2MA9B

Hiv-1 vif socs-box and elongin bc solution structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/protein binding
molecule keywords Virion infectivity factor
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ma9B00
4EKUA 3GOEA 1WXAA 4HPMB 4EEWA 1LQBA 3VVWB 3SHQA 1Q0WB 2KKCA 5DPRA 2DYBA 1Y8RC 4IC7B 5C23A 1WI0A 2WDTB 3L54A 3QAQA 5D7GA 2LRUA 4JQWC 1C1YB 4AJYB 1YD8U 5AZFA 1WXSA 5TR5A 4B95A 3OJ3A 4NJ7A 4G50A 4PYUA 2GBKA 4PYZA 2XBBC 4FJYA 1Z5SB 2VRRB 4HPLB 2O6VB 3PV1A 3TBLD 2KDEB 1SGHA 3PREA 2BF8B 2LRWA 4GGQA 2AYOB 4MGKE 2BPSA 3VHTC 2LGDA 1WH3A 3APDA 3BINA 2PPHA 3NY5A 4M8MA 3L16A 2ZPNA 1WZ3A 4W9DA 4IM0A 3PPAA 1HE8A 4K81A 2KFKA 4E71A 3EC8A 2PE9A 2CR5A 3UF8A 4FN2A 1V2YA 3KYDD 2MBHA 4E3CA 4K7UA 2ZVNA 2HJ8A 2KFJA 2MBOA 4GDLB 2KANA 4JIOU 4OVVA 2ZJDA 4KV2A 4MM3A 4PS7A 3AXCA 2D07B 3DBRI 2EMTA 2K1FA 3PTFC 3U30A 1EUVB 3VUYA 5AZGA 4NAWB 5LXIB 1SIFA 2N1WA 2LVOA 4TQ1A 3N3KB 2A5UA 4LJOB 1K8RB 2A4ZA 3DBSA 2M17A 2W9NA 4MDKE 2RPQA 4I6PA 3R66C 4HJKA 2DZMA 2J0JA 3VXWA 4MGYE 4HWIB 4W9GA 1E7UA 4ZRJA 3DVNV 1EF5A 4WJQA 4FJVB 3KUCB 2ZNVB 3KH0A 3UINB 3IHPC 1UBIA 2O6VD 2MBQA 2BKRB 2LI5A 3A9JB 4GU2A 4EFOA 2IY0B 3DCGA 1RFAA 2G3QB 1X1MA 2V4LA 4W9JA 1GC7A 2KN5A 3K9PB 4MGIE 2NPTA 4JLCA 1YJ1A 4GMVA 2LXCA 1IP9A 2L05A 3R7RA 2B3AA 3VTUA 1EO6A 4F1SA 2BYFA 3L13A 2Y5BB 1E8ZA 2MBEA 3H7PB 1RAXA 4LDTB 3TCAA 2Z0EB 5AEKB 4NY0A 1OEYJ 1WMHA 4DDGD 2N7EA 2KVRA 4II3B 2N9XA 2KDIA 2CU1A 3QJZA 3UIPB 2XK5B 3L10B 1UELA 3LJ3A 3A33B 1ZGUB 4HXDA 2JVCA 3AU4A 3KYCD 2CS4A 1UGMA 2KLGA 2N9EB 4WQOB 3V6CB 3ZLZA 3W1YA 4IWOA 4MSMB 2BWES 3KW5B 4ZRKA 1E7VA 1YQBA 5E6OA 4GB9A 2KDBA 3AU5A 2AL6A 3RUIB 3R7QA 2ZCBA 2ZVOA 4X57B 3VAWA 3D32A 3ECIA 3K9OB 1WX8A 2KMCA 2MCNB 3GZNI 3WA0A 2NCNA 4AJWA 1FXTB 1CMXB 4II2B 3PRZA 2DZIA 4GSWA 2BGFA 1R4NI 3ZDTA 3QQ8B 4HCNB 4TUUA 2MP2A 2RD0A 1JRUA 2YVCA 3DPDA 4AUQC 5IAAC 4TV3A 2MLBA 4LCDE 5D94A 1UBQA 2G4DB 4KZ0A 3VH4B 2KNBA 3ZNID 2V1YA 2N9PC 3RD2A 2AL3A 1UH6A 5KHQA 1TTNA 4EOYA 2DZKA 1RRBA 2R2QA 2LASA 2ZCCA 4LJPB 1OGWA 1WXVA 4ASWC 1WJUA 4IWPA 4FJZA 4MGZE 3A4RA 4LDTD 3TL5A 1Q5WB 3B1LX 3PLVA 4K7SA 2CHWA 3APFA 4GN1A 4F7ZA 4WJNA 1H8CA 3H9DA 1MG8A 3BY4B 3PRMB 2HTHA 1C3TA 1KLVA 1QZEA 3PHXB 5FR6A 4AWJA 1V5OA 2FIDA 1WX7A 2ZZPB 3EECA 4DXAB 1E5WA 3KUZA 3UIOB 4BKGA 2IY1B 3PGEA 1WGRA 2O2VA 3ML8A 2BYVE 3WAPA 1V9JA 1P98A 4DWFA 2M0XA 5LLIA 3M95A 2I1JA 2J0MA 2JRIB 3L0WB 3HK0A 3DVGX 2ZPYA 3T9LA 2ZEQA 2LGXA 3R3MA 4KIKA 4EUTA 4B6WA 4ICUA 5J2RA 5JHAA 2L0TA 2N7DA 5IA7A 1F9JA 3JSVA 3VDZA 3RT3B 3AULA 4KVGB 3SD5A 4B9KA 3A9KB 3RZFA 2MA9B 3QA8A 4BOZB 3ALBA 3C0RB 2OOBB 3QK0A 3KUDB 3H7SA 3NZUA 4TQ0A 3B08A 4NJ6A 4RM8A 2MBBB 5JZEB 3DBHI 1P9DU 2IBIB 3AI5A 2DAFA 4ZDVA 3Q3FA 2RSUA 4MEMA 2IZVB 2D2QA 3X23A 3RULA 1WM3A 4BOSC 4G11A 4BBNC 1KOTA 4GDKA 5G2NA 1I42A 5CHVC 1Z2MA 4F8CB 1LXDA 2LXAA 3IBEA 5J18A 3LDZE 3VUXA 1T0YA 2JZZA 5DPSA 5GMVA 1D3ZA 3CSFA 1E8WA 3UQAA 2O6VA 4HDOA 2GBJA 2JZ3B 2IO2B 3SU8X 3OJ4B 2LUEA 3WANA 4MH0E 2KWCA 2JF5A 2KK8A 4JGHB 4RMAA 1GJZA 5EDSA 2FAZA 4WWNA 1V5TA 2FCQA 1RLFA 4HDQA 5D2MB 2FCSA 4W9EA 2PE6B 3QIJA 2WYQA 3ZRFA 2LD9A 2L7RA 2KZRA 3KVFB 3PLUA 2NS5A 3IVFA 3MJWA 3M3JA 4IW0A 3NZSA 4EZKA 4RM9A 2KMAA 4IWQA 4W9LA 2KC2A 1WXMA 4MJSB 1A5RA 1LFDA 4ZYNA 3JW0X 3ZRCA 1WY8A 1V80A 1XD3B 2LVQA 2M4NA 3MTNB 4N9F4 3UGBB 2GBMA 2KFKB 3HHMA 4MELA 2MP2B 1Q1OA 2L00B 3RZWC 3QHTA 2LGYA 1V49A 2DHZA 5LXHA 2AWTA 3N30A 3ZVVA 3H1UA 4WWPA 3WIMA 3IFWB 1E8XA 3DVGY 3QX1A 2KXJA 4M8NA 2MRPA 4FLHA 3V62A 2MW5A 1E8YA 4BKSA 4FA6A 5J17A 2KO3A 2REXA 4G0NB 3DQVA 5D6JB 3L08A 3X0WA 1V81A 3IG3A 1YIWA 4ANXA 5DPWA 1U4AA 3VFKA 1YX5B 3NOBA 4BKTA 1WGDA 1UZXB 1I35A 3JVZX 3PVLA 3WAMA 1J0GA 2KTRA 2PEAA 3VQIA 4XX5A 3A4SC 3ZNHB 3QC8B 2JRHA 3ZUNA 3ZTCA 3VH3B 2KWUB 1WR6E 1WRDB 4P7IA 2MX2A 2K8CA 3W1SA 5E6NA 3ZDMC 3A9JA 2YLMA 3CMMB 3APCA 2JY6A 4WAAA 4DK5A 2MWSB 2IO0B 4IG7B 3JYUA 2NVUI 2NBWB 2JXXA 3S2AA 3HIZA 1P3QU 2DAJA 3ZIMA 5C1ZA 1IYFA 4A3OA 1S1QB 4IUMB 1OTRB 2BWFA 4W9HA 2XEWA 2D10A 3A1QB 3V6EB 4FBJB 1OQYA 3TIXA 3P2BA 2UWQA 3I3TB 3MHSD 1XQQA 1S3SG 2M1MA 4CYEA 1ZKHA 2LJ5A 4EZJA 4URKA 2KX3A 2K39A 1WJ6A 2KJ6A 2UYZB 2LVPA 1PQSA 2KJHB 3EHVA 4W9CA 1J8CA 1YX6B 5CHFA 4I6LB 4BVUC 5CTRC 1L7YA 2C5LC 2M8SA 3DOWA 2IO1B 2K6QA 3HM6X 4PS3A 4A20A 3W1SC 4HCPB 4KDIC 3TJPA 1GUAB 1GC6A 2JT4B 2KQ7A 2JUOA 4FHJA 4WWOA 4DHZE 2Z59B 2AEHA 4GDLA 2L3ZA 1WX9A 1NI2A 2KDFB 5DCNA 5AZHA 3H7PA 1P1AA 4KSKC 4W9FA 1SE9A 5DPTA 1WE7A 3DDCB 3RCZA 4NAWA 3V60A 4HVBA 2MQJA 3ZNZB 3DVNU 2WX0A 3ML9A 4J6IA 4ICVA 4PS8A 2EKEC 1J19A 2C7MB 5BO4B 3DBLI 2V3SA 3M63B 2CHZA 2L0FA 4EZLA 3UQBA 4KIKB 1WZ0A 4JL9A 1WE6A 4BBNF 1WIAA 4NQKE 5G55A 3ZW3A 4YL8A 2KHWB 3JSVB 4CHKA 1GNUA 4W9KA 3A9KA 3M62B 3WALA 1WMHB 2PJHA 5L83A 1TBEA 5JH5C 1WYWB 4ZRIA 2GBRA 3O65B 3CF6E 4XC2A 4GXBA 4E74A 2C7NB 1L2NA 2I1KA 3PRPB 4K7WA 1P0RA 1GG3A 2KQSA 1WGGA 2K8BA 2FCNA 2NPTB 2WX1A 4OVUA 5E6PA 1OEYA 2HD5B 4NNJB 4DDID 2DZJA 4IM3A 3HM3A 2KC1A 2EMSA 3ONSA 4MJSA 1TGZB 2LZ6A 4HK2A 4KSLC 2BYEA 2N1VA 3T8MA 2KJRA 4GOCA 1VD2A 4AP4C 4HLEA 1KJTA 1WJ4A 2BKFA 1XT9B 2NBVB 2OJRA 2CKHB 5CX3A 2K25A 3Q3JA 1EF1A 4DBGA 3OLMD 4I6NB 1NDDA 3VTWA 4TKNA 3WAOA 4AOFA 3QCAA 4W9IA 3TMPB 4FADA 2C9WB 2DX5B 4IM2A 4G3XB 3RYTA 2J7QB 2N4FA 4M0WB 2JPHA 3SDLC 4FHKA 1WGHA 2NR2A 2FIFA 4KDLB 4WJPA 1IPGA 1E90A 1WM2A 4MSQB 5L95C 4DHJD 3QARA 2C7HA 1V6EA 2K6DB 2L76A 2WWZA 3PT2B 2IYDB 5HKHA 2DYOA 4ANVA 3H6NA 4WJOA 3U7DA 1UD7A 2D3GA 2NBUA 2LWPA 4GDKB 2KOXA 4XZ4A 3QWZB 1BT0A 2KTRB 1WFYA 1KM7A 3PHWB 3ENEA 4A3PA 2KX0A 2ZNVC 4ANUA 2GOWA 4DHZB 2R2OA 5JHBA 1AARA 3NHEB 2RR9A 3ZKJC 2MSED 3NS8A 4ANWA 4BFRA 2Z0DB 2K8HA 4NQLB 2C60A 2QHOA 3ZTDA 2FCMA 1WF9A 2GBNA 4FULA 2KTFA 1M94A 1NBFC 2XK5A 4NPNA 1WGYA 3PSEB 2G4SA 3VUWA 2FNJB 2DYMA 2JWZA 1G6JA 4GIVA 1WJNA 2KD0A 3V61A 3A1QA 2KWVB 3L17A 1ISNA 4K1RB 3B0AA 3ZNGC 2IO3B 3EFUA 2J0KA 2G45B 2HE7A 3PS6A 2FUHB 3CSTA 2ASQA 1ZW7A 1V86A 2D11A 3PZDA 4KZCA 3OAWA 2L8JA 2O2VB 1LM8B 2CHXA 5KHOA 2KLCA 3VTVA 4CO7A 1R4MI 4BKSD 4DHJB 2DENB 3U8ZA 1VCBA 3ZO5B 2GMIC 1H4RA 5CHWA 1TZ1A 1WR1A 2RGFA 3N32A
chains in the Genus database with same CATH superfamily
1WXAA 2XN9C 4KX6B 4J3OD 5C23A 4IC7B 2YEPF 1TS2A 1E7PB 2BB6A 2GLSA 2LRUA 3ZGZA 5IO9A 1YD8U 4NAMA 1SE3A 1ZXIA 2WXOA 2LFIA 1L0YB 2WXNA 4PYZA 1E9MA 4FJYA 4IDIA 1Z5SB 3TBLD 1I7HA 1HQRD 1XF5L 3NS1A 4MGKE 2BPSA 5C3JB 3I5JC 3DBRB 4M8MA 2WDRB 1WZ3A 2JYEA 3KQ4A 4IM0A 3PPAA 1HE8A 3V05A 2PE9A 1GB4A 3GE3C 3KLSX 4E3CA 2BYTA 2KFJA 4GDLB 2RDHA 4JIOU 4KV2A 4MM3A 4HRSA 2VH2A 3DBRI 3PZ7A 2EMTA 1EUVB 3VUYA 1SXTA 2KMMA 1FM0D 3Q3MC 4M0WA 4HJKA 2R61A 4MGYE 1PFDA 4WJQA 3KUCB 3RMKC 3UINB 2MBQA 3A9JB 2G3QB 2V4LA 1L5PA 2LHDA 2KN5A 3U4EG 4JLCA 1IP9A 4GMVA 2L05A 3R7RA 2B3AA 4F1SA 3N1YC 2BYFA 3L13A 4BAXA 1XLQA 2Z0EB 3TEXA 3RNCC 5D3IB 4RFBA 4DDGD 4II3B 2N9XA 3QJZA 3UIPB 3L10B 1PUTA 3A33B 3KYCD 4YWGG 2N9EB 3L4PA 4ZRQA 3W1YA 3GP7A 5E6OA 4LNOA 3NVVA 1UGJA 1C78A 2ZVOA 5FR3A 2KMCA 4PK1A 3GZNI 5IOIA 3SFDB 5H8YE 1CMXB 4II2B 3Q2AC 2DZIA 3NRZA 2BGFA 1EM7A 3QQ8B 4HCNB 2CJNA 3Q3NC 2MP2A 1YOVB 1JRUA 5IAAC 4TV3A 2MLBA 3VH4B 4KGRA 3PZ8A 2V1YA 2N9PC 3RD2A 1TTNA 5BYQA 4EOYA 4ARIA 2WQYB 2ZCCA 1WJUA 2KVZA 4IWPA 4MGZE 4LDTD 1Q5WB 3B1LX 3PLVA 4K7SA 4GN1A 4F7ZA 1H8CA 2I2YA 3H9DA 1QZEA 3FAHA 2K5PA 1L4DB 1V5OA 4DXAB 3URYA 2O2VA 2BYVE 2W3SA 1UNSA 3M95A 3L0WB 3HK0A 3DVGX 4AQ7A 2ZEQA 1FIQA 1E6EB 1TKEA 2G9HD 5J2RA 5JHAA 1SE4A 3RT3B 3A9KB 3DBHB 3C0RB 3NZUA 4TQ0A 3B08A 4NJ6A 4RM8A 5JZEB 1NI3A 3DBHI 3AI5A 4ZHPA 4TSSA 1I4PA 2IZVB 3X23A 4O1NA 3RULA 2BT6A 1JWMD 2ON8A 1KOTA 5G2NA 2TSSA 4ITKA 5CHVC 1LXDA 2LXAA 1VZ6A 2RMMA 3AN1A 1T0YA 3CSFA 1BMLC 1XLPA 2SEBD 2GBJA 1PYWD 5EDSA 4JPSA 3EA6A 3NUHB 1V5TA 2FCQA 1RLFA 1B1ZA 3QIJA 2PTLA 3IVFA 3NZSA 1IBXB 1WXMA 4ZYNA 1XD3B 1BXTA 1M4VA 2GBMA 1SIJA 2KFKB 1HXYD 4MELA 5AUKA 1CJEA 1T6BX 2Y5CA 3OWEB 3BVMA 1V49A 1ZOYB 5HG2A 1SBBB 4WWPA 4S0RA 2KXJA 2LGIA 3L08A 4ANXA 3NOBA 2K3UA 1UZXB 1I35A 3WAMA 1ET9A 2KTRA 3VQIA 2MH7A 3QC8B 3ZUNA 1GB1A 2QIEB 1FMAD 2WLBA 2WXGA 5EE1A 1ZDVA 3W1SA 4WAAA 3RPFC 4KKJA 3JYUA 1P3QU 2DAJA 2DBYA 4B0EA 4A3OA 1AWDA 2BQQA 3SEBA 1MFWA 1OFFA 4W9HA 2XEWA 3P2BA 2H88B 2UWQA 3MHSD 4CYEA 2LJ5A 2GI9A 2KX3A 3EHVA 4W9CA 4RGMA 1FNWA 5CHFA 5CTRC 2INDC 2IO1B 3HM6X 3W1SC 4HCPB 1GC6A 1TYGB 2AEHA 1WX9A 2H89B 5DCNA 1L6UA 5GXGB 1P1AA 2IGGA 5DPTA 4NAWA 4HVBA 3DVNU 5BMIA 2C7MB 1SJHD 3M63B 2V3SA 4EZLA 1C4CA 4N58A 1AW7A 3AE2B 1TY2A 4CHKA 2MJDA 5L83A 2EELA 2QILA 3N1ZC 2GBRA 4ZRIA 4GXBA 5G5GA 1L2NA 2I1KA 1P0RA 2JWUA 2KQSA 2K8BA 2HD5B 2DZJA 3HM3A 2EMSA 5EE0A 2QEJC 4GOCA 1VD2A 3VRBB 1XT9B 1NVID 2KN4A 4A9AA 3OLMD 1NDDA 3VTWA 3QCAA 4W9IA 4YSXB 1I4GA 2C9WB 2N9LA 4ZOHC 2V3NA 2DX5B 4G3XB 3RYTA 2J7QB 2N4FA 5EE3A 3W5VB 2JPHA 3SDLC 2NR2A 2FIFA 4WJPA 2BBCA 2DYOA 3AV8A 3U7DA 5FK9C 2D3GA 4GDKB 4XZ4A 1MHHE 1BT0A 2KTRB 1KM7A 3ENEA 2N0SB 5D3DA 1VR9A 3NHEB 2IPKD 2QHOA 3ZTDA 2FCMA 2CU3A 2M19A 2KTFA 1M94A 3AH7A 3VUWA 2WGSA 1G6JA 4HKZE 1WJNA 3L17A 1ISNA 2LGSA 3ZNGC 1HTQA 4YTNB 3MJ5A 1ZW7A 2D11A 3Q14C 3OAWA 1SB3C 2L8JA 1LM8B 2CHXA 2KLCA 4XYCA 2K22A 4N59A 1UWMA 1R4MI 2LHEA 2GMIC 1VZ8A 5CHWA 1YQ4B 1WR1A 1PDXA 3N32A 3FILA 4HPMB 3RNAC 1LQBA 3VVWB 1HEZE 4LTUA 1Q0WB 1Y8RC 3AE8B 1HTOA 4JQWC 4AJYB 5AZFA 5TR5A 4B95A 4NJ7A 1J7AA 2Q5WD 2XBBC 1QF6A 3PV1A 2W82A 1YN4A 2LGDA 3BINA 5BYSA 3NY5A 1ACCA 1PGAA 1T3QA 1L4ZB 4K81A 4E71A 3E9SA 2WXQA 3EC8A 1SEBD 3UF8A 4FN2A 3KYDD 2MBHA 2ZVNA 2HJ8A 1YNTE 2D07B 3PTFC 3U30A 4FXCA 5AZGA 4NAWB 1SIFA 2LVOA 1ZDXA 4LJOB 1K8RB 2A4ZA 3DBSA 1C79A 1LGRA 2D3BA 4A55A 3VXWA 1IBXA 3N1XC 3DHIC 2WXMA 3NG0A 1F2RI 3IHPC 1UBIA 4KGSA 4EFOA 3K9PB 1SSNA 1TS5A 4MH8A 1YJ1A 2LXCA 2MHJA 1I4RA 3HVZA 2DLBA 4WIPA 1JWBD 2MBEA 2W3RA 3H7PB 4OW0A 3TCAA 1I4XA 3ZJUA 1OEYJ 1WMHA 2BS2B 2KVRA 2BW2A 3LJ3A 5MPOA 1ZGUB 4HXDA 1KH0A 3ZLZA 1FXAA 1UGMA 1E7VA 2KDBA 3AU5A 2M56B 3VAWA 2MCNB 3K9OB 2NCNA 1FXTB 2KYWA 4GSWA 1R4NI 3EUB2 1MG4A 2W55A 3LYYA 4KGTA 1DOIA 1UBQA 1BUIC 4LLGM 2QJLA 1PGXA 1N60A 2LASA 1D4BA 4LJPB 1OGWA 4RNAA 4FJZA 3TL5A 5HHDG 3PRMB 1KLVA 2J53A 1MJDA 3NJTA 3EECA 1E5WA 2IY1B 1WGRA 3WAPA 1ET6A 1F0ZA 4DWFA 2M0XA 1V1PA 1DOXA 1FO4A 1MPEA 2ZPYA 1N5WA 2LGXA 1F2RC 4P6VF 4B6WA 2IGHA 1TZOA 2L0TA 5IA7A 2K0PA 2WXFA 3JSVA 3VDZA 3TEZA 4B9KA 4WQMA 3QA8A 1V8CA 2PMVA 3C8YA 2JX5A 3QK0A 4DXGA 3EGRA 4C80A 2DAFA 3CWIA 4ZDVA 3AECB 2RSUA 1IGDA 2Z8LA 4A8XC 4BOSC 4G11A 4BBNC 3Q69A 3U7ZA 2WXHA 1IGCA 1YMHE 4F8CB 1TS3A 2B76B 1QKZA 1FCCC 1E0ZA 1T0SC 3VUXA 5DPSA 5GMVA 1FPYA 1D3ZA 1YQ3B 3UQAA 2JZ3B 4RCOA 4RGOS 2LUEA 4MH0E 2JF5A 2KWCA 5HFYA 4RMAA 1GJZA 2FAZA 1N5XA 4WWNA 1DYQA 1C9FA 2WU2B 4HROA 5BMHA 2IDYA 4HDQA 2FCSA 1TKYA 2INNE 3AEFB 2LD9A 2L7RA 2KZRA 3KVFB 1FCLA 2NS5A 2L52A 2UU7A 3MJWA 4IW0A 4W9LA 1STEA 2KC2A 1A5RA 1ZE3D 1ENFA 1V80A 3HHMA 1VDVA 2MP2B 1Q1OA 2RPVA 1VJKA 1F77A 2DHZA 5LXHA 2AWTA 4C7YA 3N30A 3AEEB 3H1UA 3DVGY 3QX1A 4M8NA 2MRPA 4FLHA 3DWGC 3Q6BA 2WHIA 1V81A 5DPWA 3VFKA 1KLUD 1TT5B 3A4SC 3ZNHB 2JRHA 4WH4A 1C4AA 2KWUB 3U52E 5TSSA 1EWYC 1WRDB 4P7IA 4RF1A 3MC9A 4B0MA 4HEA1 3CMMB 4DK5A 2JY6A 2IO0B 2JXXA 2WDVB 1IYFA 4IUMB 1B9RA 3A1QB 4UDUC 3TIXA 1K52A 2K39A 1TIFA 1XO3A 2WXJA 2C5LC 4M00A 4A20A 3TJPA 2JUOA 3Q8AA 2L3ZA 3T3NA 3SFEB 4KSKC 1FRDA 4LNFA 2MQJA 3ZNZB 2WX0A 3ZJTA 1J19A 4M01A 5BO4B 3UQBA 4KIKB 1WZ0A 4JL9A 1WE6A 4BBNF 4HKQA 3JSVB 1N63A 4XWWA 1GNUA 3WALA 2PJHA 1FFVA 5T8IA 5JH5C 3CF6E 2C7NB 3RN9C 4K7WA 4D2KA 4R3DA 1J7CA 3BVGA 5E6PA 4NNJB 4DDID 4IM3A 4KSLC 2BYEA 4S17A 1JWAD 4AP4C 2BKFA 5CX3A 2CKHB 2K25A 1EF1A 4DBGA 4FADA 1F1HA 2YEPB 2D3CA 2L83A 4YSYB 5L95C 4DHJD 2C7HA 1V6EA 2IYDB 1DOYA 4ANVA 1UD7A 1SJED 4LNNA 3U2SC 3BVZA 2D3AA 1VRAB 2ZNVC 4ANWA 2C60A 2WS3B 4NJCA 1CK1A 2XK5A 1NBFC 3IT4B 1WGYA 3PSEB 2G4SA 2DYMA 3RI7C 2JWZA 4DXFA 3ZYYX 3A1QA 1GPXA 1YJIA 4K1RB 1HZ6A 2IO3B 2J0KA 2G45B 2ONQA 4US9A 2FUHB 3CSTA 2ASQA 4HPPA 4A90A 4US8A 5KHOA 1I4HA 4CO7A 1XCTL 3I9V1 2RGFA 4GU2A 1R7SA 3GOEA 5C2TB 4EEWA 1ESFA 2KKCA 5DPRA 1NEKB 1F52A 3C19A 3QAQA 5D7GA 4C7ZA 1C1YB 3UI3A 2LUMA 4PYUA 3AE6B 2VRRB 3Q8BA 2O6VB 2N7JA 3PREA 2BF8B 4GGQA 5HI1A 3GS2A 3O13A 1WH3A 3APDA 4XE0A 2PPHA 3EFCA 3L16A 2QMTA 2ZPNA 2OHFA 1EWCA 3VRAB 2KFKA 2CR5A 1V2YA 1WSPA 3R2IA 1QOGA 5JXVA 4PS7A 2V4IB 2K1FA 1QOAA 2MJ3A 2N1WA 3N3KB 2M17A 4OZCA 4MDKE 2JYTA 4I6PA 4MACA 2JXTA 1FNVA 3P1MA 4HWIB 2V0GA 2VH1A 3DVNV 2ACZB 4FJVB 2KACA 3BIID 3AMZA 1TS4A 2BKRB 2IY0B 3DCGA 1RFAA 4USAA 2WXKA 1GC7A 2NPTA 1YJJA 5LNK1 1D5MC 2Y5BB 1E8ZA 2KQ4X 3I57A 2L32A 1QQRA 1TY0A 2KDIA 3PO0A 1WWTA 1Q10A 4NZLB 2BTEA 2JVCA 3AU4A 4WQOB 3V6CB 4MSMB 2BWES 4ZRKA 1YQBA 4RGNA 2AL6A 3RUIB 3R7QA 2ZCBA 2E6XA 1JWUD 4AJWA 3PRZA 2I38A 3ZDTA 1WYGA 4TUUA 2HTME 2YVCA 3DPDA 3OG5A 2X38A 1Y56A 3IT6B 3B2FA 4KZ0A 3ZXVA 2KNBA 4PT5A 1UH6A 5KHQA 3R8BA 2DZKA 1QOFA 3DHHC 3A4RA 2GRIA 5E6JA 2X8XX 2KT7A 2CHWA 3APFA 2NTTA 3BK2A 3MC0B 3P4PB 4WJNA 3AEAB 1MG8A 3BY4B 1C3TA 3PHXB 5FR6A 1V97A 2ZZPB 1D5XC 2FUG1 3UIOB 3PGEA 3ML8A 1XLNA 4WWMA 4ZRPA 1V9JA 1P7FA 3BZDB 2MJEA 2J0MA 1XEEA 3R3MA 4KIKA 2WXPA 2N7DA 2D5GA 4K3CA 3SD5A 2MA9B 2CJOA 4BOZB 3ALBA 2M0AA 3H7SA 2MBBB 2WXRA 2IBIB 1WRIA 3GE8C 3BYTB 2D2QA 3E56A 2AQ3B 2VZKB 1L0XB 4GDKA 2E3TA 4M02A 1EU3A 4L1BA 3IBEA 3LDZE 2JZZA 3WCQA 4QAYA 4HDOA 4YTPB 2IO2B 5EE9A 3OJ4B 3WANA 4YSZB 2KK8A 4Q2JA 4C56C 1L6VA 2WXLA 2PE6B 3ZRFA 4XGAB 3RNBC 4EZKA 2N9KA 4RM9A 2KMAA 3FC4A 4IWQA 3NZ3A 3AEDB 2PVGC 3JW0X 4XDDA 1E10A 2M4NA 3UGBB 3BYYB 4KKIA 3RZWC 4P1CC 3QHTA 1JWSD 1TJEA 3ZVVA 1CQVA 3WIMA 3MFGA 3V62A 4BKSA 4FA6A 5J17A 1IUEA 1JW9D 2KO3A 2REXA 3P4QB 3BWUD 4G0NB 2HDEA 4BKTA 4AS1A 3N20C 3PVLA 4YT0B 3P63A 1J0GA 1JRPA 2BB5A 4GLSC 3VH3B 2V3PA 1WR6E 3N9YC 2MX2A 2K8CA 1LO5D 5E6NA 4OHJA 3DBLB 3APCA 1V1OA 3V3XA 4IG7B 2KAJA 2NVUI 1EU4A 5C1ZA 2PW9A 1OTRB 2EKIA 2D10A 1K50A 4MM3B 3V6EB 1OQYA 1RYJA 1S3SG 2M1MA 3Q8FA 4EZJA 5G5HA 2WXIA 1P7EA 1WJ6A 2UYZB 1PQSA 2KJHB 1J8CA 1I4QA 1YX6B 1ZUD2 4I6LB 4BVUC 1L7YA 2M8SA 1PGBA 3DOWA 2MEKA 4PS3A 2KQ7A 5AZHA 4A6QA 3H7PA 1SE9A 2LEKA 2BVCA 4J6IA 4ICVA 1GOZA 2KDMA 2CHZA 3AE4B 5IKCM 2LMCA 1WIAA 2KHWB 2XNAC 1NENB 4W9KA 4XDCA 3M62B 4JE3B 3O65B 1JCKB 4XC2A 4YTMB 1VZ7A 2IJ0A 1V1PB 4ZHOA 4RGTA 1WGGA 2FCNA 2NPTB 1OEYA 1YN3A 2KC1A 2INPE 3ONSA 1QILA 1TGZB 2N1VA 3T8MA 3B2GA 3ZXRA 1KJTA 1WJ4A 2OJRA 3AE7B 4TKNA 3TMPB 1XCQL 1SF0A 4KDLB 1QOBA 1KFYB 1IPGA 1WM2A 1GAQB 3QARA 2WWZA 3PT2B 5HKHA 3TEWA 4P16A 4EE2A 3I63C 2LWPA 1T0QC 4C00A 2IGDA 4WURA 1NYRA 3MHZA 5JHBA 4ANUA 1AARA 2RR9A 4BFRA 2MSED 3NS8A 2Z0DB 2K8HA 4L2YA 1ROEA 1KLGD 1WF9A 3FKYA 4BZAA 4TMAB 1R4NB 4FULA 4C4VA 2FNJB 4GIVA 2KD0A 3R2TA 3V61A 1WXQA 2RDBC 3B0AA 1KF6B 1V86A 3H8HA 4KZCA 1C76A 1SE2A 3VTVA 2WNMA 4DHJB 3CIRB 2DENB 3U8ZA 1VCBA 3ZO5B 1N6ZA 1TZ1A 4OZAA 2OEDA 3LXFA 4EKUA 4OZBA 3RFZB 3SHQA 5FKAC 2DYBA 1TKGA 2VZKD 4YXDB 1WI0A 2WDTB 3L54A 2WP9B 3NVWA 4HJGE 1WXSA 3OJ3A 4G50A 2GBKA 4JWSC 4HPLB 2KDEB 1SGHA 2LRWA 2AYOB 1WGKA 3VHTC 4MT5A 1RFKA 1QLBB 4W9DA 3BK1A 4K7UA 2MBOA 3Q8EA 2KANA 4OVVA 2ZJDA 2INCC 3AXCA 2QSDA 5LXIB 4TQ1A 1YN5A 2A5UA 5BMGA 1C77A 2W9NA 2RPQA 3R66C 2DZMA 4RF0A 2J0JA 3W5UB 4W9GA 3J9CA 1E7UA 4ZRJA 1EF5A 2ZNVB 3RNGC 3KH0A 1FXIA 2O6VD 2LI5A 2QC8A 1X1MA 3HUIA 1DGJA 4W9JA 1AN8A 4MGIE 2NMQA 3VTUA 1EO6A 1R4MB 4DQOC 1RAXA 5IN7A 1C4PA 4LDTB 5AEKB 4NY0A 3AB5A 2N7EA 2ICIA 3AE9B 5H92C 2CU1A 2XK5B 1UELA 3Q8CA 2CS4A 2KLGA 1FNUA 4IWOA 1A70A 3KW5B 4GB9A 1FRRA 4X57B 3D32A 3ECIA 1WX8A 3WA0A 4ZYSA 3TUOA 1MHXA 2RDGA 1N61A 2RD0A 2G1EA 2V9HA 4AUQC 3HRDD 4LCDE 5D94A 2G4DB 4N6EB 3ZNID 2AL3A 2AQ2B 2JZPA 1RRBA 2R2QA 3AE5B 1WXVA 4ASWC 1RM6C 1MVKA 3GB1A 4P1BC 2HTHA 3GZNB 3IXSA 4JWUC 4AWJA 2QDFA 2FIDA 1WX7A 4BKGA 1FFUA 3KUZA 4K3BA 1HA5A 2KWDA 3Q3OC 1P98A 4LK0M 5LLIA 2QCZA 2I1JA 2JRIB 2SAKA 2WDQB 1QT9A 3T9LA 1UF0A 4EUTA 4ICUA 1F9JA 3IAS1 3AEGB 3AULA 4KVGB 3RZFA 4ACFA 2OOBB 3KUDB 1JMLA 5AUIA 1JALA 1P9DU 2L1AA 3SR6A 2J42A 3Q3FA 4MEMA 1T0RC 3P4SB 1WM3A 3AEBB 3ABVB 1I42A 3MC8A 1Z2MA 1L0VB 4H2AA 3W9CB 5J18A 3FILB 4C4VB 3RNFC 2Y5PA 3RNEC 4CQNA 1E8WA 2AQ1B 2O6VA 1RWSA 2OJWA 3SU8X 1HZ5A 4JGHB 5D2MB 4W9EA 2WYQA 3PLUA 3M3JA 2DWQA 3P4RB 4MJSB 1NYQA 1LFDA 3B9JA 3ZRCA 1WY8A 2LVQA 3MTNB 4N9F4 1AYFA 3AM9A 2L00B 3TEYA 2LGYA 3DWMA 3IFWB 1E8XA 4REZA 2MW5A 1E8YA 1J7BA 3W2DA 2DNFA 1JROA 3DQVA 2PKOA 5D6JB 3X0WA 3IG3A 1YIWA 1U4AA 1MI0A 1YX5B 2PLPA 1WGDA 2HJ1A 2NTSA 5BYRA 2FE8A 3JVZX 2PEAA 4XX5A 3ZTCA 4L23A 2WU5B 1JQ4A 3ZDMC 1K51A 2YLMA 2BS3B 3A9JA 3AE1B 2MWSB 2NBWB 3S2AA 3HIZA 3ZIMA 3VR9B 1S1QB 2BWFA 2JQRB 2FBWB 2GB1A 4FBJB 1VLBA 2ZW0A 3LB8C 5IP4D 3I3TB 3T3OA 1XQQA 4URKA 1ZKHA 1KRHA 2PIAA 4XWTA 2KJ6A 2LVPA 3ZQ4A 4RH6A 2K6QA 4KDIC 1GUAB 1ZXHA 1OQRA 2JT4B 4FHJA 4WWOA 4DHZE 1ZP0B 2Z59B 2BS4B 4GDLA 1NI2A 2KDFB 4W9FA 1WE7A 3DDCB 3RCZA 3V60A 2K9XA 3ML9A 2J4XA 3IAM1 4PS8A 2EKEC 5I4DA 3DBLI 2L0FA 3DHGC 2JSVX 4NQKE 5G55A 3ZW3A 4YL8A 3ZJVA 3A9KA 1WMHB 1TBEA 1WYWB 4E74A 3KWVA 4LNIA 1D5ZC 3PRPB 1GG3A 2WX1A 4OVUA 1UUPA 4MJSA 1CZPA 1FEHA 2LZ6A 4HK2A 1T5XD 2KJRA 3TSSA 4HLEA 2NBVB 3Q3JA 4I6NB 4AOFA 1N62A 1KTKA 3WAOA 1UWXA 2AX5A 4IM2A 4JX1C 3KWLA 4M0WB 4FHKA 1WGHA 1E90A 4MSQB 2K6DB 2L76A 3H6NA 3VR8B 4WJOA 2NBUA 2ZW1A 3MP9A 2KOXA 4ARCA 3QWZB 1K53A 4LNKA 2LJIA 2Y3AA 1WFYA 4A3PA 3PHWB 2KX0A 4DHZB 2GOWA 3ETRA 2R2OA 1OQQA 3NVZA 3ZKJC 4NQLB 1XLOA 2GBNA 1ZPSA 4NPNA 2KWVB 3HVDA 3AE3B 3EFUA 2HE7A 3PS6A 2W54A 3PZDA 2JU6X 2J52A 3P42A 1XXGA 2O2VB 4WAFA 2PVOD 4OVZA 4IOIE 4BKSD 1D6EC 4IKGA 3NVYA 1H4RA 1FD6A
chains in the Genus database with same CATH topology
4EKUA 3GOEA 1WXAA 4HPMB 4EEWA 1LQBA 3VVWB 3SHQA 1Q0WB 2KKCA 5DPRA 2DYBA 1Y8RC 4IC7B 5C23A 1WI0A 2WDTB 3L54A 3QAQA 5D7GA 2LRUA 4JQWC 1C1YB 4AJYB 1YD8U 5AZFA 1WXSA 5TR5A 4B95A 3OJ3A 4NJ7A 4G50A 4PYUA 2GBKA 4PYZA 2XBBC 4FJYA 1Z5SB 2VRRB 4HPLB 2O6VB 3PV1A 3TBLD 2KDEB 1SGHA 3PREA 2BF8B 2LRWA 4GGQA 2AYOB 4MGKE 2BPSA 3VHTC 2LGDA 1WH3A 3APDA 3BINA 2PPHA 3NY5A 4M8MA 3L16A 2ZPNA 1WZ3A 4W9DA 4IM0A 3PPAA 1HE8A 4K81A 2KFKA 4E71A 3EC8A 2PE9A 2CR5A 3UF8A 4FN2A 1V2YA 3KYDD 2MBHA 4E3CA 4K7UA 2ZVNA 2HJ8A 2KFJA 2MBOA 4GDLB 2KANA 4JIOU 4OVVA 2ZJDA 4KV2A 4MM3A 4PS7A 3AXCA 2D07B 3DBRI 2EMTA 2K1FA 3PTFC 3U30A 1EUVB 3VUYA 5AZGA 4NAWB 5LXIB 1SIFA 2N1WA 2LVOA 4TQ1A 3N3KB 2A5UA 4LJOB 1K8RB 2A4ZA 3DBSA 2M17A 2W9NA 4MDKE 2RPQA 4I6PA 3R66C 4HJKA 2DZMA 2J0JA 3VXWA 4MGYE 4HWIB 4W9GA 1E7UA 4ZRJA 3DVNV 1EF5A 4WJQA 4FJVB 3KUCB 2ZNVB 3KH0A 3UINB 3IHPC 1UBIA 2O6VD 2MBQA 2BKRB 2LI5A 3A9JB 4GU2A 4EFOA 2IY0B 3DCGA 1RFAA 2G3QB 1X1MA 2V4LA 4W9JA 1GC7A 2KN5A 3K9PB 4MGIE 2NPTA 4JLCA 1YJ1A 4GMVA 2LXCA 1IP9A 2L05A 3R7RA 2B3AA 3VTUA 1EO6A 4F1SA 2BYFA 3L13A 2Y5BB 1E8ZA 2MBEA 3H7PB 1RAXA 4LDTB 3TCAA 2Z0EB 5AEKB 4NY0A 1OEYJ 1WMHA 4DDGD 2N7EA 2KVRA 4II3B 2N9XA 2KDIA 2CU1A 3QJZA 3UIPB 2XK5B 3L10B 1UELA 3LJ3A 3A33B 1ZGUB 4HXDA 2JVCA 3AU4A 3KYCD 2CS4A 1UGMA 2KLGA 2N9EB 4WQOB 3V6CB 3ZLZA 3W1YA 4IWOA 4MSMB 2BWES 3KW5B 4ZRKA 1E7VA 1YQBA 5E6OA 4GB9A 2KDBA 3AU5A 2AL6A 3RUIB 3R7QA 2ZCBA 2ZVOA 4X57B 3VAWA 3D32A 3ECIA 3K9OB 1WX8A 2KMCA 2MCNB 3GZNI 3WA0A 2NCNA 4AJWA 1FXTB 1CMXB 4II2B 3PRZA 2DZIA 4GSWA 2BGFA 1R4NI 3ZDTA 3QQ8B 4HCNB 4TUUA 2MP2A 2RD0A 1JRUA 2YVCA 3DPDA 4AUQC 5IAAC 4TV3A 2MLBA 4LCDE 5D94A 1UBQA 2G4DB 4KZ0A 3VH4B 2KNBA 3ZNID 2V1YA 2N9PC 3RD2A 2AL3A 1UH6A 5KHQA 1TTNA 4EOYA 2DZKA 1RRBA 2R2QA 2LASA 2ZCCA 4LJPB 1OGWA 1WXVA 4ASWC 1WJUA 4IWPA 4FJZA 4MGZE 3A4RA 4LDTD 3TL5A 1Q5WB 3B1LX 3PLVA 4K7SA 2CHWA 3APFA 4GN1A 4F7ZA 4WJNA 1H8CA 3H9DA 1MG8A 3BY4B 3PRMB 2HTHA 1C3TA 1KLVA 1QZEA 3PHXB 5FR6A 4AWJA 1V5OA 2FIDA 1WX7A 2ZZPB 3EECA 4DXAB 1E5WA 3KUZA 3UIOB 4BKGA 2IY1B 3PGEA 1WGRA 2O2VA 3ML8A 2BYVE 3WAPA 1V9JA 1P98A 4DWFA 2M0XA 5LLIA 3M95A 2I1JA 2J0MA 2JRIB 3L0WB 3HK0A 3DVGX 2ZPYA 3T9LA 2ZEQA 2LGXA 3R3MA 4KIKA 4EUTA 4B6WA 4ICUA 5J2RA 5JHAA 2L0TA 2N7DA 5IA7A 1F9JA 3JSVA 3VDZA 3RT3B 3AULA 4KVGB 3SD5A 4B9KA 3A9KB 3RZFA 2MA9B 3QA8A 4BOZB 3ALBA 3C0RB 2OOBB 3QK0A 3KUDB 3H7SA 3NZUA 4TQ0A 3B08A 4NJ6A 4RM8A 2MBBB 5JZEB 3DBHI 1P9DU 2IBIB 3AI5A 2DAFA 4ZDVA 3Q3FA 2RSUA 4MEMA 2IZVB 2D2QA 3X23A 3RULA 1WM3A 4BOSC 4G11A 4BBNC 1KOTA 4GDKA 5G2NA 1I42A 5CHVC 1Z2MA 4F8CB 1LXDA 2LXAA 3IBEA 5J18A 3LDZE 3VUXA 1T0YA 2JZZA 5DPSA 5GMVA 1D3ZA 3CSFA 1E8WA 3UQAA 2O6VA 4HDOA 2GBJA 2JZ3B 2IO2B 3SU8X 3OJ4B 2LUEA 3WANA 4MH0E 2KWCA 2JF5A 2KK8A 4JGHB 4RMAA 1GJZA 5EDSA 2FAZA 4WWNA 1V5TA 2FCQA 1RLFA 4HDQA 5D2MB 2FCSA 4W9EA 2PE6B 3QIJA 2WYQA 3ZRFA 2LD9A 2L7RA 2KZRA 3KVFB 3PLUA 2NS5A 3IVFA 3MJWA 3M3JA 4IW0A 3NZSA 4EZKA 4RM9A 2KMAA 4IWQA 4W9LA 2KC2A 1WXMA 4MJSB 1A5RA 1LFDA 4ZYNA 3JW0X 3ZRCA 1WY8A 1V80A 1XD3B 2LVQA 2M4NA 3MTNB 4N9F4 3UGBB 2GBMA 2KFKB 3HHMA 4MELA 2MP2B 1Q1OA 2L00B 3RZWC 3QHTA 2LGYA 1V49A 2DHZA 5LXHA 2AWTA 3N30A 3ZVVA 3H1UA 4WWPA 3WIMA 3IFWB 1E8XA 3DVGY 3QX1A 2KXJA 4M8NA 2MRPA 4FLHA 3V62A 2MW5A 1E8YA 4BKSA 4FA6A 5J17A 2KO3A 2REXA 4G0NB 3DQVA 5D6JB 3L08A 3X0WA 1V81A 3IG3A 1YIWA 4ANXA 5DPWA 1U4AA 3VFKA 1YX5B 3NOBA 4BKTA 1WGDA 1UZXB 1I35A 3JVZX 3PVLA 3WAMA 1J0GA 2KTRA 2PEAA 3VQIA 4XX5A 3A4SC 3ZNHB 3QC8B 2JRHA 3ZUNA 3ZTCA 3VH3B 2KWUB 1WR6E 1WRDB 4P7IA 2MX2A 2K8CA 3W1SA 5E6NA 3ZDMC 3A9JA 2YLMA 3CMMB 3APCA 2JY6A 4WAAA 4DK5A 2MWSB 2IO0B 4IG7B 3JYUA 2NVUI 2NBWB 2JXXA 3S2AA 3HIZA 1P3QU 2DAJA 3ZIMA 5C1ZA 1IYFA 4A3OA 1S1QB 4IUMB 1OTRB 2BWFA 4W9HA 2XEWA 2D10A 3A1QB 3V6EB 4FBJB 1OQYA 3TIXA 3P2BA 2UWQA 3I3TB 3MHSD 1XQQA 1S3SG 2M1MA 4CYEA 1ZKHA 2LJ5A 4EZJA 4URKA 2KX3A 2K39A 1WJ6A 2KJ6A 2UYZB 2LVPA 1PQSA 2KJHB 3EHVA 4W9CA 1J8CA 1YX6B 5CHFA 4I6LB 4BVUC 5CTRC 1L7YA 2C5LC 2M8SA 3DOWA 2IO1B 2K6QA 3HM6X 4PS3A 4A20A 3W1SC 4HCPB 4KDIC 3TJPA 1GUAB 1GC6A 2JT4B 2KQ7A 2JUOA 4FHJA 4WWOA 4DHZE 2Z59B 2AEHA 4GDLA 2L3ZA 1WX9A 1NI2A 2KDFB 5DCNA 5AZHA 3H7PA 1P1AA 4KSKC 4W9FA 1SE9A 5DPTA 1WE7A 3DDCB 3RCZA 4NAWA 3V60A 4HVBA 2MQJA 3ZNZB 3DVNU 2WX0A 3ML9A 4J6IA 4ICVA 4PS8A 2EKEC 1J19A 2C7MB 5BO4B 3DBLI 2V3SA 3M63B 2CHZA 2L0FA 4EZLA 3UQBA 4KIKB 1WZ0A 4JL9A 1WE6A 4BBNF 1WIAA 4NQKE 5G55A 3ZW3A 4YL8A 2KHWB 3JSVB 4CHKA 1GNUA 4W9KA 3A9KA 3M62B 3WALA 1WMHB 2PJHA 5L83A 1TBEA 5JH5C 1WYWB 4ZRIA 2GBRA 3O65B 3CF6E 4XC2A 4GXBA 4E74A 2C7NB 1L2NA 2I1KA 3PRPB 4K7WA 1P0RA 1GG3A 2KQSA 1WGGA 2K8BA 2FCNA 2NPTB 2WX1A 4OVUA 5E6PA 1OEYA 2HD5B 4NNJB 4DDID 2DZJA 4IM3A 3HM3A 2KC1A 2EMSA 3ONSA 4MJSA 1TGZB 2LZ6A 4HK2A 4KSLC 2BYEA 2N1VA 3T8MA 2KJRA 4GOCA 1VD2A 4AP4C 4HLEA 1KJTA 1WJ4A 2BKFA 1XT9B 2NBVB 2OJRA 2CKHB 5CX3A 2K25A 3Q3JA 1EF1A 4DBGA 3OLMD 4I6NB 1NDDA 3VTWA 4TKNA 3WAOA 4AOFA 3QCAA 4W9IA 3TMPB 4FADA 2C9WB 2DX5B 4IM2A 4G3XB 3RYTA 2J7QB 2N4FA 4M0WB 2JPHA 3SDLC 4FHKA 1WGHA 2NR2A 2FIFA 4KDLB 4WJPA 1IPGA 1E90A 1WM2A 4MSQB 5L95C 4DHJD 3QARA 2C7HA 1V6EA 2K6DB 2L76A 2WWZA 3PT2B 2IYDB 5HKHA 2DYOA 4ANVA 3H6NA 4WJOA 3U7DA 1UD7A 2D3GA 2NBUA 2LWPA 4GDKB 2KOXA 4XZ4A 3QWZB 1BT0A 2KTRB 1WFYA 1KM7A 3PHWB 3ENEA 4A3PA 2KX0A 2ZNVC 4ANUA 2GOWA 4DHZB 2R2OA 5JHBA 1AARA 3NHEB 2RR9A 3ZKJC 2MSED 3NS8A 4ANWA 4BFRA 2Z0DB 2K8HA 4NQLB 2C60A 2QHOA 3ZTDA 2FCMA 1WF9A 2GBNA 4FULA 2KTFA 1M94A 1NBFC 2XK5A 4NPNA 1WGYA 3PSEB 2G4SA 3VUWA 2FNJB 2DYMA 2JWZA 1G6JA 4GIVA 1WJNA 2KD0A 3V61A 3A1QA 2KWVB 3L17A 1ISNA 4K1RB 3B0AA 3ZNGC 2IO3B 3EFUA 2J0KA 2G45B 2HE7A 3PS6A 2FUHB 3CSTA 2ASQA 1ZW7A 1V86A 2D11A 3PZDA 4KZCA 3OAWA 2L8JA 2O2VB 1LM8B 2CHXA 5KHOA 2KLCA 3VTVA 4CO7A 1R4MI 4BKSD 4DHJB 2DENB 3U8ZA 1VCBA 3ZO5B 2GMIC 1H4RA 5CHWA 1TZ1A 1WR1A 2RGFA 3N32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKU A;  3GOE A;  1WXA A;  4HPM B;  4EEW A;  1LQB A;  3VVW B;  3SHQ A;  1Q0W B;  2KKC A;  5DPR A;  2DYB A;  1Y8R C;  4IC7 B;  5C23 A;  1WI0 A;  2WDT B;  3L54 A;  3QAQ A;  5D7G A;  2LRU A;  4JQW C;  1C1Y B;  4AJY B;  1YD8 U;  5AZF A;  1WXS A;  5TR5 A;  4B95 A;  3OJ3 A;  4NJ7 A;  4G50 A;  4PYU A;  2GBK A;  4PYZ A;  2XBB C;  4FJY A;  1Z5S B;  2VRR B;  4HPL B;  2O6V B;  3PV1 A;  3TBL D;  2KDE B;  1SGH A;  3PRE A;  2BF8 B;  2LRW A;  4GGQ A;  2AYO B;  4MGK E;  2BPS A;  3VHT C;  2LGD A;  1WH3 A;  3APD A;  3BIN A;  2PPH A;  3NY5 A;  4M8M A;  3L16 A;  2ZPN A;  1WZ3 A;  4W9D A;  4IM0 A;  3PPA A;  1HE8 A;  4K81 A;  2KFK A;  4E71 A;  3EC8 A;  2PE9 A;  2CR5 A;  3UF8 A;  4FN2 A;  1V2Y A;  3KYD D;  2MBH A;  4E3C A;  4K7U A;  2ZVN A;  2HJ8 A;  2KFJ A;  2MBO A;  4GDL B;  2KAN A;  4JIO U;  4OVV A;  2ZJD A;  4KV2 A;  4MM3 A;  4PS7 A;  3AXC A;  2D07 B;  3DBR I;  2EMT A;  2K1F A;  3PTF C;  3U30 A;  1EUV B;  3VUY A;  5AZG A;  4NAW B;  5LXI B;  1SIF A;  2N1W A;  2LVO A;  4TQ1 A;  3N3K B;  2A5U A;  4LJO B;  1K8R B;  2A4Z A;  3DBS A;  2M17 A;  2W9N A;  4MDK E;  2RPQ A;  4I6P A;  3R66 C;  4HJK A;  2DZM A;  2J0J A;  3VXW A;  4MGY E;  4HWI B;  4W9G A;  1E7U A;  4ZRJ A;  3DVN V;  1EF5 A;  4WJQ A;  4FJV B;  3KUC B;  2ZNV B;  3KH0 A;  3UIN B;  3IHP C;  1UBI A;  2O6V D;  2MBQ A;  2BKR B;  2LI5 A;  3A9J B;  4GU2 A;  4EFO A;  2IY0 B;  3DCG A;  1RFA A;  2G3Q B;  1X1M A;  2V4L A;  4W9J A;  1GC7 A;  2KN5 A;  3K9P B;  4MGI E;  2NPT A;  4JLC A;  1YJ1 A;  4GMV A;  2LXC A;  1IP9 A;  2L05 A;  3R7R A;  2B3A A;  3VTU A;  1EO6 A;  4F1S A;  2BYF A;  3L13 A;  2Y5B B;  1E8Z A;  2MBE A;  3H7P B;  1RAX A;  4LDT B;  3TCA A;  2Z0E B;  5AEK B;  4NY0 A;  1OEY J;  1WMH A;  4DDG D;  2N7E A;  2KVR A;  4II3 B;  2N9X A;  2KDI A;  2CU1 A;  3QJZ A;  3UIP B;  2XK5 B;  3L10 B;  1UEL A;  3LJ3 A;  3A33 B;  1ZGU B;  4HXD A;  2JVC A;  3AU4 A;  3KYC D;  2CS4 A;  1UGM A;  2KLG A;  2N9E B;  4WQO B;  3V6C B;  3ZLZ A;  3W1Y A;  4IWO A;  4MSM B;  2BWE S;  3KW5 B;  4ZRK A;  1E7V A;  1YQB A;  5E6O A;  4GB9 A;  2KDB A;  3AU5 A;  2AL6 A;  3RUI B;  3R7Q A;  2ZCB A;  2ZVO A;  4X57 B;  3VAW A;  3D32 A;  3ECI A;  3K9O B;  1WX8 A;  2KMC A;  2MCN B;  3GZN I;  3WA0 A;  2NCN A;  4AJW A;  1FXT B;  1CMX B;  4II2 B;  3PRZ A;  2DZI A;  4GSW A;  2BGF A;  1R4N I;  3ZDT A;  3QQ8 B;  4HCN B;  4TUU A;  2MP2 A;  2RD0 A;  1JRU A;  2YVC A;  3DPD A;  4AUQ C;  5IAA C;  4TV3 A;  2MLB A;  4LCD E;  5D94 A;  1UBQ A;  2G4D B;  4KZ0 A;  3VH4 B;  2KNB A;  3ZNI D;  2V1Y A;  2N9P C;  3RD2 A;  2AL3 A;  1UH6 A;  5KHQ A;  1TTN A;  4EOY A;  2DZK A;  1RRB A;  2R2Q A;  2LAS A;  2ZCC A;  4LJP B;  1OGW A;  1WXV A;  4ASW C;  1WJU A;  4IWP A;  4FJZ A;  4MGZ E;  3A4R A;  4LDT D;  3TL5 A;  1Q5W B;  3B1L X;  3PLV A;  4K7S A;  2CHW A;  3APF A;  4GN1 A;  4F7Z A;  4WJN A;  1H8C A;  3H9D A;  1MG8 A;  3BY4 B;  3PRM B;  2HTH A;  1C3T A;  1KLV A;  1QZE A;  3PHX B;  5FR6 A;  4AWJ A;  1V5O A;  2FID A;  1WX7 A;  2ZZP B;  3EEC A;  4DXA B;  1E5W A;  3KUZ A;  3UIO B;  4BKG A;  2IY1 B;  3PGE A;  1WGR A;  2O2V A;  3ML8 A;  2BYV E;  3WAP A;  1V9J A;  1P98 A;  4DWF A;  2M0X A;  5LLI A;  3M95 A;  2I1J A;  2J0M A;  2JRI B;  3L0W B;  3HK0 A;  3DVG X;  2ZPY A;  3T9L A;  2ZEQ A;  2LGX A;  3R3M A;  4KIK A;  4EUT A;  4B6W A;  4ICU A;  5J2R A;  5JHA A;  2L0T A;  2N7D A;  5IA7 A;  1F9J A;  3JSV A;  3VDZ A;  3RT3 B;  3AUL A;  4KVG B;  3SD5 A;  4B9K A;  3A9K B;  3RZF A;  2MA9 B;  3QA8 A;  4BOZ B;  3ALB A;  3C0R B;  2OOB B;  3QK0 A;  3KUD B;  3H7S A;  3NZU A;  4TQ0 A;  3B08 A;  4NJ6 A;  4RM8 A;  2MBB B;  5JZE B;  3DBH I;  1P9D U;  2IBI B;  3AI5 A;  2DAF A;  4ZDV A;  3Q3F A;  2RSU A;  4MEM A;  2IZV B;  2D2Q A;  3X23 A;  3RUL A;  1WM3 A;  4BOS C;  4G11 A;  4BBN C;  1KOT A;  4GDK A;  5G2N A;  1I42 A;  5CHV C;  1Z2M A;  4F8C B;  1LXD A;  2LXA A;  3IBE A;  5J18 A;  3LDZ E;  3VUX A;  1T0Y A;  2JZZ A;  5DPS A;  5GMV A;  1D3Z A;  3CSF A;  1E8W A;  3UQA A;  2O6V A;  4HDO A;  2GBJ A;  2JZ3 B;  2IO2 B;  3SU8 X;  3OJ4 B;  2LUE A;  3WAN A;  4MH0 E;  2KWC A;  2JF5 A;  2KK8 A;  4JGH B;  4RMA A;  1GJZ A;  5EDS A;  2FAZ A;  4WWN A;  1V5T A;  2FCQ A;  1RLF A;  4HDQ A;  5D2M B;  2FCS A;  4W9E A;  2PE6 B;  3QIJ A;  2WYQ A;  3ZRF A;  2LD9 A;  2L7R A;  2KZR A;  3KVF B;  3PLU A;  2NS5 A;  3IVF A;  3MJW A;  3M3J A;  4IW0 A;  3NZS A;  4EZK A;  4RM9 A;  2KMA A;  4IWQ A;  4W9L A;  2KC2 A;  1WXM A;  4MJS B;  1A5R A;  1LFD A;  4ZYN A;  3JW0 X;  3ZRC A;  1WY8 A;  1V80 A;  1XD3 B;  2LVQ A;  2M4N A;  3MTN B;  4N9F 4;  3UGB B;  2GBM A;  2KFK B;  3HHM A;  4MEL A;  2MP2 B;  1Q1O A;  2L00 B;  3RZW C;  3QHT A;  2LGY A;  1V49 A;  2DHZ A;  5LXH A;  2AWT A;  3N30 A;  3ZVV A;  3H1U A;  4WWP A;  3WIM A;  3IFW B;  1E8X A;  3DVG Y;  3QX1 A;  2KXJ A;  4M8N A;  2MRP A;  4FLH A;  3V62 A;  2MW5 A;  1E8Y A;  4BKS A;  4FA6 A;  5J17 A;  2KO3 A;  2REX A;  4G0N B;  3DQV A;  5D6J B;  3L08 A;  3X0W A;  1V81 A;  3IG3 A;  1YIW A;  4ANX A;  5DPW A;  1U4A A;  3VFK A;  1YX5 B;  3NOB A;  4BKT A;  1WGD A;  1UZX B;  1I35 A;  3JVZ X;  3PVL A;  3WAM A;  1J0G A;  2KTR A;  2PEA A;  3VQI A;  4XX5 A;  3A4S C;  3ZNH B;  3QC8 B;  2JRH A;  3ZUN A;  3ZTC A;  3VH3 B;  2KWU B;  1WR6 E;  1WRD B;  4P7I A;  2MX2 A;  2K8C A;  3W1S A;  5E6N A;  3ZDM C;  3A9J A;  2YLM A;  3CMM B;  3APC A;  2JY6 A;  4WAA A;  4DK5 A;  2MWS B;  2IO0 B;  4IG7 B;  3JYU A;  2NVU I;  2NBW B;  2JXX A;  3S2A A;  3HIZ A;  1P3Q U;  2DAJ A;  3ZIM A;  5C1Z A;  1IYF A;  4A3O A;  1S1Q B;  4IUM B;  1OTR B;  2BWF A;  4W9H A;  2XEW A;  2D10 A;  3A1Q B;  3V6E B;  4FBJ B;  1OQY A;  3TIX A;  3P2B A;  2UWQ A;  3I3T B;  3MHS D;  1XQQ A;  1S3S G;  2M1M A;  4CYE A;  1ZKH A;  2LJ5 A;  4EZJ A;  4URK A;  2KX3 A;  2K39 A;  1WJ6 A;  2KJ6 A;  2UYZ B;  2LVP A;  1PQS A;  2KJH B;  3EHV A;  4W9C A;  1J8C A;  1YX6 B;  5CHF A;  4I6L B;  4BVU C;  5CTR C;  1L7Y A;  2C5L C;  2M8S A;  3DOW A;  2IO1 B;  2K6Q A;  3HM6 X;  4PS3 A;  4A20 A;  3W1S C;  4HCP B;  4KDI C;  3TJP A;  1GUA B;  1GC6 A;  2JT4 B;  2KQ7 A;  2JUO A;  4FHJ A;  4WWO A;  4DHZ E;  2Z59 B;  2AEH A;  4GDL A;  2L3Z A;  1WX9 A;  1NI2 A;  2KDF B;  5DCN A;  5AZH A;  3H7P A;  1P1A A;  4KSK C;  4W9F A;  1SE9 A;  5DPT A;  1WE7 A;  3DDC B;  3RCZ A;  4NAW A;  3V60 A;  4HVB A;  2MQJ A;  3ZNZ B;  3DVN U;  2WX0 A;  3ML9 A;  4J6I A;  4ICV A;  4PS8 A;  2EKE C;  1J19 A;  2C7M B;  5BO4 B;  3DBL I;  2V3S A;  3M63 B;  2CHZ A;  2L0F A;  4EZL A;  3UQB A;  4KIK B;  1WZ0 A;  4JL9 A;  1WE6 A;  4BBN F;  1WIA A;  4NQK E;  5G55 A;  3ZW3 A;  4YL8 A;  2KHW B;  3JSV B;  4CHK A;  1GNU A;  4W9K A;  3A9K A;  3M62 B;  3WAL A;  1WMH B;  2PJH A;  5L83 A;  1TBE A;  5JH5 C;  1WYW B;  4ZRI A;  2GBR A;  3O65 B;  3CF6 E;  4XC2 A;  4GXB A;  4E74 A;  2C7N B;  1L2N A;  2I1K A;  3PRP B;  4K7W A;  1P0R A;  1GG3 A;  2KQS A;  1WGG A;  2K8B A;  2FCN A;  2NPT B;  2WX1 A;  4OVU A;  5E6P A;  1OEY A;  2HD5 B;  4NNJ B;  4DDI D;  2DZJ A;  4IM3 A;  3HM3 A;  2KC1 A;  2EMS A;  3ONS A;  4MJS A;  1TGZ B;  2LZ6 A;  4HK2 A;  4KSL C;  2BYE A;  2N1V A;  3T8M A;  2KJR A;  4GOC A;  1VD2 A;  4AP4 C;  4HLE A;  1KJT A;  1WJ4 A;  2BKF A;  1XT9 B;  2NBV B;  2OJR A;  2CKH B;  5CX3 A;  2K25 A;  3Q3J A;  1EF1 A;  4DBG A;  3OLM D;  4I6N B;  1NDD A;  3VTW A;  4TKN A;  3WAO A;  4AOF A;  3QCA A;  4W9I A;  3TMP B;  4FAD A;  2C9W B;  2DX5 B;  4IM2 A;  4G3X B;  3RYT A;  2J7Q B;  2N4F A;  4M0W B;  2JPH A;  3SDL C;  4FHK A;  1WGH A;  2NR2 A;  2FIF A;  4KDL B;  4WJP A;  1IPG A;  1E90 A;  1WM2 A;  4MSQ B;  5L95 C;  4DHJ D;  3QAR A;  2C7H A;  1V6E A;  2K6D B;  2L76 A;  2WWZ A;  3PT2 B;  2IYD B;  5HKH A;  2DYO A;  4ANV A;  3H6N A;  4WJO A;  3U7D A;  1UD7 A;  2D3G A;  2NBU A;  2LWP A;  4GDK B;  2KOX A;  4XZ4 A;  3QWZ B;  1BT0 A;  2KTR B;  1WFY A;  1KM7 A;  3PHW B;  3ENE A;  4A3P A;  2KX0 A;  2ZNV C;  4ANU A;  2GOW A;  4DHZ B;  2R2O A;  5JHB A;  1AAR A;  3NHE B;  2RR9 A;  3ZKJ C;  2MSE D;  3NS8 A;  4ANW A;  4BFR A;  2Z0D B;  2K8H A;  4NQL B;  2C60 A;  2QHO A;  3ZTD A;  2FCM A;  1WF9 A;  2GBN A;  4FUL A;  2KTF A;  1M94 A;  1NBF C;  2XK5 A;  4NPN A;  1WGY A;  3PSE B;  2G4S A;  3VUW A;  2FNJ B;  2DYM A;  2JWZ A;  1G6J A;  4GIV A;  1WJN A;  2KD0 A;  3V61 A;  3A1Q A;  2KWV B;  3L17 A;  1ISN A;  4K1R B;  3B0A A;  3ZNG C;  2IO3 B;  3EFU A;  2J0K A;  2G45 B;  2HE7 A;  3PS6 A;  2FUH B;  3CST A;  2ASQ A;  1ZW7 A;  1V86 A;  2D11 A;  3PZD A;  4KZC A;  3OAW A;  2L8J A;  2O2V B;  1LM8 B;  2CHX A;  5KHO A;  2KLC A;  3VTV A;  4CO7 A;  1R4M I;  4BKS D;  4DHJ B;  2DEN B;  3U8Z A;  1VCB A;  3ZO5 B;  2GMI C;  1H4R A;  5CHW A;  1TZ1 A;  1WR1 A;  2RGF A;  3N32 A; 
#chains in the Genus database with same CATH topology
 1WXA A;  2XN9 C;  4KX6 B;  4J3O D;  5C23 A;  4IC7 B;  2YEP F;  1TS2 A;  1E7P B;  2BB6 A;  2GLS A;  2LRU A;  3ZGZ A;  5IO9 A;  1YD8 U;  4NAM A;  1SE3 A;  1ZXI A;  2WXO A;  2LFI A;  1L0Y B;  2WXN A;  4PYZ A;  1E9M A;  4FJY A;  4IDI A;  1Z5S B;  3TBL D;  1I7H A;  1HQR D;  1XF5 L;  3NS1 A;  4MGK E;  2BPS A;  5C3J B;  3I5J C;  3DBR B;  4M8M A;  2WDR B;  1WZ3 A;  2JYE A;  3KQ4 A;  4IM0 A;  3PPA A;  1HE8 A;  3V05 A;  2PE9 A;  1GB4 A;  3GE3 C;  3KLS X;  4E3C A;  2BYT A;  2KFJ A;  4GDL B;  2RDH A;  4JIO U;  4KV2 A;  4MM3 A;  4HRS A;  2VH2 A;  3DBR I;  3PZ7 A;  2EMT A;  1EUV B;  3VUY A;  1SXT A;  2KMM A;  1FM0 D;  3Q3M C;  4M0W A;  4HJK A;  2R61 A;  4MGY E;  1PFD A;  4WJQ A;  3KUC B;  3RMK C;  3UIN B;  2MBQ A;  3A9J B;  2G3Q B;  2V4L A;  1L5P A;  2LHD A;  2KN5 A;  3U4E G;  4JLC A;  1IP9 A;  4GMV A;  2L05 A;  3R7R A;  2B3A A;  4F1S A;  3N1Y C;  2BYF A;  3L13 A;  4BAX A;  1XLQ A;  2Z0E B;  3TEX A;  3RNC C;  5D3I B;  4RFB A;  4DDG D;  4II3 B;  2N9X A;  3QJZ A;  3UIP B;  3L10 B;  1PUT A;  3A33 B;  3KYC D;  4YWG G;  2N9E B;  3L4P A;  4ZRQ A;  3W1Y A;  3GP7 A;  5E6O A;  4LNO A;  3NVV A;  1UGJ A;  1C78 A;  2ZVO A;  5FR3 A;  2KMC A;  4PK1 A;  3GZN I;  5IOI A;  3SFD B;  5H8Y E;  1CMX B;  4II2 B;  3Q2A C;  2DZI A;  3NRZ A;  2BGF A;  1EM7 A;  3QQ8 B;  4HCN B;  2CJN A;  3Q3N C;  2MP2 A;  1YOV B;  1JRU A;  5IAA C;  4TV3 A;  2MLB A;  3VH4 B;  4KGR A;  3PZ8 A;  2V1Y A;  2N9P C;  3RD2 A;  1TTN A;  5BYQ A;  4EOY A;  4ARI A;  2WQY B;  2ZCC A;  1WJU A;  2KVZ A;  4IWP A;  4MGZ E;  4LDT D;  1Q5W B;  3B1L X;  3PLV A;  4K7S A;  4GN1 A;  4F7Z A;  1H8C A;  2I2Y A;  3H9D A;  1QZE A;  3FAH A;  2K5P A;  1L4D B;  1V5O A;  4DXA B;  3URY A;  2O2V A;  2BYV E;  2W3S A;  1UNS A;  3M95 A;  3L0W B;  3HK0 A;  3DVG X;  4AQ7 A;  2ZEQ A;  1FIQ A;  1E6E B;  1TKE A;  2G9H D;  5J2R A;  5JHA A;  1SE4 A;  3RT3 B;  3A9K B;  3DBH B;  3C0R B;  3NZU A;  4TQ0 A;  3B08 A;  4NJ6 A;  4RM8 A;  5JZE B;  1NI3 A;  3DBH I;  3AI5 A;  4ZHP A;  4TSS A;  1I4P A;  2IZV B;  3X23 A;  4O1N A;  3RUL A;  2BT6 A;  1JWM D;  2ON8 A;  1KOT A;  5G2N A;  2TSS A;  4ITK A;  5CHV C;  1LXD A;  2LXA A;  1VZ6 A;  2RMM A;  3AN1 A;  1T0Y A;  3CSF A;  1BML C;  1XLP A;  2SEB D;  2GBJ A;  1PYW D;  5EDS A;  4JPS A;  3EA6 A;  3NUH B;  1V5T A;  2FCQ A;  1RLF A;  1B1Z A;  3QIJ A;  2PTL A;  3IVF A;  3NZS A;  1IBX B;  1WXM A;  4ZYN A;  1XD3 B;  1BXT A;  1M4V A;  2GBM A;  1SIJ A;  2KFK B;  1HXY D;  4MEL A;  5AUK A;  1CJE A;  1T6B X;  2Y5C A;  3OWE B;  3BVM A;  1V49 A;  1ZOY B;  5HG2 A;  1SBB B;  4WWP A;  4S0R A;  2KXJ A;  2LGI A;  3L08 A;  4ANX A;  3NOB A;  2K3U A;  1UZX B;  1I35 A;  3WAM A;  1ET9 A;  2KTR A;  3VQI A;  2MH7 A;  3QC8 B;  3ZUN A;  1GB1 A;  2QIE B;  1FMA D;  2WLB A;  2WXG A;  5EE1 A;  1ZDV A;  3W1S A;  4WAA A;  3RPF C;  4KKJ A;  3JYU A;  1P3Q U;  2DAJ A;  2DBY A;  4B0E A;  4A3O A;  1AWD A;  2BQQ A;  3SEB A;  1MFW A;  1OFF A;  4W9H A;  2XEW A;  3P2B A;  2H88 B;  2UWQ A;  3MHS D;  4CYE A;  2LJ5 A;  2GI9 A;  2KX3 A;  3EHV A;  4W9C A;  4RGM A;  1FNW A;  5CHF A;  5CTR C;  2IND C;  2IO1 B;  3HM6 X;  3W1S C;  4HCP B;  1GC6 A;  1TYG B;  2AEH A;  1WX9 A;  2H89 B;  5DCN A;  1L6U A;  5GXG B;  1P1A A;  2IGG A;  5DPT A;  4NAW A;  4HVB A;  3DVN U;  5BMI A;  2C7M B;  1SJH D;  3M63 B;  2V3S A;  4EZL A;  1C4C A;  4N58 A;  1AW7 A;  3AE2 B;  1TY2 A;  4CHK A;  2MJD A;  5L83 A;  2EEL A;  2QIL A;  3N1Z C;  2GBR A;  4ZRI A;  4GXB A;  5G5G A;  1L2N A;  2I1K A;  1P0R A;  2JWU A;  2KQS A;  2K8B A;  2HD5 B;  2DZJ A;  3HM3 A;  2EMS A;  5EE0 A;  2QEJ C;  4GOC A;  1VD2 A;  3VRB B;  1XT9 B;  1NVI D;  2KN4 A;  4A9A A;  3OLM D;  1NDD A;  3VTW A;  3QCA A;  4W9I A;  4YSX B;  1I4G A;  2C9W B;  2N9L A;  4ZOH C;  2V3N A;  2DX5 B;  4G3X B;  3RYT A;  2J7Q B;  2N4F A;  5EE3 A;  3W5V B;  2JPH A;  3SDL C;  2NR2 A;  2FIF A;  4WJP A;  2BBC A;  2DYO A;  3AV8 A;  3U7D A;  5FK9 C;  2D3G A;  4GDK B;  4XZ4 A;  1MHH E;  1BT0 A;  2KTR B;  1KM7 A;  3ENE A;  2N0S B;  5D3D A;  1VR9 A;  3NHE B;  2IPK D;  2QHO A;  3ZTD A;  2FCM A;  2CU3 A;  2M19 A;  2KTF A;  1M94 A;  3AH7 A;  3VUW A;  2WGS A;  1G6J A;  4HKZ E;  1WJN A;  3L17 A;  1ISN A;  2LGS A;  3ZNG C;  1HTQ A;  4YTN B;  3MJ5 A;  1ZW7 A;  2D11 A;  3Q14 C;  3OAW A;  1SB3 C;  2L8J A;  1LM8 B;  2CHX A;  2KLC A;  4XYC A;  2K22 A;  4N59 A;  1UWM A;  1R4M I;  2LHE A;  2GMI C;  1VZ8 A;  5CHW A;  1YQ4 B;  1WR1 A;  1PDX A;  3N32 A;  3FIL A;  4HPM B;  3RNA C;  1LQB A;  3VVW B;  1HEZ E;  4LTU A;  1Q0W B;  1Y8R C;  3AE8 B;  1HTO A;  4JQW C;  4AJY B;  5AZF A;  5TR5 A;  4B95 A;  4NJ7 A;  1J7A A;  2Q5W D;  2XBB C;  1QF6 A;  3PV1 A;  2W82 A;  1YN4 A;  2LGD A;  3BIN A;  5BYS A;  3NY5 A;  1ACC A;  1PGA A;  1T3Q A;  1L4Z B;  4K81 A;  4E71 A;  3E9S A;  2WXQ A;  3EC8 A;  1SEB D;  3UF8 A;  4FN2 A;  3KYD D;  2MBH A;  2ZVN A;  2HJ8 A;  1YNT E;  2D07 B;  3PTF C;  3U30 A;  4FXC A;  5AZG A;  4NAW B;  1SIF A;  2LVO A;  1ZDX A;  4LJO B;  1K8R B;  2A4Z A;  3DBS A;  1C79 A;  1LGR A;  2D3B A;  4A55 A;  3VXW A;  1IBX A;  3N1X C;  3DHI C;  2WXM A;  3NG0 A;  1F2R I;  3IHP C;  1UBI A;  4KGS A;  4EFO A;  3K9P B;  1SSN A;  1TS5 A;  4MH8 A;  1YJ1 A;  2LXC A;  2MHJ A;  1I4R A;  3HVZ A;  2DLB A;  4WIP A;  1JWB D;  2MBE A;  2W3R A;  3H7P B;  4OW0 A;  3TCA A;  1I4X A;  3ZJU A;  1OEY J;  1WMH A;  2BS2 B;  2KVR A;  2BW2 A;  3LJ3 A;  5MPO A;  1ZGU B;  4HXD A;  1KH0 A;  3ZLZ A;  1FXA A;  1UGM A;  1E7V A;  2KDB A;  3AU5 A;  2M56 B;  3VAW A;  2MCN B;  3K9O B;  2NCN A;  1FXT B;  2KYW A;  4GSW A;  1R4N I;  3EUB 2;  1MG4 A;  2W55 A;  3LYY A;  4KGT A;  1DOI A;  1UBQ A;  1BUI C;  4LLG M;  2QJL A;  1PGX A;  1N60 A;  2LAS A;  1D4B A;  4LJP B;  1OGW A;  4RNA A;  4FJZ A;  3TL5 A;  5HHD G;  3PRM B;  1KLV A;  2J53 A;  1MJD A;  3NJT A;  3EEC A;  1E5W A;  2IY1 B;  1WGR A;  3WAP A;  1ET6 A;  1F0Z A;  4DWF A;  2M0X A;  1V1P A;  1DOX A;  1FO4 A;  1MPE A;  2ZPY A;  1N5W A;  2LGX A;  1F2R C;  4P6V F;  4B6W A;  2IGH A;  1TZO A;  2L0T A;  5IA7 A;  2K0P A;  2WXF A;  3JSV A;  3VDZ A;  3TEZ A;  4B9K A;  4WQM A;  3QA8 A;  1V8C A;  2PMV A;  3C8Y A;  2JX5 A;  3QK0 A;  4DXG A;  3EGR A;  4C80 A;  2DAF A;  3CWI A;  4ZDV A;  3AEC B;  2RSU A;  1IGD A;  2Z8L A;  4A8X C;  4BOS C;  4G11 A;  4BBN C;  3Q69 A;  3U7Z A;  2WXH A;  1IGC A;  1YMH E;  4F8C B;  1TS3 A;  2B76 B;  1QKZ A;  1FCC C;  1E0Z A;  1T0S C;  3VUX A;  5DPS A;  5GMV A;  1FPY A;  1D3Z A;  1YQ3 B;  3UQA A;  2JZ3 B;  4RCO A;  4RGO S;  2LUE A;  4MH0 E;  2JF5 A;  2KWC A;  5HFY A;  4RMA A;  1GJZ A;  2FAZ A;  1N5X A;  4WWN A;  1DYQ A;  1C9F A;  2WU2 B;  4HRO A;  5BMH A;  2IDY A;  4HDQ A;  2FCS A;  1TKY A;  2INN E;  3AEF B;  2LD9 A;  2L7R A;  2KZR A;  3KVF B;  1FCL A;  2NS5 A;  2L52 A;  2UU7 A;  3MJW A;  4IW0 A;  4W9L A;  1STE A;  2KC2 A;  1A5R A;  1ZE3 D;  1ENF A;  1V80 A;  3HHM A;  1VDV A;  2MP2 B;  1Q1O A;  2RPV A;  1VJK A;  1F77 A;  2DHZ A;  5LXH A;  2AWT A;  4C7Y A;  3N30 A;  3AEE B;  3H1U A;  3DVG Y;  3QX1 A;  4M8N A;  2MRP A;  4FLH A;  3DWG C;  3Q6B A;  2WHI A;  1V81 A;  5DPW A;  3VFK A;  1KLU D;  1TT5 B;  3A4S C;  3ZNH B;  2JRH A;  4WH4 A;  1C4A A;  2KWU B;  3U52 E;  5TSS A;  1EWY C;  1WRD B;  4P7I A;  4RF1 A;  3MC9 A;  4B0M A;  4HEA 1;  3CMM B;  4DK5 A;  2JY6 A;  2IO0 B;  2JXX A;  2WDV B;  1IYF A;  4IUM B;  1B9R A;  3A1Q B;  4UDU C;  3TIX A;  1K52 A;  2K39 A;  1TIF A;  1XO3 A;  2WXJ A;  2C5L C;  4M00 A;  4A20 A;  3TJP A;  2JUO A;  3Q8A A;  2L3Z A;  3T3N A;  3SFE B;  4KSK C;  1FRD A;  4LNF A;  2MQJ A;  3ZNZ B;  2WX0 A;  3ZJT A;  1J19 A;  4M01 A;  5BO4 B;  3UQB A;  4KIK B;  1WZ0 A;  4JL9 A;  1WE6 A;  4BBN F;  4HKQ A;  3JSV B;  1N63 A;  4XWW A;  1GNU A;  3WAL A;  2PJH A;  1FFV A;  5T8I A;  5JH5 C;  3CF6 E;  2C7N B;  3RN9 C;  4K7W A;  4D2K A;  4R3D A;  1J7C A;  3BVG A;  5E6P A;  4NNJ B;  4DDI D;  4IM3 A;  4KSL C;  2BYE A;  4S17 A;  1JWA D;  4AP4 C;  2BKF A;  5CX3 A;  2CKH B;  2K25 A;  1EF1 A;  4DBG A;  4FAD A;  1F1H A;  2YEP B;  2D3C A;  2L83 A;  4YSY B;  5L95 C;  4DHJ D;  2C7H A;  1V6E A;  2IYD B;  1DOY A;  4ANV A;  1UD7 A;  1SJE D;  4LNN A;  3U2S C;  3BVZ A;  2D3A A;  1VRA B;  2ZNV C;  4ANW A;  2C60 A;  2WS3 B;  4NJC A;  1CK1 A;  2XK5 A;  1NBF C;  3IT4 B;  1WGY A;  3PSE B;  2G4S A;  2DYM A;  3RI7 C;  2JWZ A;  4DXF A;  3ZYY X;  3A1Q A;  1GPX A;  1YJI A;  4K1R B;  1HZ6 A;  2IO3 B;  2J0K A;  2G45 B;  2ONQ A;  4US9 A;  2FUH B;  3CST A;  2ASQ A;  4HPP A;  4A90 A;  4US8 A;  5KHO A;  1I4H A;  4CO7 A;  1XCT L;  3I9V 1;  2RGF A;  4GU2 A;  1R7S A;  3GOE A;  5C2T B;  4EEW A;  1ESF A;  2KKC A;  5DPR A;  1NEK B;  1F52 A;  3C19 A;  3QAQ A;  5D7G A;  4C7Z A;  1C1Y B;  3UI3 A;  2LUM A;  4PYU A;  3AE6 B;  2VRR B;  3Q8B A;  2O6V B;  2N7J A;  3PRE A;  2BF8 B;  4GGQ A;  5HI1 A;  3GS2 A;  3O13 A;  1WH3 A;  3APD A;  4XE0 A;  2PPH A;  3EFC A;  3L16 A;  2QMT A;  2ZPN A;  2OHF A;  1EWC A;  3VRA B;  2KFK A;  2CR5 A;  1V2Y A;  1WSP A;  3R2I A;  1QOG A;  5JXV A;  4PS7 A;  2V4I B;  2K1F A;  1QOA A;  2MJ3 A;  2N1W A;  3N3K B;  2M17 A;  4OZC A;  4MDK E;  2JYT A;  4I6P A;  4MAC A;  2JXT A;  1FNV A;  3P1M A;  4HWI B;  2V0G A;  2VH1 A;  3DVN V;  2ACZ B;  4FJV B;  2KAC A;  3BII D;  3AMZ A;  1TS4 A;  2BKR B;  2IY0 B;  3DCG A;  1RFA A;  4USA A;  2WXK A;  1GC7 A;  2NPT A;  1YJJ A;  5LNK 1;  1D5M C;  2Y5B B;  1E8Z A;  2KQ4 X;  3I57 A;  2L32 A;  1QQR A;  1TY0 A;  2KDI A;  3PO0 A;  1WWT A;  1Q10 A;  4NZL B;  2BTE A;  2JVC A;  3AU4 A;  4WQO B;  3V6C B;  4MSM B;  2BWE S;  4ZRK A;  1YQB A;  4RGN A;  2AL6 A;  3RUI B;  3R7Q A;  2ZCB A;  2E6X A;  1JWU D;  4AJW A;  3PRZ A;  2I38 A;  3ZDT A;  1WYG A;  4TUU A;  2HTM E;  2YVC A;  3DPD A;  3OG5 A;  2X38 A;  1Y56 A;  3IT6 B;  3B2F A;  4KZ0 A;  3ZXV A;  2KNB A;  4PT5 A;  1UH6 A;  5KHQ A;  3R8B A;  2DZK A;  1QOF A;  3DHH C;  3A4R A;  2GRI A;  5E6J A;  2X8X X;  2KT7 A;  2CHW A;  3APF A;  2NTT A;  3BK2 A;  3MC0 B;  3P4P B;  4WJN A;  3AEA B;  1MG8 A;  3BY4 B;  1C3T A;  3PHX B;  5FR6 A;  1V97 A;  2ZZP B;  1D5X C;  2FUG 1;  3UIO B;  3PGE A;  3ML8 A;  1XLN A;  4WWM A;  4ZRP A;  1V9J A;  1P7F A;  3BZD B;  2MJE A;  2J0M A;  1XEE A;  3R3M A;  4KIK A;  2WXP A;  2N7D A;  2D5G A;  4K3C A;  3SD5 A;  2MA9 B;  2CJO A;  4BOZ B;  3ALB A;  2M0A A;  3H7S A;  2MBB B;  2WXR A;  2IBI B;  1WRI A;  3GE8 C;  3BYT B;  2D2Q A;  3E56 A;  2AQ3 B;  2VZK B;  1L0X B;  4GDK A;  2E3T A;  4M02 A;  1EU3 A;  4L1B A;  3IBE A;  3LDZ E;  2JZZ A;  3WCQ A;  4QAY A;  4HDO A;  4YTP B;  2IO2 B;  5EE9 A;  3OJ4 B;  3WAN A;  4YSZ B;  2KK8 A;  4Q2J A;  4C56 C;  1L6V A;  2WXL A;  2PE6 B;  3ZRF A;  4XGA B;  3RNB C;  4EZK A;  2N9K A;  4RM9 A;  2KMA A;  3FC4 A;  4IWQ A;  3NZ3 A;  3AED B;  2PVG C;  3JW0 X;  4XDD A;  1E10 A;  2M4N A;  3UGB B;  3BYY B;  4KKI A;  3RZW C;  4P1C C;  3QHT A;  1JWS D;  1TJE A;  3ZVV A;  1CQV A;  3WIM A;  3MFG A;  3V62 A;  4BKS A;  4FA6 A;  5J17 A;  1IUE A;  1JW9 D;  2KO3 A;  2REX A;  3P4Q B;  3BWU D;  4G0N B;  2HDE A;  4BKT A;  4AS1 A;  3N20 C;  3PVL A;  4YT0 B;  3P63 A;  1J0G A;  1JRP A;  2BB5 A;  4GLS C;  3VH3 B;  2V3P A;  1WR6 E;  3N9Y C;  2MX2 A;  2K8C A;  1LO5 D;  5E6N A;  4OHJ A;  3DBL B;  3APC A;  1V1O A;  3V3X A;  4IG7 B;  2KAJ A;  2NVU I;  1EU4 A;  5C1Z A;  2PW9 A;  1OTR B;  2EKI A;  2D10 A;  1K50 A;  4MM3 B;  3V6E B;  1OQY A;  1RYJ A;  1S3S G;  2M1M A;  3Q8F A;  4EZJ A;  5G5H A;  2WXI A;  1P7E A;  1WJ6 A;  2UYZ B;  1PQS A;  2KJH B;  1J8C A;  1I4Q A;  1YX6 B;  1ZUD 2;  4I6L B;  4BVU C;  1L7Y A;  2M8S A;  1PGB A;  3DOW A;  2MEK A;  4PS3 A;  2KQ7 A;  5AZH A;  4A6Q A;  3H7P A;  1SE9 A;  2LEK A;  2BVC A;  4J6I A;  4ICV A;  1GOZ A;  2KDM A;  2CHZ A;  3AE4 B;  5IKC M;  2LMC A;  1WIA A;  2KHW B;  2XNA C;  1NEN B;  4W9K A;  4XDC A;  3M62 B;  4JE3 B;  3O65 B;  1JCK B;  4XC2 A;  4YTM B;  1VZ7 A;  2IJ0 A;  1V1P B;  4ZHO A;  4RGT A;  1WGG A;  2FCN A;  2NPT B;  1OEY A;  1YN3 A;  2KC1 A;  2INP E;  3ONS A;  1QIL A;  1TGZ B;  2N1V A;  3T8M A;  3B2G A;  3ZXR A;  1KJT A;  1WJ4 A;  2OJR A;  3AE7 B;  4TKN A;  3TMP B;  1XCQ L;  1SF0 A;  4KDL B;  1QOB A;  1KFY B;  1IPG A;  1WM2 A;  1GAQ B;  3QAR A;  2WWZ A;  3PT2 B;  5HKH A;  3TEW A;  4P16 A;  4EE2 A;  3I63 C;  2LWP A;  1T0Q C;  4C00 A;  2IGD A;  4WUR A;  1NYR A;  3MHZ A;  5JHB A;  4ANU A;  1AAR A;  2RR9 A;  4BFR A;  2MSE D;  3NS8 A;  2Z0D B;  2K8H A;  4L2Y A;  1ROE A;  1KLG D;  1WF9 A;  3FKY A;  4BZA A;  4TMA B;  1R4N B;  4FUL A;  4C4V A;  2FNJ B;  4GIV A;  2KD0 A;  3R2T A;  3V61 A;  1WXQ A;  2RDB C;  3B0A A;  1KF6 B;  1V86 A;  3H8H A;  4KZC A;  1C76 A;  1SE2 A;  3VTV A;  2WNM A;  4DHJ B;  3CIR B;  2DEN B;  3U8Z A;  1VCB A;  3ZO5 B;  1N6Z A;  1TZ1 A;  4OZA A;  2OED A;  3LXF A;  4EKU A;  4OZB A;  3RFZ B;  3SHQ A;  5FKA C;  2DYB A;  1TKG A;  2VZK D;  4YXD B;  1WI0 A;  2WDT B;  3L54 A;  2WP9 B;  3NVW A;  4HJG E;  1WXS A;  3OJ3 A;  4G50 A;  2GBK A;  4JWS C;  4HPL B;  2KDE B;  1SGH A;  2LRW A;  2AYO B;  1WGK A;  3VHT C;  4MT5 A;  1RFK A;  1QLB B;  4W9D A;  3BK1 A;  4K7U A;  2MBO A;  3Q8E A;  2KAN A;  4OVV A;  2ZJD A;  2INC C;  3AXC A;  2QSD A;  5LXI B;  4TQ1 A;  1YN5 A;  2A5U A;  5BMG A;  1C77 A;  2W9N A;  2RPQ A;  3R66 C;  2DZM A;  4RF0 A;  2J0J A;  3W5U B;  4W9G A;  3J9C A;  1E7U A;  4ZRJ A;  1EF5 A;  2ZNV B;  3RNG C;  3KH0 A;  1FXI A;  2O6V D;  2LI5 A;  2QC8 A;  1X1M A;  3HUI A;  1DGJ A;  4W9J A;  1AN8 A;  4MGI E;  2NMQ A;  3VTU A;  1EO6 A;  1R4M B;  4DQO C;  1RAX A;  5IN7 A;  1C4P A;  4LDT B;  5AEK B;  4NY0 A;  3AB5 A;  2N7E A;  2ICI A;  3AE9 B;  5H92 C;  2CU1 A;  2XK5 B;  1UEL A;  3Q8C A;  2CS4 A;  2KLG A;  1FNU A;  4IWO A;  1A70 A;  3KW5 B;  4GB9 A;  1FRR A;  4X57 B;  3D32 A;  3ECI A;  1WX8 A;  3WA0 A;  4ZYS A;  3TUO A;  1MHX A;  2RDG A;  1N61 A;  2RD0 A;  2G1E A;  2V9H A;  4AUQ C;  3HRD D;  4LCD E;  5D94 A;  2G4D B;  4N6E B;  3ZNI D;  2AL3 A;  2AQ2 B;  2JZP A;  1RRB A;  2R2Q A;  3AE5 B;  1WXV A;  4ASW C;  1RM6 C;  1MVK A;  3GB1 A;  4P1B C;  2HTH A;  3GZN B;  3IXS A;  4JWU C;  4AWJ A;  2QDF A;  2FID A;  1WX7 A;  4BKG A;  1FFU A;  3KUZ A;  4K3B A;  1HA5 A;  2KWD A;  3Q3O C;  1P98 A;  4LK0 M;  5LLI A;  2QCZ A;  2I1J A;  2JRI B;  2SAK A;  2WDQ B;  1QT9 A;  3T9L A;  1UF0 A;  4EUT A;  4ICU A;  1F9J A;  3IAS 1;  3AEG B;  3AUL A;  4KVG B;  3RZF A;  4ACF A;  2OOB B;  3KUD B;  1JML A;  5AUI A;  1JAL A;  1P9D U;  2L1A A;  3SR6 A;  2J42 A;  3Q3F A;  4MEM A;  1T0R C;  3P4S B;  1WM3 A;  3AEB B;  3ABV B;  1I42 A;  3MC8 A;  1Z2M A;  1L0V B;  4H2A A;  3W9C B;  5J18 A;  3FIL B;  4C4V B;  3RNF C;  2Y5P A;  3RNE C;  4CQN A;  1E8W A;  2AQ1 B;  2O6V A;  1RWS A;  2OJW A;  3SU8 X;  1HZ5 A;  4JGH B;  5D2M B;  4W9E A;  2WYQ A;  3PLU A;  3M3J A;  2DWQ A;  3P4R B;  4MJS B;  1NYQ A;  1LFD A;  3B9J A;  3ZRC A;  1WY8 A;  2LVQ A;  3MTN B;  4N9F 4;  1AYF A;  3AM9 A;  2L00 B;  3TEY A;  2LGY A;  3DWM A;  3IFW B;  1E8X A;  4REZ A;  2MW5 A;  1E8Y A;  1J7B A;  3W2D A;  2DNF A;  1JRO A;  3DQV A;  2PKO A;  5D6J B;  3X0W A;  3IG3 A;  1YIW A;  1U4A A;  1MI0 A;  1YX5 B;  2PLP A;  1WGD A;  2HJ1 A;  2NTS A;  5BYR A;  2FE8 A;  3JVZ X;  2PEA A;  4XX5 A;  3ZTC A;  4L23 A;  2WU5 B;  1JQ4 A;  3ZDM C;  1K51 A;  2YLM A;  2BS3 B;  3A9J A;  3AE1 B;  2MWS B;  2NBW B;  3S2A A;  3HIZ A;  3ZIM A;  3VR9 B;  1S1Q B;  2BWF A;  2JQR B;  2FBW B;  2GB1 A;  4FBJ B;  1VLB A;  2ZW0 A;  3LB8 C;  5IP4 D;  3I3T B;  3T3O A;  1XQQ A;  4URK A;  1ZKH A;  1KRH A;  2PIA A;  4XWT A;  2KJ6 A;  2LVP A;  3ZQ4 A;  4RH6 A;  2K6Q A;  4KDI C;  1GUA B;  1ZXH A;  1OQR A;  2JT4 B;  4FHJ A;  4WWO A;  4DHZ E;  1ZP0 B;  2Z59 B;  2BS4 B;  4GDL A;  1NI2 A;  2KDF B;  4W9F A;  1WE7 A;  3DDC B;  3RCZ A;  3V60 A;  2K9X A;  3ML9 A;  2J4X A;  3IAM 1;  4PS8 A;  2EKE C;  5I4D A;  3DBL I;  2L0F A;  3DHG C;  2JSV X;  4NQK E;  5G55 A;  3ZW3 A;  4YL8 A;  3ZJV A;  3A9K A;  1WMH B;  1TBE A;  1WYW B;  4E74 A;  3KWV A;  4LNI A;  1D5Z C;  3PRP B;  1GG3 A;  2WX1 A;  4OVU A;  1UUP A;  4MJS A;  1CZP A;  1FEH A;  2LZ6 A;  4HK2 A;  1T5X D;  2KJR A;  3TSS A;  4HLE A;  2NBV B;  3Q3J A;  4I6N B;  4AOF A;  1N62 A;  1KTK A;  3WAO A;  1UWX A;  2AX5 A;  4IM2 A;  4JX1 C;  3KWL A;  4M0W B;  4FHK A;  1WGH A;  1E90 A;  4MSQ B;  2K6D B;  2L76 A;  3H6N A;  3VR8 B;  4WJO A;  2NBU A;  2ZW1 A;  3MP9 A;  2KOX A;  4ARC A;  3QWZ B;  1K53 A;  4LNK A;  2LJI A;  2Y3A A;  1WFY A;  4A3P A;  3PHW B;  2KX0 A;  4DHZ B;  2GOW A;  3ETR A;  2R2O A;  1OQQ A;  3NVZ A;  3ZKJ C;  4NQL B;  1XLO A;  2GBN A;  1ZPS A;  4NPN A;  2KWV B;  3HVD A;  3AE3 B;  3EFU A;  2HE7 A;  3PS6 A;  2W54 A;  3PZD A;  2JU6 X;  2J52 A;  3P42 A;  1XXG A;  2O2V B;  4WAF A;  2PVO D;  4OVZ A;  4IOI E;  4BKS D;  1D6E C;  4IKG A;  3NVY A;  1H4R A;  1FD6 A; 
#chains in the Genus database with same CATH homology
 4EKU A;  3GOE A;  1WXA A;  4HPM B;  4EEW A;  1LQB A;  3VVW B;  3SHQ A;  1Q0W B;  2KKC A;  5DPR A;  2DYB A;  1Y8R C;  4IC7 B;  5C23 A;  1WI0 A;  2WDT B;  3L54 A;  3QAQ A;  5D7G A;  2LRU A;  4JQW C;  1C1Y B;  4AJY B;  1YD8 U;  5AZF A;  1WXS A;  5TR5 A;  4B95 A;  3OJ3 A;  4NJ7 A;  4G50 A;  4PYU A;  2GBK A;  4PYZ A;  2XBB C;  4FJY A;  1Z5S B;  2VRR B;  4HPL B;  2O6V B;  3PV1 A;  3TBL D;  2KDE B;  1SGH A;  3PRE A;  2BF8 B;  2LRW A;  4GGQ A;  2AYO B;  4MGK E;  2BPS A;  3VHT C;  2LGD A;  1WH3 A;  3APD A;  3BIN A;  2PPH A;  3NY5 A;  4M8M A;  3L16 A;  2ZPN A;  1WZ3 A;  4W9D A;  4IM0 A;  3PPA A;  1HE8 A;  4K81 A;  2KFK A;  4E71 A;  3EC8 A;  2PE9 A;  2CR5 A;  3UF8 A;  4FN2 A;  1V2Y A;  3KYD D;  2MBH A;  4E3C A;  4K7U A;  2ZVN A;  2HJ8 A;  2KFJ A;  2MBO A;  4GDL B;  2KAN A;  4JIO U;  4OVV A;  2ZJD A;  4KV2 A;  4MM3 A;  4PS7 A;  3AXC A;  2D07 B;  3DBR I;  2EMT A;  2K1F A;  3PTF C;  3U30 A;  1EUV B;  3VUY A;  5AZG A;  4NAW B;  5LXI B;  1SIF A;  2N1W A;  2LVO A;  4TQ1 A;  3N3K B;  2A5U A;  4LJO B;  1K8R B;  2A4Z A;  3DBS A;  2M17 A;  2W9N A;  4MDK E;  2RPQ A;  4I6P A;  3R66 C;  4HJK A;  2DZM A;  2J0J A;  3VXW A;  4MGY E;  4HWI B;  4W9G A;  1E7U A;  4ZRJ A;  3DVN V;  1EF5 A;  4WJQ A;  4FJV B;  3KUC B;  2ZNV B;  3KH0 A;  3UIN B;  3IHP C;  1UBI A;  2O6V D;  2MBQ A;  2BKR B;  2LI5 A;  3A9J B;  4GU2 A;  4EFO A;  2IY0 B;  3DCG A;  1RFA A;  2G3Q B;  1X1M A;  2V4L A;  4W9J A;  1GC7 A;  2KN5 A;  3K9P B;  4MGI E;  2NPT A;  4JLC A;  1YJ1 A;  4GMV A;  2LXC A;  1IP9 A;  2L05 A;  3R7R A;  2B3A A;  3VTU A;  1EO6 A;  4F1S A;  2BYF A;  3L13 A;  2Y5B B;  1E8Z A;  2MBE A;  3H7P B;  1RAX A;  4LDT B;  3TCA A;  2Z0E B;  5AEK B;  4NY0 A;  1OEY J;  1WMH A;  4DDG D;  2N7E A;  2KVR A;  4II3 B;  2N9X A;  2KDI A;  2CU1 A;  3QJZ A;  3UIP B;  2XK5 B;  3L10 B;  1UEL A;  3LJ3 A;  3A33 B;  1ZGU B;  4HXD A;  2JVC A;  3AU4 A;  3KYC D;  2CS4 A;  1UGM A;  2KLG A;  2N9E B;  4WQO B;  3V6C B;  3ZLZ A;  3W1Y A;  4IWO A;  4MSM B;  2BWE S;  3KW5 B;  4ZRK A;  1E7V A;  1YQB A;  5E6O A;  4GB9 A;  2KDB A;  3AU5 A;  2AL6 A;  3RUI B;  3R7Q A;  2ZCB A;  2ZVO A;  4X57 B;  3VAW A;  3D32 A;  3ECI A;  3K9O B;  1WX8 A;  2KMC A;  2MCN B;  3GZN I;  3WA0 A;  2NCN A;  4AJW A;  1FXT B;  1CMX B;  4II2 B;  3PRZ A;  2DZI A;  4GSW A;  2BGF A;  1R4N I;  3ZDT A;  3QQ8 B;  4HCN B;  4TUU A;  2MP2 A;  2RD0 A;  1JRU A;  2YVC A;  3DPD A;  4AUQ C;  5IAA C;  4TV3 A;  2MLB A;  4LCD E;  5D94 A;  1UBQ A;  2G4D B;  4KZ0 A;  3VH4 B;  2KNB A;  3ZNI D;  2V1Y A;  2N9P C;  3RD2 A;  2AL3 A;  1UH6 A;  5KHQ A;  1TTN A;  4EOY A;  2DZK A;  1RRB A;  2R2Q A;  2LAS A;  2ZCC A;  4LJP B;  1OGW A;  1WXV A;  4ASW C;  1WJU A;  4IWP A;  4FJZ A;  4MGZ E;  3A4R A;  4LDT D;  3TL5 A;  1Q5W B;  3B1L X;  3PLV A;  4K7S A;  2CHW A;  3APF A;  4GN1 A;  4F7Z A;  4WJN A;  1H8C A;  3H9D A;  1MG8 A;  3BY4 B;  3PRM B;  2HTH A;  1C3T A;  1KLV A;  1QZE A;  3PHX B;  5FR6 A;  4AWJ A;  1V5O A;  2FID A;  1WX7 A;  2ZZP B;  3EEC A;  4DXA B;  1E5W A;  3KUZ A;  3UIO B;  4BKG A;  2IY1 B;  3PGE A;  1WGR A;  2O2V A;  3ML8 A;  2BYV E;  3WAP A;  1V9J A;  1P98 A;  4DWF A;  2M0X A;  5LLI A;  3M95 A;  2I1J A;  2J0M A;  2JRI B;  3L0W B;  3HK0 A;  3DVG X;  2ZPY A;  3T9L A;  2ZEQ A;  2LGX A;  3R3M A;  4KIK A;  4EUT A;  4B6W A;  4ICU A;  5J2R A;  5JHA A;  2L0T A;  2N7D A;  5IA7 A;  1F9J A;  3JSV A;  3VDZ A;  3RT3 B;  3AUL A;  4KVG B;  3SD5 A;  4B9K A;  3A9K B;  3RZF A;  2MA9 B;  3QA8 A;  4BOZ B;  3ALB A;  3C0R B;  2OOB B;  3QK0 A;  3KUD B;  3H7S A;  3NZU A;  4TQ0 A;  3B08 A;  4NJ6 A;  4RM8 A;  2MBB B;  5JZE B;  3DBH I;  1P9D U;  2IBI B;  3AI5 A;  2DAF A;  4ZDV A;  3Q3F A;  2RSU A;  4MEM A;  2IZV B;  2D2Q A;  3X23 A;  3RUL A;  1WM3 A;  4BOS C;  4G11 A;  4BBN C;  1KOT A;  4GDK A;  5G2N A;  1I42 A;  5CHV C;  1Z2M A;  4F8C B;  1LXD A;  2LXA A;  3IBE A;  5J18 A;  3LDZ E;  3VUX A;  1T0Y A;  2JZZ A;  5DPS A;  5GMV A;  1D3Z A;  3CSF A;  1E8W A;  3UQA A;  2O6V A;  4HDO A;  2GBJ A;  2JZ3 B;  2IO2 B;  3SU8 X;  3OJ4 B;  2LUE A;  3WAN A;  4MH0 E;  2KWC A;  2JF5 A;  2KK8 A;  4JGH B;  4RMA A;  1GJZ A;  5EDS A;  2FAZ A;  4WWN A;  1V5T A;  2FCQ A;  1RLF A;  4HDQ A;  5D2M B;  2FCS A;  4W9E A;  2PE6 B;  3QIJ A;  2WYQ A;  3ZRF A;  2LD9 A;  2L7R A;  2KZR A;  3KVF B;  3PLU A;  2NS5 A;  3IVF A;  3MJW A;  3M3J A;  4IW0 A;  3NZS A;  4EZK A;  4RM9 A;  2KMA A;  4IWQ A;  4W9L A;  2KC2 A;  1WXM A;  4MJS B;  1A5R A;  1LFD A;  4ZYN A;  3JW0 X;  3ZRC A;  1WY8 A;  1V80 A;  1XD3 B;  2LVQ A;  2M4N A;  3MTN B;  4N9F 4;  3UGB B;  2GBM A;  2KFK B;  3HHM A;  4MEL A;  2MP2 B;  1Q1O A;  2L00 B;  3RZW C;  3QHT A;  2LGY A;  1V49 A;  2DHZ A;  5LXH A;  2AWT A;  3N30 A;  3ZVV A;  3H1U A;  4WWP A;  3WIM A;  3IFW B;  1E8X A;  3DVG Y;  3QX1 A;  2KXJ A;  4M8N A;  2MRP A;  4FLH A;  3V62 A;  2MW5 A;  1E8Y A;  4BKS A;  4FA6 A;  5J17 A;  2KO3 A;  2REX A;  4G0N B;  3DQV A;  5D6J B;  3L08 A;  3X0W A;  1V81 A;  3IG3 A;  1YIW A;  4ANX A;  5DPW A;  1U4A A;  3VFK A;  1YX5 B;  3NOB A;  4BKT A;  1WGD A;  1UZX B;  1I35 A;  3JVZ X;  3PVL A;  3WAM A;  1J0G A;  2KTR A;  2PEA A;  3VQI A;  4XX5 A;  3A4S C;  3ZNH B;  3QC8 B;  2JRH A;  3ZUN A;  3ZTC A;  3VH3 B;  2KWU B;  1WR6 E;  1WRD B;  4P7I A;  2MX2 A;  2K8C A;  3W1S A;  5E6N A;  3ZDM C;  3A9J A;  2YLM A;  3CMM B;  3APC A;  2JY6 A;  4WAA A;  4DK5 A;  2MWS B;  2IO0 B;  4IG7 B;  3JYU A;  2NVU I;  2NBW B;  2JXX A;  3S2A A;  3HIZ A;  1P3Q U;  2DAJ A;  3ZIM A;  5C1Z A;  1IYF A;  4A3O A;  1S1Q B;  4IUM B;  1OTR B;  2BWF A;  4W9H A;  2XEW A;  2D10 A;  3A1Q B;  3V6E B;  4FBJ B;  1OQY A;  3TIX A;  3P2B A;  2UWQ A;  3I3T B;  3MHS D;  1XQQ A;  1S3S G;  2M1M A;  4CYE A;  1ZKH A;  2LJ5 A;  4EZJ A;  4URK A;  2KX3 A;  2K39 A;  1WJ6 A;  2KJ6 A;  2UYZ B;  2LVP A;  1PQS A;  2KJH B;  3EHV A;  4W9C A;  1J8C A;  1YX6 B;  5CHF A;  4I6L B;  4BVU C;  5CTR C;  1L7Y A;  2C5L C;  2M8S A;  3DOW A;  2IO1 B;  2K6Q A;  3HM6 X;  4PS3 A;  4A20 A;  3W1S C;  4HCP B;  4KDI C;  3TJP A;  1GUA B;  1GC6 A;  2JT4 B;  2KQ7 A;  2JUO A;  4FHJ A;  4WWO A;  4DHZ E;  2Z59 B;  2AEH A;  4GDL A;  2L3Z A;  1WX9 A;  1NI2 A;  2KDF B;  5DCN A;  5AZH A;  3H7P A;  1P1A A;  4KSK C;  4W9F A;  1SE9 A;  5DPT A;  1WE7 A;  3DDC B;  3RCZ A;  4NAW A;  3V60 A;  4HVB A;  2MQJ A;  3ZNZ B;  3DVN U;  2WX0 A;  3ML9 A;  4J6I A;  4ICV A;  4PS8 A;  2EKE C;  1J19 A;  2C7M B;  5BO4 B;  3DBL I;  2V3S A;  3M63 B;  2CHZ A;  2L0F A;  4EZL A;  3UQB A;  4KIK B;  1WZ0 A;  4JL9 A;  1WE6 A;  4BBN F;  1WIA A;  4NQK E;  5G55 A;  3ZW3 A;  4YL8 A;  2KHW B;  3JSV B;  4CHK A;  1GNU A;  4W9K A;  3A9K A;  3M62 B;  3WAL A;  1WMH B;  2PJH A;  5L83 A;  1TBE A;  5JH5 C;  1WYW B;  4ZRI A;  2GBR A;  3O65 B;  3CF6 E;  4XC2 A;  4GXB A;  4E74 A;  2C7N B;  1L2N A;  2I1K A;  3PRP B;  4K7W A;  1P0R A;  1GG3 A;  2KQS A;  1WGG A;  2K8B A;  2FCN A;  2NPT B;  2WX1 A;  4OVU A;  5E6P A;  1OEY A;  2HD5 B;  4NNJ B;  4DDI D;  2DZJ A;  4IM3 A;  3HM3 A;  2KC1 A;  2EMS A;  3ONS A;  4MJS A;  1TGZ B;  2LZ6 A;  4HK2 A;  4KSL C;  2BYE A;  2N1V A;  3T8M A;  2KJR A;  4GOC A;  1VD2 A;  4AP4 C;  4HLE A;  1KJT A;  1WJ4 A;  2BKF A;  1XT9 B;  2NBV B;  2OJR A;  2CKH B;  5CX3 A;  2K25 A;  3Q3J A;  1EF1 A;  4DBG A;  3OLM D;  4I6N B;  1NDD A;  3VTW A;  4TKN A;  3WAO A;  4AOF A;  3QCA A;  4W9I A;  3TMP B;  4FAD A;  2C9W B;  2DX5 B;  4IM2 A;  4G3X B;  3RYT A;  2J7Q B;  2N4F A;  4M0W B;  2JPH A;  3SDL C;  4FHK A;  1WGH A;  2NR2 A;  2FIF A;  4KDL B;  4WJP A;  1IPG A;  1E90 A;  1WM2 A;  4MSQ B;  5L95 C;  4DHJ D;  3QAR A;  2C7H A;  1V6E A;  2K6D B;  2L76 A;  2WWZ A;  3PT2 B;  2IYD B;  5HKH A;  2DYO A;  4ANV A;  3H6N A;  4WJO A;  3U7D A;  1UD7 A;  2D3G A;  2NBU A;  2LWP A;  4GDK B;  2KOX A;  4XZ4 A;  3QWZ B;  1BT0 A;  2KTR B;  1WFY A;  1KM7 A;  3PHW B;  3ENE A;  4A3P A;  2KX0 A;  2ZNV C;  4ANU A;  2GOW A;  4DHZ B;  2R2O A;  5JHB A;  1AAR A;  3NHE B;  2RR9 A;  3ZKJ C;  2MSE D;  3NS8 A;  4ANW A;  4BFR A;  2Z0D B;  2K8H A;  4NQL B;  2C60 A;  2QHO A;  3ZTD A;  2FCM A;  1WF9 A;  2GBN A;  4FUL A;  2KTF A;  1M94 A;  1NBF C;  2XK5 A;  4NPN A;  1WGY A;  3PSE B;  2G4S A;  3VUW A;  2FNJ B;  2DYM A;  2JWZ A;  1G6J A;  4GIV A;  1WJN A;  2KD0 A;  3V61 A;  3A1Q A;  2KWV B;  3L17 A;  1ISN A;  4K1R B;  3B0A A;  3ZNG C;  2IO3 B;  3EFU A;  2J0K A;  2G45 B;  2HE7 A;  3PS6 A;  2FUH B;  3CST A;  2ASQ A;  1ZW7 A;  1V86 A;  2D11 A;  3PZD A;  4KZC A;  3OAW A;  2L8J A;  2O2V B;  1LM8 B;  2CHX A;  5KHO A;  2KLC A;  3VTV A;  4CO7 A;  1R4M I;  4BKS D;  4DHJ B;  2DEN B;  3U8Z A;  1VCB A;  3ZO5 B;  2GMI C;  1H4R A;  5CHW A;  1TZ1 A;  1WR1 A;  2RGF A;  3N32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...