1CK1A

Structure of staphylococcal enterotoxin c3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (ENTEROTOXIN TYPE C-3)
publication title Zinc-mediated dimerization and its effect on activity and conformation of staphylococcal enterotoxin type C.
pubmed doi rcsb
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ck1A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ck1A02
1S5CD 3BVZA 3DWQA 2RDHA 1QILA 1SE2A 1PYWD 1D5MC 1I4GA 1UUPA 2IPKD 1PZKD 4RFBA 1M4VA 1G8ZD 1EEID 5ELDA 1PTOD 3BVMA 1D6EC 1PZJD 2XN9C 1CQVA 1FGBD 1LT6D 1S5FD 4L6TB 1ET9A 1STEA 2R61A 2TSSA 3BVGA 1RD9D 1JR0D 3EA6A 3BZDB 1HTLD 1LTRD 3DWAA 3W2DA 1V1PA 1EEFD 4Z9CB 1FNVA 4ZYSA 5D3IB 1LT3D 1PTOB 1TY2A 5ELFA 5TSSA 1LTBD 1BCPB 1LTAD 1JWSD 1T5XD 2QILA 3KLSX 5D3DA 1JCKB 4O1NA 1AN8A 4RGTA 1TS5A 1I4QA 5ELEA 1SJHD 1PRTC 1HA5A 1EFID 4BWGB 1EU4A 1LT5D 1PTOH 1LO5D 1BCPD 3OWEB 3BYYB 2SEBD 1ESFA 3MC0B 5FKAC 1L0XB 3EFXD 2AQ3B 1S5DD 1ET6A 1CT1D 5FK9C 1B44D 3TSSA 3GP7A 1MD2D 1TS4A 2XNAC 3CHBD 4RCOA 1PRTF 1RCVD 4RHSA 4UDUC 1JWMD 4RGOS 1KLGD 1TS3A 1I4RA 4RGMA 2XRQD 3DWPA 1BXTA 1YN3A 2Z8LA 1PZID 1FNUA 1KLUD 1AW7A 4RH6A 4DXGA 2NTSA 1LTSD 1F77A 1YN4A 1CHQD 1UNSA 1DYQA 4L63B 1JWUD 1SBBB 1V1OA 1D5XC 2O2LD 1JQYD 1DJRD 5ELCA 1RDPD 1SE4A 4OHJA 4NZLB 1RF2D 1I4PA 1GOZA 1D5ZC 1TY0A 3MFGA 3SEBA 1PTOC 1V1PB 2ICIA 1EWCA 3R2IA 1KTKA 1SEBD 3V05A 1TS2A 1BCPC 2CHBD 1HXYD 1L0YB 3BYTB 1FNWA 1I4HA 2IJ0A 3R8BA 4C56C 1CK1A 3URYA 1XXGA 2G9HD 2J4XA 1EU3A 1LLRD 4TSSA 5ELBA 4RHRA 1PRTB 2QEJC 1S5ED 4DXFA 2WV6D 1HQRD 1XTCD 1SE3A 1LT4D 1LTGD 2XRSD 1LTID 1PTOF 4K6LA 3R2TA 1BCPF 1FD7D 5I4DA 2RDGA 3O13A 1LTTD 2AQ1B 1I4XA 2AQ2B 2NTTA 1PRTD 1ENFA 1SXTA 1S5BD 4RGNA 1CHPD 1B1ZA 1SJED 1YN5A
chains in the Genus database with same CATH superfamily
3E5SA 3S24A 2FCSA 3AEAB 3RUIB 3VUYA 1VZ6A 2CW0C 1EFWA 3C2PA 3MZ5A 1TWCH 3HKZB 4A6QA 5FO8B 2LXCA 1NMFA 5J1ZA 4FXKC 2L4NA 1CI3M 1PGAA 3KYCD 3P1HA 4UPAA 2D0PA 2NVYB 5HG2A 3IAS1 4KKTA 4FNFA 1CQVA 1ZW7A 3PZDA 1IUEA 1XWEA 1VQFA 3AEDB 3GE8C 2XBBC 4QIWE 3EA6A 4WFN3 1HTLD 4LNNA 2KA7A 5AFWA 2G5DA 1IL8A 4DWFA 4JWUC 5EPJA 1NBFC 4JI1Q 3Q3JA 3GS2A 3W3AA 4A3LH 2PZUA 4JLCA 4B9WA 3JYUA 4JI3Q 3S1QH 4MM3B 4UY8C 3L7ZC 3RD2A 4PMBA 1E7ZA 2V4LA 3OG5A 5D2MB 1EOVA 4Q0FA 1XNRQ 4A90A 2RBMA 4LF7Q 3D6WA 1YJ9A 3K57A 4A3FH 1TWFH 2RSOA 4OO1G 2X38A 5F2DA 4IUPA 3MFYA 3AN1A 4CKBA 3V61A 3AU5A 1EY7A 4AIMA 2A8VA 2PKOA 3R93A 2HT1A 1ZXIA 2KXJA 2MEKA 4TQ1A 3AEEB 4TKNA 1QWYA 1P7EA 4K3BA 1IGCA 2K6DB 4K5VA 4GU2A 3I5JC 4AWJA 1JJCB 2LFNA 1D2BA 5GAHC 3EN2A 3I4LA 1WGHA 1VQLA 1CUKA 3N52A 3N6RA 2L7RA 3P2BA 2D62A 3A8IE 3MEHA 3QB3A 1BXTA 4GKKQ 4BY7B 2BYEA 4QCLA 3CCEA 2DJFC 1J8IA 5IYDH 1RTNA 3K5NA 1C78A 5C44H 4NY0A 2OQ0A 1WXVA 1JWUD 4IJHA 5EBCA 2N9XA 3GTKH 1OEYA 1N9WA 4DV5L 3H8HA 3KYDD 5C4XG 3OTOL 2NN6H 4FLHA 2BDOA 1IBML 1D1IA 2ASBA 3HK0A 2C35B 3VDZA 4YSZB 2OQKA 2IYDB 3J81L 3CQZB 2MHJA 1WM2A 1HXYD 5KNDA 4JI6Q 4KX6B 3U50C 2Q2HA 4C56C 3ZJTA 1K50A 1PFSA 3I90A 2KHIA 5C3EG 2IL8A 2LEKA 4IUMB 4S0RA 1E7PB 4YXDB 4I7AA 4DR2Q 2FUG1 3VH4B 1EIYB 3M85A 2F0IA 1B4OA 3PIP3 1F2LA 1B9NA 5I6YA 1WE7A 4J3OD 5AZHA 1TWGB 5FLXE 1YQBA 2JWZA 4ACFA 1KXLA 3Q6BA 4WORA 1YJNA 3QO2A 3QJYA 4KVGB 1X6OA 3MTNB 4DR3L 3Q3MC 1WRIA 4RGNA 5KRUA 5GAEC 5GROA 3UI2A 1S5CD 3DWQA 4AQYL 4YHHQ 2ATWA 2IX1A 4EGVA 2WIIB 2FCNA 1D5MC 5EKLA 5CGKA 2VQEQ 4A55A 3VA7A 2R93H 5M3MB 1M94A 1E9MA 2KEEA 2QCPX 2ON8A 3AE9B 4YWGG 1EEID 3IHPC 3N1YC 4GLAC 5DEHA 4B9XA 4JI1L 3I70A 4DR1Q 1SMYC 2JN4A 2DZIA 4LCDE 3GTPH 1FJGQ 4OO1I 2L0FA 1BF4A 5EE0A 1T0RC 2H88B 3KBGA 2F0JA 4ZKBB 2VQFQ 4IWOA 1K83B 1PXUA 4YWKA 4B3TQ 1XNRL 3MAQA 3PLUA 1EYCA 3AE6B 3NS1A 2JZPA 3M4PA 2KTRB 1FR3A 4K0KQ 1F0ZA 5C4JH 2XWJB 4FO2A 2D0OA 2EE1A 3CAMA 1LTBD 4ZUIA 2NVTH 3BG3A 1VQDA 1WR1A 3ZW3A 1J8CA 1PUTA 1J19A 5KHQA 1QOFA 3S2AA 5IN7A 2WQYB 4NDXA 1PDXA 1I94Q 1F2MA 2JYTA 2HCIA 3N20C 4A3BG 3GTGH 3ZVVA 4JI8Q 5CV7A 4RWSC 3ZJYC 1EU4A 3K5LA 1LT5D 1D4BA 1UF0A 2IZVB 3V6CB 2EQSA 2IX0A 2PIAA 1PH8A 4JV5L 2B3AA 2B2TA 2Q2TA 1DCZA 3NZ3A 1HPCA 4GSWA 1TS4A 2CWAA 3H9DA 1H8CA 2Z6KA 5IGBA 3U9SA 2K05A 1JROA 1MFWA 3N1ZC 1E1OA 4K7SA 3T4AC 1HNZQ 2ENBA 4LDTB 4KGSA 1IBXB 3NEMA 1LFDA 3PIO3 3BJUA 1PZID 1YNNC 5C4ZA 1QJOA 2F0UA 1L1OA 1HH2P 2A68C 2GA4B 4JW0A 1EY9A 4CKEA 2OOBB 3Q2AC 1NDDA 2J53A 3PHXB 2DY7A 2LASA 4QUFA 4IPGA 5A2QL 3J7AV 2L32A 3ZO5B 2F0HA 2BDNA 3HEJA 1E8YA 4YCVA 1U4LA 2WXMA 1RODA 4ZHOA 4FXDA 1ZDVA 3Q14C 1BDOA 1WE6A 2BW2A 3JAMc 4P71A 1QVFA 2K14A 4YTMB 4DR2L 2F0FA 1C1YB 3V05A 4EEWA 1B8AA 1P1AA 3DBLB 1IBLQ 4OWTB 4IZ8A 1BCPC 5CYUA 4G7OC 3HHMA 2G3QB 3AECB 1XMQQ 3TEWA 4GLVB 3TQYA 4DV0L 3KQ4A 2WFWA 3S1MB 4A3CH 1I42A 1HFGA 5E4XA 1EU3A 1VQCA 4BY1G 3GV3A 1S5ED 4M0WA 2F0DA 4K6LA 3APDA 5JZEB 3HRZC 1LTID 4BFRA 1V43A 3EQLC 4FULA 5JPMC 1VQHA 1LV9A 1F2RI 4R9WA 4JVZA 2WWZA 2LVPA 2KVRA 3P4PB 4ZCKA 4II2B 3SK8A 1HZ9A 1HE8A 2KN5A 2H1EA 2RSNA 1FJGL 1B1ZA 1FIQA 1EZ6A 4XQJA 4LFAQ 1HZ5A 3NZSA 4P1CC 1SYDA 2VQFL 2K01A 2MBHA 1A15A 4B3TL 2ZT9C 2WXFA 1G8ZD 2LUEA 1N61A 4K0KL 3J80E 1XT9B 2UXCQ 3VQIA 5GADC 4DV3Q 1VQNA 5CV8A 2NZOA 2D3AA 1KF6B 4JBKA 5IOCA 1NR4A 1MSHA 2QMTA 3D3RA 1RD9D 4P75A 1YEZA 1HHVA 3S14B 5IP9G 3S9WA 1RLFA 1L4ZB 3FP9A 2KENA 2FFKB 4KHVA 5C4XB 4EQOA 2CU1A 4DHZE 1L0WA 2MBQA 3KDFA 1MJDA 1T0SC 2MJDA 2GOWA 2K4KA 1EQQA 3ZNHB 2BH2A 3ULPA 1A0IA 5NUCA 3TMEA 1HEZE 1WZ0A 4ARCA 5H92C 4EX5A 1P7FA 1E0BA 3G4SA 2KMAA 1HUNA 3RMHA 3HRDD 2KNBA 3MHSD 2RQXA 3H15A 2C7HA 5C3EB 3LXFA 1HNZL 1QLBB 2K1FA 3TZDA 1SSNA 5KHOA 1S5DD 4CKCA 2K04A 2GBKA 2BB5A 1FPYA 1FM0D 3AI5A 3I8ZA 3ML9A 2ZCCA 1U4MA 1A70A 2F0OA 4RCOA 5E7NA 2BA1A 4GKJL 4E74A 1KIXA 1E8WA 2F3IA 2IO1B 2JSVX 3QAQA 4IG7B 1BVSA 3JAML 2Z4HA 4UAIA 3HOVH 4GDLB 3PUWA 1WWTA 3S1NH 2KX3A 3CF6E 1WH3A 4YTPB 1IBLL 1UGMA 1WJ6A 2PQAB 1EQRA 4JBMA 1GB1A 4JE3B 4ZKCB 1GHKA 1HFNA 1O7ZA 4K5XA 1L6VA 1XMQL 2N3SA 2LGXA 4YWMA 3H6NA 3P63A 4OZBA 2YTXA 2F0KA 2INNE 3MEFA 4OHJA 5ELCA 5DM63 2V3NA 3TREA 1Z9FA 3BS1A 2B2UC 2N4FA 1DOXA 3VR6A 3L3OC 1AWDA 2RCNA 3NPPA 1GUAB 3A56A 4LF4Q 1N60A 3J9CA 5FO9B 1TS2A 2HD3A 5C23A 4UP8A 1X3PA 1JJGA 4GN1A 3FILB 3JVZX 3AU7A 2JXMB 5IT9E 2O6VD 2H4OA 2OEOA 4HJ9A 3NVYA 2PCFB 2G9HD 5C1ZA 2K8BA 1A2UA 3DOWA 2QW7A 1UE6A 3TZUA 1SNPA 1F52A 2ZPYA 3HOZH 1EQVA 5FO7B 2XRSD 1EWHA 1Z5SB 2D2QA 2E2JH 1IKMA 2IGHA 2KN4A 3AE3B 3Q3OC 4A3BB 4LFAL 3MVVA 5FJ8G 1PA6A 4QIWB 3BDCA 1MG8A 5EDSA 2JA6H 4KJNA 4ABNA 5I4DA 2NBVB 3BDOA 3RNEC 3O13A 3H7SA 3N3KB 1U5KA 5LLIA 4XE0A 2Q2UA 1G6JA 1YVCA 1EQTA 1ML0D 1FXTB 4DV3L 1GUWA 2WXPA 4R3DA 4X64Q 5E6OA 1AYFA 3VR8B 2F0TA 2N9KA 1PH2A 5E4WC 2UUCQ 1C4CA 2WKCA 1GUSA 2Z6BA 1PYWD 4JPSA 4A3KG 4B3SQ 1RWSA 1HA6A 1GJXA 3ZNID 3KUCB 2K5QA 5D6JB 3NE5B 1S4ZA 4L6TB 3WAOA 2MSED 3GTJB 2KBNA 4OW0A 4XWWA 3M7NA 1X3FA 4L23A 5GMVA 1WM3A 4J15A 1FFUA 2KT7A 3L0WB 1ZYRD 3RI7C 1WCMH 2VH2A 1RRBA 2EY2A 3EROA 2MJEA 2B29A 2KECA 3IAYA 2EKEC 1XEEA 1X3GA 2YEPB 4RGTA 2EYHA 2F0PA 3ERSX 3P75A 1IYJB 1SJHD 3MXPA 2VUMG 1JOQA 2LRUA 4IM2A 4ZRJA 4JI7Q 3NZUA 2JA7H 1QOGA 4C3JG 1ICFB 4ME3A 4XYCA 4ZRPA 2FUHB 2FMCA 3BYYB 3OWEB 2M00A 3T3NA 1BBWA 4BY1B 2DYBA 1X54A 4LJZC 3U7ZA 4PZ7A 1EWIA 3A5UA 2IGDA 2MP2A 3A8JE 1WTHA 3AE2B 3AULA 3EHVA 3CMEA 3HG9A 2IO2B 3ULJA 2OJWA 4ZRZA 4KDLB 2K39A 2RCFA 4REZA 3ZNZB 5IWAQ 4XC2A 2M2LA 3K8AA 1B9MA 1HZ6A 1KDAA 3QWNA 4X65Q 4KGTA 4EZJA 1NY4A 4FBJB 4HAEA 1N5XA 1YN3A 1C7YA 3L0OA 4WWMA 1KLUD 1M8AA 2Y0SB 4X66Q 4ZK9B 4WIPA 4LNOA 4A3JH 1EO6A 3QIJA 1NEKB 1NI2A 5JJZA 4LF4L 1H9JA 3RN9C 4BBNC 1R9TH 1NYQA 3W5UB 1DD2A 1UELA 2D07B 4CDFC 3VYRA 4RKBA 3DXJC 2LVOA 3QARA 2BB6A 4KDIC 2ZXOA 3K59A 1Q8IA 2WB1E 4NZLB 5EAYA 2M19A 3D4DA 2Q8TA 1TY0A 3QOJA 1U4PA 1Y1VH 2W9NA 3AEGB 4NQLB 5LXIB 1JOKA 5C2TB 1R7SA 3I4MG 3AYHB 2C9WB 3UIPB 5BR8Q 3GTOB 1Q7YC 1DOMA 2EYJA 2K8HA 4FF3A 4QJFA 4OX9Q 1YMHE 3I3TB 2M4NA 1SNOA 5IOIA 5C0XH 1KC8C 3RLNA 1PRTB 1QB5D 3ERQA 4X64L 1XTCD 1GUTA 2JA8G 2KCNA 3S1RH 3DBHI 5GQOA 3L17A 4HKQA 4LLGM 1TYGB 2UUCL 1YHBA 3OMGA 1BCPF 3J7AF 3CRLC 3NWSA 1BT0A 4B3SL 3QJZA 4DV4Q 4L5RC 3J81E 2CHWA 1YIJA 1S5BD 1SNMA 1CHPD 3CRKC 2G45B 2RKSA 1WD0A 1V8QA 4HN7A 2JZZA 1V6EA 2WX0A 4Y7NB 3Q23A 3P7JA 2WXLA 4HDQA 4WWOA 1VZ7A 4IOAA 1PZKD 4A3EG 2ZNVB 3H0GG 1SROA 2KEDA 4PS3A 1YJWA 3HOUH 4NXML 2PPHA 3VRAB 1BKBA 1LYLA 4IUQA 1D6EC 1IBKQ 1PZJD 3ITPA 4QB4A 2JEAI 2JT4B 2EXDA 4W9CA 2RPVA 3AEVA 2D3CA 4B0EA 1TQOA 2KAJA 2B2VC 3H7PA 1GVPA 2AWNA 3RZDB 3FKIG 4LNQA 1Q90A 2N8NA 1QQRA 3KF8A 4JI7L 2GBNA 2NZ1D 3T1HQ 1NAPA 4KIKB 2NVYH 4R4CA 5TSSA 1WMHA 2KDIA 3Q8BA 4XX5A 1VQ9A 3ICEA 2JE6I 2D3GA 2NPTA 1TWHH 1JWSD 2F1MA 3CD6A 3KLSX 2FNJB 2Z0DB 3AM9A 5JOBA 4ZQ3A 2PW5A 4A3GG 4EZLA 1NTGA 3M4OB 4G3XB 5ELEA 3S15B 3NRZA 3CCJA 1O7YA 3X3NA 1YHQA 3V60A 2A69D 3NWTA 2KWCA 1I35A 2WXIA 2DWQA 2V9HA 1F1HA 4HJAA 4US9A 1W6JA 2IDYA 2CKHB 3HFZB 2SEBD 2PMZE 4X65L 2AQ3B 1HR0W 3L2PA 1QT9A 1UZXB 5BMHA 1B44D 3NHHA 4X66L 1J9OA 2RA4A 4FVMA 3I4NG 1F2ZA 1WTOA 1MKHA 2MO1A 3ZKJC 4ZHPA 3AQQA 4HSPA 4R8IA 1N33Q 2WXGA 2KMCA 4H2AA 1KABA 2UU9Q 3GE3C 4UP9A 3A0JA 4C3HG 2I2YA 1S1QB 3PPAA 2XRQD 1YITA 3DHGC 1QZGA 4BVUC 1UE5A 3RT3B 2JJQA 2VB2X 1JWAD 2V3SA 4TQ0A 4LNIA 4NXNQ 4W9IA 1JT8A 1VJKA 3J7ZC 3B0AA 4A3KB 2Y5CA 2O5JC 1I6HB 4WJOA 2K9XA 1D5XC 1NNXA 4G7HC 1A63A 5BR8L 4BY7H 2NS5A 1S40A 4C2MB 4F8MA 3HVDA 4OX9L 2KQ7A 5HY6A 4C7ZA 2EJMA 4G0NB 2K33A 4B6WA 3HOXG 1UGJA 3LWUA 3H3VI 1H9RA 2CHBD 3Q8CA 3D0FA 3U4ZA 2IX3A 4DV1Q 2B2YC 2W82A 1TKWB 4WJ3M 1C76A 2MO0A 3PO2G 1FXAA 3K7AB 2KHSA 4NAWA 1QUQB 1GUGA 5A2QE 1R4QB 4KLKA 1VQKA 3CQZH 3G7LA 2HDMA 2WB1G 3AB5A 1RAXA 3VYUA 2FCQA 5IAAC 3U30A 4LF8L 2GVAA 2VUMB 2DGYA 2FXQA 3D4WA 3DUZA 3QA8A 2F3VA 1SB3C 2NZHA 4C3JB 2IHEA 4EVOA 2EZVA 2CQAA 4PQXA 2B63G 1BMLC 2WP8J 2M1MA 2QHOA 2WU5B 5L95C 3R7QA 2PNHA 1GD7A 4IJLA 3C46A 2R7ZH 4DR7L 1AH9A 1TU2B 4DHZB 1PFNA 2KWUB 1IBKL 4IFDG 1JMLA 2VL6A 1V8CA 5JJIA 2F0VA 3PO3G 1H95A 3KW5B 1H9KA 2D5GA 4CDDC 1TWGH 4FA6A 1RM6C 2BYVE 3JW0X 3T3OA 3IFWB 3N9YC 5G3LF 4HIOA 1TWAB 1K73C 3M3YB 1SE9A 3U9OA 3RN2A 3OPOA 1I50B 2A19A 4KTAA 2ZJQA 3Q8EA 2EY5A 4XYQA 4J8QA 4DR6Q 4AYBB 2R7DA 3RZOB 5IKCM 1DOIA 1F2RC 5C3JB 3DBRI 1OXXK 2FINB 5M5XB 3S2HB 3FC4A 1Q3LA 5M3MH 4WJNA 2L3ZA 4R4IA 3ONAB 2WGSA 1PDQA 4QY7A 5FLMG 4FHJA 2D10A 4M02A 5I2YA 4V0BA 4BA2I 2HD5B 4HKZE 4M01A 5CX3A 4WAFA 1E2ZA 1H9SA 3CKIB 2K3UA 1OQQA 2KD0A 2L9HA 2MJ8A 5BMIA 2B8GA 2KC1A 1K83H 1NYRA 4LFCQ 2UXDQ 4DHJD 1IW7C 2K7VA 2AL6A 4JGHB 3I4MB 3C1FA 1VQ8A 4OONA 1A62A 1N33L 2PW7A 1SNQA 1YNJC 2J0MA 4DFAA 4DR3Q 4M0WB 5FKAC 2UU9L 1ESFA 3CCLA 1SGHA 3EFXD 3OHXC 4AQYQ 3A4SC 3A9KA 3TEYA 2M0XA 4W9KA 1MJEA 3TP6A 2JA8B 1XQQA 2JUOA 4A3DG 4WQOB 4R4TA 4NXNL 1SMYD 2I5MX 3ECIA 4RKLA 5J17A 1CTMA 1N34Q 3VVWB 4BXXG 3EIVA 2F0EA 1JJ2A 2I1KA 1NMGA 3F2DA 4NJCA 1WFQA 1KLGD 5KYIA 1PFDA 2BT6A 1AARA 2JYEA 3IVFA 1WF9A 1HNWL 3OSOA 1XCTL 2KUMA 1FNUA 1PV4A 1N36Q 1ENCA 4TMAB 3UI3A 2NBUA 4A3EB 1WGDA 2BBCA 2E2DC 3H0GB 5IYDG 1N32Q 2FCMA 2WS3B 4OL7A 2A6HC 2CH4A 4DV1L 1JQYD 4APVA 1JMCA 4ASWC 5J2RA 1L7YA 4N9PA 3DVGY 4ITKA 3NJTA 3I4OA 1Y56A 3SEBA 5A35A 4HROA 1KRTA 1HR0L 3EJIA 2BH8A 1PFMA 2ZXPA 4BBSG 3FKIB 3KDFB 1Q0WB 1TZOA 3AE7B 3DVNU 3TUOA 2O4XA 4BBNF 1Q86C 3TS2A 1RJTA 3CXCA 3JAME 3URYA 1WYDA 2ID0A 1Y69U 4IFDI 2KLCA 3PF5A 3NQIA 4JV5Q 1DZ1A 2J52A 2HTHA 1X9NA 2QC8A 1V1QA 1AZPA 4A3GB 2WV6D 2YTYA 2LXJA 3LWEA 2DAJA 3N32A 2J7QB 1YX6B 2C60A 3NVWA 2ZVNA 4G57A 1YJ1A 2R6GA 3PUXA 1JORA 1OO9B 2WACA 2RDGA 3DBRB 3S1MH 1H4RA 1KOTA 3KWVA 3FKYA 3JC66 3D31A 4QL5A 3OLMD 1SJED 2QF7A 2HHHL 3I4NB 4OO1H 4DR6L 4K7WA 4K2LA 4DR5L 2NWGA 1GPXA 4RFBA 4ILWA 2MNAA 2KLGA 2DN8A 5ELDA 4C3HB 3NUHB 2R7FA 1JOOA 1Y14B 2PE9A 4WJQA 4MJSB 2TMPA 4L1BA 2XN9C 5DAUA 3U7DA 1RL2A 3KJPA 1QZEA 4YL8A 1T3QA 2R61A 1YZ6A 1Y1WG 3QIAA 1A3TA 4HXDA 1WX7A 2GVBA 1IPGA 1FCCC 2WINB 3TP8A 4LFCL 2UXDL 3R3MA 3NBHA 3TP7A 4DV0Q 1V1PA 3S2DH 2WLBA 1XLQA 2PYKA 5D3IB 3AE8B 3IFDA 2L00B 1VQIA 3IT4B 2BCOA 3UDGA 1V5OA 2C7MB 4XQQA 4NMZA 4EOYA 1EYGA 4PS7A 2DLBA 4U673 1V5TA 4GOPA 3HOXB 4CYEA 1AN8A 1ACCA 3GO5A 4FF4A 3S14H 5HI1A 1SAPA 2JP1A 4ICVA 4MSQB 4BA1I 1PRTC 3Q8DA 1VDZA 5C4XH 1FXIA 1N34L 3B08A 1SN8A 4NPSA 5JVH3 4I65A 3KUZA 4XT3B 3PO2B 4BZAA 1VQJA 2FJ2A 3IKJA 1L0XB 3NS8A 1J7CA 4L2YA 4ZRQA 1ZGUB 2WB1B 1WXSA 3KLWA 1WJ4A 3CW2C 1N36L 1WYWB 2XK5A 5IO9A 3L9AX 3ZGZA 1BUVT 5EPLA 2B63B 2RSUA 1PGXA 3ZTDA 5C3EH 1GC7A 1K51A 3K9PB 4EQNA 1N32L 3VDYA 3VAWA 2NN6I 1BO0A 1I4RA 3M7GA 2NUCA 3HOWG 4WWPA 3TL5A 2DUDA 1JRUA 2L76A 1VQMA 2ZNVC 2ZJDA 1RHPA 1ZOYB 1TZ1A 4TRDA 3PO3B 1ESRA 2Z4IA 1CKNA 4OZAA 1ASYA 5LMNW 1Q10A 2EMSA 4MGKE 5FR6A 3U4EG 3OJ4B 4O42A 5LL6S 1K28A 2M56B 4YY3L 3C1EA 4IO9A 3I73A 1V2YA 3K6OA 5G5GA 1FFVA 1ZE3D 4I6NB 1Z2MA 3AFQA 3CPWA 1SE4A 4H02A 2DZKA 4KJOA 3Q3NC 4LF9L 4HSVA 3RNFC 3SDLC 3R2IA 3PQIA 2RGFA 3ETRA 4BAXA 4HK2A 3FMCA 3MXGA 3S16B 2DJGC 2SOBA 3J81j 2KQ4X 3AH7A 1I4HA 5BYRA 5EJWA 4KSKC 1WJJA 2J4XA 3G71A 2LHEA 1Q81C 4LK0M 4XWTA 2QA4A 1EF1A 3Q6SA 1C4AA 3NG0A 2E2HB 2QEJC 1HZBA 5IYBG 2JQRB 3ZLZA 3PSEB 1B53A 3BINA 4XZ4A 4IDIA 3SE0A 4GKJQ 3BK2A 5I9PA 4JI0Q 1OXVA 1SE8A 2E75C 3KJOA 1PVOA 5C5LA 4MZ9A 4O0AA 1BUIC 3KK7A 3AB9A 5JVG3 3Q3FA 1WJNA 1WD1A 2J0KA 2ICEC 5JAVA 1WYGA 2KZRA 2MP2B 3MC8A 2N88A 2PNRC 5C6AA 4OIKA 4DUZQ 2IO3B 4IOIE 4IWQA 3DVNV 5J22A 2K8CA 2HQLA 5CHFA 5ISRA 4A3BH 3M62B 4A3DB 2AX5A 1A8VA 3DLLA 1LABA 1N6ZA 5AZFA 2Y5PA 4X3SA 1M4VA 1CJEA 3SK6A 1WX9A 4FXCA 4AJYB 1PHJA 1STHA 2LMCA 1KNAA 2N78A 4PMWA 2F0SA 4HJ5A 2R2OA 4W9EA 3BVGA 2PJHA 4H13C 3QR8A 3U8ZA 3WANA 2N55A 1SYGA 5AZGA 2D11A 3BDLA 1UWMA 1QNKA 3R3OA 1NJIC 2HJ8A 3HOYG 2MCNB 1P16A 2LGYA 2LWPA 4POFA 1PH4A 3C0RB 1PTOB 4R1JA 4OIJA 2IW3A 5FOBB 1FVIA 2E5LQ 3GTJH 4YTNB 1W3SA 4OELB 4MNOA 2E3TA 3PUYA 1STAA 2RVLA 3FRPB 2O2VA 4BBSB 4S3SA 1SIJA 4IN3A 2KJRA 4AJWA 4AUQC 3EC8A 2A1AA 4U68A 4HJKA 1ENAA 1WGKA 3MJ5A 3W5VB 3FAHA 4ANUA 3CIRB 1WRDB 1CA6A 4KGRA 2A6ED 4ICUA 2AUKA 2C9OA 4XTCS 1VF5C 4MTNA 1M1KC 3A33B 4BKGA 1LGRA 4G11A 3PSIA 4XIGS 1T9HA 1F9QA 5EPKA 3ULLA 3CSFA 4GGQA 2Z6KC 5C3WA 3GTQB 4RGOS 3A74A 3WDNA 3RNBC 4BY1H 1TKGA 3HZXA 4II3B 1EYDA 5FLXc 3I63C 3UF8A 2L12A 1G91A 1F77A 2JA5H 1K53A 2WYQA 4LTUA 4RMAA 2OTJA 2N7JA 4B9KA 1XNQL 1WIAA 5JEAG 1LACA 4FJZA 1MHWC 3J80i 5CHWA 1GXDC 3SFDB 4N8FA 3I57A 5BN5A 5JXVA 2ZCBA 1UBQA 2ALYB 2W54A 2L1AA 1KAAA 4Y52H 4HCNB 1GHJA 4KV6A 1I4PA 4GDKA 3EVQA 1Y1WB 3TIXA 4B08A 1JB3A 3H7PB 1VQEA 3EGRA 2ICIA 1MVKA 2EJFC 4GN4B 4K3CA 1VQAA 3KF8B 5KGUA 1EIHA 1E2VA 3EUB2 3CSTA 1XD3B 1VQOA 1WMHB 2LHDA 4PK1A 2LGIA 4JI0L 2WXNA 2F0QA 4J1MA 5M3FH 4R4OA 2NPTB 1HZCA 4AQ7A 1MG4A 3VA5A 2FAZA 2MBEA 3BZKA 1JW9D 2BYFA 1VQGA 2KDFB 4TUUA 1VQPA 1VCIA 5K5PA 4C1NI 3MA2B 4DUZL 1PH6A 2NVTB 3CCVA 2MQJA 3ER0A 1OQRA 2BPSA 2BKFA 1A3VA 4A3IH 1CMXB 5T1IA 3OIQA 4JI5Q 1E7UA 4QGUA 1FD7D 3GTOH 2DHZA 2YEPF 2FIDA 4M00A 1VQ4A 1OTCA 4DPGA 1A5RA 2LI5A 4HCSA 5IGCA 3TRZA 3A55A 3QOLA 3H3VC 1KDCA 3ALBA 2BWFA 1FD6A 3IBEA 3LNNA 4DXAB 1OQYA 2D3BA 3P42A 1VRAB 4KD4A 5C0XJ 1P9DU 2RDBC 1IXRA 4DUYQ 1E0ZA 2GBJA 1XX8A 3HOWB 4ME5A 4BBRG 1VQ6A 2K32A 4X6AH 3EFUA 2JA9A 2R92G 2E5LL 2GB1A 4BKSD 3W5OA 3X23A 2CHXA 2KC2A 4Y7NH 4RA8A 3A9JA 4FF1A 1LTRD 3NTIA 2XEWA 2Q5WD 2LZ6A 4XDXA 4IPDA 4BOZB 3DEPA 1CSPA 1VD2A 3C8YA 5E6PA 1HUMA 1YI2A 3Q8AA 2HE7A 2CU3A 2FMMA 3E3XA 5LXHA 2RHQB 4B3RQ 4LK1C 1EY5A 4JIOU 3ZXVA 2NVQB 1E3PA 4JWSC 2EIFA 3RZDH 1TGZB 2ZZPB 4V190 2OJRA 2RDFA 1ROEA 2N1VA 2PLPA 3N1XC 5MPOA 1YHAA 4NAWB 3C19A 2MLBA 4LDTD 4MEMA 5J18A 2I5HA 3T8MA 3PRMB 3IFTA 3MC0B 3M9BA 1C8CA 2UWQA 2RD0A 3ZJVA 2JA7G 1QKZA 4GOCA 2O6VA 4JL9A 2MW5A 4ZRIA 3D32A 2KTRA 5EE3A 3M4OH 2N0SB 2UUBQ 2ZXRA 3S15H 3OJ3A 2LGSA 1CZPA 5BYSA 4OZCA 1EM7A 1KJTA 1FRDA 4NXMQ 4FHKA 4LF5Q 3ZQ4A 1PRTF 2E74C 4BKSA 1F9JA 1JWMD 2OHFA 3DBSA 4ID6A 2FIFA 4BOSC 4KK7A 1E7VA 1NENB 3U2SC 2JXXA 1ZUD2 1K52A 4LJOB 4F87A 1XMOQ 2ES2A 2XWBB 2QSDA 4W9FA 4TVAB 5FJ8H 2VS1A 1UNSA 2B39A 3F2UA 3BIID 5IGEA 4HCPB 2VRRB 4JOIA 2REXA 1YJIA 1P8LA 1WVLA 1WTVA 1WFYA 1KRSA 2L05A 3PV1A 4P6VF 1LTLA 4QQBX 4DV2L 2IGGA 1SIFA 2ZVOA 3HP3A 3LB8C 3I55A 2WXJA 4MACA 4KY6A 1HRJA 3PRZA 1RDPD 3S17B 3K80C 1SRUA 1SF0A 4GNXA 3L54A 1C3TA 4LFBQ 3GQBA 1MBYA 1MI2A 5M5YB 1EWCA 1EUVB 4A3KH 5IYCH 1R4NI 2PEAA 1CZWA 1I6HH 2F4IA 1WXMA 2OEDA 1EUJA 2AMCB 3HOYB 1IBXA 1IZ6A 1EOTA 3BYTB 3KYHC 4B3ML 4CO7A 1DGSA 4JI5L 4BS9A 2JY6A 1Y1VG 1K0RA 1XXGA 4C2MH 1JQ4A 1Q12A 3KUPA 4DK5A 5JPNC 2YU9B 1FO4A 4MTKA 3W1GA 1OXUA 4I6PA 1AE2A 1BQQT 1HTPA 4ZDVA 2EXZA 3WAPA 2DX5B 4X3UA 1LUZA 3R2TA 2B2VA 3CCQA 1XTDA 3A9KB 2AYOB 5IA7A 4ODGA 1UAPA 5CC4A 2AQ1B 4JYAQ 3K7AH 3SK5A 2QIEB 4DUYL 4JQWC 4N58A 1E24A 1VQBA 3GOEA 3K5OA 2EOTA 5LNK1 2HUGA 3M4QA 2VUMH 3OWFA 1GC6A 4RNAA 1QCBD 1XLOA 4IKGA 2WDTB 1UUPA 4TKOB 4C3JH 4A3MG 1II3A 3M4YA 3ZNGC 2OT2A 3RN5A 3NK9A 3NELA 2KFJA 1XO3A 5DPTA 4KY5A 4MSMB 1S5FD 4K7UA 2KHJA 4IPHA 3H6MA 2B2WA 2TSSA 3CWIA 1JE4A 3IXSA 1M90C 4B3RL 2KHWB 2B8FA 4POGA 4K81A 1X55A 4GN3B 4MIUA 2HTME 3W2DA 4K5WA 4H7BA 4PG3A 4Z9CB 3PT2B 1TWAH 3M3YH 4M8MA 4DGZA 3RLFA 1I50H 2KCTA 2CR5A 3HKSA 2F52A 3AEFB 1LTAD 4LF8Q 3VTWA 1WJUA 3RZOH 4K14A 1SYCA 3NTKA 5BMGA 5BN4A 5E1FA 3EBEA 3S2HH 2UUBL 2M8SA 4W9GA 2WXOA 1Q1EA 1IHZA 3CCRA 4DR7Q 2JXTA 3K5MA 2KFKA 1U0LA 3STBC 4LF5L 2HDEA 2LVQA 2QDFA 4KHPQ 1EIFA 4IOCA 5EBDA 1K8GA 3PHWB 1EYAA 5IT9c 1V9PA 4ZRKA 5FK9C 1YIWA 2A74C 3SFEB 4C00A 1XMOL 5DPRA 5M5WB 3I4MH 1CFMA 2K6AA 2CQOA 1BBUA 2PQEA 1R4NB 3J81i 2B2YA 4EFOA 3NENA 2F0LA 4OWWB 2EPBA 2N7EA 4L5TA 4RGMA 4C3IG 1GM5A 2KACA 3UIOB 1O80A 1MGSA 4NJ6A 1EIGA 1WI0A 2JA8H 5JJKA 4DXGA 1AW7A 1L0VB 1Q5WB 4A4IA 4OXPA 4DAPA 4LFBL 1ZYRC 1P3QU 4PT5A 4L63B 1FMAD 2PTLA 3QQ8B 1UE1A 1SBBB 1NVID 1D3ZA 3H3VH 2XVSA 2CW0D 4A93G 1B7YB 5IGGA 4BBRB 3RCZA 1IW7D 3FPPA 5D94A 3G6JB 2R92B 2RR9A 4IC7B 4IM3A 1GOZA 3DM1A 3NBHB 3KOJA 1SYBA 1PTOC 1V1PB 2PW9A 2BA0A 1UEAB 3DM3A 3CMMB 1NE3A 3G6EA 3H0GH 4WWNA 1L0YB 2RF4A 4L8JA 2H89B 2LGDA 1K8RB 1LQBA 3AMZA 4HRSA 3WIMA 1G6ZA 4GOPB 1IKLA 4JYAL 3W1SA 4HWIB 1Q82C 3VUWA 2K0PA 2G4DB 3P4RB 1SE3A 2MUYA 1WTXA 3ZRFA 1C48A 1B3QA 2XSCA 3FKIH 1YQ3B 3DBHB 2K5WA 1TT5B 5IE8A 1Z47A 3VR4A 2A5HA 1RKNA 1HNWQ 4IUUA 3VYSA 3GB1A 2JF5A 1DOYA 4AP4C 2K75A 1J5EQ 1FGUA 2XK5B 4A3GH 3FILA 1X1MA 1W6KA 2CCZA 4ANXA 3CP0A 2R7ZG 2E6XA 1QILA 2F03A 1I4GA 3VTUA 3E0JA 2EDGA 2HIXA 2K5VA 5E6JA 3IT6B 4DV6L 1Y8NB 1QZHA 2D2CC 4K8JA 4TV3A 1L2FA 4AH6A 1CKNB 4DV7Q 3UQBA 5EQ0A 1HR0Q 3I4NH 1ET9A 2JK8A 1WGRA 3RZWC 3BZCA 2QEXA 4LMQD 2KTFA 5AUIA 3AEBB 4IQZA 3T1YQ 1PH1A 3VH3B 4K8IA 3CC2A 1GUNA 1VS0A 3W1YA 4C3HH 1R4MI 1T6BX 1VLBA 4ZYSA 1CKMA 1LT3D 1TY2A 5ELFA 2NB0A 2Q8IB 4KHPL 4FN2A 3Q8FA 2K6QA 5IP7G 3CCUA 2EYOA 4ZAIA 3P20A 2WXRA 5BN3A 2V3PA 1V9JA 1VZ8A 3U4VA 5K36G 2I38A 2K03A 1S3SG 3AE5B 5H1SE 4BWGB 1EWYC 1L1OB 1PGBA 1AP0A 1XLPA 2YLMA 4FJYA 1OGWA 2JVCA 5CV9A 4HPMB 1F9SA 3RLOA 2HHHQ 3NOBA 1N62A 5KIXA 1ET6A 3T56B 3HOXH 2PI2A 4M1UB 4DR5Q 1DOKA 4LF6L 1NSNS 2G1EA 5CTRC 2K50A 4HJ7A 5L83A 4A76A 1R4PB 1F9PA 3K81C 4RG1A 2HIVA 5HGTA 5HURA 2EYPA 1KRHA 1YX5B 3RYTA 1I7HA 4UP7A 3WAMA 2VY3A 1KH0A 2L0TA 3PO2H 1ZEQX 3F2BA 1K9MC 3SXHA 4W9JA 2LUMA 1TKYA 2LKVA 4NKLA 4A3LG 1J7BA 1L6UA 4DNRB 3RULA 2ZPNA 3HGBA 4MDKE 1WGGA 4XQNA 4NB3A 1UD7A 2IY1B 3BWUD 1ILPA 4ZYNA 2B63H 1QF6A 1L2NA 1QE6A 2Z9HA 4KMUC 5LMUQ 4A3MB 1Q8KA 2LMCB 4A3FG 1STGA 5FR3A 3DVGX 2ZJPA 3DHHC 3KF6A 4IFDH 2MFIA 3T16A 3PO3H 1ISNA 1I3QB 3I2ZA 2LXAA 4HJGE 1SEBD 3MTSA 3F1ZA 2ONQA 3X0WA 1K8AC 3U52E 4DBGA 1NBWA 1B70B 4IPCA 3D6CA 1PYSB 4IW0A 1JE5A 4WJWA 5CV5A 4DK1A 4WURA 5E6NA 4F7XA 4K1RB 2O2VB 2WXHA 2WNMA 4NNJB 2NVXB 1J5EL 4A75A 5DNFA 2ZTDA 4DXFA 1MHXA 1TWHB 3S16H 3AXCA 2CKZB 2WHIA 4GIVA 1WI5A 2KQ3A 4UHVA 5FLMH 5C44G 4CQNA 4IM0A 4MH8A 5CV4A 4JBJA 2WDVB 1X65A 3JSVA 1EY6A 1R4MB 2XGTA 2E2HH 2NN6G 2P5ZX 4DV7L 4MGYE 4IALA 1YN5A 1XF5L 4C4VA 5CBAE 4I7ZC 2RDHA 2QGQA 4YY3Q 1HNXQ 3MC9A 2VW9A 4C7YA 2IHFA 5JHBA 3A7LA 3TBIB 3T1YL 1TIFA 1K3RA 3QK0A 1JRPA 4DDGD 1B3AA 1RTOA 2V0GA 2PZWA 4KY7A 2CFMA 3SGIA 4C3IB 1HCZA 5CBEE 2ZTCA 3CCMA 3MXNA 4LF9Q 3IRBA 1NR2A 2I5LX 3A1QA 4E71A 1LT6D 1PFBA 2BE5C 3SHLA 2VZKD 3P1MA 4A3DH 5J39A 4F7ZA 3HUIA 4W9HA 4BXXH 1TXYA 2NVUI 1YNND 1DONA 3P4QB 4CHTB 2W3RA 3PRPB 2A68D 4F8CB 1DOLA 2PI2E 1ZXHA 1PH7A 4A93B 4PMCA 1FNVA 3APCA 2MPMA 1OTRB 2KOXA 4GDKB 2ZEQA 1WTWA 2I46A 4YT0B 2UU7A 2E8GA 3PREA 4XDDA 4QF4A 1SFOB 1KFYB 4KN4C 5E3FA 4URKA 3NBIA 1KD1C 2N1WA 2JRHA 1QOHA 1HJPA 4N9F4 3JAMi 5G5HA 3FDTA 2FBWB 2PVOD 1WX8A 4IUTA 1PTOH 4R8NA 2I07B 2R93G 1WXQA 1LO5D 1BCPD 3F8TA 2K5HA 3J7YW 2AL3A 4IWPA 4DAYA 1A3UA 2IY0B 1UWVA 3HIZA 4P1BC 1CT1D 4RF0A 2VZAA 1KAWA 3A8KE 4KIKA 2B76B 4BBSH 3OOCA 3GP7A 2K22A 2JSOA 2NR2A 3ZTCA 1KL9A 5LMUL 3GTMB 1XPOA 3PUZA 3EECA 4F1SA 1TS3A 2A73B 4QUCA 3X3MA 2HQEA 4GLXA 1C79A 4KI0A 2A4ZA 5DCNA 2Y0SE 4RH6A 2R7ZB 2E2IB 3SR1A 2KDEB 1DXMA 1YN4A 4B95A 4XYOA 1Y8OB 3CC4A 2BYTA 1Z7TA 1D7QA 2DNCA 3GTQH 2KK8A 2Y3AA 3TS0A 3SD5A 3RNUA 3NY5A 4LWCA 3I91A 3WALA 1DJRD 1L4DB 1MPEA 3K0YA 3A9JB 4LAAA 3L16A 3DBLI 3L08A 1C4QA 3TN2A 1UH6A 1KTKA 1HQMC 4DAMA 1CKOA 2NBWB 3N30A 2DYOA 4WRDA 4CJ1B 1O7LA 1CK1A 3CMAA 3GTLB 3E9SA 2KYWA 4LUZA 3M95A 3HM6X 2KX0A 1LLRD 1Y1WH 5ELBA 3E6ZX 3RD4A 5D7GA 1VQ7A 2X69A 1I5FA 4JI3L 1LT4D 1LTGD 1CA5A 1PTOF 4LJPB 5DLQE 2FHTA 2I1JA 1HNXL 3PVLA 1TWCB 2J7ZA 3FVQA 4M8NA 4LF7L 3TEXA 4GN5A 4MHEA 5ELNA 2O6VB 5JH5C 3UE0A 2K25A 2AQ2B 4P7IA 1E1TA 4X3TA 1TIID 1XPRA 5IGDA 1QOBA 2JPHA 1E22A 4LNKA 2QCZA 5T8IA 5ELOA 1XNQQ 2JQOA 4HIMA 3E9IA 3B2FA 5I6WA 1KLVA 3SU8X 1QUQA 2M0AA 1YNXA 4RMFA 1UWXA 3L4PA 4WH4A 2V4IB 2DBYA 3MHBA 2Q8RE 4N9TA 2WXQA 4DNIA 2V4DA 3I56A 1A6XA 1ZDXA 2KVMA 3V96A 4A3CG 3D4RA 2M17A 2UYZB 3H1UA 1EZ8A 3S1QB 4GKKL 2LFIA 3PUVA 2N49A 1GO3E 1KNEA 2F4VQ 3U58A 1JWBD 2PVGC 3DWAA 3UDIA 4KKIA 5BO4B 1HZAA 2PZTA 1TWFB 4A3FB 2AWTA 1EEFD 3HOWH 2VNUD 4NJ7A 4GNXB 3PLVA 4MELA 1U9RA 3HVZA 4PS8A 2WKDA 5H8YE 5COYA 5JEAJ 2OTLA 3R66C 1S72A 3UGBB 1JCKB 1TJEA 3A4RA 2VB3X 4GOPC 1V86A 2PMVA 2K1BA 2XTIA 5GAGC 1TTNA 4HMJA 5C3XA 2CJOA 2SAKA 2INDC 5LMNQ 3L10B 1U4AA 4OVUA 4RM8A 4ALPA 3KLSA 4PV1C 1F9RA 2BVCA 5CHVC 2EY1A 2D9UA 1QG7A 5CR3A 2PMZB 4JI6L 1ZKHA 4N8X1 1T0YA 3VXWA 1V49A 2BGFA 2JU6X 4HEDA 2KDMA 4HR7B 3SHQA 3MWYW 1CZGA 2OF1A 3TSSA 2F0MA 2NVQH 1L5PA 1XJVA 2Z59B 2J0JA 3ABVB 1MD2D 1K8MA 5C44B 4QAYA 4K2KA 4HEA1 3DMUA 4DR4Q 1RCVD 3ONSA 3GTKB 4KKUA 4OEMB 3SVMA 2LD9A 2KMMA 1OEYJ 3QHTA 3ZIMA 3LYYA 1DM0B 2CWPA 4JCVE 2MA9B 4PYUA 4ULLA 5IYBH 2JZ3B 4HPPA 5G3LD 2NMQA 1SNCA 4DA2A 1JALA 3A7AB 2CH4W 1SMXA 4DDID 4K6DA 4XXEA 3E56A 1PYBA 4YHHL 2JA5G 3V6EB 1ILQA 4KV2A 2VQEL 2F0GA 3PGEA 1YQ4B 3B6YA 4R4QA 1G6PA 1STYA 2B2UA 3I7FA 4P72A 2KJ6A 2Z0EB 3KBXA 2B2TC 3A5ZB 2GN5A 3OIPA 3E0EA 3MFGA 4DR1L 2L55A 2KVZA 4KZ0A 4EQ5A 4RF1A 2Y0SG 3PTFC 1YD8U 4MM3A 2EELA 2WAQE 2F3WA 4HJ8A 5DM73 1ZP0B 2N9PC 2D5DA 2L15A 3BY4B 3C3LA 2EYFA 3VR3A 1C9OA 4EZKA 5DPSA 1IL2A 3S17H 3S2DB 3ZRCA 5AEKB 2N9EB 2K5DA 4EQPA 5M3FG 4TSSA 3DHIC 3PZ7A 1L1OC 3FHWA 5M5YH 3T13A 2EYMA 1Y8RC 3QX1A 3K0XA 2KFKB 3HOVG 1TKEA 2UUAQ 3HOYH 1KM7A 2BS2B 4P73A 2MRPA 2X6GA 3RNCC 1I94L 4ZUJA 1MHHE 4DK6C 5IP4D 3T51B 2R93B 2VXWA 2MBOA 4A3IG 4KD3A 3WOFA 2IY5B 4JI8L 1WOCA 5C5MA 1N63A 2GBRA 2CS4A 4YCWA 2YU9H 4JK1C 2KCCA 1STBA 2JYOA 3GTPB 2LJ5A 2DY8A 3VR2A 4DK3C 3BVZA 2ACZB 2BOSA 2MQHA 3B9JA 3NTHA 1OXSC 2EY6A 3KFUA 1STNA 1SDFA 4X3KA 3SK4A 4DV2Q 1OXTA 2F4VL 3PF4A 3BK1A 4KHZA 4P16A 2EYLA 1XYIA 3K9OB 1G2TA 3SDZA 3ZJUA 4E6IA 5C4JB 2L0CA 1G51A 3RUZA 1RFAA 5AJ3Q 2IBIB 4J6IA 3RZFA 3VFKA 3DWMA 1C77A 2W55A 3TCAA 1STEA 4AYBE 5IP9H 2KWVB 1TVXA 4H44C 4B3MQ 1PQSA 3HOZG 1GG3A 1WGYA 4CGYB 2MJ3A 3WWVA 4WJPA 2NYZD 3H91A 1E5WA 3GTGB 5LMNL 4ANVA 2OCEA 2PE6B 3K7UC 2Z0SA 4MT5A 2JA6G 2MBBB 2C5LC 2RPQA 1ZPSA 3ZUNA 3RMKC 5DPWA 4LUVA 2HDLA 3H09A 3MHZA 1U4RA 4HPLB 4NAMA 4OVVA 3HKZE 3NQTA 5I9OA 5JEAH 1V97A 2YVCA 4MJSA 4N59A 3B1LX 1V80A 3MXUA 5KYLA 2QDBA 4DR4L 4PNYA 2WU2B 4DK0A 1VQ5A 2MX2A 4JC0A 3PIPA 4EE2A 1B9RA 4P2CB 3F2CA 2KDBA 2LSSA 1K0SA 3DHQA 2KQSA 4WAAA 1PLFA 4L5SA 2R3ZA 2LXKA 1E8XA 3LDZE 4X57B 2JX5A 2M9VA 4FYDA 1PH5A 3CHBD 2INCC 4IUNA 1X56A 2KKCA 1LM0A 2WP9B 4FF2A 3APFA 3NVVA 3H94A 2GLSA 2I0QA 2AEHA 3O65B 3DWPA 2GI9A 4ARIA 1C9FA 1WCMG 2BQQA 4DF7A 4CJ0B 5L37A 4XGAB 1T0QC 1CQFA 3CF5A 5EE9A 4A3PA 5M5WH 3PCOB 3TEZA 1X3QA 1YOVB 1D1KA 1DYQA 3IL8A 4OWXB 5CV6A 4MH0E 2MP1A 1MIUA 1LXDA 5HFYA 2VH1A 4G7ZC 4WQMA 4NPNA 2O5IC 5BYQA 4KKJA 4I6LB 5FLXL 1RYJA 3OAWA 2UXCL 2LY7A 2AHOB 3STBD 3OMCA 3Q22A 3I3CA 1ASZA 4JX1C 4E3CA 3AE1B 1FL0A 4RAUC 2UUAL 4NW2A 3DWGC 4USAA 3VUXA 5EKIA 4YSXB 2UXBQ 3ZYYX 1KHIA 4BBRH 5IYCG 3WCQA 3Q69A 3SR6A 2A6EC 1UBIA 4LW1A 2R92H 3CCSA 3ND9A 4CDCC 4H0LC 3TDQA 1N8RC 5CMDA 4G50A 1SLJA 1IGDA 4MGZE 4ANWA 2NCNA 4AOFA 2W3SA 4QMGA 3Q0AA 4A3JG 1H9MA 1EY4A 1AFPA 1BBXC 4A20A 3R7RA 4HDOA 1LTTD 2WAQG 1AE3A 1I4XA 3Q24A 4JI4Q 3NP8A 2MWSB 3MP9A 2QJLA 3KH0A 3B2GA 4NQKE 3UQAA 2ZM6Q 3DCGA 4KZCA 3J80c 5AJ3L 4N6EB 5KNCA 3TBLD 1PH9A 1NCVA 1ZXTA 1Q46A 4HTHA 1H9SB 1X3EA 3LJ3A 1GAQB 3KVFB 3PIOA 1ONLA 4KKSA 1PTOD 4NP5A 1FRRA 3DPDA 2Z1CA 3BVMA 1QVCA 1WZ3A 2WXKA 3QCAA 1UEBA 3T9LA 1FGBD 2C5CA 1GUOA 3BU2A 1KQSA 2KANA 3M63B 3TMPB 3FPUB 3ND8A 4IURA 5C0XG 3WA0A 4P74A 3WOEA 5D14A 5KEEA 3BZDB 2AUJD 3OW7A 2CJNA 3TEHB 4Q2JA 3KF6B 2JA5B 2L52A 3UDFA 2MHVA 1K3BC 5G2NA 2C7NB 1GB4A 3PGZA 1O7IA 4A3OA 3UINB 3TP5A 2DENB 4KSLC 1SYFA 1WTQA 4LNFA 3PO0A 3PMFA 1E2WA 1XLNA 3DDCB 4FXGC 4OVZA 3M3JA 4O1NA 1TS5A 1I4QA 3ZDTA 4AYBG 1FYCA 1YBYA 2G9DA 1HA5A 2LJIA 2IO0B 1EFID 3GZNI 1EY0A 2DNFA 5M3FB 2L8JA 4DN4M 4W9DA 3HOUG 2LS01 5EGTA 1VF7A 1PH3A 1LM8B 2K5NA 3VYTA 1WSPA 1WR6E 3QWZB 2EMTA 3DEOA 3HOVB 4S17A 1BR9A 2KWDA 3S1NB 4DV6Q 3TJPA 4DHJB 3AU4A 1E90A 3JSVB 3HKZG 1Q1OA 4RHSA 1AZQA 1QOAA 4UDUC 2N9LA 4A3IB 2DNEA 1SNDA 1P98A 5IGFA 2ASQA 2N7DA 4W9LA 1Y8PB 3NXWA 1WXAA 1QVGA 2IWHA 3ENEA 4G4KA 4C4VB 3QC8B 3RFZB 1DGJA 2DZJA 1J0GA 3AE4B 5M5XH 4JI2Q 1LTSD 4GMVA 2YTVA 3NHEB 1CSQA 4CJ2C 1IYUA 3E9HA 1C4PA 2AKWB 3MXNB 2J42A 1V1OA 4JOIC 5LL6X 2O2LD 4RCNA 1BNZA 2K5PA 2WDRB 3A1QB 1E6EB 2UXBL 3IG3A 2CVRA 5AUKA 5D65A 3VTVA 1RF2D 3HS0C 5IY0A 2KOLA 2V1CC 1D5ZC 4GNXC 4HVBA 4XDCA 4DKAC 3HOZB 2QDLA 4CDEC 4TQUS 3GDEA 4A3MH 2E2JB 5KNBA 4DAVA 1ZKOA 1JB7A 2IJ0A 4RM9A 2JA6B 2ZJRA 1V81A 4KN7C 3CC7A 1SR3A 1NI3A 3LGJA 4JG2A 1TT2A 4BKTA 4LF6Q 4JI4L 5T1GA 1I3QH 5IODA 3UDXA 2XIWA 4RHRA 1WTPA 2GRIA 2ZM6L 1PMRA 3P4SB 2DYMA 3J80L 3OYYA 2SNSA 3I9V1 4B0MA 2K28A 2OWOA 3AFPA 2WDQB 3IAM1 2MGSA 2X6LA 1OFFA 4X62Q 5LHY1 4DAYB 4PYZA 4IFDJ 4YIJA 1UE7A 4ZOHC 4WJ4A 2L83A 1VCBA 1J7AA 5C0XI 1FEHA 1N5WA 4HIDA 3V2TA 3ZXRA 3PV0A 1ENFA 1ICWA 1SXTA 1X32A 2NVXH 4BY7G 1YNTE 4PZ8A 1YNJD 2Q2IA 3VRBB 4M8AA 3G48A 4YWLA 2JWUA 4GXBA 1E10A 4A3EH 2L11A 3I72A 2VZKB 1SE2A 1NUCA 3W9CB 5I2XA 4JPBW 2BS3B 2IPKD 4GDLA 3HM3A 2A5UA 4D2KA 4C1NK 3OW2A 2GMIC 3VHTC 3VR5A 3KWLA 2K52A 4IUVA 3RR5A 3W1BA 2F0WA 3MJWA 2PQAA 2WX1A 1WCMB 4JBWA 5IWAL 3GZNB 1O78A 4ZLTF 3CU7A 4MGIE 2EVBA 2RHSB 3KLRA 1RIPA 1EL0A 2B2WC 1JR0D 5J3BA 2HJ1A 2QKIC 2JRIB 1D8LA 2OXPA 4YCUA 1XPUA 4FJVB 3T53B 2KCMA 4HLEA 4C3IH 2JA7B 3UE1A 3PS6A 1G291 1GKHA 2KJXA 3KUDB 3GD7A 5M9OA 2ZW1A 1BCPB 1T5XD 1G2SA 2A6HD 2QILA 4CBVA 4DNTB 1VMCA 1KDBA 5D3DA 4GZYC 1XCQL 2GBMA 5JHAA 3NSWA 2L5TA 1B50A 2EJGC 3A54A 2SNMA 4A93H 1EY8A 1S3OA 1JC7A 1TBEA 5TR5A 5HKHA 3V62A 4US8A 4J6HA 2V1YA 5EE1A 4Q5VA 1SFOH 2INPE 2CHZA 3RNAC 1RFKA 3LX0A 5HGQA 1K8OA 1GJZA 2NBFA 1YJJA 1WTRA 5HHDG 1T5EA 1J6QA 4A3JB 1I6VC 4JI2L 1QNUA 3AV8A 1E8ZA 3L13A 3ML8A 5G55A 2MH7A 1EF5A 4GB9A 2XNAC 3D8GA 2E76C 2BE5D 5IIFA 5M3MG 2WAQB 1R9TB 1HTOA 2ZTEA 2J0TD 3VR9B 1MI0A 4A9AA 4L5QA 2ZW0A 1JICA 4C80A 2F0NA 4DV4L 5IT9L 2Y5BB 2IT1A 2Z8LA 5EKKA 2DAFA 1VR9A 2NTSA 3RPFC 2EKIA 4FDBA 2BTEA 2KO3A 3K58A 1CHQD 1VMPA 4GS3A 2FE8A 4DQOC 1Y1VB 2PPBC 4HMIA 1GNUA 1VDVA 3GTMH 3NVZA 1HTQA 3CPFA 4MN3A 1BOSA 3QG1A 4LUOA 2RMMA 2BKRB 2HCCA 2G4SA 2R2QA 1MSGA 3V3XA 1B2TA 1SSOA 4HCEA 2E2IH 2H5XA 1TR5A 4OGQC 4HIKA 5CORA 3AMUA 4EKUA 2BF8B 1SYEA 2BWES 3S1RB 4DV5Q 4CHKA 4F88A 5JJLA 4PZ6A 1IYVA 2PO4A 4XT1B 5GXGB 1FNWA 4FP5D 1AEXA 4AS1A 3R8BA 4X62L 3OTOQ 3PZ8A 1IP9A 2AWOA 2YYZA 1W2BA 2YV5A 3DQVA 1FCLA 1IBMQ 3NUCA 2B3GA 2JEBI 2DZMA 3T1HL 1C0AA 3W1SC 3J81c 4YSYB 3RNGC 4FADA 3EFCA 1WY8A 1HQRD 4O2DA 5C4HA 3J7A5 2X8XX 1MJCA 3FEWX 2BS4B 4EUTA 1Q1BA 1Z6HA 4A8XC 3GV6A 1F2YA 1IYFA 3ZDMC 2KJHB 3GTLH 2SDFA 1P0RA 4DU9A 2NTTA 1PRTD 3HOUB 5IP7H 4GLSC 1A2TA 1CM9A 2A69C 2L1BA 2LRWA 5K36H
chains in the Genus database with same CATH topology
3E5SA 3AEAB 1VZ6A 2CW0C 3C2PA 3MZ5A 3HKZB 4A6QA 5FO8B 5J1ZA 4FXKC 2L4NA 1CI3M 1PGAA 3P1HA 2NVYB 5HG2A 3IAS1 4KKTA 4FNFA 1CQVA 1IUEA 1XWEA 3AEDB 3EA6A 4WFN3 1HTLD 2KA7A 5AFWA 1IL8A 4JWUC 5EPJA 3GS2A 3W3AA 2PZUA 4B9WA 4MM3B 3L7ZC 4PMBA 4Q0FA 4A90A 2RBMA 3D6WA 3K57A 2RSOA 4OO1G 2X38A 5F2DA 4IUPA 3MFYA 3AN1A 4CKBA 1EY7A 2PKOA 3R93A 1ZXIA 2MEKA 4TQ1A 3AEEB 1QWYA 1P7EA 1IGCA 4K5VA 2LFNA 1D2BA 3I4LA 3N52A 3N6RA 2D62A 3A8IE 3MEHA 3QB3A 1BXTA 4BY7B 4QCLA 1J8IA 1RTNA 3K5NA 1C78A 1JWUD 5EBCA 3H8HA 2NN6H 2BDOA 1D1IA 4YSZB 3J81L 3CQZB 1HXYD 5KNDA 4KX6B 4C56C 3ZJTA 1K50A 3I90A 2LEKA 2IL8A 1E7PB 4YXDB 2FUG1 3M85A 2F0IA 1B4OA 3PIP3 1F2LA 1B9NA 5I6YA 4J3OD 1TWGB 5FLXE 4WORA 3QO2A 3QJYA 1WRIA 4RGNA 5KRUA 3UI2A 1S5CD 3DWQA 2IX1A 4EGVA 2WIIB 1D5MC 5EKLA 5CGKA 4A55A 3VA7A 5M3MB 1E9MA 2KEEA 2QCPX 2ON8A 3AE9B 4YWGG 1EEID 5DEHA 4B9XA 3I70A 1SMYC 5EE0A 4OO1I 1BF4A 2H88B 3KBGA 2F0JA 4ZKBB 1K83B 1PXUA 3MAQA 1EYCA 3AE6B 3NS1A 2JZPA 1FR3A 1F0ZA 2XWJB 4FO2A 2EE1A 1LTBD 4ZUIA 3BG3A 1PUTA 1QOFA 2WQYB 4NDXA 1PDXA 1F2MA 2JYTA 2HCIA 5CV7A 4RWSC 1EU4A 3K5LA 1LT5D 1D4BA 2IX0A 2PIAA 2B2TA 1DCZA 3NZ3A 1HPCA 1TS4A 5IGBA 3U9SA 2K05A 1JROA 3T4AC 2ENBA 4KGSA 1IBXB 3PIO3 1PZID 1YNNC 5C4ZA 1QJOA 2F0UA 2GA4B 2A68C 1EY9A 4CKEA 2J53A 2DY7A 4QUFA 5A2QL 3J7AV 2L32A 2F0HA 2BDNA 3HEJA 1U4LA 2WXMA 1RODA 4ZHOA 4FXDA 1ZDVA 1BDOA 2BW2A 2F0FA 3V05A 4IZ8A 1BCPC 5CYUA 4G7OC 3AECB 3TEWA 3KQ4A 3S1MB 1HFGA 5E4XA 1EU3A 3GV3A 1S5ED 4M0WA 2F0DA 4K6LA 3HRZC 1LTID 1V43A 3EQLC 5JPMC 1LV9A 1F2RI 4R9WA 3P4PB 3SK8A 2H1EA 2RSNA 1B1ZA 1FIQA 1EZ6A 4XQJA 1HZ5A 1SYDA 2K01A 1A15A 2WXFA 2ZT9C 1G8ZD 1N61A 3J80E 3VQIA 5CV8A 1KF6B 5IOCA 1NR4A 1MSHA 2QMTA 3D3RA 1RD9D 1HHVA 3S14B 3S9WA 1L4ZB 5C4XB 4KHVA 2FFKB 4EQOA 2MJDA 5NUCA 3TMEA 1HEZE 4ARCA 5H92C 1P7FA 1E0BA 1HUNA 3RMHA 3HRDD 2RQXA 3LXFA 5C3EB 1QLBB 3TZDA 1SSNA 1S5DD 4CKCA 2K04A 2BB5A 1FM0D 3I8ZA 1U4MA 1A70A 2F0OA 4RCOA 2BA1A 2JSVX 3JAML 2Z4HA 4UAIA 4GDLB 3PUWA 1WWTA 4YTPB 1GB1A 4JE3B 4ZKCB 1GHKA 1HFNA 1O7ZA 4K5XA 1L6VA 3P63A 4OZBA 2F0KA 2INNE 5ELCA 4OHJA 5DM63 2V3NA 1DOXA 3BS1A 2B2UC 3VR6A 3L3OC 1AWDA 3NPPA 3A56A 1N60A 3J9CA 5FO9B 1TS2A 1X3PA 3FILB 3AU7A 2JXMB 5IT9E 2H4OA 2OEOA 3NVYA 2PCFB 2G9HD 1A2UA 3TZUA 1SNPA 1EQVA 5FO7B 2XRSD 1EWHA 2KN4A 2IGHA 1IKMA 3AE3B 4A3BB 3MVVA 4QIWB 3BDCA 4KJNA 4ABNA 5I4DA 3BDOA 3O13A 4XE0A 4R3DA 1EQTA 1ML0D 2WXPA 1GUWA 1AYFA 3VR8B 2F0TA 2N9KA 5E4WC 1C4CA 2WKCA 1GUSA 1PYWD 4JPSA 1RWSA 1HA6A 1GJXA 2K5QA 3NE5B 1S4ZA 4L6TB 3GTJB 4OW0A 4XWWA 3M7NA 4L23A 1FFUA 1ZYRD 2EY2A 3EROA 2MJEA 2KECA 3IAYA 2YEPB 1XEEA 4RGTA 2EYHA 2F0PA 3P75A 1SJHD 3MXPA 1JOQA 1QOGA 4C3JG 4ZRPA 2FMCA 3BYYB 3OWEB 2M00A 3T3NA 4BY1B 4LJZC 3U7ZA 3AE2B 2IGDA 3A8JE 3HG9A 4ZRZA 4REZA 2M2LA 1B9MA 1HZ6A 1KDAA 3QWNA 4KGTA 4HAEA 1N5XA 1YN3A 4WWMA 1KLUD 1M8AA 2Y0SB 4ZK9B 4WIPA 1NEKB 5JJZA 1H9JA 1NYQA 3W5UB 1DD2A 3VYRA 4RKBA 3DXJC 2BB6A 2ZXOA 3K59A 1Q8IA 4NZLB 2M19A 2Q8TA 3D4DA 1TY0A 3QOJA 1U4PA 3AEGB 1JOKA 5C2TB 1R7SA 3GTOB 1DOMA 2EYJA 4FF3A 1YMHE 1SNOA 5C0XH 1PRTB 1QB5D 3ERQA 1XTCD 1GUTA 2KCNA 4HKQA 4LLGM 1TYGB 3OMGA 1BCPF 3J7AF 3CRLC 3NWSA 3J81E 1S5BD 1SNMA 1CHPD 3CRKC 2RKSA 1WD0A 1V8QA 4HN7A 2WXLA 4YTMB 4Y7NB 3Q23A 3P7JA 1VZ7A 1PZKD 2KEDA 3VRAB 4IUQA 1D6EC 2JEAI 1PZJD 3ITPA 4QB4A 2RPVA 4B0EA 1TQOA 2KAJA 2B2VC 2AWNA 3RZDB 1Q90A 1QQRA 3KF8A 2NZ1D 1NAPA 5TSSA 3Q8BA 2JE6I 1JWSD 2F1MA 3KLSX 3AM9A 5JOBA 4ZQ3A 2PW5A 3M4OB 5ELEA 3S15B 3NRZA 1O7YA 3X3NA 2A69D 3NWTA 2WXIA 2DWQA 4US9A 1W6JA 2IDYA 2SEBD 2AQ3B 1QT9A 5BMHA 1B44D 3NHHA 1J9OA 2RA4A 4FVMA 1F2ZA 1WTOA 4ZHPA 4HSPA 4R8IA 2WXGA 4H2AA 1KABA 4C3HG 2I2YA 2XRQD 1JWAD 2VB2X 4TQ0A 1VJKA 4A3KB 2Y5CA 2O5JC 1I6HB 2K9XA 1D5XC 4G7HC 3HVDA 4C2MB 4F8MA 4C7ZA 2EJMA 2K33A 1UGJA 3LWUA 1H9RA 2CHBD 2IX3A 2W82A 2B2YC 1TKWB 1C76A 1FXAA 3K7AB 2KHSA 1GUGA 5A2QE 1R4QB 3G7LA 2HDMA 3AB5A 3VYUA 2VUMB 3D4WA 3DUZA 2F3VA 1SB3C 4C3JB 4EVOA 2EZVA 2CQAA 4PQXA 1BMLC 2WU5B 2WP8J 3C46A 1TU2B 1PFNA 4IFDG 1JMLA 1V8CA 2F0VA 1H9KA 2D5GA 1RM6C 3T3OA 3N9YC 5G3LF 1TWAB 3M3YB 3U9OA 3OPOA 1I50B 4KTAA 3Q8EA 2EY5A 4XYQA 4J8QA 4AYBB 3RZOB 1DOIA 1F2RC 5C3JB 1OXXK 2FINB 5M5XB 3S2HB 3FC4A 1Q3LA 3ONAB 1PDQA 5I2YA 4V0BA 4BA2I 4HKZE 4WAFA 1E2ZA 1H9SA 3CKIB 2K3UA 1OQQA 2L9HA 2MJ8A 5BMIA 2B8GA 1NYRA 1IW7C 2K7VA 3I4MB 3C1FA 2PW7A 1SNQA 1YNJC 4DFAA 5FKAC 1ESFA 3EFXD 3OHXC 3TEYA 3TP6A 2JA8B 1SMYD 4RKLA 1CTMA 2F0EA 4NJCA 1KLGD 5KYIA 1PFDA 2BT6A 1XCTL 3OSOA 2KUMA 1FNUA 1ENCA 4TMAB 3UI3A 4A3EB 2BBCA 2E2DC 3H0GB 2WS3B 4OL7A 2A6HC 1JQYD 4N9PA 4ITKA 1Y56A 3SEBA 5A35A 4HROA 3EJIA 1PFMA 2ZXPA 1TZOA 3FKIB 3TUOA 3AE7B 2O4XA 1RJTA 3JAME 3URYA 2ID0A 4IFDI 1Y69U 1DZ1A 3NQIA 2J52A 1AZPA 4A3GB 2WV6D 3LWEA 3NVWA 4G57A 2R6GA 3PUXA 1JORA 1OO9B 2WACA 2RDGA 3KWVA 3D31A 1SJED 2QF7A 3I4NB 4OO1H 4K2LA 2NWGA 1GPXA 4RFBA 4ILWA 2DN8A 5ELDA 4C3HB 3NUHB 1JOOA 2TMPA 4L1BA 2XN9C 5DAUA 1T3QA 2R61A 3QIAA 1A3TA 1FCCC 2WINB 3TP8A 3NBHA 3TP7A 1V1PA 2WLBA 1XLQA 2PYKA 5D3IB 3AE8B 3IFDA 3IT4B 2BCOA 4XQQA 4NMZA 2DLBA 4U673 3HOXB 1AN8A 1ACCA 3GO5A 4FF4A 5HI1A 1SAPA 2JP1A 4BA1I 1PRTC 1VDZA 1FXIA 5JVH3 4I65A 4XT3B 3PO2B 2FJ2A 3IKJA 1L0XB 1J7CA 4L2YA 4ZRQA 2WB1B 3L9AX 3ZGZA 1BUVT 5EPLA 2B63B 1PGXA 1K51A 4EQNA 2NN6I 1BO0A 1I4RA 3M7GA 2NUCA 1RHPA 1ZOYB 4TRDA 3PO3B 1ESRA 2Z4IA 4OZAA 1Q10A 3U4EG 4O42A 5LL6S 2M56B 3C1EA 3I73A 3K6OA 5G5GA 1FFVA 1ZE3D 1SE4A 4KJOA 4HSVA 3R2IA 3ETRA 3FMCA 3MXGA 3S16B 2SOBA 2KQ4X 3AH7A 1I4HA 5BYRA 5EJWA 2J4XA 2LHEA 4LK0M 4XWTA 3Q6SA 1C4AA 2E2HB 2QEJC 2JQRB 1B53A 4IDIA 3SE0A 3BK2A 5I9PA 1OXVA 2E75C 5C5LA 1BUIC 3KK7A 3AB9A 5JVG3 1WD1A 2ICEC 5JAVA 1WYGA 2N88A 2PNRC 5C6AA 4OIKA 4IOIE 5J22A 5ISRA 4A3DB 2AX5A 1LABA 2Y5PA 4X3SA 1M4VA 1CJEA 3SK6A 4FXCA 1STHA 2LMCA 1KNAA 4PMWA 2F0SA 3BVGA 4H13C 2N55A 1SYGA 3BDLA 1UWMA 1QNKA 3R3OA 1PTOB 4OIJA 2IW3A 5FOBB 4YTNB 2E3TA 3PUYA 1STAA 2RVLA 3FRPB 4BBSB 4S3SA 1SIJA 4IN3A 4U68A 1ENAA 1WGKA 3MJ5A 3W5VB 3FAHA 3CIRB 1CA6A 4KGRA 2A6ED 2AUKA 2C9OA 4XTCS 1VF5C 4XIGS 5EPKA 1F9QA 5C3WA 3GTQB 4RGOS 3WDNA 1TKGA 3HZXA 1EYDA 2L12A 1G91A 1F77A 1K53A 4LTUA 2N7JA 5JEAG 1LACA 1GXDC 3I57A 5BN5A 5JXVA 2W54A 2L1AA 1KAAA 1GHJA 4KV6A 1I4PA 3EVQA 1Y1WB 4B08A 1JB3A 3EGRA 2ICIA 1MVKA 2EJFC 5KGUA 1EIHA 1E2VA 3EUB2 2LHDA 2LGIA 2WXNA 2F0QA 4J1MA 4AQ7A 3VA5A 1JW9D 1VCIA 5K5PA 4C1NI 3MA2B 2NVTB 1OQRA 1A3VA 5T1IA 3OIQA 1FD7D 2YEPF 4HCSA 5IGCA 3A55A 3QOLA 3H3VC 1KDCA 1FD6A 3LNNA 3P42A 1VRAB 4KD4A 5C0XJ 1E0ZA 1XX8A 3HOWB 4ME5A 2K32A 2GB1A 4RA8A 4FF1A 1LTRD 3NTIA 2Q5WD 4XDXA 3DEPA 3C8YA 1HUMA 3Q8AA 2CU3A 2FMMA 4LK1C 1EY5A 2NVQB 4JWSC 4V190 2RDFA 1ROEA 2PLPA 5MPOA 4NAWB 3IFTA 3MC0B 1C8CA 3ZJVA 1QKZA 5EE3A 2N0SB 2ZXRA 1CZPA 5BYSA 4OZCA 1EM7A 1FRDA 3ZQ4A 1PRTF 2E74C 1JWMD 2OHFA 4ID6A 4KK7A 1NENB 3U2SC 1ZUD2 1K52A 4F87A 2XWBB 2QSDA 1UNSA 2B39A 3F2UA 3BIID 5IGEA 1YJIA 1WVLA 4P6VF 1WTVA 2IGGA 4MACA 3HP3A 3LB8C 2WXJA 4KY6A 1HRJA 1RDPD 3S17B 1SF0A 3GQBA 1MBYA 1MI2A 5M5YB 1EWCA 1CZWA 2OEDA 2F4IA 1IBXA 3HOYB 1EOTA 3BYTB 4BS9A 1XXGA 1JQ4A 1Q12A 3KUPA 5JPNC 2YU9B 1FO4A 1OXUA 1BQQT 1HTPA 2EXZA 4X3UA 3R2TA 2B2VA 4ODGA 5CC4A 1UAPA 2AQ1B 3SK5A 2QIEB 4N58A 3K5OA 2EOTA 5LNK1 2HUGA 4RNAA 3OWFA 1QCBD 1XLOA 4IKGA 1UUPA 4TKOB 1II3A 3M4YA 2OT2A 3NK9A 1XO3A 4KY5A 1S5FD 3H6MA 2B2WA 2TSSA 3CWIA 1JE4A 3IXSA 2B8FA 4MIUA 2HTME 3W2DA 4K5WA 4H7BA 4Z9CB 4DGZA 3RLFA 3AEFB 1LTAD 4K14A 1SYCA 3NTKA 5BMGA 5BN4A 5E1FA 2WXOA 1Q1EA 1IHZA 2JXTA 3K5MA 2HDEA 5EBDA 1EYAA 5FK9C 2A74C 3SFEB 5M5WB 1CFMA 2K6AA 2PQEA 2B2YA 2F0LA 2EPBA 4RGMA 4C3IG 2KACA 1O80A 1MGSA 1EIGA 4DXGA 1AW7A 1L0VB 4DAPA 1ZYRC 4PT5A 4L63B 1FMAD 2PTLA 1SBBB 1NVID 2XVSA 2CW0D 5IGGA 4BBRB 1IW7D 3FPPA 3G6JB 2R92B 1GOZA 3DM1A 1SYBA 1PTOC 1V1PB 2PW9A 2BA0A 1UEAB 1L0YB 4L8JA 2H89B 4HRSA 3AMZA 1G6ZA 1IKLA 3W1SA 2K0PA 3P4RB 1SE3A 2MUYA 1WTXA 1C48A 2XSCA 1YQ3B 2K5WA 1Z47A 3VR4A 2A5HA 1RKNA 4IUUA 3VYSA 3GB1A 1DOYA 3FILA 1W6KA 2E6XA 1QILA 2F03A 1I4GA 3E0JA 2EDGA 5E6JA 3IT6B 1Y8NB 2D2CC 4K8JA 5EQ0A 1ET9A 4LMQD 5AUIA 3AEBB 4IQZA 4K8IA 1GUNA 1T6BX 1VLBA 4ZYSA 1LT3D 1TY2A 5ELFA 2NB0A 2Q8IB 3Q8FA 2EYOA 4ZAIA 3P20A 2WXRA 5BN3A 2V3PA 1VZ8A 5K36G 2I38A 2K03A 3AE5B 4BWGB 1EWYC 1PGBA 1AP0A 1XLPA 5CV9A 1F9SA 1N62A 5KIXA 1ET6A 3T56B 4M1UB 1DOKA 2G1EA 1NSNS 1R4PB 1F9PA 5HGTA 5HURA 2EYPA 1KRHA 1I7HA 1KH0A 1ZEQX 3SXHA 2LUMA 1TKYA 2LKVA 4NKLA 1J7BA 1L6UA 4DNRB 3HGBA 4XQNA 3BWUD 1ILPA 1QF6A 1QE6A 4KMUC 4A3MB 2LMCB 1STGA 5FR3A 4IFDH 3T16A 1I3QB 4HJGE 1SEBD 3MTSA 2ONQA 3U52E 3D6CA 4WJWA 5CV5A 4DK1A 4WURA 4F7XA 2WXHA 2WNMA 2NVXB 5DNFA 4DXFA 1MHXA 1TWHB 2KQ3A 4CQNA 4MH8A 5CV4A 2WDVB 1EY6A 2NN6G 4IALA 1YN5A 1XF5L 5CBAE 4I7ZC 2RDHA 4C7YA 3A7LA 3TBIB 1JRPA 1B3AA 1RTOA 2V0GA 2PZWA 4KY7A 5CBEE 3Q8CA 4C3IB 1HCZA 3MXNA 1NR2A 1LT6D 1PFBA 2BE5C 3SHLA 2VZKD 3P1MA 5J39A 3HUIA 1YNND 1DONA 3P4QB 4CHTB 2W3RA 2A68D 1DOLA 1ZXHA 4A93B 4PMCA 1FNVA 2MPMA 4GDKB 1WTWA 2I46A 4YT0B 4XDDA 4QF4A 1SFOB 1KFYB 4KN4C 5E3FA 3NBIA 1QOHA 5G5HA 3FDTA 2FBWB 2PVOD 4IUTA 1PTOH 4R8NA 2I07B 1WXQA 1LO5D 1BCPD 3J7YW 4DAYA 1A3UA 1CT1D 4RF0A 3A8KE 2B76B 3OOCA 3GP7A 2K22A 2JSOA 3GTMB 3PUZA 1TS3A 2A73B 4QUCA 3X3MA 2HQEA 1C79A 4KI0A 4RH6A 2R7ZB 2E2IB 3SR1A 1DXMA 1YN4A 4XYOA 1Y8OB 2BYTA 1Z7TA 2DNCA 2Y3AA 3I91A 1DJRD 1L4DB 1MPEA 3K0YA 4LAAA 1C4QA 3TN2A 1KTKA 1HQMC 2DYOA 4WRDA 4CJ1B 1O7LA 1CK1A 3GTLB 3E9SA 1LLRD 5ELBA 3E6ZX 3RD4A 5D7GA 2X69A 1CA5A 1LT4D 1LTGD 1PTOF 2FHTA 1TWCB 2J7ZA 3FVQA 3TEXA 4MHEA 2AQ2B 4X3TA 1TIID 1QOBA 5IGDA 5T8IA 3B2FA 5I6WA 2M0AA 1UWXA 3L4PA 4WH4A 2V4IB 2DBYA 3MHBA 2Q8RE 4N9TA 2WXQA 2V4DA 1A6XA 1ZDXA 2KVMA 3V96A 3D4RA 1EZ8A 3S1QB 2LFIA 3PUVA 2PVGC 1KNEA 1JWBD 4KKIA 3DWAA 2PZTA 1TWFB 4A3FB 1EEFD 2VNUD 1U9RA 3HVZA 2WKDA 5H8YE 5COYA 5JEAJ 1JCKB 1TJEA 2VB3X 2PMVA 2K1BA 2CJOA 2SAKA 4HMJA 5C3XA 3KLSA 4PV1C 1F9RA 2EY1A 2D9UA 1QG7A 5CR3A 2PMZB 2JU6X 4HEDA 2KDMA 4HR7B 3MWYW 1CZGA 2OF1A 3TSSA 2F0MA 3ABVB 1L5PA 1MD2D 1K8MA 5C44B 4K2KA 4HEA1 3DMUA 1RCVD 3GTKB 4KKUA 3SVMA 2KMMA 3LYYA 1DM0B 4ULLA 5G3LD 2NMQA 1SNCA 4DA2A 1JALA 3A7AB 4K6DA 4XXEA 3E56A 1ILQA 2F0GA 1YQ4B 1STYA 2B2UA 3KBXA 2B2TC 3OIPA 3MFGA 2L55A 4RF1A 2EELA 2F3WA 5DM73 1ZP0B 2D5DA 3C3LA 2EYFA 3VR3A 3S2DB 2K5DA 4EQPA 4TSSA 3PZ7A 3T13A 2EYMA 1TKEA 2BS2B 2X6GA 4ZUJA 1MHHE 3T51B 2R93B 2VXWA 4KD3A 3WOFA 5C5MA 1N63A 4JK1C 2KCCA 1STBA 2JYOA 3GTPB 2DY8A 3VR2A 3BVZA 2ACZB 2BOSA 3B9JA 3NTHA 1OXSC 2EY6A 1STNA 1SDFA 4X3KA 3SK4A 3BK1A 1OXTA 4KHZA 4P16A 2EYLA 1XYIA 1G2TA 3SDZA 3ZJUA 4E6IA 5C4JB 2L0CA 3RUZA 3DWMA 1C77A 2W55A 1STEA 1TVXA 4H44C 4CGYB 2MJ3A 2NYZD 3H91A 3GTGB 4MT5A 1ZPSA 2HDLA 3H09A 3MHZA 1U4RA 4NAMA 1V97A 3NQTA 5I9OA 5JEAH 4N59A 3MXUA 5KYLA 2QDBA 4PNYA 2WU2B 4DK0A 4EE2A 1B9RA 4P2CB 3DHQA 1PLFA 2R3ZA 2JX5A 2M9VA 4FYDA 3CHBD 4IUNA 2WP9B 4FF2A 3NVVA 3H94A 3DWPA 2GI9A 4ARIA 1C9FA 4DF7A 4CJ0B 1CQFA 5EE9A 3TEZA 1X3QA 1D1KA 1DYQA 3IL8A 5CV6A 2MP1A 5HFYA 4G7ZC 4WQMA 2O5IC 5BYQA 4KKJA 5FLXL 1RYJA 2LY7A 3OMCA 3Q22A 3I3CA 4JX1C 3AE1B 4RAUC 4NW2A 3DWGC 4USAA 4YSXB 5EKIA 3ZYYX 3WCQA 3Q69A 3SR6A 2A6EC 3ND9A 4H0LC 3TDQA 5CMDA 1IGDA 2W3SA 4QMGA 3Q0AA 1H9MA 1EY4A 1AFPA 1BBXC 1LTTD 1I4XA 3Q24A 3MP9A 3SFDB 3NP8A 2QJLA 3B2GA 4N6EB 5KNCA 1NCVA 1ZXTA 4HTHA 1H9SB 1GAQB 1ONLA 4KKSA 1PTOD 4NP5A 1FRRA 2Z1CA 3BVMA 2WXKA 1FGBD 2C5CA 1GUOA 3FPUB 3ND8A 4IURA 5C0XG 3WOEA 5D14A 5KEEA 3BZDB 2AUJD 3OW7A 2CJNA 4Q2JA 2JA5B 2L52A 2MHVA 1GB4A 3TP5A 1SYFA 1WTQA 3PO0A 3PMFA 1E2WA 1XLNA 4OVZA 4FXGC 4O1NA 1TS5A 1I4QA 1FYCA 2G9DA 1HA5A 2LJIA 1EFID 1EY0A 5M3FB 4DN4M 2LS01 5EGTA 1VF7A 3VYTA 1WSPA 3DEOA 3HOVB 1BR9A 2KWDA 3S1NB 4RHSA 1AZQA 1QOAA 4UDUC 2N9LA 4A3IB 2DNEA 1SNDA 5IGFA 1Y8PB 3NXWA 2IWHA 4G4KA 3RFZB 1DGJA 3AE4B 1LTSD 4CJ2C 1IYUA 2J42A 1C4PA 2JYEA 2K5PA 1V1OA 5LL6X 2WDRB 2O2LD 4RCNA 1BNZA 1E6EB 2CVRA 5AUKA 5D65A 1RF2D 3HS0C 2KOLA 1D5ZC 4XDCA 3HOZB 4TQUS 2E2JB 5KNBA 4DAVA 1ZKOA 2IJ0A 2JA6B 4KN7C 1NI3A 1TT2A 5T1GA 3P4SB 5IODA 1WTPA 2XIWA 4RHRA 2GRIA 1PMRA 2DYMA 3J80L 2SNSA 3I9V1 4B0MA 2K28A 2WDQB 3IAM1 2MGSA 2X6LA 1OFFA 5LHY1 4IFDJ 4YIJA 4ZOHC 2L83A 1J7AA 5C0XI 1FEHA 1N5WA 3V2TA 3PV0A 1ENFA 1ICWA 1SXTA 1X32A 1YNTE 1YNJD 3VRBB 4M8AA 2JWUA 1E10A 2L11A 3I72A 2VZKB 1SE2A 1NUCA 3W9CB 5I2XA 2BS3B 2IPKD 4D2KA 4C1NK 3VR5A 3KWLA 4IUVA 2F0WA 1WCMB 4JBWA 1O78A 4ZLTF 3CU7A 2EVBA 3KLRA 1EL0A 2B2WC 1JR0D 2QKIC 2OXPA 3T53B 2JA7B 1G291 2KJXA 3GD7A 5M9OA 2ZW1A 4CBVA 4DNTB 1BCPB 1T5XD 1G2SA 2A6HD 2QILA 1VMCA 1KDBA 5D3DA 4GZYC 1XCQL 3NSWA 2L5TA 1B50A 2EJGC 3A54A 2SNMA 1EY8A 1JC7A 4US8A 4J6HA 5EE1A 4Q5VA 2INPE 1RFKA 3LX0A 1K8OA 2NBFA 1YJJA 1WTRA 5HHDG 1T5EA 4A3JB 3AV8A 1I6VC 1QNUA 2MH7A 2XNAC 3D8GA 2E76C 2BE5D 5IIFA 1R9TB 2WAQB 3VR9B 4A9AA 2J0TD 1MI0A 2ZW0A 1JICA 4C80A 2F0NA 5IT9L 2IT1A 2Z8LA 5EKKA 1VR9A 2NTSA 3RPFC