2B76B

E. coli quinol fumarate reductase frda e49q mutation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 59
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2b76B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2b76B01
2WDQB 3AM9A 2W55A 1N62A 1XLNA 1NI3A 2CU3A 1E6EB 3AE6B 3AMZA 3NRZA 3NVZA 3AEGB 5H8YE 3FAHA 1TKEA 3AEEB 3AN1A 2WS3B 1DGJA 1L0VB 2K22A 1GTHA 4YTNB 2E3TA 2AX5A 2H88B 2MH7A 3CIRB 1QOGA 4US9A 3P63A 4C7YA 3DWGC 3AE7B 2K5PA 1L6UA 3SFEB 3VRBB 1QOBA 1KRHA 1OQQA 1PFDA 2L83A 3BIID 4N58A 4ZOHC 5EE3A 1FO4A 2BT6A 4JWSC 1QF6A 1A70A 1I7HA 1E10A 1XLOA 1JRPA 1TKYA 2DWQA 4FXCA 1AWDA 2CJOA 2CJNA 2K9XA 2WLBA 4HROA 2JX5A 4USAA 2MJ3A 1FMAD 3P4QB 3P1MA 2QJLA 2JQRB 5C2TB 3B9JA 3P4PB 3VRAB 1DOXA 3HRDD 1TKGA 3FC4A 4P6VF 1QT9A 2DBYA 1L5PA 4US8A 4N6EB 1DOIA 1FRDA 3W5UB 4C80A 1H7WA 1RYJA 3W9CB 1VLBA 2WU2B 1CJEA 5EE0A 3ZYYX 1FIQA 5EE9A 1XLQA 3AV8A 2EKIA 1KF6B 2H89B 1RM6C 1T3QA 3KWLA 1QOFA 3L4PA 1NYRA 4WWMA 3AE4B 1OFFA 2BS3B 1XO3A 3NS1A 3AE5B 1IUEA 2FBWB 1L6VA 3EUB2 4JX1C 1JQ4A 1GPXA 2WQYB 3AE1B 3AE3B 5H92C 2HTME 3AB5A 4YSZB 1ZP0B 4YXDB 3B2GA 4IDIA 1J7BA 1JALA 3AEDB 3AE8B 1N5XA 1WRIA 1N60A 1YJIA 1N63A 2WDRB 1NVID 3PO0A 1JROA 1WXQA 3W5VB 3NVWA 2OHFA 1FFUA 1TYGB 1NEKB 1WGKA 2PVOD 2BS4B 1N61A 1E0ZA 4A9AA 3SR6A 1ZXIA 2PKOA 1KFYB 2LEKA 3ETRA 3NVYA 4C7ZA 1NYQA 1J7AA 1YQ4B 1V8CA 3NVVA 1E7PB 1SF0A 2KAJA 3RPFC 5MPOA 4HRSA 1JWBD 3ABVB 3CF4A 1ZOYB 1SB3C 5G5HA 3VR8B 1SIJA 1VDVA 2G1EA 3AH7A 3WCQA 4ZHOA 1JWAD 4YTMB 1FRRA 5C3JB 1OQRA 1B9RA 1FFVA 2Q5WD 3HUIA 5G5GA 1VJKA 3AEAB 1J7CA 2QIEB 1FM0D 1XLPA 1YQ3B 1V97A 4YT0B 1DOYA 2KMMA 3LB8C 2WU5B 1QLBB 1R7SA 5AUIA 3VR9B 3CWIA 1ROEA 4YSYB 4YTPB 1RFKA 2BS2B 4KX6B 1RWSA 2WDVB 3AEFB 1UWMA 4JWUC 2W3SA 2B76B 2M56B 3P4SB 2W54A 4LTUA 1ZUD2 1PDXA 3LXFA 1H7XA 1CZPA 1JW9D 2MJDA 5GXGB 2Y5CA 2WP9B 1FXIA 3AECB 3AE2B 1YJJA 1TJEA 2MJEA 1WYGA 1N5WA 2W3RA 3HVZA 1EWYC 4YSXB 1E9MA 3SFDB 1AYFA 5AUKA 1WWTA 1QOAA 4WQMA 1PUTA 5EE1A 2PVGC 2L52A 2ACZB 2PIAA 4N59A 3DWMA 1GT8A 1NENB 3AE9B 2M19A 4ZHPA 3P4RB 4ITKA 3B2FA 1F0ZA 2N0SB 3AEBB 1FXAA 1GTEA 1GAQB
chains in the Genus database with same CATH superfamily
1LXDA 2KN4A 2Y5PA 4ARCA 4MELA 2K22A 1D5XC 3PRMB 3I57A 1QOGA 4MM3A 2RDGA 2WXMA 4F7ZA 2L83A 5EE3A 2WXOA 4RGMA 1SE4A 1WZ0A 4WAAA 1WX9A 2KHWB 4EEWA 2BGFA 4K1RB 1WI0A 4MGZE 3GE8C 4HJKA 3DQVA 3ZYYX 1OTRB 4RCOA 1FNVA 3AV8A 4A8XC 2GBKA 1XXGA 1L6VA 1PGXA 5GMVA 1GPXA 2KVRA 3TSSA 3FKYA 2NR2A 2JYTA 1YOVB 4XYCA 2OHFA 3QA8A 1WX8A 1EF5A 1IBXA 2ZCCA 2I2YA 2BYFA 4J6IA 1IBXB 4XDDA 2J7QB 4E71A 3SU8X 3KW5B 3ONSA 2QSDA 3HIZA 4DHZE 3Q3NC 3K9OB 1VDVA 2M8SA 3WCQA 4WJNA 1I4GA 2OEDA 2KC2A 2BYVE 4L2YA 4HJGE 3LB8C 2WU5B 4DK5A 3KVFB 1UELA 4I6LB 2W9NA 1VZ6A 4DXFA 4K7UA 1ZUD2 1IGDA 3I9V1 2XK5A 4OZCA 4BAXA 2G9HD 2KTFA 5HFYA 1JWMD 1V1PA 1E9MA 1T5XD 2WDTB 4TQ0A 4DHZB 3BVMA 2N9XA 3AEBB 1WXVA 1WGRA 1N5XA 4TV3A 5LXIB 3ZNGC 4OVVA 1RAXA 2V1YA 2BWFA 4II2B 4HKQA 2J42A 3VAWA 3DOWA 4A3PA 1I4QA 2MRPA 3JYUA 3OWEB 4BZAA 3ZUNA 3AU5A 3WA0A 4FULA 2LZ6A 1QOBA 4KVGB 4GDKA 1FO4A 4H2AA 5CTRC 2KNBA 2IY0B 3IAS1 2L8JA 5BYSA 1QQRA 4MSQB 2DBYA 2GI9A 3N32A 2JU6X 4GDLA 1CJEA 5LNK1 2WGSA 5CHWA 3R7RA 3L4PA 1WIAA 4RM8A 2BS3B 2X8XX 5AZGA 3EUB2 3NZSA 3OJ3A 4KKIA 2ZPNA 3B2GA 3C0RB 3J9CA 1N60A 3AULA 1N61A 4HDQA 5DPTA 3RNFC 3RD2A 1GC6A 2K6DB 2KAJA 1SGHA 5HHDG 3ABVB 1I4RA 5I4DA 3ZJVA 4IWPA 3DCGA 2WXQA 4WJQA 4G3XB 3DVNU 3BY4B 1S3SG 4LNFA 2HE7A 5D2MB 3B1LX 1UD7A 1PDXA 1P0RA 2ZW0A 3H7PA 3OJ4B 1GG3A 4BKSD 4ANUA 3MC8A 3UQAA 1TJEA 1WYGA 3RNCC 1GJZA 2RDBC 3EFUA 1QOAA 4NQLB 1KLGD 2ZNVC 1E8XA 3ZGZA 2PIAA 3DWMA 3ENEA 3DHHC 5JHAA 3ZJUA 2LUMA 5H8YE 1ZKHA 3V6CB 4YL8A 2GBRA 1KM7A 2NTTA 1AW7A 2MH7A 2QC8A 2N9PC 3QJZA 2KDEB 5J2RA 3R3MA 5E6OA 5IAAC 2WNMA 4JL9A 2HTHA 2PW9A 4JQWC 3R2IA 1FMAD 1DYQA 5EDSA 4ACFA 2JRHA 2DYMA 3Q8FA 1V49A 2MEKA 2ZZPB 1YN5A 1C1YB 1WXSA 3TEWA 2R2OA 5JH5C 3UIOB 4LNIA 3A4RA 2NPTB 1HZ5A 3ZNID 5CHVC 4JPSA 1OFFA 4DXAB 4A90A 1N6ZA 3NS1A 3S2AA 3A9KB 2KT7A 1UUPA 1QKZA 3IHPC 3TEXA 1KFYB 2JT4B 2L1AA 2MSED 5JHBA 4K3CA 3B0AA 1C3TA 1YQ4B 1V8CA 3FILB 5FR3A 2RPQA 3L54A 4IC7B 3ZTCA 4B9KA 3ZKJC 4IM2A 1GOZA 2AQ3B 1U4AA 2KMCA 3VR8B 4ICVA 2JRIB 2KMAA 4OVZA 4B0EA 3H1UA 2JVCA 4NJ6A 3ZQ4A 3MHZA 5DPSA 2MWSB 1PGAA 1NBFC 4FJVB 3APFA 1J8CA 3AEFB 3PVLA 4IKGA 1WXMA 1SJHD 1WR6E 5G2NA 3U2SC 2N7EA 1P98A 3VH4B 4D2KA 5AUKA 3OAWA 1KOTA 3VVWB 2ACZB 2Y3AA 1D5MC 4P1CC 5C23A 4PT5A 4E3CA 4W9IA 2JZZA 2KQ4X 2KFJA 2D2QA 4A6QA 5FKAC 2CU3A 4TQ1A 1FCLA 2QMTA 4XWWA 3CIRB 3P63A 3N1XC 1I4XA 4HCPB 3P1MA 2K5PA 2KWDA 4GSWA 2BKRB 1C4PA 1I7HA 2L3ZA 1TKYA 1ZXHA 4USAA 4XX5A 2REXA 3BWUD 2RPVA 4NAWA 4IOIE 2XBBC 2JZPA 3JW0X 4C80A 3RNGC 1K51A 3CF6E 3IG3A 4KZCA 2H89B 2VH1A 4GMVA 4KIKA 2X38A 1C4AA 1NI2A 1TT5B 3AE3B 2WXKA 3A33B 4MGKE 4KIKB 2DZMA 2CHZA 2INPE 1JALA 4NNJB 1F77A 3GOEA 4GXBA 3M95A 2BS4B 2XNAC 3ETRA 4OVUA 3U30A 1AARA 2L0TA 4HRSA 2QDFA 3I5JC 1SIJA 4HLEA 1KLUD 2AQ2B 3DPDA 3NG0A 2DAFA 2V0GA 5L95C 1VJKA 4LNKA 1YQBA 2FIDA 1I4HA 2ICIA 2BS2B 3U7ZA 2B76B 1L4DB 3BZDB 4UDUC 2WP9B 1SE3A 3HVZA 3L16A 2N1VA 3Q69A 3TUOA 2SEBD 2FE8A 3ZDTA 2PVGC 4N59A 1QZEA 1F9JA 2O2VB 3RNAC 3GZNI 4R3DA 4ZRKA 4RFBA 4J3OD 4KSLC 2N7JA 3ZXRA 4URKA 5BMHA 4RH6A 2KYWA 4MEMA 1C9FA 3VRBB 4N58A 1OQQA 3TEZA 2MBHA 1Z2MA 2QJLA 5J17A 2O6VA 3QIJA 3Q8CA 3U7DA 3ML9A 2Z59B 2KLGA 3W5UB 2I38A 4RNAA 3C19A 1XLQA 4NAMA 3DDCB 2L7RA 2BPSA 3TIXA 3DBHI 1MG8A 3UINB 2WDRB 2A4ZA 4C4VB 1JROA 2PVOD 1V5TA 4RF0A 2JUOA 3PRZA 1R4MI 4WURA 1JWBD 4M8MA 4BVUC 1MG4A 2PLPA 3U52E 5LXHA 4KGTA 2PPHA 3VUXA 1J7CA 3DVNV 1BT0A 1R7SA 4DHJD 4AJYB 3NS8A 3QHTA 3RULA 2W54A 2D3GA 2MBEA 4AS1A 2INNE 3O13A 1EUVB 3M3JA 1EO6A 4ZHPA 5DCNA 2MP2A 4GOCA 2FCSA 2DYBA 2MP2B 3NVZA 3AMZA 3IT6B 1QILA 1T0SC 3FAHA 1WH3A 2BYEA 2HJ8A 3BYYB 3CSFA 3PLVA 1H8CA 1ZGUB 1SE2A 3DWGC 4KGSA 3BVGA 2G45B 3BIID 2BT6A 5JZEB 2J0JA 1GC7A 1WFYA 3RMKC 1YN4A 3H6NA 1DOXA 1MHXA 1BMLC 3DBLB 1HE8A 4KV2A 3ZRFA 2WU2B 4XZ4A 1XCQL 2TSSA 2LD9A 2WX0A 2HDEA 4JX1C 1IUEA 2FCMA 2JPHA 2DLBA 3MTNB 1XCTL 4RGNA 2IO0B 2DYOA 1N63A 3KUDB 3UI3A 1WE6A 4N9F4 1LGRA 1CQVA 1WGYA 4DXGA 4LNNA 4XDCA 2B3AA 4MACA 1K8RB 2LMCA 4YTMB 2K3UA 5BMIA 1XQQA 3AEAB 3WAOA 4MSMB 4OZAA 1DOYA 1V9JA 5BYRA 3PZ8A 2DAJA 4IM3A 4ANXA 2LHEA 1ZW7A 4Q2JA 4RM9A 2MJDA 4K81A 3Q8EA 2LGXA 1YIWA 4YSXB 3HM3A 4ZRPA 2NBVB 4A3OA 2IPKD 3ZIMA 1FXAA 4LDTD 3QK0A 2DNFA 4M0WA 4HCNB 2JY6A 4II3B 3AE6B 4M0WB 3NUHB 4AJWA 2J0KA 3LJ3A 1SJED 2ZJDA 2BBCA 4WIPA 4HEA1 2K1FA 1V1OA 2OJWA 5EE0A 3VDZA 2M4NA 1D5ZC 1QF6A 2JX5A 3RYTA 4QAYA 3B9JA 1UBIA 1WE7A 5FK9C 1TS2A 4XC2A 4IG7B 1XEEA 2ZCBA 2K0PA 3PZDA 4EZLA 4KKJA 1RM6C 2J0MA 1L0XB 1VRAB 1YNTE 2IGGA 2QHOA 1V6EA 4IM0A 1ACCA 2WXHA 3AB5A 4YSZB 4IDIA 3E9SA 2BYTA 2CR5A 2C5LC 2KJ6A 4TSSA 3W5VB 1WGKA 4WWOA 2BF8B 4WWPA 2RDHA 3HK0A 1J7AA 4S0RA 2FIFA 4RF1A 2LGDA 2NBUA 5BMGA 4OHJA 3HUIA 1PGBA 2KDBA 2QIEB 2NBWB 1Q10A 3CWIA 3Q3JA 4LTUA 5GXGB 3ML8A 1SEBD 3W1SA 1L0YB 2D3CA 3Q2AC 1CK1A 1VZ8A 1RRBA 1NENB 2M19A 4EKUA 2IO2B 1J19A 3RNEC 2M0XA 2WDQB 3AEGB 5IN7A 2WS3B 1L0VB 4GU2A 2LFIA 4TKNA 3Q8AA 3T8MA 4ARIA 1FNUA 1C4CA 2KVZA 4BKGA 2ZNVB 2DWQA 4FXCA 4HROA 4K7SA 1UWXA 1YJ1A 3UF8A 1L2NA 1Y56A 3I63C 3P4PB 1TKGA 2WHIA 3RN9C 5G55A 3X23A 3ZNZB 1H7WA 2NTSA 2QEJC 3W9CB 3L0WB 1T0QC 2KKCA 3ALBA 3I3TB 1MVKA 2EKIA 1KF6B 1T3QA 1QOFA 1D6EC 2V4IB 4WJOA 1XO3A 3KH0A 2HD5B 3K9PB 3CMMB 4ANWA 4YXDB 2VZKD 5L83A 2D3AA 1JWUD 1M4VA 3LYYA 1WGDA 1YJIA 3A1QB 3ZXVA 2V9HA 1R4NI 4REZA 2KXJA 1SBBB 1C76A 4I6NB 5IA7A 2NPTA 3NVVA 1F1HA 1E7PB 4OW0A 2YEPF 1WRDB 2LXAA 1ZOYB 1OQYA 3AI5A 4CYEA 4W9EA 2RD0A 3A9KA 4DHJB 3VTVA 1OQRA 2OOBB 3RT3B 4WQOB 4RGTA 2BQQA 3SHQA 2WXRA 1QLBB 1XT9B 3FILA 1MPEA 2WWZA 1IP9A 1KH0A 3AE2B 3DBRI 1N5WA 2MX2A 1E8YA 3JSVB 3ZO5B 4WQMA 4EZKA 1VZ7A 4F1SA 3Q3FA 4ITKA 2ONQA 4MDKE 1JRPA 2J4XA 4EFOA 3PGEA 3TBLD 4FA6A 1ET6A 1N62A 2W55A 1NI3A 2SAKA 3DVGX 5D94A 4PS8A 3N20C 3IFWB 3PRPB 2AX5A 1RFAA 4S17A 4G50A 2KTRB 1L6UA 1UGJA 4ZOHC 4HWIB 1XLOA 2WLBA 3W2DA 3OG5A 2KZRA 2MJ3A 3TMPB 2DZKA 3OLMD 4GB9A 4O1NA 1XD3B 4BBNF 5CHFA 4XGAB 4C00A 3IT4B 3QC8B 2LGIA 2L76A 2RR9A 3L13A 3AE5B 3APCA 3APDA 3NZUA 1WR1A 4EOYA 4MH0E 5H92C 2K8HA 2BW2A 2WXLA 1GUAB 2BVCA 4WAFA 2MCNB 3NVWA 1NEKB 1HEZE 4W9FA 1ZXIA 2IJ0A 3M62B 3PZ7A 4MT5A 4MGIE 4NJ7A 1SB3C 3V60A 2LI5A 4WJPA 1ZE3D 2GMIC 3MC0B 5C3JB 4G11A 5IP4D 2WXGA 3HM6X 5TSSA 3PS6A 1EM7A 4PS7A 3VHTC 2WXPA 2XEWA 3R66C 2D3BA 2KANA 2IO1B 1WM3A 5CX3A 2KWVB 2W3RA 1EWYC 1UH6A 2LWPA 1ET9A 4LDTB 4I6PA 4EUTA 2C60A 3MJ5A 3QARA 2KWCA 3AE9B 4AQ7A 2KDMA 1GAQB 1FCCC 3HHMA 3KYDD 2CS4A 2KC1A 4P1BC 2CHXA 3TL5A 1TKEA 3AEEB 2AWTA 2K8CA 3RZFA 3RZWC 3NHEB 3NZ3A 3RFZB 2KWUB 1WX7A 4BKTA 3GP7A 4PYZA 3VFKA 2AL3A 1STEA 2CJNA 2K9XA 3PTFC 2JXXA 2O2VA 1WM2A 3HVDA 4AP4C 2RMMA 4P7IA 4KGRA 1D4BA 4P6VF 4F8CB 1L5PA 2LVPA 5DPWA 2LUEA 4A55A 5EE9A 3VQIA 2ZPYA 1WXAA 1TGZB 4W9DA 2M17A 2G3QB 1WRIA 1C79A 4ZRQA 5T8IA 2PKOA 2YLMA 4K7WA 1HTOA 3EGRA 3ZTDA 1PYWD 2MHJA 3BINA 4PK1A 3ZNHB 3U4EG 1FFVA 3DBLI 5G5GA 1VD2A 4C4VA 2LRWA 2KQ7A 1P9DU 5C1ZA 3R8BA 3VR9B 2D11A 1WJ4A 4W9LA 4YSYB 4YTPB 2K8BA 5KHOA 4MJSB 3TEYA 2MJEA 2KN5A 4DBGA 2QCZA 2ZW1A 3H8HA 1AYFA 3RCZA 2K6QA 4HK2A 5EE1A 1HA5A 2FUG1 1C77A 1GT8A 4CHKA 2KFKA 1P7EA 4W9GA 2IO3B 1T6BX 1MHHE 2KFKB 1MI0A 1WGHA 1XLNA 2PJHA 5BYQA 1FXTB 4M01A 3SEBA 4FN2A 1IGCA 2G4SA 2LXCA 3TCAA 1G6JA 2PE6B 2H88B 2IYDB 4ICUA 1Q5WB 2PE9A 4B6WA 2M1MA 3EFCA 2D10A 3ZRCA 2KDFB 1S1QB 2BB6A 3VRAB 3WALA 3L17A 2JSVX 2ZVNA 1KLVA 1WMHB 1P1AA 1IPGA 3Q6BA 3GZNB 4FJYA 1A5RA 3KQ4A 2MBQA 2WYQA 5D3DA 1V86A 2W82A 1I42A 4YWGG 1ZP0B 5AZHA 3AE8B 1TS4A 3PO0A 5KHQA 1FFUA 2BKFA 3N1YC 1SE9A 4C7ZA 2MBBB 2LVOA 2J52A 3KUCB 1TY2A 2OJRA 1E8ZA 2JYEA 4LLGM 3BK2A 3KUZA 3PSEB 1WJNA 2DZIA 1YD8U 2BTEA 2G1EA 4ZHOA 1FRRA 2DZJA 4E74A 2MW5A 1MJDA 1JWSD 3DBHB 3VUYA 1YX5B 1YX6B 1GB1A 4G0NB 3N9YC 2E6XA 4JLCA 3P4SB 2NVUI 4MM3B 3DHGC 4DDID 4TUUA 3VXWA 4XE0A 1WF9A 3NY5A 1R4MB 1PUTA 4WH4A 1XF5L 3QAQA 2RSUA 3W1YA 2UWQA 3ZLZA 4ANVA 2KX0A 5JXVA 1AN8A 4YTNB 1E5WA 2GOWA 2CU1A 3N30A 5IO9A 3ECIA 3SFEB 1F0ZA 1PFDA 2PMVA 2EMSA 4ASWC 1A70A 3PREA 2ZEQA 2Z0DB 4B95A 1E7UA 2N9EB 3VH3B 4HPLB 1H4RA 3SDLC 3H7SA 3X0WA 5AZFA 4FHJA 1WGGA 4WWMA 2FCQA 4W9HA 2CHWA 3LDZE 1JQ4A 3V05A 2WQYB 4BFRA 5AEKB 4XWTA 2WXIA 4AUQC 1K50A 2MA9B 2I1KA 3MP9A 1TYGB 2GBMA 1E0ZA 1HTQA 3JVZX 1TIFA 5BO4B 2XK5B 3T9LA 2PEAA 4A20A 2G4DB 1JWAD 1V1PB 1P7FA 3EECA 4W9JA 2KK8A 2KLCA 1PQSA 4YT0B 1KJTA 2KMMA 1V81A 4NY0A 5AUIA 1K53A 2MBOA 3N1ZC 1Z5SB 1VCBA 1RWSA 1WJ6A 2W3SA 3LXFA 1CZPA 3QX1A 4RGOS 1UNSA 3NOBA 3B08A 2YVCA 3NJTA 3PV1A 1LO5D 4GDKB 3T3NA 2ON8A 3ZVVA 1E7VA 3VTUA 1MFWA 4NZLB 1YMHE 2M56B 3WAMA 4JE3B 2Z8LA 3CSTA 1E6EB 2KQSA 4DDGD 2N7DA 3ZW3A 1DGJA 2E3TA 1LFDA 2O6VD 2V3SA 2WXJA 4GDLB 5D3IB 1JCKB 3WIMA 3RI7C 4IWQA 4US9A 2FCNA 4BOSC 2V3PA 2N4FA 4HKZE 1SXTA 3DBSA 2CJOA 5J18A 4TMAB 5C2TB 4JIOU 3SD5A 3FC4A 3ZDMC 4HPPA 2AQ1B 1E90A 2JWUA 3BYTB 3MFGA 3T3OA 1M94A 5E6NA 3W1SC 4PS3A 2FBWB 3R7QA 3AE1B 1FPYA 1J7BA 3AEDB 4NJCA 3O65B 1D3ZA 1C78A 4K3BA 1E8WA 4ZYSA 4A9AA 2DENB 4CO7A 2HJ1A 2IY1B 1Q0WB 4FLHA 1SF0A 2IBIB 3H7PB 3CF4A 5HG2A 3N3KB 3AH7A 4MH8A 2BWES 1B9RA 1Y8RC 1V2YA 2JWZA 4ZYNA 4KZ0A 3A1QA 4L23A 1ZDXA 4GGQA 3VTWA 2AL6A 4GLSC 1RFKA 3UGBB 4IWOA 3PT2B 2INDC 1H7XA 3DHIC 1K52A 3P42A 1GB4A 2D5GA 2PTLA 4AOFA 1WWTA 2KACA 2YEPB 3P4RB 2L0FA 2N0SB 3R2TA 2JXTA 1T0YA 3AM9A 1TZOA 3Q14C 3M63B 4X57B 5E6PA 3V62A 3URYA 3JSVA 1WJUA 2NCNA 4WWNA 3L08A 1E10A 3WAPA 3VUWA 4MGYE 3P4QB 3TJPA 3Q8BA 3HRDD 4M00A 4N6EB 1RYJA 2NMQA 3RUIB 1FIQA 4L1BA 4JGHB 2KTRA 3KWLA 5DPRA 1TBEA 2FAZA 1OGWA 2AEHA 2HTME 1BXTA 1UF0A 2ASQA 4ZDVA 1X1MA 2LEKA 5D7GA 1V5OA 3A4SC 1TS5A 2LHDA 1SIFA 4BBNC 1L4ZB 2WX1A 2EELA 1GNUA 1XLPA 3U8ZA 3MC9A 3V61A 2K25A 1LM8B 5HI1A 2EKEC 1T0RC 2UYZB 1ISNA 4KX6B 1EU3A 2UU7A 4JWUC 4ZRIA 4DQOC 3DVGY 1V80A 3UQBA 2Y5CA 3AECB 1HQRD 1R4NB 3QQ8B 4HPMB 3V3XA 4B0MA 4OZBA 1I35A 2RGFA 4W9KA 2M0AA 4LNOA 3IBEA 2N9KA 3B2FA 1UGMA 5LLIA 1FD6A 2NS5A 1GTEA 1L7YA 1UBQA 4NAWB 1BUIC 3NRZA 4KDLB 2AYOB 2WXFA 4IUMB 1VR9A 2L32A 1KTKA 1WYWB 2WXNA 1GTHA 1CMXB 4C7YA 2LASA 3IXSA 3AE7B 4GIVA 4EE2A 1LQBA 1KRHA 4KDIC 2L05A 3AU4A 2IGHA 4NPNA 2V3NA 1OEYJ 4AWJA 3DBRB 1TZ1A 3PLUA 2C7NB 2EMTA 2MQJA 2GRIA 2VRRB 1TY0A 1ENFA 1QT9A 1WSPA 1DOIA 2GBJA 1EWCA 1VLBA 3BVZA 3Q3MC 1RLFA 1TS3A 1NYRA 3AE4B 3L10B 2LRUA 2IGDA 4LJPB 1IYFA 4ZRJA 5E6JA 3D32A 1SSNA 3SR6A 2FNJB 2MLBA 2A5UA 3A9JA 1FNWA 1NYQA 3PHXB 3A9JB 1F2RI 4P16A 3ZJTA 5MPOA 2J53A 1TTNA 3MJWA 3PHWB 5G5HA 2R2QA 1EF1A 4IW0A 4GN1A 2GB1A 5IOIA 2KO3A 2IDYA 3EA6A 1YQ3B 1V97A 4DWFA 1ROEA 5FR6A 2LGYA 1J0GA 3C8YA 2WDVB 2JF5A 3P2BA 1EU4A 1UWMA 2N9LA 4FHKA 2QILA 5HKHA 3GE3C 4KSKC 2KOXA 4RMAA 2LVQA 2ZVOA 1JMLA 3SFDB 3KYCD 2IZVB 2L52A 2JZ3B 4FADA 2I1JA 2CKHB 2O6VB 2LGSA 3PPAA 4MJSA 3AN1A 1HZ6A 2DX5B 2FUHB 4M8NA 1P3QU 4LJOB 4NQKE 1OEYA 2KDIA 2K39A 3H9DA 4JWSC 1WZ3A 3Q3OC 1AWDA 4CQNA 2JQRB 3QCAA 4BKSA 4HVBA 5TR5A 4US8A 1FRDA 3RNBC 2N1WA 3KLSX 2Z0EB 1ZPSA 4EZJA 3KWVA 1WY8A 1ZDVA 5IKCM 2KD0A 4PYUA 2LJ5A 2KJHB 4LCDE 1NVID 2BB5A 1WXQA 2C7MB 4M02A 2L00B 1WMHA 3IVFA 3E56A 3IAM1 3NVYA 3QWZB 4W9CA 2C7HA 2VH2A 1I4PA 1HXYD 2INCC 3EC8A 2C9WB 4HDOA 3RPFC 3GB1A 3AXCA 4FJZA 2VZKB 1JRUA 3GS2A 2DHZA 3V6EB 2XN9C 1F2RC 2Q5WD 2KX3A 4HXDA 3BK1A 1FM0D 3WANA 1UZXB 2Y5BB 4LK0M 3MHSD 2LJIA 4FBJB 2KJRA 4BOZB 1FEHA 1JW9D 4C56C 5D6JB 3UIPB 1FXIA 1YJJA 1F52A 2GBNA 1NDDA 2D07B 1ESFA 3EHVA 2GLSA 1B1ZA 1Q1OA 2R61A 1YN3A 2V4LA
chains in the Genus database with same CATH topology
2Z8LA 1ET6A 1N62A 2W55A 1NI3A 2KN4A 1E6EB 2SAKA 4J3OD 4RFBA 2Y5PA 2N7JA 4ARCA 1DGJA 2K22A 2E3TA 2AX5A 2WXJA 1D5XC 4GDLB 1JCKB 4RH6A 5D3IB 3I57A 1QOGA 5BMHA 4US9A 1C9FA 2RDGA 2WXMA 1L6UA 3VRBB 4N58A 1OQQA 2L83A 5EE3A 1UGJA 2WXOA 4ZOHC 4RGMA 2V3PA 3TEZA 1SE4A 4HKZE 1SXTA 1XLOA 2CJOA 2WLBA 3W2DA 2MJ3A 2QJLA 3Q8CA 4O1NA 5C2TB 4TMAB 3FC4A 2AQ1B 2JWUA 3W5UB 3BYTB 3MFGA 2I38A 3IT4B 4RNAA 3ZYYX 4RCOA 3T3OA 1FNVA 1XLQA 2LGIA 3AV8A 4NAMA 4A8XC 1XXGA 3AE5B 1L6VA 2FBWB 1PGXA 2R61A 1GPXA 3AE1B 5H92C 3TSSA 1J7BA 3AEDB 2BW2A 2WXLA 4NJCA 2JYTA 2WDRB 4WAFA 1C78A 1JROA 3NVWA 2OHFA 1NEKB 1HEZE 2PVOD 4ZYSA 4A9AA 1ZXIA 1IBXA 2I2YA 4RF0A 1IBXB 4XDDA 1SF0A 2IJ0A 3PZ7A 4MT5A 4WURA 1JWBD 1SB3C 3CF4A 2QSDA 5HG2A 1ZE3D 1VDVA 3AH7A 3WCQA 4MH8A 3MC0B 1I4GA 2PLPA 5C3JB 2OEDA 3U52E 1B9RA 4KGTA 1J7CA 2WXGA 4L2YA 5TSSA 4HJGE 4L23A 1ZDXA 3LB8C 2WU5B 1EM7A 1R7SA 2WXPA 4GLSC 1RFKA 1VZ6A 2W54A 4DXFA 1ZUD2 1IGDA 3I9V1 1H7XA 4OZCA 1K52A 2G9HD 3P42A 2W3RA 5HFYA 1JWMD 1EWYC 4AS1A 1ET9A 1V1PA 2INNE 2D5GA 1E9MA 2PTLA 1GB4A 1WWTA 2KACA 3O13A 1T5XD 4TQ0A 2YEPB 3MJ5A 3AE9B 4ZHPA 4AQ7A 3P4RB 3BVMA 2N0SB 3AEBB 2KDMA 3R2TA 1N5XA 1GAQB 1FCCC 2JXTA 3AM9A 3NVZA 3AMZA 1TZOA 3IT6B 4HKQA 1QILA 2J42A 3FAHA 1I4QA 1TKEA 3AEEB 3OWEB 3BYYB 3URYA 3NZ3A 3RFZB 1SE2A 3DWGC 4KGSA 3BVGA 3BIID 1QOBA 3GP7A 1FO4A 4H2AA 2BT6A 1E10A 1STEA 3IAS1 2CJNA 2K9XA 3P4QB 3HVDA 1YN4A 2RMMA 3Q8BA 1DOXA 5BYSA 1MHXA 1QQRA 3HRDD 4KGRA 1D4BA 4P6VF 1BMLC 2DBYA 1L5PA 4N6EB 2GI9A 1RYJA 2NMQA 2JU6X 2WU2B 1CJEA 5LNK1 1XCQL 1FIQA 2TSSA 4L1BA 5EE9A 3VQIA 4A55A 3KWLA 3L4PA 2HDEA 2BS3B 4JX1C 1IUEA 3EUB2 2DLBA 2HTME 4KKIA 1BXTA 1XCTL 3B2GA 4RGNA 1WRIA 3J9CA 1N60A 2DYOA 1N63A 3UI3A 1C79A 4ZRQA 1N61A 5T8IA 2PKOA 2LEKA 5D7GA 1CQVA 4DXGA 2KAJA 3EGRA 4XDCA 5HHDG 1TS5A 3ABVB 1I4RA 2LHDA 1PYWD 5I4DA 4MACA 3ZJVA 1L4ZB 2LMCA 2EELA 2WXQA 4YTMB 2K3UA 5BMIA 3U4EG 1FFVA 5G5GA 3AEAB 1XLPA 4OZAA 1DOYA 5HI1A 3R8BA 3VR9B 5BYRA 4YSYB 4YTPB 3PZ8A 4KX6B 1EU3A 4JWUC 2LHEA 3TEYA 4DQOC 1PDXA 2ZW0A 4Q2JA 2MJDA 2Y5CA 3AECB 1HQRD 3Q8EA 1TJEA 2MJEA 1WYGA 3V3XA 4B0MA 4OZBA 4YSXB 2ZW1A 3H8HA 1AYFA 1QOAA 1KLGD 4ZRPA 5EE1A 1HA5A 2FUG1 1C77A 2M0AA 2PIAA 3ZGZA 3DWMA 1GT8A 2IPKD 2N9KA 3B2FA 1FD6A 1FXAA 1P7EA 3ZJUA 1GTEA 2LUMA 1T6BX 4M0WA 1MHHE 4NAWB 1BUIC 1MI0A 1XLNA 5H8YE 5BYQA 3NRZA 3AE6B 3NUHB 2WXFA 3SEBA 1VR9A 2L32A 1KTKA 1IGCA 1SJED 2WXNA 1GTHA 2BBCA 2NTTA 4WIPA 4HEA1 2H88B 1AW7A 2MH7A 1V1OA 4C7YA 3IXSA 3AE7B 4EE2A 5EE0A 1KRHA 1D5ZC 2IGHA 2WNMA 1QF6A 2V3NA 2PW9A 3R2IA 2JX5A 1FMAD 1DYQA 2BB6A 3B9JA 3VRAB 2GRIA 2DYMA 3Q8FA 1TY0A 1ENFA 2JSVX 1QT9A 1TS2A 1WSPA 2MEKA 5FK9C 1YN5A 1DOIA 1EWCA 3TEWA 1XEEA 1VLBA 2K0PA 3BVZA 3KQ4A 4KKJA 1RM6C 1HZ5A 1TS3A 1NYRA 4JPSA 3AE4B 1OFFA 5D3DA 4A90A 3NS1A 1L0XB 1VRAB 1YNTE 2IGGA 1ACCA 2W82A 2WXHA 3AB5A 4YSZB 1ZP0B 1UUPA 2IGDA 4IDIA 4YWGG 3AE8B 3E9SA 2BYTA 1QKZA 1TS4A 3PO0A 4TSSA 3W5VB 1FFUA 1WGKA 5E6JA 3TEXA 1SSNA 3SR6A 1KFYB 2L1AA 2RDHA 4C7ZA 1FNWA 2J52A 1NYQA 1J7AA 1YQ4B 1TY2A 1V8CA 3FILB 1F2RI 4P16A 5FR3A 3ZJTA 2JYEA 4LLGM 5MPOA 2J53A 3BK2A 5G5HA 1GOZA 2AQ3B 3VR8B 4RF1A 2BTEA 2G1EA 4ZHOA 4OVZA 5BMGA 1FRRA 4B0EA 4OHJA 2GB1A 3HUIA 1PGBA 3ZQ4A 2IDYA 2QIEB 1Q10A 1YQ3B 1V97A 1JWSD 3EA6A 3MHZA 1PGAA 1GB1A 3CWIA 1ROEA 3C8YA 3N9YC 2WDVB 1EU4A 3AEFB 1UWMA 2E6XA 2N9LA 4IKGA 2QILA 3P4SB 4LTUA 1SJHD 5GXGB 1SEBD 3W1SA 1L0YB 3U2SC 4MM3B 4D2KA 4XE0A 1JMLA 3SFDB 5AUKA 1CK1A 1VZ8A 1PUTA 2L52A 2ACZB 2Y3AA 1NENB 2M19A 1D5MC 4WH4A 4PT5A 1XF5L 2KQ4X 2WDQB 4A6QA 5FKAC 2CU3A 3AEGB 5JXVA 1AN8A 4TQ1A 3AN1A 1FCLA 1HZ6A 2WS3B 1L0VB 4YTNB 2LFIA 2QMTA 3Q8AA 4XWWA 3CIRB 4R3DA 3P63A 4ARIA 1I4XA 1FNUA 1C4CA 2K5PA 2KWDA 3SFEB 3P1MA 1F0ZA 1PFDA 2PMVA 1C4PA 4JWSC 1A70A 1I7HA 2DWQA 1TKYA 4FXCA 1ZXHA 4USAA 1AWDA 4HROA 4CQNA 1UWXA 1Y56A 2JQRB 3P4PB 3BWUD 2RPVA 4IOIE 1TKGA 4US8A 1FRDA 2JZPA 4C80A 1H7WA 2NTSA 2QEJC 3W9CB 3KLSX 1ZPSA 1K51A 3KWVA 1MVKA 2EKIA 1KF6B 2H89B 1T3QA 4WWMA 1QOFA 1D6EC 1ZDVA 2V4IB 1XO3A 2X38A 1JQ4A 1C4AA 3V05A 2WQYB 3AE3B 2WXKA 4XWTA 4YXDB 2WXIA 2INPE 1JALA 2VZKD 1F77A 1JWUD 1M4VA 3LYYA 1YJIA 1K50A 1NVID 2BB5A 1WXQA 3MP9A 1TYGB 2BS4B 1E0ZA 2XNAC 4REZA 3E56A 3ETRA 3IAM1 3NVYA 1SBBB 1I4PA 1C76A 1HXYD 3NVVA 1E7PB 3RPFC 4OW0A 2YEPF 4HRSA 3GB1A 1ZOYB 2VZKB 1SIJA 1KLUD 3GS2A 2AQ2B 1JWAD 1V1PB 2XN9C 1F2RC 1OQRA 1P7FA 2Q5WD 2V0GA 1VJKA 3BK1A 4RGTA 1FM0D 2WXRA 4YT0B 2KMMA 1QLBB 1I4HA 5AUIA 1K53A 2ICIA 2BS2B 1RWSA 4LK0M 3U7ZA 3FILA 2LJIA 2W3SA 2B76B 1L4DB 3BZDB 4UDUC 1MPEA 1FEHA 1CZPA 1JW9D 3LXFA 1UNSA 4RGOS 1KH0A 2WP9B 1FXIA 4C56C 1SE3A 3AE2B 1YJJA 3HVZA 1N5WA 3Q69A 3TUOA 1LO5D 2SEBD 4GDKB 2FE8A 3T3NA 4WQMA 2ON8A 1ESFA 2PVGC 4N59A 1VZ7A 4ITKA 2ONQA 1B1ZA 4NZLB 1YMHE 1JRPA 2M56B 2J4XA 4JE3B 1YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  3AM9 A;  2W55 A;  1N62 A;  1XLN A;  1NI3 A;  2CU3 A;  1E6E B;  3AE6 B;  3AMZ A;  3NRZ A;  3NVZ A;  3AEG B;  5H8Y E;  3FAH A;  1TKE A;  3AEE B;  3AN1 A;  2WS3 B;  1DGJ A;  1L0V B;  2K22 A;  1GTH A;  4YTN B;  2E3T A;  2AX5 A;  2H88 B;  2MH7 A;  3CIR B;  1QOG A;  4US9 A;  3P63 A;  4C7Y A;  3DWG C;  3AE7 B;  2K5P A;  1L6U A;  3SFE B;  3VRB B;  1QOB A;  1KRH A;  1OQQ A;  1PFD A;  2L83 A;  3BII D;  4N58 A;  4ZOH C;  5EE3 A;  1FO4 A;  2BT6 A;  4JWS C;  1QF6 A;  1A70 A;  1I7H A;  1E10 A;  1XLO A;  1JRP A;  1TKY A;  2DWQ A;  4FXC A;  1AWD A;  2CJO A;  2CJN A;  2K9X A;  2WLB A;  4HRO A;  2JX5 A;  4USA A;  2MJ3 A;  1FMA D;  3P4Q B;  3P1M A;  2QJL A;  2JQR B;  5C2T B;  3B9J A;  3P4P B;  3VRA B;  1DOX A;  3HRD D;  1TKG A;  3FC4 A;  4P6V F;  1QT9 A;  2DBY A;  1L5P A;  4US8 A;  4N6E B;  1DOI A;  1FRD A;  3W5U B;  4C80 A;  1H7W A;  1RYJ A;  3W9C B;  1VLB A;  2WU2 B;  1CJE A;  5EE0 A;  3ZYY X;  1FIQ A;  5EE9 A;  1XLQ A;  3AV8 A;  2EKI A;  1KF6 B;  2H89 B;  1RM6 C;  1T3Q A;  3KWL A;  1QOF A;  3L4P A;  1NYR A;  4WWM A;  3AE4 B;  1OFF A;  2BS3 B;  1XO3 A;  3NS1 A;  3AE5 B;  1IUE A;  2FBW B;  1L6V A;  3EUB 2;  4JX1 C;  1JQ4 A;  1GPX A;  2WQY B;  3AE1 B;  3AE3 B;  5H92 C;  2HTM E;  3AB5 A;  4YSZ B;  1ZP0 B;  4YXD B;  3B2G A;  4IDI A;  1J7B A;  1JAL A;  3AED B;  3AE8 B;  1N5X A;  1WRI A;  1N60 A;  1YJI A;  1N63 A;  2WDR B;  1NVI D;  3PO0 A;  1JRO A;  1WXQ A;  3W5V B;  3NVW A;  2OHF A;  1FFU A;  1TYG B;  1NEK B;  1WGK A;  2PVO D;  2BS4 B;  1N61 A;  1E0Z A;  4A9A A;  3SR6 A;  1ZXI A;  2PKO A;  1KFY B;  2LEK A;  3ETR A;  3NVY A;  4C7Z A;  1NYQ A;  1J7A A;  1YQ4 B;  1V8C A;  3NVV A;  1E7P B;  1SF0 A;  2KAJ A;  3RPF C;  5MPO A;  4HRS A;  1JWB D;  3ABV B;  3CF4 A;  1ZOY B;  1SB3 C;  5G5H A;  3VR8 B;  1SIJ A;  1VDV A;  2G1E A;  3AH7 A;  3WCQ A;  4ZHO A;  1JWA D;  4YTM B;  1FRR A;  5C3J B;  1OQR A;  1B9R A;  1FFV A;  2Q5W D;  3HUI A;  5G5G A;  1VJK A;  3AEA B;  1J7C A;  2QIE B;  1FM0 D;  1XLP A;  1YQ3 B;  1V97 A;  4YT0 B;  1DOY A;  2KMM A;  3LB8 C;  2WU5 B;  1QLB B;  1R7S A;  5AUI A;  3VR9 B;  3CWI A;  1ROE A;  4YSY B;  4YTP B;  1RFK A;  2BS2 B;  4KX6 B;  1RWS A;  2WDV B;  3AEF B;  1UWM A;  4JWU C;  2W3S A;  2B76 B;  2M56 B;  3P4S B;  2W54 A;  4LTU A;  1ZUD 2;  1PDX A;  3LXF A;  1H7X A;  1CZP A;  1JW9 D;  2MJD A;  5GXG B;  2Y5C A;  2WP9 B;  1FXI A;  3AEC B;  3AE2 B;  1YJJ A;  1TJE A;  2MJE A;  1WYG A;  1N5W A;  2W3R A;  3HVZ A;  1EWY C;  4YSX B;  1E9M A;  3SFD B;  1AYF A;  5AUK A;  1WWT A;  1QOA A;  4WQM A;  1PUT A;  5EE1 A;  2PVG C;  2L52 A;  2ACZ B;  2PIA A;  4N59 A;  3DWM A;  1GT8 A;  1NEN B;  3AE9 B;  2M19 A;  4ZHP A;  3P4R B;  4ITK A;  3B2F A;  1F0Z A;  2N0S B;  3AEB B;  1FXA A;  1GTE A;  1GAQ B; 
#chains in the Genus database with same CATH topology
 1LXD A;  2KN4 A;  2Y5P A;  4ARC A;  4MEL A;  2K22 A;  1D5X C;  3PRM B;  3I57 A;  1QOG A;  4MM3 A;  2RDG A;  2WXM A;  4F7Z A;  2L83 A;  5EE3 A;  2WXO A;  4RGM A;  1SE4 A;  1WZ0 A;  4WAA A;  1WX9 A;  2KHW B;  4EEW A;  2BGF A;  4K1R B;  1WI0 A;  4MGZ E;  3GE8 C;  4HJK A;  3DQV A;  3ZYY X;  1OTR B;  4RCO A;  1FNV A;  3AV8 A;  4A8X C;  2GBK A;  1XXG A;  1L6V A;  1PGX A;  5GMV A;  1GPX A;  2KVR A;  3TSS A;  3FKY A;  2NR2 A;  2JYT A;  1YOV B;  4XYC A;  2OHF A;  3QA8 A;  1WX8 A;  1EF5 A;  1IBX A;  2ZCC A;  2I2Y A;  2BYF A;  4J6I A;  1IBX B;  4XDD A;  2J7Q B;  4E71 A;  3SU8 X;  3KW5 B;  3ONS A;  2QSD A;  3HIZ A;  4DHZ E;  3Q3N C;  3K9O B;  1VDV A;  2M8S A;  3WCQ A;  4WJN A;  1I4G A;  2OED A;  2KC2 A;  2BYV E;  4L2Y A;  4HJG E;  3LB8 C;  2WU5 B;  4DK5 A;  3KVF B;  1UEL A;  4I6L B;  2W9N A;  1VZ6 A;  4DXF A;  4K7U A;  1ZUD 2;  1IGD A;  3I9V 1;  2XK5 A;  4OZC A;  4BAX A;  2G9H D;  2KTF A;  5HFY A;  1JWM D;  1V1P A;  1E9M A;  1T5X D;  2WDT B;  4TQ0 A;  4DHZ B;  3BVM A;  2N9X A;  3AEB B;  1WXV A;  1WGR A;  1N5X A;  4TV3 A;  5LXI B;  3ZNG C;  4OVV A;  1RAX A;  2V1Y A;  2BWF A;  4II2 B;  4HKQ A;  2J42 A;  3VAW A;  3DOW A;  4A3P A;  1I4Q A;  2MRP A;  3JYU A;  3OWE B;  4BZA A;  3ZUN A;  3AU5 A;  3WA0 A;  4FUL A;  2LZ6 A;  1QOB A;  4KVG B;  4GDK A;  1FO4 A;  4H2A A;  5CTR C;  2KNB A;  2IY0 B;  3IAS 1;  2L8J A;  5BYS A;  1QQR A;  4MSQ B;  2DBY A;  2GI9 A;  3N32 A;  2JU6 X;  4GDL A;  1CJE A;  5LNK 1;  2WGS A;  5CHW A;  3R7R A;  3L4P A;  1WIA A;  4RM8 A;  2BS3 B;  2X8X X;  5AZG A;  3EUB 2;  3NZS A;  3OJ3 A;  4KKI A;  2ZPN A;  3B2G A;  3C0R B;  3J9C A;  1N60 A;  3AUL A;  1N61 A;  4HDQ A;  5DPT A;  3RNF C;  3RD2 A;  1GC6 A;  2K6D B;  2KAJ A;  1SGH A;  5HHD G;  3ABV B;  1I4R A;  5I4D A;  3ZJV A;  4IWP A;  3DCG A;  2WXQ A;  4WJQ A;  4G3X B;  3DVN U;  3BY4 B;  1S3S G;  4LNF A;  2HE7 A;  5D2M B;  3B1L X;  1UD7 A;  1PDX A;  1P0R A;  2ZW0 A;  3H7P A;  3OJ4 B;  1GG3 A;  4BKS D;  4ANU A;  3MC8 A;  3UQA A;  1TJE A;  1WYG A;  3RNC C;  1GJZ A;  2RDB C;  3EFU A;  1QOA A;  4NQL B;  1KLG D;  2ZNV C;  1E8X A;  3ZGZ A;  2PIA A;  3DWM A;  3ENE A;  3DHH C;  5JHA A;  3ZJU A;  2LUM A;  5H8Y E;  1ZKH A;  3V6C B;  4YL8 A;  2GBR A;  1KM7 A;  2NTT A;  1AW7 A;  2MH7 A;  2QC8 A;  2N9P C;  3QJZ A;  2KDE B;  5J2R A;  3R3M A;  5E6O A;  5IAA C;  2WNM A;  4JL9 A;  2HTH A;  2PW9 A;  4JQW C;  3R2I A;  1FMA D;  1DYQ A;  5EDS A;  4ACF A;  2JRH A;  2DYM A;  3Q8F A;  1V49 A;  2MEK A;  2ZZP B;  1YN5 A;  1C1Y B;  1WXS A;  3TEW A;  2R2O A;  5JH5 C;  3UIO B;  4LNI A;  3A4R A;  2NPT B;  1HZ5 A;  3ZNI D;  5CHV C;  4JPS A;  1OFF A;  4DXA B;  4A90 A;  1N6Z A;  3NS1 A;  3S2A A;  3A9K B;  2KT7 A;  1UUP A;  1QKZ A;  3IHP C;  3TEX A;  1KFY B;  2JT4 B;  2L1A A;  2MSE D;  5JHB A;  4K3C A;  3B0A A;  1C3T A;  1YQ4 B;  1V8C A;  3FIL B;  5FR3 A;  2RPQ A;  3L54 A;  4IC7 B;  3ZTC A;  4B9K A;  3ZKJ C;  4IM2 A;  1GOZ A;  2AQ3 B;  1U4A A;  2KMC A;  3VR8 B;  4ICV A;  2JRI B;  2KMA A;  4OVZ A;  4B0E A;  3H1U A;  2JVC A;  4NJ6 A;  3ZQ4 A;  3MHZ A;  5DPS A;  2MWS B;  1PGA A;  1NBF C;  4FJV B;  3APF A;  1J8C A;  3AEF B;  3PVL A;  4IKG A;  1WXM A;  1SJH D;  1WR6 E;  5G2N A;  3U2S C;  2N7E A;  1P98 A;  3VH4 B;  4D2K A;  5AUK A;  3OAW A;  1KOT A;  3VVW B;  2ACZ B;  2Y3A A;  1D5M C;  4P1C C;  5C23 A;  4PT5 A;  4E3C A;  4W9I A;  2JZZ A;  2KQ4 X;  2KFJ A;  2D2Q A;  4A6Q A;  5FKA C;  2CU3 A;  4TQ1 A;  1FCL A;  2QMT A;  4XWW A;  3CIR B;  3P63 A;  3N1X C;  1I4X A;  4HCP B;  3P1M A;  2K5P A;  2KWD A;  4GSW A;  2BKR B;  1C4P A;  1I7H A;  2L3Z A;  1TKY A;  1ZXH A;  4USA A;  4XX5 A;  2REX A;  3BWU D;  2RPV A;  4NAW A;  4IOI E;  2XBB C;  2JZP A;  3JW0 X;  4C80 A;  3RNG C;  1K51 A;  3CF6 E;  3IG3 A;  4KZC A;  2H89 B;  2VH1 A;  4GMV A;  4KIK A;  2X38 A;  1C4A A;  1NI2 A;  1TT5 B;  3AE3 B;  2WXK A;  3A33 B;  4MGK E;  4KIK B;  2DZM A;  2CHZ A;  2INP E;  1JAL A;  4NNJ B;  1F77 A;  3GOE A;  4GXB A;  3M95 A;  2BS4 B;  2XNA C;  3ETR A;  4OVU A;  3U30 A;  1AAR A;  2L0T A;  4HRS A;  2QDF A;  3I5J C;  1SIJ A;  4HLE A;  1KLU D;  2AQ2 B;  3DPD A;  3NG0 A;  2DAF A;  2V0G A;  5L95 C;  1VJK A;  4LNK A;  1YQB A;  2FID A;  1I4H A;  2ICI A;  2BS2 B;  3U7Z A;  2B76 B;  1L4D B;  3BZD B;  4UDU C;  2WP9 B;  1SE3 A;  3HVZ A;  3L16 A;  2N1V A;  3Q69 A;  3TUO A;  2SEB D;  2FE8 A;  3ZDT A;  2PVG C;  4N59 A;  1QZE A;  1F9J A;  2O2V B;  3RNA C;  3GZN I;  4R3D A;  4ZRK A;  4RFB A;  4J3O D;  4KSL C;  2N7J A;  3ZXR A;  4URK A;  5BMH A;  4RH6 A;  2KYW A;  4MEM A;  1C9F A;  3VRB B;  4N58 A;  1OQQ A;  3TEZ A;  2MBH A;  1Z2M A;  2QJL A;  5J17 A;  2O6V A;  3QIJ A;  3Q8C A;  3U7D A;  3ML9 A;  2Z59 B;  2KLG A;  3W5U B;  2I38 A;  4RNA A;  3C19 A;  1XLQ A;  4NAM A;  3DDC B;  2L7R A;  2BPS A;  3TIX A;  3DBH I;  1MG8 A;  3UIN B;  2WDR B;  2A4Z A;  4C4V B;  1JRO A;  2PVO D;  1V5T A;  4RF0 A;  2JUO A;  3PRZ A;  1R4M I;  4WUR A;  1JWB D;  4M8M A;  4BVU C;  1MG4 A;  2PLP A;  3U52 E;  5LXH A;  4KGT A;  2PPH A;  3VUX A;  1J7C A;  3DVN V;  1BT0 A;  1R7S A;  4DHJ D;  4AJY B;  3NS8 A;  3QHT A;  3RUL A;  2W54 A;  2D3G A;  2MBE A;  4AS1 A;  2INN E;  3O13 A;  1EUV B;  3M3J A;  1EO6 A;  4ZHP A;  5DCN A;  2MP2 A;  4GOC A;  2FCS A;  2DYB A;  2MP2 B;  3NVZ A;  3AMZ A;  3IT6 B;  1QIL A;  1T0S C;  3FAH A;  1WH3 A;  2BYE A;  2HJ8 A;  3BYY B;  3CSF A;  3PLV A;  1H8C A;  1ZGU B;  1SE2 A;  3DWG C;  4KGS A;  3BVG A;  2G45 B;  3BII D;  2BT6 A;  5JZE B;  2J0J A;  1GC7 A;  1WFY A;  3RMK C;  1YN4 A;  3H6N A;  1DOX A;  1MHX A;  1BML C;  3DBL B;  1HE8 A;  4KV2 A;  3ZRF A;  2WU2 B;  4XZ4 A;  1XCQ L;  2TSS A;  2LD9 A;  2WX0 A;  2HDE A;  4JX1 C;  1IUE A;  2FCM A;  2JPH A;  2DLB A;  3MTN B;  1XCT L;  4RGN A;  2IO0 B;  2DYO A;  1N63 A;  3KUD B;  3UI3 A;  1WE6 A;  4N9F 4;  1LGR A;  1CQV A;  1WGY A;  4DXG A;  4LNN A;  4XDC A;  2B3A A;  4MAC A;  1K8R B;  2LMC A;  4YTM B;  2K3U A;  5BMI A;  1XQQ A;  3AEA B;  3WAO A;  4MSM B;  4OZA A;  1DOY A;  1V9J A;  5BYR A;  3PZ8 A;  2DAJ A;  4IM3 A;  4ANX A;  2LHE A;  1ZW7 A;  4Q2J A;  4RM9 A;  2MJD A;  4K81 A;  3Q8E A;  2LGX A;  1YIW A;  4YSX B;  3HM3 A;  4ZRP A;  2NBV B;  4A3O A;  2IPK D;  3ZIM A;  1FXA A;  4LDT D;  3QK0 A;  2DNF A;  4M0W A;  4HCN B;  2JY6 A;  4II3 B;  3AE6 B;  4M0W B;  3NUH B;  4AJW A;  2J0K A;  3LJ3 A;  1SJE D;  2ZJD A;  2BBC A;  4WIP A;  4HEA 1;  2K1F A;  1V1O A;  2OJW A;  5EE0 A;  3VDZ A;  2M4N A;  1D5Z C;  1QF6 A;  2JX5 A;  3RYT A;  4QAY A;  3B9J A;  1UBI A;  1WE7 A;  5FK9 C;  1TS2 A;  4XC2 A;  4IG7 B;  1XEE A;  2ZCB A;  2K0P A;  3PZD A;  4EZL A;  4KKJ A;  1RM6 C;  2J0M A;  1L0X B;  1VRA B;  1YNT E;  2IGG A;  2QHO A;  1V6E A;  4IM0 A;  1ACC A;  2WXH A;  3AB5 A;  4YSZ B;  4IDI A;  3E9S A;  2BYT A;  2CR5 A;  2C5L C;  2KJ6 A;  4TSS A;  3W5V B;  1WGK A;  4WWO A;  2BF8 B;  4WWP A;  2RDH A;  3HK0 A;  1J7A A;  4S0R A;  2FIF A;  4RF1 A;  2LGD A;  2NBU A;  5BMG A;  4OHJ A;  3HUI A;  1PGB A;  2KDB A;  2QIE B;  2NBW B;  1Q10 A;  3CWI A;  3Q3J A;  4LTU A;  5GXG B;  3ML8 A;  1SEB D;  3W1S A;  1L0Y B;  2D3C A;  3Q2A C;  1CK1 A;  1VZ8 A;  1RRB A;  1NEN B;  2M19 A;  4EKU A;  2IO2 B;  1J19 A;  3RNE C;  2M0X A;  2WDQ B;  3AEG B;  5IN7 A;  2WS3 B;  1L0V B;  4GU2 A;  2LFI A;  4TKN A;  3Q8A A;  3T8M A;  4ARI A;  1FNU A;  1C4C A;  2KVZ A;  4BKG A;  2ZNV B;  2DWQ A;  4FXC A;  4HRO A;  4K7S A;  1UWX A;  1YJ1 A;  3UF8 A;  1L2N A;  1Y56 A;  3I63 C;  3P4P B;  1TKG A;  2WHI A;  3RN9 C;  5G55 A;  3X23 A;  3ZNZ B;  1H7W A;  2NTS A;  2QEJ C;  3W9C B;  3L0W B;  1T0Q C;  2KKC A;  3ALB A;  3I3T B;  1MVK A;  2EKI A;  1KF6 B;  1T3Q A;  1QOF A;  1D6E C;  2V4I B;  4WJO A;  1XO3 A;  3KH0 A;  2HD5 B;  3K9P B;  3CMM B;  4ANW A;  4YXD B;  2VZK D;  5L83 A;  2D3A A;  1JWU D;  1M4V A;  3LYY A;  1WGD A;  1YJI A;  3A1Q B;  3ZXV A;  2V9H A;  1R4N I;  4REZ A;  2KXJ A;  1SBB B;  1C76 A;  4I6N B;  5IA7 A;  2NPT A;  3NVV A;  1F1H A;  1E7P B;  4OW0 A;  2YEP F;  1WRD B;  2LXA A;  1ZOY B;  1OQY A;  3AI5 A;  4CYE A;  4W9E A;  2RD0 A;  3A9K A;  4DHJ B;  3VTV A;  1OQR A;  2OOB B;  3RT3 B;  4WQO B;  4RGT A;  2BQQ A;  3SHQ A;  2WXR A;  1QLB B;  1XT9 B;  3FIL A;  1MPE A;  2WWZ A;  1IP9 A;  1KH0 A;  3AE2 B;  3DBR I;  1N5W A;  2MX2 A;  1E8Y A;  3JSV B;  3ZO5 B;  4WQM A;  4EZK A;  1VZ7 A;  4F1S A;  3Q3F A;  4ITK A;  2ONQ A;  4MDK E;  1JRP A;  2J4X A;  4EFO A;  3PGE A;  3TBL D;  4FA6 A;  1ET6 A;  1N62 A;  2W55 A;  1NI3 A;  2SAK A;  3DVG X;  5D94 A;  4PS8 A;  3N20 C;  3IFW B;  3PRP B;  2AX5 A;  1RFA A;  4S17 A;  4G50 A;  2KTR B;  1L6U A;  1UGJ A;  4ZOH C;  4HWI B;  1XLO A;  2WLB A;  3W2D A;  3OG5 A;  2KZR A;  2MJ3 A;  3TMP B;  2DZK A;  3OLM D;  4GB9 A;  4O1N A;  1XD3 B;  4BBN F;  5CHF A;  4XGA B;  4C00 A;  3IT4 B;  3QC8 B;  2LGI A;  2L76 A;  2RR9 A;  3L13 A;  3AE5 B;  3APC A;  3APD A;  3NZU A;  1WR1 A;  4EOY A;  4MH0 E;  5H92 C;  2K8H A;  2BW2 A;  2WXL A;  1GUA B;  2BVC A;  4WAF A;  2MCN B;  3NVW A;  1NEK B;  1HEZ E;  4W9F A;  1ZXI A;  2IJ0 A;  3M62 B;  3PZ7 A;  4MT5 A;  4MGI E;  4NJ7 A;  1SB3 C;  3V60 A;  2LI5 A;  4WJP A;  1ZE3 D;  2GMI C;  3MC0 B;  5C3J B;  4G11 A;  5IP4 D;  2WXG A;  3HM6 X;  5TSS A;  3PS6 A;  1EM7 A;  4PS7 A;  3VHT C;  2WXP A;  2XEW A;  3R66 C;  2D3B A;  2KAN A;  2IO1 B;  1WM3 A;  5CX3 A;  2KWV B;  2W3R A;  1EWY C;  1UH6 A;  2LWP A;  1ET9 A;  4LDT B;  4I6P A;  4EUT A;  2C60 A;  3MJ5 A;  3QAR A;  2KWC A;  3AE9 B;  4AQ7 A;  2KDM A;  1GAQ B;  1FCC C;  3HHM A;  3KYD D;  2CS4 A;  2KC1 A;  4P1B C;  2CHX A;  3TL5 A;  1TKE A;  3AEE B;  2AWT A;  2K8C A;  3RZF A;  3RZW C;  3NHE B;  3NZ3 A;  3RFZ B;  2KWU B;  1WX7 A;  4BKT A;  3GP7 A;  4PYZ A;  3VFK A;  2AL3 A;  1STE A;  2CJN A;  2K9X A;  3PTF C;  2JXX A;  2O2V A;  1WM2 A;  3HVD A;  4AP4 C;  2RMM A;  4P7I A;  4KGR A;  1D4B A;  4P6V F;  4F8C B;  1L5P A;  2LVP A;  5DPW A;  2LUE A;  4A55 A;  5EE9 A;  3VQI A;  2ZPY A;  1WXA A;  1TGZ B;  4W9D A;  2M17 A;  2G3Q B;  1WRI A;  1C79 A;  4ZRQ A;  5T8I A;  2PKO A;  2YLM A;  4K7W A;  1HTO A;  3EGR A;  3ZTD A;  1PYW D;  2MHJ A;  3BIN A;  4PK1 A;  3ZNH B;  3U4E G;  1FFV A;  3DBL I;  5G5G A;  1VD2 A;  4C4V A;  2LRW A;  2KQ7 A;  1P9D U;  5C1Z A;  3R8B A;  3VR9 B;  2D11 A;  1WJ4 A;  4W9L A;  4YSY B;  4YTP B;  2K8B A;  5KHO A;  4MJS B;  3TEY A;  2MJE A;  2KN5 A;  4DBG A;  2QCZ A;  2ZW1 A;  3H8H A;  1AYF A;  3RCZ A;  2K6Q A;  4HK2 A;  5EE1 A;  1HA5 A;  2FUG 1;  1C77 A;  1GT8 A;  4CHK A;  2KFK A;  1P7E A;  4W9G A;  2IO3 B;  1T6B X;  1MHH E;  2KFK B;  1MI0 A;  1WGH A;  1XLN A;  2PJH A;  5BYQ A;  1FXT B;  4M01 A;  3SEB A;  4FN2 A;  1IGC A;  2G4S A;  2LXC A;  3TCA A;  1G6J A;  2PE6 B;  2H88 B;  2IYD B;  4ICU A;  1Q5W B;  2PE9 A;  4B6W A;  2M1M A;  3EFC A;  2D10 A;  3ZRC A;  2KDF B;  1S1Q B;  2BB6 A;  3VRA B;  3WAL A;  3L17 A;  2JSV X;  2ZVN A;  1KLV A;  1WMH B;  1P1A A;  1IPG A;  3Q6B A;  3GZN B;  4FJY A;  1A5R A;  3KQ4 A;  2MBQ A;  2WYQ A;  5D3D A;  1V86 A;  2W82 A;  1I42 A;  4YWG G;  1ZP0 B;  5AZH A;  3AE8 B;  1TS4 A;  3PO0 A;  5KHQ A;  1FFU A;  2BKF A;  3N1Y C;  1SE9 A;  4C7Z A;  2MBB B;  2LVO A;  2J52 A;  3KUC B;  1TY2 A;  2OJR A;  1E8Z A;  2JYE A;  4LLG M;  3BK2 A;  3KUZ A;  3PSE B;  1WJN A;  2DZI A;  1YD8 U;  2BTE A;  2G1E A;  4ZHO A;  1FRR A;  2DZJ A;  4E74 A;  2MW5 A;  1MJD A;  1JWS D;  3DBH B;  3VUY A;  1YX5 B;  1YX6 B;  1GB1 A;  4G0N B;  3N9Y C;  2E6X A;  4JLC A;  3P4S B;  2NVU I;  4MM3 B;  3DHG C;  4DDI D;  4TUU A;  3VXW A;  4XE0 A;  1WF9 A;  3NY5 A;  1R4M B;  1PUT A;  4WH4 A;  1XF5 L;  3QAQ A;  2RSU A;  3W1Y A;  2UWQ A;  3ZLZ A;  4ANV A;  2KX0 A;  5JXV A;  1AN8 A;  4YTN B;  1E5W A;  2GOW A;  2CU1 A;  3N30 A;  5IO9 A;  3ECI A;  3SFE B;  1F0Z A;  1PFD A;  2PMV A;  2EMS A;  4ASW C;  1A70 A;  3PRE A;  2ZEQ A;  2Z0D B;  4B95 A;  1E7U A;  2N9E B;  3VH3 B;  4HPL B;  1H4R A;  3SDL C;  3H7S A;  3X0W A;  5AZF A;  4FHJ A;  1WGG A;  4WWM A;  2FCQ A;  4W9H A;  2CHW A;  3LDZ E;  1JQ4 A;  3V05 A;  2WQY B;  4BFR A;  5AEK B;  4XWT A;  2WXI A;  4AUQ C;  1K50 A;  2MA9 B;  2I1K A;  3MP9 A;  1TYG B;  2GBM A;  1E0Z A;  1HTQ A;  3JVZ X;  1TIF A;  5BO4 B;  2XK5 B;  3T9L A;  2PEA A;  4A20 A;  2G4D B;  1JWA D;  1V1P B;  1P7F A;  3EEC A;  4W9J A;  2KK8 A;  2KLC A;  1PQS A;  4YT0 B;  1KJT A;  2KMM A;  1V81 A;  4NY0 A;  5AUI A;  1K53 A;  2MBO A;  3N1Z C;  1Z5S B;  1VCB A;  1RWS A;  1WJ6 A;  2W3S A;  3LXF A;  1CZP A;  3QX1 A;  4RGO S;  1UNS A;  3NOB A;  3B08 A;  2YVC A;  3NJT A;  3PV1 A;  1LO5 D;  4GDK B;  3T3N A;  2ON8 A;  3ZVV A;  1E7V A;  3VTU A;  1MFW A;  4NZL B;  1YMH E;  2M56 B;  3WAM A;  4JE3 B;  2Z8L A;  3CST A;  1E6E B;  2KQS A;  4DDG D;  2N7D A;  3ZW3 A;  1DGJ A;  2E3T A;  1LFD A;  2O6V D;  2V3S A;  2WXJ A;  4GDL B;  5D3I B;  1JCK B;  3WIM A;  3RI7 C;  4IWQ A;  4US9 A;  2FCN A;  4BOS C;  2V3P A;  2N4F A;  4HKZ E;  1SXT A;  3DBS A;  2CJO A;  5J18 A;  4TMA B;  5C2T B;  4JIO U;  3SD5 A;  3FC4 A;  3ZDM C;  4HPP A;  2AQ1 B;  1E90 A;  2JWU A;  3BYT B;  3MFG A;  3T3O A;  1M94 A;  5E6N A;  3W1S C;  4PS3 A;  2FBW B;  3R7Q A;  3AE1 B;  1FPY A;  1J7B A;  3AED B;  4NJC A;  3O65 B;  1D3Z A;  1C78 A;  4K3B A;  1E8W A;  4ZYS A;  4A9A A;  2DEN B;  4CO7 A;  2HJ1 A;  2IY1 B;  1Q0W B;  4FLH A;  1SF0 A;  2IBI B;  3H7P B;  3CF4 A;  5HG2 A;  3N3K B;  3AH7 A;  4MH8 A;  2BWE S;  1B9R A;  1Y8R C;  1V2Y A;  2JWZ A;  4ZYN A;  4KZ0 A;  3A1Q A;  4L23 A;  1ZDX A;  4GGQ A;  3VTW A;  2AL6 A;  4GLS C;  1RFK A;  3UGB B;  4IWO A;  3PT2 B;  2IND C;  1H7X A;  3DHI C;  1K52 A;  3P42 A;  1GB4 A;  2D5G A;  2PTL A;  4AOF A;  1WWT A;  2KAC A;  2YEP B;  3P4R B;  2L0F A;  2N0S B;  3R2T A;  2JXT A;  1T0Y A;  3AM9 A;  1TZO A;  3Q14 C;  3M63 B;  4X57 B;  5E6P A;  3V62 A;  3URY A;  3JSV A;  1WJU A;  2NCN A;  4WWN A;  3L08 A;  1E10 A;  3WAP A;  3VUW A;  4MGY E;  3P4Q B;  3TJP A;  3Q8B A;  3HRD D;  4M00 A;  4N6E B;  1RYJ A;  2NMQ A;  3RUI B;  1FIQ A;  4L1B A;  4JGH B;  2KTR A;  3KWL A;  5DPR A;  1TBE A;  2FAZ A;  1OGW A;  2AEH A;  2HTM E;  1BXT A;  1UF0 A;  2ASQ A;  4ZDV A;  1X1M A;  2LEK A;  5D7G A;  1V5O A;  3A4S C;  1TS5 A;  2LHD A;  1SIF A;  4BBN C;  1L4Z B;  2WX1 A;  2EEL A;  1GNU A;  1XLP A;  3U8Z A;  3MC9 A;  3V61 A;  2K25 A;  1LM8 B;  5HI1 A;  2EKE C;  1T0R C;  2UYZ B;  1ISN A;  4KX6 B;  1EU3 A;  2UU7 A;  4JWU C;  4ZRI A;  4DQO C;  3DVG Y;  1V80 A;  3UQB A;  2Y5C A;  3AEC B;  1HQR D;  1R4N B;  3QQ8 B;  4HPM B;  3V3X A;  4B0M A;  4OZB A;  1I35 A;  2RGF A;  4W9K A;  2M0A A;  4LNO A;  3IBE A;  2N9K A;  3B2F A;  1UGM A;  5LLI A;  1FD6 A;  2NS5 A;  1GTE A;  1L7Y A;  1UBQ A;  4NAW B;  1BUI C;  3NRZ A;  4KDL B;  2AYO B;  2WXF A;  4IUM B;  1VR9 A;  2L32 A;  1KTK A;  1WYW B;  2WXN A;  1GTH A;  1CMX B;  4C7Y A;  2LAS A;  3IXS A;  3AE7 B;  4GIV A;  4EE2 A;  1LQB A;  1KRH A;  4KDI C;  2L05 A;  3AU4 A;  2IGH A;  4NPN A;  2V3N A;  1OEY J;  4AWJ A;  3DBR B;  1TZ1 A;  3PLU A;  2C7N B;  2EMT A;  2MQJ A;  2GRI A;  2VRR B;  1TY0 A;  1ENF A;  1QT9 A;  1WSP A;  1DOI A;  2GBJ A;  1EWC A;  1VLB A;  3BVZ A;  3Q3M C;  1RLF A;  1TS3 A;  1NYR A;  3AE4 B;  3L10 B;  2LRU A;  2IGD A;  4LJP B;  1IYF A;  4ZRJ A;  5E6J A;  3D32 A;  1SSN A;  3SR6 A;  2FNJ B;  2MLB A;  2A5U A;  3A9J A;  1FNW A;  1NYQ A;  3PHX B;  3A9J B;  1F2R I;  4P16 A;  3ZJT A;  5MPO A;  2J53 A;  1TTN A;  3MJW A;  3PHW B;  5G5H A;  2R2Q A;  1EF1 A;  4IW0 A;  4GN1 A;  2GB1 A;  5IOI A;  2KO3 A;  2IDY A;  3EA6 A;  1YQ3 B;  1V97 A;  4DWF A;  1ROE A;  5FR6 A;  2LGY A;  1J0G A;  3C8Y A;  2WDV B;  2JF5 A;  3P2B A;  1EU4 A;  1UWM A;  2N9L A;  4FHK A;  2QIL A;  5HKH A;  3GE3 C;  4KSK C;  2KOX A;  4RMA A;  2LVQ A;  2ZVO A;  1JML A;  3SFD B;  3KYC D;  2IZV B;  2L52 A;  2JZ3 B;  4FAD A;  2I1J A;  2CKH B;  2O6V B;  2LGS A;  3PPA A;  4MJS A;  3AN1 A;  1HZ6 A;  2DX5 B;  2FUH B;  4M8N A;  1P3Q U;  4LJO B;  4NQK E;  1OEY A;  2KDI A;  2K39 A;  3H9D A;  4JWS C;  1WZ3 A;  3Q3O C;  1AWD A;  4CQN A;  2JQR B;  3QCA A;  4BKS A;  4HVB A;  5TR5 A;  4US8 A;  1FRD A;  3RNB C;  2N1W A;  3KLS X;  2Z0E B;  1ZPS A;  4EZJ A;  3KWV A;  1WY8 A;  1ZDV A;  5IKC M;  2KD0 A;  4PYU A;  2LJ5 A;  2KJH B;  4LCD E;  1NVI D;  2BB5 A;  1WXQ A;  2C7M B;  4M02 A;  2L00 B;  1WMH A;  3IVF A;  3E56 A;  3IAM 1;  3NVY A;  3QWZ B;  4W9C A;  2C7H A;  2VH2 A;  1I4P A;  1HXY D;  2INC C;  3EC8 A;  2C9W B;  4HDO A;  3RPF C;  3GB1 A;  3AXC A;  4FJZ A;  2VZK B;  1JRU A;  3GS2 A;  2DHZ A;  3V6E B;  2XN9 C;  1F2R C;  2Q5W D;  2KX3 A;  4HXD A;  3BK1 A;  1FM0 D;  3WAN A;  1UZX B;  2Y5B B;  4LK0 M;  3MHS D;  2LJI A;  4FBJ B;  2KJR A;  4BOZ B;  1FEH A;  1JW9 D;  4C56 C;  5D6J B;  3UIP B;  1FXI A;  1YJJ A;  1F52 A;  2GBN A;  1NDD A;  2D07 B;  1ESF A;  3EHV A;  2GLS A;  1B1Z A;  1Q1O A;  2R61 A;  1YN3 A;  2V4L A; 
#chains in the Genus database with same CATH homology
 2Z8L A;  1ET6 A;  1N62 A;  2W55 A;  1NI3 A;  2KN4 A;  1E6E B;  2SAK A;  4J3O D;  4RFB A;  2Y5P A;  2N7J A;  4ARC A;  1DGJ A;  2K22 A;  2E3T A;  2AX5 A;  2WXJ A;  1D5X C;  4GDL B;  1JCK B;  4RH6 A;  5D3I B;  3I57 A;  1QOG A;  5BMH A;  4US9 A;  1C9F A;  2RDG A;  2WXM A;  1L6U A;  3VRB B;  4N58 A;  1OQQ A;  2L83 A;  5EE3 A;  1UGJ A;  2WXO A;  4ZOH C;  4RGM A;  2V3P A;  3TEZ A;  1SE4 A;  4HKZ E;  1SXT A;  1XLO A;  2CJO A;  2WLB A;  3W2D A;  2MJ3 A;  2QJL A;  3Q8C A;  4O1N A;  5C2T B;  4TMA B;  3FC4 A;  2AQ1 B;  2JWU A;  3W5U B;  3BYT B;  3MFG A;  2I38 A;  3IT4 B;  4RNA A;  3ZYY X;  4RCO A;  3T3O A;  1FNV A;  1XLQ A;  2LGI A;  3AV8 A;  4NAM A;  4A8X C;  1XXG A;  3AE5 B;  1L6V A;  2FBW B;  1PGX A;  2R61 A;  1GPX A;  3AE1 B;  5H92 C;  3TSS A;  1J7B A;  3AED B;  2BW2 A;  2WXL A;  4NJC A;  2JYT A;  2WDR B;  4WAF A;  1C78 A;  1JRO A;  3NVW A;  2OHF A;  1NEK B;  1HEZ E;  2PVO D;  4ZYS A;  4A9A A;  1ZXI A;  1IBX A;  2I2Y A;  4RF0 A;  1IBX B;  4XDD A;  1SF0 A;  2IJ0 A;  3PZ7 A;  4MT5 A;  4WUR A;  1JWB D;  1SB3 C;  3CF4 A;  2QSD A;  5HG2 A;  1ZE3 D;  1VDV A;  3AH7 A;  3WCQ A;  4MH8 A;  3MC0 B;  1I4G A;  2PLP A;  5C3J B;  2OED A;  3U52 E;  1B9R A;  4KGT A;  1J7C A;  2WXG A;  4L2Y A;  5TSS A;  4HJG E;  4L23 A;  1ZDX A;  3LB8 C;  2WU5 B;  1EM7 A;  1R7S A;  2WXP A;  4GLS C;  1RFK A;  1VZ6 A;  2W54 A;  4DXF A;  1ZUD 2;  1IGD A;  3I9V 1;  1H7X A;  4OZC A;  1K52 A;  2G9H D;  3P42 A;  2W3R A;  5HFY A;  1JWM D;  1EWY C;  4AS1 A;  1ET9 A;  1V1P A;  2INN E;  2D5G A;  1E9M A;  2PTL A;  1GB4 A;  1WWT A;  2KAC A;  3O13 A;  1T5X D;  4TQ0 A;  2YEP B;  3MJ5 A;  3AE9 B;  4ZHP A;  4AQ7 A;  3P4R B;  3BVM A;  2N0S B;  3AEB B;  2KDM A;  3R2T A;  1N5X A;  1GAQ B;  1FCC C;  2JXT A;  3AM9 A;  3NVZ A;  3AMZ A;  1TZO A;  3IT6 B;  4HKQ A;  1QIL A;  2J42 A;  3FAH A;  1I4Q A;  1TKE A;  3AEE B;  3OWE B;  3BYY B;  3URY A;  3NZ3 A;  3RFZ B;  1SE2 A;  3DWG C;  4KGS A;  3BVG A;  3BII D;  1QOB A;  3GP7 A;  1FO4 A;  4H2A A;  2BT6 A;  1E10 A;  1STE A;  3IAS 1;  2CJN A;  2K9X A;  3P4Q B;  3HVD A;  1YN4 A;  2RMM A;  3Q8B A;  1DOX A;  5BYS A;  1MHX A;  1QQR A;  3HRD D;  4KGR A;  1D4B A;  4P6V F;  1BML C;  2DBY A;  1L5P A;  4N6E B;  2GI9 A;  1RYJ A;  2NMQ A;  2JU6 X;  2WU2 B;  1CJE A;  5LNK 1;  1XCQ L;  1FIQ A;  2TSS A;  4L1B A;  5EE9 A;  3VQI A;  4A55 A;  3KWL A;  3L4P A;  2HDE A;  2BS3 B;  4JX1 C;  1IUE A;  3EUB 2;  2DLB A;  2HTM E;  4KKI A;  1BXT A;  1XCT L;  3B2G A;  4RGN A;  1WRI A;  3J9C A;  1N60 A;  2DYO A;  1N63 A;  3UI3 A;  1C79 A;  4ZRQ A;  1N61 A;  5T8I A;  2PKO A;  2LEK A;  5D7G A;  1CQV A;  4DXG A;  2KAJ A;  3EGR A;  4XDC A;  5HHD G;  1TS5 A;  3ABV B;  1I4R A;  2LHD A;  1PYW D;  5I4D A;  4MAC A;  3ZJV A;  1L4Z B;  2LMC A;  2EEL A;  2WXQ A;  4YTM B;  2K3U A;  5BMI A;  3U4E G;  1FFV A;  5G5G A;  3AEA B;  1XLP A;  4OZA A;  1DOY A;  5HI1 A;  3R8B A;  3VR9 B;  5BYR A;  4YSY B;  4YTP B;  3PZ8 A;  4KX6 B;  1EU3 A;  4JWU C;  2LHE A;  3TEY A;  4DQO C;  1PDX A;  2ZW0 A;  4Q2J A;  2MJD A;  2Y5C A;  3AEC B;  1HQR D;  3Q8E A;  1TJE A;  2MJE A;  1WYG A;  3V3X A;  4B0M A;  4OZB A;  4YSX B;  2ZW1 A;  3H8H A;  1AYF A;  1QOA A;  1KLG D;  4ZRP A;  5EE1 A;  1HA5 A;  2FUG 1;  1C77 A;  2M0A A;  2PIA A;  3ZGZ A;  3DWM A;  1GT8 A;  2IPK D;  2N9K A;  3B2F A;  1FD6 A;  1FXA A;  1P7E A;  3ZJU A;  1GTE A;  2LUM A;  1T6B X;  4M0W A;  1MHH E;  4NAW B;  1BUI C;  1MI0 A;  1XLN A;  5H8Y E;  5BYQ A;  3NRZ A;  3AE6 B;  3NUH B;  2WXF A;  3SEB A;  1VR9 A;  2L32 A;  1KTK A;  1IGC A;  1SJE D;  2WXN A;  1GTH A;  2BBC A;  2NTT A;  4WIP A;  4HEA 1;  2H88 B;  1AW7 A;  2MH7 A;  1V1O A;  4C7Y A;  3IXS A;  3AE7 B;  4EE2 A;  5EE0 A;  1KRH A;  1D5Z C;  2IGH A;  2WNM A;  1QF6 A;  2V3N A;  2PW9 A;  3R2I A;  2JX5 A;  1FMA D;  1DYQ A;  2BB6 A;  3B9J A;  3VRA B;  2GRI A;  2DYM A;  3Q8F A;  1TY0 A;  1ENF A;  2JSV X;  1QT9 A;  1TS2 A;  1WSP A;  2MEK A;  5FK9 C;  1YN5 A;  1DOI A;  1EWC A;  3TEW A;  1XEE A;  1VLB A;  2K0P A;  3BVZ A;  3KQ4 A;  4KKJ A;  1RM6 C;  1HZ5 A;  1TS3 A;  1NYR A;  4JPS A;  3AE4 B;  1OFF A;  5D3D A;  4A90 A;  3NS1 A;  1L0X B;  1VRA B;  1YNT E;  2IGG A;  1ACC A;  2W82 A;  2WXH A;  3AB5 A;  4YSZ B;  1ZP0 B;  1UUP A;  2IGD A;  4IDI A;  4YWG G;  3AE8 B;  3E9S A;  2BYT A;  1QKZ A;  1TS4 A;  3PO0 A;  4TSS A;  3W5V B;  1FFU A;  1WGK A;  5E6J A;  3TEX A;  1SSN A;  3SR6 A;  1KFY B;  2L1A A;  2RDH A;  4C7Z A;  1FNW A;  2J52 A;  1NYQ A;  1J7A A;  1YQ4 B;  1TY2 A;  1V8C A;  3FIL B;  1F2R I;  4P16 A;  5FR3 A;  3ZJT A;  2JYE A;  4LLG M;  5MPO A;  2J53 A;  3BK2 A;  5G5H A;  1GOZ A;  2AQ3 B;  3VR8 B;  4RF1 A;  2BTE A;  2G1E A;  4ZHO A;  4OVZ A;  5BMG A;  1FRR A;  4B0E A;  4OHJ A;  2GB1 A;  3HUI A;  1PGB A;  3ZQ4 A;  2IDY A;  2QIE B;  1Q10 A;  1YQ3 B;  1V97 A;  1JWS D;  3EA6 A;  3MHZ A;  1PGA A;  1GB1 A;  3CWI A;  1ROE A;  3C8Y A;  3N9Y C;  2WDV B;  1EU4 A;  3AEF B;  1UWM A;  2E6X A;  2N9L A;  4IKG A;  2QIL A;  3P4S B;  4LTU A;  1SJH D;  5GXG B;  1SEB D;  3W1S A;  1L0Y B;  3U2S C;  4MM3 B;  4D2K A;  4XE0 A;  1JML A;  3SFD B;  5AUK A;  1CK1 A;  1VZ8 A;  1PUT A;  2L52 A;  2ACZ B;  2Y3A A;  1NEN B;  2M19 A;  1D5M C;  4WH4 A;  4PT5 A;  1XF5 L;  2KQ4 X;  2WDQ B;  4A6Q A;  5FKA C;  2CU3 A;  3AEG B;  5JXV A;  1AN8 A;  4TQ1 A;  3AN1 A;  1FCL A;  1HZ6 A;  2WS3 B;  1L0V B;  4YTN B;  2LFI A;  2QMT A;  3Q8A A;  4XWW A;  3CIR B;  4R3D A;  3P63 A;  4ARI A;  1I4X A;  1FNU A;  1C4C A;  2K5P A;  2KWD A;  3SFE B;  3P1M A;  1F0Z A;  1PFD A;  2PMV A;  1C4P A;  4JWS C;  1A70 A;  1I7H A;  2DWQ A;  1TKY A;  4FXC A;  1ZXH A;  4USA A;  1AWD A;  4HRO A;  4CQN A;  1UWX A;  1Y56 A;  2JQR B;  3P4P B;  3BWU D;  2RPV A;  4IOI E;  1TKG A;  4US8 A;  1FRD A;  2JZP A;  4C80 A;  1H7W A;  2NTS A;  2QEJ C;  3W9C B;  3KLS X;  1ZPS A;  1K51 A;  3KWV A;  1MVK A;  2EKI A;  1KF6 B;  2H89 B;  1T3Q A;  4WWM A;  1QOF A;  1D6E C;  1ZDV A;  2V4I B;  1XO3 A;  2X38 A;  1JQ4 A;  1C4A A;  3V05 A;  2WQY B;  3AE3 B;  2WXK A;  4XWT A;  4YXD B;  2WXI A;  2INP E;  1JAL A;  2VZK D;  1F77 A;  1JWU D;  1M4V A;  3LYY A;  1YJI A;  1K50 A;  1NVI D;  2BB5 A;  1WXQ A;  3MP9 A;  1TYG B;  2BS4 B;  1E0Z A;  2XNA C;  4REZ A;  3E56 A;  3ETR A;  3IAM 1;  3NVY A;  1SBB B;  1I4P A;  1C76 A;  1HXY D;  3NVV A;  1E7P B;  3RPF C;  4OW0 A;  2YEP F;  4HRS A;  3GB1 A;  1ZOY B;  2VZK B;  1SIJ A;  1KLU D;  3GS2 A;  2AQ2 B;  1JWA D;  1V1P B;  2XN9 C;  1F2R C;  1OQR A;  1P7F A;  2Q5W D;  2V0G A;  1VJK A;  3BK1 A;  4RGT A;  1FM0 D;  2WXR A;  4YT0 B;  2KMM A;  1QLB B;  1I4H A;  5AUI A;  1K53 A;  2ICI A;  2BS2 B;  1RWS A;  4LK0 M;  3U7Z A;  3FIL A;  2LJI A;  2W3S A;  2B76 B;  1L4D B;  3BZD B;  4UDU C;  1MPE A;  1FEH A;  1CZP A;  1JW9 D;  3LXF A;  1UNS A;  4RGO S;  1KH0 A;  2WP9 B;  1FXI A;  4C56 C;  1SE3 A;  3AE2 B;  1YJJ A;  3HVZ A;  1N5W A;  3Q69 A;  3TUO A;  1LO5 D;  2SEB D;  4GDK B;  2FE8 A;  3T3N A;  4WQM A;  2ON8 A;  1ESF A;  2PVG C;  4N59 A;  1VZ7 A;  4ITK A;  2ONQ A;  1B1Z A;  4NZL B;  1YMH E;  1JRP A;  2M56 B;  2J4X A;  4JE3 B;  1YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...