1P1AA

Nmr structure of ubiquitin-like domain of hhr23b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog B
publication title Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p1aA00
2BGFA 3VTWA 4DXAB 4KIKA 1G6JA 4WWPA 3IG3A 2FCMA 4KIKB 2DZMA 4AJWA 4MH0E 4MGKE 4K81A 1WXAA 3UINB 2JZZA 4XC2A 4M8MA 3TL5A 2HJ8A 2LVOA 4W9KA 2D2QA 2KK8A 2NVUI 5L83A 1WX9A 3DBRI 3QHTA 3UQAA 1NBFC 2KTFA 4ANUA 3QCAA 4AWJA 4LJPB 4B6WA 4HPMB 1WF9A 5EDSA 1YJ1A 1RAXA 2PPHA 3W1YA 3L0WB 3M3JA 4K1RB 4HVBA 4WJOA 3AULA 3KYCD 4LCDE 2DX5B 2ZVNA 2GBRA 4GN1A 4MEMA 1WJ6A 3R66C 4ICUA 2BYVE 3UGBB 1R4NI 2NBUA 3UIOB 5CHFA 2WDTB 3AU5A 2REXA 2Y5BB 1ZGUB 2CKHB 2HE7A 1L7YA 2LUEA 1OEYA 4BKSA 4DDGD 2AWTA 4E3CA 3PRPB 3UF8A 3VXWA 4BKSD 4AOFA 1WE6A 3APDA 2FAZA 4N9F4 3ALBA 1E8WA 3NHEB 4GDLA 5C23A 1E5WA 3PZDA 3ZNHB 2K1FA 1X1MA 4CHKA 4W9FA 4GDLB 3DBHI 1OTRB 3DDCB 5JHAA 1E7VA 4AP4C 2IY1B 4BFRA 5C1ZA 1TTNA 1H4RA 3A4SC 2A4ZA 2FUHB 2KDFB 3PLVA 1A5RA 2RSUA 4TQ1A 4HCPB 2EMSA 1OQYA 1WJUA 2BYEA 3KUCB 2K25A 4HPLB 3TJPA 4TV3A 2KFKA 1UBQA 4NQLB 3HM6X 1WM3A 2JZ3B 4K7SA 3JYUA 1VD2A 1GNUA 2KFKB 1SGHA 2KVRA 4HK2A 3BINA 3L13A 4A3OA 5CTRC 3QARA 4IW0A 2ZPNA 2MCNB 4FA6A 2DYMA 2KJ6A 3VUWA 4EEWA 4RM9A 4ANVA 5HKHA 3ECIA 2DYOA 2KMAA 1UGMA 1YX6B 5CHWA 1KM7A 2ZJDA 2BPSA 4J6IA 3V60A 4FN2A 4MJSA 2KMCA 5D94A 2LVPA 3QK0A 4MJSB 2ZNVB 4ZRKA 1WGHA 4W9HA 1HE8A 4MSQB 4DWFA 4IM2A 1JRUA 3PPAA 4WJPA 2KX0A 4ZDVA 1V49A 5J17A 1WGRA 4ZRIA 3NZSA 2WX1A 2V3SA 4BVUC 4E74A 3PLUA 1GG3A 2KLCA 4GGQA 4IC7B 3L54A 3IVFA 2KDEB 2PJHA 3H7PA 4PS3A 2MWSB 4IM3A 3BY4B 3I3TB 3N30A 1WZ3A 1U4AA 3H7PB 1Y8RC 2K6DB 2EKEC 2KD0A 2K8HA 1V80A 2J7QB 2MP2A 1WIAA 2M0XA 3B0AA 2JT4B 2IO3B 1KJTA 3QJZA 2C60A 2KJRA 2MP2B 4DHZE 5L95C 1WM2A 2RGFA 4EZJA 2N1VA 5DPWA 4AUQC 3U7DA 3R7RA 2KWVB 3SHQA 1XD3B 3QX1A 4M0WB 5JHBA 4WJNA 3M95A 1WI0A 3DVGY 1WE7A 2G4SA 2KC2A 2CU1A 4GXBA 2JF5A 3H7SA 3VAWA 4BKTA 2AYOB 3M62B 1GC7A 4MM3A 2C7HA 4MGIE 2AL3A 2D07B 5IA7A 4PS7A 3NOBA 4B95A 3KVFB 1VCBA 3N32A 5J2RA 4E71A 2JRHA 3PVLA 2MBEA 3GOEA 2C7MB 3PHXB 1V81A 1IYFA 2LVQA 2NPTA 2BYFA 2XEWA 3MHSD 5KHOA 1E8ZA 3CSTA 4P7IA 4OVVA 4OVUA 3C0RB 2NPTB 5AZGA 1WGDA 2LGXA 4KDLB 3VTVA 2MQJA 4LDTD 1NDDA 2CHWA 3ONSA 4LDTB 2RPQA 1UD7A 3CSFA 4URKA 3ZRFA 2LRUA 5AEKB 2N9EB 4HDOA 3ZTCA 3N3KB 3A9KA 2L0FA 1E7UA 4HJKA 2L7RA 4WAAA 4ANXA 1WX8A 3ENEA 3OAWA 3A9KB 2KXJA 2LXCA 4GU2A 4WWOA 1V2YA 1XT9B 1WMHA 1WXSA 2K39A 2KANA 2D10A 2UYZB 2WX0A 3MJWA 1YQBA 1SE9A 1UBIA 1WMHB 3L08A 3IBEA 4W9JA 1WRDB 4BBNC 1UH6A 4NJ6A 2KQSA 4DBGA 2O6VA 4KSKC 2WWZA 4GDKA 4TQ0A 1K8RB 4HWIB 2O6VD 2O2VA 2MX2A 2N4FA 2O6VB 4B9KA 1KLVA 4GDKB 3DCGA 3PT2B 3NY5A 3NZUA 1AARA 1EF1A 1SIFA 2D3GA 2O2VB 4W9CA 3HHMA 2C5LC 3DPDA 3SD5A 2BKFA 3L10B 2B3AA 4KDIC 1V6EA 2KWUB 1E8XA 3AI5A 2KHWB 1IP9A 3AXCA 2KTRA 4NPNA 1V5OA 3H1UA 4HXDA 3PS6A 5E6NA 4FJVB 2KTRB 2LD9A 5DPTA 1LM8B 3D32A 1YIWA 2JWZA 4NJ7A 3WIMA 3VH4B 4II3B 2FCQA 2LXAA 3CF6E 4GOCA 3L16A 5D7GA 3QC8B 3Q3JA 4JGHB 5E6PA 3DBSA 2JRIB 2KZRA 2AL6A 3U8ZA 1F9JA 1TGZB 2DHZA 2DYBA 2PE6B 3O65B 5DPRA 2FCNA 2LZ6A 3LDZE 4FHJA 2JPHA 3DVNU 3TIXA 2N1WA 3PREA 3VVWB 3A1QA 4W9DA 2MLBA 3DOWA 2R2QA 2KNBA 4XZ4A 4KZ0A 4ICVA 1TBEA 5E6OA 1S1QB 2GOWA 3A1QB 2J0JA 5BO4B 4MGYE 3A33B 4CYEA 1UZXB 3GZNI 5LXIB 2J0KA 3PGEA 2K6QA 3KYDD 1MG8A 1GC6A 4GIVA 3DVNV 1C3TA 2G3QB 2FIDA 3OJ3A 4GMVA 2KKCA 1PQSA 4IWPA 4IM0A 3SDLC 5AZFA 2ASQA 1V86A 4I6NB 5DCNA 4DK5A 2LWPA 4G0NB 2HTHA 4IWOA 4TUUA 2LGYA 4G11A 2L00B 4II2B 1J8CA 2V1YA 2Z0EB 4NQKE 2MBOA 3UQBA 2GBKA 3RCZA 2KDBA 2XBBC 4IWQA 2KWCA 4IUMB 3KH0A 4BBNF 2RR9A 2IO2B 3M63B 4WWNA 3T9LA 3ZLZA 4W9IA 1QZEA 5AZHA 1WGGA 2C7NB 2AEHA 5CHVC 1OEYJ 3ZNZB 1P98A 2CR5A 4DDID 4AJYB 3W1SA 1WH3A 2Z59B 4I6LB 4PYUA 3WAOA 1IPGA 3X0WA 4BOSC 4IG7B 2MBQA 2L76A 4YL8A 3TMPB 3VFKA 4FJZA 2IO1B 4RM8A 4ZRJA 4TKNA 3RT3B 2ZPYA 3QQ8B 5G2NA 4KSLC 3R7QA 3B08A 3LJ3A 3V61A 4EFOA 2MW5A 2N9XA 3KUZA 3ML8A 5FR6A 3EC8A 4FJYA 1H8CA 3VHTC 3NS8A 4W9GA 1LXDA 2KDIA 3K9OB 5D2MB 3W1SC 1ISNA 3ZVVA 4DHZB 2K8BA 1I42A 3P2BA 1I35A 2QHOA 3RUIB 1FXTB 2NBVB 3OJ4B 1M94A 3QA8A 2GMIC 4G50A 2VRRB 4W9EA 1V5TA 2JUOA 1C1YB 1R4MI 1RLFA 4JQWC 3VQIA 4BKGA 2BF8B 2YLMA 4HCNB 4F1SA 2IZVB 2L3ZA 3PRZA 4FADA 4GB9A 2ZZPB 3MTNB 2KO3A 1Z2MA 4EUTA 2FIFA 2IY0B 3HIZA 2NS5A 4ANWA 2K8CA 2YVCA 4ASWC 1D3ZA 3RYTA 2DAJA 2ZVOA 2PEAA 5J18A 2ZEQA 1P1AA 4JIOU 3WAPA 2J0MA 3IFWB 1UELA 3ML9A 3A4RA 3EHVA 2IYDB 3VTUA 3HM3A 1RRBA 2I1KA 3DBLI 4G3XB 2MSED 1WR6E 2NCNA 3VH3B 2OJRA 3KUDB 1WXVA 2XK5A 3ZRCA 4EOYA 3RZWC 2N7EA 4KVGB 3ZTDA 1NI2A 2XK5B 1E90A 1EUVB 3Q3FA 3X23A 5LLIA 2GBMA 3CMMB 5DPSA 3JSVA 3VUYA 2LGDA 2N9PC 1YD8U 4K7WA 3WALA 1RFAA 2BWES 2LASA 1LFDA 3JSVB 3VUXA 3QWZB 2MRPA 2DZKA 4F8CB 2Z0DB 2JXXA 2MA9B 3DVGX 3H9DA 3ZNGC 1XQQA 4FBJB 3KW5B 3ZNID 1KOTA 1WZ0A 2G4DB 4NNJB 3H6NA 4WQOB 4FULA 2BKRB 4LJOB 3SU8X 3ZO5B 2RD0A 5GMVA 2L05A 3TCAA 1Z5SB 2GBJA 3JW0X 1GUAB 4EZKA 4NAWA 1EO6A 5TR5A 4KZCA 4NAWB 1S3SG 3V62A 3EFUA 2MBHA 3DQVA 3ZUNA 2KQ7A 4BOZB 3PV1A 3ZKJC 2C9WB 3V6CB 2KFJA 1WX7A 2N7DA 4W9LA 3WANA 3ZW3A 1T0YA 1YX5B 1ZW7A 5G55A 4A20A 1J0GA 2CHZA 2JY6A 3ZDMC 4F7ZA 4DHJD 2M17A 4DHJB 1WY8A 5CX3A 2DAFA 2KN5A 3U30A 2DZIA 2NBWB 1WYWB 2ZCCA 5JZEB 1BT0A 2BWFA 2LI5A 2JVCA 4GSWA 1OGWA 3AU4A 4KV2A 3K9PB 1WFYA 2ZCBA 4M8NA 4MSMB 4MGZE 3RZFA 5KHQA 1WJNA 2A5UA 3OLMD 1Q0WB 3VDZA 3ZIMA 2KLGA 2MBBB 3PRMB 3PTFC 3A9JA 3QIJA 3WA0A 1ZKHA 5LXHA 4MELA 1GJZA 1Q1OA 2M1MA 2W9NA 3A9JB 4HLEA 1P0RA 2D11A 2CHXA 1TZ1A 3IHPC 4NY0A 1WXMA 2FNJB 2ZNVC 1WR1A 2V4LA 4PS8A 1WGYA 1WJ4A 2LRWA 5JH5C 2GBNA 3TBLD 4JLCA 3RULA 3B1LX 4PYZA 2DENB 3V6EB 2IO0B 2CS4A 3HK0A 2HD5B 4WJQA 4RMAA 2M8SA 3PSEB 4FLHA 3S2AA 1J19A 1EF5A 3RD2A 3ZDTA 2WYQA 3JVZX 1E8YA 4K7UA 5IAAC 5D6JB 3L17A 4MDKE 2I1JA 4A3PA 2OOBB 2IBIB 4FHKA 4CO7A 4EKUA 3PHWB 3T8MA 1V9JA 2KJHB 2L8JA 1P3QU 2NR2A 1Q5WB 1P9DU 3EECA 3APFA 2EMTA 3R3MA 4XX5A 3WAMA 2KOXA 4EZLA 2L0TA 2M4NA 2UWQA 3QAQA 4JL9A 1LQBA 4ZYNA 3UIPB 4I6PA 1L2NA 2KX3A 2R2OA 2KC1A 4X57B 4HDQA 3APCA 2LJ5A 2FCSA 2DZJA 1CMXB 2PE9A 2G45B
chains in the Genus database with same CATH superfamily
3KWLA 2BGFA 3VTWA 4DXAB 2RDGA 4KIKA 4WWPA 4KGRA 3SFDB 3AN1A 4C4VB 4MH0E 4MGKE 1HTQA 2JZZA 4XC2A 1WX9A 4K3BA 4XDDA 4YXDB 1WF9A 1PFDA 2LUMA 1RAXA 3V3XA 3M3JA 4WJOA 1UF0A 3AULA 3KYCD 4GN1A 1WJ6A 2BYVE 3UGBB 3UIOB 3IT6B 2CKHB 4LLGM 2RMMA 3U2SC 4E3CA 3VXWA 1WE6A 2FAZA 3P4SB 4JPSA 1T6BX 3NHEB 2BVCA 1X1MA 4GDLB 3DBHI 5C1ZA 2KDFB 1OQYA 1UBQA 1D5MC 1WM3A 1D5XC 3PZ7A 2KFKB 1SGHA 3UI3A 4HK2A 3L13A 1T3QA 3QARA 2KAJA 4IW0A 2ZPNA 2KJ6A 4L23A 4EEWA 2WXJA 2FBWB 3V60A 4KKIA 3AE7B 5FKAC 2LVPA 2ZNVB 4ZDVA 3B2GA 4ZRIA 2V3SA 4BVUC 3PLUA 1IUEA 3NJTA 2JZPA 1TKGA 2KDEB 2Y3AA 4IM3A 4GLSC 3N30A 1U4AA 2D3CA 1CZPA 4YSZB 2K6DB 3VR8B 2WXRA 2IO3B 4YTNB 1WWTA 4AUQC 4M0WA 3U7DA 3R7RA 3SHQA 5JHBA 3M95A 1WI0A 3DVGY 5IO9A 2DWQA 3AEAB 4GXBA 1L0VB 2WDQB 2QIEB 5HHDG 3AE8B 3M62B 2Q5WD 2D07B 4MM3B 3R2TA 3NOBA 3W5VB 4C7ZA 5J2RA 2JRHA 3PVLA 4IOIE 1J7AA 2NPTA 2XEWA 3CSTA 4P7IA 4OVUA 3C0RB 1YJJA 2GB1A 1ZUD2 1UUPA 2J42A 1WGDA 1ZOYB 5D3DA 2CJNA 1NDDA 1DOYA 4HROA 3P4PB 1I4GA 3ZRFA 5MPOA 2J52A 2LRUA 3ZTCA 5IN7A 2L0FA 3Q14C 4HJKA 3GE8C 3ENEA 1FM0D 3OAWA 2KXJA 2LXCA 4PK1A 1V2YA 1J7CA 1WXSA 2D10A 1TS4A 2WX0A 3MJWA 1WYGA 1GOZA 3L08A 2BW2A 3W2DA 1WGKA 3N1YC 4DBGA 2O6VA 4KSKC 4TQ0A 1K8RB 3Q8BA 2O2VA 1I4PA 2MX2A 4B9KA 3NY5A 1EF1A 3SD5A 2BKFA 4OZCA 1UGJA 3DBHB 3AI5A 1IP9A 1FNVA 1QKZA 1OQRA 4HXDA 3PS6A 2WXQA 2NMQA 1LM8B 3D32A 1YIWA 1TS2A 2FCQA 3AE2B 3Q3JA 4JGHB 2H88B 1EWYC 3L4PA 1TGZB 1F9JA 2DHZA 1AYFA 2DYBA 5DPRA 4OHJA 2FCNA 2LZ6A 2NTTA 2WXKA 3VVWB 2R2QA 4XZ4A 4CYEA 1UZXB 1XEEA 3GZNI 5LXIB 4GIVA 3DVNV 3DWGC 2FIDA 4IWPA 5BYRA 1V86A 4I6NB 2LGYA 2JU6X 4C00A 4NQKE 1ZXHA 3RCZA 4IWQA 2KWCA 3KH0A 4LNOA 3M63B 4W9IA 3ZXRA 3KWVA 1WGGA 2AEHA 1IPGA 2MBQA 4YL8A 3ZJVA 3RT3B 5G2NA 3P63A 3R7QA 3B08A 3LJ3A 4EFOA 3VHTC 2LHEA 4A55A 2KDIA 3Q69A 5D2MB 2VZKD 3W1SC 1ISNA 3ZVVA 2VZKB 1I35A 2INCC 1FXTB 3RNFC 2NBVB 4G50A 2GMIC 1J7BA 2VRRB 2JUOA 1QOFA 3SR6A 2BS3B 1FD6A 4GB9A 2ZZPB 2KO3A 4ANWA 2K8CA 4ASWC 1FFVA 1P1AA 4KGTA 5BYSA 3BK1A 1YN5A 3FKYA 3ML9A 3A4RA 3EHVA 3IXSA 4YSYB 1RYJA 3DBLI 1MHHE 1WR6E 1MVKA 2WXGA 4LTUA 2XK5A 1JWSD 4WQMA 3AEFB 1NI2A 1NYQA 5D3IB 1K52A 3X23A 3CMMB 1LFDA 2LASA 3VUXA 2MRPA 2MA9B 3H9DA 1AW7A 3ZNGC 4O1NA 2W3RA 5H92C 1WZ0A 1N62A 4NNJB 2K5PA 4FULA 2BKRB 1IBXA 2RD0A 4HKZE 2L05A 1Z5SB 2IGGA 3ETRA 3N1ZC 3MC8A 5TR5A 2KQ4X 2ONQA 3DQVA 1NENB 2BT6A 2JYEA 2KFJA 5EE1A 1WX7A 2KWDA 1L6VA 2JYTA 1ZDXA 3ZW3A 1YX5B 5FK9C 2PMVA 1ZW7A 4A20A 2CHZA 2JY6A 4KGSA 3GZNB 2DAFA 2KN5A 1WYWB 3ZXVA 3TEYA 4ZHPA 4GSWA 4M8NA 4JWUC 4MSMB 3OLMD 3FAHA 3ZIMA 2KLGA 1D6EC 1E7PB 3WA0A 4RFBA 2IJ0A 1SE4A 1GJZA 2VH2A 2M1MA 3A9JB 4HLEA 1P0RA 2D11A 2CHXA 1TZ1A 1GB1A 2V4LA 4LNFA 1WGYA 2GBNA 4JLCA 2X38A 3RULA 1TKEA 1IGCA 5BMIA 2L32A 4WJQA 2K22A 4RMAA 2L83A 2IGHA 2G1EA 4FLHA 4OW0A 1EF5A 3RD2A 3ZDTA 2WYQA 5IAAC 1WSPA 4MDKE 1T5XD 2WXPA 2E3TA 3PHWB 3T8MA 2GI9A 2L8JA 2EMTA 2PLPA 3BVZA 2JQRB 1LQBA 4I6PA 1LGRA 2OJWA 2KC1A 4HDQA 2LJ5A 1ET9A 2DZJA 5AUIA 2D3AA 2PE9A 2ICIA 4XWWA 2GRIA 2FCMA 2DZMA 4AJWA 3HRDD 3AH7A 1WXAA 4JE3B 4M8MA 2HJ8A 2LVOA 2KK8A 2NVUI 4WWMA 1VZ8A 3UQAA 3DBLB 2KTFA 4B6WA 4HPMB 5EDSA 1BUIC 2IGDA 3Q2AC 2PPHA 2ZVNA 2N9KA 3CWIA 4WAFA 1R4NI 3AV8A 1ZGUB 2V3PA 1HZ5A 4BKSA 4DDGD 2AWTA 3PRPB 3UF8A 4AOFA 3ALBA 5C23A 1C4AA 3PZDA 2QEJC 3DDCB 2MJEA 3OG5A 2H89B 1H4RA 3A4SC 1A5RA 4TQ1A 4B0EA 1WJUA 3KUCB 4K7SA 1VD2A 2OEDA 4JWSC 2MCNB 4FA6A 2DYMA 1K51A 1EU3A 2DYOA 4J3OD 2KMAA 4HJGE 4MACA 2M19A 2W54A 2KMCA 3QK0A 4MJSB 4W9HA 4MSQB 4WJPA 1V49A 5J17A 3NZSA 2KLCA 4GGQA 3BZDB 3B9JA 3IVFA 2HTME 4P6VF 2PJHA 4RCOA 3H7PA 4PS3A 1C76A 1Y8RC 1MI0A 2EKEC 2MP2A 1V80A 3PZ8A 2M0XA 2JT4B 2C60A 2KJRA 4DHZE 1MHXA 1NEKB 1TT5B 1YNTE 3QX1A 4WJNA 1HEZE 4OZBA 2KC2A 4OZAA 2WXHA 4RGNA 3P1MA 4MGIE 1YQ4B 1ESFA 1C78A 2WU2B 1KLGD 3KVFB 3AE5B 3N32A 4E71A 2QILA 3ZJTA 3GOEA 2HJ1A 1ZPSA 2BYFA 1E8ZA 2KMMA 4S17A 4A8XC 4RGTA 5BMGA 3Q3MC 1IGDA 4KDLB 4REZA 3FILA 4ARCA 1JWMD 4XWTA 3U7ZA 5AEKB 4HDOA 3N3KB 2L7RA 3MC9A 3A9KB 1CQVA 4GU2A 1WMHA 2KANA 2UYZB 1SE9A 4MT5A 1F2RC 1WRDB 1R4NB 3VR9B 1UH6A 1JQ4A 4LK0M 1OFFA 1PGBA 2WWZA 3OWEB 4HWIB 1YOVB 2N4FA 3P4RB 4GDKB 1FNWA 1AARA 2D3GA 4W9CA 4RH6A 3DPDA 4BZAA 1SF0A 1XLOA 2DLBA 2EKIA 2KTRA 3ABVB 3H1UA 4FJVB 2LD9A 3WCQA 4ITKA 2JWZA 3I9V1 3VH4B 1E9MA 2B76B 2LXAA 2MJ3A 3CF6E 3L16A 1L5PA 2G9HD 3QC8B 5FR3A 1F77A 3O65B 1HA5A 1FFUA 1XLNA 2JPHA 3TIXA 2N1WA 2W82A 2ACZB 4ZRPA 3PREA 3TSSA 2BS2B 4W9DA 3DOWA 2VH1A 4KZ0A 4ICVA 3A1QB 2WXLA 4DQOC 2LEKA 2YEPF 3BVGA 4K3CA 3RPFC 1MG8A 1GC6A 2LMCA 2G3QB 1D5ZC 3SDLC 2ASQA 5DCNA 4P1CC 2RDBC 2L00B 2V1YA 2MBOA 3UQBA 2ON8A 3SEBA 1HZ6A 2RR9A 4Q2JA 4WWNA 3ZLZA 3LYYA 5AZHA 2JX5A 1OEYJ 4DDID 1P98A 4PYUA 2Z59B 4IG7B 3RN9C 3TMPB 4RM8A 1YN4A 3QQ8B 1GAQB 3ML8A 5FR6A 3EC8A 4FJYA 4W9GA 3O13A 3K9OB 1I42A 1SSNA 3RUIB 1TS3A 1A70A 1C1YB 4BKGA 1E10A 3NVZA 2BF8B 2YLMA 4F1SA 1L0YB 2QSDA 3I57A 3MTNB 1VRAB 2QMTA 2BS4B 2IY0B 3BIID 2WXOA 1FRRA 2NS5A 1YN3A 2YVCA 1VLBA 4EE2A 2ZVOA 3AE1B 2J0MA 3IFWB 5HFYA 5I4DA 3VTUA 1RRBA 1DGJA 4RGMA 3AEEB 3KUDB 2N7EA 1JMLA 1FCCC 5DPSA 2LGDA 2N9PC 1RFAA 1PGXA 3JSVB 3RNAC 3TEZA 4F8CB 2Z0DB 4H2AA 3KW5B 3TUOA 4US9A 1KOTA 2BB5A 3ZO5B 1V1PB 3JW0X 4EZKA 2CJOA 3ZGZA 4RGOS 2K0PA 4KZCA 4NAWB 4A90A 3V62A 1XLQA 3ZUNA 2MBHA 2KQ7A 1EWCA 4ZYSA 2C9WB 3HVDA 3WANA 3DHGC 4C56C 2M17A 1WY8A 2KDMA 4N59A 3U30A 2DZIA 2NBWB 1I4XA 3DHHC 1N5XA 2JVCA 1QOBA 2XN9C 3RZFA 2A5UA 3VDZA 2MBBB 3QIJA 4MELA 2AX5A 4L1BA 1C4PA 4P1BC 2ZNVC 1WR1A 1WJ4A 3GB1A 2LRWA 3TBLD 3MC0B 2D3BA 2CS4A 3HK0A 1HQRD 1ENFA 1J19A 1P7FA 3HUIA 2Y5PA 2MJDA 2LFIA 4FHKA 5C3JB 1JWBD 1PGAA 3IT4B 2KJHB 2NR2A 1Q5WB 3KQ4A 3APFA 4XX5A 1B1ZA 3ZJUA 1VZ6A 4XE0A 2KX3A 4XDCA 1T0RC 4X57B 2FCSA 3N1XC 4C4VA 1V8CA 4LNNA 4KIKB 5AUKA 2N9LA 1L0XB 1UWMA 2WNMA 3UINB 1FCLA 1E6EB 2K9XA 1NBFC 1F2RI 4ANUA 3QCAA 4AWJA 4C80A 1YJ1A 1JRPA 3L0WB 4HVBA 1JWUD 4MEMA 4B0MA 3R66C 4JX1C 3ZQ4A 5CHFA 2REXA 2Y5BB 3RMKC 2HE7A 1L7YA 2LUEA 1OEYA 2BQQA 1E8WA 2RPVA 4GDLA 1E5WA 2OHFA 3RNEC 1OTRB 5JHAA 1E7VA 4BFRA 2J4XA 1KTKA 2A4ZA 2FUHB 4QAYA 3AB5A 4HPLB 2BYEA 3TJPA 4TV3A 2KFKA 3HM6X 1F52A 3JYUA 4A3OA 3VUWA 4RM9A 4IDIA 5HKHA 3ECIA 5BMHA 1UGMA 1YX6B 3BYTB 3AE6B 1I4RA 2ZJDA 1FXAA 2BPSA 4J6IA 4FN2A 1PYWD 3W9CB 5D94A 2KYWA 4WH4A 2IDYA 4ZRKA 1WGHA 1JALA 1HE8A 1JRUA 3PPAA 4LNKA 4S0RA 5JXVA 2WX1A 2BB6A 4KX6B 1EU4A 1GG3A 4IC7B 1L4ZB 2WS3B 4PT5A 1DOIA 3BVMA 3BY4B 1WZ3A 2RDHA 2KD0A 2J7QB 1WIAA 1NVID 1RWSA 3QJZA 2L52A 5L95C 1WM2A 3H8HA 2N1VA 1SIJA 4C7YA 1XD3B 1RM6C 3I63C 4M0WB 4P16A 1WE7A 2G4SA 1XCTL 2JF5A 3H7SA 3VAWA 4BKTA 2AYOB 5EE3A 4MM3A 2C7HA 4B95A 1VCBA 1TIFA 3AE9B 3PHXB 1IYFA 2LVQA 3MHSD 2WXFA 5KHOA 2NPTB 1V1OA 3TEWA 4D2KA 5AZGA 3U4EG 2LGXA 1UD7A 1WXQA 1E7UA 5HG2A 4WWOA 1PUTA 3EFCA 1TS5A 2K39A 3R2IA 1F0ZA 5T8IA 1CJEA 2O6VD 2O6VB 1KLVA 3DCGA 3NZUA 1SIFA 2O2VB 3HHMA 2C5LC 2B3AA 1KRHA 3MHZA 1FNUA 1V6EA 2KWUB 4DXGA 1E8XA 4A6QA 2KHWB 3AXCA 1V5OA 1SXTA 5E6NA 5DPTA 4ZHOA 4II3B 4R3DA 1M4VA 4ARIA 1ROEA 3P42A 1AN8A 2JRIB 2AL6A 4L2YA 4FHJA 2PVOD 3DVNU 3BK2A 1ZXIA 2PVGC 5E6OA 1S1QB 2GOWA 2J0JA 5BO4B 4MGYE 3A33B 1ET6A 2W3SA 2J0KA 2K6QA 1SE2A 3KYDD 4US8A 1C3TA 1HTOA 3OJ3A 4GMVA 2KKCA 1MFWA 3BWUD 2I38A 3VRBB 4HPPA 1UNSA 4IM0A 4G0NB 2HTHA 4TUUA 4II2B 1J8CA 1I4HA 2Z0EB 2GBKA 2V0GA 1KLUD 2KDBA 2W55A 4IUMB 4BAXA 4BBNF 2JXTA 2C7NB 3ZNZB 4AJYB 1WH3A 3WAOA 4BOSC 1D4BA 2L76A 3VFKA 5IOIA 1AWDA 1QQRA 2IO1B 2IPKD 4FJZA 3NVWA 3KUZA 4NZLB 1H8CA 2M56B 1LXDA 4TMAB 1JW9D 4DHZB 3P2BA 2KVZA 3OJ4B 3QA8A 4W9EA 4ZRQA 4AQ7A 1RLFA 1R4MI 4JQWC 3VQIA 1GPXA 3TEXA 5IKCM 1FMAD 3EGRA 2L3ZA 1N60A 1Q10A 2WXMA 4EUTA 3U52E 4ZOHC 3HIZA 2D5GA 3AEDB 1XO3A 2DAJA 2PEAA 3AE4B 2ZEQA 3ZYYX 3WAPA 3AEGB 2JWUA 1TYGB 2SEBD 1SB3C 3HM3A 4G3XB 2BTEA 3ZRCA 4EOYA 3RZWC 4KVGB 3AEBB 2XK5B 3KLSX 1DOXA 1EUVB 2CU3A 3Q3FA 2GBMA 3E9SA 3VUYA 4K7WA 1OQQA 3NVVA 4DXFA 2DZKA 2JXXA 1FIQA 4MH8A 1F1HA 4FBJB 3Q8EA 1LO5D 3ZNID 2G4DB 3SU8X 4XYCA 5GMVA 3TCAA 2GBJA 1IBXB 3FC4A 1MG4A 2MEKA 1SE3A 3PO0A 1EO6A 5EE0A 1S3SG 1XXGA 5IP4D 4BOZB 3PV1A 2L1AA 3V6CB 2N7DA 1KFYB 3J9CA 5G55A 3Q6BA 5CX3A 1FPYA 4WURA 2ZCCA 4FXCA 2ZW1A 5JZEB 1BT0A 2XNAC 2LI5A 4N6EB 3C19A 3K9PB 1C77A 4M00A 4MGZE 1FXIA 3N20C 1WJNA 5KHQA 1XCQL 3MFGA 3PRMB 3R8BA 3PTFC 3A9JA 4NJCA 3GE3C 5GXGB 4YT0B 5JH5C 1YMHE 4PYZA 2WXIA 3Q3OC 3V6EB 2HD5B 2M8SA 3S2AA 3JVZX 4K7UA 2MHJA 2E6XA 2QC8A 5D6JB 1I4QA 3L17A 2I1JA 3RNCC 2KN4A 1BMLC 2IBIB 3GP7A 4HKQA 4EKUA 2V4IB 1P3QU 1P9DU 3R3MA 1R4MB 4USAA 1ZDVA 1C79A 2UWQA 3NRZA 3QAQA 4JL9A 3UIPB 1PDXA 2KT7A 1L2NA 2N7JA 4F7ZA 4TSSA 1G6JA 1SEBD 2DNFA 2PIAA 1VJKA 3IG3A 4K81A 1KH0A 4XGAB 2Y5CA 3TL5A 4YTMB 4W9KA 2D2QA 2NTSA 5L83A 3DBRI 3QHTA 3AM9A 4NAMA 1SBBB 3LB8C 4LJPB 2QCZA 1K53A 1ZE3D 3W1YA 4K1RB 4LCDE 2DX5B 2GBRA 2JSVX 1QILA 4ICUA 1RFKA 2INNE 2NBUA 1WRIA 2WDTB 3AU5A 1DYQA 1FO4A 2GLSA 4BKSD 1QF6A 3APDA 4N9F4 2R61A 3DWMA 5G5HA 4A9AA 3Q3NC 4M01A 3ZNHB 2K1FA 1SJED 4CHKA 4W9FA 2IY1B 1TTNA 3PLVA 2RSUA 4HCPB 2EMSA 3B2FA 2K25A 4NQLB 2JZ3B 1QOAA 1GNUA 2KVRA 4AS1A 3BINA 5CTRC 1TZOA 1JWAD 2PTLA 4ANVA 5CHWA 1XLPA 3V05A 1KM7A 4MJSA 5E6JA 2LGIA 4M02A 1N63A 1L6UA 4DWFA 4IM2A 4RF1A 4LNIA 2KX0A 1WGRA 1Y56A 4E74A 2PKOA 3L54A 2M0AA 1XF5L 3GS2A 2X8XX 2MWSB 3I3TB 2LGSA 3H7PB 2K8HA 3AMZA 3B0AA 1KJTA 1T0QC 1VZ7A 2MP2B 2RGFA 4EZJA 5DPWA 1JROA 2KWVB 3HVZA 2BYTA 5C2TB 2CU1A 1FRDA 1NYRA 5HI1A 1GC7A 4UDUC 2TSSA 2AL3A 5IA7A 4PS7A 1SJHD 1YJIA 5TSSA 2YEPB 2WLBA 4YSXB 4ACFA 1EM7A 2MBEA 2C7MB 2WGSA 1V81A 4CQNA 2WQYB 4OVVA 1MJDA 3T3NA 2KACA 1NI3A 2PW9A 3VTVA 2MQJA 4LDTD 2CHWA 3ONSA 4LDTB 2RPQA 2HDEA 3MP9A 3CSFA 4URKA 3DBRB 1YQ3B 3FILB 2N9EB 3A9KA 4ANXA 4WAAA 1WX8A 1XT9B 1QT9A 1YQBA 1UBIA 1WMHB 2WP9B 3IBEA 4W9JA 4BBNC 4NJ6A 2KQSA 2AQ3B 4GDKA 3VRAB 1JCKB 2SAKA 3PT2B 3MJ5A 4KKJA 4A3PA 3L10B 4KDIC 1FEHA 3C8YA 1BXTA 4NPNA 2KTRB 4NJ7A 3WIMA 4HEA1 3RFZB 4GOCA 3BYYB 5D7GA 5E6PA 2N0SB 2V3NA 3Q8AA 3NG0A 3DBSA 2KZRA 2WHIA 3U8ZA 2PE6B 3LDZE 2BBCA 3I5JC 3A1QA 2MLBA 3EUB2 2KNBA 2EELA 1TBEA 1R7SA 2INPE 3PGEA 4WIPA 5LNK1 5G5GA 3E56A 1PQSA 5AZFA 1VR9A 4YWGG 4DK5A 2LWPA 1TY0A 4IWOA 2FUG1 4G11A 3RNGC 2XBBC 3W5UB 1HXYD 2IO2B 3T9LA 1QOGA 1QZEA 5CHVC 3T3OA 2CR5A 2Z8LA 3W1SA 2WXNA 4I6LB 3X0WA 4ZRJA 4TKNA 2ZPYA 4KSLC 4RF0A 3V61A 1N61A 2MW5A 2N9XA 3LXFA 2WU5B 3RNBC 3NS8A 3NS1A 2ZW0A 1UWXA 2K8BA 2QHOA 1M94A 1K50A 1V5TA 1T0SC 2J53A 1C9FA 1TKYA 4HCNB 1C4CA 2IZVB 4IKGA 3PRZA 2FE8A 4FADA 2DBYA 1P7EA 1Z2MA 2FIFA 1D3ZA 1STEA 3RYTA 2UU7A 5J18A 4JIOU 3Q8FA 1UELA 2IYDB 2I1KA 2MSED 2NCNA 4RNAA 3VH3B 2OJRA 1WXVA 1B9RA 3P4QB 3ZTDA 1E90A 5LLIA 3NVYA 3JSVA 3WALA 1YD8U 2BWES 3QWZB 3IAS1 3DVGX 3NZ3A 1XQQA 4N58A 1E0ZA 3URYA 4HRSA 1V1PA 3H6NA 4WQOB 4LJOB 1ACCA 4YTPB 1GUAB 4NAWA 3N9YC 2QDFA 3SFEB 3EFUA 3AE3B 3ZKJC 1TY2A 5BYQA 2WDRB 2LHDA 1VDVA 4W9LA 1T0YA 1J0GA 2I2YA 3ZDMC 4DHJD 4DHJB 3CIRB 1ZP0B 2LJIA 3NUHB 2MH7A 2BWFA 2AQ2B 1CK1A 1OGWA 3AU4A 4KV2A 1WFYA 2ZCBA 1Q0WB 3AECB 1KF6B 2V9HA 4OVZA 1ZKHA 5LXHA 1MPEA 1Q1OA 2W9NA 3IHPC 4NY0A 2QJLA 1WXMA 2FNJB 2K3UA 4PS8A 5H8YE 5EE9A 1N5WA 3B1LX 2DENB 3Q8CA 2IO0B 3PSEB 1TJEA 1V97A 1E8YA 2OOBB 4CO7A 1L4DB 3EA6A 1V9JA 1I7HA 2AQ1B 2INDC 3EECA 3DHIC 3IAM1 3WAMA 2KOXA 3RI7C 4EZLA 2L0TA 2M4NA 1GB4A 2WDVB 4ZYNA 1QLBB 2R2OA 1N6ZA 3APCA 4AP4C 1CMXB 2G45B
chains in the Genus database with same CATH topology
2BGFA 3VTWA 4DXAB 4KIKA 1G6JA 4WWPA 3IG3A 2FCMA 4KIKB 2DZMA 4AJWA 4MH0E 4MGKE 4K81A 1WXAA 3UINB 2JZZA 4XC2A 4M8MA 3TL5A 2HJ8A 2LVOA 4W9KA 2D2QA 2KK8A 2NVUI 5L83A 1WX9A 3DBRI 3QHTA 3UQAA 1NBFC 2KTFA 4ANUA 3QCAA 4AWJA 4LJPB 4B6WA 4HPMB 1WF9A 5EDSA 1YJ1A 1RAXA 2PPHA 3W1YA 3L0WB 3M3JA 4K1RB 4HVBA 4WJOA 3AULA 3KYCD 4LCDE 2DX5B 2ZVNA 2GBRA 4GN1A 4MEMA 1WJ6A 3R66C 4ICUA 2BYVE 3UGBB 1R4NI 2NBUA 3UIOB 5CHFA 2WDTB 3AU5A 2REXA 2Y5BB 1ZGUB 2CKHB 2HE7A 1L7YA 2LUEA 1OEYA 4BKSA 4DDGD 2AWTA 4E3CA 3PRPB 3UF8A 3VXWA 4BKSD 4AOFA 1WE6A 3APDA 2FAZA 4N9F4 3ALBA 1E8WA 3NHEB 4GDLA 5C23A 1E5WA 3PZDA 3ZNHB 2K1FA 1X1MA 4CHKA 4W9FA 4GDLB 3DBHI 1OTRB 3DDCB 5JHAA 1E7VA 4AP4C 2IY1B 4BFRA 5C1ZA 1TTNA 1H4RA 3A4SC 2A4ZA 2FUHB 2KDFB 3PLVA 1A5RA 2RSUA 4TQ1A 4HCPB 2EMSA 1OQYA 1WJUA 2BYEA 3KUCB 2K25A 4HPLB 3TJPA 4TV3A 2KFKA 1UBQA 4NQLB 3HM6X 1WM3A 2JZ3B 4K7SA 3JYUA 1VD2A 1GNUA 2KFKB 1SGHA 2KVRA 4HK2A 3BINA 3L13A 4A3OA 5CTRC 3QARA 4IW0A 2ZPNA 2MCNB 4FA6A 2DYMA 2KJ6A 3VUWA 4EEWA 4RM9A 4ANVA 5HKHA 3ECIA 2DYOA 2KMAA 1UGMA 1YX6B 5CHWA 1KM7A 2ZJDA 2BPSA 4J6IA 3V60A 4FN2A 4MJSA 2KMCA 5D94A 2LVPA 3QK0A 4MJSB 2ZNVB 4ZRKA 1WGHA 4W9HA 1HE8A 4MSQB 4DWFA 4IM2A 1JRUA 3PPAA 4WJPA 2KX0A 4ZDVA 1V49A 5J17A 1WGRA 4ZRIA 3NZSA 2WX1A 2V3SA 4BVUC 4E74A 3PLUA 1GG3A 2KLCA 4GGQA 4IC7B 3L54A 3IVFA 2KDEB 2PJHA 3H7PA 4PS3A 2MWSB 4IM3A 3BY4B 3I3TB 3N30A 1WZ3A 1U4AA 3H7PB 1Y8RC 2K6DB 2EKEC 2KD0A 2K8HA 1V80A 2J7QB 2MP2A 1WIAA 2M0XA 3B0AA 2JT4B 2IO3B 1KJTA 3QJZA 2C60A 2KJRA 2MP2B 4DHZE 5L95C 1WM2A 2RGFA 4EZJA 2N1VA 5DPWA 4AUQC 3U7DA 3R7RA 2KWVB 3SHQA 1XD3B 3QX1A 4M0WB 5JHBA 4WJNA 3M95A 1WI0A 3DVGY 1WE7A 2G4SA 2KC2A 2CU1A 4GXBA 2JF5A 3H7SA 3VAWA 4BKTA 2AYOB 3M62B 1GC7A 4MM3A 2C7HA 4MGIE 2AL3A 2D07B 5IA7A 4PS7A 3NOBA 4B95A 3KVFB 1VCBA 3N32A 5J2RA 4E71A 2JRHA 3PVLA 2MBEA 3GOEA 2C7MB 3PHXB 1V81A 1IYFA 2LVQA 2NPTA 2BYFA 2XEWA 3MHSD 5KHOA 1E8ZA 3CSTA 4P7IA 4OVVA 4OVUA 3C0RB 2NPTB 5AZGA 1WGDA 2LGXA 4KDLB 3VTVA 2MQJA 4LDTD 1NDDA 2CHWA 3ONSA 4LDTB 2RPQA 1UD7A 3CSFA 4URKA 3ZRFA 2LRUA 5AEKB 2N9EB 4HDOA 3ZTCA 3N3KB 3A9KA 2L0FA 1E7UA 4HJKA 2L7RA 4WAAA 4ANXA 1WX8A 3ENEA 3OAWA 3A9KB 2KXJA 2LXCA 4GU2A 4WWOA 1V2YA 1XT9B 1WMHA 1WXSA 2K39A 2KANA 2D10A 2UYZB 2WX0A 3MJWA 1YQBA 1SE9A 1UBIA 1WMHB 3L08A 3IBEA 4W9JA 1WRDB 4BBNC 1UH6A 4NJ6A 2KQSA 4DBGA 2O6VA 4KSKC 2WWZA 4GDKA 4TQ0A 1K8RB 4HWIB 2O6VD 2O2VA 2MX2A 2N4FA 2O6VB 4B9KA 1KLVA 4GDKB 3DCGA 3PT2B 3NY5A 3NZUA 1AARA 1EF1A 1SIFA 2D3GA 2O2VB 4W9CA 3HHMA 2C5LC 3DPDA 3SD5A 2BKFA 3L10B 2B3AA 4KDIC 1V6EA 2KWUB 1E8XA 3AI5A 2KHWB 1IP9A 3AXCA 2KTRA 4NPNA 1V5OA 3H1UA 4HXDA 3PS6A 5E6NA 4FJVB 2KTRB 2LD9A 5DPTA 1LM8B 3D32A 1YIWA 2JWZA 4NJ7A 3WIMA 3VH4B 4II3B 2FCQA 2LXAA 3CF6E 4GOCA 3L16A 5D7GA 3QC8B 3Q3JA 4JGHB 5E6PA 3DBSA 2JRIB 2KZRA 2AL6A 3U8ZA 1F9JA 1TGZB 2DHZA 2DYBA 2PE6B 3O65B 5DPRA 2FCNA 2LZ6A 3LDZE 4FHJA 2JPHA 3DVNU 3TIXA 2N1WA 3PREA 3VVWB 3A1QA 4W9DA 2MLBA 3DOWA 2R2QA 2KNBA 4XZ4A 4KZ0A 4ICVA 1TBEA 5E6OA 1S1QB 2GOWA 3A1QB 2J0JA 5BO4B 4MGYE 3A33B 4CYEA 1UZXB 3GZNI 5LXIB 2J0KA 3PGEA 2K6QA 3KYDD 1MG8A 1GC6A 4GIVA 3DVNV 1C3TA 2G3QB 2FIDA 3OJ3A 4GMVA 2KKCA 1PQSA 4IWPA 4IM0A 3SDLC 5AZFA 2ASQA 1V86A 4I6NB 5DCNA 4DK5A 2LWPA 4G0NB 2HTHA 4IWOA 4TUUA 2LGYA 4G11A 2L00B 4II2B 1J8CA 2V1YA 2Z0EB 4NQKE 2MBOA 3UQBA 2GBKA 3RCZA 2KDBA 2XBBC 4IWQA 2KWCA 4IUMB 3KH0A 4BBNF 2RR9A 2IO2B 3M63B 4WWNA 3T9LA 3ZLZA 4W9IA 1QZEA 5AZHA 1WGGA 2C7NB 2AEHA 5CHVC 1OEYJ 3ZNZB 1P98A 2CR5A 4DDID 4AJYB 3W1SA 1WH3A 2Z59B 4I6LB 4PYUA 3WAOA 1IPGA 3X0WA 4BOSC 4IG7B 2MBQA 2L76A 4YL8A 3TMPB 3VFKA 4FJZA 2IO1B 4RM8A 4ZRJA 4TKNA 3RT3B 2ZPYA 3QQ8B 5G2NA 4KSLC 3R7QA 3B08A 3LJ3A 3V61A 4EFOA 2MW5A 2N9XA 3KUZA 3ML8A 5FR6A 3EC8A 4FJYA 1H8CA 3VHTC 3NS8A 4W9GA 1LXDA 2KDIA 3K9OB 5D2MB 3W1SC 1ISNA 3ZVVA 4DHZB 2K8BA 1I42A 3P2BA 1I35A 2QHOA 3RUIB 1FXTB 2NBVB 3OJ4B 1M94A 3QA8A 2GMIC 4G50A 2VRRB 4W9EA 1V5TA 2JUOA 1C1YB 1R4MI 1RLFA 4JQWC 3VQIA 4BKGA 2BF8B 2YLMA 4HCNB 4F1SA 2IZVB 2L3ZA 3PRZA 4FADA 4GB9A 2ZZPB 3MTNB 2KO3A 1Z2MA 4EUTA 2FIFA 2IY0B 3HIZA 2NS5A 4ANWA 2K8CA 2YVCA 4ASWC 1D3ZA 3RYTA 2DAJA 2ZVOA 2PEAA 5J18A 2ZEQA 1P1AA 4JIOU 3WAPA 2J0MA 3IFWB 1UELA 3ML9A 3A4RA 3EHVA 2IYDB 3VTUA 3HM3A 1RRBA 2I1KA 3DBLI 4G3XB 2MSED 1WR6E 2NCNA 3VH3B 2OJRA 3KUDB 1WXVA 2XK5A 3ZRCA 4EOYA 3RZWC 2N7EA 4KVGB 3ZTDA 1NI2A 2XK5B 1E90A 1EUVB 3Q3FA 3X23A 5LLIA 2GBMA 3CMMB 5DPSA 3JSVA 3VUYA 2LGDA 2N9PC 1YD8U 4K7WA 3WALA 1RFAA 2BWES 2LASA 1LFDA 3JSVB 3VUXA 3QWZB 2MRPA 2DZKA 4F8CB 2Z0DB 2JXXA 2MA9B 3DVGX 3H9DA 3ZNGC 1XQQA 4FBJB 3KW5B 3ZNID 1KOTA 1WZ0A 2G4DB 4NNJB 3H6NA 4WQOB 4FULA 2BKRB 4LJOB 3SU8X 3ZO5B 2RD0A 5GMVA 2L05A 3TCAA 1Z5SB 2GBJA 3JW0X 1GUAB 4EZKA 4NAWA 1EO6A 5TR5A 4KZCA 4NAWB 1S3SG 3V62A 3EFUA 2MBHA 3DQVA 3ZUNA 2KQ7A 4BOZB 3PV1A 3ZKJC 2C9WB 3V6CB 2KFJA 1WX7A 2N7DA 4W9LA 3WANA 3ZW3A 1T0YA 1YX5B 1ZW7A 5G55A 4A20A 1J0GA 2CHZA 2JY6A 3ZDMC 4F7ZA 4DHJD 2M17A 4DHJB 1WY8A 5CX3A 2DAFA 2KN5A 3U30A 2DZIA 2NBWB 1WYWB 2ZCCA 5JZEB 1BT0A 2BWFA 2LI5A 2JVCA 4GSWA 1OGWA 3AU4A 4KV2A 3K9PB 1WFYA 2ZCBA 4M8NA 4MSMB 4MGZE 3RZFA 5KHQA 1WJNA 2A5UA 3OLMD 1Q0WB 3VDZA 3ZIMA 2KLGA 2MBBB 3PRMB 3PTFC 3A9JA 3QIJA 3WA0A 1ZKHA 5LXHA 4MELA 1GJZA 1Q1OA 2M1MA 2W9NA 3A9JB 4HLEA 1P0RA 2D11A 2CHXA 1TZ1A 3IHPC 4NY0A 1WXMA 2FNJB 2ZNVC 1WR1A 2V4LA 4PS8A 1WGYA 1WJ4A 2LRWA 5JH5C 2GBNA 3TBLD 4JLCA 3RULA 3B1LX 4PYZA 2DENB 3V6EB 2IO0B 2CS4A 3HK0A 2HD5B 4WJQA 4RMAA 2M8SA 3PSEB 4FLHA 3S2AA 1J19A 1EF5A 3RD2A 3ZDTA 2WYQA 3JVZX 1E8YA 4K7UA 5IAAC 5D6JB 3L17A 4MDKE 2I1JA 4A3PA 2OOBB 2IBIB 4FHKA 4CO7A 4EKUA 3PHWB 3T8MA 1V9JA 2KJHB 2L8JA 1P3QU 2NR2A 1Q5WB 1P9DU 3EECA 3APFA 2EMTA 3R3MA 4XX5A 3WAMA 2KOXA 4EZLA 2L0TA 2M4NA 2UWQA 3QAQA 4JL9A 1LQBA 4ZYNA 3UIPB 4I6PA 1L2NA 2KX3A 2R2OA 2KC1A 4X57B 4HDQA 3APCA 2LJ5A 2FCSA 2DZJA 1CMXB 2PE9A 2G45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGF A;  3VTW A;  4DXA B;  4KIK A;  1G6J A;  4WWP A;  3IG3 A;  2FCM A;  4KIK B;  2DZM A;  4AJW A;  4MH0 E;  4MGK E;  4K81 A;  1WXA A;  3UIN B;  2JZZ A;  4XC2 A;  4M8M A;  3TL5 A;  2HJ8 A;  2LVO A;  4W9K A;  2D2Q A;  2KK8 A;  2NVU I;  5L83 A;  1WX9 A;  3DBR I;  3QHT A;  3UQA A;  1NBF C;  2KTF A;  4ANU A;  3QCA A;  4AWJ A;  4LJP B;  4B6W A;  4HPM B;  1WF9 A;  5EDS A;  1YJ1 A;  1RAX A;  2PPH A;  3W1Y A;  3L0W B;  3M3J A;  4K1R B;  4HVB A;  4WJO A;  3AUL A;  3KYC D;  4LCD E;  2DX5 B;  2ZVN A;  2GBR A;  4GN1 A;  4MEM A;  1WJ6 A;  3R66 C;  4ICU A;  2BYV E;  3UGB B;  1R4N I;  2NBU A;  3UIO B;  5CHF A;  2WDT B;  3AU5 A;  2REX A;  2Y5B B;  1ZGU B;  2CKH B;  2HE7 A;  1L7Y A;  2LUE A;  1OEY A;  4BKS A;  4DDG D;  2AWT A;  4E3C A;  3PRP B;  3UF8 A;  3VXW A;  4BKS D;  4AOF A;  1WE6 A;  3APD A;  2FAZ A;  4N9F 4;  3ALB A;  1E8W A;  3NHE B;  4GDL A;  5C23 A;  1E5W A;  3PZD A;  3ZNH B;  2K1F A;  1X1M A;  4CHK A;  4W9F A;  4GDL B;  3DBH I;  1OTR B;  3DDC B;  5JHA A;  1E7V A;  4AP4 C;  2IY1 B;  4BFR A;  5C1Z A;  1TTN A;  1H4R A;  3A4S C;  2A4Z A;  2FUH B;  2KDF B;  3PLV A;  1A5R A;  2RSU A;  4TQ1 A;  4HCP B;  2EMS A;  1OQY A;  1WJU A;  2BYE A;  3KUC B;  2K25 A;  4HPL B;  3TJP A;  4TV3 A;  2KFK A;  1UBQ A;  4NQL B;  3HM6 X;  1WM3 A;  2JZ3 B;  4K7S A;  3JYU A;  1VD2 A;  1GNU A;  2KFK B;  1SGH A;  2KVR A;  4HK2 A;  3BIN A;  3L13 A;  4A3O A;  5CTR C;  3QAR A;  4IW0 A;  2ZPN A;  2MCN B;  4FA6 A;  2DYM A;  2KJ6 A;  3VUW A;  4EEW A;  4RM9 A;  4ANV A;  5HKH A;  3ECI A;  2DYO A;  2KMA A;  1UGM A;  1YX6 B;  5CHW A;  1KM7 A;  2ZJD A;  2BPS A;  4J6I A;  3V60 A;  4FN2 A;  4MJS A;  2KMC A;  5D94 A;  2LVP A;  3QK0 A;  4MJS B;  2ZNV B;  4ZRK A;  1WGH A;  4W9H A;  1HE8 A;  4MSQ B;  4DWF A;  4IM2 A;  1JRU A;  3PPA A;  4WJP A;  2KX0 A;  4ZDV A;  1V49 A;  5J17 A;  1WGR A;  4ZRI A;  3NZS A;  2WX1 A;  2V3S A;  4BVU C;  4E74 A;  3PLU A;  1GG3 A;  2KLC A;  4GGQ A;  4IC7 B;  3L54 A;  3IVF A;  2KDE B;  2PJH A;  3H7P A;  4PS3 A;  2MWS B;  4IM3 A;  3BY4 B;  3I3T B;  3N30 A;  1WZ3 A;  1U4A A;  3H7P B;  1Y8R C;  2K6D B;  2EKE C;  2KD0 A;  2K8H A;  1V80 A;  2J7Q B;  2MP2 A;  1WIA A;  2M0X A;  3B0A A;  2JT4 B;  2IO3 B;  1KJT A;  3QJZ A;  2C60 A;  2KJR A;  2MP2 B;  4DHZ E;  5L95 C;  1WM2 A;  2RGF A;  4EZJ A;  2N1V A;  5DPW A;  4AUQ C;  3U7D A;  3R7R A;  2KWV B;  3SHQ A;  1XD3 B;  3QX1 A;  4M0W B;  5JHB A;  4WJN A;  3M95 A;  1WI0 A;  3DVG Y;  1WE7 A;  2G4S A;  2KC2 A;  2CU1 A;  4GXB A;  2JF5 A;  3H7S A;  3VAW A;  4BKT A;  2AYO B;  3M62 B;  1GC7 A;  4MM3 A;  2C7H A;  4MGI E;  2AL3 A;  2D07 B;  5IA7 A;  4PS7 A;  3NOB A;  4B95 A;  3KVF B;  1VCB A;  3N32 A;  5J2R A;  4E71 A;  2JRH A;  3PVL A;  2MBE A;  3GOE A;  2C7M B;  3PHX B;  1V81 A;  1IYF A;  2LVQ A;  2NPT A;  2BYF A;  2XEW A;  3MHS D;  5KHO A;  1E8Z A;  3CST A;  4P7I A;  4OVV A;  4OVU A;  3C0R B;  2NPT B;  5AZG A;  1WGD A;  2LGX A;  4KDL B;  3VTV A;  2MQJ A;  4LDT D;  1NDD A;  2CHW A;  3ONS A;  4LDT B;  2RPQ A;  1UD7 A;  3CSF A;  4URK A;  3ZRF A;  2LRU A;  5AEK B;  2N9E B;  4HDO A;  3ZTC A;  3N3K B;  3A9K A;  2L0F A;  1E7U A;  4HJK A;  2L7R A;  4WAA A;  4ANX A;  1WX8 A;  3ENE A;  3OAW A;  3A9K B;  2KXJ A;  2LXC A;  4GU2 A;  4WWO A;  1V2Y A;  1XT9 B;  1WMH A;  1WXS A;  2K39 A;  2KAN A;  2D10 A;  2UYZ B;  2WX0 A;  3MJW A;  1YQB A;  1SE9 A;  1UBI A;  1WMH B;  3L08 A;  3IBE A;  4W9J A;  1WRD B;  4BBN C;  1UH6 A;  4NJ6 A;  2KQS A;  4DBG A;  2O6V A;  4KSK C;  2WWZ A;  4GDK A;  4TQ0 A;  1K8R B;  4HWI B;  2O6V D;  2O2V A;  2MX2 A;  2N4F A;  2O6V B;  4B9K A;  1KLV A;  4GDK B;  3DCG A;  3PT2 B;  3NY5 A;  3NZU A;  1AAR A;  1EF1 A;  1SIF A;  2D3G A;  2O2V B;  4W9C A;  3HHM A;  2C5L C;  3DPD A;  3SD5 A;  2BKF A;  3L10 B;  2B3A A;  4KDI C;  1V6E A;  2KWU B;  1E8X A;  3AI5 A;  2KHW B;  1IP9 A;  3AXC A;  2KTR A;  4NPN A;  1V5O A;  3H1U A;  4HXD A;  3PS6 A;  5E6N A;  4FJV B;  2KTR B;  2LD9 A;  5DPT A;  1LM8 B;  3D32 A;  1YIW A;  2JWZ A;  4NJ7 A;  3WIM A;  3VH4 B;  4II3 B;  2FCQ A;  2LXA A;  3CF6 E;  4GOC A;  3L16 A;  5D7G A;  3QC8 B;  3Q3J A;  4JGH B;  5E6P A;  3DBS A;  2JRI B;  2KZR A;  2AL6 A;  3U8Z A;  1F9J A;  1TGZ B;  2DHZ A;  2DYB A;  2PE6 B;  3O65 B;  5DPR A;  2FCN A;  2LZ6 A;  3LDZ E;  4FHJ A;  2JPH A;  3DVN U;  3TIX A;  2N1W A;  3PRE A;  3VVW B;  3A1Q A;  4W9D A;  2MLB A;  3DOW A;  2R2Q A;  2KNB A;  4XZ4 A;  4KZ0 A;  4ICV A;  1TBE A;  5E6O A;  1S1Q B;  2GOW A;  3A1Q B;  2J0J A;  5BO4 B;  4MGY E;  3A33 B;  4CYE A;  1UZX B;  3GZN I;  5LXI B;  2J0K A;  3PGE A;  2K6Q A;  3KYD D;  1MG8 A;  1GC6 A;  4GIV A;  3DVN V;  1C3T A;  2G3Q B;  2FID A;  3OJ3 A;  4GMV A;  2KKC A;  1PQS A;  4IWP A;  4IM0 A;  3SDL C;  5AZF A;  2ASQ A;  1V86 A;  4I6N B;  5DCN A;  4DK5 A;  2LWP A;  4G0N B;  2HTH A;  4IWO A;  4TUU A;  2LGY A;  4G11 A;  2L00 B;  4II2 B;  1J8C A;  2V1Y A;  2Z0E B;  4NQK E;  2MBO A;  3UQB A;  2GBK A;  3RCZ A;  2KDB A;  2XBB C;  4IWQ A;  2KWC A;  4IUM B;  3KH0 A;  4BBN F;  2RR9 A;  2IO2 B;  3M63 B;  4WWN A;  3T9L A;  3ZLZ A;  4W9I A;  1QZE A;  5AZH A;  1WGG A;  2C7N B;  2AEH A;  5CHV C;  1OEY J;  3ZNZ B;  1P98 A;  2CR5 A;  4DDI D;  4AJY B;  3W1S A;  1WH3 A;  2Z59 B;  4I6L B;  4PYU A;  3WAO A;  1IPG A;  3X0W A;  4BOS C;  4IG7 B;  2MBQ A;  2L76 A;  4YL8 A;  3TMP B;  3VFK A;  4FJZ A;  2IO1 B;  4RM8 A;  4ZRJ A;  4TKN A;  3RT3 B;  2ZPY A;  3QQ8 B;  5G2N A;  4KSL C;  3R7Q A;  3B08 A;  3LJ3 A;  3V61 A;  4EFO A;  2MW5 A;  2N9X A;  3KUZ A;  3ML8 A;  5FR6 A;  3EC8 A;  4FJY A;  1H8C A;  3VHT C;  3NS8 A;  4W9G A;  1LXD A;  2KDI A;  3K9O B;  5D2M B;  3W1S C;  1ISN A;  3ZVV A;  4DHZ B;  2K8B A;  1I42 A;  3P2B A;  1I35 A;  2QHO A;  3RUI B;  1FXT B;  2NBV B;  3OJ4 B;  1M94 A;  3QA8 A;  2GMI C;  4G50 A;  2VRR B;  4W9E A;  1V5T A;  2JUO A;  1C1Y B;  1R4M I;  1RLF A;  4JQW C;  3VQI A;  4BKG A;  2BF8 B;  2YLM A;  4HCN B;  4F1S A;  2IZV B;  2L3Z A;  3PRZ A;  4FAD A;  4GB9 A;  2ZZP B;  3MTN B;  2KO3 A;  1Z2M A;  4EUT A;  2FIF A;  2IY0 B;  3HIZ A;  2NS5 A;  4ANW A;  2K8C A;  2YVC A;  4ASW C;  1D3Z A;  3RYT A;  2DAJ A;  2ZVO A;  2PEA A;  5J18 A;  2ZEQ A;  1P1A A;  4JIO U;  3WAP A;  2J0M A;  3IFW B;  1UEL A;  3ML9 A;  3A4R A;  3EHV A;  2IYD B;  3VTU A;  3HM3 A;  1RRB A;  2I1K A;  3DBL I;  4G3X B;  2MSE D;  1WR6 E;  2NCN A;  3VH3 B;  2OJR A;  3KUD B;  1WXV A;  2XK5 A;  3ZRC A;  4EOY A;  3RZW C;  2N7E A;  4KVG B;  3ZTD A;  1NI2 A;  2XK5 B;  1E90 A;  1EUV B;  3Q3F A;  3X23 A;  5LLI A;  2GBM A;  3CMM B;  5DPS A;  3JSV A;  3VUY A;  2LGD A;  2N9P C;  1YD8 U;  4K7W A;  3WAL A;  1RFA A;  2BWE S;  2LAS A;  1LFD A;  3JSV B;  3VUX A;  3QWZ B;  2MRP A;  2DZK A;  4F8C B;  2Z0D B;  2JXX A;  2MA9 B;  3DVG X;  3H9D A;  3ZNG C;  1XQQ A;  4FBJ B;  3KW5 B;  3ZNI D;  1KOT A;  1WZ0 A;  2G4D B;  4NNJ B;  3H6N A;  4WQO B;  4FUL A;  2BKR B;  4LJO B;  3SU8 X;  3ZO5 B;  2RD0 A;  5GMV A;  2L05 A;  3TCA A;  1Z5S B;  2GBJ A;  3JW0 X;  1GUA B;  4EZK A;  4NAW A;  1EO6 A;  5TR5 A;  4KZC A;  4NAW B;  1S3S G;  3V62 A;  3EFU A;  2MBH A;  3DQV A;  3ZUN A;  2KQ7 A;  4BOZ B;  3PV1 A;  3ZKJ C;  2C9W B;  3V6C B;  2KFJ A;  1WX7 A;  2N7D A;  4W9L A;  3WAN A;  3ZW3 A;  1T0Y A;  1YX5 B;  1ZW7 A;  5G55 A;  4A20 A;  1J0G A;  2CHZ A;  2JY6 A;  3ZDM C;  4F7Z A;  4DHJ D;  2M17 A;  4DHJ B;  1WY8 A;  5CX3 A;  2DAF A;  2KN5 A;  3U30 A;  2DZI A;  2NBW B;  1WYW B;  2ZCC A;  5JZE B;  1BT0 A;  2BWF A;  2LI5 A;  2JVC A;  4GSW A;  1OGW A;  3AU4 A;  4KV2 A;  3K9P B;  1WFY A;  2ZCB A;  4M8N A;  4MSM B;  4MGZ E;  3RZF A;  5KHQ A;  1WJN A;  2A5U A;  3OLM D;  1Q0W B;  3VDZ A;  3ZIM A;  2KLG A;  2MBB B;  3PRM B;  3PTF C;  3A9J A;  3QIJ A;  3WA0 A;  1ZKH A;  5LXH A;  4MEL A;  1GJZ A;  1Q1O A;  2M1M A;  2W9N A;  3A9J B;  4HLE A;  1P0R A;  2D11 A;  2CHX A;  1TZ1 A;  3IHP C;  4NY0 A;  1WXM A;  2FNJ B;  2ZNV C;  1WR1 A;  2V4L A;  4PS8 A;  1WGY A;  1WJ4 A;  2LRW A;  5JH5 C;  2GBN A;  3TBL D;  4JLC A;  3RUL A;  3B1L X;  4PYZ A;  2DEN B;  3V6E B;  2IO0 B;  2CS4 A;  3HK0 A;  2HD5 B;  4WJQ A;  4RMA A;  2M8S A;  3PSE B;  4FLH A;  3S2A A;  1J19 A;  1EF5 A;  3RD2 A;  3ZDT A;  2WYQ A;  3JVZ X;  1E8Y A;  4K7U A;  5IAA C;  5D6J B;  3L17 A;  4MDK E;  2I1J A;  4A3P A;  2OOB B;  2IBI B;  4FHK A;  4CO7 A;  4EKU A;  3PHW B;  3T8M A;  1V9J A;  2KJH B;  2L8J A;  1P3Q U;  2NR2 A;  1Q5W B;  1P9D U;  3EEC A;  3APF A;  2EMT A;  3R3M A;  4XX5 A;  3WAM A;  2KOX A;  4EZL A;  2L0T A;  2M4N A;  2UWQ A;  3QAQ A;  4JL9 A;  1LQB A;  4ZYN A;  3UIP B;  4I6P A;  1L2N A;  2KX3 A;  2R2O A;  2KC1 A;  4X57 B;  4HDQ A;  3APC A;  2LJ5 A;  2FCS A;  2DZJ A;  1CMX B;  2PE9 A;  2G45 B; 
#chains in the Genus database with same CATH topology
 3KWL A;  2BGF A;  3VTW A;  4DXA B;  2RDG A;  4KIK A;  4WWP A;  4KGR A;  3SFD B;  3AN1 A;  4C4V B;  4MH0 E;  4MGK E;  1HTQ A;  2JZZ A;  4XC2 A;  1WX9 A;  4K3B A;  4XDD A;  4YXD B;  1WF9 A;  1PFD A;  2LUM A;  1RAX A;  3V3X A;  3M3J A;  4WJO A;  1UF0 A;  3AUL A;  3KYC D;  4GN1 A;  1WJ6 A;  2BYV E;  3UGB B;  3UIO B;  3IT6 B;  2CKH B;  4LLG M;  2RMM A;  3U2S C;  4E3C A;  3VXW A;  1WE6 A;  2FAZ A;  3P4S B;  4JPS A;  1T6B X;  3NHE B;  2BVC A;  1X1M A;  4GDL B;  3DBH I;  5C1Z A;  2KDF B;  1OQY A;  1UBQ A;  1D5M C;  1WM3 A;  1D5X C;  3PZ7 A;  2KFK B;  1SGH A;  3UI3 A;  4HK2 A;  3L13 A;  1T3Q A;  3QAR A;  2KAJ A;  4IW0 A;  2ZPN A;  2KJ6 A;  4L23 A;  4EEW A;  2WXJ A;  2FBW B;  3V60 A;  4KKI A;  3AE7 B;  5FKA C;  2LVP A;  2ZNV B;  4ZDV A;  3B2G A;  4ZRI A;  2V3S A;  4BVU C;  3PLU A;  1IUE A;  3NJT A;  2JZP A;  1TKG A;  2KDE B;  2Y3A A;  4IM3 A;  4GLS C;  3N30 A;  1U4A A;  2D3C A;  1CZP A;  4YSZ B;  2K6D B;  3VR8 B;  2WXR A;  2IO3 B;  4YTN B;  1WWT A;  4AUQ C;  4M0W A;  3U7D A;  3R7R A;  3SHQ A;  5JHB A;  3M95 A;  1WI0 A;  3DVG Y;  5IO9 A;  2DWQ A;  3AEA B;  4GXB A;  1L0V B;  2WDQ B;  2QIE B;  5HHD G;  3AE8 B;  3M62 B;  2Q5W D;  2D07 B;  4MM3 B;  3R2T A;  3NOB A;  3W5V B;  4C7Z A;  5J2R A;  2JRH A;  3PVL A;  4IOI E;  1J7A A;  2NPT A;  2XEW A;  3CST A;  4P7I A;  4OVU A;  3C0R B;  1YJJ A;  2GB1 A;  1ZUD 2;  1UUP A;  2J42 A;  1WGD A;  1ZOY B;  5D3D A;  2CJN A;  1NDD A;  1DOY A;  4HRO A;  3P4P B;  1I4G A;  3ZRF A;  5MPO A;  2J52 A;  2LRU A;  3ZTC A;  5IN7 A;  2L0F A;  3Q14 C;  4HJK A;  3GE8 C;  3ENE A;  1FM0 D;  3OAW A;  2KXJ A;  2LXC A;  4PK1 A;  1V2Y A;  1J7C A;  1WXS A;  2D10 A;  1TS4 A;  2WX0 A;  3MJW A;  1WYG A;  1GOZ A;  3L08 A;  2BW2 A;  3W2D A;  1WGK A;  3N1Y C;  4DBG A;  2O6V A;  4KSK C;  4TQ0 A;  1K8R B;  3Q8B A;  2O2V A;  1I4P A;  2MX2 A;  4B9K A;  3NY5 A;  1EF1 A;  3SD5 A;  2BKF A;  4OZC A;  1UGJ A;  3DBH B;  3AI5 A;  1IP9 A;  1FNV A;  1QKZ A;  1OQR A;  4HXD A;  3PS6 A;  2WXQ A;  2NMQ A;  1LM8 B;  3D32 A;  1YIW A;  1TS2 A;  2FCQ A;  3AE2 B;  3Q3J A;  4JGH B;  2H88 B;  1EWY C;  3L4P A;  1TGZ B;  1F9J A;  2DHZ A;  1AYF A;  2DYB A;  5DPR A;  4OHJ A;  2FCN A;  2LZ6 A;  2NTT A;  2WXK A;  3VVW B;  2R2Q A;  4XZ4 A;  4CYE A;  1UZX B;  1XEE A;  3GZN I;  5LXI B;  4GIV A;  3DVN V;  3DWG C;  2FID A;  4IWP A;  5BYR A;  1V86 A;  4I6N B;  2LGY A;  2JU6 X;  4C00 A;  4NQK E;  1ZXH A;  3RCZ A;  4IWQ A;  2KWC A;  3KH0 A;  4LNO A;  3M63 B;  4W9I A;  3ZXR A;  3KWV A;  1WGG A;  2AEH A;  1IPG A;  2MBQ A;  4YL8 A;  3ZJV A;  3RT3 B;  5G2N A;  3P63 A;  3R7Q A;  3B08 A;  3LJ3 A;  4EFO A;  3VHT C;  2LHE A;  4A55 A;  2KDI A;  3Q69 A;  5D2M B;  2VZK D;  3W1S C;  1ISN A;  3ZVV A;  2VZK B;  1I35 A;  2INC C;  1FXT B;  3RNF C;  2NBV B;  4G50 A;  2GMI C;  1J7B A;  2VRR B;  2JUO A;  1QOF A;  3SR6 A;  2BS3 B;  1FD6 A;  4GB9 A;  2ZZP B;  2KO3 A;  4ANW A;  2K8C A;  4ASW C;  1FFV A;  1P1A A;  4KGT A;  5BYS A;  3BK1 A;  1YN5 A;  3FKY A;  3ML9 A;  3A4R A;  3EHV A;  3IXS A;  4YSY B;  1RYJ A;  3DBL I;  1MHH E;  1WR6 E;  1MVK A;  2WXG A;  4LTU A;  2XK5 A;  1JWS D;  4WQM A;  3AEF B;  1NI2 A;  1NYQ A;  5D3I B;  1K52 A;  3X23 A;  3CMM B;  1LFD A;  2LAS A;  3VUX A;  2MRP A;  2MA9 B;  3H9D A;  1AW7 A;  3ZNG C;  4O1N A;  2W3R A;  5H92 C;  1WZ0 A;  1N62 A;  4NNJ B;  2K5P A;  4FUL A;  2BKR B;  1IBX A;  2RD0 A;  4HKZ E;  2L05 A;  1Z5S B;  2IGG A;  3ETR A;  3N1Z C;  3MC8 A;  5TR5 A;  2KQ4 X;  2ONQ A;  3DQV A;  1NEN B;  2BT6 A;  2JYE A;  2KFJ A;  5EE1 A;  1WX7 A;  2KWD A;  1L6V A;  2JYT A;  1ZDX A;  3ZW3 A;  1YX5 B;  5FK9 C;  2PMV A;  1ZW7 A;  4A20 A;  2CHZ A;  2JY6 A;  4KGS A;  3GZN B;  2DAF A;  2KN5 A;  1WYW B;  3ZXV A;  3TEY A;  4ZHP A;  4GSW A;  4M8N A;  4JWU C;  4MSM B;  3OLM D;  3FAH A;  3ZIM A;  2KLG A;  1D6E C;  1E7P B;  3WA0 A;  4RFB A;  2IJ0 A;  1SE4 A;  1GJZ A;  2VH2 A;  2M1M A;  3A9J B;  4HLE A;  1P0R A;  2D11 A;  2CHX A;  1TZ1 A;  1GB1 A;  2V4L A;  4LNF A;  1WGY A;  2GBN A;  4JLC A;  2X38 A;  3RUL A;  1TKE A;  1IGC A;  5BMI A;  2L32 A;  4WJQ A;  2K22 A;  4RMA A;  2L83 A;  2IGH A;  2G1E A;  4FLH A;  4OW0 A;  1EF5 A;  3RD2 A;  3ZDT A;  2WYQ A;  5IAA C;  1WSP A;  4MDK E;  1T5X D;  2WXP A;  2E3T A;  3PHW B;  3T8M A;  2GI9 A;  2L8J A;  2EMT A;  2PLP A;  3BVZ A;  2JQR B;  1LQB A;  4I6P A;  1LGR A;  2OJW A;  2KC1 A;  4HDQ A;  2LJ5 A;  1ET9 A;  2DZJ A;  5AUI A;  2D3A A;  2PE9 A;  2ICI A;  4XWW A;  2GRI A;  2FCM A;  2DZM A;  4AJW A;  3HRD D;  3AH7 A;  1WXA A;  4JE3 B;  4M8M A;  2HJ8 A;  2LVO A;  2KK8 A;  2NVU I;  4WWM A;  1VZ8 A;  3UQA A;  3DBL B;  2KTF A;  4B6W A;  4HPM B;  5EDS A;  1BUI C;  2IGD A;  3Q2A C;  2PPH A;  2ZVN A;  2N9K A;  3CWI A;  4WAF A;  1R4N I;  3AV8 A;  1ZGU B;  2V3P A;  1HZ5 A;  4BKS A;  4DDG D;  2AWT A;  3PRP B;  3UF8 A;  4AOF A;  3ALB A;  5C23 A;  1C4A A;  3PZD A;  2QEJ C;  3DDC B;  2MJE A;  3OG5 A;  2H89 B;  1H4R A;  3A4S C;  1A5R A;  4TQ1 A;  4B0E A;  1WJU A;  3KUC B;  4K7S A;  1VD2 A;  2OED A;  4JWS C;  2MCN B;  4FA6 A;  2DYM A;  1K51 A;  1EU3 A;  2DYO A;  4J3O D;  2KMA A;  4HJG E;  4MAC A;  2M19 A;  2W54 A;  2KMC A;  3QK0 A;  4MJS B;  4W9H A;  4MSQ B;  4WJP A;  1V49 A;  5J17 A;  3NZS A;  2KLC A;  4GGQ A;  3BZD B;  3B9J A;  3IVF A;  2HTM E;  4P6V F;  2PJH A;  4RCO A;  3H7P A;  4PS3 A;  1C76 A;  1Y8R C;  1MI0 A;  2EKE C;  2MP2 A;  1V80 A;  3PZ8 A;  2M0X A;  2JT4 B;  2C60 A;  2KJR A;  4DHZ E;  1MHX A;  1NEK B;  1TT5 B;  1YNT E;  3QX1 A;  4WJN A;  1HEZ E;  4OZB A;  2KC2 A;  4OZA A;  2WXH A;  4RGN A;  3P1M A;  4MGI E;  1YQ4 B;  1ESF A;  1C78 A;  2WU2 B;  1KLG D;  3KVF B;  3AE5 B;  3N32 A;  4E71 A;  2QIL A;  3ZJT A;  3GOE A;  2HJ1 A;  1ZPS A;  2BYF A;  1E8Z A;  2KMM A;  4S17 A;  4A8X C;  4RGT A;  5BMG A;  3Q3M C;  1IGD A;  4KDL B;  4REZ A;  3FIL A;  4ARC A;  1JWM D;  4XWT A;  3U7Z A;  5AEK B;  4HDO A;  3N3K B;  2L7R A;  3MC9 A;  3A9K B;  1CQV A;  4GU2 A;  1WMH A;  2KAN A;  2UYZ B;  1SE9 A;  4MT5 A;  1F2R C;  1WRD B;  1R4N B;  3VR9 B;  1UH6 A;  1JQ4 A;  4LK0 M;  1OFF A;  1PGB A;  2WWZ A;  3OWE B;  4HWI B;  1YOV B;  2N4F A;  3P4R B;  4GDK B;  1FNW A;  1AAR A;  2D3G A;  4W9C A;  4RH6 A;  3DPD A;  4BZA A;  1SF0 A;  1XLO A;  2DLB A;  2EKI A;  2KTR A;  3ABV B;  3H1U A;  4FJV B;  2LD9 A;  3WCQ A;  4ITK A;  2JWZ A;  3I9V 1;  3VH4 B;  1E9M A;  2B76 B;  2LXA A;  2MJ3 A;  3CF6 E;  3L16 A;  1L5P A;  2G9H D;  3QC8 B;  5FR3 A;  1F77 A;  3O65 B;  1HA5 A;  1FFU A;  1XLN A;  2JPH A;  3TIX A;  2N1W A;  2W82 A;  2ACZ B;  4ZRP A;  3PRE A;  3TSS A;  2BS2 B;  4W9D A;  3DOW A;  2VH1 A;  4KZ0 A;  4ICV A;  3A1Q B;  2WXL A;  4DQO C;  2LEK A;  2YEP F;  3BVG A;  4K3C A;  3RPF C;  1MG8 A;  1GC6 A;  2LMC A;  2G3Q B;  1D5Z C;  3SDL C;  2ASQ A;  5DCN A;  4P1C C;  2RDB C;  2L00 B;  2V1Y A;  2MBO A;  3UQB A;  2ON8 A;  3SEB A;  1HZ6 A;  2RR9 A;  4Q2J A;  4WWN A;  3ZLZ A;  3LYY A;  5AZH A;  2JX5 A;  1OEY J;  4DDI D;  1P98 A;  4PYU A;  2Z59 B;  4IG7 B;  3RN9 C;  3TMP B;  4RM8 A;  1YN4 A;  3QQ8 B;  1GAQ B;  3ML8 A;  5FR6 A;  3EC8 A;  4FJY A;  4W9G A;  3O13 A;  3K9O B;  1I42 A;  1SSN A;  3RUI B;  1TS3 A;  1A70 A;  1C1Y B;  4BKG A;  1E10 A;  3NVZ A;  2BF8 B;  2YLM A;  4F1S A;  1L0Y B;  2QSD A;  3I57 A;  3MTN B;  1VRA B;  2QMT A;  2BS4 B;  2IY0 B;  3BII D;  2WXO A;  1FRR A;  2NS5 A;  1YN3 A;  2YVC A;  1VLB A;  4EE2 A;  2ZVO A;  3AE1 B;  2J0M A;  3IFW B;  5HFY A;  5I4D A;  3VTU A;  1RRB A;  1DGJ A;  4RGM A;  3AEE B;  3KUD B;  2N7E A;  1JML A;  1FCC C;  5DPS A;  2LGD A;  2N9P C;  1RFA A;  1PGX A;  3JSV B;  3RNA C;  3TEZ A;  4F8C B;  2Z0D B;  4H2A A;  3KW5 B;  3TUO A;  4US9 A;  1KOT A;  2BB5 A;  3ZO5 B;  1V1P B;  3JW0 X;  4EZK A;  2CJO A;  3ZGZ A;  4RGO S;  2K0P A;  4KZC A;  4NAW B;  4A90 A;  3V62 A;  1XLQ A;  3ZUN A;  2MBH A;  2KQ7 A;  1EWC A;  4ZYS A;  2C9W B;  3HVD A;  3WAN A;  3DHG C;  4C56 C;  2M17 A;  1WY8 A;  2KDM A;  4N59 A;  3U30 A;  2DZI A;  2NBW B;  1I4X A;  3DHH C;  1N5X A;  2JVC A;  1QOB A;  2XN9 C;  3RZF A;  2A5U A;  3VDZ A;  2MBB B;  3QIJ A;  4MEL A;  2AX5 A;  4L1B A;  1C4P A;  4P1B C;  2ZNV C;  1WR1 A;  1WJ4 A;  3GB1 A;  2LRW A;  3TBL D;  3MC0 B;  2D3B A;  2CS4 A;  3HK0 A;  1HQR D;  1ENF A;  1J19 A;  1P7F A;  3HUI A;  2Y5P A;  2MJD A;  2LFI A;  4FHK A;  5C3J B;  1JWB D;  1PGA A;  3IT4 B;  2KJH B;  2NR2 A;  1Q5W B;  3KQ4 A;  3APF A;  4XX5 A;  1B1Z A;  3ZJU A;  1VZ6 A;  4XE0 A;  2KX3 A;  4XDC A;  1T0R C;  4X57 B;  2FCS A;  3N1X C;  4C4V A;  1V8C A;  4LNN A;  4KIK B;  5AUK A;  2N9L A;  1L0X B;  1UWM A;  2WNM A;  3UIN B;  1FCL A;  1E6E B;  2K9X A;  1NBF C;  1F2R I;  4ANU A;  3QCA A;  4AWJ A;  4C80 A;  1YJ1 A;  1JRP A;  3L0W B;  4HVB A;  1JWU D;  4MEM A;  4B0M A;  3R66 C;  4JX1 C;  3ZQ4 A;  5CHF A;  2REX A;  2Y5B B;  3RMK C;  2HE7 A;  1L7Y A;  2LUE A;  1OEY A;  2BQQ A;  1E8W A;  2RPV A;  4GDL A;  1E5W A;  2OHF A;  3RNE C;  1OTR B;  5JHA A;  1E7V A;  4BFR A;  2J4X A;  1KTK A;  2A4Z A;  2FUH B;  4QAY A;  3AB5 A;  4HPL B;  2BYE A;  3TJP A;  4TV3 A;  2KFK A;  3HM6 X;  1F52 A;  3JYU A;  4A3O A;  3VUW A;  4RM9 A;  4IDI A;  5HKH A;  3ECI A;  5BMH A;  1UGM A;  1YX6 B;  3BYT B;  3AE6 B;  1I4R A;  2ZJD A;  1FXA A;  2BPS A;  4J6I A;  4FN2 A;  1PYW D;  3W9C B;  5D94 A;  2KYW A;  4WH4 A;  2IDY A;  4ZRK A;  1WGH A;  1JAL A;  1HE8 A;  1JRU A;  3PPA A;  4LNK A;  4S0R A;  5JXV A;  2WX1 A;  2BB6 A;  4KX6 B;  1EU4 A;  1GG3 A;  4IC7 B;  1L4Z B;  2WS3 B;  4PT5 A;  1DOI A;  3BVM A;  3BY4 B;  1WZ3 A;  2RDH A;  2KD0 A;  2J7Q B;  1WIA A;  1NVI D;  1RWS A;  3QJZ A;  2L52 A;  5L95 C;  1WM2 A;  3H8H A;  2N1V A;  1SIJ A;  4C7Y A;  1XD3 B;  1RM6 C;  3I63 C;  4M0W B;  4P16 A;  1WE7 A;  2G4S A;  1XCT L;  2JF5 A;  3H7S A;  3VAW A;  4BKT A;  2AYO B;  5EE3 A;  4MM3 A;  2C7H A;  4B95 A;  1VCB A;  1TIF A;  3AE9 B;  3PHX B;  1IYF A;  2LVQ A;  3MHS D;  2WXF A;  5KHO A;  2NPT B;  1V1O A;  3TEW A;  4D2K A;  5AZG A;  3U4E G;  2LGX A;  1UD7 A;  1WXQ A;  1E7U A;  5HG2 A;  4WWO A;  1PUT A;  3EFC A;  1TS5 A;  2K39 A;  3R2I A;  1F0Z A;  5T8I A;  1CJE A;  2O6V D;  2O6V B;  1KLV A;  3DCG A;  3NZU A;  1SIF A;  2O2V B;  3HHM A;  2C5L C;  2B3A A;  1KRH A;  3MHZ A;  1FNU A;  1V6E A;  2KWU B;  4DXG A;  1E8X A;  4A6Q A;  2KHW B;  3AXC A;  1V5O A;  1SXT A;  5E6N A;  5DPT A;  4ZHO A;  4II3 B;  4R3D A;  1M4V A;  4ARI A;  1ROE A;  3P42 A;  1AN8 A;  2JRI B;  2AL6 A;  4L2Y A;  4FHJ A;  2PVO D;  3DVN U;  3BK2 A;  1ZXI A;  2PVG C;  5E6O A;  1S1Q B;  2GOW A;  2J0J A;  5BO4 B;  4MGY E;  3A33 B;  1ET6 A;  2W3S A;  2J0K A;  2K6Q A;  1SE2 A;  3KYD D;  4US8 A;  1C3T A;  1HTO A;  3OJ3 A;  4GMV A;  2KKC A;  1MFW A;  3BWU D;  2I38 A;  3VRB B;  4HPP A;  1UNS A;  4IM0 A;  4G0N B;  2HTH A;  4TUU A;  4II2 B;  1J8C A;  1I4H A;  2Z0E B;  2GBK A;  2V0G A;  1KLU D;  2KDB A;  2W55 A;  4IUM B;  4BAX A;  4BBN F;  2JXT A;  2C7N B;  3ZNZ B;  4AJY B;  1WH3 A;  3WAO A;  4BOS C;  1D4B A;  2L76 A;  3VFK A;  5IOI A;  1AWD A;  1QQR A;  2IO1 B;  2IPK D;  4FJZ A;  3NVW A;  3KUZ A;  4NZL B;  1H8C A;  2M56 B;  1LXD A;  4TMA B;  1JW9 D;  4DHZ B;  3P2B A;  2KVZ A;  3OJ4 B;  3QA8 A;  4W9E A;  4ZRQ A;  4AQ7 A;  1RLF A;  1R4M I;  4JQW C;  3VQI A;  1GPX A;  3TEX A;  5IKC M;  1FMA D;  3EGR A;  2L3Z A;  1N60 A;  1Q10 A;  2WXM A;  4EUT A;  3U52 E;  4ZOH C;  3HIZ A;  2D5G A;  3AED B;  1XO3 A;  2DAJ A;  2PEA A;  3AE4 B;  2ZEQ A;  3ZYY X;  3WAP A;  3AEG B;  2JWU A;  1TYG B;  2SEB D;  1SB3 C;  3HM3 A;  4G3X B;  2BTE A;  3ZRC A;  4EOY A;  3RZW C;  4KVG B;  3AEB B;  2XK5 B;  3KLS X;  1DOX A;  1EUV B;  2CU3 A;  3Q3F A;  2GBM A;  3E9S A;  3VUY A;  4K7W A;  1OQQ A;  3NVV A;  4DXF A;  2DZK A;  2JXX A;  1FIQ A;  4MH8 A;  1F1H A;  4FBJ B;  3Q8E A;  1LO5 D;  3ZNI D;  2G4D B;  3SU8 X;  4XYC A;  5GMV A;  3TCA A;  2GBJ A;  1IBX B;  3FC4 A;  1MG4 A;  2MEK A;  1SE3 A;  3PO0 A;  1EO6 A;  5EE0 A;  1S3S G;  1XXG A;  5IP4 D;  4BOZ B;  3PV1 A;  2L1A A;  3V6C B;  2N7D A;  1KFY B;  3J9C A;  5G55 A;  3Q6B A;  5CX3 A;  1FPY A;  4WUR A;  2ZCC A;  4FXC A;  2ZW1 A;  5JZE B;  1BT0 A;  2XNA C;  2LI5 A;  4N6E B;  3C19 A;  3K9P B;  1C77 A;  4M00 A;  4MGZ E;  1FXI A;  3N20 C;  1WJN A;  5KHQ A;  1XCQ L;  3MFG A;  3PRM B;  3R8B A;  3PTF C;  3A9J A;  4NJC A;  3GE3 C;  5GXG B;  4YT0 B;  5JH5 C;  1YMH E;  4PYZ A;  2WXI A;  3Q3O C;  3V6E B;  2HD5 B;  2M8S A;  3S2A A;  3JVZ X;  4K7U A;  2MHJ A;  2E6X A;  2QC8 A;  5D6J B;  1I4Q A;  3L17 A;  2I1J A;  3RNC C;  2KN4 A;  1BML C;  2IBI B;  3GP7 A;  4HKQ A;  4EKU A;  2V4I B;  1P3Q U;  1P9D U;  3R3M A;  1R4M B;  4USA A;  1ZDV A;  1C79 A;  2UWQ A;  3NRZ A;  3QAQ A;  4JL9 A;  3UIP B;  1PDX A;  2KT7 A;  1L2N A;  2N7J A;  4F7Z A;  4TSS A;  1G6J A;  1SEB D;  2DNF A;  2PIA A;  1VJK A;  3IG3 A;  4K81 A;  1KH0 A;  4XGA B;  2Y5C A;  3TL5 A;  4YTM B;  4W9K A;  2D2Q A;  2NTS A;  5L83 A;  3DBR I;  3QHT A;  3AM9 A;  4NAM A;  1SBB B;  3LB8 C;  4LJP B;  2QCZ A;  1K53 A;  1ZE3 D;  3W1Y A;  4K1R B;  4LCD E;  2DX5 B;  2GBR A;  2JSV X;  1QIL A;  4ICU A;  1RFK A;  2INN E;  2NBU A;  1WRI A;  2WDT B;  3AU5 A;  1DYQ A;  1FO4 A;  2GLS A;  4BKS D;  1QF6 A;  3APD A;  4N9F 4;  2R61 A;  3DWM A;  5G5H A;  4A9A A;  3Q3N C;  4M01 A;  3ZNH B;  2K1F A;  1SJE D;  4CHK A;  4W9F A;  2IY1 B;  1TTN A;  3PLV A;  2RSU A;  4HCP B;  2EMS A;  3B2F A;  2K25 A;  4NQL B;  2JZ3 B;  1QOA A;  1GNU A;  2KVR A;  4AS1 A;  3BIN A;  5CTR C;  1TZO A;  1JWA D;  2PTL A;  4ANV A;  5CHW A;  1XLP A;  3V05 A;  1KM7 A;  4MJS A;  5E6J A;  2LGI A;  4M02 A;  1N63 A;  1L6U A;  4DWF A;  4IM2 A;  4RF1 A;  4LNI A;  2KX0 A;  1WGR A;  1Y56 A;  4E74 A;  2PKO A;  3L54 A;  2M0A A;  1XF5 L;  3GS2 A;  2X8X X;  2MWS B;  3I3T B;  2LGS A;  3H7P B;  2K8H A;  3AMZ A;  3B0A A;  1KJT A;  1T0Q C;  1VZ7 A;  2MP2 B;  2RGF A;  4EZJ A;  5DPW A;  1JRO A;  2KWV B;  3HVZ A;  2BYT A;  5C2T B;  2CU1 A;  1FRD A;  1NYR A;  5HI1 A;  1GC7 A;  4UDU C;  2TSS A;  2AL3 A;  5IA7 A;  4PS7 A;  1SJH D;  1YJI A;  5TSS A;  2YEP B;  2WLB A;  4YSX B;  4ACF A;  1EM7 A;  2MBE A;  2C7M B;  2WGS A;  1V81 A;  4CQN A;  2WQY B;  4OVV A;  1MJD A;  3T3N A;  2KAC A;  1NI3 A;  2PW9 A;  3VTV A;  2MQJ A;  4LDT D;  2CHW A;  3ONS A;  4LDT B;  2RPQ A;  2HDE A;  3MP9 A;  3CSF A;  4URK A;  3DBR B;  1YQ3 B;  3FIL B;  2N9E B;  3A9K A;  4ANX A;  4WAA A;  1WX8 A;  1XT9 B;  1QT9 A;  1YQB A;  1UBI A;  1WMH B;  2WP9 B;  3IBE A;  4W9J A;  4BBN C;  4NJ6 A;  2KQS A;  2AQ3 B;  4GDK A;  3VRA B;  1JCK B;  2SAK A;  3PT2 B;  3MJ5 A;  4KKJ A;  4A3P A;  3L10 B;  4KDI C;  1FEH A;  3C8Y A;  1BXT A;  4NPN A;  2KTR B;  4NJ7 A;  3WIM A;  4HEA 1;  3RFZ B;  4GOC A;  3BYY B;  5D7G A;  5E6P A;  2N0S B;  2V3N A;  3Q8A A;  3NG0 A;  3DBS A;  2KZR A;  2WHI A;  3U8Z A;  2PE6 B;  3LDZ E;  2BBC A;  3I5J C;  3A1Q A;  2MLB A;  3EUB 2;  2KNB A;  2EEL A;  1TBE A;  1R7S A;  2INP E;  3PGE A;  4WIP A;  5LNK 1;  5G5G A;  3E56 A;  1PQS A;  5AZF A;  1VR9 A;  4YWG G;  4DK5 A;  2LWP A;  1TY0 A;  4IWO A;  2FUG 1;  4G11 A;  3RNG C;  2XBB C;  3W5U B;  1HXY D;  2IO2 B;  3T9L A;  1QOG A;  1QZE A;  5CHV C;  3T3O A;  2CR5 A;  2Z8L A;  3W1S A;  2WXN A;  4I6L B;  3X0W A;  4ZRJ A;  4TKN A;  2ZPY A;  4KSL C;  4RF0 A;  3V61 A;  1N61 A;  2MW5 A;  2N9X A;  3LXF A;  2WU5 B;  3RNB C;  3NS8 A;  3NS1 A;  2ZW0 A;  1UWX A;  2K8B A;  2QHO A;  1M94 A;  1K50 A;  1V5T A;  1T0S C;  2J53 A;  1C9F A;  1TKY A;  4HCN B;  1C4C A;  2IZV B;  4IKG A;  3PRZ A;  2FE8 A;  4FAD A;  2DBY A;  1P7E A;  1Z2M A;  2FIF A;  1D3Z A;  1STE A;  3RYT A;  2UU7 A;  5J18 A;  4JIO U;  3Q8F A;  1UEL A;  2IYD B;  2I1K A;  2MSE D;  2NCN A;  4RNA A;  3VH3 B;  2OJR A;  1WXV A;  1B9R A;  3P4Q B;  3ZTD A;  1E90 A;  5LLI A;  3NVY A;  3JSV A;  3WAL A;  1YD8 U;  2BWE S;  3QWZ B;  3IAS 1;  3DVG X;  3NZ3 A;  1XQQ A;  4N58 A;  1E0Z A;  3URY A;  4HRS A;  1V1P A;  3H6N A;  4WQO B;  4LJO B;  1ACC A;  4YTP B;  1GUA B;  4NAW A;  3N9Y C;  2QDF A;  3SFE B;  3EFU A;  3AE3 B;  3ZKJ C;  1TY2 A;  5BYQ A;  2WDR B;  2LHD A;  1VDV A;  4W9L A;  1T0Y A;  1J0G A;  2I2Y A;  3ZDM C;  4DHJ D;  4DHJ B;  3CIR B;  1ZP0 B;  2LJI A;  3NUH B;  2MH7 A;  2BWF A;  2AQ2 B;  1CK1 A;  1OGW A;  3AU4 A;  4KV2 A;  1WFY A;  2ZCB A;  1Q0W B;  3AEC B;  1KF6 B;  2V9H A;  4OVZ A;  1ZKH A;  5LXH A;  1MPE A;  1Q1O A;  2W9N A;  3IHP C;  4NY0 A;  2QJL A;  1WXM A;  2FNJ B;  2K3U A;  4PS8 A;  5H8Y E;  5EE9 A;  1N5W A;  3B1L X;  2DEN B;  3Q8C A;  2IO0 B;  3PSE B;  1TJE A;  1V97 A;  1E8Y A;  2OOB B;  4CO7 A;  1L4D B;  3EA6 A;  1V9J A;  1I7H A;  2AQ1 B;  2IND C;  3EEC A;  3DHI C;  3IAM 1;  3WAM A;  2KOX A;  3RI7 C;  4EZL A;  2L0T A;  2M4N A;  1GB4 A;  2WDV B;  4ZYN A;  1QLB B;  2R2O A;  1N6Z A;  3APC A;  4AP4 C;  1CMX B;  2G45 B; 
#chains in the Genus database with same CATH homology
 2BGF A;  3VTW A;  4DXA B;  4KIK A;  1G6J A;  4WWP A;  3IG3 A;  2FCM A;  4KIK B;  2DZM A;  4AJW A;  4MH0 E;  4MGK E;  4K81 A;  1WXA A;  3UIN B;  2JZZ A;  4XC2 A;  4M8M A;  3TL5 A;  2HJ8 A;  2LVO A;  4W9K A;  2D2Q A;  2KK8 A;  2NVU I;  5L83 A;  1WX9 A;  3DBR I;  3QHT A;  3UQA A;  1NBF C;  2KTF A;  4ANU A;  3QCA A;  4AWJ A;  4LJP B;  4B6W A;  4HPM B;  1WF9 A;  5EDS A;  1YJ1 A;  1RAX A;  2PPH A;  3W1Y A;  3L0W B;  3M3J A;  4K1R B;  4HVB A;  4WJO A;  3AUL A;  3KYC D;  4LCD E;  2DX5 B;  2ZVN A;  2GBR A;  4GN1 A;  4MEM A;  1WJ6 A;  3R66 C;  4ICU A;  2BYV E;  3UGB B;  1R4N I;  2NBU A;  3UIO B;  5CHF A;  2WDT B;  3AU5 A;  2REX A;  2Y5B B;  1ZGU B;  2CKH B;  2HE7 A;  1L7Y A;  2LUE A;  1OEY A;  4BKS A;  4DDG D;  2AWT A;  4E3C A;  3PRP B;  3UF8 A;  3VXW A;  4BKS D;  4AOF A;  1WE6 A;  3APD A;  2FAZ A;  4N9F 4;  3ALB A;  1E8W A;  3NHE B;  4GDL A;  5C23 A;  1E5W A;  3PZD A;  3ZNH B;  2K1F A;  1X1M A;  4CHK A;  4W9F A;  4GDL B;  3DBH I;  1OTR B;  3DDC B;  5JHA A;  1E7V A;  4AP4 C;  2IY1 B;  4BFR A;  5C1Z A;  1TTN A;  1H4R A;  3A4S C;  2A4Z A;  2FUH B;  2KDF B;  3PLV A;  1A5R A;  2RSU A;  4TQ1 A;  4HCP B;  2EMS A;  1OQY A;  1WJU A;  2BYE A;  3KUC B;  2K25 A;  4HPL B;  3TJP A;  4TV3 A;  2KFK A;  1UBQ A;  4NQL B;  3HM6 X;  1WM3 A;  2JZ3 B;  4K7S A;  3JYU A;  1VD2 A;  1GNU A;  2KFK B;  1SGH A;  2KVR A;  4HK2 A;  3BIN A;  3L13 A;  4A3O A;  5CTR C;  3QAR A;  4IW0 A;  2ZPN A;  2MCN B;  4FA6 A;  2DYM A;  2KJ6 A;  3VUW A;  4EEW A;  4RM9 A;  4ANV A;  5HKH A;  3ECI A;  2DYO A;  2KMA A;  1UGM A;  1YX6 B;  5CHW A;  1KM7 A;  2ZJD A;  2BPS A;  4J6I A;  3V60 A;  4FN2 A;  4MJS A;  2KMC A;  5D94 A;  2LVP A;  3QK0 A;  4MJS B;  2ZNV B;  4ZRK A;  1WGH A;  4W9H A;  1HE8 A;  4MSQ B;  4DWF A;  4IM2 A;  1JRU A;  3PPA A;  4WJP A;  2KX0 A;  4ZDV A;  1V49 A;  5J17 A;  1WGR A;  4ZRI A;  3NZS A;  2WX1 A;  2V3S A;  4BVU C;  4E74 A;  3PLU A;  1GG3 A;  2KLC A;  4GGQ A;  4IC7 B;  3L54 A;  3IVF A;  2KDE B;  2PJH A;  3H7P A;  4PS3 A;  2MWS B;  4IM3 A;  3BY4 B;  3I3T B;  3N30 A;  1WZ3 A;  1U4A A;  3H7P B;  1Y8R C;  2K6D B;  2EKE C;  2KD0 A;  2K8H A;  1V80 A;  2J7Q B;  2MP2 A;  1WIA A;  2M0X A;  3B0A A;  2JT4 B;  2IO3 B;  1KJT A;  3QJZ A;  2C60 A;  2KJR A;  2MP2 B;  4DHZ E;  5L95 C;  1WM2 A;  2RGF A;  4EZJ A;  2N1V A;  5DPW A;  4AUQ C;  3U7D A;  3R7R A;  2KWV B;  3SHQ A;  1XD3 B;  3QX1 A;  4M0W B;  5JHB A;  4WJN A;  3M95 A;  1WI0 A;  3DVG Y;  1WE7 A;  2G4S A;  2KC2 A;  2CU1 A;  4GXB A;  2JF5 A;  3H7S A;  3VAW A;  4BKT A;  2AYO B;  3M62 B;  1GC7 A;  4MM3 A;  2C7H A;  4MGI E;  2AL3 A;  2D07 B;  5IA7 A;  4PS7 A;  3NOB A;  4B95 A;  3KVF B;  1VCB A;  3N32 A;  5J2R A;  4E71 A;  2JRH A;  3PVL A;  2MBE A;  3GOE A;  2C7M B;  3PHX B;  1V81 A;  1IYF A;  2LVQ A;  2NPT A;  2BYF A;  2XEW A;  3MHS D;  5KHO A;  1E8Z A;  3CST A;  4P7I A;  4OVV A;  4OVU A;  3C0R B;  2NPT B;  5AZG A;  1WGD A;  2LGX A;  4KDL B;  3VTV A;  2MQJ A;  4LDT D;  1NDD A;  2CHW A;  3ONS A;  4LDT B;  2RPQ A;  1UD7 A;  3CSF A;  4URK A;  3ZRF A;  2LRU A;  5AEK B;  2N9E B;  4HDO A;  3ZTC A;  3N3K B;  3A9K A;  2L0F A;  1E7U A;  4HJK A;  2L7R A;  4WAA A;  4ANX A;  1WX8 A;  3ENE A;  3OAW A;  3A9K B;  2KXJ A;  2LXC A;  4GU2 A;  4WWO A;  1V2Y A;  1XT9 B;  1WMH A;  1WXS A;  2K39 A;  2KAN A;  2D10 A;  2UYZ B;  2WX0 A;  3MJW A;  1YQB A;  1SE9 A;  1UBI A;  1WMH B;  3L08 A;  3IBE A;  4W9J A;  1WRD B;  4BBN C;  1UH6 A;  4NJ6 A;  2KQS A;  4DBG A;  2O6V A;  4KSK C;  2WWZ A;  4GDK A;  4TQ0 A;  1K8R B;  4HWI B;  2O6V D;  2O2V A;  2MX2 A;  2N4F A;  2O6V B;  4B9K A;  1KLV A;  4GDK B;  3DCG A;  3PT2 B;  3NY5 A;  3NZU A;  1AAR A;  1EF1 A;  1SIF A;  2D3G A;  2O2V B;  4W9C A;  3HHM A;  2C5L C;  3DPD A;  3SD5 A;  2BKF A;  3L10 B;  2B3A A;  4KDI C;  1V6E A;  2KWU B;  1E8X A;  3AI5 A;  2KHW B;  1IP9 A;  3AXC A;  2KTR A;  4NPN A;  1V5O A;  3H1U A;  4HXD A;  3PS6 A;  5E6N A;  4FJV B;  2KTR B;  2LD9 A;  5DPT A;  1LM8 B;  3D32 A;  1YIW A;  2JWZ A;  4NJ7 A;  3WIM A;  3VH4 B;  4II3 B;  2FCQ A;  2LXA A;  3CF6 E;  4GOC A;  3L16 A;  5D7G A;  3QC8 B;  3Q3J A;  4JGH B;  5E6P A;  3DBS A;  2JRI B;  2KZR A;  2AL6 A;  3U8Z A;  1F9J A;  1TGZ B;  2DHZ A;  2DYB A;  2PE6 B;  3O65 B;  5DPR A;  2FCN A;  2LZ6 A;  3LDZ E;  4FHJ A;  2JPH A;  3DVN U;  3TIX A;  2N1W A;  3PRE A;  3VVW B;  3A1Q A;  4W9D A;  2MLB A;  3DOW A;  2R2Q A;  2KNB A;  4XZ4 A;  4KZ0 A;  4ICV A;  1TBE A;  5E6O A;  1S1Q B;  2GOW A;  3A1Q B;  2J0J A;  5BO4 B;  4MGY E;  3A33 B;  4CYE A;  1UZX B;  3GZN I;  5LXI B;  2J0K A;  3PGE A;  2K6Q A;  3KYD D;  1MG8 A;  1GC6 A;  4GIV A;  3DVN V;  1C3T A;  2G3Q B;  2FID A;  3OJ3 A;  4GMV A;  2KKC A;  1PQS A;  4IWP A;  4IM0 A;  3SDL C;  5AZF A;  2ASQ A;  1V86 A;  4I6N B;  5DCN A;  4DK5 A;  2LWP A;  4G0N B;  2HTH A;  4IWO A;  4TUU A;  2LGY A;  4G11 A;  2L00 B;  4II2 B;  1J8C A;  2V1Y A;  2Z0E B;  4NQK E;  2MBO A;  3UQB A;  2GBK A;  3RCZ A;  2KDB A;  2XBB C;  4IWQ A;  2KWC A;  4IUM B;  3KH0 A;  4BBN F;  2RR9 A;  2IO2 B;  3M63 B;  4WWN A;  3T9L A;  3ZLZ A;  4W9I A;  1QZE A;  5AZH A;  1WGG A;  2C7N B;  2AEH A;  5CHV C;  1OEY J;  3ZNZ B;  1P98 A;  2CR5 A;  4DDI D;  4AJY B;  3W1S A;  1WH3 A;  2Z59 B;  4I6L B;  4PYU A;  3WAO A;  1IPG A;  3X0W A;  4BOS C;  4IG7 B;  2MBQ A;  2L76 A;  4YL8 A;  3TMP B;  3VFK A;  4FJZ A;  2IO1 B;  4RM8 A;  4ZRJ A;  4TKN A;  3RT3 B;  2ZPY A;  3QQ8 B;  5G2N A;  4KSL C;  3R7Q A;  3B08 A;  3LJ3 A;  3V61 A;  4EFO A;  2MW5 A;  2N9X A;  3KUZ A;  3ML8 A;  5FR6 A;  3EC8 A;  4FJY A;  1H8C A;  3VHT C;  3NS8 A;  4W9G A;  1LXD A;  2KDI A;  3K9O B;  5D2M B;  3W1S C;  1ISN A;  3ZVV A;  4DHZ B;  2K8B A;  1I42 A;  3P2B A;  1I35 A;  2QHO A;  3RUI B;  1FXT B;  2NBV B;  3OJ4 B;  1M94 A;  3QA8 A;  2GMI C;  4G50 A;  2VRR B;  4W9E A;  1V5T A;  2JUO A;  1C1Y B;  1R4M I;  1RLF A;  4JQW C;  3VQI A;  4BKG A;  2BF8 B;  2YLM A;  4HCN B;  4F1S A;  2IZV B;  2L3Z A;  3PRZ A;  4FAD A;  4GB9 A;  2ZZP B;  3MTN B;  2KO3 A;  1Z2M A;  4EUT A;  2FIF A;  2IY0 B;  3HIZ A;  2NS5 A;  4ANW A;  2K8C A;  2YVC A;  4ASW C;  1D3Z A;  3RYT A;  2DAJ A;  2ZVO A;  2PEA A;  5J18 A;  2ZEQ A;  1P1A A;  4JIO U;  3WAP A;  2J0M A;  3IFW B;  1UEL A;  3ML9 A;  3A4R A;  3EHV A;  2IYD B;  3VTU A;  3HM3 A;  1RRB A;  2I1K A;  3DBL I;  4G3X B;  2MSE D;  1WR6 E;  2NCN A;  3VH3 B;  2OJR A;  3KUD B;  1WXV A;  2XK5 A;  3ZRC A;  4EOY A;  3RZW C;  2N7E A;  4KVG B;  3ZTD A;  1NI2 A;  2XK5 B;  1E90 A;  1EUV B;  3Q3F A;  3X23 A;  5LLI A;  2GBM A;  3CMM B;  5DPS A;  3JSV A;  3VUY A;  2LGD A;  2N9P C;  1YD8 U;  4K7W A;  3WAL A;  1RFA A;  2BWE S;  2LAS A;  1LFD A;  3JSV B;  3VUX A;  3QWZ B;  2MRP A;  2DZK A;  4F8C B;  2Z0D B;  2JXX A;  2MA9 B;  3DVG X;  3H9D A;  3ZNG C;  1XQQ A;  4FBJ B;  3KW5 B;  3ZNI D;  1KOT A;  1WZ0 A;  2G4D B;  4NNJ B;  3H6N A;  4WQO B;  4FUL A;  2BKR B;  4LJO B;  3SU8 X;  3ZO5 B;  2RD0 A;  5GMV A;  2L05 A;  3TCA A;  1Z5S B;  2GBJ A;  3JW0 X;  1GUA B;  4EZK A;  4NAW A;  1EO6 A;  5TR5 A;  4KZC A;  4NAW B;  1S3S G;  3V62 A;  3EFU A;  2MBH A;  3DQV A;  3ZUN A;  2KQ7 A;  4BOZ B;  3PV1 A;  3ZKJ C;  2C9W B;  3V6C B;  2KFJ A;  1WX7 A;  2N7D A;  4W9L A;  3WAN A;  3ZW3 A;  1T0Y A;  1YX5 B;  1ZW7 A;  5G55 A;  4A20 A;  1J0G A;  2CHZ A;  2JY6 A;  3ZDM C;  4F7Z A;  4DHJ D;  2M17 A;  4DHJ B;  1WY8 A;  5CX3 A;  2DAF A;  2KN5 A;  3U30 A;  2DZI A;  2NBW B;  1WYW B;  2ZCC A;  5JZE B;  1BT0 A;  2BWF A;  2LI5 A;  2JVC A;  4GSW A;  1OGW A;  3AU4 A;  4KV2 A;  3K9P B;  1WFY A;  2ZCB A;  4M8N A;  4MSM B;  4MGZ E;  3RZF A;  5KHQ A;  1WJN A;  2A5U A;  3OLM D;  1Q0W B;  3VDZ A;  3ZIM A;  2KLG A;  2MBB B;  3PRM B;  3PTF C;  3A9J A;  3QIJ A;  3WA0 A;  1ZKH A;  5LXH A;  4MEL A;  1GJZ A;  1Q1O A;  2M1M A;  2W9N A;  3A9J B;  4HLE A;  1P0R A;  2D11 A;  2CHX A;  1TZ1 A;  3IHP C;  4NY0 A;  1WXM A;  2FNJ B;  2ZNV C;  1WR1 A;  2V4L A;  4PS8 A;  1WGY A;  1WJ4 A;  2LRW A;  5JH5 C;  2GBN A;  3TBL D;  4JLC A;  3RUL A;  3B1L X;  4PYZ A;  2DEN B;  3V6E B;  2IO0 B;  2CS4 A;  3HK0 A;  2HD5 B;  4WJQ A;  4RMA A;  2M8S A;  3PSE B;  4FLH A;  3S2A A;  1J19 A;  1EF5 A;  3RD2 A;  3ZDT A;  2WYQ A;  3JVZ X;  1E8Y A;  4K7U A;  5IAA C;  5D6J B;  3L17 A;  4MDK E;  2I1J A;  4A3P A;  2OOB B;  2IBI B;  4FHK A;  4CO7 A;  4EKU A;  3PHW B;  3T8M A;  1V9J A;  2KJH B;  2L8J A;  1P3Q U;  2NR2 A;  1Q5W B;  1P9D U;  3EEC A;  3APF A;  2EMT A;  3R3M A;  4XX5 A;  3WAM A;  2KOX A;  4EZL A;  2L0T A;  2M4N A;  2UWQ A;  3QAQ A;  4JL9 A;  1LQB A;  4ZYN A;  3UIP B;  4I6P A;  1L2N A;  2KX3 A;  2R2O A;  2KC1 A;  4X57 B;  4HDQ A;  3APC A;  2LJ5 A;  2FCS A;  2DZJ A;  1CMX B;  2PE9 A;  2G45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...