3KUCB

Complex of rap1a(e30d/k31e)gdp with rafrbd(a85k/n71r)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVRVRNGMSLHDCLMKKLKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1A
publication title What makes Ras an efficient molecular switch: a computational, biophysical, and structural study of Ras-GDP interactions with mutants of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein/transferase
total genus 20
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kucB00
1XT9B 2ZNVC 4M0WB 2C7NB 3LJ3A 3AXCA 2JF5A 5D2MB 2VRRB 3MHSD 4MGIE 4MJSB 3VTWA 4PYZA 1E7UA 1RLFA 3A1QA 3RYTA 2EMTA 2FAZA 1NDDA 2PJHA 5J2RA 4FULA 2KFKB 4BBNC 3K9OB 3N32A 3NOBA 4W9FA 4HJKA 1KJTA 3APFA 4PS8A 3VVWB 2R2QA 1WIAA 3HM6X 4KV2A 4HLEA 2REXA 3UF8A 2G3QB 4WJPA 1WM2A 2YLMA 3W1SA 2KX0A 4BFRA 4AUQC 2NPTA 2DAFA 3KUDB 1OTRB 3N30A 4K7SA 4NJ7A 4K1RB 3R7RA 4MSQB 1SGHA 2KTRB 1WYWB 4K7WA 4HDOA 4DWFA 2UYZB 4WJQA 1V5OA 3PRZA 5DPRA 5C23A 4AJYB 4BOZB 5JH5C 3HM3A 1V81A 4OVUA 4WWOA 2NBWB 4B95A 4K81A 1Q5WB 3S2AA 1EUVB 5LXIB 4NPNA 4TQ1A 3ZUNA 2DZKA 5CTRC 1WXVA 2JUOA 4HXDA 5L83A 3UQAA 2BWFA 4KZCA 1OEYA 4ANVA 2D07B 2FCSA 3JSVB 4E3CA 4KDIC 2MWSB 4F1SA 1E8ZA 2C9WB 1KLVA 4FBJB 4B6WA 1C3TA 2ZPNA 5LXHA 4XZ4A 4JQWC 3DCGA 4NY0A 3WA0A 2KC1A 3DVNU 4W9EA 3ZIMA 2CU1A 5DCNA 4PS3A 3M3JA 4GXBA 5DPWA 1WJUA 3L17A 2O6VB 4WJNA 5E6PA 4ZRJA 2G4SA 4DHZB 1UBIA 3VH3B 2M8SA 3WAOA 4XC2A 4II2B 2GBKA 2WYQA 4MJSA 5HKHA 4HPMB 4NAWA 3T8MA 3A1QB 4G50A 4HCNB 4DHZE 2LVQA 4HDQA 1H4RA 4AWJA 3QIJA 4JIOU 2XK5A 4FHKA 3PTFC 4KSLC 2G4DB 2WDTB 3ML8A 2KQSA 4NNJB 2FNJB 4IUMB 3RD2A 3HHMA 2KJ6A 2KXJA 1UH6A 1V9JA 3KVFB 4NQKE 2M4NA 3PPAA 3D32A 2LXCA 3L16A 4FA6A 1IYFA 2NPTB 2KDBA 3ZDTA 3Q3FA 4IM0A 2KLCA 1P1AA 1OGWA 4HVBA 3WANA 3ZKJC 4FLHA 4ICVA 4KZ0A 3EFUA 5AZHA 2KOXA 2NVUI 2Z0DB 3AI5A 2KJRA 1R4MI 4MM3A 3VFKA 4EEWA 3SU8X 4GB9A 1R4NI 3B08A 2MBOA 4FN2A 1RRBA 2KO3A 3P2BA 3ZTCA 2BF8B 4W9CA 5G2NA 1AARA 2CKHB 3ZRCA 1UZXB 4AJWA 3H9DA 3BINA 4F8CB 1LM8B 1UD7A 1WX7A 3OAWA 2JRHA 1OQYA 2W9NA 3WIMA 2KZRA 4MGYE 2AYOB 4DK5A 3VQIA 1JRUA 2L0FA 3DDCB 2IO1B 2PPHA 2PE6B 4W9GA 4E71A 3QCAA 3PS6A 2K6DB 2A5UA 2FUHB 3ALBA 2N1WA 4LDTB 1E8XA 4TUUA 2MBQA 3PLVA 4IW0A 2J0MA 3ZNGC 2LRUA 4AOFA 3V61A 3KH0A 2Z0EB 4YL8A 2EKEC 4W9JA 3DVGY 4X57B 3GZNI 2XBBC 2FIFA 5JHBA 4EKUA 3PVLA 3AU5A 3VDZA 2NBVB 2HJ8A 4ZYNA 2KKCA 2O6VA 1BT0A 2RGFA 4NAWB 2ZCCA 3PLUA 5L95C 2C5LC 2D11A 4EZKA 1OEYJ 2XK5B 3KUCB 5CHVC 1WZ0A 3RCZA 3IHPC 3PRPB 3HIZA 4CO7A 3N3KB 2HTHA 1WGYA 2L3ZA 1HE8A 2K39A 2PE9A 1V6EA 2I1KA 1KM7A 2R2OA 3U30A 3NZUA 4BBNF 4RM9A 3TCAA 3TL5A 3VUXA 4GDKA 4TV3A 3R66C 1E5WA 3KUZA 4WJOA 1ZGUB 2FCMA 2KK8A 2GBRA 3IBEA 1YQBA 3QC8B 1Q0WB 2DAJA 1U4AA 2L76A 2K1FA 3CSFA 2M17A 1I35A 3H1UA 4ASWC 3APDA 2JXXA 4II3B 3WALA 2KD0A 2KMAA 2ZNVB 3AU4A 2IO3B 5AZGA 3L10B 3B0AA 1FXTB 4FHJA 1WGGA 4ANWA 3VUYA 5AZFA 1UBQA 1Y8RC 2LZ6A 1WF9A 1YX6B 3IVFA 3L0WB 1RFAA 3U8ZA 1WE7A 3DVNV 3PZDA 1P9DU 1NBFC 1P3QU 1PQSA 2FIDA 3M63B 4HK2A 3TMPB 3ZLZA 3R7QA 3UQBA 4IWQA 3PRMB 5JZEB 3DQVA 1WGRA 1LQBA 1WI0A 2MBBB 4GSWA 3DOWA 2C60A 2IO0B 3GOEA 5LLIA 3PSEB 1D3ZA 3L08A 4IM3A 5DPSA 2GMIC 1LXDA 2BYVE 3QX1A 2HD5B 3KW5B 1VCBA 5GMVA 3B1LX 1KOTA 1WM3A 1X1MA 1WR6E 3H6NA 4JLCA 5J17A 4MELA 4XX5A 2NR2A 2LRWA 4WWNA 4K7UA 4HWIB 1YJ1A 3VUWA 5E6OA 3R3MA 4EZJA 2AWTA 2ZVNA 2N4FA 1L7YA 2B3AA 3UGBB 2M0XA 2JT4B 4A20A 4BKGA 4ZDVA 3ZO5B 4ZRKA 2MBEA 2OOBB 1GJZA 4GMVA 4PS7A 5D94A 1I42A 3SHQA 3APCA 3O65B 3PV1A 2ZCBA 2NCNA 3VH4B 2BKRB 4KDLB 2BYFA 3TJPA 1WGHA 1TZ1A 1J8CA 3EC8A 2MQJA 1TTNA 2NBUA 5FR6A 4BOSC 1GG3A 5D6JB 4GDKB 3KYCD 4W9HA 2V4LA 2N9PC 1T0YA 3DBRI 3ZRFA 3MTNB 4GGQA 3A9KA 3QAQA 2IYDB 1RAXA 2J7QB 2JPHA 2V1YA 3DBSA 1WGDA 2CR5A 3WAPA 1TBEA 1EO6A 4GU2A 2KX3A 3V60A 2J0KA 2BGFA 1WRDB 1E8YA 4BVUC 2LJ5A 2HE7A 4P7IA 2DYOA 1CMXB 5DPTA 2FCQA 1WX8A 3JW0X 2MA9B 2KNBA 4RM8A 1K8RB 1SE9A 2BYEA 1UGMA 1YD8U 2RSUA 4HCPB 4TQ0A 3A33B 2L8JA 2WX1A 4IM2A 4MGKE 3OLMD 3QJZA 2GBJA 2WX0A 4URKA 3AULA 2C7HA 2KN5A 5KHQA 4WWPA 1NI2A 2DYMA 4FJZA 1V80A 3UIPB 2YVCA 2LUEA 4W9LA 4JGHB 4BKSD 2KC2A 2KLGA 3CSTA 1WE6A 3LDZE 1V49A 2JWZA 2OJRA 1WY8A 1ZKHA 3CMMB 3ZNZB 4DXAB 5JHAA 3QHTA 3UIOB 4GIVA 3SDLC 2AEHA 2K8CA 2MSED 3DBHI 2CHZA 1J19A 5EDSA 3M95A 2MRPA 4PYUA 3UINB 1S1QB 2KDIA 3PGEA 4DHJD 3QA8A 2NS5A 4E74A 3NY5A 3NZSA 1IPGA 2Z59B 1WXMA 2IY1B 3A9JB 5KHOA 1E90A 3ECIA 4J6IA 5BO4B 3QWZB 5AEKB 2DZIA 1L2NA 4ZRIA 3VTVA 4I6LB 2EMSA 2GOWA 2KMCA 2O2VA 2N7EA 1GNUA 4AP4C 4EOYA 3H7PA 2DX5B 2LGXA 3A9KB 4BKSA 2BKFA 2K8HA 1WZ3A 4KIKA 5D7GA 2ASQA 2L00B 2KDFB 1V5TA 1V86A 2D10A 2N1VA 4I6PA 3TBLD 2CHWA 2I1JA 2N9XA 2ZZPB 3K9PB 3T9LA 3QK0A 4N9F4 5G55A 3V6CB 1XQQA 3ZTDA 4G11A 4LJPB 2AL6A 3ONSA 4MSMB 2IY0B 1WJNA 4MH0E 3ZVVA 4A3OA 4GDLA 2ZEQA 3OJ3A 2D2QA 1Z5SB 2KDEB 4FADA 1SIFA 2LD9A 2KTFA 2IBIB 3ZNHB 4A3PA 1G6JA 3CF6E 4LCDE 4EFOA 1J0GA 1ZW7A 1TGZB 2N7DA 4LDTD 4DDGD 4BKTA 2N9EB 2RPQA 2MP2A 1MG8A 3QQ8B 4W9DA 4ANXA 4IWPA 5CHWA 3DVGX 2J0JA 1WFYA 3RUIB 2LGYA 3W1YA 3TIXA 2LGDA 4KSKC 4MGZE 5J18A 4M8MA 2GBMA 2LVOA 4B9KA 3PHXB 2DZMA 4TKNA 1M94A 2Y5BB 2L05A 3VTUA 3JYUA 4W9IA 2L7RA 3VHTC 4IWOA 4F7ZA 2DHZA 1YX5B 2KJHB 3Q3JA 3V6EB 2K8BA 1H8CA 4MDKE 2DYBA 3H7SA 1QZEA 2CS4A 2PEAA 3RZFA 3W1SC 3ZNID 2KHWB 2BWES 2K6QA 3VAWA 1C1YB 2KVRA 3ZDMC 2D3GA 1GUAB 2A4ZA 1WMHA 3A4SC 1GC7A 2XEWA 3X0WA 3A9JA 4M8NA 4GN1A 5CHFA 2V3SA 3I3TB 5C1ZA 4DBGA 4DDID 3PT2B 2RD0A 4RMAA 3KYDD 5IAAC 3MJWA 3NHEB 3RT3B 2O2VB 5TR5A 4LJOB 1LFDA 5IA7A 2ZJDA 2JY6A 3H7PB 3PHWB 4EZLA 1A5RA 1Z2MA 2KWUB 1ISNA 1GC6A 3L13A 3M62B 3NS8A 2MBHA 4KIKB 2MW5A 1IP9A 1V2YA 2IZVB 4JL9A 2LASA 3QARA 1WJ6A 2AL3A 4WAAA 2CHXA 2JZZA 3ZW3A 3ML9A 1UELA 1EF1A 4DHJB 2WWZA 3C0RB 2KFKA 2G45B 2KFJA 3DBLI 2C7MB 2K25A 4FJYA 4GDLB 2MX2A 1WXAA 1XD3B 4IG7B 2MCNB 3A4RA 3HK0A 2LI5A 2JZ3B 1Q1OA 2UWQA 1P0RA 1VD2A 1WH3A 2DENB 2JRIB 3IFWB 4HPLB 4OVVA 2MP2B 2BPSA 1E7VA 5CX3A 4CYEA 2JVCA 2QHOA 1EF5A 2KTRA 3DPDA 1F9JA 2LVPA 4MEMA 5E6NA 4G3XB 2ZPYA 3OJ4B 4WQOB 2LXAA 3EECA 4NQLB 2L0TA 1S3SG 2MLBA 2O6VD 2IO2B 3L54A 4KVGB 2M1MA 2GBNA 4W9KA 4EUTA 1P98A 2RR9A 1WR1A 4G0NB 3SD5A 3BY4B 2FCNA 4FJVB 1YIWA 3V62A 4CHKA 2KWVB 3VXWA 1E8WA 2ZVOA 2DZJA 3IG3A 4I6NB 3X23A 3ENEA 3RULA 4IC7B 3JSVA 3RZWC 4NJ6A 3U7DA 3EHVA 1WXSA 2KWCA 3WAMA 4ICUA 2LWPA 1WMHB 3PREA 4ANUA 2KQ7A 4GOCA 1WX9A 3JVZX 2KANA 1WJ4A
chains in the Genus database with same CATH superfamily
4M0WB 3LJ3A 2JF5A 1T0QC 3MHSD 4MJSB 1C4AA 4MT5A 3MHZA 3RYTA 2PJHA 2KFKB 3K9OB 4PS8A 1WIAA 3UF8A 1EM7A 3BZDB 3IT6B 1WM2A 4AUQC 2DAFA 3N30A 3KWVA 4Q2JA 1I4QA 1WYWB 4DWFA 4WJQA 5DPRA 1V5OA 1UWMA 1V81A 4HROA 4OVUA 3VR8B 3AEDB 1DOXA 4K81A 2LGSA 1STEA 4NPNA 4L23A 2DZKA 3BK1A 2DLBA 1ENFA 2AQ2B 3AEGB 3ABVB 1B1ZA 2X38A 4KDIC 2MWSB 4XZ4A 2IDYA 5IO9A 4W9EA 3ZIMA 5DCNA 4PS3A 2PLPA 2B76B 1UBIA 1N61A 2GBKA 5HKHA 4HPMB 3A1QB 1OFFA 4HDQA 1L0YB 3QIJA 1LGRA 1J7AA 2WDTB 2KQSA 4NNJB 2V0GA 2FNJB 3GS2A 1UH6A 5H8YE 1L5PA 4NQKE 3BVMA 3L16A 2KDBA 3ZDTA 1R4MB 2W82A 3SEBA 5JXVA 1OGWA 1TIFA 1XCQL 1ZDXA 1ZDVA 3EFUA 3P63A 3AI5A 1KTKA 3VFKA 1R4NI 4FN2A 1RRBA 3IT4B 3ZTCA 2BF8B 5G2NA 3ZRCA 2CKHB 4AJWA 1WX7A 4MGYE 1I4XA 1JRUA 3DDCB 2PPHA 4E71A 2MEKA 2K6DB 2A5UA 4TUUA 4IW0A 2LRUA 4AOFA 3V61A 3E56A 4W9JA 1T3QA 1JWMD 2IGGA 1TKEA 3MC0B 3PVLA 2O6VA 3TSSA 4WURA 4NAWB 3CWIA 3AE5B 1NVID 1FFUA 5L95C 3B2GA 4EZKA 3RCZA 1C77A 1RM6C 1V1PA 2L3ZA 1QOGA 4BBNF 4RM9A 3TL5A 1ZGUB 2WXQA 3QC8B 3IBEA 4ZRQA 3GE3C 5MPOA 2WXKA 2K1FA 3CSFA 3NJTA 3H1UA 2KAJA 1AN8A 1MPEA 5AZGA 3VUYA 1Y8RC 3DVNV 1SIJA 1P9DU 3PRMB 3BIID 4REZA 1F1HA 5EE1A 4C00A 5LLIA 1HZ6A 1SE3A 1JALA 1N6ZA 5DPSA 2GMIC 2HD5B 1KOTA 1WR6E 4MELA 4XX5A 2UU7A 3Q8CA 3UGBB 2JT4B 4XE0A 2MBEA 4GMVA 4PS7A 1I42A 1QILA 3APCA 3IXSA 3O65B 2ZCBA 4IDIA 4K3CA 1TTNA 2NBUA 3PZ7A 3EUB2 3DBRI 1SB3C 5G5HA 4ZYSA 3DBSA 3I5JC 1T0SC 1EO6A 4GU2A 1WRDB 4BVUC 2HE7A 2DYOA 5DPTA 2FCQA 2KNBA 1FO4A 2M0AA 1IBXA 1YD8U 2RSUA 3OLMD 3B9JA 2GBJA 3QJZA 3GP7A 2JXTA 2SEBD 2C7HA 4L2YA 1NI2A 3NVWA 1ROEA 3B2FA 1YMHE 4RGOS 1N5WA 2FE8A 3CSTA 2D5GA 1V49A 1CQVA 1ZKHA 3CMMB 5JHAA 3ZXVA 3QHTA 1CZPA 4KGSA 3DBHI 1OQRA 1S1QB 3PGEA 2BQQA 2Z59B 3AE1B 3ECIA 3WCQA 3QWZB 5AEKB 3U2SC 2JSVX 4EOYA 4AP4C 1FPYA 2BKFA 1RFKA 2FUG1 3I57A 1WZ3A 5D7GA 2ASQA 3TBLD 2D10A 1V86A 2N1VA 2I1JA 2N9XA 1WXQA 3K9PB 1TS2A 1SSNA 4LJPB 2AL6A 1K52A 4GDLA 2EELA 2ZEQA 3BVZA 1FMAD 2L83A 2KTFA 2IBIB 1G6JA 1TGZB 1MG8A 2ACZB 3AE3B 5CHWA 3DVGX 3W1YA 5FKAC 2LGDA 4KSKC 5J18A 4HRSA 4B9KA 1XLPA 2DZMA 4TKNA 3URYA 2J42A 3JYUA 2L7RA 4IWOA 4F7ZA 2EKIA 1H8CA 3ZNID 2BWES 1VDVA 2KT7A 3ZQ4A 1EWYC 1GUAB 3X0WA 2XEWA 2WU5B 2VH1A 3DHGC 2JWUA 4M0WA 2PIAA 2E3TA 3RT3B 3NHEB 4HPPA 5IA7A 2ZJDA 3PHWB 1A5RA 2KWUB 1ISNA 3BWUD 2MW5A 2R61A 4OZAA 1WRIA 3VRBB 4JL9A 4WAAA 2CHXA 2JZZA 4JWUC 1TS5A 1UELA 2LHEA 1EF1A 3C0RB 2OJWA 2KFKA 2G45B 2KFJA 1MVKA 4FJYA 2K25A 1YN3A 3A4RA 3HK0A 2OHFA 1XEEA 1P0RA 4HPLB 2MJDA 2MP2B 1GB1A 1FCCC 2JVCA 2QHOA 2K0PA 2LVPA 1GB4A 1VJKA 2ZPYA 5T8IA 1SJED 2WXMA 1S3SG 2O6VD 4W9KA 3AEAB 4NJCA 1BXTA 3BY4B 4FJVB 1YIWA 5I4DA 3W5UB 2ZVOA 3X23A 2WXPA 4C4VB 2LWPA 3PREA 4GOCA 5IKCM 3BINA 2KANA 1WJ4A 2ZNVC 2C7NB 4KX6B 1XXGA 1HA5A 3FILB 3RNGC 1E7UA 3A1QA 2YEPF 1FCLA 3ETRA 1ZOYB 2FAZA 5J2RA 4FULA 4BBNC 4W9FA 3NOBA 3VVWB 4YT0B 4KV2A 4HLEA 1K50A 2REXA 2G3QB 2YLMA 4J3OD 3W1SA 2KX0A 4BFRA 1UWXA 3KUDB 4NJ7A 4P1CC 3R7RA 1IUEA 1NEKB 5GXGB 4K7WA 2UYZB 4AJYB 3PRZA 5C23A 4RF0A 3HM3A 2FBWB 3Q69A 2NBWB 1T5XD 1EUVB 5LXIB 1YJIA 2WXRA 3ZUNA 2WDVB 5CTRC 1WXVA 5D3IB 2QIEB 3UQAA 4KZCA 4ANVA 1UF0A 3NG0A 4F1SA 2Y5CA 1N60A 1C3TA 4JWSC 4NY0A 3DVNU 3L4PA 2CU1A 3N1XC 1WJUA 2RDGA 4ZRJA 3VH3B 2GRIA 4NAWA 3OWEB 1C79A 4G50A 4HCNB 2LVQA 4AWJA 1H4RA 3PTFC 3TEYA 1D4BA 3HHMA 1FNVA 1QOAA 1JROA 1SXTA 2LXCA 4FA6A 2NPTB 2INPE 3TUOA 3AB5A 2KLCA 4IM0A 3SFDB 3R2IA 5BMHA 3C8YA 1L0VB 1R4MI 3SU8X 3B08A 1I4HA 1L4ZB 4F8CB 1I4RA 1UD7A 3ZGZA 3OAWA 1YJJA 2KZRA 4WWMA 2L0FA 2IO1B 4HKQA 2H89B 3QCAA 2FUHB 1E8XA 2RDHA 2KACA 4YL8A 3GZNI 2XBBC 1QT9A 2WGSA 4EKUA 2HJ8A 2KKCA 2MJ3A 1ZXHA 2ZW1A 4B0EA 2RGFA 2C5LC 1QF6A 2JX5A 3LXFA 3N3KB 1RYJA 2HTHA 1XLOA 2E6XA 3U30A 3TCAA 3VRAB 1FEHA 4WJOA 3R66C 2FCMA 1YQBA 1Q0WB 4YSZB 4ZHPA 4LLGM 1I35A 3APDA 4DXFA 4II3B 4MM3B 1E6EB 2KD0A 5BYSA 3AU4A 2NTTA 3L10B 3B0AA 1NI3A 2LZ6A 1WF9A 1YX6B 3L0WB 3MP9A 3RNCC 1WE7A 3TMPB 1NBFC 1P3QU 3ZLZA 3NVYA 1ZUD2 1LQBA 3DOWA 2C60A 4M00A 2D3CA 1PYWD 1LXDA 3QX1A 1WM3A 1X1MA 4A6QA 1JMLA 3C19A 2WXNA 4HWIB 1YJ1A 3Q2AC 2ZVNA 2WNMA 4BKGA 4ZDVA 3R2TA 1L0XB 4WIPA 1GJZA 5D94A 3SHQA 1YN5A 3PV1A 3RNFC 2BKRB 4KDLB 2BYFA 1J8CA 1PGXA 4EE2A 4BOSC 1GG3A 5D6JB 3KYCD 1MHXA 3ZRFA 3QAQA 3U52E 2J7QB 1RAXA 4AQ7A 2CJNA 4IOIE 2JZPA 1E8YA 5IP4D 1TKGA 2BTEA 3NVVA 1CMXB 1WX8A 2MA9B 3R8BA 3P42A 4L1BA 2L8JA 4MGKE 2WP9B 3NZ3A 2WX0A 2L1AA 4AS1A 5KHQA 1TY2A 4FJZA 4BKSD 3GB1A 3LDZE 2JWZA 3P4SB 1CJEA 4KKJA 3UIOB 4GIVA 1J7CA 2G1EA 2K8CA 4KGTA 1J19A 4PYUA 3KWLA 3UINB 2KDIA 4DHJD 3NY5A 1ZPSA 1WXMA 2IY1B 5KHOA 4XGAB 4J6IA 5BO4B 4TMAB 2WXLA 3VTVA 1BMLC 4I6LB 2GOWA 2DX5B 2LGXA 2J52A 3A9KB 1DOYA 1HQRD 2LUMA 2WHIA 2CHWA 2ZZPB 1GPXA 1L4DB 3V6CB 4HEA1 3ONSA 2NTSA 1JWUD 3ZVVA 2CJOA 4LNKA 2LD9A 3FAHA 3ZNHB 3CF6E 1J0GA 4K3BA 1ZW7A 2N9EB 2MP2A 2WQYB 3QQ8B 4ANXA 4IWPA 1V97A 4WAFA 2VZKB 2J0JA 1WFYA 4RH6A 3RUIB 4M8MA 1OQQA 2GBMA 3UI3A 2WXJA 1SJHD 3VTUA 4W9IA 3VHTC 2BT6A 1WWTA 2KJHB 3V6EB 2DYBA 3RZFA 2CS4A 2PEAA 3TEWA 2KHWB 2BVCA 4C4VA 1HTOA 1N5XA 3A9JA 4M8NA 5C1ZA 4DBGA 4DDID 3PT2B 2RD0A 2KDMA 4LJOB 5TR5A 2JY6A 2LGIA 4EZLA 3L13A 3Q8EA 3NS8A 2JQRB 1B9RA 1V2YA 3FILA 2LFIA 3DBLB 2AL3A 1C4PA 3ML9A 3BK2A 4H2AA 2MX2A 1WXAA 2MCNB 2LI5A 2UWQA 3Q8FA 2JRIB 3RNAC 2HDEA 2BPSA 4C56C 1F2RI 1R4NB 3AEBB 1AW7A 4N6EB 1UUPA 4MEMA 4G3XB 4LNFA 2L0TA 2MLBA 3L54A 2IO2B 4WQMA 1I7HA 2BYTA 1P98A 1TS3A 1V8CA 1WR1A 4G0NB 3SD5A 4CHKA 1C76A 2KWVB 3IG3A 1E0ZA 5C2TB 3RZWC 2K22A 3U7DA 4UDUC 1WXSA 4ICUA 4YTNB 1WX9A 3N1YC 1JWBD 2I2YA 5D2MB 2ICIA 2VRRB 1KF6B 4OVZA 2JYEA 1DOIA 3VTWA 1D5XC 2QSDA 4PYZA 2EMTA 2PMVA 1NDDA 1KJTA 4N59A 3HM6X 1PFDA 2NPTA 4K1RB 4MSQB 1R7SA 1SGHA 3MC8A 1WYGA 4BOZB 2BS2B 4B95A 5FR3A 5HFYA 1Q5WB 4TQ1A 5L83A 1JWAD 2IJ0A 2BWFA 1OEYA 3MFGA 2FCSA 3RFZB 2WDQB 2C9WB 1KLVA 1AYFA 3P4QB 4JQWC 3WA0A 2BB5A 2G9HD 2KC1A 2QILA 2GLSA 3Q3MC 3M3JA 4GXBA 3L17A 2O6VB 4WJNA 2G4SA 1D5MC 1F2RC 3U4EG 4RGTA 4XC2A 2WYQA 4MJSA 4DHZE 4GLSC 1LO5D 2J4XA 3J9CA 4JIOU 4OZBA 3E9SA 4FHKA 4KSLC 3ML8A 1SE4A 4IUMB 3OG5A 3DBRB 3RD2A 4JX1C 3AEFB 3KVFB 2K5PA 2M4NA 1IYFA 4QAYA 3Q3FA 3BYTB 4XDDA 1P1AA 4HVBA 2WS3B 3ZKJC 2MJEA 4KZ0A 2WXGA 2Z0DB 4MM3A 5D3DA 2X8XX 4C7YA 2MBOA 3AE6B 1SBBB 1AARA 1UZXB 1LM8B 5BMGA 4PT5A 2JRHA 1OQYA 2W9NA 4DK5A 3Q6BA 3HVZA 3RNBC 4W9GA 5BMIA 2JYTA 1N62A 4LDTB 3ALBA 1FD6A 2MBQA 3PLVA 2AQ3B 2J0MA 3ZNGC 3KH0A 4DQOC 1XLNA 4MACA 2CU3A 3DVGY 3NS1A 2FIFA 3GE8C 3VDZA 2NBVB 4ZYNA 1NENB 3LB8C 4YXDB 2ZCCA 3PLUA 3N1ZC 1A70A 2XK5B 3KUCB 3HIZA 4CO7A 2TSSA 1WGYA 1F0ZA 2K39A 1V6EA 1KM7A 2R2OA 3NZUA 3VUXA 4TV3A 1E5WA 3KUZA 1AWDA 2GBRA 2KK8A 3NRZA 1FM0D 4LNOA 2L76A 4S0RA 4ZOHC 5AUIA 2M17A 3WALA 3EFCA 2KMAA 2ZNVB 2IO3B 3EA6A 1FXTB 4FHJA 1WGGA 2QDFA 1PDXA 4ANWA 5AZFA 3IVFA 1C78A 1RFAA 3U8ZA 3PZDA 1PQSA 1WSPA 3R7QA 2QEJC 3LYYA 4IWQA 3UQBA 5JZEB 1WI0A 4HKZE 2MBBB 4GSWA 3T3OA 2IO0B 3PSEB 1E9MA 5TSSA 4JPSA 3L08A 2OEDA 2GB1A 5GMVA 3B1LX 4JLCA 5HHDG 5J17A 2L32A 2BW2A 2KVZA 1SEBD 2LRWA 4WWNA 1HTQA 4K7UA 4P6VF 4LNNA 5E6OA 3R3MA 4EZJA 4USAA 2B3AA 2M0XA 3ZO5B 4ZRKA 2OOBB 1JW9D 5IOIA 4CQNA 5E6JA 1VZ6A 2NCNA 3H8HA 3VH4B 4RGMA 1WGHA 1TZ1A 1QOBA 1EU3A 3EC8A 2W54A 4GDKB 3RI7C 2V4LA 3ZJTA 2N9PC 1T0YA 3MTNB 1KLUD 3A9KA 3HVDA 1MG4A 1ZP0B 2BB6A 2CR5A 3WAPA 3AE4B 3AMZA 2KX3A 1VR9A 3IAS1 2LJ5A 3TEXA 4RM8A 1K8RB 1SE9A 1UGMA 4TQ0A 3A33B 4URKA 3KQ4A 1FXAA 4OHJA 2KN5A 1ET6A 4WWPA 1V80A 3UIPB 2YVCA 2DBYA 1UNSA 4W9LA 3AE9B 2KC2A 2IPKD 1WE6A 1JQ4A 2GI9A 1WY8A 4DXAB 5EE3A 1FXIA 5EDSA 1T0RC 3M95A 4FXCA 4NZLB 2WXOA 3P4RB 1FNUA 4ZRIA 4C80A 2V9HA 1ZXIA 2EMSA 2KMCA 2N7EA 1GNUA 1MI0A 2PKOA 4M02A 4XWWA 4BZAA 1VLBA 4ACFA 2L00B 1V5TA 2KDFB 3N20C 1XCTL 3T9LA 4N9F4 5G55A 4MSMB 2INNE 3AN1A 1FNWA 3OJ3A 2D2QA 1Z5SB 2KDEB 5EE9A 4FADA 1SIFA 4A3PA 2PW9A 2Q5WD 2KYWA 4LCDE 4EFOA 4BKTA 2KWDA 2LGYA 3TIXA 4MGZE 1GOZA 3DHHC 2LVOA 1FRRA 2INDC 3PHXB 2L05A 4NAMA 2DHZA 1YX5B 3Q3JA 2K8BA 3IAM1 1NYRA 3W1SC 3MJ5A 1C1YB 2KVRA 3V05A 3ZDMC 4C7ZA 1T6BX 2A4ZA 3A4SC 1GC7A 2ON8A 2Y5PA 2V3SA 4RMAA 2INCC 3MJWA 2O2VB 1HZ5A 3H7PB 1KFYB 2MBHA 4RCOA 4KIKB 1IP9A 3P4PB 2LASA 3AECB 3QARA 3ZW3A 4LTUA 4DHJB 2WWZA 3DBLI 1XD3B 4IG7B 2LJIA 3FKYA 2JZ3B 1Q1OA 1VZ7A 3RMKC 2MH7A 1PUTA 3HUIA 1WH3A 1YOVB 4OVVA 4B0MA 5IN7A 4CYEA 4KKIA 1F9JA 5E6NA 1VZ8A 4WQOB 1V1OA 2LXAA 3EECA 4NQLB 1MHHE 4US9A 4P16A 1GAQB 3DHIC 4RNAA 4KVGB 2GBNA 2K3UA 4EUTA 3Q3NC 2RR9A 1QQRA 2FCNA 3VXWA 1E8WA 4A90A 4I6NB 1TT5B 1TY0A 4M01A 3RULA 1PGAA 4IC7B 4NJ6A 3EHVA 2KMMA 2KWCA 3WAMA 1WMHB 3GZNB 4ANUA 2KQ7A 2IGHA 4RGNA 1XT9B 1F52A 4TSSA 3AXCA 2WDRB 2I38A 1D5ZC 4MGIE 3AE2B 1SF0A 1YN4A 1RLFA 2RMMA 2AX5A 1M4VA 4LNIA 3N32A 4HJKA 3APFA 2SAKA 2R2QA 4YSXB 1XLQA 2AQ1B 4WJPA 1I4PA 1P7FA 4K7SA 1OTRB 2JU6X 2KTRB 4HDOA 1TYGB 1TS4A 1TJEA 1KH0A 5JH5C 1DYQA 4WWOA 3S2AA 4S17A 1N63A 1D6EC 4LK0M 2YEPB 2DNFA 2JUOA 4HXDA 2BS4B 2D07B 1KLGD 3JSVB 4E3CA 2D3AA 2D3BA 3V3XA 1NYQA 1ET9A 1KRHA 1E8ZA 5LNK1 4FBJB 4B6WA 2ZPNA 5LXHA 1E10A 3DCGA 3ZJUA 5DPWA 5E6PA 4DHZB 2BS3B 2M8SA 3Q14C 3WAOA 4II2B 2QCZA 3T8MA 2N9LA 3RNEC 2KQ4X 2NMQA 2XK5A 2W3SA 1JCKB 2G4DB 2H88B 4XYCA 4ZRPA 2KJ6A 2KXJA 1V9JA 3PPAA 3D32A 1IGCA 2VZKD 1JRPA 4OZCA 4ZHOA 3WANA 3ZJVA 4FLHA 4ICVA 3U7ZA 5AZHA 2KOXA 2NVUI 2KJRA 3MC9A 4EEWA 2IGDA 4GB9A 2KO3A 2WXFA 3P2BA 4MH8A 4W9CA 3H9DA 4RF1A 3WIMA 2AYOB 3DWGC 3VQIA 2PE6B 3PS6A 1MFWA 2N1WA 2QC8A 2M19A 2Z0EB 2W55A 1FRDA 2EKEC 4JE3B 1HXYD 4X57B 3I9V1 3Q8BA 2HJ1A 3RPFC 5JHBA 3AU5A 3NVZA 2ONQA 1BT0A 5AUKA 2WXHA 2D11A 1OEYJ 5CHVC 1WZ0A 3IHPC 4XDCA 3PRPB 1VRAB 1EU4A 1HE8A 2PE9A 2I1KA 3HRDD 2QJLA 2KN4A 4GDKA 3KLSX 1L6VA 2DAJA 1U4AA 3T3NA 4ASWC 2JXXA 2ZW0A 1UBQA 4OW0A 5G5GA 3I63C 4N58A 1Q10A 1I4GA 2QMTA 4HK2A 2FIDA 3M63B 4WH4A 1QKZA 5H92C 3DQVA 1WGRA 4PK1A 1JWSD 3GOEA 2PVOD 2LMCA 1ZE3D 1D3ZA 3FC4A 4IM3A 2J53A 2BYVE 3O13A 3KW5B 1C9FA 1VCBA 3H6NA 2NR2A 2Y3AA 2Z8LA 3VUWA 2AWTA 2N4FA 1L7YA 1MJDA 4A20A 4IKGA 2PVGC 2VH2A 3AM9A 1V1PB 4A8XC 1K51A 3TJPA 1HEZE 2MQJA 5FR6A 3P1MA 4W9HA 5HI1A 1YQ3B 4GGQA 1F77A 2IYDB 2W3RA 2JPHA 1EWCA 2V1YA 1WGDA 1TBEA 4XWTA 1Y56A 1TZOA 2HTME 5HG2A 3V60A 2J0KA 2BGFA 3N9YC 3AE8B 4P7IA 4D2KA 3JW0X 1WGKA 2L52A 3RN9C 2BYEA 4YSYB 4HCPB 4IM2A 2WX1A 4BAXA 3AULA 2DYMA 1C4CA 1RWSA 2LUEA 4JGHB 1L6UA 2KLGA 3DBHB 2OJRA 2N7JA 3ZNZB 1FIQA 3SDLC 2AEHA 2MSED 1ESFA 2CHZA 3PO0A 2MRPA 3QA8A 2NS5A 4E74A 1XF5L 3BVGA 4YTPB 3NZSA 4ARCA 1IPGA 2BBCA 3A9JB 1E90A 2DZIA 4A55A 1L2NA 4KGRA 1TKYA 3SFEB 2O2VA 2WXIA 3H7PA 1IGDA 3AEEB 4BKSA 5FK9C 1BUIC 2K8HA 4KIKA 4RFBA 4I6PA 3AH7A 3QK0A 4HJGE 4YTMB 1XQQA 3ZTDA 4G11A 5EE0A 2IY0B 1WJNA 4MH0E 4A3OA 3W9CB 4R3DA 2N9KA 3ZYYX 1YNTE 2LEKA 1IBXB 2XNAC 4US8A 2V3NA 3W2DA 3VR9B 4DDGD 2N7DA 4LDTD 2RPQA 2V3PA 4W9DA 1ACCA 2RDBC 1CK1A 5BYQA 3AE7B 1M94A 2Y5BB 3TEZA 3CIRB 4MDKE 2LHDA 3H7SA 1QZEA 1FFVA 2K6QA 3NUHB 3VAWA 1J7BA 3W5VB 4DXGA 2K9XA 2D3GA 4O1NA 5BYRA 1WMHA 1SE2A 1PGBA 4GN1A 5CHFA 3I3TB 3KYDD 5IAAC 1YQ4B 1LFDA 5C3JB 2RPVA 1Z2MA 3PZ8A 4A9AA 1GC6A 3M62B 4ITKA 1P7EA 2IZVB 4P1BC 1QOFA 1WJ6A 2MHJA 1QLBB 4GDLB 3SR6A 2C7MB 1VD2A 2DENB 3IFWB 3BYYB 3EGRA 1E7VA 3Q8AA 3Q3OC 5CX3A 1EF5A 2KTRA 3DPDA 2DWQA 2XN9C 3OJ4B 1UGJA 2M1MA 4ARIA 1E7PB 2M56B 2WU2B 1XO3A 3V62A 1DGJA 2DZJA 2PTLA 4YWGG 3ENEA 2V4IB 3JSVA 3AV8A 2WLBA 2N0SB 3JVZX 1K53A 3ZXRA 3DWMA
chains in the Genus database with same CATH topology
1XT9B 2ZNVC 4M0WB 2C7NB 3LJ3A 3AXCA 2JF5A 5D2MB 2VRRB 3MHSD 4MGIE 4MJSB 3VTWA 4PYZA 1E7UA 1RLFA 3A1QA 3RYTA 2EMTA 2FAZA 1NDDA 2PJHA 5J2RA 4FULA 2KFKB 4BBNC 3K9OB 3N32A 3NOBA 4W9FA 4HJKA 1KJTA 3APFA 4PS8A 3VVWB 2R2QA 1WIAA 3HM6X 4KV2A 4HLEA 2REXA 3UF8A 2G3QB 4WJPA 1WM2A 2YLMA 3W1SA 2KX0A 4BFRA 4AUQC 2NPTA 2DAFA 3KUDB 1OTRB 3N30A 4K7SA 4NJ7A 4K1RB 3R7RA 4MSQB 1SGHA 2KTRB 1WYWB 4K7WA 4HDOA 4DWFA 2UYZB 4WJQA 1V5OA 3PRZA 5DPRA 5C23A 4AJYB 4BOZB 5JH5C 3HM3A 1V81A 4OVUA 4WWOA 2NBWB 4B95A 4K81A 1Q5WB 3S2AA 1EUVB 5LXIB 4NPNA 4TQ1A 3ZUNA 2DZKA 5CTRC 1WXVA 2JUOA 4HXDA 5L83A 3UQAA 2BWFA 4KZCA 1OEYA 4ANVA 2D07B 2FCSA 3JSVB 4E3CA 4KDIC 2MWSB 4F1SA 1E8ZA 2C9WB 1KLVA 4FBJB 4B6WA 1C3TA 2ZPNA 5LXHA 4XZ4A 4JQWC 3DCGA 4NY0A 3WA0A 2KC1A 3DVNU 4W9EA 3ZIMA 2CU1A 5DCNA 4PS3A 3M3JA 4GXBA 5DPWA 1WJUA 3L17A 2O6VB 4WJNA 5E6PA 4ZRJA 2G4SA 4DHZB 1UBIA 3VH3B 2M8SA 3WAOA 4XC2A 4II2B 2GBKA 2WYQA 4MJSA 5HKHA 4HPMB 4NAWA 3T8MA 3A1QB 4G50A 4HCNB 4DHZE 2LVQA 4HDQA 1H4RA 4AWJA 3QIJA 4JIOU 2XK5A 4FHKA 3PTFC 4KSLC 2G4DB 2WDTB 3ML8A 2KQSA 4NNJB 2FNJB 4IUMB 3RD2A 3HHMA 2KJ6A 2KXJA 1UH6A 1V9JA 3KVFB 4NQKE 2M4NA 3PPAA 3D32A 2LXCA 3L16A 4FA6A 1IYFA 2NPTB 2KDBA 3ZDTA 3Q3FA 4IM0A 2KLCA 1P1AA 1OGWA 4HVBA 3WANA 3ZKJC 4FLHA 4ICVA 4KZ0A 3EFUA 5AZHA 2KOXA 2NVUI 2Z0DB 3AI5A 2KJRA 1R4MI 4MM3A 3VFKA 4EEWA 3SU8X 4GB9A 1R4NI 3B08A 2MBOA 4FN2A 1RRBA 2KO3A 3P2BA 3ZTCA 2BF8B 4W9CA 5G2NA 1AARA 2CKHB 3ZRCA 1UZXB 4AJWA 3H9DA 3BINA 4F8CB 1LM8B 1UD7A 1WX7A 3OAWA 2JRHA 1OQYA 2W9NA 3WIMA 2KZRA 4MGYE 2AYOB 4DK5A 3VQIA 1JRUA 2L0FA 3DDCB 2IO1B 2PPHA 2PE6B 4W9GA 4E71A 3QCAA 3PS6A 2K6DB 2A5UA 2FUHB 3ALBA 2N1WA 4LDTB 1E8XA 4TUUA 2MBQA 3PLVA 4IW0A 2J0MA 3ZNGC 2LRUA 4AOFA 3V61A 3KH0A 2Z0EB 4YL8A 2EKEC 4W9JA 3DVGY 4X57B 3GZNI 2XBBC 2FIFA 5JHBA 4EKUA 3PVLA 3AU5A 3VDZA 2NBVB 2HJ8A 4ZYNA 2KKCA 2O6VA 1BT0A 2RGFA 4NAWB 2ZCCA 3PLUA 5L95C 2C5LC 2D11A 4EZKA 1OEYJ 2XK5B 3KUCB 5CHVC 1WZ0A 3RCZA 3IHPC 3PRPB 3HIZA 4CO7A 3N3KB 2HTHA 1WGYA 2L3ZA 1HE8A 2K39A 2PE9A 1V6EA 2I1KA 1KM7A 2R2OA 3U30A 3NZUA 4BBNF 4RM9A 3TCAA 3TL5A 3VUXA 4GDKA 4TV3A 3R66C 1E5WA 3KUZA 4WJOA 1ZGUB 2FCMA 2KK8A 2GBRA 3IBEA 1YQBA 3QC8B 1Q0WB 2DAJA 1U4AA 2L76A 2K1FA 3CSFA 2M17A 1I35A 3H1UA 4ASWC 3APDA 2JXXA 4II3B 3WALA 2KD0A 2KMAA 2ZNVB 3AU4A 2IO3B 5AZGA 3L10B 3B0AA 1FXTB 4FHJA 1WGGA 4ANWA 3VUYA 5AZFA 1UBQA 1Y8RC 2LZ6A 1WF9A 1YX6B 3IVFA 3L0WB 1RFAA 3U8ZA 1WE7A 3DVNV 3PZDA 1P9DU 1NBFC 1P3QU 1PQSA 2FIDA 3M63B 4HK2A 3TMPB 3ZLZA 3R7QA 3UQBA 4IWQA 3PRMB 5JZEB 3DQVA 1WGRA 1LQBA 1WI0A 2MBBB 4GSWA 3DOWA 2C60A 2IO0B 3GOEA 5LLIA 3PSEB 1D3ZA 3L08A 4IM3A 5DPSA 2GMIC 1LXDA 2BYVE 3QX1A 2HD5B 3KW5B 1VCBA 5GMVA 3B1LX 1KOTA 1WM3A 1X1MA 1WR6E 3H6NA 4JLCA 5J17A 4MELA 4XX5A 2NR2A 2LRWA 4WWNA 4K7UA 4HWIB 1YJ1A 3VUWA 5E6OA 3R3MA 4EZJA 2AWTA 2ZVNA 2N4FA 1L7YA 2B3AA 3UGBB 2M0XA 2JT4B 4A20A 4BKGA 4ZDVA 3ZO5B 4ZRKA 2MBEA 2OOBB 1GJZA 4GMVA 4PS7A 5D94A 1I42A 3SHQA 3APCA 3O65B 3PV1A 2ZCBA 2NCNA 3VH4B 2BKRB 4KDLB 2BYFA 3TJPA 1WGHA 1TZ1A 1J8CA 3EC8A 2MQJA 1TTNA 2NBUA 5FR6A 4BOSC 1GG3A 5D6JB 4GDKB 3KYCD 4W9HA 2V4LA 2N9PC 1T0YA 3DBRI 3ZRFA 3MTNB 4GGQA 3A9KA 3QAQA 2IYDB 1RAXA 2J7QB 2JPHA 2V1YA 3DBSA 1WGDA 2CR5A 3WAPA 1TBEA 1EO6A 4GU2A 2KX3A 3V60A 2J0KA 2BGFA 1WRDB 1E8YA 4BVUC 2LJ5A 2HE7A 4P7IA 2DYOA 1CMXB 5DPTA 2FCQA 1WX8A 3JW0X 2MA9B 2KNBA 4RM8A 1K8RB 1SE9A 2BYEA 1UGMA 1YD8U 2RSUA 4HCPB 4TQ0A 3A33B 2L8JA 2WX1A 4IM2A 4MGKE 3OLMD 3QJZA 2GBJA 2WX0A 4URKA 3AULA 2C7HA 2KN5A 5KHQA 4WWPA 1NI2A 2DYMA 4FJZA 1V80A 3UIPB 2YVCA 2LUEA 4W9LA 4JGHB 4BKSD 2KC2A 2KLGA 3CSTA 1WE6A 3LDZE 1V49A 2JWZA 2OJRA 1WY8A 1ZKHA 3CMMB 3ZNZB 4DXAB 5JHAA 3QHTA 3UIOB 4GIVA 3SDLC 2AEHA 2K8CA 2MSED 3DBHI 2CHZA 1J19A 5EDSA 3M95A 2MRPA 4PYUA 3UINB 1S1QB 2KDIA 3PGEA 4DHJD 3QA8A 2NS5A 4E74A 3NY5A 3NZSA 1IPGA 2Z59B 1WXMA 2IY1B 3A9JB 5KHOA 1E90A 3ECIA 4J6IA 5BO4B 3QWZB 5AEKB 2DZIA 1L2NA 4ZRIA 3VTVA 4I6LB 2EMSA 2GOWA 2KMCA 2O2VA 2N7EA 1GNUA 4AP4C 4EOYA 3H7PA 2DX5B 2LGXA 3A9KB 4BKSA 2BKFA 2K8HA 1WZ3A 4KIKA 5D7GA 2ASQA 2L00B 2KDFB 1V5TA 1V86A 2D10A 2N1VA 4I6PA 3TBLD 2CHWA 2I1JA 2N9XA 2ZZPB 3K9PB 3T9LA 3QK0A 4N9F4 5G55A 3V6CB 1XQQA 3ZTDA 4G11A 4LJPB 2AL6A 3ONSA 4MSMB 2IY0B 1WJNA 4MH0E 3ZVVA 4A3OA 4GDLA 2ZEQA 3OJ3A 2D2QA 1Z5SB 2KDEB 4FADA 1SIFA 2LD9A 2KTFA 2IBIB 3ZNHB 4A3PA 1G6JA 3CF6E 4LCDE 4EFOA 1J0GA 1ZW7A 1TGZB 2N7DA 4LDTD 4DDGD 4BKTA 2N9EB 2RPQA 2MP2A 1MG8A 3QQ8B 4W9DA 4ANXA 4IWPA 5CHWA 3DVGX 2J0JA 1WFYA 3RUIB 2LGYA 3W1YA 3TIXA 2LGDA 4KSKC 4MGZE 5J18A 4M8MA 2GBMA 2LVOA 4B9KA 3PHXB 2DZMA 4TKNA 1M94A 2Y5BB 2L05A 3VTUA 3JYUA 4W9IA 2L7RA 3VHTC 4IWOA 4F7ZA 2DHZA 1YX5B 2KJHB 3Q3JA 3V6EB 2K8BA 1H8CA 4MDKE 2DYBA 3H7SA 1QZEA 2CS4A 2PEAA 3RZFA 3W1SC 3ZNID 2KHWB 2BWES 2K6QA 3VAWA 1C1YB 2KVRA 3ZDMC 2D3GA 1GUAB 2A4ZA 1WMHA 3A4SC 1GC7A 2XEWA 3X0WA 3A9JA 4M8NA 4GN1A 5CHFA 2V3SA 3I3TB 5C1ZA 4DBGA 4DDID 3PT2B 2RD0A 4RMAA 3KYDD 5IAAC 3MJWA 3NHEB 3RT3B 2O2VB 5TR5A 4LJOB 1LFDA 5IA7A 2ZJDA 2JY6A 3H7PB 3PHWB 4EZLA 1A5RA 1Z2MA 2KWUB 1ISNA 1GC6A 3L13A 3M62B 3NS8A 2MBHA 4KIKB 2MW5A 1IP9A 1V2YA 2IZVB 4JL9A 2LASA 3QARA 1WJ6A 2AL3A 4WAAA 2CHXA 2JZZA 3ZW3A 3ML9A 1UELA 1EF1A 4DHJB 2WWZA 3C0RB 2KFKA 2G45B 2KFJA 3DBLI 2C7MB 2K25A 4FJYA 4GDLB 2MX2A 1WXAA 1XD3B 4IG7B 2MCNB 3A4RA 3HK0A 2LI5A 2JZ3B 1Q1OA 2UWQA 1P0RA 1VD2A 1WH3A 2DENB 2JRIB 3IFWB 4HPLB 4OVVA 2MP2B 2BPSA 1E7VA 5CX3A 4CYEA 2JVCA 2QHOA 1EF5A 2KTRA 3DPDA 1F9JA 2LVPA 4MEMA 5E6NA 4G3XB 2ZPYA 3OJ4B 4WQOB 2LXAA 3EECA 4NQLB 2L0TA 1S3SG 2MLBA 2O6VD 2IO2B 3L54A 4KVGB 2M1MA 2GBNA 4W9KA 4EUTA 1P98A 2RR9A 1WR1A 4G0NB 3SD5A 3BY4B 2FCNA 4FJVB 1YIWA 3V62A 4CHKA 2KWVB 3VXWA 1E8WA 2ZVOA 2DZJA 3IG3A 4I6NB 3X23A 3ENEA 3RULA 4IC7B 3JSVA 3RZWC 4NJ6A 3U7DA 3EHVA 1WXSA 2KWCA 3WAMA 4ICUA 2LWPA 1WMHB 3PREA 4ANUA 2KQ7A 4GOCA 1WX9A 3JVZX 2KANA 1WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XT9 B;  2ZNV C;  4M0W B;  2C7N B;  3LJ3 A;  3AXC A;  2JF5 A;  5D2M B;  2VRR B;  3MHS D;  4MGI E;  4MJS B;  3VTW A;  4PYZ A;  1E7U A;  1RLF A;  3A1Q A;  3RYT A;  2EMT A;  2FAZ A;  1NDD A;  2PJH A;  5J2R A;  4FUL A;  2KFK B;  4BBN C;  3K9O B;  3N32 A;  3NOB A;  4W9F A;  4HJK A;  1KJT A;  3APF A;  4PS8 A;  3VVW B;  2R2Q A;  1WIA A;  3HM6 X;  4KV2 A;  4HLE A;  2REX A;  3UF8 A;  2G3Q B;  4WJP A;  1WM2 A;  2YLM A;  3W1S A;  2KX0 A;  4BFR A;  4AUQ C;  2NPT A;  2DAF A;  3KUD B;  1OTR B;  3N30 A;  4K7S A;  4NJ7 A;  4K1R B;  3R7R A;  4MSQ B;  1SGH A;  2KTR B;  1WYW B;  4K7W A;  4HDO A;  4DWF A;  2UYZ B;  4WJQ A;  1V5O A;  3PRZ A;  5DPR A;  5C23 A;  4AJY B;  4BOZ B;  5JH5 C;  3HM3 A;  1V81 A;  4OVU A;  4WWO A;  2NBW B;  4B95 A;  4K81 A;  1Q5W B;  3S2A A;  1EUV B;  5LXI B;  4NPN A;  4TQ1 A;  3ZUN A;  2DZK A;  5CTR C;  1WXV A;  2JUO A;  4HXD A;  5L83 A;  3UQA A;  2BWF A;  4KZC A;  1OEY A;  4ANV A;  2D07 B;  2FCS A;  3JSV B;  4E3C A;  4KDI C;  2MWS B;  4F1S A;  1E8Z A;  2C9W B;  1KLV A;  4FBJ B;  4B6W A;  1C3T A;  2ZPN A;  5LXH A;  4XZ4 A;  4JQW C;  3DCG A;  4NY0 A;  3WA0 A;  2KC1 A;  3DVN U;  4W9E A;  3ZIM A;  2CU1 A;  5DCN A;  4PS3 A;  3M3J A;  4GXB A;  5DPW A;  1WJU A;  3L17 A;  2O6V B;  4WJN A;  5E6P A;  4ZRJ A;  2G4S A;  4DHZ B;  1UBI A;  3VH3 B;  2M8S A;  3WAO A;  4XC2 A;  4II2 B;  2GBK A;  2WYQ A;  4MJS A;  5HKH A;  4HPM B;  4NAW A;  3T8M A;  3A1Q B;  4G50 A;  4HCN B;  4DHZ E;  2LVQ A;  4HDQ A;  1H4R A;  4AWJ A;  3QIJ A;  4JIO U;  2XK5 A;  4FHK A;  3PTF C;  4KSL C;  2G4D B;  2WDT B;  3ML8 A;  2KQS A;  4NNJ B;  2FNJ B;  4IUM B;  3RD2 A;  3HHM A;  2KJ6 A;  2KXJ A;  1UH6 A;  1V9J A;  3KVF B;  4NQK E;  2M4N A;  3PPA A;  3D32 A;  2LXC A;  3L16 A;  4FA6 A;  1IYF A;  2NPT B;  2KDB A;  3ZDT A;  3Q3F A;  4IM0 A;  2KLC A;  1P1A A;  1OGW A;  4HVB A;  3WAN A;  3ZKJ C;  4FLH A;  4ICV A;  4KZ0 A;  3EFU A;  5AZH A;  2KOX A;  2NVU I;  2Z0D B;  3AI5 A;  2KJR A;  1R4M I;  4MM3 A;  3VFK A;  4EEW A;  3SU8 X;  4GB9 A;  1R4N I;  3B08 A;  2MBO A;  4FN2 A;  1RRB A;  2KO3 A;  3P2B A;  3ZTC A;  2BF8 B;  4W9C A;  5G2N A;  1AAR A;  2CKH B;  3ZRC A;  1UZX B;  4AJW A;  3H9D A;  3BIN A;  4F8C B;  1LM8 B;  1UD7 A;  1WX7 A;  3OAW A;  2JRH A;  1OQY A;  2W9N A;  3WIM A;  2KZR A;  4MGY E;  2AYO B;  4DK5 A;  3VQI A;  1JRU A;  2L0F A;  3DDC B;  2IO1 B;  2PPH A;  2PE6 B;  4W9G A;  4E71 A;  3QCA A;  3PS6 A;  2K6D B;  2A5U A;  2FUH B;  3ALB A;  2N1W A;  4LDT B;  1E8X A;  4TUU A;  2MBQ A;  3PLV A;  4IW0 A;  2J0M A;  3ZNG C;  2LRU A;  4AOF A;  3V61 A;  3KH0 A;  2Z0E B;  4YL8 A;  2EKE C;  4W9J A;  3DVG Y;  4X57 B;  3GZN I;  2XBB C;  2FIF A;  5JHB A;  4EKU A;  3PVL A;  3AU5 A;  3VDZ A;  2NBV B;  2HJ8 A;  4ZYN A;  2KKC A;  2O6V A;  1BT0 A;  2RGF A;  4NAW B;  2ZCC A;  3PLU A;  5L95 C;  2C5L C;  2D11 A;  4EZK A;  1OEY J;  2XK5 B;  3KUC B;  5CHV C;  1WZ0 A;  3RCZ A;  3IHP C;  3PRP B;  3HIZ A;  4CO7 A;  3N3K B;  2HTH A;  1WGY A;  2L3Z A;  1HE8 A;  2K39 A;  2PE9 A;  1V6E A;  2I1K A;  1KM7 A;  2R2O A;  3U30 A;  3NZU A;  4BBN F;  4RM9 A;  3TCA A;  3TL5 A;  3VUX A;  4GDK A;  4TV3 A;  3R66 C;  1E5W A;  3KUZ A;  4WJO A;  1ZGU B;  2FCM A;  2KK8 A;  2GBR A;  3IBE A;  1YQB A;  3QC8 B;  1Q0W B;  2DAJ A;  1U4A A;  2L76 A;  2K1F A;  3CSF A;  2M17 A;  1I35 A;  3H1U A;  4ASW C;  3APD A;  2JXX A;  4II3 B;  3WAL A;  2KD0 A;  2KMA A;  2ZNV B;  3AU4 A;  2IO3 B;  5AZG A;  3L10 B;  3B0A A;  1FXT B;  4FHJ A;  1WGG A;  4ANW A;  3VUY A;  5AZF A;  1UBQ A;  1Y8R C;  2LZ6 A;  1WF9 A;  1YX6 B;  3IVF A;  3L0W B;  1RFA A;  3U8Z A;  1WE7 A;  3DVN V;  3PZD A;  1P9D U;  1NBF C;  1P3Q U;  1PQS A;  2FID A;  3M63 B;  4HK2 A;  3TMP B;  3ZLZ A;  3R7Q A;  3UQB A;  4IWQ A;  3PRM B;  5JZE B;  3DQV A;  1WGR A;  1LQB A;  1WI0 A;  2MBB B;  4GSW A;  3DOW A;  2C60 A;  2IO0 B;  3GOE A;  5LLI A;  3PSE B;  1D3Z A;  3L08 A;  4IM3 A;  5DPS A;  2GMI C;  1LXD A;  2BYV E;  3QX1 A;  2HD5 B;  3KW5 B;  1VCB A;  5GMV A;  3B1L X;  1KOT A;  1WM3 A;  1X1M A;  1WR6 E;  3H6N A;  4JLC A;  5J17 A;  4MEL A;  4XX5 A;  2NR2 A;  2LRW A;  4WWN A;  4K7U A;  4HWI B;  1YJ1 A;  3VUW A;  5E6O A;  3R3M A;  4EZJ A;  2AWT A;  2ZVN A;  2N4F A;  1L7Y A;  2B3A A;  3UGB B;  2M0X A;  2JT4 B;  4A20 A;  4BKG A;  4ZDV A;  3ZO5 B;  4ZRK A;  2MBE A;  2OOB B;  1GJZ A;  4GMV A;  4PS7 A;  5D94 A;  1I42 A;  3SHQ A;  3APC A;  3O65 B;  3PV1 A;  2ZCB A;  2NCN A;  3VH4 B;  2BKR B;  4KDL B;  2BYF A;  3TJP A;  1WGH A;  1TZ1 A;  1J8C A;  3EC8 A;  2MQJ A;  1TTN A;  2NBU A;  5FR6 A;  4BOS C;  1GG3 A;  5D6J B;  4GDK B;  3KYC D;  4W9H A;  2V4L A;  2N9P C;  1T0Y A;  3DBR I;  3ZRF A;  3MTN B;  4GGQ A;  3A9K A;  3QAQ A;  2IYD B;  1RAX A;  2J7Q B;  2JPH A;  2V1Y A;  3DBS A;  1WGD A;  2CR5 A;  3WAP A;  1TBE A;  1EO6 A;  4GU2 A;  2KX3 A;  3V60 A;  2J0K A;  2BGF A;  1WRD B;  1E8Y A;  4BVU C;  2LJ5 A;  2HE7 A;  4P7I A;  2DYO A;  1CMX B;  5DPT A;  2FCQ A;  1WX8 A;  3JW0 X;  2MA9 B;  2KNB A;  4RM8 A;  1K8R B;  1SE9 A;  2BYE A;  1UGM A;  1YD8 U;  2RSU A;  4HCP B;  4TQ0 A;  3A33 B;  2L8J A;  2WX1 A;  4IM2 A;  4MGK E;  3OLM D;  3QJZ A;  2GBJ A;  2WX0 A;  4URK A;  3AUL A;  2C7H A;  2KN5 A;  5KHQ A;  4WWP A;  1NI2 A;  2DYM A;  4FJZ A;  1V80 A;  3UIP B;  2YVC A;  2LUE A;  4W9L A;  4JGH B;  4BKS D;  2KC2 A;  2KLG A;  3CST A;  1WE6 A;  3LDZ E;  1V49 A;  2JWZ A;  2OJR A;  1WY8 A;  1ZKH A;  3CMM B;  3ZNZ B;  4DXA B;  5JHA A;  3QHT A;  3UIO B;  4GIV A;  3SDL C;  2AEH A;  2K8C A;  2MSE D;  3DBH I;  2CHZ A;  1J19 A;  5EDS A;  3M95 A;  2MRP A;  4PYU A;  3UIN B;  1S1Q B;  2KDI A;  3PGE A;  4DHJ D;  3QA8 A;  2NS5 A;  4E74 A;  3NY5 A;  3NZS A;  1IPG A;  2Z59 B;  1WXM A;  2IY1 B;  3A9J B;  5KHO A;  1E90 A;  3ECI A;  4J6I A;  5BO4 B;  3QWZ B;  5AEK B;  2DZI A;  1L2N A;  4ZRI A;  3VTV A;  4I6L B;  2EMS A;  2GOW A;  2KMC A;  2O2V A;  2N7E A;  1GNU A;  4AP4 C;  4EOY A;  3H7P A;  2DX5 B;  2LGX A;  3A9K B;  4BKS A;  2BKF A;  2K8H A;  1WZ3 A;  4KIK A;  5D7G A;  2ASQ A;  2L00 B;  2KDF B;  1V5T A;  1V86 A;  2D10 A;  2N1V A;  4I6P A;  3TBL D;  2CHW A;  2I1J A;  2N9X A;  2ZZP B;  3K9P B;  3T9L A;  3QK0 A;  4N9F 4;  5G55 A;  3V6C B;  1XQQ A;  3ZTD A;  4G11 A;  4LJP B;  2AL6 A;  3ONS A;  4MSM B;  2IY0 B;  1WJN A;  4MH0 E;  3ZVV A;  4A3O A;  4GDL A;  2ZEQ A;  3OJ3 A;  2D2Q A;  1Z5S B;  2KDE B;  4FAD A;  1SIF A;  2LD9 A;  2KTF A;  2IBI B;  3ZNH B;  4A3P A;  1G6J A;  3CF6 E;  4LCD E;  4EFO A;  1J0G A;  1ZW7 A;  1TGZ B;  2N7D A;  4LDT D;  4DDG D;  4BKT A;  2N9E B;  2RPQ A;  2MP2 A;  1MG8 A;  3QQ8 B;  4W9D A;  4ANX A;  4IWP A;  5CHW A;  3DVG X;  2J0J A;  1WFY A;  3RUI B;  2LGY A;  3W1Y A;  3TIX A;  2LGD A;  4KSK C;  4MGZ E;  5J18 A;  4M8M A;  2GBM A;  2LVO A;  4B9K A;  3PHX B;  2DZM A;  4TKN A;  1M94 A;  2Y5B B;  2L05 A;  3VTU A;  3JYU A;  4W9I A;  2L7R A;  3VHT C;  4IWO A;  4F7Z A;  2DHZ A;  1YX5 B;  2KJH B;  3Q3J A;  3V6E B;  2K8B A;  1H8C A;  4MDK E;  2DYB A;  3H7S A;  1QZE A;  2CS4 A;  2PEA A;  3RZF A;  3W1S C;  3ZNI D;  2KHW B;  2BWE S;  2K6Q A;  3VAW A;  1C1Y B;  2KVR A;  3ZDM C;  2D3G A;  1GUA B;  2A4Z A;  1WMH A;  3A4S C;  1GC7 A;  2XEW A;  3X0W A;  3A9J A;  4M8N A;  4GN1 A;  5CHF A;  2V3S A;  3I3T B;  5C1Z A;  4DBG A;  4DDI D;  3PT2 B;  2RD0 A;  4RMA A;  3KYD D;  5IAA C;  3MJW A;  3NHE B;  3RT3 B;  2O2V B;  5TR5 A;  4LJO B;  1LFD A;  5IA7 A;  2ZJD A;  2JY6 A;  3H7P B;  3PHW B;  4EZL A;  1A5R A;  1Z2M A;  2KWU B;  1ISN A;  1GC6 A;  3L13 A;  3M62 B;  3NS8 A;  2MBH A;  4KIK B;  2MW5 A;  1IP9 A;  1V2Y A;  2IZV B;  4JL9 A;  2LAS A;  3QAR A;  1WJ6 A;  2AL3 A;  4WAA A;  2CHX A;  2JZZ A;  3ZW3 A;  3ML9 A;  1UEL A;  1EF1 A;  4DHJ B;  2WWZ A;  3C0R B;  2KFK A;  2G45 B;  2KFJ A;  3DBL I;  2C7M B;  2K25 A;  4FJY A;  4GDL B;  2MX2 A;  1WXA A;  1XD3 B;  4IG7 B;  2MCN B;  3A4R A;  3HK0 A;  2LI5 A;  2JZ3 B;  1Q1O A;  2UWQ A;  1P0R A;  1VD2 A;  1WH3 A;  2DEN B;  2JRI B;  3IFW B;  4HPL B;  4OVV A;  2MP2 B;  2BPS A;  1E7V A;  5CX3 A;  4CYE A;  2JVC A;  2QHO A;  1EF5 A;  2KTR A;  3DPD A;  1F9J A;  2LVP A;  4MEM A;  5E6N A;  4G3X B;  2ZPY A;  3OJ4 B;  4WQO B;  2LXA A;  3EEC A;  4NQL B;  2L0T A;  1S3S G;  2MLB A;  2O6V D;  2IO2 B;  3L54 A;  4KVG B;  2M1M A;  2GBN A;  4W9K A;  4EUT A;  1P98 A;  2RR9 A;  1WR1 A;  4G0N B;  3SD5 A;  3BY4 B;  2FCN A;  4FJV B;  1YIW A;  3V62 A;  4CHK A;  2KWV B;  3VXW A;  1E8W A;  2ZVO A;  2DZJ A;  3IG3 A;  4I6N B;  3X23 A;  3ENE A;  3RUL A;  4IC7 B;  3JSV A;  3RZW C;  4NJ6 A;  3U7D A;  3EHV A;  1WXS A;  2KWC A;  3WAM A;  4ICU A;  2LWP A;  1WMH B;  3PRE A;  4ANU A;  2KQ7 A;  4GOC A;  1WX9 A;  3JVZ X;  2KAN A;  1WJ4 A; 
#chains in the Genus database with same CATH topology
 4M0W B;  3LJ3 A;  2JF5 A;  1T0Q C;  3MHS D;  4MJS B;  1C4A A;  4MT5 A;  3MHZ A;  3RYT A;  2PJH A;  2KFK B;  3K9O B;  4PS8 A;  1WIA A;  3UF8 A;  1EM7 A;  3BZD B;  3IT6 B;  1WM2 A;  4AUQ C;  2DAF A;  3N30 A;  3KWV A;  4Q2J A;  1I4Q A;  1WYW B;  4DWF A;  4WJQ A;  5DPR A;  1V5O A;  1UWM A;  1V81 A;  4HRO A;  4OVU A;  3VR8 B;  3AED B;  1DOX A;  4K81 A;  2LGS A;  1STE A;  4NPN A;  4L23 A;  2DZK A;  3BK1 A;  2DLB A;  1ENF A;  2AQ2 B;  3AEG B;  3ABV B;  1B1Z A;  2X38 A;  4KDI C;  2MWS B;  4XZ4 A;  2IDY A;  5IO9 A;  4W9E A;  3ZIM A;  5DCN A;  4PS3 A;  2PLP A;  2B76 B;  1UBI A;  1N61 A;  2GBK A;  5HKH A;  4HPM B;  3A1Q B;  1OFF A;  4HDQ A;  1L0Y B;  3QIJ A;  1LGR A;  1J7A A;  2WDT B;  2KQS A;  4NNJ B;  2V0G A;  2FNJ B;  3GS2 A;  1UH6 A;  5H8Y E;  1L5P A;  4NQK E;  3BVM A;  3L16 A;  2KDB A;  3ZDT A;  1R4M B;  2W82 A;  3SEB A;  5JXV A;  1OGW A;  1TIF A;  1XCQ L;  1ZDX A;  1ZDV A;  3EFU A;  3P63 A;  3AI5 A;  1KTK A;  3VFK A;  1R4N I;  4FN2 A;  1RRB A;  3IT4 B;  3ZTC A;  2BF8 B;  5G2N A;  3ZRC A;  2CKH B;  4AJW A;  1WX7 A;  4MGY E;  1I4X A;  1JRU A;  3DDC B;  2PPH A;  4E71 A;  2MEK A;  2K6D B;  2A5U A;  4TUU A;  4IW0 A;  2LRU A;  4AOF A;  3V61 A;  3E56 A;  4W9J A;  1T3Q A;  1JWM D;  2IGG A;  1TKE A;  3MC0 B;  3PVL A;  2O6V A;  3TSS A;  4WUR A;  4NAW B;  3CWI A;  3AE5 B;  1NVI D;  1FFU A;  5L95 C;  3B2G A;  4EZK A;  3RCZ A;  1C77 A;  1RM6 C;  1V1P A;  2L3Z A;  1QOG A;  4BBN F;  4RM9 A;  3TL5 A;  1ZGU B;  2WXQ A;  3QC8 B;  3IBE A;  4ZRQ A;  3GE3 C;  5MPO A;  2WXK A;  2K1F A;  3CSF A;  3NJT A;  3H1U A;  2KAJ A;  1AN8 A;  1MPE A;  5AZG A;  3VUY A;  1Y8R C;  3DVN V;  1SIJ A;  1P9D U;  3PRM B;  3BII D;  4REZ A;  1F1H A;  5EE1 A;  4C00 A;  5LLI A;  1HZ6 A;  1SE3 A;  1JAL A;  1N6Z A;  5DPS A;  2GMI C;  2HD5 B;  1KOT A;  1WR6 E;  4MEL A;  4XX5 A;  2UU7 A;  3Q8C A;  3UGB B;  2JT4 B;  4XE0 A;  2MBE A;  4GMV A;  4PS7 A;  1I42 A;  1QIL A;  3APC A;  3IXS A;  3O65 B;  2ZCB A;  4IDI A;  4K3C A;  1TTN A;  2NBU A;  3PZ7 A;  3EUB 2;  3DBR I;  1SB3 C;  5G5H A;  4ZYS A;  3DBS A;  3I5J C;  1T0S C;  1EO6 A;  4GU2 A;  1WRD B;  4BVU C;  2HE7 A;  2DYO A;  5DPT A;  2FCQ A;  2KNB A;  1FO4 A;  2M0A A;  1IBX A;  1YD8 U;  2RSU A;  3OLM D;  3B9J A;  2GBJ A;  3QJZ A;  3GP7 A;  2JXT A;  2SEB D;  2C7H A;  4L2Y A;  1NI2 A;  3NVW A;  1ROE A;  3B2F A;  1YMH E;  4RGO S;  1N5W A;  2FE8 A;  3CST A;  2D5G A;  1V49 A;  1CQV A;  1ZKH A;  3CMM B;  5JHA A;  3ZXV A;  3QHT A;  1CZP A;  4KGS A;  3DBH I;  1OQR A;  1S1Q B;  3PGE A;  2BQQ A;  2Z59 B;  3AE1 B;  3ECI A;  3WCQ A;  3QWZ B;  5AEK B;  3U2S C;  2JSV X;  4EOY A;  4AP4 C;  1FPY A;  2BKF A;  1RFK A;  2FUG 1;  3I57 A;  1WZ3 A;  5D7G A;  2ASQ A;  3TBL D;  2D10 A;  1V86 A;  2N1V A;  2I1J A;  2N9X A;  1WXQ A;  3K9P B;  1TS2 A;  1SSN A;  4LJP B;  2AL6 A;  1K52 A;  4GDL A;  2EEL A;  2ZEQ A;  3BVZ A;  1FMA D;  2L83 A;  2KTF A;  2IBI B;  1G6J A;  1TGZ B;  1MG8 A;  2ACZ B;  3AE3 B;  5CHW A;  3DVG X;  3W1Y A;  5FKA C;  2LGD A;  4KSK C;  5J18 A;  4HRS A;  4B9K A;  1XLP A;  2DZM A;  4TKN A;  3URY A;  2J42 A;  3JYU A;  2L7R A;  4IWO A;  4F7Z A;  2EKI A;  1H8C A;  3ZNI D;  2BWE S;  1VDV A;  2KT7 A;  3ZQ4 A;  1EWY C;  1GUA B;  3X0W A;  2XEW A;  2WU5 B;  2VH1 A;  3DHG C;  2JWU A;  4M0W A;  2PIA A;  2E3T A;  3RT3 B;  3NHE B;  4HPP A;  5IA7 A;  2ZJD A;  3PHW B;  1A5R A;  2KWU B;  1ISN A;  3BWU D;  2MW5 A;  2R61 A;  4OZA A;  1WRI A;  3VRB B;  4JL9 A;  4WAA A;  2CHX A;  2JZZ A;  4JWU C;  1TS5 A;  1UEL A;  2LHE A;  1EF1 A;  3C0R B;  2OJW A;  2KFK A;  2G45 B;  2KFJ A;  1MVK A;  4FJY A;  2K25 A;  1YN3 A;  3A4R A;  3HK0 A;  2OHF A;  1XEE A;  1P0R A;  4HPL B;  2MJD A;  2MP2 B;  1GB1 A;  1FCC C;  2JVC A;  2QHO A;  2K0P A;  2LVP A;  1GB4 A;  1VJK A;  2ZPY A;  5T8I A;  1SJE D;  2WXM A;  1S3S G;  2O6V D;  4W9K A;  3AEA B;  4NJC A;  1BXT A;  3BY4 B;  4FJV B;  1YIW A;  5I4D A;  3W5U B;  2ZVO A;  3X23 A;  2WXP A;  4C4V B;  2LWP A;  3PRE A;  4GOC A;  5IKC M;  3BIN A;  2KAN A;  1WJ4 A;  2ZNV C;  2C7N B;  4KX6 B;  1XXG A;  1HA5 A;  3FIL B;  3RNG C;  1E7U A;  3A1Q A;  2YEP F;  1FCL A;  3ETR A;  1ZOY B;  2FAZ A;  5J2R A;  4FUL A;  4BBN C;  4W9F A;  3NOB A;  3VVW B;  4YT0 B;  4KV2 A;  4HLE A;  1K50 A;  2REX A;  2G3Q B;  2YLM A;  4J3O D;  3W1S A;  2KX0 A;  4BFR A;  1UWX A;  3KUD B;  4NJ7 A;  4P1C C;  3R7R A;  1IUE A;  1NEK B;  5GXG B;  4K7W A;  2UYZ B;  4AJY B;  3PRZ A;  5C23 A;  4RF0 A;  3HM3 A;  2FBW B;  3Q69 A;  2NBW B;  1T5X D;  1EUV B;  5LXI B;  1YJI A;  2WXR A;  3ZUN A;  2WDV B;  5CTR C;  1WXV A;  5D3I B;  2QIE B;  3UQA A;  4KZC A;  4ANV A;  1UF0 A;  3NG0 A;  4F1S A;  2Y5C A;  1N60 A;  1C3T A;  4JWS C;  4NY0 A;  3DVN U;  3L4P A;  2CU1 A;  3N1X C;  1WJU A;  2RDG A;  4ZRJ A;  3VH3 B;  2GRI A;  4NAW A;  3OWE B;  1C79 A;  4G50 A;  4HCN B;  2LVQ A;  4AWJ A;  1H4R A;  3PTF C;  3TEY A;  1D4B A;  3HHM A;  1FNV A;  1QOA A;  1JRO A;  1SXT A;  2LXC A;  4FA6 A;  2NPT B;  2INP E;  3TUO A;  3AB5 A;  2KLC A;  4IM0 A;  3SFD B;  3R2I A;  5BMH A;  3C8Y A;  1L0V B;  1R4M I;  3SU8 X;  3B08 A;  1I4H A;  1L4Z B;  4F8C B;  1I4R A;  1UD7 A;  3ZGZ A;  3OAW A;  1YJJ A;  2KZR A;  4WWM A;  2L0F A;  2IO1 B;  4HKQ A;  2H89 B;  3QCA A;  2FUH B;  1E8X A;  2RDH A;  2KAC A;  4YL8 A;  3GZN I;  2XBB C;  1QT9 A;  2WGS A;  4EKU A;  2HJ8 A;  2KKC A;  2MJ3 A;  1ZXH A;  2ZW1 A;  4B0E A;  2RGF A;  2C5L C;  1QF6 A;  2JX5 A;  3LXF A;  3N3K B;  1RYJ A;  2HTH A;  1XLO A;  2E6X A;  3U30 A;  3TCA A;  3VRA B;  1FEH A;  4WJO A;  3R66 C;  2FCM A;  1YQB A;  1Q0W B;  4YSZ B;  4ZHP A;  4LLG M;  1I35 A;  3APD A;  4DXF A;  4II3 B;  4MM3 B;  1E6E B;  2KD0 A;  5BYS A;  3AU4 A;  2NTT A;  3L10 B;  3B0A A;  1NI3 A;  2LZ6 A;  1WF9 A;  1YX6 B;  3L0W B;  3MP9 A;  3RNC C;  1WE7 A;  3TMP B;  1NBF C;  1P3Q U;  3ZLZ A;  3NVY A;  1ZUD 2;  1LQB A;  3DOW A;  2C60 A;  4M00 A;  2D3C A;  1PYW D;  1LXD A;  3QX1 A;  1WM3 A;  1X1M A;  4A6Q A;  1JML A;  3C19 A;  2WXN A;  4HWI B;  1YJ1 A;  3Q2A C;  2ZVN A;  2WNM A;  4BKG A;  4ZDV A;  3R2T A;  1L0X B;  4WIP A;  1GJZ A;  5D94 A;  3SHQ A;  1YN5 A;  3PV1 A;  3RNF C;  2BKR B;  4KDL B;  2BYF A;  1J8C A;  1PGX A;  4EE2 A;  4BOS C;  1GG3 A;  5D6J B;  3KYC D;  1MHX A;  3ZRF A;  3QAQ A;  3U52 E;  2J7Q B;  1RAX A;  4AQ7 A;  2CJN A;  4IOI E;  2JZP A;  1E8Y A;  5IP4 D;  1TKG A;  2BTE A;  3NVV A;  1CMX B;  1WX8 A;  2MA9 B;  3R8B A;  3P42 A;  4L1B A;  2L8J A;  4MGK E;  2WP9 B;  3NZ3 A;  2WX0 A;  2L1A A;  4AS1 A;  5KHQ A;  1TY2 A;  4FJZ A;  4BKS D;  3GB1 A;  3LDZ E;  2JWZ A;  3P4S B;  1CJE A;  4KKJ A;  3UIO B;  4GIV A;  1J7C A;  2G1E A;  2K8C A;  4KGT A;  1J19 A;  4PYU A;  3KWL A;  3UIN B;  2KDI A;  4DHJ D;  3NY5 A;  1ZPS A;  1WXM A;  2IY1 B;  5KHO A;  4XGA B;  4J6I A;  5BO4 B;  4TMA B;  2WXL A;  3VTV A;  1BML C;  4I6L B;  2GOW A;  2DX5 B;  2LGX A;  2J52 A;  3A9K B;  1DOY A;  1HQR D;  2LUM A;  2WHI A;  2CHW A;  2ZZP B;  1GPX A;  1L4D B;  3V6C B;  4HEA 1;  3ONS A;  2NTS A;  1JWU D;  3ZVV A;  2CJO A;  4LNK A;  2LD9 A;  3FAH A;  3ZNH B;  3CF6 E;  1J0G A;  4K3B A;  1ZW7 A;  2N9E B;  2MP2 A;  2WQY B;  3QQ8 B;  4ANX A;  4IWP A;  1V97 A;  4WAF A;  2VZK B;  2J0J A;  1WFY A;  4RH6 A;  3RUI B;  4M8M A;  1OQQ A;  2GBM A;  3UI3 A;  2WXJ A;  1SJH D;  3VTU A;  4W9I A;  3VHT C;  2BT6 A;  1WWT A;  2KJH B;  3V6E B;  2DYB A;  3RZF A;  2CS4 A;  2PEA A;  3TEW A;  2KHW B;  2BVC A;  4C4V A;  1HTO A;  1N5X A;  3A9J A;  4M8N A;  5C1Z A;  4DBG A;  4DDI D;  3PT2 B;  2RD0 A;  2KDM A;  4LJO B;  5TR5 A;  2JY6 A;  2LGI A;  4EZL A;  3L13 A;  3Q8E A;  3NS8 A;  2JQR B;  1B9R A;  1V2Y A;  3FIL A;  2LFI A;  3DBL B;  2AL3 A;  1C4P A;  3ML9 A;  3BK2 A;  4H2A A;  2MX2 A;  1WXA A;  2MCN B;  2LI5 A;  2UWQ A;  3Q8F A;  2JRI B;  3RNA C;  2HDE A;  2BPS A;  4C56 C;  1F2R I;  1R4N B;  3AEB B;  1AW7 A;  4N6E B;  1UUP A;  4MEM A;  4G3X B;  4LNF A;  2L0T A;  2MLB A;  3L54 A;  2IO2 B;  4WQM A;  1I7H A;  2BYT A;  1P98 A;  1TS3 A;  1V8C A;  1WR1 A;  4G0N B;  3SD5 A;  4CHK A;  1C76 A;  2KWV B;  3IG3 A;  1E0Z A;  5C2T B;  3RZW C;  2K22 A;  3U7D A;  4UDU C;  1WXS A;  4ICU A;  4YTN B;  1WX9 A;  3N1Y C;  1JWB D;  2I2Y A;  5D2M B;  2ICI A;  2VRR B;  1KF6 B;  4OVZ A;  2JYE A;  1DOI A;  3VTW A;  1D5X C;  2QSD A;  4PYZ A;  2EMT A;  2PMV A;  1NDD A;  1KJT A;  4N59 A;  3HM6 X;  1PFD A;  2NPT A;  4K1R B;  4MSQ B;  1R7S A;  1SGH A;  3MC8 A;  1WYG A;  4BOZ B;  2BS2 B;  4B95 A;  5FR3 A;  5HFY A;  1Q5W B;  4TQ1 A;  5L83 A;  1JWA D;  2IJ0 A;  2BWF A;  1OEY A;  3MFG A;  2FCS A;  3RFZ B;  2WDQ B;  2C9W B;  1KLV A;  1AYF A;  3P4Q B;  4JQW C;  3WA0 A;  2BB5 A;  2G9H D;  2KC1 A;  2QIL A;  2GLS A;  3Q3M C;  3M3J A;  4GXB A;  3L17 A;  2O6V B;  4WJN A;  2G4S A;  1D5M C;  1F2R C;  3U4E G;  4RGT A;  4XC2 A;  2WYQ A;  4MJS A;  4DHZ E;  4GLS C;  1LO5 D;  2J4X A;  3J9C A;  4JIO U;  4OZB A;  3E9S A;  4FHK A;  4KSL C;  3ML8 A;  1SE4 A;  4IUM B;  3OG5 A;  3DBR B;  3RD2 A;  4JX1 C;  3AEF B;  3KVF B;  2K5P A;  2M4N A;  1IYF A;  4QAY A;  3Q3F A;  3BYT B;  4XDD A;  1P1A A;  4HVB A;  2WS3 B;  3ZKJ C;  2MJE A;  4KZ0 A;  2WXG A;  2Z0D B;  4MM3 A;  5D3D A;  2X8X X;  4C7Y A;  2MBO A;  3AE6 B;  1SBB B;  1AAR A;  1UZX B;  1LM8 B;  5BMG A;  4PT5 A;  2JRH A;  1OQY A;  2W9N A;  4DK5 A;  3Q6B A;  3HVZ A;  3RNB C;  4W9G A;  5BMI A;  2JYT A;  1N62 A;  4LDT B;  3ALB A;  1FD6 A;  2MBQ A;  3PLV A;  2AQ3 B;  2J0M A;  3ZNG C;  3KH0 A;  4DQO C;  1XLN A;  4MAC A;  2CU3 A;  3DVG Y;  3NS1 A;  2FIF A;  3GE8 C;  3VDZ A;  2NBV B;  4ZYN A;  1NEN B;  3LB8 C;  4YXD B;  2ZCC A;  3PLU A;  3N1Z C;  1A70 A;  2XK5 B;  3KUC B;  3HIZ A;  4CO7 A;  2TSS A;  1WGY A;  1F0Z A;  2K39 A;  1V6E A;  1KM7 A;  2R2O A;  3NZU A;  3VUX A;  4TV3 A;  1E5W A;  3KUZ A;  1AWD A;  2GBR A;  2KK8 A;  3NRZ A;  1FM0 D;  4LNO A;  2L76 A;  4S0R A;  4ZOH C;  5AUI A;  2M17 A;  3WAL A;  3EFC A;  2KMA A;  2ZNV B;  2IO3 B;  3EA6 A;  1FXT B;  4FHJ A;  1WGG A;  2QDF A;  1PDX A;  4ANW A;  5AZF A;  3IVF A;  1C78 A;  1RFA A;  3U8Z A;  3PZD A;  1PQS A;  1WSP A;  3R7Q A;  2QEJ C;  3LYY A;  4IWQ A;  3UQB A;  5JZE B;  1WI0 A;  4HKZ E;  2MBB B;  4GSW A;  3T3O A;  2IO0 B;  3PSE B;  1E9M A;  5TSS A;  4JPS A;  3L08 A;  2OED A;  2GB1 A;  5GMV A;  3B1L X;  4JLC A;  5HHD G;  5J17 A;  2L32 A;  2BW2 A;  2KVZ A;  1SEB D;  2LRW A;  4WWN A;  1HTQ A;  4K7U A;  4P6V F;  4LNN A;  5E6O A;  3R3M A;  4EZJ A;  4USA A;  2B3A A;  2M0X A;  3ZO5 B;  4ZRK A;  2OOB B;  1JW9 D;  5IOI A;  4CQN A;  5E6J A;  1VZ6 A;  2NCN A;  3H8H A;  3VH4 B;  4RGM A;  1WGH A;  1TZ1 A;  1QOB A;  1EU3 A;  3EC8 A;  2W54 A;  4GDK B;  3RI7 C;  2V4L A;  3ZJT A;  2N9P C;  1T0Y A;  3MTN B;  1KLU D;  3A9K A;  3HVD A;  1MG4 A;  1ZP0 B;  2BB6 A;  2CR5 A;  3WAP A;  3AE4 B;  3AMZ A;  2KX3 A;  1VR9 A;  3IAS 1;  2LJ5 A;  3TEX A;  4RM8 A;  1K8R B;  1SE9 A;  1UGM A;  4TQ0 A;  3A33 B;  4URK A;  3KQ4 A;  1FXA A;  4OHJ A;  2KN5 A;  1ET6 A;  4WWP A;  1V80 A;  3UIP B;  2YVC A;  2DBY A;  1UNS A;  4W9L A;  3AE9 B;  2KC2 A;  2IPK D;  1WE6 A;  1JQ4 A;  2GI9 A;  1WY8 A;  4DXA B;  5EE3 A;  1FXI A;  5EDS A;  1T0R C;  3M95 A;  4FXC A;  4NZL B;  2WXO A;  3P4R B;  1FNU A;  4ZRI A;  4C80 A;  2V9H A;  1ZXI A;  2EMS A;  2KMC A;  2N7E A;  1GNU A;  1MI0 A;  2PKO A;  4M02 A;  4XWW A;  4BZA A;  1VLB A;  4ACF A;  2L00 B;  1V5T A;  2KDF B;  3N20 C;  1XCT L;  3T9L A;  4N9F 4;  5G55 A;  4MSM B;  2INN E;  3AN1 A;  1FNW A;  3OJ3 A;  2D2Q A;  1Z5S B;  2KDE B;  5EE9 A;  4FAD A;  1SIF A;  4A3P A;  2PW9 A;  2Q5W D;  2KYW A;  4LCD E;  4EFO A;  4BKT A;  2KWD A;  2LGY A;  3TIX A;  4MGZ E;  1GOZ A;  3DHH C;  2LVO A;  1FRR A;  2IND C;  3PHX B;  2L05 A;  4NAM A;  2DHZ A;  1YX5 B;  3Q3J A;  2K8B A;  3IAM 1;  1NYR A;  3W1S C;  3MJ5 A;  1C1Y B;  2KVR A;  3V05 A;  3ZDM C;  4C7Z A;  1T6B X;  2A4Z A;  3A4S C;  1GC7 A;  2ON8 A;  2Y5P A;  2V3S A;  4RMA A;  2INC C;  3MJW A;  2O2V B;  1HZ5 A;  3H7P B;  1KFY B;  2MBH A;  4RCO A;  4KIK B;  1IP9 A;  3P4P B;  2LAS A;  3AEC B;  3QAR A;  3ZW3 A;  4LTU A;  4DHJ B;  2WWZ A;  3DBL I;  1XD3 B;  4IG7 B;  2LJI A;  3FKY A;  2JZ3 B;  1Q1O A;  1VZ7 A;  3RMK C;  2MH7 A;  1PUT A;  3HUI A;  1WH3 A;  1YOV B;  4OVV A;  4B0M A;  5IN7 A;  4CYE A;  4KKI A;  1F9J A;  5E6N A;  1VZ8 A;  4WQO B;  1V1O A;  2LXA A;  3EEC A;  4NQL B;  1MHH E;  4US9 A;  4P16 A;  1GAQ B;  3DHI C;  4RNA A;  4KVG B;  2GBN A;  2K3U A;  4EUT A;  3Q3N C;  2RR9 A;  1QQR A;  2FCN A;  3VXW A;  1E8W A;  4A90 A;  4I6N B;  1TT5 B;  1TY0 A;  4M01 A;  3RUL A;  1PGA A;  4IC7 B;  4NJ6 A;  3EHV A;  2KMM A;  2KWC A;  3WAM A;  1WMH B;  3GZN B;  4ANU A;  2KQ7 A;  2IGH A;  4RGN A;  1XT9 B;  1F52 A;  4TSS A;  3AXC A;  2WDR B;  2I38 A;  1D5Z C;  4MGI E;  3AE2 B;  1SF0 A;  1YN4 A;  1RLF A;  2RMM A;  2AX5 A;  1M4V A;  4LNI A;  3N32 A;  4HJK A;  3APF A;  2SAK A;  2R2Q A;  4YSX B;  1XLQ A;  2AQ1 B;  4WJP A;  1I4P A;  1P7F A;  4K7S A;  1OTR B;  2JU6 X;  2KTR B;  4HDO A;  1TYG B;  1TS4 A;  1TJE A;  1KH0 A;  5JH5 C;  1DYQ A;  4WWO A;  3S2A A;  4S17 A;  1N63 A;  1D6E C;  4LK0 M;  2YEP B;  2DNF A;  2JUO A;  4HXD A;  2BS4 B;  2D07 B;  1KLG D;  3JSV B;  4E3C A;  2D3A A;  2D3B A;  3V3X A;  1NYQ A;  1ET9 A;  1KRH A;  1E8Z A;  5LNK 1;  4FBJ B;  4B6W A;  2ZPN A;  5LXH A;  1E10 A;  3DCG A;  3ZJU A;  5DPW A;  5E6P A;  4DHZ B;  2BS3 B;  2M8S A;  3Q14 C;  3WAO A;  4II2 B;  2QCZ A;  3T8M A;  2N9L A;  3RNE C;  2KQ4 X;  2NMQ A;  2XK5 A;  2W3S A;  1JCK B;  2G4D B;  2H88 B;  4XYC A;  4ZRP A;  2KJ6 A;  2KXJ A;  1V9J A;  3PPA A;  3D32 A;  1IGC A;  2VZK D;  1JRP A;  4OZC A;  4ZHO A;  3WAN A;  3ZJV A;  4FLH A;  4ICV A;  3U7Z A;  5AZH A;  2KOX A;  2NVU I;  2KJR A;  3MC9 A;  4EEW A;  2IGD A;  4GB9 A;  2KO3 A;  2WXF A;  3P2B A;  4MH8 A;  4W9C A;  3H9D A;  4RF1 A;  3WIM A;  2AYO B;  3DWG C;  3VQI A;  2PE6 B;  3PS6 A;  1MFW A;  2N1W A;  2QC8 A;  2M19 A;  2Z0E B;  2W55 A;  1FRD A;  2EKE C;  4JE3 B;  1HXY D;  4X57 B;  3I9V 1;  3Q8B A;  2HJ1 A;  3RPF C;  5JHB A;  3AU5 A;  3NVZ A;  2ONQ A;  1BT0 A;  5AUK A;  2WXH A;  2D11 A;  1OEY J;  5CHV C;  1WZ0 A;  3IHP C;  4XDC A;  3PRP B;  1VRA B;  1EU4 A;  1HE8 A;  2PE9 A;  2I1K A;  3HRD D;  2QJL A;  2KN4 A;  4GDK A;  3KLS X;  1L6V A;  2DAJ A;  1U4A A;  3T3N A;  4ASW C;  2JXX A;  2ZW0 A;  1UBQ A;  4OW0 A;  5G5G A;  3I63 C;  4N58 A;  1Q10 A;  1I4G A;  2QMT A;  4HK2 A;  2FID A;  3M63 B;  4WH4 A;  1QKZ A;  5H92 C;  3DQV A;  1WGR A;  4PK1 A;  1JWS D;  3GOE A;  2PVO D;  2LMC A;  1ZE3 D;  1D3Z A;  3FC4 A;  4IM3 A;  2J53 A;  2BYV E;  3O13 A;  3KW5 B;  1C9F A;  1VCB A;  3H6N A;  2NR2 A;  2Y3A A;  2Z8L A;  3VUW A;  2AWT A;  2N4F A;  1L7Y A;  1MJD A;  4A20 A;  4IKG A;  2PVG C;  2VH2 A;  3AM9 A;  1V1P B;  4A8X C;  1K51 A;  3TJP A;  1HEZ E;  2MQJ A;  5FR6 A;  3P1M A;  4W9H A;  5HI1 A;  1YQ3 B;  4GGQ A;  1F77 A;  2IYD B;  2W3R A;  2JPH A;  1EWC A;  2V1Y A;  1WGD A;  1TBE A;  4XWT A;  1Y56 A;  1TZO A;  2HTM E;  5HG2 A;  3V60 A;  2J0K A;  2BGF A;  3N9Y C;  3AE8 B;  4P7I A;  4D2K A;  3JW0 X;  1WGK A;  2L52 A;  3RN9 C;  2BYE A;  4YSY B;  4HCP B;  4IM2 A;  2WX1 A;  4BAX A;  3AUL A;  2DYM A;  1C4C A;  1RWS A;  2LUE A;  4JGH B;  1L6U A;  2KLG A;  3DBH B;  2OJR A;  2N7J A;  3ZNZ B;  1FIQ A;  3SDL C;  2AEH A;  2MSE D;  1ESF A;  2CHZ A;  3PO0 A;  2MRP A;  3QA8 A;  2NS5 A;  4E74 A;  1XF5 L;  3BVG A;  4YTP B;  3NZS A;  4ARC A;  1IPG A;  2BBC A;  3A9J B;  1E90 A;  2DZI A;  4A55 A;  1L2N A;  4KGR A;  1TKY A;  3SFE B;  2O2V A;  2WXI A;  3H7P A;  1IGD A;  3AEE B;  4BKS A;  5FK9 C;  1BUI C;  2K8H A;  4KIK A;  4RFB A;  4I6P A;  3AH7 A;  3QK0 A;  4HJG E;  4YTM B;  1XQQ A;  3ZTD A;  4G11 A;  5EE0 A;  2IY0 B;  1WJN A;  4MH0 E;  4A3O A;  3W9C B;  4R3D A;  2N9K A;  3ZYY X;  1YNT E;  2LEK A;  1IBX B;  2XNA C;  4US8 A;  2V3N A;  3W2D A;  3VR9 B;  4DDG D;  2N7D A;  4LDT D;  2RPQ A;  2V3P A;  4W9D A;  1ACC A;  2RDB C;  1CK1 A;  5BYQ A;  3AE7 B;  1M94 A;  2Y5B B;  3TEZ A;  3CIR B;  4MDK E;  2LHD A;  3H7S A;  1QZE A;  1FFV A;  2K6Q A;  3NUH B;  3VAW A;  1J7B A;  3W5V B;  4DXG A;  2K9X A;  2D3G A;  4O1N A;  5BYR A;  1WMH A;  1SE2 A;  1PGB A;  4GN1 A;  5CHF A;  3I3T B;  3KYD D;  5IAA C;  1YQ4 B;  1LFD A;  5C3J B;  2RPV A;  1Z2M A;  3PZ8 A;  4A9A A;  1GC6 A;  3M62 B;  4ITK A;  1P7E A;  2IZV B;  4P1B C;  1QOF A;  1WJ6 A;  2MHJ A;  1QLB B;  4GDL B;  3SR6 A;  2C7M B;  1VD2 A;  2DEN B;  3IFW B;  3BYY B;  3EGR A;  1E7V A;  3Q8A A;  3Q3O C;  5CX3 A;  1EF5 A;  2KTR A;  3DPD A;  2DWQ A;  2XN9 C;  3OJ4 B;  1UGJ A;  2M1M A;  4ARI A;  1E7P B;  2M56 B;  2WU2 B;  1XO3 A;  3V62 A;  1DGJ A;  2DZJ A;  2PTL A;  4YWG G;  3ENE A;  2V4I B;  3JSV A;  3AV8 A;  2WLB A;  2N0S B;  3JVZ X;  1K53 A;  3ZXR A;  3DWM A; 
#chains in the Genus database with same CATH homology
 1XT9 B;  2ZNV C;  4M0W B;  2C7N B;  3LJ3 A;  3AXC A;  2JF5 A;  5D2M B;  2VRR B;  3MHS D;  4MGI E;  4MJS B;  3VTW A;  4PYZ A;  1E7U A;  1RLF A;  3A1Q A;  3RYT A;  2EMT A;  2FAZ A;  1NDD A;  2PJH A;  5J2R A;  4FUL A;  2KFK B;  4BBN C;  3K9O B;  3N32 A;  3NOB A;  4W9F A;  4HJK A;  1KJT A;  3APF A;  4PS8 A;  3VVW B;  2R2Q A;  1WIA A;  3HM6 X;  4KV2 A;  4HLE A;  2REX A;  3UF8 A;  2G3Q B;  4WJP A;  1WM2 A;  2YLM A;  3W1S A;  2KX0 A;  4BFR A;  4AUQ C;  2NPT A;  2DAF A;  3KUD B;  1OTR B;  3N30 A;  4K7S A;  4NJ7 A;  4K1R B;  3R7R A;  4MSQ B;  1SGH A;  2KTR B;  1WYW B;  4K7W A;  4HDO A;  4DWF A;  2UYZ B;  4WJQ A;  1V5O A;  3PRZ A;  5DPR A;  5C23 A;  4AJY B;  4BOZ B;  5JH5 C;  3HM3 A;  1V81 A;  4OVU A;  4WWO A;  2NBW B;  4B95 A;  4K81 A;  1Q5W B;  3S2A A;  1EUV B;  5LXI B;  4NPN A;  4TQ1 A;  3ZUN A;  2DZK A;  5CTR C;  1WXV A;  2JUO A;  4HXD A;  5L83 A;  3UQA A;  2BWF A;  4KZC A;  1OEY A;  4ANV A;  2D07 B;  2FCS A;  3JSV B;  4E3C A;  4KDI C;  2MWS B;  4F1S A;  1E8Z A;  2C9W B;  1KLV A;  4FBJ B;  4B6W A;  1C3T A;  2ZPN A;  5LXH A;  4XZ4 A;  4JQW C;  3DCG A;  4NY0 A;  3WA0 A;  2KC1 A;  3DVN U;  4W9E A;  3ZIM A;  2CU1 A;  5DCN A;  4PS3 A;  3M3J A;  4GXB A;  5DPW A;  1WJU A;  3L17 A;  2O6V B;  4WJN A;  5E6P A;  4ZRJ A;  2G4S A;  4DHZ B;  1UBI A;  3VH3 B;  2M8S A;  3WAO A;  4XC2 A;  4II2 B;  2GBK A;  2WYQ A;  4MJS A;  5HKH A;  4HPM B;  4NAW A;  3T8M A;  3A1Q B;  4G50 A;  4HCN B;  4DHZ E;  2LVQ A;  4HDQ A;  1H4R A;  4AWJ A;  3QIJ A;  4JIO U;  2XK5 A;  4FHK A;  3PTF C;  4KSL C;  2G4D B;  2WDT B;  3ML8 A;  2KQS A;  4NNJ B;  2FNJ B;  4IUM B;  3RD2 A;  3HHM A;  2KJ6 A;  2KXJ A;  1UH6 A;  1V9J A;  3KVF B;  4NQK E;  2M4N A;  3PPA A;  3D32 A;  2LXC A;  3L16 A;  4FA6 A;  1IYF A;  2NPT B;  2KDB A;  3ZDT A;  3Q3F A;  4IM0 A;  2KLC A;  1P1A A;  1OGW A;  4HVB A;  3WAN A;  3ZKJ C;  4FLH A;  4ICV A;  4KZ0 A;  3EFU A;  5AZH A;  2KOX A;  2NVU I;  2Z0D B;  3AI5 A;  2KJR A;  1R4M I;  4MM3 A;  3VFK A;  4EEW A;  3SU8 X;  4GB9 A;  1R4N I;  3B08 A;  2MBO A;  4FN2 A;  1RRB A;  2KO3 A;  3P2B A;  3ZTC A;  2BF8 B;  4W9C A;  5G2N A;  1AAR A;  2CKH B;  3ZRC A;  1UZX B;  4AJW A;  3H9D A;  3BIN A;  4F8C B;  1LM8 B;  1UD7 A;  1WX7 A;  3OAW A;  2JRH A;  1OQY A;  2W9N A;  3WIM A;  2KZR A;  4MGY E;  2AYO B;  4DK5 A;  3VQI A;  1JRU A;  2L0F A;  3DDC B;  2IO1 B;  2PPH A;  2PE6 B;  4W9G A;  4E71 A;  3QCA A;  3PS6 A;  2K6D B;  2A5U A;  2FUH B;  3ALB A;  2N1W A;  4LDT B;  1E8X A;  4TUU A;  2MBQ A;  3PLV A;  4IW0 A;  2J0M A;  3ZNG C;  2LRU A;  4AOF A;  3V61 A;  3KH0 A;  2Z0E B;  4YL8 A;  2EKE C;  4W9J A;  3DVG Y;  4X57 B;  3GZN I;  2XBB C;  2FIF A;  5JHB A;  4EKU A;  3PVL A;  3AU5 A;  3VDZ A;  2NBV B;  2HJ8 A;  4ZYN A;  2KKC A;  2O6V A;  1BT0 A;  2RGF A;  4NAW B;  2ZCC A;  3PLU A;  5L95 C;  2C5L C;  2D11 A;  4EZK A;  1OEY J;  2XK5 B;  3KUC B;  5CHV C;  1WZ0 A;  3RCZ A;  3IHP C;  3PRP B;  3HIZ A;  4CO7 A;  3N3K B;  2HTH A;  1WGY A;  2L3Z A;  1HE8 A;  2K39 A;  2PE9 A;  1V6E A;  2I1K A;  1KM7 A;  2R2O A;  3U30 A;  3NZU A;  4BBN F;  4RM9 A;  3TCA A;  3TL5 A;  3VUX A;  4GDK A;  4TV3 A;  3R66 C;  1E5W A;  3KUZ A;  4WJO A;  1ZGU B;  2FCM A;  2KK8 A;  2GBR A;  3IBE A;  1YQB A;  3QC8 B;  1Q0W B;  2DAJ A;  1U4A A;  2L76 A;  2K1F A;  3CSF A;  2M17 A;  1I35 A;  3H1U A;  4ASW C;  3APD A;  2JXX A;  4II3 B;  3WAL A;  2KD0 A;  2KMA A;  2ZNV B;  3AU4 A;  2IO3 B;  5AZG A;  3L10 B;  3B0A A;  1FXT B;  4FHJ A;  1WGG A;  4ANW A;  3VUY A;  5AZF A;  1UBQ A;  1Y8R C;  2LZ6 A;  1WF9 A;  1YX6 B;  3IVF A;  3L0W B;  1RFA A;  3U8Z A;  1WE7 A;  3DVN V;  3PZD A;  1P9D U;  1NBF C;  1P3Q U;  1PQS A;  2FID A;  3M63 B;  4HK2 A;  3TMP B;  3ZLZ A;  3R7Q A;  3UQB A;  4IWQ A;  3PRM B;  5JZE B;  3DQV A;  1WGR A;  1LQB A;  1WI0 A;  2MBB B;  4GSW A;  3DOW A;  2C60 A;  2IO0 B;  3GOE A;  5LLI A;  3PSE B;  1D3Z A;  3L08 A;  4IM3 A;  5DPS A;  2GMI C;  1LXD A;  2BYV E;  3QX1 A;  2HD5 B;  3KW5 B;  1VCB A;  5GMV A;  3B1L X;  1KOT A;  1WM3 A;  1X1M A;  1WR6 E;  3H6N A;  4JLC A;  5J17 A;  4MEL A;  4XX5 A;  2NR2 A;  2LRW A;  4WWN A;  4K7U A;  4HWI B;  1YJ1 A;  3VUW A;  5E6O A;  3R3M A;  4EZJ A;  2AWT A;  2ZVN A;  2N4F A;  1L7Y A;  2B3A A;  3UGB B;  2M0X A;  2JT4 B;  4A20 A;  4BKG A;  4ZDV A;  3ZO5 B;  4ZRK A;  2MBE A;  2OOB B;  1GJZ A;  4GMV A;  4PS7 A;  5D94 A;  1I42 A;  3SHQ A;  3APC A;  3O65 B;  3PV1 A;  2ZCB A;  2NCN A;  3VH4 B;  2BKR B;  4KDL B;  2BYF A;  3TJP A;  1WGH A;  1TZ1 A;  1J8C A;  3EC8 A;  2MQJ A;  1TTN A;  2NBU A;  5FR6 A;  4BOS C;  1GG3 A;  5D6J B;  4GDK B;  3KYC D;  4W9H A;  2V4L A;  2N9P C;  1T0Y A;  3DBR I;  3ZRF A;  3MTN B;  4GGQ A;  3A9K A;  3QAQ A;  2IYD B;  1RAX A;  2J7Q B;  2JPH A;  2V1Y A;  3DBS A;  1WGD A;  2CR5 A;  3WAP A;  1TBE A;  1EO6 A;  4GU2 A;  2KX3 A;  3V60 A;  2J0K A;  2BGF A;  1WRD B;  1E8Y A;  4BVU C;  2LJ5 A;  2HE7 A;  4P7I A;  2DYO A;  1CMX B;  5DPT A;  2FCQ A;  1WX8 A;  3JW0 X;  2MA9 B;  2KNB A;  4RM8 A;  1K8R B;  1SE9 A;  2BYE A;  1UGM A;  1YD8 U;  2RSU A;  4HCP B;  4TQ0 A;  3A33 B;  2L8J A;  2WX1 A;  4IM2 A;  4MGK E;  3OLM D;  3QJZ A;  2GBJ A;  2WX0 A;  4URK A;  3AUL A;  2C7H A;  2KN5 A;  5KHQ A;  4WWP A;  1NI2 A;  2DYM A;  4FJZ A;  1V80 A;  3UIP B;  2YVC A;  2LUE A;  4W9L A;  4JGH B;  4BKS D;  2KC2 A;  2KLG A;  3CST A;  1WE6 A;  3LDZ E;  1V49 A;  2JWZ A;  2OJR A;  1WY8 A;  1ZKH A;  3CMM B;  3ZNZ B;  4DXA B;  5JHA A;  3QHT A;  3UIO B;  4GIV A;  3SDL C;  2AEH A;  2K8C A;  2MSE D;  3DBH I;  2CHZ A;  1J19 A;  5EDS A;  3M95 A;  2MRP A;  4PYU A;  3UIN B;  1S1Q B;  2KDI A;  3PGE A;  4DHJ D;  3QA8 A;  2NS5 A;  4E74 A;  3NY5 A;  3NZS A;  1IPG A;  2Z59 B;  1WXM A;  2IY1 B;  3A9J B;  5KHO A;  1E90 A;  3ECI A;  4J6I A;  5BO4 B;  3QWZ B;  5AEK B;  2DZI A;  1L2N A;  4ZRI A;  3VTV A;  4I6L B;  2EMS A;  2GOW A;  2KMC A;  2O2V A;  2N7E A;  1GNU A;  4AP4 C;  4EOY A;  3H7P A;  2DX5 B;  2LGX A;  3A9K B;  4BKS A;  2BKF A;  2K8H A;  1WZ3 A;  4KIK A;  5D7G A;  2ASQ A;  2L00 B;  2KDF B;  1V5T A;  1V86 A;  2D10 A;  2N1V A;  4I6P A;  3TBL D;  2CHW A;  2I1J A;  2N9X A;  2ZZP B;  3K9P B;  3T9L A;  3QK0 A;  4N9F 4;  5G55 A;  3V6C B;  1XQQ A;  3ZTD A;  4G11 A;  4LJP B;  2AL6 A;  3ONS A;  4MSM B;  2IY0 B;  1WJN A;  4MH0 E;  3ZVV A;  4A3O A;  4GDL A;  2ZEQ A;  3OJ3 A;  2D2Q A;  1Z5S B;  2KDE B;  4FAD A;  1SIF A;  2LD9 A;  2KTF A;  2IBI B;  3ZNH B;  4A3P A;  1G6J A;  3CF6 E;  4LCD E;  4EFO A;  1J0G A;  1ZW7 A;  1TGZ B;  2N7D A;  4LDT D;  4DDG D;  4BKT A;  2N9E B;  2RPQ A;  2MP2 A;  1MG8 A;  3QQ8 B;  4W9D A;  4ANX A;  4IWP A;  5CHW A;  3DVG X;  2J0J A;  1WFY A;  3RUI B;  2LGY A;  3W1Y A;  3TIX A;  2LGD A;  4KSK C;  4MGZ E;  5J18 A;  4M8M A;  2GBM A;  2LVO A;  4B9K A;  3PHX B;  2DZM A;  4TKN A;  1M94 A;  2Y5B B;  2L05 A;  3VTU A;  3JYU A;  4W9I A;  2L7R A;  3VHT C;  4IWO A;  4F7Z A;  2DHZ A;  1YX5 B;  2KJH B;  3Q3J A;  3V6E B;  2K8B A;  1H8C A;  4MDK E;  2DYB A;  3H7S A;  1QZE A;  2CS4 A;  2PEA A;  3RZF A;  3W1S C;  3ZNI D;  2KHW B;  2BWE S;  2K6Q A;  3VAW A;  1C1Y B;  2KVR A;  3ZDM C;  2D3G A;  1GUA B;  2A4Z A;  1WMH A;  3A4S C;  1GC7 A;  2XEW A;  3X0W A;  3A9J A;  4M8N A;  4GN1 A;  5CHF A;  2V3S A;  3I3T B;  5C1Z A;  4DBG A;  4DDI D;  3PT2 B;  2RD0 A;  4RMA A;  3KYD D;  5IAA C;  3MJW A;  3NHE B;  3RT3 B;  2O2V B;  5TR5 A;  4LJO B;  1LFD A;  5IA7 A;  2ZJD A;  2JY6 A;  3H7P B;  3PHW B;  4EZL A;  1A5R A;  1Z2M A;  2KWU B;  1ISN A;  1GC6 A;  3L13 A;  3M62 B;  3NS8 A;  2MBH A;  4KIK B;  2MW5 A;  1IP9 A;  1V2Y A;  2IZV B;  4JL9 A;  2LAS A;  3QAR A;  1WJ6 A;  2AL3 A;  4WAA A;  2CHX A;  2JZZ A;  3ZW3 A;  3ML9 A;  1UEL A;  1EF1 A;  4DHJ B;  2WWZ A;  3C0R B;  2KFK A;  2G45 B;  2KFJ A;  3DBL I;  2C7M B;  2K25 A;  4FJY A;  4GDL B;  2MX2 A;  1WXA A;  1XD3 B;  4IG7 B;  2MCN B;  3A4R A;  3HK0 A;  2LI5 A;  2JZ3 B;  1Q1O A;  2UWQ A;  1P0R A;  1VD2 A;  1WH3 A;  2DEN B;  2JRI B;  3IFW B;  4HPL B;  4OVV A;  2MP2 B;  2BPS A;  1E7V A;  5CX3 A;  4CYE A;  2JVC A;  2QHO A;  1EF5 A;  2KTR A;  3DPD A;  1F9J A;  2LVP A;  4MEM A;  5E6N A;  4G3X B;  2ZPY A;  3OJ4 B;  4WQO B;  2LXA A;  3EEC A;  4NQL B;  2L0T A;  1S3S G;  2MLB A;  2O6V D;  2IO2 B;  3L54 A;  4KVG B;  2M1M A;  2GBN A;  4W9K A;  4EUT A;  1P98 A;  2RR9 A;  1WR1 A;  4G0N B;  3SD5 A;  3BY4 B;  2FCN A;  4FJV B;  1YIW A;  3V62 A;  4CHK A;  2KWV B;  3VXW A;  1E8W A;  2ZVO A;  2DZJ A;  3IG3 A;  4I6N B;  3X23 A;  3ENE A;  3RUL A;  4IC7 B;  3JSV A;  3RZW C;  4NJ6 A;  3U7D A;  3EHV A;  1WXS A;  2KWC A;  3WAM A;  4ICU A;  2LWP A;  1WMH B;  3PRE A;  4ANU A;  2KQ7 A;  4GOC A;  1WX9 A;  3JVZ X;  2KAN A;  1WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...