3AEAB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aeaB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aeaB01
1OQRA 3CWIA 2W3RA 4ZOHC 1H7WA 1ROEA 4A9AA 1QLBB 3ABVB 4YTNB 2MJ3A 2PVGC 1B9RA 2WQYB 1E6EB 5EE3A 2W54A 1ZP0B 2B76B 4N6EB 1PFDA 1XLOA 2BT6A 3B2GA 1E0ZA 3AE3B 1SIJA 1VDVA 2WDQB 1NYQA 1E7PB 1ZOYB 3AB5A 4YXDB 1GTEA 1R7SA 2H88B 1WGKA 2WLBA 5G5GA 4ZHOA 1NVID 1TYGB 4ZHPA 3P1MA 1H7XA 1EWYC 2ACZB 3P4SB 1FXAA 5EE0A 3ETRA 4YT0B 3HVZA 3AE8B 1T3QA 3P63A 4JWUC 2PKOA 2LEKA 1IUEA 1J7AA 2WDVB 2K5PA 3B2FA 3FC4A 1KFYB 1L0VB 3P4QB 1WYGA 1QOAA 2WS3B 3AEDB 1I7HA 4ITKA 3AM9A 5EE1A 2L52A 3AE9B 3NS1A 5EE9A 1VJKA 3SR6A 1XLPA 1V8CA 1N63A 2DBYA 1PUTA 1JWAD 2QIEB 3SFEB 1FMAD 2BS4B 3CF4A 3AEEB 3VR8B 2QJLA 3AEAB 1DOYA 1L6UA 2Y5CA 1OQQA 1L5PA 5C2TB 3KWLA 3NVZA 1GTHA 1J7CA 1GT8A 1N61A 3AE6B 3AE7B 3RPFC 1DGJA 2CU3A 3LB8C 1NEKB 1A70A 1WRIA 1N5WA 3P4RB 5AUKA 4C80A 5H8YE 1TKEA 2MH7A 2W55A 5AUIA 1QF6A 1QT9A 2AX5A 2Q5WD 4YTMB 3NVYA 1OFFA 1TKYA 3DWGC 2H89B 4USAA 3AN1A 1RYJA 3NVVA 1QOBA 1QOGA 2OHFA 1J7BA 3SFDB 4C7YA 2FBWB 4YSXB 1FFVA 4N58A 1CJEA 2BS3B 1CZPA 1FRRA 1QOFA 2MJEA 3NRZA 4KX6B 1E9MA 4US8A 3AE5B 3EUB2 1N60A 3AEBB 3NVWA 2N0SB 3BIID 3W5VB 1DOXA 1F0ZA 3VR9B 1DOIA 2PIAA 3AV8A 2HTME 3B9JA 3L4PA 1NI3A 1AWDA 1AYFA 1ZXIA 2MJDA 3AMZA 1KRHA 1JROA 1L6VA 4IDIA 1VLBA 2BS2B 5MPOA 2W3SA 3AECB 5H92C 1YJJA 2KMMA 2JQRB 2WU2B 4JX1C 3AEFB 1GAQB 4N59A 3WCQA 1KF6B 2E3TA 3AH7A 3HUIA 3AE1B 1FRDA 1RM6C 2EKIA 1JWBD 1TKGA 4LTUA 2K9XA 2L83A 2G1EA 1N5XA 2CJNA 2WU5B 1YJIA 2CJOA 3LXFA 1PDXA 2PVOD 1N62A 5G5HA 3ZYYX 4YSZB 2WP9B 1YQ4B 1NYRA 3PO0A 3CIRB 1WWTA 1YQ3B 1JRPA 3AE4B 1FM0D 2M19A 4US9A 3W9CB 1E10A 2DWQA 1SB3C 1RFKA 3DWMA 1WXQA 4HRSA 2WDRB 1V97A 4C7ZA 3FAHA 1FIQA 2K22A 1GPXA 1UWMA 1XO3A 1NENB 4P6VF 1JW9D 1JALA 4JWSC 1FXIA 1RWSA 1XLQA 5GXGB 1FO4A 3P4PB 3HRDD 5C3JB 2KAJA 1FFUA 1SF0A 4WWMA 3W5UB 4FXCA 4YSYB 3AE2B 1ZUD2 2JX5A 4HROA 4YTPB 3VRAB 2M56B 3AEGB 1XLNA 1JQ4A 4WQMA 3VRBB 1TJEA
chains in the Genus database with same CATH superfamily
5HI1A 2W3RA 3DVGY 2KWDA 2KYWA 5BYQA 1NI2A 3V61A 4GMVA 5CHWA 2INDC 2K8CA 4KKIA 1H7XA 1TS3A 3DHGC 2PKOA 3AXCA 1H8CA 1KFYB 2DYMA 3OJ4B 1PGXA 1R4NB 3NS1A 1CMXB 4JL9A 1AN8A 1FMAD 2KVRA 1I4HA 2XNAC 5C2TB 1GT8A 1IBXA 3ZJUA 2LHDA 1SEBD 2FIFA 4DDGD 1P9DU 3NVVA 3ZNHB 3QJZA 2KC1A 4OW0A 2V4IB 2G45B 2NTSA 4ANWA 3NRZA 4NJCA 1E9MA 1WJNA 1IGDA 3I3TB 5CX3A 4BBNF 2Z59B 3VR9B 2HTME 4GB9A 1SBBB 2KFKA 5CHFA 1JROA 1WGHA 1D4BA 4L1BA 1YMHE 4JPSA 4MH0E 4EEWA 3QWZB 3RMKC 1JRUA 3NS8A 1TKGA 1Z2MA 4LTUA 5DCNA 2Y5PA 4BKTA 1GG3A 2JPHA 4FULA 4TSSA 3DBLB 4I6LB 1I4PA 3IXSA 1XO3A 4RGTA 3EC8A 4RM8A 4BAXA 1C76A 2AQ2B 3GZNB 3HRDD 4ZRIA 1UWXA 1C9FA 1MI0A 4FXCA 4W9JA 3AE2B 3VQIA 1ZUD2 4TUUA 3OLMD 5IP4D 4OZBA 1NBFC 2PVGC 3C8YA 2KQSA 3A9KB 5EE3A 3B2GA 1WX9A 4HJGE 1GTEA 3PS6A 4IM2A 1WGKA 4ICVA 3ETRA 3VXWA 4X57B 2E6XA 2MHJA 3ZVVA 2DAFA 2KDBA 2L52A 2IZVB 2NS5A 4G50A 1PGAA 2IO2B 3SFEB 4HXDA 2LJIA 3CF6E 3LDZE 5AZHA 2KX3A 1OQQA 1WSPA 3Q3JA 1OEYA 4GLSC 1WGYA 2RMMA 1VZ6A 1FCLA 3IT4B 3KW5B 1VZ7A 5CTRC 1MHHE 4OHJA 2LUEA 3QCAA 2K6QA 3JVZX 3DVGX 4EE2A 3A9JB 1ZKHA 1K8RB 3T8MA 5FR6A 1WM2A 4HWIB 4MGKE 2AQ1B 2LVPA 2MX2A 5E6PA 4PS8A 3ZTDA 1V5OA 2K3UA 4RGNA 1NI3A 3ML9A 4IDIA 4ZYSA 3Q14C 4FADA 4CHKA 1QILA 2QCZA 1P98A 2IGHA 3Q3NC 3HUIA 2O6VD 1V81A 2WXFA 1SJHD 4A55A 1R4MI 2JY6A 4M02A 4ASWC 2WXPA 3N20C 4BKGA 2K6DB 4IOIE 1Q5WB 4MT5A 2GBNA 3RD2A 4GOCA 2J7QB 4L23A 2WXLA 3T3NA 2C7MB 3GB1A 4HROA 1EUVB 1TS4A 1STEA 2LGXA 3R8BA 1UELA 2SAKA 4PK1A 1E6EB 3TUOA 1HZ5A 1F9JA 2RDBC 2KC2A 2J0JA 3EFCA 2H88B 1K51A 3M3JA 1CQVA 3S2AA 2ON8A 1T3QA 2MRPA 1J7AA 3DBRB 5GMVA 2IO0B 2C7HA 3SD5A 3ZDTA 3FC4A 2D11A 1QOAA 2WS3B 2JVCA 2A4ZA 2MCNB 3MJWA 3A4RA 4LNOA 3P2BA 1M4VA 1GOZA 2KLCA 3NY5A 3PRZA 1KTKA 2XN9C 1VCBA 2GOWA 3LB8C 1N5WA 3MJ5A 5IO9A 2FCSA 2WGSA 3C0RB 3VTWA 3ZRCA 2H89B 1M94A 2ZCBA 4K3BA 4USAA 2OHFA 5E6NA 3FILB 4YSXB 3NHEB 3ZO5B 2PTLA 4IM3A 3W5VB 3PLUA 1AYFA 2OJWA 1E90A 3HM3A 3TEYA 3MC8A 1L4DB 1YN5A 4TKNA 3RNBC 2ZPNA 1V86A 3ZXRA 3AEFB 1WMHB 2LXAA 2CS4A 3AH7A 2JF5A 3UQBA 2IGGA 4NJ6A 2BTEA 2HDEA 2WU5B 1YJIA 2L0FA 1PDXA 2NTTA 4KIKA 4MM3B 1LFDA 1JRPA 3AE4B 2KACA 3VAWA 4DHZE 2MLBA 3OG5A 4HCNB 3R7QA 2KJRA 4JWSC 2C9WB 5D7GA 4CO7A 4RF1A 2M0XA 4BKSD 2BWES 2J52A 3RFZB 2QMTA 3V62A 4XWWA 5I4DA 4RF0A 1K52A 2LMCA 3JSVA 1ZGUB 1XLOA 1ESFA 2N9PC 1C77A 3TSSA 2WXHA 4GIVA 1U4AA 4KDLB 5G5GA 3TJPA 3GOEA 3U7ZA 1TS5A 2CU1A 4DXGA 4WH4A 4RM9A 3BYYB 3N3KB 3DQVA 1V6EA 4KDIC 1T5XD 4W9GA 1E7VA 2JRHA 4HVBA 2MBQA 3HK0A 2BKFA 1HXYD 4M8MA 4MDKE 3B1LX 4EZKA 2AX5A 1F1HA 1UF0A 1RYJA 5HG2A 1QOGA 1TY0A 1LXDA 3VHTC 1UBQA 1QOFA 2LGSA 4LNKA 1EU3A 1FNUA 2BW2A 3BVZA 4FBJB 4B6WA 3TBLD 1IBXB 1L6VA 2KT7A 1T0QC 5C23A 1XD3B 4JX1C 2DENB 3DVNU 5D2MB 3DOWA 4URKA 2G1EA 4E71A 4PS7A 3R2IA 1WWTA 2RDGA 1SB3C 4C7ZA 1E8ZA 1FD6A 1FNWA 1V9JA 3HIZA 3O13A 2CKHB 2I1JA 2CHZA 3SEBA 3WA0A 2Z0EB 2M4NA 2WXJA 4KV2A 2AYOB 4YSYB 1P7EA 3V3XA 3IAM1 2RD0A 1WF9A 3I5JC 2JXTA 4E3CA 1XXGA 1TZOA 3ZGZA 3DBSA 2DZIA 2KZRA 4W9FA 1N6ZA 5J2RA 2CHWA 2SEBD 1IGCA 1VRAB 2R2OA 4YWGG 1WH3A 2LGIA 2RPQA 4XGAB 4ITKA 2VZKB 3DBHI 1MHXA 3AE9B 5EE9A 4LNNA 2L32A 1OGWA 1OTRB 3V05A 3AEAB 4MGYE 1LO5D 3NVZA 2V0GA 1WI0A 4W9KA 5H8YE 5AUIA 2KTFA 4IKGA 2G9HD 2ZW1A 3HHMA 1MG8A 5BYRA 3AN1A 4FA6A 2PJHA 2LWPA 3PREA 2PE6B 4FJYA 3FILA 3AE5B 5E6OA 3RULA 1WX7A 2DYOA 2JWZA 4WAAA 2HJ1A 2D07B 2OOBB 1OEYJ 5G55A 2NMQA 2LASA 2BYEA 4KSKC 1WMHA 3L08A 3Q3OC 1JWBD 1PYWD 3IVFA 2N7DA 2ZPYA 3ZRFA 3H9DA 2FCQA 1NYRA 3Q8BA 4MM3A 1FM0D 2JWUA 1L0YB 4II3B 2LVQA 2K22A 4F8CB 4G11A 5GXGB 2LZ6A 3ZNGC 4WURA 3GE8C 3ZQ4A 5LXHA 4ICUA 1H7WA 4A9AA 4JIOU 4P1CC 1WGDA 3ZJVA 2KX0A 2O2VA 5D6JB 5BMIA 2D3AA 1SIJA 3KUZA 2XK5B 1WM3A 1SE4A 4ZRJA 1AARA 4F1SA 3PRPB 4YT0B 3HVZA 2KK8A 1PGBA 2PEAA 3KH0A 3X23A 1WRDB 1HEZE 3AEDB 3ZUNA 3AM9A 1FPYA 4AJWA 1XLPA 1V8CA 2G3QB 2L7RA 2I38A 4NZLB 2QIEB 3BK1A 2JYTA 3O65B 2L05A 2MA9B 5CHVC 4LDTD 3AE6B 2DZMA 3A1QA 4XZ4A 2UU7A 2BF8B 2WXOA 5D3IB 3IAS1 1F2RI 2KFJA 2PE9A 1TS2A 1WGGA 2NBUA 2NPTB 3E9SA 4IUMB 2LUMA 1FFVA 3PVLA 2BS3B 2IGDA 2V3PA 4KX6B 3NVWA 2ZJDA 3ONSA 3N1ZC 3Q8FA 1DOXA 3EGRA 4HLEA 3PHWB 2KMCA 3H8HA 1HTQA 1P7FA 3H7SA 3UQAA 2BS2B 4FLHA 3RNCC 4DWFA 2KQ4X 3Q6BA 3HM6X 2ASQA 2C7NB 4IW0A 2CR5A 1UZXB 2AQ3B 2JSVX 2CJOA 2D10A 4FJVB 1C4CA 4K3CA 2EMSA 3RNAC 4M00A 1WE7A 1KLUD 2N9LA 1NENB 1R4NI 4MSQB 1KH0A 5IA7A 2IYDB 2V3NA 4YTPB 1UD7A 4HPPA 4IM0A 4WQMA 4AQ7A 2LRWA 2WNMA 1UUPA 2ZVOA 2IY0B 4RCOA 5FK9C 2PLPA 2KLGA 4KIKB 2W54A 3L16A 1ZP0B 4BFRA 2KDFB 3AU5A 1P1AA 1XCTL 3QK0A 1V1PA 3P1MA 1S1QB 2RPVA 4KVGB 1WYGA 3K9PB 3CMMB 4A3PA 5JXVA 2NVUI 4MSMB 3QIJA 1JWAD 3TEZA 1C4AA 2QJLA 3JSVB 5D3DA 3U8ZA 1WFYA 1UBIA 3I9V1 1BUIC 4WJPA 3L13A 2KOXA 2LGDA 4ACFA 4XE0A 1F77A 4W9EA 3AULA 3V60A 2JU6X 3RZWC 4US8A 3AEBB 2W82A 3BIID 1F0ZA 3AU4A 4P7IA 2MJDA 1L0XB 4KZCA 4NAMA 5JH5C 1WR6E 1YJ1A 1EO6A 4G3XB 3NJTA 4K7WA 1N5XA 4MH8A 4DHJD 4CYEA 2WP9B 2JZPA 2IY1B 2WDRB 1WGRA 1R4MB 1RWSA 3QHTA 1FO4A 3W1SC 5C3JB 1ET9A 1KM7A 2ONQA 4HCPB 3KWVA 1OQRA 4M01A 4HPLB 2JUOA 2KN5A 3OJ3A 4REZA 4P1BC 4N6EB 2XK5A 3V6CB 2Y3AA 3AB5A 3RUIB 1TY2A 1TIFA 1FEHA 4PYZA 1EWYC 2L00B 3NOBA 1EWCA 3VUXA 1Q10A 2WDVB 2KHWB 3VVWB 1L0VB 1TTNA 2AL6A 1I7HA 1Q0WB 1D5ZC 4Q2JA 1GJZA 3BY4B 2IJ0A 2LVOA 4WJNA 4FHJA 3R2TA 3Q3FA 4KGTA 2N1VA 1KOTA 3H6NA 3VTVA 1S3SG 1TT5B 3RN9C 4C00A 4DK5A 3DHIC 2C5LC 3PZDA 2I2YA 1B1ZA 3NVYA 1OFFA 3DHHC 1QQRA 1EF5A 2NPTA 2OJRA 4WQOB 5BYSA 3ZJTA 3QA8A 3SU8X 1AWDA 2J42A 4KSLC 2PMVA 1KJTA 1E8XA 3WANA 4AOFA 5MPOA 2BPSA 1ZDVA 2KDEB 2ZNVC 3AE1B 2AEHA 2X38A 2YLMA 4DDID 1XQQA 1RLFA 4YSZB 1C1YB 1YQ3B 1VD2A 2DHZA 4ZYNA 1WXQA 1V97A 2FNJB 2N9EB 1D5MC 2WWZA 4YL8A 4PS3A 4UDUC 3X0WA 2KJ6A 2K8BA 4FHKA 1J8CA 1D6EC 4FN2A 1P3QU 1YD8U 4NPNA 1GB4A 2M1MA 2MJ3A 2HD5B 1C78A 1E0ZA 3AE3B 4R3DA 4A8XC 4LK0M 1K50A 1NVID 3BZDB 1TYGB 1V2YA 1BT0A 2INPE 1SGHA 1JCKB 3W2DA 3RNGC 4GGQA 1WZ0A 3R7RA 3UI3A 2O2VB 5DPWA 2QEJC 1E7UA 3U52E 4ANXA 1WY8A 2D3GA 3H7PA 1QF6A 5JHBA 1LM8B 4ARIA 3TCAA 5JZEB 1RFAA 3SFDB 1EU4A 2K1FA 1V1OA 2NR2A 1J19A 1HTOA 4RFBA 1GC6A 3U7DA 3AV8A 2N7EA 2KDIA 4HPMB 2WXGA 3A1QB 2JXXA 2K8HA 3IBEA 1QKZA 2GBRA 3J9CA 3AECB 2JQRB 3U2SC 3NZUA 3P42A 3TL5A 5C1ZA 3PT2B 3TEWA 3Q8CA 2WXQA 2PVOD 1ACCA 3BK2A 4J6IA 1WXVA 5J17A 3KVFB 3K9OB 1YOVB 4RH6A 4KGSA 3RZFA 4HK2A 4EUTA 4P16A 5BMHA 1ZXHA 2D3BA 2O6VB 3VRAB 1JWMD 3CWIA 3OWEB 4O1NA 4XWTA 1Z5SB 1QLBB 4YTNB 3RNEC 4IWPA 3Q69A 3HVDA 3EECA 3WAMA 2WDQB 3WAOA 3N30A 2AWTA 1YQBA 2BB6A 1FXAA 1UGMA 5EDSA 4F7ZA 1IUEA 4TV3A 1BMLC 1VJKA 2DBYA 1Q1OA 4NQLB 2MEKA 2BWFA 2Y5CA 5E6JA 2ZNVB 4AWJA 3P4RB 3APFA 2HE7A 1V1PB 2W55A 1QT9A 2KJHB 2N1WA 1D3ZA 1FXTB 2J4XA 4MJSA 1FRRA 2MJEA 5IKCM 3IG3A 5IAAC 3AI5A 5FKAC 5IN7A 2JRIB 3GP7A 2G4DB 4C4VA 5H92C 2WU2B 3WCQA 1PQSA 2Z8LA 2REXA 1FNVA 2K9XA 3KQ4A 2QILA 3CIRB 3KLSX 4W9DA 2M19A 1IYFA 2WHIA 1RFKA 4DXFA 1MG4A 3RCZA 1RAXA 3ZTCA 1GPXA 4HKQA 3Q2AC 3P4PB 3T9LA 4WWMA 3PRMB 4HEA1 1UH6A 4I6PA 3WIMA 3VH3B 5FR3A 3MP9A 3VRBB 2JZ3B 5JHAA 2R2QA 1JMLA 4G0NB 1C79A 4AJYB 3JW0X 4BZAA 2WQYB 1ZE3D 3A33B 2MWSB 2XEWA 2BT6A 4GDLB 4II2B 3C19A 1WJ6A 1E7PB 2KXJA 1ZOYB 4ZHOA 1I4RA 4NQKE 2FUG1 2LD9A 4L2YA 4GXBA 1KLVA 5LNK1 2NBVB 4BOZB 1SE3A 1IPGA 3B2FA 1CK1A 5AZFA 1E8WA 3WAPA 2NCNA 3Q8AA 2Y5BB 1PUTA 2ZCCA 3ZXVA 2HJ8A 3AEEB 4DXAB 1T0SC 1Y8RC 1L5PA 4WAFA 2N9KA 1DGJA 1A70A 5HHDG 1F52A 4NAWB 3N9YC 2KTRB 1J7BA 4WJQA 4ZRQA 3H1UA 2DLBA 1MVKA 4B0MA 3W1SA 1DOIA 2KQ7A 2FAZA 2PIAA 1K53A 4S17A 2K39A 2OEDA 3NZSA 2PPHA 3KYCD 4WWNA 1VLBA 2M0AA 3URYA 2DZKA 3N1XC 2D5GA 1GB1A 3R3MA 1V5TA 4FJZA 3CSTA 1FRDA 3DCGA 2W9NA 4HJKA 4A20A 1C3TA 2L83A 3Q3MC 1SIFA 3LXFA 5DPSA 3KUDB 3PO0A 4IWQA 2MBEA 3ZLZA 4CQNA 1E10A 3PZ8A 3DWMA 2ZW0A 1JW9D 3UIPB 2O6VA 3UIOB 2BYVE 2M56B 1ZDXA 4MEMA 2QDFA 2GBMA 2N9XA 1I4XA 3ALBA 2N4FA 4KZ0A 1B9RA 3NZ3A 2B76B 1WXMA 1PFDA 2FIDA 4TQ0A 5T8IA 3PSEB 4LNIA 3EFUA 2WLBA 2MBBB 2YEPF 1TZ1A 5DPRA 1L7YA 5EE0A 3WALA 4EZJA 2C60A 3VDZA 4AS1A 3IHPC 2K5PA 5J18A 5EE1A 4RMAA 4JLCA 1YNTE 3U4EG 2BS4B 3VR8B 1GTHA 2KMAA 2LGYA 3I57A 2CU3A 2M8SA 5TSSA 2PW9A 4TQ1A 2LFIA 3ZW3A 1YX6B 4KKJA 5KHOA 3FKYA 2YVCA 2FBWB 1V80A 2I1KA 1J0GA 2MP2B 1CZPA 1P0RA 2N7JA 1TBEA 3L0WB 2EKEC 4M0WA 4ZRKA 3BVGA 3N32A 2QHOA 1WXSA 2UWQA 2KN4A 1KRHA 3PHXB 5LXIB 4W9HA 4MGIE 3ENEA 4EZLA 3H7PB 3M63B 2HTHA 2GBKA 3DPDA 4DQOC 4ANVA 4XDCA 2E3TA 2M17A 3DBLI 4B95A 4JE3B 2CJNA 3GZNI 3E56A 4LLGM 2DWQA 3EA6A 2V4LA 4AUQC 3QX1A 4BBNC 4DBGA 1ENFA 3FAHA 2L1AA 3CSFA 4OVUA 1UWMA 2RSUA 4XX5A 3BINA 2NBWB 4NY0A 2B3AA 1YN3A 2KVZA 1I35A 2J0KA 2GB1A 5LLIA 4ZOHC 2INCC 1QZEA 1MPEA 3ZDMC 2L3ZA 1YX5B 1VDVA 3MC9A 4GDLA 1NYQA 2VH2A 2WXRA 4BKSA 1Y56A 2QSDA 1ZW7A 3L10B 4S0RA 4GDKB 3PGEA 1SSNA 3W1YA 1I42A 1WX8A 1UNSA 2VRRB 3CF4A 2MBOA 4C80A 3B0AA 2IO1B 2BYFA 4NAWA 2GMIC 3MC0B 2MSED 3ZNID 1JWUD 1SJED 1XEEA 1QOBA 4NJ7A 2KTRA 4XC2A 5TR5A 4C7YA 3M62B 2GI9A 2J0MA 4K7UA 4KGRA 3OAWA 4AP4C 3BWUD 4C56C 1N60A 2KWCA 2GBJA 2FCMA 3L17A 4EFOA 4LDTB 1GNUA 1ZXIA 2JT4B 4JGHB 3SHQA 4M8NA 2KMMA 4MJSB 2BYTA 4IWOA 1VZ8A 2IBIB 1N62A 1H4RA 2K25A 4IG7B 3QAQA 1LGRA 2DNFA 4US9A 4ARCA 3VH4B 3ZKJC 2INNE 4W9LA 3R66C 1D5XC 1JWSD 4P6VF 3GS2A 1G6JA 2FCNA 2WX0A 3VUWA 2WXMA 2V9HA 4C4VB 2ICIA 1SF0A 2UYZB 4HKZE 2JX5A 1E5WA 1WYWB 3AEGB 1JQ4A 2LRUA 3LJ3A 1ROEA 2RDHA 2VZKD 2KO3A 3SDLC 3APDA 3RYTA 2MQJA 1YIWA 4OVVA 3DBRI 1A5RA 5AZGA 1VR9A 4K7SA 3P4SB 3KUCB 3P63A 4PT5A 2R61A 4A6QA 2V1YA 2KANA 3PTFC 2VH1A 3RNFC 4RNAA 1L6UA 4JQWC 2A5UA 2V3SA 3QARA 1T6BX 1YN4A 3GE3C 2YEPB 1NEKB 1GC7A 1TKEA 1SE9A 1WXAA 1TKYA 2CHXA 2BBCA 1DYQA 2X8XX 4XDDA 4WWPA 1XT9B 5HKHA 1RRBA 4N58A 2MP2A 4LCDE 3D32A 3B08A 1BXTA 1MJDA 2BGFA 5AEKB 4LJOB 5L83A 2RGFA 3B9JA 1WE6A 1MFWA 1YJJA 2D3CA 4N59A 4I6NB 1EF1A 2AL3A 4MGZE 2XBBC 1SE2A 1RM6C 1V49A 4NNJB 2KNBA 4OZAA 3ZYYX 5G5HA 3BYTB 3A9KA 3MFGA 3LYYA 3W9CB 4A90A 1ISNA 4LJPB 4J3OD 2MW5A 3TEXA 4WIPA 2MBHA 3PPAA 2BQQA 1FXIA 1XLQA 4GN1A 4GU2A 4B0EA 1SXTA 2KAJA 1FFUA 4RGMA 2WDTB 1TJEA 4H2AA 1T0RC 4DHJB 1EM7A 3MTNB 4XYCA 3M95A 2WX1A 3JYUA 1HA5A 3PZ7A 1ET6A 2ZZPB 3RT3B 2LI5A 4OVZA 1L4ZB 4YXDB 1R7SA 4K81A 5BO4B 4ZHPA 1F2RC 5IOIA 1HQRD 2ACZB 3AE8B 5L95C 2LEKA 3A9JA 1L2NA 3MHSD 4GDKA 2JZZA 1GUAB 4D2KA 2LHEA 3N1YC 3SR6A 1N63A 1WJ4A 3DDCB 2KWVB 3KWLA 1J7CA 1TGZB 2G4SA 1WRIA 4RGOS 5HFYA 2FE8A 1XF5L 2Q5WD 4YTMB 2DYBA 3DWGC 1C4PA 2L8JA 4W9IA 4MELA 1AW7A 1KLGD 2WYQA 1NDDA 3Q8EA 3EUB2 2DAJA 2JYEA 2N0SB 1OQYA 3VFKA 1UGJA 3I63C 3L4PA 4WWOA 3U30A 1I4GA 2KFKB 3AMZA 1T0YA 3DBHB 3BVMA 4IC7B 3IT6B 3VTUA 3PV1A 2KKCA 4DHZB 2EKIA 1WJUA 2L76A 4MACA 3QQ8B 2IO3B 2BB5A 1YQ4B 4M0WB 2WXIA 4HRSA 3NG0A 1JALA 3QC8B 5DPTA 1WZ3A 1WR1A 2KDMA 3W5UB 4ANUA 4A3OA 5BMGA 3RPFC 5AUKA 2KD0A 3ECIA 4LNFA 4ZRPA 2ZVNA 3ZIMA 2LJ5A 3ABVB 3TIXA 3VUYA 1E8YA 3V6EB 4W9CA 3EHVA 3DVNV 5D94A 2EELA 2LXCA 4BOSC 4JWUC 2ZEQA 3UGBB 3PLVA 3P4QB 3L54A 3T3OA 3A4SC 2IDYA 4N9F4 1DOYA 2DZJA 1ZPSA 2J53A 1N61A 3KYDD 3AE7B 3APCA 4HDQA 5G2NA 2QC8A 2MH7A 1HZ6A 3MHZA 4EKUA 4B9KA 1CJEA 2FUHB 3UF8A 3ZNZB 2L0TA 1HE8A 2EMTA 4BVUC 4OZCA 2BKRB 2DX5B 2WXKA 4PYUA 2BVCA 4K1RB 2Z0DB 4GSWA 2WXNA 1XCQL 2W3SA 4ZDVA 1LQBA 4E74A 1GAQB 4QAYA 1KF6B 4TMAB 2KWUB 3ML8A 4HDOA 2RR9A 4EOYA 5KHQA 2GLSA 1I4QA 2IPKD 1FIQA 3UINB 2TSSA 3IFWB 4WJOA 1X1MA 3TMPB 2K0PA 1IP9A 3RI7C 2D2QA 1WIAA 3NUHB 1XLNA 2GRIA 1FCCC
chains in the Genus database with same CATH topology
2GB1A 5HI1A 2W3RA 4ZOHC 1GB4A 2JXTA 2MJ3A 1XXGA 2KWDA 1TZOA 3ZGZA 1MPEA 5BYQA 1C78A 1E0ZA 3AE3B 1VDVA 4R3DA 1NYQA 2WXRA 4A8XC 4LK0M 1Y56A 4KKIA 1K50A 1NVID 2QSDA 2SEBD 1TYGB 3BZDB 1H7XA 1VRAB 1IGCA 4YWGG 1TS3A 2INPE 2LGIA 2PKOA 1JCKB 4GDKB 3W2DA 1KFYB 2DYMA 2VZKB 4ITKA 1SSNA 1MHXA 1PGXA 3AE9B 3NS1A 5EE9A 1UNSA 2L32A 1AN8A 1FMAD 3UI3A 3CF4A 3V05A 3AEAB 1LO5D 1I4HA 2QEJC 2XNAC 5C2TB 3U52E 3NVZA 1GT8A 1IBXA 2V0GA 4C80A 3ZJUA 2LHDA 1SEBD 5H8YE 5AUIA 1QF6A 4IKGA 2G9HD 3MC0B 2ZW1A 4ARIA 5BYRA 1JWUD 1SJED 1XEEA 1QOBA 3AN1A 3NVVA 4OW0A 3SFDB 1EU4A 4C7YA 2GI9A 4KGRA 1V1OA 2V4IB 3FILA 3BWUD 2NTSA 3NRZA 4NJCA 1E9MA 4C56C 3AE5B 1IGDA 1N60A 4RFBA 3VR9B 2DYOA 3AV8A 2HTME 1ZXIA 1SBBB 2WXGA 1JROA 1QKZA 3J9CA 1D4BA 3AECB 2NMQA 4L1BA 2KMMA 2JQRB 3U2SC 1YMHE 4JPSA 3P42A 3TEWA 1JWBD 1PYWD 1TKGA 3Q8CA 4LTUA 2BYTA 1VZ8A 2WXQA 2PVOD 1ACCA 1N62A 3BK2A 2Y5PA 1NYRA 3Q8BA 4US9A 1FM0D 2JWUA 4KGSA 4RH6A 4ARCA 1L0YB 4TSSA 2INNE 1D5XC 1I4PA 2K22A 1JWSD 3IXSA 1XO3A 3GS2A 4P6VF 4RGTA 4P16A 1C76A 2AQ2B 5GXGB 2WXMA 5BMHA 3HRDD 2ICIA 1UWXA 1ZXHA 1SF0A 4WURA 1C9FA 1MI0A 4FXCA 3AE2B 4HKZE 3VQIA 1ZUD2 2JX5A 3ZQ4A 3VRAB 3AEGB 1JWMD 1JQ4A 3CWIA 3OWEB 4O1NA 1H7WA 4XWTA 1ROEA 2RDHA 2VZKD 4A9AA 4OZBA 1QLBB 4YTNB 2PVGC 3ZJVA 3C8YA 5EE3A 5BMIA 3Q69A 3B2GA 3HVDA 1SIJA 2WDQB 1SE4A 4HJGE 1GTEA 1WGKA 2BB6A 1VR9A 3P4SB 1FXAA 3ETRA 4YT0B 3HVZA 2E6XA 3P63A 1IUEA 1PGBA 4PT5A 1BMLC 1HEZE 2R61A 3AEDB 3AM9A 2L52A 4A6QA 1VJKA 1XLPA 1V8CA 2DBYA 2I38A 4NZLB 1PGAA 2QIEB 3SFEB 3BK1A 2JYTA 2MEKA 4RNAA 2LJIA 1L6UA 2Y5CA 1OQQA 1WSPA 4GLSC 1T6BX 5E6JA 3AE6B 1YN4A 2RMMA 1VZ6A 1NEKB 2YEPB 1FCLA 3IT4B 3P4RB 2WXOA 5D3IB 1VZ7A 1V1PB 1TKEA 1MHHE 2W55A 4OHJA 3IAS1 1QT9A 1F2RI 4EE2A 1TKYA 2BBCA 2J4XA 1TS2A 1DYQA 3E9SA 4XDDA 2LUMA 1FFVA 4N58A 2BS3B 1FRRA 2IGDA 2MJEA 2V3PA 4KX6B 3NVWA 2AQ1B 1BXTA 3Q8FA 1DOXA 3EGRA 3H8HA 2K3UA 3B9JA 4RGNA 1NI3A 1P7FA 5FKAC 4IDIA 4ZYSA 3GP7A 2BS2B 1QILA 1YJJA 5H92C 4N59A 2WU2B 2KQ4X 3WCQA 2IGHA 2Z8LA 1FNVA 3HUIA 1SE2A 1RM6C 2K9XA 3KQ4A 2AQ3B 2JSVX 2WXFA 1SJHD 2CJOA 4OZAA 4A55A 3ZYYX 5G5HA 3BYTB 1C4CA 2QILA 2WXPA 3CIRB 3KLSX 3MFGA 3LYYA 2M19A 3W9CB 4A90A 1RFKA 1KLUD 4IOIE 4J3OD 4DXFA 3TEXA 2N9LA 4WIPA 1GPXA 1NENB 4HKQA 4MT5A 1FXIA 1XLQA 4L23A 3P4PB 4B0EA 1KH0A 1SXTA 2KAJA 1FFUA 2WXLA 2V3NA 4HEA1 4WWMA 4RGMA 3T3NA 3GB1A 4HROA 4YTPB 1TS4A 5FR3A 4WQMA 4AQ7A 3MP9A 3VRBB 1TJEA 1STEA 2WNMA 1UUPA 4H2AA 1JMLA 1EM7A 4RCOA 5FK9C 3R8BA 2PLPA 2SAKA 1C79A 2WQYB 1E6EB 1ZE3D 2W54A 1ZP0B 3TUOA 1HA5A 1HZ5A 3PZ7A 1ET6A 2BT6A 4GDLB 4OVZA 1E7PB 1L4ZB 1ZOYB 1XCTL 4YXDB 1R7SA 2H88B 1I4RA 4ZHOA 1V1PA 1K51A 4ZHPA 1F2RC 2FUG1 1CQVA 1HQRD 2ACZB 3P1MA 4L2YA 5LNK1 2RPVA 3AE8B 1T3QA 2ON8A 2LEKA 1J7AA 1SE3A 3B2FA 1CK1A 3FC4A 1WYGA 1QOAA 2WS3B 5JXVA 4D2KA 2LHEA 3Q8AA 3SR6A 1N63A 1PUTA 1JWAD 3TEZA 1M4VA 3AEEB 1C4AA 1GOZA 2QJLA 5D3DA 1KTKA 1L5PA 3KWLA 1J7CA 2XN9C 3I9V1 2N9KA 4WAFA 1BUIC 1DGJA 3LB8C 1A70A 1WRIA 1N5WA 3MJ5A 4RGOS 5HHDG 5HFYA 2FE8A 4NAWB 1XF5L 2Q5WD 4YTMB 3N9YC 3DWGC 2H89B 1C4PA 4USAA 4XE0A 2OHFA 1AW7A 1J7BA 1F77A 2JU6X 1KLGD 3FILB 4YSXB 3Q8EA 4ZRQA 4US8A 2DLBA 3EUB2 3AEBB 2PTLA 1MVKA 2JYEA 2N0SB 2W82A 3BIID 3W1SA 3W5VB 4B0MA 1F0ZA 1DOIA 1UGJA 2PIAA 1K53A 3L4PA 1AYFA 2MJDA 1I4GA 2OEDA 3AMZA 1L0XB 3TEYA 1L4DB 1YN5A 1VLBA 3BVMA 2M0AA 4NAMA 3URYA 3AEFB 3IT6B 2D5GA 1GB1A 3AH7A 1FRDA 2EKIA 2IGGA 2L83A 4MACA 2BTEA 2HDEA 1N5XA 4MH8A 2WU5B 1YJIA 3LXFA 1PDXA 2BB5A 2NTTA 2WP9B 1YQ4B 2JZPA 3PO0A 4MM3B 4CQNA 1JRPA 3AE4B 1E10A 3PZ8A 2KACA 2WXIA 3DWMA 4HRSA 2WDRB 2ZW0A 1JW9D 1JALA 4JWSC 1RWSA 5D7GA 2GRIA 4RF1A 1FO4A 2J52A 5C3JB 1ET9A 3RFZB 2KDMA 3W5UB 2ONQA 5BMGA 2QMTA 2M56B 3RPFC 1ZDXA 5AUKA 3KWVA 1OQRA 4XWWA 5I4DA 1I4XA 4ZRPA 4RF0A 1K52A 3ABVB 1B9RA 2LMCA 4REZA 3NZ3A 2B76B 4N6EB 1PFDA 1XLOA 1ESFA 4TQ0A 1C77A 3TSSA 2WXHA 5T8IA 2EELA 2Y3AA 3AB5A 1TY2A 2WLBA 5G5GA 1FEHA 2YEPF 1EWYC 3U7ZA 1EWCA 5EE0A 1Q10A 1TS5A 4DXGA 4WH4A 4JWUC 4AS1A 3BYYB 2WDVB 2K5PA 1L0VB 3P4QB 5EE1A 1I7HA 1D5ZC 4Q2JA 1T5XD 3T3OA 2IJ0A 1YNTE 2IDYA 3U4EG 2BS4B 3R2TA 3VR8B 4KGTA 1DOYA 1ZPSA 2J53A 1GTHA 1N61A 3AE7B 3I57A 2CU3A 1HXYD 5TSSA 2PW9A 4TQ1A 2LFIA 2MH7A 2I2YA 1B1ZA 2AX5A 4KKJA 1HZ6A 3NVYA 1OFFA 3MHZA 1RYJA 5HG2A 1QOGA 1TY0A 1QQRA 2FBWB 1CJEA 1CZPA 1QOFA 2N7JA 4M0WA 5BYSA 3BVGA 4OZCA 3ZJTA 2WXKA 1EU3A 1FNUA 2BW2A 3BVZA 1AWDA 2J42A 2PMVA 1IBXB 2KN4A 1KRHA 1L6VA 2WXNA 1XCQL 5MPOA 2W3SA 4JX1C 1GAQB 1KF6B 1ZDVA 4DQOC 4XDCA 2E3TA 4TMAB 3AE1B 2X38A 4JE3B 2G1EA 2CJNA 3R2IA 4YSZB 3E56A 1WWTA 1YQ3B 4LLGM 2RDGA 2DWQA 3EA6A 1SB3C 1I4QA 1WXQA 1V97A 2IPKD 4C7ZA 1ENFA 3FAHA 1FIQA 2L1AA 1FD6A 1UWMA 2TSSA 1FNWA 1D5MC 3O13A 2K0PA 3SEBA 4UDUC 2WXJA 4YSYB 1P7EA 3V3XA 3NUHB 3IAM1 1YN3A 1D6EC 1XLNA 1FCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQR A;  3CWI A;  2W3R A;  4ZOH C;  1H7W A;  1ROE A;  4A9A A;  1QLB B;  3ABV B;  4YTN B;  2MJ3 A;  2PVG C;  1B9R A;  2WQY B;  1E6E B;  5EE3 A;  2W54 A;  1ZP0 B;  2B76 B;  4N6E B;  1PFD A;  1XLO A;  2BT6 A;  3B2G A;  1E0Z A;  3AE3 B;  1SIJ A;  1VDV A;  2WDQ B;  1NYQ A;  1E7P B;  1ZOY B;  3AB5 A;  4YXD B;  1GTE A;  1R7S A;  2H88 B;  1WGK A;  2WLB A;  5G5G A;  4ZHO A;  1NVI D;  1TYG B;  4ZHP A;  3P1M A;  1H7X A;  1EWY C;  2ACZ B;  3P4S B;  1FXA A;  5EE0 A;  3ETR A;  4YT0 B;  3HVZ A;  3AE8 B;  1T3Q A;  3P63 A;  4JWU C;  2PKO A;  2LEK A;  1IUE A;  1J7A A;  2WDV B;  2K5P A;  3B2F A;  3FC4 A;  1KFY B;  1L0V B;  3P4Q B;  1WYG A;  1QOA A;  2WS3 B;  3AED B;  1I7H A;  4ITK A;  3AM9 A;  5EE1 A;  2L52 A;  3AE9 B;  3NS1 A;  5EE9 A;  1VJK A;  3SR6 A;  1XLP A;  1V8C A;  1N63 A;  2DBY A;  1PUT A;  1JWA D;  2QIE B;  3SFE B;  1FMA D;  2BS4 B;  3CF4 A;  3AEE B;  3VR8 B;  2QJL A;  3AEA B;  1DOY A;  1L6U A;  2Y5C A;  1OQQ A;  1L5P A;  5C2T B;  3KWL A;  3NVZ A;  1GTH A;  1J7C A;  1GT8 A;  1N61 A;  3AE6 B;  3AE7 B;  3RPF C;  1DGJ A;  2CU3 A;  3LB8 C;  1NEK B;  1A70 A;  1WRI A;  1N5W A;  3P4R B;  5AUK A;  4C80 A;  5H8Y E;  1TKE A;  2MH7 A;  2W55 A;  5AUI A;  1QF6 A;  1QT9 A;  2AX5 A;  2Q5W D;  4YTM B;  3NVY A;  1OFF A;  1TKY A;  3DWG C;  2H89 B;  4USA A;  3AN1 A;  1RYJ A;  3NVV A;  1QOB A;  1QOG A;  2OHF A;  1J7B A;  3SFD B;  4C7Y A;  2FBW B;  4YSX B;  1FFV A;  4N58 A;  1CJE A;  2BS3 B;  1CZP A;  1FRR A;  1QOF A;  2MJE A;  3NRZ A;  4KX6 B;  1E9M A;  4US8 A;  3AE5 B;  3EUB 2;  1N60 A;  3AEB B;  3NVW A;  2N0S B;  3BII D;  3W5V B;  1DOX A;  1F0Z A;  3VR9 B;  1DOI A;  2PIA A;  3AV8 A;  2HTM E;  3B9J A;  3L4P A;  1NI3 A;  1AWD A;  1AYF A;  1ZXI A;  2MJD A;  3AMZ A;  1KRH A;  1JRO A;  1L6V A;  4IDI A;  1VLB A;  2BS2 B;  5MPO A;  2W3S A;  3AEC B;  5H92 C;  1YJJ A;  2KMM A;  2JQR B;  2WU2 B;  4JX1 C;  3AEF B;  1GAQ B;  4N59 A;  3WCQ A;  1KF6 B;  2E3T A;  3AH7 A;  3HUI A;  3AE1 B;  1FRD A;  1RM6 C;  2EKI A;  1JWB D;  1TKG A;  4LTU A;  2K9X A;  2L83 A;  2G1E A;  1N5X A;  2CJN A;  2WU5 B;  1YJI A;  2CJO A;  3LXF A;  1PDX A;  2PVO D;  1N62 A;  5G5H A;  3ZYY X;  4YSZ B;  2WP9 B;  1YQ4 B;  1NYR A;  3PO0 A;  3CIR B;  1WWT A;  1YQ3 B;  1JRP A;  3AE4 B;  1FM0 D;  2M19 A;  4US9 A;  3W9C B;  1E10 A;  2DWQ A;  1SB3 C;  1RFK A;  3DWM A;  1WXQ A;  4HRS A;  2WDR B;  1V97 A;  4C7Z A;  3FAH A;  1FIQ A;  2K22 A;  1GPX A;  1UWM A;  1XO3 A;  1NEN B;  4P6V F;  1JW9 D;  1JAL A;  4JWS C;  1FXI A;  1RWS A;  1XLQ A;  5GXG B;  1FO4 A;  3P4P B;  3HRD D;  5C3J B;  2KAJ A;  1FFU A;  1SF0 A;  4WWM A;  3W5U B;  4FXC A;  4YSY B;  3AE2 B;  1ZUD 2;  2JX5 A;  4HRO A;  4YTP B;  3VRA B;  2M56 B;  3AEG B;  1XLN A;  1JQ4 A;  4WQM A;  3VRB B;  1TJE A; 
#chains in the Genus database with same CATH topology
 5HI1 A;  2W3R A;  3DVG Y;  2KWD A;  2KYW A;  5BYQ A;  1NI2 A;  3V61 A;  4GMV A;  5CHW A;  2IND C;  2K8C A;  4KKI A;  1H7X A;  1TS3 A;  3DHG C;  2PKO A;  3AXC A;  1H8C A;  1KFY B;  2DYM A;  3OJ4 B;  1PGX A;  1R4N B;  3NS1 A;  1CMX B;  4JL9 A;  1AN8 A;  1FMA D;  2KVR A;  1I4H A;  2XNA C;  5C2T B;  1GT8 A;  1IBX A;  3ZJU A;  2LHD A;  1SEB D;  2FIF A;  4DDG D;  1P9D U;  3NVV A;  3ZNH B;  3QJZ A;  2KC1 A;  4OW0 A;  2V4I B;  2G45 B;  2NTS A;  4ANW A;  3NRZ A;  4NJC A;  1E9M A;  1WJN A;  1IGD A;  3I3T B;  5CX3 A;  4BBN F;  2Z59 B;  3VR9 B;  2HTM E;  4GB9 A;  1SBB B;  2KFK A;  5CHF A;  1JRO A;  1WGH A;  1D4B A;  4L1B A;  1YMH E;  4JPS A;  4MH0 E;  4EEW A;  3QWZ B;  3RMK C;  1JRU A;  3NS8 A;  1TKG A;  1Z2M A;  4LTU A;  5DCN A;  2Y5P A;  4BKT A;  1GG3 A;  2JPH A;  4FUL A;  4TSS A;  3DBL B;  4I6L B;  1I4P A;  3IXS A;  1XO3 A;  4RGT A;  3EC8 A;  4RM8 A;  4BAX A;  1C76 A;  2AQ2 B;  3GZN B;  3HRD D;  4ZRI A;  1UWX A;  1C9F A;  1MI0 A;  4FXC A;  4W9J A;  3AE2 B;  3VQI A;  1ZUD 2;  4TUU A;  3OLM D;  5IP4 D;  4OZB A;  1NBF C;  2PVG C;  3C8Y A;  2KQS A;  3A9K B;  5EE3 A;  3B2G A;  1WX9 A;  4HJG E;  1GTE A;  3PS6 A;  4IM2 A;  1WGK A;  4ICV A;  3ETR A;  3VXW A;  4X57 B;  2E6X A;  2MHJ A;  3ZVV A;  2DAF A;  2KDB A;  2L52 A;  2IZV B;  2NS5 A;  4G50 A;  1PGA A;  2IO2 B;  3SFE B;  4HXD A;  2LJI A;  3CF6 E;  3LDZ E;  5AZH A;  2KX3 A;  1OQQ A;  1WSP A;  3Q3J A;  1OEY A;  4GLS C;  1WGY A;  2RMM A;  1VZ6 A;  1FCL A;  3IT4 B;  3KW5 B;  1VZ7 A;  5CTR C;  1MHH E;  4OHJ A;  2LUE A;  3QCA A;  2K6Q A;  3JVZ X;  3DVG X;  4EE2 A;  3A9J B;  1ZKH A;  1K8R B;  3T8M A;  5FR6 A;  1WM2 A;  4HWI B;  4MGK E;  2AQ1 B;  2LVP A;  2MX2 A;  5E6P A;  4PS8 A;  3ZTD A;  1V5O A;  2K3U A;  4RGN A;  1NI3 A;  3ML9 A;  4IDI A;  4ZYS A;  3Q14 C;  4FAD A;  4CHK A;  1QIL A;  2QCZ A;  1P98 A;  2IGH A;  3Q3N C;  3HUI A;  2O6V D;  1V81 A;  2WXF A;  1SJH D;  4A55 A;  1R4M I;  2JY6 A;  4M02 A;  4ASW C;  2WXP A;  3N20 C;  4BKG A;  2K6D B;  4IOI E;  1Q5W B;  4MT5 A;  2GBN A;  3RD2 A;  4GOC A;  2J7Q B;  4L23 A;  2WXL A;  3T3N A;  2C7M B;  3GB1 A;  4HRO A;  1EUV B;  1TS4 A;  1STE A;  2LGX A;  3R8B A;  1UEL A;  2SAK A;  4PK1 A;  1E6E B;  3TUO A;  1HZ5 A;  1F9J A;  2RDB C;  2KC2 A;  2J0J A;  3EFC A;  2H88 B;  1K51 A;  3M3J A;  1CQV A;  3S2A A;  2ON8 A;  1T3Q A;  2MRP A;  1J7A A;  3DBR B;  5GMV A;  2IO0 B;  2C7H A;  3SD5 A;  3ZDT A;  3FC4 A;  2D11 A;  1QOA A;  2WS3 B;  2JVC A;  2A4Z A;  2MCN B;  3MJW A;  3A4R A;  4LNO A;  3P2B A;  1M4V A;  1GOZ A;  2KLC A;  3NY5 A;  3PRZ A;  1KTK A;  2XN9 C;  1VCB A;  2GOW A;  3LB8 C;  1N5W A;  3MJ5 A;  5IO9 A;  2FCS A;  2WGS A;  3C0R B;  3VTW A;  3ZRC A;  2H89 B;  1M94 A;  2ZCB A;  4K3B A;  4USA A;  2OHF A;  5E6N A;  3FIL B;  4YSX B;  3NHE B;  3ZO5 B;  2PTL A;  4IM3 A;  3W5V B;  3PLU A;  1AYF A;  2OJW A;  1E90 A;  3HM3 A;  3TEY A;  3MC8 A;  1L4D B;  1YN5 A;  4TKN A;  3RNB C;  2ZPN A;  1V86 A;  3ZXR A;  3AEF B;  1WMH B;  2LXA A;  2CS4 A;  3AH7 A;  2JF5 A;  3UQB A;  2IGG A;  4NJ6 A;  2BTE A;  2HDE A;  2WU5 B;  1YJI A;  2L0F A;  1PDX A;  2NTT A;  4KIK A;  4MM3 B;  1LFD A;  1JRP A;  3AE4 B;  2KAC A;  3VAW A;  4DHZ E;  2MLB A;  3OG5 A;  4HCN B;  3R7Q A;  2KJR A;  4JWS C;  2C9W B;  5D7G A;  4CO7 A;  4RF1 A;  2M0X A;  4BKS D;  2BWE S;  2J52 A;  3RFZ B;  2QMT A;  3V62 A;  4XWW A;  5I4D A;  4RF0 A;  1K52 A;  2LMC A;  3JSV A;  1ZGU B;  1XLO A;  1ESF A;  2N9P C;  1C77 A;  3TSS A;  2WXH A;  4GIV A;  1U4A A;  4KDL B;  5G5G A;  3TJP A;  3GOE A;  3U7Z A;  1TS5 A;  2CU1 A;  4DXG A;  4WH4 A;  4RM9 A;  3BYY B;  3N3K B;  3DQV A;  1V6E A;  4KDI C;  1T5X D;  4W9G A;  1E7V A;  2JRH A;  4HVB A;  2MBQ A;  3HK0 A;  2BKF A;  1HXY D;  4M8M A;  4MDK E;  3B1L X;  4EZK A;  2AX5 A;  1F1H A;  1UF0 A;  1RYJ A;  5HG2 A;  1QOG A;  1TY0 A;  1LXD A;  3VHT C;  1UBQ A;  1QOF A;  2LGS A;  4LNK A;  1EU3 A;  1FNU A;  2BW2 A;  3BVZ A;  4FBJ B;  4B6W A;  3TBL D;  1IBX B;  1L6V A;  2KT7 A;  1T0Q C;  5C23 A;  1XD3 B;  4JX1 C;  2DEN B;  3DVN U;  5D2M B;  3DOW A;  4URK A;  2G1E A;  4E71 A;  4PS7 A;  3R2I A;  1WWT A;  2RDG A;  1SB3 C;  4C7Z A;  1E8Z A;  1FD6 A;  1FNW A;  1V9J A;  3HIZ A;  3O13 A;  2CKH B;  2I1J A;  2CHZ A;  3SEB A;  3WA0 A;  2Z0E B;  2M4N A;  2WXJ A;  4KV2 A;  2AYO B;  4YSY B;  1P7E A;  3V3X A;  3IAM 1;  2RD0 A;  1WF9 A;  3I5J C;  2JXT A;  4E3C A;  1XXG A;  1TZO A;  3ZGZ A;  3DBS A;  2DZI A;  2KZR A;  4W9F A;  1N6Z A;  5J2R A;  2CHW A;  2SEB D;  1IGC A;  1VRA B;  2R2O A;  4YWG G;  1WH3 A;  2LGI A;  2RPQ A;  4XGA B;  4ITK A;  2VZK B;  3DBH I;  1MHX A;  3AE9 B;  5EE9 A;  4LNN A;  2L32 A;  1OGW A;  1OTR B;  3V05 A;  3AEA B;  4MGY E;  1LO5 D;  3NVZ A;  2V0G A;  1WI0 A;  4W9K A;  5H8Y E;  5AUI A;  2KTF A;  4IKG A;  2G9H D;  2ZW1 A;  3HHM A;  1MG8 A;  5BYR A;  3AN1 A;  4FA6 A;  2PJH A;  2LWP A;  3PRE A;  2PE6 B;  4FJY A;  3FIL A;  3AE5 B;  5E6O A;  3RUL A;  1WX7 A;  2DYO A;  2JWZ A;  4WAA A;  2HJ1 A;  2D07 B;  2OOB B;  1OEY J;  5G55 A;  2NMQ A;  2LAS A;  2BYE A;  4KSK C;  1WMH A;  3L08 A;  3Q3O C;  1JWB D;  1PYW D;  3IVF A;  2N7D A;  2ZPY A;  3ZRF A;  3H9D A;  2FCQ A;  1NYR A;  3Q8B A;  4MM3 A;  1FM0 D;  2JWU A;  1L0Y B;  4II3 B;  2LVQ A;  2K22 A;  4F8C B;  4G11 A;  5GXG B;  2LZ6 A;  3ZNG C;  4WUR A;  3GE8 C;  3ZQ4 A;  5LXH A;  4ICU A;  1H7W A;  4A9A A;  4JIO U;  4P1C C;  1WGD A;  3ZJV A;  2KX0 A;  2O2V A;  5D6J B;  5BMI A;  2D3A A;  1SIJ A;  3KUZ A;  2XK5 B;  1WM3 A;  1SE4 A;  4ZRJ A;  1AAR A;  4F1S A;  3PRP B;  4YT0 B;  3HVZ A;  2KK8 A;  1PGB A;  2PEA A;  3KH0 A;  3X23 A;  1WRD B;  1HEZ E;  3AED B;  3ZUN A;  3AM9 A;  1FPY A;  4AJW A;  1XLP A;  1V8C A;  2G3Q B;  2L7R A;  2I38 A;  4NZL B;  2QIE B;  3BK1 A;  2JYT A;  3O65 B;  2L05 A;  2MA9 B;  5CHV C;  4LDT D;  3AE6 B;  2DZM A;  3A1Q A;  4XZ4 A;  2UU7 A;  2BF8 B;  2WXO A;  5D3I B;  3IAS 1;  1F2R I;  2KFJ A;  2PE9 A;  1TS2 A;  1WGG A;  2NBU A;  2NPT B;  3E9S A;  4IUM B;  2LUM A;  1FFV A;  3PVL A;  2BS3 B;  2IGD A;  2V3P A;  4KX6 B;  3NVW A;  2ZJD A;  3ONS A;  3N1Z C;  3Q8F A;  1DOX A;  3EGR A;  4HLE A;  3PHW B;  2KMC A;  3H8H A;  1HTQ A;  1P7F A;  3H7S A;  3UQA A;  2BS2 B;  4FLH A;  3RNC C;  4DWF A;  2KQ4 X;  3Q6B A;  3HM6 X;  2ASQ A;  2C7N B;  4IW0 A;  2CR5 A;  1UZX B;  2AQ3 B;  2JSV X;  2CJO A;  2D10 A;  4FJV B;  1C4C A;  4K3C A;  2EMS A;  3RNA C;  4M00 A;  1WE7 A;  1KLU D;  2N9L A;  1NEN B;  1R4N I;  4MSQ B;  1KH0 A;  5IA7 A;  2IYD B;  2V3N A;  4YTP B;  1UD7 A;  4HPP A;  4IM0 A;  4WQM A;  4AQ7 A;  2LRW A;  2WNM A;  1UUP A;  2ZVO A;  2IY0 B;  4RCO A;  5FK9 C;  2PLP A;  2KLG A;  4KIK B;  2W54 A;  3L16 A;  1ZP0 B;  4BFR A;  2KDF B;  3AU5 A;  1P1A A;  1XCT L;  3QK0 A;  1V1P A;  3P1M A;  1S1Q B;  2RPV A;  4KVG B;  1WYG A;  3K9P B;  3CMM B;  4A3P A;  5JXV A;  2NVU I;  4MSM B;  3QIJ A;  1JWA D;  3TEZ A;  1C4A A;  2QJL A;  3JSV B;  5D3D A;  3U8Z A;  1WFY A;  1UBI A;  3I9V 1;  1BUI C;  4WJP A;  3L13 A;  2KOX A;  2LGD A;  4ACF A;  4XE0 A;  1F77 A;  4W9E A;  3AUL A;  3V60 A;  2JU6 X;  3RZW C;  4US8 A;  3AEB B;  2W82 A;  3BII D;  1F0Z A;  3AU4 A;  4P7I A;  2MJD A;  1L0X B;  4KZC A;  4NAM A;  5JH5 C;  1WR6 E;  1YJ1 A;  1EO6 A;  4G3X B;  3NJT A;  4K7W A;  1N5X A;  4MH8 A;  4DHJ D;  4CYE A;  2WP9 B;  2JZP A;  2IY1 B;  2WDR B;  1WGR A;  1R4M B;  1RWS A;  3QHT A;  1FO4 A;  3W1S C;  5C3J B;  1ET9 A;  1KM7 A;  2ONQ A;  4HCP B;  3KWV A;  1OQR A;  4M01 A;  4HPL B;  2JUO A;  2KN5 A;  3OJ3 A;  4REZ A;  4P1B C;  4N6E B;  2XK5 A;  3V6C B;  2Y3A A;  3AB5 A;  3RUI B;  1TY2 A;  1TIF A;  1FEH A;  4PYZ A;  1EWY C;  2L00 B;  3NOB A;  1EWC A;  3VUX A;  1Q10 A;  2WDV B;  2KHW B;  3VVW B;  1L0V B;  1TTN A;  2AL6 A;  1I7H A;  1Q0W B;  1D5Z C;  4Q2J A;  1GJZ A;  3BY4 B;  2IJ0 A;  2LVO A;  4WJN A;  4FHJ A;  3R2T A;  3Q3F A;  4KGT A;  2N1V A;  1KOT A;  3H6N A;  3VTV A;  1S3S G;  1TT5 B;  3RN9 C;  4C00 A;  4DK5 A;  3DHI C;  2C5L C;  3PZD A;  2I2Y A;  1B1Z A;  3NVY A;  1OFF A;  3DHH C;  1QQR A;  1EF5 A;  2NPT A;  2OJR A;  4WQO B;  5BYS A;  3ZJT A;  3QA8 A;  3SU8 X;  1AWD A;  2J42 A;  4KSL C;  2PMV A;  1KJT A;  1E8X A;  3WAN A;  4AOF A;  5MPO A;  2BPS A;  1ZDV A;  2KDE B;  2ZNV C;  3AE1 B;  2AEH A;  2X38 A;  2YLM A;  4DDI D;  1XQQ A;  1RLF A;  4YSZ B;  1C1Y B;  1YQ3 B;  1VD2 A;  2DHZ A;  4ZYN A;  1WXQ A;  1V97 A;  2FNJ B;  2N9E B;  1D5M C;  2WWZ A;  4YL8 A;  4PS3 A;  4UDU C;  3X0W A;  2KJ6 A;  2K8B A;  4FHK A;  1J8C A;  1D6E C;  4FN2 A;  1P3Q U;  1YD8 U;  4NPN A;  1GB4 A;  2M1M A;  2MJ3 A;  2HD5 B;  1C78 A;  1E0Z A;  3AE3 B;  4R3D A;  4A8X C;  4LK0 M;  1K50 A;  1NVI D;  3BZD B;  1TYG B;  1V2Y A;  1BT0 A;  2INP E;  1SGH A;  1JCK B;  3W2D A;  3RNG C;  4GGQ A;  1WZ0 A;  3R7R A;  3UI3 A;  2O2V B;  5DPW A;  2QEJ C;  1E7U A;  3U52 E;  4ANX A;  1WY8 A;  2D3G A;  3H7P A;  1QF6 A;  5JHB A;  1LM8 B;  4ARI A;  3TCA A;  5JZE B;  1RFA A;  3SFD B;  1EU4 A;  2K1F A;  1V1O A;  2NR2 A;  1J19 A;  1HTO A;  4RFB A;  1GC6 A;  3U7D A;  3AV8 A;  2N7E A;  2KDI A;  4HPM B;  2WXG A;  3A1Q B;  2JXX A;  2K8H A;  3IBE A;  1QKZ A;  2GBR A;  3J9C A;  3AEC B;  2JQR B;  3U2S C;  3NZU A;  3P42 A;  3TL5 A;  5C1Z A;  3PT2 B;  3TEW A;  3Q8C A;  2WXQ A;  2PVO D;  1ACC A;  3BK2 A;  4J6I A;  1WXV A;  5J17 A;  3KVF B;  3K9O B;  1YOV B;  4RH6 A;  4KGS A;  3RZF A;  4HK2 A;  4EUT A;  4P16 A;  5BMH A;  1ZXH A;  2D3B A;  2O6V B;  3VRA B;  1JWM D;  3CWI A;  3OWE B;  4O1N A;  4XWT A;  1Z5S B;  1QLB B;  4YTN B;  3RNE C;  4IWP A;  3Q69 A;  3HVD A;  3EEC A;  3WAM A;  2WDQ B;  3WAO A;  3N30 A;  2AWT A;  1YQB A;  2BB6 A;  1FXA A;  1UGM A;  5EDS A;  4F7Z A;  1IUE A;  4TV3 A;  1BML C;  1VJK A;  2DBY A;  1Q1O A;  4NQL B;  2MEK A;  2BWF A;  2Y5C A;  5E6J A;  2ZNV B;  4AWJ A;  3P4R B;  3APF A;  2HE7 A;  1V1P B;  2W55 A;  1QT9 A;  2KJH B;  2N1W A;  1D3Z A;  1FXT B;  2J4X A;  4MJS A;  1FRR A;  2MJE A;  5IKC M;  3IG3 A;  5IAA C;  3AI5 A;  5FKA C;  5IN7 A;  2JRI B;  3GP7 A;  2G4D B;  4C4V A;  5H92 C;  2WU2 B;  3WCQ A;  1PQS A;  2Z8L A;  2REX A;  1FNV A;  2K9X A;  3KQ4 A;  2QIL A;  3CIR B;  3KLS X;  4W9D A;  2M19 A;  1IYF A;  2WHI A;  1RFK A;  4DXF A;  1MG4 A;  3RCZ A;  1RAX A;  3ZTC A;  1GPX A;  4HKQ A;  3Q2A C;  3P4P B;  3T9L A;  4WWM A;  3PRM B;  4HEA 1;  1UH6 A;  4I6P A;  3WIM A;  3VH3 B;  5FR3 A;  3MP9 A;  3VRB B;  2JZ3 B;  5JHA A;  2R2Q A;  1JML A;  4G0N B;  1C79 A;  4AJY B;  3JW0 X;  4BZA A;  2WQY B;  1ZE3 D;  3A33 B;  2MWS B;  2XEW A;  2BT6 A;  4GDL B;  4II2 B;  3C19 A;  1WJ6 A;  1E7P B;  2KXJ A;  1ZOY B;  4ZHO A;  1I4R A;  4NQK E;  2FUG 1;  2LD9 A;  4L2Y A;  4GXB A;  1KLV A;  5LNK 1;  2NBV B;  4BOZ B;  1SE3 A;  1IPG A;  3B2F A;  1CK1 A;  5AZF A;  1E8W A;  3WAP A;  2NCN A;  3Q8A A;  2Y5B B;  1PUT A;  2ZCC A;  3ZXV A;  2HJ8 A;  3AEE B;  4DXA B;  1T0S C;  1Y8R C;  1L5P A;  4WAF A;  2N9K A;  1DGJ A;  1A70 A;  5HHD G;  1F52 A;  4NAW B;  3N9Y C;  2KTR B;  1J7B A;  4WJQ A;  4ZRQ A;  3H1U A;  2DLB A;  1MVK A;  4B0M A;  3W1S A;  1DOI A;  2KQ7 A;  2FAZ A;  2PIA A;  1K53 A;  4S17 A;  2K39 A;  2OED A;  3NZS A;  2PPH A;  3KYC D;  4WWN A;  1VLB A;  2M0A A;  3URY A;  2DZK A;  3N1X C;  2D5G A;  1GB1 A;  3R3M A;  1V5T A;  4FJZ A;  3CST A;  1FRD A;  3DCG A;  2W9N A;  4HJK A;  4A20 A;  1C3T A;  2L83 A;  3Q3M C;  1SIF A;  3LXF A;  5DPS A;  3KUD B;  3PO0 A;  4IWQ A;  2MBE A;  3ZLZ A;  4CQN A;  1E10 A;  3PZ8 A;  3DWM A;  2ZW0 A;  1JW9 D;  3UIP B;  2O6V A;  3UIO B;  2BYV E;  2M56 B;  1ZDX A;  4MEM A;  2QDF A;  2GBM A;  2N9X A;  1I4X A;  3ALB A;  2N4F A;  4KZ0 A;  1B9R A;  3NZ3 A;  2B76 B;  1WXM A;  1PFD A;  2FID A;  4TQ0 A;  5T8I A;  3PSE B;  4LNI A;  3EFU A;  2WLB A;  2MBB B;  2YEP F;  1TZ1 A;  5DPR A;  1L7Y A;  5EE0 A;  3WAL A;  4EZJ A;  2C60 A;  3VDZ A;  4AS1 A;  3IHP C;  2K5P A;  5J18 A;  5EE1 A;  4RMA A;  4JLC A;  1YNT E;  3U4E G;  2BS4 B;  3VR8 B;  1GTH A;  2KMA A;  2LGY A;  3I57 A;  2CU3 A;  2M8S A;  5TSS A;  2PW9 A;  4TQ1 A;  2LFI A;  3ZW3 A;  1YX6 B;  4KKJ A;  5KHO A;  3FKY A;  2YVC A;  2FBW B;  1V80 A;  2I1K A;  1J0G A;  2MP2 B;  1CZP A;  1P0R A;  2N7J A;  1TBE A;  3L0W B;  2EKE C;  4M0W A;  4ZRK A;  3BVG A;  3N32 A;  2QHO A;  1WXS A;  2UWQ A;  2KN4 A;  1KRH A;  3PHX B;  5LXI B;  4W9H A;  4MGI E;  3ENE A;  4EZL A;  3H7P B;  3M63 B;  2HTH A;  2GBK A;  3DPD A;  4DQO C;  4ANV A;  4XDC A;  2E3T A;  2M17 A;  3DBL I;  4B95 A;  4JE3 B;  2CJN A;  3GZN I;  3E56 A;  4LLG M;  2DWQ A;  3EA6 A;  2V4L A;  4AUQ C;  3QX1 A;  4BBN C;  4DBG A;  1ENF A;  3FAH A;  2L1A A;  3CSF A;  4OVU A;  1UWM A;  2RSU A;  4XX5 A;  3BIN A;  2NBW B;  4NY0 A;  2B3A A;  1YN3 A;  2KVZ A;  1I35 A;  2J0K A;  2GB1 A;  5LLI A;  4ZOH C;  2INC C;  1QZE A;  1MPE A;  3ZDM C;  2L3Z A;  1YX5 B;  1VDV A;  3MC9 A;  4GDL A;  1NYQ A;  2VH2 A;  2WXR A;  4BKS A;  1Y56 A;  2QSD A;  1ZW7 A;  3L10 B;  4S0R A;  4GDK B;  3PGE A;  1SSN A;  3W1Y A;  1I42 A;  1WX8 A;  1UNS A;  2VRR B;  3CF4 A;  2MBO A;  4C80 A;  3B0A A;  2IO1 B;  2BYF A;  4NAW A;  2GMI C;  3MC0 B;  2MSE D;  3ZNI D;  1JWU D;  1SJE D;  1XEE A;  1QOB A;  4NJ7 A;  2KTR A;  4XC2 A;  5TR5 A;  4C7Y A;  3M62 B;  2GI9 A;  2J0M A;  4K7U A;  4KGR A;  3OAW A;  4AP4 C;  3BWU D;  4C56 C;  1N60 A;  2KWC A;  2GBJ A;  2FCM A;  3L17 A;  4EFO A;  4LDT B;  1GNU A;  1ZXI A;  2JT4 B;  4JGH B;  3SHQ A;  4M8N A;  2KMM A;  4MJS B;  2BYT A;  4IWO A;  1VZ8 A;  2IBI B;  1N62 A;  1H4R A;  2K25 A;  4IG7 B;  3QAQ A;  1LGR A;  2DNF A;  4US9 A;  4ARC A;  3VH4 B;  3ZKJ C;  2INN E;  4W9L A;  3R66 C;  1D5X C;  1JWS D;  4P6V F;  3GS2 A;  1G6J A;  2FCN A;  2WX0 A;  3VUW A;  2WXM A;  2V9H A;  4C4V B;  2ICI A;  1SF0 A;  2UYZ B;  4HKZ E;  2JX5 A;  1E5W A;  1WYW B;  3AEG B;  1JQ4 A;  2LRU A;  3LJ3 A;  1ROE A;  2RDH A;  2VZK D;  2KO3 A;  3SDL C;  3APD A;  3RYT A;  2MQJ A;  1YIW A;  4OVV A;  3DBR I;  1A5R A;  5AZG A;  1VR9 A;  4K7S A;  3P4S B;  3KUC B;  3P63 A;  4PT5 A;  2R61 A;  4A6Q A;  2V1Y A;  2KAN A;  3PTF C;  2VH1 A;  3RNF C;  4RNA A;  1L6U A;  4JQW C;  2A5U A;  2V3S A;  3QAR A;  1T6B X;  1YN4 A;  3GE3 C;  2YEP B;  1NEK B;  1GC7 A;  1TKE A;  1SE9 A;  1WXA A;  1TKY A;  2CHX A;  2BBC A;  1DYQ A;  2X8X X;  4XDD A;  4WWP A;  1XT9 B;  5HKH A;  1RRB A;  4N58 A;  2MP2 A;  4LCD E;  3D32 A;  3B08 A;  1BXT A;  1MJD A;  2BGF A;  5AEK B;  4LJO B;  5L83 A;  2RGF A;  3B9J A;  1WE6 A;  1MFW A;  1YJJ A;  2D3C A;  4N59 A;  4I6N B;  1EF1 A;  2AL3 A;  4MGZ E;  2XBB C;  1SE2 A;  1RM6 C;  1V49 A;  4NNJ B;  2KNB A;  4OZA A;  3ZYY X;  5G5H A;  3BYT B;  3A9K A;  3MFG A;  3LYY A;  3W9C B;  4A90 A;  1ISN A;  4LJP B;  4J3O D;  2MW5 A;  3TEX A;  4WIP A;  2MBH A;  3PPA A;  2BQQ A;  1FXI A;  1XLQ A;  4GN1 A;  4GU2 A;  4B0E A;  1SXT A;  2KAJ A;  1FFU A;  4RGM A;  2WDT B;  1TJE A;  4H2A A;  1T0R C;  4DHJ B;  1EM7 A;  3MTN B;  4XYC A;  3M95 A;  2WX1 A;  3JYU A;  1HA5 A;  3PZ7 A;  1ET6 A;  2ZZP B;  3RT3 B;  2LI5 A;  4OVZ A;  1L4Z B;  4YXD B;  1R7S A;  4K81 A;  5BO4 B;  4ZHP A;  1F2R C;  5IOI A;  1HQR D;  2ACZ B;  3AE8 B;  5L95 C;  2LEK A;  3A9J A;  1L2N A;  3MHS D;  4GDK A;  2JZZ A;  1GUA B;  4D2K A;  2LHE A;  3N1Y C;  3SR6 A;  1N63 A;  1WJ4 A;  3DDC B;  2KWV B;  3KWL A;  1J7C A;  1TGZ B;  2G4S A;  1WRI A;  4RGO S;  5HFY A;  2FE8 A;  1XF5 L;  2Q5W D;  4YTM B;  2DYB A;  3DWG C;  1C4P A;  2L8J A;  4W9I A;  4MEL A;  1AW7 A;  1KLG D;  2WYQ A;  1NDD A;  3Q8E A;  3EUB 2;  2DAJ A;  2JYE A;  2N0S B;  1OQY A;  3VFK A;  1UGJ A;  3I63 C;  3L4P A;  4WWO A;  3U30 A;  1I4G A;  2KFK B;  3AMZ A;  1T0Y A;  3DBH B;  3BVM A;  4IC7 B;  3IT6 B;  3VTU A;  3PV1 A;  2KKC A;  4DHZ B;  2EKI A;  1WJU A;  2L76 A;  4MAC A;  3QQ8 B;  2IO3 B;  2BB5 A;  1YQ4 B;  4M0W B;  2WXI A;  4HRS A;  3NG0 A;  1JAL A;  3QC8 B;  5DPT A;  1WZ3 A;  1WR1 A;  2KDM A;  3W5U B;  4ANU A;  4A3O A;  5BMG A;  3RPF C;  5AUK A;  2KD0 A;  3ECI A;  4LNF A;  4ZRP A;  2ZVN A;  3ZIM A;  2LJ5 A;  3ABV B;  3TIX A;  3VUY A;  1E8Y A;  3V6E B;  4W9C A;  3EHV A;  3DVN V;  5D94 A;  2EEL A;  2LXC A;  4BOS C;  4JWU C;  2ZEQ A;  3UGB B;  3PLV A;  3P4Q B;  3L54 A;  3T3O A;  3A4S C;  2IDY A;  4N9F 4;  1DOY A;  2DZJ A;  1ZPS A;  2J53 A;  1N61 A;  3KYD D;  3AE7 B;  3APC A;  4HDQ A;  5G2N A;  2QC8 A;  2MH7 A;  1HZ6 A;  3MHZ A;  4EKU A;  4B9K A;  1CJE A;  2FUH B;  3UF8 A;  3ZNZ B;  2L0T A;  1HE8 A;  2EMT A;  4BVU C;  4OZC A;  2BKR B;  2DX5 B;  2WXK A;  4PYU A;  2BVC A;  4K1R B;  2Z0D B;  4GSW A;  2WXN A;  1XCQ L;  2W3S A;  4ZDV A;  1LQB A;  4E74 A;  1GAQ B;  4QAY A;  1KF6 B;  4TMA B;  2KWU B;  3ML8 A;  4HDO A;  2RR9 A;  4EOY A;  5KHQ A;  2GLS A;  1I4Q A;  2IPK D;  1FIQ A;  3UIN B;  2TSS A;  3IFW B;  4WJO A;  1X1M A;  3TMP B;  2K0P A;  1IP9 A;  3RI7 C;  2D2Q A;  1WIA A;  3NUH B;  1XLN A;  2GRI A;  1FCC C; 
#chains in the Genus database with same CATH homology
 2GB1 A;  5HI1 A;  2W3R A;  4ZOH C;  1GB4 A;  2JXT A;  2MJ3 A;  1XXG A;  2KWD A;  1TZO A;  3ZGZ A;  1MPE A;  5BYQ A;  1C78 A;  1E0Z A;  3AE3 B;  1VDV A;  4R3D A;  1NYQ A;  2WXR A;  4A8X C;  4LK0 M;  1Y56 A;  4KKI A;  1K50 A;  1NVI D;  2QSD A;  2SEB D;  1TYG B;  3BZD B;  1H7X A;  1VRA B;  1IGC A;  4YWG G;  1TS3 A;  2INP E;  2LGI A;  2PKO A;  1JCK B;  4GDK B;  3W2D A;  1KFY B;  2DYM A;  2VZK B;  4ITK A;  1SSN A;  1MHX A;  1PGX A;  3AE9 B;  3NS1 A;  5EE9 A;  1UNS A;  2L32 A;  1AN8 A;  1FMA D;  3UI3 A;  3CF4 A;  3V05 A;  3AEA B;  1LO5 D;  1I4H A;  2QEJ C;  2XNA C;  5C2T B;  3U52 E;  3NVZ A;  1GT8 A;  1IBX A;  2V0G A;  4C80 A;  3ZJU A;  2LHD A;  1SEB D;  5H8Y E;  5AUI A;  1QF6 A;  4IKG A;  2G9H D;  3MC0 B;  2ZW1 A;  4ARI A;  5BYR A;  1JWU D;  1SJE D;  1XEE A;  1QOB A;  3AN1 A;  3NVV A;  4OW0 A;  3SFD B;  1EU4 A;  4C7Y A;  2GI9 A;  4KGR A;  1V1O A;  2V4I B;  3FIL A;  3BWU D;  2NTS A;  3NRZ A;  4NJC A;  1E9M A;  4C56 C;  3AE5 B;  1IGD A;  1N60 A;  4RFB A;  3VR9 B;  2DYO A;  3AV8 A;  2HTM E;  1ZXI A;  1SBB B;  2WXG A;  1JRO A;  1QKZ A;  3J9C A;  1D4B A;  3AEC B;  2NMQ A;  4L1B A;  2KMM A;  2JQR B;  3U2S C;  1YMH E;  4JPS A;  3P42 A;  3TEW A;  1JWB D;  1PYW D;  1TKG A;  3Q8C A;  4LTU A;  2BYT A;  1VZ8 A;  2WXQ A;  2PVO D;  1ACC A;  1N62 A;  3BK2 A;  2Y5P A;  1NYR A;  3Q8B A;  4US9 A;  1FM0 D;  2JWU A;  4KGS A;  4RH6 A;  4ARC A;  1L0Y B;  4TSS A;  2INN E;  1D5X C;  1I4P A;  2K22 A;  1JWS D;  3IXS A;  1XO3 A;  3GS2 A;  4P6V F;  4RGT A;  4P16 A;  1C76 A;  2AQ2 B;  5GXG B;  2WXM A;  5BMH A;  3HRD D;  2ICI A;  1UWX A;  1ZXH A;  1SF0 A;  4WUR A;  1C9F A;  1MI0 A;  4FXC A;  3AE2 B;  4HKZ E;  3VQI A;  1ZUD 2;  2JX5 A;  3ZQ4 A;  3VRA B;  3AEG B;  1JWM D;  1JQ4 A;  3CWI A;  3OWE B;  4O1N A;  1H7W A;  4XWT A;  1ROE A;  2RDH A;  2VZK D;  4A9A A;  4OZB A;  1QLB B;  4YTN B;  2PVG C;  3ZJV A;  3C8Y A;  5EE3 A;  5BMI A;  3Q69 A;  3B2G A;  3HVD A;  1SIJ A;  2WDQ B;  1SE4 A;  4HJG E;  1GTE A;  1WGK A;  2BB6 A;  1VR9 A;  3P4S B;  1FXA A;  3ETR A;  4YT0 B;  3HVZ A;  2E6X A;  3P63 A;  1IUE A;  1PGB A;  4PT5 A;  1BML C;  1HEZ E;  2R61 A;  3AED B;  3AM9 A;  2L52 A;  4A6Q A;  1VJK A;  1XLP A;  1V8C A;  2DBY A;  2I38 A;  4NZL B;  1PGA A;  2QIE B;  3SFE B;  3BK1 A;  2JYT A;  2MEK A;  4RNA A;  2LJI A;  1L6U A;  2Y5C A;  1OQQ A;  1WSP A;  4GLS C;  1T6B X;  5E6J A;  3AE6 B;  1YN4 A;  2RMM A;  1VZ6 A;  1NEK B;  2YEP B;  1FCL A;  3IT4 B;  3P4R B;  2WXO A;  5D3I B;  1VZ7 A;  1V1P B;  1TKE A;  1MHH E;  2W55 A;  4OHJ A;  3IAS 1;  1QT9 A;  1F2R I;  4EE2 A;  1TKY A;  2BBC A;  2J4X A;  1TS2 A;  1DYQ A;  3E9S A;  4XDD A;  2LUM A;  1FFV A;  4N58 A;  2BS3 B;  1FRR A;  2IGD A;  2MJE A;  2V3P A;  4KX6 B;  3NVW A;  2AQ1 B;  1BXT A;  3Q8F A;  1DOX A;  3EGR A;  3H8H A;  2K3U A;  3B9J A;  4RGN A;  1NI3 A;  1P7F A;  5FKA C;  4IDI A;  4ZYS A;  3GP7 A;  2BS2 B;  1QIL A;  1YJJ A;  5H92 C;  4N59 A;  2WU2 B;  2KQ4 X;  3WCQ A;  2IGH A;  2Z8L A;  1FNV A;  3HUI A;  1SE2 A;  1RM6 C;  2K9X A;  3KQ4 A;  2AQ3 B;  2JSV X;  2WXF A;  1SJH D;  2CJO A;  4OZA A;  4A55 A;  3ZYY X;  5G5H A;  3BYT B;  1C4C A;  2QIL A;  2WXP A;  3CIR B;  3KLS X;  3MFG A;  3LYY A;  2M19 A;  3W9C B;  4A90 A;  1RFK A;  1KLU D;  4IOI E;  4J3O D;  4DXF A;  3TEX A;  2N9L A;  4WIP A;  1GPX A;  1NEN B;  4HKQ A;  4MT5 A;  1FXI A;  1XLQ A;  4L23 A;  3P4P B;  4B0E A;  1KH0 A;  1SXT A;  2KAJ A;  1FFU A;  2WXL A;  2V3N A;  4HEA 1;  4WWM A;  4RGM A;  3T3N A;  3GB1 A;  4HRO A;  4YTP B;  1TS4 A;  5FR3 A;  4WQM A;  4AQ7 A;  3MP9 A;  3VRB B;  1TJE A;  1STE A;  2WNM A;  1UUP A;  4H2A A;  1JML A;  1EM7 A;  4RCO A;  5FK9 C;  3R8B A;  2PLP A;  2SAK A;  1C79 A;  2WQY B;  1E6E B;  1ZE3 D;  2W54 A;  1ZP0 B;  3TUO A;  1HA5 A;  1HZ5 A;  3PZ7 A;  1ET6 A;  2BT6 A;  4GDL B;  4OVZ A;  1E7P B;  1L4Z B;  1ZOY B;  1XCT L;  4YXD B;  1R7S A;  2H88 B;  1I4R A;  4ZHO A;  1V1P A;  1K51 A;  4ZHP A;  1F2R C;  2FUG 1;  1CQV A;  1HQR D;  2ACZ B;  3P1M A;  4L2Y A;  5LNK 1;  2RPV A;  3AE8 B;  1T3Q A;  2ON8 A;  2LEK A;  1J7A A;  1SE3 A;  3B2F A;  1CK1 A;  3FC4 A;  1WYG A;  1QOA A;  2WS3 B;  5JXV A;  4D2K A;  2LHE A;  3Q8A A;  3SR6 A;  1N63 A;  1PUT A;  1JWA D;  3TEZ A;  1M4V A;  3AEE B;  1C4A A;  1GOZ A;  2QJL A;  5D3D A;  1KTK A;  1L5P A;  3KWL A;  1J7C A;  2XN9 C;  3I9V 1;  2N9K A;  4WAF A;  1BUI C;  1DGJ A;  3LB8 C;  1A70 A;  1WRI A;  1N5W A;  3MJ5 A;  4RGO S;  5HHD G;  5HFY A;  2FE8 A;  4NAW B;  1XF5 L;  2Q5W D;  4YTM B;  3N9Y C;  3DWG C;  2H89 B;  1C4P A;  4USA A;  4XE0 A;  2OHF A;  1AW7 A;  1J7B A;  1F77 A;  2JU6 X;  1KLG D;  3FIL B;  4YSX B;  3Q8E A;  4ZRQ A;  4US8 A;  2DLB A;  3EUB 2;  3AEB B;  2PTL A;  1MVK A;  2JYE A;  2N0S B;  2W82 A;  3BII D;  3W1S A;  3W5V B;  4B0M A;  1F0Z A;  1DOI A;  1UGJ A;  2PIA A;  1K53 A;  3L4P A;  1AYF A;  2MJD A;  1I4G A;  2OED A;  3AMZ A;  1L0X B;  3TEY A;  1L4D B;  1YN5 A;  1VLB A;  3BVM A;  2M0A A;  4NAM A;  3URY A;  3AEF B;  3IT6 B;  2D5G A;  1GB1 A;  3AH7 A;  1FRD A;  2EKI A;  2IGG A;  2L83 A;  4MAC A;  2BTE A;  2HDE A;  1N5X A;  4MH8 A;  2WU5 B;  1YJI A;  3LXF A;  1PDX A;  2BB5 A;  2NTT A;  2WP9 B;  1YQ4 B;  2JZP A;  3PO0 A;  4MM3 B;  4CQN A;  1JRP A;  3AE4 B;  1E10 A;  3PZ8 A;  2KAC A;  2WXI A;  3DWM A;  4HRS A;  2WDR B;  2ZW0 A;  1JW9 D;  1JAL A;  4JWS C;  1RWS A;  5D7G A;  2GRI A;  4RF1 A;  1FO4 A;  2J52 A;  5C3J B;  1ET9 A;  3RFZ B;  2KDM A;  3W5U B;  2ONQ A;  5BMG A;  2QMT A;  2M56 B;  3RPF C;  1ZDX A;  5AUK A;  3KWV A;  1OQR A;  4XWW A;  5I4D A;  1I4X A;  4ZRP A;  4RF0 A;  1K52 A;  3ABV B;  1B9R A;  2LMC A;  4REZ A;  3NZ3 A;  2B76 B;  4N6E B;  1PFD A;  1XLO A;  1ESF A;  4TQ0 A;  1C77 A;  3TSS A;  2WXH A;  5T8I A;  2EEL A;  2Y3A A;  3AB5 A;  1TY2 A;  2WLB A;  5G5G A;  1FEH A;  2YEP F;  1EWY C;  3U7Z A;  1EWC A;  5EE0 A;  1Q10 A;  1TS5 A;  4DXG A;  4WH4 A;  4JWU C;  4AS1 A;  3BYY B;  2WDV B;  2K5P A;  1L0V B;  3P4Q B;  5EE1 A;  1I7H A;  1D5Z C;  4Q2J A;  1T5X D;  3T3O A;  2IJ0 A;  1YNT E;  2IDY A;  3U4E G;  2BS4 B;  3R2T A;  3VR8 B;  4KGT A;  1DOY A;  1ZPS A;  2J53 A;  1GTH A;  1N61 A;  3AE7 B;  3I57 A;  2CU3 A;  1HXY D;  5TSS A;  2PW9 A;  4TQ1 A;  2LFI A;  2MH7 A;  2I2Y A;  1B1Z A;  2AX5 A;  4KKJ A;  1HZ6 A;  3NVY A;  1OFF A;  3MHZ A;  1RYJ A;  5HG2 A;  1QOG A;  1TY0 A;  1QQR A;  2FBW B;  1CJE A;  1CZP A;  1QOF A;  2N7J A;  4M0W A;  5BYS A;  3BVG A;  4OZC A;  3ZJT A;  2WXK A;  1EU3 A;  1FNU A;  2BW2 A;  3BVZ A;  1AWD A;  2J42 A;  2PMV A;  1IBX B;  2KN4 A;  1KRH A;  1L6V A;  2WXN A;  1XCQ L;  5MPO A;  2W3S A;  4JX1 C;  1GAQ B;  1KF6 B;  1ZDV A;  4DQO C;  4XDC A;  2E3T A;  4TMA B;  3AE1 B;  2X38 A;  4JE3 B;  2G1E A;  2CJN A;  3R2I A;  4YSZ B;  3E56 A;  1WWT A;  1YQ3 B;  4LLG M;  2RDG A;  2DWQ A;  3EA6 A;  1SB3 C;  1I4Q A;  1WXQ A;  1V97 A;  2IPK D;  4C7Z A;  1ENF A;  3FAH A;  1FIQ A;  2L1A A;  1FD6 A;  1UWM A;  2TSS A;  1FNW A;  1D5M C;  3O13 A;  2K0P A;  3SEB A;  4UDU C;  2WXJ A;  4YSY B;  1P7E A;  3V3X A;  3NUH B;  3IAM 1;  1YN3 A;  1D6E C;  1XLN A;  1FCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...