1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23 homolog B
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
4W9FA 3ZO5B 1V81A 4M8NA 2UYZB 4IWPA 3L13A 1WXVA 3PSEB 1TTNA 3P2BA 4LCDE 2KLCA 4OVVA 3H7SA 4W9DA 3CSFA 3DBHI 3KYCD 1VCBA 3WALA 1UH6A 3M3JA 2BWFA 2GBKA 3TMPB 1E8ZA 1V2YA 2JUOA 4KIKB 2KDEB 2MW5A 2GBRA 4WAAA 3EECA 1F9JA 1PQSA 2G3QB 2K8BA 3GZNI 2N1VA 5D7GA 2IO0B 3QHTA 2JXXA 2QHOA 3HM6X 3R7RA 5LXIB 1I42A 3V6CB 2C9WB 2L0FA 2IY0B 4BBNF 1J19A 2IZVB 3A9JA 3L10B 3B08A 3ZVVA 2LGXA 4KSKC 4WWNA 3DCGA 2KQSA 1L2NA 1WX7A 1V86A 5LXHA 3L54A 3QWZB 5JHBA 4MELA 3VUXA 3ONSA 4DHJD 2GBMA 4GDLA 4DDGD 2B3AA 2XEWA 1EF1A 2KNBA 1WZ0A 2M8SA 1WMHB 4BBNC 2K8HA 3PS6A 3KH0A 4DWFA 1HE8A 2FUHB 1OEYJ 2MP2B 2A5UA 3VDZA 4NY0A 3OJ4B 3NY5A 4LJPB 4W9JA 4PS8A 4ZRJA 2FAZA 3WAMA 4EKUA 1RAXA 1TGZB 3ZW3A 2C7HA 4JL9A 4PS7A 2ZZPB 1S1QB 3IVFA 3PHXB 4MH0E 5KHOA 2FCSA 3DQVA 3QA8A 5D2MB 2JZZA 2D07B 2J0MA 3N30A 1SE9A 2KXJA 1LM8B 3H1UA 4DHZB 3EC8A 3M62B 4GGQA 3IHPC 4WJPA 3JW0X 2KWUB 2KDBA 1C3TA 1BT0A 2JWZA 3VAWA 1H8CA 3X0WA 2KD0A 2LXCA 3NS8A 3EFUA 1SGHA 4FJVB 1EO6A 1IP9A 2ASQA 3LJ3A 2BKRB 2CR5A 1V80A 3U30A 3EHVA 3PZDA 3PPAA 2LJ5A 4MSMB 4ICUA 2I1JA 1V6EA 2AWTA 3PRZA 1WF9A 2L8JA 1NBFC 2RPQA 2J0JA 2MCNB 5DPTA 5TR5A 4PYZA 1KOTA 1Y8RC 2KTFA 1AARA 2C7MB 3ZNZB 1EF5A 2DHZA 4A3OA 1WX8A 2BYEA 3KYDD 3PHWB 2LASA 2O2VA 3L08A 3V61A 2KDIA 1ZW7A 2DAFA 4BOSC 5JZEB 2NBVB 1ZGUB 4E74A 4G0NB 4W9LA 2K8CA 4KZ0A 4DDID 4PYUA 4CYEA 5AZHA 3ZNID 4K7WA 1LQBA 3NZSA 2K6QA 4KIKA 4AWJA 3TCAA 2REXA 2IYDB 2FCQA 1P98A 4IW0A 3JSVB 2KWVB 1Q0WB 2LVQA 3TL5A 4GDKA 3A9KA 2KFKB 2RSUA 4W9HA 2L76A 3VQIA 3APCA 3A4SC 1ISNA 2WWZA 3PGEA 4NAWA 4E3CA 4KDIC 1CMXB 1UD7A 4MJSA 4I6NB 4G3XB 5L95C 5E6PA 2IO2B 3UIPB 3DPDA 5IA7A 1R4NI 2KTRB 2ZPYA 2G4DB 4FJYA 5G2NA 2KN5A 2IO1B 4IWQA 3VFKA 4ANWA 1Z2MA 2M1MA 4WWPA 1IYFA 2M0XA 3A1QB 2CS4A 4MJSB 5BO4B 2JT4B 4E71A 5L83A 2A4ZA 3U7DA 1GUAB 2L00B 1WH3A 4F8CB 2N1WA 2KLGA 3ZTCA 4EZLA 3VH4B 2L7RA 2KC2A 4HXDA 1JRUA 1XD3B 1T0YA 2KJRA 3OJ3A 4NJ6A 4EFOA 1V5OA 3KUDB 4HPLB 3V6EB 2MA9B 5JHAA 4M0WB 1RLFA 2KMCA 4I6PA 3VVWB 4BKGA 1P9DU 2N9PC 2DYMA 3NHEB 3QIJA 3S2AA 4CO7A 2C60A 1L7YA 2RR9A 3IBEA 5C23A 2OOBB 3JSVA 1D3ZA 2K6DB 4BFRA 4ASWC 3A4RA 1E7UA 2KFKA 1WFYA 2G45B 3DVNU 3OAWA 4FA6A 4W9KA 5LLIA 2LWPA 1WR6E 2KQ7A 1SIFA 3V60A 2YVCA 4GIVA 1LXDA 3H6NA 2YLMA 3VTUA 2ZJDA 4KZCA 4KV2A 4ANXA 1WXMA 2AEHA 1WM2A 2N9XA 2ZVOA 3PV1A 2V3SA 4EEWA 2M4NA 2RD0A 1QZEA 3ECIA 1WRDB 4II3B 5JH5C 1UBQA 2ZNVB 4N9F4 4FHKA 2BKFA 4NQLB 2KWCA 2L3ZA 4XZ4A 1WE6A 2ZEQA 2D2QA 4LJOB 4TQ0A 1WM3A 4BKSD 3ZIMA 2LVOA 2KJ6A 3M95A 4ANVA 4AUQC 1S3SG 3L16A 4WJQA 2R2OA 3NOBA 2N4FA 3TIXA 4FHJA 2K25A 1OEYA 2UWQA 4IM2A 2K1FA 2WYQA 3UQBA 4FN2A 2XK5B 3DBRI 2MQJA 3HK0A 2LD9A 4GXBA 1Q1OA 5GMVA 1ZKHA 2ZVNA 4DK5A 2O6VB 4DXAB 2KVRA 4NAWB 3ZKJC 1YX6B 1WJ4A 2NPTA 1E5WA 3KUCB 2GBNA 4HDQA 1NI2A 4MGYE 3UF8A 1WX9A 1X1MA 4NQKE 1E7VA 4A20A 4MEMA 4FBJB 3TJPA 4J6IA 2KHWB 3A9JB 4G50A 2R2QA 4CHKA 2MBBB 4K7SA 1IPGA 2JVCA 1OQYA 4XC2A 4MDKE 2EMTA 1LFDA 1YJ1A 3IG3A 1I35A 2NR2A 2WX0A 2IY1B 3C0RB 4BKSA 2WX1A 3L17A 4EOYA 4F7ZA 5J17A 2MWSB 3A33B 1UGMA 3O65B 2KK8A 2PE6B 3ZLZA 1WGGA 4DHJB 3QC8B 1YD8U 3VUYA 1WXSA 3PRPB 2CHZA 3WA0A 1OGWA 2DYBA 2MBHA 2ZCCA 2LRWA 2LGYA 1RFAA 4II2B 5CX3A 4MGKE 2FNJB 1J8CA 2XK5A 5G55A 2KX0A 2MBEA 3UQAA 4TQ1A 1GJZA 1TBEA 3QQ8B 2NVUI 3AULA 5CHVC 4EZKA 2FIDA 1E90A 3PRMB 2LGDA 3RD2A 4I6LB 3U8ZA 3WIMA 3QK0A 1WGDA 3PREA 4YL8A 1P3QU 2D10A 2N9EB 3N3KB 4HWIB 5AZGA 2LUEA 2MBQA 4XX5A 4ZRKA 1WGRA 3X23A 4M8MA 2D3GA 4DBGA 3PT2B 3RT3B 1WMHA 2JF5A 3ZTDA 1WJUA 2DZJA 4HDOA 4JQWC 4OVUA 1UELA 2GOWA 3HM3A 3WAPA 3LDZE 1H4RA 3ENEA 3SHQA 3V62A 3W1YA 3ZDMC 2LRUA 3B0AA 4KSLC 3T8MA 3UGBB 1MG8A 1WJNA 4IUMB 2MX2A 3DVGY 1GC6A 3QCAA 2MBOA 2AL3A 2O2VB 3I3TB 4RM8A 3HIZA 3PTFC 3VXWA 4HVBA 1E8WA 4X57B 5E6OA 3TBLD 3H7PB 2WDTB 1WGHA 2CHXA 2KKCA 3A1QA 4P7IA 3KW5B 1Q5WB 2FCMA 3DOWA 4AOFA 2AL6A 2DX5B 3R66C 4GN1A 4A3PA 3QAQA 1E8XA 1KJTA 3VTWA 3APDA 3HHMA 2BYVE 3BINA 4ANUA 5KHQA 2OJRA 3B1LX 2VRRB 2EMSA 2V1YA 4B9KA 2HD5B 4K1RB 2KJHB 4IG7B 2CU1A 3DBSA 3DBLI 2JRHA 4NNJB 3PLUA 1KLVA 3UIOB 1GG3A 1VD2A 5CTRC 3UINB 3DVGX 3ZUNA 2KMAA 3MHSD 2KANA 1WZ3A 3PLVA 1WI0A 2FIFA 2LVPA 4JGHB 4HJKA 4B6WA 4KDLB 3SDLC 5DPSA 2HTHA 3CF6E 2HJ8A 2NPTB 2RGFA 2XBBC 3ML9A 1GNUA 3SD5A 2DAJA 5D94A 5FR6A 3APFA 5DPRA 1WIAA 2J7QB 3M63B 2KC1A 4FULA 1U4AA 1XQQA 3QJZA 1UBIA 4NJ7A 4TV3A 4WJOA 4ZYNA 2PJHA 4ZRIA 2LXAA 4K7UA 5EDSA 4IWOA 2KDFB 1J0GA 2MP2A 1OTRB 2DZIA 3L0WB 3NZUA 4HK2A 2LI5A 3GOEA 2ZNVC 2V4LA 2BPSA 1WXAA 4RM9A 2BGFA 2C7NB 3RULA 4NPNA 4BKTA 2IBIB 4BOZB 4HLEA 4W9GA 2EKEC 2KTRA 2ZCBA 2I1KA 2NBUA 1G6JA 3WANA 2JY6A 4EZJA 1M94A 5CHWA 5AZFA 3K9PB 4MSQB 3RYTA 1WY8A 3VTVA 4IM0A 1C1YB 2NCNA 4HPMB 3CMMB 3VUWA 2DZMA 2KOXA 2PPHA 4DHZE 2BF8B 3K9OB 3T9LA 5E6NA 3Q3FA 2Z0EB 4HCNB 5IAAC 3SU8X 2AYOB 1NDDA 2CKHB 4GMVA 2KX3A 1WGYA 4BVUC 2KO3A 3KVFB 5HKHA 1K8RB 3H7PA 2W9NA 5J18A 3MTNB 1WR1A 3D32A 4W9CA 4FADA 2PE9A 2M17A 4JIOU 3AU4A 2PEAA 4AJYB 3VHTC 4AP4C 3BY4B 2MLBA 4MGZE 4B95A 4LDTD 4F1SA 3H9DA 2JPHA 2K39A 4JLCA 4PS3A 1GC7A 1V9JA 2GBJA 2BWES 4LDTB 1R4MI 2NBWB 5CHFA 5D6JB 4FJZA 2BYFA 3AI5A 3PVLA 1RRBA 1EUVB 3RUIB 1UZXB 1V49A 3ZNGC 3ALBA 4GDLB 1Z5SB 2GMIC 3QX1A 3R3MA 3A9KB 4WJNA 5DCNA 2N7DA 2HE7A 4GSWA 2LZ6A 4WQOB 3WAOA 1E8YA 3IFWB 2C5LC 2DENB 2KFJA 4MGIE 3R7QA 2MRPA 3MJWA 2G4SA 3W1SC 2L0TA 2CHWA 3CSTA 4IM3A 2FCNA 3N32A 4GU2A 1WE7A 3QARA 4WWOA 4AJWA 1TZ1A 4GB9A 3ZDTA 2DZKA 2O6VD 4KVGB 4W9EA 2IO3B 3ZNHB 3JYUA 2Z0DB 1P1AA 4FLHA 3W1SA 2Y5BB 5C1ZA 2O6VA 2ZPNA 4HCPB 4ZDVA 2D11A 1YQBA 1XT9B 3DDCB 4MM3A 1YIWA 3ML8A 3RZFA 2NS5A 2Z59B 2DYOA 5J2RA 3OLMD 4W9IA 3Q3JA 4ICVA 2N7EA 4GDKB 4K81A 5DPWA 2KZRA 2J0KA 4RMAA 4EUTA 1KM7A 4G11A 1WJ6A 3ZRCA 4TKNA 1V5TA 3JVZX 5AEKB 4URKA 1FXTB 1YX5B 2JZ3B 3AXCA 3VH3B 3RZWC 1A5RA 1P0RA 3KUZA 3AU5A 4GOCA 1WYWB 2JRIB 4TUUA 2MSED 3DVNV 4IC7B 3RCZA 3ZRFA 2L05A
chains in the Genus database with same CATH superfamily
3ZO5B 2V3PA 3BVMA 3L13A 5EE9A 1TTNA 3H7SA 2KT7A 2GBKA 1QT9A 1FXAA 2N1VA 1I42A 2L0FA 4L2YA 1J19A 2IZVB 3B08A 2UU7A 3ZVVA 1L2NA 3DCGA 3W2DA 5JHBA 1BUIC 2SAKA 3ONSA 4GDLA 4DDGD 2J52A 2WXOA 3Q3OC 1HXYD 1HE8A 1KF6B 1STEA 4YTMB 1V97A 1KLUD 4NY0A 3NY5A 4JPSA 2B76B 2FAZA 2JYEA 1FCCC 1TZOA 3ZW3A 4IKGA 4IOIE 3QA8A 2QEJC 3IT4B 1LM8B 4DHZB 1C3TA 5C2TB 1PDXA 1IP9A 2ASQA 4A9AA 1T3QA 2BKRB 2CR5A 3EHVA 3PZDA 1EU3A 4DXGA 2HDEA 4C4VA 3KQ4A 4HEA1 2G1EA 4PYZA 1AARA 2KAJA 3ZNZB 2NTTA 2DHZA 1ZDVA 4A3OA 3IXSA 2H88B 3PHWB 2LASA 4BOSC 4OZBA 1KLGD 4DDID 4PYUA 5AZHA 4N58A 3ZNID 1VZ7A 4KIKA 3NZSA 1TKYA 1FMAD 1MVKA 1JWUD 3JSVB 3TL5A 3EGRA 3A9KA 2KFKB 4W9HA 1N5WA 2L76A 3VQIA 1GPXA 2MH7A 1C4PA 1I4RA 3VR9B 5L95C 2IO2B 1GOZA 1R4NI 3TEYA 3SFDB 1YQ4B 2M0XA 3A1QB 3DBRB 4XWTA 2JT4B 5L83A 2A4ZA 1ACCA 2KLGA 1EU4A 2WXPA 1SEBD 3RN9C 2L7RA 1C76A 1JRUA 1YOVB 2KJRA 4H2AA 4NJ6A 1R4NB 3KUDB 4BKGA 2N9PC 2DYMA 1XXGA 2RDHA 1YJJA 3JSVA 3URYA 3WCQA 3A4RA 3Q69A 2KFKA 4W9KA 1J7AA 1SIFA 3V60A 3P4PB 4GIVA 1LXDA 2YLMA 3TSSA 4P1CC 4ANXA 1WXMA 3GZNB 2WXFA 3ECIA 5JH5C 1YMHE 4FHKA 2WXGA 3P4QB 4XZ4A 2ZEQA 4OHJA 1WM3A 2W3RA 3M95A 4WJQA 2R2OA 1I4XA 1VJKA 4FHJA 2UWQA 4IM2A 1BXTA 3AH7A 4XDCA 3UQBA 4FN2A 4US8A 2XK5B 3DBRI 4MACA 2O6VB 3ZKJC 1YX6B 1FIQA 3U2SC 2E6XA 3KWVA 4HDQA 2WU5B 2K9XA 4MGYE 5AUIA 2KMMA 5MPOA 1WXQA 1MHHE 2RPVA 1YJ1A 3IG3A 3DHHC 2INDC 3ZYYX 2WX0A 2WS3B 3OWEB 4EOYA 5J17A 4F7ZA 1XEEA 2KK8A 3ZJVA 4OZCA 3AN1A 2MJ3A 2DYBA 1UGJA 2MBHA 2ZCCA 3MHZA 2LGYA 2QJLA 1CK1A 1J8CA 4MGKE 4RGMA 2XK5A 5G55A 2KX0A 2DNFA 4TQ1A 1TBEA 3QQ8B 1TS5A 3AE5B 3RNFC 1GB4A 1SF0A 1JW9D 2W3SA 3AE3B 1XLPA 2LGDA 2IGGA 3PREA 4KX6B 2D10A 1NVID 4HWIB 3RNCC 2MBQA 2V3NA 2WXNA 3ZTDA 1IUEA 1WGKA 1VZ6A 3DWGC 1UELA 3HM3A 1H4RA 2PW9A 3ZDMC 3RNBC 4BAXA 1FD6A 1TY0A 1T5XD 4IUMB 1VDVA 2MBOA 4HVBA 3H8HA 4X57B 1WGHA 2BS4B 3BYYB 2W54A 4YXDB 2PMVA 4WH4A 4M01A 1YQ3B 2DX5B 4OVZA 1K53A 4A3PA 3Q3MC 1E8XA 4HROA 1KJTA 3V05A 3APDA 5TSSA 2BYVE 3IAM1 3VTWA 4ANUA 4K1RB 3Q14C 4IG7B 2CU1A 3DBSA 3TEXA 2JRHA 1JROA 2IJ0A 3PLUA 1UF0A 3UINB 3I57A 4HJKA 1KH0A 2NPTB 1EWCA 2RGFA 1FXIA 4MT5A 2N7JA 2LMCA 2JQRB 3APFA 3Q8EA 2WXIA 3QJZA 4TV3A 4ZYNA 3MC0B 2ZNVC 2BPSA 1FRDA 4KGSA 3RULA 4HLEA 4NPNA 4BKTA 4YT0B 2PVGC 2EKEC 1BMLC 4HJGE 2WXJA 2NBUA 1UUPA 4FXCA 4HPMB 2PPHA 2BF8B 1EM7A 4ARIA 2KWDA 1K8RB 1WR1A 2PTLA 4W9CA 3BWUD 1QQRA 5FKAC 5GXGB 4JIOU 2LEKA 4UDUC 1MJDA 3BY4B 3VR8B 4JLCA 1V9JA 4C00A 3NVVA 2NBWB 5CHFA 3AI5A 3PVLA 1RRBA 1EUVB 1SJHD 2FE8A 3ALBA 5IOIA 2WDQB 1JWBD 3R3MA 1QOAA 3MFGA 5DCNA 1ZXIA 2HE7A 2N7DA 4WQOB 1E8YA 4C4VB 4C7YA 4ZRPA 4ZYSA 1MFWA 2KFJA 5H8YE 3R7QA 2MRPA 3MJWA 2CHWA 3DBLB 1D4BA 1ZPSA 1T0SC 4GB9A 1MG4A 4KVGB 2J42A 4FLHA 3W1SA 5C1ZA 4ZDVA 5HI1A 1XT9B 1WWTA 5IO9A 2M19A 2N7EA 3GB1A 4GDKB 2KZRA 1HEZE 2J0KA 4RMAA 4EUTA 4NJCA 1XO3A 3U52E 1FXTB 3HRDD 3VH3B 1ZUD2 2L05A 4M8NA 2JX5A 1CQVA 3P2BA 3DBHI 1VCBA 3WALA 1UH6A 3AE2B 1XLOA 3TMPB 1E8ZA 5LNK1 1V2YA 2JUOA 2KDEB 2MW5A 3P42A 3R7RA 1J0GA 2V0GA 5LXIB 3HM6X 3V6CB 4WURA 4KKJA 2IY0B 4BBNF 3L10B 2L83A 4ARCA 5IN7A 2LGXA 4KSKC 2KQSA 1V86A 1B9RA 4DHJD 3LXFA 3OG5A 1TS4A 1EF1A 1NEKB 2KNBA 2K8HA 3PS6A 2A5UA 4LJPB 4XE0A 5EE3A 2C7HA 4LK0M 3IVFA 4MH0E 3AEGB 2FCSA 3DWMA 5D2MB 2L1AA 3N30A 2KXJA 3EC8A 4GGQA 4WJPA 1C77A 3X0WA 2KD0A 3NS8A 4FJVB 1EO6A 3U30A 3RNEC 2LJ5A 4MSMB 4ICUA 1WF9A 3Q8FA 1VRAB 1Y8RC 2C7MB 2TSSA 1QLBB 3P63A 2O2VA 3L08A 3V61A 2KDIA 2DAFA 2NBVB 1ZGUB 2QILA 2QMTA 4W9LA 2ZW0A 1ZXHA 1N61A 3EFCA 3TCAA 3HUIA 2IYDB 3ZJUA 1Q0WB 4BZAA 5D3IB 2RSUA 3Q8AA 2N9KA 3IAS1 5HHDG 1ISNA 4E3CA 4ACFA 2DWQA 1JMLA 4MJSA 4I6NB 3B2FA 5E6PA 2K5PA 2BQQA 3Q6BA 1SIJA 3N1XC 2BW2A 3U7ZA 4RFBA 5IA7A 3Q3NC 4LNOA 1QOGA 2G4DB 4FJYA 1J7CA 2KN5A 2IO1B 2W55A 2M1MA 3BVZA 4WWPA 2CS4A 4E71A 2VZKD 3U7DA 1GUAB 3FC4A 1WH3A 4EZLA 2KC2A 3PZ7A 3Q8CA 1T0YA 4EFOA 1RFKA 2LJIA 5JHAA 4L23A 2KDMA 4M0WB 3VRBB 4C56C 1I7HA 3NHEB 4CO7A 2C60A 1XF5L 3IBEA 2K6DB 2QC8A 1E7UA 1V1OA 4YTNB 5LLIA 2OJWA 3H6NA 3VTUA 2ZJDA 2N9XA 3PV1A 2M4NA 2RD0A 3P1MA 1UBQA 2ZNVB 4N9F4 4NQLB 2Y5CA 4TQ0A 2BS2B 1F77A 2KJ6A 1OFFA 3L16A 4A6QA 1DYQA 2K25A 1OEYA 2K1FA 2WYQA 1WRIA 3HK0A 4GXBA 2WXMA 4DK5A 3B9JA 1Y56A 4NAWB 4M0WA 1WJ4A 2NPTA 1RM6C 1E5WA 3KUCB 2GBNA 1NI2A 2LFIA 1WX9A 1L0YB 2KQ4X 3GP7A 4J6IA 2WXKA 2KHWB 3A9JB 2R2QA 1IPGA 4LNNA 2EMTA 1LFDA 2M56B 2IY1B 3C0RB 3L17A 2MWSB 1JWSD 1UGMA 3O65B 4DHJB 3VUYA 1WXSA 4JX1C 3WA0A 1L0XB 5CX3A 2FNJB 3AEAB 3UQAA 2ONQA 2LUMA 4HKQA 2NVUI 3AULA 5CHVC 4XGAB 3I5JC 1E90A 3PRMB 1K50A 4I6LB 3U8ZA 3QK0A 1P3QU 2N9EB 3N3KB 1Q10A 5AZGA 4ZRKA 4DXFA 2D3GA 1WJUA 2DZJA 4HDOA 4JQWC 3WAPA 1PUTA 3ENEA 3SHQA 3W1YA 4D2KA 4KSLC 3UGBB 1MG8A 1HTQA 2VH1A 1GC6A 2O2VB 5BYRA 3I3TB 4C80A 1E0ZA 3PTFC 3HVZA 3VXWA 4PK1A 3H7PB 2PLPA 3NG0A 3KW5B 1K52A 2L52A 1Q5WB 1N62A 4M02A 5IKCM 4ZHOA 2BS3B 3RI7C 3BINA 5KHQA 2OJRA 3AE6B 2VRRB 4B9KA 4YSYB 1MPEA 4B0MA 1KLVA 3UIOB 4WQMA 3MHSD 3PLVA 1FPYA 1F1HA 2LVPA 4JGHB 4B6WA 4USAA 2XBBC 1PYWD 4RF0A 3ML9A 3SD5A 5D3DA 2AQ3B 1U4AA 1QOFA 1UBIA 2KDFB 1OTRB 1L6VA 4K3BA 1C79A 4HKZE 4P1BC 3NZUA 4HK2A 3T3OA 1WXAA 4RM9A 4BOZB 4W9GA 2ZCBA 2I1KA 2JY6A 5AZFA 5CHWA 3J9CA 1WY8A 3VTVA 2QSDA 1C1YB 3CMMB 1ET9A 3K9OB 1C78A 3T9LA 3NS1A 5E6NA 2INCC 2Z0EB 5IAAC 2CKHB 2KX3A 5HKHA 4BVUC 3H7PA 1MI0A 1E7PB 3D32A 5T8IA 2PE9A 2M17A 1C4AA 4AJYB 1DGJA 2MLBA 2WXQA 1SE2A 2BWES 4WAFA 2BYFA 1CJEA 3RUIB 1UZXB 2V4IB 3N20C 1V8CA 2GMIC 2WGSA 3A9KB 3AE1B 4YWGG 4IM3A 2FCNA 1WE7A 3QARA 2D5GA 4AJWA 2D3AA 4M00A 3ZDTA 2O6VD 2IO3B 1IBXB 2Y5BB 1I4HA 1YIWA 3RZFA 5J2RA 3OLMD 4W9IA 3Q3JA 4TSSA 4ICVA 3CIRB 4K81A 3N1YC 1KM7A 3FILA 5AEKB 3NVYA 4URKA 2WHIA 3R8BA 1YX5B 3AXCA 1C9FA 3RZWC 3KUZA 4Q2JA 3AU5A 4GOCA 1WYWB 2JRIB 2EELA 3DVNV 4EZKA 4W9FA 1V81A 3TEZA 2UYZB 4IWPA 3AE4B 3PSEB 4LNKA 4W9DA 3KYCD 1FNVA 3U4EG 3M3JA 3MC8A 4KIKB 2LGIA 2GBRA 4WAAA 4LNIA 3EECA 2G3QB 3GZNI 3ZIMA 2IO0B 3QHTA 2JXXA 2QHOA 1XLNA 3AEDB 2FUG1 2D3BA 3CWIA 1WX7A 5LXHA 3QWZB 4MELA 3RMKC 3ZQ4A 2B3AA 2XEWA 2M8SA 4BBNC 3KH0A 2FUHB 2MP2B 3LYYA 4PS8A 4ZRJA 3WAMA 1RAXA 4DQOC 3AM9A 4JL9A 2ZZPB 1S1QB 5KHOA 3NJTA 3KWLA 1L4DB 2JZZA 2D07B 2J0MA 3M62B 4JE3B 1NYQA 2KWUB 1BT0A 2JWZA 4KKIA 3EFUA 1TS2A 3LJ3A 4PT5A 2GRIA 3PPAA 1QF6A 2AWTA 3PRZA 1F0ZA 2L8JA 1NBFC 4RGTA 2J0JA 5DPTA 4ZOHC 1IGDA 2RMMA 2L32A 2BYEA 3KYDD 1TIFA 5JZEB 1EWYC 4E74A 4NZLB 4G0NB 4A90A 2K8CA 4KZ0A 2KVZA 3RPFC 2Y3AA 2Y5PA 3RNAC 4IW0A 2LVQA 1SJED 4GDKA 2LHEA 1K51A 3APCA 5BMIA 2WWZA 2VH2A 1T0RC 2X8XX 1QILA 3BVGA 2KTRB 2ZPYA 4MM3B 1SBBB 3VFKA 4IWQA 1DOIA 1Z2MA 4LTUA 4MJSB 5BO4B 4F8CB 3MC9A 3ZTCA 3VH4B 4HXDA 1VR9A 1XD3B 3OJ3A 2BTEA 3N1ZC 4HPLB 3V6EB 3AB5A 3BK1A 1L0VB 2KMCA 3VVWB 2GI9A 4GLSC 1TJEA 3S2AA 2QDFA 1ENFA 2RR9A 5C23A 2OOBB 2JU6X 1FFUA 1WFYA 3DVNU 1KTKA 1WR6E 2KQ7A 2YVCA 1HZ6A 2AEHA 2ZVOA 4O1NA 3Q8BA 1QZEA 3ZXVA 2KWCA 1WE6A 2D2QA 3FILB 4BKSD 2LVOA 5FK9C 1TS3A 4ANVA 4AUQC 1S3SG 1TKGA 3NOBA 2AX5A 4RNAA 3GE8C 1FFVA 1YNTE 1TKEA 2MQJA 2IGDA 1ZKHA 2WLBA 5BMHA 2ZVNA 4DXAB 2KVRA 1A70A 3SEBA 2RDGA 1TYGB 3UF8A 4US9A 3AEBB 1X1MA 2RDBC 2BT6A 4CHKA 1AWDA 2JVCA 1OQYA 4XC2A 4MDKE 4XWWA 3W9CB 3MP9A 2WX1A 1XLQA 3A33B 1PGAA 1ZE3D 2PE6B 1ZP0B 3ZLZA 2BVCA 1YD8U 3PRPB 5IP4D 2CHZA 2FBWB 2QCZA 1FCLA 1GJZA 2WXRA 1N6ZA 1FEHA 2FIDA 2HTME 4RGOS 3GE3C 1J7BA 1JRPA 2LUEA 4XX5A 3X23A 1WGRA 4M8MA 4DBGA 3PT2B 4LLGM 3RT3B 1FRRA 3GS2A 5I4DA 2LRUA 2CJNA 1F52A 3NRZA 5BYQA 2MEKA 2MX2A 3DVGY 3QCAA 2G9HD 4C7ZA 1E8WA 5E6OA 2WDTB 2CHXA 1GB1A 3MJ5A 1FM0D 4P7IA 2FCMA 3DOWA 1E10A 2AL6A 1JWAD 4GN1A 2WXLA 3QAQA 4B0EA 2OEDA 2OHFA 4CQNA 2IGHA 2EMSA 2V1YA 2HD5B 2KJHB 1ESFA 1RWSA 1GG3A 3DVGX 1WZ3A 2YEPF 4KDLB 3SDLC 2BBCA 3CF6E 1OQQA 1GNUA 2ACZB 3ZXRA 2DAJA 5D94A 5FR6A 1WIAA 3AE7B 1D5ZC 2Z8LA 2PJHA 4ZRIA 4K7UA 1NENB 2YEPB 2MP2A 5BYSA 2DZIA 3L0WB 3GOEA 1QOBA 2V4LA 2BGFA 2C7NB 2IBIB 3ZJTA 2KTRA 2IDYA 2QIEB 3B2GA 4TMAB 1M94A 2INNE 2JXTA 4MSQB 3RYTA 4IM0A 4P16A 2NCNA 3VUWA 2DZMA 2KOXA 1JQ4A 5FR3A 4XYCA 3Q3FA 3SU8X 2JSVX 1NDDA 4GMVA 1SXTA 5EE0A 5J18A 3MTNB 3HVDA 3PZ8A 3L4PA 3AU4A 2MHJA 3VHTC 4B95A 4F1SA 2K39A 3BIID 4PS3A 1GC7A 1R4MI 2DBYA 3ZNGC 2I38A 2J4XA 3QX1A 4WJNA 2C5LC 2DENB 1UWMA 3AE8B 1LGRA 3DHGC 1RYJA 4MGIE 2G4SA 3W1SC 2L0TA 3SR6A 3CSTA 2JZPA 4GU2A 5EE1A 4P6VF 1TZ1A 1DOYA 3JYUA 3AE9B 4HCPB 1YQBA 3ETRA 4MM3A 2NS5A 2Z59B 4RGNA 2DYOA 4XDDA 1MHXA 1YN3A 5DPWA 4YTPB 4G11A 3ZRCA 4TKNA 3R2TA 2M0AA 2JZ3B 5HG2A 1A5RA 2PVOD 4TUUA 2MSED 3ZRFA 1WXVA 4OVVA 4LCDE 2KLCA 2NMQA 3CSFA 2ICIA 4RF1A 2BWFA 1LO5D 3I9V1 1F9JA 1L5PA 1PQSA 2K8BA 5D7GA 3I63C 3AECB 2C9WB 5AUKA 1JALA 3N9YC 3A9JA 1PGXA 4ITKA 4WWNA 3L54A 3VUXA 2GBMA 2E3TA 4J3OD 2MJDA 3TUOA 1WZ0A 1WMHB 4DWFA 4N6EB 1OEYJ 3VDZA 3OJ4B 4W9JA 4HRSA 4ZRQA 4EKUA 1TGZB 3TEWA 4PS7A 3PHXB 4NAMA 3DQVA 3AV8A 3T3NA 4QAYA 1SE9A 3H1UA 3IHPC 1V1PB 3JW0X 2KDBA 4WIPA 1H8CA 3VAWA 1T0QC 1KRHA 2LXCA 1SGHA 4AQ7A 1SSNA 2SEBD 1V80A 2J53A 2I1JA 1V6EA 1PGBA 2MCNB 2RPQA 1N63A 5TR5A 4YSXB 1KOTA 2KTFA 2WXHA 1E6EB 1EF5A 1WX8A 2EKIA 4RH6A 2GLSA 1ZW7A 1WYGA 4L1BA 1SE3A 4CYEA 4K7WA 1LQBA 2K6QA 4AWJA 2REXA 2FCQA 1P98A 2KWVB 2K0PA 5HFYA 2PKOA 3A4SC 1I4QA 3PGEA 4NAWA 4KDIC 1CMXB 1UD7A 4G3XB 4OW0A 3UIPB 2WP9B 1P7FA 3DPDA 1I4GA 2JWUA 5G2NA 4ANWA 2ZW1A 1IYFA 2L00B 2N1WA 1AYFA 2XN9C 3RFZB 1WSPA 2BB6A 4S0RA 1V1PA 1HZ5A 1V5OA 2MA9B 3P4RB 3IT6B 1RLFA 4I6PA 3VRAB 5C3JB 1NYRA 1P9DU 3QIJA 1FNUA 1L7YA 1I4PA 1D3ZA 1VLBA 2LGSA 4BFRA 4ASWC 3OAWA 2G45B 4FA6A 1FNWA 3NUHB 2LWPA 1QKZA 2BYTA 4KZCA 4KV2A 5JXVA 1WM2A 2V3SA 3V3XA 1ROEA 4EEWA 1WRDB 4II3B 2BKFA 2L3ZA 1PFDA 4LJOB 4N59A 1TT5B 3W5UB 2K22A 2GB1A 3FKYA 3TIXA 2N4FA 2IPKD 1L6UA 4MH8A 2LD9A 1Q1OA 5GMVA 1IBXA 3EA6A 2INPE 1JWMD 4OZAA 1XCTL 2WNMA 2JYTA 2V9HA 1YN5A 4NQKE 1E7VA 4A20A 4MEMA 4FBJB 4JWUC 3TJPA 2K3UA 4G50A 4ZHPA 4A8XC 2MBBB 3Q2AC 4K7SA 1I35A 4HPPA 2NR2A 1AN8A 1L4ZB 3W5VB 2AQ2B 4BKSA 1F2RC 3E56A 4S17A 3PO0A 1HQRD 1WGGA 3QC8B 1OGWA 2LRWA 3AMZA 1RFAA 2N9LA 4II2B 1YJIA 3DHIC 1UWXA 2MBEA 3NZ3A 4JWSC 4AS1A 1F2RI 3BYTB 1R4MB 3O13A 3RD2A 3WIMA 1WGDA 2R61A 4YL8A 4KGTA 3R2IA 1P7EA 3E9SA 1WMHA 2JF5A 3AEFB 4OVUA 2GOWA 3LDZE 2MJEA 3V62A 4EE2A 3T8MA 3B0AA 1T6BX 1WJNA 1SE4A 3NVZA 2CU3A 2AL3A 5G5HA 4RM8A 3HIZA 1ZDXA 2BB5A 1ET6A 3TBLD 2WQYB 3UI3A 2KKCA 2AQ1B 3A1QA 4K3CA 1NI3A 3NVWA 2LHDA 4AOFA 3R66C 4IDIA 3AEEB 4LNFA 3HHMA 1UNSA 3B1LX 5G5GA 2ON8A 1DOXA 3DBLI 2PIAA 4NNJB 1M4VA 1VD2A 5CTRC 2VZKB 3ZUNA 3ABVB 2KMAA 2KANA 3DBHB 1WI0A 2FIFA 5DPSA 2HTHA 2XNAC 3EUB2 2HJ8A 1R7SA 3RNGC 1HTOA 1TY2A 1XCQL 2W82A 1N60A 5DPRA 2J7QB 4FULA 1KFYB 2KC1A 3BK2A 3M63B 1XQQA 4NJ7A 4WJOA 2DLBA 2LXAA 5EDSA 4IWOA 1B1ZA 1GAQB 2LI5A 1JCKB 2Q5WD 2KN4A 2KACA 1G6JA 3WANA 4EZJA 3K9PB 1N5XA 1C4CA 1IGCA 1OQRA 4DHZE 4HCNB 1AW7A 2AYOB 2WDRB 1WGYA 2KO3A 3KVFB 2W9NA 1HA5A 3SFEB 4FADA 1D5MC 1D5XC 1CZPA 2CJOA 4R3DA 4REZA 2PEAA 4KGRA 2X38A 2KYWA 5E6JA 4AP4C 4MGZE 1SB3C 4LDTD 5BMGA 3H9DA 2JPHA 2GBJA 4LDTB 5D6JB 4FJZA 1V49A 3KLSX 3FAHA 4GDLB 1Z5SB 3C19A 2D3CA 3WAOA 4GSWA 2LZ6A 3IFWB 1YN4A 2HJ1A 3C8YA 3BZDB 1VZ8A 3N32A 1FO4A 4WWOA 1D6EC 3ZGZA 2WU2B 4RCOA 2NTSA 1ZOYB 2DZKA 3ZNHB 4W9EA 1E9MA 2Z0DB 1P1AA 2O6VA 2ZPNA 2N0SB 2D11A 3P4SB 3DDCB 3ML8A 2H89B 4YSZB 2WDVB 1WJ6A 1V5TA 3JVZX 4A55A 1P0RA 5H92C 2I2YA 4WWMA 3LB8C 4IC7B 3RCZA
chains in the Genus database with same CATH topology
4W9FA 3ZO5B 1V81A 4M8NA 2UYZB 4IWPA 3L13A 1WXVA 3PSEB 1TTNA 3P2BA 4LCDE 2KLCA 4OVVA 3H7SA 4W9DA 3CSFA 3DBHI 3KYCD 1VCBA 3WALA 1UH6A 3M3JA 2BWFA 2GBKA 3TMPB 1E8ZA 1V2YA 2JUOA 4KIKB 2KDEB 2MW5A 2GBRA 4WAAA 3EECA 1F9JA 1PQSA 2G3QB 2K8BA 3GZNI 2N1VA 5D7GA 2IO0B 3QHTA 2JXXA 2QHOA 3HM6X 3R7RA 5LXIB 1I42A 3V6CB 2C9WB 2L0FA 2IY0B 4BBNF 1J19A 2IZVB 3A9JA 3L10B 3B08A 3ZVVA 2LGXA 4KSKC 4WWNA 3DCGA 2KQSA 1L2NA 1WX7A 1V86A 5LXHA 3L54A 3QWZB 5JHBA 4MELA 3VUXA 3ONSA 4DHJD 2GBMA 4GDLA 4DDGD 2B3AA 2XEWA 1EF1A 2KNBA 1WZ0A 2M8SA 1WMHB 4BBNC 2K8HA 3PS6A 3KH0A 4DWFA 1HE8A 2FUHB 1OEYJ 2MP2B 2A5UA 3VDZA 4NY0A 3OJ4B 3NY5A 4LJPB 4W9JA 4PS8A 4ZRJA 2FAZA 3WAMA 4EKUA 1RAXA 1TGZB 3ZW3A 2C7HA 4JL9A 4PS7A 2ZZPB 1S1QB 3IVFA 3PHXB 4MH0E 5KHOA 2FCSA 3DQVA 3QA8A 5D2MB 2JZZA 2D07B 2J0MA 3N30A 1SE9A 2KXJA 1LM8B 3H1UA 4DHZB 3EC8A 3M62B 4GGQA 3IHPC 4WJPA 3JW0X 2KWUB 2KDBA 1C3TA 1BT0A 2JWZA 3VAWA 1H8CA 3X0WA 2KD0A 2LXCA 3NS8A 3EFUA 1SGHA 4FJVB 1EO6A 1IP9A 2ASQA 3LJ3A 2BKRB 2CR5A 1V80A 3U30A 3EHVA 3PZDA 3PPAA 2LJ5A 4MSMB 4ICUA 2I1JA 1V6EA 2AWTA 3PRZA 1WF9A 2L8JA 1NBFC 2RPQA 2J0JA 2MCNB 5DPTA 5TR5A 4PYZA 1KOTA 1Y8RC 2KTFA 1AARA 2C7MB 3ZNZB 1EF5A 2DHZA 4A3OA 1WX8A 2BYEA 3KYDD 3PHWB 2LASA 2O2VA 3L08A 3V61A 2KDIA 1ZW7A 2DAFA 4BOSC 5JZEB 2NBVB 1ZGUB 4E74A 4G0NB 4W9LA 2K8CA 4KZ0A 4DDID 4PYUA 4CYEA 5AZHA 3ZNID 4K7WA 1LQBA 3NZSA 2K6QA 4KIKA 4AWJA 3TCAA 2REXA 2IYDB 2FCQA 1P98A 4IW0A 3JSVB 2KWVB 1Q0WB 2LVQA 3TL5A 4GDKA 3A9KA 2KFKB 2RSUA 4W9HA 2L76A 3VQIA 3APCA 3A4SC 1ISNA 2WWZA 3PGEA 4NAWA 4E3CA 4KDIC 1CMXB 1UD7A 4MJSA 4I6NB 4G3XB 5L95C 5E6PA 2IO2B 3UIPB 3DPDA 5IA7A 1R4NI 2KTRB 2ZPYA 2G4DB 4FJYA 5G2NA 2KN5A 2IO1B 4IWQA 3VFKA 4ANWA 1Z2MA 2M1MA 4WWPA 1IYFA 2M0XA 3A1QB 2CS4A 4MJSB 5BO4B 2JT4B 4E71A 5L83A 2A4ZA 3U7DA 1GUAB 2L00B 1WH3A 4F8CB 2N1WA 2KLGA 3ZTCA 4EZLA 3VH4B 2L7RA 2KC2A 4HXDA 1JRUA 1XD3B 1T0YA 2KJRA 3OJ3A 4NJ6A 4EFOA 1V5OA 3KUDB 4HPLB 3V6EB 2MA9B 5JHAA 4M0WB 1RLFA 2KMCA 4I6PA 3VVWB 4BKGA 1P9DU 2N9PC 2DYMA 3NHEB 3QIJA 3S2AA 4CO7A 2C60A 1L7YA 2RR9A 3IBEA 5C23A 2OOBB 3JSVA 1D3ZA 2K6DB 4BFRA 4ASWC 3A4RA 1E7UA 2KFKA 1WFYA 2G45B 3DVNU 3OAWA 4FA6A 4W9KA 5LLIA 2LWPA 1WR6E 2KQ7A 1SIFA 3V60A 2YVCA 4GIVA 1LXDA 3H6NA 2YLMA 3VTUA 2ZJDA 4KZCA 4KV2A 4ANXA 1WXMA 2AEHA 1WM2A 2N9XA 2ZVOA 3PV1A 2V3SA 4EEWA 2M4NA 2RD0A 1QZEA 3ECIA 1WRDB 4II3B 5JH5C 1UBQA 2ZNVB 4N9F4 4FHKA 2BKFA 4NQLB 2KWCA 2L3ZA 4XZ4A 1WE6A 2ZEQA 2D2QA 4LJOB 4TQ0A 1WM3A 4BKSD 3ZIMA 2LVOA 2KJ6A 3M95A 4ANVA 4AUQC 1S3SG 3L16A 4WJQA 2R2OA 3NOBA 2N4FA 3TIXA 4FHJA 2K25A 1OEYA 2UWQA 4IM2A 2K1FA 2WYQA 3UQBA 4FN2A 2XK5B 3DBRI 2MQJA 3HK0A 2LD9A 4GXBA 1Q1OA 5GMVA 1ZKHA 2ZVNA 4DK5A 2O6VB 4DXAB 2KVRA 4NAWB 3ZKJC 1YX6B 1WJ4A 2NPTA 1E5WA 3KUCB 2GBNA 4HDQA 1NI2A 4MGYE 3UF8A 1WX9A 1X1MA 4NQKE 1E7VA 4A20A 4MEMA 4FBJB 3TJPA 4J6IA 2KHWB 3A9JB 4G50A 2R2QA 4CHKA 2MBBB 4K7SA 1IPGA 2JVCA 1OQYA 4XC2A 4MDKE 2EMTA 1LFDA 1YJ1A 3IG3A 1I35A 2NR2A 2WX0A 2IY1B 3C0RB 4BKSA 2WX1A 3L17A 4EOYA 4F7ZA 5J17A 2MWSB 3A33B 1UGMA 3O65B 2KK8A 2PE6B 3ZLZA 1WGGA 4DHJB 3QC8B 1YD8U 3VUYA 1WXSA 3PRPB 2CHZA 3WA0A 1OGWA 2DYBA 2MBHA 2ZCCA 2LRWA 2LGYA 1RFAA 4II2B 5CX3A 4MGKE 2FNJB 1J8CA 2XK5A 5G55A 2KX0A 2MBEA 3UQAA 4TQ1A 1GJZA 1TBEA 3QQ8B 2NVUI 3AULA 5CHVC 4EZKA 2FIDA 1E90A 3PRMB 2LGDA 3RD2A 4I6LB 3U8ZA 3WIMA 3QK0A 1WGDA 3PREA 4YL8A 1P3QU 2D10A 2N9EB 3N3KB 4HWIB 5AZGA 2LUEA 2MBQA 4XX5A 4ZRKA 1WGRA 3X23A 4M8MA 2D3GA 4DBGA 3PT2B 3RT3B 1WMHA 2JF5A 3ZTDA 1WJUA 2DZJA 4HDOA 4JQWC 4OVUA 1UELA 2GOWA 3HM3A 3WAPA 3LDZE 1H4RA 3ENEA 3SHQA 3V62A 3W1YA 3ZDMC 2LRUA 3B0AA 4KSLC 3T8MA 3UGBB 1MG8A 1WJNA 4IUMB 2MX2A 3DVGY 1GC6A 3QCAA 2MBOA 2AL3A 2O2VB 3I3TB 4RM8A 3HIZA 3PTFC 3VXWA 4HVBA 1E8WA 4X57B 5E6OA 3TBLD 3H7PB 2WDTB 1WGHA 2CHXA 2KKCA 3A1QA 4P7IA 3KW5B 1Q5WB 2FCMA 3DOWA 4AOFA 2AL6A 2DX5B 3R66C 4GN1A 4A3PA 3QAQA 1E8XA 1KJTA 3VTWA 3APDA 3HHMA 2BYVE 3BINA 4ANUA 5KHQA 2OJRA 3B1LX 2VRRB 2EMSA 2V1YA 4B9KA 2HD5B 4K1RB 2KJHB 4IG7B 2CU1A 3DBSA 3DBLI 2JRHA 4NNJB 3PLUA 1KLVA 3UIOB 1GG3A 1VD2A 5CTRC 3UINB 3DVGX 3ZUNA 2KMAA 3MHSD 2KANA 1WZ3A 3PLVA 1WI0A 2FIFA 2LVPA 4JGHB 4HJKA 4B6WA 4KDLB 3SDLC 5DPSA 2HTHA 3CF6E 2HJ8A 2NPTB 2RGFA 2XBBC 3ML9A 1GNUA 3SD5A 2DAJA 5D94A 5FR6A 3APFA 5DPRA 1WIAA 2J7QB 3M63B 2KC1A 4FULA 1U4AA 1XQQA 3QJZA 1UBIA 4NJ7A 4TV3A 4WJOA 4ZYNA 2PJHA 4ZRIA 2LXAA 4K7UA 5EDSA 4IWOA 2KDFB 1J0GA 2MP2A 1OTRB 2DZIA 3L0WB 3NZUA 4HK2A 2LI5A 3GOEA 2ZNVC 2V4LA 2BPSA 1WXAA 4RM9A 2BGFA 2C7NB 3RULA 4NPNA 4BKTA 2IBIB 4BOZB 4HLEA 4W9GA 2EKEC 2KTRA 2ZCBA 2I1KA 2NBUA 1G6JA 3WANA 2JY6A 4EZJA 1M94A 5CHWA 5AZFA 3K9PB 4MSQB 3RYTA 1WY8A 3VTVA 4IM0A 1C1YB 2NCNA 4HPMB 3CMMB 3VUWA 2DZMA 2KOXA 2PPHA 4DHZE 2BF8B 3K9OB 3T9LA 5E6NA 3Q3FA 2Z0EB 4HCNB 5IAAC 3SU8X 2AYOB 1NDDA 2CKHB 4GMVA 2KX3A 1WGYA 4BVUC 2KO3A 3KVFB 5HKHA 1K8RB 3H7PA 2W9NA 5J18A 3MTNB 1WR1A 3D32A 4W9CA 4FADA 2PE9A 2M17A 4JIOU 3AU4A 2PEAA 4AJYB 3VHTC 4AP4C 3BY4B 2MLBA 4MGZE 4B95A 4LDTD 4F1SA 3H9DA 2JPHA 2K39A 4JLCA 4PS3A 1GC7A 1V9JA 2GBJA 2BWES 4LDTB 1R4MI 2NBWB 5CHFA 5D6JB 4FJZA 2BYFA 3AI5A 3PVLA 1RRBA 1EUVB 3RUIB 1UZXB 1V49A 3ZNGC 3ALBA 4GDLB 1Z5SB 2GMIC 3QX1A 3R3MA 3A9KB 4WJNA 5DCNA 2N7DA 2HE7A 4GSWA 2LZ6A 4WQOB 3WAOA 1E8YA 3IFWB 2C5LC 2DENB 2KFJA 4MGIE 3R7QA 2MRPA 3MJWA 2G4SA 3W1SC 2L0TA 2CHWA 3CSTA 4IM3A 2FCNA 3N32A 4GU2A 1WE7A 3QARA 4WWOA 4AJWA 1TZ1A 4GB9A 3ZDTA 2DZKA 2O6VD 4KVGB 4W9EA 2IO3B 3ZNHB 3JYUA 2Z0DB 1P1AA 4FLHA 3W1SA 2Y5BB 5C1ZA 2O6VA 2ZPNA 4HCPB 4ZDVA 2D11A 1YQBA 1XT9B 3DDCB 4MM3A 1YIWA 3ML8A 3RZFA 2NS5A 2Z59B 2DYOA 5J2RA 3OLMD 4W9IA 3Q3JA 4ICVA 2N7EA 4GDKB 4K81A 5DPWA 2KZRA 2J0KA 4RMAA 4EUTA 1KM7A 4G11A 1WJ6A 3ZRCA 4TKNA 1V5TA 3JVZX 5AEKB 4URKA 1FXTB 1YX5B 2JZ3B 3AXCA 3VH3B 3RZWC 1A5RA 1P0RA 3KUZA 3AU5A 4GOCA 1WYWB 2JRIB 4TUUA 2MSED 3DVNV 4IC7B 3RCZA 3ZRFA 2L05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9F A;  3ZO5 B;  1V81 A;  4M8N A;  2UYZ B;  4IWP A;  3L13 A;  1WXV A;  3PSE B;  1TTN A;  3P2B A;  4LCD E;  2KLC A;  4OVV A;  3H7S A;  4W9D A;  3CSF A;  3DBH I;  3KYC D;  1VCB A;  3WAL A;  1UH6 A;  3M3J A;  2BWF A;  2GBK A;  3TMP B;  1E8Z A;  1V2Y A;  2JUO A;  4KIK B;  2KDE B;  2MW5 A;  2GBR A;  4WAA A;  3EEC A;  1F9J A;  1PQS A;  2G3Q B;  2K8B A;  3GZN I;  2N1V A;  5D7G A;  2IO0 B;  3QHT A;  2JXX A;  2QHO A;  3HM6 X;  3R7R A;  5LXI B;  1I42 A;  3V6C B;  2C9W B;  2L0F A;  2IY0 B;  4BBN F;  1J19 A;  2IZV B;  3A9J A;  3L10 B;  3B08 A;  3ZVV A;  2LGX A;  4KSK C;  4WWN A;  3DCG A;  2KQS A;  1L2N A;  1WX7 A;  1V86 A;  5LXH A;  3L54 A;  3QWZ B;  5JHB A;  4MEL A;  3VUX A;  3ONS A;  4DHJ D;  2GBM A;  4GDL A;  4DDG D;  2B3A A;  2XEW A;  1EF1 A;  2KNB A;  1WZ0 A;  2M8S A;  1WMH B;  4BBN C;  2K8H A;  3PS6 A;  3KH0 A;  4DWF A;  1HE8 A;  2FUH B;  1OEY J;  2MP2 B;  2A5U A;  3VDZ A;  4NY0 A;  3OJ4 B;  3NY5 A;  4LJP B;  4W9J A;  4PS8 A;  4ZRJ A;  2FAZ A;  3WAM A;  4EKU A;  1RAX A;  1TGZ B;  3ZW3 A;  2C7H A;  4JL9 A;  4PS7 A;  2ZZP B;  1S1Q B;  3IVF A;  3PHX B;  4MH0 E;  5KHO A;  2FCS A;  3DQV A;  3QA8 A;  5D2M B;  2JZZ A;  2D07 B;  2J0M A;  3N30 A;  1SE9 A;  2KXJ A;  1LM8 B;  3H1U A;  4DHZ B;  3EC8 A;  3M62 B;  4GGQ A;  3IHP C;  4WJP A;  3JW0 X;  2KWU B;  2KDB A;  1C3T A;  1BT0 A;  2JWZ A;  3VAW A;  1H8C A;  3X0W A;  2KD0 A;  2LXC A;  3NS8 A;  3EFU A;  1SGH A;  4FJV B;  1EO6 A;  1IP9 A;  2ASQ A;  3LJ3 A;  2BKR B;  2CR5 A;  1V80 A;  3U30 A;  3EHV A;  3PZD A;  3PPA A;  2LJ5 A;  4MSM B;  4ICU A;  2I1J A;  1V6E A;  2AWT A;  3PRZ A;  1WF9 A;  2L8J A;  1NBF C;  2RPQ A;  2J0J A;  2MCN B;  5DPT A;  5TR5 A;  4PYZ A;  1KOT A;  1Y8R C;  2KTF A;  1AAR A;  2C7M B;  3ZNZ B;  1EF5 A;  2DHZ A;  4A3O A;  1WX8 A;  2BYE A;  3KYD D;  3PHW B;  2LAS A;  2O2V A;  3L08 A;  3V61 A;  2KDI A;  1ZW7 A;  2DAF A;  4BOS C;  5JZE B;  2NBV B;  1ZGU B;  4E74 A;  4G0N B;  4W9L A;  2K8C A;  4KZ0 A;  4DDI D;  4PYU A;  4CYE A;  5AZH A;  3ZNI D;  4K7W A;  1LQB A;  3NZS A;  2K6Q A;  4KIK A;  4AWJ A;  3TCA A;  2REX A;  2IYD B;  2FCQ A;  1P98 A;  4IW0 A;  3JSV B;  2KWV B;  1Q0W B;  2LVQ A;  3TL5 A;  4GDK A;  3A9K A;  2KFK B;  2RSU A;  4W9H A;  2L76 A;  3VQI A;  3APC A;  3A4S C;  1ISN A;  2WWZ A;  3PGE A;  4NAW A;  4E3C A;  4KDI C;  1CMX B;  1UD7 A;  4MJS A;  4I6N B;  4G3X B;  5L95 C;  5E6P A;  2IO2 B;  3UIP B;  3DPD A;  5IA7 A;  1R4N I;  2KTR B;  2ZPY A;  2G4D B;  4FJY A;  5G2N A;  2KN5 A;  2IO1 B;  4IWQ A;  3VFK A;  4ANW A;  1Z2M A;  2M1M A;  4WWP A;  1IYF A;  2M0X A;  3A1Q B;  2CS4 A;  4MJS B;  5BO4 B;  2JT4 B;  4E71 A;  5L83 A;  2A4Z A;  3U7D A;  1GUA B;  2L00 B;  1WH3 A;  4F8C B;  2N1W A;  2KLG A;  3ZTC A;  4EZL A;  3VH4 B;  2L7R A;  2KC2 A;  4HXD A;  1JRU A;  1XD3 B;  1T0Y A;  2KJR A;  3OJ3 A;  4NJ6 A;  4EFO A;  1V5O A;  3KUD B;  4HPL B;  3V6E B;  2MA9 B;  5JHA A;  4M0W B;  1RLF A;  2KMC A;  4I6P A;  3VVW B;  4BKG A;  1P9D U;  2N9P C;  2DYM A;  3NHE B;  3QIJ A;  3S2A A;  4CO7 A;  2C60 A;  1L7Y A;  2RR9 A;  3IBE A;  5C23 A;  2OOB B;  3JSV A;  1D3Z A;  2K6D B;  4BFR A;  4ASW C;  3A4R A;  1E7U A;  2KFK A;  1WFY A;  2G45 B;  3DVN U;  3OAW A;  4FA6 A;  4W9K A;  5LLI A;  2LWP A;  1WR6 E;  2KQ7 A;  1SIF A;  3V60 A;  2YVC A;  4GIV A;  1LXD A;  3H6N A;  2YLM A;  3VTU A;  2ZJD A;  4KZC A;  4KV2 A;  4ANX A;  1WXM A;  2AEH A;  1WM2 A;  2N9X A;  2ZVO A;  3PV1 A;  2V3S A;  4EEW A;  2M4N A;  2RD0 A;  1QZE A;  3ECI A;  1WRD B;  4II3 B;  5JH5 C;  1UBQ A;  2ZNV B;  4N9F 4;  4FHK A;  2BKF A;  4NQL B;  2KWC A;  2L3Z A;  4XZ4 A;  1WE6 A;  2ZEQ A;  2D2Q A;  4LJO B;  4TQ0 A;  1WM3 A;  4BKS D;  3ZIM A;  2LVO A;  2KJ6 A;  3M95 A;  4ANV A;  4AUQ C;  1S3S G;  3L16 A;  4WJQ A;  2R2O A;  3NOB A;  2N4F A;  3TIX A;  4FHJ A;  2K25 A;  1OEY A;  2UWQ A;  4IM2 A;  2K1F A;  2WYQ A;  3UQB A;  4FN2 A;  2XK5 B;  3DBR I;  2MQJ A;  3HK0 A;  2LD9 A;  4GXB A;  1Q1O A;  5GMV A;  1ZKH A;  2ZVN A;  4DK5 A;  2O6V B;  4DXA B;  2KVR A;  4NAW B;  3ZKJ C;  1YX6 B;  1WJ4 A;  2NPT A;  1E5W A;  3KUC B;  2GBN A;  4HDQ A;  1NI2 A;  4MGY E;  3UF8 A;  1WX9 A;  1X1M A;  4NQK E;  1E7V A;  4A20 A;  4MEM A;  4FBJ B;  3TJP A;  4J6I A;  2KHW B;  3A9J B;  4G50 A;  2R2Q A;  4CHK A;  2MBB B;  4K7S A;  1IPG A;  2JVC A;  1OQY A;  4XC2 A;  4MDK E;  2EMT A;  1LFD A;  1YJ1 A;  3IG3 A;  1I35 A;  2NR2 A;  2WX0 A;  2IY1 B;  3C0R B;  4BKS A;  2WX1 A;  3L17 A;  4EOY A;  4F7Z A;  5J17 A;  2MWS B;  3A33 B;  1UGM A;  3O65 B;  2KK8 A;  2PE6 B;  3ZLZ A;  1WGG A;  4DHJ B;  3QC8 B;  1YD8 U;  3VUY A;  1WXS A;  3PRP B;  2CHZ A;  3WA0 A;  1OGW A;  2DYB A;  2MBH A;  2ZCC A;  2LRW A;  2LGY A;  1RFA A;  4II2 B;  5CX3 A;  4MGK E;  2FNJ B;  1J8C A;  2XK5 A;  5G55 A;  2KX0 A;  2MBE A;  3UQA A;  4TQ1 A;  1GJZ A;  1TBE A;  3QQ8 B;  2NVU I;  3AUL A;  5CHV C;  4EZK A;  2FID A;  1E90 A;  3PRM B;  2LGD A;  3RD2 A;  4I6L B;  3U8Z A;  3WIM A;  3QK0 A;  1WGD A;  3PRE A;  4YL8 A;  1P3Q U;  2D10 A;  2N9E B;  3N3K B;  4HWI B;  5AZG A;  2LUE A;  2MBQ A;  4XX5 A;  4ZRK A;  1WGR A;  3X23 A;  4M8M A;  2D3G A;  4DBG A;  3PT2 B;  3RT3 B;  1WMH A;  2JF5 A;  3ZTD A;  1WJU A;  2DZJ A;  4HDO A;  4JQW C;  4OVU A;  1UEL A;  2GOW A;  3HM3 A;  3WAP A;  3LDZ E;  1H4R A;  3ENE A;  3SHQ A;  3V62 A;  3W1Y A;  3ZDM C;  2LRU A;  3B0A A;  4KSL C;  3T8M A;  3UGB B;  1MG8 A;  1WJN A;  4IUM B;  2MX2 A;  3DVG Y;  1GC6 A;  3QCA A;  2MBO A;  2AL3 A;  2O2V B;  3I3T B;  4RM8 A;  3HIZ A;  3PTF C;  3VXW A;  4HVB A;  1E8W A;  4X57 B;  5E6O A;  3TBL D;  3H7P B;  2WDT B;  1WGH A;  2CHX A;  2KKC A;  3A1Q A;  4P7I A;  3KW5 B;  1Q5W B;  2FCM A;  3DOW A;  4AOF A;  2AL6 A;  2DX5 B;  3R66 C;  4GN1 A;  4A3P A;  3QAQ A;  1E8X A;  1KJT A;  3VTW A;  3APD A;  3HHM A;  2BYV E;  3BIN A;  4ANU A;  5KHQ A;  2OJR A;  3B1L X;  2VRR B;  2EMS A;  2V1Y A;  4B9K A;  2HD5 B;  4K1R B;  2KJH B;  4IG7 B;  2CU1 A;  3DBS A;  3DBL I;  2JRH A;  4NNJ B;  3PLU A;  1KLV A;  3UIO B;  1GG3 A;  1VD2 A;  5CTR C;  3UIN B;  3DVG X;  3ZUN A;  2KMA A;  3MHS D;  2KAN A;  1WZ3 A;  3PLV A;  1WI0 A;  2FIF A;  2LVP A;  4JGH B;  4HJK A;  4B6W A;  4KDL B;  3SDL C;  5DPS A;  2HTH A;  3CF6 E;  2HJ8 A;  2NPT B;  2RGF A;  2XBB C;  3ML9 A;  1GNU A;  3SD5 A;  2DAJ A;  5D94 A;  5FR6 A;  3APF A;  5DPR A;  1WIA A;  2J7Q B;  3M63 B;  2KC1 A;  4FUL A;  1U4A A;  1XQQ A;  3QJZ A;  1UBI A;  4NJ7 A;  4TV3 A;  4WJO A;  4ZYN A;  2PJH A;  4ZRI A;  2LXA A;  4K7U A;  5EDS A;  4IWO A;  2KDF B;  1J0G A;  2MP2 A;  1OTR B;  2DZI A;  3L0W B;  3NZU A;  4HK2 A;  2LI5 A;  3GOE A;  2ZNV C;  2V4L A;  2BPS A;  1WXA A;  4RM9 A;  2BGF A;  2C7N B;  3RUL A;  4NPN A;  4BKT A;  2IBI B;  4BOZ B;  4HLE A;  4W9G A;  2EKE C;  2KTR A;  2ZCB A;  2I1K A;  2NBU A;  1G6J A;  3WAN A;  2JY6 A;  4EZJ A;  1M94 A;  5CHW A;  5AZF A;  3K9P B;  4MSQ B;  3RYT A;  1WY8 A;  3VTV A;  4IM0 A;  1C1Y B;  2NCN A;  4HPM B;  3CMM B;  3VUW A;  2DZM A;  2KOX A;  2PPH A;  4DHZ E;  2BF8 B;  3K9O B;  3T9L A;  5E6N A;  3Q3F A;  2Z0E B;  4HCN B;  5IAA C;  3SU8 X;  2AYO B;  1NDD A;  2CKH B;  4GMV A;  2KX3 A;  1WGY A;  4BVU C;  2KO3 A;  3KVF B;  5HKH A;  1K8R B;  3H7P A;  2W9N A;  5J18 A;  3MTN B;  1WR1 A;  3D32 A;  4W9C A;  4FAD A;  2PE9 A;  2M17 A;  4JIO U;  3AU4 A;  2PEA A;  4AJY B;  3VHT C;  4AP4 C;  3BY4 B;  2MLB A;  4MGZ E;  4B95 A;  4LDT D;  4F1S A;  3H9D A;  2JPH A;  2K39 A;  4JLC A;  4PS3 A;  1GC7 A;  1V9J A;  2GBJ A;  2BWE S;  4LDT B;  1R4M I;  2NBW B;  5CHF A;  5D6J B;  4FJZ A;  2BYF A;  3AI5 A;  3PVL A;  1RRB A;  1EUV B;  3RUI B;  1UZX B;  1V49 A;  3ZNG C;  3ALB A;  4GDL B;  1Z5S B;  2GMI C;  3QX1 A;  3R3M A;  3A9K B;  4WJN A;  5DCN A;  2N7D A;  2HE7 A;  4GSW A;  2LZ6 A;  4WQO B;  3WAO A;  1E8Y A;  3IFW B;  2C5L C;  2DEN B;  2KFJ A;  4MGI E;  3R7Q A;  2MRP A;  3MJW A;  2G4S A;  3W1S C;  2L0T A;  2CHW A;  3CST A;  4IM3 A;  2FCN A;  3N32 A;  4GU2 A;  1WE7 A;  3QAR A;  4WWO A;  4AJW A;  1TZ1 A;  4GB9 A;  3ZDT A;  2DZK A;  2O6V D;  4KVG B;  4W9E A;  2IO3 B;  3ZNH B;  3JYU A;  2Z0D B;  1P1A A;  4FLH A;  3W1S A;  2Y5B B;  5C1Z A;  2O6V A;  2ZPN A;  4HCP B;  4ZDV A;  2D11 A;  1YQB A;  1XT9 B;  3DDC B;  4MM3 A;  1YIW A;  3ML8 A;  3RZF A;  2NS5 A;  2Z59 B;  2DYO A;  5J2R A;  3OLM D;  4W9I A;  3Q3J A;  4ICV A;  2N7E A;  4GDK B;  4K81 A;  5DPW A;  2KZR A;  2J0K A;  4RMA A;  4EUT A;  1KM7 A;  4G11 A;  1WJ6 A;  3ZRC A;  4TKN A;  1V5T A;  3JVZ X;  5AEK B;  4URK A;  1FXT B;  1YX5 B;  2JZ3 B;  3AXC A;  3VH3 B;  3RZW C;  1A5R A;  1P0R A;  3KUZ A;  3AU5 A;  4GOC A;  1WYW B;  2JRI B;  4TUU A;  2MSE D;  3DVN V;  4IC7 B;  3RCZ A;  3ZRF A;  2L05 A; 
#chains in the Genus database with same CATH topology
 3ZO5 B;  2V3P A;  3BVM A;  3L13 A;  5EE9 A;  1TTN A;  3H7S A;  2KT7 A;  2GBK A;  1QT9 A;  1FXA A;  2N1V A;  1I42 A;  2L0F A;  4L2Y A;  1J19 A;  2IZV B;  3B08 A;  2UU7 A;  3ZVV A;  1L2N A;  3DCG A;  3W2D A;  5JHB A;  1BUI C;  2SAK A;  3ONS A;  4GDL A;  4DDG D;  2J52 A;  2WXO A;  3Q3O C;  1HXY D;  1HE8 A;  1KF6 B;  1STE A;  4YTM B;  1V97 A;  1KLU D;  4NY0 A;  3NY5 A;  4JPS A;  2B76 B;  2FAZ A;  2JYE A;  1FCC C;  1TZO A;  3ZW3 A;  4IKG A;  4IOI E;  3QA8 A;  2QEJ C;  3IT4 B;  1LM8 B;  4DHZ B;  1C3T A;  5C2T B;  1PDX A;  1IP9 A;  2ASQ A;  4A9A A;  1T3Q A;  2BKR B;  2CR5 A;  3EHV A;  3PZD A;  1EU3 A;  4DXG A;  2HDE A;  4C4V A;  3KQ4 A;  4HEA 1;  2G1E A;  4PYZ A;  1AAR A;  2KAJ A;  3ZNZ B;  2NTT A;  2DHZ A;  1ZDV A;  4A3O A;  3IXS A;  2H88 B;  3PHW B;  2LAS A;  4BOS C;  4OZB A;  1KLG D;  4DDI D;  4PYU A;  5AZH A;  4N58 A;  3ZNI D;  1VZ7 A;  4KIK A;  3NZS A;  1TKY A;  1FMA D;  1MVK A;  1JWU D;  3JSV B;  3TL5 A;  3EGR A;  3A9K A;  2KFK B;  4W9H A;  1N5W A;  2L76 A;  3VQI A;  1GPX A;  2MH7 A;  1C4P A;  1I4R A;  3VR9 B;  5L95 C;  2IO2 B;  1GOZ A;  1R4N I;  3TEY A;  3SFD B;  1YQ4 B;  2M0X A;  3A1Q B;  3DBR B;  4XWT A;  2JT4 B;  5L83 A;  2A4Z A;  1ACC A;  2KLG A;  1EU4 A;  2WXP A;  1SEB D;  3RN9 C;  2L7R A;  1C76 A;  1JRU A;  1YOV B;  2KJR A;  4H2A A;  4NJ6 A;  1R4N B;  3KUD B;  4BKG A;  2N9P C;  2DYM A;  1XXG A;  2RDH A;  1YJJ A;  3JSV A;  3URY A;  3WCQ A;  3A4R A;  3Q69 A;  2KFK A;  4W9K A;  1J7A A;  1SIF A;  3V60 A;  3P4P B;  4GIV A;  1LXD A;  2YLM A;  3TSS A;  4P1C C;  4ANX A;  1WXM A;  3GZN B;  2WXF A;  3ECI A;  5JH5 C;  1YMH E;  4FHK A;  2WXG A;  3P4Q B;  4XZ4 A;  2ZEQ A;  4OHJ A;  1WM3 A;  2W3R A;  3M95 A;  4WJQ A;  2R2O A;  1I4X A;  1VJK A;  4FHJ A;  2UWQ A;  4IM2 A;  1BXT A;  3AH7 A;  4XDC A;  3UQB A;  4FN2 A;  4US8 A;  2XK5 B;  3DBR I;  4MAC A;  2O6V B;  3ZKJ C;  1YX6 B;  1FIQ A;  3U2S C;  2E6X A;  3KWV A;  4HDQ A;  2WU5 B;  2K9X A;  4MGY E;  5AUI A;  2KMM A;  5MPO A;  1WXQ A;  1MHH E;  2RPV A;  1YJ1 A;  3IG3 A;  3DHH C;  2IND C;  3ZYY X;  2WX0 A;  2WS3 B;  3OWE B;  4EOY A;  5J17 A;  4F7Z A;  1XEE A;  2KK8 A;  3ZJV A;  4OZC A;  3AN1 A;  2MJ3 A;  2DYB A;  1UGJ A;  2MBH A;  2ZCC A;  3MHZ A;  2LGY A;  2QJL A;  1CK1 A;  1J8C A;  4MGK E;  4RGM A;  2XK5 A;  5G55 A;  2KX0 A;  2DNF A;  4TQ1 A;  1TBE A;  3QQ8 B;  1TS5 A;  3AE5 B;  3RNF C;  1GB4 A;  1SF0 A;  1JW9 D;  2W3S A;  3AE3 B;  1XLP A;  2LGD A;  2IGG A;  3PRE A;  4KX6 B;  2D10 A;  1NVI D;  4HWI B;  3RNC C;  2MBQ A;  2V3N A;  2WXN A;  3ZTD A;  1IUE A;  1WGK A;  1VZ6 A;  3DWG C;  1UEL A;  3HM3 A;  1H4R A;  2PW9 A;  3ZDM C;  3RNB C;  4BAX A;  1FD6 A;  1TY0 A;  1T5X D;  4IUM B;  1VDV A;  2MBO A;  4HVB A;  3H8H A;  4X57 B;  1WGH A;  2BS4 B;  3BYY B;  2W54 A;  4YXD B;  2PMV A;  4WH4 A;  4M01 A;  1YQ3 B;  2DX5 B;  4OVZ A;  1K53 A;  4A3P A;  3Q3M C;  1E8X A;  4HRO A;  1KJT A;  3V05 A;  3APD A;  5TSS A;  2BYV E;  3IAM 1;  3VTW A;  4ANU A;  4K1R B;  3Q14 C;  4IG7 B;  2CU1 A;  3DBS A;  3TEX A;  2JRH A;  1JRO A;  2IJ0 A;  3PLU A;  1UF0 A;  3UIN B;  3I57 A;  4HJK A;  1KH0 A;  2NPT B;  1EWC A;  2RGF A;  1FXI A;  4MT5 A;  2N7J A;  2LMC A;  2JQR B;  3APF A;  3Q8E A;  2WXI A;  3QJZ A;  4TV3 A;  4ZYN A;  3MC0 B;  2ZNV C;  2BPS A;  1FRD A;  4KGS A;  3RUL A;  4HLE A;  4NPN A;  4BKT A;  4YT0 B;  2PVG C;  2EKE C;  1BML C;  4HJG E;  2WXJ A;  2NBU A;  1UUP A;  4FXC A;  4HPM B;  2PPH A;  2BF8 B;  1EM7 A;  4ARI A;  2KWD A;  1K8R B;  1WR1 A;  2PTL A;  4W9C A;  3BWU D;  1QQR A;  5FKA C;  5GXG B;  4JIO U;  2LEK A;  4UDU C;  1MJD A;  3BY4 B;  3VR8 B;  4JLC A;  1V9J A;  4C00 A;  3NVV A;  2NBW B;  5CHF A;  3AI5 A;  3PVL A;  1RRB A;  1EUV B;  1SJH D;  2FE8 A;  3ALB A;  5IOI A;  2WDQ B;  1JWB D;  3R3M A;  1QOA A;  3MFG A;  5DCN A;  1ZXI A;  2HE7 A;  2N7D A;  4WQO B;  1E8Y A;  4C4V B;  4C7Y A;  4ZRP A;  4ZYS A;  1MFW A;  2KFJ A;  5H8Y E;  3R7Q A;  2MRP A;  3MJW A;  2CHW A;  3DBL B;  1D4B A;  1ZPS A;  1T0S C;  4GB9 A;  1MG4 A;  4KVG B;  2J42 A;  4FLH A;  3W1S A;  5C1Z A;  4ZDV A;  5HI1 A;  1XT9 B;  1WWT A;  5IO9 A;  2M19 A;  2N7E A;  3GB1 A;  4GDK B;  2KZR A;  1HEZ E;  2J0K A;  4RMA A;  4EUT A;  4NJC A;  1XO3 A;  3U52 E;  1FXT B;  3HRD D;  3VH3 B;  1ZUD 2;  2L05 A;  4M8N A;  2JX5 A;  1CQV A;  3P2B A;  3DBH I;  1VCB A;  3WAL A;  1UH6 A;  3AE2 B;  1XLO A;  3TMP B;  1E8Z A;  5LNK 1;  1V2Y A;  2JUO A;  2KDE B;  2MW5 A;  3P42 A;  3R7R A;  1J0G A;  2V0G A;  5LXI B;  3HM6 X;  3V6C B;  4WUR A;  4KKJ A;  2IY0 B;  4BBN F;  3L10 B;  2L83 A;  4ARC A;  5IN7 A;  2LGX A;  4KSK C;  2KQS A;  1V86 A;  1B9R A;  4DHJ D;  3LXF A;  3OG5 A;  1TS4 A;  1EF1 A;  1NEK B;  2KNB A;  2K8H A;  3PS6 A;  2A5U A;  4LJP B;  4XE0 A;  5EE3 A;  2C7H A;  4LK0 M;  3IVF A;  4MH0 E;  3AEG B;  2FCS A;  3DWM A;  5D2M B;  2L1A A;  3N30 A;  2KXJ A;  3EC8 A;  4GGQ A;  4WJP A;  1C77 A;  3X0W A;  2KD0 A;  3NS8 A;  4FJV B;  1EO6 A;  3U30 A;  3RNE C;  2LJ5 A;  4MSM B;  4ICU A;  1WF9 A;  3Q8F A;  1VRA B;  1Y8R C;  2C7M B;  2TSS A;  1QLB B;  3P63 A;  2O2V A;  3L08 A;  3V61 A;  2KDI A;  2DAF A;  2NBV B;  1ZGU B;  2QIL A;  2QMT A;  4W9L A;  2ZW0 A;  1ZXH A;  1N61 A;  3EFC A;  3TCA A;  3HUI A;  2IYD B;  3ZJU A;  1Q0W B;  4BZA A;  5D3I B;  2RSU A;  3Q8A A;  2N9K A;  3IAS 1;  5HHD G;  1ISN A;  4E3C A;  4ACF A;  2DWQ A;  1JML A;  4MJS A;  4I6N B;  3B2F A;  5E6P A;  2K5P A;  2BQQ A;  3Q6B A;  1SIJ A;  3N1X C;  2BW2 A;  3U7Z A;  4RFB A;  5IA7 A;  3Q3N C;  4LNO A;  1QOG A;  2G4D B;  4FJY A;  1J7C A;  2KN5 A;  2IO1 B;  2W55 A;  2M1M A;  3BVZ A;  4WWP A;  2CS4 A;  4E71 A;  2VZK D;  3U7D A;  1GUA B;  3FC4 A;  1WH3 A;  4EZL A;  2KC2 A;  3PZ7 A;  3Q8C A;  1T0Y A;  4EFO A;  1RFK A;  2LJI A;  5JHA A;  4L23 A;  2KDM A;  4M0W B;  3VRB B;  4C56 C;  1I7H A;  3NHE B;  4CO7 A;  2C60 A;  1XF5 L;  3IBE A;  2K6D B;  2QC8 A;  1E7U A;  1V1O A;  4YTN B;  5LLI A;  2OJW A;  3H6N A;  3VTU A;  2ZJD A;  2N9X A;  3PV1 A;  2M4N A;  2RD0 A;  3P1M A;  1UBQ A;  2ZNV B;  4N9F 4;  4NQL B;  2Y5C A;  4TQ0 A;  2BS2 B;  1F77 A;  2KJ6 A;  1OFF A;  3L16 A;  4A6Q A;  1DYQ A;  2K25 A;  1OEY A;  2K1F A;  2WYQ A;  1WRI A;  3HK0 A;  4GXB A;  2WXM A;  4DK5 A;  3B9J A;  1Y56 A;  4NAW B;  4M0W A;  1WJ4 A;  2NPT A;  1RM6 C;  1E5W A;  3KUC B;  2GBN A;  1NI2 A;  2LFI A;  1WX9 A;  1L0Y B;  2KQ4 X;  3GP7 A;  4J6I A;  2WXK A;  2KHW B;  3A9J B;  2R2Q A;  1IPG A;  4LNN A;  2EMT A;  1LFD A;  2M56 B;  2IY1 B;  3C0R B;  3L17 A;  2MWS B;  1JWS D;  1UGM A;  3O65 B;  4DHJ B;  3VUY A;  1WXS A;  4JX1 C;  3WA0 A;  1L0X B;  5CX3 A;  2FNJ B;  3AEA B;  3UQA A;  2ONQ A;  2LUM A;  4HKQ A;  2NVU I;  3AUL A;  5CHV C;  4XGA B;  3I5J C;  1E90 A;  3PRM B;  1K50 A;  4I6L B;  3U8Z A;  3QK0 A;  1P3Q U;  2N9E B;  3N3K B;  1Q10 A;  5AZG A;  4ZRK A;  4DXF A;  2D3G A;  1WJU A;  2DZJ A;  4HDO A;  4JQW C;  3WAP A;  1PUT A;  3ENE A;  3SHQ A;  3W1Y A;  4D2K A;  4KSL C;  3UGB B;  1MG8 A;  1HTQ A;  2VH1 A;  1GC6 A;  2O2V B;  5BYR A;  3I3T B;  4C80 A;  1E0Z A;  3PTF C;  3HVZ A;  3VXW A;  4PK1 A;  3H7P B;  2PLP A;  3NG0 A;  3KW5 B;  1K52 A;  2L52 A;  1Q5W B;  1N62 A;  4M02 A;  5IKC M;  4ZHO A;  2BS3 B;  3RI7 C;  3BIN A;  5KHQ A;  2OJR A;  3AE6 B;  2VRR B;  4B9K A;  4YSY B;  1MPE A;  4B0M A;  1KLV A;  3UIO B;  4WQM A;  3MHS D;  3PLV A;  1FPY A;  1F1H A;  2LVP A;  4JGH B;  4B6W A;  4USA A;  2XBB C;  1PYW D;  4RF0 A;  3ML9 A;  3SD5 A;  5D3D A;  2AQ3 B;  1U4A A;  1QOF A;  1UBI A;  2KDF B;  1OTR B;  1L6V A;  4K3B A;  1C79 A;  4HKZ E;  4P1B C;  3NZU A;  4HK2 A;  3T3O A;  1WXA A;  4RM9 A;  4BOZ B;  4W9G A;  2ZCB A;  2I1K A;  2JY6 A;  5AZF A;  5CHW A;  3J9C A;  1WY8 A;  3VTV A;  2QSD A;  1C1Y B;  3CMM B;  1ET9 A;  3K9O B;  1C78 A;  3T9L A;  3NS1 A;  5E6N A;  2INC C;  2Z0E B;  5IAA C;  2CKH B;  2KX3 A;  5HKH A;  4BVU C;  3H7P A;  1MI0 A;  1E7P B;  3D32 A;  5T8I A;  2PE9 A;  2M17 A;  1C4A A;  4AJY B;  1DGJ A;  2MLB A;  2WXQ A;  1SE2 A;  2BWE S;  4WAF A;  2BYF A;  1CJE A;  3RUI B;  1UZX B;  2V4I B;  3N20 C;  1V8C A;  2GMI C;  2WGS A;  3A9K B;  3AE1 B;  4YWG G;  4IM3 A;  2FCN A;  1WE7 A;  3QAR A;  2D5G A;  4AJW A;  2D3A A;  4M00 A;  3ZDT A;  2O6V D;  2IO3 B;  1IBX B;  2Y5B B;  1I4H A;  1YIW A;  3RZF A;  5J2R A;  3OLM D;  4W9I A;  3Q3J A;  4TSS A;  4ICV A;  3CIR B;  4K81 A;  3N1Y C;  1KM7 A;  3FIL A;  5AEK B;  3NVY A;  4URK A;  2WHI A;  3R8B A;  1YX5 B;  3AXC A;  1C9F A;  3RZW C;  3KUZ A;  4Q2J A;  3AU5 A;  4GOC A;  1WYW B;  2JRI B;  2EEL A;  3DVN V;  4EZK A;  4W9F A;  1V81 A;  3TEZ A;  2UYZ B;  4IWP A;  3AE4 B;  3PSE B;  4LNK A;  4W9D A;  3KYC D;  1FNV A;  3U4E G;  3M3J A;  3MC8 A;  4KIK B;  2LGI A;  2GBR A;  4WAA A;  4LNI A;  3EEC A;  2G3Q B;  3GZN I;  3ZIM A;  2IO0 B;  3QHT A;  2JXX A;  2QHO A;  1XLN A;  3AED B;  2FUG 1;  2D3B A;  3CWI A;  1WX7 A;  5LXH A;  3QWZ B;  4MEL A;  3RMK C;  3ZQ4 A;  2B3A A;  2XEW A;  2M8S A;  4BBN C;  3KH0 A;  2FUH B;  2MP2 B;  3LYY A;  4PS8 A;  4ZRJ A;  3WAM A;  1RAX A;  4DQO C;  3AM9 A;  4JL9 A;  2ZZP B;  1S1Q B;  5KHO A;  3NJT A;  3KWL A;  1L4D B;  2JZZ A;  2D07 B;  2J0M A;  3M62 B;  4JE3 B;  1NYQ A;  2KWU B;  1BT0 A;  2JWZ A;  4KKI A;  3EFU A;  1TS2 A;  3LJ3 A;  4PT5 A;  2GRI A;  3PPA A;  1QF6 A;  2AWT A;  3PRZ A;  1F0Z A;  2L8J A;  1NBF C;  4RGT A;  2J0J A;  5DPT A;  4ZOH C;  1IGD A;  2RMM A;  2L32 A;  2BYE A;  3KYD D;  1TIF A;  5JZE B;  1EWY C;  4E74 A;  4NZL B;  4G0N B;  4A90 A;  2K8C A;  4KZ0 A;  2KVZ A;  3RPF C;  2Y3A A;  2Y5P A;  3RNA C;  4IW0 A;  2LVQ A;  1SJE D;  4GDK A;  2LHE A;  1K51 A;  3APC A;  5BMI A;  2WWZ A;  2VH2 A;  1T0R C;  2X8X X;  1QIL A;  3BVG A;  2KTR B;  2ZPY A;  4MM3 B;  1SBB B;  3VFK A;  4IWQ A;  1DOI A;  1Z2M A;  4LTU A;  4MJS B;  5BO4 B;  4F8C B;  3MC9 A;  3ZTC A;  3VH4 B;  4HXD A;  1VR9 A;  1XD3 B;  3OJ3 A;  2BTE A;  3N1Z C;  4HPL B;  3V6E B;  3AB5 A;  3BK1 A;  1L0V B;  2KMC A;  3VVW B;  2GI9 A;  4GLS C;  1TJE A;  3S2A A;  2QDF A;  1ENF A;  2RR9 A;  5C23 A;  2OOB B;  2JU6 X;  1FFU A;  1WFY A;  3DVN U;  1KTK A;  1WR6 E;  2KQ7 A;  2YVC A;  1HZ6 A;  2AEH A;  2ZVO A;  4O1N A;  3Q8B A;  1QZE A;  3ZXV A;  2KWC A;  1WE6 A;  2D2Q A;  3FIL B;  4BKS D;  2LVO A;  5FK9 C;  1TS3 A;  4ANV A;  4AUQ C;  1S3S G;  1TKG A;  3NOB A;  2AX5 A;  4RNA A;  3GE8 C;  1FFV A;  1YNT E;  1TKE A;  2MQJ A;  2IGD A;  1ZKH A;  2WLB A;  5BMH A;  2ZVN A;  4DXA B;  2KVR A;  1A70 A;  3SEB A;  2RDG A;  1TYG B;  3UF8 A;  4US9 A;  3AEB B;  1X1M A;  2RDB C;  2BT6 A;  4CHK A;  1AWD A;  2JVC A;  1OQY A;  4XC2 A;  4MDK E;  4XWW A;  3W9C B;  3MP9 A;  2WX1 A;  1XLQ A;  3A33 B;  1PGA A;  1ZE3 D;  2PE6 B;  1ZP0 B;  3ZLZ A;  2BVC A;  1YD8 U;  3PRP B;  5IP4 D;  2CHZ A;  2FBW B;  2QCZ A;  1FCL A;  1GJZ A;  2WXR A;  1N6Z A;  1FEH A;  2FID A;  2HTM E;  4RGO S;  3GE3 C;  1J7B A;  1JRP A;  2LUE A;  4XX5 A;  3X23 A;  1WGR A;  4M8M A;  4DBG A;  3PT2 B;  4LLG M;  3RT3 B;  1FRR A;  3GS2 A;  5I4D A;  2LRU A;  2CJN A;  1F52 A;  3NRZ A;  5BYQ A;  2MEK A;  2MX2 A;  3DVG Y;  3QCA A;  2G9H D;  4C7Z A;  1E8W A;  5E6O A;  2WDT B;  2CHX A;  1GB1 A;  3MJ5 A;  1FM0 D;  4P7I A;  2FCM A;  3DOW A;  1E10 A;  2AL6 A;  1JWA D;  4GN1 A;  2WXL A;  3QAQ A;  4B0E A;  2OED A;  2OHF A;  4CQN A;  2IGH A;  2EMS A;  2V1Y A;  2HD5 B;  2KJH B;  1ESF A;  1RWS A;  1GG3 A;  3DVG X;  1WZ3 A;  2YEP F;  4KDL B;  3SDL C;  2BBC A;  3CF6 E;  1OQQ A;  1GNU A;  2ACZ B;  3ZXR A;  2DAJ A;  5D94 A;  5FR6 A;  1WIA A;  3AE7 B;  1D5Z C;  2Z8L A;  2PJH A;  4ZRI A;  4K7U A;  1NEN B;  2YEP B;  2MP2 A;  5BYS A;  2DZI A;  3L0W B;  3GOE A;  1QOB A;  2V4L A;  2BGF A;  2C7N B;  2IBI B;  3ZJT A;  2KTR A;  2IDY A;  2QIE B;  3B2G A;  4TMA B;  1M94 A;  2INN E;  2JXT A;  4MSQ B;  3RYT A;  4IM0 A;  4P16 A;  2NCN A;  3VUW A;  2DZM A;  2KOX A;  1JQ4 A;  5FR3 A;  4XYC A;  3Q3F A;  3SU8 X;  2JSV X;  1NDD A;  4GMV A;  1SXT A;  5EE0 A;  5J18 A;  3MTN B;  3HVD A;  3PZ8 A;  3L4P A;  3AU4 A;  2MHJ A;  3VHT C;  4B95 A;  4F1S A;  2K39 A;  3BII D;  4PS3 A;  1GC7 A;  1R4M I;  2DBY A;  3ZNG C;  2I38 A;  2J4X A;  3QX1 A;  4WJN A;  2C5L C;  2DEN B;  1UWM A;  3AE8 B;  1LGR A;  3DHG C;  1RYJ A;  4MGI E;  2G4S A;  3W1S C;  2L0T A;  3SR6 A;  3CST A;  2JZP A;  4GU2 A;  5EE1 A;  4P6V F;  1TZ1 A;  1DOY A;  3JYU A;  3AE9 B;  4HCP B;  1YQB A;  3ETR A;  4MM3 A;  2NS5 A;  2Z59 B;  4RGN A;  2DYO A;  4XDD A;  1MHX A;  1YN3 A;  5DPW A;  4YTP B;  4G11 A;  3ZRC A;  4TKN A;  3R2T A;  2M0A A;  2JZ3 B;  5HG2 A;  1A5R A;  2PVO D;  4TUU A;  2MSE D;  3ZRF A;  1WXV A;  4OVV A;  4LCD E;  2KLC A;  2NMQ A;  3CSF A;  2ICI A;  4RF1 A;  2BWF A;  1LO5 D;  3I9V 1;  1F9J A;  1L5P A;  1PQS A;  2K8B A;  5D7G A;  3I63 C;  3AEC B;  2C9W B;  5AUK A;  1JAL A;  3N9Y C;  3A9J A;  1PGX A;  4ITK A;  4WWN A;  3L54 A;  3VUX A;  2GBM A;  2E3T A;  4J3O D;  2MJD A;  3TUO A;  1WZ0 A;  1WMH B;  4DWF A;  4N6E B;  1OEY J;  3VDZ A;  3OJ4 B;  4W9J A;  4HRS A;  4ZRQ A;  4EKU A;  1TGZ B;  3TEW A;  4PS7 A;  3PHX B;  4NAM A;  3DQV A;  3AV8 A;  3T3N A;  4QAY A;  1SE9 A;  3H1U A;  3IHP C;  1V1P B;  3JW0 X;  2KDB A;  4WIP A;  1H8C A;  3VAW A;  1T0Q C;  1KRH A;  2LXC A;  1SGH A;  4AQ7 A;  1SSN A;  2SEB D;  1V80 A;  2J53 A;  2I1J A;  1V6E A;  1PGB A;  2MCN B;  2RPQ A;  1N63 A;  5TR5 A;  4YSX B;  1KOT A;  2KTF A;  2WXH A;  1E6E B;  1EF5 A;  1WX8 A;  2EKI A;  4RH6 A;  2GLS A;  1ZW7 A;  1WYG A;  4L1B A;  1SE3 A;  4CYE A;  4K7W A;  1LQB A;  2K6Q A;  4AWJ A;  2REX A;  2FCQ A;  1P98 A;  2KWV B;  2K0P A;  5HFY A;  2PKO A;  3A4S C;  1I4Q A;  3PGE A;  4NAW A;  4KDI C;  1CMX B;  1UD7 A;  4G3X B;  4OW0 A;  3UIP B;  2WP9 B;  1P7F A;  3DPD A;  1I4G A;  2JWU A;  5G2N A;  4ANW A;  2ZW1 A;  1IYF A;  2L00 B;  2N1W A;  1AYF A;  2XN9 C;  3RFZ B;  1WSP A;  2BB6 A;  4S0R A;  1V1P A;  1HZ5 A;  1V5O A;  2MA9 B;  3P4R B;  3IT6 B;  1RLF A;  4I6P A;  3VRA B;  5C3J B;  1NYR A;  1P9D U;  3QIJ A;  1FNU A;  1L7Y A;  1I4P A;  1D3Z A;  1VLB A;  2LGS A;  4BFR A;  4ASW C;  3OAW A;  2G45 B;  4FA6 A;  1FNW A;  3NUH B;  2LWP A;  1QKZ A;  2BYT A;  4KZC A;  4KV2 A;  5JXV A;  1WM2 A;  2V3S A;  3V3X A;  1ROE A;  4EEW A;  1WRD B;  4II3 B;  2BKF A;  2L3Z A;  1PFD A;  4LJO B;  4N59 A;  1TT5 B;  3W5U B;  2K22 A;  2GB1 A;  3FKY A;  3TIX A;  2N4F A;  2IPK D;  1L6U A;  4MH8 A;  2LD9 A;  1Q1O A;  5GMV A;  1IBX A;  3EA6 A;  2INP E;  1JWM D;  4OZA A;  1XCT L;  2WNM A;  2JYT A;  2V9H A;  1YN5 A;  4NQK E;  1E7V A;  4A20 A;  4MEM A;  4FBJ B;  4JWU C;  3TJP A;  2K3U A;  4G50 A;  4ZHP A;  4A8X C;  2MBB B;  3Q2A C;  4K7S A;  1I35 A;  4HPP A;  2NR2 A;  1AN8 A;  1L4Z B;  3W5V B;  2AQ2 B;  4BKS A;  1F2R C;  3E56 A;  4S17 A;  3PO0 A;  1HQR D;  1WGG A;  3QC8 B;  1OGW A;  2LRW A;  3AMZ A;  1RFA A;  2N9L A;  4II2 B;  1YJI A;  3DHI C;  1UWX A;  2MBE A;  3NZ3 A;  4JWS C;  4AS1 A;  1F2R I;  3BYT B;  1R4M B;  3O13 A;  3RD2 A;  3WIM A;  1WGD A;  2R61 A;  4YL8 A;  4KGT A;  3R2I A;  1P7E A;  3E9S A;  1WMH A;  2JF5 A;  3AEF B;  4OVU A;  2GOW A;  3LDZ E;  2MJE A;  3V62 A;  4EE2 A;  3T8M A;  3B0A A;  1T6B X;  1WJN A;  1SE4 A;  3NVZ A;  2CU3 A;  2AL3 A;  5G5H A;  4RM8 A;  3HIZ A;  1ZDX A;  2BB5 A;  1ET6 A;  3TBL D;  2WQY B;  3UI3 A;  2KKC A;  2AQ1 B;  3A1Q A;  4K3C A;  1NI3 A;  3NVW A;  2LHD A;  4AOF A;  3R66 C;  4IDI A;  3AEE B;  4LNF A;  3HHM A;  1UNS A;  3B1L X;  5G5G A;  2ON8 A;  1DOX A;  3DBL I;  2PIA A;  4NNJ B;  1M4V A;  1VD2 A;  5CTR C;  2VZK B;  3ZUN A;  3ABV B;  2KMA A;  2KAN A;  3DBH B;  1WI0 A;  2FIF A;  5DPS A;  2HTH A;  2XNA C;  3EUB 2;  2HJ8 A;  1R7S A;  3RNG C;  1HTO A;  1TY2 A;  1XCQ L;  2W82 A;  1N60 A;  5DPR A;  2J7Q B;  4FUL A;  1KFY B;  2KC1 A;  3BK2 A;  3M63 B;  1XQQ A;  4NJ7 A;  4WJO A;  2DLB A;  2LXA A;  5EDS A;  4IWO A;  1B1Z A;  1GAQ B;  2LI5 A;  1JCK B;  2Q5W D;  2KN4 A;  2KAC A;  1G6J A;  3WAN A;  4EZJ A;  3K9P B;  1N5X A;  1C4C A;  1IGC A;  1OQR A;  4DHZ E;  4HCN B;  1AW7 A;  2AYO B;  2WDR B;  1WGY A;  2KO3 A;  3KVF B;  2W9N A;  1HA5 A;  3SFE B;  4FAD A;  1D5M C;  1D5X C;  1CZP A;  2CJO A;  4R3D A;  4REZ A;  2PEA A;  4KGR A;  2X38 A;  2KYW A;  5E6J A;  4AP4 C;  4MGZ E;  1SB3 C;  4LDT D;  5BMG A;  3H9D A;  2JPH A;  2GBJ A;  4LDT B;  5D6J B;  4FJZ A;  1V49 A;  3KLS X;  3FAH A;  4GDL B;  1Z5S B;  3C19 A;  2D3C A;  3WAO A;  4GSW A;  2LZ6 A;  3IFW B;  1YN4 A;  2HJ1 A;  3C8Y A;  3BZD B;  1VZ8 A;  3N32 A;  1FO4 A;  4WWO A;  1D6E C;  3ZGZ A;  2WU2 B;  4RCO A;  2NTS A;  1ZOY B;  2DZK A;  3ZNH B;  4W9E A;  1E9M A;  2Z0D B;  1P1A A;  2O6V A;  2ZPN A;  2N0S B;  2D11 A;  3P4S B;  3DDC B;  3ML8 A;  2H89 B;  4YSZ B;  2WDV B;  1WJ6 A;  1V5T A;  3JVZ X;  4A55 A;  1P0R A;  5H92 C;  2I2Y A;  4WWM A;  3LB8 C;  4IC7 B;  3RCZ A; 
#chains in the Genus database with same CATH homology
 4W9F A;  3ZO5 B;  1V81 A;  4M8N A;  2UYZ B;  4IWP A;  3L13 A;  1WXV A;  3PSE B;  1TTN A;  3P2B A;  4LCD E;  2KLC A;  4OVV A;  3H7S A;  4W9D A;  3CSF A;  3DBH I;  3KYC D;  1VCB A;  3WAL A;  1UH6 A;  3M3J A;  2BWF A;  2GBK A;  3TMP B;  1E8Z A;  1V2Y A;  2JUO A;  4KIK B;  2KDE B;  2MW5 A;  2GBR A;  4WAA A;  3EEC A;  1F9J A;  1PQS A;  2G3Q B;  2K8B A;  3GZN I;  2N1V A;  5D7G A;  2IO0 B;  3QHT A;  2JXX A;  2QHO A;  3HM6 X;  3R7R A;  5LXI B;  1I42 A;  3V6C B;  2C9W B;  2L0F A;  2IY0 B;  4BBN F;  1J19 A;  2IZV B;  3A9J A;  3L10 B;  3B08 A;  3ZVV A;  2LGX A;  4KSK C;  4WWN A;  3DCG A;  2KQS A;  1L2N A;  1WX7 A;  1V86 A;  5LXH A;  3L54 A;  3QWZ B;  5JHB A;  4MEL A;  3VUX A;  3ONS A;  4DHJ D;  2GBM A;  4GDL A;  4DDG D;  2B3A A;  2XEW A;  1EF1 A;  2KNB A;  1WZ0 A;  2M8S A;  1WMH B;  4BBN C;  2K8H A;  3PS6 A;  3KH0 A;  4DWF A;  1HE8 A;  2FUH B;  1OEY J;  2MP2 B;  2A5U A;  3VDZ A;  4NY0 A;  3OJ4 B;  3NY5 A;  4LJP B;  4W9J A;  4PS8 A;  4ZRJ A;  2FAZ A;  3WAM A;  4EKU A;  1RAX A;  1TGZ B;  3ZW3 A;  2C7H A;  4JL9 A;  4PS7 A;  2ZZP B;  1S1Q B;  3IVF A;  3PHX B;  4MH0 E;  5KHO A;  2FCS A;  3DQV A;  3QA8 A;  5D2M B;  2JZZ A;  2D07 B;  2J0M A;  3N30 A;  1SE9 A;  2KXJ A;  1LM8 B;  3H1U A;  4DHZ B;  3EC8 A;  3M62 B;  4GGQ A;  3IHP C;  4WJP A;  3JW0 X;  2KWU B;  2KDB A;  1C3T A;  1BT0 A;  2JWZ A;  3VAW A;  1H8C A;  3X0W A;  2KD0 A;  2LXC A;  3NS8 A;  3EFU A;  1SGH A;  4FJV B;  1EO6 A;  1IP9 A;  2ASQ A;  3LJ3 A;  2BKR B;  2CR5 A;  1V80 A;  3U30 A;  3EHV A;  3PZD A;  3PPA A;  2LJ5 A;  4MSM B;  4ICU A;  2I1J A;  1V6E A;  2AWT A;  3PRZ A;  1WF9 A;  2L8J A;  1NBF C;  2RPQ A;  2J0J A;  2MCN B;  5DPT A;  5TR5 A;  4PYZ A;  1KOT A;  1Y8R C;  2KTF A;  1AAR A;  2C7M B;  3ZNZ B;  1EF5 A;  2DHZ A;  4A3O A;  1WX8 A;  2BYE A;  3KYD D;  3PHW B;  2LAS A;  2O2V A;  3L08 A;  3V61 A;  2KDI A;  1ZW7 A;  2DAF A;  4BOS C;  5JZE B;  2NBV B;  1ZGU B;  4E74 A;  4G0N B;  4W9L A;  2K8C A;  4KZ0 A;  4DDI D;  4PYU A;  4CYE A;  5AZH A;  3ZNI D;  4K7W A;  1LQB A;  3NZS A;  2K6Q A;  4KIK A;  4AWJ A;  3TCA A;  2REX A;  2IYD B;  2FCQ A;  1P98 A;  4IW0 A;  3JSV B;  2KWV B;  1Q0W B;  2LVQ A;  3TL5 A;  4GDK A;  3A9K A;  2KFK B;  2RSU A;  4W9H A;  2L76 A;  3VQI A;  3APC A;  3A4S C;  1ISN A;  2WWZ A;  3PGE A;  4NAW A;  4E3C A;  4KDI C;  1CMX B;  1UD7 A;  4MJS A;  4I6N B;  4G3X B;  5L95 C;  5E6P A;  2IO2 B;  3UIP B;  3DPD A;  5IA7 A;  1R4N I;  2KTR B;  2ZPY A;  2G4D B;  4FJY A;  5G2N A;  2KN5 A;  2IO1 B;  4IWQ A;  3VFK A;  4ANW A;  1Z2M A;  2M1M A;  4WWP A;  1IYF A;  2M0X A;  3A1Q B;  2CS4 A;  4MJS B;  5BO4 B;  2JT4 B;  4E71 A;  5L83 A;  2A4Z A;  3U7D A;  1GUA B;  2L00 B;  1WH3 A;  4F8C B;  2N1W A;  2KLG A;  3ZTC A;  4EZL A;  3VH4 B;  2L7R A;  2KC2 A;  4HXD A;  1JRU A;  1XD3 B;  1T0Y A;  2KJR A;  3OJ3 A;  4NJ6 A;  4EFO A;  1V5O A;  3KUD B;  4HPL B;  3V6E B;  2MA9 B;  5JHA A;  4M0W B;  1RLF A;  2KMC A;  4I6P A;  3VVW B;  4BKG A;  1P9D U;  2N9P C;  2DYM A;  3NHE B;  3QIJ A;  3S2A A;  4CO7 A;  2C60 A;  1L7Y A;  2RR9 A;  3IBE A;  5C23 A;  2OOB B;  3JSV A;  1D3Z A;  2K6D B;  4BFR A;  4ASW C;  3A4R A;  1E7U A;  2KFK A;  1WFY A;  2G45 B;  3DVN U;  3OAW A;  4FA6 A;  4W9K A;  5LLI A;  2LWP A;  1WR6 E;  2KQ7 A;  1SIF A;  3V60 A;  2YVC A;  4GIV A;  1LXD A;  3H6N A;  2YLM A;  3VTU A;  2ZJD A;  4KZC A;  4KV2 A;  4ANX A;  1WXM A;  2AEH A;  1WM2 A;  2N9X A;  2ZVO A;  3PV1 A;  2V3S A;  4EEW A;  2M4N A;  2RD0 A;  1QZE A;  3ECI A;  1WRD B;  4II3 B;  5JH5 C;  1UBQ A;  2ZNV B;  4N9F 4;  4FHK A;  2BKF A;  4NQL B;  2KWC A;  2L3Z A;  4XZ4 A;  1WE6 A;  2ZEQ A;  2D2Q A;  4LJO B;  4TQ0 A;  1WM3 A;  4BKS D;  3ZIM A;  2LVO A;  2KJ6 A;  3M95 A;  4ANV A;  4AUQ C;  1S3S G;  3L16 A;  4WJQ A;  2R2O A;  3NOB A;  2N4F A;  3TIX A;  4FHJ A;  2K25 A;  1OEY A;  2UWQ A;  4IM2 A;  2K1F A;  2WYQ A;  3UQB A;  4FN2 A;  2XK5 B;  3DBR I;  2MQJ A;  3HK0 A;  2LD9 A;  4GXB A;  1Q1O A;  5GMV A;  1ZKH A;  2ZVN A;  4DK5 A;  2O6V B;  4DXA B;  2KVR A;  4NAW B;  3ZKJ C;  1YX6 B;  1WJ4 A;  2NPT A;  1E5W A;  3KUC B;  2GBN A;  4HDQ A;  1NI2 A;  4MGY E;  3UF8 A;  1WX9 A;  1X1M A;  4NQK E;  1E7V A;  4A20 A;  4MEM A;  4FBJ B;  3TJP A;  4J6I A;  2KHW B;  3A9J B;  4G50 A;  2R2Q A;  4CHK A;  2MBB B;  4K7S A;  1IPG A;  2JVC A;  1OQY A;  4XC2 A;  4MDK E;  2EMT A;  1LFD A;  1YJ1 A;  3IG3 A;  1I35 A;  2NR2 A;  2WX0 A;  2IY1 B;  3C0R B;  4BKS A;  2WX1 A;  3L17 A;  4EOY A;  4F7Z A;  5J17 A;  2MWS B;  3A33 B;  1UGM A;  3O65 B;  2KK8 A;  2PE6 B;  3ZLZ A;  1WGG A;  4DHJ B;  3QC8 B;  1YD8 U;  3VUY A;  1WXS A;  3PRP B;  2CHZ A;  3WA0 A;  1OGW A;  2DYB A;  2MBH A;  2ZCC A;  2LRW A;  2LGY A;  1RFA A;  4II2 B;  5CX3 A;  4MGK E;  2FNJ B;  1J8C A;  2XK5 A;  5G55 A;  2KX0 A;  2MBE A;  3UQA A;  4TQ1 A;  1GJZ A;  1TBE A;  3QQ8 B;  2NVU I;  3AUL A;  5CHV C;  4EZK A;  2FID A;  1E90 A;  3PRM B;  2LGD A;  3RD2 A;  4I6L B;  3U8Z A;  3WIM A;  3QK0 A;  1WGD A;  3PRE A;  4YL8 A;  1P3Q U;  2D10 A;  2N9E B;  3N3K B;  4HWI B;  5AZG A;  2LUE A;  2MBQ A;  4XX5 A;  4ZRK A;  1WGR A;  3X23 A;  4M8M A;  2D3G A;  4DBG A;  3PT2 B;  3RT3 B;  1WMH A;  2JF5 A;  3ZTD A;  1WJU A;  2DZJ A;  4HDO A;  4JQW C;  4OVU A;  1UEL A;  2GOW A;  3HM3 A;  3WAP A;  3LDZ E;  1H4R A;  3ENE A;  3SHQ A;  3V62 A;  3W1Y A;  3ZDM C;  2LRU A;  3B0A A;  4KSL C;  3T8M A;  3UGB B;  1MG8 A;  1WJN A;  4IUM B;  2MX2 A;  3DVG Y;  1GC6 A;  3QCA A;  2MBO A;  2AL3 A;  2O2V B;  3I3T B;  4RM8 A;  3HIZ A;  3PTF C;  3VXW A;  4HVB A;  1E8W A;  4X57 B;  5E6O A;  3TBL D;  3H7P B;  2WDT B;  1WGH A;  2CHX A;  2KKC A;  3A1Q A;  4P7I A;  3KW5 B;  1Q5W B;  2FCM A;  3DOW A;  4AOF A;  2AL6 A;  2DX5 B;  3R66 C;  4GN1 A;  4A3P A;  3QAQ A;  1E8X A;  1KJT A;  3VTW A;  3APD A;  3HHM A;  2BYV E;  3BIN A;  4ANU A;  5KHQ A;  2OJR A;  3B1L X;  2VRR B;  2EMS A;  2V1Y A;  4B9K A;  2HD5 B;  4K1R B;  2KJH B;  4IG7 B;  2CU1 A;  3DBS A;  3DBL I;  2JRH A;  4NNJ B;  3PLU A;  1KLV A;  3UIO B;  1GG3 A;  1VD2 A;  5CTR C;  3UIN B;  3DVG X;  3ZUN A;  2KMA A;  3MHS D;  2KAN A;  1WZ3 A;  3PLV A;  1WI0 A;  2FIF A;  2LVP A;  4JGH B;  4HJK A;  4B6W A;  4KDL B;  3SDL C;  5DPS A;  2HTH A;  3CF6 E;  2HJ8 A;  2NPT B;  2RGF A;  2XBB C;  3ML9 A;  1GNU A;  3SD5 A;  2DAJ A;  5D94 A;  5FR6 A;  3APF A;  5DPR A;  1WIA A;  2J7Q B;  3M63 B;  2KC1 A;  4FUL A;  1U4A A;  1XQQ A;  3QJZ A;  1UBI A;  4NJ7 A;  4TV3 A;  4WJO A;  4ZYN A;  2PJH A;  4ZRI A;  2LXA A;  4K7U A;  5EDS A;  4IWO A;  2KDF B;  1J0G A;  2MP2 A;  1OTR B;  2DZI A;  3L0W B;  3NZU A;  4HK2 A;  2LI5 A;  3GOE A;  2ZNV C;  2V4L A;  2BPS A;  1WXA A;  4RM9 A;  2BGF A;  2C7N B;  3RUL A;  4NPN A;  4BKT A;  2IBI B;  4BOZ B;  4HLE A;  4W9G A;  2EKE C;  2KTR A;  2ZCB A;  2I1K A;  2NBU A;  1G6J A;  3WAN A;  2JY6 A;  4EZJ A;  1M94 A;  5CHW A;  5AZF A;  3K9P B;  4MSQ B;  3RYT A;  1WY8 A;  3VTV A;  4IM0 A;  1C1Y B;  2NCN A;  4HPM B;  3CMM B;  3VUW A;  2DZM A;  2KOX A;  2PPH A;  4DHZ E;  2BF8 B;  3K9O B;  3T9L A;  5E6N A;  3Q3F A;  2Z0E B;  4HCN B;  5IAA C;  3SU8 X;  2AYO B;  1NDD A;  2CKH B;  4GMV A;  2KX3 A;  1WGY A;  4BVU C;  2KO3 A;  3KVF B;  5HKH A;  1K8R B;  3H7P A;  2W9N A;  5J18 A;  3MTN B;  1WR1 A;  3D32 A;  4W9C A;  4FAD A;  2PE9 A;  2M17 A;  4JIO U;  3AU4 A;  2PEA A;  4AJY B;  3VHT C;  4AP4 C;  3BY4 B;  2MLB A;  4MGZ E;  4B95 A;  4LDT D;  4F1S A;  3H9D A;  2JPH A;  2K39 A;  4JLC A;  4PS3 A;  1GC7 A;  1V9J A;  2GBJ A;  2BWE S;  4LDT B;  1R4M I;  2NBW B;  5CHF A;  5D6J B;  4FJZ A;  2BYF A;  3AI5 A;  3PVL A;  1RRB A;  1EUV B;  3RUI B;  1UZX B;  1V49 A;  3ZNG C;  3ALB A;  4GDL B;  1Z5S B;  2GMI C;  3QX1 A;  3R3M A;  3A9K B;  4WJN A;  5DCN A;  2N7D A;  2HE7 A;  4GSW A;  2LZ6 A;  4WQO B;  3WAO A;  1E8Y A;  3IFW B;  2C5L C;  2DEN B;  2KFJ A;  4MGI E;  3R7Q A;  2MRP A;  3MJW A;  2G4S A;  3W1S C;  2L0T A;  2CHW A;  3CST A;  4IM3 A;  2FCN A;  3N32 A;  4GU2 A;  1WE7 A;  3QAR A;  4WWO A;  4AJW A;  1TZ1 A;  4GB9 A;  3ZDT A;  2DZK A;  2O6V D;  4KVG B;  4W9E A;  2IO3 B;  3ZNH B;  3JYU A;  2Z0D B;  1P1A A;  4FLH A;  3W1S A;  2Y5B B;  5C1Z A;  2O6V A;  2ZPN A;  4HCP B;  4ZDV A;  2D11 A;  1YQB A;  1XT9 B;  3DDC B;  4MM3 A;  1YIW A;  3ML8 A;  3RZF A;  2NS5 A;  2Z59 B;  2DYO A;  5J2R A;  3OLM D;  4W9I A;  3Q3J A;  4ICV A;  2N7E A;  4GDK B;  4K81 A;  5DPW A;  2KZR A;  2J0K A;  4RMA A;  4EUT A;  1KM7 A;  4G11 A;  1WJ6 A;  3ZRC A;  4TKN A;  1V5T A;  3JVZ X;  5AEK B;  4URK A;  1FXT B;  1YX5 B;  2JZ3 B;  3AXC A;  3VH3 B;  3RZW C;  1A5R A;  1P0R A;  3KUZ A;  3AU5 A;  4GOC A;  1WYW B;  2JRI B;  4TUU A;  2MSE D;  3DVN V;  4IC7 B;  3RCZ A;  3ZRF A;  2L05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...