3KUCB

Complex of rap1a(e30d/k31e)gdp with rafrbd(a85k/n71r)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVRVRNGMSLHDCLMKKLKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp binding protein/transferase
molecule keywords Ras-related protein Rap-1A
publication title What makes Ras an efficient molecular switch: a computational, biophysical, and structural study of Ras-GDP interactions with mutants of Raf.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kucB00
3DOWA 2D11A 1ISNA 2K39A 3JSVA 1WX7A 3QQ8B 3DBSA 4GSWA 3VH4B 3NY5A 2XK5B 3NHEB 3UQAA 3ZNZB 4CYEA 2KHWB 4NQLB 4W9JA 5CX3A 1EO6A 4WWNA 5AEKB 3QHTA 3A4RA 4IWPA 4W9CA 3HHMA 1XQQA 1T0YA 2JPHA 2NVUI 3JYUA 3L16A 3ZNGC 5J17A 3M3JA 1P98A 4BBNC 4E3CA 2IY0B 1Q1OA 2BYEA 1WE6A 2D3GA 3N30A 3BY4B 4ICVA 3UIOB 3VQIA 2IO2B 2ZPNA 1WGYA 3A33B 3HM3A 4GXBA 4I6LB 3IBEA 2CR5A 2L0TA 1E8WA 2L7RA 5HKHA 1UELA 4BKSA 3ECIA 2CS4A 2KX3A 4EZKA 2JVCA 4NQKE 4FULA 2PE6B 3QCAA 3HM6X 2FIDA 5IAAC 1E8YA 2REXA 4KVGB 1GJZA 2NCNA 2CU1A 2JWZA 2KFKB 4DHZB 2IO3B 4OVVA 3HK0A 3B08A 3SHQA 1ZGUB 4CHKA 1XD3B 4ANXA 1H8CA 2MBQA 2R2OA 2I1JA 3W1SC 2BYFA 3ML9A 1EUVB 2MSED 2KWVB 2KJRA 1R4NI 1WXAA 5CHVC 4MEMA 2DAJA 3SDLC 2JZZA 3K9OB 3M62B 4GN1A 3W1SA 1P0RA 3H6NA 4HCPB 4IWOA 4I6PA 2WX0A 5DPRA 4FBJB 1V81A 2KWUB 1OTRB 4EZJA 3ZRFA 3L0WB 4IW0A 4PS7A 1WJUA 5CHFA 2O2VA 3Q3FA 2JY6A 4NY0A 3ZW3A 2L0FA 1E7VA 1LFDA 2CHZA 4LJPB 4DXAB 1U4AA 2KJ6A 3AU4A 1WY8A 2DENB 2IYDB 2KOXA 3APCA 5KHOA 2RPQA 3ALBA 3VUWA 1SE9A 2BWES 3A4SC 3Q3JA 4E74A 3L13A 3HIZA 3RULA 2FCQA 4F8CB 1IP9A 3A1QA 4W9GA 1KOTA 3M95A 5DPSA 2LXCA 2KVRA 2ZVOA 1WH3A 2MW5A 2LVOA 1WZ0A 4PYZA 4IWQA 1Y8RC 5LLIA 2ASQA 2M1MA 2O6VD 2C9WB 2MBHA 4FLHA 4KSLC 3U7DA 1VD2A 3UINB 3H7PA 4FJVB 4GDKA 1WRDB 4MGYE 2UWQA 2OOBB 4EEWA 3APDA 5JHAA 2CHWA 2PE9A 3V6CB 1V2YA 4DDGD 4GU2A 4NJ7A 2J7QB 3PVLA 2WYQA 1KM7A 4RMAA 5D2MB 2R2QA 5L83A 1V6EA 3P2BA 4I6NB 4FADA 1WF9A 2RD0A 4BBNF 3PGEA 2YVCA 3LDZE 1V5OA 1Z5SB 2C60A 2XK5A 1KJTA 4ZRJA 2HJ8A 3V61A 3VUXA 4B95A 3RUIB 2FIFA 3WANA 4BKGA 1OEYJ 2MWSB 2AYOB 4PS3A 3R3MA 4WJQA 3VVWB 4EFOA 4GIVA 4NPNA 5JHBA 2JXXA 5L95C 1VCBA 2N9PC 1EF5A 4IM2A 4W9LA 1I35A 2OJRA 2NPTB 3L08A 1E5WA 2J0MA 4LJOB 3WALA 1OGWA 4HXDA 1WM3A 4TV3A 1Q0WB 4WJPA 2GBKA 2ZVNA 2BWFA 2KQSA 1RRBA 2LASA 2KDEB 4TQ1A 3PT2B 1ZW7A 2RR9A 4BFRA 1CMXB 3PRZA 2AWTA 2M0XA 3WA0A 2JF5A 4AJWA 3NZUA 2RSUA 2EMTA 2KJHB 2XBBC 2N7DA 3DQVA 2KLGA 3T8MA 2B3AA 2KFKA 3DBRI 2KLCA 2M4NA 1V86A 2L00B 2O6VB 2PEAA 3B1LX 4MELA 1WGRA 4NAWB 2AEHA 4MH0E 4DWFA 3RD2A 4M8MA 4IM3A 1PQSA 2K6DB 2L05A 3A9JB 3PS6A 1GNUA 3WAMA 5E6PA 2Z0EB 2IY1B 2N4FA 4HPMB 2KK8A 1WXSA 4LDTD 3KUCB 2KDBA 3LJ3A 3PTFC 2JUOA 3ML8A 3OLMD 1TGZB 1YD8U 1V49A 2FNJB 4GDLB 2G45B 1V9JA 1WFYA 2KTFA 3O65B 1C1YB 2KD0A 4FHKA 4PS8A 1YIWA 2FCNA 3PHWB 1J19A 3RCZA 4NJ6A 4A3PA 2MBOA 4W9DA 4W9HA 5LXIB 2DZMA 3QARA 1YX5B 1WZ3A 3UQBA 3VTUA 1TTNA 2L8JA 3H1UA 4G3XB 2D10A 2NBUA 3IFWB 2DZJA 4PYUA 3CSTA 2V1YA 1UBQA 2WX1A 4MSMB 4EKUA 1P9DU 2GBRA 2K25A 3T9LA 1P3QU 1I42A 3V60A 3PPAA 2JRHA 1S3SG 2N1WA 2ZZPB 1D3ZA 3VTVA 1YQBA 2GBMA 4DHZE 4BOSC 2NBVB 2MCNB 3ZLZA 3S2AA 4KZ0A 3N3KB 4YL8A 1Z2MA 4F7ZA 2NBWB 4M0WB 2KXJA 4WJNA 1OEYA 2NS5A 4HPLB 2DZKA 1Q5WB 2MRPA 1WJ4A 4JGHB 3U8ZA 4EZLA 4ANWA 1A5RA 2QHOA 1QZEA 4GGQA 1WGGA 3ZKJC 3OJ3A 2PJHA 5EDSA 4LDTB 3TJPA 2C5LC 2MP2B 4K1RB 2ZCBA 4EOYA 2DHZA 3VAWA 3IG3A 2LD9A 2ZPYA 2LUEA 2DYOA 2ZCCA 3WAPA 1UBIA 4HJKA 1WM2A 4WQOB 4K7UA 4KSKC 3X23A 2CHXA 4AOFA 3TIXA 3PLVA 3KUDB 2C7HA 3IHPC 1J0GA 2MQJA 2NPTA 3GZNI 2W9NA 3PRPB 3EECA 5FR6A 5TR5A 3APFA 1NBFC 1TBEA 2KTRB 3VUYA 3W1YA 2FCMA 3ZNID 2K6QA 2N7EA 4E71A 4HVBA 1G6JA 2GBNA 5D94A 2JRIB 2BGFA 4DK5A 2HE7A 3SD5A 1E8XA 1WIAA 3ZVVA 1R4MI 2HTHA 2IZVB 2JT4B 2KQ7A 3DBHI 3PZDA 4NAWA 2O6VA 3X0WA 4OVUA 3K9PB 4FJYA 3PRMB 3A9JA 5D6JB 2M17A 1WMHA 2MLBA 2K8HA 1GUAB 3AU5A 2EKEC 2LZ6A 1X1MA 3L17A 1WX9A 2UYZB 5G2NA 3ZUNA 1WR6E 2HD5B 4URKA 4JQWC 3AI5A 4K7SA 2KMCA 1F9JA 2A4ZA 2K1FA 4HK2A 4GDLA 3RZFA 2KMAA 2PPHA 1ZKHA 2BYVE 2C7MB 4KZCA 4KV2A 2WDTB 1BT0A 3H7SA 3MJWA 4B9KA 4G50A 1WX8A 1M94A 1SIFA 3MTNB 4MGZE 5E6OA 2ZNVB 3CMMB 2XEWA 5KHQA 4ANVA 3UF8A 3SU8X 2LGXA 3ENEA 1H4RA 1LQBA 4KIKB 4MJSB 4DBGA 1V5TA 3TMPB 2K8BA 3AXCA 4K81A 4W9KA 3BINA 4JIOU 1IPGA 2LRUA 3C0RB 4XX5A 4W9EA 4DDID 1MG8A 1WMHB 2ZJDA 3ZDTA 4WJOA 5D7GA 1WJ6A 5BO4B 1WXMA 5J2RA 1E7UA 2BF8B 3JW0X 2Z59B 1S1QB 3RZWC 5J18A 3QJZA 4W9IA 3PLUA 1RAXA 3QAQA 1SGHA 3ZO5B 3DPDA 4TUUA 3IVFA 2RGFA 4XC2A 2LVQA 5JZEB 5C1ZA 3ZNHB 2LXAA 4MM3A 1WJNA 3EHVA 4HDOA 4XZ4A 4HWIB 4KDLB 4BKSD 2BKRB 4TQ0A 5IA7A 3ZRCA 3QA8A 2NR2A 1V80A 5GMVA 2N9XA 3RT3B 1L2NA 1NDDA 2MP2A 3NOBA 3R66C 3OJ4B 2KDIA 1GG3A 1AARA 2MA9B 3DVGY 2KC2A 5AZHA 4IC7B 2KDFB 4IG7B 1XT9B 2KANA 2DZIA 5DCNA 1RFAA 2JZ3B 2KNBA 4GOCA 4A20A 3L10B 3NZSA 3R7QA 4HCNB 3KW5B 5AZFA 3QWZB 4IM0A 3WAOA 1HE8A 1YX6B 4ZRKA 4WAAA 3TCAA 3QK0A 3A9KA 2GBJA 1FXTB 3QC8B 2KTRA 3JSVB 1L7YA 1WGHA 2DAFA 2FAZA 4BKTA 4FA6A 3JVZX 2J0JA 4K7WA 3GOEA 3PSEB 4JL9A 2LRWA 3V62A 3R7RA 2GOWA 2D07B 1WYWB 4II2B 5DPTA 1KLVA 1IYFA 4W9FA 1LM8B 3MHSD 1UD7A 4MSQB 3D32A 1LXDA 2GMIC 3EFUA 2Z0DB 3WIMA 4DHJD 1UGMA 4X57B 2BKFA 2KC1A 3RYTA 4ASWC 2IBIB 1WR1A 2N1VA 4TKNA 1TZ1A 2I1KA 2LVPA 2LI5A 1OQYA 2FUHB 2AL3A 2IO1B 2WWZA 2ZNVC 4NNJB 1WGDA 5AZGA 3VH3B 2BPSA 2L76A 4FJZA 3ONSA 1WXVA 3DBLI 3A9KB 4MDKE 4IUMB 2L3ZA 4HDQA 2LJ5A 5CHWA 3VDZA 2EMSA 2MBEA 4RM8A 1RLFA 3CF6E 2G4DB 4LCDE 5E6NA 2LGDA 3DVNU 2KX0A 1GC6A 4N9F4 4P7IA 3OAWA 3PV1A 2M8SA 2Y5BB 4MGKE 2LWPA 3AULA 3PREA 2DYBA 2CKHB 2J0KA 4KIKA 4MJSA 4CO7A 4HLEA 3UGBB 4F1SA 3B0AA 3NS8A 3ZIMA 3U30A 3KYDD 3PHXB 1UH6A 3VHTC 4ZDVA 1JRUA 5CTRC 2V4LA 2G3QB 3DVGX 4EUTA 1NI2A 5C23A 1UZXB 3DCGA 4ICUA 2YLMA 4RM9A 2N9EB 2A5UA 4FHJA 1K8RB 3L54A 4G0NB 2KO3A 4GMVA 4II3B 3H9DA 3VFKA 2KKCA 4WWOA 3KH0A 4BVUC 3QIJA 4B6WA 4AWJA 2KWCA 2DX5B 2LGYA 4AJYB 2O2VB 2FCSA 4AP4C 3KYCD 5JH5C 4DHJB 2G4SA 2KZRA 3TL5A 3VXWA 3TBLD 3KUZA 4GB9A 4J6IA 2KFJA 4FN2A 2DYMA 2KN5A 2AL6A 3A1QB 3M63B 3UIPB 3DVNV 5DPWA 5LXHA 3I3TB 3CSFA 3N32A 1WE7A 5G55A 3ZTDA 1WI0A 4BOZB 1C3TA 1EF1A 4ANUA 4G11A 4WWPA 4ZYNA 3VTWA 2MBBB 1E8ZA 2C7NB 2V3SA 3V6EB 3ZTCA 4KDIC 1YJ1A 3H7PB 3KVFB 4GDKB 4M8NA 4A3OA 3ZDMC 3QX1A 4JLCA 1J8CA 1GC7A 2K8CA 2VRRB 2ZEQA 4MGIE 4ZRIA 2MX2A 1E90A 3EC8A 3DDCB 4AUQC 2IO0B 1P1AA 2D2QA
chains in the Genus database with same CATH superfamily
3DOWA 4L2YA 1L4DB 3VH4B 3Q8AA 1T6BX 3NHEB 2BB6A 3ZNZB 4CYEA 5BMGA 4W9JA 4WWNA 4IWPA 3HHMA 2NVUI 4LNNA 1C4CA 3M3JA 1GB1A 1Q1OA 2BYEA 2D3GA 3TUOA 4FADA 1K52A 3W2DA 2AQ3B 3NVYA 1E8WA 2L7RA 3NVZA 2JVCA 3TEZA 2FIDA 4KVGB 1GJZA 5IO9A 4OVVA 2JYTA 1BXTA 2LHDA 1R4NI 3IT4B 4OVZA 2JZZA 3AEDB 3M62B 2IGGA 4IWOA 5DPRA 1N63A 1D5ZC 4EZJA 3C8YA 3L0WB 3P4QB 2J4XA 2L0FA 1LFDA 2CHZA 1YNTE 4LLGM 1CK1A 2IYDB 5KHOA 3AECB 3Q3JA 4E74A 4USAA 3HIZA 2FCQA 1IP9A 3A1QA 4A9AA 3M95A 1VDVA 2HDEA 2MW5A 1K53A 1Y8RC 4IWQA 2M1MA 4TMAB 4KSLC 1VD2A 4FJVB 4GDKA 4MGYE 3APDA 2QJLA 3VR8B 3V6CB 1N60A 4NJ7A 2J7QB 3NUHB 2HJ1A 5G5HA 4O1NA 1SB3C 2JSVX 1TIFA 3N9YC 1E10A 3V61A 2HJ8A 3KQ4A 4B95A 5LNK1 2WU2B 2WXMA 2MEKA 3BK2A 3VVWB 4EFOA 4GIVA 5JHBA 5L95C 2JXXA 1EF5A 3RFZB 4US8A 5JXVA 1E5WA 3RNAC 4HXDA 1WM3A 1SIJA 2BWFA 2KQSA 2LASA 2KDEB 3Q8FA 1CMXB 1D5MC 2AWTA 2WDRB 4WWMA 4L23A 2RSUA 1YMHE 3DQVA 2QILA 2M4NA 4MELA 1WGRA 4H2AA 1PQSA 2K6DB 4LDTD 3KUCB 4YSXB 5C3JB 2JUOA 1SJED 1V49A 2FNJB 2G45B 1L0YB 1V9JA 4C56C 1C1YB 3AE7B 2FCNA 1JWMD 1JW9D 1R4NB 4A55A 2X8XX 2JXTA 5LXIB 1PGXA 2ICIA 3E56A 1K51A 3H1UA 2DZJA 1T0SC 2GBRA 2WXRA 3V60A 1S3SG 4LNOA 1FEHA 1YQBA 2GBMA 3S2AA 4WURA 4F7ZA 4M0WB 2KXJA 4WJNA 2ZW1A 1Q5WB 3BVGA 4JGHB 3Q8CA 3U8ZA 2QMTA 4GGQA 5EDSA 1I4GA 3AEAB 2BT6A 3N1ZC 1WWTA 1NEKB 2QC8A 2DYOA 3AEBB 4WQOB 1UUPA 4KSKC 4YTMB 1QOAA 2K22A 3PLVA 1KF6B 1J0GA 2MQJA 3GZNI 2BB5A 3APFA 5D3IB 3VUYA 4E71A 3ZNID 1G6JA 2N7EA 2GBNA 2RDGA 2WXPA 3TEXA 2HTHA 4P1CC 1KTKA 2JX5A 3AV8A 4OVUA 1C79A 3GB1A 3PRMB 5D6JB 1J7BA 3AU5A 1N5XA 1WX9A 2UYZB 5G2NA 3ZUNA 3RMKC 1UWMA 3AI5A 2K1FA 3OWEB 4RGNA 2BYVE 3AEGB 4KGRA 2WDTB 1BT0A 1QQRA 3TSSA 1ZPSA 3MTNB 3VRBB 2LGXA 3ENEA 3ZJUA 5EE9A 3AXCA 3RNGC 3PZ7A 4JIOU 3C0RB 4N59A 1VZ7A 4D2KA 2D3CA 3ZDTA 1WJ6A 1WXMA 1E7UA 3HUIA 1WXQA 3QJZA 4W9IA 1L0XB 1RAXA 4DXGA 3QAQA 1SGHA 3ZO5B 1YQ3B 1TY2A 3IVFA 2K5PA 2D3AA 4M0WA 2JZPA 3NG0A 2FE8A 4P16A 4BAXA 4XE0A 2NMQA 5GMVA 1DYQA 3RT3B 3NRZA 1WSPA 1GG3A 2KDIA 3DVGY 3RNBC 4IC7B 4IG7B 4A20A 1EWCA 1T0QC 4N58A 4RCOA 3QWZB 2WXLA 4IDIA 3N1YC 4ZRKA 1AWDA 1PGBA 3QK0A 2GBJA 4FA6A 2DAFA 2J0JA 3V62A 1VLBA 2D07B 4XYCA 3GZNB 5DPTA 1KLVA 1LM8B 3MHSD 1MJDA 1FXAA 2W3SA 1AN8A 1L0VB 2L83A 1FD6A 3RYTA 4ASWC 1WR1A 4R3DA 1OQYA 2FUHB 3DWGC 2AL3A 3I63C 3Q6BA 3ONSA 3DBLI 2TSSA 3ETRA 2LJ5A 1JCKB 2H89B 2LGDA 1E0ZA 3IT6B 1UWXA 3PV1A 2M8SA 2VZKB 4OHJA 3AULA 3CIRB 4HLEA 1XCQL 4F1SA 5HI1A 3VHTC 3EUB2 1JRUA 5I4DA 2QIEB 2A5UA 3Q14C 3W9CB 2KKCA 4WWOA 2LJIA 3MHZA 4AWJA 2V4IB 2DX5B 2FCSA 5BYSA 2INDC 4RNAA 3GP7A 3RNFC 4AP4C 2CJNA 3AMZA 3TBLD 4GB9A 3Q8EA 2KFJA 2DYMA 1PDXA 2AL6A 2KACA 3UIPB 1T5XD 3CSFA 1WI0A 2N7JA 1C3TA 1L4ZB 1BUIC 2W82A 3VTWA 2MBBB 2C7NB 2V3SA 2I38A 3H7PB 4JLCA 1J8CA 2WXJA 3P4SB 3B2GA 2K8CA 3IAM1 3EC8A 4AUQC 4OZCA 1P1AA 1FRDA 2K39A 1WX7A 3E9SA 2INPE 2XK5B 3UQAA 2NTTA 4NQLB 4W9CA 1C9FA 1XQQA 2WP9B 3JYUA 1DOYA 1P98A 4RGTA 1TKEA 1I4RA 4A6QA 3T3NA 4ICVA 2ZPNA 1WGYA 3A33B 3HM3A 4I6LB 2CS4A 2KX3A 4YWGG 2PE6B 3QCAA 1SBBB 2JWZA 5HHDG 1E6EB 5IN7A 4CHKA 3CWIA 3VR9B 2MBQA 2I1JA 1ZDVA 2BYFA 3ML9A 1V1PB 1CQVA 1EUVB 4WQMA 2KJRA 3DBLB 5CHVC 4MEMA 5EE3A 4RGMA 3H6NA 1N6ZA 1YJJA 4FBJB 1V81A 1ZXHA 4PT5A 2PKOA 4NY0A 4LJPB 4DXAB 3P42A 3VUWA 2KVZA 1EWYC 2PTLA 3L13A 1C76A 4KKIA 2WXKA 2L52A 2LXCA 2ZVOA 5IKCM 1WZ0A 4PYZA 5LLIA 1SE3A 3UINB 1YN4A 3H7PA 2UWQA 1YJIA 2CHWA 4GU2A 2J42A 1L6UA 1KM7A 4RMAA 5L83A 4B0MA 2RD0A 4BBNF 3PGEA 2C60A 2OJWA 2XK5A 2INCC 1KJTA 3VUXA 3WANA 5IOIA 4BKGA 4JWUC 2MWSB 4PS3A 4NPNA 1VCBA 2N9PC 2OJRA 2W54A 3GE8C 2J0MA 1TKYA 4LJOB 1Q0WB 2E3TA 2OEDA 2BS4B 2LMCA 2RR9A 4BFRA 3PRZA 1TT5B 3NZUA 2XBBC 2KLGA 2RDHA 3DBRI 4NAWB 2PEAA 2Z8LA 3RD2A 1RFKA 2L05A 3Q69A 1V1PA 5EE1A 3J9CA 4HPMB 2SEBD 3LJ3A 3ML8A 3EFCA 1YD8U 2WGSA 1M4VA 2GLSA 1XCTL 2KAJA 3SEBA 1WFYA 2KTFA 4FHKA 2KD0A 1YIWA 4C4VB 4ARCA 4NJ6A 4W9DA 3QARA 1YX5B 3VTUA 1ET6A 1JMLA 3KLSX 2NBUA 1ZUD2 4PYUA 3CSTA 2WX1A 3DHHC 2K25A 1P3QU 3PPAA 1CJEA 1TZOA 4LK0M 2KMMA 1EM7A 1FNUA 1NYQA 4MM3B 2DZKA 4C00A 2CJOA 2DLBA 2W55A 1A5RA 1QZEA 3U4EG 3ZKJC 3OJ3A 2PJHA 4LDTB 3TJPA 2MH7A 1L5PA 2C5LC 2MP2B 4K1RB 4EOYA 2LD9A 2ZPYA 1F2RI 4C80A 3WAPA 1SXTA 5IP4D 4NAMA 1SEBD 2CHXA 2C7HA 2G1EA 3P1MA 1MPEA 1XLNA 1UGJA 4JX1C 2Y3AA 3W1YA 2FCMA 2VH2A 2ACZB 4KKJA 2W3RA 4DK5A 3SD5A 1EU3A 3ZVVA 4Q2JA 2IZVB 2JT4B 4NAWA 1QILA 1J7AA 1WMHA 2MLBA 4ZOHC 2EKEC 3L17A 4OZAA 1WR6E 2V3NA 4JQWC 3DBRB 4KGSA 1F9JA 4HK2A 3RZFA 3URYA 2KMAA 2PPHA 3I9V1 1ZKHA 2C7MB 4KZCA 3TEWA 4C4VA 1STEA 2BS2B 3H7SA 4G50A 3V05A 1SIFA 2ZNVB 2MJ3A 5KHQA 4HKQA 3U7ZA 1H4RA 1LQBA 4DBGA 4ZRPA 4K81A 4W9KA 2LRUA 4XGAB 4XX5A 4W9EA 4YTPB 1MG8A 2ZJDA 1F2RC 5FKAC 2BF8B 2FUG1 1YOVB 3RZWC 5J18A 2ZW0A 3PLUA 4TUUA 4NZLB 2RGFA 4XC2A 4HROA 4MM3A 3EHVA 4HDOA 4KDLB 4BKSD 4TQ0A 2EELA 1AW7A 5IA7A 3QA8A 2WS3B 2NR2A 1V80A 5H92C 2QEJC 1L2NA 1UF0A 2MP2A 3R66C 2MA9B 4XDCA 2KC2A 3I5JC 5AZHA 2KDFB 2WXHA 1KH0A 2L1AA 3NZSA 3R7QA 2KN4A 3KW5B 4YSZB 1HE8A 3UI3A 3TCAA 3ZQ4A 3O13A 3ZGZA 3JSVB 1HXYD 4K7WA 4M00A 2QSDA 2GOWA 3AE5B 2GRIA 3RNEC 1IUEA 3MC8A 3P4PB 1WGKA 2DWQA 1LXDA 3EFUA 3GS2A 4DHJD 1T3QA 2KC1A 2IBIB 2JU6X 3AEFB 4TKNA 1FNWA 2IO1B 3B9JA 1UNSA 3AM9A 3VH3B 1V1OA 2L76A 2MBEA 1RLFA 1QKZA 2G4DB 1FIQA 1PUTA 4M01A 3DVNU 1J7CA 1FPYA 3OAWA 4WAFA 1FMAD 3BVZA 3Q8BA 4MGKE 3B0AA 3NS8A 3U30A 3KYDD 2K3UA 1VZ6A 1C77A 4ZDVA 3IXSA 4WH4A 5C23A 2YLMA 1K8RB 3L54A 4G0NB 2KO3A 4GMVA 4II3B 1NENB 4P1BC 1XEEA 3U2SC 3QIJA 4ZHPA 1FO4A 3TL5A 3VXWA 4ITKA 4J6IA 4FN2A 1XO3A 2WXOA 3BYTB 5DPWA 5LXHA 2B76B 3N32A 1WE7A 4G11A 4KDIC 1TS4A 4S17A 2VRRB 4MGIE 2PW9A 3SFDB 4REZA 3PT2B 2D2QA 2D11A 1ISNA 3JSVA 3DBSA 3NY5A 3AE4B 1GOZA 2KHWB 5AEKB 3A4RA 2D3BA 1T0YA 2JPHA 5J17A 2V0GA 1JWBD 2LHEA 4BBNC 2KYWA 2IY0B 4US9A 1WE6A 3BY4B 3VQIA 2IO2B 4GXBA 5T8IA 2L0TA 5HKHA 4MT5A 1SE4A 5HFYA 4EZKA 4NQKE 4FULA 5IAAC 1E8YA 2REXA 4MACA 3B08A 1F1HA 1ZGUB 1XD3B 4ANXA 1NVID 2R2OA 2KWVB 1WXAA 1MG4A 2DAJA 4IKGA 4GN1A 3W1SA 1P0RA 4HCPB 4I6PA 1TS5A 1D6EC 3IAS1 4WIPA 5AUKA 2KWUB 1OTRB 3ZRFA 4PS7A 5CHFA 4BZAA 3Q3FA 1E7VA 2KJ6A 3AU4A 2BYTA 2DENB 2KOXA 4S0RA 1SE9A 3A4SC 3RULA 4F8CB 1ZE3D 1WH3A 2LVOA 3ABVB 2O6VD 1KLGD 2C9WB 2MBHA 4FLHA 3U7DA 3I57A 1YQ4B 2OOBB 1RM6C 5JHAA 2PE9A 2WYQA 5D2MB 2R2QA 1V6EA 1WF9A 2YVCA 1V5OA 4ZRJA 5BYRA 1OEYJ 4LNIA 3R3MA 1I35A 2J52A 4IM2A 4W9LA 3L08A 4ZHOA 3WALA 1OGWA 4TV3A 4WJPA 2GBKA 3W5UB 1RRBA 4TQ1A 1ZW7A 2LFIA 5D3DA 1T0RC 2M0XA 3WA0A 2M56B 2KJHB 3DWMA 2N7DA 2PVOD 4HKZE 3T8MA 3ECIA 1V86A 1XLOA 2JQRB 2AEHA 4IM3A 1JALA 2YEPF 3A9JB 3PS6A 2EKIA 3WAMA 1MHHE 4JPSA 1D5XC 2IPKD 2Z0EB 2IY1B 1WXSA 2BS3B 2KDBA 4EE2A 3ZJVA 2KQ4X 3OLMD 1TGZB 3FILB 4GDLB 1E9MA 3NVWA 3O65B 1TY0A 1TKGA 4LTUA 4PS8A 1J19A 3AE6B 1ET9A 4ZRQA 2WDVB 2MBOA 4AQ7A 4W9HA 5BMIA 1FFUA 1TTNA 2L8JA 4HRSA 1A70A 2R61A 3NZ3A 4G3XB 2Y5CA 2V1YA 4MSMB 4ARIA 3T9LA 1VR9A 1I42A 4RF0A 1WYGA 2LEKA 2N1WA 2ZZPB 3ZXVA 5H8YE 1D3ZA 1ZDXA 3VTVA 4BOSC 2MJDA 2JYEA 4KZ0A 4YTNB 3N3KB 1Z2MA 2NBWB 2NS5A 2MRPA 4EZLA 4ANWA 5MPOA 1EU4A 2KWDA 4OW0A 3EA6A 1N61A 2ZCBA 3VAWA 3IG3A 1UBIA 2XN9C 4K7UA 3X23A 3TIXA 4YXDB 3ZJTA 3KUDB 3DBHB 3HVDA 2E6XA 3PRPB 5FR6A 1I4XA 3ZYYX 2WLBA 2LUMA 3R2TA 5TSSA 2KTRB 2JRIB 2BGFA 4KX6B 4P6VF 2HE7A 4LNFA 1E8XA 1WIAA 3MC9A 2KQ7A 1C4AA 4FJYA 3HVZA 3A9JA 1GUAB 1I7HA 2LZ6A 4YT0B 2HD5B 1HEZE 3P4RB 1ZOYB 2KMCA 3FILA 4GDLA 4KV2A 1WX8A 1M94A 5E6OA 3CMMB 1B9RA 2ON8A 4RF1A 3SU8X 2N9LA 3Q3NC 4MJSB 3TMPB 2RMMA 3BINA 1WMHB 2IGDA 4WJOA 5D7GA 5J2RA 3BK1A 3JW0X 2Z59B 2Y5PA 1FM0D 2ONQA 1HTQA 1JWSD 2CU3A 3DPDA 2LVQA 5JZEB 5C1ZA 2LXAA 1WJNA 4HWIB 1QLBB 1FCLA 3B2FA 2N9XA 1NDDA 1SE2A 2KANA 5BYQA 2J53A 1E7PB 5DCNA 2KNBA 2PMVA 1F77A 2INNE 3L10B 3HRDD 4A90A 4WAAA 1LO5D 3A9KA 2KTRA 1L7YA 2FAZA 1QT9A 3GOEA 5C2TB 3PSEB 3AE1B 4JL9A 1WYWB 1IYFA 1JWUD 1P7EA 1MI0A 1HZ5A 1C4PA 2RDBC 2N0SB 2GMIC 2Z0DB 3WIMA 1FCCC 2BKFA 1OQQA 1Y56A 5AUIA 4DXFA 1TZ1A 5G5GA 3NJTA 1MHXA 4HPPA 2ZNVC 1RYJA 1PGAA 1WGDA 3KWLA 2K0PA 1WXVA 4MDKE 4IUMB 4HDQA 5CHWA 3VDZA 3CF6E 3ZXRA 1HTOA 5E6NA 4N9F4 1HQRD 2LWPA 1FRRA 2DYBA 2CKHB 2J0KA 4MJSA 3AN1A 4CO7A 3UGBB 1QF6A 3WCQA 1AYFA 3PHXB 1UH6A 1F0ZA 3RNCC 5CTRC 3BZDB 2G3QB 3DVGX 1FNVA 1NI2A 1UZXB 2UU7A 1ACCA 2N9EB 2WDQB 5E6JA 3VFKA 2NTSA 4JWSC 4B6WA 2LGYA 1OFFA 2O2VB 3LYYA 1SJHD 4K3BA 3NS1A 2X38A 5JH5C 4DHJB 2G4SA 2KZRA 1IBXB 1JQ4A 3Q3MC 4PK1A 2KN5A 3M63B 3I3TB 2I2YA 3ZTDA 4BOZB 1EF1A 4ANUA 2KDMA 4WWPA 4JE3B 1N62A 4J3OD 4ZYNA 3V6EB 1E8ZA 3MC0B 3ZTCA 3N20C 1I4QA 3KVFB 4A3OA 4M8NA 2G9HD 2HTME 1KRHA 1GC7A 4NJCA 2ZEQA 3AH7A 2MX2A 1E90A 3DDCB 1JWAD 3LXFA 2DNFA 5FK9C 4NNJB 4XWTA 1SF0A 3QQ8B 3P63A 4GSWA 3RPFC 5CX3A 1EO6A 3QHTA 3L16A 4A8XC 3ZNGC 3FKYA 4E3CA 4HJGE 3UIOB 3N30A 3IBEA 2CR5A 1UELA 4BKSA 2OHFA 1C78A 2SAKA 3HM6X 1DGJA 2NCNA 2CU1A 2KFKB 4DHZB 2IO3B 3HK0A 3SHQA 1B1ZA 1QOBA 3LB8C 4TSSA 4RGOS 3SR6A 1H8CA 3W1SC 2MSED 3PO0A 3SDLC 1FXIA 3K9OB 4KGTA 3RN9C 1ESFA 5HG2A 2WX0A 2WQYB 3Q3OC 4ZYSA 3GE3C 4IW0A 1WJUA 5EE0A 1VRAB 2AQ2B 2O2VA 2JY6A 3ZW3A 2BTEA 2QDFA 4K3CA 3AEEB 1U4AA 4OZBA 3MJ5A 1WY8A 1IBXA 3APCA 2RPQA 3ALBA 2BWES 4W9GA 1KOTA 5DPSA 2KVRA 2RPVA 2H88B 2ASQA 2XNAC 1TS2A 3DHIC 1WRDB 3FC4A 4EEWA 3AE8B 2LGSA 1V2YA 4DDGD 2WXQA 1MFWA 3BVMA 3PVLA 3P2BA 4I6NB 3BWUD 2YEPB 1HZ6A 1XLQA 3LDZE 2KT7A 1Z5SB 3RUIB 2FIFA 2AYOB 1GB4A 4WJQA 1XF5L 2NPTB 2FBWB 2DBYA 2ZVNA 3OG5A 1VZ8A 1TYGB 2WXNA 3W5VB 2JF5A 2D5GA 4AJWA 2JWUA 4XWWA 2EMTA 2B3AA 2KFKA 5E6PA 2KLCA 3B1LX 2L00B 3ZDMC 2O6VB 2IJ0A 4MH0E 4DWFA 4M8MA 4L1BA 3NVVA 2V9HA 2IGHA 1GNUA 4LNKA 1F52A 1LGRA 2N4FA 2KK8A 2LGIA 2WHIA 3PTFC 3EGRA 1QOGA 4CQNA 1K50A 3Q2AC 1KFYB 3PHWB 3RCZA 2BQQA 4A3PA 4GLSC 1ZXIA 3UQBA 2DZMA 1WZ3A 3R8BA 1PFDA 2D10A 3AB5A 3IFWB 1UBQA 4EKUA 1P9DU 2JRHA 4IOIE 1JROA 4DHZE 2NBVB 2MCNB 3ZLZA 3MP9A 3N1XC 4YL8A 2IDYA 1OEYA 4HPLB 1WJ4A 1SSNA 2QHOA 1ENFA 1WGGA 1IGCA 2DHZA 2LUEA 2ZCCA 4HJKA 1WM2A 4AOFA 3TEYA 3IHPC 2NPTA 2W9NA 3EECA 1WRIA 4M02A 1NBFC 4RFBA 5TR5A 1NYRA 1TBEA 1OQRA 2K6QA 4HVBA 1YN3A 5D94A 1Q10A 4MH8A 5FR3A 1R4MI 3X0WA 3DBHI 3PZDA 3VRAB 2O6VA 3K9PB 2K9XA 1I4PA 1DOXA 2M17A 1PYWD 2K8HA 2VH1A 1X1MA 1XLPA 4URKA 4K7SA 1XXGA 3FAHA 2A4ZA 4UDUC 2QCZA 2M0AA 2BBCA 3SFEB 1L6VA 4ACFA 2MJEA 5BMHA 4B9KA 3MJWA 3DHGC 4MGZE 2XEWA 1R7SA 4ANVA 3UF8A 4KIKB 1V5TA 2K8BA 1TJEA 1IPGA 5GXGB 4DDID 3L4PA 2GI9A 5BO4B 2Q5WD 1KLUD 1V8CA 1S1QB 1CZPA 4AS1A 1V97A 2WU5B 3ZNHB 3MFGA 4XZ4A 2PVGC 1FFVA 2BKRB 4C7YA 1P7FA 3ZRCA 3NOBA 1QOFA 3OJ4B 1AARA 1DOIA 4RH6A 1XT9B 2DZIA 2VZKD 1RFAA 2JZ3B 4GOCA 3BYYB 1I4HA 4HCNB 5AZFA 4HEA1 1NI3A 1ROEA 4IM0A 3WAOA 1YX6B 3H8HA 4FXCA 1FXTB 3QC8B 1WGHA 4BKTA 2BVCA 1MVKA 3JVZX 2GB1A 2LRWA 3R7RA 1RWSA 4II2B 4W9FA 3KWVA 1UD7A 4MSQB 3D32A 2AQ1B 2AX5A 4C7ZA 2M19A 1UGMA 4X57B 3T3OA 1BMLC 2BW2A 2N1VA 2I1KA 2LVPA 3AE2B 2LI5A 1R4MB 2PIAA 2WWZA 5AZGA 2BPSA 1D4BA 4FJZA 3A9KB 2L3ZA 2EMSA 4RM8A 4XDDA 2PLPA 4LCDE 1HA5A 2KX0A 1GC6A 4P7IA 2Y5BB 3U52E 1GPXA 4KIKA 3PREA 3BIID 3ZIMA 4YSYB 2WXIA 2N9KA 3AE9B 1ZP0B 3R2IA 2V4LA 4EUTA 3DCGA 4ICUA 4RM9A 4FHJA 1GAQB 4DQOC 1IGDA 3H9DA 3KH0A 4BVUC 2WXFA 1VJKA 2KWCA 1YN5A 4AJYB 3RI7C 1N5WA 4QAYA 3C19A 3KYCD 1TS3A 2V3PA 3KUZA 3PZ8A 3A1QB 3DVNV 5G55A 2L32A 4N6EB 1YJ1A 4GDKB 1JRPA 3QX1A 2WXGA 2MHJA 3V3XA 2WNMA 4ZRIA 3AE3B 2IO0B 4B0EA
chains in the Genus database with same CATH topology
3DOWA 2D11A 1ISNA 2K39A 3JSVA 1WX7A 3QQ8B 3DBSA 4GSWA 3VH4B 3NY5A 2XK5B 3NHEB 3UQAA 3ZNZB 4CYEA 2KHWB 4NQLB 4W9JA 5CX3A 1EO6A 4WWNA 5AEKB 3QHTA 3A4RA 4IWPA 4W9CA 3HHMA 1XQQA 1T0YA 2JPHA 2NVUI 3JYUA 3L16A 3ZNGC 5J17A 3M3JA 1P98A 4BBNC 4E3CA 2IY0B 1Q1OA 2BYEA 1WE6A 2D3GA 3N30A 3BY4B 4ICVA 3UIOB 3VQIA 2IO2B 2ZPNA 1WGYA 3A33B 3HM3A 4GXBA 4I6LB 3IBEA 2CR5A 2L0TA 1E8WA 2L7RA 5HKHA 1UELA 4BKSA 3ECIA 2CS4A 2KX3A 4EZKA 2JVCA 4NQKE 4FULA 2PE6B 3QCAA 3HM6X 2FIDA 5IAAC 1E8YA 2REXA 4KVGB 1GJZA 2NCNA 2CU1A 2JWZA 2KFKB 4DHZB 2IO3B 4OVVA 3HK0A 3B08A 3SHQA 1ZGUB 4CHKA 1XD3B 4ANXA 1H8CA 2MBQA 2R2OA 2I1JA 3W1SC 2BYFA 3ML9A 1EUVB 2MSED 2KWVB 2KJRA 1R4NI 1WXAA 5CHVC 4MEMA 2DAJA 3SDLC 2JZZA 3K9OB 3M62B 4GN1A 3W1SA 1P0RA 3H6NA 4HCPB 4IWOA 4I6PA 2WX0A 5DPRA 4FBJB 1V81A 2KWUB 1OTRB 4EZJA 3ZRFA 3L0WB 4IW0A 4PS7A 1WJUA 5CHFA 2O2VA 3Q3FA 2JY6A 4NY0A 3ZW3A 2L0FA 1E7VA 1LFDA 2CHZA 4LJPB 4DXAB 1U4AA 2KJ6A 3AU4A 1WY8A 2DENB 2IYDB 2KOXA 3APCA 5KHOA 2RPQA 3ALBA 3VUWA 1SE9A 2BWES 3A4SC 3Q3JA 4E74A 3L13A 3HIZA 3RULA 2FCQA 4F8CB 1IP9A 3A1QA 4W9GA 1KOTA 3M95A 5DPSA 2LXCA 2KVRA 2ZVOA 1WH3A 2MW5A 2LVOA 1WZ0A 4PYZA 4IWQA 1Y8RC 5LLIA 2ASQA 2M1MA 2O6VD 2C9WB 2MBHA 4FLHA 4KSLC 3U7DA 1VD2A 3UINB 3H7PA 4FJVB 4GDKA 1WRDB 4MGYE 2UWQA 2OOBB 4EEWA 3APDA 5JHAA 2CHWA 2PE9A 3V6CB 1V2YA 4DDGD 4GU2A 4NJ7A 2J7QB 3PVLA 2WYQA 1KM7A 4RMAA 5D2MB 2R2QA 5L83A 1V6EA 3P2BA 4I6NB 4FADA 1WF9A 2RD0A 4BBNF 3PGEA 2YVCA 3LDZE 1V5OA 1Z5SB 2C60A 2XK5A 1KJTA 4ZRJA 2HJ8A 3V61A 3VUXA 4B95A 3RUIB 2FIFA 3WANA 4BKGA 1OEYJ 2MWSB 2AYOB 4PS3A 3R3MA 4WJQA 3VVWB 4EFOA 4GIVA 4NPNA 5JHBA 2JXXA 5L95C 1VCBA 2N9PC 1EF5A 4IM2A 4W9LA 1I35A 2OJRA 2NPTB 3L08A 1E5WA 2J0MA 4LJOB 3WALA 1OGWA 4HXDA 1WM3A 4TV3A 1Q0WB 4WJPA 2GBKA 2ZVNA 2BWFA 2KQSA 1RRBA 2LASA 2KDEB 4TQ1A 3PT2B 1ZW7A 2RR9A 4BFRA 1CMXB 3PRZA 2AWTA 2M0XA 3WA0A 2JF5A 4AJWA 3NZUA 2RSUA 2EMTA 2KJHB 2XBBC 2N7DA 3DQVA 2KLGA 3T8MA 2B3AA 2KFKA 3DBRI 2KLCA 2M4NA 1V86A 2L00B 2O6VB 2PEAA 3B1LX 4MELA 1WGRA 4NAWB 2AEHA 4MH0E 4DWFA 3RD2A 4M8MA 4IM3A 1PQSA 2K6DB 2L05A 3A9JB 3PS6A 1GNUA 3WAMA 5E6PA 2Z0EB 2IY1B 2N4FA 4HPMB 2KK8A 1WXSA 4LDTD 3KUCB 2KDBA 3LJ3A 3PTFC 2JUOA 3ML8A 3OLMD 1TGZB 1YD8U 1V49A 2FNJB 4GDLB 2G45B 1V9JA 1WFYA 2KTFA 3O65B 1C1YB 2KD0A 4FHKA 4PS8A 1YIWA 2FCNA 3PHWB 1J19A 3RCZA 4NJ6A 4A3PA 2MBOA 4W9DA 4W9HA 5LXIB 2DZMA 3QARA 1YX5B 1WZ3A 3UQBA 3VTUA 1TTNA 2L8JA 3H1UA 4G3XB 2D10A 2NBUA 3IFWB 2DZJA 4PYUA 3CSTA 2V1YA 1UBQA 2WX1A 4MSMB 4EKUA 1P9DU 2GBRA 2K25A 3T9LA 1P3QU 1I42A 3V60A 3PPAA 2JRHA 1S3SG 2N1WA 2ZZPB 1D3ZA 3VTVA 1YQBA 2GBMA 4DHZE 4BOSC 2NBVB 2MCNB 3ZLZA 3S2AA 4KZ0A 3N3KB 4YL8A 1Z2MA 4F7ZA 2NBWB 4M0WB 2KXJA 4WJNA 1OEYA 2NS5A 4HPLB 2DZKA 1Q5WB 2MRPA 1WJ4A 4JGHB 3U8ZA 4EZLA 4ANWA 1A5RA 2QHOA 1QZEA 4GGQA 1WGGA 3ZKJC 3OJ3A 2PJHA 5EDSA 4LDTB 3TJPA 2C5LC 2MP2B 4K1RB 2ZCBA 4EOYA 2DHZA 3VAWA 3IG3A 2LD9A 2ZPYA 2LUEA 2DYOA 2ZCCA 3WAPA 1UBIA 4HJKA 1WM2A 4WQOB 4K7UA 4KSKC 3X23A 2CHXA 4AOFA 3TIXA 3PLVA 3KUDB 2C7HA 3IHPC 1J0GA 2MQJA 2NPTA 3GZNI 2W9NA 3PRPB 3EECA 5FR6A 5TR5A 3APFA 1NBFC 1TBEA 2KTRB 3VUYA 3W1YA 2FCMA 3ZNID 2K6QA 2N7EA 4E71A 4HVBA 1G6JA 2GBNA 5D94A 2JRIB 2BGFA 4DK5A 2HE7A 3SD5A 1E8XA 1WIAA 3ZVVA 1R4MI 2HTHA 2IZVB 2JT4B 2KQ7A 3DBHI 3PZDA 4NAWA 2O6VA 3X0WA 4OVUA 3K9PB 4FJYA 3PRMB 3A9JA 5D6JB 2M17A 1WMHA 2MLBA 2K8HA 1GUAB 3AU5A 2EKEC 2LZ6A 1X1MA 3L17A 1WX9A 2UYZB 5G2NA 3ZUNA 1WR6E 2HD5B 4URKA 4JQWC 3AI5A 4K7SA 2KMCA 1F9JA 2A4ZA 2K1FA 4HK2A 4GDLA 3RZFA 2KMAA 2PPHA 1ZKHA 2BYVE 2C7MB 4KZCA 4KV2A 2WDTB 1BT0A 3H7SA 3MJWA 4B9KA 4G50A 1WX8A 1M94A 1SIFA 3MTNB 4MGZE 5E6OA 2ZNVB 3CMMB 2XEWA 5KHQA 4ANVA 3UF8A 3SU8X 2LGXA 3ENEA 1H4RA 1LQBA 4KIKB 4MJSB 4DBGA 1V5TA 3TMPB 2K8BA 3AXCA 4K81A 4W9KA 3BINA 4JIOU 1IPGA 2LRUA 3C0RB 4XX5A 4W9EA 4DDID 1MG8A 1WMHB 2ZJDA 3ZDTA 4WJOA 5D7GA 1WJ6A 5BO4B 1WXMA 5J2RA 1E7UA 2BF8B 3JW0X 2Z59B 1S1QB 3RZWC 5J18A 3QJZA 4W9IA 3PLUA 1RAXA 3QAQA 1SGHA 3ZO5B 3DPDA 4TUUA 3IVFA 2RGFA 4XC2A 2LVQA 5JZEB 5C1ZA 3ZNHB 2LXAA 4MM3A 1WJNA 3EHVA 4HDOA 4XZ4A 4HWIB 4KDLB 4BKSD 2BKRB 4TQ0A 5IA7A 3ZRCA 3QA8A 2NR2A 1V80A 5GMVA 2N9XA 3RT3B 1L2NA 1NDDA 2MP2A 3NOBA 3R66C 3OJ4B 2KDIA 1GG3A 1AARA 2MA9B 3DVGY 2KC2A 5AZHA 4IC7B 2KDFB 4IG7B 1XT9B 2KANA 2DZIA 5DCNA 1RFAA 2JZ3B 2KNBA 4GOCA 4A20A 3L10B 3NZSA 3R7QA 4HCNB 3KW5B 5AZFA 3QWZB 4IM0A 3WAOA 1HE8A 1YX6B 4ZRKA 4WAAA 3TCAA 3QK0A 3A9KA 2GBJA 1FXTB 3QC8B 2KTRA 3JSVB 1L7YA 1WGHA 2DAFA 2FAZA 4BKTA 4FA6A 3JVZX 2J0JA 4K7WA 3GOEA 3PSEB 4JL9A 2LRWA 3V62A 3R7RA 2GOWA 2D07B 1WYWB 4II2B 5DPTA 1KLVA 1IYFA 4W9FA 1LM8B 3MHSD 1UD7A 4MSQB 3D32A 1LXDA 2GMIC 3EFUA 2Z0DB 3WIMA 4DHJD 1UGMA 4X57B 2BKFA 2KC1A 3RYTA 4ASWC 2IBIB 1WR1A 2N1VA 4TKNA 1TZ1A 2I1KA 2LVPA 2LI5A 1OQYA 2FUHB 2AL3A 2IO1B 2WWZA 2ZNVC 4NNJB 1WGDA 5AZGA 3VH3B 2BPSA 2L76A 4FJZA 3ONSA 1WXVA 3DBLI 3A9KB 4MDKE 4IUMB 2L3ZA 4HDQA 2LJ5A 5CHWA 3VDZA 2EMSA 2MBEA 4RM8A 1RLFA 3CF6E 2G4DB 4LCDE 5E6NA 2LGDA 3DVNU 2KX0A 1GC6A 4N9F4 4P7IA 3OAWA 3PV1A 2M8SA 2Y5BB 4MGKE 2LWPA 3AULA 3PREA 2DYBA 2CKHB 2J0KA 4KIKA 4MJSA 4CO7A 4HLEA 3UGBB 4F1SA 3B0AA 3NS8A 3ZIMA 3U30A 3KYDD 3PHXB 1UH6A 3VHTC 4ZDVA 1JRUA 5CTRC 2V4LA 2G3QB 3DVGX 4EUTA 1NI2A 5C23A 1UZXB 3DCGA 4ICUA 2YLMA 4RM9A 2N9EB 2A5UA 4FHJA 1K8RB 3L54A 4G0NB 2KO3A 4GMVA 4II3B 3H9DA 3VFKA 2KKCA 4WWOA 3KH0A 4BVUC 3QIJA 4B6WA 4AWJA 2KWCA 2DX5B 2LGYA 4AJYB 2O2VB 2FCSA 4AP4C 3KYCD 5JH5C 4DHJB 2G4SA 2KZRA 3TL5A 3VXWA 3TBLD 3KUZA 4GB9A 4J6IA 2KFJA 4FN2A 2DYMA 2KN5A 2AL6A 3A1QB 3M63B 3UIPB 3DVNV 5DPWA 5LXHA 3I3TB 3CSFA 3N32A 1WE7A 5G55A 3ZTDA 1WI0A 4BOZB 1C3TA 1EF1A 4ANUA 4G11A 4WWPA 4ZYNA 3VTWA 2MBBB 1E8ZA 2C7NB 2V3SA 3V6EB 3ZTCA 4KDIC 1YJ1A 3H7PB 3KVFB 4GDKB 4M8NA 4A3OA 3ZDMC 3QX1A 4JLCA 1J8CA 1GC7A 2K8CA 2VRRB 2ZEQA 4MGIE 4ZRIA 2MX2A 1E90A 3EC8A 3DDCB 4AUQC 2IO0B 1P1AA 2D2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOW A;  2D11 A;  1ISN A;  2K39 A;  3JSV A;  1WX7 A;  3QQ8 B;  3DBS A;  4GSW A;  3VH4 B;  3NY5 A;  2XK5 B;  3NHE B;  3UQA A;  3ZNZ B;  4CYE A;  2KHW B;  4NQL B;  4W9J A;  5CX3 A;  1EO6 A;  4WWN A;  5AEK B;  3QHT A;  3A4R A;  4IWP A;  4W9C A;  3HHM A;  1XQQ A;  1T0Y A;  2JPH A;  2NVU I;  3JYU A;  3L16 A;  3ZNG C;  5J17 A;  3M3J A;  1P98 A;  4BBN C;  4E3C A;  2IY0 B;  1Q1O A;  2BYE A;  1WE6 A;  2D3G A;  3N30 A;  3BY4 B;  4ICV A;  3UIO B;  3VQI A;  2IO2 B;  2ZPN A;  1WGY A;  3A33 B;  3HM3 A;  4GXB A;  4I6L B;  3IBE A;  2CR5 A;  2L0T A;  1E8W A;  2L7R A;  5HKH A;  1UEL A;  4BKS A;  3ECI A;  2CS4 A;  2KX3 A;  4EZK A;  2JVC A;  4NQK E;  4FUL A;  2PE6 B;  3QCA A;  3HM6 X;  2FID A;  5IAA C;  1E8Y A;  2REX A;  4KVG B;  1GJZ A;  2NCN A;  2CU1 A;  2JWZ A;  2KFK B;  4DHZ B;  2IO3 B;  4OVV A;  3HK0 A;  3B08 A;  3SHQ A;  1ZGU B;  4CHK A;  1XD3 B;  4ANX A;  1H8C A;  2MBQ A;  2R2O A;  2I1J A;  3W1S C;  2BYF A;  3ML9 A;  1EUV B;  2MSE D;  2KWV B;  2KJR A;  1R4N I;  1WXA A;  5CHV C;  4MEM A;  2DAJ A;  3SDL C;  2JZZ A;  3K9O B;  3M62 B;  4GN1 A;  3W1S A;  1P0R A;  3H6N A;  4HCP B;  4IWO A;  4I6P A;  2WX0 A;  5DPR A;  4FBJ B;  1V81 A;  2KWU B;  1OTR B;  4EZJ A;  3ZRF A;  3L0W B;  4IW0 A;  4PS7 A;  1WJU A;  5CHF A;  2O2V A;  3Q3F A;  2JY6 A;  4NY0 A;  3ZW3 A;  2L0F A;  1E7V A;  1LFD A;  2CHZ A;  4LJP B;  4DXA B;  1U4A A;  2KJ6 A;  3AU4 A;  1WY8 A;  2DEN B;  2IYD B;  2KOX A;  3APC A;  5KHO A;  2RPQ A;  3ALB A;  3VUW A;  1SE9 A;  2BWE S;  3A4S C;  3Q3J A;  4E74 A;  3L13 A;  3HIZ A;  3RUL A;  2FCQ A;  4F8C B;  1IP9 A;  3A1Q A;  4W9G A;  1KOT A;  3M95 A;  5DPS A;  2LXC A;  2KVR A;  2ZVO A;  1WH3 A;  2MW5 A;  2LVO A;  1WZ0 A;  4PYZ A;  4IWQ A;  1Y8R C;  5LLI A;  2ASQ A;  2M1M A;  2O6V D;  2C9W B;  2MBH A;  4FLH A;  4KSL C;  3U7D A;  1VD2 A;  3UIN B;  3H7P A;  4FJV B;  4GDK A;  1WRD B;  4MGY E;  2UWQ A;  2OOB B;  4EEW A;  3APD A;  5JHA A;  2CHW A;  2PE9 A;  3V6C B;  1V2Y A;  4DDG D;  4GU2 A;  4NJ7 A;  2J7Q B;  3PVL A;  2WYQ A;  1KM7 A;  4RMA A;  5D2M B;  2R2Q A;  5L83 A;  1V6E A;  3P2B A;  4I6N B;  4FAD A;  1WF9 A;  2RD0 A;  4BBN F;  3PGE A;  2YVC A;  3LDZ E;  1V5O A;  1Z5S B;  2C60 A;  2XK5 A;  1KJT A;  4ZRJ A;  2HJ8 A;  3V61 A;  3VUX A;  4B95 A;  3RUI B;  2FIF A;  3WAN A;  4BKG A;  1OEY J;  2MWS B;  2AYO B;  4PS3 A;  3R3M A;  4WJQ A;  3VVW B;  4EFO A;  4GIV A;  4NPN A;  5JHB A;  2JXX A;  5L95 C;  1VCB A;  2N9P C;  1EF5 A;  4IM2 A;  4W9L A;  1I35 A;  2OJR A;  2NPT B;  3L08 A;  1E5W A;  2J0M A;  4LJO B;  3WAL A;  1OGW A;  4HXD A;  1WM3 A;  4TV3 A;  1Q0W B;  4WJP A;  2GBK A;  2ZVN A;  2BWF A;  2KQS A;  1RRB A;  2LAS A;  2KDE B;  4TQ1 A;  3PT2 B;  1ZW7 A;  2RR9 A;  4BFR A;  1CMX B;  3PRZ A;  2AWT A;  2M0X A;  3WA0 A;  2JF5 A;  4AJW A;  3NZU A;  2RSU A;  2EMT A;  2KJH B;  2XBB C;  2N7D A;  3DQV A;  2KLG A;  3T8M A;  2B3A A;  2KFK A;  3DBR I;  2KLC A;  2M4N A;  1V86 A;  2L00 B;  2O6V B;  2PEA A;  3B1L X;  4MEL A;  1WGR A;  4NAW B;  2AEH A;  4MH0 E;  4DWF A;  3RD2 A;  4M8M A;  4IM3 A;  1PQS A;  2K6D B;  2L05 A;  3A9J B;  3PS6 A;  1GNU A;  3WAM A;  5E6P A;  2Z0E B;  2IY1 B;  2N4F A;  4HPM B;  2KK8 A;  1WXS A;  4LDT D;  3KUC B;  2KDB A;  3LJ3 A;  3PTF C;  2JUO A;  3ML8 A;  3OLM D;  1TGZ B;  1YD8 U;  1V49 A;  2FNJ B;  4GDL B;  2G45 B;  1V9J A;  1WFY A;  2KTF A;  3O65 B;  1C1Y B;  2KD0 A;  4FHK A;  4PS8 A;  1YIW A;  2FCN A;  3PHW B;  1J19 A;  3RCZ A;  4NJ6 A;  4A3P A;  2MBO A;  4W9D A;  4W9H A;  5LXI B;  2DZM A;  3QAR A;  1YX5 B;  1WZ3 A;  3UQB A;  3VTU A;  1TTN A;  2L8J A;  3H1U A;  4G3X B;  2D10 A;  2NBU A;  3IFW B;  2DZJ A;  4PYU A;  3CST A;  2V1Y A;  1UBQ A;  2WX1 A;  4MSM B;  4EKU A;  1P9D U;  2GBR A;  2K25 A;  3T9L A;  1P3Q U;  1I42 A;  3V60 A;  3PPA A;  2JRH A;  1S3S G;  2N1W A;  2ZZP B;  1D3Z A;  3VTV A;  1YQB A;  2GBM A;  4DHZ E;  4BOS C;  2NBV B;  2MCN B;  3ZLZ A;  3S2A A;  4KZ0 A;  3N3K B;  4YL8 A;  1Z2M A;  4F7Z A;  2NBW B;  4M0W B;  2KXJ A;  4WJN A;  1OEY A;  2NS5 A;  4HPL B;  2DZK A;  1Q5W B;  2MRP A;  1WJ4 A;  4JGH B;  3U8Z A;  4EZL A;  4ANW A;  1A5R A;  2QHO A;  1QZE A;  4GGQ A;  1WGG A;  3ZKJ C;  3OJ3 A;  2PJH A;  5EDS A;  4LDT B;  3TJP A;  2C5L C;  2MP2 B;  4K1R B;  2ZCB A;  4EOY A;  2DHZ A;  3VAW A;  3IG3 A;  2LD9 A;  2ZPY A;  2LUE A;  2DYO A;  2ZCC A;  3WAP A;  1UBI A;  4HJK A;  1WM2 A;  4WQO B;  4K7U A;  4KSK C;  3X23 A;  2CHX A;  4AOF A;  3TIX A;  3PLV A;  3KUD B;  2C7H A;  3IHP C;  1J0G A;  2MQJ A;  2NPT A;  3GZN I;  2W9N A;  3PRP B;  3EEC A;  5FR6 A;  5TR5 A;  3APF A;  1NBF C;  1TBE A;  2KTR B;  3VUY A;  3W1Y A;  2FCM A;  3ZNI D;  2K6Q A;  2N7E A;  4E71 A;  4HVB A;  1G6J A;  2GBN A;  5D94 A;  2JRI B;  2BGF A;  4DK5 A;  2HE7 A;  3SD5 A;  1E8X A;  1WIA A;  3ZVV A;  1R4M I;  2HTH A;  2IZV B;  2JT4 B;  2KQ7 A;  3DBH I;  3PZD A;  4NAW A;  2O6V A;  3X0W A;  4OVU A;  3K9P B;  4FJY A;  3PRM B;  3A9J A;  5D6J B;  2M17 A;  1WMH A;  2MLB A;  2K8H A;  1GUA B;  3AU5 A;  2EKE C;  2LZ6 A;  1X1M A;  3L17 A;  1WX9 A;  2UYZ B;  5G2N A;  3ZUN A;  1WR6 E;  2HD5 B;  4URK A;  4JQW C;  3AI5 A;  4K7S A;  2KMC A;  1F9J A;  2A4Z A;  2K1F A;  4HK2 A;  4GDL A;  3RZF A;  2KMA A;  2PPH A;  1ZKH A;  2BYV E;  2C7M B;  4KZC A;  4KV2 A;  2WDT B;  1BT0 A;  3H7S A;  3MJW A;  4B9K A;  4G50 A;  1WX8 A;  1M94 A;  1SIF A;  3MTN B;  4MGZ E;  5E6O A;  2ZNV B;  3CMM B;  2XEW A;  5KHQ A;  4ANV A;  3UF8 A;  3SU8 X;  2LGX A;  3ENE A;  1H4R A;  1LQB A;  4KIK B;  4MJS B;  4DBG A;  1V5T A;  3TMP B;  2K8B A;  3AXC A;  4K81 A;  4W9K A;  3BIN A;  4JIO U;  1IPG A;  2LRU A;  3C0R B;  4XX5 A;  4W9E A;  4DDI D;  1MG8 A;  1WMH B;  2ZJD A;  3ZDT A;  4WJO A;  5D7G A;  1WJ6 A;  5BO4 B;  1WXM A;  5J2R A;  1E7U A;  2BF8 B;  3JW0 X;  2Z59 B;  1S1Q B;  3RZW C;  5J18 A;  3QJZ A;  4W9I A;  3PLU A;  1RAX A;  3QAQ A;  1SGH A;  3ZO5 B;  3DPD A;  4TUU A;  3IVF A;  2RGF A;  4XC2 A;  2LVQ A;  5JZE B;  5C1Z A;  3ZNH B;  2LXA A;  4MM3 A;  1WJN A;  3EHV A;  4HDO A;  4XZ4 A;  4HWI B;  4KDL B;  4BKS D;  2BKR B;  4TQ0 A;  5IA7 A;  3ZRC A;  3QA8 A;  2NR2 A;  1V80 A;  5GMV A;  2N9X A;  3RT3 B;  1L2N A;  1NDD A;  2MP2 A;  3NOB A;  3R66 C;  3OJ4 B;  2KDI A;  1GG3 A;  1AAR A;  2MA9 B;  3DVG Y;  2KC2 A;  5AZH A;  4IC7 B;  2KDF B;  4IG7 B;  1XT9 B;  2KAN A;  2DZI A;  5DCN A;  1RFA A;  2JZ3 B;  2KNB A;  4GOC A;  4A20 A;  3L10 B;  3NZS A;  3R7Q A;  4HCN B;  3KW5 B;  5AZF A;  3QWZ B;  4IM0 A;  3WAO A;  1HE8 A;  1YX6 B;  4ZRK A;  4WAA A;  3TCA A;  3QK0 A;  3A9K A;  2GBJ A;  1FXT B;  3QC8 B;  2KTR A;  3JSV B;  1L7Y A;  1WGH A;  2DAF A;  2FAZ A;  4BKT A;  4FA6 A;  3JVZ X;  2J0J A;  4K7W A;  3GOE A;  3PSE B;  4JL9 A;  2LRW A;  3V62 A;  3R7R A;  2GOW A;  2D07 B;  1WYW B;  4II2 B;  5DPT A;  1KLV A;  1IYF A;  4W9F A;  1LM8 B;  3MHS D;  1UD7 A;  4MSQ B;  3D32 A;  1LXD A;  2GMI C;  3EFU A;  2Z0D B;  3WIM A;  4DHJ D;  1UGM A;  4X57 B;  2BKF A;  2KC1 A;  3RYT A;  4ASW C;  2IBI B;  1WR1 A;  2N1V A;  4TKN A;  1TZ1 A;  2I1K A;  2LVP A;  2LI5 A;  1OQY A;  2FUH B;  2AL3 A;  2IO1 B;  2WWZ A;  2ZNV C;  4NNJ B;  1WGD A;  5AZG A;  3VH3 B;  2BPS A;  2L76 A;  4FJZ A;  3ONS A;  1WXV A;  3DBL I;  3A9K B;  4MDK E;  4IUM B;  2L3Z A;  4HDQ A;  2LJ5 A;  5CHW A;  3VDZ A;  2EMS A;  2MBE A;  4RM8 A;  1RLF A;  3CF6 E;  2G4D B;  4LCD E;  5E6N A;  2LGD A;  3DVN U;  2KX0 A;  1GC6 A;  4N9F 4;  4P7I A;  3OAW A;  3PV1 A;  2M8S A;  2Y5B B;  4MGK E;  2LWP A;  3AUL A;  3PRE A;  2DYB A;  2CKH B;  2J0K A;  4KIK A;  4MJS A;  4CO7 A;  4HLE A;  3UGB B;  4F1S A;  3B0A A;  3NS8 A;  3ZIM A;  3U30 A;  3KYD D;  3PHX B;  1UH6 A;  3VHT C;  4ZDV A;  1JRU A;  5CTR C;  2V4L A;  2G3Q B;  3DVG X;  4EUT A;  1NI2 A;  5C23 A;  1UZX B;  3DCG A;  4ICU A;  2YLM A;  4RM9 A;  2N9E B;  2A5U A;  4FHJ A;  1K8R B;  3L54 A;  4G0N B;  2KO3 A;  4GMV A;  4II3 B;  3H9D A;  3VFK A;  2KKC A;  4WWO A;  3KH0 A;  4BVU C;  3QIJ A;  4B6W A;  4AWJ A;  2KWC A;  2DX5 B;  2LGY A;  4AJY B;  2O2V B;  2FCS A;  4AP4 C;  3KYC D;  5JH5 C;  4DHJ B;  2G4S A;  2KZR A;  3TL5 A;  3VXW A;  3TBL D;  3KUZ A;  4GB9 A;  4J6I A;  2KFJ A;  4FN2 A;  2DYM A;  2KN5 A;  2AL6 A;  3A1Q B;  3M63 B;  3UIP B;  3DVN V;  5DPW A;  5LXH A;  3I3T B;  3CSF A;  3N32 A;  1WE7 A;  5G55 A;  3ZTD A;  1WI0 A;  4BOZ B;  1C3T A;  1EF1 A;  4ANU A;  4G11 A;  4WWP A;  4ZYN A;  3VTW A;  2MBB B;  1E8Z A;  2C7N B;  2V3S A;  3V6E B;  3ZTC A;  4KDI C;  1YJ1 A;  3H7P B;  3KVF B;  4GDK B;  4M8N A;  4A3O A;  3ZDM C;  3QX1 A;  4JLC A;  1J8C A;  1GC7 A;  2K8C A;  2VRR B;  2ZEQ A;  4MGI E;  4ZRI A;  2MX2 A;  1E90 A;  3EC8 A;  3DDC B;  4AUQ C;  2IO0 B;  1P1A A;  2D2Q A; 
#chains in the Genus database with same CATH topology
 3DOW A;  4L2Y A;  1L4D B;  3VH4 B;  3Q8A A;  1T6B X;  3NHE B;  2BB6 A;  3ZNZ B;  4CYE A;  5BMG A;  4W9J A;  4WWN A;  4IWP A;  3HHM A;  2NVU I;  4LNN A;  1C4C A;  3M3J A;  1GB1 A;  1Q1O A;  2BYE A;  2D3G A;  3TUO A;  4FAD A;  1K52 A;  3W2D A;  2AQ3 B;  3NVY A;  1E8W A;  2L7R A;  3NVZ A;  2JVC A;  3TEZ A;  2FID A;  4KVG B;  1GJZ A;  5IO9 A;  4OVV A;  2JYT A;  1BXT A;  2LHD A;  1R4N I;  3IT4 B;  4OVZ A;  2JZZ A;  3AED B;  3M62 B;  2IGG A;  4IWO A;  5DPR A;  1N63 A;  1D5Z C;  4EZJ A;  3C8Y A;  3L0W B;  3P4Q B;  2J4X A;  2L0F A;  1LFD A;  2CHZ A;  1YNT E;  4LLG M;  1CK1 A;  2IYD B;  5KHO A;  3AEC B;  3Q3J A;  4E74 A;  4USA A;  3HIZ A;  2FCQ A;  1IP9 A;  3A1Q A;  4A9A A;  3M95 A;  1VDV A;  2HDE A;  2MW5 A;  1K53 A;  1Y8R C;  4IWQ A;  2M1M A;  4TMA B;  4KSL C;  1VD2 A;  4FJV B;  4GDK A;  4MGY E;  3APD A;  2QJL A;  3VR8 B;  3V6C B;  1N60 A;  4NJ7 A;  2J7Q B;  3NUH B;  2HJ1 A;  5G5H A;  4O1N A;  1SB3 C;  2JSV X;  1TIF A;  3N9Y C;  1E10 A;  3V61 A;  2HJ8 A;  3KQ4 A;  4B95 A;  5LNK 1;  2WU2 B;  2WXM A;  2MEK A;  3BK2 A;  3VVW B;  4EFO A;  4GIV A;  5JHB A;  5L95 C;  2JXX A;  1EF5 A;  3RFZ B;  4US8 A;  5JXV A;  1E5W A;  3RNA C;  4HXD A;  1WM3 A;  1SIJ A;  2BWF A;  2KQS A;  2LAS A;  2KDE B;  3Q8F A;  1CMX B;  1D5M C;  2AWT A;  2WDR B;  4WWM A;  4L23 A;  2RSU A;  1YMH E;  3DQV A;  2QIL A;  2M4N A;  4MEL A;  1WGR A;  4H2A A;  1PQS A;  2K6D B;  4LDT D;  3KUC B;  4YSX B;  5C3J B;  2JUO A;  1SJE D;  1V49 A;  2FNJ B;  2G45 B;  1L0Y B;  1V9J A;  4C56 C;  1C1Y B;  3AE7 B;  2FCN A;  1JWM D;  1JW9 D;  1R4N B;  4A55 A;  2X8X X;  2JXT A;  5LXI B;  1PGX A;  2ICI A;  3E56 A;  1K51 A;  3H1U A;  2DZJ A;  1T0S C;  2GBR A;  2WXR A;  3V60 A;  1S3S G;  4LNO A;  1FEH A;  1YQB A;  2GBM A;  3S2A A;  4WUR A;  4F7Z A;  4M0W B;  2KXJ A;  4WJN A;  2ZW1 A;  1Q5W B;  3BVG A;  4JGH B;  3Q8C A;  3U8Z A;  2QMT A;  4GGQ A;  5EDS A;  1I4G A;  3AEA B;  2BT6 A;  3N1Z C;  1WWT A;  1NEK B;  2QC8 A;  2DYO A;  3AEB B;  4WQO B;  1UUP A;  4KSK C;  4YTM B;  1QOA A;  2K22 A;  3PLV A;  1KF6 B;  1J0G A;  2MQJ A;  3GZN I;  2BB5 A;  3APF A;  5D3I B;  3VUY A;  4E71 A;  3ZNI D;  1G6J A;  2N7E A;  2GBN A;  2RDG A;  2WXP A;  3TEX A;  2HTH A;  4P1C C;  1KTK A;  2JX5 A;  3AV8 A;  4OVU A;  1C79 A;  3GB1 A;  3PRM B;  5D6J B;  1J7B A;  3AU5 A;  1N5X A;  1WX9 A;  2UYZ B;  5G2N A;  3ZUN A;  3RMK C;  1UWM A;  3AI5 A;  2K1F A;  3OWE B;  4RGN A;  2BYV E;  3AEG B;  4KGR A;  2WDT B;  1BT0 A;  1QQR A;  3TSS A;  1ZPS A;  3MTN B;  3VRB B;  2LGX A;  3ENE A;  3ZJU A;  5EE9 A;  3AXC A;  3RNG C;  3PZ7 A;  4JIO U;  3C0R B;  4N59 A;  1VZ7 A;  4D2K A;  2D3C A;  3ZDT A;  1WJ6 A;  1WXM A;  1E7U A;  3HUI A;  1WXQ A;  3QJZ A;  4W9I A;  1L0X B;  1RAX A;  4DXG A;  3QAQ A;  1SGH A;  3ZO5 B;  1YQ3 B;  1TY2 A;  3IVF A;  2K5P A;  2D3A A;  4M0W A;  2JZP A;  3NG0 A;  2FE8 A;  4P16 A;  4BAX A;  4XE0 A;  2NMQ A;  5GMV A;  1DYQ A;  3RT3 B;  3NRZ A;  1WSP A;  1GG3 A;  2KDI A;  3DVG Y;  3RNB C;  4IC7 B;  4IG7 B;  4A20 A;  1EWC A;  1T0Q C;  4N58 A;  4RCO A;  3QWZ B;  2WXL A;  4IDI A;  3N1Y C;  4ZRK A;  1AWD A;  1PGB A;  3QK0 A;  2GBJ A;  4FA6 A;  2DAF A;  2J0J A;  3V62 A;  1VLB A;  2D07 B;  4XYC A;  3GZN B;  5DPT A;  1KLV A;  1LM8 B;  3MHS D;  1MJD A;  1FXA A;  2W3S A;  1AN8 A;  1L0V B;  2L83 A;  1FD6 A;  3RYT A;  4ASW C;  1WR1 A;  4R3D A;  1OQY A;  2FUH B;  3DWG C;  2AL3 A;  3I63 C;  3Q6B A;  3ONS A;  3DBL I;  2TSS A;  3ETR A;  2LJ5 A;  1JCK B;  2H89 B;  2LGD A;  1E0Z A;  3IT6 B;  1UWX A;  3PV1 A;  2M8S A;  2VZK B;  4OHJ A;  3AUL A;  3CIR B;  4HLE A;  1XCQ L;  4F1S A;  5HI1 A;  3VHT C;  3EUB 2;  1JRU A;  5I4D A;  2QIE B;  2A5U A;  3Q14 C;  3W9C B;  2KKC A;  4WWO A;  2LJI A;  3MHZ A;  4AWJ A;  2V4I B;  2DX5 B;  2FCS A;  5BYS A;  2IND C;  4RNA A;  3GP7 A;  3RNF C;  4AP4 C;  2CJN A;  3AMZ A;  3TBL D;  4GB9 A;  3Q8E A;  2KFJ A;  2DYM A;  1PDX A;  2AL6 A;  2KAC A;  3UIP B;  1T5X D;  3CSF A;  1WI0 A;  2N7J A;  1C3T A;  1L4Z B;  1BUI C;  2W82 A;  3VTW A;  2MBB B;  2C7N B;  2V3S A;  2I38 A;  3H7P B;  4JLC A;  1J8C A;  2WXJ A;  3P4S B;  3B2G A;  2K8C A;  3IAM 1;  3EC8 A;  4AUQ C;  4OZC A;  1P1A A;  1FRD A;  2K39 A;  1WX7 A;  3E9S A;  2INP E;  2XK5 B;  3UQA A;  2NTT A;  4NQL B;  4W9C A;  1C9F A;  1XQQ A;  2WP9 B;  3JYU A;  1DOY A;  1P98 A;  4RGT A;  1TKE A;  1I4R A;  4A6Q A;  3T3N A;  4ICV A;  2ZPN A;  1WGY A;  3A33 B;  3HM3 A;  4I6L B;  2CS4 A;  2KX3 A;  4YWG G;  2PE6 B;  3QCA A;  1SBB B;  2JWZ A;  5HHD G;  1E6E B;  5IN7 A;  4CHK A;  3CWI A;  3VR9 B;  2MBQ A;  2I1J A;  1ZDV A;  2BYF A;  3ML9 A;  1V1P B;  1CQV A;  1EUV B;  4WQM A;  2KJR A;  3DBL B;  5CHV C;  4MEM A;  5EE3 A;  4RGM A;  3H6N A;  1N6Z A;  1YJJ A;  4FBJ B;  1V81 A;  1ZXH A;  4PT5 A;  2PKO A;  4NY0 A;  4LJP B;  4DXA B;  3P42 A;  3VUW A;  2KVZ A;  1EWY C;  2PTL A;  3L13 A;  1C76 A;  4KKI A;  2WXK A;  2L52 A;  2LXC A;  2ZVO A;  5IKC M;  1WZ0 A;  4PYZ A;  5LLI A;  1SE3 A;  3UIN B;  1YN4 A;  3H7P A;  2UWQ A;  1YJI A;  2CHW A;  4GU2 A;  2J42 A;  1L6U A;  1KM7 A;  4RMA A;  5L83 A;  4B0M A;  2RD0 A;  4BBN F;  3PGE A;  2C60 A;  2OJW A;  2XK5 A;  2INC C;  1KJT A;  3VUX A;  3WAN A;  5IOI A;  4BKG A;  4JWU C;  2MWS B;  4PS3 A;  4NPN A;  1VCB A;  2N9P C;  2OJR A;  2W54 A;  3GE8 C;  2J0M A;  1TKY A;  4LJO B;  1Q0W B;  2E3T A;  2OED A;  2BS4 B;  2LMC A;  2RR9 A;  4BFR A;  3PRZ A;  1TT5 B;  3NZU A;  2XBB C;  2KLG A;  2RDH A;  3DBR I;  4NAW B;  2PEA A;  2Z8L A;  3RD2 A;  1RFK A;  2L05 A;  3Q69 A;  1V1P A;  5EE1 A;  3J9C A;  4HPM B;  2SEB D;  3LJ3 A;  3ML8 A;  3EFC A;  1YD8 U;  2WGS A;  1M4V A;  2GLS A;  1XCT L;  2KAJ A;  3SEB A;  1WFY A;  2KTF A;  4FHK A;  2KD0 A;  1YIW A;  4C4V B;  4ARC A;  4NJ6 A;  4W9D A;  3QAR A;  1YX5 B;  3VTU A;  1ET6 A;  1JML A;  3KLS X;  2NBU A;  1ZUD 2;  4PYU A;  3CST A;  2WX1 A;  3DHH C;  2K25 A;  1P3Q U;  3PPA A;  1CJE A;  1TZO A;  4LK0 M;  2KMM A;  1EM7 A;  1FNU A;  1NYQ A;  4MM3 B;  2DZK A;  4C00 A;  2CJO A;  2DLB A;  2W55 A;  1A5R A;  1QZE A;  3U4E G;  3ZKJ C;  3OJ3 A;  2PJH A;  4LDT B;  3TJP A;  2MH7 A;  1L5P A;  2C5L C;  2MP2 B;  4K1R B;  4EOY A;  2LD9 A;  2ZPY A;  1F2R I;  4C80 A;  3WAP A;  1SXT A;  5IP4 D;  4NAM A;  1SEB D;  2CHX A;  2C7H A;  2G1E A;  3P1M A;  1MPE A;  1XLN A;  1UGJ A;  4JX1 C;  2Y3A A;  3W1Y A;  2FCM A;  2VH2 A;  2ACZ B;  4KKJ A;  2W3R A;  4DK5 A;  3SD5 A;  1EU3 A;  3ZVV A;  4Q2J A;  2IZV B;  2JT4 B;  4NAW A;  1QIL A;  1J7A A;  1WMH A;  2MLB A;  4ZOH C;  2EKE C;  3L17 A;  4OZA A;  1WR6 E;  2V3N A;  4JQW C;  3DBR B;  4KGS A;  1F9J A;  4HK2 A;  3RZF A;  3URY A;  2KMA A;  2PPH A;  3I9V 1;  1ZKH A;  2C7M B;  4KZC A;  3TEW A;  4C4V A;  1STE A;  2BS2 B;  3H7S A;  4G50 A;  3V05 A;  1SIF A;  2ZNV B;  2MJ3 A;  5KHQ A;  4HKQ A;  3U7Z A;  1H4R A;  1LQB A;  4DBG A;  4ZRP A;  4K81 A;  4W9K A;  2LRU A;  4XGA B;  4XX5 A;  4W9E A;  4YTP B;  1MG8 A;  2ZJD A;  1F2R C;  5FKA C;  2BF8 B;  2FUG 1;  1YOV B;  3RZW C;  5J18 A;  2ZW0 A;  3PLU A;  4TUU A;  4NZL B;  2RGF A;  4XC2 A;  4HRO A;  4MM3 A;  3EHV A;  4HDO A;  4KDL B;  4BKS D;  4TQ0 A;  2EEL A;  1AW7 A;  5IA7 A;  3QA8 A;  2WS3 B;  2NR2 A;  1V80 A;  5H92 C;  2QEJ C;  1L2N A;  1UF0 A;  2MP2 A;  3R66 C;  2MA9 B;  4XDC A;  2KC2 A;  3I5J C;  5AZH A;  2KDF B;  2WXH A;  1KH0 A;  2L1A A;  3NZS A;  3R7Q A;  2KN4 A;  3KW5 B;  4YSZ B;  1HE8 A;  3UI3 A;  3TCA A;  3ZQ4 A;  3O13 A;  3ZGZ A;  3JSV B;  1HXY D;  4K7W A;  4M00 A;  2QSD A;  2GOW A;  3AE5 B;  2GRI A;  3RNE C;  1IUE A;  3MC8 A;  3P4P B;  1WGK A;  2DWQ A;  1LXD A;  3EFU A;  3GS2 A;  4DHJ D;  1T3Q A;  2KC1 A;  2IBI B;  2JU6 X;  3AEF B;  4TKN A;  1FNW A;  2IO1 B;  3B9J A;  1UNS A;  3AM9 A;  3VH3 B;  1V1O A;  2L76 A;  2MBE A;  1RLF A;  1QKZ A;  2G4D B;  1FIQ A;  1PUT A;  4M01 A;  3DVN U;  1J7C A;  1FPY A;  3OAW A;  4WAF A;  1FMA D;  3BVZ A;  3Q8B A;  4MGK E;  3B0A A;  3NS8 A;  3U30 A;  3KYD D;  2K3U A;  1VZ6 A;  1C77 A;  4ZDV A;  3IXS A;  4WH4 A;  5C23 A;  2YLM A;  1K8R B;  3L54 A;  4G0N B;  2KO3 A;  4GMV A;  4II3 B;  1NEN B;  4P1B C;  1XEE A;  3U2S C;  3QIJ A;  4ZHP A;  1FO4 A;  3TL5 A;  3VXW A;  4ITK A;  4J6I A;  4FN2 A;  1XO3 A;  2WXO A;  3BYT B;  5DPW A;  5LXH A;  2B76 B;  3N32 A;  1WE7 A;  4G11 A;  4KDI C;  1TS4 A;  4S17 A;  2VRR B;  4MGI E;  2PW9 A;  3SFD B;  4REZ A;  3PT2 B;  2D2Q A;  2D11 A;  1ISN A;  3JSV A;  3DBS A;  3NY5 A;  3AE4 B;  1GOZ A;  2KHW B;  5AEK B;  3A4R A;  2D3B A;  1T0Y A;  2JPH A;  5J17 A;  2V0G A;  1JWB D;  2LHE A;  4BBN C;  2KYW A;  2IY0 B;  4US9 A;  1WE6 A;  3BY4 B;  3VQI A;  2IO2 B;  4GXB A;  5T8I A;  2L0T A;  5HKH A;  4MT5 A;  1SE4 A;  5HFY A;  4EZK A;  4NQK E;  4FUL A;  5IAA C;  1E8Y A;  2REX A;  4MAC A;  3B08 A;  1F1H A;  1ZGU B;  1XD3 B;  4ANX A;  1NVI D;  2R2O A;  2KWV B;  1WXA A;  1MG4 A;  2DAJ A;  4IKG A;  4GN1 A;  3W1S A;  1P0R A;  4HCP B;  4I6P A;  1TS5 A;  1D6E C;  3IAS 1;  4WIP A;  5AUK A;  2KWU B;  1OTR B;  3ZRF A;  4PS7 A;  5CHF A;  4BZA A;  3Q3F A;  1E7V A;  2KJ6 A;  3AU4 A;  2BYT A;  2DEN B;  2KOX A;  4S0R A;  1SE9 A;  3A4S C;  3RUL A;  4F8C B;  1ZE3 D;  1WH3 A;  2LVO A;  3ABV B;  2O6V D;  1KLG D;  2C9W B;  2MBH A;  4FLH A;  3U7D A;  3I57 A;  1YQ4 B;  2OOB B;  1RM6 C;  5JHA A;  2PE9 A;  2WYQ A;  5D2M B;  2R2Q A;  1V6E A;  1WF9 A;  2YVC A;  1V5O A;  4ZRJ A;  5BYR A;  1OEY J;  4LNI A;  3R3M A;  1I35 A;  2J52 A;  4IM2 A;  4W9L A;  3L08 A;  4ZHO A;  3WAL A;  1OGW A;  4TV3 A;  4WJP A;  2GBK A;  3W5U B;  1RRB A;  4TQ1 A;  1ZW7 A;  2LFI A;  5D3D A;  1T0R C;  2M0X A;  3WA0 A;  2M56 B;  2KJH B;  3DWM A;  2N7D A;  2PVO D;  4HKZ E;  3T8M A;  3ECI A;  1V86 A;  1XLO A;  2JQR B;  2AEH A;  4IM3 A;  1JAL A;  2YEP F;  3A9J B;  3PS6 A;  2EKI A;  3WAM A;  1MHH E;  4JPS A;  1D5X C;  2IPK D;  2Z0E B;  2IY1 B;  1WXS A;  2BS3 B;  2KDB A;  4EE2 A;  3ZJV A;  2KQ4 X;  3OLM D;  1TGZ B;  3FIL B;  4GDL B;  1E9M A;  3NVW A;  3O65 B;  1TY0 A;  1TKG A;  4LTU A;  4PS8 A;  1J19 A;  3AE6 B;  1ET9 A;  4ZRQ A;  2WDV B;  2MBO A;  4AQ7 A;  4W9H A;  5BMI A;  1FFU A;  1TTN A;  2L8J A;  4HRS A;  1A70 A;  2R61 A;  3NZ3 A;  4G3X B;  2Y5C A;  2V1Y A;  4MSM B;  4ARI A;  3T9L A;  1VR9 A;  1I42 A;  4RF0 A;  1WYG A;  2LEK A;  2N1W A;  2ZZP B;  3ZXV A;  5H8Y E;  1D3Z A;  1ZDX A;  3VTV A;  4BOS C;  2MJD A;  2JYE A;  4KZ0 A;  4YTN B;  3N3K B;  1Z2M A;  2NBW B;  2NS5 A;  2MRP A;  4EZL A;  4ANW A;  5MPO A;  1EU4 A;  2KWD A;  4OW0 A;  3EA6 A;  1N61 A;  2ZCB A;  3VAW A;  3IG3 A;  1UBI A;  2XN9 C;  4K7U A;  3X23 A;  3TIX A;  4YXD B;  3ZJT A;  3KUD B;  3DBH B;  3HVD A;  2E6X A;  3PRP B;  5FR6 A;  1I4X A;  3ZYY X;  2WLB A;  2LUM A;  3R2T A;  5TSS A;  2KTR B;  2JRI B;  2BGF A;  4KX6 B;  4P6V F;  2HE7 A;  4LNF A;  1E8X A;  1WIA A;  3MC9 A;  2KQ7 A;  1C4A A;  4FJY A;  3HVZ A;  3A9J A;  1GUA B;  1I7H A;  2LZ6 A;  4YT0 B;  2HD5 B;  1HEZ E;  3P4R B;  1ZOY B;  2KMC A;  3FIL A;  4GDL A;  4KV2 A;  1WX8 A;  1M94 A;  5E6O A;  3CMM B;  1B9R A;  2ON8 A;  4RF1 A;  3SU8 X;  2N9L A;  3Q3N C;  4MJS B;  3TMP B;  2RMM A;  3BIN A;  1WMH B;  2IGD A;  4WJO A;  5D7G A;  5J2R A;  3BK1 A;  3JW0 X;  2Z59 B;  2Y5P A;  1FM0 D;  2ONQ A;  1HTQ A;  1JWS D;  2CU3 A;  3DPD A;  2LVQ A;  5JZE B;  5C1Z A;  2LXA A;  1WJN A;  4HWI B;  1QLB B;  1FCL A;  3B2F A;  2N9X A;  1NDD A;  1SE2 A;  2KAN A;  5BYQ A;  2J53 A;  1E7P B;  5DCN A;  2KNB A;  2PMV A;  1F77 A;  2INN E;  3L10 B;  3HRD D;  4A90 A;  4WAA A;  1LO5 D;  3A9K A;  2KTR A;  1L7Y A;  2FAZ A;  1QT9 A;  3GOE A;  5C2T B;  3PSE B;  3AE1 B;  4JL9 A;  1WYW B;  1IYF A;  1JWU D;  1P7E A;  1MI0 A;  1HZ5 A;  1C4P A;  2RDB C;  2N0S B;  2GMI C;  2Z0D B;  3WIM A;  1FCC C;  2BKF A;  1OQQ A;  1Y56 A;  5AUI A;  4DXF A;  1TZ1 A;  5G5G A;  3NJT A;  1MHX A;  4HPP A;  2ZNV C;  1RYJ A;  1PGA A;  1WGD A;  3KWL A;  2K0P A;  1WXV A;  4MDK E;  4IUM B;  4HDQ A;  5CHW A;  3VDZ A;  3CF6 E;  3ZXR A;  1HTO A;  5E6N A;  4N9F 4;  1HQR D;  2LWP A;  1FRR A;  2DYB A;  2CKH B;  2J0K A;  4MJS A;  3AN1 A;  4CO7 A;  3UGB B;  1QF6 A;  3WCQ A;  1AYF A;  3PHX B;  1UH6 A;  1F0Z A;  3RNC C;  5CTR C;  3BZD B;  2G3Q B;  3DVG X;  1FNV A;  1NI2 A;  1UZX B;  2UU7 A;  1ACC A;  2N9E B;  2WDQ B;  5E6J A;  3VFK A;  2NTS A;  4JWS C;  4B6W A;  2LGY A;  1OFF A;  2O2V B;  3LYY A;  1SJH D;  4K3B A;  3NS1 A;  2X38 A;  5JH5 C;  4DHJ B;  2G4S A;  2KZR A;  1IBX B;  1JQ4 A;  3Q3M C;  4PK1 A;  2KN5 A;  3M63 B;  3I3T B;  2I2Y A;  3ZTD A;  4BOZ B;  1EF1 A;  4ANU A;  2KDM A;  4WWP A;  4JE3 B;  1N62 A;  4J3O D;  4ZYN A;  3V6E B;  1E8Z A;  3MC0 B;  3ZTC A;  3N20 C;  1I4Q A;  3KVF B;  4A3O A;  4M8N A;  2G9H D;  2HTM E;  1KRH A;  1GC7 A;  4NJC A;  2ZEQ A;  3AH7 A;  2MX2 A;  1E90 A;  3DDC B;  1JWA D;  3LXF A;  2DNF A;  5FK9 C;  4NNJ B;  4XWT A;  1SF0 A;  3QQ8 B;  3P63 A;  4GSW A;  3RPF C;  5CX3 A;  1EO6 A;  3QHT A;  3L16 A;  4A8X C;  3ZNG C;  3FKY A;  4E3C A;  4HJG E;  3UIO B;  3N30 A;  3IBE A;  2CR5 A;  1UEL A;  4BKS A;  2OHF A;  1C78 A;  2SAK A;  3HM6 X;  1DGJ A;  2NCN A;  2CU1 A;  2KFK B;  4DHZ B;  2IO3 B;  3HK0 A;  3SHQ A;  1B1Z A;  1QOB A;  3LB8 C;  4TSS A;  4RGO S;  3SR6 A;  1H8C A;  3W1S C;  2MSE D;  3PO0 A;  3SDL C;  1FXI A;  3K9O B;  4KGT A;  3RN9 C;  1ESF A;  5HG2 A;  2WX0 A;  2WQY B;  3Q3O C;  4ZYS A;  3GE3 C;  4IW0 A;  1WJU A;  5EE0 A;  1VRA B;  2AQ2 B;  2O2V A;  2JY6 A;  3ZW3 A;  2BTE A;  2QDF A;  4K3C A;  3AEE B;  1U4A A;  4OZB A;  3MJ5 A;  1WY8 A;  1IBX A;  3APC A;  2RPQ A;  3ALB A;  2BWE S;  4W9G A;  1KOT A;  5DPS A;  2KVR A;  2RPV A;  2H88 B;  2ASQ A;  2XNA C;  1TS2 A;  3DHI C;  1WRD B;  3FC4 A;  4EEW A;  3AE8 B;  2LGS A;  1V2Y A;  4DDG D;  2WXQ A;  1MFW A;  3BVM A;  3PVL A;  3P2B A;  4I6N B;  3BWU D;  2YEP B;  1HZ6 A;  1XLQ A;  3LDZ E;  2KT7 A;  1Z5S B;  3RUI B;  2FIF A;  2AYO B;  1GB4 A;  4WJQ A;  1XF5 L;  2NPT B;  2FBW B;  2DBY A;  2ZVN A;  3OG5 A;  1VZ8 A;  1TYG B;  2WXN A;  3W5V B;  2JF5 A;  2D5G A;  4AJW A;  2JWU A;  4XWW A;  2EMT A;  2B3A A;  2KFK A;  5E6P A;  2KLC A;  3B1L X;  2L00 B;  3ZDM C;  2O6V B;  2IJ0 A;  4MH0 E;  4DWF A;  4M8M A;  4L1B A;  3NVV A;  2V9H A;  2IGH A;  1GNU A;  4LNK A;  1F52 A;  1LGR A;  2N4F A;  2KK8 A;  2LGI A;  2WHI A;  3PTF C;  3EGR A;  1QOG A;  4CQN A;  1K50 A;  3Q2A C;  1KFY B;  3PHW B;  3RCZ A;  2BQQ A;  4A3P A;  4GLS C;  1ZXI A;  3UQB A;  2DZM A;  1WZ3 A;  3R8B A;  1PFD A;  2D10 A;  3AB5 A;  3IFW B;  1UBQ A;  4EKU A;  1P9D U;  2JRH A;  4IOI E;  1JRO A;  4DHZ E;  2NBV B;  2MCN B;  3ZLZ A;  3MP9 A;  3N1X C;  4YL8 A;  2IDY A;  1OEY A;  4HPL B;  1WJ4 A;  1SSN A;  2QHO A;  1ENF A;  1WGG A;  1IGC A;  2DHZ A;  2LUE A;  2ZCC A;  4HJK A;  1WM2 A;  4AOF A;  3TEY A;  3IHP C;  2NPT A;  2W9N A;  3EEC A;  1WRI A;  4M02 A;  1NBF C;  4RFB A;  5TR5 A;  1NYR A;  1TBE A;  1OQR A;  2K6Q A;  4HVB A;  1YN3 A;  5D94 A;  1Q10 A;  4MH8 A;  5FR3 A;  1R4M I;  3X0W A;  3DBH I;  3PZD A;  3VRA B;  2O6V A;  3K9P B;  2K9X A;  1I4P A;  1DOX A;  2M17 A;  1PYW D;  2K8H A;  2VH1 A;  1X1M A;  1XLP A;  4URK A;  4K7S A;  1XXG A;  3FAH A;  2A4Z A;  4UDU C;  2QCZ A;  2M0A A;  2BBC A;  3SFE B;  1L6V A;  4ACF A;  2MJE A;  5BMH A;  4B9K A;  3MJW A;  3DHG C;  4MGZ E;  2XEW A;  1R7S A;  4ANV A;  3UF8 A;  4KIK B;  1V5T A;  2K8B A;  1TJE A;  1IPG A;  5GXG B;  4DDI D;  3L4P A;  2GI9 A;  5BO4 B;  2Q5W D;  1KLU D;  1V8C A;  1S1Q B;  1CZP A;  4AS1 A;  1V97 A;  2WU5 B;  3ZNH B;  3MFG A;  4XZ4 A;  2PVG C;  1FFV A;  2BKR B;  4C7Y A;  1P7F A;  3ZRC A;  3NOB A;  1QOF A;  3OJ4 B;  1AAR A;  1DOI A;  4RH6 A;  1XT9 B;  2DZI A;  2VZK D;  1RFA A;  2JZ3 B;  4GOC A;  3BYY B;  1I4H A;  4HCN B;  5AZF A;  4HEA 1;  1NI3 A;  1ROE A;  4IM0 A;  3WAO A;  1YX6 B;  3H8H A;  4FXC A;  1FXT B;  3QC8 B;  1WGH A;  4BKT A;  2BVC A;  1MVK A;  3JVZ X;  2GB1 A;  2LRW A;  3R7R A;  1RWS A;  4II2 B;  4W9F A;  3KWV A;  1UD7 A;  4MSQ B;  3D32 A;  2AQ1 B;  2AX5 A;  4C7Z A;  2M19 A;  1UGM A;  4X57 B;  3T3O A;  1BML C;  2BW2 A;  2N1V A;  2I1K A;  2LVP A;  3AE2 B;  2LI5 A;  1R4M B;  2PIA A;  2WWZ A;  5AZG A;  2BPS A;  1D4B A;  4FJZ A;  3A9K B;  2L3Z A;  2EMS A;  4RM8 A;  4XDD A;  2PLP A;  4LCD E;  1HA5 A;  2KX0 A;  1GC6 A;  4P7I A;  2Y5B B;  3U52 E;  1GPX A;  4KIK A;  3PRE A;  3BII D;  3ZIM A;  4YSY B;  2WXI A;  2N9K A;  3AE9 B;  1ZP0 B;  3R2I A;  2V4L A;  4EUT A;  3DCG A;  4ICU A;  4RM9 A;  4FHJ A;  1GAQ B;  4DQO C;  1IGD A;  3H9D A;  3KH0 A;  4BVU C;  2WXF A;  1VJK A;  2KWC A;  1YN5 A;  4AJY B;  3RI7 C;  1N5W A;  4QAY A;  3C19 A;  3KYC D;  1TS3 A;  2V3P A;  3KUZ A;  3PZ8 A;  3A1Q B;  3DVN V;  5G55 A;  2L32 A;  4N6E B;  1YJ1 A;  4GDK B;  1JRP A;  3QX1 A;  2WXG A;  2MHJ A;  3V3X A;  2WNM A;  4ZRI A;  3AE3 B;  2IO0 B;  4B0E A; 
#chains in the Genus database with same CATH homology
 3DOW A;  2D11 A;  1ISN A;  2K39 A;  3JSV A;  1WX7 A;  3QQ8 B;  3DBS A;  4GSW A;  3VH4 B;  3NY5 A;  2XK5 B;  3NHE B;  3UQA A;  3ZNZ B;  4CYE A;  2KHW B;  4NQL B;  4W9J A;  5CX3 A;  1EO6 A;  4WWN A;  5AEK B;  3QHT A;  3A4R A;  4IWP A;  4W9C A;  3HHM A;  1XQQ A;  1T0Y A;  2JPH A;  2NVU I;  3JYU A;  3L16 A;  3ZNG C;  5J17 A;  3M3J A;  1P98 A;  4BBN C;  4E3C A;  2IY0 B;  1Q1O A;  2BYE A;  1WE6 A;  2D3G A;  3N30 A;  3BY4 B;  4ICV A;  3UIO B;  3VQI A;  2IO2 B;  2ZPN A;  1WGY A;  3A33 B;  3HM3 A;  4GXB A;  4I6L B;  3IBE A;  2CR5 A;  2L0T A;  1E8W A;  2L7R A;  5HKH A;  1UEL A;  4BKS A;  3ECI A;  2CS4 A;  2KX3 A;  4EZK A;  2JVC A;  4NQK E;  4FUL A;  2PE6 B;  3QCA A;  3HM6 X;  2FID A;  5IAA C;  1E8Y A;  2REX A;  4KVG B;  1GJZ A;  2NCN A;  2CU1 A;  2JWZ A;  2KFK B;  4DHZ B;  2IO3 B;  4OVV A;  3HK0 A;  3B08 A;  3SHQ A;  1ZGU B;  4CHK A;  1XD3 B;  4ANX A;  1H8C A;  2MBQ A;  2R2O A;  2I1J A;  3W1S C;  2BYF A;  3ML9 A;  1EUV B;  2MSE D;  2KWV B;  2KJR A;  1R4N I;  1WXA A;  5CHV C;  4MEM A;  2DAJ A;  3SDL C;  2JZZ A;  3K9O B;  3M62 B;  4GN1 A;  3W1S A;  1P0R A;  3H6N A;  4HCP B;  4IWO A;  4I6P A;  2WX0 A;  5DPR A;  4FBJ B;  1V81 A;  2KWU B;  1OTR B;  4EZJ A;  3ZRF A;  3L0W B;  4IW0 A;  4PS7 A;  1WJU A;  5CHF A;  2O2V A;  3Q3F A;  2JY6 A;  4NY0 A;  3ZW3 A;  2L0F A;  1E7V A;  1LFD A;  2CHZ A;  4LJP B;  4DXA B;  1U4A A;  2KJ6 A;  3AU4 A;  1WY8 A;  2DEN B;  2IYD B;  2KOX A;  3APC A;  5KHO A;  2RPQ A;  3ALB A;  3VUW A;  1SE9 A;  2BWE S;  3A4S C;  3Q3J A;  4E74 A;  3L13 A;  3HIZ A;  3RUL A;  2FCQ A;  4F8C B;  1IP9 A;  3A1Q A;  4W9G A;  1KOT A;  3M95 A;  5DPS A;  2LXC A;  2KVR A;  2ZVO A;  1WH3 A;  2MW5 A;  2LVO A;  1WZ0 A;  4PYZ A;  4IWQ A;  1Y8R C;  5LLI A;  2ASQ A;  2M1M A;  2O6V D;  2C9W B;  2MBH A;  4FLH A;  4KSL C;  3U7D A;  1VD2 A;  3UIN B;  3H7P A;  4FJV B;  4GDK A;  1WRD B;  4MGY E;  2UWQ A;  2OOB B;  4EEW A;  3APD A;  5JHA A;  2CHW A;  2PE9 A;  3V6C B;  1V2Y A;  4DDG D;  4GU2 A;  4NJ7 A;  2J7Q B;  3PVL A;  2WYQ A;  1KM7 A;  4RMA A;  5D2M B;  2R2Q A;  5L83 A;  1V6E A;  3P2B A;  4I6N B;  4FAD A;  1WF9 A;  2RD0 A;  4BBN F;  3PGE A;  2YVC A;  3LDZ E;  1V5O A;  1Z5S B;  2C60 A;  2XK5 A;  1KJT A;  4ZRJ A;  2HJ8 A;  3V61 A;  3VUX A;  4B95 A;  3RUI B;  2FIF A;  3WAN A;  4BKG A;  1OEY J;  2MWS B;  2AYO B;  4PS3 A;  3R3M A;  4WJQ A;  3VVW B;  4EFO A;  4GIV A;  4NPN A;  5JHB A;  2JXX A;  5L95 C;  1VCB A;  2N9P C;  1EF5 A;  4IM2 A;  4W9L A;  1I35 A;  2OJR A;  2NPT B;  3L08 A;  1E5W A;  2J0M A;  4LJO B;  3WAL A;  1OGW A;  4HXD A;  1WM3 A;  4TV3 A;  1Q0W B;  4WJP A;  2GBK A;  2ZVN A;  2BWF A;  2KQS A;  1RRB A;  2LAS A;  2KDE B;  4TQ1 A;  3PT2 B;  1ZW7 A;  2RR9 A;  4BFR A;  1CMX B;  3PRZ A;  2AWT A;  2M0X A;  3WA0 A;  2JF5 A;  4AJW A;  3NZU A;  2RSU A;  2EMT A;  2KJH B;  2XBB C;  2N7D A;  3DQV A;  2KLG A;  3T8M A;  2B3A A;  2KFK A;  3DBR I;  2KLC A;  2M4N A;  1V86 A;  2L00 B;  2O6V B;  2PEA A;  3B1L X;  4MEL A;  1WGR A;  4NAW B;  2AEH A;  4MH0 E;  4DWF A;  3RD2 A;  4M8M A;  4IM3 A;  1PQS A;  2K6D B;  2L05 A;  3A9J B;  3PS6 A;  1GNU A;  3WAM A;  5E6P A;  2Z0E B;  2IY1 B;  2N4F A;  4HPM B;  2KK8 A;  1WXS A;  4LDT D;  3KUC B;  2KDB A;  3LJ3 A;  3PTF C;  2JUO A;  3ML8 A;  3OLM D;  1TGZ B;  1YD8 U;  1V49 A;  2FNJ B;  4GDL B;  2G45 B;  1V9J A;  1WFY A;  2KTF A;  3O65 B;  1C1Y B;  2KD0 A;  4FHK A;  4PS8 A;  1YIW A;  2FCN A;  3PHW B;  1J19 A;  3RCZ A;  4NJ6 A;  4A3P A;  2MBO A;  4W9D A;  4W9H A;  5LXI B;  2DZM A;  3QAR A;  1YX5 B;  1WZ3 A;  3UQB A;  3VTU A;  1TTN A;  2L8J A;  3H1U A;  4G3X B;  2D10 A;  2NBU A;  3IFW B;  2DZJ A;  4PYU A;  3CST A;  2V1Y A;  1UBQ A;  2WX1 A;  4MSM B;  4EKU A;  1P9D U;  2GBR A;  2K25 A;  3T9L A;  1P3Q U;  1I42 A;  3V60 A;  3PPA A;  2JRH A;  1S3S G;  2N1W A;  2ZZP B;  1D3Z A;  3VTV A;  1YQB A;  2GBM A;  4DHZ E;  4BOS C;  2NBV B;  2MCN B;  3ZLZ A;  3S2A A;  4KZ0 A;  3N3K B;  4YL8 A;  1Z2M A;  4F7Z A;  2NBW B;  4M0W B;  2KXJ A;  4WJN A;  1OEY A;  2NS5 A;  4HPL B;  2DZK A;  1Q5W B;  2MRP A;  1WJ4 A;  4JGH B;  3U8Z A;  4EZL A;  4ANW A;  1A5R A;  2QHO A;  1QZE A;  4GGQ A;  1WGG A;  3ZKJ C;  3OJ3 A;  2PJH A;  5EDS A;  4LDT B;  3TJP A;  2C5L C;  2MP2 B;  4K1R B;  2ZCB A;  4EOY A;  2DHZ A;  3VAW A;  3IG3 A;  2LD9 A;  2ZPY A;  2LUE A;  2DYO A;  2ZCC A;  3WAP A;  1UBI A;  4HJK A;  1WM2 A;  4WQO B;  4K7U A;  4KSK C;  3X23 A;  2CHX A;  4AOF A;  3TIX A;  3PLV A;  3KUD B;  2C7H A;  3IHP C;  1J0G A;  2MQJ A;  2NPT A;  3GZN I;  2W9N A;  3PRP B;  3EEC A;  5FR6 A;  5TR5 A;  3APF A;  1NBF C;  1TBE A;  2KTR B;  3VUY A;  3W1Y A;  2FCM A;  3ZNI D;  2K6Q A;  2N7E A;  4E71 A;  4HVB A;  1G6J A;  2GBN A;  5D94 A;  2JRI B;  2BGF A;  4DK5 A;  2HE7 A;  3SD5 A;  1E8X A;  1WIA A;  3ZVV A;  1R4M I;  2HTH A;  2IZV B;  2JT4 B;  2KQ7 A;  3DBH I;  3PZD A;  4NAW A;  2O6V A;  3X0W A;  4OVU A;  3K9P B;  4FJY A;  3PRM B;  3A9J A;  5D6J B;  2M17 A;  1WMH A;  2MLB A;  2K8H A;  1GUA B;  3AU5 A;  2EKE C;  2LZ6 A;  1X1M A;  3L17 A;  1WX9 A;  2UYZ B;  5G2N A;  3ZUN A;  1WR6 E;  2HD5 B;  4URK A;  4JQW C;  3AI5 A;  4K7S A;  2KMC A;  1F9J A;  2A4Z A;  2K1F A;  4HK2 A;  4GDL A;  3RZF A;  2KMA A;  2PPH A;  1ZKH A;  2BYV E;  2C7M B;  4KZC A;  4KV2 A;  2WDT B;  1BT0 A;  3H7S A;  3MJW A;  4B9K A;  4G50 A;  1WX8 A;  1M94 A;  1SIF A;  3MTN B;  4MGZ E;  5E6O A;  2ZNV B;  3CMM B;  2XEW A;  5KHQ A;  4ANV A;  3UF8 A;  3SU8 X;  2LGX A;  3ENE A;  1H4R A;  1LQB A;  4KIK B;  4MJS B;  4DBG A;  1V5T A;  3TMP B;  2K8B A;  3AXC A;  4K81 A;  4W9K A;  3BIN A;  4JIO U;  1IPG A;  2LRU A;  3C0R B;  4XX5 A;  4W9E A;  4DDI D;  1MG8 A;  1WMH B;  2ZJD A;  3ZDT A;  4WJO A;  5D7G A;  1WJ6 A;  5BO4 B;  1WXM A;  5J2R A;  1E7U A;  2BF8 B;  3JW0 X;  2Z59 B;  1S1Q B;  3RZW C;  5J18 A;  3QJZ A;  4W9I A;  3PLU A;  1RAX A;  3QAQ A;  1SGH A;  3ZO5 B;  3DPD A;  4TUU A;  3IVF A;  2RGF A;  4XC2 A;  2LVQ A;  5JZE B;  5C1Z A;  3ZNH B;  2LXA A;  4MM3 A;  1WJN A;  3EHV A;  4HDO A;  4XZ4 A;  4HWI B;  4KDL B;  4BKS D;  2BKR B;  4TQ0 A;  5IA7 A;  3ZRC A;  3QA8 A;  2NR2 A;  1V80 A;  5GMV A;  2N9X A;  3RT3 B;  1L2N A;  1NDD A;  2MP2 A;  3NOB A;  3R66 C;  3OJ4 B;  2KDI A;  1GG3 A;  1AAR A;  2MA9 B;  3DVG Y;  2KC2 A;  5AZH A;  4IC7 B;  2KDF B;  4IG7 B;  1XT9 B;  2KAN A;  2DZI A;  5DCN A;  1RFA A;  2JZ3 B;  2KNB A;  4GOC A;  4A20 A;  3L10 B;  3NZS A;  3R7Q A;  4HCN B;  3KW5 B;  5AZF A;  3QWZ B;  4IM0 A;  3WAO A;  1HE8 A;  1YX6 B;  4ZRK A;  4WAA A;  3TCA A;  3QK0 A;  3A9K A;  2GBJ A;  1FXT B;  3QC8 B;  2KTR A;  3JSV B;  1L7Y A;  1WGH A;  2DAF A;  2FAZ A;  4BKT A;  4FA6 A;  3JVZ X;  2J0J A;  4K7W A;  3GOE A;  3PSE B;  4JL9 A;  2LRW A;  3V62 A;  3R7R A;  2GOW A;  2D07 B;  1WYW B;  4II2 B;  5DPT A;  1KLV A;  1IYF A;  4W9F A;  1LM8 B;  3MHS D;  1UD7 A;  4MSQ B;  3D32 A;  1LXD A;  2GMI C;  3EFU A;  2Z0D B;  3WIM A;  4DHJ D;  1UGM A;  4X57 B;  2BKF A;  2KC1 A;  3RYT A;  4ASW C;  2IBI B;  1WR1 A;  2N1V A;  4TKN A;  1TZ1 A;  2I1K A;  2LVP A;  2LI5 A;  1OQY A;  2FUH B;  2AL3 A;  2IO1 B;  2WWZ A;  2ZNV C;  4NNJ B;  1WGD A;  5AZG A;  3VH3 B;  2BPS A;  2L76 A;  4FJZ A;  3ONS A;  1WXV A;  3DBL I;  3A9K B;  4MDK E;  4IUM B;  2L3Z A;  4HDQ A;  2LJ5 A;  5CHW A;  3VDZ A;  2EMS A;  2MBE A;  4RM8 A;  1RLF A;  3CF6 E;  2G4D B;  4LCD E;  5E6N A;  2LGD A;  3DVN U;  2KX0 A;  1GC6 A;  4N9F 4;  4P7I A;  3OAW A;  3PV1 A;  2M8S A;  2Y5B B;  4MGK E;  2LWP A;  3AUL A;  3PRE A;  2DYB A;  2CKH B;  2J0K A;  4KIK A;  4MJS A;  4CO7 A;  4HLE A;  3UGB B;  4F1S A;  3B0A A;  3NS8 A;  3ZIM A;  3U30 A;  3KYD D;  3PHX B;  1UH6 A;  3VHT C;  4ZDV A;  1JRU A;  5CTR C;  2V4L A;  2G3Q B;  3DVG X;  4EUT A;  1NI2 A;  5C23 A;  1UZX B;  3DCG A;  4ICU A;  2YLM A;  4RM9 A;  2N9E B;  2A5U A;  4FHJ A;  1K8R B;  3L54 A;  4G0N B;  2KO3 A;  4GMV A;  4II3 B;  3H9D A;  3VFK A;  2KKC A;  4WWO A;  3KH0 A;  4BVU C;  3QIJ A;  4B6W A;  4AWJ A;  2KWC A;  2DX5 B;  2LGY A;  4AJY B;  2O2V B;  2FCS A;  4AP4 C;  3KYC D;  5JH5 C;  4DHJ B;  2G4S A;  2KZR A;  3TL5 A;  3VXW A;  3TBL D;  3KUZ A;  4GB9 A;  4J6I A;  2KFJ A;  4FN2 A;  2DYM A;  2KN5 A;  2AL6 A;  3A1Q B;  3M63 B;  3UIP B;  3DVN V;  5DPW A;  5LXH A;  3I3T B;  3CSF A;  3N32 A;  1WE7 A;  5G55 A;  3ZTD A;  1WI0 A;  4BOZ B;  1C3T A;  1EF1 A;  4ANU A;  4G11 A;  4WWP A;  4ZYN A;  3VTW A;  2MBB B;  1E8Z A;  2C7N B;  2V3S A;  3V6E B;  3ZTC A;  4KDI C;  1YJ1 A;  3H7P B;  3KVF B;  4GDK B;  4M8N A;  4A3O A;  3ZDM C;  3QX1 A;  4JLC A;  1J8C A;  1GC7 A;  2K8C A;  2VRR B;  2ZEQ A;  4MGI E;  4ZRI A;  2MX2 A;  1E90 A;  3EC8 A;  3DDC B;  4AUQ C;  2IO0 B;  1P1A A;  2D2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...