2NTTA

Crystal structure of sek
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Staphylococcal enterotoxin K
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nttA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nttA01
3EA6A 2NTTA 1MD2D 2AQ2B 1I4GA 1LT6D 1LTAD 1YN5A 3BVMA 2WV6D 1ET9A 1JWMD 2CHBD 2Z8LA 2RDHA 1DYQA 2IJ0A 1PRTB 1QILA 2XRQD 3URYA 1SE3A 1T5XD 1B44D 1FNVA 3MFGA 4RGOS 1TY2A 1LLRD 1CK1A 1SE2A 3DWQA 1YN3A 1S5CD 1I4QA 1PTOB 2O2LD 1S5ED 1LO5D 3TSSA 5FKAC 1KLGD 3BZDB 1FNWA 1S5FD 1G8ZD 3GP7A 1PYWD 1PTOH 1BXTA 1FNUA 4RGNA 1JQYD 2SEBD 1JWUD 1LTTD 4RGMA 1EU3A 4RHSA 3BVZA 1I4HA 4DXGA 3BYYB 1PTOF 5I4DA 1PRTD 1D5ZC 5ELDA 3R2TA 1RF2D 1CHQD 1EEFD 1M4VA 1BCPB 4C56C 2R61A 1SE4A 1S5BD 2XN9C 1ESFA 1SJED 4L6TB 1S5DD 1BCPF 1I4PA 1XXGA 1JWSD 1I4RA 3DWAA 1CT1D 1V1PB 3V05A 1RD9D 1LTSD 1EFID 1PZJD 1BCPD 1HA5A 3BVGA 1LT5D 1BCPC 1KLUD 1JR0D 1I4XA 1TY0A 5ELFA 5FK9C 1PTOC 1DJRD 4RFBA 3SEBA 1AW7A 3CHBD 1V1OA 2QILA 1PZKD 1AN8A 1LT4D 1JCKB 1RDPD 4BWGB 1SBBB 2XNAC 1YN4A 3DWPA 4ZYSA 4OHJA 1CHPD 1ET6A 1D5XC 2ICIA 3O13A 4RGTA 1PZID 1SXTA 2AQ3B 1XTCD 2XRSD 1TS2A 2NTSA 1PRTF 4O1NA 1LT3D 1PRTC 4NZLB 1L0YB 1V1PA 4TSSA 1HQRD 4L63B 1UUPA 4RHRA 1CQVA 5D3DA 4RCOA 1TS5A 3BYTB 1LTGD 3R8BA 1EEID 2G9HD 1B1ZA 5ELEA 1UNSA 3MC0B 1TS3A 4RH6A 1D5MC 3R2IA 1RCVD 2QEJC 1KTKA 2AQ1B 4Z9CB 1GOZA 1SEBD 1F77A 1HTLD 1LTID 3KLSX 5TSSA 4DXFA 5D3IB 1L0XB 1TS4A 1HXYD 1EWCA 2RDGA 5ELBA 3OWEB 4UDUC 1SJHD 2J4XA 1LTBD 1LTRD 1PTOD 3W2DA 1EU4A 1FD7D 1ENFA 1FGBD 5ELCA 4K6LA 1STEA 2IPKD 2TSSA 3EFXD 1D6EC
chains in the Genus database with same CATH superfamily
1VQMA 3QCAA 3ER0A 3J80i 1WMHA 3QK0A 4U673 4CQNA 1ZOYB 4YL8A 5CORA 1SFOB 2VB2X 3M7GA 1VLBA 2Q2HA 3M4YA 4UY8C 4JOIA 2JYTA 1D7QA 3AU4A 4IKGA 3CP0A 4EQOA 1TVXA 1PFBA 5E4WC 4G7ZC 4EZLA 4URKA 3C3LA 3KFUA 2QDBA 5CV4A 2K22A 1O7YA 2IT1A 4BXXG 2F0HA 3HS0C 4OX9Q 3HVZA 3J7AF 4TVAB 3DXJC 3CCSA 1EQTA 3PTFC 1UZXB 1IBML 4YSYB 1TKEA 3GQBA 2JQRB 1A3TA 2HTME 2BA0A 4MTKA 2ZTEA 3UE0A 2K6AA 1PV4A 4G4KA 1C1YB 2I1KA 2E8GA 3D4WA 2ENBA 4DK1A 4HIDA 1SSNA 5DPTA 3FMCA 3CCQA 2RBMA 4KKJA 4FF1A 1CZWA 2UYZB 3F2BA 2W54A 2XSCA 3U4VA 2R7DA 1L2NA 1MI0A 4KGSA 1J7AA 1BCPF 3VTVA 4ZK9B 4ICVA 1HFGA 3DPDA 3MXNB 1NBFC 1QWYA 2KDEB 1QCBD 5I6WA 5LMNQ 3AE7B 2KDFB 2WLBA 3SFEB 1IW7C 2JF5A 4GDLA 3VR5A 5KEEA 1P1AA 4IUNA 1RTOA 1FVIA 2CW0D 2Q8RE 3NENA 2LXAA 2NBUA 5CHWA 2ACZB 2BH8A 1VQPA 1QUQB 2EXDA 2M00A 4K5XA 2M4NA 3AB5A 4A90A 4DAYB 5DM63 2IX0A 3SGIA 3AE3B 3E0JA 1I35A 2FCSA 2N7DA 2EJMA 4MH0E 2CH4A 5IWAQ 2PI2A 2C5CA 1HHVA 4DA2A 4A75A 4L5TA 2RVLA 1H9SA 4ZYSA 4OO1G 3AB9A 4KKSA 1S3OA 1WXVA 2UUCQ 2G4DB 4W9KA 5E4XA 4Q5VA 4RGTA 2B2YC 3UINB 1TWGB 3IFDA 2GBMA 4LLGM 3ZJYC 4JE3B 5EE0A 1GG3A 5CTRC 4DWFA 4P16A 3PGZA 2R93B 4AJYB 2L3ZA 4JYAQ 1QOHA 3A0JA 2UXDL 2C7NB 1DXMA 1E9MA 3VR2A 4AIMA 1QOAA 3CSTA 3L13A 1LTGD 4JV5Q 3N3KB 5CMDA 2KWDA 1OXTA 3ENEA 2LVOA 2K52A 3WDNA 3GTMH 2CU1A 3WA0A 2B2TC 2L5TA 2J0TD 2WACA 1EY7A 1VS0A 5TR5A 4FHKA 2E74C 1GOZA 1OTCA 1WX8A 4JWSC 4YIJA 2N3SA 1ZKHA 4DQOC 4DNRB 4N6EB 3I3CA 1FCLA 4K5WA 3J80E 1PVOA 3NP8A 4OO1I 1E3PA 1Y56A 2YLMA 2KX0A 3QIAA 4YTNB 2B2TA 2FMMA 4GKJQ 1SNDA 3GTLH 4X66L 4K6LA 1VQJA 2WXIA 2CWAA 2IPKD 1TQOA 1KDCA 2SAKA 2B63B 1YVCA 4LJZC 1DOMA 2NZHA 3AEEB 1IBXB 2B3GA 5KGUA 1HNXQ 1HNWQ 3CCMA 1EF5A 1HFNA 1VR9A 1WE7A 2EZVA 2ZJPA 1NMGA 2PMZE 3U50C 2J42A 2K32A 2JY6A 4IM0A 4KVGB 3S15B 4HJ7A 3PZ8A 2MNAA 4A3JG 4JI0Q 4FBJB 4JI8Q 3IT4B 4KV2A 1Y8RC 2CU3A 4HIMA 1PYBA 2EJGC 2WIIB 2Z6KC 4J8QA 4ILWA 4YHHQ 2KCNA 3I7FA 3I73A 2D07B 2F0SA 2Y3AA 3UDFA 3EGRA 1WFYA 4PZ8A 1F9JA 3K80C 1DOIA 4NJ6A 3DBLB 2ZTDA 4JVZA 4K1RB 4N9TA 2BS3B 3A54A 4N58A 1OGWA 1EL0A 3OJ4B 1PGBA 4MT5A 1K3RA 3SR6A 2LWPA 3ZNGC 3JAME 4E71A 1Y1WH 1MG4A 1S5DD 1YNXA 1WCMG 1EO6A 4EQPA 1IYVA 4ANUA 3PHWB 3J7AV 4HK2A 3UQAA 2PVOD 4NXNQ 1NEKB 2KOXA 4DXAB 2RHSB 3KBXA 5M3FB 1RD9D 3TMEA 1TR5A 4KSLC 3OW7A 1HA5A 1R4MB 2WP9B 5T8IA 1WOCA 4MHEA 2OEOA 2MP1A 1WGGA 1O7IA 2DWQA 3H3VH 4WFN3 1AW7A 4X6AH 1EF1A 2RCFA 3Q3FA 1V1QA 4BS9A 3T1YL 2VH2A 4QUCA 2L55A 2JA5G 2VZKB 1KNEA 3AV8A 3V6EB 4DR2L 1QOBA 1Y8OB 3UF8A 3NQIA 2D5GA 1D1KA 1O7ZA 3T51B 1WMHB 2A74C 2K04A 2KC2A 3M9BA 4CJ2C 3EQLC 2W82A 3TEZA 2NVXB 4A3EB 3D6CA 4HIKA 5AFWA 1GUSA 3MC9A 3VR4A 3Q6BA 4A3GG 2K6QA 4X57B 2F0MA 3PIO3 4TV3A 3HP3A 1TKWB 3ONSA 1UE5A 1V1PA 2OXPA 2VY3A 4CHTB 2K1BA 4RCOA 3KUPA 3BYTB 2IY1B 2MBEA 3W3AA 1UGJA 2OTLA 1T3QA 1KDBA 5ELNA 3K9PB 3LDZE 2QJLA 3OG5A 5BMHA 1UWMA 3X0WA 1K51A 3U4EG 3NPPA 4MJSB 4L5SA 2B63G 2LVPA 2AQ1B 4FP5D 2WGSA 2ZCCA 2KHSA 2B39A 1HTLD 3K57A 2ZZPB 1E1TA 5M9OA 3I72A 3R7RA 1YJ9A 4NQLB 3HOXB 3AH7A 3A9JA 2IHEA 3VXWA 2PEAA 2CH4W 2INPE 3HRZC 3A4SC 2VQEQ 4BFRA 1OXXK 2JQOA 3PUXA 4KLKA 1EYGA 2K3UA 1T5EA 2ZCBA 5GAEC 3R3OA 3Q3OC 4WJOA 3D6WA 4W9HA 1M94A 2PPHA 4JBKA 2GLSA 3S1MH 3AE1B 2DAFA 4C80A 3ZLZA 5G3LF 4KTAA 1VZ8A 1L2FA 1ET9A 3OHXC 3ABVB 2CKHB 1DYQA 1KNAA 1N33Q 1I5FA 1ZUD2 2RPQA 4OZAA 1Q8KA 1J8CA 2D3GA 4LNKA 5M5YB 4DV4Q 2MP2B 3GTLB 2MRPA 2BH2A 1QNUA 1LGRA 4ASWC 5C4XH 5FKAC 1C3TA 1WTHA 2V0GA 1G8ZD 4CO7A 3BDCA 2W9NA 5HI1A 3R3MA 1F1HA 3CCRA 4FO2A 5CC4A 2ID0A 3D32A 3AQQA 4NW2A 4DUZL 3C46A 5IT9c 1PUTA 3QO2A 1P0RA 3Q8BA 4HDOA 4BOZB 4ANWA 1ZXHA 4QY7A 3MXPA 2YU9H 2MHJA 3N32A 2MBHA 1RJTA 4HPMB 1M4VA 4R3DA 2KVMA 1BCPB 2UXCQ 4AS1A 4BY7H 3M85A 2SNMA 3S1RH 3RD4A 1UELA 2I1JA 1JQ4A 5LNK1 3ULPA 2DJFC 1H9KA 1ZPSA 2L76A 2R93G 3ONAB 4HMJA 4JBJA 4MSMB 1P7EA 3PO0A 4CDDC 2QMTA 1KDAA 4GOPB 1V81A 1M1KC 3DDCB 4JW0A 1JE5A 1YHBA 2KJXA 5IP7G 1BUVT 2GVBA 3V05A 3W5OA 2OHFA 3TEWA 3MEFA 2UU7A 2ZEQA 1HE8A 2Y5BB 5BYQA 1IP9A 1A2UA 4K7WA 4IFDI 3RT3B 5GROA 4LF7L 2D62A 4M1UB 3SR1A 1J5EL 3ZNID 1PTOC 4KDLB 3ZVVA 3K9OB 2A73B 4MH8A 4GDKB 2RDBC 5BR8L 3HG9A 4KD3A 2DY8A 2PQEA 3M4OB 2F1MA 3FDTA 3P7JA 1K53A 2HDLA 1WTQA 1AZPA 2NS5A 2KC1A 4CDCC 2PNHA 2CHXA 3H6MA 2K25A 2QA4A 5F2DA 2JA8H 4I6NB 1W3SA 1TU2B 2B2WA 2QSDA 2VL6A 3OMCA 5COYA 4V0BA 1KRTA 5C0XH 5M3MG 3S1MB 4DR1Q 2FE8A 4XDDA 2K5HA 1XMOQ 1F2YA 1PRTF 1A2TA 5BMGA 2JXXA 3NBHA 5GADC 1CKNB 1VQGA 3VYTA 2LEKA 3RNEC 1YNNC 1V97A 2EYJA 3ERQA 1BF4A 2MH7A 1PMRA 5D3DA 3V60A 3Q14C 2WNMA 3CIRB 4DR6L 1C4QA 2Y5PA 4XE0A 1QZGA 1GUNA 4RKBA 1UNSA 4EOYA 5LHY1 1PH4A 2H89B 1ISNA 2ON8A 3D3RA 2JN4A 5M5XH 3S1NB 3DBRB 1C7YA 4P1CC 2BBCA 4LW1A 3UI3A 3K7UC 3M3YH 4NQKE 1YHQA 5IGDA 2Q8IB 1Q3LA 4PNYA 2LGXA 1WD0A 2O5IC 3UDGA 4LJOB 3IBEA 2MA9B 1AWDA 2JX5A 2M0AA 3KWLA 3SK5A 3RN9C 2AWNA 2BCOA 2Z6KA 2J4XA 1NCVA 3W2DA 4JI4Q 1EOTA 2WKCA 3DBHI 1CSPA 5JEAJ 1VRAB 2PMVA 3ZIMA 4WORA 5C44G 3EFXD 1WE6A 5K5PA 5AJ3Q 3A7LA 1NYRA 1PH2A 2GMIC 4KIKB 1IKLA 3BVMA 4A3OA 4K2LA 3G48A 2WB1G 1L4DB 2EOTA 3KF8A 1MIUA 4O2DA 2UU9Q 2PVGC 2CJOA 3DWQA 3NQTA 3NXWA 4DR5L 3IAS1 4FXKC 1IBKL 1C48A 5IOIA 3ZDMC 2MJ8A 1WSPA 4FVMA 4HR7B 3HUIA 2LXJA 1JWUD 1LTTD 1H9JA 1F2LA 4L5QA 3J81i 2R7FA 5CBEE 2WDTB 3ETRA 1FEHA 3FPUB 1KIXA 1C8CA 3J7A5 2DY7A 2UXCL 1JMLA 5L37A 1K73C 2PPBC 1TIFA 2J0MA 2MLBA 4UP7A 5IYCG 5J3BA 5E6PA 4GIVA 4AH6A 1ESFA 1TIID 1VQ6A 1K28A 5EE1A 4KD4A 4GNXA 4GDKA 1Y8NB 1I4PA 2OQKA 3MXNA 4KGTA 2JA7G 4HJKA 1KH0A 3OJ3A 3APFA 4HJ8A 3HOUG 3S2DB 5AEKB 2JWUA 1BMLC 3L0OA 3LGJA 1N36Q 3HOVH 3G4SA 2CS4A 2C9WB 2OEDA 4LK0M 3T53B 1WTOA 2BYVE 3BINA 4IO9A 4DDGD 4PS8A 4A3IH 1MSHA 1EYCA 1U0LA 3UDIA 5IYBG 4LDTB 1RAXA 2K5DA 4PZ6A 1BR9A 1J5EQ 3HOUH 4OONA 2L32A 1P98A 2INCC 4KY7A 4ZKBB 2Y0SB 3S16B 1YX6B 2AKWB 2DZIA 2LRWA 1NBWA 1CTMA 1SSOA 3FC4A 1RHPA 2YTVA 1UEAB 4DGZA 3RNAC 1VF5C 2K03A 1U5KA 4UHVA 1FXAA 2NMQA 3VUXA 3W1SA 5JEAG 4JPBW 2AQ3B 2XRSD 4LFCL 2L52A 3QB3A 5IYDG 4IM3A 3VH4B 3T9LA 2CCZA 3K8AA 4ANXA 1C76A 4IUPA 2DBYA 4OWTB 2E3TA 1Z7TA 1ZXTA 4U68A 4ZLTF 1Q82C 2JEBI 1SFOH 4PG3A 1B1ZA 5A2QE 2F0JA 2JPHA 1STBA 2MBQA 2JA6B 1Q81C 4ZKCB 1FMAD 4MTNA 2ICEC 1WM2A 3FKIB 2K8CA 2QEJC 3OOCA 4C3HB 2X38A 3PO3B 2WXLA 4G11A 4W9JA 4WJQA 1R9TH 5D6JB 3WAPA 4C3IH 4RNAA 4H2AA 1VQAA 5D3IB 5ELBA 1Z5SB 1HXYD 3I4NB 2LJ5A 1EY4A 3DBRI 1CM9A 3QAQA 5BMIA 4DHJD 1MHHE 1WZ0A 1P16A 1NY4A 4CYEA 3EHVA 3DEOA 3TJPA 1JOQA 3N1YC 3H1UA 2V3SA 1ENFA 1B7YB 1SNOA 1E6EB 2F0UA 3HEJA 3OAWA 3M7NA 4BBNF 4MN3A 3FKYA 4IPDA 2QC8A 1B4OA 4BAXA 1CZGA 2Z8LA 1TTNA 1E0BA 3SXHA 3PS6A 5I9OA 3PUVA 5BR8Q 1BNZA 1E8YA 4FF4A 2JUOA 3FRPB 1N63A 1FNVA 4P2CB 4A55A 1UGMA 2UWQA 4A3BG 3PO3G 1Q1OA 1VQCA 1LABA 4ID6A 2ZJRA 3HVDA 3NJTA 1GUAB 3I4MH 3A9KB 1XD3B 2MGSA 1JJGA 2M56B 2F4VL 3ECIA 3H7PA 1PTOH 2E2IH 1PFSA 4B6WA 2CWPA 3EN2A 4OGQC 4ME3A 4ZCKA 2E2HH 3PIP3 1FFUA 4JI6Q 5E6NA 4XZ4A 2A6ED 3I70A 4F8MA 1VQ4A 5I4DA 1PRTD 1D5ZC 5BYRA 5FLMG 1EY6A 4YY3L 5FJ8H 2IO2B 4LF8L 4A20A 4OZBA 2V4IB 2GN5A 4BKSA 1SE4A 2M8SA 1K0SA 4ABNA 1LM0A 4L6TB 3CMEA 5GAHC 3IAYA 4R4TA 2M17A 1SMYD 2NZOA 1RODA 2O4XA 3SK8A 1RWSA 4MGYE 3VR8B 4LUOA 3FP9A 5AZFA 4DUZQ 2NVQH 1L0VB 1CT1D 2FIDA 3GTPH 1XQQA 2G3QB 2RMMA 4ARIA 5HGTA 4G50A 3AXCA 4X3TA 1EFID 3OIPA 3KJOA 3AMUA 3RNCC 1WFQA 2SNSA 3K6OA 5IA7A 2OTJA 4YWGG 4H02A 4MELA 2JA6H 1ZYRD 3QG1A 4EGVA 5C44H 2ES2A 1HRJA 2L00B 1DOYA 2DNEA 1GD7A 1ZEQX 4GLVB 2E76C 3I2ZA 1N32L 4A3LG 4A3PA 3KLRA 4MIUA 5G5GA 4BWGB 1SBBB 2WXOA 2MO0A 4GKJL 2O5JC 2VRRB 4MGZE 1JJCB 1JICA 4DV3Q 2PQAB 2Q2TA 4A3DB 2N1VA 4J6HA 1EM7A 1SLJA 1JROA 4NPNA 5KHQA 4A6QA 3X3NA 1H9SB 3H91A 4HN7A 3RZWC 1E8WA 3HOVG 4A3IB 3B2FA 4GMVA 1KAAA 3P75A 4IFDJ 2ASBA 3ZKJC 5IGBA 3H7PB 1F2ZA 1UE7A 4ALPA 3I55A 1GM5A 2K0PA 4RHRA 2YV5A 2KBNA 2G4SA 4Q0FA 3R8BA 2VXWA 3TBIB 5FLXE 4LFAL 2KENA 4OWXB 3RZDB 5JJLA 2PKOA 3H0GH 2F0KA 3I9V1 1X3FA 4DK0A 4M8MA 1VQBA 2UXDQ 3BK1A 4GLAC 2A5UA 4NKLA 2K75A 5H8YE 1WGKA 2K4KA 5EPJA 4X65L 1SNMA 3DMUA 4CHKA 2PJHA 4C3JH 5G3LD 3M4QA 1B50A 5E6JA 3VAWA 5AUIA 1BOSA 4A3BB 1LTBD 2WDRB 4FN2A 1EU4A 3MEHA 3PO2B 2IYDB 4ZRQA 1UF0A 4DV7Q 4A93H 4HROA 4NDXA 2YVCA 1Z6HA 4N59A 4GOPC 2WFWA 3CPWA 1WJJA 3L54A 5LL6X 4A3EH 2QDLA 3EA6A 2KO3A 3N9YC 5DPRA 1LYLA 3STBD 1JWMD 5JPMC 3S15H 3I91A 4X66Q 2AL6A 3I5JC 2MBBB 3URYA 1PH5A 3T1YQ 2CQOA 3ERSX 3I4LA 1PFMA 3PQIA 3SU8X 4EKUA 1LLRD 5D65A 4QB4A 2Y0SE 3RULA 1S5ED 3PIOA 1LXDA 4B3ML 1WJUA 2WAQG 1S3SG 1I50B 4A3JH 3CWIA 3NVYA 1STAA 4IUMB 4QGUA 1PYWD 1VCIA 3JYUA 2EY2A 1EQVA 3PHXB 1OQQA 4MEMA 4RHSA 5IYDH 4BKTA 3AEGB 4NXNL 3A5UA 1RL2A 2FNJB 1V80A 4HMIA 2MQHA 3UIOB 1E0ZA 2Q8TA 2SDFA 1VMPA 1Q1BA 2L4NA 1XNQL 4TQ1A 1J7CA 1HEZE 4JYAL 1M90C 4QMGA 3SDZA 5JHBA 2HIVA 3HGBA 3CCVA 4XYCA 1BBXC 1LV9A 2GB1A 4DV2Q 1J19A 3ZO5B 1NDDA 3KYDD 4B9XA 4BOSC 3PT2B 4AYBB 1IL2A 2JA7H 1V8QA 1MSGA 4LTUA 4DV5Q 4BKSD 3EIVA 3QOJA 5DPSA 4FADA 4YCUA 5J22A 2IHFA 5IP9H 4CDFC 2C60A 3TIXA 4B9KA 1A5RA 4GDLB 3FHWA 3Q24A 1PZJD 2NVUI 2LY7A 1WCMB 4JI1Q 4K2KA 1FXTB 1G6JA 2NCNA 4IG7B 1HUNA 2KJHB 3GO5A 3W5VB 4A3IG 1YQ4B 2X8XX 2L15A 2UU9L 3F2DA 1XT9B 1FYCA 3TS2A 3BDLA 4AJWA 2B2UA 3I63C 4ZRKA 4MM3B 1NNXA 1WTWA 2GOWA 5D2MB 3H6NA 3KYHC 1LT4D 1SNQA 1Q86C 3E9HA 4QAYA 4FXGC 5AJ3L 1ILQA 4IJHA 4KZ0A 4JC0A 3T56B 1EY5A 3I90A 4F7XA 4H13C 4B3RQ 3A8JE 3SDLC 1B53A 5C5LA 4ZUJA 3MJ5A 3ML9A 1NAPA 4GS3A 5JEAH 2XBBC 1VQ8A 1U4PA 2CKZB 5EBCA 5A2QL 4A3GH 4IUQA 3OIQA 5IO9A 2RQXA 1OEYJ 2WDVB 3CPFA 1KABA 3ULLA 5IIFA 1J8IA 3E6ZX 3AM9A 5HKHA 3TEXA 4ME5A 4O42A 2MJDA 2NVTB 4DR7L 2LKVA 1IYJB 1TWHH 2DYBA 3AECB 3RNBC 2JVCA 1VQEA 1SYDA 3ND9A 2D11A 3W9CB 3K0YA 3MXUA 4C4VB 1K0RA 5I6YA 4WWOA 1CJEA 2RD0A 1KTKA 2A1AA 2A6HD 4BBRG 4Y7NB 2D9UA 4DV0L 2XEWA 3AN1A 3GTJB 2FUHB 3D8GA 3MHSD 3MAQA 1U4RA 1FRRA 2NVQB 2B2WC 1JC7A 4DK3C 2DZMA 1Y1VG 5DAUA 1ZP0B 1BDOA 1BT0A 1NI3A 2NN6H 2EYPA 5J18A 4XDXA 4Y7NH 4A76A 4M0WB 1FGBD 2WU2B 2UXBL 2KT7A 2DYMA 1JMCA 1V2YA 2K28A 2LXKA 3SK6A 2I5HA 1YD8U 4FULA 1X3QA 2IO1B 4JBMA 2AQ2B 2PI2E 1I4GA 2LI5A 1YN5A 1WGDA 2QIEB 2WV6D 2K8HA 2KJRA 2LHEA 4RM9A 1SN8A 4MNOA 5FO9B 3VRBB 2KCCA 3EVQA 1EIGA 1NVID 4GB9A 3CMAA 1DOKA 3VH3B 1HZ6A 3KBGA 2DN8A 1B44D 3CC2A 1K8MA 4RGOS 1TY2A 3TEHB 1WCMH 4NMZA 5T1IA 2J52A 3GTOB 1KLGD 4KHZA 4DU9A 4BY7G 1RTNA 3PLUA 3HM6X 1C9FA 1FNUA 1JJ2A 2WP8J 2N9XA 3K5MA 1K8RB 2MSED 3U7DA 1JWBD 1VQ5A 4S0RA 5KNCA 1RFKA 4PMCA 4L23A 3NS1A 2V1CC 1JRUA 4JIOU 4XXEA 3H8HA 1IBLQ 4ACFA 3H0GB 2OQ0A 4NXMQ 2I0QA 3RNGC 1HNZQ 5JVG3 4FLHA 2JZPA 1QVCA 1A63A 5M5WH 3P4QB 4HTHA 1TZOA 4A3FB 3P4SB 3S2AA 4TRDA 3FEWX 1MGSA 3T4AC 4A4IA 2JXMB 1OO9B 2JRHA 3U9SA 1JE4A 4F88A 1N6ZA 2V9HA 3BDOA 1X3PA 3T1HL 1FCCC 3DBSA 3TZDA 3H15A 1W2BA 3H94A 2GI9A 3A7AB 5EKLA 2ZPNA 2D2CC 3AE6B 2LSSA 5D14A 1U4AA 4QUFA 4XIGS 1OEYA 4QIWE 3TUOA 3S24A 4B0EA 4YCWA 4DBGA 5G5HA 2JSVX 1EQRA 4IZ8A 1Q8IA 1YJWA 1N33L 3GE8C 3M3JA 3QWZB 1V1OA 2L11A 1IUEA 4P72A 4HCSA 2EY6A 5C4XB 3L7ZC 3LNNA 1EY9A 4OIKA 3KK7A 4H0LC 1V5OA 1HH2P 1SIFA 4WWPA 1GKHA 2F3WA 1WWTA 4A3MH 1E2ZA 3S17H 2KYWA 3EFUA 4ANVA 3RUZA 4EZKA 2F3IA 1EOVA 1VCBA 1XNRL 3D4DA 2BW2A 1ICFB 2KQSA 2R7ZG 4KKUA 1TWAB 1L0YB 1UWVA 4WAAA 4JBWA 3GB1A 4DHJB 1SRUA 3RLNA 1XYIA 2IX1A 2ZM6Q 1F9SA 2EYHA 3S1NH 3DBHB 5M3MB 2Z0DB 3MP9A 3N30A 4XC2A 1H8CA 1C4AA 4JI5L 5AZHA 5HFYA 1VQDA 2JA9A 3HHMA 5CX3A 1WXAA 2UXBQ 1YMHE 3PUZA 4A93B 1WRDB 4LF4Q 4Z9CB 2DX5B 4II2B 1T6BX 2LFNA 3DHQA 2Q2UA 4DXFA 4DUYQ 1MFWA 2GRIA 2NBVB 3CC4A 1C4PA 3S2DH 3V62A 1RIPA 1DGSA 2PZTA 2LVQA 1QF6A 3IFTA 2DUDA 3U30A 1VZ6A 4GKKL 4NB3A 1PXUA 4RAUC 1F9RA 5JJIA 1K50A 4OWWB 2IGDA 2KVRA 5DLQE 2BDOA 1C9OA 1IYFA 2EKEC 3I3TB 3UGBB 1WI5A 2H1EA 4KZCA 3E56A 4FJYA 5EDSA 1LTAD 2B8GA 2RF4A 3MJWA 2IJ0A 3AEBB 1L1OC 1PRTB 1QILA 3VQIA 2VUMG 3UE1A 2VB3X 4UP9A 2KQ7A 2YYZA 2FXQA 3MFGA 5CV7A 4RWSC 4A93G 1CA6A 3GTGH 2KAJA 2Z0SA 3IG3A 3TSSA 3N1ZC 4E3CA 2P5ZX 3GTKH 4LNFA 5K36G 2F0GA 2AWOA 4KGRA 3H7SA 2GA4B 2H5XA 4B3RL 3PVLA 1SYEA 2N0SB 3PV0A 3ZRCA 1WYDA 3WOEA 2LGYA 3HFZB 4IN3A 1RLFA 2ZNVB 2X6GA 3BYYB 4UP8A 4X62L 5ELDA 1P7FA 3NWSA 3DVGX 2N4FA 2KHJA 3TDQA 4H7BA 5IYCH 4AWJA 3E5SA 2BT6A 3APCA 3KF8B 1YNJD 4GOCA 2IO3B 2DJGC 2V4LA 1SYCA 3CQZB 1WGYA 2KTRA 1Z9FA 4CJ0B 2ZW1A 4A3MG 1VMCA 2A5HA 3Q22A 3RZOB 1I4RA 2I46A 3VUYA 4J1MA 4EE2A 1E7ZA 2WXRA 5KRUA 5I2XA 4JI3L 2EQSA 2AEHA 4ZYNA 3NWTA 4PS3A 3SFDB 4RCNA 1LUZA 2N9EB 1DOXA 2NWGA 2F0NA 2EDGA 1K52A 4QQBX 4H44C 3HOWG 4RG1A 5IP4D 1F9QA 4KHPL 5HGQA 2EYFA 4AOFA 5EPKA 1VQLA 2WAQE 2RCNA 3TS0A 2HHHQ 1HNWL 1JRPA 2NPTA 2AUKA 1FPYA 3RLFA 2YU9B 1GHKA 4IM2A 1XJVA 2PMZB 1N62A 2XNAC 2PNRC 2YEPF 4A8XC 4OIJA 1CUKA 1SNPA 1E7UA 3PGEA 4OELB 2J7QB 1E8ZA 4HJAA 4BXXH 2IO0B 5DPWA 1XTCD 1TS2A 1Y14B 3U2SC 4E74A 2KOLA 5IE8A 2IY5B 2I07B 3QR8A 1X32A 4TSSA 3KWVA 2G1EA 1N9WA 5EE3A 3IXSA 2PZWA 2EY5A 4C3HH 2K5QA 2V3PA 5JZEB 4XQNA 1UD7A 2WXQA 5IGEA 2IWHA 1VQKA 4LF6Q 1WY8A 1EIYB 4EZJA 4LCDE 2MUYA 2BE5D 2NUCA 4RH6A 4JV5L 3QHTA 1V8CA 2K5WA 3W1YA 2ZT9C 3PUWA 1JB3A 4DR4L 3S1QB 2RGFA 5EE9A 3RN5A 3J81c 3E9IA 2G5DA 1FGUA 3G71A 2XGTA 1NI2A 2JA6G 1ENAA 1ESRA 3RZDH 1IL8A 3OTOL 2XK5B 3BZCA 2HJ8A 3Q8DA 1ZW7A 3VA7A 2LGIA 2G9DA 5ELCA 1HR0W 1HR0Q 4WRDA 1WXQA 2EE1A 2DAJA 1VQFA 3KJPA 2E2DC 1D4BA 1GUTA 1SYBA 1PH9A 3HOUB 1IHZA 1SNCA 4A3DH 1HZBA 3GTKB 4K0KQ 4J6IA 4RMAA 2CVRA 5HURA 1ROEA 1V43A 4W9IA 3MXGA 1XNRQ 1QQRA 2F0PA 2I5LX 4EVOA 5FOBB 3TREA 1CQFA 4XGAB 1S5CD 4FA6A 2ZNVC 3PSIA 3ND8A 1G6ZA 3A1QA 4YTMB 2I2YA 3CMMB 1H9RA 1UAPA 2K05A 4RGNA 4RGMA 4L1BA 4C3JB 3OMGA 1IGCA 3VTUA 2GBNA 3LJ3A 4A9AA 4HKZE 3W1GA 4A3CH 3AMZA 3A56A 3PF5A 3PO2G 3ZXVA 2I5MX 5EKIA 2UUBQ 2WX1A 3AEAB 4HWIB 4DF7A 3T3NA 3J81j 3B08A 4BBNC 4A3BH 3R66C 3GV6A 2RR9A 4G7HC 2KFKA 3OSOA 4IPGA 1E7PB 4FXCA 3DHGC 3KH0A 4HJGE 1JB7A 4MZ9A 3AU7A 4X64L 4LF9Q 1ZXIA 3A9KA 3EJIA 3T1HQ 1YJJA 3C1FA 1XXGA 5M3FH 3C1EA 2D10A 1Y1VH 2B29A 3STBC 2DENB 3MHBA 4X3KA 1PQSA 4GKKQ 1L0WA 2QCPX 2XWJB 4HCEA 1K8AC 3N6RA 2JSOA 3Q3JA 2C35B 1YI2A 4BBRH 1HNZL 1AARA 1H9MA 3BVGA 1BCPC 5ELFA 3QQ8B 1EZ8A 2JA8G 2VQFQ 1Q46A 2DNCA 2IZVB 2YTYA 3A74A 5M3FG 1SF0A 2FCNA 2AYOB 3K5NA 4UAIA 4C2MH 1E90A 4HLEA 1D8LA 1PDQA 4XT1B 3WWVA 4PMWA 5GAGC 3BY4B 5EBDA 1PLFA 2O6VB 3SHQA 1XWEA 4JI6L 4B3SL 1Y1WG 3APDA 3LB8C 1YN4A 4LNNA 1L4ZB 2BYEA 3DWPA 2AHOB 4POFA 4BZAA 1IZ6A 3TEYA 3PSEB 4C3IG 3B2GA 4AUQC 3TN2A 3L10B 3CAMA 1RM6C 1YQBA 2KECA 3DM3A 2FBWB 1B9NA 2PW5A 2AWTA 4A3LH 1E2VA 1N60A 1K9MC 3M3YB 2HUGA 3GZNI 3SHLA 3S2HB 2B3AA 3AE9B 2BOSA 2EIFA 4JPSA 4LFBL 5EJWA 3NHEB 2KMMA 1PH7A 1CA5A 3NK9A 3R93A 2VW9A 1XF5L 2KD0A 3Q8EA 4F7ZA 2KA7A 2WWZA 3DHIC 3B9JA 2F0LA 4D2KA 4C4VA 1XLQA 2ZPYA 1X54A 1GJXA 4S3SA 4HEDA 1G2SA 4AP4C 3K59A 5C2TB 3TZUA 3I4OA 1OQYA 2BDNA 1YIWA 4JL9A 1DM0B 1TT2A 1STNA 1TBEA 3QJYA 1HPCA 1ZYRC 3JW0X 1JORA 1CKMA 4DUYL 2LGDA 4FDBA 5EKKA 1KJTA 4LF4L 5IT9L 2GVAA 1RFAA 3P42A 5HY6A 2QW7A 3UDXA 5FLXc 1F2RI 5FLMH 3M4PA 1YEZA 3EROA 5IP7H 3S14H 2LZ6A 4HAEA 4IURA 1IGDA 2PIAA 4WJ3M 3F2UA 3WCQA 4C7YA 5C4ZA 4C7ZA 1AYFA 1X1MA 4IALA 3I4NG 4AQYL 4TQ0A 1SMYC 1IBLL 3S16H 1J7BA 1T5XD 3P63A 2AUJD 1K83H 1X56A 4KI0A 2R92G 2JZ3B 2KTFA 3E3XA 2L0FA 4JG2A 2J7ZA 1I4QA 2W3RA 4CBVA 2N49A 3A55A 1S1QB 2TMPA 4K6DA 5LMNW 4R8NA 1UWXA 2EKIA 1Y8PB 4FXDA 3OLMD 5D94A 1VQHA 5NUCA 3I4NH 1UBQA 4MGIE 3AFQA 2A6EC 2JK8A 1I4HA 2F0VA 2KEEA 3MWYW 1E24A 1UE1A 2D0PA 1BUIC 5C5MA 4DKAC 1F52A 2FCQA 4ZOHC 2N9PC 1RF2D 2A8VA 1B9RA 1G6PA 3JAMc 5JAVA 4WWMA 1EEFD 2LRUA 2WXGA 3RFZB 1XPUA 3V61A 2WS3B 4IUTA 2JA7B 4YTPB 3OYYA 4FHJA 3MC8A 2XN9C 1AE2A 1FJGQ 4JI1L 4WJ4A 2K1FA 2KDIA 4ZRIA 4GN3B 3CC7A 2VH1A 3W1BA 2OJWA 5CV8A 1GNUA 3A8KE 1JT8A 4XQQA 3T16A 1XO3A 2KCTA 2F0DA 2BKFA 4IOCA 3TP7A 4KMUC 5C0XG 1TZ1A 1QKZA 2D3AA 3NOBA 4ZDVA 5IKCM 5IOCA 4DV2L 3HOZB 2MQJA 3GS2A 4LDTD 3JAML 1C0AA 2LMCA 1SE9A 3DQVA 5HHDG 1QOGA 4AYBG 1TWAH 3A1QB 5I9PA 1QE6A 2B2VA 1DJRD 2MCNB 2N8NA 1O80A 4JLCA 3KF6B 1XLPA 1WH3A 2L0CA 1I94Q 4HRSA 3DLLA 3CSFA 3GE3C 1AN8A 3RPFC 2DHZA 1RDPD 1Z47A 3D0FA 4DV1Q 4DR7Q 4DHZE 2ZVNA 2JRIB 1EYAA 3RLOA 2K5VA 5BO4B 4F87A 3AFPA 3K5OA 2ZXRA 4DDID 4ZAIA 1GB4A 2BE5C 1GUOA 5JHAA 2MJEA 1GB1A 1GO3E 3TP6A 1IBKQ 1WX9A 1VDZA 4NY0A 4CJ1B 1KD1C 2LXCA 3HKZB 3JAMi 4DAMA 2VUMH 2LGSA 2HCCA 3FILA 1AH9A 4NZLB 3K0XA 4HPPA 3DHHC 4B3TQ 1LTLA 3E0EA 4DAVA 1PA6A 3A33B 3NZSA 1UUPA 1SAPA 2WX0A 1TT5B 2K50A 1BBWA 5LL6S 1R4PB 2CFMA 2L1BA 3PCOB 3IRBA 1HZAA 2G9HD 2WAQB 4C2MB 1SYGA 1SROA 5ELEA 1B3QA 3B1LX 3L4PA 2R3ZA 4XDCA 3R2IA 4A3FH 3ICEA 4RM8A 4WQMA 3KDFA 1N5WA 1FD6A 2EYOA 5AUKA 2KWVB 4XWTA 2E2JB 4IUUA 4DAYA 1KOTA 1F77A 1LTID 4UPAA 5TSSA 3H3VI 1QT9A 5MPOA 1MBYA 1TS4A 2O6VD 1EWCA 2RDGA 3P20A 3P1MA 4X65Q 2CHWA 3L17A 4US8A 3MZ5A 5EAYA 2JWZA 1MG8A 1Q10A 4A3KH 1SJHD 1C77A 2HQEA 2KJ6A 1L7YA 5H92C 2W55A 2E2HB 3K7AH 3CD6A 2R7ZB 4YSXB 1UBIA 1FFVA 4DV0Q 1CZPA 2TSSA 2L8JA 3C0RB 2NTTA 4PMBA 1KF6B 1TYGB 1SYFA 2IY0B 3HOYB 2HIXA 3I4MB 1AFPA 5AZGA 2RDHA 1Q7YC 4JI7Q 4A3CG 3QA8A 4WWNA 4LK1C 2RSNA 1SIJA 3FILB 4XYOA 1WZ3A 5FLXL 1GHJA 2BPSA 1E7VA 3C8YA 1SE2A 5DEHA 4DR1L 1YNJC 2F0FA 3AE4B 3PUYA 4DPGA 1XCTL 2SOBA 3WAOA 2R6GA 3LWEA 2YEPB 3GP7A 4BA1I 1T0SC 4M0WA 1BXTA 4DV6Q 2WB1E 5LMUL 3LX0A 2JA5H 3AI5A 1VQ7A 3BVZA 3WOFA 3HOWB 4B3MQ 1YJ1A 2W3SA 2JXTA 3ZQ4A 2WINB 1WX7A 3LWUA 1N32Q 2WHIA 5H1SE 2J53A 4XX5A 2K9XA 3EBEA 2B2UC 4P1BC 4GLSC 3GTPB 2RKSA 3AEVA 3J81L 4LJPB 4JOIC 1DCZA 2C7MB 2N78A 2LHDA 3NUHB 4HDQA 4JI2Q 2ZJQA 2IBIB 5J1ZA 4DK6C 2N7EA 4KJOA 1VQOA 1A0IA 3QJZA 4DK5A 4J15A 4DV7L 3VHTC 5IODA 2NBWB 2FJ2A 5E7NA 3VDYA 5G55A 1QOFA 4IOAA 1V9PA 3HRDD 4FJVB 2FAZA 4DV5L 1V9JA 1QVGA 4JWUC 2R2QA 2GBJA 1V5TA 4QCLA 5FK9C 5FR6A 1P8LA 5C3WA 2PW7A 2JA5B 3P4PB 3M4OH 4RFBA 4RA8A 5C4JH 2FUG1 4YXDB 3CRLC 4KDIC 2VZAA 4E6IA 3PMFA 1HTPA 3ZW3A 2F0TA 1BKBA 4R8IA 4LAAA 1JCKB 5G2NA 1XNQQ 4GU2A 2F4IA 4LFAQ 4WJWA 1CHPD 4A3GB 4QL5A 1D5XC 2KVZA 2LFIA 5KIXA 1AE3A 2LUEA 4I65A 1LM8B 4MJSA 3J80c 4L5RC 4M00A 5C6AA 1I3QH 1LT3D 1F9PA 2Z6BA 4HJ9A 1WF9A 1YNND 3I56A 2PE6B 3HM3A 3DWGC 3VRAB 5L95C 2R92B 3V3XA 3NG0A 1WTPA 2K7VA 3CW2C 1HZCA 4DV3L 3Q3NC 4GN1A 5LLIA 1PH6A 1BQQT 3S14B 2UUAL 4BY7B 2IDYA 4BA2I 4W9EA 2A68C 4OVUA 1NR4A 1PYSB 4BY1G 1WJ6A 4C3IB 2B76B 2Q5WD 1GJZA 1TKYA 3MVVA 2QKIC 1A3UA 4PV1C 4DFAA 1XMQL 1HZ5A 2DZJA 1ASZA 2RSUA 3HZXA 1B70B 5GXGB 4K7UA 4K8JA 4K5VA 2C9OA 3HKSA 3KW5B 4WJNA 3G6EA 1ILPA 2M1MA 3LYYA 1LTRD 3VA5A 1K8OA 4LMQD 4PYUA 4G0NB 1OTRB 4KIKA 1HTOA 3RI7C 2KWUB 1STEA 2WXMA 1YIJA 1R4NI 4XYQA 2BYFA 3TBLD 2A4ZA 1EUJA 4FNFA 2WKDA 4HSPA 2CHBD 2XVSA 2A69C 4TQUS 3S2HH 1WJ4A 4IC7B 1GUGA 4RMFA 3EFCA 2QHOA 1XPOA 4ITKA 1G2TA 1FL0A 4YY3Q 2KK8A 2Z59B 1G51A 3Q2AC 4R4OA 5DM73 3VYUA 1YN3A 2DZKA 1LO5D 2M9VA 1TWGH 3BZDB 2EY1A 2HT1A 2JEAI 2MBOA 4JQWC 3AEFB 4QF4A 1N8RC 2C5LC 3PRMB 1JQYD 3NRZA 4HKQA 3MFYA 1B2TA 2CHZA 2F4VQ 3Q3MC 4REZA 4LWCA 2K6DB 1X3GA 3Q23A 4DXGA 1VJKA 1D3ZA 5M5WB 2J0KA 4WURA 1CHQD 4EEWA 1B8AA 3DUZA 2RDFA 4ODGA 4ZUIA 4C56C 2RA4A 4GNXB 3E9SA 3O65B 3UQBA 3D31A 1L1OA 1S5BD 3IVFA 1BO0A 3NBIA 1J6QA 5C3XA 4ICUA 1IYUA 2RSOA 3M63B 2E2JH 4PQXA 1R9TB 1DZ1A 2KKCA 4OW0A 4DV6L 2INDC 4P75A 3VDZA 2V3NA 3ZYYX 4OEMB 1JWAD 2HDEA 2J0JA 4M8AA 1F0ZA 1K8GA 1WD1A 4QIWB 2HD5B 4P73A 3PRPB 1NE3A 3ML8A 1GXDC 4GNXC 4HSVA 1KLUD 1NJIC 4EFOA 1I4XA 2CW0C 2MJ3A 3NUCA 3ZGZA 4P74A 3NTIA 2L12A 4DR3L 1YITA 2BS2B 1DD2A 3DOWA 3NVZA 2A19A 1HA6A 1E5WA 1PH1A 3GZNB 3ZJUA 2NVXH 3V6CB 2CQAA 4LUVA 1SB3C 3Q69A 3JC66 4LF8Q 3ZRFA 5T1GA 3AE2B 1A8VA 5EGTA 2A6HC 5A35A 2GBRA 2QDFA 4POGA 4I7ZC 3HOZG 3M95A 3I8ZA 4ZRPA 2BQQA 2IGHA 1MI2A 4DR5Q 2VZKD 4KKIA 3PLVA 2NVYB 3RMHA 4NAMA 3X23A 3GTOH 3I4MG 3FVQA 1MKHA 4O1NA 3BIID 2KHWB 2KLCA 2F52A 2Z4IA 1HQRD 4ZRZA 3KF6A 4L63B 5EPLA 1HNXL 2K5NA 3S1QH 2WXFA 4A3EG 3VYSA 1FIQA 3HOVB 3FPPA 3ULJA 1XCQL 3HOZH 2PTLA 2K39A 5LXIB 4R4CA 1Z2MA 4HVBA 1EYDA 1V86A 3WALA 1D5MC 2F0IA 2GBKA 1RCVD 4B3TL 2KANA 1KFYB 2H88B 5LMUQ 4IWPA 2L83A 2VS1A 1I6HH 2XTIA 1Y1WB 3NZUA 3CF5A 4DNIA 3IAM1 3WANA 4EQNA 1L0XB 5M5XB 1L6VA 4OXPA 2JU6X 4IWOA 2MP2A 3QX1A 4AQ7A 5C3EB 5E6OA 1N36L 2BB5A 1ZDXA 3JSVA 2F0QA 4YT0B 1V6EA 1FD7D 1Q0WB 1UH6A 5C3JB 3HOWH 1STGA 1NMFA 4KV6A 1JOOA 1I3QB 1ZDVA 1K83B 5IYBH 5CHFA 2JYOA 1UE6A 1TKGA 1EUVB 5IT9E 2BWFA 3P4RB 3T8MA 1I42A 3GV3A 4R1JA 2MFIA 1LT6D 3KLSA 3U7ZA 2NB0A 2MX2A 3ZXRA 3CCJA 1FM0D 3KDFB 3A8IE 4US9A 3U58A 4WIPA 4Q2JA 4A3KG 2NN6I 4W9DA 4K7SA 1ENCA 2DYOA 5D7GA 1XMOL 1J9OA 4MM3A 1CSQA 5C4HA 2E2IB 1QJOA 1EIHA 1SMXA 3A9JB 2F03A 2JZZA 3ZUNA 1PTOB 4USAA 4CKCA 4GLXA 1DGJA 1QZEA 1WGRA 2EXZA 4LFCQ 3IKJA 2WU5B 5CV9A 4FF3A 2KQ4X 3BU2A 4OZCA 2AL3A 3EECA 4HEA1 1A6XA 1HUMA 1Q5WB 1FJGL 2NPTB 1D2BA 2M19A 3CQZH 1KL9A 1OQRA 2KXJA 4JI2L 1VQNA 4LF5L 2PW9A 2FINB 3N20C 3ZNHB 5IN7A 3G7LA 1WR1A 3A4RA 1QG7A 4LF5Q 2BB6A 3UIPB 1HTQA 3K58A 5GMVA 3NTKA 2KFJA 1SR3A 4HXDA 1WXMA 4M01A 4NJ7A 3DWAA 2JP1A 5LMNL 1AZQA 3K5LA 2KN5A 3CF6E 5CHVC 1KRHA 2Z0EB 3DCGA 4N9F4 2LMCB 2IL8A 3G6JB 2BF8B 4R4QA 3SVMA 4L8JA 1LT5D 1TY0A 2R92H 1WIAA 1KHIA 1DONA 3BWUD 3T13A 1PH3A 3QARA 3VR3A 1JOKA 1GAQB 5IP9G 5IGFA 1S72A 1H95A 3KUDB 3Q8FA 4TKNA 3ZDTA 2QILA 1PZKD 1G291 3DVGY 4I6LB 2X69A 4ZRJA 2JA8B 1WGHA 3MTNB 4APVA 4CDEC 4DR6Q 5LXHA 4XT3B 1NSNS 3O13A 4IPCA 2XWBB 3HIZA 3C19A 3LXFA 4K14A 3QWNA 4RF1A 1ONLA 1EY8A 1MJCA 3J7ZC 4DV4L 3CU7A 3NSWA 3NZ3A 2KNBA 4ULLA 4BBSH 2N7JA 1JW9D 3AE8B 4OVZA 3EUB2 3L16A 3FKIG 1YOVB 1GVPA 3AYHB 2LASA 4I6PA 3V96A 1V49A 1WTVA 5C3EH 1KQSA 3MC0B 1WRIA 1R4QB 4V190 2HE7A 3RUIB 5M3MH 4B08A 4K81A 3TCAA 1NUCA 2FIFA 4G3XB 3FAHA 1A15A 4NNJB 2FFKB 1M8AA 3FKIH 4BBSB 4KN4C 2E5LL 2A69D 1MHXA 2KX3A 1T9HA 4JI4L 4LF7Q 4TKOB 1QLBB 1Q90A 4P6VF 2NR2A 2ZJDA 1C78A 3TP5A 1W6KA 2FHTA 5KHOA 5DNFA 5JXVA 1G91A 2ASQA 1WTXA 3TQYA 1CKOA 3M62B 1JALA 2VUMB 3PZDA 2O2VA 4IDIA 1KAWA 1ZKOA 5JOBA 4CGYB 1D6EC 5ISRA 2OOBB 2R2OA 2PQAA 1IW7D 4KJNA 4BKGA 1CI3M 4DV1L 1EWYC 1OXSC 3NS8A 3F2CA 4K3CA 2IW3A 3AULA 2XRQD 2VQFL 5JVH3 3GOEA 4F1SA 1XLNA 4NAWB 4IFDG 1SE3A 5KNBA 5GQOA 5C44B 4DR3Q 1I94L 3H09A 4YSZB 1U9RA 5FO8B 1Q1EA 2KACA 1XLOA 2A68D 1MVKA 2MWSB 1YBYA 3JVZX 4B9WA 2Q2IA 3L2PA 2SEBD 4DR2Q 1STYA 4W9GA 3UI2A 1L5PA 2BGFA 4C1NI 3GTJH 3VUWA 4HIOA 1CFMA 1WTRA 2DNFA 1D1IA 3ITPA 1VZ7A 2BA1A 4X3SA 2M2LA 2HCIA 2JYEA 1HZ9A 1TWHB 1FR3A 2UUBL 2KEDA 1GC7A 2E6XA 2XK5A 3DWMA 4IW0A 4TMAB 1TGZB 2FMCA 1X6OA 4C3JG 1T0QC 1KLVA 2PZUA 1NTGA 2B2YA 2ZVOA 5IGCA 1NR2A 3VR6A 3PV1A 2KHIA 2VQEL 1CKNA 1WJNA 4HPLB 1E2WA 2F0WA 1LTSD 4Y52H 4G57A 5E1FA 2EYLA 1DOLA 3WAMA 2REXA 4C1NK 2PCFB 1QVFA 3GDEA 2BWES 4K0KL 1MPEA 1QUQA 1YJIA 2KQ3A 4N9PA 3VYRA 1NENB 2KMAA 1W6JA 3RZFA 1VQ9A 4N8X1 3BZKA 1WYWB 4LUZA 2KFKB 2N9LA 1X55A 4P71A 5C23A 3RNFC 4WQOB 2QGQA 5JJKA 5DCNA 2VNUD 3KUCB 1B9MA 4DAPA 2KN4A 2EMTA 4PT5A 1SXTA 2B63H 5IGGA 2LD9A 4PK1A 4GXBA 4EUTA 1E10A 2ZXOA 2WYQA 1SDFA 2MPMA 4IJLA 1PGAA 2L7RA 3SD5A 1XMQQ 2KZRA 1PFNA 1F2MA 2L05A 4EQ5A 4JK1C 2JJQA 3RYTA 4LF6L 3HKZG 4KKTA 2WXJA 2QCZA 1R4MI 2ZXPA 3R7QA 1ZE3D 1TS3A 2UUAQ 1T0RC 3BS1A 2K33A 3L9AX 4OO1H 4L2YA 2L9HA 3PF4A 5E3FA 3IL8A 2KDMA 2B2VC 2HQLA 1XPRA 3RD2A 3S1RB 2Z4HA 3TRZA 1A70A 2WB1B 3KYCD 5IY0A 1HCZA 1PH8A 2D5DA 2BVCA 2NVYH 5CBAE 2ONQA 4GSWA 4HCPB 1A3VA 5CV6A 2CR5A 4XQJA 1SGHA 1PGXA 4S17A 3U8ZA 4A3FG 1EFWA 4X3UA 3OWEB 3U4ZA 2HTHA 3SE0A 2O2VB 4NP5A 3Q0AA 3SK4A 1VD2A 1E8XA 1HR0L 3RMKC 4B3SQ 1I7HA 1CMXB 1Q12A 2WQYB 4PS7A 4WAFA 4KHPQ 3L3OC 2NBFA 3N1XC 1EZ6A 4F8CB 4O0AA 4WJPA 4AYBE 5KNDA 2MW5A 4MACA 1BVSA 1RYJA 3NELA 5JJZA 2O2LD 5L83A 2EJFC 3AU5A 2UUCL 4B0MA 5FO7B 2LJIA 2MHVA 1S5FD 3VR9B 4RKLA 2NZ1D 3P1HA 4NPSA 1U4LA 1YZ6A 3KQ4A 3B0AA 1C4CA 4BY1H 1KXLA 4YCVA 2O6VA 1EU3A 5J17A 5C4JB 5M5YH 5IWAL 2KCMA 4BBRB 2KWCA 3ZJTA 5EQ0A 4BVUC 4R4IA 1PTOF 2ZTCA 1YJNA 4KSKC 3W5UB 2KMCA 4A3KB 3R2TA 1YNTE 4DHZB 2BTEA 4X64Q 3A5ZB 3GD7A 4LF9L 4G7OC 3V2TA 3MTSA 1Y1VB 2PE9A 3NEMA 4M02A 2RHQB 2V1YA 5J39A 2BKRB 1T0YA 4ZHOA 1EIFA 3NVWA 1NYQA 1QZHA 4IUVA 2WXPA 2DGYA 2Z9HA 2K01A 3HKZE 3I57A 4M8NA 4GGQA 3VVWB 3ZNZB 1V1PB 3HOXH 2QF7A 2D0OA 3H3VC 2ZW0A 3RCZA 4IPHA 3C2PA 2E75C 5IAAC 1HQMC 2EYMA 2XIWA 5ELOA 1N61A 1WM3A 4FYDA 1XEEA 3Q6SA 2EELA 2WXHA 1TXYA 1KRSA 4N8FA 1TWCH 4PZ7A 3SEBA 3ZJVA 3RNUA 4II3B 1VDVA 2Y5CA 3CHBD 4JI7L 2N9KA 1STHA 3AEDB 4KX6B 1GUWA 2NN6G 2IX3A 3DVNU 3BJUA 4JGHB 4FF2A 5C0XJ 2K5PA 4OX9L 4XTCS 1J0GA 4OHJA 4JI3Q 3L0WB 3F1ZA 1K3BC 1WR6E 1XX8A 3HK0A 3TP8A 4YHHL 4CKEA 5C3EG 2MEKA 1PZID 2KUMA 3H0GG 1O78A 2K14A 3VTWA 3CCUA 4JI8L 2OCEA 4JI0L 3PREA 3IHPC 1YHAA 4GZYC 2NYZD 3OTOQ 3GTQH 2N88A 2F3VA 2V4DA 1KC8C 4JX1C 2PYKA 3OW2A 3BG3A 2ATWA 1RKNA 5C4XG 1AP0A 2OT2A 2HJ1A 1YQ3B 2AMCB 4GN4B 3D4RA 4DR4Q 4IWQA 5HG2A 4X62Q 3AE5B 2JE6I 3MA2B 4KY5A 3KLWA 1WVLA 3F8TA 1EWHA 1L6UA 2L1AA 2B8FA 3PO2H 1SEBD 2KLGA 1GPXA 3ZTCA 3IT6B 4HCNB 3CKIB 4TUUA 4BY1B 3W1SC 4K8IA 1MJDA 1GC6A 2AX5A 2BYTA 4UDUC 1PDXA 2L0TA 1X9NA 2WDQB 1PTOD 1FXIA 4ARCA 1AEXA 1E22A 5JPNC 3QIJA 2G45B 3KUZA 1H4RA 2RPVA 3PPAA 4IQZA 3CXCA 4R9WA 3Q8AA 2F0OA 1MD2D 2MO1A 1TWFH 4KHVA 2D3CA 3Q8CA 3GTGB 3QC8B 3ZTDA 4LNQA 2X6LA 3J9CA 4HJ5A 2HHHL 3JSVB 4K3BA 2D3BA 1IBXA 1CK1A 2HD3A 4FJZA 4MSQB 4W9CA 1S40A 1LQBA 3NTHA 1TWFB 2KDBA 1FNWA 3TMPB 3HOXG 3RR5A 1FRDA 2K8BA 3OPOA 2OF1A 2WXNA 1TJEA 4XWWA 4YWMA 5BN4A 4DNTB 4RF0A 1X65A 4GN5A 4OL7A 1WXSA 3L08A 4GOPA 4NXML 2LUMA 3B6YA 3S9WA 3U52E 5BYSA 2ZM6L 2OWOA 2R61A 1N34Q 1U4MA 1Y69U 3RZOH 1RRBA 4P7IA 3J81E 4YWKA 1ICWA 4JCVE 1OFFA 1EWIA 1SJED 2H4OA 2JT4B 2N1WA 5CYUA 2PLPA 3WIMA 5C0XI 5CGKA 3EC8A 2N55A 4CKBA 2EMSA 3ALBA 1JWSD 1MJEA 3DEPA 5J2RA 3HOYG 3X3MA 2KTRB 4B95A 1E1OA 1IXRA 3K81C 1ASYA 1EY0A 3MHZA 4IOIE 5C1ZA 1II3A 1X3EA 2NVTH 4NAWA 4A3DG 2ALYB 3DVNV 1VF7A 1OXVA 1IKMA 1BCPD 4LNIA 1UEBA 1BBUA 1JR0D 1N34L 1WYGA 3TL5A 3J80L 1SE8A 2Y0SG 2WXKA 5FR3A 1VQIA 3OWFA 5FJ8G 2FCMA 1QB5D 4AQYQ 1I50H 4A3JB 5KYLA 3VFKA 1HJPA 1EQQA 4IFDH 4A3MB 3NBHB 3HOYH 3S17B 1PFDA 2YTXA 3KVFB 2BS4B 3P2BA 2IGGA 1S4ZA 2R93H 1PHJA 4I7AA 2QEXA 1LFDA 1ET6A 3CCLA 2R7ZH 1O7LA 2ICIA 5KYIA 4PYZA 5CR3A 2M0XA 1I6VC 1IBMQ 3PIPA 1XTDA 1ZGUB 3BK2A 1TWCB 3J7YW 2NTSA 3CRKC 2OJRA 1P3QU 1F2RC 1L1OB 1PRTC 4W9LA 2HDMA 5CV5A 3KOJA 1LACA 4W9FA 4KY6A 4ZQ3A 3PZ7A 1I6HB 1ML0D 3NE5B 2I38A 1CQVA 4C3HG 4DN4M 1TS5A 4KN7C 2INNE 1EEID 4KK7A 1IPGA 1ACCA 4YWLA 2LS01 3IFWB 1C79A 4BBSG 3N52A 1WI0A 4NJCA 4EX5A 3U9OA 5BN5A 1YX5B 2Z1CA 3NY5A 4JI5Q 3CCEA 2EPBA 4LNOA 3K7AB 4LFBQ 1QNKA 2CJNA 4ZHPA 1MHWC 4MDKE 2EVBA 1OXUA 3RN2A 3DBLI 3QOLA 5I2YA 3KLSX 1KM7A 2DLBA 5BN3A 5JH5C 4QJFA 3DM1A 3GTMB 3PRZA 2F0EA 4OVVA 2E5LQ 1A62A 5K36H 3NVVA 1R7SA 1P9DU 1R4NB 2PO4A 3NHHA 3H9DA 1B3AA 3T3OA 3PO3H 1N5XA 4MGKE 4J3OD 2C7HA 4WH4A 3GTQB 1FO4A 2D2QA 4C00A
chains in the Genus database with same CATH topology
4U673 4CQNA 1ZOYB 5CORA 1SFOB 2VB2X 3M7GA 1VLBA 3M4YA 4ZOHC 2JYTA 4EQOA 1TVXA 1PFBA 5E4WC 4G7ZC 3C3LA 2QDBA 5CV4A 2K22A 1O7YA 2IT1A 2F0HA 3HS0C 3HVZA 3J7AF 3DXJC 1EQTA 4YSYB 1TKEA 3GQBA 2JQRB 1A3TA 2HTME 2BA0A 5HI1A 2K6AA 4G4KA 3D4WA 2ENBA 4DK1A 1SSNA 3FMCA 2RBMA 4KKJA 4FF1A 1CZWA 2W54A 2XSCA 1MI0A 4KGSA 1J7AA 1BCPF 4ZK9B 1HFGA 1QWYA 1QCBD 5I6WA 3AE7B 2WLBA 3SFEB 1IW7C 3VR5A 5KEEA 4IUNA 1RTOA 2CW0D 2Q8RE 2ACZB 3AB5A 2M00A 4K5XA 4A90A 5DM63 2IX0A 3AE3B 3E0JA 2EJMA 2C5CA 1HHVA 4DA2A 4ZYSA 2RVLA 1H9SA 4OO1G 3AB9A 4KKSA 5E4XA 4Q5VA 4RGTA 2B2YC 1TWGB 3IFDA 4LLGM 4JE3B 5EE0A 4P16A 2R93B 1QOHA 1DXMA 1E9MA 3VR2A 1QOAA 1LTGD 5CMDA 2KWDA 1OXTA 3WDNA 2B2TC 2L5TA 2J0TD 2WACA 1EY7A 2E74C 1GOZA 4JWSC 4YIJA 4DQOC 4DNRB 4N6EB 3I3CA 1FCLA 4K5WA 3J80E 3NP8A 4OO1I 1Y56A 3QIAA 4YTNB 2B2TA 2FMMA 1SNDA 4K6LA 2WXIA 2IPKD 1TQOA 1KDCA 2SAKA 2B63B 4LJZC 1DOMA 3AEEB 1IBXB 5KGUA 1HFNA 1VR9A 2EZVA 2J42A 2K32A 3S15B 3PZ8A 3IT4B 2CU3A 2EJGC 2WIIB 4J8QA 4ILWA 2KCNA 3I73A 2Y3AA 2F0SA 3EGRA 1DOIA 4N9TA 2BS3B 3A54A 4N58A 1EL0A 1PGBA 4MT5A 3SR6A 3JAME 1S5DD 4EQPA 1IYVA 3J7AV 2PVOD 1NEKB 3KBXA 5M3FB 1RD9D 3TMEA 1TR5A 3OW7A 1HA5A 2WP9B 5T8IA 4MHEA 2OEOA 2MP1A 2DWQA 4WFN3 1AW7A 4BS9A 4QUCA 2L55A 2VZKB 1KNEA 3AV8A 1QOBA 1Y8OB 3NQIA 2D5GA 1D1KA 1O7ZA 3T51B 2A74C 2K04A 4CJ2C 3EQLC 2W82A 3TEZA 2NVXB 4A3EB 3D6CA 5AFWA 1GUSA 3VR4A 2F0MA 3PIO3 3HP3A 1TKWB 1V1PA 2OXPA 4CHTB 2K1BA 4RCOA 3KUPA 3BYTB 3W3AA 1UGJA 1T3QA 1KDBA 2QJLA 5BMHA 1UWMA 1K51A 3U4EG 3NPPA 2AQ1B 4FP5D 2KHSA 2B39A 1HTLD 3K57A 5M9OA 3I72A 3HOXB 3AH7A 2INPE 3HRZC 1OXXK 3PUXA 2K3UA 1T5EA 3R3OA 3D6WA 3AE1B 4C80A 5G3LF 4KTAA 1VZ8A 1ET9A 3OHXC 3ABVB 1DYQA 1KNAA 1ZUD2 4OZAA 5M5YB 3GTLB 1QNUA 5FKAC 2V0GA 1G8ZD 3BDCA 4FO2A 5CC4A 2ID0A 4IKGA 4NW2A 1PUTA 3C46A 3QO2A 3Q8BA 1ZXHA 3MXPA 1RJTA 1M4VA 4R3DA 2KVMA 1BCPB 4AS1A 3M85A 2SNMA 3RD4A 1JQ4A 5LNK1 1H9KA 1ZPSA 3ONAB 4HMJA 1P7EA 3PO0A 2QMTA 1KDAA 2KJXA 3TEWA 1BUVT 3V05A 2OHFA 5BYQA 1A2UA 4IFDI 2D62A 4M1UB 3SR1A 1PTOC 2A73B 4MH8A 4GDKB 3HG9A 4KD3A 2DY8A 2PQEA 3M4OB 2F1MA 3FDTA 3P7JA 1K53A 2HDLA 1WTQA 1AZPA 3H6MA 5F2DA 2B2WA 1TU2B 2QSDA 3OMCA 5COYA 4V0BA 5C0XH 3S1MB 2FE8A 4XDDA 1F2YA 1PRTF 1A2TA 5BMGA 3NBHA 3VYTA 2LEKA 1YNNC 1V97A 2EYJA 1BF4A 3ERQA 2MH7A 1PMRA 5D3DA 2WNMA 3CIRB 1C4QA 2Y5PA 4XE0A 1GUNA 4RKBA 1UNSA 5LHY1 2H89B 2ON8A 3D3RA 3S1NB 2BBCA 3UI3A 5IGDA 2Q8IB 1Q3LA 4PNYA 1WD0A 2O5IC 1AWDA 2JX5A 2M0AA 3KWLA 3SK5A 2AWNA 2BCOA 2J4XA 1NCVA 3W2DA 1EOTA 2WKCA 5JEAJ 1VRAB 2PMVA 4WORA 3EFXD 5K5PA 3A7LA 1NYRA 1IKLA 3BVMA 4K2LA 1L4DB 2EOTA 3KF8A 2PVGC 2CJOA 3DWQA 3NQTA 3NXWA 3IAS1 4FXKC 1C48A 2MJ8A 1WSPA 4FVMA 4HR7B 3HUIA 1JWUD 1LTTD 1H9JA 1F2LA 3ETRA 5CBEE 1FEHA 3FPUB 1C8CA 2DY7A 1JMLA 2PPBC 1ESFA 1TIID 5EE1A 4KD4A 1Y8NB 1I4PA 3MXNA 4KGTA 1KH0A 3S2DB 2JWUA 1BMLC 4LK0M 2OEDA 3T53B 1WTOA 1MSHA 1EYCA 2K5DA 1BR9A 2L32A 4KY7A 4ZKBB 2Y0SB 3S16B 3FC4A 1SSOA 1CTMA 1RHPA 1UEAB 4DGZA 1VF5C 2K03A 1FXAA 2NMQA 3W1SA 5JEAG 2AQ3B 2XRSD 2L52A 3QB3A 1C76A 4IUPA 2DBYA 2E3TA 1Z7TA 1ZXTA 4U68A 4ZLTF 2JEBI 1B1ZA 5A2QE 2F0JA 1STBA 2JA6B 4ZKCB 1FMAD 2ICEC 3FKIB 2QEJC 3OOCA 4C3HB 2X38A 3PO3B 2WXLA 4RNAA 4H2AA 5D3IB 5ELBA 1HXYD 3I4NB 1EY4A 1CM9A 5BMIA 1MHHE 3DEOA 1JOQA 1ENFA 1SNOA 1E6EB 2F0UA 3HEJA 3M7NA 4MN3A 1B4OA 1CZGA 2Z8LA 1E0BA 3SXHA 5I9OA 3PUVA 1BNZA 4FF4A 3FRPB 1N63A 1FNVA 4P2CB 4A55A 1LABA 4ID6A 3HVDA 2MGSA 2M56B 1PTOH 4OGQC 3PIP3 1FFUA 2A6ED 3I70A 4F8MA 5I4DA 1PRTD 1D5ZC 5BYRA 1EY6A 4OZBA 2V4IB 1SE4A 4ABNA 4L6TB 3IAYA 1SMYD 1RODA 2O4XA 3SK8A 1RWSA 3VR8B 1L0VB 2RMMA 1CT1D 4ARIA 5HGTA 4X3TA 1EFID 3OIPA 3AMUA 2SNSA 3K6OA 4YWGG 1ZYRD 3QG1A 4EGVA 1HRJA 1DOYA 2DNEA 1ZEQX 2E76C 3KLRA 4MIUA 5G5GA 4BWGB 1SBBB 2WXOA 2O5JC 1JICA 4A3DB 4J6HA 1EM7A 1JROA 4A6QA 3X3NA 1H9SB 3H91A 4HN7A 4A3IB 3B2FA 1KAAA 3P75A 4IFDJ 5IGBA 1F2ZA 2K0PA 4RHRA 4Q0FA 3R8BA 2VXWA 3TBIB 5FLXE 2PKOA 3RZDB 2F0KA 3I9V1 4DK0A 3BK1A 4NKLA 5H8YE 1WGKA 5EPJA 1SNMA 3DMUA 5G3LD 1B50A 5E6JA 5AUIA 1BOSA 4A3BB 1LTBD 2WDRB 1EU4A 3MEHA 3PO2B 4ZRQA 4HROA 4NDXA 1Z6HA 4N59A 5LL6X 3EA6A 3N9YC 1JWMD 5JPMC 3I91A 3URYA 3I4LA 1PFMA 1LLRD 5D65A 4QB4A 1S5ED 1I50B 3CWIA 3NVYA 1STAA 1PYWD 1VCIA 2EY2A 1EQVA 1OQQA 4RHSA 4HMIA 1E0ZA 2Q8TA 2SDFA 1VMPA 1Q1BA 2L4NA 4TQ1A 1J7CA 1HEZE 4QMGA 3SDZA 3HGBA 1BBXC 1LV9A 2GB1A 4B9XA 4AYBB 1V8QA 1MSGA 4LTUA 3QOJA 5J22A 4GDLB 3Q24A 1PZJD 2LY7A 1WCMB 4K2KA 1HUNA 3GO5A 3W5VB 1YQ4B 1FYCA 3BDLA 2B2UA 4MM3B 1WTWA 1LT4D 1SNQA 4FXGC 1ILQA 3T56B 1EY5A 3I90A 4F7XA 4H13C 3A8JE 1B53A 5C5LA 4ZUJA 3MJ5A 1NAPA 5JEAH 1U4PA 5EBCA 5A2QL 3OIQA 4IUQA 2RQXA 2WDVB 1KABA 5IIFA 1J8IA 3E6ZX 3AM9A 3TEXA 4ME5A 4O42A 2MJDA 2NVTB 2LKVA 3AECB 1SYDA 3ND9A 3W9CB 3K0YA 3MXUA 5I6YA 1CJEA 1KTKA 4Y7NB 2A6HD 2D9UA 3AN1A 3GTJB 3D8GA 3MAQA 1U4RA 1FRRA 2NVQB 2B2WC 1JC7A 5DAUA 1ZP0B 1BDOA 1NI3A 2NN6H 2EYPA 4XDXA 1FGBD 2WU2B 2DYMA 2K28A 3SK6A 1X3QA 2AQ2B 1I4GA 2QIEB 1YN5A 2WV6D 2LHEA 5FO9B 3VRBB 2KCCA 3EVQA 1EIGA 1NVID 1DOKA 1HZ6A 3KBGA 2DN8A 1B44D 1K8MA 4RGOS 1TY2A 4NMZA 5T1IA 2J52A 3GTOB 1KLGD 4KHZA 4DU9A 1RTNA 1C9FA 1FNUA 2WP8J 3K5MA 1JWBD 5KNCA 1RFKA 4PMCA 4L23A 3NS1A 4XXEA 3H8HA 3H0GB 5JVG3 2JZPA 3P4QB 4HTHA 1TZOA 4A3FB 3P4SB 4TRDA 3FEWX 1MGSA 3T4AC 2JXMB 1OO9B 3U9SA 1JE4A 4F88A 3BDOA 1X3PA 1FCCC 3TZDA 2GI9A 3H94A 3A7AB 5EKLA 2D2CC 3AE6B 5D14A 4QUFA 4XIGS 3TUOA 4B0EA 5G5HA 2JSVX 4IZ8A 1Q8IA 1V1OA 2L11A 1IUEA 4HCSA 2EY6A 5C4XB 3L7ZC 3LNNA 1EY9A 3KK7A 4H0LC 4OIKA 2F3WA 1WWTA 1E2ZA 3RUZA 2BW2A 3D4DA 4KKUA 1TWAB 1L0YB 4JBWA 3GB1A 1XYIA 2IX1A 1F9SA 2EYHA 5M3MB 3MP9A 1C4AA 5HFYA 1YMHE 3PUZA 4A93B 4Z9CB 1T6BX 2LFNA 3DHQA 4DXFA 2GRIA 1C4PA 2PZTA 1QF6A 3IFTA 1VZ6A 1PXUA 4RAUC 1F9RA 1K50A 2IGDA 2BDOA 2H1EA 3E56A 1LTAD 2B8GA 2IJ0A 3AEBB 1PRTB 1QILA 3VQIA 2VB3X 2YYZA 3MFGA 5CV7A 4RWSC 2KAJA 1CA6A 3TSSA 5K36G 2F0GA 2AWOA 4KGRA 2GA4B 1SYEA 2N0SB 3PV0A 3WOEA 4IN3A 2X6GA 3BYYB 1P7FA 5ELDA 3NWSA 3TDQA 4H7BA 3E5SA 2BT6A 1YNJD 1SYCA 3CQZB 4CJ0B 2ZW1A 1VMCA 2A5HA 3Q22A 3RZOB 1I4RA 2I46A 4EE2A 4J1MA 2WXRA 5KRUA 5I2XA 3NWTA 3SFDB 4RCNA 1DOXA 2NWGA 2F0NA 2EDGA 1K52A 4H44C 1F9QA 2EYFA 5EPKA 1JRPA 2AUKA 3RLFA 2YU9B 1GHKA 2PMZB 1N62A 2XNAC 2PNRC 2YEPF 4A8XC 4OIJA 1SNPA 1XTCD 1TS2A 3U2SC 2KOLA 2I07B 1X32A 4TSSA 3KWVA 2G1EA 5EE3A 3IXSA 2PZWA 2EY5A 2K5QA 2V3PA 4XQNA 2WXQA 5IGEA 2IWHA 2MUYA 2BE5D 2NUCA 4RH6A 1V8CA 2K5WA 2ZT9C 3PUWA 1JB3A 3S1QB 5EE9A 1ENAA 1ESRA 1IL8A 3VA7A 2LGIA 2G9DA 5ELCA 4WRDA 1WXQA 2EE1A 2E2DC 1D4BA 1GUTA 1SYBA 3HOUB 1IHZA 1SNCA 3GTKB 2CVRA 5HURA 1ROEA 1V43A 3MXGA 1QQRA 2F0PA 4EVOA 5FOBB 1CQFA 1S5CD 3ND8A 1G6ZA 4YTMB 2I2YA 1H9RA 1UAPA 2K05A 4RGNA 4RGMA 4L1BA 4C3JB 3OMGA 1IGCA 4A9AA 4HKZE 3AMZA 3A56A 5EKIA 3AEAB 4DF7A 3T3NA 3GV6A 4G7HC 3OSOA 1E7PB 4FXCA 4HJGE 3AU7A 1ZXIA 3EJIA 1YJJA 3C1FA 1XXGA 3C1EA 3MHBA 4X3KA 2QCPX 2XWJB 4HCEA 3N6RA 2JSOA 1H9MA 3BVGA 1BCPC 5ELFA 1EZ8A 2DNCA 1SF0A 3K5NA 4UAIA 1PDQA 4XT1B 4PMWA 5EBDA 1PLFA 1XWEA 3LB8C 1YN4A 1L4ZB 3DWPA 3TEYA 4C3IG 3B2GA 3TN2A 1RM6C 2KECA 2FBWB 1B9NA 2PW5A 1E2VA 1N60A 3M3YB 2HUGA 3SHLA 3S2HB 3AE9B 2BOSA 4JPSA 5EJWA 2KMMA 1CA5A 3Q8EA 3NK9A 3R93A 1XF5L 2KA7A 3B9JA 2F0LA 4D2KA 1XLQA 1GJXA 4S3SA 4HEDA 1G2SA 3K59A 5C2TB 3TZUA 2BDNA 1DM0B 1TT2A 1STNA 3QJYA 1HPCA 1ZYRC 1JORA 5EKKA 5IT9L 3P42A 1F2RI 3EROA 4HAEA 4IURA 1IGDA 2PIAA 3WCQA 3F2UA 4C7YA 5C4ZA 4C7ZA 1AYFA 4TQ0A 4IALA 1SMYC 1T5XD 3P63A 2AUJD 4KI0A 2J7ZA 1I4QA 2W3RA 4CBVA 3A55A 2TMPA 4K6DA 1UWXA 4R8NA 2EKIA 1Y8PB 4FXDA 5NUCA 2A6EC 2KEEA 1I4HA 2F0VA 3MWYW 1BUIC 5C5MA 1RF2D 1B9RA 5JAVA 4WWMA 1EEFD 2WXGA 3RFZB 2WS3B 4IUTA 2JA7B 4YTPB 2XN9C 5CV8A 3A8KE 4XQQA 3T16A 1XO3A 2F0DA 3TP7A 4KMUC 5C0XG 1QKZA 5IOCA 3HOZB 3GS2A 3JAML 2LMCA 5HHDG 1QOGA 5I9PA 1QE6A 2B2VA 1DJRD 1O80A 1XLPA 2L0CA 4HRSA 1AN8A 3RPFC 1RDPD 1Z47A 1EYAA 4F87A 3K5OA 2ZXRA 1GB4A 4ZAIA 2BE5C 1GUOA 1GB1A 2MJEA 3TP6A 1VDZA 4CJ1B 3HKZB 3FILA 2HCCA 4NZLB 4DAVA 1UUPA 1SAPA 5LL6S 1J7BA 1R4PB 5C4HA 2L1BA 2G9HD 4C2MB 2WAQB 3L4PA 1SYGA 5ELEA 2R3ZA 3R2IA 4WQMA 1N5WA 1FD6A 2EYOA 5AUKA 4XWTA 2E2JB 4DAYA 4IUUA 1F77A 1LTID 5TSSA 5MPOA 1QT9A 1MBYA 1TS4A 1EWCA 2RDGA 3P20A 3P1MA 4US8A 3MZ5A 1Q10A 1SJHD 1C77A 2HQEA 5H92C 2W55A 2E2HB 4YSXB 2R7ZB 1FFVA 1CZPA 2TSSA 2NTTA 4PMBA 1KF6B 1TYGB 1SYFA 3HOYB 3I4MB 1AFPA 2RDHA 4LK1C 2RSNA 1SIJA 3FILB 4XYOA 5FLXL 1GHJA 3C8YA 1SE2A 5DEHA 1YNJC 2F0FA 3AE4B 3PUYA 1XCTL 2SOBA 2R6GA 3LWEA 2YEPB 3GP7A 4BA1I 4M0WA 1BXTA 3LX0A 3BVZA 3WOFA 3HOWB 3ZQ4A 2W3SA 2JXTA 2WINB 3LWUA 2J53A 2K9XA 2B2UC 4GLSC 3GTPB 2RKSA 3J81L 1DCZA 2LHDA 3NUHB 5J1ZA 4KJOA 5IODA 2FJ2A 1QOFA 3HRDD 4JWUC 4QCLA 5FK9C 5C3WA 2PW7A 2JA5B 3P4PB 4RFBA 4RA8A 2FUG1 4YXDB 3CRLC 4E6IA 3PMFA 1HTPA 2F0TA 4R8IA 4LAAA 1JCKB 2F4IA 4WJWA 1CHPD 4A3GB 1D5XC 2LFIA 5KIXA 4I65A 5C6AA 1LT3D 4XDCA 1F9PA 1YNND 3VRAB 3DWGC 2R92B 3V3XA 1WTPA 2K7VA 1BQQT 3S14B 4BY7B 2IDYA 4BA2I 2A68C 1NR4A 2B76B 4C3IB 2Q5WD 1TKYA 3MVVA 2QKIC 1A3UA 4PV1C 4DFAA 1HZ5A 3HZXA 5GXGB 4K8JA 4K5VA 2C9OA 1ILPA 3LYYA 1LTRD 3VA5A 1K8OA 4LMQD 1STEA 2WXMA 4XYQA 4FNFA 2WKDA 4HSPA 2CHBD 2XVSA 2A69C 4TQUS 1GUGA 4ITKA 1G2TA 5DM73 3VYUA 1YN3A 1LO5D 2M9VA 3BZDB 2EY1A 2JEAI 3AEFB 4QF4A 1JQYD 3NRZA 4HKQA 3MFYA 1B2TA 4REZA 3Q23A 4DXGA 1VJKA 5M5WB 4WURA 1CHQD 3DUZA 2RDFA 4ODGA 4ZUIA 4C56C 2RA4A 3E9SA 3D31A 1S5BD 1BO0A 3NBIA 5C3XA 1IYUA 2RSOA 4PQXA 1R9TB 1DZ1A 4OW0A 2V3NA 3ZYYX 1JWAD 2HDEA 4M8AA 1F0ZA 1WD1A 4QIWB 1GXDC 4HSVA 1KLUD 1I4XA 2CW0C 2MJ3A 3NUCA 3ZGZA 3NTIA 2L12A 2BS2B 1DD2A 3NVZA 1HA6A 3ZJUA 2CQAA 1SB3C 3Q69A 5T1GA 3AE2B 5EGTA 5A35A 2A6HC 4I7ZC 3I8ZA 4ZRPA 2IGHA 1MI2A 2VZKD 4KKIA 4NAMA 2NVYB 3RMHA 3FVQA 4O1NA 3BIID 2Z4IA 1HQRD 4ZRZA 4L63B 5EPLA 2WXFA 3VYSA 1FIQA 3HOVB 3FPPA 1XCQL 2PTLA 1EYDA 1D5MC 2F0IA 1RCVD 1KFYB 2H88B 2L83A 1Y1WB 3IAM1 5M5XB 1L0XB 4EQNA 1L6VA 2JU6X 4AQ7A 5C3EB 2BB5A 1ZDXA 2F0QA 4YT0B 1FD7D 5C3JB 1STGA 4KV6A 1JOOA 1I3QB 1ZDVA 1K83B 2JYOA 1TKGA 3P4RB 5IT9E 3GV3A 1LT6D 3KLSA 3U7ZA 2NB0A 1FM0D 3A8IE 4US9A 4WIPA 4Q2JA 2NN6I 1ENCA 2DYOA 5D7GA 1J9OA 2E2IB 1QJOA 1EIHA 2F03A 1PTOB 4USAA 4CKCA 1DGJA 2EXZA 2WU5B 3IKJA 5CV9A 4FF3A 2KQ4X 4OZCA 4HEA1 1A6XA 1HUMA 1D2BA 2M19A 1OQRA 2PW9A 2FINB 3G7LA 1QG7A 2BB6A 3K58A 3NTKA 3DWAA 2JP1A 1AZQA 3K5LA 1KRHA 2LMCB 2IL8A 3G6JB 3SVMA 4L8JA 1LT5D 1TY0A 1DONA 3BWUD 3T13A 3VR3A 1JOKA 1GAQB 5IGFA 3Q8FA 2QILA 1PZKD 1G291 2X69A 2JA8B 4XT3B 1NSNS 3O13A 2XWBB 3LXFA 4K14A 3QWNA 4RF1A 1ONLA 1EY8A 3CU7A 3NSWA 3NZ3A 4ULLA 2N7JA 1JW9D 3AE8B 4OVZA 3EUB2 3V96A 1WTVA 1WRIA 3MC0B 1R4QB 4V190 4B08A 1NUCA 3FAHA 1A15A 2FFKB 1M8AA 1MHXA 4BBSB 4KN4C 2A69D 4P6VF 1QLBB 4TKOB 1Q90A 1C78A 3TP5A 1W6KA 2FHTA 5DNFA 5JXVA 1G91A 1WTXA 1JALA 2VUMB 4IDIA 4CGYB 1ZKOA 5JOBA 5ISRA 1D6EC 1IW7D 4KJNA 1CI3M 1EWYC 1OXSC 2IW3A 2XRQD 5JVH3 1XLNA 4NAWB 4IFDG 1SE3A 5KNBA 5C44B 3H09A 4YSZB 1U9RA 5FO8B 1Q1EA 2KACA 1XLOA 2A68D 1MVKA 4B9WA 2SEBD 1STYA 3UI2A 1L5PA 4C1NI 1CFMA 1WTRA 1D1IA 3ITPA 1VZ7A 2BA1A 4X3SA 2M2LA 2HCIA 2JYEA 1TWHB 1FR3A 2KEDA 2E6XA 3DWMA 4TMAB 2FMCA 4C3JG 2PZUA 2B2YA 5IGCA 1NR2A 3VR6A 1E2WA 2F0WA 1LTSD 4G57A 5E1FA 2EYLA 1DOLA 4C1NK 2PCFB 1MPEA 1YJIA 2KQ3A 4N9PA 3VYRA 1NENB 1W6JA 2N9LA 2VNUD 1B9MA 4DAPA 2KN4A 4PT5A 1SXTA 5IGGA 1E10A 2ZXOA 1SDFA 2MPMA 1PGAA 1PFNA 1F2MA 4JK1C 4KKTA 2WXJA 2ZXPA 1ZE3D 1TS3A 3BS1A 2K33A 3L9AX 4OO1H 4L2YA 2L9HA 5E3FA 3IL8A 2KDMA 2B2VC 3S1RB 2Z4HA 1A70A 2WB1B 1HCZA 2D5DA 2ONQA 5CBAE 1A3VA 5CV6A 4XQJA 1PGXA 4X3UA 3OWEB 3SE0A 4NP5A 3Q0AA 3SK4A 1I7HA 1Q12A 2WQYB 4WAFA 3L3OC 2NBFA 1EZ6A 5KNDA 4MACA 1RYJA 5JJZA 2O2LD 2EJFC 4B0MA 5FO7B 2LJIA 2MHVA 1S5FD 3VR9B 4RKLA 2NZ1D 3P1HA 1U4LA 3KQ4A 1C4CA 1EU3A 5C4JB 4BBRB 3ZJTA 5EQ0A 1PTOF 3W5UB 2BTEA 4A3KB 3R2TA 1YNTE 3GD7A 4G7OC 3V2TA 3MTSA 1Y1VB 5J39A 4ZHOA 3NVWA 1NYQA 4IUVA 2WXPA 3I57A 2K01A 1V1PB 2QF7A 3H3VC 2ZW0A 3C2PA 2E75C 1HQMC 2EYMA 2XIWA 1XEEA 1N61A 2EELA 4FYDA 2WXHA 3Q6SA 3AEGB 3SEBA 3ZJVA 1VDVA 2Y5CA 3CHBD 4KX6B 2N9KA 1STHA 3AEDB 1GUWA 2NN6G 2IX3A 4FF2A 5C0XJ 2K5PA 4XTCS 4OHJA 1XX8A 3TP8A 4CKEA 2MEKA 1PZID 2KUMA 1O78A 4GZYC 2NYZD 2N88A 2F3VA 2V4DA 4JX1C 2PYKA 3BG3A 1AP0A 1RKNA 2OT2A 1YQ3B 5HG2A 3D4RA 3AE5B 2JE6I 3MA2B 4KY5A 1WVLA 1EWHA 1L6UA 2L1AA 2B8FA 1SEBD 1GPXA 3IT6B 3CKIB 4BY1B 4K8IA 2AX5A 2BYTA 4UDUC 1PDXA 2WDQB 1PTOD 1FXIA 4ARCA 1AEXA 5JPNC 2RPVA 4IQZA 4R9WA 3Q8AA 2F0OA 1MD2D 4KHVA 3Q8CA 3GTGB 2X6LA 3J9CA 1IBXA 1CK1A 3NTHA 1TWFB 1FNWA 1FRDA 3OPOA 2OF1A 2WXNA 1TJEA 4XWWA 5BN4A 4DNTB 4RF0A 4OL7A 2LUMA 3S9WA 3U52E 5BYSA 2R61A 1U4MA 1Y69U 3J81E 1OFFA 1ICWA 1SJED 2H4OA 5CYUA 2PLPA 5C0XI 5CGKA 2N55A 4CKBA 1JWSD 3DEPA 3X3MA 1EY0A 3MHZA 4IOIE 1II3A 1VF7A 1OXVA 1IKMA 1BCPD 1JR0D 1WYGA 3J80L 2WXKA 5FR3A 3OWFA 1QB5D 4A3JB 5KYLA 4IFDH 4A3MB 3S17B