2B76B

E. coli quinol fumarate reductase frda e49q mutation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2b76B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2b76B01
3LB8C 1E9MA 2M19A 3AE3B 2ACZB 2CU3A 1EWYC 5EE3A 3AMZA 4ZOHC 2WLBA 3HUIA 1A70A 1L5PA 1L0VB 1YJIA 4WQMA 1E10A 1QOFA 3L4PA 2W3SA 4US8A 1ZXIA 3B2FA 1GPXA 3AEEB 1XLOA 2WQYB 2WU5B 3FC4A 2DBYA 1N5WA 3P4QB 1OFFA 1IUEA 1FIQA 1XLQA 3CF4A 3P4SB 1NYQA 1VLBA 1RFKA 5G5GA 3P4RB 1WGKA 3SFEB 1AWDA 1N60A 3NS1A 4LTUA 1B9RA 1DOXA 1SB3C 1GT8A 1ZUD2 5EE9A 4YTMB 1JWBD 3CIRB 4HROA 4WWMA 2MJEA 3W5UB 4YSXB 3AV8A 3VR9B 5AUKA 4N58A 2PVGC 3BIID 3ABVB 1AYFA 5EE1A 1YJJA 2WDVB 1FFVA 3DWGC 1TJEA 1SIJA 3AM9A 2QIEB 2W54A 5EE0A 1FRDA 1XO3A 3NVWA 2WU2B 1TKYA 2QJLA 4KX6B 3DWMA 2Q5WD 2W55A 2PIAA 3P63A 2M56B 2WS3B 4A9AA 2HTME 1KRHA 1VJKA 1FRRA 1KF6B 1J7AA 1CZPA 1QLBB 3EUB2 1TKGA 4ZHPA 1N61A 1J7CA 1PUTA 2KMMA 1FM0D 3LXFA 1XLNA 1L6UA 1V8CA 1J7BA 2G1EA 3AE5B 3HVZA 3KWLA 4IDIA 1I7HA 1V97A 1FXIA 4YSYB 4YT0B 3AE7B 3SR6A 3P4PB 1JWAD 1QT9A 2AX5A 2WDRB 1TKEA 4ITKA 1WYGA 5C2TB 1H7WA 1YQ4B 2H88B 3AE4B 1FXAA 2E3TA 4JWSC 3PO0A 4JX1C 3NRZA 1WRIA 1GTEA 1NYRA 2L52A 3AEGB 3CWIA 3NVYA 5G5HA 2Y5CA 4N6EB 3AE9B 1WWTA 3B9JA 1JRPA 1RM6C 3WCQA 5H8YE 1TYGB 2PVOD 1JALA 1FFUA 3SFDB 1QOBA 1ROEA 2JQRB 1PFDA 4HRSA 2BS2B 1E0ZA 1GTHA 1CJEA 2WP9B 2JX5A 3VRAB 2OHFA 4P6VF 1F0ZA 2BT6A 2MH7A 2PKOA 2CJNA 2H89B 4US9A 4ZHOA 3B2GA 2MJDA 3AEFB 2EKIA 2W3RA 2N0SB 4C7ZA 2K22A 3AECB 2WDQB 1NVID 1R7SA 3AE6B 1DGJA 2KAJA 3RPFC 3AH7A 2L83A 1OQRA 3NVZA 2K9XA 4C80A 1GAQB 1RYJA 1KFYB 3AE8B 3FAHA 1QOAA 3AB5A 3AEBB 3AEDB 3VR8B 1RWSA 1WXQA 1NENB 2BS4B 4YTPB 3W5VB 5MPOA 1XLPA 1N62A 1NEKB 1QOGA 1FO4A 1NI3A 3ETRA 1N63A 1DOIA 4FXCA 4YTNB 4JWUC 3W9CB 2MJ3A 1ZOYB 4YXDB 1L6VA 1FMAD 1PDXA 3AN1A 1QF6A 1DOYA 2LEKA 4YSZB 5C3JB 1YQ3B 3VRBB 2K5PA 1OQQA 3AEAB 3AE2B 1T3QA 2CJOA 1UWMA 1JQ4A 3P1MA 3AE1B 3NVVA 2B76B 2DWQA 1VDVA 1E7PB 4N59A 4USAA 5H92C 1JW9D 1SF0A 1H7XA 1E6EB 1N5XA 2BS3B 1ZP0B 5AUIA 1JROA 5GXGB 3ZYYX 4C7YA 2FBWB 3HRDD
chains in the Genus database with same CATH superfamily
3KUZA 1EU4A 3PLUA 4HJKA 1C3TA 3VUWA 2N4FA 2FCMA 3PVLA 2W3SA 1HQRD 1ZXIA 3WALA 1I4RA 1F2RC 2WU5B 2QILA 3W1SC 2D3BA 2CHWA 1MPEA 2C7NB 3NS1A 3MJWA 2BGFA 3APFA 3E56A 3Q8BA 5AUKA 2ZVNA 3VAWA 2PE6B 1FFVA 5CHWA 3QHTA 5C23A 1F9JA 4KZ0A 3V62A 4YWGG 1KRHA 3H8HA 2JPHA 1TKGA 4OHJA 1PUTA 3B0AA 1WRDB 2MBOA 3KWLA 1UWXA 3TUOA 3IXSA 3QCAA 4W9EA 1V9JA 3AI5A 3JSVB 2KFKB 2GBRA 2DAFA 1UGJA 2CU1A 3OWEB 3KUDB 4B0MA 2HJ1A 1RM6C 3FILA 1FFUA 2BVCA 4NJ6A 2NCNA 4ACFA 4KGRA 2KWVB 1UNSA 4MGZE 4EFOA 5IN7A 2JY6A 4TUUA 2EMTA 3NVZA 3QA8A 4OVUA 1OEYJ 3MC8A 3NJTA 3ZVVA 3RNFC 1RWSA 3W5VB 2IO1B 2L32A 1WZ0A 3ZTCA 2BF8B 3ETRA 1DOIA 2JT4B 4JWUC 3I9V1 3WAMA 1N6ZA 1I4PA 4GOCA 5AEKB 1JQ4A 4KIKA 3AE1B 1BT0A 1L4ZB 3A1QB 3QWZB 4HJGE 3WANA 1VDVA 4K7WA 4N59A 2ASQA 3TCAA 4NPNA 2BS3B 4OVZA 4PS3A 1UF0A 4RM9A 4BAXA 3N9YC 2M19A 2V3PA 1P1AA 2VZKD 3AEEB 4FHJA 1HEZE 1N5WA 1SE9A 2Z0EB 2MRPA 3QX1A 4W9LA 4HK2A 4C00A 1I4HA 4GN1A 1ZW7A 2DZJA 1UH6A 4WWMA 3DHGC 3W5UB 2LHEA 1AYFA 1Y8RC 1MHHE 3UQAA 5EE0A 2Q5WD 2W55A 2PIAA 2XN9C 2RDBC 3ZJVA 2WWZA 2M17A 3EUB2 3MHSD 3OLMD 4TQ0A 4FHKA 4IM2A 1RRBA 1HZ5A 3ZNZB 2FCQA 3BK2A 2KZRA 4KDIC 2N1WA 3TEZA 2LGIA 2K25A 1TS5A 1K50A 3R8BA 3H6NA 1E0ZA 3H7SA 2OJWA 2JX5A 4IWQA 1Z2MA 4P6VF 3PRMB 1UELA 3ZW3A 3EECA 2K22A 3AH7A 1OQRA 4IWOA 1P7FA 3HM3A 3NS8A 2AWTA 3ZRFA 3AB5A 3T8MA 3L08A 1MHXA 1QF6A 4CO7A 2D3GA 1CQVA 4A55A 2W9NA 3TEXA 5E6NA 2V3SA 1WXSA 4HEA1 3IAS1 2JWZA 4KDLB 5IP4D 4UDUC 2L1AA 2I38A 3BY4B 3H9DA 3B2FA 3TBLD 1F52A 1V5OA 4W9FA 3P4QB 2BWFA 1MJDA 1RFKA 1WGKA 1C4PA 2NVUI 3HHMA 1TIFA 2AEHA 2J53A 3LJ3A 1SE4A 5D7GA 1R4NI 4HWIB 4FLHA 3DBLI 2W54A 3RT3B 4WH4A 3Q2AC 4JE3B 1WZ3A 3PPAA 3Q8EA 4PYZA 2LMCA 2M56B 2VH2A 1SEBD 4AS1A 3BK1A 1R4MI 1I7HA 4BFRA 3A9JA 4K3CA 4YT0B 3AE7B 1IGDA 3Q8CA 4FN2A 2M1MA 3GE3C 3T3NA 1EM7A 2V0GA 2KWDA 2GBJA 1MG4A 4IKGA 5CHVC 3O65B 3RZWC 1YN4A 1OEYA 4RF1A 3VRAB 5BMIA 3ZGZA 2PKOA 1LFDA 4US9A 1J0GA 3AEFB 4RMAA 2W3RA 3AECB 1WGHA 4P1CC 2X8XX 4IC7B 1ET9A 2NTSA 1QOAA 3AEBB 4KGTA 1NEKB 2C5LC 2I2YA 4AP4C 2K5PA 1KJTA 4DHZB 2LXCA 4MGIE 1EF5A 1ET6A 2KC2A 2JU6X 2QMTA 1UBQA 1E7PB 2ZJDA 3UIPB 2MQJA 2XK5A 1WGGA 3WAOA 1V6EA 1LQBA 3AXCA 1WX9A 4ANUA 1XEEA 2PW9A 1WIAA 3QIJA 2BB6A 3KW5B 1RLFA 2FAZA 3L54A 4JQWC 3NUHB 2LXAA 1JWBD 2O6VB 3KVFB 2MJEA 2N7DA 4K81A 2IZVB 2O6VD 1TT5B 2LGDA 3PSEB 4WWPA 2YEPF 4ZRQA 4RNAA 4FJYA 1QLBB 2WNMA 3DBRI 3GS2A 1IBXB 3DCGA 3QAQA 4A8XC 1WXAA 1KLUD 3NZUA 4F8CB 1TS3A 2AYOB 2D10A 2N7JA 2JZZA 1ZDXA 2WXFA 3GB1A 4PT5A 2MP2B 3UQBA 4N6EB 1Q1OA 1WJUA 4MELA 3SFDB 2MA9B 2BKFA 2KJ6A 3L0WB 4KZCA 1SIFA 2DHZA 1OQYA 3BWUD 1QKZA 3KYCD 3DPDA 2DYMA 3AEDB 4KVGB 5AZHA 4ZRKA 3VHTC 3TEWA 2KX3A 1V5TA 2ZZPB 2N9LA 2K8CA 2KOXA 4EZJA 1WJ6A 1T3QA 3GOEA 1U4AA 1AN8A 2JZ3B 1JW9D 1T0QC 2IYDB 5L95C 2DYOA 3WIMA 3A4SC 4P1BC 2KANA 3U52E 4FBJB 3X0WA 2VRRB 1XLOA 2RPVA 2JF5A 2QDFA 2WYQA 1WSPA 4C4VA 1JCKB 3FILB 1FXTB 1ENFA 2KX0A 4I6NB 5E6JA 3UIOB 5EDSA 3N1YC 5G2NA 1F2RI 2SAKA 4FJZA 2FCNA 1YJJA 3D32A 3DQVA 1F1HA 3DWGC 1UD7A 3AM9A 1YX5B 4ICUA 4LLGM 1FRDA 4PS7A 2QJLA 3RUIB 2KFJA 4A9AA 4K7SA 2C60A 3DVNV 4LK0M 1I35A 3QQ8B 2MHJA 2LFIA 4MM3A 1EF1A 1FEHA 1QT9A 2PE9A 1WX7A 3BZDB 2ZPYA 2HD5B 2H88B 2JRHA 4TSSA 4KIKB 3PO0A 1V80A 1NYRA 4IM0A 4DK5A 4XDDA 2KTRA 1JRUA 5IOIA 1D4BA 3V6EB 5HG2A 2EMSA 1JRPA 3WCQA 5D3DA 2N9KA 2PVOD 3ZDMC 2AQ2B 4J6IA 2L00B 2LVOA 2Z8LA 4ZHOA 2K6QA 2A5UA 2BYTA 3PRPB 3EGRA 1YOVB 4NY0A 2G4DB 2YLMA 1E5WA 2NS5A 4MSMB 2LGXA 1WGYA 2MBBB 5MPOA 1EUVB 4JGHB 1N63A 4HKQA 4RF0A 4YXDB 3FKYA 4A6QA 3NZSA 4HPMB 1HE8A 3VFKA 3U30A 4K1RB 1OTRB 3B08A 1T0YA 3V6CB 1J19A 3Q8FA 2FUHB 1IYFA 2IPKD 4DXGA 2CU3A 4S0RA 4DWFA 1QOFA 3TL5A 2D3CA 5BYSA 4K3BA 1P98A 2JSVX 1ZUD2 3C0RB 2L05A 1EU3A 2GLSA 2V3NA 3VTWA 2KLCA 3BIID 4BVUC 3KLSX 1CK1A 3EHVA 4XGAB 1C79A 4W9JA 4LDTB 1E8ZA 2KYWA 3P42A 1P3QU 1T6BX 1TTNA 1CZPA 2JZPA 3E9SA 1G6JA 4QAYA 4YSYB 3I3TB 4FJVB 1VZ7A 1SE3A 2L7RA 3T3OA 2GB1A 4LCDE 3I5JC 4URKA 2KMCA 1YMHE 3AULA 3HM6X 1WXMA 3U7ZA 3L16A 1HTQA 4M02A 1PYWD 1L4DB 3IFWB 2H89B 2OJRA 2DZKA 2LVQA 4ICVA 1WH3A 2V9HA 1S3SG 2EKEC 2D2QA 3JYUA 3UF8A 3RZFA 1WJNA 1RYJA 4A20A 3AE8B 1ZE3D 3R7RA 1HZ6A 1XLPA 1QOGA 5BYQA 4MJSA 4AWJA 1L0YB 1FMAD 3DBSA 2C7MB 1FCLA 3IT6B 2B76B 4USAA 2DAJA 4XC2A 1P7EA 4XZ4A 1N5XA 2N9XA 3ALBA 1SXTA 4ARCA 2Y5PA 3A9JB 4LNFA 2LGSA 3S2AA 3DDCB 3HK0A 2X38A 1VZ6A 3MC0B 4W9KA 1FCCC 1NI2A 2FIDA 5FK9C 4LNNA 1LO5D 3ZNID 3NOBA 1C78A 4AJWA 3P63A 3M62B 4ARIA 4B9KA 3M95A 1KF6B 1H8CA 1GNUA 2GI9A 1XLNA 2WXQA 3HVZA 2DZMA 2KDBA 2HJ8A 4REZA 1YQ4B 3AE4B 1AW7A 4W9CA 4PK1A 1M94A 1GUAB 3WAPA 3HIZA 2K8HA 4F7ZA 1E8YA 1FNVA 1QOBA 2XK5B 3CSFA 4W9GA 1YIWA 1ZKHA 1XD3B 3DHIC 3B2GA 2UWQA 5TSSA 2NTTA 3URYA 3RPFC 1ZPSA 2L83A 1HA5A 3PZ7A 5D94A 1ZDVA 2MBQA 1I4QA 3JVZX 5DPWA 3VXWA 1NI3A 3KWVA 4HCPB 3W9CB 3RN9C 3DBHB 1E8XA 1FNWA 2LEKA 3AEAB 4RFBA 2CJOA 2K6DB 2GBKA 3N1XC 4GDLB 3GP7A 2UYZB 4C7YA 5GXGB 3PTFC 1OGWA 5FKAC 3ML8A 3Q8AA 2KD0A 3AE3B 5EE3A 3ZJUA 5IAAC 2WLBA 1L0VB 1GPXA 2Y3AA 3FC4A 2G4SA 1WM2A 2IDYA 2PPHA 4A90A 5G5GA 2OEDA 1SBBB 2JYTA 2L0FA 3SFEB 2N9PC 3PS6A 4EE2A 4DBGA 3B1LX 4I6PA 4XWTA 5EE9A 2KTFA 4YTMB 3PV1A 4S17A 3ZNHB 3ZTDA 2IY0B 5DPTA 1YN5A 2TSSA 4DXAB 3NG0A 1V86A 2RD0A 1FM0D 2KHWB 1V8CA 1J7BA 2YVCA 2IJ0A 3C19A 2KWUB 3SR6A 3LYYA 2AX5A 4MH8A 2E3TA 3ZXVA 2LJIA 1P9DU 1STEA 1D3ZA 1V81A 3ONSA 2OOBB 5JZEB 1JALA 1KH0A 2CKHB 2BS2B 2PEAA 3I57A 2JUOA 2MSED 3H1UA 3TIXA 2MJDA 4RH6A 1UZXB 2DENB 3EC8A 4C7ZA 2ON8A 1R7SA 1Q0WB 4FA6A 3RNBC 4WURA 1EWCA 2VH1A 4C4VB 3FAHA 4EZKA 3V60A 2KDFB 5JHBA 3BYYB 4P7IA 4FXCA 4LJOB 1ZOYB 4YSZB 2BPSA 2LASA 3AE2B 1VD2A 4WJQA 5KHOA 3P1MA 5JHAA 3RNCC 2DYBA 2DNFA 2JXXA 3DVGY 1V2YA 5H92C 2GRIA 4MSQB 2KVZA 1KLGD 4I6LB 3NZ3A 1ZP0B 5BMHA 2BWES 4MM3B 2ACZB 1EWYC 1ZGUB 1L5PA 3W2DA 3W1SA 1MFWA 2V4IB 2DBYA 2JWUA 2KTRB 4BKSD 2WXNA 1VLBA 3GZNI 4IM3A 3MFGA 4LTUA 1V1OA 1Z5SB 3VQIA 4RGTA 3Q3JA 2ZPNA 3QJZA 3MTNB 4BBNC 3ABVB 5EE1A 2WDVB 4JL9A 2G9HD 2BYFA 4YL8A 4DDGD 2HTHA 3PLVA 2JXTA 3N3KB 4XYCA 1WMHA 2CHZA 1J7CA 2KMMA 3L13A 3MHZA 1XQQA 2NPTA 3TJPA 4HXDA 4OZCA 2MBHA 2NR2A 5D2MB 1BXTA 1WYWB 4D2KA 2WXGA 5C1ZA 1KLVA 2CS4A 5FR3A 3MJ5A 1VRAB 4GDLA 1V49A 1QILA 4DHJB 4WJNA 1F0ZA 1SE2A 4L1BA 1C4CA 4NAMA 4DHJD 2LD9A 2N7EA 5JXVA 2J0MA 4XWWA 4L23A 2ZCCA 1DGJA 1RFAA 3SD5A 3IBEA 2R2OA 2K8BA 5J2RA 2CR5A 5IA7A 4MT5A 2Z0DB 3J9CA 3SU8X 1SJED 3VVWB 3VH3B 2HDEA 1UGMA 2IY1B 2JRIB 3RCZA 4EUTA 5LLIA 5KHQA 2GMIC 4PS8A 5CHFA 4IOIE 2FBWB 2WX1A 3HRDD 4OZAA 4GU2A 1A70A 1C77A 2L8JA 2WQYB 3KUCB 3L17A 3K9OB 1NYQA 3ZJTA 4IW0A 3V05A 1K53A 2KJRA 2D07B 2KDIA 1GG3A 4TMAB 4KSLC 1PGXA 4AOFA 2PMVA 3NVWA 4TV3A 3Q69A 2WS3B 1IPGA 4MDKE 2E6XA 4IG7B 1J7AA 3I63C 1V1PA 4TKNA 4M01A 3V3XA 3BVGA 4MJSB 3ZLZA 3UINB 5E6PA 1A5RA 3ZKJC 2RDGA 2L52A 2KC1A 2HE7A 4HDOA 3T9LA 1Q10A 2UU7A 2J7QB 2N1VA 3EA6A 1I4XA 3R2TA 3OJ3A 2LUEA 1K8RB 1GTHA 4RGMA 1R4NB 4KKIA 4WJOA 5HFYA 2WXPA 5I4DA 3VUXA 2J52A 2KO3A 4WQOB 3DBLB 2KAJA 4LNKA 2IGDA 2CHXA 1GAQB 2ZNVC 1WXQA 3BYTB 2A4ZA 1R4MB 2MLBA 2WXJA 2K1FA 3H7PA 2RGFA 2LI5A 4GSWA 1WGRA 1NDDA 4DXFA 2MBEA 1D6EC 3U7DA 5BYRA 2AL3A 4OVVA 1JWMD 2AL6A 3PREA 1SF0A 1H7XA 5AUIA 2IGGA 1TZ1A 4GGQA 3LB8C 1E9MA 1D5XC 3Q3OC 4WQMA 1YJIA 2KN4A 2QC8A 5G55A 2FCSA 4US8A 4WAAA 2O2VA 4FADA 4PYUA 3MP9A 2V4LA 3ECIA 5TR5A 2V1YA 3CF4A 3P4SB 3N20C 4M00A 4IWPA 1LGRA 2ZCBA 3IVFA 2DZIA 4HVBA 2YEPB 1TY0A 3QARA 2K0PA 4GLSC 2WXIA 1SIJA 2QIEB 1T0RC 1ACCA 2WU2B 5J18A 2FE8A 1MG8A 2D5GA 3DHHC 3LXFA 3C8YA 2INNE 4IDIA 1KM7A 1T0SC 1JWAD 4J3OD 4ITKA 4HDQA 1H7WA 3SEBA 1T5XD 1GTEA 2G3QB 2LGYA 4MH0E 4DHZE 1M4VA 3ZQ4A 5H8YE 5L83A 3UI3A 2ZNVB 1TY2A 2WXLA 2LJ5A 4R3DA 2J4XA 4LDTD 2WXOA 2WHIA 4ZRIA 1BMLC 4RGOS 1WI0A 2AQ3B 4KKJA 2NBVB 5AZGA 1CMXB 3BINA 2WX0A 5DPSA 3VR8B 1C1YB 3DBRB 3OJ4B 3CF6E 1FO4A 3HVDA 4ZRJA 2INPE 1E7UA 1YQ3B 4HKZE 2WXMA 2DLBA 3O13A 1UWMA 4G3XB 3A9KA 3VUYA 3RI7C 2DWQA 4L2YA 1BUIC 5T8IA 5HI1A 2XBBC 1P0RA 2GBNA 3VDZA 1S1QB 3M63B 1DYQA 4E74A 1FIQA 2REXA 4GMVA 2KNBA 3QK0A 4NQKE 1GT8A 1TZOA 3VR9B 2PJHA 2PVGC 2WDTB 5BO4B 1PQSA 5D3IB 4LJPB 4GIVA 4KX6B 3DWMA 4MGKE 2XEWA 1E8WA 1Q5WB 1YN3A 3BVMA 2KLGA 1VJKA 1FRRA 2KDEB 4H2AA 4F1SA 1L6UA 3PRZA 1E90A 1WGDA 3ZO5B 2MEKA 2WDRB 4X57B 4II3B 1WYGA 4JWSC 4M0WA 4JX1C 4WJPA 5HKHA 3K9PB 2Y5CA 3B9JA 3RMKC 2BQQA 4HRSA 4A3PA 3CSTA 3N32A 2JVCA 2NBUA 2RR9A 5CTRC 3RNAC 4NNJB 4JLCA 1GOZA 2N0SB 3WA0A 2WDQB 5HHDG 4GDKA 3AE6B 1L2NA 4ANXA 2VZKB 1KFYB 2IBIB 2BTEA 3IG3A 3RNEC 3OAWA 3Q3MC 4TQ1A 2LZ6A 3PGEA 1QQRA 2PLPA 2KMAA 4DQOC 1XT9B 4HCNB 4EEWA 3ZYYX 4KGSA 1JROA 1WMHB 1WJ4A 2MCNB 2NPTB 3HUIA 1E10A 1C9FA 2LUMA 2INDC 2FUG1 3R7QA 4KSKC 1B9RA 1GJZA 2KT7A 4RGNA 2M8SA 1YD8U 1E7VA 3PZDA 1MVKA 1HTOA 2M0XA 1XO3A 3ML9A 1SSNA 4HPPA 3KQ4A 3AU4A 1MI0A 2BYVE 3RYTA 1TS2A 4DDID 1V97A 1FXIA 2KQ7A 1ESFA 1TKEA 3P2BA 2RMMA 3RD2A 1WRIA 3AEGB 5G5HA 4XDCA 1FPYA 2AQ1B 1SGHA 5BMGA 3X23A 1TYGB 1AARA 2BKRB 1GC6A 2WP9B 3PT2B 3Q3NC 2EKIA 2L76A 3APDA 1NVID 2KK8A 1TGZB 1WE6A 2K9XA 4C80A 4BOZB 2WGSA 1F77A 4CHKA 4M8MA 4NJ7A 1NENB 2BS4B 4YTPB 2ONQA 4MEMA 3R66C 1N62A 2GBMA 2IO2B 4WIPA 2LRWA 4BBNF 1PDXA 1TBEA 3JSVA 2RSUA 1OQQA 1WX8A 2INCC 2KFKA 3SHQA 1J8CA 2KJHB 2Z59B 4ZYSA 1WY8A 2B3AA 1YJ1A 4E3CA 1E6EB 2QSDA 4WWOA 2R61A 4MACA 1LM8B 3ZNGC 1V1PB 2KXJA 3AU5A 2XNAC 4EZLA 3ZRCA 2KACA 3OG5A 4W9IA 3IAM1 1AWDA 3EFCA 4HPLB 4BKGA 3TMPB 1DOXA 3ZXRA 2RDHA 3IHPC 4ANWA 4YSXB 4N58A 4II2B 3APCA 1TJEA 1UUPA 5IKCM 3A1QA 1XCTL 5DPRA 1JMLA 3NHEB 2KN5A 5J17A 2K39A 1SJHD 5AZFA 2KKCA 4M8NA 4ZHPA 1N61A 4LNOA 3LDZE 2ICIA 3H7PB 3N30A 4G11A 2WXRA 3NRZA 4WAFA 3NVYA 3PHXB 1UBIA 3U2SC 4NZLB 1GB4A 3DVGX 2LVPA 3CMMB 3PZ8A 1ROEA 1PGAA 4EOYA 5GMVA 4B6WA 2OHFA 3Q14C 2MH7A 2CJNA 4K7UA 2O2VB 1H4RA 2WXHA 3VH4B 3DVNU 4N9F4 3PHWB 1C76A 2MWSB 2JYEA 1EO6A 1L6VA 4C56C 3AN1A 3BVZA 2M4NA 4XX5A 3M3JA 3NVVA 2LWPA 2GOWA 2I1KA 4XE0A 4W9HA 2BBCA 1WXVA 1WR6E 3UGBB 3AMZA 4ZOHC 2IGHA 1JWUD 5E6OA 2D3AA 4CQNA 3ZIMA 4NAWB 1D5ZC 1JWSD 4BOSC 1XLQA 3V61A 3DOWA 1N60A 2ZVOA 3CIRB 4MGYE 2IO3B 4JPSA 4G0NB 1L0XB 2L3ZA 1WM3A 2RPQA 4AJYB 2QEJC 1HXYD 1TKYA 2D11A 2HTME 4ZRPA 4OZBA 1TS4A 1VR9A 2C9WB 1C4AA 1GB1A 2G1EA 2ZW1A 5D6JB 4B0EA 1PGBA 2QHOA 2C7HA 4RCOA 2KVRA 3JW0X 1FXAA 3A9KB 3R3MA 3CWIA 4OW0A 4EKUA 1D5MC 1XXGA 2FNJB 1WWTA 1I42A 3QC8B 2KQSA 5IO9A 2JQRB 4WWNA 1PFDA 3TEYA 4ZDVA 2LHDA 1K51A 2N9EB 1X1MA 2KQ4X 3Q6BA 4LNIA 2QCZA 2NMQA 4RM8A 3VTVA 2M0AA 4KV2A 3IT4B 3U8ZA 4ZYNA 2BW2A 4ASWC 4Q2JA 4BKTA 1XCQL 1DOYA 3VRBB 3RNGC 1VZ8A 3MC9A 5LXIB 4P16A 5LXHA 2LRUA 4ANVA 2I1JA 1YQBA 1YNTE 5LNK1 2R2QA 4A3OA 3KH0A 5DCNA 3NY5A 2EELA 2PTLA 3W1YA 3ENEA 4AUQC 2BB5A 3L4PA 4FULA 3ZDTA 1NBFC 4CYEA 4NQLB 1B1ZA 3RULA 4JIOU 4M0WB 3A33B 1OFFA 1IUEA 3P4RB 3TSSA 4GB9A 1SB3C 1WF9A 5FR6A 1QZEA 4HROA 2J0JA 2ZW0A 4BKSA 3AV8A 1GC7A 5JH5C 2J42A 2G45B 4GDKB 2KDMA 4BZAA 1L7YA 1WFYA 1KTKA 1RAXA 4IUMB 1Y56A 3AE5B 1FD6A 1IGCA 3VTUA 3DBHI 2J0KA 3P4PB 5CX3A 2MX2A 1LXDA 5C2TB 1K52A 3A4RA 1ISNA 2BYEA 1YX6B 4G50A 3GZNB 3AE9B 2O6VA 4NJCA 3L10B 1CJEA 1VCBA 2SEBD 2W82A 2BT6A 3ZUNA 2DX5B 1WR1A 2MW5A 3GE8C 1FNUA 4W9DA 3KYDD 4HLEA 1I4GA 3Q3FA 3N1ZC 3RFZB 2K3UA 2ZEQA 3EFUA 2Y5BB 4NAWA 1WE7A 1ZXHA 2WXKA 4E71A 1IBXA 4AQ7A 2NBWB 4YTNB 3SDLC 2MJ3A 2IO0B 2FIFA 5C3JB 4O1NA 3R2IA 1KOTA 2MP2A 1IP9A 2L0TA 1XF5L 4GXBA 4B95A 3U4EG 2KWCA
chains in the Genus database with same CATH topology
1EU4A 4MM3B 2ACZB 3U52E 1EWYC 3HUIA 1L5PA 1E10A 1C9FA 2LUMA 2FUG1 3W2DA 2W3SA 1HQRD 1ZXIA 3W1SA 1I4RA 1F2RC 1XLOA 2V4IB 2WU5B 2QILA 2DBYA 2RPVA 2JWUA 2WXNA 1VLBA 1MPEA 1WSPA 3MFGA 1B9RA 3NS1A 4LTUA 1JCKB 1V1OA 3FILB 3VQIA 1ENFA 4RGTA 3E56A 4RGNA 5E6JA 3Q8BA 5AUKA 1F2RI 2SAKA 3ABVB 1MVKA 1YJJA 5EE1A 2WDVB 1FFVA 2G9HD 3DWGC 3AM9A 4LLGM 1FRDA 1XO3A 2JXTA 2QJLA 1SSNA 4YWGG 4A9AA 1KRHA 3H8HA 3KQ4A 4LK0M 1MI0A 1TKGA 4OHJA 1PUTA 1J7CA 2KMMA 1TS2A 2LFIA 3MHZA 1UWXA 3KWLA 3TUOA 1V97A 1FXIA 3IXSA 1FEHA 4OZCA 1ESFA 1QT9A 1BXTA 3BZDB 1TKEA 2H88B 4TSSA 4D2KA 2RMMA 3PO0A 1WRIA 1NYRA 1UGJA 4XDDA 3AEGB 2WXGA 5G5HA 4XDCA 5FR3A 1D4BA 2AQ1B 3OWEB 5HG2A 4B0MA 5BMGA 1JRPA 1RM6C 3MJ5A 3WCQA 5D3DA 1TYGB 2N9KA 1VRAB 2PVOD 3FILA 1FFUA 2AQ2B 1QILA 2WP9B 1F0ZA 4KGRA 1SE2A 2Z8LA 4ZHOA 4L1BA 1C4CA 4NAMA 2BYTA 1UNSA 2EKIA 5JXVA 3EGRA 4XWWA 1NVID 4L23A 1DGJA 3NVZA 2K9XA 4C80A 1F77A 1RWSA 1NENB 2BS4B 4YTPB 2ONQA 2L32A 3W5VB 5MPOA 4MT5A 1N62A 3ETRA 1N63A 1DOIA 4JWUC 3I9V1 4WIPA 4HKQA 4RF0A 3J9CA 4YXDB 1PDXA 4A6QA 1I4PA 1OQQA 1SJED 1JQ4A 3AE1B 1L4ZB 2HDEA 4HJGE 1VDVA 4N59A 4ZYSA 1E6EB 2QSDA 2BS3B 2R61A 4MACA 4OVZA 3Q8FA 4IOIE 2FBWB 3HRDD 4OZAA 2IPKD 4DXGA 3N9YC 2M19A 2V3PA 1V1PB 2CU3A 1A70A 2XNAC 1QOFA 2VZKD 2KACA 1C77A 3AEEB 2WQYB 5BYSA 1HEZE 1N5WA 3IAM1 1NYQA 3ZJTA 3V05A 1AWDA 1DOXA 1K53A 2JSVX 1ZUD2 2RDHA 1I4HA 1EU3A 2V3NA 4WWMA 3W5UB 4YSXB 4TMAB 4N58A 2LHEA 1PGXA 3BIID 3KLSX 1AYFA 1CK1A 1MHHE 1TJEA 1UUPA 1C79A 1XCTL 5EE0A 1JMLA 2PMVA 3NVWA 2Q5WD 2W55A 2PIAA 2XN9C 1SJHD 2WS3B 3P42A 3Q69A 2E6XA 3ZJVA 1T6BX 1J7AA 1CZPA 3EUB2 4ZHPA 1N61A 2JZPA 1V1PA 3E9SA 2ICIA 3V3XA 3BVGA 4YSYB 4TQ0A 1VZ7A 1SE3A 2RDGA 3T3OA 2GB1A 2WXRA 3NRZA 2L52A 4WAFA 1HZ5A 3NVYA 1YMHE 1Q10A 3BK2A 4NZLB 3U2SC 1GB4A 3EA6A 3PZ8A 1I4XA 3U7ZA 1ROEA 1PGAA 3R2TA 3TEZA 2LGIA 1TS5A 1K50A 3R8BA 1E0ZA 1GTHA 1PYWD 2JX5A 4P6VF 2OHFA 1L4DB 2MH7A 4RGMA 4KKIA 2CJNA 2H89B 5HFYA 2WXPA 5I4DA 2K22A 2J52A 2KAJA 3AH7A 1OQRA 2WXHA 2IGDA 1GAQB 1P7FA 1RYJA 3AE8B 1C76A 1ZE3D 3AB5A 1WXQA 1HZ6A 1XLPA 3BYTB 2WXJA 1QOGA 2JYEA 5BYQA 1L0YB 1MHXA 1L6VA 1FMAD 3AN1A 4C56C 1QF6A 3BVZA 1FCLA 4DXFA 1CQVA 1D6EC 3IT6B 4A55A 3NVVA 5BYRA 2B76B 3TEXA 1JWMD 4USAA 1SF0A 1P7EA 1H7XA 1N5XA 4XE0A 5AUIA 4HEA1 3IAS1 2BBCA 2IGGA 1SXTA 3LB8C 1E9MA 4UDUC 4ARCA 1D5XC 2L1AA 2Y5PA 2I38A 3AMZA 4ZOHC 2IGHA 4WQMA 1JWUD 1YJIA 2KN4A 4US8A 4CQNA 3B2FA 2X38A 4NAWB 1VZ6A 1D5ZC 1JWSD 3MC0B 3MP9A 3P4QB 1XLQA 3CF4A 3P4SB 1RFKA 1WGKA 1C4PA 1N60A 4MH8A 1FCCC 2J53A 3CIRB 4JPSA 1L0XB 5FK9C 1SE4A 5D7GA 1LO5D 2YEPB 1TY0A 2K0PA 4GLSC 2QEJC 1C78A 2WXIA 1HXYD 1SIJA 2QIEB 2W54A 4WH4A 1ACCA 2WU2B 1TKYA 4JE3B 3P63A 3Q8EA 2LMCA 2FE8A 2M56B 4ARIA 2HTME 1KF6B 1SEBD 2D5GA 4OZBA 4ZRPA 1TS4A 1VR9A 3LXFA 1C4AA 4AS1A 3C8YA 2GI9A 1XLNA 2INNE 2G1EA 2WXQA 2ZW1A 3BK1A 3HVZA 4IDIA 1GB1A 1I7HA 4B0EA 1PGBA 4REZA 4YT0B 3AE7B 1IGDA 3Q8CA 1JWAD 4RCOA 4J3OD 4ITKA 1H7WA 1YQ4B 1FXAA 3T3NA 3AE4B 1AW7A 3SEBA 1EM7A 1T5XD 1GTEA 2V0GA 2KWDA 3CWIA 1M4VA 4OW0A 1D5MC 4IKGA 1XXGA 3ZQ4A 1WWTA 5H8YE 3UI3A 1YN4A 1FNVA 1QOBA 1TY2A 2JQRB 2WXLA 1PFDA 3TEYA 4R3DA 2J4XA 2LHDA 1K51A 4RF1A 3VRAB 5BMIA 3ZGZA 2PKOA 2WXOA 4US9A 3B2GA 3AEFB 1BMLC 4RGOS 2W3RA 2KQ4X 2AQ3B 3AECB 5TSSA 4KKJA 2NTTA 3URYA 3RPFC 2NMQA 1ZPSA 2L83A 1HA5A 2M0AA 3PZ7A 1ZDVA 3IT4B 1ET9A 2NTSA 1QOAA 1I4QA 3AEBB 3VR8B 2BW2A 4KGTA 1NEKB 1FO4A 1NI3A 3HVDA 3KWVA 4Q2JA 3W9CB 2I2YA 1XCQL 2INPE 1DOYA 1FNWA 2LEKA 1YQ3B 3VRBB 4HKZE 2K5PA 3AEAB 2WXMA 2CJOA 2DLBA 1UWMA 1VZ8A 1ET6A 3O13A 4RFBA 2JU6X 2DWQA 2QMTA 4GDLB 3GP7A 4L2YA 4P16A 1E7PB 1BUIC 5T8IA 5HI1A 1YNTE 5LNK1 4C7YA 5GXGB 5FKAC 2EELA 3Q8AA 2PTLA 3AE3B 5EE3A 3ZJUA 2WLBA 1L0VB 2BB5A 3L4PA 1XEEA 1GPXA 2PW9A 1DYQA 2BB6A 1B1ZA 2Y3AA 3FC4A 1OFFA 1IUEA 1FIQA 2IDYA 4A90A 5G5GA 3P4RB 2OEDA 1SBBB 2JYTA 3SFEB 3TSSA 4EE2A 3NUHB 1SB3C 1GT8A 5EE9A 1TZOA 4XWTA 4YTMB 1JWBD 4HROA 2ZW0A 2MJEA 3AV8A 3VR9B 1YN5A 2TSSA 2PVGC 5D3IB 2J42A 4GDKB 2YEPF 2KDMA 4KX6B 3DWMA 4ZRQA 1YN3A 3BVMA 1VJKA 1FRRA 4RNAA 1QLBB 1KTKA 2WNMA 3GS2A 1IBXB 4H2AA 1Y56A 1FM0D 4A8XC 1L6UA 1V8CA 1J7BA 3AE5B 1KLUD 1FD6A 1IGCA 2IJ0A 1TS3A 3SR6A 3P4PB 3LYYA 2AX5A 2MEKA 2WDRB 2N7JA 1WYGA 5C2TB 1K52A 2E3TA 4JWSC 1ZDXA 2WXFA 3GB1A 4M0WA 4JX1C 2LJIA 4PT5A 1STEA 2Y5CA 4N6EB 3AE9B 3B9JA 1JALA 4HRSA 3SFDB 1KH0A 4NJCA 2BS2B 1CJEA 3I57A 2SEBD 2W82A 2BT6A 2MJDA 4RH6A 1FNUA 1GOZA 2N0SB 4C7ZA 2ON8A 2WDQB 1I4GA 1R7SA 1QKZA 3BWUD 3AE6B 5HHDG 3RFZB 2K3UA 4WURA 1EWCA 2VZKB 1KFYB 1ZXHA 2DYMA 2BTEA 2WXKA 3FAHA 3AEDB 1IBXA 4AQ7A 3TEWA 3BYYB 4FXCA 4YTNB 2N9LA 4TQ1A 2MJ3A 1ZOYB 4YSZB 5C3JB 1QQRA 3AE2B 1T3QA 4O1NA 3R2IA 3P1MA 1AN8A 1XF5L 2PLPA 5H92C 2GRIA 1JW9D 4DQOC 1KLGD 2DYOA 3NZ3A 1ZP0B 4KGSA 1JROA 3U4EG 3ZYYX 5BMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LB8 C;  1E9M A;  2M19 A;  3AE3 B;  2ACZ B;  2CU3 A;  1EWY C;  5EE3 A;  3AMZ A;  4ZOH C;  2WLB A;  3HUI A;  1A70 A;  1L5P A;  1L0V B;  1YJI A;  4WQM A;  1E10 A;  1QOF A;  3L4P A;  2W3S A;  4US8 A;  1ZXI A;  3B2F A;  1GPX A;  3AEE B;  1XLO A;  2WQY B;  2WU5 B;  3FC4 A;  2DBY A;  1N5W A;  3P4Q B;  1OFF A;  1IUE A;  1FIQ A;  1XLQ A;  3CF4 A;  3P4S B;  1NYQ A;  1VLB A;  1RFK A;  5G5G A;  3P4R B;  1WGK A;  3SFE B;  1AWD A;  1N60 A;  3NS1 A;  4LTU A;  1B9R A;  1DOX A;  1SB3 C;  1GT8 A;  1ZUD 2;  5EE9 A;  4YTM B;  1JWB D;  3CIR B;  4HRO A;  4WWM A;  2MJE A;  3W5U B;  4YSX B;  3AV8 A;  3VR9 B;  5AUK A;  4N58 A;  2PVG C;  3BII D;  3ABV B;  1AYF A;  5EE1 A;  1YJJ A;  2WDV B;  1FFV A;  3DWG C;  1TJE A;  1SIJ A;  3AM9 A;  2QIE B;  2W54 A;  5EE0 A;  1FRD A;  1XO3 A;  3NVW A;  2WU2 B;  1TKY A;  2QJL A;  4KX6 B;  3DWM A;  2Q5W D;  2W55 A;  2PIA A;  3P63 A;  2M56 B;  2WS3 B;  4A9A A;  2HTM E;  1KRH A;  1VJK A;  1FRR A;  1KF6 B;  1J7A A;  1CZP A;  1QLB B;  3EUB 2;  1TKG A;  4ZHP A;  1N61 A;  1J7C A;  1PUT A;  2KMM A;  1FM0 D;  3LXF A;  1XLN A;  1L6U A;  1V8C A;  1J7B A;  2G1E A;  3AE5 B;  3HVZ A;  3KWL A;  4IDI A;  1I7H A;  1V97 A;  1FXI A;  4YSY B;  4YT0 B;  3AE7 B;  3SR6 A;  3P4P B;  1JWA D;  1QT9 A;  2AX5 A;  2WDR B;  1TKE A;  4ITK A;  1WYG A;  5C2T B;  1H7W A;  1YQ4 B;  2H88 B;  3AE4 B;  1FXA A;  2E3T A;  4JWS C;  3PO0 A;  4JX1 C;  3NRZ A;  1WRI A;  1GTE A;  1NYR A;  2L52 A;  3AEG B;  3CWI A;  3NVY A;  5G5H A;  2Y5C A;  4N6E B;  3AE9 B;  1WWT A;  3B9J A;  1JRP A;  1RM6 C;  3WCQ A;  5H8Y E;  1TYG B;  2PVO D;  1JAL A;  1FFU A;  3SFD B;  1QOB A;  1ROE A;  2JQR B;  1PFD A;  4HRS A;  2BS2 B;  1E0Z A;  1GTH A;  1CJE A;  2WP9 B;  2JX5 A;  3VRA B;  2OHF A;  4P6V F;  1F0Z A;  2BT6 A;  2MH7 A;  2PKO A;  2CJN A;  2H89 B;  4US9 A;  4ZHO A;  3B2G A;  2MJD A;  3AEF B;  2EKI A;  2W3R A;  2N0S B;  4C7Z A;  2K22 A;  3AEC B;  2WDQ B;  1NVI D;  1R7S A;  3AE6 B;  1DGJ A;  2KAJ A;  3RPF C;  3AH7 A;  2L83 A;  1OQR A;  3NVZ A;  2K9X A;  4C80 A;  1GAQ B;  1RYJ A;  1KFY B;  3AE8 B;  3FAH A;  1QOA A;  3AB5 A;  3AEB B;  3AED B;  3VR8 B;  1RWS A;  1WXQ A;  1NEN B;  2BS4 B;  4YTP B;  3W5V B;  5MPO A;  1XLP A;  1N62 A;  1NEK B;  1QOG A;  1FO4 A;  1NI3 A;  3ETR A;  1N63 A;  1DOI A;  4FXC A;  4YTN B;  4JWU C;  3W9C B;  2MJ3 A;  1ZOY B;  4YXD B;  1L6V A;  1FMA D;  1PDX A;  3AN1 A;  1QF6 A;  1DOY A;  2LEK A;  4YSZ B;  5C3J B;  1YQ3 B;  3VRB B;  2K5P A;  1OQQ A;  3AEA B;  3AE2 B;  1T3Q A;  2CJO A;  1UWM A;  1JQ4 A;  3P1M A;  3AE1 B;  3NVV A;  2B76 B;  2DWQ A;  1VDV A;  1E7P B;  4N59 A;  4USA A;  5H92 C;  1JW9 D;  1SF0 A;  1H7X A;  1E6E B;  1N5X A;  2BS3 B;  1ZP0 B;  5AUI A;  1JRO A;  5GXG B;  3ZYY X;  4C7Y A;  2FBW B;  3HRD D; 
#chains in the Genus database with same CATH topology
 3KUZ A;  1EU4 A;  3PLU A;  4HJK A;  1C3T A;  3VUW A;  2N4F A;  2FCM A;  3PVL A;  2W3S A;  1HQR D;  1ZXI A;  3WAL A;  1I4R A;  1F2R C;  2WU5 B;  2QIL A;  3W1S C;  2D3B A;  2CHW A;  1MPE A;  2C7N B;  3NS1 A;  3MJW A;  2BGF A;  3APF A;  3E56 A;  3Q8B A;  5AUK A;  2ZVN A;  3VAW A;  2PE6 B;  1FFV A;  5CHW A;  3QHT A;  5C23 A;  1F9J A;  4KZ0 A;  3V62 A;  4YWG G;  1KRH A;  3H8H A;  2JPH A;  1TKG A;  4OHJ A;  1PUT A;  3B0A A;  1WRD B;  2MBO A;  3KWL A;  1UWX A;  3TUO A;  3IXS A;  3QCA A;  4W9E A;  1V9J A;  3AI5 A;  3JSV B;  2KFK B;  2GBR A;  2DAF A;  1UGJ A;  2CU1 A;  3OWE B;  3KUD B;  4B0M A;  2HJ1 A;  1RM6 C;  3FIL A;  1FFU A;  2BVC A;  4NJ6 A;  2NCN A;  4ACF A;  4KGR A;  2KWV B;  1UNS A;  4MGZ E;  4EFO A;  5IN7 A;  2JY6 A;  4TUU A;  2EMT A;  3NVZ A;  3QA8 A;  4OVU A;  1OEY J;  3MC8 A;  3NJT A;  3ZVV A;  3RNF C;  1RWS A;  3W5V B;  2IO1 B;  2L32 A;  1WZ0 A;  3ZTC A;  2BF8 B;  3ETR A;  1DOI A;  2JT4 B;  4JWU C;  3I9V 1;  3WAM A;  1N6Z A;  1I4P A;  4GOC A;  5AEK B;  1JQ4 A;  4KIK A;  3AE1 B;  1BT0 A;  1L4Z B;  3A1Q B;  3QWZ B;  4HJG E;  3WAN A;  1VDV A;  4K7W A;  4N59 A;  2ASQ A;  3TCA A;  4NPN A;  2BS3 B;  4OVZ A;  4PS3 A;  1UF0 A;  4RM9 A;  4BAX A;  3N9Y C;  2M19 A;  2V3P A;  1P1A A;  2VZK D;  3AEE B;  4FHJ A;  1HEZ E;  1N5W A;  1SE9 A;  2Z0E B;  2MRP A;  3QX1 A;  4W9L A;  4HK2 A;  4C00 A;  1I4H A;  4GN1 A;  1ZW7 A;  2DZJ A;  1UH6 A;  4WWM A;  3DHG C;  3W5U B;  2LHE A;  1AYF A;  1Y8R C;  1MHH E;  3UQA A;  5EE0 A;  2Q5W D;  2W55 A;  2PIA A;  2XN9 C;  2RDB C;  3ZJV A;  2WWZ A;  2M17 A;  3EUB 2;  3MHS D;  3OLM D;  4TQ0 A;  4FHK A;  4IM2 A;  1RRB A;  1HZ5 A;  3ZNZ B;  2FCQ A;  3BK2 A;  2KZR A;  4KDI C;  2N1W A;  3TEZ A;  2LGI A;  2K25 A;  1TS5 A;  1K50 A;  3R8B A;  3H6N A;  1E0Z A;  3H7S A;  2OJW A;  2JX5 A;  4IWQ A;  1Z2M A;  4P6V F;  3PRM B;  1UEL A;  3ZW3 A;  3EEC A;  2K22 A;  3AH7 A;  1OQR A;  4IWO A;  1P7F A;  3HM3 A;  3NS8 A;  2AWT A;  3ZRF A;  3AB5 A;  3T8M A;  3L08 A;  1MHX A;  1QF6 A;  4CO7 A;  2D3G A;  1CQV A;  4A55 A;  2W9N A;  3TEX A;  5E6N A;  2V3S A;  1WXS A;  4HEA 1;  3IAS 1;  2JWZ A;  4KDL B;  5IP4 D;  4UDU C;  2L1A A;  2I38 A;  3BY4 B;  3H9D A;  3B2F A;  3TBL D;  1F52 A;  1V5O A;  4W9F A;  3P4Q B;  2BWF A;  1MJD A;  1RFK A;  1WGK A;  1C4P A;  2NVU I;  3HHM A;  1TIF A;  2AEH A;  2J53 A;  3LJ3 A;  1SE4 A;  5D7G A;  1R4N I;  4HWI B;  4FLH A;  3DBL I;  2W54 A;  3RT3 B;  4WH4 A;  3Q2A C;  4JE3 B;  1WZ3 A;  3PPA A;  3Q8E A;  4PYZ A;  2LMC A;  2M56 B;  2VH2 A;  1SEB D;  4AS1 A;  3BK1 A;  1R4M I;  1I7H A;  4BFR A;  3A9J A;  4K3C A;  4YT0 B;  3AE7 B;  1IGD A;  3Q8C A;  4FN2 A;  2M1M A;  3GE3 C;  3T3N A;  1EM7 A;  2V0G A;  2KWD A;  2GBJ A;  1MG4 A;  4IKG A;  5CHV C;  3O65 B;  3RZW C;  1YN4 A;  1OEY A;  4RF1 A;  3VRA B;  5BMI A;  3ZGZ A;  2PKO A;  1LFD A;  4US9 A;  1J0G A;  3AEF B;  4RMA A;  2W3R A;  3AEC B;  1WGH A;  4P1C C;  2X8X X;  4IC7 B;  1ET9 A;  2NTS A;  1QOA A;  3AEB B;  4KGT A;  1NEK B;  2C5L C;  2I2Y A;  4AP4 C;  2K5P A;  1KJT A;  4DHZ B;  2LXC A;  4MGI E;  1EF5 A;  1ET6 A;  2KC2 A;  2JU6 X;  2QMT A;  1UBQ A;  1E7P B;  2ZJD A;  3UIP B;  2MQJ A;  2XK5 A;  1WGG A;  3WAO A;  1V6E A;  1LQB A;  3AXC A;  1WX9 A;  4ANU A;  1XEE A;  2PW9 A;  1WIA A;  3QIJ A;  2BB6 A;  3KW5 B;  1RLF A;  2FAZ A;  3L54 A;  4JQW C;  3NUH B;  2LXA A;  1JWB D;  2O6V B;  3KVF B;  2MJE A;  2N7D A;  4K81 A;  2IZV B;  2O6V D;  1TT5 B;  2LGD A;  3PSE B;  4WWP A;  2YEP F;  4ZRQ A;  4RNA A;  4FJY A;  1QLB B;  2WNM A;  3DBR I;  3GS2 A;  1IBX B;  3DCG A;  3QAQ A;  4A8X C;  1WXA A;  1KLU D;  3NZU A;  4F8C B;  1TS3 A;  2AYO B;  2D10 A;  2N7J A;  2JZZ A;  1ZDX A;  2WXF A;  3GB1 A;  4PT5 A;  2MP2 B;  3UQB A;  4N6E B;  1Q1O A;  1WJU A;  4MEL A;  3SFD B;  2MA9 B;  2BKF A;  2KJ6 A;  3L0W B;  4KZC A;  1SIF A;  2DHZ A;  1OQY A;  3BWU D;  1QKZ A;  3KYC D;  3DPD A;  2DYM A;  3AED B;  4KVG B;  5AZH A;  4ZRK A;  3VHT C;  3TEW A;  2KX3 A;  1V5T A;  2ZZP B;  2N9L A;  2K8C A;  2KOX A;  4EZJ A;  1WJ6 A;  1T3Q A;  3GOE A;  1U4A A;  1AN8 A;  2JZ3 B;  1JW9 D;  1T0Q C;  2IYD B;  5L95 C;  2DYO A;  3WIM A;  3A4S C;  4P1B C;  2KAN A;  3U52 E;  4FBJ B;  3X0W A;  2VRR B;  1XLO A;  2RPV A;  2JF5 A;  2QDF A;  2WYQ A;  1WSP A;  4C4V A;  1JCK B;  3FIL B;  1FXT B;  1ENF A;  2KX0 A;  4I6N B;  5E6J A;  3UIO B;  5EDS A;  3N1Y C;  5G2N A;  1F2R I;  2SAK A;  4FJZ A;  2FCN A;  1YJJ A;  3D32 A;  3DQV A;  1F1H A;  3DWG C;  1UD7 A;  3AM9 A;  1YX5 B;  4ICU A;  4LLG M;  1FRD A;  4PS7 A;  2QJL A;  3RUI B;  2KFJ A;  4A9A A;  4K7S A;  2C60 A;  3DVN V;  4LK0 M;  1I35 A;  3QQ8 B;  2MHJ A;  2LFI A;  4MM3 A;  1EF1 A;  1FEH A;  1QT9 A;  2PE9 A;  1WX7 A;  3BZD B;  2ZPY A;  2HD5 B;  2H88 B;  2JRH A;  4TSS A;  4KIK B;  3PO0 A;  1V80 A;  1NYR A;  4IM0 A;  4DK5 A;  4XDD A;  2KTR A;  1JRU A;  5IOI A;  1D4B A;  3V6E B;  5HG2 A;  2EMS A;  1JRP A;  3WCQ A;  5D3D A;  2N9K A;  2PVO D;  3ZDM C;  2AQ2 B;  4J6I A;  2L00 B;  2LVO A;  2Z8L A;  4ZHO A;  2K6Q A;  2A5U A;  2BYT A;  3PRP B;  3EGR A;  1YOV B;  4NY0 A;  2G4D B;  2YLM A;  1E5W A;  2NS5 A;  4MSM B;  2LGX A;  1WGY A;  2MBB B;  5MPO A;  1EUV B;  4JGH B;  1N63 A;  4HKQ A;  4RF0 A;  4YXD B;  3FKY A;  4A6Q A;  3NZS A;  4HPM B;  1HE8 A;  3VFK A;  3U30 A;  4K1R B;  1OTR B;  3B08 A;  1T0Y A;  3V6C B;  1J19 A;  3Q8F A;  2FUH B;  1IYF A;  2IPK D;  4DXG A;  2CU3 A;  4S0R A;  4DWF A;  1QOF A;  3TL5 A;  2D3C A;  5BYS A;  4K3B A;  1P98 A;  2JSV X;  1ZUD 2;  3C0R B;  2L05 A;  1EU3 A;  2GLS A;  2V3N A;  3VTW A;  2KLC A;  3BII D;  4BVU C;  3KLS X;  1CK1 A;  3EHV A;  4XGA B;  1C79 A;  4W9J A;  4LDT B;  1E8Z A;  2KYW A;  3P42 A;  1P3Q U;  1T6B X;  1TTN A;  1CZP A;  2JZP A;  3E9S A;  1G6J A;  4QAY A;  4YSY B;  3I3T B;  4FJV B;  1VZ7 A;  1SE3 A;  2L7R A;  3T3O A;  2GB1 A;  4LCD E;  3I5J C;  4URK A;  2KMC A;  1YMH E;  3AUL A;  3HM6 X;  1WXM A;  3U7Z A;  3L16 A;  1HTQ A;  4M02 A;  1PYW D;  1L4D B;  3IFW B;  2H89 B;  2OJR A;  2DZK A;  2LVQ A;  4ICV A;  1WH3 A;  2V9H A;  1S3S G;  2EKE C;  2D2Q A;  3JYU A;  3UF8 A;  3RZF A;  1WJN A;  1RYJ A;  4A20 A;  3AE8 B;  1ZE3 D;  3R7R A;  1HZ6 A;  1XLP A;  1QOG A;  5BYQ A;  4MJS A;  4AWJ A;  1L0Y B;  1FMA D;  3DBS A;  2C7M B;  1FCL A;  3IT6 B;  2B76 B;  4USA A;  2DAJ A;  4XC2 A;  1P7E A;  4XZ4 A;  1N5X A;  2N9X A;  3ALB A;  1SXT A;  4ARC A;  2Y5P A;  3A9J B;  4LNF A;  2LGS A;  3S2A A;  3DDC B;  3HK0 A;  2X38 A;  1VZ6 A;  3MC0 B;  4W9K A;  1FCC C;  1NI2 A;  2FID A;  5FK9 C;  4LNN A;  1LO5 D;  3ZNI D;  3NOB A;  1C78 A;  4AJW A;  3P63 A;  3M62 B;  4ARI A;  4B9K A;  3M95 A;  1KF6 B;  1H8C A;  1GNU A;  2GI9 A;  1XLN A;  2WXQ A;  3HVZ A;  2DZM A;  2KDB A;  2HJ8 A;  4REZ A;  1YQ4 B;  3AE4 B;  1AW7 A;  4W9C A;  4PK1 A;  1M94 A;  1GUA B;  3WAP A;  3HIZ A;  2K8H A;  4F7Z A;  1E8Y A;  1FNV A;  1QOB A;  2XK5 B;  3CSF A;  4W9G A;  1YIW A;  1ZKH A;  1XD3 B;  3DHI C;  3B2G A;  2UWQ A;  5TSS A;  2NTT A;  3URY A;  3RPF C;  1ZPS A;  2L83 A;  1HA5 A;  3PZ7 A;  5D94 A;  1ZDV A;  2MBQ A;  1I4Q A;  3JVZ X;  5DPW A;  3VXW A;  1NI3 A;  3KWV A;  4HCP B;  3W9C B;  3RN9 C;  3DBH B;  1E8X A;  1FNW A;  2LEK A;  3AEA B;  4RFB A;  2CJO A;  2K6D B;  2GBK A;  3N1X C;  4GDL B;  3GP7 A;  2UYZ B;  4C7Y A;  5GXG B;  3PTF C;  1OGW A;  5FKA C;  3ML8 A;  3Q8A A;  2KD0 A;  3AE3 B;  5EE3 A;  3ZJU A;  5IAA C;  2WLB A;  1L0V B;  1GPX A;  2Y3A A;  3FC4 A;  2G4S A;  1WM2 A;  2IDY A;  2PPH A;  4A90 A;  5G5G A;  2OED A;  1SBB B;  2JYT A;  2L0F A;  3SFE B;  2N9P C;  3PS6 A;  4EE2 A;  4DBG A;  3B1L X;  4I6P A;  4XWT A;  5EE9 A;  2KTF A;  4YTM B;  3PV1 A;  4S17 A;  3ZNH B;  3ZTD A;  2IY0 B;  5DPT A;  1YN5 A;  2TSS A;  4DXA B;  3NG0 A;  1V86 A;  2RD0 A;  1FM0 D;  2KHW B;  1V8C A;  1J7B A;  2YVC A;  2IJ0 A;  3C19 A;  2KWU B;  3SR6 A;  3LYY A;  2AX5 A;  4MH8 A;  2E3T A;  3ZXV A;  2LJI A;  1P9D U;  1STE A;  1D3Z A;  1V81 A;  3ONS A;  2OOB B;  5JZE B;  1JAL A;  1KH0 A;  2CKH B;  2BS2 B;  2PEA A;  3I57 A;  2JUO A;  2MSE D;  3H1U A;  3TIX A;  2MJD A;  4RH6 A;  1UZX B;  2DEN B;  3EC8 A;  4C7Z A;  2ON8 A;  1R7S A;  1Q0W B;  4FA6 A;  3RNB C;  4WUR A;  1EWC A;  2VH1 A;  4C4V B;  3FAH A;  4EZK A;  3V60 A;  2KDF B;  5JHB A;  3BYY B;  4P7I A;  4FXC A;  4LJO B;  1ZOY B;  4YSZ B;  2BPS A;  2LAS A;  3AE2 B;  1VD2 A;  4WJQ A;  5KHO A;  3P1M A;  5JHA A;  3RNC C;  2DYB A;  2DNF A;  2JXX A;  3DVG Y;  1V2Y A;  5H92 C;  2GRI A;  4MSQ B;  2KVZ A;  1KLG D;  4I6L B;  3NZ3 A;  1ZP0 B;  5BMH A;  2BWE S;  4MM3 B;  2ACZ B;  1EWY C;  1ZGU B;  1L5P A;  3W2D A;  3W1S A;  1MFW A;  2V4I B;  2DBY A;  2JWU A;  2KTR B;  4BKS D;  2WXN A;  1VLB A;  3GZN I;  4IM3 A;  3MFG A;  4LTU A;  1V1O A;  1Z5S B;  3VQI A;  4RGT A;  3Q3J A;  2ZPN A;  3QJZ A;  3MTN B;  4BBN C;  3ABV B;  5EE1 A;  2WDV B;  4JL9 A;  2G9H D;  2BYF A;  4YL8 A;  4DDG D;  2HTH A;  3PLV A;  2JXT A;  3N3K B;  4XYC A;  1WMH A;  2CHZ A;  1J7C A;  2KMM A;  3L13 A;  3MHZ A;  1XQQ A;  2NPT A;  3TJP A;  4HXD A;  4OZC A;  2MBH A;  2NR2 A;  5D2M B;  1BXT A;  1WYW B;  4D2K A;  2WXG A;  5C1Z A;  1KLV A;  2CS4 A;  5FR3 A;  3MJ5 A;  1VRA B;  4GDL A;  1V49 A;  1QIL A;  4DHJ B;  4WJN A;  1F0Z A;  1SE2 A;  4L1B A;  1C4C A;  4NAM A;  4DHJ D;  2LD9 A;  2N7E A;  5JXV A;  2J0M A;  4XWW A;  4L23 A;  2ZCC A;  1DGJ A;  1RFA A;  3SD5 A;  3IBE A;  2R2O A;  2K8B A;  5J2R A;  2CR5 A;  5IA7 A;  4MT5 A;  2Z0D B;  3J9C A;  3SU8 X;  1SJE D;  3VVW B;  3VH3 B;  2HDE A;  1UGM A;  2IY1 B;  2JRI B;  3RCZ A;  4EUT A;  5LLI A;  5KHQ A;  2GMI C;  4PS8 A;  5CHF A;  4IOI E;  2FBW B;  2WX1 A;  3HRD D;  4OZA A;  4GU2 A;  1A70 A;  1C77 A;  2L8J A;  2WQY B;  3KUC B;  3L17 A;  3K9O B;  1NYQ A;  3ZJT A;  4IW0 A;  3V05 A;  1K53 A;  2KJR A;  2D07 B;  2KDI A;  1GG3 A;  4TMA B;  4KSL C;  1PGX A;  4AOF A;  2PMV A;  3NVW A;  4TV3 A;  3Q69 A;  2WS3 B;  1IPG A;  4MDK E;  2E6X A;  4IG7 B;  1J7A A;  3I63 C;  1V1P A;  4TKN A;  4M01 A;  3V3X A;  3BVG A;  4MJS B;  3ZLZ A;  3UIN B;  5E6P A;  1A5R A;  3ZKJ C;  2RDG A;  2L52 A;  2KC1 A;  2HE7 A;  4HDO A;  3T9L A;  1Q10 A;  2UU7 A;  2J7Q B;  2N1V A;  3EA6 A;  1I4X A;  3R2T A;  3OJ3 A;  2LUE A;  1K8R B;  1GTH A;  4RGM A;  1R4N B;  4KKI A;  4WJO A;  5HFY A;  2WXP A;  5I4D A;  3VUX A;  2J52 A;  2KO3 A;  4WQO B;  3DBL B;  2KAJ A;  4LNK A;  2IGD A;  2CHX A;  1GAQ B;  2ZNV C;  1WXQ A;  3BYT B;  2A4Z A;  1R4M B;  2MLB A;  2WXJ A;  2K1F A;  3H7P A;  2RGF A;  2LI5 A;  4GSW A;  1WGR A;  1NDD A;  4DXF A;  2MBE A;  1D6E C;  3U7D A;  5BYR A;  2AL3 A;  4OVV A;  1JWM D;  2AL6 A;  3PRE A;  1SF0 A;  1H7X A;  5AUI A;  2IGG A;  1TZ1 A;  4GGQ A;  3LB8 C;  1E9M A;  1D5X C;  3Q3O C;  4WQM A;  1YJI A;  2KN4 A;  2QC8 A;  5G55 A;  2FCS A;  4US8 A;  4WAA A;  2O2V A;  4FAD A;  4PYU A;  3MP9 A;  2V4L A;  3ECI A;  5TR5 A;  2V1Y A;  3CF4 A;  3P4S B;  3N20 C;  4M00 A;  4IWP A;  1LGR A;  2ZCB A;  3IVF A;  2DZI A;  4HVB A;  2YEP B;  1TY0 A;  3QAR A;  2K0P A;  4GLS C;  2WXI A;  1SIJ A;  2QIE B;  1T0R C;  1ACC A;  2WU2 B;  5J18 A;  2FE8 A;  1MG8 A;  2D5G A;  3DHH C;  3LXF A;  3C8Y A;  2INN E;  4IDI A;  1KM7 A;  1T0S C;  1JWA D;  4J3O D;  4ITK A;  4HDQ A;  1H7W A;  3SEB A;  1T5X D;  1GTE A;  2G3Q B;  2LGY A;  4MH0 E;  4DHZ E;  1M4V A;  3ZQ4 A;  5H8Y E;  5L83 A;  3UI3 A;  2ZNV B;  1TY2 A;  2WXL A;  2LJ5 A;  4R3D A;  2J4X A;  4LDT D;  2WXO A;  2WHI A;  4ZRI A;  1BML C;  4RGO S;  1WI0 A;  2AQ3 B;  4KKJ A;  2NBV B;  5AZG A;  1CMX B;  3BIN A;  2WX0 A;  5DPS A;  3VR8 B;  1C1Y B;  3DBR B;  3OJ4 B;  3CF6 E;  1FO4 A;  3HVD A;  4ZRJ A;  2INP E;  1E7U A;  1YQ3 B;  4HKZ E;  2WXM A;  2DLB A;  3O13 A;  1UWM A;  4G3X B;  3A9K A;  3VUY A;  3RI7 C;  2DWQ A;  4L2Y A;  1BUI C;  5T8I A;  5HI1 A;  2XBB C;  1P0R A;  2GBN A;  3VDZ A;  1S1Q B;  3M63 B;  1DYQ A;  4E74 A;  1FIQ A;  2REX A;  4GMV A;  2KNB A;  3QK0 A;  4NQK E;  1GT8 A;  1TZO A;  3VR9 B;  2PJH A;  2PVG C;  2WDT B;  5BO4 B;  1PQS A;  5D3I B;  4LJP B;  4GIV A;  4KX6 B;  3DWM A;  4MGK E;  2XEW A;  1E8W A;  1Q5W B;  1YN3 A;  3BVM A;  2KLG A;  1VJK A;  1FRR A;  2KDE B;  4H2A A;  4F1S A;  1L6U A;  3PRZ A;  1E90 A;  1WGD A;  3ZO5 B;  2MEK A;  2WDR B;  4X57 B;  4II3 B;  1WYG A;  4JWS C;  4M0W A;  4JX1 C;  4WJP A;  5HKH A;  3K9P B;  2Y5C A;  3B9J A;  3RMK C;  2BQQ A;  4HRS A;  4A3P A;  3CST A;  3N32 A;  2JVC A;  2NBU A;  2RR9 A;  5CTR C;  3RNA C;  4NNJ B;  4JLC A;  1GOZ A;  2N0S B;  3WA0 A;  2WDQ B;  5HHD G;  4GDK A;  3AE6 B;  1L2N A;  4ANX A;  2VZK B;  1KFY B;  2IBI B;  2BTE A;  3IG3 A;  3RNE C;  3OAW A;  3Q3M C;  4TQ1 A;  2LZ6 A;  3PGE A;  1QQR A;  2PLP A;  2KMA A;  4DQO C;  1XT9 B;  4HCN B;  4EEW A;  3ZYY X;  4KGS A;  1JRO A;  1WMH B;  1WJ4 A;  2MCN B;  2NPT B;  3HUI A;  1E10 A;  1C9F A;  2LUM A;  2IND C;  2FUG 1;  3R7Q A;  4KSK C;  1B9R A;  1GJZ A;  2KT7 A;  4RGN A;  2M8S A;  1YD8 U;  1E7V A;  3PZD A;  1MVK A;  1HTO A;  2M0X A;  1XO3 A;  3ML9 A;  1SSN A;  4HPP A;  3KQ4 A;  3AU4 A;  1MI0 A;  2BYV E;  3RYT A;  1TS2 A;  4DDI D;  1V97 A;  1FXI A;  2KQ7 A;  1ESF A;  1TKE A;  3P2B A;  2RMM A;  3RD2 A;  1WRI A;  3AEG B;  5G5H A;  4XDC A;  1FPY A;  2AQ1 B;  1SGH A;  5BMG A;  3X23 A;  1TYG B;  1AAR A;  2BKR B;  1GC6 A;  2WP9 B;  3PT2 B;  3Q3N C;  2EKI A;  2L76 A;  3APD A;  1NVI D;  2KK8 A;  1TGZ B;  1WE6 A;  2K9X A;  4C80 A;  4BOZ B;  2WGS A;  1F77 A;  4CHK A;  4M8M A;  4NJ7 A;  1NEN B;  2BS4 B;  4YTP B;  2ONQ A;  4MEM A;  3R66 C;  1N62 A;  2GBM A;  2IO2 B;  4WIP A;  2LRW A;  4BBN F;  1PDX A;  1TBE A;  3JSV A;  2RSU A;  1OQQ A;  1WX8 A;  2INC C;  2KFK A;  3SHQ A;  1J8C A;  2KJH B;  2Z59 B;  4ZYS A;  1WY8 A;  2B3A A;  1YJ1 A;  4E3C A;  1E6E B;  2QSD A;  4WWO A;  2R61 A;  4MAC A;  1LM8 B;  3ZNG C;  1V1P B;  2KXJ A;  3AU5 A;  2XNA C;  4EZL A;  3ZRC A;  2KAC A;  3OG5 A;  4W9I A;  3IAM 1;  1AWD A;  3EFC A;  4HPL B;  4BKG A;  3TMP B;  1DOX A;  3ZXR A;  2RDH A;  3IHP C;  4ANW A;  4YSX B;  4N58 A;  4II2 B;  3APC A;  1TJE A;  1UUP A;  5IKC M;  3A1Q A;  1XCT L;  5DPR A;  1JML A;  3NHE B;  2KN5 A;  5J17 A;  2K39 A;  1SJH D;  5AZF A;  2KKC A;  4M8N A;  4ZHP A;  1N61 A;  4LNO A;  3LDZ E;  2ICI A;  3H7P B;  3N30 A;  4G11 A;  2WXR A;  3NRZ A;  4WAF A;  3NVY A;  3PHX B;  1UBI A;  3U2S C;  4NZL B;  1GB4 A;  3DVG X;  2LVP A;  3CMM B;  3PZ8 A;  1ROE A;  1PGA A;  4EOY A;  5GMV A;  4B6W A;  2OHF A;  3Q14 C;  2MH7 A;  2CJN A;  4K7U A;  2O2V B;  1H4R A;  2WXH A;  3VH4 B;  3DVN U;  4N9F 4;  3PHW B;  1C76 A;  2MWS B;  2JYE A;  1EO6 A;  1L6V A;  4C56 C;  3AN1 A;  3BVZ A;  2M4N A;  4XX5 A;  3M3J A;  3NVV A;  2LWP A;  2GOW A;  2I1K A;  4XE0 A;  4W9H A;  2BBC A;  1WXV A;  1WR6 E;  3UGB B;  3AMZ A;  4ZOH C;  2IGH A;  1JWU D;  5E6O A;  2D3A A;  4CQN A;  3ZIM A;  4NAW B;  1D5Z C;  1JWS D;  4BOS C;  1XLQ A;  3V61 A;  3DOW A;  1N60 A;  2ZVO A;  3CIR B;  4MGY E;  2IO3 B;  4JPS A;  4G0N B;  1L0X B;  2L3Z A;  1WM3 A;  2RPQ A;  4AJY B;  2QEJ C;  1HXY D;  1TKY A;  2D11 A;  2HTM E;  4ZRP A;  4OZB A;  1TS4 A;  1VR9 A;  2C9W B;  1C4A A;  1GB1 A;  2G1E A;  2ZW1 A;  5D6J B;  4B0E A;  1PGB A;  2QHO A;  2C7H A;  4RCO A;  2KVR A;  3JW0 X;  1FXA A;  3A9K B;  3R3M A;  3CWI A;  4OW0 A;  4EKU A;  1D5M C;  1XXG A;  2FNJ B;  1WWT A;  1I42 A;  3QC8 B;  2KQS A;  5IO9 A;  2JQR B;  4WWN A;  1PFD A;  3TEY A;  4ZDV A;  2LHD A;  1K51 A;  2N9E B;  1X1M A;  2KQ4 X;  3Q6B A;  4LNI A;  2QCZ A;  2NMQ A;  4RM8 A;  3VTV A;  2M0A A;  4KV2 A;  3IT4 B;  3U8Z A;  4ZYN A;  2BW2 A;  4ASW C;  4Q2J A;  4BKT A;  1XCQ L;  1DOY A;  3VRB B;  3RNG C;  1VZ8 A;  3MC9 A;  5LXI B;  4P16 A;  5LXH A;  2LRU A;  4ANV A;  2I1J A;  1YQB A;  1YNT E;  5LNK 1;  2R2Q A;  4A3O A;  3KH0 A;  5DCN A;  3NY5 A;  2EEL A;  2PTL A;  3W1Y A;  3ENE A;  4AUQ C;  2BB5 A;  3L4P A;  4FUL A;  3ZDT A;  1NBF C;  4CYE A;  4NQL B;  1B1Z A;  3RUL A;  4JIO U;  4M0W B;  3A33 B;  1OFF A;  1IUE A;  3P4R B;  3TSS A;  4GB9 A;  1SB3 C;  1WF9 A;  5FR6 A;  1QZE A;  4HRO A;  2J0J A;  2ZW0 A;  4BKS A;  3AV8 A;  1GC7 A;  5JH5 C;  2J42 A;  2G45 B;  4GDK B;  2KDM A;  4BZA A;  1L7Y A;  1WFY A;  1KTK A;  1RAX A;  4IUM B;  1Y56 A;  3AE5 B;  1FD6 A;  1IGC A;  3VTU A;  3DBH I;  2J0K A;  3P4P B;  5CX3 A;  2MX2 A;  1LXD A;  5C2T B;  1K52 A;  3A4R A;  1ISN A;  2BYE A;  1YX6 B;  4G50 A;  3GZN B;  3AE9 B;  2O6V A;  4NJC A;  3L10 B;  1CJE A;  1VCB A;  2SEB D;  2W82 A;  2BT6 A;  3ZUN A;  2DX5 B;  1WR1 A;  2MW5 A;  3GE8 C;  1FNU A;  4W9D A;  3KYD D;  4HLE A;  1I4G A;  3Q3F A;  3N1Z C;  3RFZ B;  2K3U A;  2ZEQ A;  3EFU A;  2Y5B B;  4NAW A;  1WE7 A;  1ZXH A;  2WXK A;  4E71 A;  1IBX A;  4AQ7 A;  2NBW B;  4YTN B;  3SDL C;  2MJ3 A;  2IO0 B;  2FIF A;  5C3J B;  4O1N A;  3R2I A;  1KOT A;  2MP2 A;  1IP9 A;  2L0T A;  1XF5 L;  4GXB A;  4B95 A;  3U4E G;  2KWC A; 
#chains in the Genus database with same CATH homology
 1EU4 A;  4MM3 B;  2ACZ B;  3U52 E;  1EWY C;  3HUI A;  1L5P A;  1E10 A;  1C9F A;  2LUM A;  2FUG 1;  3W2D A;  2W3S A;  1HQR D;  1ZXI A;  3W1S A;  1I4R A;  1F2R C;  1XLO A;  2V4I B;  2WU5 B;  2QIL A;  2DBY A;  2RPV A;  2JWU A;  2WXN A;  1VLB A;  1MPE A;  1WSP A;  3MFG A;  1B9R A;  3NS1 A;  4LTU A;  1JCK B;  1V1O A;  3FIL B;  3VQI A;  1ENF A;  4RGT A;  3E56 A;  4RGN A;  5E6J A;  3Q8B A;  5AUK A;  1F2R I;  2SAK A;  3ABV B;  1MVK A;  1YJJ A;  5EE1 A;  2WDV B;  1FFV A;  2G9H D;  3DWG C;  3AM9 A;  4LLG M;  1FRD A;  1XO3 A;  2JXT A;  2QJL A;  1SSN A;  4YWG G;  4A9A A;  1KRH A;  3H8H A;  3KQ4 A;  4LK0 M;  1MI0 A;  1TKG A;  4OHJ A;  1PUT A;  1J7C A;  2KMM A;  1TS2 A;  2LFI A;  3MHZ A;  1UWX A;  3KWL A;  3TUO A;  1V97 A;  1FXI A;  3IXS A;  1FEH A;  4OZC A;  1ESF A;  1QT9 A;  1BXT A;  3BZD B;  1TKE A;  2H88 B;  4TSS A;  4D2K A;  2RMM A;  3PO0 A;  1WRI A;  1NYR A;  1UGJ A;  4XDD A;  3AEG B;  2WXG A;  5G5H A;  4XDC A;  5FR3 A;  1D4B A;  2AQ1 B;  3OWE B;  5HG2 A;  4B0M A;  5BMG A;  1JRP A;  1RM6 C;  3MJ5 A;  3WCQ A;  5D3D A;  1TYG B;  2N9K A;  1VRA B;  2PVO D;  3FIL A;  1FFU A;  2AQ2 B;  1QIL A;  2WP9 B;  1F0Z A;  4KGR A;  1SE2 A;  2Z8L A;  4ZHO A;  4L1B A;  1C4C A;  4NAM A;  2BYT A;  1UNS A;  2EKI A;  5JXV A;  3EGR A;  4XWW A;  1NVI D;  4L23 A;  1DGJ A;  3NVZ A;  2K9X A;  4C80 A;  1F77 A;  1RWS A;  1NEN B;  2BS4 B;  4YTP B;  2ONQ A;  2L32 A;  3W5V B;  5MPO A;  4MT5 A;  1N62 A;  3ETR A;  1N63 A;  1DOI A;  4JWU C;  3I9V 1;  4WIP A;  4HKQ A;  4RF0 A;  3J9C A;  4YXD B;  1PDX A;  4A6Q A;  1I4P A;  1OQQ A;  1SJE D;  1JQ4 A;  3AE1 B;  1L4Z B;  2HDE A;  4HJG E;  1VDV A;  4N59 A;  4ZYS A;  1E6E B;  2QSD A;  2BS3 B;  2R61 A;  4MAC A;  4OVZ A;  3Q8F A;  4IOI E;  2FBW B;  3HRD D;  4OZA A;  2IPK D;  4DXG A;  3N9Y C;  2M19 A;  2V3P A;  1V1P B;  2CU3 A;  1A70 A;  2XNA C;  1QOF A;  2VZK D;  2KAC A;  1C77 A;  3AEE B;  2WQY B;  5BYS A;  1HEZ E;  1N5W A;  3IAM 1;  1NYQ A;  3ZJT A;  3V05 A;  1AWD A;  1DOX A;  1K53 A;  2JSV X;  1ZUD 2;  2RDH A;  1I4H A;  1EU3 A;  2V3N A;  4WWM A;  3W5U B;  4YSX B;  4TMA B;  4N58 A;  2LHE A;  1PGX A;  3BII D;  3KLS X;  1AYF A;  1CK1 A;  1MHH E;  1TJE A;  1UUP A;  1C79 A;  1XCT L;  5EE0 A;  1JML A;  2PMV A;  3NVW A;  2Q5W D;  2W55 A;  2PIA A;  2XN9 C;  1SJH D;  2WS3 B;  3P42 A;  3Q69 A;  2E6X A;  3ZJV A;  1T6B X;  1J7A A;  1CZP A;  3EUB 2;  4ZHP A;  1N61 A;  2JZP A;  1V1P A;  3E9S A;  2ICI A;  3V3X A;  3BVG A;  4YSY B;  4TQ0 A;  1VZ7 A;  1SE3 A;  2RDG A;  3T3O A;  2GB1 A;  2WXR A;  3NRZ A;  2L52 A;  4WAF A;  1HZ5 A;  3NVY A;  1YMH E;  1Q10 A;  3BK2 A;  4NZL B;  3U2S C;  1GB4 A;  3EA6 A;  3PZ8 A;  1I4X A;  3U7Z A;  1ROE A;  1PGA A;  3R2T A;  3TEZ A;  2LGI A;  1TS5 A;  1K50 A;  3R8B A;  1E0Z A;  1GTH A;  1PYW D;  2JX5 A;  4P6V F;  2OHF A;  1L4D B;  2MH7 A;  4RGM A;  4KKI A;  2CJN A;  2H89 B;  5HFY A;  2WXP A;  5I4D A;  2K22 A;  2J52 A;  2KAJ A;  3AH7 A;  1OQR A;  2WXH A;  2IGD A;  1GAQ B;  1P7F A;  1RYJ A;  3AE8 B;  1C76 A;  1ZE3 D;  3AB5 A;  1WXQ A;  1HZ6 A;  1XLP A;  3BYT B;  2WXJ A;  1QOG A;  2JYE A;  5BYQ A;  1L0Y B;  1MHX A;  1L6V A;  1FMA D;  3AN1 A;  4C56 C;  1QF6 A;  3BVZ A;  1FCL A;  4DXF A;  1CQV A;  1D6E C;  3IT6 B;  4A55 A;  3NVV A;  5BYR A;  2B76 B;  3TEX A;  1JWM D;  4USA A;  1SF0 A;  1P7E A;  1H7X A;  1N5X A;  4XE0 A;  5AUI A;  4HEA 1;  3IAS 1;  2BBC A;  2IGG A;  1SXT A;  3LB8 C;  1E9M A;  4UDU C;  4ARC A;  1D5X C;  2L1A A;  2Y5P A;  2I38 A;  3AMZ A;  4ZOH C;  2IGH A;  4WQM A;  1JWU D;  1YJI A;  2KN4 A;  4US8 A;  4CQN A;  3B2F A;  2X38 A;  4NAW B;  1VZ6 A;  1D5Z C;  1JWS D;  3MC0 B;  3MP9 A;  3P4Q B;  1XLQ A;  3CF4 A;  3P4S B;  1RFK A;  1WGK A;  1C4P A;  1N60 A;  4MH8 A;  1FCC C;  2J53 A;  3CIR B;  4JPS A;  1L0X B;  5FK9 C;  1SE4 A;  5D7G A;  1LO5 D;  2YEP B;  1TY0 A;  2K0P A;  4GLS C;  2QEJ C;  1C78 A;  2WXI A;  1HXY D;  1SIJ A;  2QIE B;  2W54 A;  4WH4 A;  1ACC A;  2WU2 B;  1TKY A;  4JE3 B;  3P63 A;  3Q8E A;  2LMC A;  2FE8 A;  2M56 B;  4ARI A;  2HTM E;  1KF6 B;  1SEB D;  2D5G A;  4OZB A;  4ZRP A;  1TS4 A;  1VR9 A;  3LXF A;  1C4A A;  4AS1 A;  3C8Y A;  2GI9 A;  1XLN A;  2INN E;  2G1E A;  2WXQ A;  2ZW1 A;  3BK1 A;  3HVZ A;  4IDI A;  1GB1 A;  1I7H A;  4B0E A;  1PGB A;  4REZ A;  4YT0 B;  3AE7 B;  1IGD A;  3Q8C A;  1JWA D;  4RCO A;  4J3O D;  4ITK A;  1H7W A;  1YQ4 B;  1FXA A;  3T3N A;  3AE4 B;  1AW7 A;  3SEB A;  1EM7 A;  1T5X D;  1GTE A;  2V0G A;  2KWD A;  3CWI A;  1M4V A;  4OW0 A;  1D5M C;  4IKG A;  1XXG A;  3ZQ4 A;  1WWT A;  5H8Y E;  3UI3 A;  1YN4 A;  1FNV A;  1QOB A;  1TY2 A;  2JQR B;  2WXL A;  1PFD A;  3TEY A;  4R3D A;  2J4X A;  2LHD A;  1K51 A;  4RF1 A;  3VRA B;  5BMI A;  3ZGZ A;  2PKO A;  2WXO A;  4US9 A;  3B2G A;  3AEF B;  1BML C;  4RGO S;  2W3R A;  2KQ4 X;  2AQ3 B;  3AEC B;  5TSS A;  4KKJ A;  2NTT A;  3URY A;  3RPF C;  2NMQ A;  1ZPS A;  2L83 A;  1HA5 A;  2M0A A;  3PZ7 A;  1ZDV A;  3IT4 B;  1ET9 A;  2NTS A;  1QOA A;  1I4Q A;  3AEB B;  3VR8 B;  2BW2 A;  4KGT A;  1NEK B;  1FO4 A;  1NI3 A;  3HVD A;  3KWV A;  4Q2J A;  3W9C B;  2I2Y A;  1XCQ L;  2INP E;  1DOY A;  1FNW A;  2LEK A;  1YQ3 B;  3VRB B;  4HKZ E;  2K5P A;  3AEA B;  2WXM A;  2CJO A;  2DLB A;  1UWM A;  1VZ8 A;  1ET6 A;  3O13 A;  4RFB A;  2JU6 X;  2DWQ A;  2QMT A;  4GDL B;  3GP7 A;  4L2Y A;  4P16 A;  1E7P B;  1BUI C;  5T8I A;  5HI1 A;  1YNT E;  5LNK 1;  4C7Y A;  5GXG B;  5FKA C;  2EEL A;  3Q8A A;  2PTL A;  3AE3 B;  5EE3 A;  3ZJU A;  2WLB A;  1L0V B;  2BB5 A;  3L4P A;  1XEE A;  1GPX A;  2PW9 A;  1DYQ A;  2BB6 A;  1B1Z A;  2Y3A A;  3FC4 A;  1OFF A;  1IUE A;  1FIQ A;  2IDY A;  4A90 A;  5G5G A;  3P4R B;  2OED A;  1SBB B;  2JYT A;  3SFE B;  3TSS A;  4EE2 A;  3NUH B;  1SB3 C;  1GT8 A;  5EE9 A;  1TZO A;  4XWT A;  4YTM B;  1JWB D;  4HRO A;  2ZW0 A;  2MJE A;  3AV8 A;  3VR9 B;  1YN5 A;  2TSS A;  2PVG C;  5D3I B;  2J42 A;  4GDK B;  2YEP F;  2KDM A;  4KX6 B;  3DWM A;  4ZRQ A;  1YN3 A;  3BVM A;  1VJK A;  1FRR A;  4RNA A;  1QLB B;  1KTK A;  2WNM A;  3GS2 A;  1IBX B;  4H2A A;  1Y56 A;  1FM0 D;  4A8X C;  1L6U A;  1V8C A;  1J7B A;  3AE5 B;  1KLU D;  1FD6 A;  1IGC A;  2IJ0 A;  1TS3 A;  3SR6 A;  3P4P B;  3LYY A;  2AX5 A;  2MEK A;  2WDR B;  2N7J A;  1WYG A;  5C2T B;  1K52 A;  2E3T A;  4JWS C;  1ZDX A;  2WXF A;  3GB1 A;  4M0W A;  4JX1 C;  2LJI A;  4PT5 A;  1STE A;  2Y5C A;  4N6E B;  3AE9 B;  3B9J A;  1JAL A;  4HRS A;  3SFD B;  1KH0 A;  4NJC A;  2BS2 B;  1CJE A;  3I57 A;  2SEB D;  2W82 A;  2BT6 A;  2MJD A;  4RH6 A;  1FNU A;  1GOZ A;  2N0S B;  4C7Z A;  2ON8 A;  2WDQ B;  1I4G A;  1R7S A;  1QKZ A;  3BWU D;  3AE6 B;  5HHD G;  3RFZ B;  2K3U A;  4WUR A;  1EWC A;  2VZK B;  1KFY B;  1ZXH A;  2DYM A;  2BTE A;  2WXK A;  3FAH A;  3AED B;  1IBX A;  4AQ7 A;  3TEW A;  3BYY B;  4FXC A;  4YTN B;  2N9L A;  4TQ1 A;  2MJ3 A;  1ZOY B;  4YSZ B;  5C3J B;  1QQR A;  3AE2 B;  1T3Q A;  4O1N A;  3R2I A;  3P1M A;  1AN8 A;  1XF5 L;  2PLP A;  5H92 C;  2GRI A;  1JW9 D;  4DQO C;  1KLG D;  2DYO A;  3NZ3 A;  1ZP0 B;  4KGS A;  1JRO A;  3U4E G;  3ZYY X;  5BMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...