3PV1A

Crystal structure of the usp15 dusp-ubl domains
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
215
Chain Sequence
b'AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structural variability of the ubiquitin specific protease DUSP-UBL double domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 215
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pv1A02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3pv1A01
2AWTA 4MGIE 2MWSB 1EF5A 2JWZA 3QJZA 4J6IA 3N30A 3QWZB 4K7SA 2DZIA 2FCQA 3TL5A 3TJPA 4GDLA 2FUHB 2M0XA 3AULA 3OLMD 3WAMA 2Z59B 1A5RA 1V80A 1WMHB 2RR9A 2JRIB 1L7YA 3APCA 5KHQA 2KZRA 2FIFA 2L3ZA 3QHTA 4BKTA 3UIPB 2HD5B 3PT2B 5JHAA 1WE7A 1WX8A 4MDKE 3NHEB 2DAFA 4ANWA 4FBJB 2V3SA 2C60A 1ISNA 1J19A 2JZZA 4KDLB 2GBJA 2KFKB 4BOSC 2ASQA 3EHVA 3WAPA 3DPDA 2NBVB 4B6WA 1OGWA 4W9HA 4KIKB 3PRZA 2LVPA 4G0NB 1MG8A 2AL3A 2K6QA 2FIDA 2D11A 2KLCA 3ZTDA 1GG3A 5CHFA 1WE6A 3UGBB 4IM3A 3DCGA 1WGHA 3IG3A 3IBEA 1P3QU 1E8YA 4ICUA 2BYVE 2DAJA 3R7QA 2KJRA 1WYWB 2WYQA 5D7GA 1WIAA 2L8JA 4TKNA 5J17A 3CMMB 4DHJB 1E7VA 2O2VB 4MSMB 1UELA 3D32A 1KOTA 3HM3A 3L0WB 4I6NB 2K8BA 1WJNA 4W9GA 3MJWA 3LMNA 3O65B 4W9LA 4ZYNA 4RMAA 4HLEA 4K81A 5D2MB 2DZJA 4GOCA 4WWNA 2LGDA 3W1SC 3PRPB 3ALBA 2CU1A 3L17A 2RPQA 4PS7A 4TUUA 4BKGA 3BINA 1EO6A 1XQQA 2N1VA 3JSVB 4KVGB 5E6OA 3WANA 4CO7A 4GN1A 3UIOB 2C7HA 1YIWA 2KTRA 3PLUA 4GSWA 4JL9A 4OVUA 3A9JA 4WAAA 2KTFA 3H1UA 3PREA 4BFRA 1J0GA 4GDKA 2G3QB 3KYCD 1KM7A 2K1FA 1V6EA 2N9PC 3A1QA 4K7UA 3VQIA 5IAAC 4EFOA 1E8ZA 4TQ1A 1UBIA 1WXAA 2O6VD 5CHVC 4EZJA 4M8NA 2C9WB 2ZPNA 3PLVA 4G3XB 3V62A 1E5WA 1Z5SB 2N7EA 4DXAB 2DYOA 3IHPC 4P7IA 1GC6A 1K8RB 2DZKA 2PPHA 5DPSA 3MHSD 3ZVVA 1I42A 2ZZPB 4OVVA 4W9EA 4FLHA 2MRPA 3PZDA 1KLVA 3ML9A 1IYFA 4XX5A 2DYBA 3PVLA 4IW0A 2LI5A 2B3AA 4GU2A 1H8CA 3RT3B 3PTFC 1R4MI 2KX3A 2M1MA 2J0MA 3LJ3A 1LM8B 4LJOB 2KWCA 2Y5BB 3Q3FA 4HCPB 2NS5A 2MBBB 1TZ1A 2KC2A 3KUCB 4PS8A 4AWJA 5C23A 3DQVA 2NR2A 4PS3A 1UGMA 2IY0B 2FCSA 5AZGA 4XC2A 4MJSB 1V9JA 4AOFA 5LXHA 2L00B 3HK0A 5C1ZA 2GBRA 4TV3A 2KWUB 2CR5A 4G50A 1WZ0A 2XBBC 3L13A 2IO3B 1ZKHA 1YX5B 1V2YA 4M0WB 5L83A 5AEKB 1WGRA 2IO1B 2LVQA 2YVCA 5BO4B 2L0FA 2NPTA 3PRMB 1J8CA 2I1KA 2ZEQA 3B08A 4IUMB 2KD0A 2KDFB 3VUXA 1X1MA 4CHKA 4JIOU 2JVCA 3H9DA 2NBWB 3V60A 1YQBA 3R7RA 3RCZA 4EUTA 4TQ0A 2KXJA 1V49A 3ZNHB 4AJYB 3L10B 2LXAA 1WY8A 2MBOA 2XK5B 2PJHA 4HCNB 3AXCA 1RRBA 4GDLB 3A9KA 1XT9B 5IA7A 3QX1A 3U7DA 3R3MA 4HDOA 5CTRC 1H4RA 4RM9A 2GBMA 2KMAA 3MTNB 4BBNF 4HJKA 3VAWA 2L05A 1KJTA 2K6DB 3H7PB 2O6VA 2FNJB 1WR1A 1P98A 2J0JA 2NVUI 3W1YA 2JXXA 4E74A 5G2NA 1WM2A 3KVFB 3OJ3A 4ZRKA 2KMCA 4ZRIA 2FCMA 2DHZA 1TTNA 2IO2B 1YJ1A 3VUYA 1TBEA 1WH3A 3N32A 3I3TB 2DZMA 3ML8A 4II3B 1C1YB 2ZVNA 3ENEA 2WX0A 1WX9A 2KDBA 3U30A 2KC1A 3DDCB 2MSED 4KSKC 4YL8A 4W9KA 2BPSA 1E8WA 2ZCCA 3DOWA 3K9PB 4FHJA 3PV1A 5D94A 3V61A 3VHTC 4HPLB 3X23A 2AL6A 1ZGUB 2KJHB 2N9XA 4IC7B 1UBQA 1OEYJ 3VTWA 1WMHA 2CKHB 1OQYA 4B9KA 3QCAA 1GC7A 5AZFA 1RLFA 4DDID 1FXTB 4GB9A 1CMXB 1NDDA 3NZUA 3APDA 2MQJA 4KV2A 4NQKE 1WI0A 1M94A 3QARA 2M17A 3DBLI 1T0YA 4KZCA 4X57B 3AU5A 2HTHA 3NY5A 5E6NA 2LASA 2RGFA 3IVFA 2KFKA 2LUEA 2PE6B 1UD7A 2C5LC 3OJ4B 1WM3A 2R2QA 3UINB 4GDKB 2DYMA 4KIKA 4W9JA 3DVGX 3BY4B 4F7ZA 3HHMA 2KHWB 3SD5A 2MP2B 2C7MB 1P0RA 3TCAA 2VRRB 3TIXA 4DDGD 2MA9B 2Z0EB 1D3ZA 4EOYA 2EMSA 5DPRA 5HKHA 1WF9A 2KK8A 2MBEA 3Q3JA 2GBKA 3HM6X 4MGYE 2G45B 2O2VA 5GMVA 3S2AA 3RUIB 1SGHA 2KVRA 2KQSA 4N9F4 3RD2A 2G4DB 5DPWA 1C3TA 2R2OA 3DVNV 3VH3B 3SDLC 4NPNA 2FAZA 3VDZA 1LXDA 4A3PA 3ONSA 2JPHA 3V6EB 5L95C 4W9DA 3JSVA 5DPTA 4II2B 2MBQA 2WX1A 5LLIA 2RD0A 2JRHA 4PYUA 4EZLA 2ZVOA 4EZKA 2XEWA 2IYDB 4JQWC 4NJ6A 3CF6E 5AZHA 3X0WA 3EECA 2LVOA 4MEMA 1OEYA 2J7QB 4W9FA 2IBIB 1SIFA 4FN2A 3TMPB 1QZEA 4NAWB 3QIJA 2KO3A 2WDTB 3GOEA 4DHZE 5CHWA 1WGYA 2JT4B 4B95A 2KN5A 4IM2A 1WGDA 3ZDTA 4DHZB 4MH0E 2K39A 4ANXA 2ZNVB 3PHXB 3CSTA 4ZRJA 2KWVB 3H7SA 3R66C 3WIMA 1P1AA 5FR6A 3ZTCA 3ZO5B 3NS8A 3QC8B 3K9OB 4HXDA 2BKFA 1LFDA 4IWPA 2KX0A 1HE8A 2AYOB 2L76A 4MSQB 3EFUA 5J18A 3ZNZB 4EKUA 2LD9A 3N3KB 4E71A 2IO0B 4NQLB 3RZWC 1Q0WB 4LCDE 1WJUA 1UZXB 4GMVA 4DHJD 1V81A 1E90A 5CX3A 1VD2A 4NY0A 3VTUA 1S3SG 5LXIB 4MJSA 2UWQA 4JLCA 3UQBA 4LDTB 2V4LA 3RULA 1V86A 4K7WA 2GMIC 3LDZE 1YX6B 1NBFC 2LXCA 3DVGY 4JGHB 4WWOA 3WALA 4ICVA 1WX7A 4F8CB 2NBUA 3GZNI 3KUDB 1WRDB 3RZFA 4BKSD 4CYEA 1I35A 2KKCA 2OJRA 1Q1OA 1WR6E 5D6JB 3ZRCA 1IP9A 3P2BA 2JY6A 1WXMA 2LZ6A 5E6PA 4ANVA 3WAOA 2CHZA 4IWQA 2M4NA 4G11A 1G6JA 3SU8X 4PYZA 1YD8U 2XK5A 3ZNID 2AEHA 2ZJDA 2GBNA 3A33B 4GIVA 4IG7B 2FCNA 2NCNA 1LQBA 3UQAA 2LGYA 2YLMA 2CHXA 1E7UA 1WJ4A 2C7NB 2KQ7A 4HWIB 3ZNGC 1W6VA 3ZLZA 3T8MA 1GUAB 2BKRB 4KSLC 4W9CA 3VFKA 3ZUNA 4BVUC 3PSEB 3H7PA 3QK0A 4GXBA 3VH4B 3VVWB 1WXVA 2HJ8A 2PE9A 4FJZA 2EMTA 2JZ3B 2LJ5A 2ZCBA 3NZSA 3RYTA 1U4AA 4AP4C 1EF1A 3U8ZA 3ZDMC 1L2NA 1Z2MA 2M8SA 2ZPYA 4FHKA 4GGQA 4HPMB 1WFYA 2J0KA 3B0AA 3M63B 2BWES 2N4FA 5J2RA 3T9LA 2KOXA 2IZVB 3AI5A 3KW5B 2KTRB 4IWOA 4WQOB 5KHOA 3ZRFA 4DBGA 2W9NA 1V5OA 3HIZA 3A9JB 2BYEA 2KNBA 2HE7A 1WXSA 4MM3A 2DENB 4FJYA 3CSFA 3QA8A 4WWPA 1XD3B 3VTVA 1WGGA 3A1QB 3L54A 4KZ0A 4XZ4A 3VUWA 5G55A 2K25A 3V6CB 3A4RA 4KDIC 2DX5B 4F1SA 2EKEC 4LJPB 2D10A 2KDIA 2L0TA 4DK5A 4AJWA 3KUZA 2JUOA 3JVZX 3JW0X 2N7DA 2KANA 4M8MA 3ECIA 4BOZB 3DBSA 3PPAA 3B1LX 2V1YA 3QQ8B 2D3GA 2BF8B 3L16A 3AU4A 3A4SC 2G4SA 5JZEB 3UF8A 1IPGA 2MLBA 4HK2A 1OTRB 2I1JA 3APFA 3PS6A 2K8HA 2LWPA 4BKSA 4MELA 2K8CA 1Q5WB 1JRUA 4FA6A 1WJ6A 2D07B 1V5TA 3M95A 4LDTD 1EUVB 1E8XA 2MP2A 4DWFA 3NOBA 1SE9A 4A3OA 5EDSA 1PQSA 3W1SA 4WJOA 1UH6A 2L7RA 3DBRI 3PHWB 4NJ7A 1NI2A 3JYUA 4ANUA 4IM0A 2Z0DB 3ZW3A 4URKA 2PEAA 4FJVB 1RAXA 2WWZA 3KH0A 4WJNA 4WJQA 4MGKE 3TBLD 4FADA 2JF5A 3QAQA 2CHWA 3M62B 3ZKJC 2N9EB 1GNUA 3DVNU 3ZIMA 2RSUA 2A5UA 4HDQA 4W9IA 2KDEB 2REXA 2QHOA 3SHQA 3EC8A 2BYFA 3VXWA 2MX2A 4FULA 5JHBA 1F9JA 3IFWB 2NPTB 5JH5C 2UYZB 3PGEA 4ZDVA 1Y8RC 2BGFA 3M3JA 4EEWA 3C0RB 2D2QA 3KYDD 4K1RB 1WZ3A 5TR5A 2KJ6A 2OOBB 2ZNVC 2A4ZA 5DCNA 1ZW7A 2IY1B 4A20A 2CS4A 4E3CA 3A9KB 4AUQC 1GJZA 4NAWA 4WJPA 4ASWC 1VCBA 2N1WA 1R4NI 1BT0A 2MBHA 1RFAA 3L08A 2O6VB 2KLGA 1TGZB 3WA0A 1S1QB 1AARA 2MCNB 3DBHI 2LGXA 2KFJA 2LRUA 4RM8A 3H6NA 4I6PA 2MW5A 4I6LB 2BWFA 1P9DU 4MGZE 4NNJB 4HVBA 2GOWA 3OAWA 2LRWA 4BBNC
chains in the Genus database with same CATH superfamily
2MWSB 3DHHC 2AQ1B 4HROA 3N30A 1FNUA 2H89B 2DZIA 1SB3C 2E3TA 4DQOC 4J3OD 3WAMA 3C8YA 5IKCM 1A5RA 3AE4B 1SJED 1V80A 3DHGC 1CJEA 1FCCC 1L7YA 2L3ZA 2HD5B 5JHAA 4MDKE 2N7JA 2GB1A 2GBJA 2KFKB 4BOSC 1K53A 3EHVA 3DBRB 3PRZA 2LVPA 2AL3A 5LNK1 3N1XC 4IM3A 3IG3A 3R2TA 1P3QU 4ICUA 2DAJA 1WYWB 1I4RA 2WQYB 2L8JA 5J17A 2QDFA 3TSSA 3GB1A 1E7VA 1TYGB 3L4PA 1UELA 3D32A 4W9GA 2IJ0A 4MH8A 4WWNA 1D5XC 1UWMA 3ALBA 3L17A 4LNIA 1LGRA 3BINA 5E6OA 2N1VA 4CO7A 3UIOB 3PLUA 1MI0A 4OVUA 1DGJA 2KTFA 1QT9A 1I4PA 4BFRA 1QOBA 2WXRA 3NVWA 1J0GA 3GS2A 2N9PC 1R4NB 2VZKD 1UBIA 2O6VD 5CHVC 4M8NA 4H2AA 3E9SA 1ZE3D 2JQRB 2N7EA 1BMLC 3AECB 1D6EC 2DZKA 1ENFA 4FLHA 2Y3AA 3PVLA 3NRZA 2LI5A 1WGKA 3PTFC 2M1MA 2J0MA 4A55A 4P1BC 4A90A 2BVCA 5BYQA 4PS8A 4JE3B 4PS3A 5AZGA 1KFYB 3HK0A 5C1ZA 2CR5A 3BWUD 2MJEA 2MEKA 1ZKHA 2WDQB 3MP9A 2YVCA 1D5MC 3AH7A 2W54A 2NPTA 2I1KA 2KDFB 1X1MA 3H9DA 2PVOD 1YQBA 2Y5PA 4AJYB 3L10B 2LXAA 1NI3A 1UNSA 2XK5B 1FO4A 2PJHA 1QF6A 1RRBA 2DLBA 3A9KA 1L6UA 1K51A 3EUB2 3ZXVA 4YTMB 3MC0B 5EE1A 1MVKA 1EU4A 4A6QA 3FILA 2FCMA 3VUYA 4II3B 4KGTA 1L5PA 2JYTA 2Z8LA 1I4HA 3AE6B 2KDBA 4KSKC 2J4XA 2ZCCA 4FHJA 1K50A 4BZAA 2K22A 3X23A 2AL6A 4WWMA 1OEYJ 3VTWA 4XDDA 3PZ7A 5BYSA 1NENB 1L4ZB 1M94A 3DBLI 4KZCA 2G1EA 4X57B 3NY5A 5E6NA 3RNGC 2G9HD 2MJDA 2PE6B 1UD7A 3UINB 2DYMA 3DVGX 2KHWB 3LB8C 4XWTA 1P0RA 3TCAA 2VRRB 2LFIA 3TIXA 1D3ZA 4EOYA 5EE9A 3HM6X 4N9F4 3HVZA 2W82A 4RCOA 5DPWA 2J53A 4OZBA 3VDZA 5H8YE 2JPHA 1E7PB 4W9DA 1MHXA 4II2B 2NMQA 3IAS1 4YSYB 3ZQ4A 1N61A 3AE7B 3CWIA 4FN2A 4NAWB 3QIJA 3ABVB 3AEEB 2WDTB 3GOEA 3KLSX 4DHZE 2JT4B 1WGDA 4MH0E 1ZUD2 3CSTA 3TEWA 3MC9A 3H7SA 3WIMA 3ZO5B 2D5GA 3ZTCA 3QC8B 4HXDA 1VRAB 2BKFA 2R61A 5J18A 5HI1A 4EKUA 4LCDE 1WYGA 1KTKA 1UZXB 5CX3A 5LXIB 1VD2A 2UWQA 3UQBA 3LDZE 4WWOA 4JGHB 5FR3A 1KLGD 1QOGA 4M0WA 3Q8CA 2EKIA 2SEBD 1WR6E 3IT6B 3ZRCA 1IP9A 2JY6A 4XDCA 1F0ZA 3KQ4A 4IWQA 2M4NA 3SU8X 2M0AA 1YD8U 1SIJA 2AEHA 2ZJDA 2GBNA 2FCNA 2YLMA 1C9FA 2CHXA 2C7NB 3ZLZA 1VZ6A 3VFKA 4ZOHC 3PSEB 3H7PA 2HJ8A 3URYA 4FJZA 2BS4B 1EF1A 3ZDMC 1E6EB 3B0AA 3M63B 5KHOA 2Y5CA 4IWOA 4WQOB 1V8CA 3HIZA 3A9JB 3OG5A 1FMAD 2KT7A 2I2YA 2KNBA 1VZ7A 2DENB 1BXTA 4XZ4A 3VUWA 2EKEC 4LJPB 4DK5A 4AJWA 2LGSA 4IOIE 2N7DA 1T3QA 2WXPA 4N59A 2V1YA 3QQ8B 1ZPSA 1JWUD 4ZRPA 1OTRB 3PS6A 4NJCA 2K8CA 1JRUA 4LDTD 1EUVB 4DWFA 1E9MA 1PQSA 2FUG1 3DBRI 4NJ7A 4ANUA 4URKA 4FJVB 4FADA 2WWZA 3LXFA 4OVZA 3VR8B 2BW2A 2JF5A 1KRHA 3M62B 1GNUA 3DVNU 4W9IA 2KDEB 2QHOA 3N1ZC 1FIQA 4FULA 3IFWB 2KACA 3VR9B 3C0RB 3AV8A 4K1RB 1WZ3A 1XLOA 4S17A 2MH7A 1ZW7A 2IY1B 4R3DA 1GJZA 2OHFA 4WJPA 4ASWC 4C4VB 1R4NI 3NZ3A 4K3BA 2O6VB 1TGZB 1S1QB 1AARA 3DBLB 2MCNB 3DBHI 2KFJA 4RM8A 2BB6A 2MW5A 3B2GA 2BWFA 3BK1A 1YN5A 1TJEA 4HVBA 1Q10A 3SEBA 3MJ5A 1EF5A 2FCQA 2QIEB 3OLMD 3BVZA 2LGIA 1WMHB 3UIPB 1WE7A 1WX8A 4L2YA 1FFUA 5IO9A 2V3SA 4RH6A 2ASQA 2NBVB 2YEPF 4KIKB 3W9CB 3T3NA 1DYQA 4M00A 3I5JC 2D11A 2KLCA 2BB5A 2L1AA 1GG3A 4JX1C 5CHFA 3UGBB 3DCGA 1ZOYB 2BYVE 1DOXA 1XXGA 2WYQA 2WXOA 4TKNA 4DHJB 4YTNB 1C4CA 1VJKA 3O65B 4RMAA 1ZDVA 4HLEA 4K81A 1UF0A 2DZJA 3W1SC 1YN3A 4PS7A 4TUUA 4BKGA 2RPQA 1HXYD 4JPSA 1I4GA 3AEFB 4WAAA 2QC8A 3PREA 3TEXA 3Q3MC 3KYCD 2M56B 1V6EA 2RDGA 3VQIA 4EFOA 1E8ZA 1WXAA 1QOFA 4ZRQA 2V4IB 1BUIC 2WXJA 4G3XB 1Z5SB 4YTPB 2DYOA 4DXAB 1K8RB 1QKZA 1I42A 5DPSA 2RDHA 2BQQA 3ML9A 1IYFA 4IW0A 2B3AA 3WCQA 1N60A 1T0RC 1YJJA 2KX3A 2J42A 1C4AA 4AS1A 2Y5BB 4HCPB 4WH4A 1IGDA 4AWJA 1UGMA 4XC2A 4MJSB 5LXHA 1M4VA 5TSSA 1WZ0A 2XBBC 3L13A 1TKGA 4YSXB 2IO3B 2ZW0A 2IO1B 4XYCA 5BO4B 4RNAA 1TS4A 3RNFC 1RFKA 5G5GA 2NTSA 3VUXA 3RCZA 3ZNHB 3U52E 3AXCA 4ZYSA 5IA7A 3P63A 1ET9A 4HDOA 5CTRC 5HHDG 4BBNF 1TS5A 2WXGA 3T3OA 2JXXA 4E74A 3RN9C 1WM2A 3KVFB 3OJ3A 2KMCA 3TUOA 3W5VB 2WLBA 1C1YB 4LTUA 1WSPA 2ZVNA 4MM3B 3DDCB 3K9PB 1E8WA 1HZ5A 1T0QC 1N62A 2LJIA 1PDXA 1CK1A 3VHTC 4IC7B 4C7YA 4B9KA 1IGCA 4B0MA 4DDID 4GB9A 4KV2A 3NZUA 3APDA 2MQJA 1A70A 2XNAC 1PUTA 2M17A 1T0YA 4WURA 3AU5A 2HTHA 2LASA 1XCTL 2C5LC 4IDIA 1WM3A 4K3CA 3SD5A 2MP2B 4ITKA 3BZDB 4OZAA 2Z0EB 3SFDB 1WF9A 1TKEA 4MGYE 2O2VA 5GMVA 2JYEA 1DOIA 1SGHA 1HZ6A 2KQSA 1N6ZA 3RD2A 1E10A 4RGNA 3DBHB 1JMLA 1Y56A 1C4PA 3DVNV 2WHIA 1LXDA 4A3PA 2JX5A 5L95C 2WNMA 3JSVA 5DPTA 2MBQA 4A8XC 4RGMA 2ZVOA 4EZKA 3GP7A 2D3CA 4HPPA 4JQWC 3C19A 5E6JA 3EECA 2V3NA 1PFDA 2J7QB 3TMPB 1LO5D 1CZPA 2KO3A 2WU2B 1GPXA 4O1NA 3Q8BA 4DHZB 5GXGB 2K39A 4ANXA 2KWVB 1V1PA 3NS8A 1T0SC 2KX0A 2TSSA 4MSQB 5BMGA 2N0SB 4YSZB 4WIPA 1NVID 4US8A 3ZNZB 3Q2AC 4E71A 4NQLB 2JXTA 3RZWC 1Q0WB 4DHJD 1V81A 1E90A 3VTUA 2K5PA 4LDTB 1V86A 4DXFA 2GMIC 1ZDXA 2NBUA 3GZNI 3KUDB 1I4QA 2KN4A 2L83A 1Q1OA 2E6XA 3P2BA 2W55A 3WAOA 2CHZA 1G6JA 4KGRA 4DXGA 1IBXA 4GIVA 2VH2A 2KQ7A 1WJ4A 3ZNGC 2WXNA 4ARIA 2V9HA 1EWYC 3QK0A 4CQNA 3AE8B 2PE9A 1TIFA 2JZ3B 2LJ5A 1SE2A 2ZCBA 4A9AA 1FRRA 1L2NA 1Z2MA 4GGQA 2J0KA 5J2RA 1KF6B 2BWES 2BYTA 3T9LA 2KOXA 3AI5A 1RYJA 2W9NA 1QOAA 2BYEA 2WS3B 1WXSA 2X8XX 1STEA 4KDIC 2DX5B 2L0TA 2JUOA 3JVZX 1XF5L 3JW0X 3P4SB 4D2KA 4LNFA 4B0EA 3PPAA 3A4SC 2G4SA 4LK0M 2MLBA 4HK2A 2LWPA 3RNCC 2I38A 4BKSA 3NG0A 2D07B 5FK9C 4A3OA 4WJOA 2L7RA 3PHWB 2INDC 1NI2A 1YQ4B 2Z0DB 3ZW3A 5KHQA 4WJQA 4WJNA 4IKGA 1WRIA 2PKOA 3QAQA 3ZKJC 4NAMA 2N9EB 3DHIC 3ZIMA 4HDQA 2ON8A 3SHQA 3VXWA 2MJ3A 1UUPA 5JHBA 3NVZA 2NPTB 1HQRD 2UYZB 4XGAB 5AUIA 5TR5A 2KJ6A 2CU3A 2A4ZA 5DCNA 4E3CA 2CS4A 2PIAA 3A9KB 2MHJA 3LYYA 2L32A 4C7ZA 1FM0D 1VCBA 2N1WA 2INCC 3Q8FA 2K3UA 3O13A 1C77A 2BS3B 2KLGA 1GOZA 2LGXA 2LRUA 4I6PA 2PTLA 1TY0A 3FILB 2KAJA 5HFYA 2LRWA 2JWZA 3QJZA 2FE8A 3TL5A 1JWSD 1JWAD 3TJPA 2FUHB 2M0XA 2FBWB 1L6VA 1NYRA 1AN8A 2Z59B 4UDUC 4Q2JA 5AUKA 2JRIB 1GB1A 3APCA 2KZRA 1AWDA 3PT2B 3AEGB 3NHEB 2DAFA 3VRBB 4ANWA 2C60A 1ISNA 2N9LA 1J19A 3KWLA 5G5HA 3DPDA 4B6WA 1OGWA 4W9HA 2YEPB 4MACA 1MG8A 2FIDA 1WE6A 3IBEA 1E8YA 3R7QA 5D7GA 3CMMB 3R8BA 3MHZA 4MSMB 3HM3A 3L0WB 1SF0A 3LMNA 1WJNA 4M02A 1FEHA 4GOCA 1JCKB 2LGDA 3I63C 4RFBA 4GN1A 2KTRA 4GSWA 4PT5A 3RMKC 2G3QB 1KM7A 3A1QA 4K7UA 4TQ1A 2C9WB 2ZPNA 4OW0A 3GZNB 3PLVA 2EELA 3V62A 1ZXHA 1E5WA 3IHPC 2ZZPB 3HUIA 1KLVA 4XX5A 4LLGM 5C2TB 3RT3B 2RMMA 3LJ3A 5C3JB 1LM8B 4LJOB 3Q3FA 2NS5A 2MBBB 1TZ1A 2KC2A 3KUCB 2IGGA 5C23A 3DQVA 2NR2A 2IY0B 3RI7C 3W2DA 4AOFA 1SJHD 2GBRA 2KWUB 3AE2B 4G50A 1YX5B 1V2YA 4M0WB 5L83A 2WXFA 1WGRA 5FKAC 3ZXRA 4C00A 2L0FA 4HKZE 4RF1A 1J8CA 2ZEQA 4CHKA 4EUTA 3V60A 3R7RA 5EE3A 1V49A 1WY8A 2MBOA 1K52A 1JALA 4HCNB 4LNOA 1XT9B 2ACZB 3U7DA 3DWGC 3N1YC 3FAHA 1UGJA 1ROEA 4HJKA 5BYRA 3H7PB 4US9A 1P7FA 2ONQA 2FNJB 1WR1A 1P98A 2J0JA 2M19A 2NVUI 1JWBD 1YOVB 3I9V1 1ESFA 5G2NA 2AQ2B 4ZRKA 2IO2B 1YJ1A 1EM7A 2JZPA 1TBEA 3N32A 4XE0A 2DZMA 1SSNA 1WX9A 3U30A 1QQRA 2MSED 2D3AA 4YL8A 3BIID 3DOWA 3AB5A 2WDVB 3PO0A 5D94A 1SEBD 4HPLB 1ZGUB 1UBQA 2CKHB 2LMCA 1OQYA 3ZJVA 1D4BA 1GC7A 2JSVX 3N9YC 1NDDA 3EFCA 1WI0A 3QARA 1R4MB 1GB4A 2UU7A 2KFKA 4OHJA 2X38A 5I4DA 1RM6C 2R2QA 4F7ZA 2K9XA 3BY4B 3HHMA 4WAFA 1ET6A 3H8HA 4S0RA 2C7MB 4DDGD 2NTTA 5DPRA 2KK8A 3Q3JA 2G45B 3S2AA 3RUIB 4TMAB 2KVRA 1AW7A 2G4DB 1PGAA 1L0XB 1JWMD 3SDLC 2IPKD 3V6EB 5H92C 3AE1B 1HTQA 2WX1A 2XN9C 2RD0A 4PYUA 3AM9A 4EZLA 1TT5B 2IYDB 3Q3NC 1IUEA 2KYWA 5AZHA 4OZCA 3RNAC 3X0WA 4YWGG 2LVOA 4GLSC 3BVMA 2WXIA 4MEMA 4NZLB 2WXKA 3ZJTA 2IBIB 1SIFA 1FRDA 4JWUC 2W3SA 2LEKA 5CHWA 1ZP0B 3IAM1 4IM2A 2WGSA 4ZRJA 1PYWD 5FR6A 4IWPA 2PMVA 2L76A 1C78A 2PW9A 3EFUA 2IGHA 2L52A 2IO0B 3NS1A 4L1BA 4NY0A 1S3SG 2QEJC 4JLCA 3RULA 3WALA 1YX6B 1NBFC 3DVGY 4F8CB 3TEYA 4BKSD 4ZHOA 1C79A 1I35A 3N20C 3B2FA 2OJRA 1SBBB 5D6JB 1WXMA 1VLBA 1JW9D 3E56A 3KWVA 2XK5A 1TS3A 1J7AA 3AN1A 3UQAA 2LGYA 4LNNA 3T8MA 2BKRB 4M01A 3HRDD 4KSLC 4GXBA 3VH4B 1WXVA 4MT5A 2EMTA 4QAYA 3U8ZA 2M8SA 3NVVA 2ZPYA 4FHKA 4HPMB 2N4FA 2IZVB 3KW5B 4DBGA 2HE7A 1FXAA 4ARCA 4FJYA 3CSFA 2DNFA 3VTVA 1WGGA 3L54A 4KZ0A 2OEDA 5G55A 3TEZA 3V6CB 3A4RA 4F1SA 1V1OA 2D10A 2KDIA 1GAQB 1EWCA 3U2SC 5D3DA 2QILA 3ECIA 1FNVA 2ZW1A 3DBSA 2DWQA 2H88B 3AE5B 3B1LX 3L16A 1MPEA 5D3IB 1P7EA 1YJIA 3UF8A 3ZYYX 1IPGA 3R2IA 2K8HA 4JWSC 1Q5WB 2LUMA 3AEDB 4FA6A 4C80A 3M95A 1XEEA 1E8XA 1F77A 1SE9A 5EDSA 3W1SA 1UH6A 4BAXA 1JRPA 3GE8C 4IM0A 2DBYA 2QCZA 1RAXA 3Q3OC 2CHWA 3AE3B 1FCLA 1VZ8A 1TS2A 3MC8A 2REXA 2WU5B 2MX2A 1F9JA 1ZXIA 3BYYB 2LHEA 1N5XA 2K0PA 5JH5C 4ZDVA 3M3JA 1F1HA 1SE4A 3RFZB 2D2QA 2J52A 4LNKA 1T6BX 2ZNVC 1L4DB 3OWEB 4AUQC 4NAWA 2GLSA 3MFGA 3L08A 3ZGZA 3BK2A 2AX5A 1P9DU 1RWSA 4NNJB 2GOWA 3OAWA 4BBNC 2AWTA 3Q8AA 4MGIE 1AYFA 4J6IA 2BT6A 3QWZB 2HJ1A 4K7SA 2QJLA 4GDLA 3AULA 3SR6A 1I7HA 2RR9A 1XLPA 1YQ3B 1SXTA 2FIFA 3QHTA 4BKTA 4HRSA 4FBJB 2AQ3B 2JZZA 4RGTA 3B9JA 4KDLB 1N63A 4HKQA 3V05A 3WAPA 1XCQL 2ICIA 3U7ZA 4G0NB 2K6QA 5IOIA 3ZTDA 1WGHA 2KJRA 1WIAA 3IT4B 2O2VB 2V3PA 1KOTA 1C76A 4I6NB 2K8BA 3MJWA 4W9LA 4ZYNA 4FXCA 5D2MB 3PRPB 1J7CA 2CU1A 1EO6A 1XQQA 3JSVB 4KVGB 3WANA 1L0YB 3EGRA 2C7HA 1YIWA 1YMHE 1WXQA 4JL9A 3W5UB 3A9JA 3H1UA 4GDKA 2W3RA 5IN7A 2K1FA 1XO3A 1KH0A 5IAAC 4L23A 2OJWA 4EZJA 3U4EG 3PZ8A 2KDMA 1F52A 4P7IA 1GC6A 2LHDA 2PPHA 3ZVVA 3MHSD 4OVVA 4W9EA 2MRPA 3CIRB 3PZDA 1TY2A 2DYBA 1V1PB 3P4PB 1H8CA 4GU2A 1L0VB 1PGBA 3AE9B 1R4MI 2RDBC 2JU6X 2KWCA 4RF0A 3AEAB 3I57A 2IGDA 2FCSA 1V9JA 2L00B 1KLUD 3V3XA 2HDEA 4TV3A 1J7BA 5AEKB 2LVQA 2INNE 3PRMB 1QLBB 4AQ7A 1JQ4A 3B08A 4IUMB 2KD0A 4N58A 4JIOU 2JVCA 2NBWB 4TQ0A 2KXJA 2GRIA 2D3BA 1IBXB 4GDLB 4PK1A 3QX1A 5T8IA 3ZJUA 4RGOS 3R3MA 4HEA1 4C4VA 1H4RA 2RPVA 4RM9A 2GBMA 2KMAA 3MTNB 3VAWA 2L05A 2VH1A 1KJTA 2K6DB 2O6VA 1VR9A 3W1YA 2JWUA 2CJOA 4ZRIA 2DHZA 1TTNA 3RNEC 1WH3A 1B9RA 3I3TB 3ML8A 3ENEA 2CJNA 2WX0A 2B76B 2KC1A 4W9KA 2BPSA 3PV1A 3V61A 1WWTA 2KJHB 2N9XA 3NVYA 1WMHA 3QCAA 5BMIA 3Q69A 5AZFA 1RLFA 1FXTB 1CMXB 4NQKE 1MFWA 2RGFA 3IVFA 2LUEA 3OJ4B 4GDKB 4W9JA 4KIKA 2MA9B 4ZHPA 2EMSA 2WXQA 5HKHA 2MBEA 2GBKA 1FD6A 1XLQA 2Q5WD 1NYQA 1C3TA 1CQVA 1F2RC 2R2OA 3VH3B 4NPNA 2FAZA 3ONSA 5JXVA 4KKIA 3BYTB 5LLIA 1NEKB 2JRHA 5IP4D 2XEWA 4ACFA 2HTME 4NJ6A 3CF6E 3IXSA 1OEYA 4EE2A 4W9FA 2PVGC 2V0GA 1QZEA 5EE0A 1WGYA 3ETRA 1YN4A 1MG4A 4B95A 2KN5A 3ZDTA 2ZNVB 3PHXB 1QILA 3Q8EA 3R66C 1P1AA 3K9OB 1LFDA 1JROA 1HE8A 2AYOB 2LD9A 3N3KB 3BVGA 2WP9B 3SFEB 1ACCA 1XLNA 1WJUA 4GMVA 1D5ZC 4MJSA 1F2RI 2V4LA 4WQMA 2QMTA 4K7WA 1FNWA 1HA5A 2LXCA 2VZKB 4ICVA 1HEZE 1WX7A 4TSSA 5HG2A 1WRDB 3RZFA 4CYEA 2KKCA 2BS2B 2WDRB 4P16A 2N9KA 3FKYA 2LZ6A 5E6PA 4ANVA 1V97A 4G11A 4N6EB 2BBCA 2WXLA 4PYZA 3ZNID 3A33B 4IG7B 2NCNA 1LQBA 1B1ZA 1E7UA 1W6VA 4HWIB 1SE3A 1FXIA 1GUAB 2KMMA 3P1MA 4W9CA 5MPOA 3NUHB 3Q14C 3ZUNA 4BVUC 3VVWB 3NJTA 3AEBB 3RYTA 3NZSA 4AP4C 1U4AA 2WXHA 2PLPA 3Q6BA 1WFYA 4P6VF 2KTRB 3ZRFA 1T5XD 1V5OA 3P4QB 1OQRA 4MM3A 3QA8A 4WWPA 1XD3B 3UI3A 3A1QB 1E0ZA 1TZOA 2K25A 3P4RB 5BMHA 3KUZA 3AMZA 2QSDA 1N5WA 2KANA 4M8MA 1PGXA 1MJDA 4BOZB 3P42A 2D3GA 2BF8B 5JZEB 3AU4A 1VDVA 2KVZA 3EA6A 3APFA 2I1JA 4MELA 4HJGE 1WJ6A 1V5TA 2WXMA 2MP2A 3NOBA 3FC4A 3RNBC 4KGSA 2SAKA 3JYUA 4YT0B 2PEAA 4XWWA 3KH0A 4MGKE 3TBLD 2RSUA 2A5UA 1FFVA 3EC8A 2BYFA 3J9CA 2IDYA 3PGEA 3GE3C 1FPYA 1HTOA 1Y8RC 2BGFA 4EEWA 1I4XA 1TKYA 2KWDA 3HVDA 1OQQA 3KYDD 1OFFA 2OOBB 1R7SA 2GI9A 3RPFC 4REZA 1DOYA 3DWMA 1MHHE 4USAA 4A20A 1UWXA 1BT0A 2MBHA 1RFAA 3VRAB 3WA0A 2KQ4X 4P1CC 1EU3A 3H6NA 2BTEA 4I6LB 2INPE 4YXDB 4MGZE 4C56C 4KX6B 4KKJA 1YNTE
chains in the Genus database with same CATH topology
2AWTA 4MGIE 2MWSB 1EF5A 2JWZA 3QJZA 4J6IA 3N30A 3QWZB 4K7SA 2DZIA 2FCQA 3TL5A 3TJPA 4GDLA 2FUHB 2M0XA 3AULA 3OLMD 3WAMA 2Z59B 1A5RA 1V80A 1WMHB 2RR9A 2JRIB 1L7YA 3APCA 5KHQA 2KZRA 2FIFA 2L3ZA 3QHTA 4BKTA 3UIPB 2HD5B 3PT2B 5JHAA 1WE7A 1WX8A 4MDKE 3NHEB 2DAFA 4ANWA 4FBJB 2V3SA 2C60A 1ISNA 1J19A 2JZZA 4KDLB 2GBJA 2KFKB 4BOSC 2ASQA 3EHVA 3WAPA 3DPDA 2NBVB 4B6WA 1OGWA 4W9HA 4KIKB 3PRZA 2LVPA 4G0NB 1MG8A 2AL3A 2K6QA 2FIDA 2D11A 2KLCA 3ZTDA 1GG3A 5CHFA 1WE6A 3UGBB 4IM3A 3DCGA 1WGHA 3IG3A 3IBEA 1P3QU 1E8YA 4ICUA 2BYVE 2DAJA 3R7QA 2KJRA 1WYWB 2WYQA 5D7GA 1WIAA 2L8JA 4TKNA 5J17A 3CMMB 4DHJB 1E7VA 2O2VB 4MSMB 1UELA 3D32A 1KOTA 3HM3A 3L0WB 4I6NB 2K8BA 1WJNA 4W9GA 3MJWA 3LMNA 3O65B 4W9LA 4ZYNA 4RMAA 4HLEA 4K81A 5D2MB 2DZJA 4GOCA 4WWNA 2LGDA 3W1SC 3PRPB 3ALBA 2CU1A 3L17A 2RPQA 4PS7A 4TUUA 4BKGA 3BINA 1EO6A 1XQQA 2N1VA 3JSVB 4KVGB 5E6OA 3WANA 4CO7A 4GN1A 3UIOB 2C7HA 1YIWA 2KTRA 3PLUA 4GSWA 4JL9A 4OVUA 3A9JA 4WAAA 2KTFA 3H1UA 3PREA 4BFRA 1J0GA 4GDKA 2G3QB 3KYCD 1KM7A 2K1FA 1V6EA 2N9PC 3A1QA 4K7UA 3VQIA 5IAAC 4EFOA 1E8ZA 4TQ1A 1UBIA 1WXAA 2O6VD 5CHVC 4EZJA 4M8NA 2C9WB 2ZPNA 3PLVA 4G3XB 3V62A 1E5WA 1Z5SB 2N7EA 4DXAB 2DYOA 3IHPC 4P7IA 1GC6A 1K8RB 2DZKA 2PPHA 5DPSA 3MHSD 3ZVVA 1I42A 2ZZPB 4OVVA 4W9EA 4FLHA 2MRPA 3PZDA 1KLVA 3ML9A 1IYFA 4XX5A 2DYBA 3PVLA 4IW0A 2LI5A 2B3AA 4GU2A 1H8CA 3RT3B 3PTFC 1R4MI 2KX3A 2M1MA 2J0MA 3LJ3A 1LM8B 4LJOB 2KWCA 2Y5BB 3Q3FA 4HCPB 2NS5A 2MBBB 1TZ1A 2KC2A 3KUCB 4PS8A 4AWJA 5C23A 3DQVA 2NR2A 4PS3A 1UGMA 2IY0B 2FCSA 5AZGA 4XC2A 4MJSB 1V9JA 4AOFA 5LXHA 2L00B 3HK0A 5C1ZA 2GBRA 4TV3A 2KWUB 2CR5A 4G50A 1WZ0A 2XBBC 3L13A 2IO3B 1ZKHA 1YX5B 1V2YA 4M0WB 5L83A 5AEKB 1WGRA 2IO1B 2LVQA 2YVCA 5BO4B 2L0FA 2NPTA 3PRMB 1J8CA 2I1KA 2ZEQA 3B08A 4IUMB 2KD0A 2KDFB 3VUXA 1X1MA 4CHKA 4JIOU 2JVCA 3H9DA 2NBWB 3V60A 1YQBA 3R7RA 3RCZA 4EUTA 4TQ0A 2KXJA 1V49A 3ZNHB 4AJYB 3L10B 2LXAA 1WY8A 2MBOA 2XK5B 2PJHA 4HCNB 3AXCA 1RRBA 4GDLB 3A9KA 1XT9B 5IA7A 3QX1A 3U7DA 3R3MA 4HDOA 5CTRC 1H4RA 4RM9A 2GBMA 2KMAA 3MTNB 4BBNF 4HJKA 3VAWA 2L05A 1KJTA 2K6DB 3H7PB 2O6VA 2FNJB 1WR1A 1P98A 2J0JA 2NVUI 3W1YA 2JXXA 4E74A 5G2NA 1WM2A 3KVFB 3OJ3A 4ZRKA 2KMCA 4ZRIA 2FCMA 2DHZA 1TTNA 2IO2B 1YJ1A 3VUYA 1TBEA 1WH3A 3N32A 3I3TB 2DZMA 3ML8A 4II3B 1C1YB 2ZVNA 3ENEA 2WX0A 1WX9A 2KDBA 3U30A 2KC1A 3DDCB 2MSED 4KSKC 4YL8A 4W9KA 2BPSA 1E8WA 2ZCCA 3DOWA 3K9PB 4FHJA 3PV1A 5D94A 3V61A 3VHTC 4HPLB 3X23A 2AL6A 1ZGUB 2KJHB 2N9XA 4IC7B 1UBQA 1OEYJ 3VTWA 1WMHA 2CKHB 1OQYA 4B9KA 3QCAA 1GC7A 5AZFA 1RLFA 4DDID 1FXTB 4GB9A 1CMXB 1NDDA 3NZUA 3APDA 2MQJA 4KV2A 4NQKE 1WI0A 1M94A 3QARA 2M17A 3DBLI 1T0YA 4KZCA 4X57B 3AU5A 2HTHA 3NY5A 5E6NA 2LASA 2RGFA 3IVFA 2KFKA 2LUEA 2PE6B 1UD7A 2C5LC 3OJ4B 1WM3A 2R2QA 3UINB 4GDKB 2DYMA 4KIKA 4W9JA 3DVGX 3BY4B 4F7ZA 3HHMA 2KHWB 3SD5A 2MP2B 2C7MB 1P0RA 3TCAA 2VRRB 3TIXA 4DDGD 2MA9B 2Z0EB 1D3ZA 4EOYA 2EMSA 5DPRA 5HKHA 1WF9A 2KK8A 2MBEA 3Q3JA 2GBKA 3HM6X 4MGYE 2G45B 2O2VA 5GMVA 3S2AA 3RUIB 1SGHA 2KVRA 2KQSA 4N9F4 3RD2A 2G4DB 5DPWA 1C3TA 2R2OA 3DVNV 3VH3B 3SDLC 4NPNA 2FAZA 3VDZA 1LXDA 4A3PA 3ONSA 2JPHA 3V6EB 5L95C 4W9DA 3JSVA 5DPTA 4II2B 2MBQA 2WX1A 5LLIA 2RD0A 2JRHA 4PYUA 4EZLA 2ZVOA 4EZKA 2XEWA 2IYDB 4JQWC 4NJ6A 3CF6E 5AZHA 3X0WA 3EECA 2LVOA 4MEMA 1OEYA 2J7QB 4W9FA 2IBIB 1SIFA 4FN2A 3TMPB 1QZEA 4NAWB 3QIJA 2KO3A 2WDTB 3GOEA 4DHZE 5CHWA 1WGYA 2JT4B 4B95A 2KN5A 4IM2A 1WGDA 3ZDTA 4DHZB 4MH0E 2K39A 4ANXA 2ZNVB 3PHXB 3CSTA 4ZRJA 2KWVB 3H7SA 3R66C 3WIMA 1P1AA 5FR6A 3ZTCA 3ZO5B 3NS8A 3QC8B 3K9OB 4HXDA 2BKFA 1LFDA 4IWPA 2KX0A 1HE8A 2AYOB 2L76A 4MSQB 3EFUA 5J18A 3ZNZB 4EKUA 2LD9A 3N3KB 4E71A 2IO0B 4NQLB 3RZWC 1Q0WB 4LCDE 1WJUA 1UZXB 4GMVA 4DHJD 1V81A 1E90A 5CX3A 1VD2A 4NY0A 3VTUA 1S3SG 5LXIB 4MJSA 2UWQA 4JLCA 3UQBA 4LDTB 2V4LA 3RULA 1V86A 4K7WA 2GMIC 3LDZE 1YX6B 1NBFC 2LXCA 3DVGY 4JGHB 4WWOA 3WALA 4ICVA 1WX7A 4F8CB 2NBUA 3GZNI 3KUDB 1WRDB 3RZFA 4BKSD 4CYEA 1I35A 2KKCA 2OJRA 1Q1OA 1WR6E 5D6JB 3ZRCA 1IP9A 3P2BA 2JY6A 1WXMA 2LZ6A 5E6PA 4ANVA 3WAOA 2CHZA 4IWQA 2M4NA 4G11A 1G6JA 3SU8X 4PYZA 1YD8U 2XK5A 3ZNID 2AEHA 2ZJDA 2GBNA 3A33B 4GIVA 4IG7B 2FCNA 2NCNA 1LQBA 3UQAA 2LGYA 2YLMA 2CHXA 1E7UA 1WJ4A 2C7NB 2KQ7A 4HWIB 3ZNGC 1W6VA 3ZLZA 3T8MA 1GUAB 2BKRB 4KSLC 4W9CA 3VFKA 3ZUNA 4BVUC 3PSEB 3H7PA 3QK0A 4GXBA 3VH4B 3VVWB 1WXVA 2HJ8A 2PE9A 4FJZA 2EMTA 2JZ3B 2LJ5A 2ZCBA 3NZSA 3RYTA 1U4AA 4AP4C 1EF1A 3U8ZA 3ZDMC 1L2NA 1Z2MA 2M8SA 2ZPYA 4FHKA 4GGQA 4HPMB 1WFYA 2J0KA 3B0AA 3M63B 2BWES 2N4FA 5J2RA 3T9LA 2KOXA 2IZVB 3AI5A 3KW5B 2KTRB 4IWOA 4WQOB 5KHOA 3ZRFA 4DBGA 2W9NA 1V5OA 3HIZA 3A9JB 2BYEA 2KNBA 2HE7A 1WXSA 4MM3A 2DENB 4FJYA 3CSFA 3QA8A 4WWPA 1XD3B 3VTVA 1WGGA 3A1QB 3L54A 4KZ0A 4XZ4A 3VUWA 5G55A 2K25A 3V6CB 3A4RA 4KDIC 2DX5B 4F1SA 2EKEC 4LJPB 2D10A 2KDIA 2L0TA 4DK5A 4AJWA 3KUZA 2JUOA 3JVZX 3JW0X 2N7DA 2KANA 4M8MA 3ECIA 4BOZB 3DBSA 3PPAA 3B1LX 2V1YA 3QQ8B 2D3GA 2BF8B 3L16A 3AU4A 3A4SC 2G4SA 5JZEB 3UF8A 1IPGA 2MLBA 4HK2A 1OTRB 2I1JA 3APFA 3PS6A 2K8HA 2LWPA 4BKSA 4MELA 2K8CA 1Q5WB 1JRUA 4FA6A 1WJ6A 2D07B 1V5TA 3M95A 4LDTD 1EUVB 1E8XA 2MP2A 4DWFA 3NOBA 1SE9A 4A3OA 5EDSA 1PQSA 3W1SA 4WJOA 1UH6A 2L7RA 3DBRI 3PHWB 4NJ7A 1NI2A 3JYUA 4ANUA 4IM0A 2Z0DB 3ZW3A 4URKA 2PEAA 4FJVB 1RAXA 2WWZA 3KH0A 4WJNA 4WJQA 4MGKE 3TBLD 4FADA 2JF5A 3QAQA 2CHWA 3M62B 3ZKJC 2N9EB 1GNUA 3DVNU 3ZIMA 2RSUA 2A5UA 4HDQA 4W9IA 2KDEB 2REXA 2QHOA 3SHQA 3EC8A 2BYFA 3VXWA 2MX2A 4FULA 5JHBA 1F9JA 3IFWB 2NPTB 5JH5C 2UYZB 3PGEA 4ZDVA 1Y8RC 2BGFA 3M3JA 4EEWA 3C0RB 2D2QA 3KYDD 4K1RB 1WZ3A 5TR5A 2KJ6A 2OOBB 2ZNVC 2A4ZA 5DCNA 1ZW7A 2IY1B 4A20A 2CS4A 4E3CA 3A9KB 4AUQC 1GJZA 4NAWA 4WJPA 4ASWC 1VCBA 2N1WA 1R4NI 1BT0A 2MBHA 1RFAA 3L08A 2O6VB 2KLGA 1TGZB 3WA0A 1S1QB 1AARA 2MCNB 3DBHI 2LGXA 2KFJA 2LRUA 4RM8A 3H6NA 4I6PA 2MW5A 4I6LB 2BWFA 1P9DU 4MGZE 4NNJB 4HVBA 2GOWA 3OAWA 2LRWA 4BBNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWT A;  4MGI E;  2MWS B;  1EF5 A;  2JWZ A;  3QJZ A;  4J6I A;  3N30 A;  3QWZ B;  4K7S A;  2DZI A;  2FCQ A;  3TL5 A;  3TJP A;  4GDL A;  2FUH B;  2M0X A;  3AUL A;  3OLM D;  3WAM A;  2Z59 B;  1A5R A;  1V80 A;  1WMH B;  2RR9 A;  2JRI B;  1L7Y A;  3APC A;  5KHQ A;  2KZR A;  2FIF A;  2L3Z A;  3QHT A;  4BKT A;  3UIP B;  2HD5 B;  3PT2 B;  5JHA A;  1WE7 A;  1WX8 A;  4MDK E;  3NHE B;  2DAF A;  4ANW A;  4FBJ B;  2V3S A;  2C60 A;  1ISN A;  1J19 A;  2JZZ A;  4KDL B;  2GBJ A;  2KFK B;  4BOS C;  2ASQ A;  3EHV A;  3WAP A;  3DPD A;  2NBV B;  4B6W A;  1OGW A;  4W9H A;  4KIK B;  3PRZ A;  2LVP A;  4G0N B;  1MG8 A;  2AL3 A;  2K6Q A;  2FID A;  2D11 A;  2KLC A;  3ZTD A;  1GG3 A;  5CHF A;  1WE6 A;  3UGB B;  4IM3 A;  3DCG A;  1WGH A;  3IG3 A;  3IBE A;  1P3Q U;  1E8Y A;  4ICU A;  2BYV E;  2DAJ A;  3R7Q A;  2KJR A;  1WYW B;  2WYQ A;  5D7G A;  1WIA A;  2L8J A;  4TKN A;  5J17 A;  3CMM B;  4DHJ B;  1E7V A;  2O2V B;  4MSM B;  1UEL A;  3D32 A;  1KOT A;  3HM3 A;  3L0W B;  4I6N B;  2K8B A;  1WJN A;  4W9G A;  3MJW A;  3LMN A;  3O65 B;  4W9L A;  4ZYN A;  4RMA A;  4HLE A;  4K81 A;  5D2M B;  2DZJ A;  4GOC A;  4WWN A;  2LGD A;  3W1S C;  3PRP B;  3ALB A;  2CU1 A;  3L17 A;  2RPQ A;  4PS7 A;  4TUU A;  4BKG A;  3BIN A;  1EO6 A;  1XQQ A;  2N1V A;  3JSV B;  4KVG B;  5E6O A;  3WAN A;  4CO7 A;  4GN1 A;  3UIO B;  2C7H A;  1YIW A;  2KTR A;  3PLU A;  4GSW A;  4JL9 A;  4OVU A;  3A9J A;  4WAA A;  2KTF A;  3H1U A;  3PRE A;  4BFR A;  1J0G A;  4GDK A;  2G3Q B;  3KYC D;  1KM7 A;  2K1F A;  1V6E A;  2N9P C;  3A1Q A;  4K7U A;  3VQI A;  5IAA C;  4EFO A;  1E8Z A;  4TQ1 A;  1UBI A;  1WXA A;  2O6V D;  5CHV C;  4EZJ A;  4M8N A;  2C9W B;  2ZPN A;  3PLV A;  4G3X B;  3V62 A;  1E5W A;  1Z5S B;  2N7E A;  4DXA B;  2DYO A;  3IHP C;  4P7I A;  1GC6 A;  1K8R B;  2DZK A;  2PPH A;  5DPS A;  3MHS D;  3ZVV A;  1I42 A;  2ZZP B;  4OVV A;  4W9E A;  4FLH A;  2MRP A;  3PZD A;  1KLV A;  3ML9 A;  1IYF A;  4XX5 A;  2DYB A;  3PVL A;  4IW0 A;  2LI5 A;  2B3A A;  4GU2 A;  1H8C A;  3RT3 B;  3PTF C;  1R4M I;  2KX3 A;  2M1M A;  2J0M A;  3LJ3 A;  1LM8 B;  4LJO B;  2KWC A;  2Y5B B;  3Q3F A;  4HCP B;  2NS5 A;  2MBB B;  1TZ1 A;  2KC2 A;  3KUC B;  4PS8 A;  4AWJ A;  5C23 A;  3DQV A;  2NR2 A;  4PS3 A;  1UGM A;  2IY0 B;  2FCS A;  5AZG A;  4XC2 A;  4MJS B;  1V9J A;  4AOF A;  5LXH A;  2L00 B;  3HK0 A;  5C1Z A;  2GBR A;  4TV3 A;  2KWU B;  2CR5 A;  4G50 A;  1WZ0 A;  2XBB C;  3L13 A;  2IO3 B;  1ZKH A;  1YX5 B;  1V2Y A;  4M0W B;  5L83 A;  5AEK B;  1WGR A;  2IO1 B;  2LVQ A;  2YVC A;  5BO4 B;  2L0F A;  2NPT A;  3PRM B;  1J8C A;  2I1K A;  2ZEQ A;  3B08 A;  4IUM B;  2KD0 A;  2KDF B;  3VUX A;  1X1M A;  4CHK A;  4JIO U;  2JVC A;  3H9D A;  2NBW B;  3V60 A;  1YQB A;  3R7R A;  3RCZ A;  4EUT A;  4TQ0 A;  2KXJ A;  1V49 A;  3ZNH B;  4AJY B;  3L10 B;  2LXA A;  1WY8 A;  2MBO A;  2XK5 B;  2PJH A;  4HCN B;  3AXC A;  1RRB A;  4GDL B;  3A9K A;  1XT9 B;  5IA7 A;  3QX1 A;  3U7D A;  3R3M A;  4HDO A;  5CTR C;  1H4R A;  4RM9 A;  2GBM A;  2KMA A;  3MTN B;  4BBN F;  4HJK A;  3VAW A;  2L05 A;  1KJT A;  2K6D B;  3H7P B;  2O6V A;  2FNJ B;  1WR1 A;  1P98 A;  2J0J A;  2NVU I;  3W1Y A;  2JXX A;  4E74 A;  5G2N A;  1WM2 A;  3KVF B;  3OJ3 A;  4ZRK A;  2KMC A;  4ZRI A;  2FCM A;  2DHZ A;  1TTN A;  2IO2 B;  1YJ1 A;  3VUY A;  1TBE A;  1WH3 A;  3N32 A;  3I3T B;  2DZM A;  3ML8 A;  4II3 B;  1C1Y B;  2ZVN A;  3ENE A;  2WX0 A;  1WX9 A;  2KDB A;  3U30 A;  2KC1 A;  3DDC B;  2MSE D;  4KSK C;  4YL8 A;  4W9K A;  2BPS A;  1E8W A;  2ZCC A;  3DOW A;  3K9P B;  4FHJ A;  3PV1 A;  5D94 A;  3V61 A;  3VHT C;  4HPL B;  3X23 A;  2AL6 A;  1ZGU B;  2KJH B;  2N9X A;  4IC7 B;  1UBQ A;  1OEY J;  3VTW A;  1WMH A;  2CKH B;  1OQY A;  4B9K A;  3QCA A;  1GC7 A;  5AZF A;  1RLF A;  4DDI D;  1FXT B;  4GB9 A;  1CMX B;  1NDD A;  3NZU A;  3APD A;  2MQJ A;  4KV2 A;  4NQK E;  1WI0 A;  1M94 A;  3QAR A;  2M17 A;  3DBL I;  1T0Y A;  4KZC A;  4X57 B;  3AU5 A;  2HTH A;  3NY5 A;  5E6N A;  2LAS A;  2RGF A;  3IVF A;  2KFK A;  2LUE A;  2PE6 B;  1UD7 A;  2C5L C;  3OJ4 B;  1WM3 A;  2R2Q A;  3UIN B;  4GDK B;  2DYM A;  4KIK A;  4W9J A;  3DVG X;  3BY4 B;  4F7Z A;  3HHM A;  2KHW B;  3SD5 A;  2MP2 B;  2C7M B;  1P0R A;  3TCA A;  2VRR B;  3TIX A;  4DDG D;  2MA9 B;  2Z0E B;  1D3Z A;  4EOY A;  2EMS A;  5DPR A;  5HKH A;  1WF9 A;  2KK8 A;  2MBE A;  3Q3J A;  2GBK A;  3HM6 X;  4MGY E;  2G45 B;  2O2V A;  5GMV A;  3S2A A;  3RUI B;  1SGH A;  2KVR A;  2KQS A;  4N9F 4;  3RD2 A;  2G4D B;  5DPW A;  1C3T A;  2R2O A;  3DVN V;  3VH3 B;  3SDL C;  4NPN A;  2FAZ A;  3VDZ A;  1LXD A;  4A3P A;  3ONS A;  2JPH A;  3V6E B;  5L95 C;  4W9D A;  3JSV A;  5DPT A;  4II2 B;  2MBQ A;  2WX1 A;  5LLI A;  2RD0 A;  2JRH A;  4PYU A;  4EZL A;  2ZVO A;  4EZK A;  2XEW A;  2IYD B;  4JQW C;  4NJ6 A;  3CF6 E;  5AZH A;  3X0W A;  3EEC A;  2LVO A;  4MEM A;  1OEY A;  2J7Q B;  4W9F A;  2IBI B;  1SIF A;  4FN2 A;  3TMP B;  1QZE A;  4NAW B;  3QIJ A;  2KO3 A;  2WDT B;  3GOE A;  4DHZ E;  5CHW A;  1WGY A;  2JT4 B;  4B95 A;  2KN5 A;  4IM2 A;  1WGD A;  3ZDT A;  4DHZ B;  4MH0 E;  2K39 A;  4ANX A;  2ZNV B;  3PHX B;  3CST A;  4ZRJ A;  2KWV B;  3H7S A;  3R66 C;  3WIM A;  1P1A A;  5FR6 A;  3ZTC A;  3ZO5 B;  3NS8 A;  3QC8 B;  3K9O B;  4HXD A;  2BKF A;  1LFD A;  4IWP A;  2KX0 A;  1HE8 A;  2AYO B;  2L76 A;  4MSQ B;  3EFU A;  5J18 A;  3ZNZ B;  4EKU A;  2LD9 A;  3N3K B;  4E71 A;  2IO0 B;  4NQL B;  3RZW C;  1Q0W B;  4LCD E;  1WJU A;  1UZX B;  4GMV A;  4DHJ D;  1V81 A;  1E90 A;  5CX3 A;  1VD2 A;  4NY0 A;  3VTU A;  1S3S G;  5LXI B;  4MJS A;  2UWQ A;  4JLC A;  3UQB A;  4LDT B;  2V4L A;  3RUL A;  1V86 A;  4K7W A;  2GMI C;  3LDZ E;  1YX6 B;  1NBF C;  2LXC A;  3DVG Y;  4JGH B;  4WWO A;  3WAL A;  4ICV A;  1WX7 A;  4F8C B;  2NBU A;  3GZN I;  3KUD B;  1WRD B;  3RZF A;  4BKS D;  4CYE A;  1I35 A;  2KKC A;  2OJR A;  1Q1O A;  1WR6 E;  5D6J B;  3ZRC A;  1IP9 A;  3P2B A;  2JY6 A;  1WXM A;  2LZ6 A;  5E6P A;  4ANV A;  3WAO A;  2CHZ A;  4IWQ A;  2M4N A;  4G11 A;  1G6J A;  3SU8 X;  4PYZ A;  1YD8 U;  2XK5 A;  3ZNI D;  2AEH A;  2ZJD A;  2GBN A;  3A33 B;  4GIV A;  4IG7 B;  2FCN A;  2NCN A;  1LQB A;  3UQA A;  2LGY A;  2YLM A;  2CHX A;  1E7U A;  1WJ4 A;  2C7N B;  2KQ7 A;  4HWI B;  3ZNG C;  1W6V A;  3ZLZ A;  3T8M A;  1GUA B;  2BKR B;  4KSL C;  4W9C A;  3VFK A;  3ZUN A;  4BVU C;  3PSE B;  3H7P A;  3QK0 A;  4GXB A;  3VH4 B;  3VVW B;  1WXV A;  2HJ8 A;  2PE9 A;  4FJZ A;  2EMT A;  2JZ3 B;  2LJ5 A;  2ZCB A;  3NZS A;  3RYT A;  1U4A A;  4AP4 C;  1EF1 A;  3U8Z A;  3ZDM C;  1L2N A;  1Z2M A;  2M8S A;  2ZPY A;  4FHK A;  4GGQ A;  4HPM B;  1WFY A;  2J0K A;  3B0A A;  3M63 B;  2BWE S;  2N4F A;  5J2R A;  3T9L A;  2KOX A;  2IZV B;  3AI5 A;  3KW5 B;  2KTR B;  4IWO A;  4WQO B;  5KHO A;  3ZRF A;  4DBG A;  2W9N A;  1V5O A;  3HIZ A;  3A9J B;  2BYE A;  2KNB A;  2HE7 A;  1WXS A;  4MM3 A;  2DEN B;  4FJY A;  3CSF A;  3QA8 A;  4WWP A;  1XD3 B;  3VTV A;  1WGG A;  3A1Q B;  3L54 A;  4KZ0 A;  4XZ4 A;  3VUW A;  5G55 A;  2K25 A;  3V6C B;  3A4R A;  4KDI C;  2DX5 B;  4F1S A;  2EKE C;  4LJP B;  2D10 A;  2KDI A;  2L0T A;  4DK5 A;  4AJW A;  3KUZ A;  2JUO A;  3JVZ X;  3JW0 X;  2N7D A;  2KAN A;  4M8M A;  3ECI A;  4BOZ B;  3DBS A;  3PPA A;  3B1L X;  2V1Y A;  3QQ8 B;  2D3G A;  2BF8 B;  3L16 A;  3AU4 A;  3A4S C;  2G4S A;  5JZE B;  3UF8 A;  1IPG A;  2MLB A;  4HK2 A;  1OTR B;  2I1J A;  3APF A;  3PS6 A;  2K8H A;  2LWP A;  4BKS A;  4MEL A;  2K8C A;  1Q5W B;  1JRU A;  4FA6 A;  1WJ6 A;  2D07 B;  1V5T A;  3M95 A;  4LDT D;  1EUV B;  1E8X A;  2MP2 A;  4DWF A;  3NOB A;  1SE9 A;  4A3O A;  5EDS A;  1PQS A;  3W1S A;  4WJO A;  1UH6 A;  2L7R A;  3DBR I;  3PHW B;  4NJ7 A;  1NI2 A;  3JYU A;  4ANU A;  4IM0 A;  2Z0D B;  3ZW3 A;  4URK A;  2PEA A;  4FJV B;  1RAX A;  2WWZ A;  3KH0 A;  4WJN A;  4WJQ A;  4MGK E;  3TBL D;  4FAD A;  2JF5 A;  3QAQ A;  2CHW A;  3M62 B;  3ZKJ C;  2N9E B;  1GNU A;  3DVN U;  3ZIM A;  2RSU A;  2A5U A;  4HDQ A;  4W9I A;  2KDE B;  2REX A;  2QHO A;  3SHQ A;  3EC8 A;  2BYF A;  3VXW A;  2MX2 A;  4FUL A;  5JHB A;  1F9J A;  3IFW B;  2NPT B;  5JH5 C;  2UYZ B;  3PGE A;  4ZDV A;  1Y8R C;  2BGF A;  3M3J A;  4EEW A;  3C0R B;  2D2Q A;  3KYD D;  4K1R B;  1WZ3 A;  5TR5 A;  2KJ6 A;  2OOB B;  2ZNV C;  2A4Z A;  5DCN A;  1ZW7 A;  2IY1 B;  4A20 A;  2CS4 A;  4E3C A;  3A9K B;  4AUQ C;  1GJZ A;  4NAW A;  4WJP A;  4ASW C;  1VCB A;  2N1W A;  1R4N I;  1BT0 A;  2MBH A;  1RFA A;  3L08 A;  2O6V B;  2KLG A;  1TGZ B;  3WA0 A;  1S1Q B;  1AAR A;  2MCN B;  3DBH I;  2LGX A;  2KFJ A;  2LRU A;  4RM8 A;  3H6N A;  4I6P A;  2MW5 A;  4I6L B;  2BWF A;  1P9D U;  4MGZ E;  4NNJ B;  4HVB A;  2GOW A;  3OAW A;  2LRW A;  4BBN C; 
#chains in the Genus database with same CATH topology
 2MWS B;  3DHH C;  2AQ1 B;  4HRO A;  3N30 A;  1FNU A;  2H89 B;  2DZI A;  1SB3 C;  2E3T A;  4DQO C;  4J3O D;  3WAM A;  3C8Y A;  5IKC M;  1A5R A;  3AE4 B;  1SJE D;  1V80 A;  3DHG C;  1CJE A;  1FCC C;  1L7Y A;  2L3Z A;  2HD5 B;  5JHA A;  4MDK E;  2N7J A;  2GB1 A;  2GBJ A;  2KFK B;  4BOS C;  1K53 A;  3EHV A;  3DBR B;  3PRZ A;  2LVP A;  2AL3 A;  5LNK 1;  3N1X C;  4IM3 A;  3IG3 A;  3R2T A;  1P3Q U;  4ICU A;  2DAJ A;  1WYW B;  1I4R A;  2WQY B;  2L8J A;  5J17 A;  2QDF A;  3TSS A;  3GB1 A;  1E7V A;  1TYG B;  3L4P A;  1UEL A;  3D32 A;  4W9G A;  2IJ0 A;  4MH8 A;  4WWN A;  1D5X C;  1UWM A;  3ALB A;  3L17 A;  4LNI A;  1LGR A;  3BIN A;  5E6O A;  2N1V A;  4CO7 A;  3UIO B;  3PLU A;  1MI0 A;  4OVU A;  1DGJ A;  2KTF A;  1QT9 A;  1I4P A;  4BFR A;  1QOB A;  2WXR A;  3NVW A;  1J0G A;  3GS2 A;  2N9P C;  1R4N B;  2VZK D;  1UBI A;  2O6V D;  5CHV C;  4M8N A;  4H2A A;  3E9S A;  1ZE3 D;  2JQR B;  2N7E A;  1BML C;  3AEC B;  1D6E C;  2DZK A;  1ENF A;  4FLH A;  2Y3A A;  3PVL A;  3NRZ A;  2LI5 A;  1WGK A;  3PTF C;  2M1M A;  2J0M A;  4A55 A;  4P1B C;  4A90 A;  2BVC A;  5BYQ A;  4PS8 A;  4JE3 B;  4PS3 A;  5AZG A;  1KFY B;  3HK0 A;  5C1Z A;  2CR5 A;  3BWU D;  2MJE A;  2MEK A;  1ZKH A;  2WDQ B;  3MP9 A;  2YVC A;  1D5M C;  3AH7 A;  2W54 A;  2NPT A;  2I1K A;  2KDF B;  1X1M A;  3H9D A;  2PVO D;  1YQB A;  2Y5P A;  4AJY B;  3L10 B;  2LXA A;  1NI3 A;  1UNS A;  2XK5 B;  1FO4 A;  2PJH A;  1QF6 A;  1RRB A;  2DLB A;  3A9K A;  1L6U A;  1K51 A;  3EUB 2;  3ZXV A;  4YTM B;  3MC0 B;  5EE1 A;  1MVK A;  1EU4 A;  4A6Q A;  3FIL A;  2FCM A;  3VUY A;  4II3 B;  4KGT A;  1L5P A;  2JYT A;  2Z8L A;  1I4H A;  3AE6 B;  2KDB A;  4KSK C;  2J4X A;  2ZCC A;  4FHJ A;  1K50 A;  4BZA A;  2K22 A;  3X23 A;  2AL6 A;  4WWM A;  1OEY J;  3VTW A;  4XDD A;  3PZ7 A;  5BYS A;  1NEN B;  1L4Z B;  1M94 A;  3DBL I;  4KZC A;  2G1E A;  4X57 B;  3NY5 A;  5E6N A;  3RNG C;  2G9H D;  2MJD A;  2PE6 B;  1UD7 A;  3UIN B;  2DYM A;  3DVG X;  2KHW B;  3LB8 C;  4XWT A;  1P0R A;  3TCA A;  2VRR B;  2LFI A;  3TIX A;  1D3Z A;  4EOY A;  5EE9 A;  3HM6 X;  4N9F 4;  3HVZ A;  2W82 A;  4RCO A;  5DPW A;  2J53 A;  4OZB A;  3VDZ A;  5H8Y E;  2JPH A;  1E7P B;  4W9D A;  1MHX A;  4II2 B;  2NMQ A;  3IAS 1;  4YSY B;  3ZQ4 A;  1N61 A;  3AE7 B;  3CWI A;  4FN2 A;  4NAW B;  3QIJ A;  3ABV B;  3AEE B;  2WDT B;  3GOE A;  3KLS X;  4DHZ E;  2JT4 B;  1WGD A;  4MH0 E;  1ZUD 2;  3CST A;  3TEW A;  3MC9 A;  3H7S A;  3WIM A;  3ZO5 B;  2D5G A;  3ZTC A;  3QC8 B;  4HXD A;  1VRA B;  2BKF A;  2R61 A;  5J18 A;  5HI1 A;  4EKU A;  4LCD E;  1WYG A;  1KTK A;  1UZX B;  5CX3 A;  5LXI B;  1VD2 A;  2UWQ A;  3UQB A;  3LDZ E;  4WWO A;  4JGH B;  5FR3 A;  1KLG D;  1QOG A;  4M0W A;  3Q8C A;  2EKI A;  2SEB D;  1WR6 E;  3IT6 B;  3ZRC A;  1IP9 A;  2JY6 A;  4XDC A;  1F0Z A;  3KQ4 A;  4IWQ A;  2M4N A;  3SU8 X;  2M0A A;  1YD8 U;  1SIJ A;  2AEH A;  2ZJD A;  2GBN A;  2FCN A;  2YLM A;  1C9F A;  2CHX A;  2C7N B;  3ZLZ A;  1VZ6 A;  3VFK A;  4ZOH C;  3PSE B;  3H7P A;  2HJ8 A;  3URY A;  4FJZ A;  2BS4 B;  1EF1 A;  3ZDM C;  1E6E B;  3B0A A;  3M63 B;  5KHO A;  2Y5C A;  4IWO A;  4WQO B;  1V8C A;  3HIZ A;  3A9J B;  3OG5 A;  1FMA D;  2KT7 A;  2I2Y A;  2KNB A;  1VZ7 A;  2DEN B;  1BXT A;  4XZ4 A;  3VUW A;  2EKE C;  4LJP B;  4DK5 A;  4AJW A;  2LGS A;  4IOI E;  2N7D A;  1T3Q A;  2WXP A;  4N59 A;  2V1Y A;  3QQ8 B;  1ZPS A;  1JWU D;  4ZRP A;  1OTR B;  3PS6 A;  4NJC A;  2K8C A;  1JRU A;  4LDT D;  1EUV B;  4DWF A;  1E9M A;  1PQS A;  2FUG 1;  3DBR I;  4NJ7 A;  4ANU A;  4URK A;  4FJV B;  4FAD A;  2WWZ A;  3LXF A;  4OVZ A;  3VR8 B;  2BW2 A;  2JF5 A;  1KRH A;  3M62 B;  1GNU A;  3DVN U;  4W9I A;  2KDE B;  2QHO A;  3N1Z C;  1FIQ A;  4FUL A;  3IFW B;  2KAC A;  3VR9 B;  3C0R B;  3AV8 A;  4K1R B;  1WZ3 A;  1XLO A;  4S17 A;  2MH7 A;  1ZW7 A;  2IY1 B;  4R3D A;  1GJZ A;  2OHF A;  4WJP A;  4ASW C;  4C4V B;  1R4N I;  3NZ3 A;  4K3B A;  2O6V B;  1TGZ B;  1S1Q B;  1AAR A;  3DBL B;  2MCN B;  3DBH I;  2KFJ A;  4RM8 A;  2BB6 A;  2MW5 A;  3B2G A;  2BWF A;  3BK1 A;  1YN5 A;  1TJE A;  4HVB A;  1Q10 A;  3SEB A;  3MJ5 A;  1EF5 A;  2FCQ A;  2QIE B;  3OLM D;  3BVZ A;  2LGI A;  1WMH B;  3UIP B;  1WE7 A;  1WX8 A;  4L2Y A;  1FFU A;  5IO9 A;  2V3S A;  4RH6 A;  2ASQ A;  2NBV B;  2YEP F;  4KIK B;  3W9C B;  3T3N A;  1DYQ A;  4M00 A;  3I5J C;  2D11 A;  2KLC A;  2BB5 A;  2L1A A;  1GG3 A;  4JX1 C;  5CHF A;  3UGB B;  3DCG A;  1ZOY B;  2BYV E;  1DOX A;  1XXG A;  2WYQ A;  2WXO A;  4TKN A;  4DHJ B;  4YTN B;  1C4C A;  1VJK A;  3O65 B;  4RMA A;  1ZDV A;  4HLE A;  4K81 A;  1UF0 A;  2DZJ A;  3W1S C;  1YN3 A;  4PS7 A;  4TUU A;  4BKG A;  2RPQ A;  1HXY D;  4JPS A;  1I4G A;  3AEF B;  4WAA A;  2QC8 A;  3PRE A;  3TEX A;  3Q3M C;  3KYC D;  2M56 B;  1V6E A;  2RDG A;  3VQI A;  4EFO A;  1E8Z A;  1WXA A;  1QOF A;  4ZRQ A;  2V4I B;  1BUI C;  2WXJ A;  4G3X B;  1Z5S B;  4YTP B;  2DYO A;  4DXA B;  1K8R B;  1QKZ A;  1I42 A;  5DPS A;  2RDH A;  2BQQ A;  3ML9 A;  1IYF A;  4IW0 A;  2B3A A;  3WCQ A;  1N60 A;  1T0R C;  1YJJ A;  2KX3 A;  2J42 A;  1C4A A;  4AS1 A;  2Y5B B;  4HCP B;  4WH4 A;  1IGD A;  4AWJ A;  1UGM A;  4XC2 A;  4MJS B;  5LXH A;  1M4V A;  5TSS A;  1WZ0 A;  2XBB C;  3L13 A;  1TKG A;  4YSX B;  2IO3 B;  2ZW0 A;  2IO1 B;  4XYC A;  5BO4 B;  4RNA A;  1TS4 A;  3RNF C;  1RFK A;  5G5G A;  2NTS A;  3VUX A;  3RCZ A;  3ZNH B;  3U52 E;  3AXC A;  4ZYS A;  5IA7 A;  3P63 A;  1ET9 A;  4HDO A;  5CTR C;  5HHD G;  4BBN F;  1TS5 A;  2WXG A;  3T3O A;  2JXX A;  4E74 A;  3RN9 C;  1WM2 A;  3KVF B;  3OJ3 A;  2KMC A;  3TUO A;  3W5V B;  2WLB A;  1C1Y B;  4LTU A;  1WSP A;  2ZVN A;  4MM3 B;  3DDC B;  3K9P B;  1E8W A;  1HZ5 A;  1T0Q C;  1N62 A;  2LJI A;  1PDX A;  1CK1 A;  3VHT C;  4IC7 B;  4C7Y A;  4B9K A;  1IGC A;  4B0M A;  4DDI D;  4GB9 A;  4KV2 A;  3NZU A;  3APD A;  2MQJ A;  1A70 A;  2XNA C;  1PUT A;  2M17 A;  1T0Y A;  4WUR A;  3AU5 A;  2HTH A;  2LAS A;  1XCT L;  2C5L C;  4IDI A;  1WM3 A;  4K3C A;  3SD5 A;  2MP2 B;  4ITK A;  3BZD B;  4OZA A;  2Z0E B;  3SFD B;  1WF9 A;  1TKE A;  4MGY E;  2O2V A;  5GMV A;  2JYE A;  1DOI A;  1SGH A;  1HZ6 A;  2KQS A;  1N6Z A;  3RD2 A;  1E10 A;  4RGN A;  3DBH B;  1JML A;  1Y56 A;  1C4P A;  3DVN V;  2WHI A;  1LXD A;  4A3P A;  2JX5 A;  5L95 C;  2WNM A;  3JSV A;  5DPT A;  2MBQ A;  4A8X C;  4RGM A;  2ZVO A;  4EZK A;  3GP7 A;  2D3C A;  4HPP A;  4JQW C;  3C19 A;  5E6J A;  3EEC A;  2V3N A;  1PFD A;  2J7Q B;  3TMP B;  1LO5 D;  1CZP A;  2KO3 A;  2WU2 B;  1GPX A;  4O1N A;  3Q8B A;  4DHZ B;  5GXG B;  2K39 A;  4ANX A;  2KWV B;  1V1P A;  3NS8 A;  1T0S C;  2KX0 A;  2TSS A;  4MSQ B;  5BMG A;  2N0S B;  4YSZ B;  4WIP A;  1NVI D;  4US8 A;  3ZNZ B;  3Q2A C;  4E71 A;  4NQL B;  2JXT A;  3RZW C;  1Q0W B;  4DHJ D;  1V81 A;  1E90 A;  3VTU A;  2K5P A;  4LDT B;  1V86 A;  4DXF A;  2GMI C;  1ZDX A;  2NBU A;  3GZN I;  3KUD B;  1I4Q A;  2KN4 A;  2L83 A;  1Q1O A;  2E6X A;  3P2B A;  2W55 A;  3WAO A;  2CHZ A;  1G6J A;  4KGR A;  4DXG A;  1IBX A;  4GIV A;  2VH2 A;  2KQ7 A;  1WJ4 A;  3ZNG C;  2WXN A;  4ARI A;  2V9H A;  1EWY C;  3QK0 A;  4CQN A;  3AE8 B;  2PE9 A;  1TIF A;  2JZ3 B;  2LJ5 A;  1SE2 A;  2ZCB A;  4A9A A;  1FRR A;  1L2N A;  1Z2M A;  4GGQ A;  2J0K A;  5J2R A;  1KF6 B;  2BWE S;  2BYT A;  3T9L A;  2KOX A;  3AI5 A;  1RYJ A;  2W9N A;  1QOA A;  2BYE A;  2WS3 B;  1WXS A;  2X8X X;  1STE A;  4KDI C;  2DX5 B;  2L0T A;  2JUO A;  3JVZ X;  1XF5 L;  3JW0 X;  3P4S B;  4D2K A;  4LNF A;  4B0E A;  3PPA A;  3A4S C;  2G4S A;  4LK0 M;  2MLB A;  4HK2 A;  2LWP A;  3RNC C;  2I38 A;  4BKS A;  3NG0 A;  2D07 B;  5FK9 C;  4A3O A;  4WJO A;  2L7R A;  3PHW B;  2IND C;  1NI2 A;  1YQ4 B;  2Z0D B;  3ZW3 A;  5KHQ A;  4WJQ A;  4WJN A;  4IKG A;  1WRI A;  2PKO A;  3QAQ A;  3ZKJ C;  4NAM A;  2N9E B;  3DHI C;  3ZIM A;  4HDQ A;  2ON8 A;  3SHQ A;  3VXW A;  2MJ3 A;  1UUP A;  5JHB A;  3NVZ A;  2NPT B;  1HQR D;  2UYZ B;  4XGA B;  5AUI A;  5TR5 A;  2KJ6 A;  2CU3 A;  2A4Z A;  5DCN A;  4E3C A;  2CS4 A;  2PIA A;  3A9K B;  2MHJ A;  3LYY A;  2L32 A;  4C7Z A;  1FM0 D;  1VCB A;  2N1W A;  2INC C;  3Q8F A;  2K3U A;  3O13 A;  1C77 A;  2BS3 B;  2KLG A;  1GOZ A;  2LGX A;  2LRU A;  4I6P A;  2PTL A;  1TY0 A;  3FIL B;  2KAJ A;  5HFY A;  2LRW A;  2JWZ A;  3QJZ A;  2FE8 A;  3TL5 A;  1JWS D;  1JWA D;  3TJP A;  2FUH B;  2M0X A;  2FBW B;  1L6V A;  1NYR A;  1AN8 A;  2Z59 B;  4UDU C;  4Q2J A;  5AUK A;  2JRI B;  1GB1 A;  3APC A;  2KZR A;  1AWD A;  3PT2 B;  3AEG B;  3NHE B;  2DAF A;  3VRB B;  4ANW A;  2C60 A;  1ISN A;  2N9L A;  1J19 A;  3KWL A;  5G5H A;  3DPD A;  4B6W A;  1OGW A;  4W9H A;  2YEP B;  4MAC A;  1MG8 A;  2FID A;  1WE6 A;  3IBE A;  1E8Y A;  3R7Q A;  5D7G A;  3CMM B;  3R8B A;  3MHZ A;  4MSM B;  3HM3 A;  3L0W B;  1SF0 A;  3LMN A;  1WJN A;  4M02 A;  1FEH A;  4GOC A;  1JCK B;  2LGD A;  3I63 C;  4RFB A;  4GN1 A;  2KTR A;  4GSW A;  4PT5 A;  3RMK C;  2G3Q B;  1KM7 A;  3A1Q A;  4K7U A;  4TQ1 A;  2C9W B;  2ZPN A;  4OW0 A;  3GZN B;  3PLV A;  2EEL A;  3V62 A;  1ZXH A;  1E5W A;  3IHP C;  2ZZP B;  3HUI A;  1KLV A;  4XX5 A;  4LLG M;  5C2T B;  3RT3 B;  2RMM A;  3LJ3 A;  5C3J B;  1LM8 B;  4LJO B;  3Q3F A;  2NS5 A;  2MBB B;  1TZ1 A;  2KC2 A;  3KUC B;  2IGG A;  5C23 A;  3DQV A;  2NR2 A;  2IY0 B;  3RI7 C;  3W2D A;  4AOF A;  1SJH D;  2GBR A;  2KWU B;  3AE2 B;  4G50 A;  1YX5 B;  1V2Y A;  4M0W B;  5L83 A;  2WXF A;  1WGR A;  5FKA C;  3ZXR A;  4C00 A;  2L0F A;  4HKZ E;  4RF1 A;  1J8C A;  2ZEQ A;  4CHK A;  4EUT A;  3V60 A;  3R7R A;  5EE3 A;  1V49 A;  1WY8 A;  2MBO A;  1K52 A;  1JAL A;  4HCN B;  4LNO A;  1XT9 B;  2ACZ B;  3U7D A;  3DWG C;  3N1Y C;  3FAH A;  1UGJ A;  1ROE A;  4HJK A;  5BYR A;  3H7P B;  4US9 A;  1P7F A;  2ONQ A;  2FNJ B;  1WR1 A;  1P98 A;  2J0J A;  2M19 A;  2NVU I;  1JWB D;  1YOV B;  3I9V 1;  1ESF A;  5G2N A;  2AQ2 B;  4ZRK A;  2IO2 B;  1YJ1 A;  1EM7 A;  2JZP A;  1TBE A;  3N32 A;  4XE0 A;  2DZM A;  1SSN A;  1WX9 A;  3U30 A;  1QQR A;  2MSE D;  2D3A A;  4YL8 A;  3BII D;  3DOW A;  3AB5 A;  2WDV B;  3PO0 A;  5D94 A;  1SEB D;  4HPL B;  1ZGU B;  1UBQ A;  2CKH B;  2LMC A;  1OQY A;  3ZJV A;  1D4B A;  1GC7 A;  2JSV X;  3N9Y C;  1NDD A;  3EFC A;  1WI0 A;  3QAR A;  1R4M B;  1GB4 A;  2UU7 A;  2KFK A;  4OHJ A;  2X38 A;  5I4D A;  1RM6 C;  2R2Q A;  4F7Z A;  2K9X A;  3BY4 B;  3HHM A;  4WAF A;  1ET6 A;  3H8H A;  4S0R A;  2C7M B;  4DDG D;  2NTT A;  5DPR A;  2KK8 A;  3Q3J A;  2G45 B;  3S2A A;  3RUI B;  4TMA B;  2KVR A;  1AW7 A;  2G4D B;  1PGA A;  1L0X B;  1JWM D;  3SDL C;  2IPK D;  3V6E B;  5H92 C;  3AE1 B;  1HTQ A;  2WX1 A;  2XN9 C;  2RD0 A;  4PYU A;  3AM9 A;  4EZL A;  1TT5 B;  2IYD B;  3Q3N C;  1IUE A;  2KYW A;  5AZH A;  4OZC A;  3RNA C;  3X0W A;  4YWG G;  2LVO A;  4GLS C;  3BVM A;  2WXI A;  4MEM A;  4NZL B;  2WXK A;  3ZJT A;  2IBI B;  1SIF A;  1FRD A;  4JWU C;  2W3S A;  2LEK A;  5CHW A;  1ZP0 B;  3IAM 1;  4IM2 A;  2WGS A;  4ZRJ A;  1PYW D;  5FR6 A;  4IWP A;  2PMV A;  2L76 A;  1C78 A;  2PW9 A;  3EFU A;  2IGH A;  2L52 A;  2IO0 B;  3NS1 A;  4L1B A;  4NY0 A;  1S3S G;  2QEJ C;  4JLC A;  3RUL A;  3WAL A;  1YX6 B;  1NBF C;  3DVG Y;  4F8C B;  3TEY A;  4BKS D;  4ZHO A;  1C79 A;  1I35 A;  3N20 C;  3B2F A;  2OJR A;  1SBB B;  5D6J B;  1WXM A;  1VLB A;  1JW9 D;  3E56 A;  3KWV A;  2XK5 A;  1TS3 A;  1J7A A;  3AN1 A;  3UQA A;  2LGY A;  4LNN A;  3T8M A;  2BKR B;  4M01 A;  3HRD D;  4KSL C;  4GXB A;  3VH4 B;  1WXV A;  4MT5 A;  2EMT A;  4QAY A;  3U8Z A;  2M8S A;  3NVV A;  2ZPY A;  4FHK A;  4HPM B;  2N4F A;  2IZV B;  3KW5 B;  4DBG A;  2HE7 A;  1FXA A;  4ARC A;  4FJY A;  3CSF A;  2DNF A;  3VTV A;  1WGG A;  3L54 A;  4KZ0 A;  2OED A;  5G55 A;  3TEZ A;  3V6C B;  3A4R A;  4F1S A;  1V1O A;  2D10 A;  2KDI A;  1GAQ B;  1EWC A;  3U2S C;  5D3D A;  2QIL A;  3ECI A;  1FNV A;  2ZW1 A;  3DBS A;  2DWQ A;  2H88 B;  3AE5 B;  3B1L X;  3L16 A;  1MPE A;  5D3I B;  1P7E A;  1YJI A;  3UF8 A;  3ZYY X;  1IPG A;  3R2I A;  2K8H A;  4JWS C;  1Q5W B;  2LUM A;  3AED B;  4FA6 A;  4C80 A;  3M95 A;  1XEE A;  1E8X A;  1F77 A;  1SE9 A;  5EDS A;  3W1S A;  1UH6 A;  4BAX A;  1JRP A;  3GE8 C;  4IM0 A;  2DBY A;  2QCZ A;  1RAX A;  3Q3O C;  2CHW A;  3AE3 B;  1FCL A;  1VZ8 A;  1TS2 A;  3MC8 A;  2REX A;  2WU5 B;  2MX2 A;  1F9J A;  1ZXI A;  3BYY B;  2LHE A;  1N5X A;  2K0P A;  5JH5 C;  4ZDV A;  3M3J A;  1F1H A;  1SE4 A;  3RFZ B;  2D2Q A;  2J52 A;  4LNK A;  1T6B X;  2ZNV C;  1L4D B;  3OWE B;  4AUQ C;  4NAW A;  2GLS A;  3MFG A;  3L08 A;  3ZGZ A;  3BK2 A;  2AX5 A;  1P9D U;  1RWS A;  4NNJ B;  2GOW A;  3OAW A;  4BBN C;  2AWT A;  3Q8A A;  4MGI E;  1AYF A;  4J6I A;  2BT6 A;  3QWZ B;  2HJ1 A;  4K7S A;  2QJL A;  4GDL A;  3AUL A;  3SR6 A;  1I7H A;  2RR9 A;  1XLP A;  1YQ3 B;  1SXT A;  2FIF A;  3QHT A;  4BKT A;  4HRS A;  4FBJ B;  2AQ3 B;  2JZZ A;  4RGT A;  3B9J A;  4KDL B;  1N63 A;  4HKQ A;  3V05 A;  3WAP A;  1XCQ L;  2ICI A;  3U7Z A;  4G0N B;  2K6Q A;  5IOI A;  3ZTD A;  1WGH A;  2KJR A;  1WIA A;  3IT4 B;  2O2V B;  2V3P A;  1KOT A;  1C76 A;  4I6N B;  2K8B A;  3MJW A;  4W9L A;  4ZYN A;  4FXC A;  5D2M B;  3PRP B;  1J7C A;  2CU1 A;  1EO6 A;  1XQQ A;  3JSV B;  4KVG B;  3WAN A;  1L0Y B;  3EGR A;  2C7H A;  1YIW A;  1YMH E;  1WXQ A;  4JL9 A;  3W5U B;  3A9J A;  3H1U A;  4GDK A;  2W3R A;  5IN7 A;  2K1F A;  1XO3 A;  1KH0 A;  5IAA C;  4L23 A;  2OJW A;  4EZJ A;  3U4E G;  3PZ8 A;  2KDM A;  1F52 A;  4P7I A;  1GC6 A;  2LHD A;  2PPH A;  3ZVV A;  3MHS D;  4OVV A;  4W9E A;  2MRP A;  3CIR B;  3PZD A;  1TY2 A;  2DYB A;  1V1P B;  3P4P B;  1H8C A;  4GU2 A;  1L0V B;  1PGB A;  3AE9 B;  1R4M I;  2RDB C;  2JU6 X;  2KWC A;  4RF0 A;  3AEA B;  3I57 A;  2IGD A;  2FCS A;  1V9J A;  2L00 B;  1KLU D;  3V3X A;  2HDE A;  4TV3 A;  1J7B A;  5AEK B;  2LVQ A;  2INN E;  3PRM B;  1QLB B;  4AQ7 A;  1JQ4 A;  3B08 A;  4IUM B;  2KD0 A;  4N58 A;  4JIO U;  2JVC A;  2NBW B;  4TQ0 A;  2KXJ A;  2GRI A;  2D3B A;  1IBX B;  4GDL B;  4PK1 A;  3QX1 A;  5T8I A;  3ZJU A;  4RGO S;  3R3M A;  4HEA 1;  4C4V A;  1H4R A;  2RPV A;  4RM9 A;  2GBM A;  2KMA A;  3MTN B;  3VAW A;  2L05 A;  2VH1 A;  1KJT A;  2K6D B;  2O6V A;  1VR9 A;  3W1Y A;  2JWU A;  2CJO A;  4ZRI A;  2DHZ A;  1TTN A;  3RNE C;  1WH3 A;  1B9R A;  3I3T B;  3ML8 A;  3ENE A;  2CJN A;  2WX0 A;  2B76 B;  2KC1 A;  4W9K A;  2BPS A;  3PV1 A;  3V61 A;  1WWT A;  2KJH B;  2N9X A;  3NVY A;  1WMH A;  3QCA A;  5BMI A;  3Q69 A;  5AZF A;  1RLF A;  1FXT B;  1CMX B;  4NQK E;  1MFW A;  2RGF A;  3IVF A;  2LUE A;  3OJ4 B;  4GDK B;  4W9J A;  4KIK A;  2MA9 B;  4ZHP A;  2EMS A;  2WXQ A;  5HKH A;  2MBE A;  2GBK A;  1FD6 A;  1XLQ A;  2Q5W D;  1NYQ A;  1C3T A;  1CQV A;  1F2R C;  2R2O A;  3VH3 B;  4NPN A;  2FAZ A;  3ONS A;  5JXV A;  4KKI A;  3BYT B;  5LLI A;  1NEK B;  2JRH A;  5IP4 D;  2XEW A;  4ACF A;  2HTM E;  4NJ6 A;  3CF6 E;  3IXS A;  1OEY A;  4EE2 A;  4W9F A;  2PVG C;  2V0G A;  1QZE A;  5EE0 A;  1WGY A;  3ETR A;  1YN4 A;  1MG4 A;  4B95 A;  2KN5 A;  3ZDT A;  2ZNV B;  3PHX B;  1QIL A;  3Q8E A;  3R66 C;  1P1A A;  3K9O B;  1LFD A;  1JRO A;  1HE8 A;  2AYO B;  2LD9 A;  3N3K B;  3BVG A;  2WP9 B;  3SFE B;  1ACC A;  1XLN A;  1WJU A;  4GMV A;  1D5Z C;  4MJS A;  1F2R I;  2V4L A;  4WQM A;  2QMT A;  4K7W A;  1FNW A;  1HA5 A;  2LXC A;  2VZK B;  4ICV A;  1HEZ E;  1WX7 A;  4TSS A;  5HG2 A;  1WRD B;  3RZF A;  4CYE A;  2KKC A;  2BS2 B;  2WDR B;  4P16 A;  2N9K A;  3FKY A;  2LZ6 A;  5E6P A;  4ANV A;  1V97 A;  4G11 A;  4N6E B;  2BBC A;  2WXL A;  4PYZ A;  3ZNI D;  3A33 B;  4IG7 B;  2NCN A;  1LQB A;  1B1Z A;  1E7U A;  1W6V A;  4HWI B;  1SE3 A;  1FXI A;  1GUA B;  2KMM A;  3P1M A;  4W9C A;  5MPO A;  3NUH B;  3Q14 C;  3ZUN A;  4BVU C;  3VVW B;  3NJT A;  3AEB B;  3RYT A;  3NZS A;  4AP4 C;  1U4A A;  2WXH A;  2PLP A;  3Q6B A;  1WFY A;  4P6V F;  2KTR B;  3ZRF A;  1T5X D;  1V5O A;  3P4Q B;  1OQR A;  4MM3 A;  3QA8 A;  4WWP A;  1XD3 B;  3UI3 A;  3A1Q B;  1E0Z A;  1TZO A;  2K25 A;  3P4R B;  5BMH A;  3KUZ A;  3AMZ A;  2QSD A;  1N5W A;  2KAN A;  4M8M A;  1PGX A;  1MJD A;  4BOZ B;  3P42 A;  2D3G A;  2BF8 B;  5JZE B;  3AU4 A;  1VDV A;  2KVZ A;  3EA6 A;  3APF A;  2I1J A;  4MEL A;  4HJG E;  1WJ6 A;  1V5T A;  2WXM A;  2MP2 A;  3NOB A;  3FC4 A;  3RNB C;  4KGS A;  2SAK A;  3JYU A;  4YT0 B;  2PEA A;  4XWW A;  3KH0 A;  4MGK E;  3TBL D;  2RSU A;  2A5U A;  1FFV A;  3EC8 A;  2BYF A;  3J9C A;  2IDY A;  3PGE A;  3GE3 C;  1FPY A;  1HTO A;  1Y8R C;  2BGF A;  4EEW A;  1I4X A;  1TKY A;  2KWD A;  3HVD A;  1OQQ A;  3KYD D;  1OFF A;  2OOB B;  1R7S A;  2GI9 A;  3RPF C;  4REZ A;  1DOY A;  3DWM A;  1MHH E;  4USA A;  4A20 A;  1UWX A;  1BT0 A;  2MBH A;  1RFA A;  3VRA B;  3WA0 A;  2KQ4 X;  4P1C C;  1EU3 A;  3H6N A;  2BTE A;  4I6L B;  2INP E;  4YXD B;  4MGZ E;  4C56 C;  4KX6 B;  4KKJ A;  1YNT E; 
#chains in the Genus database with same CATH homology
 2AWT A;  4MGI E;  2MWS B;  1EF5 A;  2JWZ A;  3QJZ A;  4J6I A;  3N30 A;  3QWZ B;  4K7S A;  2DZI A;  2FCQ A;  3TL5 A;  3TJP A;  4GDL A;  2FUH B;  2M0X A;  3AUL A;  3OLM D;  3WAM A;  2Z59 B;  1A5R A;  1V80 A;  1WMH B;  2RR9 A;  2JRI B;  1L7Y A;  3APC A;  5KHQ A;  2KZR A;  2FIF A;  2L3Z A;  3QHT A;  4BKT A;  3UIP B;  2HD5 B;  3PT2 B;  5JHA A;  1WE7 A;  1WX8 A;  4MDK E;  3NHE B;  2DAF A;  4ANW A;  4FBJ B;  2V3S A;  2C60 A;  1ISN A;  1J19 A;  2JZZ A;  4KDL B;  2GBJ A;  2KFK B;  4BOS C;  2ASQ A;  3EHV A;  3WAP A;  3DPD A;  2NBV B;  4B6W A;  1OGW A;  4W9H A;  4KIK B;  3PRZ A;  2LVP A;  4G0N B;  1MG8 A;  2AL3 A;  2K6Q A;  2FID A;  2D11 A;  2KLC A;  3ZTD A;  1GG3 A;  5CHF A;  1WE6 A;  3UGB B;  4IM3 A;  3DCG A;  1WGH A;  3IG3 A;  3IBE A;  1P3Q U;  1E8Y A;  4ICU A;  2BYV E;  2DAJ A;  3R7Q A;  2KJR A;  1WYW B;  2WYQ A;  5D7G A;  1WIA A;  2L8J A;  4TKN A;  5J17 A;  3CMM B;  4DHJ B;  1E7V A;  2O2V B;  4MSM B;  1UEL A;  3D32 A;  1KOT A;  3HM3 A;  3L0W B;  4I6N B;  2K8B A;  1WJN A;  4W9G A;  3MJW A;  3LMN A;  3O65 B;  4W9L A;  4ZYN A;  4RMA A;  4HLE A;  4K81 A;  5D2M B;  2DZJ A;  4GOC A;  4WWN A;  2LGD A;  3W1S C;  3PRP B;  3ALB A;  2CU1 A;  3L17 A;  2RPQ A;  4PS7 A;  4TUU A;  4BKG A;  3BIN A;  1EO6 A;  1XQQ A;  2N1V A;  3JSV B;  4KVG B;  5E6O A;  3WAN A;  4CO7 A;  4GN1 A;  3UIO B;  2C7H A;  1YIW A;  2KTR A;  3PLU A;  4GSW A;  4JL9 A;  4OVU A;  3A9J A;  4WAA A;  2KTF A;  3H1U A;  3PRE A;  4BFR A;  1J0G A;  4GDK A;  2G3Q B;  3KYC D;  1KM7 A;  2K1F A;  1V6E A;  2N9P C;  3A1Q A;  4K7U A;  3VQI A;  5IAA C;  4EFO A;  1E8Z A;  4TQ1 A;  1UBI A;  1WXA A;  2O6V D;  5CHV C;  4EZJ A;  4M8N A;  2C9W B;  2ZPN A;  3PLV A;  4G3X B;  3V62 A;  1E5W A;  1Z5S B;  2N7E A;  4DXA B;  2DYO A;  3IHP C;  4P7I A;  1GC6 A;  1K8R B;  2DZK A;  2PPH A;  5DPS A;  3MHS D;  3ZVV A;  1I42 A;  2ZZP B;  4OVV A;  4W9E A;  4FLH A;  2MRP A;  3PZD A;  1KLV A;  3ML9 A;  1IYF A;  4XX5 A;  2DYB A;  3PVL A;  4IW0 A;  2LI5 A;  2B3A A;  4GU2 A;  1H8C A;  3RT3 B;  3PTF C;  1R4M I;  2KX3 A;  2M1M A;  2J0M A;  3LJ3 A;  1LM8 B;  4LJO B;  2KWC A;  2Y5B B;  3Q3F A;  4HCP B;  2NS5 A;  2MBB B;  1TZ1 A;  2KC2 A;  3KUC B;  4PS8 A;  4AWJ A;  5C23 A;  3DQV A;  2NR2 A;  4PS3 A;  1UGM A;  2IY0 B;  2FCS A;  5AZG A;  4XC2 A;  4MJS B;  1V9J A;  4AOF A;  5LXH A;  2L00 B;  3HK0 A;  5C1Z A;  2GBR A;  4TV3 A;  2KWU B;  2CR5 A;  4G50 A;  1WZ0 A;  2XBB C;  3L13 A;  2IO3 B;  1ZKH A;  1YX5 B;  1V2Y A;  4M0W B;  5L83 A;  5AEK B;  1WGR A;  2IO1 B;  2LVQ A;  2YVC A;  5BO4 B;  2L0F A;  2NPT A;  3PRM B;  1J8C A;  2I1K A;  2ZEQ A;  3B08 A;  4IUM B;  2KD0 A;  2KDF B;  3VUX A;  1X1M A;  4CHK A;  4JIO U;  2JVC A;  3H9D A;  2NBW B;  3V60 A;  1YQB A;  3R7R A;  3RCZ A;  4EUT A;  4TQ0 A;  2KXJ A;  1V49 A;  3ZNH B;  4AJY B;  3L10 B;  2LXA A;  1WY8 A;  2MBO A;  2XK5 B;  2PJH A;  4HCN B;  3AXC A;  1RRB A;  4GDL B;  3A9K A;  1XT9 B;  5IA7 A;  3QX1 A;  3U7D A;  3R3M A;  4HDO A;  5CTR C;  1H4R A;  4RM9 A;  2GBM A;  2KMA A;  3MTN B;  4BBN F;  4HJK A;  3VAW A;  2L05 A;  1KJT A;  2K6D B;  3H7P B;  2O6V A;  2FNJ B;  1WR1 A;  1P98 A;  2J0J A;  2NVU I;  3W1Y A;  2JXX A;  4E74 A;  5G2N A;  1WM2 A;  3KVF B;  3OJ3 A;  4ZRK A;  2KMC A;  4ZRI A;  2FCM A;  2DHZ A;  1TTN A;  2IO2 B;  1YJ1 A;  3VUY A;  1TBE A;  1WH3 A;  3N32 A;  3I3T B;  2DZM A;  3ML8 A;  4II3 B;  1C1Y B;  2ZVN A;  3ENE A;  2WX0 A;  1WX9 A;  2KDB A;  3U30 A;  2KC1 A;  3DDC B;  2MSE D;  4KSK C;  4YL8 A;  4W9K A;  2BPS A;  1E8W A;  2ZCC A;  3DOW A;  3K9P B;  4FHJ A;  3PV1 A;  5D94 A;  3V61 A;  3VHT C;  4HPL B;  3X23 A;  2AL6 A;  1ZGU B;  2KJH B;  2N9X A;  4IC7 B;  1UBQ A;  1OEY J;  3VTW A;  1WMH A;  2CKH B;  1OQY A;  4B9K A;  3QCA A;  1GC7 A;  5AZF A;  1RLF A;  4DDI D;  1FXT B;  4GB9 A;  1CMX B;  1NDD A;  3NZU A;  3APD A;  2MQJ A;  4KV2 A;  4NQK E;  1WI0 A;  1M94 A;  3QAR A;  2M17 A;  3DBL I;  1T0Y A;  4KZC A;  4X57 B;  3AU5 A;  2HTH A;  3NY5 A;  5E6N A;  2LAS A;  2RGF A;  3IVF A;  2KFK A;  2LUE A;  2PE6 B;  1UD7 A;  2C5L C;  3OJ4 B;  1WM3 A;  2R2Q A;  3UIN B;  4GDK B;  2DYM A;  4KIK A;  4W9J A;  3DVG X;  3BY4 B;  4F7Z A;  3HHM A;  2KHW B;  3SD5 A;  2MP2 B;  2C7M B;  1P0R A;  3TCA A;  2VRR B;  3TIX A;  4DDG D;  2MA9 B;  2Z0E B;  1D3Z A;  4EOY A;  2EMS A;  5DPR A;  5HKH A;  1WF9 A;  2KK8 A;  2MBE A;  3Q3J A;  2GBK A;  3HM6 X;  4MGY E;  2G45 B;  2O2V A;  5GMV A;  3S2A A;  3RUI B;  1SGH A;  2KVR A;  2KQS A;  4N9F 4;  3RD2 A;  2G4D B;  5DPW A;  1C3T A;  2R2O A;  3DVN V;  3VH3 B;  3SDL C;  4NPN A;  2FAZ A;  3VDZ A;  1LXD A;  4A3P A;  3ONS A;  2JPH A;  3V6E B;  5L95 C;  4W9D A;  3JSV A;  5DPT A;  4II2 B;  2MBQ A;  2WX1 A;  5LLI A;  2RD0 A;  2JRH A;  4PYU A;  4EZL A;  2ZVO A;  4EZK A;  2XEW A;  2IYD B;  4JQW C;  4NJ6 A;  3CF6 E;  5AZH A;  3X0W A;  3EEC A;  2LVO A;  4MEM A;  1OEY A;  2J7Q B;  4W9F A;  2IBI B;  1SIF A;  4FN2 A;  3TMP B;  1QZE A;  4NAW B;  3QIJ A;  2KO3 A;  2WDT B;  3GOE A;  4DHZ E;  5CHW A;  1WGY A;  2JT4 B;  4B95 A;  2KN5 A;  4IM2 A;  1WGD A;  3ZDT A;  4DHZ B;  4MH0 E;  2K39 A;  4ANX A;  2ZNV B;  3PHX B;  3CST A;  4ZRJ A;  2KWV B;  3H7S A;  3R66 C;  3WIM A;  1P1A A;  5FR6 A;  3ZTC A;  3ZO5 B;  3NS8 A;  3QC8 B;  3K9O B;  4HXD A;  2BKF A;  1LFD A;  4IWP A;  2KX0 A;  1HE8 A;  2AYO B;  2L76 A;  4MSQ B;  3EFU A;  5J18 A;  3ZNZ B;  4EKU A;  2LD9 A;  3N3K B;  4E71 A;  2IO0 B;  4NQL B;  3RZW C;  1Q0W B;  4LCD E;  1WJU A;  1UZX B;  4GMV A;  4DHJ D;  1V81 A;  1E90 A;  5CX3 A;  1VD2 A;  4NY0 A;  3VTU A;  1S3S G;  5LXI B;  4MJS A;  2UWQ A;  4JLC A;  3UQB A;  4LDT B;  2V4L A;  3RUL A;  1V86 A;  4K7W A;  2GMI C;  3LDZ E;  1YX6 B;  1NBF C;  2LXC A;  3DVG Y;  4JGH B;  4WWO A;  3WAL A;  4ICV A;  1WX7 A;  4F8C B;  2NBU A;  3GZN I;  3KUD B;  1WRD B;  3RZF A;  4BKS D;  4CYE A;  1I35 A;  2KKC A;  2OJR A;  1Q1O A;  1WR6 E;  5D6J B;  3ZRC A;  1IP9 A;  3P2B A;  2JY6 A;  1WXM A;  2LZ6 A;  5E6P A;  4ANV A;  3WAO A;  2CHZ A;  4IWQ A;  2M4N A;  4G11 A;  1G6J A;  3SU8 X;  4PYZ A;  1YD8 U;  2XK5 A;  3ZNI D;  2AEH A;  2ZJD A;  2GBN A;  3A33 B;  4GIV A;  4IG7 B;  2FCN A;  2NCN A;  1LQB A;  3UQA A;  2LGY A;  2YLM A;  2CHX A;  1E7U A;  1WJ4 A;  2C7N B;  2KQ7 A;  4HWI B;  3ZNG C;  1W6V A;  3ZLZ A;  3T8M A;  1GUA B;  2BKR B;  4KSL C;  4W9C A;  3VFK A;  3ZUN A;  4BVU C;  3PSE B;  3H7P A;  3QK0 A;  4GXB A;  3VH4 B;  3VVW B;  1WXV A;  2HJ8 A;  2PE9 A;  4FJZ A;  2EMT A;  2JZ3 B;  2LJ5 A;  2ZCB A;  3NZS A;  3RYT A;  1U4A A;  4AP4 C;  1EF1 A;  3U8Z A;  3ZDM C;  1L2N A;  1Z2M A;  2M8S A;  2ZPY A;  4FHK A;  4GGQ A;  4HPM B;  1WFY A;  2J0K A;  3B0A A;  3M63 B;  2BWE S;  2N4F A;  5J2R A;  3T9L A;  2KOX A;  2IZV B;  3AI5 A;  3KW5 B;  2KTR B;  4IWO A;  4WQO B;  5KHO A;  3ZRF A;  4DBG A;  2W9N A;  1V5O A;  3HIZ A;  3A9J B;  2BYE A;  2KNB A;  2HE7 A;  1WXS A;  4MM3 A;  2DEN B;  4FJY A;  3CSF A;  3QA8 A;  4WWP A;  1XD3 B;  3VTV A;  1WGG A;  3A1Q B;  3L54 A;  4KZ0 A;  4XZ4 A;  3VUW A;  5G55 A;  2K25 A;  3V6C B;  3A4R A;  4KDI C;  2DX5 B;  4F1S A;  2EKE C;  4LJP B;  2D10 A;  2KDI A;  2L0T A;  4DK5 A;  4AJW A;  3KUZ A;  2JUO A;  3JVZ X;  3JW0 X;  2N7D A;  2KAN A;  4M8M A;  3ECI A;  4BOZ B;  3DBS A;  3PPA A;  3B1L X;  2V1Y A;  3QQ8 B;  2D3G A;  2BF8 B;  3L16 A;  3AU4 A;  3A4S C;  2G4S A;  5JZE B;  3UF8 A;  1IPG A;  2MLB A;  4HK2 A;  1OTR B;  2I1J A;  3APF A;  3PS6 A;  2K8H A;  2LWP A;  4BKS A;  4MEL A;  2K8C A;  1Q5W B;  1JRU A;  4FA6 A;  1WJ6 A;  2D07 B;  1V5T A;  3M95 A;  4LDT D;  1EUV B;  1E8X A;  2MP2 A;  4DWF A;  3NOB A;  1SE9 A;  4A3O A;  5EDS A;  1PQS A;  3W1S A;  4WJO A;  1UH6 A;  2L7R A;  3DBR I;  3PHW B;  4NJ7 A;  1NI2 A;  3JYU A;  4ANU A;  4IM0 A;  2Z0D B;  3ZW3 A;  4URK A;  2PEA A;  4FJV B;  1RAX A;  2WWZ A;  3KH0 A;  4WJN A;  4WJQ A;  4MGK E;  3TBL D;  4FAD A;  2JF5 A;  3QAQ A;  2CHW A;  3M62 B;  3ZKJ C;  2N9E B;  1GNU A;  3DVN U;  3ZIM A;  2RSU A;  2A5U A;  4HDQ A;  4W9I A;  2KDE B;  2REX A;  2QHO A;  3SHQ A;  3EC8 A;  2BYF A;  3VXW A;  2MX2 A;  4FUL A;  5JHB A;  1F9J A;  3IFW B;  2NPT B;  5JH5 C;  2UYZ B;  3PGE A;  4ZDV A;  1Y8R C;  2BGF A;  3M3J A;  4EEW A;  3C0R B;  2D2Q A;  3KYD D;  4K1R B;  1WZ3 A;  5TR5 A;  2KJ6 A;  2OOB B;  2ZNV C;  2A4Z A;  5DCN A;  1ZW7 A;  2IY1 B;  4A20 A;  2CS4 A;  4E3C A;  3A9K B;  4AUQ C;  1GJZ A;  4NAW A;  4WJP A;  4ASW C;  1VCB A;  2N1W A;  1R4N I;  1BT0 A;  2MBH A;  1RFA A;  3L08 A;  2O6V B;  2KLG A;  1TGZ B;  3WA0 A;  1S1Q B;  1AAR A;  2MCN B;  3DBH I;  2LGX A;  2KFJ A;  2LRU A;  4RM8 A;  3H6N A;  4I6P A;  2MW5 A;  4I6L B;  2BWF A;  1P9D U;  4MGZ E;  4NNJ B;  4HVB A;  2GOW A;  3OAW A;  2LRW A;  4BBN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...