3PV1A

Crystal structure of the usp15 dusp-ubl domains
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
215
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structural variability of the ubiquitin specific protease DUSP-UBL double domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 215
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pv1A02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3pv1A01
3DOWA 3RUIB 2K1FA 5DPRA 3PRMB 1UH6A 2Z0EB 4GOCA 1OGWA 2LVPA 2Z59B 2G45B 2IO2B 3PVLA 2CHZA 2KJHB 2Y5BB 3QK0A 1WM2A 1WE6A 3UQBA 2AL3A 4WQOB 2ASQA 2KNBA 4F1SA 3VTUA 4CYEA 3X23A 2NS5A 2D3GA 5CHVC 4W9LA 4JL9A 4BFRA 5DPSA 1GG3A 1AARA 1J8CA 4GXBA 4MGYE 2O6VD 1E7VA 3WAPA 1VCBA 2RGFA 3A33B 1LXDA 4EZKA 2D11A 3A1QA 1TZ1A 2DHZA 3I3TB 4II3B 2BPSA 2NPTA 3JW0X 2KDFB 3MTNB 3ZNGC 1KOTA 3Q3JA 2KN5A 1Q1OA 1F9JA 1GC6A 1OTRB 2K8HA 2IY1B 2IY0B 4DWFA 4TKNA 1E8XA 1R4NI 2BYVE 2KTRB 2MA9B 3ECIA 3W1SA 2IZVB 4GSWA 2O6VA 4BBNF 4W9KA 2KJ6A 3L16A 4E74A 1J19A 3NHEB 2OJRA 4HPMB 2LGYA 2MP2B 2RR9A 4KV2A 1LM8B 4M0WB 4LDTD 2MBEA 4ZRIA 3K9OB 4HK2A 3X0WA 3V6EB 3PGEA 4DHJB 1ZGUB 4G50A 2O2VB 3OAWA 5G2NA 4BOSC 5C1ZA 1WR6E 2GBJA 5DPTA 3UQAA 2LXAA 2K8BA 4EUTA 1RAXA 4IM3A 1GUAB 2UYZB 2KTFA 2ZPYA 3U8ZA 4EFOA 2JRIB 5CHFA 1C1YB 3UIOB 5L83A 2MBHA 4FJZA 2JF5A 4W9JA 1Y8RC 2M1MA 2NBVB 3M95A 3A9JB 5EDSA 5JHBA 1WXAA 1IPGA 1D3ZA 1TTNA 2IYDB 2WDTB 5IA7A 2RSUA 2AEHA 2K6QA 3ZNZB 4K81A 3VUWA 4RM9A 4DHZE 4HLEA 1UBQA 2JXXA 2BF8B 1YX5B 2K6DB 4FLHA 1EO6A 1WR1A 3AXCA 4GDLB 2ZEQA 4K7SA 2AL6A 4MSMB 4ZYNA 2L7RA 2N1VA 3PRZA 2KC1A 2LUEA 3OJ4B 2A4ZA 4MJSB 3NS8A 2V4LA 4FJVB 3RYTA 3PLUA 4WJNA 3VH3B 4BKTA 3A4RA 4MGIE 1GC7A 3ENEA 3KYCD 4W9DA 3IG3A 4W9GA 1E7UA 3HIZA 2LWPA 1V80A 1WX8A 3TL5A 4YL8A 4E3CA 4ZDVA 3JSVB 1E8WA 3UIPB 2ZVOA 1HE8A 5FR6A 2M17A 4NNJB 5KHQA 3QC8B 2M8SA 2BYFA 2JZZA 1WFYA 2LD9A 3N30A 4G3XB 4HCPB 1WF9A 4IM2A 4AJWA 4HJKA 2MX2A 2RD0A 3KVFB 4IWOA 1W6VA 2BKRB 2KANA 4HDOA 4IC7B 4M8MA 2IO3B 3W1YA 3PSEB 2MBBB 1OQYA 3DDCB 4RM8A 4NPNA 4BBNC 5LXIB 5G55A 4LJOB 2FIDA 2ZCBA 3N3KB 2C60A 5KHOA 4FHKA 4XZ4A 3CF6E 5D2MB 1WIAA 3SDLC 1RFAA 1X1MA 3PT2B 2PE6B 2VRRB 4ZRJA 5C23A 1E90A 3QHTA 2JZ3B 1WGYA 2K39A 2LXCA 3MJWA 2KC2A 2NVUI 3ALBA 2ZCCA 3TMPB 2DAFA 2L0TA 5J2RA 4KDIC 5JZEB 2XBBC 3SHQA 3DVGY 2WX1A 2LVOA 2L76A 2V1YA 3L54A 1KM7A 2KFKB 3DBSA 4KIKB 2ZJDA 1WJNA 4MM3A 1ZW7A 5E6OA 2JVCA 4PYUA 4WAAA 1YQBA 4DHJD 3UGBB 3RZWC 1V5TA 3T9LA 3H7PA 4TV3A 2PJHA 2KQ7A 4P7IA 1L2NA 4WWPA 3BY4B 1A5RA 2KTRA 1U4AA 3V6CB 2CKHB 3V60A 2KZRA 3IVFA 4G11A 2GMIC 5DPWA 2J0KA 4GB9A 4K7UA 3VXWA 1EUVB 4BVUC 4X57B 2FCSA 2MP2A 3GOEA 1LQBA 3NZSA 3UINB 1IP9A 3VUXA 4KVGB 3RZFA 2LGXA 4F7ZA 5AZHA 2KWVB 4XC2A 4B9KA 4FJYA 4ANWA 1WJUA 4N9F4 2FCQA 1YX6B 1V49A 2IO0B 2PPHA 1UZXB 4GDKB 2KO3A 2DX5B 3LMNA 3AU4A 3JVZX 2LJ5A 3ML8A 3SD5A 3DQVA 1WX7A 2CR5A 4PYZA 4W9CA 3TCAA 5E6NA 3R7QA 3H1UA 2C7MB 4WJQA 2B3AA 3W1SC 5D7GA 1H4RA 1SGHA 3EFUA 2KDEB 2LRUA 3VDZA 1IYFA 2KD0A 3ONSA 3ZTDA 2REXA 2BWES 2KHWB 2UWQA 4AWJA 4MH0E 1QZEA 4NAWA 2DZKA 3ZNID 1CMXB 4HXDA 4AJYB 3WAOA 4B6WA 2NR2A 1WH3A 4DDGD 1SE9A 2BKFA 2LI5A 4FULA 4M8NA 4GDLA 5LLIA 4WWNA 3PHWB 4I6LB 3VQIA 1KLVA 2MSED 3B08A 4RMAA 2BYEA 1TGZB 3M3JA 1KJTA 1WZ3A 4MJSA 4ZRKA 2KX3A 3APCA 1RRBA 4GGQA 3ZRFA 4MSQB 3R3MA 2N9EB 4JQWC 2GBNA 1WXSA 2IO1B 4G0NB 4K7WA 5J17A 3KUZA 4EZLA 2CHWA 3QA8A 3ZNHB 2BGFA 3NOBA 4EKUA 4KSLC 3O65B 4BKSD 2G4SA 3RCZA 5AZFA 1E8ZA 2HJ8A 2O6VB 4JLCA 4PS8A 1Z2MA 3APDA 4FBJB 3ZKJC 2KXJA 3PZDA 2JPHA 3QJZA 3ZTCA 4I6NB 2C9WB 2JT4B 2JRHA 4AP4C 1R4MI 2MQJA 1OEYA 1XD3B 4TUUA 2MRPA 1P98A 2MW5A 2EMSA 4LJPB 3V62A 4A3PA 2K8CA 3RULA 1S3SG 3NZUA 3UF8A 4HVBA 2GBRA 4XX5A 5BO4B 1MG8A 3ZIMA 2ZNVC 2D10A 2IBIB 3ML9A 1UD7A 2DYBA 3A9KB 2KVRA 3U30A 4AOFA 3M63B 4BKSA 4EZJA 1P9DU 1M94A 1WJ4A 3DCGA 4BOZB 4II2B 2LRWA 2DZJA 4ANVA 2J0MA 1J0GA 1UELA 3WANA 2CU1A 5DCNA 1WGHA 4OVUA 3QCAA 3B0AA 1E8YA 4LDTB 1WE7A 3CMMB 1UGMA 2DYOA 1V2YA 1C3TA 1E5WA 3PHXB 2KFKA 2EMTA 3WAMA 4KIKA 3PTFC 4IUMB 3IHPC 3V61A 4W9FA 1NBFC 3QWZB 3OJ3A 4JGHB 3U7DA 4J6IA 2BWFA 3PPAA 3PLVA 4GN1A 2MCNB 2A5UA 4MGKE 2FUHB 2L00B 2R2QA 3VH4B 2L8JA 3KYDD 4GMVA 2N4FA 4W9IA 1BT0A 1XQQA 2KWUB 2RPQA 1GJZA 1V5OA 1WGDA 3EC8A 3KUCB 2DAJA 4NY0A 2KDIA 2D2QA 1OEYJ 4TQ1A 3QIJA 3QARA 3SU8X 3BINA 2W9NA 2GBKA 1H8CA 3R66C 1V6EA 2XEWA 4HCNB 4NJ7A 3GZNI 4F8CB 2WX0A 2NBWB 2FAZA 4FADA 1NI2A 3L17A 4KZ0A 5JHAA 5AEKB 1WMHB 2DYMA 3VUYA 4IWPA 2J7QB 3JYUA 4IM0A 2K25A 4E71A 2ZVNA 3DBLI 2AYOB 2N7DA 1K8RB 4PS3A 3VHTC 2C5LC 3IFWB 2NBUA 3ZUNA 2KK8A 3L08A 4B95A 4BKGA 1V86A 2KMCA 3H7SA 2HD5B 2MBOA 4WWOA 4DHZB 4KZCA 2O2VA 3ZO5B 1YJ1A 2YVCA 1EF5A 1ISNA 3KW5B 2DZIA 3A4SC 3TIXA 3L10B 2XK5B 4ANXA 5J18A 1Z5SB 2ZPNA 1I42A 1Q0WB 1YIWA 2G3QB 1WGGA 3WA0A 5JH5C 1WXMA 2JUOA 2KDBA 2MBQA 2DENB 2PEAA 3A9JA 4NQKE 3DBHI 2HTHA 2DZMA 2G4DB 3DPDA 4I6PA 4OVVA 3HM3A 1WRDB 3T8MA 2FCMA 2LZ6A 4HPLB 5TR5A 4CHKA 1P3QU 3MHSD 5AZGA 4AUQC 1RLFA 2C7NB 4EEWA 4DDID 3C0RB 2CS4A 3H7PB 3L0WB 2FIFA 1P0RA 1WY8A 1YD8U 3VTVA 2NCNA 4MEMA 3VTWA 3VVWB 3ZDMC 3TJPA 4DK5A 5CX3A 5LXHA 3AU5A 1WM3A 4FN2A 2HE7A 1WYWB 5D6JB 3A1QB 3AULA 4WJPA 4MDKE 4DXAB 3QAQA 4IG7B 4TQ0A 4URKA 5HKHA 2NPTB 2LGDA 2LVQA 3D32A 3DBRI 4HDQA 5IAAC 1T0YA 2J0JA 3PRPB 3PS6A 3QQ8B 3JSVA 1TBEA 2FNJB 2KKCA 2CHXA 3PV1A 2MWSB 4CO7A 3A9KA 1PQSA 3CSTA 3HK0A 3ZDTA 1ZKHA 2KQSA 2N1WA 4KSKC 3IBEA 1WI0A 4NJ6A 3M62B 1SIFA 3L13A 4IW0A 3AI5A 4LCDE 3VAWA 4GU2A 2KJRA 3EECA 2WYQA 1FXTB 4W9EA 3VFKA 4K1RB 4ICUA 2ZZPB 4EOYA 2V3SA 2YLMA 2R2OA 1V9JA 2KWCA 4NAWB 3B1LX 3H9DA 1G6JA 3ZW3A 4KDLB 1V81A 2I1KA 1XT9B 2KLCA 4ICVA 3OLMD 3ZLZA 4ANUA 5L95C 1L7YA 2N9PC 1LFDA 5CTRC 2MLBA 2AWTA 5E6PA 2M4NA 3P2BA 2L05A 3CSFA 3KUDB 4NQLB 2KFJA 4FA6A 2L3ZA 3R7RA 1WZ0A 3DVNU 1WJ6A 3QX1A 2KMAA 2FCNA 4WJOA 2WWZA 4MELA 2KLGA 2Z0DB 3DVNV 3K9PB 3LJ3A 3Q3FA 4FHJA 4IWQA 4HWIB 3H6NA 3HM6X 4GIVA 1VD2A 3LDZE 2QHOA 5CHWA 1Q5WB 1WX9A 2I1JA 3KH0A 3RT3B 2D07B 2KX0A 3PREA 1S1QB 1P1AA 2N9XA 1WXVA 1WMHA 1UBIA 4W9HA 4JIOU 2ZNVB 3ZVVA 2N7EA 4A3OA 4ASWC 4PS7A 2GOWA 2JY6A 2LASA 1GNUA 2KOXA 4MGZE 1EF1A 1JRUA 2C7HA 2EKEC 1I35A 2GBMA 5GMVA 3APFA 4A20A 1WGRA 3DVGX 3HHMA 2M0XA 3N32A 3EHVA 4GDKA 5D94A 1NDDA 2PE9A 2XK5A 3RD2A 3WIMA 2L0FA 3NY5A 3ZRCA 3WALA 3TBLD 4DBGA 2OOBB 2JWZA 3S2AA
chains in the Genus database with same CATH superfamily
3U7ZA 3AEGB 1FIQA 1PGXA 4YSYB 2NS5A 3VR9B 3NJTA 4BAXA 2WXFA 1E7VA 1VCBA 2TSSA 1RYJA 1IGCA 4M00A 3MTNB 5D3IB 1DOXA 1L0YB 2K8HA 3P4RB 2IY0B 3TEWA 1E8XA 1R4NI 4AS1A 3W1SA 2KTRB 4GSWA 3J9CA 2KJ6A 3R2IA 4HPMB 5EE3A 2RR9A 1NVID 4ZRIA 4G50A 1VZ8A 3OAWA 5C1ZA 2LXAA 1IGDA 3U8ZA 2ZPYA 4EFOA 1I4HA 2L83A 2MBHA 4FJZA 1KFYB 1Q10A 5EDSA 3BYYB 1KH0A 1TTNA 3T3NA 4K3CA 2L52A 3ZJTA 3VUWA 4RM9A 4DHZE 2IPKD 2JXXA 2BF8B 1WR1A 3AXCA 4ZYNA 2L7RA 3PRZA 2ZW0A 2KC1A 2LUEA 4KGTA 2A4ZA 4MJSB 1K50A 3VH3B 1ZP0B 4BKTA 3KYCD 3ENEA 3IG3A 1V80A 2V3NA 4C00A 2WXJA 2ONQA 5FR6A 4XDCA 3PO0A 3GE8C 3QC8B 4HCPB 1WF9A 1WGKA 1VZ6A 4IWOA 1E9MA 1UF0A 4XWWA 2MBBB 4RM8A 1DOIA 2FIDA 2ZCBA 3NUHB 4OHJA 1YN4A 1AWDA 4PK1A 3CF6E 3SDLC 3W5UB 1RFAA 5C23A 1EWYC 4LTUA 3QHTA 3MJWA 1EM7A 2CU3A 3CWIA 1KRHA 5J2RA 4TSSA 3SHQA 3KQ4A 4IKGA 1L0VB 1CJEA 5G5GA 4KIKB 4MACA 4N58A 4MM3A 2JVCA 4PYUA 4LNKA 4OZAA 1JWMD 3VR8B 4TV3A 1MHHE 2KQ7A 4KGSA 1L2NA 1U4AA 1XO3A 2INNE 3IVFA 3MFGA 4K7UA 2CJNA 3MC9A 1IP9A 1PGBA 3VUXA 1EWCA 4LNOA 4XC2A 4B9KA 1PYWD 3BK1A 2FCQA 1QLBB 2PPHA 1L0XB 1UZXB 2INDC 2KO3A 2DX5B 3LMNA 3ML8A 4PYZA 3TCAA 3R7QA 1AN8A 4WJQA 3AE8B 1YN3A 4RGNA 1IYFA 3EFUA 2LRUA 2W55A 1ZDVA 2WXPA 2KD0A 2KHWB 2H89B 1QZEA 1T6BX 3SFDB 1DGJA 1I4GA 4AJYB 2WP9B 4M8NA 2QC8A 4WWNA 3PHWB 4RGOS 1P7FA 1C4CA 2OHFA 4B0MA 1WZ3A 3APCA 4MSQB 1WXSA 3OG5A 2Y3AA 1F1HA 2IO1B 2QEJC 3ZXVA 4K7WA 4ARIA 3QA8A 3ZNHB 3NOBA 4EKUA 4BKSD 4HKQA 4NZLB 1JROA 1N60A 1TJEA 4FBJB 3ZKJC 5EE1A 4I6NB 2C9WB 2JT4B 3BZDB 4AP4C 1OEYA 3V62A 3KWLA 3UF8A 4XX5A 2D10A 3ML9A 1UD7A 4BKSA 1J7AA 3DCGA 4BOZB 3E9SA 3Q8AA 2D3BA 2CU1A 4OVUA 1QQRA 2ACZB 2EKIA 1SF0A 1E8YA 3P4QB 4EE2A 1UGMA 1V2YA 4ZRQA 1MPEA 1CZPA 2EMTA 3WAMA 3PTFC 4IUMB 3V61A 3U7DA 3OJ3A 2BWFA 3PPAA 3PLVA 1FMAD 2A5UA 3VH4B 2N4FA 4W9IA 1V5OA 4UDUC 3PZ7A 3SU8X 2NMQA 3VRAB 4H2AA 1L6UA 2GBKA 2MEKA 3AE5B 1MI0A 3GZNI 2NBWB 5HI1A 4FADA 1NI2A 1ZPSA 1QKZA 5EE9A 1WMHB 1SSNA 4IWPA 1FXAA 3JYUA 4E71A 2ZVNA 1K8RB 5HFYA 2MBOA 4KZCA 3ZO5B 4US9A 2YVCA 3L10B 1UWXA 1GPXA 5JH5C 3WA0A 3BVGA 3FAHA 4I6PA 3LB8C 4HJGE 1WRDB 4MM3B 3RN9C 4L1BA 4CHKA 1RLFA 4DDID 1P0RA 5CX3A 1QT9A 2N9LA 3A1QB 3AULA 4MDKE 3QAQA 2MJEA 2PLPA 1MFWA 4L2YA 3D32A 3DBRI 3PS6A 3JSVA 1TBEA 2FNJB 2LGSA 2CHXA 1TKYA 2QSDA 3ZDTA 2QMTA 3RI7C 1WI0A 2XN9C 4B0EA 3L13A 3AI5A 1JCKB 4W9EA 3NVZA 3H8HA 4ICUA 2ZZPB 1UUPA 3NVWA 1D4BA 1HXYD 1G6JA 4KDLB 2I1KA 2KLCA 3I57A 3OLMD 4GLSC 1IUEA 2N9PC 1QOFA 3P2BA 3KUDB 4NQLB 2KFJA 4A55A 5C3JB 1WJ6A 2FCNA 2WWZA 5E6JA 3Q3FA 3DVNV 3LJ3A 4FXCA 3WCQA 4CQNA 5BYRA 1VD2A 1XCTL 2QHOA 3Q3OC 1Q5WB 1WX9A 2I1JA 3N20C 2FBWB 3KH0A 3PREA 1LGRA 1UBIA 4W9HA 4TMAB 2N7EA 4RGTA 2LASA 1GNUA 5BYQA 4JWUC 4N59A 1JRUA 2EKEC 1I35A 2L1AA 2M0XA 2M19A 4ARCA 2ZW1A 4GDKA 2MH7A 2L32A 3ZRCA 3WALA 5DPRA 1UH6A 2BBCA 2WXRA 2Z59B 1WE6A 3B9JA 2ASQA 3VTUA 2AX5A 4MT5A 3AM9A 2KQ4X 3PZ8A 1J8CA 2PVGC 4MGYE 3Q8FA 3A33B 1LXDA 4EZKA 2V0GA 2D11A 3I3TB 2DHZA 2NPTA 1N5XA 2KDFB 3GZNB 3ZNGC 3Q3JA 1Q1OA 1ZXHA 1JW9D 4C4VA 4TKNA 2MA9B 3ECIA 2XNAC 4BBNF 4W9KA 2OJRA 3RNCC 1FM0D 2MP2B 4D2KA 4Q2JA 4KV2A 4LDTD 4C56C 3V6EB 3PGEA 2K3UA 4N6EB 4DHJB 1MHXA 3DHHC 2PVOD 5G2NA 4BOSC 1WR6E 5DPTA 2K8BA 1RAXA 4IM3A 5I4DA 3UIOB 2JF5A 1Y8RC 4YSXB 3TEZA 2WDTB 2WHIA 2RSUA 1IBXA 3MJ5A 1UBQA 4FLHA 1XEEA 2ZEQA 4MSMB 1SE3A 2IGDA 3NS8A 4WJNA 3DBRB 3RNAC 1QOGA 2RPVA 3GS2A 1WX8A 3TL5A 3JSVB 1E8WA 1VZ7A 1KTKA 4NNJB 3AEAB 3MC0B 1K53A 3Q69A 2M8SA 2BYFA 1WFYA 4IM2A 4AJWA 2MX2A 1OQRA 4WH4A 1FRRA 3KVFB 3NRZA 1W6VA 2KANA 2WDQB 1FCLA 4M8MA 3W1YA 2IO3B 2KN4A 1OQYA 2Y5CA 4LJOB 1STEA 2C60A 1JWSD 4YTNB 2BT6A 3KWVA 4XZ4A 1WIAA 3HUIA 3PT2B 4ZRJA 3IAM1 2KC2A 2NVUI 2ZCCA 2Z8LA 5JZEB 2INCC 1C4PA 2LVOA 3AE7B 4YTMB 3L54A 1KM7A 5IO9A 3HVZA 1FXIA 5E6OA 1YQBA 1JALA 3IT4B 4P6VF 2KAJA 3T9LA 2PJHA 1T3QA 3V60A 5DPWA 2GMIC 2J0KA 4LK0M 1EUVB 2PIAA 1NYRA 2FCSA 4XYCA 5BMHA 3UINB 1KLGD 4KVGB 4M0WA 5AZHA 1VR9A 2KWVB 1MG4A 4ANWA 1WJUA 2Y5PA 2WDRB 4YWGG 3FILA 4A8XC 4ITKA 1FNWA 4GDKB 3AU4A 3P1MA 3HVDA 2BS4B 3Q8CA 3Q8EA 3C8YA 3AEDB 4MH0E 4NAWA 2N9KA 3WAOA 4B6WA 2LI5A 4FULA 4GDLA 5LLIA 4I6LB 1KLVA 3M3JA 1RRBA 1WYGA 4JQWC 2GBNA 2BQQA 2WQYB 5IKCM 2AQ2B 3KUZA 2QDFA 4US8A 2BGFA 4XWTA 1K52A 1E8ZA 1L4DB 3APDA 1JWBD 3PZDA 2IGGA 2WXQA 2INPE 3URYA 2M56B 2MRPA 2G1EA 4LJPB 1S3SG 4KKJA 3DWGC 1XF5L 2DYBA 3AE9B 2KVRA 3U30A 1C4AA 4AOFA 4EZJA 1TS5A 1J0GA 4JX1C 3BVZA 1WGHA 2RMMA 4LDTB 4QAYA 1IBXB 2FUG1 3PHXB 2KFKA 3SR6A 1NBFC 4JGHB 1JWUD 2MCNB 4MGKE 2FUHB 2R2QA 2UU7A 2L8JA 3KYDD 3Q3NC 1XQQA 1R4MB 1F52A 1FCCC 2KDIA 2W82A 1TYGB 2PTLA 2IJ0A 1ACCA 4YXDB 3P4SB 4F8CB 3LYYA 4KZ0A 1TIFA 2ICIA 2WGSA 5AEKB 1T5XD 2J7QB 1ZE3D 2WXLA 1UNSA 3DBLI 3N9YC 1SE4A 3VHTC 2C5LC 3ZUNA 2KK8A 3L08A 3H7SA 1YJ1A 1QOBA 2J52A 2DZIA 2W3SA 5J18A 1Z5SB 1YIWA 1WGGA 2JUOA 2N7JA 2X8XX 2DENB 2IGHA 3A9JA 2HTHA 3ZXRA 2DZMA 2CJOA 5AUKA 3U4EG 1YQ3B 3HM3A 4RF0A 2FCMA 1ZUD2 1P3QU 4C7YA 2C7NB 3C0RB 2CS4A 2DWQA 1L5PA 3VTVA 3VTWA 1OFFA 2NCNA 2WXNA 4DK5A 4FN2A 2BYTA 2HE7A 1WYWB 3NVYA 4DXAB 4IG7B 3PRPB 3QQ8B 3FILB 1PGAA 3A9KA 3Q3MC 1PQSA 3HK0A 2VH2A 2KQSA 2N1WA 3Q14C 4WIPA 4GU2A 3EECA 4EOYA 2YLMA 2R2OA 4LNIA 4NAWB 3EUB2 4KX6B 4ICVA 5L95C 4ZHOA 2WDVB 1TT5B 2JYTA 4FA6A 3ZGZA 1WZ0A 2D3AA 3CIRB 2KMAA 4WJOA 3GP7A 2KLGA 2Z0DB 4FHJA 4IWQA 1MJDA 2WXHA 1YJJA 3LDZE 5IOIA 4MH8A 1C79A 3RT3B 2LUMA 3O13A 3AE4B 1ZXIA 2ZNVB 3ZVVA 4A3OA 4ASWC 2GOWA 2JY6A 1EF1A 1PUTA 2GBMA 1MVKA 4RF1A 5GMVA 2G9HD 3T3OA 1WGRA 3OWEB 4BZAA 1SE2A 2PE9A 2XK5A 3ABVB 3RD2A 3WIMA 4DBGA 3RFZB 3DOWA 3RUIB 1PDXA 2Z0EB 4GOCA 2J42A 1V1PA 4HRSA 1OGWA 2LVPA 2G45B 1NI3A 2IO2B 2Y5BB 4JE3B 3UQBA 2AL3A 2YEPF 2KNBA 1SBBB 3X23A 5CHVC 2D3GA 4W9LA 5JXVA 2MHJA 4GXBA 3BYTB 3ETRA 3WAPA 2RGFA 1F2RI 1TZ1A 2RDBC 4II3B 3AB5A 3JW0X 1Y56A 3Q8BA 1KOTA 4ZYSA 1GC6A 1OTRB 2JYEA 4DWFA 3DBLB 3DHIC 3AN1A 2WXKA 2LGYA 2MBEA 3K9OB 2LHEA 3P4PB 1M4VA 4KGRA 2LFIA 2BS3B 2J4XA 4EUTA 3LXFA 2V3PA 1GUAB 2UYZB 2JRIB 1LO5D 5MPOA 1F77A 4JPSA 4W9JA 2M1MA 5G5HA 3A9JB 1IPGA 1D3ZA 1V97A 2IYDB 1NYQA 3ZNZB 4K81A 1SJHD 4HLEA 4R3DA 1D6EC 2FE8A 1EO6A 4K7SA 2K0PA 2MJDA 2N1VA 3RYTA 3SFEB 4W9DA 3HIZA 2V4IB 4YL8A 4ZDVA 1FNUA 2M17A 4OVZA 5KHQA 4DXGA 5T8IA 5FKAC 1VJKA 2LD9A 4RNAA 3NVVA 4HJKA 2RD0A 2BKRB 4HDOA 4IC7B 3DDCB 4NPNA 5LXIB 3N1XC 5G55A 1I4QA 1BUIC 1XLOA 3N3KB 4AQ7A 1TKGA 5KHOA 4FHKA 3N1YC 3N1ZC 2VRRB 1E90A 2JZ3B 1WGYA 2K39A 1RM6C 3TMPB 1SEBD 2DAFA 4KDIC 3DWMA 5D3DA 2XBBC 3DVGY 1RWSA 2WX1A 1N61A 2L76A 3AMZA 2ZJDA 1WJNA 4WAAA 2PMVA 3UGBB 3TSSA 1ET6A 1V5TA 3AE3B 2JXTA 4WURA 4REZA 3BY4B 1A5RA 2KTRA 3V6CB 2KZRA 4G11A 1FPYA 3VXWA 1V1OA 4X57B 4BVUC 1LQBA 1OQQA 1T0SC 3NZSA 2PKOA 2LGXA 3MP9A 4FJYA 1YX6B 4A6QA 3JVZX 2LJ5A 3SD5A 1WX7A 2JU6X 4W9CA 5E6NA 3H1UA 2C7MB 1B1ZA 1HTQA 1J7BA 3W1SC 3BIID 5D7GA 1SGHA 3U52E 2JWUA 2WLBA 3ZTDA 4AWJA 2D3CA 1CMXB 3GB1A 5BMGA 2NR2A 4DDGD 1SE9A 2LMCA 2E3TA 2BYEA 1TGZB 3AEFB 4MJSA 4ZRKA 3ZRFA 2KX3A 1GAQB 3AECB 2N9EB 5H92C 1K51A 1ENFA 4EZLA 2CHWA 2KVZA 2G4SA 3RCZA 1L4ZB 2HJ8A 4JLCA 1JRPA 4PS8A 4J3OD 2KXJA 2JPHA 2V9HA 3QJZA 1T0QC 1R4MI 2MQJA 4TUUA 2MW5A 1P98A 2K8CA 2ZNVC 2IBIB 1YJIA 2OJWA 3M63B 1P9DU 2LGIA 2LRWA 2DZJA 4ANVA 2J0MA 5FK9C 1EU3A 1DYQA 5HHDG 3QCAA 1HQRD 5IP4D 4S17A 1A70A 1WE7A 2BB6A 2DYOA 1E5WA 1FD6A 4KIKA 2N0SB 4WQMA 2VZKD 3IHPC 4W9FA 2GB1A 1AYFA 2KT7A 2L00B 4ACFA 4LNNA 2WU2B 1C78A 2RPQA 4XE0A 4A90A 1OEYJ 3HRDD 3TUOA 4OW0A 3QIJA 3QARA 3BINA 3MC8A 2W9NA 1H8CA 2W54A 1V6EA 2I2YA 2XEWA 4HCNB 4NJ7A 3EGRA 1GB4A 1FRDA 2WXOA 2LJIA 5JHAA 1TKEA 2DYMA 2D5GA 4IM0A 4S0RA 2K25A 2AYOB 2N7DA 4PS3A 4K3BA 4B95A 4BKGA 5LNK1 2O2VA 2BTEA 1FNVA 1ISNA 3KW5B 2RDGA 3TIXA 4ANXA 2ZPNA 3E56A 1Q0WB 2RDHA 2JZPA 2MBQA 2KDBA 2PEAA 3DBHI 5FR3A 3DPDA 2QILA 1WSPA 4OVVA 3T8MA 2LZ6A 4HPLB 1D5ZC 3MHSD 5AZGA 4YTPB 2JQRB 2KACA 2FIFA 1WY8A 1YD8U 2K9XA 4MEMA 3VVWB 2DBYA 4DQOC 1XXGA 2K22A 3MHZA 3TJPA 4ZRPA 1I7HA 1ZOYB 4JWSC 5LXHA 5D6JB 4TQ0A 4WJPA 1KF6B 3TEYA 5HKHA 2NPTB 2LVQA 1E6EB 2Q5WD 5IAAC 1T0YA 3PV1A 2MWSB 3CSTA 4C4VB 1NEKB 3IBEA 3R2TA 3ZYYX 4IW0A 1ESFA 1SIFA 2WYQA 1N6ZA 5GXGB 1DOYA 2V3SA 4M01A 3IT6B 4M02A 3EFCA 1V9JA 2JSVX 3V3XA 2KWCA 1AW7A 3ZQ4A 1CQVA 3H9DA 2QJLA 1V81A 1XT9B 4C7ZA 1L7YA 1VDVA 3I5JC 2AWTA 5E6PA 2M4NA 4L23A 4WWMA 2L05A 1TS2A 3CSFA 3FC4A 3R7RA 2SAKA 3QX1A 3K9PB 1FEHA 2D07B 1V8CA 1P1AA 1WMHA 2PW9A 5HG2A 4PS7A 4ZOHC 2KOXA 1VRAB 5AUIA 4RFBA 3DVGX 1VLBA 1YMHE 3EHVA 2L0FA 1ET9A 4HROA 3NY5A 5C2TB 3TBLD 2OOBB 1N63A 2K1FA 1TZOA 2NTSA 3PRMB 2IDYA 1WXQA 3PVLA 2CHZA 2KJHB 3BVMA 3QK0A 1F0ZA 1WM2A 2KWDA 4WQOB 4HKZE 4F1SA 4CYEA 3ZJUA 1PFDA 4JL9A 4BFRA 5DPSA 1GG3A 1AARA 2O6VD 4HEA1 4A9AA 3A1QA 2VZKB 2BPSA 2OEDA 1F2RC 3KLSX 1GB1A 2B76B 1SJED 4P1CC 2KN5A 1C9FA 1F9JA 1QF6A 2IY1B 2BYVE 2IZVB 2O6VA 2R61A 4E74A 3L16A 3RNEC 1J19A 2KDMA 2E6XA 3NHEB 3AH7A 3AE6B 1I4RA 2GLSA 1LM8B 4M0WB 4IDIA 3L4PA 4HK2A 3X0WA 1TS3A 1ZGUB 2O2VB 3UQAA 2GBJA 3Q2AC 2KTFA 4RGMA 2NTTA 5CHFA 1C1YB 1YQ4B 5L83A 3DBHB 1BXTA 5JHBA 2NBVB 3M95A 1WXAA 5IA7A 2AEHA 2K6QA 3RPFC 1E10A 1XCQL 2AQ3B 1YX5B 2K6DB 2QIEB 1R4NB 4GDLB 2AL6A 3AEBB 1HA5A 3OJ4B 1CK1A 2V4LA 4FJVB 3P42A 1N5WA 3PLUA 3A4RA 4MGIE 1GC7A 4W9GA 1E7UA 1GOZA 2LWPA 4NJCA 4RCOA 1FFVA 4E3CA 2WXIA 3UIPB 2ZVOA 2M0AA 3Q6BA 1HE8A 2KMMA 3AEEB 1R7SA 2GRIA 2JZZA 3N30A 4G3XB 1SB3C 3TEXA 3RMKC 1J7CA 3W2DA 3PSEB 2WNMA 3AV8A 4BBNC 3SEBA 2GI9A 2JX5A 5D2MB 1X1MA 2PE6B 4YSZB 2LXCA 3ALBA 1L6VA 2L0TA 3R8BA 2WXGA 2V1YA 4RH6A 5BYSA 2KFKB 3DBSA 1ZW7A 2QCZA 4DHJD 1HZ5A 3RZWC 3H7PA 1SXTA 4P7IA 4WWPA 1ROEA 2CKHB 1TS4A 4GB9A 2MP2A 2BVCA 3GOEA 1JMLA 3RZFA 3I63C 4F7ZA 1XLQA 4N9F4 1V49A 2IO0B 2WXMA 4P16A 3DQVA 2CR5A 3V05A 1P7EA 1I4XA 2DNFA 2B3AA 1H4RA 3VDZA 2KDEB 3ONSA 2REXA 2BWES 2UWQA 2W3RA 3NZ3A 4HPPA 2DZKA 3ZNID 4HXDA 1WH3A 3FKYA 2BKFA 1B9RA 3VQIA 2MSED 3RNGC 3B08A 4RMAA 1KJTA 2EELA 4GGQA 3C19A 3R3MA 4G0NB 5J17A 1TY2A 1RFKA 4KSLC 3O65B 2J53A 2BS2B 4OZCA 5EE0A 5AZFA 2O6VB 1Z2MA 3ZTCA 2JRHA 1QOAA 3UI3A 1XD3B 2EMSA 4A3PA 1N62A 3RULA 3NZUA 4HVBA 3B2FA 2GBRA 5BO4B 1MG8A 3ZIMA 3NG0A 3A9KB 1M94A 1WJ4A 4II2B 3BWUD 1UELA 3WANA 3EA6A 5DCNA 3B0AA 2K5PA 1FO4A 2DLBA 3CMMB 1HTOA 1HEZE 3QWZB 2YEPB 4J6IA 3BK2A 4GN1A 3RNBC 4GMVA 1GJZA 1BT0A 2KWUB 1KLUD 1WGDA 5IN7A 3EC8A 1UWMA 1QILA 3KUCB 2DAJA 4NY0A 2LEKA 2D2QA 1D5XC 3W9CB 2X38A 4TQ1A 1WWTA 4YT0B 3R66C 4WAFA 2WU5B 1JQ4A 2WX0A 1BMLC 4PT5A 2FAZA 3RNFC 3L17A 2LHDA 1WRIA 3VUYA 1XLNA 1D5MC 3GE3C 4P1BC 3IFWB 2NBUA 5BMIA 1V86A 2KMCA 4DHZB 2HD5B 4WWOA 1ZDXA 1EF5A 4KKIA 3A4SC 1C77A 2XK5B 1I42A 2G3QB 1WXMA 4NQKE 2G4DB 1V1PB 2MJ3A 4O1NA 4C80A 3NS1A 1SIJA 5TR5A 4AUQC 3VRBB 1NENB 4EEWA 4XGAB 3H7PB 3L0WB 3DHGC 2KYWA 3ZDMC 3I9V1 1JWAD 1EU4A 3AU5A 1YN5A 1WM3A 1C3TA 2BB5A 4URKA 3ZJVA 2LGDA 1E0ZA 4HDQA 2HTME 2J0JA 2AQ1B 5TSSA 2KKCA 4CO7A 2VH1A 2ON8A 1ZKHA 4KSKC 3B2GA 2BW2A 2I38A 4NJ6A 1E7PB 3M62B 4LCDE 3VAWA 1HZ6A 4XDDA 2KJRA 3AE2B 1FXTB 3VFKA 4OZBA 1XLPA 4K1RB 4NAMA 4ZHPA 2H88B 3B1LX 3IXSA 3ZW3A 2HJ1A 3ZLZA 4ANUA 4LLGM 1LFDA 1FFUA 1T0RC 5CTRC 2MLBA 5H8YE 1YNTE 1C76A 1TY0A 4LNFA 2L3ZA 4IOIE 3DVNU 4MELA 4HWIB 3H6NA 3P63A 3HM6X 4GIVA 1I4PA 5CHWA 1UGJA 2KX0A 3W5VB 3AE1B 1S1QB 2WS3B 2N9XA 4DXFA 2HDEA 1WXVA 1YOVB 2SEBD 4JIOU 3IAS1 4MGZE 4USAA 2C7HA 3APFA 4A20A 3HHMA 3N32A 3U2SC 5D94A 1NDDA 2JWZA 3S2AA
chains in the Genus database with same CATH topology
3DOWA 3RUIB 2K1FA 5DPRA 3PRMB 1UH6A 2Z0EB 4GOCA 1OGWA 2LVPA 2Z59B 2G45B 2IO2B 3PVLA 2CHZA 2KJHB 2Y5BB 3QK0A 1WM2A 1WE6A 3UQBA 2AL3A 4WQOB 2ASQA 2KNBA 4F1SA 3VTUA 4CYEA 3X23A 2NS5A 2D3GA 5CHVC 4W9LA 4JL9A 4BFRA 5DPSA 1GG3A 1AARA 1J8CA 4GXBA 4MGYE 2O6VD 1E7VA 3WAPA 1VCBA 2RGFA 3A33B 1LXDA 4EZKA 2D11A 3A1QA 1TZ1A 2DHZA 3I3TB 4II3B 2BPSA 2NPTA 3JW0X 2KDFB 3MTNB 3ZNGC 1KOTA 3Q3JA 2KN5A 1Q1OA 1F9JA 1GC6A 1OTRB 2K8HA 2IY1B 2IY0B 4DWFA 4TKNA 1E8XA 1R4NI 2BYVE 2KTRB 2MA9B 3ECIA 3W1SA 2IZVB 4GSWA 2O6VA 4BBNF 4W9KA 2KJ6A 3L16A 4E74A 1J19A 3NHEB 2OJRA 4HPMB 2LGYA 2MP2B 2RR9A 4KV2A 1LM8B 4M0WB 4LDTD 2MBEA 4ZRIA 3K9OB 4HK2A 3X0WA 3V6EB 3PGEA 4DHJB 1ZGUB 4G50A 2O2VB 3OAWA 5G2NA 4BOSC 5C1ZA 1WR6E 2GBJA 5DPTA 3UQAA 2LXAA 2K8BA 4EUTA 1RAXA 4IM3A 1GUAB 2UYZB 2KTFA 2ZPYA 3U8ZA 4EFOA 2JRIB 5CHFA 1C1YB 3UIOB 5L83A 2MBHA 4FJZA 2JF5A 4W9JA 1Y8RC 2M1MA 2NBVB 3M95A 3A9JB 5EDSA 5JHBA 1WXAA 1IPGA 1D3ZA 1TTNA 2IYDB 2WDTB 5IA7A 2RSUA 2AEHA 2K6QA 3ZNZB 4K81A 3VUWA 4RM9A 4DHZE 4HLEA 1UBQA 2JXXA 2BF8B 1YX5B 2K6DB 4FLHA 1EO6A 1WR1A 3AXCA 4GDLB 2ZEQA 4K7SA 2AL6A 4MSMB 4ZYNA 2L7RA 2N1VA 3PRZA 2KC1A 2LUEA 3OJ4B 2A4ZA 4MJSB 3NS8A 2V4LA 4FJVB 3RYTA 3PLUA 4WJNA 3VH3B 4BKTA 3A4RA 4MGIE 1GC7A 3ENEA 3KYCD 4W9DA 3IG3A 4W9GA 1E7UA 3HIZA 2LWPA 1V80A 1WX8A 3TL5A 4YL8A 4E3CA 4ZDVA 3JSVB 1E8WA 3UIPB 2ZVOA 1HE8A 5FR6A 2M17A 4NNJB 5KHQA 3QC8B 2M8SA 2BYFA 2JZZA 1WFYA 2LD9A 3N30A 4G3XB 4HCPB 1WF9A 4IM2A 4AJWA 4HJKA 2MX2A 2RD0A 3KVFB 4IWOA 1W6VA 2BKRB 2KANA 4HDOA 4IC7B 4M8MA 2IO3B 3W1YA 3PSEB 2MBBB 1OQYA 3DDCB 4RM8A 4NPNA 4BBNC 5LXIB 5G55A 4LJOB 2FIDA 2ZCBA 3N3KB 2C60A 5KHOA 4FHKA 4XZ4A 3CF6E 5D2MB 1WIAA 3SDLC 1RFAA 1X1MA 3PT2B 2PE6B 2VRRB 4ZRJA 5C23A 1E90A 3QHTA 2JZ3B 1WGYA 2K39A 2LXCA 3MJWA 2KC2A 2NVUI 3ALBA 2ZCCA 3TMPB 2DAFA 2L0TA 5J2RA 4KDIC 5JZEB 2XBBC 3SHQA 3DVGY 2WX1A 2LVOA 2L76A 2V1YA 3L54A 1KM7A 2KFKB 3DBSA 4KIKB 2ZJDA 1WJNA 4MM3A 1ZW7A 5E6OA 2JVCA 4PYUA 4WAAA 1YQBA 4DHJD 3UGBB 3RZWC 1V5TA 3T9LA 3H7PA 4TV3A 2PJHA 2KQ7A 4P7IA 1L2NA 4WWPA 3BY4B 1A5RA 2KTRA 1U4AA 3V6CB 2CKHB 3V60A 2KZRA 3IVFA 4G11A 2GMIC 5DPWA 2J0KA 4GB9A 4K7UA 3VXWA 1EUVB 4BVUC 4X57B 2FCSA 2MP2A 3GOEA 1LQBA 3NZSA 3UINB 1IP9A 3VUXA 4KVGB 3RZFA 2LGXA 4F7ZA 5AZHA 2KWVB 4XC2A 4B9KA 4FJYA 4ANWA 1WJUA 4N9F4 2FCQA 1YX6B 1V49A 2IO0B 2PPHA 1UZXB 4GDKB 2KO3A 2DX5B 3LMNA 3AU4A 3JVZX 2LJ5A 3ML8A 3SD5A 3DQVA 1WX7A 2CR5A 4PYZA 4W9CA 3TCAA 5E6NA 3R7QA 3H1UA 2C7MB 4WJQA 2B3AA 3W1SC 5D7GA 1H4RA 1SGHA 3EFUA 2KDEB 2LRUA 3VDZA 1IYFA 2KD0A 3ONSA 3ZTDA 2REXA 2BWES 2KHWB 2UWQA 4AWJA 4MH0E 1QZEA 4NAWA 2DZKA 3ZNID 1CMXB 4HXDA 4AJYB 3WAOA 4B6WA 2NR2A 1WH3A 4DDGD 1SE9A 2BKFA 2LI5A 4FULA 4M8NA 4GDLA 5LLIA 4WWNA 3PHWB 4I6LB 3VQIA 1KLVA 2MSED 3B08A 4RMAA 2BYEA 1TGZB 3M3JA 1KJTA 1WZ3A 4MJSA 4ZRKA 2KX3A 3APCA 1RRBA 4GGQA 3ZRFA 4MSQB 3R3MA 2N9EB 4JQWC 2GBNA 1WXSA 2IO1B 4G0NB 4K7WA 5J17A 3KUZA 4EZLA 2CHWA 3QA8A 3ZNHB 2BGFA 3NOBA 4EKUA 4KSLC 3O65B 4BKSD 2G4SA 3RCZA 5AZFA 1E8ZA 2HJ8A 2O6VB 4JLCA 4PS8A 1Z2MA 3APDA 4FBJB 3ZKJC 2KXJA 3PZDA 2JPHA 3QJZA 3ZTCA 4I6NB 2C9WB 2JT4B 2JRHA 4AP4C 1R4MI 2MQJA 1OEYA 1XD3B 4TUUA 2MRPA 1P98A 2MW5A 2EMSA 4LJPB 3V62A 4A3PA 2K8CA 3RULA 1S3SG 3NZUA 3UF8A 4HVBA 2GBRA 4XX5A 5BO4B 1MG8A 3ZIMA 2ZNVC 2D10A 2IBIB 3ML9A 1UD7A 2DYBA 3A9KB 2KVRA 3U30A 4AOFA 3M63B 4BKSA 4EZJA 1P9DU 1M94A 1WJ4A 3DCGA 4BOZB 4II2B 2LRWA 2DZJA 4ANVA 2J0MA 1J0GA 1UELA 3WANA 2CU1A 5DCNA 1WGHA 4OVUA 3QCAA 3B0AA 1E8YA 4LDTB 1WE7A 3CMMB 1UGMA 2DYOA 1V2YA 1C3TA 1E5WA 3PHXB 2KFKA 2EMTA 3WAMA 4KIKA 3PTFC 4IUMB 3IHPC 3V61A 4W9FA 1NBFC 3QWZB 3OJ3A 4JGHB 3U7DA 4J6IA 2BWFA 3PPAA 3PLVA 4GN1A 2MCNB 2A5UA 4MGKE 2FUHB 2L00B 2R2QA 3VH4B 2L8JA 3KYDD 4GMVA 2N4FA 4W9IA 1BT0A 1XQQA 2KWUB 2RPQA 1GJZA 1V5OA 1WGDA 3EC8A 3KUCB 2DAJA 4NY0A 2KDIA 2D2QA 1OEYJ 4TQ1A 3QIJA 3QARA 3SU8X 3BINA 2W9NA 2GBKA 1H8CA 3R66C 1V6EA 2XEWA 4HCNB 4NJ7A 3GZNI 4F8CB 2WX0A 2NBWB 2FAZA 4FADA 1NI2A 3L17A 4KZ0A 5JHAA 5AEKB 1WMHB 2DYMA 3VUYA 4IWPA 2J7QB 3JYUA 4IM0A 2K25A 4E71A 2ZVNA 3DBLI 2AYOB 2N7DA 1K8RB 4PS3A 3VHTC 2C5LC 3IFWB 2NBUA 3ZUNA 2KK8A 3L08A 4B95A 4BKGA 1V86A 2KMCA 3H7SA 2HD5B 2MBOA 4WWOA 4DHZB 4KZCA 2O2VA 3ZO5B 1YJ1A 2YVCA 1EF5A 1ISNA 3KW5B 2DZIA 3A4SC 3TIXA 3L10B 2XK5B 4ANXA 5J18A 1Z5SB 2ZPNA 1I42A 1Q0WB 1YIWA 2G3QB 1WGGA 3WA0A 5JH5C 1WXMA 2JUOA 2KDBA 2MBQA 2DENB 2PEAA 3A9JA 4NQKE 3DBHI 2HTHA 2DZMA 2G4DB 3DPDA 4I6PA 4OVVA 3HM3A 1WRDB 3T8MA 2FCMA 2LZ6A 4HPLB 5TR5A 4CHKA 1P3QU 3MHSD 5AZGA 4AUQC 1RLFA 2C7NB 4EEWA 4DDID 3C0RB 2CS4A 3H7PB 3L0WB 2FIFA 1P0RA 1WY8A 1YD8U 3VTVA 2NCNA 4MEMA 3VTWA 3VVWB 3ZDMC 3TJPA 4DK5A 5CX3A 5LXHA 3AU5A 1WM3A 4FN2A 2HE7A 1WYWB 5D6JB 3A1QB 3AULA 4WJPA 4MDKE 4DXAB 3QAQA 4IG7B 4TQ0A 4URKA 5HKHA 2NPTB 2LGDA 2LVQA 3D32A 3DBRI 4HDQA 5IAAC 1T0YA 2J0JA 3PRPB 3PS6A 3QQ8B 3JSVA 1TBEA 2FNJB 2KKCA 2CHXA 3PV1A 2MWSB 4CO7A 3A9KA 1PQSA 3CSTA 3HK0A 3ZDTA 1ZKHA 2KQSA 2N1WA 4KSKC 3IBEA 1WI0A 4NJ6A 3M62B 1SIFA 3L13A 4IW0A 3AI5A 4LCDE 3VAWA 4GU2A 2KJRA 3EECA 2WYQA 1FXTB 4W9EA 3VFKA 4K1RB 4ICUA 2ZZPB 4EOYA 2V3SA 2YLMA 2R2OA 1V9JA 2KWCA 4NAWB 3B1LX 3H9DA 1G6JA 3ZW3A 4KDLB 1V81A 2I1KA 1XT9B 2KLCA 4ICVA 3OLMD 3ZLZA 4ANUA 5L95C 1L7YA 2N9PC 1LFDA 5CTRC 2MLBA 2AWTA 5E6PA 2M4NA 3P2BA 2L05A 3CSFA 3KUDB 4NQLB 2KFJA 4FA6A 2L3ZA 3R7RA 1WZ0A 3DVNU 1WJ6A 3QX1A 2KMAA 2FCNA 4WJOA 2WWZA 4MELA 2KLGA 2Z0DB 3DVNV 3K9PB 3LJ3A 3Q3FA 4FHJA 4IWQA 4HWIB 3H6NA 3HM6X 4GIVA 1VD2A 3LDZE 2QHOA 5CHWA 1Q5WB 1WX9A 2I1JA 3KH0A 3RT3B 2D07B 2KX0A 3PREA 1S1QB 1P1AA 2N9XA 1WXVA 1WMHA 1UBIA 4W9HA 4JIOU 2ZNVB 3ZVVA 2N7EA 4A3OA 4ASWC 4PS7A 2GOWA 2JY6A 2LASA 1GNUA 2KOXA 4MGZE 1EF1A 1JRUA 2C7HA 2EKEC 1I35A 2GBMA 5GMVA 3APFA 4A20A 1WGRA 3DVGX 3HHMA 2M0XA 3N32A 3EHVA 4GDKA 5D94A 1NDDA 2PE9A 2XK5A 3RD2A 3WIMA 2L0FA 3NY5A 3ZRCA 3WALA 3TBLD 4DBGA 2OOBB 2JWZA 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOW A;  3RUI B;  2K1F A;  5DPR A;  3PRM B;  1UH6 A;  2Z0E B;  4GOC A;  1OGW A;  2LVP A;  2Z59 B;  2G45 B;  2IO2 B;  3PVL A;  2CHZ A;  2KJH B;  2Y5B B;  3QK0 A;  1WM2 A;  1WE6 A;  3UQB A;  2AL3 A;  4WQO B;  2ASQ A;  2KNB A;  4F1S A;  3VTU A;  4CYE A;  3X23 A;  2NS5 A;  2D3G A;  5CHV C;  4W9L A;  4JL9 A;  4BFR A;  5DPS A;  1GG3 A;  1AAR A;  1J8C A;  4GXB A;  4MGY E;  2O6V D;  1E7V A;  3WAP A;  1VCB A;  2RGF A;  3A33 B;  1LXD A;  4EZK A;  2D11 A;  3A1Q A;  1TZ1 A;  2DHZ A;  3I3T B;  4II3 B;  2BPS A;  2NPT A;  3JW0 X;  2KDF B;  3MTN B;  3ZNG C;  1KOT A;  3Q3J A;  2KN5 A;  1Q1O A;  1F9J A;  1GC6 A;  1OTR B;  2K8H A;  2IY1 B;  2IY0 B;  4DWF A;  4TKN A;  1E8X A;  1R4N I;  2BYV E;  2KTR B;  2MA9 B;  3ECI A;  3W1S A;  2IZV B;  4GSW A;  2O6V A;  4BBN F;  4W9K A;  2KJ6 A;  3L16 A;  4E74 A;  1J19 A;  3NHE B;  2OJR A;  4HPM B;  2LGY A;  2MP2 B;  2RR9 A;  4KV2 A;  1LM8 B;  4M0W B;  4LDT D;  2MBE A;  4ZRI A;  3K9O B;  4HK2 A;  3X0W A;  3V6E B;  3PGE A;  4DHJ B;  1ZGU B;  4G50 A;  2O2V B;  3OAW A;  5G2N A;  4BOS C;  5C1Z A;  1WR6 E;  2GBJ A;  5DPT A;  3UQA A;  2LXA A;  2K8B A;  4EUT A;  1RAX A;  4IM3 A;  1GUA B;  2UYZ B;  2KTF A;  2ZPY A;  3U8Z A;  4EFO A;  2JRI B;  5CHF A;  1C1Y B;  3UIO B;  5L83 A;  2MBH A;  4FJZ A;  2JF5 A;  4W9J A;  1Y8R C;  2M1M A;  2NBV B;  3M95 A;  3A9J B;  5EDS A;  5JHB A;  1WXA A;  1IPG A;  1D3Z A;  1TTN A;  2IYD B;  2WDT B;  5IA7 A;  2RSU A;  2AEH A;  2K6Q A;  3ZNZ B;  4K81 A;  3VUW A;  4RM9 A;  4DHZ E;  4HLE A;  1UBQ A;  2JXX A;  2BF8 B;  1YX5 B;  2K6D B;  4FLH A;  1EO6 A;  1WR1 A;  3AXC A;  4GDL B;  2ZEQ A;  4K7S A;  2AL6 A;  4MSM B;  4ZYN A;  2L7R A;  2N1V A;  3PRZ A;  2KC1 A;  2LUE A;  3OJ4 B;  2A4Z A;  4MJS B;  3NS8 A;  2V4L A;  4FJV B;  3RYT A;  3PLU A;  4WJN A;  3VH3 B;  4BKT A;  3A4R A;  4MGI E;  1GC7 A;  3ENE A;  3KYC D;  4W9D A;  3IG3 A;  4W9G A;  1E7U A;  3HIZ A;  2LWP A;  1V80 A;  1WX8 A;  3TL5 A;  4YL8 A;  4E3C A;  4ZDV A;  3JSV B;  1E8W A;  3UIP B;  2ZVO A;  1HE8 A;  5FR6 A;  2M17 A;  4NNJ B;  5KHQ A;  3QC8 B;  2M8S A;  2BYF A;  2JZZ A;  1WFY A;  2LD9 A;  3N30 A;  4G3X B;  4HCP B;  1WF9 A;  4IM2 A;  4AJW A;  4HJK A;  2MX2 A;  2RD0 A;  3KVF B;  4IWO A;  1W6V A;  2BKR B;  2KAN A;  4HDO A;  4IC7 B;  4M8M A;  2IO3 B;  3W1Y A;  3PSE B;  2MBB B;  1OQY A;  3DDC B;  4RM8 A;  4NPN A;  4BBN C;  5LXI B;  5G55 A;  4LJO B;  2FID A;  2ZCB A;  3N3K B;  2C60 A;  5KHO A;  4FHK A;  4XZ4 A;  3CF6 E;  5D2M B;  1WIA A;  3SDL C;  1RFA A;  1X1M A;  3PT2 B;  2PE6 B;  2VRR B;  4ZRJ A;  5C23 A;  1E90 A;  3QHT A;  2JZ3 B;  1WGY A;  2K39 A;  2LXC A;  3MJW A;  2KC2 A;  2NVU I;  3ALB A;  2ZCC A;  3TMP B;  2DAF A;  2L0T A;  5J2R A;  4KDI C;  5JZE B;  2XBB C;  3SHQ A;  3DVG Y;  2WX1 A;  2LVO A;  2L76 A;  2V1Y A;  3L54 A;  1KM7 A;  2KFK B;  3DBS A;  4KIK B;  2ZJD A;  1WJN A;  4MM3 A;  1ZW7 A;  5E6O A;  2JVC A;  4PYU A;  4WAA A;  1YQB A;  4DHJ D;  3UGB B;  3RZW C;  1V5T A;  3T9L A;  3H7P A;  4TV3 A;  2PJH A;  2KQ7 A;  4P7I A;  1L2N A;  4WWP A;  3BY4 B;  1A5R A;  2KTR A;  1U4A A;  3V6C B;  2CKH B;  3V60 A;  2KZR A;  3IVF A;  4G11 A;  2GMI C;  5DPW A;  2J0K A;  4GB9 A;  4K7U A;  3VXW A;  1EUV B;  4BVU C;  4X57 B;  2FCS A;  2MP2 A;  3GOE A;  1LQB A;  3NZS A;  3UIN B;  1IP9 A;  3VUX A;  4KVG B;  3RZF A;  2LGX A;  4F7Z A;  5AZH A;  2KWV B;  4XC2 A;  4B9K A;  4FJY A;  4ANW A;  1WJU A;  4N9F 4;  2FCQ A;  1YX6 B;  1V49 A;  2IO0 B;  2PPH A;  1UZX B;  4GDK B;  2KO3 A;  2DX5 B;  3LMN A;  3AU4 A;  3JVZ X;  2LJ5 A;  3ML8 A;  3SD5 A;  3DQV A;  1WX7 A;  2CR5 A;  4PYZ A;  4W9C A;  3TCA A;  5E6N A;  3R7Q A;  3H1U A;  2C7M B;  4WJQ A;  2B3A A;  3W1S C;  5D7G A;  1H4R A;  1SGH A;  3EFU A;  2KDE B;  2LRU A;  3VDZ A;  1IYF A;  2KD0 A;  3ONS A;  3ZTD A;  2REX A;  2BWE S;  2KHW B;  2UWQ A;  4AWJ A;  4MH0 E;  1QZE A;  4NAW A;  2DZK A;  3ZNI D;  1CMX B;  4HXD A;  4AJY B;  3WAO A;  4B6W A;  2NR2 A;  1WH3 A;  4DDG D;  1SE9 A;  2BKF A;  2LI5 A;  4FUL A;  4M8N A;  4GDL A;  5LLI A;  4WWN A;  3PHW B;  4I6L B;  3VQI A;  1KLV A;  2MSE D;  3B08 A;  4RMA A;  2BYE A;  1TGZ B;  3M3J A;  1KJT A;  1WZ3 A;  4MJS A;  4ZRK A;  2KX3 A;  3APC A;  1RRB A;  4GGQ A;  3ZRF A;  4MSQ B;  3R3M A;  2N9E B;  4JQW C;  2GBN A;  1WXS A;  2IO1 B;  4G0N B;  4K7W A;  5J17 A;  3KUZ A;  4EZL A;  2CHW A;  3QA8 A;  3ZNH B;  2BGF A;  3NOB A;  4EKU A;  4KSL C;  3O65 B;  4BKS D;  2G4S A;  3RCZ A;  5AZF A;  1E8Z A;  2HJ8 A;  2O6V B;  4JLC A;  4PS8 A;  1Z2M A;  3APD A;  4FBJ B;  3ZKJ C;  2KXJ A;  3PZD A;  2JPH A;  3QJZ A;  3ZTC A;  4I6N B;  2C9W B;  2JT4 B;  2JRH A;  4AP4 C;  1R4M I;  2MQJ A;  1OEY A;  1XD3 B;  4TUU A;  2MRP A;  1P98 A;  2MW5 A;  2EMS A;  4LJP B;  3V62 A;  4A3P A;  2K8C A;  3RUL A;  1S3S G;  3NZU A;  3UF8 A;  4HVB A;  2GBR A;  4XX5 A;  5BO4 B;  1MG8 A;  3ZIM A;  2ZNV C;  2D10 A;  2IBI B;  3ML9 A;  1UD7 A;  2DYB A;  3A9K B;  2KVR A;  3U30 A;  4AOF A;  3M63 B;  4BKS A;  4EZJ A;  1P9D U;  1M94 A;  1WJ4 A;  3DCG A;  4BOZ B;  4II2 B;  2LRW A;  2DZJ A;  4ANV A;  2J0M A;  1J0G A;  1UEL A;  3WAN A;  2CU1 A;  5DCN A;  1WGH A;  4OVU A;  3QCA A;  3B0A A;  1E8Y A;  4LDT B;  1WE7 A;  3CMM B;  1UGM A;  2DYO A;  1V2Y A;  1C3T A;  1E5W A;  3PHX B;  2KFK A;  2EMT A;  3WAM A;  4KIK A;  3PTF C;  4IUM B;  3IHP C;  3V61 A;  4W9F A;  1NBF C;  3QWZ B;  3OJ3 A;  4JGH B;  3U7D A;  4J6I A;  2BWF A;  3PPA A;  3PLV A;  4GN1 A;  2MCN B;  2A5U A;  4MGK E;  2FUH B;  2L00 B;  2R2Q A;  3VH4 B;  2L8J A;  3KYD D;  4GMV A;  2N4F A;  4W9I A;  1BT0 A;  1XQQ A;  2KWU B;  2RPQ A;  1GJZ A;  1V5O A;  1WGD A;  3EC8 A;  3KUC B;  2DAJ A;  4NY0 A;  2KDI A;  2D2Q A;  1OEY J;  4TQ1 A;  3QIJ A;  3QAR A;  3SU8 X;  3BIN A;  2W9N A;  2GBK A;  1H8C A;  3R66 C;  1V6E A;  2XEW A;  4HCN B;  4NJ7 A;  3GZN I;  4F8C B;  2WX0 A;  2NBW B;  2FAZ A;  4FAD A;  1NI2 A;  3L17 A;  4KZ0 A;  5JHA A;  5AEK B;  1WMH B;  2DYM A;  3VUY A;  4IWP A;  2J7Q B;  3JYU A;  4IM0 A;  2K25 A;  4E71 A;  2ZVN A;  3DBL I;  2AYO B;  2N7D A;  1K8R B;  4PS3 A;  3VHT C;  2C5L C;  3IFW B;  2NBU A;  3ZUN A;  2KK8 A;  3L08 A;  4B95 A;  4BKG A;  1V86 A;  2KMC A;  3H7S A;  2HD5 B;  2MBO A;  4WWO A;  4DHZ B;  4KZC A;  2O2V A;  3ZO5 B;  1YJ1 A;  2YVC A;  1EF5 A;  1ISN A;  3KW5 B;  2DZI A;  3A4S C;  3TIX A;  3L10 B;  2XK5 B;  4ANX A;  5J18 A;  1Z5S B;  2ZPN A;  1I42 A;  1Q0W B;  1YIW A;  2G3Q B;  1WGG A;  3WA0 A;  5JH5 C;  1WXM A;  2JUO A;  2KDB A;  2MBQ A;  2DEN B;  2PEA A;  3A9J A;  4NQK E;  3DBH I;  2HTH A;  2DZM A;  2G4D B;  3DPD A;  4I6P A;  4OVV A;  3HM3 A;  1WRD B;  3T8M A;  2FCM A;  2LZ6 A;  4HPL B;  5TR5 A;  4CHK A;  1P3Q U;  3MHS D;  5AZG A;  4AUQ C;  1RLF A;  2C7N B;  4EEW A;  4DDI D;  3C0R B;  2CS4 A;  3H7P B;  3L0W B;  2FIF A;  1P0R A;  1WY8 A;  1YD8 U;  3VTV A;  2NCN A;  4MEM A;  3VTW A;  3VVW B;  3ZDM C;  3TJP A;  4DK5 A;  5CX3 A;  5LXH A;  3AU5 A;  1WM3 A;  4FN2 A;  2HE7 A;  1WYW B;  5D6J B;  3A1Q B;  3AUL A;  4WJP A;  4MDK E;  4DXA B;  3QAQ A;  4IG7 B;  4TQ0 A;  4URK A;  5HKH A;  2NPT B;  2LGD A;  2LVQ A;  3D32 A;  3DBR I;  4HDQ A;  5IAA C;  1T0Y A;  2J0J A;  3PRP B;  3PS6 A;  3QQ8 B;  3JSV A;  1TBE A;  2FNJ B;  2KKC A;  2CHX A;  3PV1 A;  2MWS B;  4CO7 A;  3A9K A;  1PQS A;  3CST A;  3HK0 A;  3ZDT A;  1ZKH A;  2KQS A;  2N1W A;  4KSK C;  3IBE A;  1WI0 A;  4NJ6 A;  3M62 B;  1SIF A;  3L13 A;  4IW0 A;  3AI5 A;  4LCD E;  3VAW A;  4GU2 A;  2KJR A;  3EEC A;  2WYQ A;  1FXT B;  4W9E A;  3VFK A;  4K1R B;  4ICU A;  2ZZP B;  4EOY A;  2V3S A;  2YLM A;  2R2O A;  1V9J A;  2KWC A;  4NAW B;  3B1L X;  3H9D A;  1G6J A;  3ZW3 A;  4KDL B;  1V81 A;  2I1K A;  1XT9 B;  2KLC A;  4ICV A;  3OLM D;  3ZLZ A;  4ANU A;  5L95 C;  1L7Y A;  2N9P C;  1LFD A;  5CTR C;  2MLB A;  2AWT A;  5E6P A;  2M4N A;  3P2B A;  2L05 A;  3CSF A;  3KUD B;  4NQL B;  2KFJ A;  4FA6 A;  2L3Z A;  3R7R A;  1WZ0 A;  3DVN U;  1WJ6 A;  3QX1 A;  2KMA A;  2FCN A;  4WJO A;  2WWZ A;  4MEL A;  2KLG A;  2Z0D B;  3DVN V;  3K9P B;  3LJ3 A;  3Q3F A;  4FHJ A;  4IWQ A;  4HWI B;  3H6N A;  3HM6 X;  4GIV A;  1VD2 A;  3LDZ E;  2QHO A;  5CHW A;  1Q5W B;  1WX9 A;  2I1J A;  3KH0 A;  3RT3 B;  2D07 B;  2KX0 A;  3PRE A;  1S1Q B;  1P1A A;  2N9X A;  1WXV A;  1WMH A;  1UBI A;  4W9H A;  4JIO U;  2ZNV B;  3ZVV A;  2N7E A;  4A3O A;  4ASW C;  4PS7 A;  2GOW A;  2JY6 A;  2LAS A;  1GNU A;  2KOX A;  4MGZ E;  1EF1 A;  1JRU A;  2C7H A;  2EKE C;  1I35 A;  2GBM A;  5GMV A;  3APF A;  4A20 A;  1WGR A;  3DVG X;  3HHM A;  2M0X A;  3N32 A;  3EHV A;  4GDK A;  5D94 A;  1NDD A;  2PE9 A;  2XK5 A;  3RD2 A;  3WIM A;  2L0F A;  3NY5 A;  3ZRC A;  3WAL A;  3TBL D;  4DBG A;  2OOB B;  2JWZ A;  3S2A A; 
#chains in the Genus database with same CATH topology
 3U7Z A;  3AEG B;  1FIQ A;  1PGX A;  4YSY B;  2NS5 A;  3VR9 B;  3NJT A;  4BAX A;  2WXF A;  1E7V A;  1VCB A;  2TSS A;  1RYJ A;  1IGC A;  4M00 A;  3MTN B;  5D3I B;  1DOX A;  1L0Y B;  2K8H A;  3P4R B;  2IY0 B;  3TEW A;  1E8X A;  1R4N I;  4AS1 A;  3W1S A;  2KTR B;  4GSW A;  3J9C A;  2KJ6 A;  3R2I A;  4HPM B;  5EE3 A;  2RR9 A;  1NVI D;  4ZRI A;  4G50 A;  1VZ8 A;  3OAW A;  5C1Z A;  2LXA A;  1IGD A;  3U8Z A;  2ZPY A;  4EFO A;  1I4H A;  2L83 A;  2MBH A;  4FJZ A;  1KFY B;  1Q10 A;  5EDS A;  3BYY B;  1KH0 A;  1TTN A;  3T3N A;  4K3C A;  2L52 A;  3ZJT A;  3VUW A;  4RM9 A;  4DHZ E;  2IPK D;  2JXX A;  2BF8 B;  1WR1 A;  3AXC A;  4ZYN A;  2L7R A;  3PRZ A;  2ZW0 A;  2KC1 A;  2LUE A;  4KGT A;  2A4Z A;  4MJS B;  1K50 A;  3VH3 B;  1ZP0 B;  4BKT A;  3KYC D;  3ENE A;  3IG3 A;  1V80 A;  2V3N A;  4C00 A;  2WXJ A;  2ONQ A;  5FR6 A;  4XDC A;  3PO0 A;  3GE8 C;  3QC8 B;  4HCP B;  1WF9 A;  1WGK A;  1VZ6 A;  4IWO A;  1E9M A;  1UF0 A;  4XWW A;  2MBB B;  4RM8 A;  1DOI A;  2FID A;  2ZCB A;  3NUH B;  4OHJ A;  1YN4 A;  1AWD A;  4PK1 A;  3CF6 E;  3SDL C;  3W5U B;  1RFA A;  5C23 A;  1EWY C;  4LTU A;  3QHT A;  3MJW A;  1EM7 A;  2CU3 A;  3CWI A;  1KRH A;  5J2R A;  4TSS A;  3SHQ A;  3KQ4 A;  4IKG A;  1L0V B;  1CJE A;  5G5G A;  4KIK B;  4MAC A;  4N58 A;  4MM3 A;  2JVC A;  4PYU A;  4LNK A;  4OZA A;  1JWM D;  3VR8 B;  4TV3 A;  1MHH E;  2KQ7 A;  4KGS A;  1L2N A;  1U4A A;  1XO3 A;  2INN E;  3IVF A;  3MFG A;  4K7U A;  2CJN A;  3MC9 A;  1IP9 A;  1PGB A;  3VUX A;  1EWC A;  4LNO A;  4XC2 A;  4B9K A;  1PYW D;  3BK1 A;  2FCQ A;  1QLB B;  2PPH A;  1L0X B;  1UZX B;  2IND C;  2KO3 A;  2DX5 B;  3LMN A;  3ML8 A;  4PYZ A;  3TCA A;  3R7Q A;  1AN8 A;  4WJQ A;  3AE8 B;  1YN3 A;  4RGN A;  1IYF A;  3EFU A;  2LRU A;  2W55 A;  1ZDV A;  2WXP A;  2KD0 A;  2KHW B;  2H89 B;  1QZE A;  1T6B X;  3SFD B;  1DGJ A;  1I4G A;  4AJY B;  2WP9 B;  4M8N A;  2QC8 A;  4WWN A;  3PHW B;  4RGO S;  1P7F A;  1C4C A;  2OHF A;  4B0M A;  1WZ3 A;  3APC A;  4MSQ B;  1WXS A;  3OG5 A;  2Y3A A;  1F1H A;  2IO1 B;  2QEJ C;  3ZXV A;  4K7W A;  4ARI A;  3QA8 A;  3ZNH B;  3NOB A;  4EKU A;  4BKS D;  4HKQ A;  4NZL B;  1JRO A;  1N60 A;  1TJE A;  4FBJ B;  3ZKJ C;  5EE1 A;  4I6N B;  2C9W B;  2JT4 B;  3BZD B;  4AP4 C;  1OEY A;  3V62 A;  3KWL A;  3UF8 A;  4XX5 A;  2D10 A;  3ML9 A;  1UD7 A;  4BKS A;  1J7A A;  3DCG A;  4BOZ B;  3E9S A;  3Q8A A;  2D3B A;  2CU1 A;  4OVU A;  1QQR A;  2ACZ B;  2EKI A;  1SF0 A;  1E8Y A;  3P4Q B;  4EE2 A;  1UGM A;  1V2Y A;  4ZRQ A;  1MPE A;  1CZP A;  2EMT A;  3WAM A;  3PTF C;  4IUM B;  3V61 A;  3U7D A;  3OJ3 A;  2BWF A;  3PPA A;  3PLV A;  1FMA D;  2A5U A;  3VH4 B;  2N4F A;  4W9I A;  1V5O A;  4UDU C;  3PZ7 A;  3SU8 X;  2NMQ A;  3VRA B;  4H2A A;  1L6U A;  2GBK A;  2MEK A;  3AE5 B;  1MI0 A;  3GZN I;  2NBW B;  5HI1 A;  4FAD A;  1NI2 A;  1ZPS A;  1QKZ A;  5EE9 A;  1WMH B;  1SSN A;  4IWP A;  1FXA A;  3JYU A;  4E71 A;  2ZVN A;  1K8R B;  5HFY A;  2MBO A;  4KZC A;  3ZO5 B;  4US9 A;  2YVC A;  3L10 B;  1UWX A;  1GPX A;  5JH5 C;  3WA0 A;  3BVG A;  3FAH A;  4I6P A;  3LB8 C;  4HJG E;  1WRD B;  4MM3 B;  3RN9 C;  4L1B A;  4CHK A;  1RLF A;  4DDI D;  1P0R A;  5CX3 A;  1QT9 A;  2N9L A;  3A1Q B;  3AUL A;  4MDK E;  3QAQ A;  2MJE A;  2PLP A;  1MFW A;  4L2Y A;  3D32 A;  3DBR I;  3PS6 A;  3JSV A;  1TBE A;  2FNJ B;  2LGS A;  2CHX A;  1TKY A;  2QSD A;  3ZDT A;  2QMT A;  3RI7 C;  1WI0 A;  2XN9 C;  4B0E A;  3L13 A;  3AI5 A;  1JCK B;  4W9E A;  3NVZ A;  3H8H A;  4ICU A;  2ZZP B;  1UUP A;  3NVW A;  1D4B A;  1HXY D;  1G6J A;  4KDL B;  2I1K A;  2KLC A;  3I57 A;  3OLM D;  4GLS C;  1IUE A;  2N9P C;  1QOF A;  3P2B A;  3KUD B;  4NQL B;  2KFJ A;  4A55 A;  5C3J B;  1WJ6 A;  2FCN A;  2WWZ A;  5E6J A;  3Q3F A;  3DVN V;  3LJ3 A;  4FXC A;  3WCQ A;  4CQN A;  5BYR A;  1VD2 A;  1XCT L;  2QHO A;  3Q3O C;  1Q5W B;  1WX9 A;  2I1J A;  3N20 C;  2FBW B;  3KH0 A;  3PRE A;  1LGR A;  1UBI A;  4W9H A;  4TMA B;  2N7E A;  4RGT A;  2LAS A;  1GNU A;  5BYQ A;  4JWU C;  4N59 A;  1JRU A;  2EKE C;  1I35 A;  2L1A A;  2M0X A;  2M19 A;  4ARC A;  2ZW1 A;  4GDK A;  2MH7 A;  2L32 A;  3ZRC A;  3WAL A;  5DPR A;  1UH6 A;  2BBC A;  2WXR A;  2Z59 B;  1WE6 A;  3B9J A;  2ASQ A;  3VTU A;  2AX5 A;  4MT5 A;  3AM9 A;  2KQ4 X;  3PZ8 A;  1J8C A;  2PVG C;  4MGY E;  3Q8F A;  3A33 B;  1LXD A;  4EZK A;  2V0G A;  2D11 A;  3I3T B;  2DHZ A;  2NPT A;  1N5X A;  2KDF B;  3GZN B;  3ZNG C;  3Q3J A;  1Q1O A;  1ZXH A;  1JW9 D;  4C4V A;  4TKN A;  2MA9 B;  3ECI A;  2XNA C;  4BBN F;  4W9K A;  2OJR A;  3RNC C;  1FM0 D;  2MP2 B;  4D2K A;  4Q2J A;  4KV2 A;  4LDT D;  4C56 C;  3V6E B;  3PGE A;  2K3U A;  4N6E B;  4DHJ B;  1MHX A;  3DHH C;  2PVO D;  5G2N A;  4BOS C;  1WR6 E;  5DPT A;  2K8B A;  1RAX A;  4IM3 A;  5I4D A;  3UIO B;  2JF5 A;  1Y8R C;  4YSX B;  3TEZ A;  2WDT B;  2WHI A;  2RSU A;  1IBX A;  3MJ5 A;  1UBQ A;  4FLH A;  1XEE A;  2ZEQ A;  4MSM B;  1SE3 A;  2IGD A;  3NS8 A;  4WJN A;  3DBR B;  3RNA C;  1QOG A;  2RPV A;  3GS2 A;  1WX8 A;  3TL5 A;  3JSV B;  1E8W A;  1VZ7 A;  1KTK A;  4NNJ B;  3AEA B;  3MC0 B;  1K53 A;  3Q69 A;  2M8S A;  2BYF A;  1WFY A;  4IM2 A;  4AJW A;  2MX2 A;  1OQR A;  4WH4 A;  1FRR A;  3KVF B;  3NRZ A;  1W6V A;  2KAN A;  2WDQ B;  1FCL A;  4M8M A;  3W1Y A;  2IO3 B;  2KN4 A;  1OQY A;  2Y5C A;  4LJO B;  1STE A;  2C60 A;  1JWS D;  4YTN B;  2BT6 A;  3KWV A;  4XZ4 A;  1WIA A;  3HUI A;  3PT2 B;  4ZRJ A;  3IAM 1;  2KC2 A;  2NVU I;  2ZCC A;  2Z8L A;  5JZE B;  2INC C;  1C4P A;  2LVO A;  3AE7 B;  4YTM B;  3L54 A;  1KM7 A;  5IO9 A;  3HVZ A;  1FXI A;  5E6O A;  1YQB A;  1JAL A;  3IT4 B;  4P6V F;  2KAJ A;  3T9L A;  2PJH A;  1T3Q A;  3V60 A;  5DPW A;  2GMI C;  2J0K A;  4LK0 M;  1EUV B;  2PIA A;  1NYR A;  2FCS A;  4XYC A;  5BMH A;  3UIN B;  1KLG D;  4KVG B;  4M0W A;  5AZH A;  1VR9 A;  2KWV B;  1MG4 A;  4ANW A;  1WJU A;  2Y5P A;  2WDR B;  4YWG G;  3FIL A;  4A8X C;  4ITK A;  1FNW A;  4GDK B;  3AU4 A;  3P1M A;  3HVD A;  2BS4 B;  3Q8C A;  3Q8E A;  3C8Y A;  3AED B;  4MH0 E;  4NAW A;  2N9K A;  3WAO A;  4B6W A;  2LI5 A;  4FUL A;  4GDL A;  5LLI A;  4I6L B;  1KLV A;  3M3J A;  1RRB A;  1WYG A;  4JQW C;  2GBN A;  2BQQ A;  2WQY B;  5IKC M;  2AQ2 B;  3KUZ A;  2QDF A;  4US8 A;  2BGF A;  4XWT A;  1K52 A;  1E8Z A;  1L4D B;  3APD A;  1JWB D;  3PZD A;  2IGG A;  2WXQ A;  2INP E;  3URY A;  2M56 B;  2MRP A;  2G1E A;  4LJP B;  1S3S G;  4KKJ A;  3DWG C;  1XF5 L;  2DYB A;  3AE9 B;  2KVR A;  3U30 A;  1C4A A;  4AOF A;  4EZJ A;  1TS5 A;  1J0G A;  4JX1 C;  3BVZ A;  1WGH A;  2RMM A;  4LDT B;  4QAY A;  1IBX B;  2FUG 1;  3PHX B;  2KFK A;  3SR6 A;  1NBF C;  4JGH B;  1JWU D;  2MCN B;  4MGK E;  2FUH B;  2R2Q A;  2UU7 A;  2L8J A;  3KYD D;  3Q3N C;  1XQQ A;  1R4M B;  1F52 A;  1FCC C;  2KDI A;  2W82 A;  1TYG B;  2PTL A;  2IJ0 A;  1ACC A;  4YXD B;  3P4S B;  4F8C B;  3LYY A;  4KZ0 A;  1TIF A;  2ICI A;  2WGS A;  5AEK B;  1T5X D;  2J7Q B;  1ZE3 D;  2WXL A;  1UNS A;  3DBL I;  3N9Y C;  1SE4 A;  3VHT C;  2C5L C;  3ZUN A;  2KK8 A;  3L08 A;  3H7S A;  1YJ1 A;  1QOB A;  2J52 A;  2DZI A;  2W3S A;  5J18 A;  1Z5S B;  1YIW A;  1WGG A;  2JUO A;  2N7J A;  2X8X X;  2DEN B;  2IGH A;  3A9J A;  2HTH A;  3ZXR A;  2DZM A;  2CJO A;  5AUK A;  3U4E G;  1YQ3 B;  3HM3 A;  4RF0 A;  2FCM A;  1ZUD 2;  1P3Q U;  4C7Y A;  2C7N B;  3C0R B;  2CS4 A;  2DWQ A;  1L5P A;  3VTV A;  3VTW A;  1OFF A;  2NCN A;  2WXN A;  4DK5 A;  4FN2 A;  2BYT A;  2HE7 A;  1WYW B;  3NVY A;  4DXA B;  4IG7 B;  3PRP B;  3QQ8 B;  3FIL B;  1PGA A;  3A9K A;  3Q3M C;  1PQS A;  3HK0 A;  2VH2 A;  2KQS A;  2N1W A;  3Q14 C;  4WIP A;  4GU2 A;  3EEC A;  4EOY A;  2YLM A;  2R2O A;  4LNI A;  4NAW B;  3EUB 2;  4KX6 B;  4ICV A;  5L95 C;  4ZHO A;  2WDV B;  1TT5 B;  2JYT A;  4FA6 A;  3ZGZ A;  1WZ0 A;  2D3A A;  3CIR B;  2KMA A;  4WJO A;  3GP7 A;  2KLG A;  2Z0D B;  4FHJ A;  4IWQ A;  1MJD A;  2WXH A;  1YJJ A;  3LDZ E;  5IOI A;  4MH8 A;  1C79 A;  3RT3 B;  2LUM A;  3O13 A;  3AE4 B;  1ZXI A;  2ZNV B;  3ZVV A;  4A3O A;  4ASW C;  2GOW A;  2JY6 A;  1EF1 A;  1PUT A;  2GBM A;  1MVK A;  4RF1 A;  5GMV A;  2G9H D;  3T3O A;  1WGR A;  3OWE B;  4BZA A;  1SE2 A;  2PE9 A;  2XK5 A;  3ABV B;  3RD2 A;  3WIM A;  4DBG A;  3RFZ B;  3DOW A;  3RUI B;  1PDX A;  2Z0E B;  4GOC A;  2J42 A;  1V1P A;  4HRS A;  1OGW A;  2LVP A;  2G45 B;  1NI3 A;  2IO2 B;  2Y5B B;  4JE3 B;  3UQB A;  2AL3 A;  2YEP F;  2KNB A;  1SBB B;  3X23 A;  5CHV C;  2D3G A;  4W9L A;  5JXV A;  2MHJ A;  4GXB A;  3BYT B;  3ETR A;  3WAP A;  2RGF A;  1F2R I;  1TZ1 A;  2RDB C;  4II3 B;  3AB5 A;  3JW0 X;  1Y56 A;  3Q8B A;  1KOT A;  4ZYS A;  1GC6 A;  1OTR B;  2JYE A;  4DWF A;  3DBL B;  3DHI C;  3AN1 A;  2WXK A;  2LGY A;  2MBE A;  3K9O B;  2LHE A;  3P4P B;  1M4V A;  4KGR A;  2LFI A;  2BS3 B;  2J4X A;  4EUT A;  3LXF A;  2V3P A;  1GUA B;  2UYZ B;  2JRI B;  1LO5 D;  5MPO A;  1F77 A;  4JPS A;  4W9J A;  2M1M A;  5G5H A;  3A9J B;  1IPG A;  1D3Z A;  1V97 A;  2IYD B;  1NYQ A;  3ZNZ B;  4K81 A;  1SJH D;  4HLE A;  4R3D A;  1D6E C;  2FE8 A;  1EO6 A;  4K7S A;  2K0P A;  2MJD A;  2N1V A;  3RYT A;  3SFE B;  4W9D A;  3HIZ A;  2V4I B;  4YL8 A;  4ZDV A;  1FNU A;  2M17 A;  4OVZ A;  5KHQ A;  4DXG A;  5T8I A;  5FKA C;  1VJK A;  2LD9 A;  4RNA A;  3NVV A;  4HJK A;  2RD0 A;  2BKR B;  4HDO A;  4IC7 B;  3DDC B;  4NPN A;  5LXI B;  3N1X C;  5G55 A;  1I4Q A;  1BUI C;  1XLO A;  3N3K B;  4AQ7 A;  1TKG A;  5KHO A;  4FHK A;  3N1Y C;  3N1Z C;  2VRR B;  1E90 A;  2JZ3 B;  1WGY A;  2K39 A;  1RM6 C;  3TMP B;  1SEB D;  2DAF A;  4KDI C;  3DWM A;  5D3D A;  2XBB C;  3DVG Y;  1RWS A;  2WX1 A;  1N61 A;  2L76 A;  3AMZ A;  2ZJD A;  1WJN A;  4WAA A;  2PMV A;  3UGB B;  3TSS A;  1ET6 A;  1V5T A;  3AE3 B;  2JXT A;  4WUR A;  4REZ A;  3BY4 B;  1A5R A;  2KTR A;  3V6C B;  2KZR A;  4G11 A;  1FPY A;  3VXW A;  1V1O A;  4X57 B;  4BVU C;  1LQB A;  1OQQ A;  1T0S C;  3NZS A;  2PKO A;  2LGX A;  3MP9 A;  4FJY A;  1YX6 B;  4A6Q A;  3JVZ X;  2LJ5 A;  3SD5 A;  1WX7 A;  2JU6 X;  4W9C A;  5E6N A;  3H1U A;  2C7M B;  1B1Z A;  1HTQ A;  1J7B A;  3W1S C;  3BII D;  5D7G A;  1SGH A;  3U52 E;  2JWU A;  2WLB A;  3ZTD A;  4AWJ A;  2D3C A;  1CMX B;  3GB1 A;  5BMG A;  2NR2 A;  4DDG D;  1SE9 A;  2LMC A;  2E3T A;  2BYE A;  1TGZ B;  3AEF B;  4MJS A;  4ZRK A;  3ZRF A;  2KX3 A;  1GAQ B;  3AEC B;  2N9E B;  5H92 C;  1K51 A;  1ENF A;  4EZL A;  2CHW A;  2KVZ A;  2G4S A;  3RCZ A;  1L4Z B;  2HJ8 A;  4JLC A;  1JRP A;  4PS8 A;  4J3O D;  2KXJ A;  2JPH A;  2V9H A;  3QJZ A;  1T0Q C;  1R4M I;  2MQJ A;  4TUU A;  2MW5 A;  1P98 A;  2K8C A;  2ZNV C;  2IBI B;  1YJI A;  2OJW A;  3M63 B;  1P9D U;  2LGI A;  2LRW A;  2DZJ A;  4ANV A;  2J0M A;  5FK9 C;  1EU3 A;  1DYQ A;  5HHD G;  3QCA A;  1HQR D;  5IP4 D;  4S17 A;  1A70 A;  1WE7 A;  2BB6 A;  2DYO A;  1E5W A;  1FD6 A;  4KIK A;  2N0S B;  4WQM A;  2VZK D;  3IHP C;  4W9F A;  2GB1 A;  1AYF A;  2KT7 A;  2L00 B;  4ACF A;  4LNN A;  2WU2 B;  1C78 A;  2RPQ A;  4XE0 A;  4A90 A;  1OEY J;  3HRD D;  3TUO A;  4OW0 A;  3QIJ A;  3QAR A;  3BIN A;  3MC8 A;  2W9N A;  1H8C A;  2W54 A;  1V6E A;  2I2Y A;  2XEW A;  4HCN B;  4NJ7 A;  3EGR A;  1GB4 A;  1FRD A;  2WXO A;  2LJI A;  5JHA A;  1TKE A;  2DYM A;  2D5G A;  4IM0 A;  4S0R A;  2K25 A;  2AYO B;  2N7D A;  4PS3 A;  4K3B A;  4B95 A;  4BKG A;  5LNK 1;  2O2V A;  2BTE A;  1FNV A;  1ISN A;  3KW5 B;  2RDG A;  3TIX A;  4ANX A;  2ZPN A;  3E56 A;  1Q0W B;  2RDH A;  2JZP A;  2MBQ A;  2KDB A;  2PEA A;  3DBH I;  5FR3 A;  3DPD A;  2QIL A;  1WSP A;  4OVV A;  3T8M A;  2LZ6 A;  4HPL B;  1D5Z C;  3MHS D;  5AZG A;  4YTP B;  2JQR B;  2KAC A;  2FIF A;  1WY8 A;  1YD8 U;  2K9X A;  4MEM A;  3VVW B;  2DBY A;  4DQO C;  1XXG A;  2K22 A;  3MHZ A;  3TJP A;  4ZRP A;  1I7H A;  1ZOY B;  4JWS C;  5LXH A;  5D6J B;  4TQ0 A;  4WJP A;  1KF6 B;  3TEY A;  5HKH A;  2NPT B;  2LVQ A;  1E6E B;  2Q5W D;  5IAA C;  1T0Y A;  3PV1 A;  2MWS B;  3CST A;  4C4V B;  1NEK B;  3IBE A;  3R2T A;  3ZYY X;  4IW0 A;  1ESF A;  1SIF A;  2WYQ A;  1N6Z A;  5GXG B;  1DOY A;  2V3S A;  4M01 A;  3IT6 B;  4M02 A;  3EFC A;  1V9J A;  2JSV X;  3V3X A;  2KWC A;  1AW7 A;  3ZQ4 A;  1CQV A;  3H9D A;  2QJL A;  1V81 A;  1XT9 B;  4C7Z A;  1L7Y A;  1VDV A;  3I5J C;  2AWT A;  5E6P A;  2M4N A;  4L23 A;  4WWM A;  2L05 A;  1TS2 A;  3CSF A;  3FC4 A;  3R7R A;  2SAK A;  3QX1 A;  3K9P B;  1FEH A;  2D07 B;  1V8C A;  1P1A A;  1WMH A;  2PW9 A;  5HG2 A;  4PS7 A;  4ZOH C;  2KOX A;  1VRA B;  5AUI A;  4RFB A;  3DVG X;  1VLB A;  1YMH E;  3EHV A;  2L0F A;  1ET9 A;  4HRO A;  3NY5 A;  5C2T B;  3TBL D;  2OOB B;  1N63 A;  2K1F A;  1TZO A;  2NTS A;  3PRM B;  2IDY A;  1WXQ A;  3PVL A;  2CHZ A;  2KJH B;  3BVM A;  3QK0 A;  1F0Z A;  1WM2 A;  2KWD A;  4WQO B;  4HKZ E;  4F1S A;  4CYE A;  3ZJU A;  1PFD A;  4JL9 A;  4BFR A;  5DPS A;  1GG3 A;  1AAR A;  2O6V D;  4HEA 1;  4A9A A;  3A1Q A;  2VZK B;  2BPS A;  2OED A;  1F2R C;  3KLS X;  1GB1 A;  2B76 B;  1SJE D;  4P1C C;  2KN5 A;  1C9F A;  1F9J A;  1QF6 A;  2IY1 B;  2BYV E;  2IZV B;  2O6V A;  2R61 A;  4E74 A;  3L16 A;  3RNE C;  1J19 A;  2KDM A;  2E6X A;  3NHE B;  3AH7 A;  3AE6 B;  1I4R A;  2GLS A;  1LM8 B;  4M0W B;  4IDI A;  3L4P A;  4HK2 A;  3X0W A;  1TS3 A;  1ZGU B;  2O2V B;  3UQA A;  2GBJ A;  3Q2A C;  2KTF A;  4RGM A;  2NTT A;  5CHF A;  1C1Y B;  1YQ4 B;  5L83 A;  3DBH B;  1BXT A;  5JHB A;  2NBV B;  3M95 A;  1WXA A;  5IA7 A;  2AEH A;  2K6Q A;  3RPF C;  1E10 A;  1XCQ L;  2AQ3 B;  1YX5 B;  2K6D B;  2QIE B;  1R4N B;  4GDL B;  2AL6 A;  3AEB B;  1HA5 A;  3OJ4 B;  1CK1 A;  2V4L A;  4FJV B;  3P42 A;  1N5W A;  3PLU A;  3A4R A;  4MGI E;  1GC7 A;  4W9G A;  1E7U A;  1GOZ A;  2LWP A;  4NJC A;  4RCO A;  1FFV A;  4E3C A;  2WXI A;  3UIP B;  2ZVO A;  2M0A A;  3Q6B A;  1HE8 A;  2KMM A;  3AEE B;  1R7S A;  2GRI A;  2JZZ A;  3N30 A;  4G3X B;  1SB3 C;  3TEX A;  3RMK C;  1J7C A;  3W2D A;  3PSE B;  2WNM A;  3AV8 A;  4BBN C;  3SEB A;  2GI9 A;  2JX5 A;  5D2M B;  1X1M A;  2PE6 B;  4YSZ B;  2LXC A;  3ALB A;  1L6V A;  2L0T A;  3R8B A;  2WXG A;  2V1Y A;  4RH6 A;  5BYS A;  2KFK B;  3DBS A;  1ZW7 A;  2QCZ A;  4DHJ D;  1HZ5 A;  3RZW C;  3H7P A;  1SXT A;  4P7I A;  4WWP A;  1ROE A;  2CKH B;  1TS4 A;  4GB9 A;  2MP2 A;  2BVC A;  3GOE A;  1JML A;  3RZF A;  3I63 C;  4F7Z A;  1XLQ A;  4N9F 4;  1V49 A;  2IO0 B;  2WXM A;  4P16 A;  3DQV A;  2CR5 A;  3V05 A;  1P7E A;  1I4X A;  2DNF A;  2B3A A;  1H4R A;  3VDZ A;  2KDE B;  3ONS A;  2REX A;  2BWE S;  2UWQ A;  2W3R A;  3NZ3 A;  4HPP A;  2DZK A;  3ZNI D;  4HXD A;  1WH3 A;  3FKY A;  2BKF A;  1B9R A;  3VQI A;  2MSE D;  3RNG C;  3B08 A;  4RMA A;  1KJT A;  2EEL A;  4GGQ A;  3C19 A;  3R3M A;  4G0N B;  5J17 A;  1TY2 A;  1RFK A;  4KSL C;  3O65 B;  2J53 A;  2BS2 B;  4OZC A;  5EE0 A;  5AZF A;  2O6V B;  1Z2M A;  3ZTC A;  2JRH A;  1QOA A;  3UI3 A;  1XD3 B;  2EMS A;  4A3P A;  1N62 A;  3RUL A;  3NZU A;  4HVB A;  3B2F A;  2GBR A;  5BO4 B;  1MG8 A;  3ZIM A;  3NG0 A;  3A9K B;  1M94 A;  1WJ4 A;  4II2 B;  3BWU D;  1UEL A;  3WAN A;  3EA6 A;  5DCN A;  3B0A A;  2K5P A;  1FO4 A;  2DLB A;  3CMM B;  1HTO A;  1HEZ E;  3QWZ B;  2YEP B;  4J6I A;  3BK2 A;  4GN1 A;  3RNB C;  4GMV A;  1GJZ A;  1BT0 A;  2KWU B;  1KLU D;  1WGD A;  5IN7 A;  3EC8 A;  1UWM A;  1QIL A;  3KUC B;  2DAJ A;  4NY0 A;  2LEK A;  2D2Q A;  1D5X C;  3W9C B;  2X38 A;  4TQ1 A;  1WWT A;  4YT0 B;  3R66 C;  4WAF A;  2WU5 B;  1JQ4 A;  2WX0 A;  1BML C;  4PT5 A;  2FAZ A;  3RNF C;  3L17 A;  2LHD A;  1WRI A;  3VUY A;  1XLN A;  1D5M C;  3GE3 C;  4P1B C;  3IFW B;  2NBU A;  5BMI A;  1V86 A;  2KMC A;  4DHZ B;  2HD5 B;  4WWO A;  1ZDX A;  1EF5 A;  4KKI A;  3A4S C;  1C77 A;  2XK5 B;  1I42 A;  2G3Q B;  1WXM A;  4NQK E;  2G4D B;  1V1P B;  2MJ3 A;  4O1N A;  4C80 A;  3NS1 A;  1SIJ A;  5TR5 A;  4AUQ C;  3VRB B;  1NEN B;  4EEW A;  4XGA B;  3H7P B;  3L0W B;  3DHG C;  2KYW A;  3ZDM C;  3I9V 1;  1JWA D;  1EU4 A;  3AU5 A;  1YN5 A;  1WM3 A;  1C3T A;  2BB5 A;  4URK A;  3ZJV A;  2LGD A;  1E0Z A;  4HDQ A;  2HTM E;  2J0J A;  2AQ1 B;  5TSS A;  2KKC A;  4CO7 A;  2VH1 A;  2ON8 A;  1ZKH A;  4KSK C;  3B2G A;  2BW2 A;  2I38 A;  4NJ6 A;  1E7P B;  3M62 B;  4LCD E;  3VAW A;  1HZ6 A;  4XDD A;  2KJR A;  3AE2 B;  1FXT B;  3VFK A;  4OZB A;  1XLP A;  4K1R B;  4NAM A;  4ZHP A;  2H88 B;  3B1L X;  3IXS A;  3ZW3 A;  2HJ1 A;  3ZLZ A;  4ANU A;  4LLG M;  1LFD A;  1FFU A;  1T0R C;  5CTR C;  2MLB A;  5H8Y E;  1YNT E;  1C76 A;  1TY0 A;  4LNF A;  2L3Z A;  4IOI E;  3DVN U;  4MEL A;  4HWI B;  3H6N A;  3P63 A;  3HM6 X;  4GIV A;  1I4P A;  5CHW A;  1UGJ A;  2KX0 A;  3W5V B;  3AE1 B;  1S1Q B;  2WS3 B;  2N9X A;  4DXF A;  2HDE A;  1WXV A;  1YOV B;  2SEB D;  4JIO U;  3IAS 1;  4MGZ E;  4USA A;  2C7H A;  3APF A;  4A20 A;  3HHM A;  3N32 A;  3U2S C;  5D94 A;  1NDD A;  2JWZ A;  3S2A A; 
#chains in the Genus database with same CATH homology
 3DOW A;  3RUI B;  2K1F A;  5DPR A;  3PRM B;  1UH6 A;  2Z0E B;  4GOC A;  1OGW A;  2LVP A;  2Z59 B;  2G45 B;  2IO2 B;  3PVL A;  2CHZ A;  2KJH B;  2Y5B B;  3QK0 A;  1WM2 A;  1WE6 A;  3UQB A;  2AL3 A;  4WQO B;  2ASQ A;  2KNB A;  4F1S A;  3VTU A;  4CYE A;  3X23 A;  2NS5 A;  2D3G A;  5CHV C;  4W9L A;  4JL9 A;  4BFR A;  5DPS A;  1GG3 A;  1AAR A;  1J8C A;  4GXB A;  4MGY E;  2O6V D;  1E7V A;  3WAP A;  1VCB A;  2RGF A;  3A33 B;  1LXD A;  4EZK A;  2D11 A;  3A1Q A;  1TZ1 A;  2DHZ A;  3I3T B;  4II3 B;  2BPS A;  2NPT A;  3JW0 X;  2KDF B;  3MTN B;  3ZNG C;  1KOT A;  3Q3J A;  2KN5 A;  1Q1O A;  1F9J A;  1GC6 A;  1OTR B;  2K8H A;  2IY1 B;  2IY0 B;  4DWF A;  4TKN A;  1E8X A;  1R4N I;  2BYV E;  2KTR B;  2MA9 B;  3ECI A;  3W1S A;  2IZV B;  4GSW A;  2O6V A;  4BBN F;  4W9K A;  2KJ6 A;  3L16 A;  4E74 A;  1J19 A;  3NHE B;  2OJR A;  4HPM B;  2LGY A;  2MP2 B;  2RR9 A;  4KV2 A;  1LM8 B;  4M0W B;  4LDT D;  2MBE A;  4ZRI A;  3K9O B;  4HK2 A;  3X0W A;  3V6E B;  3PGE A;  4DHJ B;  1ZGU B;  4G50 A;  2O2V B;  3OAW A;  5G2N A;  4BOS C;  5C1Z A;  1WR6 E;  2GBJ A;  5DPT A;  3UQA A;  2LXA A;  2K8B A;  4EUT A;  1RAX A;  4IM3 A;  1GUA B;  2UYZ B;  2KTF A;  2ZPY A;  3U8Z A;  4EFO A;  2JRI B;  5CHF A;  1C1Y B;  3UIO B;  5L83 A;  2MBH A;  4FJZ A;  2JF5 A;  4W9J A;  1Y8R C;  2M1M A;  2NBV B;  3M95 A;  3A9J B;  5EDS A;  5JHB A;  1WXA A;  1IPG A;  1D3Z A;  1TTN A;  2IYD B;  2WDT B;  5IA7 A;  2RSU A;  2AEH A;  2K6Q A;  3ZNZ B;  4K81 A;  3VUW A;  4RM9 A;  4DHZ E;  4HLE A;  1UBQ A;  2JXX A;  2BF8 B;  1YX5 B;  2K6D B;  4FLH A;  1EO6 A;  1WR1 A;  3AXC A;  4GDL B;  2ZEQ A;  4K7S A;  2AL6 A;  4MSM B;  4ZYN A;  2L7R A;  2N1V A;  3PRZ A;  2KC1 A;  2LUE A;  3OJ4 B;  2A4Z A;  4MJS B;  3NS8 A;  2V4L A;  4FJV B;  3RYT A;  3PLU A;  4WJN A;  3VH3 B;  4BKT A;  3A4R A;  4MGI E;  1GC7 A;  3ENE A;  3KYC D;  4W9D A;  3IG3 A;  4W9G A;  1E7U A;  3HIZ A;  2LWP A;  1V80 A;  1WX8 A;  3TL5 A;  4YL8 A;  4E3C A;  4ZDV A;  3JSV B;  1E8W A;  3UIP B;  2ZVO A;  1HE8 A;  5FR6 A;  2M17 A;  4NNJ B;  5KHQ A;  3QC8 B;  2M8S A;  2BYF A;  2JZZ A;  1WFY A;  2LD9 A;  3N30 A;  4G3X B;  4HCP B;  1WF9 A;  4IM2 A;  4AJW A;  4HJK A;  2MX2 A;  2RD0 A;  3KVF B;  4IWO A;  1W6V A;  2BKR B;  2KAN A;  4HDO A;  4IC7 B;  4M8M A;  2IO3 B;  3W1Y A;  3PSE B;  2MBB B;  1OQY A;  3DDC B;  4RM8 A;  4NPN A;  4BBN C;  5LXI B;  5G55 A;  4LJO B;  2FID A;  2ZCB A;  3N3K B;  2C60 A;  5KHO A;  4FHK A;  4XZ4 A;  3CF6 E;  5D2M B;  1WIA A;  3SDL C;  1RFA A;  1X1M A;  3PT2 B;  2PE6 B;  2VRR B;  4ZRJ A;  5C23 A;  1E90 A;  3QHT A;  2JZ3 B;  1WGY A;  2K39 A;  2LXC A;  3MJW A;  2KC2 A;  2NVU I;  3ALB A;  2ZCC A;  3TMP B;  2DAF A;  2L0T A;  5J2R A;  4KDI C;  5JZE B;  2XBB C;  3SHQ A;  3DVG Y;  2WX1 A;  2LVO A;  2L76 A;  2V1Y A;  3L54 A;  1KM7 A;  2KFK B;  3DBS A;  4KIK B;  2ZJD A;  1WJN A;  4MM3 A;  1ZW7 A;  5E6O A;  2JVC A;  4PYU A;  4WAA A;  1YQB A;  4DHJ D;  3UGB B;  3RZW C;  1V5T A;  3T9L A;  3H7P A;  4TV3 A;  2PJH A;  2KQ7 A;  4P7I A;  1L2N A;  4WWP A;  3BY4 B;  1A5R A;  2KTR A;  1U4A A;  3V6C B;  2CKH B;  3V60 A;  2KZR A;  3IVF A;  4G11 A;  2GMI C;  5DPW A;  2J0K A;  4GB9 A;  4K7U A;  3VXW A;  1EUV B;  4BVU C;  4X57 B;  2FCS A;  2MP2 A;  3GOE A;  1LQB A;  3NZS A;  3UIN B;  1IP9 A;  3VUX A;  4KVG B;  3RZF A;  2LGX A;  4F7Z A;  5AZH A;  2KWV B;  4XC2 A;  4B9K A;  4FJY A;  4ANW A;  1WJU A;  4N9F 4;  2FCQ A;  1YX6 B;  1V49 A;  2IO0 B;  2PPH A;  1UZX B;  4GDK B;  2KO3 A;  2DX5 B;  3LMN A;  3AU4 A;  3JVZ X;  2LJ5 A;  3ML8 A;  3SD5 A;  3DQV A;  1WX7 A;  2CR5 A;  4PYZ A;  4W9C A;  3TCA A;  5E6N A;  3R7Q A;  3H1U A;  2C7M B;  4WJQ A;  2B3A A;  3W1S C;  5D7G A;  1H4R A;  1SGH A;  3EFU A;  2KDE B;  2LRU A;  3VDZ A;  1IYF A;  2KD0 A;  3ONS A;  3ZTD A;  2REX A;  2BWE S;  2KHW B;  2UWQ A;  4AWJ A;  4MH0 E;  1QZE A;  4NAW A;  2DZK A;  3ZNI D;  1CMX B;  4HXD A;  4AJY B;  3WAO A;  4B6W A;  2NR2 A;  1WH3 A;  4DDG D;  1SE9 A;  2BKF A;  2LI5 A;  4FUL A;  4M8N A;  4GDL A;  5LLI A;  4WWN A;  3PHW B;  4I6L B;  3VQI A;  1KLV A;  2MSE D;  3B08 A;  4RMA A;  2BYE A;  1TGZ B;  3M3J A;  1KJT A;  1WZ3 A;  4MJS A;  4ZRK A;  2KX3 A;  3APC A;  1RRB A;  4GGQ A;  3ZRF A;  4MSQ B;  3R3M A;  2N9E B;  4JQW C;  2GBN A;  1WXS A;  2IO1 B;  4G0N B;  4K7W A;  5J17 A;  3KUZ A;  4EZL A;  2CHW A;  3QA8 A;  3ZNH B;  2BGF A;  3NOB A;  4EKU A;  4KSL C;  3O65 B;  4BKS D;  2G4S A;  3RCZ A;  5AZF A;  1E8Z A;  2HJ8 A;  2O6V B;  4JLC A;  4PS8 A;  1Z2M A;  3APD A;  4FBJ B;  3ZKJ C;  2KXJ A;  3PZD A;  2JPH A;  3QJZ A;  3ZTC A;  4I6N B;  2C9W B;  2JT4 B;  2JRH A;  4AP4 C;  1R4M I;  2MQJ A;  1OEY A;  1XD3 B;  4TUU A;  2MRP A;  1P98 A;  2MW5 A;  2EMS A;  4LJP B;  3V62 A;  4A3P A;  2K8C A;  3RUL A;  1S3S G;  3NZU A;  3UF8 A;  4HVB A;  2GBR A;  4XX5 A;  5BO4 B;  1MG8 A;  3ZIM A;  2ZNV C;  2D10 A;  2IBI B;  3ML9 A;  1UD7 A;  2DYB A;  3A9K B;  2KVR A;  3U30 A;  4AOF A;  3M63 B;  4BKS A;  4EZJ A;  1P9D U;  1M94 A;  1WJ4 A;  3DCG A;  4BOZ B;  4II2 B;  2LRW A;  2DZJ A;  4ANV A;  2J0M A;  1J0G A;  1UEL A;  3WAN A;  2CU1 A;  5DCN A;  1WGH A;  4OVU A;  3QCA A;  3B0A A;  1E8Y A;  4LDT B;  1WE7 A;  3CMM B;  1UGM A;  2DYO A;  1V2Y A;  1C3T A;  1E5W A;  3PHX B;  2KFK A;  2EMT A;  3WAM A;  4KIK A;  3PTF C;  4IUM B;  3IHP C;  3V61 A;  4W9F A;  1NBF C;  3QWZ B;  3OJ3 A;  4JGH B;  3U7D A;  4J6I A;  2BWF A;  3PPA A;  3PLV A;  4GN1 A;  2MCN B;  2A5U A;  4MGK E;  2FUH B;  2L00 B;  2R2Q A;  3VH4 B;  2L8J A;  3KYD D;  4GMV A;  2N4F A;  4W9I A;  1BT0 A;  1XQQ A;  2KWU B;  2RPQ A;  1GJZ A;  1V5O A;  1WGD A;  3EC8 A;  3KUC B;  2DAJ A;  4NY0 A;  2KDI A;  2D2Q A;  1OEY J;  4TQ1 A;  3QIJ A;  3QAR A;  3SU8 X;  3BIN A;  2W9N A;  2GBK A;  1H8C A;  3R66 C;  1V6E A;  2XEW A;  4HCN B;  4NJ7 A;  3GZN I;  4F8C B;  2WX0 A;  2NBW B;  2FAZ A;  4FAD A;  1NI2 A;  3L17 A;  4KZ0 A;  5JHA A;  5AEK B;  1WMH B;  2DYM A;  3VUY A;  4IWP A;  2J7Q B;  3JYU A;  4IM0 A;  2K25 A;  4E71 A;  2ZVN A;  3DBL I;  2AYO B;  2N7D A;  1K8R B;  4PS3 A;  3VHT C;  2C5L C;  3IFW B;  2NBU A;  3ZUN A;  2KK8 A;  3L08 A;  4B95 A;  4BKG A;  1V86 A;  2KMC A;  3H7S A;  2HD5 B;  2MBO A;  4WWO A;  4DHZ B;  4KZC A;  2O2V A;  3ZO5 B;  1YJ1 A;  2YVC A;  1EF5 A;  1ISN A;  3KW5 B;  2DZI A;  3A4S C;  3TIX A;  3L10 B;  2XK5 B;  4ANX A;  5J18 A;  1Z5S B;  2ZPN A;  1I42 A;  1Q0W B;  1YIW A;  2G3Q B;  1WGG A;  3WA0 A;  5JH5 C;  1WXM A;  2JUO A;  2KDB A;  2MBQ A;  2DEN B;  2PEA A;  3A9J A;  4NQK E;  3DBH I;  2HTH A;  2DZM A;  2G4D B;  3DPD A;  4I6P A;  4OVV A;  3HM3 A;  1WRD B;  3T8M A;  2FCM A;  2LZ6 A;  4HPL B;  5TR5 A;  4CHK A;  1P3Q U;  3MHS D;  5AZG A;  4AUQ C;  1RLF A;  2C7N B;  4EEW A;  4DDI D;  3C0R B;  2CS4 A;  3H7P B;  3L0W B;  2FIF A;  1P0R A;  1WY8 A;  1YD8 U;  3VTV A;  2NCN A;  4MEM A;  3VTW A;  3VVW B;  3ZDM C;  3TJP A;  4DK5 A;  5CX3 A;  5LXH A;  3AU5 A;  1WM3 A;  4FN2 A;  2HE7 A;  1WYW B;  5D6J B;  3A1Q B;  3AUL A;  4WJP A;  4MDK E;  4DXA B;  3QAQ A;  4IG7 B;  4TQ0 A;  4URK A;  5HKH A;  2NPT B;  2LGD A;  2LVQ A;  3D32 A;  3DBR I;  4HDQ A;  5IAA C;  1T0Y A;  2J0J A;  3PRP B;  3PS6 A;  3QQ8 B;  3JSV A;  1TBE A;  2FNJ B;  2KKC A;  2CHX A;  3PV1 A;  2MWS B;  4CO7 A;  3A9K A;  1PQS A;  3CST A;  3HK0 A;  3ZDT A;  1ZKH A;  2KQS A;  2N1W A;  4KSK C;  3IBE A;  1WI0 A;  4NJ6 A;  3M62 B;  1SIF A;  3L13 A;  4IW0 A;  3AI5 A;  4LCD E;  3VAW A;  4GU2 A;  2KJR A;  3EEC A;  2WYQ A;  1FXT B;  4W9E A;  3VFK A;  4K1R B;  4ICU A;  2ZZP B;  4EOY A;  2V3S A;  2YLM A;  2R2O A;  1V9J A;  2KWC A;  4NAW B;  3B1L X;  3H9D A;  1G6J A;  3ZW3 A;  4KDL B;  1V81 A;  2I1K A;  1XT9 B;  2KLC A;  4ICV A;  3OLM D;  3ZLZ A;  4ANU A;  5L95 C;  1L7Y A;  2N9P C;  1LFD A;  5CTR C;  2MLB A;  2AWT A;  5E6P A;  2M4N A;  3P2B A;  2L05 A;  3CSF A;  3KUD B;  4NQL B;  2KFJ A;  4FA6 A;  2L3Z A;  3R7R A;  1WZ0 A;  3DVN U;  1WJ6 A;  3QX1 A;  2KMA A;  2FCN A;  4WJO A;  2WWZ A;  4MEL A;  2KLG A;  2Z0D B;  3DVN V;  3K9P B;  3LJ3 A;  3Q3F A;  4FHJ A;  4IWQ A;  4HWI B;  3H6N A;  3HM6 X;  4GIV A;  1VD2 A;  3LDZ E;  2QHO A;  5CHW A;  1Q5W B;  1WX9 A;  2I1J A;  3KH0 A;  3RT3 B;  2D07 B;  2KX0 A;  3PRE A;  1S1Q B;  1P1A A;  2N9X A;  1WXV A;  1WMH A;  1UBI A;  4W9H A;  4JIO U;  2ZNV B;  3ZVV A;  2N7E A;  4A3O A;  4ASW C;  4PS7 A;  2GOW A;  2JY6 A;  2LAS A;  1GNU A;  2KOX A;  4MGZ E;  1EF1 A;  1JRU A;  2C7H A;  2EKE C;  1I35 A;  2GBM A;  5GMV A;  3APF A;  4A20 A;  1WGR A;  3DVG X;  3HHM A;  2M0X A;  3N32 A;  3EHV A;  4GDK A;  5D94 A;  1NDD A;  2PE9 A;  2XK5 A;  3RD2 A;  3WIM A;  2L0F A;  3NY5 A;  3ZRC A;  3WAL A;  3TBL D;  4DBG A;  2OOB B;  2JWZ A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...