2L76A

Solution nmr structure of human nfatc2ip ubiquitin-like domain, nfatc2ip_244_338, nesg target ht65a/ocsp target hs00387_244_338/sgc-toronto
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
b'QGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NFATC2-interacting protein
publication title Human NFATC2IP ubiquitin-like domains
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l76A00
3WALA 4AUQC 3Q3FA 4K81A 2AEHA 4DK5A 2CHZA 2N4FA 2MBEA 3NZSA 4KZCA 2IBIB 3PTFC 3ZW3A 1OEYA 2GBRA 5KHOA 4K7UA 4A3PA 2KANA 2LD9A 3A33B 2ZNVB 2KDIA 3NHEB 3U30A 4DHZB 1WMHB 3S2AA 1I35A 3ZRCA 1GNUA 2REXA 1E7VA 2PEAA 4W9JA 4FHJA 2B3AA 1XT9B 3W1SA 1YQBA 1MG8A 1TZ1A 2IO2B 4GIVA 3SD5A 4AJYB 2A4ZA 4ANVA 2BPSA 1V86A 4LJPB 3VFKA 1IP9A 1GG3A 4WWOA 4PYZA 5D2MB 4BKSD 1V80A 4DHJD 4GU2A 4WJPA 1V5TA 3APDA 4F1SA 1AARA 1WGDA 2BF8B 3EECA 3H6NA 1JRUA 3KUDB 2OOBB 1L7YA 4NQKE 4ZRJA 5DCNA 3X0WA 5D7GA 3VH3B 2ZEQA 2MBHA 2DAJA 3R66C 3W1SC 3A9JB 1V6EA 3NZUA 2NR2A 3DOWA 3MTNB 4JQWC 2IO3B 3M3JA 2HD5B 2MA9B 4HXDA 3KYCD 2JWZA 5CX3A 2CR5A 4E74A 2RR9A 4ZDVA 3WAPA 3ZTCA 4DBGA 2LVQA 2I1KA 4CO7A 3QAQA 3EHVA 3UIPB 4HLEA 4A3OA 1V9JA 4NJ7A 2LWPA 2O6VA 4MGZE 3K9PB 2K8HA 2K1FA 1KOTA 3DBRI 2WX1A 2MBBB 4ZYNA 2DZIA 1YJ1A 2NPTB 2AYOB 2V1YA 2FUHB 2LZ6A 4IWOA 2FCNA 1UH6A 2LXCA 3JSVB 2LI5A 3JW0X 3SU8X 2ASQA 3H7PB 3VTUA 5C1ZA 3HM3A 4LJOB 1P98A 1UD7A 1S1QB 1ZGUB 2KDEB 1C3TA 5D6JB 2GBKA 4BBNC 5LLIA 1LQBA 1SIFA 5C23A 2BWES 3QWZB 3PGEA 3EC8A 4GDLA 2LVOA 3UF8A 3TIXA 1RLFA 1WZ3A 2CS4A 3PT2B 5G55A 2FIDA 3QX1A 3PZDA 4B95A 1UGMA 1E7UA 3QARA 5DPSA 4W9IA 4DHJB 1Z2MA 3UQBA 3A1QB 2NS5A 2ZVNA 3A9KA 2N9XA 4JGHB 2GBJA 3A4SC 4GMVA 4WJOA 1YIWA 3IG3A 3ZRFA 4MGYE 2ZCBA 2MCNB 3N3KB 5E6NA 2XEWA 3NS8A 2K25A 3QK0A 1R4NI 3P2BA 2D11A 3PHWB 3ZIMA 3T9LA 2ZPNA 1WI0A 3KUCB 2JUOA 2ZJDA 3TL5A 5LXIB 1Q0WB 4XC2A 1WGYA 2N9PC 4HWIB 3V6CB 3PVLA 2C60A 1WGGA 5AZGA 5AZFA 2NBVB 4WJNA 1WJ6A 2V3SA 2PE9A 2DHZA 3DBSA 3N32A 2DYOA 5CHWA 1ZKHA 2KC2A 1WXMA 2JVCA 2RPQA 3O65B 1WFYA 5CHVC 3VUYA 4TV3A 4X57B 4GDKB 1E8YA 3VDZA 5AZHA 4NPNA 4PS3A 1WMHA 4IM2A 2LUEA 2KZRA 2J0MA 4MJSA 3OLMD 5L95C 1E90A 1J19A 5HKHA 3GZNI 5G2NA 4BBNF 4IC7B 3RUIB 2M1MA 3RYTA 1T0YA 4ANUA 4FJZA 3QA8A 2BYVE 2DX5B 4IG7B 5J17A 2MBOA 2EKEC 2KN5A 2KLGA 2C7HA 3PSEB 1WGRA 1WGHA 3RZFA 1WM3A 3ZO5B 3CSFA 3QJZA 4KV2A 3PPAA 4PYUA 4FLHA 1WR6E 4F7ZA 2KX3A 3JYUA 4TQ0A 2NBWB 2ZNVC 2GBMA 5E6OA 1F9JA 1WXSA 2IZVB 2QHOA 1XD3B 4BOSC 4ASWC 1LFDA 1OGWA 1WJ4A 4AWJA 2JRHA 3PRZA 3AU5A 3VTWA 4IWQA 4MGKE 3C0RB 3HIZA 1WF9A 3VUXA 1R4MI 4M0WB 1OQYA 3DQVA 3OAWA 4HCPB 4DHZE 1IYFA 2N7EA 3DDCB 3IVFA 3VXWA 4BKTA 4EZLA 1H8CA 2BGFA 2O2VB 4OVVA 2O6VD 3WA0A 3ZTDA 2MBQA 3ZDTA 2KK8A 3OJ3A 1L2NA 3AI5A 2XK5B 2EMTA 2NPTA 4I6PA 3DVNV 1QZEA 2KWCA 1WYWB 3SDLC 1KJTA 3JSVA 2NCNA 3IFWB 4KIKB 3WANA 3H7PA 4YL8A 4ANWA 3ZNZB 1YD8U 1NBFC 2MQJA 4RM8A 2JZ3B 1RRBA 4W9DA 3R7QA 4B6WA 1WH3A 3M63B 2A5UA 3VAWA 3OJ4B 2C9WB 3QIJA 4II3B 5LXHA 2KMCA 2BKFA 3ALBA 2G4SA 3B0AA 1UBQA 5AEKB 2BYFA 2N1WA 1P3QU 4NAWA 2KJHB 3KYDD 1PQSA 3KVFB 3L54A 5CHFA 1EUVB 2L05A 2RD0A 3V61A 2ZVOA 3TCAA 3X23A 1GC6A 2RSUA 1WX9A 5J18A 2YVCA 4BKSA 4W9CA 4TUUA 3N30A 1LM8B 2KJ6A 3L10B 1XQQA 2J0JA 3A1QA 3H9DA 2LRWA 4XX5A 1KM7A 1IPGA 4AJWA 4LDTD 4G3XB 1A5RA 3K9OB 2HTHA 1WX8A 2LRUA 1Y8RC 2V4LA 4W9GA 2DYMA 1WJUA 4NY0A 4P7IA 2M17A 1Q1OA 4EZKA 3KW5B 4IW0A 1TTNA 2M4NA 2MP2B 2KNBA 2KO3A 3T8MA 1WM2A 2I1JA 3UIOB 2D3GA 2KTRA 3PS6A 1NDDA 2AL3A 1D3ZA 2L3ZA 1VD2A 2MSED 4FHKA 4NJ6A 3U7DA 4HVBA 3M62B 3AU4A 3NY5A 4EOYA 2KWVB 2LASA 3CF6E 4II2B 5BO4B 4B9KA 3UINB 4GDKA 4GSWA 4HK2A 4HPMB 4ANXA 1J8CA 3I3TB 4GOCA 2DZKA 2LXAA 2AWTA 2L00B 3QCAA 3V62A 4A20A 3W1YA 5IA7A 1WJNA 2IY1B 4XZ4A 2JXXA 2KFKB 2KWUB 1UBIA 5JZEB 3ECIA 4G0NB 3PHXB 3L0WB 3TJPA 2MWSB 3ZDMC 1WXVA 5L83A 2KOXA 3APFA 3VH4B 4FJVB 2BWFA 2IYDB 4HDQA 2K6QA 4LCDE 4NNJB 2C5LC 5EDSA 2D2QA 1CMXB 3ZVVA 3DPDA 3RT3B 2CKHB 2KKCA 4GGQA 1SE9A 4IM3A 2PE6B 3DBHI 4W9KA 2GOWA 1E5WA 2HJ8A 4FJYA 4ZRIA 2AL6A 2D10A 2L0TA 3WIMA 2ZPYA 4JIOU 4TKNA 4I6NB 4I6LB 4MSQB 2N1VA 3UQAA 2HE7A 2GMIC 1WE6A 2Z0EB 3Q3JA 2JZZA 2EMSA 4MEMA 2VRRB 2C7NB 1TGZB 4MSMB 2CU1A 3KH0A 1YX6B 3VUWA 2KLCA 3WAOA 4IM0A 1KLVA 3PRPB 2MRPA 2KJRA 4BKGA 2GBNA 2CHXA 2FAZA 4M8MA 1G6JA 2KQ7A 1HE8A 1EF5A 2DENB 4GB9A 2LGYA 3HM6X 4F8CB 4HCNB 2JF5A 1E8XA 3A9JA 5D94A 1P1AA 1M94A 4KIKA 1OTRB 2L0FA 4E71A 2KMAA 2L8JA 4EZJA 2G3QB 3D32A 4KSLC 3V6EB 2KVRA 5JHBA 3R7RA 1C1YB 4BFRA 4KZ0A 3VTVA 2YLMA 2KDFB 4ZRKA 3R3MA 2JY6A 3MJWA 4BVUC 3EFUA 2PPHA 1Q5WB 2DAFA 2L76A 4MDKE 4MJSB 3SHQA 4K7WA 1GJZA 4M8NA 4FBJB 4K7SA 2WYQA 2ZZPB 3CSTA 3PV1A 4G50A 3L17A 3HHMA 1WXAA 3ZUNA 2OJRA 5GMVA 1BT0A 2MLBA 2RGFA 2LVPA 1OEYJ 2Y5BB 3KUZA 3WAMA 3DVNU 2ZCCA 3ZNGC 2XBBC 5DPRA 4DDGD 2L7RA 3L08A 3B1LX 3AXCA 3U8ZA 4URKA 1WZ0A 1P0RA 3PLUA 1FXTB 2K39A 4WWPA 2WDTB 4NQLB 5JH5C 3ZLZA 4KDIC 3ZNID 1LXDA 2DZMA 4RMAA 1S3SG 2MP2A 4OVUA 4W9HA 1UZXB 4GN1A 2KQSA 1VCBA 2K8BA 4W9FA 1U4AA 3QC8B 4G11A 1WE7A 3H7SA 5IAAC 2N7DA 1K8RB 3HK0A 2KX0A 1NI2A 1GC7A 2R2OA 5J2RA 1V2YA 3V60A 2IO0B 4HJKA 1RFAA 2LJ5A 3VHTC 4WQOB 4TQ1A 4HDOA 2FIFA 2Z59B 3RZWC 3VQIA 1EF1A 1SGHA 4EKUA 5FR6A 4PS7A 2JRIB 3PRMB 3QQ8B 5DPTA 3ONSA 5E6PA 1ISNA 2KFKA 2PJHA 3VVWB 2KDBA 2KXJA 2UYZB 3M95A 2IO1B 4AOFA 4DDID 3RD2A 1V81A 2FNJB 3ZNHB 2IY0B 3JVZX 3MHSD 4FULA 3L13A 2FCQA 2KFJA 4FN2A 4MH0E 4FA6A 4EEWA 2K6DB 2D07B 3RULA 2J7QB 3AULA 4IWPA 1Z5SB 1H4RA 2KTFA 1WX7A 2O6VB 2UWQA 3ML8A 5JHAA 3BY4B 1V5OA 4RM9A 4WAAA 4NAWB 3NOBA 2CHWA 3DVGY 4AP4C 2LGDA 2BYEA 3BINA 4PS8A 5DPWA 4BOZB 1UELA 2JPHA 2R2QA 2C7MB 4KSKC 4KVGB 4FADA 2MX2A 4EFOA 1WY8A 4WJQA 1I42A 4JL9A 4CHKA 2W9NA 3LJ3A 3IBEA 4W9EA 3PLVA 1WIAA 2M0XA 4MELA 4WWNA 3UGBB 2DYBA 2KD0A 2KHWB 2NVUI 3LDZE 5KHQA 1WRDB 2N9EB 3GOEA 3ZKJC 2G4DB 4GXBA 1YX5B 4IUMB 4DXAB 4J6IA 1P9DU 2MW5A 2J0KA 3PREA 3B08A 2FCMA 2Z0DB 4GDLB 3CMMB 1E8WA 4ICUA 2KTRB 1TBEA 3IHPC 2BKRB 4E3CA 1GUAB 3RCZA 2JT4B 2WX0A 4HPLB 1EO6A 2KC1A 4W9LA 1RAXA 3TMPB 4MM3A 1ZW7A 2G45B 3A4RA 3QHTA 1X1MA 3DBLI 4LDTB 3DVGX 2M8SA 4KDLB 2K8CA 2NBUA 3A9KB 1WR1A 2O2VA 1J0GA 3L16A 1V49A 3TBLD 5TR5A 3H1UA 4EUTA 4K1RB 2XK5A 4DWFA 3DCGA 1E8ZA 2FCSA 2WWZA 4JLCA 3APCA 3ML9A 2DZJA 4N9F4 3ENEA 4MGIE 2LGXA 5CTRC 4CYEA 4ICVA
chains in the Genus database with same CATH superfamily
3WALA 2AQ2B 2AEHA 3PTFC 3AE6B 3TSSA 3ZW3A 2GBRA 2JWUA 4K7UA 4D2KA 3AEFB 2KDIA 3U30A 4DHZB 1MPEA 1I35A 3ZRCA 2REXA 2E3TA 1ZPSA 2IO2B 3ZGZA 3CIRB 3SD5A 1HZ5A 2NMQA 1GG3A 5D2MB 4DHJD 4WJPA 1T0QC 2V3NA 1EWCA 4XGAB 4ACFA 3KUDB 1L7YA 3T3OA 2I2YA 1FXAA 1CJEA 3VH3B 2ZEQA 2MBHA 2NTSA 3R66C 3A9JB 5H8YE 2WDRB 2INDC 3DWGC 3M3JA 4HXDA 3KYCD 2CR5A 4RGNA 4E74A 1UF0A 2ACZB 3WAPA 1SB3C 4A3OA 2OHFA 4WIPA 2WX1A 1PGBA 2NPTB 4IWOA 2LI5A 1J7CA 2HDEA 1XLPA 4P6VF 4KGSA 4JPSA 1FXIA 1P98A 2JZPA 1C3TA 2GBKA 4JWUC 4BBNC 3BWUD 1LQBA 2WXPA 1SIFA 1JALA 5C23A 3UF8A 1RLFA 2CS4A 3PT2B 4ZRQA 1DOXA 3PZ8A 3Q3OC 2CJOA 4W9IA 4DHJB 1TYGB 3HRDD 2ZCBA 5E6NA 3NS8A 2D11A 4YTMB 1WI0A 5LXIB 1Q0WB 3V6CB 1WGYA 3PVLA 2C60A 3W5VB 1WJ6A 5CHWA 3N32A 3Q69A 2DYOA 1ZKHA 3GB1A 2KC2A 1WXMA 3Q8EA 1F2RC 4GDKB 1E8YA 1WMHA 3O13A 2WLBA 3V05A 5HKHA 3GZNI 5G2NA 3U7ZA 1B9RA 4JWSC 2KLGA 5AUKA 1WGHA 3RZFA 1WM3A 3TEXA 4FLHA 1WR6E 4F7ZA 2D5GA 1I4XA 4US8A 4TQ0A 1YJJA 5E6OA 2GBMA 1I4PA 4BOSC 4ASWC 5BMHA 1OGWA 2RPVA 4AWJA 2JRHA 2HJ1A 4IWQA 4MGKE 2W55A 4P16A 3AEAB 2OEDA 3DQVA 3AV8A 1J7BA 1IYFA 1WGKA 3DDCB 3IVFA 3Q2AC 4BKTA 2N9LA 1L4ZB 1EWYC 1QOAA 2O6VD 3N1YC 1K52A 1L5PA 3ZTDA 2WXGA 3PO0A 2EMTA 3CWIA 1ESFA 3DVNV 1QZEA 1WYWB 3SDLC 1JQ4A 2PIAA 3H7PA 1YD8U 3ZYYX 1NBFC 2N0SB 4B6WA 5TSSA 4M00A 1FFVA 1T6BX 2BKFA 1UBQA 1SE4A 4NAWA 2KJHB 3KYDD 1PQSA 1EUVB 1JWAD 4O1NA 3NS1A 2YVCA 4ZHPA 4ARCA 1D6EC 3N30A 1LM8B 2IGDA 1VZ7A 4TSSA 1IPGA 4AJWA 4LDTD 1A5RA 3K9OB 2V4LA 2IPKD 2DYMA 2AQ1B 2TSSA 4EZKA 3RPFC 4P1CC 1YN5A 4IW0A 1TTNA 2WXOA 2I38A 3NZ3A 4ZYSA 3UIOB 2VZKD 4H2AA 2KTRA 1RFKA 2L3ZA 1VD2A 4NJ6A 3KQ4A 3U7DA 4K3CA 4EOYA 2KWVB 2QEJC 5BO4B 4HPMB 4WAFA 2LXAA 1SEBD 2L00B 3V62A 1CQVA 5IA7A 2WDVB 2XNAC 3LXFA 1HQRD 4LTUA 2WU2B 3C19A 2KFKB 2LGSA 2QCZA 3GZNB 1I4HA 2MWSB 1HXYD 2K6QA 5EDSA 2C5LC 3ZVVA 2JU6X 1FMAD 3RT3B 3IXSA 2G9HD 3DBHI 1E5WA 2D10A 2BYTA 2LJIA 4MSQB 3GE8C 1FM0D 1KLGD 2JZZA 2KVZA 4MEMA 1KTKA 2L83A 1TGZB 1SSNA 1YX6B 1KLVA 4N58A 1OFFA 3R2TA 4KGTA 1EF5A 4GB9A 1IGCA 1FRRA 4ZOHC 1P1AA 1M94A 4KIKA 3D32A 4KSLC 3ZJUA 3V6EB 4KZ0A 3V3XA 5IKCM 4ZRKA 2M56B 3U52E 1Q5WB 2L76A 3B2GA 4K7WA 3RNBC 1GJZA 2PLPA 5JXVA 1FIQA 1VDVA 2ONQA 1K50A 2RGFA 3KUZA 3NVWA 3Q8FA 3FILB 5EE9A 5DPRA 4DDGD 2QC8A 3B1LX 1P0RA 1FXTB 2WDTB 2WXKA 3ZLZA 4L2YA 2DZMA 2MP2A 1VCBA 1PUTA 1PGXA 1C4CA 1WE7A 4WWMA 1VRAB 2R2OA 5G5HA 3E56A 4K3BA 1V1PB 2Y3AA 1RFAA 2KQ4X 1FNUA 5FR6A 1D4BA 4PS7A 2JRIB 3PRMB 5DPTA 5E6PA 3ONSA 5C3JB 2E6XA 2IY0B 4FULA 2FE8A 2FCQA 4LNOA 2KFJA 4MH0E 4FA6A 2PVOD 2Z8LA 3AULA 1Z5SB 3FKYA 3BY4B 2MJEA 1V5OA 4RM9A 4WAAA 2PMVA 2WGSA 3BINA 1JWUD 4BOZB 2C7MB 3Q3NC 2MX2A 4EFOA 4WJQA 4JL9A 1XCQL 1WIAA 5EE3A 3HVZA 4WWNA 2KHWB 5KHQA 1HTQA 2G4DB 4GXBA 4J6IA 3E9SA 2J0KA 3Q8BA 2FCMA 2Z0DB 4GDLB 4B0EA 1TBEA 1F0ZA 1GUAB 3AE8B 4HROA 4HPLB 3C8YA 4MM3A 3TMPB 1ZW7A 2G45B 2M8SA 2QJLA 2Q5WD 3A9KB 2FUG1 1FCCC 1VZ6A 5TR5A 4OZBA 2XK5A 1CK1A 2FCSA 3APCA 3ENEA 1IBXB 4CYEA 2D3AA 4AUQC 4LNFA 4N6EB 4DK5A 1AWDA 2N4FA 4KZCA 4RH6A 2MJDA 1C9FA 2XN9C 1OEYA 4GLSC 1SIJA 3NHEB 4JX1C 1SE3A 2N9KA 1E7VA 2PEAA 4W9JA 4FHJA 2B3AA 1YOVB 3W1SA 1MG8A 1ZUD2 2IJ0A 4EE2A 4AJYB 2BPSA 2UU7A 2BW2A 1V86A 1L0YB 4LJPB 1IP9A 4OW0A 4BKSD 1V80A 1YJIA 4GU2A 2LMCA 2J53A 1WGDA 3EECA 3H6NA 1JRUA 2ZW0A 1FPYA 3RNCC 4NQKE 2D3CA 5DCNA 2DAJA 4RGMA 2LGIA 1MJDA 3RFZB 5CX3A 1P7EA 4A55A 2LVQA 2I1KA 4HLEA 1JWBD 2J42A 3K9PB 1KOTA 2K1FA 4ZYNA 3OWEB 2DZIA 1MVKA 2KN4A 1YJ1A 1QQRA 3SU8X 3VTUA 3TEZA 4BZAA 1QOGA 3HM3A 1J7AA 4LJOB 2K0PA 3ABVB 5IN7A 5LLIA 2L1AA 3LB8C 4P1BC 2BWES 3QWZB 3EC8A 4L1BA 2FIDA 2OJWA 2WXJA 3VR8B 1D5MC 2WXMA 2INCC 3A1QB 1SBBB 4GMVA 1YIWA 3IG3A 2ZW1A 4XDCA 3P2BA 3T9LA 2IGGA 4BAXA 1ZXHA 2JUOA 2R61A 2ZJDA 3Q14C 3MHZA 4XC2A 5AZGA 1WGGA 2JVCA 2RPQA 3O65B 3VUYA 4TV3A 4X57B 4NPNA 1MI0A 1PFDA 2KZRA 2LUEA 4MJSA 3OLMD 5L95C 3P4QB 1J19A 4IC7B 3KWVA 4C80A 5BMGA 1DGJA 3L4PA 1EU3A 4AS1A 2WXLA 2MBOA 2EKEC 2C7HA 3PSEB 3GE3C 2BBCA 1E9MA 1TS4A 2PTLA 4KV2A 2JSVX 2NBWB 2ZNVC 2QHOA 1XD3B 1JRPA 3U4EG 1BUIC 1ROEA 2BQQA 3AU5A 5BYSA 3C0RB 3HIZA 3NUHB 3SEBA 1FNWA 4RGTA 4HCPB 2N7EA 3VXWA 4EZLA 2BGFA 1QF6A 1ZDXA 3WA0A 4C4VB 2PVGC 2MBQA 3OJ3A 3AI5A 2L32A 4A90A 2GI9A 2NPTA 2BS4B 1N61A 1AN8A 2WS3B 3WANA 1FCLA 2WXQA 1QT9A 3ZNZB 3AEBB 4S0RA 1HZ6A 4RFBA 1FRDA 2LEKA 1JWSD 1WH3A 1XO3A 2MJ3A 3BVGA 4II3B 3Q8AA 1SF0A 3ALBA 2BYFA 3IAM1 1KRHA 4USAA 3V61A 1WWTA 2ZVOA 1R7SA 1GC6A 3R2IA 5J18A 2KJ6A 3AN1A 3H9DA 1WX8A 2HTHA 2RDBC 1Y8RC 4W9GA 3ZXVA 2WXRA 3ZJVA 2QILA 2M4NA 2HTME 2DBYA 1ZXIA 2D3GA 1LGRA 1NYRA 2MSED 3I63C 3M62B 3NY5A 3AE4B 1TKYA 2LASA 2ICIA 4GDKA 4HK2A 4YSYB 4A20A 1WJNA 1PGAA 4Q2JA 2JXXA 1YQ3B 2KT7A 3ECIA 3L0WB 1WXVA 1AW7A 4FJVB 2BWFA 1CMXB 3WCQA 1F1HA 2CKHB 2JX5A 1K53A 2PE6B 3AE7B 4LK0M 2HJ8A 2L0TA 3WIMA 4YXDB 1MG4A 4M02A 3UQAA 3NJTA 1WE6A 2LHDA 4IDIA 4C56C 2KLCA 3PRPB 4XWWA 2KJRA 5BMIA 2CHXA 4WQMA 1G6JA 1FEHA 3MC0B 2JF5A 3I9V1 1NENB 1N5WA 2L0FA 1F2RI 5IO9A 4EZJA 5JHBA 2DWQA 3R7RA 5HHDG 3VTVA 1FO4A 3R3MA 4BVUC 1XF5L 2DAFA 3SHQA 3RNGC 4M8NA 4FBJB 4K7SA 2WYQA 3CSTA 5HFYA 1WXAA 2SAKA 2ZCCA 1D5ZC 2L7RA 3KWLA 1WZ0A 3PLUA 1TS5A 5C2TB 4WWPA 4NQLB 1TS2A 4A9AA 1LXDA 5FKAC 1E7PB 1S3SG 4GN1A 4UDUC 1U4AA 3ETRA 1WSPA 3HK0A 2IO0B 2LJ5A 4WQOB 3VQIA 4EKUA 1SGHA 3QQ8B 1ISNA 2KFKA 4LNKA 1NI3A 2PJHA 2YEPB 1T0SC 4LNIA 1QILA 3RD2A 3ZNHB 3MHSD 4ZRPA 3I57A 1YQ4B 2KACA 2K6DB 3RULA 1GAQB 1H4RA 1YN4A 1WX7A 2O6VB 2UWQA 3EGRA 3W2DA 3OG5A 1L0VB 4NAWB 4C7YA 3NOBA 1C4AA 5IP4D 2JPHA 4KVGB 4FADA 1F52A 4KGRA 2W9NA 3LJ3A 3PLVA 2K5PA 4MELA 2DYBA 3MP9A 3SR6A 3LDZE 2N9EB 3FC4A 3ZKJC 4A6QA 4IUMB 2V9HA 1P9DU 4KX6B 1T5XD 3CMMB 3Q6BA 4ICUA 2KTRB 3IHPC 2BKRB 1HEZE 1KH0A 4M0WA 2KC1A 3QHTA 4LDTB 3RNAC 2NBUA 1WR1A 2O2VA 2RMMA 1DOIA 3DCGA 2VZKB 4JLCA 3TEWA 4N9F4 4MGIE 5CTRC 4F8CB 3FILA 3Q3FA 1JW9D 2CHZA 1ACCA 2MBEA 2WU5B 3NZSA 2IBIB 3A33B 3S2AA 1GNUA 3ZJTA 3GP7A 4ITKA 1TZ1A 4GIVA 4ANVA 1T0RC 3VFKA 4OVZA 4WWOA 4PYZA 4RF1A 3RNFC 4NAMA 3AE2B 3DWMA 4F1SA 1AARA 4PT5A 1VLBA 4C7ZA 2OOBB 1E10A 1STEA 1JROA 2WXNA 3W1SC 3DOWA 3MTNB 3P4SB 3BZDB 2WHIA 2IDYA 4DBGA 1NVID 3ZTCA 3EHVA 3UIPB 1V9JA 4N59A 4NJ7A 2LWPA 4MGZE 2K8HA 3DBRI 1HTOA 1C76A 5T8IA 3BYTB 1E0ZA 4WH4A 2AYOB 2FUHB 2LZ6A 2FCNA 1UH6A 2LXCA 3JSVB 2ASQA 5C1ZA 4KKIA 1KFYB 1ZGUB 3RMKC 5D6JB 1QOBA 4YSZB 2IGHA 1IGDA 3PGEA 3TUOA 4GDLA 3DBHB 3TIXA 1WZ3A 5G55A 4B95A 1UGMA 1E7UA 1VR9A 1Z2MA 3UQBA 1EM7A 2AX5A 2QDFA 2ZVNA 3A9KA 2GBJA 3A4SC 4WJOA 1YN3A 4MGYE 2XEWA 5EE1A 2K25A 2WDQB 3QK0A 1R4NI 5FR3A 3PHWB 3ZIMA 2ZPNA 1A70A 1IBXA 3IT6B 4HWIB 5AZFA 2V3SA 3DBSA 2PE9A 2YEPF 1WFYA 5CHVC 4XDDA 4PS3A 1E90A 3BVMA 3AMZA 1ZOYB 4BBNF 3RUIB 1ET6A 2LHEA 4ANUA 4FJZA 3VRAB 4IG7B 3RNEC 3TEYA 1UWXA 1ZDVA 3ZO5B 3CSFA 3QJZA 3PPAA 1UUPA 2KX3A 3JYUA 1PYWD 2IZVB 3IAS1 3NVVA 1LFDA 4LLGM 1FFUA 3PRZA 5IOIA 4HKZE 1WF9A 1KLUD 1R4MI 1JCKB 1OQYA 3OAWA 4MM3B 4DHZE 2V0GA 4OVVA 1QLBB 1TKGA 1XCTL 2JQRB 1N63A 1L2NA 2XK5B 4I6PA 1KJTA 2NCNA 2CU3A 3IFWB 4ANWA 2MQJA 4RM8A 1RRBA 1MHXA 3R7QA 4PK1A 3M63B 2A5UA 3OJ4B 2MHJA 2KMCA 3B0AA 2G4SA 3NRZA 2BB5A 2N1WA 1P3QU 3J9CA 3KVFB 2BTEA 2WNMA 3TCAA 1WX9A 1AYFA 4BKSA 3A1QA 3GS2A 2WP9B 4XX5A 1KM7A 2PKOA 4FXCA 4G3XB 1WJUA 4NY0A 2M17A 4XE0A 3KW5B 2KNBA 2I1JA 2X8XX 1GB1A 1YNTE 1R4NB 1EU4A 1D3ZA 2AL3A 4RGOS 4HVBA 3MFGA 5BYRA 3B2FA 4GSWA 4ANXA 2DZKA 2AWTA 3QCAA 3W1YA 2IY1B 4R3DA 2G1EA 4XZ4A 2D3BA 1UBIA 2DNFA 5JZEB 3P4PB 3TJPA 4IOIE 5EE0A 1UWMA 3URYA 2CJNA 2IYDB 3DPDA 3LYYA 2KKCA 4GGQA 3EA6A 1UGJA 2LFIA 3NVZA 3Q8CA 1C78A 4FJYA 4I6NB 4I6LB 2NTTA 2N1VA 2Z0EB 3Q3JA 2X38A 4MSMB 2CU1A 1GOZA 3WAOA 1R4MB 2MRPA 4C4VA 4M8MA 2FAZA 2KQ7A 1HE8A 2DENB 1XXGA 4RCOA 3DHHC 4HCNB 3A9JA 4QAYA 1I7HA 2L8JA 1TS3A 2RDGA 3H8HA 2Y5CA 3HUIA 3MJWA 3EFUA 2PPHA 2SEBD 4HKQA 1L4DB 4MDKE 4MJSB 2EELA 3L17A 4HJGE 5GMVA 1BT0A 4YWGG 2Y5BB 1V1OA 3DVNU 3ZNGC 2XBBC 3AXCA 3U8ZA 3W5UB 4URKA 2K39A 3RI7C 2JYEA 2W3RA 2BVCA 1SXTA 4DQOC 3ZNID 3W9CB 1SJED 4RMAA 4W9HA 1UZXB 2KQSA 2VH1A 4W9FA 4G11A 5IAAC 2KDMA 2N7DA 1K8RB 2KX0A 1NI2A 4NJCA 5J2RA 3R8BA 4HJKA 1TT5B 4TQ1A 1TY2A 4HDOA 1C77A 2WXHA 2WXIA 3N1ZC 3VVWB 4DXFA 4AOFA 3M95A 2IO1B 3UI3A 3AE9B 3JVZX 1WRIA 4FN2A 2GLSA 1RWSA 3MJ5A 4EEWA 2D07B 2J7QB 2J4XA 4ZHOA 2KTFA 2M0AA 3ML8A 5JHAA 1N62A 2CHWA 3DVGY 1Q10A 1GB4A 3BK1A 2QIEB 2R2QA 4RF0A 2L52A 3ZXRA 1WY8A 2Y5PA 2B76B 1I42A 3IBEA 4CQNA 1PDXA 2KD0A 2NVUI 3KLSX 1YX5B 4DXAB 4B0MA 2MW5A 5MPOA 3B08A 2KWDA 1E8WA 2PW9A 4YTNB 1X1MA 3DBLI 4KDLB 3DHGC 3AM9A 1IUEA 3H1UA 4K1RB 2INPE 3AECB 2WWZA 3ML9A 5GXGB 1UNSA 2INNE 1B1ZA 4K81A 1NEKB 5HI1A 5KHOA 4A3PA 2KANA 2LD9A 2ZNVB 1WMHB 5BYQA 1LO5D 1XT9B 1YQBA 4XYCA 2A4ZA 1NYQA 2LUMA 1N6ZA 3P63A 1WXQA 3AEDB 3SFEB 1V5TA 2H88B 3APDA 3MC9A 2BF8B 1WYGA 3HVDA 4ZRJA 1C79A 1K51A 3X0WA 5D7GA 1I4RA 4US9A 1V6EA 3NZUA 2NR2A 4JQWC 1XLQA 5G5GA 2IO3B 2K3UA 2HD5B 2MA9B 2JWZA 2AQ3B 2RR9A 4ZDVA 4CO7A 3QAQA 3PZ7A 1QKZA 1E6EB 2O6VA 3IT4B 4MACA 2MBBB 5H92C 3AEGB 2V1YA 3JW0X 2K22A 3H7PB 4A8XC 1KF6B 3N1XC 3ZQ4A 1V97A 1ENFA 1UD7A 1S1QB 2KDEB 1DYQA 2MEKA 1VZ8A 2GB1A 4OHJA 3DHIC 3B9JA 1N5XA 2LVOA 1VJKA 2WQYB 3QX1A 3PZDA 1XLOA 3QARA 5LNK1 5DPSA 3P4RB 3EUB2 3BK2A 1P7FA 2NS5A 4JGHB 2N9XA 3T3NA 3ZRFA 3DBLB 2MCNB 1BMLC 3N3KB 4HPPA 3AE3B 3KUCB 3TL5A 1TKEA 2N9PC 2NBVB 4WJNA 2DHZA 1RM6C 1N60A 3BVZA 3VDZA 5AZHA 4IM2A 2J0MA 3NVYA 3BIID 1OQRA 2KYWA 2M1MA 3RYTA 1T0YA 4J3OD 3QA8A 2BYVE 2M19A 2DX5B 5J17A 1TY0A 2KN5A 3AE1B 1WGRA 1JMLA 1XLNA 2FBWB 4PYUA 5AUIA 3VR9B 1F9JA 1WXSA 1MFWA 2BS2B 1WJ4A 2V3PA 3VTWA 4YT0B 3FAHA 2DLBA 3VUXA 4M0WB 1V1PA 1C4PA 1H8CA 2O2VB 2GRIA 2QSDA 3ZDTA 1F77A 2KK8A 1L6UA 2KWCA 1DOYA 3JSVA 4KIKB 4YL8A 1SJHD 2J52A 4C00A 2JZ3B 2VH2A 4W9DA 2BS3B 4LNNA 3VAWA 3QIJA 2C9WB 1D5XC 4HRSA 5LXHA 1I4GA 4S17A 5AEKB 3L54A 5CHFA 2L05A 2RD0A 3X23A 2QMTA 4MH8A 2RSUA 3N9YC 1L6VA 4W9CA 4TUUA 5HG2A 3L10B 1XQQA 2J0JA 2LRWA 4NZLB 2LRUA 4P7IA 2K9XA 4L23A 1Q1OA 3NG0A 2MP2B 2KO3A 3T8MA 1WM2A 4OZAA 3PS6A 1NDDA 1ZE3D 1HA5A 1ET9A 4RNAA 1SE2A 4FHKA 4YTPB 3RN9C 3AU4A 3VRBB 3CF6E 4II2B 4B9KA 3UINB 1J8CA 3I3TB 4GOCA 2KWUB 4IKGA 4G0NB 3PHXB 3EFCA 3BYYB 4OZCA 3ZDMC 5L83A 2KOXA 1TZOA 3APFA 3VH4B 5I4DA 4LCDE 4HDQA 4NNJB 2D2QA 2MH7A 2EKIA 1T3QA 1SE9A 4IM3A 4W9KA 2GOWA 4ZRIA 2AL6A 2ZPYA 4WURA 5D3IB 4HEA1 4JIOU 4TKNA 1Y56A 2HE7A 4JE3B 3MC8A 1ZP0B 2GMIC 2EMSA 2VRRB 2C7NB 3KH0A 3VUWA 4IM0A 1MHHE 4BKGA 2GBNA 2V4IB 4AQ7A 2LGYA 3HM6X 1E8XA 2H89B 5D94A 1OTRB 4E71A 2KMAA 2G3QB 1QOFA 3Q3MC 2KVRA 4XWTA 1C1YB 4BFRA 4ARIA 1TIFA 2YLMA 2KDFB 3P42A 2JY6A 4G50A 2ZZPB 3DBRB 3PV1A 3HHMA 3I5JC 1V8CA 2BT6A 3ZUNA 2OJRA 2MLBA 2W82A 2LVPA 1OEYJ 3WAMA 4KKJA 1I4QA 3L08A 1TJEA 5FK9C 1M4VA 5JH5C 4KDIC 1JWMD 1RYJA 3AB5A 4OVUA 1XEEA 1OQQA 2K8BA 1L0XB 3QC8B 2KMMA 3H7SA 1GC7A 1V2YA 3V60A 3VHTC 5D3DA 2ON8A 2FIFA 2Z59B 3N20C 3RZWC 1EF1A 2KAJA 4M01A 2W54A 3U2SC 4TMAB 2KDBA 2KXJA 2UYZB 4DDID 1V81A 2FNJB 3L13A 4MT5A 4IWPA 2N7JA 2JYTA 4REZA 3AEEB 1FD6A 5E6JA 3AH7A 4AP4C 2LGDA 3AE5B 2BYEA 1BXTA 4PS8A 4YSXB 5DPWA 1UELA 4KSKC 1YMHE 2JXTA 4CHKA 2BB6A 4W9EA 1GPXA 1FNVA 2M0XA 3UGBB 4DXGA 2W3SA 1WRDB 3GOEA 2WXFA 3PREA 2RDHA 3P1MA 4E3CA 3RCZA 2JT4B 2WX0A 1EO6A 4W9LA 1RAXA 3A4RA 3DVGX 2K8CA 1J0GA 3L16A 1V49A 3TBLD 4EUTA 4DWFA 1E8ZA 1CZPA 2DZJA 2LGXA 3SFDB 4ICVA
chains in the Genus database with same CATH topology
3WALA 4AUQC 3Q3FA 4K81A 2AEHA 4DK5A 2CHZA 2N4FA 2MBEA 3NZSA 4KZCA 2IBIB 3PTFC 3ZW3A 1OEYA 2GBRA 5KHOA 4K7UA 4A3PA 2KANA 2LD9A 3A33B 2ZNVB 2KDIA 3NHEB 3U30A 4DHZB 1WMHB 3S2AA 1I35A 3ZRCA 1GNUA 2REXA 1E7VA 2PEAA 4W9JA 4FHJA 2B3AA 1XT9B 3W1SA 1YQBA 1MG8A 1TZ1A 2IO2B 4GIVA 3SD5A 4AJYB 2A4ZA 4ANVA 2BPSA 1V86A 4LJPB 3VFKA 1IP9A 1GG3A 4WWOA 4PYZA 5D2MB 4BKSD 1V80A 4DHJD 4GU2A 4WJPA 1V5TA 3APDA 4F1SA 1AARA 1WGDA 2BF8B 3EECA 3H6NA 1JRUA 3KUDB 2OOBB 1L7YA 4NQKE 4ZRJA 5DCNA 3X0WA 5D7GA 3VH3B 2ZEQA 2MBHA 2DAJA 3R66C 3W1SC 3A9JB 1V6EA 3NZUA 2NR2A 3DOWA 3MTNB 4JQWC 2IO3B 3M3JA 2HD5B 2MA9B 4HXDA 3KYCD 2JWZA 5CX3A 2CR5A 4E74A 2RR9A 4ZDVA 3WAPA 3ZTCA 4DBGA 2LVQA 2I1KA 4CO7A 3QAQA 3EHVA 3UIPB 4HLEA 4A3OA 1V9JA 4NJ7A 2LWPA 2O6VA 4MGZE 3K9PB 2K8HA 2K1FA 1KOTA 3DBRI 2WX1A 2MBBB 4ZYNA 2DZIA 1YJ1A 2NPTB 2AYOB 2V1YA 2FUHB 2LZ6A 4IWOA 2FCNA 1UH6A 2LXCA 3JSVB 2LI5A 3JW0X 3SU8X 2ASQA 3H7PB 3VTUA 5C1ZA 3HM3A 4LJOB 1P98A 1UD7A 1S1QB 1ZGUB 2KDEB 1C3TA 5D6JB 2GBKA 4BBNC 5LLIA 1LQBA 1SIFA 5C23A 2BWES 3QWZB 3PGEA 3EC8A 4GDLA 2LVOA 3UF8A 3TIXA 1RLFA 1WZ3A 2CS4A 3PT2B 5G55A 2FIDA 3QX1A 3PZDA 4B95A 1UGMA 1E7UA 3QARA 5DPSA 4W9IA 4DHJB 1Z2MA 3UQBA 3A1QB 2NS5A 2ZVNA 3A9KA 2N9XA 4JGHB 2GBJA 3A4SC 4GMVA 4WJOA 1YIWA 3IG3A 3ZRFA 4MGYE 2ZCBA 2MCNB 3N3KB 5E6NA 2XEWA 3NS8A 2K25A 3QK0A 1R4NI 3P2BA 2D11A 3PHWB 3ZIMA 3T9LA 2ZPNA 1WI0A 3KUCB 2JUOA 2ZJDA 3TL5A 5LXIB 1Q0WB 4XC2A 1WGYA 2N9PC 4HWIB 3V6CB 3PVLA 2C60A 1WGGA 5AZGA 5AZFA 2NBVB 4WJNA 1WJ6A 2V3SA 2PE9A 2DHZA 3DBSA 3N32A 2DYOA 5CHWA 1ZKHA 2KC2A 1WXMA 2JVCA 2RPQA 3O65B 1WFYA 5CHVC 3VUYA 4TV3A 4X57B 4GDKB 1E8YA 3VDZA 5AZHA 4NPNA 4PS3A 1WMHA 4IM2A 2LUEA 2KZRA 2J0MA 4MJSA 3OLMD 5L95C 1E90A 1J19A 5HKHA 3GZNI 5G2NA 4BBNF 4IC7B 3RUIB 2M1MA 3RYTA 1T0YA 4ANUA 4FJZA 3QA8A 2BYVE 2DX5B 4IG7B 5J17A 2MBOA 2EKEC 2KN5A 2KLGA 2C7HA 3PSEB 1WGRA 1WGHA 3RZFA 1WM3A 3ZO5B 3CSFA 3QJZA 4KV2A 3PPAA 4PYUA 4FLHA 1WR6E 4F7ZA 2KX3A 3JYUA 4TQ0A 2NBWB 2ZNVC 2GBMA 5E6OA 1F9JA 1WXSA 2IZVB 2QHOA 1XD3B 4BOSC 4ASWC 1LFDA 1OGWA 1WJ4A 4AWJA 2JRHA 3PRZA 3AU5A 3VTWA 4IWQA 4MGKE 3C0RB 3HIZA 1WF9A 3VUXA 1R4MI 4M0WB 1OQYA 3DQVA 3OAWA 4HCPB 4DHZE 1IYFA 2N7EA 3DDCB 3IVFA 3VXWA 4BKTA 4EZLA 1H8CA 2BGFA 2O2VB 4OVVA 2O6VD 3WA0A 3ZTDA 2MBQA 3ZDTA 2KK8A 3OJ3A 1L2NA 3AI5A 2XK5B 2EMTA 2NPTA 4I6PA 3DVNV 1QZEA 2KWCA 1WYWB 3SDLC 1KJTA 3JSVA 2NCNA 3IFWB 4KIKB 3WANA 3H7PA 4YL8A 4ANWA 3ZNZB 1YD8U 1NBFC 2MQJA 4RM8A 2JZ3B 1RRBA 4W9DA 3R7QA 4B6WA 1WH3A 3M63B 2A5UA 3VAWA 3OJ4B 2C9WB 3QIJA 4II3B 5LXHA 2KMCA 2BKFA 3ALBA 2G4SA 3B0AA 1UBQA 5AEKB 2BYFA 2N1WA 1P3QU 4NAWA 2KJHB 3KYDD 1PQSA 3KVFB 3L54A 5CHFA 1EUVB 2L05A 2RD0A 3V61A 2ZVOA 3TCAA 3X23A 1GC6A 2RSUA 1WX9A 5J18A 2YVCA 4BKSA 4W9CA 4TUUA 3N30A 1LM8B 2KJ6A 3L10B 1XQQA 2J0JA 3A1QA 3H9DA 2LRWA 4XX5A 1KM7A 1IPGA 4AJWA 4LDTD 4G3XB 1A5RA 3K9OB 2HTHA 1WX8A 2LRUA 1Y8RC 2V4LA 4W9GA 2DYMA 1WJUA 4NY0A 4P7IA 2M17A 1Q1OA 4EZKA 3KW5B 4IW0A 1TTNA 2M4NA 2MP2B 2KNBA 2KO3A 3T8MA 1WM2A 2I1JA 3UIOB 2D3GA 2KTRA 3PS6A 1NDDA 2AL3A 1D3ZA 2L3ZA 1VD2A 2MSED 4FHKA 4NJ6A 3U7DA 4HVBA 3M62B 3AU4A 3NY5A 4EOYA 2KWVB 2LASA 3CF6E 4II2B 5BO4B 4B9KA 3UINB 4GDKA 4GSWA 4HK2A 4HPMB 4ANXA 1J8CA 3I3TB 4GOCA 2DZKA 2LXAA 2AWTA 2L00B 3QCAA 3V62A 4A20A 3W1YA 5IA7A 1WJNA 2IY1B 4XZ4A 2JXXA 2KFKB 2KWUB 1UBIA 5JZEB 3ECIA 4G0NB 3PHXB 3L0WB 3TJPA 2MWSB 3ZDMC 1WXVA 5L83A 2KOXA 3APFA 3VH4B 4FJVB 2BWFA 2IYDB 4HDQA 2K6QA 4LCDE 4NNJB 2C5LC 5EDSA 2D2QA 1CMXB 3ZVVA 3DPDA 3RT3B 2CKHB 2KKCA 4GGQA 1SE9A 4IM3A 2PE6B 3DBHI 4W9KA 2GOWA 1E5WA 2HJ8A 4FJYA 4ZRIA 2AL6A 2D10A 2L0TA 3WIMA 2ZPYA 4JIOU 4TKNA 4I6NB 4I6LB 4MSQB 2N1VA 3UQAA 2HE7A 2GMIC 1WE6A 2Z0EB 3Q3JA 2JZZA 2EMSA 4MEMA 2VRRB 2C7NB 1TGZB 4MSMB 2CU1A 3KH0A 1YX6B 3VUWA 2KLCA 3WAOA 4IM0A 1KLVA 3PRPB 2MRPA 2KJRA 4BKGA 2GBNA 2CHXA 2FAZA 4M8MA 1G6JA 2KQ7A 1HE8A 1EF5A 2DENB 4GB9A 2LGYA 3HM6X 4F8CB 4HCNB 2JF5A 1E8XA 3A9JA 5D94A 1P1AA 1M94A 4KIKA 1OTRB 2L0FA 4E71A 2KMAA 2L8JA 4EZJA 2G3QB 3D32A 4KSLC 3V6EB 2KVRA 5JHBA 3R7RA 1C1YB 4BFRA 4KZ0A 3VTVA 2YLMA 2KDFB 4ZRKA 3R3MA 2JY6A 3MJWA 4BVUC 3EFUA 2PPHA 1Q5WB 2DAFA 2L76A 4MDKE 4MJSB 3SHQA 4K7WA 1GJZA 4M8NA 4FBJB 4K7SA 2WYQA 2ZZPB 3CSTA 3PV1A 4G50A 3L17A 3HHMA 1WXAA 3ZUNA 2OJRA 5GMVA 1BT0A 2MLBA 2RGFA 2LVPA 1OEYJ 2Y5BB 3KUZA 3WAMA 3DVNU 2ZCCA 3ZNGC 2XBBC 5DPRA 4DDGD 2L7RA 3L08A 3B1LX 3AXCA 3U8ZA 4URKA 1WZ0A 1P0RA 3PLUA 1FXTB 2K39A 4WWPA 2WDTB 4NQLB 5JH5C 3ZLZA 4KDIC 3ZNID 1LXDA 2DZMA 4RMAA 1S3SG 2MP2A 4OVUA 4W9HA 1UZXB 4GN1A 2KQSA 1VCBA 2K8BA 4W9FA 1U4AA 3QC8B 4G11A 1WE7A 3H7SA 5IAAC 2N7DA 1K8RB 3HK0A 2KX0A 1NI2A 1GC7A 2R2OA 5J2RA 1V2YA 3V60A 2IO0B 4HJKA 1RFAA 2LJ5A 3VHTC 4WQOB 4TQ1A 4HDOA 2FIFA 2Z59B 3RZWC 3VQIA 1EF1A 1SGHA 4EKUA 5FR6A 4PS7A 2JRIB 3PRMB 3QQ8B 5DPTA 3ONSA 5E6PA 1ISNA 2KFKA 2PJHA 3VVWB 2KDBA 2KXJA 2UYZB 3M95A 2IO1B 4AOFA 4DDID 3RD2A 1V81A 2FNJB 3ZNHB 2IY0B 3JVZX 3MHSD 4FULA 3L13A 2FCQA 2KFJA 4FN2A 4MH0E 4FA6A 4EEWA 2K6DB 2D07B 3RULA 2J7QB 3AULA 4IWPA 1Z5SB 1H4RA 2KTFA 1WX7A 2O6VB 2UWQA 3ML8A 5JHAA 3BY4B 1V5OA 4RM9A 4WAAA 4NAWB 3NOBA 2CHWA 3DVGY 4AP4C 2LGDA 2BYEA 3BINA 4PS8A 5DPWA 4BOZB 1UELA 2JPHA 2R2QA 2C7MB 4KSKC 4KVGB 4FADA 2MX2A 4EFOA 1WY8A 4WJQA 1I42A 4JL9A 4CHKA 2W9NA 3LJ3A 3IBEA 4W9EA 3PLVA 1WIAA 2M0XA 4MELA 4WWNA 3UGBB 2DYBA 2KD0A 2KHWB 2NVUI 3LDZE 5KHQA 1WRDB 2N9EB 3GOEA 3ZKJC 2G4DB 4GXBA 1YX5B 4IUMB 4DXAB 4J6IA 1P9DU 2MW5A 2J0KA 3PREA 3B08A 2FCMA 2Z0DB 4GDLB 3CMMB 1E8WA 4ICUA 2KTRB 1TBEA 3IHPC 2BKRB 4E3CA 1GUAB 3RCZA 2JT4B 2WX0A 4HPLB 1EO6A 2KC1A 4W9LA 1RAXA 3TMPB 4MM3A 1ZW7A 2G45B 3A4RA 3QHTA 1X1MA 3DBLI 4LDTB 3DVGX 2M8SA 4KDLB 2K8CA 2NBUA 3A9KB 1WR1A 2O2VA 1J0GA 3L16A 1V49A 3TBLD 5TR5A 3H1UA 4EUTA 4K1RB 2XK5A 4DWFA 3DCGA 1E8ZA 2FCSA 2WWZA 4JLCA 3APCA 3ML9A 2DZJA 4N9F4 3ENEA 4MGIE 2LGXA 5CTRC 4CYEA 4ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAL A;  4AUQ C;  3Q3F A;  4K81 A;  2AEH A;  4DK5 A;  2CHZ A;  2N4F A;  2MBE A;  3NZS A;  4KZC A;  2IBI B;  3PTF C;  3ZW3 A;  1OEY A;  2GBR A;  5KHO A;  4K7U A;  4A3P A;  2KAN A;  2LD9 A;  3A33 B;  2ZNV B;  2KDI A;  3NHE B;  3U30 A;  4DHZ B;  1WMH B;  3S2A A;  1I35 A;  3ZRC A;  1GNU A;  2REX A;  1E7V A;  2PEA A;  4W9J A;  4FHJ A;  2B3A A;  1XT9 B;  3W1S A;  1YQB A;  1MG8 A;  1TZ1 A;  2IO2 B;  4GIV A;  3SD5 A;  4AJY B;  2A4Z A;  4ANV A;  2BPS A;  1V86 A;  4LJP B;  3VFK A;  1IP9 A;  1GG3 A;  4WWO A;  4PYZ A;  5D2M B;  4BKS D;  1V80 A;  4DHJ D;  4GU2 A;  4WJP A;  1V5T A;  3APD A;  4F1S A;  1AAR A;  1WGD A;  2BF8 B;  3EEC A;  3H6N A;  1JRU A;  3KUD B;  2OOB B;  1L7Y A;  4NQK E;  4ZRJ A;  5DCN A;  3X0W A;  5D7G A;  3VH3 B;  2ZEQ A;  2MBH A;  2DAJ A;  3R66 C;  3W1S C;  3A9J B;  1V6E A;  3NZU A;  2NR2 A;  3DOW A;  3MTN B;  4JQW C;  2IO3 B;  3M3J A;  2HD5 B;  2MA9 B;  4HXD A;  3KYC D;  2JWZ A;  5CX3 A;  2CR5 A;  4E74 A;  2RR9 A;  4ZDV A;  3WAP A;  3ZTC A;  4DBG A;  2LVQ A;  2I1K A;  4CO7 A;  3QAQ A;  3EHV A;  3UIP B;  4HLE A;  4A3O A;  1V9J A;  4NJ7 A;  2LWP A;  2O6V A;  4MGZ E;  3K9P B;  2K8H A;  2K1F A;  1KOT A;  3DBR I;  2WX1 A;  2MBB B;  4ZYN A;  2DZI A;  1YJ1 A;  2NPT B;  2AYO B;  2V1Y A;  2FUH B;  2LZ6 A;  4IWO A;  2FCN A;  1UH6 A;  2LXC A;  3JSV B;  2LI5 A;  3JW0 X;  3SU8 X;  2ASQ A;  3H7P B;  3VTU A;  5C1Z A;  3HM3 A;  4LJO B;  1P98 A;  1UD7 A;  1S1Q B;  1ZGU B;  2KDE B;  1C3T A;  5D6J B;  2GBK A;  4BBN C;  5LLI A;  1LQB A;  1SIF A;  5C23 A;  2BWE S;  3QWZ B;  3PGE A;  3EC8 A;  4GDL A;  2LVO A;  3UF8 A;  3TIX A;  1RLF A;  1WZ3 A;  2CS4 A;  3PT2 B;  5G55 A;  2FID A;  3QX1 A;  3PZD A;  4B95 A;  1UGM A;  1E7U A;  3QAR A;  5DPS A;  4W9I A;  4DHJ B;  1Z2M A;  3UQB A;  3A1Q B;  2NS5 A;  2ZVN A;  3A9K A;  2N9X A;  4JGH B;  2GBJ A;  3A4S C;  4GMV A;  4WJO A;  1YIW A;  3IG3 A;  3ZRF A;  4MGY E;  2ZCB A;  2MCN B;  3N3K B;  5E6N A;  2XEW A;  3NS8 A;  2K25 A;  3QK0 A;  1R4N I;  3P2B A;  2D11 A;  3PHW B;  3ZIM A;  3T9L A;  2ZPN A;  1WI0 A;  3KUC B;  2JUO A;  2ZJD A;  3TL5 A;  5LXI B;  1Q0W B;  4XC2 A;  1WGY A;  2N9P C;  4HWI B;  3V6C B;  3PVL A;  2C60 A;  1WGG A;  5AZG A;  5AZF A;  2NBV B;  4WJN A;  1WJ6 A;  2V3S A;  2PE9 A;  2DHZ A;  3DBS A;  3N32 A;  2DYO A;  5CHW A;  1ZKH A;  2KC2 A;  1WXM A;  2JVC A;  2RPQ A;  3O65 B;  1WFY A;  5CHV C;  3VUY A;  4TV3 A;  4X57 B;  4GDK B;  1E8Y A;  3VDZ A;  5AZH A;  4NPN A;  4PS3 A;  1WMH A;  4IM2 A;  2LUE A;  2KZR A;  2J0M A;  4MJS A;  3OLM D;  5L95 C;  1E90 A;  1J19 A;  5HKH A;  3GZN I;  5G2N A;  4BBN F;  4IC7 B;  3RUI B;  2M1M A;  3RYT A;  1T0Y A;  4ANU A;  4FJZ A;  3QA8 A;  2BYV E;  2DX5 B;  4IG7 B;  5J17 A;  2MBO A;  2EKE C;  2KN5 A;  2KLG A;  2C7H A;  3PSE B;  1WGR A;  1WGH A;  3RZF A;  1WM3 A;  3ZO5 B;  3CSF A;  3QJZ A;  4KV2 A;  3PPA A;  4PYU A;  4FLH A;  1WR6 E;  4F7Z A;  2KX3 A;  3JYU A;  4TQ0 A;  2NBW B;  2ZNV C;  2GBM A;  5E6O A;  1F9J A;  1WXS A;  2IZV B;  2QHO A;  1XD3 B;  4BOS C;  4ASW C;  1LFD A;  1OGW A;  1WJ4 A;  4AWJ A;  2JRH A;  3PRZ A;  3AU5 A;  3VTW A;  4IWQ A;  4MGK E;  3C0R B;  3HIZ A;  1WF9 A;  3VUX A;  1R4M I;  4M0W B;  1OQY A;  3DQV A;  3OAW A;  4HCP B;  4DHZ E;  1IYF A;  2N7E A;  3DDC B;  3IVF A;  3VXW A;  4BKT A;  4EZL A;  1H8C A;  2BGF A;  2O2V B;  4OVV A;  2O6V D;  3WA0 A;  3ZTD A;  2MBQ A;  3ZDT A;  2KK8 A;  3OJ3 A;  1L2N A;  3AI5 A;  2XK5 B;  2EMT A;  2NPT A;  4I6P A;  3DVN V;  1QZE A;  2KWC A;  1WYW B;  3SDL C;  1KJT A;  3JSV A;  2NCN A;  3IFW B;  4KIK B;  3WAN A;  3H7P A;  4YL8 A;  4ANW A;  3ZNZ B;  1YD8 U;  1NBF C;  2MQJ A;  4RM8 A;  2JZ3 B;  1RRB A;  4W9D A;  3R7Q A;  4B6W A;  1WH3 A;  3M63 B;  2A5U A;  3VAW A;  3OJ4 B;  2C9W B;  3QIJ A;  4II3 B;  5LXH A;  2KMC A;  2BKF A;  3ALB A;  2G4S A;  3B0A A;  1UBQ A;  5AEK B;  2BYF A;  2N1W A;  1P3Q U;  4NAW A;  2KJH B;  3KYD D;  1PQS A;  3KVF B;  3L54 A;  5CHF A;  1EUV B;  2L05 A;  2RD0 A;  3V61 A;  2ZVO A;  3TCA A;  3X23 A;  1GC6 A;  2RSU A;  1WX9 A;  5J18 A;  2YVC A;  4BKS A;  4W9C A;  4TUU A;  3N30 A;  1LM8 B;  2KJ6 A;  3L10 B;  1XQQ A;  2J0J A;  3A1Q A;  3H9D A;  2LRW A;  4XX5 A;  1KM7 A;  1IPG A;  4AJW A;  4LDT D;  4G3X B;  1A5R A;  3K9O B;  2HTH A;  1WX8 A;  2LRU A;  1Y8R C;  2V4L A;  4W9G A;  2DYM A;  1WJU A;  4NY0 A;  4P7I A;  2M17 A;  1Q1O A;  4EZK A;  3KW5 B;  4IW0 A;  1TTN A;  2M4N A;  2MP2 B;  2KNB A;  2KO3 A;  3T8M A;  1WM2 A;  2I1J A;  3UIO B;  2D3G A;  2KTR A;  3PS6 A;  1NDD A;  2AL3 A;  1D3Z A;  2L3Z A;  1VD2 A;  2MSE D;  4FHK A;  4NJ6 A;  3U7D A;  4HVB A;  3M62 B;  3AU4 A;  3NY5 A;  4EOY A;  2KWV B;  2LAS A;  3CF6 E;  4II2 B;  5BO4 B;  4B9K A;  3UIN B;  4GDK A;  4GSW A;  4HK2 A;  4HPM B;  4ANX A;  1J8C A;  3I3T B;  4GOC A;  2DZK A;  2LXA A;  2AWT A;  2L00 B;  3QCA A;  3V62 A;  4A20 A;  3W1Y A;  5IA7 A;  1WJN A;  2IY1 B;  4XZ4 A;  2JXX A;  2KFK B;  2KWU B;  1UBI A;  5JZE B;  3ECI A;  4G0N B;  3PHX B;  3L0W B;  3TJP A;  2MWS B;  3ZDM C;  1WXV A;  5L83 A;  2KOX A;  3APF A;  3VH4 B;  4FJV B;  2BWF A;  2IYD B;  4HDQ A;  2K6Q A;  4LCD E;  4NNJ B;  2C5L C;  5EDS A;  2D2Q A;  1CMX B;  3ZVV A;  3DPD A;  3RT3 B;  2CKH B;  2KKC A;  4GGQ A;  1SE9 A;  4IM3 A;  2PE6 B;  3DBH I;  4W9K A;  2GOW A;  1E5W A;  2HJ8 A;  4FJY A;  4ZRI A;  2AL6 A;  2D10 A;  2L0T A;  3WIM A;  2ZPY A;  4JIO U;  4TKN A;  4I6N B;  4I6L B;  4MSQ B;  2N1V A;  3UQA A;  2HE7 A;  2GMI C;  1WE6 A;  2Z0E B;  3Q3J A;  2JZZ A;  2EMS A;  4MEM A;  2VRR B;  2C7N B;  1TGZ B;  4MSM B;  2CU1 A;  3KH0 A;  1YX6 B;  3VUW A;  2KLC A;  3WAO A;  4IM0 A;  1KLV A;  3PRP B;  2MRP A;  2KJR A;  4BKG A;  2GBN A;  2CHX A;  2FAZ A;  4M8M A;  1G6J A;  2KQ7 A;  1HE8 A;  1EF5 A;  2DEN B;  4GB9 A;  2LGY A;  3HM6 X;  4F8C B;  4HCN B;  2JF5 A;  1E8X A;  3A9J A;  5D94 A;  1P1A A;  1M94 A;  4KIK A;  1OTR B;  2L0F A;  4E71 A;  2KMA A;  2L8J A;  4EZJ A;  2G3Q B;  3D32 A;  4KSL C;  3V6E B;  2KVR A;  5JHB A;  3R7R A;  1C1Y B;  4BFR A;  4KZ0 A;  3VTV A;  2YLM A;  2KDF B;  4ZRK A;  3R3M A;  2JY6 A;  3MJW A;  4BVU C;  3EFU A;  2PPH A;  1Q5W B;  2DAF A;  2L76 A;  4MDK E;  4MJS B;  3SHQ A;  4K7W A;  1GJZ A;  4M8N A;  4FBJ B;  4K7S A;  2WYQ A;  2ZZP B;  3CST A;  3PV1 A;  4G50 A;  3L17 A;  3HHM A;  1WXA A;  3ZUN A;  2OJR A;  5GMV A;  1BT0 A;  2MLB A;  2RGF A;  2LVP A;  1OEY J;  2Y5B B;  3KUZ A;  3WAM A;  3DVN U;  2ZCC A;  3ZNG C;  2XBB C;  5DPR A;  4DDG D;  2L7R A;  3L08 A;  3B1L X;  3AXC A;  3U8Z A;  4URK A;  1WZ0 A;  1P0R A;  3PLU A;  1FXT B;  2K39 A;  4WWP A;  2WDT B;  4NQL B;  5JH5 C;  3ZLZ A;  4KDI C;  3ZNI D;  1LXD A;  2DZM A;  4RMA A;  1S3S G;  2MP2 A;  4OVU A;  4W9H A;  1UZX B;  4GN1 A;  2KQS A;  1VCB A;  2K8B A;  4W9F A;  1U4A A;  3QC8 B;  4G11 A;  1WE7 A;  3H7S A;  5IAA C;  2N7D A;  1K8R B;  3HK0 A;  2KX0 A;  1NI2 A;  1GC7 A;  2R2O A;  5J2R A;  1V2Y A;  3V60 A;  2IO0 B;  4HJK A;  1RFA A;  2LJ5 A;  3VHT C;  4WQO B;  4TQ1 A;  4HDO A;  2FIF A;  2Z59 B;  3RZW C;  3VQI A;  1EF1 A;  1SGH A;  4EKU A;  5FR6 A;  4PS7 A;  2JRI B;  3PRM B;  3QQ8 B;  5DPT A;  3ONS A;  5E6P A;  1ISN A;  2KFK A;  2PJH A;  3VVW B;  2KDB A;  2KXJ A;  2UYZ B;  3M95 A;  2IO1 B;  4AOF A;  4DDI D;  3RD2 A;  1V81 A;  2FNJ B;  3ZNH B;  2IY0 B;  3JVZ X;  3MHS D;  4FUL A;  3L13 A;  2FCQ A;  2KFJ A;  4FN2 A;  4MH0 E;  4FA6 A;  4EEW A;  2K6D B;  2D07 B;  3RUL A;  2J7Q B;  3AUL A;  4IWP A;  1Z5S B;  1H4R A;  2KTF A;  1WX7 A;  2O6V B;  2UWQ A;  3ML8 A;  5JHA A;  3BY4 B;  1V5O A;  4RM9 A;  4WAA A;  4NAW B;  3NOB A;  2CHW A;  3DVG Y;  4AP4 C;  2LGD A;  2BYE A;  3BIN A;  4PS8 A;  5DPW A;  4BOZ B;  1UEL A;  2JPH A;  2R2Q A;  2C7M B;  4KSK C;  4KVG B;  4FAD A;  2MX2 A;  4EFO A;  1WY8 A;  4WJQ A;  1I42 A;  4JL9 A;  4CHK A;  2W9N A;  3LJ3 A;  3IBE A;  4W9E A;  3PLV A;  1WIA A;  2M0X A;  4MEL A;  4WWN A;  3UGB B;  2DYB A;  2KD0 A;  2KHW B;  2NVU I;  3LDZ E;  5KHQ A;  1WRD B;  2N9E B;  3GOE A;  3ZKJ C;  2G4D B;  4GXB A;  1YX5 B;  4IUM B;  4DXA B;  4J6I A;  1P9D U;  2MW5 A;  2J0K A;  3PRE A;  3B08 A;  2FCM A;  2Z0D B;  4GDL B;  3CMM B;  1E8W A;  4ICU A;  2KTR B;  1TBE A;  3IHP C;  2BKR B;  4E3C A;  1GUA B;  3RCZ A;  2JT4 B;  2WX0 A;  4HPL B;  1EO6 A;  2KC1 A;  4W9L A;  1RAX A;  3TMP B;  4MM3 A;  1ZW7 A;  2G45 B;  3A4R A;  3QHT A;  1X1M A;  3DBL I;  4LDT B;  3DVG X;  2M8S A;  4KDL B;  2K8C A;  2NBU A;  3A9K B;  1WR1 A;  2O2V A;  1J0G A;  3L16 A;  1V49 A;  3TBL D;  5TR5 A;  3H1U A;  4EUT A;  4K1R B;  2XK5 A;  4DWF A;  3DCG A;  1E8Z A;  2FCS A;  2WWZ A;  4JLC A;  3APC A;  3ML9 A;  2DZJ A;  4N9F 4;  3ENE A;  4MGI E;  2LGX A;  5CTR C;  4CYE A;  4ICV A; 
#chains in the Genus database with same CATH topology
 3WAL A;  2AQ2 B;  2AEH A;  3PTF C;  3AE6 B;  3TSS A;  3ZW3 A;  2GBR A;  2JWU A;  4K7U A;  4D2K A;  3AEF B;  2KDI A;  3U30 A;  4DHZ B;  1MPE A;  1I35 A;  3ZRC A;  2REX A;  2E3T A;  1ZPS A;  2IO2 B;  3ZGZ A;  3CIR B;  3SD5 A;  1HZ5 A;  2NMQ A;  1GG3 A;  5D2M B;  4DHJ D;  4WJP A;  1T0Q C;  2V3N A;  1EWC A;  4XGA B;  4ACF A;  3KUD B;  1L7Y A;  3T3O A;  2I2Y A;  1FXA A;  1CJE A;  3VH3 B;  2ZEQ A;  2MBH A;  2NTS A;  3R66 C;  3A9J B;  5H8Y E;  2WDR B;  2IND C;  3DWG C;  3M3J A;  4HXD A;  3KYC D;  2CR5 A;  4RGN A;  4E74 A;  1UF0 A;  2ACZ B;  3WAP A;  1SB3 C;  4A3O A;  2OHF A;  4WIP A;  2WX1 A;  1PGB A;  2NPT B;  4IWO A;  2LI5 A;  1J7C A;  2HDE A;  1XLP A;  4P6V F;  4KGS A;  4JPS A;  1FXI A;  1P98 A;  2JZP A;  1C3T A;  2GBK A;  4JWU C;  4BBN C;  3BWU D;  1LQB A;  2WXP A;  1SIF A;  1JAL A;  5C23 A;  3UF8 A;  1RLF A;  2CS4 A;  3PT2 B;  4ZRQ A;  1DOX A;  3PZ8 A;  3Q3O C;  2CJO A;  4W9I A;  4DHJ B;  1TYG B;  3HRD D;  2ZCB A;  5E6N A;  3NS8 A;  2D11 A;  4YTM B;  1WI0 A;  5LXI B;  1Q0W B;  3V6C B;  1WGY A;  3PVL A;  2C60 A;  3W5V B;  1WJ6 A;  5CHW A;  3N32 A;  3Q69 A;  2DYO A;  1ZKH A;  3GB1 A;  2KC2 A;  1WXM A;  3Q8E A;  1F2R C;  4GDK B;  1E8Y A;  1WMH A;  3O13 A;  2WLB A;  3V05 A;  5HKH A;  3GZN I;  5G2N A;  3U7Z A;  1B9R A;  4JWS C;  2KLG A;  5AUK A;  1WGH A;  3RZF A;  1WM3 A;  3TEX A;  4FLH A;  1WR6 E;  4F7Z A;  2D5G A;  1I4X A;  4US8 A;  4TQ0 A;  1YJJ A;  5E6O A;  2GBM A;  1I4P A;  4BOS C;  4ASW C;  5BMH A;  1OGW A;  2RPV A;  4AWJ A;  2JRH A;  2HJ1 A;  4IWQ A;  4MGK E;  2W55 A;  4P16 A;  3AEA B;  2OED A;  3DQV A;  3AV8 A;  1J7B A;  1IYF A;  1WGK A;  3DDC B;  3IVF A;  3Q2A C;  4BKT A;  2N9L A;  1L4Z B;  1EWY C;  1QOA A;  2O6V D;  3N1Y C;  1K52 A;  1L5P A;  3ZTD A;  2WXG A;  3PO0 A;  2EMT A;  3CWI A;  1ESF A;  3DVN V;  1QZE A;  1WYW B;  3SDL C;  1JQ4 A;  2PIA A;  3H7P A;  1YD8 U;  3ZYY X;  1NBF C;  2N0S B;  4B6W A;  5TSS A;  4M00 A;  1FFV A;  1T6B X;  2BKF A;  1UBQ A;  1SE4 A;  4NAW A;  2KJH B;  3KYD D;  1PQS A;  1EUV B;  1JWA D;  4O1N A;  3NS1 A;  2YVC A;  4ZHP A;  4ARC A;  1D6E C;  3N30 A;  1LM8 B;  2IGD A;  1VZ7 A;  4TSS A;  1IPG A;  4AJW A;  4LDT D;  1A5R A;  3K9O B;  2V4L A;  2IPK D;  2DYM A;  2AQ1 B;  2TSS A;  4EZK A;  3RPF C;  4P1C C;  1YN5 A;  4IW0 A;  1TTN A;  2WXO A;  2I38 A;  3NZ3 A;  4ZYS A;  3UIO B;  2VZK D;  4H2A A;  2KTR A;  1RFK A;  2L3Z A;  1VD2 A;  4NJ6 A;  3KQ4 A;  3U7D A;  4K3C A;  4EOY A;  2KWV B;  2QEJ C;  5BO4 B;  4HPM B;  4WAF A;  2LXA A;  1SEB D;  2L00 B;  3V62 A;  1CQV A;  5IA7 A;  2WDV B;  2XNA C;  3LXF A;  1HQR D;  4LTU A;  2WU2 B;  3C19 A;  2KFK B;  2LGS A;  2QCZ A;  3GZN B;  1I4H A;  2MWS B;  1HXY D;  2K6Q A;  5EDS A;  2C5L C;  3ZVV A;  2JU6 X;  1FMA D;  3RT3 B;  3IXS A;  2G9H D;  3DBH I;  1E5W A;  2D10 A;  2BYT A;  2LJI A;  4MSQ B;  3GE8 C;  1FM0 D;  1KLG D;  2JZZ A;  2KVZ A;  4MEM A;  1KTK A;  2L83 A;  1TGZ B;  1SSN A;  1YX6 B;  1KLV A;  4N58 A;  1OFF A;  3R2T A;  4KGT A;  1EF5 A;  4GB9 A;  1IGC A;  1FRR A;  4ZOH C;  1P1A A;  1M94 A;  4KIK A;  3D32 A;  4KSL C;  3ZJU A;  3V6E B;  4KZ0 A;  3V3X A;  5IKC M;  4ZRK A;  2M56 B;  3U52 E;  1Q5W B;  2L76 A;  3B2G A;  4K7W A;  3RNB C;  1GJZ A;  2PLP A;  5JXV A;  1FIQ A;  1VDV A;  2ONQ A;  1K50 A;  2RGF A;  3KUZ A;  3NVW A;  3Q8F A;  3FIL B;  5EE9 A;  5DPR A;  4DDG D;  2QC8 A;  3B1L X;  1P0R A;  1FXT B;  2WDT B;  2WXK A;  3ZLZ A;  4L2Y A;  2DZM A;  2MP2 A;  1VCB A;  1PUT A;  1PGX A;  1C4C A;  1WE7 A;  4WWM A;  1VRA B;  2R2O A;  5G5H A;  3E56 A;  4K3B A;  1V1P B;  2Y3A A;  1RFA A;  2KQ4 X;  1FNU A;  5FR6 A;  1D4B A;  4PS7 A;  2JRI B;  3PRM B;  5DPT A;  5E6P A;  3ONS A;  5C3J B;  2E6X A;  2IY0 B;  4FUL A;  2FE8 A;  2FCQ A;  4LNO A;  2KFJ A;  4MH0 E;  4FA6 A;  2PVO D;  2Z8L A;  3AUL A;  1Z5S B;  3FKY A;  3BY4 B;  2MJE A;  1V5O A;  4RM9 A;  4WAA A;  2PMV A;  2WGS A;  3BIN A;  1JWU D;  4BOZ B;  2C7M B;  3Q3N C;  2MX2 A;  4EFO A;  4WJQ A;  4JL9 A;  1XCQ L;  1WIA A;  5EE3 A;  3HVZ A;  4WWN A;  2KHW B;  5KHQ A;  1HTQ A;  2G4D B;  4GXB A;  4J6I A;  3E9S A;  2J0K A;  3Q8B A;  2FCM A;  2Z0D B;  4GDL B;  4B0E A;  1TBE A;  1F0Z A;  1GUA B;  3AE8 B;  4HRO A;  4HPL B;  3C8Y A;  4MM3 A;  3TMP B;  1ZW7 A;  2G45 B;  2M8S A;  2QJL A;  2Q5W D;  3A9K B;  2FUG 1;  1FCC C;  1VZ6 A;  5TR5 A;  4OZB A;  2XK5 A;  1CK1 A;  2FCS A;  3APC A;  3ENE A;  1IBX B;  4CYE A;  2D3A A;  4AUQ C;  4LNF A;  4N6E B;  4DK5 A;  1AWD A;  2N4F A;  4KZC A;  4RH6 A;  2MJD A;  1C9F A;  2XN9 C;  1OEY A;  4GLS C;  1SIJ A;  3NHE B;  4JX1 C;  1SE3 A;  2N9K A;  1E7V A;  2PEA A;  4W9J A;  4FHJ A;  2B3A A;  1YOV B;  3W1S A;  1MG8 A;  1ZUD 2;  2IJ0 A;  4EE2 A;  4AJY B;  2BPS A;  2UU7 A;  2BW2 A;  1V86 A;  1L0Y B;  4LJP B;  1IP9 A;  4OW0 A;  4BKS D;  1V80 A;  1YJI A;  4GU2 A;  2LMC A;  2J53 A;  1WGD A;  3EEC A;  3H6N A;  1JRU A;  2ZW0 A;  1FPY A;  3RNC C;  4NQK E;  2D3C A;  5DCN A;  2DAJ A;  4RGM A;  2LGI A;  1MJD A;  3RFZ B;  5CX3 A;  1P7E A;  4A55 A;  2LVQ A;  2I1K A;  4HLE A;  1JWB D;  2J42 A;  3K9P B;  1KOT A;  2K1F A;  4ZYN A;  3OWE B;  2DZI A;  1MVK A;  2KN4 A;  1YJ1 A;  1QQR A;  3SU8 X;  3VTU A;  3TEZ A;  4BZA A;  1QOG A;  3HM3 A;  1J7A A;  4LJO B;  2K0P A;  3ABV B;  5IN7 A;  5LLI A;  2L1A A;  3LB8 C;  4P1B C;  2BWE S;  3QWZ B;  3EC8 A;  4L1B A;  2FID A;  2OJW A;  2WXJ A;  3VR8 B;  1D5M C;  2WXM A;  2INC C;  3A1Q B;  1SBB B;  4GMV A;  1YIW A;  3IG3 A;  2ZW1 A;  4XDC A;  3P2B A;  3T9L A;  2IGG A;  4BAX A;  1ZXH A;  2JUO A;  2R61 A;  2ZJD A;  3Q14 C;  3MHZ A;  4XC2 A;  5AZG A;  1WGG A;  2JVC A;  2RPQ A;  3O65 B;  3VUY A;  4TV3 A;  4X57 B;  4NPN A;  1MI0 A;  1PFD A;  2KZR A;  2LUE A;  4MJS A;  3OLM D;  5L95 C;  3P4Q B;  1J19 A;  4IC7 B;  3KWV A;  4C80 A;  5BMG A;  1DGJ A;  3L4P A;  1EU3 A;  4AS1 A;  2WXL A;  2MBO A;  2EKE C;  2C7H A;  3PSE B;  3GE3 C;  2BBC A;  1E9M A;  1TS4 A;  2PTL A;  4KV2 A;  2JSV X;  2NBW B;  2ZNV C;  2QHO A;  1XD3 B;  1JRP A;  3U4E G;  1BUI C;  1ROE A;  2BQQ A;  3AU5 A;  5BYS A;  3C0R B;  3HIZ A;  3NUH B;  3SEB A;  1FNW A;  4RGT A;  4HCP B;  2N7E A;  3VXW A;  4EZL A;  2BGF A;  1QF6 A;  1ZDX A;  3WA0 A;  4C4V B;  2PVG C;  2MBQ A;  3OJ3 A;  3AI5 A;  2L32 A;  4A90 A;  2GI9 A;  2NPT A;  2BS4 B;  1N61 A;  1AN8 A;  2WS3 B;  3WAN A;  1FCL A;  2WXQ A;  1QT9 A;  3ZNZ B;  3AEB B;  4S0R A;  1HZ6 A;  4RFB A;  1FRD A;  2LEK A;  1JWS D;  1WH3 A;  1XO3 A;  2MJ3 A;  3BVG A;  4II3 B;  3Q8A A;  1SF0 A;  3ALB A;  2BYF A;  3IAM 1;  1KRH A;  4USA A;  3V61 A;  1WWT A;  2ZVO A;  1R7S A;  1GC6 A;  3R2I A;  5J18 A;  2KJ6 A;  3AN1 A;  3H9D A;  1WX8 A;  2HTH A;  2RDB C;  1Y8R C;  4W9G A;  3ZXV A;  2WXR A;  3ZJV A;  2QIL A;  2M4N A;  2HTM E;  2DBY A;  1ZXI A;  2D3G A;  1LGR A;  1NYR A;  2MSE D;  3I63 C;  3M62 B;  3NY5 A;  3AE4 B;  1TKY A;  2LAS A;  2ICI A;  4GDK A;  4HK2 A;  4YSY B;  4A20 A;  1WJN A;  1PGA A;  4Q2J A;  2JXX A;  1YQ3 B;  2KT7 A;  3ECI A;  3L0W B;  1WXV A;  1AW7 A;  4FJV B;  2BWF A;  1CMX B;  3WCQ A;  1F1H A;  2CKH B;  2JX5 A;  1K53 A;  2PE6 B;  3AE7 B;  4LK0 M;  2HJ8 A;  2L0T A;  3WIM A;  4YXD B;  1MG4 A;  4M02 A;  3UQA A;  3NJT A;  1WE6 A;  2LHD A;  4IDI A;  4C56 C;  2KLC A;  3PRP B;  4XWW A;  2KJR A;  5BMI A;  2CHX A;  4WQM A;  1G6J A;  1FEH A;  3MC0 B;  2JF5 A;  3I9V 1;  1NEN B;  1N5W A;  2L0F A;  1F2R I;  5IO9 A;  4EZJ A;  5JHB A;  2DWQ A;  3R7R A;  5HHD G;  3VTV A;  1FO4 A;  3R3M A;  4BVU C;  1XF5 L;  2DAF A;  3SHQ A;  3RNG C;  4M8N A;  4FBJ B;  4K7S A;  2WYQ A;  3CST A;  5HFY A;  1WXA A;  2SAK A;  2ZCC A;  1D5Z C;  2L7R A;  3KWL A;  1WZ0 A;  3PLU A;  1TS5 A;  5C2T B;  4WWP A;  4NQL B;  1TS2 A;  4A9A A;  1LXD A;  5FKA C;  1E7P B;  1S3S G;  4GN1 A;  4UDU C;  1U4A A;  3ETR A;  1WSP A;  3HK0 A;  2IO0 B;  2LJ5 A;  4WQO B;  3VQI A;  4EKU A;  1SGH A;  3QQ8 B;  1ISN A;  2KFK A;  4LNK A;  1NI3 A;  2PJH A;  2YEP B;  1T0S C;  4LNI A;  1QIL A;  3RD2 A;  3ZNH B;  3MHS D;  4ZRP A;  3I57 A;  1YQ4 B;  2KAC A;  2K6D B;  3RUL A;  1GAQ B;  1H4R A;  1YN4 A;  1WX7 A;  2O6V B;  2UWQ A;  3EGR A;  3W2D A;  3OG5 A;  1L0V B;  4NAW B;  4C7Y A;  3NOB A;  1C4A A;  5IP4 D;  2JPH A;  4KVG B;  4FAD A;  1F52 A;  4KGR A;  2W9N A;  3LJ3 A;  3PLV A;  2K5P A;  4MEL A;  2DYB A;  3MP9 A;  3SR6 A;  3LDZ E;  2N9E B;  3FC4 A;  3ZKJ C;  4A6Q A;  4IUM B;  2V9H A;  1P9D U;  4KX6 B;  1T5X D;  3CMM B;  3Q6B A;  4ICU A;  2KTR B;  3IHP C;  2BKR B;  1HEZ E;  1KH0 A;  4M0W A;  2KC1 A;  3QHT A;  4LDT B;  3RNA C;  2NBU A;  1WR1 A;  2O2V A;  2RMM A;  1DOI A;  3DCG A;  2VZK B;  4JLC A;  3TEW A;  4N9F 4;  4MGI E;  5CTR C;  4F8C B;  3FIL A;  3Q3F A;  1JW9 D;  2CHZ A;  1ACC A;  2MBE A;  2WU5 B;  3NZS A;  2IBI B;  3A33 B;  3S2A A;  1GNU A;  3ZJT A;  3GP7 A;  4ITK A;  1TZ1 A;  4GIV A;  4ANV A;  1T0R C;  3VFK A;  4OVZ A;  4WWO A;  4PYZ A;  4RF1 A;  3RNF C;  4NAM A;  3AE2 B;  3DWM A;  4F1S A;  1AAR A;  4PT5 A;  1VLB A;  4C7Z A;  2OOB B;  1E10 A;  1STE A;  1JRO A;  2WXN A;  3W1S C;  3DOW A;  3MTN B;  3P4S B;  3BZD B;  2WHI A;  2IDY A;  4DBG A;  1NVI D;  3ZTC A;  3EHV A;  3UIP B;  1V9J A;  4N59 A;  4NJ7 A;  2LWP A;  4MGZ E;  2K8H A;  3DBR I;  1HTO A;  1C76 A;  5T8I A;  3BYT B;  1E0Z A;  4WH4 A;  2AYO B;  2FUH B;  2LZ6 A;  2FCN A;  1UH6 A;  2LXC A;  3JSV B;  2ASQ A;  5C1Z A;  4KKI A;  1KFY B;  1ZGU B;  3RMK C;  5D6J B;  1QOB A;  4YSZ B;  2IGH A;  1IGD A;  3PGE A;  3TUO A;  4GDL A;  3DBH B;  3TIX A;  1WZ3 A;  5G55 A;  4B95 A;  1UGM A;  1E7U A;  1VR9 A;  1Z2M A;  3UQB A;  1EM7 A;  2AX5 A;  2QDF A;  2ZVN A;  3A9K A;  2GBJ A;  3A4S C;  4WJO A;  1YN3 A;  4MGY E;  2XEW A;  5EE1 A;  2K25 A;  2WDQ B;  3QK0 A;  1R4N I;  5FR3 A;  3PHW B;  3ZIM A;  2ZPN A;  1A70 A;  1IBX A;  3IT6 B;  4HWI B;  5AZF A;  2V3S A;  3DBS A;  2PE9 A;  2YEP F;  1WFY A;  5CHV C;  4XDD A;  4PS3 A;  1E90 A;  3BVM A;  3AMZ A;  1ZOY B;  4BBN F;  3RUI B;  1ET6 A;  2LHE A;  4ANU A;  4FJZ A;  3VRA B;  4IG7 B;  3RNE C;  3TEY A;  1UWX A;  1ZDV A;  3ZO5 B;  3CSF A;  3QJZ A;  3PPA A;  1UUP A;  2KX3 A;  3JYU A;  1PYW D;  2IZV B;  3IAS 1;  3NVV A;  1LFD A;  4LLG M;  1FFU A;  3PRZ A;  5IOI A;  4HKZ E;  1WF9 A;  1KLU D;  1R4M I;  1JCK B;  1OQY A;  3OAW A;  4MM3 B;  4DHZ E;  2V0G A;  4OVV A;  1QLB B;  1TKG A;  1XCT L;  2JQR B;  1N63 A;  1L2N A;  2XK5 B;  4I6P A;  1KJT A;  2NCN A;  2CU3 A;  3IFW B;  4ANW A;  2MQJ A;  4RM8 A;  1RRB A;  1MHX A;  3R7Q A;  4PK1 A;  3M63 B;  2A5U A;  3OJ4 B;  2MHJ A;  2KMC A;  3B0A A;  2G4S A;  3NRZ A;  2BB5 A;  2N1W A;  1P3Q U;  3J9C A;  3KVF B;  2BTE A;  2WNM A;  3TCA A;  1WX9 A;  1AYF A;  4BKS A;  3A1Q A;  3GS2 A;  2WP9 B;  4XX5 A;  1KM7 A;  2PKO A;  4FXC A;  4G3X B;  1WJU A;  4NY0 A;  2M17 A;  4XE0 A;  3KW5 B;  2KNB A;  2I1J A;  2X8X X;  1GB1 A;  1YNT E;  1R4N B;  1EU4 A;  1D3Z A;  2AL3 A;  4RGO S;  4HVB A;  3MFG A;  5BYR A;  3B2F A;  4GSW A;  4ANX A;  2DZK A;  2AWT A;  3QCA A;  3W1Y A;  2IY1 B;  4R3D A;  2G1E A;  4XZ4 A;  2D3B A;  1UBI A;  2DNF A;  5JZE B;  3P4P B;  3TJP A;  4IOI E;  5EE0 A;  1UWM A;  3URY A;  2CJN A;  2IYD B;  3DPD A;  3LYY A;  2KKC A;  4GGQ A;  3EA6 A;  1UGJ A;  2LFI A;  3NVZ A;  3Q8C A;  1C78 A;  4FJY A;  4I6N B;  4I6L B;  2NTT A;  2N1V A;  2Z0E B;  3Q3J A;  2X38 A;  4MSM B;  2CU1 A;  1GOZ A;  3WAO A;  1R4M B;  2MRP A;  4C4V A;  4M8M A;  2FAZ A;  2KQ7 A;  1HE8 A;  2DEN B;  1XXG A;  4RCO A;  3DHH C;  4HCN B;  3A9J A;  4QAY A;  1I7H A;  2L8J A;  1TS3 A;  2RDG A;  3H8H A;  2Y5C A;  3HUI A;  3MJW A;  3EFU A;  2PPH A;  2SEB D;  4HKQ A;  1L4D B;  4MDK E;  4MJS B;  2EEL A;  3L17 A;  4HJG E;  5GMV A;  1BT0 A;  4YWG G;  2Y5B B;  1V1O A;  3DVN U;  3ZNG C;  2XBB C;  3AXC A;  3U8Z A;  3W5U B;  4URK A;  2K39 A;  3RI7 C;  2JYE A;  2W3R A;  2BVC A;  1SXT A;  4DQO C;  3ZNI D;  3W9C B;  1SJE D;  4RMA A;  4W9H A;  1UZX B;  2KQS A;  2VH1 A;  4W9F A;  4G11 A;  5IAA C;  2KDM A;  2N7D A;  1K8R B;  2KX0 A;  1NI2 A;  4NJC A;  5J2R A;  3R8B A;  4HJK A;  1TT5 B;  4TQ1 A;  1TY2 A;  4HDO A;  1C77 A;  2WXH A;  2WXI A;  3N1Z C;  3VVW B;  4DXF A;  4AOF A;  3M95 A;  2IO1 B;  3UI3 A;  3AE9 B;  3JVZ X;  1WRI A;  4FN2 A;  2GLS A;  1RWS A;  3MJ5 A;  4EEW A;  2D07 B;  2J7Q B;  2J4X A;  4ZHO A;  2KTF A;  2M0A A;  3ML8 A;  5JHA A;  1N62 A;  2CHW A;  3DVG Y;  1Q10 A;  1GB4 A;  3BK1 A;  2QIE B;  2R2Q A;  4RF0 A;  2L52 A;  3ZXR A;  1WY8 A;  2Y5P A;  2B76 B;  1I42 A;  3IBE A;  4CQN A;  1PDX A;  2KD0 A;  2NVU I;  3KLS X;  1YX5 B;  4DXA B;  4B0M A;  2MW5 A;  5MPO A;  3B08 A;  2KWD A;  1E8W A;  2PW9 A;  4YTN B;  1X1M A;  3DBL I;  4KDL B;  3DHG C;  3AM9 A;  1IUE A;  3H1U A;  4K1R B;  2INP E;  3AEC B;  2WWZ A;  3ML9 A;  5GXG B;  1UNS A;  2INN E;  1B1Z A;  4K81 A;  1NEK B;  5HI1 A;  5KHO A;  4A3P A;  2KAN A;  2LD9 A;  2ZNV B;  1WMH B;  5BYQ A;  1LO5 D;  1XT9 B;  1YQB A;  4XYC A;  2A4Z A;  1NYQ A;  2LUM A;  1N6Z A;  3P63 A;  1WXQ A;  3AED B;  3SFE B;  1V5T A;  2H88 B;  3APD A;  3MC9 A;  2BF8 B;  1WYG A;  3HVD A;  4ZRJ A;  1C79 A;  1K51 A;  3X0W A;  5D7G A;  1I4R A;  4US9 A;  1V6E A;  3NZU A;  2NR2 A;  4JQW C;  1XLQ A;  5G5G A;  2IO3 B;  2K3U A;  2HD5 B;  2MA9 B;  2JWZ A;  2AQ3 B;  2RR9 A;  4ZDV A;  4CO7 A;  3QAQ A;  3PZ7 A;  1QKZ A;  1E6E B;  2O6V A;  3IT4 B;  4MAC A;  2MBB B;  5H92 C;  3AEG B;  2V1Y A;  3JW0 X;  2K22 A;  3H7P B;  4A8X C;  1KF6 B;  3N1X C;  3ZQ4 A;  1V97 A;  1ENF A;  1UD7 A;  1S1Q B;  2KDE B;  1DYQ A;  2MEK A;  1VZ8 A;  2GB1 A;  4OHJ A;  3DHI C;  3B9J A;  1N5X A;  2LVO A;  1VJK A;  2WQY B;  3QX1 A;  3PZD A;  1XLO A;  3QAR A;  5LNK 1;  5DPS A;  3P4R B;  3EUB 2;  3BK2 A;  1P7F A;  2NS5 A;  4JGH B;  2N9X A;  3T3N A;  3ZRF A;  3DBL B;  2MCN B;  1BML C;  3N3K B;  4HPP A;  3AE3 B;  3KUC B;  3TL5 A;  1TKE A;  2N9P C;  2NBV B;  4WJN A;  2DHZ A;  1RM6 C;  1N60 A;  3BVZ A;  3VDZ A;  5AZH A;  4IM2 A;  2J0M A;  3NVY A;  3BII D;  1OQR A;  2KYW A;  2M1M A;  3RYT A;  1T0Y A;  4J3O D;  3QA8 A;  2BYV E;  2M19 A;  2DX5 B;  5J17 A;  1TY0 A;  2KN5 A;  3AE1 B;  1WGR A;  1JML A;  1XLN A;  2FBW B;  4PYU A;  5AUI A;  3VR9 B;  1F9J A;  1WXS A;  1MFW A;  2BS2 B;  1WJ4 A;  2V3P A;  3VTW A;  4YT0 B;  3FAH A;  2DLB A;  3VUX A;  4M0W B;  1V1P A;  1C4P A;  1H8C A;  2O2V B;  2GRI A;  2QSD A;  3ZDT A;  1F77 A;  2KK8 A;  1L6U A;  2KWC A;  1DOY A;  3JSV A;  4KIK B;  4YL8 A;  1SJH D;  2J52 A;  4C00 A;  2JZ3 B;  2VH2 A;  4W9D A;  2BS3 B;  4LNN A;  3VAW A;  3QIJ A;  2C9W B;  1D5X C;  4HRS A;  5LXH A;  1I4G A;  4S17 A;  5AEK B;  3L54 A;  5CHF A;  2L05 A;  2RD0 A;  3X23 A;  2QMT A;  4MH8 A;  2RSU A;  3N9Y C;  1L6V A;  4W9C A;  4TUU A;  5HG2 A;  3L10 B;  1XQQ A;  2J0J A;  2LRW A;  4NZL B;  2LRU A;  4P7I A;  2K9X A;  4L23 A;  1Q1O A;  3NG0 A;  2MP2 B;  2KO3 A;  3T8M A;  1WM2 A;  4OZA A;  3PS6 A;  1NDD A;  1ZE3 D;  1HA5 A;  1ET9 A;  4RNA A;  1SE2 A;  4FHK A;  4YTP B;  3RN9 C;  3AU4 A;  3VRB B;  3CF6 E;  4II2 B;  4B9K A;  3UIN B;  1J8C A;  3I3T B;  4GOC A;  2KWU B;  4IKG A;  4G0N B;  3PHX B;  3EFC A;  3BYY B;  4OZC A;  3ZDM C;  5L83 A;  2KOX A;  1TZO A;  3APF A;  3VH4 B;  5I4D A;  4LCD E;  4HDQ A;  4NNJ B;  2D2Q A;  2MH7 A;  2EKI A;  1T3Q A;  1SE9 A;  4IM3 A;  4W9K A;  2GOW A;  4ZRI A;  2AL6 A;  2ZPY A;  4WUR A;  5D3I B;  4HEA 1;  4JIO U;  4TKN A;  1Y56 A;  2HE7 A;  4JE3 B;  3MC8 A;  1ZP0 B;  2GMI C;  2EMS A;  2VRR B;  2C7N B;  3KH0 A;  3VUW A;  4IM0 A;  1MHH E;  4BKG A;  2GBN A;  2V4I B;  4AQ7 A;  2LGY A;  3HM6 X;  1E8X A;  2H89 B;  5D94 A;  1OTR B;  4E71 A;  2KMA A;  2G3Q B;  1QOF A;  3Q3M C;  2KVR A;  4XWT A;  1C1Y B;  4BFR A;  4ARI A;  1TIF A;  2YLM A;  2KDF B;  3P42 A;  2JY6 A;  4G50 A;  2ZZP B;  3DBR B;  3PV1 A;  3HHM A;  3I5J C;  1V8C A;  2BT6 A;  3ZUN A;  2OJR A;  2MLB A;  2W82 A;  2LVP A;  1OEY J;  3WAM A;  4KKJ A;  1I4Q A;  3L08 A;  1TJE A;  5FK9 C;  1M4V A;  5JH5 C;  4KDI C;  1JWM D;  1RYJ A;  3AB5 A;  4OVU A;  1XEE A;  1OQQ A;  2K8B A;  1L0X B;  3QC8 B;  2KMM A;  3H7S A;  1GC7 A;  1V2Y A;  3V60 A;  3VHT C;  5D3D A;  2ON8 A;  2FIF A;  2Z59 B;  3N20 C;  3RZW C;  1EF1 A;  2KAJ A;  4M01 A;  2W54 A;  3U2S C;  4TMA B;  2KDB A;  2KXJ A;  2UYZ B;  4DDI D;  1V81 A;  2FNJ B;  3L13 A;  4MT5 A;  4IWP A;  2N7J A;  2JYT A;  4REZ A;  3AEE B;  1FD6 A;  5E6J A;  3AH7 A;  4AP4 C;  2LGD A;  3AE5 B;  2BYE A;  1BXT A;  4PS8 A;  4YSX B;  5DPW A;  1UEL A;  4KSK C;  1YMH E;  2JXT A;  4CHK A;  2BB6 A;  4W9E A;  1GPX A;  1FNV A;  2M0X A;  3UGB B;  4DXG A;  2W3S A;  1WRD B;  3GOE A;  2WXF A;  3PRE A;  2RDH A;  3P1M A;  4E3C A;  3RCZ A;  2JT4 B;  2WX0 A;  1EO6 A;  4W9L A;  1RAX A;  3A4R A;  3DVG X;  2K8C A;  1J0G A;  3L16 A;  1V49 A;  3TBL D;  4EUT A;  4DWF A;  1E8Z A;  1CZP A;  2DZJ A;  2LGX A;  3SFD B;  4ICV A; 
#chains in the Genus database with same CATH homology
 3WAL A;  4AUQ C;  3Q3F A;  4K81 A;  2AEH A;  4DK5 A;  2CHZ A;  2N4F A;  2MBE A;  3NZS A;  4KZC A;  2IBI B;  3PTF C;  3ZW3 A;  1OEY A;  2GBR A;  5KHO A;  4K7U A;  4A3P A;  2KAN A;  2LD9 A;  3A33 B;  2ZNV B;  2KDI A;  3NHE B;  3U30 A;  4DHZ B;  1WMH B;  3S2A A;  1I35 A;  3ZRC A;  1GNU A;  2REX A;  1E7V A;  2PEA A;  4W9J A;  4FHJ A;  2B3A A;  1XT9 B;  3W1S A;  1YQB A;  1MG8 A;  1TZ1 A;  2IO2 B;  4GIV A;  3SD5 A;  4AJY B;  2A4Z A;  4ANV A;  2BPS A;  1V86 A;  4LJP B;  3VFK A;  1IP9 A;  1GG3 A;  4WWO A;  4PYZ A;  5D2M B;  4BKS D;  1V80 A;  4DHJ D;  4GU2 A;  4WJP A;  1V5T A;  3APD A;  4F1S A;  1AAR A;  1WGD A;  2BF8 B;  3EEC A;  3H6N A;  1JRU A;  3KUD B;  2OOB B;  1L7Y A;  4NQK E;  4ZRJ A;  5DCN A;  3X0W A;  5D7G A;  3VH3 B;  2ZEQ A;  2MBH A;  2DAJ A;  3R66 C;  3W1S C;  3A9J B;  1V6E A;  3NZU A;  2NR2 A;  3DOW A;  3MTN B;  4JQW C;  2IO3 B;  3M3J A;  2HD5 B;  2MA9 B;  4HXD A;  3KYC D;  2JWZ A;  5CX3 A;  2CR5 A;  4E74 A;  2RR9 A;  4ZDV A;  3WAP A;  3ZTC A;  4DBG A;  2LVQ A;  2I1K A;  4CO7 A;  3QAQ A;  3EHV A;  3UIP B;  4HLE A;  4A3O A;  1V9J A;  4NJ7 A;  2LWP A;  2O6V A;  4MGZ E;  3K9P B;  2K8H A;  2K1F A;  1KOT A;  3DBR I;  2WX1 A;  2MBB B;  4ZYN A;  2DZI A;  1YJ1 A;  2NPT B;  2AYO B;  2V1Y A;  2FUH B;  2LZ6 A;  4IWO A;  2FCN A;  1UH6 A;  2LXC A;  3JSV B;  2LI5 A;  3JW0 X;  3SU8 X;  2ASQ A;  3H7P B;  3VTU A;  5C1Z A;  3HM3 A;  4LJO B;  1P98 A;  1UD7 A;  1S1Q B;  1ZGU B;  2KDE B;  1C3T A;  5D6J B;  2GBK A;  4BBN C;  5LLI A;  1LQB A;  1SIF A;  5C23 A;  2BWE S;  3QWZ B;  3PGE A;  3EC8 A;  4GDL A;  2LVO A;  3UF8 A;  3TIX A;  1RLF A;  1WZ3 A;  2CS4 A;  3PT2 B;  5G55 A;  2FID A;  3QX1 A;  3PZD A;  4B95 A;  1UGM A;  1E7U A;  3QAR A;  5DPS A;  4W9I A;  4DHJ B;  1Z2M A;  3UQB A;  3A1Q B;  2NS5 A;  2ZVN A;  3A9K A;  2N9X A;  4JGH B;  2GBJ A;  3A4S C;  4GMV A;  4WJO A;  1YIW A;  3IG3 A;  3ZRF A;  4MGY E;  2ZCB A;  2MCN B;  3N3K B;  5E6N A;  2XEW A;  3NS8 A;  2K25 A;  3QK0 A;  1R4N I;  3P2B A;  2D11 A;  3PHW B;  3ZIM A;  3T9L A;  2ZPN A;  1WI0 A;  3KUC B;  2JUO A;  2ZJD A;  3TL5 A;  5LXI B;  1Q0W B;  4XC2 A;  1WGY A;  2N9P C;  4HWI B;  3V6C B;  3PVL A;  2C60 A;  1WGG A;  5AZG A;  5AZF A;  2NBV B;  4WJN A;  1WJ6 A;  2V3S A;  2PE9 A;  2DHZ A;  3DBS A;  3N32 A;  2DYO A;  5CHW A;  1ZKH A;  2KC2 A;  1WXM A;  2JVC A;  2RPQ A;  3O65 B;  1WFY A;  5CHV C;  3VUY A;  4TV3 A;  4X57 B;  4GDK B;  1E8Y A;  3VDZ A;  5AZH A;  4NPN A;  4PS3 A;  1WMH A;  4IM2 A;  2LUE A;  2KZR A;  2J0M A;  4MJS A;  3OLM D;  5L95 C;  1E90 A;  1J19 A;  5HKH A;  3GZN I;  5G2N A;  4BBN F;  4IC7 B;  3RUI B;  2M1M A;  3RYT A;  1T0Y A;  4ANU A;  4FJZ A;  3QA8 A;  2BYV E;  2DX5 B;  4IG7 B;  5J17 A;  2MBO A;  2EKE C;  2KN5 A;  2KLG A;  2C7H A;  3PSE B;  1WGR A;  1WGH A;  3RZF A;  1WM3 A;  3ZO5 B;  3CSF A;  3QJZ A;  4KV2 A;  3PPA A;  4PYU A;  4FLH A;  1WR6 E;  4F7Z A;  2KX3 A;  3JYU A;  4TQ0 A;  2NBW B;  2ZNV C;  2GBM A;  5E6O A;  1F9J A;  1WXS A;  2IZV B;  2QHO A;  1XD3 B;  4BOS C;  4ASW C;  1LFD A;  1OGW A;  1WJ4 A;  4AWJ A;  2JRH A;  3PRZ A;  3AU5 A;  3VTW A;  4IWQ A;  4MGK E;  3C0R B;  3HIZ A;  1WF9 A;  3VUX A;  1R4M I;  4M0W B;  1OQY A;  3DQV A;  3OAW A;  4HCP B;  4DHZ E;  1IYF A;  2N7E A;  3DDC B;  3IVF A;  3VXW A;  4BKT A;  4EZL A;  1H8C A;  2BGF A;  2O2V B;  4OVV A;  2O6V D;  3WA0 A;  3ZTD A;  2MBQ A;  3ZDT A;  2KK8 A;  3OJ3 A;  1L2N A;  3AI5 A;  2XK5 B;  2EMT A;  2NPT A;  4I6P A;  3DVN V;  1QZE A;  2KWC A;  1WYW B;  3SDL C;  1KJT A;  3JSV A;  2NCN A;  3IFW B;  4KIK B;  3WAN A;  3H7P A;  4YL8 A;  4ANW A;  3ZNZ B;  1YD8 U;  1NBF C;  2MQJ A;  4RM8 A;  2JZ3 B;  1RRB A;  4W9D A;  3R7Q A;  4B6W A;  1WH3 A;  3M63 B;  2A5U A;  3VAW A;  3OJ4 B;  2C9W B;  3QIJ A;  4II3 B;  5LXH A;  2KMC A;  2BKF A;  3ALB A;  2G4S A;  3B0A A;  1UBQ A;  5AEK B;  2BYF A;  2N1W A;  1P3Q U;  4NAW A;  2KJH B;  3KYD D;  1PQS A;  3KVF B;  3L54 A;  5CHF A;  1EUV B;  2L05 A;  2RD0 A;  3V61 A;  2ZVO A;  3TCA A;  3X23 A;  1GC6 A;  2RSU A;  1WX9 A;  5J18 A;  2YVC A;  4BKS A;  4W9C A;  4TUU A;  3N30 A;  1LM8 B;  2KJ6 A;  3L10 B;  1XQQ A;  2J0J A;  3A1Q A;  3H9D A;  2LRW A;  4XX5 A;  1KM7 A;  1IPG A;  4AJW A;  4LDT D;  4G3X B;  1A5R A;  3K9O B;  2HTH A;  1WX8 A;  2LRU A;  1Y8R C;  2V4L A;  4W9G A;  2DYM A;  1WJU A;  4NY0 A;  4P7I A;  2M17 A;  1Q1O A;  4EZK A;  3KW5 B;  4IW0 A;  1TTN A;  2M4N A;  2MP2 B;  2KNB A;  2KO3 A;  3T8M A;  1WM2 A;  2I1J A;  3UIO B;  2D3G A;  2KTR A;  3PS6 A;  1NDD A;  2AL3 A;  1D3Z A;  2L3Z A;  1VD2 A;  2MSE D;  4FHK A;  4NJ6 A;  3U7D A;  4HVB A;  3M62 B;  3AU4 A;  3NY5 A;  4EOY A;  2KWV B;  2LAS A;  3CF6 E;  4II2 B;  5BO4 B;  4B9K A;  3UIN B;  4GDK A;  4GSW A;  4HK2 A;  4HPM B;  4ANX A;  1J8C A;  3I3T B;  4GOC A;  2DZK A;  2LXA A;  2AWT A;  2L00 B;  3QCA A;  3V62 A;  4A20 A;  3W1Y A;  5IA7 A;  1WJN A;  2IY1 B;  4XZ4 A;  2JXX A;  2KFK B;  2KWU B;  1UBI A;  5JZE B;  3ECI A;  4G0N B;  3PHX B;  3L0W B;  3TJP A;  2MWS B;  3ZDM C;  1WXV A;  5L83 A;  2KOX A;  3APF A;  3VH4 B;  4FJV B;  2BWF A;  2IYD B;  4HDQ A;  2K6Q A;  4LCD E;  4NNJ B;  2C5L C;  5EDS A;  2D2Q A;  1CMX B;  3ZVV A;  3DPD A;  3RT3 B;  2CKH B;  2KKC A;  4GGQ A;  1SE9 A;  4IM3 A;  2PE6 B;  3DBH I;  4W9K A;  2GOW A;  1E5W A;  2HJ8 A;  4FJY A;  4ZRI A;  2AL6 A;  2D10 A;  2L0T A;  3WIM A;  2ZPY A;  4JIO U;  4TKN A;  4I6N B;  4I6L B;  4MSQ B;  2N1V A;  3UQA A;  2HE7 A;  2GMI C;  1WE6 A;  2Z0E B;  3Q3J A;  2JZZ A;  2EMS A;  4MEM A;  2VRR B;  2C7N B;  1TGZ B;  4MSM B;  2CU1 A;  3KH0 A;  1YX6 B;  3VUW A;  2KLC A;  3WAO A;  4IM0 A;  1KLV A;  3PRP B;  2MRP A;  2KJR A;  4BKG A;  2GBN A;  2CHX A;  2FAZ A;  4M8M A;  1G6J A;  2KQ7 A;  1HE8 A;  1EF5 A;  2DEN B;  4GB9 A;  2LGY A;  3HM6 X;  4F8C B;  4HCN B;  2JF5 A;  1E8X A;  3A9J A;  5D94 A;  1P1A A;  1M94 A;  4KIK A;  1OTR B;  2L0F A;  4E71 A;  2KMA A;  2L8J A;  4EZJ A;  2G3Q B;  3D32 A;  4KSL C;  3V6E B;  2KVR A;  5JHB A;  3R7R A;  1C1Y B;  4BFR A;  4KZ0 A;  3VTV A;  2YLM A;  2KDF B;  4ZRK A;  3R3M A;  2JY6 A;  3MJW A;  4BVU C;  3EFU A;  2PPH A;  1Q5W B;  2DAF A;  2L76 A;  4MDK E;  4MJS B;  3SHQ A;  4K7W A;  1GJZ A;  4M8N A;  4FBJ B;  4K7S A;  2WYQ A;  2ZZP B;  3CST A;  3PV1 A;  4G50 A;  3L17 A;  3HHM A;  1WXA A;  3ZUN A;  2OJR A;  5GMV A;  1BT0 A;  2MLB A;  2RGF A;  2LVP A;  1OEY J;  2Y5B B;  3KUZ A;  3WAM A;  3DVN U;  2ZCC A;  3ZNG C;  2XBB C;  5DPR A;  4DDG D;  2L7R A;  3L08 A;  3B1L X;  3AXC A;  3U8Z A;  4URK A;  1WZ0 A;  1P0R A;  3PLU A;  1FXT B;  2K39 A;  4WWP A;  2WDT B;  4NQL B;  5JH5 C;  3ZLZ A;  4KDI C;  3ZNI D;  1LXD A;  2DZM A;  4RMA A;  1S3S G;  2MP2 A;  4OVU A;  4W9H A;  1UZX B;  4GN1 A;  2KQS A;  1VCB A;  2K8B A;  4W9F A;  1U4A A;  3QC8 B;  4G11 A;  1WE7 A;  3H7S A;  5IAA C;  2N7D A;  1K8R B;  3HK0 A;  2KX0 A;  1NI2 A;  1GC7 A;  2R2O A;  5J2R A;  1V2Y A;  3V60 A;  2IO0 B;  4HJK A;  1RFA A;  2LJ5 A;  3VHT C;  4WQO B;  4TQ1 A;  4HDO A;  2FIF A;  2Z59 B;  3RZW C;  3VQI A;  1EF1 A;  1SGH A;  4EKU A;  5FR6 A;  4PS7 A;  2JRI B;  3PRM B;  3QQ8 B;  5DPT A;  3ONS A;  5E6P A;  1ISN A;  2KFK A;  2PJH A;  3VVW B;  2KDB A;  2KXJ A;  2UYZ B;  3M95 A;  2IO1 B;  4AOF A;  4DDI D;  3RD2 A;  1V81 A;  2FNJ B;  3ZNH B;  2IY0 B;  3JVZ X;  3MHS D;  4FUL A;  3L13 A;  2FCQ A;  2KFJ A;  4FN2 A;  4MH0 E;  4FA6 A;  4EEW A;  2K6D B;  2D07 B;  3RUL A;  2J7Q B;  3AUL A;  4IWP A;  1Z5S B;  1H4R A;  2KTF A;  1WX7 A;  2O6V B;  2UWQ A;  3ML8 A;  5JHA A;  3BY4 B;  1V5O A;  4RM9 A;  4WAA A;  4NAW B;  3NOB A;  2CHW A;  3DVG Y;  4AP4 C;  2LGD A;  2BYE A;  3BIN A;  4PS8 A;  5DPW A;  4BOZ B;  1UEL A;  2JPH A;  2R2Q A;  2C7M B;  4KSK C;  4KVG B;  4FAD A;  2MX2 A;  4EFO A;  1WY8 A;  4WJQ A;  1I42 A;  4JL9 A;  4CHK A;  2W9N A;  3LJ3 A;  3IBE A;  4W9E A;  3PLV A;  1WIA A;  2M0X A;  4MEL A;  4WWN A;  3UGB B;  2DYB A;  2KD0 A;  2KHW B;  2NVU I;  3LDZ E;  5KHQ A;  1WRD B;  2N9E B;  3GOE A;  3ZKJ C;  2G4D B;  4GXB A;  1YX5 B;  4IUM B;  4DXA B;  4J6I A;  1P9D U;  2MW5 A;  2J0K A;  3PRE A;  3B08 A;  2FCM A;  2Z0D B;  4GDL B;  3CMM B;  1E8W A;  4ICU A;  2KTR B;  1TBE A;  3IHP C;  2BKR B;  4E3C A;  1GUA B;  3RCZ A;  2JT4 B;  2WX0 A;  4HPL B;  1EO6 A;  2KC1 A;  4W9L A;  1RAX A;  3TMP B;  4MM3 A;  1ZW7 A;  2G45 B;  3A4R A;  3QHT A;  1X1M A;  3DBL I;  4LDT B;  3DVG X;  2M8S A;  4KDL B;  2K8C A;  2NBU A;  3A9K B;  1WR1 A;  2O2V A;  1J0G A;  3L16 A;  1V49 A;  3TBL D;  5TR5 A;  3H1U A;  4EUT A;  4K1R B;  2XK5 A;  4DWF A;  3DCG A;  1E8Z A;  2FCS A;  2WWZ A;  4JLC A;  3APC A;  3ML9 A;  2DZJ A;  4N9F 4;  3ENE A;  4MGI E;  2LGX A;  5CTR C;  4CYE A;  4ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...