4D2KA

Crystal structure of drep2 cide domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
RGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DREP2
publication title CIDE domains form functionally important higher-order assemblies for DNA fragmentation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Apoptosis
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4d2kA00
2JXTA 1UWXA 1YMHE 2KN4A 3FILA 4IOIE 1IBXA 1FD6A 2I2YA 1K50A 1KH0A 2K0PA 2LHEA 2RPVA 2PLPA 3FILB 4GLSC 2ON8A 2EELA 1GB1A 2PTLA 4HJGE 2KQ4X 2KACA 5HFYA 2ZW1A 1MHHE 1K53A 4KGSA 1PGXA 1Q10A 4OZCA 1MHXA 1XCTL 3GB1A 1IBXB 4KGTA 5BMIA 1FCLA 4IKGA 2N7JA 1K52A 2I38A 2LHDA 4WH4A 4KGRA 1MI0A 2GI9A 1JMLA 5JXVA 1QKZA 5HI1A 2JSVX 5BMHA 2N9KA 1K51A 5HG2A 1HZ5A 2KDMA 1XF5L 1HZ6A 4OZBA 1FCCC 3MP9A 1ZXHA 5BMGA 1MVKA 2JWUA 2NMQA 2QSDA 1F2RC 2KWDA 4HKZE 1F2RI 2OEDA 3UI3A 1MPEA 1P7EA 2LGIA 2GB1A 1D4BA 1GB4A 4OZAA 1YNTE 2J53A 1C9FA 2IGGA 2IGDA 1IGCA 1PGAA 2IGHA 2JU6X 1HEZE 4D2KA 2QMTA 2LUMA 1IGDA 1PGBA 2N9LA 2RMMA 5HHDG 2ZW0A 2ONQA 2JZPA 3V3XA 2PW9A 4MACA 1EM7A 1P7FA 2J52A 1XCQL
chains in the Genus database with same CATH superfamily
2KFJA 3PZ8A 1VZ6A 2R2QA 3UF8A 3OG5A 1WXVA 1S1QB 4A20A 2NCNA 4NZLB 2IO3B 4FULA 4NAWB 4NJ7A 4B0MA 1OEYJ 3VTWA 2QJLA 3ZGZA 2WXFA 3GOEA 1DGJA 3RZWC 4DHJB 4ANVA 3EFUA 1DOXA 4NNJB 2JRIB 2Q5WD 5BYSA 1E10A 2V9HA 4FXCA 2D10A 1GPXA 3ZIMA 1PGXA 3PRMB 3L13A 2KVZA 2N9EB 1V86A 3BYTB 3WANA 3L0WB 1FRDA 5AEKB 1L0XB 1V81A 1C4CA 2LHDA 4WAAA 1FMAD 2GBNA 1YJIA 3ZDMC 1V8CA 2I1JA 4G11A 4KKIA 3EECA 2O6VB 3H1UA 1EF5A 4AS1A 3ML9A 2DX5B 2RDGA 4MGIE 2LEKA 2REXA 2V0GA 1VD2A 1OQQA 2GBMA 3ZJTA 3Q8CA 1FXIA 5FK9C 3AXCA 5BYQA 3IBEA 3NS1A 5CTRC 4OVZA 1JWMD 1C4AA 2ICIA 2BGFA 2RMMA 4IM2A 2L1AA 4HDQA 4XZ4A 1JQ4A 2DAJA 1I4GA 3DBRI 1ZUD2 2BB5A 2MHJA 3AU5A 2D07B 1T0QC 3DBRB 3DBLI 1NEKB 3NHEB 1OGWA 1N61A 1I4QA 2WXNA 3DBLB 4XGAB 1LQBA 4GMVA 4US8A 3DWMA 4JX1C 4W9GA 4A3PA 3P4PB 1Z2MA 3PHXB 2BPSA 5IOIA 3HVDA 2KAJA 2C7HA 3AV8A 2DLBA 2H89B 3Q3NC 3SDLC 1FM0D 3WAOA 1WR6E 2N1VA 5TR5A 3NVZA 2KWUB 1AN8A 2INNE 1J7BA 3TSSA 3SD5A 2V3PA 3SFDB 3NOBA 4BBNF 1UF0A 5C1ZA 4DXGA 1SEBD 3Q8FA 2WU5B 3A9JB 3GZNI 1FXAA 3M63B 1KJTA 3MJWA 1QOFA 2HTHA 2WXJA 3HM6X 2SAKA 3ZTCA 1HZ6A 3QX1A 2KDFB 2L32A 1WGGA 2M4NA 1FFVA 2DYBA 4ICUA 5CHVC 2KC2A 2FAZA 2XNAC 1ZPSA 1IUEA 2J0JA 3ZQ4A 3HVZA 2PKOA 3N20C 4YL8A 2OHFA 5AZFA 2KTFA 1XQQA 2IGGA 4GDLB 1E0ZA 2JU6X 4ASWC 2Y5BB 3UQBA 3Q3JA 3Q3OC 1IGDA 4KSKC 5HHDG 3V61A 1VJKA 2BT6A 1BT0A 2DENB 2CR5A 4DQOC 1SB3C 1ESFA 2GBRA 2UU7A 1STEA 1YMHE 2PE6B 3ZO5B 4MSQB 3TEWA 2KMMA 4RFBA 2L52A 1Y8RC 2XK5A 4KV2A 5LXHA 4EKUA 2RD0A 3GP7A 2L05A 1I4RA 1UGJA 2A4ZA 4ARIA 3VUXA 1U4AA 2LVQA 3ONSA 3PLUA 2V3NA 3AEFB 4GN1A 4G3XB 3L08A 1WX9A 1FNVA 2RGFA 2KLGA 1CK1A 4XC2A 3PT2B 4E3CA 1ET6A 2DYOA 4A6QA 1YOVB 2LASA 3HM3A 2R2OA 2W55A 4N9F4 2KTRB 1J8CA 1V49A 4CHKA 1T5XD 2NTTA 4KGRA 2WXKA 1DOIA 1ZW7A 1I4HA 4FJZA 3WAPA 3AECB 1CZPA 2IZVB 2D3GA 4W9FA 2JXXA 4W9HA 2PPHA 1WF9A 1Y56A 2FE8A 1XLNA 4MEMA 3EFCA 4GSWA 2ZNVB 1OQRA 1SF0A 2CHZA 3VXWA 4ANXA 1BMLC 2DZKA 2KDIA 2KX3A 1V1PA 2LRUA 2BQQA 4KVGB 3B2GA 1C9FA 2IGDA 4CQNA 1XLQA 4P1CC 3AEBB 1KLGD 4WJOA 2N9LA 2MLBA 1XLPA 2D3AA 3RNCC 3CMMB 2JWZA 3RPFC 2PW9A 4MACA 2B76B 1XCQL 2BS2B 1H8CA 3RYTA 2MWSB 3S2AA 1XEEA 3NUHB 1K50A 2LGSA 5AZHA 3DHIC 3PGEA 3W1SC 1LFDA 3IFWB 3I5JC 4BAXA 1HXYD 3BWUD 2KANA 5DPWA 2ON8A 3LDZE 1WWTA 4PYZA 2BBCA 1KLUD 1UBQA 4XWWA 4A9AA 3VH4B 2KACA 1WJ4A 2K25A 3I9V1 4KKJA 2KT7A 2CU1A 3VTUA 4JL9A 1N63A 1WXSA 3Q3MC 3GB1A 4C7YA 2K8HA 3DVNV 2FCQA 3P4SB 3ABVB 4RGOS 3ZDTA 4IWPA 1RLFA 2LWPA 3E56A 1E5WA 3T8MA 1FIQA 4IM3A 2Z0EB 3AE9B 3QQ8B 2WXLA 2I1KA 5J17A 4W9DA 1ZXHA 2KLCA 5G2NA 3RI7C 1CMXB 1WSPA 2NMQA 5E6NA 2DWQA 3T3OA 1JWBD 4FA6A 3VVWB 2BKFA 3L16A 4FLHA 2LD9A 3QC8B 4MELA 4HCNB 3N30A 2WNMA 5CHWA 4OVVA 3AE7B 4WJPA 4IWOA 2L3ZA 1WFYA 4GU2A 3APCA 3C19A 4EFOA 2KVRA 4NAMA 2ONQA 1QQRA 5AZGA 2LXAA 3O65B 4WURA 5J18A 1GOZA 4LNNA 4LJOB 4YT0B 3VRBB 4XWTA 2W54A 2SEBD 4JLCA 2K0PA 3DPDA 2RPVA 1OTRB 3AE3B 3AE8B 3L10B 1TZOA 1KTKA 3WAMA 2ACZB 4WAFA 4C4VA 2K6QA 1MHHE 3JW0X 3P4QB 4BKSA 2N1WA 2GLSA 2PIAA 1WH3A 1V6EA 4DDGD 1JWSD 1NI2A 3V05A 1FCLA 2M0XA 5J2RA 3N32A 4XX5A 4E71A 2I38A 3AE5B 3ZVVA 1K51A 3QCAA 5EE3A 3V6EB 2EKEC 2K22A 3PRPB 2R61A 1E8ZA 3Q3FA 3MHSD 4HCPB 2IDYA 2KWDA 1L5PA 4HKZE 1SIJA 4MJSB 4OW0A 1JCKB 1TS3A 3UI3A 4P16A 3UIPB 1YN4A 2ZVNA 2MSED 3QIJA 3JYUA 2O2VB 4R3DA 3MC0B 4IUMB 3PPAA 1DYQA 1WGDA 5E6PA 4IG7B 4BVUC 1D6EC 2ZJDA 4IM0A 4USAA 2LGYA 1HEZE 1ZXIA 3MTNB 2DZMA 4RM8A 4F8CB 3Q2AC 5I4DA 4J6IA 4DDID 2M0AA 4XYCA 3AE6B 1QZEA 3Q8AA 4P7IA 2KFKA 1DOYA 2DYMA 4BKGA 1ZOYB 2JQRB 1V1OA 3KWVA 2WX0A 1FD6A 1P1AA 3P1MA 3AH7A 3ETRA 2LHEA 5C3JB 1V80A 2DZJA 2EKIA 2WYQA 3V60A 3MHZA 1OEYA 2MW5A 4YSXB 2IYDB 1GB1A 4EZLA 1UZXB 1F9JA 1EF1A 3UIOB 4ZRKA 1WJ6A 3AU4A 2KQ7A 4H2AA 2Y5PA 1QLBB 1PFDA 1WE7A 5AUKA 3B1LX 1IP9A 3N9YC 2DAFA 4HPPA 2AL3A 4EOYA 1TZ1A 1JROA 1KOTA 2X38A 1OQYA 2J42A 3A1QB 1K52A 1YQ3B 4ZYSA 2QIEB 3OAWA 1E8XA 3RNFC 3VH3B 1WXAA 5JH5C 3VRAB 1D5XC 1C4PA 1UD7A 3ZRCA 5H92C 4M0WA 3AULA 1BXTA 2KWVB 5IAAC 4OZBA 1JWAD 3CWIA 5FR6A 1RRBA 3NZ3A 1HQRD 2ZPYA 1L6UA 4LDTB 2BS3B 1WM3A 2AX5A 2LGDA 4M02A 2WS3B 5D6JB 1J7CA 5T8IA 2PE9A 4NAWA 3BY4B 2WXRA 1YNTE 4KSLC 3BINA 3AEAB 1F0ZA 3R2IA 2C5LC 3JSVB 3A9KA 3DWGC 1D5MC 3TL5A 4LLGM 2M1MA 1FNUA 1PUTA 1P7FA 1MG8A 1AARA 3RULA 3VUYA 1CJEA 4MSMB 1C77A 4IOIE 4JIOU 1GG3A 4MGYE 1F52A 3R66C 2WXPA 4WJNA 2WDRB 5DPTA 3M95A 1K8RB 3H6NA 1HTQA 2BKRB 1G6JA 3PRZA 4NJCA 3R8BA 1YX6B 3UQAA 2IJ0A 3RUIB 2O6VA 4W9KA 3VTVA 4HJGE 1GNUA 4PS3A 2MP2B 2WP9B 2NPTA 3RT3B 1AW7A 3HRDD 3A4RA 2MH7A 1V5TA 1P9DU 3ZXRA 1ZE3D 4XE0A 2NS5A 2V4IB 4ANWA 4ZYNA 2KJHB 2XN9C 3APDA 3LB8C 1Q0WB 2N7JA 1B9RA 2KDBA 2IBIB 2K3UA 2D5GA 2ZNVC 3EA6A 2W3SA 2ZCCA 1WYGA 5JHBA 3BYYB 5D3DA 4PT5A 1TGZB 5MPOA 2MQJA 3RFZB 3ZNGC 4W9EA 1F2RI 2WX1A 2KD0A 2OEDA 3CSTA 4KIKB 1WR1A 4AQ7A 2JX5A 1QF6A 2JUOA 1D4BA 2K8BA 1N6ZA 4FJYA 3DCGA 2IO1B 2JPHA 2LJ5A 3VAWA 3GZNB 3W1YA 4TMAB 2WDQB 3NY5A 2AL6A 4DXAB 3I3TB 1T6BX 2WXIA 2VRRB 3V3XA 1WY8A 3R2TA 1YX5B 3RNEC 3W5VB 4AP4C 2WDVB 2N7DA 3A4SC 5FR3A 2FUG1 1SJED 4XDCA 3IG3A 4LNKA 2NBUA 3C8YA 4W9JA 1NYRA 4LJPB 5JZEB 2BTEA 5G55A 1VR9A 1WJNA 2JT4B 2CU3A 2XK5B 2K8CA 3OLMD 4TV3A 3U7DA 2L0TA 3NVYA 3PVLA 1CQVA 2INCC 3N1XC 2M19A 3VDZA 1UNSA 2HJ1A 3VR8B 3ALBA 3AEEB 4MGKE 3QAQA 4ICVA 3N1YC 4RF0A 4GDLA 1E6EB 1V97A 2KMCA 2JY6A 1JALA 3PREA 3VHTC 1RYJA 4WH4A 4KDIC 3DVGY 3QJZA 4Q2JA 1N5XA 1EWCA 3VUWA 5HG2A 1HZ5A 2MBBB 3P4RB 1XF5L 3EGRA 1FXTB 2CJNA 4LNIA 5E6JA 3BIID 4JWUC 3UGBB 1D5ZC 2QHOA 1D3ZA 1MPEA 1QOAA 4AJWA 1KLVA 3DHHC 3IXSA 1WX8A 4B6WA 1T3QA 3DVNU 2AQ1B 2J53A 1SSNA 2DNFA 1KFYB 2D3BA 1WZ3A 3U4EG 5D2MB 1A70A 3TEYA 1QOBA 2LRWA 3TCAA 1TY0A 3SU8X 2C9WB 1HE8A 2ZCBA 1FFUA 3ZYYX 1OFFA 2KHWB 2IO0B 2MBQA 2BW2A 2V3SA 1YIWA 4RM9A 4QAYA 1PYWD 2ZEQA 4MGZE 3I63C 3BVGA 4NQLB 1UH6A 1SE2A 1I7HA 2FUHB 1TKGA 2BYVE 3PZDA 2PTLA 3DVGX 3ENEA 1E9MA 3U2SC 3K9PB 3TEXA 4W9IA 2LFIA 4PYUA 3OJ3A 2XBBC 4TQ0A 2BF8B 3BVMA 1P98A 2WDTB 1MJDA 3LXFA 2WXQA 2MJEA 2YEPF 1QILA 3H7PB 3QWZB 3U30A 3V62A 4UDUC 3PZ7A 1EUVB 1WZ0A 1GUAB 2J0KA 2QC8A 4GIVA 4NJ6A 4YXDB 5HI1A 3KQ4A 5IP4D 3VFKA 2NBVB 3DQVA 4IDIA 1EO6A 3TIXA 1NENB 3PHWB 3OJ4B 3MP9A 4AWJA 1E7UA 2L7RA 1SGHA 4WWPA 3TMPB 4K3BA 2K1FA 4EZKA 1ZDXA 1GB4A 1C79A 4REZA 3R7RA 4BKSD 4A3OA 3KW5B 1WYWB 4N6EB 4EEWA 2M8SA 2KXJA 4LCDE 1YN5A 4BFRA 4HVBA 3E9SA 1KRHA 4IC7B 2JZPA 2L83A 4ACFA 4RMAA 2JZZA 3LJ3A 1JW9D 4DXFA 4DK5A 3ZJVA 2MBEA 4K3CA 1XD3B 2MJ3A 2ZVOA 4MM3B 1ET9A 1EU4A 3P2BA 3RNGC 3ZNZB 3Q69A 1YD8U 1I42A 3GE8C 4W9CA 2KQ4X 3BVZA 1WM2A 3QHTA 3N1ZC 3W2DA 2KYWA 2N4FA 2RDHA 2KJRA 2JVCA 3SEBA 1WMHA 1L7YA 1Q10A 4OZCA 2BYEA 2HJ8A 5LXIB 1IBXB 5BMIA 2AQ3B 1GC6A 4IKGA 2L0FA 3KH0A 4K7WA 3L17A 2MBOA 3KUDB 2E3TA 1E7VA 4LTUA 1M4VA 2ZPNA 1P0RA 3M3JA 2KDMA 4HWIB 3URYA 3X0WA 1PQSA 3IAM1 2A5UA 1WGHA 3L54A 1PDXA 2JWUA 2MBHA 3GS2A 2Z8LA 5JHAA 1P7EA 4DBGA 1TKEA 5GMVA 1VZ7A 2LVPA 5L83A 1I4PA 2LXCA 1QOGA 2OOBB 5EDSA 2M56B 4ANUA 2BYTA 1C1YB 3NVWA 2LUMA 1LO5D 2G4SA 2ZW0A 4GXBA 1YJJA 4BOZB 1FO4A 2KX0A 4KZCA 1UWMA 1YN3A 3WIMA 3FILA 2VZKD 4GDKA 4PS8A 3W1SA 4IW0A 3CSFA 4L1BA 4NY0A 3RN9C 5IO9A 2J4XA 3UINB 2PLPA 4ZOHC 1FPYA 2EELA 3P63A 1RAXA 2KO3A 3PSEB 4EUTA 3QK0A 1RFAA 2G4DB 3PV1A 2WLBA 5EE9A 3PO0A 2G45B 1IPGA 1E8YA 3B9JA 2O2VA 5KHOA 3BK2A 4DHJD 1MHXA 5E6OA 4DHZB 2BVCA 4WQMA 5HKHA 4ZRJA 2KMAA 1TS4A 5DCNA 1VDVA 1H4RA 1L0VB 4HPLB 4AUQC 2JSVX 1NBFC 5BMHA 5GXGB 2INPE 2N9XA 1XXGA 3RMKC 1NI3A 3DDCB 4O1NA 1N5WA 4F1SA 2MRPA 3Q8EA 4JQWC 3Q8BA 1YQ4B 4C00A 1F2RC 1E90A 2O6VD 2RSUA 1VZ8A 1EU3A 2CHWA 1HA5A 1S3SG 3TJPA 3WA0A 2FCSA 3R7QA 3VR9B 3ML8A 4OZAA 4RF1A 2HDEA 4RH6A 1F1HA 1SE9A 4D2KA 1LXDA 2D3CA 2WHIA 1UUPA 2PVGC 1TBEA 3FAHA 4WWMA 2G3QB 4II2B 1HTOA 4C80A 2RPQA 3A9KB 3TEZA 2EMSA 3SHQA 2H88B 2IY1B 2FCNA 3A1QA 4F7ZA 1GJZA 4LK0M 3FKYA 3ZXVA 1VLBA 4FN2A 2DBYA 3WCQA 3B08A 3IT4B 2WXHA 5IA7A 2QEJC 1TKYA 4M00A 4I6LB 1WXQA 1WI0A 1ZKHA 4J3OD 4MH8A 2G9HD 2ZW1A 1ROEA 3HUIA 4RCOA 1L2NA 3I57A 4HK2A 5EE1A 2YLMA 2UWQA 2MCNB 3P42A 4WWOA 2NPTB 3OWEB 3IHPC 3JSVA 1TYGB 4BOSC 3PTFC 5IN7A 1WX7A 2Y5CA 1JRPA 3W9CB 2WXOA 2CS4A 2LMCA 4M8NA 3AM9A 4K7UA 4I6PA 1R7SA 4WIPA 1ZGUB 4HDOA 1FCCC 2J0MA 3C0RB 3QARA 2WXGA 1P3QU 4YSYB 1EWYC 2KK8A 3AB5A 2ZZPB 3AEDB 1M94A 2BYFA 5IKCM 1TS5A 1WJUA 3B2FA 1WRIA 2K9XA 2LGIA 1C76A 2HTME 2JYEA 4TQ1A 2KNBA 1N62A 3ZRFA 4ZHOA 2M17A 4YTPB 4PS7A 4HEA1 3H8HA 1PGBA 1L6VA 2MP2A 5BYRA 2KDEB 4CYEA 2W82A 3VQIA 3KUZA 5C23A 4S0RA 2D11A 1Z5SB 2DHZA 4BBNC 1TS2A 3Q14C 4KX6B 1X1MA 3NS8A 2KN4A 2Z0DB 1RM6C 4N58A 3T9LA 4OHJA 3NG0A 3MC9A 3ZKJC 1WE6A 1UGMA 2IY0B 1SE4A 3RZFA 3KYCD 3CIRB 1VRAB 4HPMB 4E74A 4MDKE 3H7SA 3HHMA 4TSSA 1XLOA 2C60A 4YSZB 3PS6A 1E7PB 2BWES 2GBJA 1SXTA 2KQSA 4KIKA 4YTNB 4EZJA 4M8MA 1FEHA 5CHFA 3A9JA 4M01A 4AJYB 3APFA 1L4ZB 3RNAC 1TY2A 3ECIA 3CF6E 3AMZA 5JXVA 1NDDA 4MT5A 2LJIA 3MC8A 1MG4A 3V6CB 3ZNID 2NVUI 3W5UB 5KHQA 2KWCA 1WIAA 4ZDVA 1NVID 2CJOA 4L23A 2GMIC 3SR6A 2GBKA 2FCMA 1Q5WB 1I4XA 4JPSA 4X57B 1SJHD 3DHGC 1ZDVA 2KJ6A 1ISNA 1B1ZA 3EUB2 2C7NB 2JYTA 3N3KB 2QDFA 5CX3A 4NQKE 1YJ1A 2ASQA 3TBLD 1T0RC 2AYOB 3MFGA 1T0SC 1SIFA 1C3TA 1WRDB 4WJQA 5G5GA 1V9JA 3NRZA 4NPNA 1JRUA 1FNWA 2LZ6A 3NVVA 4ZRPA 2JRHA 4KDLB 2JXTA 2IO2B 5DPRA 2LUEA 4N59A 1J0GA 4GOCA 3AE1B 5AUIA 1KH0A 3TUOA 4B95A 1V5OA 3EC8A 3LYYA 1V1PB 5LNK1 2L8JA 4GLSC 5D7GA 1YQBA 2NR2A 5HFYA 1SBBB 2KTRA 3ZLZA 1RFKA 3K9OB 4KGSA 1J7AA 1L0YB 1Q1OA 2TSSA 2CKHB 2IPKD 4K1RB 4WWNA 2GRIA 5C2TB 1AWDA 3D32A 4ZHPA 4C56C 4RGTA 1XO3A 2OJRA 3IT6B 3KUCB 5EE0A 4MH0E 1MI0A 1BUIC 1JMLA 2FBWB 2LGXA 2KZRA 4CO7A 4HJKA 2KC1A 2RDBC 3X23A 2Y3AA 1ZP0B 3R3MA 2KKCA 3KVFB 3ZJUA 2VH1A 1FRRA 2J7QB 2QILA 4XDDA 3RCZA 2FNJB 4L2YA 4A55A 2LVOA 2FIFA 3NJTA 4IWQA 2N7EA 1T0YA 4S17A 3HIZA 2V4LA 2K5PA 1NYQA 2CHXA 1RWSA 2LI5A 5TSSA 1F77A 2Z59B 3NZSA 1SE3A 4FJVB 3BK1A 3ZNHB 4FADA 1XT9B 1KF6B 3J9CA 1UWXA 2D2QA 3H7PA 3DBHI 1TTNA 4K81A 2WQYB 3HK0A 2UYZB 3H9DA 1I35A 3DBHB 1ACCA 2EMTA 4GB9A 4P1BC 2K39A 4JE3B 4ZRQA 3AE2B 3ZW3A 3A33B 2L76A 3NZUA 2QCZA 3KWLA 2VH2A 2JZ3B 4HKQA 4RGNA 1TIFA 2GOWA 2KN5A 2FIDA 5L95C 1WXMA 3MJ5A 2WU2B 4B9KA 4DHZE 4US9A 4HROA 2WXMA 4FHKA 2PVOD 4HRSA 2V1YA 1C78A 5DPSA 1XCTL 4K7SA 4LNFA 4KGTA 1UELA 4BKTA 1WMHB 1R4NI 2GI9A 5FKAC 1QKZA 4ARCA 1R4NB 3WALA 4ITKA 3U8ZA 3JVZX 2HE7A 2WGSA 3RD2A 2YVCA 1V2YA 4W9LA 2MEKA 4GGQA 4RGMA 1N60A 3BZDB 4C4VB 4EE2A 2QSDA 4BZAA 2C7MB 1TJEA 5D3IB 1LGRA 4MM3A 2BB6A 3DBSA 2GB1A 1MFWA 3QA8A 4JGHB 4AOFA 4TKNA 2G1EA 1IGCA 4ZRIA 2IGHA 2NBWB 2B3AA 3L4PA 5H8YE 2E6XA 1TT5B 1WGKA 2BWFA 5LLIA 3KYDD 4HLEA 3AI5A 3KLSX 2J52A 2YEPB 3DOWA 4TUUA 3U7ZA 2N9PC 3AN1A 1IBXA 2AQ2B 2I2YA 3ZUNA 4HXDA 2WWZA 2XEWA 1IYFA 3FILB 4GDKB 4P6VF 2BS4B 1E8WA 3FC4A 4G50A 1KM7A 1GC7A 4G0NB 4JWSC 4II3B 4PK1A 3AEGB 2OJWA 4URKA 1K53A 2PEAA 3SFEB 2MX2A 2KFKB 1GAQB 2DZIA 3M62B 3T3NA 2AWTA 2KOXA 4A8XC 2N0SB 2PJHA 1LM8B 1ENFA 1L4DB 4WQOB 5D94A 2INDC 1JWUD 4FHJA 2K6DB 5BO4B 3EHVA 2X8XX 3U52E 4LNOA 4C7ZA 1A5RA 2RR9A 5G5HA 1J19A 3IVFA 4OVUA 2N9KA 2MJDA 4MJSA 1QT9A 2NTSA 1VCBA 4YTMB 2HD5B 3PLVA 5BMGA 1MVKA 3Q6BA 2JF5A 4RNAA 1WGRA 1UBIA 3AE4B 4LDTD 4FBJB 2MA9B 4I6NB 1WGYA 4YWGG 1PGAA 3GE3C 2QMTA 4KZ0A 3B0AA 2PMVA 3ZTDA 2VZKB 4B0EA 1AYFA 1R4MI 4DWFA 3IAS1 3O13A 2W9NA 4M0WB 3RNBC 1EM7A 2W3RA 2AEHA 2L00B 1R4MB 4A90A
chains in the Genus database with same CATH topology
2KN4A 2BW2A 3PZ8A 1RM6C 1VZ6A 4WURA 4N58A 1GOZA 4OHJA 4YT0B 3VRBB 4XWTA 1PYWD 2W54A 2SEBD 2K0PA 3BVGA 2RPVA 4NZLB 1SE2A 1I7HA 3AE3B 1TKGA 3AE8B 4NAWB 1SE4A 1TZOA 4B0MA 1KTKA 3CIRB 1VRAB 2PTLA 2ACZB 1E9MA 4WAFA 3U2SC 2QJLA 4TSSA 1XLOA 3ZGZA 3TEXA 4YSZB 2WXFA 1DGJA 1E7PB 1SXTA 1MHHE 2LFIA 3P4QB 4YTNB 4TQ0A 1DOXA 3BVMA 2Q5WD 5BYSA 1E10A 1FEHA 4FXCA 1GPXA 1PGXA 2PIAA 3LXFA 2WXQA 2MJEA 2YEPF 1QILA 1JWSD 1L4ZB 3BYTB 3V05A 4UDUC 3PZ7A 1FCLA 1FRDA 1L0XB 1TY2A 2I38A 1C4CA 2LHDA 3AMZA 5JXVA 4MT5A 2LJIA 1FMAD 3AE5B 1YJIA 4YXDB 5HI1A 1V8CA 1K51A 3KQ4A 3W5UB 5EE3A 4KKIA 4IDIA 1NENB 2K22A 3MP9A 1NVID 2R61A 2CJOA 4L23A 2IDYA 3SR6A 4AS1A 2KWDA 1L5PA 4HKZE 1SIJA 1I4XA 2RDGA 4JPSA 4OW0A 1JCKB 1SJHD 1TS3A 2LEKA 4P16A 3UI3A 1YN4A 1ZDVA 2V0GA 1B1ZA 3EUB2 2JYTA 4R3DA 1OQQA 1ZDXA 3MC0B 3ZJTA 1GB4A 1DYQA 1C79A 3MFGA 1FXIA 3Q8CA 4REZA 1D6EC 5FK9C 4USAA 1HEZE 1ZXIA 4N6EB 5BYQA 3NS1A 5G5GA 4OVZA 1JWMD 3NRZA 5I4DA 1C4AA 2ICIA 1YN5A 2RMMA 1FNWA 3NVVA 2L1AA 2M0AA 3AE6B 3E9SA 1KRHA 2JZPA 3Q8AA 1DOYA 4ZRPA 1JQ4A 2DYMA 2L83A 1ZOYB 1I4GA 2JQRB 1V1OA 2JXTA 3KWVA 1ZUD2 2BB5A 1JW9D 4N59A 1FD6A 3P1MA 4DXFA 3ZJVA 1NEKB 3AH7A 3AE1B 5AUIA 1KH0A 3TUOA 3ETRA 2LHEA 5C3JB 3LYYA 1N61A 2EKIA 1I4QA 2WXNA 1V1PB 5LNK1 2MJ3A 4MM3B 4GLSC 1ET9A 1EU4A 3MHZA 4US8A 5D7GA 4YSXB 1GB1A 3DWMA 3Q69A 4JX1C 3P4PB 2KQ4X 3BVZA 4H2AA 3W2DA 3HVDA 5HFYA 2Y5PA 1SBBB 2RDHA 2KAJA 1QLBB 3AV8A 2DLBA 2H89B 1PFDA 1RFKA 4KGSA 3SEBA 1J7AA 5AUKA 1L0YB 3N9YC 2TSSA 1FM0D 2IPKD 2GRIA 3NVZA 1Q10A 5C2TB 1AN8A 1AWDA 4OZCA 4ZHPA 1JROA 4C56C 2X38A 4RGTA 2INNE 1J7BA 3TSSA 1IBXB 1XO3A 2W3RA 2AQ3B 5BMIA 2V3PA 2J42A 4IKGA 3SFDB 3IT6B 5EE0A 1K52A 4DXGA 1SEBD 1YQ3B 3Q8FA 2QIEB 4ZYSA 1MI0A 2WU5B 1BUIC 1JMLA 2FBWB 2E3TA 1FXAA 4LTUA 1QOFA 1M4VA 2WXJA 3VRAB 1D5XC 1C4PA 2KDMA 2SAKA 5H92C 4M0WA 2Y3AA 1HZ6A 1BXTA 3URYA 1ZP0B 4OZBA 3IAM1 1JWAD 3CWIA 3NZ3A 1HQRD 1PDXA 2JWUA 2L32A 3ZJUA 1L6UA 2BS3B 1FRRA 1FFVA 3GS2A 2QILA 2AX5A 4XDDA 2Z8LA 2WS3B 4L2YA 4A55A 1P7EA 2XNAC 1J7CA 1TKEA 1ZPSA 1IUEA 3ZQ4A 5T8IA 3HVZA 2PKOA 1VZ7A 2OHFA 1I4PA 1YNTE 2WXRA 1QOGA 2IGGA 4GDLB 3AEAB 1E0ZA 2JU6X 2K5PA 1NYQA 1F0ZA 3R2IA 2M56B 2BYTA 1RWSA 3DWGC 5TSSA 3NVWA 1F77A 2LUMA 1LO5D 1IGDA 1D5MC 5HHDG 1SE3A 1VJKA 2BT6A 2ZW0A 4LLGM 1YJJA 3BK1A 1FNUA 1SB3C 4DQOC 1ESFA 1PUTA 1P7FA 1FO4A 1STEA 1KF6B 3J9CA 1UWMA 1UWXA 1YN3A 1YMHE 3FILA 2VZKD 1CJEA 3TEWA 3W1SA 1C77A 4IOIE 2KMMA 4RFBA 2L52A 2WQYB 4L1BA 2WXPA 1ACCA 2J4XA 2WDRB 3GP7A 2PLPA 4ZOHC 1I4RA 1UGJA 4NJCA 3R8BA 4ARIA 4JE3B 2EELA 4ZRQA 3AE2B 2V3NA 3P63A 2IJ0A 3AEFB 3KWLA 4HJGE 4HKQA 4RGNA 2WLBA 2WP9B 3MJ5A 1FNVA 2WU2B 5EE9A 3PO0A 4US9A 1AW7A 1CK1A 3HRDD 4HROA 2WXMA 2MH7A 3B9JA 1ET6A 2PVOD 4HRSA 1ZE3D 2DYOA 3BK2A 4XE0A 4A6QA 1MHXA 1C78A 2W55A 1XCTL 2V4IB 4KGTA 2XN9C 3LB8C 4WQMA 2N7JA 1B9RA 1T5XD 2NTTA 4KGRA 2WXKA 2K3UA 1DOIA 2GI9A 1TS4A 1I4HA 1VDVA 5FKAC 1L0VB 1QKZA 2D5GA 3AECB 4ARCA 1CZPA 2JSVX 4ITKA 5BMHA 3EA6A 5GXGB 2W3SA 1Y56A 2INPE 2FE8A 1XLNA 1WYGA 1XXGA 3BYYB 1NI3A 5D3DA 1OQRA 4PT5A 1SF0A 4O1NA 5MPOA 2MEKA 1N5WA 3RFZB 4RGMA 1N60A 3BZDB 3Q8EA 3Q8BA 1YQ4B 4EE2A 2QSDA 1F2RC 1F2RI 1BMLC 2OEDA 4AQ7A 1V1PA 1VZ8A 2JX5A 1TJEA 1EU3A 1QF6A 5D3IB 2BB6A 1HA5A 2GB1A 1D4BA 3B2GA 3VR9B 4OZAA 1C9FA 4RF1A 2HDEA 2IGDA 4CQNA 2G1EA 1IGCA 2IGHA 4RH6A 4D2KA 1XLQA 4TMAB 2WDQB 3L4PA 5H8YE 3AEBB 1KLGD 1UUPA 2N9LA 2E6XA 2PVGC 1XLPA 3FAHA 4WWMA 1T6BX 1WGKA 2WXIA 3V3XA 4C80A 2PW9A 3R2TA 3W5VB 3KLSX 4MACA 2B76B 2J52A 2YEPB 1XCQL 2WDVB 2BS2B 3U7ZA 3TEZA 1XEEA 3AN1A 1IBXA 2AQ2B 2H88B 3NUHB 2I2YA 1K50A 5FR3A 2FUG1 1SJED 4LK0M 4XDCA 1VLBA 3C8YA 3FILB 4GDKB 1HXYD 2DBYA 3BWUD 4P6VF 1NYRA 2BS4B 2ON8A 3WCQA 3FC4A 3IT4B 2WXHA 2BTEA 1WWTA 2QEJC 1VR9A 2BBCA 1TKYA 1KLUD 2CU3A 4JWSC 4XWWA 4A9AA 1WXQA 2KACA 3AEGB 4J3OD 4MH8A 2G9HD 2ZW1A 1ROEA 3I9V1 3NVYA 1CQVA 3HUIA 4RCOA 1K53A 4KKJA 2M19A 3I57A 3VR8B 1UNSA 5EE1A 3SFEB 3T3NA 1GAQB 1N63A 3AEEB 4A8XC 2N0SB 1ENFA 1L4DB 4RF0A 3GB1A 4C7YA 1E6EB 1V97A 1JWUD 3P42A 3OWEB 1JALA 1RYJA 3P4SB 3ABVB 4RGOS 4WH4A 3U52E 1TYGB 4C7ZA 4Q2JA 1N5XA 1EWCA 3E56A 3W9CB 2Y5CA 1JRPA 5G5HA 2WXOA 2LMCA 3AM9A 1FIQA 2N9KA 2MJDA 5HG2A 1HZ5A 3AE9B 3P4RB 1QT9A 1XF5L 1R7SA 2NTSA 2WXLA 3EGRA 4WIPA 4YTMB 2CJNA 1FCCC 5E6JA 3BIID 1ZXHA 5BMGA 1MVKA 1WSPA 2NMQA 2DWQA 3T3OA 4JWUC 4RNAA 1JWBD 2WXGA 4YSYB 1EWYC 3AB5A 3AEDB 1D5ZC 1MPEA 1QOAA 3AE4B 1TS5A 3B2FA 1WRIA 2K9XA 3IXSA 2LGIA 1C76A 2HTME 1T3QA 2AQ1B 2J53A 2JYEA 2WNMA 4TQ1A 1N62A 1PGAA 4YWGG 1SSNA 4ZHOA 1KFYB 2QMTA 3AE7B 4YTPB 4HEA1 2PMVA 3U4EG 3H8HA 1PGBA 1L6VA 5BYRA 1A70A 2VZKB 4B0EA 3TEYA 2W82A 4NAMA 2ONQA 3VQIA 1QOBA 1QQRA 3IAS1 1TY0A 3O13A 1FFUA 3ZYYX 1OFFA 1EM7A 1TS2A 1AYFA 3RPFC 4KX6B 4A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXT A;  1UWX A;  1YMH E;  2KN4 A;  3FIL A;  4IOI E;  1IBX A;  1FD6 A;  2I2Y A;  1K50 A;  1KH0 A;  2K0P A;  2LHE A;  2RPV A;  2PLP A;  3FIL B;  4GLS C;  2ON8 A;  2EEL A;  1GB1 A;  2PTL A;  4HJG E;  2KQ4 X;  2KAC A;  5HFY A;  2ZW1 A;  1MHH E;  1K53 A;  4KGS A;  1PGX A;  1Q10 A;  4OZC A;  1MHX A;  1XCT L;  3GB1 A;  1IBX B;  4KGT A;  5BMI A;  1FCL A;  4IKG A;  2N7J A;  1K52 A;  2I38 A;  2LHD A;  4WH4 A;  4KGR A;  1MI0 A;  2GI9 A;  1JML A;  5JXV A;  1QKZ A;  5HI1 A;  2JSV X;  5BMH A;  2N9K A;  1K51 A;  5HG2 A;  1HZ5 A;  2KDM A;  1XF5 L;  1HZ6 A;  4OZB A;  1FCC C;  3MP9 A;  1ZXH A;  5BMG A;  1MVK A;  2JWU A;  2NMQ A;  2QSD A;  1F2R C;  2KWD A;  4HKZ E;  1F2R I;  2OED A;  3UI3 A;  1MPE A;  1P7E A;  2LGI A;  2GB1 A;  1D4B A;  1GB4 A;  4OZA A;  1YNT E;  2J53 A;  1C9F A;  2IGG A;  2IGD A;  1IGC A;  1PGA A;  2IGH A;  2JU6 X;  1HEZ E;  4D2K A;  2QMT A;  2LUM A;  1IGD A;  1PGB A;  2N9L A;  2RMM A;  5HHD G;  2ZW0 A;  2ONQ A;  2JZP A;  3V3X A;  2PW9 A;  4MAC A;  1EM7 A;  1P7F A;  2J52 A;  1XCQ L; 
#chains in the Genus database with same CATH topology
 2KFJ A;  3PZ8 A;  1VZ6 A;  2R2Q A;  3UF8 A;  3OG5 A;  1WXV A;  1S1Q B;  4A20 A;  2NCN A;  4NZL B;  2IO3 B;  4FUL A;  4NAW B;  4NJ7 A;  4B0M A;  1OEY J;  3VTW A;  2QJL A;  3ZGZ A;  2WXF A;  3GOE A;  1DGJ A;  3RZW C;  4DHJ B;  4ANV A;  3EFU A;  1DOX A;  4NNJ B;  2JRI B;  2Q5W D;  5BYS A;  1E10 A;  2V9H A;  4FXC A;  2D10 A;  1GPX A;  3ZIM A;  1PGX A;  3PRM B;  3L13 A;  2KVZ A;  2N9E B;  1V86 A;  3BYT B;  3WAN A;  3L0W B;  1FRD A;  5AEK B;  1L0X B;  1V81 A;  1C4C A;  2LHD A;  4WAA A;  1FMA D;  2GBN A;  1YJI A;  3ZDM C;  1V8C A;  2I1J A;  4G11 A;  4KKI A;  3EEC A;  2O6V B;  3H1U A;  1EF5 A;  4AS1 A;  3ML9 A;  2DX5 B;  2RDG A;  4MGI E;  2LEK A;  2REX A;  2V0G A;  1VD2 A;  1OQQ A;  2GBM A;  3ZJT A;  3Q8C A;  1FXI A;  5FK9 C;  3AXC A;  5BYQ A;  3IBE A;  3NS1 A;  5CTR C;  4OVZ A;  1JWM D;  1C4A A;  2ICI A;  2BGF A;  2RMM A;  4IM2 A;  2L1A A;  4HDQ A;  4XZ4 A;  1JQ4 A;  2DAJ A;  1I4G A;  3DBR I;  1ZUD 2;  2BB5 A;  2MHJ A;  3AU5 A;  2D07 B;  1T0Q C;  3DBR B;  3DBL I;  1NEK B;  3NHE B;  1OGW A;  1N61 A;  1I4Q A;  2WXN A;  3DBL B;  4XGA B;  1LQB A;  4GMV A;  4US8 A;  3DWM A;  4JX1 C;  4W9G A;  4A3P A;  3P4P B;  1Z2M A;  3PHX B;  2BPS A;  5IOI A;  3HVD A;  2KAJ A;  2C7H A;  3AV8 A;  2DLB A;  2H89 B;  3Q3N C;  3SDL C;  1FM0 D;  3WAO A;  1WR6 E;  2N1V A;  5TR5 A;  3NVZ A;  2KWU B;  1AN8 A;  2INN E;  1J7B A;  3TSS A;  3SD5 A;  2V3P A;  3SFD B;  3NOB A;  4BBN F;  1UF0 A;  5C1Z A;  4DXG A;  1SEB D;  3Q8F A;  2WU5 B;  3A9J B;  3GZN I;  1FXA A;  3M63 B;  1KJT A;  3MJW A;  1QOF A;  2HTH A;  2WXJ A;  3HM6 X;  2SAK A;  3ZTC A;  1HZ6 A;  3QX1 A;  2KDF B;  2L32 A;  1WGG A;  2M4N A;  1FFV A;  2DYB A;  4ICU A;  5CHV C;  2KC2 A;  2FAZ A;  2XNA C;  1ZPS A;  1IUE A;  2J0J A;  3ZQ4 A;  3HVZ A;  2PKO A;  3N20 C;  4YL8 A;  2OHF A;  5AZF A;  2KTF A;  1XQQ A;  2IGG A;  4GDL B;  1E0Z A;  2JU6 X;  4ASW C;  2Y5B B;  3UQB A;  3Q3J A;  3Q3O C;  1IGD A;  4KSK C;  5HHD G;  3V61 A;  1VJK A;  2BT6 A;  1BT0 A;  2DEN B;  2CR5 A;  4DQO C;  1SB3 C;  1ESF A;  2GBR A;  2UU7 A;  1STE A;  1YMH E;  2PE6 B;  3ZO5 B;  4MSQ B;  3TEW A;  2KMM A;  4RFB A;  2L52 A;  1Y8R C;  2XK5 A;  4KV2 A;  5LXH A;  4EKU A;  2RD0 A;  3GP7 A;  2L05 A;  1I4R A;  1UGJ A;  2A4Z A;  4ARI A;  3VUX A;  1U4A A;  2LVQ A;  3ONS A;  3PLU A;  2V3N A;  3AEF B;  4GN1 A;  4G3X B;  3L08 A;  1WX9 A;  1FNV A;  2RGF A;  2KLG A;  1CK1 A;  4XC2 A;  3PT2 B;  4E3C A;  1ET6 A;  2DYO A;  4A6Q A;  1YOV B;  2LAS A;  3HM3 A;  2R2O A;  2W55 A;  4N9F 4;  2KTR B;  1J8C A;  1V49 A;  4CHK A;  1T5X D;  2NTT A;  4KGR A;  2WXK A;  1DOI A;  1ZW7 A;  1I4H A;  4FJZ A;  3WAP A;  3AEC B;  1CZP A;  2IZV B;  2D3G A;  4W9F A;  2JXX A;  4W9H A;  2PPH A;  1WF9 A;  1Y56 A;  2FE8 A;  1XLN A;  4MEM A;  3EFC A;  4GSW A;  2ZNV B;  1OQR A;  1SF0 A;  2CHZ A;  3VXW A;  4ANX A;  1BML C;  2DZK A;  2KDI A;  2KX3 A;  1V1P A;  2LRU A;  2BQQ A;  4KVG B;  3B2G A;  1C9F A;  2IGD A;  4CQN A;  1XLQ A;  4P1C C;  3AEB B;  1KLG D;  4WJO A;  2N9L A;  2MLB A;  1XLP A;  2D3A A;  3RNC C;  3CMM B;  2JWZ A;  3RPF C;  2PW9 A;  4MAC A;  2B76 B;  1XCQ L;  2BS2 B;  1H8C A;  3RYT A;  2MWS B;  3S2A A;  1XEE A;  3NUH B;  1K50 A;  2LGS A;  5AZH A;  3DHI C;  3PGE A;  3W1S C;  1LFD A;  3IFW B;  3I5J C;  4BAX A;  1HXY D;  3BWU D;  2KAN A;  5DPW A;  2ON8 A;  3LDZ E;  1WWT A;  4PYZ A;  2BBC A;  1KLU D;  1UBQ A;  4XWW A;  4A9A A;  3VH4 B;  2KAC A;  1WJ4 A;  2K25 A;  3I9V 1;  4KKJ A;  2KT7 A;  2CU1 A;  3VTU A;  4JL9 A;  1N63 A;  1WXS A;  3Q3M C;  3GB1 A;  4C7Y A;  2K8H A;  3DVN V;  2FCQ A;  3P4S B;  3ABV B;  4RGO S;  3ZDT A;  4IWP A;  1RLF A;  2LWP A;  3E56 A;  1E5W A;  3T8M A;  1FIQ A;  4IM3 A;  2Z0E B;  3AE9 B;  3QQ8 B;  2WXL A;  2I1K A;  5J17 A;  4W9D A;  1ZXH A;  2KLC A;  5G2N A;  3RI7 C;  1CMX B;  1WSP A;  2NMQ A;  5E6N A;  2DWQ A;  3T3O A;  1JWB D;  4FA6 A;  3VVW B;  2BKF A;  3L16 A;  4FLH A;  2LD9 A;  3QC8 B;  4MEL A;  4HCN B;  3N30 A;  2WNM A;  5CHW A;  4OVV A;  3AE7 B;  4WJP A;  4IWO A;  2L3Z A;  1WFY A;  4GU2 A;  3APC A;  3C19 A;  4EFO A;  2KVR A;  4NAM A;  2ONQ A;  1QQR A;  5AZG A;  2LXA A;  3O65 B;  4WUR A;  5J18 A;  1GOZ A;  4LNN A;  4LJO B;  4YT0 B;  3VRB B;  4XWT A;  2W54 A;  2SEB D;  4JLC A;  2K0P A;  3DPD A;  2RPV A;  1OTR B;  3AE3 B;  3AE8 B;  3L10 B;  1TZO A;  1KTK A;  3WAM A;  2ACZ B;  4WAF A;  4C4V A;  2K6Q A;  1MHH E;  3JW0 X;  3P4Q B;  4BKS A;  2N1W A;  2GLS A;  2PIA A;  1WH3 A;  1V6E A;  4DDG D;  1JWS D;  1NI2 A;  3V05 A;  1FCL A;  2M0X A;  5J2R A;  3N32 A;  4XX5 A;  4E71 A;  2I38 A;  3AE5 B;  3ZVV A;  1K51 A;  3QCA A;  5EE3 A;  3V6E B;  2EKE C;  2K22 A;  3PRP B;  2R61 A;  1E8Z A;  3Q3F A;  3MHS D;  4HCP B;  2IDY A;  2KWD A;  1L5P A;  4HKZ E;  1SIJ A;  4MJS B;  4OW0 A;  1JCK B;  1TS3 A;  3UI3 A;  4P16 A;  3UIP B;  1YN4 A;  2ZVN A;  2MSE D;  3QIJ A;  3JYU A;  2O2V B;  4R3D A;  3MC0 B;  4IUM B;  3PPA A;  1DYQ A;  1WGD A;  5E6P A;  4IG7 B;  4BVU C;  1D6E C;  2ZJD A;  4IM0 A;  4USA A;  2LGY A;  1HEZ E;  1ZXI A;  3MTN B;  2DZM A;  4RM8 A;  4F8C B;  3Q2A C;  5I4D A;  4J6I A;  4DDI D;  2M0A A;  4XYC A;  3AE6 B;  1QZE A;  3Q8A A;  4P7I A;  2KFK A;  1DOY A;  2DYM A;  4BKG A;  1ZOY B;  2JQR B;  1V1O A;  3KWV A;  2WX0 A;  1FD6 A;  1P1A A;  3P1M A;  3AH7 A;  3ETR A;  2LHE A;  5C3J B;  1V80 A;  2DZJ A;  2EKI A;  2WYQ A;  3V60 A;  3MHZ A;  1OEY A;  2MW5 A;  4YSX B;  2IYD B;  1GB1 A;  4EZL A;  1UZX B;  1F9J A;  1EF1 A;  3UIO B;  4ZRK A;  1WJ6 A;  3AU4 A;  2KQ7 A;  4H2A A;  2Y5P A;  1QLB B;  1PFD A;  1WE7 A;  5AUK A;  3B1L X;  1IP9 A;  3N9Y C;  2DAF A;  4HPP A;  2AL3 A;  4EOY A;  1TZ1 A;  1JRO A;  1KOT A;  2X38 A;  1OQY A;  2J42 A;  3A1Q B;  1K52 A;  1YQ3 B;  4ZYS A;  2QIE B;  3OAW A;  1E8X A;  3RNF C;  3VH3 B;  1WXA A;  5JH5 C;  3VRA B;  1D5X C;  1C4P A;  1UD7 A;  3ZRC A;  5H92 C;  4M0W A;  3AUL A;  1BXT A;  2KWV B;  5IAA C;  4OZB A;  1JWA D;  3CWI A;  5FR6 A;  1RRB A;  3NZ3 A;  1HQR D;  2ZPY A;  1L6U A;  4LDT B;  2BS3 B;  1WM3 A;  2AX5 A;  2LGD A;  4M02 A;  2WS3 B;  5D6J B;  1J7C A;  5T8I A;  2PE9 A;  4NAW A;  3BY4 B;  2WXR A;  1YNT E;  4KSL C;  3BIN A;  3AEA B;  1F0Z A;  3R2I A;  2C5L C;  3JSV B;  3A9K A;  3DWG C;  1D5M C;  3TL5 A;  4LLG M;  2M1M A;  1FNU A;  1PUT A;  1P7F A;  1MG8 A;  1AAR A;  3RUL A;  3VUY A;  1CJE A;  4MSM B;  1C77 A;  4IOI E;  4JIO U;  1GG3 A;  4MGY E;  1F52 A;  3R66 C;  2WXP A;  4WJN A;  2WDR B;  5DPT A;  3M95 A;  1K8R B;  3H6N A;  1HTQ A;  2BKR B;  1G6J A;  3PRZ A;  4NJC A;  3R8B A;  1YX6 B;  3UQA A;  2IJ0 A;  3RUI B;  2O6V A;  4W9K A;  3VTV A;  4HJG E;  1GNU A;  4PS3 A;  2MP2 B;  2WP9 B;  2NPT A;  3RT3 B;  1AW7 A;  3HRD D;  3A4R A;  2MH7 A;  1V5T A;  1P9D U;  3ZXR A;  1ZE3 D;  4XE0 A;  2NS5 A;  2V4I B;  4ANW A;  4ZYN A;  2KJH B;  2XN9 C;  3APD A;  3LB8 C;  1Q0W B;  2N7J A;  1B9R A;  2KDB A;  2IBI B;  2K3U A;  2D5G A;  2ZNV C;  3EA6 A;  2W3S A;  2ZCC A;  1WYG A;  5JHB A;  3BYY B;  5D3D A;  4PT5 A;  1TGZ B;  5MPO A;  2MQJ A;  3RFZ B;  3ZNG C;  4W9E A;  1F2R I;  2WX1 A;  2KD0 A;  2OED A;  3CST A;  4KIK B;  1WR1 A;  4AQ7 A;  2JX5 A;  1QF6 A;  2JUO A;  1D4B A;  2K8B A;  1N6Z A;  4FJY A;  3DCG A;  2IO1 B;  2JPH A;  2LJ5 A;  3VAW A;  3GZN B;  3W1Y A;  4TMA B;  2WDQ B;  3NY5 A;  2AL6 A;  4DXA B;  3I3T B;  1T6B X;  2WXI A;  2VRR B;  3V3X A;  1WY8 A;  3R2T A;  1YX5 B;  3RNE C;  3W5V B;  4AP4 C;  2WDV B;  2N7D A;  3A4S C;  5FR3 A;  2FUG 1;  1SJE D;  4XDC A;  3IG3 A;  4LNK A;  2NBU A;  3C8Y A;  4W9J A;  1NYR A;  4LJP B;  5JZE B;  2BTE A;  5G55 A;  1VR9 A;  1WJN A;  2JT4 B;  2CU3 A;  2XK5 B;  2K8C A;  3OLM D;  4TV3 A;  3U7D A;  2L0T A;  3NVY A;  3PVL A;  1CQV A;  2INC C;  3N1X C;  2M19 A;  3VDZ A;  1UNS A;  2HJ1 A;  3VR8 B;  3ALB A;  3AEE B;  4MGK E;  3QAQ A;  4ICV A;  3N1Y C;  4RF0 A;  4GDL A;  1E6E B;  1V97 A;  2KMC A;  2JY6 A;  1JAL A;  3PRE A;  3VHT C;  1RYJ A;  4WH4 A;  4KDI C;  3DVG Y;  3QJZ A;  4Q2J A;  1N5X A;  1EWC A;  3VUW A;  5HG2 A;  1HZ5 A;  2MBB B;  3P4R B;  1XF5 L;  3EGR A;  1FXT B;  2CJN A;  4LNI A;  5E6J A;  3BII D;  4JWU C;  3UGB B;  1D5Z C;  2QHO A;  1D3Z A;  1MPE A;  1QOA A;  4AJW A;  1KLV A;  3DHH C;  3IXS A;  1WX8 A;  4B6W A;  1T3Q A;  3DVN U;  2AQ1 B;  2J53 A;  1SSN A;  2DNF A;  1KFY B;  2D3B A;  1WZ3 A;  3U4E G;  5D2M B;  1A70 A;  3TEY A;  1QOB A;  2LRW A;  3TCA A;  1TY0 A;  3SU8 X;  2C9W B;  1HE8 A;  2ZCB A;  1FFU A;  3ZYY X;  1OFF A;  2KHW B;  2IO0 B;  2MBQ A;  2BW2 A;  2V3S A;  1YIW A;  4RM9 A;  4QAY A;  1PYW D;  2ZEQ A;  4MGZ E;  3I63 C;  3BVG A;  4NQL B;  1UH6 A;  1SE2 A;  1I7H A;  2FUH B;  1TKG A;  2BYV E;  3PZD A;  2PTL A;  3DVG X;  3ENE A;  1E9M A;  3U2S C;  3K9P B;  3TEX A;  4W9I A;  2LFI A;  4PYU A;  3OJ3 A;  2XBB C;  4TQ0 A;  2BF8 B;  3BVM A;  1P98 A;  2WDT B;  1MJD A;  3LXF A;  2WXQ A;  2MJE A;  2YEP F;  1QIL A;  3H7P B;  3QWZ B;  3U30 A;  3V62 A;  4UDU C;  3PZ7 A;  1EUV B;  1WZ0 A;  1GUA B;  2J0K A;  2QC8 A;  4GIV A;  4NJ6 A;  4YXD B;  5HI1 A;  3KQ4 A;  5IP4 D;  3VFK A;  2NBV B;  3DQV A;  4IDI A;  1EO6 A;  3TIX A;  1NEN B;  3PHW B;  3OJ4 B;  3MP9 A;  4AWJ A;  1E7U A;  2L7R A;  1SGH A;  4WWP A;  3TMP B;  4K3B A;  2K1F A;  4EZK A;  1ZDX A;  1GB4 A;  1C79 A;  4REZ A;  3R7R A;  4BKS D;  4A3O A;  3KW5 B;  1WYW B;  4N6E B;  4EEW A;  2M8S A;  2KXJ A;  4LCD E;  1YN5 A;  4BFR A;  4HVB A;  3E9S A;  1KRH A;  4IC7 B;  2JZP A;  2L83 A;  4ACF A;  4RMA A;  2JZZ A;  3LJ3 A;  1JW9 D;  4DXF A;  4DK5 A;  3ZJV A;  2MBE A;  4K3C A;  1XD3 B;  2MJ3 A;  2ZVO A;  4MM3 B;  1ET9 A;  1EU4 A;  3P2B A;  3RNG C;  3ZNZ B;  3Q69 A;  1YD8 U;  1I42 A;  3GE8 C;  4W9C A;  2KQ4 X;  3BVZ A;  1WM2 A;  3QHT A;  3N1Z C;  3W2D A;  2KYW A;  2N4F A;  2RDH A;  2KJR A;  2JVC A;  3SEB A;  1WMH A;  1L7Y A;  1Q10 A;  4OZC A;  2BYE A;  2HJ8 A;  5LXI B;  1IBX B;  5BMI A;  2AQ3 B;  1GC6 A;  4IKG A;  2L0F A;  3KH0 A;  4K7W A;  3L17 A;  2MBO A;  3KUD B;  2E3T A;  1E7V A;  4LTU A;  1M4V A;  2ZPN A;  1P0R A;  3M3J A;  2KDM A;  4HWI B;  3URY A;  3X0W A;  1PQS A;  3IAM 1;  2A5U A;  1WGH A;  3L54 A;  1PDX A;  2JWU A;  2MBH A;  3GS2 A;  2Z8L A;  5JHA A;  1P7E A;  4DBG A;  1TKE A;  5GMV A;  1VZ7 A;  2LVP A;  5L83 A;  1I4P A;  2LXC A;  1QOG A;  2OOB B;  5EDS A;  2M56 B;  4ANU A;  2BYT A;  1C1Y B;  3NVW A;  2LUM A;  1LO5 D;  2G4S A;  2ZW0 A;  4GXB A;  1YJJ A;  4BOZ B;  1FO4 A;  2KX0 A;  4KZC A;  1UWM A;  1YN3 A;  3WIM A;  3FIL A;  2VZK D;  4GDK A;  4PS8 A;  3W1S A;  4IW0 A;  3CSF A;  4L1B A;  4NY0 A;  3RN9 C;  5IO9 A;  2J4X A;  3UIN B;  2PLP A;  4ZOH C;  1FPY A;  2EEL A;  3P63 A;  1RAX A;  2KO3 A;  3PSE B;  4EUT A;  3QK0 A;  1RFA A;  2G4D B;  3PV1 A;  2WLB A;  5EE9 A;  3PO0 A;  2G45 B;  1IPG A;  1E8Y A;  3B9J A;  2O2V A;  5KHO A;  3BK2 A;  4DHJ D;  1MHX A;  5E6O A;  4DHZ B;  2BVC A;  4WQM A;  5HKH A;  4ZRJ A;  2KMA A;  1TS4 A;  5DCN A;  1VDV A;  1H4R A;  1L0V B;  4HPL B;  4AUQ C;  2JSV X;  1NBF C;  5BMH A;  5GXG B;  2INP E;  2N9X A;  1XXG A;  3RMK C;  1NI3 A;  3DDC B;  4O1N A;  1N5W A;  4F1S A;  2MRP A;  3Q8E A;  4JQW C;  3Q8B A;  1YQ4 B;  4C00 A;  1F2R C;  1E90 A;  2O6V D;  2RSU A;  1VZ8 A;  1EU3 A;  2CHW A;  1HA5 A;  1S3S G;  3TJP A;  3WA0 A;  2FCS A;  3R7Q A;  3VR9 B;  3ML8 A;  4OZA A;  4RF1 A;  2HDE A;  4RH6 A;  1F1H A;  1SE9 A;  4D2K A;  1LXD A;  2D3C A;  2WHI A;  1UUP A;  2PVG C;  1TBE A;  3FAH A;  4WWM A;  2G3Q B;  4II2 B;  1HTO A;  4C80 A;  2RPQ A;  3A9K B;  3TEZ A;  2EMS A;  3SHQ A;  2H88 B;  2IY1 B;  2FCN A;  3A1Q A;  4F7Z A;  1GJZ A;  4LK0 M;  3FKY A;  3ZXV A;  1VLB A;  4FN2 A;  2DBY A;  3WCQ A;  3B08 A;  3IT4 B;  2WXH A;  5IA7 A;  2QEJ C;  1TKY A;  4M00 A;  4I6L B;  1WXQ A;  1WI0 A;  1ZKH A;  4J3O D;  4MH8 A;  2G9H D;  2ZW1 A;  1ROE A;  3HUI A;  4RCO A;  1L2N A;  3I57 A;  4HK2 A;  5EE1 A;  2YLM A;  2UWQ A;  2MCN B;  3P42 A;  4WWO A;  2NPT B;  3OWE B;  3IHP C;  3JSV A;  1TYG B;  4BOS C;  3PTF C;  5IN7 A;  1WX7 A;  2Y5C A;  1JRP A;  3W9C B;  2WXO A;  2CS4 A;  2LMC A;  4M8N A;  3AM9 A;  4K7U A;  4I6P A;  1R7S A;  4WIP A;  1ZGU B;  4HDO A;  1FCC C;  2J0M A;  3C0R B;  3QAR A;  2WXG A;  1P3Q U;  4YSY B;  1EWY C;  2KK8 A;  3AB5 A;  2ZZP B;  3AED B;  1M94 A;  2BYF A;  5IKC M;  1TS5 A;  1WJU A;  3B2F A;  1WRI A;  2K9X A;  2LGI A;  1C76 A;  2HTM E;  2JYE A;  4TQ1 A;  2KNB A;  1N62 A;  3ZRF A;  4ZHO A;  2M17 A;  4YTP B;  4PS7 A;  4HEA 1;  3H8H A;  1PGB A;  1L6V A;  2MP2 A;  5BYR A;  2KDE B;  4CYE A;  2W82 A;  3VQI A;  3KUZ A;  5C23 A;  4S0R A;  2D11 A;  1Z5S B;  2DHZ A;  4BBN C;  1TS2 A;  3Q14 C;  4KX6 B;  1X1M A;  3NS8 A;  2KN4 A;  2Z0D B;  1RM6 C;  4N58 A;  3T9L A;  4OHJ A;  3NG0 A;  3MC9 A;  3ZKJ C;  1WE6 A;  1UGM A;  2IY0 B;  1SE4 A;  3RZF A;  3KYC D;  3CIR B;  1VRA B;  4HPM B;  4E74 A;  4MDK E;  3H7S A;  3HHM A;  4TSS A;  1XLO A;  2C60 A;  4YSZ B;  3PS6 A;  1E7P B;  2BWE S;  2GBJ A;  1SXT A;  2KQS A;  4KIK A;  4YTN B;  4EZJ A;  4M8M A;  1FEH A;  5CHF A;  3A9J A;  4M01 A;  4AJY B;  3APF A;  1L4Z B;  3RNA C;  1TY2 A;  3ECI A;  3CF6 E;  3AMZ A;  5JXV A;  1NDD A;  4MT5 A;  2LJI A;  3MC8 A;  1MG4 A;  3V6C B;  3ZNI D;  2NVU I;  3W5U B;  5KHQ A;  2KWC A;  1WIA A;  4ZDV A;  1NVI D;  2CJO A;  4L23 A;  2GMI C;  3SR6 A;  2GBK A;  2FCM A;  1Q5W B;  1I4X A;  4JPS A;  4X57 B;  1SJH D;  3DHG C;  1ZDV A;  2KJ6 A;  1ISN A;  1B1Z A;  3EUB 2;  2C7N B;  2JYT A;  3N3K B;  2QDF A;  5CX3 A;  4NQK E;  1YJ1 A;  2ASQ A;  3TBL D;  1T0R C;  2AYO B;  3MFG A;  1T0S C;  1SIF A;  1C3T A;  1WRD B;  4WJQ A;  5G5G A;  1V9J A;  3NRZ A;  4NPN A;  1JRU A;  1FNW A;  2LZ6 A;  3NVV A;  4ZRP A;  2JRH A;  4KDL B;  2JXT A;  2IO2 B;  5DPR A;  2LUE A;  4N59 A;  1J0G A;  4GOC A;  3AE1 B;  5AUI A;  1KH0 A;  3TUO A;  4B95 A;  1V5O A;  3EC8 A;  3LYY A;  1V1P B;  5LNK 1;  2L8J A;  4GLS C;  5D7G A;  1YQB A;  2NR2 A;  5HFY A;  1SBB B;  2KTR A;  3ZLZ A;  1RFK A;  3K9O B;  4KGS A;  1J7A A;  1L0Y B;  1Q1O A;  2TSS A;  2CKH B;  2IPK D;  4K1R B;  4WWN A;  2GRI A;  5C2T B;  1AWD A;  3D32 A;  4ZHP A;  4C56 C;  4RGT A;  1XO3 A;  2OJR A;  3IT6 B;  3KUC B;  5EE0 A;  4MH0 E;  1MI0 A;  1BUI C;  1JML A;  2FBW B;  2LGX A;  2KZR A;  4CO7 A;  4HJK A;  2KC1 A;  2RDB C;  3X23 A;  2Y3A A;  1ZP0 B;  3R3M A;  2KKC A;  3KVF B;  3ZJU A;  2VH1 A;  1FRR A;  2J7Q B;  2QIL A;  4XDD A;  3RCZ A;  2FNJ B;  4L2Y A;  4A55 A;  2LVO A;  2FIF A;  3NJT A;  4IWQ A;  2N7E A;  1T0Y A;  4S17 A;  3HIZ A;  2V4L A;  2K5P A;  1NYQ A;  2CHX A;  1RWS A;  2LI5 A;  5TSS A;  1F77 A;  2Z59 B;  3NZS A;  1SE3 A;  4FJV B;  3BK1 A;  3ZNH B;  4FAD A;  1XT9 B;  1KF6 B;  3J9C A;  1UWX A;  2D2Q A;  3H7P A;  3DBH I;  1TTN A;  4K81 A;  2WQY B;  3HK0 A;  2UYZ B;  3H9D A;  1I35 A;  3DBH B;  1ACC A;  2EMT A;  4GB9 A;  4P1B C;  2K39 A;  4JE3 B;  4ZRQ A;  3AE2 B;  3ZW3 A;  3A33 B;  2L76 A;  3NZU A;  2QCZ A;  3KWL A;  2VH2 A;  2JZ3 B;  4HKQ A;  4RGN A;  1TIF A;  2GOW A;  2KN5 A;  2FID A;  5L95 C;  1WXM A;  3MJ5 A;  2WU2 B;  4B9K A;  4DHZ E;  4US9 A;  4HRO A;  2WXM A;  4FHK A;  2PVO D;  4HRS A;  2V1Y A;  1C78 A;  5DPS A;  1XCT L;  4K7S A;  4LNF A;  4KGT A;  1UEL A;  4BKT A;  1WMH B;  1R4N I;  2GI9 A;  5FKA C;  1QKZ A;  4ARC A;  1R4N B;  3WAL A;  4ITK A;  3U8Z A;  3JVZ X;  2HE7 A;  2WGS A;  3RD2 A;  2YVC A;  1V2Y A;  4W9L A;  2MEK A;  4GGQ A;  4RGM A;  1N60 A;  3BZD B;  4C4V B;  4EE2 A;  2QSD A;  4BZA A;  2C7M B;  1TJE A;  5D3I B;  1LGR A;  4MM3 A;  2BB6 A;  3DBS A;  2GB1 A;  1MFW A;  3QA8 A;  4JGH B;  4AOF A;  4TKN A;  2G1E A;  1IGC A;  4ZRI A;  2IGH A;  2NBW B;  2B3A A;  3L4P A;  5H8Y E;  2E6X A;  1TT5 B;  1WGK A;  2BWF A;  5LLI A;  3KYD D;  4HLE A;  3AI5 A;  3KLS X;  2J52 A;  2YEP B;  3DOW A;  4TUU A;  3U7Z A;  2N9P C;  3AN1 A;  1IBX A;  2AQ2 B;  2I2Y A;  3ZUN A;  4HXD A;  2WWZ A;  2XEW A;  1IYF A;  3FIL B;  4GDK B;  4P6V F;  2BS4 B;  1E8W A;  3FC4 A;  4G50 A;  1KM7 A;  1GC7 A;  4G0N B;  4JWS C;  4II3 B;  4PK1 A;  3AEG B;  2OJW A;  4URK A;  1K53 A;  2PEA A;  3SFE B;  2MX2 A;  2KFK B;  1GAQ B;  2DZI A;  3M62 B;  3T3N A;  2AWT A;  2KOX A;  4A8X C;  2N0S B;  2PJH A;  1LM8 B;  1ENF A;  1L4D B;  4WQO B;  5D94 A;  2IND C;  1JWU D;  4FHJ A;  2K6D B;  5BO4 B;  3EHV A;  2X8X X;  3U52 E;  4LNO A;  4C7Z A;  1A5R A;  2RR9 A;  5G5H A;  1J19 A;  3IVF A;  4OVU A;  2N9K A;  2MJD A;  4MJS A;  1QT9 A;  2NTS A;  1VCB A;  4YTM B;  2HD5 B;  3PLV A;  5BMG A;  1MVK A;  3Q6B A;  2JF5 A;  4RNA A;  1WGR A;  1UBI A;  3AE4 B;  4LDT D;  4FBJ B;  2MA9 B;  4I6N B;  1WGY A;  4YWG G;  1PGA A;  3GE3 C;  2QMT A;  4KZ0 A;  3B0A A;  2PMV A;  3ZTD A;  2VZK B;  4B0E A;  1AYF A;  1R4M I;  4DWF A;  3IAS 1;  3O13 A;  2W9N A;  4M0W B;  3RNB C;  1EM7 A;  2W3R A;  2AEH A;  2L00 B;  1R4M B;  4A90 A; 
#chains in the Genus database with same CATH homology
 2KN4 A;  2BW2 A;  3PZ8 A;  1RM6 C;  1VZ6 A;  4WUR A;  4N58 A;  1GOZ A;  4OHJ A;  4YT0 B;  3VRB B;  4XWT A;  1PYW D;  2W54 A;  2SEB D;  2K0P A;  3BVG A;  2RPV A;  4NZL B;  1SE2 A;  1I7H A;  3AE3 B;  1TKG A;  3AE8 B;  4NAW B;  1SE4 A;  1TZO A;  4B0M A;  1KTK A;  3CIR B;  1VRA B;  2PTL A;  2ACZ B;  1E9M A;  4WAF A;  3U2S C;  2QJL A;  4TSS A;  1XLO A;  3ZGZ A;  3TEX A;  4YSZ B;  2WXF A;  1DGJ A;  1E7P B;  1SXT A;  1MHH E;  2LFI A;  3P4Q B;  4YTN B;  4TQ0 A;  1DOX A;  3BVM A;  2Q5W D;  5BYS A;  1E10 A;  1FEH A;  4FXC A;  1GPX A;  1PGX A;  2PIA A;  3LXF A;  2WXQ A;  2MJE A;  2YEP F;  1QIL A;  1JWS D;  1L4Z B;  3BYT B;  3V05 A;  4UDU C;  3PZ7 A;  1FCL A;  1FRD A;  1L0X B;  1TY2 A;  2I38 A;  1C4C A;  2LHD A;  3AMZ A;  5JXV A;  4MT5 A;  2LJI A;  1FMA D;  3AE5 B;  1YJI A;  4YXD B;  5HI1 A;  1V8C A;  1K51 A;  3KQ4 A;  3W5U B;  5EE3 A;  4KKI A;  4IDI A;  1NEN B;  2K22 A;  3MP9 A;  1NVI D;  2R61 A;  2CJO A;  4L23 A;  2IDY A;  3SR6 A;  4AS1 A;  2KWD A;  1L5P A;  4HKZ E;  1SIJ A;  1I4X A;  2RDG A;  4JPS A;  4OW0 A;  1JCK B;  1SJH D;  1TS3 A;  2LEK A;  4P16 A;  3UI3 A;  1YN4 A;  1ZDV A;  2V0G A;  1B1Z A;  3EUB 2;  2JYT A;  4R3D A;  1OQQ A;  1ZDX A;  3MC0 B;  3ZJT A;  1GB4 A;  1DYQ A;  1C79 A;  3MFG A;  1FXI A;  3Q8C A;  4REZ A;  1D6E C;  5FK9 C;  4USA A;  1HEZ E;  1ZXI A;  4N6E B;  5BYQ A;  3NS1 A;  5G5G A;  4OVZ A;  1JWM D;  3NRZ A;  5I4D A;  1C4A A;  2ICI A;  1YN5 A;  2RMM A;  1FNW A;  3NVV A;  2L1A A;  2M0A A;  3AE6 B;  3E9S A;  1KRH A;  2JZP A;  3Q8A A;  1DOY A;  4ZRP A;  1JQ4 A;  2DYM A;  2L83 A;  1ZOY B;  1I4G A;  2JQR B;  1V1O A;  2JXT A;  3KWV A;  1ZUD 2;  2BB5 A;  1JW9 D;  4N59 A;  1FD6 A;  3P1M A;  4DXF A;  3ZJV A;  1NEK B;  3AH7 A;  3AE1 B;  5AUI A;  1KH0 A;  3TUO A;  3ETR A;  2LHE A;  5C3J B;  3LYY A;  1N61 A;  2EKI A;  1I4Q A;  2WXN A;  1V1P B;  5LNK 1;  2MJ3 A;  4MM3 B;  4GLS C;  1ET9 A;  1EU4 A;  3MHZ A;  4US8 A;  5D7G A;  4YSX B;  1GB1 A;  3DWM A;  3Q69 A;  4JX1 C;  3P4P B;  2KQ4 X;  3BVZ A;  4H2A A;  3W2D A;  3HVD A;  5HFY A;  2Y5P A;  1SBB B;  2RDH A;  2KAJ A;  1QLB B;  3AV8 A;  2DLB A;  2H89 B;  1PFD A;  1RFK A;  4KGS A;  3SEB A;  1J7A A;  5AUK A;  1L0Y B;  3N9Y C;  2TSS A;  1FM0 D;  2IPK D;  2GRI A;  3NVZ A;  1Q10 A;  5C2T B;  1AN8 A;  1AWD A;  4OZC A;  4ZHP A;  1JRO A;  4C56 C;  2X38 A;  4RGT A;  2INN E;  1J7B A;  3TSS A;  1IBX B;  1XO3 A;  2W3R A;  2AQ3 B;  5BMI A;  2V3P A;  2J42 A;  4IKG A;  3SFD B;  3IT6 B;  5EE0 A;  1K52 A;  4DXG A;  1SEB D;  1YQ3 B;  3Q8F A;  2QIE B;  4ZYS A;  1MI0 A;  2WU5 B;  1BUI C;  1JML A;  2FBW B;  2E3T A;  1FXA A;  4LTU A;  1QOF A;  1M4V A;  2WXJ A;  3VRA B;  1D5X C;  1C4P A;  2KDM A;  2SAK A;  5H92 C;  4M0W A;  2Y3A A;  1HZ6 A;  1BXT A;  3URY A;  1ZP0 B;  4OZB A;  3IAM 1;  1JWA D;  3CWI A;  3NZ3 A;  1HQR D;  1PDX A;  2JWU A;  2L32 A;  3ZJU A;  1L6U A;  2BS3 B;  1FRR A;  1FFV A;  3GS2 A;  2QIL A;  2AX5 A;  4XDD A;  2Z8L A;  2WS3 B;  4L2Y A;  4A55 A;  1P7E A;  2XNA C;  1J7C A;  1TKE A;  1ZPS A;  1IUE A;  3ZQ4 A;  5T8I A;  3HVZ A;  2PKO A;  1VZ7 A;  2OHF A;  1I4P A;  1YNT E;  2WXR A;  1QOG A;  2IGG A;  4GDL B;  3AEA B;  1E0Z A;  2JU6 X;  2K5P A;  1NYQ A;  1F0Z A;  3R2I A;  2M56 B;  2BYT A;  1RWS A;  3DWG C;  5TSS A;  3NVW A;  1F77 A;  2LUM A;  1LO5 D;  1IGD A;  1D5M C;  5HHD G;  1SE3 A;  1VJK A;  2BT6 A;  2ZW0 A;  4LLG M;  1YJJ A;  3BK1 A;  1FNU A;  1SB3 C;  4DQO C;  1ESF A;  1PUT A;  1P7F A;  1FO4 A;  1STE A;  1KF6 B;  3J9C A;  1UWM A;  1UWX A;  1YN3 A;  1YMH E;  3FIL A;  2VZK D;  1CJE A;  3TEW A;  3W1S A;  1C77 A;  4IOI E;  2KMM A;  4RFB A;  2L52 A;  2WQY B;  4L1B A;  2WXP A;  1ACC A;  2J4X A;  2WDR B;  3GP7 A;  2PLP A;  4ZOH C;  1I4R A;  1UGJ A;  4NJC A;  3R8B A;  4ARI A;  4JE3 B;  2EEL A;  4ZRQ A;  3AE2 B;  2V3N A;  3P63 A;  2IJ0 A;  3AEF B;  3KWL A;  4HJG E;  4HKQ A;  4RGN A;  2WLB A;  2WP9 B;  3MJ5 A;  1FNV A;  2WU2 B;  5EE9 A;  3PO0 A;  4US9 A;  1AW7 A;  1CK1 A;  3HRD D;  4HRO A;  2WXM A;  2MH7 A;  3B9J A;  1ET6 A;  2PVO D;  4HRS A;  1ZE3 D;  2DYO A;  3BK2 A;  4XE0 A;  4A6Q A;  1MHX A;  1C78 A;  2W55 A;  1XCT L;  2V4I B;  4KGT A;  2XN9 C;  3LB8 C;  4WQM A;  2N7J A;  1B9R A;  1T5X D;  2NTT A;  4KGR A;  2WXK A;  2K3U A;  1DOI A;  2GI9 A;  1TS4 A;  1I4H A;  1VDV A;  5FKA C;  1L0V B;  1QKZ A;  2D5G A;  3AEC B;  4ARC A;  1CZP A;  2JSV X;  4ITK A;  5BMH A;  3EA6 A;  5GXG B;  2W3S A;  1Y56 A;  2INP E;  2FE8 A;  1XLN A;  1WYG A;  1XXG A;  3BYY B;  1NI3 A;  5D3D A;  1OQR A;  4PT5 A;  1SF0 A;  4O1N A;  5MPO A;  2MEK A;  1N5W A;  3RFZ B;  4RGM A;  1N60 A;  3BZD B;  3Q8E A;  3Q8B A;  1YQ4 B;  4EE2 A;  2QSD A;  1F2R C;  1F2R I;  1BML C;  2OED A;  4AQ7 A;  1V1P A;  1VZ8 A;  2JX5 A;  1TJE A;  1EU3 A;  1QF6 A;  5D3I B;  2BB6 A;  1HA5 A;  2GB1 A;  1D4B A;  3B2G A;  3VR9 B;  4OZA A;  1C9F A;  4RF1 A;  2HDE A;  2IGD A;  4CQN A;  2G1E A;  1IGC A;  2IGH A;  4RH6 A;  4D2K A;  1XLQ A;  4TMA B;  2WDQ B;  3L4P A;  5H8Y E;  3AEB B;  1KLG D;  1UUP A;  2N9L A;  2E6X A;  2PVG C;  1XLP A;  3FAH A;  4WWM A;  1T6B X;  1WGK A;  2WXI A;  3V3X A;  4C80 A;  2PW9 A;  3R2T A;  3W5V B;  3KLS X;  4MAC A;  2B76 B;  2J52 A;  2YEP B;  1XCQ L;  2WDV B;  2BS2 B;  3U7Z A;  3TEZ A;  1XEE A;  3AN1 A;  1IBX A;  2AQ2 B;  2H88 B;  3NUH B;  2I2Y A;  1K50 A;  5FR3 A;  2FUG 1;  1SJE D;  4LK0 M;  4XDC A;  1VLB A;  3C8Y A;  3FIL B;  4GDK B;  1HXY D;  2DBY A;  3BWU D;  4P6V F;  1NYR A;  2BS4 B;  2ON8 A;  3WCQ A;  3FC4 A;  3IT4 B;  2WXH A;  2BTE A;  1WWT A;  2QEJ C;  1VR9 A;  2BBC A;  1TKY A;  1KLU D;  2CU3 A;  4JWS C;  4XWW A;  4A9A A;  1WXQ A;  2KAC A;  3AEG B;  4J3O D;  4MH8 A;  2G9H D;  2ZW1 A;  1ROE A;  3I9V 1;  3NVY A;  1CQV A;  3HUI A;  4RCO A;  1K53 A;  4KKJ A;  2M19 A;  3I57 A;  3VR8 B;  1UNS A;  5EE1 A;  3SFE B;  3T3N A;  1GAQ B;  1N63 A;  3AEE B;  4A8X C;  2N0S B;  1ENF A;  1L4D B;  4RF0 A;  3GB1 A;  4C7Y A;  1E6E B;  1V97 A;  1JWU D;  3P42 A;  3OWE B;  1JAL A;  1RYJ A;  3P4S B;  3ABV B;  4RGO S;  4WH4 A;  3U52 E;  1TYG B;  4C7Z A;  4Q2J A;  1N5X A;  1EWC A;  3E56 A;  3W9C B;  2Y5C A;  1JRP A;  5G5H A;  2WXO A;  2LMC A;  3AM9 A;  1FIQ A;  2N9K A;  2MJD A;  5HG2 A;  1HZ5 A;  3AE9 B;  3P4R B;  1QT9 A;  1XF5 L;  1R7S A;  2NTS A;  2WXL A;  3EGR A;  4WIP A;  4YTM B;  2CJN A;  1FCC C;  5E6J A;  3BII D;  1ZXH A;  5BMG A;  1MVK A;  1WSP A;  2NMQ A;  2DWQ A;  3T3O A;  4JWU C;  4RNA A;  1JWB D;  2WXG A;  4YSY B;  1EWY C;  3AB5 A;  3AED B;  1D5Z C;  1MPE A;  1QOA A;  3AE4 B;  1TS5 A;  3B2F A;  1WRI A;  2K9X A;  3IXS A;  2LGI A;  1C76 A;  2HTM E;  1T3Q A;  2AQ1 B;  2J53 A;  2JYE A;  2WNM A;  4TQ1 A;  1N62 A;  1PGA A;  4YWG G;  1SSN A;  4ZHO A;  1KFY B;  2QMT A;  3AE7 B;  4YTP B;  4HEA 1;  2PMV A;  3U4E G;  3H8H A;  1PGB A;  1L6V A;  5BYR A;  1A70 A;  2VZK B;  4B0E A;  3TEY A;  2W82 A;  4NAM A;  2ONQ A;  3VQI A;  1QOB A;  1QQR A;  3IAS 1;  1TY0 A;  3O13 A;  1FFU A;  3ZYY X;  1OFF A;  1EM7 A;  1TS2 A;  1AYF A;  3RPF C;  4KX6 B;  4A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...