4JE3B

An iml3-chl4 heterodimer links the core centromere to factors required for accurate chromosome segregation
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
SRYSSLVPIEKVGFTLKNEINSRIITIKLKFNGNDIFGGLHELCDKNLINIDKVPGWLAGENGSFSGTIMNGDFQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Central kinetochore subunit IML3
publication title An iml3-chl4 heterodimer links the core centromere to factors required for accurate chromosome segregation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.720 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4je3B00
4JE3B
chains in the Genus database with same CATH superfamily
5DPSA 3C0RB 3A9JB 5D6JB 2L0FA 2RSUA 1PDXA 3HVZA 1SBBB 3TJPA 4BOZB 1I42A 1KOTA 4J3OD 2AL3A 2ON8A 3URYA 4AS1A 3BY4B 2Z0DB 3ZJUA 1UGJA 5EDSA 1FNVA 1IGCA 1R4NI 3NZ3A 1XT9B 2XNAC 2M8SA 3PREA 1MVKA 1JCKB 1WIAA 2ASQA 4KGRA 2ZEQA 3VH3B 1N61A 1HQRD 3H7SA 4K7UA 2QC8A 4EZJA 3W5VB 4WQMA 1PFDA 2BS3B 2GBRA 5G2NA 4LNOA 1DOIA 3AH7A 3OAWA 1WXSA 2WNMA 5E6PA 2BB5A 5IOIA 4YTPB 4GU2A 1N60A 4WURA 1VR9A 2M1MA 4WJOA 1Q10A 1WXMA 2LUEA 1JROA 2LGIA 2WDTB 4KKIA 1KF6B 4TMAB 2QJLA 4WWMA 4IKGA 1TKYA 1TGZB 2KVRA 2C7HA 3C19A 4MGYE 3V05A 1K53A 1F2RI 3H8HA 2XK5B 2B3AA 2J53A 2KC1A 2GI9A 3L0WB 2NBUA 2DHZA 3TL5A 1KRHA 1XLPA 4JIOU 1XLNA 1VZ7A 2ZVNA 2JUOA 2REXA 2N9LA 3DDCB 3APCA 2IGGA 4BKSD 2J0MA 4ANXA 2LXAA 4ACFA 1YN4A 3PSEB 1SE9A 4P7IA 3P1MA 1ZDVA 2BT6A 2MW5A 4BOSC 2BS4B 4N6EB 3RNFC 2RDHA 3L17A 4TQ1A 3UIOB 1FFUA 1EU4A 1F52A 1D6EC 1DYQA 4ZDVA 2WQYB 3RNEC 2Z59B 4NPNA 3QAQA 2FIDA 3QIJA 2JRHA 5T8IA 5CHVC 1IBXB 5BYQA 3NVZA 4KZ0A 2NMQA 1JWUD 1UZXB 1N5XA 4HDQA 4PS8A 2KQ7A 3PHWB 1SF0A 4W9FA 1E7UA 2M17A 1UELA 2V4IB 1VCBA 4M0WA 3K9PB 4NJ6A 2JZ3B 3QARA 4W9DA 1J0GA 3TUOA 3M95A 3QCAA 1QILA 4S17A 4TKNA 1XD3B 1NDDA 2I38A 1FNWA 2WXJA 5HKHA 3UQAA 4ZRJA 2L0TA 1YQ4B 2BW2A 2LASA 2CHZA 4QAYA 3BZDB 1SGHA 2WXGA 3B08A 1VRAB 3PHXB 2N9XA 1FEHA 5FR6A 2WXRA 3ZTDA 1XLQA 3K9OB 1C77A 1TZ1A 3ABVB 2BPSA 2MEKA 4LNNA 3EHVA 3RT3B 3H7PB 2MWSB 1EF1A 2K8CA 2V9HA 1FXTB 5IAAC 5AEKB 3MFGA 4B95A 3FILA 3TSSA 1MFWA 3QC8B 2D3BA 2LD9A 3Q3MC 4KKJA 1N63A 1QKZA 1PYWD 1YN5A 3AE4B 1L0VB 3GS2A 1ACCA 2FUG1 2MLBA 2O6VA 3AEGB 3KH0A 3Q3OC 3ZJVA 3AU5A 1HA5A 3WA0A 4C7YA 1E7PB 1KFYB 1RWSA 5CX3A 4P1CC 1JWAD 4YSXB 3AE8B 2MCNB 1I4XA 2N7EA 4EEWA 2GBNA 4WJNA 1GUAB 1AYFA 3PV1A 2W3RA 3DVNU 1QOBA 2WXPA 4M00A 1YX5B 5D3IB 2MBHA 2LZ6A 1XXGA 4G50A 4HPPA 2KMAA 4W9IA 4XYCA 4ANWA 4TUUA 2FNJB 4AJWA 3AMZA 3P4PB 1L7YA 3EA6A 4MJSA 2ZPYA 3WALA 4ASWC 3DBSA 2WXQA 4MGKE 2HTME 1A70A 1MPEA 2D2QA 2W55A 3ZNZB 2DYOA 1ZXIA 3AE5B 2CJOA 4ITKA 4FA6A 1RFKA 3DVNV 3MC0B 1J7AA 4RMAA 2FE8A 3DPDA 2H89B 2JVCA 2IO2B 3VRAB 1L0YB 2H88B 5J2RA 1P1AA 1T3QA 4ZOHC 3TEXA 1WX9A 1IP9A 1WE6A 2W9NA 2INPE 4IWPA 1YIWA 3T9LA 3Q8BA 3CWIA 4ZRQA 4N58A 3QJZA 3L08A 2FCMA 1M4VA 5LLIA 4H2AA 3ZNID 4DHJD 3A4SC 1EM7A 2LGDA 2GBJA 4FLHA 1QT9A 2XN9C 3KVFB 4P1BC 2AEHA 4NQKE 5MPOA 4W9KA 1V5OA 1FD6A 1MJDA 3VAWA 3ZVVA 2WYQA 3WAMA 4W9GA 1QLBB 1WSPA 4YSZB 1LM8B 1WGGA 1S1QB 5CTRC 2ZNVB 2LGSA 1YNTE 1KM7A 1VJKA 4ARIA 3QHTA 1JRUA 4KVGB 5HFYA 3DBRB 3QX1A 2WP9B 1YQBA 2PTLA 3AEFB 4IUMB 2YEPF 4AP4C 2JF5A 3MC9A 3NHEB 3IT6B 2JXTA 1YD8U 2FCQA 2AX5A 3T3NA 2WU5B 1TT5B 3KLSX 2HD5B 4L2YA 4A9AA 4HEA1 1L6VA 3EFCA 4WAAA 1OEYA 3B9JA 1OTRB 2OEDA 2RMMA 4NY0A 4BBNF 2KWCA 3O13A 1LXDA 2NTTA 1VLBA 4ZHOA 2L00B 3APDA 1GJZA 4LDTB 2MBEA 2N4FA 4HLEA 4A55A 1I7HA 2DZKA 1L6UA 3ZUNA 2IGHA 1E9MA 2J4XA 2HDEA 1UD7A 1I4RA 2W3SA 2AQ2B 4OZBA 3NZUA 4R3DA 4XDDA 4GN1A 2EMTA 4IW0A 2WXHA 4RNAA 5J18A 2CKHB 3UGBB 3WAOA 2GRIA 3HHMA 1HTOA 2INNE 1VD2A 4TQ0A 4A3OA 3FKYA 3KYCD 2WLBA 3Q6BA 4K1RB 3Q3JA 4AJYB 3CSFA 2INCC 1J19A 3W5UB 2GMIC 2N9KA 3ZXVA 1D5ZC 4F1SA 1ZUD2 1R4NB 1DOXA 4YTMB 3NY5A 1HEZE 2WS3B 3LXFA 3RNGC 2O2VB 2YLMA 4JL9A 4I6PA 1WXQA 3IG3A 3UIPB 1SJHD 2KJHB 3W1SC 1V2YA 2Y5BB 2L8JA 1SB3C 1A5RA 3RI7C 2MHJA 2OOBB 3MC8A 3AE6B 2JZZA 4MACA 3BWUD 1OGWA 5HHDG 1GPXA 3RNAC 1NYQA 4IM3A 2MRPA 4WWOA 3SEBA 1AN8A 4HDOA 3U7DA 2FUHB 3ZNGC 3V6CB 1ZGUB 2C7MB 2ICIA 3VHTC 2BWFA 3RCZA 2R2QA 1IPGA 3SHQA 4AOFA 2G3QB 1OQYA 4NZLB 3B0AA 1UNSA 1GNUA 3U30A 2WGSA 4DHZE 2I1JA 4N59A 3IHPC 2L05A 2MP2B 3DQVA 1WRDB 1WMHB 2ZW1A 1D3ZA 2KDMA 3TEZA 3TEWA 4HJGE 1GB4A 3LB8C 4C00A 2LEKA 4GDKB 1UGMA 3SU8X 2G1EA 2K5PA 4OZAA 3P4SB 1WE7A 2J52A 1V80A 2G45B 3S2AA 3DHGC 3OG5A 5LNK1 4UDUC 3BINA 1E8XA 2QIEB 3VTWA 1VZ8A 2DZMA 4US8A 2KWDA 3JSVB 3BYTB 1YQ3B 4AQ7A 1TTNA 1UBIA 3ZW3A 4HPMB 2K1FA 3L4PA 2PE9A 1WXVA 4J6IA 3J9CA 4OVUA 4B0EA 3AI5A 5IA7A 1P7FA 5AZHA 1B1ZA 4BKGA 1V86A 2NS5A 1NVID 3EUB2 1HE8A 4FHKA 2GBMA 2RPQA 2GBKA 2JSVX 3HRDD 1DGJA 3AEEB 4LLGM 4ICVA 5KHQA 2KTFA 2L52A 2DYBA 3RZFA 1Q5WB 1Q0WB 4LK0M 4CQNA 1AARA 2KYWA 2SEBD 1FXIA 5DPTA 3MJ5A 1UWXA 2N9EB 3WAPA 2D3GA 4S0RA 2L1AA 4I6NB 4IDIA 4KIKA 5C1ZA 3I3TB 4KV2A 2KXJA 2PPHA 4EZLA 4FXCA 1QZEA 4A3PA 2R61A 5D3DA 2BYEA 4F7ZA 2EMSA 2BQQA 2AQ1B 4RGNA 3ZRCA 4HWIB 2DNFA 1G6JA 1V97A 4HCNB 5BYSA 3PRPB 4OW0A 1B9RA 1F1HA 2BS2B 2JYEA 2G4SA 2X38A 1E5WA 4P16A 2KFJA 4RCOA 5D2MB 2NTSA 4XWTA 1FCCC 4LNKA 3PZ8A 4XC2A 3KQ4A 2L7RA 2BYVE 1V9JA 1ISNA 4XWWA 2YEPB 2BF8B 1FRRA 1KLVA 1XF5L 2QILA 5DCNA 2KN5A 3GB1A 4ARCA 2KDEB 1WF9A 2J42A 5JHBA 1EU3A 1TS2A 4GSWA 3V6EB 1AW7A 4IM0A 1P0RA 3L54A 3GZNI 1WZ3A 2LWPA 4DWFA 2OJWA 1TKGA 4E71A 4P6VF 3BK2A 3H6NA 4MH8A 2KDIA 2WU2B 1NI2A 1UUPA 3PZDA 1QOFA 3NZSA 1E8ZA 3U7ZA 5IN7A 1WRIA 3MHSD 1CQVA 4RM9A 4M0WB 2KK8A 4PS7A 3GP7A 4ZRKA 1RAXA 3EECA 1JALA 1EWYC 2RDGA 1TS3A 5IO9A 2N9PC 2ZNVC 4DK5A 4B9KA 2LRUA 5DPRA 3R7RA 4JWSC 4XGAB 3PO0A 2KFKA 1K52A 3H1UA 3RNBC 3A1QA 4MM3A 2AWTA 2CJNA 2ONQA 1NENB 3RUIB 2D5GA 3AE1B 2JRIB 3DHIC 3N30A 3RZWC 4IWOA 1ZP0B 2M0XA 2UWQA 4OVZA 4FJYA 3TIXA 3U4EG 1JW9D 4US9A 3ZDMC 5BMHA 3RFZB 4K7SA 4KGTA 4LDTD 1V1OA 2PLPA 1WR1A 3ZDTA 4WQOB 4HXDA 2KC2A 3FILB 1C4CA 1Y8RC 2KNBA 1E90A 1V5TA 4MSMB 3T3OA 2KKCA 2C5LC 4MGIE 4C4VA 3U8ZA 4L1BA 4BKTA 4M01A 5D7GA 3AXCA 3T8MA 3ZKJC 3KWLA 1XCQL 2V3NA 2NVUI 2O6VB 3KUZA 1WXAA 4IM2A 4W9JA 2KANA 1NBFC 1E8YA 2M4NA 3N20C 1JWSD 3UI3A 2KJRA 2ZVOA 2KACA 3DBHI 1WGYA 2IY0B 2MJ3A 2KWVB 1Z5SB 2KDFB 1LQBA 4PYZA 1EF5A 1J7CA 1NYRA 3NVYA 3I5JC 3IAM1 4W9EA 2KVZA 2IO0B 5KHOA 3V62A 3VR9B 3LYYA 2QCZA 2LJIA 2WX0A 5E6NA 4MJSB 4MEMA 4EKUA 1ZXHA 3R8BA 2X8XX 4WJPA 1NEKB 5EE1A 3Q3FA 2MBOA 2MJDA 3BK1A 3MTNB 3ZJTA 4BFRA 2A5UA 1OEYJ 3OWEB 1UBQA 2ZPNA 1XEEA 1F2RC 3RYTA 3A9KA 1KTKA 3A33B 1OFFA 2LVQA 1KLGD 1ZKHA 4MELA 1UH6A 4BKSA 2LVPA 4II3B 2UU7A 4DBGA 1IYFA 3V3XA 3GOEA 1TZOA 2KDBA 2G4DB 3SFDB 2LRWA 4CHKA 1EUVB 5FKAC 2GLSA 3M62B 1H8CA 3N3KB 3PS6A 3LJ3A 1C9FA 2CR5A 5IP4D 1C4PA 2A4ZA 4YSYB 4GIVA 1GAQB 3NRZA 2QSDA 1WJNA 1GC7A 1L4DB 3RMKC 4LNFA 2JXXA 2MX2A 4DDGD 2K25A 4WAFA 2JWZA 2LVOA 4DQOC 1C4AA 1EO6A 4EZKA 3DWMA 1RLFA 2M56B 2VH2A 3W2DA 5C2TB 2ZZPB 5GMVA 3IXSA 1WJ6A 4CYEA 4FJVB 4WH4A 4C80A 2UYZB 1KH0A 4REZA 4OZCA 1PQSA 3RNCC 2BBCA 2LFIA 2LJ5A 1E6EB 2KTRA 4YWGG 3L16A 3ALBA 1JWBD 3P63A 3PZ7A 5C23A 4HK2A 2VRRB 3Q14C 4RGMA 2VH1A 2JY6A 2RGFA 4FHJA 1H4RA 3U2SC 1FIQA 2BKRB 4IG7B 4X57B 1FCLA 2IYDB 4WWPA 1K8RB 2PE6B 2D10A 1TKEA 2FBWB 1QOAA 1CZPA 5IKCM 3A4RA 4JE3B 1V1PA 5L95C 3AEDB 1TY0A 3NVWA 2KD0A 5EE3A 3N1YC 5I4DA 2WDVB 2K3UA 1YJJA 2WXMA 1D5XC 1TS5A 5AUIA 1V8CA 1WJ4A 2C60A 1OQQA 4JX1C 1F0ZA 3AEAB 2Z0EB 3E56A 2L3ZA 4KDLB 4DXAB 1K50A 1N5WA 4WJQA 4K3BA 2VZKB 2N7DA 2XBBC 5H92C 3AE3B 1JMLA 2JYTA 2WDRB 1R7SA 4BAXA 4RF0A 1ET6A 3JYUA 1STEA 3ONSA 3N9YC 3NVVA 4GB9A 1QQRA 1WYGA 4K81A 4BBNC 4A20A 3MHZA 3FAHA 2PVGC 2CS4A 4ZRIA 1X1MA 3NG0A 4HROA 4W9HA 1K51A 2K22A 4HCPB 2LI5A 4NAWA 2BVCA 4RGOS 2QHOA 2DBYA 4K7WA 2PEAA 1P3QU 3Q2AC 3R2IA 2SAKA 1I35A 3VUXA 1FXAA 2MBBB 3AEBB 4LNIA 4RM8A 2JQRB 3QWZB 5TSSA 3NS1A 3L10B 2Y5CA 4KGSA 5J17A 3BVZA 2WXKA 4G0NB 1L0XB 1FNUA 3W1YA 3APFA 2KX0A 2I1KA 4IC7B 2FIFA 3DCGA 2D3CA 4GDLA 4K3CA 2LHDA 2MBQA 1C79A 4KSLC 3ENEA 2IJ0A 1WM2A 2C9WB 2NCNA 3IBEA 1L4ZB 2IDYA 4YL8A 1C76A 2IPKD 5BO4B 2EKIA 1SIJA 3GZNB 2JPHA 1ET9A 3PGEA 1TS4A 1IUEA 3DWGC 3Q8CA 1WGHA 5TR5A 2PVOD 4DHZB 1I4PA 3VVWB 1WYWB 5D94A 1T0SC 3TCAA 3VTUA 3DBLI 2OJRA 4NQLB 2QMTA 3AE7B 2IGDA 2KLGA 1P98A 4KX6B 4FADA 3A9JA 1BXTA 2JZPA 2BB6A 2CU3A 2V4LA 1I4QA 2MQJA 2ZJDA 1T0YA 4L23A 1HZ6A 1ZOYB 1XLOA 3DVGX 1L2NA 1GG3A 3OJ4B 3OJ3A 3TMPB 1RRBA 2O6VD 2NPTA 2KT7A 3B2GA 1CMXB 1ENFA 1GB1A 2NPTB 5EE0A 4NJCA 3TBLD 3ZXRA 4I6LB 4C7ZA 2LUMA 3PRZA 3AE9B 4OVVA 5BMIA 1WWTA 3ZO5B 1YMHE 2WXLA 1T0QC 2DWQA 1NI3A 5CHFA 2KMMA 2K8HA 2L83A 5CHWA 1LFDA 1WGKA 4BVUC 4KIKB 2WXNA 4AWJA 3X23A 3UINB 2MSED 3HIZA 2J7QB 3ETRA 2IY1B 2K8BA 2MJEA 4MDKE 1DOYA 4JLCA 4LJOB 5C3JB 4KDIC 1ROEA 1ZW7A 4TV3A 2KHWB 3NUHB 1Y56A 3EC8A 2XK5A 1V81A 2IZVB 3VR8B 5JXVA 5JHAA 2JWUA 3EFUA 3AN1A 4C56C 3ECIA 1SJED 1RM6C 1CJEA 5JH5C 2CHXA 2LGYA 2IBIB 3RULA 2KWUB 3M3JA 4URKA 4A90A 3HUIA 4ANVA 2KAJA 4PT5A 2Q5WD 1P7EA 3C8YA 2B76B 2E6XA 1SIFA 3AV8A 1TY2A 1Z2MA 2FAZA 1FM0D 3DBHB 3W1SA 2BYFA 4EE2A 3RN9C 1R4MI 4IWQA 3CF6E 1ZE3D 3GE3C 1YX6B 1UF0A 3ZNHB 3AM9A 1IBXA 2DENB 1BMLC 3PPAA 2KN4A 2DAFA 4JQWC 4W9LA 3B2FA 2RR9A 2ZCBA 3DOWA 1QOGA 1JRPA 3P4QB 1LGRA 2E3TA 2D11A 5AUKA 2IO3B 3VQIA 1I4GA 3MP9A 4E3CA 5GXGB 4GMVA 1TYGB 4A6QA 1L5PA 1WY8A 3HM6X 3AB5A 2WX1A 3VDZA 3B1LX 3PRMB 4FN2A 2YVCA 3I9V1 5FK9C 1YJIA 3LDZE 1KJTA 3ML9A 2KFKB 4HJKA 3A1QB 3WIMA 1I4HA 1WX7A 2WXIA 2PIAA 5BMGA 4ANUA 4A8XC 4MM3B 4LCDE 1PUTA 3PLVA 4RFBA 2QEJC 4KZCA 4RF1A 2C7NB 2K0PA 3KUCB 3IVFA 2RDBC 5FR3A 5JZEB 1E10A 4KSKC 3R7QA 3ZYYX 1QF6A 3H9DA 4IOIE 2K9XA 2DZIA 3I63C 5AZGA 2ZCCA 2DLBA 4YXDB 3H7PA 1XCTL 3P42A 3BIID 1WJUA 1XQQA 4HKZE 4USAA 3JVZX 1VDVA 2QDFA 2BWES 3QA8A 2IO1B 1E0ZA 3D32A 4JGHB 4JPSA 5HG2A 4C4VB 3HVDA 2JT4B 3VRBB 4ZYNA 3VUYA 3QQ8B 1FFVA 3ZIMA 1WI0A 4EOYA 3V61A 3V60A 2I2YA 2KJ6A 3IAS1 3P4RB 4G3XB 4GOCA 3VXWA 2KZRA 4MSQB 1PGXA 4HKQA 2VZKD 2KO3A 4FBJB 2J0KA 2KQ4X 1J7BA 1T5XD 2ZW0A 3HM3A 3Q8FA 2ACZB 4M8MA 5L83A 2EKEC 3Q69A 4B0MA 3UF8A 3QK0A 2D3AA 4AUQC 4LTUA 1GOZA 1EWCA 2J0JA 2LXCA 1XO3A 4MGZE 3OLMD 2INDC 3IT4B 2HTHA 1D5MC 1C78A 1N6ZA 1J8CA 4XE0A 2Z8LA 4NNJB 3VTVA 2LMCA 2DAJA 4RGTA 1TJEA 3SDLC 2BKFA 2WHIA 4XX5A 2AL6A 2BGFA 4N9F4 1Q1OA 2HJ8A 4B6WA 2KOXA 2LHEA 2HE7A 3A9KB 2FCSA 3I57A 2K6QA 5DPWA 2NBVB 1D4BA 3TEYA 1LO5D 3KUDB 1HXYD 1WH3A 2XEWA 1SXTA 1SE3A 2FCNA 2L32A 4GGQA 1JWMD 4HRSA 2KLCA 4PS3A 2AYOB 2NBWB 2R2OA 1YJ1A 3JW0X 3X0WA 1IGDA 2JX5A 1MG4A 2WXFA 3EGRA 4GXBA 3NOBA 4CO7A 4M8NA 2L76A 2Y5PA 1MHHE 3U52E 4PYUA 4BZAA 3HK0A 1MHXA 4E74A 1SEBD 3AULA 2KX3A 3R2TA 4ZRPA 2BTEA 3BVMA 3ZRFA 2RPVA 1S3SG 2MH7A 1TIFA 4TSSA 2N7JA 5G5GA 3Q8AA 5E6OA 2V3SA 3O65B 3RPFC 1MG8A 3PVLA 3VFKA 4HVBA 3WCQA 3MJWA 1PGBA 1BT0A 1YN3A 3AECB 4NJ7A 4OHJA 1MI0A 2OHFA 5E6JA 5G55A 1SSNA 3SFEB 1BUIC 2V3PA 1WX8A 2JU6X 1V49A 3SR6A 2PJHA 1U4AA 4O1NA 3ZTCA 1TBEA 4ICUA 3BVGA 2CHWA 2KMCA 1T6BX 2KTRB 3KWVA 2PKOA 2PMVA 4G11A 3DVGY 5HI1A 3W9CB 4ZYSA 1KLUD 4RH6A 3ZQ4A 4Q2JA 1WFYA 4JWUC 5EE9A 1CK1A 4FJZA 1N62A 1ZDXA 1WGDA 2M19A 2PW9A 2K6DB 2WWZA 2CU1A 4II2B 2WXOA 4DXGA 3DBLB 2KQSA 1V1PB 2V0GA 1SE2A 4XDCA 3SD5A 3E9SA 2K39A 1C1YB 4D2KA 1P9DU 3DHHC 3GE8C 3UQBA 4M02A 1UWMA 2Y3AA 3NS8A 1ESFA 1FPYA 2GB1A 1FMAD 3N1XC 1V6EA 3N32A 2G9HD 3ZGZA 2BYTA 3PT2B 3WANA 1GC6A 2WDQB 2LGXA 2O2VA 3FC4A 1SE4A 1WM3A 4W9CA 3CMMB 1JQ4A 1C3TA 3N1ZC 4YTNB 1F9JA 4DXFA 3CIRB 4HPLB 1HZ5A 2V1YA 1WGRA 3Q8EA 2HJ1A 4EFOA 1YOVB 1HTQA 1F77A 3VH4B 1E8WA 3ML8A 1WR6E 4ZHPA 4GLSC 3ZLZA 2W54A 2EELA 4EUTA 3KYDD 3IFWB 1PGAA 4WWNA 5H8YE 3L13A 2N0SB 2N1VA 3Q3NC 4NAMA 5LXHA 3P2BA 4NAWB 2GOWA 3CSTA 3BYYB 1OQRA 1T0RC 2RD0A 3R66C 3DBRI 1VZ6A 2MA9B 4LJPB 1FRDA 5AZFA 2MP2A 2M0AA 3AE2B 1FO4A 2D07B 1M94A 3VUWA 1WMHA 3R3MA 5BYRA 2DZJA 2N1WA 1E7VA 4GDLB 2AQ3B 4GDKA 3AU4A 2W82A 4XZ4A 4DDID 4PK1A 4FULA 5LXIB 1RFAA 2NR2A 3RD2A 3KW5B 3PTFC 4MT5A 4DHJB 1AWDA 1R4MB 4WIPA 2DX5B 3NJTA 1ZPSA 4YT0B 3M63B 1WZ0A 4MH0E 3JSVA 2DYMA 3PLUA 4F8CB 2TSSA 5G5HA 1RYJA
chains in the Genus database with same CATH topology
2E3TA 1L6UA 1NEKB 5EE1A 2IGHA 1E9MA 2J4XA 2HDEA 2MJDA 3BK1A 5AUKA 1I4RA 2W3SA 3VQIA 1I4GA 2AQ2B 3MP9A 4OZBA 3ZJTA 4R3DA 4XDDA 5GXGB 2WXHA 3OWEB 4RNAA 1PDXA 1TYGB 3HVZA 4A6QA 1XEEA 1F2RC 1L5PA 1KTKA 1SBBB 2GRIA 1OFFA 2INNE 1KLGD 3AB5A 4TQ0A 3I9V1 4J3OD 5FK9C 1YJIA 2ON8A 3URYA 2WLBA 4AS1A 3ZJUA 1UGJA 1I4HA 3V3XA 1FNVA 1IGCA 2WXIA 3NZ3A 2PIAA 2N9KA 3W5UB 5BMGA 2XNAC 1D5ZC 1MVKA 1TZOA 1ZUD2 1JCKB 4KGRA 4MM3B 4A8XC 1DOXA 1PUTA 1N61A 4RFBA 3SFDB 1HQRD 4YTMB 2QEJC 1HEZE 4RF1A 2WS3B 3LXFA 5FKAC 3W5VB 4WQMA 1PFDA 1WXQA 2K0PA 1C9FA 2BS3B 5FR3A 1E10A 1DOIA 1SJHD 3AH7A 3ZYYX 1QF6A 2WNMA 2BB5A 4YTPB 1SB3C 1N60A 4WURA 1VR9A 1C4PA 4IOIE 4YSYB 1Q10A 1GAQB 3NRZA 3AE6B 2K9XA 2QSDA 4MACA 4YXDB 1JROA 2DLBA 2LGIA 3BWUD 1L4DB 1XCTL 3P42A 4KKIA 1KF6B 4TMAB 3BIID 2QJLA 5HHDG 1GPXA 4HKZE 4WWMA 1NYQA 4IKGA 4USAA 1TKYA 1VDVA 3V05A 1K53A 3R8BA 4WAFA 1F2RI 3SEBA 1AN8A 3H8HA 2J53A 4DQOC 1E0ZA 2GI9A 1C4AA 4JPSA 5HG2A 3DWMA 1KRHA 1XLPA 3HVDA 1XLNA 2M56B 1VZ7A 3VRBB 3W2DA 2ICIA 5C2TB 2N9LA 3IXSA 4NZLB 2IGGA 1UNSA 1FFVA 4N59A 1YN4A 2I2YA 4WH4A 4C80A 3P1MA 2ZW1A 3IAS1 3P4RB 1KH0A 1ZDVA 2KDMA 4REZA 4OZCA 3TEZA 2BT6A 3TEWA 4HJGE 1GB4A 3LB8C 1PGXA 2BS4B 4HKQA 4N6EB 2LEKA 2RDHA 2VZKD 2BBCA 4GDKB 2KQ4X 2LFIA 1J7BA 1T5XD 2ZW0A 3Q8FA 4TQ1A 2ACZB 1FFUA 1EU4A 3Q69A 4B0MA 1D6EC 2G1EA 1E6EB 2K5PA 4OZAA 3P4SB 1DYQA 4LTUA 4YWGG 1GOZA 1EWCA 2J52A 2WQYB 1XO3A 1JWBD 3P63A 3PZ7A 5LNK1 4UDUC 3IT4B 1D5MC 2QIEB 5T8IA 4RGMA 1IBXB 5BYQA 1VZ8A 1C78A 3NVZA 4US8A 2KWDA 4XE0A 3BYTB 2NMQA 3U2SC 1FIQA 2Z8LA 1JWUD 1YQ3B 4AQ7A 1FCLA 1N5XA 2LMCA 1TKEA 2FBWB 1QOAA 1CZPA 4RGTA 1TJEA 3L4PA 1SF0A 4JE3B 1V1PA 3AEDB 2V4IB 1TY0A 4M0WA 3NVWA 5EE3A 5I4DA 3J9CA 2WDVB 2LHEA 2K3UA 4B0EA 1YJJA 2WXMA 1D5XC 1TS5A 5AUIA 1V8CA 3I57A 3TUOA 1P7FA 1B1ZA 1D4BA 3TEYA 1LO5D 1NVID 1OQQA 1QILA 3EUB2 1HXYD 4JX1C 2I38A 2JSVX 1FNWA 1SXTA 3AEAB 1F0ZA 1SE3A 2WXJA 3HRDD 3E56A 1DGJA 3AEEB 2L32A 1K50A 1N5WA 1JWMD 1YQ4B 4LLGM 4HRSA 2BW2A 2VZKB 2L52A 5H92C 3AE3B 1JMLA 2JYTA 1IGDA 2WDRB 3BZDB 2JX5A 3EGRA 2WXFA 1R7SA 2WXGA 4RF0A 4LK0M 1ET6A 1STEA 1VRAB 4CQNA 2SEBD 1FXIA 2Y5PA 1MHHE 1FEHA 3U52E 2WXRA 1UWXA 3MJ5A 3N9YC 1XLQA 3NVVA 1C77A 1MHXA 2L1AA 4IDIA 1QQRA 1WYGA 1SEBD 3ABVB 3MHZA 3R2TA 2MEKA 3FAHA 2PVGC 4FXCA 2R61A 4HROA 4ZRPA 5D3DA 2BTEA 3BVMA 1K51A 2K22A 3MFGA 2AQ1B 3FILA 4RGOS 4RGNA 3TSSA 2RPVA 2DBYA 1V97A 2MH7A 4KKJA 5BYSA 1N63A 4OW0A 4TSSA 1QKZA 2N7JA 1PYWD 3R2IA 3Q8AA 5G5GA 1B9RA 1YN5A 3RPFC 2BS2B 2SAKA 3AE4B 1L0VB 2JYEA 3GS2A 1ACCA 1FXAA 2X38A 4P16A 2FUG1 3AEBB 4RCOA 3WCQA 2JQRB 2NTSA 1PGBA 1YN3A 3NS1A 3AECB 1FCCC 4XWTA 3AEGB 4OHJA 5TSSA 3ZJVA 1MI0A 2OHFA 2Y5CA 3PZ8A 4KGSA 5E6JA 3BVZA 3KQ4A 1HA5A 2WXKA 1L0XB 1E7PB 4C7YA 1FNUA 1KFYB 1RWSA 1SSNA 4XWWA 2YEPB 1JWAD 3SFEB 4YSXB 1BUIC 2V3PA 3AE8B 1I4XA 1FRRA 2JU6X 1XF5L 2QILA 3SR6A 1AYFA 4O1NA 2W3RA 3GB1A 1QOBA 2LHDA 2WXPA 4ARCA 2J42A 1C79A 3BVGA 1EU3A 1T6BX 3KWVA 5D3IB 1TS2A 2IJ0A 2PKOA 2PMVA 1XXGA 5HI1A 1AW7A 3W9CB 4ZYSA 1KLUD 1L4ZB 2IDYA 4RH6A 1C76A 3ZQ4A 2IPKD 4Q2JA 2EKIA 1SIJA 4JWUC 5EE9A 1ET9A 1TS4A 3AMZA 1CK1A 1IUEA 1TKGA 3DWGC 3P4PB 1N62A 3Q8CA 4P6VF 1ZDXA 3BK2A 2PVOD 1I4PA 2M19A 2PW9A 3EA6A 4MH8A 2WU2B 1UUPA 2WXQA 2HTME 1QOFA 2WXOA 2QMTA 1A70A 3AE7B 2IGDA 1MPEA 2W55A 4DXGA 1V1PB 2V0GA 3U7ZA 4KX6B 2DYOA 1WRIA 1SE2A 1CQVA 1ZXIA 1BXTA 3AE5B 2CJOA 4XDCA 4ITKA 2JZPA 2BB6A 3GP7A 2CU3A 1RFKA 1I4QA 1JALA 3MC0B 3E9SA 1J7AA 4L23A 1EWYC 1HZ6A 1ZOYB 1XLOA 2FE8A 4D2KA 2H89B 2RDGA 1TS3A 1UWMA 2Y3AA 3VRAB 1L0YB 2H88B 1T3QA 3B2GA 4JWSC 4ZOHC 3PO0A 3TEXA 1ESFA 1K52A 1ENFA 2GB1A 1GB1A 1FMAD 5EE0A 4NJCA 4C7ZA 2G9HD 2LUMA 2BYTA 2INPE 3ZGZA 3AE9B 5BMIA 2CJNA 2ONQA 1NENB 2WDQB 1WWTA 1YMHE 2D5GA 2WXLA 3AE1B 3Q8BA 3CWIA 4ZRQA 4N58A 3FC4A 1SE4A 2DWQA 1NI3A 2KMMA 1JQ4A 4YTNB 1M4VA 4DXFA 1ZP0B 2L83A 3CIRB 4H2AA 1HZ5A 4OVZA 3Q8EA 1WGKA 1F77A 3U4EG 1JW9D 2WXNA 1EM7A 1QT9A 4US9A 4ZHPA 4GLSC 5BMHA 3RFZB 2XN9C 3ETRA 2W54A 4KGTA 2EELA 1V1OA 2PLPA 1PGAA 2MJEA 5H8YE 5MPOA 1DOYA 2N0SB 4NAMA 4NAWB 3FILB 1C4CA 5C3JB 1ROEA 3NUHB 3BYYB 1Y56A 1OQRA 1FD6A 1QLBB 1WSPA 4YSZB 3VR8B 5JXVA 3T3OA 2JWUA 3AN1A 4L1BA 4C56C 1YNTE 1VJKA 5D7GA 4ARIA 1VZ6A 5HFYA 1SJED 3KWLA 1RM6C 1XCQL 1FRDA 2V3NA 1CJEA 2WP9B 2M0AA 3AE2B 2PTLA 1FO4A 3AEFB 2YEPF 5BYRA 1JWSD 3IT6B 4A90A 3UI3A 3HUIA 2JXTA 2KAJA 2AX5A 4PT5A 3T3NA 2Q5WD 2WU5B 2KACA 1P7EA 3C8YA 2B76B 3KLSX 4GDLB 2E6XA 2AQ3B 4L2YA 4A9AA 4HEA1 1L6VA 2MJ3A 2W82A 3AV8A 1TY2A 1FM0D 3W1SA 3B9JA 4EE2A 2OEDA 2RMMA 1J7CA 1NYRA 3NVYA 4MT5A 1AWDA 1ZE3D 4WIPA 3O13A 1ZPSA 4YT0B 3IAM1 2NTTA 3VR9B 3AM9A 1IBXA 3LYYA 1BMLC 1VLBA 4ZHOA 2KN4A 2LJIA 2DYMA 3B2FA 4A55A 2TSSA 1ZXHA 1I7HA 1QOGA 5G5HA 1RYJA 1JRPA 3P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JE3 B; 
#chains in the Genus database with same CATH topology
 5DPS A;  3C0R B;  3A9J B;  5D6J B;  2L0F A;  2RSU A;  1PDX A;  3HVZ A;  1SBB B;  3TJP A;  4BOZ B;  1I42 A;  1KOT A;  4J3O D;  2AL3 A;  2ON8 A;  3URY A;  4AS1 A;  3BY4 B;  2Z0D B;  3ZJU A;  1UGJ A;  5EDS A;  1FNV A;  1IGC A;  1R4N I;  3NZ3 A;  1XT9 B;  2XNA C;  2M8S A;  3PRE A;  1MVK A;  1JCK B;  1WIA A;  2ASQ A;  4KGR A;  2ZEQ A;  3VH3 B;  1N61 A;  1HQR D;  3H7S A;  4K7U A;  2QC8 A;  4EZJ A;  3W5V B;  4WQM A;  1PFD A;  2BS3 B;  2GBR A;  5G2N A;  4LNO A;  1DOI A;  3AH7 A;  3OAW A;  1WXS A;  2WNM A;  5E6P A;  2BB5 A;  5IOI A;  4YTP B;  4GU2 A;  1N60 A;  4WUR A;  1VR9 A;  2M1M A;  4WJO A;  1Q10 A;  1WXM A;  2LUE A;  1JRO A;  2LGI A;  2WDT B;  4KKI A;  1KF6 B;  4TMA B;  2QJL A;  4WWM A;  4IKG A;  1TKY A;  1TGZ B;  2KVR A;  2C7H A;  3C19 A;  4MGY E;  3V05 A;  1K53 A;  1F2R I;  3H8H A;  2XK5 B;  2B3A A;  2J53 A;  2KC1 A;  2GI9 A;  3L0W B;  2NBU A;  2DHZ A;  3TL5 A;  1KRH A;  1XLP A;  4JIO U;  1XLN A;  1VZ7 A;  2ZVN A;  2JUO A;  2REX A;  2N9L A;  3DDC B;  3APC A;  2IGG A;  4BKS D;  2J0M A;  4ANX A;  2LXA A;  4ACF A;  1YN4 A;  3PSE B;  1SE9 A;  4P7I A;  3P1M A;  1ZDV A;  2BT6 A;  2MW5 A;  4BOS C;  2BS4 B;  4N6E B;  3RNF C;  2RDH A;  3L17 A;  4TQ1 A;  3UIO B;  1FFU A;  1EU4 A;  1F52 A;  1D6E C;  1DYQ A;  4ZDV A;  2WQY B;  3RNE C;  2Z59 B;  4NPN A;  3QAQ A;  2FID A;  3QIJ A;  2JRH A;  5T8I A;  5CHV C;  1IBX B;  5BYQ A;  3NVZ A;  4KZ0 A;  2NMQ A;  1JWU D;  1UZX B;  1N5X A;  4HDQ A;  4PS8 A;  2KQ7 A;  3PHW B;  1SF0 A;  4W9F A;  1E7U A;  2M17 A;  1UEL A;  2V4I B;  1VCB A;  4M0W A;  3K9P B;  4NJ6 A;  2JZ3 B;  3QAR A;  4W9D A;  1J0G A;  3TUO A;  3M95 A;  3QCA A;  1QIL A;  4S17 A;  4TKN A;  1XD3 B;  1NDD A;  2I38 A;  1FNW A;  2WXJ A;  5HKH A;  3UQA A;  4ZRJ A;  2L0T A;  1YQ4 B;  2BW2 A;  2LAS A;  2CHZ A;  4QAY A;  3BZD B;  1SGH A;  2WXG A;  3B08 A;  1VRA B;  3PHX B;  2N9X A;  1FEH A;  5FR6 A;  2WXR A;  3ZTD A;  1XLQ A;  3K9O B;  1C77 A;  1TZ1 A;  3ABV B;  2BPS A;  2MEK A;  4LNN A;  3EHV A;  3RT3 B;  3H7P B;  2MWS B;  1EF1 A;  2K8C A;  2V9H A;  1FXT B;  5IAA C;  5AEK B;  3MFG A;  4B95 A;  3FIL A;  3TSS A;  1MFW A;  3QC8 B;  2D3B A;  2LD9 A;  3Q3M C;  4KKJ A;  1N63 A;  1QKZ A;  1PYW D;  1YN5 A;  3AE4 B;  1L0V B;  3GS2 A;  1ACC A;  2FUG 1;  2MLB A;  2O6V A;  3AEG B;  3KH0 A;  3Q3O C;  3ZJV A;  3AU5 A;  1HA5 A;  3WA0 A;  4C7Y A;  1E7P B;  1KFY B;  1RWS A;  5CX3 A;  4P1C C;  1JWA D;  4YSX B;  3AE8 B;  2MCN B;  1I4X A;  2N7E A;  4EEW A;  2GBN A;  4WJN A;  1GUA B;  1AYF A;  3PV1 A;  2W3R A;  3DVN U;  1QOB A;  2WXP A;  4M00 A;  1YX5 B;  5D3I B;  2MBH A;  2LZ6 A;  1XXG A;  4G50 A;  4HPP A;  2KMA A;  4W9I A;  4XYC A;  4ANW A;  4TUU A;  2FNJ B;  4AJW A;  3AMZ A;  3P4P B;  1L7Y A;  3EA6 A;  4MJS A;  2ZPY A;  3WAL A;  4ASW C;  3DBS A;  2WXQ A;  4MGK E;  2HTM E;  1A70 A;  1MPE A;  2D2Q A;  2W55 A;  3ZNZ B;  2DYO A;  1ZXI A;  3AE5 B;  2CJO A;  4ITK A;  4FA6 A;  1RFK A;  3DVN V;  3MC0 B;  1J7A A;  4RMA A;  2FE8 A;  3DPD A;  2H89 B;  2JVC A;  2IO2 B;  3VRA B;  1L0Y B;  2H88 B;  5J2R A;  1P1A A;  1T3Q A;  4ZOH C;  3TEX A;  1WX9 A;  1IP9 A;  1WE6 A;  2W9N A;  2INP E;  4IWP A;  1YIW A;  3T9L A;  3Q8B A;  3CWI A;  4ZRQ A;  4N58 A;  3QJZ A;  3L08 A;  2FCM A;  1M4V A;  5LLI A;  4H2A A;  3ZNI D;  4DHJ D;  3A4S C;  1EM7 A;  2LGD A;  2GBJ A;  4FLH A;  1QT9 A;  2XN9 C;  3KVF B;  4P1B C;  2AEH A;  4NQK E;  5MPO A;  4W9K A;  1V5O A;  1FD6 A;  1MJD A;  3VAW A;  3ZVV A;  2WYQ A;  3WAM A;  4W9G A;  1QLB B;  1WSP A;  4YSZ B;  1LM8 B;  1WGG A;  1S1Q B;  5CTR C;  2ZNV B;  2LGS A;  1YNT E;  1KM7 A;  1VJK A;  4ARI A;  3QHT A;  1JRU A;  4KVG B;  5HFY A;  3DBR B;  3QX1 A;  2WP9 B;  1YQB A;  2PTL A;  3AEF B;  4IUM B;  2YEP F;  4AP4 C;  2JF5 A;  3MC9 A;  3NHE B;  3IT6 B;  2JXT A;  1YD8 U;  2FCQ A;  2AX5 A;  3T3N A;  2WU5 B;  1TT5 B;  3KLS X;  2HD5 B;  4L2Y A;  4A9A A;  4HEA 1;  1L6V A;  3EFC A;  4WAA A;  1OEY A;  3B9J A;  1OTR B;  2OED A;  2RMM A;  4NY0 A;  4BBN F;  2KWC A;  3O13 A;  1LXD A;  2NTT A;  1VLB A;  4ZHO A;  2L00 B;  3APD A;  1GJZ A;  4LDT B;  2MBE A;  2N4F A;  4HLE A;  4A55 A;  1I7H A;  2DZK A;  1L6U A;  3ZUN A;  2IGH A;  1E9M A;  2J4X A;  2HDE A;  1UD7 A;  1I4R A;  2W3S A;  2AQ2 B;  4OZB A;  3NZU A;  4R3D A;  4XDD A;  4GN1 A;  2EMT A;  4IW0 A;  2WXH A;  4RNA A;  5J18 A;  2CKH B;  3UGB B;  3WAO A;  2GRI A;  3HHM A;  1HTO A;  2INN E;  1VD2 A;  4TQ0 A;  4A3O A;  3FKY A;  3KYC D;  2WLB A;  3Q6B A;  4K1R B;  3Q3J A;  4AJY B;  3CSF A;  2INC C;  1J19 A;  3W5U B;  2GMI C;  2N9K A;  3ZXV A;  1D5Z C;  4F1S A;  1ZUD 2;  1R4N B;  1DOX A;  4YTM B;  3NY5 A;  1HEZ E;  2WS3 B;  3LXF A;  3RNG C;  2O2V B;  2YLM A;  4JL9 A;  4I6P A;  1WXQ A;  3IG3 A;  3UIP B;  1SJH D;  2KJH B;  3W1S C;  1V2Y A;  2Y5B B;  2L8J A;  1SB3 C;  1A5R A;  3RI7 C;  2MHJ A;  2OOB B;  3MC8 A;  3AE6 B;  2JZZ A;  4MAC A;  3BWU D;  1OGW A;  5HHD G;  1GPX A;  3RNA C;  1NYQ A;  4IM3 A;  2MRP A;  4WWO A;  3SEB A;  1AN8 A;  4HDO A;  3U7D A;  2FUH B;  3ZNG C;  3V6C B;  1ZGU B;  2C7M B;  2ICI A;  3VHT C;  2BWF A;  3RCZ A;  2R2Q A;  1IPG A;  3SHQ A;  4AOF A;  2G3Q B;  1OQY A;  4NZL B;  3B0A A;  1UNS A;  1GNU A;  3U30 A;  2WGS A;  4DHZ E;  2I1J A;  4N59 A;  3IHP C;  2L05 A;  2MP2 B;  3DQV A;  1WRD B;  1WMH B;  2ZW1 A;  1D3Z A;  2KDM A;  3TEZ A;  3TEW A;  4HJG E;  1GB4 A;  3LB8 C;  4C00 A;  2LEK A;  4GDK B;  1UGM A;  3SU8 X;  2G1E A;  2K5P A;  4OZA A;  3P4S B;  1WE7 A;  2J52 A;  1V80 A;  2G45 B;  3S2A A;  3DHG C;  3OG5 A;  5LNK 1;  4UDU C;  3BIN A;  1E8X A;  2QIE B;  3VTW A;  1VZ8 A;  2DZM A;  4US8 A;  2KWD A;  3JSV B;  3BYT B;  1YQ3 B;  4AQ7 A;  1TTN A;  1UBI A;  3ZW3 A;  4HPM B;  2K1F A;  3L4P A;  2PE9 A;  1WXV A;  4J6I A;  3J9C A;  4OVU A;  4B0E A;  3AI5 A;  5IA7 A;  1P7F A;  5AZH A;  1B1Z A;  4BKG A;  1V86 A;  2NS5 A;  1NVI D;  3EUB 2;  1HE8 A;  4FHK A;  2GBM A;  2RPQ A;  2GBK A;  2JSV X;  3HRD D;  1DGJ A;  3AEE B;  4LLG M;  4ICV A;  5KHQ A;  2KTF A;  2L52 A;  2DYB A;  3RZF A;  1Q5W B;  1Q0W B;  4LK0 M;  4CQN A;  1AAR A;  2KYW A;  2SEB D;  1FXI A;  5DPT A;  3MJ5 A;  1UWX A;  2N9E B;  3WAP A;  2D3G A;  4S0R A;  2L1A A;  4I6N B;  4IDI A;  4KIK A;  5C1Z A;  3I3T B;  4KV2 A;  2KXJ A;  2PPH A;  4EZL A;  4FXC A;  1QZE A;  4A3P A;  2R61 A;  5D3D A;  2BYE A;  4F7Z A;  2EMS A;  2BQQ A;  2AQ1 B;  4RGN A;  3ZRC A;  4HWI B;  2DNF A;  1G6J A;  1V97 A;  4HCN B;  5BYS A;  3PRP B;  4OW0 A;  1B9R A;  1F1H A;  2BS2 B;  2JYE A;  2G4S A;  2X38 A;  1E5W A;  4P16 A;  2KFJ A;  4RCO A;  5D2M B;  2NTS A;  4XWT A;  1FCC C;  4LNK A;  3PZ8 A;  4XC2 A;  3KQ4 A;  2L7R A;  2BYV E;  1V9J A;  1ISN A;  4XWW A;  2YEP B;  2BF8 B;  1FRR A;  1KLV A;  1XF5 L;  2QIL A;  5DCN A;  2KN5 A;  3GB1 A;  4ARC A;  2KDE B;  1WF9 A;  2J42 A;  5JHB A;  1EU3 A;  1TS2 A;  4GSW A;  3V6E B;  1AW7 A;  4IM0 A;  1P0R A;  3L54 A;  3GZN I;  1WZ3 A;  2LWP A;  4DWF A;  2OJW A;  1TKG A;  4E71 A;  4P6V F;  3BK2 A;  3H6N A;  4MH8 A;  2KDI A;  2WU2 B;  1NI2 A;  1UUP A;  3PZD A;  1QOF A;  3NZS A;  1E8Z A;  3U7Z A;  5IN7 A;  1WRI A;  3MHS D;  1CQV A;  4RM9 A;  4M0W B;  2KK8 A;  4PS7 A;  3GP7 A;  4ZRK A;  1RAX A;  3EEC A;  1JAL A;  1EWY C;  2RDG A;  1TS3 A;  5IO9 A;  2N9P C;  2ZNV C;  4DK5 A;  4B9K A;  2LRU A;  5DPR A;  3R7R A;  4JWS C;  4XGA B;  3PO0 A;  2KFK A;  1K52 A;  3H1U A;  3RNB C;  3A1Q A;  4MM3 A;  2AWT A;  2CJN A;  2ONQ A;  1NEN B;  3RUI B;  2D5G A;  3AE1 B;  2JRI B;  3DHI C;  3N30 A;  3RZW C;  4IWO A;  1ZP0 B;  2M0X A;  2UWQ A;  4OVZ A;  4FJY A;  3TIX A;  3U4E G;  1JW9 D;  4US9 A;  3ZDM C;  5BMH A;  3RFZ B;  4K7S A;  4KGT A;  4LDT D;  1V1O A;  2PLP A;  1WR1 A;  3ZDT A;  4WQO B;  4HXD A;  2KC2 A;  3FIL B;  1C4C A;  1Y8R C;  2KNB A;  1E90 A;  1V5T A;  4MSM B;  3T3O A;  2KKC A;  2C5L C;  4MGI E;  4C4V A;  3U8Z A;  4L1B A;  4BKT A;  4M01 A;  5D7G A;  3AXC A;  3T8M A;  3ZKJ C;  3KWL A;  1XCQ L;  2V3N A;  2NVU I;  2O6V B;  3KUZ A;  1WXA A;  4IM2 A;  4W9J A;  2KAN A;  1NBF C;  1E8Y A;  2M4N A;  3N20 C;  1JWS D;  3UI3 A;  2KJR A;  2ZVO A;  2KAC A;  3DBH I;  1WGY A;  2IY0 B;  2MJ3 A;  2KWV B;  1Z5S B;  2KDF B;  1LQB A;  4PYZ A;  1EF5 A;  1J7C A;  1NYR A;  3NVY A;  3I5J C;  3IAM 1;  4W9E A;  2KVZ A;  2IO0 B;  5KHO A;  3V62 A;  3VR9 B;  3LYY A;  2QCZ A;  2LJI A;  2WX0 A;  5E6N A;  4MJS B;  4MEM A;  4EKU A;  1ZXH A;  3R8B A;  2X8X X;  4WJP A;  1NEK B;  5EE1 A;  3Q3F A;  2MBO A;  2MJD A;  3BK1 A;  3MTN B;  3ZJT A;  4BFR A;  2A5U A;  1OEY J;  3OWE B;  1UBQ A;  2ZPN A;  1XEE A;  1F2R C;  3RYT A;  3A9K A;  1KTK A;  3A33 B;  1OFF A;  2LVQ A;  1KLG D;  1ZKH A;  4MEL A;  1UH6 A;  4BKS A;  2LVP A;  4II3 B;  2UU7 A;  4DBG A;  1IYF A;  3V3X A;  3GOE A;  1TZO A;  2KDB A;  2G4D B;  3SFD B;  2LRW A;  4CHK A;  1EUV B;  5FKA C;  2GLS A;  3M62 B;  1H8C A;  3N3K B;  3PS6 A;  3LJ3 A;  1C9F A;  2CR5 A;  5IP4 D;  1C4P A;  2A4Z A;  4YSY B;  4GIV A;  1GAQ B;  3NRZ A;  2QSD A;  1WJN A;  1GC7 A;  1L4D B;  3RMK C;  4LNF A;  2JXX A;  2MX2 A;  4DDG D;  2K25 A;  4WAF A;  2JWZ A;  2LVO A;  4DQO C;  1C4A A;  1EO6 A;  4EZK A;  3DWM A;  1RLF A;  2M56 B;  2VH2 A;  3W2D A;  5C2T B;  2ZZP B;  5GMV A;  3IXS A;  1WJ6 A;  4CYE A;  4FJV B;  4WH4 A;  4C80 A;  2UYZ B;  1KH0 A;  4REZ A;  4OZC A;  1PQS A;  3RNC C;  2BBC A;  2LFI A;  2LJ5 A;  1E6E B;  2KTR A;  4YWG G;  3L16 A;  3ALB A;  1JWB D;  3P63 A;  3PZ7 A;  5C23 A;  4HK2 A;  2VRR B;  3Q14 C;  4RGM A;  2VH1 A;  2JY6 A;  2RGF A;  4FHJ A;  1H4R A;  3U2S C;  1FIQ A;  2BKR B;  4IG7 B;  4X57 B;  1FCL A;  2IYD B;  4WWP A;  1K8R B;  2PE6 B;  2D10 A;  1TKE A;  2FBW B;  1QOA A;  1CZP A;  5IKC M;  3A4R A;  4JE3 B;  1V1P A;  5L95 C;  3AED B;  1TY0 A;  3NVW A;  2KD0 A;  5EE3 A;  3N1Y C;  5I4D A;  2WDV B;  2K3U A;  1YJJ A;  2WXM A;  1D5X C;  1TS5 A;  5AUI A;  1V8C A;  1WJ4 A;  2C60 A;  1OQQ A;  4JX1 C;  1F0Z A;  3AEA B;  2Z0E B;  3E56 A;  2L3Z A;  4KDL B;  4DXA B;  1K50 A;  1N5W A;  4WJQ A;  4K3B A;  2VZK B;  2N7D A;  2XBB C;  5H92 C;  3AE3 B;  1JML A;  2JYT A;  2WDR B;  1R7S A;  4BAX A;  4RF0 A;  1ET6 A;  3JYU A;  1STE A;  3ONS A;  3N9Y C;  3NVV A;  4GB9 A;  1QQR A;  1WYG A;  4K81 A;  4BBN C;  4A20 A;  3MHZ A;  3FAH A;  2PVG C;  2CS4 A;  4ZRI A;  1X1M A;  3NG0 A;  4HRO A;  4W9H A;  1K51 A;  2K22 A;  4HCP B;  2LI5 A;  4NAW A;  2BVC A;  4RGO S;  2QHO A;  2DBY A;  4K7W A;  2PEA A;  1P3Q U;  3Q2A C;  3R2I A;  2SAK A;  1I35 A;  3VUX A;  1FXA A;  2MBB B;  3AEB B;  4LNI A;  4RM8 A;  2JQR B;  3QWZ B;  5TSS A;  3NS1 A;  3L10 B;  2Y5C A;  4KGS A;  5J17 A;  3BVZ A;  2WXK A;  4G0N B;  1L0X B;  1FNU A;  3W1Y A;  3APF A;  2KX0 A;  2I1K A;  4IC7 B;  2FIF A;  3DCG A;  2D3C A;  4GDL A;  4K3C A;  2LHD A;  2MBQ A;  1C79 A;  4KSL C;  3ENE A;  2IJ0 A;  1WM2 A;  2C9W B;  2NCN A;  3IBE A;  1L4Z B;  2IDY A;  4YL8 A;  1C76 A;  2IPK D;  5BO4 B;  2EKI A;  1SIJ A;  3GZN B;  2JPH A;  1ET9 A;  3PGE A;  1TS4 A;  1IUE A;  3DWG C;  3Q8C A;  1WGH A;  5TR5 A;  2PVO D;  4DHZ B;  1I4P A;  3VVW B;  1WYW B;  5D94 A;  1T0S C;  3TCA A;  3VTU A;  3DBL I;  2OJR A;  4NQL B;  2QMT A;  3AE7 B;  2IGD A;  2KLG A;  1P98 A;  4KX6 B;  4FAD A;  3A9J A;  1BXT A;  2JZP A;  2BB6 A;  2CU3 A;  2V4L A;  1I4Q A;  2MQJ A;  2ZJD A;  1T0Y A;  4L23 A;  1HZ6 A;  1ZOY B;  1XLO A;  3DVG X;  1L2N A;  1GG3 A;  3OJ4 B;  3OJ3 A;  3TMP B;  1RRB A;  2O6V D;  2NPT A;  2KT7 A;  3B2G A;  1CMX B;  1ENF A;  1GB1 A;  2NPT B;  5EE0 A;  4NJC A;  3TBL D;  3ZXR A;  4I6L B;  4C7Z A;  2LUM A;  3PRZ A;  3AE9 B;  4OVV A;  5BMI A;  1WWT A;  3ZO5 B;  1YMH E;  2WXL A;  1T0Q C;  2DWQ A;  1NI3 A;  5CHF A;  2KMM A;  2K8H A;  2L83 A;  5CHW A;  1LFD A;  1WGK A;  4BVU C;  4KIK B;  2WXN A;  4AWJ A;  3X23 A;  3UIN B;  2MSE D;  3HIZ A;  2J7Q B;  3ETR A;  2IY1 B;  2K8B A;  2MJE A;  4MDK E;  1DOY A;  4JLC A;  4LJO B;  5C3J B;  4KDI C;  1ROE A;  1ZW7 A;  4TV3 A;  2KHW B;  3NUH B;  1Y56 A;  3EC8 A;  2XK5 A;  1V81 A;  2IZV B;  3VR8 B;  5JXV A;  5JHA A;  2JWU A;  3EFU A;  3AN1 A;  4C56 C;  3ECI A;  1SJE D;  1RM6 C;  1CJE A;  5JH5 C;  2CHX A;  2LGY A;  2IBI B;  3RUL A;  2KWU B;  3M3J A;  4URK A;  4A90 A;  3HUI A;  4ANV A;  2KAJ A;  4PT5 A;  2Q5W D;  1P7E A;  3C8Y A;  2B76 B;  2E6X A;  1SIF A;  3AV8 A;  1TY2 A;  1Z2M A;  2FAZ A;  1FM0 D;  3DBH B;  3W1S A;  2BYF A;  4EE2 A;  3RN9 C;  1R4M I;  4IWQ A;  3CF6 E;  1ZE3 D;  3GE3 C;  1YX6 B;  1UF0 A;  3ZNH B;  3AM9 A;  1IBX A;  2DEN B;  1BML C;  3PPA A;  2KN4 A;  2DAF A;  4JQW C;  4W9L A;  3B2F A;  2RR9 A;  2ZCB A;  3DOW A;  1QOG A;  1JRP A;  3P4Q B;  1LGR A;  2E3T A;  2D11 A;  5AUK A;  2IO3 B;  3VQI A;  1I4G A;  3MP9 A;  4E3C A;  5GXG B;  4GMV A;  1TYG B;  4A6Q A;  1L5P A;  1WY8 A;  3HM6 X;  3AB5 A;  2WX1 A;  3VDZ A;  3B1L X;  3PRM B;  4FN2 A;  2YVC A;  3I9V 1;  5FK9 C;  1YJI A;  3LDZ E;  1KJT A;  3ML9 A;  2KFK B;  4HJK A;  3A1Q B;  3WIM A;  1I4H A;  1WX7 A;  2WXI A;  2PIA A;  5BMG A;  4ANU A;  4A8X C;  4MM3 B;  4LCD E;  1PUT A;  3PLV A;  4RFB A;  2QEJ C;  4KZC A;  4RF1 A;  2C7N B;  2K0P A;  3KUC B;  3IVF A;  2RDB C;  5FR3 A;  5JZE B;  1E10 A;  4KSK C;  3R7Q A;  3ZYY X;  1QF6 A;  3H9D A;  4IOI E;  2K9X A;  2DZI A;  3I63 C;  5AZG A;  2ZCC A;  2DLB A;  4YXD B;  3H7P A;  1XCT L;  3P42 A;  3BII D;  1WJU A;  1XQQ A;  4HKZ E;  4USA A;  3JVZ X;  1VDV A;  2QDF A;  2BWE S;  3QA8 A;  2IO1 B;  1E0Z A;  3D32 A;  4JGH B;  4JPS A;  5HG2 A;  4C4V B;  3HVD A;  2JT4 B;  3VRB B;  4ZYN A;  3VUY A;  3QQ8 B;  1FFV A;  3ZIM A;  1WI0 A;  4EOY A;  3V61 A;  3V60 A;  2I2Y A;  2KJ6 A;  3IAS 1;  3P4R B;  4G3X B;  4GOC A;  3VXW A;  2KZR A;  4MSQ B;  1PGX A;  4HKQ A;  2VZK D;  2KO3 A;  4FBJ B;  2J0K A;  2KQ4 X;  1J7B A;  1T5X D;  2ZW0 A;  3HM3 A;  3Q8F A;  2ACZ B;  4M8M A;  5L83 A;  2EKE C;  3Q69 A;  4B0M A;  3UF8 A;  3QK0 A;  2D3A A;  4AUQ C;  4LTU A;  1GOZ A;  1EWC A;  2J0J A;  2LXC A;  1XO3 A;  4MGZ E;  3OLM D;  2IND C;  3IT4 B;  2HTH A;  1D5M C;  1C78 A;  1N6Z A;  1J8C A;  4XE0 A;  2Z8L A;  4NNJ B;  3VTV A;  2LMC A;  2DAJ A;  4RGT A;  1TJE A;  3SDL C;  2BKF A;  2WHI A;  4XX5 A;  2AL6 A;  2BGF A;  4N9F 4;  1Q1O A;  2HJ8 A;  4B6W A;  2KOX A;  2LHE A;  2HE7 A;  3A9K B;  2FCS A;  3I57 A;  2K6Q A;  5DPW A;  2NBV B;  1D4B A;  3TEY A;  1LO5 D;  3KUD B;  1HXY D;  1WH3 A;  2XEW A;  1SXT A;  1SE3 A;  2FCN A;  2L32 A;  4GGQ A;  1JWM D;  4HRS A;  2KLC A;  4PS3 A;  2AYO B;  2NBW B;  2R2O A;  1YJ1 A;  3JW0 X;  3X0W A;  1IGD A;  2JX5 A;  1MG4 A;  2WXF A;  3EGR A;  4GXB A;  3NOB A;  4CO7 A;  4M8N A;  2L76 A;  2Y5P A;  1MHH E;  3U52 E;  4PYU A;  4BZA A;  3HK0 A;  1MHX A;  4E74 A;  1SEB D;  3AUL A;  2KX3 A;  3R2T A;  4ZRP A;  2BTE A;  3BVM A;  3ZRF A;  2RPV A;  1S3S G;  2MH7 A;  1TIF A;  4TSS A;  2N7J A;  5G5G A;  3Q8A A;  5E6O A;  2V3S A;  3O65 B;  3RPF C;  1MG8 A;  3PVL A;  3VFK A;  4HVB A;  3WCQ A;  3MJW A;  1PGB A;  1BT0 A;  1YN3 A;  3AEC B;  4NJ7 A;  4OHJ A;  1MI0 A;  2OHF A;  5E6J A;  5G55 A;  1SSN A;  3SFE B;  1BUI C;  2V3P A;  1WX8 A;  2JU6 X;  1V49 A;  3SR6 A;  2PJH A;  1U4A A;  4O1N A;  3ZTC A;  1TBE A;  4ICU A;  3BVG A;  2CHW A;  2KMC A;  1T6B X;  2KTR B;  3KWV A;  2PKO A;  2PMV A;  4G11 A;  3DVG Y;  5HI1 A;  3W9C B;  4ZYS A;  1KLU D;  4RH6 A;  3ZQ4 A;  4Q2J A;  1WFY A;  4JWU C;  5EE9 A;  1CK1 A;  4FJZ A;  1N62 A;  1ZDX A;  1WGD A;  2M19 A;  2PW9 A;  2K6D B;  2WWZ A;  2CU1 A;  4II2 B;  2WXO A;  4DXG A;  3DBL B;  2KQS A;  1V1P B;  2V0G A;  1SE2 A;  4XDC A;  3SD5 A;  3E9S A;  2K39 A;  1C1Y B;  4D2K A;  1P9D U;  3DHH C;  3GE8 C;  3UQB A;  4M02 A;  1UWM A;  2Y3A A;  3NS8 A;  1ESF A;  1FPY A;  2GB1 A;  1FMA D;  3N1X C;  1V6E A;  3N32 A;  2G9H D;  3ZGZ A;  2BYT A;  3PT2 B;  3WAN A;  1GC6 A;  2WDQ B;  2LGX A;  2O2V A;  3FC4 A;  1SE4 A;  1WM3 A;  4W9C A;  3CMM B;  1JQ4 A;  1C3T A;  3N1Z C;  4YTN B;  1F9J A;  4DXF A;  3CIR B;  4HPL B;  1HZ5 A;  2V1Y A;  1WGR A;  3Q8E A;  2HJ1 A;  4EFO A;  1YOV B;  1HTQ A;  1F77 A;  3VH4 B;  1E8W A;  3ML8 A;  1WR6 E;  4ZHP A;  4GLS C;  3ZLZ A;  2W54 A;  2EEL A;  4EUT A;  3KYD D;  3IFW B;  1PGA A;  4WWN A;  5H8Y E;  3L13 A;  2N0S B;  2N1V A;  3Q3N C;  4NAM A;  5LXH A;  3P2B A;  4NAW B;  2GOW A;  3CST A;  3BYY B;  1OQR A;  1T0R C;  2RD0 A;  3R66 C;  3DBR I;  1VZ6 A;  2MA9 B;  4LJP B;  1FRD A;  5AZF A;  2MP2 A;  2M0A A;  3AE2 B;  1FO4 A;  2D07 B;  1M94 A;  3VUW A;  1WMH A;  3R3M A;  5BYR A;  2DZJ A;  2N1W A;  1E7V A;  4GDL B;  2AQ3 B;  4GDK A;  3AU4 A;  2W82 A;  4XZ4 A;  4DDI D;  4PK1 A;  4FUL A;  5LXI B;  1RFA A;  2NR2 A;  3RD2 A;  3KW5 B;  3PTF C;  4MT5 A;  4DHJ B;  1AWD A;  1R4M B;  4WIP A;  2DX5 B;  3NJT A;  1ZPS A;  4YT0 B;  3M63 B;  1WZ0 A;  4MH0 E;  3JSV A;  2DYM A;  3PLU A;  4F8C B;  2TSS A;  5G5H A;  1RYJ A; 
#chains in the Genus database with same CATH homology
 2E3T A;  1L6U A;  1NEK B;  5EE1 A;  2IGH A;  1E9M A;  2J4X A;  2HDE A;  2MJD A;  3BK1 A;  5AUK A;  1I4R A;  2W3S A;  3VQI A;  1I4G A;  2AQ2 B;  3MP9 A;  4OZB A;  3ZJT A;  4R3D A;  4XDD A;  5GXG B;  2WXH A;  3OWE B;  4RNA A;  1PDX A;  1TYG B;  3HVZ A;  4A6Q A;  1XEE A;  1F2R C;  1L5P A;  1KTK A;  1SBB B;  2GRI A;  1OFF A;  2INN E;  1KLG D;  3AB5 A;  4TQ0 A;  3I9V 1;  4J3O D;  5FK9 C;  1YJI A;  2ON8 A;  3URY A;  2WLB A;  4AS1 A;  3ZJU A;  1UGJ A;  1I4H A;  3V3X A;  1FNV A;  1IGC A;  2WXI A;  3NZ3 A;  2PIA A;  2N9K A;  3W5U B;  5BMG A;  2XNA C;  1D5Z C;  1MVK A;  1TZO A;  1ZUD 2;  1JCK B;  4KGR A;  4MM3 B;  4A8X C;  1DOX A;  1PUT A;  1N61 A;  4RFB A;  3SFD B;  1HQR D;  4YTM B;  2QEJ C;  1HEZ E;  4RF1 A;  2WS3 B;  3LXF A;  5FKA C;  3W5V B;  4WQM A;  1PFD A;  1WXQ A;  2K0P A;  1C9F A;  2BS3 B;  5FR3 A;  1E10 A;  1DOI A;  1SJH D;  3AH7 A;  3ZYY X;  1QF6 A;  2WNM A;  2BB5 A;  4YTP B;  1SB3 C;  1N60 A;  4WUR A;  1VR9 A;  1C4P A;  4IOI E;  4YSY B;  1Q10 A;  1GAQ B;  3NRZ A;  3AE6 B;  2K9X A;  2QSD A;  4MAC A;  4YXD B;  1JRO A;  2DLB A;  2LGI A;  3BWU D;  1L4D B;  1XCT L;  3P42 A;  4KKI A;  1KF6 B;  4TMA B;  3BII D;  2QJL A;  5HHD G;  1GPX A;  4HKZ E;  4WWM A;  1NYQ A;  4IKG A;  4USA A;  1TKY A;  1VDV A;  3V05 A;  1K53 A;  3R8B A;  4WAF A;  1F2R I;  3SEB A;  1AN8 A;  3H8H A;  2J53 A;  4DQO C;  1E0Z A;  2GI9 A;  1C4A A;  4JPS A;  5HG2 A;  3DWM A;  1KRH A;  1XLP A;  3HVD A;  1XLN A;  2M56 B;  1VZ7 A;  3VRB B;  3W2D A;  2ICI A;  5C2T B;  2N9L A;  3IXS A;  4NZL B;  2IGG A;  1UNS A;  1FFV A;  4N59 A;  1YN4 A;  2I2Y A;  4WH4 A;  4C80 A;  3P1M A;  2ZW1 A;  3IAS 1;  3P4R B;  1KH0 A;  1ZDV A;  2KDM A;  4REZ A;  4OZC A;  3TEZ A;  2BT6 A;  3TEW A;  4HJG E;  1GB4 A;  3LB8 C;  1PGX A;  2BS4 B;  4HKQ A;  4N6E B;  2LEK A;  2RDH A;  2VZK D;  2BBC A;  4GDK B;  2KQ4 X;  2LFI A;  1J7B A;  1T5X D;  2ZW0 A;  3Q8F A;  4TQ1 A;  2ACZ B;  1FFU A;  1EU4 A;  3Q69 A;  4B0M A;  1D6E C;  2G1E A;  1E6E B;  2K5P A;  4OZA A;  3P4S B;  1DYQ A;  4LTU A;  4YWG G;  1GOZ A;  1EWC A;  2J52 A;  2WQY B;  1XO3 A;  1JWB D;  3P63 A;  3PZ7 A;  5LNK 1;  4UDU C;  3IT4 B;  1D5M C;  2QIE B;  5T8I A;  4RGM A;  1IBX B;  5BYQ A;  1VZ8 A;  1C78 A;  3NVZ A;  4US8 A;  2KWD A;  4XE0 A;  3BYT B;  2NMQ A;  3U2S C;  1FIQ A;  2Z8L A;  1JWU D;  1YQ3 B;  4AQ7 A;  1FCL A;  1N5X A;  2LMC A;  1TKE A;  2FBW B;  1QOA A;  1CZP A;  4RGT A;  1TJE A;  3L4P A;  1SF0 A;  4JE3 B;  1V1P A;  3AED B;  2V4I B;  1TY0 A;  4M0W A;  3NVW A;  5EE3 A;  5I4D A;  3J9C A;  2WDV B;  2LHE A;  2K3U A;  4B0E A;  1YJJ A;  2WXM A;  1D5X C;  1TS5 A;  5AUI A;  1V8C A;  3I57 A;  3TUO A;  1P7F A;  1B1Z A;  1D4B A;  3TEY A;  1LO5 D;  1NVI D;  1OQQ A;  1QIL A;  3EUB 2;  1HXY D;  4JX1 C;  2I38 A;  2JSV X;  1FNW A;  1SXT A;  3AEA B;  1F0Z A;  1SE3 A;  2WXJ A;  3HRD D;  3E56 A;  1DGJ A;  3AEE B;  2L32 A;  1K50 A;  1N5W A;  1JWM D;  1YQ4 B;  4LLG M;  4HRS A;  2BW2 A;  2VZK B;  2L52 A;  5H92 C;  3AE3 B;  1JML A;  2JYT A;  1IGD A;  2WDR B;  3BZD B;  2JX5 A;  3EGR A;  2WXF A;  1R7S A;  2WXG A;  4RF0 A;  4LK0 M;  1ET6 A;  1STE A;  1VRA B;  4CQN A;  2SEB D;  1FXI A;  2Y5P A;  1MHH E;  1FEH A;  3U52 E;  2WXR A;  1UWX A;  3MJ5 A;  3N9Y C;  1XLQ A;  3NVV A;  1C77 A;  1MHX A;  2L1A A;  4IDI A;  1QQR A;  1WYG A;  1SEB D;  3ABV B;  3MHZ A;  3R2T A;  2MEK A;  3FAH A;  2PVG C;  4FXC A;  2R61 A;  4HRO A;  4ZRP A;  5D3D A;  2BTE A;  3BVM A;  1K51 A;  2K22 A;  3MFG A;  2AQ1 B;  3FIL A;  4RGO S;  4RGN A;  3TSS A;  2RPV A;  2DBY A;  1V97 A;  2MH7 A;  4KKJ A;  5BYS A;  1N63 A;  4OW0 A;  4TSS A;  1QKZ A;  2N7J A;  1PYW D;  3R2I A;  3Q8A A;  5G5G A;  1B9R A;  1YN5 A;  3RPF C;  2BS2 B;  2SAK A;  3AE4 B;  1L0V B;  2JYE A;  3GS2 A;  1ACC A;  1FXA A;  2X38 A;  4P16 A;  2FUG 1;  3AEB B;  4RCO A;  3WCQ A;  2JQR B;  2NTS A;  1PGB A;  1YN3 A;  3NS1 A;  3AEC B;  1FCC C;  4XWT A;  3AEG B;  4OHJ A;  5TSS A;  3ZJV A;  1MI0 A;  2OHF A;  2Y5C A;  3PZ8 A;  4KGS A;  5E6J A;  3BVZ A;  3KQ4 A;  1HA5 A;  2WXK A;  1L0X B;  1E7P B;  4C7Y A;  1FNU A;  1KFY B;  1RWS A;  1SSN A;  4XWW A;  2YEP B;  1JWA D;  3SFE B;  4YSX B;  1BUI C;  2V3P A;  3AE8 B;  1I4X A;  1FRR A;  2JU6 X;  1XF5 L;  2QIL A;  3SR6 A;  1AYF A;  4O1N A;  2W3R A;  3GB1 A;  1QOB A;  2LHD A;  2WXP A;  4ARC A;  2J42 A;  1C79 A;  3BVG A;  1EU3 A;  1T6B X;  3KWV A;  5D3I B;  1TS2 A;  2IJ0 A;  2PKO A;  2PMV A;  1XXG A;  5HI1 A;  1AW7 A;  3W9C B;  4ZYS A;  1KLU D;  1L4Z B;  2IDY A;  4RH6 A;  1C76 A;  3ZQ4 A;  2IPK D;  4Q2J A;  2EKI A;  1SIJ A;  4JWU C;  5EE9 A;  1ET9 A;  1TS4 A;  3AMZ A;  1CK1 A;  1IUE A;  1TKG A;  3DWG C;  3P4P B;  1N62 A;  3Q8C A;  4P6V F;  1ZDX A;  3BK2 A;  2PVO D;  1I4P A;  2M19 A;  2PW9 A;  3EA6 A;  4MH8 A;  2WU2 B;  1UUP A;  2WXQ A;  2HTM E;  1QOF A;  2WXO A;  2QMT A;  1A70 A;  3AE7 B;  2IGD A;  1MPE A;  2W55 A;  4DXG A;  1V1P B;  2V0G A;  3U7Z A;  4KX6 B;  2DYO A;  1WRI A;  1SE2 A;  1CQV A;  1ZXI A;  1BXT A;  3AE5 B;  2CJO A;  4XDC A;  4ITK A;  2JZP A;  2BB6 A;  3GP7 A;  2CU3 A;  1RFK A;  1I4Q A;  1JAL A;  3MC0 B;  3E9S A;  1J7A A;  4L23 A;  1EWY C;  1HZ6 A;  1ZOY B;  1XLO A;  2FE8 A;  4D2K A;  2H89 B;  2RDG A;  1TS3 A;  1UWM A;  2Y3A A;  3VRA B;  1L0Y B;  2H88 B;  1T3Q A;  3B2G A;  4JWS C;  4ZOH C;  3PO0 A;  3TEX A;  1ESF A;  1K52 A;  1ENF A;  2GB1 A;  1GB1 A;  1FMA D;  5EE0 A;  4NJC A;  4C7Z A;  2G9H D;  2LUM A;  2BYT A;  2INP E;  3ZGZ A;  3AE9 B;  5BMI A;  2CJN A;  2ONQ A;  1NEN B;  2WDQ B;  1WWT A;  1YMH E;  2D5G A;  2WXL A;  3AE1 B;  3Q8B A;  3CWI A;  4ZRQ A;  4N58 A;  3FC4 A;  1SE4 A;  2DWQ A;  1NI3 A;  2KMM A;  1JQ4 A;  4YTN B;  1M4V A;  4DXF A;  1ZP0 B;  2L83 A;  3CIR B;  4H2A A;  1HZ5 A;  4OVZ A;  3Q8E A;  1WGK A;  1F77 A;  3U4E G;  1JW9 D;  2WXN A;  1EM7 A;  1QT9 A;  4US9 A;  4ZHP A;  4GLS C;  5BMH A;  3RFZ B;  2XN9 C;  3ETR A;  2W54 A;  4KGT A;  2EEL A;  1V1O A;  2PLP A;  1PGA A;  2MJE A;  5H8Y E;  5MPO A;  1DOY A;  2N0S B;  4NAM A;  4NAW B;  3FIL B;  1C4C A;  5C3J B;  1ROE A;  3NUH B;  3BYY B;  1Y56 A;  1OQR A;  1FD6 A;  1QLB B;  1WSP A;  4YSZ B;  3VR8 B;  5JXV A;  3T3O A;  2JWU A;  3AN1 A;  4L1B A;  4C56 C;  1YNT E;  1VJK A;  5D7G A;  4ARI A;  1VZ6 A;  5HFY A;  1SJE D;  3KWL A;  1RM6 C;  1XCQ L;  1FRD A;  2V3N A;  1CJE A;  2WP9 B;  2M0A A;  3AE2 B;  2PTL A;  1FO4 A;  3AEF B;  2YEP F;  5BYR A;  1JWS D;  3IT6 B;  4A90 A;  3UI3 A;  3HUI A;  2JXT A;  2KAJ A;  2AX5 A;  4PT5 A;  3T3N A;  2Q5W D;  2WU5 B;  2KAC A;  1P7E A;  3C8Y A;  2B76 B;  3KLS X;  4GDL B;  2E6X A;  2AQ3 B;  4L2Y A;  4A9A A;  4HEA 1;  1L6V A;  2MJ3 A;  2W82 A;  3AV8 A;  1TY2 A;  1FM0 D;  3W1S A;  3B9J A;  4EE2 A;  2OED A;  2RMM A;  1J7C A;  1NYR A;  3NVY A;  4MT5 A;  1AWD A;  1ZE3 D;  4WIP A;  3O13 A;  1ZPS A;  4YT0 B;  3IAM 1;  2NTT A;  3VR9 B;  3AM9 A;  1IBX A;  3LYY A;  1BML C;  1VLB A;  4ZHO A;  2KN4 A;  2LJI A;  2DYM A;  3B2F A;  4A55 A;  2TSS A;  1ZXH A;  1I7H A;  1QOG A;  5G5H A;  1RYJ A;  1JRP A;  3P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...