4D2KA

Crystal structure of drep2 cide domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
RGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CIDE domains form functionally important higher-order assemblies for DNA fragmentation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Apoptosis
molecule keywords DREP2
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4d2kA00
2RMMA 1D4BA 2KQ4X 5JXVA 2ONQA 2PLPA 4KGSA 1PGAA 1PGXA 4IOIE 2EELA 2IGGA 3FILB 2K0PA 5HG2A 1P7FA 1HZ6A 1MVKA 2IGHA 2KN4A 5HI1A 1KH0A 2N7JA 2PTLA 4OZBA 1QKZA 1IGCA 1HZ5A 1GB4A 2JSVX 4OZAA 3FILA 1C9FA 4D2KA 1HEZE 1PGBA 1EM7A 2NMQA 2N9KA 2ON8A 4WH4A 5BMHA 1K53A 3UI3A 5BMIA 5HFYA 2RPVA 2JWUA 1ZXHA 2LHDA 2IGDA 1F2RC 1K51A 2LGIA 1XCQL 4KGRA 1UWXA 2QSDA 2KDMA 1MHHE 1MI0A 3GB1A 1MHXA 1YNTE 2JZPA 2J52A 2GB1A 3V3XA 1FCLA 1FD6A 1MPEA 4HJGE 4IKGA 4OZCA 1FCCC 2JXTA 1GB1A 1IBXA 2GI9A 4KGTA 2I38A 1XCTL 1K52A 2J53A 4MACA 1XF5L 4GLSC 1F2RI 1IBXB 1Q10A 1JMLA 2QMTA 2ZW1A 2KACA 5HHDG 2ZW0A 1IGDA 2LUMA 2PW9A 1YMHE 2N9LA 4HKZE 2KWDA 2OEDA 1K50A 3MP9A 2I2YA 2JU6X 1P7EA 5BMGA 2LHEA
chains in the Genus database with same CATH superfamily
2KN5A 1D4BA 2MJ3A 4I6LB 3CIRB 1SJHD 3SFEB 2YEPB 2MX2A 3E9SA 4XDCA 3QIJA 2W82A 2WWZA 2LFIA 3JW0X 3PRMB 1R4MI 4GOCA 3TMPB 1HZ6A 2OHFA 1ZXIA 2KN4A 3ETRA 5KHOA 3I63C 2MBHA 4KSLC 4M00A 3W5UB 1V5OA 3R2TA 4GXBA 4KSKC 1GB4A 4QAYA 4IM3A 4AWJA 4XWWA 5AUKA 2W3RA 2RDGA 4YXDB 1OQRA 2JX5A 1K53A 2KXJA 4I6NB 5C3JB 1Q0WB 3A9KA 2L32A 4F1SA 2RPVA 1P3QU 4A3OA 3WAPA 3KWLA 3AU4A 3ZKJC 2PJHA 1WRIA 2QSDA 2MBQA 4C80A 3QAQA 2N4FA 3L0WB 1P1AA 2RR9A 3ZO5B 3UGBB 3TEYA 3IT6B 2KMAA 3A1QB 1WXVA 5CHWA 1YQBA 2ZJDA 2Z0EB 3V3XA 1T3QA 1MPEA 1L4DB 4W9EA 3NVVA 1GB1A 1SEBD 4IM0A 1FRRA 4NPNA 2KFJA 2M0XA 3W1SC 2BYTA 4JX1C 4BAXA 1SE9A 1V1PB 1KFYB 1D6EC 2KACA 1WGHA 2PW9A 2DWQA 4HPLB 3JSVA 2O2VB 3PZDA 2K3UA 3M62B 1UH6A 3N30A 4FLHA 4KV2A 1K50A 1D5XC 1WF9A 1N61A 2DZMA 5BMGA 2L0FA 2JYTA 2ONQA 1VCBA 4K1RB 2EELA 2MP2A 3ENEA 3KH0A 3LXFA 4NJ7A 3ZDMC 3AXCA 3VTWA 3U7DA 3VUYA 1ZUD2 4XC2A 1C76A 3DCGA 1QF6A 5GMVA 2L1AA 4OZBA 2NBWB 1WMHA 2J42A 4RM9A 3PGEA 2M17A 2V3NA 1RRBA 3A9KB 1T0SC 4B0EA 1C78A 3ZYYX 2DENB 3RNEC 3R7RA 2D5GA 2IZVB 3AEGB 1E0ZA 3HRDD 3ZQ4A 1FO4A 2DYBA 4ZOHC 5LLIA 2LXAA 1XCQL 1EU3A 5H8YE 2EKEC 3DHGC 1RWSA 1SE4A 3MHSD 2AYOB 1FNVA 2LMCA 4OW0A 4N59A 2KJHB 2E3TA 4L1BA 3GZNI 1C4PA 1E7VA 4YWGG 3CSFA 2KX0A 3OJ4B 1I4XA 2C60A 4GLSC 3HM3A 2E6XA 4YTNB 4FJZA 5EE9A 1C4AA 3Q3NC 3N1YC 3S2AA 1YIWA 4M01A 4DXFA 1IGDA 4A9AA 4AP4C 1RAXA 4EEWA 2DLBA 2DYOA 2M0AA 3BIID 1UUPA 2BYVE 3JVZX 1RFAA 2OOBB 4IDIA 3PHWB 3TSSA 2V3SA 3KVFB 4FJYA 2KQ4X 1SGHA 4KZ0A 4ZHOA 2KDIA 1WYWB 2DX5B 1YN4A 4REZA 1FFVA 2LZ6A 3VR9B 2HDEA 4BKSD 1C3TA 4WJQA 2LUEA 3DBLB 3AE3B 4K7SA 3J9CA 1CK1A 4B0MA 4HCPB 1VLBA 2XEWA 4TSSA 3DVGY 3P42A 4K3CA 1LFDA 3TBLD 2C7MB 3KUZA 1E9MA 4TMAB 5D2MB 1TBEA 4TQ0A 4HDQA 4HROA 2XK5A 1N63A 3U52E 3L10B 5D7GA 4ANWA 2MQJA 2AX5A 2WS3B 4P7IA 3PV1A 3BINA 3IXSA 3QWZB 3SDLC 1UF0A 4H2AA 2REXA 1YNTE 2IDYA 1F77A 2KAJA 4LCDE 3RNCC 2FAZA 4W9CA 3IBEA 3I5JC 3SR6A 4LJOB 2W3SA 3MFGA 1N62A 2JYEA 4IKGA 1KTKA 2MBOA 3WCQA 1L7YA 1CQVA 5AZGA 4RF1A 4TV3A 1PUTA 1XF5L 3NG0A 4FHJA 4EZJA 4MSQB 4OVZA 3HK0A 2AQ2B 1FXAA 1WGDA 5FR6A 1V6EA 2BYEA 3RN9C 3EUB2 4MGIE 3ZTDA 5LNK1 4XZ4A 1KM7A 1IPGA 3AE5B 3NVYA 3UIPB 4A8XC 2GBMA 2A5UA 3TIXA 1FPYA 2RSUA 2LJIA 3DHHC 4NAWB 4TQ1A 5AUIA 4IG7B 3APCA 2BPSA 2D3BA 3NZUA 4NJ6A 2Z0DB 3VVWB 2K8BA 2KC2A 3ZDTA 1JCKB 4HPMB 3B0AA 3IHPC 3FILA 2BTEA 4D2KA 2I1KA 3IVFA 3SFDB 1E6EB 4WJOA 3PTFC 1YQ3B 2WX0A 5BMHA 2WXOA 2BGFA 3NZ3A 4ZDVA 3UI3A 5BMIA 1A5RA 2K6QA 5HFYA 1UNSA 3MC8A 2I1JA 2QHOA 2LHDA 4HJKA 1SF0A 1VJKA 3ZLZA 2ZNVC 3A33B 4IC7B 3V05A 3I57A 1ENFA 5J18A 3UF8A 2TSSA 3GS2A 3IAM1 1V81A 2FCMA 3OG5A 1IUEA 1SIFA 3VFKA 4YTMB 4DHZB 2Z8LA 4G0NB 3X0WA 3AM9A 1VR9A 1WFYA 2CJOA 3APDA 2WX1A 2GBJA 1K52A 4G50A 4EZLA 2GRIA 4P1CC 2WXPA 5JHBA 1UGJA 1TS2A 1U4AA 2HTHA 2IO3B 2KJ6A 2KVZA 2YLMA 3HIZA 1OEYJ 3Q8EA 4BOSC 3N32A 2KFKB 1EUVB 4YSYB 4DHZE 1TJEA 1V86A 1LM8B 2N7DA 1J7AA 5J2RA 4CHKA 3VUXA 2HJ8A 4XWTA 3WANA 4NQKE 3AN1A 2KNBA 2D3AA 3KQ4A 2LJ5A 2RDHA 3ZXVA 3AI5A 2K1FA 2V4LA 3VDZA 1P9DU 4BOZB 1S3SG 3ZUNA 2LVPA 3PZ8A 4HEA1 1VDVA 1TKEA 1WYGA 2WXHA 4MM3A 2CU3A 4ZYSA 2MRPA 2N0SB 4WIPA 2KTRB 2WXIA 1IGCA 2J4XA 3T8MA 3ML9A 5E6NA 2KDBA 4C4VA 4XE0A 2NMQA 4PS8A 2MEKA 1CJEA 2KYWA 3AV8A 2KTRA 2KK8A 1V9JA 1UWMA 2FCSA 2JWZA 1MG4A 3BYTB 1E8WA 3H8HA 4YT0B 3A1QA 3TJPA 1HXYD 3P4PB 4C00A 1XO3A 4RF0A 3BVGA 3ONSA 2JF5A 2A4ZA 1YJIA 4S0RA 2QDFA 1YN5A 1VZ7A 2K8CA 2GLSA 3MC0B 5CHFA 3K9OB 2MHJA 1ISNA 1JRPA 4JGHB 5I4DA 1C1YB 4XX5A 4ANVA 2PEAA 3TL5A 2GBKA 1UBIA 3DBHI 4USAA 4WWPA 1B9RA 2ZW1A 3R3MA 1F9JA 1SB3C 2LUMA 4W9JA 4W9LA 2NTTA 1SBBB 2XBBC 2KHWB 1YD8U 2IY1B 5DPSA 1WM3A 3DOWA 1QOGA 4MDKE 2NBUA 3VH4B 4J3OD 1PGXA 4JLCA 3OLMD 2K6DB 3BK2A 4ARCA 2NR2A 2R2QA 1EWCA 2QILA 1AYFA 2VH1A 3FKYA 4IWOA 3N20C 1E7UA 2UYZB 3HVZA 5L95C 4AQ7A 4GIVA 1I4RA 3FAHA 3V6EB 2KVRA 1HEZE 2IBIB 2C5LC 2IJ0A 2B76B 2HE7A 5L83A 1T5XD 1HQRD 5EE3A 3KUCB 4AJWA 4ZRJA 1ZDXA 1C79A 1QZEA 2BBCA 1L6UA 1JW9D 2ASQA 1E5WA 3DPDA 1TKGA 4MM3B 3L08A 3QK0A 3UQBA 3PO0A 4BKSA 4KKIA 3HHMA 4WQOB 2IY0B 4ZRKA 4LK0M 3WAOA 1GNUA 4B9KA 2G9HD 2BF8B 1JQ4A 4MELA 2L05A 1MG8A 4II3B 3AE2B 2DZKA 4ICVA 1TIFA 2CKHB 1V5TA 4JWUC 2V1YA 2I38A 3PSEB 1YX6B 1XCTL 4RFBA 4FADA 3NVWA 3ZNZB 1C77A 4HWIB 2MCNB 4RMAA 1NENB 1D5ZC 1V2YA 5D6JB 1WXAA 3N1ZC 2MA9B 1I42A 3O13A 3CF6E 5JHAA 2MBEA 5IA7A 5BYRA 2LHEA 1BUIC 4HCNB 1STEA 3SHQA 4MSMB 2UWQA 1ZW7A 1JALA 1OFFA 3AECB 2PMVA 5BO4B 4BBNF 3BWUD 2IO2B 2K0PA 3QCAA 3P1MA 1L6VA 5TR5A 3DBSA 4IUMB 1RFKA 3Q8FA 3W9CB 3W2DA 2KTFA 4W9HA 1PDXA 1N5WA 1K8RB 4MH0E 2WYQA 3ZW3A 4N6EB 4W9FA 4IW0A 3AU5A 2MJDA 2LVOA 5IO9A 3CMMB 4P1BC 2V0GA 3RUIB 5TSSA 4WAAA 1OEYA 3M95A 2JUOA 1XEEA 4ACFA 4AS1A 3ZRCA 3RNGC 2DBYA 3ALBA 3VTUA 2MH7A 1UWXA 2QC8A 3L4PA 2BKFA 3AE9B 4F8CB 1XLNA 1KLGD 3X23A 4RGMA 1FD6A 2CHZA 2ZVOA 4XYCA 2M19A 1OQYA 4MGYE 3EGRA 1WIAA 1ZP0B 3ABVB 1JWSD 1Q10A 4ZYNA 3A9JB 2PKOA 3N9YC 2OJRA 2ZW0A 1X1MA 3VTVA 1TKYA 4JIOU 2W55A 4DWFA 3A4RA 2JQRB 4CQNA 2QCZA 2JPHA 4KVGB 2FNJB 4PS3A 2WXJA 3Q8AA 4Q2JA 4RGOS 3R7QA 2IGGA 3OAWA 1WXMA 2CHWA 5JZEB 3ECIA 3U30A 3NS8A 4LLGM 2PE6B 3VQIA 3P4SB 1JWMD 2KFKA 2JSVX 4J6IA 1NVID 3N1XC 4NY0A 4GDKA 1AWDA 4B95A 1DOXA 1FNUA 3U8ZA 2J7QB 4GDKB 1TZOA 2K25A 5IAAC 1UBQA 4RGTA 2IGDA 2R2OA 4AJYB 1WGKA 2DHZA 4A90A 2BS2B 4A6QA 2KT7A 1WX8A 3AE7B 5FK9C 2WXMA 3KYCD 2JZPA 2J52A 3U7ZA 2WDTB 4WQMA 1FCCC 2KKCA 1LXDA 2GI9A 2WU2B 4KGTA 4A55A 1E10A 2R61A 4K7WA 4URKA 2MSED 4E3CA 4N9F4 1EF5A 1IYFA 2IO1B 1XT9B 1YJJA 3AEEB 2O6VD 1Z2MA 1FM0D 2DAJA 3PVLA 2JVCA 2LRWA 4M8NA 2FBWB 4KIKB 2KLGA 4I6PA 2O6VB 4A20A 2KMCA 2GOWA 2BS4B 3B2GA 4WAFA 2C9WB 3FC4A 3FILB 4E74A 2PE9A 2X8XX 3ZJTA 3NUHB 3NOBA 4HK2A 1EO6A 2IGHA 4NAWA 2D3GA 1ZDVA 5HI1A 2KD0A 2PTLA 1NYQA 1C4CA 3TCAA 2ZEQA 3ZVVA 2KZRA 2CR5A 3IAS1 4EUTA 1TTNA 2XNAC 2CU1A 5DPWA 1QOBA 2L0TA 3DVNU 2IO0B 5C23A 2AQ1B 4JE3B 4XDDA 4F7ZA 1WWTA 5LXHA 1GUAB 3W1SA 1P0RA 4C4VB 5DCNA 2VZKB 4DBGA 3GZNB 3ZNHB 4IM2A 4LNIA 2N1VA 3ZRFA 3H6NA 3SD5A 2ZZPB 3GB1A 2DZIA 4S17A 2M56B 1TY0A 1R4MB 2KOXA 3PZ7A 4CO7A 3H7SA 1VZ6A 2JY6A 1FCLA 3DVNV 4ZRPA 3B9JA 2WXKA 4IWQA 4ZRQA 1J7CA 3NRZA 1TY2A 3BY4B 2HTME 2V9HA 1IBXB 1TZ1A 4FBJB 2INCC 4GSWA 3Q8BA 5LXIB 4KDIC 1WY8A 2L52A 4WJNA 3ZJVA 1CZPA 2MP2B 5D3DA 1YMHE 1Q5WB 2N9LA 2ZPNA 2FIFA 4NAMA 3EHVA 1F0ZA 3RZWC 1FMAD 1BT0A 2RGFA 2SAKA 3AE6B 2KWDA 3MP9A 5JH5C 1QILA 3VHTC 5T8IA 5AZHA 3TEXA 2RDBC 3TEWA 3I3TB 5DPRA 4KZCA 2M8SA 3JSVB 1ESFA 4IOIE 3C19A 4TUUA 2QJLA 5HG2A 1RLFA 3P2BA 4DDGD 2VH2A 4ASWC 1JRUA 1GG3A 2NBVB 1V8CA 2C7HA 4ZHPA 1HTOA 2N7JA 5AEKB 3JYUA 2N1WA 4PT5A 5EDSA 2LI5A 1ZE3D 2INDC 4OZAA 4KX6B 2KDEB 4LNKA 3ZNID 2WDQB 2N9PC 1ROEA 1LQBA 1FEHA 1ZGUB 1LO5D 5CTRC 5G55A 2IYDB 4DK5A 1WJ4A 3VAWA 1P98A 1NBFC 4L2YA 4PK1A 3RCZA 3WALA 4C56C 1V49A 2NCNA 2Y5CA 3M3JA 2LGIA 2KDMA 1WJNA 1WJUA 3BVZA 2HD5B 2L83A 3VR8B 1Y8RC 2W54A 3PRZA 1SE3A 2GB1A 1J8CA 2BW2A 4LNOA 5G2NA 2IPKD 3AEBB 2Q5WD 5J17A 4W9IA 3L16A 2BQQA 3WIMA 1TS4A 3VH3B 3UQAA 5CHVC 2KLCA 2WXRA 2EMSA 1YN3A 1PFDA 2AL6A 1VD2A 4GMVA 1YX5B 1JWBD 1L0VB 3E56A 2CHXA 1BXTA 1HTQA 2EMTA 5AZFA 3IG3A 1TGZB 1JWAD 1WX7A 3T9LA 3UIOB 3RFZB 3L17A 4OVUA 4IWPA 1AN8A 3GE8C 5FKAC 5EE1A 2VRRB 2K5PA 4EOYA 4ICUA 1XLOA 3AE1B 3GOEA 3I9V1 1GOZA 2GMIC 4MT5A 2G4DB 2INNE 2BWFA 3EECA 2HJ1A 2G45B 2KWVB 2M4NA 3TUOA 2LEKA 2L00B 4FULA 1R7SA 2JRIB 2D07B 2L3ZA 2N9XA 1QT9A 1L2NA 1H4RA 3SU8X 3T3OA 2ON8A 4WH4A 4C7YA 3QHTA 3NY5A 4K7UA 1Q1OA 3RT3B 4R3DA 2WXGA 4MJSA 4NZLB 3H9DA 3LJ3A 5EE0A 1K51A 2Y5PA 4RM8A 4EFOA 2OJWA 4YSZB 2KMMA 1H8CA 3P63A 1WGGA 2UU7A 3VXWA 2BT6A 4FJVB 5H92C 2MLBA 4G3XB 3AEFB 4BKGA 3VRAB 4W9DA 4BBNC 4HJGE 1V1PA 4BZAA 3ZXRA 3CSTA 2WXFA 4NNJB 1I7HA 1I4HA 3KW5B 3KLSX 1D5MC 1ZOYB 2LXCA 1IP9A 1M4VA 3NS1A 3BK1A 3C0RB 2BVCA 3PHXB 2Z59B 4OHJA 4WWMA 4MGKE 3MJ5A 1WE6A 5BYSA 3MC9A 1UZXB 3RI7C 1BMLC 4PS7A 1T0RC 2RMMA 2L7RA 2NTSA 1ACCA 3AMZA 1WX9A 1I4PA 1EU4A 1WH3A 1P7FA 1OQQA 1NEKB 2FE8A 3B08A 2KQSA 1HE8A 1KF6B 2V4IB 1FXIA 3Q3JA 1QKZA 1PQSA 1N60A 1Y56A 4ANXA 3L13A 1WZ3A 3EFUA 1UGMA 4DXAB 1F52A 3HUIA 1DGJA 3T3NA 4HLEA 2JWUA 1L5PA 4P6VF 4EZKA 4WURA 4UDUC 5C1ZA 3KWVA 1KLUD 4EE2A 1OGWA 1SIJA 2X38A 3NHEB 2PIAA 3Q6BA 3W1YA 1WSPA 3BVMA 4YL8A 3RYTA 1MI0A 4FXCA 3W5VB 1KLVA 1L0XB 3QX1A 2BYFA 2JZ3B 4YTPB 1NDDA 3OJ3A 3VRBB 4FA6A 2K9XA 4KKJA 2G3QB 3GP7A 4BKTA 1SSNA 1J7BA 3H7PA 2CJNA 1JROA 4MACA 5G5GA 1QLBB 2LVQA 2MWSB 1F2RI 3Q3OC 3QJZA 3LYYA 1TT5B 1WE7A 4AUQC 1WXQA 1AARA 5FR3A 2KWUB 1ZPSA 2LASA 3DBHB 1P7EA 4LJPB 2YEPF 4RCOA 4ANUA 1R4NB 4E71A 2D2QA 2PLPA 4B6WA 1L4ZB 1YJ1A 2RD0A 1NI3A 3AEDB 5DPTA 1MVKA 2KQ7A 3RNBC 1J19A 4DXGA 2G4SA 3SEBA 4JL9A 2C7NB 4GDLB 2KX3A 1WM2A 3NVZA 3B2FA 2LGSA 4LNFA 3AE8B 2PVOD 1NI2A 1SJED 2N7EA 2PVGC 4WWNA 4II2B 1V1OA 3Q2AC 2M1MA 1MJDA 1XLQA 3LB8C 4LDTB 4HVBA 3DWGC 1V97A 4KGRA 3R2IA 4HXDA 2WXQA 4K3BA 2EKIA 2GBRA 2AQ3B 1R4NI 4GB9A 3GE3C 5IKCM 3Q3FA 4C7ZA 5C2TB 1WZ0A 2LGDA 3AULA 4OZCA 1XXGA 1IBXA 1QOAA 2B3AA 1E90A 3R8BA 3L54A 2L76A 1WRDB 2D11A 3V6CB 4O1NA 5HHDG 2FCQA 2MJEA 3U2SC 3IT4B 5GXGB 1UELA 2BS3B 4M8MA 2Y3AA 3AH7A 3DHIC 1TS5A 4HKZE 4ZRIA 2CS4A 1GJZA 2NPTA 1XD3B 1WJ6A 1E7PB 2WXNA 3URYA 2ZCBA 2D10A 5IOIA 5JXVA 2LRUA 3MTNB 2KC1A 3EC8A 2PPHA 4M0WB 4XGAB 3ZJUA 2WLBA 1I4QA 4KDLB 2BB6A 1T0YA 1KOTA 4N58A 3EFCA 2ZVNA 3APFA 2NS5A 5D3IB 4NQLB 1GC7A 4KIKA 5E6JA 4TKNA 1HZ5A 2JZZA 2LD9A 2O6VA 4K81A 1C9FA 2WHIA 2NVUI 3B1LX 1G6JA 5HKHA 1WMHB 1WR1A 2INPE 1DOYA 4M02A 2AEHA 3PRPB 2BKRB 4PYUA 1E8YA 4EKUA 3PPAA 2QIEB 3UINB 1WGYA 3ML8A 2H89B 2N9EB 1B1ZA 2RPQA 1KRHA 5IP4D 2LGXA 1MFWA 1EWYC 1XLPA 2WXLA 3PLUA 1MHXA 1TYGB 3ZNGC 4US9A 3M63B 4FN2A 3Q14C 4NJCA 1PYWD 4G11A 2WQYB 1ET9A 4HPPA 2JXTA 1RM6C 2XK5B 3VUWA 3V62A 2KO3A 1SXTA 2WNMA 4JPSA 2FCNA 3RPFC 4LTUA 3AB5A 1FRDA 3U4EG 3BZDB 4MGZE 1VRAB 1JMLA 2QMTA 1I4GA 1LGRA 1KJTA 3C8YA 1DYQA 4JWSC 3N3KB 1S1QB 1NYRA 1QOFA 1FIQA 3Q8CA 2I2YA 4X57B 5KHQA 4RH6A 2KANA 1OTRB 2K22A 2K8HA 1WI0A 3P4RB 4GGQA 4WJPA 1PGAA 5IN7A 4LDTD 2DNFA 5E6PA 2V3PA 3RZFA 2LWPA 2WGSA 2DZJA 3H1UA 4CYEA 4W9KA 3DDCB 3NJTA 2ZPYA 3ZTCA 3QARA 3A9JA 1T6BX 1UD7A 4HKQA 4M0WA 3RULA 1M94A 1N5XA 3MJWA 1EM7A 4ARIA 1N6ZA 4A3PA 4HDOA 2WDRB 2FUG1 1ZXHA 3DBLI 2H88B 2JRHA 1HA5A 3H7PB 1RYJA 2ZNVB 3PLVA 1AW7A 3DBRB 1MHHE 2J0JA 1FFUA 4MH8A 1WXSA 4DDID 3O65B 2L8JA 4AOFA 2WDVB 3RNAC 1TS3A 4PYZA 3KYDD 2D3CA 1DOIA 1FNWA 3KUDB 4YSXB 4LNNA 1Z5SB 3A4SC 2ICIA 1QQRA 3AEAB 3CWIA 2YVCA 3DWMA 1ET6A 1J0GA 2VZKD 4GU2A 3V60A 3MHZA 3DBRI 1F1HA 2JT4B 3QA8A 4RGNA 3DQVA 3ZGZA 3ZIMA 3Q69A 2WU5B 4BFRA 3K9PB 3BYYB 2OEDA 2W9NA 2JU6X 3R66C 4P16A 3HVDA 1E8ZA 3LDZE 1VZ8A 2XN9C 3TEZA 2AWTA 4KGSA 3DVGX 1A70A 3WAMA 4L23A 1D3ZA 2KJRA 2Y5BB 4W9GA 2JXXA 2QEJC 3P4QB 1KH0A 1SE2A 2GBNA 4JQWC 3PS6A 1YOVB 1EF1A 2DAFA 4MJSB 1E8XA 5D94A 1PGBA 2N9KA 3EA6A 3OWEB 2O2VA 2FUHB 2MW5A 5CX3A 4GDLA 3RMKC 3RD2A 4RNAA 1WGRA 4HRSA 1T0QC 2LGYA 1XQQA 4US8A 2BWES 5MPOA 3QQ8B 1F2RC 2DYMA 2WP9B 1YQ4B 2J0KA 2KDFB 1ZKHA 1WR6E 5BYQA 3PT2B 4BVUC 2ZCCA 1CMXB 3RNFC 1GAQB 3QC8B 5G5HA 2J0MA 3D32A 3Q3MC 2SEBD 1GPXA 2MBBB 4GN1A 2FIDA 2KWCA 4ITKA 2J53A 2NPTB 4DHJD 3NZSA 5E6OA 2AL3A 1GC6A 4DQOC 1V80A 3WA0A 3IFWB 2BB5A 4MEMA 2K39A 1I35A 4OVVA 4WWOA 1FXTB 2G1EA 4DHJB 3AE4B 3V61A 1L0YB 3HM6X 4FHKA 3PREA 2ACZB 1JWUD
chains in the Genus database with same CATH topology
1J7AA 2YEPF 4RCOA 1D4BA 2MJ3A 3CIRB 4XWTA 3AN1A 2BS4B 1SJHD 2PLPA 3B2GA 4WAFA 3KQ4A 2YEPB 3E9SA 3SFEB 4XDCA 2RDHA 3FC4A 1L4ZB 2W82A 3FILB 2LFIA 1NI3A 3AEDB 3NUHB 3ZJTA 3PZ8A 1HZ6A 2OHFA 1MVKA 2IGHA 1ZXIA 1VDVA 2KN4A 4HEA1 3ETRA 1TKEA 1WYGA 1ZDVA 2WXHA 5HI1A 2CU3A 2PTLA 4ZYSA 2N0SB 4WIPA 2WXIA 3W5UB 1IGCA 1NYQA 1C4CA 4DXGA 2J4XA 1GB4A 3R2TA 3SEBA 4GDLB 3IAS1 3NVZA 3B2FA 4XE0A 2NMQA 2XNAC 2MEKA 4XWWA 5AUKA 2W3RA 1QOBA 2RDGA 3AE8B 2PVOD 1CJEA 4YXDB 1SJED 1OQRA 3AV8A 2JX5A 1K53A 2PVGC 1V1OA 5C3JB 2AQ1B 4JE3B 2L32A 4XDDA 1UWMA 2RPVA 1WWTA 1XLQA 3LB8C 3W1SA 3BYTB 3H8HA 2VZKB 3KWLA 4YT0B 3DWGC 1V97A 1WRIA 1HXYD 3P4PB 4KGRA 1XO3A 3R2IA 2QSDA 4RF0A 3BVGA 4C80A 2WXQA 1YJIA 3TEYA 3GB1A 1YN5A 2EKIA 3IT6B 2M56B 1TY0A 2AQ3B 3PZ7A 1VZ7A 3MC0B 4C7ZA 5C2TB 1VZ6A 3V3XA 1FCLA 1T3QA 4ZRPA 1MPEA 3B9JA 1L4DB 1JRPA 2WXKA 4OZCA 3NVVA 1XXGA 1GB1A 1IBXA 4ZRQA 5I4DA 1J7CA 1SEBD 1FRRA 1QOAA 3NRZA 2BYTA 4JX1C 1TY2A 3R8BA 4USAA 1V1PB 2HTME 1IBXB 1KFYB 1D6EC 1B9RA 4O1NA 2ZW1A 3Q8BA 2KACA 5HHDG 1SB3C 2MJEA 2L52A 3U2SC 3ZJVA 3IT4B 1CZPA 2LUMA 5GXGB 2BS3B 2PW9A 5D3DA 1YMHE 2DWQA 2N9LA 4NAMA 2K3UA 1F0ZA 2NTTA 1SBBB 2Y3AA 3AH7A 1FMAD 1TS5A 4HKZE 2SAKA 3AE6B 2KWDA 1K50A 3MP9A 1D5XC 1QILA 1N61A 5BMGA 1E7PB 2WXNA 3URYA 5JXVA 5T8IA 1QOGA 3TEXA 3TEWA 2JYTA 2ONQA 1ESFA 4J3OD 2WLBA 3ZJUA 1PGXA 1I4QA 4IOIE 2EELA 2BB6A 2QJLA 3BK2A 5HG2A 4ARCA 3LXFA 4N58A 1ZUD2 1C76A 1V8CA 5D3IB 4ZHPA 2N7JA 1EWCA 2QILA 1AYFA 1QF6A 4PT5A 5E6JA 2L1AA 4OZBA 1HZ5A 3HVZA 4AQ7A 2J42A 1ZE3D 4OZAA 1I4RA 1C9FA 4KX6B 3FAHA 2V3NA 2WDQB 1HEZE 1ROEA 1FEHA 4B0EA 2IJ0A 1LO5D 2B76B 1C78A 3ZYYX 2INPE 1T5XD 1DOYA 1HQRD 5EE3A 2D5GA 3AEGB 4L2YA 1E0ZA 3HRDD 1ZDXA 1C79A 2BBCA 1L6UA 3ZQ4A 2QIEB 1FO4A 1JW9D 4C56C 2Y5CA 4ZOHC 2H89B 1TKGA 2LGIA 4MM3B 1XCQL 1B1ZA 1EU3A 1KRHA 2KDMA 3PO0A 5H8YE 3BVZA 4KKIA 2L83A 3VR8B 1EWYC 1XLPA 2WXLA 1MHXA 1TYGB 4LK0M 4US9A 2W54A 1SE3A 1RWSA 1SE4A 2GB1A 4NJCA 2G9HD 1PYWD 2WQYB 1FNVA 2BW2A 2LMCA 4OW0A 1JQ4A 1ET9A 4N59A 2E3TA 2IPKD 3AE2B 4L1BA 2JXTA 1RM6C 1C4PA 3AEBB 4JWUC 4YWGG 2Q5WD 2I38A 2WNMA 1SXTA 4JPSA 1XCTL 3RPFC 4LTUA 3AB5A 4RFBA 1FRDA 3U4EG 3NVWA 1TS4A 1I4XA 4GLSC 1C77A 2E6XA 3BZDB 4YTNB 2WXRA 5EE9A 1C4AA 1JMLA 1VRAB 2QMTA 1YN3A 1I4GA 1NENB 1D5ZC 1PFDA 4DXFA 1IGDA 4A9AA 3C8YA 1DYQA 4JWSC 1JWBD 1L0VB 3E56A 1NYRA 2DLBA 3O13A 1BXTA 2DYOA 2M0AA 3BIID 1QOFA 1FIQA 1UUPA 3Q8CA 2I2YA 1JWAD 5BYRA 4IDIA 2LHEA 1BUIC 4RH6A 3TSSA 2KQ4X 3RFZB 2K22A 4ZHOA 1STEA 1AN8A 5FKAC 3P4RB 5EE1A 1YN4A 1PGAA 4REZA 1JALA 1OFFA 3AECB 2PMVA 2K5PA 1FFVA 3BWUD 2K0PA 3P1MA 1XLOA 2V3PA 2HDEA 3AE1B 3VR9B 3I9V1 1GOZA 4MT5A 1L6VA 2INNE 1RFKA 3AE3B 3Q8FA 3W9CB 3W2DA 3J9CA 1CK1A 4B0MA 1PDXA 1VLBA 3TUOA 1N5WA 2LEKA 4TSSA 1T6BX 3P42A 1R7SA 4HKQA 4M0WA 1N5XA 1QT9A 4N6EB 1EM7A 4ARIA 3T3OA 2ON8A 4WH4A 1E9MA 2MJDA 4C7YA 4TMAB 2WDRB 2V0GA 4TQ0A 5TSSA 4HROA 1N63A 2FUG1 1XEEA 1ZXHA 4R3DA 2WXGA 4NZLB 3U52E 5D7GA 4AS1A 2H88B 2AX5A 2WS3B 1HA5A 2DBYA 1K51A 1RYJA 2Y5PA 5EE0A 4YSZB 2KMMA 3P63A 2MH7A 1AW7A 1UWXA 3IXSA 1MHHE 3L4PA 4H2AA 1FFUA 4MH8A 3AE9B 1YNTE 2IDYA 2BT6A 1F77A 2KAJA 2WDVB 5H92C 1XLNA 3AEFB 1KLGD 1TS3A 4RGMA 3VRAB 1DOIA 1FD6A 3SR6A 2W3SA 3MFGA 1N62A 2JYEA 1FNWA 4HJGE 4IKGA 4YSXB 2M19A 1KTKA 3WCQA 1V1PA 1CQVA 3EGRA 2ICIA 1ZP0B 3ABVB 4RF1A 1QQRA 3AEAB 1PUTA 3CWIA 2WXFA 1I7HA 1XF5L 3DWMA 1I4HA 1ET6A 1JWSD 3KLSX 1Q10A 2PKOA 1D5MC 1ZOYB 2VZKD 3N9YC 1M4VA 3MHZA 3NS1A 4OVZA 2ZW0A 3BK1A 2AQ2B 1FXAA 4RGNA 3ZGZA 4OHJA 1TKYA 4WWMA 2W55A 3EUB2 3Q69A 2WU5B 5LNK1 2JQRB 3MJ5A 4CQNA 3BYYB 2OEDA 5BYSA 2JU6X 1BMLC 3AE5B 4P16A 3NVYA 3HVDA 2RMMA 2WXJA 3Q8AA 4A8XC 1VZ8A 2XN9C 3TEZA 4Q2JA 4KGSA 4RGOS 2LJIA 1A70A 2NTSA 1ACCA 3AMZA 4NAWB 2IGGA 4TQ1A 1I4PA 5AUIA 1EU4A 4L23A 1P7FA 1OQQA 2QEJC 3P4QB 1NEKB 4LLGM 2FE8A 1KH0A 1SE2A 2V4IB 1KF6B 1FXIA 3VQIA 1JCKB 1QKZA 3P4SB 1JWMD 2JSVX 3FILA 1N60A 2BTEA 4D2KA 3SFDB 1Y56A 1E6EB 1NVID 1YQ3B 1PGBA 2N9KA 5BMHA 2WXOA 3EA6A 3NZ3A 3OWEB 1AWDA 3HUIA 3UI3A 1DGJA 1DOXA 1FNUA 5BMIA 3T3NA 5HFYA 2JWUA 1UNSA 4RNAA 1L5PA 4HRSA 2LHDA 4GDKB 1TZOA 4P6VF 4US8A 4WURA 1SF0A 4UDUC 5MPOA 3KWVA 1VJKA 2IGDA 1F2RC 2DYMA 1KLUD 4RGTA 2WP9B 4EE2A 1WGKA 1SIJA 2X38A 2PIAA 4A90A 3V05A 2BS2B 4A6QA 3I57A 1WSPA 1ENFA 1YQ4B 3BVMA 1MI0A 4FXCA 3W5VB 3AE7B 2TSSA 2WXMA 3GS2A 3IAM1 5FK9C 1L0XB 5BYQA 2JZPA 2J52A 1IUEA 3U7ZA 4YTPB 4YTMB 3VRBB 2Z8LA 1GAQB 5G5HA 2K9XA 4KKJA 3AM9A 3GP7A 1VR9A 2SEBD 4WQMA 1SSNA 1GPXA 1FCCC 2CJOA 2GI9A 1J7BA 2WU2B 4KGTA 4A55A 1E10A 2CJNA 2R61A 1K52A 4ITKA 1JROA 2J53A 4MACA 5G5GA 2GRIA 1QLBB 1F2RI 2WXPA 1UGJA 1TS2A 4DQOC 3LYYA 2BB5A 1YJJA 3AEEB 1WXQA 1FM0D 5FR3A 2G1EA 3AE4B 3Q8EA 4YSYB 1ZPSA 2FBWB 1TJEA 1L0YB 2ACZB 1P7EA 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMM A;  1D4B A;  2KQ4 X;  5JXV A;  2ONQ A;  2PLP A;  4KGS A;  1PGA A;  1PGX A;  4IOI E;  2EEL A;  2IGG A;  3FIL B;  2K0P A;  5HG2 A;  1P7F A;  1HZ6 A;  1MVK A;  2IGH A;  2KN4 A;  5HI1 A;  1KH0 A;  2N7J A;  2PTL A;  4OZB A;  1QKZ A;  1IGC A;  1HZ5 A;  1GB4 A;  2JSV X;  4OZA A;  3FIL A;  1C9F A;  4D2K A;  1HEZ E;  1PGB A;  1EM7 A;  2NMQ A;  2N9K A;  2ON8 A;  4WH4 A;  5BMH A;  1K53 A;  3UI3 A;  5BMI A;  5HFY A;  2RPV A;  2JWU A;  1ZXH A;  2LHD A;  2IGD A;  1F2R C;  1K51 A;  2LGI A;  1XCQ L;  4KGR A;  1UWX A;  2QSD A;  2KDM A;  1MHH E;  1MI0 A;  3GB1 A;  1MHX A;  1YNT E;  2JZP A;  2J52 A;  2GB1 A;  3V3X A;  1FCL A;  1FD6 A;  1MPE A;  4HJG E;  4IKG A;  4OZC A;  1FCC C;  2JXT A;  1GB1 A;  1IBX A;  2GI9 A;  4KGT A;  2I38 A;  1XCT L;  1K52 A;  2J53 A;  4MAC A;  1XF5 L;  4GLS C;  1F2R I;  1IBX B;  1Q10 A;  1JML A;  2QMT A;  2ZW1 A;  2KAC A;  5HHD G;  2ZW0 A;  1IGD A;  2LUM A;  2PW9 A;  1YMH E;  2N9L A;  4HKZ E;  2KWD A;  2OED A;  1K50 A;  3MP9 A;  2I2Y A;  2JU6 X;  1P7E A;  5BMG A;  2LHE A; 
#chains in the Genus database with same CATH topology
 2KN5 A;  1D4B A;  2MJ3 A;  4I6L B;  3CIR B;  1SJH D;  3SFE B;  2YEP B;  2MX2 A;  3E9S A;  4XDC A;  3QIJ A;  2W82 A;  2WWZ A;  2LFI A;  3JW0 X;  3PRM B;  1R4M I;  4GOC A;  3TMP B;  1HZ6 A;  2OHF A;  1ZXI A;  2KN4 A;  3ETR A;  5KHO A;  3I63 C;  2MBH A;  4KSL C;  4M00 A;  3W5U B;  1V5O A;  3R2T A;  4GXB A;  4KSK C;  1GB4 A;  4QAY A;  4IM3 A;  4AWJ A;  4XWW A;  5AUK A;  2W3R A;  2RDG A;  4YXD B;  1OQR A;  2JX5 A;  1K53 A;  2KXJ A;  4I6N B;  5C3J B;  1Q0W B;  3A9K A;  2L32 A;  4F1S A;  2RPV A;  1P3Q U;  4A3O A;  3WAP A;  3KWL A;  3AU4 A;  3ZKJ C;  2PJH A;  1WRI A;  2QSD A;  2MBQ A;  4C80 A;  3QAQ A;  2N4F A;  3L0W B;  1P1A A;  2RR9 A;  3ZO5 B;  3UGB B;  3TEY A;  3IT6 B;  2KMA A;  3A1Q B;  1WXV A;  5CHW A;  1YQB A;  2ZJD A;  2Z0E B;  3V3X A;  1T3Q A;  1MPE A;  1L4D B;  4W9E A;  3NVV A;  1GB1 A;  1SEB D;  4IM0 A;  1FRR A;  4NPN A;  2KFJ A;  2M0X A;  3W1S C;  2BYT A;  4JX1 C;  4BAX A;  1SE9 A;  1V1P B;  1KFY B;  1D6E C;  2KAC A;  1WGH A;  2PW9 A;  2DWQ A;  4HPL B;  3JSV A;  2O2V B;  3PZD A;  2K3U A;  3M62 B;  1UH6 A;  3N30 A;  4FLH A;  4KV2 A;  1K50 A;  1D5X C;  1WF9 A;  1N61 A;  2DZM A;  5BMG A;  2L0F A;  2JYT A;  2ONQ A;  1VCB A;  4K1R B;  2EEL A;  2MP2 A;  3ENE A;  3KH0 A;  3LXF A;  4NJ7 A;  3ZDM C;  3AXC A;  3VTW A;  3U7D A;  3VUY A;  1ZUD 2;  4XC2 A;  1C76 A;  3DCG A;  1QF6 A;  5GMV A;  2L1A A;  4OZB A;  2NBW B;  1WMH A;  2J42 A;  4RM9 A;  3PGE A;  2M17 A;  2V3N A;  1RRB A;  3A9K B;  1T0S C;  4B0E A;  1C78 A;  3ZYY X;  2DEN B;  3RNE C;  3R7R A;  2D5G A;  2IZV B;  3AEG B;  1E0Z A;  3HRD D;  3ZQ4 A;  1FO4 A;  2DYB A;  4ZOH C;  5LLI A;  2LXA A;  1XCQ L;  1EU3 A;  5H8Y E;  2EKE C;  3DHG C;  1RWS A;  1SE4 A;  3MHS D;  2AYO B;  1FNV A;  2LMC A;  4OW0 A;  4N59 A;  2KJH B;  2E3T A;  4L1B A;  3GZN I;  1C4P A;  1E7V A;  4YWG G;  3CSF A;  2KX0 A;  3OJ4 B;  1I4X A;  2C60 A;  4GLS C;  3HM3 A;  2E6X A;  4YTN B;  4FJZ A;  5EE9 A;  1C4A A;  3Q3N C;  3N1Y C;  3S2A A;  1YIW A;  4M01 A;  4DXF A;  1IGD A;  4A9A A;  4AP4 C;  1RAX A;  4EEW A;  2DLB A;  2DYO A;  2M0A A;  3BII D;  1UUP A;  2BYV E;  3JVZ X;  1RFA A;  2OOB B;  4IDI A;  3PHW B;  3TSS A;  2V3S A;  3KVF B;  4FJY A;  2KQ4 X;  1SGH A;  4KZ0 A;  4ZHO A;  2KDI A;  1WYW B;  2DX5 B;  1YN4 A;  4REZ A;  1FFV A;  2LZ6 A;  3VR9 B;  2HDE A;  4BKS D;  1C3T A;  4WJQ A;  2LUE A;  3DBL B;  3AE3 B;  4K7S A;  3J9C A;  1CK1 A;  4B0M A;  4HCP B;  1VLB A;  2XEW A;  4TSS A;  3DVG Y;  3P42 A;  4K3C A;  1LFD A;  3TBL D;  2C7M B;  3KUZ A;  1E9M A;  4TMA B;  5D2M B;  1TBE A;  4TQ0 A;  4HDQ A;  4HRO A;  2XK5 A;  1N63 A;  3U52 E;  3L10 B;  5D7G A;  4ANW A;  2MQJ A;  2AX5 A;  2WS3 B;  4P7I A;  3PV1 A;  3BIN A;  3IXS A;  3QWZ B;  3SDL C;  1UF0 A;  4H2A A;  2REX A;  1YNT E;  2IDY A;  1F77 A;  2KAJ A;  4LCD E;  3RNC C;  2FAZ A;  4W9C A;  3IBE A;  3I5J C;  3SR6 A;  4LJO B;  2W3S A;  3MFG A;  1N62 A;  2JYE A;  4IKG A;  1KTK A;  2MBO A;  3WCQ A;  1L7Y A;  1CQV A;  5AZG A;  4RF1 A;  4TV3 A;  1PUT A;  1XF5 L;  3NG0 A;  4FHJ A;  4EZJ A;  4MSQ B;  4OVZ A;  3HK0 A;  2AQ2 B;  1FXA A;  1WGD A;  5FR6 A;  1V6E A;  2BYE A;  3RN9 C;  3EUB 2;  4MGI E;  3ZTD A;  5LNK 1;  4XZ4 A;  1KM7 A;  1IPG A;  3AE5 B;  3NVY A;  3UIP B;  4A8X C;  2GBM A;  2A5U A;  3TIX A;  1FPY A;  2RSU A;  2LJI A;  3DHH C;  4NAW B;  4TQ1 A;  5AUI A;  4IG7 B;  3APC A;  2BPS A;  2D3B A;  3NZU A;  4NJ6 A;  2Z0D B;  3VVW B;  2K8B A;  2KC2 A;  3ZDT A;  1JCK B;  4HPM B;  3B0A A;  3IHP C;  3FIL A;  2BTE A;  4D2K A;  2I1K A;  3IVF A;  3SFD B;  1E6E B;  4WJO A;  3PTF C;  1YQ3 B;  2WX0 A;  5BMH A;  2WXO A;  2BGF A;  3NZ3 A;  4ZDV A;  3UI3 A;  5BMI A;  1A5R A;  2K6Q A;  5HFY A;  1UNS A;  3MC8 A;  2I1J A;  2QHO A;  2LHD A;  4HJK A;  1SF0 A;  1VJK A;  3ZLZ A;  2ZNV C;  3A33 B;  4IC7 B;  3V05 A;  3I57 A;  1ENF A;  5J18 A;  3UF8 A;  2TSS A;  3GS2 A;  3IAM 1;  1V81 A;  2FCM A;  3OG5 A;  1IUE A;  1SIF A;  3VFK A;  4YTM B;  4DHZ B;  2Z8L A;  4G0N B;  3X0W A;  3AM9 A;  1VR9 A;  1WFY A;  2CJO A;  3APD A;  2WX1 A;  2GBJ A;  1K52 A;  4G50 A;  4EZL A;  2GRI A;  4P1C C;  2WXP A;  5JHB A;  1UGJ A;  1TS2 A;  1U4A A;  2HTH A;  2IO3 B;  2KJ6 A;  2KVZ A;  2YLM A;  3HIZ A;  1OEY J;  3Q8E A;  4BOS C;  3N32 A;  2KFK B;  1EUV B;  4YSY B;  4DHZ E;  1TJE A;  1V86 A;  1LM8 B;  2N7D A;  1J7A A;  5J2R A;  4CHK A;  3VUX A;  2HJ8 A;  4XWT A;  3WAN A;  4NQK E;  3AN1 A;  2KNB A;  2D3A A;  3KQ4 A;  2LJ5 A;  2RDH A;  3ZXV A;  3AI5 A;  2K1F A;  2V4L A;  3VDZ A;  1P9D U;  4BOZ B;  1S3S G;  3ZUN A;  2LVP A;  3PZ8 A;  4HEA 1;  1VDV A;  1TKE A;  1WYG A;  2WXH A;  4MM3 A;  2CU3 A;  4ZYS A;  2MRP A;  2N0S B;  4WIP A;  2KTR B;  2WXI A;  1IGC A;  2J4X A;  3T8M A;  3ML9 A;  5E6N A;  2KDB A;  4C4V A;  4XE0 A;  2NMQ A;  4PS8 A;  2MEK A;  1CJE A;  2KYW A;  3AV8 A;  2KTR A;  2KK8 A;  1V9J A;  1UWM A;  2FCS A;  2JWZ A;  1MG4 A;  3BYT B;  1E8W A;  3H8H A;  4YT0 B;  3A1Q A;  3TJP A;  1HXY D;  3P4P B;  4C00 A;  1XO3 A;  4RF0 A;  3BVG A;  3ONS A;  2JF5 A;  2A4Z A;  1YJI A;  4S0R A;  2QDF A;  1YN5 A;  1VZ7 A;  2K8C A;  2GLS A;  3MC0 B;  5CHF A;  3K9O B;  2MHJ A;  1ISN A;  1JRP A;  4JGH B;  5I4D A;  1C1Y B;  4XX5 A;  4ANV A;  2PEA A;  3TL5 A;  2GBK A;  1UBI A;  3DBH I;  4USA A;  4WWP A;  1B9R A;  2ZW1 A;  3R3M A;  1F9J A;  1SB3 C;  2LUM A;  4W9J A;  4W9L A;  2NTT A;  1SBB B;  2XBB C;  2KHW B;  1YD8 U;  2IY1 B;  5DPS A;  1WM3 A;  3DOW A;  1QOG A;  4MDK E;  2NBU A;  3VH4 B;  4J3O D;  1PGX A;  4JLC A;  3OLM D;  2K6D B;  3BK2 A;  4ARC A;  2NR2 A;  2R2Q A;  1EWC A;  2QIL A;  1AYF A;  2VH1 A;  3FKY A;  4IWO A;  3N20 C;  1E7U A;  2UYZ B;  3HVZ A;  5L95 C;  4AQ7 A;  4GIV A;  1I4R A;  3FAH A;  3V6E B;  2KVR A;  1HEZ E;  2IBI B;  2C5L C;  2IJ0 A;  2B76 B;  2HE7 A;  5L83 A;  1T5X D;  1HQR D;  5EE3 A;  3KUC B;  4AJW A;  4ZRJ A;  1ZDX A;  1C79 A;  1QZE A;  2BBC A;  1L6U A;  1JW9 D;  2ASQ A;  1E5W A;  3DPD A;  1TKG A;  4MM3 B;  3L08 A;  3QK0 A;  3UQB A;  3PO0 A;  4BKS A;  4KKI A;  3HHM A;  4WQO B;  2IY0 B;  4ZRK A;  4LK0 M;  3WAO A;  1GNU A;  4B9K A;  2G9H D;  2BF8 B;  1JQ4 A;  4MEL A;  2L05 A;  1MG8 A;  4II3 B;  3AE2 B;  2DZK A;  4ICV A;  1TIF A;  2CKH B;  1V5T A;  4JWU C;  2V1Y A;  2I38 A;  3PSE B;  1YX6 B;  1XCT L;  4RFB A;  4FAD A;  3NVW A;  3ZNZ B;  1C77 A;  4HWI B;  2MCN B;  4RMA A;  1NEN B;  1D5Z C;  1V2Y A;  5D6J B;  1WXA A;  3N1Z C;  2MA9 B;  1I42 A;  3O13 A;  3CF6 E;  5JHA A;  2MBE A;  5IA7 A;  5BYR A;  2LHE A;  1BUI C;  4HCN B;  1STE A;  3SHQ A;  4MSM B;  2UWQ A;  1ZW7 A;  1JAL A;  1OFF A;  3AEC B;  2PMV A;  5BO4 B;  4BBN F;  3BWU D;  2IO2 B;  2K0P A;  3QCA A;  3P1M A;  1L6V A;  5TR5 A;  3DBS A;  4IUM B;  1RFK A;  3Q8F A;  3W9C B;  3W2D A;  2KTF A;  4W9H A;  1PDX A;  1N5W A;  1K8R B;  4MH0 E;  2WYQ A;  3ZW3 A;  4N6E B;  4W9F A;  4IW0 A;  3AU5 A;  2MJD A;  2LVO A;  5IO9 A;  3CMM B;  4P1B C;  2V0G A;  3RUI B;  5TSS A;  4WAA A;  1OEY A;  3M95 A;  2JUO A;  1XEE A;  4ACF A;  4AS1 A;  3ZRC A;  3RNG C;  2DBY A;  3ALB A;  3VTU A;  2MH7 A;  1UWX A;  2QC8 A;  3L4P A;  2BKF A;  3AE9 B;  4F8C B;  1XLN A;  1KLG D;  3X23 A;  4RGM A;  1FD6 A;  2CHZ A;  2ZVO A;  4XYC A;  2M19 A;  1OQY A;  4MGY E;  3EGR A;  1WIA A;  1ZP0 B;  3ABV B;  1JWS D;  1Q10 A;  4ZYN A;  3A9J B;  2PKO A;  3N9Y C;  2OJR A;  2ZW0 A;  1X1M A;  3VTV A;  1TKY A;  4JIO U;  2W55 A;  4DWF A;  3A4R A;  2JQR B;  4CQN A;  2QCZ A;  2JPH A;  4KVG B;  2FNJ B;  4PS3 A;  2WXJ A;  3Q8A A;  4Q2J A;  4RGO S;  3R7Q A;  2IGG A;  3OAW A;  1WXM A;  2CHW A;  5JZE B;  3ECI A;  3U30 A;  3NS8 A;  4LLG M;  2PE6 B;  3VQI A;  3P4S B;  1JWM D;  2KFK A;  2JSV X;  4J6I A;  1NVI D;  3N1X C;  4NY0 A;  4GDK A;  1AWD A;  4B95 A;  1DOX A;  1FNU A;  3U8Z A;  2J7Q B;  4GDK B;  1TZO A;  2K25 A;  5IAA C;  1UBQ A;  4RGT A;  2IGD A;  2R2O A;  4AJY B;  1WGK A;  2DHZ A;  4A90 A;  2BS2 B;  4A6Q A;  2KT7 A;  1WX8 A;  3AE7 B;  5FK9 C;  2WXM A;  3KYC D;  2JZP A;  2J52 A;  3U7Z A;  2WDT B;  4WQM A;  1FCC C;  2KKC A;  1LXD A;  2GI9 A;  2WU2 B;  4KGT A;  4A55 A;  1E10 A;  2R61 A;  4K7W A;  4URK A;  2MSE D;  4E3C A;  4N9F 4;  1EF5 A;  1IYF A;  2IO1 B;  1XT9 B;  1YJJ A;  3AEE B;  2O6V D;  1Z2M A;  1FM0 D;  2DAJ A;  3PVL A;  2JVC A;  2LRW A;  4M8N A;  2FBW B;  4KIK B;  2KLG A;  4I6P A;  2O6V B;  4A20 A;  2KMC A;  2GOW A;  2BS4 B;  3B2G A;  4WAF A;  2C9W B;  3FC4 A;  3FIL B;  4E74 A;  2PE9 A;  2X8X X;  3ZJT A;  3NUH B;  3NOB A;  4HK2 A;  1EO6 A;  2IGH A;  4NAW A;  2D3G A;  1ZDV A;  5HI1 A;  2KD0 A;  2PTL A;  1NYQ A;  1C4C A;  3TCA A;  2ZEQ A;  3ZVV A;  2KZR A;  2CR5 A;  3IAS 1;  4EUT A;  1TTN A;  2XNA C;  2CU1 A;  5DPW A;  1QOB A;  2L0T A;  3DVN U;  2IO0 B;  5C23 A;  2AQ1 B;  4JE3 B;  4XDD A;  4F7Z A;  1WWT A;  5LXH A;  1GUA B;  3W1S A;  1P0R A;  4C4V B;  5DCN A;  2VZK B;  4DBG A;  3GZN B;  3ZNH B;  4IM2 A;  4LNI A;  2N1V A;  3ZRF A;  3H6N A;  3SD5 A;  2ZZP B;  3GB1 A;  2DZI A;  4S17 A;  2M56 B;  1TY0 A;  1R4M B;  2KOX A;  3PZ7 A;  4CO7 A;  3H7S A;  1VZ6 A;  2JY6 A;  1FCL A;  3DVN V;  4ZRP A;  3B9J A;  2WXK A;  4IWQ A;  4ZRQ A;  1J7C A;  3NRZ A;  1TY2 A;  3BY4 B;  2HTM E;  2V9H A;  1IBX B;  1TZ1 A;  4FBJ B;  2INC C;  4GSW A;  3Q8B A;  5LXI B;  4KDI C;  1WY8 A;  2L52 A;  4WJN A;  3ZJV A;  1CZP A;  2MP2 B;  5D3D A;  1YMH E;  1Q5W B;  2N9L A;  2ZPN A;  2FIF A;  4NAM A;  3EHV A;  1F0Z A;  3RZW C;  1FMA D;  1BT0 A;  2RGF A;  2SAK A;  3AE6 B;  2KWD A;  3MP9 A;  5JH5 C;  1QIL A;  3VHT C;  5T8I A;  5AZH A;  3TEX A;  2RDB C;  3TEW A;  3I3T B;  5DPR A;  4KZC A;  2M8S A;  3JSV B;  1ESF A;  4IOI E;  3C19 A;  4TUU A;  2QJL A;  5HG2 A;  1RLF A;  3P2B A;  4DDG D;  2VH2 A;  4ASW C;  1JRU A;  1GG3 A;  2NBV B;  1V8C A;  2C7H A;  4ZHP A;  1HTO A;  2N7J A;  5AEK B;  3JYU A;  2N1W A;  4PT5 A;  5EDS A;  2LI5 A;  1ZE3 D;  2IND C;  4OZA A;  4KX6 B;  2KDE B;  4LNK A;  3ZNI D;  2WDQ B;  2N9P C;  1ROE A;  1LQB A;  1FEH A;  1ZGU B;  1LO5 D;  5CTR C;  5G55 A;  2IYD B;  4DK5 A;  1WJ4 A;  3VAW A;  1P98 A;  1NBF C;  4L2Y A;  4PK1 A;  3RCZ A;  3WAL A;  4C56 C;  1V49 A;  2NCN A;  2Y5C A;  3M3J A;  2LGI A;  2KDM A;  1WJN A;  1WJU A;  3BVZ A;  2HD5 B;  2L83 A;  3VR8 B;  1Y8R C;  2W54 A;  3PRZ A;  1SE3 A;  2GB1 A;  1J8C A;  2BW2 A;  4LNO A;  5G2N A;  2IPK D;  3AEB B;  2Q5W D;  5J17 A;  4W9I A;  3L16 A;  2BQQ A;  3WIM A;  1TS4 A;  3VH3 B;  3UQA A;  5CHV C;  2KLC A;  2WXR A;  2EMS A;  1YN3 A;  1PFD A;  2AL6 A;  1VD2 A;  4GMV A;  1YX5 B;  1JWB D;  1L0V B;  3E56 A;  2CHX A;  1BXT A;  1HTQ A;  2EMT A;  5AZF A;  3IG3 A;  1TGZ B;  1JWA D;  1WX7 A;  3T9L A;  3UIO B;  3RFZ B;  3L17 A;  4OVU A;  4IWP A;  1AN8 A;  3GE8 C;  5FKA C;  5EE1 A;  2VRR B;  2K5P A;  4EOY A;  4ICU A;  1XLO A;  3AE1 B;  3GOE A;  3I9V 1;  1GOZ A;  2GMI C;  4MT5 A;  2G4D B;  2INN E;  2BWF A;  3EEC A;  2HJ1 A;  2G45 B;  2KWV B;  2M4N A;  3TUO A;  2LEK A;  2L00 B;  4FUL A;  1R7S A;  2JRI B;  2D07 B;  2L3Z A;  2N9X A;  1QT9 A;  1L2N A;  1H4R A;  3SU8 X;  3T3O A;  2ON8 A;  4WH4 A;  4C7Y A;  3QHT A;  3NY5 A;  4K7U A;  1Q1O A;  3RT3 B;  4R3D A;  2WXG A;  4MJS A;  4NZL B;  3H9D A;  3LJ3 A;  5EE0 A;  1K51 A;  2Y5P A;  4RM8 A;  4EFO A;  2OJW A;  4YSZ B;  2KMM A;  1H8C A;  3P63 A;  1WGG A;  2UU7 A;  3VXW A;  2BT6 A;  4FJV B;  5H92 C;  2MLB A;  4G3X B;  3AEF B;  4BKG A;  3VRA B;  4W9D A;  4BBN C;  4HJG E;  1V1P A;  4BZA A;  3ZXR A;  3CST A;  2WXF A;  4NNJ B;  1I7H A;  1I4H A;  3KW5 B;  3KLS X;  1D5M C;  1ZOY B;  2LXC A;  1IP9 A;  1M4V A;  3NS1 A;  3BK1 A;  3C0R B;  2BVC A;  3PHX B;  2Z59 B;  4OHJ A;  4WWM A;  4MGK E;  3MJ5 A;  1WE6 A;  5BYS A;  3MC9 A;  1UZX B;  3RI7 C;  1BML C;  4PS7 A;  1T0R C;  2RMM A;  2L7R A;  2NTS A;  1ACC A;  3AMZ A;  1WX9 A;  1I4P A;  1EU4 A;  1WH3 A;  1P7F A;  1OQQ A;  1NEK B;  2FE8 A;  3B08 A;  2KQS A;  1HE8 A;  1KF6 B;  2V4I B;  1FXI A;  3Q3J A;  1QKZ A;  1PQS A;  1N60 A;  1Y56 A;  4ANX A;  3L13 A;  1WZ3 A;  3EFU A;  1UGM A;  4DXA B;  1F52 A;  3HUI A;  1DGJ A;  3T3N A;  4HLE A;  2JWU A;  1L5P A;  4P6V F;  4EZK A;  4WUR A;  4UDU C;  5C1Z A;  3KWV A;  1KLU D;  4EE2 A;  1OGW A;  1SIJ A;  2X38 A;  3NHE B;  2PIA A;  3Q6B A;  3W1Y A;  1WSP A;  3BVM A;  4YL8 A;  3RYT A;  1MI0 A;  4FXC A;  3W5V B;  1KLV A;  1L0X B;  3QX1 A;  2BYF A;  2JZ3 B;  4YTP B;  1NDD A;  3OJ3 A;  3VRB B;  4FA6 A;  2K9X A;  4KKJ A;  2G3Q B;  3GP7 A;  4BKT A;  1SSN A;  1J7B A;  3H7P A;  2CJN A;  1JRO A;  4MAC A;  5G5G A;  1QLB B;  2LVQ A;  2MWS B;  1F2R I;  3Q3O C;  3QJZ A;  3LYY A;  1TT5 B;  1WE7 A;  4AUQ C;  1WXQ A;  1AAR A;  5FR3 A;  2KWU B;  1ZPS A;  2LAS A;  3DBH B;  1P7E A;  4LJP B;  2YEP F;  4RCO A;  4ANU A;  1R4N B;  4E71 A;  2D2Q A;  2PLP A;  4B6W A;  1L4Z B;  1YJ1 A;  2RD0 A;  1NI3 A;  3AED B;  5DPT A;  1MVK A;  2KQ7 A;  3RNB C;  1J19 A;  4DXG A;  2G4S A;  3SEB A;  4JL9 A;  2C7N B;  4GDL B;  2KX3 A;  1WM2 A;  3NVZ A;  3B2F A;  2LGS A;  4LNF A;  3AE8 B;  2PVO D;  1NI2 A;  1SJE D;  2N7E A;  2PVG C;  4WWN A;  4II2 B;  1V1O A;  3Q2A C;  2M1M A;  1MJD A;  1XLQ A;  3LB8 C;  4LDT B;  4HVB A;  3DWG C;  1V97 A;  4KGR A;  3R2I A;  4HXD A;  2WXQ A;  4K3B A;  2EKI A;  2GBR A;  2AQ3 B;  1R4N I;  4GB9 A;  3GE3 C;  5IKC M;  3Q3F A;  4C7Z A;  5C2T B;  1WZ0 A;  2LGD A;  3AUL A;  4OZC A;  1XXG A;  1IBX A;  1QOA A;  2B3A A;  1E90 A;  3R8B A;  3L54 A;  2L76 A;  1WRD B;  2D11 A;  3V6C B;  4O1N A;  5HHD G;  2FCQ A;  2MJE A;  3U2S C;  3IT4 B;  5GXG B;  1UEL A;  2BS3 B;  4M8M A;  2Y3A A;  3AH7 A;  3DHI C;  1TS5 A;  4HKZ E;  4ZRI A;  2CS4 A;  1GJZ A;  2NPT A;  1XD3 B;  1WJ6 A;  1E7P B;  2WXN A;  3URY A;  2ZCB A;  2D10 A;  5IOI A;  5JXV A;  2LRU A;  3MTN B;  2KC1 A;  3EC8 A;  2PPH A;  4M0W B;  4XGA B;  3ZJU A;  2WLB A;  1I4Q A;  4KDL B;  2BB6 A;  1T0Y A;  1KOT A;  4N58 A;  3EFC A;  2ZVN A;  3APF A;  2NS5 A;  5D3I B;  4NQL B;  1GC7 A;  4KIK A;  5E6J A;  4TKN A;  1HZ5 A;  2JZZ A;  2LD9 A;  2O6V A;  4K81 A;  1C9F A;  2WHI A;  2NVU I;  3B1L X;  1G6J A;  5HKH A;  1WMH B;  1WR1 A;  2INP E;  1DOY A;  4M02 A;  2AEH A;  3PRP B;  2BKR B;  4PYU A;  1E8Y A;  4EKU A;  3PPA A;  2QIE B;  3UIN B;  1WGY A;  3ML8 A;  2H89 B;  2N9E B;  1B1Z A;  2RPQ A;  1KRH A;  5IP4 D;  2LGX A;  1MFW A;  1EWY C;  1XLP A;  2WXL A;  3PLU A;  1MHX A;  1TYG B;  3ZNG C;  4US9 A;  3M63 B;  4FN2 A;  3Q14 C;  4NJC A;  1PYW D;  4G11 A;  2WQY B;  1ET9 A;  4HPP A;  2JXT A;  1RM6 C;  2XK5 B;  3VUW A;  3V62 A;  2KO3 A;  1SXT A;  2WNM A;  4JPS A;  2FCN A;  3RPF C;  4LTU A;  3AB5 A;  1FRD A;  3U4E G;  3BZD B;  4MGZ E;  1VRA B;  1JML A;  2QMT A;  1I4G A;  1LGR A;  1KJT A;  3C8Y A;  1DYQ A;  4JWS C;  3N3K B;  1S1Q B;  1NYR A;  1QOF A;  1FIQ A;  3Q8C A;  2I2Y A;  4X57 B;  5KHQ A;  4RH6 A;  2KAN A;  1OTR B;  2K22 A;  2K8H A;  1WI0 A;  3P4R B;  4GGQ A;  4WJP A;  1PGA A;  5IN7 A;  4LDT D;  2DNF A;  5E6P A;  2V3P A;  3RZF A;  2LWP A;  2WGS A;  2DZJ A;  3H1U A;  4CYE A;  4W9K A;  3DDC B;  3NJT A;  2ZPY A;  3ZTC A;  3QAR A;  3A9J A;  1T6B X;  1UD7 A;  4HKQ A;  4M0W A;  3RUL A;  1M94 A;  1N5X A;  3MJW A;  1EM7 A;  4ARI A;  1N6Z A;  4A3P A;  4HDO A;  2WDR B;  2FUG 1;  1ZXH A;  3DBL I;  2H88 B;  2JRH A;  1HA5 A;  3H7P B;  1RYJ A;  2ZNV B;  3PLV A;  1AW7 A;  3DBR B;  1MHH E;  2J0J A;  1FFU A;  4MH8 A;  1WXS A;  4DDI D;  3O65 B;  2L8J A;  4AOF A;  2WDV B;  3RNA C;  1TS3 A;  4PYZ A;  3KYD D;  2D3C A;  1DOI A;  1FNW A;  3KUD B;  4YSX B;  4LNN A;  1Z5S B;  3A4S C;  2ICI A;  1QQR A;  3AEA B;  3CWI A;  2YVC A;  3DWM A;  1ET6 A;  1J0G A;  2VZK D;  4GU2 A;  3V60 A;  3MHZ A;  3DBR I;  1F1H A;  2JT4 B;  3QA8 A;  4RGN A;  3DQV A;  3ZGZ A;  3ZIM A;  3Q69 A;  2WU5 B;  4BFR A;  3K9P B;  3BYY B;  2OED A;  2W9N A;  2JU6 X;  3R66 C;  4P16 A;  3HVD A;  1E8Z A;  3LDZ E;  1VZ8 A;  2XN9 C;  3TEZ A;  2AWT A;  4KGS A;  3DVG X;  1A70 A;  3WAM A;  4L23 A;  1D3Z A;  2KJR A;  2Y5B B;  4W9G A;  2JXX A;  2QEJ C;  3P4Q B;  1KH0 A;  1SE2 A;  2GBN A;  4JQW C;  3PS6 A;  1YOV B;  1EF1 A;  2DAF A;  4MJS B;  1E8X A;  5D94 A;  1PGB A;  2N9K A;  3EA6 A;  3OWE B;  2O2V A;  2FUH B;  2MW5 A;  5CX3 A;  4GDL A;  3RMK C;  3RD2 A;  4RNA A;  1WGR A;  4HRS A;  1T0Q C;  2LGY A;  1XQQ A;  4US8 A;  2BWE S;  5MPO A;  3QQ8 B;  1F2R C;  2DYM A;  2WP9 B;  1YQ4 B;  2J0K A;  2KDF B;  1ZKH A;  1WR6 E;  5BYQ A;  3PT2 B;  4BVU C;  2ZCC A;  1CMX B;  3RNF C;  1GAQ B;  3QC8 B;  5G5H A;  2J0M A;  3D32 A;  3Q3M C;  2SEB D;  1GPX A;  2MBB B;  4GN1 A;  2FID A;  2KWC A;  4ITK A;  2J53 A;  2NPT B;  4DHJ D;  3NZS A;  5E6O A;  2AL3 A;  1GC6 A;  4DQO C;  1V80 A;  3WA0 A;  3IFW B;  2BB5 A;  4MEM A;  2K39 A;  1I35 A;  4OVV A;  4WWO A;  1FXT B;  2G1E A;  4DHJ B;  3AE4 B;  3V61 A;  1L0Y B;  3HM6 X;  4FHK A;  3PRE A;  2ACZ B;  1JWU D; 
#chains in the Genus database with same CATH homology
 1J7A A;  2YEP F;  4RCO A;  1D4B A;  2MJ3 A;  3CIR B;  4XWT A;  3AN1 A;  2BS4 B;  1SJH D;  2PLP A;  3B2G A;  4WAF A;  3KQ4 A;  2YEP B;  3E9S A;  3SFE B;  4XDC A;  2RDH A;  3FC4 A;  1L4Z B;  2W82 A;  3FIL B;  2LFI A;  1NI3 A;  3AED B;  3NUH B;  3ZJT A;  3PZ8 A;  1HZ6 A;  2OHF A;  1MVK A;  2IGH A;  1ZXI A;  1VDV A;  2KN4 A;  4HEA 1;  3ETR A;  1TKE A;  1WYG A;  1ZDV A;  2WXH A;  5HI1 A;  2CU3 A;  2PTL A;  4ZYS A;  2N0S B;  4WIP A;  2WXI A;  3W5U B;  1IGC A;  1NYQ A;  1C4C A;  4DXG A;  2J4X A;  1GB4 A;  3R2T A;  3SEB A;  4GDL B;  3IAS 1;  3NVZ A;  3B2F A;  4XE0 A;  2NMQ A;  2XNA C;  2MEK A;  4XWW A;  5AUK A;  2W3R A;  1QOB A;  2RDG A;  3AE8 B;  2PVO D;  1CJE A;  4YXD B;  1SJE D;  1OQR A;  3AV8 A;  2JX5 A;  1K53 A;  2PVG C;  1V1O A;  5C3J B;  2AQ1 B;  4JE3 B;  2L32 A;  4XDD A;  1UWM A;  2RPV A;  1WWT A;  1XLQ A;  3LB8 C;  3W1S A;  3BYT B;  3H8H A;  2VZK B;  3KWL A;  4YT0 B;  3DWG C;  1V97 A;  1WRI A;  1HXY D;  3P4P B;  4KGR A;  1XO3 A;  3R2I A;  2QSD A;  4RF0 A;  3BVG A;  4C80 A;  2WXQ A;  1YJI A;  3TEY A;  3GB1 A;  1YN5 A;  2EKI A;  3IT6 B;  2M56 B;  1TY0 A;  2AQ3 B;  3PZ7 A;  1VZ7 A;  3MC0 B;  4C7Z A;  5C2T B;  1VZ6 A;  3V3X A;  1FCL A;  1T3Q A;  4ZRP A;  1MPE A;  3B9J A;  1L4D B;  1JRP A;  2WXK A;  4OZC A;  3NVV A;  1XXG A;  1GB1 A;  1IBX A;  4ZRQ A;  5I4D A;  1J7C A;  1SEB D;  1FRR A;  1QOA A;  3NRZ A;  2BYT A;  4JX1 C;  1TY2 A;  3R8B A;  4USA A;  1V1P B;  2HTM E;  1IBX B;  1KFY B;  1D6E C;  1B9R A;  4O1N A;  2ZW1 A;  3Q8B A;  2KAC A;  5HHD G;  1SB3 C;  2MJE A;  2L52 A;  3U2S C;  3ZJV A;  3IT4 B;  1CZP A;  2LUM A;  5GXG B;  2BS3 B;  2PW9 A;  5D3D A;  1YMH E;  2DWQ A;  2N9L A;  4NAM A;  2K3U A;  1F0Z A;  2NTT A;  1SBB B;  2Y3A A;  3AH7 A;  1FMA D;  1TS5 A;  4HKZ E;  2SAK A;  3AE6 B;  2KWD A;  1K50 A;  3MP9 A;  1D5X C;  1QIL A;  1N61 A;  5BMG A;  1E7P B;  2WXN A;  3URY A;  5JXV A;  5T8I A;  1QOG A;  3TEX A;  3TEW A;  2JYT A;  2ONQ A;  1ESF A;  4J3O D;  2WLB A;  3ZJU A;  1PGX A;  1I4Q A;  4IOI E;  2EEL A;  2BB6 A;  2QJL A;  3BK2 A;  5HG2 A;  4ARC A;  3LXF A;  4N58 A;  1ZUD 2;  1C76 A;  1V8C A;  5D3I B;  4ZHP A;  2N7J A;  1EWC A;  2QIL A;  1AYF A;  1QF6 A;  4PT5 A;  5E6J A;  2L1A A;  4OZB A;  1HZ5 A;  3HVZ A;  4AQ7 A;  2J42 A;  1ZE3 D;  4OZA A;  1I4R A;  1C9F A;  4KX6 B;  3FAH A;  2V3N A;  2WDQ B;  1HEZ E;  1ROE A;  1FEH A;  4B0E A;  2IJ0 A;  1LO5 D;  2B76 B;  1C78 A;  3ZYY X;  2INP E;  1T5X D;  1DOY A;  1HQR D;  5EE3 A;  2D5G A;  3AEG B;  4L2Y A;  1E0Z A;  3HRD D;  1ZDX A;  1C79 A;  2BBC A;  1L6U A;  3ZQ4 A;  2QIE B;  1FO4 A;  1JW9 D;  4C56 C;  2Y5C A;  4ZOH C;  2H89 B;  1TKG A;  2LGI A;  4MM3 B;  1XCQ L;  1B1Z A;  1EU3 A;  1KRH A;  2KDM A;  3PO0 A;  5H8Y E;  3BVZ A;  4KKI A;  2L83 A;  3VR8 B;  1EWY C;  1XLP A;  2WXL A;  1MHX A;  1TYG B;  4LK0 M;  4US9 A;  2W54 A;  1SE3 A;  1RWS A;  1SE4 A;  2GB1 A;  4NJC A;  2G9H D;  1PYW D;  2WQY B;  1FNV A;  2BW2 A;  2LMC A;  4OW0 A;  1JQ4 A;  1ET9 A;  4N59 A;  2E3T A;  2IPK D;  3AE2 B;  4L1B A;  2JXT A;  1RM6 C;  1C4P A;  3AEB B;  4JWU C;  4YWG G;  2Q5W D;  2I38 A;  2WNM A;  1SXT A;  4JPS A;  1XCT L;  3RPF C;  4LTU A;  3AB5 A;  4RFB A;  1FRD A;  3U4E G;  3NVW A;  1TS4 A;  1I4X A;  4GLS C;  1C77 A;  2E6X A;  3BZD B;  4YTN B;  2WXR A;  5EE9 A;  1C4A A;  1JML A;  1VRA B;  2QMT A;  1YN3 A;  1I4G A;  1NEN B;  1D5Z C;  1PFD A;  4DXF A;  1IGD A;  4A9A A;  3C8Y A;  1DYQ A;  4JWS C;  1JWB D;  1L0V B;  3E56 A;  1NYR A;  2DLB A;  3O13 A;  1BXT A;  2DYO A;  2M0A A;  3BII D;  1QOF A;  1FIQ A;  1UUP A;  3Q8C A;  2I2Y A;  1JWA D;  5BYR A;  4IDI A;  2LHE A;  1BUI C;  4RH6 A;  3TSS A;  2KQ4 X;  3RFZ B;  2K22 A;  4ZHO A;  1STE A;  1AN8 A;  5FKA C;  3P4R B;  5EE1 A;  1YN4 A;  1PGA A;  4REZ A;  1JAL A;  1OFF A;  3AEC B;  2PMV A;  2K5P A;  1FFV A;  3BWU D;  2K0P A;  3P1M A;  1XLO A;  2V3P A;  2HDE A;  3AE1 B;  3VR9 B;  3I9V 1;  1GOZ A;  4MT5 A;  1L6V A;  2INN E;  1RFK A;  3AE3 B;  3Q8F A;  3W9C B;  3W2D A;  3J9C A;  1CK1 A;  4B0M A;  1PDX A;  1VLB A;  3TUO A;  1N5W A;  2LEK A;  4TSS A;  1T6B X;  3P42 A;  1R7S A;  4HKQ A;  4M0W A;  1N5X A;  1QT9 A;  4N6E B;  1EM7 A;  4ARI A;  3T3O A;  2ON8 A;  4WH4 A;  1E9M A;  2MJD A;  4C7Y A;  4TMA B;  2WDR B;  2V0G A;  4TQ0 A;  5TSS A;  4HRO A;  1N63 A;  2FUG 1;  1XEE A;  1ZXH A;  4R3D A;  2WXG A;  4NZL B;  3U52 E;  5D7G A;  4AS1 A;  2H88 B;  2AX5 A;  2WS3 B;  1HA5 A;  2DBY A;  1K51 A;  1RYJ A;  2Y5P A;  5EE0 A;  4YSZ B;  2KMM A;  3P63 A;  2MH7 A;  1AW7 A;  1UWX A;  3IXS A;  1MHH E;  3L4P A;  4H2A A;  1FFU A;  4MH8 A;  3AE9 B;  1YNT E;  2IDY A;  2BT6 A;  1F77 A;  2KAJ A;  2WDV B;  5H92 C;  1XLN A;  3AEF B;  1KLG D;  1TS3 A;  4RGM A;  3VRA B;  1DOI A;  1FD6 A;  3SR6 A;  2W3S A;  3MFG A;  1N62 A;  2JYE A;  1FNW A;  4HJG E;  4IKG A;  4YSX B;  2M19 A;  1KTK A;  3WCQ A;  1V1P A;  1CQV A;  3EGR A;  2ICI A;  1ZP0 B;  3ABV B;  4RF1 A;  1QQR A;  3AEA B;  1PUT A;  3CWI A;  2WXF A;  1I7H A;  1XF5 L;  3DWM A;  1I4H A;  1ET6 A;  1JWS D;  3KLS X;  1Q10 A;  2PKO A;  1D5M C;  1ZOY B;  2VZK D;  3N9Y C;  1M4V A;  3MHZ A;  3NS1 A;  4OVZ A;  2ZW0 A;  3BK1 A;  2AQ2 B;  1FXA A;  4RGN A;  3ZGZ A;  4OHJ A;  1TKY A;  4WWM A;  2W55 A;  3EUB 2;  3Q69 A;  2WU5 B;  5LNK 1;  2JQR B;  3MJ5 A;  4CQN A;  3BYY B;  2OED A;  5BYS A;  2JU6 X;  1BML C;  3AE5 B;  4P16 A;  3NVY A;  3HVD A;  2RMM A;  2WXJ A;  3Q8A A;  4A8X C;  1VZ8 A;  2XN9 C;  3TEZ A;  4Q2J A;  4KGS A;  4RGO S;  2LJI A;  1A70 A;  2NTS A;  1ACC A;  3AMZ A;  4NAW B;  2IGG A;  4TQ1 A;  1I4P A;  5AUI A;  1EU4 A;  4L23 A;  1P7F A;  1OQQ A;  2QEJ C;  3P4Q B;  1NEK B;  4LLG M;  2FE8 A;  1KH0 A;  1SE2 A;  2V4I B;  1KF6 B;  1FXI A;  3VQI A;  1JCK B;  1QKZ A;  3P4S B;  1JWM D;  2JSV X;  3FIL A;  1N60 A;  2BTE A;  4D2K A;  3SFD B;  1Y56 A;  1E6E B;  1NVI D;  1YQ3 B;  1PGB A;  2N9K A;  5BMH A;  2WXO A;  3EA6 A;  3NZ3 A;  3OWE B;  1AWD A;  3HUI A;  3UI3 A;  1DGJ A;  1DOX A;  1FNU A;  5BMI A;  3T3N A;  5HFY A;  2JWU A;  1UNS A;  4RNA A;  1L5P A;  4HRS A;  2LHD A;  4GDK B;  1TZO A;  4P6V F;  4US8 A;  4WUR A;  1SF0 A;  4UDU C;  5MPO A;  3KWV A;  1VJK A;  2IGD A;  1F2R C;  2DYM A;  1KLU D;  4RGT A;  2WP9 B;  4EE2 A;  1WGK A;  1SIJ A;  2X38 A;  2PIA A;  4A90 A;  3V05 A;  2BS2 B;  4A6Q A;  3I57 A;  1WSP A;  1ENF A;  1YQ4 B;  3BVM A;  1MI0 A;  4FXC A;  3W5V B;  3AE7 B;  2TSS A;  2WXM A;  3GS2 A;  3IAM 1;  5FK9 C;  1L0X B;  5BYQ A;  2JZP A;  2J52 A;  1IUE A;  3U7Z A;  4YTP B;  4YTM B;  3VRB B;  2Z8L A;  1GAQ B;  5G5H A;  2K9X A;  4KKJ A;  3AM9 A;  3GP7 A;  1VR9 A;  2SEB D;  4WQM A;  1SSN A;  1GPX A;  1FCC C;  2CJO A;  2GI9 A;  1J7B A;  2WU2 B;  4KGT A;  4A55 A;  1E10 A;  2CJN A;  2R61 A;  1K52 A;  4ITK A;  1JRO A;  2J53 A;  4MAC A;  5G5G A;  2GRI A;  1QLB B;  1F2R I;  2WXP A;  1UGJ A;  1TS2 A;  4DQO C;  3LYY A;  2BB5 A;  1YJJ A;  3AEE B;  1WXQ A;  1FM0 D;  5FR3 A;  2G1E A;  3AE4 B;  3Q8E A;  4YSY B;  1ZPS A;  2FBW B;  1TJE A;  1L0Y B;  2ACZ B;  1P7E A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...