4JE3B

An iml3-chl4 heterodimer links the core centromere to factors required for accurate chromosome segregation
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
SRYSSLVPIEKVGFTLKNEINSRIITIKLKFNGNDIFGGLHELCDKNLINIDKVPGWLAGENGSFSGTIMNGDFQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Central kinetochore subunit IML3
publication title An iml3-chl4 heterodimer links the core centromere to factors required for accurate chromosome segregation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.720 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4je3B00
4JE3B
chains in the Genus database with same CATH superfamily
1VCBA 4II2B 1VZ7A 4RGOS 1SE4A 1Q0WB 5FR3A 2CJNA 2BB6A 2OHFA 4AS1A 3Q8EA 2KN4A 2KD0A 1JALA 2JT4B 3O65B 3LDZE 2KJ6A 4WAAA 1UF0A 2UYZB 3NVVA 3PHWB 2J53A 4EKUA 4NPNA 4M8MA 3ZW3A 4NY0A 2J0MA 1P1AA 2QILA 4W9KA 3ZNHB 4A9AA 1P3QU 2JF5A 1JRUA 2NBWB 1V8CA 1E7VA 3C19A 1BMLC 2RSUA 1ET6A 3SR6A 2Y5CA 4M01A 4MGIE 2IPKD 3MC8A 1T5XD 2LRWA 2O2VA 5IOIA 1PUTA 4AP4C 2BB5A 2JSVX 2QCZA 3DQVA 4RMAA 1Q5WB 3TEXA 1TZ1A 4MGZE 1L2NA 4K81A 1Y56A 1WJ4A 2Z0DB 4ZRPA 2V3NA 1M94A 2BW2A 1QOAA 4OVZA 4MSMB 4MEMA 4A6QA 2J42A 1ACCA 3UGBB 3TIXA 1RWSA 3B9JA 3PPAA 1FFUA 2N7DA 1UWMA 1KOTA 2L0TA 1GUAB 4C4VB 2V3PA 1B9RA 3I5JC 2ZZPB 4F1SA 2DYBA 3B1LX 4IC7B 1TYGB 4HPLB 4XYCA 2JXXA 3QQ8B 3HUIA 2WU5B 2MBEA 4LDTD 5AEKB 2VH2A 4KDIC 1FXAA 4TSSA 4EZLA 1XD3B 2LVQA 3UIPB 3DHGC 2RGFA 1WX8A 4XE0A 5HG2A 1U4AA 1TT5B 3P4RB 1M4VA 4WQOB 1IYFA 4RGMA 4RM9A 4GDLB 1QF6A 4EZKA 2CU1A 1LO5D 5MPOA 2KYWA 1GOZA 1YNTE 3B2FA 2ZCBA 1JWSD 2SEBD 1CZPA 2WXIA 4WIPA 1KF6B 4KKIA 1KLGD 1WJNA 4JQWC 3IHPC 4BKSD 3U30A 3P4PB 4A3PA 4RNAA 5DCNA 3Q3JA 1YIWA 1S1QB 3NVYA 1VD2A 1V9JA 4LJPB 5H92C 4P7IA 3RT3B 1RM6C 2MBQA 2M19A 2W9NA 2TSSA 4MH0E 1R4NB 3ZIMA 2WNMA 4MDKE 2H88B 5TR5A 4C00A 1E8WA 1AN8A 1D5MC 4IWPA 2BYVE 2BGFA 3L17A 4RGTA 2C60A 2JX5A 3ZNID 2V1YA 3IFWB 1IBXB 1NVID 2OEDA 4NQLB 4QAYA 1QOBA 2GOWA 4ZRQA 1YQ4B 2KZRA 3NS1A 1I7HA 3OAWA 2KC2A 1EF5A 3VFKA 2BT6A 3SD5A 2KN5A 1E9MA 5G5GA 3AE2B 2ZW0A 3URYA 3SHQA 3PLVA 2DYMA 2INDC 3N30A 2DZKA 4KSKC 2AWTA 2IO2B 3LB8C 4P6VF 4ZDVA 1IUEA 2D3BA 1V2YA 3KQ4A 3JSVA 3ZGZA 3RNCC 2B3AA 2WP9B 2N9PC 4ZRJA 5BMHA 4DXGA 2NBUA 4FA6A 3VUXA 4K7SA 4MACA 2BF8B 5BMGA 2I1JA 2X8XX 4L1BA 4REZA 3N32A 1E8XA 2VZKD 4NJ7A 1OQYA 1WSPA 4A55A 2V4IB 4BVUC 3ZDMC 1I4PA 4S17A 2G1EA 2BWES 4A3OA 1I4XA 1SIJA 4MJSB 3KUZA 2IO1B 2N9EB 3VR8B 1XO3A 4BBNC 1L4ZB 2J7QB 1I4QA 2JVCA 3Q14C 4KVGB 3W1SC 2YEPB 3ZQ4A 5EE3A 3AN1A 2WXJA 2M56B 3CWIA 2KQSA 1ZE3D 2WLBA 5D7GA 2NMQA 4WQMA 4R3DA 2PIAA 2WQYB 1K8RB 4PT5A 5EDSA 4HJKA 1LGRA 4BOSC 1GC6A 3BWUD 2LJIA 4AJYB 3OWEB 4DHJB 2XK5B 4FBJB 1JWUD 2MSED 3HRDD 3HM3A 3GZNI 3CF6E 3KH0A 5IO9A 2L0FA 1EUVB 1FM0D 2KFJA 5T8IA 4ARCA 3MTNB 2FE8A 4YT0B 2LGDA 2JZ3B 4WWNA 2W3SA 2L00B 1I4RA 1I42A 1KLVA 4LJOB 1NEKB 1N62A 2CS4A 3H1UA 3EHVA 3OG5A 4ACFA 1ZUD2 2ON8A 1C1YB 3RNBC 5H8YE 3T8MA 4D2KA 4IWQA 3VUWA 4ANUA 1PFDA 1XCTL 2KTRA 4IKGA 3VUYA 3BYYB 3A4SC 3AE3B 1SB3C 4DXFA 4MM3B 4FJZA 2NTSA 1OFFA 3BVMA 4N58A 2KDFB 2MP2B 4TKNA 3L16A 1NDDA 1QOFA 1C4CA 1WYWB 4HK2A 4NAMA 4PYZA 4BKSA 3SFEB 3ECIA 3T3NA 2HDEA 2Y5PA 1EO6A 1T0RC 2MX2A 4MH8A 2HTME 4RCOA 2KMCA 3P2BA 2C7MB 4F8CB 2D2QA 4KKJA 3GP7A 4TQ0A 1V5OA 3P1MA 3VTUA 3ZTCA 3PREA 1D6EC 3QIJA 4FHKA 3VAWA 2ZCCA 5AZFA 1WXAA 4AWJA 1GB1A 1FNWA 1L5PA 1K50A 2OJRA 4I6PA 4ZYNA 3FILB 3M95A 1HXYD 2MJEA 2I2YA 2BYEA 2N9LA 1KTKA 3J9CA 3VDZA 3ZJTA 2KX0A 2UU7A 4YL8A 1YD8U 5J2RA 5D94A 1GC7A 2Z59B 3GB1A 2D3GA 2DZMA 1V1PA 3APCA 2O6VB 1YX5B 1J0GA 1LQBA 4UDUC 1OEYJ 2JZPA 3ZDTA 2N0SB 2WX0A 1WJ6A 2M8SA 2INNE 2LVPA 2W3RA 3EA6A 1ZW7A 3KUDB 4MT5A 4LNKA 4A8XC 2MBBB 4W9IA 4YXDB 4BBNF 1DOYA 4B95A 2EELA 1FMAD 1HEZE 3T3OA 1A5RA 3SU8X 2M17A 2IBIB 4FJVB 2ICIA 2KMAA 2NVUI 4OZAA 1N63A 2K9XA 3DHIC 1E8YA 4OZBA 2LXCA 3RPFC 3L54A 3AXCA 4DWFA 3DBSA 4GN1A 2PTLA 3Q3FA 3IT6B 3W1SA 3TSSA 2A5UA 3DDCB 4PS3A 2DZJA 1ZPSA 1Z5SB 2QMTA 2JUOA 1IGCA 1PGXA 2FCQA 1D5XC 1P9DU 2LJ5A 2WXHA 1TBEA 2AYOB 3H7PB 1R4MB 4G3XB 3ZXVA 4J3OD 5I4DA 2N7JA 4YSZB 3GE8C 2L32A 3ZO5B 4JLCA 3NVZA 2G4DB 1XEEA 1I4HA 4ASWC 2JQRB 3U8ZA 2K8HA 1F2RI 2WDVB 2V0GA 2WU2B 3CSFA 5C23A 1RFAA 4YTNB 4HJGE 1JW9D 2MJ3A 2WXQA 4XWWA 1WM2A 1GJZA 1C79A 3ZRCA 1ISNA 2R2QA 5TSSA 5D3IB 4M0WB 2RDHA 1ZP0B 3VXWA 2LGSA 3O13A 1ENFA 1UZXB 3DBHI 3N9YC 3GOEA 2MEKA 5E6NA 3X0WA 4DHZE 1SE3A 1FFVA 3U2SC 2JRIB 1UBQA 5E6PA 1AW7A 5L95C 1KLUD 2M4NA 1CK1A 1KM7A 1SE9A 4LNNA 1FRRA 1HTOA 3D32A 4ICVA 4KGTA 2WXMA 4FULA 1FNUA 4IG7B 3PRMB 4FHJA 4W9JA 3ZXRA 3UQAA 1SJHD 3TEWA 3ENEA 4M02A 3A1QA 1LXDA 1WX9A 1C9FA 1P7EA 1WRIA 2ZNVC 3M3JA 4G11A 3WANA 1D5ZC 4GMVA 4W9DA 3W2DA 1YN5A 4IOIE 2ZVNA 1E6EB 3NZUA 2ZW1A 2WXPA 2O2VB 4BOZB 3DOWA 3QHTA 2QSDA 3MP9A 3HM6X 1PDXA 2IY1B 3EECA 1MVKA 1R7SA 2H89B 2WDTB 4F7ZA 3SDLC 4JGHB 1TKGA 3JW0X 2WXOA 4LNFA 1WY8A 2B76B 1JRPA 2CU3A 2GBRA 5AZGA 3DVNV 3ZYYX 3DVGX 3N1XC 3JYUA 1WGHA 2GLSA 3Q2AC 1LM8B 3AEFB 5CX3A 3QCAA 2AQ3B 2MJDA 2LGIA 1ZDXA 4HCPB 2D3CA 2WXLA 5G5HA 4IWOA 2BWFA 1WMHB 1GPXA 2DBYA 4BKTA 3V60A 2GB1A 4LK0M 1MG8A 2HD5B 2FNJB 4I6NB 2IGHA 4FXCA 5AZHA 4DHJD 2JWZA 1VZ6A 4OVUA 4FADA 3KLSX 3Q3MC 2DHZA 4RFBA 1SIFA 3Q8CA 3QK0A 1XCQL 3N20C 2GRIA 2JRHA 2J0KA 3A9KA 2HJ1A 1TIFA 3MHZA 2JXTA 1P7FA 2I1KA 1NBFC 4JE3B 5CHVC 2RPVA 1SF0A 3IG3A 3NY5A 1CMXB 1ET9A 2K3UA 2WYQA 5EE1A 1FPYA 1T0SC 1YMHE 3VTWA 2DLBA 5IN7A 4TMAB 4WJPA 4WWPA 3HVZA 1RRBA 3BK1A 1DGJA 2EMSA 2INCC 3QAQA 1ZKHA 2FIFA 4XWTA 2FCMA 2KWDA 1N5XA 3BINA 4XC2A 1L4DB 3PV1A 1P0RA 3V61A 1ZGUB 2RR9A 3BY4B 1SE2A 3DBLI 5HHDG 3BVZA 4RF0A 1QZEA 4GDKA 4DBGA 1WM3A 5FK9C 4K3BA 3MJWA 2DWQA 2W55A 2XEWA 2W54A 2VRRB 1MHHE 2W82A 3ZUNA 1RFKA 1YX6B 4XZ4A 3VVWB 2LFIA 2ZPYA 4HEA1 1TS4A 2MRPA 3EC8A 1TKEA 1WFYA 2KFKA 2D07B 1SSNA 1MJDA 2QJLA 3V3XA 1ZXIA 1BXTA 4OW0A 4HCNB 3PO0A 3UI3A 1YN4A 2BS2B 2HE7A 3I63C 4B6WA 2GI9A 4KZCA 1VJKA 3DBHB 2IJ0A 3I3TB 2BKFA 2WXNA 3H9DA 3V05A 2BS3B 3JSVB 3KYCD 1AWDA 4K7UA 4NAWA 2REXA 5BYQA 1E0ZA 2O6VD 2BVCA 4N59A 2HJ8A 2EKIA 3AECB 3DBRI 1EF1A 2PVGC 3KWLA 2Y3AA 1TKYA 2LVOA 3RZWC 2OJWA 2MQJA 1FEHA 2KJRA 3KVFB 1J8CA 1ROEA 5AUKA 2M0XA 2I38A 1QOGA 2KWUB 4OHJA 2LUEA 2D5GA 2GMIC 1T3QA 4DK5A 4KSLC 1I4GA 4P1BC 4E71A 4PYUA 2Y5BB 3IXSA 1J7CA 3EFUA 4JIOU 1UGJA 3AEGB 3RNEC 1HZ6A 2JYTA 3P4QB 2IO3B 1MHXA 2CKHB 2NPTA 4WJOA 2JYEA 3MC9A 4IM0A 4NZLB 2IDYA 2MHJA 5IP4D 1EM7A 5GMVA 3WCQA 4BKGA 4GSWA 2IGGA 3RD2A 1BUIC 2N9KA 1E7PB 4BFRA 2KQ4X 3Q69A 2LHEA 1EU4A 3AEDB 1WXMA 4CHKA 2K25A 5C1ZA 4M00A 3HVDA 3NHEB 4IUMB 1WZ3A 2DX5B 2INPE 1HZ5A 3AE5B 3TEZA 3QC8B 2KKCA 3A9JB 4Q2JA 2FAZA 4N6EB 3HK0A 3PS6A 4TV3A 1F77A 1L7YA 1K51A 1NI2A 3IAM1 4MGYE 4HRSA 4DXAB 4US9A 4ZYSA 4RF1A 2IYDB 2NTTA 1FCLA 3ONSA 2BYFA 1TS3A 1KJTA 3NZ3A 1EWCA 1V80A 3NZSA 3AI5A 1N5WA 2X38A 3TEYA 2AEHA 4AQ7A 1XLPA 1XT9B 4JWUC 4KGRA 2L52A 1WGDA 2LD9A 1C4AA 2KDIA 2KWCA 5GXGB 2BKRB 5IKCM 1C3TA 3AEAB 2CHXA 3AEBB 4YSYB 3P42A 3FC4A 3H8HA 1ESFA 2KMMA 4C7YA 4S0RA 1JWMD 3WALA 4IM3A 2LGXA 2SAKA 4ITKA 5CHWA 3RFZB 4L2YA 2BTEA 2PE9A 1WWTA 3FKYA 1C78A 5CTRC 3C8YA 3AE7B 4XDCA 2MP2A 1UUPA 1HQRD 1S3SG 2N1WA 4JWSC 5EE9A 1SJED 3MJ5A 3DBLB 4JX1C 2GBMA 2RMMA 3VH3B 2C9WB 4G0NB 3R2TA 2LI5A 2K5PA 1XF5L 3DPDA 4HPMB 1SGHA 4ZRKA 4WH4A 3E9SA 2FUHB 1XXGA 2V3SA 5C2TB 4DHZB 2WXFA 4KIKA 1UH6A 4TQ1A 1Q10A 1GAQB 3FILA 1X1MA 1UBIA 1DYQA 5D6JB 5JZEB 3I9V1 3TJPA 2MW5A 3AE8B 4YSXB 2AX5A 3GE3C 2A4ZA 4KX6B 2ZVOA 2O6VA 1E7UA 3WIMA 2L7RA 5JH5C 4BZAA 1IGDA 4CO7A 1QKZA 2L83A 4B0EA 1VR9A 2D10A 2R2OA 4W9HA 3HIZA 3R3MA 4K1RB 5BO4B 2C5LC 3PZ7A 2Q5WD 2LXAA 2ZEQA 3EGRA 4RM8A 4YTMB 2L8JA 3VRAB 2G3QB 3ETRA 2D11A 2LEKA 2RD0A 3AE9B 1D3ZA 2BBCA 2WXKA 3ALBA 1K53A 1F52A 5IAAC 3ZLZA 2K0PA 5LXIB 2MWSB 3Q3OC 2IO0B 4C80A 3WAPA 3DWMA 5FR6A 3ZJUA 1DOIA 4YWGG 5G2NA 2KLCA 4W9EA 3WAOA 2QC8A 3ML8A 1NI3A 2D3AA 2NR2A 3W1YA 1RAXA 1YJ1A 2IZVB 4TUUA 1T0YA 2K6QA 3RCZA 2M0AA 4EUTA 3Q8BA 4L23A 2ZJDA 3B0AA 4FN2A 3GZNB 1QILA 3L08A 3PTFC 4ZOHC 1IPGA 1R4NI 1WXQA 1K52A 4BAXA 3RI7C 2DAFA 1AARA 5CHFA 4PK1A 3QWZB 3PGEA 2ACZB 3W9CB 3KWVA 1PGAA 2KJHB 3C0RB 3PVLA 3QX1A 2JZZA 1V86A 3P4SB 2LHDA 1CQVA 1V81A 2KVZA 2KLGA 4LTUA 1PQSA 2WGSA 1WF9A 4GLSC 4M0WA 3WAMA 2AQ1B 1OEYA 3AULA 2K22A 4LLGM 1SXTA 1UELA 4A90A 1L0VB 2Z8LA 2VH1A 3E56A 2LGYA 2KXJA 1FRDA 2WDRB 1TY2A 3R2IA 3A1QB 2L76A 3ZJVA 2MBOA 3U52E 1IP9A 1HTQA 4EOYA 2PEAA 5JHAA 2KDMA 3EUB2 3NRZA 1FXIA 4KDLB 2WS3B 3ML9A 2GBJA 1UGMA 3B2GA 2G45B 4HXDA 4W9FA 3AE4B 4HDOA 5KHOA 3PLUA 3W5VB 2G9HD 5LXHA 3N1YC 2QHOA 3UINB 4HWIB 1D4BA 4GXBA 3N1ZC 2RDGA 2WXGA 3AU4A 3OJ4B 4URKA 4IM2A 3WA0A 5HKHA 2L3ZA 2N7EA 5EE0A 4JL9A 1TGZB 2LASA 1XLNA 2WDQB 3RUIB 4E74A 2YVCA 3Q8AA 2IGDA 1MFWA 3PRZA 1VZ8A 2K39A 1TS2A 2MBHA 2NCNA 1T0QC 2XN9C 3KW5B 4EZJA 1TJEA 1YOVB 1WI0A 3BIID 1OGWA 1STEA 2E3TA 2WXRA 3RNFC 2PVOD 4WWMA 3TUOA 2KOXA 1ZDVA 2MLBA 3R66C 4EE2A 2RDBC 1C77A 2FBWB 3BYTB 3R7RA 1VLBA 4C4VA 2Z0EB 4HKZE 3PSEB 1H8CA 4NJCA 3A9KB 5DPWA 1NYRA 2J52A 1GG3A 1WH3A 3I57A 4A20A 1GB4A 2KDBA 1QLBB 1WMHA 3DWGC 3NUHB 2HTHA 2JY6A 4LCDE 1TTNA 1OQQA 1J7BA 3SFDB 2KC1A 1SBBB 3UQBA 1EWYC 3EFCA 3NVWA 1B1ZA 3RZFA 4RGNA 1C76A 1E90A 3RNGC 4NQKE 1FXTB 1HA5A 1XLOA 4MSQB 3W5UB 4GDLA 5HI1A 2WX1A 5C3JB 4KV2A 4B9KA 4FLHA 1WX7A 2QIEB 3KYDD 2PPHA 5L83A 1WGRA 2NBVB 3LXFA 4OVVA 1UWXA 4AUQC 1H4RA 4GDKB 3AB5A 2PKOA 2C7HA 2JWUA 3DVGY 1JWAD 3QARA 3PT2B 1VDVA 4M8NA 1F1HA 3RN9C 2KT7A 3GS2A 1KRHA 1MG4A 4HKQA 3AH7A 2MA9B 3TL5A 5BYSA 3CMMB 3A4RA 3HHMA 4C7ZA 2KFKB 1RLFA 1T6BX 2DAJA 4ARIA 5J18A 5LNK1 1V6EA 3OJ3A 2K8CA 3PZDA 1E10A 1EU3A 2BS4B 1TS5A 1N6ZA 2LMCA 5KHQA 3LJ3A 3M63B 4W9GA 3X23A 1JQ4A 4O1NA 2XNAC 2KTFA 1IBXA 2XBBC 3PZ8A 4NAWB 3K9OB 1FNVA 3NJTA 3QJZA 3R8BA 1VRAB 3APDA 2NS5A 2J4XA 1YQ3B 3BK2A 2ZNVB 2KANA 3RULA 3BZDB 3DVNU 1FO4A 4PS8A 3ZNZB 1Z2MA 3VHTC 3SEBA 4NJ6A 2LZ6A 1GNUA 1ZXHA 4WWOA 1CJEA 3B08A 2J0JA 1QT9A 4C56C 1FIQA 2DYOA 3AMZA 4LNIA 4ZHPA 1P98A 1UD7A 2PLPA 3TCAA 3Q3NC 4WAFA 5G55A 2YEPF 3V6EB 2BYTA 2NPTB 5DPSA 2KQ7A 3IT4B 3P63A 4DDID 2CHWA 1A70A 4H2AA 1V1OA 3M62B 1V49A 2QEJC 5JHBA 3NOBA 4MJSA 3ZTDA 2KO3A 3AU5A 2L1AA 2FIDA 4OZCA 3ZNGC 1WGYA 3L0WB 1R4MI 1V5TA 4US8A 4HPPA 4ICUA 1FCCC 3MHSD 1JROA 3RNAC 3UF8A 3Q8FA 2KWVB 4XDDA 2EKEC 4LDTB 1WZ0A 3KUCB 2GBNA 2LRUA 3PRPB 2UWQA 4II3B 4XGAB 3VR9B 1LFDA 2XK5A 1I35A 3U7ZA 2OOBB 3DHHC 4ANXA 2ONQA 2L05A 4WJNA 4K7WA 1MI0A 3NS8A 4CQNA 2FCSA 2JU6X 5HFYA 4GIVA 4I6LB 2KTRB 3A33B 1Q1OA 4HDQA 5DPRA 1QQRA 3R7QA 4JPSA 4FJYA 2KDEB 5DPTA 2RPQA 5E6OA 3ABVB 3A9JA 3ZRFA 2N9XA 4CYEA 1TY0A 2N4FA 2K8BA 4LNOA 2AL3A 2AL6A 1L6VA 1YJIA 2R61A 3V62A 1TZOA 2FCNA 3AEEB 4MELA 4HVBA 4P16A 3U7DA 2DZIA 3FAHA 4MM3A 2MH7A 1MPEA 4HROA 3PHXB 1DOXA 2KHWB 1WR6E 4KGSA 1G6JA 4ZRIA 1JWBD 3U4EG 1ZOYB 2CHZA 3VQIA 1XQQA 2DENB 1YJJA 3CSTA 2EMTA 1KFYB 1L0XB 3NG0A 1PGBA 4AOFA 3AE1B 4ANWA 4W9CA 1PYWD 5AUIA 4DDGD 1WJUA 1UNSA 3RMKC 4KIKB 3V6CB 1V1PB 1N61A 2GBKA 1L0YB 4GU2A 2KVRA 2CR5A 2PMVA 1WE7A 1WXVA 1KH0A 3APFA 5J17A 3LYYA 4K3CA 4HLEA 3N3KB 5D2MB 3L10B 4KZ0A 1F0ZA 1J19A 2K6DB 1E5WA 1HE8A 3VH4B 3Q6BA 1WYGA 2E6XA 4GB9A 3MC0B 2C7NB 4IDIA 1Y8RC 3H6NA 1BT0A 3TBLD 3DBRB 1AYFA 2KACA 3VTVA 3IBEA 3TMPB 5BMIA 3IVFA 1WE6A 2M1MA 3VRBB 1OTRB 1YN3A 2VZKB 2ZPNA 5JXVA 3JVZX 2KAJA 2K1FA 4GOCA 4XX5A 2LUMA 3S2AA 4ZHOA 2YLMA 2PE6B 1RYJA 2BPSA 3K9PB 4N9F4 2DNFA 1XLQA 3OLMD 4RH6A 2PW9A 4ANVA 4WJQA 1SEBD 4USAA 2KK8A 3MFGA 1WR1A 2MCNB 4EEWA 1J7AA 5LLIA 1JCKB 1OQRA 2WWZA 1WIAA 1FD6A 2ASQA 3AV8A 1NYQA 5D3DA 1L6UA 5FKAC 1WGGA 4PS7A 2FUG1 2QDFA 1E8ZA 4EFOA 4GGQA 2AQ2B 2V4LA 2WHIA 2N1VA 4B0MA 4W9LA 2V9HA 2PJHA 3QA8A 1JMLA 1V97A 4WURA 2JPHA 3H7PA 3T9LA 4G50A 4DQOC 2LWPA 4YTPB 4AJWA 3CIRB 3DCGA 4P1CC 4E3CA 3L4PA 1WRDB 2G4SA 1N60A 3H7SA 1YQBA 4MGKE 2BQQA 5BYRA 2CJOA 3ZKJC 4NNJB 1WGKA 3ZVVA 3UIOB 4X57B 2IY0B 3AE6B 1F2RC 1NENB 2KNBA 3BVGA 4J6IA 1F9JA 1WXSA 5E6JA 3L13A 1C4PA 3AM9A 3IAS1 5IA7A 3RYTA 4IW0A 2KX3A
chains in the Genus database with same CATH topology
1BUIC 1VZ7A 4RGOS 1SE4A 2N9KA 2JZPA 1E7PB 2KQ4X 2N0SB 2QIEB 5FR3A 3Q69A 2CJNA 2BB6A 2LHEA 2OHFA 4AS1A 3Q8EA 2INNE 2W3RA 3EA6A 2KN4A 4MT5A 1JALA 3LXFA 1EU4A 1UWXA 3AEDB 4A8XC 4YXDB 1DOYA 3HVDA 4GDKB 3AB5A 2PKOA 2EELA 2JWUA 1FMAD 1JWAD 1VDVA 1HEZE 2INPE 3T3OA 3NVVA 2J53A 1HZ5A 3AE5B 3TEZA 3GS2A 1KRHA 2ICIA 4HKQA 3AH7A 4OZAA 1N63A 5BYSA 2K9XA 4Q2JA 2QILA 4C7ZA 4N6EB 4A9AA 1F77A 3IAM1 1K51A 4OZBA 1T6BX 4ARIA 3RPFC 4HRSA 5LNK1 4US9A 2PTLA 1V8CA 1BMLC 1E10A 4ZYSA 3IT6B 4RF1A 3TSSA 1ET6A 3SR6A 3W1SA 2NTTA 2Y5CA 1FCLA 1EU3A 2BS4B 1TS5A 2IPKD 2LMCA 1TS3A 1ZPSA 1T5XD 3NZ3A 1EWCA 1PUTA 1JQ4A 2BB5A 4O1NA 2XNAC 2JSVX 1N5WA 1IBXA 2X38A 3PZ8A 3TEYA 2QMTA 4NAWB 3TEXA 1FNVA 4AQ7A 1XLPA 4JWUC 1IGCA 4KGRA 1PGXA 1Y56A 2L52A 1C4AA 1D5XC 3R8BA 1VRAB 4ZRPA 5GXGB 2WXHA 2V3NA 2BW2A 1QOAA 5I4DA 4J3OD 4OVZA 2N7JA 3AEAB 3AEBB 2J4XA 4A6QA 1YQ3B 1ACCA 2J42A 2L32A 3BK2A 3FC4A 3P42A 3H8HA 1RWSA 1ESFA 4YSYB 2KMMA 3B9JA 4C7YA 3BZDB 1FFUA 1JWMD 1UWMA 1FO4A 3NVZA 1XEEA 1I4HA 2SAKA 2JQRB 2V3PA 4ITKA 3SEBA 4L2YA 3RFZB 2BTEA 1WWTA 1B9RA 1F2RI 1C78A 2WDVB 3C8YA 1ZXHA 3AE7B 4XDCA 1CJEA 1UUPA 2V0GA 1TYGB 2WU2B 1HQRD 4JWSC 5EE9A 1SJED 3HUIA 2WU5B 3MJ5A 1QT9A 4C56C 4YTNB 1FXAA 1FIQA 4TSSA 2DYOA 3AMZA 4JX1C 4ZHPA 2PLPA 4HJGE 1JW9D 2MJ3A 2WXQA 2RMMA 4XWWA 1C79A 4XE0A 5HG2A 4WAFA 2YEPF 5TSSA 2BYTA 5D3IB 3R2TA 2K5PA 1XF5L 3IT4B 3P63A 3P4RB 1M4VA 2RDHA 1ZP0B 4WH4A 3E9SA 4RGMA 1A70A 4GDLB 3O13A 1QF6A 1ENFA 1XXGA 4H2AA 1V1OA 1LO5D 5C2TB 5MPOA 1GOZA 1YNTE 2WXFA 3N9YC 2QEJC 3B2FA 2MEKA 4TQ1A 1JWSD 1Q10A 2SEBD 1CZPA 2WXIA 4WIPA 1GAQB 1SE3A 1FFVA 3U2SC 3FILA 2L1AA 1DYQA 1KF6B 4OZCA 4KKIA 1AW7A 1KLGD 3I9V1 1KLUD 4US8A 3AE8B 4YSXB 1CK1A 2AX5A 1FRRA 1FCCC 4KGTA 4KX6B 2WXMA 3P4PB 1JROA 3Q8FA 4XDDA 4RNAA 1FNUA 3NVYA 1IGDA 1SJHD 3TEWA 1QKZA 2L83A 4B0EA 1VR9A 5H92C 1C9FA 1P7EA 1RM6C 3VR9B 1WRIA 2M19A 2TSSA 3PZ7A 1D5ZC 3U7ZA 2Q5WD 2WNMA 3W2DA 2ONQA 2H88B 3EGRA 1YN5A 4YTMB 1MI0A 4IOIE 4CQNA 1AN8A 2JU6X 1D5MC 3VRAB 5HFYA 1E6EB 3ETRA 4RGTA 2ZW1A 2LEKA 1QQRA 3AE9B 2WXPA 2JX5A 4JPSA 2BBCA 2WXKA 1IBXB 1NVID 2OEDA 3ABVB 1K53A 2QSDA 3MP9A 1QOBA 1PDXA 4ZRQA 1YQ4B 1MVKA 1R7SA 2K0PA 3NS1A 1I7HA 2H89B 1TY0A 1TKGA 2BT6A 4C80A 1E9MA 3DWMA 1L6VA 1YJIA 2WXOA 5G5GA 3ZJUA 1DOIA 3AE2B 2ZW0A 4YWGG 3URYA 2B76B 1JRPA 2CU3A 2R61A 1TZOA 3ZYYX 2DYMA 3AEEB 1NI3A 4P16A 3FAHA 3AEFB 2AQ3B 2MJDA 2LGIA 2MH7A 3LB8C 1ZDXA 1MPEA 1IUEA 4P6VF 4HROA 2M0AA 2WXLA 5G5HA 3KQ4A 1DOXA 3Q8BA 3ZGZA 4L23A 4KGSA 1JWBD 3U4EG 1ZOYB 2WP9B 3VQIA 1GPXA 2DBYA 5BMHA 4DXGA 2GB1A 4LK0M 1QILA 4MACA 4ZOHC 1YJJA 2IGHA 5BMGA 4FXCA 1KFYB 1VZ6A 1L0XB 1WXQA 4L1BA 1PGBA 4REZA 3KLSX 1K52A 2VZKD 3AE1B 4RFBA 1PYWD 1WSPA 3Q8CA 4A55A 5AUIA 2V4IB 1UNSA 1XCQL 4YSZB 2GRIA 1I4PA 2G1EA 2ACZB 3W9CB 1I4XA 1SIJA 3KWVA 1PGAA 1V1PB 1N61A 3P4SB 2LHDA 3MHZA 1L0YB 3VR8B 2JXTA 1CQVA 1P7FA 1XO3A 1L4ZB 2PMVA 1I4QA 4JE3B 1KH0A 2RPVA 2YEPB 1SF0A 4LTUA 5EE3A 3ZQ4A 3LYYA 1ET9A 2K3UA 3AN1A 5EE1A 2WXJA 1YMHE 2M56B 3CWIA 4GLSC 4M0WA 2DLBA 1F0ZA 2AQ1B 4TMAB 2K22A 1ZE3D 2WLBA 1WYGA 4LLGM 5D7GA 1SXTA 2NMQA 3HVZA 2E6XA 4A90A 4WQMA 3BK1A 1DGJA 1L0VB 4R3DA 2PIAA 2WQYB 2Z8LA 3E56A 4PT5A 3MC0B 4IDIA 1FRDA 2WDRB 4XWTA 2KWDA 1N5XA 1TY2A 1L4DB 3BWUD 2LJIA 3R2IA 1AYFA 2KACA 3OWEB 3ZJVA 3U52E 5BMIA 3VRBB 1YN3A 1SE2A 1JWUD 3HRDD 5HHDG 2VZKB 3BVZA 5JXVA 2KDMA 4RF0A 3EUB2 3NRZA 1FXIA 2WS3B 5FK9C 2KAJA 3B2GA 1FM0D 5T8IA 2DWQA 3AE4B 4ARCA 3W5VB 2FE8A 2G9HD 2W55A 4YT0B 2LUMA 2W54A 1MHHE 2W3SA 2W82A 1D4BA 1I4RA 4ZHOA 1RFKA 2RDGA 1RYJA 2LFIA 4HEA1 1NEKB 2WXGA 1TS4A 1N62A 1XLQA 1ZUD2 1TKEA 2ON8A 2PW9A 1SSNA 4RH6A 5EE0A 1SEBD 2QJLA 4USAA 1XLNA 5H8YE 3V3XA 4D2KA 1ZXIA 1BXTA 2WDQB 3MFGA 4OW0A 3PO0A 3UI3A 1YN4A 3Q8AA 2IGDA 2BS2B 1PFDA 1XCTL 4IKGA 1VZ8A 1J7AA 3BYYB 2GI9A 3AE3B 1SB3C 1TS2A 4DXFA 4MM3B 1VJKA 1JCKB 1OQRA 2NTSA 1OFFA 1FD6A 3AV8A 1NYQA 2IJ0A 2XN9C 3BVMA 5D3DA 2WXNA 4N58A 1L6UA 3V05A 2BS3B 5FKAC 2FUG1 1AWDA 1TJEA 2AQ2B 5BYQA 4B0MA 1E0ZA 3BIID 4N59A 1QOFA 1STEA 1C4CA 2EKIA 3AECB 4NAMA 2PVGC 3KWLA 2E3TA 2WXRA 1JMLA 1V97A 2Y3AA 4WURA 1TKYA 2PVOD 4WWMA 3SFEB 3TUOA 4DQOC 3T3NA 2HDEA 2Y5PA 1ZDVA 1FEHA 4YTPB 4EE2A 1C77A 1ROEA 3CIRB 5AUKA 2FBWB 2I38A 3BYTB 4MH8A 1VLBA 1QOGA 2HTME 4OHJA 4RCOA 2D5GA 1T3QA 3L4PA 4HKZE 4KKJA 3GP7A 4TQ0A 4NJCA 1N60A 3P1MA 1NYRA 1D6EC 2J52A 1I4GA 3I57A 5BYRA 2CJOA 1GB4A 1QLBB 1GB1A 1FNWA 3DWGC 1L5PA 3NUHB 1K50A 1WGKA 3IXSA 1J7CA 1OQQA 1J7BA 3FILB 3SFDB 1UGJA 1SBBB 1HXYD 2MJEA 3AEGB 1HZ6A 3AE6B 2JYTA 3P4QB 2I2YA 1EWYC 1F2RC 1NENB 2N9LA 1KTKA 1MHXA 3J9CA 3BVGA 3ZJTA 3NVWA 1B1ZA 2JYEA 4RGNA 5E6JA 1C76A 1C4PA 3AM9A 4NZLB 1HA5A 2IDYA 1XLOA 3IAS1 3W5UB 3GB1A 1EM7A 5HI1A 1V1PA 3WCQA 2IGGA 4UDUC 5C3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JE3 B; 
#chains in the Genus database with same CATH topology
 1VCB A;  4II2 B;  1VZ7 A;  4RGO S;  1SE4 A;  1Q0W B;  5FR3 A;  2CJN A;  2BB6 A;  2OHF A;  4AS1 A;  3Q8E A;  2KN4 A;  2KD0 A;  1JAL A;  2JT4 B;  3O65 B;  3LDZ E;  2KJ6 A;  4WAA A;  1UF0 A;  2UYZ B;  3NVV A;  3PHW B;  2J53 A;  4EKU A;  4NPN A;  4M8M A;  3ZW3 A;  4NY0 A;  2J0M A;  1P1A A;  2QIL A;  4W9K A;  3ZNH B;  4A9A A;  1P3Q U;  2JF5 A;  1JRU A;  2NBW B;  1V8C A;  1E7V A;  3C19 A;  1BML C;  2RSU A;  1ET6 A;  3SR6 A;  2Y5C A;  4M01 A;  4MGI E;  2IPK D;  3MC8 A;  1T5X D;  2LRW A;  2O2V A;  5IOI A;  1PUT A;  4AP4 C;  2BB5 A;  2JSV X;  2QCZ A;  3DQV A;  4RMA A;  1Q5W B;  3TEX A;  1TZ1 A;  4MGZ E;  1L2N A;  4K81 A;  1Y56 A;  1WJ4 A;  2Z0D B;  4ZRP A;  2V3N A;  1M94 A;  2BW2 A;  1QOA A;  4OVZ A;  4MSM B;  4MEM A;  4A6Q A;  2J42 A;  1ACC A;  3UGB B;  3TIX A;  1RWS A;  3B9J A;  3PPA A;  1FFU A;  2N7D A;  1UWM A;  1KOT A;  2L0T A;  1GUA B;  4C4V B;  2V3P A;  1B9R A;  3I5J C;  2ZZP B;  4F1S A;  2DYB A;  3B1L X;  4IC7 B;  1TYG B;  4HPL B;  4XYC A;  2JXX A;  3QQ8 B;  3HUI A;  2WU5 B;  2MBE A;  4LDT D;  5AEK B;  2VH2 A;  4KDI C;  1FXA A;  4TSS A;  4EZL A;  1XD3 B;  2LVQ A;  3UIP B;  3DHG C;  2RGF A;  1WX8 A;  4XE0 A;  5HG2 A;  1U4A A;  1TT5 B;  3P4R B;  1M4V A;  4WQO B;  1IYF A;  4RGM A;  4RM9 A;  4GDL B;  1QF6 A;  4EZK A;  2CU1 A;  1LO5 D;  5MPO A;  2KYW A;  1GOZ A;  1YNT E;  3B2F A;  2ZCB A;  1JWS D;  2SEB D;  1CZP A;  2WXI A;  4WIP A;  1KF6 B;  4KKI A;  1KLG D;  1WJN A;  4JQW C;  3IHP C;  4BKS D;  3U30 A;  3P4P B;  4A3P A;  4RNA A;  5DCN A;  3Q3J A;  1YIW A;  1S1Q B;  3NVY A;  1VD2 A;  1V9J A;  4LJP B;  5H92 C;  4P7I A;  3RT3 B;  1RM6 C;  2MBQ A;  2M19 A;  2W9N A;  2TSS A;  4MH0 E;  1R4N B;  3ZIM A;  2WNM A;  4MDK E;  2H88 B;  5TR5 A;  4C00 A;  1E8W A;  1AN8 A;  1D5M C;  4IWP A;  2BYV E;  2BGF A;  3L17 A;  4RGT A;  2C60 A;  2JX5 A;  3ZNI D;  2V1Y A;  3IFW B;  1IBX B;  1NVI D;  2OED A;  4NQL B;  4QAY A;  1QOB A;  2GOW A;  4ZRQ A;  1YQ4 B;  2KZR A;  3NS1 A;  1I7H A;  3OAW A;  2KC2 A;  1EF5 A;  3VFK A;  2BT6 A;  3SD5 A;  2KN5 A;  1E9M A;  5G5G A;  3AE2 B;  2ZW0 A;  3URY A;  3SHQ A;  3PLV A;  2DYM A;  2IND C;  3N30 A;  2DZK A;  4KSK C;  2AWT A;  2IO2 B;  3LB8 C;  4P6V F;  4ZDV A;  1IUE A;  2D3B A;  1V2Y A;  3KQ4 A;  3JSV A;  3ZGZ A;  3RNC C;  2B3A A;  2WP9 B;  2N9P C;  4ZRJ A;  5BMH A;  4DXG A;  2NBU A;  4FA6 A;  3VUX A;  4K7S A;  4MAC A;  2BF8 B;  5BMG A;  2I1J A;  2X8X X;  4L1B A;  4REZ A;  3N32 A;  1E8X A;  2VZK D;  4NJ7 A;  1OQY A;  1WSP A;  4A55 A;  2V4I B;  4BVU C;  3ZDM C;  1I4P A;  4S17 A;  2G1E A;  2BWE S;  4A3O A;  1I4X A;  1SIJ A;  4MJS B;  3KUZ A;  2IO1 B;  2N9E B;  3VR8 B;  1XO3 A;  4BBN C;  1L4Z B;  2J7Q B;  1I4Q A;  2JVC A;  3Q14 C;  4KVG B;  3W1S C;  2YEP B;  3ZQ4 A;  5EE3 A;  3AN1 A;  2WXJ A;  2M56 B;  3CWI A;  2KQS A;  1ZE3 D;  2WLB A;  5D7G A;  2NMQ A;  4WQM A;  4R3D A;  2PIA A;  2WQY B;  1K8R B;  4PT5 A;  5EDS A;  4HJK A;  1LGR A;  4BOS C;  1GC6 A;  3BWU D;  2LJI A;  4AJY B;  3OWE B;  4DHJ B;  2XK5 B;  4FBJ B;  1JWU D;  2MSE D;  3HRD D;  3HM3 A;  3GZN I;  3CF6 E;  3KH0 A;  5IO9 A;  2L0F A;  1EUV B;  1FM0 D;  2KFJ A;  5T8I A;  4ARC A;  3MTN B;  2FE8 A;  4YT0 B;  2LGD A;  2JZ3 B;  4WWN A;  2W3S A;  2L00 B;  1I4R A;  1I42 A;  1KLV A;  4LJO B;  1NEK B;  1N62 A;  2CS4 A;  3H1U A;  3EHV A;  3OG5 A;  4ACF A;  1ZUD 2;  2ON8 A;  1C1Y B;  3RNB C;  5H8Y E;  3T8M A;  4D2K A;  4IWQ A;  3VUW A;  4ANU A;  1PFD A;  1XCT L;  2KTR A;  4IKG A;  3VUY A;  3BYY B;  3A4S C;  3AE3 B;  1SB3 C;  4DXF A;  4MM3 B;  4FJZ A;  2NTS A;  1OFF A;  3BVM A;  4N58 A;  2KDF B;  2MP2 B;  4TKN A;  3L16 A;  1NDD A;  1QOF A;  1C4C A;  1WYW B;  4HK2 A;  4NAM A;  4PYZ A;  4BKS A;  3SFE B;  3ECI A;  3T3N A;  2HDE A;  2Y5P A;  1EO6 A;  1T0R C;  2MX2 A;  4MH8 A;  2HTM E;  4RCO A;  2KMC A;  3P2B A;  2C7M B;  4F8C B;  2D2Q A;  4KKJ A;  3GP7 A;  4TQ0 A;  1V5O A;  3P1M A;  3VTU A;  3ZTC A;  3PRE A;  1D6E C;  3QIJ A;  4FHK A;  3VAW A;  2ZCC A;  5AZF A;  1WXA A;  4AWJ A;  1GB1 A;  1FNW A;  1L5P A;  1K50 A;  2OJR A;  4I6P A;  4ZYN A;  3FIL B;  3M95 A;  1HXY D;  2MJE A;  2I2Y A;  2BYE A;  2N9L A;  1KTK A;  3J9C A;  3VDZ A;  3ZJT A;  2KX0 A;  2UU7 A;  4YL8 A;  1YD8 U;  5J2R A;  5D94 A;  1GC7 A;  2Z59 B;  3GB1 A;  2D3G A;  2DZM A;  1V1P A;  3APC A;  2O6V B;  1YX5 B;  1J0G A;  1LQB A;  4UDU C;  1OEY J;  2JZP A;  3ZDT A;  2N0S B;  2WX0 A;  1WJ6 A;  2M8S A;  2INN E;  2LVP A;  2W3R A;  3EA6 A;  1ZW7 A;  3KUD B;  4MT5 A;  4LNK A;  4A8X C;  2MBB B;  4W9I A;  4YXD B;  4BBN F;  1DOY A;  4B95 A;  2EEL A;  1FMA D;  1HEZ E;  3T3O A;  1A5R A;  3SU8 X;  2M17 A;  2IBI B;  4FJV B;  2ICI A;  2KMA A;  2NVU I;  4OZA A;  1N63 A;  2K9X A;  3DHI C;  1E8Y A;  4OZB A;  2LXC A;  3RPF C;  3L54 A;  3AXC A;  4DWF A;  3DBS A;  4GN1 A;  2PTL A;  3Q3F A;  3IT6 B;  3W1S A;  3TSS A;  2A5U A;  3DDC B;  4PS3 A;  2DZJ A;  1ZPS A;  1Z5S B;  2QMT A;  2JUO A;  1IGC A;  1PGX A;  2FCQ A;  1D5X C;  1P9D U;  2LJ5 A;  2WXH A;  1TBE A;  2AYO B;  3H7P B;  1R4M B;  4G3X B;  3ZXV A;  4J3O D;  5I4D A;  2N7J A;  4YSZ B;  3GE8 C;  2L32 A;  3ZO5 B;  4JLC A;  3NVZ A;  2G4D B;  1XEE A;  1I4H A;  4ASW C;  2JQR B;  3U8Z A;  2K8H A;  1F2R I;  2WDV B;  2V0G A;  2WU2 B;  3CSF A;  5C23 A;  1RFA A;  4YTN B;  4HJG E;  1JW9 D;  2MJ3 A;  2WXQ A;  4XWW A;  1WM2 A;  1GJZ A;  1C79 A;  3ZRC A;  1ISN A;  2R2Q A;  5TSS A;  5D3I B;  4M0W B;  2RDH A;  1ZP0 B;  3VXW A;  2LGS A;  3O13 A;  1ENF A;  1UZX B;  3DBH I;  3N9Y C;  3GOE A;  2MEK A;  5E6N A;  3X0W A;  4DHZ E;  1SE3 A;  1FFV A;  3U2S C;  2JRI B;  1UBQ A;  5E6P A;  1AW7 A;  5L95 C;  1KLU D;  2M4N A;  1CK1 A;  1KM7 A;  1SE9 A;  4LNN A;  1FRR A;  1HTO A;  3D32 A;  4ICV A;  4KGT A;  2WXM A;  4FUL A;  1FNU A;  4IG7 B;  3PRM B;  4FHJ A;  4W9J A;  3ZXR A;  3UQA A;  1SJH D;  3TEW A;  3ENE A;  4M02 A;  3A1Q A;  1LXD A;  1WX9 A;  1C9F A;  1P7E A;  1WRI A;  2ZNV C;  3M3J A;  4G11 A;  3WAN A;  1D5Z C;  4GMV A;  4W9D A;  3W2D A;  1YN5 A;  4IOI E;  2ZVN A;  1E6E B;  3NZU A;  2ZW1 A;  2WXP A;  2O2V B;  4BOZ B;  3DOW A;  3QHT A;  2QSD A;  3MP9 A;  3HM6 X;  1PDX A;  2IY1 B;  3EEC A;  1MVK A;  1R7S A;  2H89 B;  2WDT B;  4F7Z A;  3SDL C;  4JGH B;  1TKG A;  3JW0 X;  2WXO A;  4LNF A;  1WY8 A;  2B76 B;  1JRP A;  2CU3 A;  2GBR A;  5AZG A;  3DVN V;  3ZYY X;  3DVG X;  3N1X C;  3JYU A;  1WGH A;  2GLS A;  3Q2A C;  1LM8 B;  3AEF B;  5CX3 A;  3QCA A;  2AQ3 B;  2MJD A;  2LGI A;  1ZDX A;  4HCP B;  2D3C A;  2WXL A;  5G5H A;  4IWO A;  2BWF A;  1WMH B;  1GPX A;  2DBY A;  4BKT A;  3V60 A;  2GB1 A;  4LK0 M;  1MG8 A;  2HD5 B;  2FNJ B;  4I6N B;  2IGH A;  4FXC A;  5AZH A;  4DHJ D;  2JWZ A;  1VZ6 A;  4OVU A;  4FAD A;  3KLS X;  3Q3M C;  2DHZ A;  4RFB A;  1SIF A;  3Q8C A;  3QK0 A;  1XCQ L;  3N20 C;  2GRI A;  2JRH A;  2J0K A;  3A9K A;  2HJ1 A;  1TIF A;  3MHZ A;  2JXT A;  1P7F A;  2I1K A;  1NBF C;  4JE3 B;  5CHV C;  2RPV A;  1SF0 A;  3IG3 A;  3NY5 A;  1CMX B;  1ET9 A;  2K3U A;  2WYQ A;  5EE1 A;  1FPY A;  1T0S C;  1YMH E;  3VTW A;  2DLB A;  5IN7 A;  4TMA B;  4WJP A;  4WWP A;  3HVZ A;  1RRB A;  3BK1 A;  1DGJ A;  2EMS A;  2INC C;  3QAQ A;  1ZKH A;  2FIF A;  4XWT A;  2FCM A;  2KWD A;  1N5X A;  3BIN A;  4XC2 A;  1L4D B;  3PV1 A;  1P0R A;  3V61 A;  1ZGU B;  2RR9 A;  3BY4 B;  1SE2 A;  3DBL I;  5HHD G;  3BVZ A;  4RF0 A;  1QZE A;  4GDK A;  4DBG A;  1WM3 A;  5FK9 C;  4K3B A;  3MJW A;  2DWQ A;  2W55 A;  2XEW A;  2W54 A;  2VRR B;  1MHH E;  2W82 A;  3ZUN A;  1RFK A;  1YX6 B;  4XZ4 A;  3VVW B;  2LFI A;  2ZPY A;  4HEA 1;  1TS4 A;  2MRP A;  3EC8 A;  1TKE A;  1WFY A;  2KFK A;  2D07 B;  1SSN A;  1MJD A;  2QJL A;  3V3X A;  1ZXI A;  1BXT A;  4OW0 A;  4HCN B;  3PO0 A;  3UI3 A;  1YN4 A;  2BS2 B;  2HE7 A;  3I63 C;  4B6W A;  2GI9 A;  4KZC A;  1VJK A;  3DBH B;  2IJ0 A;  3I3T B;  2BKF A;  2WXN A;  3H9D A;  3V05 A;  2BS3 B;  3JSV B;  3KYC D;  1AWD A;  4K7U A;  4NAW A;  2REX A;  5BYQ A;  1E0Z A;  2O6V D;  2BVC A;  4N59 A;  2HJ8 A;  2EKI A;  3AEC B;  3DBR I;  1EF1 A;  2PVG C;  3KWL A;  2Y3A A;  1TKY A;  2LVO A;  3RZW C;  2OJW A;  2MQJ A;  1FEH A;  2KJR A;  3KVF B;  1J8C A;  1ROE A;  5AUK A;  2M0X A;  2I38 A;  1QOG A;  2KWU B;  4OHJ A;  2LUE A;  2D5G A;  2GMI C;  1T3Q A;  4DK5 A;  4KSL C;  1I4G A;  4P1B C;  4E71 A;  4PYU A;  2Y5B B;  3IXS A;  1J7C A;  3EFU A;  4JIO U;  1UGJ A;  3AEG B;  3RNE C;  1HZ6 A;  2JYT A;  3P4Q B;  2IO3 B;  1MHX A;  2CKH B;  2NPT A;  4WJO A;  2JYE A;  3MC9 A;  4IM0 A;  4NZL B;  2IDY A;  2MHJ A;  5IP4 D;  1EM7 A;  5GMV A;  3WCQ A;  4BKG A;  4GSW A;  2IGG A;  3RD2 A;  1BUI C;  2N9K A;  1E7P B;  4BFR A;  2KQ4 X;  3Q69 A;  2LHE A;  1EU4 A;  3AED B;  1WXM A;  4CHK A;  2K25 A;  5C1Z A;  4M00 A;  3HVD A;  3NHE B;  4IUM B;  1WZ3 A;  2DX5 B;  2INP E;  1HZ5 A;  3AE5 B;  3TEZ A;  3QC8 B;  2KKC A;  3A9J B;  4Q2J A;  2FAZ A;  4N6E B;  3HK0 A;  3PS6 A;  4TV3 A;  1F77 A;  1L7Y A;  1K51 A;  1NI2 A;  3IAM 1;  4MGY E;  4HRS A;  4DXA B;  4US9 A;  4ZYS A;  4RF1 A;  2IYD B;  2NTT A;  1FCL A;  3ONS A;  2BYF A;  1TS3 A;  1KJT A;  3NZ3 A;  1EWC A;  1V80 A;  3NZS A;  3AI5 A;  1N5W A;  2X38 A;  3TEY A;  2AEH A;  4AQ7 A;  1XLP A;  1XT9 B;  4JWU C;  4KGR A;  2L52 A;  1WGD A;  2LD9 A;  1C4A A;  2KDI A;  2KWC A;  5GXG B;  2BKR B;  5IKC M;  1C3T A;  3AEA B;  2CHX A;  3AEB B;  4YSY B;  3P42 A;  3FC4 A;  3H8H A;  1ESF A;  2KMM A;  4C7Y A;  4S0R A;  1JWM D;  3WAL A;  4IM3 A;  2LGX A;  2SAK A;  4ITK A;  5CHW A;  3RFZ B;  4L2Y A;  2BTE A;  2PE9 A;  1WWT A;  3FKY A;  1C78 A;  5CTR C;  3C8Y A;  3AE7 B;  4XDC A;  2MP2 A;  1UUP A;  1HQR D;  1S3S G;  2N1W A;  4JWS C;  5EE9 A;  1SJE D;  3MJ5 A;  3DBL B;  4JX1 C;  2GBM A;  2RMM A;  3VH3 B;  2C9W B;  4G0N B;  3R2T A;  2LI5 A;  2K5P A;  1XF5 L;  3DPD A;  4HPM B;  1SGH A;  4ZRK A;  4WH4 A;  3E9S A;  2FUH B;  1XXG A;  2V3S A;  5C2T B;  4DHZ B;  2WXF A;  4KIK A;  1UH6 A;  4TQ1 A;  1Q10 A;  1GAQ B;  3FIL A;  1X1M A;  1UBI A;  1DYQ A;  5D6J B;  5JZE B;  3I9V 1;  3TJP A;  2MW5 A;  3AE8 B;  4YSX B;  2AX5 A;  3GE3 C;  2A4Z A;  4KX6 B;  2ZVO A;  2O6V A;  1E7U A;  3WIM A;  2L7R A;  5JH5 C;  4BZA A;  1IGD A;  4CO7 A;  1QKZ A;  2L83 A;  4B0E A;  1VR9 A;  2D10 A;  2R2O A;  4W9H A;  3HIZ A;  3R3M A;  4K1R B;  5BO4 B;  2C5L C;  3PZ7 A;  2Q5W D;  2LXA A;  2ZEQ A;  3EGR A;  4RM8 A;  4YTM B;  2L8J A;  3VRA B;  2G3Q B;  3ETR A;  2D11 A;  2LEK A;  2RD0 A;  3AE9 B;  1D3Z A;  2BBC A;  2WXK A;  3ALB A;  1K53 A;  1F52 A;  5IAA C;  3ZLZ A;  2K0P A;  5LXI B;  2MWS B;  3Q3O C;  2IO0 B;  4C80 A;  3WAP A;  3DWM A;  5FR6 A;  3ZJU A;  1DOI A;  4YWG G;  5G2N A;  2KLC A;  4W9E A;  3WAO A;  2QC8 A;  3ML8 A;  1NI3 A;  2D3A A;  2NR2 A;  3W1Y A;  1RAX A;  1YJ1 A;  2IZV B;  4TUU A;  1T0Y A;  2K6Q A;  3RCZ A;  2M0A A;  4EUT A;  3Q8B A;  4L23 A;  2ZJD A;  3B0A A;  4FN2 A;  3GZN B;  1QIL A;  3L08 A;  3PTF C;  4ZOH C;  1IPG A;  1R4N I;  1WXQ A;  1K52 A;  4BAX A;  3RI7 C;  2DAF A;  1AAR A;  5CHF A;  4PK1 A;  3QWZ B;  3PGE A;  2ACZ B;  3W9C B;  3KWV A;  1PGA A;  2KJH B;  3C0R B;  3PVL A;  3QX1 A;  2JZZ A;  1V86 A;  3P4S B;  2LHD A;  1CQV A;  1V81 A;  2KVZ A;  2KLG A;  4LTU A;  1PQS A;  2WGS A;  1WF9 A;  4GLS C;  4M0W A;  3WAM A;  2AQ1 B;  1OEY A;  3AUL A;  2K22 A;  4LLG M;  1SXT A;  1UEL A;  4A90 A;  1L0V B;  2Z8L A;  2VH1 A;  3E56 A;  2LGY A;  2KXJ A;  1FRD A;  2WDR B;  1TY2 A;  3R2I A;  3A1Q B;  2L76 A;  3ZJV A;  2MBO A;  3U52 E;  1IP9 A;  1HTQ A;  4EOY A;  2PEA A;  5JHA A;  2KDM A;  3EUB 2;  3NRZ A;  1FXI A;  4KDL B;  2WS3 B;  3ML9 A;  2GBJ A;  1UGM A;  3B2G A;  2G45 B;  4HXD A;  4W9F A;  3AE4 B;  4HDO A;  5KHO A;  3PLU A;  3W5V B;  2G9H D;  5LXH A;  3N1Y C;  2QHO A;  3UIN B;  4HWI B;  1D4B A;  4GXB A;  3N1Z C;  2RDG A;  2WXG A;  3AU4 A;  3OJ4 B;  4URK A;  4IM2 A;  3WA0 A;  5HKH A;  2L3Z A;  2N7E A;  5EE0 A;  4JL9 A;  1TGZ B;  2LAS A;  1XLN A;  2WDQ B;  3RUI B;  4E74 A;  2YVC A;  3Q8A A;  2IGD A;  1MFW A;  3PRZ A;  1VZ8 A;  2K39 A;  1TS2 A;  2MBH A;  2NCN A;  1T0Q C;  2XN9 C;  3KW5 B;  4EZJ A;  1TJE A;  1YOV B;  1WI0 A;  3BII D;  1OGW A;  1STE A;  2E3T A;  2WXR A;  3RNF C;  2PVO D;  4WWM A;  3TUO A;  2KOX A;  1ZDV A;  2MLB A;  3R66 C;  4EE2 A;  2RDB C;  1C77 A;  2FBW B;  3BYT B;  3R7R A;  1VLB A;  4C4V A;  2Z0E B;  4HKZ E;  3PSE B;  1H8C A;  4NJC A;  3A9K B;  5DPW A;  1NYR A;  2J52 A;  1GG3 A;  1WH3 A;  3I57 A;  4A20 A;  1GB4 A;  2KDB A;  1QLB B;  1WMH A;  3DWG C;  3NUH B;  2HTH A;  2JY6 A;  4LCD E;  1TTN A;  1OQQ A;  1J7B A;  3SFD B;  2KC1 A;  1SBB B;  3UQB A;  1EWY C;  3EFC A;  3NVW A;  1B1Z A;  3RZF A;  4RGN A;  1C76 A;  1E90 A;  3RNG C;  4NQK E;  1FXT B;  1HA5 A;  1XLO A;  4MSQ B;  3W5U B;  4GDL A;  5HI1 A;  2WX1 A;  5C3J B;  4KV2 A;  4B9K A;  4FLH A;  1WX7 A;  2QIE B;  3KYD D;  2PPH A;  5L83 A;  1WGR A;  2NBV B;  3LXF A;  4OVV A;  1UWX A;  4AUQ C;  1H4R A;  4GDK B;  3AB5 A;  2PKO A;  2C7H A;  2JWU A;  3DVG Y;  1JWA D;  3QAR A;  3PT2 B;  1VDV A;  4M8N A;  1F1H A;  3RN9 C;  2KT7 A;  3GS2 A;  1KRH A;  1MG4 A;  4HKQ A;  3AH7 A;  2MA9 B;  3TL5 A;  5BYS A;  3CMM B;  3A4R A;  3HHM A;  4C7Z A;  2KFK B;  1RLF A;  1T6B X;  2DAJ A;  4ARI A;  5J18 A;  5LNK 1;  1V6E A;  3OJ3 A;  2K8C A;  3PZD A;  1E10 A;  1EU3 A;  2BS4 B;  1TS5 A;  1N6Z A;  2LMC A;  5KHQ A;  3LJ3 A;  3M63 B;  4W9G A;  3X23 A;  1JQ4 A;  4O1N A;  2XNA C;  2KTF A;  1IBX A;  2XBB C;  3PZ8 A;  4NAW B;  3K9O B;  1FNV A;  3NJT A;  3QJZ A;  3R8B A;  1VRA B;  3APD A;  2NS5 A;  2J4X A;  1YQ3 B;  3BK2 A;  2ZNV B;  2KAN A;  3RUL A;  3BZD B;  3DVN U;  1FO4 A;  4PS8 A;  3ZNZ B;  1Z2M A;  3VHT C;  3SEB A;  4NJ6 A;  2LZ6 A;  1GNU A;  1ZXH A;  4WWO A;  1CJE A;  3B08 A;  2J0J A;  1QT9 A;  4C56 C;  1FIQ A;  2DYO A;  3AMZ A;  4LNI A;  4ZHP A;  1P98 A;  1UD7 A;  2PLP A;  3TCA A;  3Q3N C;  4WAF A;  5G55 A;  2YEP F;  3V6E B;  2BYT A;  2NPT B;  5DPS A;  2KQ7 A;  3IT4 B;  3P63 A;  4DDI D;  2CHW A;  1A70 A;  4H2A A;  1V1O A;  3M62 B;  1V49 A;  2QEJ C;  5JHB A;  3NOB A;  4MJS A;  3ZTD A;  2KO3 A;  3AU5 A;  2L1A A;  2FID A;  4OZC A;  3ZNG C;  1WGY A;  3L0W B;  1R4M I;  1V5T A;  4US8 A;  4HPP A;  4ICU A;  1FCC C;  3MHS D;  1JRO A;  3RNA C;  3UF8 A;  3Q8F A;  2KWV B;  4XDD A;  2EKE C;  4LDT B;  1WZ0 A;  3KUC B;  2GBN A;  2LRU A;  3PRP B;  2UWQ A;  4II3 B;  4XGA B;  3VR9 B;  1LFD A;  2XK5 A;  1I35 A;  3U7Z A;  2OOB B;  3DHH C;  4ANX A;  2ONQ A;  2L05 A;  4WJN A;  4K7W A;  1MI0 A;  3NS8 A;  4CQN A;  2FCS A;  2JU6 X;  5HFY A;  4GIV A;  4I6L B;  2KTR B;  3A33 B;  1Q1O A;  4HDQ A;  5DPR A;  1QQR A;  3R7Q A;  4JPS A;  4FJY A;  2KDE B;  5DPT A;  2RPQ A;  5E6O A;  3ABV B;  3A9J A;  3ZRF A;  2N9X A;  4CYE A;  1TY0 A;  2N4F A;  2K8B A;  4LNO A;  2AL3 A;  2AL6 A;  1L6V A;  1YJI A;  2R61 A;  3V62 A;  1TZO A;  2FCN A;  3AEE B;  4MEL A;  4HVB A;  4P16 A;  3U7D A;  2DZI A;  3FAH A;  4MM3 A;  2MH7 A;  1MPE A;  4HRO A;  3PHX B;  1DOX A;  2KHW B;  1WR6 E;  4KGS A;  1G6J A;  4ZRI A;  1JWB D;  3U4E G;  1ZOY B;  2CHZ A;  3VQI A;  1XQQ A;  2DEN B;  1YJJ A;  3CST A;  2EMT A;  1KFY B;  1L0X B;  3NG0 A;  1PGB A;  4AOF A;  3AE1 B;  4ANW A;  4W9C A;  1PYW D;  5AUI A;  4DDG D;  1WJU A;  1UNS A;  3RMK C;  4KIK B;  3V6C B;  1V1P B;  1N61 A;  2GBK A;  1L0Y B;  4GU2 A;  2KVR A;  2CR5 A;  2PMV A;  1WE7 A;  1WXV A;  1KH0 A;  3APF A;  5J17 A;  3LYY A;  4K3C A;  4HLE A;  3N3K B;  5D2M B;  3L10 B;  4KZ0 A;  1F0Z A;  1J19 A;  2K6D B;  1E5W A;  1HE8 A;  3VH4 B;  3Q6B A;  1WYG A;  2E6X A;  4GB9 A;  3MC0 B;  2C7N B;  4IDI A;  1Y8R C;  3H6N A;  1BT0 A;  3TBL D;  3DBR B;  1AYF A;  2KAC A;  3VTV A;  3IBE A;  3TMP B;  5BMI A;  3IVF A;  1WE6 A;  2M1M A;  3VRB B;  1OTR B;  1YN3 A;  2VZK B;  2ZPN A;  5JXV A;  3JVZ X;  2KAJ A;  2K1F A;  4GOC A;  4XX5 A;  2LUM A;  3S2A A;  4ZHO A;  2YLM A;  2PE6 B;  1RYJ A;  2BPS A;  3K9P B;  4N9F 4;  2DNF A;  1XLQ A;  3OLM D;  4RH6 A;  2PW9 A;  4ANV A;  4WJQ A;  1SEB D;  4USA A;  2KK8 A;  3MFG A;  1WR1 A;  2MCN B;  4EEW A;  1J7A A;  5LLI A;  1JCK B;  1OQR A;  2WWZ A;  1WIA A;  1FD6 A;  2ASQ A;  3AV8 A;  1NYQ A;  5D3D A;  1L6U A;  5FKA C;  1WGG A;  4PS7 A;  2FUG 1;  2QDF A;  1E8Z A;  4EFO A;  4GGQ A;  2AQ2 B;  2V4L A;  2WHI A;  2N1V A;  4B0M A;  4W9L A;  2V9H A;  2PJH A;  3QA8 A;  1JML A;  1V97 A;  4WUR A;  2JPH A;  3H7P A;  3T9L A;  4G50 A;  4DQO C;  2LWP A;  4YTP B;  4AJW A;  3CIR B;  3DCG A;  4P1C C;  4E3C A;  3L4P A;  1WRD B;  2G4S A;  1N60 A;  3H7S A;  1YQB A;  4MGK E;  2BQQ A;  5BYR A;  2CJO A;  3ZKJ C;  4NNJ B;  1WGK A;  3ZVV A;  3UIO B;  4X57 B;  2IY0 B;  3AE6 B;  1F2R C;  1NEN B;  2KNB A;  3BVG A;  4J6I A;  1F9J A;  1WXS A;  5E6J A;  3L13 A;  1C4P A;  3AM9 A;  3IAS 1;  5IA7 A;  3RYT A;  4IW0 A;  2KX3 A; 
#chains in the Genus database with same CATH homology
 1BUI C;  1VZ7 A;  4RGO S;  1SE4 A;  2N9K A;  2JZP A;  1E7P B;  2KQ4 X;  2N0S B;  2QIE B;  5FR3 A;  3Q69 A;  2CJN A;  2BB6 A;  2LHE A;  2OHF A;  4AS1 A;  3Q8E A;  2INN E;  2W3R A;  3EA6 A;  2KN4 A;  4MT5 A;  1JAL A;  3LXF A;  1EU4 A;  1UWX A;  3AED B;  4A8X C;  4YXD B;  1DOY A;  3HVD A;  4GDK B;  3AB5 A;  2PKO A;  2EEL A;  2JWU A;  1FMA D;  1JWA D;  1VDV A;  1HEZ E;  2INP E;  3T3O A;  3NVV A;  2J53 A;  1HZ5 A;  3AE5 B;  3TEZ A;  3GS2 A;  1KRH A;  2ICI A;  4HKQ A;  3AH7 A;  4OZA A;  1N63 A;  5BYS A;  2K9X A;  4Q2J A;  2QIL A;  4C7Z A;  4N6E B;  4A9A A;  1F77 A;  3IAM 1;  1K51 A;  4OZB A;  1T6B X;  4ARI A;  3RPF C;  4HRS A;  5LNK 1;  4US9 A;  2PTL A;  1V8C A;  1BML C;  1E10 A;  4ZYS A;  3IT6 B;  4RF1 A;  3TSS A;  1ET6 A;  3SR6 A;  3W1S A;  2NTT A;  2Y5C A;  1FCL A;  1EU3 A;  2BS4 B;  1TS5 A;  2IPK D;  2LMC A;  1TS3 A;  1ZPS A;  1T5X D;  3NZ3 A;  1EWC A;  1PUT A;  1JQ4 A;  2BB5 A;  4O1N A;  2XNA C;  2JSV X;  1N5W A;  1IBX A;  2X38 A;  3PZ8 A;  3TEY A;  2QMT A;  4NAW B;  3TEX A;  1FNV A;  4AQ7 A;  1XLP A;  4JWU C;  1IGC A;  4KGR A;  1PGX A;  1Y56 A;  2L52 A;  1C4A A;  1D5X C;  3R8B A;  1VRA B;  4ZRP A;  5GXG B;  2WXH A;  2V3N A;  2BW2 A;  1QOA A;  5I4D A;  4J3O D;  4OVZ A;  2N7J A;  3AEA B;  3AEB B;  2J4X A;  4A6Q A;  1YQ3 B;  1ACC A;  2J42 A;  2L32 A;  3BK2 A;  3FC4 A;  3P42 A;  3H8H A;  1RWS A;  1ESF A;  4YSY B;  2KMM A;  3B9J A;  4C7Y A;  3BZD B;  1FFU A;  1JWM D;  1UWM A;  1FO4 A;  3NVZ A;  1XEE A;  1I4H A;  2SAK A;  2JQR B;  2V3P A;  4ITK A;  3SEB A;  4L2Y A;  3RFZ B;  2BTE A;  1WWT A;  1B9R A;  1F2R I;  1C78 A;  2WDV B;  3C8Y A;  1ZXH A;  3AE7 B;  4XDC A;  1CJE A;  1UUP A;  2V0G A;  1TYG B;  2WU2 B;  1HQR D;  4JWS C;  5EE9 A;  1SJE D;  3HUI A;  2WU5 B;  3MJ5 A;  1QT9 A;  4C56 C;  4YTN B;  1FXA A;  1FIQ A;  4TSS A;  2DYO A;  3AMZ A;  4JX1 C;  4ZHP A;  2PLP A;  4HJG E;  1JW9 D;  2MJ3 A;  2WXQ A;  2RMM A;  4XWW A;  1C79 A;  4XE0 A;  5HG2 A;  4WAF A;  2YEP F;  5TSS A;  2BYT A;  5D3I B;  3R2T A;  2K5P A;  1XF5 L;  3IT4 B;  3P63 A;  3P4R B;  1M4V A;  2RDH A;  1ZP0 B;  4WH4 A;  3E9S A;  4RGM A;  1A70 A;  4GDL B;  3O13 A;  1QF6 A;  1ENF A;  1XXG A;  4H2A A;  1V1O A;  1LO5 D;  5C2T B;  5MPO A;  1GOZ A;  1YNT E;  2WXF A;  3N9Y C;  2QEJ C;  3B2F A;  2MEK A;  4TQ1 A;  1JWS D;  1Q10 A;  2SEB D;  1CZP A;  2WXI A;  4WIP A;  1GAQ B;  1SE3 A;  1FFV A;  3U2S C;  3FIL A;  2L1A A;  1DYQ A;  1KF6 B;  4OZC A;  4KKI A;  1AW7 A;  1KLG D;  3I9V 1;  1KLU D;  4US8 A;  3AE8 B;  4YSX B;  1CK1 A;  2AX5 A;  1FRR A;  1FCC C;  4KGT A;  4KX6 B;  2WXM A;  3P4P B;  1JRO A;  3Q8F A;  4XDD A;  4RNA A;  1FNU A;  3NVY A;  1IGD A;  1SJH D;  3TEW A;  1QKZ A;  2L83 A;  4B0E A;  1VR9 A;  5H92 C;  1C9F A;  1P7E A;  1RM6 C;  3VR9 B;  1WRI A;  2M19 A;  2TSS A;  3PZ7 A;  1D5Z C;  3U7Z A;  2Q5W D;  2WNM A;  3W2D A;  2ONQ A;  2H88 B;  3EGR A;  1YN5 A;  4YTM B;  1MI0 A;  4IOI E;  4CQN A;  1AN8 A;  2JU6 X;  1D5M C;  3VRA B;  5HFY A;  1E6E B;  3ETR A;  4RGT A;  2ZW1 A;  2LEK A;  1QQR A;  3AE9 B;  2WXP A;  2JX5 A;  4JPS A;  2BBC A;  2WXK A;  1IBX B;  1NVI D;  2OED A;  3ABV B;  1K53 A;  2QSD A;  3MP9 A;  1QOB A;  1PDX A;  4ZRQ A;  1YQ4 B;  1MVK A;  1R7S A;  2K0P A;  3NS1 A;  1I7H A;  2H89 B;  1TY0 A;  1TKG A;  2BT6 A;  4C80 A;  1E9M A;  3DWM A;  1L6V A;  1YJI A;  2WXO A;  5G5G A;  3ZJU A;  1DOI A;  3AE2 B;  2ZW0 A;  4YWG G;  3URY A;  2B76 B;  1JRP A;  2CU3 A;  2R61 A;  1TZO A;  3ZYY X;  2DYM A;  3AEE B;  1NI3 A;  4P16 A;  3FAH A;  3AEF B;  2AQ3 B;  2MJD A;  2LGI A;  2MH7 A;  3LB8 C;  1ZDX A;  1MPE A;  1IUE A;  4P6V F;  4HRO A;  2M0A A;  2WXL A;  5G5H A;  3KQ4 A;  1DOX A;  3Q8B A;  3ZGZ A;  4L23 A;  4KGS A;  1JWB D;  3U4E G;  1ZOY B;  2WP9 B;  3VQI A;  1GPX A;  2DBY A;  5BMH A;  4DXG A;  2GB1 A;  4LK0 M;  1QIL A;  4MAC A;  4ZOH C;  1YJJ A;  2IGH A;  5BMG A;  4FXC A;  1KFY B;  1VZ6 A;  1L0X B;  1WXQ A;  4L1B A;  1PGB A;  4REZ A;  3KLS X;  1K52 A;  2VZK D;  3AE1 B;  4RFB A;  1PYW D;  1WSP A;  3Q8C A;  4A55 A;  5AUI A;  2V4I B;  1UNS A;  1XCQ L;  4YSZ B;  2GRI A;  1I4P A;  2G1E A;  2ACZ B;  3W9C B;  1I4X A;  1SIJ A;  3KWV A;  1PGA A;  1V1P B;  1N61 A;  3P4S B;  2LHD A;  3MHZ A;  1L0Y B;  3VR8 B;  2JXT A;  1CQV A;  1P7F A;  1XO3 A;  1L4Z B;  2PMV A;  1I4Q A;  4JE3 B;  1KH0 A;  2RPV A;  2YEP B;  1SF0 A;  4LTU A;  5EE3 A;  3ZQ4 A;  3LYY A;  1ET9 A;  2K3U A;  3AN1 A;  5EE1 A;  2WXJ A;  1YMH E;  2M56 B;  3CWI A;  4GLS C;  4M0W A;  2DLB A;  1F0Z A;  2AQ1 B;  4TMA B;  2K22 A;  1ZE3 D;  2WLB A;  1WYG A;  4LLG M;  5D7G A;  1SXT A;  2NMQ A;  3HVZ A;  2E6X A;  4A90 A;  4WQM A;  3BK1 A;  1DGJ A;  1L0V B;  4R3D A;  2PIA A;  2WQY B;  2Z8L A;  3E56 A;  4PT5 A;  3MC0 B;  4IDI A;  1FRD A;  2WDR B;  4XWT A;  2KWD A;  1N5X A;  1TY2 A;  1L4D B;  3BWU D;  2LJI A;  3R2I A;  1AYF A;  2KAC A;  3OWE B;  3ZJV A;  3U52 E;  5BMI A;  3VRB B;  1YN3 A;  1SE2 A;  1JWU D;  3HRD D;  5HHD G;  2VZK B;  3BVZ A;  5JXV A;  2KDM A;  4RF0 A;  3EUB 2;  3NRZ A;  1FXI A;  2WS3 B;  5FK9 C;  2KAJ A;  3B2G A;  1FM0 D;  5T8I A;  2DWQ A;  3AE4 B;  4ARC A;  3W5V B;  2FE8 A;  2G9H D;  2W55 A;  4YT0 B;  2LUM A;  2W54 A;  1MHH E;  2W3S A;  2W82 A;  1D4B A;  1I4R A;  4ZHO A;  1RFK A;  2RDG A;  1RYJ A;  2LFI A;  4HEA 1;  1NEK B;  2WXG A;  1TS4 A;  1N62 A;  1XLQ A;  1ZUD 2;  1TKE A;  2ON8 A;  2PW9 A;  1SSN A;  4RH6 A;  5EE0 A;  1SEB D;  2QJL A;  4USA A;  1XLN A;  5H8Y E;  3V3X A;  4D2K A;  1ZXI A;  1BXT A;  2WDQ B;  3MFG A;  4OW0 A;  3PO0 A;  3UI3 A;  1YN4 A;  3Q8A A;  2IGD A;  2BS2 B;  1PFD A;  1XCT L;  4IKG A;  1VZ8 A;  1J7A A;  3BYY B;  2GI9 A;  3AE3 B;  1SB3 C;  1TS2 A;  4DXF A;  4MM3 B;  1VJK A;  1JCK B;  1OQR A;  2NTS A;  1OFF A;  1FD6 A;  3AV8 A;  1NYQ A;  2IJ0 A;  2XN9 C;  3BVM A;  5D3D A;  2WXN A;  4N58 A;  1L6U A;  3V05 A;  2BS3 B;  5FKA C;  2FUG 1;  1AWD A;  1TJE A;  2AQ2 B;  5BYQ A;  4B0M A;  1E0Z A;  3BII D;  4N59 A;  1QOF A;  1STE A;  1C4C A;  2EKI A;  3AEC B;  4NAM A;  2PVG C;  3KWL A;  2E3T A;  2WXR A;  1JML A;  1V97 A;  2Y3A A;  4WUR A;  1TKY A;  2PVO D;  4WWM A;  3SFE B;  3TUO A;  4DQO C;  3T3N A;  2HDE A;  2Y5P A;  1ZDV A;  1FEH A;  4YTP B;  4EE2 A;  1C77 A;  1ROE A;  3CIR B;  5AUK A;  2FBW B;  2I38 A;  3BYT B;  4MH8 A;  1VLB A;  1QOG A;  2HTM E;  4OHJ A;  4RCO A;  2D5G A;  1T3Q A;  3L4P A;  4HKZ E;  4KKJ A;  3GP7 A;  4TQ0 A;  4NJC A;  1N60 A;  3P1M A;  1NYR A;  1D6E C;  2J52 A;  1I4G A;  3I57 A;  5BYR A;  2CJO A;  1GB4 A;  1QLB B;  1GB1 A;  1FNW A;  3DWG C;  1L5P A;  3NUH B;  1K50 A;  1WGK A;  3IXS A;  1J7C A;  1OQQ A;  1J7B A;  3FIL B;  3SFD B;  1UGJ A;  1SBB B;  1HXY D;  2MJE A;  3AEG B;  1HZ6 A;  3AE6 B;  2JYT A;  3P4Q B;  2I2Y A;  1EWY C;  1F2R C;  1NEN B;  2N9L A;  1KTK A;  1MHX A;  3J9C A;  3BVG A;  3ZJT A;  3NVW A;  1B1Z A;  2JYE A;  4RGN A;  5E6J A;  1C76 A;  1C4P A;  3AM9 A;  4NZL B;  1HA5 A;  2IDY A;  1XLO A;  3IAS 1;  3W5U B;  3GB1 A;  1EM7 A;  5HI1 A;  1V1P A;  3WCQ A;  2IGG A;  4UDU C;  5C3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...