2NTTA

Crystal structure of sek
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
b'QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin K
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nttA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nttA01
1LTTD 2QILA 1XXGA 1PTOH 1LO5D 4RCOA 1BCPF 5ELEA 1PRTD 2ICIA 1FNUA 4K6LA 5ELFA 1STEA 2XRQD 4O1NA 1D5ZC 1V1OA 1SJHD 1FNWA 1SXTA 3R2IA 1S5FD 3R8BA 2SEBD 3BYTB 1EEID 1I4XA 1KLGD 1PTOD 1I4PA 2CHBD 2NTTA 5FK9C 1FGBD 1PYWD 1SEBD 1TY0A 3GP7A 1UUPA 1EEFD 3BVGA 1ESFA 1LT5D 3V05A 1F77A 1V1PB 3SEBA 1CHQD 2RDHA 2TSSA 1TS4A 1CQVA 5ELCA 1CHPD 1LTAD 1LT3D 4L6TB 5FKAC 2AQ3B 1I4RA 4BWGB 3DWPA 3MC0B 3R2TA 1TS2A 1BCPC 1S5CD 1LT6D 4NZLB 1AW7A 1JWSD 4RGTA 1ENFA 1SE4A 3EA6A 1PZJD 4RHRA 5D3DA 1CK1A 1JWMD 1RDPD 2QEJC 1CT1D 3BVZA 5D3IB 3URYA 1EFID 1T5XD 1EWCA 3CHBD 4L63B 3KLSX 3MFGA 2AQ2B 4RGMA 5ELBA 1PTOB 1KLUD 1S5ED 4UDUC 1BCPD 2J4XA 1LTRD 4RGNA 4C56C 1S5BD 3BZDB 3DWAA 4OHJA 4RFBA 1I4QA 1RF2D 1B1ZA 3O13A 1PZID 1S5DD 1PRTF 1QILA 1V1PA 1FNVA 4TSSA 1M4VA 2O2LD 1TS3A 1JQYD 1DJRD 1D5MC 1SE3A 1GOZA 1BXTA 1XTCD 1LTBD 1SJED 1PRTB 1LTID 2R61A 2XRSD 2IPKD 1PTOF 1ET6A 1EU4A 1HQRD 2RDGA 2Z8LA 3TSSA 2WV6D 1HXYD 2AQ1B 4ZYSA 1ET9A 4RGOS 1PTOC 1TY2A 1G8ZD 1HA5A 5I4DA 3BYYB 1L0XB 1I4GA 5TSSA 1FD7D 1L0YB 4DXFA 3W2DA 1TS5A 3DWQA 1DYQA 1HTLD 1D6EC 1LT4D 1AN8A 1LLRD 2XN9C 1BCPB 1EU3A 3BVMA 1RD9D 4RHSA 1SE2A 1JR0D 1B44D 1LTSD 1KTKA 4RH6A 1MD2D 1PRTC 2NTSA 2IJ0A 1JCKB 1I4HA 1JWUD 1YN3A 5ELDA 3OWEB 1YN4A 4Z9CB 1PZKD 1YN5A 1D5XC 1RCVD 1UNSA 2G9HD 3EFXD 4DXGA 2XNAC 1LTGD 1SBBB
chains in the Genus database with same CATH superfamily
3IAS1 5CV4A 3VR2A 3PRMB 4TQ0A 2F0MA 2D3GA 2OTJA 4MTNA 3CQZB 4BY1H 1J8IA 3ZW3A 2A6HC 2XRQD 1I6HB 3NVZA 2MQHA 1WD0A 2QDLA 4DV6Q 2DZKA 3PUVA 4HLEA 1V1QA 5M3MH 1K9MC 1LQBA 4EQNA 2IGHA 3T4AC 4O42A 1O7YA 4JI4Q 4JC0A 1EO6A 2A68D 1WJUA 1WXQA 4JI5Q 4Q5VA 4P1CC 1GAQB 3ZJUA 2EIFA 2A6HD 3JW0X 4EEWA 2KN4A 2UXBQ 1VQLA 2JA7B 3CPFA 4MHEA 2M0XA 4Y7NB 3RZOH 2RR9A 2DUDA 1STYA 1UBIA 3M3YH 5C5MA 3HOZB 1FL0A 4L5QA 4GU2A 3W1SA 4PS8A 3HOZG 4JBWA 2VZKB 5IP7G 1WSPA 3R93A 2LZ6A 3DVNV 2VH2A 4QF4A 2BWES 1CTMA 4K0KQ 2IYDB 4IURA 4P73A 3ICEA 4MDKE 2R3ZA 3RMKC 1BO0A 3PO3H 4RGTA 3IAM1 1E8ZA 1B3QA 3EA6A 5D3DA 4FYDA 3W5VB 2GN5A 1CK1A 3CMMB 3UQAA 4QIWE 3P75A 2G4DB 2WXRA 4UY8C 5D3IB 5LNK1 3M4PA 2ON8A 4KHVA 3AYHB 2O6VB 3W1SC 2JP1A 2IW3A 5J1ZA 4C3IH 5IP9G 2JEAI 1QOAA 3TEZA 5ELBA 3G6JB 1D1IA 1HZBA 2WDRB 3MHZA 3A9JA 4JLCA 5J17A 1HTQA 3AU7A 2KCCA 3TBLD 4A3CG 3HEJA 1S1QB 4PMBA 1ZKOA 1VQ5A 1AEXA 3BZDB 3NS1A 4ZRZA 1ASZA 3DVGX 4IFDI 2L5TA 4RMAA 2Q2TA 4XYOA 4DKAC 2ICEC 2WKCA 3JC66 1FYCA 4I7AA 4GNXB 5IT9E 3DBRI 3DVGY 4ICUA 4BA2I 5BO4B 1BBXC 1XLOA 4JI8L 1D7QA 4BBRH 1DJRD 3H15A 3T9LA 3GTPB 3SU8X 2NVTH 4KY7A 1BXTA 4DV2L 4TUUA 4WQOB 1X32A 4LFAQ 2EY5A 3FRPB 3TRZA 2KVRA 3APDA 4N6EB 3E9SA 3MEHA 3HGBA 1EU4A 4YL8A 4A3EB 3TSSA 1HZ9A 2G4SA 2N55A 4US8A 2HD5B 3GTLH 1CZWA 2Z59B 2HQEA 5FO9B 3K0XA 4N8FA 3ENEA 4FXCA 3CCJA 1HA5A 4JCVE 4IPCA 1KAWA 3SVMA 1SYBA 2QCPX 3LDZE 1JC7A 4HPLB 1V5TA 2VZAA 2NBVB 2O6VA 2JVCA 3SD5A 4NP5A 3FKIB 3B08A 2CH4W 1R4MI 3BK1A 1X1MA 2UWQA 3B6YA 3ZNID 1SLJA 2NZ1D 2KC1A 2GBKA 4IUVA 3I91A 1W2BA 4BS9A 3I4LA 2JA5B 1P7EA 1GUAB 5I2YA 1VD2A 5IGGA 3Q2AC 1V86A 4GNXA 1YN5A 4WJNA 4KD3A 1F2RC 2LXKA 3WWVA 2VRRB 4DV0Q 4YIJA 2VZKD 1T5EA 3HP3A 3BJUA 1JALA 1LTTD 4UP7A 3TEYA 1ZEQX 4LLGM 3UDGA 2QILA 5KNDA 3DWGC 4X3TA 4GKKL 2KWDA 4DUZL 1R4NI 4M8NA 5EKKA 4HMJA 4CHTB 3GDEA 4ILWA 3WALA 3PMFA 2HIXA 3RFZB 5AZGA 1MJEA 5D94A 1SJHD 1CMXB 4GNXC 3KLSA 1MPEA 5M5XB 2O6VD 3NSWA 2WDVB 3QC8B 1K3RA 2WXOA 2C5CA 3L4PA 1KLGD 2MEKA 1KM7A 1BR9A 1XMQL 2R2QA 3EFUA 2ZW1A 2KENA 1TY0A 2WIIB 1N62A 3CSFA 1OTCA 3R7QA 1PH8A 5AZHA 2JYTA 5JVH3 4DV3L 5T1IA 2B8FA 4AYBG 2HTHA 1LTAD 5JEAJ 3PSIA 2ID0A 2PZUA 2VQFQ 5LXIB 1GHKA 1QE6A 3R2TA 3ULJA 5LMNW 1NUCA 1TS2A 1VQJA 4XT1B 4FF2A 2B3AA 3VA5A 3N32A 4TQ1A 2SNSA 3HOXH 2LKVA 4G0NB 2N88A 4MGYE 2GLSA 2L1BA 1XT9B 4DR1Q 3BZCA 3W1BA 2IZVB 2H1EA 4DV4L 4HSVA 4QUCA 5JZEB 5FLMG 2FJ2A 4HTHA 3MC9A 2Z6KA 4K2LA 3NVWA 4L63B 5J39A 4XQJA 4FLHA 4C1NK 2D9UA 3I2ZA 3LGJA 5JEAH 2UU9L 2LS01 3RZOB 1TKYA 2KTRB 1A15A 5IOCA 2PW5A 2CFMA 2ASQA 4LWCA 5M3FG 4RA8A 4L23A 4CGYB 2K03A 1X3QA 1FJGL 1UD7A 4K7SA 3L7ZC 3HOVG 2WXQA 4G3XB 4JPSA 3PIOA 1STNA 3IFDA 1ZKHA 1ZXTA 5C3JB 1T9HA 3LYYA 2Z6KC 2C9WB 2HJ8A 3I3TB 1M4VA 2I0QA 3PO3B 3H0GG 1GUNA 1KNAA 4IO9A 2E5LL 4DA2A 3DBLI 1B70B 2GBMA 4QMGA 5I2XA 1YHAA 3AH7A 3A9KB 4C1NI 4IM2A 4C7YA 1A2TA 4C3IB 4DV6L 1EYDA 4X57B 1ACCA 1ET6A 2AWTA 2WS3B 1U4PA 2A5HA 3J7YW 1J5EL 3GB1A 4IUPA 4YSYB 3OMCA 4K3BA 5MPOA 5EKIA 3SHQA 4XXEA 3DVNU 4DV7Q 5IYDH 4XYQA 1HUNA 1JWAD 1VRAB 2UXBL 4DV1Q 1PGXA 2KDMA 1KRHA 1JE5A 2V3SA 4K5XA 1DXMA 1FIQA 2RCFA 2MA9B 4JI2Q 2Y0SB 1VDVA 3ZLZA 4BBRB 5GADC 2Y0SG 1H4RA 1WWTA 2OQKA 3LNNA 3U4VA 3L2PA 1KFYB 2IO3B 1AFPA 3VR6A 4MSMB 1JWUD 3I57A 1QOHA 2ZXOA 3S14B 1BOSA 5G5HA 3UF8A 1KF6B 3ZKJC 3GTLB 4FN2A 4DXGA 4RM8A 5BMHA 1EIFA 5KGUA 4C2MH 3I5JC 2WX0A 2MBBB 4GN3B 4OO1I 4IM0A 3A9KA 1PV4A 3KYCD 1KHIA 1XNQQ 5LMUQ 3DUZA 2A74C 3CC2A 1W3SA 1DZ1A 3KH0A 4HIMA 2PJHA 5FR6A 2F4VQ 1SGHA 4DNRB 1WRDB 3KF6B 1Q86C 4LFCL 3L9AX 2ZCCA 2B8GA 2C7MB 2BW2A 3CXCA 4GOCA 2PZWA 2SEBD 3UIOB 5HKHA 3L0WB 3ZO5B 1AWDA 2WB1E 1XYIA 2BWFA 5BN3A 3K7AB 3H3VI 2PMVA 1SEBD 4K7WA 4A3OA 3BVGA 4NAWB 3U4ZA 4U673 2KDFB 4ULLA 2WU2B 1C48A 5EPLA 3TIXA 3NVYA 4LFAL 3C3LA 4OGQC 3U9SA 1TS4A 5ELCA 1LT3D 3ALBA 4H02A 2O5IC 2BPSA 1ML0D 2JXMB 3MXUA 1F52A 4NAMA 4IM3A 4MZ9A 1M1KC 3RNCC 1P98A 3HIZA 4JI0Q 2WLBA 2JYEA 3HK0A 1WXMA 3AE7B 3DWMA 4US9A 4DNIA 5IT9L 2E2IH 2F0EA 4IW0A 5I6YA 4GLVB 1AE3A 2R92G 1VZ8A 2JZ3B 3KF6A 4J6IA 4HSPA 2EYMA 1NENB 2AX5A 1A62A 4G7ZC 3C8YA 2NR2A 2FCQA 5DPWA 1B3AA 1X3GA 4WJWA 4HJ9A 1E1TA 2C35B 2H4OA 2NVYH 1KLUD 3VA7A 5JHAA 1E7PB 4M0WA 1JOKA 4ZHOA 1XPUA 3V60A 4NAWA 1I4QA 4O2DA 5E4WC 2R93H 2NCNA 3NY5A 2N7EA 3L17A 1SNQA 5BYSA 1EWYC 1VQ7A 3EVQA 2PCFB 2ZJQA 3HM3A 1WTVA 1WJJA 3STBD 3PUXA 3FHWA 1D4BA 1ZP0B 1U4LA 4IFDG 3AE8B 4LJPB 2NZOA 1CKOA 2K75A 5EBCA 1QKZA 3E0JA 3NZUA 1VF7A 3TP7A 2TMPA 4NNJB 5C44G 4WQMA 5CV8A 1XLNA 5A35A 4USAA 3BYYB 1CUKA 1L0XB 3G48A 1RYJA 2EYPA 4W9LA 4K6DA 3A7AB 2WU5B 3AV8A 1U4MA 1A8VA 2WXHA 3NTKA 2J0MA 3KWVA 3E5SA 3PLUA 4NY0A 2VUMH 3C19A 5IY0A 4B0MA 4TMAB 4A4IA 2VQFL 1HZ5A 1B9MA 2DX5B 3EJIA 2Y5PA 2DN8A 1KDCA 3NZ3A 3S9WA 1MD2D 1IGCA 1AE2A 4N9TA 4B3SQ 4NXMQ 1TZOA 1KDAA 2X6LA 1E8YA 3RI7C 3U2SC 4P74A 5ELDA 2LY7A 2C9OA 3T13A 1D5XC 4DR1L 2WXNA 1Q82C 2KANA 2QC8A 3HKZG 5GQOA 3AI5A 5EAYA 5IA7A 4EOYA 3RN5A 4M8MA 3IL8A 4B6WA 3KW5B 2QGQA 2HDMA 2HIVA 1NR2A 3T16A 4LUVA 5C3EH 2CHZA 1X55A 3GQBA 3M4OB 2RKSA 3BZKA 4A3MH 3A0JA 1T3QA 4CKBA 2KC2A 3OYYA 1YQ3B 4ITKA 3B2GA 3R66C 2W55A 2QKIC 1J8CA 3OPOA 1EEID 5COYA 3BDOA 1F1HA 4C2MB 4OEMB 3HUIA 2RDBC 3EROA 4ODGA 2HTME 4BKSA 2RF4A 4W9KA 3VR8B 2I5MX 3D0FA 4HDQA 3FVQA 3D32A 1J7CA 3SK6A 1ENAA 1TWHH 4EQ5A 5EQ0A 2Q8TA 3J81E 1EYCA 2RSNA 3KJPA 2CCZA 2LWPA 1KD1C 4N58A 3NVVA 4WWNA 1KH0A 4A3DG 4L6TB 2W3RA 1I50H 1ILQA 2K0PA 2Z0DB 3DWPA 1SR3A 4UP8A 1K51A 1R7SA 1QQRA 1WX9A 1V2YA 2LEKA 3FC4A 3CCUA 1M94A 3CF5A 1JOOA 3GTKH 1SN8A 1PDQA 4DV1L 4KDIC 2C7HA 1H95A 3ERSX 4JI2L 3WA0A 1ZPSA 1CKMA 4A3IB 1E24A 4K8IA 2BQQA 4A3IG 4R4CA 3CCSA 3CIRB 2E2DC 4NXNQ 2NMQA 3H8HA 1QF6A 2DY7A 5HFYA 4OONA 3VFKA 1F9QA 5IIFA 4A3FH 1XX8A 1YX6B 4BKSD 4IG7B 1F0ZA 4V190 2K8BA 2FMMA 1K53A 3Q3MC 2BTEA 2E6XA 2O5JC 4DR6Q 2KQ4X 2PPBC 1BUIC 3IBEA 4OHJA 1F9PA 4DFAA 3A56A 4X65Q 3NK9A 4MTKA 4IJLA 4NPSA 2L12A 4BBNF 1X65A 4MM3B 4A55A 4E71A 1VQFA 4R4TA 2BKFA 2L3ZA 2E2IB 1F2RI 2EPBA 5BMGA 1WGYA 2CU1A 1YNTE 4M1UB 1O80A 2WXFA 5C3XA 3VH4B 2NPTB 4RMFA 2WB1B 2E75C 2V4DA 3RZDH 2K5WA 1TZ1A 1PTOF 1C76A 4IUMB 4XZ4A 1FCLA 5I6WA 2NVYB 1JJ2A 3DM1A 5IO9A 4DR5L 3A5UA 1EOTA 3RUIB 4JX1C 1Y56A 2FIDA 3S15H 2UXCL 1PFMA 2XSCA 2MO1A 2NUCA 3TS2A 3PPAA 4D2KA 3QO2A 4MH0E 3UINB 2K28A 4WFN3 2YTVA 3NHHA 2EY6A 1D6EC 2QDBA 3N6RA 1WRIA 2ONQA 4A20A 3EQLC 1U5KA 3OIPA 4A9AA 4KHPL 3JVZX 4RF0A 2RD0A 3ZIMA 4KTAA 3RNUA 2YLMA 1B44D 2HCCA 3I9V1 1SE9A 1IW7C 2KN5A 2A6EC 1ILPA 3WAPA 1OEYJ 4F8CB 3MVVA 3NPPA 4MM3A 1WY8A 2ZJPA 4A3JB 2F0FA 3A8IE 3DEOA 2YEPF 1Z7TA 4A3JG 3FEWX 3RLFA 3VUWA 3PQIA 2HE7A 3BDCA 3GTGH 1DOLA 2AUJD 1TWGH 2NPTA 2WXIA 2ZW0A 1PGBA 2Y5BB 4A93B 4LF6Q 2DLBA 1UWVA 3D6WA 5FLXc 1YX5B 1NSNS 4A93G 3DBHB 4HXDA 2VUMB 3CCMA 1IW7D 1XF5L 2A6ED 1YQBA 1B50A 2AYOB 1F9JA 1QOGA 4LF9L 2J0JA 5AUIA 4QQBX 4OO1G 2I38A 5H1SE 3Q8DA 1ENCA 1UEAB 5C0XH 4WJPA 3KBGA 1N60A 4IJHA 3K57A 2RQXA 5HGTA 5DAUA 4B9KA 4GOPB 4NJ7A 5C4XH 3Q22A 1HE8A 2F0HA 3RD4A 4J15A 3U4EG 3S24A 3ZRCA 4A3KH 4DDGD 4JIOU 2A5UA 1WX8A 2W82A 2Z1CA 4KY5A 3NENA 4RG1A 3GV3A 3SEBA 2FCMA 4K2KA 3J81j 3NRZA 2R7ZG 5C3EB 2F0SA 3R3OA 2DENB 1WE7A 4H13C 4A3MB 3V62A 1EIHA 3OW7A 1EY5A 3I56A 5AEKB 2F3IA 4JV5L 5J2RA 1K8AC 2JQOA 2KJXA 4DV2Q 1FRDA 1IGDA 1S3SG 1UH6A 3RCZA 3OSOA 3AEEB 2F0JA 4NZLB 1ZYRC 4ZLTF 1F2LA 4MN3A 1H8CA 3PO2H 4A3GH 2CKHB 4W9CA 1JWMD 4LNKA 1TWHB 2F3WA 3ERQA 3URYA 1UAPA 4A6QA 4BKTA 3UGBB 3NQTA 5IGCA 3AXCA 3GTJH 1HR0Q 4GOPA 1PTOB 1QB5D 4OXPA 3JAME 3LWEA 3AEVA 1C77A 1VJKA 3SR1A 3QWZB 3ZQ4A 2EOTA 3AEBB 1ZYRD 3FMCA 4Q0FA 4IUUA 3UDXA 2EYJA 1SE8A 3GTKB 4ANVA 4YHHL 2B3GA 4IZ8A 1J7AA 2D3BA 1N9WA 2MFIA 1QILA 1IHZA 1AZQA 4PZ6A 2FFKB 3LWUA 4X64L 2PVOD 3AEFB 2HUGA 1BT0A 1EQVA 5C6AA 2GVAA 4KY6A 4HCNB 1B8AA 4GOPC 1XTCD 4CDDC 2VQEL 4JI3Q 2BS3B 3PRPB 2IL8A 1OTRB 3TEXA 1XLPA 4A3FB 4KK7A 3GOEA 1L1OB 1OXTA 2MJEA 5L83A 3TEHB 1NYQA 4QCLA 3N1XC 2QF7A 2JA6B 4DUZQ 2KBNA 3A54A 3DHQA 3VYTA 1C4QA 1H9SB 1A63A 4DPGA 2JA6G 1C1YB 3E3XA 1T0SC 2YEPB 5IYBH 3AE5B 1P0RA 4LDTB 3ZTCA 3DLLA 2G45B 1EM7A 1WJ4A 2X38A 4WWMA 2AMCB 2KOLA 3GS2A 3CSTA 3PHWB 4C3JH 4AJYB 4LF4L 2Q8IB 3TZDA 1A3VA 3CCEA 4B9WA 1RIPA 2ALYB 5K36G 2INDC 1EU3A 4RHSA 4HIDA 1XMQQ 2JF5A 2KJRA 3RZDB 1LTSD 2NBWB 2DYOA 1Z2MA 1WZ0A 1WR6E 4W9JA 2N9EB 4Z9CB 4DV3Q 1I3QH 3VR4A 2BOSA 3NOBA 4OVZA 1TIFA 1LTGD 2NN6H 1XPOA 4KI0A 3S15B 3J81c 1EUVB 2KT7A 3DCGA 4DAVA 3QOJA 2EELA 1STBA 2YV5A 4N9F4 1L1OA 3I90A 3J81L 2LGXA 4IWPA 4FADA 4GLSC 2INNE 2N4FA 4K5VA 2F0PA 5IYCH 4DHZB 4DR6L 1GG3A 2ZXRA 5T1GA 3QHTA 4A75A 2Z9HA 4DU9A 3HOYH 4EUTA 2BYFA 4EE2A 4OWXB 1PTOD 1I4PA 1O7ZA 1ZGUB 3S2HH 2WXGA 3MJWA 1EY9A 4TQUS 5AJ3Q 2IO1B 1V8CA 1MG4A 2IY1B 1L1OC 3SK8A 3Q8FA 3GTGB 1YNXA 1TWGB 2KQ3A 2ATWA 3GE3C 1IYVA 4HJ7A 3HG9A 4FNFA 3RN9C 1YNJD 5JJKA 3VDYA 1FJGQ 1K83B 3RMHA 1K8RB 1YQ4B 1PA6A 2I1JA 2UXDQ 3J81i 2RMMA 2EY1A 3FDTA 1R4QB 4BY7B 4W9DA 3K58A 1YHQA 3MXGA 2E5LQ 4G57A 2KWUB 2OEDA 4BY7G 2VH1A 5CHWA 2F0UA 2MHVA 3PIPA 4DR2L 4FDBA 2OOBB 1FM0D 3HOUH 2RCNA 1PH9A 3D4WA 2LFIA 1D2BA 3EUB2 3AU4A 3DQVA 3HOWB 1L0VB 4LDTD 2N3SA 1KRTA 1J5EQ 4RKBA 3A9JB 1RDPD 3OAWA 4GDKB 5EE3A 2CVRA 4I7ZC 1XPRA 4KJOA 1EWCA 4R8NA 3PZDA 1WTWA 5JJLA 2RVLA 1KAAA 3EC8A 2PMZE 4W9FA 2CH4A 2G1EA 2JA7G 4HMIA 5C4JB 3L08A 4LMQD 2V4LA 3PVLA 2ZXPA 1TQOA 3J80c 4HKZE 4LF6L 1Q0WB 1FNVA 1SF0A 1HNXL 1WH3A 4PMWA 3S1QB 4U68A 4LW1A 3PO2B 4ALPA 4DNTB 3H7PB 4WURA 4H0LC 3RPFC 4EKUA 1D5MC 1V6EA 2K1BA 1GOZA 1ONLA 3S17B 2WNMA 1OEYA 5IOIA 1PXUA 1MIUA 1TWAH 1HQRD 1LUZA 1NR4A 3AFQA 1VQ9A 4DDID 1A3UA 5E4XA 4ZYSA 2FMCA 1EWIA 1EF1A 4XQQA 1I7HA 1DOMA 3P63A 1CZGA 1MHWC 3I4MB 4GDKA 3ZRFA 5EPKA 3I4MG 4HDOA 4FJYA 4LFCQ 4G50A 1VQBA 1TS5A 1E8XA 4TRDA 2KX3A 4NB3A 3VVWB 4YWLA 3NP8A 5KYIA 1NI3A 4EFOA 4MGKE 2M2LA 3K8AA 1WTQA 1V8QA 1FRRA 2XTIA 3CPWA 1QJOA 4MELA 4IOIE 1HNZL 3KYHC 5E6OA 2VXWA 3OWEB 3K9OB 5D65A 2PVGC 1RCVD 4DXAB 1B9NA 1E2VA 3VTUA 3PREA 3WCQA 4YTMB 1Y1VB 4N9PA 1RTOA 4GS3A 3RLNA 2K8HA 3H7PA 3P2BA 4BOZB 1X54A 1Y1VG 4A3EG 2KMCA 3NG0A 4HEA1 4YWGG 2D07B 1JW9D 2HQLA 2K3UA 1MFWA 4X66L 1YVCA 3RULA 3P4RB 3H1UA 1EQTA 4C3JB 3VRBB 1HR0L 1C4PA 3GTOH 2KX0A 1L5PA 3F2CA 4O1NA 1CKNB 3A1QB 1V1OA 1UELA 2J42A 2PPHA 4LNFA 3FKIG 4ARIA 2JX5A 4HAEA 1R4PB 3IHPC 4PS7A 2K25A 2KAJA 5JOBA 1HEZE 1WTXA 3BYTB 3QJYA 4KJNA 2CHBD 1I3QB 1E8WA 1G6PA 2FUG1 3GZNB 1CZPA 1YJ1A 1HUMA 2WXJA 2MRPA 1TWCH 2PQEA 2JA5G 1QUQB 1UUPA 2WACA 1UE7A 1I35A 3Q0AA 4JI6Q 2M17A 4JI3L 1YIWA 1QNKA 4ID6A 1F77A 4YCUA 3Q24A 4E6IA 4FF4A 2M19A 2TSSA 1HNWL 3BU2A 3JAMc 4G11A 2K22A 4JWUC 3DEPA 2DZIA 3EHVA 3JAML 3MJ5A 1JJGA 1K8OA 3VDZA 1XO3A 2D0PA 4ZRIA 1K0SA 1SYGA 1S72A 5HY6A 1EF5A 3HOYB 5BN5A 1QVGA 1MGSA 5EE1A 4AP4C 4GLAC 2E2JH 1GJXA 5DM73 2KFJA 3FKYA 2CKZB 1DCZA 1EIYB 3PUZA 3ZDMC 1CKNA 3A1QA 1DGSA 5J3BA 2D10A 4AJWA 1N5XA 4C00A 4OL7A 4MGZE 4JPBW 3PCOB 2L1AA 3TL5A 2JA8H 2CJNA 3NHEB 3ML8A 2L76A 2A73B 4YCWA 1Y8RC 4FHKA 2WP8J 3M85A 2DZMA 4RGNA 1CA5A 3M7NA 1Z5SB 2PW9A 4BY1B 2KQ7A 3KUZA 3H91A 1QUQA 1WOCA 4BY1G 3TDQA 1QT9A 2GI9A 5AFWA 3JAMi 1MI2A 5J22A 2CQAA 2C60A 4GKJL 3K9PB 2F4IA 4ME5A 2CW0C 2Y5CA 1J0GA 5M3MB 4GMVA 2H5XA 1JQYD 3N52A 1B53A 5M3MG 2UUBQ 4M00A 4RWSC 3KBXA 2L0CA 5ELNA 1SNDA 1OXXK 4HWIB 4XX5A 2GB1A 5CTRC 3V61A 4I65A 2RSUA 1RTNA 3ZJVA 3ND8A 3TP8A 1SRUA 1WXAA 4L1BA 5AJ3L 3KF8B 3M3YB 4CO7A 1VMCA 2CU3A 4KMUC 1ZXIA 4IDIA 5IN7A 3B1LX 1FD7D 3I3CA 1GKHA 1MI0A 1V49A 2Q2UA 3SFDB 2WAQE 2LD9A 4GN4B 2RGFA 4HIOA 1WTPA 3AE6B 4IUQA 4W9HA 4R4QA 5DPRA 2XN9C 2BKRB 3U30A 4ZDVA 3T3NA 1N32L 1B9RA 3SXHA 2UXDL 2LI5A 1RD9D 1MHHE 1MSHA 1NJIC 2GVBA 2NWGA 4MIUA 2VB2X 4RH6A 2KEEA 3PO3G 3A4RA 5G55A 2R7DA 2K32A 5BN4A 1F2MA 2R2OA 1WGRA 2PI2E 2W9NA 2KA7A 1YNNC 2RBMA 2RDFA 3HKZE 3Q8BA 2F0TA 3EFXD 3Q3JA 4PYUA 1EUJA 3APCA 3O65B 4C3IG 2XNAC 3PUWA 2NVQH 3IG3A 2QJLA 1U4RA 1SBBB 5C44H 1U4AA 4M02A 4FF1A 2JRHA 1VQ8A 2K8CA 4URKA 2EJGC 4P2CB 2INCC 2EJFC 4EZKA 4YTNB 1JB7A 1VQIA 2IHEA 2FIFA 2QSDA 3BK2A 4PNYA 3QCAA 2LFNA 4B3TL 2LGIA 2X8XX 4HROA 3NJTA 2BS4B 5GMVA 5ELFA 1STEA 2V1YA 3NUHB 4PK1A 4ICVA 1IP9A 1YNND 3KF8A 5EE9A 1LM0A 4B3RQ 2EYOA 2BH2A 4MACA 1J6QA 2BYVE 2NVTB 1GD7A 4BBRG 3UE1A 2RPVA 2KHIA 1XLQA 2JQRB 2P5ZX 4LF8L 1ICFB 3A74A 5C2TB 4QIWB 4ZRKA 1SYCA 4LFBL 4XT3B 3P1HA 3DBHI 5G2NA 3ZTDA 3PHXB 4DAYB 1SMXA 1NEKB 1K8MA 1Q3LA 1JT8A 3S16H 2FCNA 3DHHC 2J7ZA 1PYBA 5JXVA 2K5NA 3K81C 1J7BA 1PDXA 4JL9A 2WKDA 1NCVA 1UEBA 1QCBD 5JPMC 3HRDD 4IN3A 1TR5A 3JSVB 2I07B 2WFWA 3MAQA 2G5DA 4IUTA 3TQYA 3MXNB 3U7DA 5HGQA 2KZRA 4F7ZA 4YT0B 2WQYB 1HA6A 1BUVT 1L0WA 4S0RA 4DAMA 3F8TA 1TWCB 3KUCB 2LVPA 4Q2JA 4FXKC 4DR5Q 2HDEA 2PKOA 3P42A 1G2SA 1RJTA 4J8QA 2K05A 4M0WB 2A4ZA 1EY4A 2PYKA 3M9BA 1EFID 5IWAQ 1JQ4A 1HTOA 4XE0A 2UXCQ 5KEEA 3DM3A 4K1RB 1E1OA 1Q90A 2AQ2B 2JXXA 4A3LH 4IWQA 4AIMA 4UDUC 2KCNA 1N6ZA 5FLXE 4KKIA 4WJ4A 4KKJA 4KHPQ 2KOXA 1K73C 1C4CA 1A70A 4DAYA 3U8ZA 1TGZB 1E7VA 1S5DD 4R4IA 2CJOA 1WF9A 3E6ZX 3RNGC 5KIXA 2E2JB 1UWXA 3I4NH 2WGSA 3HHMA 2D2CC 4PT5A 3NBHA 1SSNA 2MQJA 4NJCA 3UQBA 3GTMH 3IT6B 1RKNA 3V3XA 4K5WA 3S1MH 1LTBD 4X3KA 3FILB 3JSVA 2JA8B 4F1SA 5FJ8G 1JMLA 2LUMA 3MXNA 2MJ8A 3VR5A 2DHZA 1X9NA 3UI2A 2B63H 3QQ8B 5CBEE 1VF5C 4WRDA 1ET9A 1WCMH 4KGTA 3J7AV 1L4DB 4PG3A 1GC6A 1D8LA 3ULPA 4HJAA 1OQYA 2K1FA 4LF9Q 1I6VC 4JI6L 4IALA 5JPNC 3MHSD 3A7LA 3D4DA 1LXDA 4DUYQ 2UYZB 3D3RA 3HOXB 3HFZB 1ZDXA 3CCLA 1ZW7A 3HOXG 4ASWC 4CHKA 1QZEA 4AQYQ 5C5LA 1H9MA 1WTOA 5JHBA 4HPMB 4NJ6A 3BG3A 1XCTL 2H88B 4LCDE 1TVXA 1OGWA 3E56A 4TKOB 5IGBA 5CV6A 2G9HD 1DOKA 1MG8A 2KXJA 1QLBB 3MP9A 4C4VA 5JEAG 4B9XA 4G7HC 2DNEA 3AE2B 1QOBA 5JH5C 4BBSH 1M8AA 3E9IA 3FILA 4ABNA 1QVFA 4JV5Q 1N61A 4KX6B 3Q3OC 2I2YA 3S2DH 1H9JA 5ELEA 1BVSA 2ZT9C 1VQNA 4K6LA 1JRUA 3N9YC 4XWTA 2OWOA 1A2UA 4M8AA 3N3KB 1Y1WH 1SXTA 4LF7L 3I70A 1HRJA 4OZBA 1V9JA 1K3BC 2F0NA 4NW2A 2MJ3A 1E9MA 1I4XA 4ACFA 4AQ7A 3F2UA 4FHJA 4R4OA 1S4ZA 2F0OA 2N1VA 5FK9C 4YY3L 1VQ4A 4GXBA 1SYEA 2JJQA 3UDIA 2UUBL 1F2YA 1UGJA 2PTLA 1X56A 2AL6A 2B29A 1E7UA 4BA1I 3KUDB 4YHHQ 3I7FA 3TREA 1R9TH 1T0YA 2ZZPB 5IYDG 4XYCA 4DWFA 4XQNA 1WM3A 4WWOA 1W6JA 1P16A 4X64Q 4CJ2C 1VQPA 2BT6A 2E3TA 2YTXA 3ML9A 3IKJA 4FJZA 4DR4Q 4ZK9B 1WGHA 4X3UA 2QMTA 3ZNZB 2ASBA 1KDBA 4LAAA 4EQPA 2GMIC 3TP6A 2VQEQ 2KUMA 3RZFA 1WZ3A 3W1GA 1FXTB 2G3QB 5I9PA 1JMCA 3QB3A 4C3HH 4A3PA 1TIID 4F7XA 1HTPA 1CT1D 1J19A 1S3OA 4BXXH 4L5TA 3CHBD 2KDEB 4NQLB 1SNMA 1JJCB 2K50A 4NDXA 2F03A 2J4XA 1LTRD 2XWBB 1PHJA 4LF4Q 3Q8EA 4YXDB 3H94A 1S5BD 4JBJA 2LHEA 4OWWB 2DAJA 3KK7A 3VHTC 1GXDC 2REXA 1Y8OB 5CC4A 2KACA 4HJGE 5G3LF 1PRTF 1BBUA 1WJ6A 1AYFA 1RLFA 4TV3A 2MBQA 4EQOA 5IGFA 2MHJA 4QGUA 1NE3A 1I94Q 4YCVA 1WYWB 1WTHA 4P7IA 4B3RL 3PZ8A 1VQGA 2KNBA 1GVPA 4GZYC 3VH3B 1IKLA 2BB6A 5NUCA 3AN1A 3F2DA 2ZPNA 4DQOC 1PYSB 3M62B 1TU2B 2KCMA 2YVCA 2L8JA 5KYLA 2HHHQ 2K52A 1X3EA 1VQDA 1MJDA 2CS4A 2ZCBA 2JK8A 2PI2A 4F87A 3DOWA 4HEDA 1VQMA 3N30A 4KKTA 2JZPA 2OJRA 3W9CB 3I4NB 2A19A 1O7IA 3VTWA 3TEWA 4OWTB 2NVXH 3GTMB 4FBJB 1BDOA 5EPJA 5FO7B 2M0AA 3CF6E 3S1MB 5IGEA 4A3BH 3IFWB 3V6CB 1Y8NB 1WI5A 3F2BA 3OW2A 3TUOA 2L7RA 4XC2A 1MKHA 4K7UA 4QY7A 2WB1G 2LASA 2J53A 2K6DB 2JPHA 4UAIA 2K01A 2PE9A 1VQOA 1HZCA 4AH6A 3J7A5 2GBJA 3B0AA 4OVVA 4JE3B 2M00A 2LSSA 3ZXRA 1E10A 2M1MA 4IWOA 5IWAL 3VAWA 2KHSA 4L8JA 2B2YA 1UWMA 2PLPA 1AH9A 2XBBC 1ROEA 1H9RA 2R93B 3V2TA 2R93G 3J80E 4DR2Q 3RUZA 1UF0A 1Y8PB 1FFUA 2KKCA 4L2YA 2E2HH 1X6OA 1PH7A 2ZNVB 4FJVB 4JBKA 4S3SA 2XEWA 1A5RA 2XK5A 4HK2A 1WD1A 1S5FD 3W5OA 1GC7A 2W3SA 2AKWB 3I55A 2L4NA 4POFA 2NBUA 4K3CA 5JVG3 1JRPA 2B2YC 1RRBA 2DNFA 2SOBA 1FGBD 5C0XJ 4H2AA 2K9XA 4S17A 3GP7A 3U7ZA 2R7FA 4JI1L 3AB5A 3AULA 4BBSB 1WX7A 4II3B 4PS3A 4HKQA 1HPCA 5GAEC 1LT5D 2K6AA 1V1PB 5LLIA 4HCSA 3J7ZC 3S2DB 3C1EA 2LXAA 3Q14C 4WAAA 3ZNHB 3AE1B 4JQWC 1C79A 2I5HA 1GHJA 4FXGC 1EZ6A 1Y1WB 2EYLA 2XVSA 2JYOA 1HNXQ 2D3CA 2DYMA 1KRSA 4JOIA 3GZNI 3OIQA 2VUMG 5FLXL 1YITA 2OJWA 3PSEB 5KHQA 5HG2A 1Z47A 2KLCA 3LX0A 3VYUA 3AE9B 2VY3A 2GBRA 3Q8AA 4ZOHC 1PH4A 4M01A 4DUYL 1WJNA 1JWSD 2A8VA 2IBIB 2KQSA 3N20C 2KDBA 3ITPA 2Z0SA 2JZZA 2JU6X 1EOVA 4AQYL 3DXJC 4P1BC 4WH4A 2MBOA 2OEOA 5L95C 3KWLA 1PH6A 4LTUA 5M5YH 4JOIC 4DAPA 4HPPA 1R9TB 1L4ZB 4LUOA 1SNCA 1UZXB 2GA4B 2N7JA 4IPHA 3NUCA 4CKCA 5E1FA 4QUFA 2MP2B 3OG5A 2KJHB 3VUXA 5C3EG 5H8YE 1GPXA 3NTIA 1JWBD 4IPDA 1B1ZA 4A3MG 1MJCA 2DGYA 3CQZH 4OIJA 3GTQH 1V1PA 2RPQA 2ZNVC 1I6HH 1K0RA 2JE6I 1HNZQ 5DPSA 2KD0A 3KFUA 3NELA 4C3HB 2N9XA 1QNUA 4KKUA 3S1RH 1ESRA 1VS0A 5LMNQ 2IHFA 4FA6A 2C5LC 3I8ZA 4BOSC 4CJ1B 4MT5A 3ZUNA 2MBEA 3RD2A 4RCNA 4X66Q 1PH2A 2AQ1B 3M4YA 3VYRA 4AOFA 4ARCA 3KOJA 1A3TA 1YIJA 3X0WA 1ICWA 1I50B 1IBML 4KSLC 1C8CA 1C3TA 2LXJA 1DONA 3GO5A 2Z4IA 3HOZH 1Q1EA 2PW7A 5EKLA 3PF4A 5IP7H 3BS1A 1TWFH 4HCEA 2ACZB 1IBLL 2B2UA 1LLRD 4KLKA 2GRIA 2K6QA 3L10B 1IYUA 2PIAA 1VQAA 4WJOA 2BF8B 2MP2A 4CDFC 4DR4L 2JA9A 1PRTC 1NMFA 2BYEA 5LHY1 1JOQA 1YN4A 2KECA 1NY4A 3FPUB 1IXRA 4QB4A 1C0AA 2BDNA 2DYBA 1HNWQ 2N78A 2KVZA 4DK3C 4A3FG 1SIJA 1NDDA 5IP9H 3ABVB 3E0EA 2B2UC 3NEMA 4H44C 5C4HA 1YJIA 2KVMA 4HVBA 1XXGA 4A3CH 2JEBI 4KN7C 4ZKBB 3OJ3A 4KGRA 4IOCA 1BCPF 3X23A 2QEXA 1F2ZA 3T1HL 5G3LD 1PRTD 2B2WC 2YTYA 4G4KA 4G7OC 1C9FA 5HURA 4POGA 2FBWB 3IXSA 1FNWA 1XJVA 4LF5L 2FNJB 1CM9A 2F0GA 3M4QA 2NB0A 1FXIA 1BQQT 2L05A 4A90A 2QW7A 2Z6BA 1YBYA 1SIFA 3GTPH 3QIJA 1G51A 1NAPA 5CR3A 4HJ5A 2QCZA 4I6PA 5LL6S 1CJEA 1I94L 4QL5A 2CHXA 4A3EH 1ZOYB 1E0ZA 5D2MB 4LNOA 2UUCL 3CRLC 1P8LA 4K14A 1JROA 4GKJQ 2MBHA 1HZ6A 1NNXA 2HHHL 2K5PA 4X62L 2E2HB 3CC4A 2JXTA 2G9DA 4FP5D 4ZUIA 4APVA 1SFOH 1ZXHA 3FKIH 1XMOQ 3MEFA 1WIAA 3U50C 1U0LA 2N9KA 1Q7YC 3TJPA 2RSOA 2D3AA 4IKGA 3GE8C 5JJIA 3EIVA 3FAHA 3CCVA 4II2B 5AZFA 1XQQA 1KLVA 1UE6A 5CV5A 4AYBE 2M8SA 3P4SB 2E76C 1D1KA 2IO0B 3AEDB 4KDLB 5EGTA 1G6ZA 3MHBA 1JE4A 4OIKA 5DLQE 1P1AA 2FAZA 3BINA 2V1CC 5G5GA 3RR5A 4HIKA 3QIAA 4B3ML 1Q8KA 1OXVA 1N32Q 1TJEA 1YJJA 2L15A 3PRZA 1RF2D 3U52E 3C2PA 3RNAC 3QX1A 3FPPA 5E6JA 1SYDA 3TZUA 2FINB 2J0TD 1G6JA 2D5DA 5C23A 3VYSA 4LNNA 1TS3A 2K5QA 3A5ZB 3WDNA 5LL6X 5M5XH 1RFAA 5C4XB 4F8MA 2D0OA 2EKIA 3LJ3A 5C4XG 1YZ6A 1EYAA 1LTID 3OWFA 3HOWG 4A3KB 5M5YB 4JI7L 2Z8LA 4A3KG 5EDSA 2OT2A 1VQEA 3NWSA 4CQNA 1K52A 3EBEA 4EVOA 1GUGA 2A68C 5IKCM 1TY2A 4B3TQ 2J7QB 3M95A 1XWEA 3ONAB 3GV6A 2LGYA 3VQIA 3SFEB 3KJOA 1HHVA 2Z0EB 3GTQB 3K5MA 4LJOB 2CWAA 1IYJB 1VQ6A 3S1NH 4R1JA 1CI3M 1CFMA 1LT4D 2B39A 1RHPA 1BCPB 4XGAB 1MHXA 3S1RB 3J80L 1WM2A 1N36L 4LF8Q 3APFA 4A3GB 4LFBQ 4LK0M 4YSZB 2LUEA 2IJ0A 3PO2G 1E22A 3D6CA 4A3GG 1OQRA 2L0FA 2JWUA 3AEAB 2EY2A 3SHLA 2KHJA 5ELOA 1PZKD 5FLMH 4MGIE 1UNSA 3L3OC 4DR7L 5EE0A 3ZNGC 3GTJB 4A8XC 1GUTA 4KV2A 3QR8A 3TCAA 1WYGA 5C3WA 1BF4A 3KLRA 4DK5A 1EWHA 2DJGC 1M90C 4RCOA 1TWFB 5M3FH 2F0IA 1FD6A 1PH5A 2D5GA 3Q3NC 3C46A 4GLXA 5FOBB 2NBFA 2WHIA 1SNPA 2Y0SE 3HOVH 2J0KA 2GOWA 3VR3A 1XNRL 5D6JB 2K39A 4AUQC 3R2IA 1F9RA 3X3NA 2IO2B 5E6PA 1O78A 3H0GH 5FO8B 3QAQA 1NBWA 1SSOA 3J80i 4GB9A 4RAUC 1V43A 2ZVOA 4C7ZA 2RHQB 3TMEA 3H7SA 4IUNA 1VMPA 2K14A 1GJZA 2HT1A 1HCZA 3H09A 1S40A 1DD2A 2F0DA 3GD7A 3M7GA 2KWVB 1IBXB 5LMNL 3V05A 3C1FA 3DDCB 1STGA 3RYTA 3VRAB 2D11A 5IYBG 5CYUA 1V97A 2DZJA 3CWIA 3PT2B 1I5FA 4MNOA 3LB8C 3QA8A 2WXKA 2V4IB 3UIPB 5DPTA 1EY8A 2M9VA 4ME3A 4IQZA 1EZ8A 4C3JG 3CCQA 1H9KA 4K8JA 2C7NB 1BCPC 4KHZA 5T8IA 4QAYA 2MUYA 4IC7B 3W1YA 4ANUA 1LT6D 2MWSB 3EFCA 2Q8RE 4GGQA 1KL9A 3P1MA 4RHRA 2LVOA 3WAOA 1E2WA 2K04A 1QOFA 2BCOA 1CSQA 2MSED 1STAA 5CORA 3S14H 1FXAA 2ZEQA 2NN6G 1PUTA 5IODA 4CKEA 2ENBA 1SB3C 1VCBA 5CGKA 2IWHA 1JB3A 1BCPD 3AB9A 4IPGA 2PE6B 4C56C 3MTSA 1T6BX 1SFOB 3MXPA 4RFBA 4DV5L 4L5RC 2KTFA 1IBXA 3L13A 3ND9A 2M4NA 1ZE3D 5IYCG 2CQOA 2F0LA 2AEHA 3TP5A 1HQMC 2M56B 4B08A 1IBKQ 1LTLA 3HOYG 1TTNA 3G71A 3PLVA 2F0WA 4KD4A 1SE3A 5DEHA 3S2HB 2X6GA 1UE5A 2XRSD 3T51B 4L5SA 3ZGZA 1LM8B 4YWKA 1AP0A 1QWYA 2AWOA 3K7AH 1C7YA 1YMHE 1LV9A 4RGOS 1DOIA 1EIGA 1PMRA 4DK6C 2WINB 4YTPB 4P71A 3DMUA 1L7YA 3MC8A 4WWPA 5CBAE 3IVFA 5H92C 2K7VA 1Q46A 4DXFA 2EYFA 4LF7Q 2KWCA 3J9CA 2LRUA 5BR8L 3P4QB 3NWTA 2X69A 5IP4D 3ZDTA 3HOUB 3MTNB 4YWMA 3Q6SA 1J9OA 4PYZA 3HOUG 2DJFC 4YY3Q 2L83A 3HVZA 1GUOA 1KTKA 3AMZA 3JYUA 2I1KA 4OZAA 1XMOL 5FJ8H 2O2VB 3RZWC 4JYAL 2R92H 3T1YL 4PMCA 4OW0A 2SAKA 1XEEA 4AYBB 3CRKC 1C78A 1K8GA 1X3PA 4DK1A 3NQIA 4IFDJ 1WFYA 2Y3AA 1N34L 2AL3A 5GXGB 2CW0D 3CD6A 1CSPA 2F0QA 3S1NB 1RAXA 4HJKA 1EY6A 1FNUA 2UUAQ 3MA2B 2L32A 1SDFA 3IRBA 5ISRA 1PH3A 1CA6A 1HJPA 4XDCA 1IZ6A 3G4SA 4ZRJA 3W3AA 1IL8A 5I9OA 3CMEA 1N33L 1HR0W 2O4XA 3OTOL 1TWAB 4IFDH 3T3OA 2ZM6Q 2JUOA 2N1WA 1TKGA 2WXPA 1EEFD 2WXLA 3RT3B 1ESFA 3Q8CA 1V5OA 1FO4A 3D31A 2D62A 5M3FB 1E2ZA 4MH8A 2PMZB 1CQVA 2O2VA 1CHPD 3B2FA 3HOVB 4DR3Q 2LGDA 4GDLB 4NMZA 1I4RA 5DNFA 3A33B 3MC0B 1Z9FA 1YI2A 3H0GB 1AARA 1YOVB 2BA0A 1SMYC 3D4RA 1A0IA 1FFVA 4HRSA 3HS0C 3EECA 2L11A 3WOEA 1S5CD 2HDLA 2VB3X 1AW7A 1L2FA 1HFNA 4RNAA 1SE4A 3K80C 4KN4C 2EZVA 2XWJB 5BMIA 3F1ZA 3TN2A 1OO9B 2K5VA 3ZJTA 1T5XD 4JI4L 1TT5B 1HZAA 1WGGA 1E90A 1WGKA 1JORA 3MFGA 4JI5L 3WOFA 1SMYD 3R3MA 5CHFA 2H89B 3NBHB 2L00B 3GTOB 4K81A 5GAGC 1KOTA 5IGDA 1GB4A 1Q5WB 2VW9A 1C9OA 2KTRA 1IYFA 3M4OH 1DGJA 1XCQL 2QDFA 4JG2A 4TSSA 3ONSA 4GN5A 4XDDA 2OHFA 2O2LD 2MH7A 3BIID 2AHOB 1WFQA 4K0KL 4GDLA 4BAXA 1E6EB 4QJFA 2XIWA 1PQSA 3G6EA 3B9JA 3BY4B 1IPGA 2WV6D 5BYRA 1L2NA 1EL0A 1P3QU 5I4DA 3AQQA 2DWQA 4KZCA 1VQHA 4A3DH 5KHOA 1SAPA 4ZYNA 4KZ0A 1TYGB 3PV1A 1V9PA 3W2DA 4PV1C 3I63C 1SROA 1HTLD 1BKBA 3P20A 1IKMA 3EN2A 2DY8A 5E7NA 3PIP3 1K28A 2VS1A 4CBVA 2ZPYA 3UE0A 5CMDA 1SE2A 5TR5A 1HFGA 2LJ5A 4C4VB 4J1MA 2NTSA 4JI1Q 1A6XA 2NVUI 1I4HA 2WDQB 2ZTCA 1YN3A 2IT1A 4A3IH 1TBEA 2MW5A 3VTVA 3KYDD 2KJ6A 2WXMA 2JA8G 5IE8A 3OMGA 2KMMA 3PTFC 3ZYYX 4I6NB 5FR3A 1Q10A 4HR7B 1E0BA 2N49A 3V96A 1UGMA 1YJWA 3MFYA 3H6MA 5HI1A 2ICIA 2K5DA 4RF1A 3V6EB 3KDFB 2OXPA 4KVGB 5IT9c 2UU7A 1EY0A 1WYDA 3SGIA 4WJ3M 4P75A 2R92B 2MGSA 3QG1A 3A8JE 2NTTA 1YD8U 2GBNA 1G91A 1KIXA 1IBKL 4WJQA 3E9HA 5A2QE 2YU9H 2EMSA 3I72A 3PUYA 4UP9A 3HZXA 3STBC 5K5PA 4NKLA 2N7DA 2EQSA 2BDOA 3ETRA 2RDHA 2RA4A 1L6VA 1ZDVA 4DV0L 2K4KA 2OCEA 2IX1A 2VNUD 2L52A 4ZHPA 2PNHA 3QARA 3IAYA 3PZ7A 4BWGB 1KC8C 3K7UC 2ES2A 3L16A 1DM0B 3ULLA 4HN7A 2JY6A 5C4ZA 1KQSA 4PZ8A 2HJ1A 4N59A 3Q6BA 2WDTB 3I4OA 2F3VA 5M9OA 4J3OD 2R6GA 3CC7A 4W9EA 1ENFA 2E8GA 1PZJD 5E3FA 4NPNA 3KDFA 3PGZA 3TMPB 1PFDA 2QEJC 1F9SA 3DBRB 3ECIA 1EFWA 2NVQB 4JK1C 5C1ZA 5C44B 2I5LX 1BBWA 3KLSX 3QOLA 4A3JH 1IBMQ 4RGMA 3PGEA 4JGHB 2MNAA 4XDXA 4DGZA 1B7YB 1LGRA 1LACA 3QWNA 1IBLQ 2F0KA 4A93H 4FVMA 3O13A 1PZID 1Q8IA 2KEDA 3RNFC 2WAQB 3U9OA 3P4PB 4CJ0B 2WAQG 2ZVNA 4OO1H 1WI0A 4ZCKA 4OX9Q 4LNIA 2UUAL 5IAAC 3DPDA 1Y69U 3NTHA 2L0TA 4OELB 5F2DA 3PF5A 1ZUD2 1R4MB 3NE5B 3IFTA 2XGTA 1VCIA 2NYZD 2RDGA 3HKZB 3AE4B 3MZ5A 3H9DA 2Z4HA 2L9HA 3IT4B 4MJSB 1GNUA 3S16B 3D8GA 2ZM6L 3T1HQ 2JN4A 3SK5A 4XIGS 5L37A 5C0XI 1OQQA 2R7ZH 1C4AA 2IDYA 4AWJA 5CX3A 1L0YB 2K5HA 4RKLA 4LF5Q 5D14A 3AM9A 3H3VH 3DWQA 1DYQA 3DBSA 1V81A 2L55A 3C0RB 2N9PC 2PO4A 1WGDA 1VR9A 3PS6A 1LABA 4WORA 2SDFA 4DR3L 4PQXA 3BVMA 4X3SA 1R4NB 2EVBA 1JR0D 2KCTA 3SR6A 2HCIA 1VLBA 1TKWB 4UPAA 3WIMA 2EXDA 1QVCA 1JCKB 1AZPA 2IY0B 2LGSA 3W5UB 3KQ4A 3ZXVA 2PNRC 2UUCQ 1VQCA 3A55A 4X6AH 4A3DB 3CMAA 1NMGA 4A3LG 4AS1A 3U58A 3PV0A 4X62Q 1VQKA 2QIEB 1STHA 3RN2A 3BDLA 2MJDA 2V3PA 1PTOH 2J52A 2XK5B 4BFRA 3G7LA 2IY5B 1ISNA 1WMHB 4MJSA 2EXZA 1WR1A 4DV7L 4LNQA 1D5ZC 4JWSC 3I4NG 1D3ZA 1IUEA 2IGDA 4ANWA 3R8BA 3AECB 4BVUC 1N8RC 4JW0A 1JICA 2W54A 1P7FA 1PGAA 4EZJA 2IX3A 4PZ7A 5DM63 3CCRA 4HJ8A 1QZGA 2B63B 4JVZA 4ZQ3A 1WCMB 1YEZA 2ZTDA 2B63G 2VL6A 1WCMG 2MPMA 1Y14B 5EJWA 1LYLA 3K5OA 2KFKB 1CHQD 4B3MQ 2QHOA 3AE3B 2JA6H 2HD3A 2BH8A 3VUYA 1UE1A 1OXUA 4KSKC 1B4OA 1W6KA 2AQ3B 3Q3FA 1XNQL 4UHVA 5LMUL 3BWUD 1Z6HA 3KVFB 3PIO3 4DHZE 1QG7A 3I73A 5K36H 5CHVC 4CYEA 3AMUA 2F4VL 2FCSA 3SE0A 1MBYA 4WIPA 1PFNA 1L6UA 1U9RA 3ZJYC 4JI7Q 1WMHA 1FMAD 1EQRA 2YU9B 3BVZA 2QA4A 1WTRA 3ER0A 4P72A 1N63A 1NI2A 2INPE 2MCNB 3M3JA 4B95A 3DBLB 2JSVX 2LHDA 4KIKB 4BBSG 3KUPA 2I46A 1S5ED 3K0YA 2SNMA 1KABA 3CU7A 5JAVA 3CAMA 1IL2A 2DAFA 1DOXA 3T8MA 3AU5A 3DWAA 4MSQB 4OVUA 1O7LA 2F0VA 1N36Q 5M5WH 4W9IA 2KFKA 1WXVA 1GO3E 2EYHA 1Y1WG 2LJIA 4EZLA 4YSXB 1II3A 3SDZA 2EE1A 4ZAIA 1NBFC 2NN6I 2B2VA 2Q2HA 2CWPA 3CKIB 4DR7Q 1PFBA 2FXQA 5D7GA 2N8NA 1FEHA 1SJED 4W9GA 1PRTB 4JI0L 4IOAA 2N0SB 3NZSA 4GN1A 2IPKD 4XWWA 5DCNA 2V0GA 1YJNA 1EYGA 4O0AA 1GM5A 4J6HA 3X3MA 1HXYD 4DHJB 3HKSA 5JJZA 4OZCA 3T56B 5GAHC 4P16A 2ZJRA 1OXSC 1G8ZD 3L0OA 1EY7A 1SYFA 1E7ZA 5KNCA 4HCPB 1Q81C 1FGUA 1K83H 1XNRQ 2B2VC 2LMCB 4WAFA 1WXSA 3S2AA 1YHBA 4ZKCB 1Q1OA 1OFFA 3K5NA 4FXDA 4A76A 3AFPA 1AN8A 3A8KE 2D2QA 3DHIC 2RHSB 4KIKA 5HHDG 4BY7H 1XD3B 2Q5WD 1E3PA 1LFDA 5CV7A 2MLBA 2E74C 1GUWA 2PEAA 3PO0A 2KYWA 3P7JA 3RNEC 3R7RA 1NYRA 4C3HG 2JWZA 2KLGA 2N9LA 3HOWH 3K5LA 5E6NA 3AEGB 3OOCA 4BXXG 2MP1A 3H6NA 3VR9B 2OF1A 2EJMA 1RM6C 4V0BA 2R7ZB 4DBGA 5A2QL 2LRWA 5BYQA 2A69C 3DHGC 1Q12A 1EQQA 4N8X1 4EGVA 1UBQA 1LO5D 2JA7H 3UDFA 1PFSA 1BNZA 4Y7NH 1HH2P 4LUZA 4JI8Q 5GROA 4FF3A 5C4JH 4C80A 1G291 2MO0A 3K59A 1B2TA 2BS2B 3ZVVA 1I42A 3NBIA 2OQ0A 2B76B 1XTDA 2V9HA 3CP0A 2WP9B 3HVDA 3N1ZC 3S1QH 2LMCA 2MX2A 2B2WA 2ZJDA 2A69D 3RLOA 3S17H 4OX9L 1CQFA 3QK0A 4P6VF 1PYWD 1P9DU 2JRIB 4B3SL 4NXML 4FULA 1KJTA 2LXCA 5CV9A 3UI3A 3RNBC 4JBMA 3TS0A 4GSWA 5KRUA 4DV5Q 1QZHA 4BZAA 3N1YC 1YJ9A 4ANXA 1X3FA 1GB1A 2EKEC 3I4MH 5FKAC 4TKNA 3SDLC 2Q2IA 2NVXB 3NS8A 5J18A 4BKGA 4ZRPA 1N5WA 1RODA 3FP9A 1NVID 2BVCA 2WX1A 4A3BB 1GUSA 2EMTA 2KDIA 4A3BG 2EDGA 2BGFA 2V3NA 4DHJD 1MSGA 2BA1A 1KXLA 1VZ7A 2BBCA 3L54A 3OLMD 1G2TA 2BYTA 4FO2A 5AUKA 1DOYA 3TBIB 3SK4A 2KMAA 4NQKE 1TKEA 3M63B 2YYZA 1K50A 4GKKQ 4GIVA 2LVQA 1ASYA 1Y1VH 1KNEA 2BB5A 2CR5A 3HRZC 4KGSA 1FPYA 2B2TA 5BR8Q 3H3VC 1FCCC 1V80A 5KNBA 2IX0A 4ZUJA 3A4SC 1MVKA 2KO3A 2PZTA 5EBDA 1RWSA 4ZRQA 4REZA 2A1AA 4DK0A 2PQAB 5LXHA 2AUKA 2KHWB 2NS5A 4F88A 2JSOA 4LJZC 3OHXC 1SNOA 2K33A 2DNCA 2IGGA 2F1MA 4BBNC 4JYAQ 3T1YQ 3J7AF 2WYQA 4E3CA 4LK1C 1FVIA 2FE8A 2AWNA 4Y52H 2WWZA 3OJ4B 2R61A 2ZTEA 2B2TC 4EX5A 3WANA 1NTGA 3LXFA 2JA5H 4H7BA 1N34Q 4CDCC 4XTCS 2NZHA 1T0QC 4R9WA 4RM9A 1PTOC 4NXNL 1VDZA 3VXWA 1PLFA 3Q69A 3HM6X 4B0EA 2OTLA 2CHWA 1RL2A 3KLWA 1E5WA 1I4GA 3CW2C 5TSSA 5M5WB 4DN4M 2JT4B 1Q1BA 2BE5C 3T53B 1TXYA 1WE6A 3QJZA 2KK8A 1YNJC 1H9SA 2FUHB 4MEMA 4DV4Q 3NXWA 3MWYW 4R8IA 1RFKA 3WAMA 1N33Q 1FR3A 4X65L 2FHTA 4CDEC 3OTOQ 3EGRA 4E74A 2DBYA 5C0XG 4I6LB 1T0RC 1TT2A 3Q23A 1PH1A 3K6OA 2PQAA 2UU9Q 2F52A 1WVLA 4KV6A 4TVAB 1VZ6A 1PVOA 2BE5D 4R3DA 4DF7A 4KKSA 1BMLC
chains in the Genus database with same CATH topology
3IAS1 5CV4A 3VR2A 4TQ0A 2F0MA 3CQZB 1J8IA 2A6HC 2XRQD 1I6HB 3NVZA 1WD0A 3PUVA 4EQNA 2IGHA 3T4AC 4O42A 1O7YA 2A68D 1WXQA 4Q5VA 1GAQB 3ZJUA 2A6HD 2KN4A 2JA7B 4MHEA 4Y7NB 1STYA 5C5MA 3HOZB 3W1SA 4JBWA 2VZKB 1WSPA 3R93A 4QF4A 1CTMA 4IURA 2R3ZA 1BO0A 3IAM1 4RGTA 3EA6A 3W5VB 5D3DA 4FYDA 1CK1A 2WXRA 3P75A 5D3IB 5LNK1 2ON8A 4KHVA 2JP1A 2IW3A 5J1ZA 2JEAI 1QOAA 3TEZA 5ELBA 3G6JB 1D1IA 2WDRB 3MHZA 3AU7A 2KCCA 3HEJA 4PMBA 1ZKOA 1AEXA 3BZDB 3NS1A 4ZRZA 4IFDI 2L5TA 4XYOA 2ICEC 2WKCA 1FYCA 5IT9E 4BA2I 1BBXC 1XLOA 1DJRD 3GTPB 4KY7A 1BXTA 1X32A 2EY5A 3FRPB 4N6EB 3E9SA 3MEHA 3HGBA 1EU4A 4A3EB 3TSSA 2N55A 4US8A 1CZWA 2HQEA 5FO9B 4FXCA 1HA5A 3SVMA 1SYBA 2QCPX 1JC7A 4NP5A 3FKIB 3BK1A 2NZ1D 4IUVA 3I91A 4BS9A 3I4LA 2JA5B 1P7EA 5I2YA 5IGGA 1YN5A 4KD3A 1F2RC 4YIJA 2VZKD 1T5EA 3HP3A 1JALA 1LTTD 3TEYA 1ZEQX 4LLGM 2QILA 5KNDA 3DWGC 4X3TA 2KWDA 5EKKA 4HMJA 4CHTB 4ILWA 3PMFA 3RFZB 1SJHD 1MPEA 3KLSA 5M5XB 3NSWA 2WDVB 2WXOA 2C5CA 3L4PA 1KLGD 2MEKA 1BR9A 2ZW1A 1TY0A 2WIIB 1N62A 2JYTA 5JVH3 5T1IA 2B8FA 1LTAD 5JEAJ 2ID0A 2PZUA 1GHKA 1QE6A 3R2TA 1NUCA 1TS2A 4XT1B 4FF2A 3VA5A 4TQ1A 2SNSA 2LKVA 2N88A 2L1BA 2H1EA 4HSVA 4QUCA 2FJ2A 4HTHA 4K2LA 3NVWA 4L63B 5J39A 4XQJA 4C1NK 2D9UA 5JEAH 3RZOB 2LS01 1TKYA 1A15A 5IOCA 2PW5A 4RA8A 4L23A 4CGYB 2K03A 1X3QA 3L7ZC 4JPSA 2WXQA 1STNA 3IFDA 1ZXTA 5C3JB 3LYYA 1M4VA 3PO3B 1GUNA 1KNAA 4DA2A 4QMGA 5I2XA 3AH7A 4C1NI 4C7YA 1A2TA 4C3IB 1EYDA 1ACCA 1ET6A 2WS3B 1U4PA 2A5HA 3J7YW 3GB1A 4IUPA 4YSYB 3OMCA 5MPOA 5EKIA 4XXEA 4XYQA 1HUNA 1JWAD 1VRAB 2KDMA 1PGXA 1KRHA 4K5XA 1DXMA 1FIQA 2Y0SB 1VDVA 4BBRB 1WWTA 3LNNA 1KFYB 1AFPA 3VR6A 1JWUD 3I57A 1QOHA 2ZXOA 3S14B 1BOSA 5G5HA 1KF6B 3GTLB 4DXGA 5BMHA 5KGUA 4OO1I 3DUZA 2A74C 1DZ1A 4DNRB 3L9AX 2B8GA 2BW2A 2PZWA 2SEBD 1AWDA 1XYIA 5BN3A 3K7AB 2PMVA 1SEBD 3BVGA 4NAWB 4U673 2WU2B 4ULLA 1C48A 5EPLA 3NVYA 3C3LA 4OGQC 3U9SA 1TS4A 5ELCA 1LT3D 2O5IC 1ML0D 2JXMB 3MXUA 4NAMA 2WLBA 2JYEA 3AE7B 3DWMA 4US9A 5IT9L 2F0EA 5I6YA 1VZ8A 4HSPA 2EYMA 1NENB 2AX5A 4G7ZC 3C8YA 1B3AA 4WJWA 3VA7A 2H4OA 1KLUD 1E7PB 4M0WA 1JOKA 4ZHOA 1I4QA 5E4WC 1SNQA 5BYSA 1EWYC 3EVQA 2PCFB 1WTVA 1D4BA 3PUXA 1ZP0B 1U4LA 4IFDG 3AE8B 5EBCA 1QKZA 3E0JA 1VF7A 3TP7A 2TMPA 4WQMA 5CV8A 1XLNA 5A35A 4USAA 3BYYB 1L0XB 1RYJA 2EYPA 4K6DA 3A7AB 2WU5B 3AV8A 1U4MA 2WXHA 3NTKA 3KWVA 3E5SA 4B0MA 4TMAB 1HZ5A 1B9MA 3EJIA 2Y5PA 2DN8A 1KDCA 3NZ3A 3S9WA 1MD2D 1IGCA 4N9TA 1TZOA 1KDAA 2X6LA 3U2SC 5ELDA 2LY7A 2C9OA 3T13A 1D5XC 2WXNA 3IL8A 2HDMA 1NR2A 3T16A 3GQBA 3M4OB 2RKSA 1T3QA 4CKBA 1YQ3B 4ITKA 3B2GA 2W55A 2QKIC 3OPOA 1EEID 5COYA 3BDOA 4C2MB 3HUIA 3EROA 4ODGA 2HTME 3VR8B 3FVQA 1J7CA 3SK6A 1ENAA 5EQ0A 2Q8TA 3J81E 1EYCA 2RSNA 4N58A 3NVVA 1KH0A 4L6TB 2W3RA 1ILQA 2K0PA 3DWPA 1K51A 1R7SA 1QQRA 3FC4A 2LEKA 1JOOA 1PDQA 1ZPSA 4A3IB 4K8IA 3CIRB 2E2DC 2NMQA 3H8HA 1QF6A 2DY7A 5HFYA 1F9QA 5IIFA 1XX8A 1F0ZA 4V190 2FMMA 1K53A 2BTEA 2E6XA 2O5JC 2KQ4X 2PPBC 1BUIC 4OHJA 1F9PA 4DFAA 3A56A 3NK9A 2L12A 4MM3B 4A55A 2E2IB 1F2RI 2EPBA 5BMGA 1YNTE 4M1UB 1O80A 2WXFA 5C3XA 2WB1B 2E75C 2V4DA 2K5WA 1PTOF 1C76A 1FCLA 5I6WA 2NVYB 3DM1A 1EOTA 4JX1C 1Y56A 1PFMA 2XSCA 2NUCA 4D2KA 3QO2A 2K28A 4WFN3 2EY6A 1D6EC 2QDBA 3N6RA 3NHHA 1WRIA 2ONQA 3EQLC 4A9AA 3OIPA 4RF0A 4KTAA 1B44D 2HCCA 3I9V1 1IW7C 2A6EC 1ILPA 3MVVA 3NPPA 4A3JB 2F0FA 3A8IE 3DEOA 2YEPF 1Z7TA 3FEWX 3RLFA 3BDCA 1DOLA 2AUJD 2WXIA 2ZW0A 1PGBA 4A93B 2DLBA 3D6WA 1NSNS 2VUMB 1XF5L 1IW7D 2A6ED 1B50A 1QOGA 5AUIA 4OO1G 2I38A 1ENCA 1UEAB 5C0XH 3KBGA 1N60A 3K57A 2RQXA 5HGTA 5DAUA 3Q22A 2F0HA 3RD4A 3U4EG 2W82A 2Z1CA 4KY5A 3GV3A 3SEBA 4K2KA 3NRZA 5C3EB 2F0SA 3R3OA 4H13C 4A3MB 1EIHA 3OW7A 1EY5A 1FRDA 2KJXA 1IGDA 3OSOA 3AEEB 2F0JA 4NZLB 1ZYRC 4ZLTF 1F2LA 4MN3A 1JWMD 1TWHB 2F3WA 3ERQA 3URYA 1UAPA 4A6QA 3NQTA 5IGCA 1VJKA 1PTOB 1QB5D 3JAME 1C77A 3LWEA 3SR1A 3ZQ4A 2EOTA 3AEBB 1ZYRD 3FMCA 4Q0FA 4IUUA 2EYJA 3GTKB 4IZ8A 1J7AA 1QILA 1IHZA 1AZQA 2FFKB 3LWUA 3AEFB 2PVOD 2HUGA 1EQVA 5C6AA 4KY6A 1XTCD 2BS3B 3TEXA 2IL8A 1XLPA 4A3FB 4KK7A 1OXTA 2MJEA 1NYQA 4QCLA 2QF7A 2JA6B 3A54A 3DHQA 3VYTA 1C4QA 1H9SB 2YEPB 3AE5B 1EM7A 2X38A 4WWMA 2KOLA 3GS2A 2Q8IB 3TZDA 1A3VA 5K36G 4B9WA 1EU3A 4RHSA 3RZDB 1LTSD 2DYOA 4Z9CB 3VR4A 4OVZA 2BOSA 1LTGD 2NN6H 3S15B 4KI0A 4DAVA 3QOJA 2EELA 1STBA 3I90A 3J81L 4GLSC 2INNE 4K5VA 2F0PA 2ZXRA 5T1GA 4DU9A 4EE2A 1PTOD 1I4PA 1O7ZA 2WXGA 1EY9A 4TQUS 1V8CA 3Q8FA 3SK8A 3GTGB 1TWGB 2KQ3A 1IYVA 3HG9A 4FNFA 1YNJD 1K83B 3RMHA 1YQ4B 2RMMA 2EY1A 3FDTA 1R4QB 4BY7B 3K58A 3MXGA 2OEDA 4G57A 2F0UA 2MHVA 1FM0D 3D4WA 2LFIA 1D2BA 3EUB2 3HOWB 1L0VB 4GDKB 5EE3A 4RKBA 1RDPD 2CVRA 4I7ZC 4KJOA 1EWCA 4R8NA 1WTWA 2RVLA 1KAAA 2G1EA 4HMIA 5C4JB 4LMQD 2ZXPA 1TQOA 4HKZE 1FNVA 1SF0A 4PMWA 3S1QB 4U68A 3PO2B 4WURA 4DNTB 3RPFC 4H0LC 1D5MC 2K1BA 1GOZA 1ONLA 3S17B 2WNMA 1PXUA 1HQRD 1NR4A 1A3UA 5E4XA 4ZYSA 2FMCA 4XQQA 1I7HA 1DOMA 3P63A 1CZGA 3I4MB 5EPKA 1TS5A 4TRDA 3NP8A 5KYIA 1NI3A 2M2LA 1WTQA 1V8QA 1FRRA 1QJOA 4IOIE 2VXWA 3OWEB 5D65A 2PVGC 1RCVD 1B9NA 1E2VA 3WCQA 4YTMB 1Y1VB 4N9PA 1RTOA 4HEA1 4YWGG 1JW9D 2K3UA 3P4RB 1EQTA 4C3JB 3VRBB 1C4PA 1L5PA 4O1NA 1V1OA 2J42A 4ARIA 2JX5A 4HAEA 1R4PB 2KAJA 5JOBA 1HEZE 1WTXA 3BYTB 3QJYA 4KJNA 2CHBD 1I3QB 2FUG1 1CZPA 1HUMA 2WXJA 2PQEA 2WACA 1UUPA 3Q0AA 1QNKA 4ID6A 1F77A 3Q24A 2M19A 4E6IA 4FF4A 2TSSA 2K22A 4JWUC 3DEPA 3MJ5A 3JAML 1K8OA 1XO3A 1SYGA 3HOYB 5BN5A 1MGSA 5EE1A 1GJXA 5DM73 1DCZA 3PUZA 1N5XA 4OL7A 2L1AA 2CJNA 2A73B 2WP8J 3M85A 4RGNA 1CA5A 3M7NA 2PW9A 4BY1B 3H91A 3TDQA 1QT9A 2GI9A 5AFWA 1MI2A 5J22A 2CQAA 2F4IA 4ME5A 2CW0C 2Y5CA 5M3MB 1JQYD 1B53A 3N52A 4RWSC 3KBXA 2L0CA 1SNDA 1OXXK 2GB1A 4I65A 1RTNA 3ZJVA 3ND8A 3TP8A 4L1BA 3M3YB 1VMCA 2CU3A 4KMUC 1ZXIA 4IDIA 1FD7D 3I3CA 1MI0A 3SFDB 1WTPA 3AE6B 4IUQA 2XN9C 3T3NA 1B9RA 3SXHA 1RD9D 1MHHE 1MSHA 2NWGA 4MIUA 4RH6A 2VB2X 2KEEA 2K32A 5BN4A 1F2MA 2KA7A 1YNNC 2RBMA 2RDFA 3Q8BA 2F0TA 3EFXD 4C3IG 2XNAC 3PUWA 2QJLA 1U4RA 1SBBB 4FF1A 2EJGC 4P2CB 2EJFC 4YTNB 2QSDA 3BK2A 4PNYA 2LFNA 2LGIA 4HROA 2BS4B 5ELFA 1STEA 3NUHB 1YNND 3KF8A 5EE9A 2EYOA 4MACA 2NVTB 2RPVA 1XLQA 2JQRB 5C2TB 4QIWB 1SYCA 4XT3B 3P1HA 1NEKB 1K8MA 1Q3LA 2J7ZA 5JXVA 1J7BA 1PDXA 2WKDA 1NCVA 1QCBD 5JPMC 3HRDD 4IN3A 1TR5A 2I07B 3MAQA 4IUTA 4YT0B 2WQYB 1HA6A 1BUVT 1TWCB 4Q2JA 4FXKC 2HDEA 2PKOA 3P42A 1G2SA 1RJTA 4J8QA 2K05A 1JQ4A 1EY4A 2PYKA 1EFID 4XE0A 5KEEA 1Q90A 2AQ2B 4UDUC 2KCNA 5FLXE 4KKIA 4KKJA 1C4CA 1A70A 4DAYA 1S5DD 2CJOA 3E6ZX 5KIXA 2E2JB 1UWXA 2D2CC 4PT5A 3NBHA 1SSNA 4NJCA 3IT6B 1RKNA 3V3XA 4K5WA 1LTBD 4X3KA 3FILB 2JA8B 1JMLA 2LUMA 3MXNA 2MJ8A 3VR5A 3UI2A 5CBEE 1VF5C 4WRDA 1ET9A 4KGTA 3J7AV 1L4DB 1I6VC 4IALA 5JPNC 3A7LA 3D4DA 3D3RA 3HOXB 1ZDXA 5C5LA 1H9MA 1WTOA 3BG3A 1XCTL 2H88B 1TVXA 3E56A 4TKOB 5IGBA 5CV6A 2G9HD 1DOKA 1QLBB 3MP9A 5JEAG 4B9XA 4G7HC 2DNEA 3AE2B 1QOBA 3FILA 1M8AA 4ABNA 1N61A 4KX6B 2I2YA 1H9JA 5ELEA 3N9YC 2ZT9C 4K6LA 4XWTA 1A2UA 4M8AA 1SXTA 3I70A 1HRJA 4OZBA 2F0NA 4NW2A 2MJ3A 1E9MA 1I4XA 4AQ7A 3F2UA 1S4ZA 2F0OA 5FK9C 1SYEA 1UGJA 1F2YA 2PTLA 4BA1I 4XQNA 1W6JA 4CJ2C 2E3TA 2BT6A 3IKJA 4ZK9B 4X3UA 2QMTA 1KDBA 4LAAA 4EQPA 3TP6A 2KUMA 5I9PA 3QB3A 1TIID 4F7XA 1HTPA 1CT1D 3CHBD 1SNMA 4NDXA 2F03A 2J4XA 1LTRD 2XWBB 4YXDB 3Q8EA 3H94A 1S5BD 2LHEA 3KK7A 1GXDC 1Y8OB 5CC4A 2KACA 4HJGE 5G3LF 1PRTF 1AYFA 4EQOA 5IGFA 3PZ8A 4GZYC 1IKLA 2BB6A 5NUCA 3AN1A 4DQOC 1TU2B 5KYLA 4F87A 4HEDA 4KKTA 2JZPA 3W9CB 3I4NB 3TEWA 3GTMB 1BDOA 5EPJA 5FO7B 2M0AA 3S1MB 5IGEA 1Y8NB 3TUOA 2J53A 4UAIA 2K01A 1E10A 4JE3B 2M00A 2KHSA 4L8JA 2B2YA 1UWMA 2PLPA 1ROEA 1H9RA 2R93B 3V2TA 3J80E 3RUZA 1Y8PB 1FFUA 4L2YA 4S3SA 1WD1A 1S5FD 2W3SA 2L4NA 5JVG3 1JRPA 2B2YC 4H2AA 2SOBA 1FGBD 5C0XJ 3U7ZA 2K9XA 3GP7A 3AB5A 4HKQA 4BBSB 1HPCA 1LT5D 2K6AA 1V1PB 4HCSA 3S2DB 3C1EA 3AE1B 1C79A 1GHJA 4FXGC 1EZ6A 1Y1WB 2EYLA 2XVSA 2JYOA 2DYMA 3OIQA 5FLXL 5HG2A 1Z47A 3AE9B 3LX0A 3VYUA 4ZOHC 3Q8AA 1JWSD 3ITPA 2JU6X 3DXJC 4WH4A 2OEOA 3KWLA 4LTUA 4DAPA 1R9TB 1L4ZB 1SNCA 2GA4B 2N7JA 3NUCA 4CKCA 5E1FA 4QUFA 1GPXA 5H8YE 3NTIA 1JWBD 1B1ZA 4OIJA 1V1PA 2JE6I 4C3HB 1QNUA 4KKUA 1ESRA 3I8ZA 4CJ1B 4MT5A 4RCNA 2AQ1B 3M4YA 3VYRA 4ARCA 1A3TA 1ICWA 1I50B 1C8CA 1DONA 3GO5A 2Z4IA 1Q1EA 2PW7A 5EKLA 3BS1A 4HCEA 2ACZB 2B2UA 1LLRD 2GRIA 1IYUA 2PIAA 1PRTC 5LHY1 1JOQA 1YN4A 2KECA 3FPUB 4QB4A 2BDNA 1SIJA 3ABVB 2B2UC 5C4HA 4H44C 1YJIA 2KVMA 1XXGA 2JEBI 4KN7C 4ZKBB 4KGRA 1BCPF 1F2ZA 5G3LD 1PRTD 2B2WC 4G7OC 4G4KA 1C9FA 5HURA 2FBWB 3IXSA 1FNWA 1CM9A 2F0GA 2NB0A 1FXIA 1BQQT 4A90A 1NAPA 5CR3A 5LL6S 1CJEA 1ZOYB 1E0ZA 3CRLC 4K14A 1JROA 1HZ6A 2K5PA 2E2HB 2JXTA 2G9DA 4FP5D 4ZUIA 1ZXHA 2N9KA 2RSOA 4IKGA 3FAHA 5CV5A 3P4SB 2E76C 1D1KA 3AEDB 5EGTA 1G6ZA 3MHBA 1JE4A 4OIKA 5G5GA 3QIAA 1TJEA 3U52E 1OXVA 1YJJA 1RF2D 3C2PA 3FPPA 5E6JA 1SYDA 3TZUA 2FINB 2J0TD 2D5DA 3VYSA 1TS3A 2K5QA 3WDNA 5LL6X 2EKIA 5C4XB 4F8MA 1EYAA 1LTID 3OWFA 4A3KB 5M5YB 2Z8LA 2OT2A 4CQNA 3NWSA 1K52A 4EVOA 1GUGA 2A68C 1TY2A 1XWEA 3ONAB 3GV6A 3VQIA 3SFEB 1HHVA 3GTQB 3K5MA 1CI3M 1CFMA 1LT4D 2B39A 1RHPA 1BCPB 1MHXA 3S1RB 3J80L 4A3GB 4LK0M 4YSZB 2IJ0A 3D6CA 1OQRA 3AEAB 2JWUA 2EY2A 3SHLA 1PZKD 1UNSA 3L3OC 5EE0A 3GTJB 4A8XC 1GUTA 1WYGA 5C3WA 1BF4A 3KLRA 1EWHA 4RCOA 1TWFB 1FD6A 2F0IA 2D5GA 3C46A 5FOBB 2NBFA 1SNPA 3VR3A 3R2IA 1F9RA 3X3NA 1O78A 5FO8B 1SSOA 4RAUC 1V43A 4C7ZA 3TMEA 4IUNA 1VMPA 1HCZA 3H09A 1DD2A 2F0DA 3GD7A 3M7GA 1IBXB 3V05A 3C1FA 1STGA 3VRAB 5CYUA 1V97A 3CWIA 3LB8C 2WXKA 2V4IB 1EY8A 2M9VA 4C3JG 4IQZA 1EZ8A 1H9KA 4K8JA 1BCPC 4KHZA 5T8IA 2MUYA 1LT6D 2Q8RE 3P1MA 4RHRA 1E2WA 2K04A 1QOFA 2BCOA 1STAA 5CORA 1FXAA 2NN6G 1PUTA 5IODA 4CKEA 2ENBA 1SB3C 5CGKA 2IWHA 1JB3A 1BCPD 3AB9A 4C56C 3MTSA 1T6BX 1SFOB 3MXPA 4RFBA 1IBXA 3ND9A 1ZE3D 2F0LA 3TP5A 1HQMC 2M56B 4B08A 2F0WA 4KD4A 1SE3A 5DEHA 3S2HB 2X6GA 2XRSD 3T51B 3ZGZA 1AP0A 1QWYA 2AWOA 1YMHE 1LV9A 4RGOS 1DOIA 1EIGA 1PMRA 4YTPB 2WINB 3DMUA 5CBAE 5H92C 2K7VA 4DXFA 2EYFA 3J9CA 3P4QB 3NWTA 2X69A 3HOUB 3Q6SA 1J9OA 2L83A 3HVZA 1GUOA 1KTKA 3AMZA 4OZAA 4OW0A 4PMCA 2SAKA 1XEEA 4AYBB 3CRKC 1C78A 1X3PA 4DK1A 3NQIA 4IFDJ 2Y3AA 5GXGB 2CW0D 2F0QA 3S1NB 1EY6A 1FNUA 3MA2B 2L32A 1SDFA 5ISRA 1CA6A 4XDCA 3W3AA 1IL8A 5I9OA 2O4XA 1TWAB 4IFDH 3T3OA 1TKGA 2WXPA 1EEFD 2WXLA 1ESFA 3Q8CA 1FO4A 3D31A 2D62A 5M3FB 1E2ZA 4MH8A 2PMZB 1CQVA 1CHPD 3B2FA 3HOVB 4GDLB 4NMZA 1I4RA 5DNFA 3MC0B 3H0GB 2BA0A 1SMYC 3D4RA 1FFVA 4HRSA 3HS0C 2L11A 3WOEA 1S5CD 2HDLA 2VB3X 1AW7A 1HFNA 4RNAA 1SE4A 4KN4C 2EZVA 2XWJB 5BMIA 3TN2A 1OO9B 3ZJTA 1T5XD 1WGKA 1JORA 3MFGA 3WOFA 1SMYD 2H89B 3GTOB 5IGDA 1GB4A 1DGJA 1XCQL 4TSSA 4XDDA 2OHFA 2O2LD 2MH7A 3BIID 1E6EB 2XIWA 3B9JA 2WV6D 5BYRA 1EL0A 5I4DA 2DWQA 1SAPA 1TYGB 3W2DA 4PV1C 1HTLD 3P20A 1IKMA 2DY8A 3PIP3 4CBVA 5CMDA 1SE2A 1HFGA 4J1MA 2NTSA 1A6XA 2WDQB 1I4HA 1YN3A 2IT1A 2WXMA 3OMGA 2KMMA 3ZYYX 5FR3A 1Q10A 4HR7B 1E0BA 3V96A 3MFYA 3H6MA 5HI1A 2ICIA 2K5DA 4RF1A 2OXPA 1EY0A 2R92B 2MGSA 3QG1A 3A8JE 2NTTA 1G91A 5A2QE 3I72A 3PUYA 5K5PA 3HZXA 4NKLA 2BDOA 3ETRA 2RDHA 2RA4A 1L6VA 1ZDVA 2IX1A 2L52A 2VNUD 4ZHPA 3IAYA 3PZ7A 4BWGB 1DM0B 4HN7A 5C4ZA 4N59A 2F3VA 5M9OA 4J3OD 2R6GA 1ENFA 1PZJD 5E3FA 1PFDA 2QEJC 1F9SA 2NVQB 4JK1C 5C44B 3KLSX 3QOLA 4RGMA 4XDXA 4DGZA 1LACA 3QWNA 2F0KA 4FVMA 3O13A 1PZID 1Q8IA 2KEDA 2WAQB 3U9OA 3P4PB 4CJ0B 4OO1H 1Y69U 3NTHA 5F2DA 1ZUD2 3NE5B 3IFTA 3HKZB 1VCIA 2NYZD 2RDGA 3AE4B 3IT4B 3MZ5A 2Z4HA 2L9HA 3S16B 3D8GA 3SK5A 4XIGS 1OQQA 5C0XI 2IDYA 1C4AA 1L0YB 4RKLA 3AM9A 5D14A 3DWQA 1DYQA 2L55A 2PO4A 1VR9A 1LABA 4WORA 2SDFA 4PQXA 3BVMA 4X3SA 3SR6A 2EVBA 1JR0D 2HCIA 1VLBA 1TKWB 1AZPA 1JCKB 3W5UB 3KQ4A 2PNRC 3A55A 4A3DB 4AS1A 3PV0A 2QIEB 1STHA 2MJDA 3BDLA 2V3PA 1PTOH 2J52A 3G7LA 2EXZA 4JWSC 1D5ZC 1IUEA 2IGDA 3R8BA 3AECB 1JICA 2W54A 1P7FA 1PGAA 2IX3A 5DM63 2B63B 4ZQ3A 1WCMB 2MPMA 5EJWA 3K5OA 1CHQD 3AE3B 1OXUA 1B4OA 1W6KA 2AQ3B 3BWUD 1Z6HA 3PIO3 1QG7A 3I73A 5K36H 3AMUA 4WIPA 3SE0A 1MBYA 1PFNA 1L6UA 1U9RA 1FMAD 2YU9B 3BVZA 1WTRA 2INPE 1N63A 2JSVX 2LHDA 3KUPA 2I46A 1S5ED 3K0YA 2SNMA 1KABA 3CU7A 5JAVA 1DOXA 3DWAA 1O7LA 2F0VA 2EYHA 2LJIA 4YSXB 1II3A 3SDZA 2EE1A 4ZAIA 2NN6I 2B2VA 3CKIB 1PFBA 5D7GA 1FEHA 1SJED 1PRTB 2N0SB 2IPKD 4XWWA 2V0GA 4J6HA 3X3MA 1HXYD 5JJZA 4OZCA 3T56B 4P16A 1OXSC 1G8ZD 1EY7A 1SYFA 5KNCA 2B2VC 2LMCB 4WAFA 4ZKCB 1OFFA 3K5NA 4FXDA 1AN8A 3A8KE 5HHDG 2Q5WD 5CV7A 2E74C 1GUWA 3PO0A 3P7JA 1NYRA 4C3HG 2N9LA 3K5LA 3AEGB 3OOCA 2MP1A 3VR9B 2OF1A 2EJMA 1RM6C 4V0BA 2R7ZB 5A2QL 5BYQA 2A69C 1Q12A 4EGVA 1LO5D 1BNZA 4FF3A 4C80A 1G291 3K59A 1B2TA 2BS2B 3NBIA 2B76B 2WP9B 3HVDA 2LMCA 2B2WA 2A69D 1CQFA 4P6VF 1PYWD 5CV9A 3UI3A 5KRUA 1GB1A 5FKAC 2NVXB 4ZRPA 1N5WA 1RODA 1NVID 4A3BB 1GUSA 2V3NA 2EDGA 1MSGA 2BA1A 1VZ7A 2BBCA 2BYTA 1G2TA 4FO2A 5AUKA 1DOYA 3TBIB 3SK4A 1TKEA 2YYZA 1K50A 1KNEA