1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23 homolog B
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
4A3PA 2BYVE 2DENB 3MHSD 3KYCD 1GG3A 4DHZB 1TBEA 1WZ3A 3NZUA 3PREA 4K7UA 2V3SA 4KSLC 5J18A 4FHKA 4MH0E 2PEAA 4NY0A 5AZHA 3T9LA 2DAJA 1XT9B 3R66C 4ANWA 3VUXA 1P98A 2M1MA 2EKEC 4HPMB 4HVBA 4TUUA 4GDKA 2BKRB 3PRMB 3QC8B 2D10A 2GBNA 1LXDA 4GDLA 3VQIA 4FADA 1WXVA 2FCSA 3DOWA 3DPDA 2K25A 2LGXA 1WXAA 3PRZA 3L08A 1V49A 1EF5A 4FJVB 4WWPA 2IO2B 5LLIA 1GJZA 3H6NA 3NZSA 4IM2A 4MELA 2BGFA 3U30A 1WGDA 2K6DB 3L10B 2LI5A 2AL6A 1KOTA 2JF5A 3PRPB 2HD5B 1UD7A 2KHWB 2JY6A 2QHOA 3AU5A 2C7HA 2LD9A 3DVNV 4I6PA 3SHQA 4DDGD 4JLCA 4KV2A 3VTVA 4E71A 3X23A 2RR9A 2ZVOA 3RULA 2HTHA 3WANA 4MGIE 2DHZA 3VFKA 1GC7A 4HXDA 1Q1OA 1S3SG 4B6WA 4HLEA 4X57B 1YQBA 1AARA 2KWVB 4CYEA 4DHZE 3CMMB 2LRUA 4WJNA 3A9JB 3TMPB 1WIAA 4HCNB 5DPSA 4II3B 2DZJA 5E6PA 4ANUA 3PLVA 2CHXA 1YX6B 2KTFA 4PS8A 4MJSB 3QJZA 1NDDA 1TZ1A 2JWZA 3L16A 4MEMA 5L95C 3KYDD 4KZ0A 5CHVC 4NQKE 5BO4B 2MQJA 4KVGB 3APCA 3TCAA 3A33B 4WJPA 4A3OA 2ZZPB 3AU4A 3ZUNA 5G2NA 4AJYB 4KIKA 2I1JA 2L0FA 2KANA 2K8BA 2JUOA 1A5RA 2KMCA 3H9DA 2KQSA 5D94A 5LXHA 4W9LA 4MSMB 3OLMD 2N4FA 2KJHB 5HKHA 4AJWA 3EC8A 3IFWB 2KTRB 3ZIMA 5E6OA 4LDTD 4EKUA 1UBQA 1YX5B 3U7DA 3PTFC 3ZDTA 2C9WB 1OTRB 2KOXA 3ENEA 1TGZB 2M4NA 5CHWA 1UELA 4XZ4A 5IAAC 3QAQA 2BF8B 2NPTA 4GIVA 3NS8A 2AL3A 1H4RA 3R3MA 3PS6A 1WMHA 4NAWA 2AEHA 2GBRA 2N9PC 1UGMA 3DQVA 4YL8A 3I3TB 3H7PA 2YLMA 3LJ3A 2I1KA 3ALBA 4JQWC 1VCBA 2DZIA 2MP2B 2N1VA 2NR2A 3PHXB 4IWOA 2O6VB 3HM6X 4XC2A 4KDIC 3W1SC 4PS7A 2J0JA 5J17A 4KDLB 3JSVA 4AUQC 2M17A 4J6IA 5AEKB 4DHJB 1D3ZA 2HJ8A 4M8NA 1E7VA 3ZNGC 4W9EA 3DBRI 1QZEA 4OVVA 2LVPA 2KZRA 3ZW3A 3ML8A 3BY4B 3PSEB 3NOBA 3ZRCA 2ASQA 4NNJB 1TTNA 4BBNF 2JZZA 5KHOA 3VHTC 3PVLA 2GBMA 4GMVA 1P1AA 3VTUA 1V86A 3VH3B 1XQQA 2RD0A 3UGBB 2JPHA 2N9EB 1V6EA 1WY8A 1YD8U 2Z59B 4II2B 4FJZA 1E5WA 3M62B 3T8MA 2RSUA 2ZNVB 3JVZX 1GC6A 1UBIA 3DBSA 2LRWA 3KH0A 1WF9A 4F7ZA 2W9NA 1VD2A 2G45B 4FN2A 2MBQA 5AZGA 2IYDB 2LVOA 4MDKE 2KO3A 2XK5B 3GZNI 3R7RA 3RZWC 2G4DB 3KUDB 1OGWA 1RLFA 3R7QA 1E8YA 2GMIC 2ZPYA 3EECA 1WJ6A 4G0NB 1WYWB 1E8XA 4MGZE 4EFOA 2PJHA 2C7NB 3A9JA 3UF8A 4IWQA 4EEWA 3PZDA 2MX2A 2JRHA 1Q0WB 2LGDA 4TQ0A 4ZRIA 4DDID 3A4RA 1V81A 3ZRFA 4ICVA 1RRBA 4JIOU 3KVFB 2AYOB 3RCZA 5JH5C 1WX7A 2MLBA 3IG3A 3W1YA 4M0WB 4NJ6A 1I35A 2GBJA 5D2MB 1LM8B 2IO1B 3OJ4B 3RT3B 1WGHA 1RFAA 4EZJA 1V9JA 4IUMB 3DVNU 1IP9A 1H8CA 3B1LX 1XD3B 5CTRC 2ZJDA 2LWPA 3RUIB 3MTNB 4TQ1A 1E7UA 3RYTA 2DYOA 2KLGA 3K9PB 5EDSA 3ZNZB 2LJ5A 2KWCA 1IPGA 4EZKA 3SDLC 3QHTA 4JGHB 2KJRA 3WIMA 2WX0A 5L83A 4K1RB 2IBIB 4ZRKA 4HCPB 4W9FA 1WGRA 2A4ZA 2MWSB 3KUZA 1WX8A 2K8CA 1WXMA 2KFKB 1WH3A 2KD0A 3EFUA 1OEYJ 4N9F4 3ZTDA 1ZGUB 2IO3B 4BOZB 2D2QA 4GOCA 4IM0A 5TR5A 4FA6A 2G4SA 2M0XA 5JZEB 2J0KA 2M8SA 4CO7A 4I6LB 4PYZA 2O2VB 2L00B 3A1QA 3CSTA 3GOEA 1WGGA 4LDTB 2UYZB 3VAWA 2D07B 2DAFA 2FCQA 2IZVB 2JZ3B 2GBKA 3QQ8B 3N3KB 2KVRA 5LXIB 1K8RB 2DZKA 3QK0A 4GGQA 2V1YA 4PS3A 3V62A 5E6NA 3V60A 4WAAA 2Y5BB 5JHAA 4IM3A 3ONSA 3SD5A 3A9KA 2C5LC 2D3GA 2PPHA 4NJ7A 1KM7A 1I42A 3PHWB 5DPTA 3L17A 4W9DA 3TL5A 1LQBA 3AI5A 3PGEA 4PYUA 1Z2MA 2KNBA 2KX3A 4GDKB 1KLVA 2KN5A 2EMTA 3U8ZA 4GDLB 4HJKA 3S2AA 1WM2A 4W9IA 2MA9B 3N32A 2FNJB 3PPAA 1P9DU 2DZMA 1Y8RC 2C60A 2JXXA 2XBBC 4IG7B 1V2YA 4TKNA 5IA7A 3X0WA 2KDFB 1GNUA 2JVCA 3DCGA 3HK0A 1P3QU 2LGYA 3KW5B 4M8MA 3TBLD 3W1SA 4EZLA 2JRIB 3DVGX 2DX5B 4FLHA 4BKTA 1YIWA 2PE9A 4MGKE 4MGYE 3AXCA 4XX5A 5JHBA 4W9JA 3H1UA 3IHPC 3JYUA 4F8CB 4BKGA 2FIDA 1V80A 4G11A 2IY0B 3Q3JA 4WJOA 4DK5A 5D6JB 2J0MA 3TJPA 2KC1A 2NS5A 2MCNB 4ANVA 1WJ4A 1WR6E 2BPSA 3IBEA 2L05A 1CMXB 3C0RB 3WALA 1M94A 4B9KA 2FCMA 4GN1A 2AWTA 2NVUI 5AZFA 1V5OA 3PV1A 2KWUB 3VUYA 4CHKA 2CR5A 4KSKC 2MW5A 2L3ZA 2V4LA 2IO0B 2YVCA 3RZFA 4ZDVA 5C1ZA 1SGHA 3VXWA 4DWFA 4KIKB 1HE8A 1WR1A 2REXA 5D7GA 3UQBA 4AP4C 1E8WA 2BKFA 3PLUA 2JT4B 1J8CA 2N1WA 1ISNA 1WX9A 1X1MA 2LXAA 3ZDMC 4ICUA 4RM8A 2BWES 3IVFA 3ECIA 1WJUA 3QA8A 2LZ6A 5CHFA 2CHZA 2KFJA 2K8HA 1OEYA 3CF6E 3EHVA 4BKSA 3VH4B 2L76A 1YJ1A 2D11A 4MJSA 2K6QA 4DHJD 3ZKJC 4K7WA 3LDZE 2NPTB 2FUHB 4WWNA 1NI2A 4NAWB 3QWZB 2CHWA 4ZYNA 2ZVNA 2KDBA 3H7PB 3V6CB 1U4AA 2KLCA 2KKCA 1FXTB 2KX0A 3Q3FA 3HHMA 1SIFA 1UH6A 4WWOA 3QCAA 2MBBB 2ZEQA 1R4MI 4LCDE 5C23A 3DVGY 3VDZA 2A5UA 3V6EB 3QX1A 4IW0A 2EMSA 2L0TA 1ZKHA 2KTRA 4FULA 3JSVB 4A20A 3B08A 4LJOB 1WRDB 4E3CA 1C3TA 3WA0A 5DPWA 2XEWA 3AULA 2N7DA 1IYFA 2KXJA 2Z0EB 1EUVB 3L54A 2NCNA 2VRRB 4ZRJA 1NBFC 2NBWB 4ANXA 2KK8A 2HE7A 4P7IA 2RPQA 4K7SA 2LUEA 3K9OB 3WAPA 4IWPA 4BBNC 1WZ0A 4EOYA 4W9GA 1MG8A 1WE7A 4WJQA 3ZNID 4BVUC 1GUAB 3APFA 2WX1A 4LJPB 4RM9A 1V5TA 2ZPNA 4W9CA 2MP2A 3TIXA 2L8JA 3A4SC 2O6VA 3L0WB 4NPNA 5GMVA 2FIFA 4JL9A 5CX3A 3B0AA 4KZCA 3M95A 1WFYA 2KDIA 3OAWA 3ZLZA 4BFRA 3BINA 3VTWA 3M3JA 3UIPB 1JRUA 4GB9A 3HM3A 2KJ6A 2ZCCA 1C1YB 3DBHI 2N9XA 4HK2A 4OVUA 2MBHA 3UQAA 2IY1B 3NHEB 3RD2A 4AWJA 3UINB 2DYBA 2DYMA 4GXBA 3DBLI 2WWZA 5FR6A 2OJRA 2LVQA 2KC2A 3ZVVA 2WDTB 4HDOA 2OOBB 2BYEA 1R4NI 4G50A 1E8ZA 4NQLB 3PT2B 2L7RA 2UWQA 3SU8X 3ZNHB 4F1SA 3V61A 3JW0X 4FHJA 4WQOB 1RAXA 4K81A 3OJ3A 2ZNVC 1WJNA 4HWIB 4URKA 1WI0A 3MJWA 4ASWC 2XK5A 1T0YA 3ZO5B 2MBOA 5G55A 1WGYA 2BWFA 2LXCA 4DBGA 2KQ7A 3P2BA 3VUWA 1WM3A 4B95A 2K1FA 4BKSD 4W9HA 3DDCB 2NBUA 1BT0A 2C7MB 1P0RA 4DXAB 4FJYA 2N7EA 1KJTA 2CS4A 2MBEA 2MRPA 2FAZA 4GSWA 3N30A 2RGFA 1ZW7A 2KMAA 2LASA 4MSQB 2J7QB 3APDA 4AOFA 1J0GA 1WE6A 1OQYA 2CU1A 4G3XB 4W9KA 3ZTCA 1UZXB 2K39A 3UIOB 3A1QB 3O65B 1Q5WB 4GU2A 2G3QB 3VVWB 2Z0DB 1E90A 2GOWA 4MM3A 2WYQA 3CSFA 1EO6A 1S1QB 3L13A 5DPRA 3HIZA 4TV3A 5DCNA 1PQSA 1Z5SB 3ML9A 4I6NB 1G6JA 2KFKA 3A9KB 2MSED 2B3AA 3M63B 4HPLB 2ZCBA 3D32A 3H7SA 2O6VD 2R2QA 4BOSC 3QIJA 1L7YA 1LFDA 3WAOA 2O2VA 5KHQA 2KDEB 3QARA 3WAMA 2FCNA 3KUCB 4HDQA 1J19A 2R2OA 4IC7B 1WXSA 4FBJB 2NBVB 1L2NA 5J2RA 4E74A 1F9JA 2CKHB 3NY5A 4EUTA 2BYFA 1WMHB 1EF1A 1SE9A 2PE6B 4RMAA
chains in the Genus database with same CATH superfamily
4A3PA 2K9XA 3MHSD 4KSLC 3NVVA 3T9LA 1XLQA 2INPE 4HVBA 4GDKA 1LXDA 1WXVA 2FCSA 1IBXA 3DOWA 4N59A 1WXAA 1IGDA 3IAM1 4DQOC 1GJZA 2WQYB 1WGDA 2AL6A 1F2RC 2QHOA 2JY6A 2WXJA 2LD9A 4I6PA 4DDGD 4KV2A 1VLBA 4ZHPA 3U2SC 3J9CA 2ZVOA 1V97A 2PKOA 2N7JA 3VFKA 1Q1OA 1S3SG 1SE4A 3BVGA 3DBLB 3HVZA 2KWVB 1KH0A 1Q10A 3KWVA 2DNFA 1R4NB 3FAHA 4HCNB 2MEKA 3P4RB 2DZJA 1UUPA 3AM9A 1YX6B 3AV8A 2JWZA 2V9HA 3AMZA 3W5VB 2MQJA 3ZXRA 2ZZPB 4KIKA 2L0FA 3FKYA 5D94A 1EU4A 2K22A 4MSMB 3I63C 3OLMD 2KJHB 1C4PA 3EC8A 3ZJUA 2KTRB 2WDQB 3I5JC 3BYTB 1OTRB 2WXNA 2D3CA 1N60A 5IKCM 3QAQA 3NS8A 3Q14C 2AL3A 3MC8A 3AEFB 2QSDA 1UGMA 3DQVA 3NJTA 3H7PA 2YLMA 2Y3AA 1SEBD 3VRAB 4PT5A 1L0XB 3NVZA 3RNAC 4KDLB 1RFKA 3DHIC 2M17A 4YSYB 1D3ZA 4M8NA 1CK1A 3ML8A 2ZW0A 3PSEB 3ZW3A 2ASQA 1VRAB 2LGIA 2GBMA 4GMVA 1V86A 3Q8AA 1V6EA 3FILB 1YD8U 2RSUA 1FNWA 2ZNVB 2H89B 2QMTA 3R2TA 3SR6A 3BYYB 4BZAA 1DOXA 1F52A 5AZGA 2LVOA 4ITKA 4MDKE 2KO3A 3Q3NC 1XXGA 2W54A 2G4DB 3E9SA 1RLFA 2J53A 2MHJA 4G0NB 3L4PA 1HZ5A 2D3AA 2PJHA 2C7NB 3UF8A 4EEWA 3PZDA 2AQ1B 1ZP0B 1Q0WB 1YN3A 3A4RA 1V81A 4ICVA 1RRBA 3RCZA 3URYA 2MLBA 3IG3A 2NMQA 5D2MB 1JW9D 3RT3B 1E0ZA 1RFAA 4HKQA 2OHFA 2VH2A 3DVNU 2L83A 2LWPA 1GPXA 3RYTA 2KQ4X 1L6UA 4MACA 2KJRA 2WX0A 4RF0A 5L83A 4S17A 4ZRKA 2A4ZA 3KUZA 2K8CA 3EFUA 2SEBD 5C3JB 1ZGUB 4BOZB 4LLGM 5TR5A 2M0XA 5EE3A 3AEDB 3EUB2 1YOVB 4I6LB 1LO5D 2L00B 2O2VB 3GOEA 2Q5WD 2FCQA 3PZ8A 3RNCC 2GBKA 1GOZA 3Q8CA 3N3KB 3V62A 5E6NA 2Y5BB 3A9KA 2C5LC 3PHWB 4WQMA 3TL5A 1QF6A 4M02A 3AI5A 2KX3A 1KLVA 1JWUD 2AX5A 3GS2A 2MA9B 3N32A 2FNJB 3PPAA 2JYEA 4KKJA 3AEEB 4A8XC 4IG7B 1V2YA 4TKNA 3DCGA 3HK0A 2LGYA 3TBLD 3GE3C 2JRIB 3GP7A 3DBRB 1YIWA 3AXCA 3IHPC 1TKEA 4G11A 4A90A 4RGTA 2NS5A 5BYSA 1CMXB 1QQRA 2J52A 3C0RB 3WALA 3Q8FA 4JWUC 5AZFA 2KWUB 4CHKA 2CR5A 3GZNB 2IO0B 2YVCA 4OZCA 3VXWA 4DWFA 1UGJA 5D7GA 4AP4C 1E8WA 1T0QC 3Q6BA 1ISNA 1WX9A 3MC9A 2BWES 3IVFA 3ECIA 2LZ6A 2L52A 2K8HA 3EHVA 3TSSA 4MJSA 5BMGA 2NPTB 1NI2A 3P4SB 1D6EC 4ZYNA 2QIEB 1PGBA 1P7EA 3ZYYX 1UH6A 4WWOA 3AN1A 2ZEQA 5C23A 1R4MI 3AE5B 3VDZA 1DOYA 4C7YA 4IW0A 2L0TA 1EWCA 5IN7A 4FULA 3NUHB 3WA0A 1KF6B 2N7DA 1IYFA 3NZ3A 1EUVB 1YJIA 2NCNA 2NBWB 2WXPA 2KVZA 4IWPA 1RM6C 1WZ0A 4EOYA 4IDIA 4WJQA 3ZNID 4LJPB 5H92C 2CJOA 1T6BX 5GMVA 3L0WB 1ENFA 4HKZE 3B0AA 3ZLZA 4BFRA 3BINA 3MHZA 3VTWA 4ARCA 4GB9A 1C4AA 1Y56A 2LUMA 1C1YB 4EE2A 4OVUA 2MBHA 1PGXA 3HRDD 2DYBA 3O13A 1PFDA 2OJRA 1T0RC 4HDOA 3IAS1 1E8ZA 3U4EG 1MHHE 4K81A 3OJ3A 3RFZB 1WI0A 3MJWA 4AQ7A 2XK5A 3ZO5B 1AWDA 2LXCA 1XLNA 4DBGA 2ACZB 3P2BA 1AW7A 1V1PB 1ROEA 2C7MB 1XF5L 1P0RA 1KJTA 1BXTA 2JX5A 3EA6A 4HJGE 5I4DA 4MSQB 4M0WA 5HI1A 1OQQA 5GXGB 4H2AA 3ZTCA 2K39A 1JMLA 3A1QB 2RDGA 2G3QB 1CZPA 1E90A 3Q3MC 4MM3A 2WYQA 1KLGD 2VH1A 1VJKA 5LNK1 2IJ0A 4JWSC 1PQSA 4I6NB 2QILA 3M63B 4HPLB 3D32A 1HZ6A 4BOSC 2H88B 3RNBC 1J19A 2NBVB 2RDHA 3Q3OC 3NY5A 1WMHB 1BUIC 1SE9A 4RMAA 2DENB 3NZUA 2V3SA 5FR3A 4MH0E 2PEAA 5AZHA 4GLSC 1XT9B 3VUXA 3SEBA 1P98A 3LXFA 4HPMB 4TUUA 3QC8B 1L0VB 2D10A 4GDLA 3DPDA 2V0GA 2LGXA 4FJVB 4WWPA 2IO2B 5LLIA 2I2YA 4IM2A 4MELA 2BGFA 3L10B 3PRPB 2HD5B 1F1HA 2TSSA 1RYJA 1JRPA 3SFEB 3VTVA 1AN8A 2HJ1A 4MGIE 4P1CC 1UWMA 2BB6A 2WS3B 4HLEA 3AE9B 4USAA 4WJNA 4HROA 3TMPB 4ANUA 3LYYA 3NG0A 4N6EB 1WWTA 2CHXA 1TZ1A 3HVDA 5L95C 4NQKE 5BO4B 4KVGB 3TCAA 3A33B 3N1YC 4A3OA 3AB5A 4AJYB 2KANA 2JUOA 3H9DA 2KQSA 5LXHA 3ZIMA 3W2DA 5E6OA 4EKUA 1I4QA 1FM0D 2KYWA 3ZDTA 2C9WB 2KN4A 3ENEA 5G5GA 1TGZB 5IAAC 2BF8B 2JZPA 1VZ7A 1ET6A 3R3MA 3PS6A 2VZKD 1WMHA 2GBRA 2N9PC 3LJ3A 2YEPB 5BMHA 2I1KA 1C78A 4RH6A 1VCBA 2DZIA 2MP2B 2N1VA 2I38A 4IWOA 3W9CB 1NEKB 3HM6X 3TEXA 3W1SC 2J0JA 2WXGA 4AUQC 3ZNGC 4W9EA 1QZEA 3BY4B 2EELA 1TTNA 1OQRA 1D5ZC 5KHOA 3PVLA 3P4PB 4NZLB 2RD0A 1M4VA 3UGBB 1IUEA 1FFVA 3T8MA 3JVZX 1CJEA 1WF9A 2W9NA 2G45B 2INNE 3IT4B 1ACCA 1XCQL 2GMIC 3EECA 1WJ6A 1WYWB 2MX2A 1E7PB 4ZRPA 2LGDA 1NYQA 4TQ0A 1YN5A 4ZRIA 1K51A 3KVFB 2D3BA 3W1YA 3GB1A 1LM8B 3OJ4B 1WGHA 4EZJA 1C79A 1IP9A 3B1LX 4XGAB 5CTRC 2KLGA 3SDLC 3WIMA 4W9FA 2LGSA 1WX8A 4OZAA 2KFKB 1WH3A 2KD0A 1FCLA 2D2QA 4YXDB 4IM0A 2ICIA 2LMCA 4CO7A 4FXCA 4PYZA 3VAWA 2D07B 1TS2A 3QQ8B 2KVRA 1K8RB 3QK0A 5EE9A 4WAAA 3ONSA 4OHJA 1KM7A 3PGEA 4PYUA 1Z2MA 2KNBA 1B9RA 1QKZA 1C9FA 2KN5A 4HJKA 3S2AA 2W82A 1P9DU 2DZMA 1I4PA 1SIJA 5IOIA 1I4HA 2JXXA 3DVGX 4FLHA 2LEKA 4BKTA 3ZJVA 4XX5A 3H1UA 3JYUA 4ZHOA 2FIDA 1V80A 2IY0B 5D6JB 4ANVA 1WR6E 2BPSA 2KWDA 3IBEA 4NAMA 5BYRA 4B9KA 2FCMA 2AWTA 4KSKC 2V4LA 5IP4D 4ZDVA 1SGHA 1WR1A 2REXA 1FNVA 1J8CA 2BKFA 2AQ2B 3MJ5A 2DLBA 2LXAA 3VRBB 1LGRA 2JSVX 4RM8A 3QA8A 2CHZA 1T5XD 3CF6E 1YJ1A 4JX1C 3AEGB 4DHJD 1QT9A 1FO4A 4B0MA 2BS4B 3LDZE 2JXTA 2FUHB 3ABVB 4WWNA 3KLSX 3CWIA 4MH8A 1I4RA 4YWGG 4NAWB 1XCTL 1HXYD 1U4AA 2KX0A 3HHMA 1SIFA 2MBBB 4LCDE 2EMSA 2KTRA 4P16A 3JSVB 3B08A 1WRDB 4E3CA 1MPEA 2XEWA 1QOGA 3L54A 1VDVA 3V05A 4ZRJA 2WDRB 1NBFC 2HE7A 2R61A 2RPQA 2LUEA 3K9OB 5EE1A 1K50A 1MG8A 1GUAB 1XLOA 3TIXA 2L8JA 4NPNA 1JWSD 1DYQA 4KZCA 2WLBA 3OAWA 2KJ6A 2KAJA 3VR8B 1JWBD 4XDCA 4J3OD 3UQAA 3RD2A 4YTPB 3DBLI 2WWZA 1DOIA 3P63A 1N63A 5AUIA 3FILA 2JQRB 1R4NI 2PW9A 3PZ7A 3SU8X 3V61A 4WQOB 2NTSA 2X38A 1RAXA 2ZNVC 4KKIA 5G55A 1WGYA 1WM3A 1ZXIA 1WSPA 4HPPA 4BKSD 4W9HA 3DDCB 2PIAA 2N9LA 4DXAB 4RGOS 3RPFC 2MRPA 3N30A 1ZW7A 4WURA 2WXMA 2WHIA 1FNUA 4NJCA 3APDA 3U52E 2L32A 2J42A 1WE6A 2CU1A 1UZXB 4IOIE 2Z0DB 1T3QA 1T0SC 3C19A 1EO6A 1S1QB 3L13A 1K52A 2BB5A 1D5MC 1R7SA 2IGGA 3ML9A 5DCNA 1G6JA 3Q69A 3RNGC 2B3AA 2N9KA 3GE8C 3TEZA 2O6VD 3QIJA 1IGCA 1L7YA 3MP9A 2WU2B 1LFDA 3BIID 2WXQA 2O2VA 3QARA 5BYQA 3WAMA 3KUCB 3V3XA 1SB3C 4A6QA 5J2RA 4M01A 1SSNA 4EUTA 4XE0A 4DHZB 3BZDB 1WZ3A 3PREA 4FHKA 4LTUA 1J7BA 4NY0A 4XYCA 2DAJA 2WGSA 3R66C 2FUG1 3IXSA 2LHDA 2M1MA 2BKRB 3AE8B 3OG5A 4FADA 2K25A 3PRZA 3L08A 1V49A 1FXAA 5T8IA 3U30A 1CQVA 3ZXVA 4WAFA 1MFWA 1KOTA 1UD7A 3SHQA 2C7HA 2Y5PA 2PVGC 4XDDA 3X23A 2RR9A 1YN4A 1E10A 2M56B 4B6WA 1ZXHA 4C4VB 3RN9C 1AARA 4CYEA 4DHZE 3N20C 2LRUA 1WIAA 5DPSA 5E6PA 2CU3A 3P42A 1TYGB 3PLVA 3DWGC 1PYWD 3AEBB 2MH7A 3QJZA 1NDDA 3KYDD 4KZ0A 4C56C 3AU4A 3ZUNA 1UWXA 5G2NA 1KLUD 4W9LA 5HKHA 4AJWA 3IFWB 2EKIA 4LDTD 3U7DA 2D5GA 2M4NA 4XZ4A 2NPTA 4GIVA 2QJLA 2AEHA 2WXKA 2O6VB 3TUOA 3NVWA 1YQ4B 5J17A 2CJNA 4QAYA 1E7VA 3DBRI 2KZRA 3WCQA 3NOBA 3ZRCA 1N5WA 3ZQ4A 2RPVA 3E56A 2JZZA 1AYFA 3VHTC 1P1AA 3T3NA 3VH3B 2YEPF 2N9EB 2Z59B 4II2B 4FJZA 1E5WA 3M62B 1SJED 1UBIA 3DBSA 2LRWA 3KH0A 4F7ZA 1VD2A 3PO0A 2MBQA 4YT0B 2QEJC 4L2YA 3GZNI 3KUDB 2ZPYA 1JROA 1GB1A 2W3RA 4DDID 1MJDA 3TEWA 4JIOU 2AYOB 2E3TA 4LK0M 1V1OA 1WRIA 2IO1B 3FC4A 4IUMB 1H8CA 1V1PA 3MTNB 4RFBA 1E7UA 4UDUC 1TKYA 3K9PB 4B0EA 1FPYA 3ZNZB 5EDSA 2BT6A 2LJ5A 1IPGA 4EZKA 2IDYA 4JGHB 3Q2AC 1WGKA 4K1RB 1J7CA 4K3CA 5HHDG 1WXMA 4A9AA 4ZYSA 1MI0A 3ZTDA 1TY2A 1N61A 2J0KA 2M8SA 3CSTA 3A1QA 4LDTB 1WGGA 2UYZB 2IZVB 1TS3A 1QOBA 2DZKA 4LNFA 2V1YA 3DHHC 3V60A 4IM3A 3SFDB 2LJIA 4NJ7A 1I42A 5DPTA 1SBBB 1LQBA 4GDKB 2EMTA 3U8ZA 2RDBC 1WM2A 1ZOYB 2INCC 1IBXB 1YNTE 2PVOD 2W55A 2DBYA 1C4CA 2C60A 2GB1A 4M00A 2XBBC 2KDFB 1GNUA 2JVCA 4M8MA 2KMMA 5TSSA 3W1SA 4LNNA 2DX5B 3U7ZA 2IGHA 1F77A 2PE9A 1QILA 5JHBA 1JWAD 2MJ3A 4F8CB 2ZW1A 1PDXA 4BKGA 3Q3JA 4RF1A 4WJOA 2GI9A 2KC1A 2MCNB 3I9V1 1L0YB 2X8XX 4LNIA 1J7AA 2GLSA 1M94A 1ZUD2 4GN1A 2NVUI 3BK2A 2MW5A 4LNOA 3RZFA 4YTNB 3RNFC 1ET9A 1QLBB 4KIKB 1HE8A 3UQBA 3PLUA 1TJEA 4ICUA 4P1BC 1SE2A 1MVKA 5HFYA 2MJDA 4DXFA 2L76A 2IGDA 3ZKJC 2J4XA 2WP9B 4K7WA 3VR9B 2Y5CA 3QWZB 1KFYB 3N1XC 3H7PB 2KDBA 3V6CB 2OJWA 3DVGY 3V6EB 3W5UB 3QX1A 1ZKHA 5EE0A 4A55A 2E6XA 4A20A 1C77A 1C3TA 3AULA 1V8CA 4C00A 1E6EB 5AUKA 2KK8A 4K7SA 3WAPA 2LHEA 1WE7A 2KACA 4RM9A 4W9CA 2MP2A 3A4SC 1SE3A 4JL9A 3BK1A 5CX3A 3M95A 1WFYA 1D4BA 2HTME 5D3DA 3M3JA 3BVMA 3UIPB 2JU6X 4XWTA 3HM3A 3TEYA 2FE8A 2VZKB 2IY1B 2BS3B 3UINB 4HEA1 4GXBA 3EFCA 1WYGA 5FR6A 4KX6B 2LVQA 3CIRB 1RWSA 2WDTB 3I57A 1I7HA 2OOBB 2MJEA 4G50A 2JWUA 3PT2B 3ZNHB 4F1SA 3JW0X 1WJNA 5G5HA 3NS1A 1T0YA 2KQ7A 4B95A 2K1FA 2GRIA 1BT0A 2CS4A 2MBEA 4D2KA 2FAZA 2RGFA 2KMAA 3ETRA 1HA5A 1UF0A 5HG2A 4PK1A 4AOFA 1J0GA 1F2RI 3UIOB 4RCOA 4L23A 4GU2A 3VVWB 2GOWA 4YTMB 5DPRA 1XLPA 5JXVA 1Z5SB 2KFKA 3A9KB 2MSED 3C8YA 2ZCBA 2IPKD 3WAOA 2PTLA 5KHQA 4IKGA 1FEHA 1MG4A 1ZDVA 2R2OA 4IC7B 1WXSA 4FBJB 1L2NA 1F9JA 2CKHB 4RGNA 2L1AA 3BVZA 1EF1A 2PE6B 1R4MB 2BYVE 1FIQA 1FXIA 3KYCD 1GG3A 1TBEA 3T3OA 4K7UA 3R2IA 5J18A 1P7FA 2FBWB 2WXRA 4ANWA 4RGMA 2EKEC 4C80A 2XN9C 3PRMB 3VQIA 2GBNA 2K0PA 2BS2B 4ZOHC 5MPOA 2XNAC 1EF5A 3R8BA 3BWUD 5H8YE 3H6NA 5C2TB 2UU7A 1N6ZA 3NZSA 3Q8BA 2K6DB 2N0SB 2LI5A 4ZRQA 2JF5A 2KHWB 1MHXA 3AU5A 3DVNV 4JLCA 5FK9C 2DWQA 4E71A 1BMLC 3RULA 2HTHA 3WANA 2DHZA 2WNMA 1GC7A 4HXDA 1TZOA 2V3NA 4X57B 1YQBA 2V4IB 1FD6A 3CMMB 3A9JB 4WIPA 4II3B 2BW2A 4PS8A 2KTFA 4MJSB 3L16A 4MEMA 5CHVC 4KGRA 3APCA 4WJPA 4S0RA 3AE1B 1EWYC 2I1JA 2K8BA 3OWEB 1N5XA 2KMCA 1A5RA 2N4FA 2G1EA 3B2FA 1JCKB 3Q8EA 2QC8A 4WWMA 4YSZB 1UBQA 1YX5B 3PTFC 2KOXA 1NI3A 5CHWA 1UELA 1K53A 1YMHE 1H4RA 4NAWA 3ZGZA 4YL8A 1F0ZA 3I3TB 1GAQB 3H8HA 1XEEA 4WH4A 3ALBA 4OVZA 4JQWC 2NR2A 3PHXB 4N58A 4XC2A 4KDIC 4PS7A 3JSVA 4J6IA 5AEKB 4DHJB 2HJ8A 4O1NA 1GB4A 4OVVA 1FCCC 2LVPA 2Z8LA 4NNJB 4BBNF 4P6VF 1VR9A 4DXGA 3VTUA 1FFUA 3KQ4A 1XQQA 2JPHA 1QOFA 1WY8A 1GC6A 5E6JA 2WXHA 4FN2A 1NYRA 4TMAB 2IYDB 2XK5B 3R7RA 3RZWC 1OGWA 3R7QA 1E8YA 1E8XA 1HTOA 4MGZE 4EFOA 1WXQA 3A9JA 4IWQA 2KT7A 2JRHA 2K5PA 2M19A 3ZRFA 5JH5C 1WX7A 2WDVB 3MC0B 4M0WB 4JE3B 4NJ6A 2GBJA 1D5XC 1I35A 3DWMA 2G9HD 4ARIA 1V9JA 4LNKA 2RMMA 1XD3B 2ZJDA 3RUIB 4TQ1A 2DYOA 1HQRD 4MM3B 2KWCA 2QCZA 4US8A 2M0AA 3DBHB 3QHTA 2IBIB 4HCPB 1DGJA 1WGRA 1XO3A 2MWSB 4REZA 3B2GA 1OEYJ 4N9F4 2IO3B 4GOCA 4YSXB 4FA6A 2G4SA 5JZEB 4KGSA 4CQNA 3AEAB 3B9JA 3AE7B 2DAFA 2JZ3B 5LXIB 1L4ZB 2LFIA 4GGQA 4PS3A 3UI3A 1QOAA 1SJHD 5JHAA 3SD5A 1FRDA 2D3GA 3RNEC 2PPHA 3L17A 4W9DA 3AE2B 3AE4B 4GDLB 2BTEA 5IO9A 4W9IA 1HTQA 1TT5B 1Y8RC 5IA7A 4OZBA 3X0WA 3KW5B 1P3QU 4EZLA 5D3IB 3N1ZC 4MGKE 4MGYE 4W9JA 1I4GA 1YJJA 4OW0A 2PLPA 2NTTA 1JALA 2PMVA 3EGRA 4DK5A 1VZ6A 1VZ8A 2J0MA 2ONQA 3TJPA 3ZJTA 2BVCA 1WJ4A 2L05A 4R3DA 2WU5B 1SF0A 1V5OA 3PV1A 3VUYA 4AS1A 5FKAC 5BMIA 1STEA 2L3ZA 2WXOA 3KWLA 3NVYA 1A70A 5C1ZA 3AECB 2JT4B 4C4VA 2N1WA 3ZDMC 1X1MA 3RI7C 3DHGC 1WJUA 2BBCA 1N62A 5CHFA 2KFJA 2BYTA 3AE6B 1OEYA 4BKSA 3VH4B 1HEZE 2D11A 2K6QA 1TY0A 1PUTA 2AQ3B 2QDFA 2SAKA 2CHWA 2ZVNA 1ZE3D 1ZPSA 1NENB 2KLCA 2KKCA 1FXTB 2ON8A 3Q3FA 1FMAD 3QCAA 1ESFA 1PGAA 2V3PA 2A5UA 2BQQA 1TS5A 4LJOB 5DPWA 1SXTA 2KXJA 2Z0EB 2WXFA 2VRRB 4ANXA 4P7IA 4K3BA 3P1MA 4BBNC 4W9GA 4BVUC 3APFA 2WX1A 1V5TA 2ZPNA 4C7ZA 4US9A 2O6VA 2B76B 2FIFA 2WXIA 4TSSA 2KDIA 2KDMA 4BAXA 4L1BA 4XWWA 1TS4A 1JRUA 4JPSA 1C76A 2ZCCA 3DBHI 2N9XA 4HK2A 1E9MA 3LB8C 4AWJA 3NHEB 4HRSA 2DYMA 3ZVVA 2KC2A 3AH7A 1ZDXA 2BYEA 2JYTA 1TIFA 4NQLB 2K3UA 2L7RA 2UWQA 2INDC 3P4QB 4FHJA 2OEDA 1YQ3B 3IT6B 4HWIB 4URKA 4ASWC 1KRHA 1KTKA 2MBOA 2BWFA 1EU3A 4MT5A 3VUWA 3HUIA 1B1ZA 2NBUA 1TKGA 4FJYA 2N7EA 4GSWA 1JQ4A 2HDEA 2LASA 2J7QB 4RNAA 1EM7A 1OFFA 2W3SA 1OQYA 4G3XB 4W9KA 3N9YC 3O65B 1NVID 1Q5WB 4ACFA 3RMKC 4Q2JA 3CSFA 1I4XA 3HIZA 4KGTA 4TV3A 1FRRA 3MFGA 1L5PA 3H7SA 2R2QA 1L6VA 1L4DB 2WXLA 2KDEB 3AE3B 2FCNA 3NRZA 4HDQA 1UNSA 1JWMD 4E74A 2BYFA
chains in the Genus database with same CATH topology
4A3PA 2BYVE 2DENB 3MHSD 3KYCD 1GG3A 4DHZB 1TBEA 1WZ3A 3NZUA 3PREA 4K7UA 2V3SA 4KSLC 5J18A 4FHKA 4MH0E 2PEAA 4NY0A 5AZHA 3T9LA 2DAJA 1XT9B 3R66C 4ANWA 3VUXA 1P98A 2M1MA 2EKEC 4HPMB 4HVBA 4TUUA 4GDKA 2BKRB 3PRMB 3QC8B 2D10A 2GBNA 1LXDA 4GDLA 3VQIA 4FADA 1WXVA 2FCSA 3DOWA 3DPDA 2K25A 2LGXA 1WXAA 3PRZA 3L08A 1V49A 1EF5A 4FJVB 4WWPA 2IO2B 5LLIA 1GJZA 3H6NA 3NZSA 4IM2A 4MELA 2BGFA 3U30A 1WGDA 2K6DB 3L10B 2LI5A 2AL6A 1KOTA 2JF5A 3PRPB 2HD5B 1UD7A 2KHWB 2JY6A 2QHOA 3AU5A 2C7HA 2LD9A 3DVNV 4I6PA 3SHQA 4DDGD 4JLCA 4KV2A 3VTVA 4E71A 3X23A 2RR9A 2ZVOA 3RULA 2HTHA 3WANA 4MGIE 2DHZA 3VFKA 1GC7A 4HXDA 1Q1OA 1S3SG 4B6WA 4HLEA 4X57B 1YQBA 1AARA 2KWVB 4CYEA 4DHZE 3CMMB 2LRUA 4WJNA 3A9JB 3TMPB 1WIAA 4HCNB 5DPSA 4II3B 2DZJA 5E6PA 4ANUA 3PLVA 2CHXA 1YX6B 2KTFA 4PS8A 4MJSB 3QJZA 1NDDA 1TZ1A 2JWZA 3L16A 4MEMA 5L95C 3KYDD 4KZ0A 5CHVC 4NQKE 5BO4B 2MQJA 4KVGB 3APCA 3TCAA 3A33B 4WJPA 4A3OA 2ZZPB 3AU4A 3ZUNA 5G2NA 4AJYB 4KIKA 2I1JA 2L0FA 2KANA 2K8BA 2JUOA 1A5RA 2KMCA 3H9DA 2KQSA 5D94A 5LXHA 4W9LA 4MSMB 3OLMD 2N4FA 2KJHB 5HKHA 4AJWA 3EC8A 3IFWB 2KTRB 3ZIMA 5E6OA 4LDTD 4EKUA 1UBQA 1YX5B 3U7DA 3PTFC 3ZDTA 2C9WB 1OTRB 2KOXA 3ENEA 1TGZB 2M4NA 5CHWA 1UELA 4XZ4A 5IAAC 3QAQA 2BF8B 2NPTA 4GIVA 3NS8A 2AL3A 1H4RA 3R3MA 3PS6A 1WMHA 4NAWA 2AEHA 2GBRA 2N9PC 1UGMA 3DQVA 4YL8A 3I3TB 3H7PA 2YLMA 3LJ3A 2I1KA 3ALBA 4JQWC 1VCBA 2DZIA 2MP2B 2N1VA 2NR2A 3PHXB 4IWOA 2O6VB 3HM6X 4XC2A 4KDIC 3W1SC 4PS7A 2J0JA 5J17A 4KDLB 3JSVA 4AUQC 2M17A 4J6IA 5AEKB 4DHJB 1D3ZA 2HJ8A 4M8NA 1E7VA 3ZNGC 4W9EA 3DBRI 1QZEA 4OVVA 2LVPA 2KZRA 3ZW3A 3ML8A 3BY4B 3PSEB 3NOBA 3ZRCA 2ASQA 4NNJB 1TTNA 4BBNF 2JZZA 5KHOA 3VHTC 3PVLA 2GBMA 4GMVA 1P1AA 3VTUA 1V86A 3VH3B 1XQQA 2RD0A 3UGBB 2JPHA 2N9EB 1V6EA 1WY8A 1YD8U 2Z59B 4II2B 4FJZA 1E5WA 3M62B 3T8MA 2RSUA 2ZNVB 3JVZX 1GC6A 1UBIA 3DBSA 2LRWA 3KH0A 1WF9A 4F7ZA 2W9NA 1VD2A 2G45B 4FN2A 2MBQA 5AZGA 2IYDB 2LVOA 4MDKE 2KO3A 2XK5B 3GZNI 3R7RA 3RZWC 2G4DB 3KUDB 1OGWA 1RLFA 3R7QA 1E8YA 2GMIC 2ZPYA 3EECA 1WJ6A 4G0NB 1WYWB 1E8XA 4MGZE 4EFOA 2PJHA 2C7NB 3A9JA 3UF8A 4IWQA 4EEWA 3PZDA 2MX2A 2JRHA 1Q0WB 2LGDA 4TQ0A 4ZRIA 4DDID 3A4RA 1V81A 3ZRFA 4ICVA 1RRBA 4JIOU 3KVFB 2AYOB 3RCZA 5JH5C 1WX7A 2MLBA 3IG3A 3W1YA 4M0WB 4NJ6A 1I35A 2GBJA 5D2MB 1LM8B 2IO1B 3OJ4B 3RT3B 1WGHA 1RFAA 4EZJA 1V9JA 4IUMB 3DVNU 1IP9A 1H8CA 3B1LX 1XD3B 5CTRC 2ZJDA 2LWPA 3RUIB 3MTNB 4TQ1A 1E7UA 3RYTA 2DYOA 2KLGA 3K9PB 5EDSA 3ZNZB 2LJ5A 2KWCA 1IPGA 4EZKA 3SDLC 3QHTA 4JGHB 2KJRA 3WIMA 2WX0A 5L83A 4K1RB 2IBIB 4ZRKA 4HCPB 4W9FA 1WGRA 2A4ZA 2MWSB 3KUZA 1WX8A 2K8CA 1WXMA 2KFKB 1WH3A 2KD0A 3EFUA 1OEYJ 4N9F4 3ZTDA 1ZGUB 2IO3B 4BOZB 2D2QA 4GOCA 4IM0A 5TR5A 4FA6A 2G4SA 2M0XA 5JZEB 2J0KA 2M8SA 4CO7A 4I6LB 4PYZA 2O2VB 2L00B 3A1QA 3CSTA 3GOEA 1WGGA 4LDTB 2UYZB 3VAWA 2D07B 2DAFA 2FCQA 2IZVB 2JZ3B 2GBKA 3QQ8B 3N3KB 2KVRA 5LXIB 1K8RB 2DZKA 3QK0A 4GGQA 2V1YA 4PS3A 3V62A 5E6NA 3V60A 4WAAA 2Y5BB 5JHAA 4IM3A 3ONSA 3SD5A 3A9KA 2C5LC 2D3GA 2PPHA 4NJ7A 1KM7A 1I42A 3PHWB 5DPTA 3L17A 4W9DA 3TL5A 1LQBA 3AI5A 3PGEA 4PYUA 1Z2MA 2KNBA 2KX3A 4GDKB 1KLVA 2KN5A 2EMTA 3U8ZA 4GDLB 4HJKA 3S2AA 1WM2A 4W9IA 2MA9B 3N32A 2FNJB 3PPAA 1P9DU 2DZMA 1Y8RC 2C60A 2JXXA 2XBBC 4IG7B 1V2YA 4TKNA 5IA7A 3X0WA 2KDFB 1GNUA 2JVCA 3DCGA 3HK0A 1P3QU 2LGYA 3KW5B 4M8MA 3TBLD 3W1SA 4EZLA 2JRIB 3DVGX 2DX5B 4FLHA 4BKTA 1YIWA 2PE9A 4MGKE 4MGYE 3AXCA 4XX5A 5JHBA 4W9JA 3H1UA 3IHPC 3JYUA 4F8CB 4BKGA 2FIDA 1V80A 4G11A 2IY0B 3Q3JA 4WJOA 4DK5A 5D6JB 2J0MA 3TJPA 2KC1A 2NS5A 2MCNB 4ANVA 1WJ4A 1WR6E 2BPSA 3IBEA 2L05A 1CMXB 3C0RB 3WALA 1M94A 4B9KA 2FCMA 4GN1A 2AWTA 2NVUI 5AZFA 1V5OA 3PV1A 2KWUB 3VUYA 4CHKA 2CR5A 4KSKC 2MW5A 2L3ZA 2V4LA 2IO0B 2YVCA 3RZFA 4ZDVA 5C1ZA 1SGHA 3VXWA 4DWFA 4KIKB 1HE8A 1WR1A 2REXA 5D7GA 3UQBA 4AP4C 1E8WA 2BKFA 3PLUA 2JT4B 1J8CA 2N1WA 1ISNA 1WX9A 1X1MA 2LXAA 3ZDMC 4ICUA 4RM8A 2BWES 3IVFA 3ECIA 1WJUA 3QA8A 2LZ6A 5CHFA 2CHZA 2KFJA 2K8HA 1OEYA 3CF6E 3EHVA 4BKSA 3VH4B 2L76A 1YJ1A 2D11A 4MJSA 2K6QA 4DHJD 3ZKJC 4K7WA 3LDZE 2NPTB 2FUHB 4WWNA 1NI2A 4NAWB 3QWZB 2CHWA 4ZYNA 2ZVNA 2KDBA 3H7PB 3V6CB 1U4AA 2KLCA 2KKCA 1FXTB 2KX0A 3Q3FA 3HHMA 1SIFA 1UH6A 4WWOA 3QCAA 2MBBB 2ZEQA 1R4MI 4LCDE 5C23A 3DVGY 3VDZA 2A5UA 3V6EB 3QX1A 4IW0A 2EMSA 2L0TA 1ZKHA 2KTRA 4FULA 3JSVB 4A20A 3B08A 4LJOB 1WRDB 4E3CA 1C3TA 3WA0A 5DPWA 2XEWA 3AULA 2N7DA 1IYFA 2KXJA 2Z0EB 1EUVB 3L54A 2NCNA 2VRRB 4ZRJA 1NBFC 2NBWB 4ANXA 2KK8A 2HE7A 4P7IA 2RPQA 4K7SA 2LUEA 3K9OB 3WAPA 4IWPA 4BBNC 1WZ0A 4EOYA 4W9GA 1MG8A 1WE7A 4WJQA 3ZNID 4BVUC 1GUAB 3APFA 2WX1A 4LJPB 4RM9A 1V5TA 2ZPNA 4W9CA 2MP2A 3TIXA 2L8JA 3A4SC 2O6VA 3L0WB 4NPNA 5GMVA 2FIFA 4JL9A 5CX3A 3B0AA 4KZCA 3M95A 1WFYA 2KDIA 3OAWA 3ZLZA 4BFRA 3BINA 3VTWA 3M3JA 3UIPB 1JRUA 4GB9A 3HM3A 2KJ6A 2ZCCA 1C1YB 3DBHI 2N9XA 4HK2A 4OVUA 2MBHA 3UQAA 2IY1B 3NHEB 3RD2A 4AWJA 3UINB 2DYBA 2DYMA 4GXBA 3DBLI 2WWZA 5FR6A 2OJRA 2LVQA 2KC2A 3ZVVA 2WDTB 4HDOA 2OOBB 2BYEA 1R4NI 4G50A 1E8ZA 4NQLB 3PT2B 2L7RA 2UWQA 3SU8X 3ZNHB 4F1SA 3V61A 3JW0X 4FHJA 4WQOB 1RAXA 4K81A 3OJ3A 2ZNVC 1WJNA 4HWIB 4URKA 1WI0A 3MJWA 4ASWC 2XK5A 1T0YA 3ZO5B 2MBOA 5G55A 1WGYA 2BWFA 2LXCA 4DBGA 2KQ7A 3P2BA 3VUWA 1WM3A 4B95A 2K1FA 4BKSD 4W9HA 3DDCB 2NBUA 1BT0A 2C7MB 1P0RA 4DXAB 4FJYA 2N7EA 1KJTA 2CS4A 2MBEA 2MRPA 2FAZA 4GSWA 3N30A 2RGFA 1ZW7A 2KMAA 2LASA 4MSQB 2J7QB 3APDA 4AOFA 1J0GA 1WE6A 1OQYA 2CU1A 4G3XB 4W9KA 3ZTCA 1UZXB 2K39A 3UIOB 3A1QB 3O65B 1Q5WB 4GU2A 2G3QB 3VVWB 2Z0DB 1E90A 2GOWA 4MM3A 2WYQA 3CSFA 1EO6A 1S1QB 3L13A 5DPRA 3HIZA 4TV3A 5DCNA 1PQSA 1Z5SB 3ML9A 4I6NB 1G6JA 2KFKA 3A9KB 2MSED 2B3AA 3M63B 4HPLB 2ZCBA 3D32A 3H7SA 2O6VD 2R2QA 4BOSC 3QIJA 1L7YA 1LFDA 3WAOA 2O2VA 5KHQA 2KDEB 3QARA 3WAMA 2FCNA 3KUCB 4HDQA 1J19A 2R2OA 4IC7B 1WXSA 4FBJB 2NBVB 1L2NA 5J2RA 4E74A 1F9JA 2CKHB 3NY5A 4EUTA 2BYFA 1WMHB 1EF1A 1SE9A 2PE6B 4RMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3P A;  2BYV E;  2DEN B;  3MHS D;  3KYC D;  1GG3 A;  4DHZ B;  1TBE A;  1WZ3 A;  3NZU A;  3PRE A;  4K7U A;  2V3S A;  4KSL C;  5J18 A;  4FHK A;  4MH0 E;  2PEA A;  4NY0 A;  5AZH A;  3T9L A;  2DAJ A;  1XT9 B;  3R66 C;  4ANW A;  3VUX A;  1P98 A;  2M1M A;  2EKE C;  4HPM B;  4HVB A;  4TUU A;  4GDK A;  2BKR B;  3PRM B;  3QC8 B;  2D10 A;  2GBN A;  1LXD A;  4GDL A;  3VQI A;  4FAD A;  1WXV A;  2FCS A;  3DOW A;  3DPD A;  2K25 A;  2LGX A;  1WXA A;  3PRZ A;  3L08 A;  1V49 A;  1EF5 A;  4FJV B;  4WWP A;  2IO2 B;  5LLI A;  1GJZ A;  3H6N A;  3NZS A;  4IM2 A;  4MEL A;  2BGF A;  3U30 A;  1WGD A;  2K6D B;  3L10 B;  2LI5 A;  2AL6 A;  1KOT A;  2JF5 A;  3PRP B;  2HD5 B;  1UD7 A;  2KHW B;  2JY6 A;  2QHO A;  3AU5 A;  2C7H A;  2LD9 A;  3DVN V;  4I6P A;  3SHQ A;  4DDG D;  4JLC A;  4KV2 A;  3VTV A;  4E71 A;  3X23 A;  2RR9 A;  2ZVO A;  3RUL A;  2HTH A;  3WAN A;  4MGI E;  2DHZ A;  3VFK A;  1GC7 A;  4HXD A;  1Q1O A;  1S3S G;  4B6W A;  4HLE A;  4X57 B;  1YQB A;  1AAR A;  2KWV B;  4CYE A;  4DHZ E;  3CMM B;  2LRU A;  4WJN A;  3A9J B;  3TMP B;  1WIA A;  4HCN B;  5DPS A;  4II3 B;  2DZJ A;  5E6P A;  4ANU A;  3PLV A;  2CHX A;  1YX6 B;  2KTF A;  4PS8 A;  4MJS B;  3QJZ A;  1NDD A;  1TZ1 A;  2JWZ A;  3L16 A;  4MEM A;  5L95 C;  3KYD D;  4KZ0 A;  5CHV C;  4NQK E;  5BO4 B;  2MQJ A;  4KVG B;  3APC A;  3TCA A;  3A33 B;  4WJP A;  4A3O A;  2ZZP B;  3AU4 A;  3ZUN A;  5G2N A;  4AJY B;  4KIK A;  2I1J A;  2L0F A;  2KAN A;  2K8B A;  2JUO A;  1A5R A;  2KMC A;  3H9D A;  2KQS A;  5D94 A;  5LXH A;  4W9L A;  4MSM B;  3OLM D;  2N4F A;  2KJH B;  5HKH A;  4AJW A;  3EC8 A;  3IFW B;  2KTR B;  3ZIM A;  5E6O A;  4LDT D;  4EKU A;  1UBQ A;  1YX5 B;  3U7D A;  3PTF C;  3ZDT A;  2C9W B;  1OTR B;  2KOX A;  3ENE A;  1TGZ B;  2M4N A;  5CHW A;  1UEL A;  4XZ4 A;  5IAA C;  3QAQ A;  2BF8 B;  2NPT A;  4GIV A;  3NS8 A;  2AL3 A;  1H4R A;  3R3M A;  3PS6 A;  1WMH A;  4NAW A;  2AEH A;  2GBR A;  2N9P C;  1UGM A;  3DQV A;  4YL8 A;  3I3T B;  3H7P A;  2YLM A;  3LJ3 A;  2I1K A;  3ALB A;  4JQW C;  1VCB A;  2DZI A;  2MP2 B;  2N1V A;  2NR2 A;  3PHX B;  4IWO A;  2O6V B;  3HM6 X;  4XC2 A;  4KDI C;  3W1S C;  4PS7 A;  2J0J A;  5J17 A;  4KDL B;  3JSV A;  4AUQ C;  2M17 A;  4J6I A;  5AEK B;  4DHJ B;  1D3Z A;  2HJ8 A;  4M8N A;  1E7V A;  3ZNG C;  4W9E A;  3DBR I;  1QZE A;  4OVV A;  2LVP A;  2KZR A;  3ZW3 A;  3ML8 A;  3BY4 B;  3PSE B;  3NOB A;  3ZRC A;  2ASQ A;  4NNJ B;  1TTN A;  4BBN F;  2JZZ A;  5KHO A;  3VHT C;  3PVL A;  2GBM A;  4GMV A;  1P1A A;  3VTU A;  1V86 A;  3VH3 B;  1XQQ A;  2RD0 A;  3UGB B;  2JPH A;  2N9E B;  1V6E A;  1WY8 A;  1YD8 U;  2Z59 B;  4II2 B;  4FJZ A;  1E5W A;  3M62 B;  3T8M A;  2RSU A;  2ZNV B;  3JVZ X;  1GC6 A;  1UBI A;  3DBS A;  2LRW A;  3KH0 A;  1WF9 A;  4F7Z A;  2W9N A;  1VD2 A;  2G45 B;  4FN2 A;  2MBQ A;  5AZG A;  2IYD B;  2LVO A;  4MDK E;  2KO3 A;  2XK5 B;  3GZN I;  3R7R A;  3RZW C;  2G4D B;  3KUD B;  1OGW A;  1RLF A;  3R7Q A;  1E8Y A;  2GMI C;  2ZPY A;  3EEC A;  1WJ6 A;  4G0N B;  1WYW B;  1E8X A;  4MGZ E;  4EFO A;  2PJH A;  2C7N B;  3A9J A;  3UF8 A;  4IWQ A;  4EEW A;  3PZD A;  2MX2 A;  2JRH A;  1Q0W B;  2LGD A;  4TQ0 A;  4ZRI A;  4DDI D;  3A4R A;  1V81 A;  3ZRF A;  4ICV A;  1RRB A;  4JIO U;  3KVF B;  2AYO B;  3RCZ A;  5JH5 C;  1WX7 A;  2MLB A;  3IG3 A;  3W1Y A;  4M0W B;  4NJ6 A;  1I35 A;  2GBJ A;  5D2M B;  1LM8 B;  2IO1 B;  3OJ4 B;  3RT3 B;  1WGH A;  1RFA A;  4EZJ A;  1V9J A;  4IUM B;  3DVN U;  1IP9 A;  1H8C A;  3B1L X;  1XD3 B;  5CTR C;  2ZJD A;  2LWP A;  3RUI B;  3MTN B;  4TQ1 A;  1E7U A;  3RYT A;  2DYO A;  2KLG A;  3K9P B;  5EDS A;  3ZNZ B;  2LJ5 A;  2KWC A;  1IPG A;  4EZK A;  3SDL C;  3QHT A;  4JGH B;  2KJR A;  3WIM A;  2WX0 A;  5L83 A;  4K1R B;  2IBI B;  4ZRK A;  4HCP B;  4W9F A;  1WGR A;  2A4Z A;  2MWS B;  3KUZ A;  1WX8 A;  2K8C A;  1WXM A;  2KFK B;  1WH3 A;  2KD0 A;  3EFU A;  1OEY J;  4N9F 4;  3ZTD A;  1ZGU B;  2IO3 B;  4BOZ B;  2D2Q A;  4GOC A;  4IM0 A;  5TR5 A;  4FA6 A;  2G4S A;  2M0X A;  5JZE B;  2J0K A;  2M8S A;  4CO7 A;  4I6L B;  4PYZ A;  2O2V B;  2L00 B;  3A1Q A;  3CST A;  3GOE A;  1WGG A;  4LDT B;  2UYZ B;  3VAW A;  2D07 B;  2DAF A;  2FCQ A;  2IZV B;  2JZ3 B;  2GBK A;  3QQ8 B;  3N3K B;  2KVR A;  5LXI B;  1K8R B;  2DZK A;  3QK0 A;  4GGQ A;  2V1Y A;  4PS3 A;  3V62 A;  5E6N A;  3V60 A;  4WAA A;  2Y5B B;  5JHA A;  4IM3 A;  3ONS A;  3SD5 A;  3A9K A;  2C5L C;  2D3G A;  2PPH A;  4NJ7 A;  1KM7 A;  1I42 A;  3PHW B;  5DPT A;  3L17 A;  4W9D A;  3TL5 A;  1LQB A;  3AI5 A;  3PGE A;  4PYU A;  1Z2M A;  2KNB A;  2KX3 A;  4GDK B;  1KLV A;  2KN5 A;  2EMT A;  3U8Z A;  4GDL B;  4HJK A;  3S2A A;  1WM2 A;  4W9I A;  2MA9 B;  3N32 A;  2FNJ B;  3PPA A;  1P9D U;  2DZM A;  1Y8R C;  2C60 A;  2JXX A;  2XBB C;  4IG7 B;  1V2Y A;  4TKN A;  5IA7 A;  3X0W A;  2KDF B;  1GNU A;  2JVC A;  3DCG A;  3HK0 A;  1P3Q U;  2LGY A;  3KW5 B;  4M8M A;  3TBL D;  3W1S A;  4EZL A;  2JRI B;  3DVG X;  2DX5 B;  4FLH A;  4BKT A;  1YIW A;  2PE9 A;  4MGK E;  4MGY E;  3AXC A;  4XX5 A;  5JHB A;  4W9J A;  3H1U A;  3IHP C;  3JYU A;  4F8C B;  4BKG A;  2FID A;  1V80 A;  4G11 A;  2IY0 B;  3Q3J A;  4WJO A;  4DK5 A;  5D6J B;  2J0M A;  3TJP A;  2KC1 A;  2NS5 A;  2MCN B;  4ANV A;  1WJ4 A;  1WR6 E;  2BPS A;  3IBE A;  2L05 A;  1CMX B;  3C0R B;  3WAL A;  1M94 A;  4B9K A;  2FCM A;  4GN1 A;  2AWT A;  2NVU I;  5AZF A;  1V5O A;  3PV1 A;  2KWU B;  3VUY A;  4CHK A;  2CR5 A;  4KSK C;  2MW5 A;  2L3Z A;  2V4L A;  2IO0 B;  2YVC A;  3RZF A;  4ZDV A;  5C1Z A;  1SGH A;  3VXW A;  4DWF A;  4KIK B;  1HE8 A;  1WR1 A;  2REX A;  5D7G A;  3UQB A;  4AP4 C;  1E8W A;  2BKF A;  3PLU A;  2JT4 B;  1J8C A;  2N1W A;  1ISN A;  1WX9 A;  1X1M A;  2LXA A;  3ZDM C;  4ICU A;  4RM8 A;  2BWE S;  3IVF A;  3ECI A;  1WJU A;  3QA8 A;  2LZ6 A;  5CHF A;  2CHZ A;  2KFJ A;  2K8H A;  1OEY A;  3CF6 E;  3EHV A;  4BKS A;  3VH4 B;  2L76 A;  1YJ1 A;  2D11 A;  4MJS A;  2K6Q A;  4DHJ D;  3ZKJ C;  4K7W A;  3LDZ E;  2NPT B;  2FUH B;  4WWN A;  1NI2 A;  4NAW B;  3QWZ B;  2CHW A;  4ZYN A;  2ZVN A;  2KDB A;  3H7P B;  3V6C B;  1U4A A;  2KLC A;  2KKC A;  1FXT B;  2KX0 A;  3Q3F A;  3HHM A;  1SIF A;  1UH6 A;  4WWO A;  3QCA A;  2MBB B;  2ZEQ A;  1R4M I;  4LCD E;  5C23 A;  3DVG Y;  3VDZ A;  2A5U A;  3V6E B;  3QX1 A;  4IW0 A;  2EMS A;  2L0T A;  1ZKH A;  2KTR A;  4FUL A;  3JSV B;  4A20 A;  3B08 A;  4LJO B;  1WRD B;  4E3C A;  1C3T A;  3WA0 A;  5DPW A;  2XEW A;  3AUL A;  2N7D A;  1IYF A;  2KXJ A;  2Z0E B;  1EUV B;  3L54 A;  2NCN A;  2VRR B;  4ZRJ A;  1NBF C;  2NBW B;  4ANX A;  2KK8 A;  2HE7 A;  4P7I A;  2RPQ A;  4K7S A;  2LUE A;  3K9O B;  3WAP A;  4IWP A;  4BBN C;  1WZ0 A;  4EOY A;  4W9G A;  1MG8 A;  1WE7 A;  4WJQ A;  3ZNI D;  4BVU C;  1GUA B;  3APF A;  2WX1 A;  4LJP B;  4RM9 A;  1V5T A;  2ZPN A;  4W9C A;  2MP2 A;  3TIX A;  2L8J A;  3A4S C;  2O6V A;  3L0W B;  4NPN A;  5GMV A;  2FIF A;  4JL9 A;  5CX3 A;  3B0A A;  4KZC A;  3M95 A;  1WFY A;  2KDI A;  3OAW A;  3ZLZ A;  4BFR A;  3BIN A;  3VTW A;  3M3J A;  3UIP B;  1JRU A;  4GB9 A;  3HM3 A;  2KJ6 A;  2ZCC A;  1C1Y B;  3DBH I;  2N9X A;  4HK2 A;  4OVU A;  2MBH A;  3UQA A;  2IY1 B;  3NHE B;  3RD2 A;  4AWJ A;  3UIN B;  2DYB A;  2DYM A;  4GXB A;  3DBL I;  2WWZ A;  5FR6 A;  2OJR A;  2LVQ A;  2KC2 A;  3ZVV A;  2WDT B;  4HDO A;  2OOB B;  2BYE A;  1R4N I;  4G50 A;  1E8Z A;  4NQL B;  3PT2 B;  2L7R A;  2UWQ A;  3SU8 X;  3ZNH B;  4F1S A;  3V61 A;  3JW0 X;  4FHJ A;  4WQO B;  1RAX A;  4K81 A;  3OJ3 A;  2ZNV C;  1WJN A;  4HWI B;  4URK A;  1WI0 A;  3MJW A;  4ASW C;  2XK5 A;  1T0Y A;  3ZO5 B;  2MBO A;  5G55 A;  1WGY A;  2BWF A;  2LXC A;  4DBG A;  2KQ7 A;  3P2B A;  3VUW A;  1WM3 A;  4B95 A;  2K1F A;  4BKS D;  4W9H A;  3DDC B;  2NBU A;  1BT0 A;  2C7M B;  1P0R A;  4DXA B;  4FJY A;  2N7E A;  1KJT A;  2CS4 A;  2MBE A;  2MRP A;  2FAZ A;  4GSW A;  3N30 A;  2RGF A;  1ZW7 A;  2KMA A;  2LAS A;  4MSQ B;  2J7Q B;  3APD A;  4AOF A;  1J0G A;  1WE6 A;  1OQY A;  2CU1 A;  4G3X B;  4W9K A;  3ZTC A;  1UZX B;  2K39 A;  3UIO B;  3A1Q B;  3O65 B;  1Q5W B;  4GU2 A;  2G3Q B;  3VVW B;  2Z0D B;  1E90 A;  2GOW A;  4MM3 A;  2WYQ A;  3CSF A;  1EO6 A;  1S1Q B;  3L13 A;  5DPR A;  3HIZ A;  4TV3 A;  5DCN A;  1PQS A;  1Z5S B;  3ML9 A;  4I6N B;  1G6J A;  2KFK A;  3A9K B;  2MSE D;  2B3A A;  3M63 B;  4HPL B;  2ZCB A;  3D32 A;  3H7S A;  2O6V D;  2R2Q A;  4BOS C;  3QIJ A;  1L7Y A;  1LFD A;  3WAO A;  2O2V A;  5KHQ A;  2KDE B;  3QAR A;  3WAM A;  2FCN A;  3KUC B;  4HDQ A;  1J19 A;  2R2O A;  4IC7 B;  1WXS A;  4FBJ B;  2NBV B;  1L2N A;  5J2R A;  4E74 A;  1F9J A;  2CKH B;  3NY5 A;  4EUT A;  2BYF A;  1WMH B;  1EF1 A;  1SE9 A;  2PE6 B;  4RMA A; 
#chains in the Genus database with same CATH topology
 4A3P A;  2K9X A;  3MHS D;  4KSL C;  3NVV A;  3T9L A;  1XLQ A;  2INP E;  4HVB A;  4GDK A;  1LXD A;  1WXV A;  2FCS A;  1IBX A;  3DOW A;  4N59 A;  1WXA A;  1IGD A;  3IAM 1;  4DQO C;  1GJZ A;  2WQY B;  1WGD A;  2AL6 A;  1F2R C;  2QHO A;  2JY6 A;  2WXJ A;  2LD9 A;  4I6P A;  4DDG D;  4KV2 A;  1VLB A;  4ZHP A;  3U2S C;  3J9C A;  2ZVO A;  1V97 A;  2PKO A;  2N7J A;  3VFK A;  1Q1O A;  1S3S G;  1SE4 A;  3BVG A;  3DBL B;  3HVZ A;  2KWV B;  1KH0 A;  1Q10 A;  3KWV A;  2DNF A;  1R4N B;  3FAH A;  4HCN B;  2MEK A;  3P4R B;  2DZJ A;  1UUP A;  3AM9 A;  1YX6 B;  3AV8 A;  2JWZ A;  2V9H A;  3AMZ A;  3W5V B;  2MQJ A;  3ZXR A;  2ZZP B;  4KIK A;  2L0F A;  3FKY A;  5D94 A;  1EU4 A;  2K22 A;  4MSM B;  3I63 C;  3OLM D;  2KJH B;  1C4P A;  3EC8 A;  3ZJU A;  2KTR B;  2WDQ B;  3I5J C;  3BYT B;  1OTR B;  2WXN A;  2D3C A;  1N60 A;  5IKC M;  3QAQ A;  3NS8 A;  3Q14 C;  2AL3 A;  3MC8 A;  3AEF B;  2QSD A;  1UGM A;  3DQV A;  3NJT A;  3H7P A;  2YLM A;  2Y3A A;  1SEB D;  3VRA B;  4PT5 A;  1L0X B;  3NVZ A;  3RNA C;  4KDL B;  1RFK A;  3DHI C;  2M17 A;  4YSY B;  1D3Z A;  4M8N A;  1CK1 A;  3ML8 A;  2ZW0 A;  3PSE B;  3ZW3 A;  2ASQ A;  1VRA B;  2LGI A;  2GBM A;  4GMV A;  1V86 A;  3Q8A A;  1V6E A;  3FIL B;  1YD8 U;  2RSU A;  1FNW A;  2ZNV B;  2H89 B;  2QMT A;  3R2T A;  3SR6 A;  3BYY B;  4BZA A;  1DOX A;  1F52 A;  5AZG A;  2LVO A;  4ITK A;  4MDK E;  2KO3 A;  3Q3N C;  1XXG A;  2W54 A;  2G4D B;  3E9S A;  1RLF A;  2J53 A;  2MHJ A;  4G0N B;  3L4P A;  1HZ5 A;  2D3A A;  2PJH A;  2C7N B;  3UF8 A;  4EEW A;  3PZD A;  2AQ1 B;  1ZP0 B;  1Q0W B;  1YN3 A;  3A4R A;  1V81 A;  4ICV A;  1RRB A;  3RCZ A;  3URY A;  2MLB A;  3IG3 A;  2NMQ A;  5D2M B;  1JW9 D;  3RT3 B;  1E0Z A;  1RFA A;  4HKQ A;  2OHF A;  2VH2 A;  3DVN U;  2L83 A;  2LWP A;  1GPX A;  3RYT A;  2KQ4 X;  1L6U A;  4MAC A;  2KJR A;  2WX0 A;  4RF0 A;  5L83 A;  4S17 A;  4ZRK A;  2A4Z A;  3KUZ A;  2K8C A;  3EFU A;  2SEB D;  5C3J B;  1ZGU B;  4BOZ B;  4LLG M;  5TR5 A;  2M0X A;  5EE3 A;  3AED B;  3EUB 2;  1YOV B;  4I6L B;  1LO5 D;  2L00 B;  2O2V B;  3GOE A;  2Q5W D;  2FCQ A;  3PZ8 A;  3RNC C;  2GBK A;  1GOZ A;  3Q8C A;  3N3K B;  3V62 A;  5E6N A;  2Y5B B;  3A9K A;  2C5L C;  3PHW B;  4WQM A;  3TL5 A;  1QF6 A;  4M02 A;  3AI5 A;  2KX3 A;  1KLV A;  1JWU D;  2AX5 A;  3GS2 A;  2MA9 B;  3N32 A;  2FNJ B;  3PPA A;  2JYE A;  4KKJ A;  3AEE B;  4A8X C;  4IG7 B;  1V2Y A;  4TKN A;  3DCG A;  3HK0 A;  2LGY A;  3TBL D;  3GE3 C;  2JRI B;  3GP7 A;  3DBR B;  1YIW A;  3AXC A;  3IHP C;  1TKE A;  4G11 A;  4A90 A;  4RGT A;  2NS5 A;  5BYS A;  1CMX B;  1QQR A;  2J52 A;  3C0R B;  3WAL A;  3Q8F A;  4JWU C;  5AZF A;  2KWU B;  4CHK A;  2CR5 A;  3GZN B;  2IO0 B;  2YVC A;  4OZC A;  3VXW A;  4DWF A;  1UGJ A;  5D7G A;  4AP4 C;  1E8W A;  1T0Q C;  3Q6B A;  1ISN A;  1WX9 A;  3MC9 A;  2BWE S;  3IVF A;  3ECI A;  2LZ6 A;  2L52 A;  2K8H A;  3EHV A;  3TSS A;  4MJS A;  5BMG A;  2NPT B;  1NI2 A;  3P4S B;  1D6E C;  4ZYN A;  2QIE B;  1PGB A;  1P7E A;  3ZYY X;  1UH6 A;  4WWO A;  3AN1 A;  2ZEQ A;  5C23 A;  1R4M I;  3AE5 B;  3VDZ A;  1DOY A;  4C7Y A;  4IW0 A;  2L0T A;  1EWC A;  5IN7 A;  4FUL A;  3NUH B;  3WA0 A;  1KF6 B;  2N7D A;  1IYF A;  3NZ3 A;  1EUV B;  1YJI A;  2NCN A;  2NBW B;  2WXP A;  2KVZ A;  4IWP A;  1RM6 C;  1WZ0 A;  4EOY A;  4IDI A;  4WJQ A;  3ZNI D;  4LJP B;  5H92 C;  2CJO A;  1T6B X;  5GMV A;  3L0W B;  1ENF A;  4HKZ E;  3B0A A;  3ZLZ A;  4BFR A;  3BIN A;  3MHZ A;  3VTW A;  4ARC A;  4GB9 A;  1C4A A;  1Y56 A;  2LUM A;  1C1Y B;  4EE2 A;  4OVU A;  2MBH A;  1PGX A;  3HRD D;  2DYB A;  3O13 A;  1PFD A;  2OJR A;  1T0R C;  4HDO A;  3IAS 1;  1E8Z A;  3U4E G;  1MHH E;  4K81 A;  3OJ3 A;  3RFZ B;  1WI0 A;  3MJW A;  4AQ7 A;  2XK5 A;  3ZO5 B;  1AWD A;  2LXC A;  1XLN A;  4DBG A;  2ACZ B;  3P2B A;  1AW7 A;  1V1P B;  1ROE A;  2C7M B;  1XF5 L;  1P0R A;  1KJT A;  1BXT A;  2JX5 A;  3EA6 A;  4HJG E;  5I4D A;  4MSQ B;  4M0W A;  5HI1 A;  1OQQ A;  5GXG B;  4H2A A;  3ZTC A;  2K39 A;  1JML A;  3A1Q B;  2RDG A;  2G3Q B;  1CZP A;  1E90 A;  3Q3M C;  4MM3 A;  2WYQ A;  1KLG D;  2VH1 A;  1VJK A;  5LNK 1;  2IJ0 A;  4JWS C;  1PQS A;  4I6N B;  2QIL A;  3M63 B;  4HPL B;  3D32 A;  1HZ6 A;  4BOS C;  2H88 B;  3RNB C;  1J19 A;  2NBV B;  2RDH A;  3Q3O C;  3NY5 A;  1WMH B;  1BUI C;  1SE9 A;  4RMA A;  2DEN B;  3NZU A;  2V3S A;  5FR3 A;  4MH0 E;  2PEA A;  5AZH A;  4GLS C;  1XT9 B;  3VUX A;  3SEB A;  1P98 A;  3LXF A;  4HPM B;  4TUU A;  3QC8 B;  1L0V B;  2D10 A;  4GDL A;  3DPD A;  2V0G A;  2LGX A;  4FJV B;  4WWP A;  2IO2 B;  5LLI A;  2I2Y A;  4IM2 A;  4MEL A;  2BGF A;  3L10 B;  3PRP B;  2HD5 B;  1F1H A;  2TSS A;  1RYJ A;  1JRP A;  3SFE B;  3VTV A;  1AN8 A;  2HJ1 A;  4MGI E;  4P1C C;  1UWM A;  2BB6 A;  2WS3 B;  4HLE A;  3AE9 B;  4USA A;  4WJN A;  4HRO A;  3TMP B;  4ANU A;  3LYY A;  3NG0 A;  4N6E B;  1WWT A;  2CHX A;  1TZ1 A;  3HVD A;  5L95 C;  4NQK E;  5BO4 B;  4KVG B;  3TCA A;  3A33 B;  3N1Y C;  4A3O A;  3AB5 A;  4AJY B;  2KAN A;  2JUO A;  3H9D A;  2KQS A;  5LXH A;  3ZIM A;  3W2D A;  5E6O A;  4EKU A;  1I4Q A;  1FM0 D;  2KYW A;  3ZDT A;  2C9W B;  2KN4 A;  3ENE A;  5G5G A;  1TGZ B;  5IAA C;  2BF8 B;  2JZP A;  1VZ7 A;  1ET6 A;  3R3M A;  3PS6 A;  2VZK D;  1WMH A;  2GBR A;  2N9P C;  3LJ3 A;  2YEP B;  5BMH A;  2I1K A;  1C78 A;  4RH6 A;  1VCB A;  2DZI A;  2MP2 B;  2N1V A;  2I38 A;  4IWO A;  3W9C B;  1NEK B;  3HM6 X;  3TEX A;  3W1S C;  2J0J A;  2WXG A;  4AUQ C;  3ZNG C;  4W9E A;  1QZE A;  3BY4 B;  2EEL A;  1TTN A;  1OQR A;  1D5Z C;  5KHO A;  3PVL A;  3P4P B;  4NZL B;  2RD0 A;  1M4V A;  3UGB B;  1IUE A;  1FFV A;  3T8M A;  3JVZ X;  1CJE A;  1WF9 A;  2W9N A;  2G45 B;  2INN E;  3IT4 B;  1ACC A;  1XCQ L;  2GMI C;  3EEC A;  1WJ6 A;  1WYW B;  2MX2 A;  1E7P B;  4ZRP A;  2LGD A;  1NYQ A;  4TQ0 A;  1YN5 A;  4ZRI A;  1K51 A;  3KVF B;  2D3B A;  3W1Y A;  3GB1 A;  1LM8 B;  3OJ4 B;  1WGH A;  4EZJ A;  1C79 A;  1IP9 A;  3B1L X;  4XGA B;  5CTR C;  2KLG A;  3SDL C;  3WIM A;  4W9F A;  2LGS A;  1WX8 A;  4OZA A;  2KFK B;  1WH3 A;  2KD0 A;  1FCL A;  2D2Q A;  4YXD B;  4IM0 A;  2ICI A;  2LMC A;  4CO7 A;  4FXC A;  4PYZ A;  3VAW A;  2D07 B;  1TS2 A;  3QQ8 B;  2KVR A;  1K8R B;  3QK0 A;  5EE9 A;  4WAA A;  3ONS A;  4OHJ A;  1KM7 A;  3PGE A;  4PYU A;  1Z2M A;  2KNB A;  1B9R A;  1QKZ A;  1C9F A;  2KN5 A;  4HJK A;  3S2A A;  2W82 A;  1P9D U;  2DZM A;  1I4P A;  1SIJ A;  5IOI A;  1I4H A;  2JXX A;  3DVG X;  4FLH A;  2LEK A;  4BKT A;  3ZJV A;  4XX5 A;  3H1U A;  3JYU A;  4ZHO A;  2FID A;  1V80 A;  2IY0 B;  5D6J B;  4ANV A;  1WR6 E;  2BPS A;  2KWD A;  3IBE A;  4NAM A;  5BYR A;  4B9K A;  2FCM A;  2AWT A;  4KSK C;  2V4L A;  5IP4 D;  4ZDV A;  1SGH A;  1WR1 A;  2REX A;  1FNV A;  1J8C A;  2BKF A;  2AQ2 B;  3MJ5 A;  2DLB A;  2LXA A;  3VRB B;  1LGR A;  2JSV X;  4RM8 A;  3QA8 A;  2CHZ A;  1T5X D;  3CF6 E;  1YJ1 A;  4JX1 C;  3AEG B;  4DHJ D;  1QT9 A;  1FO4 A;  4B0M A;  2BS4 B;  3LDZ E;  2JXT A;  2FUH B;  3ABV B;  4WWN A;  3KLS X;  3CWI A;  4MH8 A;  1I4R A;  4YWG G;  4NAW B;  1XCT L;  1HXY D;  1U4A A;  2KX0 A;  3HHM A;  1SIF A;  2MBB B;  4LCD E;  2EMS A;  2KTR A;  4P16 A;  3JSV B;  3B08 A;  1WRD B;  4E3C A;  1MPE A;  2XEW A;  1QOG A;  3L54 A;  1VDV A;  3V05 A;  4ZRJ A;  2WDR B;  1NBF C;  2HE7 A;  2R61 A;  2RPQ A;  2LUE A;  3K9O B;  5EE1 A;  1K50 A;  1MG8 A;  1GUA B;  1XLO A;  3TIX A;  2L8J A;  4NPN A;  1JWS D;  1DYQ A;  4KZC A;  2WLB A;  3OAW A;  2KJ6 A;  2KAJ A;  3VR8 B;  1JWB D;  4XDC A;  4J3O D;  3UQA A;  3RD2 A;  4YTP B;  3DBL I;  2WWZ A;  1DOI A;  3P63 A;  1N63 A;  5AUI A;  3FIL A;  2JQR B;  1R4N I;  2PW9 A;  3PZ7 A;  3SU8 X;  3V61 A;  4WQO B;  2NTS A;  2X38 A;  1RAX A;  2ZNV C;  4KKI A;  5G55 A;  1WGY A;  1WM3 A;  1ZXI A;  1WSP A;  4HPP A;  4BKS D;  4W9H A;  3DDC B;  2PIA A;  2N9L A;  4DXA B;  4RGO S;  3RPF C;  2MRP A;  3N30 A;  1ZW7 A;  4WUR A;  2WXM A;  2WHI A;  1FNU A;  4NJC A;  3APD A;  3U52 E;  2L32 A;  2J42 A;  1WE6 A;  2CU1 A;  1UZX B;  4IOI E;  2Z0D B;  1T3Q A;  1T0S C;  3C19 A;  1EO6 A;  1S1Q B;  3L13 A;  1K52 A;  2BB5 A;  1D5M C;  1R7S A;  2IGG A;  3ML9 A;  5DCN A;  1G6J A;  3Q69 A;  3RNG C;  2B3A A;  2N9K A;  3GE8 C;  3TEZ A;  2O6V D;  3QIJ A;  1IGC A;  1L7Y A;  3MP9 A;  2WU2 B;  1LFD A;  3BII D;  2WXQ A;  2O2V A;  3QAR A;  5BYQ A;  3WAM A;  3KUC B;  3V3X A;  1SB3 C;  4A6Q A;  5J2R A;  4M01 A;  1SSN A;  4EUT A;  4XE0 A;  4DHZ B;  3BZD B;  1WZ3 A;  3PRE A;  4FHK A;  4LTU A;  1J7B A;  4NY0 A;  4XYC A;  2DAJ A;  2WGS A;  3R66 C;  2FUG 1;  3IXS A;  2LHD A;  2M1M A;  2BKR B;  3AE8 B;  3OG5 A;  4FAD A;  2K25 A;  3PRZ A;  3L08 A;  1V49 A;  1FXA A;  5T8I A;  3U30 A;  1CQV A;  3ZXV A;  4WAF A;  1MFW A;  1KOT A;  1UD7 A;  3SHQ A;  2C7H A;  2Y5P A;  2PVG C;  4XDD A;  3X23 A;  2RR9 A;  1YN4 A;  1E10 A;  2M56 B;  4B6W A;  1ZXH A;  4C4V B;  3RN9 C;  1AAR A;  4CYE A;  4DHZ E;  3N20 C;  2LRU A;  1WIA A;  5DPS A;  5E6P A;  2CU3 A;  3P42 A;  1TYG B;  3PLV A;  3DWG C;  1PYW D;  3AEB B;  2MH7 A;  3QJZ A;  1NDD A;  3KYD D;  4KZ0 A;  4C56 C;  3AU4 A;  3ZUN A;  1UWX A;  5G2N A;  1KLU D;  4W9L A;  5HKH A;  4AJW A;  3IFW B;  2EKI A;  4LDT D;  3U7D A;  2D5G A;  2M4N A;  4XZ4 A;  2NPT A;  4GIV A;  2QJL A;  2AEH A;  2WXK A;  2O6V B;  3TUO A;  3NVW A;  1YQ4 B;  5J17 A;  2CJN A;  4QAY A;  1E7V A;  3DBR I;  2KZR A;  3WCQ A;  3NOB A;  3ZRC A;  1N5W A;  3ZQ4 A;  2RPV A;  3E56 A;  2JZZ A;  1AYF A;  3VHT C;  1P1A A;  3T3N A;  3VH3 B;  2YEP F;  2N9E B;  2Z59 B;  4II2 B;  4FJZ A;  1E5W A;  3M62 B;  1SJE D;  1UBI A;  3DBS A;  2LRW A;  3KH0 A;  4F7Z A;  1VD2 A;  3PO0 A;  2MBQ A;  4YT0 B;  2QEJ C;  4L2Y A;  3GZN I;  3KUD B;  2ZPY A;  1JRO A;  1GB1 A;  2W3R A;  4DDI D;  1MJD A;  3TEW A;  4JIO U;  2AYO B;  2E3T A;  4LK0 M;  1V1O A;  1WRI A;  2IO1 B;  3FC4 A;  4IUM B;  1H8C A;  1V1P A;  3MTN B;  4RFB A;  1E7U A;  4UDU C;  1TKY A;  3K9P B;  4B0E A;  1FPY A;  3ZNZ B;  5EDS A;  2BT6 A;  2LJ5 A;  1IPG A;  4EZK A;  2IDY A;  4JGH B;  3Q2A C;  1WGK A;  4K1R B;  1J7C A;  4K3C A;  5HHD G;  1WXM A;  4A9A A;  4ZYS A;  1MI0 A;  3ZTD A;  1TY2 A;  1N61 A;  2J0K A;  2M8S A;  3CST A;  3A1Q A;  4LDT B;  1WGG A;  2UYZ B;  2IZV B;  1TS3 A;  1QOB A;  2DZK A;  4LNF A;  2V1Y A;  3DHH C;  3V60 A;  4IM3 A;  3SFD B;  2LJI A;  4NJ7 A;  1I42 A;  5DPT A;  1SBB B;  1LQB A;  4GDK B;  2EMT A;  3U8Z A;  2RDB C;  1WM2 A;  1ZOY B;  2INC C;  1IBX B;  1YNT E;  2PVO D;  2W55 A;  2DBY A;  1C4C A;  2C60 A;  2GB1 A;  4M00 A;  2XBB C;  2KDF B;  1GNU A;  2JVC A;  4M8M A;  2KMM A;  5TSS A;  3W1S A;  4LNN A;  2DX5 B;  3U7Z A;  2IGH A;  1F77 A;  2PE9 A;  1QIL A;  5JHB A;  1JWA D;  2MJ3 A;  4F8C B;  2ZW1 A;  1PDX A;  4BKG A;  3Q3J A;  4RF1 A;  4WJO A;  2GI9 A;  2KC1 A;  2MCN B;  3I9V 1;  1L0Y B;  2X8X X;  4LNI A;  1J7A A;  2GLS A;  1M94 A;  1ZUD 2;  4GN1 A;  2NVU I;  3BK2 A;  2MW5 A;  4LNO A;  3RZF A;  4YTN B;  3RNF C;  1ET9 A;  1QLB B;  4KIK B;  1HE8 A;  3UQB A;  3PLU A;  1TJE A;  4ICU A;  4P1B C;  1SE2 A;  1MVK A;  5HFY A;  2MJD A;  4DXF A;  2L76 A;  2IGD A;  3ZKJ C;  2J4X A;  2WP9 B;  4K7W A;  3VR9 B;  2Y5C A;  3QWZ B;  1KFY B;  3N1X C;  3H7P B;  2KDB A;  3V6C B;  2OJW A;  3DVG Y;  3V6E B;  3W5U B;  3QX1 A;  1ZKH A;  5EE0 A;  4A55 A;  2E6X A;  4A20 A;  1C77 A;  1C3T A;  3AUL A;  1V8C A;  4C00 A;  1E6E B;  5AUK A;  2KK8 A;  4K7S A;  3WAP A;  2LHE A;  1WE7 A;  2KAC A;  4RM9 A;  4W9C A;  2MP2 A;  3A4S C;  1SE3 A;  4JL9 A;  3BK1 A;  5CX3 A;  3M95 A;  1WFY A;  1D4B A;  2HTM E;  5D3D A;  3M3J A;  3BVM A;  3UIP B;  2JU6 X;  4XWT A;  3HM3 A;  3TEY A;  2FE8 A;  2VZK B;  2IY1 B;  2BS3 B;  3UIN B;  4HEA 1;  4GXB A;  3EFC A;  1WYG A;  5FR6 A;  4KX6 B;  2LVQ A;  3CIR B;  1RWS A;  2WDT B;  3I57 A;  1I7H A;  2OOB B;  2MJE A;  4G50 A;  2JWU A;  3PT2 B;  3ZNH B;  4F1S A;  3JW0 X;  1WJN A;  5G5H A;  3NS1 A;  1T0Y A;  2KQ7 A;  4B95 A;  2K1F A;  2GRI A;  1BT0 A;  2CS4 A;  2MBE A;  4D2K A;  2FAZ A;  2RGF A;  2KMA A;  3ETR A;  1HA5 A;  1UF0 A;  5HG2 A;  4PK1 A;  4AOF A;  1J0G A;  1F2R I;  3UIO B;  4RCO A;  4L23 A;  4GU2 A;  3VVW B;  2GOW A;  4YTM B;  5DPR A;  1XLP A;  5JXV A;  1Z5S B;  2KFK A;  3A9K B;  2MSE D;  3C8Y A;  2ZCB A;  2IPK D;  3WAO A;  2PTL A;  5KHQ A;  4IKG A;  1FEH A;  1MG4 A;  1ZDV A;  2R2O A;  4IC7 B;  1WXS A;  4FBJ B;  1L2N A;  1F9J A;  2CKH B;  4RGN A;  2L1A A;  3BVZ A;  1EF1 A;  2PE6 B;  1R4M B;  2BYV E;  1FIQ A;  1FXI A;  3KYC D;  1GG3 A;  1TBE A;  3T3O A;  4K7U A;  3R2I A;  5J18 A;  1P7F A;  2FBW B;  2WXR A;  4ANW A;  4RGM A;  2EKE C;  4C80 A;  2XN9 C;  3PRM B;  3VQI A;  2GBN A;  2K0P A;  2BS2 B;  4ZOH C;  5MPO A;  2XNA C;  1EF5 A;  3R8B A;  3BWU D;  5H8Y E;  3H6N A;  5C2T B;  2UU7 A;  1N6Z A;  3NZS A;  3Q8B A;  2K6D B;  2N0S B;  2LI5 A;  4ZRQ A;  2JF5 A;  2KHW B;  1MHX A;  3AU5 A;  3DVN V;  4JLC A;  5FK9 C;  2DWQ A;  4E71 A;  1BML C;  3RUL A;  2HTH A;  3WAN A;  2DHZ A;  2WNM A;  1GC7 A;  4HXD A;  1TZO A;  2V3N A;  4X57 B;  1YQB A;  2V4I B;  1FD6 A;  3CMM B;  3A9J B;  4WIP A;  4II3 B;  2BW2 A;  4PS8 A;  2KTF A;  4MJS B;  3L16 A;  4MEM A;  5CHV C;  4KGR A;  3APC A;  4WJP A;  4S0R A;  3AE1 B;  1EWY C;  2I1J A;  2K8B A;  3OWE B;  1N5X A;  2KMC A;  1A5R A;  2N4F A;  2G1E A;  3B2F A;  1JCK B;  3Q8E A;  2QC8 A;  4WWM A;  4YSZ B;  1UBQ A;  1YX5 B;  3PTF C;  2KOX A;  1NI3 A;  5CHW A;  1UEL A;  1K53 A;  1YMH E;  1H4R A;  4NAW A;  3ZGZ A;  4YL8 A;  1F0Z A;  3I3T B;  1GAQ B;  3H8H A;  1XEE A;  4WH4 A;  3ALB A;  4OVZ A;  4JQW C;  2NR2 A;  3PHX B;  4N58 A;  4XC2 A;  4KDI C;  4PS7 A;  3JSV A;  4J6I A;  5AEK B;  4DHJ B;  2HJ8 A;  4O1N A;  1GB4 A;  4OVV A;  1FCC C;  2LVP A;  2Z8L A;  4NNJ B;  4BBN F;  4P6V F;  1VR9 A;  4DXG A;  3VTU A;  1FFU A;  3KQ4 A;  1XQQ A;  2JPH A;  1QOF A;  1WY8 A;  1GC6 A;  5E6J A;  2WXH A;  4FN2 A;  1NYR A;  4TMA B;  2IYD B;  2XK5 B;  3R7R A;  3RZW C;  1OGW A;  3R7Q A;  1E8Y A;  1E8X A;  1HTO A;  4MGZ E;  4EFO A;  1WXQ A;  3A9J A;  4IWQ A;  2KT7 A;  2JRH A;  2K5P A;  2M19 A;  3ZRF A;  5JH5 C;  1WX7 A;  2WDV B;  3MC0 B;  4M0W B;  4JE3 B;  4NJ6 A;  2GBJ A;  1D5X C;  1I35 A;  3DWM A;  2G9H D;  4ARI A;  1V9J A;  4LNK A;  2RMM A;  1XD3 B;  2ZJD A;  3RUI B;  4TQ1 A;  2DYO A;  1HQR D;  4MM3 B;  2KWC A;  2QCZ A;  4US8 A;  2M0A A;  3DBH B;  3QHT A;  2IBI B;  4HCP B;  1DGJ A;  1WGR A;  1XO3 A;  2MWS B;  4REZ A;  3B2G A;  1OEY J;  4N9F 4;  2IO3 B;  4GOC A;  4YSX B;  4FA6 A;  2G4S A;  5JZE B;  4KGS A;  4CQN A;  3AEA B;  3B9J A;  3AE7 B;  2DAF A;  2JZ3 B;  5LXI B;  1L4Z B;  2LFI A;  4GGQ A;  4PS3 A;  3UI3 A;  1QOA A;  1SJH D;  5JHA A;  3SD5 A;  1FRD A;  2D3G A;  3RNE C;  2PPH A;  3L17 A;  4W9D A;  3AE2 B;  3AE4 B;  4GDL B;  2BTE A;  5IO9 A;  4W9I A;  1HTQ A;  1TT5 B;  1Y8R C;  5IA7 A;  4OZB A;  3X0W A;  3KW5 B;  1P3Q U;  4EZL A;  5D3I B;  3N1Z C;  4MGK E;  4MGY E;  4W9J A;  1I4G A;  1YJJ A;  4OW0 A;  2PLP A;  2NTT A;  1JAL A;  2PMV A;  3EGR A;  4DK5 A;  1VZ6 A;  1VZ8 A;  2J0M A;  2ONQ A;  3TJP A;  3ZJT A;  2BVC A;  1WJ4 A;  2L05 A;  4R3D A;  2WU5 B;  1SF0 A;  1V5O A;  3PV1 A;  3VUY A;  4AS1 A;  5FKA C;  5BMI A;  1STE A;  2L3Z A;  2WXO A;  3KWL A;  3NVY A;  1A70 A;  5C1Z A;  3AEC B;  2JT4 B;  4C4V A;  2N1W A;  3ZDM C;  1X1M A;  3RI7 C;  3DHG C;  1WJU A;  2BBC A;  1N62 A;  5CHF A;  2KFJ A;  2BYT A;  3AE6 B;  1OEY A;  4BKS A;  3VH4 B;  1HEZ E;  2D11 A;  2K6Q A;  1TY0 A;  1PUT A;  2AQ3 B;  2QDF A;  2SAK A;  2CHW A;  2ZVN A;  1ZE3 D;  1ZPS A;  1NEN B;  2KLC A;  2KKC A;  1FXT B;  2ON8 A;  3Q3F A;  1FMA D;  3QCA A;  1ESF A;  1PGA A;  2V3P A;  2A5U A;  2BQQ A;  1TS5 A;  4LJO B;  5DPW A;  1SXT A;  2KXJ A;  2Z0E B;  2WXF A;  2VRR B;  4ANX A;  4P7I A;  4K3B A;  3P1M A;  4BBN C;  4W9G A;  4BVU C;  3APF A;  2WX1 A;  1V5T A;  2ZPN A;  4C7Z A;  4US9 A;  2O6V A;  2B76 B;  2FIF A;  2WXI A;  4TSS A;  2KDI A;  2KDM A;  4BAX A;  4L1B A;  4XWW A;  1TS4 A;  1JRU A;  4JPS A;  1C76 A;  2ZCC A;  3DBH I;  2N9X A;  4HK2 A;  1E9M A;  3LB8 C;  4AWJ A;  3NHE B;  4HRS A;  2DYM A;  3ZVV A;  2KC2 A;  3AH7 A;  1ZDX A;  2BYE A;  2JYT A;  1TIF A;  4NQL B;  2K3U A;  2L7R A;  2UWQ A;  2IND C;  3P4Q B;  4FHJ A;  2OED A;  1YQ3 B;  3IT6 B;  4HWI B;  4URK A;  4ASW C;  1KRH A;  1KTK A;  2MBO A;  2BWF A;  1EU3 A;  4MT5 A;  3VUW A;  3HUI A;  1B1Z A;  2NBU A;  1TKG A;  4FJY A;  2N7E A;  4GSW A;  1JQ4 A;  2HDE A;  2LAS A;  2J7Q B;  4RNA A;  1EM7 A;  1OFF A;  2W3S A;  1OQY A;  4G3X B;  4W9K A;  3N9Y C;  3O65 B;  1NVI D;  1Q5W B;  4ACF A;  3RMK C;  4Q2J A;  3CSF A;  1I4X A;  3HIZ A;  4KGT A;  4TV3 A;  1FRR A;  3MFG A;  1L5P A;  3H7S A;  2R2Q A;  1L6V A;  1L4D B;  2WXL A;  2KDE B;  3AE3 B;  2FCN A;  3NRZ A;  4HDQ A;  1UNS A;  1JWM D;  4E74 A;  2BYF A; 
#chains in the Genus database with same CATH homology
 4A3P A;  2BYV E;  2DEN B;  3MHS D;  3KYC D;  1GG3 A;  4DHZ B;  1TBE A;  1WZ3 A;  3NZU A;  3PRE A;  4K7U A;  2V3S A;  4KSL C;  5J18 A;  4FHK A;  4MH0 E;  2PEA A;  4NY0 A;  5AZH A;  3T9L A;  2DAJ A;  1XT9 B;  3R66 C;  4ANW A;  3VUX A;  1P98 A;  2M1M A;  2EKE C;  4HPM B;  4HVB A;  4TUU A;  4GDK A;  2BKR B;  3PRM B;  3QC8 B;  2D10 A;  2GBN A;  1LXD A;  4GDL A;  3VQI A;  4FAD A;  1WXV A;  2FCS A;  3DOW A;  3DPD A;  2K25 A;  2LGX A;  1WXA A;  3PRZ A;  3L08 A;  1V49 A;  1EF5 A;  4FJV B;  4WWP A;  2IO2 B;  5LLI A;  1GJZ A;  3H6N A;  3NZS A;  4IM2 A;  4MEL A;  2BGF A;  3U30 A;  1WGD A;  2K6D B;  3L10 B;  2LI5 A;  2AL6 A;  1KOT A;  2JF5 A;  3PRP B;  2HD5 B;  1UD7 A;  2KHW B;  2JY6 A;  2QHO A;  3AU5 A;  2C7H A;  2LD9 A;  3DVN V;  4I6P A;  3SHQ A;  4DDG D;  4JLC A;  4KV2 A;  3VTV A;  4E71 A;  3X23 A;  2RR9 A;  2ZVO A;  3RUL A;  2HTH A;  3WAN A;  4MGI E;  2DHZ A;  3VFK A;  1GC7 A;  4HXD A;  1Q1O A;  1S3S G;  4B6W A;  4HLE A;  4X57 B;  1YQB A;  1AAR A;  2KWV B;  4CYE A;  4DHZ E;  3CMM B;  2LRU A;  4WJN A;  3A9J B;  3TMP B;  1WIA A;  4HCN B;  5DPS A;  4II3 B;  2DZJ A;  5E6P A;  4ANU A;  3PLV A;  2CHX A;  1YX6 B;  2KTF A;  4PS8 A;  4MJS B;  3QJZ A;  1NDD A;  1TZ1 A;  2JWZ A;  3L16 A;  4MEM A;  5L95 C;  3KYD D;  4KZ0 A;  5CHV C;  4NQK E;  5BO4 B;  2MQJ A;  4KVG B;  3APC A;  3TCA A;  3A33 B;  4WJP A;  4A3O A;  2ZZP B;  3AU4 A;  3ZUN A;  5G2N A;  4AJY B;  4KIK A;  2I1J A;  2L0F A;  2KAN A;  2K8B A;  2JUO A;  1A5R A;  2KMC A;  3H9D A;  2KQS A;  5D94 A;  5LXH A;  4W9L A;  4MSM B;  3OLM D;  2N4F A;  2KJH B;  5HKH A;  4AJW A;  3EC8 A;  3IFW B;  2KTR B;  3ZIM A;  5E6O A;  4LDT D;  4EKU A;  1UBQ A;  1YX5 B;  3U7D A;  3PTF C;  3ZDT A;  2C9W B;  1OTR B;  2KOX A;  3ENE A;  1TGZ B;  2M4N A;  5CHW A;  1UEL A;  4XZ4 A;  5IAA C;  3QAQ A;  2BF8 B;  2NPT A;  4GIV A;  3NS8 A;  2AL3 A;  1H4R A;  3R3M A;  3PS6 A;  1WMH A;  4NAW A;  2AEH A;  2GBR A;  2N9P C;  1UGM A;  3DQV A;  4YL8 A;  3I3T B;  3H7P A;  2YLM A;  3LJ3 A;  2I1K A;  3ALB A;  4JQW C;  1VCB A;  2DZI A;  2MP2 B;  2N1V A;  2NR2 A;  3PHX B;  4IWO A;  2O6V B;  3HM6 X;  4XC2 A;  4KDI C;  3W1S C;  4PS7 A;  2J0J A;  5J17 A;  4KDL B;  3JSV A;  4AUQ C;  2M17 A;  4J6I A;  5AEK B;  4DHJ B;  1D3Z A;  2HJ8 A;  4M8N A;  1E7V A;  3ZNG C;  4W9E A;  3DBR I;  1QZE A;  4OVV A;  2LVP A;  2KZR A;  3ZW3 A;  3ML8 A;  3BY4 B;  3PSE B;  3NOB A;  3ZRC A;  2ASQ A;  4NNJ B;  1TTN A;  4BBN F;  2JZZ A;  5KHO A;  3VHT C;  3PVL A;  2GBM A;  4GMV A;  1P1A A;  3VTU A;  1V86 A;  3VH3 B;  1XQQ A;  2RD0 A;  3UGB B;  2JPH A;  2N9E B;  1V6E A;  1WY8 A;  1YD8 U;  2Z59 B;  4II2 B;  4FJZ A;  1E5W A;  3M62 B;  3T8M A;  2RSU A;  2ZNV B;  3JVZ X;  1GC6 A;  1UBI A;  3DBS A;  2LRW A;  3KH0 A;  1WF9 A;  4F7Z A;  2W9N A;  1VD2 A;  2G45 B;  4FN2 A;  2MBQ A;  5AZG A;  2IYD B;  2LVO A;  4MDK E;  2KO3 A;  2XK5 B;  3GZN I;  3R7R A;  3RZW C;  2G4D B;  3KUD B;  1OGW A;  1RLF A;  3R7Q A;  1E8Y A;  2GMI C;  2ZPY A;  3EEC A;  1WJ6 A;  4G0N B;  1WYW B;  1E8X A;  4MGZ E;  4EFO A;  2PJH A;  2C7N B;  3A9J A;  3UF8 A;  4IWQ A;  4EEW A;  3PZD A;  2MX2 A;  2JRH A;  1Q0W B;  2LGD A;  4TQ0 A;  4ZRI A;  4DDI D;  3A4R A;  1V81 A;  3ZRF A;  4ICV A;  1RRB A;  4JIO U;  3KVF B;  2AYO B;  3RCZ A;  5JH5 C;  1WX7 A;  2MLB A;  3IG3 A;  3W1Y A;  4M0W B;  4NJ6 A;  1I35 A;  2GBJ A;  5D2M B;  1LM8 B;  2IO1 B;  3OJ4 B;  3RT3 B;  1WGH A;  1RFA A;  4EZJ A;  1V9J A;  4IUM B;  3DVN U;  1IP9 A;  1H8C A;  3B1L X;  1XD3 B;  5CTR C;  2ZJD A;  2LWP A;  3RUI B;  3MTN B;  4TQ1 A;  1E7U A;  3RYT A;  2DYO A;  2KLG A;  3K9P B;  5EDS A;  3ZNZ B;  2LJ5 A;  2KWC A;  1IPG A;  4EZK A;  3SDL C;  3QHT A;  4JGH B;  2KJR A;  3WIM A;  2WX0 A;  5L83 A;  4K1R B;  2IBI B;  4ZRK A;  4HCP B;  4W9F A;  1WGR A;  2A4Z A;  2MWS B;  3KUZ A;  1WX8 A;  2K8C A;  1WXM A;  2KFK B;  1WH3 A;  2KD0 A;  3EFU A;  1OEY J;  4N9F 4;  3ZTD A;  1ZGU B;  2IO3 B;  4BOZ B;  2D2Q A;  4GOC A;  4IM0 A;  5TR5 A;  4FA6 A;  2G4S A;  2M0X A;  5JZE B;  2J0K A;  2M8S A;  4CO7 A;  4I6L B;  4PYZ A;  2O2V B;  2L00 B;  3A1Q A;  3CST A;  3GOE A;  1WGG A;  4LDT B;  2UYZ B;  3VAW A;  2D07 B;  2DAF A;  2FCQ A;  2IZV B;  2JZ3 B;  2GBK A;  3QQ8 B;  3N3K B;  2KVR A;  5LXI B;  1K8R B;  2DZK A;  3QK0 A;  4GGQ A;  2V1Y A;  4PS3 A;  3V62 A;  5E6N A;  3V60 A;  4WAA A;  2Y5B B;  5JHA A;  4IM3 A;  3ONS A;  3SD5 A;  3A9K A;  2C5L C;  2D3G A;  2PPH A;  4NJ7 A;  1KM7 A;  1I42 A;  3PHW B;  5DPT A;  3L17 A;  4W9D A;  3TL5 A;  1LQB A;  3AI5 A;  3PGE A;  4PYU A;  1Z2M A;  2KNB A;  2KX3 A;  4GDK B;  1KLV A;  2KN5 A;  2EMT A;  3U8Z A;  4GDL B;  4HJK A;  3S2A A;  1WM2 A;  4W9I A;  2MA9 B;  3N32 A;  2FNJ B;  3PPA A;  1P9D U;  2DZM A;  1Y8R C;  2C60 A;  2JXX A;  2XBB C;  4IG7 B;  1V2Y A;  4TKN A;  5IA7 A;  3X0W A;  2KDF B;  1GNU A;  2JVC A;  3DCG A;  3HK0 A;  1P3Q U;  2LGY A;  3KW5 B;  4M8M A;  3TBL D;  3W1S A;  4EZL A;  2JRI B;  3DVG X;  2DX5 B;  4FLH A;  4BKT A;  1YIW A;  2PE9 A;  4MGK E;  4MGY E;  3AXC A;  4XX5 A;  5JHB A;  4W9J A;  3H1U A;  3IHP C;  3JYU A;  4F8C B;  4BKG A;  2FID A;  1V80 A;  4G11 A;  2IY0 B;  3Q3J A;  4WJO A;  4DK5 A;  5D6J B;  2J0M A;  3TJP A;  2KC1 A;  2NS5 A;  2MCN B;  4ANV A;  1WJ4 A;  1WR6 E;  2BPS A;  3IBE A;  2L05 A;  1CMX B;  3C0R B;  3WAL A;  1M94 A;  4B9K A;  2FCM A;  4GN1 A;  2AWT A;  2NVU I;  5AZF A;  1V5O A;  3PV1 A;  2KWU B;  3VUY A;  4CHK A;  2CR5 A;  4KSK C;  2MW5 A;  2L3Z A;  2V4L A;  2IO0 B;  2YVC A;  3RZF A;  4ZDV A;  5C1Z A;  1SGH A;  3VXW A;  4DWF A;  4KIK B;  1HE8 A;  1WR1 A;  2REX A;  5D7G A;  3UQB A;  4AP4 C;  1E8W A;  2BKF A;  3PLU A;  2JT4 B;  1J8C A;  2N1W A;  1ISN A;  1WX9 A;  1X1M A;  2LXA A;  3ZDM C;  4ICU A;  4RM8 A;  2BWE S;  3IVF A;  3ECI A;  1WJU A;  3QA8 A;  2LZ6 A;  5CHF A;  2CHZ A;  2KFJ A;  2K8H A;  1OEY A;  3CF6 E;  3EHV A;  4BKS A;  3VH4 B;  2L76 A;  1YJ1 A;  2D11 A;  4MJS A;  2K6Q A;  4DHJ D;  3ZKJ C;  4K7W A;  3LDZ E;  2NPT B;  2FUH B;  4WWN A;  1NI2 A;  4NAW B;  3QWZ B;  2CHW A;  4ZYN A;  2ZVN A;  2KDB A;  3H7P B;  3V6C B;  1U4A A;  2KLC A;  2KKC A;  1FXT B;  2KX0 A;  3Q3F A;  3HHM A;  1SIF A;  1UH6 A;  4WWO A;  3QCA A;  2MBB B;  2ZEQ A;  1R4M I;  4LCD E;  5C23 A;  3DVG Y;  3VDZ A;  2A5U A;  3V6E B;  3QX1 A;  4IW0 A;  2EMS A;  2L0T A;  1ZKH A;  2KTR A;  4FUL A;  3JSV B;  4A20 A;  3B08 A;  4LJO B;  1WRD B;  4E3C A;  1C3T A;  3WA0 A;  5DPW A;  2XEW A;  3AUL A;  2N7D A;  1IYF A;  2KXJ A;  2Z0E B;  1EUV B;  3L54 A;  2NCN A;  2VRR B;  4ZRJ A;  1NBF C;  2NBW B;  4ANX A;  2KK8 A;  2HE7 A;  4P7I A;  2RPQ A;  4K7S A;  2LUE A;  3K9O B;  3WAP A;  4IWP A;  4BBN C;  1WZ0 A;  4EOY A;  4W9G A;  1MG8 A;  1WE7 A;  4WJQ A;  3ZNI D;  4BVU C;  1GUA B;  3APF A;  2WX1 A;  4LJP B;  4RM9 A;  1V5T A;  2ZPN A;  4W9C A;  2MP2 A;  3TIX A;  2L8J A;  3A4S C;  2O6V A;  3L0W B;  4NPN A;  5GMV A;  2FIF A;  4JL9 A;  5CX3 A;  3B0A A;  4KZC A;  3M95 A;  1WFY A;  2KDI A;  3OAW A;  3ZLZ A;  4BFR A;  3BIN A;  3VTW A;  3M3J A;  3UIP B;  1JRU A;  4GB9 A;  3HM3 A;  2KJ6 A;  2ZCC A;  1C1Y B;  3DBH I;  2N9X A;  4HK2 A;  4OVU A;  2MBH A;  3UQA A;  2IY1 B;  3NHE B;  3RD2 A;  4AWJ A;  3UIN B;  2DYB A;  2DYM A;  4GXB A;  3DBL I;  2WWZ A;  5FR6 A;  2OJR A;  2LVQ A;  2KC2 A;  3ZVV A;  2WDT B;  4HDO A;  2OOB B;  2BYE A;  1R4N I;  4G50 A;  1E8Z A;  4NQL B;  3PT2 B;  2L7R A;  2UWQ A;  3SU8 X;  3ZNH B;  4F1S A;  3V61 A;  3JW0 X;  4FHJ A;  4WQO B;  1RAX A;  4K81 A;  3OJ3 A;  2ZNV C;  1WJN A;  4HWI B;  4URK A;  1WI0 A;  3MJW A;  4ASW C;  2XK5 A;  1T0Y A;  3ZO5 B;  2MBO A;  5G55 A;  1WGY A;  2BWF A;  2LXC A;  4DBG A;  2KQ7 A;  3P2B A;  3VUW A;  1WM3 A;  4B95 A;  2K1F A;  4BKS D;  4W9H A;  3DDC B;  2NBU A;  1BT0 A;  2C7M B;  1P0R A;  4DXA B;  4FJY A;  2N7E A;  1KJT A;  2CS4 A;  2MBE A;  2MRP A;  2FAZ A;  4GSW A;  3N30 A;  2RGF A;  1ZW7 A;  2KMA A;  2LAS A;  4MSQ B;  2J7Q B;  3APD A;  4AOF A;  1J0G A;  1WE6 A;  1OQY A;  2CU1 A;  4G3X B;  4W9K A;  3ZTC A;  1UZX B;  2K39 A;  3UIO B;  3A1Q B;  3O65 B;  1Q5W B;  4GU2 A;  2G3Q B;  3VVW B;  2Z0D B;  1E90 A;  2GOW A;  4MM3 A;  2WYQ A;  3CSF A;  1EO6 A;  1S1Q B;  3L13 A;  5DPR A;  3HIZ A;  4TV3 A;  5DCN A;  1PQS A;  1Z5S B;  3ML9 A;  4I6N B;  1G6J A;  2KFK A;  3A9K B;  2MSE D;  2B3A A;  3M63 B;  4HPL B;  2ZCB A;  3D32 A;  3H7S A;  2O6V D;  2R2Q A;  4BOS C;  3QIJ A;  1L7Y A;  1LFD A;  3WAO A;  2O2V A;  5KHQ A;  2KDE B;  3QAR A;  3WAM A;  2FCN A;  3KUC B;  4HDQ A;  1J19 A;  2R2O A;  4IC7 B;  1WXS A;  4FBJ B;  2NBV B;  1L2N A;  5J2R A;  4E74 A;  1F9J A;  2CKH B;  3NY5 A;  4EUT A;  2BYF A;  1WMH B;  1EF1 A;  1SE9 A;  2PE6 B;  4RMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...