4D2KA

Crystal structure of drep2 cide domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'RGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DREP2
publication title CIDE domains form functionally important higher-order assemblies for DNA fragmentation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Apoptosis
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4d2kA00
3GB1A 1YNTE 1IGDA 4IOIE 3MP9A 1FCCC 1K50A 2ZW1A 2IGDA 2NMQA 2RPVA 1MI0A 1MPEA 4KGRA 2PW9A 2JWUA 4OZBA 2ON8A 2IGGA 3UI3A 1ZXHA 1F2RI 4GLSC 1IBXB 1UWXA 2N9KA 1GB1A 2ONQA 5BMHA 2KWDA 4OZAA 2OEDA 1Q10A 5JXVA 4HJGE 2N9LA 3FILB 1XCTL 1XF5L 4D2KA 1C9FA 2EELA 2QMTA 1FD6A 1MHHE 1EM7A 1PGAA 5BMGA 4WH4A 2QSDA 2I2YA 1K52A 1P7EA 2ZW0A 3V3XA 2IGHA 2LHDA 2J53A 1FCLA 2N7JA 2PTLA 1MHXA 2K0PA 2LGIA 2PLPA 4OZCA 1K51A 4MACA 1D4BA 5HG2A 1P7FA 1HZ6A 2KDMA 4KGSA 2KN4A 2JU6X 2JXTA 2KQ4X 1XCQL 4IKGA 2GB1A 2KACA 2I38A 2JZPA 2LHEA 1QKZA 2J52A 1IGCA 1PGXA 1MVKA 1KH0A 1YMHE 1IBXA 2GI9A 1HZ5A 2RMMA 5BMIA 2JSVX 4HKZE 2LUMA 5HI1A 3FILA 1K53A 1HEZE 5HFYA 4KGTA 1GB4A 1JMLA 5HHDG 1F2RC 1PGBA
chains in the Genus database with same CATH superfamily
1V5TA 3R8BA 1B9RA 5E6OA 4CO7A 5H8YE 1WGGA 1RRBA 1J7BA 3M63B 5AEKB 3RN9C 4CYEA 1VLBA 4NAWB 2WU5B 1V86A 4M00A 4HWIB 3L54A 3R3MA 2ON8A 3ML8A 4YTPB 5E6PA 3AE5B 4ICUA 1YN5A 4HDQA 2V4LA 2N7DA 2V9HA 3BK2A 3ZNHB 4D2KA 5C2TB 4WJOA 3SFEB 2G9HD 1EO6A 1YQ3B 1E7VA 4KZCA 5EE3A 1VD2A 4IM3A 5DPRA 2IDYA 2K5PA 2LGDA 2LVPA 4RCOA 5AUIA 2ZJDA 4AUQC 2ACZB 3H6NA 2PTLA 2IY1B 1P3QU 3R2TA 2HJ8A 2PIAA 4GDKB 4MEMA 4TMAB 4DHZE 2KQ4X 3P42A 2FBWB 2WXKA 3E56A 3ZYYX 1PYWD 3PV1A 4TQ1A 3WALA 1QILA 4W9IA 3VTWA 1QT9A 3H7SA 4GDLB 3L0WB 3NVYA 2L32A 4E71A 1L0XB 5DPSA 2J42A 4FJZA 3NY5A 3I3TB 4KGTA 4K7UA 4XWWA 2C60A 4NAMA 2IO0B 2IO2B 1Q5WB 4I6PA 1VDVA 4YTNB 1C4AA 1MPEA 4W9LA 4WWPA 2WX0A 1SGHA 1SBBB 2M19A 3TUOA 4XZ4A 5JZEB 2ASQA 3MJWA 2OJWA 2PKOA 2J0JA 4XE0A 1IP9A 2ZNVB 2K3UA 1F2RI 2DAJA 3VTUA 5BMHA 4WAAA 2IZVB 4MELA 3AE1B 3KWVA 4JGHB 1NI3A 5GMVA 3NVWA 4LDTD 5JXVA 5BYSA 2N9LA 3FILB 1WRIA 1WH3A 2DAFA 2EELA 2AWTA 2BYFA 4EE2A 4B0MA 2VH2A 3UIOB 3C0RB 1H4RA 2IGHA 1V6EA 4FHJA 1PUTA 3TEXA 3X23A 3AH7A 1TIFA 1NYQA 1R4NI 1TYGB 1I4HA 2KQ7A 2PJHA 4K7WA 3AI5A 2O6VA 3LXFA 2KTFA 2MW5A 1QZEA 1WGHA 4BKGA 4LNKA 3L13A 1EU3A 4MGYE 2KDMA 2KN4A 2G4DB 2WU2B 3PVLA 3TMPB 2KWCA 2CJOA 2FIDA 1PFDA 4TKNA 2WQYB 3QIJA 4GGQA 3EUB2 1N62A 1UBIA 4LJOB 1C4PA 2N0SB 1KH0A 4XYCA 1E8WA 4NZLB 1WSPA 1EF5A 2W54A 1VCBA 3QAQA 4HKZE 2IO3B 2UU7A 4BFRA 4WWMA 2WXMA 4W9DA 2WXRA 2YLMA 4RH6A 4L1BA 1DOYA 3IVFA 3MP9A 5DPWA 1SE2A 1WXMA 3ABVB 1TKGA 3QJZA 4EZLA 1OEYA 4J3OD 2LWPA 2A5UA 4B9KA 1FPYA 4S0RA 1DGJA 4JQWC 4IM0A 1ZKHA 2L05A 3PPAA 4HJKA 3V60A 4MM3A 5E6JA 2MBBB 1U4AA 1TZOA 3SD5A 2RR9A 4DK5A 5BO4B 1C4CA 2JRHA 1TTNA 4DHZB 4C4VB 1JQ4A 2GBNA 1ZW7A 1T0RC 3BK1A 1TS3A 3T9LA 3A4SC 4WJQA 1C77A 4MGIE 2VZKD 4DXAB 1C76A 1TZ1A 4MGZE 4M01A 2LRUA 1E0ZA 1FCLA 4G0NB 4YT0B 1WXVA 3UGBB 4YSZB 2D3CA 3IAS1 2V3PA 3N32A 3W9CB 5J2RA 4WJNA 4M8MA 3RPFC 4L2YA 3S2AA 4P1CC 3TSSA 5CHVC 4JIOU 5I4DA 3N20C 3PS6A 4ZRIA 3ZTCA 1FNVA 3KYDD 2KYWA 3BWUD 1VR9A 4NY0A 5L95C 2KJHB 4RM8A 1WJUA 1ZGUB 5BMIA 3ZDTA 2ZPNA 1UD7A 3GZNI 3AU4A 1YOVB 1WXSA 2BB5A 1YJIA 1YX6B 1R4MB 3HVDA 3HM6X 1WJ6A 4IW0A 2C7MB 2NPTA 4MDKE 2BBCA 4JWSC 4L23A 1IUEA 1KTKA 1TGZB 3CF6E 3LB8C 5CX3A 3OWEB 3PRPB 3DVGX 3JYUA 1E8ZA 4W9KA 2IO1B 4A55A 3IXSA 3N30A 3L4PA 2ZCCA 4N59A 2SEBD 4A8XC 2IGGA 1Z2MA 3P2BA 4II3B 2ICIA 3P1MA 1SSNA 3L16A 4RGOS 4MSMB 4O1NA 4PT5A 4JWUC 1RWSA 2EKIA 4DXGA 1IYFA 1L0VB 4R3DA 3VR8B 4YXDB 4KDLB 4XC2A 2CR5A 1ZDXA 2MA9B 1WGRA 3P63A 2G4SA 4WH4A 3MC9A 3R7RA 2G45B 2WDVB 4EZKA 5FK9C 2GBJA 5L83A 1WY8A 2KO3A 4ASWC 1ZP0B 5JHAA 2N7JA 4KDIC 1OQQA 2LGIA 3CIRB 3DDCB 3GP7A 4OVZA 1FFVA 3DPDA 3U7ZA 2MBOA 1QLBB 1R4MI 4IKGA 2C5LC 5D3IB 2BB6A 1LXDA 3I9V1 4ZRKA 2N4FA 3JSVA 3UF8A 1STEA 3AU5A 4RGTA 2IBIB 3GE8C 4DDGD 4P7IA 2KT7A 1KJTA 4P6VF 2HDEA 1LQBA 1SE4A 4K1RB 5D6JB 1WRDB 5C1ZA 3VR9B 2W82A 2WHIA 2WX1A 1GB4A 4ZRPA 5LXHA 4GMVA 1SIJA 2W3RA 1PGBA 4NJCA 2VRRB 1TT5B 3AE7B 2MCNB 4ZOHC 2BS2B 3RI7C 1IGDA 4W9CA 3RFZB 3DOWA 3OJ3A 2R2QA 1L7YA 3NHEB 3ZNZB 2IGDA 2RPVA 2D3BA 5IP4D 4LNOA 5AZGA 1ZUD2 3CWIA 4REZA 4H2AA 1A70A 1EF1A 1UELA 5FKAC 3VFKA 4LLGM 1UGJA 3BYTB 1DOIA 2D11A 3AE9B 2WDTB 3A4RA 2BKFA 4US8A 3EFCA 2N1WA 1CMXB 3KUCB 3KYCD 4ZRQA 2N9KA 2PMVA 1WYWB 1WWTA 3ZJVA 2JYEA 4PS8A 3MHZA 3NUHB 2MQJA 1T3QA 1L4ZB 3PO0A 1YQBA 5IO9A 3T3OA 1WFYA 3N1YC 2BYEA 5BMGA 4OVVA 2CHZA 4DXFA 1HXYD 4K3CA 4C00A 1UH6A 3BY4B 1WM2A 2LHDA 1P9DU 1NENB 3J9CA 5BYRA 4IM2A 5DCNA 3EGRA 1F9JA 1KLVA 2KLCA 1P7FA 1XT9B 3VAWA 1V1PA 1WJ4A 1HZ6A 2CU3A 2KZRA 2QILA 2DZKA 5KHQA 4TSSA 2AQ2B 4RMAA 1XO3A 1ZE3D 3M3JA 2LJIA 2MJEA 4AQ7A 2BYTA 4DDID 3EA6A 2FAZA 4GSWA 1JWAD 5JHBA 4PS3A 2MX2A 1BT0A 2W55A 2DLBA 3ZDMC 3URYA 2O6VB 5JH5C 1V80A 4LNNA 4IOIE 1FMAD 3AM9A 3T8MA 4B6WA 4BOZB 5AZHA 4WIPA 4ZDVA 3RNGC 4MJSA 3VHTC 2ZW1A 3D32A 1C79A 5EE1A 4LCDE 4CQNA 1JRPA 4HPPA 2BW2A 2NVUI 5EDSA 3DHGC 4IWPA 4LTUA 5C3JB 3ETRA 3H1UA 3EC8A 1UWXA 4B0EA 2HD5B 2OEDA 1I35A 4EUTA 2WGSA 4HJGE 2FCSA 4FHKA 5EE9A 1IPGA 1I4RA 1P7EA 4BAXA 1R7SA 2Y5CA 1NYRA 1BMLC 4LNFA 5EE0A 2FIFA 1GNUA 2INDC 2AL6A 2J0MA 2M56B 2SAKA 3GS2A 1CK1A 3MHSD 4FJVB 3AV8A 1T5XD 1KM7A 1GOZA 2IY0B 3NS1A 2GLSA 4MM3B 3NS8A 2QC8A 4A3PA 1YJ1A 4C7ZA 3AMZA 2KFKA 3B2FA 2K1FA 2EMTA 2W9NA 2QDFA 2RMMA 4NPNA 4PYZA 4OHJA 4DWFA 4EZJA 1LFDA 4YSYB 1WIAA 1NVID 2XN9C 1HEZE 2MWSB 2FNJB 3PHXB 3Q8BA 2L1AA 3DQVA 2BWFA 2BGFA 1JWSD 2JX5A 3RUIB 4K3BA 3VQIA 1YN3A 2K9XA 3ZLZA 3DWMA 3FC4A 2MHJA 3U30A 1KRHA 3AEEB 3E9SA 4MGKE 3U4EG 4ARIA 4KKIA 4URKA 4BOSC 3EFUA 3WANA 4WAFA 2QEJC 1KOTA 2R2OA 5IA7A 1L2NA 1N6ZA 2KANA 2GOWA 1PQSA 2MBQA 4A6QA 2INNE 2Q5WD 2Y3AA 2CKHB 3DBHB 1Q10A 3PGEA 3KH0A 1FD6A 1MHHE 1LGRA 3V6EB 3MFGA 1TKEA 3VH4B 1MFWA 2NPTB 1RM6C 2LZ6A 3Q8FA 2L0TA 1FO4A 2JVCA 2WXHA 3AEFB 3QX1A 1MHXA 3HM3A 2PLPA 4OZCA 3NZ3A 1EWCA 3ALBA 3N9YC 1AARA 4JPSA 2K25A 1L0YB 1SE9A 2YVCA 2PVOD 1SXTA 3Q3MC 4J6IA 1E9MA 3Q3OC 1WR6E 5G5GA 2NBUA 3N1XC 2KN5A 4JL9A 1Y8RC 2AQ3B 3NVZA 1WX8A 2E3TA 1JWUD 4IDIA 3UINB 2GI9A 2KD0A 5CHWA 4ANXA 2KC1A 1SB3C 2L00B 2R61A 1UWMA 2V1YA 1FNUA 1JMLA 4G3XB 3MC0B 3C8YA 5AUKA 1K8RB 2CS4A 2KAJA 4ANUA 3V6CB 3RNBC 3DVGY 1KLUD 3DBHI 1YX5B 1T0YA 3U2SC 1MI0A 3A9KA 2DENB 4NQLB 2CU1A 4DHJB 1LO5D 4KV2A 3R66C 4OW0A 3ZVVA 1QOAA 4A9AA 4CHKA 2O2VA 3JSVB 1RYJA 3RMKC 3H9DA 3NG0A 3Q6BA 3RNCC 3I57A 3ZUNA 3DBLB 4AJYB 1NEKB 1MG4A 1CJEA 1RFAA 4G11A 3FAHA 3B0AA 3ZIMA 4Q2JA 4HKQA 1ACCA 4US9A 3VTVA 4RF1A 3DBSA 2V0GA 1P1AA 1ET6A 2KDBA 3H8HA 3A1QA 3AEBB 1HA5A 1E6EB 3ZO5B 4FLHA 3PRZA 4EKUA 2FUHB 3TCAA 3T3NA 2XEWA 2K39A 2V3SA 3ZNGC 5D94A 3JVZX 1QQRA 4USAA 2KACA 1WXAA 3QCAA 2G1EA 2K6DB 1FFUA 4FXCA 1I4PA 1WZ3A 3OG5A 2WDQB 2INPE 4UDUC 3PLVA 4FADA 2KMMA 2LUMA 5D3DA 4GDKA 3HHMA 5KHOA 1V49A 3SHQA 2KVZA 2JWZA 1TBEA 2DHZA 3WA0A 1S3SG 2XNAC 1V5OA 1H8CA 2WYQA 2KOXA 1V1PB 5FR3A 2D10A 1GC6A 3DBLI 1J7AA 1FRRA 3PSEB 3AEDB 2C7NB 2WDRB 5G55A 3CMMB 3KUDB 4ITKA 4P1BC 3KQ4A 1KFYB 4OZBA 4C56C 4YTMB 3Q14C 4GN1A 3B2GA 2PVGC 3HUIA 2N9XA 4FJYA 2ONQA 3DBRB 2MP2A 5TR5A 4OZAA 3I5JC 1KF6B 2CHWA 3ZTDA 3MJ5A 3HRDD 1I4GA 1WE7A 1FRDA 1Y56A 2LEKA 2PPHA 1X1MA 4W9EA 2L3ZA 1VRAB 1K52A 1AWDA 4MJSB 5HKHA 2K8BA 2JXXA 1WF9A 3TEWA 2MJ3A 2GMIC 1JALA 3Q69A 3U8ZA 2KHWB 1E8XA 2EKEC 3RNAC 1GJZA 2PEAA 3HVZA 3W1YA 2JT4B 1N60A 2OOBB 2AX5A 2Z8LA 1ZPSA 4G50A 2I38A 2JZPA 3KWLA 3IT6B 2PE6B 1OQYA 3IT4B 5IKCM 2KVRA 2L0FA 3ECIA 3NZSA 2LXCA 4KSKC 2BQQA 2LASA 1JWMD 4XDDA 2LXAA 2VZKB 4HXDA 3NZUA 1ZXIA 4KX6B 1WMHA 2N7EA 2WXLA 3P4SB 5HHDG 2KJ6A 3BINA 3TIXA 1XLOA 4ZRJA 3R2IA 1RAXA 3SR6A 2WXNA 2KTRA 2TSSA 2DZJA 2M1MA 2WLBA 1S1QB 3QARA 2CHXA 2OHFA 5J18A 4DBGA 2KQSA 2RDBC 3AEGB 4HVBA 3WAPA 3AULA 2KFKB 4S17A 4LNIA 4KSLC 3Q8AA 1GB1A 4AOFA 4A90A 1LM8B 2DX5B 2JZ3B 3UQAA 4WQMA 2O6VD 3APCA 3K9PB 1UF0A 1XF5L 2KX3A 1F77A 4KVGB 4BBNF 1FNWA 1RLFA 2DYMA 2IYDB 4YL8A 4GOCA 4M0WA 2I1JA 2J53A 3QA8A 2PE9A 1Z5SB 2XK5A 4ICVA 3QC8B 1I4QA 1ET9A 3GE3C 3ZRCA 1KLGD 3IG3A 5IOIA 4W9HA 1J8CA 2Y5BB 2KWUB 3ZJTA 3W5UB 1TY0A 1I4XA 1TY2A 1E90A 2MLBA 5CTRC 1XLPA 2C9WB 4TV3A 1WYGA 3AE3B 1Q1OA 4N6EB 4XWTA 2X38A 3M95A 3IAM1 4IWQA 1QOGA 4BBNC 3ZJUA 4KZ0A 4WJPA 2JPHA 3MC8A 2JF5A 1WGDA 2IPKD 4RGNA 4JX1C 4AWJA 2K8HA 5E6NA 3IHPC 3TJPA 2ZEQA 3B08A 1L6UA 4KGRA 3W5VB 2M17A 3TL5A 4WQOB 3BZDB 1L5PA 1SE3A 2JWUA 2NBWB 3O13A 3RULA 2WXJA 2VH1A 3X0WA 3UI3A 4KIKA 2LGYA 2QJLA 3TBLD 4HRSA 4RF0A 2H89B 1YJJA 3M62B 1C3TA 4E74A 2WXOA 2Y5PA 2JUOA 5MPOA 5LLIA 3LYYA 4EEWA 4BVUC 1WR1A 2BF8B 1FXTB 4M8NA 2J7QB 2LMCA 2N9EB 2LRWA 3NJTA 1NDDA 4ANWA 2C7HA 3A9KB 2JY6A 3P4PB 2FCQA 2YEPB 2L8JA 4BKTA 4QAYA 2GBMA 4ACFA 3K9OB 4XX5A 2W3SA 2O2VB 1V1OA 2KJRA 3AECB 3VXWA 1OEYJ 1SF0A 2J4XA 3DHHC 4MH8A 3NVVA 2L7RA 3QK0A 1C78A 1TJEA 2LJ5A 3SEBA 4E3CA 4RFBA 1YMHE 1IBXA 3IFWB 4C7YA 2JSVX 2DZMA 2WXIA 1YN4A 5HI1A 1VZ7A 4HROA 4IWOA 2MH7A 4M02A 3PT2B 1XEEA 1YIWA 2V4IB 1F1HA 3A1QB 2L83A 4N9F4 3ZW3A 1N61A 4HCPB 2B76B 1UNSA 2NMQA 5AZFA 4PK1A 2KDFB 1SJHD 3PTFC 1TS4A 1UGMA 2D5GA 2NTTA 4B95A 2Z0DB 2INCC 3BVMA 3N1ZC 3DHIC 2HTME 1C9FA 1ROEA 3UIPB 5TSSA 3BVZA 2KDIA 3QWZB 5FR6A 1ISNA 1VZ6A 2NTSA 3B9JA 4DHJD 2WXFA 4HDOA 1YQ4B 3NRZA 2RDHA 3PLUA 3H7PA 1R4NB 2QHOA 1E8YA 1GPXA 1WI0A 1XXGA 1MG8A 1XLNA 2FE8A 5HG2A 3U52E 1F0ZA 2D2QA 2M0XA 2JU6X 2JXTA 3BIID 2MP2B 1M4VA 2AQ1B 2KDEB 2YEPF 1VJKA 3LJ3A 2NCNA 3A9JA 3CSTA 3KVFB 1N5WA 3Q3NC 4TQ0A 1QOFA 2J52A 1GG3A 3ZNID 1Q0WB 5G2NA 1D5MC 2E6XA 1AW7A 2D3AA 1BUIC 1FIQA 1QOBA 3WAMA 3W1SC 2DYOA 2MSED 1WJNA 1OQRA 1ZDVA 2KWVB 4I6NB 4C80A 3W1SA 3OLMD 1FCCC 2M8SA 3Q8CA 1OTRB 1XQQA 4EOYA 2AEHA 2LUEA 2PW9A 3GOEA 5D7GA 2HE7A 1A5RA 4HK2A 3AE8B 3Q3FA 4IUMB 2KK8A 2KWDA 3L17A 1FXAA 2BYVE 2KKCA 2MBHA 2BTEA 1B1ZA 1WMHB 4JE3B 1HQRD 2WWZA 4BKSD 3TEYA 2L76A 3AXCA 4WWNA 2FCMA 1EM7A 4ZYNA 2BT6A 4K81A 2LD9A 4TUUA 2KTRB 1SIFA 2OJRA 4F8CB 5J17A 2RD0A 2K6QA 2ZVOA 2D3GA 2JZZA 1UZXB 4GXBA 3U7DA 3ZRFA 4X57B 1N5XA 3QHTA 4ZHOA 1E10A 4NAWA 1RFKA 3P4QB 2NR2A 1WGYA 2MBEA 4PS7A 4EFOA 3RNFC 1QKZA 1IGCA 4GU2A 4IC7B 2H88B 2LGSA 1HZ5A 4FN2A 2BS4B 3GZNB 1L6VA 2WXQA 4K7SA 2K8CA 2CJNA 4M0WB 3N3KB 1K53A 5HFYA 1TS2A 2I1KA 1NI2A 2XK5B 1F2RC 4LDTB 1N63A 3APDA 1MJDA 3SDLC 2KMAA 3LDZE 4DQOC 2ZZPB 2MJDA 3VUWA 1V2YA 2LFIA 3RZWC 4HLEA 3P4RB 3EHVA 4HPMB 2QCZA 1F52A 2DYBA 2Z0EB 1WE6A 3FKYA 3BVGA 2ZVNA 5LXIB 2MEKA 3CSFA 3BYYB 2KC2A 4GLSC 3RNEC 3O65B 5G5HA 4W9FA 2HTHA 2JRIB 2WXGA 2JQRB 2X8XX 2EMSA 1TKYA 4FA6A 1ENFA 3V05A 1P0RA 3PZ8A 3PHWB 3PRMB 3KUZA 4RNAA 5IN7A 1OFFA 2FUG1 2QSDA 4HCNB 5CHFA 2RPQA 2BPSA 4GDLA 4II2B 2G3QB 3VDZA 1V97A 2BVCA 3PREA 5GXGB 2JYTA 2N1VA 3L10B 2KFJA 2GBRA 3OJ4B 1ESFA 4MACA 3ZGZA 3KW5B 2DWQA 1XD3B 3ML9A 2QIEB 2ZPYA 1HE8A 4KIKB 2Z59B 4YSXB 2ZNVC 1XCQL 3JW0X 2GB1A 2WS3B 3PZ7A 3SU8X 2J0KA 2BKRB 2HJ1A 1MVKA 4JLCA 3OAWA 2DZIA 3Q3JA 4FBJB 3QQ8B 4A20A 1C1YB 1P98A 5LNK1 3APFA 2K22A 1GAQB 3FILA 3SFDB 1WXQA 3VVWB 1E7UA 2M0AA 1JWBD 2WP9B 3I63C 1GUAB 3B1LX 3DCGA 3W2DA 2V3NA 2KX0A 3AN1A 2NS5A 3AEAB 4MT5A 4NQKE 3NOBA 3DVNV 3IBEA 1V81A 1D5XC 1XLQA 4KKJA 2KMCA 3VUXA 2RGFA 4F7ZA 2MRPA 3R7QA 1T0QC 3HK0A 2DNFA 4HEA1 1I42A 2LVOA 3ZXRA 4NNJB 3L08A 4WURA 1IBXB 1I7HA 3DBRI 2REXA 1WX9A 1L4DB 4ARCA 3AB5A 2RSUA 3DWGC 5IAAC 3ZQ4A 2QMTA 1HTOA 2BWES 2I2YA 4AJWA 1ZOYB 3Q2AC 2RDGA 1DOXA 5DPTA 1HTQA 1T0SC 2L52A 3RZFA 3V3XA 2GBKA 2NBVB 4RM9A 1G6JA 4IG7B 4LK0M 1EWYC 2WNMA 1J7CA 3WCQA 3ONSA 1D4BA 1SEBD 5T8IA 1JCKB 2BS3B 4KGSA 4PYUA 5D2MB 4MH0E 1PDXA 4A3OA 3HIZA 1V9JA 4ZHPA 2LGXA 4I6LB 4GIVA 3UQBA 2ZCBA 1D5ZC 4OVUA 1YD8U 5H92C 1PGXA 1JW9D 3C19A 1TS5A 1WX7A 3PZDA 1GC7A 4FULA 1AYFA 1JROA 4AP4C 1EU4A 2GRIA 3WIMA 3DVNU 3H7PB 1M94A 3AE6B 4C4VA 3GB1A 1YNTE 2UWQA 4W9JA 1BXTA 1K50A 4P16A 3ENEA 4AS1A 1FXIA 4RGMA 3ZKJC 1D6EC 3WAOA 1AN8A 3V61A 3VRBB 4ZYSA 3V62A 3A9JB 2D07B 1NBFC 1CZPA 1WGKA 2KLGA 1ZXHA 1FM0D 4YWGG 1J19A 2UYZB 1E7PB 1XCTL 4NJ6A 4BKSA 1WZ0A 2FCNA 2AYOB 1T6BX 1SJED 2KNBA 5BYQA 1PGAA 1UUPA 3AE4B 1VZ8A 1WM3A 4LJPB 3RYTA 2WXPA 4W9GA 4XDCA 2ZW0A 2B3AA 3MTNB 2AL3A 2A4ZA 4N58A 3Q8EA 2K0PA 1E5WA 1QF6A 1OGWA 3ZXVA 1D3ZA 1K51A 3TEZA 3A33B 4NJ7A 1J0GA 2KXJA 4WWOA 1CQVA 4F1SA 3VH3B 4MSQB 4GB9A 2M4NA 1V8CA 4XGAB 2LVQA 1EUVB 2IJ0A 1UBQA 4ANVA 2LI5A 2LHEA 3VRAB 3AE2B 3EECA 1JRUA 3VUYA 2DBYA 3RT3B 2N9PC 5C23A 3KLSX 1FEHA 4HPLB 4BZAA 1DYQA 3RD2A 3RCZA 2XBBC
chains in the Genus database with same CATH topology
1OQRA 3AE7B 1ZDVA 4ZOHC 2BS2B 1IGDA 3R8BA 3RFZB 4C80A 3W1SA 2XNAC 1FCCC 1B9RA 3Q8CA 1V1PB 5FR3A 1J7AA 2IGDA 1FRRA 5H8YE 2RPVA 1J7BA 3AEDB 1ZUD2 3CWIA 2WDRB 4REZA 1VLBA 4NAWB 2WU5B 4H2AA 2PW9A 1A70A 5FKAC 4LLGM 5D7GA 1UGJA 4ITKA 3KQ4A 1KFYB 2ON8A 3AE8B 1DOIA 3BYTB 3AE9B 4OZBA 4YTPB 4C56C 4YTMB 4US8A 3B2GA 2PVGC 3HUIA 3AE5B 4ZRQA 2N9KA 1YN5A 2ONQA 2PMVA 2KWDA 4OZAA 1FXAA 1WWTA 3BK2A 1KF6B 3ZJVA 3MJ5A 2BTEA 2JYEA 3HRDD 1I4GA 4D2KA 1B1ZA 5C2TB 3MHZA 3NUHB 4JE3B 1HQRD 3TEYA 3SFEB 1T3QA 1L4ZB 2G9HD 3PO0A 1FRDA 1Y56A 1YQ3B 2LEKA 5EE3A 3T3OA 1EM7A 5BMGA 4DXFA 2BT6A 1VRAB 1HXYD 1K52A 1AWDA 2IDYA 2K5PA 4RCOA 5AUIA 3TEWA 2LHDA 2MJ3A 2ACZB 1JALA 2PTLA 3Q69A 1NENB 3J9CA 3R2TA 5BYRA 2PIAA 4GDKB 3EGRA 3HVZA 1P7FA 4TMAB 1V1PA 1HZ6A 2CU3A 2QILA 1N5XA 1N60A 2KQ4X 4ZHOA 2AX5A 2FBWB 3P42A 4TSSA 2Z8LA 1ZPSA 1E10A 2AQ2B 2WXKA 1RFKA 3P4QB 3E56A 2I38A 2JZPA 1XO3A 3KWLA 3IT6B 1QKZA 3IT4B 1ZE3D 3ZYYX 1PYWD 1IGCA 4TQ1A 1QILA 2LJIA 2MJEA 4AQ7A 2H88B 2BYTA 1HZ5A 3EA6A 1QT9A 1JWMD 4XDDA 4GDLB 2BS4B 1L6VA 2VZKB 2WXQA 1JWAD 2CJNA 3NVYA 2L32A 1ZXIA 1K53A 1L0XB 4KX6B 2J42A 5HFYA 4KGTA 1TS2A 2WXLA 3P4SB 5HHDG 2W55A 2DLBA 4XWWA 1F2RC 3URYA 4NAMA 1N63A 4IOIE 1FMAD 3AM9A 1XLOA 3R2IA 1VDVA 4DQOC 4WIPA 4YTNB 2MJDA 2LFIA 1C4AA 2WXNA 2ZW1A 3SR6A 1C79A 2TSSA 5EE1A 1MPEA 2WLBA 4CQNA 1JRPA 1SBBB 3P4RB 2M19A 2BW2A 3TUOA 2OHFA 3BVGA 4LTUA 3AEGB 2PKOA 2MEKA 4XE0A 5C3JB 3ETRA 3BYYB 2K3UA 1F2RI 4GLSC 1UWXA 5G5HA 3Q8AA 1GB1A 5BMHA 2WXGA 2JQRB 4B0EA 3AE1B 4A90A 3KWVA 1NI3A 2OEDA 1TKYA 3NVWA 4WQMA 5JXVA 4HJGE 5BYSA 2N9LA 1ENFA 3FILB 1WRIA 3V05A 1XF5L 3PZ8A 2EELA 5EE9A 1F77A 4RNAA 1OFFA 4EE2A 1FNWA 1I4RA 4B0MA 2FUG1 2QSDA 2DYMA 1P7EA 1R7SA 2IGHA 4M0WA 1PUTA 3TEXA 2J53A 2Y5CA 1NYRA 1V97A 1BMLC 3AH7A 1NYQA 1TYGB 1I4HA 5EE0A 2JYTA 5GXGB 3LXFA 4MACA 1ESFA 3ZGZA 1I4QA 1ET9A 2M56B 2SAKA 3GS2A 1CK1A 1KLGD 2DWQA 3AV8A 1T5XD 1GOZA 2QIEB 1EU3A 2KDMA 2KN4A 3NS1A 4MM3B 4YSXB 1XCQL 2WU2B 2GB1A 2WS3B 2CJOA 3ZJTA 3W5UB 1PFDA 4C7ZA 1TY0A 1I4XA 3PZ7A 2WQYB 1TY2A 3AMZA 1N62A 3EUB2 1XLPA 3B2FA 1C4PA 1MVKA 1KH0A 2N0SB 4NZLB 1WSPA 2RMMA 2W54A 4OHJA 1WYGA 3AE3B 4HKZE 4N6EB 4XWTA 5LNK1 2K22A 1GAQB 3FILA 4YSYB 2X38A 2XN9C 1NVID 4WWMA 2WXMA 1HEZE 1WXQA 2M0AA 1QOGA 1JWBD 2WP9B 3IAM1 3SFDB 3ZJUA 3Q8BA 2L1AA 3W2DA 2WXRA 2IPKD 2V3NA 3AN1A 3AEAB 1JWSD 2JX5A 4RH6A 4L1BA 4MT5A 1DOYA 3MP9A 4RGNA 3VQIA 4JX1C 1YN3A 1SE2A 2K9XA 3ABVB 1D5XC 1TKGA 1XLQA 3DWMA 4KKJA 3FC4A 1KRHA 1L6UA 3AEEB 3E9SA 4J3OD 4KGRA 3U4EG 4ARIA 4KKIA 3W5VB 4HEA1 3BZDB 1L5PA 1SE3A 1DGJA 2JWUA 3O13A 4WAFA 2WXJA 2QEJC 3UI3A 4WURA 1IBXB 2QJLA 4A6QA 1I7HA 5E6JA 2INNE 2Q5WD 2Y3AA 1TZOA 4HRSA 2H89B 4RF0A 1Q10A 1YJJA 1L4DB 4ARCA 1C4CA 3AB5A 2WXOA 2Y5PA 3DWGC 5MPOA 3LYYA 3ZQ4A 2QMTA 1FD6A 1JQ4A 1MHHE 3MFGA 2I2YA 1TKEA 2LMCA 3BK1A 1TS3A 1ZOYB 2RDGA 1DOXA 1RM6C 2L52A 3Q8FA 1C77A 3V3XA 2VZKD 1C76A 1FO4A 4LK0M 2WXHA 1E0ZA 1FCLA 1EWYC 2WNMA 3AEFB 3P4PB 1MHXA 2YEPB 1J7CA 3WCQA 2PLPA 4YT0B 4OZCA 3NZ3A 1EWCA 4YSZB 3N9YC 1D4BA 3IAS1 2W3SA 4JPSA 2V3PA 3W9CB 1V1OA 1SEBD 3AECB 1L0YB 5T8IA 1JCKB 2PVOD 2BS3B 1SF0A 1SXTA 4KGSA 3RPFC 2J4XA 4L2YA 1PDXA 1E9MA 4MH8A 3NVVA 3TSSA 4ZHPA 5G5GA 1C78A 1TJEA 5I4DA 3SEBA 1FNVA 2AQ3B 3NVZA 1D5ZC 3BWUD 2E3TA 1VR9A 5H92C 1PGXA 1JW9D 1JWUD 4IDIA 4RFBA 1YMHE 1IBXA 2GI9A 1TS5A 4C7YA 5BMIA 2JSVX 1SB3C 1AYFA 1JROA 2R61A 2WXIA 1YN4A 5HI1A 2BB5A 1EU4A 1VZ7A 4HROA 1UWMA 2GRIA 2MH7A 1YJIA 1FNUA 1JMLA 3AE6B 3HVDA 3MC0B 3C8YA 5AUKA 2KAJA 1XEEA 2V4IB 3GB1A 1YNTE 1KLUD 2L83A 1BXTA 1N61A 2BBCA 4JWSC 1K50A 4L23A 2B76B 1IUEA 1KTKA 4P16A 1UNSA 2NMQA 4AS1A 3U2SC 1FXIA 1MI0A 3LB8C 4RGMA 3OWEB 4A55A 1D6EC 1LO5D 4OW0A 1AN8A 3IXSA 3VRBB 1QOAA 4ZYSA 1SJHD 4A9AA 3L4PA 1TS4A 4N59A 2SEBD 4A8XC 1CZPA 1WGKA 2IGGA 2D5GA 1RYJA 1ZXHA 1FM0D 2ICIA 1SSNA 2NTTA 3P1MA 4RGOS 4YWGG 4O1NA 4PT5A 4JWUC 3I57A 1RWSA 2EKIA 3BVMA 4DXGA 1E7PB 1XCTL 1L0VB 4R3DA 1NEKB 2HTME 3VR8B 4YXDB 1C9FA 1CJEA 1ROEA 1ZDXA 3FAHA 5TSSA 3BVZA 3P63A 1T6BX 1SJED 5BYQA 1PGAA 4WH4A 1VZ6A 1UUPA 3AE4B 1VZ8A 4Q2JA 2NTSA 2WDVB 2WXPA 2WXFA 3B9JA 1YQ4B 1ACCA 2ZW0A 4XDCA 5FK9C 4HKQA 3NRZA 4US9A 2RDHA 1ZP0B 4N58A 4RF1A 2N7JA 3Q8EA 2V0GA 1OQQA 2K0PA 2LGIA 1GPXA 1ET6A 1QF6A 3CIRB 3H8HA 1XXGA 1K51A 3GP7A 1XLNA 1HA5A 2FE8A 3AEBB 4OVZA 5HG2A 3TEZA 1E6EB 1FFVA 3U52E 1F0ZA 3U7ZA 3T3NA 1QLBB 2JU6X 1CQVA 2JXTA 3BIID 4IKGA 1M4VA 1V8CA 1QQRA 4USAA 2KACA 2AQ1B 2IJ0A 2YEPF 1VJKA 5D3IB 2BB6A 2G1EA 2LHEA 1FFUA 1N5WA 4FXCA 1I4PA 3VRAB 3AE2B 1QOFA 2J52A 3I9V1 2WDQB 4TQ0A 2DBYA 2INPE 1D5MC 1STEA 1AW7A 2E6XA 4RGTA 3KLSX 1BUIC 1FIQA 1QOBA 4UDUC 1FEHA 4P6VF 2KMMA 2LUMA 2HDEA 5D3DA 2DYOA 1SE4A 3VR9B 2W82A 1GB4A 1DYQA 4ZRPA 1SIJA 2W3RA 1PGBA 4NJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GB1 A;  1YNT E;  1IGD A;  4IOI E;  3MP9 A;  1FCC C;  1K50 A;  2ZW1 A;  2IGD A;  2NMQ A;  2RPV A;  1MI0 A;  1MPE A;  4KGR A;  2PW9 A;  2JWU A;  4OZB A;  2ON8 A;  2IGG A;  3UI3 A;  1ZXH A;  1F2R I;  4GLS C;  1IBX B;  1UWX A;  2N9K A;  1GB1 A;  2ONQ A;  5BMH A;  2KWD A;  4OZA A;  2OED A;  1Q10 A;  5JXV A;  4HJG E;  2N9L A;  3FIL B;  1XCT L;  1XF5 L;  4D2K A;  1C9F A;  2EEL A;  2QMT A;  1FD6 A;  1MHH E;  1EM7 A;  1PGA A;  5BMG A;  4WH4 A;  2QSD A;  2I2Y A;  1K52 A;  1P7E A;  2ZW0 A;  3V3X A;  2IGH A;  2LHD A;  2J53 A;  1FCL A;  2N7J A;  2PTL A;  1MHX A;  2K0P A;  2LGI A;  2PLP A;  4OZC A;  1K51 A;  4MAC A;  1D4B A;  5HG2 A;  1P7F A;  1HZ6 A;  2KDM A;  4KGS A;  2KN4 A;  2JU6 X;  2JXT A;  2KQ4 X;  1XCQ L;  4IKG A;  2GB1 A;  2KAC A;  2I38 A;  2JZP A;  2LHE A;  1QKZ A;  2J52 A;  1IGC A;  1PGX A;  1MVK A;  1KH0 A;  1YMH E;  1IBX A;  2GI9 A;  1HZ5 A;  2RMM A;  5BMI A;  2JSV X;  4HKZ E;  2LUM A;  5HI1 A;  3FIL A;  1K53 A;  1HEZ E;  5HFY A;  4KGT A;  1GB4 A;  1JML A;  5HHD G;  1F2R C;  1PGB A; 
#chains in the Genus database with same CATH topology
 1V5T A;  3R8B A;  1B9R A;  5E6O A;  4CO7 A;  5H8Y E;  1WGG A;  1RRB A;  1J7B A;  3M63 B;  5AEK B;  3RN9 C;  4CYE A;  1VLB A;  4NAW B;  2WU5 B;  1V86 A;  4M00 A;  4HWI B;  3L54 A;  3R3M A;  2ON8 A;  3ML8 A;  4YTP B;  5E6P A;  3AE5 B;  4ICU A;  1YN5 A;  4HDQ A;  2V4L A;  2N7D A;  2V9H A;  3BK2 A;  3ZNH B;  4D2K A;  5C2T B;  4WJO A;  3SFE B;  2G9H D;  1EO6 A;  1YQ3 B;  1E7V A;  4KZC A;  5EE3 A;  1VD2 A;  4IM3 A;  5DPR A;  2IDY A;  2K5P A;  2LGD A;  2LVP A;  4RCO A;  5AUI A;  2ZJD A;  4AUQ C;  2ACZ B;  3H6N A;  2PTL A;  2IY1 B;  1P3Q U;  3R2T A;  2HJ8 A;  2PIA A;  4GDK B;  4MEM A;  4TMA B;  4DHZ E;  2KQ4 X;  3P42 A;  2FBW B;  2WXK A;  3E56 A;  3ZYY X;  1PYW D;  3PV1 A;  4TQ1 A;  3WAL A;  1QIL A;  4W9I A;  3VTW A;  1QT9 A;  3H7S A;  4GDL B;  3L0W B;  3NVY A;  2L32 A;  4E71 A;  1L0X B;  5DPS A;  2J42 A;  4FJZ A;  3NY5 A;  3I3T B;  4KGT A;  4K7U A;  4XWW A;  2C60 A;  4NAM A;  2IO0 B;  2IO2 B;  1Q5W B;  4I6P A;  1VDV A;  4YTN B;  1C4A A;  1MPE A;  4W9L A;  4WWP A;  2WX0 A;  1SGH A;  1SBB B;  2M19 A;  3TUO A;  4XZ4 A;  5JZE B;  2ASQ A;  3MJW A;  2OJW A;  2PKO A;  2J0J A;  4XE0 A;  1IP9 A;  2ZNV B;  2K3U A;  1F2R I;  2DAJ A;  3VTU A;  5BMH A;  4WAA A;  2IZV B;  4MEL A;  3AE1 B;  3KWV A;  4JGH B;  1NI3 A;  5GMV A;  3NVW A;  4LDT D;  5JXV A;  5BYS A;  2N9L A;  3FIL B;  1WRI A;  1WH3 A;  2DAF A;  2EEL A;  2AWT A;  2BYF A;  4EE2 A;  4B0M A;  2VH2 A;  3UIO B;  3C0R B;  1H4R A;  2IGH A;  1V6E A;  4FHJ A;  1PUT A;  3TEX A;  3X23 A;  3AH7 A;  1TIF A;  1NYQ A;  1R4N I;  1TYG B;  1I4H A;  2KQ7 A;  2PJH A;  4K7W A;  3AI5 A;  2O6V A;  3LXF A;  2KTF A;  2MW5 A;  1QZE A;  1WGH A;  4BKG A;  4LNK A;  3L13 A;  1EU3 A;  4MGY E;  2KDM A;  2KN4 A;  2G4D B;  2WU2 B;  3PVL A;  3TMP B;  2KWC A;  2CJO A;  2FID A;  1PFD A;  4TKN A;  2WQY B;  3QIJ A;  4GGQ A;  3EUB 2;  1N62 A;  1UBI A;  4LJO B;  1C4P A;  2N0S B;  1KH0 A;  4XYC A;  1E8W A;  4NZL B;  1WSP A;  1EF5 A;  2W54 A;  1VCB A;  3QAQ A;  4HKZ E;  2IO3 B;  2UU7 A;  4BFR A;  4WWM A;  2WXM A;  4W9D A;  2WXR A;  2YLM A;  4RH6 A;  4L1B A;  1DOY A;  3IVF A;  3MP9 A;  5DPW A;  1SE2 A;  1WXM A;  3ABV B;  1TKG A;  3QJZ A;  4EZL A;  1OEY A;  4J3O D;  2LWP A;  2A5U A;  4B9K A;  1FPY A;  4S0R A;  1DGJ A;  4JQW C;  4IM0 A;  1ZKH A;  2L05 A;  3PPA A;  4HJK A;  3V60 A;  4MM3 A;  5E6J A;  2MBB B;  1U4A A;  1TZO A;  3SD5 A;  2RR9 A;  4DK5 A;  5BO4 B;  1C4C A;  2JRH A;  1TTN A;  4DHZ B;  4C4V B;  1JQ4 A;  2GBN A;  1ZW7 A;  1T0R C;  3BK1 A;  1TS3 A;  3T9L A;  3A4S C;  4WJQ A;  1C77 A;  4MGI E;  2VZK D;  4DXA B;  1C76 A;  1TZ1 A;  4MGZ E;  4M01 A;  2LRU A;  1E0Z A;  1FCL A;  4G0N B;  4YT0 B;  1WXV A;  3UGB B;  4YSZ B;  2D3C A;  3IAS 1;  2V3P A;  3N32 A;  3W9C B;  5J2R A;  4WJN A;  4M8M A;  3RPF C;  4L2Y A;  3S2A A;  4P1C C;  3TSS A;  5CHV C;  4JIO U;  5I4D A;  3N20 C;  3PS6 A;  4ZRI A;  3ZTC A;  1FNV A;  3KYD D;  2KYW A;  3BWU D;  1VR9 A;  4NY0 A;  5L95 C;  2KJH B;  4RM8 A;  1WJU A;  1ZGU B;  5BMI A;  3ZDT A;  2ZPN A;  1UD7 A;  3GZN I;  3AU4 A;  1YOV B;  1WXS A;  2BB5 A;  1YJI A;  1YX6 B;  1R4M B;  3HVD A;  3HM6 X;  1WJ6 A;  4IW0 A;  2C7M B;  2NPT A;  4MDK E;  2BBC A;  4JWS C;  4L23 A;  1IUE A;  1KTK A;  1TGZ B;  3CF6 E;  3LB8 C;  5CX3 A;  3OWE B;  3PRP B;  3DVG X;  3JYU A;  1E8Z A;  4W9K A;  2IO1 B;  4A55 A;  3IXS A;  3N30 A;  3L4P A;  2ZCC A;  4N59 A;  2SEB D;  4A8X C;  2IGG A;  1Z2M A;  3P2B A;  4II3 B;  2ICI A;  3P1M A;  1SSN A;  3L16 A;  4RGO S;  4MSM B;  4O1N A;  4PT5 A;  4JWU C;  1RWS A;  2EKI A;  4DXG A;  1IYF A;  1L0V B;  4R3D A;  3VR8 B;  4YXD B;  4KDL B;  4XC2 A;  2CR5 A;  1ZDX A;  2MA9 B;  1WGR A;  3P63 A;  2G4S A;  4WH4 A;  3MC9 A;  3R7R A;  2G45 B;  2WDV B;  4EZK A;  5FK9 C;  2GBJ A;  5L83 A;  1WY8 A;  2KO3 A;  4ASW C;  1ZP0 B;  5JHA A;  2N7J A;  4KDI C;  1OQQ A;  2LGI A;  3CIR B;  3DDC B;  3GP7 A;  4OVZ A;  1FFV A;  3DPD A;  3U7Z A;  2MBO A;  1QLB B;  1R4M I;  4IKG A;  2C5L C;  5D3I B;  2BB6 A;  1LXD A;  3I9V 1;  4ZRK A;  2N4F A;  3JSV A;  3UF8 A;  1STE A;  3AU5 A;  4RGT A;  2IBI B;  3GE8 C;  4DDG D;  4P7I A;  2KT7 A;  1KJT A;  4P6V F;  2HDE A;  1LQB A;  1SE4 A;  4K1R B;  5D6J B;  1WRD B;  5C1Z A;  3VR9 B;  2W82 A;  2WHI A;  2WX1 A;  1GB4 A;  4ZRP A;  5LXH A;  4GMV A;  1SIJ A;  2W3R A;  1PGB A;  4NJC A;  2VRR B;  1TT5 B;  3AE7 B;  2MCN B;  4ZOH C;  2BS2 B;  3RI7 C;  1IGD A;  4W9C A;  3RFZ B;  3DOW A;  3OJ3 A;  2R2Q A;  1L7Y A;  3NHE B;  3ZNZ B;  2IGD A;  2RPV A;  2D3B A;  5IP4 D;  4LNO A;  5AZG A;  1ZUD 2;  3CWI A;  4REZ A;  4H2A A;  1A70 A;  1EF1 A;  1UEL A;  5FKA C;  3VFK A;  4LLG M;  1UGJ A;  3BYT B;  1DOI A;  2D11 A;  3AE9 B;  2WDT B;  3A4R A;  2BKF A;  4US8 A;  3EFC A;  2N1W A;  1CMX B;  3KUC B;  3KYC D;  4ZRQ A;  2N9K A;  2PMV A;  1WYW B;  1WWT A;  3ZJV A;  2JYE A;  4PS8 A;  3MHZ A;  3NUH B;  2MQJ A;  1T3Q A;  1L4Z B;  3PO0 A;  1YQB A;  5IO9 A;  3T3O A;  1WFY A;  3N1Y C;  2BYE A;  5BMG A;  4OVV A;  2CHZ A;  4DXF A;  1HXY D;  4K3C A;  4C00 A;  1UH6 A;  3BY4 B;  1WM2 A;  2LHD A;  1P9D U;  1NEN B;  3J9C A;  5BYR A;  4IM2 A;  5DCN A;  3EGR A;  1F9J A;  1KLV A;  2KLC A;  1P7F A;  1XT9 B;  3VAW A;  1V1P A;  1WJ4 A;  1HZ6 A;  2CU3 A;  2KZR A;  2QIL A;  2DZK A;  5KHQ A;  4TSS A;  2AQ2 B;  4RMA A;  1XO3 A;  1ZE3 D;  3M3J A;  2LJI A;  2MJE A;  4AQ7 A;  2BYT A;  4DDI D;  3EA6 A;  2FAZ A;  4GSW A;  1JWA D;  5JHB A;  4PS3 A;  2MX2 A;  1BT0 A;  2W55 A;  2DLB A;  3ZDM C;  3URY A;  2O6V B;  5JH5 C;  1V80 A;  4LNN A;  4IOI E;  1FMA D;  3AM9 A;  3T8M A;  4B6W A;  4BOZ B;  5AZH A;  4WIP A;  4ZDV A;  3RNG C;  4MJS A;  3VHT C;  2ZW1 A;  3D32 A;  1C79 A;  5EE1 A;  4LCD E;  4CQN A;  1JRP A;  4HPP A;  2BW2 A;  2NVU I;  5EDS A;  3DHG C;  4IWP A;  4LTU A;  5C3J B;  3ETR A;  3H1U A;  3EC8 A;  1UWX A;  4B0E A;  2HD5 B;  2OED A;  1I35 A;  4EUT A;  2WGS A;  4HJG E;  2FCS A;  4FHK A;  5EE9 A;  1IPG A;  1I4R A;  1P7E A;  4BAX A;  1R7S A;  2Y5C A;  1NYR A;  1BML C;  4LNF A;  5EE0 A;  2FIF A;  1GNU A;  2IND C;  2AL6 A;  2J0M A;  2M56 B;  2SAK A;  3GS2 A;  1CK1 A;  3MHS D;  4FJV B;  3AV8 A;  1T5X D;  1KM7 A;  1GOZ A;  2IY0 B;  3NS1 A;  2GLS A;  4MM3 B;  3NS8 A;  2QC8 A;  4A3P A;  1YJ1 A;  4C7Z A;  3AMZ A;  2KFK A;  3B2F A;  2K1F A;  2EMT A;  2W9N A;  2QDF A;  2RMM A;  4NPN A;  4PYZ A;  4OHJ A;  4DWF A;  4EZJ A;  1LFD A;  4YSY B;  1WIA A;  1NVI D;  2XN9 C;  1HEZ E;  2MWS B;  2FNJ B;  3PHX B;  3Q8B A;  2L1A A;  3DQV A;  2BWF A;  2BGF A;  1JWS D;  2JX5 A;  3RUI B;  4K3B A;  3VQI A;  1YN3 A;  2K9X A;  3ZLZ A;  3DWM A;  3FC4 A;  2MHJ A;  3U30 A;  1KRH A;  3AEE B;  3E9S A;  4MGK E;  3U4E G;  4ARI A;  4KKI A;  4URK A;  4BOS C;  3EFU A;  3WAN A;  4WAF A;  2QEJ C;  1KOT A;  2R2O A;  5IA7 A;  1L2N A;  1N6Z A;  2KAN A;  2GOW A;  1PQS A;  2MBQ A;  4A6Q A;  2INN E;  2Q5W D;  2Y3A A;  2CKH B;  3DBH B;  1Q10 A;  3PGE A;  3KH0 A;  1FD6 A;  1MHH E;  1LGR A;  3V6E B;  3MFG A;  1TKE A;  3VH4 B;  1MFW A;  2NPT B;  1RM6 C;  2LZ6 A;  3Q8F A;  2L0T A;  1FO4 A;  2JVC A;  2WXH A;  3AEF B;  3QX1 A;  1MHX A;  3HM3 A;  2PLP A;  4OZC A;  3NZ3 A;  1EWC A;  3ALB A;  3N9Y C;  1AAR A;  4JPS A;  2K25 A;  1L0Y B;  1SE9 A;  2YVC A;  2PVO D;  1SXT A;  3Q3M C;  4J6I A;  1E9M A;  3Q3O C;  1WR6 E;  5G5G A;  2NBU A;  3N1X C;  2KN5 A;  4JL9 A;  1Y8R C;  2AQ3 B;  3NVZ A;  1WX8 A;  2E3T A;  1JWU D;  4IDI A;  3UIN B;  2GI9 A;  2KD0 A;  5CHW A;  4ANX A;  2KC1 A;  1SB3 C;  2L00 B;  2R61 A;  1UWM A;  2V1Y A;  1FNU A;  1JML A;  4G3X B;  3MC0 B;  3C8Y A;  5AUK A;  1K8R B;  2CS4 A;  2KAJ A;  4ANU A;  3V6C B;  3RNB C;  3DVG Y;  1KLU D;  3DBH I;  1YX5 B;  1T0Y A;  3U2S C;  1MI0 A;  3A9K A;  2DEN B;  4NQL B;  2CU1 A;  4DHJ B;  1LO5 D;  4KV2 A;  3R66 C;  4OW0 A;  3ZVV A;  1QOA A;  4A9A A;  4CHK A;  2O2V A;  3JSV B;  1RYJ A;  3RMK C;  3H9D A;  3NG0 A;  3Q6B A;  3RNC C;  3I57 A;  3ZUN A;  3DBL B;  4AJY B;  1NEK B;  1MG4 A;  1CJE A;  1RFA A;  4G11 A;  3FAH A;  3B0A A;  3ZIM A;  4Q2J A;  4HKQ A;  1ACC A;  4US9 A;  3VTV A;  4RF1 A;  3DBS A;  2V0G A;  1P1A A;  1ET6 A;  2KDB A;  3H8H A;  3A1Q A;  3AEB B;  1HA5 A;  1E6E B;  3ZO5 B;  4FLH A;  3PRZ A;  4EKU A;  2FUH B;  3TCA A;  3T3N A;  2XEW A;  2K39 A;  2V3S A;  3ZNG C;  5D94 A;  3JVZ X;  1QQR A;  4USA A;  2KAC A;  1WXA A;  3QCA A;  2G1E A;  2K6D B;  1FFU A;  4FXC A;  1I4P A;  1WZ3 A;  3OG5 A;  2WDQ B;  2INP E;  4UDU C;  3PLV A;  4FAD A;  2KMM A;  2LUM A;  5D3D A;  4GDK A;  3HHM A;  5KHO A;  1V49 A;  3SHQ A;  2KVZ A;  2JWZ A;  1TBE A;  2DHZ A;  3WA0 A;  1S3S G;  2XNA C;  1V5O A;  1H8C A;  2WYQ A;  2KOX A;  1V1P B;  5FR3 A;  2D10 A;  1GC6 A;  3DBL I;  1J7A A;  1FRR A;  3PSE B;  3AED B;  2C7N B;  2WDR B;  5G55 A;  3CMM B;  3KUD B;  4ITK A;  4P1B C;  3KQ4 A;  1KFY B;  4OZB A;  4C56 C;  4YTM B;  3Q14 C;  4GN1 A;  3B2G A;  2PVG C;  3HUI A;  2N9X A;  4FJY A;  2ONQ A;  3DBR B;  2MP2 A;  5TR5 A;  4OZA A;  3I5J C;  1KF6 B;  2CHW A;  3ZTD A;  3MJ5 A;  3HRD D;  1I4G A;  1WE7 A;  1FRD A;  1Y56 A;  2LEK A;  2PPH A;  1X1M A;  4W9E A;  2L3Z A;  1VRA B;  1K52 A;  1AWD A;  4MJS B;  5HKH A;  2K8B A;  2JXX A;  1WF9 A;  3TEW A;  2MJ3 A;  2GMI C;  1JAL A;  3Q69 A;  3U8Z A;  2KHW B;  1E8X A;  2EKE C;  3RNA C;  1GJZ A;  2PEA A;  3HVZ A;  3W1Y A;  2JT4 B;  1N60 A;  2OOB B;  2AX5 A;  2Z8L A;  1ZPS A;  4G50 A;  2I38 A;  2JZP A;  3KWL A;  3IT6 B;  2PE6 B;  1OQY A;  3IT4 B;  5IKC M;  2KVR A;  2L0F A;  3ECI A;  3NZS A;  2LXC A;  4KSK C;  2BQQ A;  2LAS A;  1JWM D;  4XDD A;  2LXA A;  2VZK B;  4HXD A;  3NZU A;  1ZXI A;  4KX6 B;  1WMH A;  2N7E A;  2WXL A;  3P4S B;  5HHD G;  2KJ6 A;  3BIN A;  3TIX A;  1XLO A;  4ZRJ A;  3R2I A;  1RAX A;  3SR6 A;  2WXN A;  2KTR A;  2TSS A;  2DZJ A;  2M1M A;  2WLB A;  1S1Q B;  3QAR A;  2CHX A;  2OHF A;  5J18 A;  4DBG A;  2KQS A;  2RDB C;  3AEG B;  4HVB A;  3WAP A;  3AUL A;  2KFK B;  4S17 A;  4LNI A;  4KSL C;  3Q8A A;  1GB1 A;  4AOF A;  4A90 A;  1LM8 B;  2DX5 B;  2JZ3 B;  3UQA A;  4WQM A;  2O6V D;  3APC A;  3K9P B;  1UF0 A;  1XF5 L;  2KX3 A;  1F77 A;  4KVG B;  4BBN F;  1FNW A;  1RLF A;  2DYM A;  2IYD B;  4YL8 A;  4GOC A;  4M0W A;  2I1J A;  2J53 A;  3QA8 A;  2PE9 A;  1Z5S B;  2XK5 A;  4ICV A;  3QC8 B;  1I4Q A;  1ET9 A;  3GE3 C;  3ZRC A;  1KLG D;  3IG3 A;  5IOI A;  4W9H A;  1J8C A;  2Y5B B;  2KWU B;  3ZJT A;  3W5U B;  1TY0 A;  1I4X A;  1TY2 A;  1E90 A;  2MLB A;  5CTR C;  1XLP A;  2C9W B;  4TV3 A;  1WYG A;  3AE3 B;  1Q1O A;  4N6E B;  4XWT A;  2X38 A;  3M95 A;  3IAM 1;  4IWQ A;  1QOG A;  4BBN C;  3ZJU A;  4KZ0 A;  4WJP A;  2JPH A;  3MC8 A;  2JF5 A;  1WGD A;  2IPK D;  4RGN A;  4JX1 C;  4AWJ A;  2K8H A;  5E6N A;  3IHP C;  3TJP A;  2ZEQ A;  3B08 A;  1L6U A;  4KGR A;  3W5V B;  2M17 A;  3TL5 A;  4WQO B;  3BZD B;  1L5P A;  1SE3 A;  2JWU A;  2NBW B;  3O13 A;  3RUL A;  2WXJ A;  2VH1 A;  3X0W A;  3UI3 A;  4KIK A;  2LGY A;  2QJL A;  3TBL D;  4HRS A;  4RF0 A;  2H89 B;  1YJJ A;  3M62 B;  1C3T A;  4E74 A;  2WXO A;  2Y5P A;  2JUO A;  5MPO A;  5LLI A;  3LYY A;  4EEW A;  4BVU C;  1WR1 A;  2BF8 B;  1FXT B;  4M8N A;  2J7Q B;  2LMC A;  2N9E B;  2LRW A;  3NJT A;  1NDD A;  4ANW A;  2C7H A;  3A9K B;  2JY6 A;  3P4P B;  2FCQ A;  2YEP B;  2L8J A;  4BKT A;  4QAY A;  2GBM A;  4ACF A;  3K9O B;  4XX5 A;  2W3S A;  2O2V B;  1V1O A;  2KJR A;  3AEC B;  3VXW A;  1OEY J;  1SF0 A;  2J4X A;  3DHH C;  4MH8 A;  3NVV A;  2L7R A;  3QK0 A;  1C78 A;  1TJE A;  2LJ5 A;  3SEB A;  4E3C A;  4RFB A;  1YMH E;  1IBX A;  3IFW B;  4C7Y A;  2JSV X;  2DZM A;  2WXI A;  1YN4 A;  5HI1 A;  1VZ7 A;  4HRO A;  4IWO A;  2MH7 A;  4M02 A;  3PT2 B;  1XEE A;  1YIW A;  2V4I B;  1F1H A;  3A1Q B;  2L83 A;  4N9F 4;  3ZW3 A;  1N61 A;  4HCP B;  2B76 B;  1UNS A;  2NMQ A;  5AZF A;  4PK1 A;  2KDF B;  1SJH D;  3PTF C;  1TS4 A;  1UGM A;  2D5G A;  2NTT A;  4B95 A;  2Z0D B;  2INC C;  3BVM A;  3N1Z C;  3DHI C;  2HTM E;  1C9F A;  1ROE A;  3UIP B;  5TSS A;  3BVZ A;  2KDI A;  3QWZ B;  5FR6 A;  1ISN A;  1VZ6 A;  2NTS A;  3B9J A;  4DHJ D;  2WXF A;  4HDO A;  1YQ4 B;  3NRZ A;  2RDH A;  3PLU A;  3H7P A;  1R4N B;  2QHO A;  1E8Y A;  1GPX A;  1WI0 A;  1XXG A;  1MG8 A;  1XLN A;  2FE8 A;  5HG2 A;  3U52 E;  1F0Z A;  2D2Q A;  2M0X A;  2JU6 X;  2JXT A;  3BII D;  2MP2 B;  1M4V A;  2AQ1 B;  2KDE B;  2YEP F;  1VJK A;  3LJ3 A;  2NCN A;  3A9J A;  3CST A;  3KVF B;  1N5W A;  3Q3N C;  4TQ0 A;  1QOF A;  2J52 A;  1GG3 A;  3ZNI D;  1Q0W B;  5G2N A;  1D5M C;  2E6X A;  1AW7 A;  2D3A A;  1BUI C;  1FIQ A;  1QOB A;  3WAM A;  3W1S C;  2DYO A;  2MSE D;  1WJN A;  1OQR A;  1ZDV A;  2KWV B;  4I6N B;  4C80 A;  3W1S A;  3OLM D;  1FCC C;  2M8S A;  3Q8C A;  1OTR B;  1XQQ A;  4EOY A;  2AEH A;  2LUE A;  2PW9 A;  3GOE A;  5D7G A;  2HE7 A;  1A5R A;  4HK2 A;  3AE8 B;  3Q3F A;  4IUM B;  2KK8 A;  2KWD A;  3L17 A;  1FXA A;  2BYV E;  2KKC A;  2MBH A;  2BTE A;  1B1Z A;  1WMH B;  4JE3 B;  1HQR D;  2WWZ A;  4BKS D;  3TEY A;  2L76 A;  3AXC A;  4WWN A;  2FCM A;  1EM7 A;  4ZYN A;  2BT6 A;  4K81 A;  2LD9 A;  4TUU A;  2KTR B;  1SIF A;  2OJR A;  4F8C B;  5J17 A;  2RD0 A;  2K6Q A;  2ZVO A;  2D3G A;  2JZZ A;  1UZX B;  4GXB A;  3U7D A;  3ZRF A;  4X57 B;  1N5X A;  3QHT A;  4ZHO A;  1E10 A;  4NAW A;  1RFK A;  3P4Q B;  2NR2 A;  1WGY A;  2MBE A;  4PS7 A;  4EFO A;  3RNF C;  1QKZ A;  1IGC A;  4GU2 A;  4IC7 B;  2H88 B;  2LGS A;  1HZ5 A;  4FN2 A;  2BS4 B;  3GZN B;  1L6V A;  2WXQ A;  4K7S A;  2K8C A;  2CJN A;  4M0W B;  3N3K B;  1K53 A;  5HFY A;  1TS2 A;  2I1K A;  1NI2 A;  2XK5 B;  1F2R C;  4LDT B;  1N63 A;  3APD A;  1MJD A;  3SDL C;  2KMA A;  3LDZ E;  4DQO C;  2ZZP B;  2MJD A;  3VUW A;  1V2Y A;  2LFI A;  3RZW C;  4HLE A;  3P4R B;  3EHV A;  4HPM B;  2QCZ A;  1F52 A;  2DYB A;  2Z0E B;  1WE6 A;  3FKY A;  3BVG A;  2ZVN A;  5LXI B;  2MEK A;  3CSF A;  3BYY B;  2KC2 A;  4GLS C;  3RNE C;  3O65 B;  5G5H A;  4W9F A;  2HTH A;  2JRI B;  2WXG A;  2JQR B;  2X8X X;  2EMS A;  1TKY A;  4FA6 A;  1ENF A;  3V05 A;  1P0R A;  3PZ8 A;  3PHW B;  3PRM B;  3KUZ A;  4RNA A;  5IN7 A;  1OFF A;  2FUG 1;  2QSD A;  4HCN B;  5CHF A;  2RPQ A;  2BPS A;  4GDL A;  4II2 B;  2G3Q B;  3VDZ A;  1V97 A;  2BVC A;  3PRE A;  5GXG B;  2JYT A;  2N1V A;  3L10 B;  2KFJ A;  2GBR A;  3OJ4 B;  1ESF A;  4MAC A;  3ZGZ A;  3KW5 B;  2DWQ A;  1XD3 B;  3ML9 A;  2QIE B;  2ZPY A;  1HE8 A;  4KIK B;  2Z59 B;  4YSX B;  2ZNV C;  1XCQ L;  3JW0 X;  2GB1 A;  2WS3 B;  3PZ7 A;  3SU8 X;  2J0K A;  2BKR B;  2HJ1 A;  1MVK A;  4JLC A;  3OAW A;  2DZI A;  3Q3J A;  4FBJ B;  3QQ8 B;  4A20 A;  1C1Y B;  1P98 A;  5LNK 1;  3APF A;  2K22 A;  1GAQ B;  3FIL A;  3SFD B;  1WXQ A;  3VVW B;  1E7U A;  2M0A A;  1JWB D;  2WP9 B;  3I63 C;  1GUA B;  3B1L X;  3DCG A;  3W2D A;  2V3N A;  2KX0 A;  3AN1 A;  2NS5 A;  3AEA B;  4MT5 A;  4NQK E;  3NOB A;  3DVN V;  3IBE A;  1V81 A;  1D5X C;  1XLQ A;  4KKJ A;  2KMC A;  3VUX A;  2RGF A;  4F7Z A;  2MRP A;  3R7Q A;  1T0Q C;  3HK0 A;  2DNF A;  4HEA 1;  1I42 A;  2LVO A;  3ZXR A;  4NNJ B;  3L08 A;  4WUR A;  1IBX B;  1I7H A;  3DBR I;  2REX A;  1WX9 A;  1L4D B;  4ARC A;  3AB5 A;  2RSU A;  3DWG C;  5IAA C;  3ZQ4 A;  2QMT A;  1HTO A;  2BWE S;  2I2Y A;  4AJW A;  1ZOY B;  3Q2A C;  2RDG A;  1DOX A;  5DPT A;  1HTQ A;  1T0S C;  2L52 A;  3RZF A;  3V3X A;  2GBK A;  2NBV B;  4RM9 A;  1G6J A;  4IG7 B;  4LK0 M;  1EWY C;  2WNM A;  1J7C A;  3WCQ A;  3ONS A;  1D4B A;  1SEB D;  5T8I A;  1JCK B;  2BS3 B;  4KGS A;  4PYU A;  5D2M B;  4MH0 E;  1PDX A;  4A3O A;  3HIZ A;  1V9J A;  4ZHP A;  2LGX A;  4I6L B;  4GIV A;  3UQB A;  2ZCB A;  1D5Z C;  4OVU A;  1YD8 U;  5H92 C;  1PGX A;  1JW9 D;  3C19 A;  1TS5 A;  1WX7 A;  3PZD A;  1GC7 A;  4FUL A;  1AYF A;  1JRO A;  4AP4 C;  1EU4 A;  2GRI A;  3WIM A;  3DVN U;  3H7P B;  1M94 A;  3AE6 B;  4C4V A;  3GB1 A;  1YNT E;  2UWQ A;  4W9J A;  1BXT A;  1K50 A;  4P16 A;  3ENE A;  4AS1 A;  1FXI A;  4RGM A;  3ZKJ C;  1D6E C;  3WAO A;  1AN8 A;  3V61 A;  3VRB B;  4ZYS A;  3V62 A;  3A9J B;  2D07 B;  1NBF C;  1CZP A;  1WGK A;  2KLG A;  1ZXH A;  1FM0 D;  4YWG G;  1J19 A;  2UYZ B;  1E7P B;  1XCT L;  4NJ6 A;  4BKS A;  1WZ0 A;  2FCN A;  2AYO B;  1T6B X;  1SJE D;  2KNB A;  5BYQ A;  1PGA A;  1UUP A;  3AE4 B;  1VZ8 A;  1WM3 A;  4LJP B;  3RYT A;  2WXP A;  4W9G A;  4XDC A;  2ZW0 A;  2B3A A;  3MTN B;  2AL3 A;  2A4Z A;  4N58 A;  3Q8E A;  2K0P A;  1E5W A;  1QF6 A;  1OGW A;  3ZXV A;  1D3Z A;  1K51 A;  3TEZ A;  3A33 B;  4NJ7 A;  1J0G A;  2KXJ A;  4WWO A;  1CQV A;  4F1S A;  3VH3 B;  4MSQ B;  4GB9 A;  2M4N A;  1V8C A;  4XGA B;  2LVQ A;  1EUV B;  2IJ0 A;  1UBQ A;  4ANV A;  2LI5 A;  2LHE A;  3VRA B;  3AE2 B;  3EEC A;  1JRU A;  3VUY A;  2DBY A;  3RT3 B;  2N9P C;  5C23 A;  3KLS X;  1FEH A;  4HPL B;  4BZA A;  1DYQ A;  3RD2 A;  3RCZ A;  2XBB C; 
#chains in the Genus database with same CATH homology
 1OQR A;  3AE7 B;  1ZDV A;  4ZOH C;  2BS2 B;  1IGD A;  3R8B A;  3RFZ B;  4C80 A;  3W1S A;  2XNA C;  1FCC C;  1B9R A;  3Q8C A;  1V1P B;  5FR3 A;  1J7A A;  2IGD A;  1FRR A;  5H8Y E;  2RPV A;  1J7B A;  3AED B;  1ZUD 2;  3CWI A;  2WDR B;  4REZ A;  1VLB A;  4NAW B;  2WU5 B;  4H2A A;  2PW9 A;  1A70 A;  5FKA C;  4LLG M;  5D7G A;  1UGJ A;  4ITK A;  3KQ4 A;  1KFY B;  2ON8 A;  3AE8 B;  1DOI A;  3BYT B;  3AE9 B;  4OZB A;  4YTP B;  4C56 C;  4YTM B;  4US8 A;  3B2G A;  2PVG C;  3HUI A;  3AE5 B;  4ZRQ A;  2N9K A;  1YN5 A;  2ONQ A;  2PMV A;  2KWD A;  4OZA A;  1FXA A;  1WWT A;  3BK2 A;  1KF6 B;  3ZJV A;  3MJ5 A;  2BTE A;  2JYE A;  3HRD D;  1I4G A;  4D2K A;  1B1Z A;  5C2T B;  3MHZ A;  3NUH B;  4JE3 B;  1HQR D;  3TEY A;  3SFE B;  1T3Q A;  1L4Z B;  2G9H D;  3PO0 A;  1FRD A;  1Y56 A;  1YQ3 B;  2LEK A;  5EE3 A;  3T3O A;  1EM7 A;  5BMG A;  4DXF A;  2BT6 A;  1VRA B;  1HXY D;  1K52 A;  1AWD A;  2IDY A;  2K5P A;  4RCO A;  5AUI A;  3TEW A;  2LHD A;  2MJ3 A;  2ACZ B;  1JAL A;  2PTL A;  3Q69 A;  1NEN B;  3J9C A;  3R2T A;  5BYR A;  2PIA A;  4GDK B;  3EGR A;  3HVZ A;  1P7F A;  4TMA B;  1V1P A;  1HZ6 A;  2CU3 A;  2QIL A;  1N5X A;  1N60 A;  2KQ4 X;  4ZHO A;  2AX5 A;  2FBW B;  3P42 A;  4TSS A;  2Z8L A;  1ZPS A;  1E10 A;  2AQ2 B;  2WXK A;  1RFK A;  3P4Q B;  3E56 A;  2I38 A;  2JZP A;  1XO3 A;  3KWL A;  3IT6 B;  1QKZ A;  3IT4 B;  1ZE3 D;  3ZYY X;  1PYW D;  1IGC A;  4TQ1 A;  1QIL A;  2LJI A;  2MJE A;  4AQ7 A;  2H88 B;  2BYT A;  1HZ5 A;  3EA6 A;  1QT9 A;  1JWM D;  4XDD A;  4GDL B;  2BS4 B;  1L6V A;  2VZK B;  2WXQ A;  1JWA D;  2CJN A;  3NVY A;  2L32 A;  1ZXI A;  1K53 A;  1L0X B;  4KX6 B;  2J42 A;  5HFY A;  4KGT A;  1TS2 A;  2WXL A;  3P4S B;  5HHD G;  2W55 A;  2DLB A;  4XWW A;  1F2R C;  3URY A;  4NAM A;  1N63 A;  4IOI E;  1FMA D;  3AM9 A;  1XLO A;  3R2I A;  1VDV A;  4DQO C;  4WIP A;  4YTN B;  2MJD A;  2LFI A;  1C4A A;  2WXN A;  2ZW1 A;  3SR6 A;  1C79 A;  2TSS A;  5EE1 A;  1MPE A;  2WLB A;  4CQN A;  1JRP A;  1SBB B;  3P4R B;  2M19 A;  2BW2 A;  3TUO A;  2OHF A;  3BVG A;  4LTU A;  3AEG B;  2PKO A;  2MEK A;  4XE0 A;  5C3J B;  3ETR A;  3BYY B;  2K3U A;  1F2R I;  4GLS C;  1UWX A;  5G5H A;  3Q8A A;  1GB1 A;  5BMH A;  2WXG A;  2JQR B;  4B0E A;  3AE1 B;  4A90 A;  3KWV A;  1NI3 A;  2OED A;  1TKY A;  3NVW A;  4WQM A;  5JXV A;  4HJG E;  5BYS A;  2N9L A;  1ENF A;  3FIL B;  1WRI A;  3V05 A;  1XF5 L;  3PZ8 A;  2EEL A;  5EE9 A;  1F77 A;  4RNA A;  1OFF A;  4EE2 A;  1FNW A;  1I4R A;  4B0M A;  2FUG 1;  2QSD A;  2DYM A;  1P7E A;  1R7S A;  2IGH A;  4M0W A;  1PUT A;  3TEX A;  2J53 A;  2Y5C A;  1NYR A;  1V97 A;  1BML C;  3AH7 A;  1NYQ A;  1TYG B;  1I4H A;  5EE0 A;  2JYT A;  5GXG B;  3LXF A;  4MAC A;  1ESF A;  3ZGZ A;  1I4Q A;  1ET9 A;  2M56 B;  2SAK A;  3GS2 A;  1CK1 A;  1KLG D;  2DWQ A;  3AV8 A;  1T5X D;  1GOZ A;  2QIE B;  1EU3 A;  2KDM A;  2KN4 A;  3NS1 A;  4MM3 B;  4YSX B;  1XCQ L;  2WU2 B;  2GB1 A;  2WS3 B;  2CJO A;  3ZJT A;  3W5U B;  1PFD A;  4C7Z A;  1TY0 A;  1I4X A;  3PZ7 A;  2WQY B;  1TY2 A;  3AMZ A;  1N62 A;  3EUB 2;  1XLP A;  3B2F A;  1C4P A;  1MVK A;  1KH0 A;  2N0S B;  4NZL B;  1WSP A;  2RMM A;  2W54 A;  4OHJ A;  1WYG A;  3AE3 B;  4HKZ E;  4N6E B;  4XWT A;  5LNK 1;  2K22 A;  1GAQ B;  3FIL A;  4YSY B;  2X38 A;  2XN9 C;  1NVI D;  4WWM A;  2WXM A;  1HEZ E;  1WXQ A;  2M0A A;  1QOG A;  1JWB D;  2WP9 B;  3IAM 1;  3SFD B;  3ZJU A;  3Q8B A;  2L1A A;  3W2D A;  2WXR A;  2IPK D;  2V3N A;  3AN1 A;  3AEA B;  1JWS D;  2JX5 A;  4RH6 A;  4L1B A;  4MT5 A;  1DOY A;  3MP9 A;  4RGN A;  3VQI A;  4JX1 C;  1YN3 A;  1SE2 A;  2K9X A;  3ABV B;  1D5X C;  1TKG A;  1XLQ A;  3DWM A;  4KKJ A;  3FC4 A;  1KRH A;  1L6U A;  3AEE B;  3E9S A;  4J3O D;  4KGR A;  3U4E G;  4ARI A;  4KKI A;  3W5V B;  4HEA 1;  3BZD B;  1L5P A;  1SE3 A;  1DGJ A;  2JWU A;  3O13 A;  4WAF A;  2WXJ A;  2QEJ C;  3UI3 A;  4WUR A;  1IBX B;  2QJL A;  4A6Q A;  1I7H A;  5E6J A;  2INN E;  2Q5W D;  2Y3A A;  1TZO A;  4HRS A;  2H89 B;  4RF0 A;  1Q10 A;  1YJJ A;  1L4D B;  4ARC A;  1C4C A;  3AB5 A;  2WXO A;  2Y5P A;  3DWG C;  5MPO A;  3LYY A;  3ZQ4 A;  2QMT A;  1FD6 A;  1JQ4 A;  1MHH E;  3MFG A;  2I2Y A;  1TKE A;  2LMC A;  3BK1 A;  1TS3 A;  1ZOY B;  2RDG A;  1DOX A;  1RM6 C;  2L52 A;  3Q8F A;  1C77 A;  3V3X A;  2VZK D;  1C76 A;  1FO4 A;  4LK0 M;  2WXH A;  1E0Z A;  1FCL A;  1EWY C;  2WNM A;  3AEF B;  3P4P B;  1MHX A;  2YEP B;  1J7C A;  3WCQ A;  2PLP A;  4YT0 B;  4OZC A;  3NZ3 A;  1EWC A;  4YSZ B;  3N9Y C;  1D4B A;  3IAS 1;  2W3S A;  4JPS A;  2V3P A;  3W9C B;  1V1O A;  1SEB D;  3AEC B;  1L0Y B;  5T8I A;  1JCK B;  2PVO D;  2BS3 B;  1SF0 A;  1SXT A;  4KGS A;  3RPF C;  2J4X A;  4L2Y A;  1PDX A;  1E9M A;  4MH8 A;  3NVV A;  3TSS A;  4ZHP A;  5G5G A;  1C78 A;  1TJE A;  5I4D A;  3SEB A;  1FNV A;  2AQ3 B;  3NVZ A;  1D5Z C;  3BWU D;  2E3T A;  1VR9 A;  5H92 C;  1PGX A;  1JW9 D;  1JWU D;  4IDI A;  4RFB A;  1YMH E;  1IBX A;  2GI9 A;  1TS5 A;  4C7Y A;  5BMI A;  2JSV X;  1SB3 C;  1AYF A;  1JRO A;  2R61 A;  2WXI A;  1YN4 A;  5HI1 A;  2BB5 A;  1EU4 A;  1VZ7 A;  4HRO A;  1UWM A;  2GRI A;  2MH7 A;  1YJI A;  1FNU A;  1JML A;  3AE6 B;  3HVD A;  3MC0 B;  3C8Y A;  5AUK A;  2KAJ A;  1XEE A;  2V4I B;  3GB1 A;  1YNT E;  1KLU D;  2L83 A;  1BXT A;  1N61 A;  2BBC A;  4JWS C;  1K50 A;  4L23 A;  2B76 B;  1IUE A;  1KTK A;  4P16 A;  1UNS A;  2NMQ A;  4AS1 A;  3U2S C;  1FXI A;  1MI0 A;  3LB8 C;  4RGM A;  3OWE B;  4A55 A;  1D6E C;  1LO5 D;  4OW0 A;  1AN8 A;  3IXS A;  3VRB B;  1QOA A;  4ZYS A;  1SJH D;  4A9A A;  3L4P A;  1TS4 A;  4N59 A;  2SEB D;  4A8X C;  1CZP A;  1WGK A;  2IGG A;  2D5G A;  1RYJ A;  1ZXH A;  1FM0 D;  2ICI A;  1SSN A;  2NTT A;  3P1M A;  4RGO S;  4YWG G;  4O1N A;  4PT5 A;  4JWU C;  3I57 A;  1RWS A;  2EKI A;  3BVM A;  4DXG A;  1E7P B;  1XCT L;  1L0V B;  4R3D A;  1NEK B;  2HTM E;  3VR8 B;  4YXD B;  1C9F A;  1CJE A;  1ROE A;  1ZDX A;  3FAH A;  5TSS A;  3BVZ A;  3P63 A;  1T6B X;  1SJE D;  5BYQ A;  1PGA A;  4WH4 A;  1VZ6 A;  1UUP A;  3AE4 B;  1VZ8 A;  4Q2J A;  2NTS A;  2WDV B;  2WXP A;  2WXF A;  3B9J A;  1YQ4 B;  1ACC A;  2ZW0 A;  4XDC A;  5FK9 C;  4HKQ A;  3NRZ A;  4US9 A;  2RDH A;  1ZP0 B;  4N58 A;  4RF1 A;  2N7J A;  3Q8E A;  2V0G A;  1OQQ A;  2K0P A;  2LGI A;  1GPX A;  1ET6 A;  1QF6 A;  3CIR B;  3H8H A;  1XXG A;  1K51 A;  3GP7 A;  1XLN A;  1HA5 A;  2FE8 A;  3AEB B;  4OVZ A;  5HG2 A;  3TEZ A;  1E6E B;  1FFV A;  3U52 E;  1F0Z A;  3U7Z A;  3T3N A;  1QLB B;  2JU6 X;  1CQV A;  2JXT A;  3BII D;  4IKG A;  1M4V A;  1V8C A;  1QQR A;  4USA A;  2KAC A;  2AQ1 B;  2IJ0 A;  2YEP F;  1VJK A;  5D3I B;  2BB6 A;  2G1E A;  2LHE A;  1FFU A;  1N5W A;  4FXC A;  1I4P A;  3VRA B;  3AE2 B;  1QOF A;  2J52 A;  3I9V 1;  2WDQ B;  4TQ0 A;  2DBY A;  2INP E;  1D5M C;  1STE A;  1AW7 A;  2E6X A;  4RGT A;  3KLS X;  1BUI C;  1FIQ A;  1QOB A;  4UDU C;  1FEH A;  4P6V F;  2KMM A;  2LUM A;  2HDE A;  5D3D A;  2DYO A;  1SE4 A;  3VR9 B;  2W82 A;  1GB4 A;  1DYQ A;  4ZRP A;  1SIJ A;  2W3R A;  1PGB A;  4NJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...