1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23 homolog B
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
2JRIB 2WWZA 3H7SA 3B1LX 3ZVVA 1UGMA 1CMXB 3A4RA 3QCAA 4G50A 4I6PA 2J0KA 4A20A 3PLVA 1WXVA 3ZNZB 4F8CB 2EMTA 3VUWA 2DYBA 4MSMB 2IZVB 4LJPB 4TKNA 4CO7A 2GBNA 4HDOA 5L83A 3Q3JA 3QAQA 4W9HA 2KNBA 4ANUA 2LGXA 4FHJA 3WIMA 2LVOA 3A9KB 2VRRB 3CMMB 1WM3A 3RZFA 3HM3A 2C7HA 1ZGUB 2EKEC 1WXMA 2IY1B 4EZJA 2NBUA 4IM2A 4IW0A 3U7DA 4ANVA 4GDLB 2LJ5A 3L13A 3X23A 1FXTB 1V2YA 4E71A 3NHEB 1L7YA 1WYWB 2LGDA 3C0RB 5D2MB 2AWTA 4KDLB 1G6JA 4W9IA 3T8MA 2LVPA 1UELA 2KMCA 2LGYA 5L95C 2G4SA 1P9DU 1T0YA 4I6LB 3KUZA 3X0WA 5D6JB 3PLUA 2M8SA 2IBIB 1HE8A 3K9OB 2FIFA 2A5UA 2KWUB 3DOWA 3QIJA 2D10A 2K25A 2O6VA 3H7PB 4TV3A 3RT3B 4E3CA 4BOSC 4TQ1A 3ML9A 4HCNB 4MEMA 3PT2B 4BFRA 2N9PC 2GBMA 3AU5A 5J18A 3V61A 1IPGA 4MGKE 3DCGA 1NDDA 2KTFA 4JGHB 4LJOB 3TL5A 3OJ4B 4K7UA 4NNJB 5C23A 1WH3A 4MGIE 4W9JA 1KLVA 5JHAA 3CSFA 3L10B 3KUCB 2I1JA 1IP9A 2KOXA 1OEYJ 2RSUA 1EUVB 4GU2A 2GBRA 2MBHA 2HTHA 3D32A 4EEWA 1WF9A 2Z59B 4WQOB 1E90A 2MBBB 1UZXB 1RLFA 2KJHB 2NS5A 2FCQA 2RPQA 3ONSA 1NI2A 1V49A 2J0MA 2DZIA 5E6OA 3UIPB 5HKHA 3ZW3A 2DENB 4RMAA 2CKHB 4MM3A 2FCSA 2N9EB 2ZNVC 1H8CA 3UF8A 3NY5A 2MBQA 2WX0A 3QARA 1WJUA 2NBWB 3EECA 2ZPYA 3ENEA 3V60A 2KQ7A 2LZ6A 3P2BA 4F1SA 5DCNA 2BKRB 2YVCA 2ZCBA 2CHZA 2DYMA 2IO0B 3SD5A 3VUXA 3SU8X 5LLIA 2FUHB 4FA6A 2G4DB 1J0GA 4JQWC 2NPTA 3QX1A 2LXCA 4PS3A 3V6CB 2RGFA 2J7QB 2KDIA 2PEAA 2LD9A 1AARA 2C7MB 2HJ8A 3DVNU 4IWQA 3RCZA 4GGQA 4IUMB 4AUQC 4EZKA 4MDKE 2IO3B 1SIFA 1SGHA 3B0AA 3TCAA 2MSED 4GDKB 3PS6A 3VVWB 2L0TA 2AEHA 3DBSA 3VQIA 5IA7A 4HCPB 4DBGA 3HHMA 5CX3A 4EOYA 2I1KA 4CYEA 2V3SA 1LFDA 2JZ3B 3ZTDA 1WXSA 3M3JA 2ZNVB 3RULA 3VTWA 1YX6B 3UIOB 2BYVE 3RUIB 3R7RA 4WJOA 2K6DB 2MWSB 4WJNA 4EKUA 1WR6E 3VTUA 2L05A 1GG3A 2DAJA 3A9KA 2L0FA 1E7UA 1UD7A 2L00B 3PREA 3ZKJC 4AWJA 2O6VD 5JHBA 1E8XA 1UBQA 2R2QA 2R2OA 3IFWB 4GIVA 1P3QU 5D94A 4BKTA 3N30A 3A33B 3L0WB 4ANWA 1WR1A 4K1RB 5AEKB 3K9PB 3L08A 3RYTA 3UGBB 1OQYA 4W9LA 3W1YA 2KVRA 4OVUA 1GC7A 2KLCA 2Z0EB 1TGZB 4HXDA 3L16A 1RRBA 1WXAA 2KTRA 3PRMB 2DZMA 2UYZB 3QJZA 4DK5A 4DHJD 2JRHA 4WWOA 4ZRJA 4NQKE 4WJPA 4AJWA 2FNJB 2PJHA 4LDTD 3WANA 1EF1A 4FULA 4FBJB 5C1ZA 2MQJA 4N9F4 1I42A 3ZNGC 2KFKB 4JIOU 3IG3A 2K8CA 4DHZB 5CHFA 1ZW7A 3QQ8B 1IYFA 1GJZA 4GSWA 5E6PA 3UQBA 1M94A 3NS8A 2ZPNA 2KX0A 3PVLA 2FAZA 2Y5BB 1TZ1A 3ZNHB 2HD5B 4ZRKA 1V86A 4HPLB 4HLEA 3DBRI 3V62A 1OGWA 2DHZA 2KQSA 3TBLD 3ZUNA 3OJ3A 2KK8A 1UH6A 3DVGY 1TTNA 1E5WA 4MH0E 4NQLB 2KC1A 2KO3A 1U4AA 3DDCB 1NBFC 5J2RA 4BKGA 1WE6A 1S3SG 3T9LA 2DX5B 4B9KA 4A3OA 4PYUA 4K7SA 4KZ0A 4BBNC 3PHXB 4ICVA 1RFAA 3SDLC 4GDLA 4GMVA 1C3TA 2JZZA 3IVFA 1WRDB 3OLMD 2KWVB 3QHTA 1WE7A 4GOCA 1YX5B 4BVUC 2KXJA 2ZZPB 2N1WA 1WJNA 2XEWA 3PV1A 4XZ4A 2JVCA 3TMPB 2REXA 1PQSA 2BYFA 1XQQA 4KIKB 2MW5A 3JYUA 5IAAC 2PPHA 5EDSA 3M95A 4EUTA 2NCNA 2N7EA 1V6EA 2BWFA 3KYDD 4HK2A 4ZDVA 2ZCCA 5CTRC 1VD2A 5AZGA 3Q3FA 3ECIA 3WAMA 2JXXA 1WGDA 2NBVB 1WJ6A 2KDBA 1LM8B 1KM7A 5LXIB 2K1FA 2IYDB 1E8WA 2CS4A 2OOBB 4ANXA 2MBOA 4NY0A 4DHZE 3EHVA 4K81A 3ZTCA 2LI5A 1TBEA 4FADA 1V81A 3ZIMA 3JSVA 1Z5SB 3WALA 1WZ0A 2KFKA 2M0XA 3A9JB 4FLHA 1QZEA 2KJ6A 2L3ZA 3AU4A 2KX3A 2BF8B 4OVVA 3B08A 3KYCD 3RZWC 4IC7B 3QC8B 5CHVC 3NZSA 4JLCA 4KV2A 4I6NB 2FCMA 2N1VA 3H9DA 3HM6X 3RD2A 4A3PA 3V6EB 1VCBA 3APDA 2CR5A 1K8RB 1GNUA 3SHQA 5DPWA 2C9WB 3KUDB 3M63B 3DVNV 2G45B 4AJYB 2KMAA 4AP4C 3DQVA 3TJPA 4MGZE 3L54A 1LXDA 5BO4B 2AL3A 3ZO5B 2JF5A 2JY6A 4GXBA 2CHXA 5G55A 3ZRCA 3I3TB 2AL6A 2MCNB 2DZJA 5JZEB 3AI5A 1D3ZA 4RM8A 4K7WA 4M8NA 4WWNA 3ZRFA 3NZUA 1OEYA 2KANA 2KDFB 3DVGX 5TR5A 3R66C 2JUOA 1WI0A 4MJSB 4B6WA 3CSTA 4X57B 2KD0A 2LUEA 2KDEB 1F9JA 3ZDMC 4DDID 2DZKA 2G3QB 5DPRA 3PPAA 2EMSA 1WFYA 4KDIC 3KVFB 3MTNB 2MA9B 1XT9B 3AXCA 2MX2A 4IWPA 3GOEA 2KKCA 2Z0DB 2BYEA 3NOBA 4DDGD 3A9JA 3PTFC 3ML8A 2L8JA 4WWPA 1LQBA 1E8ZA 3LJ3A 3ALBA 4FJYA 4FN2A 2C60A 4W9CA 4CHKA 2K8BA 4BOZB 2BKFA 3A1QA 2XK5A 3HIZA 2KN5A 4P7IA 4BBNF 4II3B 4II2B 4TQ0A 1WGGA 1ZKHA 3IBEA 3JW0X 1SE9A 1S1QB 1MG8A 2KWCA 4G3XB 2IO2B 4LDTB 3LDZE 2LASA 1E7VA 3OAWA 1J8CA 1WZ3A 4NAWB 2MLBA 2N4FA 4YL8A 4MELA 1P98A 5LXHA 5GMVA 3M62B 2C7NB 2MP2A 3EC8A 4KVGB 5FR6A 1EF5A 2WDTB 3QWZB 3ZLZA 2BPSA 2UWQA 1Q1OA 3HK0A 1Q5WB 5AZHA 2IY0B 2WYQA 4MGYE 3N32A 3QK0A 4RM9A 4G11A 3ZNID 4EZLA 4F7ZA 5DPSA 2D3GA 5AZFA 1WMHB 4FJVB 2GMIC 3R3MA 4NPNA 2GBKA 1P0RA 4W9FA 4HWIB 3PRPB 2BWES 1ISNA 4ZYNA 4URKA 4FHKA 4PS8A 1Z2MA 4DXAB 1V5OA 4M0WB 1WJ4A 2K6QA 1KJTA 3PSEB 3VH4B 2ASQA 2BGFA 3WA0A 1V5TA 2PE6B 1RAXA 3O65B 3VXWA 2FIDA 4E74A 2NVUI 2L76A 2KFJA 2JWZA 4LCDE 2CU1A 1X1MA 5KHQA 2RR9A 4NJ7A 2LRWA 2KHWB 4ASWC 2MBEA 3DPDA 2D07B 2NR2A 2MRPA 2LWPA 4KIKA 2FCNA 2W9NA 1H4RA 3VH3B 3APCA 1WIAA 1C1YB 3TIXA 3R7QA 3MJWA 3W1SA 3VAWA 1WGYA 4AOFA 2ZVOA 5G2NA 2GOWA 1YD8U 2M4NA 5JH5C 3UINB 4KZCA 4WJQA 2XK5B 3VDZA 1GUAB 3AULA 2O6VB 3H7PA 3GZNI 4JL9A 5E6NA 3APFA 4EFOA 2OJRA 2RD0A 4HJKA 5CHWA 3S2AA 1WGHA 3EFUA 4XC2A 2JPHA 1UBIA 2N7DA 3N3KB 2O2VA 1WMHA 2D2QA 4FJZA 1R4NI 1YIWA 4HDQA 4M8MA 4ZRIA 2LRUA 1L2NA 2IO1B 1Y8RC 1BT0A 2PE9A 1WM2A 3VHTC 4MJSA 2NPTB 2LXAA 1V80A 4J6IA 2K8HA 2AYOB 3A1QB 2MP2B 4ICUA 3VUYA 2A4ZA 1WGRA 3IHPC 5D7GA 1V9JA 1A5RA 1WX7A 3DBLI 3U8ZA 3H6NA 3MHSD 2JT4B 3DBHI 4B95A 2N9XA 3QA8A 3JSVB 1Q0WB 2KZRA 2C5LC 3PHWB 1OTRB 4WAAA 3PGEA 4HVBA 3KH0A 1KOTA 4DHJB 4NJ6A 3WAPA 5J17A 1P1AA 4GDKA 4IWOA 2B3AA 4W9GA 3L17A 4KSLC 1J19A 2DAFA 4IM0A 4IM3A 2LVQA 4GN1A 5DPTA 4W9DA 1WX9A 2K39A 4IG7B 2GBJA 4HPMB 2L7RA 3ZDTA 2HE7A 2D11A 2KJRA 4BKSD 2CHWA 3BY4B 1WX8A 3JVZX 2J0JA 4NAWA 4XX5A 2M17A 1WY8A 1XD3B 2KTRB 3PZDA 2ZJDA 3CF6E 1R4MI 2ZEQA 2V4LA 3UQAA 3KW5B 4PYZA 3BINA 1GC6A 3VTVA 3W1SC 1YJ1A 2KC2A 4TUUA 4W9KA 2O2VB 2DYOA 1EO6A 2QHOA 2V1YA 4PS7A 2KLGA 3VFKA 3H1UA 5KHOA 4DWFA 1I35A 1YQBA 4MSQB 4GB9A 4KSKC 2YLMA 2XBBC 3A4SC 4W9EA 3PRZA 2ZVNA 1JRUA 1E8YA 3U30A 3WAOA 2M1MA 2WX1A 4G0NB 4BKSA
chains in the Genus database with same CATH superfamily
2JRIB 3Q8BA 3ZVVA 1UGMA 5EE9A 3IT6B 1TY0A 2DYBA 1FFVA 2IZVB 3Q8EA 2W3RA 2PW9A 2GBNA 4HDOA 2KNBA 3WIMA 1WM3A 2C7HA 3LB8C 2BS2B 3U7DA 4GDLB 1XLPA 1XLNA 1FXTB 2AQ1B 1GB1A 1DOYA 4KDLB 4JWUC 4HRSA 2KMCA 4KGSA 1MPEA 1T0YA 4I6LB 3KUZA 2J4XA 1HE8A 2B76B 3N1XC 2A5UA 2KWUB 3DOWA 3QIJA 3H7PB 3RT3B 4E3CA 1FNVA 4BFRA 3PT2B 2GBMA 3P4PB 4MGKE 3ETRA 1NDDA 2KTFA 4JGHB 4P6VF 4K7UA 4MGIE 2INNE 3CSFA 3KUCB 4XE0A 2WHIA 3D32A 4EEWA 2Z59B 1E90A 2MBBB 2FCQA 2QDFA 3ONSA 2J0MA 1V49A 1FFUA 4RMAA 2CKHB 3DHGC 1I4XA 3UF8A 1H8CA 2QJLA 2WDRB 1L4ZB 2WX0A 5C2TB 1TT5B 3QARA 3ENEA 3EECA 2ZPYA 3V60A 4P1CC 2LZ6A 2BKRB 1K52A 2ZCBA 2CHZA 2IO0B 3L4PA 3RMKC 1L6UA 4NZLB 1HZ5A 2WNMA 3IAM1 1HZ6A 2HJ8A 3DVNU 1GAQB 4GGQA 3RCZA 3Q69A 4AUQC 4L2YA 4A9AA 2QSDA 3PS6A 3U2SC 5CX3A 3VR8B 2V3SA 2JZ3B 3ZTDA 1WXSA 2ZNVB 3VTWA 3R7RA 4EKUA 2RMMA 1NYQA 4J3OD 4KX6B 1D5MC 4BKTA 3A33B 1F52A 4ANWA 1L5PA 2Z0EB 1ZDVA 1WXAA 1JMLA 3PRMB 2DZMA 2UYZB 3QJZA 4NQKE 4WJPA 2K5PA 4AJWA 2WU5B 4ITKA 2PJHA 4N9F4 1HTQA 2QEJC 4JIOU 4DHZB 1ZW7A 1GJZA 1M94A 2KX0A 5BYRA 4HLEA 1TZ1A 4ZRKA 4HPLB 3DBRI 3AE8B 2DHZA 2KQSA 4RCOA 1D4BA 4JWSC 3FILA 4NJCA 3BYTB 2SEBD 4NQLB 5FR3A 1U4AA 3DDCB 3RFZB 1S3SG 4B9KA 1HA5A 4K7SA 4KZ0A 2WDVB 4ICVA 3SDLC 3RN9C 3IVFA 3OLMD 1K51A 1YX5B 1WJNA 3AM9A 1ZXHA 5EE0A 5IAAC 1QT9A 3DWMA 4HK2A 4N6EB 1MJDA 2IPKD 5AZGA 3Q3FA 2WP9B 1HTOA 3RNAC 2NBVB 2KDBA 1HXYD 4RF0A 1KM7A 2CS4A 2D3CA 2WGSA 1NVID 2YEPB 4K81A 2LI5A 1K50A 3EFCA 4FADA 3JSVA 3WALA 1WZ0A 3A9JB 1BXTA 2KJ6A 2L3ZA 1KRHA 2BF8B 4OVVA 3RZWC 3KYCD 3NZSA 3P4QB 1C77A 2N1VA 4ARIA 3RD2A 1VCBA 2CR5A 3NVYA 2C9WB 3DVNV 4AJYB 1CJEA 3TJPA 4MGZE 2ON8A 1PGXA 2CHXA 5H92C 2DZJA 3AEEB 3AI5A 2JX5A 2L52A 1YN5A 1VZ7A 2PMVA 1N60A 3N1YC 1FPYA 3DVGX 2JUOA 3P1MA 3CSTA 3ZYYX 2KDEB 4DDID 4LLGM 3CWIA 4KDIC 1NYRA 2K0PA 1R4NB 3GOEA 3NOBA 1D6EC 2L8JA 3AE2B 4C00A 3HIZA 3WCQA 2R61A 2KN5A 2NTTA 2L83A 1MG8A 3LDZE 4C56C 4AQ7A 2LHDA 4YTNB 2H89B 2C7NB 5FR6A 1YMHE 2QMTA 4KVGB 1EF5A 1F2RI 1RFKA 2BPSA 1OQRA 1UUPA 3HK0A 5AZHA 2QCZA 3QK0A 4FJVB 2GMIC 4YSXB 4URKA 4PS8A 3T3NA 1WJ4A 1KJTA 1WSPA 1V1PA 2BGFA 2G1EA 2NVUI 1VZ6A 3MFGA 5IP4D 3APCA 1WIAA 3R7QA 3MJWA 1YNTE 4FXCA 1WGYA 2DLBA 4AOFA 2M4NA 2Y5PA 1GB4A 3VDZA 1CK1A 3H7PA 4JL9A 3AE6B 1YJJA 4GLSC 5CHWA 2BBCA 2JPHA 1UBIA 4HPPA 1WMHA 2D2QA 1R4NI 4HDQA 2V9HA 1QQRA 1L2NA 2IO1B 2PE9A 2NPTB 1QF6A 1V80A 2MP2B 4O1NA 2JYTA 1FIQA 2KQ4X 2Y5CA 3MHSD 3DBHI 1UWMA 3CIRB 3U4EG 3JSVB 1FO4A 3PHWB 1KOTA 4DHJB 1QOFA 3TEZA 4IWOA 1J19A 2IDYA 4OZCA 4N59A 4W9DA 2K39A 4HPMB 2HE7A 2D11A 2WXMA 1WX8A 2M17A 3AEBB 3UQAA 2D5GA 3VTVA 2BS4B 2ZW0A 2O2VB 4W9KA 2V1YA 1EO6A 2QHOA 1I35A 3VFKA 3H1UA 5KHOA 2FE8A 1JWMD 2XBBC 1R4MB 1SE3A 3NVZA 1JRUA 4M02A 4BKSA 3H7SA 1UGJA 3PLVA 4IKGA 3ZNZB 4F8CB 2X38A 1KLUD 1J7BA 4LJPB 4CO7A 3Q3JA 3QAQA 2VRRB 3CMMB 3NRZA 5GXGB 3HM3A 3RNEC 2EKEC 2IY1B 3AECB 2RDGA 4IM2A 4IW0A 4ANVA 1E7PB 4C7YA 1V2YA 1D5ZC 3NHEB 4E71A 1WYWB 5D2MB 2AWTA 1EU3A 3FILB 3P4RB 2LMCA 3IT4B 5L95C 3KLSX 2VZKB 4MH8A 1P9DU 2V3NA 3E9SA 2M8SA 2IBIB 1QILA 4TV3A 4LNKA 4MEMA 3AU5A 3DCGA 4LJOB 3OJ4B 1WH3A 1KLVA 2LGIA 3L10B 2WS3B 4LK0M 1IP9A 2RSUA 1BUIC 1OEYJ 2GBRA 4A55A 2HTHA 2WXFA 5G5GA 4WQOB 2NS5A 1AW7A 2GI9A 3AEGB 4OW0A 2DZIA 3UIPB 5HKHA 1YQ4B 2FCSA 2ZNVC 1VLBA 1JCKB 3BVGA 4KKJA 4D2KA 2KAJA 2MH7A 1L0VB 3VUXA 5H8YE 2L32A 3SU8X 5LLIA 2FUHB 4FA6A 4ZOHC 2NPTA 2Q5WD 2BT6A 4RGOS 4PS3A 4DXGA 4C7ZA 3BWUD 2G9HD 4EZKA 4MACA 2ZW1A 3AV8A 4MDKE 2W3SA 3AE7B 4K3BA 3HHMA 4EE2A 2I1KA 4CYEA 1IBXB 1YX6B 3RUIB 2E6XA 1KTKA 1WGKA 1WR6E 3NJTA 2L05A 1GG3A 3Q14C 1E10A 3A9KA 2L0FA 1E7UA 1UD7A 4AWJA 1F0ZA 1UBQA 4YXDB 1A70A 3AEFB 1P3QU 1C4AA 3SFEB 3K9PB 4W9LA 4QAYA 3W1YA 2KVRA 4HXDA 1RRBA 2JU6X 1EM7A 1OQQA 4DHJD 4WWOA 4ZRJA 1MFWA 2GRIA 4LDTD 4FBJB 1I4RA 3R2IA 3IG3A 1NENB 1IYFA 5E6PA 2K9XA 3UQBA 3OWEB 2FAZA 3ZNHB 1ACCA 3MC8A 1OGWA 3ZUNA 1C79A 3ZJUA 1MHHE 3V05A 3W5VB 1UH6A 4MH0E 4ZYSA 1SEBD 2J52A 4BKGA 1WE6A 1MVKA 3T9LA 2JZPA 2KN4A 4A6QA 4GDLA 4GMVA 2PTLA 3QHTA 4BVUC 2KXJA 2XEWA 4XZ4A 2JVCA 3GB1A 2BYFA 3UI3A 1TIFA 4KIKB 3SR6A 1T0SC 3JYUA 4YTMB 2NCNA 1CZPA 4KGRA 2BWFA 4ZDVA 1VD2A 4XWWA 3WAMA 1E6EB 1WGDA 3PZ8A 2HDEA 2WXQA 1LM8B 5LXIB 2IYDB 1I4QA 1YN3A 4DHZE 2OEDA 3ZTCA 1C76A 1NEKB 1FCLA 2JYEA 4WWMA 2KX3A 3QC8B 5CHVC 3HM6X 2ACZB 3APDA 1K8RB 1DOXA 1KLGD 4WAFA 1GNUA 2JWUA 2H88B 3BYYB 2KMAA 2N9KA 3L54A 4S17A 1LXDA 2M56B 5BO4B 2JF5A 2VH2A 2WDQB 4B0MA 2AL6A 4UDUC 1SBBB 4M8NA 4WWNA 1XCTL 4MJSB 4X57B 1ROEA 2EMSA 1F1HA 1XEEA 1PYWD 3MTNB 2MA9B 1XT9B 1ET6A 2MX2A 4IWPA 4NAMA 2KKCA 4LNIA 2BYEA 3A9JA 3ML8A 2N0SB 1I4HA 3AE9B 5AUKA 1QKZA 2BKFA 1SF0A 1VJKA 2CU3A 1TKYA 5JXVA 2DNFA 2WXRA 3JW0X 1S1QB 1JQ4A 2OJWA 1E7VA 4JPSA 2Y3AA 4YL8A 1P98A 3HUIA 3ZLZA 3MP9A 2IY0B 3AE5B 3N32A 3ZNID 4RM9A 1QLBB 4F7ZA 2D3GA 1SE2A 1FMAD 1MG4A 4W9FA 1UNSA 4HWIB 4ZYNA 3SFDB 4FHKA 1Z2MA 2K6QA 2JXTA 1JALA 3RPFC 1MHXA 2PE6B 2KFJA 4LCDE 1X1MA 2QIEB 2RR9A 4NJ7A 2LRWA 1E9MA 5HI1A 2LWPA 1XLQA 5E6JA 3VH3B 4WQMA 3TIXA 3AE3B 1KF6B 3VAWA 5G2NA 3RI7C 2ONQA 3UINB 3ABVB 2WXOA 4WJQA 2O6VB 3GZNI 4OZAA 1JWSD 3IXSA 3GE3C 4HJKA 2N7DA 3N3KB 2O2VA 4M8MA 4OHJA 2LRUA 2MEKA 3SEBA 3VHTC 1T6BX 1F77A 2K8HA 2A4ZA 3PZ7A 3IHPC 5BMIA 1V9JA 3U8ZA 2WU2B 2KZRA 2C5LC 1OTRB 3PGEA 4HVBA 5LNK1 5J17A 2B3AA 3L17A 4IM0A 5FKAC 4GN1A 3HVDA 1P7FA 3E56A 5BYQA 4BKSD 2J0JA 2ZJDA 3AB5A 2V4LA 3W2DA 3KW5B 4PYZA 1N6ZA 2KC2A 5D3DA 1FNUA 3C8YA 2ZVNA 1E8YA 3U30A 4L1BA 2WX1A 2QC8A 1TS4A 3A4RA 3QCAA 3NVVA 2J0KA 3I63C 5BYSA 4HKQA 3VUWA 2LGSA 3AN1A 2XN9C 1J7AA 2BQQA 3N20C 5L83A 4ANUA 4FHJA 4JE3B 2LVOA 3A9KB 1XCQL 1ZGUB 5EE1A 1T5XD 1WXMA 4EZJA 3L13A 3X23A 2SAKA 1L7YA 3R2TA 3O13A 1G6JA 1D5XC 4W9IA 3T8MA 4KKIA 2DBYA 1XO3A 2G4SA 1V1OA 5D6JB 3PLUA 2WXPA 3NVWA 2FIFA 2D10A 2IGHA 4BOSC 4TQ1A 1SB3C 4HCNB 3V61A 3TL5A 1OFFA 2AQ2B 1UWXA 1YJIA 3I57A 4NNJB 1JWUD 1FNWA 2I1JA 1ZP0B 1EUVB 2MBHA 2KWDA 3W9CB 1WF9A 4LNOA 1UZXB 2RPQA 4PT5A 4US8A 4USAA 4RFBA 5E6OA 3I5JC 3ZW3A 3C19A 4YSZB 1SIJA 3LYYA 4YTPB 2KYWA 3BK1A 5IN7A 2NBWB 4KGTA 3VRAB 2WXGA 3B9JA 3P2BA 4F1SA 3SD5A 2DYMA 2LFIA 2G4DB 1WXQA 2JQRB 1J0GA 4JQWC 3TSSA 3NS1A 2PKOA 3VRBB 2V0GA 2EKIA 2J7QB 2LD9A 1AARA 1GOZA 2C7MB 3Q8FA 4IWQA 2HJ1A 2BYTA 3Q8CA 3B0AA 1SGHA 4ZHOA 2MSED 4GDKB 3VVWB 2TSSA 3DBSA 4DBGA 4EOYA 1VRAB 1LFDA 2WXLA 3RULA 2BYVE 4REZA 4WJOA 2MWSB 5MPOA 4WJNA 3PREA 3ZJVA 4RGNA 2L00B 3ZKJC 4TMAB 1TKGA 5JHBA 2R2QA 1R7SA 2R2OA 3IFWB 4XWTA 4GIVA 5D94A 3GP7A 3P4SB 3L0WB 3AEDB 1SE4A 1WR1A 4K1RB 5AEKB 3L08A 4HROA 3UGBB 4A90A 4MT5A 3I9V1 2WLBA 1IGCA 2KTRA 4DK5A 1PGBA 3WANA 1EF1A 4FULA 2CJNA 2PVGC 3ZNGC 4IDIA 5CHFA 3QQ8B 4GSWA 1TY2A 3NS8A 3PVLA 2Y5BB 4M0WA 1V86A 3V62A 4LNFA 3TBLD 3U7ZA 1TS2A 3KWVA 1ZE3D 3N9YC 1NI3A 3DVGY 1TTNA 1E5WA 4HJGE 2KC1A 3Q3OC 3DBRB 2HTME 4PYUA 1C78A 3KWLA 4YSYB 3RNBC 3BVZA 1C9FA 1JROA 1WRDB 5HFYA 4GOCA 2ZZPB 2AX5A 1DOIA 2REXA 1PQSA 2MW5A 1FXAA 2PPHA 1T3QA 3M95A 4EUTA 2K22A 1V6EA 2N7EA 5CTRC 3TUOA 2L1AA 3DBHB 1WJ6A 3BZDB 2W55A 2K1FA 1E8WA 5D3IB 2AQ3B 4ANXA 4NY0A 2WXKA 3EHVA 1J7CA 1Z5SB 2RDHA 3PO0A 2KFKA 1I4GA 1QZEA 2GLSA 3AU4A 1M4VA 3B08A 5TSSA 4OZBA 4JLCA 4KV2A 2FCMA 3W5UB 3V6EB 4RH6A 3SHQA 5DPWA 4BAXA 3DQVA 3ZO5B 2JY6A 1L0XB 1GPXA 4GXBA 3ZRCA 3I3TB 2MCNB 5JZEB 1ESFA 4K7WA 1IBXA 3RNFC 3ZRFA 1SSNA 3NZUA 1OEYA 5IO9A 1WI0A 3ZDMC 2KD0A 2LUEA 1F9JA 1FRRA 2G3QB 5DPRA 2K3UA 1VR9A 3KVFB 1KFYB 1BMLC 1IUEA 1ET9A 1FEHA 1I7HA 3PTFC 4WIPA 4WURA 4WWPA 3ALBA 1C4CA 4FN2A 2C60A 2K8BA 4BOZB 2XK5A 4P7IA 4II3B 4II2B 2M19A 4TQ0A 1WGGA 4AS1A 3IBEA 1EWCA 1SE9A 4G3XB 1N63A 2BS3B 2LASA 1WZ3A 1QOAA 4ARCA 2MLBA 4MELA 3EC8A 1JWBD 1Q5WB 3ZQ4A 2W54A 4MGYE 4EZLA 1JWAD 1L4DB 2MJ3A 3H8HA 3ZXRA 4NPNA 5I4DA 2N9LA 1DYQA 1ISNA 2NMQA 4DXAB 4M0WB 3PSEB 3VH4B 2ASQA 3WA0A 1V5TA 1RAXA 1EU4A 3VXWA 4E74A 2INDC 2L76A 3MHZA 2JWZA 2CU1A 5KHQA 2KDMA 2UU7A 2KHWB 1Y56A 4ASWC 2D07B 2NR2A 2WXNA 4KIKA 2FCNA 2W9NA 1H4RA 2WXJA 3W1SA 2ZVOA 1MI0A 2GOWA 1TS3A 1F2RC 4KZCA 1ZOYB 5HG2A 3AE4B 2D3AA 4XC2A 1N61A 4ZRIA 4FJZA 3P63A 1P7EA 1BT0A 1E0ZA 3A1QB 3HVZA 1AYFA 1A5RA 4B95A 2N9XA 3QA8A 2KMMA 4NJ6A 1P1AA 2BVCA 3AMZA 4KSLC 2I2YA 4IM3A 5DPTA 1XLOA 4R3DA 1RWSA 3ZJTA 1WX9A 3N1ZC 1TYGB 4C4VA 1QOBA 4RGTA 2GBJA 4H2AA 3BY4B 4XX5A 5IKCM 2RDBC 1WY8A 3PZDA 3CF6E 3Q2AC 1R4MI 2BW2A 1FD6A 3B2GA 1VDVA 3BINA 3W1SC 2PLPA 4TUUA 4PS7A 4WH4A 4DWFA 4RF1A 1YQBA 2GB1A 4KSKC 1L6VA 2YLMA 4S0RA 3PRZA 4RGMA 3WAOA 3X0WA 3AEAB 2VZKD 2WWZA 4Q2JA 1PGAA 3B1LX 1CMXB 3OG5A 3RNCC 4G50A 4I6PA 4A20A 4XDDA 1WXVA 2EMTA 4MSMB 4TKNA 1V1PB 2IGGA 1AN8A 4W9HA 2XNAC 2LGXA 3MC9A 3RZFA 4LNNA 1WWTA 1FCCC 1ZDXA 2NBUA 3BVMA 2LJ5A 3HRDD 2LGDA 3C0RB 1N62A 2LVPA 1UELA 1SJHD 2LGYA 2JSVX 2MHJA 3K9OB 1ZXIA 2K25A 2O6VA 2YEPF 4C4VB 3ML9A 2N9PC 5J18A 1IPGA 4HKZE 4JX1C 2J42A 5C23A 2IJ0A 3MC0B 4W9JA 5JHAA 1XF5L 4P16A 3U52E 3Q3NC 2KOXA 4GU2A 2INCC 1ENFA 4P1BC 1PDXA 2ICIA 1RLFA 2KJHB 1EWYC 1NI2A 1B9RA 2DENB 3RNGC 1T0RC 3Q6BA 4LTUA 4MM3A 4XYCA 2N9EB 3TEYA 2FBWB 3NY5A 2EELA 2MBQA 1WJUA 1PFDA 2KQ7A 2E3TA 5DCNA 2YVCA 1UF0A 3J9CA 3FAHA 3KQ4A 2KT7A 3QX1A 2LXCA 2DWQA 1TJEA 3V6CB 2RGFA 2KDIA 2PEAA 1VZ8A 1TS5A 4IUMB 2IO3B 2LHEA 1SIFA 5HHDG 3TCAA 2LJIA 1RM6C 2L0TA 2AEHA 3VQIA 5IA7A 4HCPB 1SJED 5FK9C 3M3JA 2KACA 3NZ3A 3UIOB 4XDCA 2K6DB 1QOGA 3VTUA 4M01A 2DAJA 3Q3MC 3GE8C 4RNAA 1ZPSA 2O6VD 1IGDA 1E8XA 1FM0D 1SXTA 3N30A 5IOIA 1YN4A 2WQYB 5T8IA 3EUB2 3RYTA 1OQYA 2OHFA 4OVUA 1GC7A 2KLCA 1TGZB 3L16A 4XGAB 1Q10A 2JRHA 4ZRQA 2FNJB 3DWGC 2X8XX 1I42A 5C1ZA 2MQJA 2KFKB 2K8CA 3B2FA 2ZPNA 2HD5B 2MJEA 3BIID 2NTSA 1TKEA 3OJ3A 2KK8A 2FUG1 2KO3A 2LUMA 1K53A 1NBFC 5J2RA 3ZXVA 2DX5B 4TSSA 4A3OA 4BBNC 3NG0A 4ZRPA 3PHXB 3TEXA 1RFAA 1V97A 2CJOA 1C3TA 2JZZA 1DGJA 5BMHA 2KWVB 1WE7A 2N1WA 3PV1A 4MM3B 3TMPB 2BTEA 1YQ3B 2Z8LA 1XQQA 5BMGA 3R8BA 5EDSA 4A8XC 1YOVB 3KYDD 2M0AA 2ZCCA 1T0QC 3ECIA 2JXXA 1C4PA 2QILA 2OOBB 2MBOA 1TBEA 1RYJA 1V81A 3ZIMA 5AUIA 2M0XA 2WXIA 1JRPA 4FLHA 3FC4A 4IC7B 3LXFA 3DHHC 4I6NB 3H9DA 4IOIE 4ZHPA 4A3PA 4M00A 3KUDB 2J53A 3M63B 2G45B 4AP4C 2WXHA 3EA6A 2AL3A 2RPVA 4C80A 5G55A 3Q8AA 1D3ZA 4RM8A 2KANA 2KDFB 5C3JB 5TR5A 1WYGA 3R66C 1N5WA 4B6WA 2VH1A 1V8CA 3NUHB 2DZKA 3PPAA 1WFYA 1LGRA 1CQVA 3AXCA 4N58A 2Z0DB 2BB6A 1WRIA 4DDGD 3AH7A 3ZGZA 1LQBA 1E8ZA 3LJ3A 4FJYA 1XXGA 4W9CA 4CHKA 1N5XA 3A1QA 2V4IB 3URYA 4BBNF 1ZKHA 3DHIC 1HQRD 4B0EA 4OVZA 2KWCA 2IO2B 4LDTB 1L0YB 1J8CA 3OAWA 4NAWB 2N4FA 2V3PA 5LXHA 5GMVA 3M62B 2MP2A 2WDTB 3QWZB 2UWQA 1Q1OA 2WYQA 4G11A 1AWDA 5DPSA 1I4PA 2I38A 5AZFA 1WMHB 3R3MA 2GBKA 1P0RA 1LO5D 2MJDA 3AE1B 1JW9D 1KH0A 3FKYA 3GZNB 3PRPB 2BWES 4DXFA 1V5OA 5EE3A 1FXIA 3O65B 2FIDA 4YWGG 2PVOD 2D3BA 3DBLB 2MBEA 3DPDA 2IGDA 2MRPA 2BB5A 4DQOC 1C1YB 2PIAA 3EGRA 2LEKA 4BZAA 1YD8U 5G5HA 5JH5C 1HEZE 2XK5B 1GUAB 3AULA 1PUTA 5E6NA 3APFA 3V3XA 4EFOA 2OJRA 2RD0A 3S2AA 1WGHA 3EFUA 4HEA1 1YIWA 1Y8RC 1WM2A 4K3CA 4MJSA 1TZOA 2LXAA 4J6IA 4YT0B 2AYOB 4ICUA 4L23A 3VUYA 1WGRA 3VR9B 5D7GA 1WX7A 3DBLI 3H6NA 2JT4B 4PK1A 3P42A 1Q0WB 2W82A 4WAAA 3KH0A 3WAPA 4GDKA 3GS2A 4W9GA 4CQNA 1ZUD2 3IAS1 2DAFA 2LVQA 3MJ5A 4IG7B 1B1ZA 2L7RA 2N7JA 3ZDTA 2KJRA 2CHWA 4NAWA 3JVZX 1XD3B 2KTRB 4US9A 1STEA 3TEWA 2ZEQA 4ACFA 1GC6A 1YJ1A 2KVZA 3BK2A 2DYOA 2KLGA 3T3OA 1FRDA 4MSQB 4GB9A 3A4SC 4W9EA 2M1MA 4G0NB 2INPE
chains in the Genus database with same CATH topology
2JRIB 2WWZA 3H7SA 3B1LX 3ZVVA 1UGMA 1CMXB 3A4RA 3QCAA 4G50A 4I6PA 2J0KA 4A20A 3PLVA 1WXVA 3ZNZB 4F8CB 2EMTA 3VUWA 2DYBA 4MSMB 2IZVB 4LJPB 4TKNA 4CO7A 2GBNA 4HDOA 5L83A 3Q3JA 3QAQA 4W9HA 2KNBA 4ANUA 2LGXA 4FHJA 3WIMA 2LVOA 3A9KB 2VRRB 3CMMB 1WM3A 3RZFA 3HM3A 2C7HA 1ZGUB 2EKEC 1WXMA 2IY1B 4EZJA 2NBUA 4IM2A 4IW0A 3U7DA 4ANVA 4GDLB 2LJ5A 3L13A 3X23A 1FXTB 1V2YA 4E71A 3NHEB 1L7YA 1WYWB 2LGDA 3C0RB 5D2MB 2AWTA 4KDLB 1G6JA 4W9IA 3T8MA 2LVPA 1UELA 2KMCA 2LGYA 5L95C 2G4SA 1P9DU 1T0YA 4I6LB 3KUZA 3X0WA 5D6JB 3PLUA 2M8SA 2IBIB 1HE8A 3K9OB 2FIFA 2A5UA 2KWUB 3DOWA 3QIJA 2D10A 2K25A 2O6VA 3H7PB 4TV3A 3RT3B 4E3CA 4BOSC 4TQ1A 3ML9A 4HCNB 4MEMA 3PT2B 4BFRA 2N9PC 2GBMA 3AU5A 5J18A 3V61A 1IPGA 4MGKE 3DCGA 1NDDA 2KTFA 4JGHB 4LJOB 3TL5A 3OJ4B 4K7UA 4NNJB 5C23A 1WH3A 4MGIE 4W9JA 1KLVA 5JHAA 3CSFA 3L10B 3KUCB 2I1JA 1IP9A 2KOXA 1OEYJ 2RSUA 1EUVB 4GU2A 2GBRA 2MBHA 2HTHA 3D32A 4EEWA 1WF9A 2Z59B 4WQOB 1E90A 2MBBB 1UZXB 1RLFA 2KJHB 2NS5A 2FCQA 2RPQA 3ONSA 1NI2A 1V49A 2J0MA 2DZIA 5E6OA 3UIPB 5HKHA 3ZW3A 2DENB 4RMAA 2CKHB 4MM3A 2FCSA 2N9EB 2ZNVC 1H8CA 3UF8A 3NY5A 2MBQA 2WX0A 3QARA 1WJUA 2NBWB 3EECA 2ZPYA 3ENEA 3V60A 2KQ7A 2LZ6A 3P2BA 4F1SA 5DCNA 2BKRB 2YVCA 2ZCBA 2CHZA 2DYMA 2IO0B 3SD5A 3VUXA 3SU8X 5LLIA 2FUHB 4FA6A 2G4DB 1J0GA 4JQWC 2NPTA 3QX1A 2LXCA 4PS3A 3V6CB 2RGFA 2J7QB 2KDIA 2PEAA 2LD9A 1AARA 2C7MB 2HJ8A 3DVNU 4IWQA 3RCZA 4GGQA 4IUMB 4AUQC 4EZKA 4MDKE 2IO3B 1SIFA 1SGHA 3B0AA 3TCAA 2MSED 4GDKB 3PS6A 3VVWB 2L0TA 2AEHA 3DBSA 3VQIA 5IA7A 4HCPB 4DBGA 3HHMA 5CX3A 4EOYA 2I1KA 4CYEA 2V3SA 1LFDA 2JZ3B 3ZTDA 1WXSA 3M3JA 2ZNVB 3RULA 3VTWA 1YX6B 3UIOB 2BYVE 3RUIB 3R7RA 4WJOA 2K6DB 2MWSB 4WJNA 4EKUA 1WR6E 3VTUA 2L05A 1GG3A 2DAJA 3A9KA 2L0FA 1E7UA 1UD7A 2L00B 3PREA 3ZKJC 4AWJA 2O6VD 5JHBA 1E8XA 1UBQA 2R2QA 2R2OA 3IFWB 4GIVA 1P3QU 5D94A 4BKTA 3N30A 3A33B 3L0WB 4ANWA 1WR1A 4K1RB 5AEKB 3K9PB 3L08A 3RYTA 3UGBB 1OQYA 4W9LA 3W1YA 2KVRA 4OVUA 1GC7A 2KLCA 2Z0EB 1TGZB 4HXDA 3L16A 1RRBA 1WXAA 2KTRA 3PRMB 2DZMA 2UYZB 3QJZA 4DK5A 4DHJD 2JRHA 4WWOA 4ZRJA 4NQKE 4WJPA 4AJWA 2FNJB 2PJHA 4LDTD 3WANA 1EF1A 4FULA 4FBJB 5C1ZA 2MQJA 4N9F4 1I42A 3ZNGC 2KFKB 4JIOU 3IG3A 2K8CA 4DHZB 5CHFA 1ZW7A 3QQ8B 1IYFA 1GJZA 4GSWA 5E6PA 3UQBA 1M94A 3NS8A 2ZPNA 2KX0A 3PVLA 2FAZA 2Y5BB 1TZ1A 3ZNHB 2HD5B 4ZRKA 1V86A 4HPLB 4HLEA 3DBRI 3V62A 1OGWA 2DHZA 2KQSA 3TBLD 3ZUNA 3OJ3A 2KK8A 1UH6A 3DVGY 1TTNA 1E5WA 4MH0E 4NQLB 2KC1A 2KO3A 1U4AA 3DDCB 1NBFC 5J2RA 4BKGA 1WE6A 1S3SG 3T9LA 2DX5B 4B9KA 4A3OA 4PYUA 4K7SA 4KZ0A 4BBNC 3PHXB 4ICVA 1RFAA 3SDLC 4GDLA 4GMVA 1C3TA 2JZZA 3IVFA 1WRDB 3OLMD 2KWVB 3QHTA 1WE7A 4GOCA 1YX5B 4BVUC 2KXJA 2ZZPB 2N1WA 1WJNA 2XEWA 3PV1A 4XZ4A 2JVCA 3TMPB 2REXA 1PQSA 2BYFA 1XQQA 4KIKB 2MW5A 3JYUA 5IAAC 2PPHA 5EDSA 3M95A 4EUTA 2NCNA 2N7EA 1V6EA 2BWFA 3KYDD 4HK2A 4ZDVA 2ZCCA 5CTRC 1VD2A 5AZGA 3Q3FA 3ECIA 3WAMA 2JXXA 1WGDA 2NBVB 1WJ6A 2KDBA 1LM8B 1KM7A 5LXIB 2K1FA 2IYDB 1E8WA 2CS4A 2OOBB 4ANXA 2MBOA 4NY0A 4DHZE 3EHVA 4K81A 3ZTCA 2LI5A 1TBEA 4FADA 1V81A 3ZIMA 3JSVA 1Z5SB 3WALA 1WZ0A 2KFKA 2M0XA 3A9JB 4FLHA 1QZEA 2KJ6A 2L3ZA 3AU4A 2KX3A 2BF8B 4OVVA 3B08A 3KYCD 3RZWC 4IC7B 3QC8B 5CHVC 3NZSA 4JLCA 4KV2A 4I6NB 2FCMA 2N1VA 3H9DA 3HM6X 3RD2A 4A3PA 3V6EB 1VCBA 3APDA 2CR5A 1K8RB 1GNUA 3SHQA 5DPWA 2C9WB 3KUDB 3M63B 3DVNV 2G45B 4AJYB 2KMAA 4AP4C 3DQVA 3TJPA 4MGZE 3L54A 1LXDA 5BO4B 2AL3A 3ZO5B 2JF5A 2JY6A 4GXBA 2CHXA 5G55A 3ZRCA 3I3TB 2AL6A 2MCNB 2DZJA 5JZEB 3AI5A 1D3ZA 4RM8A 4K7WA 4M8NA 4WWNA 3ZRFA 3NZUA 1OEYA 2KANA 2KDFB 3DVGX 5TR5A 3R66C 2JUOA 1WI0A 4MJSB 4B6WA 3CSTA 4X57B 2KD0A 2LUEA 2KDEB 1F9JA 3ZDMC 4DDID 2DZKA 2G3QB 5DPRA 3PPAA 2EMSA 1WFYA 4KDIC 3KVFB 3MTNB 2MA9B 1XT9B 3AXCA 2MX2A 4IWPA 3GOEA 2KKCA 2Z0DB 2BYEA 3NOBA 4DDGD 3A9JA 3PTFC 3ML8A 2L8JA 4WWPA 1LQBA 1E8ZA 3LJ3A 3ALBA 4FJYA 4FN2A 2C60A 4W9CA 4CHKA 2K8BA 4BOZB 2BKFA 3A1QA 2XK5A 3HIZA 2KN5A 4P7IA 4BBNF 4II3B 4II2B 4TQ0A 1WGGA 1ZKHA 3IBEA 3JW0X 1SE9A 1S1QB 1MG8A 2KWCA 4G3XB 2IO2B 4LDTB 3LDZE 2LASA 1E7VA 3OAWA 1J8CA 1WZ3A 4NAWB 2MLBA 2N4FA 4YL8A 4MELA 1P98A 5LXHA 5GMVA 3M62B 2C7NB 2MP2A 3EC8A 4KVGB 5FR6A 1EF5A 2WDTB 3QWZB 3ZLZA 2BPSA 2UWQA 1Q1OA 3HK0A 1Q5WB 5AZHA 2IY0B 2WYQA 4MGYE 3N32A 3QK0A 4RM9A 4G11A 3ZNID 4EZLA 4F7ZA 5DPSA 2D3GA 5AZFA 1WMHB 4FJVB 2GMIC 3R3MA 4NPNA 2GBKA 1P0RA 4W9FA 4HWIB 3PRPB 2BWES 1ISNA 4ZYNA 4URKA 4FHKA 4PS8A 1Z2MA 4DXAB 1V5OA 4M0WB 1WJ4A 2K6QA 1KJTA 3PSEB 3VH4B 2ASQA 2BGFA 3WA0A 1V5TA 2PE6B 1RAXA 3O65B 3VXWA 2FIDA 4E74A 2NVUI 2L76A 2KFJA 2JWZA 4LCDE 2CU1A 1X1MA 5KHQA 2RR9A 4NJ7A 2LRWA 2KHWB 4ASWC 2MBEA 3DPDA 2D07B 2NR2A 2MRPA 2LWPA 4KIKA 2FCNA 2W9NA 1H4RA 3VH3B 3APCA 1WIAA 1C1YB 3TIXA 3R7QA 3MJWA 3W1SA 3VAWA 1WGYA 4AOFA 2ZVOA 5G2NA 2GOWA 1YD8U 2M4NA 5JH5C 3UINB 4KZCA 4WJQA 2XK5B 3VDZA 1GUAB 3AULA 2O6VB 3H7PA 3GZNI 4JL9A 5E6NA 3APFA 4EFOA 2OJRA 2RD0A 4HJKA 5CHWA 3S2AA 1WGHA 3EFUA 4XC2A 2JPHA 1UBIA 2N7DA 3N3KB 2O2VA 1WMHA 2D2QA 4FJZA 1R4NI 1YIWA 4HDQA 4M8MA 4ZRIA 2LRUA 1L2NA 2IO1B 1Y8RC 1BT0A 2PE9A 1WM2A 3VHTC 4MJSA 2NPTB 2LXAA 1V80A 4J6IA 2K8HA 2AYOB 3A1QB 2MP2B 4ICUA 3VUYA 2A4ZA 1WGRA 3IHPC 5D7GA 1V9JA 1A5RA 1WX7A 3DBLI 3U8ZA 3H6NA 3MHSD 2JT4B 3DBHI 4B95A 2N9XA 3QA8A 3JSVB 1Q0WB 2KZRA 2C5LC 3PHWB 1OTRB 4WAAA 3PGEA 4HVBA 3KH0A 1KOTA 4DHJB 4NJ6A 3WAPA 5J17A 1P1AA 4GDKA 4IWOA 2B3AA 4W9GA 3L17A 4KSLC 1J19A 2DAFA 4IM0A 4IM3A 2LVQA 4GN1A 5DPTA 4W9DA 1WX9A 2K39A 4IG7B 2GBJA 4HPMB 2L7RA 3ZDTA 2HE7A 2D11A 2KJRA 4BKSD 2CHWA 3BY4B 1WX8A 3JVZX 2J0JA 4NAWA 4XX5A 2M17A 1WY8A 1XD3B 2KTRB 3PZDA 2ZJDA 3CF6E 1R4MI 2ZEQA 2V4LA 3UQAA 3KW5B 4PYZA 3BINA 1GC6A 3VTVA 3W1SC 1YJ1A 2KC2A 4TUUA 4W9KA 2O2VB 2DYOA 1EO6A 2QHOA 2V1YA 4PS7A 2KLGA 3VFKA 3H1UA 5KHOA 4DWFA 1I35A 1YQBA 4MSQB 4GB9A 4KSKC 2YLMA 2XBBC 3A4SC 4W9EA 3PRZA 2ZVNA 1JRUA 1E8YA 3U30A 3WAOA 2M1MA 2WX1A 4G0NB 4BKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI B;  2WWZ A;  3H7S A;  3B1L X;  3ZVV A;  1UGM A;  1CMX B;  3A4R A;  3QCA A;  4G50 A;  4I6P A;  2J0K A;  4A20 A;  3PLV A;  1WXV A;  3ZNZ B;  4F8C B;  2EMT A;  3VUW A;  2DYB A;  4MSM B;  2IZV B;  4LJP B;  4TKN A;  4CO7 A;  2GBN A;  4HDO A;  5L83 A;  3Q3J A;  3QAQ A;  4W9H A;  2KNB A;  4ANU A;  2LGX A;  4FHJ A;  3WIM A;  2LVO A;  3A9K B;  2VRR B;  3CMM B;  1WM3 A;  3RZF A;  3HM3 A;  2C7H A;  1ZGU B;  2EKE C;  1WXM A;  2IY1 B;  4EZJ A;  2NBU A;  4IM2 A;  4IW0 A;  3U7D A;  4ANV A;  4GDL B;  2LJ5 A;  3L13 A;  3X23 A;  1FXT B;  1V2Y A;  4E71 A;  3NHE B;  1L7Y A;  1WYW B;  2LGD A;  3C0R B;  5D2M B;  2AWT A;  4KDL B;  1G6J A;  4W9I A;  3T8M A;  2LVP A;  1UEL A;  2KMC A;  2LGY A;  5L95 C;  2G4S A;  1P9D U;  1T0Y A;  4I6L B;  3KUZ A;  3X0W A;  5D6J B;  3PLU A;  2M8S A;  2IBI B;  1HE8 A;  3K9O B;  2FIF A;  2A5U A;  2KWU B;  3DOW A;  3QIJ A;  2D10 A;  2K25 A;  2O6V A;  3H7P B;  4TV3 A;  3RT3 B;  4E3C A;  4BOS C;  4TQ1 A;  3ML9 A;  4HCN B;  4MEM A;  3PT2 B;  4BFR A;  2N9P C;  2GBM A;  3AU5 A;  5J18 A;  3V61 A;  1IPG A;  4MGK E;  3DCG A;  1NDD A;  2KTF A;  4JGH B;  4LJO B;  3TL5 A;  3OJ4 B;  4K7U A;  4NNJ B;  5C23 A;  1WH3 A;  4MGI E;  4W9J A;  1KLV A;  5JHA A;  3CSF A;  3L10 B;  3KUC B;  2I1J A;  1IP9 A;  2KOX A;  1OEY J;  2RSU A;  1EUV B;  4GU2 A;  2GBR A;  2MBH A;  2HTH A;  3D32 A;  4EEW A;  1WF9 A;  2Z59 B;  4WQO B;  1E90 A;  2MBB B;  1UZX B;  1RLF A;  2KJH B;  2NS5 A;  2FCQ A;  2RPQ A;  3ONS A;  1NI2 A;  1V49 A;  2J0M A;  2DZI A;  5E6O A;  3UIP B;  5HKH A;  3ZW3 A;  2DEN B;  4RMA A;  2CKH B;  4MM3 A;  2FCS A;  2N9E B;  2ZNV C;  1H8C A;  3UF8 A;  3NY5 A;  2MBQ A;  2WX0 A;  3QAR A;  1WJU A;  2NBW B;  3EEC A;  2ZPY A;  3ENE A;  3V60 A;  2KQ7 A;  2LZ6 A;  3P2B A;  4F1S A;  5DCN A;  2BKR B;  2YVC A;  2ZCB A;  2CHZ A;  2DYM A;  2IO0 B;  3SD5 A;  3VUX A;  3SU8 X;  5LLI A;  2FUH B;  4FA6 A;  2G4D B;  1J0G A;  4JQW C;  2NPT A;  3QX1 A;  2LXC A;  4PS3 A;  3V6C B;  2RGF A;  2J7Q B;  2KDI A;  2PEA A;  2LD9 A;  1AAR A;  2C7M B;  2HJ8 A;  3DVN U;  4IWQ A;  3RCZ A;  4GGQ A;  4IUM B;  4AUQ C;  4EZK A;  4MDK E;  2IO3 B;  1SIF A;  1SGH A;  3B0A A;  3TCA A;  2MSE D;  4GDK B;  3PS6 A;  3VVW B;  2L0T A;  2AEH A;  3DBS A;  3VQI A;  5IA7 A;  4HCP B;  4DBG A;  3HHM A;  5CX3 A;  4EOY A;  2I1K A;  4CYE A;  2V3S A;  1LFD A;  2JZ3 B;  3ZTD A;  1WXS A;  3M3J A;  2ZNV B;  3RUL A;  3VTW A;  1YX6 B;  3UIO B;  2BYV E;  3RUI B;  3R7R A;  4WJO A;  2K6D B;  2MWS B;  4WJN A;  4EKU A;  1WR6 E;  3VTU A;  2L05 A;  1GG3 A;  2DAJ A;  3A9K A;  2L0F A;  1E7U A;  1UD7 A;  2L00 B;  3PRE A;  3ZKJ C;  4AWJ A;  2O6V D;  5JHB A;  1E8X A;  1UBQ A;  2R2Q A;  2R2O A;  3IFW B;  4GIV A;  1P3Q U;  5D94 A;  4BKT A;  3N30 A;  3A33 B;  3L0W B;  4ANW A;  1WR1 A;  4K1R B;  5AEK B;  3K9P B;  3L08 A;  3RYT A;  3UGB B;  1OQY A;  4W9L A;  3W1Y A;  2KVR A;  4OVU A;  1GC7 A;  2KLC A;  2Z0E B;  1TGZ B;  4HXD A;  3L16 A;  1RRB A;  1WXA A;  2KTR A;  3PRM B;  2DZM A;  2UYZ B;  3QJZ A;  4DK5 A;  4DHJ D;  2JRH A;  4WWO A;  4ZRJ A;  4NQK E;  4WJP A;  4AJW A;  2FNJ B;  2PJH A;  4LDT D;  3WAN A;  1EF1 A;  4FUL A;  4FBJ B;  5C1Z A;  2MQJ A;  4N9F 4;  1I42 A;  3ZNG C;  2KFK B;  4JIO U;  3IG3 A;  2K8C A;  4DHZ B;  5CHF A;  1ZW7 A;  3QQ8 B;  1IYF A;  1GJZ A;  4GSW A;  5E6P A;  3UQB A;  1M94 A;  3NS8 A;  2ZPN A;  2KX0 A;  3PVL A;  2FAZ A;  2Y5B B;  1TZ1 A;  3ZNH B;  2HD5 B;  4ZRK A;  1V86 A;  4HPL B;  4HLE A;  3DBR I;  3V62 A;  1OGW A;  2DHZ A;  2KQS A;  3TBL D;  3ZUN A;  3OJ3 A;  2KK8 A;  1UH6 A;  3DVG Y;  1TTN A;  1E5W A;  4MH0 E;  4NQL B;  2KC1 A;  2KO3 A;  1U4A A;  3DDC B;  1NBF C;  5J2R A;  4BKG A;  1WE6 A;  1S3S G;  3T9L A;  2DX5 B;  4B9K A;  4A3O A;  4PYU A;  4K7S A;  4KZ0 A;  4BBN C;  3PHX B;  4ICV A;  1RFA A;  3SDL C;  4GDL A;  4GMV A;  1C3T A;  2JZZ A;  3IVF A;  1WRD B;  3OLM D;  2KWV B;  3QHT A;  1WE7 A;  4GOC A;  1YX5 B;  4BVU C;  2KXJ A;  2ZZP B;  2N1W A;  1WJN A;  2XEW A;  3PV1 A;  4XZ4 A;  2JVC A;  3TMP B;  2REX A;  1PQS A;  2BYF A;  1XQQ A;  4KIK B;  2MW5 A;  3JYU A;  5IAA C;  2PPH A;  5EDS A;  3M95 A;  4EUT A;  2NCN A;  2N7E A;  1V6E A;  2BWF A;  3KYD D;  4HK2 A;  4ZDV A;  2ZCC A;  5CTR C;  1VD2 A;  5AZG A;  3Q3F A;  3ECI A;  3WAM A;  2JXX A;  1WGD A;  2NBV B;  1WJ6 A;  2KDB A;  1LM8 B;  1KM7 A;  5LXI B;  2K1F A;  2IYD B;  1E8W A;  2CS4 A;  2OOB B;  4ANX A;  2MBO A;  4NY0 A;  4DHZ E;  3EHV A;  4K81 A;  3ZTC A;  2LI5 A;  1TBE A;  4FAD A;  1V81 A;  3ZIM A;  3JSV A;  1Z5S B;  3WAL A;  1WZ0 A;  2KFK A;  2M0X A;  3A9J B;  4FLH A;  1QZE A;  2KJ6 A;  2L3Z A;  3AU4 A;  2KX3 A;  2BF8 B;  4OVV A;  3B08 A;  3KYC D;  3RZW C;  4IC7 B;  3QC8 B;  5CHV C;  3NZS A;  4JLC A;  4KV2 A;  4I6N B;  2FCM A;  2N1V A;  3H9D A;  3HM6 X;  3RD2 A;  4A3P A;  3V6E B;  1VCB A;  3APD A;  2CR5 A;  1K8R B;  1GNU A;  3SHQ A;  5DPW A;  2C9W B;  3KUD B;  3M63 B;  3DVN V;  2G45 B;  4AJY B;  2KMA A;  4AP4 C;  3DQV A;  3TJP A;  4MGZ E;  3L54 A;  1LXD A;  5BO4 B;  2AL3 A;  3ZO5 B;  2JF5 A;  2JY6 A;  4GXB A;  2CHX A;  5G55 A;  3ZRC A;  3I3T B;  2AL6 A;  2MCN B;  2DZJ A;  5JZE B;  3AI5 A;  1D3Z A;  4RM8 A;  4K7W A;  4M8N A;  4WWN A;  3ZRF A;  3NZU A;  1OEY A;  2KAN A;  2KDF B;  3DVG X;  5TR5 A;  3R66 C;  2JUO A;  1WI0 A;  4MJS B;  4B6W A;  3CST A;  4X57 B;  2KD0 A;  2LUE A;  2KDE B;  1F9J A;  3ZDM C;  4DDI D;  2DZK A;  2G3Q B;  5DPR A;  3PPA A;  2EMS A;  1WFY A;  4KDI C;  3KVF B;  3MTN B;  2MA9 B;  1XT9 B;  3AXC A;  2MX2 A;  4IWP A;  3GOE A;  2KKC A;  2Z0D B;  2BYE A;  3NOB A;  4DDG D;  3A9J A;  3PTF C;  3ML8 A;  2L8J A;  4WWP A;  1LQB A;  1E8Z A;  3LJ3 A;  3ALB A;  4FJY A;  4FN2 A;  2C60 A;  4W9C A;  4CHK A;  2K8B A;  4BOZ B;  2BKF A;  3A1Q A;  2XK5 A;  3HIZ A;  2KN5 A;  4P7I A;  4BBN F;  4II3 B;  4II2 B;  4TQ0 A;  1WGG A;  1ZKH A;  3IBE A;  3JW0 X;  1SE9 A;  1S1Q B;  1MG8 A;  2KWC A;  4G3X B;  2IO2 B;  4LDT B;  3LDZ E;  2LAS A;  1E7V A;  3OAW A;  1J8C A;  1WZ3 A;  4NAW B;  2MLB A;  2N4F A;  4YL8 A;  4MEL A;  1P98 A;  5LXH A;  5GMV A;  3M62 B;  2C7N B;  2MP2 A;  3EC8 A;  4KVG B;  5FR6 A;  1EF5 A;  2WDT B;  3QWZ B;  3ZLZ A;  2BPS A;  2UWQ A;  1Q1O A;  3HK0 A;  1Q5W B;  5AZH A;  2IY0 B;  2WYQ A;  4MGY E;  3N32 A;  3QK0 A;  4RM9 A;  4G11 A;  3ZNI D;  4EZL A;  4F7Z A;  5DPS A;  2D3G A;  5AZF A;  1WMH B;  4FJV B;  2GMI C;  3R3M A;  4NPN A;  2GBK A;  1P0R A;  4W9F A;  4HWI B;  3PRP B;  2BWE S;  1ISN A;  4ZYN A;  4URK A;  4FHK A;  4PS8 A;  1Z2M A;  4DXA B;  1V5O A;  4M0W B;  1WJ4 A;  2K6Q A;  1KJT A;  3PSE B;  3VH4 B;  2ASQ A;  2BGF A;  3WA0 A;  1V5T A;  2PE6 B;  1RAX A;  3O65 B;  3VXW A;  2FID A;  4E74 A;  2NVU I;  2L76 A;  2KFJ A;  2JWZ A;  4LCD E;  2CU1 A;  1X1M A;  5KHQ A;  2RR9 A;  4NJ7 A;  2LRW A;  2KHW B;  4ASW C;  2MBE A;  3DPD A;  2D07 B;  2NR2 A;  2MRP A;  2LWP A;  4KIK A;  2FCN A;  2W9N A;  1H4R A;  3VH3 B;  3APC A;  1WIA A;  1C1Y B;  3TIX A;  3R7Q A;  3MJW A;  3W1S A;  3VAW A;  1WGY A;  4AOF A;  2ZVO A;  5G2N A;  2GOW A;  1YD8 U;  2M4N A;  5JH5 C;  3UIN B;  4KZC A;  4WJQ A;  2XK5 B;  3VDZ A;  1GUA B;  3AUL A;  2O6V B;  3H7P A;  3GZN I;  4JL9 A;  5E6N A;  3APF A;  4EFO A;  2OJR A;  2RD0 A;  4HJK A;  5CHW A;  3S2A A;  1WGH A;  3EFU A;  4XC2 A;  2JPH A;  1UBI A;  2N7D A;  3N3K B;  2O2V A;  1WMH A;  2D2Q A;  4FJZ A;  1R4N I;  1YIW A;  4HDQ A;  4M8M A;  4ZRI A;  2LRU A;  1L2N A;  2IO1 B;  1Y8R C;  1BT0 A;  2PE9 A;  1WM2 A;  3VHT C;  4MJS A;  2NPT B;  2LXA A;  1V80 A;  4J6I A;  2K8H A;  2AYO B;  3A1Q B;  2MP2 B;  4ICU A;  3VUY A;  2A4Z A;  1WGR A;  3IHP C;  5D7G A;  1V9J A;  1A5R A;  1WX7 A;  3DBL I;  3U8Z A;  3H6N A;  3MHS D;  2JT4 B;  3DBH I;  4B95 A;  2N9X A;  3QA8 A;  3JSV B;  1Q0W B;  2KZR A;  2C5L C;  3PHW B;  1OTR B;  4WAA A;  3PGE A;  4HVB A;  3KH0 A;  1KOT A;  4DHJ B;  4NJ6 A;  3WAP A;  5J17 A;  1P1A A;  4GDK A;  4IWO A;  2B3A A;  4W9G A;  3L17 A;  4KSL C;  1J19 A;  2DAF A;  4IM0 A;  4IM3 A;  2LVQ A;  4GN1 A;  5DPT A;  4W9D A;  1WX9 A;  2K39 A;  4IG7 B;  2GBJ A;  4HPM B;  2L7R A;  3ZDT A;  2HE7 A;  2D11 A;  2KJR A;  4BKS D;  2CHW A;  3BY4 B;  1WX8 A;  3JVZ X;  2J0J A;  4NAW A;  4XX5 A;  2M17 A;  1WY8 A;  1XD3 B;  2KTR B;  3PZD A;  2ZJD A;  3CF6 E;  1R4M I;  2ZEQ A;  2V4L A;  3UQA A;  3KW5 B;  4PYZ A;  3BIN A;  1GC6 A;  3VTV A;  3W1S C;  1YJ1 A;  2KC2 A;  4TUU A;  4W9K A;  2O2V B;  2DYO A;  1EO6 A;  2QHO A;  2V1Y A;  4PS7 A;  2KLG A;  3VFK A;  3H1U A;  5KHO A;  4DWF A;  1I35 A;  1YQB A;  4MSQ B;  4GB9 A;  4KSK C;  2YLM A;  2XBB C;  3A4S C;  4W9E A;  3PRZ A;  2ZVN A;  1JRU A;  1E8Y A;  3U30 A;  3WAO A;  2M1M A;  2WX1 A;  4G0N B;  4BKS A; 
#chains in the Genus database with same CATH topology
 2JRI B;  3Q8B A;  3ZVV A;  1UGM A;  5EE9 A;  3IT6 B;  1TY0 A;  2DYB A;  1FFV A;  2IZV B;  3Q8E A;  2W3R A;  2PW9 A;  2GBN A;  4HDO A;  2KNB A;  3WIM A;  1WM3 A;  2C7H A;  3LB8 C;  2BS2 B;  3U7D A;  4GDL B;  1XLP A;  1XLN A;  1FXT B;  2AQ1 B;  1GB1 A;  1DOY A;  4KDL B;  4JWU C;  4HRS A;  2KMC A;  4KGS A;  1MPE A;  1T0Y A;  4I6L B;  3KUZ A;  2J4X A;  1HE8 A;  2B76 B;  3N1X C;  2A5U A;  2KWU B;  3DOW A;  3QIJ A;  3H7P B;  3RT3 B;  4E3C A;  1FNV A;  4BFR A;  3PT2 B;  2GBM A;  3P4P B;  4MGK E;  3ETR A;  1NDD A;  2KTF A;  4JGH B;  4P6V F;  4K7U A;  4MGI E;  2INN E;  3CSF A;  3KUC B;  4XE0 A;  2WHI A;  3D32 A;  4EEW A;  2Z59 B;  1E90 A;  2MBB B;  2FCQ A;  2QDF A;  3ONS A;  2J0M A;  1V49 A;  1FFU A;  4RMA A;  2CKH B;  3DHG C;  1I4X A;  3UF8 A;  1H8C A;  2QJL A;  2WDR B;  1L4Z B;  2WX0 A;  5C2T B;  1TT5 B;  3QAR A;  3ENE A;  3EEC A;  2ZPY A;  3V60 A;  4P1C C;  2LZ6 A;  2BKR B;  1K52 A;  2ZCB A;  2CHZ A;  2IO0 B;  3L4P A;  3RMK C;  1L6U A;  4NZL B;  1HZ5 A;  2WNM A;  3IAM 1;  1HZ6 A;  2HJ8 A;  3DVN U;  1GAQ B;  4GGQ A;  3RCZ A;  3Q69 A;  4AUQ C;  4L2Y A;  4A9A A;  2QSD A;  3PS6 A;  3U2S C;  5CX3 A;  3VR8 B;  2V3S A;  2JZ3 B;  3ZTD A;  1WXS A;  2ZNV B;  3VTW A;  3R7R A;  4EKU A;  2RMM A;  1NYQ A;  4J3O D;  4KX6 B;  1D5M C;  4BKT A;  3A33 B;  1F52 A;  4ANW A;  1L5P A;  2Z0E B;  1ZDV A;  1WXA A;  1JML A;  3PRM B;  2DZM A;  2UYZ B;  3QJZ A;  4NQK E;  4WJP A;  2K5P A;  4AJW A;  2WU5 B;  4ITK A;  2PJH A;  4N9F 4;  1HTQ A;  2QEJ C;  4JIO U;  4DHZ B;  1ZW7 A;  1GJZ A;  1M94 A;  2KX0 A;  5BYR A;  4HLE A;  1TZ1 A;  4ZRK A;  4HPL B;  3DBR I;  3AE8 B;  2DHZ A;  2KQS A;  4RCO A;  1D4B A;  4JWS C;  3FIL A;  4NJC A;  3BYT B;  2SEB D;  4NQL B;  5FR3 A;  1U4A A;  3DDC B;  3RFZ B;  1S3S G;  4B9K A;  1HA5 A;  4K7S A;  4KZ0 A;  2WDV B;  4ICV A;  3SDL C;  3RN9 C;  3IVF A;  3OLM D;  1K51 A;  1YX5 B;  1WJN A;  3AM9 A;  1ZXH A;  5EE0 A;  5IAA C;  1QT9 A;  3DWM A;  4HK2 A;  4N6E B;  1MJD A;  2IPK D;  5AZG A;  3Q3F A;  2WP9 B;  1HTO A;  3RNA C;  2NBV B;  2KDB A;  1HXY D;  4RF0 A;  1KM7 A;  2CS4 A;  2D3C A;  2WGS A;  1NVI D;  2YEP B;  4K81 A;  2LI5 A;  1K50 A;  3EFC A;  4FAD A;  3JSV A;  3WAL A;  1WZ0 A;  3A9J B;  1BXT A;  2KJ6 A;  2L3Z A;  1KRH A;  2BF8 B;  4OVV A;  3RZW C;  3KYC D;  3NZS A;  3P4Q B;  1C77 A;  2N1V A;  4ARI A;  3RD2 A;  1VCB A;  2CR5 A;  3NVY A;  2C9W B;  3DVN V;  4AJY B;  1CJE A;  3TJP A;  4MGZ E;  2ON8 A;  1PGX A;  2CHX A;  5H92 C;  2DZJ A;  3AEE B;  3AI5 A;  2JX5 A;  2L52 A;  1YN5 A;  1VZ7 A;  2PMV A;  1N60 A;  3N1Y C;  1FPY A;  3DVG X;  2JUO A;  3P1M A;  3CST A;  3ZYY X;  2KDE B;  4DDI D;  4LLG M;  3CWI A;  4KDI C;  1NYR A;  2K0P A;  1R4N B;  3GOE A;  3NOB A;  1D6E C;  2L8J A;  3AE2 B;  4C00 A;  3HIZ A;  3WCQ A;  2R61 A;  2KN5 A;  2NTT A;  2L83 A;  1MG8 A;  3LDZ E;  4C56 C;  4AQ7 A;  2LHD A;  4YTN B;  2H89 B;  2C7N B;  5FR6 A;  1YMH E;  2QMT A;  4KVG B;  1EF5 A;  1F2R I;  1RFK A;  2BPS A;  1OQR A;  1UUP A;  3HK0 A;  5AZH A;  2QCZ A;  3QK0 A;  4FJV B;  2GMI C;  4YSX B;  4URK A;  4PS8 A;  3T3N A;  1WJ4 A;  1KJT A;  1WSP A;  1V1P A;  2BGF A;  2G1E A;  2NVU I;  1VZ6 A;  3MFG A;  5IP4 D;  3APC A;  1WIA A;  3R7Q A;  3MJW A;  1YNT E;  4FXC A;  1WGY A;  2DLB A;  4AOF A;  2M4N A;  2Y5P A;  1GB4 A;  3VDZ A;  1CK1 A;  3H7P A;  4JL9 A;  3AE6 B;  1YJJ A;  4GLS C;  5CHW A;  2BBC A;  2JPH A;  1UBI A;  4HPP A;  1WMH A;  2D2Q A;  1R4N I;  4HDQ A;  2V9H A;  1QQR A;  1L2N A;  2IO1 B;  2PE9 A;  2NPT B;  1QF6 A;  1V80 A;  2MP2 B;  4O1N A;  2JYT A;  1FIQ A;  2KQ4 X;  2Y5C A;  3MHS D;  3DBH I;  1UWM A;  3CIR B;  3U4E G;  3JSV B;  1FO4 A;  3PHW B;  1KOT A;  4DHJ B;  1QOF A;  3TEZ A;  4IWO A;  1J19 A;  2IDY A;  4OZC A;  4N59 A;  4W9D A;  2K39 A;  4HPM B;  2HE7 A;  2D11 A;  2WXM A;  1WX8 A;  2M17 A;  3AEB B;  3UQA A;  2D5G A;  3VTV A;  2BS4 B;  2ZW0 A;  2O2V B;  4W9K A;  2V1Y A;  1EO6 A;  2QHO A;  1I35 A;  3VFK A;  3H1U A;  5KHO A;  2FE8 A;  1JWM D;  2XBB C;  1R4M B;  1SE3 A;  3NVZ A;  1JRU A;  4M02 A;  4BKS A;  3H7S A;  1UGJ A;  3PLV A;  4IKG A;  3ZNZ B;  4F8C B;  2X38 A;  1KLU D;  1J7B A;  4LJP B;  4CO7 A;  3Q3J A;  3QAQ A;  2VRR B;  3CMM B;  3NRZ A;  5GXG B;  3HM3 A;  3RNE C;  2EKE C;  2IY1 B;  3AEC B;  2RDG A;  4IM2 A;  4IW0 A;  4ANV A;  1E7P B;  4C7Y A;  1V2Y A;  1D5Z C;  3NHE B;  4E71 A;  1WYW B;  5D2M B;  2AWT A;  1EU3 A;  3FIL B;  3P4R B;  2LMC A;  3IT4 B;  5L95 C;  3KLS X;  2VZK B;  4MH8 A;  1P9D U;  2V3N A;  3E9S A;  2M8S A;  2IBI B;  1QIL A;  4TV3 A;  4LNK A;  4MEM A;  3AU5 A;  3DCG A;  4LJO B;  3OJ4 B;  1WH3 A;  1KLV A;  2LGI A;  3L10 B;  2WS3 B;  4LK0 M;  1IP9 A;  2RSU A;  1BUI C;  1OEY J;  2GBR A;  4A55 A;  2HTH A;  2WXF A;  5G5G A;  4WQO B;  2NS5 A;  1AW7 A;  2GI9 A;  3AEG B;  4OW0 A;  2DZI A;  3UIP B;  5HKH A;  1YQ4 B;  2FCS A;  2ZNV C;  1VLB A;  1JCK B;  3BVG A;  4KKJ A;  4D2K A;  2KAJ A;  2MH7 A;  1L0V B;  3VUX A;  5H8Y E;  2L32 A;  3SU8 X;  5LLI A;  2FUH B;  4FA6 A;  4ZOH C;  2NPT A;  2Q5W D;  2BT6 A;  4RGO S;  4PS3 A;  4DXG A;  4C7Z A;  3BWU D;  2G9H D;  4EZK A;  4MAC A;  2ZW1 A;  3AV8 A;  4MDK E;  2W3S A;  3AE7 B;  4K3B A;  3HHM A;  4EE2 A;  2I1K A;  4CYE A;  1IBX B;  1YX6 B;  3RUI B;  2E6X A;  1KTK A;  1WGK A;  1WR6 E;  3NJT A;  2L05 A;  1GG3 A;  3Q14 C;  1E10 A;  3A9K A;  2L0F A;  1E7U A;  1UD7 A;  4AWJ A;  1F0Z A;  1UBQ A;  4YXD B;  1A70 A;  3AEF B;  1P3Q U;  1C4A A;  3SFE B;  3K9P B;  4W9L A;  4QAY A;  3W1Y A;  2KVR A;  4HXD A;  1RRB A;  2JU6 X;  1EM7 A;  1OQQ A;  4DHJ D;  4WWO A;  4ZRJ A;  1MFW A;  2GRI A;  4LDT D;  4FBJ B;  1I4R A;  3R2I A;  3IG3 A;  1NEN B;  1IYF A;  5E6P A;  2K9X A;  3UQB A;  3OWE B;  2FAZ A;  3ZNH B;  1ACC A;  3MC8 A;  1OGW A;  3ZUN A;  1C79 A;  3ZJU A;  1MHH E;  3V05 A;  3W5V B;  1UH6 A;  4MH0 E;  4ZYS A;  1SEB D;  2J52 A;  4BKG A;  1WE6 A;  1MVK A;  3T9L A;  2JZP A;  2KN4 A;  4A6Q A;  4GDL A;  4GMV A;  2PTL A;  3QHT A;  4BVU C;  2KXJ A;  2XEW A;  4XZ4 A;  2JVC A;  3GB1 A;  2BYF A;  3UI3 A;  1TIF A;  4KIK B;  3SR6 A;  1T0S C;  3JYU A;  4YTM B;  2NCN A;  1CZP A;  4KGR A;  2BWF A;  4ZDV A;  1VD2 A;  4XWW A;  3WAM A;  1E6E B;  1WGD A;  3PZ8 A;  2HDE A;  2WXQ A;  1LM8 B;  5LXI B;  2IYD B;  1I4Q A;  1YN3 A;  4DHZ E;  2OED A;  3ZTC A;  1C76 A;  1NEK B;  1FCL A;  2JYE A;  4WWM A;  2KX3 A;  3QC8 B;  5CHV C;  3HM6 X;  2ACZ B;  3APD A;  1K8R B;  1DOX A;  1KLG D;  4WAF A;  1GNU A;  2JWU A;  2H88 B;  3BYY B;  2KMA A;  2N9K A;  3L54 A;  4S17 A;  1LXD A;  2M56 B;  5BO4 B;  2JF5 A;  2VH2 A;  2WDQ B;  4B0M A;  2AL6 A;  4UDU C;  1SBB B;  4M8N A;  4WWN A;  1XCT L;  4MJS B;  4X57 B;  1ROE A;  2EMS A;  1F1H A;  1XEE A;  1PYW D;  3MTN B;  2MA9 B;  1XT9 B;  1ET6 A;  2MX2 A;  4IWP A;  4NAM A;  2KKC A;  4LNI A;  2BYE A;  3A9J A;  3ML8 A;  2N0S B;  1I4H A;  3AE9 B;  5AUK A;  1QKZ A;  2BKF A;  1SF0 A;  1VJK A;  2CU3 A;  1TKY A;  5JXV A;  2DNF A;  2WXR A;  3JW0 X;  1S1Q B;  1JQ4 A;  2OJW A;  1E7V A;  4JPS A;  2Y3A A;  4YL8 A;  1P98 A;  3HUI A;  3ZLZ A;  3MP9 A;  2IY0 B;  3AE5 B;  3N32 A;  3ZNI D;  4RM9 A;  1QLB B;  4F7Z A;  2D3G A;  1SE2 A;  1FMA D;  1MG4 A;  4W9F A;  1UNS A;  4HWI B;  4ZYN A;  3SFD B;  4FHK A;  1Z2M A;  2K6Q A;  2JXT A;  1JAL A;  3RPF C;  1MHX A;  2PE6 B;  2KFJ A;  4LCD E;  1X1M A;  2QIE B;  2RR9 A;  4NJ7 A;  2LRW A;  1E9M A;  5HI1 A;  2LWP A;  1XLQ A;  5E6J A;  3VH3 B;  4WQM A;  3TIX A;  3AE3 B;  1KF6 B;  3VAW A;  5G2N A;  3RI7 C;  2ONQ A;  3UIN B;  3ABV B;  2WXO A;  4WJQ A;  2O6V B;  3GZN I;  4OZA A;  1JWS D;  3IXS A;  3GE3 C;  4HJK A;  2N7D A;  3N3K B;  2O2V A;  4M8M A;  4OHJ A;  2LRU A;  2MEK A;  3SEB A;  3VHT C;  1T6B X;  1F77 A;  2K8H A;  2A4Z A;  3PZ7 A;  3IHP C;  5BMI A;  1V9J A;  3U8Z A;  2WU2 B;  2KZR A;  2C5L C;  1OTR B;  3PGE A;  4HVB A;  5LNK 1;  5J17 A;  2B3A A;  3L17 A;  4IM0 A;  5FKA C;  4GN1 A;  3HVD A;  1P7F A;  3E56 A;  5BYQ A;  4BKS D;  2J0J A;  2ZJD A;  3AB5 A;  2V4L A;  3W2D A;  3KW5 B;  4PYZ A;  1N6Z A;  2KC2 A;  5D3D A;  1FNU A;  3C8Y A;  2ZVN A;  1E8Y A;  3U30 A;  4L1B A;  2WX1 A;  2QC8 A;  1TS4 A;  3A4R A;  3QCA A;  3NVV A;  2J0K A;  3I63 C;  5BYS A;  4HKQ A;  3VUW A;  2LGS A;  3AN1 A;  2XN9 C;  1J7A A;  2BQQ A;  3N20 C;  5L83 A;  4ANU A;  4FHJ A;  4JE3 B;  2LVO A;  3A9K B;  1XCQ L;  1ZGU B;  5EE1 A;  1T5X D;  1WXM A;  4EZJ A;  3L13 A;  3X23 A;  2SAK A;  1L7Y A;  3R2T A;  3O13 A;  1G6J A;  1D5X C;  4W9I A;  3T8M A;  4KKI A;  2DBY A;  1XO3 A;  2G4S A;  1V1O A;  5D6J B;  3PLU A;  2WXP A;  3NVW A;  2FIF A;  2D10 A;  2IGH A;  4BOS C;  4TQ1 A;  1SB3 C;  4HCN B;  3V61 A;  3TL5 A;  1OFF A;  2AQ2 B;  1UWX A;  1YJI A;  3I57 A;  4NNJ B;  1JWU D;  1FNW A;  2I1J A;  1ZP0 B;  1EUV B;  2MBH A;  2KWD A;  3W9C B;  1WF9 A;  4LNO A;  1UZX B;  2RPQ A;  4PT5 A;  4US8 A;  4USA A;  4RFB A;  5E6O A;  3I5J C;  3ZW3 A;  3C19 A;  4YSZ B;  1SIJ A;  3LYY A;  4YTP B;  2KYW A;  3BK1 A;  5IN7 A;  2NBW B;  4KGT A;  3VRA B;  2WXG A;  3B9J A;  3P2B A;  4F1S A;  3SD5 A;  2DYM A;  2LFI A;  2G4D B;  1WXQ A;  2JQR B;  1J0G A;  4JQW C;  3TSS A;  3NS1 A;  2PKO A;  3VRB B;  2V0G A;  2EKI A;  2J7Q B;  2LD9 A;  1AAR A;  1GOZ A;  2C7M B;  3Q8F A;  4IWQ A;  2HJ1 A;  2BYT A;  3Q8C A;  3B0A A;  1SGH A;  4ZHO A;  2MSE D;  4GDK B;  3VVW B;  2TSS A;  3DBS A;  4DBG A;  4EOY A;  1VRA B;  1LFD A;  2WXL A;  3RUL A;  2BYV E;  4REZ A;  4WJO A;  2MWS B;  5MPO A;  4WJN A;  3PRE A;  3ZJV A;  4RGN A;  2L00 B;  3ZKJ C;  4TMA B;  1TKG A;  5JHB A;  2R2Q A;  1R7S A;  2R2O A;  3IFW B;  4XWT A;  4GIV A;  5D94 A;  3GP7 A;  3P4S B;  3L0W B;  3AED B;  1SE4 A;  1WR1 A;  4K1R B;  5AEK B;  3L08 A;  4HRO A;  3UGB B;  4A90 A;  4MT5 A;  3I9V 1;  2WLB A;  1IGC A;  2KTR A;  4DK5 A;  1PGB A;  3WAN A;  1EF1 A;  4FUL A;  2CJN A;  2PVG C;  3ZNG C;  4IDI A;  5CHF A;  3QQ8 B;  4GSW A;  1TY2 A;  3NS8 A;  3PVL A;  2Y5B B;  4M0W A;  1V86 A;  3V62 A;  4LNF A;  3TBL D;  3U7Z A;  1TS2 A;  3KWV A;  1ZE3 D;  3N9Y C;  1NI3 A;  3DVG Y;  1TTN A;  1E5W A;  4HJG E;  2KC1 A;  3Q3O C;  3DBR B;  2HTM E;  4PYU A;  1C78 A;  3KWL A;  4YSY B;  3RNB C;  3BVZ A;  1C9F A;  1JRO A;  1WRD B;  5HFY A;  4GOC A;  2ZZP B;  2AX5 A;  1DOI A;  2REX A;  1PQS A;  2MW5 A;  1FXA A;  2PPH A;  1T3Q A;  3M95 A;  4EUT A;  2K22 A;  1V6E A;  2N7E A;  5CTR C;  3TUO A;  2L1A A;  3DBH B;  1WJ6 A;  3BZD B;  2W55 A;  2K1F A;  1E8W A;  5D3I B;  2AQ3 B;  4ANX A;  4NY0 A;  2WXK A;  3EHV A;  1J7C A;  1Z5S B;  2RDH A;  3PO0 A;  2KFK A;  1I4G A;  1QZE A;  2GLS A;  3AU4 A;  1M4V A;  3B08 A;  5TSS A;  4OZB A;  4JLC A;  4KV2 A;  2FCM A;  3W5U B;  3V6E B;  4RH6 A;  3SHQ A;  5DPW A;  4BAX A;  3DQV A;  3ZO5 B;  2JY6 A;  1L0X B;  1GPX A;  4GXB A;  3ZRC A;  3I3T B;  2MCN B;  5JZE B;  1ESF A;  4K7W A;  1IBX A;  3RNF C;  3ZRF A;  1SSN A;  3NZU A;  1OEY A;  5IO9 A;  1WI0 A;  3ZDM C;  2KD0 A;  2LUE A;  1F9J A;  1FRR A;  2G3Q B;  5DPR A;  2K3U A;  1VR9 A;  3KVF B;  1KFY B;  1BML C;  1IUE A;  1ET9 A;  1FEH A;  1I7H A;  3PTF C;  4WIP A;  4WUR A;  4WWP A;  3ALB A;  1C4C A;  4FN2 A;  2C60 A;  2K8B A;  4BOZ B;  2XK5 A;  4P7I A;  4II3 B;  4II2 B;  2M19 A;  4TQ0 A;  1WGG A;  4AS1 A;  3IBE A;  1EWC A;  1SE9 A;  4G3X B;  1N63 A;  2BS3 B;  2LAS A;  1WZ3 A;  1QOA A;  4ARC A;  2MLB A;  4MEL A;  3EC8 A;  1JWB D;  1Q5W B;  3ZQ4 A;  2W54 A;  4MGY E;  4EZL A;  1JWA D;  1L4D B;  2MJ3 A;  3H8H A;  3ZXR A;  4NPN A;  5I4D A;  2N9L A;  1DYQ A;  1ISN A;  2NMQ A;  4DXA B;  4M0W B;  3PSE B;  3VH4 B;  2ASQ A;  3WA0 A;  1V5T A;  1RAX A;  1EU4 A;  3VXW A;  4E74 A;  2IND C;  2L76 A;  3MHZ A;  2JWZ A;  2CU1 A;  5KHQ A;  2KDM A;  2UU7 A;  2KHW B;  1Y56 A;  4ASW C;  2D07 B;  2NR2 A;  2WXN A;  4KIK A;  2FCN A;  2W9N A;  1H4R A;  2WXJ A;  3W1S A;  2ZVO A;  1MI0 A;  2GOW A;  1TS3 A;  1F2R C;  4KZC A;  1ZOY B;  5HG2 A;  3AE4 B;  2D3A A;  4XC2 A;  1N61 A;  4ZRI A;  4FJZ A;  3P63 A;  1P7E A;  1BT0 A;  1E0Z A;  3A1Q B;  3HVZ A;  1AYF A;  1A5R A;  4B95 A;  2N9X A;  3QA8 A;  2KMM A;  4NJ6 A;  1P1A A;  2BVC A;  3AMZ A;  4KSL C;  2I2Y A;  4IM3 A;  5DPT A;  1XLO A;  4R3D A;  1RWS A;  3ZJT A;  1WX9 A;  3N1Z C;  1TYG B;  4C4V A;  1QOB A;  4RGT A;  2GBJ A;  4H2A A;  3BY4 B;  4XX5 A;  5IKC M;  2RDB C;  1WY8 A;  3PZD A;  3CF6 E;  3Q2A C;  1R4M I;  2BW2 A;  1FD6 A;  3B2G A;  1VDV A;  3BIN A;  3W1S C;  2PLP A;  4TUU A;  4PS7 A;  4WH4 A;  4DWF A;  4RF1 A;  1YQB A;  2GB1 A;  4KSK C;  1L6V A;  2YLM A;  4S0R A;  3PRZ A;  4RGM A;  3WAO A;  3X0W A;  3AEA B;  2VZK D;  2WWZ A;  4Q2J A;  1PGA A;  3B1L X;  1CMX B;  3OG5 A;  3RNC C;  4G50 A;  4I6P A;  4A20 A;  4XDD A;  1WXV A;  2EMT A;  4MSM B;  4TKN A;  1V1P B;  2IGG A;  1AN8 A;  4W9H A;  2XNA C;  2LGX A;  3MC9 A;  3RZF A;  4LNN A;  1WWT A;  1FCC C;  1ZDX A;  2NBU A;  3BVM A;  2LJ5 A;  3HRD D;  2LGD A;  3C0R B;  1N62 A;  2LVP A;  1UEL A;  1SJH D;  2LGY A;  2JSV X;  2MHJ A;  3K9O B;  1ZXI A;  2K25 A;  2O6V A;  2YEP F;  4C4V B;  3ML9 A;  2N9P C;  5J18 A;  1IPG A;  4HKZ E;  4JX1 C;  2J42 A;  5C23 A;  2IJ0 A;  3MC0 B;  4W9J A;  5JHA A;  1XF5 L;  4P16 A;  3U52 E;  3Q3N C;  2KOX A;  4GU2 A;  2INC C;  1ENF A;  4P1B C;  1PDX A;  2ICI A;  1RLF A;  2KJH B;  1EWY C;  1NI2 A;  1B9R A;  2DEN B;  3RNG C;  1T0R C;  3Q6B A;  4LTU A;  4MM3 A;  4XYC A;  2N9E B;  3TEY A;  2FBW B;  3NY5 A;  2EEL A;  2MBQ A;  1WJU A;  1PFD A;  2KQ7 A;  2E3T A;  5DCN A;  2YVC A;  1UF0 A;  3J9C A;  3FAH A;  3KQ4 A;  2KT7 A;  3QX1 A;  2LXC A;  2DWQ A;  1TJE A;  3V6C B;  2RGF A;  2KDI A;  2PEA A;  1VZ8 A;  1TS5 A;  4IUM B;  2IO3 B;  2LHE A;  1SIF A;  5HHD G;  3TCA A;  2LJI A;  1RM6 C;  2L0T A;  2AEH A;  3VQI A;  5IA7 A;  4HCP B;  1SJE D;  5FK9 C;  3M3J A;  2KAC A;  3NZ3 A;  3UIO B;  4XDC A;  2K6D B;  1QOG A;  3VTU A;  4M01 A;  2DAJ A;  3Q3M C;  3GE8 C;  4RNA A;  1ZPS A;  2O6V D;  1IGD A;  1E8X A;  1FM0 D;  1SXT A;  3N30 A;  5IOI A;  1YN4 A;  2WQY B;  5T8I A;  3EUB 2;  3RYT A;  1OQY A;  2OHF A;  4OVU A;  1GC7 A;  2KLC A;  1TGZ B;  3L16 A;  4XGA B;  1Q10 A;  2JRH A;  4ZRQ A;  2FNJ B;  3DWG C;  2X8X X;  1I42 A;  5C1Z A;  2MQJ A;  2KFK B;  2K8C A;  3B2F A;  2ZPN A;  2HD5 B;  2MJE A;  3BII D;  2NTS A;  1TKE A;  3OJ3 A;  2KK8 A;  2FUG 1;  2KO3 A;  2LUM A;  1K53 A;  1NBF C;  5J2R A;  3ZXV A;  2DX5 B;  4TSS A;  4A3O A;  4BBN C;  3NG0 A;  4ZRP A;  3PHX B;  3TEX A;  1RFA A;  1V97 A;  2CJO A;  1C3T A;  2JZZ A;  1DGJ A;  5BMH A;  2KWV B;  1WE7 A;  2N1W A;  3PV1 A;  4MM3 B;  3TMP B;  2BTE A;  1YQ3 B;  2Z8L A;  1XQQ A;  5BMG A;  3R8B A;  5EDS A;  4A8X C;  1YOV B;  3KYD D;  2M0A A;  2ZCC A;  1T0Q C;  3ECI A;  2JXX A;  1C4P A;  2QIL A;  2OOB B;  2MBO A;  1TBE A;  1RYJ A;  1V81 A;  3ZIM A;  5AUI A;  2M0X A;  2WXI A;  1JRP A;  4FLH A;  3FC4 A;  4IC7 B;  3LXF A;  3DHH C;  4I6N B;  3H9D A;  4IOI E;  4ZHP A;  4A3P A;  4M00 A;  3KUD B;  2J53 A;  3M63 B;  2G45 B;  4AP4 C;  2WXH A;  3EA6 A;  2AL3 A;  2RPV A;  4C80 A;  5G55 A;  3Q8A A;  1D3Z A;  4RM8 A;  2KAN A;  2KDF B;  5C3J B;  5TR5 A;  1WYG A;  3R66 C;  1N5W A;  4B6W A;  2VH1 A;  1V8C A;  3NUH B;  2DZK A;  3PPA A;  1WFY A;  1LGR A;  1CQV A;  3AXC A;  4N58 A;  2Z0D B;  2BB6 A;  1WRI A;  4DDG D;  3AH7 A;  3ZGZ A;  1LQB A;  1E8Z A;  3LJ3 A;  4FJY A;  1XXG A;  4W9C A;  4CHK A;  1N5X A;  3A1Q A;  2V4I B;  3URY A;  4BBN F;  1ZKH A;  3DHI C;  1HQR D;  4B0E A;  4OVZ A;  2KWC A;  2IO2 B;  4LDT B;  1L0Y B;  1J8C A;  3OAW A;  4NAW B;  2N4F A;  2V3P A;  5LXH A;  5GMV A;  3M62 B;  2MP2 A;  2WDT B;  3QWZ B;  2UWQ A;  1Q1O A;  2WYQ A;  4G11 A;  1AWD A;  5DPS A;  1I4P A;  2I38 A;  5AZF A;  1WMH B;  3R3M A;  2GBK A;  1P0R A;  1LO5 D;  2MJD A;  3AE1 B;  1JW9 D;  1KH0 A;  3FKY A;  3GZN B;  3PRP B;  2BWE S;  4DXF A;  1V5O A;  5EE3 A;  1FXI A;  3O65 B;  2FID A;  4YWG G;  2PVO D;  2D3B A;  3DBL B;  2MBE A;  3DPD A;  2IGD A;  2MRP A;  2BB5 A;  4DQO C;  1C1Y B;  2PIA A;  3EGR A;  2LEK A;  4BZA A;  1YD8 U;  5G5H A;  5JH5 C;  1HEZ E;  2XK5 B;  1GUA B;  3AUL A;  1PUT A;  5E6N A;  3APF A;  3V3X A;  4EFO A;  2OJR A;  2RD0 A;  3S2A A;  1WGH A;  3EFU A;  4HEA 1;  1YIW A;  1Y8R C;  1WM2 A;  4K3C A;  4MJS A;  1TZO A;  2LXA A;  4J6I A;  4YT0 B;  2AYO B;  4ICU A;  4L23 A;  3VUY A;  1WGR A;  3VR9 B;  5D7G A;  1WX7 A;  3DBL I;  3H6N A;  2JT4 B;  4PK1 A;  3P42 A;  1Q0W B;  2W82 A;  4WAA A;  3KH0 A;  3WAP A;  4GDK A;  3GS2 A;  4W9G A;  4CQN A;  1ZUD 2;  3IAS 1;  2DAF A;  2LVQ A;  3MJ5 A;  4IG7 B;  1B1Z A;  2L7R A;  2N7J A;  3ZDT A;  2KJR A;  2CHW A;  4NAW A;  3JVZ X;  1XD3 B;  2KTR B;  4US9 A;  1STE A;  3TEW A;  2ZEQ A;  4ACF A;  1GC6 A;  1YJ1 A;  2KVZ A;  3BK2 A;  2DYO A;  2KLG A;  3T3O A;  1FRD A;  4MSQ B;  4GB9 A;  3A4S C;  4W9E A;  2M1M A;  4G0N B;  2INP E; 
#chains in the Genus database with same CATH homology
 2JRI B;  2WWZ A;  3H7S A;  3B1L X;  3ZVV A;  1UGM A;  1CMX B;  3A4R A;  3QCA A;  4G50 A;  4I6P A;  2J0K A;  4A20 A;  3PLV A;  1WXV A;  3ZNZ B;  4F8C B;  2EMT A;  3VUW A;  2DYB A;  4MSM B;  2IZV B;  4LJP B;  4TKN A;  4CO7 A;  2GBN A;  4HDO A;  5L83 A;  3Q3J A;  3QAQ A;  4W9H A;  2KNB A;  4ANU A;  2LGX A;  4FHJ A;  3WIM A;  2LVO A;  3A9K B;  2VRR B;  3CMM B;  1WM3 A;  3RZF A;  3HM3 A;  2C7H A;  1ZGU B;  2EKE C;  1WXM A;  2IY1 B;  4EZJ A;  2NBU A;  4IM2 A;  4IW0 A;  3U7D A;  4ANV A;  4GDL B;  2LJ5 A;  3L13 A;  3X23 A;  1FXT B;  1V2Y A;  4E71 A;  3NHE B;  1L7Y A;  1WYW B;  2LGD A;  3C0R B;  5D2M B;  2AWT A;  4KDL B;  1G6J A;  4W9I A;  3T8M A;  2LVP A;  1UEL A;  2KMC A;  2LGY A;  5L95 C;  2G4S A;  1P9D U;  1T0Y A;  4I6L B;  3KUZ A;  3X0W A;  5D6J B;  3PLU A;  2M8S A;  2IBI B;  1HE8 A;  3K9O B;  2FIF A;  2A5U A;  2KWU B;  3DOW A;  3QIJ A;  2D10 A;  2K25 A;  2O6V A;  3H7P B;  4TV3 A;  3RT3 B;  4E3C A;  4BOS C;  4TQ1 A;  3ML9 A;  4HCN B;  4MEM A;  3PT2 B;  4BFR A;  2N9P C;  2GBM A;  3AU5 A;  5J18 A;  3V61 A;  1IPG A;  4MGK E;  3DCG A;  1NDD A;  2KTF A;  4JGH B;  4LJO B;  3TL5 A;  3OJ4 B;  4K7U A;  4NNJ B;  5C23 A;  1WH3 A;  4MGI E;  4W9J A;  1KLV A;  5JHA A;  3CSF A;  3L10 B;  3KUC B;  2I1J A;  1IP9 A;  2KOX A;  1OEY J;  2RSU A;  1EUV B;  4GU2 A;  2GBR A;  2MBH A;  2HTH A;  3D32 A;  4EEW A;  1WF9 A;  2Z59 B;  4WQO B;  1E90 A;  2MBB B;  1UZX B;  1RLF A;  2KJH B;  2NS5 A;  2FCQ A;  2RPQ A;  3ONS A;  1NI2 A;  1V49 A;  2J0M A;  2DZI A;  5E6O A;  3UIP B;  5HKH A;  3ZW3 A;  2DEN B;  4RMA A;  2CKH B;  4MM3 A;  2FCS A;  2N9E B;  2ZNV C;  1H8C A;  3UF8 A;  3NY5 A;  2MBQ A;  2WX0 A;  3QAR A;  1WJU A;  2NBW B;  3EEC A;  2ZPY A;  3ENE A;  3V60 A;  2KQ7 A;  2LZ6 A;  3P2B A;  4F1S A;  5DCN A;  2BKR B;  2YVC A;  2ZCB A;  2CHZ A;  2DYM A;  2IO0 B;  3SD5 A;  3VUX A;  3SU8 X;  5LLI A;  2FUH B;  4FA6 A;  2G4D B;  1J0G A;  4JQW C;  2NPT A;  3QX1 A;  2LXC A;  4PS3 A;  3V6C B;  2RGF A;  2J7Q B;  2KDI A;  2PEA A;  2LD9 A;  1AAR A;  2C7M B;  2HJ8 A;  3DVN U;  4IWQ A;  3RCZ A;  4GGQ A;  4IUM B;  4AUQ C;  4EZK A;  4MDK E;  2IO3 B;  1SIF A;  1SGH A;  3B0A A;  3TCA A;  2MSE D;  4GDK B;  3PS6 A;  3VVW B;  2L0T A;  2AEH A;  3DBS A;  3VQI A;  5IA7 A;  4HCP B;  4DBG A;  3HHM A;  5CX3 A;  4EOY A;  2I1K A;  4CYE A;  2V3S A;  1LFD A;  2JZ3 B;  3ZTD A;  1WXS A;  3M3J A;  2ZNV B;  3RUL A;  3VTW A;  1YX6 B;  3UIO B;  2BYV E;  3RUI B;  3R7R A;  4WJO A;  2K6D B;  2MWS B;  4WJN A;  4EKU A;  1WR6 E;  3VTU A;  2L05 A;  1GG3 A;  2DAJ A;  3A9K A;  2L0F A;  1E7U A;  1UD7 A;  2L00 B;  3PRE A;  3ZKJ C;  4AWJ A;  2O6V D;  5JHB A;  1E8X A;  1UBQ A;  2R2Q A;  2R2O A;  3IFW B;  4GIV A;  1P3Q U;  5D94 A;  4BKT A;  3N30 A;  3A33 B;  3L0W B;  4ANW A;  1WR1 A;  4K1R B;  5AEK B;  3K9P B;  3L08 A;  3RYT A;  3UGB B;  1OQY A;  4W9L A;  3W1Y A;  2KVR A;  4OVU A;  1GC7 A;  2KLC A;  2Z0E B;  1TGZ B;  4HXD A;  3L16 A;  1RRB A;  1WXA A;  2KTR A;  3PRM B;  2DZM A;  2UYZ B;  3QJZ A;  4DK5 A;  4DHJ D;  2JRH A;  4WWO A;  4ZRJ A;  4NQK E;  4WJP A;  4AJW A;  2FNJ B;  2PJH A;  4LDT D;  3WAN A;  1EF1 A;  4FUL A;  4FBJ B;  5C1Z A;  2MQJ A;  4N9F 4;  1I42 A;  3ZNG C;  2KFK B;  4JIO U;  3IG3 A;  2K8C A;  4DHZ B;  5CHF A;  1ZW7 A;  3QQ8 B;  1IYF A;  1GJZ A;  4GSW A;  5E6P A;  3UQB A;  1M94 A;  3NS8 A;  2ZPN A;  2KX0 A;  3PVL A;  2FAZ A;  2Y5B B;  1TZ1 A;  3ZNH B;  2HD5 B;  4ZRK A;  1V86 A;  4HPL B;  4HLE A;  3DBR I;  3V62 A;  1OGW A;  2DHZ A;  2KQS A;  3TBL D;  3ZUN A;  3OJ3 A;  2KK8 A;  1UH6 A;  3DVG Y;  1TTN A;  1E5W A;  4MH0 E;  4NQL B;  2KC1 A;  2KO3 A;  1U4A A;  3DDC B;  1NBF C;  5J2R A;  4BKG A;  1WE6 A;  1S3S G;  3T9L A;  2DX5 B;  4B9K A;  4A3O A;  4PYU A;  4K7S A;  4KZ0 A;  4BBN C;  3PHX B;  4ICV A;  1RFA A;  3SDL C;  4GDL A;  4GMV A;  1C3T A;  2JZZ A;  3IVF A;  1WRD B;  3OLM D;  2KWV B;  3QHT A;  1WE7 A;  4GOC A;  1YX5 B;  4BVU C;  2KXJ A;  2ZZP B;  2N1W A;  1WJN A;  2XEW A;  3PV1 A;  4XZ4 A;  2JVC A;  3TMP B;  2REX A;  1PQS A;  2BYF A;  1XQQ A;  4KIK B;  2MW5 A;  3JYU A;  5IAA C;  2PPH A;  5EDS A;  3M95 A;  4EUT A;  2NCN A;  2N7E A;  1V6E A;  2BWF A;  3KYD D;  4HK2 A;  4ZDV A;  2ZCC A;  5CTR C;  1VD2 A;  5AZG A;  3Q3F A;  3ECI A;  3WAM A;  2JXX A;  1WGD A;  2NBV B;  1WJ6 A;  2KDB A;  1LM8 B;  1KM7 A;  5LXI B;  2K1F A;  2IYD B;  1E8W A;  2CS4 A;  2OOB B;  4ANX A;  2MBO A;  4NY0 A;  4DHZ E;  3EHV A;  4K81 A;  3ZTC A;  2LI5 A;  1TBE A;  4FAD A;  1V81 A;  3ZIM A;  3JSV A;  1Z5S B;  3WAL A;  1WZ0 A;  2KFK A;  2M0X A;  3A9J B;  4FLH A;  1QZE A;  2KJ6 A;  2L3Z A;  3AU4 A;  2KX3 A;  2BF8 B;  4OVV A;  3B08 A;  3KYC D;  3RZW C;  4IC7 B;  3QC8 B;  5CHV C;  3NZS A;  4JLC A;  4KV2 A;  4I6N B;  2FCM A;  2N1V A;  3H9D A;  3HM6 X;  3RD2 A;  4A3P A;  3V6E B;  1VCB A;  3APD A;  2CR5 A;  1K8R B;  1GNU A;  3SHQ A;  5DPW A;  2C9W B;  3KUD B;  3M63 B;  3DVN V;  2G45 B;  4AJY B;  2KMA A;  4AP4 C;  3DQV A;  3TJP A;  4MGZ E;  3L54 A;  1LXD A;  5BO4 B;  2AL3 A;  3ZO5 B;  2JF5 A;  2JY6 A;  4GXB A;  2CHX A;  5G55 A;  3ZRC A;  3I3T B;  2AL6 A;  2MCN B;  2DZJ A;  5JZE B;  3AI5 A;  1D3Z A;  4RM8 A;  4K7W A;  4M8N A;  4WWN A;  3ZRF A;  3NZU A;  1OEY A;  2KAN A;  2KDF B;  3DVG X;  5TR5 A;  3R66 C;  2JUO A;  1WI0 A;  4MJS B;  4B6W A;  3CST A;  4X57 B;  2KD0 A;  2LUE A;  2KDE B;  1F9J A;  3ZDM C;  4DDI D;  2DZK A;  2G3Q B;  5DPR A;  3PPA A;  2EMS A;  1WFY A;  4KDI C;  3KVF B;  3MTN B;  2MA9 B;  1XT9 B;  3AXC A;  2MX2 A;  4IWP A;  3GOE A;  2KKC A;  2Z0D B;  2BYE A;  3NOB A;  4DDG D;  3A9J A;  3PTF C;  3ML8 A;  2L8J A;  4WWP A;  1LQB A;  1E8Z A;  3LJ3 A;  3ALB A;  4FJY A;  4FN2 A;  2C60 A;  4W9C A;  4CHK A;  2K8B A;  4BOZ B;  2BKF A;  3A1Q A;  2XK5 A;  3HIZ A;  2KN5 A;  4P7I A;  4BBN F;  4II3 B;  4II2 B;  4TQ0 A;  1WGG A;  1ZKH A;  3IBE A;  3JW0 X;  1SE9 A;  1S1Q B;  1MG8 A;  2KWC A;  4G3X B;  2IO2 B;  4LDT B;  3LDZ E;  2LAS A;  1E7V A;  3OAW A;  1J8C A;  1WZ3 A;  4NAW B;  2MLB A;  2N4F A;  4YL8 A;  4MEL A;  1P98 A;  5LXH A;  5GMV A;  3M62 B;  2C7N B;  2MP2 A;  3EC8 A;  4KVG B;  5FR6 A;  1EF5 A;  2WDT B;  3QWZ B;  3ZLZ A;  2BPS A;  2UWQ A;  1Q1O A;  3HK0 A;  1Q5W B;  5AZH A;  2IY0 B;  2WYQ A;  4MGY E;  3N32 A;  3QK0 A;  4RM9 A;  4G11 A;  3ZNI D;  4EZL A;  4F7Z A;  5DPS A;  2D3G A;  5AZF A;  1WMH B;  4FJV B;  2GMI C;  3R3M A;  4NPN A;  2GBK A;  1P0R A;  4W9F A;  4HWI B;  3PRP B;  2BWE S;  1ISN A;  4ZYN A;  4URK A;  4FHK A;  4PS8 A;  1Z2M A;  4DXA B;  1V5O A;  4M0W B;  1WJ4 A;  2K6Q A;  1KJT A;  3PSE B;  3VH4 B;  2ASQ A;  2BGF A;  3WA0 A;  1V5T A;  2PE6 B;  1RAX A;  3O65 B;  3VXW A;  2FID A;  4E74 A;  2NVU I;  2L76 A;  2KFJ A;  2JWZ A;  4LCD E;  2CU1 A;  1X1M A;  5KHQ A;  2RR9 A;  4NJ7 A;  2LRW A;  2KHW B;  4ASW C;  2MBE A;  3DPD A;  2D07 B;  2NR2 A;  2MRP A;  2LWP A;  4KIK A;  2FCN A;  2W9N A;  1H4R A;  3VH3 B;  3APC A;  1WIA A;  1C1Y B;  3TIX A;  3R7Q A;  3MJW A;  3W1S A;  3VAW A;  1WGY A;  4AOF A;  2ZVO A;  5G2N A;  2GOW A;  1YD8 U;  2M4N A;  5JH5 C;  3UIN B;  4KZC A;  4WJQ A;  2XK5 B;  3VDZ A;  1GUA B;  3AUL A;  2O6V B;  3H7P A;  3GZN I;  4JL9 A;  5E6N A;  3APF A;  4EFO A;  2OJR A;  2RD0 A;  4HJK A;  5CHW A;  3S2A A;  1WGH A;  3EFU A;  4XC2 A;  2JPH A;  1UBI A;  2N7D A;  3N3K B;  2O2V A;  1WMH A;  2D2Q A;  4FJZ A;  1R4N I;  1YIW A;  4HDQ A;  4M8M A;  4ZRI A;  2LRU A;  1L2N A;  2IO1 B;  1Y8R C;  1BT0 A;  2PE9 A;  1WM2 A;  3VHT C;  4MJS A;  2NPT B;  2LXA A;  1V80 A;  4J6I A;  2K8H A;  2AYO B;  3A1Q B;  2MP2 B;  4ICU A;  3VUY A;  2A4Z A;  1WGR A;  3IHP C;  5D7G A;  1V9J A;  1A5R A;  1WX7 A;  3DBL I;  3U8Z A;  3H6N A;  3MHS D;  2JT4 B;  3DBH I;  4B95 A;  2N9X A;  3QA8 A;  3JSV B;  1Q0W B;  2KZR A;  2C5L C;  3PHW B;  1OTR B;  4WAA A;  3PGE A;  4HVB A;  3KH0 A;  1KOT A;  4DHJ B;  4NJ6 A;  3WAP A;  5J17 A;  1P1A A;  4GDK A;  4IWO A;  2B3A A;  4W9G A;  3L17 A;  4KSL C;  1J19 A;  2DAF A;  4IM0 A;  4IM3 A;  2LVQ A;  4GN1 A;  5DPT A;  4W9D A;  1WX9 A;  2K39 A;  4IG7 B;  2GBJ A;  4HPM B;  2L7R A;  3ZDT A;  2HE7 A;  2D11 A;  2KJR A;  4BKS D;  2CHW A;  3BY4 B;  1WX8 A;  3JVZ X;  2J0J A;  4NAW A;  4XX5 A;  2M17 A;  1WY8 A;  1XD3 B;  2KTR B;  3PZD A;  2ZJD A;  3CF6 E;  1R4M I;  2ZEQ A;  2V4L A;  3UQA A;  3KW5 B;  4PYZ A;  3BIN A;  1GC6 A;  3VTV A;  3W1S C;  1YJ1 A;  2KC2 A;  4TUU A;  4W9K A;  2O2V B;  2DYO A;  1EO6 A;  2QHO A;  2V1Y A;  4PS7 A;  2KLG A;  3VFK A;  3H1U A;  5KHO A;  4DWF A;  1I35 A;  1YQB A;  4MSQ B;  4GB9 A;  4KSK C;  2YLM A;  2XBB C;  3A4S C;  4W9E A;  3PRZ A;  2ZVN A;  1JRU A;  1E8Y A;  3U30 A;  3WAO A;  2M1M A;  2WX1 A;  4G0N B;  4BKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...