1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
b'GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog B
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
4AOFA 1I35A 1MG8A 3A9JB 1P0RA 4W9IA 3W1SC 1WX9A 4MSMB 2GOWA 1WGYA 2NPTB 2M1MA 3ZNGC 3W1YA 2LGDA 4A20A 1WMHB 3ZNZB 3TJPA 1OTRB 2IYDB 3L08A 5AZGA 2CHZA 2NBUA 5G55A 5J18A 2WX1A 1YD8U 2KO3A 2N1WA 2FCSA 4W9CA 4WWNA 1JRUA 1WE6A 1V49A 2N4FA 3N30A 2RD0A 3TBLD 4KV2A 2NBWB 3CSTA 3PRPB 5E6OA 2C60A 3R7QA 3QCAA 1BT0A 2J0JA 2LXCA 1QZEA 2REXA 4GDKA 3WALA 2LGYA 3VVWB 5LLIA 1ISNA 2KMCA 1E8XA 3KUZA 2XK5B 2K39A 4E74A 4DHJB 2FUHB 3WAOA 1OEYA 4GDLA 1E8ZA 4LJOB 1LQBA 2M17A 1YQBA 3OJ4B 4W9HA 2KNBA 3AU5A 2Z0DB 3T8MA 2DZKA 2IY0B 3HM3A 1IYFA 1YJ1A 3VDZA 4A3PA 4WJPA 2KFKB 1GUAB 1R4NI 3JSVA 4IM3A 3VHTC 3A1QA 3L17A 2K8CA 1UD7A 1EO6A 3QJZA 2JXXA 4KIKA 2LZ6A 2M0XA 1U4AA 2KK8A 3IG3A 3APDA 2LASA 3ZLZA 4BBNF 2JF5A 4LJPB 3H7PA 2BYFA 4OVVA 4AWJA 3IVFA 2RPQA 1UBIA 1S3SG 3QK0A 3PGEA 3ZTCA 3PLUA 4GDKB 4HCPB 3PV1A 2DZIA 4DDGD 4BBNC 3DBSA 5DPWA 1OQYA 3MHSD 1RAXA 4OVUA 4LDTD 5DPTA 1ZGUB 2O2VA 4GDLB 1E8YA 3S2AA 2YVCA 3VUYA 1NI2A 2G4SA 4BOZB 3TCAA 4M8NA 1Q1OA 3I3TB 3N3KB 3U7DA 3VQIA 2GBKA 1WX8A 3JSVB 2MCNB 2IO1B 3DVNU 4WQOB 1WGRA 1E7VA 1EUVB 2KX3A 3A1QB 5L83A 3L13A 4KIKB 3V62A 3DDCB 3R3MA 4KZ0A 4G3XB 4TKNA 3PZDA 1XT9B 2LXAA 2LWPA 2KANA 3JYUA 4TQ1A 4MDKE 4W9JA 4X57B 1C1YB 1OEYJ 2R2OA 3SD5A 5BO4B 1WY8A 2R2QA 3VXWA 3NZUA 4B9KA 2ZPNA 4MGYE 1J19A 2FNJB 2KLCA 4E71A 3WAPA 3DVGY 4ZYNA 3H7SA 2B3AA 2K6QA 2BF8B 3EHVA 2N9PC 4W9GA 2O2VB 2PE9A 1P9DU 5C23A 2QHOA 3U8ZA 2BWES 2LRUA 4HWIB 4IM0A 4ANVA 1WGHA 1V2YA 2MWSB 2C9WB 4GXBA 1NBFC 3ZDMC 1IPGA 3QC8B 4G11A 5GMVA 4AJWA 1V86A 2JVCA 2MBQA 2J0KA 3D32A 1V80A 3MJWA 3ZKJC 1VD2A 2ZJDA 1TTNA 1WXSA 4FHJA 2M8SA 1WZ0A 4NJ6A 2ZNVC 2BYVE 3RZFA 1WF9A 4JL9A 3B0AA 4AP4C 3PS6A 5AEKB 4EZLA 2MRPA 2OOBB 2VRRB 3K9PB 2KOXA 1IP9A 1R4MI 4XZ4A 3IHPC 2KQ7A 3R66C 4F1SA 1J0GA 4NAWB 4PS3A 5L95C 1WRDB 5G2NA 3ZIMA 4HVBA 5LXIB 3W1SA 3KUCB 4FADA 2AL6A 3M62B 1LXDA 3A33B 3DBLI 3VFKA 4FA6A 3ZO5B 5D6JB 1HE8A 1Q0WB 1P98A 1UBQA 2A4ZA 2KTRA 2Z59B 2K1FA 4RM9A 1M94A 1KLVA 1KOTA 4CHKA 4ZDVA 3O65B 5AZFA 5HKHA 5FR6A 5KHOA 2KJHB 2ZCBA 3U30A 4MJSB 4W9LA 4NQLB 4RMAA 2KD0A 4EZKA 2K6DB 4W9FA 3PLVA 4NPNA 4DBGA 2KFJA 4DXAB 1G6JA 2NCNA 4EUTA 2D07B 4YL8A 4DHJD 4LCDE 1TBEA 1GG3A 4ZRIA 3KH0A 4DDID 3ENEA 4ICUA 2LD9A 1E90A 2BWFA 2MW5A 3DBRI 4F8CB 4GN1A 4N9F4 1AARA 2DYOA 3TIXA 1GC6A 2KTRB 2NVUI 1YX5B 2LRWA 2FCQA 3IBEA 5E6NA 1TGZB 1GNUA 4IM2A 2I1KA 2C5LC 4B95A 2O6VA 4ANWA 5LXHA 2IZVB 4ZRKA 1EF1A 2KQSA 2FCNA 3QWZB 4K7WA 5JH5C 4KDIC 3RD2A 3DOWA 3HIZA 1I42A 4BFRA 1WXVA 2KDIA 3VTUA 2M4NA 3VUXA 2RR9A 2JPHA 3QA8A 4FJVB 4BKSA 2MQJA 1A5RA 3PVLA 4GSWA 4CYEA 3P2BA 2PE6B 2KJ6A 3HHMA 3VTWA 2KJRA 1E7UA 2KVRA 1GC7A 3KUDB 5CHVC 4WWOA 2DENB 4IWPA 3WA0A 1D3ZA 4DHZB 2Y5BB 2HJ8A 1VCBA 1WJNA 4IUMB 1S1QB 2LVQA 2CU1A 2WDTB 4IW0A 4MSQB 2CS4A 3QHTA 2AL3A 4EZJA 4EKUA 1F9JA 2JT4B 4WWPA 2O6VB 4ANXA 4KSKC 3ZVVA 4PS8A 1UH6A 3ML8A 4P7IA 1XD3B 3QQ8B 3ZRFA 2BYEA 3QIJA 4G50A 1V9JA 4KDLB 3KYCD 2DZMA 2NS5A 3UIOB 3H7PB 4M0WB 3DVNV 3ML9A 1V5TA 4F7ZA 3QARA 4TUUA 1YX6B 1EF5A 4HLEA 1GJZA 2XBBC 4E3CA 1L7YA 5C1ZA 3NY5A 5AZHA 3V61A 2MLBA 3N32A 2WX0A 4FN2A 4DHZE 3UINB 3Q3JA 3DCGA 5D94A 1WJUA 2V4LA 2JZ3B 2C7NB 3OJ3A 2ZZPB 2K25A 2DHZA 1UGMA 2EMTA 3ONSA 3V6CB 3APCA 2UWQA 4IG7B 1WM3A 5JZEB 2WWZA 2V3SA 1T0YA 2MX2A 4MGIE 4BKTA 1Y8RC 4NQKE 2A5UA 1WXAA 4ASWC 4HDQA 3A9KA 2KXJA 1Q5WB 4NNJB 2LI5A 1P3QU 4AUQC 2MSED 2DAFA 3K9OB 4ANUA 1WZ3A 2N7EA 2L00B 4II3B 2PJHA 1E8WA 4ICVA 4TQ0A 3BY4B 3SDLC 2MBOA 2UYZB 4GMVA 3WANA 1SGHA 3QAQA 3WAMA 2BKRB 2XEWA 3CF6E 5DPRA 2AWTA 3A9JA 2KKCA 2BPSA 3RULA 1YIWA 3UQBA 2NPTA 2DX5B 2KWVB 2DAJA 2LJ5A 3LJ3A 4EOYA 3ZNID 5D7GA 4URKA 5CTRC 3VUWA 3X0WA 2L0FA 2ZEQA 4CO7A 2I1JA 2LVOA 1NDDA 4GU2A 3IFWB 4JLCA 4HPLB 1KJTA 4MH0E 4I6PA 4A3OA 4B6WA 4JIOU 2NR2A 4HXDA 3A9KB 2ZPYA 4W9DA 3ZW3A 4ZRJA 2MP2A 4I6NB 4GGQA 4PYZA 3RYTA 1XQQA 4W9EA 5DPSA 2KZRA 3DBHI 2YLMA 3ZTDA 2L0TA 2CR5A 2KWUB 1Z5SB 3AI5A 3KVFB 4HPMB 2L76A 2KDFB 2LVPA 3EC8A 4XX5A 3LDZE 3PHWB 4PYUA 3GOEA 4MELA 2XK5A 2IO2B 2W9NA 3NZSA 3PHXB 3TL5A 1WJ6A 4K1RB 3RCZA 2JZZA 5E6PA 2JRHA 5KHQA 4HK2A 2G4DB 2HD5B 4WJOA 4II2B 1LFDA 3UQAA 2CHXA 3NS8A 4K81A 2FIFA 3RUIB 2KFKA 1LM8B 3WIMA 3UGBB 2PEAA 4GIVA 4KZCA 3VH3B 2JUOA 2KN5A 2LGXA 3EFUA 4K7SA 4WJQA 5J17A 2GBMA 1V5OA 2BGFA 3EECA 3L0WB 1WIAA 1UELA 3X23A 4G0NB 2HTHA 2IO3B 2MP2B 2NBVB 2EKEC 1WXMA 1WX7A 3B08A 4IWOA 3SHQA 3L10B 5CHFA 2DYMA 1WR1A 3MTNB 3Q3FA 4EFOA 5EDSA 2D11A 2JRIB 3H9DA 3KYDD 5DCNA 2D3GA 2MBHA 2JY6A 4WJNA 4MGKE 1WGGA 3HM6X 3H6NA 3A4SC 1ZW7A 4DK5A 2C7HA 1P1AA 4MM3A 3GZNI 2DYBA 3CSFA 2GBRA 2GMIC 2O6VD 3DPDA 3H1UA 2OJRA 5TR5A 1WH3A 2LUEA 2CHWA 3M3JA 3CMMB 2K8HA 2KDBA 2V1YA 2FIDA 3SU8X 4BKGA 4HJKA 2N9XA 3PT2B 1CMXB 4JGHB 3VTVA 1WR6E 4BKSD 3PRZA 1X1MA 3V60A 2N7DA 2RGFA 2AEHA 2L7RA 3JW0X 2C7MB 4RM8A 2GBJA 2KHWB 2ZVOA 3OLMD 3PSEB 3TMPB 2RSUA 2MBBB 3V6EB 2KTFA 2G45B 1PQSA 3M63B 2L05A 2DZJA 2D10A 2KWCA 2PPHA 4WAAA 1L2NA 1WGDA 2Z0EB 4KSLC 1FXTB 2IY1B 1RRBA 3UF8A 4DWFA 5JHBA 1WJ4A 1Z2MA 2KX0A 3ZUNA 3NOBA 5CX3A 3UIPB 1RLFA 2IBIB 3PPAA 2EMSA 2J0MA 1WFYA 2N9EB 3L54A 2ZVNA 4JQWC 2N1VA 2FCMA 2IO0B 4KVGB 4PS7A 2WYQA 4LDTB 3DVGX 2AYOB 3ZDTA 1KM7A 3RT3B 3JVZX 4IWQA 4FULA 3NHEB 5JHAA 1K8RB 1ZKHA 3APFA 1TZ1A 3DQVA 2HE7A 2KMAA 2GBNA 4FBJB 3VAWA 3KW5B 1WM2A 1E5WA 4HCNB 1WE7A 2MA9B 4BOSC 2ZCCA 4XC2A 3RZWC 1RFAA 2BKFA 2ASQA 1WI0A 3AULA 4J6IA 1OGWA 1H4RA 3L16A 3R7RA 3AU4A 3A4RA 3PRMB 2JWZA 4NAWA 4GOCA 3ZRCA 4FJZA 4FHKA 2KDEB 3OAWA 4AJYB 4M8MA 3ZNHB 2L8JA 2KC2A 5IAAC 3B1LX 2L3ZA 1C3TA 3PTFC 1WMHA 2KLGA 1V6EA 3PREA 4W9KA 3ALBA 1V81A 2MBEA 3C0RB 4FJYA 5CHWA 3T9LA 4EEWA 5J2RA 2ZNVB 2KC1A 4HDOA 4TV3A 2K8BA 4IC7B 4MGZE 4MJSA 3ECIA 3M95A 4FLHA 4NJ7A 5D2MB 3VH4B 5IA7A 2CKHB 3QX1A 4K7UA 2FAZA 2D2QA 2G3QB 1SIFA 2J7QB 1UZXB 3BINA 1J8CA 1H8CA 4GB9A 1SE9A 3AXCA 4NY0A 4I6LB 3HK0A 1WYWB 4MEMA 4BVUC
chains in the Genus database with same CATH superfamily
2MH7A 1I35A 3HUIA 1WX9A 4PK1A 1PUTA 1N63A 2N9LA 2X8XX 4A20A 3TJPA 2IYDB 5AZGA 2WXFA 5G55A 2PW9A 2DBYA 1YD8U 2KO3A 1FIQA 1JRUA 1RFKA 3O13A 2WQYB 4KV2A 1FEHA 3CSTA 3PRPB 2H88B 4GDKA 3WALA 2LGYA 2GI9A 4E74A 1TS5A 2WXLA 1OEYA 1LQBA 2IY0B 1IYFA 4J3OD 1YJ1A 4LTUA 1F77A 4HEA1 4IM3A 3AN1A 3AV8A 5MPOA 3QJZA 3ZYYX 3APDA 3P4RB 3H7PA 3Q8FA 3IVFA 1UBIA 1S3SG 3PGEA 4GDKB 4HCPB 3BVZA 4BBNC 1MFWA 5DPWA 3MHSD 1RAXA 1FRDA 2KAJA 1ZPSA 1E8YA 2BW2A 1QLBB 1TYGB 3W2DA 2WDRB 3U7DA 2GBKA 1WX8A 1XEEA 3NS1A 2KDMA 2IO1B 4WQOB 1E7VA 1VZ8A 4RH6A 3DDCB 3R3MA 4MACA 4W9JA 4MDKE 1C1YB 3EFCA 2R2QA 3I57A 4B9KA 1J19A 4E71A 3AE9B 3AE6B 4ZYNA 2B3AA 1J7CA 4W9GA 2N9PC 1B9RA 5D3DA 4N59A 4HWIB 2C9WB 4JX1C 5GMVA 1QILA 4AJWA 2J0KA 3U7ZA 3MJWA 1WXSA 4FHJA 2GLSA 1SF0A 1CQVA 2ZNVC 3FKYA 4WH4A 1A70A 3RZFA 4AP4C 2INDC 3K9PB 1NVID 2E3TA 1GB1A 2KYWA 2LFIA 4B0EA 1J0GA 1JMLA 1TKYA 4LLGM 3ZIMA 1FRRA 3W1SA 4FADA 2AL6A 3M62B 3KQ4A 5AUKA 2K5PA 3GE3C 1HE8A 3Q69A 1SJED 1E6EB 1P98A 3NVWA 1M94A 1KOTA 3AB5A 4ZDVA 3BWUD 4N6EB 2NTSA 5FR6A 2KJHB 2PVGC 5C3JB 4W9LA 4NQLB 2KD0A 3MFGA 2K6DB 4DBGA 4NPNA 4DXAB 1BXTA 3Q8AA 4K3CA 2D07B 4LCDE 3BVMA 1E90A 1SSNA 3DBRI 1V1PA 3VRAB 1GC6A 4K3BA 2LRWA 2W55A 1GNUA 4IM2A 4ANWA 2O6VA 2LGIA 3VUXA 4XE0A 3RFZB 4BKSA 3PVLA 1SEBD 3CWIA 3HHMA 3VTWA 1E7UA 1GC7A 1V1PB 2MEKA 4IWPA 3WA0A 4P16A 1VCBA 4XDCA 2N0SB 2JU6X 5EE0A 1HA5A 2WXPA 4EZJA 1N5XA 2O6VB 4ANXA 1FCLA 4YTNB 1NYRA 1VZ6A 2VZKD 1UH6A 3ML8A 4A55A 3BIID 3AE3B 3ZRFA 2BYEA 3Q3NC 3KYCD 3KWLA 3UIOB 1V5TA 2RDBC 2KWDA 5C1ZA 3NY5A 3V61A 5FK9C 4DHZE 3Q3JA 1STEA 3DCGA 1QOFA 3SR6A 2JZ3B 1WM3A 3NUHB 2WWZA 2V3SA 1T6BX 5HFYA 2V3NA 3P4SB 2A5UA 1WXAA 4HDQA 1K51A 1Q5WB 4NNJB 2LI5A 4AUQC 1FD6A 2MJEA 3TUOA 4TQ0A 5FKAC 4GMVA 1SGHA 1TT5B 1AN8A 3CF6E 1V1OA 3DWMA 3RULA 1YIWA 2J53A 2QCZA 5HHDG 2LJ5A 1RWSA 3EGRA 1AW7A 3E9SA 2LVOA 1KJTA 1T5XD 4I6PA 4MH0E 4JIOU 2Q5WD 4HXDA 1AWDA 4US9A 4ARIA 4XDDA 4PYZA 1QQRA 4W9EA 3N1ZC 2KZRA 3ZTDA 1N5WA 2L76A 2KDFB 1ET9A 2KMMA 2LVPA 3EC8A 4PYUA 1FNVA 4XX5A 3GOEA 3NZSA 3PHXB 3TEWA 2JRHA 2HD5B 4A6QA 2BVCA 2QSDA 4RCOA 4KZCA 2WXQA 1EM7A 2JUOA 4TMAB 5J17A 1V5OA 4G0NB 2HTHA 2IO3B 2NBVB 2FUG1 2DYMA 1D5ZC 1WR1A 2D11A 3H9DA 2MBHA 4A8XC 1FFVA 1ZP0B 3H6NA 3VR8B 2GBRA 2OJRA 2CHWA 1CMXB 3BYTB 3PRZA 2RGFA 1TIFA 3T3NA 2KHWB 3OLMD 3PSEB 2MBBB 3EA6A 1PQSA 2KWCA 3UI3A 4KSLC 1FXTB 2IY1B 2NTTA 1SB3C 5JHBA 1XLNA 2FE8A 3ZUNA 2IBIB 2J0MA 2N9EB 2ZVNA 1D4BA 2WYQA 1F1HA 1HZ6A 1XXGA 3ZDTA 1C77A 4WAFA 1FPYA 1TZ1A 3DQVA 3VR9B 3VAWA 3KW5B 1WM2A 4HCNB 4KX6B 4XC2A 5BYSA 4ZYSA 2BKFA 2ASQA 4J6IA 3AULA 3R7RA 3AU4A 1J7BA 2WDVB 4GOCA 3Q2AC 4FJZA 2KDEB 4C4VB 3TSSA 4OW0A 2L3ZA 3ABVB 2KVZA 1KFYB 1V6EA 4W9KA 3AECB 1SE3A 3C0RB 2ZNVB 4HDOA 3NVVA 1FXAA 2K8BA 4MJSA 1KRHA 4NJ7A 5BMGA 3NZ3A 1C78A 1SIFA 2D3BA 2VH1A 2BB6A 1J8CA 2Y5CA 1SE9A 4I6LB 4BVUC 4W9IA 3W1SC 1FNWA 1SXTA 3IXSA 4MSMB 2GOWA 2NPTB 2M1MA 1C4PA 1CK1A 2LGDA 3RNBC 3W1YA 2L32A 2CHZA 2NBUA 2BYTA 3Q8EA 3ETRA 4WWNA 2Y3AA 4LNFA 1FO4A 1V49A 1LGRA 4KGTA 4RGOS 3N30A 3ZJUA 1IGDA 1L6UA 2C60A 3QCAA 1BT0A 2J0JA 2V3PA 2LXCA 2REXA 1L0XB 3VVWB 1IBXA 2PTLA 1ISNA 2KMCA 2XK5B 3WAOA 4GDLA 3OJ4B 3T8MA 3HM3A 3MC8A 3VDZA 2INCC 3VHTC 3L17A 2JXXA 2LZ6A 3AEFB 3ZLZA 2Y5PA 2RPQA 3ZTCA 3PLUA 1Q10A 2DZIA 3AEAB 3ZXVA 1JCKB 4OVUA 4LDTD 4GDLB 1Y56A 2N9KA 3S2AA 2YVCA 1NI2A 3W5VB 1EU4A 1LO5D 2G4SA 4EE2A 1HZ5A 3I3TB 3VQIA 1YJJA 1WGRA 5L83A 3CIRB 4TKNA 1ZDVA 2VH2A 1XT9B 3VXWA 2R2OA 5BO4B 3NZUA 2PVOD 2IDYA 2QC8A 4MGYE 2NMQA 3WAPA 3H7SA 1TKGA 2BF8B 1JROA 2XN9C 1XLOA 3E56A 4ARCA 5BYRA 2PE9A 1ZXHA 1D6EC 1R7SA 4XWTA 3U8ZA 2BWES 4IM0A 4ANVA 2JXTA 1IPGA 3QC8B 1TS4A 2MBQA 1V80A 4ZHOA 4MH8A 4NJ6A 3V3XA 1DOYA 1L0YB 2WXOA 1WF9A 3PS6A 2N7JA 4ZOHC 2PIAA 1R4MI 3NRZA 4FXCA 1NEKB 4NAWB 5L95C 4HVBA 4C7ZA 1LXDA 2JSVX 2A4ZA 2KTRA 2K1FA 2AQ1B 5AZFA 4RGNA 5KHOA 1L5PA 1TS3A 4RMAA 4EZKA 2KFJA 1G6JA 2K0PA 1GG3A 1WYGA 4DDID 3ENEA 2B76B 2BWFA 4GN1A 4N9F4 4LNOA 2DYOA 2PLPA 3N1YC 2KTRB 1FNUA 1IGCA 4C00A 5LXHA 4ZRKA 1EF1A 4KDIC 3RD2A 3HIZA 1I42A 4BFRA 5FR3A 3BZDB 3Q8CA 3BYYB 1UWMA 4GSWA 4M0WA 3P2BA 2OJWA 2KJRA 2KVRA 3ZGZA 2JQRB 1D3ZA 4DHZB 1K53A 1S1QB 2LVQA 4ZHPA 1GAQB 4EKUA 1F9JA 2JT4B 4WWPA 3P42A 3ZVVA 1C79A 3QIJA 2IPKD 2NS5A 1I4PA 3H7PB 1YJIA 4M0WB 1YX6B 1EF5A 1NYQA 4HLEA 4E3CA 3AE2B 3HRDD 2MLBA 2WX0A 1XO3A 5D3IB 4XYCA 5D94A 2V4LA 2UWQA 4RF0A 1TZOA 2SEBD 1T0YA 2MX2A 2JZPA 4PT5A 3KWVA 1Y8RC 2CJNA 1DOXA 3B9JA 2KXJA 3U2SC 2FBWB 3K9OB 3BY4B 3SDLC 2UYZB 1TJEA 1NENB 3B2FA 3WAMA 1DGJA 1F0ZA 3A9JA 4NJCA 2BPSA 1ESFA 2BT6A 2DX5B 2KWVB 2DAJA 3LJ3A 1BMLC 3VUWA 2YEPF 2L0FA 1QF6A 3DHGC 4GU2A 4HPLB 4A3OA 4YWGG 1VZ7A 2NR2A 3I63C 2INNE 2I2YA 2JYEA 4I6NB 4GGQA 3RN9C 3RYTA 1C4AA 5DPSA 2QEJC 3DBHI 3AI5A 3C19A 3MC0B 3LDZE 3PHWB 2IO2B 2W9NA 1WJ6A 4K1RB 3RCZA 5E6PA 3PZ7A 3GP7A 3UQAA 1OQQA 3NS8A 3WIMA 3RUIB 2KFKA 4QAYA 1I7HA 2PEAA 2KN5A 2WXMA 2BGFA 3EECA 1WIAA 5T8IA 2RPVA 1V8CA 1WX7A 4IWOA 5CHFA 5EDSA 1KH0A 5DCNA 2DWQA 2QIEB 4M01A 1ACCA 3A4SC 1CJEA 4DK5A 2C7HA 2L83A 3GZNI 2GMIC 2O6VD 1JRPA 1FFUA 3H1UA 5TR5A 1UGJA 2LUEA 2K8HA 3RNEC 1I4GA 3PT2B 4JGHB 4BKSD 3NVYA 3V60A 1X1MA 2N7DA 4US8A 4RM8A 2RSUA 1ROEA 3UF8A 3Q3OC 1RRBA 4B0MA 4DWFA 1WJ4A 3P1MA 2KX0A 1BUIC 3UIPB 2PMVA 4YSYB 4KKJA 1WFYA 1I4XA 3T3OA 2QILA 3FILA 1VRAB 1SE4A 3J9CA 2AYOB 1KM7A 4KKIA 3ZJVA 3NHEB 4M02A 1ZKHA 3APFA 2KMAA 3FC4A 1TS2A 1E9MA 1L6VA 4LK0M 1RFAA 1FXIA 1H4RA 3L16A 3LYYA 1RM6C 4AJYB 4M8MA 3ZNHB 2L8JA 3FILB 3W9CB 1K50A 3PZ8A 1N61A 2LHDA 1WMHA 1PGBA 3N1XC 2WGSA 3T9LA 3BK2A 4IC7B 1T3QA 4FLHA 4LNIA 5IA7A 4XWWA 4YSZB 4NY0A 2ONQA 1WYWB 1PGAA 1I4HA 1MG8A 3WCQA 2M19A 3DHHC 4REZA 4OZAA 1WGYA 3ZNGC 2W3RA 1WMHB 3ZNZB 1OTRB 1WSPA 3L08A 1T0SC 2DNFA 2WX1A 2N1WA 4W9CA 3LB8C 2YEPB 4O1NA 2K9XA 2N4FA 4LNNA 1ZXIA 2BQQA 2LEKA 3TBLD 2BTEA 1L4DB 3Q6BA 4NAMA 3R7QA 1QZEA 2Z8LA 5LLIA 3KUZA 2K39A 4DHJB 2FUHB 4LJOB 4W9HA 1YQBA 2KNBA 3AU5A 3RNAC 3DBRB 3FAHA 3A1QA 2K8CA 4KIKA 4RNAA 2M0XA 1CZPA 1U4AA 3IG3A 2LASA 1SIJA 3GB1A 2GB1A 2JF5A 4LJPB 4OZCA 4OVVA 1EWYC 4DDGD 3DBSA 1HXYD 3DWGC 1VJKA 5DPTA 5IKCM 2O2VA 1PDXA 1Q1OA 3RNFC 3N20C 3DVNU 3GZNB 3NVZA 4P1BC 2KX3A 3A1QB 1T0QC 4DXGA 3L13A 4KIKB 4KZ0A 5BMHA 1L0VB 4G3XB 3AE1B 1HTQA 3PZDA 1C3TA 1OEYJ 1JW9D 2ZPNA 3AM9A 2CJOA 2K6QA 3BK1A 1GOZA 3EHVA 1NI3A 2O2VB 1P9DU 2QHOA 4GXBA 3ZDMC 4IDIA 2V4IB 3D32A 2ZJDA 2M8SA 3V05A 2M0AA 2ACZB 1L4ZB 2BYVE 1ZDXA 2WXKA 3IAS1 1JQ4A 1RYJA 5AEKB 4EZLA 2MRPA 4IOIE 3MC9A 4XZ4A 4JE3B 2KQ7A 3R66C 3U52E 4F1SA 4PS3A 3AE5B 1QOGA 4S0RA 1F2RI 5LXIB 1E7PB 3KUCB 3VFKA 4FA6A 3ZO5B 1UBQA 2Z59B 4WQMA 4NZLB 2QDFA 4CHKA 1J7AA 5HI1A 3AE8B 4HJGE 4MJSB 3OG5A 2INPE 2MJ3A 4W9FA 4BAXA 5HG2A 2NCNA 4EUTA 4YL8A 4OHJA 1TBEA 2J42A 2MW5A 4F8CB 4L2YA 4ACFA 1AARA 2W82A 3AE4B 2OEDA 4RFBA 4RGMA 1N6ZA 5E6NA 1TGZB 2D3AA 2H89B 2IZVB 1C76A 2KQSA 5JH5C 4C56C 5C2TB 1P7FA 2OHFA 2M4NA 2RR9A 1YN4A 1E0ZA 3QA8A 3RMKC 4FJVB 2MQJA 1A5RA 4BZAA 4CYEA 2PE6B 1ET6A 2RDHA 1YOVB 1KTKA 5CHVC 4WWOA 1IBXB 1PYWD 2BS3B 2E6XA 2WU5B 2LMCA 1WJNA 1JWMD 3ZXRA 1UUPA 4MSQB 2CS4A 3QHTA 5H8YE 1UNSA 1JWSD 4KSKC 1F52A 3I9V1 4PS8A 4P7IA 1XD3B 1QKZA 4D2KA 4G50A 2V0GA 4KGRA 2DZMA 3ML9A 4ZRPA 3QARA 2WU2B 1GJZA 1FMAD 1GPXA 2XBBC 4RF1A 1L7YA 3P4PB 2ON8A 5AZHA 3N32A 3ZQ4A 1WJUA 3AH7A 2TSSA 2ZZPB 2K25A 2BS2B 2DHZA 3APCA 2EKIA 2KACA 5JZEB 1EU3A 1MVKA 4BKTA 4NQKE 1MHXA 4ASWC 3A9KA 2WS3B 2HJ1A 2DAFA 4ANUA 1WZ3A 4II3B 4ICVA 3QAQA 1N62A 2BKRB 2XEWA 5DPRA 1WRIA 3Q3MC 1I4QA 2WXIA 4EOYA 3ZNID 5D7GA 1HQRD 3SFEB 3X0WA 2ZEQA 4CO7A 2I1JA 1NDDA 3IFWB 2WXNA 4YSXB 3A9KB 2ZPYA 4W9DA 3U4EG 2WHIA 2MP2A 1JALA 2EELA 3EUB2 3GE8C 2L0TA 3KVFB 4MELA 3AEDB 4JWSC 2JZZA 2G4DB 2ZW0A 4WJOA 4USAA 2WXJA 4II2B 1LFDA 4CQNA 3UGBB 4GIVA 3VH3B 4WJQA 5IN7A 2GBMA 4DQOC 1UELA 2HTME 2J52A 2MP2B 1YQ4B 1WXMA 2EKEC 2IJ0A 3B08A 3SHQA 3L10B 5IO9A 3MTNB 4EFOA 2JRIB 3KYDD 4WJNA 4MGKE 3HM6X 1P7EA 5G5HA 2M56B 1P1AA 2DYBA 1MI0A 4YTMB 2MHJA 3M3JA 2V1YA 2KDBA 3SU8X 4WIPA 4BKGA 4HJKA 2N9XA 2J4XA 3VTVA 2L7RA 1SBBB 2GBJA 3V6EB 3MHZA 2KTFA 3M63B 4WAAA 3URYA 1XLQA 2PPHA 2W54A 2SAKA 1VR9A 1WGDA 2CU3A 4S17A 3NOBA 4GLSC 5CX3A 3PPAA 2KT7A 4JQWC 2N1VA 1QOAA 2FCMA 2IO0B 4WWMA 4ITKA 4JPSA 1ZUD2 3DVGX 3JVZX 5I4DA 4FULA 4OZBA 3R8BA 1TKEA 2GBNA 4FBJB 4P1CC 1TY0A 3NJTA 1KLUD 1OGWA 3A4RA 2LUMA 3ZRCA 2JX5A 3LXFA 2KC2A 5IAAC 2W3SA 1WGKA 1C4CA 2KLGA 3PREA 3ALBA 1V81A 2MBEA 2GRIA 4FJYA 5CHWA 4EEWA 2KC1A 3KLSX 4MGZE 3M95A 2IGGA 5D2MB 5LNK1 3QX1A 4K7UA 2FAZA 2D2QA 2G3QB 5BMIA 2I38A 3BINA 4AQ7A 1N60A 1WXQA 3IT6B 1MG4A 3RNGC 3AEGB 4AOFA 2G1EA 1P0RA 3A9JB 5BYQA 1R4MB 1HEZE 3RPFC 4Q2JA 5J18A 1PGXA 2FCSA 5IP4D 2LGSA 1OFFA 1WE6A 2RD0A 1TY2A 1VDVA 1ENFA 1FM0D 2NBWB 5E6OA 1ZE3D 1QOBA 1YN5A 3IT4B 2XNAC 1SJHD 2HDEA 1E8XA 5EE9A 2WXGA 1E8ZA 3VRBB 2M17A 5IOIA 2IGHA 2Z0DB 2DZKA 4A3PA 4WJPA 2KFKB 1GUAB 1R4NI 3JSVA 4HKZE 2ZW1A 1UD7A 1EO6A 4BBNF 2KK8A 3L4PA 2BYFA 4AWJA 3QK0A 3PV1A 1MPEA 2X38A 1OQYA 1XCQL 1YMHE 1ZGUB 2R61A 3VUYA 4BOZB 3TCAA 4M8NA 3N3KB 1D5XC 5HKHA 2BBCA 3JSVB 2MCNB 1V97A 1EUVB 4H2AA 3V62A 2LXAA 2LWPA 3JYUA 2KANA 4TQ1A 3SD5A 4X57B 1YNTE 1WY8A 2AQ3B 1B1ZA 1AYFA 2VZKB 2DLBA 2FNJB 2KLCA 3DVGY 2LHEA 4A9AA 4RGTA 3Q14C 4HROA 5C23A 2LRUA 2WP9B 3AEEB 1PFDA 1WGHA 1V2YA 2MWSB 1NBFC 4G11A 2K3UA 1V86A 2JVCA 5G5GA 3ZKJC 1VD2A 1TTNA 1WWTA 3I5JC 1WZ0A 2JYTA 4DXFA 3HVZA 1KLGD 2KQ4X 4JL9A 3B0AA 4ZRQA 2VRRB 2OOBB 3Q8BA 2KOXA 1IP9A 3IHPC 1WRDB 2L1AA 2L52A 5G2NA 4YTPB 3A33B 3DBLI 5D6JB 1Q0WB 3ZJTA 1F2RC 2G9HD 4RM9A 4AS1A 1YN3A 3GS2A 1KLVA 3O65B 3P63A 2ZCBA 3U30A 3PLVA 4TSSA 4L23A 4DHJD 4C7YA 4ZRIA 3KH0A 4ICUA 2LD9A 1QT9A 5GXGB 4C80A 3DBHB 2K22A 3TIXA 2NVUI 1YX5B 2FCQA 1GB4A 1D5MC 4HRSA 3AEBB 1DYQA 3IBEA 3C8YA 2I1KA 2C5LC 4B95A 4K7WA 2D5GA 2FCNA 1HTOA 3QWZB 3DOWA 1WXVA 2KDIA 3VTUA 1SE2A 1IUEA 2JPHA 1MHHE 3BVGA 3P4QB 1ZOYB 1XLPA 2BB5A 2KJ6A 4L1BA 3KUDB 2DENB 2Y5BB 2QMTA 2HJ8A 4IUMB 2CU1A 2WDTB 4IW0A 2AL3A 3PO0A 1R4NB 5EE3A 3QQ8B 1V9JA 4KDLB 3DVNV 4F7ZA 4IKGA 4TUUA 1MJDA 1T0RC 3AMZA 4C4VA 4FN2A 3UINB 1JWUD 3AE7B 2C7NB 3OJ3A 3V6CB 2EMTA 1UGMA 3ONSA 4IG7B 1JWBD 3HVDA 3DHIC 4MGIE 1DOIA 1P3QU 2MSED 4P6VF 2N7EA 2L00B 2PJHA 1E8WA 2MBOA 4YXDB 3WANA 4YT0B 4XGAB 1OQRA 2AWTA 2AX5A 2KKCA 4HPPA 3UQBA 3OWEB 2NPTA 5EE1A 4URKA 4N58A 5CTRC 1C9FA 1XF5L 4JLCA 4B6WA 3R2IA 2UU7A 3R2TA 1KF6B 3ZW3A 4ZRJA 2QJLA 1XQQA 5H92C 3NG0A 2YLMA 2CR5A 2KWUB 1Z5SB 4HPMB 4UDUC 1UF0A 2XK5A 3TL5A 5KHQA 4HK2A 5TSSA 4A90A 4K81A 2CHXA 2MJDA 2FIFA 2RMMA 1LM8B 3DBLB 4MT5A 3TEYA 2LGXA 4K7SA 3EFUA 2RDGA 3L0WB 2WXHA 3X23A 1EWCA 3Q3FA 3IAM1 3MP9A 2D3GA 4LNKA 5JXVA 2JY6A 1WGGA 3TEXA 3W5UB 1ZW7A 3SFDB 2PKOA 1I4RA 4MM3A 3CSFA 3H8HA 4R3DA 5AUIA 3DPDA 1WH3A 1M4VA 3B2GA 2LJIA 3CMMB 2FIDA 1UWXA 2BS4B 4WURA 1WR6E 3N9YC 3TEZA 2AEHA 1E10A 2WLBA 3JW0X 2C7MB 2ZVOA 2KN4A 3TMPB 1VLBA 2D3CA 2G45B 2L05A 2DZJA 2D10A 1L2NA 3MJ5A 2Z0EB 1Z2MA 4MM3B 2ICIA 1RLFA 5E6JA 2EMSA 3L54A 2WDQB 4KVGB 1YQ3B 2IGDA 4PS7A 4LDTB 4OVZA 3RT3B 4IWQA 5JHAA 1K8RB 2HE7A 1E5WA 3RI7C 1WE7A 2MA9B 4BOSC 2ZCCA 1JWAD 3RZWC 1WI0A 3PRMB 2JWZA 4NAWA 3RNCC 4FHKA 3OAWA 2WNMA 2AQ2B 4JWUC 1K52A 3B1LX 3PTFC 1FCCC 4KGSA 5J2RA 4TV3A 1XCTL 2JWUA 2WXRA 3ECIA 4HKQA 3VH4B 2CKHB 3SEBA 2J7QB 1UZXB 1H8CA 4M00A 4GB9A 3AXCA 3HK0A 2V9HA 4MEMA
chains in the Genus database with same CATH topology
4AOFA 1I35A 1MG8A 3A9JB 1P0RA 4W9IA 3W1SC 1WX9A 4MSMB 2GOWA 1WGYA 2NPTB 2M1MA 3ZNGC 3W1YA 2LGDA 4A20A 1WMHB 3ZNZB 3TJPA 1OTRB 2IYDB 3L08A 5AZGA 2CHZA 2NBUA 5G55A 5J18A 2WX1A 1YD8U 2KO3A 2N1WA 2FCSA 4W9CA 4WWNA 1JRUA 1WE6A 1V49A 2N4FA 3N30A 2RD0A 3TBLD 4KV2A 2NBWB 3CSTA 3PRPB 5E6OA 2C60A 3R7QA 3QCAA 1BT0A 2J0JA 2LXCA 1QZEA 2REXA 4GDKA 3WALA 2LGYA 3VVWB 5LLIA 1ISNA 2KMCA 1E8XA 3KUZA 2XK5B 2K39A 4E74A 4DHJB 2FUHB 3WAOA 1OEYA 4GDLA 1E8ZA 4LJOB 1LQBA 2M17A 1YQBA 3OJ4B 4W9HA 2KNBA 3AU5A 2Z0DB 3T8MA 2DZKA 2IY0B 3HM3A 1IYFA 1YJ1A 3VDZA 4A3PA 4WJPA 2KFKB 1GUAB 1R4NI 3JSVA 4IM3A 3VHTC 3A1QA 3L17A 2K8CA 1UD7A 1EO6A 3QJZA 2JXXA 4KIKA 2LZ6A 2M0XA 1U4AA 2KK8A 3IG3A 3APDA 2LASA 3ZLZA 4BBNF 2JF5A 4LJPB 3H7PA 2BYFA 4OVVA 4AWJA 3IVFA 2RPQA 1UBIA 1S3SG 3QK0A 3PGEA 3ZTCA 3PLUA 4GDKB 4HCPB 3PV1A 2DZIA 4DDGD 4BBNC 3DBSA 5DPWA 1OQYA 3MHSD 1RAXA 4OVUA 4LDTD 5DPTA 1ZGUB 2O2VA 4GDLB 1E8YA 3S2AA 2YVCA 3VUYA 1NI2A 2G4SA 4BOZB 3TCAA 4M8NA 1Q1OA 3I3TB 3N3KB 3U7DA 3VQIA 2GBKA 1WX8A 3JSVB 2MCNB 2IO1B 3DVNU 4WQOB 1WGRA 1E7VA 1EUVB 2KX3A 3A1QB 5L83A 3L13A 4KIKB 3V62A 3DDCB 3R3MA 4KZ0A 4G3XB 4TKNA 3PZDA 1XT9B 2LXAA 2LWPA 2KANA 3JYUA 4TQ1A 4MDKE 4W9JA 4X57B 1C1YB 1OEYJ 2R2OA 3SD5A 5BO4B 1WY8A 2R2QA 3VXWA 3NZUA 4B9KA 2ZPNA 4MGYE 1J19A 2FNJB 2KLCA 4E71A 3WAPA 3DVGY 4ZYNA 3H7SA 2B3AA 2K6QA 2BF8B 3EHVA 2N9PC 4W9GA 2O2VB 2PE9A 1P9DU 5C23A 2QHOA 3U8ZA 2BWES 2LRUA 4HWIB 4IM0A 4ANVA 1WGHA 1V2YA 2MWSB 2C9WB 4GXBA 1NBFC 3ZDMC 1IPGA 3QC8B 4G11A 5GMVA 4AJWA 1V86A 2JVCA 2MBQA 2J0KA 3D32A 1V80A 3MJWA 3ZKJC 1VD2A 2ZJDA 1TTNA 1WXSA 4FHJA 2M8SA 1WZ0A 4NJ6A 2ZNVC 2BYVE 3RZFA 1WF9A 4JL9A 3B0AA 4AP4C 3PS6A 5AEKB 4EZLA 2MRPA 2OOBB 2VRRB 3K9PB 2KOXA 1IP9A 1R4MI 4XZ4A 3IHPC 2KQ7A 3R66C 4F1SA 1J0GA 4NAWB 4PS3A 5L95C 1WRDB 5G2NA 3ZIMA 4HVBA 5LXIB 3W1SA 3KUCB 4FADA 2AL6A 3M62B 1LXDA 3A33B 3DBLI 3VFKA 4FA6A 3ZO5B 5D6JB 1HE8A 1Q0WB 1P98A 1UBQA 2A4ZA 2KTRA 2Z59B 2K1FA 4RM9A 1M94A 1KLVA 1KOTA 4CHKA 4ZDVA 3O65B 5AZFA 5HKHA 5FR6A 5KHOA 2KJHB 2ZCBA 3U30A 4MJSB 4W9LA 4NQLB 4RMAA 2KD0A 4EZKA 2K6DB 4W9FA 3PLVA 4NPNA 4DBGA 2KFJA 4DXAB 1G6JA 2NCNA 4EUTA 2D07B 4YL8A 4DHJD 4LCDE 1TBEA 1GG3A 4ZRIA 3KH0A 4DDID 3ENEA 4ICUA 2LD9A 1E90A 2BWFA 2MW5A 3DBRI 4F8CB 4GN1A 4N9F4 1AARA 2DYOA 3TIXA 1GC6A 2KTRB 2NVUI 1YX5B 2LRWA 2FCQA 3IBEA 5E6NA 1TGZB 1GNUA 4IM2A 2I1KA 2C5LC 4B95A 2O6VA 4ANWA 5LXHA 2IZVB 4ZRKA 1EF1A 2KQSA 2FCNA 3QWZB 4K7WA 5JH5C 4KDIC 3RD2A 3DOWA 3HIZA 1I42A 4BFRA 1WXVA 2KDIA 3VTUA 2M4NA 3VUXA 2RR9A 2JPHA 3QA8A 4FJVB 4BKSA 2MQJA 1A5RA 3PVLA 4GSWA 4CYEA 3P2BA 2PE6B 2KJ6A 3HHMA 3VTWA 2KJRA 1E7UA 2KVRA 1GC7A 3KUDB 5CHVC 4WWOA 2DENB 4IWPA 3WA0A 1D3ZA 4DHZB 2Y5BB 2HJ8A 1VCBA 1WJNA 4IUMB 1S1QB 2LVQA 2CU1A 2WDTB 4IW0A 4MSQB 2CS4A 3QHTA 2AL3A 4EZJA 4EKUA 1F9JA 2JT4B 4WWPA 2O6VB 4ANXA 4KSKC 3ZVVA 4PS8A 1UH6A 3ML8A 4P7IA 1XD3B 3QQ8B 3ZRFA 2BYEA 3QIJA 4G50A 1V9JA 4KDLB 3KYCD 2DZMA 2NS5A 3UIOB 3H7PB 4M0WB 3DVNV 3ML9A 1V5TA 4F7ZA 3QARA 4TUUA 1YX6B 1EF5A 4HLEA 1GJZA 2XBBC 4E3CA 1L7YA 5C1ZA 3NY5A 5AZHA 3V61A 2MLBA 3N32A 2WX0A 4FN2A 4DHZE 3UINB 3Q3JA 3DCGA 5D94A 1WJUA 2V4LA 2JZ3B 2C7NB 3OJ3A 2ZZPB 2K25A 2DHZA 1UGMA 2EMTA 3ONSA 3V6CB 3APCA 2UWQA 4IG7B 1WM3A 5JZEB 2WWZA 2V3SA 1T0YA 2MX2A 4MGIE 4BKTA 1Y8RC 4NQKE 2A5UA 1WXAA 4ASWC 4HDQA 3A9KA 2KXJA 1Q5WB 4NNJB 2LI5A 1P3QU 4AUQC 2MSED 2DAFA 3K9OB 4ANUA 1WZ3A 2N7EA 2L00B 4II3B 2PJHA 1E8WA 4ICVA 4TQ0A 3BY4B 3SDLC 2MBOA 2UYZB 4GMVA 3WANA 1SGHA 3QAQA 3WAMA 2BKRB 2XEWA 3CF6E 5DPRA 2AWTA 3A9JA 2KKCA 2BPSA 3RULA 1YIWA 3UQBA 2NPTA 2DX5B 2KWVB 2DAJA 2LJ5A 3LJ3A 4EOYA 3ZNID 5D7GA 4URKA 5CTRC 3VUWA 3X0WA 2L0FA 2ZEQA 4CO7A 2I1JA 2LVOA 1NDDA 4GU2A 3IFWB 4JLCA 4HPLB 1KJTA 4MH0E 4I6PA 4A3OA 4B6WA 4JIOU 2NR2A 4HXDA 3A9KB 2ZPYA 4W9DA 3ZW3A 4ZRJA 2MP2A 4I6NB 4GGQA 4PYZA 3RYTA 1XQQA 4W9EA 5DPSA 2KZRA 3DBHI 2YLMA 3ZTDA 2L0TA 2CR5A 2KWUB 1Z5SB 3AI5A 3KVFB 4HPMB 2L76A 2KDFB 2LVPA 3EC8A 4XX5A 3LDZE 3PHWB 4PYUA 3GOEA 4MELA 2XK5A 2IO2B 2W9NA 3NZSA 3PHXB 3TL5A 1WJ6A 4K1RB 3RCZA 2JZZA 5E6PA 2JRHA 5KHQA 4HK2A 2G4DB 2HD5B 4WJOA 4II2B 1LFDA 3UQAA 2CHXA 3NS8A 4K81A 2FIFA 3RUIB 2KFKA 1LM8B 3WIMA 3UGBB 2PEAA 4GIVA 4KZCA 3VH3B 2JUOA 2KN5A 2LGXA 3EFUA 4K7SA 4WJQA 5J17A 2GBMA 1V5OA 2BGFA 3EECA 3L0WB 1WIAA 1UELA 3X23A 4G0NB 2HTHA 2IO3B 2MP2B 2NBVB 2EKEC 1WXMA 1WX7A 3B08A 4IWOA 3SHQA 3L10B 5CHFA 2DYMA 1WR1A 3MTNB 3Q3FA 4EFOA 5EDSA 2D11A 2JRIB 3H9DA 3KYDD 5DCNA 2D3GA 2MBHA 2JY6A 4WJNA 4MGKE 1WGGA 3HM6X 3H6NA 3A4SC 1ZW7A 4DK5A 2C7HA 1P1AA 4MM3A 3GZNI 2DYBA 3CSFA 2GBRA 2GMIC 2O6VD 3DPDA 3H1UA 2OJRA 5TR5A 1WH3A 2LUEA 2CHWA 3M3JA 3CMMB 2K8HA 2KDBA 2V1YA 2FIDA 3SU8X 4BKGA 4HJKA 2N9XA 3PT2B 1CMXB 4JGHB 3VTVA 1WR6E 4BKSD 3PRZA 1X1MA 3V60A 2N7DA 2RGFA 2AEHA 2L7RA 3JW0X 2C7MB 4RM8A 2GBJA 2KHWB 2ZVOA 3OLMD 3PSEB 3TMPB 2RSUA 2MBBB 3V6EB 2KTFA 2G45B 1PQSA 3M63B 2L05A 2DZJA 2D10A 2KWCA 2PPHA 4WAAA 1L2NA 1WGDA 2Z0EB 4KSLC 1FXTB 2IY1B 1RRBA 3UF8A 4DWFA 5JHBA 1WJ4A 1Z2MA 2KX0A 3ZUNA 3NOBA 5CX3A 3UIPB 1RLFA 2IBIB 3PPAA 2EMSA 2J0MA 1WFYA 2N9EB 3L54A 2ZVNA 4JQWC 2N1VA 2FCMA 2IO0B 4KVGB 4PS7A 2WYQA 4LDTB 3DVGX 2AYOB 3ZDTA 1KM7A 3RT3B 3JVZX 4IWQA 4FULA 3NHEB 5JHAA 1K8RB 1ZKHA 3APFA 1TZ1A 3DQVA 2HE7A 2KMAA 2GBNA 4FBJB 3VAWA 3KW5B 1WM2A 1E5WA 4HCNB 1WE7A 2MA9B 4BOSC 2ZCCA 4XC2A 3RZWC 1RFAA 2BKFA 2ASQA 1WI0A 3AULA 4J6IA 1OGWA 1H4RA 3L16A 3R7RA 3AU4A 3A4RA 3PRMB 2JWZA 4NAWA 4GOCA 3ZRCA 4FJZA 4FHKA 2KDEB 3OAWA 4AJYB 4M8MA 3ZNHB 2L8JA 2KC2A 5IAAC 3B1LX 2L3ZA 1C3TA 3PTFC 1WMHA 2KLGA 1V6EA 3PREA 4W9KA 3ALBA 1V81A 2MBEA 3C0RB 4FJYA 5CHWA 3T9LA 4EEWA 5J2RA 2ZNVB 2KC1A 4HDOA 4TV3A 2K8BA 4IC7B 4MGZE 4MJSA 3ECIA 3M95A 4FLHA 4NJ7A 5D2MB 3VH4B 5IA7A 2CKHB 3QX1A 4K7UA 2FAZA 2D2QA 2G3QB 1SIFA 2J7QB 1UZXB 3BINA 1J8CA 1H8CA 4GB9A 1SE9A 3AXCA 4NY0A 4I6LB 3HK0A 1WYWB 4MEMA 4BVUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOF A;  1I35 A;  1MG8 A;  3A9J B;  1P0R A;  4W9I A;  3W1S C;  1WX9 A;  4MSM B;  2GOW A;  1WGY A;  2NPT B;  2M1M A;  3ZNG C;  3W1Y A;  2LGD A;  4A20 A;  1WMH B;  3ZNZ B;  3TJP A;  1OTR B;  2IYD B;  3L08 A;  5AZG A;  2CHZ A;  2NBU A;  5G55 A;  5J18 A;  2WX1 A;  1YD8 U;  2KO3 A;  2N1W A;  2FCS A;  4W9C A;  4WWN A;  1JRU A;  1WE6 A;  1V49 A;  2N4F A;  3N30 A;  2RD0 A;  3TBL D;  4KV2 A;  2NBW B;  3CST A;  3PRP B;  5E6O A;  2C60 A;  3R7Q A;  3QCA A;  1BT0 A;  2J0J A;  2LXC A;  1QZE A;  2REX A;  4GDK A;  3WAL A;  2LGY A;  3VVW B;  5LLI A;  1ISN A;  2KMC A;  1E8X A;  3KUZ A;  2XK5 B;  2K39 A;  4E74 A;  4DHJ B;  2FUH B;  3WAO A;  1OEY A;  4GDL A;  1E8Z A;  4LJO B;  1LQB A;  2M17 A;  1YQB A;  3OJ4 B;  4W9H A;  2KNB A;  3AU5 A;  2Z0D B;  3T8M A;  2DZK A;  2IY0 B;  3HM3 A;  1IYF A;  1YJ1 A;  3VDZ A;  4A3P A;  4WJP A;  2KFK B;  1GUA B;  1R4N I;  3JSV A;  4IM3 A;  3VHT C;  3A1Q A;  3L17 A;  2K8C A;  1UD7 A;  1EO6 A;  3QJZ A;  2JXX A;  4KIK A;  2LZ6 A;  2M0X A;  1U4A A;  2KK8 A;  3IG3 A;  3APD A;  2LAS A;  3ZLZ A;  4BBN F;  2JF5 A;  4LJP B;  3H7P A;  2BYF A;  4OVV A;  4AWJ A;  3IVF A;  2RPQ A;  1UBI A;  1S3S G;  3QK0 A;  3PGE A;  3ZTC A;  3PLU A;  4GDK B;  4HCP B;  3PV1 A;  2DZI A;  4DDG D;  4BBN C;  3DBS A;  5DPW A;  1OQY A;  3MHS D;  1RAX A;  4OVU A;  4LDT D;  5DPT A;  1ZGU B;  2O2V A;  4GDL B;  1E8Y A;  3S2A A;  2YVC A;  3VUY A;  1NI2 A;  2G4S A;  4BOZ B;  3TCA A;  4M8N A;  1Q1O A;  3I3T B;  3N3K B;  3U7D A;  3VQI A;  2GBK A;  1WX8 A;  3JSV B;  2MCN B;  2IO1 B;  3DVN U;  4WQO B;  1WGR A;  1E7V A;  1EUV B;  2KX3 A;  3A1Q B;  5L83 A;  3L13 A;  4KIK B;  3V62 A;  3DDC B;  3R3M A;  4KZ0 A;  4G3X B;  4TKN A;  3PZD A;  1XT9 B;  2LXA A;  2LWP A;  2KAN A;  3JYU A;  4TQ1 A;  4MDK E;  4W9J A;  4X57 B;  1C1Y B;  1OEY J;  2R2O A;  3SD5 A;  5BO4 B;  1WY8 A;  2R2Q A;  3VXW A;  3NZU A;  4B9K A;  2ZPN A;  4MGY E;  1J19 A;  2FNJ B;  2KLC A;  4E71 A;  3WAP A;  3DVG Y;  4ZYN A;  3H7S A;  2B3A A;  2K6Q A;  2BF8 B;  3EHV A;  2N9P C;  4W9G A;  2O2V B;  2PE9 A;  1P9D U;  5C23 A;  2QHO A;  3U8Z A;  2BWE S;  2LRU A;  4HWI B;  4IM0 A;  4ANV A;  1WGH A;  1V2Y A;  2MWS B;  2C9W B;  4GXB A;  1NBF C;  3ZDM C;  1IPG A;  3QC8 B;  4G11 A;  5GMV A;  4AJW A;  1V86 A;  2JVC A;  2MBQ A;  2J0K A;  3D32 A;  1V80 A;  3MJW A;  3ZKJ C;  1VD2 A;  2ZJD A;  1TTN A;  1WXS A;  4FHJ A;  2M8S A;  1WZ0 A;  4NJ6 A;  2ZNV C;  2BYV E;  3RZF A;  1WF9 A;  4JL9 A;  3B0A A;  4AP4 C;  3PS6 A;  5AEK B;  4EZL A;  2MRP A;  2OOB B;  2VRR B;  3K9P B;  2KOX A;  1IP9 A;  1R4M I;  4XZ4 A;  3IHP C;  2KQ7 A;  3R66 C;  4F1S A;  1J0G A;  4NAW B;  4PS3 A;  5L95 C;  1WRD B;  5G2N A;  3ZIM A;  4HVB A;  5LXI B;  3W1S A;  3KUC B;  4FAD A;  2AL6 A;  3M62 B;  1LXD A;  3A33 B;  3DBL I;  3VFK A;  4FA6 A;  3ZO5 B;  5D6J B;  1HE8 A;  1Q0W B;  1P98 A;  1UBQ A;  2A4Z A;  2KTR A;  2Z59 B;  2K1F A;  4RM9 A;  1M94 A;  1KLV A;  1KOT A;  4CHK A;  4ZDV A;  3O65 B;  5AZF A;  5HKH A;  5FR6 A;  5KHO A;  2KJH B;  2ZCB A;  3U30 A;  4MJS B;  4W9L A;  4NQL B;  4RMA A;  2KD0 A;  4EZK A;  2K6D B;  4W9F A;  3PLV A;  4NPN A;  4DBG A;  2KFJ A;  4DXA B;  1G6J A;  2NCN A;  4EUT A;  2D07 B;  4YL8 A;  4DHJ D;  4LCD E;  1TBE A;  1GG3 A;  4ZRI A;  3KH0 A;  4DDI D;  3ENE A;  4ICU A;  2LD9 A;  1E90 A;  2BWF A;  2MW5 A;  3DBR I;  4F8C B;  4GN1 A;  4N9F 4;  1AAR A;  2DYO A;  3TIX A;  1GC6 A;  2KTR B;  2NVU I;  1YX5 B;  2LRW A;  2FCQ A;  3IBE A;  5E6N A;  1TGZ B;  1GNU A;  4IM2 A;  2I1K A;  2C5L C;  4B95 A;  2O6V A;  4ANW A;  5LXH A;  2IZV B;  4ZRK A;  1EF1 A;  2KQS A;  2FCN A;  3QWZ B;  4K7W A;  5JH5 C;  4KDI C;  3RD2 A;  3DOW A;  3HIZ A;  1I42 A;  4BFR A;  1WXV A;  2KDI A;  3VTU A;  2M4N A;  3VUX A;  2RR9 A;  2JPH A;  3QA8 A;  4FJV B;  4BKS A;  2MQJ A;  1A5R A;  3PVL A;  4GSW A;  4CYE A;  3P2B A;  2PE6 B;  2KJ6 A;  3HHM A;  3VTW A;  2KJR A;  1E7U A;  2KVR A;  1GC7 A;  3KUD B;  5CHV C;  4WWO A;  2DEN B;  4IWP A;  3WA0 A;  1D3Z A;  4DHZ B;  2Y5B B;  2HJ8 A;  1VCB A;  1WJN A;  4IUM B;  1S1Q B;  2LVQ A;  2CU1 A;  2WDT B;  4IW0 A;  4MSQ B;  2CS4 A;  3QHT A;  2AL3 A;  4EZJ A;  4EKU A;  1F9J A;  2JT4 B;  4WWP A;  2O6V B;  4ANX A;  4KSK C;  3ZVV A;  4PS8 A;  1UH6 A;  3ML8 A;  4P7I A;  1XD3 B;  3QQ8 B;  3ZRF A;  2BYE A;  3QIJ A;  4G50 A;  1V9J A;  4KDL B;  3KYC D;  2DZM A;  2NS5 A;  3UIO B;  3H7P B;  4M0W B;  3DVN V;  3ML9 A;  1V5T A;  4F7Z A;  3QAR A;  4TUU A;  1YX6 B;  1EF5 A;  4HLE A;  1GJZ A;  2XBB C;  4E3C A;  1L7Y A;  5C1Z A;  3NY5 A;  5AZH A;  3V61 A;  2MLB A;  3N32 A;  2WX0 A;  4FN2 A;  4DHZ E;  3UIN B;  3Q3J A;  3DCG A;  5D94 A;  1WJU A;  2V4L A;  2JZ3 B;  2C7N B;  3OJ3 A;  2ZZP B;  2K25 A;  2DHZ A;  1UGM A;  2EMT A;  3ONS A;  3V6C B;  3APC A;  2UWQ A;  4IG7 B;  1WM3 A;  5JZE B;  2WWZ A;  2V3S A;  1T0Y A;  2MX2 A;  4MGI E;  4BKT A;  1Y8R C;  4NQK E;  2A5U A;  1WXA A;  4ASW C;  4HDQ A;  3A9K A;  2KXJ A;  1Q5W B;  4NNJ B;  2LI5 A;  1P3Q U;  4AUQ C;  2MSE D;  2DAF A;  3K9O B;  4ANU A;  1WZ3 A;  2N7E A;  2L00 B;  4II3 B;  2PJH A;  1E8W A;  4ICV A;  4TQ0 A;  3BY4 B;  3SDL C;  2MBO A;  2UYZ B;  4GMV A;  3WAN A;  1SGH A;  3QAQ A;  3WAM A;  2BKR B;  2XEW A;  3CF6 E;  5DPR A;  2AWT A;  3A9J A;  2KKC A;  2BPS A;  3RUL A;  1YIW A;  3UQB A;  2NPT A;  2DX5 B;  2KWV B;  2DAJ A;  2LJ5 A;  3LJ3 A;  4EOY A;  3ZNI D;  5D7G A;  4URK A;  5CTR C;  3VUW A;  3X0W A;  2L0F A;  2ZEQ A;  4CO7 A;  2I1J A;  2LVO A;  1NDD A;  4GU2 A;  3IFW B;  4JLC A;  4HPL B;  1KJT A;  4MH0 E;  4I6P A;  4A3O A;  4B6W A;  4JIO U;  2NR2 A;  4HXD A;  3A9K B;  2ZPY A;  4W9D A;  3ZW3 A;  4ZRJ A;  2MP2 A;  4I6N B;  4GGQ A;  4PYZ A;  3RYT A;  1XQQ A;  4W9E A;  5DPS A;  2KZR A;  3DBH I;  2YLM A;  3ZTD A;  2L0T A;  2CR5 A;  2KWU B;  1Z5S B;  3AI5 A;  3KVF B;  4HPM B;  2L76 A;  2KDF B;  2LVP A;  3EC8 A;  4XX5 A;  3LDZ E;  3PHW B;  4PYU A;  3GOE A;  4MEL A;  2XK5 A;  2IO2 B;  2W9N A;  3NZS A;  3PHX B;  3TL5 A;  1WJ6 A;  4K1R B;  3RCZ A;  2JZZ A;  5E6P A;  2JRH A;  5KHQ A;  4HK2 A;  2G4D B;  2HD5 B;  4WJO A;  4II2 B;  1LFD A;  3UQA A;  2CHX A;  3NS8 A;  4K81 A;  2FIF A;  3RUI B;  2KFK A;  1LM8 B;  3WIM A;  3UGB B;  2PEA A;  4GIV A;  4KZC A;  3VH3 B;  2JUO A;  2KN5 A;  2LGX A;  3EFU A;  4K7S A;  4WJQ A;  5J17 A;  2GBM A;  1V5O A;  2BGF A;  3EEC A;  3L0W B;  1WIA A;  1UEL A;  3X23 A;  4G0N B;  2HTH A;  2IO3 B;  2MP2 B;  2NBV B;  2EKE C;  1WXM A;  1WX7 A;  3B08 A;  4IWO A;  3SHQ A;  3L10 B;  5CHF A;  2DYM A;  1WR1 A;  3MTN B;  3Q3F A;  4EFO A;  5EDS A;  2D11 A;  2JRI B;  3H9D A;  3KYD D;  5DCN A;  2D3G A;  2MBH A;  2JY6 A;  4WJN A;  4MGK E;  1WGG A;  3HM6 X;  3H6N A;  3A4S C;  1ZW7 A;  4DK5 A;  2C7H A;  1P1A A;  4MM3 A;  3GZN I;  2DYB A;  3CSF A;  2GBR A;  2GMI C;  2O6V D;  3DPD A;  3H1U A;  2OJR A;  5TR5 A;  1WH3 A;  2LUE A;  2CHW A;  3M3J A;  3CMM B;  2K8H A;  2KDB A;  2V1Y A;  2FID A;  3SU8 X;  4BKG A;  4HJK A;  2N9X A;  3PT2 B;  1CMX B;  4JGH B;  3VTV A;  1WR6 E;  4BKS D;  3PRZ A;  1X1M A;  3V60 A;  2N7D A;  2RGF A;  2AEH A;  2L7R A;  3JW0 X;  2C7M B;  4RM8 A;  2GBJ A;  2KHW B;  2ZVO A;  3OLM D;  3PSE B;  3TMP B;  2RSU A;  2MBB B;  3V6E B;  2KTF A;  2G45 B;  1PQS A;  3M63 B;  2L05 A;  2DZJ A;  2D10 A;  2KWC A;  2PPH A;  4WAA A;  1L2N A;  1WGD A;  2Z0E B;  4KSL C;  1FXT B;  2IY1 B;  1RRB A;  3UF8 A;  4DWF A;  5JHB A;  1WJ4 A;  1Z2M A;  2KX0 A;  3ZUN A;  3NOB A;  5CX3 A;  3UIP B;  1RLF A;  2IBI B;  3PPA A;  2EMS A;  2J0M A;  1WFY A;  2N9E B;  3L54 A;  2ZVN A;  4JQW C;  2N1V A;  2FCM A;  2IO0 B;  4KVG B;  4PS7 A;  2WYQ A;  4LDT B;  3DVG X;  2AYO B;  3ZDT A;  1KM7 A;  3RT3 B;  3JVZ X;  4IWQ A;  4FUL A;  3NHE B;  5JHA A;  1K8R B;  1ZKH A;  3APF A;  1TZ1 A;  3DQV A;  2HE7 A;  2KMA A;  2GBN A;  4FBJ B;  3VAW A;  3KW5 B;  1WM2 A;  1E5W A;  4HCN B;  1WE7 A;  2MA9 B;  4BOS C;  2ZCC A;  4XC2 A;  3RZW C;  1RFA A;  2BKF A;  2ASQ A;  1WI0 A;  3AUL A;  4J6I A;  1OGW A;  1H4R A;  3L16 A;  3R7R A;  3AU4 A;  3A4R A;  3PRM B;  2JWZ A;  4NAW A;  4GOC A;  3ZRC A;  4FJZ A;  4FHK A;  2KDE B;  3OAW A;  4AJY B;  4M8M A;  3ZNH B;  2L8J A;  2KC2 A;  5IAA C;  3B1L X;  2L3Z A;  1C3T A;  3PTF C;  1WMH A;  2KLG A;  1V6E A;  3PRE A;  4W9K A;  3ALB A;  1V81 A;  2MBE A;  3C0R B;  4FJY A;  5CHW A;  3T9L A;  4EEW A;  5J2R A;  2ZNV B;  2KC1 A;  4HDO A;  4TV3 A;  2K8B A;  4IC7 B;  4MGZ E;  4MJS A;  3ECI A;  3M95 A;  4FLH A;  4NJ7 A;  5D2M B;  3VH4 B;  5IA7 A;  2CKH B;  3QX1 A;  4K7U A;  2FAZ A;  2D2Q A;  2G3Q B;  1SIF A;  2J7Q B;  1UZX B;  3BIN A;  1J8C A;  1H8C A;  4GB9 A;  1SE9 A;  3AXC A;  4NY0 A;  4I6L B;  3HK0 A;  1WYW B;  4MEM A;  4BVU C; 
#chains in the Genus database with same CATH topology
 2MH7 A;  1I35 A;  3HUI A;  1WX9 A;  4PK1 A;  1PUT A;  1N63 A;  2N9L A;  2X8X X;  4A20 A;  3TJP A;  2IYD B;  5AZG A;  2WXF A;  5G55 A;  2PW9 A;  2DBY A;  1YD8 U;  2KO3 A;  1FIQ A;  1JRU A;  1RFK A;  3O13 A;  2WQY B;  4KV2 A;  1FEH A;  3CST A;  3PRP B;  2H88 B;  4GDK A;  3WAL A;  2LGY A;  2GI9 A;  4E74 A;  1TS5 A;  2WXL A;  1OEY A;  1LQB A;  2IY0 B;  1IYF A;  4J3O D;  1YJ1 A;  4LTU A;  1F77 A;  4HEA 1;  4IM3 A;  3AN1 A;  3AV8 A;  5MPO A;  3QJZ A;  3ZYY X;  3APD A;  3P4R B;  3H7P A;  3Q8F A;  3IVF A;  1UBI A;  1S3S G;  3PGE A;  4GDK B;  4HCP B;  3BVZ A;  4BBN C;  1MFW A;  5DPW A;  3MHS D;  1RAX A;  1FRD A;  2KAJ A;  1ZPS A;  1E8Y A;  2BW2 A;  1QLB B;  1TYG B;  3W2D A;  2WDR B;  3U7D A;  2GBK A;  1WX8 A;  1XEE A;  3NS1 A;  2KDM A;  2IO1 B;  4WQO B;  1E7V A;  1VZ8 A;  4RH6 A;  3DDC B;  3R3M A;  4MAC A;  4W9J A;  4MDK E;  1C1Y B;  3EFC A;  2R2Q A;  3I57 A;  4B9K A;  1J19 A;  4E71 A;  3AE9 B;  3AE6 B;  4ZYN A;  2B3A A;  1J7C A;  4W9G A;  2N9P C;  1B9R A;  5D3D A;  4N59 A;  4HWI B;  2C9W B;  4JX1 C;  5GMV A;  1QIL A;  4AJW A;  2J0K A;  3U7Z A;  3MJW A;  1WXS A;  4FHJ A;  2GLS A;  1SF0 A;  1CQV A;  2ZNV C;  3FKY A;  4WH4 A;  1A70 A;  3RZF A;  4AP4 C;  2IND C;  3K9P B;  1NVI D;  2E3T A;  1GB1 A;  2KYW A;  2LFI A;  4B0E A;  1J0G A;  1JML A;  1TKY A;  4LLG M;  3ZIM A;  1FRR A;  3W1S A;  4FAD A;  2AL6 A;  3M62 B;  3KQ4 A;  5AUK A;  2K5P A;  3GE3 C;  1HE8 A;  3Q69 A;  1SJE D;  1E6E B;  1P98 A;  3NVW A;  1M94 A;  1KOT A;  3AB5 A;  4ZDV A;  3BWU D;  4N6E B;  2NTS A;  5FR6 A;  2KJH B;  2PVG C;  5C3J B;  4W9L A;  4NQL B;  2KD0 A;  3MFG A;  2K6D B;  4DBG A;  4NPN A;  4DXA B;  1BXT A;  3Q8A A;  4K3C A;  2D07 B;  4LCD E;  3BVM A;  1E90 A;  1SSN A;  3DBR I;  1V1P A;  3VRA B;  1GC6 A;  4K3B A;  2LRW A;  2W55 A;  1GNU A;  4IM2 A;  4ANW A;  2O6V A;  2LGI A;  3VUX A;  4XE0 A;  3RFZ B;  4BKS A;  3PVL A;  1SEB D;  3CWI A;  3HHM A;  3VTW A;  1E7U A;  1GC7 A;  1V1P B;  2MEK A;  4IWP A;  3WA0 A;  4P16 A;  1VCB A;  4XDC A;  2N0S B;  2JU6 X;  5EE0 A;  1HA5 A;  2WXP A;  4EZJ A;  1N5X A;  2O6V B;  4ANX A;  1FCL A;  4YTN B;  1NYR A;  1VZ6 A;  2VZK D;  1UH6 A;  3ML8 A;  4A55 A;  3BII D;  3AE3 B;  3ZRF A;  2BYE A;  3Q3N C;  3KYC D;  3KWL A;  3UIO B;  1V5T A;  2RDB C;  2KWD A;  5C1Z A;  3NY5 A;  3V61 A;  5FK9 C;  4DHZ E;  3Q3J A;  1STE A;  3DCG A;  1QOF A;  3SR6 A;  2JZ3 B;  1WM3 A;  3NUH B;  2WWZ A;  2V3S A;  1T6B X;  5HFY A;  2V3N A;  3P4S B;  2A5U A;  1WXA A;  4HDQ A;  1K51 A;  1Q5W B;  4NNJ B;  2LI5 A;  4AUQ C;  1FD6 A;  2MJE A;  3TUO A;  4TQ0 A;  5FKA C;  4GMV A;  1SGH A;  1TT5 B;  1AN8 A;  3CF6 E;  1V1O A;  3DWM A;  3RUL A;  1YIW A;  2J53 A;  2QCZ A;  5HHD G;  2LJ5 A;  1RWS A;  3EGR A;  1AW7 A;  3E9S A;  2LVO A;  1KJT A;  1T5X D;  4I6P A;  4MH0 E;  4JIO U;  2Q5W D;  4HXD A;  1AWD A;  4US9 A;  4ARI A;  4XDD A;  4PYZ A;  1QQR A;  4W9E A;  3N1Z C;  2KZR A;  3ZTD A;  1N5W A;  2L76 A;  2KDF B;  1ET9 A;  2KMM A;  2LVP A;  3EC8 A;  4PYU A;  1FNV A;  4XX5 A;  3GOE A;  3NZS A;  3PHX B;  3TEW A;  2JRH A;  2HD5 B;  4A6Q A;  2BVC A;  2QSD A;  4RCO A;  4KZC A;  2WXQ A;  1EM7 A;  2JUO A;  4TMA B;  5J17 A;  1V5O A;  4G0N B;  2HTH A;  2IO3 B;  2NBV B;  2FUG 1;  2DYM A;  1D5Z C;  1WR1 A;  2D11 A;  3H9D A;  2MBH A;  4A8X C;  1FFV A;  1ZP0 B;  3H6N A;  3VR8 B;  2GBR A;  2OJR A;  2CHW A;  1CMX B;  3BYT B;  3PRZ A;  2RGF A;  1TIF A;  3T3N A;  2KHW B;  3OLM D;  3PSE B;  2MBB B;  3EA6 A;  1PQS A;  2KWC A;  3UI3 A;  4KSL C;  1FXT B;  2IY1 B;  2NTT A;  1SB3 C;  5JHB A;  1XLN A;  2FE8 A;  3ZUN A;  2IBI B;  2J0M A;  2N9E B;  2ZVN A;  1D4B A;  2WYQ A;  1F1H A;  1HZ6 A;  1XXG A;  3ZDT A;  1C77 A;  4WAF A;  1FPY A;  1TZ1 A;  3DQV A;  3VR9 B;  3VAW A;  3KW5 B;  1WM2 A;  4HCN B;  4KX6 B;  4XC2 A;  5BYS A;  4ZYS A;  2BKF A;  2ASQ A;  4J6I A;  3AUL A;  3R7R A;  3AU4 A;  1J7B A;  2WDV B;  4GOC A;  3Q2A C;  4FJZ A;  2KDE B;  4C4V B;  3TSS A;  4OW0 A;  2L3Z A;  3ABV B;  2KVZ A;  1KFY B;  1V6E A;  4W9K A;  3AEC B;  1SE3 A;  3C0R B;  2ZNV B;  4HDO A;  3NVV A;  1FXA A;  2K8B A;  4MJS A;  1KRH A;  4NJ7 A;  5BMG A;  3NZ3 A;  1C78 A;  1SIF A;  2D3B A;  2VH1 A;  2BB6 A;  1J8C A;  2Y5C A;  1SE9 A;  4I6L B;  4BVU C;  4W9I A;  3W1S C;  1FNW A;  1SXT A;  3IXS A;  4MSM B;  2GOW A;  2NPT B;  2M1M A;  1C4P A;  1CK1 A;  2LGD A;  3RNB C;  3W1Y A;  2L32 A;  2CHZ A;  2NBU A;  2BYT A;  3Q8E A;  3ETR A;  4WWN A;  2Y3A A;  4LNF A;  1FO4 A;  1V49 A;  1LGR A;  4KGT A;  4RGO S;  3N30 A;  3ZJU A;  1IGD A;  1L6U A;  2C60 A;  3QCA A;  1BT0 A;  2J0J A;  2V3P A;  2LXC A;  2REX A;  1L0X B;  3VVW B;  1IBX A;  2PTL A;  1ISN A;  2KMC A;  2XK5 B;  3WAO A;  4GDL A;  3OJ4 B;  3T8M A;  3HM3 A;  3MC8 A;  3VDZ A;  2INC C;  3VHT C;  3L17 A;  2JXX A;  2LZ6 A;  3AEF B;  3ZLZ A;  2Y5P A;  2RPQ A;  3ZTC A;  3PLU A;  1Q10 A;  2DZI A;  3AEA B;  3ZXV A;  1JCK B;  4OVU A;  4LDT D;  4GDL B;  1Y56 A;  2N9K A;  3S2A A;  2YVC A;  1NI2 A;  3W5V B;  1EU4 A;  1LO5 D;  2G4S A;  4EE2 A;  1HZ5 A;  3I3T B;  3VQI A;  1YJJ A;  1WGR A;  5L83 A;  3CIR B;  4TKN A;  1ZDV A;  2VH2 A;  1XT9 B;  3VXW A;  2R2O A;  5BO4 B;  3NZU A;  2PVO D;  2IDY A;  2QC8 A;  4MGY E;  2NMQ A;  3WAP A;  3H7S A;  1TKG A;  2BF8 B;  1JRO A;  2XN9 C;  1XLO A;  3E56 A;  4ARC A;  5BYR A;  2PE9 A;  1ZXH A;  1D6E C;  1R7S A;  4XWT A;  3U8Z A;  2BWE S;  4IM0 A;  4ANV A;  2JXT A;  1IPG A;  3QC8 B;  1TS4 A;  2MBQ A;  1V80 A;  4ZHO A;  4MH8 A;  4NJ6 A;  3V3X A;  1DOY A;  1L0Y B;  2WXO A;  1WF9 A;  3PS6 A;  2N7J A;  4ZOH C;  2PIA A;  1R4M I;  3NRZ A;  4FXC A;  1NEK B;  4NAW B;  5L95 C;  4HVB A;  4C7Z A;  1LXD A;  2JSV X;  2A4Z A;  2KTR A;  2K1F A;  2AQ1 B;  5AZF A;  4RGN A;  5KHO A;  1L5P A;  1TS3 A;  4RMA A;  4EZK A;  2KFJ A;  1G6J A;  2K0P A;  1GG3 A;  1WYG A;  4DDI D;  3ENE A;  2B76 B;  2BWF A;  4GN1 A;  4N9F 4;  4LNO A;  2DYO A;  2PLP A;  3N1Y C;  2KTR B;  1FNU A;  1IGC A;  4C00 A;  5LXH A;  4ZRK A;  1EF1 A;  4KDI C;  3RD2 A;  3HIZ A;  1I42 A;  4BFR A;  5FR3 A;  3BZD B;  3Q8C A;  3BYY B;  1UWM A;  4GSW A;  4M0W A;  3P2B A;  2OJW A;  2KJR A;  2KVR A;  3ZGZ A;  2JQR B;  1D3Z A;  4DHZ B;  1K53 A;  1S1Q B;  2LVQ A;  4ZHP A;  1GAQ B;  4EKU A;  1F9J A;  2JT4 B;  4WWP A;  3P42 A;  3ZVV A;  1C79 A;  3QIJ A;  2IPK D;  2NS5 A;  1I4P A;  3H7P B;  1YJI A;  4M0W B;  1YX6 B;  1EF5 A;  1NYQ A;  4HLE A;  4E3C A;  3AE2 B;  3HRD D;  2MLB A;  2WX0 A;  1XO3 A;  5D3I B;  4XYC A;  5D94 A;  2V4L A;  2UWQ A;  4RF0 A;  1TZO A;  2SEB D;  1T0Y A;  2MX2 A;  2JZP A;  4PT5 A;  3KWV A;  1Y8R C;  2CJN A;  1DOX A;  3B9J A;  2KXJ A;  3U2S C;  2FBW B;  3K9O B;  3BY4 B;  3SDL C;  2UYZ B;  1TJE A;  1NEN B;  3B2F A;  3WAM A;  1DGJ A;  1F0Z A;  3A9J A;  4NJC A;  2BPS A;  1ESF A;  2BT6 A;  2DX5 B;  2KWV B;  2DAJ A;  3LJ3 A;  1BML C;  3VUW A;  2YEP F;  2L0F A;  1QF6 A;  3DHG C;  4GU2 A;  4HPL B;  4A3O A;  4YWG G;  1VZ7 A;  2NR2 A;  3I63 C;  2INN E;  2I2Y A;  2JYE A;  4I6N B;  4GGQ A;  3RN9 C;  3RYT A;  1C4A A;  5DPS A;  2QEJ C;  3DBH I;  3AI5 A;  3C19 A;  3MC0 B;  3LDZ E;  3PHW B;  2IO2 B;  2W9N A;  1WJ6 A;  4K1R B;  3RCZ A;  5E6P A;  3PZ7 A;  3GP7 A;  3UQA A;  1OQQ A;  3NS8 A;  3WIM A;  3RUI B;  2KFK A;  4QAY A;  1I7H A;  2PEA A;  2KN5 A;  2WXM A;  2BGF A;  3EEC A;  1WIA A;  5T8I A;  2RPV A;  1V8C A;  1WX7 A;  4IWO A;  5CHF A;  5EDS A;  1KH0 A;  5DCN A;  2DWQ A;  2QIE B;  4M01 A;  1ACC A;  3A4S C;  1CJE A;  4DK5 A;  2C7H A;  2L83 A;  3GZN I;  2GMI C;  2O6V D;  1JRP A;  1FFU A;  3H1U A;  5TR5 A;  1UGJ A;  2LUE A;  2K8H A;  3RNE C;  1I4G A;  3PT2 B;  4JGH B;  4BKS D;  3NVY A;  3V60 A;  1X1M A;  2N7D A;  4US8 A;  4RM8 A;  2RSU A;  1ROE A;  3UF8 A;  3Q3O C;  1RRB A;  4B0M A;  4DWF A;  1WJ4 A;  3P1M A;  2KX0 A;  1BUI C;  3UIP B;  2PMV A;  4YSY B;  4KKJ A;  1WFY A;  1I4X A;  3T3O A;  2QIL A;  3FIL A;  1VRA B;  1SE4 A;  3J9C A;  2AYO B;  1KM7 A;  4KKI A;  3ZJV A;  3NHE B;  4M02 A;  1ZKH A;  3APF A;  2KMA A;  3FC4 A;  1TS2 A;  1E9M A;  1L6V A;  4LK0 M;  1RFA A;  1FXI A;  1H4R A;  3L16 A;  3LYY A;  1RM6 C;  4AJY B;  4M8M A;  3ZNH B;  2L8J A;  3FIL B;  3W9C B;  1K50 A;  3PZ8 A;  1N61 A;  2LHD A;  1WMH A;  1PGB A;  3N1X C;  2WGS A;  3T9L A;  3BK2 A;  4IC7 B;  1T3Q A;  4FLH A;  4LNI A;  5IA7 A;  4XWW A;  4YSZ B;  4NY0 A;  2ONQ A;  1WYW B;  1PGA A;  1I4H A;  1MG8 A;  3WCQ A;  2M19 A;  3DHH C;  4REZ A;  4OZA A;  1WGY A;  3ZNG C;  2W3R A;  1WMH B;  3ZNZ B;  1OTR B;  1WSP A;  3L08 A;  1T0S C;  2DNF A;  2WX1 A;  2N1W A;  4W9C A;  3LB8 C;  2YEP B;  4O1N A;  2K9X A;  2N4F A;  4LNN A;  1ZXI A;  2BQQ A;  2LEK A;  3TBL D;  2BTE A;  1L4D B;  3Q6B A;  4NAM A;  3R7Q A;  1QZE A;  2Z8L A;  5LLI A;  3KUZ A;  2K39 A;  4DHJ B;  2FUH B;  4LJO B;  4W9H A;  1YQB A;  2KNB A;  3AU5 A;  3RNA C;  3DBR B;  3FAH A;  3A1Q A;  2K8C A;  4KIK A;  4RNA A;  2M0X A;  1CZP A;  1U4A A;  3IG3 A;  2LAS A;  1SIJ A;  3GB1 A;  2GB1 A;  2JF5 A;  4LJP B;  4OZC A;  4OVV A;  1EWY C;  4DDG D;  3DBS A;  1HXY D;  3DWG C;  1VJK A;  5DPT A;  5IKC M;  2O2V A;  1PDX A;  1Q1O A;  3RNF C;  3N20 C;  3DVN U;  3GZN B;  3NVZ A;  4P1B C;  2KX3 A;  3A1Q B;  1T0Q C;  4DXG A;  3L13 A;  4KIK B;  4KZ0 A;  5BMH A;  1L0V B;  4G3X B;  3AE1 B;  1HTQ A;  3PZD A;  1C3T A;  1OEY J;  1JW9 D;  2ZPN A;  3AM9 A;  2CJO A;  2K6Q A;  3BK1 A;  1GOZ A;  3EHV A;  1NI3 A;  2O2V B;  1P9D U;  2QHO A;  4GXB A;  3ZDM C;  4IDI A;  2V4I B;  3D32 A;  2ZJD A;  2M8S A;  3V05 A;  2M0A A;  2ACZ B;  1L4Z B;  2BYV E;  1ZDX A;  2WXK A;  3IAS 1;  1JQ4 A;  1RYJ A;  5AEK B;  4EZL A;  2MRP A;  4IOI E;  3MC9 A;  4XZ4 A;  4JE3 B;  2KQ7 A;  3R66 C;  3U52 E;  4F1S A;  4PS3 A;  3AE5 B;  1QOG A;  4S0R A;  1F2R I;  5LXI B;  1E7P B;  3KUC B;  3VFK A;  4FA6 A;  3ZO5 B;  1UBQ A;  2Z59 B;  4WQM A;  4NZL B;  2QDF A;  4CHK A;  1J7A A;  5HI1 A;  3AE8 B;  4HJG E;  4MJS B;  3OG5 A;  2INP E;  2MJ3 A;  4W9F A;  4BAX A;  5HG2 A;  2NCN A;  4EUT A;  4YL8 A;  4OHJ A;  1TBE A;  2J42 A;  2MW5 A;  4F8C B;  4L2Y A;  4ACF A;  1AAR A;  2W82 A;  3AE4 B;  2OED A;  4RFB A;  4RGM A;  1N6Z A;  5E6N A;  1TGZ B;  2D3A A;  2H89 B;  2IZV B;  1C76 A;  2KQS A;  5JH5 C;  4C56 C;  5C2T B;  1P7F A;  2OHF A;  2M4N A;  2RR9 A;  1YN4 A;  1E0Z A;  3QA8 A;  3RMK C;  4FJV B;  2MQJ A;  1A5R A;  4BZA A;  4CYE A;  2PE6 B;  1ET6 A;  2RDH A;  1YOV B;  1KTK A;  5CHV C;  4WWO A;  1IBX B;  1PYW D;  2BS3 B;  2E6X A;  2WU5 B;  2LMC A;  1WJN A;  1JWM D;  3ZXR A;  1UUP A;  4MSQ B;  2CS4 A;  3QHT A;  5H8Y E;  1UNS A;  1JWS D;  4KSK C;  1F52 A;  3I9V 1;  4PS8 A;  4P7I A;  1XD3 B;  1QKZ A;  4D2K A;  4G50 A;  2V0G A;  4KGR A;  2DZM A;  3ML9 A;  4ZRP A;  3QAR A;  2WU2 B;  1GJZ A;  1FMA D;  1GPX A;  2XBB C;  4RF1 A;  1L7Y A;  3P4P B;  2ON8 A;  5AZH A;  3N32 A;  3ZQ4 A;  1WJU A;  3AH7 A;  2TSS A;  2ZZP B;  2K25 A;  2BS2 B;  2DHZ A;  3APC A;  2EKI A;  2KAC A;  5JZE B;  1EU3 A;  1MVK A;  4BKT A;  4NQK E;  1MHX A;  4ASW C;  3A9K A;  2WS3 B;  2HJ1 A;  2DAF A;  4ANU A;  1WZ3 A;  4II3 B;  4ICV A;  3QAQ A;  1N62 A;  2BKR B;  2XEW A;  5DPR A;  1WRI A;  3Q3M C;  1I4Q A;  2WXI A;  4EOY A;  3ZNI D;  5D7G A;  1HQR D;  3SFE B;  3X0W A;  2ZEQ A;  4CO7 A;  2I1J A;  1NDD A;  3IFW B;  2WXN A;  4YSX B;  3A9K B;  2ZPY A;  4W9D A;  3U4E G;  2WHI A;  2MP2 A;  1JAL A;  2EEL A;  3EUB 2;  3GE8 C;  2L0T A;  3KVF B;  4MEL A;  3AED B;  4JWS C;  2JZZ A;  2G4D B;  2ZW0 A;  4WJO A;  4USA A;  2WXJ A;  4II2 B;  1LFD A;  4CQN A;  3UGB B;  4GIV A;  3VH3 B;  4WJQ A;  5IN7 A;  2GBM A;  4DQO C;  1UEL A;  2HTM E;  2J52 A;  2MP2 B;  1YQ4 B;  1WXM A;  2EKE C;  2IJ0 A;  3B08 A;  3SHQ A;  3L10 B;  5IO9 A;  3MTN B;  4EFO A;  2JRI B;  3KYD D;  4WJN A;  4MGK E;  3HM6 X;  1P7E A;  5G5H A;  2M56 B;  1P1A A;  2DYB A;  1MI0 A;  4YTM B;  2MHJ A;  3M3J A;  2V1Y A;  2KDB A;  3SU8 X;  4WIP A;  4BKG A;  4HJK A;  2N9X A;  2J4X A;  3VTV A;  2L7R A;  1SBB B;  2GBJ A;  3V6E B;  3MHZ A;  2KTF A;  3M63 B;  4WAA A;  3URY A;  1XLQ A;  2PPH A;  2W54 A;  2SAK A;  1VR9 A;  1WGD A;  2CU3 A;  4S17 A;  3NOB A;  4GLS C;  5CX3 A;  3PPA A;  2KT7 A;  4JQW C;  2N1V A;  1QOA A;  2FCM A;  2IO0 B;  4WWM A;  4ITK A;  4JPS A;  1ZUD 2;  3DVG X;  3JVZ X;  5I4D A;  4FUL A;  4OZB A;  3R8B A;  1TKE A;  2GBN A;  4FBJ B;  4P1C C;  1TY0 A;  3NJT A;  1KLU D;  1OGW A;  3A4R A;  2LUM A;  3ZRC A;  2JX5 A;  3LXF A;  2KC2 A;  5IAA C;  2W3S A;  1WGK A;  1C4C A;  2KLG A;  3PRE A;  3ALB A;  1V81 A;  2MBE A;  2GRI A;  4FJY A;  5CHW A;  4EEW A;  2KC1 A;  3KLS X;  4MGZ E;  3M95 A;  2IGG A;  5D2M B;  5LNK 1;  3QX1 A;  4K7U A;  2FAZ A;  2D2Q A;  2G3Q B;  5BMI A;  2I38 A;  3BIN A;  4AQ7 A;  1N60 A;  1WXQ A;  3IT6 B;  1MG4 A;  3RNG C;  3AEG B;  4AOF A;  2G1E A;  1P0R A;  3A9J B;  5BYQ A;  1R4M B;  1HEZ E;  3RPF C;  4Q2J A;  5J18 A;  1PGX A;  2FCS A;  5IP4 D;  2LGS A;  1OFF A;  1WE6 A;  2RD0 A;  1TY2 A;  1VDV A;  1ENF A;  1FM0 D;  2NBW B;  5E6O A;  1ZE3 D;  1QOB A;  1YN5 A;  3IT4 B;  2XNA C;  1SJH D;  2HDE A;  1E8X A;  5EE9 A;  2WXG A;  1E8Z A;  3VRB B;  2M17 A;  5IOI A;  2IGH A;  2Z0D B;  2DZK A;  4A3P A;  4WJP A;  2KFK B;  1GUA B;  1R4N I;  3JSV A;  4HKZ E;  2ZW1 A;  1UD7 A;  1EO6 A;  4BBN F;  2KK8 A;  3L4P A;  2BYF A;  4AWJ A;  3QK0 A;  3PV1 A;  1MPE A;  2X38 A;  1OQY A;  1XCQ L;  1YMH E;  1ZGU B;  2R61 A;  3VUY A;  4BOZ B;  3TCA A;  4M8N A;  3N3K B;  1D5X C;  5HKH A;  2BBC A;  3JSV B;  2MCN B;  1V97 A;  1EUV B;  4H2A A;  3V62 A;  2LXA A;  2LWP A;  3JYU A;  2KAN A;  4TQ1 A;  3SD5 A;  4X57 B;  1YNT E;  1WY8 A;  2AQ3 B;  1B1Z A;  1AYF A;  2VZK B;  2DLB A;  2FNJ B;  2KLC A;  3DVG Y;  2LHE A;  4A9A A;  4RGT A;  3Q14 C;  4HRO A;  5C23 A;  2LRU A;  2WP9 B;  3AEE B;  1PFD A;  1WGH A;  1V2Y A;  2MWS B;  1NBF C;  4G11 A;  2K3U A;  1V86 A;  2JVC A;  5G5G A;  3ZKJ C;  1VD2 A;  1TTN A;  1WWT A;  3I5J C;  1WZ0 A;  2JYT A;  4DXF A;  3HVZ A;  1KLG D;  2KQ4 X;  4JL9 A;  3B0A A;  4ZRQ A;  2VRR B;  2OOB B;  3Q8B A;  2KOX A;  1IP9 A;  3IHP C;  1WRD B;  2L1A A;  2L52 A;  5G2N A;  4YTP B;  3A33 B;  3DBL I;  5D6J B;  1Q0W B;  3ZJT A;  1F2R C;  2G9H D;  4RM9 A;  4AS1 A;  1YN3 A;  3GS2 A;  1KLV A;  3O65 B;  3P63 A;  2ZCB A;  3U30 A;  3PLV A;  4TSS A;  4L23 A;  4DHJ D;  4C7Y A;  4ZRI A;  3KH0 A;  4ICU A;  2LD9 A;  1QT9 A;  5GXG B;  4C80 A;  3DBH B;  2K22 A;  3TIX A;  2NVU I;  1YX5 B;  2FCQ A;  1GB4 A;  1D5M C;  4HRS A;  3AEB B;  1DYQ A;  3IBE A;  3C8Y A;  2I1K A;  2C5L C;  4B95 A;  4K7W A;  2D5G A;  2FCN A;  1HTO A;  3QWZ B;  3DOW A;  1WXV A;  2KDI A;  3VTU A;  1SE2 A;  1IUE A;  2JPH A;  1MHH E;  3BVG A;  3P4Q B;  1ZOY B;  1XLP A;  2BB5 A;  2KJ6 A;  4L1B A;  3KUD B;  2DEN B;  2Y5B B;  2QMT A;  2HJ8 A;  4IUM B;  2CU1 A;  2WDT B;  4IW0 A;  2AL3 A;  3PO0 A;  1R4N B;  5EE3 A;  3QQ8 B;  1V9J A;  4KDL B;  3DVN V;  4F7Z A;  4IKG A;  4TUU A;  1MJD A;  1T0R C;  3AMZ A;  4C4V A;  4FN2 A;  3UIN B;  1JWU D;  3AE7 B;  2C7N B;  3OJ3 A;  3V6C B;  2EMT A;  1UGM A;  3ONS A;  4IG7 B;  1JWB D;  3HVD A;  3DHI C;  4MGI E;  1DOI A;  1P3Q U;  2MSE D;  4P6V F;  2N7E A;  2L00 B;  2PJH A;  1E8W A;  2MBO A;  4YXD B;  3WAN A;  4YT0 B;  4XGA B;  1OQR A;  2AWT A;  2AX5 A;  2KKC A;  4HPP A;  3UQB A;  3OWE B;  2NPT A;  5EE1 A;  4URK A;  4N58 A;  5CTR C;  1C9F A;  1XF5 L;  4JLC A;  4B6W A;  3R2I A;  2UU7 A;  3R2T A;  1KF6 B;  3ZW3 A;  4ZRJ A;  2QJL A;  1XQQ A;  5H92 C;  3NG0 A;  2YLM A;  2CR5 A;  2KWU B;  1Z5S B;  4HPM B;  4UDU C;  1UF0 A;  2XK5 A;  3TL5 A;  5KHQ A;  4HK2 A;  5TSS A;  4A90 A;  4K81 A;  2CHX A;  2MJD A;  2FIF A;  2RMM A;  1LM8 B;  3DBL B;  4MT5 A;  3TEY A;  2LGX A;  4K7S A;  3EFU A;  2RDG A;  3L0W B;  2WXH A;  3X23 A;  1EWC A;  3Q3F A;  3IAM 1;  3MP9 A;  2D3G A;  4LNK A;  5JXV A;  2JY6 A;  1WGG A;  3TEX A;  3W5U B;  1ZW7 A;  3SFD B;  2PKO A;  1I4R A;  4MM3 A;  3CSF A;  3H8H A;  4R3D A;  5AUI A;  3DPD A;  1WH3 A;  1M4V A;  3B2G A;  2LJI A;  3CMM B;  2FID A;  1UWX A;  2BS4 B;  4WUR A;  1WR6 E;  3N9Y C;  3TEZ A;  2AEH A;  1E10 A;  2WLB A;  3JW0 X;  2C7M B;  2ZVO A;  2KN4 A;  3TMP B;  1VLB A;  2D3C A;  2G45 B;  2L05 A;  2DZJ A;  2D10 A;  1L2N A;  3MJ5 A;  2Z0E B;  1Z2M A;  4MM3 B;  2ICI A;  1RLF A;  5E6J A;  2EMS A;  3L54 A;  2WDQ B;  4KVG B;  1YQ3 B;  2IGD A;  4PS7 A;  4LDT B;  4OVZ A;  3RT3 B;  4IWQ A;  5JHA A;  1K8R B;  2HE7 A;  1E5W A;  3RI7 C;  1WE7 A;  2MA9 B;  4BOS C;  2ZCC A;  1JWA D;  3RZW C;  1WI0 A;  3PRM B;  2JWZ A;  4NAW A;  3RNC C;  4FHK A;  3OAW A;  2WNM A;  2AQ2 B;  4JWU C;  1K52 A;  3B1L X;  3PTF C;  1FCC C;  4KGS A;  5J2R A;  4TV3 A;  1XCT L;  2JWU A;  2WXR A;  3ECI A;  4HKQ A;  3VH4 B;  2CKH B;  3SEB A;  2J7Q B;  1UZX B;  1H8C A;  4M00 A;  4GB9 A;  3AXC A;  3HK0 A;  2V9H A;  4MEM A; 
#chains in the Genus database with same CATH homology
 4AOF A;  1I35 A;  1MG8 A;  3A9J B;  1P0R A;  4W9I A;  3W1S C;  1WX9 A;  4MSM B;  2GOW A;  1WGY A;  2NPT B;  2M1M A;  3ZNG C;  3W1Y A;  2LGD A;  4A20 A;  1WMH B;  3ZNZ B;  3TJP A;  1OTR B;  2IYD B;  3L08 A;  5AZG A;  2CHZ A;  2NBU A;  5G55 A;  5J18 A;  2WX1 A;  1YD8 U;  2KO3 A;  2N1W A;  2FCS A;  4W9C A;  4WWN A;  1JRU A;  1WE6 A;  1V49 A;  2N4F A;  3N30 A;  2RD0 A;  3TBL D;  4KV2 A;  2NBW B;  3CST A;  3PRP B;  5E6O A;  2C60 A;  3R7Q A;  3QCA A;  1BT0 A;  2J0J A;  2LXC A;  1QZE A;  2REX A;  4GDK A;  3WAL A;  2LGY A;  3VVW B;  5LLI A;  1ISN A;  2KMC A;  1E8X A;  3KUZ A;  2XK5 B;  2K39 A;  4E74 A;  4DHJ B;  2FUH B;  3WAO A;  1OEY A;  4GDL A;  1E8Z A;  4LJO B;  1LQB A;  2M17 A;  1YQB A;  3OJ4 B;  4W9H A;  2KNB A;  3AU5 A;  2Z0D B;  3T8M A;  2DZK A;  2IY0 B;  3HM3 A;  1IYF A;  1YJ1 A;  3VDZ A;  4A3P A;  4WJP A;  2KFK B;  1GUA B;  1R4N I;  3JSV A;  4IM3 A;  3VHT C;  3A1Q A;  3L17 A;  2K8C A;  1UD7 A;  1EO6 A;  3QJZ A;  2JXX A;  4KIK A;  2LZ6 A;  2M0X A;  1U4A A;  2KK8 A;  3IG3 A;  3APD A;  2LAS A;  3ZLZ A;  4BBN F;  2JF5 A;  4LJP B;  3H7P A;  2BYF A;  4OVV A;  4AWJ A;  3IVF A;  2RPQ A;  1UBI A;  1S3S G;  3QK0 A;  3PGE A;  3ZTC A;  3PLU A;  4GDK B;  4HCP B;  3PV1 A;  2DZI A;  4DDG D;  4BBN C;  3DBS A;  5DPW A;  1OQY A;  3MHS D;  1RAX A;  4OVU A;  4LDT D;  5DPT A;  1ZGU B;  2O2V A;  4GDL B;  1E8Y A;  3S2A A;  2YVC A;  3VUY A;  1NI2 A;  2G4S A;  4BOZ B;  3TCA A;  4M8N A;  1Q1O A;  3I3T B;  3N3K B;  3U7D A;  3VQI A;  2GBK A;  1WX8 A;  3JSV B;  2MCN B;  2IO1 B;  3DVN U;  4WQO B;  1WGR A;  1E7V A;  1EUV B;  2KX3 A;  3A1Q B;  5L83 A;  3L13 A;  4KIK B;  3V62 A;  3DDC B;  3R3M A;  4KZ0 A;  4G3X B;  4TKN A;  3PZD A;  1XT9 B;  2LXA A;  2LWP A;  2KAN A;  3JYU A;  4TQ1 A;  4MDK E;  4W9J A;  4X57 B;  1C1Y B;  1OEY J;  2R2O A;  3SD5 A;  5BO4 B;  1WY8 A;  2R2Q A;  3VXW A;  3NZU A;  4B9K A;  2ZPN A;  4MGY E;  1J19 A;  2FNJ B;  2KLC A;  4E71 A;  3WAP A;  3DVG Y;  4ZYN A;  3H7S A;  2B3A A;  2K6Q A;  2BF8 B;  3EHV A;  2N9P C;  4W9G A;  2O2V B;  2PE9 A;  1P9D U;  5C23 A;  2QHO A;  3U8Z A;  2BWE S;  2LRU A;  4HWI B;  4IM0 A;  4ANV A;  1WGH A;  1V2Y A;  2MWS B;  2C9W B;  4GXB A;  1NBF C;  3ZDM C;  1IPG A;  3QC8 B;  4G11 A;  5GMV A;  4AJW A;  1V86 A;  2JVC A;  2MBQ A;  2J0K A;  3D32 A;  1V80 A;  3MJW A;  3ZKJ C;  1VD2 A;  2ZJD A;  1TTN A;  1WXS A;  4FHJ A;  2M8S A;  1WZ0 A;  4NJ6 A;  2ZNV C;  2BYV E;  3RZF A;  1WF9 A;  4JL9 A;  3B0A A;  4AP4 C;  3PS6 A;  5AEK B;  4EZL A;  2MRP A;  2OOB B;  2VRR B;  3K9P B;  2KOX A;  1IP9 A;  1R4M I;  4XZ4 A;  3IHP C;  2KQ7 A;  3R66 C;  4F1S A;  1J0G A;  4NAW B;  4PS3 A;  5L95 C;  1WRD B;  5G2N A;  3ZIM A;  4HVB A;  5LXI B;  3W1S A;  3KUC B;  4FAD A;  2AL6 A;  3M62 B;  1LXD A;  3A33 B;  3DBL I;  3VFK A;  4FA6 A;  3ZO5 B;  5D6J B;  1HE8 A;  1Q0W B;  1P98 A;  1UBQ A;  2A4Z A;  2KTR A;  2Z59 B;  2K1F A;  4RM9 A;  1M94 A;  1KLV A;  1KOT A;  4CHK A;  4ZDV A;  3O65 B;  5AZF A;  5HKH A;  5FR6 A;  5KHO A;  2KJH B;  2ZCB A;  3U30 A;  4MJS B;  4W9L A;  4NQL B;  4RMA A;  2KD0 A;  4EZK A;  2K6D B;  4W9F A;  3PLV A;  4NPN A;  4DBG A;  2KFJ A;  4DXA B;  1G6J A;  2NCN A;  4EUT A;  2D07 B;  4YL8 A;  4DHJ D;  4LCD E;  1TBE A;  1GG3 A;  4ZRI A;  3KH0 A;  4DDI D;  3ENE A;  4ICU A;  2LD9 A;  1E90 A;  2BWF A;  2MW5 A;  3DBR I;  4F8C B;  4GN1 A;  4N9F 4;  1AAR A;  2DYO A;  3TIX A;  1GC6 A;  2KTR B;  2NVU I;  1YX5 B;  2LRW A;  2FCQ A;  3IBE A;  5E6N A;  1TGZ B;  1GNU A;  4IM2 A;  2I1K A;  2C5L C;  4B95 A;  2O6V A;  4ANW A;  5LXH A;  2IZV B;  4ZRK A;  1EF1 A;  2KQS A;  2FCN A;  3QWZ B;  4K7W A;  5JH5 C;  4KDI C;  3RD2 A;  3DOW A;  3HIZ A;  1I42 A;  4BFR A;  1WXV A;  2KDI A;  3VTU A;  2M4N A;  3VUX A;  2RR9 A;  2JPH A;  3QA8 A;  4FJV B;  4BKS A;  2MQJ A;  1A5R A;  3PVL A;  4GSW A;  4CYE A;  3P2B A;  2PE6 B;  2KJ6 A;  3HHM A;  3VTW A;  2KJR A;  1E7U A;  2KVR A;  1GC7 A;  3KUD B;  5CHV C;  4WWO A;  2DEN B;  4IWP A;  3WA0 A;  1D3Z A;  4DHZ B;  2Y5B B;  2HJ8 A;  1VCB A;  1WJN A;  4IUM B;  1S1Q B;  2LVQ A;  2CU1 A;  2WDT B;  4IW0 A;  4MSQ B;  2CS4 A;  3QHT A;  2AL3 A;  4EZJ A;  4EKU A;  1F9J A;  2JT4 B;  4WWP A;  2O6V B;  4ANX A;  4KSK C;  3ZVV A;  4PS8 A;  1UH6 A;  3ML8 A;  4P7I A;  1XD3 B;  3QQ8 B;  3ZRF A;  2BYE A;  3QIJ A;  4G50 A;  1V9J A;  4KDL B;  3KYC D;  2DZM A;  2NS5 A;  3UIO B;  3H7P B;  4M0W B;  3DVN V;  3ML9 A;  1V5T A;  4F7Z A;  3QAR A;  4TUU A;  1YX6 B;  1EF5 A;  4HLE A;  1GJZ A;  2XBB C;  4E3C A;  1L7Y A;  5C1Z A;  3NY5 A;  5AZH A;  3V61 A;  2MLB A;  3N32 A;  2WX0 A;  4FN2 A;  4DHZ E;  3UIN B;  3Q3J A;  3DCG A;  5D94 A;  1WJU A;  2V4L A;  2JZ3 B;  2C7N B;  3OJ3 A;  2ZZP B;  2K25 A;  2DHZ A;  1UGM A;  2EMT A;  3ONS A;  3V6C B;  3APC A;  2UWQ A;  4IG7 B;  1WM3 A;  5JZE B;  2WWZ A;  2V3S A;  1T0Y A;  2MX2 A;  4MGI E;  4BKT A;  1Y8R C;  4NQK E;  2A5U A;  1WXA A;  4ASW C;  4HDQ A;  3A9K A;  2KXJ A;  1Q5W B;  4NNJ B;  2LI5 A;  1P3Q U;  4AUQ C;  2MSE D;  2DAF A;  3K9O B;  4ANU A;  1WZ3 A;  2N7E A;  2L00 B;  4II3 B;  2PJH A;  1E8W A;  4ICV A;  4TQ0 A;  3BY4 B;  3SDL C;  2MBO A;  2UYZ B;  4GMV A;  3WAN A;  1SGH A;  3QAQ A;  3WAM A;  2BKR B;  2XEW A;  3CF6 E;  5DPR A;  2AWT A;  3A9J A;  2KKC A;  2BPS A;  3RUL A;  1YIW A;  3UQB A;  2NPT A;  2DX5 B;  2KWV B;  2DAJ A;  2LJ5 A;  3LJ3 A;  4EOY A;  3ZNI D;  5D7G A;  4URK A;  5CTR C;  3VUW A;  3X0W A;  2L0F A;  2ZEQ A;  4CO7 A;  2I1J A;  2LVO A;  1NDD A;  4GU2 A;  3IFW B;  4JLC A;  4HPL B;  1KJT A;  4MH0 E;  4I6P A;  4A3O A;  4B6W A;  4JIO U;  2NR2 A;  4HXD A;  3A9K B;  2ZPY A;  4W9D A;  3ZW3 A;  4ZRJ A;  2MP2 A;  4I6N B;  4GGQ A;  4PYZ A;  3RYT A;  1XQQ A;  4W9E A;  5DPS A;  2KZR A;  3DBH I;  2YLM A;  3ZTD A;  2L0T A;  2CR5 A;  2KWU B;  1Z5S B;  3AI5 A;  3KVF B;  4HPM B;  2L76 A;  2KDF B;  2LVP A;  3EC8 A;  4XX5 A;  3LDZ E;  3PHW B;  4PYU A;  3GOE A;  4MEL A;  2XK5 A;  2IO2 B;  2W9N A;  3NZS A;  3PHX B;  3TL5 A;  1WJ6 A;  4K1R B;  3RCZ A;  2JZZ A;  5E6P A;  2JRH A;  5KHQ A;  4HK2 A;  2G4D B;  2HD5 B;  4WJO A;  4II2 B;  1LFD A;  3UQA A;  2CHX A;  3NS8 A;  4K81 A;  2FIF A;  3RUI B;  2KFK A;  1LM8 B;  3WIM A;  3UGB B;  2PEA A;  4GIV A;  4KZC A;  3VH3 B;  2JUO A;  2KN5 A;  2LGX A;  3EFU A;  4K7S A;  4WJQ A;  5J17 A;  2GBM A;  1V5O A;  2BGF A;  3EEC A;  3L0W B;  1WIA A;  1UEL A;  3X23 A;  4G0N B;  2HTH A;  2IO3 B;  2MP2 B;  2NBV B;  2EKE C;  1WXM A;  1WX7 A;  3B08 A;  4IWO A;  3SHQ A;  3L10 B;  5CHF A;  2DYM A;  1WR1 A;  3MTN B;  3Q3F A;  4EFO A;  5EDS A;  2D11 A;  2JRI B;  3H9D A;  3KYD D;  5DCN A;  2D3G A;  2MBH A;  2JY6 A;  4WJN A;  4MGK E;  1WGG A;  3HM6 X;  3H6N A;  3A4S C;  1ZW7 A;  4DK5 A;  2C7H A;  1P1A A;  4MM3 A;  3GZN I;  2DYB A;  3CSF A;  2GBR A;  2GMI C;  2O6V D;  3DPD A;  3H1U A;  2OJR A;  5TR5 A;  1WH3 A;  2LUE A;  2CHW A;  3M3J A;  3CMM B;  2K8H A;  2KDB A;  2V1Y A;  2FID A;  3SU8 X;  4BKG A;  4HJK A;  2N9X A;  3PT2 B;  1CMX B;  4JGH B;  3VTV A;  1WR6 E;  4BKS D;  3PRZ A;  1X1M A;  3V60 A;  2N7D A;  2RGF A;  2AEH A;  2L7R A;  3JW0 X;  2C7M B;  4RM8 A;  2GBJ A;  2KHW B;  2ZVO A;  3OLM D;  3PSE B;  3TMP B;  2RSU A;  2MBB B;  3V6E B;  2KTF A;  2G45 B;  1PQS A;  3M63 B;  2L05 A;  2DZJ A;  2D10 A;  2KWC A;  2PPH A;  4WAA A;  1L2N A;  1WGD A;  2Z0E B;  4KSL C;  1FXT B;  2IY1 B;  1RRB A;  3UF8 A;  4DWF A;  5JHB A;  1WJ4 A;  1Z2M A;  2KX0 A;  3ZUN A;  3NOB A;  5CX3 A;  3UIP B;  1RLF A;  2IBI B;  3PPA A;  2EMS A;  2J0M A;  1WFY A;  2N9E B;  3L54 A;  2ZVN A;  4JQW C;  2N1V A;  2FCM A;  2IO0 B;  4KVG B;  4PS7 A;  2WYQ A;  4LDT B;  3DVG X;  2AYO B;  3ZDT A;  1KM7 A;  3RT3 B;  3JVZ X;  4IWQ A;  4FUL A;  3NHE B;  5JHA A;  1K8R B;  1ZKH A;  3APF A;  1TZ1 A;  3DQV A;  2HE7 A;  2KMA A;  2GBN A;  4FBJ B;  3VAW A;  3KW5 B;  1WM2 A;  1E5W A;  4HCN B;  1WE7 A;  2MA9 B;  4BOS C;  2ZCC A;  4XC2 A;  3RZW C;  1RFA A;  2BKF A;  2ASQ A;  1WI0 A;  3AUL A;  4J6I A;  1OGW A;  1H4R A;  3L16 A;  3R7R A;  3AU4 A;  3A4R A;  3PRM B;  2JWZ A;  4NAW A;  4GOC A;  3ZRC A;  4FJZ A;  4FHK A;  2KDE B;  3OAW A;  4AJY B;  4M8M A;  3ZNH B;  2L8J A;  2KC2 A;  5IAA C;  3B1L X;  2L3Z A;  1C3T A;  3PTF C;  1WMH A;  2KLG A;  1V6E A;  3PRE A;  4W9K A;  3ALB A;  1V81 A;  2MBE A;  3C0R B;  4FJY A;  5CHW A;  3T9L A;  4EEW A;  5J2R A;  2ZNV B;  2KC1 A;  4HDO A;  4TV3 A;  2K8B A;  4IC7 B;  4MGZ E;  4MJS A;  3ECI A;  3M95 A;  4FLH A;  4NJ7 A;  5D2M B;  3VH4 B;  5IA7 A;  2CKH B;  3QX1 A;  4K7U A;  2FAZ A;  2D2Q A;  2G3Q B;  1SIF A;  2J7Q B;  1UZX B;  3BIN A;  1J8C A;  1H8C A;  4GB9 A;  1SE9 A;  3AXC A;  4NY0 A;  4I6L B;  3HK0 A;  1WYW B;  4MEM A;  4BVU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...