1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog B
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
3K9OB 4GXBA 3APDA 2B3AA 2O6VD 1J8CA 1KJTA 1Z5SB 3R7RA 2CR5A 2OJRA 3RZFA 2GBKA 4W9DA 4MSMB 1V5OA 3MJWA 2G4SA 2K6DB 1Q1OA 1S1QB 3UQAA 4KVGB 3L17A 2K8HA 1WJ6A 2I1KA 2IZVB 2KC1A 3VUXA 2KWCA 1P9DU 2LJ5A 5L83A 2WWZA 3M95A 2M4NA 3H9DA 1WZ0A 3M3JA 3PT2B 1WH3A 2JVCA 3HM6X 3L08A 2KTRB 3ZDMC 4BKSD 2YLMA 2KQSA 1WGYA 3H1UA 4X57B 3ZUNA 1TTNA 1WXMA 3PV1A 3UF8A 4EFOA 4EKUA 3T9LA 1D3ZA 4HLEA 5CX3A 2JXXA 4ZRIA 2J0JA 1XQQA 2LZ6A 2RSUA 4ANUA 4XZ4A 4MELA 2ZPYA 1J0GA 2KFJA 2ASQA 4GOCA 2EKEC 1WGRA 2RR9A 4GMVA 5CHVC 4F1SA 3A4SC 3TBLD 3IG3A 4ICUA 2N7DA 1RAXA 4G11A 4NAWB 3APFA 4J6IA 1YJ1A 4FJZA 2MCNB 1WX9A 2AWTA 3NY5A 4W9FA 3VTVA 3KUDB 1WZ3A 1YIWA 5DPSA 3O65B 4AUQC 1P3QU 3HK0A 3EC8A 4NNJB 3TL5A 4K7SA 1NBFC 1QZEA 2JPHA 1F9JA 2K6QA 4B9KA 1LXDA 2BGFA 3PVLA 3OLMD 5G55A 3W1YA 4DK5A 1WJ4A 4NJ7A 2BYEA 2GBJA 3Q3FA 2FCNA 1EF5A 3A33B 1K8RB 3ZRFA 4PYZA 3R66C 1LM8B 3DBSA 2KLCA 1V2YA 2KWUB 2A5UA 5JHBA 2V3SA 2K8BA 2VRRB 4KIKA 3IHPC 3CSFA 2KJRA 3ML9A 2NBUA 1P1AA 4MGIE 1WJNA 2O2VB 2HE7A 3W1SA 4GDLA 3VUWA 2O6VB 1LFDA 4EZLA 1EF1A 2KX0A 2M1MA 2DX5B 3NZUA 3X23A 3KW5B 3WIMA 1E8ZA 1CMXB 3ZNZB 5D6JB 2L3ZA 3VH3B 4AJWA 1WXAA 2CHZA 3CMMB 2MQJA 2BPSA 3A1QA 4B6WA 2L00B 4IWQA 4KZCA 3A9KA 4W9HA 4MH0E 1GJZA 1E7UA 2MLBA 1WMHA 2M0XA 5DCNA 3P2BA 5E6OA 2ZVOA 1OQYA 2MBEA 3UGBB 5E6NA 2ZJDA 1V5TA 1R4NI 4M8NA 1V86A 2K1FA 3KVFB 2BWFA 3RCZA 3V6CB 1V49A 3KUZA 5DPRA 2G45B 1WJUA 3PLUA 1I35A 1Y8RC 3PRMB 2KMCA 2FAZA 3ZO5B 1WY8A 3A9JA 4DXAB 2ZNVC 1PQSA 2JT4B 1XT9B 2ZEQA 3WANA 1WF9A 2DZJA 4A3OA 4DHZB 3OAWA 4WJNA 2MRPA 2OOBB 3DVGY 1UH6A 5CHWA 2L05A 2DENB 2BKRB 1VCBA 2V1YA 1ZGUB 3WAOA 3ALBA 4GU2A 2IYDB 2L7RA 4MGYE 2I1JA 2RGFA 3QAQA 3VDZA 4CYEA 4TQ1A 2AYOB 1E8YA 2Y5BB 3JSVA 4CO7A 1BT0A 2KX3A 4E71A 2IO0B 4JLCA 2KDBA 2XK5A 4W9KA 4P7IA 3CSTA 4A20A 3ZNID 2EMTA 3AU5A 2GMIC 2KTFA 2HJ8A 3H7PA 4MJSB 2FIFA 4W9JA 4RM8A 2DYOA 2A4ZA 1JRUA 4ANWA 3DVNU 1GUAB 1X1MA 2BF8B 2CS4A 3B08A 4FADA 2G4DB 3SDLC 2BYFA 3VHTC 3BINA 4E3CA 5JHAA 4K1RB 1IPGA 2JUOA 4NJ6A 2DYMA 3V60A 4A3PA 1KLVA 2HTHA 5GMVA 2JZZA 1IYFA 2FCQA 3TMPB 3AI5A 1GG3A 2MBBB 5LXHA 1SIFA 4HK2A 1GNUA 1UGMA 2KWVB 3OJ4B 5KHOA 4BVUC 3H6NA 2D07B 2ZPNA 3DBRI 2GBMA 3U8ZA 2LI5A 4M8MA 3T8MA 1AARA 1U4AA 2RD0A 3QIJA 3HM3A 4ICVA 3ZW3A 4EZJA 3L10B 4KDIC 1WRDB 1ZW7A 3A4RA 5JZEB 3KYDD 4IG7B 4K7UA 3DOWA 2CKHB 5JH5C 3TCAA 3DDCB 3U30A 4XX5A 2K25A 1TBEA 4G3XB 1E5WA 1OEYA 1WR1A 1WR6E 1WM2A 4II3B 4TKNA 3VXWA 2KVRA 4DBGA 4FHJA 3VQIA 2R2QA 2MWSB 3DPDA 2DAFA 4EEWA 1WI0A 2KNBA 2GBNA 2MP2B 3APCA 4PS3A 3JYUA 4DDGD 2LXAA 1WX8A 3WA0A 4E74A 2UWQA 3UQBA 3PSEB 1WXSA 2UYZB 4AOFA 2MX2A 4RM9A 3QARA 5LLIA 4AJYB 4HVBA 3R3MA 1C1YB 3C0RB 2IO1B 4FA6A 3N32A 4HXDA 3U7DA 1A5RA 2KZRA 4MGKE 2FIDA 4KSLC 2JZ3B 2LRWA 2DYBA 4DHZE 4IC7B 3L0WB 3ZIMA 1Q0WB 1Z2MA 3DVNV 1I42A 5C1ZA 2NPTB 2KTRA 2ZCBA 3TIXA 4BOZB 1KM7A 1ZKHA 4FHKA 3UIPB 3DBLI 1WGDA 1YD8U 2M8SA 2PJHA 1WGGA 2KK8A 1OTRB 3PGEA 3PREA 1H8CA 3PRPB 2MW5A 5DPWA 2L76A 5DPTA 1L7YA 2C7HA 3GOEA 3PZDA 2AL6A 2IY0B 2PEAA 3QJZA 3ZDTA 4IUMB 2GBRA 3PHXB 1G6JA 2Z59B 2DZMA 4ZRKA 5AZFA 1YX5B 2KFKB 3AU4A 1UZXB 4TQ0A 2KDIA 3CF6E 3KYCD 1XD3B 2LVOA 2ZVNA 4NPNA 3IBEA 4WWPA 5IAAC 3QX1A 3VTWA 4GDKB 1TZ1A 4II2B 5IA7A 1V6EA 2PPHA 4NAWA 2WX0A 3I3TB 4F7ZA 3ZTCA 4BKGA 4WQOB 2NVUI 3N30A 5AEKB 2LGYA 4WWNA 2N9EB 1WM3A 1YQBA 3PPAA 1J19A 4FULA 2MBQA 1UD7A 2CU1A 2D11A 3AXCA 4ZDVA 2FCMA 2LVQA 3ECIA 3RZWC 1UBIA 3ZNHB 2L0FA 4F8CB 1YX6B 2FUHB 3ZNGC 2LUEA 1V9JA 2RPQA 1VD2A 3OJ3A 4ZYNA 2KXJA 2KJ6A 2O2VA 3DBHI 1NDDA 1WGHA 2LXCA 2KQ7A 2KHWB 3DQVA 4KV2A 2O6VA 4HDQA 2BYVE 1SE9A 1WIAA 5C23A 4URKA 4MDKE 1R4MI 2N4FA 2L8JA 3VH4B 2MBOA 4MGZE 5CTRC 2CHWA 3ZKJC 3RUIB 1RLFA 5AZHA 3QC8B 2KD0A 2BWES 4BBNF 3EHVA 2WDTB 1FXTB 3NHEB 3VUYA 4IWPA 2LVPA 4I6NB 4LJOB 4KDLB 2HD5B 2M17A 3WALA 3L16A 3ZRCA 2JF5A 3Q3JA 4WJQA 1UBQA 3V62A 1T0YA 3IVFA 4BKSA 2IY1B 1RFAA 4IM3A 2R2OA 2D2QA 1E8XA 4GN1A 3PRZA 3QQ8B 4GGQA 4W9EA 2MA9B 4NQLB 2C7MB 4KZ0A 4MEMA 2JWZA 4PYUA 2J0MA 5FR6A 1LQBA 5EDSA 2MSED 2ZNVB 3BY4B 4MM3A 4B95A 2LRUA 4GIVA 4TV3A 2N1WA 3ZTDA 4MSQB 5CHFA 4KSKC 3B0AA 4I6PA 2BKFA 2REXA 3V61A 2C5LC 2D10A 2Z0EB 3WAPA 4DWFA 3UIOB 2LGDA 4IWOA 4W9LA 1WYWB 4W9IA 3S2AA 4HCNB 3QHTA 3VTUA 2KO3A 3JVZX 1TGZB 3LDZE 4LJPB 3EECA 2KDEB 1WX7A 4KIKB 3SU8X 5D2MB 3M63B 5J17A 3ZVVA 4DDID 4GDLB 4ANXA 1S3SG 4TUUA 5J2RA 4W9CA 3TJPA 4GSWA 2J7QB 3D32A 3QWZB 4MJSA 2QHOA 3QA8A 4HPMB 2ZCCA 3PLVA 4WWOA 2K8CA 2PE9A 2JRHA 3ML8A 3JW0X 4GB9A 3A1QB 4LDTD 5HKHA 4EUTA 3A9KB 1RRBA 2N9XA 2NR2A 2D3GA 4BFRA 1WMHB 1E7VA 4HDOA 5J18A 4HPLB 5G2NA 1E90A 4YL8A 1UELA 2NCNA 3HIZA 4DHJD 2GOWA 3NZSA 4ANVA 2KOXA 4NQKE 1GC7A 4OVUA 4HJKA 2N9PC 3QCAA 5BO4B 2DAJA 4PS8A 3SD5A 2DZIA 2N1VA 4JL9A 2IBIB 4JIOU 4LCDE 3MTNB 3SHQA 2DZKA 3HHMA 3A9JB 4HWIB 4PS7A 2G3QB 4BKTA 1IP9A 2C9WB 3GZNI 3PHWB 3H7SA 2PE6B 2J0KA 2LWPA 3NS8A 2JRIB 3K9PB 4OVVA 3PS6A 2KC2A 4AWJA 2K39A 2XBBC 4ASWC 5L95C 3IFWB 3N3KB 2EMSA 3MHSD 4G0NB 2KMAA 1L2NA 1V80A 3DCGA 2WX1A 3JSVB 2YVCA 3KUCB 1ISNA 2MP2A 2XK5B 1OEYJ 4BBNC 2NBVB 4FLHA 4NY0A 3H7PB 2IO2B 4BOSC 2LASA 2KLGA 2MBHA 3M62B 4FN2A 1HE8A 4XC2A 1E8WA 1OGWA 1Q5WB 3L54A 2NBWB 2W9NA 3DVGX 4IM2A 5KHQA 3RT3B 1H4RA 1M94A 1SGHA 3NOBA 3X0WA 1P98A 4FBJB 1GC6A 5D7GA 2KJHB 4G50A 2KANA 2C60A 4I6LB 2AEHA 2AL3A 2C7NB 2NPTA 4IM0A 4IW0A 4K81A 3VAWA 3ZLZA 4EZKA 1MG8A 4WJOA 4M0WB 3VVWB 3LJ3A 3VFKA 4CHKA 2LGXA 4K7WA 4FJVB 4W9GA 3KH0A 3UINB 4EOYA 5TR5A 2L0TA 4LDTB 4RMAA 4JQWC 1KOTA 2N7EA 2KN5A 5E6PA 1EO6A 1WXVA 4HCPB 4N9F4 2WYQA 3QK0A 1V81A 5D94A 1WFYA 3R7QA 2FCSA 3WAMA 3AULA 4AP4C 1P0RA 4DHJB 1WE6A 2KFKA 2XEWA 1EUVB 4ZRJA 2V4LA 5AZGA 3L13A 3RYTA 2KKCA 4WJPA 4GDKA 2FNJB 2KDFB 3RULA 1C3TA 3V6EB 5LXIB 3EFUA 2LD9A 2IO3B 1NI2A 2DHZA 3B1LX 3ONSA 2Z0DB 2ZZPB 3ENEA 4FJYA 2NS5A 4WAAA 3W1SC 2CHXA 2JY6A 3PTFC 3RD2A 1WE7A 4JGHB
chains in the Genus database with same CATH superfamily
2B3AA 1TY2A 1MHXA 1Z5SB 3RZFA 1V5OA 3MJWA 1TS4A 2WP9B 4KX6B 3UQAA 4M01A 2WWZA 3M95A 2M4NA 1ZUD2 3L08A 2KTRB 1YN4A 3RNFC 2YLMA 3ZDMC 1BUIC 3NG0A 1WXMA 3RNEC 4EFOA 1RM6C 2SEBD 1E9MA 4HLEA 1QOBA 5CX3A 4ZRIA 3GS2A 3AEGB 1JWSD 4JWSC 4XZ4A 4MELA 2DNFA 2ZPYA 2ASQA 4GOCA 2GRIA 1XLQA 2RR9A 5CHVC 1HQRD 3AB5A 4YSZB 4ICUA 2N7DA 2RDBC 1YJ1A 1BXTA 1WZ3A 1YIWA 3RI7C 4K7SA 2Q5WD 3Q8EA 1QZEA 2BGFA 5G55A 4NJ7A 2GBJA 2CJOA 1I4XA 1K8RB 4PYZA 3R66C 3KLSX 1JWUD 1V2YA 2V3SA 1VZ8A 3Q8AA 2VRRB 4KIKA 3IHPC 3ML9A 2HE7A 3W1SA 3VUWA 1DOXA 2O6VB 5H92C 2M1MA 5IP4D 2DX5B 2V9HA 1TIFA 2CU3A 3ZNZB 2L3ZA 4B6WA 2MQJA 1I7HA 2BQQA 2L00B 2PVOD 1XO3A 2PLPA 1XLNA 3UGBB 1R7SA 5BYSA 1I4GA 1V5TA 4M8NA 1V86A 4DXGA 4LLGM 1V49A 3FILA 1SSNA 5DPRA 2BBCA 2YEPB 4MM3B 3ZO5B 2PVGC 3A9JA 4UDUC 2FUG1 5TSSA 3W9CB 2ZEQA 2JT4B 2DZJA 3OAWA 2OOBB 1UH6A 5CHWA 2DENB 1B1ZA 2MJ3A 1MHHE 2I1JA 3JSVA 4CO7A 1BT0A 2J52A 3UI3A 2KDBA 1WRIA 1IBXA 1XXGA 4W9KA 4P7IA 1QOFA 2GMIC 4ITKA 5IOIA 1P7EA 2FIFA 1WWTA 2GLSA 4YSYB 3B08A 4FADA 3AE9B 2BYFA 1FO4A 4K1RB 1IPGA 5IO9A 4NJ6A 4MACA 2ZW1A 5FK9C 1IYFA 2FCQA 3TMPB 5LNK1 1GG3A 1VDVA 4MT5A 5GXGB 2E6XA 2KWVB 5KHOA 1AYFA 1UWXA 3DBRI 2GBMA 3U8ZA 1U4AA 2RD0A 1L4ZB 3L10B 1WRDB 3KYDD 4IG7B 2CKHB 3TCAA 3U30A 1WR1A 5JXVA 1FEHA 4FHJA 4XWTA 1TZOA 2ZW0A 1WSPA 2WDRB 4PS3A 2MP2B 2GBNA 3BYTB 4E74A 3RN9C 2UYZB 4RM9A 4LNNA 4LNIA 4AJYB 5FR3A 1C1YB 4HXDA 4DHZE 2DYBA 4R3DA 3L0WB 2WXLA 1Z2MA 1UNSA 3FAHA 1KM7A 2NTTA 3UIPB 1JQ4A 3HVDA 4RGMA 1E0ZA 3PGEA 2IY0B 2PEAA 1EU3A 1GB4A 1UZXB 1N6ZA 3KYCD 5EE3A 3VTWA 3MC0B 3R2IA 4GDKB 5IA7A 3P4SB 4NAWA 3Q14C 4BKGA 1IBXB 2NVUI 3N30A 1UF0A 2LGYA 2K9XA 4ZYSA 3RPFC 1D5MC 2D11A 1YJJA 1JALA 1L5PA 1YQ3B 3DWGC 4F8CB 1YX6B 2FUHB 5IN7A 1WXQA 3OJ3A 1MG4A 2KQ7A 2BYVE 1SE9A 2MBOA 4MGZE 3AE6B 1RLFA 1GOZA 2BT6A 1IGCA 4BBNF 3EHVA 3VUYA 4M00A 5BMIA 1P7FA 2B76B 3WALA 3NVZA 3ZRCA 3L16A 2WQYB 2WXRA 3Q3JA 4WJQA 3SFDB 5C2TB 3V62A 4BKSA 4US9A 1RFAA 2R2OA 3IAS1 3PRZA 3MJ5A 3Q2AC 1JWAD 5EDSA 1ET6A 2MSED 1ZXIA 2WXNA 2HTME 4RFBA 2QILA 1J7CA 3HVZA 2D10A 3WAPA 1WYWB 1TGZB 4LJPB 1DGJA 1IUEA 5J17A 2Y5CA 3ZVVA 4TUUA 2H88B 3TJPA 4GSWA 3D32A 3QWZB 4MJSA 2IPKD 4WWOA 1T5XD 2AQ1B 3W5UB 4GB9A 2M56B 4XE0A 4LDTD 1RRBA 2NR2A 2LHEA 2PKOA 4HPLB 3HIZA 4ANVA 1YQ4B 4NQKE 1GC7A 3LXFA 2DAJA 2J4XA 4JL9A 3SHQA 1QT9A 2WXOA 1QILA 2LWPA 2WHIA 3K9PB 2WXGA 4L23A 3IFWB 4D2KA 3MHSD 4G0NB 1L2NA 3ZJVA 2YVCA 3BK1A 3EGRA 1N62A 3ZXVA 2XK5B 4YTPB 4BBNC 4FLHA 2IO2B 2KLGA 4FN2A 1HE8A 2LGSA 1J7BA 2W9NA 3DVGX 1H4RA 1M94A 1GC6A 3SEBA 2KJHB 4G50A 2AEHA 2C7NB 4EZKA 2NPTA 4IW0A 3L4PA 4FJVB 4W9GA 2M19A 1N61A 4RMAA 4JQWC 4C56C 2CJNA 2N7EA 1FD6A 2KN5A 1WXVA 3RNBC 3QK0A 4C4VB 4H2AA 1SF0A 2KFKA 4BAXA 5AUKA 2LMCA 4ZRJA 2V4LA 5MPOA 2KKCA 1C3TA 3V6EB 3ABVB 2DHZA 2Z0DB 4HROA 1F0ZA 3PTFC 4S17A 2O6VD 2OJRA 2G4SA 2K8HA 2KC1A 1P9DU 1AN8A 1VJKA 1WH3A 2JVCA 1FMAD 1WGYA 1FNUA 1TTNA 2JYTA 2K5PA 4C80A 2R61A 2JXXA 2LZ6A 4ARIA 3AECB 1Y56A 2EKEC 1WGRA 4GMVA 3P63A 3IG3A 1XLPA 1HTQA 1OQQA 3I57A 4RH6A 1MPEA 1SIJA 4JPSA 2G1EA 4FJZA 1WX9A 3NY5A 5T8IA 3AE7B 5DPSA 2MJDA 3O65B 4AUQC 1P3QU 3TL5A 1TKEA 1JCKB 1SXTA 1FNVA 4IDIA 1LXDA 3MC8A 3A33B 1LM8B 4RF1A 1QOAA 2KJRA 2NBUA 1CQVA 4C7YA 4RF0A 1WJNA 2O2VB 1E10A 1FXAA 1LFDA 4EZLA 1EF1A 2K3UA 3OG5A 2DBYA 3NZUA 1E8ZA 3VR9B 5D6JB 3LYYA 2CHZA 3U4EG 4IWQA 4KZCA 2MLBA 1WMHA 5DCNA 3DWMA 3P2BA 4US8A 1OQYA 4XDDA 2M0AA 2L52A 1R4NI 2K1FA 4XDCA 3PRMB 2NTSA 4OZCA 2FAZA 1WY8A 4DXAB 2ZNVC 1XT9B 2KN4A 5FKAC 1WF9A 2YEPF 3DVGY 3KQ4A 2L05A 2JQRB 3AEBB 2V1YA 3ALBA 4GU2A 2PIAA 4MGYE 3QAQA 4CYEA 2Y5BB 4LNKA 1PFDA 3FC4A 4JLCA 3CSTA 4A20A 2EMTA 3TEWA 2KTFA 4W9JA 1WGKA 2IDYA 1C76A 1V1PB 2RPVA 2BS4B 3DVNU 1GUAB 4KGTA 4DQOC 1VR9A 3SDLC 2Y3AA 3VHTC 3BINA 2JUOA 3V60A 4A3PA 2HTHA 5GMVA 2JZZA 3AI5A 2MBBB 5LXHA 4M0WA 4XYCA 4ZRPA 3W5VB 4M8MA 3T8MA 3P42A 4EZJA 1ZW7A 2UU7A 4A6QA 2ICIA 4XX5A 2N0SB 2K25A 4ACFA 4G3XB 1OEYA 1WR6E 4DBGA 3U7ZA 3VQIA 2R2QA 4P16A 5EE0A 3DPDA 1WI0A 3APCA 4RGTA 3C8YA 1YNTE 3WA0A 2UWQA 4AOFA 2MX2A 3QARA 3C0RB 2IO1B 2KDMA 4FA6A 1FRRA 4KSLC 1I4QA 5E6JA 2JZ3B 3AE1B 4NZLB 3HUIA 4IC7B 1NYRA 3ZIMA 4JX1C 1M4VA 1ZKHA 4A9AA 4FHKA 2D3BA 4AQ7A 5IKCM 1MFWA 3H8HA 4WH4A 1YN3A 2KK8A 3PREA 4GLSC 1EWYC 2MW5A 2L76A 5DPTA 1L7YA 3GOEA 3ZDTA 2GBRA 1G6JA 4A90A 2Z59B 1FFVA 1YX5B 4TQ0A 1LGRA 1K52A 3IBEA 5IAAC 3QX1A 4NAMA 1V6EA 5HFYA 2X8XX 1EU4A 3IXSA 5AUIA 2N9EB 1WM3A 1YQBA 3PPAA 2MBQA 2FCMA 1NI3A 1KTKA 1D6EC 4OHJA 2LVQA 1UUPA 4OW0A 3ZNHB 3MC9A 1TS3A 2W54A 3B2GA 2XNAC 2LUEA 1V9JA 3BZDB 4ZYNA 5G5HA 2LXCA 2KHWB 3DQVA 4HDQA 5C23A 1WIAA 3VH4B 5CTRC 3RUIB 4LK0M 1HZ6A 2WDTB 4HJGE 2LVPA 4LJOB 3IT4B 2INNE 2JSVX 1V97A 3Q3MC 1D4BA 1UBQA 2D3CA 2IY1B 4IM3A 1E8XA 3QQ8B 4NQLB 4KZ0A 4MEMA 1SE4A 2J0MA 1D5XC 5G5GA 4B95A 2LRUA 1HA5A 3T3NA 2E3TA 1Q10A 1ET9A 2LGDA 4W9LA 4HCNB 3QHTA 4RGOS 2KO3A 3EECA 4KIKB 3SU8X 4K3CA 4DDID 5I4DA 3E9SA 1S3SG 4W9CA 2LHDA 2J7QB 1TY0A 3QA8A 2ZCCA 3PLVA 2K8CA 1UWMA 1CJEA 2PE9A 3JW0X 4EUTA 3URYA 2INDC 4YL8A 1UELA 2GOWA 3NZSA 4WQMA 2LFIA 1PGAA 4HJKA 3BK2A 3FILB 3SD5A 3QCAA 3MP9A 2IBIB 3A9JB 4PS7A 1IP9A 3PHWB 2J0KA 2JX5A 2OJWA 5C3JB 2JRIB 4OVVA 4S0RA 4JWUC 3BVZA 2KT7A 4KGSA 3N3KB 3KWVA 3JSVB 1XF5L 1ISNA 2V4IB 4NY0A 1EM7A 1WYGA 3M62B 1OQRA 2KYWA 2NBWB 2LGIA 3TUOA 3N1YC 3RT3B 1SGHA 2IGDA 1N63A 5D7GA 1F77A 2ONQA 1ZDXA 4YTNB 1TS5A 3VAWA 2WXJA 4N58A 2DWQA 3VFKA 2LGXA 2V3NA 5TR5A 2L0TA 3RNCC 3KWLA 1K51A 5D94A 1XLOA 2I2YA 2FCSA 3AULA 4DHJB 5AZGA 3RYTA 4WJPA 4P1BC 2KDFB 2QEJC 4OZAA 1VZ6A 1NI2A 4IOIE 3TEYA 4WAAA 1N5WA 2JY6A 3PO0A 3K9OB 4GXBA 3APDA 3NZ3A 4OZBA 1J8CA 3R7RA 2CR5A 3AEAB 2GBKA 4MSMB 4RNAA 2K6DB 1Q1OA 1S1QB 3T3OA 4KVGB 3L17A 4IKGA 2IZVB 2MEKA 5L83A 1PYWD 3H9DA 4HRSA 3AMZA 2JWUA 2KQSA 4L1BA 3ZUNA 3U2SC 3PV1A 3UF8A 1KRHA 3IAM1 1XQQA 1HXYD 4ANUA 1J0GA 2W3SA 4LNFA 1L0XB 3TBLD 1F2RI 4USAA 1RAXA 4P1CC 4G11A 4NAWB 3P4PB 4YXDB 2MCNB 3VTVA 4W9FA 1T3QA 1ACCA 3HK0A 2VH1A 4NNJB 1I4PA 2JPHA 4B9KA 3OLMD 3W1YA 2L83A 1WJ4A 4DK5A 2BYEA 3Q3FA 3ZRFA 3DBSA 2WXIA 2KWUB 2GB1A 5JHBA 2D5GA 2WXKA 2VZKB 1P1AA 1TKYA 4GDLA 3FKYA 3U52E 2KX0A 3X23A 2G9HD 2IJ0A 4AJWA 3A1QA 3AE2B 3NVWA 1GJZA 3A9KA 2V0GA 2M0XA 1L4DB 5EE9A 3ZJTA 3E56A 1QQRA 2ZJDA 1K53A 3V6CB 2LEKA 1WJUA 2N7JA 1Y8RC 2XN9C 3R2TA 3ZXRA 3CWIA 4DHZB 1JWBD 2BTEA 2MRPA 3RMKC 4HKZE 4HKQA 4B0EA 2BKRB 3IT6B 3WAOA 2IYDB 2L7RA 2RGFA 2AYOB 2QSDA 2BS3B 2KX3A 2IO0B 4C7ZA 1FCCC 4N59A 1E6EB 3AU5A 3H7PA 4MJSB 4LTUA 4RM8A 2DYOA 2LUMA 2A4ZA 1ESFA 1JRUA 3Q8BA 1X1MA 2BF8B 4WWMA 2G4DB 4BZAA 4KKIA 5JHAA 4C00A 3P1MA 2DYMA 1KLVA 2IGHA 3GE8C 1NEKB 3TEZA 4HK2A 1PGBA 3H6NA 2BYTA 5EE1A 1MI0A 2LI5A 1AARA 4ICVA 1ZDVA 3VRAB 2INCC 4KDIC 5JZEB 4K7UA 1BMLC 4CQNA 2OEDA 3DDCB 3PZ7A 1TBEA 2QJLA 1GAQB 1E5WA 4II3B 4TKNA 4K3BA 3VXWA 2KVRA 3B9JA 2MWSB 4EEWA 2BW2A 3JYUA 2LXAA 3UQBA 2KWDA 3MFGA 3AEDB 1C9FA 2AX5A 4HVBA 1ZE3D 3N32A 3U7DA 1A5RA 2LJIA 2FIDA 2LRWA 1DYQA 1Q0WB 3DVNV 1I42A 5C1ZA 2NPTB 2KTRA 3TIXA 2ON8A 3GZNB 4YWGG 3Q69A 2M8SA 2PJHA 1WGGA 3P4RB 1I4RA 1H8CA 3PRPB 5DPWA 4BVUC 3PZDA 1XCTL 3PHXB 5BYRA 1NYQA 2DZMA 4ZRKA 3AE5B 3AU4A 2KFKB 2KDIA 1FXIA 3CF6E 4WAFA 2LVOA 2KMMA 1TZ1A 3BWUD 2WX0A 3I3TB 3ZTCA 3DHIC 1SEBD 4O1NA 1N60A 1UD7A 1L6VA 3AH7A 2EKIA 2WNMA 1UBIA 3WCQA 2L0FA 3VR8B 4KKJA 3ZNGC 3DBHB 4PT5A 1VD2A 3TSSA 1N5XA 2KXJA 1I4HA 3DBHI 4KV2A 2O6VA 2Z8LA 4URKA 4MDKE 2CHWA 3ZKJC 1QF6A 1FXTB 4IWPA 4I6NB 2M17A 5HHDG 3RNAC 2PMVA 2D2QA 4GN1A 1JMLA 1AWDA 3N20C 2C7MB 1QLBB 5FR6A 2ZNVB 4MM3A 1L6UA 1YN5A 4AS1A 4MSQB 5CHFA 2BKFA 2REXA 4DWFA 2V3PA 3TEXA 3UIOB 4KGRA 1JWMD 3VTUA 3LDZE 3Q8FA 2KDEB 4ARCA 1PDXA 4ZHPA 3M63B 2MH7A 1T0QC 3NUHB 5BMHA 5J2RA 1C79A 5D3IB 2JXTA 2QHOA 5H8YE 2X38A 1WMHB 1E7VA 5J18A 4RCOA 5G2NA 2RMMA 3BIID 4ZHOA 1E90A 4DHJD 2KOXA 4OVUA 2N9PC 4PS8A 2DZIA 2N1VA 1SB3C 2INPE 3Q6BA 3HHMA 4BKTA 3H7SA 2HDEA 4ZOHC 3NS8A 4WURA 3Q8CA 4AWJA 3R8BA 2K39A 4ASWC 4N6EB 2EMSA 2KMAA 2WU2B 1L0VB 2WX1A 2QMTA 2MP2A 1OEYJ 2LASA 2MBHA 1L0YB 2SAKA 1XCQL 2D3AA 2QDFA 1E8WA 1OGWA 1Q5WB 4IM2A 1FRDA 3NOBA 4FBJB 1HEZE 1KH0A 2KANA 3OWEB 2AL3A 4K81A 1SJED 4HPPA 1MG8A 2KACA 4WJOA 2BB6A 4M0WB 3VVWB 3LJ3A 4CHKA 3UINB 4EOYA 1J7AA 2JU6X 1UGJA 4HCPB 2OHFA 1WFYA 1TKGA 3WAMA 1SJHD 4PK1A 3NRZA 2XEWA 1EUVB 2RDGA 3L13A 4GDKA 3RULA 3EFUA 3B1LX 3ONSA 2WU5B 3ENEA 2VZKD 4TSSA 1MVKA 3W1SC 2CHXA 2WXHA 2W82A 2IGGA 1KJTA 2H89B 1YJIA 3LB8C 2DLBA 4W9DA 4JE3B 1JROA 1KFYB 1WJ6A 2I1KA 3VUXA 2KWCA 3I5JC 2LJ5A 1WZ0A 1VLBA 3M3JA 3PT2B 3HM6X 4BKSD 3DBRB 2NMQA 3NVYA 4RGNA 3H1UA 4X57B 4EKUA 3T9LA 1D3ZA 2J0JA 2RSUA 3ZJUA 2KQ4X 2KFJA 3DHGC 4F1SA 3A4SC 2FE8A 4YT0B 2WXMA 1SBBB 3ZGZA 3APFA 4J6IA 1A70A 4WIPA 2AWTA 1RFKA 3KUDB 2FBWB 2J42A 2K0PA 3EC8A 1NBFC 1TT5B 3B2FA 1F9JA 2K6QA 1GB1A 3PVLA 2FCNA 1EF5A 4P6VF 3BVMA 2KLCA 3SFEB 1EWCA 2A5UA 1VZ7A 2K8BA 2WGSA 3CSFA 3DHHC 4MGIE 1C4PA 1TJEA 4HEA1 1DOIA 3ETRA 2Y5PA 1FCLA 3KW5B 3WIMA 1CMXB 4L2YA 1JW9D 4OVZA 3VH3B 1V8CA 1WXAA 2QIEB 3CMMB 2BPSA 1SE3A 4W9HA 4MH0E 1E7UA 1KLGD 2PW9A 5E6OA 2ZVOA 2MBEA 5E6NA 3PZ8A 3W2DA 1ZP0B 3KVFB 2BWFA 3RCZA 3KUZA 2G45B 3PLUA 1I35A 1ROEA 2KMCA 3AN1A 3CIRB 3GB1A 2EELA 1C77A 4EE2A 1PQSA 3WANA 4A3OA 4WJNA 1GPXA 1FM0D 1RWSA 5BYQA 1VCBA 1ZGUB 1HZ5A 1C4CA 1LO5D 3VDZA 2WXQA 3EFCA 4TQ1A 1E8YA 1ZPSA 3AE8B 2N9KA 4E71A 4YSXB 2XK5A 4Q2JA 3ZNID 2HJ8A 1SE2A 1TS2A 4ANWA 1IGDA 2BB5A 2I38A 3V05A 2CS4A 1F2RC 4E3CA 1XEEA 1F1HA 3AV8A 1SIFA 1VRAB 1GNUA 1UGMA 1V1OA 3OJ4B 2D07B 4B0MA 4NJCA 1YOVB 1C4AA 2ZPNA 3EA6A 5HG2A 2WS3B 3QIJA 3HM3A 4C4VA 3ZW3A 1CK1A 3A4RA 5D3DA 3DOWA 5JH5C 1T6BX 1WM2A 2DAFA 2KNBA 1KF6B 4DDGD 1WX8A 2GI9A 3PSEB 1WXSA 3BYYB 5LLIA 2AQ3B 3R3MA 1RYJA 3P4QB 1E7PB 1ZOYB 1FNWA 2KZRA 4MGKE 1QOGA 1PUTA 3Q3OC 2RDHA 3VRBB 2WDVB 4LNOA 3O13A 3DBLB 4XGAB 4XWWA 2ZCBA 4BOZB 3DBLI 1WGDA 1AW7A 1YD8U 1D5ZC 1OTRB 3Q3NC 3NVVA 2C7HA 3GE3C 3QJZA 2AL6A 3V3XA 1PGXA 4IUMB 1YMHE 1T0RC 5AZFA 3BVGA 4REZA 4J3OD 1XD3B 2ZVNA 4NPNA 4WWPA 4II2B 2PPHA 1FIQA 4F7ZA 2HJ1A 4WQOB 5AEKB 4WWNA 1J19A 4FULA 3ZYYX 2CU1A 3AXCA 4ZDVA 1QKZA 3AEFB 4TMAB 3AM9A 3ECIA 3RZWC 2JZPA 2WLBA 2VH2A 3J9CA 4QAYA 2WXPA 2RPQA 2WDQB 2KJ6A 2O2VA 1R4MB 1NDDA 1WGHA 1T0SC 1R4MI 2N4FA 2L8JA 1DOYA 5AZHA 3QC8B 2KD0A 2BWES 2J53A 3NHEB 2K22A 1F52A 1TYGB 4KDLB 2HD5B 2JF5A 2KAJA 3RNGC 1ENFA 1FPYA 1T0YA 3IVFA 2QC8A 4GGQA 4W9EA 2MA9B 2JWZA 2QCZA 4PYUA 1LQBA 1KLUD 3BY4B 5BMGA 4GIVA 4TV3A 2N1WA 3AEEB 3ZTDA 1NVID 1FFUA 4KSKC 3B0AA 4I6PA 3I63C 3V61A 2C5LC 2Z0EB 4IWOA 4W9IA 3S2AA 3JVZX 4A55A 1STEA 1WX7A 5D2MB 3NJTA 4GDLB 4ANXA 4M02A 4HPMB 2AQ2B 2JRHA 1V1PA 2BS2B 3ML8A 3A1QB 2WXFA 5HKHA 3A9KB 1JRPA 2N9XA 2D3GA 4BFRA 4HDOA 3NS1A 2NCNA 3ZQ4A 1NENB 2L32A 1MJDA 1OFFA 3GP7A 5BO4B 4JIOU 5HI1A 4LCDE 3MTNB 3N1ZC 2DZKA 4HWIB 2G3QB 2W55A 2C9WB 3RFZB 3GZNI 2PE6B 4YTMB 3PS6A 2KC2A 2PTLA 2TSSA 2BVCA 2XBBC 5L95C 3EUB2 3C19A 2ACZB 1V80A 3DCGA 3KUCB 1CZPA 3N9YC 2L1AA 2NBVB 3H7PB 4BOSC 1C78A 3AE3B 4XC2A 2MHJA 3HRDD 2W3RA 3L54A 5KHQA 1R4NB 3X0WA 1P98A 4I6LB 2C60A 2MJEA 2N9LA 4IM0A 3ZLZA 1K50A 4K7WA 3KH0A 4A8XC 4LDTB 1KOTA 5E6PA 1EO6A 4N9F4 2WYQA 1V81A 4ZRQA 3R7QA 3AE4B 4AP4C 1P0RA 3MHZA 3N1XC 4DXFA 1WE6A 4MH8A 1HTOA 2KVZA 4FXCA 2FNJB 5LXIB 3SR6A 2LD9A 2IO3B 3I9V1 2ZZPB 1ZXHA 4FJYA 1B9RA 2JYEA 2NS5A 3RD2A 1WE7A 4JGHB
chains in the Genus database with same CATH topology
3K9OB 4GXBA 3APDA 2B3AA 2O6VD 1J8CA 1KJTA 1Z5SB 3R7RA 2CR5A 2OJRA 3RZFA 2GBKA 4W9DA 4MSMB 1V5OA 3MJWA 2G4SA 2K6DB 1Q1OA 1S1QB 3UQAA 4KVGB 3L17A 2K8HA 1WJ6A 2I1KA 2IZVB 2KC1A 3VUXA 2KWCA 1P9DU 2LJ5A 5L83A 2WWZA 3M95A 2M4NA 3H9DA 1WZ0A 3M3JA 3PT2B 1WH3A 2JVCA 3HM6X 3L08A 2KTRB 3ZDMC 4BKSD 2YLMA 2KQSA 1WGYA 3H1UA 4X57B 3ZUNA 1TTNA 1WXMA 3PV1A 3UF8A 4EFOA 4EKUA 3T9LA 1D3ZA 4HLEA 5CX3A 2JXXA 4ZRIA 2J0JA 1XQQA 2LZ6A 2RSUA 4ANUA 4XZ4A 4MELA 2ZPYA 1J0GA 2KFJA 2ASQA 4GOCA 2EKEC 1WGRA 2RR9A 4GMVA 5CHVC 4F1SA 3A4SC 3TBLD 3IG3A 4ICUA 2N7DA 1RAXA 4G11A 4NAWB 3APFA 4J6IA 1YJ1A 4FJZA 2MCNB 1WX9A 2AWTA 3NY5A 4W9FA 3VTVA 3KUDB 1WZ3A 1YIWA 5DPSA 3O65B 4AUQC 1P3QU 3HK0A 3EC8A 4NNJB 3TL5A 4K7SA 1NBFC 1QZEA 2JPHA 1F9JA 2K6QA 4B9KA 1LXDA 2BGFA 3PVLA 3OLMD 5G55A 3W1YA 4DK5A 1WJ4A 4NJ7A 2BYEA 2GBJA 3Q3FA 2FCNA 1EF5A 3A33B 1K8RB 3ZRFA 4PYZA 3R66C 1LM8B 3DBSA 2KLCA 1V2YA 2KWUB 2A5UA 5JHBA 2V3SA 2K8BA 2VRRB 4KIKA 3IHPC 3CSFA 2KJRA 3ML9A 2NBUA 1P1AA 4MGIE 1WJNA 2O2VB 2HE7A 3W1SA 4GDLA 3VUWA 2O6VB 1LFDA 4EZLA 1EF1A 2KX0A 2M1MA 2DX5B 3NZUA 3X23A 3KW5B 3WIMA 1E8ZA 1CMXB 3ZNZB 5D6JB 2L3ZA 3VH3B 4AJWA 1WXAA 2CHZA 3CMMB 2MQJA 2BPSA 3A1QA 4B6WA 2L00B 4IWQA 4KZCA 3A9KA 4W9HA 4MH0E 1GJZA 1E7UA 2MLBA 1WMHA 2M0XA 5DCNA 3P2BA 5E6OA 2ZVOA 1OQYA 2MBEA 3UGBB 5E6NA 2ZJDA 1V5TA 1R4NI 4M8NA 1V86A 2K1FA 3KVFB 2BWFA 3RCZA 3V6CB 1V49A 3KUZA 5DPRA 2G45B 1WJUA 3PLUA 1I35A 1Y8RC 3PRMB 2KMCA 2FAZA 3ZO5B 1WY8A 3A9JA 4DXAB 2ZNVC 1PQSA 2JT4B 1XT9B 2ZEQA 3WANA 1WF9A 2DZJA 4A3OA 4DHZB 3OAWA 4WJNA 2MRPA 2OOBB 3DVGY 1UH6A 5CHWA 2L05A 2DENB 2BKRB 1VCBA 2V1YA 1ZGUB 3WAOA 3ALBA 4GU2A 2IYDB 2L7RA 4MGYE 2I1JA 2RGFA 3QAQA 3VDZA 4CYEA 4TQ1A 2AYOB 1E8YA 2Y5BB 3JSVA 4CO7A 1BT0A 2KX3A 4E71A 2IO0B 4JLCA 2KDBA 2XK5A 4W9KA 4P7IA 3CSTA 4A20A 3ZNID 2EMTA 3AU5A 2GMIC 2KTFA 2HJ8A 3H7PA 4MJSB 2FIFA 4W9JA 4RM8A 2DYOA 2A4ZA 1JRUA 4ANWA 3DVNU 1GUAB 1X1MA 2BF8B 2CS4A 3B08A 4FADA 2G4DB 3SDLC 2BYFA 3VHTC 3BINA 4E3CA 5JHAA 4K1RB 1IPGA 2JUOA 4NJ6A 2DYMA 3V60A 4A3PA 1KLVA 2HTHA 5GMVA 2JZZA 1IYFA 2FCQA 3TMPB 3AI5A 1GG3A 2MBBB 5LXHA 1SIFA 4HK2A 1GNUA 1UGMA 2KWVB 3OJ4B 5KHOA 4BVUC 3H6NA 2D07B 2ZPNA 3DBRI 2GBMA 3U8ZA 2LI5A 4M8MA 3T8MA 1AARA 1U4AA 2RD0A 3QIJA 3HM3A 4ICVA 3ZW3A 4EZJA 3L10B 4KDIC 1WRDB 1ZW7A 3A4RA 5JZEB 3KYDD 4IG7B 4K7UA 3DOWA 2CKHB 5JH5C 3TCAA 3DDCB 3U30A 4XX5A 2K25A 1TBEA 4G3XB 1E5WA 1OEYA 1WR1A 1WR6E 1WM2A 4II3B 4TKNA 3VXWA 2KVRA 4DBGA 4FHJA 3VQIA 2R2QA 2MWSB 3DPDA 2DAFA 4EEWA 1WI0A 2KNBA 2GBNA 2MP2B 3APCA 4PS3A 3JYUA 4DDGD 2LXAA 1WX8A 3WA0A 4E74A 2UWQA 3UQBA 3PSEB 1WXSA 2UYZB 4AOFA 2MX2A 4RM9A 3QARA 5LLIA 4AJYB 4HVBA 3R3MA 1C1YB 3C0RB 2IO1B 4FA6A 3N32A 4HXDA 3U7DA 1A5RA 2KZRA 4MGKE 2FIDA 4KSLC 2JZ3B 2LRWA 2DYBA 4DHZE 4IC7B 3L0WB 3ZIMA 1Q0WB 1Z2MA 3DVNV 1I42A 5C1ZA 2NPTB 2KTRA 2ZCBA 3TIXA 4BOZB 1KM7A 1ZKHA 4FHKA 3UIPB 3DBLI 1WGDA 1YD8U 2M8SA 2PJHA 1WGGA 2KK8A 1OTRB 3PGEA 3PREA 1H8CA 3PRPB 2MW5A 5DPWA 2L76A 5DPTA 1L7YA 2C7HA 3GOEA 3PZDA 2AL6A 2IY0B 2PEAA 3QJZA 3ZDTA 4IUMB 2GBRA 3PHXB 1G6JA 2Z59B 2DZMA 4ZRKA 5AZFA 1YX5B 2KFKB 3AU4A 1UZXB 4TQ0A 2KDIA 3CF6E 3KYCD 1XD3B 2LVOA 2ZVNA 4NPNA 3IBEA 4WWPA 5IAAC 3QX1A 3VTWA 4GDKB 1TZ1A 4II2B 5IA7A 1V6EA 2PPHA 4NAWA 2WX0A 3I3TB 4F7ZA 3ZTCA 4BKGA 4WQOB 2NVUI 3N30A 5AEKB 2LGYA 4WWNA 2N9EB 1WM3A 1YQBA 3PPAA 1J19A 4FULA 2MBQA 1UD7A 2CU1A 2D11A 3AXCA 4ZDVA 2FCMA 2LVQA 3ECIA 3RZWC 1UBIA 3ZNHB 2L0FA 4F8CB 1YX6B 2FUHB 3ZNGC 2LUEA 1V9JA 2RPQA 1VD2A 3OJ3A 4ZYNA 2KXJA 2KJ6A 2O2VA 3DBHI 1NDDA 1WGHA 2LXCA 2KQ7A 2KHWB 3DQVA 4KV2A 2O6VA 4HDQA 2BYVE 1SE9A 1WIAA 5C23A 4URKA 4MDKE 1R4MI 2N4FA 2L8JA 3VH4B 2MBOA 4MGZE 5CTRC 2CHWA 3ZKJC 3RUIB 1RLFA 5AZHA 3QC8B 2KD0A 2BWES 4BBNF 3EHVA 2WDTB 1FXTB 3NHEB 3VUYA 4IWPA 2LVPA 4I6NB 4LJOB 4KDLB 2HD5B 2M17A 3WALA 3L16A 3ZRCA 2JF5A 3Q3JA 4WJQA 1UBQA 3V62A 1T0YA 3IVFA 4BKSA 2IY1B 1RFAA 4IM3A 2R2OA 2D2QA 1E8XA 4GN1A 3PRZA 3QQ8B 4GGQA 4W9EA 2MA9B 4NQLB 2C7MB 4KZ0A 4MEMA 2JWZA 4PYUA 2J0MA 5FR6A 1LQBA 5EDSA 2MSED 2ZNVB 3BY4B 4MM3A 4B95A 2LRUA 4GIVA 4TV3A 2N1WA 3ZTDA 4MSQB 5CHFA 4KSKC 3B0AA 4I6PA 2BKFA 2REXA 3V61A 2C5LC 2D10A 2Z0EB 3WAPA 4DWFA 3UIOB 2LGDA 4IWOA 4W9LA 1WYWB 4W9IA 3S2AA 4HCNB 3QHTA 3VTUA 2KO3A 3JVZX 1TGZB 3LDZE 4LJPB 3EECA 2KDEB 1WX7A 4KIKB 3SU8X 5D2MB 3M63B 5J17A 3ZVVA 4DDID 4GDLB 4ANXA 1S3SG 4TUUA 5J2RA 4W9CA 3TJPA 4GSWA 2J7QB 3D32A 3QWZB 4MJSA 2QHOA 3QA8A 4HPMB 2ZCCA 3PLVA 4WWOA 2K8CA 2PE9A 2JRHA 3ML8A 3JW0X 4GB9A 3A1QB 4LDTD 5HKHA 4EUTA 3A9KB 1RRBA 2N9XA 2NR2A 2D3GA 4BFRA 1WMHB 1E7VA 4HDOA 5J18A 4HPLB 5G2NA 1E90A 4YL8A 1UELA 2NCNA 3HIZA 4DHJD 2GOWA 3NZSA 4ANVA 2KOXA 4NQKE 1GC7A 4OVUA 4HJKA 2N9PC 3QCAA 5BO4B 2DAJA 4PS8A 3SD5A 2DZIA 2N1VA 4JL9A 2IBIB 4JIOU 4LCDE 3MTNB 3SHQA 2DZKA 3HHMA 3A9JB 4HWIB 4PS7A 2G3QB 4BKTA 1IP9A 2C9WB 3GZNI 3PHWB 3H7SA 2PE6B 2J0KA 2LWPA 3NS8A 2JRIB 3K9PB 4OVVA 3PS6A 2KC2A 4AWJA 2K39A 2XBBC 4ASWC 5L95C 3IFWB 3N3KB 2EMSA 3MHSD 4G0NB 2KMAA 1L2NA 1V80A 3DCGA 2WX1A 3JSVB 2YVCA 3KUCB 1ISNA 2MP2A 2XK5B 1OEYJ 4BBNC 2NBVB 4FLHA 4NY0A 3H7PB 2IO2B 4BOSC 2LASA 2KLGA 2MBHA 3M62B 4FN2A 1HE8A 4XC2A 1E8WA 1OGWA 1Q5WB 3L54A 2NBWB 2W9NA 3DVGX 4IM2A 5KHQA 3RT3B 1H4RA 1M94A 1SGHA 3NOBA 3X0WA 1P98A 4FBJB 1GC6A 5D7GA 2KJHB 4G50A 2KANA 2C60A 4I6LB 2AEHA 2AL3A 2C7NB 2NPTA 4IM0A 4IW0A 4K81A 3VAWA 3ZLZA 4EZKA 1MG8A 4WJOA 4M0WB 3VVWB 3LJ3A 3VFKA 4CHKA 2LGXA 4K7WA 4FJVB 4W9GA 3KH0A 3UINB 4EOYA 5TR5A 2L0TA 4LDTB 4RMAA 4JQWC 1KOTA 2N7EA 2KN5A 5E6PA 1EO6A 1WXVA 4HCPB 4N9F4 2WYQA 3QK0A 1V81A 5D94A 1WFYA 3R7QA 2FCSA 3WAMA 3AULA 4AP4C 1P0RA 4DHJB 1WE6A 2KFKA 2XEWA 1EUVB 4ZRJA 2V4LA 5AZGA 3L13A 3RYTA 2KKCA 4WJPA 4GDKA 2FNJB 2KDFB 3RULA 1C3TA 3V6EB 5LXIB 3EFUA 2LD9A 2IO3B 1NI2A 2DHZA 3B1LX 3ONSA 2Z0DB 2ZZPB 3ENEA 4FJYA 2NS5A 4WAAA 3W1SC 2CHXA 2JY6A 3PTFC 3RD2A 1WE7A 4JGHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O B;  4GXB A;  3APD A;  2B3A A;  2O6V D;  1J8C A;  1KJT A;  1Z5S B;  3R7R A;  2CR5 A;  2OJR A;  3RZF A;  2GBK A;  4W9D A;  4MSM B;  1V5O A;  3MJW A;  2G4S A;  2K6D B;  1Q1O A;  1S1Q B;  3UQA A;  4KVG B;  3L17 A;  2K8H A;  1WJ6 A;  2I1K A;  2IZV B;  2KC1 A;  3VUX A;  2KWC A;  1P9D U;  2LJ5 A;  5L83 A;  2WWZ A;  3M95 A;  2M4N A;  3H9D A;  1WZ0 A;  3M3J A;  3PT2 B;  1WH3 A;  2JVC A;  3HM6 X;  3L08 A;  2KTR B;  3ZDM C;  4BKS D;  2YLM A;  2KQS A;  1WGY A;  3H1U A;  4X57 B;  3ZUN A;  1TTN A;  1WXM A;  3PV1 A;  3UF8 A;  4EFO A;  4EKU A;  3T9L A;  1D3Z A;  4HLE A;  5CX3 A;  2JXX A;  4ZRI A;  2J0J A;  1XQQ A;  2LZ6 A;  2RSU A;  4ANU A;  4XZ4 A;  4MEL A;  2ZPY A;  1J0G A;  2KFJ A;  2ASQ A;  4GOC A;  2EKE C;  1WGR A;  2RR9 A;  4GMV A;  5CHV C;  4F1S A;  3A4S C;  3TBL D;  3IG3 A;  4ICU A;  2N7D A;  1RAX A;  4G11 A;  4NAW B;  3APF A;  4J6I A;  1YJ1 A;  4FJZ A;  2MCN B;  1WX9 A;  2AWT A;  3NY5 A;  4W9F A;  3VTV A;  3KUD B;  1WZ3 A;  1YIW A;  5DPS A;  3O65 B;  4AUQ C;  1P3Q U;  3HK0 A;  3EC8 A;  4NNJ B;  3TL5 A;  4K7S A;  1NBF C;  1QZE A;  2JPH A;  1F9J A;  2K6Q A;  4B9K A;  1LXD A;  2BGF A;  3PVL A;  3OLM D;  5G55 A;  3W1Y A;  4DK5 A;  1WJ4 A;  4NJ7 A;  2BYE A;  2GBJ A;  3Q3F A;  2FCN A;  1EF5 A;  3A33 B;  1K8R B;  3ZRF A;  4PYZ A;  3R66 C;  1LM8 B;  3DBS A;  2KLC A;  1V2Y A;  2KWU B;  2A5U A;  5JHB A;  2V3S A;  2K8B A;  2VRR B;  4KIK A;  3IHP C;  3CSF A;  2KJR A;  3ML9 A;  2NBU A;  1P1A A;  4MGI E;  1WJN A;  2O2V B;  2HE7 A;  3W1S A;  4GDL A;  3VUW A;  2O6V B;  1LFD A;  4EZL A;  1EF1 A;  2KX0 A;  2M1M A;  2DX5 B;  3NZU A;  3X23 A;  3KW5 B;  3WIM A;  1E8Z A;  1CMX B;  3ZNZ B;  5D6J B;  2L3Z A;  3VH3 B;  4AJW A;  1WXA A;  2CHZ A;  3CMM B;  2MQJ A;  2BPS A;  3A1Q A;  4B6W A;  2L00 B;  4IWQ A;  4KZC A;  3A9K A;  4W9H A;  4MH0 E;  1GJZ A;  1E7U A;  2MLB A;  1WMH A;  2M0X A;  5DCN A;  3P2B A;  5E6O A;  2ZVO A;  1OQY A;  2MBE A;  3UGB B;  5E6N A;  2ZJD A;  1V5T A;  1R4N I;  4M8N A;  1V86 A;  2K1F A;  3KVF B;  2BWF A;  3RCZ A;  3V6C B;  1V49 A;  3KUZ A;  5DPR A;  2G45 B;  1WJU A;  3PLU A;  1I35 A;  1Y8R C;  3PRM B;  2KMC A;  2FAZ A;  3ZO5 B;  1WY8 A;  3A9J A;  4DXA B;  2ZNV C;  1PQS A;  2JT4 B;  1XT9 B;  2ZEQ A;  3WAN A;  1WF9 A;  2DZJ A;  4A3O A;  4DHZ B;  3OAW A;  4WJN A;  2MRP A;  2OOB B;  3DVG Y;  1UH6 A;  5CHW A;  2L05 A;  2DEN B;  2BKR B;  1VCB A;  2V1Y A;  1ZGU B;  3WAO A;  3ALB A;  4GU2 A;  2IYD B;  2L7R A;  4MGY E;  2I1J A;  2RGF A;  3QAQ A;  3VDZ A;  4CYE A;  4TQ1 A;  2AYO B;  1E8Y A;  2Y5B B;  3JSV A;  4CO7 A;  1BT0 A;  2KX3 A;  4E71 A;  2IO0 B;  4JLC A;  2KDB A;  2XK5 A;  4W9K A;  4P7I A;  3CST A;  4A20 A;  3ZNI D;  2EMT A;  3AU5 A;  2GMI C;  2KTF A;  2HJ8 A;  3H7P A;  4MJS B;  2FIF A;  4W9J A;  4RM8 A;  2DYO A;  2A4Z A;  1JRU A;  4ANW A;  3DVN U;  1GUA B;  1X1M A;  2BF8 B;  2CS4 A;  3B08 A;  4FAD A;  2G4D B;  3SDL C;  2BYF A;  3VHT C;  3BIN A;  4E3C A;  5JHA A;  4K1R B;  1IPG A;  2JUO A;  4NJ6 A;  2DYM A;  3V60 A;  4A3P A;  1KLV A;  2HTH A;  5GMV A;  2JZZ A;  1IYF A;  2FCQ A;  3TMP B;  3AI5 A;  1GG3 A;  2MBB B;  5LXH A;  1SIF A;  4HK2 A;  1GNU A;  1UGM A;  2KWV B;  3OJ4 B;  5KHO A;  4BVU C;  3H6N A;  2D07 B;  2ZPN A;  3DBR I;  2GBM A;  3U8Z A;  2LI5 A;  4M8M A;  3T8M A;  1AAR A;  1U4A A;  2RD0 A;  3QIJ A;  3HM3 A;  4ICV A;  3ZW3 A;  4EZJ A;  3L10 B;  4KDI C;  1WRD B;  1ZW7 A;  3A4R A;  5JZE B;  3KYD D;  4IG7 B;  4K7U A;  3DOW A;  2CKH B;  5JH5 C;  3TCA A;  3DDC B;  3U30 A;  4XX5 A;  2K25 A;  1TBE A;  4G3X B;  1E5W A;  1OEY A;  1WR1 A;  1WR6 E;  1WM2 A;  4II3 B;  4TKN A;  3VXW A;  2KVR A;  4DBG A;  4FHJ A;  3VQI A;  2R2Q A;  2MWS B;  3DPD A;  2DAF A;  4EEW A;  1WI0 A;  2KNB A;  2GBN A;  2MP2 B;  3APC A;  4PS3 A;  3JYU A;  4DDG D;  2LXA A;  1WX8 A;  3WA0 A;  4E74 A;  2UWQ A;  3UQB A;  3PSE B;  1WXS A;  2UYZ B;  4AOF A;  2MX2 A;  4RM9 A;  3QAR A;  5LLI A;  4AJY B;  4HVB A;  3R3M A;  1C1Y B;  3C0R B;  2IO1 B;  4FA6 A;  3N32 A;  4HXD A;  3U7D A;  1A5R A;  2KZR A;  4MGK E;  2FID A;  4KSL C;  2JZ3 B;  2LRW A;  2DYB A;  4DHZ E;  4IC7 B;  3L0W B;  3ZIM A;  1Q0W B;  1Z2M A;  3DVN V;  1I42 A;  5C1Z A;  2NPT B;  2KTR A;  2ZCB A;  3TIX A;  4BOZ B;  1KM7 A;  1ZKH A;  4FHK A;  3UIP B;  3DBL I;  1WGD A;  1YD8 U;  2M8S A;  2PJH A;  1WGG A;  2KK8 A;  1OTR B;  3PGE A;  3PRE A;  1H8C A;  3PRP B;  2MW5 A;  5DPW A;  2L76 A;  5DPT A;  1L7Y A;  2C7H A;  3GOE A;  3PZD A;  2AL6 A;  2IY0 B;  2PEA A;  3QJZ A;  3ZDT A;  4IUM B;  2GBR A;  3PHX B;  1G6J A;  2Z59 B;  2DZM A;  4ZRK A;  5AZF A;  1YX5 B;  2KFK B;  3AU4 A;  1UZX B;  4TQ0 A;  2KDI A;  3CF6 E;  3KYC D;  1XD3 B;  2LVO A;  2ZVN A;  4NPN A;  3IBE A;  4WWP A;  5IAA C;  3QX1 A;  3VTW A;  4GDK B;  1TZ1 A;  4II2 B;  5IA7 A;  1V6E A;  2PPH A;  4NAW A;  2WX0 A;  3I3T B;  4F7Z A;  3ZTC A;  4BKG A;  4WQO B;  2NVU I;  3N30 A;  5AEK B;  2LGY A;  4WWN A;  2N9E B;  1WM3 A;  1YQB A;  3PPA A;  1J19 A;  4FUL A;  2MBQ A;  1UD7 A;  2CU1 A;  2D11 A;  3AXC A;  4ZDV A;  2FCM A;  2LVQ A;  3ECI A;  3RZW C;  1UBI A;  3ZNH B;  2L0F A;  4F8C B;  1YX6 B;  2FUH B;  3ZNG C;  2LUE A;  1V9J A;  2RPQ A;  1VD2 A;  3OJ3 A;  4ZYN A;  2KXJ A;  2KJ6 A;  2O2V A;  3DBH I;  1NDD A;  1WGH A;  2LXC A;  2KQ7 A;  2KHW B;  3DQV A;  4KV2 A;  2O6V A;  4HDQ A;  2BYV E;  1SE9 A;  1WIA A;  5C23 A;  4URK A;  4MDK E;  1R4M I;  2N4F A;  2L8J A;  3VH4 B;  2MBO A;  4MGZ E;  5CTR C;  2CHW A;  3ZKJ C;  3RUI B;  1RLF A;  5AZH A;  3QC8 B;  2KD0 A;  2BWE S;  4BBN F;  3EHV A;  2WDT B;  1FXT B;  3NHE B;  3VUY A;  4IWP A;  2LVP A;  4I6N B;  4LJO B;  4KDL B;  2HD5 B;  2M17 A;  3WAL A;  3L16 A;  3ZRC A;  2JF5 A;  3Q3J A;  4WJQ A;  1UBQ A;  3V62 A;  1T0Y A;  3IVF A;  4BKS A;  2IY1 B;  1RFA A;  4IM3 A;  2R2O A;  2D2Q A;  1E8X A;  4GN1 A;  3PRZ A;  3QQ8 B;  4GGQ A;  4W9E A;  2MA9 B;  4NQL B;  2C7M B;  4KZ0 A;  4MEM A;  2JWZ A;  4PYU A;  2J0M A;  5FR6 A;  1LQB A;  5EDS A;  2MSE D;  2ZNV B;  3BY4 B;  4MM3 A;  4B95 A;  2LRU A;  4GIV A;  4TV3 A;  2N1W A;  3ZTD A;  4MSQ B;  5CHF A;  4KSK C;  3B0A A;  4I6P A;  2BKF A;  2REX A;  3V61 A;  2C5L C;  2D10 A;  2Z0E B;  3WAP A;  4DWF A;  3UIO B;  2LGD A;  4IWO A;  4W9L A;  1WYW B;  4W9I A;  3S2A A;  4HCN B;  3QHT A;  3VTU A;  2KO3 A;  3JVZ X;  1TGZ B;  3LDZ E;  4LJP B;  3EEC A;  2KDE B;  1WX7 A;  4KIK B;  3SU8 X;  5D2M B;  3M63 B;  5J17 A;  3ZVV A;  4DDI D;  4GDL B;  4ANX A;  1S3S G;  4TUU A;  5J2R A;  4W9C A;  3TJP A;  4GSW A;  2J7Q B;  3D32 A;  3QWZ B;  4MJS A;  2QHO A;  3QA8 A;  4HPM B;  2ZCC A;  3PLV A;  4WWO A;  2K8C A;  2PE9 A;  2JRH A;  3ML8 A;  3JW0 X;  4GB9 A;  3A1Q B;  4LDT D;  5HKH A;  4EUT A;  3A9K B;  1RRB A;  2N9X A;  2NR2 A;  2D3G A;  4BFR A;  1WMH B;  1E7V A;  4HDO A;  5J18 A;  4HPL B;  5G2N A;  1E90 A;  4YL8 A;  1UEL A;  2NCN A;  3HIZ A;  4DHJ D;  2GOW A;  3NZS A;  4ANV A;  2KOX A;  4NQK E;  1GC7 A;  4OVU A;  4HJK A;  2N9P C;  3QCA A;  5BO4 B;  2DAJ A;  4PS8 A;  3SD5 A;  2DZI A;  2N1V A;  4JL9 A;  2IBI B;  4JIO U;  4LCD E;  3MTN B;  3SHQ A;  2DZK A;  3HHM A;  3A9J B;  4HWI B;  4PS7 A;  2G3Q B;  4BKT A;  1IP9 A;  2C9W B;  3GZN I;  3PHW B;  3H7S A;  2PE6 B;  2J0K A;  2LWP A;  3NS8 A;  2JRI B;  3K9P B;  4OVV A;  3PS6 A;  2KC2 A;  4AWJ A;  2K39 A;  2XBB C;  4ASW C;  5L95 C;  3IFW B;  3N3K B;  2EMS A;  3MHS D;  4G0N B;  2KMA A;  1L2N A;  1V80 A;  3DCG A;  2WX1 A;  3JSV B;  2YVC A;  3KUC B;  1ISN A;  2MP2 A;  2XK5 B;  1OEY J;  4BBN C;  2NBV B;  4FLH A;  4NY0 A;  3H7P B;  2IO2 B;  4BOS C;  2LAS A;  2KLG A;  2MBH A;  3M62 B;  4FN2 A;  1HE8 A;  4XC2 A;  1E8W A;  1OGW A;  1Q5W B;  3L54 A;  2NBW B;  2W9N A;  3DVG X;  4IM2 A;  5KHQ A;  3RT3 B;  1H4R A;  1M94 A;  1SGH A;  3NOB A;  3X0W A;  1P98 A;  4FBJ B;  1GC6 A;  5D7G A;  2KJH B;  4G50 A;  2KAN A;  2C60 A;  4I6L B;  2AEH A;  2AL3 A;  2C7N B;  2NPT A;  4IM0 A;  4IW0 A;  4K81 A;  3VAW A;  3ZLZ A;  4EZK A;  1MG8 A;  4WJO A;  4M0W B;  3VVW B;  3LJ3 A;  3VFK A;  4CHK A;  2LGX A;  4K7W A;  4FJV B;  4W9G A;  3KH0 A;  3UIN B;  4EOY A;  5TR5 A;  2L0T A;  4LDT B;  4RMA A;  4JQW C;  1KOT A;  2N7E A;  2KN5 A;  5E6P A;  1EO6 A;  1WXV A;  4HCP B;  4N9F 4;  2WYQ A;  3QK0 A;  1V81 A;  5D94 A;  1WFY A;  3R7Q A;  2FCS A;  3WAM A;  3AUL A;  4AP4 C;  1P0R A;  4DHJ B;  1WE6 A;  2KFK A;  2XEW A;  1EUV B;  4ZRJ A;  2V4L A;  5AZG A;  3L13 A;  3RYT A;  2KKC A;  4WJP A;  4GDK A;  2FNJ B;  2KDF B;  3RUL A;  1C3T A;  3V6E B;  5LXI B;  3EFU A;  2LD9 A;  2IO3 B;  1NI2 A;  2DHZ A;  3B1L X;  3ONS A;  2Z0D B;  2ZZP B;  3ENE A;  4FJY A;  2NS5 A;  4WAA A;  3W1S C;  2CHX A;  2JY6 A;  3PTF C;  3RD2 A;  1WE7 A;  4JGH B; 
#chains in the Genus database with same CATH topology
 2B3A A;  1TY2 A;  1MHX A;  1Z5S B;  3RZF A;  1V5O A;  3MJW A;  1TS4 A;  2WP9 B;  4KX6 B;  3UQA A;  4M01 A;  2WWZ A;  3M95 A;  2M4N A;  1ZUD 2;  3L08 A;  2KTR B;  1YN4 A;  3RNF C;  2YLM A;  3ZDM C;  1BUI C;  3NG0 A;  1WXM A;  3RNE C;  4EFO A;  1RM6 C;  2SEB D;  1E9M A;  4HLE A;  1QOB A;  5CX3 A;  4ZRI A;  3GS2 A;  3AEG B;  1JWS D;  4JWS C;  4XZ4 A;  4MEL A;  2DNF A;  2ZPY A;  2ASQ A;  4GOC A;  2GRI A;  1XLQ A;  2RR9 A;  5CHV C;  1HQR D;  3AB5 A;  4YSZ B;  4ICU A;  2N7D A;  2RDB C;  1YJ1 A;  1BXT A;  1WZ3 A;  1YIW A;  3RI7 C;  4K7S A;  2Q5W D;  3Q8E A;  1QZE A;  2BGF A;  5G55 A;  4NJ7 A;  2GBJ A;  2CJO A;  1I4X A;  1K8R B;  4PYZ A;  3R66 C;  3KLS X;  1JWU D;  1V2Y A;  2V3S A;  1VZ8 A;  3Q8A A;  2VRR B;  4KIK A;  3IHP C;  3ML9 A;  2HE7 A;  3W1S A;  3VUW A;  1DOX A;  2O6V B;  5H92 C;  2M1M A;  5IP4 D;  2DX5 B;  2V9H A;  1TIF A;  2CU3 A;  3ZNZ B;  2L3Z A;  4B6W A;  2MQJ A;  1I7H A;  2BQQ A;  2L00 B;  2PVO D;  1XO3 A;  2PLP A;  1XLN A;  3UGB B;  1R7S A;  5BYS A;  1I4G A;  1V5T A;  4M8N A;  1V86 A;  4DXG A;  4LLG M;  1V49 A;  3FIL A;  1SSN A;  5DPR A;  2BBC A;  2YEP B;  4MM3 B;  3ZO5 B;  2PVG C;  3A9J A;  4UDU C;  2FUG 1;  5TSS A;  3W9C B;  2ZEQ A;  2JT4 B;  2DZJ A;  3OAW A;  2OOB B;  1UH6 A;  5CHW A;  2DEN B;  1B1Z A;  2MJ3 A;  1MHH E;  2I1J A;  3JSV A;  4CO7 A;  1BT0 A;  2J52 A;  3UI3 A;  2KDB A;  1WRI A;  1IBX A;  1XXG A;  4W9K A;  4P7I A;  1QOF A;  2GMI C;  4ITK A;  5IOI A;  1P7E A;  2FIF A;  1WWT A;  2GLS A;  4YSY B;  3B08 A;  4FAD A;  3AE9 B;  2BYF A;  1FO4 A;  4K1R B;  1IPG A;  5IO9 A;  4NJ6 A;  4MAC A;  2ZW1 A;  5FK9 C;  1IYF A;  2FCQ A;  3TMP B;  5LNK 1;  1GG3 A;  1VDV A;  4MT5 A;  5GXG B;  2E6X A;  2KWV B;  5KHO A;  1AYF A;  1UWX A;  3DBR I;  2GBM A;  3U8Z A;  1U4A A;  2RD0 A;  1L4Z B;  3L10 B;  1WRD B;  3KYD D;  4IG7 B;  2CKH B;  3TCA A;  3U30 A;  1WR1 A;  5JXV A;  1FEH A;  4FHJ A;  4XWT A;  1TZO A;  2ZW0 A;  1WSP A;  2WDR B;  4PS3 A;  2MP2 B;  2GBN A;  3BYT B;  4E74 A;  3RN9 C;  2UYZ B;  4RM9 A;  4LNN A;  4LNI A;  4AJY B;  5FR3 A;  1C1Y B;  4HXD A;  4DHZ E;  2DYB A;  4R3D A;  3L0W B;  2WXL A;  1Z2M A;  1UNS A;  3FAH A;  1KM7 A;  2NTT A;  3UIP B;  1JQ4 A;  3HVD A;  4RGM A;  1E0Z A;  3PGE A;  2IY0 B;  2PEA A;  1EU3 A;  1GB4 A;  1UZX B;  1N6Z A;  3KYC D;  5EE3 A;  3VTW A;  3MC0 B;  3R2I A;  4GDK B;  5IA7 A;  3P4S B;  4NAW A;  3Q14 C;  4BKG A;  1IBX B;  2NVU I;  3N30 A;  1UF0 A;  2LGY A;  2K9X A;  4ZYS A;  3RPF C;  1D5M C;  2D11 A;  1YJJ A;  1JAL A;  1L5P A;  1YQ3 B;  3DWG C;  4F8C B;  1YX6 B;  2FUH B;  5IN7 A;  1WXQ A;  3OJ3 A;  1MG4 A;  2KQ7 A;  2BYV E;  1SE9 A;  2MBO A;  4MGZ E;  3AE6 B;  1RLF A;  1GOZ A;  2BT6 A;  1IGC A;  4BBN F;  3EHV A;  3VUY A;  4M00 A;  5BMI A;  1P7F A;  2B76 B;  3WAL A;  3NVZ A;  3ZRC A;  3L16 A;  2WQY B;  2WXR A;  3Q3J A;  4WJQ A;  3SFD B;  5C2T B;  3V62 A;  4BKS A;  4US9 A;  1RFA A;  2R2O A;  3IAS 1;  3PRZ A;  3MJ5 A;  3Q2A C;  1JWA D;  5EDS A;  1ET6 A;  2MSE D;  1ZXI A;  2WXN A;  2HTM E;  4RFB A;  2QIL A;  1J7C A;  3HVZ A;  2D10 A;  3WAP A;  1WYW B;  1TGZ B;  4LJP B;  1DGJ A;  1IUE A;  5J17 A;  2Y5C A;  3ZVV A;  4TUU A;  2H88 B;  3TJP A;  4GSW A;  3D32 A;  3QWZ B;  4MJS A;  2IPK D;  4WWO A;  1T5X D;  2AQ1 B;  3W5U B;  4GB9 A;  2M56 B;  4XE0 A;  4LDT D;  1RRB A;  2NR2 A;  2LHE A;  2PKO A;  4HPL B;  3HIZ A;  4ANV A;  1YQ4 B;  4NQK E;  1GC7 A;  3LXF A;  2DAJ A;  2J4X A;  4JL9 A;  3SHQ A;  1QT9 A;  2WXO A;  1QIL A;  2LWP A;  2WHI A;  3K9P B;  2WXG A;  4L23 A;  3IFW B;  4D2K A;  3MHS D;  4G0N B;  1L2N A;  3ZJV A;  2YVC A;  3BK1 A;  3EGR A;  1N62 A;  3ZXV A;  2XK5 B;  4YTP B;  4BBN C;  4FLH A;  2IO2 B;  2KLG A;  4FN2 A;  1HE8 A;  2LGS A;  1J7B A;  2W9N A;  3DVG X;  1H4R A;  1M94 A;  1GC6 A;  3SEB A;  2KJH B;  4G50 A;  2AEH A;  2C7N B;  4EZK A;  2NPT A;  4IW0 A;  3L4P A;  4FJV B;  4W9G A;  2M19 A;  1N61 A;  4RMA A;  4JQW C;  4C56 C;  2CJN A;  2N7E A;  1FD6 A;  2KN5 A;  1WXV A;  3RNB C;  3QK0 A;  4C4V B;  4H2A A;  1SF0 A;  2KFK A;  4BAX A;  5AUK A;  2LMC A;  4ZRJ A;  2V4L A;  5MPO A;  2KKC A;  1C3T A;  3V6E B;  3ABV B;  2DHZ A;  2Z0D B;  4HRO A;  1F0Z A;  3PTF C;  4S17 A;  2O6V D;  2OJR A;  2G4S A;  2K8H A;  2KC1 A;  1P9D U;  1AN8 A;  1VJK A;  1WH3 A;  2JVC A;  1FMA D;  1WGY A;  1FNU A;  1TTN A;  2JYT A;  2K5P A;  4C80 A;  2R61 A;  2JXX A;  2LZ6 A;  4ARI A;  3AEC B;  1Y56 A;  2EKE C;  1WGR A;  4GMV A;  3P63 A;  3IG3 A;  1XLP A;  1HTQ A;  1OQQ A;  3I57 A;  4RH6 A;  1MPE A;  1SIJ A;  4JPS A;  2G1E A;  4FJZ A;  1WX9 A;  3NY5 A;  5T8I A;  3AE7 B;  5DPS A;  2MJD A;  3O65 B;  4AUQ C;  1P3Q U;  3TL5 A;  1TKE A;  1JCK B;  1SXT A;  1FNV A;  4IDI A;  1LXD A;  3MC8 A;  3A33 B;  1LM8 B;  4RF1 A;  1QOA A;  2KJR A;  2NBU A;  1CQV A;  4C7Y A;  4RF0 A;  1WJN A;  2O2V B;  1E10 A;  1FXA A;  1LFD A;  4EZL A;  1EF1 A;  2K3U A;  3OG5 A;  2DBY A;  3NZU A;  1E8Z A;  3VR9 B;  5D6J B;  3LYY A;  2CHZ A;  3U4E G;  4IWQ A;  4KZC A;  2MLB A;  1WMH A;  5DCN A;  3DWM A;  3P2B A;  4US8 A;  1OQY A;  4XDD A;  2M0A A;  2L52 A;  1R4N I;  2K1F A;  4XDC A;  3PRM B;  2NTS A;  4OZC A;  2FAZ A;  1WY8 A;  4DXA B;  2ZNV C;  1XT9 B;  2KN4 A;  5FKA C;  1WF9 A;  2YEP F;  3DVG Y;  3KQ4 A;  2L05 A;  2JQR B;  3AEB B;  2V1Y A;  3ALB A;  4GU2 A;  2PIA A;  4MGY E;  3QAQ A;  4CYE A;  2Y5B B;  4LNK A;  1PFD A;  3FC4 A;  4JLC A;  3CST A;  4A20 A;  2EMT A;  3TEW A;  2KTF A;  4W9J A;  1WGK A;  2IDY A;  1C76 A;  1V1P B;  2RPV A;  2BS4 B;  3DVN U;  1GUA B;  4KGT A;  4DQO C;  1VR9 A;  3SDL C;  2Y3A A;  3VHT C;  3BIN A;  2JUO A;  3V60 A;  4A3P A;  2HTH A;  5GMV A;  2JZZ A;  3AI5 A;  2MBB B;  5LXH A;  4M0W A;  4XYC A;  4ZRP A;  3W5V B;  4M8M A;  3T8M A;  3P42 A;  4EZJ A;  1ZW7 A;  2UU7 A;  4A6Q A;  2ICI A;  4XX5 A;  2N0S B;  2K25 A;  4ACF A;  4G3X B;  1OEY A;  1WR6 E;  4DBG A;  3U7Z A;  3VQI A;  2R2Q A;  4P16 A;  5EE0 A;  3DPD A;  1WI0 A;  3APC A;  4RGT A;  3C8Y A;  1YNT E;  3WA0 A;  2UWQ A;  4AOF A;  2MX2 A;  3QAR A;  3C0R B;  2IO1 B;  2KDM A;  4FA6 A;  1FRR A;  4KSL C;  1I4Q A;  5E6J A;  2JZ3 B;  3AE1 B;  4NZL B;  3HUI A;  4IC7 B;  1NYR A;  3ZIM A;  4JX1 C;  1M4V A;  1ZKH A;  4A9A A;  4FHK A;  2D3B A;  4AQ7 A;  5IKC M;  1MFW A;  3H8H A;  4WH4 A;  1YN3 A;  2KK8 A;  3PRE A;  4GLS C;  1EWY C;  2MW5 A;  2L76 A;  5DPT A;  1L7Y A;  3GOE A;  3ZDT A;  2GBR A;  1G6J A;  4A90 A;  2Z59 B;  1FFV A;  1YX5 B;  4TQ0 A;  1LGR A;  1K52 A;  3IBE A;  5IAA C;  3QX1 A;  4NAM A;  1V6E A;  5HFY A;  2X8X X;  1EU4 A;  3IXS A;  5AUI A;  2N9E B;  1WM3 A;  1YQB A;  3PPA A;  2MBQ A;  2FCM A;  1NI3 A;  1KTK A;  1D6E C;  4OHJ A;  2LVQ A;  1UUP A;  4OW0 A;  3ZNH B;  3MC9 A;  1TS3 A;  2W54 A;  3B2G A;  2XNA C;  2LUE A;  1V9J A;  3BZD B;  4ZYN A;  5G5H A;  2LXC A;  2KHW B;  3DQV A;  4HDQ A;  5C23 A;  1WIA A;  3VH4 B;  5CTR C;  3RUI B;  4LK0 M;  1HZ6 A;  2WDT B;  4HJG E;  2LVP A;  4LJO B;  3IT4 B;  2INN E;  2JSV X;  1V97 A;  3Q3M C;  1D4B A;  1UBQ A;  2D3C A;  2IY1 B;  4IM3 A;  1E8X A;  3QQ8 B;  4NQL B;  4KZ0 A;  4MEM A;  1SE4 A;  2J0M A;  1D5X C;  5G5G A;  4B95 A;  2LRU A;  1HA5 A;  3T3N A;  2E3T A;  1Q10 A;  1ET9 A;  2LGD A;  4W9L A;  4HCN B;  3QHT A;  4RGO S;  2KO3 A;  3EEC A;  4KIK B;  3SU8 X;  4K3C A;  4DDI D;  5I4D A;  3E9S A;  1S3S G;  4W9C A;  2LHD A;  2J7Q B;  1TY0 A;  3QA8 A;  2ZCC A;  3PLV A;  2K8C A;  1UWM A;  1CJE A;  2PE9 A;  3JW0 X;  4EUT A;  3URY A;  2IND C;  4YL8 A;  1UEL A;  2GOW A;  3NZS A;  4WQM A;  2LFI A;  1PGA A;  4HJK A;  3BK2 A;  3FIL B;  3SD5 A;  3QCA A;  3MP9 A;  2IBI B;  3A9J B;  4PS7 A;  1IP9 A;  3PHW B;  2J0K A;  2JX5 A;  2OJW A;  5C3J B;  2JRI B;  4OVV A;  4S0R A;  4JWU C;  3BVZ A;  2KT7 A;  4KGS A;  3N3K B;  3KWV A;  3JSV B;  1XF5 L;  1ISN A;  2V4I B;  4NY0 A;  1EM7 A;  1WYG A;  3M62 B;  1OQR A;  2KYW A;  2NBW B;  2LGI A;  3TUO A;  3N1Y C;  3RT3 B;  1SGH A;  2IGD A;  1N63 A;  5D7G A;  1F77 A;  2ONQ A;  1ZDX A;  4YTN B;  1TS5 A;  3VAW A;  2WXJ A;  4N58 A;  2DWQ A;  3VFK A;  2LGX A;  2V3N A;  5TR5 A;  2L0T A;  3RNC C;  3KWL A;  1K51 A;  5D94 A;  1XLO A;  2I2Y A;  2FCS A;  3AUL A;  4DHJ B;  5AZG A;  3RYT A;  4WJP A;  4P1B C;  2KDF B;  2QEJ C;  4OZA A;  1VZ6 A;  1NI2 A;  4IOI E;  3TEY A;  4WAA A;  1N5W A;  2JY6 A;  3PO0 A;  3K9O B;  4GXB A;  3APD A;  3NZ3 A;  4OZB A;  1J8C A;  3R7R A;  2CR5 A;  3AEA B;  2GBK A;  4MSM B;  4RNA A;  2K6D B;  1Q1O A;  1S1Q B;  3T3O A;  4KVG B;  3L17 A;  4IKG A;  2IZV B;  2MEK A;  5L83 A;  1PYW D;  3H9D A;  4HRS A;  3AMZ A;  2JWU A;  2KQS A;  4L1B A;  3ZUN A;  3U2S C;  3PV1 A;  3UF8 A;  1KRH A;  3IAM 1;  1XQQ A;  1HXY D;  4ANU A;  1J0G A;  2W3S A;  4LNF A;  1L0X B;  3TBL D;  1F2R I;  4USA A;  1RAX A;  4P1C C;  4G11 A;  4NAW B;  3P4P B;  4YXD B;  2MCN B;  3VTV A;  4W9F A;  1T3Q A;  1ACC A;  3HK0 A;  2VH1 A;  4NNJ B;  1I4P A;  2JPH A;  4B9K A;  3OLM D;  3W1Y A;  2L83 A;  1WJ4 A;  4DK5 A;  2BYE A;  3Q3F A;  3ZRF A;  3DBS A;  2WXI A;  2KWU B;  2GB1 A;  5JHB A;  2D5G A;  2WXK A;  2VZK B;  1P1A A;  1TKY A;  4GDL A;  3FKY A;  3U52 E;  2KX0 A;  3X23 A;  2G9H D;  2IJ0 A;  4AJW A;  3A1Q A;  3AE2 B;  3NVW A;  1GJZ A;  3A9K A;  2V0G A;  2M0X A;  1L4D B;  5EE9 A;  3ZJT A;  3E56 A;  1QQR A;  2ZJD A;  1K53 A;  3V6C B;  2LEK A;  1WJU A;  2N7J A;  1Y8R C;  2XN9 C;  3R2T A;  3ZXR A;  3CWI A;  4DHZ B;  1JWB D;  2BTE A;  2MRP A;  3RMK C;  4HKZ E;  4HKQ A;  4B0E A;  2BKR B;  3IT6 B;  3WAO A;  2IYD B;  2L7R A;  2RGF A;  2AYO B;  2QSD A;  2BS3 B;  2KX3 A;  2IO0 B;  4C7Z A;  1FCC C;  4N59 A;  1E6E B;  3AU5 A;  3H7P A;  4MJS B;  4LTU A;  4RM8 A;  2DYO A;  2LUM A;  2A4Z A;  1ESF A;  1JRU A;  3Q8B A;  1X1M A;  2BF8 B;  4WWM A;  2G4D B;  4BZA A;  4KKI A;  5JHA A;  4C00 A;  3P1M A;  2DYM A;  1KLV A;  2IGH A;  3GE8 C;  1NEK B;  3TEZ A;  4HK2 A;  1PGB A;  3H6N A;  2BYT A;  5EE1 A;  1MI0 A;  2LI5 A;  1AAR A;  4ICV A;  1ZDV A;  3VRA B;  2INC C;  4KDI C;  5JZE B;  4K7U A;  1BML C;  4CQN A;  2OED A;  3DDC B;  3PZ7 A;  1TBE A;  2QJL A;  1GAQ B;  1E5W A;  4II3 B;  4TKN A;  4K3B A;  3VXW A;  2KVR A;  3B9J A;  2MWS B;  4EEW A;  2BW2 A;  3JYU A;  2LXA A;  3UQB A;  2KWD A;  3MFG A;  3AED B;  1C9F A;  2AX5 A;  4HVB A;  1ZE3 D;  3N32 A;  3U7D A;  1A5R A;  2LJI A;  2FID A;  2LRW A;  1DYQ A;  1Q0W B;  3DVN V;  1I42 A;  5C1Z A;  2NPT B;  2KTR A;  3TIX A;  2ON8 A;  3GZN B;  4YWG G;  3Q69 A;  2M8S A;  2PJH A;  1WGG A;  3P4R B;  1I4R A;  1H8C A;  3PRP B;  5DPW A;  4BVU C;  3PZD A;  1XCT L;  3PHX B;  5BYR A;  1NYQ A;  2DZM A;  4ZRK A;  3AE5 B;  3AU4 A;  2KFK B;  2KDI A;  1FXI A;  3CF6 E;  4WAF A;  2LVO A;  2KMM A;  1TZ1 A;  3BWU D;  2WX0 A;  3I3T B;  3ZTC A;  3DHI C;  1SEB D;  4O1N A;  1N60 A;  1UD7 A;  1L6V A;  3AH7 A;  2EKI A;  2WNM A;  1UBI A;  3WCQ A;  2L0F A;  3VR8 B;  4KKJ A;  3ZNG C;  3DBH B;  4PT5 A;  1VD2 A;  3TSS A;  1N5X A;  2KXJ A;  1I4H A;  3DBH I;  4KV2 A;  2O6V A;  2Z8L A;  4URK A;  4MDK E;  2CHW A;  3ZKJ C;  1QF6 A;  1FXT B;  4IWP A;  4I6N B;  2M17 A;  5HHD G;  3RNA C;  2PMV A;  2D2Q A;  4GN1 A;  1JML A;  1AWD A;  3N20 C;  2C7M B;  1QLB B;  5FR6 A;  2ZNV B;  4MM3 A;  1L6U A;  1YN5 A;  4AS1 A;  4MSQ B;  5CHF A;  2BKF A;  2REX A;  4DWF A;  2V3P A;  3TEX A;  3UIO B;  4KGR A;  1JWM D;  3VTU A;  3LDZ E;  3Q8F A;  2KDE B;  4ARC A;  1PDX A;  4ZHP A;  3M63 B;  2MH7 A;  1T0Q C;  3NUH B;  5BMH A;  5J2R A;  1C79 A;  5D3I B;  2JXT A;  2QHO A;  5H8Y E;  2X38 A;  1WMH B;  1E7V A;  5J18 A;  4RCO A;  5G2N A;  2RMM A;  3BII D;  4ZHO A;  1E90 A;  4DHJ D;  2KOX A;  4OVU A;  2N9P C;  4PS8 A;  2DZI A;  2N1V A;  1SB3 C;  2INP E;  3Q6B A;  3HHM A;  4BKT A;  3H7S A;  2HDE A;  4ZOH C;  3NS8 A;  4WUR A;  3Q8C A;  4AWJ A;  3R8B A;  2K39 A;  4ASW C;  4N6E B;  2EMS A;  2KMA A;  2WU2 B;  1L0V B;  2WX1 A;  2QMT A;  2MP2 A;  1OEY J;  2LAS A;  2MBH A;  1L0Y B;  2SAK A;  1XCQ L;  2D3A A;  2QDF A;  1E8W A;  1OGW A;  1Q5W B;  4IM2 A;  1FRD A;  3NOB A;  4FBJ B;  1HEZ E;  1KH0 A;  2KAN A;  3OWE B;  2AL3 A;  4K81 A;  1SJE D;  4HPP A;  1MG8 A;  2KAC A;  4WJO A;  2BB6 A;  4M0W B;  3VVW B;  3LJ3 A;  4CHK A;  3UIN B;  4EOY A;  1J7A A;  2JU6 X;  1UGJ A;  4HCP B;  2OHF A;  1WFY A;  1TKG A;  3WAM A;  1SJH D;  4PK1 A;  3NRZ A;  2XEW A;  1EUV B;  2RDG A;  3L13 A;  4GDK A;  3RUL A;  3EFU A;  3B1L X;  3ONS A;  2WU5 B;  3ENE A;  2VZK D;  4TSS A;  1MVK A;  3W1S C;  2CHX A;  2WXH A;  2W82 A;  2IGG A;  1KJT A;  2H89 B;  1YJI A;  3LB8 C;  2DLB A;  4W9D A;  4JE3 B;  1JRO A;  1KFY B;  1WJ6 A;  2I1K A;  3VUX A;  2KWC A;  3I5J C;  2LJ5 A;  1WZ0 A;  1VLB A;  3M3J A;  3PT2 B;  3HM6 X;  4BKS D;  3DBR B;  2NMQ A;  3NVY A;  4RGN A;  3H1U A;  4X57 B;  4EKU A;  3T9L A;  1D3Z A;  2J0J A;  2RSU A;  3ZJU A;  2KQ4 X;  2KFJ A;  3DHG C;  4F1S A;  3A4S C;  2FE8 A;  4YT0 B;  2WXM A;  1SBB B;  3ZGZ A;  3APF A;  4J6I A;  1A70 A;  4WIP A;  2AWT A;  1RFK A;  3KUD B;  2FBW B;  2J42 A;  2K0P A;  3EC8 A;  1NBF C;  1TT5 B;  3B2F A;  1F9J A;  2K6Q A;  1GB1 A;  3PVL A;  2FCN A;  1EF5 A;  4P6V F;  3BVM A;  2KLC A;  3SFE B;  1EWC A;  2A5U A;  1VZ7 A;  2K8B A;  2WGS A;  3CSF A;  3DHH C;  4MGI E;  1C4P A;  1TJE A;  4HEA 1;  1DOI A;  3ETR A;  2Y5P A;  1FCL A;  3KW5 B;  3WIM A;  1CMX B;  4L2Y A;  1JW9 D;  4OVZ A;  3VH3 B;  1V8C A;  1WXA A;  2QIE B;  3CMM B;  2BPS A;  1SE3 A;  4W9H A;  4MH0 E;  1E7U A;  1KLG D;  2PW9 A;  5E6O A;  2ZVO A;  2MBE A;  5E6N A;  3PZ8 A;  3W2D A;  1ZP0 B;  3KVF B;  2BWF A;  3RCZ A;  3KUZ A;  2G45 B;  3PLU A;  1I35 A;  1ROE A;  2KMC A;  3AN1 A;  3CIR B;  3GB1 A;  2EEL A;  1C77 A;  4EE2 A;  1PQS A;  3WAN A;  4A3O A;  4WJN A;  1GPX A;  1FM0 D;  1RWS A;  5BYQ A;  1VCB A;  1ZGU B;  1HZ5 A;  1C4C A;  1LO5 D;  3VDZ A;  2WXQ A;  3EFC A;  4TQ1 A;  1E8Y A;  1ZPS A;  3AE8 B;  2N9K A;  4E71 A;  4YSX B;  2XK5 A;  4Q2J A;  3ZNI D;  2HJ8 A;  1SE2 A;  1TS2 A;  4ANW A;  1IGD A;  2BB5 A;  2I38 A;  3V05 A;  2CS4 A;  1F2R C;  4E3C A;  1XEE A;  1F1H A;  3AV8 A;  1SIF A;  1VRA B;  1GNU A;  1UGM A;  1V1O A;  3OJ4 B;  2D07 B;  4B0M A;  4NJC A;  1YOV B;  1C4A A;  2ZPN A;  3EA6 A;  5HG2 A;  2WS3 B;  3QIJ A;  3HM3 A;  4C4V A;  3ZW3 A;  1CK1 A;  3A4R A;  5D3D A;  3DOW A;  5JH5 C;  1T6B X;  1WM2 A;  2DAF A;  2KNB A;  1KF6 B;  4DDG D;  1WX8 A;  2GI9 A;  3PSE B;  1WXS A;  3BYY B;  5LLI A;  2AQ3 B;  3R3M A;  1RYJ A;  3P4Q B;  1E7P B;  1ZOY B;  1FNW A;  2KZR A;  4MGK E;  1QOG A;  1PUT A;  3Q3O C;  2RDH A;  3VRB B;  2WDV B;  4LNO A;  3O13 A;  3DBL B;  4XGA B;  4XWW A;  2ZCB A;  4BOZ B;  3DBL I;  1WGD A;  1AW7 A;  1YD8 U;  1D5Z C;  1OTR B;  3Q3N C;  3NVV A;  2C7H A;  3GE3 C;  3QJZ A;  2AL6 A;  3V3X A;  1PGX A;  4IUM B;  1YMH E;  1T0R C;  5AZF A;  3BVG A;  4REZ A;  4J3O D;  1XD3 B;  2ZVN A;  4NPN A;  4WWP A;  4II2 B;  2PPH A;  1FIQ A;  4F7Z A;  2HJ1 A;  4WQO B;  5AEK B;  4WWN A;  1J19 A;  4FUL A;  3ZYY X;  2CU1 A;  3AXC A;  4ZDV A;  1QKZ A;  3AEF B;  4TMA B;  3AM9 A;  3ECI A;  3RZW C;  2JZP A;  2WLB A;  2VH2 A;  3J9C A;  4QAY A;  2WXP A;  2RPQ A;  2WDQ B;  2KJ6 A;  2O2V A;  1R4M B;  1NDD A;  1WGH A;  1T0S C;  1R4M I;  2N4F A;  2L8J A;  1DOY A;  5AZH A;  3QC8 B;  2KD0 A;  2BWE S;  2J53 A;  3NHE B;  2K22 A;  1F52 A;  1TYG B;  4KDL B;  2HD5 B;  2JF5 A;  2KAJ A;  3RNG C;  1ENF A;  1FPY A;  1T0Y A;  3IVF A;  2QC8 A;  4GGQ A;  4W9E A;  2MA9 B;  2JWZ A;  2QCZ A;  4PYU A;  1LQB A;  1KLU D;  3BY4 B;  5BMG A;  4GIV A;  4TV3 A;  2N1W A;  3AEE B;  3ZTD A;  1NVI D;  1FFU A;  4KSK C;  3B0A A;  4I6P A;  3I63 C;  3V61 A;  2C5L C;  2Z0E B;  4IWO A;  4W9I A;  3S2A A;  3JVZ X;  4A55 A;  1STE A;  1WX7 A;  5D2M B;  3NJT A;  4GDL B;  4ANX A;  4M02 A;  4HPM B;  2AQ2 B;  2JRH A;  1V1P A;  2BS2 B;  3ML8 A;  3A1Q B;  2WXF A;  5HKH A;  3A9K B;  1JRP A;  2N9X A;  2D3G A;  4BFR A;  4HDO A;  3NS1 A;  2NCN A;  3ZQ4 A;  1NEN B;  2L32 A;  1MJD A;  1OFF A;  3GP7 A;  5BO4 B;  4JIO U;  5HI1 A;  4LCD E;  3MTN B;  3N1Z C;  2DZK A;  4HWI B;  2G3Q B;  2W55 A;  2C9W B;  3RFZ B;  3GZN I;  2PE6 B;  4YTM B;  3PS6 A;  2KC2 A;  2PTL A;  2TSS A;  2BVC A;  2XBB C;  5L95 C;  3EUB 2;  3C19 A;  2ACZ B;  1V80 A;  3DCG A;  3KUC B;  1CZP A;  3N9Y C;  2L1A A;  2NBV B;  3H7P B;  4BOS C;  1C78 A;  3AE3 B;  4XC2 A;  2MHJ A;  3HRD D;  2W3R A;  3L54 A;  5KHQ A;  1R4N B;  3X0W A;  1P98 A;  4I6L B;  2C60 A;  2MJE A;  2N9L A;  4IM0 A;  3ZLZ A;  1K50 A;  4K7W A;  3KH0 A;  4A8X C;  4LDT B;  1KOT A;  5E6P A;  1EO6 A;  4N9F 4;  2WYQ A;  1V81 A;  4ZRQ A;  3R7Q A;  3AE4 B;  4AP4 C;  1P0R A;  3MHZ A;  3N1X C;  4DXF A;  1WE6 A;  4MH8 A;  1HTO A;  2KVZ A;  4FXC A;  2FNJ B;  5LXI B;  3SR6 A;  2LD9 A;  2IO3 B;  3I9V 1;  2ZZP B;  1ZXH A;  4FJY A;  1B9R A;  2JYE A;  2NS5 A;  3RD2 A;  1WE7 A;  4JGH B; 
#chains in the Genus database with same CATH homology
 3K9O B;  4GXB A;  3APD A;  2B3A A;  2O6V D;  1J8C A;  1KJT A;  1Z5S B;  3R7R A;  2CR5 A;  2OJR A;  3RZF A;  2GBK A;  4W9D A;  4MSM B;  1V5O A;  3MJW A;  2G4S A;  2K6D B;  1Q1O A;  1S1Q B;  3UQA A;  4KVG B;  3L17 A;  2K8H A;  1WJ6 A;  2I1K A;  2IZV B;  2KC1 A;  3VUX A;  2KWC A;  1P9D U;  2LJ5 A;  5L83 A;  2WWZ A;  3M95 A;  2M4N A;  3H9D A;  1WZ0 A;  3M3J A;  3PT2 B;  1WH3 A;  2JVC A;  3HM6 X;  3L08 A;  2KTR B;  3ZDM C;  4BKS D;  2YLM A;  2KQS A;  1WGY A;  3H1U A;  4X57 B;  3ZUN A;  1TTN A;  1WXM A;  3PV1 A;  3UF8 A;  4EFO A;  4EKU A;  3T9L A;  1D3Z A;  4HLE A;  5CX3 A;  2JXX A;  4ZRI A;  2J0J A;  1XQQ A;  2LZ6 A;  2RSU A;  4ANU A;  4XZ4 A;  4MEL A;  2ZPY A;  1J0G A;  2KFJ A;  2ASQ A;  4GOC A;  2EKE C;  1WGR A;  2RR9 A;  4GMV A;  5CHV C;  4F1S A;  3A4S C;  3TBL D;  3IG3 A;  4ICU A;  2N7D A;  1RAX A;  4G11 A;  4NAW B;  3APF A;  4J6I A;  1YJ1 A;  4FJZ A;  2MCN B;  1WX9 A;  2AWT A;  3NY5 A;  4W9F A;  3VTV A;  3KUD B;  1WZ3 A;  1YIW A;  5DPS A;  3O65 B;  4AUQ C;  1P3Q U;  3HK0 A;  3EC8 A;  4NNJ B;  3TL5 A;  4K7S A;  1NBF C;  1QZE A;  2JPH A;  1F9J A;  2K6Q A;  4B9K A;  1LXD A;  2BGF A;  3PVL A;  3OLM D;  5G55 A;  3W1Y A;  4DK5 A;  1WJ4 A;  4NJ7 A;  2BYE A;  2GBJ A;  3Q3F A;  2FCN A;  1EF5 A;  3A33 B;  1K8R B;  3ZRF A;  4PYZ A;  3R66 C;  1LM8 B;  3DBS A;  2KLC A;  1V2Y A;  2KWU B;  2A5U A;  5JHB A;  2V3S A;  2K8B A;  2VRR B;  4KIK A;  3IHP C;  3CSF A;  2KJR A;  3ML9 A;  2NBU A;  1P1A A;  4MGI E;  1WJN A;  2O2V B;  2HE7 A;  3W1S A;  4GDL A;  3VUW A;  2O6V B;  1LFD A;  4EZL A;  1EF1 A;  2KX0 A;  2M1M A;  2DX5 B;  3NZU A;  3X23 A;  3KW5 B;  3WIM A;  1E8Z A;  1CMX B;  3ZNZ B;  5D6J B;  2L3Z A;  3VH3 B;  4AJW A;  1WXA A;  2CHZ A;  3CMM B;  2MQJ A;  2BPS A;  3A1Q A;  4B6W A;  2L00 B;  4IWQ A;  4KZC A;  3A9K A;  4W9H A;  4MH0 E;  1GJZ A;  1E7U A;  2MLB A;  1WMH A;  2M0X A;  5DCN A;  3P2B A;  5E6O A;  2ZVO A;  1OQY A;  2MBE A;  3UGB B;  5E6N A;  2ZJD A;  1V5T A;  1R4N I;  4M8N A;  1V86 A;  2K1F A;  3KVF B;  2BWF A;  3RCZ A;  3V6C B;  1V49 A;  3KUZ A;  5DPR A;  2G45 B;  1WJU A;  3PLU A;  1I35 A;  1Y8R C;  3PRM B;  2KMC A;  2FAZ A;  3ZO5 B;  1WY8 A;  3A9J A;  4DXA B;  2ZNV C;  1PQS A;  2JT4 B;  1XT9 B;  2ZEQ A;  3WAN A;  1WF9 A;  2DZJ A;  4A3O A;  4DHZ B;  3OAW A;  4WJN A;  2MRP A;  2OOB B;  3DVG Y;  1UH6 A;  5CHW A;  2L05 A;  2DEN B;  2BKR B;  1VCB A;  2V1Y A;  1ZGU B;  3WAO A;  3ALB A;  4GU2 A;  2IYD B;  2L7R A;  4MGY E;  2I1J A;  2RGF A;  3QAQ A;  3VDZ A;  4CYE A;  4TQ1 A;  2AYO B;  1E8Y A;  2Y5B B;  3JSV A;  4CO7 A;  1BT0 A;  2KX3 A;  4E71 A;  2IO0 B;  4JLC A;  2KDB A;  2XK5 A;  4W9K A;  4P7I A;  3CST A;  4A20 A;  3ZNI D;  2EMT A;  3AU5 A;  2GMI C;  2KTF A;  2HJ8 A;  3H7P A;  4MJS B;  2FIF A;  4W9J A;  4RM8 A;  2DYO A;  2A4Z A;  1JRU A;  4ANW A;  3DVN U;  1GUA B;  1X1M A;  2BF8 B;  2CS4 A;  3B08 A;  4FAD A;  2G4D B;  3SDL C;  2BYF A;  3VHT C;  3BIN A;  4E3C A;  5JHA A;  4K1R B;  1IPG A;  2JUO A;  4NJ6 A;  2DYM A;  3V60 A;  4A3P A;  1KLV A;  2HTH A;  5GMV A;  2JZZ A;  1IYF A;  2FCQ A;  3TMP B;  3AI5 A;  1GG3 A;  2MBB B;  5LXH A;  1SIF A;  4HK2 A;  1GNU A;  1UGM A;  2KWV B;  3OJ4 B;  5KHO A;  4BVU C;  3H6N A;  2D07 B;  2ZPN A;  3DBR I;  2GBM A;  3U8Z A;  2LI5 A;  4M8M A;  3T8M A;  1AAR A;  1U4A A;  2RD0 A;  3QIJ A;  3HM3 A;  4ICV A;  3ZW3 A;  4EZJ A;  3L10 B;  4KDI C;  1WRD B;  1ZW7 A;  3A4R A;  5JZE B;  3KYD D;  4IG7 B;  4K7U A;  3DOW A;  2CKH B;  5JH5 C;  3TCA A;  3DDC B;  3U30 A;  4XX5 A;  2K25 A;  1TBE A;  4G3X B;  1E5W A;  1OEY A;  1WR1 A;  1WR6 E;  1WM2 A;  4II3 B;  4TKN A;  3VXW A;  2KVR A;  4DBG A;  4FHJ A;  3VQI A;  2R2Q A;  2MWS B;  3DPD A;  2DAF A;  4EEW A;  1WI0 A;  2KNB A;  2GBN A;  2MP2 B;  3APC A;  4PS3 A;  3JYU A;  4DDG D;  2LXA A;  1WX8 A;  3WA0 A;  4E74 A;  2UWQ A;  3UQB A;  3PSE B;  1WXS A;  2UYZ B;  4AOF A;  2MX2 A;  4RM9 A;  3QAR A;  5LLI A;  4AJY B;  4HVB A;  3R3M A;  1C1Y B;  3C0R B;  2IO1 B;  4FA6 A;  3N32 A;  4HXD A;  3U7D A;  1A5R A;  2KZR A;  4MGK E;  2FID A;  4KSL C;  2JZ3 B;  2LRW A;  2DYB A;  4DHZ E;  4IC7 B;  3L0W B;  3ZIM A;  1Q0W B;  1Z2M A;  3DVN V;  1I42 A;  5C1Z A;  2NPT B;  2KTR A;  2ZCB A;  3TIX A;  4BOZ B;  1KM7 A;  1ZKH A;  4FHK A;  3UIP B;  3DBL I;  1WGD A;  1YD8 U;  2M8S A;  2PJH A;  1WGG A;  2KK8 A;  1OTR B;  3PGE A;  3PRE A;  1H8C A;  3PRP B;  2MW5 A;  5DPW A;  2L76 A;  5DPT A;  1L7Y A;  2C7H A;  3GOE A;  3PZD A;  2AL6 A;  2IY0 B;  2PEA A;  3QJZ A;  3ZDT A;  4IUM B;  2GBR A;  3PHX B;  1G6J A;  2Z59 B;  2DZM A;  4ZRK A;  5AZF A;  1YX5 B;  2KFK B;  3AU4 A;  1UZX B;  4TQ0 A;  2KDI A;  3CF6 E;  3KYC D;  1XD3 B;  2LVO A;  2ZVN A;  4NPN A;  3IBE A;  4WWP A;  5IAA C;  3QX1 A;  3VTW A;  4GDK B;  1TZ1 A;  4II2 B;  5IA7 A;  1V6E A;  2PPH A;  4NAW A;  2WX0 A;  3I3T B;  4F7Z A;  3ZTC A;  4BKG A;  4WQO B;  2NVU I;  3N30 A;  5AEK B;  2LGY A;  4WWN A;  2N9E B;  1WM3 A;  1YQB A;  3PPA A;  1J19 A;  4FUL A;  2MBQ A;  1UD7 A;  2CU1 A;  2D11 A;  3AXC A;  4ZDV A;  2FCM A;  2LVQ A;  3ECI A;  3RZW C;  1UBI A;  3ZNH B;  2L0F A;  4F8C B;  1YX6 B;  2FUH B;  3ZNG C;  2LUE A;  1V9J A;  2RPQ A;  1VD2 A;  3OJ3 A;  4ZYN A;  2KXJ A;  2KJ6 A;  2O2V A;  3DBH I;  1NDD A;  1WGH A;  2LXC A;  2KQ7 A;  2KHW B;  3DQV A;  4KV2 A;  2O6V A;  4HDQ A;  2BYV E;  1SE9 A;  1WIA A;  5C23 A;  4URK A;  4MDK E;  1R4M I;  2N4F A;  2L8J A;  3VH4 B;  2MBO A;  4MGZ E;  5CTR C;  2CHW A;  3ZKJ C;  3RUI B;  1RLF A;  5AZH A;  3QC8 B;  2KD0 A;  2BWE S;  4BBN F;  3EHV A;  2WDT B;  1FXT B;  3NHE B;  3VUY A;  4IWP A;  2LVP A;  4I6N B;  4LJO B;  4KDL B;  2HD5 B;  2M17 A;  3WAL A;  3L16 A;  3ZRC A;  2JF5 A;  3Q3J A;  4WJQ A;  1UBQ A;  3V62 A;  1T0Y A;  3IVF A;  4BKS A;  2IY1 B;  1RFA A;  4IM3 A;  2R2O A;  2D2Q A;  1E8X A;  4GN1 A;  3PRZ A;  3QQ8 B;  4GGQ A;  4W9E A;  2MA9 B;  4NQL B;  2C7M B;  4KZ0 A;  4MEM A;  2JWZ A;  4PYU A;  2J0M A;  5FR6 A;  1LQB A;  5EDS A;  2MSE D;  2ZNV B;  3BY4 B;  4MM3 A;  4B95 A;  2LRU A;  4GIV A;  4TV3 A;  2N1W A;  3ZTD A;  4MSQ B;  5CHF A;  4KSK C;  3B0A A;  4I6P A;  2BKF A;  2REX A;  3V61 A;  2C5L C;  2D10 A;  2Z0E B;  3WAP A;  4DWF A;  3UIO B;  2LGD A;  4IWO A;  4W9L A;  1WYW B;  4W9I A;  3S2A A;  4HCN B;  3QHT A;  3VTU A;  2KO3 A;  3JVZ X;  1TGZ B;  3LDZ E;  4LJP B;  3EEC A;  2KDE B;  1WX7 A;  4KIK B;  3SU8 X;  5D2M B;  3M63 B;  5J17 A;  3ZVV A;  4DDI D;  4GDL B;  4ANX A;  1S3S G;  4TUU A;  5J2R A;  4W9C A;  3TJP A;  4GSW A;  2J7Q B;  3D32 A;  3QWZ B;  4MJS A;  2QHO A;  3QA8 A;  4HPM B;  2ZCC A;  3PLV A;  4WWO A;  2K8C A;  2PE9 A;  2JRH A;  3ML8 A;  3JW0 X;  4GB9 A;  3A1Q B;  4LDT D;  5HKH A;  4EUT A;  3A9K B;  1RRB A;  2N9X A;  2NR2 A;  2D3G A;  4BFR A;  1WMH B;  1E7V A;  4HDO A;  5J18 A;  4HPL B;  5G2N A;  1E90 A;  4YL8 A;  1UEL A;  2NCN A;  3HIZ A;  4DHJ D;  2GOW A;  3NZS A;  4ANV A;  2KOX A;  4NQK E;  1GC7 A;  4OVU A;  4HJK A;  2N9P C;  3QCA A;  5BO4 B;  2DAJ A;  4PS8 A;  3SD5 A;  2DZI A;  2N1V A;  4JL9 A;  2IBI B;  4JIO U;  4LCD E;  3MTN B;  3SHQ A;  2DZK A;  3HHM A;  3A9J B;  4HWI B;  4PS7 A;  2G3Q B;  4BKT A;  1IP9 A;  2C9W B;  3GZN I;  3PHW B;  3H7S A;  2PE6 B;  2J0K A;  2LWP A;  3NS8 A;  2JRI B;  3K9P B;  4OVV A;  3PS6 A;  2KC2 A;  4AWJ A;  2K39 A;  2XBB C;  4ASW C;  5L95 C;  3IFW B;  3N3K B;  2EMS A;  3MHS D;  4G0N B;  2KMA A;  1L2N A;  1V80 A;  3DCG A;  2WX1 A;  3JSV B;  2YVC A;  3KUC B;  1ISN A;  2MP2 A;  2XK5 B;  1OEY J;  4BBN C;  2NBV B;  4FLH A;  4NY0 A;  3H7P B;  2IO2 B;  4BOS C;  2LAS A;  2KLG A;  2MBH A;  3M62 B;  4FN2 A;  1HE8 A;  4XC2 A;  1E8W A;  1OGW A;  1Q5W B;  3L54 A;  2NBW B;  2W9N A;  3DVG X;  4IM2 A;  5KHQ A;  3RT3 B;  1H4R A;  1M94 A;  1SGH A;  3NOB A;  3X0W A;  1P98 A;  4FBJ B;  1GC6 A;  5D7G A;  2KJH B;  4G50 A;  2KAN A;  2C60 A;  4I6L B;  2AEH A;  2AL3 A;  2C7N B;  2NPT A;  4IM0 A;  4IW0 A;  4K81 A;  3VAW A;  3ZLZ A;  4EZK A;  1MG8 A;  4WJO A;  4M0W B;  3VVW B;  3LJ3 A;  3VFK A;  4CHK A;  2LGX A;  4K7W A;  4FJV B;  4W9G A;  3KH0 A;  3UIN B;  4EOY A;  5TR5 A;  2L0T A;  4LDT B;  4RMA A;  4JQW C;  1KOT A;  2N7E A;  2KN5 A;  5E6P A;  1EO6 A;  1WXV A;  4HCP B;  4N9F 4;  2WYQ A;  3QK0 A;  1V81 A;  5D94 A;  1WFY A;  3R7Q A;  2FCS A;  3WAM A;  3AUL A;  4AP4 C;  1P0R A;  4DHJ B;  1WE6 A;  2KFK A;  2XEW A;  1EUV B;  4ZRJ A;  2V4L A;  5AZG A;  3L13 A;  3RYT A;  2KKC A;  4WJP A;  4GDK A;  2FNJ B;  2KDF B;  3RUL A;  1C3T A;  3V6E B;  5LXI B;  3EFU A;  2LD9 A;  2IO3 B;  1NI2 A;  2DHZ A;  3B1L X;  3ONS A;  2Z0D B;  2ZZP B;  3ENE A;  4FJY A;  2NS5 A;  4WAA A;  3W1S C;  2CHX A;  2JY6 A;  3PTF C;  3RD2 A;  1WE7 A;  4JGH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...