1CK1A

Structure of staphylococcal enterotoxin c3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENTEROTOXIN TYPE C-3)
publication title Zinc-mediated dimerization and its effect on activity and conformation of staphylococcal enterotoxin type C.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ck1A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ck1A02
2XRQD 1RDPD 2TSSA 1L0XB 1F77A 1PZJD 2Z8LA 1V1PA 1PRTC 1CQVA 1B44D 1LLRD 1TS4A 4OHJA 1PTOF 1JWUD 1S5ED 2G9HD 1EFID 2RDHA 3MC0B 4RFBA 4RGNA 3R2TA 1MD2D 1BCPF 3BVZA 3BZDB 5ELCA 2ICIA 2QILA 1D5XC 2AQ1B 1ET6A 1LTTD 1SBBB 1KLGD 3BVMA 3URYA 1CT1D 2NTTA 3SEBA 4RGOS 1FD7D 1STEA 3W2DA 1SJED 2AQ3B 2QEJC 1LTRD 3TSSA 1RCVD 1PRTD 3KLSX 1JQYD 1EU3A 2XN9C 2XNAC 1BCPC 5ELBA 1FNVA 1D5ZC 1QILA 4TSSA 1I4XA 4ZYSA 2XRSD 1HQRD 1S5BD 3DWAA 3EFXD 2IPKD 1SE2A 1PZID 3DWQA 1D5MC 2O2LD 3BYTB 1RF2D 4RCOA 1FNUA 5ELEA 1SXTA 4RGMA 4L63B 1TY0A 4RHRA 4DXFA 1UUPA 1LTBD 1PYWD 1BCPB 3R8BA 4RHSA 1LTID 1I4PA 1EU4A 1YN3A 5D3DA 1PTOC 1HA5A 2R61A 1EEID 1I4RA 1M4VA 1PTOH 1PZKD 3O13A 1S5FD 1KTKA 2NTSA 2WV6D 1YN5A 1AW7A 1GOZA 1L0YB 1ESFA 3EA6A 1LT4D 1FGBD 1ENFA 1RD9D 2IJ0A 4DXGA 1KLUD 5FKAC 5D3IB 1LTAD 1LO5D 3GP7A 5I4DA 1JR0D 3MFGA 1YN4A 1T5XD 1PRTF 2SEBD 1I4HA 1LT6D 1TS3A 1FNWA 1JWSD 1G8ZD 1I4QA 1PTOB 1BCPD 4Z9CB 1AN8A 1TY2A 2CHBD 1DYQA 1LTSD 1S5DD 1HTLD 1XTCD 1LT3D 3CHBD 1SEBD 1ET9A 4BWGB 4RH6A 4C56C 1D6EC 1SE4A 3OWEB 5TSSA 1SE3A 3BVGA 1V1PB 1LT5D 1TS5A 1S5CD 1TS2A 4NZLB 3V05A 1HXYD 1CHQD 1XXGA 5FK9C 4RGTA 1EEFD 3R2IA 2J4XA 1DJRD 1JCKB 1V1OA 1UNSA 1CK1A 1B1ZA 1BXTA 1LTGD 1PTOD 5ELDA 4UDUC 1I4GA 1CHPD 4L6TB 3DWPA 2AQ2B 5ELFA 1SJHD 2RDGA 1EWCA 3BYYB 1JWMD 1PRTB 4K6LA 4O1NA
chains in the Genus database with same CATH superfamily
3IT4B 4B95A 2GVBA 1MIUA 1O7IA 4GKKL 1SNOA 4IUUA 4WRDA 2JA7H 1GAQB 2F0NA 1GC7A 2BGFA 4EQPA 2UXBQ 3MJ5A 1E2WA 4AWJA 2A69D 2ZTDA 1TS4A 4DK6C 3TUOA 1JWUD 1Q12A 2KQ3A 3E5SA 2LJ5A 3AE2B 1QG7A 4PV1C 3G4SA 2F0HA 2F0QA 4WWMA 3NUHB 4LAAA 3T16A 3A55A 4HLEA 2VB2X 2N7DA 3U58A 2Z0SA 4RM8A 3S14H 1WX8A 3I4NH 2BF8B 3CC7A 4X64Q 3MAQA 4G0NB 1BCPC 1HNXQ 1HR0L 2Q2TA 4TSSA 5IE8A 4JGHB 3W5VB 2F03A 3OOCA 4A3LH 1K8OA 3DOWA 4BKGA 1BBXC 3PO2H 2RF4A 3AQQA 2HJ1A 3OAWA 4DUZQ 2MJ8A 1N36Q 4HPLB 1O80A 4AJWA 4MJSB 4FULA 3EHVA 2WIIB 3U9OA 3SR6A 2ZPYA 4JBKA 3T51B 3OJ3A 2EYOA 2I46A 1QE6A 2XSCA 1QCBD 2KMAA 1WZ0A 1FD6A 1J5EL 1FYCA 3F1ZA 2O5JC 3KLWA 4IFDH 1N60A 3A0JA 3RNAC 2JU6X 4XZ4A 3GO5A 4XYCA 3CSFA 1KOTA 3ZNID 1YOVB 4L2YA 1UWXA 2E2HB 2Z0EB 3EA6A 1T0QC 5GAEC 1FGBD 3PO3G 3L0OA 2CJOA 2L0TA 4RKLA 2ZTCA 1RD9D 4DR6Q 2E6XA 2QJLA 3L13A 3VTUA 4EVOA 4LUVA 3NELA 2LUMA 3ZGZA 2RMMA 4KGSA 3H9DA 1VZ7A 2JEBI 3K7AB 1CKNB 4Y7NH 2PE6B 3KJOA 1FJGQ 4LFBL 1MKHA 1FL0A 2UXDQ 3NVWA 4XYQA 1FVIA 1N62A 5C4JH 1E9MA 3L08A 3D4DA 4GLVB 2K3UA 2JA6H 2DNEA 4ICVA 3E56A 2F4IA 1J9OA 1VQ6A 1O7LA 1C1YB 2FE8A 5TR5A 4YWLA 2PO4A 2F4VL 2KC2A 2L52A 2Q2HA 4LUOA 3QA8A 1NE3A 2TMPA 4ABNA 1WY8A 2KN5A 5AUIA 1TWFH 3UE0A 4PZ8A 4JI7Q 1TU2B 1QZGA 3HEJA 1M90C 2EYMA 2CH4A 1C0AA 4R4CA 1IBMQ 3VUWA 4YCVA 1V1OA 3NE5B 5KEEA 3PF4A 2B8GA 3S1NB 1XMQL 1L6UA 2KEEA 3APCA 4HEA1 1HPCA 1Y1WG 1QOGA 4I6PA 4BZAA 5A2QL 1RM6C 5IWAL 3I3CA 2M9VA 4P7IA 4M02A 2PTLA 1U4PA 3MXNA 2HD5B 2NPTB 2F0JA 1EWCA 1KDCA 3TZUA 5BMGA 3EBEA 1V49A 2B63G 3T9LA 2QCZA 1TIID 4IW0A 4X62L 1KQSA 4ARCA 2TSSA 3A4RA 2WLBA 5M3MH 3V3XA 2LXAA 2JRHA 1F9RA 3UDFA 4K81A 3RT3B 4OO1I 4OO1H 2CU1A 4ANXA 2K0PA 2F1MA 3MC0B 3T8MA 1RL2A 1B53A 3ZDMC 5J3BA 3CW2C 1VMCA 3Q8AA 4ACFA 5DAUA 4MACA 2F0WA 3M7GA 2UUBQ 4AH6A 5A35A 1Y1VH 5C44H 3MXPA 2L8JA 4QGUA 3I4MB 1X3PA 4IURA 3U7ZA 3AXCA 1MPEA 3PTFC 1EU3A 1YZ6A 2XN9C 2R7ZB 2ZNVC 5BYRA 2G1EA 1W6JA 2AMCB 5J17A 1D5ZC 4A3FH 4A3EH 4LF9L 3MXGA 4LW1A 3ZIMA 4ZRPA 1FCLA 1DCZA 1NBWA 4DV7Q 3ONAB 4DAPA 2JE6I 3EC8A 2D3AA 1TWAB 4I6NB 4LJOB 4A3GH 1IBLQ 4RCOA 2EJMA 3DWMA 2PNHA 3GZNI 5IOCA 3HFZB 1G6PA 1WSPA 2WXPA 1SRUA 2Q8RE 5AZFA 2BOSA 2LRUA 2NVTH 4CJ2C 2ZW1A 3A9KA 5M5YH 1PV4A 1MHHE 2ACZB 5KHOA 1V80A 1EEID 4ITKA 1NBFC 1RYJA 2KFKA 1L1OB 4HR7B 3RCZA 4JI8L 2G3QB 2KN4A 3AE6B 5LMNL 4QMGA 1STYA 2QC8A 1YNTE 2UYZB 3W3AA 1RJTA 3A4SC 3ZRFA 3P63A 3AU4A 2VUMB 1NUCA 2MWSB 4F87A 4B3SQ 1I50B 1PGXA 4ZHPA 3UDGA 2K5QA 3ERSX 3I9V1 1T5XD 3GTLB 2LGIA 4C3IG 2HDMA 5C4XG 4X64L 4C4VB 1JWSD 1RKNA 1MI0A 1E6EB 3DMUA 3NQTA 2LMCA 3C8YA 3DBRI 4GOCA 1STHA 3KDFB 2LD9A 2KOXA 2K05A 3C1FA 3EJIA 5I9OA 3ML8A 1ZKOA 5COYA 3K59A 1VQBA 3GB1A 3VFKA 4HKQA 1EFWA 4X65Q 3SD5A 3NWTA 1HQMC 2O2VA 4M1UB 2M8SA 4A90A 5C0XJ 5KNCA 4JI2L 2KDEB 1WCMB 1WXAA 4JK1C 1CKMA 1PGAA 1ZKHA 2EJFC 1XXGA 2GBJA 3GTOH 2PLPA 5FR3A 5H8YE 3ZW3A 4FF4A 2J4XA 3W5OA 3IG3A 3SHLA 3M3YH 4DR5Q 1AZPA 5M5WH 3MJWA 1ESRA 1N63A 2VQEQ 1A2TA 1V5OA 2L1AA 2N4FA 3RD4A 3RLOA 3AEFB 4REZA 2KHSA 2JYEA 2KDIA 3RZDH 4WIPA 4LFAL 4ZOHC 4GU2A 2I5MX 2PMVA 4DUYQ 1HEZE 4K0KL 4EQNA 1YJJA 3NP8A 2E3TA 4LNNA 4ANVA 4N9F4 3RZWC 4DAYB 2L0CA 2E5LL 4MT5A 3CPWA 5EKIA 5FO9B 2BS4B 4AUQC 4K5VA 2MQJA 2KJRA 3HOXH 4YWGG 2BE5D 1J7BA 2FNJB 4M0WB 3V2TA 4J15A 2Y5PA 4ZCKA 4EQ5A 5KYIA 1CJEA 3MVVA 2H88B 2J0JA 4BA2I 5J39A 2C7NB 1C9FA 1JORA 2L5TA 4KLKA 4IPCA 1FFUA 1T5EA 2L76A 2V9HA 3K7UC 3VYUA 2JN4A 4X3SA 2CQAA 1YNND 3BZCA 3AEAB 2JXXA 2EMTA 3F2BA 1I3QB 1QUQA 4LNOA 4XWTA 2F0SA 3KH0A 3S2HH 4JOIC 2LHEA 4C7ZA 2OEOA 2DNCA 3BZKA 3DWQA 2WGSA 5C0XH 2HDEA 2NS5A 2UXCL 4FLHA 4GNXB 2UUAL 1GXDC 2L9HA 1N33Q 4A3BH 2OTLA 2KEDA 4YTNB 2RHSB 4GOPA 5JZEB 2XEWA 4A3JB 1QOBA 5CBAE 3S9WA 3H94A 1YD8U 3VR9B 4BY7H 4DV1Q 4OONA 4KHPQ 3H91A 4IM3A 4X57B 3P4PB 3ZJUA 5E3FA 1B9RA 1I4PA 2KDMA 5KHQA 4F7XA 4JOIA 2Y0SG 1PTOC 4LF7L 1T6BX 4J6HA 4E3CA 2PMZB 1Q8IA 2JK8A 1L0VB 4OXPA 4C1NI 1R4MB 1WVLA 4D2KA 3P4SB 1G291 4R4QA 4LNIA 3GQBA 1EYCA 2QKIC 1ESFA 4K3CA 3U4EG 5G55A 1QOFA 1OXVA 2UUBL 4A3DH 1D1KA 3NQIA 3GTGB 3D6CA 3AH7A 5D7GA 2EXDA 1XPUA 3RUZA 5IYCH 5GAHC 2WFWA 1G6JA 4JI6Q 2ZW0A 3OSOA 1C7YA 3UI2A 4C3JH 3S17B 1N32Q 1WXSA 4LMQD 4B3MQ 3PF5A 3RNBC 1XTCD 4EKUA 4TUUA 4KVGB 3P4RB 2MO0A 2PZTA 5KIXA 4BWGB 2OHFA 3DHIC 3U4VA 2C5CA 4KZCA 3TP7A 4GDKA 4DDID 2QDFA 2LFIA 4GDLA 4MH8A 3RZOB 1Q46A 2KHWB 4CQNA 2Y0SE 1F2ZA 3CCLA 4NZLB 4DV3L 4LFCL 4X6AH 1V9JA 2L3ZA 2WDQB 4RGTA 4Q2JA 2LZ6A 1VQ9A 4OWWB 1J6QA 1BBWA 3BK1A 1IYUA 5CX3A 4A3MB 4NY0A 3K81C 1B9NA 3CP0A 3DUZA 3NUCA 5GROA 4DKAC 2CCZA 2N7JA 3OLMD 1EUVB 3K5NA 3M4YA 2GMIC 1SN8A 1HUMA 3ITPA 2IGDA 3FKIB 5JVH3 2NCNA 3HRDD 4KSKC 4HJ7A 1EF5A 1QNKA 2A1AA 2B2WC 3PSEB 1H9SA 3S16H 2XK5A 1PRTB 4K8JA 2CWPA 1D7QA 5EE3A 3S24A 2V3PA 4NXMQ 1R9TB 2XRQD 5IGCA 2MO1A 1X55A 2G9DA 4FF1A 1Z47A 1DXMA 5IYBG 3S1RH 2CKHB 2K25A 2A6ED 2PE9A 2XBBC 3MHSD 4TQUS 4XT1B 3JSVB 3SFDB 1CQVA 1QZEA 4CKCA 3S2AA 2L7RA 4ANUA 2ZXPA 3Q3MC 1Y69U 1E8XA 4JBJA 5DPSA 2KBNA 1D8LA 2PNRC 1KJTA 1WIAA 2QILA 3OMCA 4DV2L 1ET6A 1WMHA 2IO1B 4JI4L 1V81A 3AN1A 3SEBA 1CZGA 2B2WA 2MH7A 4X3TA 4WQOB 4ZRIA 4BXXH 3UINB 4DV5L 2H4OA 2LEKA 3TSSA 4X65L 3WOFA 1UH6A 4HDOA 2K03A 2LSSA 4OIKA 1I35A 1PRTD 4C3HB 3KLSX 3J81L 2JA8B 3K5LA 2NN6G 3P20A 2R93G 5J1ZA 2R2QA 4NAWB 3HOWB 4HJ8A 2JRIB 2N0SB 1KDBA 3H15A 3SU8X 3ZNGC 4L8JA 4IN3A 2EE1A 1B2TA 4JX1C 1A63A 1WR1A 4A6QA 1CZPA 5NUCA 3UDIA 2QEXA 4N8FA 4R9WA 2WXRA 2R92B 3RNFC 4RM9A 2Y3AA 4C00A 4HIMA 3NPPA 3QR8A 2KENA 1OTCA 1WE7A 3NVZA 2YU9B 2BA0A 1UELA 2GBKA 2WXOA 3QCAA 2HD3A 3MXUA 2KAJA 2ASBA 1QJOA 4RHSA 3M62B 4TMAB 3Q8CA 2KDFB 1BUIC 5E4XA 1K3RA 2BPSA 1F2MA 3HOUB 1BDOA 2OQKA 1LACA 1WI5A 3X23A 4RF0A 4P73A 4A76A 2DJGC 3V60A 4DQOC 2B2TC 2K32A 1YN5A 4HJKA 2GBNA 3CRLC 1UBQA 4KIKA 1EY9A 1X3GA 1WTWA 5BYSA 1TZOA 2JA7G 3ALBA 1CQFA 3T1YQ 2AYOB 1Y8OB 2KUMA 2YYZA 4FXDA 2F3VA 2MA9B 4XQJA 3AEBB 2NBFA 1GB4A 4FJYA 1WTQA 1KC8C 1PFBA 1FR3A 2ES2A 3AB5A 1AYFA 2KYWA 1PRTF 3CMAA 4A55A 4KSLC 4IUPA 4X66L 1FNWA 3I90A 1Q86C 2X6LA 4GZYC 2IGHA 3SHQA 1AN8A 4N58A 4LF8L 5J18A 3NWSA 2O6VA 1LYLA 2OOBB 4ODGA 3VYRA 1ONLA 3K9PB 5IT9c 3S1QB 2BB6A 2D5GA 4JL9A 4FP5D 4WWPA 4MN3A 3QWNA 4YL8A 2JA5H 5FO8B 3HOZH 3H3VI 3I4NG 3NG0A 1YIWA 3S2DH 4DR4L 2KA7A 1P16A 2J0TD 5EPJA 1VCBA 4A3LG 2MP2B 3W1BA 3PO2G 3EIVA 1WJ6A 1TJEA 5EE9A 2Z59B 4WJ3M 1E3PA 1ZYRC 5FLXL 2VQFL 2IDYA 4PQXA 1EY5A 2OT2A 3L7ZC 4PZ6A 1WWTA 2GA4B 4OVUA 2PZUA 1SJHD 1E8WA 4A4IA 3PVLA 3KK7A 2Z8LA 1A6XA 4JI3L 3MA2B 4G7HC 3UQBA 1WTVA 1HR0W 3Q3FA 2EOTA 2BYEA 2DWQA 1UE1A 2WINB 4IFDG 4JYAL 3Q8EA 1A2UA 2KD0A 1N61A 1G91A 1NMFA 1I7HA 2XVSA 1KRHA 2KWDA 4GN4B 4TVAB 3FVQA 2F0FA 4XWWA 4KKSA 1I6VC 1U9RA 4RFBA 3RMHA 4DGZA 4P6VF 2W3RA 4MSMB 1HUNA 3BVZA 2ZXRA 4KJNA 3BIID 2AQ1B 3JAME 4XE0A 3VTVA 5G3LD 3T56B 1MJEA 2KHIA 1VZ8A 2F0TA 1S3SG 1FD7D 1VS0A 5FLMH 1XLNA 1EQRA 2B2VC 3PO3B 2IGGA 1LTRD 3UDXA 2F0IA 2JVCA 1TGZB 3OW7A 5D94A 2OQ0A 4GMVA 3C0RB 3VDYA 4DR1L 2DLBA 3TCAA 4OL7A 4II3B 4KKIA 1S1QB 3GTJH 2L11A 2JA6G 4XGAB 2XRSD 5M3FH 3NEMA 3VR3A 1S40A 2UUCQ 1WFQA 3A8JE 2J7QB 1Y56A 3AE8B 4FDBA 3GDEA 1EF1A 2MW5A 1RTOA 5GADC 1PZID 2B2YA 3GV6A 3NZSA 1NNXA 1JE5A 2FXQA 2HIXA 4QL5A 4HIDA 2J7ZA 4ZAIA 4HCEA 5ELEA 4W9IA 2LY7A 2AHOB 3KUPA 1TWHH 2D11A 3N52A 4HXDA 4K8IA 2FCSA 4V0BA 1PFDA 1CSQA 4JVZA 4CDEC 1W2BA 3X0WA 3TEZA 4LNFA 1JALA 3TIXA 2DY7A 2OWOA 4XDCA 1HA5A 1NMGA 1M4VA 1I94Q 3I2ZA 3O13A 4JI1L 4JCVE 1KTKA 3CF6E 3NSWA 1TWGH 3B08A 2A73B 4C1NK 1Y1WB 1KABA 3HG9A 2NVXH 1P0RA 2A19A 2N78A 4U673 3LXFA 1EQVA 1WD0A 1TKGA 5G3LF 2HQLA 1IL2A 1WM2A 1XLQA 4DXAB 2L83A 5M3MG 3P42A 2FHTA 1LTLA 5BR8L 2B63B 1SGHA 1VR9A 4OO1G 1YN4A 1XNRQ 3I7FA 1VQJA 3T1HL 4C2MH 3CCSA 1Y8RC 2WXIA 3DBHB 1F9PA 1HA6A 4BKTA 1X32A 1JMCA 1F1HA 3PIP3 1EY8A 1Y1VG 4JE3B 4DHJB 5C44G 3J80L 1LABA 3WCQA 1VF7A 3DXJC 4K7SA 1AEXA 2FCQA 2NVUI 2R7DA 1SE4A 2KHJA 4E6IA 5AJ3Q 3K58A 1I6HB 1AFPA 1C4CA 3A1QA 3HM3A 2F0DA 4WWOA 4B0EA 4G3XB 2XWJB 4CHKA 1T9HA 4A3FG 4A3EG 3U30A 4NNJB 4AQ7A 5F2DA 1K8RB 2V3SA 3PZ7A 2ENBA 4JBMA 2A5HA 2RCFA 1GVPA 4A3GG 3TEXA 4DR7L 5IP9H 1R4PB 1HCZA 4G57A 2CR5A 2V0GA 4EOYA 2C35B 4BBRH 5IN7A 1X3FA 2L12A 4DHJD 4W9HA 4LK0M 2WDRB 5DLQE 4RGNA 2L32A 4FXCA 1ACCA 4PNYA 5JEAJ 4K6DA 1PHJA 2PZWA 3IAYA 1KH0A 1XNQQ 1WJ4A 4IKGA 1AP0A 1VZ6A 4YY3Q 4MDKE 2C5LC 1VJKA 1SYCA 3KVFB 3BG3A 4RA8A 1NSNS 2VL6A 4CDCC 4DF7A 3LNNA 2G9HD 1EFID 3PLUA 4WWNA 3B2GA 2K22A 1HH2P 2K8CA 3S15H 4MGYE 2HDLA 4UP7A 1HRJA 1PYBA 4HTHA 2HHHQ 2B76B 3RR5A 4GGQA 1YEZA 2KQ7A 3MC9A 3UGBB 5CHFA 4KY5A 2F0VA 1NAPA 1HFNA 1FEHA 1ZW7A 3KJPA 1SYFA 2R7FA 3CD6A 1SROA 1MJDA 2L0FA 3RNUA 1P7FA 2Y5CA 3U7DA 4HDQA 4Y52H 2D0OA 2ZM6Q 2GLSA 2K8HA 2XNAC 1Q5WB 3M95A 1B3AA 5CV9A 2LI5A 3ZNHB 5I9PA 4C3IB 4XT3B 4JWSC 5C4XB 3WALA 5LMNW 1YNJD 1OQQA 1E22A 1S5BD 4MZ9A 1OQYA 4JLCA 1Q10A 3RD2A 4NMZA 2JJQA 3A56A 1FFVA 1RF2D 4BS9A 4JC0A 1Z7TA 3GTMH 4DR3Q 4WJWA 4YIJA 4ICUA 4AIMA 2WB1G 5GXGB 3ZO5B 1N9WA 1TWCB 3NOBA 2IW3A 2KWVB 2DENB 3VTWA 1C4QA 4R4OA 3FRPB 2RBMA 3M4OH 1FPYA 3PRZA 4JW0A 3GTQB 1ROEA 1IW7D 3PSIA 5CV5A 4OX9Q 2JSVX 5EDSA 2R61A 1VQAA 2CFMA 2NBUA 1PTOH 2ON8A 1NR2A 5JJLA 4IALA 1ZPSA 2CH4W 2NTSA 3HOVH 3CCRA 2N7EA 3AMZA 5IP4D 3TDQA 2EYHA 5JPNC 5JEAH 5EPKA 1LT4D 1L4DB 1PGBA 1IGDA 2BVCA 4HIKA 3C1EA 3PUXA 3F2UA 1IP9A 5D3IB 1SSOA 2GOWA 3J9CA 4AQYQ 1GM5A 1VQHA 3EECA 1FCCC 3MFGA 2FIDA 2M4NA 5IGEA 4NQKE 3HOXG 3ZTDA 3ZJTA 1EY4A 1EOTA 1F9SA 2JT4B 4WJPA 3QO2A 3KF8A 5IIFA 4DDGD 4K2LA 4LF6L 3MXNB 4FXGC 2NMQA 2R2OA 3UIPB 4KHZA 3SXHA 2WB1E 2RPVA 4G11A 2RSNA 3QWZB 2XTIA 3PQIA 2MQHA 2MBQA 4Q0FA 1E8YA 4MHEA 2K50A 1IHZA 2GRIA 1IL8A 3U52E 3B1LX 1T0RC 1J0GA 1VLBA 4DV0Q 2B29A 1MG4A 5E7NA 1HNZQ 1EZ6A 2CHWA 2I38A 1TTNA 3SR1A 5E6OA 2D3BA 2BWES 2K6QA 4RMAA 1XWEA 2AL6A 2IL8A 1KAWA 2FFKB 3CIRB 1TKWB 1UF0A 2H89B 5C0XG 1V1QA 2PQAA 2LHDA 2K01A 3CMMB 3JYUA 3QB3A 1QVGA 2K8BA 3GOEA 4A3BG 2KC1A 2KQ4X 3ABVB 1LM8B 4HPPA 5I6YA 1HTOA 3PREA 4PYUA 4F1SA 2RDGA 1YX6B 3QAQA 3HRZC 1NJIC 4BY7G 4IOAA 1L0WA 4P1CC 4DV6Q 5CTRC 1KAAA 1VCIA 3GV3A 5IGBA 3R3MA 4GS3A 3H3VC 2K5NA 2CHXA 3VR8B 3GTPH 1I5FA 2INDC 1ZP0B 1LLRD 4OHJA 3CQZB 4XDDA 4ZDVA 5BMHA 1X3EA 2F0LA 4HAEA 4ARIA 2Y0SB 1EL0A 1SMYD 2RPQA 1N5XA 4JPSA 3UI3A 2EDGA 1AZQA 3OIPA 4A3DG 4XQNA 5K36H 1EM7A 3QQ8B 4WJNA 3SK4A 3FMCA 4I7ZC 4W9DA 1QOHA 4J6IA 3I56A 3VRAB 1HTPA 5L37A 2ZNVB 3A9KB 2K7VA 5IYCG 5M5XB 4PYZA 2K5WA 4X3UA 2LXJA 2LS01 5C2TB 5T8IA 2NYZD 3AU7A 4C3JG 2G5DA 3D4WA 1U4LA 3GTKH 1F2YA 1UBIA 1DOLA 2ZXOA 1IKMA 1AH9A 1ASYA 2KFKB 4HK2A 5ELBA 2RR9A 4IG7B 1QILA 5CHWA 4DNTB 4IWOA 2JF5A 2KTRA 1HQRD 1GUTA 1Q1EA 2D2QA 1MGSA 3DVGX 1E5WA 1PH8A 1DOYA 2DUDA 2H5XA 2DYBA 1F52A 3J7AF 1SIJA 3HP3A 3ZRCA 1E0BA 2BTEA 4YHHL 5HY6A 1RAXA 1CMXB 4K7UA 3K0YA 1C79A 1FNUA 3BJUA 4A20A 3OG5A 1JOOA 1SXTA 1JJ2A 1H9KA 3VR5A 2QCPX 2E2IH 3A9JA 3FILA 2KLCA 4ZUIA 3IVFA 2W9NA 2LMCB 3G6JB 1RFAA 3R8BA 3Q8DA 3A5ZB 1NR4A 1P1AA 1WGDA 1EYDA 1VQCA 1GUGA 4A3IH 3LX0A 2Q2UA 5HKHA 3K57A 4HROA 2HIVA 3QJYA 4KTAA 3ER0A 3TEHB 3UE1A 3S1MH 4IUMB 4A3PA 5GMVA 2O2VB 4DWFA 3RYTA 2BB5A 1AW7A 2OF1A 4A3KH 4GKJQ 1MHXA 3W1YA 1TQOA 2AKWB 3I57A 2I5LX 4ZK9B 4B3RQ 1K83H 1JW9D 2F52A 1OXUA 3A74A 4QAYA 4DHZE 1XLPA 3NHHA 1JJCB 5IY0A 3AEGB 3K6OA 1G51A 3CCVA 3TRZA 4NJ6A 5A2QE 4G50A 3TP6A 4YWMA 1EIYB 3OWFA 3CXCA 3NZUA 4BXXG 2UXBL 2D10A 4GN5A 4DN4M 3Q69A 4C56C 4FF2A 5H1SE 3H6MA 3VVWB 3H7SA 4IDIA 2SDFA 2N9PC 4CO7A 2BS3B 2V1CC 5KNDA 1DGSA 4DR2Q 1E7UA 2B3GA 3RN2A 2JUOA 2RDBC 3LGJA 1CHQD 1F2RI 1LQBA 5BMIA 3MP9A 1GJXA 1SSNA 2MLBA 2M0XA 1DJRD 3WDNA 2R93B 3UF8A 4A9AA 1C9OA 2JX5A 3AU5A 1PXUA 2PW7A 3ZVVA 1NENB 3I55A 2BKRB 2WXGA 5C23A 1SR3A 2IHFA 3U50C 2CW0D 3A7LA 4DA2A 2LGYA 1HNXL 1CA5A 4G4KA 3J81j 1V5TA 4DK1A 4DAMA 5JHAA 4O1NA 2NVYH 1SFOH 2E76C 1QUQB 4DUZL 1RDPD 2F3WA 1ENAA 1N36L 1L0XB 1F77A 1SNQA 2KECA 3HKZG 1V1PA 2A6HD 2K5VA 4U68A 2KJ6A 5DM63 4NPSA 1R4QB 2HCIA 3EVQA 1RWSA 2RDHA 4FADA 1OXTA 2N49A 4CKEA 5M9OA 1XX8A 1WX9A 3WANA 1IBKQ 1D5XC 4KV6A 4GOPB 1YMHE 2FBWB 5EAYA 4DK3C 4J1MA 4ZLTF 1Q81C 3DDCB 3QHTA 3N30A 5LXIB 1GC6A 2LWPA 2PEAA 1E0ZA 2JA7B 3TBLD 3PLVA 4F8MA 3PZ8A 1F9JA 2IT1A 3OHXC 4BBSH 1TXYA 2EPBA 2N88A 1WJNA 1UD7A 2GN5A 5IODA 4DR6L 4TV3A 4FBJB 2WP9B 3B6YA 3M63B 5KYLA 1VQ8A 1LGRA 3DWAA 2I5HA 3ZXRA 1YJWA 3N6RA 1YVCA 1FO4A 1SE2A 2JA5G 4Q5VA 3HOZG 2RKSA 1ZE3D 3VA7A 5IGDA 1A8VA 4BY1H 1FJGL 3APFA 3JW0X 3VUXA 2UXDL 1X9NA 3HKZE 1VQPA 4JWUC 3ZKJC 2A68C 4P71A 3WOEA 3S14B 1WYWB 3I4NB 3RUIB 2M2LA 2K52A 1WJUA 3FHWA 4W9FA 2N9XA 5E6PA 5AZHA 3HZXA 2EMSA 2M00A 3H1UA 4RCNA 2E2JH 2WYQA 1LTID 2VRRB 5DPTA 1EU4A 1A3TA 5D3DA 3PO2B 3X3MA 4JI7L 3HUIA 1AE3A 4WORA 4GDKB 4GDLB 2YTYA 1IBML 2NR2A 1V43A 4LF5Q 1WYDA 1AWDA 3J7ZC 3DM1A 3TREA 3B2FA 3RN9C 1H9RA 1LTAD 2Q2IA 5CYUA 2D3CA 3G7LA 1E90A 5E1FA 1ZGUB 1PFMA 3STBD 1LT6D 4RG1A 4PG3A 4KMUC 2MP1A 4DK0A 1G8ZD 4JI5Q 5K5PA 1S5DD 2P5ZX 3A8IE 2JZ3B 2KQSA 2MHJA 1PDQA 3KUDB 1CFMA 4OVZA 1AARA 5FLMG 2XK5B 5C3EH 1WGYA 3SFEB 4XX5A 3ZQ4A 4MM3A 4UP9A 3BK2A 3BVGA 3P75A 1YNNC 1GUSA 4IQZA 5J22A 2MNAA 2WX1A 1S5CD 3JAMi 2NZOA 4B9XA 3SDLC 1ENCA 2JY6A 2KK8A 4CHTB 4Y7NB 1PMRA 5M3FG 3BY4B 1SAPA 5T1IA 4WJ4A 4O0AA 4B3TQ 2BT6A 1Q0WB 5C4JB 1WMHB 4R8IA 4BBNC 1WRIA 1SIFA 1KLVA 2JA6B 4H44C 1JRPA 2CVRA 2JP1A 2FCMA 4AOFA 4LF4Q 5ISRA 5EE0A 3D8GA 2AQ2B 4DAVA 4UHVA 1TWFB 4DV7L 1MSHA 3PZDA 4K6LA 3Q6SA 2L00B 4XC2A 4MIUA 4HCSA 2ATWA 1NI3A 1ZEQX 1KNAA 3I70A 4K14A 1PH4A 4WAFA 1IBLL 2DJFC 5AZGA 1K3BC 4QQBX 2CHZA 3AEVA 4HWIB 5E6NA 4KJOA 4APVA 1LV9A 1PH5A 3RNGC 4FN2A 1ZXHA 4BOZB 1PTOF 4M0WA 2WXQA 3H0GH 4HN7A 5I6WA 2KCCA 4XXEA 1CM9A 4POGA 3BZDB 2AX5A 4BA1I 1IGCA 2HE7A 2NVQH 4IO9A 2FINB 1WGRA 5HGTA 3LJ3A 4CGYB 1TYGB 1OXXK 1HNWQ 3KW5B 2E2DC 1KF6B 4KN4C 2ZZPB 3PMFA 3OMGA 3QOLA 1BKBA 5M3MB 2EJGC 3PGZA 2WU2B 1NI2A 1JQYD 5HG2A 3BDLA 4I7AA 2FMMA 1DZ1A 1DGJA 2LXKA 4JI0Q 3OTOQ 1IBXA 4IOIE 5BN3A 1N6ZA 3EFXD 4B3SL 5IYDH 2K6DB 4KIKB 4KKUA 1ML0D 5CV6A 1Y1VB 2QGQA 5C44B 3IFTA 3NHEB 1SF0A 5D2MB 1STGA 1FXIA 3MHBA 1K0SA 3ERQA 1DOIA 4R4TA 1R4NB 4K1RB 1Q1OA 2CWAA 1EIFA 3LB8C 4MELA 4TQ1A 1LXDA 2Z4HA 1XT9B 2QHOA 4LNQA 2EYJA 1OXSC 4A3FB 4A3EB 3HOYH 3LYYA 5DEHA 4FHKA 2O6VB 5IP9G 1YN3A 3M4QA 1MI2A 2C60A 4BBRG 3H09A 5IAAC 5LNK1 3O65B 4A3GB 1PZKD 3KYHC 1F0ZA 2JQOA 3TBIB 1ICWA 2IY1B 2VZAA 2QF7A 2IO0B 4DR5L 3AMUA 1F2LA 3QJZA 2HUGA 3FAHA 1KLUD 1TIFA 2VQEL 2NVTB 3GP7A 4KD3A 1OO9B 1WX7A 1M8AA 5M5YB 5EKLA 4A93H 4PK1A 4QB4A 2E75C 2PW5A 2X69A 4DK5A 2SNMA 1EY6A 4DUYL 1ASZA 2O6VD 2IZVB 1HTLD 1PH7A 1LT3D 3NK9A 4FXKC 2WXJA 3TEYA 3PIOA 4K5XA 1II3A 4IWQA 4BAXA 2X8XX 5TSSA 1X56A 2F0KA 1JE4A 1TZ1A 2HT1A 3DHHC 3KWLA 5J2RA 1QZHA 4EZKA 1TS5A 2PPHA 4TQ0A 1D4BA 2CQOA 2CU3A 2OCEA 1Z5SB 3FC4A 1TVXA 2EKEC 5IT9L 1BMLC 3J81c 1JC7A 5LMUQ 4UY8C 2D9UA 5DNFA 3L2PA 1RODA 3DBRB 4TKNA 5ELOA 2ZJRA 4K7WA 4QCLA 2I1KA 2V3NA 5HHDG 3VR6A 5FO7B 1BXTA 1NEKB 1CHPD 4H02A 3L4PA 5JPMC 3AB9A 4IJHA 2B2TA 2RCNA 3T4AC 3J81E 1Y8NB 2WB1B 4FF3A 3GTOB 3CCMA 5AFWA 4HJ5A 3AEEB 4GLAC 2BQQA 3DEPA 1U4RA 3FPPA 1N33L 3H3VH 3M3YB 1C4PA 1WR6E 2NZHA 5M5WB 3Q14C 3ND8A 1F2RC 4NPNA 2VXWA 1HZ6A 3V6EB 3HOVG 4UPAA 2F0MA 5JEAG 4DV1L 4HJAA 4KHPL 3PCOB 5C5MA 4JV5Q 1UZXB 1AE2A 3KYCD 2LGDA 4ZRJA 1P8LA 5C3JB 1E7PB 3RZDB 1UAPA 4RGOS 3NTHA 1Q8KA 4O2DA 1R7SA 2QEJC 1VQ7A 2D07B 2KDBA 2SAKA 5EBCA 4ZRZA 5EKKA 2JYTA 3HOXB 1V97A 3VH4B 3KBXA 3JAMc 5FJ8H 4CJ0B 2RD0A 4DV4Q 1YX5B 1FXTB 4ZQ3A 3OW2A 1PA6A 1V86A 1N34Q 4IWPA 4B6WA 2WXKA 2KCTA 4F8CB 4GKKQ 4C80A 1YI2A 2NWGA 4H0LC 2J0MA 4JI6L 4BBNF 4CJ1B 2QMTA 2G4DB 4BFRA 3DVNV 2E2HH 1N32L 3V6CB 1XEEA 1YJIA 4B3ML 4AYBG 2REXA 3AE9B 3NVYA 4RHRA 2K5HA 2BBCA 2BKFA 3Q3OC 3IXSA 1P3QU 1L6VA 3S2HB 3AYHB 2OEDA 3K7AH 5DPWA 4G7ZC 3AECB 4TRDA 3I72A 1UE5A 3HHMA 3MC8A 4KX6B 1S5FD 3A1QB 4KGRA 2HTME 4LDTB 3PUYA 5FLXc 2B3AA 3P4QB 1GOZA 3ECIA 4A3BB 3NENA 4J8QA 3RFZB 1U4AA 3CPFA 1NY4A 3CWIA 2K5DA 3L9AX 4OIJA 4P74A 4BY7B 1GNUA 3NBHA 1WGHA 3KUCB 4RNAA 2EXZA 3ULJA 1D1IA 3VYSA 1V8CA 2B2VA 2A8VA 4FHJA 2B2UC 2K1BA 1TS3A 3M85A 1EYGA 4N59A 1YBYA 2Z9HA 5FLXE 3D32A 1C8CA 1LTSD 4NXML 5K36G 2JWUA 4GIVA 4UP8A 1STBA 2RQXA 1VQLA 4AYBE 3S1NH 2MBBB 4AJYB 4ZKBB 2DZKA 2V4DA 5DCNA 5D6JB 2LVQA 4RH6A 4A3DB 2FUHB 1W6KA 3NRZA 4LDTD 4KN7C 5ELNA 1HHVA 1E8ZA 2I1JA 1J5EQ 3ND9A 2DAFA 2PYKA 3SK6A 4XTCS 1PH6A 2MRPA 1U5KA 5IA7A 2XWBB 4R8NA 2IHEA 4C3JB 3DWGC 3QK0A 2WHIA 2BYVE 2MSED 1XTDA 4CDDC 2DZJA 2X6GA 1PDXA 1XQQA 1UNSA 4DHZB 1VMPA 4JG2A 2L1BA 5BN4A 2X38A 4HJ9A 3J7YW 2V4LA 4BKSA 1RHPA 3PS6A 1WXQA 4CYEA 2F0PA 5JH5C 3MFYA 3DHQA 3TQYA 5CBEE 1SLJA 2VH1A 4LFBQ 1G2TA 4QUCA 2YEPB 3IKJA 3V62A 4RWSC 2K39A 3Q8BA 3ZLZA 3NJTA 3I4MH 4A3IG 1SE9A 3AI5A 2A4ZA 2DX5B 2LGXA 2F4VQ 2JEAI 2WDVB 3NY5A 2ZTEA 3HS0C 2R7ZH 1HJPA 1VQNA 2C7HA 3TZDA 5C5LA 4ZYNA 4IUNA 3E9IA 1E2VA 3NTKA 3R2TA 1MSGA 2Z6KC 1MD2D 4A3KG 1ZXIA 3L17A 2L05A 1QKZA 1WJJA 1TWAH 3S16B 3CU7A 3W1SC 3ULPA 1H95A 1SJED 2WU5B 4P72A 1QVFA 1IYFA 1XMQQ 2MBOA 1N8RC 3S1RB 2ZPNA 2L15A 3ZYYX 4A3CH 5BO4B 5IO9A 4MSQB 3DLLA 2MEKA 5IWAQ 4LWCA 1FNVA 4RAUC 3T1YL 3KFUA 5LMUL 1BQQT 3CF5A 1T0SC 2VZKB 4LJPB 1RLFA 3IRBA 3QX1A 4NJ7A 4X62Q 4HPMB 5CC4A 2O2LD 3BYTB 3W1GA 3M3JA 5C4HA 2JPHA 1WRDB 1GD7A 2LKVA 3BWUD 4MGIE 5BYQA 4L63B 4NB3A 4NW2A 4DXFA 2NN6I 3KF8B 2VUMH 3P7JA 1I50H 2ZJDA 1HTQA 3VH3B 1BCPB 4J3OD 2FJ2A 1KDAA 1STAA 3HIZA 3PT2B 1UWVA 1V9PA 4DPGA 3GTLH 1KRTA 4ILWA 2EKIA 2IX0A 1TKYA 1U0LA 3R3OA 3J80E 4LLGM 3CMEA 1JMLA 4WURA 2GB1A 2M0AA 1JICA 2VZKD 3CCUA 2WWZA 1WGKA 3G6EA 2EZVA 4KK7A 3AEDB 4HCPB 3CKIB 2RHQB 3PUVA 4LF9Q 5FKAC 3N3KB 1Y8PB 4YXDB 2IO2B 4LCDE 1BVSA 4B08A 2CJNA 2FUG1 1J8IA 5C3WA 3J7A5 1WCMH 2R3ZA 4W9LA 2PQAB 4W9KA 3CC2A 3HKZB 2YEPF 3D31A 2LUEA 2Z6BA 2PVOD 2PI2A 1BCPD 4L5TA 1TY2A 1K9MC 1FRRA 1YQ3B 5IOIA 2E8GA 3K5OA 2KMMA 4FJZA 3FP9A 4F7ZA 4IUTA 5C6AA 2JSOA 2MBEA 3RN5A 2INPE 1KL9A 5EBDA 1I42A 1Z9FA 1GB1A 2M1MA 2WP8J 1KD1C 2F0UA 5IP7H 2NB0A 3KF6A 4BBSG 1JROA 1M1KC 4M00A 3G48A 1VQFA 1RIPA 1T0YA 3Q0AA 2DHZA 4JI8Q 4PS7A 3H7PA 5LMNQ 1EEFD 1YNJC 2LJIA 1K73C 2K33A 4PMWA 1PH1A 3CAMA 1IYVA 1YHBA 1CI3M 2A69C 2D5DA 2H1EA 1BT0A 1UGMA 1TKEA 4BY1G 5JAVA 1I4GA 2IO3B 1SYDA 2BYTA 1UEBA 2JA5B 3HOZB 3F2DA 3DWPA 1NYRA 5ELFA 4E74A 1FMAD 2BS2B 3S2DB 1C3TA 2IX3A 2UUCL 4P16A 1XO3A 1PYSB 1QQRA 2OJRA 3P2BA 2KTRB 1IW7C 1KFYB 3AE5B 1TT2A 2QSDA 1VDVA 1A15A 3PPAA 1I3QH 4EUTA 3QC8B 3CRKC 1WGGA 4JI2Q 1BCPF 2N1VA 4OEMB 5L83A 1VQEA 2ZCBA 1DOXA 3A9JB 1KLGD 5LHY1 2NTTA 3FILB 1GO3E 2WACA 4MTNA 5D65A 3DBLB 4RF1A 2L4NA 3PUZA 1I94L 3VR2A 1XLOA 2KNBA 3MEHA 4IFDI 2PCFB 1QWYA 5EQ0A 4A3JH 4MNOA 1FIQA 3N9YC 4KKTA 2NBWB 3AFPA 1MVKA 1SNDA 1YITA 1YQ4B 3IBEA 2QDBA 3U9SA 4LUZA 4URKA 5C3EG 1QOAA 5LL6X 4LFAQ 1JQ4A 1MHWC 4K0KQ 5HI1A 1O7YA 2IPKD 1XNRL 4YWKA 1R4MI 2A5UA 2M56B 1HE8A 2FCNA 2E5LQ 4RKBA 2VS1A 4GSWA 3A7AB 3ZTCA 4ZRKA 3PV1A 3PUWA 3IAS1 2ID0A 4US9A 2KACA 4HRSA 3GTGH 1WTHA 3GTJB 2HCCA 5AJ3L 3WAPA 2VY3A 1ZDXA 1T3QA 5M3FB 4DU9A 2DYOA 3QG1A 1MJCA 1SNPA 1ILPA 3EUB2 3R7QA 3S17H 1SYEA 1YIJA 2WXLA 1A3UA 3E9SA 1E1OA 4YTPB 4B9KA 2KX0A 3L0WB 1J7AA 1UWMA 1TWHB 3NXWA 3R93A 1Q7YC 1K53A 4PZ7A 3DEOA 4PMCA 1RRBA 2JYOA 4R1JA 3OJ4B 4H2AA 4L5QA 4MJSA 3RZOH 4MGZE 4QJFA 4ULLA 1JB3A 3H0GG 2KLGA 5IKCM 2UXCQ 3VRBB 4ANWA 1SMYC 2MPMA 4HJGE 1I4QA 2UUAQ 1OEYJ 4I6LB 3DM3A 2WXHA 1TWGB 1XNQL 3KOJA 2NVXB 3DBSA 4A3MH 3DHGC 1BOSA 4YY3L 3E6ZX 5DPRA 1NVID 2N9KA 1HZAA 3HVDA 1B7YB 2BYFA 1SE3A 3FKIH 2KT7A 2HJ8A 1V1PB 2LFNA 3NS1A 2E74C 3LWEA 1LT5D 4CBVA 4LF7Q 1QLBB 2RGFA 2KKCA 2KXJA 3D0FA 1TS2A 3GD7A 4S3SA 1JOKA 5KRUA 5I2XA 2HHHL 3GE8C 4IM0A 4C2MB 2D2CC 3SVMA 1R9TH 1K50A 3N1YC 3IT6B 5IYDG 3RNEC 1JCKB 4K2KA 2EY6A 3E0JA 5CHVC 3FKYA 2EVBA 2DGYA 2BH8A 4ZKCB 1YJ1A 1ZUD2 3DVNU 1CKOA 3L54A 2ZM6L 1CKNA 1WTRA 1WZ3A 2BW2A 2JZZA 3W9CB 1E10A 4UDUC 1K0RA 1L5PA 1SMXA 1R4NI 2DZMA 3G71A 1LM0A 2XGTA 1STNA 2WAQG 2C9OA 2AWOA 2YV5A 3A54A 3HOYG 1WH3A 2EIFA 4IM2A 4B9WA 3T3OA 4IPHA 4C3HH 2ZT9C 3B0AA 3BDCA 4DR3L 2JA8H 1B50A 1GUWA 4FNFA 4ME3A 2PJHA 3HOWH 4L5SA 2BDNA 4BBRB 1EOVA 2KFJA 4M8NA 1Z6HA 1J19A 2ICIA 2LXCA 1HZ9A 4DV3Q 4JIOU 4LFCQ 4OW0A 2PI2E 3BVMA 3I8ZA 5I2YA 3ETRA 1JT8A 1STEA 3QIJA 2WNMA 5DM73 4OX9L 5C3XA 2AQ3B 3Q6BA 4BOSC 1ZDVA 2R92H 3DVGY 4QUFA 4IC7B 2FMCA 4A93G 1WXMA 3MWYW 4DNRB 5CMDA 2NPTA 3KLSA 3LDZE 4KV2A 2O5IC 3C3LA 4KDIC 2YU9H 4US8A 4ZYSA 4EZLA 1I4XA 3QIAA 3S15B 4HSVA 1DM0B 4AQYL 3E0EA 3D3RA 4IUQA 3K0XA 2LVPA 2PQEA 2WAQE 4I65A 3HOUH 4BVUC 1OTRB 1JJGA 2BCOA 2CS4A 1WTPA 2FAZA 2K28A 5KNBA 1OGWA 2J52A 2UU7A 5G5HA 3RNCC 3RPFC 1VQDA 2B39A 4A75A 3R66C 1EIGA 2KJHB 2DYMA 2AWNA 2VH2A 5L95C 3HVZA 1UUPA 2W3SA 3RI7C 4F88A 1PYWD 2JXTA 5MPOA 4DV2Q 2VNUD 4KY7A 2BH2A 4JI4Q 2J0KA 2JZPA 3VR4A 1QNUA 1RTNA 5EPLA 1MFWA 4QIWB 2IY5B 1HZ5A 2CW0C 4DV5Q 3ZJVA 1SE8A 2G4SA 4MM3B 2Q8TA 3V61A 3V96A 2NBVB 2G45B 4MEMA 4DV0L 1KRSA 1HNZL 1IBXB 3GTMB 1L0YB 1H8CA 2W55A 2A68D 2BWFA 1L1OC 4DXGA 3LWUA 3S1QH 1Q3LA 4WAAA 1PUTA 3ULLA 3WA0A 2MHVA 3MEFA 2ASQA 2A6HC 5GAGC 2VB3X 5I4DA 1JR0D 3M4OB 2C9WB 2DNFA 4YT0B 1VDZA 3K80C 1JRUA 3CCJA 2SEBD 3T13A 1BO0A 2EELA 3C46A 4KHVA 3J81i 1O78A 1X1MA 1PTOB 4DV6L 4XIGS 2CHBD 3KBGA 1PQSA 3HOVB 3N32A 4MGKE 5CORA 2N3SA 3GE3C 1SEBD 2MUYA 4OELB 1WF9A 1D6EC 3OWEB 1WOCA 4CDFC 1L1OA 2J53A 2F0OA 3HKSA 3PV0A 2KTFA 1MG8A 3V05A 2K6AA 3EROA 5FJ8G 1GJZA 1P98A 3R2IA 1IKLA 4NAMA 2AUJD 2SOBA 3PO0A 2RDFA 3EN2A 1S72A 3X3NA 2INCC 2PPBC 3ZDTA 4MTKA 4GLXA 2PKOA 4W9CA 3K5MA 1UE6A 1LTGD 1PTOD 2B8FA 2BE5C 2EYLA 5ELDA 5JJZA 2KANA 4A3OA 4C4VA 2XIWA 1GG3A 4GOPC 1XF5L 4L6TB 2C7MB 1PLFA 2AUKA 2YLMA 3KDFA 4X66Q 3U2SC 1H9SB 4R3DA 1N5WA 4AYBB 3PO3H 4LF8Q 3L3OC 2EYFA 4XQQA 1XCTL 1FM0D 2IYDB 1XMOQ 3PHWB 1PZJD 4M8MA 1C77A 1ICFB 2M17A 4K3BA 2K04A 2K1FA 1YNXA 2A74C 3BINA 1WYGA 4NXNQ 1PVOA 5C0XI 2N1WA 1VQ5A 2N55A 4IPDA 3RULA 1YHQA 4ZHOA 2EY1A 3PGEA 5ELCA 4DR4Q 1YQBA 3DCGA 2PW9A 1B3QA 2DAJA 2VW9A 2K14A 1SBBB 4L5RC 3I4OA 4FO2A 2F0GA 2Z1CA 3VA5A 2IX1A 4JPBW 1EWYC 3D4RA 2K5PA 3FDTA 2VQFQ 3F8TA 3STBC 3TS2A 3I3TB 3B9JA 1EY0A 4PS3A 4ID6A 3GTPB 1EWHA 1JWAD 2WXNA 1ZXTA 1HFGA 3I4LA 4GKJL 3M4PA 2CKZB 1F9QA 4B3RL 4P75A 4DAYA 2HTHA 4NQLB 4USAA 2LVOA 4JI3Q 1L7YA 3CSTA 1H9MA 3L10B 3UQAA 1K8GA 4H7BA 2LGSA 4JYAQ 4EE2A 1Y1WH 1HZCA 1P7EA 3AM9A 4W9EA 2KVMA 2IWHA 1GUOA 3Q3JA 4RGMA 4WFN3 4EX5A 1TY0A 3MTNB 3GTKB 2KX3A 5T1GA 4GNXC 1LTBD 2NUCA 2B63H 4KGTA 1K8MA 1Z2MA 2ZVOA 2ZJQA 2DZIA 1G2SA 2IY0B 4AS1A 1OQRA 3SK8A 5CV8A 4KD4A 2Y5BB 4IUVA 4OGQC 4DR2L 3K9OB 1WTOA 3DBHI 4NP5A 3M7NA 3F2CA 1EZ8A 3CCEA 2KO3A 1OFFA 4EZJA 4IOCA 2BDOA 1C48A 2R6GA 4DR1Q 1V6EA 1ILQA 2YTXA 1H9JA 4GN3B 2E2IB 3JC66 2IJ0A 5AEKB 1X6OA 3I4MG 1I6HH 4S17A 3WWVA 3VAWA 4XDXA 2W82A 4GNXA 3TL5A 4TKOB 2R7ZG 2DY8A 4A3IB 4OZBA 5JVG3 3Q3NC 4Z9CB 3S1MB 3OPOA 1K8AC 3E9HA 2MCNB 1DYQA 4OZCA 4JBWA 1V8QA 4DNIA 4ALPA 2D62A 4GB9A 2IBIB 2KWUB 2J42A 3CHBD 4A3KB 2WS3B 1VQ4A 1BNZA 3IFWB 1XCQL 3N1XC 3BDOA 5D14A 4KDLB 3KYDD 2QW7A 1K83B 4A3CG 1E7VA 3Q24A 3I5JC 3Q23A 1MBYA 3EFUA 5IGFA 5AUKA 3GZNB 4EEWA 4P2CB 2WX0A 1IBKL 1C76A 4JI1Q 1Q82C 1X54A 2ALYB 5FR6A 3MZ5A 4YTMB 1WD1A 1CTMA 1QVCA 2ONQA 2A6EC 1UEAB 4DFAA 3ZXVA 1DOMA 5E4WC 4O42A 1B1ZA 1QT9A 5BR8Q 2OXPA 3OYYA 3RLFA 1BF4A 3IFDA 5JJKA 2UU9Q 1A62A 1CA6A 4HIOA 3T1HQ 3E3XA 4L23A 3Q2AC 2D0PA 3RLNA 2VUMG 2I2YA 5FOBB 5C4ZA 1CSPA 1IXRA 2F3IA 3SDZA 3CCQA 3TJPA 1J7CA 1EWIA 2RA4A 1PRTC 3T53B 1A70A 1Q90A 3AE1B 3K8AA 1XPOA 2EQSA 1SNCA 4C3IH 4KKJA 3FEWX 4N9PA 3M9BA 5C4XH 1PFNA 5CV7A 1H4RA 3RZFA 4DBGA 3ZNZB 2FIFA 3H8HA 2KMCA 2PIAA 1LTTD 2K75A 1SB3C 2SNSA 5HGQA 2LRWA 2V4IB 2NVYB 1SFOB 5GQOA 3J80i 4HKZE 1YJ9A 1NYQA 3HGBA 4AP4C 3KQ4A 1WCMG 1LUZA 3PRMB 1XJVA 2HQEA 3AULA 3ZJYC 2AWTA 4DR7Q 4HSPA 3I91A 1TWCH 4PS8A 2KVZA 4LF5L 1SYBA 2I07B 3D6WA 3ICEA 3IAM1 1UE7A 3U4ZA 2ZVNA 1A3VA 1P9DU 3GTQH 4HVBA 4G7OC 3JVZX 1FGUA 2W54A 2AEHA 3JSVA 1O7ZA 1BR9A 1SDFA 2WDTB 3VDZA 1ZYRD 3NBHB 5IP7G 3NZ3A 4NKLA 3JAML 4JI5L 2MJ3A 1BBUA 1DONA 1EQQA 1PH3A 2ICEC 2KJXA 4BBSB 2Z0DB 4GXBA 1TR5A 1JWBD 1YJNA 4PMBA 3N20C 1D3ZA 2L55A 1XMOL 1D2BA 1K51A 3AE3B 1XPRA 4QIWE 2MGSA 4POFA 4M01A 3DPDA 1E7ZA 4NXNL 1I4RA 2O4XA 3P1MA 4W9GA 3CC4A 4NAWA 2KWCA 1J8CA 4LNKA 4ASWC 1NDDA 4E71A 2EYPA 1S4ZA 3VYTA 4BY1B 4PT5A 4B3TL 4P1BC 1PH2A 3TMPB 2ZCCA 4WQMA 1B4OA 4H13C 4CKBA 1L2NA 3A33B 2OTJA 4XYOA 1EUJA 1LO5D 3H6NA 1XD3B 2E2JB 5IT9E 3Q22A 2AL3A 2K4KA 4FJVB 4LF4L 3APDA 4YSYB 5E6JA 1JB7A 1WE6A 4KY6A 3PIO3 1X65A 3QOJA 1OEYA 3T3NA 3FPUB 3NS8A 1EO6A 5LL6S 4M8AA 5KGUA 3HK0A 5BN5A 2ZJPA 1KIXA 2I0QA 2K9XA 4WH4A 5LLIA 4GN1A 1ET9A 3DBLI 3C2PA 5IGGA 2DBYA 4A8XC 1ZOYB 4WJQA 1IPGA 3TEWA 3ZUNA 4N9TA 2WQYB 3I63C 4A3JG 2ZEQA 3PIPA 3ML9A 3KUZA 4OWTB 2GBRA 2YVCA 1VQOA 1V2YA 4HEDA 1HR0Q 1C4AA 3ENEA 1UGJA 5LXHA 4ZUJA 3EFCA 1HNWL 1L4ZB 2WKCA 4L1BA 1NCVA 4OZAA 5CGKA 4C7YA 1GHKA 1B9MA 2B2YC 2KZRA 1C78A 4RMFA 1B70B 3CQZH 5C3EB 3TP5A 4BKSD 2QIEB 4YCWA 4FA6A 3SK5A 3PRPB 3WAMA 4NJCA 1VQGA 1W3SA 4JI0L 1GUAB 3OTOL 4YCUA 1GUNA 3SE0A 5G2NA 2Q8IB 2N9LA 2WXMA 3GS2A 1JWMD 1EYAA 3TMEA 1FXAA 2V1YA 3IL8A 1LFDA 4X3KA 1IYJB 5M5XH 4LF6Q 2GBMA 3I73A 2MBHA 5CV4A 3AV8A 5H92C 3NVVA 1K28A 2WXFA 3VXWA 1B44D 5JXVA 4OVVA 1SYGA 3VUYA 4HMIA 1S5ED 1RFKA 4KZ0A 1VF5C 4V190 2NZ1D 2B2UA 2Z4IA 1VQMA 1K52A 2MP2A 2JQRB 1KM7A 2UWQA 3C19A 3HM6X 2JA9A 1TBEA 3U8ZA 5EGTA 3MHZA 1A5RA 3URYA 4EQOA 1CT1D 3W2DA 2JXMB 3A8KE 3SGIA 1E24A 1GPXA 2M19A 3WIMA 4FVMA 1DOKA 1HZBA 1RCVD 5HURA 1E2ZA 1KNEA 2PMZE 1KHIA 2YTVA 4R4IA 1EY7A 4ZRQA 1IUEA 1PH9A 2KOLA 3L16A 2Q5WD 2RSUA 3H0GB 3OIQA 4A3MG 4B0MA 1VQKA 2EY5A 1IZ6A 3N1ZC 4ME5A 4HCNB 2NVQB 1WXVA 3MTSA 1WFYA 2LASA 4IJLA 1EQTA 3FKIG 4IZ8A 1VQIA 1D5MC 2PVGC 1PFSA 2GVAA 2BA1A 2UU9L 1QF6A 1CZWA 3A5UA 1VD2A 4WJOA 4QY7A 1Q1BA 3P1HA 5CR3A 1QB5D 1KXLA 2EY2A 1ISNA 1TT5B 4W9JA 4KI0A 1FRDA 2N9EB 1A0IA 2GI9A 1B8AA 3RMKC 3QARA 5EE1A 5EJWA 5IYBH 2JWZA 4S0RA 2N8NA 3IHPC 3PHXB 5C1ZA 3EQLC 2DN8A 1BUVT 3UIOB 4IPGA 4YSZB 1DD2A 1M94A 2F0EA 3DQVA 2WV6D 5JHBA 2MJDA 3KF6B 1WI0A 3KLRA 1VRAB 1U4MA 1ENFA 2Z6KA 4EGVA 1WTXA 3Q8FA 3NTIA 4QF4A 3BS1A 3H7PB 2WAQB 1L2FA 4C3HG 5HFYA 3W1SA 1JOQA 2MX2A 4GLSC 4K5WA 3J80c 1YHAA 2JA8G 3HOYB 4II2B 3BU2A 3HOWG 3EGRA 4JQWC 1I4HA 3AE4B 4HMJA 1X3QA 2RSOA 4YHHQ 5G5GA 3W5UB 3NBIA 2KCMA 1SNMA 3J7AV 3WAOA 1S3OA 2NN6H 4OWXB 2R93H 5JJIA 4EFOA 2WKDA 2MJEA 1CUKA 1G6ZA 1GKHA 2KVRA 3TS0A 2OJWA 4MH0E 3AE7B 2R92G 4LTUA 4N8X1 3KWVA 1WM3A 3TN2A 2KCNA 4JV5L 4A93B 1HXYD 4N6EB 5FK9C 4LJZC 1E1TA 2INNE 2QDLA 2MFIA 1Y14B 3HOUG 3VQIA 4YSXB 4NDXA 1XYIA 4FYDA 2D3GA 3ONSA 1GHJA 1CK1A 3AFQA 4UAIA 3VHTC 4IFDJ 1NTGA 3TP8A 2RVLA 4LK1C 1EIHA 5JOBA 4DV4L 3BYYB 1N34L 3R7RA 2QA4A
chains in the Genus database with same CATH topology
3IT4B 1GAQB 1SNOA 4IUUA 4WRDA 2F0NA 4EQPA 3MJ5A 1E2WA 2A69D 1TS4A 3TUOA 1JWUD 1Q12A 2KQ3A 3E5SA 3AE2B 1QG7A 4PV1C 2F0HA 2F0QA 4WWMA 3NUHB 4LAAA 3T16A 3A55A 2VB2X 3MAQA 1BCPC 4TSSA 3W5VB 2F03A 3OOCA 1K8OA 1BBXC 2MJ8A 1O80A 2WIIB 3U9OA 3SR6A 3T51B 2EYOA 2I46A 1QE6A 2XSCA 1QCBD 1FD6A 1FYCA 2O5JC 4IFDH 1N60A 2JU6X 3GO5A 4L2YA 1UWXA 2E2HB 3EA6A 1FGBD 2CJOA 4RKLA 1RD9D 2E6XA 2QJLA 4EVOA 2LUMA 3ZGZA 2RMMA 4KGSA 1VZ7A 2JEBI 3K7AB 3NVWA 4XYQA 1N62A 1E9MA 3D4DA 2K3UA 2DNEA 3E56A 2F4IA 1J9OA 2FE8A 1O7LA 2PO4A 2L52A 2TMPA 4ABNA 5AUIA 1TU2B 3HEJA 2EYMA 1V1OA 3NE5B 5KEEA 4HEA1 2B8GA 3S1NB 1L6UA 2KEEA 1HPCA 1QOGA 5A2QL 1RM6C 3I3CA 2M9VA 2PTLA 1U4PA 3MXNA 2F0JA 1EWCA 1KDCA 3TZUA 5BMGA 1TIID 4ARCA 2TSSA 2WLBA 3V3XA 1F9RA 4OO1I 4OO1H 2K0PA 2F1MA 3MC0B 1B53A 1VMCA 3Q8AA 5DAUA 4MACA 2F0WA 3M7GA 5A35A 3MXPA 3I4MB 1X3PA 4IURA 3U7ZA 1MPEA 1EU3A 2XN9C 2R7ZB 5BYRA 2G1EA 1W6JA 1D5ZC 1FCLA 3MXGA 4ZRPA 1DCZA 3ONAB 4DAPA 2JE6I 1TWAB 4RCOA 2EJMA 3DWMA 5IOCA 1WSPA 2WXPA 2Q8RE 2BOSA 4CJ2C 2ZW1A 1MHHE 2ACZB 1EEID 4ITKA 1RYJA 4HR7B 2KN4A 3AE6B 4QMGA 1STYA 1YNTE 3W3AA 1RJTA 3P63A 2VUMB 1NUCA 4F87A 4ZHPA 1I50B 1PGXA 2K5QA 3I9V1 1T5XD 3GTLB 2LGIA 4C3IG 2HDMA 1JWSD 1RKNA 1MI0A 1E6EB 3DMUA 3NQTA 2LMCA 3C8YA 1STHA 2K05A 3C1FA 3EJIA 5I9OA 1ZKOA 5COYA 3K59A 3GB1A 4HKQA 3NWTA 1HQMC 4M1UB 4A90A 5C0XJ 5KNCA 1WCMB 4JK1C 1PGAA 2EJFC 1XXGA 5FR3A 2PLPA 5H8YE 4FF4A 2J4XA 3SHLA 1AZPA 1ESRA 1N63A 1A2TA 2L1AA 3RD4A 3AEFB 4REZA 2KHSA 2JYEA 4WIPA 4ZOHC 2PMVA 1HEZE 4EQNA 1YJJA 3NP8A 2E3TA 2L0CA 4MT5A 5EKIA 5FO9B 2BS4B 4K5VA 4YWGG 2BE5D 1J7BA 3V2TA 2Y5PA 5KYIA 1CJEA 3MVVA 2H88B 4BA2I 5J39A 1C9FA 1JORA 2L5TA 1FFUA 1T5EA 3VYUA 4X3SA 2CQAA 1YNND 3AEAB 1I3QB 4XWTA 2F0SA 2LHEA 4C7ZA 2OEOA 2DNCA 3DWQA 5C0XH 2HDEA 1GXDC 2L9HA 2KEDA 4YTNB 4A3JB 1QOBA 5CBAE 3S9WA 3H94A 3VR9B 3H91A 3P4PB 3ZJUA 5E3FA 1B9RA 1I4PA 2KDMA 4F7XA 1PTOC 1T6BX 4J6HA 2PMZB 1Q8IA 1L0VB 4C1NI 4D2KA 1WVLA 3P4SB 1G291 3GQBA 1EYCA 2QKIC 1ESFA 3U4EG 1QOFA 1OXVA 1D1KA 3NQIA 3GTGB 3D6CA 3AH7A 5D7GA 3RUZA 2ZW0A 3OSOA 3UI2A 3S17B 4LMQD 1XTCD 3P4RB 5KIXA 2PZTA 4BWGB 2OHFA 2C5CA 3TP7A 2LFIA 4MH8A 3RZOB 4CQNA 1F2ZA 4NZLB 2WDQB 4RGTA 4Q2JA 3BK1A 1IYUA 4A3MB 1B9NA 3DUZA 3NUCA 2N7JA 3K5NA 3M4YA 2IGDA 1HUMA 3ITPA 3FKIB 5JVH3 3HRDD 1QNKA 2B2WC 1H9SA 1PRTB 4K8JA 5EE3A 2V3PA 1R9TB 2XRQD 5IGCA 2G9DA 4FF1A 1Z47A 1DXMA 2A6ED 4TQUS 4XT1B 3SFDB 1CQVA 4CKCA 2ZXPA 1Y69U 2PNRC 2QILA 3OMCA 1ET6A 3AN1A 3SEBA 1CZGA 2B2WA 2MH7A 4X3TA 2H4OA 2LEKA 3TSSA 3WOFA 2K03A 4OIKA 1PRTD 4C3HB 3KLSX 3J81L 2JA8B 3K5LA 2NN6G 3P20A 5J1ZA 4NAWB 3HOWB 2N0SB 1KDBA 4L8JA 4IN3A 2EE1A 1B2TA 4JX1C 4A6QA 1CZPA 5NUCA 2WXRA 4R9WA 2R92B 2Y3AA 3NPPA 3NVZA 2YU9B 2BA0A 2WXOA 2KAJA 3MXUA 1QJOA 4RHSA 4TMAB 3Q8CA 1BUIC 5E4XA 1F2MA 3HOUB 1BDOA 1LACA 4RF0A 4DQOC 2B2TC 2K32A 1YN5A 3CRLC 1EY9A 1WTWA 5BYSA 1TZOA 1CQFA 1Y8OB 2KUMA 2YYZA 4FXDA 2F3VA 3AEBB 4XQJA 2NBFA 1GB4A 1WTQA 1PFBA 1FR3A 3AB5A 1AYFA 1PRTF 4A55A 4IUPA 1FNWA 3I90A 2X6LA 4GZYC 2IGHA 1AN8A 4N58A 3NWSA 4ODGA 3VYRA 1ONLA 3S1QB 2D5GA 2BB6A 4FP5D 4MN3A 3QWNA 5FO8B 2KA7A 2J0TD 5EPJA 1TJEA 5EE9A 1ZYRC 5FLXL 2IDYA 4PQXA 1EY5A 2OT2A 3L7ZC 1WWTA 2GA4B 2PZUA 1SJHD 3KK7A 2Z8LA 1A6XA 3MA2B 4G7HC 1WTVA 2EOTA 2DWQA 2WINB 4IFDG 3Q8EA 1A2UA 1N61A 1G91A 1I7HA 2KWDA 2XVSA 1KRHA 3FVQA 2F0FA 4XWWA 4KKSA 1I6VC 1U9RA 4RFBA 3RMHA 4DGZA 4P6VF 2W3RA 1HUNA 3BVZA 2ZXRA 4KJNA 3BIID 2AQ1B 3JAME 4XE0A 5G3LD 3T56B 1VZ8A 2F0TA 1FD7D 1XLNA 2B2VC 3PO3B 2IGGA 1LTRD 2F0IA 3OW7A 2DLBA 4OL7A 4KKIA 2L11A 2XRSD 3VR3A 3A8JE 1Y56A 3AE8B 1RTOA 1PZID 2B2YA 3GV6A 2J7ZA 4ZAIA 4HCEA 5ELEA 2LY7A 3KUPA 3N52A 4K8IA 4V0BA 1PFDA 3TEZA 1JALA 2DY7A 4XDCA 1HA5A 1M4VA 3O13A 1KTKA 3NSWA 2A73B 4C1NK 1Y1WB 1KABA 3HG9A 3LXFA 4U673 1EQVA 1WD0A 1TKGA 5G3LF 1XLQA 2L83A 3P42A 2FHTA 2B63B 1VR9A 4OO1G 1YN4A 2WXIA 1F9PA 1HA6A 1X32A 3PIP3 1EY8A 4JE3B 3J80L 1LABA 3WCQA 1VF7A 3DXJC 1AEXA 3K58A 1SE4A 4E6IA 1I6HB 1AFPA 1C4CA 2F0DA 4B0EA 2XWJB 4AQ7A 5F2DA 3PZ7A 2ENBA 2A5HA 3TEXA 1R4PB 1HCZA 4G57A 2V0GA 2L12A 4LK0M 2WDRB 4RGNA 2L32A 4FXCA 1ACCA 4PNYA 5JEAJ 4K6DA 2PZWA 3IAYA 1KH0A 4IKGA 1AP0A 1VZ6A 1VJKA 1SYCA 3BG3A 4RA8A 1NSNS 4DF7A 3LNNA 2G9HD 1EFID 3B2GA 2K22A 2HDLA 1HRJA 2B76B 4HTHA 4KY5A 2F0VA 1NAPA 1HFNA 1FEHA 1SYFA 1P7FA 2Y5CA 2XNAC 1B3AA 5CV9A 5I9PA 4C3IB 4XT3B 4JWSC 5C4XB 1YNJD 1OQQA 1S5BD 1Q10A 4NMZA 3A56A 1FFVA 1RF2D 4BS9A 1Z7TA 4WJWA 4YIJA 5GXGB 1TWCB 2IW3A 1C4QA 3FRPB 2RBMA 3GTQB 1ROEA 1IW7D 5CV5A 2JSVX 2R61A 1PTOH 2ON8A 1NR2A 1ZPSA 4IALA 2NTSA 3AMZA 3TDQA 2EYHA 5JPNC 5JEAH 5EPKA 1LT4D 1L4DB 1PGBA 1IGDA 3C1EA 3PUXA 3F2UA 5D3IB 1SSOA 3J9CA 1FCCC 3MFGA 5IGEA 3ZJTA 1EY4A 1EOTA 1F9SA 3QO2A 3KF8A 5IIFA 4K2LA 4FXGC 2NMQA 4KHZA 3SXHA 2RPVA 2RSNA 4Q0FA 4MHEA 2GRIA 1IHZA 3U52E 1IL8A 1VLBA 1EZ6A 2I38A 3SR1A 1XWEA 2IL8A 2FFKB 3CIRB 1TKWB 2H89B 4HJGE 5C0XG 2LHDA 2K01A 3QB3A 2KQ4X 3ABVB 5I6YA 2RDGA 3HRZC 1KAAA 1VCIA 3GV3A 5IGBA 3H3VC 3VR8B 1ZP0B 1LLRD 4OHJA 3CQZB 4XDDA 5BMHA 2F0LA 4HAEA 4ARIA 2Y0SB 1EL0A 1SMYD 1N5XA 4JPSA 3UI3A 2EDGA 1AZQA 3OIPA 4XQNA 5K36H 1EM7A 3SK4A 3FMCA 4I7ZC 1QOHA 3VRAB 1HTPA 2K7VA 5M5XB 2K5WA 4X3UA 2LS01 5C2TB 5T8IA 2NYZD 3AU7A 4C3JG 3D4WA 1U4LA 1F2YA 1DOLA 2ZXOA 1IKMA 5ELBA 1QILA 4DNTB 1HQRD 1GUTA 1Q1EA 1MGSA 1DOYA 3J7AF 1SIJA 3HP3A 1E0BA 2BTEA 3K0YA 1C79A 1FNUA 1JOOA 1SXTA 1H9KA 3VR5A 2QCPX 3FILA 4ZUIA 2LMCB 3G6JB 3R8BA 1NR4A 1EYDA 1GUGA 3LX0A 3K57A 4HROA 3QJYA 4KTAA 2BB5A 1AW7A 2OF1A 1MHXA 1TQOA 3I57A 4ZK9B 1JW9D 1OXUA 1XLPA 3NHHA 3AEGB 3K6OA 5A2QE 3TP6A 3OWFA 3Q69A 4DN4M 4C56C 4FF2A 3H6MA 4IDIA 2SDFA 2BS3B 5KNDA 1F2RI 1CHQD 5BMIA 3MP9A 1GJXA 1SSNA 1DJRD 3WDNA 2R93B 4A9AA 2JX5A 1PXUA 2PW7A 1NENB 2WXGA 2CW0D 3A7LA 4DA2A 1CA5A 4G4KA 4DK1A 4O1NA 2E76C 1RDPD 2F3WA 1ENAA 1L0XB 1F77A 1SNQA 2KECA 1V1PA 2A6HD 4U68A 5DM63 1R4QB 2HCIA 3EVQA 1RWSA 2RDHA 1OXTA 4CKEA 5M9OA 1XX8A 1D5XC 4KV6A 1YMHE 2FBWB 4J1MA 4ZLTF 1E0ZA 2JA7B 4F8MA 3PZ8A 2IT1A 3OHXC 2EPBA 2N88A 5IODA 2WP9B 5KYLA 3DWAA 3N6RA 1FO4A 1SE2A 4Q5VA 2RKSA 1ZE3D 3VA7A 5IGDA 4JWUC 2A68C 3WOEA 3S14B 3I4NB 2M2LA 3HZXA 2M00A 4RCNA 1LTID 1EU4A 1A3TA 5D3DA 3PO2B 3X3MA 3HUIA 4WORA 4GDKB 4GDLB 1V43A 1AWDA 3DM1A 3B2FA 1H9RA 1LTAD 5CYUA 3G7LA 5E1FA 1PFMA 1LT6D 4KMUC 2MP1A 4DK0A 1G8ZD 5K5PA 1S5DD 3A8IE 1PDQA 1CFMA 4OVZA 3SFEB 3ZQ4A 3BK2A 3BVGA 3P75A 1YNNC 1GUSA 4IQZA 5J22A 1S5CD 4B9XA 1ENCA 4CHTB 4Y7NB 1PMRA 1SAPA 5T1IA 2BT6A 5C4JB 4R8IA 1WRIA 2JA6B 4H44C 1JRPA 2CVRA 2JP1A 5EE0A 5ISRA 3D8GA 2AQ2B 4DAVA 1TWFB 1MSHA 4K6LA 3Q6SA 4MIUA 4HCSA 1NI3A 1ZEQX 1KNAA 3I70A 4K14A 4WAFA 4KJOA 1LV9A 1ZXHA 1PTOF 4M0WA 2WXQA 4HN7A 5I6WA 2KCCA 4XXEA 1CM9A 2AX5A 3BZDB 4BA1I 1IGCA 2FINB 5HGTA 4CGYB 1TYGB 1OXXK 2E2DC 1KF6B 4KN4C 3PMFA 3OMGA 3QOLA 5M3MB 2EJGC 2WU2B 1JQYD 5HG2A 3BDLA 1DZ1A 2FMMA 1DGJA 1IBXA 4IOIE 5BN3A 3EFXD 4KKUA 1ML0D 5CV6A 1Y1VB 5C44B 3IFTA 1SF0A 1STGA 1FXIA 3MHBA 3ERQA 1DOIA 3LB8C 4TQ1A 2Z4HA 2EYJA 1OXSC 4A3FB 4A3EB 3LYYA 5DEHA 1YN3A 1MI2A 5LNK1 3H09A 4A3GB 1PZKD 1F0ZA 3TBIB 1ICWA 2QF7A 3AMUA 1F2LA 2HUGA 3FAHA 1KLUD 2NVTB 3GP7A 4KD3A 1OO9B 1M8AA 5M5YB 5EKLA 4QB4A 2E75C 2PW5A 2X69A 2SNMA 1EY6A 1HTLD 1LT3D 3NK9A 4FXKC 2WXJA 3TEYA 4K5XA 1II3A 5TSSA 2F0KA 1JE4A 3KWLA 1TS5A 4TQ0A 1D4BA 2CU3A 3FC4A 1TVXA 5IT9L 1BMLC 1JC7A 2D9UA 5DNFA 1RODA 4QCLA 2V3NA 5HHDG 3VR6A 5FO7B 1BXTA 1NEKB 1CHPD 3L4PA 5JPMC 3AB9A 2B2TA 3T4AC 3J81E 1Y8NB 2WB1B 4FF3A 3GTOB 5AFWA 3AEEB 3DEPA 1U4RA 3FPPA 3M3YB 1C4PA 5M5WB 3ND8A 1F2RC 2VXWA 1HZ6A 2F0MA 5JEAG 5C5MA 5C3JB 1E7PB 3RZDB 1UAPA 4RGOS 3NTHA 1R7SA 2QEJC 2SAKA 5EBCA 4ZRZA 5EKKA 2JYTA 3HOXB 1V97A 3KBXA 4CJ0B 4ZQ3A 2WXKA 4C80A 2NWGA 4H0LC 4CJ1B 2QMTA 1XEEA 1YJIA 3AE9B 3NVYA 4RHRA 2BBCA 3IXSA 1L6VA 3S2HB 2OEDA 4G7ZC 3AECB 4TRDA 3I72A 4KX6B 1S5FD 4KGRA 2HTME 3PUYA 3P4QB 1GOZA 4A3BB 4J8QA 3RFZB 3CWIA 2K5DA 3L9AX 4OIJA 4BY7B 4RNAA 3NBHA 2EXZA 1D1IA 3VYSA 1V8CA 2B2VA 2B2UC 2K1BA 1TS3A 3M85A 4N59A 5FLXE 1C8CA 1LTSD 5K36G 2JWUA 1STBA 2RQXA 4ZKBB 2V4DA 4RH6A 4A3DB 1W6KA 3NRZA 4KN7C 1HHVA 3ND9A 2PYKA 3SK6A 4XTCS 2XWBB 4R8NA 4C3JB 3DWGC 2X6GA 1PDXA 1UNSA 1VMPA 2L1BA 5BN4A 2X38A 3J7YW 1RHPA 1WXQA 2F0PA 3MFYA 3DHQA 5CBEE 1G2TA 4QUCA 2YEPB 3IKJA 4RWSC 3Q8BA 2JEAI 2WDVB 3HS0C 3TZDA 5C5LA 4IUNA 1E2VA 3NTKA 3R2TA 1MSGA 1ZXIA 1MD2D 1QKZA 3S16B 3CU7A 1SJED 2WU5B 3S1RB 3ZYYX 2MEKA 1FNVA 4RAUC 1BQQT 2VZKB 5CC4A 2O2LD 3BYTB 5C4HA 2LKVA 3BWUD 5BYQA 4L63B 4NW2A 4DXFA 2NN6I 3P7JA 1BCPB 4J3OD 2FJ2A 1KDAA 1STAA 2EKIA 4ILWA 2IX0A 1TKYA 3R3OA 3J80E 4LLGM 4WURA 1JMLA 2GB1A 2M0AA 1JICA 2VZKD 1WGKA 2EZVA 4KK7A 3AEDB 3CKIB 3PUVA 5FKAC 1Y8PB 4YXDB 4B08A 2CJNA 2FUG1 1J8IA 5C3WA 2R3ZA 3HKZB 2YEPF 3D31A 2PVOD 1BCPD 1TY2A 1FRRA 1YQ3B 2KMMA 3K5OA 4IUTA 5C6AA 2JSOA 2INPE 5EBDA 1GB1A 2WP8J 2F0UA 1JROA 2NB0A 3Q0AA 1EEFD 1YNJC 2LJIA 2K33A 4PMWA 1IYVA 1CI3M 2A69C 2D5DA 2H1EA 1TKEA 5JAVA 1I4GA 1SYDA 2BYTA 2JA5B 3HOZB 3DWPA 1NYRA 5ELFA 1FMAD 2BS2B 3S2DB 2IX3A 4P16A 1XO3A 1QQRA 1IW7C 1KFYB 3AE5B 1TT2A 2QSDA 1VDVA 1A15A 3CRKC 1BCPF 1DOXA 1KLGD 5LHY1 2NTTA 3FILB 2WACA 5D65A 4RF1A 2L4NA 3PUZA 3VR2A 1XLOA 3MEHA 4IFDI 2PCFB 1QWYA 5EQ0A 1FIQA 3N9YC 4KKTA 1MVKA 1SNDA 1YQ4B 2QDBA 3U9SA 1QOAA 5LL6X 1JQ4A 5HI1A 1O7YA 2IPKD 2M56B 4RKBA 3A7AB 3PUWA 3IAS1 2ID0A 4US9A 2KACA 4HRSA 3GTJB 2HCCA 1ZDXA 1T3QA 5M3FB 4DU9A 2DYOA 3QG1A 1SNPA 1ILPA 3EUB2 1SYEA 2WXLA 1A3UA 3E9SA 4YTPB 1J7AA 1UWMA 1TWHB 3NXWA 3R93A 1K53A 3DEOA 4PMCA 2JYOA 4H2AA 4ULLA 1JB3A 3VRBB 1SMYC 2MPMA 1I4QA 2WXHA 1TWGB 2NVXB 1BOSA 3E6ZX 1NVID 2N9KA 3HVDA 1SE3A 1V1PB 2LFNA 3NS1A 2E74C 3LWEA 1LT5D 4CBVA 1QLBB 1TS2A 3GD7A 4S3SA 1JOKA 5KRUA 5I2XA 4C2MB 2D2CC 3SVMA 1K50A 3IT6B 1JCKB 4K2KA 2EY6A 3E0JA 2EVBA 4ZKCB 1ZUD2 1WTRA 2BW2A 3W9CB 1E10A 4UDUC 1L5PA 1STNA 2C9OA 2AWOA 3A54A 4B9WA 3T3OA 2ZT9C 3BDCA 1B50A 1GUWA 4FNFA 2BDNA 4BBRB 1Z6HA 2ICIA 4OW0A 3ETRA 3BVMA 3I8ZA 5I2YA 1STEA 2WNMA 5DM73 5C3XA 2AQ3B 1ZDVA 4QUFA 2FMCA 3MWYW 4DNRB 5CMDA 3KLSA 2O5IC 3C3LA 4US8A 4ZYSA 1I4XA 3QIAA 3S15B 4HSVA 1DM0B 3D3RA 4IUQA 2PQEA 4I65A 2BCOA 1WTPA 2K28A 5KNBA 5G5HA 2J52A 3RPFC 2B39A 1EIGA 2DYMA 2AWNA 3HVZA 1UUPA 2W3SA 4F88A 1PYWD 2JXTA 5MPOA 2VNUD 4KY7A 2JZPA 3VR4A 1QNUA 1RTNA 5EPLA 4QIWB 1HZ5A 2CW0C 3ZJVA 4MM3B 2Q8TA 3V96A 3GTMB 1L0YB 2W55A 2A68D 4DXGA 3LWUA 1Q3LA 1PUTA 2MHVA 2A6HC 5I4DA 2VB3X 1JR0D 3M4OB 4YT0B 1VDZA 2SEBD 3T13A 1BO0A 2EELA 3C46A 4KHVA 1O78A 1PTOB 4XIGS 2CHBD 3KBGA 3HOVB 5CORA 1SEBD 2MUYA 1D6EC 3OWEB 2J53A 2F0OA 3PV0A 3V05A 2K6AA 3EROA 3R2IA 1IKLA 4NAMA 2AUJD 2SOBA 3PO0A 2RDFA 3X3NA 2PPBC 2PKOA 3K5MA 1LTGD 1PTOD 2B8FA 2BE5C 2EYLA 5ELDA 5JJZA 2XIWA 1XF5L 4L6TB 1PLFA 2AUKA 3U2SC 1H9SB 4R3DA 1N5WA 4AYBB 3L3OC 2EYFA 4XQQA 1XCTL 1FM0D 1IBXB 1PZJD 1C77A 2K04A 2A74C 1WYGA 5C0XI 2N55A 4ZHOA 2EY1A 5ELCA 2PW9A 1SBBB 4FO2A 2F0GA 2Z1CA 3VA5A 2IX1A 1EWYC 3D4RA 2K5PA 3FDTA 3B9JA 1EY0A 4ID6A 3GTPB 1EWHA 1JWAD 2WXNA 1ZXTA 1HFGA 3I4LA 1F9QA 4DAYA 4USAA 1H9MA 4H7BA 4EE2A 1P7EA 3AM9A 2KVMA 2IWHA 1GUOA 4RGMA 4WFN3 1TY0A 3GTKB 5T1GA 1LTBD 2NUCA 4KGTA 1K8MA 1G2SA 4AS1A 1OQRA 3SK8A 5CV8A 4KD4A 4IUVA 4OGQC 1WTOA 4NP5A 3M7NA 1EZ8A 1OFFA 2BDOA 1C48A 2R6GA 1ILQA 1H9JA 2E2IB 2IJ0A 4XDXA 2W82A 4TKOB 2DY8A 4A3IB 4OZBA 5JVG3 4Z9CB 3S1MB 3OPOA 1DYQA 4OZCA 4JBWA 1V8QA 2D62A 2J42A 3CHBD 4A3KB 2WS3B 1BNZA 1XCQL 3BDOA 5D14A 1K83B 3Q24A 3Q23A 1MBYA 5IGFA 5AUKA 4P2CB 1C76A 3MZ5A 4YTMB 1WD1A 1CTMA 2ONQA 2A6EC 1UEAB 4DFAA 1DOMA 5E4WC 4O42A 1B1ZA 1QT9A 2OXPA 3RLFA 1BF4A 3IFDA 1CA6A 4L23A 2I2YA 5FOBB 5C4ZA 3SDZA 1J7CA 2RA4A 1PRTC 3T53B 1A70A 1Q90A 3AE1B 1SNCA 4KKJA 3FEWX 4N9PA 1PFNA 5CV7A 3H8HA 2PIAA 1LTTD 1SB3C 2SNSA 2V4IB 2NVYB 1SFOB 4HKZE 1NYQA 3HGBA 3KQ4A 2HQEA 4HSPA 3I91A 3IAM1 1SYBA 2I07B 3D6WA 1A3VA 4G7OC 2W54A 1O7ZA 1BR9A 1SDFA 1ZYRD 3NZ3A 4NKLA 3JAML 2MJ3A 1DONA 2ICEC 2KJXA 4BBSB 1TR5A 1JWBD 4PMBA 2L55A 1D2BA 3AE3B 1K51A 2MGSA 1I4RA 2O4XA 3P1MA 2EYPA 1S4ZA 3VYTA 4BY1B 4PT5A 4WQMA 1B4OA 4H13C 4CKBA 4XYOA 1LO5D 2E2JB 5IT9E 3Q22A 4YSYB 5E6JA 4KY6A 3PIO3 3QOJA 3T3NA 3FPUB 5LL6S 4M8AA 5KGUA 5BN5A 2K9XA 4WH4A 1ET9A 3C2PA 5IGGA 2DBYA 4A8XC 1ZOYB 3TEWA 4N9TA 2WQYB 4HEDA 1C4AA 1UGJA 4ZUJA 1L4ZB 2WKCA 4L1BA 1NCVA 4OZAA 5CGKA 4C7YA 1GHKA 1B9MA 2B2YC 1C78A 5C3EB 3TP5A 2QIEB 3SK5A 4NJCA 3SE0A 1GUNA 2Q8IB 2N9LA 2WXMA 3GS2A 1JWMD 1EYAA 3TMEA 1FXAA 3IL8A 4X3KA 3I73A 5CV4A 3AV8A 5H92C 3NVVA 2WXFA 1B44D 5JXVA 1SYGA 4HMIA 1S5ED 1RFKA 1VF5C 4V190 2NZ1D 2B2UA 2Z4IA 1K52A 2JQRB 5EGTA 3MHZA 3URYA 4EQOA 1CT1D 3W2DA 2JXMB 3A8KE 1GPXA 2M19A 4FVMA 1DOKA 1RCVD 5HURA 1E2ZA 1KNEA 1EY7A 4ZRQA 1IUEA 2KOLA 2Q5WD 3H0GB 3OIQA 4B0MA 2EY5A 4ME5A 2NVQB 3MTSA 1EQTA 4IZ8A 1D5MC 2PVGC 2BA1A 1QF6A 1CZWA 1Q1BA 3P1HA 5CR3A 1QB5D 2EY2A 4KI0A 1FRDA 2GI9A 5EE1A 5EJWA 3EQLC 2DN8A