3KUCB

Complex of rap1a(e30d/k31e)gdp with rafrbd(a85k/n71r)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVRVRNGMSLHDCLMKKLKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1A
publication title What makes Ras an efficient molecular switch: a computational, biophysical, and structural study of Ras-GDP interactions with mutants of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein/transferase
total genus 20
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kucB00
1UBIA 3QA8A 2MWSB 1TBEA 2BWES 2K8BA 2PE9A 1YX5B 2IY1B 4JGHB 2KXJA 3DBRI 3ZNHB 2XK5A 4AWJA 1YD8U 4FHKA 2KJRA 1VD2A 3W1YA 2RR9A 2LUEA 3WAOA 3AI5A 3VTUA 3X0WA 5AZFA 2BGFA 4PS8A 4AP4C 2O6VD 1J19A 1IP9A 3ZO5B 3B1LX 1RFAA 4FJZA 2C60A 3H7PB 1LM8B 1E8YA 2CHWA 4K7UA 5E6NA 1ZKHA 4GDKA 4NQLB 4A3OA 5J2RA 1V86A 2L05A 2KMAA 2K8CA 5D2MB 2KFJA 1QZEA 1JRUA 2QHOA 3UQAA 1L2NA 3JSVA 2FCQA 3RCZA 3M3JA 4ZYNA 4FN2A 3ZRCA 1NDDA 3PHXB 4IG7B 2DAJA 3P2BA 3QCAA 2N4FA 2K1FA 3QX1A 4ZRIA 2D2QA 3PREA 1Z2MA 2YLMA 3MJWA 3SD5A 3AULA 3OAWA 5DPWA 3L0WB 4ANVA 1YQBA 3MTNB 4DHJD 3BY4B 3IVFA 1U4AA 4X57B 2IO1B 4G3XB 3EHVA 4GN1A 3QC8B 1E7UA 3V61A 3LJ3A 2Z59B 3DDCB 4DK5A 1SIFA 1UBQA 1V49A 4KSLC 2HE7A 1LFDA 4GOCA 1KM7A 2M0XA 2PEAA 3I3TB 1WE7A 5LLIA 4J6IA 2FCNA 2LD9A 3OJ4B 4ANXA 3IBEA 1XD3B 3V6EB 4HLEA 1WGHA 2MA9B 1J0GA 2JRHA 1LQBA 2NR2A 5KHQA 1LXDA 1TTNA 1UELA 4KIKA 5AZHA 3SDLC 3U30A 3VAWA 4NPNA 3RZWC 1KLVA 4FLHA 2KJHB 2KQ7A 4W9HA 2KD0A 3QJZA 1WM3A 1P0RA 2KZRA 3N30A 2BKRB 3DBLI 1P9DU 2ZNVB 4PYZA 1WH3A 1WIAA 2L00B 3ZLZA 3QHTA 5EDSA 4ZDVA 2JRIB 2FCMA 2CU1A 2K6DB 3WALA 4BKGA 4MGIE 1S3SG 1WJ6A 5G55A 3RT3B 3TJPA 2KVRA 2DYOA 3H1UA 4W9GA 1CMXB 4F8CB 3A9KA 2RGFA 1H8CA 2MLBA 4AJWA 1X1MA 2D10A 2WX1A 3R7RA 2RSUA 1WE6A 4LCDE 3RUIB 2DYMA 1XT9B 2L8JA 3A1QB 4OVVA 2MP2B 4DXAB 4LJPB 2D3GA 5DPSA 4JIOU 2M8SA 2L0FA 4IM0A 4E71A 4HK2A 2LXCA 3PRMB 1XQQA 1RLFA 2FIDA 1WFYA 2LJ5A 2NPTB 4II3B 3RULA 3SHQA 4DHZB 2LVPA 4G11A 1ISNA 3AU5A 3HIZA 4NNJB 1OGWA 2REXA 4NAWB 4WWNA 3K9PB 2KDEB 2KLCA 1YIWA 2DAFA 2RD0A 2XEWA 3GZNI 2ZEQA 4KZ0A 2MBEA 1ZGUB 3A4RA 4KZCA 3TIXA 4WAAA 3DBSA 2KC1A 1SGHA 2N1WA 2KN5A 4GMVA 4BKSA 1WJNA 4E3CA 3B0AA 4WJQA 3IHPC 1WGGA 4KDIC 3ZUNA 4TV3A 3NHEB 2NVUI 1OEYJ 2BPSA 3KUCB 5CHVC 3A9JB 4NY0A 5AEKB 4MH0E 4NQKE 4W9KA 4I6LB 4WJNA 2CS4A 2KC2A 2KTRB 1YJ1A 2PJHA 2OJRA 4K1RB 4GIVA 3VFKA 1EF5A 2BYEA 2MBOA 1A5RA 2IO3B 1C1YB 4EUTA 1OQYA 2DZMA 5BO4B 4DHJB 2KFKB 2KQSA 1M94A 4NAWA 4W9CA 1FXTB 2JUOA 4MSQB 2IZVB 2O2VA 2KDFB 1AARA 2L76A 2N9EB 2FAZA 3JW0X 2JPHA 3JYUA 3S2AA 5CTRC 4IWPA 1GC7A 2BYFA 2O6VA 3R7QA 3WANA 1GNUA 2G3QB 1C3TA 2B3AA 4HPLB 3QK0A 3Q3JA 3ZVVA 3CSTA 1WM2A 2KTFA 1TZ1A 2XBBC 3PT2B 1WX8A 4TQ0A 3L54A 4KV2A 2HTHA 1P98A 2KX3A 1VCBA 1GJZA 3APCA 3QIJA 4DBGA 5C1ZA 3O65B 2BWFA 3HK0A 3TMPB 3WAMA 3CMMB 3PGEA 3ZNID 2HD5B 5LXHA 1WYWB 2N9PC 2V1YA 4GB9A 3QAQA 2LASA 1TGZB 4JLCA 3PVLA 1WMHB 4II2B 3IG3A 4DDGD 4MEMA 4FBJB 2KFKA 2LGDA 4KDLB 4IWOA 2J0KA 4HVBA 2UWQA 3L08A 1HE8A 2KHWB 4IUMB 4TKNA 2G45B 4TUUA 4A3PA 4ANWA 3UGBB 4FADA 2EMTA 3PV1A 3A4SC 3H7PA 1R4NI 3T8MA 3U7DA 1G6JA 1E8ZA 4BBNF 2C9WB 3VDZA 1UZXB 3DVGX 1RAXA 3PS6A 4WJOA 3KUZA 1NI2A 2ZCCA 2LRUA 1WXAA 3ZTCA 2LVOA 5E6OA 1KOTA 1D3ZA 2VRRB 4A20A 4ICUA 4B9KA 2M1MA 2CHZA 4XX5A 3VHTC 4GXBA 2AEHA 2MW5A 3Q3FA 4RM8A 3L16A 3KUDB 2L7RA 2KMCA 2DZKA 5DPRA 5J17A 3JVZX 1WF9A 2GBJA 3V60A 3X23A 1BT0A 2KWUB 2CKHB 2CR5A 4DHZE 2KKCA 5HKHA 2FCSA 2EMSA 4I6PA 2LZ6A 2KDBA 3SU8X 2GBRA 3ZDTA 2KO3A 2W9NA 3TL5A 2LGYA 2MX2A 4YL8A 2WWZA 3ZNZB 5L95C 1WRDB 2G4SA 3ML8A 2DZIA 3ONSA 3ZKJC 2DYBA 4GGQA 2FIFA 4GDLB 3M95A 3V6CB 2J0MA 1GC6A 2NBWB 2RPQA 3L13A 3NOBA 2ZVOA 3UIOB 4HDOA 3PRZA 3ZRFA 3K9OB 5CX3A 2L0TA 4KSKC 4IM2A 2LI5A 5G2NA 1I42A 4DDID 4ANUA 2C5LC 4CO7A 1E90A 3R3MA 2GBNA 3L10B 1WZ3A 5CHFA 1Z5SB 4PYUA 4NJ6A 2MSED 2DX5B 2NBVB 4HWIB 1WY8A 2DHZA 4MDKE 3W1SC 4MJSB 1V5OA 4BVUC 1GG3A 3KH0A 3UINB 2AL3A 2IYDB 3B08A 4WWPA 4HJKA 5FR6A 2HJ8A 3ZDMC 4G50A 3ZNGC 1V2YA 1WZ0A 4URKA 1R4MI 4LDTB 2XK5B 3H6NA 2CHXA 4CYEA 2IO0B 2WDTB 1NBFC 1ZW7A 4IM3A 4MM3A 4EZKA 2V4LA 1YX6B 2BF8B 2IO2B 3OLMD 1Q1OA 3A1QA 4HCPB 2MP2A 4CHKA 3EC8A 3VQIA 1GUAB 1I35A 2Z0DB 2DENB 2KOXA 4MSMB 5D7GA 4FA6A 5JHAA 1UD7A 2NPTA 2KX0A 1WI0A 1E8WA 2KWCA 2KWVB 4MGYE 2D07B 1UGMA 4AJYB 2J7QB 3JSVB 5IA7A 2DZJA 4W9IA 4K7WA 4NJ7A 5D6JB 1WGDA 1P3QU 3N32A 1V5TA 3UF8A 3VUYA 3EFUA 4ICVA 3CF6E 3H9DA 1V81A 4JL9A 4PS7A 2Y5BB 3VH4B 4P7IA 2YVCA 5D94A 4LDTD 2D11A 3PSEB 4HDQA 4EFOA 2N7DA 2G4DB 4W9FA 3KVFB 5AZGA 3QQ8B 2M17A 4BFRA 1IYFA 3QWZB 3QARA 4MELA 2LGXA 4M8MA 3A9JA 2JVCA 4W9LA 5C23A 1E5WA 2GMIC 3WAPA 1Y8RC 1P1AA 4JQWC 3W1SA 2L3ZA 3VTVA 3V62A 2KTRA 2ZVNA 2A4ZA 3DOWA 4OVUA 2I1JA 4IW0A 5E6PA 4I6NB 3VUWA 2AYOB 2ZPYA 2JZZA 3DCGA 2Z0EB 5DPTA 3ECIA 3VXWA 3NY5A 1S1QB 3PLUA 1WXVA 4AUQC 1WR6E 2NS5A 3OJ3A 5CHWA 4KIKB 1WXMA 3RD2A 3UIPB 4HPMB 2JY6A 3APDA 3VH3B 4XZ4A 4AOFA 4BBNC 2ZZPB 3M63B 1V80A 2ZJDA 5DCNA 3HM3A 4EKUA 4HCNB 2LRWA 3KW5B 3A33B 2ZNVC 2K8HA 2V3SA 1E8XA 4W9DA 4G0NB 4PS3A 1J8CA 3DBHI 3RZFA 3TCAA 3DVGY 1IPGA 1MG8A 4FHJA 3ML9A 4K81A 4MGKE 1WX9A 3D32A 3NZSA 4BOSC 4LJOB 4HXDA 3NZUA 1PQSA 4BOZB 2IY0B 2AWTA 4ZRJA 4FJVB 4WWOA 2GBKA 2LVQA 2GOWA 5TR5A 1OEYA 5J18A 4K7SA 5GMVA 1EF1A 1RRBA 2KJ6A 1WR1A 3DQVA 5JH5C 3AXCA 3A9KB 1KJTA 2BYVE 5LXIB 1WMHA 2NCNA 3ENEA 1WXSA 3VTWA 3CSFA 1WX7A 2ZCBA 3PTFC 4TQ1A 2N1VA 3BINA 3DVNV 3KYCD 3C0RB 4WJPA 5JZEB 4WQOB 1WJ4A 1OTRB 4M8NA 3VUXA 2C7HA 3ALBA 3PLVA 4XC2A 5IAAC 2BKFA 1SE9A 2ASQA 2JWZA 2J0JA 2MRPA 2OOBB 3APFA 3PZDA 3T9LA 4ASWC 5L83A 2WYQA 1WGRA 4F7ZA 4M0WB 3AU4A 3DVNU 4B95A 4FJYA 2PPHA 4EZLA 4GSWA 2I1KA 2KK8A 2R2QA 2WX0A 2PE6B 2K39A 2JT4B 1Q0WB 2KDIA 1H4RA 2JZ3B 1EUVB 3HM6X 3PHWB 3ZTDA 3HHMA 2IBIB 5KHOA 4IC7B 3NS8A 3KYDD 2NBUA 3VVWB 3UQBA 2LWPA 3WIMA 1F9JA 1T0YA 3M62B 3R66C 1UH6A 3N3KB 3L17A 2GBMA 2N9XA 3GOEA 4W9JA 2MBBB 2ZPNA 4RM9A 4EZJA 2MBQA 2K25A 4EOYA 3PRPB 1Q5WB 3ZW3A 2EKEC 2N7EA 3TBLD 2MBHA 2LXAA 1L7YA 2MCNB 2JF5A 4W9EA 2M4NA 3IFWB 4KVGB 4BKTA 4E74A 2K6QA 4B6WA 3PPAA 1WJUA 3WA0A 4BKSD 2JXXA 1E7VA 2MQJA 3MHSD 2O2VB 4GDLA 4ZRKA 2R2OA 2KANA 2C7NB 5JHBA 2C7MB 2UYZB 3LDZE 3RYTA 3U8ZA 1V9JA 4GDKB 1EO6A 2KNBA 4EEWA 2O6VB 4F1SA 1V6EA 2KLGA 3H7SA 3ZIMA 4IWQA 2FNJB 1K8RB 4DWFA 4N9F4 2FUHB 4FULA 3DPDA 1WGYA 2AL6A 4RMAA 4MJSA 4GU2A 3EECA 4MGZE 2A5UA
chains in the Genus database with same CATH superfamily
3QA8A 2MWSB 1V97A 1C76A 3NS1A 5H92C 2IY1B 3RNAC 1YD8U 1VD2A 3W1YA 2NTTA 4YWGG 2BGFA 2N9KA 1J19A 4L23A 2C60A 3H7PB 1LM8B 4JWSC 1HTOA 5E6NA 4GDKA 5J2RA 4JX1C 4USAA 1V86A 2L05A 5D2MB 2K8CA 1QZEA 1JRUA 2QHOA 2LEKA 1L2NA 2FCQA 1SE3A 4XE0A 4ZYNA 4IG7B 2KQ4X 3MJWA 1TS4A 2SAKA 3AULA 3OAWA 1TYGB 3L0WB 2PW9A 3MTNB 4DHJD 3BY4B 3I9V1 4G3XB 1E7UA 4RCOA 3V61A 5IP4D 3DDCB 1I4PA 1N60A 1SIFA 5BYRA 1TJEA 2Y5PA 3I3TB 5LLIA 4J6IA 4ANXA 1XD3B 1SXTA 1GPXA 1LO5D 3RNEC 1QT9A 3N30A 2BKRB 2Y5CA 1SIJA 4ZYSA 3BK2A 3ZLZA 5FK9C 2JRIB 2CU1A 4MGIE 1S3SG 3U2SC 3TJPA 2CU3A 4R3DA 2DYOA 2XNAC 3T3OA 2W54A 1H8CA 4AJWA 2D10A 2QSDA 4LCDE 1DOXA 2R61A 3RUIB 2L8JA 1YNTE 2D3GA 4YTNB 4LTUA 2WXOA 2LXCA 2ZW0A 3SHQA 2LVPA 4G11A 4M0WA 1OGWA 2PVOD 2DAFA 2ZEQA 4KZCA 3BYYB 2KC1A 1Q10A 3B0AA 2DLBA 4KDIC 4KKIA 2BPSA 1ZPSA 4GLSC 4OW0A 2KACA 5AEKB 2FBWB 2W3RA 2V9HA 4I6LB 3B2FA 4HPPA 3VFKA 1A5RA 1F0ZA 3MFGA 4EUTA 1OQYA 2DZMA 5BO4B 2KFKB 1T0RC 3R8BA 4W9CA 3N1ZC 3P4RB 3N1XC 2O6VA 3R7QA 1SSNA 3WANA 3SFDB 1WM2A 3NRZA 4TQ0A 1P98A 2PLPA 2J52A 4A55A 3O65B 2BWFA 3WAMA 2RDGA 3WCQA 3Q69A 3QAQA 2LASA 3ZYYX 3CWIA 3OG5A 4DDGD 3RNGC 2PIAA 4MEMA 2BVCA 2LGDA 4KDLB 3DHGC 3ETRA 1HE8A 2KHWB 4TUUA 4A3PA 3PV1A 3H7PA 3T8MA 4C7YA 2LMCA 4JWUC 3VDZA 1EU3A 1JQ4A 1STEA 1RAXA 4WJOA 1NI2A 2LRUA 1AWDA 3FC4A 1D3ZA 2VRRB 4A20A 3VHTC 4GXBA 1UWXA 2IDYA 2GBJA 2KWUB 3U52E 1N6ZA 2PVGC 1SJHD 4YSXB 3AEFB 2WU2B 3TL5A 1ET9A 3ZNZB 5L95C 5G5GA 1WRDB 3ML8A 3ONSA 2DYBA 2FIFA 1E7PB 3V6CB 4C00A 3DHHC 1GC6A 3L13A 3NOBA 1TKEA 3PRZA 5CX3A 2L0TA 4IM2A 2LI5A 4DDID 4ANUA 3I57A 2C5LC 4BAXA 4CO7A 5CHFA 2GBNA 3L10B 1WZ3A 1TKYA 1Z5SB 2NBVB 3TUOA 2DHZA 4MJSB 5IKCM 1KF6B 3FILB 2XK5B 4CYEA 2WDTB 2ON8A 1NENB 2IO2B 3OLMD 2ACZB 3EC8A 5JHAA 2KX0A 4CQNA 1UGMA 4AJYB 5IA7A 2DZJA 4K7WA 3VUYA 1ACCA 3UF8A 3VH4B 4PS7A 2YEPB 1TIFA 4LDTD 3PSEB 3ABVB 4EFOA 1XF5L 5AZGA 3OWEB 4Q2JA 3QARA 4M8MA 1I4XA 4W9LA 1P1AA 2JYEA 2L3ZA 2VZKD 4M01A 2ZVNA 2A4ZA 1F77A 2I1JA 2Z0EB 5DPTA 1FFUA 3ECIA 1S1QB 1VLBA 2NS5A 3OJ3A 4LNNA 2WHIA 5E6JA 3APDA 3P4SB 3VH3B 2LJIA 3M63B 2BT6A 4IKGA 3O13A 1DOYA 2ZNVC 2I2YA 1E8XA 3T3NA 3TCAA 4A90A 1FNVA 1GOZA 2INDC 1MPEA 1MG8A 3ML9A 4MGKE 3NZUA 3URYA 2AWTA 3AEEB 2GBKA 2LVQA 2GOWA 1OEYA 5J18A 1EF1A 3A9KB 5LXIB 3NUHB 4PT5A 3P42A 1WX7A 2BS4B 4TQ1A 3BINA 4BZAA 2N7JA 3VUXA 4M8NA 2C7HA 2BKFA 1SE9A 2JWZA 2OOBB 2J0JA 2MRPA 3T9LA 1IBXB 2WYQA 3AU4A 2LUMA 3DVNU 1MG4A 4EZLA 2I1KA 2R2QA 2WX0A 1H4RA 3ZTDA 2BS3B 3PO0A 3HHMA 5KHOA 3NS8A 3UQBA 2LWPA 1QILA 3R66C 1UH6A 2INPE 3B9JA 2SEBD 2MBBB 2ZPNA 4RM9A 1BXTA 3KQ4A 4WH4A 3PRPB 2INNE 1JW9D 3FAHA 2MBHA 1GAQB 2LXAA 3CIRB 2JF5A 4KX6B 2FE8A 1CZPA 3BIID 2KT7A 3PPAA 1ESFA 3RPFC 3AE9B 2O2VB 2R2OA 4LNKA 5JHBA 3L4PA 2YEPF 3AV8A 3RYTA 1FEHA 4GDKB 2WXIA 2LHEA 1WGYA 4MJSA 3HRDD 2A5UA 1UBIA 3FILA 2QEJC 1E9MA 3IT6B 2RDHA 2WXRA 4C80A 1E10A 4JGHB 2XK5A 4FHKA 2KJRA 2W82A 2RR9A 3WAOA 1KH0A 3AI5A 1BUIC 3U7ZA 1IP9A 3B1LX 1HXYD 3I63C 4NQLB 1FM0D 3C19A 3ZJTA 2AQ2B 3M3JA 5IOIA 1VR9A 3PHXB 1LGRA 2K9XA 2CJOA 2DBYA 4LNOA 1V8CA 2D2QA 3PREA 4ZRIA 1QOBA 1Z2MA 5FR3A 1YQBA 3IVFA 1U4AA 4X57B 1B1ZA 2WXKA 3KWVA 4GN1A 3FKYA 1I4QA 4DK5A 2WXPA 1V49A 4KGRA 2WXLA 1AN8A 1LFDA 2UU7A 4GOCA 2LFIA 2PEAA 3Q3OC 2V3NA 1JRPA 3V6EB 4HLEA 1L4DB 3VAWA 1KLVA 4FLHA 4W9HA 3Q3MC 1P0RA 3DBLI 3QHTA 4K3CA 2FCMA 3IT4B 1I4HA 2K6DB 5TSSA 3WALA 1WJ6A 2QJLA 5AUKA 1CMXB 1JWMD 1OQRA 3A9KA 2PMVA 1QOAA 2MLBA 1C4CA 4MACA 3R7RA 1DGJA 1WE6A 2MP2B 3BZDB 4LJPB 4E71A 4HK2A 2FIDA 4DHZB 1D6EC 2LJ5A 4II3B 3C8YA 4LK0M 4K3BA 1IBXA 3HIZA 1TS5A 4YSYB 1FNWA 4NNJB 1TY2A 3J9CA 3GS2A 3N20C 2KDEB 2RD0A 2XEWA 4KZ0A 2MBEA 1ZGUB 1JROA 3A4RA 3TIXA 3DBSA 3EFCA 1V1OA 2N1WA 1FPYA 4RGNA 4TV3A 3ZXVA 3KUCB 1FD6A 3A9JB 4P1CC 1KRHA 2ONQA 4W9KA 2OJRA 4K1RB 2MBOA 2CJNA 5BMIA 1UGJA 1I4RA 1M94A 4NAWA 2JUOA 1WRIA 4MSQB 2O2VA 2N9EB 3MJ5A 3S2AA 2IJ0A 5CTRC 2VH2A 1JWUD 2J42A 3Q6BA 1GNUA 4XWWA 1XXGA 4HPLB 3Q3JA 5IO9A 3L54A 1NYRA 3LXFA 4ZRQA 1GJZA 4OVZA 3QIJA 5C1ZA 2DNFA 1WYWB 1J7BA 1V1PA 1TGZB 3PVLA 1YOVB 1WMHB 4P16A 4FBJB 4IWOA 4LNFA 5D3IB 3MC8A 4IUMB 4FADA 4ANWA 2EMTA 3U7DA 3DWGC 1G6JA 2WGSA 4BBNF 2C9WB 2W55A 1UZXB 3DVGX 3TEXA 1J7AA 2ZCCA 4RFBA 2MJEA 1KOTA 2M1MA 2WXGA 2CHZA 2MHJA 2KMCA 3V60A 1BT0A 1NYQA 4ACFA 4DHZE 2KKCA 3IAS1 4REZA 2JU6X 1L0XB 3SU8X 1QF6A 3AE7B 2KO3A 2MX2A 2WWZA 1UWMA 2DZIA 3ZKJC 2J0MA 2NBWB 4OZCA 3AB5A 2LHDA 2OEDA 3UIOB 4HDOA 1EWYC 1I42A 1HEZE 3H8HA 3AEDB 2KWDA 4NJ6A 2DX5B 4HKQA 3UI3A 1WY8A 1ROEA 3SR6A 4BVUC 4ZHPA 1GG3A 3KH0A 3UINB 3B08A 3NVVA 4C4VB 5HFYA 1WZ0A 4IM3A 2V4LA 1Q1OA 4CHKA 2MP2A 3AE4B 1SB3C 3Q2AC 2Z0DB 4XWTA 2DENB 2KOXA 5D7GA 4ARIA 1WI0A 3GB1A 2KWCA 5EE1A 4MGYE 3JSVB 4NJ7A 5D6JB 1WGDA 1P3QU 3GZNB 3EFUA 1CK1A 1L0VB 2N7DA 2G4DB 3IAM1 3MHZA 1TT5B 2M17A 1R4MB 4BFRA 2LGXA 1MFWA 3A9JA 3AM9A 2JVCA 1Y8RC 3W1SA 4I6NB 2JZZA 3DCGA 1WXVA 1T0QC 4KIKB 1WXMA 1TKGA 3W5UB 2JY6A 3BK1A 1V80A 4ZRPA 5BYQA 2K8HA 2JXTA 1J8CA 2WXNA 3ZQ4A 2BTEA 4FHJA 1VZ8A 3D32A 1PQSA 4BOZB 2WXHA 4FJVB 5TR5A 5GMVA 1RRBA 3AXCA 3W2DA 1WMHA 2NCNA 1JWAD 2V0GA 1ZDXA 2IPKD 2B76B 3KYCD 4HKZE 1EU4A 4WQOB 1WJ4A 3ALBA 3PLVA 4XC2A 1R4NB 2ASQA 4ASWC 1CQVA 1SE2A 2JX5A 4B95A 3DBHB 4ZOHC 1L5PA 1RFKA 3MC9A 1K52A 2JT4B 2KDIA 2JZ3B 3V05A 1N5XA 3P1MA 4YTMB 3KYDD 3VVWB 3WIMA 1MVKA 3N3KB 3L17A 2N9XA 3GOEA 2MJ3A 3Q3NC 2MBQA 1EM7A 3AECB 1Q5WB 4S17A 3TBLD 4WIPA 3IFWB 4B6WA 4C56C 1KFYB 1WJUA 3AE3B 2C7NB 1FNUA 2UYZB 3NVZA 3LYYA 2WXQA 1TS3A 4H2AA 2KLGA 1HA5A 3TEWA 5HHDG 3ZIMA 4AS1A 2WXJA 1AYFA 4N9F4 3DPDA 4HROA 2AL6A 3BWUD 1SEBD 4GU2A 2I38A 4C4VA 1C77A 2BWES 2K8BA 2PE9A 4MT5A 1YX5B 1XLQA 2LUEA 3VTUA 4B0EA 1JWSD 2K5PA 4AP4C 2O6VD 1PGXA 4FJZA 4K7UA 4A3OA 3I5JC 4DXGA 2LGSA 2V4IB 2BBCA 2KFJA 3NG0A 2WDQB 2JSVX 3JSVA 3RCZA 3BYTB 4WURA 3ZRCA 1NDDA 3HUIA 2DAJA 1C4PA 3QX1A 3QCAA 2N0SB 2D3BA 2N4FA 2XN9C 2YLMA 3SD5A 5I4DA 3N9YC 3EHVA 3QC8B 3AE1B 3LJ3A 1M4VA 2Z59B 5FKAC 1UBQA 1NVID 2G1EA 2HE7A 2QDFA 1KM7A 2M0XA 2FCNA 3N1YC 3IBEA 5JXVA 1J0GA 4KGTA 1LXDA 1TTNA 4RNAA 4KIKA 3U30A 4RGTA 3RNBC 4NPNA 4OHJA 2KJHB 2KQ7A 2KD0A 3QJZA 1UUPA 1E0ZA 2KZRA 3U4EG 3NZ3A 2ZNVB 4PYZA 3RN9C 2H89B 5EDSA 5G55A 3RT3B 2KVRA 1PUTA 1WXQA 3H1UA 4FXCA 5C2TB 3P4QB 2KN4A 1X1MA 3GE3C 3TEYA 4JIOU 3Q8EA 3PRMB 2J53A 1XQQA 3HVDA 4B0MA 1ISNA 1XLOA 4NAWB 4TSSA 4WWNA 3K9PB 3PZ7A 4ARCA 3GZNI 3P4PB 1T0SC 4WAAA 1SGHA 4BKSA 2KN5A 4GMVA 1MJDA 1WJNA 3ZUNA 1C4AA 5CHVC 4NY0A 4A9AA 3ZJUA 4NQKE 4RGMA 4WJNA 2CS4A 2KTRB 1V1PB 1YJ1A 2GLSA 1JCKB 1L0YB 1P7FA 4GIVA 1EF5A 2IO3B 1GB1A 2KQSA 2WDVB 2MEKA 2IZVB 1AARA 3JYUA 1GC7A 1K51A 2KMMA 1C3TA 1JMLA 3CSTA 2KTFA 2XBBC 3PT2B 5H8YE 1WX8A 2WXMA 4JPSA 2HTHA 3TEZA 3AE5B 1VCBA 2X8XX 2H88B 4DBGA 3AE6B 3HK0A 3CMMB 3PGEA 1D5XC 2IGDA 5LXHA 1PGBA 2OJWA 4XDDA 2N9PC 2D3CA 1SBBB 4JLCA 4C7ZA 3DBRB 1KLUD 1CJEA 1NEKB 2X38A 5GXGB 2J0KA 4HVBA 2UWQA 1F52A 3L08A 1UNSA 1C9FA 4L1BA 3A4SC 1R4NI 3KWLA 2W3SA 2WXFA 3E56A 1C78A 3AE2B 2LVOA 5E6OA 2WDRB 1TZOA 4ICUA 4XX5A 2JQRB 2MW5A 4RM8A 1N63A 3KUDB 3JVZX 1N5WA 1WF9A 4XDCA 1PFDA 3RFZB 2CKHB 1Y56A 2WQYB 1SJED 2GI9A 2FCSA 3KLSX 5IN7A 3ZDTA 2W9NA 1HZ6A 2K22A 5D3DA 2LGYA 4YL8A 3Q8FA 2G4SA 2WS3B 1R7SA 4GGQA 4GDLB 2RPQA 4KSKC 1XO3A 1E90A 3R3MA 1P7EA 3W1SC 2L83A 3Q8BA 2IYDB 1JALA 4G50A 1XCQL 3ZNGC 4LDTB 1ET6A 1HZ5A 1ZW7A 4EZKA 2BF8B 4HCPB 1XLNA 1QOFA 1E8WA 3LB8C 2KWVB 3V3XA 2J7QB 4D2KA 4W9IA 1VDVA 1V5TA 4JL9A 4ICVA 1IUEA 1I4GA 3CF6E 1V81A 3H9DA 2Y5BB 2M0AA 4HDQA 2QCZA 4W9FA 2LGIA 2RDBC 3QQ8B 3QWZB 5C23A 2BYTA 1E5WA 2GMIC 3WAPA 4JQWC 3VTVA 2KTRA 3SFEB 1JWBD 3DOWA 4IW0A 4WAFA 5E6PA 3VUWA 3PLUA 2NTSA 4AUQC 4P1BC 2BS2B 1YN3A 3RNCC 2E6XA 1YQ3B 4HPMB 1ZUD2 4TMAB 4AOFA 4XYCA 3HM3A 1N61A 4HCNB 3MC0B 2LRWA 4NAMA 3A33B 1YQ4B 2MJDA 4PS3A 3RZFA 4US8A 1GB4A 1IPGA 1WX9A 4LNIA 2IY0B 4WWOA 1ZXIA 3AE8B 1WR1A 3DQVA 4XGAB 5JH5C 4RH6A 2BYVE 3ENEA 1WXSA 1MI0A 3CSFA 2ZCBA 3C0RB 4RF1A 3B2GA 5LNK1 2JYTA 1FIQA 1WGRA 1WGKA 3TSSA 1MHHE 1YN4A 4RF0A 2KK8A 2PE6B 1SE4A 2K39A 3E9SA 3RNFC 3PHWB 1EUVB 3HM6X 2N9LA 1T0YA 3M62B 3HVZA 2HJ1A 1YJIA 4KKJA 2K25A 4EOYA 2EKEC 2GRIA 3ZGZA 4O1NA 1SF0A 1L7YA 2M19A 2M4NA 4KVGB 4E74A 3WA0A 3NJTA 2JXXA 2MQJA 3MHSD 4GDLA 2KANA 2HDEA 2HTME 3U8ZA 1ZP0B 1FRDA 1V6EA 4LLGM 4NJCA 3H7SA 1I7HA 4IWQA 1K8RB 4FULA 4M02A 1ZOYB 1DOIA 4KGSA 1TBEA 1PDXA 2QILA 2KXJA 3DBRI 1QQRA 3ZNHB 2K3UA 4AWJA 3X0WA 5AZFA 4PS8A 1ZE3D 1BMLC 1XCTL 3ZO5B 1RFAA 1WYGA 1E8YA 2CHWA 1ZKHA 1D5ZC 1NI3A 2KMAA 1T3QA 3UQAA 3VRAB 4FN2A 2L52A 3P2BA 2K1FA 4ITKA 4UDUC 5DPWA 4ANVA 2WP9B 1QKZA 2IO1B 4J3OD 3GE8C 4KSLC 1WE7A 2LD9A 2D3AA 2L32A 3MP9A 3OJ4B 1QLBB 1WGHA 2MA9B 2JRHA 1LQBA 2NR2A 5KHQA 1N62A 1UELA 5AZHA 3SDLC 4JE3B 1QOGA 3RZWC 1KLGD 1WM3A 3GP7A 1IGDA 4OZBA 2D5GA 3EGRA 3BVGA 1P9DU 1WH3A 1WIAA 2L00B 1FXAA 2GB1A 4ZDVA 2DWQA 4BKGA 2BB6A 1WSPA 4W9GA 4DXFA 4F8CB 3ZJVA 1XEEA 2RGFA 2K0PA 4YSZB 4MM3B 2WX1A 2PKOA 2RSUA 4M00A 2DYMA 1XT9B 3A1QB 4OVVA 4DXAB 1E6EB 5DPSA 2M8SA 1PYWD 2KAJA 2L0FA 4IM0A 3RULA 1RLFA 2NPTB 1WFYA 3W9CB 4PK1A 3AU5A 3RI7C 1L6VA 2REXA 1TS2A 3DBLB 2KLCA 1YIWA 2BB5A 4S0RA 2OHFA 4MH8A 1VRAB 4E3CA 4WJQA 2E3TA 1WGGA 3IHPC 3NHEB 2NVUI 1OEYJ 1F2RI 4HEA1 1YN5A 4MH0E 2KC2A 2PJHA 5AUIA 2BYEA 2INCC 2AQ1B 1C1YB 2RMMA 4DHJB 2VH1A 4WQMA 4N59A 1FXTB 4N58A 2KDFB 2L76A 1D4BA 2FAZA 3JW0X 2JPHA 4MGZE 2KVZA 4IWPA 1KTKA 2BYFA 1FFVA 4RGOS 2QMTA 2G3QB 4DQOC 2B3AA 5EE3A 3QK0A 3ZVVA 2BW2A 1IGCA 1TZ1A 2L1AA 4KV2A 4IDIA 1WWTA 2KX3A 3APCA 1FXIA 5HI1A 3ZNID 3TMPB 2G9HD 2HD5B 2EELA 2V1YA 4GB9A 4YXDB 3BVZA 4US9A 4II2B 3IG3A 2KFKA 4TKNA 2G45B 3UGBB 2TSSA 3DHIC 1E8ZA 4A6QA 3PS6A 3KUZA 2Q5WD 4N6EB 1RM6C 3ZXRA 3RMKC 5BMGA 1WXAA 1F1HA 3ZTCA 5T8IA 4HRSA 4B9KA 1ENFA 3NVWA 3EA6A 2AEHA 3Q3FA 3L16A 2RPVA 2L7RA 5DPRA 2DZKA 5J17A 4EE2A 3X23A 5BMHA 2CR5A 5HKHA 2EMSA 4I6PA 2LZ6A 2KDBA 2GBRA 2PTLA 3AEBB 2WNMA 1YMHE 1UF0A 2AQ3B 3AN1A 3M95A 3AEGB 2ZVOA 3ZRFA 3K9OB 3DWMA 4YTPB 1L4ZB 5G2NA 1T5XD 1ZDVA 1FCLA 1ZXHA 4PYUA 3SEBA 2MSED 2V3PA 4HWIB 1VZ6A 1B9RA 4MDKE 2QC8A 1HQRD 2IGGA 1V5OA 2QIEB 2AL3A 3PZ8A 3Q8AA 4WWPA 4HJKA 5FR6A 2HJ8A 3ZDMC 2EKIA 1V2YA 4URKA 1R4MI 2KYWA 3H6NA 2CHXA 2IO0B 1NBFC 4MM3A 5EE9A 1YX6B 3A1QA 3AH7A 3VQIA 1GUAB 1K53A 1OFFA 1OQQA 1I35A 2Z8LA 4MSMB 4FA6A 4IOIE 3VR9B 3Q8CA 1UD7A 2NPTA 2D07B 4QAYA 1PGAA 2WU5B 5C3JB 3N32A 3VR8B 4P7IA 2YVCA 5D94A 2D11A 2Y3AA 3KVFB 5EE0A 1RYJA 3R2IA 1IYFA 3AEAB 4MELA 5MPOA 3EUB2 3AMZA 4WWMA 1EWCA 1D5MC 1DYQA 5BYSA 3V62A 1YJJA 1K50A 2MH7A 4OVUA 2AYOB 2ZPYA 2JZPA 3VXWA 3NY5A 2ZW1A 4NZLB 1WR6E 5CHWA 3VRBB 2BQQA 3RD2A 3UIPB 4BBNC 4XZ4A 2ZZPB 5DCNA 2ZJDA 4EKUA 3KW5B 2V3SA 1FRRA 1T6BX 4G0NB 4W9DA 3DBHI 2WLBA 3DVGY 3BVMA 4K81A 1AW7A 1MHXA 2M56B 3NZSA 4BOSC 4LJOB 4HXDA 1HTQA 4ZRJA 1VJKA 2AX5A 4K7SA 2KJ6A 1KJTA 4P6VF 3VTWA 2FUG1 3PTFC 2N1VA 3DVNV 4ZHOA 4WJPA 1RWSA 5JZEB 1OTRB 4AQ7A 1FO4A 1J7CA 5IAAC 3APFA 3PZDA 5L83A 4F7ZA 4M0WB 4FJYA 2PPHA 4GSWA 4A8XC 1Q0WB 3R2TA 2IBIB 4IC7B 2IGHA 2NBUA 1F9JA 4OZAA 2GBMA 1L6UA 4W9JA 4EZJA 5HG2A 3ZW3A 1A70A 2N7EA 4HJGE 1FMAD 2J4XA 2MCNB 4W9EA 4BKTA 2K6QA 2KDMA 4L2YA 4BKSD 1E7VA 4ZRKA 1FCCC 3W5VB 2ICIA 1C79A 1XLPA 2C7MB 3LDZE 3P63A 1VZ7A 1V9JA 4YT0B 1EO6A 3IXSA 2KNBA 5G5HA 2O6VB 2VZKB 4EEWA 4F1SA 1F2RC 2NMQA 1TY0A 2FNJB 3Q14C 4DWFA 2FUHB 4RMAA 3NVYA 3EECA 2JWUA
chains in the Genus database with same CATH topology
1UBIA 3QA8A 2MWSB 1TBEA 2BWES 2K8BA 2PE9A 1YX5B 2IY1B 4JGHB 2KXJA 3DBRI 3ZNHB 2XK5A 4AWJA 1YD8U 4FHKA 2KJRA 1VD2A 3W1YA 2RR9A 2LUEA 3WAOA 3AI5A 3VTUA 3X0WA 5AZFA 2BGFA 4PS8A 4AP4C 2O6VD 1J19A 1IP9A 3ZO5B 3B1LX 1RFAA 4FJZA 2C60A 3H7PB 1LM8B 1E8YA 2CHWA 4K7UA 5E6NA 1ZKHA 4GDKA 4NQLB 4A3OA 5J2RA 1V86A 2L05A 2KMAA 2K8CA 5D2MB 2KFJA 1QZEA 1JRUA 2QHOA 3UQAA 1L2NA 3JSVA 2FCQA 3RCZA 3M3JA 4ZYNA 4FN2A 3ZRCA 1NDDA 3PHXB 4IG7B 2DAJA 3P2BA 3QCAA 2N4FA 2K1FA 3QX1A 4ZRIA 2D2QA 3PREA 1Z2MA 2YLMA 3MJWA 3SD5A 3AULA 3OAWA 5DPWA 3L0WB 4ANVA 1YQBA 3MTNB 4DHJD 3BY4B 3IVFA 1U4AA 4X57B 2IO1B 4G3XB 3EHVA 4GN1A 3QC8B 1E7UA 3V61A 3LJ3A 2Z59B 3DDCB 4DK5A 1SIFA 1UBQA 1V49A 4KSLC 2HE7A 1LFDA 4GOCA 1KM7A 2M0XA 2PEAA 3I3TB 1WE7A 5LLIA 4J6IA 2FCNA 2LD9A 3OJ4B 4ANXA 3IBEA 1XD3B 3V6EB 4HLEA 1WGHA 2MA9B 1J0GA 2JRHA 1LQBA 2NR2A 5KHQA 1LXDA 1TTNA 1UELA 4KIKA 5AZHA 3SDLC 3U30A 3VAWA 4NPNA 3RZWC 1KLVA 4FLHA 2KJHB 2KQ7A 4W9HA 2KD0A 3QJZA 1WM3A 1P0RA 2KZRA 3N30A 2BKRB 3DBLI 1P9DU 2ZNVB 4PYZA 1WH3A 1WIAA 2L00B 3ZLZA 3QHTA 5EDSA 4ZDVA 2JRIB 2FCMA 2CU1A 2K6DB 3WALA 4BKGA 4MGIE 1S3SG 1WJ6A 5G55A 3RT3B 3TJPA 2KVRA 2DYOA 3H1UA 4W9GA 1CMXB 4F8CB 3A9KA 2RGFA 1H8CA 2MLBA 4AJWA 1X1MA 2D10A 2WX1A 3R7RA 2RSUA 1WE6A 4LCDE 3RUIB 2DYMA 1XT9B 2L8JA 3A1QB 4OVVA 2MP2B 4DXAB 4LJPB 2D3GA 5DPSA 4JIOU 2M8SA 2L0FA 4IM0A 4E71A 4HK2A 2LXCA 3PRMB 1XQQA 1RLFA 2FIDA 1WFYA 2LJ5A 2NPTB 4II3B 3RULA 3SHQA 4DHZB 2LVPA 4G11A 1ISNA 3AU5A 3HIZA 4NNJB 1OGWA 2REXA 4NAWB 4WWNA 3K9PB 2KDEB 2KLCA 1YIWA 2DAFA 2RD0A 2XEWA 3GZNI 2ZEQA 4KZ0A 2MBEA 1ZGUB 3A4RA 4KZCA 3TIXA 4WAAA 3DBSA 2KC1A 1SGHA 2N1WA 2KN5A 4GMVA 4BKSA 1WJNA 4E3CA 3B0AA 4WJQA 3IHPC 1WGGA 4KDIC 3ZUNA 4TV3A 3NHEB 2NVUI 1OEYJ 2BPSA 3KUCB 5CHVC 3A9JB 4NY0A 5AEKB 4MH0E 4NQKE 4W9KA 4I6LB 4WJNA 2CS4A 2KC2A 2KTRB 1YJ1A 2PJHA 2OJRA 4K1RB 4GIVA 3VFKA 1EF5A 2BYEA 2MBOA 1A5RA 2IO3B 1C1YB 4EUTA 1OQYA 2DZMA 5BO4B 4DHJB 2KFKB 2KQSA 1M94A 4NAWA 4W9CA 1FXTB 2JUOA 4MSQB 2IZVB 2O2VA 2KDFB 1AARA 2L76A 2N9EB 2FAZA 3JW0X 2JPHA 3JYUA 3S2AA 5CTRC 4IWPA 1GC7A 2BYFA 2O6VA 3R7QA 3WANA 1GNUA 2G3QB 1C3TA 2B3AA 4HPLB 3QK0A 3Q3JA 3ZVVA 3CSTA 1WM2A 2KTFA 1TZ1A 2XBBC 3PT2B 1WX8A 4TQ0A 3L54A 4KV2A 2HTHA 1P98A 2KX3A 1VCBA 1GJZA 3APCA 3QIJA 4DBGA 5C1ZA 3O65B 2BWFA 3HK0A 3TMPB 3WAMA 3CMMB 3PGEA 3ZNID 2HD5B 5LXHA 1WYWB 2N9PC 2V1YA 4GB9A 3QAQA 2LASA 1TGZB 4JLCA 3PVLA 1WMHB 4II2B 3IG3A 4DDGD 4MEMA 4FBJB 2KFKA 2LGDA 4KDLB 4IWOA 2J0KA 4HVBA 2UWQA 3L08A 1HE8A 2KHWB 4IUMB 4TKNA 2G45B 4TUUA 4A3PA 4ANWA 3UGBB 4FADA 2EMTA 3PV1A 3A4SC 3H7PA 1R4NI 3T8MA 3U7DA 1G6JA 1E8ZA 4BBNF 2C9WB 3VDZA 1UZXB 3DVGX 1RAXA 3PS6A 4WJOA 3KUZA 1NI2A 2ZCCA 2LRUA 1WXAA 3ZTCA 2LVOA 5E6OA 1KOTA 1D3ZA 2VRRB 4A20A 4ICUA 4B9KA 2M1MA 2CHZA 4XX5A 3VHTC 4GXBA 2AEHA 2MW5A 3Q3FA 4RM8A 3L16A 3KUDB 2L7RA 2KMCA 2DZKA 5DPRA 5J17A 3JVZX 1WF9A 2GBJA 3V60A 3X23A 1BT0A 2KWUB 2CKHB 2CR5A 4DHZE 2KKCA 5HKHA 2FCSA 2EMSA 4I6PA 2LZ6A 2KDBA 3SU8X 2GBRA 3ZDTA 2KO3A 2W9NA 3TL5A 2LGYA 2MX2A 4YL8A 2WWZA 3ZNZB 5L95C 1WRDB 2G4SA 3ML8A 2DZIA 3ONSA 3ZKJC 2DYBA 4GGQA 2FIFA 4GDLB 3M95A 3V6CB 2J0MA 1GC6A 2NBWB 2RPQA 3L13A 3NOBA 2ZVOA 3UIOB 4HDOA 3PRZA 3ZRFA 3K9OB 5CX3A 2L0TA 4KSKC 4IM2A 2LI5A 5G2NA 1I42A 4DDID 4ANUA 2C5LC 4CO7A 1E90A 3R3MA 2GBNA 3L10B 1WZ3A 5CHFA 1Z5SB 4PYUA 4NJ6A 2MSED 2DX5B 2NBVB 4HWIB 1WY8A 2DHZA 4MDKE 3W1SC 4MJSB 1V5OA 4BVUC 1GG3A 3KH0A 3UINB 2AL3A 2IYDB 3B08A 4WWPA 4HJKA 5FR6A 2HJ8A 3ZDMC 4G50A 3ZNGC 1V2YA 1WZ0A 4URKA 1R4MI 4LDTB 2XK5B 3H6NA 2CHXA 4CYEA 2IO0B 2WDTB 1NBFC 1ZW7A 4IM3A 4MM3A 4EZKA 2V4LA 1YX6B 2BF8B 2IO2B 3OLMD 1Q1OA 3A1QA 4HCPB 2MP2A 4CHKA 3EC8A 3VQIA 1GUAB 1I35A 2Z0DB 2DENB 2KOXA 4MSMB 5D7GA 4FA6A 5JHAA 1UD7A 2NPTA 2KX0A 1WI0A 1E8WA 2KWCA 2KWVB 4MGYE 2D07B 1UGMA 4AJYB 2J7QB 3JSVB 5IA7A 2DZJA 4W9IA 4K7WA 4NJ7A 5D6JB 1WGDA 1P3QU 3N32A 1V5TA 3UF8A 3VUYA 3EFUA 4ICVA 3CF6E 3H9DA 1V81A 4JL9A 4PS7A 2Y5BB 3VH4B 4P7IA 2YVCA 5D94A 4LDTD 2D11A 3PSEB 4HDQA 4EFOA 2N7DA 2G4DB 4W9FA 3KVFB 5AZGA 3QQ8B 2M17A 4BFRA 1IYFA 3QWZB 3QARA 4MELA 2LGXA 4M8MA 3A9JA 2JVCA 4W9LA 5C23A 1E5WA 2GMIC 3WAPA 1Y8RC 1P1AA 4JQWC 3W1SA 2L3ZA 3VTVA 3V62A 2KTRA 2ZVNA 2A4ZA 3DOWA 4OVUA 2I1JA 4IW0A 5E6PA 4I6NB 3VUWA 2AYOB 2ZPYA 2JZZA 3DCGA 2Z0EB 5DPTA 3ECIA 3VXWA 3NY5A 1S1QB 3PLUA 1WXVA 4AUQC 1WR6E 2NS5A 3OJ3A 5CHWA 4KIKB 1WXMA 3RD2A 3UIPB 4HPMB 2JY6A 3APDA 3VH3B 4XZ4A 4AOFA 4BBNC 2ZZPB 3M63B 1V80A 2ZJDA 5DCNA 3HM3A 4EKUA 4HCNB 2LRWA 3KW5B 3A33B 2ZNVC 2K8HA 2V3SA 1E8XA 4W9DA 4G0NB 4PS3A 1J8CA 3DBHI 3RZFA 3TCAA 3DVGY 1IPGA 1MG8A 4FHJA 3ML9A 4K81A 4MGKE 1WX9A 3D32A 3NZSA 4BOSC 4LJOB 4HXDA 3NZUA 1PQSA 4BOZB 2IY0B 2AWTA 4ZRJA 4FJVB 4WWOA 2GBKA 2LVQA 2GOWA 5TR5A 1OEYA 5J18A 4K7SA 5GMVA 1EF1A 1RRBA 2KJ6A 1WR1A 3DQVA 5JH5C 3AXCA 3A9KB 1KJTA 2BYVE 5LXIB 1WMHA 2NCNA 3ENEA 1WXSA 3VTWA 3CSFA 1WX7A 2ZCBA 3PTFC 4TQ1A 2N1VA 3BINA 3DVNV 3KYCD 3C0RB 4WJPA 5JZEB 4WQOB 1WJ4A 1OTRB 4M8NA 3VUXA 2C7HA 3ALBA 3PLVA 4XC2A 5IAAC 2BKFA 1SE9A 2ASQA 2JWZA 2J0JA 2MRPA 2OOBB 3APFA 3PZDA 3T9LA 4ASWC 5L83A 2WYQA 1WGRA 4F7ZA 4M0WB 3AU4A 3DVNU 4B95A 4FJYA 2PPHA 4EZLA 4GSWA 2I1KA 2KK8A 2R2QA 2WX0A 2PE6B 2K39A 2JT4B 1Q0WB 2KDIA 1H4RA 2JZ3B 1EUVB 3HM6X 3PHWB 3ZTDA 3HHMA 2IBIB 5KHOA 4IC7B 3NS8A 3KYDD 2NBUA 3VVWB 3UQBA 2LWPA 3WIMA 1F9JA 1T0YA 3M62B 3R66C 1UH6A 3N3KB 3L17A 2GBMA 2N9XA 3GOEA 4W9JA 2MBBB 2ZPNA 4RM9A 4EZJA 2MBQA 2K25A 4EOYA 3PRPB 1Q5WB 3ZW3A 2EKEC 2N7EA 3TBLD 2MBHA 2LXAA 1L7YA 2MCNB 2JF5A 4W9EA 2M4NA 3IFWB 4KVGB 4BKTA 4E74A 2K6QA 4B6WA 3PPAA 1WJUA 3WA0A 4BKSD 2JXXA 1E7VA 2MQJA 3MHSD 2O2VB 4GDLA 4ZRKA 2R2OA 2KANA 2C7NB 5JHBA 2C7MB 2UYZB 3LDZE 3RYTA 3U8ZA 1V9JA 4GDKB 1EO6A 2KNBA 4EEWA 2O6VB 4F1SA 1V6EA 2KLGA 3H7SA 3ZIMA 4IWQA 2FNJB 1K8RB 4DWFA 4N9F4 2FUHB 4FULA 3DPDA 1WGYA 2AL6A 4RMAA 4MJSA 4GU2A 3EECA 4MGZE 2A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBI A;  3QA8 A;  2MWS B;  1TBE A;  2BWE S;  2K8B A;  2PE9 A;  1YX5 B;  2IY1 B;  4JGH B;  2KXJ A;  3DBR I;  3ZNH B;  2XK5 A;  4AWJ A;  1YD8 U;  4FHK A;  2KJR A;  1VD2 A;  3W1Y A;  2RR9 A;  2LUE A;  3WAO A;  3AI5 A;  3VTU A;  3X0W A;  5AZF A;  2BGF A;  4PS8 A;  4AP4 C;  2O6V D;  1J19 A;  1IP9 A;  3ZO5 B;  3B1L X;  1RFA A;  4FJZ A;  2C60 A;  3H7P B;  1LM8 B;  1E8Y A;  2CHW A;  4K7U A;  5E6N A;  1ZKH A;  4GDK A;  4NQL B;  4A3O A;  5J2R A;  1V86 A;  2L05 A;  2KMA A;  2K8C A;  5D2M B;  2KFJ A;  1QZE A;  1JRU A;  2QHO A;  3UQA A;  1L2N A;  3JSV A;  2FCQ A;  3RCZ A;  3M3J A;  4ZYN A;  4FN2 A;  3ZRC A;  1NDD A;  3PHX B;  4IG7 B;  2DAJ A;  3P2B A;  3QCA A;  2N4F A;  2K1F A;  3QX1 A;  4ZRI A;  2D2Q A;  3PRE A;  1Z2M A;  2YLM A;  3MJW A;  3SD5 A;  3AUL A;  3OAW A;  5DPW A;  3L0W B;  4ANV A;  1YQB A;  3MTN B;  4DHJ D;  3BY4 B;  3IVF A;  1U4A A;  4X57 B;  2IO1 B;  4G3X B;  3EHV A;  4GN1 A;  3QC8 B;  1E7U A;  3V61 A;  3LJ3 A;  2Z59 B;  3DDC B;  4DK5 A;  1SIF A;  1UBQ A;  1V49 A;  4KSL C;  2HE7 A;  1LFD A;  4GOC A;  1KM7 A;  2M0X A;  2PEA A;  3I3T B;  1WE7 A;  5LLI A;  4J6I A;  2FCN A;  2LD9 A;  3OJ4 B;  4ANX A;  3IBE A;  1XD3 B;  3V6E B;  4HLE A;  1WGH A;  2MA9 B;  1J0G A;  2JRH A;  1LQB A;  2NR2 A;  5KHQ A;  1LXD A;  1TTN A;  1UEL A;  4KIK A;  5AZH A;  3SDL C;  3U30 A;  3VAW A;  4NPN A;  3RZW C;  1KLV A;  4FLH A;  2KJH B;  2KQ7 A;  4W9H A;  2KD0 A;  3QJZ A;  1WM3 A;  1P0R A;  2KZR A;  3N30 A;  2BKR B;  3DBL I;  1P9D U;  2ZNV B;  4PYZ A;  1WH3 A;  1WIA A;  2L00 B;  3ZLZ A;  3QHT A;  5EDS A;  4ZDV A;  2JRI B;  2FCM A;  2CU1 A;  2K6D B;  3WAL A;  4BKG A;  4MGI E;  1S3S G;  1WJ6 A;  5G55 A;  3RT3 B;  3TJP A;  2KVR A;  2DYO A;  3H1U A;  4W9G A;  1CMX B;  4F8C B;  3A9K A;  2RGF A;  1H8C A;  2MLB A;  4AJW A;  1X1M A;  2D10 A;  2WX1 A;  3R7R A;  2RSU A;  1WE6 A;  4LCD E;  3RUI B;  2DYM A;  1XT9 B;  2L8J A;  3A1Q B;  4OVV A;  2MP2 B;  4DXA B;  4LJP B;  2D3G A;  5DPS A;  4JIO U;  2M8S A;  2L0F A;  4IM0 A;  4E71 A;  4HK2 A;  2LXC A;  3PRM B;  1XQQ A;  1RLF A;  2FID A;  1WFY A;  2LJ5 A;  2NPT B;  4II3 B;  3RUL A;  3SHQ A;  4DHZ B;  2LVP A;  4G11 A;  1ISN A;  3AU5 A;  3HIZ A;  4NNJ B;  1OGW A;  2REX A;  4NAW B;  4WWN A;  3K9P B;  2KDE B;  2KLC A;  1YIW A;  2DAF A;  2RD0 A;  2XEW A;  3GZN I;  2ZEQ A;  4KZ0 A;  2MBE A;  1ZGU B;  3A4R A;  4KZC A;  3TIX A;  4WAA A;  3DBS A;  2KC1 A;  1SGH A;  2N1W A;  2KN5 A;  4GMV A;  4BKS A;  1WJN A;  4E3C A;  3B0A A;  4WJQ A;  3IHP C;  1WGG A;  4KDI C;  3ZUN A;  4TV3 A;  3NHE B;  2NVU I;  1OEY J;  2BPS A;  3KUC B;  5CHV C;  3A9J B;  4NY0 A;  5AEK B;  4MH0 E;  4NQK E;  4W9K A;  4I6L B;  4WJN A;  2CS4 A;  2KC2 A;  2KTR B;  1YJ1 A;  2PJH A;  2OJR A;  4K1R B;  4GIV A;  3VFK A;  1EF5 A;  2BYE A;  2MBO A;  1A5R A;  2IO3 B;  1C1Y B;  4EUT A;  1OQY A;  2DZM A;  5BO4 B;  4DHJ B;  2KFK B;  2KQS A;  1M94 A;  4NAW A;  4W9C A;  1FXT B;  2JUO A;  4MSQ B;  2IZV B;  2O2V A;  2KDF B;  1AAR A;  2L76 A;  2N9E B;  2FAZ A;  3JW0 X;  2JPH A;  3JYU A;  3S2A A;  5CTR C;  4IWP A;  1GC7 A;  2BYF A;  2O6V A;  3R7Q A;  3WAN A;  1GNU A;  2G3Q B;  1C3T A;  2B3A A;  4HPL B;  3QK0 A;  3Q3J A;  3ZVV A;  3CST A;  1WM2 A;  2KTF A;  1TZ1 A;  2XBB C;  3PT2 B;  1WX8 A;  4TQ0 A;  3L54 A;  4KV2 A;  2HTH A;  1P98 A;  2KX3 A;  1VCB A;  1GJZ A;  3APC A;  3QIJ A;  4DBG A;  5C1Z A;  3O65 B;  2BWF A;  3HK0 A;  3TMP B;  3WAM A;  3CMM B;  3PGE A;  3ZNI D;  2HD5 B;  5LXH A;  1WYW B;  2N9P C;  2V1Y A;  4GB9 A;  3QAQ A;  2LAS A;  1TGZ B;  4JLC A;  3PVL A;  1WMH B;  4II2 B;  3IG3 A;  4DDG D;  4MEM A;  4FBJ B;  2KFK A;  2LGD A;  4KDL B;  4IWO A;  2J0K A;  4HVB A;  2UWQ A;  3L08 A;  1HE8 A;  2KHW B;  4IUM B;  4TKN A;  2G45 B;  4TUU A;  4A3P A;  4ANW A;  3UGB B;  4FAD A;  2EMT A;  3PV1 A;  3A4S C;  3H7P A;  1R4N I;  3T8M A;  3U7D A;  1G6J A;  1E8Z A;  4BBN F;  2C9W B;  3VDZ A;  1UZX B;  3DVG X;  1RAX A;  3PS6 A;  4WJO A;  3KUZ A;  1NI2 A;  2ZCC A;  2LRU A;  1WXA A;  3ZTC A;  2LVO A;  5E6O A;  1KOT A;  1D3Z A;  2VRR B;  4A20 A;  4ICU A;  4B9K A;  2M1M A;  2CHZ A;  4XX5 A;  3VHT C;  4GXB A;  2AEH A;  2MW5 A;  3Q3F A;  4RM8 A;  3L16 A;  3KUD B;  2L7R A;  2KMC A;  2DZK A;  5DPR A;  5J17 A;  3JVZ X;  1WF9 A;  2GBJ A;  3V60 A;  3X23 A;  1BT0 A;  2KWU B;  2CKH B;  2CR5 A;  4DHZ E;  2KKC A;  5HKH A;  2FCS A;  2EMS A;  4I6P A;  2LZ6 A;  2KDB A;  3SU8 X;  2GBR A;  3ZDT A;  2KO3 A;  2W9N A;  3TL5 A;  2LGY A;  2MX2 A;  4YL8 A;  2WWZ A;  3ZNZ B;  5L95 C;  1WRD B;  2G4S A;  3ML8 A;  2DZI A;  3ONS A;  3ZKJ C;  2DYB A;  4GGQ A;  2FIF A;  4GDL B;  3M95 A;  3V6C B;  2J0M A;  1GC6 A;  2NBW B;  2RPQ A;  3L13 A;  3NOB A;  2ZVO A;  3UIO B;  4HDO A;  3PRZ A;  3ZRF A;  3K9O B;  5CX3 A;  2L0T A;  4KSK C;  4IM2 A;  2LI5 A;  5G2N A;  1I42 A;  4DDI D;  4ANU A;  2C5L C;  4CO7 A;  1E90 A;  3R3M A;  2GBN A;  3L10 B;  1WZ3 A;  5CHF A;  1Z5S B;  4PYU A;  4NJ6 A;  2MSE D;  2DX5 B;  2NBV B;  4HWI B;  1WY8 A;  2DHZ A;  4MDK E;  3W1S C;  4MJS B;  1V5O A;  4BVU C;  1GG3 A;  3KH0 A;  3UIN B;  2AL3 A;  2IYD B;  3B08 A;  4WWP A;  4HJK A;  5FR6 A;  2HJ8 A;  3ZDM C;  4G50 A;  3ZNG C;  1V2Y A;  1WZ0 A;  4URK A;  1R4M I;  4LDT B;  2XK5 B;  3H6N A;  2CHX A;  4CYE A;  2IO0 B;  2WDT B;  1NBF C;  1ZW7 A;  4IM3 A;  4MM3 A;  4EZK A;  2V4L A;  1YX6 B;  2BF8 B;  2IO2 B;  3OLM D;  1Q1O A;  3A1Q A;  4HCP B;  2MP2 A;  4CHK A;  3EC8 A;  3VQI A;  1GUA B;  1I35 A;  2Z0D B;  2DEN B;  2KOX A;  4MSM B;  5D7G A;  4FA6 A;  5JHA A;  1UD7 A;  2NPT A;  2KX0 A;  1WI0 A;  1E8W A;  2KWC A;  2KWV B;  4MGY E;  2D07 B;  1UGM A;  4AJY B;  2J7Q B;  3JSV B;  5IA7 A;  2DZJ A;  4W9I A;  4K7W A;  4NJ7 A;  5D6J B;  1WGD A;  1P3Q U;  3N32 A;  1V5T A;  3UF8 A;  3VUY A;  3EFU A;  4ICV A;  3CF6 E;  3H9D A;  1V81 A;  4JL9 A;  4PS7 A;  2Y5B B;  3VH4 B;  4P7I A;  2YVC A;  5D94 A;  4LDT D;  2D11 A;  3PSE B;  4HDQ A;  4EFO A;  2N7D A;  2G4D B;  4W9F A;  3KVF B;  5AZG A;  3QQ8 B;  2M17 A;  4BFR A;  1IYF A;  3QWZ B;  3QAR A;  4MEL A;  2LGX A;  4M8M A;  3A9J A;  2JVC A;  4W9L A;  5C23 A;  1E5W A;  2GMI C;  3WAP A;  1Y8R C;  1P1A A;  4JQW C;  3W1S A;  2L3Z A;  3VTV A;  3V62 A;  2KTR A;  2ZVN A;  2A4Z A;  3DOW A;  4OVU A;  2I1J A;  4IW0 A;  5E6P A;  4I6N B;  3VUW A;  2AYO B;  2ZPY A;  2JZZ A;  3DCG A;  2Z0E B;  5DPT A;  3ECI A;  3VXW A;  3NY5 A;  1S1Q B;  3PLU A;  1WXV A;  4AUQ C;  1WR6 E;  2NS5 A;  3OJ3 A;  5CHW A;  4KIK B;  1WXM A;  3RD2 A;  3UIP B;  4HPM B;  2JY6 A;  3APD A;  3VH3 B;  4XZ4 A;  4AOF A;  4BBN C;  2ZZP B;  3M63 B;  1V80 A;  2ZJD A;  5DCN A;  3HM3 A;  4EKU A;  4HCN B;  2LRW A;  3KW5 B;  3A33 B;  2ZNV C;  2K8H A;  2V3S A;  1E8X A;  4W9D A;  4G0N B;  4PS3 A;  1J8C A;  3DBH I;  3RZF A;  3TCA A;  3DVG Y;  1IPG A;  1MG8 A;  4FHJ A;  3ML9 A;  4K81 A;  4MGK E;  1WX9 A;  3D32 A;  3NZS A;  4BOS C;  4LJO B;  4HXD A;  3NZU A;  1PQS A;  4BOZ B;  2IY0 B;  2AWT A;  4ZRJ A;  4FJV B;  4WWO A;  2GBK A;  2LVQ A;  2GOW A;  5TR5 A;  1OEY A;  5J18 A;  4K7S A;  5GMV A;  1EF1 A;  1RRB A;  2KJ6 A;  1WR1 A;  3DQV A;  5JH5 C;  3AXC A;  3A9K B;  1KJT A;  2BYV E;  5LXI B;  1WMH A;  2NCN A;  3ENE A;  1WXS A;  3VTW A;  3CSF A;  1WX7 A;  2ZCB A;  3PTF C;  4TQ1 A;  2N1V A;  3BIN A;  3DVN V;  3KYC D;  3C0R B;  4WJP A;  5JZE B;  4WQO B;  1WJ4 A;  1OTR B;  4M8N A;  3VUX A;  2C7H A;  3ALB A;  3PLV A;  4XC2 A;  5IAA C;  2BKF A;  1SE9 A;  2ASQ A;  2JWZ A;  2J0J A;  2MRP A;  2OOB B;  3APF A;  3PZD A;  3T9L A;  4ASW C;  5L83 A;  2WYQ A;  1WGR A;  4F7Z A;  4M0W B;  3AU4 A;  3DVN U;  4B95 A;  4FJY A;  2PPH A;  4EZL A;  4GSW A;  2I1K A;  2KK8 A;  2R2Q A;  2WX0 A;  2PE6 B;  2K39 A;  2JT4 B;  1Q0W B;  2KDI A;  1H4R A;  2JZ3 B;  1EUV B;  3HM6 X;  3PHW B;  3ZTD A;  3HHM A;  2IBI B;  5KHO A;  4IC7 B;  3NS8 A;  3KYD D;  2NBU A;  3VVW B;  3UQB A;  2LWP A;  3WIM A;  1F9J A;  1T0Y A;  3M62 B;  3R66 C;  1UH6 A;  3N3K B;  3L17 A;  2GBM A;  2N9X A;  3GOE A;  4W9J A;  2MBB B;  2ZPN A;  4RM9 A;  4EZJ A;  2MBQ A;  2K25 A;  4EOY A;  3PRP B;  1Q5W B;  3ZW3 A;  2EKE C;  2N7E A;  3TBL D;  2MBH A;  2LXA A;  1L7Y A;  2MCN B;  2JF5 A;  4W9E A;  2M4N A;  3IFW B;  4KVG B;  4BKT A;  4E74 A;  2K6Q A;  4B6W A;  3PPA A;  1WJU A;  3WA0 A;  4BKS D;  2JXX A;  1E7V A;  2MQJ A;  3MHS D;  2O2V B;  4GDL A;  4ZRK A;  2R2O A;  2KAN A;  2C7N B;  5JHB A;  2C7M B;  2UYZ B;  3LDZ E;  3RYT A;  3U8Z A;  1V9J A;  4GDK B;  1EO6 A;  2KNB A;  4EEW A;  2O6V B;  4F1S A;  1V6E A;  2KLG A;  3H7S A;  3ZIM A;  4IWQ A;  2FNJ B;  1K8R B;  4DWF A;  4N9F 4;  2FUH B;  4FUL A;  3DPD A;  1WGY A;  2AL6 A;  4RMA A;  4MJS A;  4GU2 A;  3EEC A;  4MGZ E;  2A5U A; 
#chains in the Genus database with same CATH topology
 3QA8 A;  2MWS B;  1V97 A;  1C76 A;  3NS1 A;  5H92 C;  2IY1 B;  3RNA C;  1YD8 U;  1VD2 A;  3W1Y A;  2NTT A;  4YWG G;  2BGF A;  2N9K A;  1J19 A;  4L23 A;  2C60 A;  3H7P B;  1LM8 B;  4JWS C;  1HTO A;  5E6N A;  4GDK A;  5J2R A;  4JX1 C;  4USA A;  1V86 A;  2L05 A;  5D2M B;  2K8C A;  1QZE A;  1JRU A;  2QHO A;  2LEK A;  1L2N A;  2FCQ A;  1SE3 A;  4XE0 A;  4ZYN A;  4IG7 B;  2KQ4 X;  3MJW A;  1TS4 A;  2SAK A;  3AUL A;  3OAW A;  1TYG B;  3L0W B;  2PW9 A;  3MTN B;  4DHJ D;  3BY4 B;  3I9V 1;  4G3X B;  1E7U A;  4RCO A;  3V61 A;  5IP4 D;  3DDC B;  1I4P A;  1N60 A;  1SIF A;  5BYR A;  1TJE A;  2Y5P A;  3I3T B;  5LLI A;  4J6I A;  4ANX A;  1XD3 B;  1SXT A;  1GPX A;  1LO5 D;  3RNE C;  1QT9 A;  3N30 A;  2BKR B;  2Y5C A;  1SIJ A;  4ZYS A;  3BK2 A;  3ZLZ A;  5FK9 C;  2JRI B;  2CU1 A;  4MGI E;  1S3S G;  3U2S C;  3TJP A;  2CU3 A;  4R3D A;  2DYO A;  2XNA C;  3T3O A;  2W54 A;  1H8C A;  4AJW A;  2D10 A;  2QSD A;  4LCD E;  1DOX A;  2R61 A;  3RUI B;  2L8J A;  1YNT E;  2D3G A;  4YTN B;  4LTU A;  2WXO A;  2LXC A;  2ZW0 A;  3SHQ A;  2LVP A;  4G11 A;  4M0W A;  1OGW A;  2PVO D;  2DAF A;  2ZEQ A;  4KZC A;  3BYY B;  2KC1 A;  1Q10 A;  3B0A A;  2DLB A;  4KDI C;  4KKI A;  2BPS A;  1ZPS A;  4GLS C;  4OW0 A;  2KAC A;  5AEK B;  2FBW B;  2W3R A;  2V9H A;  4I6L B;  3B2F A;  4HPP A;  3VFK A;  1A5R A;  1F0Z A;  3MFG A;  4EUT A;  1OQY A;  2DZM A;  5BO4 B;  2KFK B;  1T0R C;  3R8B A;  4W9C A;  3N1Z C;  3P4R B;  3N1X C;  2O6V A;  3R7Q A;  1SSN A;  3WAN A;  3SFD B;  1WM2 A;  3NRZ A;  4TQ0 A;  1P98 A;  2PLP A;  2J52 A;  4A55 A;  3O65 B;  2BWF A;  3WAM A;  2RDG A;  3WCQ A;  3Q69 A;  3QAQ A;  2LAS A;  3ZYY X;  3CWI A;  3OG5 A;  4DDG D;  3RNG C;  2PIA A;  4MEM A;  2BVC A;  2LGD A;  4KDL B;  3DHG C;  3ETR A;  1HE8 A;  2KHW B;  4TUU A;  4A3P A;  3PV1 A;  3H7P A;  3T8M A;  4C7Y A;  2LMC A;  4JWU C;  3VDZ A;  1EU3 A;  1JQ4 A;  1STE A;  1RAX A;  4WJO A;  1NI2 A;  2LRU A;  1AWD A;  3FC4 A;  1D3Z A;  2VRR B;  4A20 A;  3VHT C;  4GXB A;  1UWX A;  2IDY A;  2GBJ A;  2KWU B;  3U52 E;  1N6Z A;  2PVG C;  1SJH D;  4YSX B;  3AEF B;  2WU2 B;  3TL5 A;  1ET9 A;  3ZNZ B;  5L95 C;  5G5G A;  1WRD B;  3ML8 A;  3ONS A;  2DYB A;  2FIF A;  1E7P B;  3V6C B;  4C00 A;  3DHH C;  1GC6 A;  3L13 A;  3NOB A;  1TKE A;  3PRZ A;  5CX3 A;  2L0T A;  4IM2 A;  2LI5 A;  4DDI D;  4ANU A;  3I57 A;  2C5L C;  4BAX A;  4CO7 A;  5CHF A;  2GBN A;  3L10 B;  1WZ3 A;  1TKY A;  1Z5S B;  2NBV B;  3TUO A;  2DHZ A;  4MJS B;  5IKC M;  1KF6 B;  3FIL B;  2XK5 B;  4CYE A;  2WDT B;  2ON8 A;  1NEN B;  2IO2 B;  3OLM D;  2ACZ B;  3EC8 A;  5JHA A;  2KX0 A;  4CQN A;  1UGM A;  4AJY B;  5IA7 A;  2DZJ A;  4K7W A;  3VUY A;  1ACC A;  3UF8 A;  3VH4 B;  4PS7 A;  2YEP B;  1TIF A;  4LDT D;  3PSE B;  3ABV B;  4EFO A;  1XF5 L;  5AZG A;  3OWE B;  4Q2J A;  3QAR A;  4M8M A;  1I4X A;  4W9L A;  1P1A A;  2JYE A;  2L3Z A;  2VZK D;  4M01 A;  2ZVN A;  2A4Z A;  1F77 A;  2I1J A;  2Z0E B;  5DPT A;  1FFU A;  3ECI A;  1S1Q B;  1VLB A;  2NS5 A;  3OJ3 A;  4LNN A;  2WHI A;  5E6J A;  3APD A;  3P4S B;  3VH3 B;  2LJI A;  3M63 B;  2BT6 A;  4IKG A;  3O13 A;  1DOY A;  2ZNV C;  2I2Y A;  1E8X A;  3T3N A;  3TCA A;  4A90 A;  1FNV A;  1GOZ A;  2IND C;  1MPE A;  1MG8 A;  3ML9 A;  4MGK E;  3NZU A;  3URY A;  2AWT A;  3AEE B;  2GBK A;  2LVQ A;  2GOW A;  1OEY A;  5J18 A;  1EF1 A;  3A9K B;  5LXI B;  3NUH B;  4PT5 A;  3P42 A;  1WX7 A;  2BS4 B;  4TQ1 A;  3BIN A;  4BZA A;  2N7J A;  3VUX A;  4M8N A;  2C7H A;  2BKF A;  1SE9 A;  2JWZ A;  2OOB B;  2J0J A;  2MRP A;  3T9L A;  1IBX B;  2WYQ A;  3AU4 A;  2LUM A;  3DVN U;  1MG4 A;  4EZL A;  2I1K A;  2R2Q A;  2WX0 A;  1H4R A;  3ZTD A;  2BS3 B;  3PO0 A;  3HHM A;  5KHO A;  3NS8 A;  3UQB A;  2LWP A;  1QIL A;  3R66 C;  1UH6 A;  2INP E;  3B9J A;  2SEB D;  2MBB B;  2ZPN A;  4RM9 A;  1BXT A;  3KQ4 A;  4WH4 A;  3PRP B;  2INN E;  1JW9 D;  3FAH A;  2MBH A;  1GAQ B;  2LXA A;  3CIR B;  2JF5 A;  4KX6 B;  2FE8 A;  1CZP A;  3BII D;  2KT7 A;  3PPA A;  1ESF A;  3RPF C;  3AE9 B;  2O2V B;  2R2O A;  4LNK A;  5JHB A;  3L4P A;  2YEP F;  3AV8 A;  3RYT A;  1FEH A;  4GDK B;  2WXI A;  2LHE A;  1WGY A;  4MJS A;  3HRD D;  2A5U A;  1UBI A;  3FIL A;  2QEJ C;  1E9M A;  3IT6 B;  2RDH A;  2WXR A;  4C80 A;  1E10 A;  4JGH B;  2XK5 A;  4FHK A;  2KJR A;  2W82 A;  2RR9 A;  3WAO A;  1KH0 A;  3AI5 A;  1BUI C;  3U7Z A;  1IP9 A;  3B1L X;  1HXY D;  3I63 C;  4NQL B;  1FM0 D;  3C19 A;  3ZJT A;  2AQ2 B;  3M3J A;  5IOI A;  1VR9 A;  3PHX B;  1LGR A;  2K9X A;  2CJO A;  2DBY A;  4LNO A;  1V8C A;  2D2Q A;  3PRE A;  4ZRI A;  1QOB A;  1Z2M A;  5FR3 A;  1YQB A;  3IVF A;  1U4A A;  4X57 B;  1B1Z A;  2WXK A;  3KWV A;  4GN1 A;  3FKY A;  1I4Q A;  4DK5 A;  2WXP A;  1V49 A;  4KGR A;  2WXL A;  1AN8 A;  1LFD A;  2UU7 A;  4GOC A;  2LFI A;  2PEA A;  3Q3O C;  2V3N A;  1JRP A;  3V6E B;  4HLE A;  1L4D B;  3VAW A;  1KLV A;  4FLH A;  4W9H A;  3Q3M C;  1P0R A;  3DBL I;  3QHT A;  4K3C A;  2FCM A;  3IT4 B;  1I4H A;  2K6D B;  5TSS A;  3WAL A;  1WJ6 A;  2QJL A;  5AUK A;  1CMX B;  1JWM D;  1OQR A;  3A9K A;  2PMV A;  1QOA A;  2MLB A;  1C4C A;  4MAC A;  3R7R A;  1DGJ A;  1WE6 A;  2MP2 B;  3BZD B;  4LJP B;  4E71 A;  4HK2 A;  2FID A;  4DHZ B;  1D6E C;  2LJ5 A;  4II3 B;  3C8Y A;  4LK0 M;  4K3B A;  1IBX A;  3HIZ A;  1TS5 A;  4YSY B;  1FNW A;  4NNJ B;  1TY2 A;  3J9C A;  3GS2 A;  3N20 C;  2KDE B;  2RD0 A;  2XEW A;  4KZ0 A;  2MBE A;  1ZGU B;  1JRO A;  3A4R A;  3TIX A;  3DBS A;  3EFC A;  1V1O A;  2N1W A;  1FPY A;  4RGN A;  4TV3 A;  3ZXV A;  3KUC B;  1FD6 A;  3A9J B;  4P1C C;  1KRH A;  2ONQ A;  4W9K A;  2OJR A;  4K1R B;  2MBO A;  2CJN A;  5BMI A;  1UGJ A;  1I4R A;  1M94 A;  4NAW A;  2JUO A;  1WRI A;  4MSQ B;  2O2V A;  2N9E B;  3MJ5 A;  3S2A A;  2IJ0 A;  5CTR C;  2VH2 A;  1JWU D;  2J42 A;  3Q6B A;  1GNU A;  4XWW A;  1XXG A;  4HPL B;  3Q3J A;  5IO9 A;  3L54 A;  1NYR A;  3LXF A;  4ZRQ A;  1GJZ A;  4OVZ A;  3QIJ A;  5C1Z A;  2DNF A;  1WYW B;  1J7B A;  1V1P A;  1TGZ B;  3PVL A;  1YOV B;  1WMH B;  4P16 A;  4FBJ B;  4IWO A;  4LNF A;  5D3I B;  3MC8 A;  4IUM B;  4FAD A;  4ANW A;  2EMT A;  3U7D A;  3DWG C;  1G6J A;  2WGS A;  4BBN F;  2C9W B;  2W55 A;  1UZX B;  3DVG X;  3TEX A;  1J7A A;  2ZCC A;  4RFB A;  2MJE A;  1KOT A;  2M1M A;  2WXG A;  2CHZ A;  2MHJ A;  2KMC A;  3V60 A;  1BT0 A;  1NYQ A;  4ACF A;  4DHZ E;  2KKC A;  3IAS 1;  4REZ A;  2JU6 X;  1L0X B;  3SU8 X;  1QF6 A;  3AE7 B;  2KO3 A;  2MX2 A;  2WWZ A;  1UWM A;  2DZI A;  3ZKJ C;  2J0M A;  2NBW B;  4OZC A;  3AB5 A;  2LHD A;  2OED A;  3UIO B;  4HDO A;  1EWY C;  1I42 A;  1HEZ E;  3H8H A;  3AED B;  2KWD A;  4NJ6 A;  2DX5 B;  4HKQ A;  3UI3 A;  1WY8 A;  1ROE A;  3SR6 A;  4BVU C;  4ZHP A;  1GG3 A;  3KH0 A;  3UIN B;  3B08 A;  3NVV A;  4C4V B;  5HFY A;  1WZ0 A;  4IM3 A;  2V4L A;  1Q1O A;  4CHK A;  2MP2 A;  3AE4 B;  1SB3 C;  3Q2A C;  2Z0D B;  4XWT A;  2DEN B;  2KOX A;  5D7G A;  4ARI A;  1WI0 A;  3GB1 A;  2KWC A;  5EE1 A;  4MGY E;  3JSV B;  4NJ7 A;  5D6J B;  1WGD A;  1P3Q U;  3GZN B;  3EFU A;  1CK1 A;  1L0V B;  2N7D A;  2G4D B;  3IAM 1;  3MHZ A;  1TT5 B;  2M17 A;  1R4M B;  4BFR A;  2LGX A;  1MFW A;  3A9J A;  3AM9 A;  2JVC A;  1Y8R C;  3W1S A;  4I6N B;  2JZZ A;  3DCG A;  1WXV A;  1T0Q C;  4KIK B;  1WXM A;  1TKG A;  3W5U B;  2JY6 A;  3BK1 A;  1V80 A;  4ZRP A;  5BYQ A;  2K8H A;  2JXT A;  1J8C A;  2WXN A;  3ZQ4 A;  2BTE A;  4FHJ A;  1VZ8 A;  3D32 A;  1PQS A;  4BOZ B;  2WXH A;  4FJV B;  5TR5 A;  5GMV A;  1RRB A;  3AXC A;  3W2D A;  1WMH A;  2NCN A;  1JWA D;  2V0G A;  1ZDX A;  2IPK D;  2B76 B;  3KYC D;  4HKZ E;  1EU4 A;  4WQO B;  1WJ4 A;  3ALB A;  3PLV A;  4XC2 A;  1R4N B;  2ASQ A;  4ASW C;  1CQV A;  1SE2 A;  2JX5 A;  4B95 A;  3DBH B;  4ZOH C;  1L5P A;  1RFK A;  3MC9 A;  1K52 A;  2JT4 B;  2KDI A;  2JZ3 B;  3V05 A;  1N5X A;  3P1M A;  4YTM B;  3KYD D;  3VVW B;  3WIM A;  1MVK A;  3N3K B;  3L17 A;  2N9X A;  3GOE A;  2MJ3 A;  3Q3N C;  2MBQ A;  1EM7 A;  3AEC B;  1Q5W B;  4S17 A;  3TBL D;  4WIP A;  3IFW B;  4B6W A;  4C56 C;  1KFY B;  1WJU A;  3AE3 B;  2C7N B;  1FNU A;  2UYZ B;  3NVZ A;  3LYY A;  2WXQ A;  1TS3 A;  4H2A A;  2KLG A;  1HA5 A;  3TEW A;  5HHD G;  3ZIM A;  4AS1 A;  2WXJ A;  1AYF A;  4N9F 4;  3DPD A;  4HRO A;  2AL6 A;  3BWU D;  1SEB D;  4GU2 A;  2I38 A;  4C4V A;  1C77 A;  2BWE S;  2K8B A;  2PE9 A;  4MT5 A;  1YX5 B;  1XLQ A;  2LUE A;  3VTU A;  4B0E A;  1JWS D;  2K5P A;  4AP4 C;  2O6V D;  1PGX A;  4FJZ A;  4K7U A;  4A3O A;  3I5J C;  4DXG A;  2LGS A;  2V4I B;  2BBC A;  2KFJ A;  3NG0 A;  2WDQ B;  2JSV X;  3JSV A;  3RCZ A;  3BYT B;  4WUR A;  3ZRC A;  1NDD A;  3HUI A;  2DAJ A;  1C4P A;  3QX1 A;  3QCA A;  2N0S B;  2D3B A;  2N4F A;  2XN9 C;  2YLM A;  3SD5 A;  5I4D A;  3N9Y C;  3EHV A;  3QC8 B;  3AE1 B;  3LJ3 A;  1M4V A;  2Z59 B;  5FKA C;  1UBQ A;  1NVI D;  2G1E A;  2HE7 A;  2QDF A;  1KM7 A;  2M0X A;  2FCN A;  3N1Y C;  3IBE A;  5JXV A;  1J0G A;  4KGT A;  1LXD A;  1TTN A;  4RNA A;  4KIK A;  3U30 A;  4RGT A;  3RNB C;  4NPN A;  4OHJ A;  2KJH B;  2KQ7 A;  2KD0 A;  3QJZ A;  1UUP A;  1E0Z A;  2KZR A;  3U4E G;  3NZ3 A;  2ZNV B;  4PYZ A;  3RN9 C;  2H89 B;  5EDS A;  5G55 A;  3RT3 B;  2KVR A;  1PUT A;  1WXQ A;  3H1U A;  4FXC A;  5C2T B;  3P4Q B;  2KN4 A;  1X1M A;  3GE3 C;  3TEY A;  4JIO U;  3Q8E A;  3PRM B;  2J53 A;  1XQQ A;  3HVD A;  4B0M A;  1ISN A;  1XLO A;  4NAW B;  4TSS A;  4WWN A;  3K9P B;  3PZ7 A;  4ARC A;  3GZN I;  3P4P B;  1T0S C;  4WAA A;  1SGH A;  4BKS A;  2KN5 A;  4GMV A;  1MJD A;  1WJN A;  3ZUN A;  1C4A A;  5CHV C;  4NY0 A;  4A9A A;  3ZJU A;  4NQK E;  4RGM A;  4WJN A;  2CS4 A;  2KTR B;  1V1P B;  1YJ1 A;  2GLS A;  1JCK B;  1L0Y B;  1P7F A;  4GIV A;  1EF5 A;  2IO3 B;  1GB1 A;  2KQS A;  2WDV B;  2MEK A;  2IZV B;  1AAR A;  3JYU A;  1GC7 A;  1K51 A;  2KMM A;  1C3T A;  1JML A;  3CST A;  2KTF A;  2XBB C;  3PT2 B;  5H8Y E;  1WX8 A;  2WXM A;  4JPS A;  2HTH A;  3TEZ A;  3AE5 B;  1VCB A;  2X8X X;  2H88 B;  4DBG A;  3AE6 B;  3HK0 A;  3CMM B;  3PGE A;  1D5X C;  2IGD A;  5LXH A;  1PGB A;  2OJW A;  4XDD A;  2N9P C;  2D3C A;  1SBB B;  4JLC A;  4C7Z A;  3DBR B;  1KLU D;  1CJE A;  1NEK B;  2X38 A;  5GXG B;  2J0K A;  4HVB A;  2UWQ A;  1F52 A;  3L08 A;  1UNS A;  1C9F A;  4L1B A;  3A4S C;  1R4N I;  3KWL A;  2W3S A;  2WXF A;  3E56 A;  1C78 A;  3AE2 B;  2LVO A;  5E6O A;  2WDR B;  1TZO A;  4ICU A;  4XX5 A;  2JQR B;  2MW5 A;  4RM8 A;  1N63 A;  3KUD B;  3JVZ X;  1N5W A;  1WF9 A;  4XDC A;  1PFD A;  3RFZ B;  2CKH B;  1Y56 A;  2WQY B;  1SJE D;  2GI9 A;  2FCS A;  3KLS X;  5IN7 A;  3ZDT A;  2W9N A;  1HZ6 A;  2K22 A;  5D3D A;  2LGY A;  4YL8 A;  3Q8F A;  2G4S A;  2WS3 B;  1R7S A;  4GGQ A;  4GDL B;  2RPQ A;  4KSK C;  1XO3 A;  1E90 A;  3R3M A;  1P7E A;  3W1S C;  2L83 A;  3Q8B A;  2IYD B;  1JAL A;  4G50 A;  1XCQ L;  3ZNG C;  4LDT B;  1ET6 A;  1HZ5 A;  1ZW7 A;  4EZK A;  2BF8 B;  4HCP B;  1XLN A;  1QOF A;  1E8W A;  3LB8 C;  2KWV B;  3V3X A;  2J7Q B;  4D2K A;  4W9I A;  1VDV A;  1V5T A;  4JL9 A;  4ICV A;  1IUE A;  1I4G A;  3CF6 E;  1V81 A;  3H9D A;  2Y5B B;  2M0A A;  4HDQ A;  2QCZ A;  4W9F A;  2LGI A;  2RDB C;  3QQ8 B;  3QWZ B;  5C23 A;  2BYT A;  1E5W A;  2GMI C;  3WAP A;  4JQW C;  3VTV A;  2KTR A;  3SFE B;  1JWB D;  3DOW A;  4IW0 A;  4WAF A;  5E6P A;  3VUW A;  3PLU A;  2NTS A;  4AUQ C;  4P1B C;  2BS2 B;  1YN3 A;  3RNC C;  2E6X A;  1YQ3 B;  4HPM B;  1ZUD 2;  4TMA B;  4AOF A;  4XYC A;  3HM3 A;  1N61 A;  4HCN B;  3MC0 B;  2LRW A;  4NAM A;  3A33 B;  1YQ4 B;  2MJD A;  4PS3 A;  3RZF A;  4US8 A;  1GB4 A;  1IPG A;  1WX9 A;  4LNI A;  2IY0 B;  4WWO A;  1ZXI A;  3AE8 B;  1WR1 A;  3DQV A;  4XGA B;  5JH5 C;  4RH6 A;  2BYV E;  3ENE A;  1WXS A;  1MI0 A;  3CSF A;  2ZCB A;  3C0R B;  4RF1 A;  3B2G A;  5LNK 1;  2JYT A;  1FIQ A;  1WGR A;  1WGK A;  3TSS A;  1MHH E;  1YN4 A;  4RF0 A;  2KK8 A;  2PE6 B;  1SE4 A;  2K39 A;  3E9S A;  3RNF C;  3PHW B;  1EUV B;  3HM6 X;  2N9L A;  1T0Y A;  3M62 B;  3HVZ A;  2HJ1 A;  1YJI A;  4KKJ A;  2K25 A;  4EOY A;  2EKE C;  2GRI A;  3ZGZ A;  4O1N A;  1SF0 A;  1L7Y A;  2M19 A;  2M4N A;  4KVG B;  4E74 A;  3WA0 A;  3NJT A;  2JXX A;  2MQJ A;  3MHS D;  4GDL A;  2KAN A;  2HDE A;  2HTM E;  3U8Z A;  1ZP0 B;  1FRD A;  1V6E A;  4LLG M;  4NJC A;  3H7S A;  1I7H A;  4IWQ A;  1K8R B;  4FUL A;  4M02 A;  1ZOY B;  1DOI A;  4KGS A;  1TBE A;  1PDX A;  2QIL A;  2KXJ A;  3DBR I;  1QQR A;  3ZNH B;  2K3U A;  4AWJ A;  3X0W A;  5AZF A;  4PS8 A;  1ZE3 D;  1BML C;  1XCT L;  3ZO5 B;  1RFA A;  1WYG A;  1E8Y A;  2CHW A;  1ZKH A;  1D5Z C;  1NI3 A;  2KMA A;  1T3Q A;  3UQA A;  3VRA B;  4FN2 A;  2L52 A;  3P2B A;  2K1F A;  4ITK A;  4UDU C;  5DPW A;  4ANV A;  2WP9 B;  1QKZ A;  2IO1 B;  4J3O D;  3GE8 C;  4KSL C;  1WE7 A;  2LD9 A;  2D3A A;  2L32 A;  3MP9 A;  3OJ4 B;  1QLB B;  1WGH A;  2MA9 B;  2JRH A;  1LQB A;  2NR2 A;  5KHQ A;  1N62 A;  1UEL A;  5AZH A;  3SDL C;  4JE3 B;  1QOG A;  3RZW C;  1KLG D;  1WM3 A;  3GP7 A;  1IGD A;  4OZB A;  2D5G A;  3EGR A;  3BVG A;  1P9D U;  1WH3 A;  1WIA A;  2L00 B;  1FXA A;  2GB1 A;  4ZDV A;  2DWQ A;  4BKG A;  2BB6 A;  1WSP A;  4W9G A;  4DXF A;  4F8C B;  3ZJV A;  1XEE A;  2RGF A;  2K0P A;  4YSZ B;  4MM3 B;  2WX1 A;  2PKO A;  2RSU A;  4M00 A;  2DYM A;  1XT9 B;  3A1Q B;  4OVV A;  4DXA B;  1E6E B;  5DPS A;  2M8S A;  1PYW D;  2KAJ A;  2L0F A;  4IM0 A;  3RUL A;  1RLF A;  2NPT B;  1WFY A;  3W9C B;  4PK1 A;  3AU5 A;  3RI7 C;  1L6V A;  2REX A;  1TS2 A;  3DBL B;  2KLC A;  1YIW A;  2BB5 A;  4S0R A;  2OHF A;  4MH8 A;  1VRA B;  4E3C A;  4WJQ A;  2E3T A;  1WGG A;  3IHP C;  3NHE B;  2NVU I;  1OEY J;  1F2R I;  4HEA 1;  1YN5 A;  4MH0 E;  2KC2 A;  2PJH A;  5AUI A;  2BYE A;  2INC C;  2AQ1 B;  1C1Y B;  2RMM A;  4DHJ B;  2VH1 A;  4WQM A;  4N59 A;  1FXT B;  4N58 A;  2KDF B;  2L76 A;  1D4B A;  2FAZ A;  3JW0 X;  2JPH A;  4MGZ E;  2KVZ A;  4IWP A;  1KTK A;  2BYF A;  1FFV A;  4RGO S;  2QMT A;  2G3Q B;  4DQO C;  2B3A A;  5EE3 A;  3QK0 A;  3ZVV A;  2BW2 A;  1IGC A;  1TZ1 A;  2L1A A;  4KV2 A;  4IDI A;  1WWT A;  2KX3 A;  3APC A;  1FXI A;  5HI1 A;  3ZNI D;  3TMP B;  2G9H D;  2HD5 B;  2EEL A;  2V1Y A;  4GB9 A;  4YXD B;  3BVZ A;  4US9 A;  4II2 B;  3IG3 A;  2KFK A;  4TKN A;  2G45 B;  3UGB B;  2TSS A;  3DHI C;  1E8Z A;  4A6Q A;  3PS6 A;  3KUZ A;  2Q5W D;  4N6E B;  1RM6 C;  3ZXR A;  3RMK C;  5BMG A;  1WXA A;  1F1H A;  3ZTC A;  5T8I A;  4HRS A;  4B9K A;  1ENF A;  3NVW A;  3EA6 A;  2AEH A;  3Q3F A;  3L16 A;  2RPV A;  2L7R A;  5DPR A;  2DZK A;  5J17 A;  4EE2 A;  3X23 A;  5BMH A;  2CR5 A;  5HKH A;  2EMS A;  4I6P A;  2LZ6 A;  2KDB A;  2GBR A;  2PTL A;  3AEB B;  2WNM A;  1YMH E;  1UF0 A;  2AQ3 B;  3AN1 A;  3M95 A;  3AEG B;  2ZVO A;  3ZRF A;  3K9O B;  3DWM A;  4YTP B;  1L4Z B;  5G2N A;  1T5X D;  1ZDV A;  1FCL A;  1ZXH A;  4PYU A;  3SEB A;  2MSE D;  2V3P A;  4HWI B;  1VZ6 A;  1B9R A;  4MDK E;  2QC8 A;  1HQR D;  2IGG A;  1V5O A;  2QIE B;  2AL3 A;  3PZ8 A;  3Q8A A;  4WWP A;  4HJK A;  5FR6 A;  2HJ8 A;  3ZDM C;  2EKI A;  1V2Y A;  4URK A;  1R4M I;  2KYW A;  3H6N A;  2CHX A;  2IO0 B;  1NBF C;  4MM3 A;  5EE9 A;  1YX6 B;  3A1Q A;  3AH7 A;  3VQI A;  1GUA B;  1K53 A;  1OFF A;  1OQQ A;  1I35 A;  2Z8L A;  4MSM B;  4FA6 A;  4IOI E;  3VR9 B;  3Q8C A;  1UD7 A;  2NPT A;  2D07 B;  4QAY A;  1PGA A;  2WU5 B;  5C3J B;  3N32 A;  3VR8 B;  4P7I A;  2YVC A;  5D94 A;  2D11 A;  2Y3A A;  3KVF B;  5EE0 A;  1RYJ A;  3R2I A;  1IYF A;  3AEA B;  4MEL A;  5MPO A;  3EUB 2;  3AMZ A;  4WWM A;  1EWC A;  1D5M C;  1DYQ A;  5BYS A;  3V62 A;  1YJJ A;  1K50 A;  2MH7 A;  4OVU A;  2AYO B;  2ZPY A;  2JZP A;  3VXW A;  3NY5 A;  2ZW1 A;  4NZL B;  1WR6 E;  5CHW A;  3VRB B;  2BQQ A;  3RD2 A;  3UIP B;  4BBN C;  4XZ4 A;  2ZZP B;  5DCN A;  2ZJD A;  4EKU A;  3KW5 B;  2V3S A;  1FRR A;  1T6B X;  4G0N B;  4W9D A;  3DBH I;  2WLB A;  3DVG Y;  3BVM A;  4K81 A;  1AW7 A;  1MHX A;  2M56 B;  3NZS A;  4BOS C;  4LJO B;  4HXD A;  1HTQ A;  4ZRJ A;  1VJK A;  2AX5 A;  4K7S A;  2KJ6 A;  1KJT A;  4P6V F;  3VTW A;  2FUG 1;  3PTF C;  2N1V A;  3DVN V;  4ZHO A;  4WJP A;  1RWS A;  5JZE B;  1OTR B;  4AQ7 A;  1FO4 A;  1J7C A;  5IAA C;  3APF A;  3PZD A;  5L83 A;  4F7Z A;  4M0W B;  4FJY A;  2PPH A;  4GSW A;  4A8X C;  1Q0W B;  3R2T A;  2IBI B;  4IC7 B;  2IGH A;  2NBU A;  1F9J A;  4OZA A;  2GBM A;  1L6U A;  4W9J A;  4EZJ A;  5HG2 A;  3ZW3 A;  1A70 A;  2N7E A;  4HJG E;  1FMA D;  2J4X A;  2MCN B;  4W9E A;  4BKT A;  2K6Q A;  2KDM A;  4L2Y A;  4BKS D;  1E7V A;  4ZRK A;  1FCC C;  3W5V B;  2ICI A;  1C79 A;  1XLP A;  2C7M B;  3LDZ E;  3P63 A;  1VZ7 A;  1V9J A;  4YT0 B;  1EO6 A;  3IXS A;  2KNB A;  5G5H A;  2O6V B;  2VZK B;  4EEW A;  4F1S A;  1F2R C;  2NMQ A;  1TY0 A;  2FNJ B;  3Q14 C;  4DWF A;  2FUH B;  4RMA A;  3NVY A;  3EEC A;  2JWU A; 
#chains in the Genus database with same CATH homology
 1UBI A;  3QA8 A;  2MWS B;  1TBE A;  2BWE S;  2K8B A;  2PE9 A;  1YX5 B;  2IY1 B;  4JGH B;  2KXJ A;  3DBR I;  3ZNH B;  2XK5 A;  4AWJ A;  1YD8 U;  4FHK A;  2KJR A;  1VD2 A;  3W1Y A;  2RR9 A;  2LUE A;  3WAO A;  3AI5 A;  3VTU A;  3X0W A;  5AZF A;  2BGF A;  4PS8 A;  4AP4 C;  2O6V D;  1J19 A;  1IP9 A;  3ZO5 B;  3B1L X;  1RFA A;  4FJZ A;  2C60 A;  3H7P B;  1LM8 B;  1E8Y A;  2CHW A;  4K7U A;  5E6N A;  1ZKH A;  4GDK A;  4NQL B;  4A3O A;  5J2R A;  1V86 A;  2L05 A;  2KMA A;  2K8C A;  5D2M B;  2KFJ A;  1QZE A;  1JRU A;  2QHO A;  3UQA A;  1L2N A;  3JSV A;  2FCQ A;  3RCZ A;  3M3J A;  4ZYN A;  4FN2 A;  3ZRC A;  1NDD A;  3PHX B;  4IG7 B;  2DAJ A;  3P2B A;  3QCA A;  2N4F A;  2K1F A;  3QX1 A;  4ZRI A;  2D2Q A;  3PRE A;  1Z2M A;  2YLM A;  3MJW A;  3SD5 A;  3AUL A;  3OAW A;  5DPW A;  3L0W B;  4ANV A;  1YQB A;  3MTN B;  4DHJ D;  3BY4 B;  3IVF A;  1U4A A;  4X57 B;  2IO1 B;  4G3X B;  3EHV A;  4GN1 A;  3QC8 B;  1E7U A;  3V61 A;  3LJ3 A;  2Z59 B;  3DDC B;  4DK5 A;  1SIF A;  1UBQ A;  1V49 A;  4KSL C;  2HE7 A;  1LFD A;  4GOC A;  1KM7 A;  2M0X A;  2PEA A;  3I3T B;  1WE7 A;  5LLI A;  4J6I A;  2FCN A;  2LD9 A;  3OJ4 B;  4ANX A;  3IBE A;  1XD3 B;  3V6E B;  4HLE A;  1WGH A;  2MA9 B;  1J0G A;  2JRH A;  1LQB A;  2NR2 A;  5KHQ A;  1LXD A;  1TTN A;  1UEL A;  4KIK A;  5AZH A;  3SDL C;  3U30 A;  3VAW A;  4NPN A;  3RZW C;  1KLV A;  4FLH A;  2KJH B;  2KQ7 A;  4W9H A;  2KD0 A;  3QJZ A;  1WM3 A;  1P0R A;  2KZR A;  3N30 A;  2BKR B;  3DBL I;  1P9D U;  2ZNV B;  4PYZ A;  1WH3 A;  1WIA A;  2L00 B;  3ZLZ A;  3QHT A;  5EDS A;  4ZDV A;  2JRI B;  2FCM A;  2CU1 A;  2K6D B;  3WAL A;  4BKG A;  4MGI E;  1S3S G;  1WJ6 A;  5G55 A;  3RT3 B;  3TJP A;  2KVR A;  2DYO A;  3H1U A;  4W9G A;  1CMX B;  4F8C B;  3A9K A;  2RGF A;  1H8C A;  2MLB A;  4AJW A;  1X1M A;  2D10 A;  2WX1 A;  3R7R A;  2RSU A;  1WE6 A;  4LCD E;  3RUI B;  2DYM A;  1XT9 B;  2L8J A;  3A1Q B;  4OVV A;  2MP2 B;  4DXA B;  4LJP B;  2D3G A;  5DPS A;  4JIO U;  2M8S A;  2L0F A;  4IM0 A;  4E71 A;  4HK2 A;  2LXC A;  3PRM B;  1XQQ A;  1RLF A;  2FID A;  1WFY A;  2LJ5 A;  2NPT B;  4II3 B;  3RUL A;  3SHQ A;  4DHZ B;  2LVP A;  4G11 A;  1ISN A;  3AU5 A;  3HIZ A;  4NNJ B;  1OGW A;  2REX A;  4NAW B;  4WWN A;  3K9P B;  2KDE B;  2KLC A;  1YIW A;  2DAF A;  2RD0 A;  2XEW A;  3GZN I;  2ZEQ A;  4KZ0 A;  2MBE A;  1ZGU B;  3A4R A;  4KZC A;  3TIX A;  4WAA A;  3DBS A;  2KC1 A;  1SGH A;  2N1W A;  2KN5 A;  4GMV A;  4BKS A;  1WJN A;  4E3C A;  3B0A A;  4WJQ A;  3IHP C;  1WGG A;  4KDI C;  3ZUN A;  4TV3 A;  3NHE B;  2NVU I;  1OEY J;  2BPS A;  3KUC B;  5CHV C;  3A9J B;  4NY0 A;  5AEK B;  4MH0 E;  4NQK E;  4W9K A;  4I6L B;  4WJN A;  2CS4 A;  2KC2 A;  2KTR B;  1YJ1 A;  2PJH A;  2OJR A;  4K1R B;  4GIV A;  3VFK A;  1EF5 A;  2BYE A;  2MBO A;  1A5R A;  2IO3 B;  1C1Y B;  4EUT A;  1OQY A;  2DZM A;  5BO4 B;  4DHJ B;  2KFK B;  2KQS A;  1M94 A;  4NAW A;  4W9C A;  1FXT B;  2JUO A;  4MSQ B;  2IZV B;  2O2V A;  2KDF B;  1AAR A;  2L76 A;  2N9E B;  2FAZ A;  3JW0 X;  2JPH A;  3JYU A;  3S2A A;  5CTR C;  4IWP A;  1GC7 A;  2BYF A;  2O6V A;  3R7Q A;  3WAN A;  1GNU A;  2G3Q B;  1C3T A;  2B3A A;  4HPL B;  3QK0 A;  3Q3J A;  3ZVV A;  3CST A;  1WM2 A;  2KTF A;  1TZ1 A;  2XBB C;  3PT2 B;  1WX8 A;  4TQ0 A;  3L54 A;  4KV2 A;  2HTH A;  1P98 A;  2KX3 A;  1VCB A;  1GJZ A;  3APC A;  3QIJ A;  4DBG A;  5C1Z A;  3O65 B;  2BWF A;  3HK0 A;  3TMP B;  3WAM A;  3CMM B;  3PGE A;  3ZNI D;  2HD5 B;  5LXH A;  1WYW B;  2N9P C;  2V1Y A;  4GB9 A;  3QAQ A;  2LAS A;  1TGZ B;  4JLC A;  3PVL A;  1WMH B;  4II2 B;  3IG3 A;  4DDG D;  4MEM A;  4FBJ B;  2KFK A;  2LGD A;  4KDL B;  4IWO A;  2J0K A;  4HVB A;  2UWQ A;  3L08 A;  1HE8 A;  2KHW B;  4IUM B;  4TKN A;  2G45 B;  4TUU A;  4A3P A;  4ANW A;  3UGB B;  4FAD A;  2EMT A;  3PV1 A;  3A4S C;  3H7P A;  1R4N I;  3T8M A;  3U7D A;  1G6J A;  1E8Z A;  4BBN F;  2C9W B;  3VDZ A;  1UZX B;  3DVG X;  1RAX A;  3PS6 A;  4WJO A;  3KUZ A;  1NI2 A;  2ZCC A;  2LRU A;  1WXA A;  3ZTC A;  2LVO A;  5E6O A;  1KOT A;  1D3Z A;  2VRR B;  4A20 A;  4ICU A;  4B9K A;  2M1M A;  2CHZ A;  4XX5 A;  3VHT C;  4GXB A;  2AEH A;  2MW5 A;  3Q3F A;  4RM8 A;  3L16 A;  3KUD B;  2L7R A;  2KMC A;  2DZK A;  5DPR A;  5J17 A;  3JVZ X;  1WF9 A;  2GBJ A;  3V60 A;  3X23 A;  1BT0 A;  2KWU B;  2CKH B;  2CR5 A;  4DHZ E;  2KKC A;  5HKH A;  2FCS A;  2EMS A;  4I6P A;  2LZ6 A;  2KDB A;  3SU8 X;  2GBR A;  3ZDT A;  2KO3 A;  2W9N A;  3TL5 A;  2LGY A;  2MX2 A;  4YL8 A;  2WWZ A;  3ZNZ B;  5L95 C;  1WRD B;  2G4S A;  3ML8 A;  2DZI A;  3ONS A;  3ZKJ C;  2DYB A;  4GGQ A;  2FIF A;  4GDL B;  3M95 A;  3V6C B;  2J0M A;  1GC6 A;  2NBW B;  2RPQ A;  3L13 A;  3NOB A;  2ZVO A;  3UIO B;  4HDO A;  3PRZ A;  3ZRF A;  3K9O B;  5CX3 A;  2L0T A;  4KSK C;  4IM2 A;  2LI5 A;  5G2N A;  1I42 A;  4DDI D;  4ANU A;  2C5L C;  4CO7 A;  1E90 A;  3R3M A;  2GBN A;  3L10 B;  1WZ3 A;  5CHF A;  1Z5S B;  4PYU A;  4NJ6 A;  2MSE D;  2DX5 B;  2NBV B;  4HWI B;  1WY8 A;  2DHZ A;  4MDK E;  3W1S C;  4MJS B;  1V5O A;  4BVU C;  1GG3 A;  3KH0 A;  3UIN B;  2AL3 A;  2IYD B;  3B08 A;  4WWP A;  4HJK A;  5FR6 A;  2HJ8 A;  3ZDM C;  4G50 A;  3ZNG C;  1V2Y A;  1WZ0 A;  4URK A;  1R4M I;  4LDT B;  2XK5 B;  3H6N A;  2CHX A;  4CYE A;  2IO0 B;  2WDT B;  1NBF C;  1ZW7 A;  4IM3 A;  4MM3 A;  4EZK A;  2V4L A;  1YX6 B;  2BF8 B;  2IO2 B;  3OLM D;  1Q1O A;  3A1Q A;  4HCP B;  2MP2 A;  4CHK A;  3EC8 A;  3VQI A;  1GUA B;  1I35 A;  2Z0D B;  2DEN B;  2KOX A;  4MSM B;  5D7G A;  4FA6 A;  5JHA A;  1UD7 A;  2NPT A;  2KX0 A;  1WI0 A;  1E8W A;  2KWC A;  2KWV B;  4MGY E;  2D07 B;  1UGM A;  4AJY B;  2J7Q B;  3JSV B;  5IA7 A;  2DZJ A;  4W9I A;  4K7W A;  4NJ7 A;  5D6J B;  1WGD A;  1P3Q U;  3N32 A;  1V5T A;  3UF8 A;  3VUY A;  3EFU A;  4ICV A;  3CF6 E;  3H9D A;  1V81 A;  4JL9 A;  4PS7 A;  2Y5B B;  3VH4 B;  4P7I A;  2YVC A;  5D94 A;  4LDT D;  2D11 A;  3PSE B;  4HDQ A;  4EFO A;  2N7D A;  2G4D B;  4W9F A;  3KVF B;  5AZG A;  3QQ8 B;  2M17 A;  4BFR A;  1IYF A;  3QWZ B;  3QAR A;  4MEL A;  2LGX A;  4M8M A;  3A9J A;  2JVC A;  4W9L A;  5C23 A;  1E5W A;  2GMI C;  3WAP A;  1Y8R C;  1P1A A;  4JQW C;  3W1S A;  2L3Z A;  3VTV A;  3V62 A;  2KTR A;  2ZVN A;  2A4Z A;  3DOW A;  4OVU A;  2I1J A;  4IW0 A;  5E6P A;  4I6N B;  3VUW A;  2AYO B;  2ZPY A;  2JZZ A;  3DCG A;  2Z0E B;  5DPT A;  3ECI A;  3VXW A;  3NY5 A;  1S1Q B;  3PLU A;  1WXV A;  4AUQ C;  1WR6 E;  2NS5 A;  3OJ3 A;  5CHW A;  4KIK B;  1WXM A;  3RD2 A;  3UIP B;  4HPM B;  2JY6 A;  3APD A;  3VH3 B;  4XZ4 A;  4AOF A;  4BBN C;  2ZZP B;  3M63 B;  1V80 A;  2ZJD A;  5DCN A;  3HM3 A;  4EKU A;  4HCN B;  2LRW A;  3KW5 B;  3A33 B;  2ZNV C;  2K8H A;  2V3S A;  1E8X A;  4W9D A;  4G0N B;  4PS3 A;  1J8C A;  3DBH I;  3RZF A;  3TCA A;  3DVG Y;  1IPG A;  1MG8 A;  4FHJ A;  3ML9 A;  4K81 A;  4MGK E;  1WX9 A;  3D32 A;  3NZS A;  4BOS C;  4LJO B;  4HXD A;  3NZU A;  1PQS A;  4BOZ B;  2IY0 B;  2AWT A;  4ZRJ A;  4FJV B;  4WWO A;  2GBK A;  2LVQ A;  2GOW A;  5TR5 A;  1OEY A;  5J18 A;  4K7S A;  5GMV A;  1EF1 A;  1RRB A;  2KJ6 A;  1WR1 A;  3DQV A;  5JH5 C;  3AXC A;  3A9K B;  1KJT A;  2BYV E;  5LXI B;  1WMH A;  2NCN A;  3ENE A;  1WXS A;  3VTW A;  3CSF A;  1WX7 A;  2ZCB A;  3PTF C;  4TQ1 A;  2N1V A;  3BIN A;  3DVN V;  3KYC D;  3C0R B;  4WJP A;  5JZE B;  4WQO B;  1WJ4 A;  1OTR B;  4M8N A;  3VUX A;  2C7H A;  3ALB A;  3PLV A;  4XC2 A;  5IAA C;  2BKF A;  1SE9 A;  2ASQ A;  2JWZ A;  2J0J A;  2MRP A;  2OOB B;  3APF A;  3PZD A;  3T9L A;  4ASW C;  5L83 A;  2WYQ A;  1WGR A;  4F7Z A;  4M0W B;  3AU4 A;  3DVN U;  4B95 A;  4FJY A;  2PPH A;  4EZL A;  4GSW A;  2I1K A;  2KK8 A;  2R2Q A;  2WX0 A;  2PE6 B;  2K39 A;  2JT4 B;  1Q0W B;  2KDI A;  1H4R A;  2JZ3 B;  1EUV B;  3HM6 X;  3PHW B;  3ZTD A;  3HHM A;  2IBI B;  5KHO A;  4IC7 B;  3NS8 A;  3KYD D;  2NBU A;  3VVW B;  3UQB A;  2LWP A;  3WIM A;  1F9J A;  1T0Y A;  3M62 B;  3R66 C;  1UH6 A;  3N3K B;  3L17 A;  2GBM A;  2N9X A;  3GOE A;  4W9J A;  2MBB B;  2ZPN A;  4RM9 A;  4EZJ A;  2MBQ A;  2K25 A;  4EOY A;  3PRP B;  1Q5W B;  3ZW3 A;  2EKE C;  2N7E A;  3TBL D;  2MBH A;  2LXA A;  1L7Y A;  2MCN B;  2JF5 A;  4W9E A;  2M4N A;  3IFW B;  4KVG B;  4BKT A;  4E74 A;  2K6Q A;  4B6W A;  3PPA A;  1WJU A;  3WA0 A;  4BKS D;  2JXX A;  1E7V A;  2MQJ A;  3MHS D;  2O2V B;  4GDL A;  4ZRK A;  2R2O A;  2KAN A;  2C7N B;  5JHB A;  2C7M B;  2UYZ B;  3LDZ E;  3RYT A;  3U8Z A;  1V9J A;  4GDK B;  1EO6 A;  2KNB A;  4EEW A;  2O6V B;  4F1S A;  1V6E A;  2KLG A;  3H7S A;  3ZIM A;  4IWQ A;  2FNJ B;  1K8R B;  4DWF A;  4N9F 4;  2FUH B;  4FUL A;  3DPD A;  1WGY A;  2AL6 A;  4RMA A;  4MJS A;  4GU2 A;  3EEC A;  4MGZ E;  2A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...