D;  2IBI B;  2KC2 A;  3RNC C;  2GBR A;  2XK5 B;  3M95 A;  4KIK A;  2TSS A;  1YN3 A;  3SEB A;  2IO3 B;  3MHS D;  3PRZ A;  1XQQ A;  1OTR B;  1WI0 A;  2MP2 A;  1RYJ A;  4AS1 A;  3DQV A;  1KJT A;  1XCQ L;  2WDV B;  3ML9 A;  3IXS A;  2GB1 A;  3PRE A;  3B0A A;  2C5L C;  4ZRQ A;  2WXK A;  1C4C A;  4W9I A;  5CHW A;  4EOY A;  1TY0 A;  2ZNV C;  2REX A;  2BBC A;  1H8C A;  3ZNZ B;  3QK0 A;  5KHQ A;  3ML8 A;  3C0R B;  1JRU A;  4URK A;  2KJ6 A;  3QIJ A;  2LVQ A;  2I2Y A;  2ZPY A;  2HJ8 A;  1DOX A;  3ZXR A;  3UIO B;  1WGG A;  2E6X A;  1VZ6 A;  1Y8R C;  3PSE B;  3NVZ A;  5BYS A;  1DOY A;  1UD7 A;  4L1B A;  2ZNV B;  3IHP C;  4W9C A;  4GIV A;  2BWF A;  3DWG C;  3KWV A;  1SJH D;  2L8J A;  4PS3 A;  4GB9 A;  1PGB A;  3PT2 B;  1UH6 A;  3TEX A;  4AWJ A;  1IUE A;  2JF5 A;  3NRZ A;  4M0W B;  3QC8 B;  1UEL A;  4C7Z A;  1ZDX A;  1J19 A;  1YX6 B;  1EUV B;  5BMI A;  1L0X B;  2KD0 A;  1I4Q A;  3RI7 C;  2KAJ A;  1NI3 A;  3MFG A;  3SHQ A;  4NNJ B;  4PS7 A;  5LLI A;  1J0G A;  3OJ4 B;  3AE9 B;  1V5O A;  3N1Z C;  4HJG E;  3DDC B;  3V6C B;  1XT9 B;  4XE0 A;  4ICV A;  5EDS A;  1OGW A;  1T5X D;  1ZW7 A;  2K8H A;  4JWU C;  3LXF A;  1FNU A;  2MCN B;  1E9M A;  4ZYN A;  3NZU A;  3L10 B;  2IYD B;  5E6N A;  1TS3 A;  2FCN A;  4JWS C;  4AP4 C;  1V2Y A;  1E7P B;  3P1M A;  3AUL A;  1ENF A;  4G3X B;  1WGY A;  2Z8L A;  4CQN A;  4EZL A;  4IM2 A;  1P3Q U;  5H8Y E;  1V81 A;  2L52 A;  2KTR B;  2AYO B;  2D3C A;  4MJS A;  2WX1 A;  1CK1 A;  1GB1 A;  4IW0 A;  1K50 A;  1LO5 D;  3B9J A;  1E0Z A;  1K53 A;  3RZF A;  3ZJV A;  4JQW C;  2L3Z A;  4KIK B;  1E10 A;  2O2V A;  2JRI B;  2JUO A;  2MP2 B;  4CYE A;  4AOF A;  2IO0 B;  4DDG D;  3TEZ A;  3R7Q A;  4OVV A;  1WZ0 A;  3EHV A;  4HKZ E;  2AWT A;  1SE4 A;  1QLB B;  3A33 B;  4KDL B;  1FEH A;  2RPQ A;  2QCZ A;  3Q8C A;  2M4N A;  4A6Q A;  3DVG Y;  2VZK D;  3EFU A;  1SIF A;  3ABV B;  1U4A A;  1ZOY B;  1YX5 B;  4K7S A;  2M19 A;  2MX2 A;  2K9X A;  2M0X A;  1E5W A;  1T3Q A;  1QOA A;  1GG3 A;  4A3P A;  2BGF A;  5DCN A;  2G3Q B;  4ZRJ A;  2DZI A;  2NR2 A;  1WSP A;  1WGK A;  1V80 A;  1FFU A;  2VZK B;  2BYE A;  4N59 A;  2FCM A;  3RD2 A;  1E7U A;  1CJE A;  1WYW B;  4Q2J A;  5C23 A;  2L00 B;  2HTM E;  4M8N A;  5TSS A;  4BFR A;  3K9O B;  1Z2M A;  4C56 C;  4RMA A;  4HCP B;  1F1H A;  4EUT A;  3FC4 A;  1ZDV A;  3ZUN A;  3EFC A;  4A55 A;  5J2R A;  3SU8 X;  1YQ4 B;  3QQ8 B;  4HPP A;  3ZLZ A;  1B1Z A;  4US8 A;  4CO7 A;  4A90 A;  4W9D A;  2ICI A;  3ZTD A;  1W6V A;  3IAM 1;  5FR6 A;  1PYW D;  3IG3 A;  1WXM A;  2CKH B;  5HKH A;  3OLM D;  1N5W A;  2MH7 A;  5D94 A;  2KWU B;  2RMM A;  3I9V 1;  3AU4 A;  3PTF C;  5BMG A;  3AEG B;  3CST A;  3OG5 A;  2GBN A;  4BVU C;  4WWM A;  2GBK A;  2HDE A;  1YOV B;  1VRA B;  3DBL I;  2KAN A;  4TMA B;  3V05 A;  4JX1 C;  4LCD E;  5CHF A;  4E74 A;  2V3N A;  4GMV A;  2MRP A;  3AXC A;  5HI1 A;  1ZXI A;  2KWD A;  3ZNI D;  2IDY A;  1L2N A;  2KO3 A;  1SJE D;  1WJ6 A;  3KUC B;  4K3C A;  2J53 A;  4KGS A;  1TS2 A;  1P1A A;  1LXD A;  2MJ3 A;  2JXX A;  3ALB A;  1D6E C;  1S1Q B;  2KZR A;  3BY4 B;  4ARC A;  4RFB A;  2KMM A;  1AWD A;  1IBX A;  3L13 A;  1J8C A;  4MJS B;  4HRO A;  1SB3 C;  1UUP A;  4WH4 A;  3NZS A;  2KK8 A;  5AEK B;  3APF A;  4EZJ A;  3UQA A;  1SE3 A;  2XEW A;  1QZE A;  2LI5 A;  2NBV B;  2WXM A;  3NVW A;  4JL9 A;  2CJN A;  3URY A;  4ANX A;  2KOX A;  2LGD A;  3BWU D;  2WXL A;  3MC9 A;  2BB6 A;  1D5Z C;  1JML A;  1LGR A;  1D3Z A;  3UGB B;  1C4P A;  4I6L B;  4YXD B;  3GS2 A;  3U52 E;  1KLU D;  3Q8B A;  1BUI C;  4QAY A;  2W54 A;  3N1Y C;  3ZVV A;  3FKY A;  3J9C A;  3DBL B;  2C7M B;  5E6O A;  5IO9 A;  1YQ3 B;  1L6V A;  4YL8 A;  4US9 A;  1XLN A;  4DK5 A;  3PRM B;  3ZXV A;  3ZDM C;  1PQS A;  3PS6 A;  4BBN C;  2DLB A;  4ARI A;  1FNW A;  4HVB A;  1WRD B;  4WQM A;  5EE3 A;  3W9C B;  1NEN B;  1GNU A;  3VRB B;  1NVI D;  2N9X A;  3PHX B;  4JGH B;  3C8Y A;  3I63 C;  4DHJ D;  4YTP B;  3Q3O C;  2KC1 A;  2LHD A;  2MJD A;  2NTT A;  4W9L A;  4BBN F;  2RSU A;  3U2S C;  1JRP A;  1MPE A;  1T0Y A;  3KWL A;  1BXT A;  3KLS X;  2N9E B;  1AAR A;  4ZOH C;  2VH2 A;  4XYC A;  4N6E B;  4LNK A;  3Q14 C;  4WIP A;  1TTN A;  2NCN A;  4ZYS A;  1YN4 A;  2NBU A;  2KMC A;  4JPS A;  2M1M A;  3EA6 A;  4NQL B;  4P6V F;  3AEE B;  2OJR A;  4J3O D;  1R4M I;  1KLG D;  2FUH B;  4YTM B;  5T8I A;  2WXN A;  2MBH A;  1F9J A;  3MP9 A;  4IG7 B;  4S17 A;  3WAO A;  5GMV A;  3AU5 A;  3CSF A;  1KF6 B;  2KQ7 A;  3TCA A;  1Z5S B;  2X8X X;  2INN E;  1TGZ B;  1J7A A;  3VTV A;  3DBH I;  5JH5 C;  2KVR A;  4MH8 A;  2V0G A;  4YT0 B;  1XO3 A;  2AQ2 B;  2JY6 A;  2N4F A;  2IGH A;  5GXG B;  1I42 A;  1WH3 A;  2WYQ A;  2KDI A;  1M4V A;  4BAX A;  1ZKH A;  1HEZ E;  2WXF A;  3ONS A;  2IGG A;  2GBM A;  5MPO A;  1VR9 A;  2LAS A;  3QAQ A;  1ET9 A;  3NVV A;  1IBX B;  3GE3 C;  1C1Y B;  2RPV A;  3MC8 A;  4FHJ A;  4LDT D;  4WJO A;  3W1Y A;  1VLB A;  2K8C A;  1GC6 A;  3VR8 B;  4MM3 A;  1WGD A;  3PZD A;  1CZP A;  4KGR A;  1FRR A;  4B0M A;  3WAM A;  4KVG B;  3H6N A;  4MGI E;  3M3J A;  1E8X A;  2WNM A;  4LNI A;  3M63 B;  5D6J B;  3E56 A;  3I5J C;  2PE9 A;  3RZW C;  1V1O A;  2WP9 B;  1WXQ A;  1R4M B;  2UU7 A;  2J0K A;  3P4P B;  4GLS C;  4XZ4 A;  4N9F 4;  2J52 A;  2GLS A;  2JXT A;  3Q3F A;  1WGH A;  3L0W B;  2NMQ A;  1WYG A;  3HM3 A;  1JWM D;  4MT5 A;  1EF1 A;  4B95 A;  2V3S A;  4HDO A;  2KAC A;  1GPX A;  2DAJ A;  1JWS D;  4J6I A;  2LVP A;  3DBH B;  2UWQ A;  4HCN B;  3DCG A;  1FO4 A;  5L95 C;  2EKI A;  3APC A;  3HM6 X;  5DPW A;  2PE6 B;  4OHJ A;  3AB5 A;  4ZRI A;  3RNA C;  1P7F A;  2K6Q A;  3CF6 E;  2KLG A;  2L1A A;  2LZ6 A;  3N3K B;  4TKN A;  1MVK A;  2DEN B;  3GE8 C;  2PEA A;  3QHT A;  4DBG A;  2BS4 B;  2HD5 B;  1WWT A;  4NAM A;  2CHZ A;  5HFY A;  1XXG A;  3OWE B;  3B2F A;  5D7G A;  4G11 A;  2DYM A;  3AE3 B;  4K1R B;  4IWO A;  3ZQ4 A;  5D3D A;  3HIZ A;  2H89 B;  4BKT A;  2HE7 A;  2JYE A;  3BYT B;  2NBW B;  4IKG A;  3MJ5 A;  1FRD A;  1FIQ A;  4LLG M;  3P4R B;  2QIL A;  2FAZ A;  5D2M B;  3AE7 B;  4FJY A;  3RUI B;  2MBQ A;  4I6N B;  2L83 A;  3QCA A;  2D10 A;  3HVZ A;  1HTQ A;  2LUE A;  3ZIM A;  3TBL D;  5TR5 A;  2CR5 A;  1KRH A;  3NOB A;  4E71 A;  1OEY A;  2G1E A;  3UIP B;  2D3B A;  2N1V A;  3SD5 A;  3RFZ B;  2LJI A;  3WCQ A;  1FCL A;  4WUR A;  2A4Z A;  3NHE B;  2KLC A;  2DNF A;  2PPH A;  3B2G A;  3T3N A;  2QDF A;  4P1C C;  2LWP A;  2GBJ A;  1Q10 A;  2BF8 B;  1C76 A;  5G55 A;  2K0P A;  1WJN A;  3S2A A;  1NYR A;  3AE5 B;  1AN8 A;  3OAW A;  4WJQ A;  4NAW B;  1QIL A;  4IDI A;  1XLP A;  1VD2 A;  1RAX A;  1WMH A;  4NY0 A;  3U4E G;  4O1N A;  1HZ6 A;  3D32 A;  4MM3 B;  2KDE B;  1EF5 A;  4P1B C;  2BYT A;  3SFD B;  3BVM A;  2NVU I;  2WHI A;  2DYO A;  2FIF A;  5EE9 A;  1ZE3 D;  3K9P B;  1V9J A;  2AEH A;  3P42 A;  3VUY A;  2V9H A;  4P7I A;  4RGO S;  5H92 C;  1Q1O A;  2JT4 B;  4HWI B;  4RH6 A;  5CHV C;  2JRH A;  5EE1 A;  1STE A;  1XLQ A;  3UIN B;  4RNA A;  1PDX A;  1ROE A;  2G4S A;  2I38 A;  3KYD D;  3DPD A;  4FUL A;  3DVN V;  2QSD A;  4R3D A;  1GB4 A;  5J17 A;  3H1U A;  3H8H A;  3P2B A;  2D5G A;  4BKS A;  2M17 A;  4BOZ B;  2NPT A;  5AUI A;  1WRI A;  4PK1 A;  1B9R A;  1NI2 A;  3JW0 X;  5BO4 B;  1UZX B;  1QOG A;  1HZ5 A;  2D2Q A;  2N7J A;  5E6P A;  2WXO A;  4K81 A;  3TJP A;  3AE6 B;  2DZK A;  2LRW A;  1I4G A;  2IND C;  1ACC A;  1TKY A;  2LEK A;  3RNF C;  4A8X C;  2Q5W D;  4RGN A;  1EU4 A;  3LDZ E;  2QHO A;  3L16 A;  3X0W A;  3AEB B;  2X38 A;  4E3C A;  5C3J B;  1I4X A;  3V61 A;  1T6B X;  2LFI A;  1RFK A;  2Z59 B;  4GU2 A;  5JHB A;  1N60 A;  3AEA B;  2GMI C;  1ESF A;  1MHH E;  3A9K A;  5IN7 A;  4LJP B;  2OHF A;  4D2K A;  1Q0W B;  2JVC A;  3U30 A;  5IOI A;  4HJK A;  2PVG C;  1IP9 A;  3KUD B;  3W5U B;  4M02 A;  3ENE A;  4K7U A;  3ZNG C;  2MBE A;  3LB8 C;  1BT0 A;  1WXA A;  2INP E;  2ONQ A;  3V60 A;  2Y5C A;  3PRP B;  2G4D B;  5CX3 A;  4LNF A;  2J4X A;  2K39 A;  1GOZ A;  2LRU A;  4TQ0 A;  2KVZ A;  2H88 B;  3Q8E A;  2XN9 C;  1HTO A;  2L7R A;  3TEY A;  2YLM A;  2ZCB A;  4ZDV A;  3L4P A;  1NDD A;  3PVL A;  1KH0 A;  1QOB A;  2YEP B;  3ECI A;  4YSX B;  2EMT A;  4BZA A;  4TUU A;  1FNV A;  1LQB A;  2LVO A;  1N5X A;  2V4I B;  2ASQ A;  4A3O A;  1F0Z A;  1KOT A;  2PIA A;  3KH0 A;  4USA A;  2RDG A;  4RM8 A;  3ZJT A;  2Z0D B;  1WR1 A;  3N30 A;  1WMH B;  4WWP A;  3NUH B;  4DXG A;  4OW0 A;  1GC7 A;  1WJU A;  4ZRP A;  4IM3 A;  4CHK A;  4EZK A;  4KX6 B;  2J0M A;  2BT6 A;  2NS5 A;  2EKE C;  1TY2 A;  4GSW A;  1I7H A;  5AUK A;  3BK1 A;  4GN1 A;  2AQ1 B;  3P4Q B;  1M94 A;  2D3G A;  3VAW A;  3VR9 B;  2IJ0 A;  2GRI A;  3BYY B;  5LXI B;  1OEY J;  1GUA B;  3TL5 A;  4AQ7 A;  4KKJ A; 
#chains in the Genus database with same CATH homology
 1Z5S B;  3W1S A;  2LVQ A;  2ZPY A;  1TGZ B;  2HJ8 A;  2PJH A;  3QAR A;  4I6P A;  3VTV A;  3DBH I;  2DZJ A;  2KJH B;  3PPA A;  3UIO B;  1XD3 B;  2BKF A;  2NPT B;  1WGG A;  5JH5 C;  3LJ3 A;  3PLU A;  1GJZ A;  2N7D A;  2KVR A;  1WJ4 A;  4ANU A;  2JY6 A;  2N4F A;  3KW5 B;  3R3M A;  1I42 A;  1WH3 A;  2WYQ A;  1Y8R C;  3PSE B;  2KDI A;  1E8Z A;  1V6E A;  1WXS A;  1YIW A;  1ZKH A;  3JVZ X;  4MH0 E;  3ONS A;  4DDI D;  1UD7 A;  2ZNV B;  2GBM A;  4K7W A;  1WGR A;  3IHP C;  2LAS A;  3QAQ A;  5LXH A;  2O6V A;  4W9C A;  4GIV A;  5IAA C;  4FAD A;  4FA6 A;  3PGE A;  2J7Q B;  3DOW A;  2BWF A;  1RLF A;  2XBB C;  1IYF A;  4G0N B;  3V6E B;  1C1Y B;  2L8J A;  2ZVO A;  4PS3 A;  4FHJ A;  2FNJ B;  4GB9 A;  4LDT D;  4WJO A;  3PT2 B;  3W1Y A;  2N7E A;  2K8C A;  1UH6 A;  1GC6 A;  4AWJ A;  1K8R B;  1YQB A;  2AL3 A;  2K1F A;  1WGD A;  3PZD A;  4MM3 A;  2JF5 A;  4NQK E;  4W9J A;  3IFW B;  4M0W B;  3QC8 B;  3X23 A;  2WWZ A;  1UEL A;  2CU1 A;  2KWV B;  1C3T A;  1SGH A;  1J19 A;  1YX6 B;  1EUV B;  3WAM A;  4KVG B;  4EKU A;  3VDZ A;  3H6N A;  2KD0 A;  4MGK E;  4MGI E;  4WWN A;  4GDK A;  3M3J A;  1E8X A;  3VUX A;  2ZEQ A;  3M63 B;  3SHQ A;  2KHW B;  1V49 A;  2VRR B;  2FCS A;  4JLC A;  4NNJ B;  5D6J B;  4PS7 A;  2M8S A;  5LLI A;  2MSE D;  1J0G A;  3OJ4 B;  1V5O A;  1WM2 A;  3A9K B;  2OOB B;  1ZGU B;  4IWQ A;  2PE9 A;  3RZW C;  4W9K A;  3V62 A;  3DDC B;  2K25 A;  3V6C B;  2C7N B;  1XT9 B;  3UF8 A;  4HDQ A;  4KZC A;  2J0K A;  4ICV A;  4XZ4 A;  1OGW A;  4N9F 4;  5EDS A;  1ZW7 A;  4MGZ E;  2K8H A;  2MLB A;  3KYC D;  3A4S C;  3JSV A;  4TQ1 A;  3Q3F A;  3MJW A;  1UGM A;  3B1L X;  2MCN B;  1WGH A;  3L0W B;  4ZYN A;  3NZU A;  3H9D A;  3L10 B;  2IYD B;  3WA0 A;  3HM3 A;  2D07 B;  1EF1 A;  3ZRF A;  4B95 A;  2V3S A;  4HDO A;  4M8M A;  5E6N A;  2KFJ A;  2DAJ A;  2FID A;  2ZZP B;  4OVU A;  2KJR A;  1I35 A;  4J6I A;  2LVP A;  2FCN A;  4AP4 C;  1V2Y A;  3R66 C;  2ZJD A;  2UWQ A;  4XX5 A;  4MEL A;  2L76 A;  2KNB A;  4HCN B;  2DZM A;  3AUL A;  3R7R A;  4BOS C;  2R2Q A;  3DCG A;  5DPR A;  2AL6 A;  2CHW A;  4G3X B;  3Q3J A;  3HHM A;  2KWC A;  1WGY A;  2RR9 A;  3APC A;  1OQY A;  2BPS A;  3H7P A;  3HM6 X;  2FCQ A;  3JYU A;  3L08 A;  3U7D A;  4F1S A;  2PE6 B;  5DPW A;  4EZL A;  5JZE B;  4IM2 A;  4DHZ E;  1P3Q U;  4ZRI A;  4KZ0 A;  1V81 A;  1X1M A;  2KTR B;  2AYO B;  2K6Q A;  4MJS A;  2JWZ A;  2WX1 A;  3CF6 E;  2KLG A;  4B9K A;  1LFD A;  4IW0 A;  2LZ6 A;  3JSV B;  3N3K B;  3VXW A;  2HTH A;  4AJY B;  4TKN A;  4BKS D;  3RZF A;  4JQW C;  5JHA A;  2L3Z A;  3KVF B;  2DEN B;  1WFY A;  2EMS A;  4KIK B;  1WX8 A;  2PEA A;  3QHT A;  4DBG A;  2WDT B;  1E8Y A;  2HD5 B;  2C7H A;  2O2V A;  4F7Z A;  3B08 A;  1L7Y A;  3TMP B;  3VH4 B;  4W9E A;  2JRI B;  2RGF A;  4IWP A;  3AI5 A;  4EEW A;  4XC2 A;  2JUO A;  2CHZ A;  4KSL C;  1RFA A;  2MP2 B;  2MW5 A;  3W1S C;  1HE8 A;  4GDL A;  5D7G A;  4CYE A;  4AOF A;  2JPH A;  2IO0 B;  4G11 A;  4DDG D;  2DYM A;  4KDI C;  2KFK A;  2Y5B B;  2KKC A;  4K1R B;  4W9H A;  3R7Q A;  4IWO A;  4HLE A;  1YJ1 A;  4OVV A;  4PS8 A;  1WZ0 A;  3HIZ A;  1CMX B;  3EHV A;  1E8W A;  2AWT A;  5J18 A;  4BKT A;  2HE7 A;  3A33 B;  2NBW B;  4KDL B;  4IC7 B;  2RPQ A;  4W9F A;  1P98 A;  2IO2 B;  4AJW A;  3BIN A;  2M4N A;  4II3 B;  3VTW A;  4B6W A;  4MGY E;  4KV2 A;  2FAZ A;  5D2M B;  1TBE A;  2C60 A;  3DVG Y;  2MBQ A;  3EFU A;  4FJY A;  3RUI B;  4I6N B;  1SIF A;  3WIM A;  3QCA A;  2D10 A;  1U4A A;  2DAF A;  3PLV A;  1VCB A;  1KLV A;  2LUE A;  1YX5 B;  3ZIM A;  4GOC A;  4K7S A;  3TBL D;  2MX2 A;  5TR5 A;  2CR5 A;  3NOB A;  4F8C B;  4E71 A;  2J0J A;  2M0X A;  2O2V B;  1E5W A;  3IVF A;  3ZKJ C;  2L0F A;  1OEY A;  3A1Q B;  1GG3 A;  3UIP B;  4A3P A;  4NAW A;  2DYB A;  3QWZ B;  1V5T A;  2BGF A;  2K8B A;  4ASW C;  4DXA B;  5DCN A;  4X57 B;  2G3Q B;  2N1V A;  4ZRJ A;  2DZI A;  2CS4 A;  3SD5 A;  2WX0 A;  2NR2 A;  2O6V D;  2R2O A;  1V80 A;  2BYE A;  2FCM A;  3RD2 A;  2ZVN A;  3ZDT A;  1E7U A;  5C1Z A;  3QX1 A;  2A4Z A;  1WYW B;  2K6D B;  2RD0 A;  5C23 A;  2L00 B;  3NHE B;  4M8N A;  4BFR A;  2KLC A;  2D11 A;  1Z2M A;  2V4L A;  3K9O B;  2PPH A;  4RMA A;  4MEM A;  4ICU A;  3DVN U;  2KTF A;  3APD A;  2LWP A;  2GBJ A;  4HCP B;  4KSK C;  2BF8 B;  3NS8 A;  4HPM B;  4EUT A;  1SE9 A;  1MG8 A;  2O6V B;  2XK5 A;  5G55 A;  1TZ1 A;  3ZUN A;  1WXV A;  3IBE A;  4MDK E;  5J2R A;  4TV3 A;  2BYV E;  1WJN A;  4II2 B;  3SU8 X;  3S2A A;  3OAW A;  4LJO B;  4WJQ A;  3VH3 B;  4GGQ A;  3EC8 A;  3QQ8 B;  4NAW B;  2KDB A;  2KQS A;  3I3T B;  3ZLZ A;  1VD2 A;  1RAX A;  4ZRK A;  1WMH A;  4NY0 A;  1S3S G;  4PYU A;  3D32 A;  4G50 A;  2KDE B;  1EF5 A;  2MWS B;  3U8Z A;  3KUZ A;  4CO7 A;  1KM7 A;  4DWF A;  4W9D A;  3ZTD A;  3GZN I;  1WIA A;  1UBQ A;  1P0R A;  2V1Y A;  2NVU I;  3DBR I;  1W6V A;  4GDK B;  2DYO A;  2FIF A;  3EEC A;  3UQB A;  2BKR B;  4HK2 A;  5FR6 A;  3WAL A;  1E7V A;  3IG3 A;  3K9P B;  1V9J A;  1WXM A;  2AEH A;  2CKH B;  4MSM B;  3OLM D;  5D94 A;  5HKH A;  3VVW B;  2KWU B;  2LXC A;  3VUY A;  1WR6 E;  3AU4 A;  4P7I A;  3PTF C;  1WZ3 A;  2KDF B;  1Q1O A;  3A9J A;  2JT4 B;  4HWI B;  2CHX A;  3A4R A;  3CST A;  3L17 A;  5CHV C;  2JRH A;  2GBN A;  4BVU C;  2GBK A;  5KHO A;  3UIN B;  4WAA A;  3L54 A;  1WE7 A;  3TIX A;  3DBL I;  2YVC A;  2KAN A;  1RRB A;  2G4S A;  3KYD D;  2IO1 B;  2I1J A;  4LCD E;  5CHF A;  3DPD A;  4FUL A;  4E74 A;  5IA7 A;  3DVN V;  4GMV A;  2IY0 B;  2MRP A;  4FJV B;  4GXB A;  3AXC A;  5J17 A;  3H1U A;  5CTR C;  2LD9 A;  3ZNI D;  4BKS A;  2N9P C;  3P2B A;  2KO3 A;  5G2N A;  2M17 A;  1WJ6 A;  3KUC B;  4BOZ B;  1L2N A;  4DHJ B;  2NPT A;  1LM8 B;  1WM3 A;  4JIO U;  1P1A A;  1LXD A;  4WWO A;  2LJ5 A;  1NI2 A;  3JW0 X;  5BO4 B;  5AZG A;  1UZX B;  2DHZ A;  1FXT B;  5AZF A;  3HK0 A;  2JXX A;  4HPL B;  4ANW A;  2D2Q A;  3ALB A;  2LGX A;  2KZR A;  1S1Q B;  1NBF C;  3BY4 B;  5E6P A;  1UBI A;  3RYT A;  2JZZ A;  2Z0E B;  4K81 A;  3TJP A;  3H7P B;  3QJZ A;  2DZK A;  3QA8 A;  2LRW A;  2W9N A;  2I1K A;  3L13 A;  1J8C A;  4EFO A;  3PHW B;  1IPG A;  4MJS B;  1WE6 A;  5L95 C;  5DPS A;  2KX3 A;  4MSQ B;  3LDZ E;  2QHO A;  2B3A A;  3NZS A;  3L16 A;  4PYZ A;  3X0W A;  2KK8 A;  4WJN A;  5AEK B;  3APF A;  4E3C A;  4EZJ A;  2IY1 B;  3NY5 A;  3UQA A;  1Q5W B;  2XEW A;  1QZE A;  3WAP A;  3WAN A;  4DHZ B;  2A5U A;  3V61 A;  2GOW A;  2LI5 A;  2NBV B;  3ZNH B;  2LGY A;  2KN5 A;  4FHK A;  3LMN A;  2LXA A;  3GOE A;  4GDL B;  3VQI A;  2L0T A;  4WJP A;  2N1W A;  2Z59 B;  4GU2 A;  1P9D U;  4JL9 A;  3VFK A;  5JHB A;  2KFK B;  4ANX A;  4RM9 A;  2KOX A;  5L83 A;  3SDL C;  2LGD A;  1E90 A;  2GMI C;  2IZV B;  3RUL A;  3A9K A;  1D3Z A;  4HXD A;  4LJP B;  3UGB B;  4I6L B;  2C9W B;  2G45 B;  1Q0W B;  4NPN A;  4A20 A;  2JVC A;  3U30 A;  2MQJ A;  4NJ6 A;  4HJK A;  3ZVV A;  1IP9 A;  3KUD B;  3ENE A;  1V86 A;  4K7U A;  3ZNG C;  1A5R A;  3DVG X;  2MBE A;  2C7M B;  3N32 A;  1BT0 A;  1WXA A;  4NJ7 A;  4WQO B;  5E6O A;  3V60 A;  2DX5 B;  4YL8 A;  3PRP B;  1R4N I;  2KJ6 A;  2G4D B;  4DK5 A;  5CX3 A;  3PRM B;  1WF9 A;  3ZDM C;  1PQS A;  3PS6 A;  4BBN C;  4FN2 A;  1EO6 A;  3VHT C;  4HVB A;  1H4R A;  2ZCC A;  2BWE S;  1WRD B;  2K39 A;  2UYZ B;  3OJ3 A;  4LDT B;  2LRU A;  4TQ0 A;  3ZRC A;  3PV1 A;  2ZPN A;  2MA9 B;  3VUW A;  2L05 A;  1WX9 A;  4AUQ C;  2L7R A;  4IUM B;  3H7S A;  3DBS A;  2KXJ A;  2YLM A;  2ZCB A;  4FLH A;  4IM0 A;  4ZDV A;  1NDD A;  3PVL A;  4FBJ B;  2BYF A;  2KMA A;  2KTR A;  3CMM B;  3ZTC A;  3ECI A;  2MBO A;  1GNU A;  2MBB B;  2N9X A;  3PHX B;  2EMT A;  4JGH B;  4TUU A;  5DPT A;  4DHJ D;  2KC2 A;  2IBI B;  1LQB A;  2LVO A;  2GBR A;  2KC1 A;  2ASQ A;  2XK5 B;  3M95 A;  4KIK A;  4A3O A;  4ANV A;  1KOT A;  3RCZ A;  3KH0 A;  2IO3 B;  4FJZ A;  4W9L A;  3MHS D;  4BBN F;  3PRZ A;  1WX7 A;  2RSU A;  4RM8 A;  1XQQ A;  1OTR B;  1T0Y A;  1WI0 A;  2N9E B;  1AAR A;  2MP2 A;  2Z0D B;  3ZW3 A;  1WR1 A;  3N30 A;  1WMH B;  4WWP A;  3DQV A;  1KJT A;  3ML9 A;  4W9G A;  1GC7 A;  1TTN A;  2NCN A;  1WJU A;  3PRE A;  3B0A A;  4IM3 A;  2NBU A;  2C5L C;  4CHK A;  2JZ3 B;  1WY8 A;  2KMC A;  3T9L A;  1G6J A;  4EZK A;  2M1M A;  4NQL B;  2J0M A;  4W9I A;  1ISN A;  2NS5 A;  5CHW A;  3RT3 B;  2EKE C;  4EOY A;  1YD8 U;  2OJR A;  4GSW A;  4BKG A;  5AZH A;  2ZNV C;  3VTU A;  3ZO5 B;  4GN1 A;  1R4M I;  2FUH B;  1M94 A;  3T8M A;  2D3G A;  3A9J B;  2KX0 A;  3VAW A;  2REX A;  3MTN B;  1H8C A;  2MBH A;  1F9J A;  3ZNZ B;  3A1Q A;  3QK0 A;  5KHQ A;  4IG7 B;  5LXI B;  1OEY J;  3M62 B;  3ML8 A;  3WAO A;  1GUA B;  3C0R B;  1JRU A;  5GMV A;  3TL5 A;  3AU5 A;  4URK A;  3O65 B;  3CSF A;  2KQ7 A;  3QIJ A;  3TCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...