2MA9B

Hiv-1 vif socs-box and elongin bc solution structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/protein binding
molecule keywords Virion infectivity factor
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ma9B00
2L76A 1WM2A 2MP2A 4OVVA 3ZKJC 4DK5A 3L16A 3PZDA 4JLCA 1V80A 2JVCA 4G11A 4BKTA 1U4AA 4G0NB 1J8CA 3KW5B 3ZNHB 3HHMA 1V9JA 2MCNB 4KVGB 3H1UA 1WF9A 2AEHA 2OOBB 4FHKA 4YL8A 3K9OB 2A4ZA 2PJHA 4BVUC 4W9JA 4W9GA 2K8HA 3N32A 3R7RA 4B9KA 3JW0X 4W9FA 4WJQA 3AU5A 4DHZE 3H6NA 1WFYA 4EUTA 5E6NA 1WYWB 4FULA 4MSMB 2ZEQA 2VRRB 2M1MA 2FCQA 3QA8A 1WXSA 2K39A 2RPQA 3V60A 4HPLB 1WH3A 4JQWC 2YVCA 3APCA 3H7SA 2CU1A 3QC8B 4BOSC 2JZ3B 2ZCBA 2MBOA 2WWZA 3AULA 1OTRB 4LJOB 1L7YA 3BY4B 4IUMB 5LLIA 2FNJB 3PLVA 5AEKB 4GOCA 5LXHA 2MRPA 3VFKA 2NS5A 1YIWA 2W9NA 1IP9A 2D3GA 3ZIMA 2DZKA 1GNUA 4FJVB 5E6OA 3A4RA 3N30A 3H7PB 1CMXB 1VD2A 3ZNGC 5JZEB 2M8SA 4E3CA 3PLUA 4JIOU 1V49A 4WWOA 4DHZB 2BYVE 1E7UA 1V81A 1I42A 2ZVOA 2I1KA 4URKA 3VDZA 2KO3A 3B1LX 3ALBA 2FIFA 2L3ZA 2HD5B 4WWNA 1ZW7A 2EMTA 3U30A 4KZCA 4HJKA 3SHQA 1GC7A 1GC6A 2M0XA 4W9IA 1WIAA 4NJ7A 1YQBA 1LFDA 2L0FA 2RR9A 4RMAA 3DQVA 4WJPA 2MBBB 2WX0A 3DBRI 4TQ0A 2DAFA 1TBEA 1LXDA 4ANWA 3NZSA 4XX5A 3ZNID 2XK5A 3R7QA 5DCNA 2O6VB 2JUOA 4M0WB 2GBNA 1KM7A 2KQSA 3PTFC 3K9PB 4KDLB 3DVGY 2C9WB 3DBSA 3TBLD 2MWSB 2WX1A 4M8NA 2XBBC 2DENB 3VUWA 2KXJA 3DBLI 4ASWC 3A33B 4CYEA 3TMPB 4TQ1A 3OJ4B 2O6VD 2JRHA 2YLMA 4HCPB 4JL9A 2O2VA 4G3XB 5DPWA 1YX6B 4GSWA 4EFOA 3DOWA 2KTRB 1E5WA 2M17A 3VH3B 4NAWA 4W9EA 5C1ZA 4GN1A 2MLBA 5G55A 5E6PA 1WGDA 3ZDMC 1WJ6A 4ANVA 4TUUA 3ZUNA 2JRIB 4EZJA 3BINA 2I1JA 5J17A 3EC8A 3KUDB 4WJNA 2KX3A 3QJZA 2C7HA 3EECA 3UINB 2N9EB 2K1FA 1RLFA 2MQJA 4AJYB 1YD8U 2JWZA 1ISNA 2J7QB 3ZRCA 1JRUA 1J19A 3NHEB 3RT3B 3VTVA 1M94A 2GBRA 2J0KA 4GDKA 3AI5A 3RZWC 3PHWB 1RRBA 1WXAA 3MTNB 2DX5B 3IG3A 3IVFA 3SD5A 1XD3B 3VUYA 4E74A 4DDGD 4RM9A 1ZGUB 4IW0A 2JXXA 5CHFA 4N9F4 3IBEA 3RUIB 3KUCB 4IWOA 2CR5A 4F8CB 2LGDA 2LUEA 3ECIA 5D94A 3HM3A 2R2QA 3TL5A 2FCSA 1H4RA 2JZZA 3DVGX 4KIKA 2LRWA 2N1VA 2RSUA 3A1QB 2LVPA 1WI0A 2KDBA 3M95A 2V1YA 3CF6E 1K8RB 2KWCA 3NZUA 4MGKE 2ZZPB 1WGYA 3APDA 3JYUA 4M8MA 4I6PA 1SE9A 2C7NB 4HDQA 2CS4A 3PPAA 3WIMA 1R4MI 3VTWA 3KYCD 4OVUA 3DVNV 3OAWA 2MBHA 3PS6A 3M62B 4GXBA 1EUVB 4W9KA 1V6EA 1SGHA 3PRMB 3QAQA 2MA9B 4A3PA 1XT9B 2FAZA 2K6QA 3IFWB 3UIOB 5CX3A 2FCMA 2UWQA 5JHBA 4X57B 1Z2MA 3X0WA 1WZ0A 2KANA 3JSVA 1KLVA 3CMMB 2XK5B 5C23A 2IO1B 2N4FA 3SU8X 4BOZB 3CSTA 3MJWA 3L10B 2KWVB 3U7DA 4ANXA 2DZMA 2KMAA 4W9DA 2GBMA 3MHSD 2BF8B 2V3SA 4IM2A 1C1YB 2NCNA 2HTHA 4G50A 4PYUA 4CHKA 4ZDVA 2PE9A 3M3JA 3V6EB 3O65B 4KSKC 2N7DA 3WAPA 1NI2A 3W1YA 1EF5A 3JSVB 2KTRA 2NR2A 2OJRA 2KZRA 2K8CA 3RD2A 3RYTA 2D10A 1Z5SB 2KFKB 2ZPNA 3HK0A 3ZW3A 3QARA 5L83A 2LWPA 1J0GA 4AWJA 4GGQA 2N9PC 1WGRA 1HE8A 1NBFC 3UQBA 5EDSA 1G6JA 2ZJDA 3ML9A 1YJ1A 2BKFA 5KHQA 1LQBA 2N1WA 3WANA 3RULA 2GOWA 3NOBA 3QWZB 2M4NA 3DBHI 2K25A 5LXIB 2MW5A 2KJ6A 2AL3A 4GDKB 1EF1A 3A9JB 1UBIA 3KVFB 3HM6X 2J0JA 2A5UA 2DZJA 2BWES 3JVZX 3L0WB 1WX8A 4B95A 3PRPB 4P7IA 2O6VA 3ZVVA 2Y5BB 4NJ6A 3A1QA 4MDKE 4KDIC 2KC1A 4KIKB 3T9LA 3KYDD 2D11A 1V86A 3PVLA 4BBNF 2AWTA 3B0AA 1FXTB 3ML8A 1OQYA 2MBEA 2XEWA 2G45B 4KSLC 4MEMA 2MP2B 2KTFA 2MX2A 3L13A 3T8MA 5CHWA 1A5RA 4F7ZA 4EEWA 1E8YA 3LDZE 2K8BA 2KNBA 2ZNVC 3WAOA 2FIDA 4NAWB 4AUQC 2LGXA 4FJZA 2KD0A 3R3MA 4BKGA 3KH0A 4GU2A 1GUAB 1Q5WB 3DDCB 4K7SA 4NY0A 2O2VB 3R66C 3UF8A 1T0YA 2FCNA 2KDFB 2KFJA 2LI5A 1E8WA 2GMIC 1L2NA 1X1MA 3IHPC 5DPSA 1PQSA 3AXCA 1E8XA 3S2AA 3TJPA 4MGIE 2JF5A 4ICVA 3PSEB 2G3QB 4MGZE 5KHOA 4CO7A 1WGGA 2CHWA 1F9JA 4IG7B 1Y8RC 4ANUA 4AOFA 2N7EA 4K81A 4IM3A 2BWFA 2HE7A 1IYFA 3X23A 4B6WA 2NBWB 4GIVA 2CHZA 4ICUA 2IY1B 1WE6A 3N3KB 2DAJA 2MBQA 4BKSA 4AJWA 1P98A 4W9CA 3EHVA 3Q3FA 4PYZA 2RD0A 3DPDA 4DBGA 4DXAB 5G2NA 1H8CA 2L0TA 4MSQB 2BPSA 1WJNA 1V2YA 2KLGA 1WRDB 1WE7A 3QCAA 2QHOA 5TR5A 4DHJD 1WZ3A 2Z59B 3PV1A 4IM0A 3ZDTA 2CKHB 1P3QU 1UELA 2KLCA 3ONSA 4FA6A 3NY5A 3ZTCA 4EZKA 4DWFA 4GDLA 4A20A 4ZYNA 2ZVNA 5JH5C 3LJ3A 3WALA 5D2MB 1AARA 3I3TB 2KQ7A 3A4SC 3OJ3A 4FLHA 2DYBA 4RM8A 4TKNA 3KUZA 2KC2A 4MJSB 1UGMA 2KX0A 2CHXA 3ZRFA 2ZNVB 5IAAC 5L95C 2LXAA 2ZCCA 2KJHB 4HK2A 4FJYA 4HDOA 2DHZA 1LM8B 3OLMD 4HXDA 2IO2B 3ZLZA 2KDEB 2KKCA 2ASQA 1UH6A 2AYOB 2WDTB 3EFUA 4NNJB 2C60A 4GB9A 4NPNA 1YX5B 2JT4B 2REXA 2DYOA 2LZ6A 3Q3JA 3VUXA 4HPMB 4WAAA 4EKUA 4IWPA 1WGHA 3PT2B 4FHJA 2EMSA 2IZVB 2KMCA 2BKRB 4K1RB 3TCAA 3ZTDA 2LRUA 1SIFA 2N9XA 1OEYJ 1QZEA 4II3B 3V6CB 3A9KB 3RZFA 2D2QA 4MM3A 1RFAA 1WMHB 2PEAA 3W1SC 1V5OA 5D6JB 4MJSA 3RCZA 2C7MB 2HJ8A 2LVOA 1Q0WB 1UBQA 3PRZA 3UGBB 2IY0B 4EZLA 3VXWA 3UIPB 1IPGA 2IBIB 1ZKHA 1UZXB 1VCBA 1P0RA 4W9LA 3V62A 1Q1OA 3PREA 4PS7A 2KDIA 4IC7B 3DVNU 2IO3B 3P2BA 4BBNC 3TIXA 5HKHA 1WM3A 1WMHA 2NPTA 4MELA 3ZNZB 3GOEA 1E7VA 1I35A 2L05A 4KZ0A 1V5TA 4WQOB 2KN5A 2L00B 3QIJA 1OEYA 2G4SA 4PS3A 2IYDB 4BKSD 1TZ1A 3CSFA 2Z0DB 4JGHB 4NQKE 4MGYE 4LJPB 2NVUI 2FUHB 2BYFA 3H7PA 4KV2A 3B08A 4HWIB 4XZ4A 2BYEA 1E8ZA 4DDID 5D7GA 2KWUB 1S1QB 5AZFA 3PHXB 2GBJA 2V4LA 3QX1A 5DPRA 2NBVB 4MH0E 4ZRKA 3APFA 1WR1A 1RAXA 1S3SG 5J18A 4LDTB 2LASA 4BFRA 4I6LB 3ZO5B 4K7WA 1WJ4A 2DYMA 3W1SA 3AU4A 1WXVA 2B3AA 4NQLB 5GMVA 3QQ8B 2JPHA 4E71A 2D07B 2RGFA 2R2OA 3D32A 4IWQA 4WWPA 3VAWA 2LGYA 3C0RB 1TTNA 4HCNB 2KHWB 1EO6A 4GDLB 2DZIA 3V61A 4LCDE 2C5LC 1XQQA 4FADA 1GJZA 4ZRIA 2L7RA 4F1SA 5CTRC 1WX9A 4K7UA 4XC2A 1R4NI 2Z0EB 5CHVC 4J6IA 2G4DB 2IO0B 2KJRA 1E90A 3WA0A 2UYZB 1WX7A 2WYQA 3L54A 1D3ZA 1WXMA 3QK0A 4PS8A 5AZHA 3SDLC 4W9HA 3VQIA 2MSED 1NDDA 5J2RA 1MG8A 1KJTA 2JY6A 3NS8A 4FBJB 4TV3A 2NBUA 3VTUA 3VVWB 4GMVA 1WY8A 5FR6A 4AP4C 1UD7A 2GBKA 2L8JA 2KOXA 2PPHA 2LVQA 2ZPYA 2KK8A 3A9KA 3H9DA 4EOYA 3VHTC 4DHJB 1C3TA 2BGFA 3DCGA 3HIZA 4FN2A 4I6NB 3A9JA 2PE6B 5JHAA 1WR6E 1GG3A 3U8ZA 3UQAA 1KOTA 2LJ5A 4WJOA 4LDTD 1TGZB 2AL6A 4II2B 3WAMA 3GZNI 3L08A 2EKEC 4HVBA 4HLEA 2J0MA 3ENEA 3L17A 3VH4B 2LD9A 3QHTA 5DPTA 1WJUA 1BT0A 2K6DB 2KFKA 5BO4B 4A3OA 1P9DU 2NPTB 3PGEA 3M63B 5IA7A 1P1AA 2LXCA 4ZRJA 5AZGA 2KVRA 1OGWA
chains in the Genus database with same CATH superfamily
1WM2A 3AE8B 4YSZB 3ZKJC 4DK5A 1V80A 2JVCA 3ZYYX 4ZOHC 3WCQA 1BMLC 3HHMA 4C80A 1V9JA 4YT0B 2MCNB 3H1UA 1MG4A 4YL8A 3K9OB 1KH0A 1IGCA 1QOAA 5D3DA 2KVZA 3R7RA 3JW0X 1ZXIA 3BYTB 3AU5A 1ENFA 2ZEQA 1VDVA 3QA8A 2K39A 2QDFA 2RPQA 3VRAB 1L5PA 3FC4A 4RH6A 1FNVA 2CJNA 1N5XA 3AB5A 2JZ3B 2MBOA 4IDIA 1I7HA 3ZIMA 3N30A 4P1CC 3P4RB 1C77A 5BYQA 3PLUA 2OEDA 1V49A 2BYVE 1E7UA 2W55A 1JQ4A 3AM9A 2FIFA 2R61A 2INDC 1GC6A 2L0FA 3Q8AA 2WU2B 4RMAA 1F2RI 2MBBB 2WX0A 4L23A 4ANWA 3FILA 3NZSA 4XX5A 3R7QA 2LMCA 2O6VB 2GBNA 1KM7A 3PTFC 3K9PB 3DVGY 2MWSB 3R2TA 4OZBA 3AMZA 3VUWA 1MJDA 4ASWC 3A33B 4LK0M 3TMPB 3OJ4B 4HCPB 3NUHB 3I63C 2AQ3B 1JALA 3DWGC 1SXTA 5DPWA 3RI7C 2JYEA 2WP9B 5BMGA 4N6EB 2LGSA 4EZJA 2WXOA 3EC8A 4WJNA 1SE3A 3UINB 2OHFA 2K1FA 1RLFA 2N9EB 5GXGB 1YD8U 3LXFA 4A90A 2N9KA 3AI5A 3PHWB 1TKGA 1RRBA 3MTNB 3IVFA 3BK1A 1ZGUB 5CHFA 4N9F4 3KUCB 4IWOA 2CR5A 4F8CB 2LGDA 2QC8A 2LUEA 3ECIA 5D94A 3HM3A 1QLBB 2R2QA 3TL5A 2LVPA 1WI0A 3FILB 1FNUA 1HZ6A 1QOFA 4MGKE 2KWCA 2ZZPB 1WGYA 5LNK1 4L2YA 3JYUA 2WXPA 1AW7A 4I6PA 4M8MA 1C9FA 1YN5A 3VTWA 4GXBA 3HUIA 1EUVB 2JWUA 4A3PA 1I4RA 2SEBD 3IFWB 2UWQA 4X57B 1WZ0A 1NI3A 3CMMB 2IO1B 1XXGA 2N4FA 4BOZB 3L10B 2KWVB 3N1ZC 1RYJA 2DBYA 4YSYB 2EELA 2CJOA 4CHKA 2PE9A 3AEFB 4KSKC 3WAPA 1P7FA 1NI2A 1F52A 2L1AA 2D5GA 2K3UA 1XF5L 2NR2A 2KZRA 2ZPNA 1J0GA 5L83A 1ZOYB 2N9PC 3UQBA 1G6JA 1MPEA 3ML9A 4YWGG 2BKFA 5KHQA 1LQBA 2WDVB 4N59A 1E6EB 3RULA 2GOWA 3NOBA 4WH4A 4ACFA 3LB8C 4GDKB 3T3OA 2BVCA 2DZJA 4C00A 3L0WB 2O6VA 3ZVVA 5IOIA 4NJ6A 4KDIC 2WXJA 1C4PA 2BT6A 1HXYD 4BBNF 3I57A 3Q8EA 1OQYA 2WQYB 1A5RA 1E8YA 2K8BA 2JZPA 2KNBA 2ZNVC 3V3XA 2JU6X 2KD0A 3R3MA 1DGJA 1OQRA 1GUAB 3DDCB 4NY0A 4NZLB 5DPSA 1TJEA 3DHIC 3AE5B 5EE3A 5KHOA 2CHWA 3R8BA 1VZ7A 2DLBA 4AOFA 2N7EA 2JYTA 3X23A 3EUB2 2GLSA 2CHZA 4ICUA 4YTPB 1QOGA 2IY1B 2MBQA 3AEBB 1FPYA 5HFYA 4PYZA 1N63A 3DPDA 4DXAB 2KACA 2L0TA 2BW2A 4MSQB 2JQRB 1QF6A 4RGNA 4DHJD 1TS3A 4IM0A 3ZDTA 3ONSA 1UELA 4FA6A 4M01A 4EZKA 3P4QB 1UUPA 4A20A 5JH5C 4C56C 3I3TB 2VH1A 2IGGA 1R4NB 2KC2A 1GPXA 4RGOS 2CHXA 4RF1A 1V1OA 3E56A 5IAAC 5L95C 4L1BA 4HXDA 2KKCA 2AYOB 4KKJA 4ZYSA 3ZJUA 4WAAA 4EKUA 3NS1A 1PDXA 3ZTDA 1QOBA 1VZ6A 2V3PA 2N9XA 2D2QA 3CWIA 1RFAA 1JW9D 3W1SC 2C7MB 1ET9A 4OVZA 2LVOA 2WHIA 3UIPB 1IPGA 1T5XD 3V62A 2J53A 3VR9B 3PREA 3DVNU 2IO3B 3P2BA 2BTEA 1V97A 4US8A 4K3BA 1I35A 2L00B 4LNNA 2G4SA 1EWYC 4RCOA 2IYDB 2MEKA 1IBXA 1TKEA 4A8XC 1F77A 4OZAA 2V4LA 2INPE 5C2TB 1TIFA 4ZRKA 3APFA 1RAXA 4P16A 4BFRA 4K7WA 1WJ4A 1GB4A 1XLNA 3AEEB 2B3AA 2D07B 3W9CB 1C4CA 3VAWA 1ZUD2 2LGYA 1OFFA 2WXRA 2N7JA 1TTNA 4HCNB 1ROEA 2KHWB 4CQNA 1FCCC 3Q3MC 2L7RA 5H8YE 1E90A 2HTME 2NTSA 1WXMA 3SDLC 5BMHA 4W9HA 1NDDA 5J2RA 3NS8A 4C4VA 4TSSA 4TV3A 3VVWB 4AP4C 2ZPYA 4FXCA 4KGTA 1XLOA 2BGFA 3DCGA 1FRRA 1TY0A 2D3CA 1GG3A 2WXHA 1E10A 4ZRPA 4HLEA 2J0MA 3ENEA 2XN9C 3DBLB 4YTNB 2IJ0A 5IO9A 4A3OA 2NPTB 2AQ1B 1P1AA 1M4VA 2L76A 4H2AA 2MP2A 3PZDA 4BKTA 1U4AA 3N20C 3KW5B 2AEHA 4FHKA 3Q69A 4W9JA 3GB1A 4B9KA 1KFYB 4DHZE 4MSMB 5HI1A 4ZRQA 3BVGA 3UI3A 3AEDB 4JQWC 3APCA 2IGHA 3QC8B 4BOSC 4J3OD 2WWZA 3AULA 1L7YA 1JWAD 3BY4B 3PLVA 5AEKB 3TEWA 2MRPA 3VFKA 1TZOA 1IP9A 3OWEB 2DZKA 1GNUA 2FE8A 1CMXB 3PZ8A 2LFIA 4E3CA 4WWOA 2QSDA 1V81A 2I1KA 4URKA 1P7EA 3B1LX 3ALBA 2HD5B 2BS4B 1L4ZB 4KZCA 3SHQA 1WIAA 4JX1C 1LFDA 2RR9A 1PGBA 3DBRI 3B2GA 4YSXB 1EU3A 2DAFA 2L52A 4IOIE 2XK5A 4KX6B 2JUOA 4M0WB 4RGMA 4KDLB 3BIID 1GAQB 1A70A 2C9WB 3DBSA 1FNWA 2WX1A 1PGAA 2XBBC 1VZ8A 2DENB 2KXJA 3P42A 1I4QA 4HRSA 1DOIA 3TEXA 4JL9A 1XLPA 1ET6A 1YX6B 1F0ZA 1E5WA 4ARCA 4NAWA 4W9EA 5C1ZA 4GN1A 2QJLA 3FKYA 5G55A 1WWTA 5E6PA 3ZXRA 2UU7A 1HTQA 3RNEC 1VR9A 4TUUA 3ZUNA 3NG0A 2I1JA 2C7HA 4HKQA 3RNCC 2JWZA 1ISNA 3ZRCA 1T6BX 1J19A 3RT3B 3VTVA 3R2IA 1DOXA 1WXAA 3IG3A 4E74A 1XD3B 2G1EA 4DDGD 1HA5A 3IBEA 4ZHPA 2FCSA 1H4RA 2JZZA 2LRWA 5IKCM 3Q8FA 1K8RB 1R4MB 1SE9A 2C7NB 3PPAA 1R4MI 5IN7A 1SGHA 3QAQA 2MA9B 2FAZA 2K6QA 3UIOB 5FKAC 5JHBA 3EA6A 3JSVA 2XK5B 1CK1A 4ANXA 3AE7B 2BF8B 1C1YB 2NCNA 4G50A 3O65B 1ZP0B 3Q2AC 2TSSA 2KTRA 4US9A 2K5PA 3RD2A 3DHHC 2D10A 1Z5SB 2KFKB 3H8HA 3QARA 4GGQA 1DYQA 1ESFA 2ZJDA 1F2RC 1J7CA 2MW5A 2KJ6A 1YJIA 3KVFB 3HM6X 2J0JA 2BWES 3JVZX 1WX8A 4Q2JA 3Q3NC 2KC1A 3W5UB 2D11A 3PVLA 1ZPSA 2AWTA 1C79A 2XEWA 2MJ3A 3EGRA 1WYGA 4KSLC 2MX2A 4RGTA 1LGRA 3WAOA 4NAWB 4FJZA 3ZXVA 2W3SA 4K7SA 2FCNA 1E8WA 2GMIC 2CU3A 1PQSA 4MGZE 2G3QB 5EE9A 4B0EA 3U4EG 4CO7A 4JWSC 4IM3A 1JRPA 4XDCA 1CQVA 2Y5PA 3DWMA 3N3KB 2DAJA 4BKSA 4AJWA 1P98A 4ZHOA 1D5MC 3Q3FA 4XDDA 1D5XC 3Q8BA 5G5GA 2KLGA 2K9XA 4WQMA 2MJDA 1AWDA 4TMAB 1P3QU 2ON8A 1K53A 4DWFA 4GDLA 4ZYNA 3U52E 5D2MB 3LYYA 1AARA 2KQ7A 3URYA 2IGDA 4ARIA 3NRZA 3KUZA 2LXAA 2WDQB 4FJYA 1LM8B 3OLMD 2IO2B 2RDBC 1WRIA 2WDTB 1KF6B 3BVMA 3BZDB 3DBHB 3VUXA 1TKYA 1BXTA 2IZVB 2BKRB 1SIFA 1YQ3B 3A9KB 3RZFA 3MC9A 1V5OA 4YXDB 1NENB 5D6JB 3IXSA 3Q3OC 3TSSA 1UBQA 1ZKHA 3AE3B 1KLUD 4IC7B 5HKHA 3O13A 3TIXA 2KAJA 4MELA 3ZNZB 4MM3B 3TEYA 4HROA 4KZ0A 2KN5A 2XNAC 4PS3A 4BKSD 2Z0DB 2KN4A 3BWUD 2FUHB 3T3NA 4KV2A 3B08A 4HWIB 4XZ4A 2BYEA 1ZE3D 5D7GA 2HJ1A 3RFZB 3P4SB 1I4HA 1S1QB 1NYRA 3N1YC 5C3JB 2NBVB 3TUOA 5BYSA 5J18A 5FR3A 2LASA 3ZO5B 1PYWD 2QILA 3Q14C 3V05A 2R2OA 4IWQA 1IGDA 4WWPA 5BYRA 3C0RB 4WWMA 3ZJTA 4GDLB 2B76B 4DXFA 3V61A 1E0ZA 4LCDE 2C5LC 4OW0A 1C4AA 4FADA 2EKIA 4ZRIA 4K7UA 1SE2A 2KMMA 1R4NI 2Z0EB 2G4DB 1XLQA 1WSPA 4MH8A 3WA0A 4M02A 2WYQA 3NVZA 4AS1A 4REZA 3VQIA 2MSED 1BUIC 3RNFC 1MG8A 1HZ5A 2RDGA 2RMMA 4FBJB 4EE2A 1XO3A 3VTUA 4JPSA 4GMVA 1FMAD 1WY8A 1UD7A 2GBKA 3NJTA 2L8JA 3HRDD 1J7BA 2PPHA 3AN1A 1K50A 3H9DA 4EOYA 1C3TA 1FXAA 1GOZA 2PE6B 5JHAA 3U8ZA 3IAM1 3E9SA 4II2B 3GZNI 2EKEC 4WURA 1WJUA 5IA7A 5AZGA 2DX5B 3KQ4A 4OVVA 3L16A 2L32A 2JX5A 4G0NB 4R3DA 3ZNHB 5IP4D 4KVGB 1L4DB 1WF9A 4DXGA 1B1ZA 2A4ZA 4B0MA 4WJQA 3H6NA 4PT5A 2WNMA 4EUTA 1KRHA 3BK2A 2FCQA 1WXSA 3V60A 5I4DA 1C76A 1N6ZA 2MHJA 2D3AA 1FCLA 2ZCBA 1OTRB 4LJOB 1QT9A 1LO5D 2FNJB 4GOCA 3PO0A 4FJVB 5E6OA 3H7PB 2M8SA 1IUEA 3VDZA 2KO3A 4WWNA 2LHDA 1HQRD 2VZKB 2W82A 4HJKA 4W9IA 1YQBA 2LEKA 5JXVA 2I38A 3DQVA 4WJPA 4XWWA 4S17A 4TQ0A 2GRIA 1LXDA 4JWUC 1ACCA 5DCNA 2I2YA 2KQSA 3TBLD 3I9V1 4M8NA 1K52A 3DBLI 2RPVA 1TS4A 2O6VD 2JRHA 1F1HA 2E6XA 2YLMA 5G5HA 2K22A 4EFOA 2KTRB 4HEA1 2M17A 3VH3B 3SFEB 1FEHA 2MLBA 2IPKD 1T3QA 3ZDMC 1EM7A 3BINA 2WS3B 5J17A 2LUMA 2KYWA 4P1BC 3KUDB 4NAMA 2MQJA 4IKGA 2ICIA 2J7QB 1JRUA 3NHEB 1M94A 2J0KA 4GDKA 3RZWC 2PTLA 3SD5A 1NEKB 3VUYA 4RM9A 4IW0A 2JXXA 2AQ2B 3AE4B 2J42A 1WXQA 3DVGX 4KIKA 2X38A 1B9RA 2LHEA 3A1QB 4RNAA 2KDBA 2V1YA 1SB3C 3NZUA 1YNTE 3WIMA 2CS4A 4OVUA 3DVNV 1UF0A 3M62B 4W9KA 3RNBC 1XEEA 2OJWA 4LLGM 1TYGB 3AE1B 3MP9A 3X0WA 2KANA 5C23A 3MHZA 3MJWA 3U7DA 4W9DA 4O1NA 2GBMA 3ZGZA 2V3SA 4IM2A 4ZDVA 3M3JA 3W1YA 2M19A 5BMIA 2WXQA 2OJRA 3RYTA 3HK0A 3N1XC 4LNOA 1EU4A 1NYQA 2M4NA 3DBHI 5LXIB 3ZJVA 1EF1A 3A9JB 1UBIA 2A5UA 4B95A 3PRPB 2Y5BB 3AE2B 4KIKB 3KYDD 3B0AA 4MEMA 2MP2B 2KTFA 4EEWA 3LDZE 3RNAC 2FBWB 3NVVA 4BKGA 4GU2A 2WXKA 1SBBB 3UF8A 1T0YA 2KFJA 3IHPC 4XYCA 1MHHE 2X8XX 3AXCA 3TJPA 4MGIE 2AX5A 2JF5A 4ICVA 3AE6B 5E6JA 1WGGA 1F9JA 2HE7A 4GIVA 1ZXHA 2WXGA 2WXFA 5EE0A 2RD0A 3RPFC 2BPSA 1WRDB 5TR5A 1I4XA 1WZ3A 2Z59B 1RWSA 1SF0A 3VRBB 3ZTCA 4DQOC 3U7ZA 3WALA 2QEJC 1V1PA 3A4SC 1JWSD 4BZAA 4MJSB 3ZRFA 5AUIA 2SAKA 1ZDXA 4A6QA 1I4GA 4RFBA 4HK2A 1EWCA 4OHJA 2WLBA 1YN4A 1QKZA 2M56B 2KDEB 1GB1A 2ASQA 2C60A 4GB9A 1YX5B 2REXA 2WXLA 2H89B 1OQQA 2GB1A 4HPMB 5TSSA 4S0RA 4IWPA 1WGHA 4K1RB 4FHJA 2KMCA 3PT2B 1DOYA 1SJED 4II3B 4KGRA 4MM3A 1MFWA 2VH2A 3DHGC 1L6UA 4MJSA 2HJ8A 4AQ7A 1SEBD 3SFDB 1TY2A 1L6VA 2IBIB 1UZXB 1VCBA 4PS7A 1WM3A 1CJEA 2NPTA 3GOEA 1E7VA 1TT5B 3QIJA 1OEYA 3KLSX 2GI9A 1TZ1A 2BS3B 2BYFA 3H7PA 2NTTA 2PW9A 4DDID 5AZFA 3PHXB 2GBJA 1FRDA 5DPRA 4MH0E 1WR1A 1S3SG 3OG5A 4I6LB 2DYMA 1T0RC 4NQLB 5GMVA 3QQ8B 1FFVA 2RGFA 3D32A 2IDYA 1TS5A 1EO6A 2DZIA 2LJIA 2ONQA 3HVZA 4F1SA 1NVID 3L4PA 1WX9A 4XC2A 4NJCA 2Y3AA 2KJRA 3L54A 3VR8B 3PZ7A 5AZHA 4A9AA 1VRAB 3AECB 1SSNA 4JE3B 2NBUA 5FR6A 1JMLA 1C78A 3RN9C 3A9KA 2KK8A 2WXIA 4FN2A 3HIZA 4I6NB 1Q10A 3A9JA 3P63A 3ABVB 3UQAA 2LJ5A 2HDEA 2AL6A 3L08A 2PKOA 3L17A 1STEA 3VH4B 3QHTA 2V3NA 3GS2A 1UGJA 2K6DB 2KFKA 4BAXA 1YN3A 1P9DU 3PGEA 3M63B 2LXCA 3AE9B 4ZRJA 4GLSC 3NVWA 3WANA 1V1PB 3DBRB 4JLCA 4G11A 1J8CA 1KLGD 3NVYA 1TS2A 2OOBB 2PJHA 4BVUC 4W9GA 2K8HA 2NMQA 2INCC 3N32A 1FFUA 4N58A 4W9FA 1SIJA 1WFYA 4KGSA 2PVOD 1WYWB 5E6NA 4FULA 2VRRB 3IT4B 2M1MA 2ZW1A 4HPLB 1WH3A 2Y5CA 2YVCA 1D5ZC 3H7SA 2CU1A 3SEBA 1UWXA 3C19A 3HVDA 2BBCA 4IUMB 4P6VF 5LLIA 2ZW0A 2YEPF 5LXHA 2NS5A 1YIWA 2W9NA 2D3GA 5JZEB 3A4RA 2K0PA 3ZNGC 1VD2A 3MC8A 2LGIA 4JIOU 4DHZB 1I42A 1KTKA 1PFDA 2ZVOA 4MT5A 2V0GA 4ITKA 4M00A 2L3ZA 1ZW7A 2EMTA 3U30A 1GC7A 2M0XA 4NJ7A 1YQ4B 3N9YC 1TBEA 4HJGE 3ZNID 3Q6BA 5HHDG 2DWQA 4CYEA 1XCTL 1N5WA 4TQ1A 3AEAB 1FIQA 3GZNB 1QQRA 2O2VA 4G3XB 3MC0B 4GSWA 3DOWA 1YMHE 1WGDA 2JSVX 1WJ6A 4ANVA 2JRIB 2KT7A 2KX3A 4XWTA 3QJZA 3EECA 4AJYB 1T0QC 2GBRA 3SR6A 1FM0D 3KWLA 3RUIB 3MJ5A 1RFKA 1E9MA 2N1VA 2RSUA 4M0WA 3P1MA 3M95A 3CF6E 4LNIA 5T8IA 3APDA 4KKIA 4HDQA 3IT6B 3RNGC 3AH7A 3KYCD 1Y56A 3OAWA 2MBHA 3PS6A 1V6EA 2E3TA 3PRMB 4HKZE 1JWBD 1XT9B 1AN8A 5CX3A 2FCMA 2BB6A 2H88B 1Z2MA 1KLVA 3SU8X 3CSTA 2DZMA 2KMAA 2QIEB 3MHSD 2HTHA 4PYUA 3V6EB 2N7DA 2BQQA 1EF5A 1MHXA 3JSVB 1FO4A 2K8CA 3ZW3A 2LWPA 3Q8CA 4AWJA 4USAA 1WGRA 1HE8A 1NBFC 5EDSA 1ZDVA 2Q5WD 1YJ1A 2N0SB 2N1WA 2PIAA 1JWMD 3GP7A 3QWZB 1L0XB 3MFGA 1UNSA 2K25A 2AL3A 2M0AA 4P7IA 3A1QA 4MDKE 3T9LA 1V86A 1FXTB 3ML8A 2BB5A 1V8CA 4C4VB 2MBEA 2RDHA 1FD6A 4LNKA 2G45B 3T8MA 3L13A 5CHWA 4F7ZA 1AYFA 2N9LA 2FIDA 5EE1A 4AUQC 2LGXA 3AEGB 5AUKA 1R7SA 3KH0A 4LNFA 1Q5WB 2O2VB 3R66C 2KDFB 2LI5A 2ACZB 3GE3C 1L2NA 1X1MA 4WIPA 2D3BA 1E8XA 3S2AA 1I4PA 3PSEB 3B2FA 3BYYB 4IG7B 1Y8RC 4ANUA 1XCQL 1FXIA 4K81A 2BWFA 3I5JC 4LTUA 1IYFA 4B6WA 3GE8C 1MI0A 2NBWB 1WE6A 1SJHD 3EFCA 3TEZA 4W9CA 1D6EC 3EHVA 4XE0A 2MH7A 2G9HD 4DBGA 5G2NA 1H8CA 1WJNA 1V2YA 1WE7A 3QCAA 2QHOA 1YJJA 1PUTA 3PV1A 1YOVB 2V4IB 2CKHB 2KLCA 3NY5A 1CZPA 2QCZA 4A55A 2PVGC 2ZVNA 4RF0A 2PLPA 3LJ3A 4OZCA 4WAFA 3OJ3A 4FLHA 1N60A 1QILA 2DYBA 5HG2A 4RM8A 4TKNA 2FUG1 2J52A 1UGMA 2KX0A 3AV8A 1N61A 2ZNVB 3CIRB 2WGSA 2ZCCA 2KJHB 1JCKB 1UWMA 2WDRB 4HDOA 2BS2B 2DHZA 5FK9C 3ZLZA 3ZQ4A 1UH6A 4NPNA 3EFUA 4NNJB 2L83A 2JT4B 3IAS1 2DYOA 1J7AA 2LZ6A 1WGKA 3W5VB 3Q3JA 4QAYA 2INNE 2EMSA 3TCAA 1JROA 2LRUA 2KWDA 1OEYJ 1QZEA 3V6CB 5D3IB 1VJKA 1D4BA 2MJEA 1WMHB 2PEAA 3RCZA 1Q0WB 1K51A 3PRZA 4XGAB 2IY0B 3UGBB 4EZLA 3VXWA 2V9HA 1P0RA 4W9LA 1JWUD 2YEPB 1Q1OA 2WXNA 2KDIA 4BBNC 1RM6C 1WMHA 2L05A 1V5TA 4MACA 4WQOB 2J4XA 2BYTA 1SE4A 3CSFA 4JGHB 4NQKE 4MGYE 4LJPB 2NVUI 4UDUC 3RMKC 2PMVA 2W54A 1E8ZA 2KDMA 2KWUB 3QX1A 4PK1A 1L0VB 3KWVA 3C8YA 4LDTB 1L0YB 3NZ3A 3W1SA 3AU4A 1E7PB 3B9JA 1WXVA 5MPOA 3P4PB 3BVZA 2JPHA 4E71A 3W2DA 2JXTA 1XQQA 1GJZA 1IBXB 1HTOA 3J9CA 5CTRC 2WU5B 1PGXA 5CHVC 4J6IA 2IO0B 2UYZB 1WX7A 2Z8LA 2WXMA 1D3ZA 3QK0A 4PS8A 2DNFA 3FAHA 1KJTA 2JY6A 2QMTA 1MVKA 3U2SC 1VLBA 2KOXA 2W3RA 2LVQA 1N62A 3VHTC 4C7ZA 4DHJB 4C7YA 2KQ4X 4K3CA 1WR6E 1KOTA 4WJOA 4LDTD 1TGZB 2VZKD 3WAMA 4D2KA 4HVBA 2LD9A 4HPPA 5DPTA 1T0SC 1BT0A 1HEZE 3ETRA 5H92C 5BO4B 4YTMB 2KVRA 1OGWA
chains in the Genus database with same CATH topology
2L76A 1WM2A 2MP2A 4OVVA 3ZKJC 4DK5A 3L16A 3PZDA 4JLCA 1V80A 2JVCA 4G11A 4BKTA 1U4AA 4G0NB 1J8CA 3KW5B 3ZNHB 3HHMA 1V9JA 2MCNB 4KVGB 3H1UA 1WF9A 2AEHA 2OOBB 4FHKA 4YL8A 3K9OB 2A4ZA 2PJHA 4BVUC 4W9JA 4W9GA 2K8HA 3N32A 3R7RA 4B9KA 3JW0X 4W9FA 4WJQA 3AU5A 4DHZE 3H6NA 1WFYA 4EUTA 5E6NA 1WYWB 4FULA 4MSMB 2ZEQA 2VRRB 2M1MA 2FCQA 3QA8A 1WXSA 2K39A 2RPQA 3V60A 4HPLB 1WH3A 4JQWC 2YVCA 3APCA 3H7SA 2CU1A 3QC8B 4BOSC 2JZ3B 2ZCBA 2MBOA 2WWZA 3AULA 1OTRB 4LJOB 1L7YA 3BY4B 4IUMB 5LLIA 2FNJB 3PLVA 5AEKB 4GOCA 5LXHA 2MRPA 3VFKA 2NS5A 1YIWA 2W9NA 1IP9A 2D3GA 3ZIMA 2DZKA 1GNUA 4FJVB 5E6OA 3A4RA 3N30A 3H7PB 1CMXB 1VD2A 3ZNGC 5JZEB 2M8SA 4E3CA 3PLUA 4JIOU 1V49A 4WWOA 4DHZB 2BYVE 1E7UA 1V81A 1I42A 2ZVOA 2I1KA 4URKA 3VDZA 2KO3A 3B1LX 3ALBA 2FIFA 2L3ZA 2HD5B 4WWNA 1ZW7A 2EMTA 3U30A 4KZCA 4HJKA 3SHQA 1GC7A 1GC6A 2M0XA 4W9IA 1WIAA 4NJ7A 1YQBA 1LFDA 2L0FA 2RR9A 4RMAA 3DQVA 4WJPA 2MBBB 2WX0A 3DBRI 4TQ0A 2DAFA 1TBEA 1LXDA 4ANWA 3NZSA 4XX5A 3ZNID 2XK5A 3R7QA 5DCNA 2O6VB 2JUOA 4M0WB 2GBNA 1KM7A 2KQSA 3PTFC 3K9PB 4KDLB 3DVGY 2C9WB 3DBSA 3TBLD 2MWSB 2WX1A 4M8NA 2XBBC 2DENB 3VUWA 2KXJA 3DBLI 4ASWC 3A33B 4CYEA 3TMPB 4TQ1A 3OJ4B 2O6VD 2JRHA 2YLMA 4HCPB 4JL9A 2O2VA 4G3XB 5DPWA 1YX6B 4GSWA 4EFOA 3DOWA 2KTRB 1E5WA 2M17A 3VH3B 4NAWA 4W9EA 5C1ZA 4GN1A 2MLBA 5G55A 5E6PA 1WGDA 3ZDMC 1WJ6A 4ANVA 4TUUA 3ZUNA 2JRIB 4EZJA 3BINA 2I1JA 5J17A 3EC8A 3KUDB 4WJNA 2KX3A 3QJZA 2C7HA 3EECA 3UINB 2N9EB 2K1FA 1RLFA 2MQJA 4AJYB 1YD8U 2JWZA 1ISNA 2J7QB 3ZRCA 1JRUA 1J19A 3NHEB 3RT3B 3VTVA 1M94A 2GBRA 2J0KA 4GDKA 3AI5A 3RZWC 3PHWB 1RRBA 1WXAA 3MTNB 2DX5B 3IG3A 3IVFA 3SD5A 1XD3B 3VUYA 4E74A 4DDGD 4RM9A 1ZGUB 4IW0A 2JXXA 5CHFA 4N9F4 3IBEA 3RUIB 3KUCB 4IWOA 2CR5A 4F8CB 2LGDA 2LUEA 3ECIA 5D94A 3HM3A 2R2QA 3TL5A 2FCSA 1H4RA 2JZZA 3DVGX 4KIKA 2LRWA 2N1VA 2RSUA 3A1QB 2LVPA 1WI0A 2KDBA 3M95A 2V1YA 3CF6E 1K8RB 2KWCA 3NZUA 4MGKE 2ZZPB 1WGYA 3APDA 3JYUA 4M8MA 4I6PA 1SE9A 2C7NB 4HDQA 2CS4A 3PPAA 3WIMA 1R4MI 3VTWA 3KYCD 4OVUA 3DVNV 3OAWA 2MBHA 3PS6A 3M62B 4GXBA 1EUVB 4W9KA 1V6EA 1SGHA 3PRMB 3QAQA 2MA9B 4A3PA 1XT9B 2FAZA 2K6QA 3IFWB 3UIOB 5CX3A 2FCMA 2UWQA 5JHBA 4X57B 1Z2MA 3X0WA 1WZ0A 2KANA 3JSVA 1KLVA 3CMMB 2XK5B 5C23A 2IO1B 2N4FA 3SU8X 4BOZB 3CSTA 3MJWA 3L10B 2KWVB 3U7DA 4ANXA 2DZMA 2KMAA 4W9DA 2GBMA 3MHSD 2BF8B 2V3SA 4IM2A 1C1YB 2NCNA 2HTHA 4G50A 4PYUA 4CHKA 4ZDVA 2PE9A 3M3JA 3V6EB 3O65B 4KSKC 2N7DA 3WAPA 1NI2A 3W1YA 1EF5A 3JSVB 2KTRA 2NR2A 2OJRA 2KZRA 2K8CA 3RD2A 3RYTA 2D10A 1Z5SB 2KFKB 2ZPNA 3HK0A 3ZW3A 3QARA 5L83A 2LWPA 1J0GA 4AWJA 4GGQA 2N9PC 1WGRA 1HE8A 1NBFC 3UQBA 5EDSA 1G6JA 2ZJDA 3ML9A 1YJ1A 2BKFA 5KHQA 1LQBA 2N1WA 3WANA 3RULA 2GOWA 3NOBA 3QWZB 2M4NA 3DBHI 2K25A 5LXIB 2MW5A 2KJ6A 2AL3A 4GDKB 1EF1A 3A9JB 1UBIA 3KVFB 3HM6X 2J0JA 2A5UA 2DZJA 2BWES 3JVZX 3L0WB 1WX8A 4B95A 3PRPB 4P7IA 2O6VA 3ZVVA 2Y5BB 4NJ6A 3A1QA 4MDKE 4KDIC 2KC1A 4KIKB 3T9LA 3KYDD 2D11A 1V86A 3PVLA 4BBNF 2AWTA 3B0AA 1FXTB 3ML8A 1OQYA 2MBEA 2XEWA 2G45B 4KSLC 4MEMA 2MP2B 2KTFA 2MX2A 3L13A 3T8MA 5CHWA 1A5RA 4F7ZA 4EEWA 1E8YA 3LDZE 2K8BA 2KNBA 2ZNVC 3WAOA 2FIDA 4NAWB 4AUQC 2LGXA 4FJZA 2KD0A 3R3MA 4BKGA 3KH0A 4GU2A 1GUAB 1Q5WB 3DDCB 4K7SA 4NY0A 2O2VB 3R66C 3UF8A 1T0YA 2FCNA 2KDFB 2KFJA 2LI5A 1E8WA 2GMIC 1L2NA 1X1MA 3IHPC 5DPSA 1PQSA 3AXCA 1E8XA 3S2AA 3TJPA 4MGIE 2JF5A 4ICVA 3PSEB 2G3QB 4MGZE 5KHOA 4CO7A 1WGGA 2CHWA 1F9JA 4IG7B 1Y8RC 4ANUA 4AOFA 2N7EA 4K81A 4IM3A 2BWFA 2HE7A 1IYFA 3X23A 4B6WA 2NBWB 4GIVA 2CHZA 4ICUA 2IY1B 1WE6A 3N3KB 2DAJA 2MBQA 4BKSA 4AJWA 1P98A 4W9CA 3EHVA 3Q3FA 4PYZA 2RD0A 3DPDA 4DBGA 4DXAB 5G2NA 1H8CA 2L0TA 4MSQB 2BPSA 1WJNA 1V2YA 2KLGA 1WRDB 1WE7A 3QCAA 2QHOA 5TR5A 4DHJD 1WZ3A 2Z59B 3PV1A 4IM0A 3ZDTA 2CKHB 1P3QU 1UELA 2KLCA 3ONSA 4FA6A 3NY5A 3ZTCA 4EZKA 4DWFA 4GDLA 4A20A 4ZYNA 2ZVNA 5JH5C 3LJ3A 3WALA 5D2MB 1AARA 3I3TB 2KQ7A 3A4SC 3OJ3A 4FLHA 2DYBA 4RM8A 4TKNA 3KUZA 2KC2A 4MJSB 1UGMA 2KX0A 2CHXA 3ZRFA 2ZNVB 5IAAC 5L95C 2LXAA 2ZCCA 2KJHB 4HK2A 4FJYA 4HDOA 2DHZA 1LM8B 3OLMD 4HXDA 2IO2B 3ZLZA 2KDEB 2KKCA 2ASQA 1UH6A 2AYOB 2WDTB 3EFUA 4NNJB 2C60A 4GB9A 4NPNA 1YX5B 2JT4B 2REXA 2DYOA 2LZ6A 3Q3JA 3VUXA 4HPMB 4WAAA 4EKUA 4IWPA 1WGHA 3PT2B 4FHJA 2EMSA 2IZVB 2KMCA 2BKRB 4K1RB 3TCAA 3ZTDA 2LRUA 1SIFA 2N9XA 1OEYJ 1QZEA 4II3B 3V6CB 3A9KB 3RZFA 2D2QA 4MM3A 1RFAA 1WMHB 2PEAA 3W1SC 1V5OA 5D6JB 4MJSA 3RCZA 2C7MB 2HJ8A 2LVOA 1Q0WB 1UBQA 3PRZA 3UGBB 2IY0B 4EZLA 3VXWA 3UIPB 1IPGA 2IBIB 1ZKHA 1UZXB 1VCBA 1P0RA 4W9LA 3V62A 1Q1OA 3PREA 4PS7A 2KDIA 4IC7B 3DVNU 2IO3B 3P2BA 4BBNC 3TIXA 5HKHA 1WM3A 1WMHA 2NPTA 4MELA 3ZNZB 3GOEA 1E7VA 1I35A 2L05A 4KZ0A 1V5TA 4WQOB 2KN5A 2L00B 3QIJA 1OEYA 2G4SA 4PS3A 2IYDB 4BKSD 1TZ1A 3CSFA 2Z0DB 4JGHB 4NQKE 4MGYE 4LJPB 2NVUI 2FUHB 2BYFA 3H7PA 4KV2A 3B08A 4HWIB 4XZ4A 2BYEA 1E8ZA 4DDID 5D7GA 2KWUB 1S1QB 5AZFA 3PHXB 2GBJA 2V4LA 3QX1A 5DPRA 2NBVB 4MH0E 4ZRKA 3APFA 1WR1A 1RAXA 1S3SG 5J18A 4LDTB 2LASA 4BFRA 4I6LB 3ZO5B 4K7WA 1WJ4A 2DYMA 3W1SA 3AU4A 1WXVA 2B3AA 4NQLB 5GMVA 3QQ8B 2JPHA 4E71A 2D07B 2RGFA 2R2OA 3D32A 4IWQA 4WWPA 3VAWA 2LGYA 3C0RB 1TTNA 4HCNB 2KHWB 1EO6A 4GDLB 2DZIA 3V61A 4LCDE 2C5LC 1XQQA 4FADA 1GJZA 4ZRIA 2L7RA 4F1SA 5CTRC 1WX9A 4K7UA 4XC2A 1R4NI 2Z0EB 5CHVC 4J6IA 2G4DB 2IO0B 2KJRA 1E90A 3WA0A 2UYZB 1WX7A 2WYQA 3L54A 1D3ZA 1WXMA 3QK0A 4PS8A 5AZHA 3SDLC 4W9HA 3VQIA 2MSED 1NDDA 5J2RA 1MG8A 1KJTA 2JY6A 3NS8A 4FBJB 4TV3A 2NBUA 3VTUA 3VVWB 4GMVA 1WY8A 5FR6A 4AP4C 1UD7A 2GBKA 2L8JA 2KOXA 2PPHA 2LVQA 2ZPYA 2KK8A 3A9KA 3H9DA 4EOYA 3VHTC 4DHJB 1C3TA 2BGFA 3DCGA 3HIZA 4FN2A 4I6NB 3A9JA 2PE6B 5JHAA 1WR6E 1GG3A 3U8ZA 3UQAA 1KOTA 2LJ5A 4WJOA 4LDTD 1TGZB 2AL6A 4II2B 3WAMA 3GZNI 3L08A 2EKEC 4HVBA 4HLEA 2J0MA 3ENEA 3L17A 3VH4B 2LD9A 3QHTA 5DPTA 1WJUA 1BT0A 2K6DB 2KFKA 5BO4B 4A3OA 1P9DU 2NPTB 3PGEA 3M63B 5IA7A 1P1AA 2LXCA 4ZRJA 5AZGA 2KVRA 1OGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L76 A;  1WM2 A;  2MP2 A;  4OVV A;  3ZKJ C;  4DK5 A;  3L16 A;  3PZD A;  4JLC A;  1V80 A;  2JVC A;  4G11 A;  4BKT A;  1U4A A;  4G0N B;  1J8C A;  3KW5 B;  3ZNH B;  3HHM A;  1V9J A;  2MCN B;  4KVG B;  3H1U A;  1WF9 A;  2AEH A;  2OOB B;  4FHK A;  4YL8 A;  3K9O B;  2A4Z A;  2PJH A;  4BVU C;  4W9J A;  4W9G A;  2K8H A;  3N32 A;  3R7R A;  4B9K A;  3JW0 X;  4W9F A;  4WJQ A;  3AU5 A;  4DHZ E;  3H6N A;  1WFY A;  4EUT A;  5E6N A;  1WYW B;  4FUL A;  4MSM B;  2ZEQ A;  2VRR B;  2M1M A;  2FCQ A;  3QA8 A;  1WXS A;  2K39 A;  2RPQ A;  3V60 A;  4HPL B;  1WH3 A;  4JQW C;  2YVC A;  3APC A;  3H7S A;  2CU1 A;  3QC8 B;  4BOS C;  2JZ3 B;  2ZCB A;  2MBO A;  2WWZ A;  3AUL A;  1OTR B;  4LJO B;  1L7Y A;  3BY4 B;  4IUM B;  5LLI A;  2FNJ B;  3PLV A;  5AEK B;  4GOC A;  5LXH A;  2MRP A;  3VFK A;  2NS5 A;  1YIW A;  2W9N A;  1IP9 A;  2D3G A;  3ZIM A;  2DZK A;  1GNU A;  4FJV B;  5E6O A;  3A4R A;  3N30 A;  3H7P B;  1CMX B;  1VD2 A;  3ZNG C;  5JZE B;  2M8S A;  4E3C A;  3PLU A;  4JIO U;  1V49 A;  4WWO A;  4DHZ B;  2BYV E;  1E7U A;  1V81 A;  1I42 A;  2ZVO A;  2I1K A;  4URK A;  3VDZ A;  2KO3 A;  3B1L X;  3ALB A;  2FIF A;  2L3Z A;  2HD5 B;  4WWN A;  1ZW7 A;  2EMT A;  3U30 A;  4KZC A;  4HJK A;  3SHQ A;  1GC7 A;  1GC6 A;  2M0X A;  4W9I A;  1WIA A;  4NJ7 A;  1YQB A;  1LFD A;  2L0F A;  2RR9 A;  4RMA A;  3DQV A;  4WJP A;  2MBB B;  2WX0 A;  3DBR I;  4TQ0 A;  2DAF A;  1TBE A;  1LXD A;  4ANW A;  3NZS A;  4XX5 A;  3ZNI D;  2XK5 A;  3R7Q A;  5DCN A;  2O6V B;  2JUO A;  4M0W B;  2GBN A;  1KM7 A;  2KQS A;  3PTF C;  3K9P B;  4KDL B;  3DVG Y;  2C9W B;  3DBS A;  3TBL D;  2MWS B;  2WX1 A;  4M8N A;  2XBB C;  2DEN B;  3VUW A;  2KXJ A;  3DBL I;  4ASW C;  3A33 B;  4CYE A;  3TMP B;  4TQ1 A;  3OJ4 B;  2O6V D;  2JRH A;  2YLM A;  4HCP B;  4JL9 A;  2O2V A;  4G3X B;  5DPW A;  1YX6 B;  4GSW A;  4EFO A;  3DOW A;  2KTR B;  1E5W A;  2M17 A;  3VH3 B;  4NAW A;  4W9E A;  5C1Z A;  4GN1 A;  2MLB A;  5G55 A;  5E6P A;  1WGD A;  3ZDM C;  1WJ6 A;  4ANV A;  4TUU A;  3ZUN A;  2JRI B;  4EZJ A;  3BIN A;  2I1J A;  5J17 A;  3EC8 A;  3KUD B;  4WJN A;  2KX3 A;  3QJZ A;  2C7H A;  3EEC A;  3UIN B;  2N9E B;  2K1F A;  1RLF A;  2MQJ A;  4AJY B;  1YD8 U;  2JWZ A;  1ISN A;  2J7Q B;  3ZRC A;  1JRU A;  1J19 A;  3NHE B;  3RT3 B;  3VTV A;  1M94 A;  2GBR A;  2J0K A;  4GDK A;  3AI5 A;  3RZW C;  3PHW B;  1RRB A;  1WXA A;  3MTN B;  2DX5 B;  3IG3 A;  3IVF A;  3SD5 A;  1XD3 B;  3VUY A;  4E74 A;  4DDG D;  4RM9 A;  1ZGU B;  4IW0 A;  2JXX A;  5CHF A;  4N9F 4;  3IBE A;  3RUI B;  3KUC B;  4IWO A;  2CR5 A;  4F8C B;  2LGD A;  2LUE A;  3ECI A;  5D94 A;  3HM3 A;  2R2Q A;  3TL5 A;  2FCS A;  1H4R A;  2JZZ A;  3DVG X;  4KIK A;  2LRW A;  2N1V A;  2RSU A;  3A1Q B;  2LVP A;  1WI0 A;  2KDB A;  3M95 A;  2V1Y A;  3CF6 E;  1K8R B;  2KWC A;  3NZU A;  4MGK E;  2ZZP B;  1WGY A;  3APD A;  3JYU A;  4M8M A;  4I6P A;  1SE9 A;  2C7N B;  4HDQ A;  2CS4 A;  3PPA A;  3WIM A;  1R4M I;  3VTW A;  3KYC D;  4OVU A;  3DVN V;  3OAW A;  2MBH A;  3PS6 A;  3M62 B;  4GXB A;  1EUV B;  4W9K A;  1V6E A;  1SGH A;  3PRM B;  3QAQ A;  2MA9 B;  4A3P A;  1XT9 B;  2FAZ A;  2K6Q A;  3IFW B;  3UIO B;  5CX3 A;  2FCM A;  2UWQ A;  5JHB A;  4X57 B;  1Z2M A;  3X0W A;  1WZ0 A;  2KAN A;  3JSV A;  1KLV A;  3CMM B;  2XK5 B;  5C23 A;  2IO1 B;  2N4F A;  3SU8 X;  4BOZ B;  3CST A;  3MJW A;  3L10 B;  2KWV B;  3U7D A;  4ANX A;  2DZM A;  2KMA A;  4W9D A;  2GBM A;  3MHS D;  2BF8 B;  2V3S A;  4IM2 A;  1C1Y B;  2NCN A;  2HTH A;  4G50 A;  4PYU A;  4CHK A;  4ZDV A;  2PE9 A;  3M3J A;  3V6E B;  3O65 B;  4KSK C;  2N7D A;  3WAP A;  1NI2 A;  3W1Y A;  1EF5 A;  3JSV B;  2KTR A;  2NR2 A;  2OJR A;  2KZR A;  2K8C A;  3RD2 A;  3RYT A;  2D10 A;  1Z5S B;  2KFK B;  2ZPN A;  3HK0 A;  3ZW3 A;  3QAR A;  5L83 A;  2LWP A;  1J0G A;  4AWJ A;  4GGQ A;  2N9P C;  1WGR A;  1HE8 A;  1NBF C;  3UQB A;  5EDS A;  1G6J A;  2ZJD A;  3ML9 A;  1YJ1 A;  2BKF A;  5KHQ A;  1LQB A;  2N1W A;  3WAN A;  3RUL A;  2GOW A;  3NOB A;  3QWZ B;  2M4N A;  3DBH I;  2K25 A;  5LXI B;  2MW5 A;  2KJ6 A;  2AL3 A;  4GDK B;  1EF1 A;  3A9J B;  1UBI A;  3KVF B;  3HM6 X;  2J0J A;  2A5U A;  2DZJ A;  2BWE S;  3JVZ X;  3L0W B;  1WX8 A;  4B95 A;  3PRP B;  4P7I A;  2O6V A;  3ZVV A;  2Y5B B;  4NJ6 A;  3A1Q A;  4MDK E;  4KDI C;  2KC1 A;  4KIK B;  3T9L A;  3KYD D;  2D11 A;  1V86 A;  3PVL A;  4BBN F;  2AWT A;  3B0A A;  1FXT B;  3ML8 A;  1OQY A;  2MBE A;  2XEW A;  2G45 B;  4KSL C;  4MEM A;  2MP2 B;  2KTF A;  2MX2 A;  3L13 A;  3T8M A;  5CHW A;  1A5R A;  4F7Z A;  4EEW A;  1E8Y A;  3LDZ E;  2K8B A;  2KNB A;  2ZNV C;  3WAO A;  2FID A;  4NAW B;  4AUQ C;  2LGX A;  4FJZ A;  2KD0 A;  3R3M A;  4BKG A;  3KH0 A;  4GU2 A;  1GUA B;  1Q5W B;  3DDC B;  4K7S A;  4NY0 A;  2O2V B;  3R66 C;  3UF8 A;  1T0Y A;  2FCN A;  2KDF B;  2KFJ A;  2LI5 A;  1E8W A;  2GMI C;  1L2N A;  1X1M A;  3IHP C;  5DPS A;  1PQS A;  3AXC A;  1E8X A;  3S2A A;  3TJP A;  4MGI E;  2JF5 A;  4ICV A;  3PSE B;  2G3Q B;  4MGZ E;  5KHO A;  4CO7 A;  1WGG A;  2CHW A;  1F9J A;  4IG7 B;  1Y8R C;  4ANU A;  4AOF A;  2N7E A;  4K81 A;  4IM3 A;  2BWF A;  2HE7 A;  1IYF A;  3X23 A;  4B6W A;  2NBW B;  4GIV A;  2CHZ A;  4ICU A;  2IY1 B;  1WE6 A;  3N3K B;  2DAJ A;  2MBQ A;  4BKS A;  4AJW A;  1P98 A;  4W9C A;  3EHV A;  3Q3F A;  4PYZ A;  2RD0 A;  3DPD A;  4DBG A;  4DXA B;  5G2N A;  1H8C A;  2L0T A;  4MSQ B;  2BPS A;  1WJN A;  1V2Y A;  2KLG A;  1WRD B;  1WE7 A;  3QCA A;  2QHO A;  5TR5 A;  4DHJ D;  1WZ3 A;  2Z59 B;  3PV1 A;  4IM0 A;  3ZDT A;  2CKH B;  1P3Q U;  1UEL A;  2KLC A;  3ONS A;  4FA6 A;  3NY5 A;  3ZTC A;  4EZK A;  4DWF A;  4GDL A;  4A20 A;  4ZYN A;  2ZVN A;  5JH5 C;  3LJ3 A;  3WAL A;  5D2M B;  1AAR A;  3I3T B;  2KQ7 A;  3A4S C;  3OJ3 A;  4FLH A;  2DYB A;  4RM8 A;  4TKN A;  3KUZ A;  2KC2 A;  4MJS B;  1UGM A;  2KX0 A;  2CHX A;  3ZRF A;  2ZNV B;  5IAA C;  5L95 C;  2LXA A;  2ZCC A;  2KJH B;  4HK2 A;  4FJY A;  4HDO A;  2DHZ A;  1LM8 B;  3OLM D;  4HXD A;  2IO2 B;  3ZLZ A;  2KDE B;  2KKC A;  2ASQ A;  1UH6 A;  2AYO B;  2WDT B;  3EFU A;  4NNJ B;  2C60 A;  4GB9 A;  4NPN A;  1YX5 B;  2JT4 B;  2REX A;  2DYO A;  2LZ6 A;  3Q3J A;  3VUX A;  4HPM B;  4WAA A;  4EKU A;  4IWP A;  1WGH A;  3PT2 B;  4FHJ A;  2EMS A;  2IZV B;  2KMC A;  2BKR B;  4K1R B;  3TCA A;  3ZTD A;  2LRU A;  1SIF A;  2N9X A;  1OEY J;  1QZE A;  4II3 B;  3V6C B;  3A9K B;  3RZF A;  2D2Q A;  4MM3 A;  1RFA A;  1WMH B;  2PEA A;  3W1S C;  1V5O A;  5D6J B;  4MJS A;  3RCZ A;  2C7M B;  2HJ8 A;  2LVO A;  1Q0W B;  1UBQ A;  3PRZ A;  3UGB B;  2IY0 B;  4EZL A;  3VXW A;  3UIP B;  1IPG A;  2IBI B;  1ZKH A;  1UZX B;  1VCB A;  1P0R A;  4W9L A;  3V62 A;  1Q1O A;  3PRE A;  4PS7 A;  2KDI A;  4IC7 B;  3DVN U;  2IO3 B;  3P2B A;  4BBN C;  3TIX A;  5HKH A;  1WM3 A;  1WMH A;  2NPT A;  4MEL A;  3ZNZ B;  3GOE A;  1E7V A;  1I35 A;  2L05 A;  4KZ0 A;  1V5T A;  4WQO B;  2KN5 A;  2L00 B;  3QIJ A;  1OEY A;  2G4S A;  4PS3 A;  2IYD B;  4BKS D;  1TZ1 A;  3CSF A;  2Z0D B;  4JGH B;  4NQK E;  4MGY E;  4LJP B;  2NVU I;  2FUH B;  2BYF A;  3H7P A;  4KV2 A;  3B08 A;  4HWI B;  4XZ4 A;  2BYE A;  1E8Z A;  4DDI D;  5D7G A;  2KWU B;  1S1Q B;  5AZF A;  3PHX B;  2GBJ A;  2V4L A;  3QX1 A;  5DPR A;  2NBV B;  4MH0 E;  4ZRK A;  3APF A;  1WR1 A;  1RAX A;  1S3S G;  5J18 A;  4LDT B;  2LAS A;  4BFR A;  4I6L B;  3ZO5 B;  4K7W A;  1WJ4 A;  2DYM A;  3W1S A;  3AU4 A;  1WXV A;  2B3A A;  4NQL B;  5GMV A;  3QQ8 B;  2JPH A;  4E71 A;  2D07 B;  2RGF A;  2R2O A;  3D32 A;  4IWQ A;  4WWP A;  3VAW A;  2LGY A;  3C0R B;  1TTN A;  4HCN B;  2KHW B;  1EO6 A;  4GDL B;  2DZI A;  3V61 A;  4LCD E;  2C5L C;  1XQQ A;  4FAD A;  1GJZ A;  4ZRI A;  2L7R A;  4F1S A;  5CTR C;  1WX9 A;  4K7U A;  4XC2 A;  1R4N I;  2Z0E B;  5CHV C;  4J6I A;  2G4D B;  2IO0 B;  2KJR A;  1E90 A;  3WA0 A;  2UYZ B;  1WX7 A;  2WYQ A;  3L54 A;  1D3Z A;  1WXM A;  3QK0 A;  4PS8 A;  5AZH A;  3SDL C;  4W9H A;  3VQI A;  2MSE D;  1NDD A;  5J2R A;  1MG8 A;  1KJT A;  2JY6 A;  3NS8 A;  4FBJ B;  4TV3 A;  2NBU A;  3VTU A;  3VVW B;  4GMV A;  1WY8 A;  5FR6 A;  4AP4 C;  1UD7 A;  2GBK A;  2L8J A;  2KOX A;  2PPH A;  2LVQ A;  2ZPY A;  2KK8 A;  3A9K A;  3H9D A;  4EOY A;  3VHT C;  4DHJ B;  1C3T A;  2BGF A;  3DCG A;  3HIZ A;  4FN2 A;  4I6N B;  3A9J A;  2PE6 B;  5JHA A;  1WR6 E;  1GG3 A;  3U8Z A;  3UQA A;  1KOT A;  2LJ5 A;  4WJO A;  4LDT D;  1TGZ B;  2AL6 A;  4II2 B;  3WAM A;  3GZN I;  3L08 A;  2EKE C;  4HVB A;  4HLE A;  2J0M A;  3ENE A;  3L17 A;  3VH4 B;  2LD9 A;  3QHT A;  5DPT A;  1WJU A;  1BT0 A;  2K6D B;  2KFK A;  5BO4 B;  4A3O A;  1P9D U;  2NPT B;  3PGE A;  3M63 B;  5IA7 A;  1P1A A;  2LXC A;  4ZRJ A;  5AZG A;  2KVR A;  1OGW A; 
#chains in the Genus database with same CATH topology
 1WM2 A;  3AE8 B;  4YSZ B;  3ZKJ C;  4DK5 A;  1V80 A;  2JVC A;  3ZYY X;  4ZOH C;  3WCQ A;  1BML C;  3HHM A;  4C80 A;  1V9J A;  4YT0 B;  2MCN B;  3H1U A;  1MG4 A;  4YL8 A;  3K9O B;  1KH0 A;  1IGC A;  1QOA A;  5D3D A;  2KVZ A;  3R7R A;  3JW0 X;  1ZXI A;  3BYT B;  3AU5 A;  1ENF A;  2ZEQ A;  1VDV A;  3QA8 A;  2K39 A;  2QDF A;  2RPQ A;  3VRA B;  1L5P A;  3FC4 A;  4RH6 A;  1FNV A;  2CJN A;  1N5X A;  3AB5 A;  2JZ3 B;  2MBO A;  4IDI A;  1I7H A;  3ZIM A;  3N30 A;  4P1C C;  3P4R B;  1C77 A;  5BYQ A;  3PLU A;  2OED A;  1V49 A;  2BYV E;  1E7U A;  2W55 A;  1JQ4 A;  3AM9 A;  2FIF A;  2R61 A;  2IND C;  1GC6 A;  2L0F A;  3Q8A A;  2WU2 B;  4RMA A;  1F2R I;  2MBB B;  2WX0 A;  4L23 A;  4ANW A;  3FIL A;  3NZS A;  4XX5 A;  3R7Q A;  2LMC A;  2O6V B;  2GBN A;  1KM7 A;  3PTF C;  3K9P B;  3DVG Y;  2MWS B;  3R2T A;  4OZB A;  3AMZ A;  3VUW A;  1MJD A;  4ASW C;  3A33 B;  4LK0 M;  3TMP B;  3OJ4 B;  4HCP B;  3NUH B;  3I63 C;  2AQ3 B;  1JAL A;  3DWG C;  1SXT A;  5DPW A;  3RI7 C;  2JYE A;  2WP9 B;  5BMG A;  4N6E B;  2LGS A;  4EZJ A;  2WXO A;  3EC8 A;  4WJN A;  1SE3 A;  3UIN B;  2OHF A;  2K1F A;  1RLF A;  2N9E B;  5GXG B;  1YD8 U;  3LXF A;  4A90 A;  2N9K A;  3AI5 A;  3PHW B;  1TKG A;  1RRB A;  3MTN B;  3IVF A;  3BK1 A;  1ZGU B;  5CHF A;  4N9F 4;  3KUC B;  4IWO A;  2CR5 A;  4F8C B;  2LGD A;  2QC8 A;  2LUE A;  3ECI A;  5D94 A;  3HM3 A;  1QLB B;  2R2Q A;  3TL5 A;  2LVP A;  1WI0 A;  3FIL B;  1FNU A;  1HZ6 A;  1QOF A;  4MGK E;  2KWC A;  2ZZP B;  1WGY A;  5LNK 1;  4L2Y A;  3JYU A;  2WXP A;  1AW7 A;  4I6P A;  4M8M A;  1C9F A;  1YN5 A;  3VTW A;  4GXB A;  3HUI A;  1EUV B;  2JWU A;  4A3P A;  1I4R A;  2SEB D;  3IFW B;  2UWQ A;  4X57 B;  1WZ0 A;  1NI3 A;  3CMM B;  2IO1 B;  1XXG A;  2N4F A;  4BOZ B;  3L10 B;  2KWV B;  3N1Z C;  1RYJ A;  2DBY A;  4YSY B;  2EEL A;  2CJO A;  4CHK A;  2PE9 A;  3AEF B;  4KSK C;  3WAP A;  1P7F A;  1NI2 A;  1F52 A;  2L1A A;  2D5G A;  2K3U A;  1XF5 L;  2NR2 A;  2KZR A;  2ZPN A;  1J0G A;  5L83 A;  1ZOY B;  2N9P C;  3UQB A;  1G6J A;  1MPE A;  3ML9 A;  4YWG G;  2BKF A;  5KHQ A;  1LQB A;  2WDV B;  4N59 A;  1E6E B;  3RUL A;  2GOW A;  3NOB A;  4WH4 A;  4ACF A;  3LB8 C;  4GDK B;  3T3O A;  2BVC A;  2DZJ A;  4C00 A;  3L0W B;  2O6V A;  3ZVV A;  5IOI A;  4NJ6 A;  4KDI C;  2WXJ A;  1C4P A;  2BT6 A;  1HXY D;  4BBN F;  3I57 A;  3Q8E A;  1OQY A;  2WQY B;  1A5R A;  1E8Y A;  2K8B A;  2JZP A;  2KNB A;  2ZNV C;  3V3X A;  2JU6 X;  2KD0 A;  3R3M A;  1DGJ A;  1OQR A;  1GUA B;  3DDC B;  4NY0 A;  4NZL B;  5DPS A;  1TJE A;  3DHI C;  3AE5 B;  5EE3 A;  5KHO A;  2CHW A;  3R8B A;  1VZ7 A;  2DLB A;  4AOF A;  2N7E A;  2JYT A;  3X23 A;  3EUB 2;  2GLS A;  2CHZ A;  4ICU A;  4YTP B;  1QOG A;  2IY1 B;  2MBQ A;  3AEB B;  1FPY A;  5HFY A;  4PYZ A;  1N63 A;  3DPD A;  4DXA B;  2KAC A;  2L0T A;  2BW2 A;  4MSQ B;  2JQR B;  1QF6 A;  4RGN A;  4DHJ D;  1TS3 A;  4IM0 A;  3ZDT A;  3ONS A;  1UEL A;  4FA6 A;  4M01 A;  4EZK A;  3P4Q B;  1UUP A;  4A20 A;  5JH5 C;  4C56 C;  3I3T B;  2VH1 A;  2IGG A;  1R4N B;  2KC2 A;  1GPX A;  4RGO S;  2CHX A;  4RF1 A;  1V1O A;  3E56 A;  5IAA C;  5L95 C;  4L1B A;  4HXD A;  2KKC A;  2AYO B;  4KKJ A;  4ZYS A;  3ZJU A;  4WAA A;  4EKU A;  3NS1 A;  1PDX A;  3ZTD A;  1QOB A;  1VZ6 A;  2V3P A;  2N9X A;  2D2Q A;  3CWI A;  1RFA A;  1JW9 D;  3W1S C;  2C7M B;  1ET9 A;  4OVZ A;  2LVO A;  2WHI A;  3UIP B;  1IPG A;  1T5X D;  3V62 A;  2J53 A;  3VR9 B;  3PRE A;  3DVN U;  2IO3 B;  3P2B A;  2BTE A;  1V97 A;  4US8 A;  4K3B A;  1I35 A;  2L00 B;  4LNN A;  2G4S A;  1EWY C;  4RCO A;  2IYD B;  2MEK A;  1IBX A;  1TKE A;  4A8X C;  1F77 A;  4OZA A;  2V4L A;  2INP E;  5C2T B;  1TIF A;  4ZRK A;  3APF A;  1RAX A;  4P16 A;  4BFR A;  4K7W A;  1WJ4 A;  1GB4 A;  1XLN A;  3AEE B;  2B3A A;  2D07 B;  3W9C B;  1C4C A;  3VAW A;  1ZUD 2;  2LGY A;  1OFF A;  2WXR A;  2N7J A;  1TTN A;  4HCN B;  1ROE A;  2KHW B;  4CQN A;  1FCC C;  3Q3M C;  2L7R A;  5H8Y E;  1E90 A;  2HTM E;  2NTS A;  1WXM A;  3SDL C;  5BMH A;  4W9H A;  1NDD A;  5J2R A;  3NS8 A;  4C4V A;  4TSS A;  4TV3 A;  3VVW B;  4AP4 C;  2ZPY A;  4FXC A;  4KGT A;  1XLO A;  2BGF A;  3DCG A;  1FRR A;  1TY0 A;  2D3C A;  1GG3 A;  2WXH A;  1E10 A;  4ZRP A;  4HLE A;  2J0M A;  3ENE A;  2XN9 C;  3DBL B;  4YTN B;  2IJ0 A;  5IO9 A;  4A3O A;  2NPT B;  2AQ1 B;  1P1A A;  1M4V A;  2L76 A;  4H2A A;  2MP2 A;  3PZD A;  4BKT A;  1U4A A;  3N20 C;  3KW5 B;  2AEH A;  4FHK A;  3Q69 A;  4W9J A;  3GB1 A;  4B9K A;  1KFY B;  4DHZ E;  4MSM B;  5HI1 A;  4ZRQ A;  3BVG A;  3UI3 A;  3AED B;  4JQW C;  3APC A;  2IGH A;  3QC8 B;  4BOS C;  4J3O D;  2WWZ A;  3AUL A;  1L7Y A;  1JWA D;  3BY4 B;  3PLV A;  5AEK B;  3TEW A;  2MRP A;  3VFK A;  1TZO A;  1IP9 A;  3OWE B;  2DZK A;  1GNU A;  2FE8 A;  1CMX B;  3PZ8 A;  2LFI A;  4E3C A;  4WWO A;  2QSD A;  1V81 A;  2I1K A;  4URK A;  1P7E A;  3B1L X;  3ALB A;  2HD5 B;  2BS4 B;  1L4Z B;  4KZC A;  3SHQ A;  1WIA A;  4JX1 C;  1LFD A;  2RR9 A;  1PGB A;  3DBR I;  3B2G A;  4YSX B;  1EU3 A;  2DAF A;  2L52 A;  4IOI E;  2XK5 A;  4KX6 B;  2JUO A;  4M0W B;  4RGM A;  4KDL B;  3BII D;  1GAQ B;  1A70 A;  2C9W B;  3DBS A;  1FNW A;  2WX1 A;  1PGA A;  2XBB C;  1VZ8 A;  2DEN B;  2KXJ A;  3P42 A;  1I4Q A;  4HRS A;  1DOI A;  3TEX A;  4JL9 A;  1XLP A;  1ET6 A;  1YX6 B;  1F0Z A;  1E5W A;  4ARC A;  4NAW A;  4W9E A;  5C1Z A;  4GN1 A;  2QJL A;  3FKY A;  5G55 A;  1WWT A;  5E6P A;  3ZXR A;  2UU7 A;  1HTQ A;  3RNE C;  1VR9 A;  4TUU A;  3ZUN A;  3NG0 A;  2I1J A;  2C7H A;  4HKQ A;  3RNC C;  2JWZ A;  1ISN A;  3ZRC A;  1T6B X;  1J19 A;  3RT3 B;  3VTV A;  3R2I A;  1DOX A;  1WXA A;  3IG3 A;  4E74 A;  1XD3 B;  2G1E A;  4DDG D;  1HA5 A;  3IBE A;  4ZHP A;  2FCS A;  1H4R A;  2JZZ A;  2LRW A;  5IKC M;  3Q8F A;  1K8R B;  1R4M B;  1SE9 A;  2C7N B;  3PPA A;  1R4M I;  5IN7 A;  1SGH A;  3QAQ A;  2MA9 B;  2FAZ A;  2K6Q A;  3UIO B;  5FKA C;  5JHB A;  3EA6 A;  3JSV A;  2XK5 B;  1CK1 A;  4ANX A;  3AE7 B;  2BF8 B;  1C1Y B;  2NCN A;  4G50 A;  3O65 B;  1ZP0 B;  3Q2A C;  2TSS A;  2KTR A;  4US9 A;  2K5P A;  3RD2 A;  3DHH C;  2D10 A;  1Z5S B;  2KFK B;  3H8H A;  3QAR A;  4GGQ A;  1DYQ A;  1ESF A;  2ZJD A;  1F2R C;  1J7C A;  2MW5 A;  2KJ6 A;  1YJI A;  3KVF B;  3HM6 X;  2J0J A;  2BWE S;  3JVZ X;  1WX8 A;  4Q2J A;  3Q3N C;  2KC1 A;  3W5U B;  2D11 A;  3PVL A;  1ZPS A;  2AWT A;  1C79 A;  2XEW A;  2MJ3 A;  3EGR A;  1WYG A;  4KSL C;  2MX2 A;  4RGT A;  1LGR A;  3WAO A;  4NAW B;  4FJZ A;  3ZXV A;  2W3S A;  4K7S A;  2FCN A;  1E8W A;  2GMI C;  2CU3 A;  1PQS A;  4MGZ E;  2G3Q B;  5EE9 A;  4B0E A;  3U4E G;  4CO7 A;  4JWS C;  4IM3 A;  1JRP A;  4XDC A;  1CQV A;  2Y5P A;  3DWM A;  3N3K B;  2DAJ A;  4BKS A;  4AJW A;  1P98 A;  4ZHO A;  1D5M C;  3Q3F A;  4XDD A;  1D5X C;  3Q8B A;  5G5G A;  2KLG A;  2K9X A;  4WQM A;  2MJD A;  1AWD A;  4TMA B;  1P3Q U;  2ON8 A;  1K53 A;  4DWF A;  4GDL A;  4ZYN A;  3U52 E;  5D2M B;  3LYY A;  1AAR A;  2KQ7 A;  3URY A;  2IGD A;  4ARI A;  3NRZ A;  3KUZ A;  2LXA A;  2WDQ B;  4FJY A;  1LM8 B;  3OLM D;  2IO2 B;  2RDB C;  1WRI A;  2WDT B;  1KF6 B;  3BVM A;  3BZD B;  3DBH B;  3VUX A;  1TKY A;  1BXT A;  2IZV B;  2BKR B;  1SIF A;  1YQ3 B;  3A9K B;  3RZF A;  3MC9 A;  1V5O A;  4YXD B;  1NEN B;  5D6J B;  3IXS A;  3Q3O C;  3TSS A;  1UBQ A;  1ZKH A;  3AE3 B;  1KLU D;  4IC7 B;  5HKH A;  3O13 A;  3TIX A;  2KAJ A;  4MEL A;  3ZNZ B;  4MM3 B;  3TEY A;  4HRO A;  4KZ0 A;  2KN5 A;  2XNA C;  4PS3 A;  4BKS D;  2Z0D B;  2KN4 A;  3BWU D;  2FUH B;  3T3N A;  4KV2 A;  3B08 A;  4HWI B;  4XZ4 A;  2BYE A;  1ZE3 D;  5D7G A;  2HJ1 A;  3RFZ B;  3P4S B;  1I4H A;  1S1Q B;  1NYR A;  3N1Y C;  5C3J B;  2NBV B;  3TUO A;  5BYS A;  5J18 A;  5FR3 A;  2LAS A;  3ZO5 B;  1PYW D;  2QIL A;  3Q14 C;  3V05 A;  2R2O A;  4IWQ A;  1IGD A;  4WWP A;  5BYR A;  3C0R B;  4WWM A;  3ZJT A;  4GDL B;  2B76 B;  4DXF A;  3V61 A;  1E0Z A;  4LCD E;  2C5L C;  4OW0 A;  1C4A A;  4FAD A;  2EKI A;  4ZRI A;  4K7U A;  1SE2 A;  2KMM A;  1R4N I;  2Z0E B;  2G4D B;  1XLQ A;  1WSP A;  4MH8 A;  3WA0 A;  4M02 A;  2WYQ A;  3NVZ A;  4AS1 A;  4REZ A;  3VQI A;  2MSE D;  1BUI C;  3RNF C;  1MG8 A;  1HZ5 A;  2RDG A;  2RMM A;  4FBJ B;  4EE2 A;  1XO3 A;  3VTU A;  4JPS A;  4GMV A;  1FMA D;  1WY8 A;  1UD7 A;  2GBK A;  3NJT A;  2L8J A;  3HRD D;  1J7B A;  2PPH A;  3AN1 A;  1K50 A;  3H9D A;  4EOY A;  1C3T A;  1FXA A;  1GOZ A;  2PE6 B;  5JHA A;  3U8Z A;  3IAM 1;  3E9S A;  4II2 B;  3GZN I;  2EKE C;  4WUR A;  1WJU A;  5IA7 A;  5AZG A;  2DX5 B;  3KQ4 A;  4OVV A;  3L16 A;  2L32 A;  2JX5 A;  4G0N B;  4R3D A;  3ZNH B;  5IP4 D;  4KVG B;  1L4D B;  1WF9 A;  4DXG A;  1B1Z A;  2A4Z A;  4B0M A;  4WJQ A;  3H6N A;  4PT5 A;  2WNM A;  4EUT A;  1KRH A;  3BK2 A;  2FCQ A;  1WXS A;  3V60 A;  5I4D A;  1C76 A;  1N6Z A;  2MHJ A;  2D3A A;  1FCL A;  2ZCB A;  1OTR B;  4LJO B;  1QT9 A;  1LO5 D;  2FNJ B;  4GOC A;  3PO0 A;  4FJV B;  5E6O A;  3H7P B;  2M8S A;  1IUE A;  3VDZ A;  2KO3 A;  4WWN A;  2LHD A;  1HQR D;  2VZK B;  2W82 A;  4HJK A;  4W9I A;  1YQB A;  2LEK A;  5JXV A;  2I38 A;  3DQV A;  4WJP A;  4XWW A;  4S17 A;  4TQ0 A;  2GRI A;  1LXD A;  4JWU C;  1ACC A;  5DCN A;  2I2Y A;  2KQS A;  3TBL D;  3I9V 1;  4M8N A;  1K52 A;  3DBL I;  2RPV A;  1TS4 A;  2O6V D;  2JRH A;  1F1H A;  2E6X A;  2YLM A;  5G5H A;  2K22 A;  4EFO A;  2KTR B;  4HEA 1;  2M17 A;  3VH3 B;  3SFE B;  1FEH A;  2MLB A;  2IPK D;  1T3Q A;  3ZDM C;  1EM7 A;  3BIN A;  2WS3 B;  5J17 A;  2LUM A;  2KYW A;  4P1B C;  3KUD B;  4NAM A;  2MQJ A;  4IKG A;  2ICI A;  2J7Q B;  1JRU A;  3NHE B;  1M94 A;  2J0K A;  4GDK A;  3RZW C;  2PTL A;  3SD5 A;  1NEK B;  3VUY A;  4RM9 A;  4IW0 A;  2JXX A;  2AQ2 B;  3AE4 B;  2J42 A;  1WXQ A;  3DVG X;  4KIK A;  2X38 A;  1B9R A;  2LHE A;  3A1Q B;  4RNA A;  2KDB A;  2V1Y A;  1SB3 C;  3NZU A;  1YNT E;  3WIM A;  2CS4 A;  4OVU A;  3DVN V;  1UF0 A;  3M62 B;  4W9K A;  3RNB C;  1XEE A;  2OJW A;  4LLG M;  1TYG B;  3AE1 B;  3MP9 A;  3X0W A;  2KAN A;  5C23 A;  3MHZ A;  3MJW A;  3U7D A;  4W9D A;  4O1N A;  2GBM A;  3ZGZ A;  2V3S A;  4IM2 A;  4ZDV A;  3M3J A;  3W1Y A;  2M19 A;  5BMI A;  2WXQ A;  2OJR A;  3RYT A;  3HK0 A;  3N1X C;  4LNO A;  1EU4 A;  1NYQ A;  2M4N A;  3DBH I;  5LXI B;  3ZJV A;  1EF1 A;  3A9J B;  1UBI A;  2A5U A;  4B95 A;  3PRP B;  2Y5B B;  3AE2 B;  4KIK B;  3KYD D;  3B0A A;  4MEM A;  2MP2 B;  2KTF A;  4EEW A;  3LDZ E;  3RNA C;  2FBW B;  3NVV A;  4BKG A;  4GU2 A;  2WXK A;  1SBB B;  3UF8 A;  1T0Y A;  2KFJ A;  3IHP C;  4XYC A;  1MHH E;  2X8X X;  3AXC A;  3TJP A;  4MGI E;  2AX5 A;  2JF5 A;  4ICV A;  3AE6 B;  5E6J A;  1WGG A;  1F9J A;  2HE7 A;  4GIV A;  1ZXH A;  2WXG A;  2WXF A;  5EE0 A;  2RD0 A;  3RPF C;  2BPS A;  1WRD B;  5TR5 A;  1I4X A;  1WZ3 A;  2Z59 B;  1RWS A;  1SF0 A;  3VRB B;  3ZTC A;  4DQO C;  3U7Z A;  3WAL A;  2QEJ C;  1V1P A;  3A4S C;  1JWS D;  4BZA A;  4MJS B;  3ZRF A;  5AUI A;  2SAK A;  1ZDX A;  4A6Q A;  1I4G A;  4RFB A;  4HK2 A;  1EWC A;  4OHJ A;  2WLB A;  1YN4 A;  1QKZ A;  2M56 B;  2KDE B;  1GB1 A;  2ASQ A;  2C60 A;  4GB9 A;  1YX5 B;  2REX A;  2WXL A;  2H89 B;  1OQQ A;  2GB1 A;  4HPM B;  5TSS A;  4S0R A;  4IWP A;  1WGH A;  4K1R B;  4FHJ A;  2KMC A;  3PT2 B;  1DOY A;  1SJE D;  4II3 B;  4KGR A;  4MM3 A;  1MFW A;  2VH2 A;  3DHG C;  1L6U A;  4MJS A;  2HJ8 A;  4AQ7 A;  1SEB D;  3SFD B;  1TY2 A;  1L6V A;  2IBI B;  1UZX B;  1VCB A;  4PS7 A;  1WM3 A;  1CJE A;  2NPT A;  3GOE A;  1E7V A;  1TT5 B;  3QIJ A;  1OEY A;  3KLS X;  2GI9 A;  1TZ1 A;  2BS3 B;  2BYF A;  3H7P A;  2NTT A;  2PW9 A;  4DDI D;  5AZF A;  3PHX B;  2GBJ A;  1FRD A;  5DPR A;  4MH0 E;  1WR1 A;  1S3S G;  3OG5 A;  4I6L B;  2DYM A;  1T0R C;  4NQL B;  5GMV A;  3QQ8 B;  1FFV A;  2RGF A;  3D32 A;  2IDY A;  1TS5 A;  1EO6 A;  2DZI A;  2LJI A;  2ONQ A;  3HVZ A;  4F1S A;  1NVI D;  3L4P A;  1WX9 A;  4XC2 A;  4NJC A;  2Y3A A;  2KJR A;  3L54 A;  3VR8 B;  3PZ7 A;  5AZH A;  4A9A A;  1VRA B;  3AEC B;  1SSN A;  4JE3 B;  2NBU A;  5FR6 A;  1JML A;  1C78 A;  3RN9 C;  3A9K A;  2KK8 A;  2WXI A;  4FN2 A;  3HIZ A;  4I6N B;  1Q10 A;  3A9J A;  3P63 A;  3ABV B;  3UQA A;  2LJ5 A;  2HDE A;  2AL6 A;  3L08 A;  2PKO A;  3L17 A;  1STE A;  3VH4 B;  3QHT A;  2V3N A;  3GS2 A;  1UGJ A;  2K6D B;  2KFK A;  4BAX A;  1YN3 A;  1P9D U;  3PGE A;  3M63 B;  2LXC A;  3AE9 B;  4ZRJ A;  4GLS C;  3NVW A;  3WAN A;  1V1P B;  3DBR B;  4JLC A;  4G11 A;  1J8C A;  1KLG D;  3NVY A;  1TS2 A;  2OOB B;  2PJH A;  4BVU C;  4W9G A;  2K8H A;  2NMQ A;  2INC C;  3N32 A;  1FFU A;  4N58 A;  4W9F A;  1SIJ A;  1WFY A;  4KGS A;  2PVO D;  1WYW B;  5E6N A;  4FUL A;  2VRR B;  3IT4 B;  2M1M A;  2ZW1 A;  4HPL B;  1WH3 A;  2Y5C A;  2YVC A;  1D5Z C;  3H7S A;  2CU1 A;  3SEB A;  1UWX A;  3C19 A;  3HVD A;  2BBC A;  4IUM B;  4P6V F;  5LLI A;  2ZW0 A;  2YEP F;  5LXH A;  2NS5 A;  1YIW A;  2W9N A;  2D3G A;  5JZE B;  3A4R A;  2K0P A;  3ZNG C;  1VD2 A;  3MC8 A;  2LGI A;  4JIO U;  4DHZ B;  1I42 A;  1KTK A;  1PFD A;  2ZVO A;  4MT5 A;  2V0G A;  4ITK A;  4M00 A;  2L3Z A;  1ZW7 A;  2EMT A;  3U30 A;  1GC7 A;  2M0X A;  4NJ7 A;  1YQ4 B;  3N9Y C;  1TBE A;  4HJG E;  3ZNI D;  3Q6B A;  5HHD G;  2DWQ A;  4CYE A;  1XCT L;  1N5W A;  4TQ1 A;  3AEA B;  1FIQ A;  3GZN B;  1QQR A;  2O2V A;  4G3X B;  3MC0 B;  4GSW A;  3DOW A;  1YMH E;  1WGD A;  2JSV X;  1WJ6 A;  4ANV A;  2JRI B;  2KT7 A;  2KX3 A;  4XWT A;  3QJZ A;  3EEC A;  4AJY B;  1T0Q C;  2GBR A;  3SR6 A;  1FM0 D;  3KWL A;  3RUI B;  3MJ5 A;  1RFK A;  1E9M A;  2N1V A;  2RSU A;  4M0W A;  3P1M A;  3M95 A;  3CF6 E;  4LNI A;  5T8I A;  3APD A;  4KKI A;  4HDQ A;  3IT6 B;  3RNG C;  3AH7 A;  3KYC D;  1Y56 A;  3OAW A;  2MBH A;  3PS6 A;  1V6E A;  2E3T A;  3PRM B;  4HKZ E;  1JWB D;  1XT9 B;  1AN8 A;  5CX3 A;  2FCM A;  2BB6 A;  2H88 B;  1Z2M A;  1KLV A;  3SU8 X;  3CST A;  2DZM A;  2KMA A;  2QIE B;  3MHS D;  2HTH A;  4PYU A;  3V6E B;  2N7D A;  2BQQ A;  1EF5 A;  1MHX A;  3JSV B;  1FO4 A;  2K8C A;  3ZW3 A;  2LWP A;  3Q8C A;  4AWJ A;  4USA A;  1WGR A;  1HE8 A;  1NBF C;  5EDS A;  1ZDV A;  2Q5W D;  1YJ1 A;  2N0S B;  2N1W A;  2PIA A;  1JWM D;  3GP7 A;  3QWZ B;  1L0X B;  3MFG A;  1UNS A;  2K25 A;  2AL3 A;  2M0A A;  4P7I A;  3A1Q A;  4MDK E;  3T9L A;  1V86 A;  1FXT B;  3ML8 A;  2BB5 A;  1V8C A;  4C4V B;  2MBE A;  2RDH A;  1FD6 A;  4LNK A;  2G45 B;  3T8M A;  3L13 A;  5CHW A;  4F7Z A;  1AYF A;  2N9L A;  2FID A;  5EE1 A;  4AUQ C;  2LGX A;  3AEG B;  5AUK A;  1R7S A;  3KH0 A;  4LNF A;  1Q5W B;  2O2V B;  3R66 C;  2KDF B;  2LI5 A;  2ACZ B;  3GE3 C;  1L2N A;  1X1M A;  4WIP A;  2D3B A;  1E8X A;  3S2A A;  1I4P A;  3PSE B;  3B2F A;  3BYY B;  4IG7 B;  1Y8R C;  4ANU A;  1XCQ L;  1FXI A;  4K81 A;  2BWF A;  3I5J C;  4LTU A;  1IYF A;  4B6W A;  3GE8 C;  1MI0 A;  2NBW B;  1WE6 A;  1SJH D;  3EFC A;  3TEZ A;  4W9C A;  1D6E C;  3EHV A;  4XE0 A;  2MH7 A;  2G9H D;  4DBG A;  5G2N A;  1H8C A;  1WJN A;  1V2Y A;  1WE7 A;  3QCA A;  2QHO A;  1YJJ A;  1PUT A;  3PV1 A;  1YOV B;  2V4I B;  2CKH B;  2KLC A;  3NY5 A;  1CZP A;  2QCZ A;  4A55 A;  2PVG C;  2ZVN A;  4RF0 A;  2PLP A;  3LJ3 A;  4OZC A;  4WAF A;  3OJ3 A;  4FLH A;  1N60 A;  1QIL A;  2DYB A;  5HG2 A;  4RM8 A;  4TKN A;  2FUG 1;  2J52 A;  1UGM A;  2KX0 A;  3AV8 A;  1N61 A;  2ZNV B;  3CIR B;  2WGS A;  2ZCC A;  2KJH B;  1JCK B;  1UWM A;  2WDR B;  4HDO A;  2BS2 B;  2DHZ A;  5FK9 C;  3ZLZ A;  3ZQ4 A;  1UH6 A;  4NPN A;  3EFU A;  4NNJ B;  2L83 A;  2JT4 B;  3IAS 1;  2DYO A;  1J7A A;  2LZ6 A;  1WGK A;  3W5V B;  3Q3J A;  4QAY A;  2INN E;  2EMS A;  3TCA A;  1JRO A;  2LRU A;  2KWD A;  1OEY J;  1QZE A;  3V6C B;  5D3I B;  1VJK A;  1D4B A;  2MJE A;  1WMH B;  2PEA A;  3RCZ A;  1Q0W B;  1K51 A;  3PRZ A;  4XGA B;  2IY0 B;  3UGB B;  4EZL A;  3VXW A;  2V9H A;  1P0R A;  4W9L A;  1JWU D;  2YEP B;  1Q1O A;  2WXN A;  2KDI A;  4BBN C;  1RM6 C;  1WMH A;  2L05 A;  1V5T A;  4MAC A;  4WQO B;  2J4X A;  2BYT A;  1SE4 A;  3CSF A;  4JGH B;  4NQK E;  4MGY E;  4LJP B;  2NVU I;  4UDU C;  3RMK C;  2PMV A;  2W54 A;  1E8Z A;  2KDM A;  2KWU B;  3QX1 A;  4PK1 A;  1L0V B;  3KWV A;  3C8Y A;  4LDT B;  1L0Y B;  3NZ3 A;  3W1S A;  3AU4 A;  1E7P B;  3B9J A;  1WXV A;  5MPO A;  3P4P B;  3BVZ A;  2JPH A;  4E71 A;  3W2D A;  2JXT A;  1XQQ A;  1GJZ A;  1IBX B;  1HTO A;  3J9C A;  5CTR C;  2WU5 B;  1PGX A;  5CHV C;  4J6I A;  2IO0 B;  2UYZ B;  1WX7 A;  2Z8L A;  2WXM A;  1D3Z A;  3QK0 A;  4PS8 A;  2DNF A;  3FAH A;  1KJT A;  2JY6 A;  2QMT A;  1MVK A;  3U2S C;  1VLB A;  2KOX A;  2W3R A;  2LVQ A;  1N62 A;  3VHT C;  4C7Z A;  4DHJ B;  4C7Y A;  2KQ4 X;  4K3C A;  1WR6 E;  1KOT A;  4WJO A;  4LDT D;  1TGZ B;  2VZK D;  3WAM A;  4D2K A;  4HVB A;  2LD9 A;  4HPP A;  5DPT A;  1T0S C;  1BT0 A;  1HEZ E;  3ETR A;  5H92 C;  5BO4 B;  4YTM B;  2KVR A;  1OGW A; 
#chains in the Genus database with same CATH homology
 2L76 A;  1WM2 A;  2MP2 A;  4OVV A;  3ZKJ C;  4DK5 A;  3L16 A;  3PZD A;  4JLC A;  1V80 A;  2JVC A;  4G11 A;  4BKT A;  1U4A A;  4G0N B;  1J8C A;  3KW5 B;  3ZNH B;  3HHM A;  1V9J A;  2MCN B;  4KVG B;  3H1U A;  1WF9 A;  2AEH A;  2OOB B;  4FHK A;  4YL8 A;  3K9O B;  2A4Z A;  2PJH A;  4BVU C;  4W9J A;  4W9G A;  2K8H A;  3N32 A;  3R7R A;  4B9K A;  3JW0 X;  4W9F A;  4WJQ A;  3AU5 A;  4DHZ E;  3H6N A;  1WFY A;  4EUT A;  5E6N A;  1WYW B;  4FUL A;  4MSM B;  2ZEQ A;  2VRR B;  2M1M A;  2FCQ A;  3QA8 A;  1WXS A;  2K39 A;  2RPQ A;  3V60 A;  4HPL B;  1WH3 A;  4JQW C;  2YVC A;  3APC A;  3H7S A;  2CU1 A;  3QC8 B;  4BOS C;  2JZ3 B;  2ZCB A;  2MBO A;  2WWZ A;  3AUL A;  1OTR B;  4LJO B;  1L7Y A;  3BY4 B;  4IUM B;  5LLI A;  2FNJ B;  3PLV A;  5AEK B;  4GOC A;  5LXH A;  2MRP A;  3VFK A;  2NS5 A;  1YIW A;  2W9N A;  1IP9 A;  2D3G A;  3ZIM A;  2DZK A;  1GNU A;  4FJV B;  5E6O A;  3A4R A;  3N30 A;  3H7P B;  1CMX B;  1VD2 A;  3ZNG C;  5JZE B;  2M8S A;  4E3C A;  3PLU A;  4JIO U;  1V49 A;  4WWO A;  4DHZ B;  2BYV E;  1E7U A;  1V81 A;  1I42 A;  2ZVO A;  2I1K A;  4URK A;  3VDZ A;  2KO3 A;  3B1L X;  3ALB A;  2FIF A;  2L3Z A;  2HD5 B;  4WWN A;  1ZW7 A;  2EMT A;  3U30 A;  4KZC A;  4HJK A;  3SHQ A;  1GC7 A;  1GC6 A;  2M0X A;  4W9I A;  1WIA A;  4NJ7 A;  1YQB A;  1LFD A;  2L0F A;  2RR9 A;  4RMA A;  3DQV A;  4WJP A;  2MBB B;  2WX0 A;  3DBR I;  4TQ0 A;  2DAF A;  1TBE A;  1LXD A;  4ANW A;  3NZS A;  4XX5 A;  3ZNI D;  2XK5 A;  3R7Q A;  5DCN A;  2O6V B;  2JUO A;  4M0W B;  2GBN A;  1KM7 A;  2KQS A;  3PTF C;  3K9P B;  4KDL B;  3DVG Y;  2C9W B;  3DBS A;  3TBL D;  2MWS B;  2WX1 A;  4M8N A;  2XBB C;  2DEN B;  3VUW A;  2KXJ A;  3DBL I;  4ASW C;  3A33 B;  4CYE A;  3TMP B;  4TQ1 A;  3OJ4 B;  2O6V D;  2JRH A;  2YLM A;  4HCP B;  4JL9 A;  2O2V A;  4G3X B;  5DPW A;  1YX6 B;  4GSW A;  4EFO A;  3DOW A;  2KTR B;  1E5W A;  2M17 A;  3VH3 B;  4NAW A;  4W9E A;  5C1Z A;  4GN1 A;  2MLB A;  5G55 A;  5E6P A;  1WGD A;  3ZDM C;  1WJ6 A;  4ANV A;  4TUU A;  3ZUN A;  2JRI B;  4EZJ A;  3BIN A;  2I1J A;  5J17 A;  3EC8 A;  3KUD B;  4WJN A;  2KX3 A;  3QJZ A;  2C7H A;  3EEC A;  3UIN B;  2N9E B;  2K1F A;  1RLF A;  2MQJ A;  4AJY B;  1YD8 U;  2JWZ A;  1ISN A;  2J7Q B;  3ZRC A;  1JRU A;  1J19 A;  3NHE B;  3RT3 B;  3VTV A;  1M94 A;  2GBR A;  2J0K A;  4GDK A;  3AI5 A;  3RZW C;  3PHW B;  1RRB A;  1WXA A;  3MTN B;  2DX5 B;  3IG3 A;  3IVF A;  3SD5 A;  1XD3 B;  3VUY A;  4E74 A;  4DDG D;  4RM9 A;  1ZGU B;  4IW0 A;  2JXX A;  5CHF A;  4N9F 4;  3IBE A;  3RUI B;  3KUC B;  4IWO A;  2CR5 A;  4F8C B;  2LGD A;  2LUE A;  3ECI A;  5D94 A;  3HM3 A;  2R2Q A;  3TL5 A;  2FCS A;  1H4R A;  2JZZ A;  3DVG X;  4KIK A;  2LRW A;  2N1V A;  2RSU A;  3A1Q B;  2LVP A;  1WI0 A;  2KDB A;  3M95 A;  2V1Y A;  3CF6 E;  1K8R B;  2KWC A;  3NZU A;  4MGK E;  2ZZP B;  1WGY A;  3APD A;  3JYU A;  4M8M A;  4I6P A;  1SE9 A;  2C7N B;  4HDQ A;  2CS4 A;  3PPA A;  3WIM A;  1R4M I;  3VTW A;  3KYC D;  4OVU A;  3DVN V;  3OAW A;  2MBH A;  3PS6 A;  3M62 B;  4GXB A;  1EUV B;  4W9K A;  1V6E A;  1SGH A;  3PRM B;  3QAQ A;  2MA9 B;  4A3P A;  1XT9 B;  2FAZ A;  2K6Q A;  3IFW B;  3UIO B;  5CX3 A;  2FCM A;  2UWQ A;  5JHB A;  4X57 B;  1Z2M A;  3X0W A;  1WZ0 A;  2KAN A;  3JSV A;  1KLV A;  3CMM B;  2XK5 B;  5C23 A;  2IO1 B;  2N4F A;  3SU8 X;  4BOZ B;  3CST A;  3MJW A;  3L10 B;  2KWV B;  3U7D A;  4ANX A;  2DZM A;  2KMA A;  4W9D A;  2GBM A;  3MHS D;  2BF8 B;  2V3S A;  4IM2 A;  1C1Y B;  2NCN A;  2HTH A;  4G50 A;  4PYU A;  4CHK A;  4ZDV A;  2PE9 A;  3M3J A;  3V6E B;  3O65 B;  4KSK C;  2N7D A;  3WAP A;  1NI2 A;  3W1Y A;  1EF5 A;  3JSV B;  2KTR A;  2NR2 A;  2OJR A;  2KZR A;  2K8C A;  3RD2 A;  3RYT A;  2D10 A;  1Z5S B;  2KFK B;  2ZPN A;  3HK0 A;  3ZW3 A;  3QAR A;  5L83 A;  2LWP A;  1J0G A;  4AWJ A;  4GGQ A;  2N9P C;  1WGR A;  1HE8 A;  1NBF C;  3UQB A;  5EDS A;  1G6J A;  2ZJD A;  3ML9 A;  1YJ1 A;  2BKF A;  5KHQ A;  1LQB A;  2N1W A;  3WAN A;  3RUL A;  2GOW A;  3NOB A;  3QWZ B;  2M4N A;  3DBH I;  2K25 A;  5LXI B;  2MW5 A;  2KJ6 A;  2AL3 A;  4GDK B;  1EF1 A;  3A9J B;  1UBI A;  3KVF B;  3HM6 X;  2J0J A;  2A5U A;  2DZJ A;  2BWE S;  3JVZ X;  3L0W B;  1WX8 A;  4B95 A;  3PRP B;  4P7I A;  2O6V A;  3ZVV A;  2Y5B B;  4NJ6 A;  3A1Q A;  4MDK E;  4KDI C;  2KC1 A;  4KIK B;  3T9L A;  3KYD D;  2D11 A;  1V86 A;  3PVL A;  4BBN F;  2AWT A;  3B0A A;  1FXT B;  3ML8 A;  1OQY A;  2MBE A;  2XEW A;  2G45 B;  4KSL C;  4MEM A;  2MP2 B;  2KTF A;  2MX2 A;  3L13 A;  3T8M A;  5CHW A;  1A5R A;  4F7Z A;  4EEW A;  1E8Y A;  3LDZ E;  2K8B A;  2KNB A;  2ZNV C;  3WAO A;  2FID A;  4NAW B;  4AUQ C;  2LGX A;  4FJZ A;  2KD0 A;  3R3M A;  4BKG A;  3KH0 A;  4GU2 A;  1GUA B;  1Q5W B;  3DDC B;  4K7S A;  4NY0 A;  2O2V B;  3R66 C;  3UF8 A;  1T0Y A;  2FCN A;  2KDF B;  2KFJ A;  2LI5 A;  1E8W A;  2GMI C;  1L2N A;  1X1M A;  3IHP C;  5DPS A;  1PQS A;  3AXC A;  1E8X A;  3S2A A;  3TJP A;  4MGI E;  2JF5 A;  4ICV A;  3PSE B;  2G3Q B;  4MGZ E;  5KHO A;  4CO7 A;  1WGG A;  2CHW A;  1F9J A;  4IG7 B;  1Y8R C;  4ANU A;  4AOF A;  2N7E A;  4K81 A;  4IM3 A;  2BWF A;  2HE7 A;  1IYF A;  3X23 A;  4B6W A;  2NBW B;  4GIV A;  2CHZ A;  4ICU A;  2IY1 B;  1WE6 A;  3N3K B;  2DAJ A;  2MBQ A;  4BKS A;  4AJW A;  1P98 A;  4W9C A;  3EHV A;  3Q3F A;  4PYZ A;  2RD0 A;  3DPD A;  4DBG A;  4DXA B;  5G2N A;  1H8C A;  2L0T A;  4MSQ B;  2BPS A;  1WJN A;  1V2Y A;  2KLG A;  1WRD B;  1WE7 A;  3QCA A;  2QHO A;  5TR5 A;  4DHJ D;  1WZ3 A;  2Z59 B;  3PV1 A;  4IM0 A;  3ZDT A;  2CKH B;  1P3Q U;  1UEL A;  2KLC A;  3ONS A;  4FA6 A;  3NY5 A;  3ZTC A;  4EZK A;  4DWF A;  4GDL A;  4A20 A;  4ZYN A;  2ZVN A;  5JH5 C;  3LJ3 A;  3WAL A;  5D2M B;  1AAR A;  3I3T B;  2KQ7 A;  3A4S C;  3OJ3 A;  4FLH A;  2DYB A;  4RM8 A;  4TKN A;  3KUZ A;  2KC2 A;  4MJS B;  1UGM A;  2KX0 A;  2CHX A;  3ZRF A;  2ZNV B;  5IAA C;  5L95 C;  2LXA A;  2ZCC A;  2KJH B;  4HK2 A;  4FJY A;  4HDO A;  2DHZ A;  1LM8 B;  3OLM D;  4HXD A;  2IO2 B;  3ZLZ A;  2KDE B;  2KKC A;  2ASQ A;  1UH6 A;  2AYO B;  2WDT B;  3EFU A;  4NNJ B;  2C60 A;  4GB9 A;  4NPN A;  1YX5 B;  2JT4 B;  2REX A;  2DYO A;  2LZ6 A;  3Q3J A;  3VUX A;  4HPM B;  4WAA A;  4EKU A;  4IWP A;  1WGH A;  3PT2 B;  4FHJ A;  2EMS A;  2IZV B;  2KMC A;  2BKR B;  4K1R B;  3TCA A;  3ZTD A;  2LRU A;  1SIF A;  2N9X A;  1OEY J;  1QZE A;  4II3 B;  3V6C B;  3A9K B;  3RZF A;  2D2Q A;  4MM3 A;  1RFA A;  1WMH B;  2PEA A;  3W1S C;  1V5O A;  5D6J B;  4MJS A;  3RCZ A;  2C7M B;  2HJ8 A;  2LVO A;  1Q0W B;  1UBQ A;  3PRZ A;  3UGB B;  2IY0 B;  4EZL A;  3VXW A;  3UIP B;  1IPG A;  2IBI B;  1ZKH A;  1UZX B;  1VCB A;  1P0R A;  4W9L A;  3V62 A;  1Q1O A;  3PRE A;  4PS7 A;  2KDI A;  4IC7 B;  3DVN U;  2IO3 B;  3P2B A;  4BBN C;  3TIX A;  5HKH A;  1WM3 A;  1WMH A;  2NPT A;  4MEL A;  3ZNZ B;  3GOE A;  1E7V A;  1I35 A;  2L05 A;  4KZ0 A;  1V5T A;  4WQO B;  2KN5 A;  2L00 B;  3QIJ A;  1OEY A;  2G4S A;  4PS3 A;  2IYD B;  4BKS D;  1TZ1 A;  3CSF A;  2Z0D B;  4JGH B;  4NQK E;  4MGY E;  4LJP B;  2NVU I;  2FUH B;  2BYF A;  3H7P A;  4KV2 A;  3B08 A;  4HWI B;  4XZ4 A;  2BYE A;  1E8Z A;  4DDI D;  5D7G A;  2KWU B;  1S1Q B;  5AZF A;  3PHX B;  2GBJ A;  2V4L A;  3QX1 A;  5DPR A;  2NBV B;  4MH0 E;  4ZRK A;  3APF A;  1WR1 A;  1RAX A;  1S3S G;  5J18 A;  4LDT B;  2LAS A;  4BFR A;  4I6L B;  3ZO5 B;  4K7W A;  1WJ4 A;  2DYM A;  3W1S A;  3AU4 A;  1WXV A;  2B3A A;  4NQL B;  5GMV A;  3QQ8 B;  2JPH A;  4E71 A;  2D07 B;  2RGF A;  2R2O A;  3D32 A;  4IWQ A;  4WWP A;  3VAW A;  2LGY A;  3C0R B;  1TTN A;  4HCN B;  2KHW B;  1EO6 A;  4GDL B;  2DZI A;  3V61 A;  4LCD E;  2C5L C;  1XQQ A;  4FAD A;  1GJZ A;  4ZRI A;  2L7R A;  4F1S A;  5CTR C;  1WX9 A;  4K7U A;  4XC2 A;  1R4N I;  2Z0E B;  5CHV C;  4J6I A;  2G4D B;  2IO0 B;  2KJR A;  1E90 A;  3WA0 A;  2UYZ B;  1WX7 A;  2WYQ A;  3L54 A;  1D3Z A;  1WXM A;  3QK0 A;  4PS8 A;  5AZH A;  3SDL C;  4W9H A;  3VQI A;  2MSE D;  1NDD A;  5J2R A;  1MG8 A;  1KJT A;  2JY6 A;  3NS8 A;  4FBJ B;  4TV3 A;  2NBU A;  3VTU A;  3VVW B;  4GMV A;  1WY8 A;  5FR6 A;  4AP4 C;  1UD7 A;  2GBK A;  2L8J A;  2KOX A;  2PPH A;  2LVQ A;  2ZPY A;  2KK8 A;  3A9K A;  3H9D A;  4EOY A;  3VHT C;  4DHJ B;  1C3T A;  2BGF A;  3DCG A;  3HIZ A;  4FN2 A;  4I6N B;  3A9J A;  2PE6 B;  5JHA A;  1WR6 E;  1GG3 A;  3U8Z A;  3UQA A;  1KOT A;  2LJ5 A;  4WJO A;  4LDT D;  1TGZ B;  2AL6 A;  4II2 B;  3WAM A;  3GZN I;  3L08 A;  2EKE C;  4HVB A;  4HLE A;  2J0M A;  3ENE A;  3L17 A;  3VH4 B;  2LD9 A;  3QHT A;  5DPT A;  1WJU A;  1BT0 A;  2K6D B;  2KFK A;  5BO4 B;  4A3O A;  1P9D U;  2NPT B;  3PGE A;  3M63 B;  5IA7 A;  1P1A A;  2LXC A;  4ZRJ A;  5AZG A;  2KVR A;  1OGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...