1CK1A

Structure of staphylococcal enterotoxin c3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc-mediated dimerization and its effect on activity and conformation of staphylococcal enterotoxin type C.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PROTEIN (ENTEROTOXIN TYPE C-3)
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ck1A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ck1A02
2XRQD 1EFID 4L63B 1YN4A 1D5XC 1QILA 1CT1D 1JR0D 3BYTB 1CQVA 2AQ1B 3MC0B 1RD9D 3CHBD 1ET6A 1PRTD 4DXFA 1HA5A 1SE4A 4UDUC 1FNVA 1XXGA 4TSSA 1TS5A 1BXTA 1B1ZA 1I4GA 3OWEB 1LTID 3MFGA 4K6LA 3R2TA 4DXGA 3R2IA 2NTSA 5ELCA 2QEJC 1JCKB 1EWCA 1SXTA 4RFBA 5D3IB 1UNSA 4L6TB 1LTSD 1PZID 1YN5A 1T5XD 3BVGA 3URYA 1CHPD 4C56C 1ENFA 1TS3A 5FK9C 1D5MC 1SE3A 3EFXD 2XN9C 1LTRD 1BCPB 1JWSD 4RGNA 1PRTF 3W2DA 3KLSX 1FNWA 2RDHA 3O13A 1I4PA 4RGMA 1LTAD 1I4QA 1M4VA 2SEBD 4RGTA 2TSSA 1PYWD 2G9HD 1PTOF 1YN3A 1DJRD 4ZYSA 1PTOD 1LTBD 2O2LD 1BCPD 1PTOH 3BZDB 1RCVD 1EEID 1ESFA 1CHQD 1TY0A 1D5ZC 1G8ZD 4RGOS 5ELBA 3TSSA 3V05A 1UUPA 2XRSD 2WV6D 1MD2D 5D3DA 1AN8A 1LTTD 1S5BD 2R61A 4Z9CB 1LT6D 1HXYD 1KLGD 3BVMA 2NTTA 1PZKD 4BWGB 1BCPC 1EU4A 1RDPD 2AQ2B 1TS2A 1S5DD 1FD7D 2RDGA 5FKAC 2AQ3B 4O1NA 4RHRA 1LT5D 3DWAA 1LT3D 1FNUA 3DWQA 2IJ0A 3BYYB 1GOZA 1LTGD 1PRTB 1PTOC 1BCPF 1JQYD 2XNAC 1LT4D 1DYQA 1PTOB 3SEBA 1I4XA 1STEA 1RF2D 1I4RA 2ICIA 1F77A 1EEFD 1SJHD 5I4DA 1TY2A 5TSSA 4RH6A 1B44D 1LLRD 2IPKD 1SBBB 1FGBD 2QILA 3BVZA 1V1OA 1PZJD 1V1PB 1HTLD 1S5CD 3R8BA 1L0YB 1ET9A 1LO5D 1S5FD 1PRTC 1SEBD 4OHJA 3DWPA 1JWUD 1S5ED 1HQRD 2Z8LA 4RHSA 5ELEA 1KLUD 4RCOA 1JWMD 3EA6A 1AW7A 2CHBD 2J4XA 1CK1A 1L0XB 5ELFA 4NZLB 1EU3A 5ELDA 1TS4A 1SE2A 1I4HA 3GP7A 1SJED 1XTCD 1V1PA 1KTKA 1D6EC
chains in the Genus database with same CATH superfamily
1GHJA 3CQZH 3L10B 2DYBA 5HKHA 4AQ7A 4DV0L 3TBLD 5IYCH 2RA4A 1A3TA 2JVCA 4WWMA 2HDEA 3OIQA 1HHVA 4JI0Q 3RNUA 3T3NA 1LYLA 2QKIC 4IOIE 1CKNB 4DUZL 5C44H 2IT1A 3KW5B 2BYTA 4WH4A 4TSSA 3I4LA 2JA8H 4OZBA 1WM3A 1I4GA 1NR2A 1NEKB 5CMDA 1BF4A 2C9WB 5LMUQ 4DV2L 3V61A 1XT9B 4N59A 3LXFA 1S3OA 4B9XA 3HOUB 3H0GB 4RFBA 3STBD 4ZRIA 1XPUA 4NXML 4LF5Q 3P42A 4KD3A 1JQ4A 5AFWA 2NB0A 4CJ1B 4EEWA 2RD0A 2BQQA 1CZWA 2Y5BB 3HVZA 1L4DB 3MJ5A 3AEBB 4TV3A 2Q8TA 3OSOA 3N1YC 1U9RA 2KOLA 3HZXA 4B3TL 1OXXK 2F0VA 4G7HC 2HCCA 3K0XA 3S2DH 3LNNA 5AJ3L 4E71A 3NBIA 1O7YA 1YVCA 1I4QA 1GUWA 4NQLB 3SGIA 1P16A 3NTHA 4GDKA 4D2KA 2YV5A 1PTOF 1QOHA 1DJRD 1Y1VG 3NP8A 3HM3A 2EMTA 2O2LD 4ANWA 2I5HA 2WXFA 2ZVNA 1SROA 3HS0C 4MNOA 1MG8A 5C2TB 3UIPB 1WTOA 4LF9Q 1ZKOA 3QC8B 3M4YA 1MJCA 1WY8A 2C35B 3OW2A 3G6JB 1NSNS 4FP5D 4ZRZA 4HEA1 1ZPSA 1Q1OA 5JVH3 1N36Q 1J7AA 1VDZA 1XPOA 5J3BA 4HSVA 5FLXc 3AV8A 2CQAA 1TGZB 2Z4HA 5NUCA 3D6WA 3P75A 1WJNA 1TWFH 2N9PC 4Q2JA 3AB9A 1Q7YC 2WDRB 2RPQA 3G7LA 1WTQA 4W9FA 3EN2A 1FL0A 3ICEA 2JF5A 4KZCA 2GB1A 4FJVB 3JAMi 2A6HD 1NYQA 5EE3A 4DR6Q 3GTJH 3RI7C 3ZGZA 3L08A 4MACA 4GZYC 4DK1A 3H1UA 4EQPA 4W9KA 2DYMA 3L4PA 3CRLC 1UGJA 2PZWA 4R8NA 2N1VA 3UIOB 2R92G 1WSPA 3A0JA 2JA5B 2JZ3B 4KX6B 3WANA 2A4ZA 3N20C 3RN5A 1G291 1V5OA 3DHHC 5I2YA 4JYAQ 3OTOL 2CHBD 2OF1A 3UF8A 1JOKA 2JYOA 4H44C 1HTPA 4A3DH 5GROA 4H2AA 2QDLA 2NVXB 5IGCA 5G55A 2L3ZA 1SNDA 4X64L 3CSTA 3ZTDA 1WJUA 2MJ3A 4OONA 2MA9B 3RZOB 4WWPA 1WXMA 2K5WA 2LXCA 3AQQA 3NWSA 1IYJB 4A3GB 5E1FA 3U9SA 1EFID 1C9FA 3QIAA 3Q8DA 4QB4A 2SAKA 3ZJYC 2LHEA 4QQBX 1JR0D 4B9KA 1UEAB 2E6XA 4BZAA 3D3RA 1ZW7A 5C3EG 1PHJA 4ZLTF 2IO2B 3GE3C 1Z2MA 1U4MA 2MUYA 3PS6A 4P6VF 2DLBA 4KHPL 1PRTD 1C9OA 4ZRKA 2KFKA 1WTRA 4IUPA 5GAEC 2EYPA 1CFMA 1BXTA 3PUXA 4XGAB 4KVGB 2SDFA 3OWEB 5IGDA 4DV5Q 2FBWB 3CPWA 4GLXA 3CC7A 1HH2P 4JBJA 3U4EG 4I6LB 3M63B 1WTVA 2DJGC 4UHVA 1LABA 1EYAA 2MCNB 3W5VB 3AU4A 4B95A 1T5XD 4OIKA 1LXDA 3IAM1 2PQAB 5ELOA 1ILPA 4DV5L 2HE7A 5IA7A 2VRRB 2ZXOA 4HCPB 1LTRD 5D94A 3BK1A 3EQLC 5CTRC 2MWSB 3AEVA 2B63G 1HJPA 3KLSX 1L0VB 2PIAA 3SFDB 4K7UA 3HK0A 4K81A 1Q1EA 3S2AA 2SEBD 2D5DA 3S24A 3RD4A 3A4RA 2DZMA 5GAGC 1O7LA 1XMQQ 5HFYA 1STHA 2F0SA 2BS2B 4WJWA 1WGDA 5DM73 4BBSB 2MLBA 3CIRB 1YQ3B 2LY7A 2ZNVC 3ETRA 1ZYRD 5KIXA 3HOVH 2BYEA 4QJFA 2RDBC 3FDTA 4C80A 3HM6X 2XRSD 1Z9FA 2LUEA 2NZ1D 3TIXA 4HJ9A 1KL9A 1GKHA 2QCZA 5CV5A 4LF7L 4AOFA 1WCMG 3RUZA 1EY6A 3EBEA 4BY1B 5M3FG 4DR5Q 2WDVB 1KIXA 2F0IA 1YJWA 2LSSA 4YWKA 4G7OC 4GOPC 1E9MA 1R4NI 2JU6X 2Z1CA 3NS8A 3HEJA 2V4IB 3DWQA 5CHVC 4JV5Q 2INCC 1GOZA 3D8GA 2VUMB 2K6DB 4GU2A 5GQOA 3M3YB 5J1ZA 3AE6B 3S9WA 2IY5B 2M19A 1A5RA 3MHBA 1WM2A 5HI1A 1EIGA 5EE0A 4N9TA 3HVDA 2HHHL 1WH3A 4IALA 1RM6C 2K5DA 4JI7Q 2WGSA 3VYRA 1B4OA 4ZKBB 1WXVA 3Q3FA 1FD6A 4IM2A 1B44D 1E1OA 3NUCA 4HN7A 4ME5A 1CKMA 4RWSC 3B9JA 1SNPA 2F0FA 3PF4A 4DFAA 2C9OA 4HSPA 1TTNA 1XNRL 1VZ8A 3R3OA 1STAA 1X3EA 4RG1A 2JA7G 3GTPB 3T1YL 4YWGG 1EOTA 4GMVA 1BQQT 1IGCA 1X3FA 2KCCA 4DV4L 5C4XH 4HIDA 2K5HA 2FCMA 4ASWC 1DGJA 3ZW3A 4B9WA 1UE7A 2N49A 3Q69A 1STYA 1ZOYB 4BXXH 2I5MX 4GXBA 4ZAIA 2N9LA 4ANUA 1SDFA 3S2HB 1I5FA 5D65A 3AE4B 1QF6A 4DK6C 4KGRA 2F0NA 1ONLA 2OXPA 3S15H 3OTOQ 1NNXA 1TWFB 4HCNB 2KDBA 1A3VA 3TL5A 4AUQC 4W9GA 3WWVA 5CV4A 4DF7A 5C4XG 1EY5A 4MJSA 4JI6Q 1Z6HA 2ZW0A 4K3BA 3MHSD 4XDXA 3T53B 1F9JA 5A2QL 4W9CA 1EIFA 4LWCA 2JA7B 3PZ8A 4JPSA 1SN8A 4QMGA 3CCMA 1Q0WB 3UDGA 4M8NA 1R4PB 2EQSA 3UINB 3Q6SA 3M4PA 5BN5A 3UI3A 2H4OA 1RFKA 3AEEB 2ON8A 4B0MA 5D7GA 3I7FA 5AUIA 2PW5A 4EFOA 4DR7L 2WAQG 3VRBB 4NB3A 3NVYA 3LB8C 4M8MA 5IO9A 2VB3X 1GPXA 4QUCA 4DXGA 5IODA 3EHVA 3AMZA 2ZEQA 4OZAA 3DBLB 2QEJC 4F7ZA 1QT9A 5L37A 4WWNA 4DAVA 3ABVB 4LLGM 1XX8A 1OXVA 1Y8RC 4C56C 1TIID 3HIZA 4X6AH 2B8FA 2ZTDA 2JRHA 1EUJA 2KKCA 3CC2A 4LTUA 2RSNA 3I9V1 3K5LA 2E8GA 4WQOB 2WDTB 3A7LA 5IGGA 1R9TH 1YNTE 2L5TA 1B3AA 3RZOH 3L13A 4A3JB 5L83A 4YHHL 3FKYA 2A68D 3HOXH 4IKGA 1I4PA 3UGBB 2WAQB 5IGBA 4PK1A 2XEWA 5IT9L 1SYEA 2BYVE 1WGGA 4PT5A 2I5LX 3KK7A 2D3CA 1HNXQ 2XWBB 1WI0A 2LWPA 2PEAA 3APDA 1WI5A 1QJOA 4KHZA 4R4OA 3DVGY 2CW0C 4DV2Q 1ZYRC 1A70A 3CCLA 1QOGA 3IAS1 3HOXG 4LFAL 1MPEA 3T51B 4YSYB 1F0ZA 2OTJA 2WIIB 3J81L 2H88B 1IXRA 2Y5PA 2LFNA 5BMIA 4A3FH 5FO8B 2ZPNA 2H1EA 3F2CA 3EJIA 2GI9A 4RA8A 3BVMA 1KLGD 2AL3A 5LXIB 5KYIA 2WKCA 3ULJA 3H7PA 3HOWG 2F0JA 4GNXC 2EMSA 1JOOA 1FYCA 3U50C 4LF7Q 2Z0EB 1K8MA 4DV0Q 2WX0A 2VW9A 2L83A 4KI0A 4DR5L 3DBHB 1VZ7A 3BJUA 2E2HH 1Q8IA 4US9A 1LM0A 1SYGA 1H95A 1UE1A 5K36G 4M8AA 2XNAC 2E2IB 4DUYQ 4TQ0A 4DR1L 4II2B 3PUZA 4I65A 3TEYA 1OQRA 2YYZA 4F8MA 4JV5L 4NPSA 1X3GA 5T1IA 3U2SC 1M8AA 3LWUA 1MFWA 3Q8BA 1XLNA 2NBUA 2K9XA 2B2UC 4FF4A 1S5CD 3PSIA 1L0YB 3R8BA 1P0RA 3PO3B 1VQJA 1Y69U 1CA5A 3B6YA 1KAWA 3DWPA 1MHHE 5KGUA 4JIOU 2WKDA 4DV3L 4ANVA 2FIFA 1QVCA 5G5GA 1F2LA 3W1GA 2HT1A 3JSVA 1Q86C 1FJGQ 1V9JA 2KWUB 1F2RI 2X8XX 3DUZA 1YD8U 2K6QA 4DR3Q 1SE2A 1M94A 5C5MA 1XLOA 3GP7A 3VA7A 2BCOA 1QQRA 3DHQA 4C3HG 3H8HA 5C6AA 4DR2L 4OXPA 4NAWB 2AKWB 4KGTA 3PO3G 2IGGA 2L32A 2W55A 1VMPA 3A7AB 3Q8EA 4ACFA 1PVOA 1BT0A 1P8LA 4KLKA 3PZDA 1NBWA 2OEDA 1WJ6A 1WTHA 2PLPA 2WYQA 1ILQA 4DAMA 3O65B 3PV1A 2YTXA 1W6KA 1BBXC 1E8YA 4LFCL 3AN1A 4JLCA 3HRZC 4WRDA 2X69A 4A3BG 4AJYB 2JA6H 1U4LA 1Q81C 3BS1A 3P4SB 4K3CA 2O2VB 1B8AA 3CF5A 1N34L 1ZDXA 2LEKA 4MN3A 2LGSA 4J6HA 4RM8A 1STGA 1WGHA 4QIWE 4JOIA 4EOYA 3WIMA 4OW0A 2YLMA 1SRUA 4P7IA 3ZVVA 5FK9C 2JEAI 3DPDA 2YTVA 3GB1A 4C4VB 2WB1E 3EFXD 2DY8A 2WU2B 4YSXB 5JHAA 5CV8A 2JYTA 1BCPB 2KWDA 1B50A 1JE5A 4DAYB 1V80A 2I1JA 3C1FA 4HJGE 1FNWA 1Q8KA 2MP2B 2RGFA 3J9CA 2WXLA 5C44B 1WR1A 2W3RA 2TSSA 4AYBG 1HTQA 4DDID 2JA8B 3JAME 1T0YA 2M56B 4GNXB 1JB7A 5I6WA 2KHSA 4LF5L 2YTYA 1ESFA 4OGQC 3J80L 4K5XA 1E7PB 1F2MA 3H15A 1FRRA 2L0FA 3K80C 3FC4A 3VFKA 1SIJA 5BYSA 3GTLB 1LT6D 2JEBI 4DDGD 2JJQA 2KA7A 1H9SA 1QKZA 2DX5B 2OTLA 2EYFA 2K32A 4WAAA 3SDLC 4K7WA 1I50B 4FNFA 3FVQA 3VUWA 3MTSA 3VR6A 4Y7NH 4KSLC 5D6JB 5G5HA 3F1ZA 4C3JG 4AP4C 3MP9A 3QK0A 3TCAA 1LTGD 3J81c 1QVGA 3T1HQ 2IY0B 2E5LL 4JL9A 1L2NA 2XVSA 1KFYB 3SR6A 4A3JH 4A4IA 5I2XA 1Z5SB 4Y7NB 4X57B 4BVUC 1C78A 2MHJA 2EPBA 1T0SC 5TSSA 2KDMA 3ER0A 4A3LG 5AZGA 2WB1G 3AXCA 1V1OA 2MO0A 2CH4W 4MEMA 2J52A 2LGDA 2KMMA 4HCSA 3NS1A 3F2BA 4CHTB 5E6PA 1JWUD 3I90A 4WJPA 4NY0A 4W9DA 3I70A 5ELEA 5CX3A 4EZJA 4P2CB 3AEGB 4IPHA 1E2WA 3X3NA 3HOYB 3RZDH 2JZPA 1TQOA 5ELFA 3A9JA 1NCVA 4ID6A 1WD0A 2JA7H 3HOUH 5KNBA 1XTCD 2B2TC 1OEYJ 2EKEC 1TKEA 4M00A 1FXAA 1SAPA 2F4VL 4RKBA 3BYTB 3GTJB 1I6VC 1HEZE 3Q14C 4WJOA 1CTMA 3ECIA 1SYBA 1D4BA 3KUPA 4QL5A 2ZCBA 1ET6A 3W1YA 4EZLA 3PUVA 2NVTH 2YU9B 2B63B 5BMHA 1F2YA 3HOYG 1G6ZA 3VR4A 1XXGA 2UXBQ 3L17A 1V2YA 4W9LA 1PQSA 3EECA 1YHAA 2LXKA 1KDBA 2QDBA 1EZ6A 1SYFA 3GZNB 3KVFB 4ZRJA 1TKWB 3GDEA 2F4VQ 3GV3A 1VQHA 3CPFA 4C1NI 1FR3A 3E0EA 1E8XA 4AJWA 2DAFA 1IBLQ 4FXKC 2IX1A 3JAMc 2VH2A 1LTSD 3KF6B 1Y1WG 2KJXA 3ZUNA 4HRSA 2ZJRA 3RMKC 2GVBA 2MNAA 3K58A 4DPGA 4A75A 4CBVA 1IBXB 1CM9A 2IWHA 3D4DA 4EQ5A 4TVAB 2UXBL 2F3IA 1AARA 1PRTF 4R1JA 2ZJQA 1PV4A 1V49A 5M5YH 1J8CA 3AYHB 3MHZA 2F52A 1TBEA 1F2ZA 1M4VA 2BS4B 4HIOA 2E2JH 3CMAA 1K73C 3G6EA 1N33L 1PTOD 1XD3B 1EWHA 5DNFA 5M5YB 1SE9A 2HUGA 3ALBA 3FAHA 2AWTA 1IP9A 4HPPA 4GLSC 4YTMB 3OJ3A 4REZA 2ASQA 1UUPA 2KLCA 1PH1A 2OWOA 1P98A 2B2VA 1YNNC 3PIO3 4JI0L 1L6VA 1CUKA 2K5PA 2M1MA 3T9LA 1V43A 1RWSA 2E2IH 4C00A 4OWXB 2ZNVB 5EBDA 4PZ8A 1VRAB 2GBKA 4JI3L 4JW0A 1D1IA 2B3GA 2K5QA 5DEHA 2PI2A 5EBCA 5J17A 4L2YA 2PMZB 3I73A 1VQMA 4MTNA 2WNMA 1H9JA 3TJPA 3HG9A 3BYYB 4GN3B 4RCNA 3KYDD 4EQOA 1VCIA 3S1RH 2UUAQ 4LF4L 5IGEA 1L5PA 2V3NA 1RF2D 4IUQA 3IFDA 2LGIA 3FILB 1VQCA 3MC9A 2GN5A 2DZKA 4BBRG 2KDIA 2SNMA 2DYOA 1SBBB 1QNKA 1UWVA 4IUUA 2UUAL 2NVYH 3N3KB 1IW7C 1WYWB 3H3VC 2QIEB 1LO5D 3VAWA 3A5UA 1MSGA 3NZUA 3CC4A 1JICA 5AJ3Q 2O2VA 5M3FH 5FLMH 1HUMA 4A3DG 2B2WC 2RCNA 3HFZB 1VR9A 3IVFA 3KH0A 1EY0A 4FJYA 4WQMA 3RZFA 4C2MB 4C1NK 3Q8FA 1E0BA 2LI5A 2N88A 2XGTA 4JG2A 4MM3B 4LF9L 3P1MA 1XQQA 1X3QA 3J81i 1WCMB 2VQEQ 2C5LC 2K03A 1NTGA 5M3FB 4Y52H 2WXRA 1GUGA 4EE2A 1E90A 3TP6A 1PA6A 3KWLA 5C3EH 4ZQ3A 2QJLA 2B2UA 5IYBG 4DV6L 2C5CA 2L1AA 3RN9C 4I6NB 3MC0B 3NXWA 4KKJA 2KWVB 5C0XH 1NBFC 4K5VA 2ZXPA 5IYDG 4GN5A 3KFUA 1WMHB 1KXLA 4GN4B 3NOBA 2UXCL 1PH6A 2KJRA 2C7HA 1FNVA 5BYRA 1EF1A 1P9DU 1TWHB 4GKJL 4NXNL 1V81A 2BT6A 3ZNZB 2KEEA 3ZKJC 3HOVB 2F3WA 4FF1A 4ARIA 2NTSA 4OL7A 3QWZB 2PJHA 4OO1G 1E2ZA 1JCKB 3CU7A 4WJ4A 2PE6B 5IP4D 4IUMB 4EGVA 1B7YB 4G57A 1SR3A 3S15B 2WXPA 4DUYL 2M00A 3M95A 2CS4A 3CCSA 2MJDA 2UXCQ 4IURA 2E2JB 4JWSC 1BNZA 2MBOA 3A1QB 2LVOA 3T13A 4F88A 3K7UC 1IPGA 3AI5A 4PYUA 2EYJA 3DBRI 3S1QH 3A56A 4B3RQ 4CDCC 2D3AA 2L05A 4P16A 2AX5A 1E1TA 3VDYA 4XC2A 5C4XB 1LTBD 4IG7B 4X65L 1B2TA 1CSPA 4HJ8A 1X65A 1IHZA 2LRWA 2FUHB 5EKKA 2NPTA 2CR5A 1AYFA 2F0KA 3GQBA 2WV6D 3PIPA 3PLVA 4KKSA 2ES2A 4JVZA 3MEHA 2UXDQ 2FMCA 4IZ8A 4NQKE 1AZPA 2EY6A 1IZ6A 1C1YB 2B76B 3RNFC 1EU4A 1BDOA 2AHOB 3RLFA 3NZ3A 5IGFA 3PZ7A 4XYQA 2YVCA 4K8IA 1B53A 3W9CB 5E4XA 1JC7A 3B2GA 3QHTA 4MSQB 4JPBW 3NBHA 4A3KH 2M4NA 3MXPA 3DCGA 3ZJTA 4DR4L 1GVPA 2O6VA 1J5EQ 4A3BH 2AL6A 4G11A 1XCTL 3RNGC 5JPMC 4A3PA 4OO1H 4GDKB 4BOSC 4HKZE 3A55A 1L1OC 2ICIA 4GGQA 2E75C 1HNZQ 2GBRA 4AWJA 2ENBA 1TWCH 3ONAB 4XIGS 1TWAB 4CKBA 1HQMC 4LK1C 1I6HH 1K8RB 4L5SA 1KH0A 2QILA 3VR5A 4F87A 1PZJD 3CCRA 2K8BA 3A8JE 1BUIC 3QIJA 4IUNA 3BZCA 3G48A 3KF8A 3C8YA 5HG2A 1KJTA 1VDVA 3WOEA 1R9TB 3F2UA 4YWMA 5E4WC 3SXHA 5I9PA 3L16A 1ZKHA 4XYCA 1KLUD 3Q3MC 5IN7A 3R7RA 1TWAH 3HOXB 1I6HB 4Q5VA 1BVSA 4WIPA 1AE3A 1VQNA 2WWZA 1GNUA 1ML0D 1EOVA 3EGRA 2FUG1 4NZLB 4ZDVA 1ENAA 5IYBH 5ELDA 4C4VA 1ZXTA 1S72A 2D0OA 2XSCA 1HNXL 1F9QA 2A69C 4LFAQ 4DV7Q 4NKLA 1V1PA 2UUCL 5G2NA 2F0WA 3GD7A 4LAAA 1FIQA 4ANXA 1B70B 4LDTB 2VQFL 1SSNA 1C4QA 2PCFB 2Z6KC 1OQYA 2R2QA 3U52E 2QEXA 1EFWA 4TKNA 4NP5A 3N1XC 4E3CA 3RNEC 5IE8A 1OO9B 3CCUA 3TQYA 4A3EB 4L5RC 2GBMA 2F0EA 3S14H 3ZIMA 4FO2A 4H13C 2H5XA 3H0GH 5IWAL 1K3BC 5DM63 1KC8C 1D1KA 4HIMA 3HKZE 1JW9D 2DY7A 2IHEA 3C2PA 1J8IA 5K36H 3S1MB 4JBMA 1WTPA 4YY3Q 2A6EC 3J81j 4AYBB 1WTWA 4JC0A 3VXWA 4IM3A 5F2DA 4A3EH 4TUUA 4I7AA 3NE5B 2Q2HA 4IPCA 2G1EA 1UNSA 2K52A 4X3UA 1PH5A 4G50A 4BKSD 1WGYA 3ONSA 2EIFA 1PZID 2DWQA 1PFMA 1ENFA 1E3PA 5M5WH 1AZQA 2BWES 4YY3L 5EPJA 2FHTA 4A9AA 2AMCB 1EY8A 4A3EG 3NZSA 1PFDA 5J22A 4WJNA 4A93B 5DLQE 2IX3A 4LF6L 3W1SC 1FRDA 2K7VA 3BDCA 4OIJA 1V8CA 2TMPA 2A6HC 4ZKCB 3A8KE 1LTAD 4KDLB 3NK9A 5IYCG 1FFUA 1TWGB 2ID0A 1I35A 1GC7A 4C3JB 3H7SA 4C3HB 3PREA 2A1AA 3VYSA 1N32L 1YJ1A 1BMLC 1J0GA 1PMRA 3FPPA 4OWTB 2L76A 4KY7A 3ZO5B 4PYZA 3A9KB 2R93G 2ATWA 3QB3A 3MTNB 5EQ0A 3QJZA 4X3SA 1STNA 4KN7C 4ZOHC 4DHZE 1D5ZC 4KK7A 4RGOS 5KEEA 3EFUA 1TVXA 3SHLA 1WD1A 1AN8A 1K3RA 2K8CA 2G4SA 2N4FA 3ZJVA 1HR0W 2MSED 3LX0A 1UAPA 3PVLA 2NTTA 3Q2AC 4A3BB 2WB1B 1V9PA 1SE8A 2OT2A 3K9OB 1TYGB 3LWEA 4XXEA 2F0HA 3T1YQ 5M3MH 3GTKH 4NAMA 4YXDB 4JI3Q 5JJLA 2I1KA 2W54A 1L0WA 2W3SA 1VQ8A 2WAQE 1YJ9A 4A3LH 1WFYA 3EIVA 1XNQL 4KV6A 4CJ0B 3KJPA 2CJNA 3K5NA 2PVOD 1BCPF 1EY9A 1YNXA 2NBVB 1WX8A 2R7DA 3T3OA 2KEDA 1R4MB 2F0MA 3E3XA 1ICFB 3PLUA 4YWLA 2WXNA 3MFYA 1AWDA 4JK1C 3I4MG 1GHKA 1ZGUB 2RDFA 4DR4Q 3VR9B 2K01A 3KF8B 3V2TA 4J15A 4X66L 5C44G 1K9MC 1DONA 2GMIC 1HTLD 2JA8G 5E6JA 1V6EA 1SEBD 4L8JA 2B8GA 4LNKA 5C4JH 3J7AV 5COYA 1K52A 2KUMA 2JA6B 4NXMQ 1V1QA 1G2SA 1O7ZA 1VQDA 4AYBE 3IFWB 3NHEB 3RD2A 4POFA 3RT3B 3EUB2 2K6AA 4BY7H 2JRIB 3RUIB 1EZ8A 3P4RB 4AIMA 5C4JB 5KHOA 2KK8A 1YN4A 4OX9L 3PSEB 2D5GA 2N55A 1KHIA 3F8TA 4K5WA 1J5EL 2ALYB 2V9HA 1KAAA 2AQ1B 1LGRA 4IWOA 1EWIA 1PYBA 1RD9D 3MEFA 2B2WA 4U673 4FVMA 1D7QA 3HP3A 3K81C 3PMFA 1I50H 4KTAA 3M4OH 1HA5A 1NI2A 1PDXA 4UP9A 2FAZA 4EUTA 3S16H 2UWQA 2MBQA 2LJ5A 1YJNA 4ICVA 3J7AF 4KD4A 3M3YH 2GA4B 1Z47A 3NQTA 3I5JC 3AU7A 5LMNQ 2KDEB 3Q3NC 3KBGA 4IC7B 5CHWA 2EYLA 1XPRA 4MDKE 3DM3A 3AE1B 1NENB 3DXJC 1R4NB 1V86A 3TS2A 3DBSA 1PGAA 3C19A 1MGSA 2R92B 2EY5A 3URYA 4DAYA 1MJEA 2IX0A 2V4DA 3CMMB 3KUZA 1D5MC 4OVUA 2B39A 3CRKC 4J8QA 4LNQA 5D14A 3RNCC 2OJRA 3GTPH 1JWAD 3AFPA 2QC8A 4GNXA 2JSVX 1D8LA 2BKFA 1C8CA 5JHBA 2KTFA 4G4KA 1YN3A 4MT5A 4IPDA 4K1RB 5G3LD 3RZDB 5JZEB 2NWGA 2KT7A 3KOJA 3ERQA 5BN3A 1RCVD 1RIPA 1RKNA 1RYJA 1WF9A 3IT4B 3QAQA 3N52A 2KMAA 1U4AA 4KV2A 1MG4A 1E24A 1QG7A 1K8OA 2KANA 1NMFA 4APVA 4OEMB 3PRMB 1N32Q 3I2ZA 3ZYYX 4ZYNA 1BOSA 2VUMH 4JGHB 3V60A 3MA2B 1JALA 2ICEC 3U8ZA 2UYZB 4QGUA 1YX6B 3WAMA 4CQNA 1U4RA 2AQ3B 4OELB 5FKAC 1HRJA 2L55A 4A3IH 3GTQH 1XTDA 1Y1WB 1ZP0B 1EUVB 1Q12A 1WE7A 5EE1A 1WOCA 2FE8A 1RL2A 1N5XA 3U7ZA 2Z4IA 1L7YA 2VH1A 1AH9A 1EEFD 1SNQA 2NR2A 5I4DA 2CQOA 1A63A 2FNJB 3IG3A 4RKLA 2RSOA 4DK3C 2GLSA 2N9EB 3MXNB 4A8XC 1J7CA 4CKEA 3PUWA 1C48A 4FDBA 3SVMA 3DBHI 4ARCA 3AM9A 2KVZA 1YMHE 3C0RB 4K8JA 5FO7B 2PPBC 3SDZA 3MVVA 4YT0B 1WZ0A 2VZKD 1JWBD 3I91A 2KJ6A 3AECB 1WJJA 1U0LA 2NN6G 3E6ZX 3GTOB 2WQYB 3E9HA 2KOXA 2VXWA 4J6IA 3WA0A 2X6GA 3X23A 3K6OA 2HJ8A 3QOLA 3W1SA 4LNOA 2K5VA 4JI8L 2MJ8A 5T8IA 3RPFC 3I3TB 3J80i 3APCA 2A68C 3BK2A 3Q22A 1DYQA 1KTKA 1LTLA 2DHZA 4FJZA 1C7YA 1VCBA 2FCQA 1VQBA 1LV9A 1TWCB 4XX5A 5BR8Q 3KQ4A 2F3VA 2NVYB 4YIJA 4ZRQA 1XMQL 4HWIB 1SB3C 1SYDA 2EVBA 2L1BA 5FLXE 2K1BA 3OJ4B 4UP7A 1F9RA 4IWQA 4CDFC 1Y8NB 3E56A 1D2BA 2V1YA 4IOCA 5JXVA 4K6LA 2J0JA 1IBKL 2RPVA 2WXMA 1ZUD2 3JSVB 1K8AC 5EPKA 2HD3A 4R4QA 3JW0X 4R9WA 1BO0A 3UE1A 1VLBA 4CYEA 3J7YW 2BPSA 3J81E 1QUQB 4XQNA 3A1QA 1SNOA 2KD0A 1TWGH 3DHIC 1HZ9A 3NSWA 4A3DB 3K5MA 2M8SA 4C3HH 2I38A 3V3XA 3TRZA 2XN9C 1OXUA 1BUVT 1UGMA 1A62A 1FJGL 1EL0A 1VF7A 3GOEA 4BKSA 4PS8A 3H6MA 2JN4A 3I3CA 3W2DA 3QQ8B 1XCQL 2WXHA 5J18A 1O7IA 2VQFQ 4NJCA 1GUNA 1NR4A 1WIAA 2X38A 5DPSA 3X3MA 3S1RB 1FXIA 4EVOA 2I46A 1J6QA 1PGBA 4K2LA 1ICWA 2ASBA 1UE6A 4LMQD 2BDNA 4JOIC 2CHXA 4KKTA 1DD2A 3GTMH 1QZGA 4MIUA 4K2KA 3S2DB 1K83H 4ZUIA 3HKZB 4ABNA 1MD2D 4ZRPA 1S5BD 1NVID 5LMNL 1E8WA 4DV3Q 2HD5B 3MXUA 4QUFA 4FF3A 1G2TA 2QW7A 1NDDA 3Q0AA 4B6WA 4DHJB 1WYGA 5AUKA 2KACA 3MZ5A 4R4TA 3H09A 1IYVA 1FD7D 3HOVG 4LJOB 5AZHA 2E76C 2JUOA 3OIPA 3DWAA 3T16A 2GVAA 3KLSA 4MSMB 3IL8A 1JB3A 2IJ0A 2J7ZA 4OVVA 3IBEA 4PS7A 4N9PA 1RRBA 3VH3B 5M9OA 4HTHA 3AEDB 1FCCC 5CV9A 3ITPA 3BIID 2KFKB 2HIVA 3H7PB 5ELNA 4DR3L 3T4AC 2KFJA 5M3MG 2WXOA 1LT4D 4MGKE 2NVUI 4L1BA 1WR6E 4KKUA 3UDFA 4HJKA 1PYSB 3IXSA 3VYTA 3I55A 3PIOA 1X56A 3NHHA 1LACA 2G5DA 1TY2A 2F0TA 1CKOA 2HQEA 5T1GA 2M2LA 4JI8Q 4A3JG 3H3VH 4A3KG 3HOZG 2BDOA 3NY5A 4KY5A 2AWOA 4JI2L 5C5LA 1DGSA 4MGYE 4GDLA 1QZHA 2DNCA 4AS1A 3CXCA 4H7BA 1PRTC 4O2DA 4DV1Q 2BH2A 4DK5A 3TZDA 1NY4A 2WLBA 2D3BA 1RAXA 2D9UA 2JXMB 2PMZE 4M01A 2V1CC 1I3QB 5EPLA 4US8A 5BYQA 1FM0D 1CK1A 4JI6L 1E7VA 1X55A 3CF6E 3P2BA 4JQWC 2MP2A 4DR6L 2BE5C 2D2QA 3AE8B 3NJTA 3ZRFA 1B9NA 4NJ7A 3IRBA 3W5OA 2PQEA 1J9OA 3A8IE 1IBKQ 3VA5A 3HOWB 1EIHA 2ACZB 4BY7G 2VS1A 3K0YA 4A3FB 2NBWB 4CO7A 4JYAL 1J7BA 2EXDA 1MVKA 3M62B 1EQRA 1CT1D 2WINB 2E74C 4XT3B 1EQTA 1CQVA 4R4IA 1PH2A 4DR7Q 4AH6A 3SU8X 4KHVA 5C4HA 2KENA 4C7ZA 1HZBA 4HJ7A 1UZXB 4LNFA 4P1CC 1EIYB 1CA6A 4H0LC 1X6OA 4XT1B 5JOBA 1CSQA 3A9KA 3UQBA 1SMXA 1SE4A 2NZOA 4H02A 1KRSA 3I56A 3SFEB 1EYDA 4A3MG 4LCDE 5ISRA 3JAML 1B1ZA 3TZUA 2XIWA 3CMEA 1PFSA 1I94Q 2A74C 3RMHA 1VQKA 1O80A 3PGEA 2J0KA 3Q24A 3VDZA 4EZKA 1MI2A 5GAHC 2B2TA 4BY7B 3V96A 4P74A 1LFDA 2KXJA 1STBA 1ZDVA 3L0WB 1PXUA 3OPOA 1II3A 1N8RC 2F0DA 4HEDA 1YN5A 4KDIC 1VQAA 5LMUL 3NVWA 3DQVA 3APFA 1IYUA 1LUZA 2F0PA 1DOMA 4N8FA 4BBSH 3L7ZC 3X0WA 1K0RA 5HGQA 4HR7B 3QG1A 5C3JB 2UUBL 1UH6A 4X66Q 4BA1I 3M4QA 3GTMB 1X3PA 2LGXA 2MBBB 3B0AA 3E9SA 1YJJA 4N58A 3P4PB 5LLIA 1FFVA 3VUYA 4L5TA 5HGTA 1PYWD 2MPMA 2R3ZA 4I6PA 2G9HD 2F1MA 1K0SA 1SGHA 4RF1A 2EYMA 3TEZA 4ODGA 3A54A 4KSKC 1IW7D 1ESRA 4F1SA 4BA2I 1BCPD 1KABA 1GM5A 1GC6A 1GB4A 4GKKL 4IUVA 4IO9A 5TR5A 1M1KC 4HPMB 3GTQB 2XBBC 3AE5B 3AE7B 1S40A 2KCNA 4II3B 3NEMA 1R7SA 4YHHQ 2B29A 5JJKA 4LF6Q 4A6QA 3VVWB 4BWGB 2GOWA 3C1EA 2LHDA 5CHFA 2VL6A 3OMCA 2PNRC 1GG3A 3RNBC 2Q2IA 1RFAA 1R4QB 5FO9B 3KYHC 4A3CG 4C3IB 4URKA 2HJ1A 4ALPA 2KZRA 3RR5A 4MELA 5LMNW 1JE4A 4XQQA 1IKLA 5IIFA 3QO2A 2WU5B 2VZKB 1M90C 2RR9A 5LL6X 2ZJPA 4A55A 4BY1H 1DXMA 4HIKA 1WX7A 2ZTEA 1HZCA 4FXGC 4C3IH 4A3CH 4LNNA 3WOFA 3K5OA 4TMAB 4A93G 1YHBA 2K5NA 1PGXA 5IY0A 4RH6A 1VQOA 4DU9A 1HFNA 1KD1C 4WAFA 1FGBD 2ZJDA 5L95C 4YTPB 3DWGC 3EC8A 5IKCM 3NWTA 5EAYA 4YTNB 3H0GG 4N6EB 1KDAA 2BH8A 2KQ4X 1S5FD 2E2DC 4C3IG 3ML8A 1K83B 3VTVA 1ROEA 2FCSA 1B3QA 3CD6A 3IAYA 2FCNA 1GD7A 2J42A 2REXA 3R66C 3QARA 5JH5C 2FMMA 3VR2A 4TQUS 3J80c 3CKIB 1TT5B 3GS2A 1Z7TA 2NVQB 4DR2Q 2PNHA 2J53A 5IAAC 3IFTA 3DEOA 5FR6A 2NMQA 4IPGA 3CCJA 4OWWB 1BKBA 1TS4A 5IP7H 3MXGA 3TBIB 1SJED 4L5QA 5I9OA 1S3SG 2DZIA 2NVTB 2XTIA 4X64Q 4J3OD 1UWXA 2KECA 3CAMA 3KF6A 1IUEA 4G3XB 2XK5A 1TT2A 1XWEA 3N32A 3I4MH 1WRIA 4FN2A 2N8NA 3VHTC 2M9VA 1G6PA 5JVG3 2LD9A 4PG3A 4WJQA 5EJWA 1H9RA 2JZZA 3A4SC 3RZWC 5CORA 3R7QA 5LL6S 3JYUA 5IP9G 1WWTA 4G7ZC 1YNND 4XYOA 4A3IG 3GTOH 1SMYC 3MFGA 3D32A 3U7DA 5BN4A 3I4MB 2NBFA 3OAWA 2JQOA 3R2TA 4N9F4 1MIUA 1GO3E 2KX3A 3D4RA 2JX5A 3Q3OC 1KRTA 2KX0A 1EY7A 4HKQA 4LFBL 1MHXA 3CCQA 2WFWA 2JPHA 1HZ6A 1C3TA 1NYRA 1H9MA 2W82A 4BOZB 5K5PA 1G91A 2L4NA 5KYLA 3KLRA 2G9DA 1DOXA 1SE3A 2QDFA 3DDCB 2MRPA 3FILA 3PCOB 1P1AA 1YQBA 1R4MI 1OTCA 2IO1B 1QZEA 4KMUC 3CCVA 2QF7A 4RGTA 5FOBB 4A3IB 3SK8A 3LJ3A 2O4XA 1LQBA 3K9PB 2JA5G 1PTOH 3BZDB 3Q6BA 2CH4A 3KUDB 4MH8A 4A76A 2QHOA 1TY0A 3TSSA 4LUZA 2A5HA 3OHXC 2JA9A 4B3ML 1WFQA 3BZKA 4IFDJ 2Z59B 2R92H 5D3DA 3SD5A 1LTTD 2NN6I 1OFFA 2N3SA 5JEAJ 4NDXA 1HXYD 4JI5L 4W9IA 2M0XA 4AQYL 2MH7A 1L6UA 1WYDA 5J39A 1RDPD 2HIXA 5CV6A 3L9AX 4A3GG 2K33A 3NENA 4PMCA 1JORA 2HDMA 5BR8L 2IO0B 4B0EA 2EDGA 4OO1I 2Q8RE 3I4NG 2B2YC 4P71A 2QMTA 3FKIB 2LXJA 4JI5Q 2F0OA 3AB5A 1YEZA 2VQEL 4YCWA 1DOYA 4FXDA 1IKMA 4F8CB 2KVRA 4FULA 3CWIA 3GO5A 3J80E 2XK5B 2KTRA 2DENB 2IHFA 2HQLA 4HJ5A 1QOAA 1GAQB 1PH8A 1OQQA 3CW2C 4A90A 3HOYH 4EKUA 2ZM6L 1YJIA 1V1PB 3D6CA 5A2QE 1GUSA 3FP9A 4M0WA 5EE9A 1ET9A 4OHJA 1PFNA 1A8VA 3PO2B 4USAA 4RM9A 3IT6B 2Y0SG 1N36L 4DV1L 5IP7G 2OHFA 2Q2TA 1YNJC 3VQIA 4HROA 2J4XA 2MEKA 3ZQ4A 2CU1A 2DZJA 3Q3JA 3SK5A 2BS3B 3HGBA 3NBHB 4V0BA 2G4DB 5CBEE 3PO3H 5E3FA 4CKCA 1TJEA 1V5TA 4ZHPA 1JJGA 1UELA 1VD2A 3ULLA 2BBCA 1RHPA 4P73A 4NJ6A 2ZCCA 4GN1A 4QF4A 4UY8C 2JQRB 1HNWL 4YCVA 1TKGA 2LRUA 3AFQA 1X32A 3P7JA 3PO2G 3DVNU 4BBNC 4FA6A 1EYGA 4MH0E 2DBYA 3GTKB 2EY2A 1YITA 3D31A 4DGZA 4CDDC 1Y1VH 5IT9E 4YSZB 1H8CA 1ASZA 4BBRB 1LTID 1QOBA 1SMYD 1L1OB 3K59A 2KYWA 2MQHA 2V3PA 4ITKA 2VB2X 1WGRA 5CC4A 1W2BA 2K39A 5LNK1 5C0XI 4DV4Q 4LFCQ 2Y5CA 3BVGA 4CDEC 1HR0Q 2NPTB 1ZXIA 2L12A 4WFN3 2Z0SA 3GV6A 1JWSD 3WCQA 4RGNA 2K8HA 4S0RA 3DVNV 3QX1A 1OXTA 2JA5H 4JI2Q 3W5UB 2K25A 2IW3A 3ND8A 1HNZL 1NJIC 2WXQA 1IBLL 4KGSA 5IYDH 4GLAC 1N62A 5C3XA 2RSUA 2Z6BA 1FXTB 3DVGX 1HR0L 2I2YA 3KLWA 5M5XB 3R3MA 3T8MA 1GJZA 4BS9A 2J0TD 2ZTCA 2ZXRA 4PZ6A 2CHWA 4EQNA 4PV1C 1TKYA 4IJLA 1JMLA 3AE9B 4K14A 4ZCKA 4DWFA 1FPYA 2A73B 1XEEA 3E9IA 4B3TQ 1O78A 3B2FA 3KJOA 1PH9A 2AQ2B 2D0PA 1IL8A 1HTOA 1K8GA 1C4CA 1HZAA 2QA4A 2LMCA 4P75A 4E6IA 2PPHA 1H4RA 2KDFB 4O1NA 2EJGC 4DBGA 2WACA 3VTUA 1TWHH 3I4OA 3KUCB 3P1HA 3OMGA 3NVVA 2C7NB 2OQ0A 2DGYA 4DV6Q 2JXTA 2D62A 1PFBA 1QVFA 4MTKA 1E6EB 2IDYA 3TS0A 3VH4B 4DNTB 1PLFA 5CV7A 3IKJA 2LVQA 1SJHD 3WAOA 1KM7A 4GDLB 4DR1Q 3ZRCA 5C0XG 1EY4A 5M5WB 2IPKD 2PO4A 3T1HL 4HMJA 1RTOA 1ISNA 1ASYA 1XO3A 3U30A 3M7GA 2EXZA 3S1QB 4BXXG 4OVZA 4RMAA 2EE1A 2KAJA 3CSFA 2MQJA 2R7ZB 3OYYA 1EYCA 3BDOA 1VMCA 1AFPA 2K75A 2LKVA 3HKZG 2ZM6Q 3NG0A 4BKTA 2Y3AA 3PF5A 2CJOA 4PMBA 3I57A 2O5JC 2E3TA 4JCVE 1WTXA 5I6YA 1SFOB 1Q5WB 2EOTA 4J1MA 1FEHA 2BVCA 3PT2B 2R93H 3JVZX 1E10A 5CR3A 2V0GA 2EZVA 1XYIA 3S14B 2FXQA 2ONQA 1GJXA 2L8JA 2FJ2A 4B3RL 1YX5B 2AYOB 4GKJQ 3WDNA 5JAVA 3HOZH 2BE5D 3ND9A 4KJNA 1SIFA 2R6GA 1HE8A 2D3GA 5M3MB 1HNWQ 2JWZA 2HTME 4WORA 2KC2A 3STBC 2X6LA 2N1WA 1XNRQ 4QIWB 3H91A 2L0TA 1TS5A 5H92C 3DM1A 3RLOA 1CI3M 3N1ZC 2PW9A 4S17A 2RKSA 5A35A 3J7A5 3HOZB 2NVQH 4B3SL 3H6NA 2KJHB 1C0AA 3UQAA 3T56B 5D3IB 3VYUA 2JWUA 1WXAA 3D4WA 1ENCA 4NNJB 4C2MH 1N34Q 1KF6B 2Z9HA 4TQ1A 2D10A 2KHJA 1L2FA 3DHGC 4DXAB 3CCEA 3HHMA 1VZ6A 1QE6A 1VF5C 2NS5A 3Q8AA 3N6RA 1VQPA 3J7ZC 3PPAA 5E6OA 2DN8A 2Q8IB 2JT4B 2BW2A 3M7NA 3NUHB 2O5IC 3OLMD 3E0JA 3A9JB 1Q90A 3O13A 1NE3A 4RGMA 2WX1A 3UDXA 4GOPA 3TP5A 4K6DA 5C4ZA 4ILWA 4XQJA 4A3FG 4IFDH 3GTGB 5H8YE 1I42A 2K3UA 4MZ9A 4ZYSA 1C79A 3QR8A 3VR3A 2LUMA 3GE8C 3TREA 3MWYW 5CBAE 1N60A 4M02A 3U4ZA 1AE2A 1F52A 4KIKA 3PRZA 1KOTA 1K51A 1GUOA 1G8ZD 1SLJA 4JBWA 4IWPA 4XDCA 3CQZB 5LXHA 1PH4A 2AEHA 2MO1A 2RHQB 1YHQA 4FADA 1MBYA 4EX5A 2NZHA 4IDIA 3VRAB 3PV0A 1BBWA 3P20A 4QAYA 2UU7A 3PQIA 4IW0A 3IHPC 2RDGA 3E5SA 4RHRA 4DN4M 1LT5D 1LT3D 1FNUA 3BG3A 4DNIA 2WDQB 4HCEA 2JYEA 2RMMA 3M9BA 1NMGA 5EKLA 3I4NH 3DOWA 1WGKA 3ZDMC 1YQ4B 1PTOC 1EM7A 3QOJA 3WAPA 4C7YA 2KN4A 3SEBA 5HY6A 2D2CC 3A5ZB 1I4XA 3HOWH 1F77A 1YIWA 1JT8A 1FGUA 3R93A 1BR9A 4IQZA 4X3TA 3FHWA 2LZ6A 2LS01 2BGFA 2D11A 4NAWA 2CWAA 5DPRA 3OWFA 4K0KL 4DKAC 2W9NA 3BVZA 4ULLA 4U68A 2INNE 4W9HA 1SNMA 3KYCD 4FHJA 1WCMH 3DBRB 1WVLA 4AQYQ 2A5UA 2HTHA 4RF0A 1S5ED 1VQ4A 4DQOC 2R93B 3A74A 3GZNI 3NRZA 1JWMD 1HUNA 1IGDA 3BY4B 4WWOA 1DCZA 2IBIB 3FKIH 3H9DA 4LJPB 2HHHQ 2EYOA 2A6ED 1JRPA 1QB5D 2DJFC 1T6BX 3DWMA 3V62A 3C3LA 4DHJD 1I7HA 3I8ZA 2BB5A 2OOBB 2CWPA 2INPE 3TMEA 1C4PA 1AEXA 1DZ1A 4L63B 2XRQD 1HFGA 3AU5A 1Y1VB 2BB6A 2N7JA 2K28A 4HXDA 3L0OA 4X65Q 3FPUB 2E5LQ 4JWUC 4BBRH 2KLGA 3GTLH 5DPTA 2VZAA 1FVIA 1JJ2A 4R8IA 5C0XJ 3NPPA 1RTNA 1YBYA 4K7SA 3BU2A 1P7FA 4S3SA 5C1ZA 4RNAA 4DXFA 1LM8B 1VS0A 2RHSB 2IYDB 4UDUC 1W3SA 1WJ4A 3ML9A 2MHVA 1TR5A 2L52A 1WZ3A 2WXJA 4DV7L 1E2VA 3RLNA 4W9EA 2K14A 3NTKA 4POGA 3ERSX 4IUTA 2F0UA 5GADC 2F4IA 2LJIA 2RF4A 4PMWA 4A93H 1EWCA 3ZNID 4XTCS 4L6TB 1WX9A 2V3SA 5FR3A 4ZHOA 1T5EA 1XLPA 5C3WA 3I63C 4LNIA 4A20A 2DNFA 1F9SA 4LJZC 1TS3A 2SNSA 1GUTA 4A3MH 4NXNQ 3GTGH 2CVRA 4BFRA 3KDFB 2JA6G 2MGSA 2OQKA 2KO3A 3K57A 1A6XA 5M5XH 1VQIA 4V190 2G3QB 1P3QU 2LGYA 4GOPB 2OCEA 2RDHA 2UXDL 1T3QA 2IGDA 3HRDD 3ZXVA 3N30A 3I72A 4IOAA 1YOVB 4X62L 2V4LA 3TMPB 3JC66 2MBHA 4HJAA 3CP0A 5G3LF 4X3KA 2KHWB 2F03A 5DAUA 1RJTA 3NTIA 4LK0M 4JBKA 4N8X1 5H1SE 4FLHA 2Q2UA 4XZ4A 1S4ZA 3RFZB 1Y14B 2XWJB 3S1NB 2PE9A 1PH3A 2OJWA 3TN2A 2F0LA 4IN3A 2R61A 4Z9CB 4UPAA 4RAUC 5KNCA 4LUOA 3EFCA 3TUOA 1G51A 1A15A 2VNUD 2K1FA 1BCPC 1Q46A 3PUYA 5IT9c 2WXIA 4Q0FA 3V6EB 4OZCA 4L23A 4LUVA 4GS3A 3RULA 1SYCA 3K7AB 1VQ6A 2IO3B 2YU9H 2B63H 1OGWA 4M1UB 4CGYB 2FIDA 2Z6KA 5C3EB 2Y0SB 1T0RC 3M3JA 3FMCA 2CCZA 3P63A 2BA1A 1GUAB 2PI2E 2ZT9C 1FMAD 5KNDA 5JJIA 1E5WA 2H89B 1PTOB 2A8VA 3HKSA 1F2RC 3DLLA 1FCLA 2OEOA 1WRDB 2LVPA 4M0WB 1KNAA 1F9PA 2JK8A 1OTRB 1UF0A 1X1MA 4G0NB 3H3VI 5FJ8G 4LF4Q 3G4SA 3PRPB 2F0GA 2UUBQ 2EJFC 4PZ7A 2D07B 2L0CA 2K0PA 3ENEA 3LDZE 1N5WA 5HHDG 3DBLI 3EVQA 3P4QB 2KWCA 1CMXB 4KZ0A 3SK6A 3OG5A 3SR1A 3AMUA 4RCOA 1SNCA 1J19A 4DAPA 4XDDA 3MC8A 1AW7A 2YEPF 5DCNA 3NQIA 1NAPA 1EU3A 3B1LX 3L2PA 1I94L 1UD7A 2LASA 1KRHA 1N6ZA 4P1BC 1KDCA 3TEWA 1IBXA 4WJ3M 1D5XC 4UP8A 3S16B 1N63A 1QCBD 2K22A 5E7NA 3NVZA 3I4NB 1QOFA 1UEBA 4BBSG 1P7EA 3KBXA 2KC1A 3AE2B 1MSHA 1QUQA 3FKIG 1K53A 1NI3A 1RODA 1W6JA 4DUZQ 4MJSB 4FF2A 2AUKA 3ZNHB 1SSOA 1DOIA 2BA0A 2PMVA 2O6VB 2L15A 1L1OA 4QY7A 1KNEA 3RN2A 3S17H 2CHZA 2MW5A 4JX1C 4GOCA 5JPNC 1Y1WH 2R7ZH 2EJMA 2MP1A 2E2HB 3PHXB 4XWWA 3SE0A 1U4PA 2UUCQ 4DA2A 2KHIA 4JI7L 5AEKB 2K04A 2QCPX 2RVLA 5HURA 4OX9Q 2KMCA 1WXQA 5GXGB 3R2IA 1N9WA 2HDLA 4NMZA 5ELCA 4FYDA 2VUMG 1H9SB 3L3OC 4A3GH 1FO4A 2RBMA 3LGJA 3C46A 1V8QA 2CKZB 3AH7A 1BBUA 3AEAB 1GB1A 3D0FA 3U4VA 4ZUJA 4DNRB 1ZE3D 1MI0A 2KNBA 2BYFA 1HPCA 2PQAA 5IOCA 3SHQA 1RLFA 1ACCA 2KQSA 2CU3A 2IZVB 1QWYA 2P5ZX 3PO2H 1N61A 3BWUD 4MM3A 4JI1Q 3N9YC 2WHIA 1MHWC 3ZXRA 2NUCA 1XF5L 4O42A 5GMVA 4PNYA 2M17A 3VUXA 2WS3B 4JI4L 5AZFA 1UBIA 1EEID 2ZW1A 1CHQD 2N7EA 2AUJD 2L9HA 5ELBA 3W1BA 4X62Q 1VQGA 4KJOA 1PDQA 1E7ZA 2DUDA 1Q1BA 2B3AA 5IWAQ 2AWNA 2ZVOA 4JI4Q 1NUCA 2FINB 4RMFA 1XMOQ 2N9XA 1PH7A 1VQ5A 3Q8CA 2KCTA 2CFMA 4MGIE 1VQ9A 2BWFA 1CQFA 2C7MB 3RCZA 2O6VD 5EKIA 4PQXA 4LFBQ 1VJKA 2Y0SE 3AEFB 1IYFA 1ZXHA 2ZPYA 1JQYD 4R4CA 3UE0A 2C60A 4B08A 4BAXA 4JE3B 2BOSA 1UBQA 1V97A 3PGZA 2EKIA 5FJ8H 2MBEA 3A33B 1H9KA 3QCAA 5J2RA 2PTLA 4E74A 4GB9A 2VY3A 1Y56A 4BY1G 1LLRD 4JI1L 3M85A 1S1QB 1TIFA 1XNQQ 2EELA 2K05A 3U9OA 1IBML 2LXAA 3PO0A 4BBNF 1TZ1A 4KHPQ 2I07B 1JRUA 2ZZPB 2MJEA 4HDQA 2QSDA 1CZPA 1E7UA 3TP8A 1Q10A 2PKOA 4KKIA 5CYUA 3DMUA 2EYHA 1HQRD 1UE5A 1CJEA 4NPNA 5KHQA 1UWMA 2KVMA 4TRDA 2WXKA 3VR8B 4FXCA 2A19A 3K8AA 1L0XB 1KQSA 4ZK9B 1Y8PB 4IFDG 2NCNA 2LFIA 3MJWA 2WXGA 3LYYA 2I0QA 1D3ZA 2EY1A 2MFIA 1I4HA 1A2TA 4TKOB 4GIVA 5C23A 4B3MQ 5JEAG 4ICUA 2UU9Q 2QGQA 1D6EC 3NELA 2WP8J 1IL2A 3F2DA 1CZGA 3HUIA 5JJZA 1QILA 3EROA 1YNJD 1WXSA 1QNUA 2NN6H 4MHEA 1EO6A 1SF0A 1Q82C 4XWTA 5EGTA 1AP0A 1EF5A 4P72A 3OOCA 1QLBB 3CHBD 2R7FA 4DHZB 4I7ZC 4UAIA 2IL8A 2M0AA 1L4ZB 4K0KQ 4KIKB 3TEXA 3ZLZA 1K50A 1GXDC 3BINA 5DPWA 4YCUA 3UI2A 1JROA 2J0MA 1YZ6A 4GKKQ 4FHKA 2UU9L 1EWYC 3TEHB 2N9KA 4A3KB 1B9MA 1KLVA 1E0ZA 3KWVA 2A69D 2PZTA 1SXTA 3S2HH 2L7RA 4O0AA 3M4OB 2RQXA 3V6CB 4HLEA 2K50A 2PVGC 5KRUA 1HA6A 3KDFA 1X9NA 4HDOA 1CHPD 3H94A 2R7ZG 2FFKB 4HAEA 2CKHB 3RYTA 3ULPA 3WALA 2F0QA 1JMCA 4IJHA 3AULA 5BMGA 2BTEA 2JP1A 2SOBA 1VQFA 3ZDTA 3B08A 2GBJA 2CW0D 2JE6I 3MXNA 4CJ2C 1PUTA 4FBJB 5EDSA 5FLXL 1C4AA 3S1NH 1A2UA 2JXXA 2IGHA 1F1HA 3Q23A 1X54A 2KQ7A 4MGZE 3ZTCA 1I3QH 2KBNA 1K28A 4IFDI 3OW7A 4HMIA 2JY6A 4GLVB 4KY6A 5LHY1 3G71A 5E6NA 4XE0A 1CKNA 4F7XA 2YEPB 2KCMA 5JEAH 1EQQA 4B3SQ 2JSOA 1EQVA 3QWNA 5IOIA 3V05A 3K7AH 1C77A 4LDTD 2L00B 1YI2A 2R2OA 4DK0A 1T9HA 1WMHA 1DM0B 1HCZA 1U5KA 2LMCB 4ME3A 2DAJA 1G6JA 4WURA 2BKRB 3MAQA 4NW2A 2N78A 3FRPB 2Q5WD 4A3MB 2GBNA 1A3UA 1PZKD 2KTRB 3RNAC 1Y8OB 1TU2B 2PZUA 1HZ5A 4BKGA 1TS2A 2NVXH 3ZJUA 1A0IA 1Q3LA 1S5DD 2IY1B 5FLMG 3PHWB 4LW1A 1MJDA 3VTWA 1DOLA 3DEPA 3UDIA 2INDC 5IP9H 2HCIA 1WE6A 4KN4C 1PRTB 1VQ7A 1ZEQX 3U58A 3S1MH 2BF8B 1SFOH 4GSWA 1VQEA 1YIJA 1B9RA 1STEA 5CGKA 1I4RA 1DOKA 1C76A 4YL8A 1XLQA 5MPOA 1T0QC 2MX2A 2J7QB 2B2VC 2RCFA 3PTFC 4CHKA 4LF8Q 3QA8A 4HVBA 2N0SB 3AE3B 1MKHA 2L11A 3TP7A 4IM0A 2G45B 3BDLA 2K4KA 2KQ3A 2Z0DB 3SK4A 1TZOA 3FEWX 1JOQA 4QCLA 1OXSC 2PYKA 2GRIA 1JJCB 2B2YA 3ZNGC 1IBMQ 4A3OA 2Z8LA 4RHSA 2PW7A 2NYZD 1VQLA 4LF8L 3EA6A 4PS3A 3PIP3 1XMOL 3L54A 4HK2A 4HPLB 3QJYA 5D2MB 1TXYA 1OEYA 4C3JH 1E22A 2WP9B 4W9JA 5BO4B 1E8ZA 3W3AA 2N7DA 2DNEA 1N33Q 2KN5A 3TDQA 3S17B 3HOUG 1XJVA 4R3DA
chains in the Genus database with same CATH topology
1GHJA 4AQ7A 2RA4A 1A3TA 2HDEA 3OIQA 1HHVA 3T3NA 2QKIC 4IOIE 2IT1A 2BYTA 4WH4A 4TSSA 3I4LA 4OZBA 1I4GA 1NR2A 1NEKB 5CMDA 1BF4A 4N59A 3LXFA 4B9XA 3HOUB 3H0GB 4RFBA 3P42A 4KD3A 1JQ4A 5AFWA 2NB0A 4CJ1B 1CZWA 3HVZA 1L4DB 3MJ5A 3AEBB 2Q8TA 3OSOA 1U9RA 2KOLA 3HZXA 1OXXK 2F0VA 4G7HC 2HCCA 3LNNA 3NBIA 1O7YA 1I4QA 1GUWA 3NTHA 4D2KA 1PTOF 1QOHA 1DJRD 3NP8A 2O2LD 2WXFA 3HS0C 5C2TB 1WTOA 1ZKOA 3M4YA 3G6JB 1NSNS 4FP5D 4ZRZA 4HEA1 1ZPSA 5JVH3 1J7AA 1VDZA 4HSVA 3AV8A 2CQAA 2Z4HA 5NUCA 3D6WA 3P75A 4Q2JA 3AB9A 2WDRB 3G7LA 1WTQA 2GB1A 2A6HD 1NYQA 5EE3A 3ZGZA 4MACA 4GZYC 4DK1A 4EQPA 2DYMA 3L4PA 3CRLC 1UGJA 2PZWA 4R8NA 1WSPA 2JA5B 4KX6B 1G291 5I2YA 2CHBD 2OF1A 1JOKA 2JYOA 4H44C 1HTPA 4H2AA 2NVXB 5IGCA 1SNDA 2MJ3A 3RZOB 2K5WA 3NWSA 4A3GB 5E1FA 3U9SA 1EFID 1C9FA 3QIAA 4QB4A 2SAKA 2LHEA 1JR0D 1UEAB 2E6XA 3D3RA 4ZLTF 1U4MA 2MUYA 4P6VF 2DLBA 1PRTD 1WTRA 4IUPA 2EYPA 1CFMA 1BXTA 3PUXA 2SDFA 3OWEB 5IGDA 2FBWB 3U4EG 1WTVA 1LABA 1EYAA 3W5VB 1T5XD 4OIKA 3IAM1 1ILPA 2ZXOA 1LTRD 3BK1A 3EQLC 3KLSX 1L0VB 2PIAA 3SFDB 1Q1EA 2SEBD 2D5DA 3RD4A 1O7LA 5HFYA 1STHA 2F0SA 2BS2B 4WJWA 5DM73 4BBSB 3CIRB 1YQ3B 2LY7A 3ETRA 1ZYRD 5KIXA 3FDTA 4C80A 2XRSD 2NZ1D 5CV5A 4BY1B 1EY6A 3RUZA 2WDVB 2F0IA 2JU6X 4G7OC 1E9MA 2Z1CA 3HEJA 2V4IB 3DWQA 1GOZA 3D8GA 2VUMB 3M3YB 5J1ZA 3AE6B 3S9WA 2M19A 3MHBA 5HI1A 1EIGA 5EE0A 4N9TA 3HVDA 4IALA 1RM6C 2K5DA 3VYRA 1B4OA 4ZKBB 1FD6A 1B44D 4RWSC 3NUCA 4HN7A 4ME5A 3B9JA 1SNPA 2F0FA 4DFAA 2C9OA 4HSPA 1VZ8A 3R3OA 1STAA 3GTPB 4YWGG 1EOTA 1BQQT 1IGCA 2KCCA 1DGJA 4B9WA 3Q69A 1STYA 1ZOYB 4ZAIA 2N9LA 1SDFA 3S2HB 5D65A 3AE4B 1QF6A 4KGRA 2F0NA 1ONLA 2OXPA 1TWFB 1A3VA 5CV4A 4DF7A 1EY5A 2ZW0A 1Z6HA 4XDXA 3T53B 5A2QL 2JA7B 3PZ8A 4JPSA 4QMGA 1R4PB 3Q6SA 5BN5A 2H4OA 1RFKA 3AEEB 2ON8A 4B0MA 5D7GA 5AUIA 2PW5A 3VRBB 3NVYA 3LB8C 2VB3X 1GPXA 4QUCA 4DXGA 5IODA 4OZAA 3AMZA 2QEJC 1QT9A 4DAVA 3ABVB 4LLGM 1XX8A 1OXVA 4C56C 1TIID 2B8FA 4LTUA 2RSNA 3I9V1 3K5LA 3A7LA 5IGGA 1YNTE 2L5TA 1B3AA 4A3JB 2A68D 4IKGA 1I4PA 2WAQB 5IGBA 4PT5A 5IT9L 1SYEA 3KK7A 2XWBB 1QJOA 4KHZA 2CW0C 1A70A 1ZYRC 1QOGA 3IAS1 4YSYB 1MPEA 1F0ZA 3T51B 3J81L 2WIIB 2H88B 2Y5PA 2LFNA 5BMIA 5FO8B 2H1EA 3EJIA 2GI9A 4RA8A 3BVMA 1KLGD 5KYIA 2WKCA 2F0JA 1JOOA 1FYCA 1K8MA 2L83A 4KI0A 1VZ7A 1Q8IA 4US9A 1SYGA 4TQ0A 5K36G 4M8AA 2XNAC 2E2IB 3PUZA 4I65A 3TEYA 1OQRA 2YYZA 4F8MA 5T1IA 3U2SC 1M8AA 3LWUA 3Q8BA 1XLNA 2K9XA 2B2UC 4FF4A 1S5CD 3R8BA 1L0YB 3PO3B 1Y69U 1CA5A 3DWPA 1MHHE 5KGUA 2WKDA 5G5GA 1F2LA 1F2RI 3DUZA 1SE2A 5C5MA 1XLOA 3GP7A 3VA7A 2BCOA 1QQRA 3DHQA 4C3HG 3H8HA 5C6AA 4NAWB 4KGTA 2IGGA 2L32A 2W55A 1VMPA 3A7AB 3Q8EA 2OEDA 2PLPA 1ILQA 1W6KA 1BBXC 3AN1A 3HRZC 4WRDA 2X69A 1U4LA 3BS1A 3P4SB 1ZDXA 2LEKA 4MN3A 4J6HA 1STGA 4OW0A 2JEAI 5FK9C 3GB1A 3EFXD 2DY8A 2WU2B 4YSXB 5CV8A 2JYTA 1BCPB 2KWDA 1B50A 3C1FA 4HJGE 1FNWA 3J9CA 2WXLA 5C44B 2W3RA 2TSSA 2JA8B 3JAME 2M56B 5I6WA 2KHSA 1ESFA 4OGQC 3J80L 4K5XA 1E7PB 1F2MA 1FRRA 3FC4A 1SIJA 5BYSA 3GTLB 1LT6D 2JEBI 2KA7A 1H9SA 1QKZA 2EYFA 2K32A 1I50B 4FNFA 3FVQA 3MTSA 3VR6A 5G5HA 4C3JG 3MP9A 1LTGD 2XVSA 1KFYB 3SR6A 5I2XA 4Y7NB 1C78A 2EPBA 5TSSA 2KDMA 1V1OA 2J52A 2KMMA 4HCSA 3NS1A 4CHTB 1JWUD 3I90A 3I70A 5ELEA 4P2CB 3AEGB 1E2WA 3X3NA 3HOYB 2JZPA 1TQOA 5ELFA 1NCVA 4ID6A 1WD0A 5KNBA 1XTCD 2B2TC 1TKEA 1FXAA 1SAPA 4RKBA 3BYTB 3GTJB 1I6VC 1HEZE 1CTMA 1SYBA 1D4BA 3KUPA 1ET6A 3PUVA 2YU9B 2B63B 5BMHA 1F2YA 1G6ZA 3VR4A 1XXGA 2QDBA 1KDBA 1EZ6A 1SYFA 1TKWB 3GV3A 4C1NI 1FR3A 2IX1A 4FXKC 1LTSD 2KJXA 4HRSA 3K58A 4CBVA 1IBXB 1CM9A 2IWHA 3D4DA 1PRTF 3MHZA 1F2ZA 1M4VA 2BS4B 1PTOD 1EWHA 5DNFA 5M5YB 2HUGA 3FAHA 4GLSC 4YTMB 4REZA 1UUPA 2B2VA 1YNNC 3PIO3 2K5PA 1L6VA 1V43A 1RWSA 5EBDA 1VRAB 1D1IA 2K5QA 5DEHA 5EBCA 4L2YA 2PMZB 3I73A 2WNMA 1H9JA 3HG9A 3BYYB 4RCNA 4EQOA 1VCIA 5IGEA 1L5PA 2V3NA 1RF2D 4IUQA 3IFDA 2LGIA 3FILB 2SNMA 2DYOA 1SBBB 1QNKA 4IUUA 1IW7C 3H3VC 2QIEB 1LO5D 1MSGA 1JICA 1HUMA 1VR9A 2B2WC 4WQMA 1EY0A 4C2MB 4C1NK 3Q8FA 1E0BA 2N88A 4MM3B 3P1MA 1X3QA 1WCMB 2K03A 5M3FB 2WXRA 1GUGA 4EE2A 3TP6A 3KWLA 4ZQ3A 2QJLA 2B2UA 2L1AA 2C5CA 3MC0B 3NXWA 4KKJA 5C0XH 4K5VA 2ZXPA 1FNVA 5BYRA 1TWHB 2BT6A 2KEEA 3HOVB 2F3WA 4FF1A 4ARIA 2NTSA 4OL7A 4OO1G 1E2ZA 1JCKB 3CU7A 4EGVA 4G57A 3S15B 2WXPA 2M00A 2MJDA 4IURA 2E2JB 4JWSC 1BNZA 3T13A 4F88A 2EYJA 3A56A 4P16A 2AX5A 5C4XB 1LTBD 1B2TA 1IHZA 5EKKA 1AYFA 2F0KA 3GQBA 2WV6D 4KKSA 3MEHA 2FMCA 4IZ8A 1AZPA 2EY6A 2B76B 1EU4A 1BDOA 3RLFA 3NZ3A 5IGFA 3PZ7A 4XYQA 4K8IA 1B53A 3W9CB 5E4XA 1JC7A 3B2GA 3NBHA 3MXPA 3ZJTA 1XCTL 5JPMC 4OO1H 4GDKB 4HKZE 3A55A 2ICIA 2E75C 2ENBA 3ONAB 4XIGS 1TWAB 4CKBA 1HQMC 4LK1C 1KH0A 2QILA 3VR5A 4F87A 1PZJD 3A8JE 1BUIC 5HG2A 4IUNA 3C8YA 3KF8A 1VDVA 3WOEA 1R9TB 3F2UA 5I9PA 5E4WC 3SXHA 1KLUD 1I6HB 3HOXB 4Q5VA 4WIPA 1ML0D 3EGRA 2FUG1 4NZLB 1ENAA 5ELDA 1ZXTA 2XSCA 1F9QA 2A69C 4NKLA 1V1PA 2F0WA 3GD7A 4LAAA 1FIQA 1SSNA 1C4QA 2PCFB 3U52E 4NP5A 1OO9B 4A3EB 2F0EA 4FO2A 4H13C 5DM63 1D1KA 1JW9D 2DY7A 3C2PA 1J8IA 5K36H 3S1MB 1WTPA 2A6EC 4AYBB 1WTWA 5F2DA 3NE5B 2G1EA 1UNSA 4X3UA 1PZID 2DWQA 1PFMA 1ENFA 1AZQA 5EPJA 2FHTA 4A9AA 1EY8A 1PFDA 5J22A 4A93B 2IX3A 1FRDA 2K7VA 3BDCA 4OIJA 1V8CA 2TMPA 2A6HC 4ZKCB 3A8KE 1LTAD 3NK9A 1FFUA 1TWGB 2ID0A 4C3JB 4C3HB 3VYSA 1BMLC 1PMRA 3FPPA 4KY7A 3QB3A 5EQ0A 4X3SA 1STNA 4KN7C 4ZOHC 1D5ZC 4KK7A 4RGOS 5KEEA 1TVXA 3SHLA 1WD1A 1AN8A 3ZJVA 3LX0A 1UAPA 2NTTA 4A3BB 2WB1B 2OT2A 1TYGB 3LWEA 4XXEA 2F0HA 4NAMA 4YXDB 2W54A 2W3SA 4KV6A 4CJ0B 2CJNA 3K5NA 2PVOD 1BCPF 1EY9A 3T3OA 2KEDA 2F0MA 2WXNA 3MFYA 1AWDA 4JK1C 1GHKA 2RDFA 3VR9B 2K01A 3V2TA 1DONA 5E6JA 1HTLD 1SEBD 4L8JA 2B8GA 3J7AV 5COYA 1K52A 2KUMA 2JA6B 1G2SA 1O7ZA 3EUB2 2K6AA 1EZ8A 3P4RB 5C4JB 1YN4A 2D5GA 2N55A 4K5WA 1KAAA 2AQ1B 1RD9D 2B2WA 4U673 4FVMA 3HP3A 4KTAA 3PMFA 1HA5A 1PDXA 3J7AF 4KD4A 2GA4B 1Z47A 3NQTA 3AU7A 3UI3A 3KBGA 2EYLA 3AE1B 1NENB 3DXJC 1PGAA 1MGSA 2R92B 2EY5A 3URYA 4DAYA 2IX0A 2V4DA 1D5MC 2B39A 3CRKC 4J8QA 5D14A 1JWAD 2JSVX 1C8CA 4G4KA 1YN3A 4MT5A 5G3LD 3RZDB 2NWGA 3ERQA 5BN3A 1RCVD 1RKNA 1RYJA 3IT4B 3N52A 1QG7A 1K8OA 3ZYYX 1BOSA 3MA2B 1JALA 2ICEC 4CQNA 1U4RA 2AQ3B 5FKAC 1HRJA 2L55A 1Y1WB 1ZP0B 1Q12A 5EE1A 2FE8A 1N5XA 3U7ZA 2Z4IA 1EEFD 1SNQA 5I4DA 4RKLA 2RSOA 4A8XC 1J7CA 4CKEA 3PUWA 1C48A 3SVMA 4ARCA 3AM9A 1YMHE 4K8JA 5FO7B 2PPBC 3SDZA 3MVVA 4YT0B 2VZKD 1JWBD 3I91A 3AECB 2NN6G 3E6ZX 3GTOB 2WQYB 2VXWA 2X6GA 3K6OA 3QOLA 3W1SA 2MJ8A 5T8IA 3RPFC 2A68C 3BK2A 3Q22A 1DYQA 1KTKA 1LV9A 1TWCB 3KQ4A 2F3VA 2NVYB 4YIJA 4ZRQA 1SB3C 1SYDA 2EVBA 2L1BA 5FLXE 2K1BA 1F9RA 1Y8NB 3E56A 1D2BA 5JXVA 4K6LA 2WXMA 2RPVA 1ZUD2 5EPKA 4R9WA 1BO0A 1VLBA 3J7YW 3J81E 4XQNA 1SNOA 3NSWA 4A3DB 3K5MA 3V3XA 2I38A 2XN9C 1OXUA 1BUVT 1EL0A 1VF7A 3H6MA 3I3CA 3W2DA 1XCQL 2WXHA 4NJCA 1GUNA 1NR4A 2X38A 3X3MA 3S1RB 1FXIA 4EVOA 2I46A 1PGBA 4K2LA 1ICWA 4LMQD 2BDNA 4KKTA 1DD2A 4MIUA 4K2KA 3S2DB 4ZUIA 3HKZB 4ABNA 1MD2D 4ZRPA 1S5BD 1NVID 3MXUA 4QUFA 4FF3A 1G2TA 3Q0AA 1WYGA 5AUKA 2KACA 3MZ5A 1IYVA 3H09A 1FD7D 2E76C 3OIPA 3DWAA 3T16A 3KLSA 3IL8A 1JB3A 2IJ0A 2J7ZA 4N9PA 5M9OA 4HTHA 3AEDB 1FCCC 5CV9A 3ITPA 3BIID 4WWMA 2WXOA 4L1BA 3T4AC 1LT4D 4KKUA 3IXSA 3VYTA 3NHHA 1LACA 1TY2A 2F0TA 2HQEA 5T1GA 2M2LA 2BDOA 4KY5A 2AWOA 5C5LA 2DNCA 4AS1A 4H7BA 1PRTC 3TZDA 2WLBA 2D9UA 2JXMB 1I3QB 5EPLA 4US8A 5BYQA 1FM0D 1CK1A 2BE5C 3AE8B 1B9NA 2PQEA 1J9OA 3A8IE 3VA5A 3HOWB 1EIHA 2ACZB 3K0YA 4A3FB 1J7BA 1MVKA 1CT1D 2WINB 2E74C 4XT3B 1EQTA 1CQVA 4C7ZA 4KHVA 5C4HA 1CA6A 4H0LC 4XT1B 5JOBA 1SE4A 3SFEB 1EYDA 5ISRA 3JAML 1B1ZA 3TZUA 2XIWA 2A74C 3RMHA 1O80A 3Q24A 1MI2A 2B2TA 4BY7B 3V96A 1STBA 1ZDVA 1PXUA 3OPOA 1II3A 2F0DA 4HEDA 1YN5A 3NVWA 1IYUA 2F0PA 1DOMA 3L7ZC 4HR7B 3QG1A 5C3JB 3E9SA 4BA1I 3GTMB 1X3PA 4N58A 1YJJA 3P4PB 1FFVA 5HGTA 1PYWD 2MPMA 2R3ZA 2G9HD 2F1MA 4RF1A 2EYMA 3TEZA 4ODGA 3A54A 1IW7D 1ESRA 4BA2I 1BCPD 1KABA 1GB4A 4IUVA 3GTQB 3AE5B 3AE7B 2KCNA 1R7SA 4A6QA 4BWGB 3C1EA 2LHDA 3OMCA 2PNRC 1R4QB 5FO9B 4C3IB 1JE4A 4XQQA 1IKLA 5IIFA 3QO2A 2WU5B 2VZKB 5LL6X 4A55A 1DXMA 4FXGC 3WOFA 3K5OA 4TMAB 1PGXA 4RH6A 1HFNA 4DU9A 4WAFA 1FGBD 4YTPB 3DWGC 3NWTA 4YTNB 4N6EB 1KDAA 2KQ4X 1S5FD 2E2DC 4C3IG 1K83B 1ROEA 3IAYA 2J42A 2FMMA 3VR2A 4TQUS 3CKIB 3GS2A 1Z7TA 2NVQB 2J53A 3IFTA 3DEOA 2NMQA 1TS4A 3MXGA 3TBIB 1SJED 5I9OA 2NVTB 4J3OD 1UWXA 2KECA 1IUEA 1TT2A 1XWEA 1WRIA 2M9VA 5JVG3 5EJWA 1H9RA 5CORA 5LL6S 1WWTA 4G7ZC 1YNND 4XYOA 1SMYC 3MFGA 5BN4A 3I4MB 2NBFA 3R2TA 3D4RA 2JX5A 1EY7A 4HKQA 1MHXA 1HZ6A 1NYRA 1H9MA 2W82A 5K5PA 1G91A 2L4NA 5KYLA 2G9DA 3KLRA 1DOXA 1SE3A 3FILA 4KMUC 2QF7A 4A3IB 4RGTA 5FOBB 3SK8A 2O4XA 1PTOH 3BZDB 4MH8A 1TY0A 3TSSA 4IFDJ 2A5HA 3OHXC 5D3DA 1LTTD 2NN6I 1OFFA 5JEAJ 4NDXA 1HXYD 2MH7A 1L6UA 5J39A 1RDPD 5CV6A 3L9AX 2K33A 4PMCA 1JORA 2HDMA 4B0EA 2EDGA 4OO1I 2Q8RE 2B2YC 2QMTA 3FKIB 2F0OA 3AB5A 1DOYA 4FXDA 1IKMA 3CWIA 3GO5A 3J80E 1QOAA 1GAQB 1OQQA 4A90A 1YJIA 5EE9A 1V1PB 3D6CA 5A2QE 1GUSA 4M0WA 1ET9A 4OHJA 1PFNA 3PO2B 4USAA 3IT6B 2OHFA 1YNJC 3VQIA 4HROA 2J4XA 2MEKA 3ZQ4A 3SK5A 2BS3B 3HGBA 4V0BA 5CBEE 1TJEA 5E3FA 4CKCA 4ZHPA 2BBCA 1RHPA 4QF4A 2JQRB 1TKGA 1X32A 3P7JA 2DBYA 3GTKB 2EY2A 3D31A 4DGZA 5IT9E 4YSZB 4BBRB 1LTID 1QOBA 1SMYD 3K59A 2V3PA 4ITKA 2VB2X 5CC4A 5LNK1 5C0XI 2Y5CA 3BVGA 1ZXIA 2L12A 4WFN3 3GV6A 1JWSD 3WCQA 4RGNA 1OXTA 3W5UB 2IW3A 3ND8A 2WXQA 4KGSA 1N62A 5C3XA 2I2YA 5M5XB 4BS9A 2J0TD 2ZXRA 4EQNA 4PV1C 1TKYA 1JMLA 3AE9B 4K14A 1XEEA 2A73B 1O78A 3B2FA 2AQ2B 1IL8A 1C4CA 2LMCA 4E6IA 4O1NA 2EJGC 2WACA 3P1HA 3OMGA 3NVVA 2JXTA 2D62A 1PFBA 1E6EB 2IDYA 4DNTB 1PLFA 5CV7A 3IKJA 1SJHD 4GDLB 5C0XG 1EY4A 5M5WB 2IPKD 2PO4A 4HMJA 1RTOA 1XO3A 3M7GA 2EXZA 3S1QB 4OVZA 2EE1A 2KAJA 2R7ZB 1EYCA 3BDOA 1VMCA 1AFPA 2LKVA 2Y3AA 2CJOA 4PMBA 3I57A 2O5JC 2E3TA 1WTXA 5I6YA 1SFOB 2EOTA 4J1MA 1FEHA 1E10A 5CR3A 2V0GA 2EZVA 1XYIA 3S14B 2ONQA 1GJXA 2FJ2A 3WDNA 5JAVA 2BE5D 3ND9A 4KJNA 2BTEA 2R6GA 5M3MB 2HTME 4WORA 2X6LA 4QIWB 3H91A 1TS5A 5H92C 3DM1A 1CI3M 2PW9A 2RKSA 5A35A 3HOZB 3T56B 5D3IB 3VYUA 2JWUA 3D4WA 1ENCA 1KF6B 4TQ1A 1VZ6A 1QE6A 1VF5C 3Q8AA 3N6RA 2DN8A 2Q8IB 2BW2A 3M7NA 3NUHB 2O5IC 3E0JA 1Q90A 3O13A 4RGMA 3TP5A 4K6DA 5C4ZA 4ILWA 4XQJA 4IFDH 3GTGB 5H8YE 2K3UA 4ZYSA 1C79A 3VR3A 2LUMA 3MWYW 5CBAE 1N60A 1K51A 1GUOA 1G8ZD 4JBWA 4XDCA 3CQZB 1MBYA 4IDIA 3VRAB 3PV0A 3P20A 2RDGA 3E5SA 4RHRA 4DN4M 1LT5D 1LT3D 1FNUA 3BG3A 2WDQB 4HCEA 2JYEA 2RMMA 5EKLA 1WGKA 1YQ4B 1PTOC 1EM7A 3QOJA 4C7YA 2KN4A 3SEBA 2D2CC 1I4XA 1F77A 3R93A 1BR9A 4IQZA 4X3TA 2LS01 3OWFA 3BVZA 4ULLA 4U68A 2INNE 1SNMA 1WVLA 4RF0A 1S5ED 4DQOC 2R93B 3NRZA 1JWMD 1HUNA 1IGDA 1DCZA 2EYOA 2A6ED 1JRPA 1QB5D 1T6BX 3DWMA 3C3LA 1I7HA 3I8ZA 2BB5A 2INPE 3TMEA 1C4PA 1AEXA 1DZ1A 2XRQD 4L63B 1HFGA 1Y1VB 2BB6A 2N7JA 2K28A 4JWUC 3FPUB 4R8IA 5C0XJ 3NPPA 1RTNA 1P7FA 4S3SA 4RNAA 4DXFA 4UDUC 2MHVA 1TR5A 2L52A 2WXJA 1E2VA 3NTKA 4IUTA 2F0UA 2F4IA 2LJIA 4PMWA 1EWCA 4XTCS 4L6TB 5FR3A 4ZHOA 1T5EA 1XLPA 5C3WA 1F9SA 4LJZC 1TS3A 2SNSA 1GUTA 2CVRA 2MGSA 3K57A 1A6XA 4V190 2RDHA 1T3QA 2IGDA 3HRDD 3I72A 5G3LF 4X3KA 2F03A 5DAUA 1RJTA 3NTIA 4LK0M 1S4ZA 3RFZB 2XWJB 3S1NB 3TN2A 2F0LA 4IN3A 2R61A 4Z9CB 5KNCA 4RAUC 3TUOA 1A15A 2VNUD 2WXIA 1BCPC 3PUYA 4Q0FA 4OZCA 4L23A 1SYCA 3K7AB 4M1UB 4CGYB 5C3EB 2Y0SB 3FMCA 3P63A 2BA1A 2ZT9C 1FMAD 5KNDA 2H89B 1PTOB 1F2RC 1FCLA 2OEOA 1KNAA 1F9PA 2F0GA 2K0PA 2EJFC 2L0CA 1N5WA 5HHDG 3P4QB 3EVQA 3SK6A 3SR1A 3AMUA 4RCOA 1SNCA 4XDDA 4DAPA 1AW7A 2YEPF 3NQIA 1NAPA 1EU3A 1KRHA 1KDCA 3TEWA 1IBXA 3NVZA 1D5XC 3S16B 1N63A 1QCBD 2K22A 3I4NB 1QOFA 1P7EA 3KBXA 3AE2B 1MSHA 1K53A 1NI3A 1RODA 1W6JA 4FF2A 2AUKA 1SSOA 1DOIA 2BA0A 2PMVA 4JX1C 1KNEA 5JPNC 2EJMA 2MP1A 2E2HB 4XWWA 3SE0A 1U4PA 4DA2A 2K04A 2QCPX 2RVLA 5HURA 1WXQA 5GXGB 3R2IA 2HDLA 4NMZA 5ELCA 4FYDA 1H9SB 3L3OC 1FO4A 2RBMA 3C46A 1V8QA 3AH7A 3AEAB 1GB1A 4ZUJA 4DNRB 1ZE3D 1MI0A 1HPCA 5IOCA 1ACCA 2CU3A 1QWYA 1N61A 3BWUD 3N9YC 2NUCA 1XF5L 4O42A 4PNYA 2WS3B 1EEID 2ZW1A 1CHQD 2AUJD 2L9HA 5ELBA 4KJOA 1PDQA 1Q1BA 2AWNA 1NUCA 2FINB 3Q8CA 1CQFA 5EKIA 4PQXA 1VJKA 3AEFB 1ZXHA 1JQYD 4B08A 4JE3B 2BOSA 1V97A 2EKIA 1H9KA 2PTLA 1Y56A 1LLRD 3M85A 2EELA 3PO0A 2K05A 3U9OA 2I07B 2MJEA 2QSDA 1CZPA 4KKIA 3TP8A 1Q10A 2PKOA 5CYUA 3DMUA 2EYHA 1HQRD 1CJEA 1UWMA 2KVMA 4TRDA 2WXKA 3VR8B 4FXCA 1L0XB 4ZK9B 1Y8PB 4IFDG 2LFIA 2WXGA 3LYYA 2EY1A 1I4HA 1A2TA 4TKOB 5JEAG 1D6EC 2WP8J 1CZGA 3HUIA 5JJZA 1QILA 3EROA 1YNJD 1QNUA 2NN6H 4MHEA 1SF0A 4XWTA 5EGTA 1AP0A 3OOCA 1QLBB 3CHBD 4I7ZC 4UAIA 2IL8A 2M0AA 1L4ZB 3TEXA 1K50A 1GXDC 3UI2A 1JROA 1EWYC 2N9KA 4A3KB 1B9MA 1E0ZA 3KWVA 2A69D 2PZTA 1SXTA 3M4OB 2RQXA 2PVGC 5KRUA 1HA6A 1CHPD 3H94A 2FFKB 4HAEA 2F0QA 5BMGA 2JP1A 2SOBA 2CW0D 2JE6I 3MXNA 4CJ2C 1PUTA 5FLXL 1C4AA 1A2UA 2IGHA 3Q23A 4IFDI 3OW7A 4HMIA 4KY6A 5LHY1 4XE0A 4F7XA 2YEPB 5JEAH 2JSOA 1EQVA 3QWNA