2NTTA

Crystal structure of sek
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Staphylococcal enterotoxin K
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nttA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nttA01
3O13A 1T5XD 5I4DA 4UDUC 1JWMD 1JQYD 1JWUD 1S5ED 1LLRD 1YN4A 1LTTD 4DXGA 1I4PA 4L6TB 2G9HD 1KTKA 1PRTC 1XTCD 1FNWA 2J4XA 2R61A 3DWQA 1S5DD 4C56C 4Z9CB 1SE4A 1AN8A 1EFID 1HA5A 1TS4A 3SEBA 1LTID 1PYWD 1QILA 3MFGA 2QILA 2XNAC 1L0XB 1LT4D 1I4XA 1ENFA 2RDGA 3DWPA 4TSSA 1I4QA 1TS3A 1TY2A 4RHSA 1EU3A 1SE3A 1TY0A 1JCKB 1PZID 2XN9C 1M4VA 3EFXD 1YN5A 1BCPC 1CT1D 1PTOD 1V1PA 1AW7A 1EEFD 1CHQD 3V05A 1JR0D 1LO5D 1V1OA 1UNSA 2CHBD 5ELCA 1LT5D 3URYA 1EWCA 1HQRD 1EU4A 1DJRD 1SXTA 1D5XC 1LTAD 1KLUD 5D3DA 1BXTA 1FGBD 5TSSA 1EEID 1TS5A 3EA6A 1PTOB 1L0YB 1D5MC 2XRSD 2QEJC 2SEBD 5FK9C 4OHJA 1RD9D 1S5FD 1LTRD 3R2IA 5ELEA 2XRQD 1GOZA 1D6EC 5ELFA 5D3IB 2NTSA 3R2TA 1CK1A 4RH6A 1PTOF 1FNVA 1SEBD 1RCVD 2AQ3B 1HTLD 1TS2A 3DWAA 1I4GA 4RCOA 4L63B 3BYYB 1S5CD 4RFBA 2WV6D 3TSSA 1I4RA 1SE2A 1PZKD 5FKAC 1LTBD 3KLSX 1B1ZA 1LTSD 1SJHD 3BZDB 4RHRA 3R8BA 2AQ1B 4DXFA 1CHPD 1ET6A 1JWSD 2Z8LA 1RF2D 1YN3A 1LT3D 1BCPD 1PZJD 1RDPD 2IJ0A 4RGNA 1PTOH 1D5ZC 4RGMA 2O2LD 1FNUA 3BVGA 1S5BD 4ZYSA 1V1PB 1F77A 1PTOC 1STEA 3BYTB 1ESFA 1MD2D 1PRTD 1PRTF 1CQVA 1LTGD 4BWGB 3MC0B 5ELDA 3BVMA 1XXGA 5ELBA 2IPKD 1UUPA 4NZLB 2NTTA 3CHBD 1KLGD 1BCPB 1HXYD 2TSSA 1DYQA 2ICIA 1FD7D 2AQ2B 4RGOS 1G8ZD 1LT6D 1SJED 3OWEB 4RGTA 1B44D 3W2DA 3BVZA 1ET9A 1BCPF 3GP7A 2RDHA 4O1NA 1PRTB 4K6LA 1I4HA 1SBBB
chains in the Genus database with same CATH superfamily
3QARA 3EFUA 4C1NI 2Y0SE 2OTJA 3KLWA 1J9OA 1S5ED 4LF8Q 3I8ZA 3IRBA 2Z1CA 4CJ2C 4JE3B 4RF0A 4LF4Q 2NVYB 4I6LB 3VVWB 4C3HB 3VA7A 2ZM6L 3UE0A 1LFDA 2JX5A 1DOLA 4DR5L 1G6ZA 3VYRA 4OIKA 3GTJB 2BW2A 4V0BA 3PSIA 1VDZA 4JI1Q 2DLBA 3BK2A 3IAS1 2AEHA 2B2YA 2CWPA 5FO8B 5L95C 1RKNA 4UP7A 4A3JH 4V190 1EIYB 4BY7B 4C4VB 2ZTCA 1HZ9A 2KJRA 2BS3B 1VZ7A 1E2ZA 5E7NA 3JC66 4A3BH 1MI0A 1VCIA 4Q5VA 1JWBD 3UIPB 1VR9A 1KLVA 4U68A 4NY0A 1CHQD 1RODA 3ND8A 2DYMA 3UQBA 2JA9A 4O2DA 4BY1H 4HPMB 2B2TA 4OZCA 3K58A 3H09A 3KF8B 3CCUA 2DNCA 1ICWA 2VQEL 5CV5A 4GLXA 2IT1A 2FCNA 2IDYA 3E56A 1V1QA 4GOCA 4HEDA 4W9EA 1EEID 1W6KA 1PUTA 5JJLA 3B2GA 3IFWB 1WSPA 2Q2UA 2K8CA 1AH9A 3ZTCA 1L0YB 1XNRL 5FLMH 5JHAA 4WJNA 1Q1EA 2FINB 2MHVA 1XYIA 2HHHQ 2HUGA 5IO9A 3U7DA 4KY5A 2NN6G 3NHHA 3I4LA 5E3FA 1HNZQ 2LASA 4GKJL 1GVPA 4JX1C 5J1ZA 1XJVA 2XBBC 2WLBA 3L10B 4DV5L 1WTHA 2SNSA 4LFBQ 2J0KA 3QJZA 1I4GA 4H7BA 4L63B 1I50H 3NTHA 4IUPA 2BDOA 4WAFA 3NBHB 3QOLA 1OXUA 3M95A 4P72A 1ZYRD 1SF0A 4HJGE 1E90A 2PE9A 2YTXA 2ZJPA 2QDFA 2WXFA 5EKIA 2J7ZA 3GTOH 1X56A 2AL6A 4XDXA 4LJPB 2MA9B 4ZUJA 4IDIA 1IUEA 1HTPA 1FMAD 2V4LA 4UP9A 4MH0E 1EUJA 3KLSA 4N8FA 1B7YB 1HA6A 1P9DU 1I42A 3CPWA 2RHQB 4CJ0B 5CBEE 4A3CH 1M94A 1CMXB 3WAPA 1BBXC 2ZZPB 3IXSA 5ELBA 3SR1A 1E22A 5M3FH 2L12A 4W9LA 3A1QA 3FHWA 1NJIC 5LXHA 5BMIA 1E10A 3MHBA 2JJQA 3KLRA 5I9OA 1SNCA 3M9BA 1DD2A 4FJVB 4DK5A 2CQAA 1GC6A 1IW7D 3A5UA 4GSWA 1WGYA 2XIWA 4HPPA 3ZO5B 1Y8RC 5BYQA 1TWFB 4A3KH 1WM3A 1XNQL 1X3QA 4OEMB 1DONA 3SGIA 3NVWA 4H02A 1D1KA 1TVXA 4AIMA 1Z2MA 4J3OD 3IFDA 3SFDB 4PYUA 1Y14B 2R61A 4C3JG 1N32L 1NAPA 1QUQA 3EIVA 3G48A 4B3SL 3ETRA 5J2RA 2C9WB 4LNIA 1JQ4A 4AYBE 1PXUA 2DY8A 2DYBA 2QSDA 3N3KB 1E2WA 1LABA 4A3IG 3WALA 2JA8G 1N36L 2PPBC 1QVGA 4DR7L 5IA7A 1E8ZA 3T1HL 4QB4A 2Q8TA 2WGSA 1P7EA 2LMCB 1I3QH 1EWIA 3I55A 4B3ML 3RZOB 1NMFA 2LGIA 4MGIE 5DPRA 2I2YA 3STBC 4DUZQ 3QK0A 3E0EA 3IAYA 2F4VQ 2ATWA 3ONAB 1XMQL 4J6HA 1JC7A 3VYUA 2RSUA 4MN3A 2MUYA 3VDZA 3I72A 3PZ8A 5KHQA 1BXTA 2NPTB 1GUTA 2JYEA 3KJPA 4HIKA 3EA6A 3M4OH 3E6ZX 1KF6B 2JT4B 4FJYA 1T0SC 1R4NI 3CF6E 5CX3A 2KOXA 5E6NA 1KAAA 3OOCA 3VUYA 3DBHB 4GLVB 4JBWA 2EMTA 4JI6L 2F0VA 3DDCB 3WAMA 4M02A 3RLFA 4B0MA 1VS0A 4YIJA 3DHHC 3PIO3 5K5PA 4DHJB 4W9JA 1SEBD 1TT2A 1CUKA 1NENB 3BIID 2JRHA 2KWDA 4LNQA 3CD6A 2G3QB 4P1CC 5JZEB 1PFBA 4DK0A 1EO6A 5C23A 4F8CB 2BGFA 3S1RH 3T1YL 1YQBA 4NNJB 1PLFA 4XX5A 3TS2A 2DGYA 3PO2G 5AUIA 2F03A 3IG3A 1TR5A 1VQEA 4YSXB 4E6IA 5K36H 4C7ZA 3EGRA 5EBCA 4A76A 3MEHA 1YN3A 3PREA 2KEDA 3JAMi 3RNBC 2JEAI 1K83B 3I4NB 1RWSA 2HJ1A 3GTPH 2N7EA 5C1ZA 3GTMH 2MPMA 3KW5B 3N32A 1QE6A 3U4VA 4PS3A 4XGAB 3DCGA 4CHTB 2DZIA 3H1UA 2PQAB 2NVXH 2LFIA 1WD0A 5IGGA 3HOZH 4HPLB 4YWLA 4QF4A 5C4HA 3DM3A 2BCOA 3HOWB 3ECIA 1JW9D 3SFEB 1FVIA 1ESFA 4OO1H 1QT9A 3QHTA 1V2YA 1EM7A 3OJ3A 1D8LA 3CRLC 3BVMA 4ZK9B 3CU7A 2LVPA 1HZCA 4HEA1 3FMCA 1TWGB 1VQKA 1KIXA 1MGSA 2Z9HA 2L3ZA 1RYJA 4HKZE 4OZAA 1YX5B 2KZRA 1G91A 2DUDA 3KYCD 2K5NA 5NUCA 1EZ8A 4B3TL 4KSLC 2EYOA 3HZXA 1A63A 2L4NA 1X3EA 4X6AH 1N6ZA 1KDBA 2FCMA 1V80A 2F4IA 4F7XA 2LI5A 4RM9A 1UE6A 1E7VA 4HDQA 1J5EQ 2CW0C 4TQ1A 3Q8BA 3AFQA 1IPGA 4DK6C 3O13A 5IAAC 1Y1VH 4L5QA 2K5VA 4A3LG 4K14A 1XPRA 1PVOA 4BBRH 2OEOA 4DXGA 4L6TB 1RLFA 2J53A 4KSKC 3TEZA 1TKYA 1HQMC 4A3FH 2E74C 4A6QA 2SDFA 1UD7A 5AJ3Q 3HK0A 4FDBA 4MJSB 1SE4A 2KHJA 4CDFC 2R2QA 2ZVOA 1G291 4JPBW 4IFDH 2XK5A 3AE9B 3NG0A 4N9F4 3NSWA 3BY4B 2V3NA 4EOYA 2JU6X 1J19A 1J6QA 2JEBI 1OXVA 1TS3A 2F0IA 4CDCC 3DM1A 3CF5A 3MEFA 4K0KQ 3ALBA 1SYFA 4QAYA 4W9KA 1A0IA 1P8LA 1YN5A 1NMGA 4DR3L 1QNKA 1EY8A 5IWAQ 4LF7L 1IXRA 1ENAA 4IOCA 2Z0EB 4NMZA 4IG7B 2V3PA 4KD3A 1SFOH 2PNRC 2CKZB 4DV2Q 4NAWA 2QF7A 1VLBA 4GXBA 4HKQA 1F9SA 1FD6A 2B2WC 2D11A 3NE5B 4P74A 4JI4L 2ZT9C 1WX7A 3IAM1 3JAME 2WYQA 4X66Q 2N1WA 1DM0B 1XPUA 4GMVA 2Z4IA 2DHZA 4LF5Q 4HDOA 2AKWB 1AE3A 1HNXQ 2WXOA 3AE2B 1SRUA 2PO4A 4OVZA 4WJ4A 1TWCB 1P98A 5C44G 4OHJA 1PH8A 3EFCA 5C4JB 2WS3B 1IBXB 3E5SA 1CSQA 2G4DB 4RH6A 2YVCA 4KLKA 2B39A 1Q8IA 1OO9B 3A4SC 2L9HA 1HTLD 1Y8OB 4X64L 4A93G 1WGRA 2O2VA 5HURA 1YQ3B 5L83A 1JJ2A 2K0PA 4PMWA 3M85A 4A3EH 2N0SB 2MJDA 1YEZA 4FHJA 4FLHA 3SDLC 4H2AA 4HCSA 2D3CA 5D2MB 2GA4B 2KN4A 4IWPA 3A9KA 2DN8A 5EJWA 3ULJA 2JXTA 1LM8B 3UI2A 3AMUA 1QZEA 2KX0A 4ITKA 1SE9A 1DOMA 2KA7A 1E0BA 1XLNA 3APDA 1S72A 2C9OA 1WXAA 1RRBA 4JI1L 2CU3A 2DX5B 5BMHA 2F0LA 4BBSG 1K8AC 3I2ZA 5EPKA 4K6DA 1RL2A 1N34L 1WGDA 5TR5A 2VW9A 2LGXA 3NTIA 1DZ1A 4BOZB 2ZM6Q 4DR5Q 4JWUC 1WM2A 3UDGA 2WHIA 2R7FA 5CV8A 1X3PA 3Q23A 2NVUI 4R4TA 2CH4W 3Q24A 2QC8A 5C4XG 1XLOA 2D5DA 3KF6B 4URKA 1IL8A 1RTNA 1IYFA 2CVRA 2NBFA 1SB3C 3TDQA 1X1MA 3B0AA 2YTVA 2ASBA 4WJWA 3IVFA 2YV5A 2LXJA 3JW0X 1N61A 4YSZB 1YNNC 4WFN3 2M2LA 4JW0A 4K6LA 4U673 3GTGH 2E5LL 3P75A 1H8CA 1YHQA 2PKOA 5I4DA 2WAQG 2MBEA 5FO7B 1LLRD 2VQEQ 1QNUA 4C3JB 3CCVA 1L4ZB 3C1EA 5KNDA 2MP1A 2BPSA 1XT9B 4AQ7A 3OIQA 2AYOB 1R4MB 4JOIA 4Y7NB 3ZRCA 1XNRQ 4S3SA 4RCNA 1QILA 5IP9G 1KD1C 4A3IB 3K7UC 3PUWA 4QL5A 1QOHA 2JA8B 2GOWA 3IBEA 2Y5BB 4LDTD 5EE3A 5HHDG 4GOPB 1EIFA 2G9DA 4IUTA 4GKJQ 4OX9L 4GZYC 4EZKA 2JQOA 1PZID 2D0OA 2L15A 1JRUA 3CPFA 4DV5Q 2C7NB 3DBHI 3L16A 3HM3A 1BCPC 4EUTA 4KIKB 1GD7A 3UIOB 1MJCA 2KCCA 2CH4A 5I2YA 3OG5A 4JV5L 1RJTA 2HTHA 2KD0A 4DNIA 1MHXA 1X32A 5EDSA 1STGA 2INCC 3HRZC 2X6LA 2Z6BA 3K9OB 4HLEA 1D5XC 3E9IA 4R4OA 4TRDA 2JA7G 3S2HB 1V43A 4KY6A 1G2TA 5IYDG 3FILA 3I5JC 2I07B 1FGBD 1AP0A 1QF6A 2GLSA 1WXQA 4ZRIA 4WRDA 3EHVA 4APVA 2K8HA 4JLCA 1E8WA 3C19A 3S14H 2X69A 4ILWA 5M5XB 4ZOHC 2JE6I 1FXAA 2KQSA 1IBLL 4HJ9A 2GBRA 1MHHE 5M5YB 2WXHA 1QZHA 1BO0A 5CYUA 3I4MG 3QO2A 1M1KC 1PH7A 3U2SC 2AQ3B 1TS2A 3VTVA 4A3DG 2NVTH 3A8KE 4HIMA 4DV3L 1VJKA 3M3JA 1QZGA 1F52A 3VR4A 4B0EA 1K3RA 4ABNA 3PO2B 1F2ZA 3U4ZA 3GTLB 2PNHA 3L0OA 1B1ZA 3R8BA 2AQ1B 3ZNID 3QJYA 1JJCB 3KBXA 1CQFA 5M3MG 2BS4B 2G45B 3DVGY 3NZUA 4HVBA 3Q3OC 3V3XA 1XNQQ 2K50A 4GIVA 3J7ZC 3S15H 3DBLB 4TV3A 1MVKA 1CTMA 4HAEA 1PTOH 3BU2A 4K3CA 3OIPA 4I65A 5BN3A 1F9RA 2KDBA 4OWTB 1EF5A 1K28A 2JZPA 2K1FA 3PLVA 4N58A 1QJOA 4MM3B 1N32Q 1EL0A 1V1PB 1IYJB 1KC8C 2B2VA 2DJFC 4IM3A 3HVZA 1JRPA 2M8SA 2OWOA 4B3SQ 1ENCA 4A4IA 4M1UB 5M9OA 2KQ4X 5IP7H 2QJLA 1LACA 2VH2A 1LUZA 3PRPB 3MC0B 4CHKA 5JPNC 3MHSD 1XXGA 2IO0B 3NVYA 1JE5A 5CHFA 3PO3H 1N36Q 3LJ3A 5J22A 4NZLB 3NQIA 3CHBD 3T1HQ 4E3CA 2LWPA 1K9MC 2SNMA 2R93H 2MCNB 4MT5A 4KTAA 1ZYRC 1G8ZD 2V4IB 4WH4A 4AP4C 4IO9A 5HGTA 1EY6A 4A3JG 4LTUA 4REZA 1WFYA 1XQQA 1CI3M 3GE3C 2JF5A 4LW1A 1WCMH 1CKNA 1TIFA 4A3BG 1ICFB 5BO4B 2BE5D 4B3MQ 1HTQA 4IJHA 4JI2L 3BG3A 3MXNA 2JA6H 1XMQQ 1WJNA 2I1KA 3NZSA 4BY1G 2XSCA 2BQQA 2ZXPA 2KKCA 1V8CA 2KJHB 1UGJA 2EY2A 3IT4B 2KCTA 3FEWX 4ZRZA 1HZBA 1MSGA 5IGCA 4A93H 1C4AA 5E6PA 4YTPB 4JGHB 2MEKA 2N4FA 1HR0W 3HOUH 1CKOA 1EFID 1TS4A 2PTLA 3FKYA 3KH0A 3D4RA 1OXXK 4EKUA 1A3TA 2QILA 4K2LA 1O80A 5H1SE 5C0XH 2RDGA 2R3ZA 2AX5A 4JI6Q 4A20A 2L55A 5FLMG 2H89B 4DFAA 2DY7A 3HUIA 3Q3JA 1A2UA 3Q3MC 4KGTA 2O5IC 3A8JE 5GXGB 2Q5WD 2WXRA 3V62A 2WIIB 3HG9A 1CA6A 3SD5A 1IW7C 2NN6I 3AEVA 4BVUC 4DV7L 3KDFA 4BBSH 3T1YQ 3A54A 1QOFA 3K5LA 5ELCA 1I6VC 3QG1A 3L54A 2Q8RE 1C4QA 3NWTA 1OXTA 1LYLA 1KRTA 5E6OA 2JXMB 4BKSD 1HFGA 1GUWA 5LHY1 1VQ4A 4X57B 1HUNA 5D3DA 1EWHA 2N49A 4GDLB 1HR0L 4QQBX 5DAUA 5C44B 2QCZA 4MSMB 2K25A 2IO3B 2JZZA 2K7VA 4FVMA 1ASYA 1EFWA 3HRDD 3DEOA 4B08A 5IOIA 2KT7A 2FFKB 3VA5A 3W5UB 3NWSA 2KFJA 2J42A 5KRUA 3N1ZC 4RM8A 3A9JA 2FUHB 3VR8B 4LF9L 3LNNA 2AWTA 4A3CG 1JORA 2VRRB 2QCPX 2BVCA 2WU5B 1CZPA 3ZKJC 2PMZB 3TSSA 4HSPA 5BYSA 1KDAA 5M3FG 4X3SA 1YHAA 4B3TQ 1ZXHA 3UDXA 1L1OA 4S17A 4EZJA 1YX6B 2J7QB 4FXKC 3DUZA 1WTOA 5AJ3L 3ONSA 3PUYA 1VQJA 2IHFA 3QOJA 2D62A 2PLPA 4K7UA 3W9CB 5EBDA 4XZ4A 4XWWA 2K04A 1SYCA 1ZOYB 4A3KG 3EROA 1ZDXA 2XWJB 3BVGA 3OYYA 2KOLA 2WXKA 2E2HB 4WJOA 3NP8A 2F0UA 1N5WA 4NPNA 3TEWA 1EQRA 4IQZA 3T4AC 4BOSC 5IGFA 1ROEA 3DVGX 2WWZA 4C7YA 4BWGB 2N7JA 3CQZH 1WTPA 5GAEC 1FCLA 4R4CA 2N78A 1VQGA 5C4XB 2K32A 1R4MI 4PNYA 2MJ3A 3A7AB 3P63A 3V6CB 2ZTDA 1TQOA 4DAYA 4ZUIA 5IT9E 1FEHA 2RMMA 2NVQB 4RKBA 4IUNA 3PGZA 3D8GA 4X3KA 1T0YA 3CP0A 4LF7Q 2HDLA 2A5UA 2EVBA 4ASWC 1I6HH 2RPVA 2AWNA 3H7SA 2PW9A 1KDCA 4G0NB 1Y8PB 3TBLD 4BA2I 3CSTA 4HJ5A 3W1YA 2F0NA 1HNXL 3TZDA 2WAQB 2SOBA 1JWMD 3AEBB 2BH8A 3Q8DA 4JI4Q 2GMIC 2HE7A 1HTOA 2FHTA 3R3OA 4C2MB 3NUHB 2F3IA 4JI7L 4FN2A 2KFKA 2W9NA 1B4OA 2E2IH 4FF3A 1KHIA 1AN8A 2KACA 1E0ZA 4A55A 4DV0L 1SIJA 4W9HA 3EQLC 1I4XA 1ENFA 3WA0A 3T53B 1NVID 4X3TA 2OT2A 1I4QA 4OGQC 2GVAA 1DGJA 3V2TA 1FXTB 2J0JA 1EU3A 5G2NA 3ZQ4A 4NAMA 1G2SA 5JVG3 2IGDA 1F2LA 4BY7H 4X64Q 1PTOD 3S1MB 1VQOA 4UY8C 4IPGA 4R8NA 3NOBA 4OELB 5BMGA 3ZRFA 2BA1A 4QGUA 2Y3AA 1LO5D 2N55A 3AE8B 1KOTA 4DUYL 2A19A 2QA4A 4KKJA 4ME5A 2A69D 4KK7A 4S0RA 2IX1A 5FO9B 2UUCL 2JA7B 3H7PA 4ZRPA 1SXTA 3ZDMC 3Q22A 3IL8A 4NXMQ 3TIXA 1R9TB 3ENEA 2JWZA 4B9XA 4JVZA 5K36G 3TP8A 1OEYJ 2I5LX 1MJEA 2WDTB 2WKCA 3OLMD 3C3LA 2A8VA 3GZNI 1H9SB 4RF1A 1N34Q 1NE3A 1WD1A 3HOXB 3DBLI 2ICEC 2ZW0A 3RULA 3HOZG 3NS8A 4WORA 3I4MB 2L0CA 4OO1G 2M9VA 1HUMA 4A3DB 1K53A 5JOBA 2FMMA 1NSNS 3HVDA 4GLSC 2K5HA 1LGRA 2OQ0A 3LWUA 1FJGL 2UWQA 4WAAA 1GC7A 2KWVB 1YQ4B 2N9LA 4MSQB 2KCMA 4HN7A 3KLSX 1SJHD 5M3MB 3RZDH 4IKGA 4MGZE 4TMAB 4MHEA 1PFMA 3CSFA 1V9PA 3QAQA 2KJXA 4MELA 5M5WB 2E5LQ 2KX3A 3L2PA 3RNGC 1DOKA 3NRZA 5BN5A 1UAPA 4LUVA 2QEXA 3K5MA 2RQXA 1Y1VG 2INNE 4I7AA 4NW2A 4PMCA 1NNXA 4LJZC 5KHOA 3PF5A 1M8AA 3OW2A 2K33A 4BBRG 4L5RC 4WWNA 4A3FG 2BYTA 1Y8NB 2K75A 4IM2A 4W9IA 2K28A 4DU9A 3SHQA 4NXNL 3Q0AA 1PQSA 4H0LC 2CHZA 4IFDG 2KTRB 4DHZE 3F2BA 2CJOA 1WE6A 1VMCA 3NJTA 1GG3A 2EDGA 2B8GA 4OX9Q 4QIWB 2MBBB 4A3JB 1NI3A 2L32A 2LGSA 4IM0A 3H3VI 3AXCA 1WTVA 2B2UA 5ELOA 3T3NA 4A3BB 4JV5Q 3Q8CA 1MIUA 1SDFA 4KHPL 1A6XA 3L4PA 3C0RB 1T5XD 1IKMA 4PV1C 4BY1B 4MTKA 1JQYD 1Q90A 1TBEA 2IY1B 2WXMA 1PGBA 1OTRB 4KMUC 2I46A 1HRJA 4KN4C 1VQCA 2AUKA 1VQFA 5D6JB 1KJTA 2FMCA 4GLAC 4Z9CB 1MFWA 4GGQA 1SGHA 3M3YH 5FJ8H 2RBMA 4JWSC 4PMBA 3PCOB 1LT4D 4NJ7A 3WWVA 2KVMA 1T0QC 1B3QA 4AWJA 4DNTB 5E4XA 2GVBA 1IBLQ 1HZAA 4IFDJ 1KM7A 3KOJA 2PVOD 1GPXA 1VZ6A 5DM63 2LGYA 1Q12A 1Q82C 1Y1WH 3HOVH 3EFXD 2Q2TA 4KKIA 1C78A 4DV3Q 4KVGB 1MSHA 3PQIA 2FJ2A 3A5ZB 4IUUA 1NI2A 2NR2A 2F52A 1I50B 3DWGC 3P4RB 3PRZA 2LRUA 3TJPA 1STNA 3J80L 4HJKA 1SMYD 3ITPA 4IZ8A 2LRWA 3NENA 4A3EG 1KFYB 2WX1A 2L0FA 3HM6X 4K81A 1YD8U 1VQAA 4PG3A 3I56A 4ICUA 5KIXA 4ZDVA 3GTOB 2BWFA 2UYZB 5CC4A 4E74A 1PH4A 1J0GA 3NUCA 2A6ED 1ZEQX 2YU9H 1MJDA 4II3B 4EZLA 1SNDA 1WE7A 2WINB 1QB5D 4XXEA 1PA6A 1MG4A 2ACZB 2KNBA 3IHPC 4RMFA 4N8X1 5COYA 2JN4A 3K59A 4W9GA 1YNTE 1WY8A 1XD3B 4LK1C 3J80c 4M8AA 3CCMA 3QWZB 3JAML 5C5MA 3EECA 3J81i 2NZOA 3CW2C 5M3FB 1WZ0A 2D3AA 4OWWB 3VYSA 2C60A 1J8CA 2E8GA 3SDZA 1U4RA 3R7QA 4UAIA 2MSED 1NUCA 2O6VA 5D94A 1DOYA 4BA1I 3NVZA 4LNKA 2MQJA 3TS0A 1U4MA 2JA5H 2Z8LA 3I7FA 1A3UA 3C46A 2E75C 4JI2Q 2KHWB 2NMQA 1RDPD 1E2VA 5DLQE 4YHHL 1TKGA 4A3KB 4BAXA 1K0RA 2O6VD 3OPOA 1HNWL 2H1EA 3PZ7A 4M0WB 1IKLA 1C9FA 1L2NA 4YWMA 3TP7A 1FNUA 3PUXA 4FJZA 4GDKB 3W1SA 2PMZE 1STEA 2LD9A 5DM73 4C00A 2IBIB 5T1GA 5GAHC 2GBJA 1RM6C 3JAMc 2LXAA 3DQVA 1HH2P 5FR3A 3KF8A 2GN5A 1SE8A 3PMFA 5ELDA 1NDDA 2DZJA 1JOQA 2DWQA 4JIOU 3HFZB 1AFPA 5EAYA 2JK8A 1T6BX 2C7MB 2CCZA 2Y5PA 2EJGC 3PO0A 3H0GH 4ARCA 5IIFA 5HG2A 3R7RA 3DWMA 2OQKA 4DV7Q 2KDMA 2WXJA 1C7YA 2PYKA 4JI8L 3D4WA 3HP3A 1C9OA 4QUFA 2NB0A 2TMPA 3CC4A 4FF1A 1E7PB 4TKNA 4G11A 1I3QB 3U8ZA 1S40A 1Z7TA 2O4XA 2HIVA 1RFAA 2INPE 2HQEA 2WXPA 4A3GH 4JI0L 2NBWB 4JL9A 3NBHA 1XWEA 2KO3A 2G9HD 4HK2A 1KTKA 2WP9B 1JROA 1XTCD 1FNWA 2J4XA 1VQ6A 2C35B 1S5DD 4M00A 3TL5A 4A3MH 4JCVE 1HR0Q 2LUEA 1PFSA 4DF7A 3PT2B 1FFVA 3M4OB 1D2BA 2Z6KC 4DWFA 4M8NA 2K01A 4TSSA 2UU9L 3JSVB 3AB9A 1O7ZA 4LUZA 3HKZG 5JPMC 2R92H 2MWSB 1G51A 2OCEA 2OXPA 5KGUA 3K57A 3LX0A 4TKOB 2D3BA 3RUZA 3O65B 2WAQE 1JCKB 2FCSA 4YTMB 3C2PA 1TGZB 4YTNB 2KQ7A 3DHIC 4LF9Q 1LQBA 2BE5C 2M19A 3H9DA 3AYHB 3J81E 2WDQB 1BKBA 2WNMA 5CMDA 4DA2A 1T5EA 3S1RB 4A3PA 1EWCA 1LTLA 4O0AA 4GKKL 4OONA 1HQRD 1EU4A 3ZNHB 1BBWA 3ZJYC 3KUZA 2W3SA 1WH3A 1Q46A 1WVLA 3PIP3 4GN5A 4H44C 3T3OA 3W3AA 1XCTL 1ZPSA 1IBML 1YITA 3IT6B 3GTPB 1EQQA 3GTMB 1X54A 4ICVA 3OHXC 2MNAA 3F2DA 1BMLC 1IL2A 4LFAL 2NVXB 3S16H 3HOZB 1DOIA 1EUVB 1ZUD2 2MLBA 3NZ3A 3F2UA 4N59A 2KC1A 1TWCH 5JJZA 1YNXA 2A1AA 2ZJRA 3S1QH 4I6PA 2M4NA 4Q2JA 1S4ZA 4GNXC 3VH3B 3CAMA 3I73A 4TQ0A 1GUNA 2IX3A 4GOPC 5IP7G 3L13A 1U5KA 1FYCA 3NELA 5EKLA 2DNFA 1FIQA 1AE2A 2E2JH 3OTOL 3PO3G 3I63C 5C3JB 2FAZA 2DAJA 1N62A 3GO5A 2LVQA 1H9RA 2R93G 1KNEA 3AU7A 2DENB 3RT3B 1ZE3D 1WMHB 5LL6X 1AYFA 1RFKA 3FILB 3DMUA 4L23A 2OEDA 1LT3D 1B9NA 1WCMG 3EJIA 4DAPA 1Z9FA 4YWKA 1Y1VB 2QW7A 4E71A 2LMCA 1JOKA 3J7YW 4MGKE 3N30A 3V6EB 1I35A 2VZKD 4JI7Q 5EQ0A 2JA6G 1E5WA 1S5BD 5EPLA 5BR8Q 4BBRB 2MP2B 1J7CA 3K5NA 4A3FB 3NTKA 1F1HA 2XTIA 3N1YC 1MD2D 1VF7A 1QOAA 2JUOA 1CQVA 4DV0Q 2KVRA 4G7HC 2OJRA 3HOUG 3BDCA 1TZOA 4K5WA 1XLQA 1K3BC 2MO0A 5JHBA 1L6UA 2NPTA 3BK1A 3I57A 1QG7A 5C0XG 2BBCA 3B2FA 2UUAL 2KLCA 1DYQA 1BUVT 2MRPA 1HHVA 4AS1A 2YLMA 4G4KA 4A8XC 3CCSA 4XQJA 1IHZA 4HROA 1Z47A 1W2BA 1K8MA 1EY9A 1WI5A 2VXWA 3K7AH 4EX5A 1X9NA 4NXML 2EYFA 3JYUA 4KI0A 3FC4A 4R9WA 4FADA 5T1IA 1CKMA 4DUYQ 1SROA 1VQPA 1C77A 1K50A 5EE1A 5LL6S 1QWYA 1SFOB 1SBBB 1VDVA 2UUCQ 2WXNA 3R66C 1B9MA 4GB9A 1E7UA 3AU5A 4P7IA 1C4PA 3FVQA 3W5OA 4DKAC 4F7ZA 4QIWE 4EEWA 3DEPA 1FRDA 2WDVB 1STBA 2I5HA 2NZ1D 2VS1A 2KDIA 4NQKE 3SE0A 1HA5A 1GB4A 3NK9A 1MHWC 4KHVA 2G1EA 1YI2A 4HXDA 1GO3E 1N60A 3TCAA 5FOBB 1Q1BA 1B53A 2HT1A 1PGXA 4C3IH 2PQAA 5C0XJ 4RAUC 4LK0M 3GTKB 4AUQC 5J39A 2DYOA 1BF4A 2WP8J 1FJGQ 3N20C 4JPSA 4XDCA 1IBKL 4HCNB 3CC2A 3NBIA 1UNSA 4EE2A 2CHBD 4X65L 4A3EB 2K1BA 1LV9A 1W6JA 4MACA 2J52A 3W5VB 1SYGA 2WB1G 1J7BA 2D9UA 2MX2A 3UF8A 3A33B 1B8AA 2WX0A 1S3OA 1KH0A 2I5MX 3M4PA 3HOYH 3J7AV 2K05A 2D5GA 1LTAD 1XEEA 2MH7A 1L0WA 2BDNA 2N9KA 1UE1A 3E9SA 4WURA 2INDC 4B3RL 3AE6B 4XE0A 4KN7C 1VQNA 3D6WA 4KGSA 4GNXB 2M0XA 1XF5L 2QEJC 2CR5A 1E1TA 1HE8A 1RD9D 4K7WA 1AZQA 1A5RA 1GOZA 2PE6B 2A6HD 3AEEB 1PTOF 2PI2A 3H3VC 4NXNQ 1ZXTA 1GXDC 3AE7B 5CHVC 1E3PA 5DPWA 2IO1B 2RPQA 4RMAA 4WWPA 4L5SA 2LY7A 3DOWA 1A8VA 3ZDTA 2A69C 4W9CA 2KVZA 2EY6A 3HIZA 1QVCA 3OSOA 2B63H 3B08A 3L0WB 4KHPQ 1WGKA 4MEMA 1PGAA 2KHIA 5I2XA 1P3QU 1SLJA 3ZYYX 4CDEC 4N6EB 1KXLA 1UELA 1WOCA 1ILPA 3GTGB 3CMMB 2ZNVC 4ANWA 1GAQB 4BKTA 1UWXA 3CKIB 2M17A 2VL6A 3MAQA 1A15A 2M1MA 1XO3A 4DR6L 4OW0A 3K9PB 4L2YA 2PMVA 1UWVA 5GAGC 3CXCA 5AZGA 3KK7A 2Q2IA 2B2YC 1PRTF 5KYIA 4PS8A 3IFTA 3RNFC 2UXBL 4ZRQA 4P71A 2BYVE 4YCVA 3BZCA 3ER0A 5C3EH 2EJFC 5LMNW 1PDXA 5HY6A 1A3VA 3S17H 1BDOA 3MA2B 2K5DA 2EKEC 1FD7D 2JYTA 2F0DA 4JBKA 4RGOS 3PIOA 4J1MA 4DV6L 1ZDVA 2L52A 4DHZB 2AWOA 4DV4L 3I90A 4XYCA 4KKSA 1IBXA 3U9SA 5IYBH 1H4RA 1JE4A 4FF4A 1V81A 2B2TC 4F8MA 4BY7G 1WRIA 2KUMA 4O1NA 2K6AA 4GN1A 1SN8A 1XX8A 3S2DH 2VQFL 2EY1A 3EVQA 1BVSA 1N8RC 3V61A 2H5XA 1G6JA 2RDFA 5AUKA 4YCUA 1LTTD 1SSOA 3L7ZC 1I4PA 5DEHA 1YMHE 2PPHA 1V9JA 4FHKA 4I7ZC 2GBKA 2VUMH 2ZTEA 1LM0A 2N9XA 5IT9L 3I3TB 3ULLA 5D7GA 1BBUA 3BZKA 4CKCA 5JAVA 1X6OA 2L1BA 1U4LA 2HCCA 3LDZE 3HKZB 1FPYA 5I6WA 1O7YA 2RDBC 2R6GA 3S14B 3C1FA 4EVOA 3RN5A 1VQ9A 5LMNL 1TY2A 3KUPA 1NR2A 4EQNA 5KNCA 4R4QA 1AZPA 2JSOA 2KK8A 3AB5A 2CJNA 4XWTA 2EYPA 5A2QE 3RR5A 3PF4A 4IWOA 4ZCKA 4OO1I 2NVTB 2HDMA 3V05A 1C79A 1VQ7A 3KYHC 1NYQA 1Q10A 3T9LA 1M90C 3HGBA 1WFQA 2K5QA 1NY4A 5IT9c 1DJRD 3EUB2 4W9DA 3P42A 3VTWA 3TEXA 4IJLA 3F8TA 2QGQA 4PZ8A 3KF6A 4OWXB 1C0AA 1QOGA 1K51A 3TEYA 3CC7A 3RNEC 4RWSC 1YJWA 4YHHQ 1KLUD 1J7AA 1TYGB 1HNWQ 3BJUA 1N33L 4HSVA 3TP5A 1FRRA 1PTOB 4HWIB 2EJMA 2C7HA 2M0AA 3L9AX 1F2YA 1OQQA 3MVVA 3CCRA 1Z5SB 2ON8A 1LTRD 1X3GA 2RHSB 1TWAH 3R2IA 4FYDA 4K3BA 3VUXA 1D6EC 3D0FA 4IURA 5ELFA 4ALPA 4IWQA 2ENBA 2F0HA 3AE4B 5GMVA 4B6WA 3X3MA 5KNBA 4I6NB 3OW7A 3T13A 4K2KA 1WTQA 5ISRA 2GRIA 4CO7A 2OOBB 1EWYC 3PO3B 2LXKA 1IZ6A 5C3XA 1JMCA 2W54A 2WV6D 1YJ9A 4IFDI 4ULLA 3NS1A 1PHJA 3ULPA 2R93B 4LCDE 3I70A 3LYYA 1HCZA 1RIPA 1E24A 1Z6HA 1GUAB 2ZNVB 3Q6SA 1Q3LA 1PZKD 2R7DA 3AEGB 5HKHA 3TZUA 1C4CA 4JI8Q 3ZW3A 3BZDB 3H91A 4EQPA 1PH2A 1YJJA 2RA4A 1JWSD 1WCMB 3ICEA 1FXIA 2L0TA 4DR4L 3AEDB 4ZKCB 2A6EC 2RKSA 1PZJD 5IODA 2V1YA 1K8RB 1NYRA 4KIKA 1IP9A 4MIUA 4RGNA 4CGYB 5HFYA 1V5TA 2B2WA 1SYBA 4JI0Q 3VQIA 1V86A 3MZ5A 5FLXE 2JA6B 1P7FA 1H9MA 2O2LD 2I38A 3RD4A 1EY5A 4EFOA 3GTQH 3WANA 5KYLA 5IN7A 1GJZA 1PYBA 4HMJA 2P5ZX 3A8IE 4J15A 4A93B 4EQOA 3MJWA 1B70B 2A68D 3HOUB 1VQLA 4FXGC 3PLUA 1A62A 2UU9Q 5AZHA 3MP9A 5FJ8G 1WF9A 2IPKD 3LGJA 2ZCCA 1U4AA 4LFCL 4DPGA 1B50A 1TKWB 2TSSA 1L5PA 2ASQA 3A0JA 2WXGA 1PH5A 2F0JA 4YT0B 1HEZE 2WDRB 1B44D 3FKIH 4UHVA 4LAAA 5F2DA 5GADC 5D65A 3ABVB 1STYA 1Y1WG 3HOVG 3VR6A 4BFRA 2RDHA 4BBSB 2MW5A 2D10A 3Q8FA 4GKKQ 1QQRA 1EYCA 3RLOA 4EQ5A 3V60A 4P1BC 4KZ0A 2FE8A 2NCNA 2V3SA 2VZAA 4GN3B 5JJKA 2KWCA 1RAXA 1IBMQ 4R1JA 2SAKA 4KDIC 1FR3A 1JB3A 2PZUA 2N3SA 4A75A 2JZ3B 4KD4A 3UI3A 4UP8A 4LFAQ 4C80A 3CIRB 3VR9B 4AJWA 1EYGA 4RKLA 2R7ZH 5FR6A 4HIDA 4JI5Q 2KMMA 1VQDA 3CMEA 4LNOA 3S1NH 4MGYE 1ZKHA 3CCQA 3RD2A 3RZWC 4XYOA 3S9WA 1XCQL 1M4VA 1XMOL 3G71A 1TWHH 1WGGA 1V1PA 1SNQA 2F0MA 3KJOA 3KYDD 3P4QB 1AW7A 1EEFD 2AHOB 5IGBA 3OTOQ 2BB5A 1JR0D 4KKTA 4FULA 3RN9C 1V1OA 2JRIB 4K1RB 2WB1B 4Y52H 1HJPA 2NS5A 2BH2A 4OL7A 1Y69U 3N1XC 5BR8L 2UXDL 1Q5WB 1FFUA 3VTUA 1CJEA 4XQQA 5D14A 2NVYH 1X65A 3B1LX 3ZJTA 2JA5G 5TSSA 4C3HH 1QLBB 3A1QB 3U58A 2HDEA 2L83A 3GTJH 3AE3B 1L0VB 4ZRJA 2F0QA 1D5MC 2K6DB 4FNFA 4YXDB 2BYEA 4CYEA 1S5FD 4AQYL 1PH1A 2GBNA 5D3IB 3HOXH 1UE7A 1KABA 2PZWA 4HR7B 2CHXA 2ID0A 2E6XA 4BS9A 2EE1A 3CQZB 1RCVD 2MJ8A 2DNEA 3GS2A 3OMGA 2UUAQ 3BYYB 5I9PA 5H8YE 4FF2A 3FRPB 4IOIE 1UGMA 3ZIMA 4X62L 2CS4A 3P4SB 1WXSA 2KXJA 3H0GG 1QUQB 3X23A 1I6HB 2VB3X 4KKUA 4HTHA 1MI2A 2A73B 2CQOA 2MHJA 3VAWA 1T9HA 1BCPD 2LUMA 2CWAA 4TVAB 2Q8IB 2JXXA 3H6NA 1L6VA 1JB7A 1YIWA 4RGMA 4A3GG 4G7OC 1OTCA 4NJCA 4IW0A 3ZJUA 3G6JB 4R8IA 1I94L 5C5LA 1PRTD 2E2IB 2K3UA 5IGDA 2KEEA 1LTGD 2ZEQA 2V1CC 4FO2A 2A4ZA 3ND9A 4A3MG 2WFWA 4ZYNA 2JVCA 1N63A 5C2TB 2B76B 2J0TD 1YJIA 4A3OA 1S3SG 1F9QA 1EQVA 4GDLA 3APFA 1IYUA 4DR1L 2MBOA 3AI5A 2ZXOA 2R92G 2O6VB 3VDYA 2DJGC 1WJJA 2KWUB 4G3XB 4RGTA 4LF6L 3DBRB 2F0SA 2CHWA 1DGSA 2HQLA 3BVZA 2DZKA 1IBKQ 3FAHA 4QMGA 2JP1A 3W1GA 1F2RC 4X65Q 1U4PA 4L8JA 1ESRA 4PZ7A 3I9V1 4QY7A 4NKLA 4DBGA 1KNAA 1DOXA 2NYZD 3VR2A 2KANA 3T8MA 2M00A 1E8YA 1QKZA 2PW7A 1JWUD 2CFMA 3K80C 1YN4A 5G5HA 2RCNA 3RFZB 5ELNA 1WXVA 3FPUB 3UDIA 3DWQA 4B3RQ 2CU1A 4C56C 1YHBA 1EY7A 1C48A 4JC0A 3U50C 4DN4M 1YJ1A 4USAA 1LTID 1EQTA 2XNAC 4YSYB 4XIGS 1E9MA 2W3RA 3AN1A 3DWPA 1Q1OA 4J8QA 4YWGG 5JEAH 3H15A 2KMCA 3I3CA 1DCZA 3E3XA 2IL8A 2Z0SA 2DAFA 2F0FA 3OAWA 4WQMA 2HIXA 1EF1A 1SYEA 2VY3A 1F2MA 1VF5C 2XEWA 1V5OA 1TWFH 3GV6A 5EPJA 2NZHA 3VUWA 4ZKBB 2LHDA 4HJ7A 2LJIA 5GQOA 3RZDB 3HKZE 2DBYA 3NHEB 5E1FA 1UE5A 2UUBL 2Q2HA 4P73A 3RZFA 3RLNA 2KDEB 2A5HA 2F0EA 4XYQA 1GUOA 2K52A 2PVGC 5CORA 4FXDA 1PH3A 4DR6Q 2LVOA 4ANUA 4GU2A 2EXZA 2B29A 3BWUD 2SEBD 3J81L 2ZW1A 5DCNA 3P4PB 5ELEA 3ZNZB 1GB1A 5JJIA 4RA8A 2JSVX 3CMAA 3VH4B 3BINA 4OVVA 5G3LF 3DVNU 4AOFA 2V0GA 2UXBQ 3QIJA 2YEPF 2EQSA 2HJ8A 2GBMA 4PT5A 4CKBA 1EY0A 1KRHA 4RCOA 5LMUL 3Q3NC 2QDLA 2KYWA 2D07B 1YIJA 3RZOH 2B8FA 4DV6Q 1QOBA 3ZNGC 4DV4Q 1I4RA 5C0XI 3P2BA 1B3AA 4IALA 3B9JA 4PYZA 4KJNA 4RHRA 1EZ6A 2VB2X 3TBIB 1YNJD 2IGGA 2XK5B 4KJOA 1OGWA 2BT6A 3EBEA 2VQFQ 3ZGZA 3J81c 1WI0A 5A35A 1PYSB 1FM0D 3MTNB 2UXCL 3Q6BA 3OWFA 4JOIC 1V6EA 4ARIA 2W82A 5AZFA 1Q81C 2JQRB 2A6HC 2I1JA 3QB3A 3AULA 3L3OC 2X6GA 2JWUA 4JYAL 1K0SA 3M3YB 3U4EG 3MTSA 3AECB 1K52A 2Y0SG 2BKFA 4LUOA 2IYDB 2NBUA 4PK1A 5LMNQ 2K03A 4NAWB 3AQQA 3A56A 3EN2A 4G7ZC 2Z4HA 3AE1B 3L08A 3U52E 1H9SA 2F0WA 1O78A 1EOVA 2EELA 1E1OA 1LT6D 4C3IG 3DBSA 2VZKB 1Y1WB 3HOVB 3KWVA 4C4VA 1L2FA 2M56B 4ZLTF 1ET9A 4IC7B 2EMSA 2KCNA 4K5VA 3NQTA 1K83H 1BR9A 3I4NH 3QC8B 2NTTA 4JI3L 2OJWA 2FCQA 2EKIA 4KX6B 1Q8KA 1U9RA 2OF1A 4G57A 2LS01 3D32A 1BT0A 2KC2A 4HJ8A 4A9AA 3LB8C 1NEKB 3HOWH 3PTFC 2KMAA 3ZTDA 5DNFA 2Z0DB 4L5TA 4WJQA 3HOYG 3CCLA 1N33Q 1GUGA 4XQNA 2O2VB 2F0GA 1G6PA 4B9KA 2YU9B 1SNOA 2IW3A 1TWGH 1C8CA 3U7ZA 3J80i 2YYZA 3SHLA 3Q69A 2RSNA 4DV1L 1SE3A 3A55A 5IYCH 4PS7A 2OHFA 3A9KB 4JG2A 2L8JA 4YY3L 2XN9C 4IUMB 3AE5B 1T3QA 1CT1D 3QA8A 1SAPA 3F1ZA 2L7RA 2HCIA 4BXXH 1CA5A 2FXQA 5CV6A 1OFFA 3B6YA 4LJOB 5AEKB 1GM5A 4FXCA 4DDGD 1LT5D 3AM9A 2KTRA 2MBHA 1ZP0B 4PQXA 4LNFA 2AUJD 1XTDA 4P75A 5IY0A 1PH9A 1TZ1A 4JQWC 3QX1A 2B63G 4DR4Q 3HHMA 4KZCA 1A70A 2JA5B 2KECA 3AH7A 3PGEA 4LWCA 4BZAA 1T0RC 2B2VC 4DDID 3QQ8B 4RNAA 3TUOA 1WYGA 2YEPB 3IKJA 1QVFA 2N9PC 3PV0A 5J17A 1XLPA 2J0MA 1E8XA 4DGZA 5C6AA 2PJHA 2WB1E 1CK1A 3P20A 2PQEA 2L1AA 4NJ6A 2UU7A 3ZVVA 1SR3A 3BDLA 1F9PA 1ZKOA 3I91A 1EOTA 3RUIB 1EYAA 4LFCQ 4KV2A 3D31A 3NY5A 3MXGA 4WJPA 3S2AA 2C5LC 4RFBA 2KQ3A 2ALYB 5C3EG 3TQYA 3DPDA 3A7LA 4ANXA 1FCCC 4ZRKA 2RF4A 1SE2A 4ZHOA 3WIMA 3H0GB 1WRDB 4LDTB 4ACFA 1LTSD 3VFKA 4DR2L 1ZXIA 1MG8A 1F0ZA 5IYBG 1VQMA 1RF2D 5JXVA 3C8YA 1NR4A 3DBRI 1W3SA 2MFIA 1V49A 2R2OA 2FIDA 2YTYA 1L7YA 5LXIB 1SNMA 4A3GB 4US8A 3ERQA 1PMRA 3TP6A 2EY5A 3ML8A 4J6IA 3G4SA 5C4JH 4JI5L 2NN6H 2ZPYA 1PV4A 1C76A 4YL8A 4ZYSA 3BYTB 1WX8A 1IGDA 3G7LA 1R7SA 2QMTA 2K14A 3HKSA 4A3MB 2VUMG 3L17A 1P0RA 3MXUA 2FUG1 3NPPA 4DK3C 3J80E 1UWMA 3Q3FA 3GOEA 1VQ5A 1HXYD 2R92B 3WOFA 2W55A 2ICIA 4N9TA 2BA0A 1XMOQ 3UE1A 2WU2B 3N9YC 1SJED 2MO1A 3UGBB 1NTGA 3RMKC 4MNOA 1YBYA 1VQHA 3KVFB 3OJ4B 4AYBG 1WJ6A 1CSPA 1WTXA 3SK4A 3PV1A 2WXIA 1H9JA 1MKHA 2DZMA 5LLIA 5BYRA 4WWMA 2UXDQ 5AFWA 1JOOA 3MHZA 2AL3A 1FGUA 1K8GA 3ZUNA 1L4DB 4AJYB 1U0LA 2LFNA 2C5CA 3ZXRA 2A68C 4XT3B 4ANVA 3K81C 2IGHA 2K39A 2RGFA 1XPOA 1BUIC 1S1QB 1L0XB 2KBNA 1C1YB 1FL0A 4AQYQ 2A74C 3S16B 2BS2B 4P16A 1STHA 1UEBA 2WXLA 4M0WA 4MH8A 1TY0A 1IYVA 2KTFA 3X3NA 2Y5CA 3S1QB 2BTEA 1V8QA 3K0XA 4O42A 1AEXA 4TQUS 4GDKA 3QIAA 2O5JC 4WJ3M 3PZDA 3GTKH 2ES2A 1WTRA 3RNAC 1L1OC 1ACCA 2D2QA 3M7GA 3SK5A 2F0KA 4X62Q 5I6YA 3CCEA 2E2JB 1ZW7A 4BBNF 5L37A 3URYA 3MXPA 3SK6A 2ZJQA 2KAJA 1MPEA 2B3AA 5HGQA 4BBNC 3K5OA 4DHJD 4NPSA 1EY4A 2F3WA 2PW5A 4C3JH 4LF8L 5GROA 4F1SA 4R3DA 1VCBA 1YVCA 2NWGA 3KQ4A 5BN4A 4ID6A 3KBGA 2KHSA 3TN2A 4Y7NH 3J7AF 1YOVB 5A2QL 4LF4L 2BF8B 2K5PA 4IN3A 2BKRB 4A3IH 5IGEA 2EYHA 2K9XA 3GE8C 2JA8H 1UZXB 2MBQA 3T51B 5IP4D 3TREA 2F0PA 4K8IA 1IGCA 4HCEA 1I94Q 2IX0A 1OEYA 2KLGA 5G3LD 3GV3A 1CKNB 3M62B 3PPAA 4R4IA 1P1AA 2PZTA 3PSEB 4POGA 1UH6A 4KDLB 3MXNB 3NXWA 4DR1Q 1UBIA 2QKIC 3DLLA 4CQNA 2XWBB 2G4SA 3UDFA 4LF6Q 4ME3A 3RMHA 1HZ6A 4MZ9A 5CHWA 3JSVA 5C4ZA 5FKAC 1LTBD 3TRZA 2EYJA 2QDBA 1F2RI 4KY7A 3K7AB 1KRSA 3FKIG 3S2HH 2K8BA 1SNPA 2RD0A 3WCQA 4MTNA 5E4WC 4LLGM 4K5XA 5CGKA 3A4RA 1UBQA 2OTLA 2WXQA 2K4KA 2IWHA 4NB3A 1HPCA 1OQYA 2EXDA 1BOSA 2GI9A 2N8NA 3VXWA 1TKEA 1A2TA 5M5XH 4IOAA 1CFMA 1PTOC 5DPSA 2HHHL 3GQBA 4ZAIA 1GHKA 1UEAB 5M5YH 3KDFB 1WZ3A 1HNZL 4XTCS 2Y0SB 3FPPA 4MJSA 3F2CA 5CV4A 4POFA 2ZJDA 2PIAA 3UQAA 5G5GA 2L05A 4LFBL 1WWTA 3M7NA 3Q8EA 4P2CB 3T56B 3PO2H 2R7ZG 4HJAA 1FO4A 5IE8A 4C3IB 3K6OA 4IUQA 4IUVA 5IOCA 3GTLH 1JJGA 3OWEB 4LNNA 5FLXL 3ZXVA 1VMPA 1D4BA 3N6RA 3KFUA 4UPAA 3AEAB 1HZ5A 3H94A 1BCPF 2IHEA 3D4DA 4KV6A 3TMEA 3EC8A 2RCFA 1BNZA 4Q0FA 2CKHB 1O7IA 3AMZA 3QCAA 5H92C 1R4QB 3QR8A 1OQRA 2JPHA 1E7ZA 2EYMA 1PFDA 1EIGA 2LGDA 2ZVNA 1KQSA 3STBD 2JY6A 2UUBQ 2EOTA 1B2TA 4ODGA 3J9CA 2F0OA 3HOYB 1WYWB 5CR3A 3A9JB 1PRTC 3LWEA 4US9A 2RR9A 1X55A 1ML0D 3RN2A 1VD2A 1WMHA 1Q7YC 3CRKC 3SEBA 1PYWD 3APCA 4C3HG 2BYFA 2LEKA 1QCBD 4F87A 4HCPB 5FLXc 3M4YA 3QWNA 1D7QA 1ZGUB 1L1OB 4ZHPA 2E2DC 1TJEA 5CV9A 3JVZX 3PHXB 4K8JA 3S24A 1TXYA 2KENA 3HOXG 2MP2A 1STAA 3CWIA 3D3RA 5LMUQ 3RCZA 2X38A 3U30A 4BKGA 2XVSA 2N9EB 3AU4A 3ERSX 1JALA 2B3GA 3CCJA 4A3LH 4FP5D 3M4QA 3HS0C 4RG1A 3SR6A 5J3BA 4MDKE 2X8XX 2B63B 1N5XA 3DVNV 1NCVA 1VQ8A 5CTRC 3P1MA 3NEMA 4DNRB 2BB6A 1V97A 3RNCC 3VR3A 4NQLB 1JT8A 1II3A 1X3FA 1K73C 1JWAD 3GZNB 3D6CA 4DK1A 1TS5A 3PUZA 4HMIA 2UXCQ 1WR1A 3M63B 3RPFC 4DAYB 5JVH3 1P16A 1GKHA 3VHTC 1TU2B 4YCWA 3H3VH 1H95A 4IPDA 4D2KA 2XRQD 2D2CC 2F0TA 1LXDA 3TMPB 2LXCA 3FDTA 4JYAQ 2N88A 2NTSA 2Z6KA 3AV8A 3VRBB 4B95A 2V4DA 2JYOA 2REXA 2EPBA 4XDDA 1PH6A 3DWAA 2FIFA 3Q2AC 3RI7C 2H4OA 1WIAA 5HI1A 2B2UC 4KGRA 3BDOA 5CBAE 5C3EB 1SYDA 4XT1B 1J8IA 3RYTA 4DR7Q 3S17B 3T16A 1E6EB 1K8OA 2KFKB 3ZJVA 1B9RA 4DUZL 1N9WA 2XGTA 2F4VL 1ET6A 2RVLA 1YZ6A 3S15B 2LZ6A 1O7LA 3SK8A 2VH1A 1GJXA 4X3UA 2EZVA 4KHZA 4JI3Q 4DQOC 3RNUA 5LNK1 3ML9A 2K5WA 3S2DB 2CW0D 3WDNA 1Q86C 1VRAB 3Q8AA 2WACA 5C44H 3K0YA 2BOSA 1ISNA 3G6EA 4CDDC 4FBJB 3PIPA 3AEFB 5CV7A 2HD3A 2LSSA 2ZCBA 2VUMB 1JICA 4OXPA 2E76C 3PUVA 2LHEA 2N7DA 2IY0B 2QHOA 2K22A 5IKCM 4M8MA 1GUSA 3FP9A 1SMYC 5EE0A 1WYDA 1YJNA 4DV1Q 3E9HA 3MWYW 1KLGD 1BCPB 3H7PB 3H6MA 4GNXA 1H9KA 1CZGA 4YY3Q 3Q14C 3HEJA 4CKEA 5T8IA 2AQ2B 3VR5A 4GOPA 5JEAG 2KJ6A 4G50A 4WQOB 4A90A 1D1IA 1YNJC 3W2DA 2F3VA 3MJ5A 1CZWA 3R3MA 1BQQT 5J18A 4AYBB 2RSOA 1TT5B 4JK1C 1VZ8A 2ZPNA 1OXSC 2PI2E 1WTWA 3PS6A 1PRTB 2WQYB 4BKSA 4QCLA 1WX9A 2HTME 1GNUA 4W9FA 2KN5A 2LJ5A 4UDUC 1I7HA 3GD7A 4JBMA 3I4OA 3DXJC 4PZ6A 3MFYA 4CBVA 2E2HH 1ASZA 5EKKA 2VNUD 2F1MA 3P7JA 3MFGA 5DPTA 1SSNA 5C4XH 3J81j 1F9JA 4DAMA 2NUCA 3E0JA 4HRSA 2ZXRA 3OMCA 4DAVA 3SU8X 1TWAB 4JBJA 1VQIA 4RHSA 3UINB 4ZQ3A 1TTNA 2FNJB 4NDXA 2NVQH 3MC8A 1WXMA 1PDQA 5JEAJ 3DHGC 3AFPA 1KAWA 3V96A 3MC9A 1WJ4A 4FA6A 1J5EL 1RTOA 3N52A 2AMCB 2GB1A 4DR2Q 3WAOA 4C2MH 2N1VA 1NBWA 3SXHA 2PEAA 3KUDB 2LKVA 1SIFA 3LXFA 2IZVB 1Q0WB 4GN4B 1GHJA 5IP9H 3VRAB 3W1SC 4N9PA 1D3ZA 5G55A 4LMQD 4OZBA 3K8AA 3R93A 4WIPA 2G5DA 2XRSD 4WWOA 5FK9C 3KUCB 3X0WA 3A74A 4B9WA 5E6JA 1CM9A 3GTQB 4MM3A 1C3TA 3R2TA 4K0KL 2EYLA 1WJUA 4QUCA 1FNVA 1EIHA 2E3TA 3S1MH 2ONQA 4F88A 3PVLA 2EIFA 2KDFB 5IWAL 4II2B 2D3GA 1S5CD 1WR6E 3PHWB 4GS3A 3DHQA 4CJ1B 5EE9A 3WOEA 2V9HA 4C1NK 3TEHB 2Z59B 2JA7H 3FKIB 3U9OA 4DXFA 4QJFA 4DV2L 3PRMB 1MBYA 5IYDH 1CHPD 4AH6A 4DR3Q 1PFNA 3VYTA 5C3WA 1R9TH 4IPHA 2HD5B 1R4NB 4M01A 4TUUA 1SMXA 4XC2A 2MGSA 5MPOA 2L00B 2NBVB 2IJ0A 4X66L 3P1HA 1YNND 3J7A5 3I4NG 2L5TA 4LF5L 3NVVA 3BS1A 3GDEA 1I5FA 1D5ZC 1KL9A 1DXMA 2IY5B 1NBFC 4K7SA 2BWES 3KWLA 2D0PA 1RHPA 4EGVA 3SVMA 4L1BA 1EYDA 1F77A 2MQHA 5KEEA 3HOWG 3I4MH 5JH5C 5EGTA 4NP5A 1Y56A 4A3DH 4P6VF 2QIEB 4OVUA 4DXAB 1WGHA 1R4PB 1UUPA 2R7ZB 2PCFB 1ONLA 1JMLA 2K6QA 3GB1A 3S1NB 2IO2B 3W1BA 2L76A 1ILQA 5IYCG 2I0QA 4HIOA 2MJEA 5M3MH 1AWDA 4IPCA 2H88B 1TWHB 1AARA 1UF0A 3ZLZA 1VQBA 1HFNA 2L11A 5M5WH 3GP7A 4BXXG 2FBWB 1TIID 3H8HA 4OIJA 2WKDA 1I4HA 4H13C
chains in the Genus database with same CATH topology
4C1NI 1J9OA 1S5ED 3I8ZA 2Z1CA 4CJ2C 4JE3B 4RF0A 2NVYB 4C3HB 3VA7A 2JX5A 1DOLA 1G6ZA 3VYRA 4OIKA 3GTJB 2BW2A 4V0BA 2DLBA 1VDZA 3BK2A 3IAS1 2B2YA 5FO8B 1RKNA 4V190 4BY7B 2BS3B 1VZ7A 1E2ZA 1MI0A 1VCIA 4Q5VA 1JWBD 1VR9A 4U68A 1CHQD 1RODA 3ND8A 2DYMA 2B2TA 4OZCA 3K58A 3H09A 2DNCA 1ICWA 5CV5A 2IT1A 2IDYA 3E56A 4HEDA 1EEID 1W6KA 1PUTA 3B2GA 1WSPA 1L0YB 1Q1EA 2FINB 2MHVA 1XYIA 2HUGA 4KY5A 2NN6G 3NHHA 3I4LA 5E3FA 4JX1C 5J1ZA 2WLBA 2SNSA 1I4GA 4H7BA 4L63B 3NTHA 4IUPA 2BDOA 4WAFA 3QOLA 1OXUA 1ZYRD 1SF0A 4HJGE 2WXFA 5EKIA 2J7ZA 4XDXA 4ZUJA 4IDIA 1IUEA 1HTPA 1FMAD 3KLSA 1HA6A 4CJ0B 5CBEE 1BBXC 3IXSA 5ELBA 3SR1A 2L12A 5BMIA 1E10A 3MHBA 3KLRA 5I9OA 1SNCA 1DD2A 2CQAA 1IW7D 2XIWA 1TWFB 1X3QA 1DONA 3NVWA 1D1KA 1TVXA 4J3OD 3IFDA 3SFDB 2R61A 4C3JG 1NAPA 3ETRA 1JQ4A 1PXUA 2DY8A 2QSDA 1E2WA 1LABA 2PPBC 4QB4A 2Q8TA 1P7EA 2LMCB 3RZOB 2LGIA 2I2YA 3IAYA 3ONAB 4J6HA 1JC7A 3VYUA 4MN3A 2MUYA 3I72A 3PZ8A 1BXTA 1GUTA 2JYEA 3EA6A 3E6ZX 1KF6B 1KAAA 3OOCA 4JBWA 2F0VA 3RLFA 4B0MA 4YIJA 3PIO3 5K5PA 1SEBD 1TT2A 1NENB 3BIID 2KWDA 1PFBA 4DK0A 1PLFA 5AUIA 2F03A 1TR5A 4YSXB 4E6IA 5K36H 4C7ZA 3EGRA 5EBCA 3MEHA 1YN3A 2KEDA 2JEAI 1K83B 3I4NB 1RWSA 2MPMA 1QE6A 4CHTB 2LFIA 1WD0A 5IGGA 4QF4A 5C4HA 3SFEB 2BCOA 3HOWB 1JW9D 1ESFA 4OO1H 1QT9A 1EM7A 3CRLC 3BVMA 4ZK9B 3CU7A 4HEA1 3FMCA 1TWGB 1MGSA 4HKZE 1RYJA 4OZAA 1G91A 5NUCA 1EZ8A 2EYOA 3HZXA 2L4NA 1KDBA 2F4IA 4F7XA 2CW0C 4TQ1A 3Q8BA 3O13A 4K14A 2OEOA 4DXGA 4L6TB 2J53A 3TEZA 1TKYA 1HQMC 2E74C 4A6QA 2SDFA 1SE4A 1G291 4IFDH 3AE9B 3NSWA 2V3NA 2JU6X 3AE3B 2JEBI 1OXVA 1TS3A 2F0IA 3DM1A 1SYFA 1YN5A 1QNKA 1EY8A 1ENAA 4NMZA 2V3PA 4KD3A 2PNRC 4HKQA 2QF7A 1VLBA 1F9SA 1FD6A 2B2WC 3NE5B 3IAM1 2ZT9C 3JAME 1DM0B 2Z4IA 2WXOA 3AE2B 2PO4A 4OVZA 1TWCB 4OHJA 5C4JB 2WS3B 1IBXB 3E5SA 4RH6A 2B39A 1Q8IA 1OO9B 2L9HA 1HTLD 1Y8OB 5HURA 1YQ3B 2K0PA 4PMWA 3M85A 2N0SB 2MJDA 4H2AA 4HCSA 2GA4B 2KN4A 2DN8A 5EJWA 2JXTA 4ITKA 3UI2A 3AMUA 1DOMA 2KA7A 1E0BA 1XLNA 2C9OA 2CU3A 5BMHA 2F0LA 5EPKA 4K6DA 3NTIA 1DZ1A 4JWUC 5CV8A 1X3PA 3Q23A 3Q24A 1XLOA 2D5DA 1IL8A 1RTNA 2CVRA 2NBFA 1SB3C 3TDQA 4WJWA 1N61A 4YSZB 1YNNC 4WFN3 2M2LA 4K6LA 4U673 3P75A 2PKOA 5I4DA 5FO7B 1LLRD 1QNUA 4C3JB 1L4ZB 3C1EA 5KNDA 2MP1A 4AQ7A 3OIQA 4Y7NB 4S3SA 4RCNA 1QILA 4A3IB 3PUWA 1QOHA 2JA8B 5EE3A 5HHDG 2G9DA 4GZYC 4IUTA 1PZID 1BCPC 2KCCA 5I2YA 1RJTA 1MHXA 1X32A 1STGA 3HRZC 2X6LA 1D5XC 4TRDA 3S2HB 1V43A 4KY6A 1G2TA 3FILA 2I07B 1FGBD 1AP0A 1QF6A 1WXQA 4WRDA 4ZOHC 2X69A 4ILWA 5M5XB 2JE6I 1FXAA 1MHHE 5M5YB 2WXHA 1BO0A 5CYUA 3QO2A 3U2SC 2AQ3B 1TS2A 3A8KE 1VJKA 3VR4A 4B0EA 4ABNA 3PO2B 1F2ZA 3GTLB 1B1ZA 3R8BA 2AQ1B 3QJYA 3KBXA 2BS4B 1CQFA 3V3XA 1MVKA 1CTMA 4HAEA 1PTOH 3OIPA 4I65A 5BN3A 1F9RA 4N58A 2JZPA 1QJOA 4MM3B 1EL0A 1V1PB 2B2VA 3HVZA 1JRPA 1ENCA 5M9OA 4M1UB 2KQ4X 2QJLA 1LACA 3MC0B 5JPNC 1XXGA 3NVYA 5J22A 4NZLB 3NQIA 3CHBD 2SNMA 4MT5A 4KTAA 1ZYRC 1G8ZD 2V4IB 4WH4A 4LTUA 5HGTA 1EY6A 4REZA 1CI3M 2BE5D 3BG3A 3MXNA 2XSCA 2ZXPA 1V8CA 1UGJA 2EY2A 3IT4B 3FEWX 5IGCA 4ZRZA 1MSGA 1C4AA 4YTPB 2MEKA 1EFID 1TS4A 2PTLA 3D4RA 1OXXK 1A3TA 2QILA 4K2LA 1O80A 5C0XH 2RDGA 2R3ZA 2AX5A 2L55A 2H89B 4DFAA 2DY7A 3HUIA 4KGTA 1A2UA 2O5IC 3A8JE 5GXGB 2Q5WD 2WXRA 2WIIB 3HG9A 1CA6A 1IW7C 2NN6I 3A54A 1QOFA 3K5LA 5ELCA 1I6VC 3QG1A 2Q8RE 1C4QA 3NWTA 1OXTA 2JXMB 1HFGA 1GUWA 5LHY1 1HUNA 5D3DA 1EWHA 4GDLB 5DAUA 5C44B 2K7VA 4FVMA 3HRDD 3DEOA 4B08A 2FFKB 3VA5A 3W5UB 3NWSA 2J42A 5KRUA 3VR8B 3LNNA 1JORA 2QCPX 2WU5B 1CZPA 2PMZB 3TSSA 4HSPA 5BYSA 1KDAA 4X3SA 1ZXHA 4FXKC 3DUZA 1WTOA 3PUYA 3QOJA 2PLPA 2D62A 3W9CB 5EBDA 4XWWA 2K04A 1SYCA 1ZOYB 3EROA 1ZDXA 2XWJB 3BVGA 2KOLA 2WXKA 2E2HB 3NP8A 2F0UA 1N5WA 3TEWA 3T4AC 4IQZA 5IGFA 1ROEA 4C7YA 4BWGB 2N7JA 1WTPA 1FCLA 5C4XB 2K32A 4PNYA 2MJ3A 3A7AB 3P63A 1TQOA 4DAYA 4ZUIA 5IT9E 1FEHA 2RMMA 2NVQB 4RKBA 4IUNA 3D8GA 4X3KA 2HDLA 2EVBA 2RPVA 2AWNA 2PW9A 1KDCA 1Y8PB 4BA2I 2F0NA 3TZDA 2WAQB 2SOBA 1JWMD 3AEBB 3NUHB 2FHTA 3R3OA 4C2MB 1B4OA 4FF3A 1AN8A 2KACA 1E0ZA 4A55A 1SIJA 3EQLC 1I4XA 1ENFA 3T53B 1NVID 4X3TA 2OT2A 1I4QA 4OGQC 1DGJA 5BYQA 3V2TA 3ZQ4A 1EU3A 4NAMA 1G2SA 5JVG3 2IGDA 1F2LA 3S1MB 1PTOD 4R8NA 5BMGA 2BA1A 2Y3AA 1LO5D 2N55A 3AE8B 4KKJA 4ME5A 2A69D 4KK7A 2IX1A 5FO9B 2JA7B 4ZRPA 1SXTA 3Q22A 3IL8A 1R9TB 4B9XA 5K36G 3TP8A 2WKCA 3C3LA 1H9SB 4RF1A 1WD1A 3HOXB 2ICEC 2ZW0A 4WORA 3I4MB 2L0CA 4OO1G 2M9VA 1HUMA 4A3DB 1K53A 5JOBA 2FMMA 1NSNS 4GLSC 3LWUA 1YQ4B 2N9LA 4HN7A 3KLSX 1SJHD 5M3MB 4IKGA 4TMAB 4MHEA 1PFMA 2KJXA 5M5WB 1DOKA 3NRZA 5BN5A 1UAPA 3K5MA 2RQXA 2INNE 4NW2A 4PMCA 4LJZC 1M8AA 2K33A 2BYTA 1Y8NB 2K28A 4DU9A 3Q0AA 4H0LC 4IFDG 2CJOA 1VMCA 2EDGA 2B8GA 4QIWB 4A3JB 1NI3A 2L32A 1WTVA 2B2UA 3T3NA 4A3BB 3Q8CA 1SDFA 1A6XA 3L4PA 1T5XD 1IKMA 4PV1C 4BY1B 1JQYD 1Q90A 2WXMA 1PGBA 4KMUC 2I46A 1HRJA 4KN4C 2AUKA 2FMCA 4Z9CB 2RBMA 4JWSC 4PMBA 1LT4D 2KVMA 4DNTB 5E4XA 4IFDJ 2PVOD 1GPXA 1VZ6A 5DM63 1Q12A 3EFXD 4KKIA 1C78A 1MSHA 2FJ2A 4IUUA 3DWGC 3P4RB 1I50B 1STNA 3J80L 1SMYD 3ITPA 4IZ8A 1KFYB 5KIXA 3GTOB 5CC4A 3NUCA 2A6ED 1ZEQX 1SNDA 2WINB 1QB5D 4XXEA 2ACZB 5COYA 3K59A 1YNTE 4LK1C 4M8AA 3JAML 5C5MA 5M3FB 3VYSA 3SDZA 1U4RA 4UAIA 1NUCA 1DOYA 4BA1I 3NVZA 1U4MA 2Z8LA 3C46A 1A3UA 2E75C 2NMQA 1RDPD 1E2VA 1TKGA 4A3KB 3OPOA 2H1EA 3PZ7A 1IKLA 1C9FA 3TP7A 1FNUA 3PUXA 4GDKB 3W1SA 1STEA 5DM73 5T1GA 1RM6C 5FR3A 3KF8A 3PMFA 5ELDA 1JOQA 2DWQA 1AFPA 1T6BX 2Y5PA 2EJGC 3PO0A 4ARCA 5IIFA 5HG2A 3DWMA 2KDMA 2WXJA 2PYKA 4FF1A 3D4WA 3HP3A 4QUFA 1E7PB 2NB0A 2TMPA 1I3QB 1Z7TA 2O4XA 2WXPA 2INPE 2HQEA 3NBHA 1XWEA 2G9HD 1KTKA 2WP9B 1JROA 1XTCD 1FNWA 2J4XA 1S5DD 4DF7A 1FFVA 3M4OB 1D2BA 2K01A 4TSSA 3AB9A 1O7ZA 5JPMC 2OXPA 5KGUA 3K57A 3LX0A 4TKOB 3RUZA 1JCKB 4YTMB 3C2PA 4YTNB 2M19A 2BE5C 3J81E 2WDQB 2WNMA 5CMDA 4DA2A 1T5EA 3S1RB 1EWCA 1HQRD 1EU4A 2W3SA 1WVLA 3PIP3 4H44C 3T3OA 3W3AA 1XCTL 1ZPSA 3IT6B 3GTPB 3GTMB 3OHXC 1BMLC 2NVXB 1DOIA 1ZUD2 3NZ3A 3HOZB 4N59A 3F2UA 5JJZA 4Q2JA 1S4ZA 3I73A 4TQ0A 1GUNA 2IX3A 1FYCA 5EKLA 1FIQA 5C3JB 1N62A 3GO5A 1H9RA 1KNEA 3AU7A 1ZE3D 5LL6X 1AYFA 1RFKA 3FILB 3DMUA 4L23A 2OEDA 1LT3D 1B9NA 3EJIA 4DAPA 1Y1VB 2LMCA 1JOKA 3J7YW 2VZKD 5EQ0A 1S5BD 5EPLA 4BBRB 1J7CA 3K5NA 4A3FB 3NTKA 1MD2D 1VF7A 1QOAA 1CQVA 4G7HC 3BDCA 1TZOA 4K5WA 1XLQA 1L6UA 3BK1A 3I57A 1QG7A 5C0XG 2BBCA 3B2FA 1DYQA 1BUVT 1HHVA 4AS1A 4G4KA 4A8XC 4XQJA 1IHZA 4HROA 1Z47A 1K8MA 1EY9A 2VXWA 2EYFA 4KI0A 3FC4A 4R9WA 5T1IA 1C77A 1K50A 5EE1A 5LL6S 1QWYA 1SFOB 1SBBB 1VDVA 2WXNA 1B9MA 1C4PA 3FVQA 3DEPA 1FRDA 2WDVB 1STBA 2NZ1D 3SE0A 1HA5A 1GB4A 3NK9A 4KHVA 2G1EA 1N60A 5FOBB 1Q1BA 1B53A 1PGXA 5C0XJ 4RAUC 4LK0M 3GTKB 5J39A 2DYOA 1BF4A 2WP8J 4JPSA 4XDCA 3NBIA 1UNSA 4EE2A 2CHBD 4A3EB 2K1BA 1LV9A 1W6JA 2J52A 3W5VB 1SYGA 1J7BA 2D9UA 1KH0A 3J7AV 2K05A 2D5GA 1LTAD 1XEEA 2MH7A 4XE0A 2BDNA 2N9KA 3E9SA 4WURA 3AE6B 4KN7C 3D6WA 4KGSA 1XF5L 2QEJC 1RD9D 1AZQA 1GOZA 2A6HD 3AEEB 1PTOF 3H3VC 1ZXTA 1GXDC 3AE7B 2LY7A 2A69C 2EY6A 3OSOA 1WGKA 1PGAA 5I2XA 4N6EB 3ZYYX 1ILPA 3GTGB 1GAQB 1UWXA 3CKIB 3MAQA 1A15A 1XO3A 4OW0A 4L2YA 2PMVA 3KK7A 2B2YC 1PRTF 5KYIA 3IFTA 4ZRQA 2EJFC 1PDXA 1A3VA 1BDOA 3MA2B 2K5DA 2JYTA 1FD7D 2F0DA 2L52A 4RGOS 4J1MA 1ZDVA 2AWOA 3I90A 1IBXA 4KKSA 3U9SA 1JE4A 4FF4A 2B2TC 4F8MA 1WRIA 2KUMA 4O1NA 2K6AA 1XX8A 2EY1A 3EVQA 2RDFA 5AUKA 1LTTD 1SSOA 3L7ZC 1I4PA 5DEHA 1YMHE 4I7ZC 5IT9L 5D7GA 4CKCA 5JAVA 2L1BA 1U4LA 2HCCA 3HKZB 5I6WA 1O7YA 2R6GA 3S14B 3C1FA 4EVOA 1TY2A 3KUPA 1NR2A 4EQNA 5KNCA 1AZPA 3AB5A 2JSOA 4XWTA 2CJNA 2EYPA 5A2QE 4OO1I 2NVTB 2HDMA 3V05A 1C79A 1NYQA 1Q10A 3HGBA 2K5QA 3EUB2 1DJRD 3P42A 3TEXA 1QOGA 3TEYA 1K51A 4RWSC 1KLUD 1J7AA 1TYGB 4HSVA 3TP5A 1FRRA 1PTOB 2EJMA 2M0AA 3L9AX 1F2YA 1OQQA 3MVVA 2ON8A 3HVDA 1LTRD 3R2IA 4FYDA 1D6EC 5ELFA 4IURA 2ENBA 2F0HA 3AE4B 3X3MA 5KNBA 3OW7A 3T13A 4K2KA 1WTQA 5ISRA 2GRIA 1EWYC 3PO3B 5C3XA 2W54A 2WV6D 4IFDI 3NS1A 4ULLA 2R93B 3I70A 3LYYA 1HCZA 1Z6HA 4MACA 3Q6SA 1Q3LA 1PZKD 3AEGB 3TZUA 1C4CA 3BZDB 3H91A 4EQPA 1YJJA 2RA4A 1JWSD 1WCMB 1FXIA 3AEDB 4ZKCB 2A6EC 2RKSA 1PZJD 5IODA 1NYRA 4MIUA 4RGNA 4CGYB 5HFYA 3VQIA 2B2WA 1SYBA 3MZ5A 5FLXE 2JA6B 1P7FA 1H9MA 2O2LD 2I38A 3RD4A 1EY5A 5KYLA 4HMJA 3A8IE 4A93B 4EQOA 2A68D 3HOUB 4FXGC 3MP9A 2IPKD 1B50A 1TKWB 2TSSA 1L5PA 2WXGA 2F0JA 4YT0B 1HEZE 2WDRB 1B44D 4LAAA 5F2DA 3ABVB 5D65A 1STYA 3VR6A 2RDHA 4BBSB 3Q8FA 1QQRA 1EYCA 2FE8A 2SAKA 1FR3A 1JB3A 2PZUA 4KD4A 3UI3A 4C80A 3CIRB 3VR9B 4RKLA 2KMMA 4XYOA 3S9WA 1XCQL 1M4VA 1V1PA 1SNQA 2F0MA 3P4QB 1AW7A 1EEFD 5IGBA 2BB5A 1JR0D 4KKTA 1V1OA 2WB1B 4OL7A 1Y69U 1FFUA 1CJEA 4XQQA 5D14A 3ZJTA 5TSSA 1QLBB 2HDEA 2L83A 1L0VB 4YXDB 2F0QA 1D5MC 4FNFA 1S5FD 5D3IB 1KABA 2PZWA 4HR7B 2ID0A 2E6XA 4BS9A 2EE1A 3CQZB 1RCVD 2MJ8A 2DNEA 3GS2A 3OMGA 3BYYB 5I9PA 5H8YE 4FF2A 3FRPB 4IOIE 3P4SB 1I6HB 2VB3X 4KKUA 4HTHA 1MI2A 2A73B 1BCPD 2LUMA 2Q8IB 1L6VA 4RGMA 4G7OC 4NJCA 3ZJUA 3G6JB 4R8IA 2K3UA 5C5LA 1PRTD 2E2IB 5IGDA 2KEEA 1LTGD 4FO2A 3ND9A 1N63A 5C2TB 2B76B 2J0TD 1YJIA 1F9QA 1EQVA 1IYUA 2ZXOA 4RGTA 2F0SA 3BVZA 3FAHA 4QMGA 2JP1A 1F2RC 1U4PA 4L8JA 1ESRA 3I9V1 4NKLA 1KNAA 1DOXA 2NYZD 3VR2A 2M00A 1QKZA 2PW7A 1JWUD 1YN4A 5G5HA 3RFZB 3FPUB 3DWQA 4C56C 1EY7A 1C48A 4DN4M 4USAA 1LTID 1EQTA 2XNAC 4YSYB 4XIGS 1E9MA 2W3RA 3AN1A 3DWPA 4J8QA 4YWGG 5JEAH 3I3CA 1DCZA 2IL8A 2F0FA 4WQMA 1SYEA 1F2MA 1VF5C 3GV6A 5EPJA 4ZKBB 2LHDA 2LJIA 3RZDB 2DBYA 5E1FA 2A5HA 2F0EA 4XYQA 1GUOA 2PVGC 5CORA 4FXDA 2EXZA 3BWUD 2SEBD 3J81L 2ZW1A 3P4PB 5ELEA 1GB1A 4RA8A 2JSVX 5G3LF 2V0GA 2YEPF 4PT5A 4CKBA 1EY0A 1KRHA 4RCOA 2B8FA 1QOBA 1I4RA 5C0XI 1B3AA 4IALA 3B9JA 4KJNA 4RHRA 1EZ6A 3TBIB 2VB2X 1YNJD 2IGGA 4KJOA 2BT6A 3ZGZA 5A35A 1FM0D 3OWFA 4ARIA 2W82A 2JQRB 2A6HC 3QB3A 3L3OC 2X6GA 2JWUA 3M3YB 3U4EG 3MTSA 3AECB 1K52A 2K03A 4NAWB 3A56A 4G7ZC 2Z4HA 3AE1B 3U52E 1H9SA 2F0WA 1O78A 2EELA 1LT6D 4C3IG 2VZKB 1Y1WB 3HOVB 3KWVA 2M56B 4ZLTF 1ET9A 2KCNA 4K5VA 3NQTA 1BR9A 2NTTA 4KX6B 2EKIA 1U9RA 2OF1A 4G57A 2LS01 4A9AA 3LB8C 1NEKB 5DNFA 1GUGA 4XQNA 2F0GA 2YU9B 1SNOA 2IW3A 3U7ZA 1C8CA 2YYZA 3SHLA 3Q69A 2RSNA 1SE3A 3A55A 2OHFA 2XN9C 3AE5B 1T3QA 1CT1D 1SAPA 2HCIA 1CA5A 5CV6A 1OFFA 4FXCA 1LT5D 3AM9A 1ZP0B 4PQXA 2AUJD 1A70A 2JA5B 2KECA 3AH7A 2B2VC 4RNAA 3TUOA 1WYGA 2YEPB 3IKJA 3PV0A 1XLPA 4DGZA 5C6AA 1CK1A 3P20A 2PQEA 2L1AA 3BDLA 1F9PA 1ZKOA 3I91A 1EOTA 1EYAA 3D31A 3MXGA 4RFBA 2KQ3A 3A7LA 1FCCC 1SE2A 4ZHOA 3H0GB 1LTSD 1ZXIA 1F0ZA 5JXVA 1RF2D 3C8YA 1NR4A 1SNMA 4A3GB 4US8A 3ERQA 1PMRA 3TP6A 2EY5A 2NN6H 1C76A 4ZYSA 3BYTB 1IGDA 3G7LA 1R7SA 2QMTA 4A3MB 3MXUA 2FUG1 3NPPA 3J80E 1UWMA 1HXYD 2R92B 3WOFA 2W55A 2ICIA 4N9TA 2BA0A 3N9YC 2WU2B 1SJED 1WTXA 3SK4A 2WXIA 1H9JA 5BYRA 4WWMA 5AFWA 1JOOA 3MHZA 1L4DB 2LFNA 2C5CA 2A68C 4XT3B 2IGHA 1BUIC 1L0XB 2A74C 3S16B 2BS2B 4P16A 1STHA 2WXLA 4M0WA 4MH8A 1TY0A 1IYVA 3X3NA 2Y5CA 3S1QB 2BTEA 1V8QA 4O42A 1AEXA 4TQUS 3QIAA 2O5JC 1WTRA 1ACCA 3M7GA 3SK5A 2F0KA 2E2JB 5I6YA 3URYA 3MXPA 3SK6A 2KAJA 1MPEA 3K5OA 1EY4A 2F3WA 2PW5A 4R3DA 2NWGA 3KQ4A 5BN4A 4ID6A 3KBGA 2KHSA 3TN2A 3J7AF 2K5PA 5A2QL 4IN3A 2K9XA 5IGEA 2EYHA 3T51B 2F0PA 4K8IA 1IGCA 4HCEA 2IX0A 5G3LD 3GV3A 2PZTA 3NXWA 2QKIC 4CQNA 2XWBB 1HZ6A 3RMHA 5C4ZA 5FKAC 1LTBD 2EYJA 2QDBA 1F2RI 4KY7A 3K7AB 1SNPA 3WCQA 5E4WC 4LLGM 4K5XA 5CGKA 2WXQA 2IWHA 1HPCA 1BOSA 2GI9A 1TKEA 1A2TA 1CFMA 1PTOC 1GHKA 3GQBA 4ZAIA 1UEAB 4XTCS 2Y0SB 3FPPA 5CV4A 2PIAA 5G5GA 1WWTA 3M7NA 3Q8EA 4P2CB 3T56B 1FO4A 4C3IB 3K6OA 4IUQA 4IUVA 5IOCA 1D4BA 3OWEB 5FLXL 1VMPA 3N6RA 3AEAB 1HZ5A 3H94A 1BCPF 3D4DA 4KV6A 3TMEA 1BNZA 4Q0FA 5H92C 3AMZA 1R4QB 1OQRA 2EYMA 1PFDA 1EIGA 2EOTA 1B2TA 4ODGA 3J9CA 2F0OA 3HOYB 5CR3A 1PRTC 3LWEA 4US9A 1ML0D 3CRKC 3SEBA 1PYWD 4C3HG 2LEKA 1QCBD 4F87A 3M4YA 3QWNA 4ZHPA 2E2DC 1TJEA 5CV9A 4K8JA 1STAA 3CWIA 3D3RA 2X38A 2XVSA 1JALA 4FP5D 3HS0C 3SR6A 2B63B 1N5XA 1NCVA 3P1MA 4DNRB 2BB6A 1V97A 3VR3A 1II3A 1JWAD 3D6CA 4DK1A 1TS5A 3PUZA 4HMIA 3RPFC 5JVH3 1TU2B 4D2KA 2XRQD 2D2CC 2F0TA 3VRBB 3FDTA 2N88A 2NTSA 3AV8A 2V4DA 2JYOA 2EPBA 4XDDA 3DWAA 2H4OA 5HI1A 2B2UC 4KGRA 3BDOA 5CBAE 5C3EB 1SYDA 4XT1B 1J8IA 3S17B 3T16A 1E6EB 1K8OA 3ZJVA 1B9RA 1ET6A 2RVLA 3S15B 1O7LA 3SK8A 1GJXA 4X3UA 2EZVA 4KHZA 4DQOC 5LNK1 2K5WA 3S2DB 2CW0D 3WDNA 1VRAB 3Q8AA 2WACA 3K0YA 2BOSA 3AEFB 5CV7A 2VUMB 1JICA 2E76C 3PUVA 2LHEA 2K22A 1GUSA 1SMYC 5EE0A 3MWYW 1KLGD 1BCPB 3H6MA 1H9KA 1CZGA 3HEJA 4CKEA 5T8IA 2AQ2B 3VR5A 5JEAG 4A90A 1D1IA 1YNJC 3W2DA 2F3VA 3MJ5A 1CZWA 1BQQT 4AYBB 2RSOA 4JK1C 1VZ8A 1OXSC 1WTWA 1PRTB 2WQYB 4QCLA 2HTME 4UDUC 1I7HA 3GD7A 3DXJC 3MFYA 4CBVA 5EKKA 2VNUD 2F1MA 3P7JA 3MFGA 1SSNA 2NUCA 3E0JA 4HRSA 2ZXRA 3OMCA 4DAVA 1TWAB 4RHSA 4ZQ3A 4NDXA 1PDQA 5JEAJ 3V96A 1RTOA 3N52A 2GB1A 3SXHA 2LKVA 3LXFA 1GHJA 3VRAB 4N9PA 4LMQD 4OZBA 3R93A 4WIPA 2XRSD 5FK9C 4B9WA 5E6JA