2B76B

E. coli quinol fumarate reductase frda e49q mutation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 59
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2b76B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2b76B01
3B2FA 4ZOHC 3DWMA 1IUEA 1DGJA 3SFDB 3AE8B 2W3RA 1JQ4A 3P4RB 3ETRA 3ZYYX 1VJKA 5C2TB 2PIAA 1YQ4B 5AUKA 1FO4A 3P4SB 1ZUD2 1B9RA 2QJLA 4YXDB 3W5UB 3NVZA 3B2GA 3AB5A 2AX5A 4YSXB 1E10A 1NYRA 1YJJA 2N0SB 3CWIA 4C7YA 3NVVA 2CJOA 3AE1B 1L0VB 1JRPA 1CZPA 1J7BA 1SF0A 1RWSA 4US8A 2FBWB 2JQRB 1DOYA 2H88B 2WU5B 1AYFA 3VR8B 4YTPB 2WQYB 3AEGB 3AE9B 1SIJA 1WWTA 2W3SA 1I7HA 4JWSC 3WCQA 4ITKA 1ROEA 3HUIA 1QOFA 1ZP0B 1FXIA 1V8CA 1WYGA 2K5PA 3AE3B 1TKYA 2CU3A 2CJNA 3AEDB 3AECB 2HTME 3L4PA 4US9A 1AWDA 4C80A 1RFKA 1QOAA 3ABVB 3W5VB 1N60A 3AH7A 3HRDD 1E6EB 1DOXA 1FIQA 2G1EA 2WLBA 3NRZA 5EE9A 1CJEA 3SFEB 5C3JB 1XO3A 1TYGB 1GTHA 2L83A 3EUB2 4YTMB 1N5XA 1FRDA 1J7AA 1OFFA 2W55A 3VRBB 4KX6B 2LEKA 2PVOD 3AMZA 4N58A 4P6VF 2MJDA 3AN1A 2WU2B 1QT9A 3CIRB 1XLNA 3HVZA 1SB3C 3LB8C 1A70A 1N61A 2BT6A 3BIID 2M56B 2K22A 1QF6A 1KRHA 5G5HA 2PKOA 1RYJA 2MJEA 2MH7A 1T3QA 2H89B 4WQMA 1JROA 1YQ3B 1UWMA 5AUIA 1JWAD 3SR6A 2K9XA 2BS3B 2WDRB 4YSYB 1NEKB 3P1MA 2MJ3A 1OQQA 3NVWA 4ZHOA 3AE7B 2B76B 3CF4A 2M19A 2PVGC 3FC4A 2DWQA 1V97A 3FAHA 1L5PA 1QOGA 4FXCA 1FFUA 2JX5A 3DWGC 4IDIA 4HRSA 4JWUC 5EE1A 2BS2B 1R7SA 1PFDA 2BS4B 1ZOYB 1QOBA 1PUTA 1RM6C 2EKIA 1F0ZA 2W54A 1N63A 2WP9B 1XLPA 5G5GA 1TKGA 1XLOA 2ACZB 5H8YE 1JALA 1TKEA 1YJIA 4JX1C 4YSZB 1JWBD 2WDVB 1NI3A 4N6EB 2OHFA 1FXAA 1QLBB 1PDXA 1OQRA 2WDQB 1VLBA 2L52A 1DOIA 2WS3B 1L6VA 2KAJA 3B9JA 1J7CA 1GT8A 1VDVA 5EE0A 1GTEA 1NENB 1N5WA 3LXFA 4USAA 1NYQA 1FM0D 3AV8A 4WWMA 3AE6B 2KMMA 1KF6B 4YT0B 3NS1A 4LTUA 3VRAB 3W9CB 3AEAB 3AE2B 3AEFB 1E0ZA 1EWYC 3P4QB 1E9MA 3P63A 4HROA 3AE4B 4ZHPA 1TJEA 1NVID 1WXQA 1JW9D 1KFYB 3AEBB 1WRIA 1ZXIA 2Q5WD 1WGKA 3P4PB 3AE5B 1H7WA 4YTNB 3AM9A 4N59A 3PO0A 5GXGB 5MPOA 1FFVA 1E7PB 1XLQA 1GPXA 1N62A 2QIEB 5EE3A 2DBYA 1GAQB 4A9AA 4C7ZA 3NVYA 5H92C 2E3TA 1L6UA 3RPFC 1H7XA 1FRRA 3KWLA 2Y5CA 1FMAD 3AEEB 3VR9B
chains in the Genus database with same CATH superfamily
3KVFB 4K7SA 1RRBA 2WXKA 4M8NA 2KJ6A 4TKNA 3T9LA 2DYOA 1K52A 3B2GA 1NYRA 4ZRIA 2MP2A 4LLGM 1SGHA 1IPGA 1J7BA 4M0WA 1D5ZC 3BVZA 3DOWA 3UF8A 4AWJA 3AEGB 2INPE 2D10A 1ET6A 1WJ6A 2C60A 1RFKA 3ZNHB 3BINA 1EM7A 2L76A 1Q1OA 5IN7A 4HDQA 1CMXB 1I42A 1IBXB 2KJHB 2OJWA 2AQ1B 3HIZA 3UQAA 2MP2B 4P1BC 2KVZA 5JH5C 2WDTB 1L4DB 4M0WB 3ZNGC 3CSTA 4JIOU 2WXMA 3K9OB 1WGHA 3V62A 2QEJC 2NBUA 1ZKHA 2JWZA 4LJOB 1GG3A 2PVGC 3FAHA 2FAZA 2MA9B 3QX1A 4HEA1 2EKIA 3NZ3A 2ACZB 3AULA 1OQRA 4ANWA 1VDVA 1WIAA 5FKAC 1KF6B 2MW5A 3TBLD 1V5TA 2NS5A 2K8HA 3O65B 1WXQA 3DHHC 3ZNID 1H7WA 1WR6E 4QAYA 3X23A 3KLSX 1B1ZA 2PTLA 5H92C 2E3TA 4ARIA 4HPLB 4NQKE 2C9WB 1XCTL 2INDC 1T0SC 5HHDG 5E6PA 3RNCC 4XZ4A 1E8WA 3IT4B 5D2MB 1SF0A 1RWSA 3RUIB 1T0RC 2JPHA 4P7IA 3RNEC 3KH0A 1ZGUB 1I4QA 1MG4A 3R66C 3D32A 2HD5B 3WAMA 3S2AA 1FXIA 2K5PA 3AEDB 4ANXA 2MRPA 1ISNA 3R3MA 2ZEQA 2WXOA 4XDDA 3Q8FA 1FNVA 1XCQL 2L0FA 3C19A 1QF6A 1PGAA 4KGTA 2UU7A 2JXXA 4II3B 3TL5A 2JXTA 2JT4B 3NVWA 2M19A 2NMQA 3LDZE 4KVGB 4LDTB 5EDSA 1PFDA 1F0ZA 1N63A 3WALA 1XLOA 4BKSA 4NJCA 4NAWB 2WDVB 3NOBA 4N6EB 2N7JA 4LK0M 2LZ6A 2VH1A 5TR5A 1ZW7A 2EELA 4IW0A 2PLPA 3AU4A 2JZZA 4JPSA 1E0ZA 3PS6A 3VUYA 1WXAA 4IM2A 2LUMA 2DAFA 3L10B 4ZRQA 1WGKA 4FJVB 2JZ3B 4R3DA 2JYTA 5BMHA 4C7ZA 1SEBD 2VH2A 3PVLA 1IP9A 1FRRA 1BUIC 2KDEB 3AEEB 1FCLA 3B2FA 4NNJB 4PYZA 4BBNC 1IUEA 3OLMD 4DHJD 3TJPA 2VZKD 5CHVC 3MC8A 1U4AA 2W3RA 2V3NA 1YQ4B 1UUPA 3QIJA 4IKGA 3W5UB 2AX5A 2DZMA 3Q6BA 4WWOA 5CHWA 1QQRA 2O6VA 1WM2A 1YIWA 2KNBA 2MBQA 3I57A 3DDCB 4G3XB 1WGDA 1AYFA 2M1MA 3DBRB 2WQYB 3WCQA 2C7MB 2K6QA 1C78A 4ITKA 3U7DA 3V05A 2BF8B 2N7EA 3JW0X 3NHEB 5IOIA 3TEZA 2K6DB 2G1EA 3U30A 3PT2B 5FK9C 4MH0E 1N5XA 2LWPA 2PPHA 1A70A 2O6VB 2KACA 4B0EA 4KKJA 1KRHA 5G5HA 4WH4A 2KDIA 4XYCA 4GIVA 4EZKA 1K53A 2LHDA 3CF4A 3UIPB 1WE7A 4FXCA 2XK5B 1EO6A 2YEPB 3PZ7A 2HJ8A 1KJTA 1JWMD 1ESFA 2M17A 1R4MB 2OHFA 1WMHA 1GT8A 5DPSA 3EFCA 1GTEA 2ZZPB 3QWZB 4NZLB 3AEFB 3HK0A 4ANVA 2A5UA 2MX2A 3LYYA 2I2YA 3PV1A 3P4PB 3SD5A 2L7RA 4OVZA 2DBYA 3BVMA 3SHQA 1SBBB 1H7XA 3I9V1 4DHZB 2NBVB 2D3CA 4PS3A 3GS2A 1WMHB 2NBWB 2XEWA 3ZLZA 2QJLA 3R7QA 3NVZA 2L8JA 2X38A 2CJOA 2L3ZA 3QARA 3M3JA 1LQBA 1KLUD 3AE9B 3L17A 2GBJA 1ZDXA 5IKCM 1C9FA 4RGMA 2KDMA 2AQ2B 3FILA 3ABVB 2IGGA 4X57B 2IGHA 4F7ZA 2D3AA 2MQJA 3EUB2 1T5XD 4AJYB 1J7AA 2PVOD 2WXRA 3AN1A 5D3IB 4FBJB 2D3BA 3CIRB 1XLNA 1V1PB 4BZAA 1N61A 4HKZE 4M02A 1DYQA 1P7EA 3PLUA 1HXYD 3IFWB 1RFAA 2GBMA 4W9CA 3FC4A 1WGRA 3PTFC 3H7PA 1R7SA 3WIMA 1YX6B 2W54A 3UI3A 3FILB 4F1SA 1KH0A 1L0YB 1FXAA 4RM8A 3B9JA 2QMTA 2G4DB 4RMAA 3WANA 2J0MA 3V60A 4LNIA 2UWQA 1OGWA 3GE3C 3T3NA 2RGFA 4YWGG 1TJEA 1VZ7A 2J0JA 1ET9A 3V61A 1FFVA 4JGHB 1OEYJ 1E8YA 2AYOB 3Q8BA 3RPFC 2FIFA 4IOIE 1SJHD 2DLBA 3SU8X 1ACCA 1DGJA 4MACA 3Q2AC 4L1BA 3PPAA 1JQ4A 5JHAA 4W9HA 3IXSA 1YJJA 2C7HA 3Q14C 1WZ3A 2N0SB 3CWIA 1FEHA 2V9HA 3AU5A 2L32A 2N4FA 4W9JA 4HCPB 1MHXA 2K25A 1ZDVA 2N9PC 3EHVA 3ML8A 3L54A 4TUUA 2MHJA 2BW2A 2RSUA 3DVGY 1V8CA 2N9XA 4PYUA 2ASQA 2CU3A 2CJNA 3L4PA 2JF5A 3L0WB 3ZTCA 2CHZA 4AOFA 2GOWA 2L83A 4A3PA 1MI0A 4GSWA 3R2IA 3UGBB 2KXJA 3QAQA 4H2AA 2W9NA 2LGYA 4MGZE 2AL6A 2ZW0A 4ZDVA 4NY0A 3Q8CA 4F8CB 1SE4A 4EOYA 2K9XA 1C4CA 3AE7B 3ZYYX 3OWEB 2EMSA 1XQQA 1RM6C 2K0PA 2WP9B 2V0GA 2XN9C 2ICIA 1HZ5A 2M4NA 2WS3B 4LNFA 1TZOA 3U52E 2CS4A 2ZVOA 3ZJUA 3VRAB 1MG8A 1C4PA 2I1JA 2LFIA 2LRWA 1UH6A 3P4QB 3N32A 3AE4B 4FULA 3ZIMA 3RFZB 3A9KA 2FCMA 1IGCA 3AM9A 3IAM1 3M95A 1I4RA 4ICUA 1GAQB 2D5GA 2Z0EB 5T8IA 2IY0B 2G3QB 3J9CA 2NCNA 3VQIA 3VR9B 3NVVA 2BB6A 2QILA 1WR1A 4II2B 4ZOHC 3SFDB 2BWES 1C79A 2GBRA 3BVGA 4WJQA 1P7FA 3UIOB 4URKA 1JRPA 4US8A 2JQRB 3A9KB 4DQOC 3PZDA 1SIJA 3KYDD 4S17A 2IJ0A 4K7UA 5BYRA 1ROEA 2MSED 4BOZB 1WYGA 4RF1A 2LUEA 3H7SA 4RGTA 4CQNA 1KM7A 4XWWA 4FHKA 4C56C 5EE9A 2MBBB 2WXNA 2ON8A 4LNKA 4RGOS 3QQ8B 3BK1A 1OFFA 2W55A 4KX6B 2KTFA 1PQSA 2WU2B 1D6EC 2IPKD 5IA7A 5LNK1 1EWCA 1P0RA 3FKYA 2FUHB 1ZPSA 3ZXVA 4TQ1A 3NS8A 1UNSA 2FCQA 3APDA 4K7WA 2BS2B 3VTWA 4NAMA 1YX5B 4OZCA 4JX1C 3Q3OC 3N1ZC 4N9F4 1WXSA 4KKIA 2G9HD 1N5WA 1NYQA 5HI1A 2IO1B 2DZJA 4YT0B 3ML9A 3NS1A 5GMVA 2DAJA 2WXJA 4IM0A 5GXGB 1D3ZA 3Q3FA 5J2RA 1WRDB 4IUMB 3QC8B 2UYZB 4MDKE 3W2DA 1WSPA 3IG3A 3RCZA 2KFJA 4MM3A 1Y56A 1LXDA 3GB1A 3ENEA 5AUKA 3MJWA 5IP4D 2C5LC 2Z8LA 2GBNA 4HVBA 2IO0B 2WYQA 2BYVE 1L0VB 2LGIA 4RGNA 5E6NA 1DOYA 3TCAA 2NR2A 3DBHB 3VR8B 1WWTA 1JWSD 4A90A 4DWFA 5LLIA 1HQRD 3VHTC 3ZJTA 2KYWA 5FR6A 1NBFC 2INCC 1ZXHA 4C80A 1ZE3D 4LDTD 4MM3B 3IBEA 1F2RC 1FIQA 3ECIA 4RCOA 3MHSD 2BYFA 4WWPA 4N58A 2J0KA 2KDFB 2RDHA 2BT6A 3BIID 5DPTA 4UDUC 1Q0WB 1JROA 2BS3B 2MJ3A 3MTNB 4XDCA 1V97A 1F1HA 2HDEA 5AZFA 4A3OA 2YLMA 5E6JA 1WX9A 3IVFA 1JWBD 4IWQA 2D11A 4IWPA 2V4LA 3NY5A 1J7CA 2KD0A 3AE6B 3AE2B 3A9JA 3HVDA 3PRPB 1E9MA 1WE6A 2HJ1A 1CQVA 4GLSC 4C4VA 4DXFA 2GB1A 2ZNVB 1ZXIA 3AEBB 1E90A 3MP9A 2KC1A 4EZLA 2LMCA 4JE3B 3PHXB 4WWNA 5L95C 1SXTA 5KHQA 1OEYA 1TTNA 1LGRA 1TIFA 1JCKB 3MFGA 2L00B 4P16A 2KWVB 1XEEA 3UQBA 2Z59B 4MGIE 3CSFA 3AB5A 4BAXA 4OHJA 3RZWC 2KWDA 3ZRFA 4MGKE 4AP4C 2R2QA 2FBWB 2WU5B 2N9KA 4C4VB 2J53A 1E7UA 1C76A 4NJ7A 3L08A 2FCSA 1UELA 5DPWA 3HUIA 1RAXA 2GMIC 3MC9A 2PW9A 4HWIB 1VR9A 3TUOA 1IGDA 3TSSA 3NRZA 4KDLB 2Y5BB 3JSVA 5C3JB 2BVCA 3AMZA 2G4SA 3KW5B 2PE6B 3LB8C 4A55A 3V6EB 2K8CA 1V2YA 2MJEA 2QCZA 1JWAD 2IDYA 4LCDE 4W9EA 3B0AA 4HRSA 4JWUC 2PJHA 3C0RB 3T8MA 4WJPA 1QOBA 1E5WA 3GOEA 2KMAA 2LJIA 4KSLC 1JALA 1FPYA 1YJIA 2LXCA 1NI3A 5KHOA 4MH8A 3U7ZA 2KFKA 3B08A 1DOIA 5IO9A 2LJ5A 2WXLA 2KJRA 3LXFA 3AI5A 2BBCA 3KQ4A 2DHZA 3Q8EA 4HROA 4HDOA 2RDBC 2WGSA 4FJYA 2I1KA 3M62B 3VUWA 2PE9A 4ZRPA 5H8YE 4C00A 1V49A 2KFKB 2IY1B 4BKGA 4DHJB 1F52A 2PIAA 5C2TB 3GZNI 5BMIA 1EU4A 2CHWA 1E10A 3RI7C 4C7YA 1VD2A 1V80A 1Y8RC 2DZIA 5AZGA 2TSSA 3RYTA 3CMMB 2WXHA 5HKHA 1WGGA 3U8ZA 2K3UA 1X1MA 2NPTA 4KSKC 1STEA 3OJ3A 1YOVB 2IGDA 1E6EB 3NG0A 1FCCC 1GTHA 3PZ8A 1FRDA 2VRRB 3IAS1 3Q69A 4WURA 2LEKA 4P6VF 2KANA 3P2BA 2MJDA 2JZPA 2KLCA 3ZGZA 4M8MA 5DCNA 2FNJB 2M56B 2K22A 1KLGD 1V5OA 2PKOA 3DBSA 4MJSA 2LGXA 4D2KA 4O1NA 4YSYB 3RNFC 1QOGA 4FHJA 1FXTB 4BVUC 3E9SA 4GDKA 3GE8C 2NPTB 1LFDA 2NTTA 3QHTA 1TKEA 1HE8A 3N20C 2KQ7A 4AS1A 3KUCB 1WF9A 3ZQ4A 4HJKA 4REZA 3C8YA 2KMMA 3RULA 3W9CB 1WXMA 2RPVA 3U2SC 2O2VA 1SSNA 2LHEA 2BB5A 1XT9B 4DXAB 1WZ0A 1L2NA 4HKQA 2N1WA 5CTRC 5G2NA 4GDKB 3NVYA 2KKCA 3H9DA 1D5MC 4W9LA 1LM8B 3RN9C 4MSMB 3ETRA 2KWCA 1V86A 3HM3A 1ZUD2 1B9RA 1MJDA 4YXDB 1SIFA 3L16A 2KTRA 1CZPA 2O2VB 3IT6B 3ZRCA 2HE7A 3H7PB 4XWTA 4DHZE 2KOXA 2N7DA 3GZNB 3A33B 4K81A 2DX5B 4DDID 1E7VA 4US9A 1AWDA 4WAFA 3HRDD 2M0AA 2Z0DB 2MBHA 2LGDA 3ZO5B 3V6CB 2CR5A 4W9FA 2KLGA 1MPEA 2A4ZA 1UBQA 2KZRA 3BK2A 2BQQA 1C3TA 2LD9A 1OTRB 3RD2A 1YQ3B 3N1XC 2WDRB 3BYTB 3JYUA 3I63C 2B76B 2KK8A 4B9KA 4HCNB 5EE1A 3W1SA 1A5RA 4HJGE 2J7QB 3EFUA 5HG2A 2JVCA 5BMGA 1M94A 2B3AA 2KWUB 3HHMA 4ASWC 1HTQA 2R2OA 4USAA 3PGEA 1WJ4A 5I4DA 1HEZE 2L1AA 2MCNB 1P9DU 1UZXB 2ONQA 2HTHA 4N59A 3PO0A 4A8XC 3ALBA 1L7YA 1TS4A 3AXCA 1TZ1A 1JWUD 4GMVA 1F2RI 3PHWB 3BWUD 2CHXA 2DZKA 1PGXA 4GN1A 4GB9A 2LVOA 4YSXB 2JRIB 2LVPA 1WJNA 2K8BA 2KT7A 3AE1B 3VTUA 1P98A 1WGYA 1KOTA 4XX5A 4B0MA 1F77A 4RF0A 4EUTA 3TEXA 3VH3B 2C7NB 2BYEA 1EF5A 1ZP0B 1YNTE 1YJ1A 2LASA 5JXVA 3TEWA 3AECB 1GJZA 2QDFA 4LJPB 3OAWA 2BPSA 3W5VB 5LXIB 5AEKB 1CJEA 2WXGA 4W9IA 3LJ3A 4ZYNA 1QKZA 3N9YC 3RNAC 3VTVA 1YN5A 2CU1A 3HVZA 1SB3C 3V3XA 1FD6A 3APFA 2N9LA 1RYJA 1AW7A 4NQLB 2IO2B 1N6ZA 4IM3A 3P1MA 2LVQA 1NEKB 4GOCA 2EKEC 3NZSA 2JX5A 1WX7A 2KDBA 2V3PA 3PSEB 1I4GA 2IYDB 3BYYB 1EUVB 3ZTDA 2KHWB 4KIKA 3AEAB 3QK0A 1IBXA 2LGSA 3P42A 1NVID 3VVWB 2KN5A 2QSDA 4G11A 4WJOA 5HFYA 2JRHA 5MPOA 1I4PA 1N62A 2FIDA 1IYFA 2OJRA 2PMVA 4ACFA 4I6NB 4GGQA 4FADA 1VJKA 3P4SB 1Z2MA 2ZCCA 4PS7A 2GLSA 4AUQC 4KIKB 5D3DA 3EC8A 1GUAB 3K9PB 5D94A 3SDLC 2ZPNA 1L0XB 2H88B 3MC0B 1XD3B 1E8ZA 1J19A 5CX3A 1SE3A 2WXPA 2W3SA 2KQSA 1WXVA 3O13A 3A1QA 3AE3B 1I4XA 4CO7A 4XC2A 1D5XC 4RM9A 3DBLI 1DOXA 2QHOA 2BGFA 3RNBC 4RH6A 2X8XX 4EFOA 1NDDA 4KZCA 1XXGA 1TS2A 3EA6A 1ENFA 4L2YA 2WXFA 3NJTA 2V3SA 2WX1A 3EECA 4FA6A 3VDZA 2KMCA 1GB4A 4L23A 3SR6A 4S0RA 4ZHOA 1WH3A 4HLEA 4LTUA 1L5PA 3DWGC 3L13A 3H6NA 3A1QB 2BS4B 2KC2A 3DVGX 3DQVA 2RDGA 2K1FA 4I6LB 5LXHA 1RLFA 1WM3A 4DXGA 1QLBB 1PDXA 2WDQB 2ZVNA 2LI5A 4MGYE 4OVVA 3ZDMC 4TQ0A 3DBRI 1TGZB 4CHKA 3JVZX 2ZJDA 1SE9A 4IG7B 1KTKA 1XF5L 3R2TA 5IAAC 3ZXRA 1GOZA 1HTOA 5G55A 4ZHPA 5AZHA 4WQOB 1V81A 4BKTA 1KFYB 1WRIA 1HA5A 4A6QA 5EE3A 1TS3A 1Q5WB 3KWLA 4BKSD 1G6JA 1FMAD 4BOSC 3PRMB 2ZCBA 3P4RB 1SJED 4KGSA 4NAWA 3A4SC 4M00A 2FE8A 3KUDB 3GP7A 3E56A 1LO5D 1R4NI 1YN3A 1MHHE 2IZVB 2J52A 3KWVA 4YTPB 2G45B 4WJNA 4E71A 1I7HA 4JWSC 1S3SG 1VCBA 1R4MI 1OQYA 1TKYA 4ZRJA 1TBEA 3B1LX 3A4RA 3WAPA 3AH7A 3MJ5A 2JY6A 4E74A 4G50A 2D2QA 4BBNF 2GI9A 3A9JB 2N1VA 1C1YB 5DPRA 1GNUA 2RR9A 4Q2JA 1QT9A 2J42A 2O6VD 3HM6X 1NI2A 4KZ0A 3R7RA 1H4RA 5D6JB 2MBEA 3DBLB 4HPPA 5AUIA 1T6BX 2BWFA 2FUG1 2MLBA 1OQQA 1K51A 3R8BA 1UD7A 3CF6E 3QA8A 1ZOYB 2JUOA 3Q3JA 1XLPA 5G5GA 3U4EG 1TKGA 4MELA 4XGAB 3DHIC 4YSZB 1QILA 1WY8A 2XBBC 4HPMB 1VLBA 2L52A 5BYSA 2LXAA 5C1ZA 3NUHB 4K3CA 1WYWB 2ZPYA 2ZNVC 4GXBA 4KV2A 1EWYC 4RFBA 2AEHA 5L83A 1S1QB 2ZW1A 4E3CA 4J3OD 1UGMA 2PEAA 3QJZA 4DBGA 1GPXA 2QIEB 4MEMA 2DYBA 2IO3B 2V4IB 4W9DA 4ZYSA 2WX0A 1L6UA 3JSVB 1YQBA 2Y5CA 1XO3A 4EE2A 2XK5A 4DDGD 5BYQA 4J6IA 1FO4A 2KO3A 4B95A 5E6OA 3MHZA 2INNE 4WAAA 1TY0A 1VZ8A 3URYA 1UF0A 1H8CA 1FNUA 2JU6X 2Y5PA 2WHIA 2WXIA 4NPNA 5JZEB 3BZDB 4TV3A 1QOFA 1YD8U 2JYEA 1V1OA 2FCNA 4FLHA 2VZKB 4OZBA 1QOAA 3VXWA 2NVUI 1N60A 2L0TA 2AWTA 3ZDTA 1R4NB 2WLBA 3SFEB 2RMMA 3VRBB 2K39A 1AN8A 1BXTA 2SEBD 3T3OA 2WNMA 3ZW3A 1AARA 2KQ4X 1J8CA 1T3QA 5TSSA 2KN4A 2XNAC 1UWXA 1V6EA 4IDIA 5JHBA 4K1RB 1FFUA 4XE0A 3WA0A 1PUTA 4JL9A 2L05A 2E6XA 4W9KA 2YEPF 2SAKA 3ONSA 1SE2A 5J17A 4P1CC 2KAJA 5EE0A 2WXQA 3Q3NC 2I38A 2YVCA 4K3BA 1JMLA 3RZFA 1GC7A 1V1PA 2MEKA 2Q5WD 3AE5B 3WAOA 1C4AA 1UGJA 1Z5SB 2DNFA 1K50A 2MWSB 3I5JC 1T0YA 4I6PA 5C23A 4EKUA 3DWMA 1P1AA 3ZUNA 3AE8B 1T0QC 1UBIA 2RD0A 3UINB 1VRAB 2BYTA 4M01A 2NTSA 2D07B 4MJSB 4A20A 3PREA 1GC6A 2BKFA 4W9GA 4KGRA 2CKHB 3EGRA 3N3KB 1K8RB 4EEWA 1CK1A 3IHPC 1MFWA 2GRIA 4RNAA 4GU2A 1WFYA 1PGBA 4MSQB 1E8XA 3ZNZB 4JQWC 3VFKA 1BT0A 2N9EB 1J0GA 5FR3A 4B6WA 3VAWA 3I3TB 4LNOA 2RPQA 3ZVVA 1GB1A 4EZJA 1Q10A 4AQ7A 1VZ6A 3N30A 2H89B 1TT5B 4DK5A 3DHGC 1L4ZB 4LNNA 2DWQA 2J4XA 1MVKA 3TMPB 3RT3B 4KDIC 1KLVA 2KTRB 3DVNV 2AL3A 4NJ6A 1I35A 1L6VA 4OW0A 1HZ6A 2WWZA 1NENB 3DCGA 1FM0D 4WWMA 1C77A 4AJWA 2KX3A 3TIXA 5CHFA 4OZAA 4WIPA 1D4BA 4PT5A 2DYMA 1WI0A 2KX0A 3KYCD 2Y3AA 2JSVX 4IC7B 2GBKA 4YTNB 3W1YA 1M4VA 1E7PB 1TS5A 1XLQA 2QC8A 3SEBA 4FJZA 3PLVA 4ICVA 2DENB 2BKRB 1TYGB 3BY4B 3VUXA 3RNGC 4IWOA 3NZUA 1YN4A 2OEDA 1QZEA 1FNWA 2OOBB 4FN2A 2LRUA 1EU3A 1P3QU 4CYEA 4ARCA 2JWUA 1TY2A 4TMAB 4PK1A 3H8HA 2M8SA 1EF1A 2IBIB 5J18A 3APCA 4BFRA 5BO4B 1JRUA 1I4HA 3X0WA 2KVRA 3KUZA 4GDLA 1YMHE 3H1UA 3OG5A 4YL8A 2HTME 4OVUA 4HXDA 2W82A 4YTMB 4A9AA 3VH4B 4ZRKA 3PRZA 3TEYA 1V9JA 2M0XA 2MBOA 3ZJVA 1PYWD 3ZKJC 4MT5A 2MH7A 4WQMA 4JLCA 1UWMA 1F9JA 4GDLB 3M63B 3QCAA 1WX8A 3OJ4B 2BTEA 4PS8A 1WJUA 3Q3MC 3RMKC 2REXA 1BMLC 3DPDA 2EMTA 4TSSA 4HK2A 3AV8A 3DBHI 2D3GA 2R61A 3P63A 4G0NB 4ANUA 1JW9D 2V1YA 3W1SC 3DVNU 3N1YC 5D7GA 3Q8AA 2AQ3B
chains in the Genus database with same CATH topology
1ACCA 1DGJA 2WXKA 4MACA 4L1BA 1JQ4A 3P4RB 2PIAA 5C2TB 1SJED 4KGSA 2DYOA 5BMIA 1EU4A 1K52A 3B2GA 3IXSA 1E10A 1NYRA 1YJJA 2FE8A 2N0SB 3CWIA 4C7YA 3GP7A 4LLGM 1FEHA 3E56A 1J7BA 2TSSA 1D5ZC 4M0WA 1LO5D 3BVZA 2L32A 1YN3A 1MHHE 2J52A 1MHXA 1ZDVA 3KWVA 4YTPB 2WXHA 3AEGB 2INPE 1I7HA 4JWSC 1ET6A 2BW2A 1V8CA 1TKYA 2CU3A 2CJNA 2K3UA 3L4PA 1RFKA 1STEA 2IGDA 1EM7A 3AH7A 3MJ5A 1E6EB 1FCCC 2L83A 1GTHA 2GI9A 3PZ8A 1FRDA 3IAS1 1IBXB 3Q69A 4WURA 2LEKA 4P6VF 1MI0A 2MJDA 2JZPA 4Q2JA 3R2IA 2AQ1B 1QT9A 2J42A 4H2AA 3ZGZA 2ZW0A 2M56B 2K22A 3Q8CA 1L4DB 1KLGD 2PKOA 2WXMA 2QEJC 1SE4A 4D2KA 5AUIA 1T6BX 2FUG1 4O1NA 2K9XA 4YSYB 1OQQA 1C4CA 3AE7B 1K51A 3ZYYX 2PVGC 3FAHA 1QOGA 3R8BA 3OWEB 3E9SA 4HEA1 2EKIA 1ZOYB 1RM6C 2K0PA 3NZ3A 2WP9B 1XLPA 5G5GA 3U4EG 1TKGA 2NTTA 2ACZB 1TKEA 4YSZB 2V0GA 2XN9C 2ICIA 1HZ5A 1QILA 4AS1A 1OQRA 1VLBA 2L52A 5BYSA 2WS3B 1TZOA 3U52E 1VDVA 3ZQ4A 3NUHB 4REZA 3C8YA 5FKAC 2KMMA 3ZJUA 1KF6B 3W9CB 3VRAB 2RPVA 1C4PA 2LFIA 1EWYC 3P4QB 4RFBA 3U2SC 2ZW1A 3AE4B 1SSNA 1WXQA 2LHEA 2BB5A 4J3OD 3RFZB 1IGCA 3AM9A 3IAM1 1H7WA 4HKQA 1GPXA 1I4RA 2QIEB 2V4IB 4ZYSA 1GAQB 1B1ZA 2D5GA 3KLSX 3NVYA 4GDKB 5T8IA 2PTLA 5H92C 2E3TA 1L6UA 3J9CA 2Y5CA 1D5MC 4ARIA 3VQIA 1XO3A 3VR9B 3NVVA 2BB6A 2QILA 4EE2A 4ZOHC 1XCTL 3SFDB 5BYQA 3ETRA 1C79A 1FO4A 1ZUD2 5HHDG 1B9RA 4YXDB 3BVGA 3MHZA 2INNE 1TY0A 1P7FA 1VZ8A 3URYA 3IT4B 1JRPA 1CZPA 1FNUA 1SF0A 1RWSA 3IT6B 4US8A 2JQRB 2JU6X 4DQOC 2Y5PA 4XWTA 1SIJA 2WXIA 2IJ0A 1I4QA 3BZDB 5BYRA 1ROEA 1QOFA 2JYEA 1FXIA 1V1OA 1WYGA 2K5PA 3AEDB 4RF1A 4US9A 1AWDA 2VZKB 4OZBA 1QOAA 4RGTA 4WAFA 1N60A 3HRDD 4CQNA 2M0AA 4XWWA 4C56C 2WLBA 2WXOA 5EE9A 3SFEB 2WXNA 2ON8A 4RGOS 2RMMA 4XDDA 3BK1A 1OFFA 2W55A 3VRBB 4KX6B 2WU2B 1AN8A 3Q8FA 1BXTA 1FNVA 1D6EC 1MPEA 2SEBD 1XCQL 2IPKD 3T3OA 2WNMA 3BK2A 5LNK1 1QF6A 1EWCA 2KQ4X 1PGAA 4KGTA 1ZPSA 1T3QA 5TSSA 1YQ3B 2KN4A 2XNAC 2JXTA 2WDRB 3BYTB 4TQ1A 3NVWA 1UWXA 2M19A 2B76B 2NMQA 1UNSA 4IDIA 1FFUA 4XE0A 5EE1A 2BS2B 1PFDA 3W1SA 1F0ZA 1PUTA 4HJGE 1N63A 4NAMA 1XLOA 2E6XA 5HG2A 2YEPF 4OZCA 2SAKA 5BMGA 4JX1C 4NJCA 4NAWB 2WDVB 1SE2A 2N7JA 4N6EB 4LK0M 2KAJA 4KKIA 2G9HD 5EE0A 2WXQA 2EELA 1N5WA 4USAA 1NYQA 2I38A 5HI1A 2PLPA 4YT0B 3NS1A 1JMLA 5I4DA 4JPSA 1E0ZA 1HEZE 2L1AA 2WXJA 2LUMA 1V1PA 2ONQA 2MEKA 2Q5WD 4ZRQA 1WGKA 3AE5B 5GXGB 4N59A 3PO0A 4A8XC 1C4AA 1UGJA 4R3DA 1TS4A 2JYTA 5BMHA 4C7ZA 1JWUD 1K50A 1SEBD 1F2RI 1FRRA 1BUIC 3BWUD 3W2DA 1WSPA 3AEEB 1FCLA 3B2FA 3DWMA 1IUEA 1Y56A 2VZKD 1PGXA 3AE8B 2W3RA 3GB1A 2V3NA 1YQ4B 1UUPA 1VRAB 5AUKA 2BYTA 4IKGA 3W5UB 2AX5A 4YSXB 2NTSA 2Z8LA 1QQRA 3AE1B 1L0VB 2LGIA 4RGNA 4KGRA 3EGRA 3I57A 1DOYA 1AYFA 1CK1A 4B0MA 3VR8B 1WWTA 2WQYB 1JWSD 3WCQA 1F77A 4RF0A 2GRIA 4A90A 1C78A 4ITKA 4RNAA 3TEXA 3V05A 1HQRD 1ZP0B 1YNTE 3ZJTA 5JXVA 1PGBA 3TEZA 3TEWA 3AECB 1ZXHA 4C80A 1ZE3D 3W5VB 4MM3B 1F2RC 1FIQA 2G1EA 1CJEA 2WXGA 5FR3A 4RCOA 5FK9C 1N5XA 4N58A 1QKZA 3N9YC 1YN5A 3HVZA 1SB3C 2RDHA 1A70A 3V3XA 1FD6A 2BT6A 3BIID 2KACA 4B0EA 4KKJA 1KRHA 2N9LA 5G5HA 1GB1A 4UDUC 1Q10A 4WH4A 1RYJA 1AW7A 1VZ6A 4AQ7A 2H89B 1JROA 2BS3B 1L4ZB 1K53A 1NEKB 3P1MA 2MJ3A 2LHDA 3CF4A 4XDCA 2DWQA 1V97A 4FXCA 2JX5A 2J4XA 2HDEA 2YEPB 3PZ7A 1MVKA 1JWMD 2V3PA 1ESFA 5H8YE 1I4GA 5E6JA 1JWBD 2OHFA 3BYYB 1L6VA 1J7CA 1GT8A 4OW0A 1GTEA 1HZ6A 1NENB 1FM0D 4WWMA 1C77A 3AE6B 4NZLB 3AEAB 3AE2B 4OZAA 3AEFB 4WIPA 1D4BA 1IBXA 3HVDA 1E9MA 1CQVA 4PT5A 2DYMA 4GLSC 3P42A 1NVID 4DXFA 2GB1A 2Y3AA 2JSVX 2QSDA 1ZXIA 3AEBB 3LYYA 3MP9A 5HFYA 2I2YA 3P4PB 4YTNB 5MPOA 1I4PA 2LMCA 4JE3B 1M4VA 1E7PB 1TS5A 1XLQA 3SEBA 1N62A 4OVZA 1SXTA 2DBYA 3BVMA 1SBBB 1H7XA 3I9V1 1TYGB 1JCKB 3MFGA 2PMVA 3GS2A 4P16A 1XEEA 1YN4A 1VJKA 2OEDA 3P4SB 1FNWA 2QJLA 3NVZA 1EU3A 3AB5A 4ARCA 2JWUA 1TY2A 5D3DA 4TMAB 4OHJA 2X38A 2CJOA 2KWDA 3H8HA 2FBWB 1L0XB 2H88B 2WU5B 2N9KA 3MC0B 1SE3A 2WXPA 1I4HA 2J53A 1KLUD 3AE9B 1C76A 2W3SA 1YMHE 1ZDXA 3HUIA 3O13A 1C9FA 3AE3B 2PW9A 4RGMA 2KDMA 1VR9A 1I4XA 2HTME 3TUOA 1D5XC 2AQ2B 3FILA 3ABVB 1IGDA 2IGGA 1DOXA 2IGHA 3TSSA 3NRZA 2W82A 4RH6A 3EUB2 5C3JB 1T5XD 4YTMB 4A9AA 1J7AA 2PVOD 3AMZA 2WXRA 3AN1A 5D3IB 1XXGA 1TS2A 3EA6A 3TEYA 1ENFA 4L2YA 3CIRB 1XLNA 1V1PB 3LB8C 2WXFA 1N61A 4HKZE 4A55A 3ZJVA 1PYWD 4MT5A 2MJEA 1DYQA 1P7EA 2MH7A 1GB4A 4L23A 1HXYD 4WQMA 1UWMA 1JWAD 3SR6A 2IDYA 4ZHOA 4GDLB 3FC4A 4LTUA 1L5PA 3DWGC 4HRSA 4JWUC 1R7SA 1QOBA 2BS4B 2W54A 2RDGA 2BTEA 3UI3A 3FILB 2LJIA 1JALA 1YJIA 4DXGA 1KH0A 1NI3A 1L0YB 4MH8A 1BMLC 3U7ZA 1FXAA 1QLBB 1PDXA 2WDQB 1DOIA 3B9JA 2QMTA 2WXLA 4TSSA 4TQ0A 3LXFA 3AV8A 3KQ4A 2BBCA 2R61A 1KTKA 1XF5L 3R2TA 3Q8EA 3T3NA 3P63A 4HROA 1GOZA 4YWGG 1TJEA 4ZHPA 1VZ7A 1JW9D 1KFYB 1WRIA 1HA5A 1ET9A 4A6QA 1FFVA 5D7GA 5EE3A 1TS3A 3Q8BA 3Q8AA 3RPFC 2AQ3B 4IOIE 1SJHD 2DLBA 3KWLA 4ZRPA 1FMAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2F A;  4ZOH C;  3DWM A;  1IUE A;  1DGJ A;  3SFD B;  3AE8 B;  2W3R A;  1JQ4 A;  3P4R B;  3ETR A;  3ZYY X;  1VJK A;  5C2T B;  2PIA A;  1YQ4 B;  5AUK A;  1FO4 A;  3P4S B;  1ZUD 2;  1B9R A;  2QJL A;  4YXD B;  3W5U B;  3NVZ A;  3B2G A;  3AB5 A;  2AX5 A;  4YSX B;  1E10 A;  1NYR A;  1YJJ A;  2N0S B;  3CWI A;  4C7Y A;  3NVV A;  2CJO A;  3AE1 B;  1L0V B;  1JRP A;  1CZP A;  1J7B A;  1SF0 A;  1RWS A;  4US8 A;  2FBW B;  2JQR B;  1DOY A;  2H88 B;  2WU5 B;  1AYF A;  3VR8 B;  4YTP B;  2WQY B;  3AEG B;  3AE9 B;  1SIJ A;  1WWT A;  2W3S A;  1I7H A;  4JWS C;  3WCQ A;  4ITK A;  1ROE A;  3HUI A;  1QOF A;  1ZP0 B;  1FXI A;  1V8C A;  1WYG A;  2K5P A;  3AE3 B;  1TKY A;  2CU3 A;  2CJN A;  3AED B;  3AEC B;  2HTM E;  3L4P A;  4US9 A;  1AWD A;  4C80 A;  1RFK A;  1QOA A;  3ABV B;  3W5V B;  1N60 A;  3AH7 A;  3HRD D;  1E6E B;  1DOX A;  1FIQ A;  2G1E A;  2WLB A;  3NRZ A;  5EE9 A;  1CJE A;  3SFE B;  5C3J B;  1XO3 A;  1TYG B;  1GTH A;  2L83 A;  3EUB 2;  4YTM B;  1N5X A;  1FRD A;  1J7A A;  1OFF A;  2W55 A;  3VRB B;  4KX6 B;  2LEK A;  2PVO D;  3AMZ A;  4N58 A;  4P6V F;  2MJD A;  3AN1 A;  2WU2 B;  1QT9 A;  3CIR B;  1XLN A;  3HVZ A;  1SB3 C;  3LB8 C;  1A70 A;  1N61 A;  2BT6 A;  3BII D;  2M56 B;  2K22 A;  1QF6 A;  1KRH A;  5G5H A;  2PKO A;  1RYJ A;  2MJE A;  2MH7 A;  1T3Q A;  2H89 B;  4WQM A;  1JRO A;  1YQ3 B;  1UWM A;  5AUI A;  1JWA D;  3SR6 A;  2K9X A;  2BS3 B;  2WDR B;  4YSY B;  1NEK B;  3P1M A;  2MJ3 A;  1OQQ A;  3NVW A;  4ZHO A;  3AE7 B;  2B76 B;  3CF4 A;  2M19 A;  2PVG C;  3FC4 A;  2DWQ A;  1V97 A;  3FAH A;  1L5P A;  1QOG A;  4FXC A;  1FFU A;  2JX5 A;  3DWG C;  4IDI A;  4HRS A;  4JWU C;  5EE1 A;  2BS2 B;  1R7S A;  1PFD A;  2BS4 B;  1ZOY B;  1QOB A;  1PUT A;  1RM6 C;  2EKI A;  1F0Z A;  2W54 A;  1N63 A;  2WP9 B;  1XLP A;  5G5G A;  1TKG A;  1XLO A;  2ACZ B;  5H8Y E;  1JAL A;  1TKE A;  1YJI A;  4JX1 C;  4YSZ B;  1JWB D;  2WDV B;  1NI3 A;  4N6E B;  2OHF A;  1FXA A;  1QLB B;  1PDX A;  1OQR A;  2WDQ B;  1VLB A;  2L52 A;  1DOI A;  2WS3 B;  1L6V A;  2KAJ A;  3B9J A;  1J7C A;  1GT8 A;  1VDV A;  5EE0 A;  1GTE A;  1NEN B;  1N5W A;  3LXF A;  4USA A;  1NYQ A;  1FM0 D;  3AV8 A;  4WWM A;  3AE6 B;  2KMM A;  1KF6 B;  4YT0 B;  3NS1 A;  4LTU A;  3VRA B;  3W9C B;  3AEA B;  3AE2 B;  3AEF B;  1E0Z A;  1EWY C;  3P4Q B;  1E9M A;  3P63 A;  4HRO A;  3AE4 B;  4ZHP A;  1TJE A;  1NVI D;  1WXQ A;  1JW9 D;  1KFY B;  3AEB B;  1WRI A;  1ZXI A;  2Q5W D;  1WGK A;  3P4P B;  3AE5 B;  1H7W A;  4YTN B;  3AM9 A;  4N59 A;  3PO0 A;  5GXG B;  5MPO A;  1FFV A;  1E7P B;  1XLQ A;  1GPX A;  1N62 A;  2QIE B;  5EE3 A;  2DBY A;  1GAQ B;  4A9A A;  4C7Z A;  3NVY A;  5H92 C;  2E3T A;  1L6U A;  3RPF C;  1H7X A;  1FRR A;  3KWL A;  2Y5C A;  1FMA D;  3AEE B;  3VR9 B; 
#chains in the Genus database with same CATH topology
 3KVF B;  4K7S A;  1RRB A;  2WXK A;  4M8N A;  2KJ6 A;  4TKN A;  3T9L A;  2DYO A;  1K52 A;  3B2G A;  1NYR A;  4ZRI A;  2MP2 A;  4LLG M;  1SGH A;  1IPG A;  1J7B A;  4M0W A;  1D5Z C;  3BVZ A;  3DOW A;  3UF8 A;  4AWJ A;  3AEG B;  2INP E;  2D10 A;  1ET6 A;  1WJ6 A;  2C60 A;  1RFK A;  3ZNH B;  3BIN A;  1EM7 A;  2L76 A;  1Q1O A;  5IN7 A;  4HDQ A;  1CMX B;  1I42 A;  1IBX B;  2KJH B;  2OJW A;  2AQ1 B;  3HIZ A;  3UQA A;  2MP2 B;  4P1B C;  2KVZ A;  5JH5 C;  2WDT B;  1L4D B;  4M0W B;  3ZNG C;  3CST A;  4JIO U;  2WXM A;  3K9O B;  1WGH A;  3V62 A;  2QEJ C;  2NBU A;  1ZKH A;  2JWZ A;  4LJO B;  1GG3 A;  2PVG C;  3FAH A;  2FAZ A;  2MA9 B;  3QX1 A;  4HEA 1;  2EKI A;  3NZ3 A;  2ACZ B;  3AUL A;  1OQR A;  4ANW A;  1VDV A;  1WIA A;  5FKA C;  1KF6 B;  2MW5 A;  3TBL D;  1V5T A;  2NS5 A;  2K8H A;  3O65 B;  1WXQ A;  3DHH C;  3ZNI D;  1H7W A;  1WR6 E;  4QAY A;  3X23 A;  3KLS X;  1B1Z A;  2PTL A;  5H92 C;  2E3T A;  4ARI A;  4HPL B;  4NQK E;  2C9W B;  1XCT L;  2IND C;  1T0S C;  5HHD G;  5E6P A;  3RNC C;  4XZ4 A;  1E8W A;  3IT4 B;  5D2M B;  1SF0 A;  1RWS A;  3RUI B;  1T0R C;  2JPH A;  4P7I A;  3RNE C;  3KH0 A;  1ZGU B;  1I4Q A;  1MG4 A;  3R66 C;  3D32 A;  2HD5 B;  3WAM A;  3S2A A;  1FXI A;  2K5P A;  3AED B;  4ANX A;  2MRP A;  1ISN A;  3R3M A;  2ZEQ A;  2WXO A;  4XDD A;  3Q8F A;  1FNV A;  1XCQ L;  2L0F A;  3C19 A;  1QF6 A;  1PGA A;  4KGT A;  2UU7 A;  2JXX A;  4II3 B;  3TL5 A;  2JXT A;  2JT4 B;  3NVW A;  2M19 A;  2NMQ A;  3LDZ E;  4KVG B;  4LDT B;  5EDS A;  1PFD A;  1F0Z A;  1N63 A;  3WAL A;  1XLO A;  4BKS A;  4NJC A;  4NAW B;  2WDV B;  3NOB A;  4N6E B;  2N7J A;  4LK0 M;  2LZ6 A;  2VH1 A;  5TR5 A;  1ZW7 A;  2EEL A;  4IW0 A;  2PLP A;  3AU4 A;  2JZZ A;  4JPS A;  1E0Z A;  3PS6 A;  3VUY A;  1WXA A;  4IM2 A;  2LUM A;  2DAF A;  3L10 B;  4ZRQ A;  1WGK A;  4FJV B;  2JZ3 B;  4R3D A;  2JYT A;  5BMH A;  4C7Z A;  1SEB D;  2VH2 A;  3PVL A;  1IP9 A;  1FRR A;  1BUI C;  2KDE B;  3AEE B;  1FCL A;  3B2F A;  4NNJ B;  4PYZ A;  4BBN C;  1IUE A;  3OLM D;  4DHJ D;  3TJP A;  2VZK D;  5CHV C;  3MC8 A;  1U4A A;  2W3R A;  2V3N A;  1YQ4 B;  1UUP A;  3QIJ A;  4IKG A;  3W5U B;  2AX5 A;  2DZM A;  3Q6B A;  4WWO A;  5CHW A;  1QQR A;  2O6V A;  1WM2 A;  1YIW A;  2KNB A;  2MBQ A;  3I57 A;  3DDC B;  4G3X B;  1WGD A;  1AYF A;  2M1M A;  3DBR B;  2WQY B;  3WCQ A;  2C7M B;  2K6Q A;  1C78 A;  4ITK A;  3U7D A;  3V05 A;  2BF8 B;  2N7E A;  3JW0 X;  3NHE B;  5IOI A;  3TEZ A;  2K6D B;  2G1E A;  3U30 A;  3PT2 B;  5FK9 C;  4MH0 E;  1N5X A;  2LWP A;  2PPH A;  1A70 A;  2O6V B;  2KAC A;  4B0E A;  4KKJ A;  1KRH A;  5G5H A;  4WH4 A;  2KDI A;  4XYC A;  4GIV A;  4EZK A;  1K53 A;  2LHD A;  3CF4 A;  3UIP B;  1WE7 A;  4FXC A;  2XK5 B;  1EO6 A;  2YEP B;  3PZ7 A;  2HJ8 A;  1KJT A;  1JWM D;  1ESF A;  2M17 A;  1R4M B;  2OHF A;  1WMH A;  1GT8 A;  5DPS A;  3EFC A;  1GTE A;  2ZZP B;  3QWZ B;  4NZL B;  3AEF B;  3HK0 A;  4ANV A;  2A5U A;  2MX2 A;  3LYY A;  2I2Y A;  3PV1 A;  3P4P B;  3SD5 A;  2L7R A;  4OVZ A;  2DBY A;  3BVM A;  3SHQ A;  1SBB B;  1H7X A;  3I9V 1;  4DHZ B;  2NBV B;  2D3C A;  4PS3 A;  3GS2 A;  1WMH B;  2NBW B;  2XEW A;  3ZLZ A;  2QJL A;  3R7Q A;  3NVZ A;  2L8J A;  2X38 A;  2CJO A;  2L3Z A;  3QAR A;  3M3J A;  1LQB A;  1KLU D;  3AE9 B;  3L17 A;  2GBJ A;  1ZDX A;  5IKC M;  1C9F A;  4RGM A;  2KDM A;  2AQ2 B;  3FIL A;  3ABV B;  2IGG A;  4X57 B;  2IGH A;  4F7Z A;  2D3A A;  2MQJ A;  3EUB 2;  1T5X D;  4AJY B;  1J7A A;  2PVO D;  2WXR A;  3AN1 A;  5D3I B;  4FBJ B;  2D3B A;  3CIR B;  1XLN A;  1V1P B;  4BZA A;  1N61 A;  4HKZ E;  4M02 A;  1DYQ A;  1P7E A;  3PLU A;  1HXY D;  3IFW B;  1RFA A;  2GBM A;  4W9C A;  3FC4 A;  1WGR A;  3PTF C;  3H7P A;  1R7S A;  3WIM A;  1YX6 B;  2W54 A;  3UI3 A;  3FIL B;  4F1S A;  1KH0 A;  1L0Y B;  1FXA A;  4RM8 A;  3B9J A;  2QMT A;  2G4D B;  4RMA A;  3WAN A;  2J0M A;  3V60 A;  4LNI A;  2UWQ A;  1OGW A;  3GE3 C;  3T3N A;  2RGF A;  4YWG G;  1TJE A;  1VZ7 A;  2J0J A;  1ET9 A;  3V61 A;  1FFV A;  4JGH B;  1OEY J;  1E8Y A;  2AYO B;  3Q8B A;  3RPF C;  2FIF A;  4IOI E;  1SJH D;  2DLB A;  3SU8 X;  1ACC A;  1DGJ A;  4MAC A;  3Q2A C;  4L1B A;  3PPA A;  1JQ4 A;  5JHA A;  4W9H A;  3IXS A;  1YJJ A;  2C7H A;  3Q14 C;  1WZ3 A;  2N0S B;  3CWI A;  1FEH A;  2V9H A;  3AU5 A;  2L32 A;  2N4F A;  4W9J A;  4HCP B;  1MHX A;  2K25 A;  1ZDV A;  2N9P C;  3EHV A;  3ML8 A;  3L54 A;  4TUU A;  2MHJ A;  2BW2 A;  2RSU A;  3DVG Y;  1V8C A;  2N9X A;  4PYU A;  2ASQ A;  2CU3 A;  2CJN A;  3L4P A;  2JF5 A;  3L0W B;  3ZTC A;  2CHZ A;  4AOF A;  2GOW A;  2L83 A;  4A3P A;  1MI0 A;  4GSW A;  3R2I A;  3UGB B;  2KXJ A;  3QAQ A;  4H2A A;  2W9N A;  2LGY A;  4MGZ E;  2AL6 A;  2ZW0 A;  4ZDV A;  4NY0 A;  3Q8C A;  4F8C B;  1SE4 A;  4EOY A;  2K9X A;  1C4C A;  3AE7 B;  3ZYY X;  3OWE B;  2EMS A;  1XQQ A;  1RM6 C;  2K0P A;  2WP9 B;  2V0G A;  2XN9 C;  2ICI A;  1HZ5 A;  2M4N A;  2WS3 B;  4LNF A;  1TZO A;  3U52 E;  2CS4 A;  2ZVO A;  3ZJU A;  3VRA B;  1MG8 A;  1C4P A;  2I1J A;  2LFI A;  2LRW A;  1UH6 A;  3P4Q B;  3N32 A;  3AE4 B;  4FUL A;  3ZIM A;  3RFZ B;  3A9K A;  2FCM A;  1IGC A;  3AM9 A;  3IAM 1;  3M95 A;  1I4R A;  4ICU A;  1GAQ B;  2D5G A;  2Z0E B;  5T8I A;  2IY0 B;  2G3Q B;  3J9C A;  2NCN A;  3VQI A;  3VR9 B;  3NVV A;  2BB6 A;  2QIL A;  1WR1 A;  4II2 B;  4ZOH C;  3SFD B;  2BWE S;  1C79 A;  2GBR A;  3BVG A;  4WJQ A;  1P7F A;  3UIO B;  4URK A;  1JRP A;  4US8 A;  2JQR B;  3A9K B;  4DQO C;  3PZD A;  1SIJ A;  3KYD D;  4S17 A;  2IJ0 A;  4K7U A;  5BYR A;  1ROE A;  2MSE D;  4BOZ B;  1WYG A;  4RF1 A;  2LUE A;  3H7S A;  4RGT A;  4CQN A;  1KM7 A;  4XWW A;  4FHK A;  4C56 C;  5EE9 A;  2MBB B;  2WXN A;  2ON8 A;  4LNK A;  4RGO S;  3QQ8 B;  3BK1 A;  1OFF A;  2W55 A;  4KX6 B;  2KTF A;  1PQS A;  2WU2 B;  1D6E C;  2IPK D;  5IA7 A;  5LNK 1;  1EWC A;  1P0R A;  3FKY A;  2FUH B;  1ZPS A;  3ZXV A;  4TQ1 A;  3NS8 A;  1UNS A;  2FCQ A;  3APD A;  4K7W A;  2BS2 B;  3VTW A;  4NAM A;  1YX5 B;  4OZC A;  4JX1 C;  3Q3O C;  3N1Z C;  4N9F 4;  1WXS A;  4KKI A;  2G9H D;  1N5W A;  1NYQ A;  5HI1 A;  2IO1 B;  2DZJ A;  4YT0 B;  3ML9 A;  3NS1 A;  5GMV A;  2DAJ A;  2WXJ A;  4IM0 A;  5GXG B;  1D3Z A;  3Q3F A;  5J2R A;  1WRD B;  4IUM B;  3QC8 B;  2UYZ B;  4MDK E;  3W2D A;  1WSP A;  3IG3 A;  3RCZ A;  2KFJ A;  4MM3 A;  1Y56 A;  1LXD A;  3GB1 A;  3ENE A;  5AUK A;  3MJW A;  5IP4 D;  2C5L C;  2Z8L A;  2GBN A;  4HVB A;  2IO0 B;  2WYQ A;  2BYV E;  1L0V B;  2LGI A;  4RGN A;  5E6N A;  1DOY A;  3TCA A;  2NR2 A;  3DBH B;  3VR8 B;  1WWT A;  1JWS D;  4A90 A;  4DWF A;  5LLI A;  1HQR D;  3VHT C;  3ZJT A;  2KYW A;  5FR6 A;  1NBF C;  2INC C;  1ZXH A;  4C80 A;  1ZE3 D;  4LDT D;  4MM3 B;  3IBE A;  1F2R C;  1FIQ A;  3ECI A;  4RCO A;  3MHS D;  2BYF A;  4WWP A;  4N58 A;  2J0K A;  2KDF B;  2RDH A;  2BT6 A;  3BII D;  5DPT A;  4UDU C;  1Q0W B;  1JRO A;  2BS3 B;  2MJ3 A;  3MTN B;  4XDC A;  1V97 A;  1F1H A;  2HDE A;  5AZF A;  4A3O A;  2YLM A;  5E6J A;  1WX9 A;  3IVF A;  1JWB D;  4IWQ A;  2D11 A;  4IWP A;  2V4L A;  3NY5 A;  1J7C A;  2KD0 A;  3AE6 B;  3AE2 B;  3A9J A;  3HVD A;  3PRP B;  1E9M A;  1WE6 A;  2HJ1 A;  1CQV A;  4GLS C;  4C4V A;  4DXF A;  2GB1 A;  2ZNV B;  1ZXI A;  3AEB B;  1E90 A;  3MP9 A;  2KC1 A;  4EZL A;  2LMC A;  4JE3 B;  3PHX B;  4WWN A;  5L95 C;  1SXT A;  5KHQ A;  1OEY A;  1TTN A;  1LGR A;  1TIF A;  1JCK B;  3MFG A;  2L00 B;  4P16 A;  2KWV B;  1XEE A;  3UQB A;  2Z59 B;  4MGI E;  3CSF A;  3AB5 A;  4BAX A;  4OHJ A;  3RZW C;  2KWD A;  3ZRF A;  4MGK E;  4AP4 C;  2R2Q A;  2FBW B;  2WU5 B;  2N9K A;  4C4V B;  2J53 A;  1E7U A;  1C76 A;  4NJ7 A;  3L08 A;  2FCS A;  1UEL A;  5DPW A;  3HUI A;  1RAX A;  2GMI C;  3MC9 A;  2PW9 A;  4HWI B;  1VR9 A;  3TUO A;  1IGD A;  3TSS A;  3NRZ A;  4KDL B;  2Y5B B;  3JSV A;  5C3J B;  2BVC A;  3AMZ A;  2G4S A;  3KW5 B;  2PE6 B;  3LB8 C;  4A55 A;  3V6E B;  2K8C A;  1V2Y A;  2MJE A;  2QCZ A;  1JWA D;  2IDY A;  4LCD E;  4W9E A;  3B0A A;  4HRS A;  4JWU C;  2PJH A;  3C0R B;  3T8M A;  4WJP A;  1QOB A;  1E5W A;  3GOE A;  2KMA A;  2LJI A;  4KSL C;  1JAL A;  1FPY A;  1YJI A;  2LXC A;  1NI3 A;  5KHO A;  4MH8 A;  3U7Z A;  2KFK A;  3B08 A;  1DOI A;  5IO9 A;  2LJ5 A;  2WXL A;  2KJR A;  3LXF A;  3AI5 A;  2BBC A;  3KQ4 A;  2DHZ A;  3Q8E A;  4HRO A;  4HDO A;  2RDB C;  2WGS A;  4FJY A;  2I1K A;  3M62 B;  3VUW A;  2PE9 A;  4ZRP A;  5H8Y E;  4C00 A;  1V49 A;  2KFK B;  2IY1 B;  4BKG A;  4DHJ B;  1F52 A;  2PIA A;  5C2T B;  3GZN I;  5BMI A;  1EU4 A;  2CHW A;  1E10 A;  3RI7 C;  4C7Y A;  1VD2 A;  1V80 A;  1Y8R C;  2DZI A;  5AZG A;  2TSS A;  3RYT A;  3CMM B;  2WXH A;  5HKH A;  1WGG A;  3U8Z A;  2K3U A;  1X1M A;  2NPT A;  4KSK C;  1STE A;  3OJ3 A;  1YOV B;  2IGD A;  1E6E B;  3NG0 A;  1FCC C;  1GTH A;  3PZ8 A;  1FRD A;  2VRR B;  3IAS 1;  3Q69 A;  4WUR A;  2LEK A;  4P6V F;  2KAN A;  3P2B A;  2MJD A;  2JZP A;  2KLC A;  3ZGZ A;  4M8M A;  5DCN A;  2FNJ B;  2M56 B;  2K22 A;  1KLG D;  1V5O A;  2PKO A;  3DBS A;  4MJS A;  2LGX A;  4D2K A;  4O1N A;  4YSY B;  3RNF C;  1QOG A;  4FHJ A;  1FXT B;  4BVU C;  3E9S A;  4GDK A;  3GE8 C;  2NPT B;  1LFD A;  2NTT A;  3QHT A;  1TKE A;  1HE8 A;  3N20 C;  2KQ7 A;  4AS1 A;  3KUC B;  1WF9 A;  3ZQ4 A;  4HJK A;  4REZ A;  3C8Y A;  2KMM A;  3RUL A;  3W9C B;  1WXM A;  2RPV A;  3U2S C;  2O2V A;  1SSN A;  2LHE A;  2BB5 A;  1XT9 B;  4DXA B;  1WZ0 A;  1L2N A;  4HKQ A;  2N1W A;  5CTR C;  5G2N A;  4GDK B;  3NVY A;  2KKC A;  3H9D A;  1D5M C;  4W9L A;  1LM8 B;  3RN9 C;  4MSM B;  3ETR A;  2KWC A;  1V86 A;  3HM3 A;  1ZUD 2;  1B9R A;  1MJD A;  4YXD B;  1SIF A;  3L16 A;  2KTR A;  1CZP A;  2O2V B;  3IT6 B;  3ZRC A;  2HE7 A;  3H7P B;  4XWT A;  4DHZ E;  2KOX A;  2N7D A;  3GZN B;  3A33 B;  4K81 A;  2DX5 B;  4DDI D;  1E7V A;  4US9 A;  1AWD A;  4WAF A;  3HRD D;  2M0A A;  2Z0D B;  2MBH A;  2LGD A;  3ZO5 B;  3V6C B;  2CR5 A;  4W9F A;  2KLG A;  1MPE A;  2A4Z A;  1UBQ A;  2KZR A;  3BK2 A;  2BQQ A;  1C3T A;  2LD9 A;  1OTR B;  3RD2 A;  1YQ3 B;  3N1X C;  2WDR B;  3BYT B;  3JYU A;  3I63 C;  2B76 B;  2KK8 A;  4B9K A;  4HCN B;  5EE1 A;  3W1S A;  1A5R A;  4HJG E;  2J7Q B;  3EFU A;  5HG2 A;  2JVC A;  5BMG A;  1M94 A;  2B3A A;  2KWU B;  3HHM A;  4ASW C;  1HTQ A;  2R2O A;  4USA A;  3PGE A;  1WJ4 A;  5I4D A;  1HEZ E;  2L1A A;  2MCN B;  1P9D U;  1UZX B;  2ONQ A;  2HTH A;  4N59 A;  3PO0 A;  4A8X C;  3ALB A;  1L7Y A;  1TS4 A;  3AXC A;  1TZ1 A;  1JWU D;  4GMV A;  1F2R I;  3PHW B;  3BWU D;  2CHX A;  2DZK A;  1PGX A;  4GN1 A;  4GB9 A;  2LVO A;  4YSX B;  2JRI B;  2LVP A;  1WJN A;  2K8B A;  2KT7 A;  3AE1 B;  3VTU A;  1P98 A;  1WGY A;  1KOT A;  4XX5 A;  4B0M A;  1F77 A;  4RF0 A;  4EUT A;  3TEX A;  3VH3 B;  2C7N B;  2BYE A;  1EF5 A;  1ZP0 B;  1YNT E;  1YJ1 A;  2LAS A;  5JXV A;  3TEW A;  3AEC B;  1GJZ A;  2QDF A;  4LJP B;  3OAW A;  2BPS A;  3W5V B;  5LXI B;  5AEK B;  1CJE A;  2WXG A;  4W9I A;  3LJ3 A;  4ZYN A;  1QKZ A;  3N9Y C;  3RNA C;  3VTV A;  1YN5 A;  2CU1 A;  3HVZ A;  1SB3 C;  3V3X A;  1FD6 A;  3APF A;  2N9L A;  1RYJ A;  1AW7 A;  4NQL B;  2IO2 B;  1N6Z A;  4IM3 A;  3P1M A;  2LVQ A;  1NEK B;  4GOC A;  2EKE C;  3NZS A;  2JX5 A;  1WX7 A;  2KDB A;  2V3P A;  3PSE B;  1I4G A;  2IYD B;  3BYY B;  1EUV B;  3ZTD A;  2KHW B;  4KIK A;  3AEA B;  3QK0 A;  1IBX A;  2LGS A;  3P42 A;  1NVI D;  3VVW B;  2KN5 A;  2QSD A;  4G11 A;  4WJO A;  5HFY A;  2JRH A;  5MPO A;  1I4P A;  1N62 A;  2FID A;  1IYF A;  2OJR A;  2PMV A;  4ACF A;  4I6N B;  4GGQ A;  4FAD A;  1VJK A;  3P4S B;  1Z2M A;  2ZCC A;  4PS7 A;  2GLS A;  4AUQ C;  4KIK B;  5D3D A;  3EC8 A;  1GUA B;  3K9P B;  5D94 A;  3SDL C;  2ZPN A;  1L0X B;  2H88 B;  3MC0 B;  1XD3 B;  1E8Z A;  1J19 A;  5CX3 A;  1SE3 A;  2WXP A;  2W3S A;  2KQS A;  1WXV A;  3O13 A;  3A1Q A;  3AE3 B;  1I4X A;  4CO7 A;  4XC2 A;  1D5X C;  4RM9 A;  3DBL I;  1DOX A;  2QHO A;  2BGF A;  3RNB C;  4RH6 A;  2X8X X;  4EFO A;  1NDD A;  4KZC A;  1XXG A;  1TS2 A;  3EA6 A;  1ENF A;  4L2Y A;  2WXF A;  3NJT A;  2V3S A;  2WX1 A;  3EEC A;  4FA6 A;  3VDZ A;  2KMC A;  1GB4 A;  4L23 A;  3SR6 A;  4S0R A;  4ZHO A;  1WH3 A;  4HLE A;  4LTU A;  1L5P A;  3DWG C;  3L13 A;  3H6N A;  3A1Q B;  2BS4 B;  2KC2 A;  3DVG X;  3DQV A;  2RDG A;  2K1F A;  4I6L B;  5LXH A;  1RLF A;  1WM3 A;  4DXG A;  1QLB B;  1PDX A;  2WDQ B;  2ZVN A;  2LI5 A;  4MGY E;  4OVV A;  3ZDM C;  4TQ0 A;  3DBR I;  1TGZ B;  4CHK A;  3JVZ X;  2ZJD A;  1SE9 A;  4IG7 B;  1KTK A;  1XF5 L;  3R2T A;  5IAA C;  3ZXR A;  1GOZ A;  1HTO A;  5G55 A;  4ZHP A;  5AZH A;  4WQO B;  1V81 A;  4BKT A;  1KFY B;  1WRI A;  1HA5 A;  4A6Q A;  5EE3 A;  1TS3 A;  1Q5W B;  3KWL A;  4BKS D;  1G6J A;  1FMA D;  4BOS C;  3PRM B;  2ZCB A;  3P4R B;  1SJE D;  4KGS A;  4NAW A;  3A4S C;  4M00 A;  2FE8 A;  3KUD B;  3GP7 A;  3E56 A;  1LO5 D;  1R4N I;  1YN3 A;  1MHH E;  2IZV B;  2J52 A;  3KWV A;  4YTP B;  2G45 B;  4WJN A;  4E71 A;  1I7H A;  4JWS C;  1S3S G;  1VCB A;  1R4M I;  1OQY A;  1TKY A;  4ZRJ A;  1TBE A;  3B1L X;  3A4R A;  3WAP A;  3AH7 A;  3MJ5 A;  2JY6 A;  4E74 A;  4G50 A;  2D2Q A;  4BBN F;  2GI9 A;  3A9J B;  2N1V A;  1C1Y B;  5DPR A;  1GNU A;  2RR9 A;  4Q2J A;  1QT9 A;  2J42 A;  2O6V D;  3HM6 X;  1NI2 A;  4KZ0 A;  3R7R A;  1H4R A;  5D6J B;  2MBE A;  3DBL B;  4HPP A;  5AUI A;  1T6B X;  2BWF A;  2FUG 1;  2MLB A;  1OQQ A;  1K51 A;  3R8B A;  1UD7 A;  3CF6 E;  3QA8 A;  1ZOY B;  2JUO A;  3Q3J A;  1XLP A;  5G5G A;  3U4E G;  1TKG A;  4MEL A;  4XGA B;  3DHI C;  4YSZ B;  1QIL A;  1WY8 A;  2XBB C;  4HPM B;  1VLB A;  2L52 A;  5BYS A;  2LXA A;  5C1Z A;  3NUH B;  4K3C A;  1WYW B;  2ZPY A;  2ZNV C;  4GXB A;  4KV2 A;  1EWY C;  4RFB A;  2AEH A;  5L83 A;  1S1Q B;  2ZW1 A;  4E3C A;  4J3O D;  1UGM A;  2PEA A;  3QJZ A;  4DBG A;  1GPX A;  2QIE B;  4MEM A;  2DYB A;  2IO3 B;  2V4I B;  4W9D A;  4ZYS A;  2WX0 A;  1L6U A;  3JSV B;  1YQB A;  2Y5C A;  1XO3 A;  4EE2 A;  2XK5 A;  4DDG D;  5BYQ A;  4J6I A;  1FO4 A;  2KO3 A;  4B95 A;  5E6O A;  3MHZ A;  2INN E;  4WAA A;  1TY0 A;  1VZ8 A;  3URY A;  1UF0 A;  1H8C A;  1FNU A;  2JU6 X;  2Y5P A;  2WHI A;  2WXI A;  4NPN A;  5JZE B;  3BZD B;  4TV3 A;  1QOF A;  1YD8 U;  2JYE A;  1V1O A;  2FCN A;  4FLH A;  2VZK B;  4OZB A;  1QOA A;  3VXW A;  2NVU I;  1N60 A;  2L0T A;  2AWT A;  3ZDT A;  1R4N B;  2WLB A;  3SFE B;  2RMM A;  3VRB B;  2K39 A;  1AN8 A;  1BXT A;  2SEB D;  3T3O A;  2WNM A;  3ZW3 A;  1AAR A;  2KQ4 X;  1J8C A;  1T3Q A;  5TSS A;  2KN4 A;  2XNA C;  1UWX A;  1V6E A;  4IDI A;  5JHB A;  4K1R B;  1FFU A;  4XE0 A;  3WA0 A;  1PUT A;  4JL9 A;  2L05 A;  2E6X A;  4W9K A;  2YEP F;  2SAK A;  3ONS A;  1SE2 A;  5J17 A;  4P1C C;  2KAJ A;  5EE0 A;  2WXQ A;  3Q3N C;  2I38 A;  2YVC A;  4K3B A;  1JML A;  3RZF A;  1GC7 A;  1V1P A;  2MEK A;  2Q5W D;  3AE5 B;  3WAO A;  1C4A A;  1UGJ A;  1Z5S B;  2DNF A;  1K50 A;  2MWS B;  3I5J C;  1T0Y A;  4I6P A;  5C23 A;  4EKU A;  3DWM A;  1P1A A;  3ZUN A;  3AE8 B;  1T0Q C;  1UBI A;  2RD0 A;  3UIN B;  1VRA B;  2BYT A;  4M01 A;  2NTS A;  2D07 B;  4MJS B;  4A20 A;  3PRE A;  1GC6 A;  2BKF A;  4W9G A;  4KGR A;  2CKH B;  3EGR A;  3N3K B;  1K8R B;  4EEW A;  1CK1 A;  3IHP C;  1MFW A;  2GRI A;  4RNA A;  4GU2 A;  1WFY A;  1PGB A;  4MSQ B;  1E8X A;  3ZNZ B;  4JQW C;  3VFK A;  1BT0 A;  2N9E B;  1J0G A;  5FR3 A;  4B6W A;  3VAW A;  3I3T B;  4LNO A;  2RPQ A;  3ZVV A;  1GB1 A;  4EZJ A;  1Q10 A;  4AQ7 A;  1VZ6 A;  3N30 A;  2H89 B;  1TT5 B;  4DK5 A;  3DHG C;  1L4Z B;  4LNN A;  2DWQ A;  2J4X A;  1MVK A;  3TMP B;  3RT3 B;  4KDI C;  1KLV A;  2KTR B;  3DVN V;  2AL3 A;  4NJ6 A;  1I35 A;  1L6V A;  4OW0 A;  1HZ6 A;  2WWZ A;  1NEN B;  3DCG A;  1FM0 D;  4WWM A;  1C77 A;  4AJW A;  2KX3 A;  3TIX A;  5CHF A;  4OZA A;  4WIP A;  1D4B A;  4PT5 A;  2DYM A;  1WI0 A;  2KX0 A;  3KYC D;  2Y3A A;  2JSV X;  4IC7 B;  2GBK A;  4YTN B;  3W1Y A;  1M4V A;  1E7P B;  1TS5 A;  1XLQ A;  2QC8 A;  3SEB A;  4FJZ A;  3PLV A;  4ICV A;  2DEN B;  2BKR B;  1TYG B;  3BY4 B;  3VUX A;  3RNG C;  4IWO A;  3NZU A;  1YN4 A;  2OED A;  1QZE A;  1FNW A;  2OOB B;  4FN2 A;  2LRU A;  1EU3 A;  1P3Q U;  4CYE A;  4ARC A;  2JWU A;  1TY2 A;  4TMA B;  4PK1 A;  3H8H A;  2M8S A;  1EF1 A;  2IBI B;  5J18 A;  3APC A;  4BFR A;  5BO4 B;  1JRU A;  1I4H A;  3X0W A;  2KVR A;  3KUZ A;  4GDL A;  1YMH E;  3H1U A;  3OG5 A;  4YL8 A;  2HTM E;  4OVU A;  4HXD A;  2W82 A;  4YTM B;  4A9A A;  3VH4 B;  4ZRK A;  3PRZ A;  3TEY A;  1V9J A;  2M0X A;  2MBO A;  3ZJV A;  1PYW D;  3ZKJ C;  4MT5 A;  2MH7 A;  4WQM A;  4JLC A;  1UWM A;  1F9J A;  4GDL B;  3M63 B;  3QCA A;  1WX8 A;  3OJ4 B;  2BTE A;  4PS8 A;  1WJU A;  3Q3M C;  3RMK C;  2REX A;  1BML C;  3DPD A;  2EMT A;  4TSS A;  4HK2 A;  3AV8 A;  3DBH I;  2D3G A;  2R61 A;  3P63 A;  4G0N B;  4ANU A;  1JW9 D;  2V1Y A;  3W1S C;  3DVN U;  3N1Y C;  5D7G A;  3Q8A A;  2AQ3 B; 
#chains in the Genus database with same CATH homology
 1ACC A;  1DGJ A;  2WXK A;  4MAC A;  4L1B A;  1JQ4 A;  3P4R B;  2PIA A;  5C2T B;  1SJE D;  4KGS A;  2DYO A;  5BMI A;  1EU4 A;  1K52 A;  3B2G A;  3IXS A;  1E10 A;  1NYR A;  1YJJ A;  2FE8 A;  2N0S B;  3CWI A;  4C7Y A;  3GP7 A;  4LLG M;  1FEH A;  3E56 A;  1J7B A;  2TSS A;  1D5Z C;  4M0W A;  1LO5 D;  3BVZ A;  2L32 A;  1YN3 A;  1MHH E;  2J52 A;  1MHX A;  1ZDV A;  3KWV A;  4YTP B;  2WXH A;  3AEG B;  2INP E;  1I7H A;  4JWS C;  1ET6 A;  2BW2 A;  1V8C A;  1TKY A;  2CU3 A;  2CJN A;  2K3U A;  3L4P A;  1RFK A;  1STE A;  2IGD A;  1EM7 A;  3AH7 A;  3MJ5 A;  1E6E B;  1FCC C;  2L83 A;  1GTH A;  2GI9 A;  3PZ8 A;  1FRD A;  3IAS 1;  1IBX B;  3Q69 A;  4WUR A;  2LEK A;  4P6V F;  1MI0 A;  2MJD A;  2JZP A;  4Q2J A;  3R2I A;  2AQ1 B;  1QT9 A;  2J42 A;  4H2A A;  3ZGZ A;  2ZW0 A;  2M56 B;  2K22 A;  3Q8C A;  1L4D B;  1KLG D;  2PKO A;  2WXM A;  2QEJ C;  1SE4 A;  4D2K A;  5AUI A;  1T6B X;  2FUG 1;  4O1N A;  2K9X A;  4YSY B;  1OQQ A;  1C4C A;  3AE7 B;  1K51 A;  3ZYY X;  2PVG C;  3FAH A;  1QOG A;  3R8B A;  3OWE B;  3E9S A;  4HEA 1;  2EKI A;  1ZOY B;  1RM6 C;  2K0P A;  3NZ3 A;  2WP9 B;  1XLP A;  5G5G A;  3U4E G;  1TKG A;  2NTT A;  2ACZ B;  1TKE A;  4YSZ B;  2V0G A;  2XN9 C;  2ICI A;  1HZ5 A;  1QIL A;  4AS1 A;  1OQR A;  1VLB A;  2L52 A;  5BYS A;  2WS3 B;  1TZO A;  3U52 E;  1VDV A;  3ZQ4 A;  3NUH B;  4REZ A;  3C8Y A;  5FKA C;  2KMM A;  3ZJU A;  1KF6 B;  3W9C B;  3VRA B;  2RPV A;  1C4P A;  2LFI A;  1EWY C;  3P4Q B;  4RFB A;  3U2S C;  2ZW1 A;  3AE4 B;  1SSN A;  1WXQ A;  2LHE A;  2BB5 A;  4J3O D;  3RFZ B;  1IGC A;  3AM9 A;  3IAM 1;  1H7W A;  4HKQ A;  1GPX A;  1I4R A;  2QIE B;  2V4I B;  4ZYS A;  1GAQ B;  1B1Z A;  2D5G A;  3KLS X;  3NVY A;  4GDK B;  5T8I A;  2PTL A;  5H92 C;  2E3T A;  1L6U A;  3J9C A;  2Y5C A;  1D5M C;  4ARI A;  3VQI A;  1XO3 A;  3VR9 B;  3NVV A;  2BB6 A;  2QIL A;  4EE2 A;  4ZOH C;  1XCT L;  3SFD B;  5BYQ A;  3ETR A;  1C79 A;  1FO4 A;  1ZUD 2;  5HHD G;  1B9R A;  4YXD B;  3BVG A;  3MHZ A;  2INN E;  1TY0 A;  1P7F A;  1VZ8 A;  3URY A;  3IT4 B;  1JRP A;  1CZP A;  1FNU A;  1SF0 A;  1RWS A;  3IT6 B;  4US8 A;  2JQR B;  2JU6 X;  4DQO C;  2Y5P A;  4XWT A;  1SIJ A;  2WXI A;  2IJ0 A;  1I4Q A;  3BZD B;  5BYR A;  1ROE A;  1QOF A;  2JYE A;  1FXI A;  1V1O A;  1WYG A;  2K5P A;  3AED B;  4RF1 A;  4US9 A;  1AWD A;  2VZK B;  4OZB A;  1QOA A;  4RGT A;  4WAF A;  1N60 A;  3HRD D;  4CQN A;  2M0A A;  4XWW A;  4C56 C;  2WLB A;  2WXO A;  5EE9 A;  3SFE B;  2WXN A;  2ON8 A;  4RGO S;  2RMM A;  4XDD A;  3BK1 A;  1OFF A;  2W55 A;  3VRB B;  4KX6 B;  2WU2 B;  1AN8 A;  3Q8F A;  1BXT A;  1FNV A;  1D6E C;  1MPE A;  2SEB D;  1XCQ L;  2IPK D;  3T3O A;  2WNM A;  3BK2 A;  5LNK 1;  1QF6 A;  1EWC A;  2KQ4 X;  1PGA A;  4KGT A;  1ZPS A;  1T3Q A;  5TSS A;  1YQ3 B;  2KN4 A;  2XNA C;  2JXT A;  2WDR B;  3BYT B;  4TQ1 A;  3NVW A;  1UWX A;  2M19 A;  2B76 B;  2NMQ A;  1UNS A;  4IDI A;  1FFU A;  4XE0 A;  5EE1 A;  2BS2 B;  1PFD A;  3W1S A;  1F0Z A;  1PUT A;  4HJG E;  1N63 A;  4NAM A;  1XLO A;  2E6X A;  5HG2 A;  2YEP F;  4OZC A;  2SAK A;  5BMG A;  4JX1 C;  4NJC A;  4NAW B;  2WDV B;  1SE2 A;  2N7J A;  4N6E B;  4LK0 M;  2KAJ A;  4KKI A;  2G9H D;  5EE0 A;  2WXQ A;  2EEL A;  1N5W A;  4USA A;  1NYQ A;  2I38 A;  5HI1 A;  2PLP A;  4YT0 B;  3NS1 A;  1JML A;  5I4D A;  4JPS A;  1E0Z A;  1HEZ E;  2L1A A;  2WXJ A;  2LUM A;  1V1P A;  2ONQ A;  2MEK A;  2Q5W D;  4ZRQ A;  1WGK A;  3AE5 B;  5GXG B;  4N59 A;  3PO0 A;  4A8X C;  1C4A A;  1UGJ A;  4R3D A;  1TS4 A;  2JYT A;  5BMH A;  4C7Z A;  1JWU D;  1K50 A;  1SEB D;  1F2R I;  1FRR A;  1BUI C;  3BWU D;  3W2D A;  1WSP A;  3AEE B;  1FCL A;  3B2F A;  3DWM A;  1IUE A;  1Y56 A;  2VZK D;  1PGX A;  3AE8 B;  2W3R A;  3GB1 A;  2V3N A;  1YQ4 B;  1UUP A;  1VRA B;  5AUK A;  2BYT A;  4IKG A;  3W5U B;  2AX5 A;  4YSX B;  2NTS A;  2Z8L A;  1QQR A;  3AE1 B;  1L0V B;  2LGI A;  4RGN A;  4KGR A;  3EGR A;  3I57 A;  1DOY A;  1AYF A;  1CK1 A;  4B0M A;  3VR8 B;  1WWT A;  2WQY B;  1JWS D;  3WCQ A;  1F77 A;  4RF0 A;  2GRI A;  4A90 A;  1C78 A;  4ITK A;  4RNA A;  3TEX A;  3V05 A;  1HQR D;  1ZP0 B;  1YNT E;  3ZJT A;  5JXV A;  1PGB A;  3TEZ A;  3TEW A;  3AEC B;  1ZXH A;  4C80 A;  1ZE3 D;  3W5V B;  4MM3 B;  1F2R C;  1FIQ A;  2G1E A;  1CJE A;  2WXG A;  5FR3 A;  4RCO A;  5FK9 C;  1N5X A;  4N58 A;  1QKZ A;  3N9Y C;  1YN5 A;  3HVZ A;  1SB3 C;  2RDH A;  1A70 A;  3V3X A;  1FD6 A;  2BT6 A;  3BII D;  2KAC A;  4B0E A;  4KKJ A;  1KRH A;  2N9L A;  5G5H A;  1GB1 A;  4UDU C;  1Q10 A;  4WH4 A;  1RYJ A;  1AW7 A;  1VZ6 A;  4AQ7 A;  2H89 B;  1JRO A;  2BS3 B;  1L4Z B;  1K53 A;  1NEK B;  3P1M A;  2MJ3 A;  2LHD A;  3CF4 A;  4XDC A;  2DWQ A;  1V97 A;  4FXC A;  2JX5 A;  2J4X A;  2HDE A;  2YEP B;  3PZ7 A;  1MVK A;  1JWM D;  2V3P A;  1ESF A;  5H8Y E;  1I4G A;  5E6J A;  1JWB D;  2OHF A;  3BYY B;  1L6V A;  1J7C A;  1GT8 A;  4OW0 A;  1GTE A;  1HZ6 A;  1NEN B;  1FM0 D;  4WWM A;  1C77 A;  3AE6 B;  4NZL B;  3AEA B;  3AE2 B;  4OZA A;  3AEF B;  4WIP A;  1D4B A;  1IBX A;  3HVD A;  1E9M A;  1CQV A;  4PT5 A;  2DYM A;  4GLS C;  3P42 A;  1NVI D;  4DXF A;  2GB1 A;  2Y3A A;  2JSV X;  2QSD A;  1ZXI A;  3AEB B;  3LYY A;  3MP9 A;  5HFY A;  2I2Y A;  3P4P B;  4YTN B;  5MPO A;  1I4P A;  2LMC A;  4JE3 B;  1M4V A;  1E7P B;  1TS5 A;  1XLQ A;  3SEB A;  1N62 A;  4OVZ A;  1SXT A;  2DBY A;  3BVM A;  1SBB B;  1H7X A;  3I9V 1;  1TYG B;  1JCK B;  3MFG A;  2PMV A;  3GS2 A;  4P16 A;  1XEE A;  1YN4 A;  1VJK A;  2OED A;  3P4S B;  1FNW A;  2QJL A;  3NVZ A;  1EU3 A;  3AB5 A;  4ARC A;  2JWU A;  1TY2 A;  5D3D A;  4TMA B;  4OHJ A;  2X38 A;  2CJO A;  2KWD A;  3H8H A;  2FBW B;  1L0X B;  2H88 B;  2WU5 B;  2N9K A;  3MC0 B;  1SE3 A;  2WXP A;  1I4H A;  2J53 A;  1KLU D;  3AE9 B;  1C76 A;  2W3S A;  1YMH E;  1ZDX A;  3HUI A;  3O13 A;  1C9F A;  3AE3 B;  2PW9 A;  4RGM A;  2KDM A;  1VR9 A;  1I4X A;  2HTM E;  3TUO A;  1D5X C;  2AQ2 B;  3FIL A;  3ABV B;  1IGD A;  2IGG A;  1DOX A;  2IGH A;  3TSS A;  3NRZ A;  2W82 A;  4RH6 A;  3EUB 2;  5C3J B;  1T5X D;  4YTM B;  4A9A A;  1J7A A;  2PVO D;  3AMZ A;  2WXR A;  3AN1 A;  5D3I B;  1XXG A;  1TS2 A;  3EA6 A;  3TEY A;  1ENF A;  4L2Y A;  3CIR B;  1XLN A;  1V1P B;  3LB8 C;  2WXF A;  1N61 A;  4HKZ E;  4A55 A;  3ZJV A;  1PYW D;  4MT5 A;  2MJE A;  1DYQ A;  1P7E A;  2MH7 A;  1GB4 A;  4L23 A;  1HXY D;  4WQM A;  1UWM A;  1JWA D;  3SR6 A;  2IDY A;  4ZHO A;  4GDL B;  3FC4 A;  4LTU A;  1L5P A;  3DWG C;  4HRS A;  4JWU C;  1R7S A;  1QOB A;  2BS4 B;  2W54 A;  2RDG A;  2BTE A;  3UI3 A;  3FIL B;  2LJI A;  1JAL A;  1YJI A;  4DXG A;  1KH0 A;  1NI3 A;  1L0Y B;  4MH8 A;  1BML C;  3U7Z A;  1FXA A;  1QLB B;  1PDX A;  2WDQ B;  1DOI A;  3B9J A;  2QMT A;  2WXL A;  4TSS A;  4TQ0 A;  3LXF A;  3AV8 A;  3KQ4 A;  2BBC A;  2R61 A;  1KTK A;  1XF5 L;  3R2T A;  3Q8E A;  3T3N A;  3P63 A;  4HRO A;  1GOZ A;  4YWG G;  1TJE A;  4ZHP A;  1VZ7 A;  1JW9 D;  1KFY B;  1WRI A;  1HA5 A;  1ET9 A;  4A6Q A;  1FFV A;  5D7G A;  5EE3 A;  1TS3 A;  3Q8B A;  3Q8A A;  3RPF C;  2AQ3 B;  4IOI E;  1SJH D;  2DLB A;  3KWL A;  4ZRP A;  1FMA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...