2NTTA

Crystal structure of sek
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin K
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nttA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nttA01
1JWUD 2RDGA 3BYTB 2QEJC 1S5ED 1L0XB 3R2TA 3KLSX 1LTAD 1TS5A 2G9HD 1SE3A 4RGOS 4BWGB 5D3DA 1ENFA 1LO5D 1ET9A 1JCKB 2XRQD 4OHJA 2Z8LA 1S5FD 1BCPB 1LTBD 5TSSA 2RDHA 1M4VA 1FD7D 4RHRA 1PZID 2AQ1B 2ICIA 1BCPF 1I4GA 2AQ3B 1ESFA 1SE4A 4Z9CB 4UDUC 1PZKD 1PRTD 1D5ZC 4RFBA 5ELCA 1V1PA 4L6TB 1UNSA 3BVMA 1KLGD 1S5BD 2NTSA 1GOZA 1I4RA 1AW7A 1L0YB 1MD2D 1UUPA 3DWAA 4C56C 1CT1D 2TSSA 1CQVA 5D3IB 4RCOA 5FKAC 1TS2A 4ZYSA 2J4XA 1YN5A 1HQRD 1HXYD 1I4XA 1LT3D 1SXTA 4DXFA 3MC0B 1D5XC 1D5MC 3EA6A 1EWCA 1SJHD 1LT6D 1PTOD 1EEFD 3GP7A 3MFGA 1KLUD 1DJRD 1BCPC 3DWPA 1LLRD 1DYQA 2NTTA 5ELEA 1FNWA 1EEID 1XTCD 2R61A 3R2IA 5ELBA 2CHBD 2AQ2B 1SBBB 1YN4A 1TY0A 3TSSA 1B1ZA 1LTSD 1PRTF 2IJ0A 1HA5A 1YN3A 1FGBD 3BZDB 4RHSA 1I4HA 2XRSD 4RGTA 1LT5D 1RF2D 2XN9C 1SE2A 1I4QA 1LT4D 1BCPD 1TY2A 1EU4A 3W2DA 4L63B 1FNVA 1LTID 4RGMA 1ET6A 1V1OA 4DXGA 3BYYB 1V1PB 3O13A 3OWEB 1QILA 2SEBD 1JWMD 3EFXD 5FK9C 4NZLB 1CHQD 4O1NA 4K6LA 3BVZA 1PTOF 1EFID 1B44D 1SEBD 1PRTB 1BXTA 3SEBA 1RD9D 3URYA 4TSSA 1JQYD 1PRTC 1RDPD 1S5DD 2O2LD 1EU3A 1KTKA 5ELFA 2QILA 2IPKD 1JWSD 1LTRD 1FNUA 1STEA 2XNAC 3DWQA 1S5CD 2WV6D 1I4PA 1TS3A 1AN8A 1TS4A 4RH6A 3BVGA 3V05A 3R8BA 4RGNA 1PZJD 1XXGA 1PTOB 1LTTD 5ELDA 1PYWD 1CHPD 1F77A 1D6EC 1RCVD 1G8ZD 1PTOC 1CK1A 5I4DA 1JR0D 1SJED 1LTGD 3CHBD 1HTLD 1PTOH 1T5XD
chains in the Genus database with same CATH superfamily
3A5UA 4JI6Q 2D07B 4A3FG 2KQ3A 1A2UA 1WTPA 1CTMA 4K5XA 2R2OA 4A3MB 1P98A 2PPHA 3IBEA 4A8XC 4A3DG 3S15H 1SMXA 2QDFA 5E3FA 2PNRC 3GTLH 1JC7A 1O7IA 1E9MA 2KNBA 3HUIA 1NR2A 2NVQH 1S4ZA 2IZVB 3K7AB 4C3IH 5IY0A 4H02A 1EYCA 1N32L 1EWYC 5GAHC 1B2TA 2DHZA 4HCNB 2A4ZA 2EELA 1E7VA 4Z9CB 1V8CA 4KKSA 5EE0A 4KKUA 2UWQA 2NN6G 2XK5B 1Z6HA 2Z1CA 4CJ0B 4HSVA 4YWMA 4W9GA 2KD0A 2JSOA 3M7GA 2V3SA 4M8NA 5CBEE 4AQ7A 2D3CA 3MTSA 2K33A 3HOYB 2BYVE 5D65A 1IP9A 4DUYQ 1GC6A 2C7HA 2AWNA 4AYBE 1FXIA 4RKLA 1OEYA 5JVG3 1PXUA 2AWOA 3ONAB 4B9WA 1L7YA 2MLBA 2PMVA 3MJ5A 3STBC 1XO3A 4G50A 1AFPA 2PJHA 4B3SL 4X62L 4FBJB 3Q2AC 1TWGB 1O7ZA 2Y0SE 2GBNA 3ECIA 1YJIA 2F3IA 4EZJA 4MELA 4F87A 2UXCQ 2QW7A 3J80c 4GNXC 1S40A 3LJ3A 2KX0A 1DYQA 1X55A 3EIVA 1CZPA 2WXLA 3IT4B 1FNWA 2J0JA 4LK0M 4DNIA 1SYFA 3K57A 3R2IA 3OMCA 1XPRA 1Q5WB 1IW7C 4EQ5A 4A3JB 1O7YA 1SLJA 4HSPA 4OELB 3OLMD 4IKGA 1STBA 2PZWA 1HR0Q 2IJ0A 2EKEC 2DWQA 3HOVH 2K6DB 1VQGA 2VW9A 5M5WB 2XRSD 5C3XA 2GBMA 2WNMA 5I9PA 3L17A 2V0GA 3N20C 1LT4D 2NVXB 4BOSC 2IX0A 3ZJVA 1HZ9A 3CF6E 3MXNB 4LTUA 2VS1A 1QOAA 2MEKA 1S3SG 2KEDA 1OQQA 4NXML 4F88A 3RT3B 1PDQA 2F4IA 4O1NA 4M0WB 4ZK9B 3ERQA 3VDZA 4TVAB 3JAMc 1ZUD2 4RM8A 2O6VB 4M8AA 4LJOB 4A3OA 2F0LA 3P7JA 4DV7L 2KLCA 1WZ0A 1ZEQX 4XIGS 2ENBA 2N78A 2WDRB 2N9LA 3K0YA 2CJOA 4MJSA 3ONSA 4IOAA 5H92C 2N0SB 3NTIA 4WURA 2Q8IB 1CA6A 4EUTA 2G3QB 4ME3A 5JHBA 4OVUA 3DWQA 4LMQD 1YNNC 2MO0A 3PMFA 3N1YC 4OWWB 1CKNB 3UQBA 4RMAA 4JX1C 3QOLA 4LDTB 1PZJD 2D62A 3EVQA 2KXJA 1EZ8A 4J8QA 2NZHA 2B8FA 2ZXOA 1SNDA 1D3ZA 1EOTA 3RD4A 1E8YA 2ACZB 5I6YA 4GOPB 2VY3A 3GV3A 3ZYYX 2JY6A 1LTGD 1R4PB 4BXXG 1HTLD 2NBUA 3G71A 1DD2A 2EY1A 4GDKA 2EY6A 1F1HA 3PF4A 5IN7A 2I1KA 1KIXA 1K8RB 4HMJA 1PH1A 4RM9A 1H9SB 3H7PB 3Q8BA 5EE1A 5JH5C 1D1KA 1CFMA 3HGBA 2KDBA 4WQMA 1Q90A 1BBUA 1S5FD 1F2RI 2PNHA 1WCMG 1C8CA 2M17A 1LFDA 4EQPA 3RN5A 5TR5A 3L4PA 1J5EQ 4KD4A 1L6VA 3JSVA 5C3JB 5A2QE 2B2VA 2AQ1B 2BE5C 1RRBA 1T3QA 1GHJA 2VZAA 3M4QA 5JEAG 2IY1B 5G2NA 2B2YA 1EUVB 4GXBA 3KF6B 2JE6I 4PNYA 3EN2A 4OXPA 5KRUA 1FPYA 2K6QA 1PHJA 4IPCA 1F9JA 1RAXA 1AEXA 2JA5B 2CQOA 3L10B 2V4DA 1S5BD 5FLXE 1YIJA 1UH6A 2GMIC 3MEFA 1GPXA 2MNAA 3HOWB 2JT4B 1Q0WB 3JC66 3ZNHB 4MN3A 2GB1A 4NJ7A 1V5TA 2ATWA 4DR6L 1NYRA 3MC0B 3NENA 1EY7A 2F0KA 4DR7L 4L23A 2DLBA 3U4EG 4H7BA 1Q82C 1LABA 2I5HA 2PMZB 1DJRD 1BCPC 1RFAA 2D3BA 5M5XB 5BR8L 3QC8B 1GB4A 3L13A 1W3SA 2A1AA 2KKCA 3IHPC 4M00A 1EIGA 2ZJPA 4HCEA 5C0XG 3S1QH 4DK1A 2VUMH 2L15A 1O78A 1TKWB 4ZRPA 1UE5A 1YEZA 2A6EC 1QCBD 4QF4A 1JWAD 3FDTA 1YJNA 5GMVA 1MJEA 2IO1B 1PRTF 3RMHA 1O7LA 5CX3A 2AL3A 2VL6A 5BMIA 4UY8C 2OF1A 1CSPA 2KK8A 2MP2A 3L0WB 3PV0A 4EX5A 4Y7NH 2KC1A 1EY5A 3S1MB 3AFPA 5HGQA 3HIZA 4WRDA 4GLVB 2GVBA 4P2CB 4C4VB 2FINB 4OO1H 4R4IA 3UE0A 1P3QU 5EE3A 1U4MA 1UE1A 1YNXA 1D2BA 4BY7H 3DBRB 2K50A 4PZ8A 3LB8C 4WJQA 2KHSA 4HEDA 3TZDA 4CJ1B 1QZHA 4A3CH 3PUXA 2GLSA 3A7AB 4OWXB 4KMUC 3Q24A 3VA5A 3UIPB 1B44D 5IGCA 2JVCA 4X65Q 3PREA 3VRBB 2KACA 3FKIG 1ZDXA 4KKIA 5JJLA 1PH8A 2WXHA 3AECB 4RMFA 3KWLA 4G11A 2PVOD 1TIFA 4OX9L 2JA8G 1F52A 2EY2A 2GVAA 2Y3AA 3SHLA 4QY7A 3D0FA 2L55A 5EKLA 1N33Q 3UINB 1N36L 4KY6A 1PYSB 4JK1C 3IFWB 4AJWA 2N88A 2ZW0A 2KJ6A 2UU7A 1EIHA 1Q1EA 1SJED 4B08A 4JYAQ 1PTOH 3T4AC 3TEHB 1JWUD 1ML0D 4X66L 1LQBA 3Q8AA 4DXAB 2UXDL 4DK5A 2BB5A 3DVNV 1QNUA 3KUPA 3ZGZA 4FP5D 1TS5A 2R7FA 3UDIA 3VAWA 2R7ZB 5J39A 3K5OA 4L5TA 2JEBI 2L52A 4JG2A 3DM3A 1ET9A 2FCMA 1C77A 2QIEB 2REXA 5G3LD 4LF7L 3H3VI 5IP9H 3OOCA 4BY1H 4X64Q 3DHGC 5TSSA 5HHDG 4AJYB 3RUIB 1IYFA 2L9HA 2AUJD 5IGGA 2JU6X 5CHFA 5JHAA 4FF2A 3SR1A 3DHHC 4BFRA 5C1ZA 1MHWC 1WTXA 1V43A 1OEYJ 3DWGC 5C5LA 1EUJA 2A6HC 3FMCA 1PLFA 3P63A 4GB9A 1U4PA 4KKJA 1BUIC 3VR4A 3QX1A 1K0SA 4CKCA 3S15B 4RAUC 3GTLB 1XX8A 2KQ7A 4IUPA 4A3IH 4HJKA 2OXPA 4ZCKA 3TP7A 3GD7A 3D4WA 4C3IB 4WAFA 3TIXA 2DZMA 2PZUA 2LXJA 3RLOA 1ASZA 4M01A 5IGBA 1LTLA 1A63A 1E8WA 4B3ML 3M9BA 4JV5Q 1IKMA 4LNFA 2NTTA 5ELEA 2BWFA 3QO2A 3WOFA 4HDOA 1ISNA 2MX2A 1I94Q 4BBNF 3QQ8B 1O80A 2G4DB 2OEOA 2HDLA 5LMUL 4I6LB 2K5PA 4BVUC 1SRUA 1VDZA 1NTGA 5BO4B 1JORA 2J53A 3PS6A 4K7WA 4BKSD 4YY3L 2VB2X 2H4OA 2OT2A 3KF8A 4KVGB 3I4NG 2V1CC 2A5UA 3B0AA 4MGIE 2L8JA 3VUYA 1EU4A 2E74C 2N9XA 1SAPA 1SYEA 4AYBG 4JIOU 2RSOA 3K0XA 2IGGA 1MIUA 3H0GG 3N9YC 3T56B 1HNZQ 1Z47A 2YEPF 1WTRA 5E6PA 4IZ8A 1EQRA 4X6AH 1AE2A 4UP9A 2Y0SG 3VR2A 3CC4A 1UE6A 5CV8A 3PHXB 3TREA 3NZUA 3TMEA 2L11A 3GTGH 1QKZA 3ZDTA 2PW9A 2UU9Q 1R4MI 1SFOB 3ZTDA 1EFID 4HLEA 1WXVA 4DR4L 3BDCA 3MHBA 1MVKA 4TSSA 3QIJA 2QCZA 4BBSH 1KLVA 1YHAA 1MKHA 1L1OA 2MPMA 4HJAA 4OZBA 4P1BC 1WRDB 1F9PA 2QHOA 4HK2A 1VS0A 3ML8A 1C4CA 1PMRA 4P71A 2MHJA 1S5CD 3GTQB 3I3TB 4X57B 1RODA 2K5HA 1RM6C 1HZBA 3I57A 4FHKA 1V49A 1B7YB 1WTHA 3SR6A 2ZJDA 4IFDH 4YT0B 1G51A 5IA7A 1IW7D 1HFGA 1UF0A 3EROA 1PTOC 3OIPA 3HKSA 3RNUA 2JPHA 2B63H 3OTOQ 4LNIA 2IW3A 4DV1Q 1HEZE 3J80L 1WE6A 3GV6A 1L0XB 3AE5B 1EWHA 1LTAD 4O2DA 5CMDA 3I90A 4BWGB 2F0NA 2XEWA 1TGZB 1NUCA 4KLKA 4GS3A 1I3QH 1XD3B 4K7UA 5HG2A 3F2BA 1KFYB 4IO9A 2FMMA 4K0KL 3CQZH 1TJEA 3B08A 2ZXRA 3B1LX 1M4VA 3R7QA 1VZ8A 4YTNB 1XF5L 2R92B 2H88B 2PW7A 3OG5A 3N52A 4WWNA 1H95A 5T8IA 3VTWA 3AEDB 4MNOA 2RDFA 4JPBW 4QL5A 3T16A 3PZ7A 1SYGA 2BDOA 4UHVA 5IYBH 2Y5BB 4MJSB 1XTDA 4JBJA 1ACCA 4EEWA 3KK7A 1KLGD 5C3EH 3CWIA 1ZXHA 4CKBA 2LHDA 3DWAA 1AE3A 2PI2E 5J22A 3NG0A 1YNND 1WM2A 5C23A 5FKAC 4ARIA 2KDMA 1SYDA 4LUZA 2E2DC 4P75A 4AQYQ 1C78A 4A3EG 3BZKA 3EA6A 1KHIA 5K36H 2VQEQ 3SDLC 3TEZA 3N6RA 3GP7A 2BKRB 2D10A 1ONLA 2K5DA 2EZVA 1GHKA 1WGYA 4ILWA 2IO2B 4LF5Q 4L1BA 4GDKB 2R6GA 1SYBA 4DV6L 4A90A 4FVMA 1TWGH 2BW2A 4A3FH 2LASA 3NBHA 3U4VA 2JWUA 3CIRB 3LXFA 1VQIA 3LYYA 1F0ZA 4AP4C 4IM0A 4ARCA 2LXAA 1MHHE 3ZJYC 2K1BA 2UUBL 3BIID 1PFNA 3GS2A 1NCVA 4A3DH 1ASYA 2F52A 3H1UA 3JSVB 3MTNB 1RF2D 5A2QL 1DONA 1KF6B 3AEAB 1L5PA 2KA7A 2D0PA 2L76A 1X54A 3QOJA 3S24A 2JZ3B 2WU2B 4WJ3M 4JCVE 4GLSC 1CSQA 1FNVA 3WDNA 5LNK1 4J6HA 5KNCA 1N34Q 2NN6H 2NVXH 4DHJD 3TP8A 4LF8Q 1N9WA 4POFA 4DV0Q 3HOZG 3RPFC 4OVVA 1GXDC 2KWCA 1BMLC 4CDCC 2F0HA 4MTKA 4DAPA 1QOHA 4CDEC 3D4DA 1JQYD 2DY8A 3AMUA 1EO6A 1XWEA 2QSDA 1LACA 3SFDB 4ZRKA 2LRUA 4LFBL 5C3WA 2IPKD 1FEHA 2FIDA 3HHMA 1PGBA 1CI3M 3IAYA 3ZRFA 2KCMA 2PO4A 3E3XA 4RCNA 3PLVA 2V3PA 2IX1A 1I42A 2EPBA 1FL0A 2N55A 4N6EB 4ZUJA 3KWVA 1X65A 3FVQA 4C3HG 1WMHA 4CBVA 3KUZA 4W9CA 2OHFA 1R4NI 3W1GA 4RGNA 3GO5A 4ZRZA 2A6ED 4HIOA 2BOSA 3DVNU 1G8ZD 3ZNID 3MWYW 4G7ZC 2MJ8A 2LKVA 2HTME 2RPVA 1EY8A 3S14B 4G4KA 5G5GA 3CMAA 2E8GA 2MP2B 3UE1A 5ELNA 2E2IB 1U4RA 5DLQE 4QIWE 1OQRA 1RLFA 3T1HQ 2I0QA 2C7MB 5LL6S 4LW1A 2BS4B 3P4RB 3J7YW 2D5DA 1N8RC 4RNAA 4IURA 1I6HH 4TQUS 1HUNA 3T53B 5JJZA 4WWOA 4NAWA 2HDEA 5M5YH 3D8GA 2NWGA 1PFBA 3SHQA 2HCIA 2L05A 4KSKC 1HTOA 2QA4A 4UDUC 2LHEA 4KHVA 3K58A 3B9JA 4IG7B 1XLPA 4NXNL 5ELCA 1FIQA 2EMTA 1V1PA 3IFDA 2FCSA 3SK5A 3BVMA 3I70A 4JW0A 3AM9A 2ZZPB 1LGRA 5IP7G 2AEHA 5CV7A 4N59A 2Q8RE 1RL2A 2KBNA 5IYCG 2INDC 2IWHA 1EIYB 4BY1B 1XNRQ 2PTLA 4KY5A 4ZYSA 2GRIA 1WYWB 1KNAA 3MEHA 2DJGC 1UZXB 3KLSA 3FEWX 4B3TQ 1J8CA 1TT2A 4QB4A 3JVZX 3M63B 1KL9A 4N9TA 4A93G 1VQ9A 4FO2A 5G3LF 2LSSA 4DR2L 4PYZA 1KAAA 1TKYA 1EY4A 1CQFA 5COYA 4BXXH 1XNQQ 4DBGA 2UYZB 3CCLA 2JUOA 4EZLA 2DYMA 3TUOA 1FXTB 1IBKQ 4K2LA 3KBGA 4JI0L 1E3PA 2BTEA 5EAYA 3I4OA 2EXDA 1WR6E 2ZNVB 3X3NA 3AU7A 2N9EB 4IFDJ 5AJ3Q 4ACFA 3N32A 3PLUA 4JE3B 2DAJA 4KZCA 1HH2P 5JEAH 4B3RQ 3AE8B 5LMNL 1LTID 2HD5B 1T0SC 2OOBB 5JAVA 3WAPA 3SGIA 2JP1A 4DGZA 1B70B 5J18A 2SEBD 4P7IA 2A6HD 3BG3A 3PIOA 1HNWL 3RNCC 1KXLA 5JZEB 3X3MA 3M85A 5IOIA 1YIWA 1NR4A 4GOCA 4II3B 4K5WA 3UDXA 2KHJA 3A5ZB 4CKEA 4RG1A 1VQ4A 1VQ7A 2SNSA 2K6AA 3F1ZA 2KYWA 4K81A 4IUNA 2N1VA 5BYRA 4N9F4 1A3TA 2PCFB 1A3VA 3V6EB 1A62A 3MHZA 4DK0A 1VMPA 4X3KA 2P5ZX 4IPGA 2JWZA 1E2ZA 1G2SA 2G1EA 1JWSD 3VH4B 1STEA 4PZ7A 1UAPA 3AV8A 2BS3B 2AX5A 2VRRB 3D31A 3L7ZC 3DBSA 3GTGB 2A68C 5C0XH 1F2LA 2GI9A 2HJ1A 4LCDE 3GTMH 4NP5A 1MI0A 2F0VA 5C5MA 1GUAB 4NY0A 3X0WA 3P4SB 1RCVD 3I72A 1NBWA 3LWUA 5E7NA 5BN4A 1CK1A 4BBSB 1AH9A 2D11A 2KC2A 5AZHA 2LVOA 3ALBA 4WFN3 4FULA 4GLXA 3KF8B 3G7LA 3UI3A 4ZRJA 3TRZA 4G57A 3IAM1 4KTAA 4GOPC 5JJKA 3RZOH 2B2TC 1IHZA 5J17A 2G9HD 3U7DA 1Z2MA 3TEWA 1QZEA 3SK4A 3APFA 2IHEA 5CBAE 1YITA 3TP6A 1LO5D 4LFCL 1N32Q 2OEDA 1K83H 3IG3A 4UPAA 3A56A 2QEXA 2X69A 1XLNA 5T1IA 2R7ZH 1WI0A 1IBLL 3AEEB 2BB6A 3Q23A 3NE5B 4CGYB 3I3CA 3TS2A 2B63B 2JZPA 4IUUA 5FO7B 4LF9L 2L32A 3FKIH 5F2DA 3U58A 1EL0A 1L1OB 3HFZB 5EPKA 5CORA 4A55A 1VCIA 2M1MA 2E75C 2NBWB 1QVFA 2YLMA 1IYJB 1BDOA 1C79A 1LXDA 4ZRIA 3VR6A 4H44C 2B2WA 1I3QB 1JB3A 1I4RA 1L0YB 2K7VA 4X62Q 3B6YA 4B3SQ 2EY5A 4XYOA 2JA8H 1BNZA 1CQVA 3J81c 3AEVA 3OSOA 2WXJA 3BK1A 3ML9A 1GUTA 3RZWC 4B0MA 5AFWA 3CQZB 1HXYD 4DAVA 4A3GG 2VQFL 4IM3A 2HUGA 1OXTA 2K5NA 2F0WA 4IJHA 4POGA 1WR1A 3RNEC 2I2YA 1LT6D 1PTOD 2Q2TA 2N7DA 3H6NA 2CHXA 2JA6G 1PH4A 3J7AV 1P7FA 1ENCA 5C4XG 4JI7L 2PEAA 5C3EB 1H9RA 1U9RA 5FLMG 3A74A 1G6JA 5IAAC 1VQEA 1K8AC 4ZHOA 1GUWA 3CKIB 4FXDA 4LNOA 2EYOA 2XSCA 3AN1A 3PO3G 1TY0A 2KUMA 4GN4B 1V6EA 1B1ZA 3ZDMC 4IOCA 4F8CB 1YN3A 1GAQB 4DU9A 3EJIA 1WTVA 4F8MA 2ZM6L 4NXMQ 4XQQA 3UI2A 4DV2L 2FCQA 2M2LA 4II2B 4MACA 3A8KE 2BH8A 3W2DA 2OWOA 1RFKA 3R3MA 4GSWA 4N9PA 1A3UA 2K14A 5H1SE 4L63B 4FADA 4K7SA 4DV7Q 1B53A 4A3FB 4IW0A 2B29A 1XMQL 1G2TA 2K25A 5IO9A 4AOFA 2CU3A 4FA6A 3U4ZA 1HZ5A 4DKAC 1SIFA 3BY4B 1QG7A 1Y1VG 1Q8IA 4R9WA 3U9SA 1VD2A 3ENEA 3AU4A 1R7SA 1V1QA 3A8JE 4A3DB 2MQHA 4RKBA 3RYTA 2EXZA 2LGXA 3OJ4B 2O2LD 2JYEA 3A4SC 1EU3A 3TJPA 2EE1A 2EYHA 1SFOH 5C4XB 1T5EA 5FO8B 1FFUA 3SK6A 2JF5A 1IGCA 2JQOA 4CYEA 2K52A 3J80E 1JMLA 4M1UB 2WV6D 3CCEA 2MH7A 1EM7A 1YJWA 2QGQA 2FFKB 3IAS1 2PIAA 1I50H 3NBHB 3AE7B 3M7NA 3L16A 4M02A 2KLGA 1YZ6A 1OXUA 5FR3A 2NZ1D 3GTQH 4A75A 3GZNB 1TIID 4DHZE 1AZQA 4ZOHC 2K8BA 4A3LG 3E9HA 2ASQA 2WXRA 2HHHL 1V2YA 2INPE 3ZIMA 2QC8A 1HHVA 1UEAB 3NUHB 3VRAB 3I4NH 1S72A 4O42A 2AHOB 3R2TA 5IE8A 1C9OA 1HZAA 2ES2A 1Y1WG 1SE3A 3PIP3 2QCPX 3BDOA 1MGSA 4JI4L 1FRDA 1FXAA 3H0GH 2B8GA 5M3FG 2WXFA 2K5VA 2XRQD 2DAFA 2LY7A 1DCZA 1T0QC 3Q8EA 4LNNA 4KKTA 3C46A 1MPEA 4QJFA 4N8X1 3HRZC 1HZCA 2Z0SA 3PO0A 4F1SA 4WJNA 4LJZC 1FD7D 1PZID 3JAME 2FUHB 3P42A 1UWXA 1BCPF 2GBJA 1I4GA 1TYGB 1E7UA 1WJNA 4RA8A 4OGQC 2FNJB 3VTUA 2MP1A 5EBDA 2R2QA 3DVGX 4YWLA 1BF4A 2R92H 4DR6Q 1C0AA 3HM3A 3OW2A 4P16A 4TMAB 1FO4A 3RLFA 4DR7Q 1KDCA 5JEAJ 2M0AA 4AH6A 3LDZE 4XWTA 1VQPA 1WMHB 4EKUA 1I6HB 4YL8A 1TS2A 5CV5A 3W5VB 1YN5A 5FOBB 3GOEA 3RZFA 5BR8Q 3HVZA 1C9FA 2BDNA 4JVZA 3Q3JA 2C9OA 1ZKHA 3MC8A 5M5YB 3I56A 1K8GA 1QOGA 2CHWA 4KX6B 5C2TB 1P7EA 1UELA 2TMPA 1SF0A 2ZCBA 1F9SA 3MFGA 3C19A 1Y1WB 1VCBA 2KX3A 2VXWA 1HJPA 4J3OD 4K3CA 1HFNA 2VB3X 4R4OA 2Z6KC 1P9DU 2MJ3A 2CVRA 3V62A 3QJZA 1PDXA 2WXGA 1CKOA 3KLRA 3K5MA 3TN2A 2CHZA 2G5DA 3R93A 3ZXRA 4RHSA 2ZXPA 5C0XJ 1Z7TA 3LGJA 3H6MA 1Q8KA 2FCNA 3CC7A 4XT1B 4GKJL 2CCZA 4NAWB 3ICEA 4MH8A 2F0EA 5AZFA 3ZNGC 2J42A 1PV4A 3HOXG 2LFIA 2PZTA 1V1PB 3PUVA 3I73A 4IALA 3LX0A 1QILA 1EYGA 1V80A 2F0DA 4QIWB 3VVWB 3TS0A 1N6ZA 1XQQA 3B2FA 5DPWA 3MZ5A 2KJXA 4WORA 1WE7A 4OX9Q 3CU7A 1W2BA 4L5QA 2CS4A 3FKYA 1WCMB 1CUKA 1NEKB 4LFAL 2MCNB 1S5DD 1JOOA 2HCCA 1F2ZA 3RUZA 4HPPA 4MGYE 3U30A 1SB3C 1N36Q 1B9MA 1QF6A 2XNAC 1C3TA 1WTWA 1Q10A 2XIWA 1VQBA 1T6BX 2QJLA 3A1QA 2JZZA 3CAMA 4A3KG 1BR9A 3RI7C 5IIFA 1J9OA 3DWMA 1KRSA 2RF4A 3V05A 3A54A 4X66Q 5GAGC 1XXGA 3LWEA 2LMCA 5E6OA 5L95C 2UXDQ 3H15A 3U2SC 2IY0B 5EKKA 3PRMB 4JI1L 1FR3A 4PS3A 1TU2B 1YQ4B 1AZPA 1XMOL 4R1JA 2NPTA 2X6GA 3C1FA 1N63A 5I6WA 4LF7Q 4JL9A 1UGMA 3ER0A 4N58A 1D8LA 3K81C 4HKQA 1ZDVA 1JB7A 4MH0E 1BVSA 4S3SA 3S14H 2RR9A 4KHZA 1T0YA 4JPSA 4ITKA 2F0IA 2E2IH 2CW0D 4E71A 3S17H 1CZGA 2ZJQA 3GTMB 1NYQA 3HKZE 1XCTL 3HOUG 3PPAA 3JW0X 3HOZH 3ND8A 1J7AA 4DV5L 4IDIA 3EFUA 4L2YA 2JRHA 3A0JA 4ULLA 4R4QA 4ME5A 2L12A 4BKGA 3SXHA 3TQYA 1TWAH 3RZOB 2X38A 3BDLA 2O6VD 5KYLA 1D5ZC 4RFBA 2FXQA 1Y69U 3Q8DA 1WH3A 5JPMC 3KOJA 4E74A 2EYFA 1K83B 4U673 2D5GA 4KK7A 4FYDA 2HIXA 2DZIA 2YTXA 1BUVT 4PQXA 4IWOA 4C3HH 3KYDD 2D2CC 4E3CA 4B3MQ 1AP0A 2A68D 1K51A 2RMMA 4G7OC 4GGQA 2L1AA 4GLAC 3K7UC 3PHWB 4US8A 1J8IA 4LUVA 2K8CA 3QR8A 4A3PA 3FKIB 1EWCA 1SJHD 5LMUQ 4LNQA 1VLBA 2JXTA 4LDTD 1MSHA 5GADC 1W6KA 2HQLA 3KFUA 3TEXA 2IT1A 2LWPA 3RMKC 1X3PA 4OIKA 4YY3Q 2KFJA 2WP9B 1PA6A 2JA8B 5IODA 2M19A 3J7AF 2CHBD 3DBLI 3P4PB 3CC2A 1DOLA 5E6NA 2N49A 4ANXA 3WANA 2ZTDA 1LTSD 2N3SA 1SNQA 2WX0A 1ILQA 2QF7A 5CYUA 3NY5A 1YI2A 3I4MG 2VZKB 2A19A 2E2JB 1N62A 4OWTB 1RIPA 3K9OB 1TY2A 3PUZA 4IQZA 4PS7A 1NY4A 3NOBA 1PFSA 2B2VC 3AE6B 3QHTA 4DR4Q 1NBFC 1V1OA 3CF5A 2B2YC 3WAOA 5JVH3 3M95A 3DEOA 3E0JA 1R4QB 1UWVA 4DAYA 1BKBA 4DDID 4ZKCB 1PTOF 5IP7H 1WYGA 2I38A 2F0UA 5IYCH 3MA2B 1X56A 4W9IA 1WXAA 5IT9c 3BK2A 2NBFA 4P73A 2NCNA 3WA0A 4PYUA 2N7JA 2ASBA 4KSLC 5GROA 3H3VH 1RDPD 3K6OA 2R3ZA 3SVMA 2QILA 3N1XC 1VQJA 3AEGB 1LTRD 2JYOA 3DXJC 1UGJA 2QDLA 1BO0A 4EQNA 4A93H 5HFYA 3T1YL 4X3SA 2JXXA 2EQSA 3WIMA 5IOCA 1B3QA 1XYIA 5CHWA 3ZJUA 1ZYRC 1K8MA 3H9DA 4NDXA 3I4MB 3DBHI 1YD8U 1ZXTA 4XYCA 5LLIA 1STGA 1JW9D 1E8XA 4MGKE 2ALYB 1L4DB 1HZ6A 4MSMB 1WJJA 4JI2L 2KCCA 2V9HA 2MO1A 1KM7A 3AE9B 3BYTB 3NK9A 4K0KQ 1S5ED 2LVQA 2M56B 3G4SA 4JOIA 3NBIA 1EFWA 1VQFA 1A6XA 1J19A 3M3JA 4DWFA 1I50B 5GAEC 4DNRB 1ENFA 1CZWA 3AQQA 2I5LX 2LGSA 3S16H 2V3NA 3Q69A 3Q6BA 1BCPB 2A69D 3N30A 1MJCA 1LTBD 4LNKA 3RN9C 1J6QA 4PT5A 4FXGC 3ZNZB 2QKIC 5FJ8G 5LMNW 1G6ZA 1PGXA 3NS1A 1DOXA 1ZGUB 1WFQA 4KD3A 3I4NB 1PZKD 2KTRA 2L0CA 2JA7G 2J0KA 4AYBB 2EJMA 1HTPA 4DV4L 2W55A 2NTSA 3H0GB 1H4RA 2F0JA 2N9KA 2J52A 2KT7A 2N1WA 1D1IA 5MPOA 2ONQA 2F0FA 4RCOA 3UF8A 2Y0SB 1K73C 5CTRC 4ZYNA 4HPLB 2K32A 1HQRD 1WGHA 4DXFA 5IWAL 1MHXA 1SSNA 2LD9A 4DV6Q 2BS2B 2Q8TA 1MI2A 2KWVB 2CQAA 4HCSA 2L0FA 1PH2A 2MBHA 2B2UA 2F0QA 1WX7A 2NBVB 2E3TA 2BQQA 2BA1A 4ABNA 1WGKA 4KGSA 3ND9A 2UUBQ 4LJPB 3PT2B 4JLCA 4TRDA 4CDFC 1QQRA 1FVIA 1IL8A 4PV1C 4BBRG 3C3LA 4USAA 4C7YA 1ICFB 3ITPA 5ELBA 4JI5L 1B4OA 4NAMA 1YN4A 3SFEB 1SMYC 2K28A 3E0EA 2DNEA 1E6EB 1KABA 2KHWB 2LUEA 3HVDA 1P16A 1X3FA 2K01A 4J15A 4WQOB 4MT5A 1LT5D 2XN9C 5JXVA 1M90C 1WTOA 2RGFA 5IGEA 4NPNA 2F0OA 3JAML 4P1CC 2K03A 2NVTB 3FRPB 1L0WA 3MAQA 4UP8A 1VQAA 2RHSB 5C4HA 2M0XA 1ET6A 4DXGA 1ZPSA 3P2BA 3NJTA 3O13A 4PG3A 3AFQA 3TBIB 3MHSD 1JWMD 5FK9C 1ROEA 2WGSA 2FAZA 1X1MA 3ABVB 4W9KA 4LFBQ 2WS3B 3DHIC 1EY6A 4QAYA 2KCTA 1PRTB 1WZ3A 5EE9A 3SEBA 3TMPB 1RD9D 1UE7A 2AL6A 4W9LA 3NHHA 1HPCA 2DGYA 4A3GH 1PFMA 3SE0A 2PI2A 2WXPA 2ZTEA 1IUEA 1C1YB 2C9WB 1SR3A 2RVLA 1RKNA 4YCUA 4HJ8A 5G5HA 4ZQ3A 3EUB2 4BBRB 5CR3A 5JJIA 1JROA 4XC2A 3UDGA 2JA6H 1AN8A 5C4XH 3MXUA 3J80i 1NVID 1RTOA 1TS4A 5FLMH 3KH0A 4IM2A 1Y14B 4JI3L 4KGRA 2PE6B 3DLLA 4XXEA 3NUCA 1K52A 1F9QA 4MM3A 3PO3H 4QCLA 2EJGC 2K0PA 5DPRA 2K39A 2WX1A 1PVOA 1U4LA 2MBBB 2WKCA 2BVCA 3J7ZC 4TKNA 3VTVA 4FF3A 4A3EB 1TT5B 2G4SA 2RDGA 2CU1A 3TZUA 2E5LL 4G3XB 3KLSX 4S0RA 3VH3B 1SE9A 1YNTE 4JI8L 2D9UA 3I55A 3I9V1 4S17A 2WB1E 2VNUD 1UBIA 1A2TA 4V0BA 2E2HH 1EWIA 4C3JG 4NXNQ 1PH9A 2JEAI 2BKFA 2M8SA 3RNFC 4BOZB 2INCC 1Y1VH 2HE7A 2BPSA 3IL8A 3HP3A 2ICIA 4OONA 2LXCA 2WXKA 1WFYA 1WSPA 3JAMi 2F0PA 1Q46A 3NWTA 1MJDA 2D3AA 1SNMA 2BT6A 3QJYA 1PH6A 1KDAA 1UNSA 2LJIA 1Y8OB 2MJEA 4TQ0A 5EDSA 4M8MA 3GTJH 3S17B 3A1QB 2TSSA 5D3IB 4DR5L 2XVSA 2W54A 4KV2A 4DR2Q 3S1NB 2ID0A 2UXBL 3W1SA 1LUZA 2LMCB 4IUTA 5EJWA 3HOZB 2KEEA 2WAQE 3IFTA 1WD1A 3SK8A 1H9KA 4MEMA 3D3RA 4KN7C 4O0AA 5IGDA 3CCVA 1D7QA 3MVVA 4HXDA 4TUUA 1TWAB 4JI0Q 4LF6L 3HKZG 1E7ZA 2R93G 2NPTB 4ZHPA 5BYQA 4A3LH 2D3GA 2C35B 2BYFA 4H13C 1XPOA 3AYHB 1J0GA 4NJCA 2KVRA 1YQBA 4QQBX 4C00A 1Y1WH 4C3HB 3NZ3A 1B8AA 1EF5A 1M8AA 3WOEA 1WJ4A 4HROA 5M3FH 5LMNQ 3Q3MC 5J2RA 1KOTA 2IYDB 1FGBD 2O5JC 1OXXK 3IT6B 2B39A 3WAMA 4XQNA 2HTHA 3E5SA 2I5MX 1TWFH 1JJCB 1HNWQ 1STYA 2LEKA 1C4AA 4MTNA 4AUQC 4APVA 4BKSA 1A15A 2BBCA 5LHY1 1FRRA 1V81A 2J7QB 2I46A 2KENA 5DNFA 4DR3L 1VQMA 4GN5A 3M3YH 4DV3L 4A3BG 1CHQD 4ZUIA 4MZ9A 3CPWA 1I6VC 2JX5A 3ZVVA 5G55A 4XDDA 3V3XA 2KFKA 1IBXA 3HKZB 1CM9A 3P1HA 4QUCA 5KIXA 1TXYA 5ELFA 3DBRI 1QLBB 3W5OA 2MFIA 2N8NA 3U52E 2L0TA 1JQ4A 2XTIA 1WCMH 2WWZA 3J9CA 1RWSA 3K8AA 3NP8A 2KN4A 2O2VA 2YEPB 1E5WA 1RJTA 1XCQL 2FBWB 5NUCA 2KDEB 4IWPA 2QMTA 4EZKA 3RLNA 1NNXA 3KDFA 1EF1A 5BYSA 2RQXA 3A7LA 2OTLA 2K4KA 2X6LA 3C8YA 2CW0C 2L4NA 2UUCL 3A55A 2JN4A 1V97A 4A9AA 5ELDA 1TZOA 2VH2A 2WACA 1BQQT 3A9KA 3E6ZX 1D6EC 4GNXA 4GKKL 1Z5SB 4K1RB 5CGKA 3ZJTA 1QUQA 2WFWA 1JR0D 1B9NA 3L9AX 2RPQA 4LFCQ 4QGUA 4HPMB 4YTPB 2M9VA 1QOFA 1IZ6A 4A93B 2K9XA 2PKOA 2F0TA 1IBLQ 2WXQA 4HTHA 3Q14C 4J6IA 4HKZE 3HOXH 4LUOA 2KN5A 1GUGA 5BN3A 3WCQA 4KY7A 4LF9Q 4OHJA 2K8HA 3L54A 3Q3NC 4DAYB 4YWGG 5FO9B 2BWES 1MG8A 1IBML 4GIVA 5M3MG 4Q0FA 1GO3E 4R8IA 3CMEA 3C1EA 3CCUA 2OJRA 2Z0EB 2BA0A 3EQLC 5BN5A 4DUZL 1JJ2A 2KOLA 2LZ6A 4URKA 4HVBA 4CDDC 1SE4A 5I2YA 1JWBD 2DYOA 1L0VB 1PFDA 1TWHB 1WGRA 3CSFA 2Q2HA 2MUYA 1J7CA 1KRHA 4IOIE 4L6TB 1HNXL 4LF4L 3NVWA 2JK8A 1K9MC 3BU2A 2VQFQ 1UD7A 1MG4A 1WJUA 3LNNA 1GOZA 3M62B 2KJHB 1KC8C 2D2QA 3S16B 5AUKA 2UUAL 2PQAA 3VYTA 1QT9A 1L4ZB 1CT1D 3F8TA 4ZAIA 2JA9A 2B3GA 4A3KH 3P75A 3DOWA 3V2TA 2KVMA 4JI7Q 2AWTA 5KNDA 5HI1A 2RCNA 5EGTA 1ZYRD 4DR1L 1JMCA 1V86A 2IO0B 2DENB 2OJWA 3NVYA 3CCJA 3PZ8A 2F4VL 4ZRQA 2MJDA 3P4QB 4UAIA 3OHXC 4EOYA 4V190 4A3MG 4XDCA 3S2DH 1WM3A 1F2MA 3OWFA 1EQQA 2KWDA 3DVGY 3ZKJC 3ZRCA 2LFNA 1NDDA 1BBWA 3Q6SA 2ZM6Q 4ANVA 4DV2Q 5KHQA 2NVUI 3NRZA 5CHVC 2AQ2B 1JRPA 4Y52H 3F2CA 2WINB 2Z9HA 4X3TA 3PF5A 1GG3A 1Q1BA 2XWJB 1JJGA 1DGSA 1SIJA 4K6DA 4KZ0A 1DOYA 4NNJB 1XMQQ 1I4HA 4YXDB 2Z4HA 3I91A 3AH7A 3HOUH 4WWPA 4ALPA 1SE2A 1I4QA 1R4MB 3E9IA 4BKTA 2MBOA 1JOKA 5GQOA 1TKEA 1NAPA 2ZTCA 3OJ3A 2W9NA 2KTRB 2E2JH 4IWQA 4JWSC 2W3RA 3HOYG 3U7ZA 2Z4IA 2VH1A 1WGGA 3EC8A 1PQSA 4EE2A 3AULA 1PH5A 1G291 2IL8A 2NYZD 3VA7A 4NMZA 3PO2G 3IKJA 3Q8FA 1SEBD 3J81E 2K5WA 1FJGL 1ZW7A 4YHHL 4B0EA 3QCAA 3WALA 3Q8CA 1VZ7A 5DAUA 1TZ1A 3VR9B 4KHPL 3F2UA 1UEBA 1C48A 1R9TB 1RYJA 1KQSA 4ZKBB 2E76C 1PGAA 3TDQA 2LS01 1WX9A 3NXWA 4A3JG 1Q12A 5CV4A 2NUCA 2K5QA 1SNCA 1J7BA 3RR5A 2HHHQ 2EJFC 5IYDG 4EVOA 1WYDA 2PW5A 4NKLA 2NB0A 1GM5A 4XX5A 2A69C 3H09A 2D0OA 1Q81C 2NZOA 1WGDA 4BAXA 4HIDA 3QARA 4JI4Q 2NVYH 3DHQA 4A3GB 1V8QA 1SMYD 2EYMA 3GTPH 3GE8C 4EQOA 3I4MH 3IXSA 3K5NA 3T51B 3ERSX 2HD3A 2H1EA 3PIO3 2YU9H 1VJKA 2EVBA 3ETRA 3H8HA 3K9PB 1EYAA 3ZUNA 4YSZB 2JA6B 2K05A 3AU5A 2MQJA 4IN3A 3V60A 2F0GA 3PUYA 4KI0A 2PVGC 1VQ8A 1A5RA 3V96A 1IYVA 3PO2B 1WJ6A 3I5JC 1YHBA 4JI6L 1QE6A 3M4PA 3PO3B 3PQIA 1FMAD 3W5UB 1C4QA 4CO7A 1HE8A 2PYKA 1QZGA 3E56A 2J0TD 4DN4M 1EOVA 1STAA 3D6CA 4A76A 2RSNA 3PSIA 1CKMA 1P1AA 3RFZB 4XQJA 2WDTB 1KD1C 5AUIA 2W3SA 5D2MB 1ZXIA 1HA6A 3T3OA 3EFCA 3MP9A 3UDFA 2B3AA 3K5LA 1C76A 3PCOB 4HIKA 3FC4A 4HJGE 4K5VA 2F0MA 1UWMA 2E2HB 2I1JA 2PQEA 2J4XA 2WP8J 5KEEA 4H0LC 1MSGA 1Y1VB 1I4XA 1LT3D 4PMWA 1WRIA 3MJWA 4MGZE 3ZQ4A 1GJZA 4FF4A 4LAAA 3K59A 4JGHB 4DK3C 4MM3B 2KANA 3A4RA 5IP4D 3NEMA 2WXIA 4IPHA 2WB1G 1EEFD 4DUYL 1DOMA 1RTNA 1SE8A 5DEHA 4L5RC 5IKCM 4KN4C 1KAWA 4JBKA 4C2MB 1ESRA 2RA4A 3GTJB 1JE4A 4GKJQ 1U5KA 3MXGA 1FCLA 3AEFB 4IC7B 2UXCL 3T13A 2V4LA 1I5FA 1GUSA 5LXIB 1E24A 4F7XA 3QG1A 3CCSA 1YNJD 4FDBA 3RNAC 2XGTA 4GN3B 5FJ8H 4R8NA 2JA5G 3TBLD 1JE5A 2ZVNA 4GMVA 3TL5A 1E0BA 2WHIA 2WXNA 3F2DA 1HR0L 3JYUA 2FIFA 2WAQG 2KVZA 3HOWG 1CMXB 1M94A 2MHVA 1VQOA 3H94A 4LFAQ 3OW7A 3U9OA 4YSXB 2JA7H 2MW5A 4DDGD 2NVTH 2DBYA 4IUQA 2GOWA 1LM0A 2IGHA 4A20A 5IGFA 5M3FB 2B2WC 3N3KB 3NWSA 1EQVA 3PGEA 3URYA 1W6JA 3H91A 1R4NB 2VZKD 2WB1B 1T0RC 4GDLA 3RZDH 1TWFB 2KECA 2ZVOA 1ZOYB 3GQBA 3I8ZA 5AZGA 4DA2A 1BBXC 5FLXc 1FNUA 3S2HH 2MBEA 2ZPYA 3DUZA 4JI1Q 3APCA 4WH4A 2ZEQA 4F7ZA 3L08A 1TS3A 4OEMB 3M3YB 3DM1A 3G6JB 1XMOQ 3KQ4A 4WJPA 4CQNA 5EPLA 4NQKE 1FD6A 4KJNA 4BBRH 5E4WC 3G6EA 4A4IA 4WAAA 2L00B 2YV5A 2HIVA 2H5XA 2LXKA 4OO1I 5I4DA 1CJEA 4HAEA 3VR5A 4ZLTF 4TQ1A 2GBKA 1WX8A 5M9OA 5C4ZA 1SGHA 3L2PA 1Q3LA 3VUWA 1OXSC 2WAQB 3ULLA 3BWUD 3HRDD 2EYJA 3AE2B 1WD0A 1PUTA 5CC4A 2K22A 3T9LA 1DXMA 4RGOS 3PRZA 2GN5A 4DV5Q 4A3EH 3RNGC 4YTMB 2MGSA 5C44G 3BS1A 3KLWA 2RD0A 2A74C 3OIQA 2C5CA 1N5WA 3VFKA 2C5LC 1KRTA 1QVGA 3PRPB 4RHRA 4I7AA 3PZDA 1H9MA 4KDLB 1OTRB 5GXGB 4KIKA 4W9HA 1AYFA 1VQLA 1L2NA 2KFKB 1IBXB 4PMCA 4C1NI 4FHJA 4PZ6A 1FYCA 3I7FA 3CCQA 1J5EL 5DCNA 1E22A 1YX5B 2Y5PA 3HOXB 3CCRA 4W9FA 3WWVA 1XLOA 4XZ4A 4AIMA 2O2VB 1GUNA 3VUXA 1VQDA 3Q22A 2F03A 3DCGA 3KDFB 3R3OA 3NELA 4B9KA 1SXTA 2C7NB 4KGTA 2IX3A 3A9KB 1D5MC 4UP7A 4FXKC 4N8FA 4GNXB 1JT8A 1QUQB 2HQEA 4I6PA 3S1NH 4J1MA 3GB1A 1KLUD 3VYUA 2R7ZG 4NPSA 4NJ6A 4WIPA 3DEPA 5C44B 4YCWA 4QUFA 2IDYA 1QVCA 2DN8A 3KUCB 1Y8PB 4A3KB 2KHIA 3HZXA 1IGDA 2RCFA 3NZSA 3I2ZA 3SD5A 2Q2IA 5L37A 3ZO5B 4D2KA 1E90A 1N5XA 3BZDB 4RGTA 2KAJA 4C3JH 1X32A 3AB5A 1MFWA 2QDBA 1WXMA 3S1RB 1C4PA 1WXQA 3S2DB 2EIFA 2RBMA 2XBBC 5DPSA 5ISRA 2WXMA 3KYCD 2B76B 3FPUB 3L0OA 3NS8A 2Z6BA 4TKOB 4US9A 4LLGM 5LXHA 4HDQA 2RHQB 2MRPA 1TVXA 1NMGA 2DX5B 2PQAB 4CHTB 4C3IG 1II3A 2YVCA 1GC7A 2J0MA 2F3WA 2ICEC 1WVLA 2LGYA 1YMHE 5J3BA 3HOUB 3HG9A 1YQ3B 3T1YQ 1PRTC 2PLPA 4G7HC 2DJFC 3ULPA 4GU2A 1DGJA 2WYQA 4RF1A 1FGUA 4YIJA 2ZJRA 3A9JA 2WKDA 1T9HA 1B50A 4X65L 1IYUA 2KZRA 1IPGA 5C4JH 2R93H 3VR8B 2KMCA 4NQLB 4JI2Q 3BVGA 1YBYA 2WQYB 3E9SA 2FE8A 3GTOH 4FLHA 2EOTA 5HKHA 5J1ZA 1P8LA 1CHPD 1OFFA 2HT1A 3TEYA 1WTQA 2DNFA 4XE0A 4K8IA 1SDFA 1EIFA 1VQCA 2L7RA 3S2AA 2OTJA 4OZAA 4W9DA 3EECA 1T5XD 3KJPA 1N33L 3Q3OC 3CW2C 1E7PB 1F2RC 1I7HA 2INNE 4JQWC 2SDFA 4K2KA 2LUMA 4HJ7A 2BYTA 3P20A 2NVQB 1Z9FA 3SDZA 4JYAL 3DMUA 1JCKB 4DNTB 4GZYC 3VQIA 3W1BA 2Z8LA 2XWBB 2F0SA 4DFAA 3HOVG 1KJTA 4ICUA 1TBEA 1K3RA 1TWCH 4FNFA 4A3BH 1VF5C 1H8CA 2O4XA 2YTYA 3QA8A 4JC0A 2NVYB 4WJOA 4DV4Q 3U8ZA 1V5OA 4PMBA 2BGFA 3J81L 5IT9E 3GTPB 1HQMC 3BINA 4DHJB 1VMCA 4K8JA 2YU9B 1ZKOA 4GN1A 4X64L 3IRBA 1LYLA 2HDMA 5IWAQ 4IFDI 3H7SA 3GTKH 1GVPA 3KYHC 5A35A 4HCPB 1A0IA 1GNUA 1MD2D 1UUPA 5T1GA 1TWHH 4C56C 1YX6B 1ILPA 3AXCA 1OXVA 4E6IA 2LJ5A 1WY8A 4BA2I 2F3VA 5C6AA 4OW0A 2A8VA 1N61A 3EBEA 4CHKA 2J7ZA 2MSED 3CD6A 4JI5Q 5I2XA 5D7GA 5LL6X 2EKIA 4LWCA 3C0RB 3FILA 1QB5D 5D6JB 4I7ZC 1LLRD 2L3ZA 2GBRA 5EKIA 4DPGA 1SNPA 3RD2A 2WU5B 3HOVB 3D32A 1EZ6A 4U68A 1N60A 3QIAA 5DM63 3OMGA 5D94A 2R92G 3HK0A 3STBD 4JV5L 4HJ9A 4HR7B 4BZAA 4OVZA 2KDIA 1I94L 1S3OA 4PS8A 1Q7YC 1P0RA 4G0NB 1WXSA 5M3MH 1CA5A 3BJUA 3S9WA 2H89B 4AS1A 1VQNA 5KHOA 1XEEA 5E4XA 2Z0DB 2SNMA 4ODGA 3HM6X 1SYCA 1NENB 4OIJA 1STNA 3OWEB 5ELOA 3M4OH 2ZCCA 4NZLB 1DZ1A 2CH4A 2OQKA 4FF1A 3I63C 4BBNC 1HTQA 1L2FA 3T3NA 3J7A5 4FJZA 5L83A 2MWSB 5EQ0A 2RKSA 1HNZL 1PH7A 1JALA 3QK0A 4L5SA 4ICVA 4TV3A 4R4CA 1HRJA 3J81i 1EYDA 4P72A 2E6XA 3I4LA 2XK5A 3A33B 3KBXA 4JI3Q 3EGRA 2UU9L 1L6UA 1NI2A 2ZNVC 3OPOA 4XT3B 2N4FA 1GD7A 1MBYA 3CPFA 3NVZA 1PYBA 4B95A 3CRLC 2EDGA 2JA7B 2SAKA 4A3MH 5I9OA 4DHZB 4HMIA 1R9TH 4ANUA 4XGAB 3TP5A 3R8BA 2R7DA 2V1YA 2Q2UA 1LTTD 3CP0A 1PYWD 2E5LQ 3KW5B 4IPDA 1XLQA 1NJIC 2KTFA 4K14A 3RZDB 4JI8Q 2JSVX 3Q3FA 3FPPA 3K7AH 4PK1A 3CHBD 2NN6I 4HN7A 1VR9A 1E1TA 2G45B 3H3VC 3VDYA 2IBIB 1H9JA 1F9RA 3S2HB 3L3OC 2VUMG 2KJRA 2ZPNA 1GB1A 2L1BA 3UIOB 5HY6A 3PSEB 1GJXA 1Q86C 1C7YA 2PPBC 1VRAB 4NW2A 2DZJA 3P1MA 1VQ5A 4B9XA 3NTHA 4IUVA 5KGUA 3K80C 3GZNI 1ICWA 5HURA 3OTOL 3N1ZC 2KWUB 1RHPA 3HOYH 4DV1L 2MBQA 3ZXVA 2FUG1 3AE4B 2DNCA 4EFOA 1TQOA 2CH4W 2RDHA 3APDA 4P6VF 4IJLA 1VQ6A 3QB3A 3AE3B 4P74A 3CXCA 4LK1C 3PO2H 1YJ1A 4HEA1 4OO1G 2AQ3B 1IL2A 2FMCA 3MXNA 1YJJA 4GDLB 4DR5Q 2IO3B 3NTKA 2JQRB 2JRIB 3VHTC 4BY7G 2UXBQ 1WIAA 3V61A 4ID6A 4A3CG 1YJ9A 1K8OA 3FHWA 2FHTA 2NMQA 2WLBA 4M0WA 4BS9A 3HEJA 1PH3A 4KV6A 1E2VA 4LF6Q 2O6VA 2DUDA 4A3JH 2KMMA 2OCEA 1YVCA 1LM8B 3KUDB 2X8XX 4JWUC 2BE5D 3OYYA 2JXMB 2DY7A 1D5XC 5IYDH 1G91A 5M5WH 1YNJC 3S1QB 2Y5CA 2VUMB 5EPJA 2L5TA 1SN8A 3HS0C 1HUMA 3NQTA 4DK6C 4DF7A 4BA1I 1S1QB 1ZP0B 1OO9B 5FLXL 1E0ZA 1Y8NB 1CKNA 4AQYL 3VYRA 1EEID 2N7EA 2VQEL 1QOBA 1XTCD 2K1FA 1X9NA 2YYZA 1F2YA 2AUKA 1X3EA 3C2PA 1OGWA 3FAHA 4OZCA 4JOIC 1L1OC 5JOBA 3TSSA 4LF5L 4Y7NB 4C2MH 3DDCB 1V9JA 3D4RA 1HA5A 4GOPA 2LVPA 2PE9A 4FJVB 1DM0B 2B2TA 2YTVA 3ZTCA 4C80A 2AKWB 4DR3Q 1KH0A 2M4NA 4R3DA 5HGTA 5E6JA 1K3BC 4C1NK 4DV3Q 4BY7B 2HJ8A 1BCPD 3DPDA 4FXCA 4KIKB 4W9JA 2KO3A 3A8IE 1X6OA 1H9SA 3H7PA 3MXPA 2CFMA 4BY1G 3BYYB 5IP9G 1Q1OA 3W3AA 4YCVA 1XJVA 1QNKA 4W9EA 3VR3A 1WI5A 4Q5VA 4MSQB 4DQOC 3VYSA 4MHEA 4ASWC 1EY0A 3BVZA 4K6LA 2IGDA 1DOKA 1SROA 1STHA 3AEBB 2A73B 2PMZE 1BXTA 1XPUA 1OQYA 5DPTA 1M1KC 2CKZB 4C7ZA 4C3JB 3GDEA 3PUWA 1N34L 3KF6A 1E8ZA 3NSWA 1A70A 4ANWA 1KTKA 2EYPA 4LF8L 2KQ4X 4DV0L 2UUCQ 1Y56A 3QWZB 3G48A 5BMGA 2B2UC 4GKKQ 4XYQA 2BF8B 1I4PA 4A3IG 2ZT9C 3NQIA 1QJOA 2CKHB 3AI5A 1K0RA 1GUOA 1PTOB 1FFVA 2WIIB 1XT9B 3TCAA 2A5HA 1F77A 2F1MA 2K75A 4X3UA 2K3UA 1SNOA 3MC9A 4JBWA 3MFYA 1HCZA 1TTNA 5CV9A 2O5IC 2CWAA 3U50C 3AE1B 1OTCA 4WWMA 1NMFA 3CCMA 2CR5A 2WXOA 1VQKA 1NE3A 4K3BA 3OAWA 3RN2A 3R7RA 2QEJC 4I65A 3X23A 4YWKA 1U4AA 1VDVA 2LRWA 5C4JB 3PVLA 4HRSA 2R93B 3Q0AA 1IBMQ 2JA5H 2KMAA 5D3DA 5EBCA 4DUZQ 1AARA 2V4IB 3HOWH 4ZDVA 3GTOB 2KCNA 1A8VA 3B2GA 1VF7A 4NB3A 4RWSC 1HR0W 4RF0A 1HNXQ 4LF4Q 3T1HL 3PTFC 1WOCA 4XTCS 3UGBB 1WWTA 1K53A 4WJ4A 3NVVA 2UUAQ 2AMCB 2DZKA 1ESFA 4MIUA 2BYEA 1YOVB 2C60A 2NS5A 3PV1A 4Q2JA 4C4VA 1LV9A 1PRTD 5C0XI 2NR2A 3QAQA 4A3IB 5M5XH 3A9JB 1ZE3D 1DOIA 3CSTA 2FJ2A 4DR1Q 3CMMB 1AW7A 3RULA 2IHFA 1NSNS 2F4VQ 4REZA 3M4YA 3W1YA 1SSOA 1TWCB 1ENAA 4BBSG 4A3BB 4FJYA 3R66C 4H2AA 4AWJA 1I35A 2N9PC 4CJ2C 4L8JA 5DM73 2KQSA 4JBMA 2WDQB 2M00A 3DBLB 1KDBA 1YHQA 4XWWA 1VZ6A 3BZCA 1XNRL 1FM0D 2IY5B 2GA4B 3KVFB 2RDBC 2CWPA 1TKGA 3S1MH 3DWPA 4HJ5A 1FCCC 1E1OA 4QMGA 5JPNC 5FR6A 3UQAA 4B3TL 3GTKB 4B6WA 3KJOA 3ULJA 3RCZA 3ZLZA 2R61A 3QWNA 2K04A 4IFDG 2LGDA 2MA9B 4WJWA 3ZW3A 4HWIB 3J81j 1SBBB 2BH2A 2ZW1A 5C44H 4XDXA 3RNBC 1XNQL 2B63G 2WDVB 5K5PA 2KOXA 1IBKL 3FP9A 4HIMA 4R4TA 1IKLA 1V9PA 2JJQA 5D14A 3V6CB 4MDKE 5IT9L 3GE3C 1JICA 2KDFB 2LGIA 2EYLA 4RGMA 1B3AA 1FJGQ 3PGZA 4YHHQ 2I07B 1Y8RC 3S1RH 4OL7A 3EFXD 1E2WA 1TR5A 2G9DA 4DAMA 5AJ3L 4KHPQ 2SOBA 1JRUA 1UBQA 3SU8X 2Z59B 2LI5A 3PIPA 4B3RL 1VQHA 4A6QA 2BCOA 1JOQA 4KJOA 1EQTA 3DQVA 2AYOB 5IYBG 1K28A 3IVFA 2EMSA 5M3MB 5BMHA 3W1SC 3CRKC 1IXRA 3DBHB 5C3EG 3O65B 5KNBA 5KYIA 1NI3A 2RSUA 1WF9A 4KDIC 1D4BA 2Q5WD 5H8YE 1K50A 3FILB 5AEKB 1G6PA 5E1FA 2DYBA 4FN2A 3M4OB 2L83A 3T8MA 1GKHA 3W9CB 3AMZA 4YSYB 1U0LA 4RH6A 3D6WA 4IUMB 2W82A 4EGVA 2ON8A 1E10A 4I6NB 2JYTA 1BOSA 5K36G 1AWDA 3VXWA 5CV6A 1EY9A 1B9RA 3EHVA 1KNEA 3NPPA 3NHEB 1QWYA 1BT0A 1X3QA 2CJNA 2OQ0A 3AB9A 1X3GA 2Z6KA
chains in the Genus database with same CATH topology
2KQ3A 1A2UA 1WTPA 1CTMA 4K5XA 4A3MB 4A8XC 5E3FA 2PNRC 3HUIA 1JC7A 1E9MA 1NR2A 1S4ZA 3K7AB 1EYCA 1EWYC 1B2TA 5EE0A 2EELA 1V8CA 4Z9CB 4KKSA 4KKUA 2NN6G 1Z6HA 2Z1CA 4CJ0B 4HSVA 2JSOA 3M7GA 5CBEE 4AQ7A 3MTSA 2K33A 3HOYB 5D65A 2AWNA 1FXIA 4RKLA 5JVG3 1PXUA 2AWOA 3ONAB 4B9WA 2PMVA 3MJ5A 1XO3A 1AFPA 1TWGB 1O7ZA 1YJIA 4F87A 1DYQA 1CZPA 2WXLA 3IT4B 1FNWA 4LK0M 1SYFA 3K57A 3R2IA 3OMCA 1IW7C 4A3JB 1O7YA 4HSPA 4IKGA 1STBA 2PZWA 2IJ0A 2DWQA 5M5WB 2WNMA 2XRSD 5C3XA 5I9PA 2V0GA 1LT4D 2NVXB 2IX0A 3ZJVA 4LTUA 1QOAA 2MEKA 2KEDA 1OQQA 4F88A 1PDQA 2F4IA 4O1NA 4ZK9B 3ERQA 1ZUD2 4M8AA 2F0LA 3P7JA 1ZEQX 4XIGS 2ENBA 2WDRB 2N9LA 3K0YA 2CJOA 5H92C 2N0SB 3NTIA 4WURA 2Q8IB 1CA6A 3DWQA 4LMQD 1YNNC 3PMFA 4JX1C 3QOLA 1PZJD 2D62A 3EVQA 1EZ8A 4J8QA 2B8FA 2ZXOA 1SNDA 1EOTA 3RD4A 4KGTA 2ACZB 5I6YA 3ZYYX 3GV3A 1LTGD 1R4PB 1HTLD 1DD2A 2EY1A 2EY6A 4HMJA 1H9SB 3Q8BA 5EE1A 1D1KA 1CFMA 3HGBA 4WQMA 1Q90A 1S5FD 1F2RI 1C8CA 4EQPA 3L4PA 1L6VA 4KD4A 5C3JB 5A2QE 2B2VA 2AQ1B 2BE5C 1T3QA 1GHJA 5JEAG 2B2YA 4PNYA 2JE6I 5KRUA 1AEXA 2JA5B 2V4DA 1S5BD 5FLXE 1GPXA 3HOWB 4MN3A 2GB1A 1NYRA 3MC0B 1EY7A 2F0KA 4L23A 2DLBA 3U4EG 4H7BA 1LABA 2PMZB 1DJRD 1BCPC 5M5XB 1GB4A 1EIGA 4HCEA 5C0XG 4DK1A 1O78A 1TKWB 4ZRPA 2A6EC 1QCBD 4QF4A 1JWAD 3FDTA 1PRTF 3RMHA 1O7LA 5BMIA 2OF1A 3PV0A 1EY5A 3S1MB 4WRDA 4P2CB 2FINB 4OO1H 5EE3A 1U4MA 1D2BA 3LB8C 2KHSA 4HEDA 3TZDA 4CJ1B 3PUXA 3A7AB 4KMUC 3Q24A 3VA5A 1B44D 5IGCA 3VRBB 2KACA 1ZDXA 4KKIA 2WXHA 3AECB 3KWLA 2PVOD 2EY2A 2Y3AA 3SHLA 2L55A 5EKLA 4KY6A 4JK1C 2N88A 2ZW0A 1EIHA 1Q1EA 1SJED 4B08A 1PTOH 3T4AC 1JWUD 1ML0D 3Q8AA 2BB5A 3ZGZA 1QNUA 3KUPA 4FP5D 1TS5A 2R7ZB 5J39A 3K5OA 2JEBI 2L52A 1ET9A 1C77A 2QIEB 5G3LD 3OOCA 5HHDG 5TSSA 2L9HA 2AUJD 5IGGA 2JU6X 4FF2A 3SR1A 1WTXA 1V43A 3DWGC 5C5LA 2A6HC 3FMCA 1PLFA 3P63A 4KKJA 1U4PA 1BUIC 3VR4A 4CKCA 3S15B 4RAUC 3GTLB 1XX8A 4IUPA 2OXPA 3TP7A 3GD7A 3D4WA 4C3IB 4WAFA 2PZUA 5IGBA 4C7ZA 1IKMA 2NTTA 5ELEA 3QO2A 3WOFA 1O80A 2OEOA 2HDLA 2K5PA 1VDZA 1JORA 2J53A 2VB2X 2H4OA 2OT2A 3KF8A 1EU4A 2E74C 1SAPA 1SYEA 2RSOA 2IGGA 3N9YC 3T56B 2YEPF 1Z47A 1WTRA 4IZ8A 3VR2A 5CV8A 3TMEA 2L11A 1QKZA 2PW9A 1SFOB 1EFID 3BDCA 3MHBA 1MVKA 4TSSA 2MPMA 4OZBA 1F9PA 1C4CA 1PMRA 1S5CD 3GTQB 1RODA 1RM6C 3I57A 3SR6A 4IFDH 4YT0B 1IW7D 1HFGA 3EROA 1PTOC 3OIPA 2IW3A 1HEZE 3J80L 3GV6A 1L0XB 3AE5B 1EWHA 1LTAD 5CMDA 3I90A 4BWGB 2F0NA 1NUCA 5HG2A 1KFYB 2FMMA 1TJEA 2ZXRA 1M4VA 1VZ8A 4YTNB 1XF5L 2R92B 2H88B 2PW7A 5T8IA 3N52A 3AEDB 2RDFA 3T16A 3PZ7A 1SYGA 2BDOA 1ACCA 3KK7A 1KLGD 3CWIA 1ZXHA 4CKBA 2LHDA 3DWAA 5J22A 1YNND 5FKAC 4ARIA 2KDMA 1SYDA 2E2DC 1C78A 3EA6A 5K36H 3TEZA 3N6RA 3GP7A 1ONLA 2K5DA 2EZVA 1GHKA 4ILWA 4L1BA 4GDKB 2R6GA 1SYBA 4A90A 4FVMA 2BW2A 3NBHA 2JWUA 3CIRB 3LXFA 1F0ZA 3LYYA 4ARCA 1MHHE 2K1BA 3BIID 1PFNA 3GS2A 1NCVA 1RF2D 5A2QL 1DONA 1KF6B 3AEAB 1L5PA 2KA7A 2WU2B 3QOJA 4GLSC 1FNVA 3WDNA 5LNK1 4J6HA 5KNCA 2NN6H 3TP8A 3RPFC 1GXDC 1BMLC 2F0HA 4DAPA 1QOHA 3D4DA 1JQYD 2DY8A 3AMUA 1XWEA 2QSDA 1LACA 3SFDB 5C3WA 2IPKD 1FEHA 1PGBA 1CI3M 3IAYA 2PO4A 4RCNA 2V3PA 2IX1A 2EPBA 2N55A 4N6EB 4ZUJA 3KWVA 3FVQA 4C3HG 4CBVA 2OHFA 4RGNA 3GO5A 4ZRZA 2A6ED 2BOSA 1G8ZD 3MWYW 4G7ZC 2MJ8A 2LKVA 2HTME 2RPVA 1EY8A 3S14B 4G4KA 5G5GA 2E2IB 1U4RA 1OQRA 5LL6S 2BS4B 3P4RB 3J7YW 2D5DA 4RNAA 4IURA 4TQUS 1HUNA 3T53B 5JJZA 2HDEA 3D8GA 2NWGA 1PFBA 2HCIA 4UDUC 2LHEA 4KHVA 3K58A 3B9JA 1XLPA 1FIQA 5ELCA 1V1PA 3IFDA 3SK5A 3BVMA 3I70A 3AM9A 4N59A 5CV7A 2Q8RE 2IWHA 4BY1B 2PTLA 4KY5A 4ZYSA 2GRIA 1KNAA 3MEHA 3KLSA 3FEWX 1TT2A 4QB4A 4N9TA 4FO2A 5G3LF 1KAAA 1TKYA 1EY4A 1CQFA 5COYA 2DYMA 3TUOA 4K2LA 3KBGA 2BTEA 3X3NA 3AU7A 4IFDJ 4JE3B 5JEAH 3AE8B 1LTID 5JAVA 2JP1A 4DGZA 2SEBD 2A6HD 3BG3A 3X3MA 3M85A 1NR4A 4K5WA 4CKEA 2WXJA 2SNSA 2K6AA 4IUNA 5BYRA 1A3TA 2PCFB 1A3VA 3MHZA 4DK0A 1VMPA 4X3KA 1E2ZA 1G2SA 2G1EA 1JWSD 1STEA 1UAPA 3AV8A 2BS3B 2AX5A 3D31A 3L7ZC 3GTGB 2A68C 5C0XH 1F2LA 2GI9A 4NP5A 1MI0A 2F0VA 5C5MA 3P4SB 1RCVD 3I72A 3LWUA 5BN4A 4BBSB 1CK1A 4WFN3 3G7LA 3UI3A 3IAM1 4G57A 4KTAA 2B2TC 1IHZA 2G9HD 3TEWA 3SK4A 5CBAE 3TP6A 1LO5D 2OEDA 3A56A 2X69A 1XLNA 5T1IA 3AEEB 2BB6A 3Q23A 3NE5B 4CGYB 3I3CA 2B63B 2JZPA 4IUUA 5FO7B 2L32A 5F2DA 1EL0A 5EPKA 5CORA 4A55A 1VCIA 2E75C 1BDOA 1C79A 3VR6A 4H44C 2B2WA 1I3QB 1JB3A 1I4RA 1L0YB 2K7VA 2VZKB 3SFEB 2EY5A 4XYOA 1BNZA 1CQVA 3BK1A 3OSOA 4B0MA 1GUTA 5AFWA 3CQZB 1HXYD 4DAVA 2HUGA 1OXTA 2F0WA 2I2YA 1LT6D 1PTOD 3J7AV 1P7FA 1ENCA 5C3EB 1H9RA 1U9RA 4ZHOA 1GUWA 3CKIB 4FXDA 2EYOA 2XSCA 3AN1A 1TY0A 2KUMA 1B1ZA 1YN3A 1GAQB 4DU9A 3EJIA 1WTVA 4F8MA 4XQQA 3UI2A 2M2LA 4MACA 3A8KE 3W2DA 1RFKA 4N9PA 1A3UA 4L63B 4A3FB 1B53A 1G2TA 2CU3A 1HZ5A 1QG7A 3U9SA 1Q8IA 4R9WA 1R7SA 3A8JE 4A3DB 4RKBA 2EXZA 2O2LD 2JYEA 1EU3A 2EE1A 2EYHA 5C4XB 1T5EA 5FO8B 1FFUA 3SK6A 1IGCA 3J80E 1JMLA 4M1UB 2WV6D 2MH7A 1EM7A 2FFKB 3IAS1 2PIAA 3AE7B 3M7NA 1OXUA 5FR3A 2NZ1D 1TIID 1AZQA 4ZOHC 2WXRA 2INPE 3VRAB 1HHVA 1UEAB 3NUHB 4O42A 3R2TA 1SE3A 3PIP3 2QCPX 3BDOA 1MGSA 1FXAA 1FRDA 2B8GA 2WXFA 2XRQD 2LY7A 1DCZA 3Q8EA 4KKTA 3C46A 1MPEA 3PO0A 3HRZC 4LJZC 1FD7D 1PZID 3JAME 3P42A 1UWXA 1BCPF 1I4GA 1TYGB 4RA8A 4OGQC 2MP1A 5EBDA 1BF4A 4P16A 4TMAB 1FO4A 3RLFA 1KDCA 5JEAJ 2M0AA 4XWTA 1I6HB 1TS2A 5CV5A 1YN5A 5FOBB 3HVZA 1C9FA 2BDNA 2C9OA 5M5YB 1QOGA 4KX6B 5C2TB 1P7EA 2TMPA 1SF0A 1F9SA 3MFGA 1Y1WB 2VXWA 4J3OD 1HFNA 2VB3X 2MJ3A 2CVRA 1PDXA 2WXGA 3KLRA 3K5MA 3TN2A 3R93A 4RHSA 2ZXPA 5C0XJ 1Z7TA 3H6MA 4XT1B 4NAWB 4MH8A 2F0EA 2J42A 2LFIA 2PZTA 1V1PB 3PUVA 3I73A 4IALA 3LX0A 1QILA 2F0DA 4QIWB 3B2FA 3MZ5A 2KJXA 4WORA 3CU7A 1WCMB 1NEKB 1S5DD 1JOOA 2HCCA 1F2ZA 3RUZA 1SB3C 1B9MA 1QF6A 2XNAC 1WTWA 1Q10A 2XIWA 1T6BX 2QJLA 1BR9A 5IIFA 1J9OA 3DWMA 3V05A 3A54A 2LMCA 1XXGA 3LWEA 3U2SC 5EKKA 1FR3A 1TU2B 1YQ4B 1AZPA 2X6GA 3C1FA 1N63A 5I6WA 4N58A 4HKQA 1ZDVA 4S3SA 4KHZA 4JPSA 4ITKA 2F0IA 2CW0D 1CZGA 1NYQA 3GTMB 1XCTL 3ND8A 1J7AA 4IDIA 4L2YA 4ULLA 4ME5A 2L12A 3SXHA 2X38A 3RZOB 5BMHA 3BDLA 5KYLA 1D5ZC 4RFBA 1Y69U 5JPMC 2EYFA 1K83B 4U673 2D5GA 4KK7A 4FYDA 1BUVT 4PQXA 2D2CC 1AP0A 2A68D 1K51A 2RMMA 4G7OC 2L1AA 4US8A 1J8IA 3FKIB 1EWCA 1SJHD 1VLBA 2JXTA 1MSHA 1W6KA 3TEXA 2IT1A 1X3PA 4OIKA 2WP9B 2JA8B 5IODA 2M19A 3J7AF 2CHBD 3P4PB 1DOLA 1LTSD 1SNQA 1ILQA 2QF7A 5CYUA 2E2JB 1N62A 1TY2A 3PUZA 4IQZA 2B2VC 3AE6B 1V1OA 2B2YC 5JVH3 3DEOA 3E0JA 1R4QB 4DAYA 4ZKCB 1PTOF 2I38A 1WYGA 2F0UA 3MA2B 3BK2A 2NBFA 2N7JA 1RDPD 3K6OA 2R3ZA 3SVMA 2QILA 3AEGB 1LTRD 2JYOA 3DXJC 1UGJA 1BO0A 4EQNA 4X3SA 5IOCA 1XYIA 3ZJUA 1ZYRC 1K8MA 4NDXA 3I4MB 1ZXTA 1STGA 1JW9D 1L4DB 1HZ6A 2KCCA 3AE9B 3BYTB 3NK9A 1S5ED 2M56B 3NBIA 1A6XA 1I50B 4DNRB 1ENFA 1CZWA 2V3NA 3Q69A 1BCPB 2A69D 1LTBD 4PT5A 4FXGC 2QKIC 1G6ZA 1PGXA 3NS1A 1DOXA 4KD3A 3I4NB 1PZKD 2L0CA 4AYBB 2EJMA 1HTPA 2W55A 2NTSA 3H0GB 2N9KA 2F0JA 2J52A 1D1IA 5MPOA 2ONQA 2F0FA 4RCOA 2Y0SB 2K32A 1HQRD 4DXFA 1MHXA 1SSNA 2BS2B 2Q8TA 1MI2A 2CQAA 4HCSA 2B2UA 2F0QA 2E3TA 2BA1A 4ABNA 1WGKA 4KGSA 3ND9A 4TRDA 1QQRA 1IL8A 4PV1C 3C3LA 4USAA 4C7YA 3ITPA 5ELBA 1B4OA 4NAMA 1YN4A 1SMYC 2K28A 2DNEA 1E6EB 1KABA 3HVDA 2K01A 4MT5A 1LT5D 2XN9C 5JXVA 1WTOA 5IGEA 2F0OA 3JAML 2K03A 2NVTB 3FRPB 3MAQA 5C4HA 1ET6A 4DXGA 1ZPSA 3O13A 3TBIB 1JWMD 5FK9C 1ROEA 3ABVB 2WS3B 1EY6A 1PRTB 5EE9A 3SEBA 1RD9D 3NHHA 1HPCA 1PFMA 3SE0A 2WXPA 1IUEA 2RVLA 1RKNA 5G5HA 4ZQ3A 3EUB2 4BBRB 5CR3A 1JROA 1AN8A 3MXUA 1NVID 1RTOA 1TS4A 4KGRA 4XXEA 3NUCA 1K52A 1F9QA 4QCLA 2EJGC 2K0PA 1U4LA 2WKCA 4FF3A 4A3EB 2RDGA 3TZUA 3KLSX 1YNTE 2D9UA 3I9V1 2VNUD 1A2TA 4V0BA 4C3JG 2JEAI 3IL8A 3HP3A 2ICIA 2WXKA 1WSPA 2F0PA 3NWTA 1SNMA 2BT6A 3QJYA 1KDAA 1UNSA 2LJIA 1Y8OB 2MJEA 4TQ0A 3S17B 2TSSA 5D3IB 2XVSA 2W54A 3S1NB 2ID0A 3W1SA 2LMCB 4IUTA 5EJWA 3HOZB 2KEEA 3IFTA 1WD1A 3SK8A 1H9KA 3D3RA 4KN7C 5IGDA 3MVVA 1TWAB 4ZHPA 5BYQA 4H13C 4NJCA 4C3HB 3NZ3A 1M8AA 3WOEA 4HROA 1FGBD 2O5JC 1OXXK 3IT6B 2B39A 4XQNA 3E5SA 1STYA 2LEKA 1C4AA 1A15A 2BBCA 5LHY1 1FRRA 2I46A 5DNFA 1CHQD 4ZUIA 1I6VC 2JX5A 3V3XA 4XDDA 1IBXA 3HKZB 1CM9A 3P1HA 4QUCA 5KIXA 5ELFA 3U52E 1QLBB 1JQ4A 3J9CA 1RWSA 3NP8A 2KN4A 2YEPB 2FBWB 1RJTA 1XCQL 5NUCA 5BYSA 2QMTA 2RQXA 3A7LA 2X6LA 3C8YA 2CW0C 2L4NA 1V97A 3A55A 4A9AA 5ELDA 1TZOA 2WACA 1BQQT 3E6ZX 1D6EC 5CGKA 3ZJTA 1JR0D 1B9NA 3L9AX 4YTPB 2M9VA 1QOFA 4A93B 2K9XA 2PKOA 2F0TA 2WXQA 4HTHA 4HKZE 1GUGA 5BN3A 3WCQA 4KY7A 4OHJA 4YWGG 5FO9B 4Q0FA 4R8IA 3C1EA 2BA0A 3EQLC 5BN5A 2KOLA 1SE4A 5I2YA 1JWBD 2DYOA 1L0VB 1PFDA 1TWHB 2MUYA 1J7CA 1KRHA 4IOIE 4L6TB 3NVWA 4AS1A 3LNNA 1GOZA 3S16B 5AUKA 3VYTA 1QT9A 1L4ZB 1CT1D 4ZAIA 3P75A 3V2TA 2KVMA 5KNDA 5HI1A 5EGTA 1ZYRD 3PZ8A 3NVYA 4ZRQA 2MJDA 3P4QB 4UAIA 3OHXC 4V190 4XDCA 2KWDA 1F2MA 3OWFA 2LFNA 3Q6SA 3NRZA 2AQ2B 1JRPA 2WINB 4X3TA 1Q1BA 2XWJB 1SIJA 4K6DA 1DOYA 4YXDB 1I4HA 2Z4HA 3I91A 3AH7A 1SE2A 1I4QA 1JOKA 1TKEA 1NAPA 4JWSC 2W3RA 3U7ZA 2Z4IA 4EE2A 1G291 2IL8A 2NYZD 3VA7A 4NMZA 3IKJA 3Q8FA 1SEBD 3J81E 2K5WA 4B0EA 3Q8CA 1VZ7A 5DAUA 3VR9B 3F2UA 1C48A 1R9TB 1RYJA 1PGAA 4ZKBB 2E76C 3TDQA 2LS01 3NXWA 1Q12A 5CV4A 2NUCA 2K5QA 1SNCA 1J7BA 2EJFC 4EVOA 2PW5A 4NKLA 2NB0A 2A69C 3H09A 3DHQA 4A3GB 1V8QA 1SMYD 2EYMA 4EQOA 3IXSA 3K5NA 3T51B 3H8HA 2H1EA 3PIO3 1VJKA 3ETRA 2EVBA 1EYAA 4YSZB 2JA6B 2K05A 4IN3A 2F0GA 3PUYA 4KI0A 2PVGC 3V96A 1IYVA 3PO2B 1QE6A 3PO3B 1FMAD 3W5UB 1C4QA 2PYKA 3E56A 2J0TD 4DN4M 1STAA 3D6CA 2RSNA 3RFZB 4XQJA 5AUIA 2W3SA 1ZXIA 1HA6A 3T3OA 3MP9A 3K5LA 1C76A 3FC4A 4HJGE 4K5VA 2F0MA 1UWMA 2E2HB 2PQEA 2J4XA 2WP8J 5KEEA 4H0LC 1MSGA 1Y1VB 1I4XA 1LT3D 4PMWA 1WRIA 3ZQ4A 4FF4A 4LAAA 3K59A 4MM3B 2WXIA 1EEFD 1DOMA 1RTNA 5DEHA 4KN4C 4C2MB 1ESRA 2RA4A 3GTJB 1JE4A 1FCLA 3MXGA 3AEFB 3T13A 1GUSA 4F7XA 3QG1A 1YNJD 4R8NA 1E0BA 2WXNA 2MHVA 3H94A 3OW7A 3U9OA 4YSXB 2DBYA 4IUQA 2IGHA 5IGFA 5M3FB 2B2WC 3NWSA 1EQVA 3URYA 1W6JA 3H91A 2VZKD 2WB1B 1TWFB 2KECA 1ZOYB 3GQBA 3I8ZA 4DA2A 1BBXC 1FNUA 3DUZA 4WH4A 1TS3A 3M3YB 3DM1A 3G6JB 3KQ4A 4CQNA 5EPLA 1FD6A 4KJNA 5E4WC 4OO1I 1CJEA 5I4DA 4HAEA 3VR5A 4ZLTF 4TQ1A 5M9OA 5C4ZA 1Q3LA 1OXSC 2WAQB 3BWUD 3HRDD 2EYJA 3AE2B 1WD0A 1PUTA 5CC4A 2K22A 1DXMA 4RGOS 4YTMB 2MGSA 3BS1A 2A74C 3OIQA 2C5CA 1N5WA 4RHRA 1H9MA 5GXGB 1AYFA 1IBXB 4PMCA 4C1NI 1FYCA 2Y5PA 3HOXB 1XLOA 1GUNA 3Q22A 2F03A 3R3OA 1SXTA 2IX3A 1D5MC 4FXKC 2HQEA 4J1MA 3GB1A 1KLUD 3VYUA 4WIPA 3DEPA 5C44B 4QUFA 2IDYA 2DN8A 1Y8PB 4A3KB 3HZXA 1IGDA 4D2KA 1N5XA 3BZDB 4RGTA 2KAJA 1X32A 3AB5A 2QDBA 3S1RB 1C4PA 1WXQA 3S2DB 2RBMA 5ISRA 2WXMA 2B76B 3FPUB 4US9A 4TKOB 4LLGM 1TVXA 4CHTB 4C3IG 1II3A 2F3WA 2ICEC 1WVLA 1YMHE 3HOUB 3HG9A 1YQ3B 1PRTC 2PLPA 4G7HC 1DGJA 4RF1A 4YIJA 2WKDA 1B50A 1IYUA 3VR8B 3BVGA 2WQYB 3E9SA 2FE8A 2EOTA 5J1ZA 1CHPD 1OFFA 3TEYA 1WTQA 4XE0A 4K8IA 1SDFA 4OZAA 1T5XD 1E7PB 1F2RC 1I7HA 2INNE 2SDFA 4K2KA 2LUMA 2BYTA 3P20A 2NVQB 3SDZA 3DMUA 1JCKB 4DNTB 4GZYC 3VQIA 2Z8LA 2XWBB 2F0SA 4DFAA 4FNFA 1VF5C 2O4XA 2NVYB 4PMBA 3J81L 5IT9E 3GTPB 1HQMC 1VMCA 4K8JA 2YU9B 1ZKOA 2HDMA 4IFDI 5A35A 1MD2D 1UUPA 5T1GA 4C56C 1ILPA 1OXVA 4E6IA 4BA2I 2F3VA 5C6AA 4OW0A 1N61A 2J7ZA 5I2XA 5D7GA 5LL6X 2EKIA 3FILA 1QB5D 4I7ZC 1LLRD 5EKIA 1SNPA 2WU5B 3HOVB 1EZ6A 4U68A 1N60A 3QIAA 5DM63 3OMGA 4HR7B 4OVZA 1CA5A 3S9WA 2H89B 1XEEA 5E4XA 2SNMA 4ODGA 1SYCA 1NENB 4OIJA 1STNA 3OWEB 4NZLB 1DZ1A 4FF1A 3T3NA 5EQ0A 2RKSA 1JALA 1HRJA 1EYDA 2E6XA 3I4LA 3KBXA 3EGRA 1L6UA 3OPOA 4XT3B 1MBYA 3NVZA 3CRLC 2EDGA 2JA7B 2SAKA 5I9OA 4HMIA 3TP5A 3R8BA 1LTTD 1PYWD 1XLQA 4K14A 3RZDB 2JSVX 3FPPA 3CHBD 2NN6I 4HN7A 1VR9A 3H3VC 1H9JA 1F9RA 3S2HB 3L3OC 1GB1A 2L1BA 1GJXA 2PPBC 1VRAB 4NW2A 3P1MA 4B9XA 3NTHA 4IUVA 5KGUA 3W5VB 1ICWA 5HURA 1RHPA 2FUG1 3AE4B 2DNCA 1TQOA 2RDHA 4P6VF 3QB3A 3AE3B 4HEA1 4LK1C 4OO1G 2AQ3B 1YJJA 2FMCA 3MXNA 4GDLB 2JQRB 3NTKA 4ID6A 1K8OA 2FHTA 2NMQA 2WLBA 4M0WA 4BS9A 3HEJA 4KV6A 1E2VA 2KMMA 4JWUC 2BE5D 2JXMB 2DY7A 1D5XC 1G91A 1YNJC 3S1QB 2Y5CA 2VUMB 5EPJA 2L5TA 3HS0C 1HUMA 3NQTA 1ZP0B 4DF7A 4BA1I 1OO9B 5FLXL 1E0ZA 1Y8NB 3VYRA 1EEID 1QOBA 1XTCD 2YYZA 1F2YA 2AUKA 3C2PA 4OZCA 3FAHA 5JOBA 3TSSA 4Y7NB 3D4RA 1HA5A 1DM0B 2B2TA 4C80A 5E6JA 4R3DA 1KH0A 5HGTA 5HFYA 4C1NK 4BY7B 1BCPD 4FXCA 3A8IE 1H9SA 3MXPA 3BYYB 3W3AA 1QNKA 3VR3A 4Q5VA 4DQOC 3VYSA 4MHEA 1EY0A 3BVZA 4K6LA 2IGDA 1DOKA 1STHA 3AEBB 2A73B 1BXTA 4C3JB 3PUWA 3NSWA 1A70A 1KTKA 2EYPA 2KQ4X 1Y56A 5BMGA 2B2UC 4XYQA 1I4PA 2ZT9C 3NQIA 1QJOA 1GUOA 1PTOB 1FFVA 2WIIB 2A5HA 1F77A 2F1MA 4X3UA 2K3UA 1SNOA 4JBWA 3MFYA 1HCZA 5CV9A 2O5IC 3AE1B 4WWMA 2WXOA 2QEJC 4I65A 1VDVA 5C4JB 4HRSA 2R93B 3Q0AA 5D3DA 5EBCA 2V4IB 3GTOB 2KCNA 3B2GA 1VF7A 4RWSC 4RF0A 4XTCS 1WWTA 1K53A 3NVVA 1ESFA 4MIUA 4Q2JA 1LV9A 1PRTD 5C0XI 4A3IB 1ZE3D 1DOIA 2FJ2A 1AW7A 1NSNS 4REZA 3M4YA 1SSOA 1TWCB 1ENAA 4A3BB 4H2AA 4CJ2C 4L8JA 5DM73 2WDQB 2M00A 1KDBA 4XWWA 1VZ6A 1FM0D 2GA4B 1TKGA