3AEAB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aeaB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aeaB01
3P1MA 4KX6B 2WDQB 2Q5WD 3AEEB 1DOXA 1XO3A 2WU2B 1RWSA 1XLQA 1L6UA 2OHFA 1RM6C 3DWGC 2BS2B 4JWSC 3CWIA 3VR8B 3VRAB 1SB3C 3B2GA 3LXFA 5EE3A 2MH7A 1JWAD 1PFDA 1QOBA 1E10A 1JRPA 1E7PB 1YJJA 3P4PB 1QT9A 3NS1A 5AUKA 1JW9D 1TKGA 5G5GA 2MJ3A 3NVWA 3AEGB 1DGJA 1ZOYB 1YQ3B 1NYQA 2CU3A 2B76B 3AM9A 4YSYB 4WWMA 5GXGB 3AE6B 2FBWB 1GTHA 4YTPB 3AB5A 3HUIA 3AEAB 2K5PA 4N59A 4P6VF 2L52A 3AE1B 3AE2B 3AEFB 3EUB2 3HRDD 4ZHPA 1L5PA 1NYRA 1R7SA 2KMMA 1OFFA 1AYFA 1WYGA 5EE9A 3W9CB 4US9A 1TKYA 3VR9B 3AE9B 1TYGB 1XLNA 1FRDA 4ITKA 5MPOA 1OQRA 1SF0A 1KF6B 3AN1A 3CIRB 1ROEA 1QLBB 2E3TA 2PIAA 3BIID 1I7HA 3L4PA 3AMZA 1KRHA 1FXAA 4C7YA 4JWUC 3AE7B 2WS3B 4WQMA 1NVID 2WQYB 1V8CA 3NVZA 1ZXIA 1QF6A 4YSXB 2PVGC 1YJIA 3LB8C 1JALA 1H7XA 1FXIA 1T3QA 4US8A 2W55A 3FC4A 2WDVB 1WRIA 1QOFA 5EE0A 1J7AA 1NENB 1N5XA 3SFEB 1E6EB 3AE4B 3W5UB 1DOYA 3FAHA 1N62A 4IDIA 1JQ4A 1GTEA 2K9XA 3B2FA 3AE3B 1J7CA 3AE5B 1FFVA 5C2TB 1QOAA 5C3JB 1NEKB 4YTNB 5G5HA 1NI3A 2WU5B 1WGKA 2DWQA 2M19A 3B9JA 3P63A 3RPFC 4C80A 4N6EB 2QIEB 1PDXA 3ABVB 1EWYC 1TKEA 1FMAD 2JX5A 1N63A 5H92C 1RFKA 1A70A 1WXQA 4YSZB 3HVZA 1GT8A 4HRSA 1J7BA 4A9AA 1KFYB 2LEKA 3AECB 2CJOA 3ETRA 1F0ZA 3AH7A 4HROA 2H89B 2EKIA 1TJEA 1E0ZA 2G1EA 1GAQB 3NVYA 1YQ4B 2W3SA 4YXDB 2L83A 3SFDB 2H88B 3AEDB 3PO0A 2BS3B 2CJNA 1L6VA 1CJEA 1RYJA 2MJEA 1N5WA 1FRRA 1XLPA 5AUIA 1DOIA 4ZOHC 3ZYYX 3P4QB 1H7WA 4FXCA 1GPXA 1JWBD 2QJLA 3NVVA 5EE1A 3AV8A 1E9MA 1FFUA 3WCQA 1OQQA 2DBYA 4USAA 5H8YE 2PVOD 4JX1C 2HTME 2JQRB 1N60A 2K22A 1QOGA 3KWLA 3CF4A 1ZUD2 1VJKA 1V97A 2W3RA 1XLOA 1B9RA 3AEBB 2N0SB 1WWTA 4C7ZA 2Y5CA 3AE8B 2WLBA 2WP9B 1VLBA 1N61A 1IUEA 1L0VB 4YT0B 2M56B 4N58A 1UWMA 1ZP0B 3DWMA 1AWDA 4ZHOA 3P4SB 1FO4A 4YTMB 2ACZB 1FM0D 1PUTA 1VDVA 2KAJA 2WDRB 3VRBB 1FIQA 1CZPA 1SIJA 3P4RB 2AX5A 3NRZA 2BT6A 3W5VB 1JROA 2MJDA 2W54A 4LTUA 3SR6A 2BS4B 2PKOA
chains in the Genus database with same CATH superfamily
1T0RC 3X0WA 3H1UA 2KO3A 1C76A 4M0WB 1NDDA 3Q8AA 3K9OB 2X38A 2MH7A 1MJDA 3DBLB 1YJ1A 4LK0M 1F9JA 2KNBA 4GOCA 2QEJC 2NMQA 2L52A 2WX1A 4HPMB 5EE9A 3IXSA 1TKYA 1P7EA 3BVZA 3DBRI 4ITKA 1P9DU 3PRMB 4OZCA 3VAWA 1WM2A 2WDTB 3BIID 2IDYA 2L32A 3FC4A 1D3ZA 3ZRCA 4EUTA 4IDIA 1ACCA 2KN4A 3MP9A 3KYDD 5C2TB 4MJSB 2WXQA 1K51A 2M4NA 4OVVA 3BYYB 2IO0B 4C80A 2KHWB 1WIAA 3A9JB 4AWJA 3ZDTA 1A70A 3UI3A 1F1HA 1E0ZA 1I4RA 2KQ4X 3SFDB 2LZ6A 2MBBB 3DPDA 2FCQA 2QJLA 4YL8A 2XEWA 4C4VB 2K22A 2IGHA 3N32A 1Z5SB 5CHFA 1A5RA 1NI2A 1ZKHA 3Q3NC 1FNVA 5TSSA 1ZP0B 1FO4A 2CU1A 3GOEA 3HM3A 3W5VB 2W54A 1V49A 3TJPA 1B1ZA 1RWSA 2DZMA 3GE3C 1C4PA 1E7PB 1YJJA 1JW9D 2WXIA 3IG3A 1MHHE 4RCOA 2KT7A 3HUIA 1HZ5A 3V05A 3N9YC 3R7QA 2ZJDA 1OQRA 2M8SA 2M1MA 5JHAA 5CHWA 2GB1A 3ZQ4A 2MP2B 1ZXIA 1R4MI 4AJYB 2KTRB 5CTRC 5LXHA 2BKRB 2WXGA 3SFEB 1HE8A 1N62A 2XN9C 3EFCA 2AL3A 1SEBD 1E8XA 2L76A 2FAZA 3P63A 1WGYA 3KLSX 1EWYC 4KGSA 4HDOA 3RT3B 3UIPB 3OAWA 3I3TB 4XWWA 4TQ1A 2JY6A 1H8CA 2JT4B 3PSEB 4NZLB 2LGYA 1TS2A 1WGDA 3UF8A 2V0GA 1WGHA 3A1QB 1DOIA 4FADA 2FUHB 3PS6A 5J2RA 3EHVA 4A3PA 1ZUD2 2INNE 3ZXVA 2DAFA 2J42A 2BYVE 4M01A 2GLSA 2JZPA 4ZDVA 2X8XX 3RNGC 1UELA 4ANUA 2GMIC 3P1MA 4FBJB 2GOWA 3Q3MC 4WURA 4HLEA 2YEPB 2NPTB 5LLIA 3PLUA 2VRRB 4NNJB 4GMVA 1NYQA 3CMMB 4KKJA 4YSYB 4WJQA 2KMCA 1GOZA 1XCQL 3Q8CA 2K8BA 2A5UA 4GSWA 1P98A 1ET9A 4DQOC 3QK0A 1QLBB 1SE3A 2NBWB 3ZTDA 2KACA 3R8BA 4ASWC 1QF6A 2ZEQA 4OZBA 2W55A 2WDVB 1E7UA 3SU8X 4DXGA 4IC7B 5E6NA 4B0EA 4XGAB 2MBHA 1C9FA 1Q0WB 2NTSA 1IBXA 2UYZB 5I4DA 4BBNF 4KIKA 2L00B 2Z0EB 2N9EB 1C4AA 5H92C 1RFKA 3BZDB 3AXCA 5HKHA 4WIPA 3JSVA 1TJEA 3TBLD 4XYCA 1IPGA 2Z0DB 1RYJA 3VUXA 4RF0A 1N5WA 2OJWA 3PZDA 2NVUI 3IAS1 2FIDA 1FFUA 2VH2A 4HK2A 5H8YE 2J0MA 2PVOD 2HTME 1HQRD 4ZRQA 2MBEA 1YQBA 3FILA 1WE7A 3W1YA 3HVDA 1V5TA 4O1NA 4WAFA 1E8WA 2KX0A 3ZVVA 2GI9A 1KH0A 1XCTL 4M8NA 2J0KA 3ZJVA 2DZKA 2AX5A 4IWPA 2JZZA 1FCCC 1K53A 1DYQA 3H7PA 1EF5A 1WZ3A 3VXWA 3ZTCA 4WJNA 1YX6B 2OHFA 2N7DA 4JWSC 3L16A 1QOBA 4MGKE 1M94A 3PT2B 1HZ6A 1FEHA 1WH3A 2BB6A 1R7SA 4RGOS 1GJZA 2UU7A 3AE9B 2JVCA 3DDCB 3T3NA 4GDKB 4ZRJA 1GG3A 3TCAA 2MCNB 4DDID 1Q1OA 1WX8A 4FA6A 3U52E 5JXVA 2NR2A 5AZHA 4W9JA 3KH0A 1T5XD 3L10B 2BB5A 2JXTA 1ZW7A 1SE4A 1WYWB 2IZVB 1FCLA 1N6ZA 2EMTA 3R3MA 2ZZPB 1IBXB 1FMAD 3RNFC 4HRSA 2JWUA 1UH6A 2OJRA 4OW0A 3U2SC 1FPYA 3GB1A 2BKFA 3SHQA 1HA5A 5AUIA 1V1PA 1MPEA 1GPXA 2KDFB 3WIMA 2DBYA 2D3CA 4JX1C 5HG2A 5HFYA 1LGRA 3KWLA 3CF4A 1T0QC 1VJKA 2Y3AA 1SJED 2Y5CA 3FILB 2V3SA 2EMSA 1PYWD 2R2OA 2KWCA 2L3ZA 4A6QA 1I4HA 2ACZB 2UWQA 4WH4A 5DPTA 1WJ6A 1WM3A 1SGHA 4XDDA 1FIQA 4LCDE 3NRZA 2BT6A 4XDCA 2PKOA 2LRWA 4CQNA 1VRAB 4LLGM 4JE3B 5DPRA 3U4EG 1WY8A 1TIFA 1SB3C 3P4PB 2XK5B 4BKSD 4KV2A 2XBBC 4WWMA 2LHEA 2FBWB 1GTHA 5DCNA 5HI1A 4W9HA 3Q8FA 2KK8A 3UQAA 1OFFA 1CQVA 3DVNV 3UQBA 2V3PA 4M0WA 5HHDG 3NZSA 3RMKC 4B6WA 3ZXRA 1FXAA 3GS2A 3VDZA 1GC7A 2WGSA 2DENB 2JRHA 3EGRA 1MI0A 2WHIA 2MA9B 1J7CA 2WXMA 1V80A 2NTTA 2J52A 2KDMA 2KJRA 2WU5B 4MT5A 5C23A 1KTKA 4PS3A 1UZXB 1TKEA 2N7JA 3KWVA 1ENFA 3AI5A 2CKHB 1J7BA 3AECB 4R3DA 4RGMA 2ZW1A 3EA6A 4PS8A 1YQ4B 3TEZA 3NS8A 2LGIA 3RN9C 1P0RA 3MTNB 4MJSA 4DDGD 2HTHA 4S17A 3V6CB 4I6LB 4ARCA 3P4QB 1FNWA 5EE1A 3Q69A 3A9JA 3DCGA 3OJ3A 2AQ3B 1WR6E 1VCBA 1T0YA 4ZRPA 3V61A 3V62A 1WRDB 2JF5A 2M56B 3S2AA 5IKCM 4ZRKA 3DWMA 4ZHOA 2JUOA 3VRBB 1TS4A 2PMVA 2AWTA 4C4VA 1OEYJ 2NCNA 4ZYNA 2PW9A 3Q14C 3OJ4B 2L8JA 1XO3A 2J53A 2MQJA 2N7EA 3I63C 4TUUA 2HDEA 3DWGC 4AP4C 3O13A 5G5GA 4X57B 3AM9A 3ZLZA 3AE1B 2D2QA 1D5MC 2I38A 1T0SC 5MPOA 3P2BA 3AMZA 1MG8A 2J0JA 3WA0A 2MBQA 3AE7B 4WQMA 2ZCBA 4K1RB 2KQ7A 3EECA 2TSSA 3LB8C 3HIZA 2IYDB 4HCPB 2R2QA 3ML8A 4GB9A 2IO1B 3VHTC 2MLBA 2M17A 1WFYA 2MP2A 3DBHB 3IAM1 1GT8A 2V4IB 2KTRA 4A9AA 3QAQA 4HEA1 1GAQB 2KWDA 4YXDB 2PLPA 1AARA 4RH6A 3PRPB 1FD6A 4IM2A 4RGNA 1FRRA 4XWTA 2QCZA 3MHSD 4LNNA 2C7MB 2BWES 3I5JC 1N60A 4PS7A 4BFRA 3L13A 1WJ4A 4DXFA 3DVNU 2N0SB 4K7WA 2WLBA 3RNEC 1UWXA 1YN3A 2FNJB 1S3SG 4YTMB 2Y5BB 1FXTB 3A1QA 3DHHC 4KGRA 1E90A 4RF1A 4P16A 2PPHA 4P1CC 3C19A 3BWUD 4LTUA 3U7DA 3GZNI 1GUAB 3L17A 4ICVA 3RD2A 2XNAC 2WU2B 1D5ZC 1L6UA 2KTFA 3IFWB 4OZAA 4DHZE 2EELA 1I4GA 1L7YA 4J6IA 1YQ3B 1G6JA 1TY2A 1J0GA 2Z8LA 2LHDA 1ZPSA 1RRBA 4B9KA 3AEAB 4ZHPA 3R2TA 1L5PA 2CS4A 2G4SA 4C56C 4F1SA 2WS3B 2NPTA 3H9DA 3RYTA 3KQ4A 4FJZA 4FULA 2LFIA 2RR9A 4RM9A 2KDIA 1GTEA 2K9XA 3DBRB 1C78A 1FFVA 2HE7A 1D4BA 4Q2JA 2BYEA 4BZAA 1M4VA 3U8ZA 2WX0A 4NJCA 3GE8C 2BBCA 2LVPA 2N1WA 3HVZA 1PQSA 1HTQA 2D11A 3WALA 5BMIA 2ZCCA 3NVYA 2MSED 4A3OA 1STEA 4WWNA 1L6VA 2QDFA 1LXDA 2ZW0A 4BKGA 1WJNA 2GBNA 1H7WA 3E9SA 2FIFA 2CHWA 3PGEA 4USAA 3ZKJC 1TS5A 2JQRB 4AJWA 2WXLA 4OVUA 3U7ZA 1QOGA 1C3TA 1ESFA 1QKZA 2N9KA 1JWSD 4YT0B 2BYFA 5AZFA 3SDLC 4LNKA 1GC6A 2L05A 2R61A 5DPSA 3VH4B 3U30A 3V3XA 1YNTE 5D2MB 2N9PC 4I6PA 4IM3A 4ANVA 5D94A 1XLQA 4L1BA 1R4NI 3CWIA 2RSUA 3IT6B 4EKUA 2LWPA 5LXIB 3NS1A 1QT9A 2BW2A 2KFKB 1TKGA 1ISNA 2CU3A 3AB5A 5BMHA 3DHGC 3QA8A 4P6VF 3B1LX 3RUIB 1F77A 3PHXB 4W9DA 1UBQA 3ZJUA 2JYTA 5CX3A 4C7YA 1TS3A 4M02A 3MC8A 4JGHB 3VQIA 4RFBA 3CSTA 1H7XA 3MC0B 4G3XB 2BQQA 2GRIA 2IY0B 4F8CB 2WXHA 4FLHA 3NG0A 4DXAB 2W9NA 4P1BC 3DQVA 3P42A 4GDKA 1D6EC 3EFUA 3LJ3A 2KLCA 2L0TA 3M95A 1K50A 2NBUA 2K6QA 1XQQA 2VZKD 1R4MB 4IUMB 1N63A 4KGTA 2DYBA 4YSZB 2DHZA 1F0ZA 4KVGB 1UGJA 4LNIA 3BVMA 2NBVB 2MWSB 3E56A 3APFA 1I4XA 2L83A 4D2KA 2C9WB 1IYFA 3N1YC 1UUPA 2KN5A 1YD8U 3WANA 4KKIA 4A90A 4EOYA 4XC2A 1UBIA 5BYQA 2IPKD 4G11A 1ZXHA 4RM8A 2WXJA 1N61A 5D6JB 2LVOA 1AWDA 1C77A 4DHZB 4EZKA 4OHJA 1VDVA 3A9KA 3PV1A 2ZVNA 2K3UA 1R4NB 1MFWA 2DX5B 3PRZA 2PE9A 2Z59B 1UGMA 4W9LA 3VRAB 3NOBA 4BKTA 5EE3A 1PFDA 2C7NB 2IO2B 4HCNB 2V9HA 1KOTA 2BF8B 1ZOYB 2JU6X 3DBSA 1NYRA 2L7RA 1CK1A 2VZKB 2BPSA 3CF6E 3R66C 3VR9B 1XLNA 4IKGA 3CIRB 2E3TA 2PIAA 3ZGZA 4EZLA 4FN2A 4W9KA 4JWUC 2KC2A 4II3B 1YJIA 2XK5A 5T8IA 4PYZA 3VTUA 4CO7A 2M0AA 3V60A 1SSNA 2MBOA 2CHXA 4KDLB 3J9CA 1NEKB 2RPVA 2M19A 2SAKA 1GNUA 4F7ZA 1BMLC 2CJOA 1I4QA 5IN7A 1WJUA 4UDUC 3AEDB 1EUVB 2A4ZA 4MSMB 3EC8A 2J7QB 3C0RB 1RFAA 2JYEA 1V81A 2WWZA 4ZOHC 3OWEB 3OLMD 3A4RA 4KZCA 3TIXA 3ZNHB 1WE6A 3QC8B 3Q8EA 4REZA 4HKQA 1X1MA 3KUDB 1LO5D 3UINB 4P7IA 2C60A 1K52A 1WWTA 1J19A 4PT5A 4H2AA 3V6EB 3P4SB 1V9JA 5CHVC 2AYOB 3P4RB 2BVCA 1I35A 3A9KB 4WWOA 2WXKA 3PREA 1TGZB 1KM7A 2Q5WD 4BOZB 3JYUA 3VR8B 3QQ8B 1YX5B 3ZNZB 4KDIC 2YLMA 2OOBB 3QHTA 4YTPB 3NZ3A 4N59A 3EUB2 3M3JA 2YVCA 1E8ZA 3TL5A 3NY5A 4OVZA 1TYGB 2DAJA 3QX1A 1XT9B 5J18A 4HVBA 4TV3A 1I7HA 3GP7A 5G2NA 4WAAA 3TEYA 1QILA 4HWIB 2E6XA 1T3QA 5AEKB 3IT4B 1E6EB 3MC9A 1JMLA 2LGSA 3B2FA 3DOWA 1YOVB 1KLUD 3KUCB 4MM3B 1QOAA 2BWFA 2PTLA 5G5HA 4EZJA 2C5LC 3RPFC 1PGXA 1PDXA 1XEEA 2JX5A 1WX9A 1WXQA 1WX7A 4G0NB 2O6VD 2LEKA 3ETRA 4RNAA 2H89B 2EKIA 2ZNVB 2W3SA 1OEYA 5E6OA 2D10A 2L1AA 5J17A 1H4RA 5IA7A 3QJZA 3PTFC 1E9MA 4K81A 3OG5A 2IBIB 3ONSA 1SIFA 2O2VB 3QIJA 2KC1A 3AE8B 2KDBA 2LI5A 5D7GA 3BINA 1HXYD 1JWMD 2WXPA 1WI0A 3H7SA 4HDQA 3VH3B 4MEMA 5BO4B 1C79A 1WR1A 4IM0A 4L2YA 4TKNA 2FUG1 2LUMA 3B2GA 4ZYSA 3PVLA 1DGJA 2B76B 5IOIA 2OEDA 3HM6X 3AE6B 2AEHA 2B3AA 3WAMA 3CSFA 4XX5A 1AYFA 1WYGA 2LASA 1HTOA 5LNK1 2O6VB 3I57A 3RZWC 2ZVOA 1KRHA 3JW0X 1RLFA 4YSXB 1WXSA 4LNOA 4US8A 4IOIE 4NAMA 4PK1A 4AQ7A 1BUIC 1RAXA 3M62B 3AE3B 4URKA 1C1YB 4WWPA 4LDTD 3ZW3A 3RNAC 4ARIA 2DLBA 3BVGA 1NI3A 2KFJA 3PHWB 2N4FA 2KJ6A 1TY0A 1TT5B 2RMMA 4YWGG 3AH7A 4HROA 4B95A 1F2RC 5BMGA 5JHBA 1Q10A 4LJOB 1Y8RC 1CJEA 3JVZX 5AZGA 1EM7A 3N3KB 4IG7B 3AV8A 1D5XC 1OQQA 4DHJD 2SEBD 4E3CA 1T6BX 2KWVB 2LXCA 2JPHA 3Q3FA 2KJHB 1ZGUB 1FM0D 1PUTA 4HXDA 2AQ2B 1KJTA 2DYOA 1CZPA 2MJDA 1B9RA 4KX6B 5KHOA 2MW5A 2N1VA 2ONQA 1VR9A 1WXAA 1JWAD 1YN4A 2KVRA 4LDTB 2AL6A 4A55A 3R2IA 2LJIA 5GXGB 2QMTA 5D3DA 4EFOA 2WXOA 2KMMA 3VVWB 5DPWA 5D3IB 1LQBA 1Q5WB 1UNSA 3BY4B 3ALBA 1F52A 4M00A 1NVID 1VZ6A 4J3OD 2IJ0A 1U4AA 2INCC 2KFKA 2LGXA 2RD0A 3LYYA 4A8XC 1QOFA 4MDKE 1V2YA 1WMHA 1XF5L 4NJ7A 5EE0A 2V4LA 1E8YA 3AE4B 2LRUA 2IGDA 4DHJB 2FE8A 2CR5A 3NJTA 1OGWA 2BYTA 5C3JB 1TTNA 2D5GA 3DVGY 2G9HD 2HJ8A 5IO9A 2KX3A 3ZUNA 3N1XC 3ENEA 4NAWB 1C4CA 3L54A 3PO0A 3NHEB 5GMVA 1XLPA 4FXCA 1YMHE 3K9PB 4E74A 3ZDMC 1WXMA 1WSPA 2HD5B 2DYMA 2KXJA 2LVQA 3RI7C 1KLVA 3MJ5A 1BXTA 4NJ6A 1L0XB 2K6DB 3D32A 1Z2MA 3I9V1 4GLSC 4NQKE 1ET6A 2DZIA 2JWZA 4N9F4 4RMAA 2D3GA 3NUHB 2I1KA 3N30A 2ZPYA 4I6NB 2K1FA 1JCKB 3IBEA 2REXA 3SR6A 2BS4B 4MH0E 4WQOB 5TR5A 4IWQA 2YEPF 3PZ8A 2BS2B 4DBGA 1ZDVA 3LXFA 4JL9A 4TMAB 1E10A 1JRPA 3RCZA 3IHPC 2WXFA 1AW7A 3TEWA 3N1ZC 3ZNGC 3HRDD 4EE2A 3GZNB 4GDLA 1EU4A 1KF6B 1WGRA 3DHIC 4HJGE 2WQYB 2LXAA 1JALA 1FXIA 4AOFA 1E7VA 1E5WA 4C00A 4K7UA 4RGTA 1J7AA 2AQ1B 3W5UB 4ANWA 1WMHB 3AE5B 5IP4D 4MSQB 2I2YA 2FCNA 2MRPA 4N6EB 3ABVB 2GBMA 4EEWA 1SBBB 5L95C 3HHMA 3ZRFA 3X23A 2W82A 4ICUA 2H88B 4HPPA 4GGQA 3Q8BA 1J8CA 1QQRA 3WCQA 1EU3A 3TEXA 4KSKC 2LD9A 1EF1A 5G55A 4IWOA 2KKCA 2KMAA 4ZRIA 1V97A 2W3RA 3UIOB 3VUWA 1BT0A 1SXTA 4MH8A 2HJ1A 2WP9B 1VLBA 1V86A 3W2DA 1IUEA 4W9EA 2JXXA 2KZRA 1VZ8A 1V1OA 1MHXA 4G50A 1JROA 2KD0A 3H6NA 4BBNC 2WDQB 4IW0A 4NY0A 4K3CA 3UGBB 1L2NA 2INPE 3LDZE 2J4XA 2BTEA 3L08A 4HJKA 3QWZB 5C1ZA 3KUZA 3R7RA 1HEZE 3C8YA 2K5PA 4FJVB 1P7FA 2WNMA 3W1SA 3QARA 4GDLB 1L4DB 3L4PA 1LM8B 3B0AA 2D3BA 4LNFA 4ACFA 4NPNA 3ML9A 3QCAA 4S0RA 3FAHA 1JQ4A 2RDGA 3RULA 2D3AA 4MGYE 3TSSA 4TSSA 3ZJTA 4YTNB 4MGIE 2DWQA 3PPAA 3W1SC 1OQYA 1IP9A 2G45B 4BOSC 2K39A 1YIWA 2KLGA 2NS5A 3ZO5B 4MM3A 3MFGA 1V5OA 3ZYYX 2C7HA 2N9LA 1UF0A 5FK9C 2QSDA 3KVFB 1Y56A 1MG4A 3AEBB 4C7ZA 3MJWA 5L83A 4WJPA 2MHJA 1XD3B 4XZ4A 4E71A 4PYUA 4GU2A 3BYTB 3TMPB 2V3NA 3HK0A 2WDRB 3O65B 4JLCA 2FCSA 2N9XA 3T8MA 2GBKA 3ECIA 4M8MA 4MGZE 2RDBC 3AULA 1WGGA 4JPSA 1K8RB 3VTWA 2O2VA 1RM6C 1I4PA 1QZEA 2ZNVC 4GIVA 2WXRA 4QAYA 5AUKA 2JSVX 3A33B 2KQSA 2ZPNA 1OTRB 3BK2A 4AUQC 2LUEA 3WAPA 3AE2B 3RFZB 5IAAC 2K8HA 4US9A 1EWCA 3PZ7A 5JH5C 1SF0A 2L0FA 2LGDA 2ASQA 4BKSA 4CHKA 4LJPB 1XXGA 3Q3JA 4KIKB 4W9FA 3N20C 2KOXA 3JSVB 1WRIA 1N5XA 2BGFA 4AS1A 1DOYA 2IO3B 2ON8A 3A4SC 2IY1B 4ANXA 1SE9A 2O6VA 2K8CA 1I42A 2PJHA 2EKEC 2V1YA 1NBFC 2QIEB 1P3QU 2GBRA 4W9CA 2RDHA 3APDA 4HPLB 1WXVA 1JRUA 1ZE3D 3ZNID 1WF9A 3NZUA 4L23A 3RZFA 1JWBD 3NVVA 1FNUA 5FKAC 2K0PA 4II2B 3H7PB 5BYSA 4JIOU 1V6EA 1WZ0A 1XLOA 4B0MA 3L0WB 5BYRA 2QILA 1L0VB 2WYQA 3Q6BA 4N58A 1TZOA 5EDSA 2IGGA 2RGFA 3KYCD 2KAJA 3T9LA 1SIJA 2PEAA 3VUYA 1SE2A 3Q3OC 4W9IA 3AU4A 2VH1A 3VFKA 3AEEB 1DOXA 1L4ZB 3M63B 4K7SA 1IGCA 5JZEB 1PGBA 2LMCA 4BVUC 2KANA 1AN8A 3B08A 2Y5PA 2D07B 4MACA 1GB4A 2QHOA 2MJ3A 1MVKA 3AEGB 3NVWA 4WJOA 3DBLI 3FKYA 1KLGD 1L0YB 2K25A 4FJYA 3AEFB 3KW5B 1VZ7A 3W9CB 3SEBA 3ZIMA 3BK1A 1FRDA 4KSLC 3AN1A 1ROEA 4NQLB 1PGAA 2KVZA 2WXNA 1IGDA 4BAXA 1V8CA 3NVZA 2GBJA 4XE0A 2PVGC 3DBHI 3SD5A 4FHJA 3H8HA 2DZJA 2I1JA 5FR3A 2DNFA 4CYEA 1NENB 3PLVA 1P1AA 4MELA 1UD7A 2G3QB 4K3BA 5E6JA 1V1PB 1TBEA 3RNCC 2INDC 4FHKA 1WGKA 3RNBC 3B9JA 3TUOA 1EO6A 2KWUB 4HKZE 1S1QB 2QC8A 3IVFA 2MEKA 4KZ0A 1KFYB 3VTVA 1ZDXA 4GN1A 4W9GA 2G1EA 5FR6A 5KHQA 3URYA 2ICIA 3DVGX 1GB1A 3Q2AC 2BS3B 2CJNA 2KYWA 1VD2A 1JWUD 2FCMA 2MJEA 1SJHD 3WAOA 4GXBA 1LFDA 2M0XA 4JQWC 2PE6B 4A20A 1CMXB 1YN5A 2JZ3B 2KDEB 3APCA 3MHZA 3AU5A 4NAWA 4DWFA 1UWMA 2CHZA 1TZ1A 2LJ5A 2JRIB 4TQ0A 1F2RI 2MX2A 4DK5A 3T3OA 2G4DB 2RPQA 5E6PA
chains in the Genus database with same CATH topology
2K3UA 4CQNA 1VRAB 4LLGM 4JE3B 1C76A 3U4EG 2YEPF 3PZ8A 3Q8AA 2BS2B 3VRAB 1ZDVA 1SB3C 3LXFA 2X38A 2MH7A 4TMAB 5EE3A 1PFDA 1E10A 1JRPA 4LK0M 3P4PB 2WXFA 1AW7A 1ZOYB 2JU6X 2QEJC 4WWMA 2LHEA 2FBWB 1GTHA 3TEWA 2NMQA 5HI1A 2L52A 3HRDD 3Q8FA 4EE2A 1NYRA 2VZKB 1CK1A 1OFFA 5EE9A 3IXSA 1TKYA 1P7EA 3VR9B 1XLNA 3BVZA 1EU4A 1CQVA 4ITKA 1KF6B 4IKGA 3CIRB 2E3TA 4OZCA 2V3PA 4M0WA 2PIAA 5HHDG 3BIID 3ZGZA 2IDYA 1FXAA 4JWUC 3GS2A 4HJGE 2WQYB 2L32A 1YJIA 5T8IA 1JALA 1FXIA 3FC4A 4RGTA 1J7AA 2AQ1B 3W5UB 3EGRA 1MI0A 4IDIA 1ACCA 2KN4A 2M0AA 3MP9A 1J7CA 3AE5B 2WXMA 1SSNA 5C2TB 2WXQA 1K51A 3J9CA 1NEKB 2J52A 2NTTA 2KDMA 4MT5A 2WU5B 2RPVA 3BYYB 2M19A 2I2YA 1KTKA 4C80A 4N6EB 3ABVB 1TKEA 2SAKA 2N7JA 3KWVA 1ENFA 1A70A 1SBBB 1BMLC 1J7BA 3UI3A 3AECB 2CJOA 4R3DA 1I4QA 4RGMA 2ZW1A 2W82A 3EA6A 1E0ZA 4UDUC 1I4RA 1YQ4B 2KQ4X 3TEZA 3SFDB 2H88B 3AEDB 2LGIA 3Q8BA 2JYEA 4ZOHC 4ARCA 3P4QB 3OWEB 1FNWA 1QQRA 2QJLA 5EE1A 3WCQA 1EU3A 3Q69A 3Q8EA 4REZA 4HKQA 3TEXA 2AQ3B 2K22A 1LO5D 2IGHA 4ZRPA 1V97A 2W3RA 1K52A 1WWTA 1SXTA 4MH8A 2WP9B 1VLBA 2M56B 1IUEA 3W2DA 1FNVA 4PT5A 4H2AA 5TSSA 1ZP0B 3DWMA 4ZHOA 3P4SB 1FO4A 1VZ8A 3VRBB 1TS4A 2PMVA 1V1OA 3P4RB 1MHXA 3W5VB 1JROA 2W54A 2WXKA 2PW9A 2WDQB 1B1ZA 2Q5WD 1XO3A 1RWSA 2J53A 2HDEA 2INPE 3DWGC 1C4PA 2J4XA 3VR8B 2BTEA 3O13A 1E7PB 1YJJA 5G5GA 1JW9D 1HEZE 2WXIA 3AM9A 3C8YA 1MHHE 4RCOA 3HUIA 4YTPB 1HZ5A 2K5PA 3NZ3A 4N59A 3AE1B 3EUB2 1D5MC 3V05A 3N9YC 1P7FA 2I38A 2WNMA 1TYGB 4OVZA 3W1SA 5MPOA 1OQRA 4GDLB 1L4DB 1I7HA 3GP7A 3AMZA 2GB1A 3L4PA 3TEYA 1QILA 3AE7B 4WQMA 3ZQ4A 1ZXIA 2E6XA 2TSSA 3LB8C 1T3QA 2WXGA 3SFEB 1E6EB 3IT4B 3FAHA 1N62A 2XN9C 1JMLA 1JQ4A 2RDGA 3B2FA 1KLUD 4MM3B 3TSSA 1QOAA 1SEBD 4TSSA 3ZJTA 2PTLA 4YTNB 5G5HA 2DWQA 3P63A 3RPFC 1PGXA 3KLSX 1PDXA 1XEEA 1EWYC 2JX5A 4KGSA 3IAM1 1WXQA 1GT8A 2V4IB 4XWWA 4A9AA 4TQ1A 2LEKA 3ETRA 4RNAA 2H89B 2EKIA 4HEA1 1GAQB 2KWDA 2W3SA 4YXDB 2PLPA 4NZLB 1TS2A 4RH6A 1FD6A 2V0GA 2L1AA 4RGNA 1FRRA 4XWTA 3MFGA 1DOIA 3ZYYX 1E9MA 2N9LA 5FK9C 2QSDA 1N60A 1Y56A 1ZUD2 2INNE 4DXFA 2J42A 3AEBB 2N0SB 4C7ZA 3AE8B 2WLBA 1UWXA 2JZPA 5D7GA 1YN3A 4YTMB 3BYTB 1HXYD 4KGRA 2V3NA 2WDRB 4RF1A 4P16A 1JWMD 2WXPA 3BWUD 4LTUA 3P1MA 1C79A 4JPSA 2XNAC 2WU2B 4WURA 1D5ZC 1L6UA 4L2YA 2FUG1 2YEPB 1RM6C 2LUMA 1I4PA 3B2GA 4OZAA 4ZYSA 2WXRA 5AUKA 2JSVX 2EELA 1I4GA 1DGJA 1NYQA 1YQ3B 4KKJA 3BK2A 2B76B 1TY2A 4YSYB 2OEDA 3AE6B 2Z8LA 2LHDA 1ZPSA 3AEAB 1GOZA 1XCQL 3AE2B 3Q8CA 3R2TA 4ZHPA 1L5PA 3RFZB 1AYFA 1WYGA 4US9A 1EWCA 3PZ7A 5LNK1 1ET9A 4DQOC 1SF0A 4C56C 1QLBB 3I57A 1SE3A 1KRHA 2WS3B 1XXGA 2KACA 3R8BA 1QF6A 4YSXB 4OZBA 4US8A 2W55A 4IOIE 2WDVB 4NAMA 1WRIA 3KQ4A 2LFIA 4DXGA 1N5XA 4AS1A 1DOYA 1GTEA 2ON8A 4AQ7A 1BUIC 2K9XA 4B0EA 3AE3B 1C78A 1FFVA 1C9FA 1D4BA 2NTSA 4Q2JA 1IBXA 1M4VA 2DLBA 4ARIA 3BVGA 5I4DA 1NI3A 4NJCA 2QIEB 2BBCA 1C4AA 5H92C 1RFKA 3HVZA 1TY0A 2RDHA 3BZDB 4WIPA 2RMMA 4YWGG 3AH7A 4HROA 1TJEA 1F2RC 1ZE3D 5BMIA 3NVYA 5BMGA 1Q10A 4L23A 1STEA 1L6VA 1CJEA 1RYJA 4RF0A 1N5WA 2ZW0A 1EM7A 1H7WA 3E9SA 1JWBD 3NVVA 3IAS1 3AV8A 1FFUA 1D5XC 1OQQA 1FNUA 4USAA 5H8YE 2PVOD 5FKAC 2HTME 1TS5A 2JQRB 1HQRD 2K0PA 2SEBD 2WXLA 4ZRQA 3U7ZA 5BYSA 1QOGA 3FILA 1T6BX 1XLOA 4B0MA 1ESFA 3HVDA 5BYRA 1QKZA 2N9KA 1JWSD 2QILA 4O1NA 1L0VB 4YT0B 4WAFA 4N58A 1TZOA 2IGGA 2GI9A 1FM0D 1PUTA 2KAJA 1KH0A 1XCTL 2R61A 2AQ2B 3ZJVA 2DYOA 1CZPA 1SIJA 2AX5A 1FCCC 1SE2A 2MJDA 3V3XA 1K53A 1YNTE 1DYQA 1B9RA 4KX6B 3AEEB 1DOXA 1L4ZB 2ONQA 1VR9A 1XLQA 4L1BA 2OHFA 1IGCA 4JWSC 1PGBA 2LMCA 3CWIA 3IT6B 1AN8A 1JWAD 1QOBA 1YN4A 2Y5PA 4MACA 3NS1A 1QT9A 2BW2A 1GB4A 1TKGA 2MJ3A 1MVKA 3AEGB 1HZ6A 2CU3A 3NVWA 4A55A 1KLGD 1L0YB 3R2IA 2LJIA 5GXGB 3AB5A 5BMHA 1FEHA 2QMTA 4P6VF 3AEFB 2BB6A 5D3DA 1VZ7A 2WXOA 1R7SA 1F77A 2KMMA 3W9CB 4RGOS 3SEBA 3AE9B 3BK1A 1FRDA 3T3NA 4GDKB 3AN1A 1ROEA 5D3IB 3ZJUA 2JYTA 1UNSA 4C7YA 1PGAA 2WXNA 1TS3A 1IGDA 3U52E 1NVID 1V8CA 1VZ6A 2IJ0A 3NVZA 4J3OD 5JXVA 4XE0A 2PVGC 3VQIA 4RFBA 3H8HA 1H7XA 3LYYA 3MC0B 4A8XC 1QOFA 2GRIA 1XF5L 5EE0A 5FR3A 1NENB 1T5XD 3AE4B 2BB5A 2JXTA 2WXHA 2IGDA 2FE8A 1SE4A 3P42A 2BYTA 5E6JA 1D6EC 1FCLA 1V1PB 5C3JB 1WGKA 1K50A 3B9JA 3TUOA 1IBXB 2VZKD 4HKZE 2D5GA 1FMAD 1N63A 4KGTA 4YSZB 2G9HD 2MEKA 4HRSA 1KFYB 2JWUA 1ZDXA 1F0ZA 1UGJA 3BVMA 4OW0A 2G1EA 3URYA 3U2SC 2ICIA 3E56A 1GB1A 1I4XA 2L83A 3GB1A 4NAWB 1C4CA 4D2KA 3PO0A 2BS3B 2CJNA 1JWUD 2MJEA 1SJHD 1HA5A 1XLPA 5AUIA 1V1PA 1MPEA 1UUPA 4FXCA 1YMHE 1GPXA 4KKIA 4A90A 2DBYA 4JX1C 5HG2A 1WSPA 5BYQA 5HFYA 2DYMA 2IPKD 3KWLA 1ZXHA 1YN5A 3CF4A 1VJKA 2Y3AA 3MJ5A 1BXTA 1SJED 1L0XB 2Y5CA 3MHZA 3FILB 2WXJA 1N61A 1PYWD 1UWMA 4A6QA 3I9V1 4GLSC 1AWDA 1C77A 1ET6A 1I4HA 2ACZB 4OHJA 4WH4A 4TQ0A 1VDVA 1F2RI 3NUHB 4XDDA 1FIQA 1JCKB 3T3OA 3NRZA 2BT6A 3SR6A 2BS4B 4XDCA 2PKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1M A;  4KX6 B;  2WDQ B;  2Q5W D;  3AEE B;  1DOX A;  1XO3 A;  2WU2 B;  1RWS A;  1XLQ A;  1L6U A;  2OHF A;  1RM6 C;  3DWG C;  2BS2 B;  4JWS C;  3CWI A;  3VR8 B;  3VRA B;  1SB3 C;  3B2G A;  3LXF A;  5EE3 A;  2MH7 A;  1JWA D;  1PFD A;  1QOB A;  1E10 A;  1JRP A;  1E7P B;  1YJJ A;  3P4P B;  1QT9 A;  3NS1 A;  5AUK A;  1JW9 D;  1TKG A;  5G5G A;  2MJ3 A;  3NVW A;  3AEG B;  1DGJ A;  1ZOY B;  1YQ3 B;  1NYQ A;  2CU3 A;  2B76 B;  3AM9 A;  4YSY B;  4WWM A;  5GXG B;  3AE6 B;  2FBW B;  1GTH A;  4YTP B;  3AB5 A;  3HUI A;  3AEA B;  2K5P A;  4N59 A;  4P6V F;  2L52 A;  3AE1 B;  3AE2 B;  3AEF B;  3EUB 2;  3HRD D;  4ZHP A;  1L5P A;  1NYR A;  1R7S A;  2KMM A;  1OFF A;  1AYF A;  1WYG A;  5EE9 A;  3W9C B;  4US9 A;  1TKY A;  3VR9 B;  3AE9 B;  1TYG B;  1XLN A;  1FRD A;  4ITK A;  5MPO A;  1OQR A;  1SF0 A;  1KF6 B;  3AN1 A;  3CIR B;  1ROE A;  1QLB B;  2E3T A;  2PIA A;  3BII D;  1I7H A;  3L4P A;  3AMZ A;  1KRH A;  1FXA A;  4C7Y A;  4JWU C;  3AE7 B;  2WS3 B;  4WQM A;  1NVI D;  2WQY B;  1V8C A;  3NVZ A;  1ZXI A;  1QF6 A;  4YSX B;  2PVG C;  1YJI A;  3LB8 C;  1JAL A;  1H7X A;  1FXI A;  1T3Q A;  4US8 A;  2W55 A;  3FC4 A;  2WDV B;  1WRI A;  1QOF A;  5EE0 A;  1J7A A;  1NEN B;  1N5X A;  3SFE B;  1E6E B;  3AE4 B;  3W5U B;  1DOY A;  3FAH A;  1N62 A;  4IDI A;  1JQ4 A;  1GTE A;  2K9X A;  3B2F A;  3AE3 B;  1J7C A;  3AE5 B;  1FFV A;  5C2T B;  1QOA A;  5C3J B;  1NEK B;  4YTN B;  5G5H A;  1NI3 A;  2WU5 B;  1WGK A;  2DWQ A;  2M19 A;  3B9J A;  3P63 A;  3RPF C;  4C80 A;  4N6E B;  2QIE B;  1PDX A;  3ABV B;  1EWY C;  1TKE A;  1FMA D;  2JX5 A;  1N63 A;  5H92 C;  1RFK A;  1A70 A;  1WXQ A;  4YSZ B;  3HVZ A;  1GT8 A;  4HRS A;  1J7B A;  4A9A A;  1KFY B;  2LEK A;  3AEC B;  2CJO A;  3ETR A;  1F0Z A;  3AH7 A;  4HRO A;  2H89 B;  2EKI A;  1TJE A;  1E0Z A;  2G1E A;  1GAQ B;  3NVY A;  1YQ4 B;  2W3S A;  4YXD B;  2L83 A;  3SFD B;  2H88 B;  3AED B;  3PO0 A;  2BS3 B;  2CJN A;  1L6V A;  1CJE A;  1RYJ A;  2MJE A;  1N5W A;  1FRR A;  1XLP A;  5AUI A;  1DOI A;  4ZOH C;  3ZYY X;  3P4Q B;  1H7W A;  4FXC A;  1GPX A;  1JWB D;  2QJL A;  3NVV A;  5EE1 A;  3AV8 A;  1E9M A;  1FFU A;  3WCQ A;  1OQQ A;  2DBY A;  4USA A;  5H8Y E;  2PVO D;  4JX1 C;  2HTM E;  2JQR B;  1N60 A;  2K22 A;  1QOG A;  3KWL A;  3CF4 A;  1ZUD 2;  1VJK A;  1V97 A;  2W3R A;  1XLO A;  1B9R A;  3AEB B;  2N0S B;  1WWT A;  4C7Z A;  2Y5C A;  3AE8 B;  2WLB A;  2WP9 B;  1VLB A;  1N61 A;  1IUE A;  1L0V B;  4YT0 B;  2M56 B;  4N58 A;  1UWM A;  1ZP0 B;  3DWM A;  1AWD A;  4ZHO A;  3P4S B;  1FO4 A;  4YTM B;  2ACZ B;  1FM0 D;  1PUT A;  1VDV A;  2KAJ A;  2WDR B;  3VRB B;  1FIQ A;  1CZP A;  1SIJ A;  3P4R B;  2AX5 A;  3NRZ A;  2BT6 A;  3W5V B;  1JRO A;  2MJD A;  2W54 A;  4LTU A;  3SR6 A;  2BS4 B;  2PKO A; 
#chains in the Genus database with same CATH topology
 1T0R C;  3X0W A;  3H1U A;  2KO3 A;  1C76 A;  4M0W B;  1NDD A;  3Q8A A;  3K9O B;  2X38 A;  2MH7 A;  1MJD A;  3DBL B;  1YJ1 A;  4LK0 M;  1F9J A;  2KNB A;  4GOC A;  2QEJ C;  2NMQ A;  2L52 A;  2WX1 A;  4HPM B;  5EE9 A;  3IXS A;  1TKY A;  1P7E A;  3BVZ A;  3DBR I;  4ITK A;  1P9D U;  3PRM B;  4OZC A;  3VAW A;  1WM2 A;  2WDT B;  3BII D;  2IDY A;  2L32 A;  3FC4 A;  1D3Z A;  3ZRC A;  4EUT A;  4IDI A;  1ACC A;  2KN4 A;  3MP9 A;  3KYD D;  5C2T B;  4MJS B;  2WXQ A;  1K51 A;  2M4N A;  4OVV A;  3BYY B;  2IO0 B;  4C80 A;  2KHW B;  1WIA A;  3A9J B;  4AWJ A;  3ZDT A;  1A70 A;  3UI3 A;  1F1H A;  1E0Z A;  1I4R A;  2KQ4 X;  3SFD B;  2LZ6 A;  2MBB B;  3DPD A;  2FCQ A;  2QJL A;  4YL8 A;  2XEW A;  4C4V B;  2K22 A;  2IGH A;  3N32 A;  1Z5S B;  5CHF A;  1A5R A;  1NI2 A;  1ZKH A;  3Q3N C;  1FNV A;  5TSS A;  1ZP0 B;  1FO4 A;  2CU1 A;  3GOE A;  3HM3 A;  3W5V B;  2W54 A;  1V49 A;  3TJP A;  1B1Z A;  1RWS A;  2DZM A;  3GE3 C;  1C4P A;  1E7P B;  1YJJ A;  1JW9 D;  2WXI A;  3IG3 A;  1MHH E;  4RCO A;  2KT7 A;  3HUI A;  1HZ5 A;  3V05 A;  3N9Y C;  3R7Q A;  2ZJD A;  1OQR A;  2M8S A;  2M1M A;  5JHA A;  5CHW A;  2GB1 A;  3ZQ4 A;  2MP2 B;  1ZXI A;  1R4M I;  4AJY B;  2KTR B;  5CTR C;  5LXH A;  2BKR B;  2WXG A;  3SFE B;  1HE8 A;  1N62 A;  2XN9 C;  3EFC A;  2AL3 A;  1SEB D;  1E8X A;  2L76 A;  2FAZ A;  3P63 A;  1WGY A;  3KLS X;  1EWY C;  4KGS A;  4HDO A;  3RT3 B;  3UIP B;  3OAW A;  3I3T B;  4XWW A;  4TQ1 A;  2JY6 A;  1H8C A;  2JT4 B;  3PSE B;  4NZL B;  2LGY A;  1TS2 A;  1WGD A;  3UF8 A;  2V0G A;  1WGH A;  3A1Q B;  1DOI A;  4FAD A;  2FUH B;  3PS6 A;  5J2R A;  3EHV A;  4A3P A;  1ZUD 2;  2INN E;  3ZXV A;  2DAF A;  2J42 A;  2BYV E;  4M01 A;  2GLS A;  2JZP A;  4ZDV A;  2X8X X;  3RNG C;  1UEL A;  4ANU A;  2GMI C;  3P1M A;  4FBJ B;  2GOW A;  3Q3M C;  4WUR A;  4HLE A;  2YEP B;  2NPT B;  5LLI A;  3PLU A;  2VRR B;  4NNJ B;  4GMV A;  1NYQ A;  3CMM B;  4KKJ A;  4YSY B;  4WJQ A;  2KMC A;  1GOZ A;  1XCQ L;  3Q8C A;  2K8B A;  2A5U A;  4GSW A;  1P98 A;  1ET9 A;  4DQO C;  3QK0 A;  1QLB B;  1SE3 A;  2NBW B;  3ZTD A;  2KAC A;  3R8B A;  4ASW C;  1QF6 A;  2ZEQ A;  4OZB A;  2W55 A;  2WDV B;  1E7U A;  3SU8 X;  4DXG A;  4IC7 B;  5E6N A;  4B0E A;  4XGA B;  2MBH A;  1C9F A;  1Q0W B;  2NTS A;  1IBX A;  2UYZ B;  5I4D A;  4BBN F;  4KIK A;  2L00 B;  2Z0E B;  2N9E B;  1C4A A;  5H92 C;  1RFK A;  3BZD B;  3AXC A;  5HKH A;  4WIP A;  3JSV A;  1TJE A;  3TBL D;  4XYC A;  1IPG A;  2Z0D B;  1RYJ A;  3VUX A;  4RF0 A;  1N5W A;  2OJW A;  3PZD A;  2NVU I;  3IAS 1;  2FID A;  1FFU A;  2VH2 A;  4HK2 A;  5H8Y E;  2J0M A;  2PVO D;  2HTM E;  1HQR D;  4ZRQ A;  2MBE A;  1YQB A;  3FIL A;  1WE7 A;  3W1Y A;  3HVD A;  1V5T A;  4O1N A;  4WAF A;  1E8W A;  2KX0 A;  3ZVV A;  2GI9 A;  1KH0 A;  1XCT L;  4M8N A;  2J0K A;  3ZJV A;  2DZK A;  2AX5 A;  4IWP A;  2JZZ A;  1FCC C;  1K53 A;  1DYQ A;  3H7P A;  1EF5 A;  1WZ3 A;  3VXW A;  3ZTC A;  4WJN A;  1YX6 B;  2OHF A;  2N7D A;  4JWS C;  3L16 A;  1QOB A;  4MGK E;  1M94 A;  3PT2 B;  1HZ6 A;  1FEH A;  1WH3 A;  2BB6 A;  1R7S A;  4RGO S;  1GJZ A;  2UU7 A;  3AE9 B;  2JVC A;  3DDC B;  3T3N A;  4GDK B;  4ZRJ A;  1GG3 A;  3TCA A;  2MCN B;  4DDI D;  1Q1O A;  1WX8 A;  4FA6 A;  3U52 E;  5JXV A;  2NR2 A;  5AZH A;  4W9J A;  3KH0 A;  1T5X D;  3L10 B;  2BB5 A;  2JXT A;  1ZW7 A;  1SE4 A;  1WYW B;  2IZV B;  1FCL A;  1N6Z A;  2EMT A;  3R3M A;  2ZZP B;  1IBX B;  1FMA D;  3RNF C;  4HRS A;  2JWU A;  1UH6 A;  2OJR A;  4OW0 A;  3U2S C;  1FPY A;  3GB1 A;  2BKF A;  3SHQ A;  1HA5 A;  5AUI A;  1V1P A;  1MPE A;  1GPX A;  2KDF B;  3WIM A;  2DBY A;  2D3C A;  4JX1 C;  5HG2 A;  5HFY A;  1LGR A;  3KWL A;  3CF4 A;  1T0Q C;  1VJK A;  2Y3A A;  1SJE D;  2Y5C A;  3FIL B;  2V3S A;  2EMS A;  1PYW D;  2R2O A;  2KWC A;  2L3Z A;  4A6Q A;  1I4H A;  2ACZ B;  2UWQ A;  4WH4 A;  5DPT A;  1WJ6 A;  1WM3 A;  1SGH A;  4XDD A;  1FIQ A;  4LCD E;  3NRZ A;  2BT6 A;  4XDC A;  2PKO A;  2LRW A;  4CQN A;  1VRA B;  4LLG M;  4JE3 B;  5DPR A;  3U4E G;  1WY8 A;  1TIF A;  1SB3 C;  3P4P B;  2XK5 B;  4BKS D;  4KV2 A;  2XBB C;  4WWM A;  2LHE A;  2FBW B;  1GTH A;  5DCN A;  5HI1 A;  4W9H A;  3Q8F A;  2KK8 A;  3UQA A;  1OFF A;  1CQV A;  3DVN V;  3UQB A;  2V3P A;  4M0W A;  5HHD G;  3NZS A;  3RMK C;  4B6W A;  3ZXR A;  1FXA A;  3GS2 A;  3VDZ A;  1GC7 A;  2WGS A;  2DEN B;  2JRH A;  3EGR A;  1MI0 A;  2WHI A;  2MA9 B;  1J7C A;  2WXM A;  1V80 A;  2NTT A;  2J52 A;  2KDM A;  2KJR A;  2WU5 B;  4MT5 A;  5C23 A;  1KTK A;  4PS3 A;  1UZX B;  1TKE A;  2N7J A;  3KWV A;  1ENF A;  3AI5 A;  2CKH B;  1J7B A;  3AEC B;  4R3D A;  4RGM A;  2ZW1 A;  3EA6 A;  4PS8 A;  1YQ4 B;  3TEZ A;  3NS8 A;  2LGI A;  3RN9 C;  1P0R A;  3MTN B;  4MJS A;  4DDG D;  2HTH A;  4S17 A;  3V6C B;  4I6L B;  4ARC A;  3P4Q B;  1FNW A;  5EE1 A;  3Q69 A;  3A9J A;  3DCG A;  3OJ3 A;  2AQ3 B;  1WR6 E;  1VCB A;  1T0Y A;  4ZRP A;  3V61 A;  3V62 A;  1WRD B;  2JF5 A;  2M56 B;  3S2A A;  5IKC M;  4ZRK A;  3DWM A;  4ZHO A;  2JUO A;  3VRB B;  1TS4 A;  2PMV A;  2AWT A;  4C4V A;  1OEY J;  2NCN A;  4ZYN A;  2PW9 A;  3Q14 C;  3OJ4 B;  2L8J A;  1XO3 A;  2J53 A;  2MQJ A;  2N7E A;  3I63 C;  4TUU A;  2HDE A;  3DWG C;  4AP4 C;  3O13 A;  5G5G A;  4X57 B;  3AM9 A;  3ZLZ A;  3AE1 B;  2D2Q A;  1D5M C;  2I38 A;  1T0S C;  5MPO A;  3P2B A;  3AMZ A;  1MG8 A;  2J0J A;  3WA0 A;  2MBQ A;  3AE7 B;  4WQM A;  2ZCB A;  4K1R B;  2KQ7 A;  3EEC A;  2TSS A;  3LB8 C;  3HIZ A;  2IYD B;  4HCP B;  2R2Q A;  3ML8 A;  4GB9 A;  2IO1 B;  3VHT C;  2MLB A;  2M17 A;  1WFY A;  2MP2 A;  3DBH B;  3IAM 1;  1GT8 A;  2V4I B;  2KTR A;  4A9A A;  3QAQ A;  4HEA 1;  1GAQ B;  2KWD A;  4YXD B;  2PLP A;  1AAR A;  4RH6 A;  3PRP B;  1FD6 A;  4IM2 A;  4RGN A;  1FRR A;  4XWT A;  2QCZ A;  3MHS D;  4LNN A;  2C7M B;  2BWE S;  3I5J C;  1N60 A;  4PS7 A;  4BFR A;  3L13 A;  1WJ4 A;  4DXF A;  3DVN U;  2N0S B;  4K7W A;  2WLB A;  3RNE C;  1UWX A;  1YN3 A;  2FNJ B;  1S3S G;  4YTM B;  2Y5B B;  1FXT B;  3A1Q A;  3DHH C;  4KGR A;  1E90 A;  4RF1 A;  4P16 A;  2PPH A;  4P1C C;  3C19 A;  3BWU D;  4LTU A;  3U7D A;  3GZN I;  1GUA B;  3L17 A;  4ICV A;  3RD2 A;  2XNA C;  2WU2 B;  1D5Z C;  1L6U A;  2KTF A;  3IFW B;  4OZA A;  4DHZ E;  2EEL A;  1I4G A;  1L7Y A;  4J6I A;  1YQ3 B;  1G6J A;  1TY2 A;  1J0G A;  2Z8L A;  2LHD A;  1ZPS A;  1RRB A;  4B9K A;  3AEA B;  4ZHP A;  3R2T A;  1L5P A;  2CS4 A;  2G4S A;  4C56 C;  4F1S A;  2WS3 B;  2NPT A;  3H9D A;  3RYT A;  3KQ4 A;  4FJZ A;  4FUL A;  2LFI A;  2RR9 A;  4RM9 A;  2KDI A;  1GTE A;  2K9X A;  3DBR B;  1C78 A;  1FFV A;  2HE7 A;  1D4B A;  4Q2J A;  2BYE A;  4BZA A;  1M4V A;  3U8Z A;  2WX0 A;  4NJC A;  3GE8 C;  2BBC A;  2LVP A;  2N1W A;  3HVZ A;  1PQS A;  1HTQ A;  2D11 A;  3WAL A;  5BMI A;  2ZCC A;  3NVY A;  2MSE D;  4A3O A;  1STE A;  4WWN A;  1L6V A;  2QDF A;  1LXD A;  2ZW0 A;  4BKG A;  1WJN A;  2GBN A;  1H7W A;  3E9S A;  2FIF A;  2CHW A;  3PGE A;  4USA A;  3ZKJ C;  1TS5 A;  2JQR B;  4AJW A;  2WXL A;  4OVU A;  3U7Z A;  1QOG A;  1C3T A;  1ESF A;  1QKZ A;  2N9K A;  1JWS D;  4YT0 B;  2BYF A;  5AZF A;  3SDL C;  4LNK A;  1GC6 A;  2L05 A;  2R61 A;  5DPS A;  3VH4 B;  3U30 A;  3V3X A;  1YNT E;  5D2M B;  2N9P C;  4I6P A;  4IM3 A;  4ANV A;  5D94 A;  1XLQ A;  4L1B A;  1R4N I;  3CWI A;  2RSU A;  3IT6 B;  4EKU A;  2LWP A;  5LXI B;  3NS1 A;  1QT9 A;  2BW2 A;  2KFK B;  1TKG A;  1ISN A;  2CU3 A;  3AB5 A;  5BMH A;  3DHG C;  3QA8 A;  4P6V F;  3B1L X;  3RUI B;  1F77 A;  3PHX B;  4W9D A;  1UBQ A;  3ZJU A;  2JYT A;  5CX3 A;  4C7Y A;  1TS3 A;  4M02 A;  3MC8 A;  4JGH B;  3VQI A;  4RFB A;  3CST A;  1H7X A;  3MC0 B;  4G3X B;  2BQQ A;  2GRI A;  2IY0 B;  4F8C B;  2WXH A;  4FLH A;  3NG0 A;  4DXA B;  2W9N A;  4P1B C;  3DQV A;  3P42 A;  4GDK A;  1D6E C;  3EFU A;  3LJ3 A;  2KLC A;  2L0T A;  3M95 A;  1K50 A;  2NBU A;  2K6Q A;  1XQQ A;  2VZK D;  1R4M B;  4IUM B;  1N63 A;  4KGT A;  2DYB A;  4YSZ B;  2DHZ A;  1F0Z A;  4KVG B;  1UGJ A;  4LNI A;  3BVM A;  2NBV B;  2MWS B;  3E56 A;  3APF A;  1I4X A;  2L83 A;  4D2K A;  2C9W B;  1IYF A;  3N1Y C;  1UUP A;  2KN5 A;  1YD8 U;  3WAN A;  4KKI A;  4A90 A;  4EOY A;  4XC2 A;  1UBI A;  5BYQ A;  2IPK D;  4G11 A;  1ZXH A;  4RM8 A;  2WXJ A;  1N61 A;  5D6J B;  2LVO A;  1AWD A;  1C77 A;  4DHZ B;  4EZK A;  4OHJ A;  1VDV A;  3A9K A;  3PV1 A;  2ZVN A;  2K3U A;  1R4N B;  1MFW A;  2DX5 B;  3PRZ A;  2PE9 A;  2Z59 B;  1UGM A;  4W9L A;  3VRA B;  3NOB A;  4BKT A;  5EE3 A;  1PFD A;  2C7N B;  2IO2 B;  4HCN B;  2V9H A;  1KOT A;  2BF8 B;  1ZOY B;  2JU6 X;  3DBS A;  1NYR A;  2L7R A;  1CK1 A;  2VZK B;  2BPS A;  3CF6 E;  3R66 C;  3VR9 B;  1XLN A;  4IKG A;  3CIR B;  2E3T A;  2PIA A;  3ZGZ A;  4EZL A;  4FN2 A;  4W9K A;  4JWU C;  2KC2 A;  4II3 B;  1YJI A;  2XK5 A;  5T8I A;  4PYZ A;  3VTU A;  4CO7 A;  2M0A A;  3V60 A;  1SSN A;  2MBO A;  2CHX A;  4KDL B;  3J9C A;  1NEK B;  2RPV A;  2M19 A;  2SAK A;  1GNU A;  4F7Z A;  1BML C;  2CJO A;  1I4Q A;  5IN7 A;  1WJU A;  4UDU C;  3AED B;  1EUV B;  2A4Z A;  4MSM B;  3EC8 A;  2J7Q B;  3C0R B;  1RFA A;  2JYE A;  1V81 A;  2WWZ A;  4ZOH C;  3OWE B;  3OLM D;  3A4R A;  4KZC A;  3TIX A;  3ZNH B;  1WE6 A;  3QC8 B;  3Q8E A;  4REZ A;  4HKQ A;  1X1M A;  3KUD B;  1LO5 D;  3UIN B;  4P7I A;  2C60 A;  1K52 A;  1WWT A;  1J19 A;  4PT5 A;  4H2A A;  3V6E B;  3P4S B;  1V9J A;  5CHV C;  2AYO B;  3P4R B;  2BVC A;  1I35 A;  3A9K B;  4WWO A;  2WXK A;  3PRE A;  1TGZ B;  1KM7 A;  2Q5W D;  4BOZ B;  3JYU A;  3VR8 B;  3QQ8 B;  1YX5 B;  3ZNZ B;  4KDI C;  2YLM A;  2OOB B;  3QHT A;  4YTP B;  3NZ3 A;  4N59 A;  3EUB 2;  3M3J A;  2YVC A;  1E8Z A;  3TL5 A;  3NY5 A;  4OVZ A;  1TYG B;  2DAJ A;  3QX1 A;  1XT9 B;  5J18 A;  4HVB A;  4TV3 A;  1I7H A;  3GP7 A;  5G2N A;  4WAA A;  3TEY A;  1QIL A;  4HWI B;  2E6X A;  1T3Q A;  5AEK B;  3IT4 B;  1E6E B;  3MC9 A;  1JML A;  2LGS A;  3B2F A;  3DOW A;  1YOV B;  1KLU D;  3KUC B;  4MM3 B;  1QOA A;  2BWF A;  2PTL A;  5G5H A;  4EZJ A;  2C5L C;  3RPF C;  1PGX A;  1PDX A;  1XEE A;  2JX5 A;  1WX9 A;  1WXQ A;  1WX7 A;  4G0N B;  2O6V D;  2LEK A;  3ETR A;  4RNA A;  2H89 B;  2EKI A;  2ZNV B;  2W3S A;  1OEY A;  5E6O A;  2D10 A;  2L1A A;  5J17 A;  1H4R A;  5IA7 A;  3QJZ A;  3PTF C;  1E9M A;  4K81 A;  3OG5 A;  2IBI B;  3ONS A;  1SIF A;  2O2V B;  3QIJ A;  2KC1 A;  3AE8 B;  2KDB A;  2LI5 A;  5D7G A;  3BIN A;  1HXY D;  1JWM D;  2WXP A;  1WI0 A;  3H7S A;  4HDQ A;  3VH3 B;  4MEM A;  5BO4 B;  1C79 A;  1WR1 A;  4IM0 A;  4L2Y A;  4TKN A;  2FUG 1;  2LUM A;  3B2G A;  4ZYS A;  3PVL A;  1DGJ A;  2B76 B;  5IOI A;  2OED A;  3HM6 X;  3AE6 B;  2AEH A;  2B3A A;  3WAM A;  3CSF A;  4XX5 A;  1AYF A;  1WYG A;  2LAS A;  1HTO A;  5LNK 1;  2O6V B;  3I57 A;  3RZW C;  2ZVO A;  1KRH A;  3JW0 X;  1RLF A;  4YSX B;  1WXS A;  4LNO A;  4US8 A;  4IOI E;  4NAM A;  4PK1 A;  4AQ7 A;  1BUI C;  1RAX A;  3M62 B;  3AE3 B;  4URK A;  1C1Y B;  4WWP A;  4LDT D;  3ZW3 A;  3RNA C;  4ARI A;  2DLB A;  3BVG A;  1NI3 A;  2KFJ A;  3PHW B;  2N4F A;  2KJ6 A;  1TY0 A;  1TT5 B;  2RMM A;  4YWG G;  3AH7 A;  4HRO A;  4B95 A;  1F2R C;  5BMG A;  5JHB A;  1Q10 A;  4LJO B;  1Y8R C;  1CJE A;  3JVZ X;  5AZG A;  1EM7 A;  3N3K B;  4IG7 B;  3AV8 A;  1D5X C;  1OQQ A;  4DHJ D;  2SEB D;  4E3C A;  1T6B X;  2KWV B;  2LXC A;  2JPH A;  3Q3F A;  2KJH B;  1ZGU B;  1FM0 D;  1PUT A;  4HXD A;  2AQ2 B;  1KJT A;  2DYO A;  1CZP A;  2MJD A;  1B9R A;  4KX6 B;  5KHO A;  2MW5 A;  2N1V A;  2ONQ A;  1VR9 A;  1WXA A;  1JWA D;  1YN4 A;  2KVR A;  4LDT B;  2AL6 A;  4A55 A;  3R2I A;  2LJI A;  5GXG B;  2QMT A;  5D3D A;  4EFO A;  2WXO A;  2KMM A;  3VVW B;  5DPW A;  5D3I B;  1LQB A;  1Q5W B;  1UNS A;  3BY4 B;  3ALB A;  1F52 A;  4M00 A;  1NVI D;  1VZ6 A;  4J3O D;  2IJ0 A;  1U4A A;  2INC C;  2KFK A;  2LGX A;  2RD0 A;  3LYY A;  4A8X C;  1QOF A;  4MDK E;  1V2Y A;  1WMH A;  1XF5 L;  4NJ7 A;  5EE0 A;  2V4L A;  1E8Y A;  3AE4 B;  2LRU A;  2IGD A;  4DHJ B;  2FE8 A;  2CR5 A;  3NJT A;  1OGW A;  2BYT A;  5C3J B;  1TTN A;  2D5G A;  3DVG Y;  2G9H D;  2HJ8 A;  5IO9 A;  2KX3 A;  3ZUN A;  3N1X C;  3ENE A;  4NAW B;  1C4C A;  3L54 A;  3PO0 A;  3NHE B;  5GMV A;  1XLP A;  4FXC A;  1YMH E;  3K9P B;  4E74 A;  3ZDM C;  1WXM A;  1WSP A;  2HD5 B;  2DYM A;  2KXJ A;  2LVQ A;  3RI7 C;  1KLV A;  3MJ5 A;  1BXT A;  4NJ6 A;  1L0X B;  2K6D B;  3D32 A;  1Z2M A;  3I9V 1;  4GLS C;  4NQK E;  1ET6 A;  2DZI A;  2JWZ A;  4N9F 4;  4RMA A;  2D3G A;  3NUH B;  2I1K A;  3N30 A;  2ZPY A;  4I6N B;  2K1F A;  1JCK B;  3IBE A;  2REX A;  3SR6 A;  2BS4 B;  4MH0 E;  4WQO B;  5TR5 A;  4IWQ A;  2YEP F;  3PZ8 A;  2BS2 B;  4DBG A;  1ZDV A;  3LXF A;  4JL9 A;  4TMA B;  1E10 A;  1JRP A;  3RCZ A;  3IHP C;  2WXF A;  1AW7 A;  3TEW A;  3N1Z C;  3ZNG C;  3HRD D;  4EE2 A;  3GZN B;  4GDL A;  1EU4 A;  1KF6 B;  1WGR A;  3DHI C;  4HJG E;  2WQY B;  2LXA A;  1JAL A;  1FXI A;  4AOF A;  1E7V A;  1E5W A;  4C00 A;  4K7U A;  4RGT A;  1J7A A;  2AQ1 B;  3W5U B;  4ANW A;  1WMH B;  3AE5 B;  5IP4 D;  4MSQ B;  2I2Y A;  2FCN A;  2MRP A;  4N6E B;  3ABV B;  2GBM A;  4EEW A;  1SBB B;  5L95 C;  3HHM A;  3ZRF A;  3X23 A;  2W82 A;  4ICU A;  2H88 B;  4HPP A;  4GGQ A;  3Q8B A;  1J8C A;  1QQR A;  3WCQ A;  1EU3 A;  3TEX A;  4KSK C;  2LD9 A;  1EF1 A;  5G55 A;  4IWO A;  2KKC A;  2KMA A;  4ZRI A;  1V97 A;  2W3R A;  3UIO B;  3VUW A;  1BT0 A;  1SXT A;  4MH8 A;  2HJ1 A;  2WP9 B;  1VLB A;  1V86 A;  3W2D A;  1IUE A;  4W9E A;  2JXX A;  2KZR A;  1VZ8 A;  1V1O A;  1MHX A;  4G50 A;  1JRO A;  2KD0 A;  3H6N A;  4BBN C;  2WDQ B;  4IW0 A;  4NY0 A;  4K3C A;  3UGB B;  1L2N A;  2INP E;  3LDZ E;  2J4X A;  2BTE A;  3L08 A;  4HJK A;  3QWZ B;  5C1Z A;  3KUZ A;  3R7R A;  1HEZ E;  3C8Y A;  2K5P A;  4FJV B;  1P7F A;  2WNM A;  3W1S A;  3QAR A;  4GDL B;  1L4D B;  3L4P A;  1LM8 B;  3B0A A;  2D3B A;  4LNF A;  4ACF A;  4NPN A;  3ML9 A;  3QCA A;  4S0R A;  3FAH A;  1JQ4 A;  2RDG A;  3RUL A;  2D3A A;  4MGY E;  3TSS A;  4TSS A;  3ZJT A;  4YTN B;  4MGI E;  2DWQ A;  3PPA A;  3W1S C;  1OQY A;  1IP9 A;  2G45 B;  4BOS C;  2K39 A;  1YIW A;  2KLG A;  2NS5 A;  3ZO5 B;  4MM3 A;  3MFG A;  1V5O A;  3ZYY X;  2C7H A;  2N9L A;  1UF0 A;  5FK9 C;  2QSD A;  3KVF B;  1Y56 A;  1MG4 A;  3AEB B;  4C7Z A;  3MJW A;  5L83 A;  4WJP A;  2MHJ A;  1XD3 B;  4XZ4 A;  4E71 A;  4PYU A;  4GU2 A;  3BYT B;  3TMP B;  2V3N A;  3HK0 A;  2WDR B;  3O65 B;  4JLC A;  2FCS A;  2N9X A;  3T8M A;  2GBK A;  3ECI A;  4M8M A;  4MGZ E;  2RDB C;  3AUL A;  1WGG A;  4JPS A;  1K8R B;  3VTW A;  2O2V A;  1RM6 C;  1I4P A;  1QZE A;  2ZNV C;  4GIV A;  2WXR A;  4QAY A;  5AUK A;  2JSV X;  3A33 B;  2KQS A;  2ZPN A;  1OTR B;  3BK2 A;  4AUQ C;  2LUE A;  3WAP A;  3AE2 B;  3RFZ B;  5IAA C;  2K8H A;  4US9 A;  1EWC A;  3PZ7 A;  5JH5 C;  1SF0 A;  2L0F A;  2LGD A;  2ASQ A;  4BKS A;  4CHK A;  4LJP B;  1XXG A;  3Q3J A;  4KIK B;  4W9F A;  3N20 C;  2KOX A;  3JSV B;  1WRI A;  1N5X A;  2BGF A;  4AS1 A;  1DOY A;  2IO3 B;  2ON8 A;  3A4S C;  2IY1 B;  4ANX A;  1SE9 A;  2O6V A;  2K8C A;  1I42 A;  2PJH A;  2EKE C;  2V1Y A;  1NBF C;  2QIE B;  1P3Q U;  2GBR A;  4W9C A;  2RDH A;  3APD A;  4HPL B;  1WXV A;  1JRU A;  1ZE3 D;  3ZNI D;  1WF9 A;  3NZU A;  4L23 A;  3RZF A;  1JWB D;  3NVV A;  1FNU A;  5FKA C;  2K0P A;  4II2 B;  3H7P B;  5BYS A;  4JIO U;  1V6E A;  1WZ0 A;  1XLO A;  4B0M A;  3L0W B;  5BYR A;  2QIL A;  1L0V B;  2WYQ A;  3Q6B A;  4N58 A;  1TZO A;  5EDS A;  2IGG A;  2RGF A;  3KYC D;  2KAJ A;  3T9L A;  1SIJ A;  2PEA A;  3VUY A;  1SE2 A;  3Q3O C;  4W9I A;  3AU4 A;  2VH1 A;  3VFK A;  3AEE B;  1DOX A;  1L4Z B;  3M63 B;  4K7S A;  1IGC A;  5JZE B;  1PGB A;  2LMC A;  4BVU C;  2KAN A;  1AN8 A;  3B08 A;  2Y5P A;  2D07 B;  4MAC A;  1GB4 A;  2QHO A;  2MJ3 A;  1MVK A;  3AEG B;  3NVW A;  4WJO A;  3DBL I;  3FKY A;  1KLG D;  1L0Y B;  2K25 A;  4FJY A;  3AEF B;  3KW5 B;  1VZ7 A;  3W9C B;  3SEB A;  3ZIM A;  3BK1 A;  1FRD A;  4KSL C;  3AN1 A;  1ROE A;  4NQL B;  1PGA A;  2KVZ A;  2WXN A;  1IGD A;  4BAX A;  1V8C A;  3NVZ A;  2GBJ A;  4XE0 A;  2PVG C;  3DBH I;  3SD5 A;  4FHJ A;  3H8H A;  2DZJ A;  2I1J A;  5FR3 A;  2DNF A;  4CYE A;  1NEN B;  3PLV A;  1P1A A;  4MEL A;  1UD7 A;  2G3Q B;  4K3B A;  5E6J A;  1V1P B;  1TBE A;  3RNC C;  2IND C;  4FHK A;  1WGK A;  3RNB C;  3B9J A;  3TUO A;  1EO6 A;  2KWU B;  4HKZ E;  1S1Q B;  2QC8 A;  3IVF A;  2MEK A;  4KZ0 A;  1KFY B;  3VTV A;  1ZDX A;  4GN1 A;  4W9G A;  2G1E A;  5FR6 A;  5KHQ A;  3URY A;  2ICI A;  3DVG X;  1GB1 A;  3Q2A C;  2BS3 B;  2CJN A;  2KYW A;  1VD2 A;  1JWU D;  2FCM A;  2MJE A;  1SJH D;  3WAO A;  4GXB A;  1LFD A;  2M0X A;  4JQW C;  2PE6 B;  4A20 A;  1CMX B;  1YN5 A;  2JZ3 B;  2KDE B;  3APC A;  3MHZ A;  3AU5 A;  4NAW A;  4DWF A;  1UWM A;  2CHZ A;  1TZ1 A;  2LJ5 A;  2JRI B;  4TQ0 A;  1F2R I;  2MX2 A;  4DK5 A;  3T3O A;  2G4D B;  2RPQ A;  5E6P A; 
#chains in the Genus database with same CATH homology
 2K3U A;  4CQN A;  1VRA B;  4LLG M;  4JE3 B;  1C76 A;  3U4E G;  2YEP F;  3PZ8 A;  3Q8A A;  2BS2 B;  3VRA B;  1ZDV A;  1SB3 C;  3LXF A;  2X38 A;  2MH7 A;  4TMA B;  5EE3 A;  1PFD A;  1E10 A;  1JRP A;  4LK0 M;  3P4P B;  2WXF A;  1AW7 A;  1ZOY B;  2JU6 X;  2QEJ C;  4WWM A;  2LHE A;  2FBW B;  1GTH A;  3TEW A;  2NMQ A;  5HI1 A;  2L52 A;  3HRD D;  3Q8F A;  4EE2 A;  1NYR A;  2VZK B;  1CK1 A;  1OFF A;  5EE9 A;  3IXS A;  1TKY A;  1P7E A;  3VR9 B;  1XLN A;  3BVZ A;  1EU4 A;  1CQV A;  4ITK A;  1KF6 B;  4IKG A;  3CIR B;  2E3T A;  4OZC A;  2V3P A;  4M0W A;  2PIA A;  5HHD G;  3BII D;  3ZGZ A;  2IDY A;  1FXA A;  4JWU C;  3GS2 A;  4HJG E;  2WQY B;  2L32 A;  1YJI A;  5T8I A;  1JAL A;  1FXI A;  3FC4 A;  4RGT A;  1J7A A;  2AQ1 B;  3W5U B;  3EGR A;  1MI0 A;  4IDI A;  1ACC A;  2KN4 A;  2M0A A;  3MP9 A;  1J7C A;  3AE5 B;  2WXM A;  1SSN A;  5C2T B;  2WXQ A;  1K51 A;  3J9C A;  1NEK B;  2J52 A;  2NTT A;  2KDM A;  4MT5 A;  2WU5 B;  2RPV A;  3BYY B;  2M19 A;  2I2Y A;  1KTK A;  4C80 A;  4N6E B;  3ABV B;  1TKE A;  2SAK A;  2N7J A;  3KWV A;  1ENF A;  1A70 A;  1SBB B;  1BML C;  1J7B A;  3UI3 A;  3AEC B;  2CJO A;  4R3D A;  1I4Q A;  4RGM A;  2ZW1 A;  2W82 A;  3EA6 A;  1E0Z A;  4UDU C;  1I4R A;  1YQ4 B;  2KQ4 X;  3TEZ A;  3SFD B;  2H88 B;  3AED B;  2LGI A;  3Q8B A;  2JYE A;  4ZOH C;  4ARC A;  3P4Q B;  3OWE B;  1FNW A;  1QQR A;  2QJL A;  5EE1 A;  3WCQ A;  1EU3 A;  3Q69 A;  3Q8E A;  4REZ A;  4HKQ A;  3TEX A;  2AQ3 B;  2K22 A;  1LO5 D;  2IGH A;  4ZRP A;  1V97 A;  2W3R A;  1K52 A;  1WWT A;  1SXT A;  4MH8 A;  2WP9 B;  1VLB A;  2M56 B;  1IUE A;  3W2D A;  1FNV A;  4PT5 A;  4H2A A;  5TSS A;  1ZP0 B;  3DWM A;  4ZHO A;  3P4S B;  1FO4 A;  1VZ8 A;  3VRB B;  1TS4 A;  2PMV A;  1V1O A;  3P4R B;  1MHX A;  3W5V B;  1JRO A;  2W54 A;  2WXK A;  2PW9 A;  2WDQ B;  1B1Z A;  2Q5W D;  1XO3 A;  1RWS A;  2J53 A;  2HDE A;  2INP E;  3DWG C;  1C4P A;  2J4X A;  3VR8 B;  2BTE A;  3O13 A;  1E7P B;  1YJJ A;  5G5G A;  1JW9 D;  1HEZ E;  2WXI A;  3AM9 A;  3C8Y A;  1MHH E;  4RCO A;  3HUI A;  4YTP B;  1HZ5 A;  2K5P A;  3NZ3 A;  4N59 A;  3AE1 B;  3EUB 2;  1D5M C;  3V05 A;  3N9Y C;  1P7F A;  2I38 A;  2WNM A;  1TYG B;  4OVZ A;  3W1S A;  5MPO A;  1OQR A;  4GDL B;  1L4D B;  1I7H A;  3GP7 A;  3AMZ A;  2GB1 A;  3L4P A;  3TEY A;  1QIL A;  3AE7 B;  4WQM A;  3ZQ4 A;  1ZXI A;  2E6X A;  2TSS A;  3LB8 C;  1T3Q A;  2WXG A;  3SFE B;  1E6E B;  3IT4 B;  3FAH A;  1N62 A;  2XN9 C;  1JML A;  1JQ4 A;  2RDG A;  3B2F A;  1KLU D;  4MM3 B;  3TSS A;  1QOA A;  1SEB D;  4TSS A;  3ZJT A;  2PTL A;  4YTN B;  5G5H A;  2DWQ A;  3P63 A;  3RPF C;  1PGX A;  3KLS X;  1PDX A;  1XEE A;  1EWY C;  2JX5 A;  4KGS A;  3IAM 1;  1WXQ A;  1GT8 A;  2V4I B;  4XWW A;  4A9A A;  4TQ1 A;  2LEK A;  3ETR A;  4RNA A;  2H89 B;  2EKI A;  4HEA 1;  1GAQ B;  2KWD A;  2W3S A;  4YXD B;  2PLP A;  4NZL B;  1TS2 A;  4RH6 A;  1FD6 A;  2V0G A;  2L1A A;  4RGN A;  1FRR A;  4XWT A;  3MFG A;  1DOI A;  3ZYY X;  1E9M A;  2N9L A;  5FK9 C;  2QSD A;  1N60 A;  1Y56 A;  1ZUD 2;  2INN E;  4DXF A;  2J42 A;  3AEB B;  2N0S B;  4C7Z A;  3AE8 B;  2WLB A;  1UWX A;  2JZP A;  5D7G A;  1YN3 A;  4YTM B;  3BYT B;  1HXY D;  4KGR A;  2V3N A;  2WDR B;  4RF1 A;  4P16 A;  1JWM D;  2WXP A;  3BWU D;  4LTU A;  3P1M A;  1C79 A;  4JPS A;  2XNA C;  2WU2 B;  4WUR A;  1D5Z C;  1L6U A;  4L2Y A;  2FUG 1;  2YEP B;  1RM6 C;  2LUM A;  1I4P A;  3B2G A;  4OZA A;  4ZYS A;  2WXR A;  5AUK A;  2JSV X;  2EEL A;  1I4G A;  1DGJ A;  1NYQ A;  1YQ3 B;  4KKJ A;  3BK2 A;  2B76 B;  1TY2 A;  4YSY B;  2OED A;  3AE6 B;  2Z8L A;  2LHD A;  1ZPS A;  3AEA B;  1GOZ A;  1XCQ L;  3AE2 B;  3Q8C A;  3R2T A;  4ZHP A;  1L5P A;  3RFZ B;  1AYF A;  1WYG A;  4US9 A;  1EWC A;  3PZ7 A;  5LNK 1;  1ET9 A;  4DQO C;  1SF0 A;  4C56 C;  1QLB B;  3I57 A;  1SE3 A;  1KRH A;  2WS3 B;  1XXG A;  2KAC A;  3R8B A;  1QF6 A;  4YSX B;  4OZB A;  4US8 A;  2W55 A;  4IOI E;  2WDV B;  4NAM A;  1WRI A;  3KQ4 A;  2LFI A;  4DXG A;  1N5X A;  4AS1 A;  1DOY A;  1GTE A;  2ON8 A;  4AQ7 A;  1BUI C;  2K9X A;  4B0E A;  3AE3 B;  1C78 A;  1FFV A;  1C9F A;  1D4B A;  2NTS A;  4Q2J A;  1IBX A;  1M4V A;  2DLB A;  4ARI A;  3BVG A;  5I4D A;  1NI3 A;  4NJC A;  2QIE B;  2BBC A;  1C4A A;  5H92 C;  1RFK A;  3HVZ A;  1TY0 A;  2RDH A;  3BZD B;  4WIP A;  2RMM A;  4YWG G;  3AH7 A;  4HRO A;  1TJE A;  1F2R C;  1ZE3 D;  5BMI A;  3NVY A;  5BMG A;  1Q10 A;  4L23 A;  1STE A;  1L6V A;  1CJE A;  1RYJ A;  4RF0 A;  1N5W A;  2ZW0 A;  1EM7 A;  1H7W A;  3E9S A;  1JWB D;  3NVV A;  3IAS 1;  3AV8 A;  1FFU A;  1D5X C;  1OQQ A;  1FNU A;  4USA A;  5H8Y E;  2PVO D;  5FKA C;  2HTM E;  1TS5 A;  2JQR B;  1HQR D;  2K0P A;  2SEB D;  2WXL A;  4ZRQ A;  3U7Z A;  5BYS A;  1QOG A;  3FIL A;  1T6B X;  1XLO A;  4B0M A;  1ESF A;  3HVD A;  5BYR A;  1QKZ A;  2N9K A;  1JWS D;  2QIL A;  4O1N A;  1L0V B;  4YT0 B;  4WAF A;  4N58 A;  1TZO A;  2IGG A;  2GI9 A;  1FM0 D;  1PUT A;  2KAJ A;  1KH0 A;  1XCT L;  2R61 A;  2AQ2 B;  3ZJV A;  2DYO A;  1CZP A;  1SIJ A;  2AX5 A;  1FCC C;  1SE2 A;  2MJD A;  3V3X A;  1K53 A;  1YNT E;  1DYQ A;  1B9R A;  4KX6 B;  3AEE B;  1DOX A;  1L4Z B;  2ONQ A;  1VR9 A;  1XLQ A;  4L1B A;  2OHF A;  1IGC A;  4JWS C;  1PGB A;  2LMC A;  3CWI A;  3IT6 B;  1AN8 A;  1JWA D;  1QOB A;  1YN4 A;  2Y5P A;  4MAC A;  3NS1 A;  1QT9 A;  2BW2 A;  1GB4 A;  1TKG A;  2MJ3 A;  1MVK A;  3AEG B;  1HZ6 A;  2CU3 A;  3NVW A;  4A55 A;  1KLG D;  1L0Y B;  3R2I A;  2LJI A;  5GXG B;  3AB5 A;  5BMH A;  1FEH A;  2QMT A;  4P6V F;  3AEF B;  2BB6 A;  5D3D A;  1VZ7 A;  2WXO A;  1R7S A;  1F77 A;  2KMM A;  3W9C B;  4RGO S;  3SEB A;  3AE9 B;  3BK1 A;  1FRD A;  3T3N A;  4GDK B;  3AN1 A;  1ROE A;  5D3I B;  3ZJU A;  2JYT A;  1UNS A;  4C7Y A;  1PGA A;  2WXN A;  1TS3 A;  1IGD A;  3U52 E;  1NVI D;  1V8C A;  1VZ6 A;  2IJ0 A;  3NVZ A;  4J3O D;  5JXV A;  4XE0 A;  2PVG C;  3VQI A;  4RFB A;  3H8H A;  1H7X A;  3LYY A;  3MC0 B;  4A8X C;  1QOF A;  2GRI A;  1XF5 L;  5EE0 A;  5FR3 A;  1NEN B;  1T5X D;  3AE4 B;  2BB5 A;  2JXT A;  2WXH A;  2IGD A;  2FE8 A;  1SE4 A;  3P42 A;  2BYT A;  5E6J A;  1D6E C;  1FCL A;  1V1P B;  5C3J B;  1WGK A;  1K50 A;  3B9J A;  3TUO A;  1IBX B;  2VZK D;  4HKZ E;  2D5G A;  1FMA D;  1N63 A;  4KGT A;  4YSZ B;  2G9H D;  2MEK A;  4HRS A;  1KFY B;  2JWU A;  1ZDX A;  1F0Z A;  1UGJ A;  3BVM A;  4OW0 A;  2G1E A;  3URY A;  3U2S C;  2ICI A;  3E56 A;  1GB1 A;  1I4X A;  2L83 A;  3GB1 A;  4NAW B;  1C4C A;  4D2K A;  3PO0 A;  2BS3 B;  2CJN A;  1JWU D;  2MJE A;  1SJH D;  1HA5 A;  1XLP A;  5AUI A;  1V1P A;  1MPE A;  1UUP A;  4FXC A;  1YMH E;  1GPX A;  4KKI A;  4A90 A;  2DBY A;  4JX1 C;  5HG2 A;  1WSP A;  5BYQ A;  5HFY A;  2DYM A;  2IPK D;  3KWL A;  1ZXH A;  1YN5 A;  3CF4 A;  1VJK A;  2Y3A A;  3MJ5 A;  1BXT A;  1SJE D;  1L0X B;  2Y5C A;  3MHZ A;  3FIL B;  2WXJ A;  1N61 A;  1PYW D;  1UWM A;  4A6Q A;  3I9V 1;  4GLS C;  1AWD A;  1C77 A;  1ET6 A;  1I4H A;  2ACZ B;  4OHJ A;  4WH4 A;  4TQ0 A;  1VDV A;  1F2R I;  3NUH B;  4XDD A;  1FIQ A;  1JCK B;  3T3O A;  3NRZ A;  2BT6 A;  3SR6 A;  2BS4 B;  4XDC A;  2PKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...