3AEAB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aeaB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aeaB01
3KWLA 1QOFA 3FC4A 1FFUA 3ABVB 4KX6B 1WRIA 4WWMA 2WU2B 5H92C 1FMAD 1RFKA 1FXIA 2FBWB 1QT9A 3AV8A 2WDQB 1E9MA 4JWUC 3W5VB 1GPXA 2WS3B 3AEBB 1J7BA 4YXDB 1L6UA 1WXQA 3EUB2 3NVZA 2WU5B 3VRAB 2W3RA 4C80A 2MJEA 2PIAA 1FRRA 1TKYA 2Q5WD 2K22A 2N0SB 3AN1A 3HRDD 2DBYA 3NRZA 1JQ4A 2LEKA 4ITKA 2Y5CA 3HUIA 1DOXA 3VR9B 1PUTA 2JX5A 1GT8A 3SFDB 4ZHPA 2M19A 1GTHA 5G5HA 1OFFA 1UWMA 4P6VF 1OQRA 3CIRB 3AE7B 2CU3A 3AE2B 1E6EB 4US8A 1H7WA 1R7SA 3B2FA 2K9XA 1TJEA 2ACZB 1SB3C 1YQ4B 1JALA 1FM0D 1V8CA 1JROA 5G5GA 1F0ZA 3AEFB 3ETRA 2WDVB 3B2GA 1NEKB 4N59A 2L83A 1L5PA 3AE8B 3NVVA 3PO0A 1NVID 2MJ3A 5AUIA 3NS1A 3NVYA 1B9RA 1XLQA 2DWQA 2KAJA 3AEEB 1TYGB 1QLBB 1QOBA 4LTUA 4N6EB 2PVGC 1VLBA 2MJDA 4JX1C 5EE3A 3W5UB 1N62A 1WGKA 2W54A 3L4PA 2G1EA 4HRSA 1FO4A 1ZP0B 1AWDA 2WDRB 3SR6A 4A9AA 1DOYA 3P4QB 1JRPA 2B76B 2BS2B 4YTNB 3AE5B 4C7YA 1FRDA 2KMMA 1YQ3B 1ZUD2 2MH7A 4N58A 1JWBD 1VDVA 5EE0A 2QJLA 4USAA 2QIEB 4YSYB 1N5XA 2WQYB 2CJNA 2WP9B 4YSXB 3AMZA 3W9CB 5MPOA 3ZYYX 4WQMA 1TKGA 1N61A 1N60A 3DWMA 2HTME 4YTMB 2L52A 3P1MA 1T3QA 3WCQA 1KFYB 2JQRB 2E3TA 5EE1A 2BS3B 3RPFC 1OQQA 2W3SA 1RWSA 3SFEB 2H88B 1L6VA 3AEDB 1WYGA 3NVWA 3AE9B 3VRBB 3DWGC 1NENB 4IDIA 1NYQA 1ROEA 4JWSC 3CF4A 3AE4B 4US9A 1PFDA 4ZOHC 5C3JB 3AH7A 1RM6C 3AE1B 2M56B 1RYJA 3AECB 2BT6A 1TKEA 1N5WA 1A70A 4YSZB 1L0VB 1AYFA 1JW9D 1PDXA 5AUKA 1XLNA 1KF6B 3AE3B 1I7HA 1NI3A 3B9JA 3FAHA 2W55A 3P63A 3AB5A 2OHFA 4HROA 1ZOYB 1N63A 1DGJA 5C2TB 2PVOD 3P4RB 3AM9A 1NYRA 1QOAA 2K5PA 2CJOA 1CJEA 1XO3A 3P4SB 4YTPB 5H8YE 1JWAD 2WLBA 1QF6A 1IUEA 1J7AA 1DOIA 1GTEA 1FFVA 1YJJA 1YJIA 1ZXIA 5EE9A 3AEAB 1VJKA 3AE6B 3AEGB 1V97A 2H89B 1SIJA 2PKOA 3LB8C 1H7XA 4ZHOA 4C7ZA 1XLPA 1J7CA 3P4PB 1CZPA 1FIQA 1GAQB 2BS4B 1FXAA 1QOGA 3BIID 3CWIA 1E0ZA 3LXFA 1SF0A 1EWYC 4FXCA 3VR8B 1XLOA 2AX5A 1E10A 5GXGB 3HVZA 2EKIA 1WWTA 4YT0B 1KRHA 1E7PB
chains in the Genus database with same CATH superfamily
1IBXB 3IT6B 4TQ0A 1V5TA 1WI0A 2ZZPB 4NQLB 4AJYB 3GS2A 2V4IB 3PRMB 3R8BA 2ZVOA 4ANVA 2BKFA 3VRAB 1L0YB 4BOSC 4S17A 2VH2A 2KX3A 2AQ2B 2JX5A 2NMQA 2LGXA 1GTHA 3ZJTA 2N4FA 1T5XD 2WXFA 4MEMA 5LNK1 2IGGA 3HM6X 5G5GA 3TMPB 4NJ7A 4NPNA 2Z0DB 4LCDE 3APCA 2WXIA 3QC8B 3QHTA 1VZ8A 4WIPA 2BS2B 4YTNB 4NQKE 3MC0B 1ZKHA 2RDGA 2G4SA 3GP7A 4AWJA 1SE2A 2RPQA 3UQAA 1WJNA 2QIEB 2CJNA 1WYWB 3W9CB 1EO6A 2ASQA 2KDMA 2Y3AA 3MJ5A 3N1YC 2KQ7A 2DAJA 4KKJA 2M8SA 1XXGA 4O1NA 5J18A 3AEDB 5CX3A 4B95A 1SGHA 2FE8A 1J8CA 1OGWA 3BY4B 2D3GA 1HA5A 1YN4A 2Z8LA 1TIFA 4ANWA 2L32A 2AQ1B 2CJOA 2KVZA 2ZCBA 5H8YE 5DPSA 3AU5A 1ZXIA 3Q2AC 2BYTA 1AW7A 4II3B 2K39A 4PS8A 4NAWA 3IBEA 1QOGA 4DBGA 2KQSA 3RYTA 4KDIC 2LXCA 2O6VD 4GIVA 5BMIA 1MHXA 3W5VB 1EF5A 2AL6A 4ICVA 2MJEA 3VAWA 3HRDD 1V80A 2BPSA 4E3CA 2WXHA 4GLSC 1CQVA 2JF5A 3DVNV 3IAS1 4DHJB 3TEYA 3EC8A 2EKEC 3AE7B 3A9KA 1WF9A 1WR6E 5C1ZA 1WR1A 4XGAB 1WFYA 3L54A 1F0ZA 3KUZA 4EZLA 2WDVB 2KD0A 1GC6A 4ZRKA 3VDZA 3AE8B 4DK5A 2KOXA 1NVID 1TZ1A 1C1YB 2DWQA 1KM7A 4BBNC 3MTNB 3KYCD 4JIOU 4FA6A 1F2RI 1VD2A 3NUHB 1FRDA 2KN5A 4MM3B 1YQ3B 2FCNA 3RN9C 4N58A 5EE0A 2WXOA 4M8MA 2EMSA 1V81A 3Q8AA 5BYSA 4TMAB 2N9XA 5CHFA 1UF0A 2FCMA 2C60A 3WAMA 3WIMA 2C5LC 4OZCA 3DVGY 2LI5A 3A33B 1YMHE 1L2NA 5FR6A 4DXGA 4KDLB 3DWGC 1SEBD 1I42A 2ZNVC 4FULA 4E74A 2LXAA 4L2YA 2OHFA 2J53A 2PVOD 2LFIA 2K0PA 2K5PA 3PS6A 4N9F4 3ZNID 2MCNB 4FJYA 4G50A 2K1FA 3LB8C 1SE9A 3QIJA 1ZDVA 4ACFA 4HPLB 4P16A 2I1JA 3Q3FA 3DBHI 2J42A 3EECA 4MGKE 3A4SC 2JWZA 2FBWB 1WXVA 3DHIC 2ZPYA 2V3NA 4TQ1A 3E9SA 3AN1A 2KACA 3BK2A 3UINB 5LXIB 1IYFA 4D2KA 3H7PB 3A1QA 1GT8A 2RMMA 2BWFA 1SIFA 4DHJD 1UZXB 1YOVB 2DZJA 2BF8B 2QSDA 3PPAA 2ACZB 2KVRA 2Y5BB 4GDLB 2NCNA 4MH8A 2MSED 2QC8A 2TSSA 5D7GA 3PO0A 1UH6A 5DPTA 1RAXA 1FXTB 2GBJA 3V3XA 4B9KA 2MW5A 2XK5A 4JQWC 4IOIE 3PVLA 3RNAC 4C7YA 2W9NA 2ON8A 3VHTC 1ZDXA 3PREA 2OOBB 3VXWA 4EKUA 4YSYB 2NBVB 1HXYD 2LUMA 2AEHA 4YTMB 3WCQA 3OAWA 1XEEA 1YX5B 3NVWA 1TY2A 5J2RA 1MG8A 4LNKA 2HTHA 1I7HA 1WZ3A 2ZPNA 1ZXHA 2MP2A 4F1SA 3APFA 1OEYJ 3DQVA 3APDA 1YJJA 1FFVA 4ARCA 4LNFA 1WX8A 2GBNA 1SIJA 3JSVB 2LVPA 4FXCA 2L8JA 4K1RB 3B0AA 1KRHA 1ET6A 4ZYSA 2UYZB 2IY0B 4CQNA 2IZVB 3AXCA 1C4PA 1WXQA 2JZ3B 3V62A 3AI5A 4KV2A 5E6OA 2PPHA 1ZGUB 2Y5CA 3BVMA 3DDCB 4AUQC 2BYEA 2IBIB 1OQRA 1KH0A 3Q6BA 3ENEA 1H7WA 4IWQA 1TS5A 3M62B 2C7NB 4W9JA 1AN8A 1FM0D 4NNJB 4HK2A 2WNMA 3I57A 1L5PA 3P42A 3NVVA 1VCBA 5AEKB 2V1YA 3AEEB 2ZW0A 2BYVE 1GB4A 4LJOB 3UIOB 2KC2A 1TZOA 1WGKA 2W54A 1WJUA 1AWDA 1PGXA 2CR5A 3N1ZC 3ZIMA 5BO4B 2G4DB 1QZEA 2O6VA 3RNBC 2HTME 1D4BA 1RWSA 3ZXVA 3U30A 3VUXA 4BFRA 4XDCA 1RYJA 4GB9A 2I2YA 1WIAA 1KF6B 1G6JA 4C4VB 1CMXB 1MPEA 2LHDA 4B6WA 2C9WB 2VZKB 2DZKA 4LNNA 1JWAD 4KSKC 3Q3JA 2D3CA 1KJTA 1ISNA 3P4PB 1GAQB 3CWIA 2KJ6A 1E0ZA 1E7VA 2D3BA 2XN9C 2V3PA 2EKIA 3C19A 1HZ6A 1I4HA 4YT0B 2J4XA 4ZYNA 3SDLC 2LJ5A 3ABVB 4HVBA 5H92C 2IO2B 1FXIA 3UF8A 5BYQA 3M63B 4HDOA 2PE6B 1JQ4A 5E6JA 2KWCA 4IW0A 2WU5B 1E8WA 4TKNA 2NR2A 3VR9B 1PUTA 3PZ7A 4KIKB 2K6QA 4FN2A 1WGHA 1V86A 5G5HA 3SHQA 3AE2B 1D5MC 3RD2A 1E8XA 2GLSA 4XX5A 4N59A 2JZPA 4RMAA 3NS1A 1B9RA 3R2TA 3EFCA 1TT5B 2MX2A 4ICUA 2GOWA 4DWFA 3NG0A 1JRPA 1P0RA 2LMCA 4NZLB 1N6ZA 2LJIA 1C4CA 1EM7A 4BKGA 2M4NA 1V9JA 3A9JB 3PRZA 1WMHA 2INNE 3QQ8B 2BS3B 4KKIA 1ESFA 1F9JA 3AE9B 4M0WB 4IM0A 2V4LA 2NVUI 2JSVX 4BZAA 3I63C 2K25A 1GUAB 2WXKA 2KYWA 2QMTA 2KMAA 4WAFA 1T0SC 5KHQA 2IY1B 3QWZB 3PHXB 1WRDB 1KOTA 2LVQA 3BIID 2CHZA 1E8ZA 1XLOA 1E10A 4W9HA 3ZJUA 1C76A 5AZFA 4BAXA 4EZKA 3BVZA 4ASWC 2WS3B 4YXDB 3DVNU 2MLBA 4Q2JA 2N7EA 1UGMA 3L08A 5HG2A 5IAAC 1XQQA 2M19A 4HJKA 1UWMA 3LYYA 3KVFB 3HM3A 3ZDTA 3UQBA 4HXDA 4TUUA 2WX1A 3ZRFA 2DLBA 2IJ0A 1VRAB 1E90A 1I35A 4LK0M 2DYBA 3W1YA 2YLMA 3GZNB 4W9IA 3L4PA 4MJSB 3TIXA 3ZW3A 3KYDD 4FHJA 4G0NB 1JWBD 1BMLC 2UWQA 2LRWA 4W9EA 2KK8A 3FILA 3V05A 4K7WA 5FK9C 4MACA 2N9EB 3VRBB 3RZFA 4RFBA 4EFOA 3AH7A 2YEPF 4KGTA 1F2RC 1JMLA 4I6PA 5HFYA 3TUOA 3QCAA 4YWGG 1JWUD 1NYRA 3RUIB 4JPSA 1VZ7A 2Z59B 1ET9A 2K6DB 3AEGB 1V97A 4L1BA 2L1AA 3N32A 1V1PA 3H6NA 2BS4B 1ENFA 2L0FA 1EWYC 1T0RC 4MDKE 1V49A 4NY0A 4W9KA 4DDID 4L23A 2BBCA 4DHZB 3VVWB 3NVZA 3JW0X 2PIAA 1FRRA 1TS3A 4LNOA 1VR9A 1DOXA 2MHJA 5IN7A 5BMHA 2K3UA 4NJCA 4IUMB 1WY8A 2FNJB 1R7SA 1F1HA 2BB5A 1D3ZA 2KFKB 2CHXA 4X57B 2DZMA 1CK1A 1P7EA 3ETRA 4XDDA 2PEAA 3ZLZA 1YD8U 2L83A 5D2MB 4CHKA 3HK0A 4QAYA 4HPPA 1XLQA 1TYGB 1HTOA 3VH4B 3WAPA 3Q8EA 3OJ4B 5I4DA 1I4XA 4A6QA 2MH7A 1C9FA 4LDTB 3MP9A 1I4PA 2LWPA 2WQYB 3AMZA 1I4QA 1UWXA 4MGZE 3M3JA 3DHGC 1YQBA 2O2VA 2N7DA 3RPFC 2BKRB 4M8NA 3CSTA 5L95C 2DNFA 4KVGB 2GBKA 3RNGC 4IDIA 2FCSA 1WX7A 2KTRA 3Q8FA 2PE9A 2KMCA 3FAHA 4A3OA 2W55A 2QEJC 3AB5A 5D94A 2DENB 2NPTA 3C0RB 3ZO5B 3DBRB 2J7QB 1K51A 1JWSD 5EE9A 4HEA1 1Q10A 3TL5A 1RFAA 2GBRA 2PJHA 2FIFA 2YVCA 3PV1A 1FFUA 2J52A 1L7YA 4KZCA 4ARIA 1GPXA 3AEBB 2LZ6A 4GDKB 3B08A 1EU3A 2D11A 5IOIA 2MRPA 2KLCA 2RSUA 3VUYA 2IDYA 4ZHPA 1GB1A 4REZA 4EZJA 1P9DU 5KHOA 2XEWA 3ZNGC 3DCGA 3KUDB 2I1KA 2YEPB 3ALBA 4RF0A 3W2DA 1V8CA 3V61A 2JRIB 1NEKB 2FCQA 3VUWA 2KJHB 3KH0A 1LO5D 2KAJA 4UDUC 4A55A 4N6EB 2MJDA 2MBBB 1N62A 3MHSD 2WDRB 3QA8A 1PGAA 3WAOA 2DHZA 1TTNA 1V6EA 4HCNB 4USAA 3EHVA 5D6JB 2C7HA 3ZYYX 2JY6A 5CHVC 4K3BA 4F7ZA 1EF1A 3RI7C 2KT7A 2W3SA 1BUIC 3E56A 1PDXA 1AYFA 1XLNA 3P63A 2LGYA 1T0YA 3N30A 3QK0A 1E5WA 1IUEA 1WH3A 1YJIA 4BBNF 1WZ0A 2R2OA 3Q69A 1C4AA 1J7CA 1CZPA 3KQ4A 5G55A 1SF0A 2WXRA 2L0TA 2AX5A 2WWZA 4I6NB 3RFZB 4FJVB 1S1QB 1P98A 2ZVNA 4NAWB 3TEZA 3RMKC 1WGRA 1LGRA 1OTRB 2BGFA 2KJRA 1J7BA 4PYUA 4MGIE 4B0EA 2W3RA 3RT3B 2K8CA 1E7UA 1WX9A 2FUG1 2KC1A 2CU1A 2HJ8A 3T3OA 2INPE 2R61A 2KWDA 2KO3A 1C3TA 1FCLA 2BW2A 2N1WA 4JGHB 5FR3A 4DXAB 2N7JA 2ZCCA 4RH6A 4FLHA 2HE7A 1OEYA 1F52A 1C79A 3NVYA 3A9KB 2BWES 4GMVA 3L10B 2V0GA 4MSQB 1VZ6A 4A9AA 1Q5WB 2V9HA 2KMMA 4PYZA 2IO3B 2WXPA 2WXGA 1N5XA 3A4RA 1LFDA 2REXA 1I4GA 1FNVA 1KLUD 2E3TA 4TV3A 4GOCA 2JYEA 1V2YA 5AZHA 3CF4A 1FCCC 3PGEA 1N5WA 4YSZB 5C23A 4AP4C 4W9FA 4HPMB 1SJED 2RDHA 3QJZA 1ZW7A 2LHEA 4HROA 4KSLC 3ZRCA 3KW5B 1C77A 2GB1A 3P4RB 4RM9A 2NBUA 5DPRA 1IBXA 4IWPA 3ZKJC 1J7AA 2KHWB 4HKZE 4PS3A 1FXAA 1AARA 3LXFA 1PYWD 4OVUA 1T6BX 1E7PB 5HHDG 3KWLA 1STEA 4RGOS 4XYCA 2WU2B 3WA0A 1H8CA 2EELA 4NJ6A 2AQ3B 5CTRC 2L3ZA 3GZNI 4A8XC 2N9PC 4RCOA 2K22A 2AYOB 2N0SB 4K7UA 1WE6A 2N1VA 1R4NB 3R3MA 1RLFA 4K7SA 3CF6E 3CSFA 3NY5A 4US8A 1QQRA 1BT0A 1SB3C 2FIDA 2X38A 4RGTA 3I3TB 3A1QB 2KQ4X 3BINA 3C8YA 2JZZA 1JRUA 4LTUA 4B0MA 2Y5PA 1R4MB 1I4RA 3U2SC 1FNUA 1LQBA 1MFWA 1TBEA 3ZJVA 2R2QA 3AE5B 3H9DA 1TS2A 2KNBA 2C7MB 4OHJA 2XK5B 1N60A 4FADA 4PS7A 1PQSA 3SFEB 2WXQA 1FD6A 2KWVB 3BWUD 1ROEA 4US9A 2ZEQA 3PLVA 2G9HD 2M56B 3K9OB 3AECB 1UUPA 2RDBC 2ZNVB 2LUEA 2JWUA 3U7DA 4AS1A 1HQRD 1ZOYB 2LRUA 3AM9A 1K8RB 3IAM1 5GMVA 1EU4A 3KLSX 1YN3A 3AE6B 1H7XA 2MP2B 2DYOA 4AJWA 3OG5A 4AQ7A 1U4AA 2L76A 5IA7A 1JWMD 1E9MA 5JHAA 3U52E 3L16A 3T3NA 4M02A 4C80A 2VZKD 1ACCA 3MHZA 3SU8X 4EE2A 2MBHA 2MQJA 2PLPA 3O65B 2KTFA 1KLVA 2CKHB 3HVDA 1LM8B 2K9XA 3O13A 2LGIA 1M4VA 3KWVA 1JROA 1J0GA 2I38A 1Y8RC 1QKZA 1S3SG 2KZRA 2IGDA 1QLBB 2PVGC 4DXFA 4JX1C 4PT5A 3MC9A 2E6XA 2G1EA 2SEBD 2GMIC 2LVOA 4H2AA 3WALA 2WDTB 3DBRI 1FNWA 2JUOA 1WXMA 1ZUD2 2QJLA 3T8MA 1MJDA 1UELA 1WM3A 2INCC 4ZRJA 1TKGA 5HI1A 2L52A 3PZDA 3GB1A 3DOWA 3T9LA 2H88B 2RR9A 4WWPA 4RF1A 1NYQA 1PFDA 4AOFA 2WYQA 4ZOHC 2O6VB 2KWUB 3TJPA 4A90A 1L0VB 3BYYB 3R7QA 2J0MA 5TSSA 1DGJA 5C2TB 1XT9B 3Q8BA 4MH0E 3VTUA 3P4SB 4YTPB 4IM2A 4MT5A 1GTEA 1SE3A 2JT4B 1ZPSA 4G3XB 1FO4A 2HDEA 2MA9B 1EUVB 4ZRPA 3VR8B 2KN4A 4DQOC 1WGGA 2DYMA 1P1AA 3FC4A 3ZXRA 1WRIA 3H7PA 3TSSA 5TR5A 4WURA 2J0JA 3PZ8A 3AV8A 4ANUA 2INDC 1P3QU 4WH4A 2Q5WD 4ZRQA 2M0XA 2DBYA 4GDLA 2LEKA 3KUCB 1T0QC 4OVZA 1GJZA 3RNEC 1SSNA 2K8BA 3VH3B 4HDQA 3DVGX 2JU6X 2CU3A 2HD5B 1E6EB 4JL9A 1TJEA 2BB6A 2MBEA 2IO1B 3AEFB 2DZIA 1GC7A 4DHZE 1K52A 1IP9A 4C00A 2FUHB 3H7SA 2EMTA 4W9CA 3UGBB 1TS4A 4GGQA 5EE3A 5JZEB 2NS5A 4FHKA 4WQOB 2KDFB 4CO7A 4BVUC 3ONSA 4WWNA 3L0WB 4S0RA 3LJ3A 3MC8A 4A3PA 3VTWA 4C56C 5BMGA 1WM2A 2LGDA 3Q8CA 4II2B 1T3QA 2JQRB 4RGMA 3ZQ4A 1NENB 4A20A 5C3JB 3AE1B 4RNAA 3W1SC 1WMHB 1A70A 1JW9D 5AUKA 3JSVA 1GG3A 2JXXA 1V5OA 2BVCA 3ZTCA 2GI9A 3B1LX 2JPHA 3R66C 1DOIA 3TEXA 3Q3MC 3AEAB 1NDDA 1WE7A 4W9GA 4ZHOA 2WX0A 1XCTL 4C7ZA 1XLPA 2WXNA 1P7FA 1TY0A 3NHEB 2J0KA 2BYFA 3VTVA 3NZSA 2V3SA 4WJPA 5BYRA 3N20C 3GE3C 3DBLB 5AZGA 3EUB2 1HTQA 4TSSA 4P1CC 3Q3OC 3H1UA 4ITKA 3DHHC 1WXSA 3N1XC 2VH1A 2MBOA 2UU7A 3L17A 2RPVA 1Q1OA 1MI0A 3CIRB 2OEDA 2ICIA 4GN1A 4IKGA 4FBJB 1V1OA 2KXJA 2NBWB 2D2QA 2D07B 3B2GA 3GE8C 2KFJA 5DCNA 3SEBA 4LJPB 3DPDA 3VQIA 2NTTA 4G11A 3H8HA 1WXAA 1QILA 2A5UA 1UD7A 3S2AA 1DOYA 3P4QB 2QILA 4WWOA 5FKAC 3OWEB 1XD3B 3VFKA 1HZ5A 1WGYA 2HJ1A 2OJRA 4XWTA 1GNUA 3RNFC 4WQMA 2GBMA 1Z5SB 4XWWA 4J6IA 1WSPA 2MWSB 3ML8A 3W1SA 3UIPB 4M01A 4C4VA 1L6VA 1WYGA 4WAAA 2LASA 3RNCC 4JWSC 4XC2A 1YNTE 3WANA 3MJWA 2IPKD 1UBIA 3IXSA 1RRBA 3U7ZA 1TKEA 1LXDA 1GOZA 2M17A 2B3AA 3FILB 1SXTA 3DBSA 4W9DA 3TEWA 3URYA 4BKSD 2XNAC 3Q14C 4LDTD 2W82A 3ZTDA 1R4NI 4GXBA 1CJEA 3K9PB 4DDGD 1L4DB 2H89B 2BTEA 2IGHA 3QARA 2LD9A 3NZUA 5GXGB 3HVZA 4BKTA 1WWTA 1JCKB 1QOFA 2KDBA 5E6PA 2PMVA 4KIKA 4WWMA 4P7IA 3QX1A 1XCQL 4PK1A 1V1PB 1QT9A 2WDQB 4OZAA 1R4MI 1NI2A 1YX6B 4GU2A 3ZUNA 3D32A 3HUIA 2KKCA 1X1MA 3EFUA 2WGSA 5T8IA 4HKQA 1YQ4B 2GRIA 3ZNHB 4I6LB 4OZBA 3BK1A 4HJGE 4IWOA 3MFGA 3A9JA 2FAZA 4WJNA 3W5UB 3ZGZA 3PHWB 1Z2MA 3ZNZB 1L4ZB 2B76B 1M94A 2ONQA 5D3DA 4URKA 5L83A 2KDEB 4KZ0A 4IG7B 1D5XC 1FPYA 2MEKA 4HLEA 2RD0A 2WP9B 3PRPB 4M0WA 4ZDVA 2M1MA 2AWTA 3PTFC 3IFWB 3P1MA 5EE1A 1OQQA 1B1ZA 3IVFA 3NS8A 1SBBB 3AE4B 2JXTA 4KGSA 1EWCA 1RM6C 1YJ1A 1UNSA 2X8XX 3B9JA 2O2VB 3AE3B 5IO9A 4HCPB 4P1BC 2IYDB 3HHMA 2G3QB 1QOAA 2KTRB 4R3DA 4IC7B 2KLGA 1XO3A 2KX0A 3ZDMC 2PTLA 1VJKA 2PKOA 5JHBA 2NPTB 5LLIA 1D6EC 1D5ZC 3I5JC 2D3AA 4JLCA 1MVKA 4F8CB 4M00A 4LLGM 4KX6B 3RCZA 1RFKA 2DAFA 5IP4D 1F77A 2G45B 1L6UA 2KANA 1TKYA 2XBBC 3FKYA 1YN5A 1WJ6A 1DYQA 1WJ4A 4HWIB 4CYEA 3SFDB 2QHOA 5DPWA 1HE8A 3NOBA 4LNIA 2N9LA 2NTSA 3IG3A 3B2FA 1IPGA 4MJSA 1JALA 3DBHB 5CHWA 3PT2B 3V6CB 3NJTA 3AU4A 2L7RA 5EDSA 2MJ3A 2CS4A 4K81A 1TGZB 2QCZA 3J9CA 1ZP0B 2KDIA 4J3OD 3V60A 3JVZX 2SAKA 2N9KA 3IT4B 3Q3NC 1N61A 3NZ3A 3DWMA 3I9V1 3V6EB 4W9LA 1KFYB 1E8YA 1C78A 1K53A 4OVVA 3HIZA 2OJWA 3R2IA 1IGDA 4JE3B 2ZW1A 4MGYE 2BT6A 5J17A 3X23A 1NI3A 1WGDA 4K3CA 4EUTA 1N63A 3R7RA 1KTKA 2LGSA 1Y56A 1QF6A 1BXTA 3IHPC 1IGCA 4NAMA 5JH5C 2QDFA 1H4RA 2ZJDA 5D3IB 1UBQA 3U4EG 1FEHA 4JWUC 3ML9A 3ZVVA 1SJHD 3N9YC 3JYUA 1KLGD 4RGNA 1YIWA 2BQQA 2JRHA 2RGFA 3N3KB 4EOYA 2L05A 1FMAD 2IO0B 3EGRA 3X0WA 3BZDB 2L00B 3NRZA 2KFKA 4GSWA 4WJQA 2D5GA 1HEZE 3OLMD 5IKCM 4YL8A 3LDZE 2AL3A 1OFFA 2WXLA 2PW9A 4P6VF 1MG4A 2MBQA 4E71A 2D10A 2VRRB 1A5RA 2JYTA 2WXMA 4MSMB 5G2NA 4BKSA 1SE4A 3L13A 3PLUA 3OJ3A 5AUIA 4ANXA 4FJZA 1QOBA 4IM3A 1VLBA 1NBFC 5JXVA 3UI3A 4HRSA 4XE0A 2M0AA 3SR6A 3RZWC 4WJOA 1VDVA 2K8HA 4KGRA 2CHWA 3BYTB 4XZ4A 4YSXB 2WHIA 5MPOA 1Q0WB 4ZRIA 4OW0A 3P2BA 1J19A 2Z0EB 4MM3A 1K50A 3BVGA 1ZE3D 3QAQA 2JVCA 3EA6A 4BOZB 3ECIA 1XF5L 3RULA 2WXJA 1PGBA 1MHHE 1OQYA 3DBLI 2DX5B 5HKHA 3TCAA 3GOEA 3AULA 5LXHA 3U8ZA 2A4ZA 4MELA 2WLBA 3TBLD 5E6NA 3CMMB 1UGJA 1FIQA 4RM8A 4EEWA 1L0XB 3SD5A 3M95A 4GDKA 3PSEB
chains in the Genus database with same CATH topology
1IBXB 3IT6B 3RFZB 3ABVB 4TQ0A 5H92C 3GS2A 2V4IB 4NAWB 1FXIA 5BYQA 3TEZA 3R8BA 5BYRA 1JQ4A 1J7BA 5E6JA 3EUB2 4B0EA 2WU5B 3VRAB 2W3RA 1L0YB 2FUG1 4TSSA 4ITKA 2AQ2B 3VR9B 1PUTA 2JX5A 3PZ7A 3T3OA 2NMQA 2INPE 2R61A 2KWDA 1GTHA 5G5HA 3ZJTA 1T5XD 2WXFA 5LNK1 2RPVA 1FCLA 1MI0A 2BW2A 3CIRB 2OEDA 2ICIA 3AE2B 1D5MC 4IKGA 2IGGA 1V1OA 5FR3A 5G5GA 2N7JA 4RH6A 3B2GA 4N59A 2JZPA 1C79A 3SEBA 3NS1A 3NVYA 1B9RA 3VQIA 2NTTA 3R2TA 3H8HA 2WXIA 1QILA 1VZ8A 2V0GA 1VZ6A 4WIPA 4A9AA 1DOYA 3P4QB 1JRPA 2QILA 2BS2B 4YTNB 2LMCA 3MC0B 5FKAC 4NZLB 2RDGA 3GP7A 3OWEB 2KMMA 2LJIA 1C4CA 1SE2A 1EM7A 1HZ5A 2WXPA 2WXGA 2QIEB 1N5XA 2CJNA 4XWTA 3W9CB 2Y3AA 2KDMA 3MJ5A 4WQMA 1I4GA 1FNVA 2INNE 4XWWA 1WSPA 1KLUD 4KKJA 2E3TA 2BS3B 4KKIA 1ESFA 3W1SA 2JYEA 1XXGA 4O1NA 1L6VA 3AEDB 1WYGA 3AE9B 4JWSC 3CF4A 1YNTE 2FE8A 2IPKD 3IXSA 1FCCC 3U7ZA 1TKEA 1GOZA 1N5WA 4YSZB 3FILB 1SXTA 1HA5A 1SJED 2JSVX 1YN4A 2Z8LA 2RDHA 3URYA 3TEWA 2LHEA 4HROA 2XNAC 1C77A 2GB1A 3P4RB 2W82A 2WXKA 2L32A 2QMTA 2AQ1B 2CJOA 1CJEA 4WAFA 5H8YE 1IBXA 1J7AA 1ZXIA 1L4DB 2BYTA 1AW7A 2H89B 4HKZE 2BTEA 1QOGA 2IGHA 3BIID 1FXAA 3LXFA 1PYWD 1XLOA 1E10A 5GXGB 3HVZA 1WWTA 1T6BX 1E7PB 5HHDG 3KWLA 1JCKB 1QOFA 1STEA 4RGOS 2PMVA 3ZJUA 1C76A 4WWMA 2WU2B 5BMIA 1MHXA 1XCQL 1V1PB 1QT9A 2WDQB 2EELA 4OZAA 2AQ3B 3BVZA 3W5VB 4A8XC 2WS3B 4YXDB 4RCOA 2MJEA 2K22A 2N0SB 3HRDD 2WXHA 4Q2JA 3HUIA 5HG2A 4GLSC 1CQVA 2M19A 3IAS1 3TEYA 1UWMA 3LYYA 3AE7B 4US8A 1QQRA 5T8IA 4HKQA 1SB3C 1YQ4B 2X38A 2GRIA 4RGTA 1F0ZA 2WDVB 4OZBA 3BK1A 2DLBA 2IJ0A 2KQ4X 3AE8B 4HJGE 1VRAB 1NVID 3C8YA 2DWQA 3MFGA 4LK0M 4B0MA 4LTUA 2Y5PA 3W5UB 3ZGZA 1I4RA 3L4PA 3U2SC 1FNUA 1L4ZB 1F2RI 3ZJVA 3NUHB 2B76B 3AE5B 1FRDA 4MM3B 1YQ3B 2ONQA 5D3DA 4N58A 1JWBD 5EE0A 1TS2A 2WXOA 1BMLC 3Q8AA 5BYSA 1D5XC 2MEKA 4TMAB 4M0WA 2WP9B 4OHJA 3FILA 1N60A 3V05A 3P1MA 4OZCA 5EE1A 5FK9C 1YMHE 1OQQA 1B1ZA 3SFEB 2WXQA 4MACA 4DXGA 1FD6A 3VRBB 1SBBB 1SEBD 3DWGC 3BWUD 1ROEA 4US9A 3AE4B 2JXTA 4RFBA 2G9HD 4KGSA 3AH7A 1EWCA 1RM6C 2M56B 2YEPF 3AECB 4KGTA 1UUPA 1UNSA 1F2RC 1JMLA 3B9JA 5HFYA 3AE3B 2JWUA 4L2YA 4AS1A 2OHFA 3TUOA 1HQRD 1ZOYB 4YWGG 2J53A 1JWUD 2PVOD 3AM9A 1NYRA 1QOAA 2LFIA 2K0PA 2K5PA 4JPSA 4R3DA 1VZ7A 3IAM1 1XO3A 1EU4A 2PTLA 1ET9A 3KLSX 1VJKA 1YN3A 1V97A 3AE6B 3AEGB 2L1AA 2PKOA 3LB8C 4L1BA 1H7XA 1V1PA 1ZDVA 2BS4B 1ENFA 1D6EC 1EWYC 1D5ZC 2DYOA 4P16A 4AQ7A 2J42A 1MVKA 4LLGM 4KX6B 4L23A 1RFKA 2FBWB 1JWMD 1E9MA 1F77A 2BBCA 3U52E 3T3NA 1L6UA 3NVZA 2V3NA 4TQ1A 3E9SA 4C80A 2VZKD 3AN1A 2KACA 1FRRA 1TKYA 1TS3A 2PIAA 3BK2A 1VR9A 1ACCA 1YN5A 3MHZA 1DOXA 4D2KA 1DYQA 4EE2A 1GT8A 3SFDB 2RMMA 5BMHA 2PLPA 2K3UA 4NJCA 2N9LA 2NTSA 3HVDA 1R7SA 2QSDA 3B2FA 2K9XA 2BB5A 2LGIA 3O13A 2ACZB 1M4VA 4GDLB 1JALA 3KWVA 1JROA 3ETRA 1CK1A 1P7EA 2I38A 4MH8A 4XDDA 1QKZA 2L83A 2TSSA 5D7GA 3PO0A 2MJ3A 1XLQA 2IGDA 1TYGB 1QLBB 2PVGC 4DXFA 4JX1C 3V3XA 4PT5A 2E6XA 2G1EA 2SEBD 3J9CA 1ZP0B 3Q8EA 4H2AA 4IOIE 5I4DA 4J3OD 1I4XA 4C7YA 1FNWA 4A6QA 2SAKA 1ZUD2 2MH7A 2ON8A 2N9KA 1ZDXA 2QJLA 1C9FA 3MP9A 3IT4B 1I4PA 4YSYB 2WQYB 3AMZA 1I4QA 1HXYD 1UWXA 1TKGA 2LUMA 1N61A 3NZ3A 5HI1A 3DWMA 3I9V1 2L52A 4YTMB 3WCQA 1KFYB 3RPFC 3GB1A 1C78A 1XEEA 2H88B 1K53A 3NVWA 1TY2A 4IDIA 4RF1A 1NYQA 3R2IA 1PFDA 1IGDA 4ZOHC 3Q8FA 4JE3B 4A90A 2ZW1A 2BT6A 1L0VB 3FAHA 1I7HA 3BYYB 1NI3A 2W55A 2QEJC 1ZXHA 3AB5A 5TSSA 1N63A 1DGJA 5C2TB 1KTKA 1K51A 3Q8BA 1JWSD 1Y56A 3P4SB 4YTPB 4MT5A 1QF6A 5EE9A 1YJJA 1GTEA 1BXTA 1FFVA 1SE3A 4HEA1 4ARCA 1Q10A 1IGCA 1ZPSA 4NAMA 1SIJA 5D3IB 3U4EG 1FEHA 4JWUC 2HDEA 1FO4A 4ZRPA 4FXCA 3VR8B 1SJHD 2KN4A 4DQOC 1KRHA 3N9YC 2DYMA 1KLGD 4RGNA 1ET6A 1FFUA 3FC4A 2J52A 4ZYSA 1WRIA 3TSSA 4CQNA 1FMAD 4WURA 3PZ8A 3AV8A 3EGRA 4ARIA 1C4PA 3AEBB 1WXQA 3BZDB 1GPXA 4GDKB 4WH4A 2Q5WD 4ZRQA 3NRZA 2D5GA 2DBYA 2LEKA 2Y5CA 1HEZE 1EU3A 4OVZA 3BVMA 1SSNA 2IDYA 4ZHPA 1GB1A 1OFFA 2WXLA 2PW9A 4P6VF 4REZA 1OQRA 1KH0A 2JU6X 2CU3A 1E6EB 1H7WA 1TS5A 2YEPB 1TJEA 4RF0A 2BB6A 3W2DA 1V8CA 1AN8A 1FM0D 3AEFB 2WNMA 1K52A 2JYTA 1NEKB 2WXMA 3I57A 1L5PA 3P42A 1SE4A 1LO5D 3NVVA 5AUIA 2KAJA 4UDUC 3AEEB 2ZW0A 1TS4A 4A55A 1QOBA 4N6EB 5EE3A 1GB4A 1VLBA 2MJDA 5JXVA 1N62A 1TZOA 1WGKA 2W54A 3UI3A 4HRSA 4XE0A 1AWDA 2M0AA 2WDRB 1PGXA 3SR6A 1PGAA 1VDVA 4USAA 4KGRA 3BYTB 4YSXB 4C56C 5MPOA 3ZYYX 5BMGA 3Q8CA 4OW0A 2HTME 1K50A 1T3QA 2JQRB 4RGMA 3BVGA 1D4BA 1ZE3D 2W3SA 1RWSA 3EA6A 3ZQ4A 1NENB 1BUIC 1XF5L 5C3JB 2WXJA 4XDCA 3AE1B 1RYJA 4RNAA 2I2YA 3E56A 1PGBA 1A70A 1AYFA 1JW9D 1MHHE 1PDXA 5AUKA 1XLNA 1KF6B 3P63A 2GI9A 1MPEA 2LHDA 2VZKB 1JWAD 2WLBA 1IUEA 1DOIA 1YJIA 3TEXA 3AEAB 4ZHOA 1XCTL 1C4AA 3Q69A 1XLPA 1UGJA 1J7CA 3P4PB 1CZPA 1FIQA 1GAQB 2WXNA 1P7FA 3CWIA 1L0XB 3KQ4A 1E0ZA 1SF0A 2WXRA 1TY0A 2XN9C 2AX5A 2V3PA 4C7ZA 2EKIA 1HZ6A 1I4HA 4YT0B 2J4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWL A;  1QOF A;  3FC4 A;  1FFU A;  3ABV B;  4KX6 B;  1WRI A;  4WWM A;  2WU2 B;  5H92 C;  1FMA D;  1RFK A;  1FXI A;  2FBW B;  1QT9 A;  3AV8 A;  2WDQ B;  1E9M A;  4JWU C;  3W5V B;  1GPX A;  2WS3 B;  3AEB B;  1J7B A;  4YXD B;  1L6U A;  1WXQ A;  3EUB 2;  3NVZ A;  2WU5 B;  3VRA B;  2W3R A;  4C80 A;  2MJE A;  2PIA A;  1FRR A;  1TKY A;  2Q5W D;  2K22 A;  2N0S B;  3AN1 A;  3HRD D;  2DBY A;  3NRZ A;  1JQ4 A;  2LEK A;  4ITK A;  2Y5C A;  3HUI A;  1DOX A;  3VR9 B;  1PUT A;  2JX5 A;  1GT8 A;  3SFD B;  4ZHP A;  2M19 A;  1GTH A;  5G5H A;  1OFF A;  1UWM A;  4P6V F;  1OQR A;  3CIR B;  3AE7 B;  2CU3 A;  3AE2 B;  1E6E B;  4US8 A;  1H7W A;  1R7S A;  3B2F A;  2K9X A;  1TJE A;  2ACZ B;  1SB3 C;  1YQ4 B;  1JAL A;  1FM0 D;  1V8C A;  1JRO A;  5G5G A;  1F0Z A;  3AEF B;  3ETR A;  2WDV B;  3B2G A;  1NEK B;  4N59 A;  2L83 A;  1L5P A;  3AE8 B;  3NVV A;  3PO0 A;  1NVI D;  2MJ3 A;  5AUI A;  3NS1 A;  3NVY A;  1B9R A;  1XLQ A;  2DWQ A;  2KAJ A;  3AEE B;  1TYG B;  1QLB B;  1QOB A;  4LTU A;  4N6E B;  2PVG C;  1VLB A;  2MJD A;  4JX1 C;  5EE3 A;  3W5U B;  1N62 A;  1WGK A;  2W54 A;  3L4P A;  2G1E A;  4HRS A;  1FO4 A;  1ZP0 B;  1AWD A;  2WDR B;  3SR6 A;  4A9A A;  1DOY A;  3P4Q B;  1JRP A;  2B76 B;  2BS2 B;  4YTN B;  3AE5 B;  4C7Y A;  1FRD A;  2KMM A;  1YQ3 B;  1ZUD 2;  2MH7 A;  4N58 A;  1JWB D;  1VDV A;  5EE0 A;  2QJL A;  4USA A;  2QIE B;  4YSY B;  1N5X A;  2WQY B;  2CJN A;  2WP9 B;  4YSX B;  3AMZ A;  3W9C B;  5MPO A;  3ZYY X;  4WQM A;  1TKG A;  1N61 A;  1N60 A;  3DWM A;  2HTM E;  4YTM B;  2L52 A;  3P1M A;  1T3Q A;  3WCQ A;  1KFY B;  2JQR B;  2E3T A;  5EE1 A;  2BS3 B;  3RPF C;  1OQQ A;  2W3S A;  1RWS A;  3SFE B;  2H88 B;  1L6V A;  3AED B;  1WYG A;  3NVW A;  3AE9 B;  3VRB B;  3DWG C;  1NEN B;  4IDI A;  1NYQ A;  1ROE A;  4JWS C;  3CF4 A;  3AE4 B;  4US9 A;  1PFD A;  4ZOH C;  5C3J B;  3AH7 A;  1RM6 C;  3AE1 B;  2M56 B;  1RYJ A;  3AEC B;  2BT6 A;  1TKE A;  1N5W A;  1A70 A;  4YSZ B;  1L0V B;  1AYF A;  1JW9 D;  1PDX A;  5AUK A;  1XLN A;  1KF6 B;  3AE3 B;  1I7H A;  1NI3 A;  3B9J A;  3FAH A;  2W55 A;  3P63 A;  3AB5 A;  2OHF A;  4HRO A;  1ZOY B;  1N63 A;  1DGJ A;  5C2T B;  2PVO D;  3P4R B;  3AM9 A;  1NYR A;  1QOA A;  2K5P A;  2CJO A;  1CJE A;  1XO3 A;  3P4S B;  4YTP B;  5H8Y E;  1JWA D;  2WLB A;  1QF6 A;  1IUE A;  1J7A A;  1DOI A;  1GTE A;  1FFV A;  1YJJ A;  1YJI A;  1ZXI A;  5EE9 A;  3AEA B;  1VJK A;  3AE6 B;  3AEG B;  1V97 A;  2H89 B;  1SIJ A;  2PKO A;  3LB8 C;  1H7X A;  4ZHO A;  4C7Z A;  1XLP A;  1J7C A;  3P4P B;  1CZP A;  1FIQ A;  1GAQ B;  2BS4 B;  1FXA A;  1QOG A;  3BII D;  3CWI A;  1E0Z A;  3LXF A;  1SF0 A;  1EWY C;  4FXC A;  3VR8 B;  1XLO A;  2AX5 A;  1E10 A;  5GXG B;  3HVZ A;  2EKI A;  1WWT A;  4YT0 B;  1KRH A;  1E7P B; 
#chains in the Genus database with same CATH topology
 1IBX B;  3IT6 B;  4TQ0 A;  1V5T A;  1WI0 A;  2ZZP B;  4NQL B;  4AJY B;  3GS2 A;  2V4I B;  3PRM B;  3R8B A;  2ZVO A;  4ANV A;  2BKF A;  3VRA B;  1L0Y B;  4BOS C;  4S17 A;  2VH2 A;  2KX3 A;  2AQ2 B;  2JX5 A;  2NMQ A;  2LGX A;  1GTH A;  3ZJT A;  2N4F A;  1T5X D;  2WXF A;  4MEM A;  5LNK 1;  2IGG A;  3HM6 X;  5G5G A;  3TMP B;  4NJ7 A;  4NPN A;  2Z0D B;  4LCD E;  3APC A;  2WXI A;  3QC8 B;  3QHT A;  1VZ8 A;  4WIP A;  2BS2 B;  4YTN B;  4NQK E;  3MC0 B;  1ZKH A;  2RDG A;  2G4S A;  3GP7 A;  4AWJ A;  1SE2 A;  2RPQ A;  3UQA A;  1WJN A;  2QIE B;  2CJN A;  1WYW B;  3W9C B;  1EO6 A;  2ASQ A;  2KDM A;  2Y3A A;  3MJ5 A;  3N1Y C;  2KQ7 A;  2DAJ A;  4KKJ A;  2M8S A;  1XXG A;  4O1N A;  5J18 A;  3AED B;  5CX3 A;  4B95 A;  1SGH A;  2FE8 A;  1J8C A;  1OGW A;  3BY4 B;  2D3G A;  1HA5 A;  1YN4 A;  2Z8L A;  1TIF A;  4ANW A;  2L32 A;  2AQ1 B;  2CJO A;  2KVZ A;  2ZCB A;  5H8Y E;  5DPS A;  3AU5 A;  1ZXI A;  3Q2A C;  2BYT A;  1AW7 A;  4II3 B;  2K39 A;  4PS8 A;  4NAW A;  3IBE A;  1QOG A;  4DBG A;  2KQS A;  3RYT A;  4KDI C;  2LXC A;  2O6V D;  4GIV A;  5BMI A;  1MHX A;  3W5V B;  1EF5 A;  2AL6 A;  4ICV A;  2MJE A;  3VAW A;  3HRD D;  1V80 A;  2BPS A;  4E3C A;  2WXH A;  4GLS C;  1CQV A;  2JF5 A;  3DVN V;  3IAS 1;  4DHJ B;  3TEY A;  3EC8 A;  2EKE C;  3AE7 B;  3A9K A;  1WF9 A;  1WR6 E;  5C1Z A;  1WR1 A;  4XGA B;  1WFY A;  3L54 A;  1F0Z A;  3KUZ A;  4EZL A;  2WDV B;  2KD0 A;  1GC6 A;  4ZRK A;  3VDZ A;  3AE8 B;  4DK5 A;  2KOX A;  1NVI D;  1TZ1 A;  1C1Y B;  2DWQ A;  1KM7 A;  4BBN C;  3MTN B;  3KYC D;  4JIO U;  4FA6 A;  1F2R I;  1VD2 A;  3NUH B;  1FRD A;  2KN5 A;  4MM3 B;  1YQ3 B;  2FCN A;  3RN9 C;  4N58 A;  5EE0 A;  2WXO A;  4M8M A;  2EMS A;  1V81 A;  3Q8A A;  5BYS A;  4TMA B;  2N9X A;  5CHF A;  1UF0 A;  2FCM A;  2C60 A;  3WAM A;  3WIM A;  2C5L C;  4OZC A;  3DVG Y;  2LI5 A;  3A33 B;  1YMH E;  1L2N A;  5FR6 A;  4DXG A;  4KDL B;  3DWG C;  1SEB D;  1I42 A;  2ZNV C;  4FUL A;  4E74 A;  2LXA A;  4L2Y A;  2OHF A;  2J53 A;  2PVO D;  2LFI A;  2K0P A;  2K5P A;  3PS6 A;  4N9F 4;  3ZNI D;  2MCN B;  4FJY A;  4G50 A;  2K1F A;  3LB8 C;  1SE9 A;  3QIJ A;  1ZDV A;  4ACF A;  4HPL B;  4P16 A;  2I1J A;  3Q3F A;  3DBH I;  2J42 A;  3EEC A;  4MGK E;  3A4S C;  2JWZ A;  2FBW B;  1WXV A;  3DHI C;  2ZPY A;  2V3N A;  4TQ1 A;  3E9S A;  3AN1 A;  2KAC A;  3BK2 A;  3UIN B;  5LXI B;  1IYF A;  4D2K A;  3H7P B;  3A1Q A;  1GT8 A;  2RMM A;  2BWF A;  1SIF A;  4DHJ D;  1UZX B;  1YOV B;  2DZJ A;  2BF8 B;  2QSD A;  3PPA A;  2ACZ B;  2KVR A;  2Y5B B;  4GDL B;  2NCN A;  4MH8 A;  2MSE D;  2QC8 A;  2TSS A;  5D7G A;  3PO0 A;  1UH6 A;  5DPT A;  1RAX A;  1FXT B;  2GBJ A;  3V3X A;  4B9K A;  2MW5 A;  2XK5 A;  4JQW C;  4IOI E;  3PVL A;  3RNA C;  4C7Y A;  2W9N A;  2ON8 A;  3VHT C;  1ZDX A;  3PRE A;  2OOB B;  3VXW A;  4EKU A;  4YSY B;  2NBV B;  1HXY D;  2LUM A;  2AEH A;  4YTM B;  3WCQ A;  3OAW A;  1XEE A;  1YX5 B;  3NVW A;  1TY2 A;  5J2R A;  1MG8 A;  4LNK A;  2HTH A;  1I7H A;  1WZ3 A;  2ZPN A;  1ZXH A;  2MP2 A;  4F1S A;  3APF A;  1OEY J;  3DQV A;  3APD A;  1YJJ A;  1FFV A;  4ARC A;  4LNF A;  1WX8 A;  2GBN A;  1SIJ A;  3JSV B;  2LVP A;  4FXC A;  2L8J A;  4K1R B;  3B0A A;  1KRH A;  1ET6 A;  4ZYS A;  2UYZ B;  2IY0 B;  4CQN A;  2IZV B;  3AXC A;  1C4P A;  1WXQ A;  2JZ3 B;  3V62 A;  3AI5 A;  4KV2 A;  5E6O A;  2PPH A;  1ZGU B;  2Y5C A;  3BVM A;  3DDC B;  4AUQ C;  2BYE A;  2IBI B;  1OQR A;  1KH0 A;  3Q6B A;  3ENE A;  1H7W A;  4IWQ A;  1TS5 A;  3M62 B;  2C7N B;  4W9J A;  1AN8 A;  1FM0 D;  4NNJ B;  4HK2 A;  2WNM A;  3I57 A;  1L5P A;  3P42 A;  3NVV A;  1VCB A;  5AEK B;  2V1Y A;  3AEE B;  2ZW0 A;  2BYV E;  1GB4 A;  4LJO B;  3UIO B;  2KC2 A;  1TZO A;  1WGK A;  2W54 A;  1WJU A;  1AWD A;  1PGX A;  2CR5 A;  3N1Z C;  3ZIM A;  5BO4 B;  2G4D B;  1QZE A;  2O6V A;  3RNB C;  2HTM E;  1D4B A;  1RWS A;  3ZXV A;  3U30 A;  3VUX A;  4BFR A;  4XDC A;  1RYJ A;  4GB9 A;  2I2Y A;  1WIA A;  1KF6 B;  1G6J A;  4C4V B;  1CMX B;  1MPE A;  2LHD A;  4B6W A;  2C9W B;  2VZK B;  2DZK A;  4LNN A;  1JWA D;  4KSK C;  3Q3J A;  2D3C A;  1KJT A;  1ISN A;  3P4P B;  1GAQ B;  3CWI A;  2KJ6 A;  1E0Z A;  1E7V A;  2D3B A;  2XN9 C;  2V3P A;  2EKI A;  3C19 A;  1HZ6 A;  1I4H A;  4YT0 B;  2J4X A;  4ZYN A;  3SDL C;  2LJ5 A;  3ABV B;  4HVB A;  5H92 C;  2IO2 B;  1FXI A;  3UF8 A;  5BYQ A;  3M63 B;  4HDO A;  2PE6 B;  1JQ4 A;  5E6J A;  2KWC A;  4IW0 A;  2WU5 B;  1E8W A;  4TKN A;  2NR2 A;  3VR9 B;  1PUT A;  3PZ7 A;  4KIK B;  2K6Q A;  4FN2 A;  1WGH A;  1V86 A;  5G5H A;  3SHQ A;  3AE2 B;  1D5M C;  3RD2 A;  1E8X A;  2GLS A;  4XX5 A;  4N59 A;  2JZP A;  4RMA A;  3NS1 A;  1B9R A;  3R2T A;  3EFC A;  1TT5 B;  2MX2 A;  4ICU A;  2GOW A;  4DWF A;  3NG0 A;  1JRP A;  1P0R A;  2LMC A;  4NZL B;  1N6Z A;  2LJI A;  1C4C A;  1EM7 A;  4BKG A;  2M4N A;  1V9J A;  3A9J B;  3PRZ A;  1WMH A;  2INN E;  3QQ8 B;  2BS3 B;  4KKI A;  1ESF A;  1F9J A;  3AE9 B;  4M0W B;  4IM0 A;  2V4L A;  2NVU I;  2JSV X;  4BZA A;  3I63 C;  2K25 A;  1GUA B;  2WXK A;  2KYW A;  2QMT A;  2KMA A;  4WAF A;  1T0S C;  5KHQ A;  2IY1 B;  3QWZ B;  3PHX B;  1WRD B;  1KOT A;  2LVQ A;  3BII D;  2CHZ A;  1E8Z A;  1XLO A;  1E10 A;  4W9H A;  3ZJU A;  1C76 A;  5AZF A;  4BAX A;  4EZK A;  3BVZ A;  4ASW C;  2WS3 B;  4YXD B;  3DVN U;  2MLB A;  4Q2J A;  2N7E A;  1UGM A;  3L08 A;  5HG2 A;  5IAA C;  1XQQ A;  2M19 A;  4HJK A;  1UWM A;  3LYY A;  3KVF B;  3HM3 A;  3ZDT A;  3UQB A;  4HXD A;  4TUU A;  2WX1 A;  3ZRF A;  2DLB A;  2IJ0 A;  1VRA B;  1E90 A;  1I35 A;  4LK0 M;  2DYB A;  3W1Y A;  2YLM A;  3GZN B;  4W9I A;  3L4P A;  4MJS B;  3TIX A;  3ZW3 A;  3KYD D;  4FHJ A;  4G0N B;  1JWB D;  1BML C;  2UWQ A;  2LRW A;  4W9E A;  2KK8 A;  3FIL A;  3V05 A;  4K7W A;  5FK9 C;  4MAC A;  2N9E B;  3VRB B;  3RZF A;  4RFB A;  4EFO A;  3AH7 A;  2YEP F;  4KGT A;  1F2R C;  1JML A;  4I6P A;  5HFY A;  3TUO A;  3QCA A;  4YWG G;  1JWU D;  1NYR A;  3RUI B;  4JPS A;  1VZ7 A;  2Z59 B;  1ET9 A;  2K6D B;  3AEG B;  1V97 A;  4L1B A;  2L1A A;  3N32 A;  1V1P A;  3H6N A;  2BS4 B;  1ENF A;  2L0F A;  1EWY C;  1T0R C;  4MDK E;  1V49 A;  4NY0 A;  4W9K A;  4DDI D;  4L23 A;  2BBC A;  4DHZ B;  3VVW B;  3NVZ A;  3JW0 X;  2PIA A;  1FRR A;  1TS3 A;  4LNO A;  1VR9 A;  1DOX A;  2MHJ A;  5IN7 A;  5BMH A;  2K3U A;  4NJC A;  4IUM B;  1WY8 A;  2FNJ B;  1R7S A;  1F1H A;  2BB5 A;  1D3Z A;  2KFK B;  2CHX A;  4X57 B;  2DZM A;  1CK1 A;  1P7E A;  3ETR A;  4XDD A;  2PEA A;  3ZLZ A;  1YD8 U;  2L83 A;  5D2M B;  4CHK A;  3HK0 A;  4QAY A;  4HPP A;  1XLQ A;  1TYG B;  1HTO A;  3VH4 B;  3WAP A;  3Q8E A;  3OJ4 B;  5I4D A;  1I4X A;  4A6Q A;  2MH7 A;  1C9F A;  4LDT B;  3MP9 A;  1I4P A;  2LWP A;  2WQY B;  3AMZ A;  1I4Q A;  1UWX A;  4MGZ E;  3M3J A;  3DHG C;  1YQB A;  2O2V A;  2N7D A;  3RPF C;  2BKR B;  4M8N A;  3CST A;  5L95 C;  2DNF A;  4KVG B;  2GBK A;  3RNG C;  4IDI A;  2FCS A;  1WX7 A;  2KTR A;  3Q8F A;  2PE9 A;  2KMC A;  3FAH A;  4A3O A;  2W55 A;  2QEJ C;  3AB5 A;  5D94 A;  2DEN B;  2NPT A;  3C0R B;  3ZO5 B;  3DBR B;  2J7Q B;  1K51 A;  1JWS D;  5EE9 A;  4HEA 1;  1Q10 A;  3TL5 A;  1RFA A;  2GBR A;  2PJH A;  2FIF A;  2YVC A;  3PV1 A;  1FFU A;  2J52 A;  1L7Y A;  4KZC A;  4ARI A;  1GPX A;  3AEB B;  2LZ6 A;  4GDK B;  3B08 A;  1EU3 A;  2D11 A;  5IOI A;  2MRP A;  2KLC A;  2RSU A;  3VUY A;  2IDY A;  4ZHP A;  1GB1 A;  4REZ A;  4EZJ A;  1P9D U;  5KHO A;  2XEW A;  3ZNG C;  3DCG A;  3KUD B;  2I1K A;  2YEP B;  3ALB A;  4RF0 A;  3W2D A;  1V8C A;  3V61 A;  2JRI B;  1NEK B;  2FCQ A;  3VUW A;  2KJH B;  3KH0 A;  1LO5 D;  2KAJ A;  4UDU C;  4A55 A;  4N6E B;  2MJD A;  2MBB B;  1N62 A;  3MHS D;  2WDR B;  3QA8 A;  1PGA A;  3WAO A;  2DHZ A;  1TTN A;  1V6E A;  4HCN B;  4USA A;  3EHV A;  5D6J B;  2C7H A;  3ZYY X;  2JY6 A;  5CHV C;  4K3B A;  4F7Z A;  1EF1 A;  3RI7 C;  2KT7 A;  2W3S A;  1BUI C;  3E56 A;  1PDX A;  1AYF A;  1XLN A;  3P63 A;  2LGY A;  1T0Y A;  3N30 A;  3QK0 A;  1E5W A;  1IUE A;  1WH3 A;  1YJI A;  4BBN F;  1WZ0 A;  2R2O A;  3Q69 A;  1C4A A;  1J7C A;  1CZP A;  3KQ4 A;  5G55 A;  1SF0 A;  2WXR A;  2L0T A;  2AX5 A;  2WWZ A;  4I6N B;  3RFZ B;  4FJV B;  1S1Q B;  1P98 A;  2ZVN A;  4NAW B;  3TEZ A;  3RMK C;  1WGR A;  1LGR A;  1OTR B;  2BGF A;  2KJR A;  1J7B A;  4PYU A;  4MGI E;  4B0E A;  2W3R A;  3RT3 B;  2K8C A;  1E7U A;  1WX9 A;  2FUG 1;  2KC1 A;  2CU1 A;  2HJ8 A;  3T3O A;  2INP E;  2R61 A;  2KWD A;  2KO3 A;  1C3T A;  1FCL A;  2BW2 A;  2N1W A;  4JGH B;  5FR3 A;  4DXA B;  2N7J A;  2ZCC A;  4RH6 A;  4FLH A;  2HE7 A;  1OEY A;  1F52 A;  1C79 A;  3NVY A;  3A9K B;  2BWE S;  4GMV A;  3L10 B;  2V0G A;  4MSQ B;  1VZ6 A;  4A9A A;  1Q5W B;  2V9H A;  2KMM A;  4PYZ A;  2IO3 B;  2WXP A;  2WXG A;  1N5X A;  3A4R A;  1LFD A;  2REX A;  1I4G A;  1FNV A;  1KLU D;  2E3T A;  4TV3 A;  4GOC A;  2JYE A;  1V2Y A;  5AZH A;  3CF4 A;  1FCC C;  3PGE A;  1N5W A;  4YSZ B;  5C23 A;  4AP4 C;  4W9F A;  4HPM B;  1SJE D;  2RDH A;  3QJZ A;  1ZW7 A;  2LHE A;  4HRO A;  4KSL C;  3ZRC A;  3KW5 B;  1C77 A;  2GB1 A;  3P4R B;  4RM9 A;  2NBU A;  5DPR A;  1IBX A;  4IWP A;  3ZKJ C;  1J7A A;  2KHW B;  4HKZ E;  4PS3 A;  1FXA A;  1AAR A;  3LXF A;  1PYW D;  4OVU A;  1T6B X;  1E7P B;  5HHD G;  3KWL A;  1STE A;  4RGO S;  4XYC A;  2WU2 B;  3WA0 A;  1H8C A;  2EEL A;  4NJ6 A;  2AQ3 B;  5CTR C;  2L3Z A;  3GZN I;  4A8X C;  2N9P C;  4RCO A;  2K22 A;  2AYO B;  2N0S B;  4K7U A;  1WE6 A;  2N1V A;  1R4N B;  3R3M A;  1RLF A;  4K7S A;  3CF6 E;  3CSF A;  3NY5 A;  4US8 A;  1QQR A;  1BT0 A;  1SB3 C;  2FID A;  2X38 A;  4RGT A;  3I3T B;  3A1Q B;  2KQ4 X;  3BIN A;  3C8Y A;  2JZZ A;  1JRU A;  4LTU A;  4B0M A;  2Y5P A;  1R4M B;  1I4R A;  3U2S C;  1FNU A;  1LQB A;  1MFW A;  1TBE A;  3ZJV A;  2R2Q A;  3AE5 B;  3H9D A;  1TS2 A;  2KNB A;  2C7M B;  4OHJ A;  2XK5 B;  1N60 A;  4FAD A;  4PS7 A;  1PQS A;  3SFE B;  2WXQ A;  1FD6 A;  2KWV B;  3BWU D;  1ROE A;  4US9 A;  2ZEQ A;  3PLV A;  2G9H D;  2M56 B;  3K9O B;  3AEC B;  1UUP A;  2RDB C;  2ZNV B;  2LUE A;  2JWU A;  3U7D A;  4AS1 A;  1HQR D;  1ZOY B;  2LRU A;  3AM9 A;  1K8R B;  3IAM 1;  5GMV A;  1EU4 A;  3KLS X;  1YN3 A;  3AE6 B;  1H7X A;  2MP2 B;  2DYO A;  4AJW A;  3OG5 A;  4AQ7 A;  1U4A A;  2L76 A;  5IA7 A;  1JWM D;  1E9M A;  5JHA A;  3U52 E;  3L16 A;  3T3N A;  4M02 A;  4C80 A;  2VZK D;  1ACC A;  3MHZ A;  3SU8 X;  4EE2 A;  2MBH A;  2MQJ A;  2PLP A;  3O65 B;  2KTF A;  1KLV A;  2CKH B;  3HVD A;  1LM8 B;  2K9X A;  3O13 A;  2LGI A;  1M4V A;  3KWV A;  1JRO A;  1J0G A;  2I38 A;  1Y8R C;  1QKZ A;  1S3S G;  2KZR A;  2IGD A;  1QLB B;  2PVG C;  4DXF A;  4JX1 C;  4PT5 A;  3MC9 A;  2E6X A;  2G1E A;  2SEB D;  2GMI C;  2LVO A;  4H2A A;  3WAL A;  2WDT B;  3DBR I;  1FNW A;  2JUO A;  1WXM A;  1ZUD 2;  2QJL A;  3T8M A;  1MJD A;  1UEL A;  1WM3 A;  2INC C;  4ZRJ A;  1TKG A;  5HI1 A;  2L52 A;  3PZD A;  3GB1 A;  3DOW A;  3T9L A;  2H88 B;  2RR9 A;  4WWP A;  4RF1 A;  1NYQ A;  1PFD A;  4AOF A;  2WYQ A;  4ZOH C;  2O6V B;  2KWU B;  3TJP A;  4A90 A;  1L0V B;  3BYY B;  3R7Q A;  2J0M A;  5TSS A;  1DGJ A;  5C2T B;  1XT9 B;  3Q8B A;  4MH0 E;  3VTU A;  3P4S B;  4YTP B;  4IM2 A;  4MT5 A;  1GTE A;  1SE3 A;  2JT4 B;  1ZPS A;  4G3X B;  1FO4 A;  2HDE A;  2MA9 B;  1EUV B;  4ZRP A;  3VR8 B;  2KN4 A;  4DQO C;  1WGG A;  2DYM A;  1P1A A;  3FC4 A;  3ZXR A;  1WRI A;  3H7P A;  3TSS A;  5TR5 A;  4WUR A;  2J0J A;  3PZ8 A;  3AV8 A;  4ANU A;  2IND C;  1P3Q U;  4WH4 A;  2Q5W D;  4ZRQ A;  2M0X A;  2DBY A;  4GDL A;  2LEK A;  3KUC B;  1T0Q C;  4OVZ A;  1GJZ A;  3RNE C;  1SSN A;  2K8B A;  3VH3 B;  4HDQ A;  3DVG X;  2JU6 X;  2CU3 A;  2HD5 B;  1E6E B;  4JL9 A;  1TJE A;  2BB6 A;  2MBE A;  2IO1 B;  3AEF B;  2DZI A;  1GC7 A;  4DHZ E;  1K52 A;  1IP9 A;  4C00 A;  2FUH B;  3H7S A;  2EMT A;  4W9C A;  3UGB B;  1TS4 A;  4GGQ A;  5EE3 A;  5JZE B;  2NS5 A;  4FHK A;  4WQO B;  2KDF B;  4CO7 A;  4BVU C;  3ONS A;  4WWN A;  3L0W B;  4S0R A;  3LJ3 A;  3MC8 A;  4A3P A;  3VTW A;  4C56 C;  5BMG A;  1WM2 A;  2LGD A;  3Q8C A;  4II2 B;  1T3Q A;  2JQR B;  4RGM A;  3ZQ4 A;  1NEN B;  4A20 A;  5C3J B;  3AE1 B;  4RNA A;  3W1S C;  1WMH B;  1A70 A;  1JW9 D;  5AUK A;  3JSV A;  1GG3 A;  2JXX A;  1V5O A;  2BVC A;  3ZTC A;  2GI9 A;  3B1L X;  2JPH A;  3R66 C;  1DOI A;  3TEX A;  3Q3M C;  3AEA B;  1NDD A;  1WE7 A;  4W9G A;  4ZHO A;  2WX0 A;  1XCT L;  4C7Z A;  1XLP A;  2WXN A;  1P7F A;  1TY0 A;  3NHE B;  2J0K A;  2BYF A;  3VTV A;  3NZS A;  2V3S A;  4WJP A;  5BYR A;  3N20 C;  3GE3 C;  3DBL B;  5AZG A;  3EUB 2;  1HTQ A;  4TSS A;  4P1C C;  3Q3O C;  3H1U A;  4ITK A;  3DHH C;  1WXS A;  3N1X C;  2VH1 A;  2MBO A;  2UU7 A;  3L17 A;  2RPV A;  1Q1O A;  1MI0 A;  3CIR B;  2OED A;  2ICI A;  4GN1 A;  4IKG A;  4FBJ B;  1V1O A;  2KXJ A;  2NBW B;  2D2Q A;  2D07 B;  3B2G A;  3GE8 C;  2KFJ A;  5DCN A;  3SEB A;  4LJP B;  3DPD A;  3VQI A;  2NTT A;  4G11 A;  3H8H A;  1WXA A;  1QIL A;  2A5U A;  1UD7 A;  3S2A A;  1DOY A;  3P4Q B;  2QIL A;  4WWO A;  5FKA C;  3OWE B;  1XD3 B;  3VFK A;  1HZ5 A;  1WGY A;  2HJ1 A;  2OJR A;  4XWT A;  1GNU A;  3RNF C;  4WQM A;  2GBM A;  1Z5S B;  4XWW A;  4J6I A;  1WSP A;  2MWS B;  3ML8 A;  3W1S A;  3UIP B;  4M01 A;  4C4V A;  1L6V A;  1WYG A;  4WAA A;  2LAS A;  3RNC C;  4JWS C;  4XC2 A;  1YNT E;  3WAN A;  3MJW A;  2IPK D;  1UBI A;  3IXS A;  1RRB A;  3U7Z A;  1TKE A;  1LXD A;  1GOZ A;  2M17 A;  2B3A A;  3FIL B;  1SXT A;  3DBS A;  4W9D A;  3TEW A;  3URY A;  4BKS D;  2XNA C;  3Q14 C;  4LDT D;  2W82 A;  3ZTD A;  1R4N I;  4GXB A;  1CJE A;  3K9P B;  4DDG D;  1L4D B;  2H89 B;  2BTE A;  2IGH A;  3QAR A;  2LD9 A;  3NZU A;  5GXG B;  3HVZ A;  4BKT A;  1WWT A;  1JCK B;  1QOF A;  2KDB A;  5E6P A;  2PMV A;  4KIK A;  4WWM A;  4P7I A;  3QX1 A;  1XCQ L;  4PK1 A;  1V1P B;  1QT9 A;  2WDQ B;  4OZA A;  1R4M I;  1NI2 A;  1YX6 B;  4GU2 A;  3ZUN A;  3D32 A;  3HUI A;  2KKC A;  1X1M A;  3EFU A;  2WGS A;  5T8I A;  4HKQ A;  1YQ4 B;  2GRI A;  3ZNH B;  4I6L B;  4OZB A;  3BK1 A;  4HJG E;  4IWO A;  3MFG A;  3A9J A;  2FAZ A;  4WJN A;  3W5U B;  3ZGZ A;  3PHW B;  1Z2M A;  3ZNZ B;  1L4Z B;  2B76 B;  1M94 A;  2ONQ A;  5D3D A;  4URK A;  5L83 A;  2KDE B;  4KZ0 A;  4IG7 B;  1D5X C;  1FPY A;  2MEK A;  4HLE A;  2RD0 A;  2WP9 B;  3PRP B;  4M0W A;  4ZDV A;  2M1M A;  2AWT A;  3PTF C;  3IFW B;  3P1M A;  5EE1 A;  1OQQ A;  1B1Z A;  3IVF A;  3NS8 A;  1SBB B;  3AE4 B;  2JXT A;  4KGS A;  1EWC A;  1RM6 C;  1YJ1 A;  1UNS A;  2X8X X;  3B9J A;  2O2V B;  3AE3 B;  5IO9 A;  4HCP B;  4P1B C;  2IYD B;  3HHM A;  2G3Q B;  1QOA A;  2KTR B;  4R3D A;  4IC7 B;  2KLG A;  1XO3 A;  2KX0 A;  3ZDM C;  2PTL A;  1VJK A;  2PKO A;  5JHB A;  2NPT B;  5LLI A;  1D6E C;  1D5Z C;  3I5J C;  2D3A A;  4JLC A;  1MVK A;  4F8C B;  4M00 A;  4LLG M;  4KX6 B;  3RCZ A;  1RFK A;  2DAF A;  5IP4 D;  1F77 A;  2G45 B;  1L6U A;  2KAN A;  1TKY A;  2XBB C;  3FKY A;  1YN5 A;  1WJ6 A;  1DYQ A;  1WJ4 A;  4HWI B;  4CYE A;  3SFD B;  2QHO A;  5DPW A;  1HE8 A;  3NOB A;  4LNI A;  2N9L A;  2NTS A;  3IG3 A;  3B2F A;  1IPG A;  4MJS A;  1JAL A;  3DBH B;  5CHW A;  3PT2 B;  3V6C B;  3NJT A;  3AU4 A;  2L7R A;  5EDS A;  2MJ3 A;  2CS4 A;  4K81 A;  1TGZ B;  2QCZ A;  3J9C A;  1ZP0 B;  2KDI A;  4J3O D;  3V60 A;  3JVZ X;  2SAK A;  2N9K A;  3IT4 B;  3Q3N C;  1N61 A;  3NZ3 A;  3DWM A;  3I9V 1;  3V6E B;  4W9L A;  1KFY B;  1E8Y A;  1C78 A;  1K53 A;  4OVV A;  3HIZ A;  2OJW A;  3R2I A;  1IGD A;  4JE3 B;  2ZW1 A;  4MGY E;  2BT6 A;  5J17 A;  3X23 A;  1NI3 A;  1WGD A;  4K3C A;  4EUT A;  1N63 A;  3R7R A;  1KTK A;  2LGS A;  1Y56 A;  1QF6 A;  1BXT A;  3IHP C;  1IGC A;  4NAM A;  5JH5 C;  2QDF A;  1H4R A;  2ZJD A;  5D3I B;  1UBQ A;  3U4E G;  1FEH A;  4JWU C;  3ML9 A;  3ZVV A;  1SJH D;  3N9Y C;  3JYU A;  1KLG D;  4RGN A;  1YIW A;  2BQQ A;  2JRH A;  2RGF A;  3N3K B;  4EOY A;  2L05 A;  1FMA D;  2IO0 B;  3EGR A;  3X0W A;  3BZD B;  2L00 B;  3NRZ A;  2KFK A;  4GSW A;  4WJQ A;  2D5G A;  1HEZ E;  3OLM D;  5IKC M;  4YL8 A;  3LDZ E;  2AL3 A;  1OFF A;  2WXL A;  2PW9 A;  4P6V F;  1MG4 A;  2MBQ A;  4E71 A;  2D10 A;  2VRR B;  1A5R A;  2JYT A;  2WXM A;  4MSM B;  5G2N A;  4BKS A;  1SE4 A;  3L13 A;  3PLU A;  3OJ3 A;  5AUI A;  4ANX A;  4FJZ A;  1QOB A;  4IM3 A;  1VLB A;  1NBF C;  5JXV A;  3UI3 A;  4HRS A;  4XE0 A;  2M0A A;  3SR6 A;  3RZW C;  4WJO A;  1VDV A;  2K8H A;  4KGR A;  2CHW A;  3BYT B;  4XZ4 A;  4YSX B;  2WHI A;  5MPO A;  1Q0W B;  4ZRI A;  4OW0 A;  3P2B A;  1J19 A;  2Z0E B;  4MM3 A;  1K50 A;  3BVG A;  1ZE3 D;  3QAQ A;  2JVC A;  3EA6 A;  4BOZ B;  3ECI A;  1XF5 L;  3RUL A;  2WXJ A;  1PGB A;  1MHH E;  1OQY A;  3DBL I;  2DX5 B;  5HKH A;  3TCA A;  3GOE A;  3AUL A;  5LXH A;  3U8Z A;  2A4Z A;  4MEL A;  2WLB A;  3TBL D;  5E6N A;  3CMM B;  1UGJ A;  1FIQ A;  4RM8 A;  4EEW A;  1L0X B;  3SD5 A;  3M95 A;  4GDK A;  3PSE B; 
#chains in the Genus database with same CATH homology
 1IBX B;  3IT6 B;  3RFZ B;  3ABV B;  4TQ0 A;  5H92 C;  3GS2 A;  2V4I B;  4NAW B;  1FXI A;  5BYQ A;  3TEZ A;  3R8B A;  5BYR A;  1JQ4 A;  1J7B A;  5E6J A;  3EUB 2;  4B0E A;  2WU5 B;  3VRA B;  2W3R A;  1L0Y B;  2FUG 1;  4TSS A;  4ITK A;  2AQ2 B;  3VR9 B;  1PUT A;  2JX5 A;  3PZ7 A;  3T3O A;  2NMQ A;  2INP E;  2R61 A;  2KWD A;  1GTH A;  5G5H A;  3ZJT A;  1T5X D;  2WXF A;  5LNK 1;  2RPV A;  1FCL A;  1MI0 A;  2BW2 A;  3CIR B;  2OED A;  2ICI A;  3AE2 B;  1D5M C;  4IKG A;  2IGG A;  1V1O A;  5FR3 A;  5G5G A;  2N7J A;  4RH6 A;  3B2G A;  4N59 A;  2JZP A;  1C79 A;  3SEB A;  3NS1 A;  3NVY A;  1B9R A;  3VQI A;  2NTT A;  3R2T A;  3H8H A;  2WXI A;  1QIL A;  1VZ8 A;  2V0G A;  1VZ6 A;  4WIP A;  4A9A A;  1DOY A;  3P4Q B;  1JRP A;  2QIL A;  2BS2 B;  4YTN B;  2LMC A;  3MC0 B;  5FKA C;  4NZL B;  2RDG A;  3GP7 A;  3OWE B;  2KMM A;  2LJI A;  1C4C A;  1SE2 A;  1EM7 A;  1HZ5 A;  2WXP A;  2WXG A;  2QIE B;  1N5X A;  2CJN A;  4XWT A;  3W9C B;  2Y3A A;  2KDM A;  3MJ5 A;  4WQM A;  1I4G A;  1FNV A;  2INN E;  4XWW A;  1WSP A;  1KLU D;  4KKJ A;  2E3T A;  2BS3 B;  4KKI A;  1ESF A;  3W1S A;  2JYE A;  1XXG A;  4O1N A;  1L6V A;  3AED B;  1WYG A;  3AE9 B;  4JWS C;  3CF4 A;  1YNT E;  2FE8 A;  2IPK D;  3IXS A;  1FCC C;  3U7Z A;  1TKE A;  1GOZ A;  1N5W A;  4YSZ B;  3FIL B;  1SXT A;  1HA5 A;  1SJE D;  2JSV X;  1YN4 A;  2Z8L A;  2RDH A;  3URY A;  3TEW A;  2LHE A;  4HRO A;  2XNA C;  1C77 A;  2GB1 A;  3P4R B;  2W82 A;  2WXK A;  2L32 A;  2QMT A;  2AQ1 B;  2CJO A;  1CJE A;  4WAF A;  5H8Y E;  1IBX A;  1J7A A;  1ZXI A;  1L4D B;  2BYT A;  1AW7 A;  2H89 B;  4HKZ E;  2BTE A;  1QOG A;  2IGH A;  3BII D;  1FXA A;  3LXF A;  1PYW D;  1XLO A;  1E10 A;  5GXG B;  3HVZ A;  1WWT A;  1T6B X;  1E7P B;  5HHD G;  3KWL A;  1JCK B;  1QOF A;  1STE A;  4RGO S;  2PMV A;  3ZJU A;  1C76 A;  4WWM A;  2WU2 B;  5BMI A;  1MHX A;  1XCQ L;  1V1P B;  1QT9 A;  2WDQ B;  2EEL A;  4OZA A;  2AQ3 B;  3BVZ A;  3W5V B;  4A8X C;  2WS3 B;  4YXD B;  4RCO A;  2MJE A;  2K22 A;  2N0S B;  3HRD D;  2WXH A;  4Q2J A;  3HUI A;  5HG2 A;  4GLS C;  1CQV A;  2M19 A;  3IAS 1;  3TEY A;  1UWM A;  3LYY A;  3AE7 B;  4US8 A;  1QQR A;  5T8I A;  4HKQ A;  1SB3 C;  1YQ4 B;  2X38 A;  2GRI A;  4RGT A;  1F0Z A;  2WDV B;  4OZB A;  3BK1 A;  2DLB A;  2IJ0 A;  2KQ4 X;  3AE8 B;  4HJG E;  1VRA B;  1NVI D;  3C8Y A;  2DWQ A;  3MFG A;  4LK0 M;  4B0M A;  4LTU A;  2Y5P A;  3W5U B;  3ZGZ A;  1I4R A;  3L4P A;  3U2S C;  1FNU A;  1L4Z B;  1F2R I;  3ZJV A;  3NUH B;  2B76 B;  3AE5 B;  1FRD A;  4MM3 B;  1YQ3 B;  2ONQ A;  5D3D A;  4N58 A;  1JWB D;  5EE0 A;  1TS2 A;  2WXO A;  1BML C;  3Q8A A;  5BYS A;  1D5X C;  2MEK A;  4TMA B;  4M0W A;  2WP9 B;  4OHJ A;  3FIL A;  1N60 A;  3V05 A;  3P1M A;  4OZC A;  5EE1 A;  5FK9 C;  1YMH E;  1OQQ A;  1B1Z A;  3SFE B;  2WXQ A;  4MAC A;  4DXG A;  1FD6 A;  3VRB B;  1SBB B;  1SEB D;  3DWG C;  3BWU D;  1ROE A;  4US9 A;  3AE4 B;  2JXT A;  4RFB A;  2G9H D;  4KGS A;  3AH7 A;  1EWC A;  1RM6 C;  2M56 B;  2YEP F;  3AEC B;  4KGT A;  1UUP A;  1UNS A;  1F2R C;  1JML A;  3B9J A;  5HFY A;  3AE3 B;  2JWU A;  4L2Y A;  4AS1 A;  2OHF A;  3TUO A;  1HQR D;  1ZOY B;  4YWG G;  2J53 A;  1JWU D;  2PVO D;  3AM9 A;  1NYR A;  1QOA A;  2LFI A;  2K0P A;  2K5P A;  4JPS A;  4R3D A;  1VZ7 A;  3IAM 1;  1XO3 A;  1EU4 A;  2PTL A;  1ET9 A;  3KLS X;  1VJK A;  1YN3 A;  1V97 A;  3AE6 B;  3AEG B;  2L1A A;  2PKO A;  3LB8 C;  4L1B A;  1H7X A;  1V1P A;  1ZDV A;  2BS4 B;  1ENF A;  1D6E C;  1EWY C;  1D5Z C;  2DYO A;  4P16 A;  4AQ7 A;  2J42 A;  1MVK A;  4LLG M;  4KX6 B;  4L23 A;  1RFK A;  2FBW B;  1JWM D;  1E9M A;  1F77 A;  2BBC A;  3U52 E;  3T3N A;  1L6U A;  3NVZ A;  2V3N A;  4TQ1 A;  3E9S A;  4C80 A;  2VZK D;  3AN1 A;  2KAC A;  1FRR A;  1TKY A;  1TS3 A;  2PIA A;  3BK2 A;  1VR9 A;  1ACC A;  1YN5 A;  3MHZ A;  1DOX A;  4D2K A;  1DYQ A;  4EE2 A;  1GT8 A;  3SFD B;  2RMM A;  5BMH A;  2PLP A;  2K3U A;  4NJC A;  2N9L A;  2NTS A;  3HVD A;  1R7S A;  2QSD A;  3B2F A;  2K9X A;  2BB5 A;  2LGI A;  3O13 A;  2ACZ B;  1M4V A;  4GDL B;  1JAL A;  3KWV A;  1JRO A;  3ETR A;  1CK1 A;  1P7E A;  2I38 A;  4MH8 A;  4XDD A;  1QKZ A;  2L83 A;  2TSS A;  5D7G A;  3PO0 A;  2MJ3 A;  1XLQ A;  2IGD A;  1TYG B;  1QLB B;  2PVG C;  4DXF A;  4JX1 C;  3V3X A;  4PT5 A;  2E6X A;  2G1E A;  2SEB D;  3J9C A;  1ZP0 B;  3Q8E A;  4H2A A;  4IOI E;  5I4D A;  4J3O D;  1I4X A;  4C7Y A;  1FNW A;  4A6Q A;  2SAK A;  1ZUD 2;  2MH7 A;  2ON8 A;  2N9K A;  1ZDX A;  2QJL A;  1C9F A;  3MP9 A;  3IT4 B;  1I4P A;  4YSY B;  2WQY B;  3AMZ A;  1I4Q A;  1HXY D;  1UWX A;  1TKG A;  2LUM A;  1N61 A;  3NZ3 A;  5HI1 A;  3DWM A;  3I9V 1;  2L52 A;  4YTM B;  3WCQ A;  1KFY B;  3RPF C;  3GB1 A;  1C78 A;  1XEE A;  2H88 B;  1K53 A;  3NVW A;  1TY2 A;  4IDI A;  4RF1 A;  1NYQ A;  3R2I A;  1PFD A;  1IGD A;  4ZOH C;  3Q8F A;  4JE3 B;  4A90 A;  2ZW1 A;  2BT6 A;  1L0V B;  3FAH A;  1I7H A;  3BYY B;  1NI3 A;  2W55 A;  2QEJ C;  1ZXH A;  3AB5 A;  5TSS A;  1N63 A;  1DGJ A;  5C2T B;  1KTK A;  1K51 A;  3Q8B A;  1JWS D;  1Y56 A;  3P4S B;  4YTP B;  4MT5 A;  1QF6 A;  5EE9 A;  1YJJ A;  1GTE A;  1BXT A;  1FFV A;  1SE3 A;  4HEA 1;  4ARC A;  1Q10 A;  1IGC A;  1ZPS A;  4NAM A;  1SIJ A;  5D3I B;  3U4E G;  1FEH A;  4JWU C;  2HDE A;  1FO4 A;  4ZRP A;  4FXC A;  3VR8 B;  1SJH D;  2KN4 A;  4DQO C;  1KRH A;  3N9Y C;  2DYM A;  1KLG D;  4RGN A;  1ET6 A;  1FFU A;  3FC4 A;  2J52 A;  4ZYS A;  1WRI A;  3TSS A;  4CQN A;  1FMA D;  4WUR A;  3PZ8 A;  3AV8 A;  3EGR A;  4ARI A;  1C4P A;  3AEB B;  1WXQ A;  3BZD B;  1GPX A;  4GDK B;  4WH4 A;  2Q5W D;  4ZRQ A;  3NRZ A;  2D5G A;  2DBY A;  2LEK A;  2Y5C A;  1HEZ E;  1EU3 A;  4OVZ A;  3BVM A;  1SSN A;  2IDY A;  4ZHP A;  1GB1 A;  1OFF A;  2WXL A;  2PW9 A;  4P6V F;  4REZ A;  1OQR A;  1KH0 A;  2JU6 X;  2CU3 A;  1E6E B;  1H7W A;  1TS5 A;  2YEP B;  1TJE A;  4RF0 A;  2BB6 A;  3W2D A;  1V8C A;  1AN8 A;  1FM0 D;  3AEF B;  2WNM A;  1K52 A;  2JYT A;  1NEK B;  2WXM A;  3I57 A;  1L5P A;  3P42 A;  1SE4 A;  1LO5 D;  3NVV A;  5AUI A;  2KAJ A;  4UDU C;  3AEE B;  2ZW0 A;  1TS4 A;  4A55 A;  1QOB A;  4N6E B;  5EE3 A;  1GB4 A;  1VLB A;  2MJD A;  5JXV A;  1N62 A;  1TZO A;  1WGK A;  2W54 A;  3UI3 A;  4HRS A;  4XE0 A;  1AWD A;  2M0A A;  2WDR B;  1PGX A;  3SR6 A;  1PGA A;  1VDV A;  4USA A;  4KGR A;  3BYT B;  4YSX B;  4C56 C;  5MPO A;  3ZYY X;  5BMG A;  3Q8C A;  4OW0 A;  2HTM E;  1K50 A;  1T3Q A;  2JQR B;  4RGM A;  3BVG A;  1D4B A;  1ZE3 D;  2W3S A;  1RWS A;  3EA6 A;  3ZQ4 A;  1NEN B;  1BUI C;  1XF5 L;  5C3J B;  2WXJ A;  4XDC A;  3AE1 B;  1RYJ A;  4RNA A;  2I2Y A;  3E56 A;  1PGB A;  1A70 A;  1AYF A;  1JW9 D;  1MHH E;  1PDX A;  5AUK A;  1XLN A;  1KF6 B;  3P63 A;  2GI9 A;  1MPE A;  2LHD A;  2VZK B;  1JWA D;  2WLB A;  1IUE A;  1DOI A;  1YJI A;  3TEX A;  3AEA B;  4ZHO A;  1XCT L;  1C4A A;  3Q69 A;  1XLP A;  1UGJ A;  1J7C A;  3P4P B;  1CZP A;  1FIQ A;  1GAQ B;  2WXN A;  1P7F A;  3CWI A;  1L0X B;  3KQ4 A;  1E0Z A;  1SF0 A;  2WXR A;  1TY0 A;  2XN9 C;  2AX5 A;  2V3P A;  4C7Z A;  2EKI A;  1HZ6 A;  1I4H A;  4YT0 B;  2J4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...