2MA9B

Hiv-1 vif socs-box and elongin bc solution structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virion infectivity factor
publication title Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/protein binding
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ma9B00
1YJ1A 2L0FA 2C7NB 3L13A 2WWZA 3PPAA 4M0WB 3VH3B 3AU4A 2MP2B 2DZJA 3H9DA 5E6NA 2MP2A 2L8JA 4F8CB 1Q5WB 4A3OA 1V2YA 1MG8A 2G4SA 2GBKA 4GU2A 4AOFA 4MSMB 3ML8A 3TCAA 1EF1A 4TQ0A 1XQQA 1YQBA 2LWPA 3ZDMC 2KDEB 2LRUA 4W9EA 2FCSA 3ZNGC 3R3MA 5HKHA 4W9FA 3U30A 4LDTD 2KMAA 4MGYE 5KHQA 1WZ0A 3AXCA 2HJ8A 1IP9A 2CU1A 4EFOA 2W9NA 5IA7A 1UELA 1WGRA 3L08A 3TJPA 2K8HA 1WX7A 1SGHA 4DXAB 1WGHA 2KOXA 4G50A 1ZW7A 1Y8RC 3ZNHB 4I6LB 4P7IA 3PREA 3DCGA 3EECA 1WR1A 3IVFA 3PV1A 3ZNID 2KC2A 2KJ6A 2KD0A 1WH3A 3K9OB 4HPLB 3WAMA 3VQIA 4KDLB 4NJ6A 3LDZE 4PYZA 4J6IA 2JVCA 3R7RA 4DHZB 4K7WA 5DPTA 4ICVA 1YX6B 4B9KA 3DBLI 3V61A 2KMCA 3ML9A 1EO6A 4TV3A 2K6DB 2DZMA 2D07B 1WYWB 2D3GA 2ZVOA 5CHVC 3H6NA 1WF9A 4XC2A 4KIKA 1IPGA 2KLGA 4MDKE 4CYEA 2IO0B 5EDSA 2DZKA 3JSVB 2RD0A 4ANWA 2IO3B 2K6QA 2KC1A 1FXTB 3PZDA 4NY0A 3JSVA 4W9DA 3X0WA 1WX9A 4IWOA 2MSED 1WRDB 2FCMA 4G3XB 4HCNB 2FIFA 2GOWA 5D2MB 5E6PA 4DDID 2B3AA 4TUUA 5L95C 1C3TA 2MX2A 3QIJA 2LASA 3ZDTA 1UH6A 3HM6X 4AJYB 2I1JA 2KQSA 3H1UA 3JW0X 3RULA 4ANUA 4HCPB 1KLVA 4IM3A 2DAJA 1OQYA 2QHOA 2V1YA 1V49A 2DYOA 4URKA 1SIFA 2ZZPB 4BFRA 2KHWB 2C60A 1C1YB 4FN2A 1RLFA 2VRRB 2O2VA 5AZFA 4II2B 4FJVB 1TZ1A 2K1FA 4WWOA 2LD9A 3QK0A 5GMVA 3HIZA 2D2QA 4GSWA 4GDLB 3ONSA 4KV2A 1X1MA 2RPQA 3DBHI 4GGQA 4IM2A 2KLCA 4DDGD 2YLMA 4ANXA 3ZIMA 2YVCA 4YL8A 2FUHB 2N9XA 4KSLC 1E8ZA 3PHWB 4HXDA 1WGYA 1U4AA 4KZ0A 2LVOA 4WWNA 1T0YA 1HE8A 2BYVE 1WGDA 4K7UA 2Y5BB 2DZIA 3PT2B 3CSFA 5DPWA 2BYEA 2JUOA 2KFJA 5J17A 3OJ4B 2ZEQA 3DOWA 4EZJA 5DPRA 4FADA 5J2RA 3QX1A 4GXBA 2G45B 3ENEA 3VTVA 3RYTA 1QZEA 4NNJB 3HK0A 1H4RA 2L00B 4GMVA 2DENB 5IAAC 3S2AA 2BGFA 2O6VB 4AP4C 3H7SA 2CS4A 2LRWA 2O6VA 4K81A 4PS3A 3VUXA 1AARA 3RZFA 3V62A 2J0MA 3A1QB 1WY8A 4B6WA 3M95A 3A1QA 3Q3FA 4NAWA 3RD2A 1NBFC 1RRBA 1TBEA 1J8CA 4ICUA 4MELA 4BBNF 4FBJB 2LUEA 3MHSD 3QCAA 2BWFA 2MCNB 1WM3A 4N9F4 1LQBA 2NBUA 1WZ3A 4NQKE 5D7GA 4JIOU 3VTUA 3ZUNA 2LI5A 1V9JA 2KDFB 2MWSB 4GN1A 1WMHB 1ZGUB 4HLEA 1LFDA 2KN5A 2LGYA 3NZUA 1LXDA 2BF8B 3NS8A 1UZXB 3V6EB 4BBNC 2IO2B 1KJTA 3HM3A 1WI0A 2KX0A 3UIOB 4DHJB 2JRHA 3MJWA 1P1AA 1CMXB 3L10B 4IM0A 4EKUA 1NI2A 3R66C 4HDQA 1E5WA 3RUIB 2I1KA 3B1LX 3L16A 2LVPA 3TL5A 3L54A 4CO7A 1WJ6A 3PHXB 2XK5B 5CX3A 5JZEB 3WA0A 3APFA 2KDBA 2N7DA 3DBSA 1A5RA 2ZPYA 1G6JA 3VH4B 1K8RB 2GBJA 3DDCB 2JPHA 3DQVA 4KZCA 3IG3A 2J0JA 2EMTA 3M62B 3QA8A 1RFAA 2IYDB 4WQOB 1GJZA 2G3QB 3APCA 1V5TA 2O6VD 3UIPB 2AL6A 2LZ6A 2ZVNA 4PS8A 3AU5A 3WALA 1V5OA 4K1RB 3W1SA 1E7VA 1Q0WB 4K7SA 3OAWA 3UGBB 5LXIB 4PS7A 3PVLA 3PS6A 2JY6A 2KTRB 2M1MA 3UQAA 2MBBB 4HWIB 4W9KA 2MBHA 4LJPB 2KTRA 3KW5B 4ASWC 2V3SA 3UQBA 3OJ3A 1WJNA 1V6EA 4ZRJA 3ECIA 3A9KB 4WJOA 2DYMA 1OGWA 2KO3A 1UBIA 3TBLD 3A9KA 5E6OA 1WJ4A 2XBBC 5CHWA 3WANA 2Z0DB 3PGEA 2KWVB 3ZTDA 3ZTCA 1JRUA 5JH5C 2MA9B 1P0RA 2MQJA 4KSKC 4DHJD 2DX5B 3DPDA 2JZZA 2C5LC 2KQ7A 4ZRIA 4ZYNA 4W9LA 2KFKB 4NJ7A 2C9WB 1J0GA 3QARA 2CHWA 3KUDB 2KDIA 1WX8A 2LJ5A 4BOSC 2KVRA 2MW5A 4II3B 2L0TA 4RMAA 3OLMD 4ANVA 4EZLA 3JVZX 4ZDVA 1WM2A 4M8NA 3ALBA 2HE7A 3H7PB 1KM7A 3H7PA 4MSQB 1OEYJ 2N9PC 2FCQA 2IBIB 2PJHA 1EF5A 4ZRKA 3D32A 4BKGA 1OTRB 4GDLA 3A4RA 4JGHB 3DVGY 1WR6E 3KVFB 1WJUA 2R2OA 3ZO5B 5D6JB 2ASQA 3NY5A 2M4NA 4CHKA 4DBGA 3ZW3A 5JHBA 3A4SC 1E90A 3PRPB 3ZVVA 2AEHA 1GC7A 2AL3A 2KANA 3CSTA 2MBEA 2KZRA 2Z0EB 2KJRA 2J7QB 5LXHA 1E7UA 4FLHA 1D3ZA 3T8MA 3VUYA 3V60A 5DPSA 2DHZA 4KDIC 3QAQA 2K39A 2HD5B 2N7EA 3BY4B 3JYUA 4MH0E 4BKSA 2M17A 2L3ZA 3QJZA 2BWES 2JWZA 2KTFA 3A33B 4GDKB 4FHJA 4AUQC 4FJZA 3ZLZA 4XZ4A 1NDDA 2REXA 4GDKA 5G2NA 4AJWA 1GUAB 1WE6A 3KH0A 2ZCCA 2NR2A 4BOZB 2FIDA 1Z5SB 4FULA 3SDLC 5L83A 3IHPC 3VXWA 2XEWA 2GMIC 2ZNVB 1OEYA 3NZSA 3PLVA 4E3CA 5BO4B 3W1YA 2ZCBA 4TKNA 2LXAA 4GB9A 1P98A 2MRPA 2HTHA 3W1SC 2V4LA 1SE9A 1BT0A 2IY0B 2RR9A 3O65B 1WMHA 3EHVA 4W9CA 3WIMA 2BYFA 2WX1A 4I6NB 1UBQA 3ZNZB 2N9EB 2NPTB 4RM8A 2LVQA 4W9GA 3PRMB 4JQWC 5CTRC 2NPTA 2OOBB 5AZHA 1Z2MA 1M94A 5AZGA 3M63B 4IWPA 3RCZA 4A20A 2BPSA 2KWUB 2K8CA 2XK5A 4EOYA 1GG3A 3SU8X 2C7MB 4EZKA 3EFUA 3N30A 4BKSD 4OVVA 4F7ZA 3IBEA 3QWZB 1V86A 2FCNA 1XD3B 2NS5A 3LJ3A 4JLCA 2LGDA 2JF5A 4E74A 3APDA 1R4NI 5LLIA 3P2BA 4WJPA 2D10A 3U7DA 3AI5A 2L7RA 2BKRB 2NBVB 4G0NB 2WYQA 4GOCA 2AWTA 2KNBA 3QC8B 2PEAA 3HHMA 1R4MI 4BVUC 1P3QU 3DVNU 4FJYA 4BKTA 4FHKA 3I3TB 2KXJA 5JHAA 3GOEA 2KK8A 5TR5A 4F1SA 3PRZA 3DVNV 3CF6E 4EUTA 2RSUA 2N1VA 4GIVA 4KVGB 3T9LA 4LJOB 2MLBA 3AULA 2JRIB 2R2QA 4MM3A 3SHQA 3KYDD 4EEWA 2JZ3B 1WXVA 2A4ZA 4XX5A 4HPMB 2G4DB 5C1ZA 1YD8U 2OJRA 2ZJDA 2DYBA 2CKHB 2A5UA 3KYCD 5C23A 3SD5A 1YIWA 2PE6B 1I35A 2MBQA 2BKFA 3M3JA 3Q3JA 3RZWC 3VTWA 3BINA 4W9JA 3UINB 2RGFA 1GNUA 3QQ8B 2N4FA 4HDOA 2AYOB 1WXAA 3C0RB 2GBRA 2KFKA 3MTNB 1WGGA 1YX5B 4KIKB 1S1QB 1S3SG 3N32A 3A9JB 2KX3A 4HK2A 2M8SA 3A9JA 3L17A 4W9IA 4MGIE 3PLUA 1I42A 5D94A 1H8CA 5AEKB 3VHTC 1P9DU 4AWJA 2UYZB 1UGMA 1IYFA 1ZKHA 4W9HA 1Q1OA 2ZNVC 4WWPA 3TMPB 2NCNA 4FA6A 2M0XA 2PPHA 2KKCA 2KJHB 2N1WA 1EUVB 2DAFA 4WAAA 3X23A 2KWCA 4B95A 2EMSA 1LM8B 1WXSA 4HJKA 2PE9A 4JL9A 5KHOA 3UF8A 4I6PA 1F9JA 1V80A 1WE7A 4G11A 4A3PA 4IWQA 1J19A 2K25A 2WDTB 2Z59B 3VDZA 2O2VB 2CHZA 2WX0A 3EC8A 3DBRI 3WAPA 1GC6A 4E71A 3DVGX 3QHTA 3U8ZA 4IUMB 2C7HA 1L7YA 2NVUI 2LGXA 1VD2A 1WXMA 2MBOA 3L0WB 3N3KB 1KOTA 2IY1B 1E8WA 3B0AA 2EKEC 2ZPNA 3PSEB 4IG7B 1VCBA 2LXCA 1WFYA 1PQSA 2IO1B 5CHFA 4LDTB 1RAXA 4WJNA 4OVUA 2J0KA 4DHZE 3TIXA 4DK5A 3NHEB 3VFKA 5J18A 4MJSB 1V81A 4MGKE 1TTNA 2L76A 4M8MA 4RM9A 4MJSA 3VAWA 4MGZE 3RT3B 2CHXA 2FAZA 2GBMA 1E8YA 2K8BA 3IFWB 4TQ1A 1ISNA 1UD7A 3V6CB 1L2NA 4NPNA 3ZRFA 4HVBA 3VUWA 2FNJB 1E8XA 2D11A 3PTFC 3VVWB 4X57B 2L05A 2UWQA 4LCDE 3KUZA 4PYUA 3WAOA 3B08A 5G55A 2NBWB 3CMMB 4IW0A 3KUCB 5DCNA 3R7QA 3K9PB 1WIAA 3GZNI 4IC7B 3ZRCA 4DWFA 2GBNA 1TGZB 4MEMA 1XT9B 2JXXA 2JT4B 3NOBA 4WJQA 3ZKJC 4NAWB 5FR6A 2IZVB 4NQLB 2CR5A
chains in the Genus database with same CATH superfamily
1PUTA 3VH3B 2KMMA 3AU4A 5C3JB 3J9CA 2WXIA 2M56B 2KVZA 3B2GA 4F8CB 1Q5WB 4A3OA 1E9MA 2LUMA 4MSMB 1EF1A 3ZDMC 2V0GA 4W9FA 3AXCA 1IBXB 2TSSA 1FMAD 1IBXA 2YEPF 1C77A 2W9NA 4D2KA 3TJPA 2K8HA 1JWMD 4IDIA 2INNE 4RGNA 3VRBB 1EM7A 4P7IA 2WXGA 1KF6B 3EECA 1WR1A 5HHDG 1XCQL 2KD0A 2RDHA 1YQ4B 1WH3A 3WAMA 2WS3B 4NJ6A 4Q2JA 4J6IA 3R7RA 4K7WA 4B9KA 1M4VA 3IXSA 1YN3A 2KMCA 3CIRB 1TS3A 2WDRB 2WHIA 4ANWA 3JSVB 1FXTB 3JSVA 1WX9A 4IWOA 1VZ6A 2MSED 1UF0A 2FIFA 2B3AA 4A8XC 1KH0A 2YEPB 1E6EB 4FXCA 2LASA 1TS5A 3SEBA 3JW0X 4ANUA 4HCPB 4HPPA 2INDC 1MPEA 2QHOA 1V49A 1SIFA 4KGSA 4UDUC 2C60A 4FN2A 1WXQA 1DYQA 3AE6B 1E7PB 1GAQB 5GMVA 2D2QA 2VH1A 3E9SA 2MH7A 2NTSA 4GDLB 4KV2A 1X1MA 2RPQA 4GGQA 3ZIMA 2VH2A 2N9XA 2ICIA 3P63A 1U4AA 2LVOA 4ZOHC 1HE8A 1WGDA 5JXVA 1N63A 2KFJA 3Q14C 2KYWA 4YT0B 4EZJA 5J2RA 1V97A 4NNJB 1H4RA 4GMVA 2DENB 2BGFA 4PS3A 3Q2AC 3A1QB 4C4VB 3A1QA 4JWUC 3RD2A 4C4VA 1ZXHA 4ICUA 4MELA 4FBJB 2LUEA 3MHSD 3QCAA 5D3DA 5IOIA 3FC4A 1WZ3A 4NQKE 5D7GA 2GB1A 4JIOU 3ZUNA 1WMHB 4HLEA 3NZUA 2BF8B 1PGBA 4BBNC 2WU2B 5IKCM 5LXIB 3MJWA 4IM0A 1CMXB 3R66C 4XE0A 1D4BA 2RDBC 3Q3NC 3WA0A 1N61A 2N9LA 2N7DA 3DBSA 4P1BC 2ZPYA 2GBJA 3DDCB 3AE5B 3DQVA 3U4EG 4MT5A 2J0JA 2EMTA 1J7CA 1RFAA 1AW7A 5GXGB 2JYEA 2O6VD 1YOVB 2ZVNA 4PS8A 5TSSA 3TEYA 2BS3B 1SE4A 3W1SA 2KT7A 4OHJA 2DLBA 1I4PA 3UQAA 5D3IB 4CQNA 2JZPA 4JE3B 1OQRA 3Q3OC 2ACZB 2V3NA 3PGEA 4MH8A 3RFZB 2DX5B 2QEJC 2W55A 1TS2A 4REZA 2QCZA 3RNGC 1WX8A 2MW5A 2L0TA 3OLMD 4EZLA 2R61A 3JVZX 4ZDVA 1WM2A 4M8NA 3ALBA 2I38A 1N60A 2N9PC 3AEDB 2FCQA 2PJHA 4LNFA 4YTMB 1FM0D 2J53A 1K50A 3MJ5A 3A4RA 4JGHB 1EWCA 2FBWB 3KVFB 2ASQA 4CHKA 1DOIA 2DWQA 2VZKD 5EE3A 3PRPB 2AEHA 2AL3A 1D5ZC 3E56A 4AS1A 3U52E 2KZRA 1C4PA 2Z0EB 2KJRA 4HKQA 2INCC 1F77A 3V60A 4KDIC 3ABVB 1JRPA 2N7EA 1TYGB 2WXKA 3JYUA 4BKSA 2L3ZA 2BWES 4XZ4A 1NDDA 2REXA 2RPVA 3KWVA 3KH0A 2B76B 3IAM1 3Q8BA 3DWMA 2FUG1 2GMIC 4E3CA 1MVKA 1P98A 5IO9A 2V4LA 1TJEA 2MEKA 2RR9A 4M00A 3EHVA 3GS2A 4LNOA 2OEDA 2BYFA 4RFBA 1UBQA 1M94A 4IWPA 1SJED 1DOYA 3MHZA 2D3AA 2XK5A 3EFUA 2WNMA 4F7ZA 4BAXA 3Q8EA 4JPSA 2LEKA 5LLIA 4WJPA 1UWMA 3BK1A 2WXHA 3BYTB 2NBVB 2PEAA 1BUIC 1P3QU 4FJYA 4BKTA 5JHAA 2KXJA 5TR5A 2BB5A 3DBRB 4A90A 1TKYA 2N1VA 4GIVA 1AWDA 2R2QA 3KYDD 2A4ZA 2AQ1B 4HPMB 4OVZA 2G4DB 1SBBB 1YD8U 2OJRA 1I4GA 2CJOA 1YIWA 4ACFA 3M3JA 4HRSA 2IGGA 3UINB 2Z8LA 2N4FA 4XDDA 1WXAA 3C0RB 1WGGA 1ZPSA 4KIKB 3DHGC 4W9IA 3P4RB 2H89B 5BMHA 2G9HD 1SE2A 2MJEA 1UGMA 2ZNVC 2DAFA 2LGSA 2RMMA 4WAAA 2EMSA 4JL9A 1NEKB 4G11A 1NYQA 2WDTB 2O2VB 2CHZA 3DVGX 3QHTA 1AYFA 2MBOA 1RYJA 3L0WB 1V8CA 1KOTA 1E8WA 3Q8CA 1EWYC 2WGSA 2D5GA 1WFYA 1PQSA 5CHFA 1QQRA 4WQMA 1C79A 3W5UB 2XNAC 2JQRB 4MJSB 1V81A 1VRAB 4MJSA 2CHXA 2FAZA 1L5PA 2W54A 1OFFA 3V6CB 1L2NA 3VUWA 2FNJB 1E8XA 2D11A 4USAA 2UWQA 4LCDE 3B08A 3N1YC 3B9JA 5DCNA 3BK2A 5FK9C 3GZNI 1JROA 3ZRCA 2GBNA 4WJQA 3NOBA 1PYWD 3AE2B 2IZVB 2CR5A 1N5XA 1C4CA 4L1BA 2C7NB 3PPAA 4M0WB 3H9DA 2SAKA 5E6NA 4M0WA 4RF1A 3IAS1 1MG8A 2GBKA 2LWPA 3ZNGC 2KDEB 4W9EA 3U30A 3P4SB 5KHQA 2KMAA 1WZ0A 3NVYA 4C7YA 5IA7A 1UELA 1WGRA 2JSVX 4G50A 4EE2A 4L2YA 1Y8RC 3ZNHB 4I6LB 4P6VF 3IVFA 4RCOA 2KC2A 3BZDB 4MACA 3VQIA 2RDGA 3LDZE 4PYZA 2K22A 4DHZB 3DBLI 2QDFA 2K6DB 1WYWB 4XGAB 2QC8A 1C4AA 2E6XA 2PVOD 2BTEA 1IPGA 2KLGA 2KC1A 3PZDA 3DHIC 3X0WA 1WRDB 4DDID 5E6PA 4HROA 3QIJA 1UH6A 3HM6X 2I1JA 3HUIA 1KLVA 2V1YA 1HTQA 3AN1A 2KHWB 1JWAD 1JMLA 1RLFA 1PFDA 1Y56A 4II2B 2K1FA 5EE0A 4ITKA 4NJCA 1ZDXA 4DDGD 2YLMA 4ANXA 1MFWA 2YVCA 1FNVA 2FUHB 4WWMA 1E8ZA 2MJ3A 1YN5A 5BYRA 4KZ0A 1F2RC 2BYVE 3ZYYX 1MJDA 3CSFA 5DPWA 2QSDA 1F1HA 2KN4A 1I7HA 2K3UA 2IGHA 2G45B 3ENEA 3VTVA 3GE8C 5IAAC 2O6VB 2I2YA 3H7SA 2LRWA 2O6VA 1XEEA 3RNEC 3EFCA 1AARA 3V62A 2J0MA 1WY8A 2PW9A 2ON8A 3M95A 2JYTA 3Q8AA 4US8A 1JWSD 4NAWA 4A9AA 1NBFC 3EGRA 3I63C 1YNTE 2KDFB 2IDYA 1LFDA 2LFIA 3HM3A 3UIOB 4EKUA 2JRHA 4C7ZA 3L10B 2QIEB 1VZ7A 2I1KA 1T0SC 1QOAA 2LVPA 3TL5A 4CO7A 1WJ6A 3PHXB 2HTME 5JZEB 3AE8B 3APFA 1G6JA 1NENB 1HQRD 1K8RB 3W5VB 4KZCA 3IG3A 2MHJA 3QA8A 3LB8C 2JWUA 3W9CB 3WALA 4LK0M 1V5OA 1QILA 4K7SA 1EU3A 4PS7A 2WXNA 2KTRB 2M1MA 2VZKB 1PGAA 4HWIB 4LJPB 2KTRA 3UQBA 1WJNA 1V6EA 2DYMA 1JW9D 1UBIA 1ENFA 2BT6A 2WLBA 3TBLD 5CHWA 3WANA 1LGRA 3ZTCA 1JRUA 3R2TA 5JH5C 1HZ6A 1P0RA 1RM6C 4DHJD 4XYCA 3DPDA 2JZZA 2X38A 4M01A 4US9A 4W9LA 4NJ7A 1J0GA 3DWGC 2LJ5A 5MPOA 3Q3MC 2IJ0A 3N20C 1CZPA 2OJWA 1E10A 1ZOYB 3H7PB 1KM7A 1C76A 3H7PA 4MSQB 3KQ4A 1OEYJ 4S17A 4ZRKA 1EF5A 1V1PB 3D32A 4KKJA 4N58A 1V1PA 3TEWA 2DBYA 4GDLA 1WJUA 2R2OA 5D6JB 4DBGA 2M4NA 3ZGZA 4JWSC 3ZVVA 2NTTA 1GC7A 2EELA 2DNFA 1E7UA 4FLHA 1TKGA 3P1MA 2K39A 2HD5B 5HFYA 2M17A 3QJZA 2JWZA 3A33B 4GDKB 4FHJA 4FJZA 5EE9A 3ZLZA 1WSPA 4GDKA 5G2NA 4C80A 3OWEB 2V4IB 2ZCCA 4YWGG 1SJHD 4BOZB 2LMCA 1Z5SB 4B0EA 5L83A 1HEZE 2CJNA 3R2IA 3NVZA 3AM9A 3MC8A 3PLVA 4N6EB 1OEYA 3GE3C 3W1YA 5G5HA 5T8IA 5E6JA 1K52A 3AE9B 3C8YA 1BT0A 4YTPB 1WMHA 3NVVA 1L6UA 4RM8A 4W9GA 4JQWC 5AZHA 5CTRC 2OOBB 5AZGA 1FNUA 4HJGE 2WXLA 2K8CA 1TY2A 3W2DA 4H2AA 1V86A 1XF5L 2FCNA 1ET6A 4E74A 3P2BA 2D10A 3V05A 2WYQA 2Q5WD 2KNBA 4GOCA 3I3TB 4L23A 2BQQA 3CF6E 3MC0B 3T9LA 3AULA 2JRIB 2JZ3B 1ZDVA 2ZW0A 3OG5A 5C1ZA 1T0QC 2ZJDA 2DYBA 3KYCD 3SD5A 1F0ZA 1TIFA 3VRAB 1GNUA 3QQ8B 3GP7A 1SXTA 5H8YE 3MTNB 1YX5B 1S3SG 1ZP0B 4MGIE 1I42A 5AEKB 3MC9A 2UYZB 1IUEA 1IYFA 1ZKHA 3I9V1 3PO0A 2M0AA 3GZNB 4FA6A 2PPHA 2KJHB 4M02A 2N1WA 4B95A 2KWCA 1LM8B 2PE9A 4A3PA 3VDZA 4E71A 1MHHE 1FXIA 3AEAB 4IUMB 2LGXA 2UU7A 1WXMA 3B0AA 3PSEB 2ZPNA 2IO1B 3ZJVA 4OVUA 1EU4A 3NHEB 3VFKA 5J18A 1TTNA 4M8MA 3TUOA 3RT3B 2GBMA 1E8YA 2WDVB 1SF0A 4XDCA 2K8BA 1N62A 4TQ1A 1TY0A 1IGDA 1ISNA 2K5PA 3TSSA 1FO4A 3VVWB 1F52A 2BVCA 3TEXA 5AUKA 1I4HA 1ACCA 2K9XA 1NI3A 1KLUD 3CMMB 1QLBB 4IC7B 3DBLB 4DWFA 4MEMA 2JXXA 3S2AA 4NAMA 3L13A 2WWZA 1FFVA 2DZJA 2QMTA 1TT5B 2G4SA 1LO5D 3ML8A 2L83A 4TQ0A 1XQQA 1YQBA 2LRUA 3R3MA 5HKHA 5IP4D 3AV8A 4LDTD 1SE3A 2HJ8A 2CU1A 1IP9A 2X8XX 4EFOA 5IN7A 4PT5A 4YSYB 1WX7A 1SGHA 1ZE3D 3I57A 3PREA 3O13A 3PV1A 1GB4A 3ZXVA 1VJKA 3K9OB 1FPYA 4KDLB 2W82A 2JVCA 4P16A 1QOBA 5DPTA 4ICVA 1YX6B 3V61A 3ML9A 1XLQA 1QF6A 4TV3A 2DZMA 2D07B 2D3GA 3AE4B 5CHVC 4XC2A 4KIKA 4CYEA 3L4PA 2DZKA 5C2TB 2CU3A 4W9DA 2FCMA 4OZAA 4HCNB 2GOWA 4TUUA 3H8HA 3RMKC 1FRDA 2GLSA 1ESFA 1C3TA 2BW2A 4AJYB 2KQSA 3H1UA 1CJEA 2KDMA 4IM3A 3R8BA 3EA6A 2DYOA 2ZZPB 5BYSA 4DQOC 1C1YB 2VRRB 2O2VA 3RNBC 4FJVB 1TZ1A 2M19A 4GSWA 3ONSA 1T3QA 4IM2A 2KLCA 3N9YC 1B9RA 3PHWB 4HXDA 4A55A 1WGYA 1T0YA 4K7UA 2Y5BB 2DZIA 3PT2B 1Q10A 3VR9B 5J17A 3OJ4B 2D3BA 2ZEQA 3ZXRA 3QX1A 4GXBA 1R4NB 2KACA 1FXAA 1QZEA 4DXFA 3HK0A 4ARCA 2L00B 1T5XD 4AP4C 3SFDB 2CS4A 1R4MB 1JALA 3RZFA 4B6WA 2PMVA 1TBEA 1J7AA 3P4QB 2BWFA 1LQBA 2NBUA 2LI5A 1V9JA 2PLPA 2MWSB 1QT9A 2G1EA 4GN1A 1ZGUB 2KN5A 2LGYA 3NS8A 1UZXB 2IO2B 3N1ZC 4DHJB 1P1AA 1NI2A 4HDQA 1E5WA 1SIJA 5FKAC 3L16A 3PZ7A 2KDBA 2Y5PA 4GLSC 5LNK1 1A5RA 3ZJTA 3VH4B 2JPHA 4LNKA 3M62B 4KGTA 4WQOB 1GJZA 2G3QB 3UIPB 2AL6A 1ROEA 2Y5CA 1E7VA 1L0XB 1Q0WB 1FNWA 4HKZE 3OAWA 3UGBB 4RNAA 3AMZA 2JY6A 2MBBB 4W9KA 2MBHA 3KW5B 4ASWC 4XWTA 4ZRJA 3ECIA 1XLOA 3A9KB 1OGWA 4HEA1 3A9KA 1WJ4A 2XBBC 2Z0DB 3RNAC 2MA9B 2C5LC 2KQ7A 4ZRIA 4ZYNA 2HJ1A 1I4QA 2KFKB 2WXMA 2CHWA 1L4ZB 1IGCA 4II3B 3BIID 2J52A 2HE7A 4S0RA 1WRIA 3NS1A 1OTRB 2WXOA 2KQ4X 3NY5A 2JXTA 3ZW3A 3A4SC 3Q8FA 1E90A 3Q6BA 2KANA 2L52A 4JX1C 2MBEA 3BVZA 2J7QB 3T8MA 2DHZA 3FILB 4YTNB 4MH0E 1GPXA 3FILA 3BYYB 4AJWA 2OHFA 4WH4A 4FULA 1BXTA 3SDLC 3IHPC 3VXWA 2XEWA 2ZNVB 2W3SA 2ZCBA 2PTLA 2MRPA 2HTHA 3W1SC 2HDEA 1SE9A 3T3NA 3WIMA 2FE8A 4I6NB 3ZNZB 2N9EB 2NPTB 2LVQA 3PRMB 2NPTA 2WQYB 3M63B 5BYQA 2BPSA 4WAFA 2KWUB 3PZ8A 4R3DA 4EOYA 1MG4A 1A70A 4OVVA 3QWZB 1XD3B 2NS5A 3LJ3A 3RN9C 3BVGA 4JLCA 2JF5A 2V3PA 1D5XC 3APDA 1R4NI 3RPFC 3U7DA 3AI5A 2GRIA 2BKRB 2AWTA 3QC8B 3HHMA 4RH6A 1R4MI 4FHKA 4WURA 4F1SA 2KK8A 4MM3B 2RSUA 4KVGB 3I5JC 1BMLC 4MM3A 3SHQA 3HVZA 1WXVA 2LGIA 1DGJA 4J3OD 2CKHB 2A5UA 1OQQA 2PE6B 3DBHB 3N1XC 2MBQA 1I35A 3RZWC 3VTWA 4W9JA 2RGFA 2GBRA 2BYTA 2QILA 2KX3A 2QJLA 3L17A 2BB6A 2JX5A 3PLUA 2EKIA 4N59A 2WDQB 1P9DU 1YMHE 3T3OA 1HZ5A 1JWBD 4W9HA 1Q1OA 3AE3B 4WWPA 1AN8A 1EUVB 1I4XA 1WXSA 4HJKA 3UF8A 2KWDA 1WE7A 4IWQA 1FFUA 2K25A 2NMQA 2Z59B 4YSZB 3WAPA 3EC8A 3U8ZA 1L7YA 1VD2A 3N3KB 2IY1B 1WYGA 3ETRA 1VCBA 1HTOA 2LXCA 4LDTB 1SSNA 4DHZE 3TIXA 2JU6X 4NZLB 4MGKE 3AECB 4MGZE 2L32A 1UD7A 1PDXA 1N5WA 1ZXIA 3P42A 4NPNA 4HVBA 3HRDD 1K53A 3PTFC 4X57B 2WXJA 3KUZA 3WAOA 4K3BA 2NBWB 3R7QA 2ONQA 3K9PB 1WIAA 3U7ZA 1KTKA 3ZKJC 2JT4B 3OJ3A 4NQLB 2AQ2B 1YJ1A 2L0FA 4C56C 2MP2B 2MP2A 2L8JA 1V2YA 3RNCC 1NYRA 4GU2A 4AOFA 3TCAA 2FCSA 1YJIA 4MGYE 1CK1A 1N6ZA 1FD6A 1DOXA 2BBCA 3L08A 4DXAB 2IGDA 1WGHA 2KOXA 1ZW7A 3NRZA 4OZCA 4P1CC 3DCGA 2IPKD 3ZNID 2KJ6A 4HPLB 3EUB2 1I4RA 1C78A 1CQVA 3NZ3A 1EO6A 2J42A 2ZVOA 3H6NA 1T6BX 1WF9A 3SFEB 1UWXA 1V1OA 4MDKE 2IO0B 3KLSX 5EDSA 2PIAA 4QAYA 3AEEB 2RD0A 2IO3B 2K6QA 4NY0A 4G3XB 5D2MB 5L95C 2D3CA 4LNIA 4ZRPA 1XLNA 2N7JA 2MX2A 3NUHB 3ZDTA 1QKZA 3RULA 5BMGA 2DAJA 1OQYA 4URKA 4BFRA 1C9FA 4BZAA 4ZYSA 1L0VB 4TMAB 1QOGA 1FEHA 3CWIA 5AZFA 4WWOA 2LD9A 3QK0A 1MHXA 1GOZA 3HIZA 2WXRA 3ZQ4A 1JCKB 3AEFB 3DBHI 4LLGM 3RI7C 1YJJA 4YL8A 4KSLC 4XWWA 1R7SA 1UGJA 2J4XA 4LNNA 4WWNA 3MP9A 4KKIA 2BYEA 2JUOA 4RGMA 2E3TA 3DOWA 5DPRA 4FADA 1VZ8A 3RYTA 3AH7A 3TEZA 3URYA 4K81A 3VUXA 3GB1A 4B0MA 3Q3FA 2LHDA 1RRBA 4YXDB 1J8CA 4BBNF 2MCNB 1WM3A 4N9F4 3VTUA 1MI0A 1LXDA 3V6EB 3VR8B 1KJTA 1WI0A 2KX0A 4DXGA 3B2FA 4YSXB 3RUIB 5HG2A 3NVWA 3B1LX 1PGXA 3L54A 2XK5B 5CX3A 1B1ZA 2KAJA 2K0PA 1RFKA 2IYDB 3APCA 1V5TA 2LZ6A 2LJIA 3MFGA 1J7BA 2AQ3B 3AU5A 3BWUD 2XN9C 4K1RB 1WWTA 4RF0A 1SEBD 3PVLA 3PS6A 1P7FA 1T0RC 1TZOA 2V3SA 2LHEA 1JQ4A 4WJOA 2KO3A 1SB3C 5E6OA 2KWVB 3ZTDA 4ZRQA 1F2RI 2MQJA 4KSKC 1QOFA 3V3XA 4AQ7A 2C9WB 1GB1A 1L0YB 2WXFA 2PVGC 3QARA 3KUDB 3AE1B 2KDIA 4BOSC 2KVRA 1UNSA 3IT6B 2MJDA 4ZHOA 4RMAA 4ANVA 1WGKA 1FIQA 1RWSA 1HA5A 1TS4A 1YQ3B 2IBIB 4BKGA 1KLGD 1FCCC 1XCTL 3DVGY 1WR6E 1UUPA 3ZO5B 1FCLA 1FRRA 1TKEA 5JHBA 3DHHC 1L4DB 1YN4A 3CSTA 2WXQA 3ZJUA 5LXHA 1K51A 1D3ZA 3VUYA 5DPSA 1JWUD 3QAQA 3BY4B 4RGOS 1ET9A 2KTFA 4AUQC 2W3RA 1GUAB 1L6VA 1WE6A 2NR2A 2FIDA 3U2SC 2H88B 4A6QA 3NZSA 5BO4B 4TKNA 2LXAA 4GB9A 2L1AA 4OZBA 2IY0B 3O65B 3SR6A 4W9CA 4TSSA 2WX1A 4K3CA 4RGTA 5H92C 1Z2MA 3AB5A 4O1NA 2GI9A 3RCZA 1VLBA 4A20A 2SEBD 3NJTA 1GG3A 3SU8X 2C7MB 4EZKA 2AX5A 2BS2B 3N30A 4BKSD 4KGRA 3IBEA 4C00A 5FR3A 1E0ZA 2LGDA 1KRHA 2Y3AA 1VR9A 2L7RA 1STEA 4G0NB 4BVUC 3DVNU 3GOEA 3WCQA 3PRZA 3DVNV 4EUTA 4LJOB 2MLBA 3BVMA 3NG0A 4EEWA 5BMIA 4XX5A 3LYYA 1P7EA 5AUIA 3LXFA 5C23A 1D6EC 2N0SB 2BKFA 3Q3JA 3FAHA 5EE1A 3BINA 4PK1A 2V9HA 3FKYA 4HDOA 4ARIA 2AYOB 1XLPA 2KFKA 2INPE 4LTUA 3RNFC 1S1QB 4KX6B 3N32A 3A9JB 4HK2A 2M8SA 3A9JA 4IKGA 3AEGB 3KWLA 5D94A 1H8CA 3VHTC 4AWJA 1VDVA 3HVDA 3TMPB 1NVID 2NCNA 2M0XA 3Q69A 2KKCA 3X23A 2ZW1A 4OW0A 5I4DA 2WP9B 5KHOA 4I6PA 1F9JA 1ZUD2 1V80A 1J19A 2WU5B 2WXPA 2WX0A 3DBRI 1GC6A 3IT4B 2C7HA 2NVUI 4ZHPA 4IOIE 2EKEC 3P4PB 4IG7B 2PKOA 1RAXA 4WJNA 5HI1A 2J0KA 1XXGA 4DK5A 5G5GA 2L76A 4RM9A 3VAWA 3C19A 1XO3A 4WIPA 3IFWB 3AEBB 3UI3A 1KFYB 3ZRFA 1D5MC 2BS4B 2N9KA 2L05A 4PYUA 5G55A 3AE7B 4IW0A 3KUCB 1HXYD 1TGZB 1XT9B 4NAWB 5FR6A
chains in the Genus database with same CATH topology
1YJ1A 2L0FA 2C7NB 3L13A 2WWZA 3PPAA 4M0WB 3VH3B 3AU4A 2MP2B 2DZJA 3H9DA 5E6NA 2MP2A 2L8JA 4F8CB 1Q5WB 4A3OA 1V2YA 1MG8A 2G4SA 2GBKA 4GU2A 4AOFA 4MSMB 3ML8A 3TCAA 1EF1A 4TQ0A 1XQQA 1YQBA 2LWPA 3ZDMC 2KDEB 2LRUA 4W9EA 2FCSA 3ZNGC 3R3MA 5HKHA 4W9FA 3U30A 4LDTD 2KMAA 4MGYE 5KHQA 1WZ0A 3AXCA 2HJ8A 1IP9A 2CU1A 4EFOA 2W9NA 5IA7A 1UELA 1WGRA 3L08A 3TJPA 2K8HA 1WX7A 1SGHA 4DXAB 1WGHA 2KOXA 4G50A 1ZW7A 1Y8RC 3ZNHB 4I6LB 4P7IA 3PREA 3DCGA 3EECA 1WR1A 3IVFA 3PV1A 3ZNID 2KC2A 2KJ6A 2KD0A 1WH3A 3K9OB 4HPLB 3WAMA 3VQIA 4KDLB 4NJ6A 3LDZE 4PYZA 4J6IA 2JVCA 3R7RA 4DHZB 4K7WA 5DPTA 4ICVA 1YX6B 4B9KA 3DBLI 3V61A 2KMCA 3ML9A 1EO6A 4TV3A 2K6DB 2DZMA 2D07B 1WYWB 2D3GA 2ZVOA 5CHVC 3H6NA 1WF9A 4XC2A 4KIKA 1IPGA 2KLGA 4MDKE 4CYEA 2IO0B 5EDSA 2DZKA 3JSVB 2RD0A 4ANWA 2IO3B 2K6QA 2KC1A 1FXTB 3PZDA 4NY0A 3JSVA 4W9DA 3X0WA 1WX9A 4IWOA 2MSED 1WRDB 2FCMA 4G3XB 4HCNB 2FIFA 2GOWA 5D2MB 5E6PA 4DDID 2B3AA 4TUUA 5L95C 1C3TA 2MX2A 3QIJA 2LASA 3ZDTA 1UH6A 3HM6X 4AJYB 2I1JA 2KQSA 3H1UA 3JW0X 3RULA 4ANUA 4HCPB 1KLVA 4IM3A 2DAJA 1OQYA 2QHOA 2V1YA 1V49A 2DYOA 4URKA 1SIFA 2ZZPB 4BFRA 2KHWB 2C60A 1C1YB 4FN2A 1RLFA 2VRRB 2O2VA 5AZFA 4II2B 4FJVB 1TZ1A 2K1FA 4WWOA 2LD9A 3QK0A 5GMVA 3HIZA 2D2QA 4GSWA 4GDLB 3ONSA 4KV2A 1X1MA 2RPQA 3DBHI 4GGQA 4IM2A 2KLCA 4DDGD 2YLMA 4ANXA 3ZIMA 2YVCA 4YL8A 2FUHB 2N9XA 4KSLC 1E8ZA 3PHWB 4HXDA 1WGYA 1U4AA 4KZ0A 2LVOA 4WWNA 1T0YA 1HE8A 2BYVE 1WGDA 4K7UA 2Y5BB 2DZIA 3PT2B 3CSFA 5DPWA 2BYEA 2JUOA 2KFJA 5J17A 3OJ4B 2ZEQA 3DOWA 4EZJA 5DPRA 4FADA 5J2RA 3QX1A 4GXBA 2G45B 3ENEA 3VTVA 3RYTA 1QZEA 4NNJB 3HK0A 1H4RA 2L00B 4GMVA 2DENB 5IAAC 3S2AA 2BGFA 2O6VB 4AP4C 3H7SA 2CS4A 2LRWA 2O6VA 4K81A 4PS3A 3VUXA 1AARA 3RZFA 3V62A 2J0MA 3A1QB 1WY8A 4B6WA 3M95A 3A1QA 3Q3FA 4NAWA 3RD2A 1NBFC 1RRBA 1TBEA 1J8CA 4ICUA 4MELA 4BBNF 4FBJB 2LUEA 3MHSD 3QCAA 2BWFA 2MCNB 1WM3A 4N9F4 1LQBA 2NBUA 1WZ3A 4NQKE 5D7GA 4JIOU 3VTUA 3ZUNA 2LI5A 1V9JA 2KDFB 2MWSB 4GN1A 1WMHB 1ZGUB 4HLEA 1LFDA 2KN5A 2LGYA 3NZUA 1LXDA 2BF8B 3NS8A 1UZXB 3V6EB 4BBNC 2IO2B 1KJTA 3HM3A 1WI0A 2KX0A 3UIOB 4DHJB 2JRHA 3MJWA 1P1AA 1CMXB 3L10B 4IM0A 4EKUA 1NI2A 3R66C 4HDQA 1E5WA 3RUIB 2I1KA 3B1LX 3L16A 2LVPA 3TL5A 3L54A 4CO7A 1WJ6A 3PHXB 2XK5B 5CX3A 5JZEB 3WA0A 3APFA 2KDBA 2N7DA 3DBSA 1A5RA 2ZPYA 1G6JA 3VH4B 1K8RB 2GBJA 3DDCB 2JPHA 3DQVA 4KZCA 3IG3A 2J0JA 2EMTA 3M62B 3QA8A 1RFAA 2IYDB 4WQOB 1GJZA 2G3QB 3APCA 1V5TA 2O6VD 3UIPB 2AL6A 2LZ6A 2ZVNA 4PS8A 3AU5A 3WALA 1V5OA 4K1RB 3W1SA 1E7VA 1Q0WB 4K7SA 3OAWA 3UGBB 5LXIB 4PS7A 3PVLA 3PS6A 2JY6A 2KTRB 2M1MA 3UQAA 2MBBB 4HWIB 4W9KA 2MBHA 4LJPB 2KTRA 3KW5B 4ASWC 2V3SA 3UQBA 3OJ3A 1WJNA 1V6EA 4ZRJA 3ECIA 3A9KB 4WJOA 2DYMA 1OGWA 2KO3A 1UBIA 3TBLD 3A9KA 5E6OA 1WJ4A 2XBBC 5CHWA 3WANA 2Z0DB 3PGEA 2KWVB 3ZTDA 3ZTCA 1JRUA 5JH5C 2MA9B 1P0RA 2MQJA 4KSKC 4DHJD 2DX5B 3DPDA 2JZZA 2C5LC 2KQ7A 4ZRIA 4ZYNA 4W9LA 2KFKB 4NJ7A 2C9WB 1J0GA 3QARA 2CHWA 3KUDB 2KDIA 1WX8A 2LJ5A 4BOSC 2KVRA 2MW5A 4II3B 2L0TA 4RMAA 3OLMD 4ANVA 4EZLA 3JVZX 4ZDVA 1WM2A 4M8NA 3ALBA 2HE7A 3H7PB 1KM7A 3H7PA 4MSQB 1OEYJ 2N9PC 2FCQA 2IBIB 2PJHA 1EF5A 4ZRKA 3D32A 4BKGA 1OTRB 4GDLA 3A4RA 4JGHB 3DVGY 1WR6E 3KVFB 1WJUA 2R2OA 3ZO5B 5D6JB 2ASQA 3NY5A 2M4NA 4CHKA 4DBGA 3ZW3A 5JHBA 3A4SC 1E90A 3PRPB 3ZVVA 2AEHA 1GC7A 2AL3A 2KANA 3CSTA 2MBEA 2KZRA 2Z0EB 2KJRA 2J7QB 5LXHA 1E7UA 4FLHA 1D3ZA 3T8MA 3VUYA 3V60A 5DPSA 2DHZA 4KDIC 3QAQA 2K39A 2HD5B 2N7EA 3BY4B 3JYUA 4MH0E 4BKSA 2M17A 2L3ZA 3QJZA 2BWES 2JWZA 2KTFA 3A33B 4GDKB 4FHJA 4AUQC 4FJZA 3ZLZA 4XZ4A 1NDDA 2REXA 4GDKA 5G2NA 4AJWA 1GUAB 1WE6A 3KH0A 2ZCCA 2NR2A 4BOZB 2FIDA 1Z5SB 4FULA 3SDLC 5L83A 3IHPC 3VXWA 2XEWA 2GMIC 2ZNVB 1OEYA 3NZSA 3PLVA 4E3CA 5BO4B 3W1YA 2ZCBA 4TKNA 2LXAA 4GB9A 1P98A 2MRPA 2HTHA 3W1SC 2V4LA 1SE9A 1BT0A 2IY0B 2RR9A 3O65B 1WMHA 3EHVA 4W9CA 3WIMA 2BYFA 2WX1A 4I6NB 1UBQA 3ZNZB 2N9EB 2NPTB 4RM8A 2LVQA 4W9GA 3PRMB 4JQWC 5CTRC 2NPTA 2OOBB 5AZHA 1Z2MA 1M94A 5AZGA 3M63B 4IWPA 3RCZA 4A20A 2BPSA 2KWUB 2K8CA 2XK5A 4EOYA 1GG3A 3SU8X 2C7MB 4EZKA 3EFUA 3N30A 4BKSD 4OVVA 4F7ZA 3IBEA 3QWZB 1V86A 2FCNA 1XD3B 2NS5A 3LJ3A 4JLCA 2LGDA 2JF5A 4E74A 3APDA 1R4NI 5LLIA 3P2BA 4WJPA 2D10A 3U7DA 3AI5A 2L7RA 2BKRB 2NBVB 4G0NB 2WYQA 4GOCA 2AWTA 2KNBA 3QC8B 2PEAA 3HHMA 1R4MI 4BVUC 1P3QU 3DVNU 4FJYA 4BKTA 4FHKA 3I3TB 2KXJA 5JHAA 3GOEA 2KK8A 5TR5A 4F1SA 3PRZA 3DVNV 3CF6E 4EUTA 2RSUA 2N1VA 4GIVA 4KVGB 3T9LA 4LJOB 2MLBA 3AULA 2JRIB 2R2QA 4MM3A 3SHQA 3KYDD 4EEWA 2JZ3B 1WXVA 2A4ZA 4XX5A 4HPMB 2G4DB 5C1ZA 1YD8U 2OJRA 2ZJDA 2DYBA 2CKHB 2A5UA 3KYCD 5C23A 3SD5A 1YIWA 2PE6B 1I35A 2MBQA 2BKFA 3M3JA 3Q3JA 3RZWC 3VTWA 3BINA 4W9JA 3UINB 2RGFA 1GNUA 3QQ8B 2N4FA 4HDOA 2AYOB 1WXAA 3C0RB 2GBRA 2KFKA 3MTNB 1WGGA 1YX5B 4KIKB 1S1QB 1S3SG 3N32A 3A9JB 2KX3A 4HK2A 2M8SA 3A9JA 3L17A 4W9IA 4MGIE 3PLUA 1I42A 5D94A 1H8CA 5AEKB 3VHTC 1P9DU 4AWJA 2UYZB 1UGMA 1IYFA 1ZKHA 4W9HA 1Q1OA 2ZNVC 4WWPA 3TMPB 2NCNA 4FA6A 2M0XA 2PPHA 2KKCA 2KJHB 2N1WA 1EUVB 2DAFA 4WAAA 3X23A 2KWCA 4B95A 2EMSA 1LM8B 1WXSA 4HJKA 2PE9A 4JL9A 5KHOA 3UF8A 4I6PA 1F9JA 1V80A 1WE7A 4G11A 4A3PA 4IWQA 1J19A 2K25A 2WDTB 2Z59B 3VDZA 2O2VB 2CHZA 2WX0A 3EC8A 3DBRI 3WAPA 1GC6A 4E71A 3DVGX 3QHTA 3U8ZA 4IUMB 2C7HA 1L7YA 2NVUI 2LGXA 1VD2A 1WXMA 2MBOA 3L0WB 3N3KB 1KOTA 2IY1B 1E8WA 3B0AA 2EKEC 2ZPNA 3PSEB 4IG7B 1VCBA 2LXCA 1WFYA 1PQSA 2IO1B 5CHFA 4LDTB 1RAXA 4WJNA 4OVUA 2J0KA 4DHZE 3TIXA 4DK5A 3NHEB 3VFKA 5J18A 4MJSB 1V81A 4MGKE 1TTNA 2L76A 4M8MA 4RM9A 4MJSA 3VAWA 4MGZE 3RT3B 2CHXA 2FAZA 2GBMA 1E8YA 2K8BA 3IFWB 4TQ1A 1ISNA 1UD7A 3V6CB 1L2NA 4NPNA 3ZRFA 4HVBA 3VUWA 2FNJB 1E8XA 2D11A 3PTFC 3VVWB 4X57B 2L05A 2UWQA 4LCDE 3KUZA 4PYUA 3WAOA 3B08A 5G55A 2NBWB 3CMMB 4IW0A 3KUCB 5DCNA 3R7QA 3K9PB 1WIAA 3GZNI 4IC7B 3ZRCA 4DWFA 2GBNA 1TGZB 4MEMA 1XT9B 2JXXA 2JT4B 3NOBA 4WJQA 3ZKJC 4NAWB 5FR6A 2IZVB 4NQLB 2CR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ1 A;  2L0F A;  2C7N B;  3L13 A;  2WWZ A;  3PPA A;  4M0W B;  3VH3 B;  3AU4 A;  2MP2 B;  2DZJ A;  3H9D A;  5E6N A;  2MP2 A;  2L8J A;  4F8C B;  1Q5W B;  4A3O A;  1V2Y A;  1MG8 A;  2G4S A;  2GBK A;  4GU2 A;  4AOF A;  4MSM B;  3ML8 A;  3TCA A;  1EF1 A;  4TQ0 A;  1XQQ A;  1YQB A;  2LWP A;  3ZDM C;  2KDE B;  2LRU A;  4W9E A;  2FCS A;  3ZNG C;  3R3M A;  5HKH A;  4W9F A;  3U30 A;  4LDT D;  2KMA A;  4MGY E;  5KHQ A;  1WZ0 A;  3AXC A;  2HJ8 A;  1IP9 A;  2CU1 A;  4EFO A;  2W9N A;  5IA7 A;  1UEL A;  1WGR A;  3L08 A;  3TJP A;  2K8H A;  1WX7 A;  1SGH A;  4DXA B;  1WGH A;  2KOX A;  4G50 A;  1ZW7 A;  1Y8R C;  3ZNH B;  4I6L B;  4P7I A;  3PRE A;  3DCG A;  3EEC A;  1WR1 A;  3IVF A;  3PV1 A;  3ZNI D;  2KC2 A;  2KJ6 A;  2KD0 A;  1WH3 A;  3K9O B;  4HPL B;  3WAM A;  3VQI A;  4KDL B;  4NJ6 A;  3LDZ E;  4PYZ A;  4J6I A;  2JVC A;  3R7R A;  4DHZ B;  4K7W A;  5DPT A;  4ICV A;  1YX6 B;  4B9K A;  3DBL I;  3V61 A;  2KMC A;  3ML9 A;  1EO6 A;  4TV3 A;  2K6D B;  2DZM A;  2D07 B;  1WYW B;  2D3G A;  2ZVO A;  5CHV C;  3H6N A;  1WF9 A;  4XC2 A;  4KIK A;  1IPG A;  2KLG A;  4MDK E;  4CYE A;  2IO0 B;  5EDS A;  2DZK A;  3JSV B;  2RD0 A;  4ANW A;  2IO3 B;  2K6Q A;  2KC1 A;  1FXT B;  3PZD A;  4NY0 A;  3JSV A;  4W9D A;  3X0W A;  1WX9 A;  4IWO A;  2MSE D;  1WRD B;  2FCM A;  4G3X B;  4HCN B;  2FIF A;  2GOW A;  5D2M B;  5E6P A;  4DDI D;  2B3A A;  4TUU A;  5L95 C;  1C3T A;  2MX2 A;  3QIJ A;  2LAS A;  3ZDT A;  1UH6 A;  3HM6 X;  4AJY B;  2I1J A;  2KQS A;  3H1U A;  3JW0 X;  3RUL A;  4ANU A;  4HCP B;  1KLV A;  4IM3 A;  2DAJ A;  1OQY A;  2QHO A;  2V1Y A;  1V49 A;  2DYO A;  4URK A;  1SIF A;  2ZZP B;  4BFR A;  2KHW B;  2C60 A;  1C1Y B;  4FN2 A;  1RLF A;  2VRR B;  2O2V A;  5AZF A;  4II2 B;  4FJV B;  1TZ1 A;  2K1F A;  4WWO A;  2LD9 A;  3QK0 A;  5GMV A;  3HIZ A;  2D2Q A;  4GSW A;  4GDL B;  3ONS A;  4KV2 A;  1X1M A;  2RPQ A;  3DBH I;  4GGQ A;  4IM2 A;  2KLC A;  4DDG D;  2YLM A;  4ANX A;  3ZIM A;  2YVC A;  4YL8 A;  2FUH B;  2N9X A;  4KSL C;  1E8Z A;  3PHW B;  4HXD A;  1WGY A;  1U4A A;  4KZ0 A;  2LVO A;  4WWN A;  1T0Y A;  1HE8 A;  2BYV E;  1WGD A;  4K7U A;  2Y5B B;  2DZI A;  3PT2 B;  3CSF A;  5DPW A;  2BYE A;  2JUO A;  2KFJ A;  5J17 A;  3OJ4 B;  2ZEQ A;  3DOW A;  4EZJ A;  5DPR A;  4FAD A;  5J2R A;  3QX1 A;  4GXB A;  2G45 B;  3ENE A;  3VTV A;  3RYT A;  1QZE A;  4NNJ B;  3HK0 A;  1H4R A;  2L00 B;  4GMV A;  2DEN B;  5IAA C;  3S2A A;  2BGF A;  2O6V B;  4AP4 C;  3H7S A;  2CS4 A;  2LRW A;  2O6V A;  4K81 A;  4PS3 A;  3VUX A;  1AAR A;  3RZF A;  3V62 A;  2J0M A;  3A1Q B;  1WY8 A;  4B6W A;  3M95 A;  3A1Q A;  3Q3F A;  4NAW A;  3RD2 A;  1NBF C;  1RRB A;  1TBE A;  1J8C A;  4ICU A;  4MEL A;  4BBN F;  4FBJ B;  2LUE A;  3MHS D;  3QCA A;  2BWF A;  2MCN B;  1WM3 A;  4N9F 4;  1LQB A;  2NBU A;  1WZ3 A;  4NQK E;  5D7G A;  4JIO U;  3VTU A;  3ZUN A;  2LI5 A;  1V9J A;  2KDF B;  2MWS B;  4GN1 A;  1WMH B;  1ZGU B;  4HLE A;  1LFD A;  2KN5 A;  2LGY A;  3NZU A;  1LXD A;  2BF8 B;  3NS8 A;  1UZX B;  3V6E B;  4BBN C;  2IO2 B;  1KJT A;  3HM3 A;  1WI0 A;  2KX0 A;  3UIO B;  4DHJ B;  2JRH A;  3MJW A;  1P1A A;  1CMX B;  3L10 B;  4IM0 A;  4EKU A;  1NI2 A;  3R66 C;  4HDQ A;  1E5W A;  3RUI B;  2I1K A;  3B1L X;  3L16 A;  2LVP A;  3TL5 A;  3L54 A;  4CO7 A;  1WJ6 A;  3PHX B;  2XK5 B;  5CX3 A;  5JZE B;  3WA0 A;  3APF A;  2KDB A;  2N7D A;  3DBS A;  1A5R A;  2ZPY A;  1G6J A;  3VH4 B;  1K8R B;  2GBJ A;  3DDC B;  2JPH A;  3DQV A;  4KZC A;  3IG3 A;  2J0J A;  2EMT A;  3M62 B;  3QA8 A;  1RFA A;  2IYD B;  4WQO B;  1GJZ A;  2G3Q B;  3APC A;  1V5T A;  2O6V D;  3UIP B;  2AL6 A;  2LZ6 A;  2ZVN A;  4PS8 A;  3AU5 A;  3WAL A;  1V5O A;  4K1R B;  3W1S A;  1E7V A;  1Q0W B;  4K7S A;  3OAW A;  3UGB B;  5LXI B;  4PS7 A;  3PVL A;  3PS6 A;  2JY6 A;  2KTR B;  2M1M A;  3UQA A;  2MBB B;  4HWI B;  4W9K A;  2MBH A;  4LJP B;  2KTR A;  3KW5 B;  4ASW C;  2V3S A;  3UQB A;  3OJ3 A;  1WJN A;  1V6E A;  4ZRJ A;  3ECI A;  3A9K B;  4WJO A;  2DYM A;  1OGW A;  2KO3 A;  1UBI A;  3TBL D;  3A9K A;  5E6O A;  1WJ4 A;  2XBB C;  5CHW A;  3WAN A;  2Z0D B;  3PGE A;  2KWV B;  3ZTD A;  3ZTC A;  1JRU A;  5JH5 C;  2MA9 B;  1P0R A;  2MQJ A;  4KSK C;  4DHJ D;  2DX5 B;  3DPD A;  2JZZ A;  2C5L C;  2KQ7 A;  4ZRI A;  4ZYN A;  4W9L A;  2KFK B;  4NJ7 A;  2C9W B;  1J0G A;  3QAR A;  2CHW A;  3KUD B;  2KDI A;  1WX8 A;  2LJ5 A;  4BOS C;  2KVR A;  2MW5 A;  4II3 B;  2L0T A;  4RMA A;  3OLM D;  4ANV A;  4EZL A;  3JVZ X;  4ZDV A;  1WM2 A;  4M8N A;  3ALB A;  2HE7 A;  3H7P B;  1KM7 A;  3H7P A;  4MSQ B;  1OEY J;  2N9P C;  2FCQ A;  2IBI B;  2PJH A;  1EF5 A;  4ZRK A;  3D32 A;  4BKG A;  1OTR B;  4GDL A;  3A4R A;  4JGH B;  3DVG Y;  1WR6 E;  3KVF B;  1WJU A;  2R2O A;  3ZO5 B;  5D6J B;  2ASQ A;  3NY5 A;  2M4N A;  4CHK A;  4DBG A;  3ZW3 A;  5JHB A;  3A4S C;  1E90 A;  3PRP B;  3ZVV A;  2AEH A;  1GC7 A;  2AL3 A;  2KAN A;  3CST A;  2MBE A;  2KZR A;  2Z0E B;  2KJR A;  2J7Q B;  5LXH A;  1E7U A;  4FLH A;  1D3Z A;  3T8M A;  3VUY A;  3V60 A;  5DPS A;  2DHZ A;  4KDI C;  3QAQ A;  2K39 A;  2HD5 B;  2N7E A;  3BY4 B;  3JYU A;  4MH0 E;  4BKS A;  2M17 A;  2L3Z A;  3QJZ A;  2BWE S;  2JWZ A;  2KTF A;  3A33 B;  4GDK B;  4FHJ A;  4AUQ C;  4FJZ A;  3ZLZ A;  4XZ4 A;  1NDD A;  2REX A;  4GDK A;  5G2N A;  4AJW A;  1GUA B;  1WE6 A;  3KH0 A;  2ZCC A;  2NR2 A;  4BOZ B;  2FID A;  1Z5S B;  4FUL A;  3SDL C;  5L83 A;  3IHP C;  3VXW A;  2XEW A;  2GMI C;  2ZNV B;  1OEY A;  3NZS A;  3PLV A;  4E3C A;  5BO4 B;  3W1Y A;  2ZCB A;  4TKN A;  2LXA A;  4GB9 A;  1P98 A;  2MRP A;  2HTH A;  3W1S C;  2V4L A;  1SE9 A;  1BT0 A;  2IY0 B;  2RR9 A;  3O65 B;  1WMH A;  3EHV A;  4W9C A;  3WIM A;  2BYF A;  2WX1 A;  4I6N B;  1UBQ A;  3ZNZ B;  2N9E B;  2NPT B;  4RM8 A;  2LVQ A;  4W9G A;  3PRM B;  4JQW C;  5CTR C;  2NPT A;  2OOB B;  5AZH A;  1Z2M A;  1M94 A;  5AZG A;  3M63 B;  4IWP A;  3RCZ A;  4A20 A;  2BPS A;  2KWU B;  2K8C A;  2XK5 A;  4EOY A;  1GG3 A;  3SU8 X;  2C7M B;  4EZK A;  3EFU A;  3N30 A;  4BKS D;  4OVV A;  4F7Z A;  3IBE A;  3QWZ B;  1V86 A;  2FCN A;  1XD3 B;  2NS5 A;  3LJ3 A;  4JLC A;  2LGD A;  2JF5 A;  4E74 A;  3APD A;  1R4N I;  5LLI A;  3P2B A;  4WJP A;  2D10 A;  3U7D A;  3AI5 A;  2L7R A;  2BKR B;  2NBV B;  4G0N B;  2WYQ A;  4GOC A;  2AWT A;  2KNB A;  3QC8 B;  2PEA A;  3HHM A;  1R4M I;  4BVU C;  1P3Q U;  3DVN U;  4FJY A;  4BKT A;  4FHK A;  3I3T B;  2KXJ A;  5JHA A;  3GOE A;  2KK8 A;  5TR5 A;  4F1S A;  3PRZ A;  3DVN V;  3CF6 E;  4EUT A;  2RSU A;  2N1V A;  4GIV A;  4KVG B;  3T9L A;  4LJO B;  2MLB A;  3AUL A;  2JRI B;  2R2Q A;  4MM3 A;  3SHQ A;  3KYD D;  4EEW A;  2JZ3 B;  1WXV A;  2A4Z A;  4XX5 A;  4HPM B;  2G4D B;  5C1Z A;  1YD8 U;  2OJR A;  2ZJD A;  2DYB A;  2CKH B;  2A5U A;  3KYC D;  5C23 A;  3SD5 A;  1YIW A;  2PE6 B;  1I35 A;  2MBQ A;  2BKF A;  3M3J A;  3Q3J A;  3RZW C;  3VTW A;  3BIN A;  4W9J A;  3UIN B;  2RGF A;  1GNU A;  3QQ8 B;  2N4F A;  4HDO A;  2AYO B;  1WXA A;  3C0R B;  2GBR A;  2KFK A;  3MTN B;  1WGG A;  1YX5 B;  4KIK B;  1S1Q B;  1S3S G;  3N32 A;  3A9J B;  2KX3 A;  4HK2 A;  2M8S A;  3A9J A;  3L17 A;  4W9I A;  4MGI E;  3PLU A;  1I42 A;  5D94 A;  1H8C A;  5AEK B;  3VHT C;  1P9D U;  4AWJ A;  2UYZ B;  1UGM A;  1IYF A;  1ZKH A;  4W9H A;  1Q1O A;  2ZNV C;  4WWP A;  3TMP B;  2NCN A;  4FA6 A;  2M0X A;  2PPH A;  2KKC A;  2KJH B;  2N1W A;  1EUV B;  2DAF A;  4WAA A;  3X23 A;  2KWC A;  4B95 A;  2EMS A;  1LM8 B;  1WXS A;  4HJK A;  2PE9 A;  4JL9 A;  5KHO A;  3UF8 A;  4I6P A;  1F9J A;  1V80 A;  1WE7 A;  4G11 A;  4A3P A;  4IWQ A;  1J19 A;  2K25 A;  2WDT B;  2Z59 B;  3VDZ A;  2O2V B;  2CHZ A;  2WX0 A;  3EC8 A;  3DBR I;  3WAP A;  1GC6 A;  4E71 A;  3DVG X;  3QHT A;  3U8Z A;  4IUM B;  2C7H A;  1L7Y A;  2NVU I;  2LGX A;  1VD2 A;  1WXM A;  2MBO A;  3L0W B;  3N3K B;  1KOT A;  2IY1 B;  1E8W A;  3B0A A;  2EKE C;  2ZPN A;  3PSE B;  4IG7 B;  1VCB A;  2LXC A;  1WFY A;  1PQS A;  2IO1 B;  5CHF A;  4LDT B;  1RAX A;  4WJN A;  4OVU A;  2J0K A;  4DHZ E;  3TIX A;  4DK5 A;  3NHE B;  3VFK A;  5J18 A;  4MJS B;  1V81 A;  4MGK E;  1TTN A;  2L76 A;  4M8M A;  4RM9 A;  4MJS A;  3VAW A;  4MGZ E;  3RT3 B;  2CHX A;  2FAZ A;  2GBM A;  1E8Y A;  2K8B A;  3IFW B;  4TQ1 A;  1ISN A;  1UD7 A;  3V6C B;  1L2N A;  4NPN A;  3ZRF A;  4HVB A;  3VUW A;  2FNJ B;  1E8X A;  2D11 A;  3PTF C;  3VVW B;  4X57 B;  2L05 A;  2UWQ A;  4LCD E;  3KUZ A;  4PYU A;  3WAO A;  3B08 A;  5G55 A;  2NBW B;  3CMM B;  4IW0 A;  3KUC B;  5DCN A;  3R7Q A;  3K9P B;  1WIA A;  3GZN I;  4IC7 B;  3ZRC A;  4DWF A;  2GBN A;  1TGZ B;  4MEM A;  1XT9 B;  2JXX A;  2JT4 B;  3NOB A;  4WJQ A;  3ZKJ C;  4NAW B;  5FR6 A;  2IZV B;  4NQL B;  2CR5 A; 
#chains in the Genus database with same CATH topology
 1PUT A;  3VH3 B;  2KMM A;  3AU4 A;  5C3J B;  3J9C A;  2WXI A;  2M56 B;  2KVZ A;  3B2G A;  4F8C B;  1Q5W B;  4A3O A;  1E9M A;  2LUM A;  4MSM B;  1EF1 A;  3ZDM C;  2V0G A;  4W9F A;  3AXC A;  1IBX B;  2TSS A;  1FMA D;  1IBX A;  2YEP F;  1C77 A;  2W9N A;  4D2K A;  3TJP A;  2K8H A;  1JWM D;  4IDI A;  2INN E;  4RGN A;  3VRB B;  1EM7 A;  4P7I A;  2WXG A;  1KF6 B;  3EEC A;  1WR1 A;  5HHD G;  1XCQ L;  2KD0 A;  2RDH A;  1YQ4 B;  1WH3 A;  3WAM A;  2WS3 B;  4NJ6 A;  4Q2J A;  4J6I A;  3R7R A;  4K7W A;  4B9K A;  1M4V A;  3IXS A;  1YN3 A;  2KMC A;  3CIR B;  1TS3 A;  2WDR B;  2WHI A;  4ANW A;  3JSV B;  1FXT B;  3JSV A;  1WX9 A;  4IWO A;  1VZ6 A;  2MSE D;  1UF0 A;  2FIF A;  2B3A A;  4A8X C;  1KH0 A;  2YEP B;  1E6E B;  4FXC A;  2LAS A;  1TS5 A;  3SEB A;  3JW0 X;  4ANU A;  4HCP B;  4HPP A;  2IND C;  1MPE A;  2QHO A;  1V49 A;  1SIF A;  4KGS A;  4UDU C;  2C60 A;  4FN2 A;  1WXQ A;  1DYQ A;  3AE6 B;  1E7P B;  1GAQ B;  5GMV A;  2D2Q A;  2VH1 A;  3E9S A;  2MH7 A;  2NTS A;  4GDL B;  4KV2 A;  1X1M A;  2RPQ A;  4GGQ A;  3ZIM A;  2VH2 A;  2N9X A;  2ICI A;  3P63 A;  1U4A A;  2LVO A;  4ZOH C;  1HE8 A;  1WGD A;  5JXV A;  1N63 A;  2KFJ A;  3Q14 C;  2KYW A;  4YT0 B;  4EZJ A;  5J2R A;  1V97 A;  4NNJ B;  1H4R A;  4GMV A;  2DEN B;  2BGF A;  4PS3 A;  3Q2A C;  3A1Q B;  4C4V B;  3A1Q A;  4JWU C;  3RD2 A;  4C4V A;  1ZXH A;  4ICU A;  4MEL A;  4FBJ B;  2LUE A;  3MHS D;  3QCA A;  5D3D A;  5IOI A;  3FC4 A;  1WZ3 A;  4NQK E;  5D7G A;  2GB1 A;  4JIO U;  3ZUN A;  1WMH B;  4HLE A;  3NZU A;  2BF8 B;  1PGB A;  4BBN C;  2WU2 B;  5IKC M;  5LXI B;  3MJW A;  4IM0 A;  1CMX B;  3R66 C;  4XE0 A;  1D4B A;  2RDB C;  3Q3N C;  3WA0 A;  1N61 A;  2N9L A;  2N7D A;  3DBS A;  4P1B C;  2ZPY A;  2GBJ A;  3DDC B;  3AE5 B;  3DQV A;  3U4E G;  4MT5 A;  2J0J A;  2EMT A;  1J7C A;  1RFA A;  1AW7 A;  5GXG B;  2JYE A;  2O6V D;  1YOV B;  2ZVN A;  4PS8 A;  5TSS A;  3TEY A;  2BS3 B;  1SE4 A;  3W1S A;  2KT7 A;  4OHJ A;  2DLB A;  1I4P A;  3UQA A;  5D3I B;  4CQN A;  2JZP A;  4JE3 B;  1OQR A;  3Q3O C;  2ACZ B;  2V3N A;  3PGE A;  4MH8 A;  3RFZ B;  2DX5 B;  2QEJ C;  2W55 A;  1TS2 A;  4REZ A;  2QCZ A;  3RNG C;  1WX8 A;  2MW5 A;  2L0T A;  3OLM D;  4EZL A;  2R61 A;  3JVZ X;  4ZDV A;  1WM2 A;  4M8N A;  3ALB A;  2I38 A;  1N60 A;  2N9P C;  3AED B;  2FCQ A;  2PJH A;  4LNF A;  4YTM B;  1FM0 D;  2J53 A;  1K50 A;  3MJ5 A;  3A4R A;  4JGH B;  1EWC A;  2FBW B;  3KVF B;  2ASQ A;  4CHK A;  1DOI A;  2DWQ A;  2VZK D;  5EE3 A;  3PRP B;  2AEH A;  2AL3 A;  1D5Z C;  3E56 A;  4AS1 A;  3U52 E;  2KZR A;  1C4P A;  2Z0E B;  2KJR A;  4HKQ A;  2INC C;  1F77 A;  3V60 A;  4KDI C;  3ABV B;  1JRP A;  2N7E A;  1TYG B;  2WXK A;  3JYU A;  4BKS A;  2L3Z A;  2BWE S;  4XZ4 A;  1NDD A;  2REX A;  2RPV A;  3KWV A;  3KH0 A;  2B76 B;  3IAM 1;  3Q8B A;  3DWM A;  2FUG 1;  2GMI C;  4E3C A;  1MVK A;  1P98 A;  5IO9 A;  2V4L A;  1TJE A;  2MEK A;  2RR9 A;  4M00 A;  3EHV A;  3GS2 A;  4LNO A;  2OED A;  2BYF A;  4RFB A;  1UBQ A;  1M94 A;  4IWP A;  1SJE D;  1DOY A;  3MHZ A;  2D3A A;  2XK5 A;  3EFU A;  2WNM A;  4F7Z A;  4BAX A;  3Q8E A;  4JPS A;  2LEK A;  5LLI A;  4WJP A;  1UWM A;  3BK1 A;  2WXH A;  3BYT B;  2NBV B;  2PEA A;  1BUI C;  1P3Q U;  4FJY A;  4BKT A;  5JHA A;  2KXJ A;  5TR5 A;  2BB5 A;  3DBR B;  4A90 A;  1TKY A;  2N1V A;  4GIV A;  1AWD A;  2R2Q A;  3KYD D;  2A4Z A;  2AQ1 B;  4HPM B;  4OVZ A;  2G4D B;  1SBB B;  1YD8 U;  2OJR A;  1I4G A;  2CJO A;  1YIW A;  4ACF A;  3M3J A;  4HRS A;  2IGG A;  3UIN B;  2Z8L A;  2N4F A;  4XDD A;  1WXA A;  3C0R B;  1WGG A;  1ZPS A;  4KIK B;  3DHG C;  4W9I A;  3P4R B;  2H89 B;  5BMH A;  2G9H D;  1SE2 A;  2MJE A;  1UGM A;  2ZNV C;  2DAF A;  2LGS A;  2RMM A;  4WAA A;  2EMS A;  4JL9 A;  1NEK B;  4G11 A;  1NYQ A;  2WDT B;  2O2V B;  2CHZ A;  3DVG X;  3QHT A;  1AYF A;  2MBO A;  1RYJ A;  3L0W B;  1V8C A;  1KOT A;  1E8W A;  3Q8C A;  1EWY C;  2WGS A;  2D5G A;  1WFY A;  1PQS A;  5CHF A;  1QQR A;  4WQM A;  1C79 A;  3W5U B;  2XNA C;  2JQR B;  4MJS B;  1V81 A;  1VRA B;  4MJS A;  2CHX A;  2FAZ A;  1L5P A;  2W54 A;  1OFF A;  3V6C B;  1L2N A;  3VUW A;  2FNJ B;  1E8X A;  2D11 A;  4USA A;  2UWQ A;  4LCD E;  3B08 A;  3N1Y C;  3B9J A;  5DCN A;  3BK2 A;  5FK9 C;  3GZN I;  1JRO A;  3ZRC A;  2GBN A;  4WJQ A;  3NOB A;  1PYW D;  3AE2 B;  2IZV B;  2CR5 A;  1N5X A;  1C4C A;  4L1B A;  2C7N B;  3PPA A;  4M0W B;  3H9D A;  2SAK A;  5E6N A;  4M0W A;  4RF1 A;  3IAS 1;  1MG8 A;  2GBK A;  2LWP A;  3ZNG C;  2KDE B;  4W9E A;  3U30 A;  3P4S B;  5KHQ A;  2KMA A;  1WZ0 A;  3NVY A;  4C7Y A;  5IA7 A;  1UEL A;  1WGR A;  2JSV X;  4G50 A;  4EE2 A;  4L2Y A;  1Y8R C;  3ZNH B;  4I6L B;  4P6V F;  3IVF A;  4RCO A;  2KC2 A;  3BZD B;  4MAC A;  3VQI A;  2RDG A;  3LDZ E;  4PYZ A;  2K22 A;  4DHZ B;  3DBL I;  2QDF A;  2K6D B;  1WYW B;  4XGA B;  2QC8 A;  1C4A A;  2E6X A;  2PVO D;  2BTE A;  1IPG A;  2KLG A;  2KC1 A;  3PZD A;  3DHI C;  3X0W A;  1WRD B;  4DDI D;  5E6P A;  4HRO A;  3QIJ A;  1UH6 A;  3HM6 X;  2I1J A;  3HUI A;  1KLV A;  2V1Y A;  1HTQ A;  3AN1 A;  2KHW B;  1JWA D;  1JML A;  1RLF A;  1PFD A;  1Y56 A;  4II2 B;  2K1F A;  5EE0 A;  4ITK A;  4NJC A;  1ZDX A;  4DDG D;  2YLM A;  4ANX A;  1MFW A;  2YVC A;  1FNV A;  2FUH B;  4WWM A;  1E8Z A;  2MJ3 A;  1YN5 A;  5BYR A;  4KZ0 A;  1F2R C;  2BYV E;  3ZYY X;  1MJD A;  3CSF A;  5DPW A;  2QSD A;  1F1H A;  2KN4 A;  1I7H A;  2K3U A;  2IGH A;  2G45 B;  3ENE A;  3VTV A;  3GE8 C;  5IAA C;  2O6V B;  2I2Y A;  3H7S A;  2LRW A;  2O6V A;  1XEE A;  3RNE C;  3EFC A;  1AAR A;  3V62 A;  2J0M A;  1WY8 A;  2PW9 A;  2ON8 A;  3M95 A;  2JYT A;  3Q8A A;  4US8 A;  1JWS D;  4NAW A;  4A9A A;  1NBF C;  3EGR A;  3I63 C;  1YNT E;  2KDF B;  2IDY A;  1LFD A;  2LFI A;  3HM3 A;  3UIO B;  4EKU A;  2JRH A;  4C7Z A;  3L10 B;  2QIE B;  1VZ7 A;  2I1K A;  1T0S C;  1QOA A;  2LVP A;  3TL5 A;  4CO7 A;  1WJ6 A;  3PHX B;  2HTM E;  5JZE B;  3AE8 B;  3APF A;  1G6J A;  1NEN B;  1HQR D;  1K8R B;  3W5V B;  4KZC A;  3IG3 A;  2MHJ A;  3QA8 A;  3LB8 C;  2JWU A;  3W9C B;  3WAL A;  4LK0 M;  1V5O A;  1QIL A;  4K7S A;  1EU3 A;  4PS7 A;  2WXN A;  2KTR B;  2M1M A;  2VZK B;  1PGA A;  4HWI B;  4LJP B;  2KTR A;  3UQB A;  1WJN A;  1V6E A;  2DYM A;  1JW9 D;  1UBI A;  1ENF A;  2BT6 A;  2WLB A;  3TBL D;  5CHW A;  3WAN A;  1LGR A;  3ZTC A;  1JRU A;  3R2T A;  5JH5 C;  1HZ6 A;  1P0R A;  1RM6 C;  4DHJ D;  4XYC A;  3DPD A;  2JZZ A;  2X38 A;  4M01 A;  4US9 A;  4W9L A;  4NJ7 A;  1J0G A;  3DWG C;  2LJ5 A;  5MPO A;  3Q3M C;  2IJ0 A;  3N20 C;  1CZP A;  2OJW A;  1E10 A;  1ZOY B;  3H7P B;  1KM7 A;  1C76 A;  3H7P A;  4MSQ B;  3KQ4 A;  1OEY J;  4S17 A;  4ZRK A;  1EF5 A;  1V1P B;  3D32 A;  4KKJ A;  4N58 A;  1V1P A;  3TEW A;  2DBY A;  4GDL A;  1WJU A;  2R2O A;  5D6J B;  4DBG A;  2M4N A;  3ZGZ A;  4JWS C;  3ZVV A;  2NTT A;  1GC7 A;  2EEL A;  2DNF A;  1E7U A;  4FLH A;  1TKG A;  3P1M A;  2K39 A;  2HD5 B;  5HFY A;  2M17 A;  3QJZ A;  2JWZ A;  3A33 B;  4GDK B;  4FHJ A;  4FJZ A;  5EE9 A;  3ZLZ A;  1WSP A;  4GDK A;  5G2N A;  4C80 A;  3OWE B;  2V4I B;  2ZCC A;  4YWG G;  1SJH D;  4BOZ B;  2LMC A;  1Z5S B;  4B0E A;  5L83 A;  1HEZ E;  2CJN A;  3R2I A;  3NVZ A;  3AM9 A;  3MC8 A;  3PLV A;  4N6E B;  1OEY A;  3GE3 C;  3W1Y A;  5G5H A;  5T8I A;  5E6J A;  1K52 A;  3AE9 B;  3C8Y A;  1BT0 A;  4YTP B;  1WMH A;  3NVV A;  1L6U A;  4RM8 A;  4W9G A;  4JQW C;  5AZH A;  5CTR C;  2OOB B;  5AZG A;  1FNU A;  4HJG E;  2WXL A;  2K8C A;  1TY2 A;  3W2D A;  4H2A A;  1V86 A;  1XF5 L;  2FCN A;  1ET6 A;  4E74 A;  3P2B A;  2D10 A;  3V05 A;  2WYQ A;  2Q5W D;  2KNB A;  4GOC A;  3I3T B;  4L23 A;  2BQQ A;  3CF6 E;  3MC0 B;  3T9L A;  3AUL A;  2JRI B;  2JZ3 B;  1ZDV A;  2ZW0 A;  3OG5 A;  5C1Z A;  1T0Q C;  2ZJD A;  2DYB A;  3KYC D;  3SD5 A;  1F0Z A;  1TIF A;  3VRA B;  1GNU A;  3QQ8 B;  3GP7 A;  1SXT A;  5H8Y E;  3MTN B;  1YX5 B;  1S3S G;  1ZP0 B;  4MGI E;  1I42 A;  5AEK B;  3MC9 A;  2UYZ B;  1IUE A;  1IYF A;  1ZKH A;  3I9V 1;  3PO0 A;  2M0A A;  3GZN B;  4FA6 A;  2PPH A;  2KJH B;  4M02 A;  2N1W A;  4B95 A;  2KWC A;  1LM8 B;  2PE9 A;  4A3P A;  3VDZ A;  4E71 A;  1MHH E;  1FXI A;  3AEA B;  4IUM B;  2LGX A;  2UU7 A;  1WXM A;  3B0A A;  3PSE B;  2ZPN A;  2IO1 B;  3ZJV A;  4OVU A;  1EU4 A;  3NHE B;  3VFK A;  5J18 A;  1TTN A;  4M8M A;  3TUO A;  3RT3 B;  2GBM A;  1E8Y A;  2WDV B;  1SF0 A;  4XDC A;  2K8B A;  1N62 A;  4TQ1 A;  1TY0 A;  1IGD A;  1ISN A;  2K5P A;  3TSS A;  1FO4 A;  3VVW B;  1F52 A;  2BVC A;  3TEX A;  5AUK A;  1I4H A;  1ACC A;  2K9X A;  1NI3 A;  1KLU D;  3CMM B;  1QLB B;  4IC7 B;  3DBL B;  4DWF A;  4MEM A;  2JXX A;  3S2A A;  4NAM A;  3L13 A;  2WWZ A;  1FFV A;  2DZJ A;  2QMT A;  1TT5 B;  2G4S A;  1LO5 D;  3ML8 A;  2L83 A;  4TQ0 A;  1XQQ A;  1YQB A;  2LRU A;  3R3M A;  5HKH A;  5IP4 D;  3AV8 A;  4LDT D;  1SE3 A;  2HJ8 A;  2CU1 A;  1IP9 A;  2X8X X;  4EFO A;  5IN7 A;  4PT5 A;  4YSY B;  1WX7 A;  1SGH A;  1ZE3 D;  3I57 A;  3PRE A;  3O13 A;  3PV1 A;  1GB4 A;  3ZXV A;  1VJK A;  3K9O B;  1FPY A;  4KDL B;  2W82 A;  2JVC A;  4P16 A;  1QOB A;  5DPT A;  4ICV A;  1YX6 B;  3V61 A;  3ML9 A;  1XLQ A;  1QF6 A;  4TV3 A;  2DZM A;  2D07 B;  2D3G A;  3AE4 B;  5CHV C;  4XC2 A;  4KIK A;  4CYE A;  3L4P A;  2DZK A;  5C2T B;  2CU3 A;  4W9D A;  2FCM A;  4OZA A;  4HCN B;  2GOW A;  4TUU A;  3H8H A;  3RMK C;  1FRD A;  2GLS A;  1ESF A;  1C3T A;  2BW2 A;  4AJY B;  2KQS A;  3H1U A;  1CJE A;  2KDM A;  4IM3 A;  3R8B A;  3EA6 A;  2DYO A;  2ZZP B;  5BYS A;  4DQO C;  1C1Y B;  2VRR B;  2O2V A;  3RNB C;  4FJV B;  1TZ1 A;  2M19 A;  4GSW A;  3ONS A;  1T3Q A;  4IM2 A;  2KLC A;  3N9Y C;  1B9R A;  3PHW B;  4HXD A;  4A55 A;  1WGY A;  1T0Y A;  4K7U A;  2Y5B B;  2DZI A;  3PT2 B;  1Q10 A;  3VR9 B;  5J17 A;  3OJ4 B;  2D3B A;  2ZEQ A;  3ZXR A;  3QX1 A;  4GXB A;  1R4N B;  2KAC A;  1FXA A;  1QZE A;  4DXF A;  3HK0 A;  4ARC A;  2L00 B;  1T5X D;  4AP4 C;  3SFD B;  2CS4 A;  1R4M B;  1JAL A;  3RZF A;  4B6W A;  2PMV A;  1TBE A;  1J7A A;  3P4Q B;  2BWF A;  1LQB A;  2NBU A;  2LI5 A;  1V9J A;  2PLP A;  2MWS B;  1QT9 A;  2G1E A;  4GN1 A;  1ZGU B;  2KN5 A;  2LGY A;  3NS8 A;  1UZX B;  2IO2 B;  3N1Z C;  4DHJ B;  1P1A A;  1NI2 A;  4HDQ A;  1E5W A;  1SIJ A;  5FKA C;  3L16 A;  3PZ7 A;  2KDB A;  2Y5P A;  4GLS C;  5LNK 1;  1A5R A;  3ZJT A;  3VH4 B;  2JPH A;  4LNK A;  3M62 B;  4KGT A;  4WQO B;  1GJZ A;  2G3Q B;  3UIP B;  2AL6 A;  1ROE A;  2Y5C A;  1E7V A;  1L0X B;  1Q0W B;  1FNW A;  4HKZ E;  3OAW A;  3UGB B;  4RNA A;  3AMZ A;  2JY6 A;  2MBB B;  4W9K A;  2MBH A;  3KW5 B;  4ASW C;  4XWT A;  4ZRJ A;  3ECI A;  1XLO A;  3A9K B;  1OGW A;  4HEA 1;  3A9K A;  1WJ4 A;  2XBB C;  2Z0D B;  3RNA C;  2MA9 B;  2C5L C;  2KQ7 A;  4ZRI A;  4ZYN A;  2HJ1 A;  1I4Q A;  2KFK B;  2WXM A;  2CHW A;  1L4Z B;  1IGC A;  4II3 B;  3BII D;  2J52 A;  2HE7 A;  4S0R A;  1WRI A;  3NS1 A;  1OTR B;  2WXO A;  2KQ4 X;  3NY5 A;  2JXT A;  3ZW3 A;  3A4S C;  3Q8F A;  1E90 A;  3Q6B A;  2KAN A;  2L52 A;  4JX1 C;  2MBE A;  3BVZ A;  2J7Q B;  3T8M A;  2DHZ A;  3FIL B;  4YTN B;  4MH0 E;  1GPX A;  3FIL A;  3BYY B;  4AJW A;  2OHF A;  4WH4 A;  4FUL A;  1BXT A;  3SDL C;  3IHP C;  3VXW A;  2XEW A;  2ZNV B;  2W3S A;  2ZCB A;  2PTL A;  2MRP A;  2HTH A;  3W1S C;  2HDE A;  1SE9 A;  3T3N A;  3WIM A;  2FE8 A;  4I6N B;  3ZNZ B;  2N9E B;  2NPT B;  2LVQ A;  3PRM B;  2NPT A;  2WQY B;  3M63 B;  5BYQ A;  2BPS A;  4WAF A;  2KWU B;  3PZ8 A;  4R3D A;  4EOY A;  1MG4 A;  1A70 A;  4OVV A;  3QWZ B;  1XD3 B;  2NS5 A;  3LJ3 A;  3RN9 C;  3BVG A;  4JLC A;  2JF5 A;  2V3P A;  1D5X C;  3APD A;  1R4N I;  3RPF C;  3U7D A;  3AI5 A;  2GRI A;  2BKR B;  2AWT A;  3QC8 B;  3HHM A;  4RH6 A;  1R4M I;  4FHK A;  4WUR A;  4F1S A;  2KK8 A;  4MM3 B;  2RSU A;  4KVG B;  3I5J C;  1BML C;  4MM3 A;  3SHQ A;  3HVZ A;  1WXV A;  2LGI A;  1DGJ A;  4J3O D;  2CKH B;  2A5U A;  1OQQ A;  2PE6 B;  3DBH B;  3N1X C;  2MBQ A;  1I35 A;  3RZW C;  3VTW A;  4W9J A;  2RGF A;  2GBR A;  2BYT A;  2QIL A;  2KX3 A;  2QJL A;  3L17 A;  2BB6 A;  2JX5 A;  3PLU A;  2EKI A;  4N59 A;  2WDQ B;  1P9D U;  1YMH E;  3T3O A;  1HZ5 A;  1JWB D;  4W9H A;  1Q1O A;  3AE3 B;  4WWP A;  1AN8 A;  1EUV B;  1I4X A;  1WXS A;  4HJK A;  3UF8 A;  2KWD A;  1WE7 A;  4IWQ A;  1FFU A;  2K25 A;  2NMQ A;  2Z59 B;  4YSZ B;  3WAP A;  3EC8 A;  3U8Z A;  1L7Y A;  1VD2 A;  3N3K B;  2IY1 B;  1WYG A;  3ETR A;  1VCB A;  1HTO A;  2LXC A;  4LDT B;  1SSN A;  4DHZ E;  3TIX A;  2JU6 X;  4NZL B;  4MGK E;  3AEC B;  4MGZ E;  2L32 A;  1UD7 A;  1PDX A;  1N5W A;  1ZXI A;  3P42 A;  4NPN A;  4HVB A;  3HRD D;  1K53 A;  3PTF C;  4X57 B;  2WXJ A;  3KUZ A;  3WAO A;  4K3B A;  2NBW B;  3R7Q A;  2ONQ A;  3K9P B;  1WIA A;  3U7Z A;  1KTK A;  3ZKJ C;  2JT4 B;  3OJ3 A;  4NQL B;  2AQ2 B;  1YJ1 A;  2L0F A;  4C56 C;  2MP2 B;  2MP2 A;  2L8J A;  1V2Y A;  3RNC C;  1NYR A;  4GU2 A;  4AOF A;  3TCA A;  2FCS A;  1YJI A;  4MGY E;  1CK1 A;  1N6Z A;  1FD6 A;  1DOX A;  2BBC A;  3L08 A;  4DXA B;  2IGD A;  1WGH A;  2KOX A;  1ZW7 A;  3NRZ A;  4OZC A;  4P1C C;  3DCG A;  2IPK D;  3ZNI D;  2KJ6 A;  4HPL B;  3EUB 2;  1I4R A;  1C78 A;  1CQV A;  3NZ3 A;  1EO6 A;  2J42 A;  2ZVO A;  3H6N A;  1T6B X;  1WF9 A;  3SFE B;  1UWX A;  1V1O A;  4MDK E;  2IO0 B;  3KLS X;  5EDS A;  2PIA A;  4QAY A;  3AEE B;  2RD0 A;  2IO3 B;  2K6Q A;  4NY0 A;  4G3X B;  5D2M B;  5L95 C;  2D3C A;  4LNI A;  4ZRP A;  1XLN A;  2N7J A;  2MX2 A;  3NUH B;  3ZDT A;  1QKZ A;  3RUL A;  5BMG A;  2DAJ A;  1OQY A;  4URK A;  4BFR A;  1C9F A;  4BZA A;  4ZYS A;  1L0V B;  4TMA B;  1QOG A;  1FEH A;  3CWI A;  5AZF A;  4WWO A;  2LD9 A;  3QK0 A;  1MHX A;  1GOZ A;  3HIZ A;  2WXR A;  3ZQ4 A;  1JCK B;  3AEF B;  3DBH I;  4LLG M;  3RI7 C;  1YJJ A;  4YL8 A;  4KSL C;  4XWW A;  1R7S A;  1UGJ A;  2J4X A;  4LNN A;  4WWN A;  3MP9 A;  4KKI A;  2BYE A;  2JUO A;  4RGM A;  2E3T A;  3DOW A;  5DPR A;  4FAD A;  1VZ8 A;  3RYT A;  3AH7 A;  3TEZ A;  3URY A;  4K81 A;  3VUX A;  3GB1 A;  4B0M A;  3Q3F A;  2LHD A;  1RRB A;  4YXD B;  1J8C A;  4BBN F;  2MCN B;  1WM3 A;  4N9F 4;  3VTU A;  1MI0 A;  1LXD A;  3V6E B;  3VR8 B;  1KJT A;  1WI0 A;  2KX0 A;  4DXG A;  3B2F A;  4YSX B;  3RUI B;  5HG2 A;  3NVW A;  3B1L X;  1PGX A;  3L54 A;  2XK5 B;  5CX3 A;  1B1Z A;  2KAJ A;  2K0P A;  1RFK A;  2IYD B;  3APC A;  1V5T A;  2LZ6 A;  2LJI A;  3MFG A;  1J7B A;  2AQ3 B;  3AU5 A;  3BWU D;  2XN9 C;  4K1R B;  1WWT A;  4RF0 A;  1SEB D;  3PVL A;  3PS6 A;  1P7F A;  1T0R C;  1TZO A;  2V3S A;  2LHE A;  1JQ4 A;  4WJO A;  2KO3 A;  1SB3 C;  5E6O A;  2KWV B;  3ZTD A;  4ZRQ A;  1F2R I;  2MQJ A;  4KSK C;  1QOF A;  3V3X A;  4AQ7 A;  2C9W B;  1GB1 A;  1L0Y B;  2WXF A;  2PVG C;  3QAR A;  3KUD B;  3AE1 B;  2KDI A;  4BOS C;  2KVR A;  1UNS A;  3IT6 B;  2MJD A;  4ZHO A;  4RMA A;  4ANV A;  1WGK A;  1FIQ A;  1RWS A;  1HA5 A;  1TS4 A;  1YQ3 B;  2IBI B;  4BKG A;  1KLG D;  1FCC C;  1XCT L;  3DVG Y;  1WR6 E;  1UUP A;  3ZO5 B;  1FCL A;  1FRR A;  1TKE A;  5JHB A;  3DHH C;  1L4D B;  1YN4 A;  3CST A;  2WXQ A;  3ZJU A;  5LXH A;  1K51 A;  1D3Z A;  3VUY A;  5DPS A;  1JWU D;  3QAQ A;  3BY4 B;  4RGO S;  1ET9 A;  2KTF A;  4AUQ C;  2W3R A;  1GUA B;  1L6V A;  1WE6 A;  2NR2 A;  2FID A;  3U2S C;  2H88 B;  4A6Q A;  3NZS A;  5BO4 B;  4TKN A;  2LXA A;  4GB9 A;  2L1A A;  4OZB A;  2IY0 B;  3O65 B;  3SR6 A;  4W9C A;  4TSS A;  2WX1 A;  4K3C A;  4RGT A;  5H92 C;  1Z2M A;  3AB5 A;  4O1N A;  2GI9 A;  3RCZ A;  1VLB A;  4A20 A;  2SEB D;  3NJT A;  1GG3 A;  3SU8 X;  2C7M B;  4EZK A;  2AX5 A;  2BS2 B;  3N30 A;  4BKS D;  4KGR A;  3IBE A;  4C00 A;  5FR3 A;  1E0Z A;  2LGD A;  1KRH A;  2Y3A A;  1VR9 A;  2L7R A;  1STE A;  4G0N B;  4BVU C;  3DVN U;  3GOE A;  3WCQ A;  3PRZ A;  3DVN V;  4EUT A;  4LJO B;  2MLB A;  3BVM A;  3NG0 A;  4EEW A;  5BMI A;  4XX5 A;  3LYY A;  1P7E A;  5AUI A;  3LXF A;  5C23 A;  1D6E C;  2N0S B;  2BKF A;  3Q3J A;  3FAH A;  5EE1 A;  3BIN A;  4PK1 A;  2V9H A;  3FKY A;  4HDO A;  4ARI A;  2AYO B;  1XLP A;  2KFK A;  2INP E;  4LTU A;  3RNF C;  1S1Q B;  4KX6 B;  3N32 A;  3A9J B;  4HK2 A;  2M8S A;  3A9J A;  4IKG A;  3AEG B;  3KWL A;  5D94 A;  1H8C A;  3VHT C;  4AWJ A;  1VDV A;  3HVD A;  3TMP B;  1NVI D;  2NCN A;  2M0X A;  3Q69 A;  2KKC A;  3X23 A;  2ZW1 A;  4OW0 A;  5I4D A;  2WP9 B;  5KHO A;  4I6P A;  1F9J A;  1ZUD 2;  1V80 A;  1J19 A;  2WU5 B;  2WXP A;  2WX0 A;  3DBR I;  1GC6 A;  3IT4 B;  2C7H A;  2NVU I;  4ZHP A;  4IOI E;  2EKE C;  3P4P B;  4IG7 B;  2PKO A;  1RAX A;  4WJN A;  5HI1 A;  2J0K A;  1XXG A;  4DK5 A;  5G5G A;  2L76 A;  4RM9 A;  3VAW A;  3C19 A;  1XO3 A;  4WIP A;  3IFW B;  3AEB B;  3UI3 A;  1KFY B;  3ZRF A;  1D5M C;  2BS4 B;  2N9K A;  2L05 A;  4PYU A;  5G55 A;  3AE7 B;  4IW0 A;  3KUC B;  1HXY D;  1TGZ B;  1XT9 B;  4NAW B;  5FR6 A; 
#chains in the Genus database with same CATH homology
 1YJ1 A;  2L0F A;  2C7N B;  3L13 A;  2WWZ A;  3PPA A;  4M0W B;  3VH3 B;  3AU4 A;  2MP2 B;  2DZJ A;  3H9D A;  5E6N A;  2MP2 A;  2L8J A;  4F8C B;  1Q5W B;  4A3O A;  1V2Y A;  1MG8 A;  2G4S A;  2GBK A;  4GU2 A;  4AOF A;  4MSM B;  3ML8 A;  3TCA A;  1EF1 A;  4TQ0 A;  1XQQ A;  1YQB A;  2LWP A;  3ZDM C;  2KDE B;  2LRU A;  4W9E A;  2FCS A;  3ZNG C;  3R3M A;  5HKH A;  4W9F A;  3U30 A;  4LDT D;  2KMA A;  4MGY E;  5KHQ A;  1WZ0 A;  3AXC A;  2HJ8 A;  1IP9 A;  2CU1 A;  4EFO A;  2W9N A;  5IA7 A;  1UEL A;  1WGR A;  3L08 A;  3TJP A;  2K8H A;  1WX7 A;  1SGH A;  4DXA B;  1WGH A;  2KOX A;  4G50 A;  1ZW7 A;  1Y8R C;  3ZNH B;  4I6L B;  4P7I A;  3PRE A;  3DCG A;  3EEC A;  1WR1 A;  3IVF A;  3PV1 A;  3ZNI D;  2KC2 A;  2KJ6 A;  2KD0 A;  1WH3 A;  3K9O B;  4HPL B;  3WAM A;  3VQI A;  4KDL B;  4NJ6 A;  3LDZ E;  4PYZ A;  4J6I A;  2JVC A;  3R7R A;  4DHZ B;  4K7W A;  5DPT A;  4ICV A;  1YX6 B;  4B9K A;  3DBL I;  3V61 A;  2KMC A;  3ML9 A;  1EO6 A;  4TV3 A;  2K6D B;  2DZM A;  2D07 B;  1WYW B;  2D3G A;  2ZVO A;  5CHV C;  3H6N A;  1WF9 A;  4XC2 A;  4KIK A;  1IPG A;  2KLG A;  4MDK E;  4CYE A;  2IO0 B;  5EDS A;  2DZK A;  3JSV B;  2RD0 A;  4ANW A;  2IO3 B;  2K6Q A;  2KC1 A;  1FXT B;  3PZD A;  4NY0 A;  3JSV A;  4W9D A;  3X0W A;  1WX9 A;  4IWO A;  2MSE D;  1WRD B;  2FCM A;  4G3X B;  4HCN B;  2FIF A;  2GOW A;  5D2M B;  5E6P A;  4DDI D;  2B3A A;  4TUU A;  5L95 C;  1C3T A;  2MX2 A;  3QIJ A;  2LAS A;  3ZDT A;  1UH6 A;  3HM6 X;  4AJY B;  2I1J A;  2KQS A;  3H1U A;  3JW0 X;  3RUL A;  4ANU A;  4HCP B;  1KLV A;  4IM3 A;  2DAJ A;  1OQY A;  2QHO A;  2V1Y A;  1V49 A;  2DYO A;  4URK A;  1SIF A;  2ZZP B;  4BFR A;  2KHW B;  2C60 A;  1C1Y B;  4FN2 A;  1RLF A;  2VRR B;  2O2V A;  5AZF A;  4II2 B;  4FJV B;  1TZ1 A;  2K1F A;  4WWO A;  2LD9 A;  3QK0 A;  5GMV A;  3HIZ A;  2D2Q A;  4GSW A;  4GDL B;  3ONS A;  4KV2 A;  1X1M A;  2RPQ A;  3DBH I;  4GGQ A;  4IM2 A;  2KLC A;  4DDG D;  2YLM A;  4ANX A;  3ZIM A;  2YVC A;  4YL8 A;  2FUH B;  2N9X A;  4KSL C;  1E8Z A;  3PHW B;  4HXD A;  1WGY A;  1U4A A;  4KZ0 A;  2LVO A;  4WWN A;  1T0Y A;  1HE8 A;  2BYV E;  1WGD A;  4K7U A;  2Y5B B;  2DZI A;  3PT2 B;  3CSF A;  5DPW A;  2BYE A;  2JUO A;  2KFJ A;  5J17 A;  3OJ4 B;  2ZEQ A;  3DOW A;  4EZJ A;  5DPR A;  4FAD A;  5J2R A;  3QX1 A;  4GXB A;  2G45 B;  3ENE A;  3VTV A;  3RYT A;  1QZE A;  4NNJ B;  3HK0 A;  1H4R A;  2L00 B;  4GMV A;  2DEN B;  5IAA C;  3S2A A;  2BGF A;  2O6V B;  4AP4 C;  3H7S A;  2CS4 A;  2LRW A;  2O6V A;  4K81 A;  4PS3 A;  3VUX A;  1AAR A;  3RZF A;  3V62 A;  2J0M A;  3A1Q B;  1WY8 A;  4B6W A;  3M95 A;  3A1Q A;  3Q3F A;  4NAW A;  3RD2 A;  1NBF C;  1RRB A;  1TBE A;  1J8C A;  4ICU A;  4MEL A;  4BBN F;  4FBJ B;  2LUE A;  3MHS D;  3QCA A;  2BWF A;  2MCN B;  1WM3 A;  4N9F 4;  1LQB A;  2NBU A;  1WZ3 A;  4NQK E;  5D7G A;  4JIO U;  3VTU A;  3ZUN A;  2LI5 A;  1V9J A;  2KDF B;  2MWS B;  4GN1 A;  1WMH B;  1ZGU B;  4HLE A;  1LFD A;  2KN5 A;  2LGY A;  3NZU A;  1LXD A;  2BF8 B;  3NS8 A;  1UZX B;  3V6E B;  4BBN C;  2IO2 B;  1KJT A;  3HM3 A;  1WI0 A;  2KX0 A;  3UIO B;  4DHJ B;  2JRH A;  3MJW A;  1P1A A;  1CMX B;  3L10 B;  4IM0 A;  4EKU A;  1NI2 A;  3R66 C;  4HDQ A;  1E5W A;  3RUI B;  2I1K A;  3B1L X;  3L16 A;  2LVP A;  3TL5 A;  3L54 A;  4CO7 A;  1WJ6 A;  3PHX B;  2XK5 B;  5CX3 A;  5JZE B;  3WA0 A;  3APF A;  2KDB A;  2N7D A;  3DBS A;  1A5R A;  2ZPY A;  1G6J A;  3VH4 B;  1K8R B;  2GBJ A;  3DDC B;  2JPH A;  3DQV A;  4KZC A;  3IG3 A;  2J0J A;  2EMT A;  3M62 B;  3QA8 A;  1RFA A;  2IYD B;  4WQO B;  1GJZ A;  2G3Q B;  3APC A;  1V5T A;  2O6V D;  3UIP B;  2AL6 A;  2LZ6 A;  2ZVN A;  4PS8 A;  3AU5 A;  3WAL A;  1V5O A;  4K1R B;  3W1S A;  1E7V A;  1Q0W B;  4K7S A;  3OAW A;  3UGB B;  5LXI B;  4PS7 A;  3PVL A;  3PS6 A;  2JY6 A;  2KTR B;  2M1M A;  3UQA A;  2MBB B;  4HWI B;  4W9K A;  2MBH A;  4LJP B;  2KTR A;  3KW5 B;  4ASW C;  2V3S A;  3UQB A;  3OJ3 A;  1WJN A;  1V6E A;  4ZRJ A;  3ECI A;  3A9K B;  4WJO A;  2DYM A;  1OGW A;  2KO3 A;  1UBI A;  3TBL D;  3A9K A;  5E6O A;  1WJ4 A;  2XBB C;  5CHW A;  3WAN A;  2Z0D B;  3PGE A;  2KWV B;  3ZTD A;  3ZTC A;  1JRU A;  5JH5 C;  2MA9 B;  1P0R A;  2MQJ A;  4KSK C;  4DHJ D;  2DX5 B;  3DPD A;  2JZZ A;  2C5L C;  2KQ7 A;  4ZRI A;  4ZYN A;  4W9L A;  2KFK B;  4NJ7 A;  2C9W B;  1J0G A;  3QAR A;  2CHW A;  3KUD B;  2KDI A;  1WX8 A;  2LJ5 A;  4BOS C;  2KVR A;  2MW5 A;  4II3 B;  2L0T A;  4RMA A;  3OLM D;  4ANV A;  4EZL A;  3JVZ X;  4ZDV A;  1WM2 A;  4M8N A;  3ALB A;  2HE7 A;  3H7P B;  1KM7 A;  3H7P A;  4MSQ B;  1OEY J;  2N9P C;  2FCQ A;  2IBI B;  2PJH A;  1EF5 A;  4ZRK A;  3D32 A;  4BKG A;  1OTR B;  4GDL A;  3A4R A;  4JGH B;  3DVG Y;  1WR6 E;  3KVF B;  1WJU A;  2R2O A;  3ZO5 B;  5D6J B;  2ASQ A;  3NY5 A;  2M4N A;  4CHK A;  4DBG A;  3ZW3 A;  5JHB A;  3A4S C;  1E90 A;  3PRP B;  3ZVV A;  2AEH A;  1GC7 A;  2AL3 A;  2KAN A;  3CST A;  2MBE A;  2KZR A;  2Z0E B;  2KJR A;  2J7Q B;  5LXH A;  1E7U A;  4FLH A;  1D3Z A;  3T8M A;  3VUY A;  3V60 A;  5DPS A;  2DHZ A;  4KDI C;  3QAQ A;  2K39 A;  2HD5 B;  2N7E A;  3BY4 B;  3JYU A;  4MH0 E;  4BKS A;  2M17 A;  2L3Z A;  3QJZ A;  2BWE S;  2JWZ A;  2KTF A;  3A33 B;  4GDK B;  4FHJ A;  4AUQ C;  4FJZ A;  3ZLZ A;  4XZ4 A;  1NDD A;  2REX A;  4GDK A;  5G2N A;  4AJW A;  1GUA B;  1WE6 A;  3KH0 A;  2ZCC A;  2NR2 A;  4BOZ B;  2FID A;  1Z5S B;  4FUL A;  3SDL C;  5L83 A;  3IHP C;  3VXW A;  2XEW A;  2GMI C;  2ZNV B;  1OEY A;  3NZS A;  3PLV A;  4E3C A;  5BO4 B;  3W1Y A;  2ZCB A;  4TKN A;  2LXA A;  4GB9 A;  1P98 A;  2MRP A;  2HTH A;  3W1S C;  2V4L A;  1SE9 A;  1BT0 A;  2IY0 B;  2RR9 A;  3O65 B;  1WMH A;  3EHV A;  4W9C A;  3WIM A;  2BYF A;  2WX1 A;  4I6N B;  1UBQ A;  3ZNZ B;  2N9E B;  2NPT B;  4RM8 A;  2LVQ A;  4W9G A;  3PRM B;  4JQW C;  5CTR C;  2NPT A;  2OOB B;  5AZH A;  1Z2M A;  1M94 A;  5AZG A;  3M63 B;  4IWP A;  3RCZ A;  4A20 A;  2BPS A;  2KWU B;  2K8C A;  2XK5 A;  4EOY A;  1GG3 A;  3SU8 X;  2C7M B;  4EZK A;  3EFU A;  3N30 A;  4BKS D;  4OVV A;  4F7Z A;  3IBE A;  3QWZ B;  1V86 A;  2FCN A;  1XD3 B;  2NS5 A;  3LJ3 A;  4JLC A;  2LGD A;  2JF5 A;  4E74 A;  3APD A;  1R4N I;  5LLI A;  3P2B A;  4WJP A;  2D10 A;  3U7D A;  3AI5 A;  2L7R A;  2BKR B;  2NBV B;  4G0N B;  2WYQ A;  4GOC A;  2AWT A;  2KNB A;  3QC8 B;  2PEA A;  3HHM A;  1R4M I;  4BVU C;  1P3Q U;  3DVN U;  4FJY A;  4BKT A;  4FHK A;  3I3T B;  2KXJ A;  5JHA A;  3GOE A;  2KK8 A;  5TR5 A;  4F1S A;  3PRZ A;  3DVN V;  3CF6 E;  4EUT A;  2RSU A;  2N1V A;  4GIV A;  4KVG B;  3T9L A;  4LJO B;  2MLB A;  3AUL A;  2JRI B;  2R2Q A;  4MM3 A;  3SHQ A;  3KYD D;  4EEW A;  2JZ3 B;  1WXV A;  2A4Z A;  4XX5 A;  4HPM B;  2G4D B;  5C1Z A;  1YD8 U;  2OJR A;  2ZJD A;  2DYB A;  2CKH B;  2A5U A;  3KYC D;  5C23 A;  3SD5 A;  1YIW A;  2PE6 B;  1I35 A;  2MBQ A;  2BKF A;  3M3J A;  3Q3J A;  3RZW C;  3VTW A;  3BIN A;  4W9J A;  3UIN B;  2RGF A;  1GNU A;  3QQ8 B;  2N4F A;  4HDO A;  2AYO B;  1WXA A;  3C0R B;  2GBR A;  2KFK A;  3MTN B;  1WGG A;  1YX5 B;  4KIK B;  1S1Q B;  1S3S G;  3N32 A;  3A9J B;  2KX3 A;  4HK2 A;  2M8S A;  3A9J A;  3L17 A;  4W9I A;  4MGI E;  3PLU A;  1I42 A;  5D94 A;  1H8C A;  5AEK B;  3VHT C;  1P9D U;  4AWJ A;  2UYZ B;  1UGM A;  1IYF A;  1ZKH A;  4W9H A;  1Q1O A;  2ZNV C;  4WWP A;  3TMP B;  2NCN A;  4FA6 A;  2M0X A;  2PPH A;  2KKC A;  2KJH B;  2N1W A;  1EUV B;  2DAF A;  4WAA A;  3X23 A;  2KWC A;  4B95 A;  2EMS A;  1LM8 B;  1WXS A;  4HJK A;  2PE9 A;  4JL9 A;  5KHO A;  3UF8 A;  4I6P A;  1F9J A;  1V80 A;  1WE7 A;  4G11 A;  4A3P A;  4IWQ A;  1J19 A;  2K25 A;  2WDT B;  2Z59 B;  3VDZ A;  2O2V B;  2CHZ A;  2WX0 A;  3EC8 A;  3DBR I;  3WAP A;  1GC6 A;  4E71 A;  3DVG X;  3QHT A;  3U8Z A;  4IUM B;  2C7H A;  1L7Y A;  2NVU I;  2LGX A;  1VD2 A;  1WXM A;  2MBO A;  3L0W B;  3N3K B;  1KOT A;  2IY1 B;  1E8W A;  3B0A A;  2EKE C;  2ZPN A;  3PSE B;  4IG7 B;  1VCB A;  2LXC A;  1WFY A;  1PQS A;  2IO1 B;  5CHF A;  4LDT B;  1RAX A;  4WJN A;  4OVU A;  2J0K A;  4DHZ E;  3TIX A;  4DK5 A;  3NHE B;  3VFK A;  5J18 A;  4MJS B;  1V81 A;  4MGK E;  1TTN A;  2L76 A;  4M8M A;  4RM9 A;  4MJS A;  3VAW A;  4MGZ E;  3RT3 B;  2CHX A;  2FAZ A;  2GBM A;  1E8Y A;  2K8B A;  3IFW B;  4TQ1 A;  1ISN A;  1UD7 A;  3V6C B;  1L2N A;  4NPN A;  3ZRF A;  4HVB A;  3VUW A;  2FNJ B;  1E8X A;  2D11 A;  3PTF C;  3VVW B;  4X57 B;  2L05 A;  2UWQ A;  4LCD E;  3KUZ A;  4PYU A;  3WAO A;  3B08 A;  5G55 A;  2NBW B;  3CMM B;  4IW0 A;  3KUC B;  5DCN A;  3R7Q A;  3K9P B;  1WIA A;  3GZN I;  4IC7 B;  3ZRC A;  4DWF A;  2GBN A;  1TGZ B;  4MEM A;  1XT9 B;  2JXX A;  2JT4 B;  3NOB A;  4WJQ A;  3ZKJ C;  4NAW B;  5FR6 A;  2IZV B;  4NQL B;  2CR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...