2NTTA

Crystal structure of sek
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Staphylococcal enterotoxin K
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nttA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nttA01
1KTKA 1RD9D 4K6LA 4RGNA 1I4RA 1TS3A 1V1PA 1GOZA 1L0XB 1TS2A 3TSSA 1TS4A 1BCPF 1JR0D 1RF2D 1LTID 1LTTD 3DWAA 4RGMA 3GP7A 4UDUC 1D5XC 1MD2D 2QEJC 3BVZA 1JWSD 2AQ1B 1PTOB 1HXYD 2IJ0A 4L63B 3DWQA 3MC0B 1XXGA 1D6EC 4ZYSA 5I4DA 1HA5A 3BYYB 5ELBA 3SEBA 1RDPD 1FD7D 2WV6D 4C56C 1DYQA 2XRQD 1CHQD 1BXTA 1I4QA 5FKAC 1EWCA 5D3DA 3KLSX 1CQVA 1PRTF 2IPKD 1S5ED 4OHJA 5ELCA 3MFGA 1PTOC 2NTSA 4TSSA 1EEID 3BVGA 1KLUD 3URYA 4RCOA 1SEBD 2XN9C 2QILA 1PTOF 4RHRA 2AQ3B 1TS5A 1S5CD 1PRTC 2R61A 1D5ZC 4BWGB 1M4VA 1G8ZD 1EFID 3R2IA 1L0YB 5FK9C 4DXGA 1FNUA 1HTLD 1S5BD 2O2LD 2TSSA 1HQRD 3BZDB 1B44D 1CT1D 1YN3A 1I4XA 2G9HD 1PRTB 1RCVD 1DJRD 1D5MC 1STEA 2XNAC 4NZLB 3R8BA 1LTRD 1JWMD 3CHBD 1FGBD 5ELEA 4RFBA 1B1ZA 5TSSA 1YN5A 2RDHA 3OWEB 3EA6A 2RDGA 5ELDA 1I4GA 1LT6D 1JQYD 1LTBD 1PRTD 1PYWD 2ICIA 2Z8LA 3BYTB 1BCPC 3EFXD 1SJED 5D3IB 1I4HA 1LT3D 1CHPD 2XRSD 1SBBB 1LT4D 1UUPA 3W2DA 1SE3A 1SE2A 1V1PB 1FNWA 4RHSA 4RGOS 4RH6A 1S5DD 4DXFA 1ENFA 3R2TA 1V1OA 1S5FD 1F77A 1PZID 3BVMA 1JCKB 1TY2A 1FNVA 1PZKD 2J4XA 1TY0A 1XTCD 5ELFA 1EU4A 1JWUD 1LLRD 1BCPB 1SJHD 1T5XD 2SEBD 4O1NA 1LT5D 4L6TB 1AN8A 1KLGD 1LTAD 1ESFA 1PTOD 1ET6A 1SXTA 2NTTA 1LO5D 3DWPA 1I4PA 1SE4A 1CK1A 4RGTA 1BCPD 3V05A 1YN4A 2AQ2B 3O13A 1EEFD 2CHBD 1LTSD 4Z9CB 1LTGD 1AW7A 1ET9A 1QILA 1UNSA 1EU3A 1PTOH 1PZJD
chains in the Genus database with same CATH superfamily
1Q90A 4K5VA 4TV3A 3H9DA 1R4QB 1Y1WG 2BB5A 1IBKL 5BYRA 4LF6Q 1KRSA 4C3HH 5C44B 1EY4A 1YEZA 3VHTC 2KVZA 4DV1L 2R93G 4GDKB 3K81C 2NN6I 5F2DA 1STAA 3FPPA 2N78A 4DAYB 1VQPA 1FXTB 1LQBA 2RGFA 1VMCA 1HXYD 1VQAA 4NAWA 1Y1VB 2LMCA 1P7EA 3TIXA 4G7OC 3DBRI 1PV4A 3RCZA 3DEPA 4PG3A 2XK5B 4W9HA 2ZVOA 3LNNA 3I4MH 3MXUA 5D6JB 2E5LQ 4YIJA 1BXTA 2PTLA 4AUQC 3NUHB 1X3FA 1KHIA 5D3DA 1WE6A 4ZRIA 3Q24A 3UDIA 4WWPA 1K3BC 2F0IA 1BBWA 1KXLA 4HDQA 3TBLD 4JCVE 2D3GA 5IT9E 1X3GA 1A3TA 2D3BA 2PE9A 4DK0A 2KWCA 1N62A 3AEEB 4OEMB 3APDA 1JOQA 3RLOA 5C3EG 3KYCD 5M3FH 5KHQA 1WX9A 3UGBB 3BS1A 2KJRA 1CZWA 2KQ4X 3K7UC 4HTHA 4QL5A 4JI6L 4HEDA 1K8RB 1HFGA 2I38A 4BA1I 4BY7G 1VQ9A 4JL9A 4FVMA 1E2WA 3CSFA 3AYHB 2KMMA 2KX0A 2MWSB 2TSSA 3BZDB 4KGTA 4BZAA 1RKNA 1UWMA 3N1XC 3EQLC 3H3VI 5H8YE 1IBXB 2RHSB 1DOLA 3QARA 1WGHA 1B1ZA 5C5LA 2L9HA 1W6KA 2RDHA 4TKOB 2NZHA 3V2TA 1RRBA 2N88A 3KOJA 4OZAA 1TWAH 1V1QA 1C7YA 1LT6D 1JQYD 2LEKA 1PYWD 4C3IG 3A54A 3KW5B 2B2WA 3V6EB 2F0JA 1B3AA 2MJ3A 1JOOA 4CDFC 4PV1C 2NPTA 1YHAA 1R4MI 4X6AH 3QO2A 1SE8A 4G57A 4NXMQ 2VH2A 2F0UA 3ERSX 2DAFA 1ZXTA 5HURA 2N8NA 4IFDG 2KT7A 2ZJDA 1NR2A 1TWAB 2HCIA 2PZWA 3KJOA 1F1HA 3DBLB 1N33L 4P75A 4ZDVA 3DXJC 4QCLA 4DV7L 2G4SA 3RN2A 1UGMA 5C44G 2CCZA 1WJ4A 2SEBD 3ZNZB 3ZQ4A 1Y1WB 1E8YA 1H95A 1UD7A 4AYBE 4YTNB 2NVQB 2IGGA 3TUOA 4FF4A 4NPSA 2ZM6L 4KKTA 5KNBA 1NUCA 2H4OA 4K2LA 3SXHA 3E5SA 1ZKHA 4DAVA 1OXSC 3FHWA 3M62B 2KCCA 2JX5A 2L32A 1I6HB 2ATWA 2M19A 4XT1B 3NVZA 2RPVA 4HR7B 5ELNA 5D14A 4K3BA 3LWEA 4TVAB 1LTSD 1L6VA 3QIAA 1FRDA 2F0HA 2MQJA 4PYZA 3FAHA 2RA4A 2YTYA 1KD1C 4PZ8A 2QCZA 4IWQA 2LVOA 3OMCA 3L13A 1EOVA 1SAPA 5JEAH 2DNFA 5DNFA 3J80i 1Q12A 3P4QB 1N8RC 4GU2A 5EGTA 3AE8B 3QWNA 2X69A 3OYYA 2LHEA 1JRUA 4OGQC 4RGMA 4P73A 1J5EL 1KABA 5D2MB 1V80A 1EUJA 1PTOB 3OTOQ 4EOYA 1GPXA 1U4PA 1IYJB 2IJ0A 1SNPA 1G51A 2AL3A 2BYFA 4ZYSA 4ICVA 5E1FA 4W9GA 3MHZA 2W82A 3J81j 1Q1EA 5ELBA 2OQ0A 3I70A 4IOAA 1XMQQ 2C35B 1GC7A 1CHQD 3K5MA 1QOGA 4OXPA 2KD0A 4A3KH 3I57A 2N9EB 2ZTEA 4KHZA 1RLFA 3A9KB 3ZNHB 4UP8A 5A2QL 4FNFA 4LNOA 1X9NA 1OQRA 1PGAA 5FLMH 1MJEA 4A8XC 3URYA 1ASYA 5C4XH 1TQOA 4P16A 2I2YA 2Z0EB 3EROA 2NVTH 2MPMA 2MEKA 2O2VB 4LF8L 4C7YA 2M56B 1YJJA 4LJZC 1GHJA 1IGCA 1LACA 4GDLB 1TWCB 1OO9B 1G6ZA 2B2UA 1ESRA 3VRAB 5C4JB 1PRTB 2CJNA 5GQOA 2C5LC 2MFIA 5JHAA 4JV5L 1R4NI 4KY5A 4J1MA 4HMJA 4MH8A 5EE3A 3C1FA 1A3UA 4HSPA 4L5QA 5GAHC 4DV1Q 1ZP0B 1T0QC 3TS0A 1U4LA 2ENBA 4U68A 1A8VA 4M00A 2BT6A 5C4JH 1T0SC 1D7QA 1CHPD 2LGSA 1PFSA 5FLXE 4DV2L 3TEHB 1X3EA 1U9RA 3N52A 5FLMG 3NZUA 1SE3A 3Q23A 4B3RQ 1V9JA 3A1QB 3PS6A 4RGOS 1FNWA 1C8CA 1S1QB 2DYBA 1SNDA 3CRLC 1PXUA 4HAEA 1QOFA 1S5FD 1E8XA 1GHKA 1PZID 5JH5C 4M01A 2WQYB 1WR6E 3NWSA 5L37A 3GTPB 3APFA 1PZKD 5LMNW 2K5PA 2K14A 2C7HA 1SIFA 2WB1B 1BCPB 2O5JC 2J0MA 4I6PA 1CKNB 2IGHA 2W9NA 1PUTA 2K25A 5DLQE 5IAAC 4AJYB 2MSED 1X65A 5CHVC 3U30A 1VQIA 3A8KE 1SFOB 3PLUA 2DNEA 3ZRCA 4FXGC 3A33B 4KTAA 3DHGC 4OIKA 2WHIA 5G5HA 3VR9B 1JMCA 3T3OA 4OWTB 2MLBA 4LNKA 1F9JA 1U5KA 2KLCA 2YLMA 2K04A 3TP6A 1PVOA 3UIPB 3SHLA 5JPMC 3I4NG 2PZTA 2WXLA 4B0EA 3TCAA 4POFA 4A3IH 2CW0D 1GB1A 4DR1L 3HOZG 1VJKA 5FJ8G 2WU2B 2ASQA 2CW0C 3VYSA 3K0YA 2EYMA 2BYEA 2ZCBA 3AH7A 4LWCA 4WRDA 4APVA 1RYJA 3HOXB 1D6EC 5G3LD 1ACCA 4GMVA 2R2QA 3A9JB 3EECA 4IPCA 4US8A 3K58A 1LV9A 1OEYJ 2VW9A 1WTVA 3A8IE 4JI2L 3EC8A 2N9KA 1SYCA 3VFKA 2QDBA 2HIVA 3NUCA 4BY1B 4WAAA 1KAWA 3NS8A 1AE2A 3NZSA 3MHBA 2D9UA 1EFWA 4JI7Q 2OOBB 4B9WA 1W3SA 4GKKQ 3QJYA 4A3BH 3K9PB 1DGSA 2A6ED 2WP8J 1HUNA 1WGYA 3K9OB 2UUCQ 3Q8AA 2EOTA 3PREA 1MG8A 1HJPA 3TRZA 2F4VL 2JA5G 3RLNA 1NAPA 1P3QU 1C4QA 5JJIA 1NJIC 1HR0Q 3L0OA 1PDQA 3PIPA 4BWGB 3HKZG 2WXGA 3S1MB 4DR6Q 3R2IA 1WF9A 3B2GA 5FK9C 4BXXH 2FIDA 3CAMA 3S1NB 2WDVB 4GLSC 1SNMA 4DHZE 4DDGD 1X6OA 4H44C 1EM7A 4BOZB 2B2TC 1MI2A 2EJMA 2R7ZH 1EWHA 1RCVD 3DCGA 3IFDA 1K53A 3IFWB 3P75A 2B3AA 1LM0A 1QNKA 3I55A 1E7ZA 4EVOA 1QT9A 4KV6A 3NQTA 1TZ1A 1X32A 1XWEA 5CV8A 1QKZA 2B63H 3PGZA 1PRTD 4DV6Q 5M5WB 2E2HB 3FKIH 1L0VB 1LTLA 4HWIB 5JPNC 2BB6A 3M4OB 1LT3D 3M4QA 4GB9A 2JRIB 4PS7A 2RSNA 3SDZA 4S3SA 1UUPA 3CCLA 2QIEB 3M95A 2ZJPA 1IW7C 3MHSD 1LXDA 1VQKA 3P42A 2MNAA 2KJ6A 2KQ3A 4FDBA 3PV0A 2HTHA 2INPE 3ABVB 3DWMA 4HRSA 3M4OH 2MJDA 2YTVA 1WM2A 4X3UA 3KK7A 4B3MQ 2CHWA 4W9DA 1STBA 5ELFA 1EU4A 1BO0A 1VCIA 4HMIA 2JA8G 3H6MA 2GVAA 2KDMA 4ZRPA 1KLGD 1FMAD 4JW0A 2RSUA 2Z0SA 1V43A 3PZ8A 1LO5D 4UP9A 3KDFA 3F2CA 2BDNA 4A3OA 2EPBA 5COYA 1SE4A 3KLRA 2A19A 1TIFA 4LF8Q 4NB3A 2KCNA 1L4DB 1ZW7A 2J53A 1QE6A 3O13A 3OSOA 5CBAE 1SNQA 3GTMH 4JI6Q 3CCEA 3SK8A 2KC2A 1B2TA 3KF6B 1GD7A 4IUUA 3DHIC 4DR7Q 4C1NK 1JB3A 3V60A 2L76A 1A2UA 2VS1A 1V1PA 4NKLA 2LRUA 3K6OA 2DX5B 1X3PA 2QF7A 3CRKC 5G3LF 5K5PA 1ISNA 1UBIA 1WXSA 2BS2B 2PLPA 2VRRB 2A74C 4ZRKA 4URKA 1G6JA 1LTTD 3UDGA 2LGIA 3ZYYX 4FXDA 2K75A 2JA9A 1FPYA 4EEWA 2Y5BB 5MPOA 2AQ1B 1F2YA 3WAOA 3EIVA 2OTLA 1M94A 3KLWA 3Q8BA 2BKFA 3IXSA 1YHBA 3DWQA 2UU9L 1Q10A 1YNJD 4FBJB 3APCA 1EIFA 1RAXA 2UU9Q 5IIFA 2WXMA 1YNJC 3S1QB 4JI1L 4LUOA 4IFDJ 1GJXA 3FILB 1Z9FA 1HA6A 1TWHB 1YVCA 3KBXA 4DV4Q 1FYCA 4WJ3M 1WMHA 1HUMA 4JI1Q 2VQEQ 4HJ8A 4CGYB 2MBEA 4B3SQ 1X54A 1B53A 1L2NA 5FR3A 1PTOC 4YCVA 3J7AF 4DBGA 3H0GH 3L2PA 4LF7Q 2Y0SG 3UE0A 1XMOQ 2WAQE 2M8SA 3T8MA 4A3LG 2N9XA 5L83A 4Y52H 1N60A 3KYDD 5M5WH 2NBVB 2IO2B 1PRTC 1RHPA 2D0PA 4X3SA 2MHVA 1SF0A 4CQNA 2QMTA 3RMKC 1FXIA 2SNSA 3W5UB 4K8IA 4A93H 4HVBA 5BN3A 1SNOA 1PH7A 4A3EH 3UDFA 1SSNA 3TS2A 1VZ6A 4JQWC 3HFZB 1HTQA 2LS01 1VQ5A 3EFCA 1FVIA 2XNAC 1DZ1A 3OPOA 4NZLB 4DK5A 1TWFB 2I5LX 1HNXL 4W9EA 2YU9B 4LK1C 5IGFA 3A55A 4DV3Q 2DWQA 3HS0C 1TYGB 4YCUA 3AE1B 4E6IA 3MJ5A 3K7AB 1SDFA 5ELDA 5IWAL 1XD3B 2FIFA 3RNEC 1OQYA 2BE5C 3EFXD 4A3MB 1UF0A 4OO1H 3VXWA 2RDBC 2N3SA 5FLXL 2PQEA 2BTEA 2HIXA 1WTPA 3TZDA 4KN4C 4FJVB 4DA2A 2BWFA 4WIPA 5EDSA 3A0JA 3B2FA 3L54A 2ICEC 1V1PB 4JYAQ 2A5HA 2F0VA 1C76A 1EY0A 2EZVA 1EF1A 1WGKA 4KJOA 3GB1A 4DDID 1D2BA 3R2TA 3D4RA 4CDEC 5FR6A 2MGSA 1WGDA 5I9PA 4LTUA 2Z6BA 4P72A 4C3HG 1PQSA 3OWFA 4A3EG 1E0ZA 2INDC 2YEPF 3PMFA 1JWUD 3AE3B 4HJ9A 1KLVA 2QC8A 3HOXH 3S2AA 1HPCA 3J81E 1NR4A 3VDYA 1ET6A 2Y5CA 4YT0B 3DWPA 3H91A 3KFUA 2LJIA 2HD5B 2F3WA 1QCBD 4C80A 1D4BA 5KIXA 2WINB 3A5ZB 2VQFL 4DV5L 1K0SA 4IJLA 5IGBA 3MEHA 3RZDB 4R4CA 1WXMA 5AUKA 4ZRJA 1EOTA 4F88A 3QAQA 3MFYA 4H0LC 5CX3A 1UNSA 4W9KA 4YSZB 2LGXA 3ICEA 3PRPB 4XDCA 5I9OA 2A8VA 2MBQA 1RD9D 3RULA 3ITPA 4K3CA 1TS4A 2K5DA 4M8AA 4QAYA 4WJNA 4LF9L 1FO4A 2F0GA 3KWLA 1KJTA 3DVGX 2CU1A 1QOHA 3QJZA 3SFEB 3ETRA 3DWGC 2WDQB 2EJFC 2E2IB 1WCMB 4WJOA 3H3VC 1K8MA 2W3RA 4NQKE 1J6QA 1KF6B 4HIKA 1E0BA 4W9FA 4ZOHC 1F9SA 2A5UA 1D8LA 3OIPA 2JZZA 4YTMB 1XO3A 3RUIB 1ENCA 1SYDA 1IYVA 2F3IA 5JVH3 1ROEA 4KKSA 4WJQA 3DM3A 3PUVA 4QMGA 5C0XH 2KHWB 5M5YB 4N59A 3IVFA 3S2DH 4J15A 3GTGB 2CS4A 5CMDA 1V49A 4IW0A 2ES2A 1EEID 1QG7A 3CU7A 2JA6G 1Y8RC 3B0AA 2LXCA 1HZ9A 3H09A 1KLUD 1L7YA 4BBNC 4IUNA 2QILA 2A68D 4BAXA 2O5IC 1LYLA 4XWTA 1ZDVA 1YJ9A 5IODA 3VTVA 4QB4A 4JPSA 4R4OA 3QK0A 1XNQQ 2KAJA 2W55A 2Z0DB 5J39A 4KI0A 1KNAA 1EY5A 1FNUA 1HTLD 2AYOB 2F0NA 3M4YA 2AMCB 1KC8C 3T1YQ 1BVSA 4XTCS 3S16B 2HDMA 3IL8A 4DNRB 3I4MG 3QX1A 2JK8A 5EKLA 3PZ7A 3W3AA 1W2BA 4XZ4A 1D1KA 4NJ7A 4M02A 3CCSA 3DVNV 2AWTA 3H6NA 4IPDA 2UUBQ 3NQIA 3DMUA 2F52A 5ISRA 4HCSA 3ULPA 1K52A 1YQ4B 3PIP3 2BQQA 3J9CA 3U2SC 5IYDG 3BWUD 1Q3LA 2NBFA 3D0FA 4BY7B 1E7UA 4DGZA 3VUWA 4HJGE 1MSGA 2VZKD 3PO3G 1T5EA 2R3ZA 1IBMQ 2PJHA 3GV3A 1DXMA 2ZPNA 1I3QH 3OHXC 2EIFA 2CFMA 5EPJA 2J0KA 2XTIA 2AWNA 2NVUI 3KH0A 1NBWA 4A3PA 3D8GA 2Z6KC 3QOLA 1B7YB 2EELA 1WXQA 3M85A 1C9FA 4P71A 1MKHA 2N49A 3OOCA 4G4KA 2CVRA 1H9SA 2ASBA 2A68C 1GG3A 4KGSA 4B08A 1LT5D 3P1HA 1FCCC 2K5VA 1VCBA 1ESFA 2FCQA 4KD4A 1WY8A 3PF5A 1L1OB 2HT1A 5C4ZA 3ZNGC 2B2UC 1EQQA 5J3BA 1TWHH 2ZM6Q 3PO2G 5D94A 3UE1A 4ABNA 4HDOA 1E22A 2Z9HA 4JIOU 1BCPD 2BF8B 1XEEA 5JAVA 5DM63 2PZUA 2EYPA 2MH7A 1EYCA 4YY3L 3LJ3A 2R7ZG 4KV2A 1CQFA 1ET9A 1HNWQ 1HCZA 5D7GA 1PTOH 4GOPA 1DM0B 4ZLTF 1HFNA 3I4MB 4XXEA 1TS3A 4PMBA 3LXFA 2EYOA 3QB3A 1BQQT 1SYBA 4EZKA 4IPHA 1TVXA 4MHEA 3ULJA 5I2XA 5IYBH 2QEXA 3MXNB 1PH6A 2OHFA 1Q7YC 2YEPB 1RODA 2PI2A 2KANA 2ZPYA 2LWPA 3LWUA 1CI3M 4UHVA 5H92C 1BBUA 5KEEA 2INCC 3UF8A 3P2BA 3ZKJC 2A73B 5KNCA 2EKEC 4AS1A 1R9TH 1O7ZA 1MVKA 2LJ5A 3VYUA 3VUXA 3WALA 5LL6X 2JXMB 5FJ8H 3BJUA 2OQKA 2EYLA 1RDPD 3SEBA 5GAGC 4A3LH 1JORA 3CC4A 3ZO5B 2WV6D 4L8JA 5EBDA 5AJ3L 3PO0A 3WAPA 5J22A 4K1RB 2C9WB 1WYGA 2K9XA 4A75A 4DAMA 5JOBA 3RLFA 1R4NB 2JA8H 1E5WA 2KYWA 1NMGA 3MFGA 4ZAIA 5T1GA 5C4HA 4JI8L 1CJEA 3L7ZC 4BBNF 2Y0SB 2X6GA 4KHVA 1A62A 2ZTDA 5EKKA 3ML9A 1QF6A 3IFTA 3AE6B 2GBKA 2V1YA 4EUTA 4YWLA 2UXDQ 5EBCA 2K8BA 3CCVA 3PHWB 3JAME 3NP8A 3CMEA 1VQDA 1NCVA 2HJ8A 3TN2A 1EIYB 1FFVA 1ZOYB 3E9SA 2KJHB 2J52A 2MO0A 2H5XA 2JSOA 2UUAL 3NK9A 1N32Q 2FUG1 2ID0A 3G48A 4W9JA 2L55A 1JJ2A 3L4PA 2UUAQ 4FLHA 1PH9A 1N32L 4L1BA 5G55A 2G9HD 2B8FA 1UWVA 2PQAB 3I3CA 3I2ZA 5IGGA 1QLBB 2DY7A 1ZDXA 3AULA 4FHKA 3CF5A 5ELEA 3PQIA 3J7YW 5AUIA 4FXCA 1BDOA 3D4DA 2GA4B 1WTQA 2JSVX 4A3KG 4AYBB 1WSPA 4ANUA 3ONAB 3W2DA 5E3FA 4H13C 1V5TA 2NBUA 3A56A 4EZLA 2V4IB 2MUYA 4A3GB 3PO2B 4OVZA 1GM5A 3L3OC 2R93H 1N5XA 2QA4A 1A70A 1XCTL 3CMMB 1WFQA 4IUTA 1SGHA 1UGJA 3H0GB 4YHHL 3A7AB 2WYQA 2KO3A 4YSXB 2VL6A 4QF4A 3S24A 2IGDA 5GXGB 4XYQA 3MA2B 3AEVA 2KACA 4MSMB 3DLLA 1J7BA 3SK4A 1JCKB 1TY2A 4A76A 1XYIA 2HJ1A 4DN4M 1JWAD 5EKIA 4LW1A 1OXXK 1V86A 2EKIA 1VQEA 4UPAA 2I07B 4CHTB 1HE8A 3GE8C 4HIDA 3E0JA 1WE7A 3U50C 1IBKQ 3DBHI 4L5RC 3I4NB 1R4PB 3TBIB 3VA5A 1SXTA 2F03A 2B2YC 4NJ6A 1BR9A 1EY8A 3UI2A 4A3IB 4X65L 3OJ4B 1Y1WH 1K8GA 4JBMA 1YX5B 4YSYB 3JAMc 1ZYRD 3H94A 4X65Q 4M8MA 4LFAQ 4IPGA 3F8TA 3KLSA 1AW7A 3HOXG 4X3KA 3PRZA 2L00B 2PI2E 1VF5C 3FMCA 3S1RH 3W5VB 2G9DA 2PYKA 5FO8B 2LZ6A 1I4RA 5M3MB 1Z6HA 1GOZA 3AEAB 4I6NB 2EQSA 1RF2D 1C4PA 4IJHA 1HNXQ 2PVOD 4A3KB 4FF2A 1JB7A 1VQLA 3LDZE 1ZE3D 3ONSA 2QW7A 1EYDA 1E6EB 3U9SA 2KEDA 2DGYA 2EXDA 1WCMG 3GTOB 2D2CC 2VB3X 1C4CA 4L63B 2DJFC 1AYFA 2B8GA 2X38A 2FXQA 1NMFA 1S72A 3OLMD 1WWTA 2E2JH 1FJGQ 2D3CA 4LFCQ 4GLXA 4MGKE 2ZXOA 3HKZB 5JJZA 5M3FG 1LGRA 5DPSA 5FKAC 1C77A 2V9HA 3J7A5 2DNCA 5K36H 2BYVE 1EYAA 1TWGB 5C1ZA 4TUUA 1F2RC 4ARIA 1PFMA 2IYDB 1SYFA 3S14B 3VTWA 2WXRA 2XVSA 3SR1A 3EN2A 4ZHPA 2D11A 4YTPB 1STGA 2A69C 3U9OA 3X3MA 4LDTD 5IY0A 1PTOF 2XIWA 4JOIC 2F0WA 2A1AA 1SYEA 4B3RL 2K6DB 2RVLA 3HKZE 1TT5B 1WM3A 2KCTA 5T1IA 4YY3Q 2JEAI 1CSPA 1EFID 2FFKB 4KIKA 1M1KC 2FBWB 2VQFQ 4HPMB 1Y8OB 4I65A 2LASA 3SK6A 1WZ3A 2BVCA 4MSQB 3W1YA 3HOYB 4HXDA 1A5RA 3GE3C 2JT4B 2HHHQ 2N9LA 1SE9A 3S17H 4N9TA 2D10A 3PT2B 4RFBA 3H7PB 4HROA 2KK8A 4HJKA 5IP7H 4NY0A 1ILQA 1XT9B 3HEJA 1BUVT 3V62A 3AFPA 1YHQA 3AMZA 2VNUD 2NR2A 3GTPH 3HOUH 5CHWA 5BO4B 2OJWA 2A6EC 5H1SE 4LF9Q 1ZKOA 2V1CC 3AB9A 2MQHA 4DFAA 3PCOB 4GDLA 4JX1C 2DZJA 3KUDB 2XRSD 3HM6X 2IHEA 2REXA 3WA0A 1SFOH 5LMUQ 4YWGG 3U8ZA 3PF4A 1JALA 1CKMA 2EY5A 2IO1B 4BA2I 2IX0A 2IX3A 4DR3L 3RYTA 3F1ZA 1TTNA 1WX8A 4PZ7A 5KNDA 3ZNID 4RKLA 5C0XJ 1TKEA 1V8QA 3PZDA 4OONA 4RMAA 2JA6H 4DHJB 2SNMA 4IM2A 2R2OA 2W54A 5BYSA 2NVXH 2DLBA 2BS4B 4K2KA 4TQUS 4KY7A 1V8CA 1B9NA 3IG3A 2F0SA 3SDLC 1CK1A 4ZRZA 5JJLA 5BMHA 2WFWA 2CWPA 5CTRC 2R6GA 2ALYB 3M4PA 2HTME 1KIXA 3CQZH 3I72A 4DNTB 4BBRH 1XNQL 4DR4L 4FADA 1STYA 4TRDA 3SGIA 4LJPB 5JVG3 5M3FB 3VR4A 4A3JB 1OFFA 4S17A 1EY7A 1DOXA 1PZJD 2GBRA 1XMQL 3OW7A 1PMRA 1O80A 4LFBQ 3S2HB 2ZVNA 4KSKC 4HKQA 1JR0D 3CQZB 1BT0A 4IM0A 3L16A 4JWSC 2WB1E 3AFQA 2F4VQ 1STHA 2OTJA 2RCFA 4IUQA 1TKGA 5HKHA 2CWAA 5CV7A 2Q8IB 2GBNA 4QUFA 4C4VB 1JWSD 3L9AX 1XPOA 1WJJA 3MWYW 5BN5A 2O6VA 4CO7A 1KDAA 1ML0D 3RZDH 4KZCA 1B8AA 4JK1C 2F0DA 3STBD 3OJ3A 3QCAA 4DK1A 3VRBB 3HOVH 5IGCA 2QGQA 3HOWG 1D3ZA 2ZT9C 3CW2C 4ODGA 2F0MA 2WWZA 1Y8PB 5EPLA 4MN3A 1Y14B 2J42A 1NENB 3X0WA 5C44H 3MC8A 3ZTDA 1IKMA 4YXDB 4E74A 3HIZA 2B2YA 1C78A 1AEXA 2Y0SE 4TSSA 2JJQA 2H89B 3GS2A 3AU4A 4G50A 3A9JA 1J5EQ 5HY6A 4RF1A 3OMGA 3IKJA 4DPGA 2E8GA 2KHIA 1SEBD 1EZ6A 2KBNA 1NSNS 3FDTA 4KHPQ 1WYWB 4A3FH 3CIRB 4WWMA 2WX0A 3C2PA 3H7PA 4E71A 3DPDA 2WKDA 2HDEA 3CCMA 4D2KA 2FMMA 4CJ0B 4LF5Q 4LFAL 2C5CA 3WWVA 1GUNA 1RTOA 2K6AA 2OT2A 1UELA 2KN5A 3AI5A 3JYUA 3NHEB 4HPPA 1NVID 4RM9A 2KDFB 1CT1D 4L2YA 4HCEA 4X3TA 1EWYC 3UI3A 1I5FA 4DKAC 1VF7A 4MNOA 4C3IB 5HGQA 3HOVG 1F52A 1KRHA 1N5WA 3Q69A 4M0WA 4J3OD 3SU8X 4IUPA 2V3PA 3S15H 3EA6A 1RWSA 4R4QA 1ONLA 5A35A 3ALBA 3HOYG 3RR5A 2UWQA 4F7ZA 3TEWA 2PMZB 3HKSA 1R7SA 5D3IB 3NBHB 5IKCM 2F0TA 5NUCA 3VVWB 1MFWA 3A5UA 1SBBB 5J18A 3GD7A 2NZ1D 3RNFC 2MJ8A 2QSDA 4PQXA 1EIGA 1VQBA 4C3IH 1S5DD 1BOSA 3QOJA 1ENFA 3Q8CA 3CC7A 1T6BX 4DR7L 1JROA 5LXHA 2ZJQA 4LAAA 1F77A 2K28A 3NPPA 3CMAA 4HJ7A 2EMSA 2N7EA 2XBBC 3TREA 2IDYA 1L0WA 1K83H 3D32A 1I7HA 2RDFA 1E90A 3VUYA 1TKYA 3LYYA 3TP5A 2L0FA 3RPFC 1I42A 4IFDH 3RZWC 2F0KA 3TJPA 3P7JA 3CCJA 1MSHA 3A1QA 2O6VD 4KKJA 4IZ8A 3SVMA 1E7PB 4PZ6A 3WDNA 1DOYA 4QGUA 3OW2A 3FILA 1J19A 4A9AA 1SNCA 2JY6A 2CH4W 4KKIA 2R7DA 4DNIA 2UXDL 1JOKA 2EY2A 4II3B 1DCZA 4Q5VA 1WJNA 4IWOA 3VDZA 4P7IA 4ULLA 4G0NB 1H9SB 3H3VH 2VQEL 4GNXC 1PH5A 1B50A 3I7FA 3TQYA 4PYUA 4K5XA 2NZOA 2EJGC 4JI2Q 4GN4B 1KDCA 4CJ2C 5LXIB 1VQ8A 3PUXA 5EJWA 2ACZB 1E2ZA 1L0XB 2FAZA 1WTOA 3T3NA 4XQJA 1YX6B 3ZXRA 4KN7C 1PGBA 4GKKL 1Q0WB 4NAMA 2MP2B 1Q81C 1XPRA 2UUCL 5L95C 2M1MA 3ND8A 3HOUG 1VQ7A 3WIMA 3U4VA 4YWMA 3A4RA 3VH4B 4C2MH 4FULA 1IGDA 2L7RA 3MC0B 5GAEC 1I94Q 4A3BG 1E7VA 5I4DA 4RA8A 2DBYA 2BBCA 5M9OA 2KXJA 2QDFA 3B1LX 2H1EA 4P74A 1WI5A 2FNJB 2VUMB 1QWYA 4JBJA 4RWSC 2V4DA 1PLFA 4IOCA 2CKHB 5IA7A 1NE3A 1HNZQ 1UEBA 1GJZA 1CQVA 1PRTF 3NBIA 2OWOA 1S5ED 4GS3A 1X3QA 1VQNA 1P0RA 4LNIA 1K50A 1QUQB 4QUCA 4CBVA 1PH3A 4FYDA 2IX1A 4HLEA 5IWAQ 4CKCA 4WAFA 2KUMA 4BKSD 2K22A 3P4SB 1Q1BA 3W1SC 1Z47A 1TXYA 4DR2Q 2GB1A 1KRTA 1YBYA 3CPFA 2NN6H 2KZRA 4R3DA 2K6QA 4C7ZA 3HG9A 4BS9A 2VUMH 2KTFA 1C48A 2N7JA 2N7DA 1FR3A 1K28A 1F2RI 1JICA 2XWJB 3QG1A 4XQNA 1NBFC 2CU3A 2IY0B 1M4VA 1LM8B 1G8ZD 1PFBA 4ZUIA 3VR2A 1PDXA 3G71A 1F0ZA 4QIWB 2Z6KA 1C0AA 4IM3A 3E9HA 1B9MA 3J81i 1Q5WB 1BNZA 2L15A 2LXKA 3HGBA 4M1UB 1OGWA 2OCEA 3JSVA 3NE5B 3ZGZA 2KFJA 3JAMi 3DEOA 2N1VA 3J7ZC 1J8CA 1IZ6A 3CHBD 1I3QB 1SMXA 2L1AA 5TSSA 4BVUC 5C23A 5A2QE 5C0XG 1VMPA 4A4IA 2J7QB 1RTNA 1R4MB 2RDGA 5DAUA 4EZJA 3NEMA 1JJGA 1T0RC 2KOXA 1CFMA 1I6VC 3KVFB 3D3RA 3B6YA 2YYZA 1TKWB 1C4AA 3HZXA 1IBLL 1IW7D 3FRPB 4PNYA 3V96A 2KFKA 4A3BB 2PQAA 3AQQA 1N63A 2B29A 1XNRQ 4OELB 2JQRB 4B3TQ 2K1BA 4OVUA 4DHJD 4PMCA 4JBWA 2WNMA 3I9V1 4GLVB 4XDXA 4BY7H 3EHVA 3HOWH 2B3GA 1ZEQX 4KIKB 4MZ9A 1VQHA 4RMFA 1EIHA 2K03A 4ILWA 3GTKB 2J4XA 4WJPA 1LLRD 2VY3A 4LF4Q 2K5NA 3TP7A 4X64L 1VR9A 1IYFA 1AN8A 1AE3A 2XSCA 4CKEA 3S17B 4W9LA 2NTTA 5IO9A 5C3JB 2PO4A 4WJWA 1A6XA 4EKUA 2HCCA 4HCPB 3I3TB 3V05A 1JE5A 2D07B 3NSWA 4LMQD 3T56B 4JI0L 4GNXB 4DUYQ 2FJ2A 3A9KA 1YNXA 1MJCA 1H4RA 2K8HA 3ZUNA 4E3CA 1QILA 3MJWA 1BUIC 5JXVA 1YJ1A 2KX3A 3RNBC 1SRUA 4ANVA 5CV4A 4CHKA 4K6LA 2F0FA 3GTLH 1U0LA 4CYEA 1F2ZA 3QIJA 2WS3B 1LTID 4KKUA 3DHHC 1HZBA 2B2TA 2WB1G 4BBRG 3KF8A 5IT9c 1EQTA 4B9XA 1XMOL 5AFWA 2RMMA 2QEJC 4PMWA 4PK1A 4AIMA 4K5WA 2WU5B 2ZNVC 3LGJA 1D1IA 2NVXB 4FF1A 2K32A 3N20C 4NNJB 4WWNA 3AMUA 1K73C 2PNHA 1JWBD 3U4ZA 3N3KB 4BKGA 4LNFA 1TT2A 2Q2TA 3DUZA 4KD3A 3K59A 4FF3A 2I5MX 4JI5Q 4YWKA 1K51A 2JF5A 1EWCA 3BZKA 2IO0B 3AEGB 2AX5A 3RFZB 3RUZA 4C4VA 5ELCA 2JA5B 1OTRB 2LFNA 4TQ0A 2L5TA 2VUMG 2BYTA 2LGYA 5C3XA 4UAIA 1Q8KA 2LD9A 1NEKB 4MM3A 2DAJA 1Y8NB 1YJWA 2ZEQA 1H9RA 2JA7G 4FP5D 2R92G 1YMHE 3AXCA 1TS5A 3TDQA 3KJPA 4FA6A 2GBJA 1GNUA 5C2TB 3D4WA 4NXML 4X57B 1MHWC 3ZXVA 4C00A 4DV4L 5EQ0A 4GDKA 4ME5A 2P5ZX 2VZKB 1ASZA 4AQYQ 2HQEA 1B44D 1N9WA 4Q0FA 1I4XA 4BY1H 4A3DG 5IYDH 4B0MA 3AU7A 4IOIE 1VQJA 1PYBA 1PH2A 4PS8A 1YN5A 2RHQB 4X66L 2AHOB 1KNEA 2NVTB 3ND9A 5IOIA 4CJ1B 4A93G 2O2VA 1XX8A 1XLQA 1STNA 2PW9A 2CR5A 3R7QA 3X3NA 3C46A 4GOPB 2PVGC 4IFDI 4RNAA 1C79A 4QJFA 2L4NA 1EZ8A 1CKNA 3QR8A 1FGUA 4DR6L 4GN3B 2K0PA 4MTKA 1KH0A 1K3RA 1M8AA 1V1OA 2PW5A 1T3QA 1OEYA 2WXPA 4WH4A 1X1MA 2A4ZA 2AUJD 3KF8B 1XCQL 4JC0A 1JJCB 2Y3AA 2GOWA 4X62Q 4GNXA 5I6YA 3EUB2 2WP9B 4JOIA 2RCNA 2RSOA 5GADC 1XQQA 4X62L 3ER0A 2O4XA 2K50A 1TIID 2Z4IA 4IWPA 1LTAD 1TWFH 1PH1A 4POGA 2DENB 3K80C 3GDEA 5CC4A 1VQOA 1G6PA 2WXNA 1DOKA 2VXWA 2IZVB 2EDGA 2B2VC 1HTOA 3KQ4A 1Q46A 3CC2A 2F3VA 2IBIB 1PFDA 5M5XB 3N1ZC 1L4ZB 2EE1A 4REZA 4IUMB 2K05A 3N32A 2J0JA 3AB5A 1F9RA 1L2FA 3NBHA 2XEWA 1FL0A 4Z9CB 3T16A 1TBEA 4DUZQ 3RNGC 2I1KA 5LHY1 2E5LL 3BG3A 4NP5A 3QQ8B 4JVZA 3ZLZA 1YD8U 3K5NA 2L83A 1FCLA 1CM9A 1LFDA 4IDIA 1XPUA 1A63A 1AFPA 3G6JB 2SOBA 3DVGY 2JA8B 1XLOA 3AE7B 3VR8B 1M90C 3HP3A 2MBBB 3SFDB 4XC2A 3IAS1 3NJTA 3RNAC 4R1JA 4S0RA 3GO5A 1H9JA 1WZ0A 3J80L 3IAM1 1CA5A 1SB3C 3S1QH 2V4LA 3GTKH 3T9LA 4BBRB 1QNUA 1R9TB 5C6AA 1IUEA 1FD7D 2EMTA 4GXBA 3A7LA 2LVQA 1DYQA 5FOBB 3GTJH 4K7UA 4MT5A 3TEYA 1YQBA 2N1WA 3V6CB 3KLSX 2KEEA 3ECIA 3PIO3 5FLXc 3AE2B 2CHXA 1UE5A 3KUPA 1GUWA 3P4RB 2FINB 4X64Q 3AE5B 4GSWA 4DHZB 2KOLA 5E6NA 5IP4D 4MGZE 3O65B 2JA6B 4JPBW 2L1BA 1U4AA 3DBHB 2LSSA 3BVGA 3MXGA 3PUYA 3U7ZA 3SK5A 2Z4HA 1F2LA 2XN9C 2H88B 1N6ZA 3T13A 2QJLA 3RD4A 5CYUA 2YVCA 3I63C 3IT6B 3MXNA 4WWOA 1Q82C 4MEMA 2ZCCA 2I5HA 1D5ZC 3RMHA 4JI0Q 4DUYL 1XLNA 2UYZB 1C3TA 2KJXA 1MBYA 3MVVA 3RT3B 1I50H 1QUQA 3GTQB 4F8CB 2DHZA 1FRRA 4FHJA 1HQMC 2Q8TA 4BBSB 1BMLC 2SDFA 3I90A 2MBHA 3BZCA 1E10A 2DZKA 2JWZA 2WGSA 5C3EH 2Q2IA 4FXKC 4L23A 2HHHL 3K7AH 2PIAA 2F0QA 4B3SL 1T0YA 4CDCC 1B70B 3Q6BA 3DVNU 2EY1A 3HOZB 3B08A 3I91A 3NXWA 3RZFA 4KMUC 3NG0A 1XF5L 2TMPA 1HR0W 1WTWA 4ZYNA 1VDVA 5IN7A 3I56A 4H7BA 4RAUC 3H1UA 1L1OC 4F1SA 2D62A 4OWXB 4MTNA 3JAML 3U7DA 1E9MA 4FJZA 4A93B 2ZTCA 4RHSA 5EAYA 3RNUA 2VH1A 5C3EB 2A6HC 4DXFA 4HJAA 2D2QA 4FJYA 1HTPA 2IL8A 4JI5L 1ZPSA 1YZ6A 3T1YL 2L05A 4KZ0A 4OL7A 4XX5A 2JPHA 5TR5A 4EQNA 4IQZA 2K39A 3SHQA 2KLGA 1O7YA 4ID6A 2D3AA 4DR1Q 3NOBA 5CHFA 1T5XD 5BR8L 4O1NA 2A69D 2NN6G 4HSVA 4A3MG 2W3SA 2V3NA 1G91A 3BIID 2J0TD 5BR8Q 3PIOA 4OO1I 4FN2A 4HIMA 2BCOA 3S16H 3GTOH 2IHFA 2M4NA 2X6LA 2NMQA 1NYRA 4US9A 4GIVA 1WMHB 4JE3B 4NQLB 2LUMA 2N55A 2JA7H 2FHTA 4RGTA 2BKRB 1E1OA 1BF4A 3W1SA 4BKTA 3W5OA 3E56A 1RIPA 2GVBA 3NTIA 3NRZA 5JZEB 5DEHA 1YNTE 2IPKD 1N33Q 2N9PC 2X8XX 5IE8A 1E3PA 2C7MB 4EQPA 2WXIA 1NY4A 4MGIE 1WTHA 4EGVA 1PH4A 4C3HB 5J1ZA 4XGAB 3TSSA 3BDLA 1F2MA 5CORA 3IBEA 3G6EA 3BINA 3JC66 2E2IH 3C0RB 1HH2P 5DM73 4DR5L 2GN5A 2INNE 2MO1A 3J80E 3PO3H 5IT9L 4A3MH 1QVFA 3R3OA 4LUVA 1JQ4A 1CKOA 1IBLQ 1WRIA 3L10B 3L17A 1CUKA 4DV5Q 1QQRA 4TMAB 3BDCA 1SIJA 3NZ3A 1AP0A 2JUOA 1E24A 5LMNQ 2IY5B 2RF4A 1IYUA 4ALPA 1Y56A 4PS3A 2Q2HA 2JYOA 4GOPC 2NS5A 4MACA 2KENA 1WFYA 2MRPA 4BOSC 3K0XA 4ITKA 4RF0A 3F2BA 2UXBQ 1AZQA 1JMLA 5M5XH 3A8JE 4DV6L 2MJEA 3EFUA 1WYDA 3JW0X 4V0BA 2JN4A 3ERQA 4RCOA 3CCQA 1NNXA 2KWDA 3ZTCA 4LNNA 3RI7C 2CJOA 4RHRA 4N8FA 3NY5A 3TEZA 2E2HH 2G4DB 2PPBC 4DV2Q 2BH2A 3S15B 3CKIB 2KQSA 2UXCQ 4HCNB 3GV6A 2EYFA 1PHJA 3DM1A 4GN5A 5D65A 4NXNL 2NCNA 3GZNI 4LJOB 5JHBA 3X23A 5KHOA 2KHJA 1LABA 1MHXA 2FCMA 3T53B 1QZEA 1V97A 4MGYE 3GTQH 1N34Q 3AV8A 1LTRD 1IL8A 4MJSA 1FGBD 1CMXB 4IC7B 3KBGA 3OWEB 5C5MA 3GZNB 3TL5A 5DPRA 3VR5A 2ICIA 3BYTB 3PSEB 3Q3NC 3UDXA 2BA0A 2Z1CA 5DCNA 4G3XB 3FPUB 2OXPA 1WJUA 3ML8A 4LK0M 3R3MA 4DR4Q 3HVDA 4J6HA 1YJNA 1SSOA 3Q8FA 4MM3B 5EE0A 3Q6SA 2F0OA 2JA7B 3ZW3A 3PUZA 3AEBB 1EWIA 1Z5SB 1L1OA 2GBMA 2KWVB 1DOMA 1RL2A 1U4MA 4R9WA 5M3MH 1AH9A 4JI3Q 1A2TA 2IO3B 2KC1A 4XIGS 2LUEA 2MP2A 2DYMA 4JV5Q 3C3LA 5E6JA 4NDXA 3K5LA 1AWDA 2PW7A 4K8JA 5E4XA 1WD1A 4KX6B 2BOSA 1Y69U 3D31A 1P8LA 4C3JH 1N36L 3ZJYC 4XWWA 1O7IA 3MEFA 2KFKB 3GTGH 4OVVA 1JRPA 1I6HH 4L6TB 2L52A 3NTHA 2RPQA 2Y5PA 1YQ3B 3QA8A 4N9F4 2JYEA 1EY9A 3OG5A 3R93A 2LXJA 2QDLA 3VYRA 2GRIA 1MG4A 3ZDMC 1FXAA 1I4PA 3J80c 1SN8A 4YHHQ 2OEOA 1II3A 3ZJUA 1P98A 4IUVA 2K1FA 5CBEE 3CCRA 1EEFD 3IT4B 1EQRA 2CHZA 1KAAA 5GMVA 3CP0A 2CHBD 2KCMA 1LTGD 1E8ZA 3PO2H 1Y1VG 4K0KL 1YIWA 1WCMH 1VZ7A 4IALA 1GUOA 4OZCA 4BFRA 4K0KQ 2N0SB 2G3QB 4RGNA 3AEFB 3WCQA 2OEDA 2LHDA 2E74C 4A3JH 2J7ZA 1OXVA 1TS2A 3MAQA 1S40A 4HK2A 4USAA 1UE7A 2KTRA 1GUAB 3SD5A 4NMZA 4QY7A 1MHHE 3DWAA 2KECA 4C3JG 4UDUC 1D5XC 2JP1A 1YIJA 3CD6A 5AEKB 5KRUA 5FO9B 4J8QA 1G2SA 3N30A 2NUCA 1JC7A 3S1NH 2FUHB 1WI0A 3T51B 1IPGA 1JT8A 1Z2MA 3GOEA 3Q0AA 4Q2JA 5E6PA 2Q8RE 4ZQ3A 1HR0L 1ENAA 1I94L 1WRDB 1B4OA 4KVGB 4K6DA 5G5GA 1TZOA 2F4IA 4I7AA 3J81L 1K8OA 3K5OA 1MIUA 1VQ4A 2Z59B 3EGRA 3VAWA 3C1EA 3RN9C 3G4SA 4DV3L 4G11A 4OHJA 5C3WA 5FO7B 1PYSB 4LCDE 2JWUA 3QWZB 4BXXG 4RKBA 2D0OA 3ZVVA 2B76B 2MW5A 2WKCA 2WXQA 3I4OA 4ZCKA 3HHMA 4CKBA 1YITA 3I8ZA 1AZPA 3S1RB 3ENEA 4N58A 3U52E 1VLBA 4P6VF 2AQ3B 2RQXA 2BE5D 1WR1A 1I35A 2Q5WD 1GUGA 5IP7G 1V81A 1A15A 1EUVB 4QIWE 5HG2A 4GGQA 3VYTA 5J17A 1LUZA 1QVCA 3U58A 5IYCG 2L11A 2WX1A 3BDOA 2B2VA 2LVPA 1S5BD 2LI5A 4UY8C 4ICUA 5CV5A 4K7SA 4DR3Q 4A3EB 3DBLI 4JGHB 1DJRD 1D5MC 1F9PA 1STEA 2L0CA 3BU2A 3TZUA 5AJ3Q 3NWTA 4A3GG 1Q86C 1UZXB 1UH6A 1JWMD 2XK5A 4ACFA 3A74A 1XTDA 2K5WA 1PA6A 1YOVB 1K83B 1DD2A 4GOCA 2WXKA 1CZGA 1DONA 1V9PA 3MXPA 4NPNA 3K8AA 1LTBD 2BH8A 2DYOA 2LGDA 2AEHA 4XDDA 1BCPC 5AZFA 4WJ4A 2RD0A 4F7XA 3F2UA 3NENA 4MELA 1UE1A 1E2VA 4DAPA 1GO3E 2N4FA 4KLKA 1SE2A 2PMZE 3VR6A 2KDIA 1GXDC 2ZNVB 1EO6A 1HRJA 3PPAA 4RH6A 4IG7B 4ARCA 3U4EG 4AP4C 4A55A 3KYHC 1KOTA 1FEHA 3N9YC 3RNCC 2BGFA 5K36G 2WXHA 3DBSA 1X55A 4BBSH 2PMVA 1FNVA 1I50B 2RBMA 4RG1A 1U4RA 1VZ8A 3Q3MC 3EJIA 4J6IA 3MC9A 3UQBA 4Y7NB 4ME3A 2KDEB 1P16A 1SJHD 3ZJVA 2B2WC 1TWGH 3MTSA 3S9WA 1AARA 2KMAA 1PTOD 3TMEA 4AYBG 3KUZA 3SR6A 2GI9A 1WXVA 1MI0A 2KVMA 4QQBX 3Q2AC 4XT3B 1MJDA 1IP9A 2BPSA 3PV1A 5BMGA 4DXAB 1ILPA 2K8CA 2C7NB 2DJGC 4HN7A 4A6QA 4C1NI 3Q3FA 5LLIA 3P4PB 4P2CB 3NS1A 2CH4A 3GQBA 1ICWA 1KTKA 1VS0A 1QVGA 1PFNA 2LFIA 3VTUA 2I0QA 4P1BC 2IW3A 5CGKA 4IKGA 4K81A 3P20A 3S2DB 3BK1A 4BBSG 2KQ7A 2BDOA 4DF7A 2WLBA 2ZW0A 5IP9H 3H15A 4YL8A 1JE4A 3I4NH 1MD2D 2CKZB 3M3JA 4IURA 3M63B 3NVVA 3Q3JA 2CQAA 2F0PA 2HD3A 2ZXRA 4R4TA 3SE0A 3TEXA 1QZGA 3CCUA 3DHQA 2LKVA 3HM3A 2BW2A 3FVQA 4XQQA 3BYYB 4DWFA 1UAPA 3RZOB 2M2LA 2L8JA 2DZIA 5EE9A 4HKZE 5G2NA 3M9BA 5T8IA 3ZIMA 2D5DA 5EE1A 1VDZA 4C2MB 1WTRA 3OAWA 5M3MG 2WXFA 2IY1B 1KDBA 4IN3A 2EXZA 4N9PA 1VQMA 2L0TA 2WDTB 2NYZD 4LUZA 5KYIA 3Q14C 2E2DC 3ZDTA 4KY6A 2NTSA 3M7NA 1DOIA 4A3DB 3EVQA 3S2HH 1GUTA 2GLSA 3LB8C 4ANWA 1PH8A 2FE8A 1RFKA 1P9DU 1IBXA 5HGTA 2YTXA 5IYCH 1S5CD 4ZKCB 1J8IA 3WANA 2ZJRA 2R61A 4B3TL 3IAYA 3M3YH 1SMYD 4KK7A 4MH0E 2GMIC 4DXGA 2R7ZB 1RM6C 1G291 2R7FA 1HQRD 3KWVA 1J0GA 1NDDA 4AQYL 2NPTB 3NVWA 5DPTA 3PLVA 1ZGUB 5AZGA 4A3FG 1MPEA 2ZXPA 4LF4L 4LF6L 3M3YB 2KVRA 4R4IA 2DN8A 2E76C 4KHPL 1SJED 3W1GA 1I4HA 3T1HL 4DK6C 3KF6A 3Q22A 4DR5Q 3AECB 1GUSA 5KYLA 2CQOA 1J7CA 4KJNA 1FM0D 5JJKA 2R92H 1KM7A 1V5OA 1P7FA 1HNWL 1KFYB 3DQVA 5LL6S 2JXTA 2M0AA 4I7ZC 3HOYH 2SAKA 1VQCA 1K0RA 2QKIC 2F0EA 3D6CA 3GTJB 4HJ5A 2EYJA 2C60A 2PPHA 3I4LA 3PUWA 2B63B 3NVYA 4EE2A 3PSIA 1EF5A 1XTCD 2C9OA 1L5PA 4WURA 3C8YA 2LMCB 1Y1VH 2V3SA 2DY8A 2K52A 3V61A 3FP9A 3EBEA 3HRZC 4U673 4JYAL 3PRMB 2DZMA 3VH3B 3WOFA 5KGUA 1O7LA 1WVLA 1YN4A 2KHSA 2HQLA 1SLJA 5M5YH 1X56A 3NTKA 1UBQA 1IKLA 1V6EA 4GKJL 1EU3A 4OW0A 1H8CA 3STBC 5IP9G 2MHJA 4JWUC 4GKJQ 2O6VB 3PGEA 2K4KA 3PHXB 2JYTA 1XLPA 2D5GA 2IT1A 4XYCA 1N34L 2JA5H 3TP8A 4EFOA 4IO9A 2PE6B 4H2AA 2WAQG 3VR3A 4OO1G 2M00A 3P63A 4WQOB 3GP7A 4GLAC 4YCWA 1EYGA 4M8NA 1NI2A 3R7RA 5IGEA 1GC6A 1XJVA 4I6LB 4MIUA 1VQ6A 1YNND 2LXAA 5CV9A 1XXGA 4HIOA 2FCNA 2M0XA 2B39A 1HA5A 2ZW1A 4N6EB 2QCPX 3D6WA 4DV0L 2MP1A 1B3QA 4A3JG 1DGJA 3H7SA 4HPLB 4O0AA 1G2TA 3RN5A 4JLCA 1WGRA 4JI7L 4LNQA 3J81c 3C19A 4JI3L 4DV7Q 1EY6A 1FIQA 2KMCA 2EY6A 2B63G 2MX2A 3AE4B 1CA6A 3QHTA 2WDRB 1HEZE 4NW2A 1J7AA 2VZAA 4LLGM 3AEDB 1TJEA 1ZUD2 2FCSA 4XYOA 1N36Q 4KDLB 3R66C 4LDTB 3AU5A 2LY7A 4A3GH 3HK0A 4O42A 4TKNA 2L12A 1SROA 3H0GG 1QOBA 2NWGA 3KUCB 3PTFC 4NJCA 2XWBB 2JVCA 4C3JB 2AUKA 1L0YB 4OX9L 3S14H 1IBML 5IOCA 3ULLA 3HOWB 2JE6I 4OX9Q 1KQSA 4RM8A 2JU6X 1HNZL 2KDBA 4W9IA 1SMYC 1VD2A 1F9QA 2NVQH 4ANXA 4KGRA 2PCFB 2KNBA 1GAQB 2E6XA 5E7NA 3R8BA 1K9MC 2BA1A 1QOAA 5ELOA 3P1MA 2F1MA 4DR2L 2VB2X 5JEAG 2NB0A 2KWUB 4WFN3 4GN1A 3CXCA 2WAQB 3OTOL 1OTCA 4A3FB 1C1YB 1Z7TA 3BK2A 4ZUJA 1VQFA 4AWJA 1WOCA 1UWXA 2EVBA 1NI3A 2ONQA 1LT4D 2LRWA 2ON8A 4B6WA 4ZRQA 2NVYB 2ZZPB 1S3SG 3ZRFA 5I2YA 3PVLA 3HUIA 4LF5L 4II2B 4EQ5A 3BY4B 3T4AC 2WIIB 4B3ML 2I1JA 4MDKE 3FKIB 3HOVB 2JXXA 2JZ3B 1B9RA 1MGSA 2G5DA 5BN4A 1RFAA 3CWIA 2PEAA 3FC4A 5BMIA 2YU9H 4A3CG 3GTMB 5BYQA 2AKWB 1FD6A 2MCNB 2QHOA 1WH3A 1KL9A 2KKCA 2KA7A 4K14A 4DU9A 5C0XI 2G1EA 2UU7A 2G45B 1WGGA 2JZPA 4JBKA 4L5TA 3J7AV 4A20A 2KN4A 3ZJTA 1QJOA 2JEBI 2WACA 2AWOA 1FJGL 4WORA 4B95A 1HZ5A 3W9CB 2L3ZA 5E4WC 4V190 4AOFA 2K5HA 3Q8EA 5J2RA 3H8HA 4LFCL 4O2DA 5I6WA 4A3IG 2BWES 2JRHA 5C4XB 2E2JB 4XE0A 3F2DA 2BS3B 3K57A 2MBOA 1QZHA 4N8X1 1BCPF 2R92B 3RD2A 1YI2A 3FKYA 1ZXIA 4HEA1 4RCNA 3VA7A 3T1HQ 1WXAA 1WD0A 5EPKA 1V2YA 3BVZA 1TWCH 3UQAA 3B9JA 4L5SA 1JW9D 2K5QA 3G7LA 3V3XA 3I5JC 1UEAB 5HI1A 4WQMA 3UIOB 3VQIA 4DQOC 4DK3C 1IHZA 3HVZA 5AZHA 1HZCA 2RKSA 2M9VA 4OWWB 1CZPA 5IYBG 1TGZB 1VRAB 4MJSB 4C56C 1YNNC 4PT5A 3TMPB 1WX7A 5DPWA 3KDFB 4R8NA 4ZKBB 1EL0A 2XRQD 4KSLC 1IL2A 1I4QA 3PO3B 3I73A 1ZXHA 1YJIA 1OXUA 4EX5A 5LMNL 5JEAJ 4DAYA 5HHDG 4LF7L 1TU2B 3Q8DA 3DBRB 3MZ5A 2JQOA 3W1BA 3A4SC 2UXBL 4AH6A 2R93B 3MP9A 2M17A 1W6JA 3GTLB 4X66Q 2AL6A 2NBWB 3E0EA 4P1CC 3JSVB 5HFYA 3L0WB 5GROA 4KDIC 3FEWX 2Q2UA 1RJTA 1A3VA 1C9OA 5IGDA 5LMUL 1E8WA 1E1TA 1WIAA 3IHPC 3HOUB 4ZK9B 2FMCA 1Q8IA 2RR9A 4Y7NH 1A0IA 1SR3A 2YV5A 4BKSA 1J9OA 2DUDA 4R8IA 2XGTA 2OJRA 2NVYH 3UINB 3CF6E 3WAMA 2UXCL 1T9HA 2O2LD 1K8AC 1ZYRC 1EQVA 4H02A 4NXNQ 4G7HC 1HZ6A 1YN3A 2K3UA 3L08A 4NAWB 1BKBA 5C4XG 1NTGA 3FKIG 4JI8Q 3DOWA 4JG2A 3HRDD 2MA9B 2HDLA 2HUGA 4CDDC 4JI4Q 4G7ZC 3RZOH 2PNRC 3AE9B 5CV6A 1GVPA 1UE6A 3NELA 2WXJA 4JI4L 4B9KA 1CTMA 1I4GA 2Z8LA 1SYGA 1GB4A 3E9IA 4OZBA 2PKOA 4AQ7A 1TR5A 2K01A 3HOZH 3AN1A 1H9KA 3OIQA 3E3XA 2A6HD 3M7GA 4DV0Q 2E75C 4BY1G 4A3DH 3AM9A 1BBXC 2OF1A 1L6UA 4OIJA 4F87A 1NYQA 1OXTA 1FFUA 4W9CA 3N1YC 4A3CH 1IXRA 4LFBL 1S4ZA 2WXOA 5E6OA 3BVMA 4DUZL 3QC8B 1N61A 2I46A 4FO2A 2HE7A 2K7VA 1WJ6A 3NHHA 3S1MH 3CSTA 1TY0A 3IRBA 4UP7A 1HHVA 3LX0A 1ICFB 2UUBL 1OQQA 1VQGA 1PGXA 3Q3OC 4ASWC 1P1AA 5LNK1 1HZAA 3E6ZX 1CSQA 4M0WB 2K33A 4ZHOA 4F8MA 3CPWA 2V0GA 1S3OA 2KTRB 1GKHA 2IWHA 5CR3A 4GZYC 4TQ1A 1H9MA 2EYHA 4K7WA 3DDCB 3WOEA 2AQ2B 3N6RA 3MTNB 4AJWA 4EQOA 4A90A 1XNRL 2F0LA 1QB5D 1WTXA 1Q1OA 3JVZX 2E3TA 1O78A
chains in the Genus database with same CATH topology
1Q90A 4K5VA 1R4QB 2BB5A 5BYRA 5C44B 1EY4A 4GDKB 2NN6I 5F2DA 1STAA 3FPPA 1VMCA 1HXYD 1Y1VB 2LMCA 1P7EA 4G7OC 3DEPA 3LNNA 3MXUA 4YIJA 1BXTA 2PTLA 3NUHB 5D3DA 3Q24A 2F0IA 5IT9E 1A3TA 4DK0A 3AEEB 1N62A 1JOQA 3BS1A 1CZWA 2KQ4X 4HTHA 4HEDA 1HFGA 2I38A 4BA1I 4FVMA 1E2WA 2KMMA 2TSSA 3BZDB 4KGTA 1RKNA 1UWMA 3EQLC 5H8YE 1IBXB 1DOLA 1B1ZA 5C5LA 2L9HA 1W6KA 2RDHA 4TKOB 3V2TA 2N88A 4OZAA 1LT6D 1JQYD 2LEKA 1PYWD 4C3IG 3A54A 2B2WA 2F0JA 1B3AA 2MJ3A 1JOOA 4PV1C 3QO2A 4G57A 2F0UA 1ZXTA 5HURA 4IFDG 1NR2A 1TWAB 2HCIA 2PZWA 3DXJC 4QCLA 2SEBD 3ZQ4A 1Y1WB 4YTNB 2NVQB 2IGGA 3TUOA 4FF4A 4KKTA 5KNBA 1NUCA 2H4OA 4K2LA 3SXHA 3E5SA 4DAVA 1OXSC 2KCCA 2JX5A 2L32A 1I6HB 2M19A 4XT1B 3NVZA 2RPVA 4HR7B 5D14A 3LWEA 1L6VA 1LTSD 3QIAA 1FRDA 2F0HA 3FAHA 2RA4A 3OMCA 1SAPA 5JEAH 5DNFA 1Q12A 3P4QB 5EGTA 3AE8B 3QWNA 2X69A 2LHEA 4OGQC 4RGMA 1KABA 1PTOB 1GPXA 1U4PA 2IJ0A 1SNPA 4ZYSA 5E1FA 3MHZA 2W82A 1Q1EA 5ELBA 3I70A 1CHQD 3K5MA 1QOGA 3I57A 4KHZA 5A2QL 4FNFA 1OQRA 1PGAA 4A8XC 3URYA 1TQOA 4P16A 2I2YA 3EROA 2MPMA 2MEKA 4C7YA 2M56B 1YJJA 4LJZC 1GHJA 1IGCA 1LACA 4GDLB 1TWCB 1OO9B 1G6ZA 2B2UA 1ESRA 3VRAB 5C4JB 1PRTB 2CJNA 4KY5A 4J1MA 4HMJA 4MH8A 5EE3A 3C1FA 1A3UA 4HSPA 1ZP0B 1U4LA 2ENBA 4U68A 2BT6A 1CHPD 5FLXE 1U9RA 3N52A 1SE3A 3Q23A 4RGOS 1FNWA 1C8CA 1SNDA 3CRLC 1PXUA 4HAEA 1QOFA 1S5FD 1GHKA 1PZID 2WQYB 3NWSA 3GTPB 1PZKD 2K5PA 2WB1B 1BCPB 2O5JC 2IGHA 1PUTA 3A8KE 1SFOB 2DNEA 4FXGC 4KTAA 3VR9B 4OIKA 3T3OA 5G5HA 2K04A 3TP6A 3SHLA 5JPMC 2PZTA 2WXLA 4B0EA 2CW0D 1GB1A 1VJKA 2WU2B 2CW0C 3VYSA 3K0YA 2EYMA 3AH7A 4WRDA 1RYJA 3HOXB 1D6EC 5G3LD 1ACCA 4US8A 3K58A 1LV9A 1WTVA 3A8IE 2N9KA 1SYCA 2QDBA 3NUCA 4BY1B 3MHBA 2D9UA 4B9WA 3QJYA 2A6ED 2WP8J 1HUNA 3Q8AA 2EOTA 1NAPA 1C4QA 2WXGA 1PDQA 4BWGB 3S1MB 3R2IA 3B2GA 5FK9C 3S1NB 2WDVB 4GLSC 1SNMA 4H44C 1EM7A 2B2TC 1MI2A 2EJMA 1EWHA 1RCVD 3IFDA 1K53A 3P75A 1QNKA 4EVOA 1QT9A 4KV6A 3NQTA 1X32A 1XWEA 5CV8A 1QKZA 2E2HB 1PRTD 5M5WB 1L0VB 5JPNC 2BB6A 3M4OB 1LT3D 2RSNA 3SDZA 4S3SA 1UUPA 2QIEB 1IW7C 3P42A 3ABVB 4HRSA 2KQ3A 2INPE 3PV0A 3DWMA 2MJDA 4X3UA 3KK7A 1STBA 5ELFA 1EU4A 1BO0A 1VCIA 4HMIA 3H6MA 2KDMA 4ZRPA 1KLGD 1FMAD 3PZ8A 1V43A 1LO5D 2BDNA 2EPBA 5COYA 1SE4A 3KLRA 2KCNA 1L4DB 2J53A 1QE6A 3O13A 3OSOA 5CBAE 1SNQA 3SK8A 1B2TA 4IUUA 4C1NK 1JB3A 1A2UA 1V1PA 4NKLA 3K6OA 1X3PA 2QF7A 3CRKC 5G3LF 5K5PA 2BS2B 2PLPA 2A74C 1LTTD 2LGIA 3ZYYX 4FXDA 5MPOA 2AQ1B 1F2YA 3Q8BA 3IXSA 1Q10A 3DWQA 1YNJD 5IIFA 2WXMA 1YNJC 3S1QB 4IFDJ 1GJXA 3FILB 1HA6A 1TWHB 3KBXA 1FYCA 1HUMA 4CGYB 1B53A 5FR3A 1PTOC 3J7AF 1N60A 1PRTC 1RHPA 1SF0A 4X3SA 2MHVA 4CQNA 2QMTA 1FXIA 2SNSA 3W5UB 4K8IA 5BN3A 1SNOA 1SSNA 1VZ6A 2LS01 2XNAC 1DZ1A 3OPOA 4NZLB 1TWFB 2YU9B 4LK1C 5IGFA 3A55A 2DWQA 3HS0C 1TYGB 3AE1B 4E6IA 3MJ5A 3K7AB 1SDFA 5ELDA 2BE5C 3EFXD 4A3MB 4OO1H 2BTEA 5FLXL 2PQEA 1WTPA 3TZDA 4KN4C 4DA2A 4WIPA 3B2FA 2ICEC 1V1PB 1C76A 2A5HA 2F0VA 1EY0A 2EZVA 1WGKA 4KJOA 3GB1A 1D2BA 3R2TA 3D4RA 2MGSA 5I9PA 4LTUA 4C3HG 3OWFA 1E0ZA 2YEPF 3PMFA 1JWUD 3AE3B 1HPCA 3J81E 1NR4A 1ET6A 2Y5CA 4YT0B 3DWPA 3H91A 2LJIA 2F3WA 1QCBD 4C80A 1D4BA 5KIXA 2WINB 5IGBA 3MEHA 3RZDB 5AUKA 1EOTA 4F88A 3MFYA 4H0LC 4YSZB 1UNSA 4XDCA 5I9OA 1RD9D 3ITPA 1TS4A 2K5DA 4M8AA 1FO4A 2F0GA 3KWLA 1QOHA 3SFEB 3ETRA 3DWGC 2WDQB 2EJFC 2E2IB 1WCMB 3H3VC 1K8MA 2W3RA 1KF6B 1E0BA 4ZOHC 1F9SA 3OIPA 4YTMB 1XO3A 1ENCA 1SYDA 1IYVA 5JVH3 1ROEA 4KKSA 3PUVA 4QMGA 5C0XH 5M5YB 4N59A 3GTGB 5CMDA 1EEID 1QG7A 3CU7A 3H09A 1KLUD 4IUNA 2QILA 2A68D 2O5IC 4XWTA 1ZDVA 5IODA 4QB4A 4JPSA 2KAJA 2W55A 5J39A 4KI0A 1KNAA 1EY5A 1FNUA 1HTLD 2F0NA 3M4YA 4XTCS 3S16B 2HDMA 3IL8A 4DNRB 5EKLA 3PZ7A 3W3AA 1D1KA 3NQIA 3DMUA 5ISRA 4HCSA 1YQ4B 1K52A 3J9CA 3PIP3 3BWUD 1Q3LA 2NBFA 4BY7B 4DGZA 4HJGE 1MSGA 2VZKD 1T5EA 2R3ZA 3GV3A 1DXMA 3OHXC 5EPJA 2AWNA 3D8GA 3QOLA 2EELA 1WXQA 3M85A 1C9FA 3OOCA 4G4KA 2CVRA 1H9SA 2A68C 4KGSA 4B08A 1LT5D 3P1HA 1FCCC 1ESFA 4KD4A 5C4ZA 2B2UC 4ABNA 1BCPD 1XEEA 5JAVA 5DM63 2PZUA 2EYPA 2MH7A 1EYCA 1CQFA 1ET9A 1HCZA 5D7GA 1PTOH 1DM0B 4ZLTF 1HFNA 3I4MB 4XXEA 1TS3A 4PMBA 3LXFA 2EYOA 3QB3A 1BQQT 1SYBA 4MHEA 1TVXA 2YEPB 5I2XA 2OHFA 1RODA 3LWUA 1CI3M 5H92C 5KEEA 2A73B 5KNCA 4AS1A 1MVKA 1O7ZA 3VYUA 5LL6X 2JXMB 3SEBA 2EYLA 1RDPD 1JORA 2WV6D 4L8JA 5EBDA 3PO0A 5J22A 1WYGA 2K9XA 5JOBA 3RLFA 3MFGA 5T1GA 4ZAIA 5C4HA 1CJEA 3L7ZC 2Y0SB 2X6GA 4KHVA 5EKKA 1QF6A 3IFTA 3AE6B 5EBCA 3JAME 3NP8A 1NCVA 3TN2A 1FFVA 1ZOYB 3E9SA 2J52A 2JSOA 3NK9A 2FUG1 2ID0A 2L55A 3L4PA 4L1BA 2G9HD 2B8FA 3I3CA 5IGGA 1QLBB 2DY7A 1ZDXA 5ELEA 3J7YW 5AUIA 4FXCA 1BDOA 3D4DA 2GA4B 1WTQA 2JSVX 4AYBB 1WSPA 3ONAB 3W2DA 5E3FA 4H13C 3A56A 2V4IB 2MUYA 4A3GB 3PO2B 4OVZA 3L3OC 1N5XA 1XCTL 1A70A 4IUTA 1UGJA 3H0GB 3A7AB 4YSXB 4QF4A 2IGDA 5GXGB 4XYQA 3MA2B 2KACA 1J7BA 3SK4A 1JCKB 1TY2A 1XYIA 4DN4M 1JWAD 5EKIA 1OXXK 2EKIA 2I07B 4CHTB 3E0JA 3I4NB 1R4PB 3TBIB 3VA5A 1SXTA 2F03A 2B2YC 1BR9A 1EY8A 3UI2A 4A3IB 4YSYB 1ZYRD 3H94A 3KLSA 1AW7A 4X3KA 1VF5C 3FMCA 3W5VB 2G9DA 2PYKA 5FO8B 1I4RA 5M3MB 1Z6HA 1GOZA 3AEAB 1RF2D 1C4PA 2PVOD 4A3KB 4FF2A 1ZE3D 1EYDA 1E6EB 3U9SA 2KEDA 3GTOB 2D2CC 2VB3X 1C4CA 4L63B 1AYFA 2B8GA 2X38A 1WWTA 2ZXOA 3HKZB 5JJZA 5FKAC 1C77A 2DNCA 5K36H 1EYAA 1TWGB 1F2RC 4ARIA 1PFMA 1SYFA 3S14B 2WXRA 2XVSA 3SR1A 4ZHPA 4YTPB 1STGA 2A69C 3U9OA 3X3MA 1PTOF 2XIWA 2F0WA 1SYEA 2RVLA 5T1IA 2JEAI 1EFID 2FFKB 2FBWB 1Y8OB 4I65A 3SK6A 3HOYB 2N9LA 4N9TA 4HROA 4RFBA 1ILQA 3HEJA 1BUVT 3AMZA 2VNUD 2A6EC 1ZKOA 3AB9A 4DFAA 4JX1C 2XRSD 4YWGG 1JALA 2EY5A 4BA2I 2IX0A 2IX3A 5KNDA 4RKLA 5C0XJ 1TKEA 1V8QA 2SNMA 5BYSA 2W54A 2DLBA 2BS4B 4K2KA 4TQUS 4KY7A 1V8CA 1B9NA 2F0SA 1CK1A 4ZRZA 5BMHA 2R6GA 2HTME 4DNTB 3I72A 1STYA 4TRDA 5JVG3 5M3FB 3VR4A 4A3JB 1OFFA 1EY7A 1DOXA 1PZJD 3OW7A 1PMRA 1O80A 3S2HB 4HKQA 1JR0D 3CQZB 4JWSC 1STHA 4IUQA 1TKGA 5CV7A 2Q8IB 4QUFA 1JWSD 3L9AX 3MWYW 5BN5A 1KDAA 1ML0D 4JK1C 2F0DA 4DK1A 3VRBB 5IGCA 2ZT9C 2F0MA 4ODGA 1Y8PB 5EPLA 4MN3A 2J42A 1NENB 1IKMA 4YXDB 2B2YA 1C78A 1AEXA 4TSSA 2H89B 3GS2A 4RF1A 3OMGA 3IKJA 1SEBD 1EZ6A 3U2SC 1NSNS 3FDTA 3CIRB 4WWMA 3C2PA 2WKDA 2HDEA 4D2KA 2FMMA 4CJ0B 2C5CA 1GUNA 1RTOA 2K6AA 2OT2A 1NVID 1CT1D 4L2YA 4HCEA 4X3TA 1EWYC 3UI3A 1VF7A 4C3IB 4M0WA 1KRHA 1N5WA 3Q69A 4J3OD 4IUPA 2V3PA 1RWSA 3EA6A 1ONLA 5A35A 3TEWA 2PMZB 1R7SA 5D3IB 2F0TA 5NUCA 1SBBB 3GD7A 2NZ1D 2MJ8A 2QSDA 4PQXA 1EIGA 1S5DD 1BOSA 3QOJA 1ENFA 3Q8CA 1T6BX 1JROA 4LAAA 1F77A 2K28A 3NPPA 2IDYA 1I7HA 2RDFA 1TKYA 3LYYA 3TP5A 3RPFC 4IFDH 2F0KA 3P7JA 1MSHA 4KKJA 4IZ8A 3SVMA 1E7PB 3WDNA 1DOYA 3FILA 4A9AA 1SNCA 4KKIA 1JOKA 2EY2A 1DCZA 4Q5VA 4ULLA 1H9SB 1B50A 4K5XA 2EJGC 1KDCA 4CJ2C 3PUXA 5EJWA 2ACZB 1E2ZA 1L0XB 1WTOA 3T3NA 4XQJA 4KN7C 1PGBA 4NAMA 3ND8A 1IGDA 3MC0B 5I4DA 4RA8A 2DBYA 2BBCA 5M9OA 2H1EA 2VUMB 1QWYA 4RWSC 2V4DA 1PLFA 1CQVA 1PRTF 3NBIA 1S5ED 1X3QA 1K50A 4QUCA 4CBVA 4FYDA 2IX1A 4CKCA 4WAFA 2KUMA 2K22A 3P4SB 1Q1BA 1Z47A 2GB1A 2NN6H 4R3DA 4C7ZA 3HG9A 4BS9A 1C48A 2N7JA 1FR3A 2CU3A 1F2RI 1JICA 2XWJB 3QG1A 4XQNA 1M4VA 1G8ZD 1PFBA 4ZUIA 3VR2A 1PDXA 1F0ZA 4QIWB 1B9MA 1BNZA 3HGBA 4M1UB 3ZGZA 3NE5B 3DEOA 3CHBD 1I3QB 2L1AA 5TSSA 5A2QE 5C0XG 1VMPA 1RTNA 2RDGA 5DAUA 1CFMA 1I6VC 3D3RA 2YYZA 1TKWB 1C4AA 3HZXA 1IW7D 3FRPB 4PNYA 3V96A 4A3BB 1N63A 2JQRB 2K1BA 4PMCA 4JBWA 2WNMA 3I9V1 4XDXA 1ZEQX 1EIHA 2K03A 4ILWA 3GTKB 2J4XA 1LLRD 1VR9A 3TP7A 1AN8A 2XSCA 4CKEA 3S17B 2NTTA 5C3JB 2PO4A 4WJWA 1A6XA 2HCCA 3V05A 3NSWA 4LMQD 3T56B 2FJ2A 1QILA 1BUIC 5JXVA 5CV4A 4K6LA 2F0FA 1F2ZA 2WS3B 1LTID 4KKUA 2B2TA 3KF8A 1EQTA 4B9XA 5AFWA 2RMMA 2QEJC 4PMWA 4K5WA 2WU5B 1D1IA 2NVXB 4FF1A 2K32A 3AMUA 1JWBD 1TT2A 3DUZA 4KD3A 3K59A 4FF3A 1K51A 1EWCA 3AEGB 2AX5A 3RFZB 3RUZA 5ELCA 2JA5B 2LFNA 4TQ0A 2L5TA 2BYTA 5C3XA 4UAIA 1NEKB 1Y8NB 1H9RA 4FP5D 1YMHE 1TS5A 3TDQA 5C2TB 3D4WA 5EQ0A 4ME5A 2VZKB 2HQEA 1B44D 4Q0FA 1I4XA 4B0MA 3AU7A 4IOIE 1YN5A 1KNEA 2NVTB 3ND9A 4CJ1B 1XX8A 1XLQA 1STNA 2PW9A 3X3NA 3C46A 2PVGC 4IFDI 4RNAA 1C79A 2L4NA 1EZ8A 2K0PA 1KH0A 1M8AA 1V1OA 2PW5A 1T3QA 2WXPA 4WH4A 2AUJD 1XCQL 2Y3AA 3EUB2 5I6YA 2WP9B 2RSOA 2O4XA 1TIID 2Z4IA 1LTAD 5CC4A 2WXNA 1DOKA 2VXWA 2EDGA 2B2VC 3KQ4A 2F3VA 1PFDA 5M5XB 1L4ZB 2EE1A 4REZA 2K05A 3AB5A 1F9RA 3NBHA 4Z9CB 3T16A 5LHY1 3BG3A 4NP5A 3K5NA 2L83A 1FCLA 1CM9A 4IDIA 1AFPA 3G6JB 2SOBA 2JA8B 1XLOA 3AE7B 3VR8B 3HP3A 3SFDB 3IAS1 3GO5A 1H9JA 3IAM1 3J80L 1CA5A 1SB3C 4BBRB 1QNUA 1R9TB 5C6AA 1IUEA 1FD7D 3A7LA 1DYQA 5FOBB 4MT5A 3TEYA 3KLSX 2KEEA 3PIO3 3AE2B 3P4RB 3KUPA 1GUWA 2FINB 3AE5B 2KOLA 2JA6B 2L1BA 3BVGA 3MXGA 3U7ZA 3PUYA 3SK5A 2Z4HA 1F2LA 2XN9C 2H88B 3T13A 2QJLA 3RD4A 5CYUA 3IT6B 3MXNA 1D5ZC 3RMHA 1XLNA 2KJXA 1MBYA 3MVVA 3GTQB 1FRRA 1HQMC 2Q8TA 4BBSB 1BMLC 2SDFA 3I90A 1E10A 4FXKC 4L23A 2PIAA 2F0QA 2EY1A 3HOZB 3I91A 3NXWA 4KMUC 1XF5L 2TMPA 1WTWA 1VDVA 4H7BA 4RAUC 2D62A 3JAML 1E9MA 4A93B 4RHSA 5C3EB 2A6HC 4DXFA 1HTPA 2IL8A 1ZPSA 4OL7A 4EQNA 4IQZA 1O7YA 4ID6A 1T5XD 4O1NA 2A69D 2NN6G 4HSVA 2W3SA 2V3NA 1G91A 3BIID 2J0TD 4OO1I 2BCOA 2X6LA 2NMQA 1NYRA 4US9A 4JE3B 2LUMA 2N55A 2FHTA 4RGTA 1BF4A 3W1SA 3E56A 3NTIA 3NRZA 5DEHA 1YNTE 2IPKD 4EQPA 2WXIA 4EGVA 4C3HB 5J1ZA 3TSSA 3BDLA 1F2MA 5CORA 5DM73 2INNE 3J80E 5IT9L 3R3OA 1JQ4A 1WRIA 1QQRA 4TMAB 3BDCA 1SIJA 3NZ3A 1AP0A 1Y56A 1IYUA 2JYOA 4MACA 4ITKA 4RF0A 1AZQA 1JMLA 3A8JE 2MJEA 4V0BA 3ERQA 4RCOA 2KWDA 2CJOA 4RHRA 3TEZA 2PPBC 3S15B 3CKIB 3GV6A 2EYFA 3DM1A 5D65A 1LABA 1MHXA 3T53B 1V97A 3AV8A 1LTRD 1IL8A 1FGBD 3KBGA 3OWEB 5C5MA 3VR5A 2ICIA 3BYTB 2BA0A 2Z1CA 3FPUB 2OXPA 4LK0M 3HVDA 4J6HA 4MM3B 1SSOA 3Q8FA 5EE0A 3Q6SA 2F0OA 2JA7B 3PUZA 3AEBB 3IT4B 1DOMA 1U4MA 4R9WA 1A2TA 4XIGS 2DYMA 3C3LA 5E6JA 4NDXA 3K5LA 1AWDA 2PW7A 4K8JA 5E4XA 1WD1A 4KX6B 2BOSA 1Y69U 3D31A 4XWWA 1JRPA 4L6TB 2L52A 3NTHA 2Y5PA 1YQ3B 2JYEA 1EY9A 3R93A 3VYRA 2GRIA 1FXAA 1I4PA 2OEOA 1II3A 3ZJUA 4IUVA 5CBEE 1EEFD 1KAAA 2CHBD 1LTGD 1VZ7A 4IALA 1GUOA 2N0SB 3AEFB 4RGNA 3WCQA 2OEDA 2LHDA 2E74C 2J7ZA 1OXVA 1TS2A 3MAQA 4USAA 4NMZA 1MHHE 3DWAA 2KECA 4C3JG 4UDUC 1D5XC 2JP1A 5KRUA 5FO9B 4J8QA 1G2SA 2NUCA 1JC7A 3T51B 3Q0AA 4Q2JA 2Q8RE 4ZQ3A 1ENAA 1B4OA 4K6DA 5G5GA 1TZOA 2F4IA 3EGRA 3J81L 1K8OA 3K5OA 3C1EA 4OHJA 5C3WA 5FO7B 2JWUA 4RKBA 2B76B 2WKCA 2WXQA 4CKBA 3I8ZA 1AZPA 3S1RB 4N58A 3U52E 1VLBA 4P6VF 2AQ3B 2RQXA 2BE5D 2Q5WD 1GUGA 1A15A 5HG2A 3VYTA 2L11A 3BDOA 2B2VA 1S5BD 5CV5A 4A3EB 1DJRD 1D5MC 1F9PA 1STEA 2L0CA 3TZUA 4OZCA 3NWTA 1JWMD 2K5WA 1K83B 1DD2A 2WXKA 1CZGA 1DONA 3MXPA 1LTBD 2DYOA 4XDDA 1BCPC 4F7XA 3F2UA 1E2VA 4DAPA 1SE2A 3VR6A 4ARCA 1GXDC 1HRJA 4RH6A 3U4EG 4A55A 1FEHA 3N9YC 5K36G 2WXHA 2PMVA 1FNVA 1I50B 2RBMA 1VZ8A 1U4RA 3EJIA 4Y7NB 1SJHD 3ZJVA 2B2WC 3MTSA 3S9WA 3SR6A 1PTOD 3TMEA 2GI9A 1MI0A 2KVMA 4XT3B 5BMGA 1ILPA 4HN7A 4A6QA 4C1NI 3P4PB 4P2CB 3NS1A 3GQBA 1ICWA 1KTKA 1PFNA 2LFIA 2IW3A 5CGKA 4IKGA 3P20A 3S2DB 3BK1A 2BDOA 4DF7A 2WLBA 2ZW0A 1JE4A 1MD2D 4IURA 3NVVA 2CQAA 2F0PA 2ZXRA 3SE0A 3TEXA 3DHQA 2LKVA 2BW2A 3FVQA 4XQQA 3BYYB 1UAPA 3RZOB 2M2LA 5EE9A 4HKZE 5T8IA 2D5DA 5EE1A 1VDZA 4C2MB 1WTRA 2WXFA 1KDBA 4IN3A 2EXZA 4N9PA 2NYZD 5KYIA 2E2DC 4KY6A 2NTSA 3M7NA 1DOIA 4A3DB 3EVQA 1GUTA 3LB8C 2FE8A 1RFKA 1IBXA 5HGTA 1S5CD 4ZKCB 1J8IA 2R61A 3IAYA 1SMYD 4KK7A 4DXGA 2R7ZB 1RM6C 1G291 3KWVA 1HQRD 3NVWA 1MPEA 2ZXPA 3M3YB 2DN8A 2E76C 1SJED 1I4HA 3AECB 3Q22A 1GUSA 5KYLA 1J7CA 4KJNA 1FM0D 1P7FA 1KFYB 5LL6S 2JXTA 2M0AA 4I7ZC 2SAKA 2QKIC 2F0EA 3D6CA 3GTJB 2EYJA 3I4LA 3PUWA 2B63B 3NVYA 4EE2A 1XTCD 2C9OA 1L5PA 4WURA 3C8YA 2LMCB 2DY8A 3HRZC 4U673 3WOFA 5KGUA 1O7LA 1WVLA 1YN4A 2KHSA 3NTKA 1IKLA 1EU3A 4OW0A 4JWUC 2JYTA 1XLPA 2D5GA 2IT1A 3TP8A 4H2AA 4OO1G 3VR3A 2M00A 3P63A 3GP7A 5IGEA 4MIUA 1YNND 5CV9A 1XXGA 2B39A 1HA5A 2ZW1A 4N6EB 2QCPX 3D6WA 2MP1A 1DGJA 1G2TA 1EY6A 1FIQA 2EY6A 3AE4B 1CA6A 2WDRB 1HEZE 4NW2A 1J7AA 4LLGM 3AEDB 1TJEA 1ZUD2 4XYOA 2LY7A 4O42A 2L12A 1QOBA 2NWGA 4NJCA 2XWBB 4C3JB 2AUKA 1L0YB 5IOCA 3HOWB 2JE6I 2JU6X 1SMYC 1F9QA 4KGRA 2PCFB 1GAQB 2E6XA 3R8BA 1QOAA 2BA1A 3P1MA 2F1MA 2VB2X 5JEAG 2NB0A 4WFN3 2WAQB 4A3FB 1Z7TA 3BK2A 4ZUJA 1UWXA 2EVBA 1NI3A 2ONQA 1LT4D 2ON8A 4ZRQA 2NVYB 5I2YA 3HUIA 3T4AC 2WIIB 3FKIB 3HOVB 1B9RA 1MGSA 5BN4A 3CWIA 3FC4A 5BMIA 3GTMB 5BYQA 1FD6A 2KA7A 4K14A 4DU9A 5C0XI 2G1EA 2JZPA 3J7AV 2KN4A 3ZJTA 1QJOA 2JEBI 2WACA 2AWOA 4WORA 1HZ5A 3W9CB 5E4WC 4V190 3Q8EA 3H8HA 5I6WA 5C4XB 2E2JB 4XE0A 2BS3B 3K57A 1BCPF 2R92B 1ZXIA 4HEA1 4RCNA 3VA7A 1WD0A 5EPKA 3BVZA 3B9JA 1JW9D 2K5QA 3G7LA 3V3XA 1UEAB 5HI1A 4WQMA 3VQIA 4DQOC 3HVZA 1IHZA 2RKSA 2M9VA 1CZPA 4PT5A 1VRAB 4C56C 1YNNC 4R8NA 4ZKBB 1EL0A 2XRQD 1I4QA 3PO3B 3I73A 1ZXHA 1YJIA 1OXUA 5JEAJ 4DAYA 5HHDG 1TU2B 3MZ5A 2R93B 3MP9A 1W6JA 3GTLB 5HFYA 3FEWX 1RJTA 1A3VA 5IGDA 3HOUB 4ZK9B 2FMCA 1Q8IA 1J9OA 4R8IA 2O2LD 1ZYRC 1EQVA 4NAWB 4G7HC 1HZ6A