2L76A

Solution nmr structure of human nfatc2ip ubiquitin-like domain, nfatc2ip_244_338, nesg target ht65a/ocsp target hs00387_244_338/sgc-toronto
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
QGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NFATC2-interacting protein
publication title Human NFATC2IP ubiquitin-like domains
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l76A00
3PHXB 4BVUC 3ENEA 3K9OB 3DBLI 4DHZB 3JSVB 1L2NA 3JSVA 3ZLZA 3IHPC 2MA9B 3TCAA 3ZTDA 2O6VB 2O6VA 3KVFB 2REXA 4W9JA 4IWPA 2B3AA 4X57B 2AL3A 3ECIA 5TR5A 4GXBA 4XX5A 2BWES 1WI0A 1WXSA 2FNJB 2IZVB 3NY5A 2KTRB 3R7RA 4CYEA 3AULA 2JZ3B 1WX7A 1UZXB 4URKA 1WX8A 2BYVE 2BKRB 1H4RA 2PJHA 2JVCA 5KHOA 4OVUA 5JHBA 2J0MA 1NBFC 3W1YA 3VUYA 2ZJDA 2KN5A 3VUWA 1WJ4A 2Z0EB 2MX2A 1V2YA 3EC8A 4GIVA 1XQQA 5J18A 2LZ6A 3L13A 3KYDD 1WGYA 2FCNA 4M0WB 3ZNHB 2M4NA 5JH5C 2GBKA 4WQOB 1Z5SB 2G4SA 2IO2B 4BKGA 5CHWA 4ICUA 1WJUA 2CS4A 4A3OA 2LRWA 4PS3A 3ZTCA 4W9HA 3KYCD 2KC2A 2LXAA 2J7QB 2CKHB 3EHVA 3EECA 1TTNA 4GMVA 2JT4B 1Q5WB 4GB9A 2AWTA 3QIJA 3APCA 3L10B 3IG3A 4NQLB 4XZ4A 1OGWA 5BO4B 4GGQA 1E7UA 1UGMA 3PRPB 4MJSA 2LGDA 2MBHA 3DBRI 4EZKA 2JPHA 4RMAA 4IWOA 4W9KA 5GMVA 2DZJA 3A1QB 1P3QU 5L83A 1WJ6A 2IY0B 1GJZA 3DOWA 3TIXA 2K8CA 4DWFA 4NY0A 1LM8B 2KX3A 2ZVOA 4RM8A 1YIWA 1M94A 5CHFA 2KDFB 1WRDB 2KJRA 3UGBB 3X23A 4MEMA 2BPSA 1RAXA 4FBJB 2KX0A 1HE8A 3OJ3A 3PTFC 4MELA 1S1QB 4HJKA 4TUUA 4IUMB 2D2QA 4JQWC 3W1SC 2LUEA 4E3CA 3OAWA 4KVGB 4W9IA 3V62A 3HM3A 2JRHA 2O2VB 4B95A 2PEAA 5AEKB 1GG3A 3VAWA 5LLIA 2BYEA 3V6CB 5L95C 2Z59B 3QC8B 3VHTC 4BFRA 2WX0A 4AP4C 2DYMA 1CMXB 1GC6A 4HLEA 2RR9A 4JLCA 2MQJA 1K8RB 1KLVA 2V1YA 1U4AA 4DHZE 1NI2A 2DZMA 4FHKA 4YL8A 5J2RA 1J8CA 2K8HA 1Q0WB 4AOFA 2LD9A 3PLUA 1PQSA 3MHSD 3M95A 4KZ0A 3VVWB 4BKSA 3VTVA 2NVUI 4N9F4 2LI5A 4TV3A 3PGEA 2GBNA 1E8WA 3UIOB 3WAMA 3ZNID 2LGXA 4KDIC 3MTNB 2C7NB 3APDA 4DHJD 2D10A 1EF5A 2DHZA 4HWIB 1WX9A 2M8SA 1RLFA 2R2OA 4K7UA 5D94A 4P7IA 5D6JB 2PE9A 2L8JA 2Y5BB 3ZKJC 1BT0A 2GBMA 2GBRA 3R3MA 4FHJA 3NS8A 3T8MA 3JYUA 3QJZA 4NNJB 2KQSA 4DDGD 5AZHA 4A3PA 3H9DA 1WM2A 2XK5B 4PS8A 2RGFA 5DPRA 4CHKA 3ZIMA 2DYOA 2L0TA 2RD0A 2MW5A 1WXAA 3L17A 4BKSD 3V6EB 4BOZB 3QA8A 2L3ZA 2DENB 4PYUA 4A20A 1AARA 3L54A 3D32A 3M62B 4IWQA 1WZ0A 1YD8U 3WA0A 3GZNI 3PREA 3UF8A 5JZEB 4JGHB 4I6NB 2MBBB 4G3XB 4LDTB 1LFDA 3T9LA 3VH3B 1E7VA 4EKUA 2CR5A 4OVVA 2FIDA 4W9FA 4IM3A 4GN1A 3PVLA 2LXCA 5CX3A 4ZRKA 1E8ZA 2KFJA 4WJQA 2FCSA 2C7MB 2KTRA 2GOWA 2LASA 2FUHB 5JHAA 1SIFA 4WWOA 3PRZA 3UQBA 4KSLC 2ZNVC 3PZDA 4GU2A 5LXIB 3RZFA 3ZUNA 3CF6E 1E5WA 3DVNU 4EUTA 4I6LB 2N7EA 2ASQA 3SD5A 3KW5B 3ZDMC 4GDKB 4GDKA 4NJ7A 5EDSA 3IFWB 2G45B 2K1FA 4KDLB 4EEWA 4DDID 1WFYA 2D07B 2D3GA 4DXAB 2EMTA 3DBSA 5FR6A 4J6IA 2N1WA 2WDTB 2O6VD 1A5RA 2L00B 1YQBA 2OOBB 1KM7A 1OTRB 2KNBA 4W9DA 3TMPB 2KMCA 2FAZA 2HJ8A 4K7SA 1G6JA 2MBEA 4KSKC 3BINA 3DVGY 3L08A 4MSQB 3ML9A 2KXJA 2I1KA 1P9DU 1Q1OA 3BY4B 4W9GA 2RPQA 3CSTA 2KDIA 4MDKE 4WAAA 1KOTA 4F1SA 4MH0E 2L76A 2UWQA 1GNUA 3A1QA 2IO0B 3A9KB 2DYBA 3A9KA 4HCNB 4BOSC 2QHOA 2LJ5A 3QCAA 2DZIA 1P0RA 4FN2A 2KLCA 3Q3JA 4M8NA 2A4ZA 2FCQA 2JZZA 4EFOA 2JUOA 3A4SC 3A4RA 2WX1A 2NBUA 3N3KB 2ZZPB 1SE9A 4B6WA 2JXXA 3HK0A 3WANA 1J19A 1RRBA 5DPSA 1V81A 4GDLB 1WF9A 4GDLA 2AL6A 4HCPB 1ZKHA 2DX5B 4NAWB 4NAWA 3UINB 5E6NA 4AUQC 5LXHA 2LVOA 2K6DB 2O2VA 3AI5A 4WWPA 1LQBA 3WAOA 2KDBA 2HTHA 4MM3A 3NHEB 4IC7B 1F9JA 5C1ZA 2KD0A 4EOYA 2NBWB 2V3SA 3NZSA 5DPWA 1EF1A 4E74A 4EZJA 4BBNC 4MGKE 1V86A 2JWZA 1WGGA 3V61A 1V5OA 4NQKE 1WH3A 2KWCA 4ASWC 4KIKB 2ZPNA 4KIKA 3RZWC 5CTRC 2NPTB 1MG8A 2NPTA 2NR2A 1ZW7A 3OJ4B 3ZRCA 1WZ3A 2A5UA 4W9LA 2C9WB 3L0WB 1YJ1A 2XEWA 1GC7A 2KANA 1RFAA 4NPNA 3PSEB 3RT3B 4FA6A 3O65B 3R7QA 4B9KA 2I1JA 3DDCB 4F7ZA 5IA7A 2G3QB 3DQVA 4IM2A 4W9EA 3QK0A 3ALBA 5CHVC 3U7DA 3WALA 2ZNVB 2C5LC 1WM3A 3M3JA 4HPMB 2KOXA 1IYFA 2M17A 3PLVA 4FLHA 2CU1A 2LWPA 3U8ZA 3KUZA 3UQAA 1IPGA 2NBVB 4XC2A 4ICVA 3V60A 4ZDVA 3I3TB 3B0AA 2KQ7A 3DBHI 4WWNA 2ZPYA 3JW0X 5AZGA 3SDLC 3GOEA 2JF5A 1R4MI 3N30A 2XK5A 3NZUA 1WY8A 3ZRFA 4CO7A 1XT9B 2KJ6A 1S3SG 2V4LA 2R2QA 3VQIA 3HIZA 1WE6A 2BGFA 4HVBA 1WR6E 2IYDB 3AU5A 3CMMB 2IY1B 1E8XA 3M63B 3PV1A 4WJPA 3KUDB 4MSMB 4PYZA 3RD2A 1WXMA 2KJHB 5DPTA 2BYFA 4W9CA 4G11A 2KTFA 2W9NA 4LCDE 2DAJA 3KUCB 4HK2A 2LVPA 3VUXA 1C3TA 4LJOB 3WIMA 2LGYA 2J0KA 3B1LX 2KZRA 1OEYJ 3VTUA 1WJNA 4BKTA 4G50A 2KDEB 2HE7A 3X0WA 1EUVB 2CHZA 2IO1B 1Z2MA 2ZEQA 4AJYB 3B08A 4PS7A 1JRUA 1V6EA 3P2BA 2ZVNA 2FCMA 2CHXA 4IW0A 1FXTB 1ISNA 3PT2B 1WGDA 4HPLB 3W1SA 2NCNA 1XD3B 1ZGUB 2L7RA 1VCBA 4WJOA 2JY6A 3TJPA 4NJ6A 4LDTD 2M1MA 1J0GA 1WGRA 3MJWA 2J0JA 4JL9A 4FJZA 1WXVA 3RYTA 2DAFA 1P1AA 2KFKB 2KFKA 1UBIA 2G4DB 1WGHA 1KJTA 4K7WA 2KWUB 1UELA 3OLMD 3LJ3A 3ONSA 2MWSB 3DCGA 2HD5B 3K9PB 3PHWB 2K25A 3QX1A 1QZEA 2KLGA 2PE6B 2MP2B 3CSFA 2MP2A 2IBIB 3AXCA 1YX5B 4HXDA 2EKEC 3EFUA 3L16A 2MSED 2BKFA 4II2B 1I42A 3VTWA 5DCNA 2Z0DB 3H6NA 2MBOA 2K39A 4ANUA 1E8YA 3AU4A 2MRPA 4ZRIA 2LVQA 1R4NI 2YLMA 3ML8A 4MGZE 3TBLD 2LRUA 4FULA 3DVNV 3IVFA 1OQYA 2C7HA 3QHTA 1EO6A 4DK5A 3PPAA 3ZVVA 4MJSB 2KMAA 3HM6X 3IBEA 3JVZX 3PS6A 4ZYNA 5J17A 4ANVA 4TQ0A 3Q3FA 2UYZB 3VH4B 2GBJA 2KKCA 2WYQA 4KV2A 1Y8RC 5G2NA 2KHWB 3ZNGC 4IG7B 1V9JA 4FADA 2WWZA 4M8MA 4GOCA 1UD7A 2KVRA 3H7PB 3H7PA 3WAPA 3C0RB 4ANXA 1UH6A 2AEHA 1L7YA 1WYWB 4LJPB 3QWZB 4G0NB 1D3ZA 1SGHA 4HDOA 2MCNB 3QARA 2KC1A 1I35A 2MBQA 4FJYA 2BF8B 2MLBA 2KO3A 1YX6B 1C1YB 1V49A 4E71A 1X1MA 5D2MB 2YVCA 3QQ8B 4EZLA 2C60A 3NOBA 5IAAC 5C23A 4K81A 4I6PA 1UBQA 2N7DA 1TGZB 3HHMA 4BBNF 2N4FA 3TL5A 1E90A 4DHJB 4DBGA 2KWVB 2N9PC 2L05A 1P98A 2CHWA 4MGIE 3DPDA 1IP9A 1VD2A 2D11A 3U30A 1TBEA 2IO3B 3S2AA 4RM9A 3R66C 3UIPB 4AWJA 2AYOB 5KHQA 1T0YA 2K6QA 3ZW3A 2PPHA 3LDZE 2EMSA 1LXDA 4JIOU 1WIAA 3VDZA 3ZDTA 2N9EB 1OEYA 2L0FA 3PRMB 3RUIB 1WMHB 1WMHA 3H1UA 2K8BA 2ZCBA 4KZCA 3ZNZB 2RSUA 3QAQA 4AJWA 3VFKA 4IM0A 1WE7A 5AZFA 5E6OA 5G55A 1V5TA 3N32A 3SU8X 3VXWA 3ZO5B 2NS5A 2OJRA 3SHQA 2DZKA 2M0XA 2GMIC 3H7SA 4ANWA 4ZRJA 4K1RB 4F8CB 3APFA 4WJNA 3A9JB 2KK8A 3A9JA 4HDQA 2VRRB 2N9XA 2N1VA 4II3B 3RULA 3A33B 3DVGX 1V80A 1GUAB 4MGYE 4TKNA 4GSWA 5E6PA 2XBBC 2ZCCA 4TQ1A 1TZ1A 5HKHA 2FIFA 2BWFA 3KH0A 5D7GA 1H8CA 4FJVB 1WR1A 3RCZA 1NDDA 2JRIB
chains in the Genus database with same CATH superfamily
3PHXB 3K9OB 4M02A 2EKIA 4XWWA 1NYRA 2O6VB 3KVFB 2N7JA 2WU2B 1JW9D 4X57B 2AL3A 4GXBA 1WI0A 1WXSA 3NY5A 4CYEA 3AULA 2BT6A 1FCLA 2JVCA 5JHBA 3IT6B 4KGTA 2ZJDA 4TSSA 3VUWA 4PK1A 2Z0EB 1XLOA 4M0WB 3T3NA 2G4SA 2IO2B 4BKGA 5CHWA 5IN7A 4ICUA 4PS3A 2CKHB 3GB1A 3APCA 1EU4A 3L10B 4XZ4A 5BO4B 4GGQA 4MJSA 4W9KA 3FKYA 1GJZA 3BK1A 4USAA 1LM8B 2ZVOA 1YIWA 3Q8EA 5CHFA 3AEFB 2OHFA 1N62A 1VJKA 1SJHD 3X23A 4MEMA 5I4DA 1RAXA 2KX0A 3PTFC 2AQ2B 1F52A 4HJKA 5JXVA 2QC8A 4IUMB 2JZPA 1LGRA 2O2VB 3VAWA 2BYEA 3V6CB 4BFRA 1JQ4A 1F77A 4AP4C 4YTMB 1CMXB 1GC6A 4HLEA 3BYYB 4XGAB 1R4MB 1DOXA 1KLVA 5HFYA 2FBWB 2PLPA 4KZ0A 3VVWB 2QEJC 1YN4A 1E8WA 2WU5B 1JROA 4KDIC 3URYA 3GS2A 4DHJD 5FR3A 1EF5A 1C4CA 1WX9A 2R2OA 4K7UA 2RDHA 5D6JB 2L8JA 3ZGZA 3NJTA 4FHJA 3NS8A 2BQQA 3DWGC 1WM2A 2RGFA 2WXFA 2BB6A 4BKSD 1GAQB 1BMLC 2L3ZA 1AARA 3WA0A 4IWQA 1YD8U 3FC4A 4I6NB 4G3XB 3HUIA 1E8ZA 4NAMA 4WJQA 1JALA 2FUHB 5JHAA 1Y56A 1WRIA 2EELA 3ZDMC 4J3OD 3HRDD 1SIJA 2K1FA 1R4NB 1Q10A 4KDLB 2NTSA 2D07B 2D3GA 4DXAB 2J53A 3AV8A 5FR6A 2N1WA 4C4VB 1YQBA 1FCCC 1KM7A 1OTRB 4YWGG 3BINA 3L08A 2LUMA 2K5PA 2J52A 1MI0A 2JSVX 2QMTA 3AE3B 3RFZB 3MC9A 3A9KB 2DYBA 4WQMA 1WYGA 2NBUA 1SE9A 4B6WA 2JXXA 2MHJA 1J19A 5DPSA 1FXIA 4GDLB 2JYEA 2K6DB 2OJWA 3IAM1 3Q8CA 4ITKA 2KD0A 4EOYA 5EE3A 4MGKE 3AE4B 4KIKB 1YN3A 3AE8B 2NPTA 3OJ4B 3MC8A 2RPVA 1YJ1A 3P4PB 4O1NA 3PSEB 1L6UA 4RGTA 4B9KA 2I1JA 3DDCB 5IA7A 2W54A 3WALA 1VLBA 1MJDA 4FLHA 2CU1A 4C56C 5H92C 1ZP0B 4XC2A 3I3TB 2KQ7A 1PGAA 3SR6A 4JPSA 1R4MI 2XK5A 3TEXA 2KACA 2V4LA 4HVBA 1WR6E 2IYDB 3CMMB 3PV1A 5FKAC 2BB5A 4WJPA 3I63C 4PYZA 3LXFA 3RD2A 1WXMA 2KJHB 2MH7A 1TS4A 1T5XD 2DAJA 3KUCB 4HK2A 1ZDXA 3WIMA 5LNK1 3MP9A 4BKTA 3ETRA 1HQRD 1QOAA 1C4AA 2CHZA 1N6ZA 4AJYB 3B08A 4RGMA 1J7CA 3P2BA 3PT2B 4HPLB 3W1SA 1VCBA 4A90A 1P7EA 4NJ6A 1WGRA 3EA6A 1WXQA 2G4DB 2KFKA 2QSDA 1KJTA 4K7WA 3OLMD 3LJ3A 3ONSA 3DCGA 2HD5B 1SE2A 2K25A 1KH0A 2KLGA 2PE6B 1J7BA 2IBIB 1YX5B 2EKEC 1ET9A 3U52E 3VTWA 5DCNA 1TT5B 2MRPA 1R4NI 3I57A 1SSNA 4MGZE 4FULA 2G1EA 1RM6C 2WXIA 2KWDA 4MJSB 3Q3FA 4P6VF 2KKCA 3ZNGC 4RH6A 1UD7A 3H7PB 4OW0A 4A6QA 1WYWB 1QT9A 4LJPB 4KX6B 3QWZB 1SGHA 2KC1A 4FJYA 2KO3A 3GP7A 1TJEA 1C1YB 1KFYB 5FK9C 3AH7A 5D2MB 2J4XA 4EZLA 5IAAC 5C23A 4K81A 1UBQA 3HHMA 4BBNF 2N4FA 1HTOA 2KWVB 2L05A 1P98A 4MGIE 3TUOA 1VD2A 3S2AA 1MVKA 3AE9B 2AYOB 1N5WA 3EUB2 3Q3OC 1WIAA 4YTPB 1ESFA 2N9EB 1OEYA 3E9SA 1CQVA 3SFDB 3P4SB 4DXFA 4AJWA 4LNNA 3N32A 3ZO5B 2NS5A 3TSSA 3H7SA 5IP4D 4WJNA 3FILA 1T0QC 1HXYD 4MGYE 1TZ1A 2WXKA 1UWXA 2BWFA 5D7GA 4L1BA 1H8CA 2V3NA 1WR1A 1V1PA 1N61A 5HI1A 4YSZB 1DOIA 3JSVB 3ZLZA 2MA9B 3TCAA 2JWUA 2PMVA 2INDC 4W9JA 2REXA 4IWPA 1TS5A 5TR5A 2BWES 2FNJB 1YJJA 4LNFA 2LMCA 4URKA 2PJHA 1H4RA 5KHOA 4C80A 4OVUA 1NBFC 3W1YA 3VUYA 1D5MC 1IBXB 2MX2A 1V2YA 3EC8A 1XQQA 2ICIA 2LZ6A 2KYWA 1I4XA 2M4NA 1SE3A 4A8XC 4WQOB 1Z5SB 2LRWA 3ZTCA 2KC2A 1KTKA 1L4DB 4GMVA 2JT4B 2AWTA 3QIJA 2ONQA 2LGSA 4NQLB 4L23A 3PRPB 2JPHA 4IWOA 2DZJA 1P3QU 3DOWA 3TIXA 1YMHE 2IGDA 1FXAA 4BAXA 2MJDA 1M94A 1XXGA 4ZYSA 1VZ7A 4OZAA 2KJRA 4KGSA 3MC0B 2BPSA 1HE8A 3OJ3A 4MELA 3B9JA 1S1QB 3W1SC 4JQWC 1QKZA 3OAWA 4W9IA 1EU3A 1GG3A 5LLIA 5H8YE 2ZW1A 3QC8B 1RWSA 2WX0A 3GE3C 5GXGB 2KT7A 1TZOA 2DYMA 3DBHB 1ZUD2 3LYYA 4JLCA 2FUG1 1K8RB 1U4AA 5J2RA 2I2YA 1DGJA 4AOFA 1Q0WB 5BMHA 4BKSA 4XYCA 2LI5A 3PGEA 3WAMA 3ZNID 3W5UB 1K50A 2C7NB 3APDA 1WGKA 2DHZA 4HWIB 2M8SA 2LHEA 3Q8AA 4P7IA 2Y5BB 3DHIC 3ZKJC 4ZHPA 1YQ3B 4K3BA 4NNJB 2KQSA 4DDGD 1L6VA 3TEWA 1FM0D 2XK5B 4PS8A 2L52A 2L0TA 2D3AA 1WXAA 4M01A 4BOZB 3N1ZC 2CJNA 2K0PA 1F1HA 3D32A 1WZ0A 4R3DA 4EKUA 1LFDA 3T9LA 4OVVA 3ZYYX 2FIDA 3Q2AC 1AWDA 2J42A 4HJGE 4NJCA 1FEHA 1PGBA 2C7MB 2KTRA 1KLGD 2GOWA 3B2FA 3PO0A 4KSLC 2ZNVC 5LXIB 3T3OA 4KGRA 3DVNU 4I6LB 2ASQA 2WDVB 4GDKB 4NJ7A 3NS1A 2YEPF 1TS2A 2PKOA 3ZXRA 4MH8A 4HROA 2VZKD 1OQRA 2QILA 1A5RA 2OOBB 1VR9A 2KNBA 2W82A 3TMPB 3AEAB 5MPOA 2FAZA 2MBEA 1B1ZA 1P9DU 2RPQA 3CSTA 4OZCA 1K52A 4MH0E 1GNUA 3VR8B 3A1QA 2QHOA 2VH1A 3NVWA 3A4SC 1AN8A 1FFUA 1XLPA 2WX1A 3N3KB 2ZZPB 1QOBA 4REZA 1SB3C 2D3CA 1RRBA 3CIRB 1A70A 1WF9A 1KLUD 4NAWB 4HRSA 3UINB 5E6NA 2LEKA 3AI5A 3GE8C 4YT0B 1LQBA 3WAOA 2KDBA 4MM3A 4IC7B 5C1ZA 1M4VA 2V3SA 3IXSA 1EF1A 3AE5B 2MJEA 2JWZA 1WGGA 3V61A 4RCOA 1WH3A 2KWCA 2WXLA 5CTRC 4S17A 1MG8A 2NR2A 1ZW7A 3Q6BA 3ZRCA 1EWYC 2HTME 2A5UA 1NEKB 1UGJA 3RT3B 2YEPB 4FA6A 1PGXA 4F7ZA 1GOZA 3QK0A 3ALBA 1L0VB 5CHVC 2Q5WD 2ZNVB 3U7DA 4D2KA 1STEA 3BYTB 3ZQ4A 2LWPA 2ZW0A 3DHHC 4GLSC 1C77A 3DBLB 4ICVA 3KWVA 3DBHI 3GZNB 2WXOA 5AZGA 3GOEA 3N30A 3ZRFA 4HEA1 1VZ6A 2KJ6A 4L2YA 2BS4B 3HIZA 1WE6A 2IY1B 1FNWA 5DPTA 4W9CA 2WHIA 3FILB 4LCDE 1SXTA 2XN9C 2LVPA 1L4ZB 3X0WA 2X38A 1Z2MA 2ZEQA 1V1PB 4PS7A 1V6EA 1FRRA 2FCMA 2CHXA 1WGDA 2M56B 1XD3B 2L7RA 1CK1A 4WJOA 3TJPA 3AMZA 3DBRB 4LDTD 1C9FA 2M1MA 1D5ZC 1J0GA 4FJZA 4LLGM 1WGHA 2LJIA 1B9RA 2KWUB 2B76B 3AE1B 1J7AA 2INPE 2MP2B 3CSFA 3EFUA 1I42A 4HKQA 3KQ4A 2Z0DB 3V3XA 2MBOA 2K39A 4ANUA 1E8YA 2YLMA 3ML8A 4H2AA 1EO6A 2Y5CA 3ZVVA 2KMAA 3HM6X 4TQ0A 3V05A 3VH4B 4ZRQA 2WYQA 2KHWB 1V9JA 2KVRA 3C0RB 1UH6A 1L7YA 4EE2A 1BUIC 1I35A 2BF8B 3HVDA 2MLBA 2MEKA 4P1CC 2YVCA 3QQ8B 3R2IA 1L5PA 3NOBA 2WDQB 1HEZE 1IUEA 2V9HA 2DLBA 1QF6A 4DHJB 3ZXVA 4KKIA 2KAJA 2PIAA 3C8YA 1ZDVA 1IP9A 2JQRB 1TBEA 4RM9A 1SEBD 3R66C 5KHQA 1T0YA 2K6QA 4ZRPA 4RF0A 3NVZA 4JIOU 1LXDA 3HVZA 2IJ0A 3ZDTA 1WMHA 4YXDB 3H1UA 2WNMA 1PUTA 3ZNZB 3SEBA 4BZAA 3QAQA 2WP9B 5E6OA 3U7ZA 3VXWA 4XWTA 1T0RC 4Q2JA 4ZRJA 3A9JB 3Q3MC 5IKCM 4HDQA 2VRRB 2N9XA 2N1VA 3RULA 3DVGX 1GUAB 4GSWA 4TQ1A 5HKHA 2FIFA 3ABVB 3ENEA 4ZHOA 3DBLI 4DHZB 1L2NA 4LNIA 3IHPC 3ZTDA 2O6VA 2B3AA 3ECIA 1ENFA 4N58A 4XX5A 1EM7A 1E10A 2IZVB 3R7RA 2KTRB 3SFEB 1WX7A 1SE4A 1WX8A 2BKRB 2J0MA 2HJ1A 1XLQA 2KN5A 1WJ4A 1NI3A 2JX5A 5J18A 3L13A 3BZDB 3KYDD 4UDUC 5JH5C 4S0RA 3WCQA 2GBKA 5BMIA 1WJUA 2CS4A 4A3OA 1KF6B 4W9HA 3KYCD 3EHVA 1WWTA 3EECA 1TTNA 3AEDB 1GPXA 2MBHA 2AQ1B 3DBRI 3C19A 3A1QB 3EFCA 1WJ6A 2IY0B 2K8CA 1AYFA 4DWFA 4NY0A 1I4RA 2WGSA 1VRAB 3EGRA 1V1OA 3BVZA 4FBJB 4E3CA 2LUEA 4YSYB 2JRHA 4B95A 2PEAA 5AEKB 3VHTC 1NVID 2MQJA 2PVGC 4A9AA 1E0ZA 2V1YA 4DHZE 3RPFC 1NI2A 2DZMA 1FMAD 1J8CA 2K8HA 4YTNB 1PQSA 3M95A 2NVUI 4N9F4 4TV3A 2UU7A 1DYQA 2GBNA 4KKJA 3MTNB 1P7FA 1RLFA 3NRZA 2PE9A 4HKZE 1UUPA 2GBMA 4AQ7A 2GBRA 3R3MA 3JYUA 3QJZA 1HZ5A 5AZHA 3H9DA 5DPRA 1NENB 3ZIMA 2DYOA 1JCKB 5HG2A 3QA8A 4WH4A 2DENB 1I4PA 4PYUA 3L54A 3M62B 3PREA 3UF8A 5AUKA 5JZEB 4JGHB 2MBBB 2PW9A 3VH3B 1I4QA 4IM3A 3BIID 1PFDA 1QLBB 4ZRKA 3NG0A 2FCSA 1SIFA 3PRZA 3UQBA 3U4EG 3RZFA 3CF6E 2GRIA 2K22A 4EUTA 3SD5A 1HA5A 3IFWB 2RDGA 1SJED 4EEWA 1WFYA 1XCTL 2EMTA 2HDEA 2O6VD 1C4PA 2L00B 3BVMA 3P63A 4W9DA 2AX5A 2KMCA 1G6JA 1NYQA 2SAKA 4KSKC 3DVGY 4MSQB 2QIEB 3BY4B 4W9GA 1C76A 4WIPA 2G9HD 1UF0A 2KDIA 4WAAA 3VRBB 4F1SA 2L76A 1K51A 1BXTA 3W5VB 2IO0B 4HCNB 3A9KA 1JWMD 1P0RA 4FN2A 2KLCA 3Q3JA 4EFOA 2FCQA 1SF0A 5HHDG 3TEYA 3AN1A 2H88B 1YQ4B 1QOFA 2M0AA 4RFBA 3HK0A 3WANA 1V81A 2H89B 4GDLA 2DX5B 2QJLA 2Y3AA 4AUQC 1YJIA 5LXHA 4WWPA 2BYTA 2HTHA 1F9JA 2NBWB 3NZSA 5DPWA 4E74A 4EZJA 4US9A 1V5OA 2WXRA 5BYQA 1ZE3D 2ZPNA 4KIKA 3RZWC 2NPTB 2DBYA 1WZ3A 3ZJTA 1RFAA 3O65B 3R7QA 1CJEA 1TKYA 3DQVA 4W9EA 1DOYA 2C5LC 3BWUD 3M3JA 1IYFA 2KOXA 3PLVA 2WXNA 2JXTA 3UQAA 1IPGA 2NBVB 2WXHA 3OG5A 4ZDVA 2WDRB 3JW0X 2JF5A 1WY8A 2PTLA 3I9V1 3VQIA 4PT5A 2W3RA 3AU5A 1E8XA 3VRAB 4MSMB 2BYFA 1F2RC 1WSPA 3R8BA 4G11A 2W9NA 1GB4A 1C3TA 3VUXA 3B1LX 2KZRA 3VTUA 1WJNA 2KMMA 1EUVB 2IO1B 2ZVNA 2LGIA 4IW0A 1FXTB 1ISNA 2NCNA 1ZGUB 3H8HA 2BBCA 4A55A 1V97A 1TYGB 2JU6X 1UNSA 2N0SB 4ZOHC 2J0JA 4JL9A 1WXVA 2DAFA 1P1AA 2KFKB 1UBIA 3DWMA 3AEGB 1OFFA 1UELA 2MWSB 3K9PB 3PHWB 4IOIE 3QX1A 1QZEA 3ZJUA 3AXCA 2MSED 2BKFA 4RGNA 3AU4A 4ZRIA 2LVQA 1EWCA 1XCQL 3AE2B 3KWLA 2LRUA 1UWMA 3PZ7A 5BYRA 3QHTA 4DK5A 3PPAA 1N60A 3IBEA 3MJ5A 3JVZX 3PS6A 4XE0A 2UYZB 1Y8RC 5G2NA 4M8MA 4GOCA 3H7PA 4ANXA 5G5GA 2AEHA 4G0NB 1D3ZA 4HDOA 3QARA 3RN9C 4QAYA 1V49A 4N6EB 4NZLB 1PYWD 4I6PA 2ACZB 3RNAC 2TSSA 1TGZB 4AS1A 1E90A 4DBGA 2ON8A 2N9PC 2CHWA 4JWUC 2KQ4X 2D11A 3U30A 1JWAD 3AEBB 2IO3B 1XO3A 4FXCA 3UIPB 4LK0M 2JYTA 3TEZA 2PPHA 3LDZE 2EMSA 5C3JB 4XDDA 2K8BA 4KZCA 3P4QB 2M19A 2V4IB 1WE7A 5D3IB 5G55A 4DQOC 2XNAC 2OJRA 4F8CB 2BW2A 2KK8A 3Q69A 1D6EC 3A33B 2GB1A 1N63A 3AECB 4TKNA 5E6PA 2XBBC 3ZJVA 2R61A 4DXGA 3CWIA 2BS3B 3KLSX 1NDDA 2JRIB 4BVUC 2WLBA 1MPEA 3JSVA 2VZKB 2BTEA 2RDBC 1T0SC 4CQNA 2MJ3A 2V0GA 2PVOD 1C79A 2JZ3B 1UZXB 2CU3A 5T8IA 2BYVE 1HTQA 4K3CA 3AE6B 2IPKD 1IBXA 1ET6A 4GIVA 3ZNHB 1WGYA 2FCNA 1TIFA 3AB5A 3VR9B 4LTUA 3W9CB 1TY0A 2LXAA 2J7QB 2QCZA 1QQRA 2WXQA 3N1XC 1MHHE 4GB9A 1Q5WB 3IG3A 1OGWA 1E7UA 1UGMA 1QOGA 2LGDA 4EZKA 4RMAA 5GMVA 1I4GA 5L83A 5EE1A 3N9YC 4RNAA 2KX3A 4RM8A 2KDMA 2KDFB 1WRDB 3UGBB 4TUUA 4P16A 2D2QA 3IAS1 4ARIA 4KVGB 3V62A 3HM3A 4WAFA 1I7HA 3IT4B 1JWUD 5L95C 2Z59B 2Y5PA 2RR9A 1PDXA 1T6BX 1VZ8A 4FHKA 4YL8A 1RFKA 2FE8A 1KRHA 2LD9A 3PLUA 5EE0A 5EE9A 3MHSD 3VTVA 4WURA 3N1YC 1GB1A 2IGGA 3UIOB 5E6JA 2LGXA 1F2RI 2CJOA 2D10A 2AQ3B 5D94A 5IO9A 3MFGA 4M00A 1BT0A 1XF5L 3T8MA 1TS3A 1E6EB 2WXPA 3NUHB 2BS2B 4A3PA 4N59A 3AEEB 4CHKA 2RD0A 2MW5A 3L17A 3V6EB 3RNFC 1L0XB 1ROEA 2WQYB 4A20A 3GZNI 1FFVA 3PZ8A 3AE7B 2INNE 3R2TA 4LDTB 4OVZA 4YSXB 1E7VA 2CR5A 4W9FA 4GN1A 3PVLA 2LXCA 5CX3A 2KFJA 4ARCA 1JWBD 5AUIA 2LASA 4WWOA 3OWEB 3PZDA 4GU2A 1FO4A 2VH2A 3ZUNA 1E5WA 2Z8LA 3RMKC 2N7EA 1FD6A 3KW5B 4GDKA 2G45B 3AM9A 4C7YA 4DDID 4M0WA 1FPYA 3P42A 3DBSA 4J6IA 2WDTB 4RF1A 1MHXA 2HJ8A 4K7SA 3UI3A 3NVVA 3LB8C 1OQQA 3ML9A 2KXJA 2I1KA 1Q1OA 4P1BC 4MDKE 1KOTA 2DWQA 2UWQA 4BOSC 5BMGA 2SEBD 2LJ5A 3QCAA 2DZIA 1QILA 4M8NA 2A4ZA 2JZZA 2JUOA 3BK2A 2L32A 4US8A 2KVZA 3A4RA 2N9LA 1IGDA 2LFIA 5IOIA 3MHZA 4HCPB 1ZPSA 2AL6A 2LHDA 1ZKHA 4NAWA 2GI9A 2QDFA 2LVOA 1CZPA 3Q8BA 2O2VA 1E7PB 3B2GA 1I4HA 4MM3B 3NHEB 2D3BA 4BBNC 1ZXIA 1V86A 1YN5A 4NQKE 3RNGC 4ASWC 3RNBC 2NTTA 4W9LA 2C9WB 3L0WB 2XEWA 1JWSD 1GC7A 2KANA 4NPNA 1ZXHA 2L83A 2G3QB 4IM2A 4OZBA 3L4PA 1WM3A 1XEEA 2IDYA 4HPPA 4HPMB 2M17A 1R7SA 4B0MA 3RI7C 1MFWA 3KUZA 3U8ZA 1ACCA 2DNFA 3V60A 3B0AA 1RYJA 4WWNA 2ZPYA 1D5XC 3SDLC 3NZUA 4JX1C 2N9KA 4B0EA 4CO7A 1XT9B 1S3SG 1V8CA 2R2QA 2BGFA 2K9XA 1JMLA 2IGHA 3M63B 3KUDB 3I5JC 1FIQA 2KTFA 3FAHA 4LJOB 2LGYA 2J0KA 1OEYJ 2WXMA 3BVGA 4G50A 2KDEB 2HE7A 4TMAB 1VDVA 1TKGA 1JRUA 3RNEC 3W2DA 2W3SA 5G5HA 2WXJA 3RNCC 1IGCA 3Q14C 4JWSC 1TKEA 2X8XX 1SBBB 2K3UA 3E56A 4MACA 2JY6A 4OHJA 3P1MA 4IKGA 4C4VA 3MJWA 2INCC 3RYTA 1E9MA 2E3TA 5D3DA 2MP2A 4HXDA 4C7ZA 3L16A 4II2B 3N20C 3NZ3A 3P4RB 3U2SC 3H6NA 4ACFA 2GLSA 2L1AA 2KN4A 3TBLD 4LNOA 3DVNV 3IVFA 1C78A 1OQYA 2C7HA 2E6XA 5J17A 4ZYNA 4ANVA 1TY2A 2GBJA 4KV2A 1MG4A 2D5GA 4IG7B 4FADA 2RMMA 2V3PA 2WWZA 1N5XA 3WAPA 4WWMA 2MCNB 2MBQA 3DHGC 1YX6B 1JRPA 4E71A 1X1MA 1HZ6A 2C60A 1T3QA 2N7DA 1LO5D 1YOVB 3TL5A 1XLNA 4IDIA 5BYSA 2WS3B 4JE3B 3DPDA 4MT5A 1FNUA 2WXGA 1F0ZA 4AWJA 3O13A 2BVCA 3ZW3A 1FNVA 2I38A 3Q8FA 3VDZA 1YNTE 4LNKA 1ZOYB 2L0FA 3PRMB 3RUIB 1WMHB 2ZCBA 1K53A 1FRDA 2RSUA 2OEDA 4C00A 3J9CA 5TSSA 3VFKA 4IM0A 5AZFA 3Q3NC 4RGOS 1V5TA 3SU8X 3SHQA 2DZKA 2M0XA 2GMIC 4ANWA 4K1RB 3APFA 3A9JA 4II3B 4XDCA 1V80A 2NMQA 2W55A 1D4BA 1AW7A 2ZCCA 3NVYA 3KH0A 4FJVB 3RCZA 5C2TB 1L0YB 5EDSA
chains in the Genus database with same CATH topology
3PHXB 4BVUC 3ENEA 3K9OB 3DBLI 4DHZB 3JSVB 1L2NA 3JSVA 3ZLZA 3IHPC 2MA9B 3TCAA 3ZTDA 2O6VB 2O6VA 3KVFB 2REXA 4W9JA 4IWPA 2B3AA 4X57B 2AL3A 3ECIA 5TR5A 4GXBA 4XX5A 2BWES 1WI0A 1WXSA 2FNJB 2IZVB 3NY5A 2KTRB 3R7RA 4CYEA 3AULA 2JZ3B 1WX7A 1UZXB 4URKA 1WX8A 2BYVE 2BKRB 1H4RA 2PJHA 2JVCA 5KHOA 4OVUA 5JHBA 2J0MA 1NBFC 3W1YA 3VUYA 2ZJDA 2KN5A 3VUWA 1WJ4A 2Z0EB 2MX2A 1V2YA 3EC8A 4GIVA 1XQQA 5J18A 2LZ6A 3L13A 3KYDD 1WGYA 2FCNA 4M0WB 3ZNHB 2M4NA 5JH5C 2GBKA 4WQOB 1Z5SB 2G4SA 2IO2B 4BKGA 5CHWA 4ICUA 1WJUA 2CS4A 4A3OA 2LRWA 4PS3A 3ZTCA 4W9HA 3KYCD 2KC2A 2LXAA 2J7QB 2CKHB 3EHVA 3EECA 1TTNA 4GMVA 2JT4B 1Q5WB 4GB9A 2AWTA 3QIJA 3APCA 3L10B 3IG3A 4NQLB 4XZ4A 1OGWA 5BO4B 4GGQA 1E7UA 1UGMA 3PRPB 4MJSA 2LGDA 2MBHA 3DBRI 4EZKA 2JPHA 4RMAA 4IWOA 4W9KA 5GMVA 2DZJA 3A1QB 1P3QU 5L83A 1WJ6A 2IY0B 1GJZA 3DOWA 3TIXA 2K8CA 4DWFA 4NY0A 1LM8B 2KX3A 2ZVOA 4RM8A 1YIWA 1M94A 5CHFA 2KDFB 1WRDB 2KJRA 3UGBB 3X23A 4MEMA 2BPSA 1RAXA 4FBJB 2KX0A 1HE8A 3OJ3A 3PTFC 4MELA 1S1QB 4HJKA 4TUUA 4IUMB 2D2QA 4JQWC 3W1SC 2LUEA 4E3CA 3OAWA 4KVGB 4W9IA 3V62A 3HM3A 2JRHA 2O2VB 4B95A 2PEAA 5AEKB 1GG3A 3VAWA 5LLIA 2BYEA 3V6CB 5L95C 2Z59B 3QC8B 3VHTC 4BFRA 2WX0A 4AP4C 2DYMA 1CMXB 1GC6A 4HLEA 2RR9A 4JLCA 2MQJA 1K8RB 1KLVA 2V1YA 1U4AA 4DHZE 1NI2A 2DZMA 4FHKA 4YL8A 5J2RA 1J8CA 2K8HA 1Q0WB 4AOFA 2LD9A 3PLUA 1PQSA 3MHSD 3M95A 4KZ0A 3VVWB 4BKSA 3VTVA 2NVUI 4N9F4 2LI5A 4TV3A 3PGEA 2GBNA 1E8WA 3UIOB 3WAMA 3ZNID 2LGXA 4KDIC 3MTNB 2C7NB 3APDA 4DHJD 2D10A 1EF5A 2DHZA 4HWIB 1WX9A 2M8SA 1RLFA 2R2OA 4K7UA 5D94A 4P7IA 5D6JB 2PE9A 2L8JA 2Y5BB 3ZKJC 1BT0A 2GBMA 2GBRA 3R3MA 4FHJA 3NS8A 3T8MA 3JYUA 3QJZA 4NNJB 2KQSA 4DDGD 5AZHA 4A3PA 3H9DA 1WM2A 2XK5B 4PS8A 2RGFA 5DPRA 4CHKA 3ZIMA 2DYOA 2L0TA 2RD0A 2MW5A 1WXAA 3L17A 4BKSD 3V6EB 4BOZB 3QA8A 2L3ZA 2DENB 4PYUA 4A20A 1AARA 3L54A 3D32A 3M62B 4IWQA 1WZ0A 1YD8U 3WA0A 3GZNI 3PREA 3UF8A 5JZEB 4JGHB 4I6NB 2MBBB 4G3XB 4LDTB 1LFDA 3T9LA 3VH3B 1E7VA 4EKUA 2CR5A 4OVVA 2FIDA 4W9FA 4IM3A 4GN1A 3PVLA 2LXCA 5CX3A 4ZRKA 1E8ZA 2KFJA 4WJQA 2FCSA 2C7MB 2KTRA 2GOWA 2LASA 2FUHB 5JHAA 1SIFA 4WWOA 3PRZA 3UQBA 4KSLC 2ZNVC 3PZDA 4GU2A 5LXIB 3RZFA 3ZUNA 3CF6E 1E5WA 3DVNU 4EUTA 4I6LB 2N7EA 2ASQA 3SD5A 3KW5B 3ZDMC 4GDKB 4GDKA 4NJ7A 5EDSA 3IFWB 2G45B 2K1FA 4KDLB 4EEWA 4DDID 1WFYA 2D07B 2D3GA 4DXAB 2EMTA 3DBSA 5FR6A 4J6IA 2N1WA 2WDTB 2O6VD 1A5RA 2L00B 1YQBA 2OOBB 1KM7A 1OTRB 2KNBA 4W9DA 3TMPB 2KMCA 2FAZA 2HJ8A 4K7SA 1G6JA 2MBEA 4KSKC 3BINA 3DVGY 3L08A 4MSQB 3ML9A 2KXJA 2I1KA 1P9DU 1Q1OA 3BY4B 4W9GA 2RPQA 3CSTA 2KDIA 4MDKE 4WAAA 1KOTA 4F1SA 4MH0E 2L76A 2UWQA 1GNUA 3A1QA 2IO0B 3A9KB 2DYBA 3A9KA 4HCNB 4BOSC 2QHOA 2LJ5A 3QCAA 2DZIA 1P0RA 4FN2A 2KLCA 3Q3JA 4M8NA 2A4ZA 2FCQA 2JZZA 4EFOA 2JUOA 3A4SC 3A4RA 2WX1A 2NBUA 3N3KB 2ZZPB 1SE9A 4B6WA 2JXXA 3HK0A 3WANA 1J19A 1RRBA 5DPSA 1V81A 4GDLB 1WF9A 4GDLA 2AL6A 4HCPB 1ZKHA 2DX5B 4NAWB 4NAWA 3UINB 5E6NA 4AUQC 5LXHA 2LVOA 2K6DB 2O2VA 3AI5A 4WWPA 1LQBA 3WAOA 2KDBA 2HTHA 4MM3A 3NHEB 4IC7B 1F9JA 5C1ZA 2KD0A 4EOYA 2NBWB 2V3SA 3NZSA 5DPWA 1EF1A 4E74A 4EZJA 4BBNC 4MGKE 1V86A 2JWZA 1WGGA 3V61A 1V5OA 4NQKE 1WH3A 2KWCA 4ASWC 4KIKB 2ZPNA 4KIKA 3RZWC 5CTRC 2NPTB 1MG8A 2NPTA 2NR2A 1ZW7A 3OJ4B 3ZRCA 1WZ3A 2A5UA 4W9LA 2C9WB 3L0WB 1YJ1A 2XEWA 1GC7A 2KANA 1RFAA 4NPNA 3PSEB 3RT3B 4FA6A 3O65B 3R7QA 4B9KA 2I1JA 3DDCB 4F7ZA 5IA7A 2G3QB 3DQVA 4IM2A 4W9EA 3QK0A 3ALBA 5CHVC 3U7DA 3WALA 2ZNVB 2C5LC 1WM3A 3M3JA 4HPMB 2KOXA 1IYFA 2M17A 3PLVA 4FLHA 2CU1A 2LWPA 3U8ZA 3KUZA 3UQAA 1IPGA 2NBVB 4XC2A 4ICVA 3V60A 4ZDVA 3I3TB 3B0AA 2KQ7A 3DBHI 4WWNA 2ZPYA 3JW0X 5AZGA 3SDLC 3GOEA 2JF5A 1R4MI 3N30A 2XK5A 3NZUA 1WY8A 3ZRFA 4CO7A 1XT9B 2KJ6A 1S3SG 2V4LA 2R2QA 3VQIA 3HIZA 1WE6A 2BGFA 4HVBA 1WR6E 2IYDB 3AU5A 3CMMB 2IY1B 1E8XA 3M63B 3PV1A 4WJPA 3KUDB 4MSMB 4PYZA 3RD2A 1WXMA 2KJHB 5DPTA 2BYFA 4W9CA 4G11A 2KTFA 2W9NA 4LCDE 2DAJA 3KUCB 4HK2A 2LVPA 3VUXA 1C3TA 4LJOB 3WIMA 2LGYA 2J0KA 3B1LX 2KZRA 1OEYJ 3VTUA 1WJNA 4BKTA 4G50A 2KDEB 2HE7A 3X0WA 1EUVB 2CHZA 2IO1B 1Z2MA 2ZEQA 4AJYB 3B08A 4PS7A 1JRUA 1V6EA 3P2BA 2ZVNA 2FCMA 2CHXA 4IW0A 1FXTB 1ISNA 3PT2B 1WGDA 4HPLB 3W1SA 2NCNA 1XD3B 1ZGUB 2L7RA 1VCBA 4WJOA 2JY6A 3TJPA 4NJ6A 4LDTD 2M1MA 1J0GA 1WGRA 3MJWA 2J0JA 4JL9A 4FJZA 1WXVA 3RYTA 2DAFA 1P1AA 2KFKB 2KFKA 1UBIA 2G4DB 1WGHA 1KJTA 4K7WA 2KWUB 1UELA 3OLMD 3LJ3A 3ONSA 2MWSB 3DCGA 2HD5B 3K9PB 3PHWB 2K25A 3QX1A 1QZEA 2KLGA 2PE6B 2MP2B 3CSFA 2MP2A 2IBIB 3AXCA 1YX5B 4HXDA 2EKEC 3EFUA 3L16A 2MSED 2BKFA 4II2B 1I42A 3VTWA 5DCNA 2Z0DB 3H6NA 2MBOA 2K39A 4ANUA 1E8YA 3AU4A 2MRPA 4ZRIA 2LVQA 1R4NI 2YLMA 3ML8A 4MGZE 3TBLD 2LRUA 4FULA 3DVNV 3IVFA 1OQYA 2C7HA 3QHTA 1EO6A 4DK5A 3PPAA 3ZVVA 4MJSB 2KMAA 3HM6X 3IBEA 3JVZX 3PS6A 4ZYNA 5J17A 4ANVA 4TQ0A 3Q3FA 2UYZB 3VH4B 2GBJA 2KKCA 2WYQA 4KV2A 1Y8RC 5G2NA 2KHWB 3ZNGC 4IG7B 1V9JA 4FADA 2WWZA 4M8MA 4GOCA 1UD7A 2KVRA 3H7PB 3H7PA 3WAPA 3C0RB 4ANXA 1UH6A 2AEHA 1L7YA 1WYWB 4LJPB 3QWZB 4G0NB 1D3ZA 1SGHA 4HDOA 2MCNB 3QARA 2KC1A 1I35A 2MBQA 4FJYA 2BF8B 2MLBA 2KO3A 1YX6B 1C1YB 1V49A 4E71A 1X1MA 5D2MB 2YVCA 3QQ8B 4EZLA 2C60A 3NOBA 5IAAC 5C23A 4K81A 4I6PA 1UBQA 2N7DA 1TGZB 3HHMA 4BBNF 2N4FA 3TL5A 1E90A 4DHJB 4DBGA 2KWVB 2N9PC 2L05A 1P98A 2CHWA 4MGIE 3DPDA 1IP9A 1VD2A 2D11A 3U30A 1TBEA 2IO3B 3S2AA 4RM9A 3R66C 3UIPB 4AWJA 2AYOB 5KHQA 1T0YA 2K6QA 3ZW3A 2PPHA 3LDZE 2EMSA 1LXDA 4JIOU 1WIAA 3VDZA 3ZDTA 2N9EB 1OEYA 2L0FA 3PRMB 3RUIB 1WMHB 1WMHA 3H1UA 2K8BA 2ZCBA 4KZCA 3ZNZB 2RSUA 3QAQA 4AJWA 3VFKA 4IM0A 1WE7A 5AZFA 5E6OA 5G55A 1V5TA 3N32A 3SU8X 3VXWA 3ZO5B 2NS5A 2OJRA 3SHQA 2DZKA 2M0XA 2GMIC 3H7SA 4ANWA 4ZRJA 4K1RB 4F8CB 3APFA 4WJNA 3A9JB 2KK8A 3A9JA 4HDQA 2VRRB 2N9XA 2N1VA 4II3B 3RULA 3A33B 3DVGX 1V80A 1GUAB 4MGYE 4TKNA 4GSWA 5E6PA 2XBBC 2ZCCA 4TQ1A 1TZ1A 5HKHA 2FIFA 2BWFA 3KH0A 5D7GA 1H8CA 4FJVB 1WR1A 3RCZA 1NDDA 2JRIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX B;  4BVU C;  3ENE A;  3K9O B;  3DBL I;  4DHZ B;  3JSV B;  1L2N A;  3JSV A;  3ZLZ A;  3IHP C;  2MA9 B;  3TCA A;  3ZTD A;  2O6V B;  2O6V A;  3KVF B;  2REX A;  4W9J A;  4IWP A;  2B3A A;  4X57 B;  2AL3 A;  3ECI A;  5TR5 A;  4GXB A;  4XX5 A;  2BWE S;  1WI0 A;  1WXS A;  2FNJ B;  2IZV B;  3NY5 A;  2KTR B;  3R7R A;  4CYE A;  3AUL A;  2JZ3 B;  1WX7 A;  1UZX B;  4URK A;  1WX8 A;  2BYV E;  2BKR B;  1H4R A;  2PJH A;  2JVC A;  5KHO A;  4OVU A;  5JHB A;  2J0M A;  1NBF C;  3W1Y A;  3VUY A;  2ZJD A;  2KN5 A;  3VUW A;  1WJ4 A;  2Z0E B;  2MX2 A;  1V2Y A;  3EC8 A;  4GIV A;  1XQQ A;  5J18 A;  2LZ6 A;  3L13 A;  3KYD D;  1WGY A;  2FCN A;  4M0W B;  3ZNH B;  2M4N A;  5JH5 C;  2GBK A;  4WQO B;  1Z5S B;  2G4S A;  2IO2 B;  4BKG A;  5CHW A;  4ICU A;  1WJU A;  2CS4 A;  4A3O A;  2LRW A;  4PS3 A;  3ZTC A;  4W9H A;  3KYC D;  2KC2 A;  2LXA A;  2J7Q B;  2CKH B;  3EHV A;  3EEC A;  1TTN A;  4GMV A;  2JT4 B;  1Q5W B;  4GB9 A;  2AWT A;  3QIJ A;  3APC A;  3L10 B;  3IG3 A;  4NQL B;  4XZ4 A;  1OGW A;  5BO4 B;  4GGQ A;  1E7U A;  1UGM A;  3PRP B;  4MJS A;  2LGD A;  2MBH A;  3DBR I;  4EZK A;  2JPH A;  4RMA A;  4IWO A;  4W9K A;  5GMV A;  2DZJ A;  3A1Q B;  1P3Q U;  5L83 A;  1WJ6 A;  2IY0 B;  1GJZ A;  3DOW A;  3TIX A;  2K8C A;  4DWF A;  4NY0 A;  1LM8 B;  2KX3 A;  2ZVO A;  4RM8 A;  1YIW A;  1M94 A;  5CHF A;  2KDF B;  1WRD B;  2KJR A;  3UGB B;  3X23 A;  4MEM A;  2BPS A;  1RAX A;  4FBJ B;  2KX0 A;  1HE8 A;  3OJ3 A;  3PTF C;  4MEL A;  1S1Q B;  4HJK A;  4TUU A;  4IUM B;  2D2Q A;  4JQW C;  3W1S C;  2LUE A;  4E3C A;  3OAW A;  4KVG B;  4W9I A;  3V62 A;  3HM3 A;  2JRH A;  2O2V B;  4B95 A;  2PEA A;  5AEK B;  1GG3 A;  3VAW A;  5LLI A;  2BYE A;  3V6C B;  5L95 C;  2Z59 B;  3QC8 B;  3VHT C;  4BFR A;  2WX0 A;  4AP4 C;  2DYM A;  1CMX B;  1GC6 A;  4HLE A;  2RR9 A;  4JLC A;  2MQJ A;  1K8R B;  1KLV A;  2V1Y A;  1U4A A;  4DHZ E;  1NI2 A;  2DZM A;  4FHK A;  4YL8 A;  5J2R A;  1J8C A;  2K8H A;  1Q0W B;  4AOF A;  2LD9 A;  3PLU A;  1PQS A;  3MHS D;  3M95 A;  4KZ0 A;  3VVW B;  4BKS A;  3VTV A;  2NVU I;  4N9F 4;  2LI5 A;  4TV3 A;  3PGE A;  2GBN A;  1E8W A;  3UIO B;  3WAM A;  3ZNI D;  2LGX A;  4KDI C;  3MTN B;  2C7N B;  3APD A;  4DHJ D;  2D10 A;  1EF5 A;  2DHZ A;  4HWI B;  1WX9 A;  2M8S A;  1RLF A;  2R2O A;  4K7U A;  5D94 A;  4P7I A;  5D6J B;  2PE9 A;  2L8J A;  2Y5B B;  3ZKJ C;  1BT0 A;  2GBM A;  2GBR A;  3R3M A;  4FHJ A;  3NS8 A;  3T8M A;  3JYU A;  3QJZ A;  4NNJ B;  2KQS A;  4DDG D;  5AZH A;  4A3P A;  3H9D A;  1WM2 A;  2XK5 B;  4PS8 A;  2RGF A;  5DPR A;  4CHK A;  3ZIM A;  2DYO A;  2L0T A;  2RD0 A;  2MW5 A;  1WXA A;  3L17 A;  4BKS D;  3V6E B;  4BOZ B;  3QA8 A;  2L3Z A;  2DEN B;  4PYU A;  4A20 A;  1AAR A;  3L54 A;  3D32 A;  3M62 B;  4IWQ A;  1WZ0 A;  1YD8 U;  3WA0 A;  3GZN I;  3PRE A;  3UF8 A;  5JZE B;  4JGH B;  4I6N B;  2MBB B;  4G3X B;  4LDT B;  1LFD A;  3T9L A;  3VH3 B;  1E7V A;  4EKU A;  2CR5 A;  4OVV A;  2FID A;  4W9F A;  4IM3 A;  4GN1 A;  3PVL A;  2LXC A;  5CX3 A;  4ZRK A;  1E8Z A;  2KFJ A;  4WJQ A;  2FCS A;  2C7M B;  2KTR A;  2GOW A;  2LAS A;  2FUH B;  5JHA A;  1SIF A;  4WWO A;  3PRZ A;  3UQB A;  4KSL C;  2ZNV C;  3PZD A;  4GU2 A;  5LXI B;  3RZF A;  3ZUN A;  3CF6 E;  1E5W A;  3DVN U;  4EUT A;  4I6L B;  2N7E A;  2ASQ A;  3SD5 A;  3KW5 B;  3ZDM C;  4GDK B;  4GDK A;  4NJ7 A;  5EDS A;  3IFW B;  2G45 B;  2K1F A;  4KDL B;  4EEW A;  4DDI D;  1WFY A;  2D07 B;  2D3G A;  4DXA B;  2EMT A;  3DBS A;  5FR6 A;  4J6I A;  2N1W A;  2WDT B;  2O6V D;  1A5R A;  2L00 B;  1YQB A;  2OOB B;  1KM7 A;  1OTR B;  2KNB A;  4W9D A;  3TMP B;  2KMC A;  2FAZ A;  2HJ8 A;  4K7S A;  1G6J A;  2MBE A;  4KSK C;  3BIN A;  3DVG Y;  3L08 A;  4MSQ B;  3ML9 A;  2KXJ A;  2I1K A;  1P9D U;  1Q1O A;  3BY4 B;  4W9G A;  2RPQ A;  3CST A;  2KDI A;  4MDK E;  4WAA A;  1KOT A;  4F1S A;  4MH0 E;  2L76 A;  2UWQ A;  1GNU A;  3A1Q A;  2IO0 B;  3A9K B;  2DYB A;  3A9K A;  4HCN B;  4BOS C;  2QHO A;  2LJ5 A;  3QCA A;  2DZI A;  1P0R A;  4FN2 A;  2KLC A;  3Q3J A;  4M8N A;  2A4Z A;  2FCQ A;  2JZZ A;  4EFO A;  2JUO A;  3A4S C;  3A4R A;  2WX1 A;  2NBU A;  3N3K B;  2ZZP B;  1SE9 A;  4B6W A;  2JXX A;  3HK0 A;  3WAN A;  1J19 A;  1RRB A;  5DPS A;  1V81 A;  4GDL B;  1WF9 A;  4GDL A;  2AL6 A;  4HCP B;  1ZKH A;  2DX5 B;  4NAW B;  4NAW A;  3UIN B;  5E6N A;  4AUQ C;  5LXH A;  2LVO A;  2K6D B;  2O2V A;  3AI5 A;  4WWP A;  1LQB A;  3WAO A;  2KDB A;  2HTH A;  4MM3 A;  3NHE B;  4IC7 B;  1F9J A;  5C1Z A;  2KD0 A;  4EOY A;  2NBW B;  2V3S A;  3NZS A;  5DPW A;  1EF1 A;  4E74 A;  4EZJ A;  4BBN C;  4MGK E;  1V86 A;  2JWZ A;  1WGG A;  3V61 A;  1V5O A;  4NQK E;  1WH3 A;  2KWC A;  4ASW C;  4KIK B;  2ZPN A;  4KIK A;  3RZW C;  5CTR C;  2NPT B;  1MG8 A;  2NPT A;  2NR2 A;  1ZW7 A;  3OJ4 B;  3ZRC A;  1WZ3 A;  2A5U A;  4W9L A;  2C9W B;  3L0W B;  1YJ1 A;  2XEW A;  1GC7 A;  2KAN A;  1RFA A;  4NPN A;  3PSE B;  3RT3 B;  4FA6 A;  3O65 B;  3R7Q A;  4B9K A;  2I1J A;  3DDC B;  4F7Z A;  5IA7 A;  2G3Q B;  3DQV A;  4IM2 A;  4W9E A;  3QK0 A;  3ALB A;  5CHV C;  3U7D A;  3WAL A;  2ZNV B;  2C5L C;  1WM3 A;  3M3J A;  4HPM B;  2KOX A;  1IYF A;  2M17 A;  3PLV A;  4FLH A;  2CU1 A;  2LWP A;  3U8Z A;  3KUZ A;  3UQA A;  1IPG A;  2NBV B;  4XC2 A;  4ICV A;  3V60 A;  4ZDV A;  3I3T B;  3B0A A;  2KQ7 A;  3DBH I;  4WWN A;  2ZPY A;  3JW0 X;  5AZG A;  3SDL C;  3GOE A;  2JF5 A;  1R4M I;  3N30 A;  2XK5 A;  3NZU A;  1WY8 A;  3ZRF A;  4CO7 A;  1XT9 B;  2KJ6 A;  1S3S G;  2V4L A;  2R2Q A;  3VQI A;  3HIZ A;  1WE6 A;  2BGF A;  4HVB A;  1WR6 E;  2IYD B;  3AU5 A;  3CMM B;  2IY1 B;  1E8X A;  3M63 B;  3PV1 A;  4WJP A;  3KUD B;  4MSM B;  4PYZ A;  3RD2 A;  1WXM A;  2KJH B;  5DPT A;  2BYF A;  4W9C A;  4G11 A;  2KTF A;  2W9N A;  4LCD E;  2DAJ A;  3KUC B;  4HK2 A;  2LVP A;  3VUX A;  1C3T A;  4LJO B;  3WIM A;  2LGY A;  2J0K A;  3B1L X;  2KZR A;  1OEY J;  3VTU A;  1WJN A;  4BKT A;  4G50 A;  2KDE B;  2HE7 A;  3X0W A;  1EUV B;  2CHZ A;  2IO1 B;  1Z2M A;  2ZEQ A;  4AJY B;  3B08 A;  4PS7 A;  1JRU A;  1V6E A;  3P2B A;  2ZVN A;  2FCM A;  2CHX A;  4IW0 A;  1FXT B;  1ISN A;  3PT2 B;  1WGD A;  4HPL B;  3W1S A;  2NCN A;  1XD3 B;  1ZGU B;  2L7R A;  1VCB A;  4WJO A;  2JY6 A;  3TJP A;  4NJ6 A;  4LDT D;  2M1M A;  1J0G A;  1WGR A;  3MJW A;  2J0J A;  4JL9 A;  4FJZ A;  1WXV A;  3RYT A;  2DAF A;  1P1A A;  2KFK B;  2KFK A;  1UBI A;  2G4D B;  1WGH A;  1KJT A;  4K7W A;  2KWU B;  1UEL A;  3OLM D;  3LJ3 A;  3ONS A;  2MWS B;  3DCG A;  2HD5 B;  3K9P B;  3PHW B;  2K25 A;  3QX1 A;  1QZE A;  2KLG A;  2PE6 B;  2MP2 B;  3CSF A;  2MP2 A;  2IBI B;  3AXC A;  1YX5 B;  4HXD A;  2EKE C;  3EFU A;  3L16 A;  2MSE D;  2BKF A;  4II2 B;  1I42 A;  3VTW A;  5DCN A;  2Z0D B;  3H6N A;  2MBO A;  2K39 A;  4ANU A;  1E8Y A;  3AU4 A;  2MRP A;  4ZRI A;  2LVQ A;  1R4N I;  2YLM A;  3ML8 A;  4MGZ E;  3TBL D;  2LRU A;  4FUL A;  3DVN V;  3IVF A;  1OQY A;  2C7H A;  3QHT A;  1EO6 A;  4DK5 A;  3PPA A;  3ZVV A;  4MJS B;  2KMA A;  3HM6 X;  3IBE A;  3JVZ X;  3PS6 A;  4ZYN A;  5J17 A;  4ANV A;  4TQ0 A;  3Q3F A;  2UYZ B;  3VH4 B;  2GBJ A;  2KKC A;  2WYQ A;  4KV2 A;  1Y8R C;  5G2N A;  2KHW B;  3ZNG C;  4IG7 B;  1V9J A;  4FAD A;  2WWZ A;  4M8M A;  4GOC A;  1UD7 A;  2KVR A;  3H7P B;  3H7P A;  3WAP A;  3C0R B;  4ANX A;  1UH6 A;  2AEH A;  1L7Y A;  1WYW B;  4LJP B;  3QWZ B;  4G0N B;  1D3Z A;  1SGH A;  4HDO A;  2MCN B;  3QAR A;  2KC1 A;  1I35 A;  2MBQ A;  4FJY A;  2BF8 B;  2MLB A;  2KO3 A;  1YX6 B;  1C1Y B;  1V49 A;  4E71 A;  1X1M A;  5D2M B;  2YVC A;  3QQ8 B;  4EZL A;  2C60 A;  3NOB A;  5IAA C;  5C23 A;  4K81 A;  4I6P A;  1UBQ A;  2N7D A;  1TGZ B;  3HHM A;  4BBN F;  2N4F A;  3TL5 A;  1E90 A;  4DHJ B;  4DBG A;  2KWV B;  2N9P C;  2L05 A;  1P98 A;  2CHW A;  4MGI E;  3DPD A;  1IP9 A;  1VD2 A;  2D11 A;  3U30 A;  1TBE A;  2IO3 B;  3S2A A;  4RM9 A;  3R66 C;  3UIP B;  4AWJ A;  2AYO B;  5KHQ A;  1T0Y A;  2K6Q A;  3ZW3 A;  2PPH A;  3LDZ E;  2EMS A;  1LXD A;  4JIO U;  1WIA A;  3VDZ A;  3ZDT A;  2N9E B;  1OEY A;  2L0F A;  3PRM B;  3RUI B;  1WMH B;  1WMH A;  3H1U A;  2K8B A;  2ZCB A;  4KZC A;  3ZNZ B;  2RSU A;  3QAQ A;  4AJW A;  3VFK A;  4IM0 A;  1WE7 A;  5AZF A;  5E6O A;  5G55 A;  1V5T A;  3N32 A;  3SU8 X;  3VXW A;  3ZO5 B;  2NS5 A;  2OJR A;  3SHQ A;  2DZK A;  2M0X A;  2GMI C;  3H7S A;  4ANW A;  4ZRJ A;  4K1R B;  4F8C B;  3APF A;  4WJN A;  3A9J B;  2KK8 A;  3A9J A;  4HDQ A;  2VRR B;  2N9X A;  2N1V A;  4II3 B;  3RUL A;  3A33 B;  3DVG X;  1V80 A;  1GUA B;  4MGY E;  4TKN A;  4GSW A;  5E6P A;  2XBB C;  2ZCC A;  4TQ1 A;  1TZ1 A;  5HKH A;  2FIF A;  2BWF A;  3KH0 A;  5D7G A;  1H8C A;  4FJV B;  1WR1 A;  3RCZ A;  1NDD A;  2JRI B; 
#chains in the Genus database with same CATH topology
 3PHX B;  3K9O B;  4M02 A;  2EKI A;  4XWW A;  1NYR A;  2O6V B;  3KVF B;  2N7J A;  2WU2 B;  1JW9 D;  4X57 B;  2AL3 A;  4GXB A;  1WI0 A;  1WXS A;  3NY5 A;  4CYE A;  3AUL A;  2BT6 A;  1FCL A;  2JVC A;  5JHB A;  3IT6 B;  4KGT A;  2ZJD A;  4TSS A;  3VUW A;  4PK1 A;  2Z0E B;  1XLO A;  4M0W B;  3T3N A;  2G4S A;  2IO2 B;  4BKG A;  5CHW A;  5IN7 A;  4ICU A;  4PS3 A;  2CKH B;  3GB1 A;  3APC A;  1EU4 A;  3L10 B;  4XZ4 A;  5BO4 B;  4GGQ A;  4MJS A;  4W9K A;  3FKY A;  1GJZ A;  3BK1 A;  4USA A;  1LM8 B;  2ZVO A;  1YIW A;  3Q8E A;  5CHF A;  3AEF B;  2OHF A;  1N62 A;  1VJK A;  1SJH D;  3X23 A;  4MEM A;  5I4D A;  1RAX A;  2KX0 A;  3PTF C;  2AQ2 B;  1F52 A;  4HJK A;  5JXV A;  2QC8 A;  4IUM B;  2JZP A;  1LGR A;  2O2V B;  3VAW A;  2BYE A;  3V6C B;  4BFR A;  1JQ4 A;  1F77 A;  4AP4 C;  4YTM B;  1CMX B;  1GC6 A;  4HLE A;  3BYY B;  4XGA B;  1R4M B;  1DOX A;  1KLV A;  5HFY A;  2FBW B;  2PLP A;  4KZ0 A;  3VVW B;  2QEJ C;  1YN4 A;  1E8W A;  2WU5 B;  1JRO A;  4KDI C;  3URY A;  3GS2 A;  4DHJ D;  5FR3 A;  1EF5 A;  1C4C A;  1WX9 A;  2R2O A;  4K7U A;  2RDH A;  5D6J B;  2L8J A;  3ZGZ A;  3NJT A;  4FHJ A;  3NS8 A;  2BQQ A;  3DWG C;  1WM2 A;  2RGF A;  2WXF A;  2BB6 A;  4BKS D;  1GAQ B;  1BML C;  2L3Z A;  1AAR A;  3WA0 A;  4IWQ A;  1YD8 U;  3FC4 A;  4I6N B;  4G3X B;  3HUI A;  1E8Z A;  4NAM A;  4WJQ A;  1JAL A;  2FUH B;  5JHA A;  1Y56 A;  1WRI A;  2EEL A;  3ZDM C;  4J3O D;  3HRD D;  1SIJ A;  2K1F A;  1R4N B;  1Q10 A;  4KDL B;  2NTS A;  2D07 B;  2D3G A;  4DXA B;  2J53 A;  3AV8 A;  5FR6 A;  2N1W A;  4C4V B;  1YQB A;  1FCC C;  1KM7 A;  1OTR B;  4YWG G;  3BIN A;  3L08 A;  2LUM A;  2K5P A;  2J52 A;  1MI0 A;  2JSV X;  2QMT A;  3AE3 B;  3RFZ B;  3MC9 A;  3A9K B;  2DYB A;  4WQM A;  1WYG A;  2NBU A;  1SE9 A;  4B6W A;  2JXX A;  2MHJ A;  1J19 A;  5DPS A;  1FXI A;  4GDL B;  2JYE A;  2K6D B;  2OJW A;  3IAM 1;  3Q8C A;  4ITK A;  2KD0 A;  4EOY A;  5EE3 A;  4MGK E;  3AE4 B;  4KIK B;  1YN3 A;  3AE8 B;  2NPT A;  3OJ4 B;  3MC8 A;  2RPV A;  1YJ1 A;  3P4P B;  4O1N A;  3PSE B;  1L6U A;  4RGT A;  4B9K A;  2I1J A;  3DDC B;  5IA7 A;  2W54 A;  3WAL A;  1VLB A;  1MJD A;  4FLH A;  2CU1 A;  4C56 C;  5H92 C;  1ZP0 B;  4XC2 A;  3I3T B;  2KQ7 A;  1PGA A;  3SR6 A;  4JPS A;  1R4M I;  2XK5 A;  3TEX A;  2KAC A;  2V4L A;  4HVB A;  1WR6 E;  2IYD B;  3CMM B;  3PV1 A;  5FKA C;  2BB5 A;  4WJP A;  3I63 C;  4PYZ A;  3LXF A;  3RD2 A;  1WXM A;  2KJH B;  2MH7 A;  1TS4 A;  1T5X D;  2DAJ A;  3KUC B;  4HK2 A;  1ZDX A;  3WIM A;  5LNK 1;  3MP9 A;  4BKT A;  3ETR A;  1HQR D;  1QOA A;  1C4A A;  2CHZ A;  1N6Z A;  4AJY B;  3B08 A;  4RGM A;  1J7C A;  3P2B A;  3PT2 B;  4HPL B;  3W1S A;  1VCB A;  4A90 A;  1P7E A;  4NJ6 A;  1WGR A;  3EA6 A;  1WXQ A;  2G4D B;  2KFK A;  2QSD A;  1KJT A;  4K7W A;  3OLM D;  3LJ3 A;  3ONS A;  3DCG A;  2HD5 B;  1SE2 A;  2K25 A;  1KH0 A;  2KLG A;  2PE6 B;  1J7B A;  2IBI B;  1YX5 B;  2EKE C;  1ET9 A;  3U52 E;  3VTW A;  5DCN A;  1TT5 B;  2MRP A;  1R4N I;  3I57 A;  1SSN A;  4MGZ E;  4FUL A;  2G1E A;  1RM6 C;  2WXI A;  2KWD A;  4MJS B;  3Q3F A;  4P6V F;  2KKC A;  3ZNG C;  4RH6 A;  1UD7 A;  3H7P B;  4OW0 A;  4A6Q A;  1WYW B;  1QT9 A;  4LJP B;  4KX6 B;  3QWZ B;  1SGH A;  2KC1 A;  4FJY A;  2KO3 A;  3GP7 A;  1TJE A;  1C1Y B;  1KFY B;  5FK9 C;  3AH7 A;  5D2M B;  2J4X A;  4EZL A;  5IAA C;  5C23 A;  4K81 A;  1UBQ A;  3HHM A;  4BBN F;  2N4F A;  1HTO A;  2KWV B;  2L05 A;  1P98 A;  4MGI E;  3TUO A;  1VD2 A;  3S2A A;  1MVK A;  3AE9 B;  2AYO B;  1N5W A;  3EUB 2;  3Q3O C;  1WIA A;  4YTP B;  1ESF A;  2N9E B;  1OEY A;  3E9S A;  1CQV A;  3SFD B;  3P4S B;  4DXF A;  4AJW A;  4LNN A;  3N32 A;  3ZO5 B;  2NS5 A;  3TSS A;  3H7S A;  5IP4 D;  4WJN A;  3FIL A;  1T0Q C;  1HXY D;  4MGY E;  1TZ1 A;  2WXK A;  1UWX A;  2BWF A;  5D7G A;  4L1B A;  1H8C A;  2V3N A;  1WR1 A;  1V1P A;  1N61 A;  5HI1 A;  4YSZ B;  1DOI A;  3JSV B;  3ZLZ A;  2MA9 B;  3TCA A;  2JWU A;  2PMV A;  2IND C;  4W9J A;  2REX A;  4IWP A;  1TS5 A;  5TR5 A;  2BWE S;  2FNJ B;  1YJJ A;  4LNF A;  2LMC A;  4URK A;  2PJH A;  1H4R A;  5KHO A;  4C80 A;  4OVU A;  1NBF C;  3W1Y A;  3VUY A;  1D5M C;  1IBX B;  2MX2 A;  1V2Y A;  3EC8 A;  1XQQ A;  2ICI A;  2LZ6 A;  2KYW A;  1I4X A;  2M4N A;  1SE3 A;  4A8X C;  4WQO B;  1Z5S B;  2LRW A;  3ZTC A;  2KC2 A;  1KTK A;  1L4D B;  4GMV A;  2JT4 B;  2AWT A;  3QIJ A;  2ONQ A;  2LGS A;  4NQL B;  4L23 A;  3PRP B;  2JPH A;  4IWO A;  2DZJ A;  1P3Q U;  3DOW A;  3TIX A;  1YMH E;  2IGD A;  1FXA A;  4BAX A;  2MJD A;  1M94 A;  1XXG A;  4ZYS A;  1VZ7 A;  4OZA A;  2KJR A;  4KGS A;  3MC0 B;  2BPS A;  1HE8 A;  3OJ3 A;  4MEL A;  3B9J A;  1S1Q B;  3W1S C;  4JQW C;  1QKZ A;  3OAW A;  4W9I A;  1EU3 A;  1GG3 A;  5LLI A;  5H8Y E;  2ZW1 A;  3QC8 B;  1RWS A;  2WX0 A;  3GE3 C;  5GXG B;  2KT7 A;  1TZO A;  2DYM A;  3DBH B;  1ZUD 2;  3LYY A;  4JLC A;  2FUG 1;  1K8R B;  1U4A A;  5J2R A;  2I2Y A;  1DGJ A;  4AOF A;  1Q0W B;  5BMH A;  4BKS A;  4XYC A;  2LI5 A;  3PGE A;  3WAM A;  3ZNI D;  3W5U B;  1K50 A;  2C7N B;  3APD A;  1WGK A;  2DHZ A;  4HWI B;  2M8S A;  2LHE A;  3Q8A A;  4P7I A;  2Y5B B;  3DHI C;  3ZKJ C;  4ZHP A;  1YQ3 B;  4K3B A;  4NNJ B;  2KQS A;  4DDG D;  1L6V A;  3TEW A;  1FM0 D;  2XK5 B;  4PS8 A;  2L52 A;  2L0T A;  2D3A A;  1WXA A;  4M01 A;  4BOZ B;  3N1Z C;  2CJN A;  2K0P A;  1F1H A;  3D32 A;  1WZ0 A;  4R3D A;  4EKU A;  1LFD A;  3T9L A;  4OVV A;  3ZYY X;  2FID A;  3Q2A C;  1AWD A;  2J42 A;  4HJG E;  4NJC A;  1FEH A;  1PGB A;  2C7M B;  2KTR A;  1KLG D;  2GOW A;  3B2F A;  3PO0 A;  4KSL C;  2ZNV C;  5LXI B;  3T3O A;  4KGR A;  3DVN U;  4I6L B;  2ASQ A;  2WDV B;  4GDK B;  4NJ7 A;  3NS1 A;  2YEP F;  1TS2 A;  2PKO A;  3ZXR A;  4MH8 A;  4HRO A;  2VZK D;  1OQR A;  2QIL A;  1A5R A;  2OOB B;  1VR9 A;  2KNB A;  2W82 A;  3TMP B;  3AEA B;  5MPO A;  2FAZ A;  2MBE A;  1B1Z A;  1P9D U;  2RPQ A;  3CST A;  4OZC A;  1K52 A;  4MH0 E;  1GNU A;  3VR8 B;  3A1Q A;  2QHO A;  2VH1 A;  3NVW A;  3A4S C;  1AN8 A;  1FFU A;  1XLP A;  2WX1 A;  3N3K B;  2ZZP B;  1QOB A;  4REZ A;  1SB3 C;  2D3C A;  1RRB A;  3CIR B;  1A70 A;  1WF9 A;  1KLU D;  4NAW B;  4HRS A;  3UIN B;  5E6N A;  2LEK A;  3AI5 A;  3GE8 C;  4YT0 B;  1LQB A;  3WAO A;  2KDB A;  4MM3 A;  4IC7 B;  5C1Z A;  1M4V A;  2V3S A;  3IXS A;  1EF1 A;  3AE5 B;  2MJE A;  2JWZ A;  1WGG A;  3V61 A;  4RCO A;  1WH3 A;  2KWC A;  2WXL A;  5CTR C;  4S17 A;  1MG8 A;  2NR2 A;  1ZW7 A;  3Q6B A;  3ZRC A;  1EWY C;  2HTM E;  2A5U A;  1NEK B;  1UGJ A;  3RT3 B;  2YEP B;  4FA6 A;  1PGX A;  4F7Z A;  1GOZ A;  3QK0 A;  3ALB A;  1L0V B;  5CHV C;  2Q5W D;  2ZNV B;  3U7D A;  4D2K A;  1STE A;  3BYT B;  3ZQ4 A;  2LWP A;  2ZW0 A;  3DHH C;  4GLS C;  1C77 A;  3DBL B;  4ICV A;  3KWV A;  3DBH I;  3GZN B;  2WXO A;  5AZG A;  3GOE A;  3N30 A;  3ZRF A;  4HEA 1;  1VZ6 A;  2KJ6 A;  4L2Y A;  2BS4 B;  3HIZ A;  1WE6 A;  2IY1 B;  1FNW A;  5DPT A;  4W9C A;  2WHI A;  3FIL B;  4LCD E;  1SXT A;  2XN9 C;  2LVP A;  1L4Z B;  3X0W A;  2X38 A;  1Z2M A;  2ZEQ A;  1V1P B;  4PS7 A;  1V6E A;  1FRR A;  2FCM A;  2CHX A;  1WGD A;  2M56 B;  1XD3 B;  2L7R A;  1CK1 A;  4WJO A;  3TJP A;  3AMZ A;  3DBR B;  4LDT D;  1C9F A;  2M1M A;  1D5Z C;  1J0G A;  4FJZ A;  4LLG M;  1WGH A;  2LJI A;  1B9R A;  2KWU B;  2B76 B;  3AE1 B;  1J7A A;  2INP E;  2MP2 B;  3CSF A;  3EFU A;  1I42 A;  4HKQ A;  3KQ4 A;  2Z0D B;  3V3X A;  2MBO A;  2K39 A;  4ANU A;  1E8Y A;  2YLM A;  3ML8 A;  4H2A A;  1EO6 A;  2Y5C A;  3ZVV A;  2KMA A;  3HM6 X;  4TQ0 A;  3V05 A;  3VH4 B;  4ZRQ A;  2WYQ A;  2KHW B;  1V9J A;  2KVR A;  3C0R B;  1UH6 A;  1L7Y A;  4EE2 A;  1BUI C;  1I35 A;  2BF8 B;  3HVD A;  2MLB A;  2MEK A;  4P1C C;  2YVC A;  3QQ8 B;  3R2I A;  1L5P A;  3NOB A;  2WDQ B;  1HEZ E;  1IUE A;  2V9H A;  2DLB A;  1QF6 A;  4DHJ B;  3ZXV A;  4KKI A;  2KAJ A;  2PIA A;  3C8Y A;  1ZDV A;  1IP9 A;  2JQR B;  1TBE A;  4RM9 A;  1SEB D;  3R66 C;  5KHQ A;  1T0Y A;  2K6Q A;  4ZRP A;  4RF0 A;  3NVZ A;  4JIO U;  1LXD A;  3HVZ A;  2IJ0 A;  3ZDT A;  1WMH A;  4YXD B;  3H1U A;  2WNM A;  1PUT A;  3ZNZ B;  3SEB A;  4BZA A;  3QAQ A;  2WP9 B;  5E6O A;  3U7Z A;  3VXW A;  4XWT A;  1T0R C;  4Q2J A;  4ZRJ A;  3A9J B;  3Q3M C;  5IKC M;  4HDQ A;  2VRR B;  2N9X A;  2N1V A;  3RUL A;  3DVG X;  1GUA B;  4GSW A;  4TQ1 A;  5HKH A;  2FIF A;  3ABV B;  3ENE A;  4ZHO A;  3DBL I;  4DHZ B;  1L2N A;  4LNI A;  3IHP C;  3ZTD A;  2O6V A;  2B3A A;  3ECI A;  1ENF A;  4N58 A;  4XX5 A;  1EM7 A;  1E10 A;  2IZV B;  3R7R A;  2KTR B;  3SFE B;  1WX7 A;  1SE4 A;  1WX8 A;  2BKR B;  2J0M A;  2HJ1 A;  1XLQ A;  2KN5 A;  1WJ4 A;  1NI3 A;  2JX5 A;  5J18 A;  3L13 A;  3BZD B;  3KYD D;  4UDU C;  5JH5 C;  4S0R A;  3WCQ A;  2GBK A;  5BMI A;  1WJU A;  2CS4 A;  4A3O A;  1KF6 B;  4W9H A;  3KYC D;  3EHV A;  1WWT A;  3EEC A;  1TTN A;  3AED B;  1GPX A;  2MBH A;  2AQ1 B;  3DBR I;  3C19 A;  3A1Q B;  3EFC A;  1WJ6 A;  2IY0 B;  2K8C A;  1AYF A;  4DWF A;  4NY0 A;  1I4R A;  2WGS A;  1VRA B;  3EGR A;  1V1O A;  3BVZ A;  4FBJ B;  4E3C A;  2LUE A;  4YSY B;  2JRH A;  4B95 A;  2PEA A;  5AEK B;  3VHT C;  1NVI D;  2MQJ A;  2PVG C;  4A9A A;  1E0Z A;  2V1Y A;  4DHZ E;  3RPF C;  1NI2 A;  2DZM A;  1FMA D;  1J8C A;  2K8H A;  4YTN B;  1PQS A;  3M95 A;  2NVU I;  4N9F 4;  4TV3 A;  2UU7 A;  1DYQ A;  2GBN A;  4KKJ A;  3MTN B;  1P7F A;  1RLF A;  3NRZ A;  2PE9 A;  4HKZ E;  1UUP A;  2GBM A;  4AQ7 A;  2GBR A;  3R3M A;  3JYU A;  3QJZ A;  1HZ5 A;  5AZH A;  3H9D A;  5DPR A;  1NEN B;  3ZIM A;  2DYO A;  1JCK B;  5HG2 A;  3QA8 A;  4WH4 A;  2DEN B;  1I4P A;  4PYU A;  3L54 A;  3M62 B;  3PRE A;  3UF8 A;  5AUK A;  5JZE B;  4JGH B;  2MBB B;  2PW9 A;  3VH3 B;  1I4Q A;  4IM3 A;  3BII D;  1PFD A;  1QLB B;  4ZRK A;  3NG0 A;  2FCS A;  1SIF A;  3PRZ A;  3UQB A;  3U4E G;  3RZF A;  3CF6 E;  2GRI A;  2K22 A;  4EUT A;  3SD5 A;  1HA5 A;  3IFW B;  2RDG A;  1SJE D;  4EEW A;  1WFY A;  1XCT L;  2EMT A;  2HDE A;  2O6V D;  1C4P A;  2L00 B;  3BVM A;  3P63 A;  4W9D A;  2AX5 A;  2KMC A;  1G6J A;  1NYQ A;  2SAK A;  4KSK C;  3DVG Y;  4MSQ B;  2QIE B;  3BY4 B;  4W9G A;  1C76 A;  4WIP A;  2G9H D;  1UF0 A;  2KDI A;  4WAA A;  3VRB B;  4F1S A;  2L76 A;  1K51 A;  1BXT A;  3W5V B;  2IO0 B;  4HCN B;  3A9K A;  1JWM D;  1P0R A;  4FN2 A;  2KLC A;  3Q3J A;  4EFO A;  2FCQ A;  1SF0 A;  5HHD G;  3TEY A;  3AN1 A;  2H88 B;  1YQ4 B;  1QOF A;  2M0A A;  4RFB A;  3HK0 A;  3WAN A;  1V81 A;  2H89 B;  4GDL A;  2DX5 B;  2QJL A;  2Y3A A;  4AUQ C;  1YJI A;  5LXH A;  4WWP A;  2BYT A;  2HTH A;  1F9J A;  2NBW B;  3NZS A;  5DPW A;  4E74 A;  4EZJ A;  4US9 A;  1V5O A;  2WXR A;  5BYQ A;  1ZE3 D;  2ZPN A;  4KIK A;  3RZW C;  2NPT B;  2DBY A;  1WZ3 A;  3ZJT A;  1RFA A;  3O65 B;  3R7Q A;  1CJE A;  1TKY A;  3DQV A;  4W9E A;  1DOY A;  2C5L C;  3BWU D;  3M3J A;  1IYF A;  2KOX A;  3PLV A;  2WXN A;  2JXT A;  3UQA A;  1IPG A;  2NBV B;  2WXH A;  3OG5 A;  4ZDV A;  2WDR B;  3JW0 X;  2JF5 A;  1WY8 A;  2PTL A;  3I9V 1;  3VQI A;  4PT5 A;  2W3R A;  3AU5 A;  1E8X A;  3VRA B;  4MSM B;  2BYF A;  1F2R C;  1WSP A;  3R8B A;  4G11 A;  2W9N A;  1GB4 A;  1C3T A;  3VUX A;  3B1L X;  2KZR A;  3VTU A;  1WJN A;  2KMM A;  1EUV B;  2IO1 B;  2ZVN A;  2LGI A;  4IW0 A;  1FXT B;  1ISN A;  2NCN A;  1ZGU B;  3H8H A;  2BBC A;  4A55 A;  1V97 A;  1TYG B;  2JU6 X;  1UNS A;  2N0S B;  4ZOH C;  2J0J A;  4JL9 A;  1WXV A;  2DAF A;  1P1A A;  2KFK B;  1UBI A;  3DWM A;  3AEG B;  1OFF A;  1UEL A;  2MWS B;  3K9P B;  3PHW B;  4IOI E;  3QX1 A;  1QZE A;  3ZJU A;  3AXC A;  2MSE D;  2BKF A;  4RGN A;  3AU4 A;  4ZRI A;  2LVQ A;  1EWC A;  1XCQ L;  3AE2 B;  3KWL A;  2LRU A;  1UWM A;  3PZ7 A;  5BYR A;  3QHT A;  4DK5 A;  3PPA A;  1N60 A;  3IBE A;  3MJ5 A;  3JVZ X;  3PS6 A;  4XE0 A;  2UYZ B;  1Y8R C;  5G2N A;  4M8M A;  4GOC A;  3H7P A;  4ANX A;  5G5G A;  2AEH A;  4G0N B;  1D3Z A;  4HDO A;  3QAR A;  3RN9 C;  4QAY A;  1V49 A;  4N6E B;  4NZL B;  1PYW D;  4I6P A;  2ACZ B;  3RNA C;  2TSS A;  1TGZ B;  4AS1 A;  1E90 A;  4DBG A;  2ON8 A;  2N9P C;  2CHW A;  4JWU C;  2KQ4 X;  2D11 A;  3U30 A;  1JWA D;  3AEB B;  2IO3 B;  1XO3 A;  4FXC A;  3UIP B;  4LK0 M;  2JYT A;  3TEZ A;  2PPH A;  3LDZ E;  2EMS A;  5C3J B;  4XDD A;  2K8B A;  4KZC A;  3P4Q B;  2M19 A;  2V4I B;  1WE7 A;  5D3I B;  5G55 A;  4DQO C;  2XNA C;  2OJR A;  4F8C B;  2BW2 A;  2KK8 A;  3Q69 A;  1D6E C;  3A33 B;  2GB1 A;  1N63 A;  3AEC B;  4TKN A;  5E6P A;  2XBB C;  3ZJV A;  2R61 A;  4DXG A;  3CWI A;  2BS3 B;  3KLS X;  1NDD A;  2JRI B;  4BVU C;  2WLB A;  1MPE A;  3JSV A;  2VZK B;  2BTE A;  2RDB C;  1T0S C;  4CQN A;  2MJ3 A;  2V0G A;  2PVO D;  1C79 A;  2JZ3 B;  1UZX B;  2CU3 A;  5T8I A;  2BYV E;  1HTQ A;  4K3C A;  3AE6 B;  2IPK D;  1IBX A;  1ET6 A;  4GIV A;  3ZNH B;  1WGY A;  2FCN A;  1TIF A;  3AB5 A;  3VR9 B;  4LTU A;  3W9C B;  1TY0 A;  2LXA A;  2J7Q B;  2QCZ A;  1QQR A;  2WXQ A;  3N1X C;  1MHH E;  4GB9 A;  1Q5W B;  3IG3 A;  1OGW A;  1E7U A;  1UGM A;  1QOG A;  2LGD A;  4EZK A;  4RMA A;  5GMV A;  1I4G A;  5L83 A;  5EE1 A;  3N9Y C;  4RNA A;  2KX3 A;  4RM8 A;  2KDM A;  2KDF B;  1WRD B;  3UGB B;  4TUU A;  4P16 A;  2D2Q A;  3IAS 1;  4ARI A;  4KVG B;  3V62 A;  3HM3 A;  4WAF A;  1I7H A;  3IT4 B;  1JWU D;  5L95 C;  2Z59 B;  2Y5P A;  2RR9 A;  1PDX A;  1T6B X;  1VZ8 A;  4FHK A;  4YL8 A;  1RFK A;  2FE8 A;  1KRH A;  2LD9 A;  3PLU A;  5EE0 A;  5EE9 A;  3MHS D;  3VTV A;  4WUR A;  3N1Y C;  1GB1 A;  2IGG A;  3UIO B;  5E6J A;  2LGX A;  1F2R I;  2CJO A;  2D10 A;  2AQ3 B;  5D94 A;  5IO9 A;  3MFG A;  4M00 A;  1BT0 A;  1XF5 L;  3T8M A;  1TS3 A;  1E6E B;  2WXP A;  3NUH B;  2BS2 B;  4A3P A;  4N59 A;  3AEE B;  4CHK A;  2RD0 A;  2MW5 A;  3L17 A;  3V6E B;  3RNF C;  1L0X B;  1ROE A;  2WQY B;  4A20 A;  3GZN I;  1FFV A;  3PZ8 A;  3AE7 B;  2INN E;  3R2T A;  4LDT B;  4OVZ A;  4YSX B;  1E7V A;  2CR5 A;  4W9F A;  4GN1 A;  3PVL A;  2LXC A;  5CX3 A;  2KFJ A;  4ARC A;  1JWB D;  5AUI A;  2LAS A;  4WWO A;  3OWE B;  3PZD A;  4GU2 A;  1FO4 A;  2VH2 A;  3ZUN A;  1E5W A;  2Z8L A;  3RMK C;  2N7E A;  1FD6 A;  3KW5 B;  4GDK A;  2G45 B;  3AM9 A;  4C7Y A;  4DDI D;  4M0W A;  1FPY A;  3P42 A;  3DBS A;  4J6I A;  2WDT B;  4RF1 A;  1MHX A;  2HJ8 A;  4K7S A;  3UI3 A;  3NVV A;  3LB8 C;  1OQQ A;  3ML9 A;  2KXJ A;  2I1K A;  1Q1O A;  4P1B C;  4MDK E;  1KOT A;  2DWQ A;  2UWQ A;  4BOS C;  5BMG A;  2SEB D;  2LJ5 A;  3QCA A;  2DZI A;  1QIL A;  4M8N A;  2A4Z A;  2JZZ A;  2JUO A;  3BK2 A;  2L32 A;  4US8 A;  2KVZ A;  3A4R A;  2N9L A;  1IGD A;  2LFI A;  5IOI A;  3MHZ A;  4HCP B;  1ZPS A;  2AL6 A;  2LHD A;  1ZKH A;  4NAW A;  2GI9 A;  2QDF A;  2LVO A;  1CZP A;  3Q8B A;  2O2V A;  1E7P B;  3B2G A;  1I4H A;  4MM3 B;  3NHE B;  2D3B A;  4BBN C;  1ZXI A;  1V86 A;  1YN5 A;  4NQK E;  3RNG C;  4ASW C;  3RNB C;  2NTT A;  4W9L A;  2C9W B;  3L0W B;  2XEW A;  1JWS D;  1GC7 A;  2KAN A;  4NPN A;  1ZXH A;  2L83 A;  2G3Q B;  4IM2 A;  4OZB A;  3L4P A;  1WM3 A;  1XEE A;  2IDY A;  4HPP A;  4HPM B;  2M17 A;  1R7S A;  4B0M A;  3RI7 C;  1MFW A;  3KUZ A;  3U8Z A;  1ACC A;  2DNF A;  3V60 A;  3B0A A;  1RYJ A;  4WWN A;  2ZPY A;  1D5X C;  3SDL C;  3NZU A;  4JX1 C;  2N9K A;  4B0E A;  4CO7 A;  1XT9 B;  1S3S G;  1V8C A;  2R2Q A;  2BGF A;  2K9X A;  1JML A;  2IGH A;  3M63 B;  3KUD B;  3I5J C;  1FIQ A;  2KTF A;  3FAH A;  4LJO B;  2LGY A;  2J0K A;  1OEY J;  2WXM A;  3BVG A;  4G50 A;  2KDE B;  2HE7 A;  4TMA B;  1VDV A;  1TKG A;  1JRU A;  3RNE C;  3W2D A;  2W3S A;  5G5H A;  2WXJ A;  3RNC C;  1IGC A;  3Q14 C;  4JWS C;  1TKE A;  2X8X X;  1SBB B;  2K3U A;  3E56 A;  4MAC A;  2JY6 A;  4OHJ A;  3P1M A;  4IKG A;  4C4V A;  3MJW A;  2INC C;  3RYT A;  1E9M A;  2E3T A;  5D3D A;  2MP2 A;  4HXD A;  4C7Z A;  3L16 A;  4II2 B;  3N20 C;  3NZ3 A;  3P4R B;  3U2S C;  3H6N A;  4ACF A;  2GLS A;  2L1A A;  2KN4 A;  3TBL D;  4LNO A;  3DVN V;  3IVF A;  1C78 A;  1OQY A;  2C7H A;  2E6X A;  5J17 A;  4ZYN A;  4ANV A;  1TY2 A;  2GBJ A;  4KV2 A;  1MG4 A;  2D5G A;  4IG7 B;  4FAD A;  2RMM A;  2V3P A;  2WWZ A;  1N5X A;  3WAP A;  4WWM A;  2MCN B;  2MBQ A;  3DHG C;  1YX6 B;  1JRP A;  4E71 A;  1X1M A;  1HZ6 A;  2C60 A;  1T3Q A;  2N7D A;  1LO5 D;  1YOV B;  3TL5 A;  1XLN A;  4IDI A;  5BYS A;  2WS3 B;  4JE3 B;  3DPD A;  4MT5 A;  1FNU A;  2WXG A;  1F0Z A;  4AWJ A;  3O13 A;  2BVC A;  3ZW3 A;  1FNV A;  2I38 A;  3Q8F A;  3VDZ A;  1YNT E;  4LNK A;  1ZOY B;  2L0F A;  3PRM B;  3RUI B;  1WMH B;  2ZCB A;  1K53 A;  1FRD A;  2RSU A;  2OED A;  4C00 A;  3J9C A;  5TSS A;  3VFK A;  4IM0 A;  5AZF A;  3Q3N C;  4RGO S;  1V5T A;  3SU8 X;  3SHQ A;  2DZK A;  2M0X A;  2GMI C;  4ANW A;  4K1R B;  3APF A;  3A9J A;  4II3 B;  4XDC A;  1V80 A;  2NMQ A;  2W55 A;  1D4B A;  1AW7 A;  2ZCC A;  3NVY A;  3KH0 A;  4FJV B;  3RCZ A;  5C2T B;  1L0Y B;  5EDS A; 
#chains in the Genus database with same CATH homology
 3PHX B;  4BVU C;  3ENE A;  3K9O B;  3DBL I;  4DHZ B;  3JSV B;  1L2N A;  3JSV A;  3ZLZ A;  3IHP C;  2MA9 B;  3TCA A;  3ZTD A;  2O6V B;  2O6V A;  3KVF B;  2REX A;  4W9J A;  4IWP A;  2B3A A;  4X57 B;  2AL3 A;  3ECI A;  5TR5 A;  4GXB A;  4XX5 A;  2BWE S;  1WI0 A;  1WXS A;  2FNJ B;  2IZV B;  3NY5 A;  2KTR B;  3R7R A;  4CYE A;  3AUL A;  2JZ3 B;  1WX7 A;  1UZX B;  4URK A;  1WX8 A;  2BYV E;  2BKR B;  1H4R A;  2PJH A;  2JVC A;  5KHO A;  4OVU A;  5JHB A;  2J0M A;  1NBF C;  3W1Y A;  3VUY A;  2ZJD A;  2KN5 A;  3VUW A;  1WJ4 A;  2Z0E B;  2MX2 A;  1V2Y A;  3EC8 A;  4GIV A;  1XQQ A;  5J18 A;  2LZ6 A;  3L13 A;  3KYD D;  1WGY A;  2FCN A;  4M0W B;  3ZNH B;  2M4N A;  5JH5 C;  2GBK A;  4WQO B;  1Z5S B;  2G4S A;  2IO2 B;  4BKG A;  5CHW A;  4ICU A;  1WJU A;  2CS4 A;  4A3O A;  2LRW A;  4PS3 A;  3ZTC A;  4W9H A;  3KYC D;  2KC2 A;  2LXA A;  2J7Q B;  2CKH B;  3EHV A;  3EEC A;  1TTN A;  4GMV A;  2JT4 B;  1Q5W B;  4GB9 A;  2AWT A;  3QIJ A;  3APC A;  3L10 B;  3IG3 A;  4NQL B;  4XZ4 A;  1OGW A;  5BO4 B;  4GGQ A;  1E7U A;  1UGM A;  3PRP B;  4MJS A;  2LGD A;  2MBH A;  3DBR I;  4EZK A;  2JPH A;  4RMA A;  4IWO A;  4W9K A;  5GMV A;  2DZJ A;  3A1Q B;  1P3Q U;  5L83 A;  1WJ6 A;  2IY0 B;  1GJZ A;  3DOW A;  3TIX A;  2K8C A;  4DWF A;  4NY0 A;  1LM8 B;  2KX3 A;  2ZVO A;  4RM8 A;  1YIW A;  1M94 A;  5CHF A;  2KDF B;  1WRD B;  2KJR A;  3UGB B;  3X23 A;  4MEM A;  2BPS A;  1RAX A;  4FBJ B;  2KX0 A;  1HE8 A;  3OJ3 A;  3PTF C;  4MEL A;  1S1Q B;  4HJK A;  4TUU A;  4IUM B;  2D2Q A;  4JQW C;  3W1S C;  2LUE A;  4E3C A;  3OAW A;  4KVG B;  4W9I A;  3V62 A;  3HM3 A;  2JRH A;  2O2V B;  4B95 A;  2PEA A;  5AEK B;  1GG3 A;  3VAW A;  5LLI A;  2BYE A;  3V6C B;  5L95 C;  2Z59 B;  3QC8 B;  3VHT C;  4BFR A;  2WX0 A;  4AP4 C;  2DYM A;  1CMX B;  1GC6 A;  4HLE A;  2RR9 A;  4JLC A;  2MQJ A;  1K8R B;  1KLV A;  2V1Y A;  1U4A A;  4DHZ E;  1NI2 A;  2DZM A;  4FHK A;  4YL8 A;  5J2R A;  1J8C A;  2K8H A;  1Q0W B;  4AOF A;  2LD9 A;  3PLU A;  1PQS A;  3MHS D;  3M95 A;  4KZ0 A;  3VVW B;  4BKS A;  3VTV A;  2NVU I;  4N9F 4;  2LI5 A;  4TV3 A;  3PGE A;  2GBN A;  1E8W A;  3UIO B;  3WAM A;  3ZNI D;  2LGX A;  4KDI C;  3MTN B;  2C7N B;  3APD A;  4DHJ D;  2D10 A;  1EF5 A;  2DHZ A;  4HWI B;  1WX9 A;  2M8S A;  1RLF A;  2R2O A;  4K7U A;  5D94 A;  4P7I A;  5D6J B;  2PE9 A;  2L8J A;  2Y5B B;  3ZKJ C;  1BT0 A;  2GBM A;  2GBR A;  3R3M A;  4FHJ A;  3NS8 A;  3T8M A;  3JYU A;  3QJZ A;  4NNJ B;  2KQS A;  4DDG D;  5AZH A;  4A3P A;  3H9D A;  1WM2 A;  2XK5 B;  4PS8 A;  2RGF A;  5DPR A;  4CHK A;  3ZIM A;  2DYO A;  2L0T A;  2RD0 A;  2MW5 A;  1WXA A;  3L17 A;  4BKS D;  3V6E B;  4BOZ B;  3QA8 A;  2L3Z A;  2DEN B;  4PYU A;  4A20 A;  1AAR A;  3L54 A;  3D32 A;  3M62 B;  4IWQ A;  1WZ0 A;  1YD8 U;  3WA0 A;  3GZN I;  3PRE A;  3UF8 A;  5JZE B;  4JGH B;  4I6N B;  2MBB B;  4G3X B;  4LDT B;  1LFD A;  3T9L A;  3VH3 B;  1E7V A;  4EKU A;  2CR5 A;  4OVV A;  2FID A;  4W9F A;  4IM3 A;  4GN1 A;  3PVL A;  2LXC A;  5CX3 A;  4ZRK A;  1E8Z A;  2KFJ A;  4WJQ A;  2FCS A;  2C7M B;  2KTR A;  2GOW A;  2LAS A;  2FUH B;  5JHA A;  1SIF A;  4WWO A;  3PRZ A;  3UQB A;  4KSL C;  2ZNV C;  3PZD A;  4GU2 A;  5LXI B;  3RZF A;  3ZUN A;  3CF6 E;  1E5W A;  3DVN U;  4EUT A;  4I6L B;  2N7E A;  2ASQ A;  3SD5 A;  3KW5 B;  3ZDM C;  4GDK B;  4GDK A;  4NJ7 A;  5EDS A;  3IFW B;  2G45 B;  2K1F A;  4KDL B;  4EEW A;  4DDI D;  1WFY A;  2D07 B;  2D3G A;  4DXA B;  2EMT A;  3DBS A;  5FR6 A;  4J6I A;  2N1W A;  2WDT B;  2O6V D;  1A5R A;  2L00 B;  1YQB A;  2OOB B;  1KM7 A;  1OTR B;  2KNB A;  4W9D A;  3TMP B;  2KMC A;  2FAZ A;  2HJ8 A;  4K7S A;  1G6J A;  2MBE A;  4KSK C;  3BIN A;  3DVG Y;  3L08 A;  4MSQ B;  3ML9 A;  2KXJ A;  2I1K A;  1P9D U;  1Q1O A;  3BY4 B;  4W9G A;  2RPQ A;  3CST A;  2KDI A;  4MDK E;  4WAA A;  1KOT A;  4F1S A;  4MH0 E;  2L76 A;  2UWQ A;  1GNU A;  3A1Q A;  2IO0 B;  3A9K B;  2DYB A;  3A9K A;  4HCN B;  4BOS C;  2QHO A;  2LJ5 A;  3QCA A;  2DZI A;  1P0R A;  4FN2 A;  2KLC A;  3Q3J A;  4M8N A;  2A4Z A;  2FCQ A;  2JZZ A;  4EFO A;  2JUO A;  3A4S C;  3A4R A;  2WX1 A;  2NBU A;  3N3K B;  2ZZP B;  1SE9 A;  4B6W A;  2JXX A;  3HK0 A;  3WAN A;  1J19 A;  1RRB A;  5DPS A;  1V81 A;  4GDL B;  1WF9 A;  4GDL A;  2AL6 A;  4HCP B;  1ZKH A;  2DX5 B;  4NAW B;  4NAW A;  3UIN B;  5E6N A;  4AUQ C;  5LXH A;  2LVO A;  2K6D B;  2O2V A;  3AI5 A;  4WWP A;  1LQB A;  3WAO A;  2KDB A;  2HTH A;  4MM3 A;  3NHE B;  4IC7 B;  1F9J A;  5C1Z A;  2KD0 A;  4EOY A;  2NBW B;  2V3S A;  3NZS A;  5DPW A;  1EF1 A;  4E74 A;  4EZJ A;  4BBN C;  4MGK E;  1V86 A;  2JWZ A;  1WGG A;  3V61 A;  1V5O A;  4NQK E;  1WH3 A;  2KWC A;  4ASW C;  4KIK B;  2ZPN A;  4KIK A;  3RZW C;  5CTR C;  2NPT B;  1MG8 A;  2NPT A;  2NR2 A;  1ZW7 A;  3OJ4 B;  3ZRC A;  1WZ3 A;  2A5U A;  4W9L A;  2C9W B;  3L0W B;  1YJ1 A;  2XEW A;  1GC7 A;  2KAN A;  1RFA A;  4NPN A;  3PSE B;  3RT3 B;  4FA6 A;  3O65 B;  3R7Q A;  4B9K A;  2I1J A;  3DDC B;  4F7Z A;  5IA7 A;  2G3Q B;  3DQV A;  4IM2 A;  4W9E A;  3QK0 A;  3ALB A;  5CHV C;  3U7D A;  3WAL A;  2ZNV B;  2C5L C;  1WM3 A;  3M3J A;  4HPM B;  2KOX A;  1IYF A;  2M17 A;  3PLV A;  4FLH A;  2CU1 A;  2LWP A;  3U8Z A;  3KUZ A;  3UQA A;  1IPG A;  2NBV B;  4XC2 A;  4ICV A;  3V60 A;  4ZDV A;  3I3T B;  3B0A A;  2KQ7 A;  3DBH I;  4WWN A;  2ZPY A;  3JW0 X;  5AZG A;  3SDL C;  3GOE A;  2JF5 A;  1R4M I;  3N30 A;  2XK5 A;  3NZU A;  1WY8 A;  3ZRF A;  4CO7 A;  1XT9 B;  2KJ6 A;  1S3S G;  2V4L A;  2R2Q A;  3VQI A;  3HIZ A;  1WE6 A;  2BGF A;  4HVB A;  1WR6 E;  2IYD B;  3AU5 A;  3CMM B;  2IY1 B;  1E8X A;  3M63 B;  3PV1 A;  4WJP A;  3KUD B;  4MSM B;  4PYZ A;  3RD2 A;  1WXM A;  2KJH B;  5DPT A;  2BYF A;  4W9C A;  4G11 A;  2KTF A;  2W9N A;  4LCD E;  2DAJ A;  3KUC B;  4HK2 A;  2LVP A;  3VUX A;  1C3T A;  4LJO B;  3WIM A;  2LGY A;  2J0K A;  3B1L X;  2KZR A;  1OEY J;  3VTU A;  1WJN A;  4BKT A;  4G50 A;  2KDE B;  2HE7 A;  3X0W A;  1EUV B;  2CHZ A;  2IO1 B;  1Z2M A;  2ZEQ A;  4AJY B;  3B08 A;  4PS7 A;  1JRU A;  1V6E A;  3P2B A;  2ZVN A;  2FCM A;  2CHX A;  4IW0 A;  1FXT B;  1ISN A;  3PT2 B;  1WGD A;  4HPL B;  3W1S A;  2NCN A;  1XD3 B;  1ZGU B;  2L7R A;  1VCB A;  4WJO A;  2JY6 A;  3TJP A;  4NJ6 A;  4LDT D;  2M1M A;  1J0G A;  1WGR A;  3MJW A;  2J0J A;  4JL9 A;  4FJZ A;  1WXV A;  3RYT A;  2DAF A;  1P1A A;  2KFK B;  2KFK A;  1UBI A;  2G4D B;  1WGH A;  1KJT A;  4K7W A;  2KWU B;  1UEL A;  3OLM D;  3LJ3 A;  3ONS A;  2MWS B;  3DCG A;  2HD5 B;  3K9P B;  3PHW B;  2K25 A;  3QX1 A;  1QZE A;  2KLG A;  2PE6 B;  2MP2 B;  3CSF A;  2MP2 A;  2IBI B;  3AXC A;  1YX5 B;  4HXD A;  2EKE C;  3EFU A;  3L16 A;  2MSE D;  2BKF A;  4II2 B;  1I42 A;  3VTW A;  5DCN A;  2Z0D B;  3H6N A;  2MBO A;  2K39 A;  4ANU A;  1E8Y A;  3AU4 A;  2MRP A;  4ZRI A;  2LVQ A;  1R4N I;  2YLM A;  3ML8 A;  4MGZ E;  3TBL D;  2LRU A;  4FUL A;  3DVN V;  3IVF A;  1OQY A;  2C7H A;  3QHT A;  1EO6 A;  4DK5 A;  3PPA A;  3ZVV A;  4MJS B;  2KMA A;  3HM6 X;  3IBE A;  3JVZ X;  3PS6 A;  4ZYN A;  5J17 A;  4ANV A;  4TQ0 A;  3Q3F A;  2UYZ B;  3VH4 B;  2GBJ A;  2KKC A;  2WYQ A;  4KV2 A;  1Y8R C;  5G2N A;  2KHW B;  3ZNG C;  4IG7 B;  1V9J A;  4FAD A;  2WWZ A;  4M8M A;  4GOC A;  1UD7 A;  2KVR A;  3H7P B;  3H7P A;  3WAP A;  3C0R B;  4ANX A;  1UH6 A;  2AEH A;  1L7Y A;  1WYW B;  4LJP B;  3QWZ B;  4G0N B;  1D3Z A;  1SGH A;  4HDO A;  2MCN B;  3QAR A;  2KC1 A;  1I35 A;  2MBQ A;  4FJY A;  2BF8 B;  2MLB A;  2KO3 A;  1YX6 B;  1C1Y B;  1V49 A;  4E71 A;  1X1M A;  5D2M B;  2YVC A;  3QQ8 B;  4EZL A;  2C60 A;  3NOB A;  5IAA C;  5C23 A;  4K81 A;  4I6P A;  1UBQ A;  2N7D A;  1TGZ B;  3HHM A;  4BBN F;  2N4F A;  3TL5 A;  1E90 A;  4DHJ B;  4DBG A;  2KWV B;  2N9P C;  2L05 A;  1P98 A;  2CHW A;  4MGI E;  3DPD A;  1IP9 A;  1VD2 A;  2D11 A;  3U30 A;  1TBE A;  2IO3 B;  3S2A A;  4RM9 A;  3R66 C;  3UIP B;  4AWJ A;  2AYO B;  5KHQ A;  1T0Y A;  2K6Q A;  3ZW3 A;  2PPH A;  3LDZ E;  2EMS A;  1LXD A;  4JIO U;  1WIA A;  3VDZ A;  3ZDT A;  2N9E B;  1OEY A;  2L0F A;  3PRM B;  3RUI B;  1WMH B;  1WMH A;  3H1U A;  2K8B A;  2ZCB A;  4KZC A;  3ZNZ B;  2RSU A;  3QAQ A;  4AJW A;  3VFK A;  4IM0 A;  1WE7 A;  5AZF A;  5E6O A;  5G55 A;  1V5T A;  3N32 A;  3SU8 X;  3VXW A;  3ZO5 B;  2NS5 A;  2OJR A;  3SHQ A;  2DZK A;  2M0X A;  2GMI C;  3H7S A;  4ANW A;  4ZRJ A;  4K1R B;  4F8C B;  3APF A;  4WJN A;  3A9J B;  2KK8 A;  3A9J A;  4HDQ A;  2VRR B;  2N9X A;  2N1V A;  4II3 B;  3RUL A;  3A33 B;  3DVG X;  1V80 A;  1GUA B;  4MGY E;  4TKN A;  4GSW A;  5E6P A;  2XBB C;  2ZCC A;  4TQ1 A;  1TZ1 A;  5HKH A;  2FIF A;  2BWF A;  3KH0 A;  5D7G A;  1H8C A;  4FJV B;  1WR1 A;  3RCZ A;  1NDD A;  2JRI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...