2MA9B

Hiv-1 vif socs-box and elongin bc solution structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/protein binding
molecule keywords Virion infectivity factor
publication title Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ma9B00
2V1YA 1Q5WB 3QA8A 2EMTA 2C60A 3ZNHB 1P9DU 2KTFA 2M0XA 3ZRFA 3UQBA 3EHVA 4AJYB 1Z5SB 2QHOA 3H1UA 3PLVA 2MX2A 4RM9A 3ZKJC 4XZ4A 2KQ7A 1V81A 2MQJA 3DVNV 4MJSA 4HVBA 4BKSA 3A33B 4IWOA 5J2RA 4NAWA 2EMSA 1GUAB 1V5TA 1YX5B 2FCQA 3H7SA 3PLUA 2KKCA 4BKSD 2CHXA 3TJPA 5D94A 3UF8A 1RFAA 3VTUA 2KANA 4WWNA 2WYQA 3ENEA 5CHVC 4HXDA 2CU1A 4K1RB 2N9XA 1L2NA 4IC7B 3ZNGC 4BFRA 4GDLB 2NR2A 2D11A 1WZ0A 1EUVB 3MJWA 4DDGD 4TQ1A 3L13A 2JZ3B 1LM8B 1AARA 2JY6A 3EFUA 3AI5A 2XK5B 1V80A 3QQ8B 3V61A 3VH4B 3VXWA 3PPAA 4KZCA 2FIDA 4MGKE 3TBLD 3QIJA 1E8XA 4FA6A 2WX1A 4IG7B 2N9EB 2JRHA 4WWPA 3IBEA 3ZLZA 4I6NB 4W9CA 3QCAA 2ZPNA 1L7YA 4KSLC 1YJ1A 2BKRB 1EF1A 2M17A 3ZNZB 5C23A 4AUQC 4LJOB 2L7RA 2PE9A 3ZDTA 2DZMA 2C9WB 3DVGY 3MTNB 2EKEC 4E3CA 2MRPA 2PEAA 3KH0A 3W1YA 2GBKA 2LGDA 2W9NA 1M94A 1E7UA 1GJZA 2XK5A 2K39A 1WE6A 3NZUA 1OQYA 3A9KB 3CSTA 3KUCB 2BPSA 1UZXB 4I6PA 4G3XB 2CHZA 2LRUA 1R4NI 4ASWC 3QARA 2ASQA 2BWES 3ZRCA 2J0JA 2Z0EB 2JPHA 2RPQA 5D6JB 3DVNU 4GOCA 2L3ZA 2HJ8A 5L83A 3H7PA 2IZVB 2D3GA 4M8NA 5AZHA 2FCSA 3NHEB 3TIXA 2ZCCA 3JVZX 3RZFA 4DHJD 2KLGA 4KIKB 4W9HA 4BBNC 3RT3B 3VTWA 2PJHA 2RSUA 5DPSA 3KYCD 1RRBA 3JSVA 3LJ3A 1K8RB 3VFKA 4HLEA 4F1SA 3NY5A 1E90A 3ONSA 2BYFA 2R2QA 3V62A 4AOFA 4TUUA 2ZCBA 1Q1OA 2KLCA 2Y5BB 4RM8A 2DYBA 2RD0A 5DCNA 3WAPA 2JT4B 1ISNA 4KVGB 5D7GA 2OOBB 1TBEA 2LI5A 2I1KA 3BINA 4ZDVA 1LFDA 3PTFC 4MSQB 2IO0B 2JZZA 1C3TA 1EO6A 3HM3A 2LASA 4KIKA 3Q3FA 5CHWA 3APCA 1SE9A 4HDQA 5DPRA 5GMVA 3DOWA 5HKHA 2DENB 3DVGX 2IBIB 3OJ3A 1NI2A 2FAZA 3APFA 3SDLC 5FR6A 3IG3A 3H6NA 1TGZB 1U4AA 1TZ1A 4W9DA 3PT2B 2MSED 4W9FA 1GG3A 2V4LA 2A4ZA 4EKUA 1WXMA 3DBSA 4ANWA 1UH6A 1RLFA 2K6QA 2LGXA 4XX5A 4A3OA 4BKTA 4II2B 2KVRA 4FN2A 2IY1B 3EC8A 4MJSB 5E6NA 4DHZB 2K8HA 3ZW3A 1OGWA 3QX1A 2DX5B 4NAWB 4OVUA 3TMPB 2REXA 2JUOA 5IA7A 4K81A 2KN5A 2K6DB 3VTVA 4IWPA 3QK0A 3ZIMA 4I6LB 2GBNA 4HWIB 4TQ0A 3PS6A 2V3SA 3VUYA 3A4RA 4W9JA 3R3MA 5JZEB 1WJUA 2O2VA 4E71A 1KLVA 4F8CB 1YD8U 4MEMA 2KXJA 3PHXB 2Z0DB 2O6VB 5LXIB 4ICVA 3U8ZA 3VUWA 3ZVVA 4W9LA 4WJNA 3WAOA 1FXTB 2DAJA 2KOXA 4ZRIA 4DDID 3AU4A 1WXSA 3DBLI 4HPMB 4II3B 2NCNA 3WANA 4AP4C 1P98A 1VCBA 4GDKA 5IAAC 2FCMA 1OEYA 1E8WA 1ZKHA 4ICUA 4W9KA 3ZNID 1G6JA 2D07B 1I35A 2LVOA 4P7IA 2DYMA 2CHWA 3A4SC 3ALBA 5LLIA 4NQKE 5DPWA 2DAFA 1WJNA 4K7SA 2MBBB 4ANUA 4MELA 3L54A 3QAQA 2KJRA 2O6VA 1UBIA 2IO1B 1WXVA 4GGQA 1RAXA 4HCNB 2GBJA 2AL3A 2O6VD 3A9JB 4PS3A 4EZJA 4LDTD 5DPTA 4WAAA 3V60A 5KHOA 1V5OA 4IWQA 5JHBA 2AWTA 1P3QU 2BF8B 4EOYA 2L8JA 2KX3A 2MW5A 2IYDB 2MBHA 2C7HA 3GOEA 4A20A 2RR9A 3PSEB 4RMAA 1P1AA 3L17A 2KWVB 4KSKC 4NJ7A 4WJPA 3H7PB 3L08A 1WYWB 1GNUA 2GMIC 4GMVA 2NS5A 4HDOA 1HE8A 4W9IA 4EEWA 3LDZE 1WGHA 3OJ4B 3RD2A 2GBRA 4DHJB 3QWZB 4G0NB 3UINB 1EF5A 3QHTA 4KZ0A 1IP9A 3A1QB 1C1YB 3A9JA 1P0RA 1WH3A 4HPLB 3GZNI 3PHWB 3JSVB 2PPHA 2B3AA 2NPTB 4A3PA 4DWFA 1YQBA 4W9EA 3I3TB 4FBJB 4B95A 3PV1A 2KO3A 5JHAA 4IUMB 3UIOB 1WF9A 2M8SA 4GB9A 2GBMA 2MP2B 3ZUNA 2KMCA 3D32A 4OVVA 3BY4B 2K25A 3KUDB 3TL5A 2KWCA 4NY0A 2KQSA 2L00B 3DDCB 4M0WB 4EZKA 3A1QA 3IVFA 2G4SA 3EECA 1E8ZA 3R7RA 2LRWA 2Z59B 2NPTA 4IM3A 2M1MA 4HCPB 4PS7A 4AWJA 2MWSB 3CSFA 4WJOA 3K9PB 2WDTB 3PRPB 4ANVA 4E74A 4TKNA 3ML8A 2WWZA 2MP2A 1OTRB 4K7WA 3PRZA 2D10A 2J0KA 2LUEA 1XT9B 1WXAA 3TCAA 2BGFA 2CKHB 2D2QA 2K1FA 1WX8A 3O65B 2WX0A 3ML9A 2MBQA 4WQOB 2C7MB 3H9DA 2KHWB 2LVQA 4IM0A 4FHKA 3Q3JA 3WAMA 4ANXA 1WM3A 1ZGUB 3OAWA 2KDBA 3VVWB 2MLBA 3L10B 5AEKB 5KHQA 2CR5A 3CF6E 1I42A 3NZSA 4CYEA 1T0YA 2IO3B 2LXCA 5C1ZA 2HD5B 3B1LX 1WGYA 1XQQA 3DBRI 4WWOA 2M4NA 1YIWA 3N30A 3KYDD 4ZRJA 2N9PC 1UELA 4JIOU 2J0MA 3RULA 2O2VB 3WA0A 1S1QB 2L05A 4KDLB 4DBGA 2KTRA 4M8MA 2JXXA 1WY8A 4KV2A 3W1SA 2ZVOA 4URKA 2DZKA 1WRDB 2MBOA 2KFKA 3QJZA 4PS8A 3ZTCA 4BKGA 3VUXA 2BYVE 2G45B 3T9LA 1WX7A 2NVUI 2FUHB 4GU2A 1KJTA 1UD7A 1V49A 1ZW7A 3VAWA 1E8YA 2VRRB 4DHZE 3R7QA 1WI0A 3N32A 3HK0A 4ZRKA 1Y8RC 2BKFA 4GDKB 2FNJB 3ZDMC 2MBEA 2NBVB 4EUTA 4FJZA 2BYEA 2MA9B 2OJRA 2ZZPB 4LJPB 3APDA 4LDTB 1BT0A 2HE7A 3ZO5B 2AL6A 1LQBA 4AJWA 2KX0A 1R4MI 1WIAA 4PYUA 4WJQA 1H4RA 1UBQA 1YX6B 2KK8A 2J7QB 2LGYA 2KWUB 3OLMD 3M62B 3PRMB 2UWQA 4FLHA 1V9JA 3M63B 2N1WA 1WGDA 5CHFA 3B08A 3VQIA 4GN1A 3VH3B 5J18A 4EFOA 1QZEA 2L0FA 2ZNVC 1Z2MA 5AZFA 1A5RA 4FJVB 2DHZA 3RZWC 3WIMA 3IFWB 2KDFB 3NS8A 2ZPYA 4IM2A 1SIFA 1X1MA 1GC6A 2G3QB 4G11A 1VD2A 4GXBA 4MGYE 4J6IA 5E6PA 5EDSA 4B6WA 2YLMA 4JGHB 1H8CA 2C5LC 2KNBA 3HIZA 3W1SC 1SGHA 3DQVA 3JYUA 3KVFB 4NNJB 1NBFC 5CTRC 4BVUC 2LWPA 3M95A 1E7VA 4MH0E 5BO4B 3RYTA 4FULA 2IY0B 4N9F4 2LD9A 1V86A 5CX3A 2XBBC 1D3ZA 4LCDE 3QC8B 3U7DA 3PGEA 4DXAB 3L0WB 1WJ6A 2ZEQA 4IW0A 5AZGA 4NQLB 2LJ5A 4TV3A 1Q0WB 3KUZA 4GDLA 2I1JA 3VDZA 4B9KA 2K8CA 4DK5A 1WR6E 3SU8X 5D2MB 2IO2B 2G4DB 4NPNA 3AU5A 4XC2A 3PREA 2R2OA 4FHJA 2JRIB 1WE7A 4MSMB 4EZLA 1WFYA 2KJ6A 4KDIC 4NJ6A 3WALA 1J8CA 1NDDA 1XD3B 2DZIA 2L0TA 3UGBB 3CMMB 1OEYJ 2PE6B 2ZNVB 3V6CB 1IYFA 1E5WA 3IHPC 2JF5A 3DPDA 2DYOA 1F9JA 4BOZB 3ZTDA 4PYZA 3C0RB 1V2YA 5JH5C 2KZRA 2N7EA 3B0AA 3RUIB 5L95C 2NBUA 3T8MA 1LXDA 2DZJA 2KJHB 4MGZE 2XEWA 2ZVNA 2K8BA 3DCGA 2KDIA 2KTRB 3ECIA 4BOSC 4X57B 3M3JA 5LXHA 3A9KA 2KFKB 4G50A 2KFJA 1MG8A 3L16A 4JQWC 1J0GA 3SHQA 2N4FA 5E6OA 3VHTC 2KDEB 2LXAA 2N1VA 1WZ3A 2JWZA 4CHKA 2ZJDA 1V6EA 4F7ZA 2RGFA 2FIFA 5G55A 4JL9A 3JW0X 4W9GA 2BWFA 4GIVA 2AEHA 4HK2A 3N3KB 3MHSD 1WMHB 3X0WA 3UIPB 3PZDA 1WX9A 1IPGA 2KC1A 2HTHA 2KMAA 1WM2A 3AULA 2MCNB 2JVCA 3SD5A 3NOBA 4FJYA 2CS4A 1JRUA 3K9OB 2NBWB 1J19A 2N7DA 3X23A 1GC7A 2A5UA 3RCZA 1CMXB 1PQSA 4YL8A 4MM3A 1KOTA 2KD0A 2UYZB 1KM7A 3AXCA 3R66C 4BBNF 4GSWA 1TTNA 4JLCA 2KC2A 1WGGA 2L76A 3HM6X 4CO7A 4MGIE 1WR1A 4FADA 1S3SG 1WMHA 1WJ4A 2C7NB 5TR5A 2FCNA 4ZYNA 5J17A 3KW5B 3HHMA 1UGMA 1WGRA 5G2NA 3P2BA 3PVLA 2AYOB 2GOWA 4K7UA 3DBHI 3V6EB 4MDKE 3UQAA 3S2AA 4HJKA 2LZ6A 3U30A 2LVPA 2YVCA
chains in the Genus database with same CATH superfamily
3MC8A 3W5UB 3UQBA 3EHVA 3H1UA 3TSSA 3ZKJC 2KQ7A 1V5TA 3GE8C 4RH6A 1GB4A 1XLOA 2CHXA 3TJPA 3UF8A 1NEKB 5BYQA 1LGRA 1XCTL 4M01A 2KANA 4WWNA 2WYQA 5CHVC 2ZW1A 2N9XA 3GE3C 1SE2A 2Y5CA 3B2FA 1FNWA 1P7EA 1LM8B 1YN3A 2JY6A 3EFUA 4K3CA 3QQ8B 3VH4B 4KZCA 2X38A 4MGKE 3QIJA 5I4DA 4LK0M 2IGHA 4WIPA 2BKRB 1VZ6A 3AECB 2TSSA 2GBKA 2LGDA 2W9NA 5BMIA 1WE6A 3NZUA 5BMHA 3CSTA 1C4CA 2LHDA 4G3XB 4NZLB 2CHZA 2LRUA 1L0YB 2PW9A 2BWES 2J0JA 4K3BA 2L83A 2RPQA 2MJEA 2HJ8A 4MH8A 2IZVB 2FCSA 1YN5A 3Q8EA 2E3TA 1B1ZA 4US8A 1F52A 1P7FA 1TS2A 2PJHA 5DPSA 3I57A 1I7HA 1RRBA 3JSVA 3LJ3A 3VFKA 2RPVA 3NS1A 4TUUA 2WXKA 1KH0A 2KLCA 2ZCBA 2JT4B 5D7GA 2I1KA 3BINA 4CQNA 1ZXHA 1ZXIA 2FE8A 4MSQB 2J52A 2JZZA 1C3TA 1EO6A 3APCA 1SE9A 5GMVA 1T0RC 1ZDVA 1ZPSA 1K53A 1TJEA 1TGZB 2AX5A 2CU3A 1GG3A 4P1CC 4WH4A 2QILA 3DBSA 4YWGG 1RLFA 2LGXA 4II2B 2IY1B 3EC8A 4NAWB 1ZUD2 1BXTA 2RDBC 2K6DB 1HXYD 1HA5A 4I6LB 4TQ0A 2YEPB 2G9HD 3VUYA 1B9RA 3B9JA 4A55A 2O2VA 3RNEC 2KXJA 2SAKA 2O6VB 1FXTB 4JX1C 4ZRIA 1WXSA 3AEAB 1YJIA 2NCNA 3I63C 4AP4C 3ZNID 2V3NA 5LLIA 3QAQA 4YT0B 2ONQA 2BTEA 1PYWD 2IO1B 4GGQA 4XWWA 4PS3A 3A9JB 5DPTA 2ACZB 4WAAA 5KHOA 2PTLA 2JWUA 3KWVA 2BF8B 2FUG1 4YTPB 2IYDB 3PSEB 2BW2A 2W82A 1F0ZA 4NJ7A 3FILB 3L08A 4YTMB 5HHDG 3R2TA 2NS5A 3Q69A 3OJ4B 4G0NB 3UINB 1FEHA 4KZ0A 1WH3A 3CWIA 3GZNI 3RPFC 1YQBA 3I3TB 2AQ1B 2NTSA 4B95A 5JHAA 2WXLA 4OVVA 3TL5A 1CK1A 4NY0A 2E6XA 2L00B 4M0WB 3A1QA 3IVFA 3IT4B 3EECA 4JWUC 3R7RA 3KQ4A 4PS7A 2MWSB 2XN9C 3K9PB 3C19A 4KGRA 4E74A 4KX6B 1FXIA 1IBXB 2D3CA 4TKNA 3ML8A 4HKZE 2MP2A 1OTRB 2J0KA 3HVDA 1XT9B 1WXAA 1WX8A 2INNE 2QSDA 2D5GA 3N1XC 4WQOB 4ANXA 4FHKA 1C9FA 3EFCA 1T5XD 2KDBA 3VVWB 2MLBA 3L10B 5AEKB 2I2YA 3CF6E 2LEKA 2VH1A 3U52E 1I42A 4PK1A 1T0YA 2IO3B 3Q3MC 1XQQA 2M4NA 2N9PC 2K3UA 2GB1A 3Q3OC 2J53A 4DBGA 1WY8A 2DZKA 2MBOA 2KFKA 4C4VA 3NZ3A 4BKGA 2G45B 3T9LA 3E9SA 1TKYA 1KJTA 2N9LA 2VRRB 4KKJA 1QQRA 2BKFA 3VR8B 2Z8LA 4MT5A 2BYEA 1I4GA 2DWQA 2AL6A 2B76B 1R4MI 1SSNA 1K51A 1H4RA 1YX6B 4L2YA 3PRMB 3AE4B 3RNCC 3NVYA 2MEKA 1EU3A 2LFIA 1Z2MA 1KLUD 1PGBA 4A6QA 1X1MA 2G3QB 4G11A 1GC6A 4GXBA 5E6PA 2BS3B 1UF0A 1KFYB 1SGHA 4NNJB 4O1NA 5CTRC 4P16A 1FXAA 5BO4B 2V4IB 4C00A 5T8IA 2BVCA 1PGXA 2KT7A 5CX3A 5FR3A 3U7DA 3ZGZA 4DXAB 1WJ6A 2ZEQA 5AZGA 2LJ5A 4B9KA 4A90A 1QLBB 2G4DB 3PREA 2JZPA 4FHJA 3ABVB 4EZLA 2W54A 2KJ6A 1XD3B 2DZIA 3OG5A 3CMMB 3MC0B 3BIID 1E5WA 2JF5A 4LNOA 1JROA 4EE2A 3DHGC 1VLBA 2NBUA 2L1AA 4WQMA 3ZJUA 4MGZE 1WSPA 2ZVNA 2KTRB 5LXHA 1PDXA 1SF0A 3M3JA 3A9KA 1MG8A 1J0GA 3SHQA 3BYYB 5E6OA 2M0AA 1D5ZC 1RWSA 1TS4A 3UI3A 4JL9A 1F2RC 3DWGC 4YXDB 1L0XB 3VRBB 4HK2A 3MHSD 1WMHB 3V05A 3PZDA 1WX9A 2KC1A 2N9KA 1WM2A 3AULA 2MCNB 2EKIA 1YNTE 1JRUA 2K22A 4PT5A 3K9OB 2NBWB 1J19A 3AE1B 3RCZA 4YL8A 1KOTA 3AXCA 4BBNF 4GSWA 1WGGA 4CO7A 2MH7A 4FADA 5GXGB 1E6EB 1WJ4A 2KVZA 2BS4B 3KW5B 1J7BA 5G2NA 3PVLA 3AE3B 3DBHI 2BS2B 3Q8FA 3S2AA 2IDYA 2LVPA 1Q5WB 4A9AA 1D6EC 3AEEB 3ZNHB 1P9DU 4ZHPA 1JW9D 3ZRFA 3GS2A 2QHOA 3VRAB 4XZ4A 1V81A 2MQJA 3MC9A 1OFFA 4BKSA 2EMSA 1GUAB 1YX5B 1R7SA 2WLBA 3H7SA 4XWTA 3VTUA 3ENEA 1KRHA 4NJCA 4K1RB 4A8XC 1L2NA 4IC7B 3ZNGC 4BFRA 4GDLB 2NR2A 2MJ3A 1WZ0A 1EUVB 1JQ4A 4TQ1A 2JZ3B 1V80A 2AQ3B 2WXHA 1KTKA 3V61A 1FFUA 3PPAA 3AE8B 1N60A 1JWUD 2ZW0A 3PZ8A 2N9EB 3RI7C 4WWPA 5G5GA 3ZLZA 5HI1A 2IJ0A 2N7JA 2ZPNA 1L7YA 1ET9A 3ZNZB 4AUQC 1C77A 2JXTA 2C9WB 3KH0A 4B0EA 1OQRA 2XK5A 1PFDA 2KAJA 2DLBA 2BYTA 3BK1A 1UZXB 4DXFA 4I6PA 2PVOD 3FAHA 3ZRCA 2Z0EB 2L3ZA 5L83A 3H7PA 2D3GA 5AZHA 1QOGA 4BAXA 3NHEB 1D5MC 3TIXA 3RZFA 4DHJD 5TSSA 4BBNC 1XF5L 1F2RI 1ENFA 3RT3B 1E0ZA 2QJLA 3CIRB 4ARIA 4HLEA 1E90A 3ONSA 4S17A 2R2QA 4L1BA 4AOFA 3TEWA 2BB5A 5DCNA 2DYBA 2RD0A 2MHJA 3WAPA 1ISNA 1E10A 3SEBA 3IXSA 1J7CA 1JWBD 2LASA 4KIKA 5CHWA 1PGAA 2WXJA 4HDQA 4OZBA 2L32A 1NI2A 1DGJA 3PO0A 3SDLC 3IAM1 5FR6A 3IG3A 4W9FA 2MSED 2CJNA 5EE3A 5EE1A 1WXMA 5IN7A 1UH6A 4MJSB 1T6BX 4ZOHC 4REZA 3VTVA 3QK0A 2WDVB 3U7ZA 2GBNA 4HWIB 4LNNA 2V3SA 2K5PA 4RCOA 4IOIE 5AUIA 3PHXB 2LGSA 5LXIB 4M02A 4ICVA 1NI3A 3ZVVA 4WJNA 2DAJA 2KOXA 3OWEB 4HPMB 4YSZB 2WXIA 5IAAC 3ZQ4A 2FCMA 1OEYA 1E8WA 1BUIC 1G6JA 2FBWB 2LVOA 2DYMA 3A4SC 3W9CB 3ALBA 4NQKE 2MBBB 3L54A 1ZOYB 2D3AA 1WXVA 4JE3B 2O6VD 1EU4A 3V60A 4IWQA 3RNFC 2JSVX 1YOVB 5D3DA 2KX3A 1P1AA 3L17A 4KSKC 1GNUA 2GMIC 4HDOA 2J42A 3LDZE 3RD2A 4DHJB 1EF5A 5D3IB 1IP9A 4RFBA 3A1QB 4RF1A 4L23A 4HPLB 2WNMA 4A3PA 5FK9C 4OZCA 4FBJB 3TEYA 3PV1A 1YMHE 2KO3A 4IUMB 4R3DA 2M8SA 4GB9A 2MP2B 3ZUNA 2KMCA 3RNBC 2K25A 1T0SC 1MHXA 2KQSA 1MG4A 1TS5A 2G4SA 2NPTA 4XYCA 4AWJA 1TY0A 2BBCA 2LUEA 1QOAA 2MBQA 2C7MB 3H9DA 4GLSC 3DWMA 5KHQA 5LNK1 2CR5A 4CYEA 2Y5PA 5C1ZA 4XDCA 3N30A 3KYDD 4JIOU 2J0MA 1FCCC 3V3XA 1HZ5A 1N5XA 1V1PA 2L05A 1TT5B 2JXXA 4KV2A 3W1SA 4B0MA 4C80A 2WXPA 1V1OA 1L4ZB 1V49A 1E8YA 1UWMA 4ZRKA 4GDKB 2FNJB 2W3RA 4RNAA 2MBEA 1WXQA 2MA9B 3HUIA 5E6JA 4OW0A 3APDA 2HE7A 4AJWA 3BVMA 4WJQA 1WGKA 2IPKD 2KK8A 2WXRA 1FO4A 2KWUB 4USAA 4FLHA 3KLSX 4YSXB 4FXCA 3P1MA 3AMZA 4GN1A 3VH3B 2BQQA 4WURA 5J18A 2JX5A 1QZEA 3NJTA 1GOZA 2ZNVC 4BZAA 4ZHOA 1I4XA 3IFWB 4IM2A 1VD2A 2WGSA 5EDSA 2WXNA 4B6WA 1H8CA 3W1SC 1QKZA 4BVUC 4JPSA 3NG0A 1HEZE 1WWTA 3RYTA 4J3OD 4N9F4 2LD9A 1V86A 3P4PB 4IW0A 4TMAB 1Q0WB 2D3BA 2KN4A 2K8CA 3P4SB 4UDUC 1RM6C 5D2MB 4XC2A 3AU5A 3N1ZC 3AEFB 3ZXRA 3Q14C 1CZPA 1SE3A 1WFYA 4NJ6A 1NDDA 4D2KA 3NUHB 1VDVA 3V6CB 1IYFA 2DYOA 1XXGA 4PYZA 1V2YA 5JH5C 2KZRA 2N7EA 1VR9A 3RUIB 1LXDA 2KJHB 3E56A 1UGJA 2WS3B 2JYTA 2KACA 3TEZA 3U4EG 4BOSC 2KFJA 3L16A 1ROEA 2N4FA 3FC4A 2LXAA 2HTME 4YTNB 1TZOA 4IKGA 2JWZA 1V6EA 4F7ZA 5C2TB 3JW0X 3AE9B 4W9GA 2BB6A 1RFKA 5FKAC 5BYRA 1IPGA 1VRAB 2JVCA 1N61A 3SD5A 4C7YA 2N7DA 1GC7A 1D4BA 1JRPA 1KM7A 2JYEA 1TTNA 2KQ4X 2YEPF 3HM6X 2QCZA 2W55A 1JALA 4ITKA 1ZP0B 1QT9A 5TR5A 2LMCA 3HHMA 3P2BA 2AYOB 4K7UA 4MDKE 3BVZA 1XLNA 3UQAA 2LZ6A 3U30A 2V1YA 2EMTA 2KTFA 2M0XA 4AJYB 2MX2A 1PUTA 1L0VB 4NAWA 1SJHD 3PLUA 2KKCA 2MJDA 5D94A 4TSSA 1RFAA 3VR9B 2UU7A 3P63A 4HROA 3MJWA 2EELA 4DDGD 3L13A 2HJ1A 1FRDA 3AI5A 3AE5B 2XK5B 4QAYA 2FIDA 3TBLD 1E8XA 3AM9A 2M17A 1DOIA 1Y56A 2PE9A 2GI9A 3DVGY 3MTNB 2EKEC 2HDEA 3W1YA 1M94A 1TKGA 2OEDA 1VZ7A 2BPSA 4IDIA 3DHHC 4HRSA 1HZ6A 4YSYB 1FMAD 2ASQA 3FILA 3AH7A 4C56C 2KLGA 4KIKB 4W9HA 3VTWA 2RSUA 1K8RB 3TUOA 4F1SA 2WXOA 3LXFA 2Y3AA 4MM3B 4RM8A 2Y5BB 2OOBB 3P4RB 3Q8CA 3W2DA 4RGOS 2WXFA 1LFDA 3PTFC 3EUB2 2ICIA 3DOWA 3AE6B 3DVGX 1IBXA 3APFA 3H6NA 1FIQA 5HFYA 1U4AA 1TZ1A 3I9V1 2DBYA 4EKUA 2K6QA 4XX5A 5G5HA 4XDDA 4A3OA 4BKTA 2KVRA 1XCQL 4DHZB 3TMPB 1K50A 4XE0A 2REXA 4LTUA 2JUOA 4N6EB 5IA7A 1R4NB 2KN5A 4LNKA 4IWPA 4M00A 3NVZA 3O13A 4W9JA 5JZEB 2IGDA 1UWXA 4E71A 3Q3NC 2IGGA 2Z0DB 3U8ZA 3RNGC 3WAOA 1V97A 4H2AA 3AU4A 1DOXA 2W3SA 4II3B 3TEXA 3J9CA 3WANA 1P98A 4W9KA 1VJKA 1I35A 1BMLC 1L4DB 4HJGE 2CHWA 5DPWA 2WXMA 4MELA 2KJRA 1UBIA 2KDMA 3MFGA 2GBJA 4LDTD 1IGCA 4P6VF 4RF0A 5JHBA 1D5XC 4DQOC 2MW5A 2C7HA 4A20A 4RMAA 1ZE3D 4WJPA 2KWVB 1WYWB 1F77A 4LLGM 2JU6X 3QHTA 4WAFA 3N1YC 1NYRA 1P0RA 1AW7A 3JSVB 2B3AA 2NPTB 2L52A 4DWFA 2QC8A 2R61A 5H92C 1NENB 1WF9A 3D32A 3BY4B 3KUDB 1N5WA 1I4PA 4EZKA 2WQYB 3DBLB 2LRWA 2Z59B 4IM3A 2WXGA 1STEA 2RMMA 1I4QA 2WWZA 4K7WA 3PRZA 2D2QA 3ML9A 5C3JB 4IM0A 1ZGUB 3OAWA 1UNSA 3RMKC 3N9YC 2JQRB 3NZSA 3B1LX 4WWOA 1YIWA 3SFDB 4ZRJA 2PLPA 2O2VB 3WA0A 4AQ7A 1I4RA 2KTRA 4URKA 1QOBA 1WRDB 1SXTA 3DHIC 3VUXA 1MI0A 2NVUI 1FD6A 4DHZE 4ACFA 3N32A 3HK0A 1Y8RC 2OHFA 2INPE 1MJDA 4FJZA 2RDHA 4LJPB 4LDTB 1BT0A 3HVZA 3ZO5B 1LQBA 2KX0A 4PYUA 2NMQA 4RGMA 2LGYA 3H8HA 3OLMD 1KLGD 2UWQA 5CHFA 1TY2A 3B08A 2V0GA 4EFOA 4RGNA 3AEGB 2L0FA 4ZRQA 3EGRA 5AZFA 3HRDD 2LUMA 3ZJTA 1QOFA 2DHZA 2V9HA 4N59A 3NS8A 2ZPYA 1SIFA 1FPYA 3DBRB 1JWSD 4NAMA 4JGHB 2KNBA 1N6ZA 1TS3A 1EWCA 3AEDB 3JYUA 1NBFC 2LWPA 3M95A 1E7VA 4OHJA 4FULA 3LB8C 4LCDE 1QILA 1C76A 1XEEA 3L0WB 4TV3A 1XLQA 3BK2A 3KUZA 4GDLA 2I1JA 3VDZA 4DK5A 3R2IA 4NPNA 1WYGA 2R2OA 3DBHB 2J4XA 1WE7A 4MSMB 3GP7A 3WALA 1J8CA 2DNFA 1OEYJ 2PE6B 3Q8AA 4BOZB 1LO5D 1F9JA 3ZTDA 3C0RB 2PMVA 2WDRB 3T8MA 1GB1A 2XEWA 3AN1A 2K8BA 3ECIA 4P1BC 2OJWA 2KFKB 4C4VB 4JQWC 1DOYA 1JWMD 2KDEB 3NVVA 1WZ3A 1T3QA 2RGFA 3T3NA 1V8CA 2FIFA 1YQ4B 1AWDA 2BWFA 2AEHA 3N3KB 3X0WA 3UIPB 1E9MA 2HTHA 3NRZA 2QIEB 1SE4A 3NOBA 4FJYA 1C79A 3X23A 2Q5WD 2KD0A 3R66C 1FNVA 4JLCA 1AN8A 1ESFA 1WR1A 2ON8A 2C7NB 2FCNA 4ZYNA 3SR6A 1WGRA 1YN4A 1XLPA 2GOWA 3ETRA 4MACA 3V6EB 1C78A 3I5JC 2YVCA 3IAS1 3QA8A 2C60A 5IKCM 4RGTA 1UUPA 3RNAC 1Z5SB 3PLVA 4RM9A 2V3PA 3DVNV 4MJSA 4HVBA 2M56B 5J2RA 3A33B 4IWOA 2FCQA 4BKSD 1SJED 1FNUA 4HXDA 2CU1A 1YJJA 2D11A 1L6UA 4AS1A 4JWSC 1AARA 2XNAC 3GB1A 3KWLA 3VXWA 2INCC 3AV8A 2WU5B 4FA6A 1GPXA 2WX1A 4IG7B 1ZDXA 2JRHA 5IP4D 3IBEA 3LYYA 4I6NB 4W9CA 3QCAA 4KSLC 1YJ1A 1EF1A 5C23A 4LJOB 2L7RA 3ZDTA 2H88B 2DZMA 4LNIA 4E3CA 1MHHE 2MRPA 2N0SB 2PEAA 5IO9A 1E7UA 1GJZA 1C4AA 2K39A 1OQYA 3A9KB 3KUCB 3P4QB 1R4NI 4ASWC 3QARA 5D6JB 2JPHA 3DVNU 4GOCA 1ACCA 4M8NA 1M4VA 1CQVA 2QEJC 2ZCCA 1MVKA 3JVZX 3KYCD 5H8YE 3NY5A 2BYFA 3V62A 1Q1OA 4ZYSA 3BWUD 4KVGB 1YQ3B 1TBEA 2LI5A 4ZDVA 2PKOA 2IO0B 3HM3A 3Q3FA 5DPRA 2KYWA 5HKHA 1NVID 1JMLA 2DENB 2IBIB 3OJ3A 1JCKB 2BT6A 2FAZA 3AE2B 4HKQA 4W9DA 3PT2B 3ZXVA 2V4LA 2A4ZA 4ANWA 1A70A 4FN2A 1MFWA 5E6NA 2K8HA 3ZW3A 1OGWA 3QX1A 2DX5B 4OVUA 4K81A 3BYTB 3ZIMA 1TKEA 3PS6A 3A4RA 1FM0D 4WWMA 3R3MA 1WJUA 1KLVA 5EE0A 4F8CB 5HG2A 1YD8U 4MEMA 1N62A 3VUWA 4W9LA 2PIAA 5BMGA 4DDID 3DBLI 1QF6A 1VCBA 4GDKA 4ICUA 1ZKHA 2D07B 4DXGA 4P7IA 1SB3C 2DAFA 1WJNA 4K7SA 4ANUA 3AE7B 2O6VA 1VZ8A 1RAXA 4HCNB 2AL3A 1SBBB 1J7AA 4EZJA 1V5OA 2LJIA 2AWTA 4ZRPA 1P3QU 3P42A 4EOYA 2L8JA 2MBHA 3GOEA 3URYA 4N58A 2RR9A 3U2SC 2I38A 3H7PB 1IUEA 4GMVA 1HE8A 4W9IA 4EEWA 3IT6B 1WGHA 2GBRA 4KKIA 3QWZB 2K9XA 1C1YB 3A9JA 1EM7A 1EWYC 2QDFA 1FCLA 3PHWB 2WU2B 3C8YA 2PPHA 4W9EA 2PVGC 3NVWA 2M19A 2VZKD 3UIOB 3WCQA 2GBMA 1DYQA 4C7ZA 1SEBD 2KWCA 3DDCB 3PZ7A 1MPEA 2AQ2B 2VH2A 5EE9A 1E8ZA 4OZAA 2M1MA 4HCPB 4WJOA 1OQQA 3CSFA 2WDTB 3PRPB 4ANVA 4ARCA 1NYQA 1Q10A 2D10A 3TCAA 2BGFA 2CKHB 2K1FA 3O65B 1TYGB 2WX0A 2KMMA 2KHWB 4HEA1 2LVQA 3WAMA 4M0WA 3Q3JA 1WM3A 1L5PA 1KF6B 2LXCA 2HD5B 1WGYA 3DBRI 3SFEB 1UELA 1E7PB 2H89B 3RULA 1S1QB 4KDLB 4M8MA 2ZVOA 3QJZA 4PS8A 5IOIA 3GZNB 2BYVE 4S0RA 1WX7A 2X8XX 2FUHB 4GU2A 1UD7A 1ZW7A 3VAWA 3R7QA 1WI0A 3AB5A 4KGSA 3ZDMC 2LHEA 3MJ5A 1SIJA 2NBVB 4EUTA 4KGTA 2OJRA 2ZZPB 1N63A 2WP9B 1WIAA 1UBQA 4LNFA 2J7QB 1I4HA 3M62B 5MPOA 1V9JA 3M63B 2N1WA 1WGDA 3VQIA 4US9A 2SEBD 5AUKA 1A5RA 4FJVB 3T3OA 3B2GA 3RZWC 3WIMA 1CJEA 1RYJA 2KDFB 3Q8BA 2GRIA 4MGYE 1TIFA 4J6IA 4Q2JA 4XGAB 3RFZB 2VZKB 2YLMA 2C5LC 1JWAD 3BZDB 3HIZA 3DQVA 3KVFB 3W5VB 3MP9A 4MH0E 1WRIA 2IY0B 2INDC 2XBBC 1K52A 1D3ZA 3QC8B 3PGEA 4NQLB 2NTTA 1IGDA 2G1EA 1ET6A 1WR6E 3AEBB 3Q6BA 3SU8X 2IO2B 2QMTA 1L6VA 1R4MB 2RDGA 2JRIB 3Q2AC 1XO3A 4KDIC 2L0TA 3UGBB 2ZNVB 1T0QC 3IHPC 3DPDA 1HTOA 3EA6A 3B0AA 5L95C 2DZJA 2WXQA 3ZYYX 2KWDA 4HPPA 2CJOA 1V1PB 2GLSA 3DCGA 2KDIA 4X57B 4G50A 1C4PA 3VHTC 2N1VA 4CHKA 2ZJDA 5BYSA 5G55A 1F1HA 2K0PA 3ZJVA 1HQRD 4GIVA 3R8BA 2KMAA 3MHZA 1AYFA 2CS4A 1GAQB 2A5UA 1CMXB 1HTQA 1PQSA 2LGIA 4MM3A 2UYZB 4OVZA 2KC2A 2L76A 4MGIE 3N20C 1S3SG 1WMHA 3L4PA 3BVGA 1FFVA 2WDQB 5J17A 1UGMA 5JXVA 3RN9C 3FKYA 1FRRA 2WHIA 4HJKA 3ZTCA
chains in the Genus database with same CATH topology
2V1YA 1Q5WB 3QA8A 2EMTA 2C60A 3ZNHB 1P9DU 2KTFA 2M0XA 3ZRFA 3UQBA 3EHVA 4AJYB 1Z5SB 2QHOA 3H1UA 3PLVA 2MX2A 4RM9A 3ZKJC 4XZ4A 2KQ7A 1V81A 2MQJA 3DVNV 4MJSA 4HVBA 4BKSA 3A33B 4IWOA 5J2RA 4NAWA 2EMSA 1GUAB 1V5TA 1YX5B 2FCQA 3H7SA 3PLUA 2KKCA 4BKSD 2CHXA 3TJPA 5D94A 3UF8A 1RFAA 3VTUA 2KANA 4WWNA 2WYQA 3ENEA 5CHVC 4HXDA 2CU1A 4K1RB 2N9XA 1L2NA 4IC7B 3ZNGC 4BFRA 4GDLB 2NR2A 2D11A 1WZ0A 1EUVB 3MJWA 4DDGD 4TQ1A 3L13A 2JZ3B 1LM8B 1AARA 2JY6A 3EFUA 3AI5A 2XK5B 1V80A 3QQ8B 3V61A 3VH4B 3VXWA 3PPAA 4KZCA 2FIDA 4MGKE 3TBLD 3QIJA 1E8XA 4FA6A 2WX1A 4IG7B 2N9EB 2JRHA 4WWPA 3IBEA 3ZLZA 4I6NB 4W9CA 3QCAA 2ZPNA 1L7YA 4KSLC 1YJ1A 2BKRB 1EF1A 2M17A 3ZNZB 5C23A 4AUQC 4LJOB 2L7RA 2PE9A 3ZDTA 2DZMA 2C9WB 3DVGY 3MTNB 2EKEC 4E3CA 2MRPA 2PEAA 3KH0A 3W1YA 2GBKA 2LGDA 2W9NA 1M94A 1E7UA 1GJZA 2XK5A 2K39A 1WE6A 3NZUA 1OQYA 3A9KB 3CSTA 3KUCB 2BPSA 1UZXB 4I6PA 4G3XB 2CHZA 2LRUA 1R4NI 4ASWC 3QARA 2ASQA 2BWES 3ZRCA 2J0JA 2Z0EB 2JPHA 2RPQA 5D6JB 3DVNU 4GOCA 2L3ZA 2HJ8A 5L83A 3H7PA 2IZVB 2D3GA 4M8NA 5AZHA 2FCSA 3NHEB 3TIXA 2ZCCA 3JVZX 3RZFA 4DHJD 2KLGA 4KIKB 4W9HA 4BBNC 3RT3B 3VTWA 2PJHA 2RSUA 5DPSA 3KYCD 1RRBA 3JSVA 3LJ3A 1K8RB 3VFKA 4HLEA 4F1SA 3NY5A 1E90A 3ONSA 2BYFA 2R2QA 3V62A 4AOFA 4TUUA 2ZCBA 1Q1OA 2KLCA 2Y5BB 4RM8A 2DYBA 2RD0A 5DCNA 3WAPA 2JT4B 1ISNA 4KVGB 5D7GA 2OOBB 1TBEA 2LI5A 2I1KA 3BINA 4ZDVA 1LFDA 3PTFC 4MSQB 2IO0B 2JZZA 1C3TA 1EO6A 3HM3A 2LASA 4KIKA 3Q3FA 5CHWA 3APCA 1SE9A 4HDQA 5DPRA 5GMVA 3DOWA 5HKHA 2DENB 3DVGX 2IBIB 3OJ3A 1NI2A 2FAZA 3APFA 3SDLC 5FR6A 3IG3A 3H6NA 1TGZB 1U4AA 1TZ1A 4W9DA 3PT2B 2MSED 4W9FA 1GG3A 2V4LA 2A4ZA 4EKUA 1WXMA 3DBSA 4ANWA 1UH6A 1RLFA 2K6QA 2LGXA 4XX5A 4A3OA 4BKTA 4II2B 2KVRA 4FN2A 2IY1B 3EC8A 4MJSB 5E6NA 4DHZB 2K8HA 3ZW3A 1OGWA 3QX1A 2DX5B 4NAWB 4OVUA 3TMPB 2REXA 2JUOA 5IA7A 4K81A 2KN5A 2K6DB 3VTVA 4IWPA 3QK0A 3ZIMA 4I6LB 2GBNA 4HWIB 4TQ0A 3PS6A 2V3SA 3VUYA 3A4RA 4W9JA 3R3MA 5JZEB 1WJUA 2O2VA 4E71A 1KLVA 4F8CB 1YD8U 4MEMA 2KXJA 3PHXB 2Z0DB 2O6VB 5LXIB 4ICVA 3U8ZA 3VUWA 3ZVVA 4W9LA 4WJNA 3WAOA 1FXTB 2DAJA 2KOXA 4ZRIA 4DDID 3AU4A 1WXSA 3DBLI 4HPMB 4II3B 2NCNA 3WANA 4AP4C 1P98A 1VCBA 4GDKA 5IAAC 2FCMA 1OEYA 1E8WA 1ZKHA 4ICUA 4W9KA 3ZNID 1G6JA 2D07B 1I35A 2LVOA 4P7IA 2DYMA 2CHWA 3A4SC 3ALBA 5LLIA 4NQKE 5DPWA 2DAFA 1WJNA 4K7SA 2MBBB 4ANUA 4MELA 3L54A 3QAQA 2KJRA 2O6VA 1UBIA 2IO1B 1WXVA 4GGQA 1RAXA 4HCNB 2GBJA 2AL3A 2O6VD 3A9JB 4PS3A 4EZJA 4LDTD 5DPTA 4WAAA 3V60A 5KHOA 1V5OA 4IWQA 5JHBA 2AWTA 1P3QU 2BF8B 4EOYA 2L8JA 2KX3A 2MW5A 2IYDB 2MBHA 2C7HA 3GOEA 4A20A 2RR9A 3PSEB 4RMAA 1P1AA 3L17A 2KWVB 4KSKC 4NJ7A 4WJPA 3H7PB 3L08A 1WYWB 1GNUA 2GMIC 4GMVA 2NS5A 4HDOA 1HE8A 4W9IA 4EEWA 3LDZE 1WGHA 3OJ4B 3RD2A 2GBRA 4DHJB 3QWZB 4G0NB 3UINB 1EF5A 3QHTA 4KZ0A 1IP9A 3A1QB 1C1YB 3A9JA 1P0RA 1WH3A 4HPLB 3GZNI 3PHWB 3JSVB 2PPHA 2B3AA 2NPTB 4A3PA 4DWFA 1YQBA 4W9EA 3I3TB 4FBJB 4B95A 3PV1A 2KO3A 5JHAA 4IUMB 3UIOB 1WF9A 2M8SA 4GB9A 2GBMA 2MP2B 3ZUNA 2KMCA 3D32A 4OVVA 3BY4B 2K25A 3KUDB 3TL5A 2KWCA 4NY0A 2KQSA 2L00B 3DDCB 4M0WB 4EZKA 3A1QA 3IVFA 2G4SA 3EECA 1E8ZA 3R7RA 2LRWA 2Z59B 2NPTA 4IM3A 2M1MA 4HCPB 4PS7A 4AWJA 2MWSB 3CSFA 4WJOA 3K9PB 2WDTB 3PRPB 4ANVA 4E74A 4TKNA 3ML8A 2WWZA 2MP2A 1OTRB 4K7WA 3PRZA 2D10A 2J0KA 2LUEA 1XT9B 1WXAA 3TCAA 2BGFA 2CKHB 2D2QA 2K1FA 1WX8A 3O65B 2WX0A 3ML9A 2MBQA 4WQOB 2C7MB 3H9DA 2KHWB 2LVQA 4IM0A 4FHKA 3Q3JA 3WAMA 4ANXA 1WM3A 1ZGUB 3OAWA 2KDBA 3VVWB 2MLBA 3L10B 5AEKB 5KHQA 2CR5A 3CF6E 1I42A 3NZSA 4CYEA 1T0YA 2IO3B 2LXCA 5C1ZA 2HD5B 3B1LX 1WGYA 1XQQA 3DBRI 4WWOA 2M4NA 1YIWA 3N30A 3KYDD 4ZRJA 2N9PC 1UELA 4JIOU 2J0MA 3RULA 2O2VB 3WA0A 1S1QB 2L05A 4KDLB 4DBGA 2KTRA 4M8MA 2JXXA 1WY8A 4KV2A 3W1SA 2ZVOA 4URKA 2DZKA 1WRDB 2MBOA 2KFKA 3QJZA 4PS8A 3ZTCA 4BKGA 3VUXA 2BYVE 2G45B 3T9LA 1WX7A 2NVUI 2FUHB 4GU2A 1KJTA 1UD7A 1V49A 1ZW7A 3VAWA 1E8YA 2VRRB 4DHZE 3R7QA 1WI0A 3N32A 3HK0A 4ZRKA 1Y8RC 2BKFA 4GDKB 2FNJB 3ZDMC 2MBEA 2NBVB 4EUTA 4FJZA 2BYEA 2MA9B 2OJRA 2ZZPB 4LJPB 3APDA 4LDTB 1BT0A 2HE7A 3ZO5B 2AL6A 1LQBA 4AJWA 2KX0A 1R4MI 1WIAA 4PYUA 4WJQA 1H4RA 1UBQA 1YX6B 2KK8A 2J7QB 2LGYA 2KWUB 3OLMD 3M62B 3PRMB 2UWQA 4FLHA 1V9JA 3M63B 2N1WA 1WGDA 5CHFA 3B08A 3VQIA 4GN1A 3VH3B 5J18A 4EFOA 1QZEA 2L0FA 2ZNVC 1Z2MA 5AZFA 1A5RA 4FJVB 2DHZA 3RZWC 3WIMA 3IFWB 2KDFB 3NS8A 2ZPYA 4IM2A 1SIFA 1X1MA 1GC6A 2G3QB 4G11A 1VD2A 4GXBA 4MGYE 4J6IA 5E6PA 5EDSA 4B6WA 2YLMA 4JGHB 1H8CA 2C5LC 2KNBA 3HIZA 3W1SC 1SGHA 3DQVA 3JYUA 3KVFB 4NNJB 1NBFC 5CTRC 4BVUC 2LWPA 3M95A 1E7VA 4MH0E 5BO4B 3RYTA 4FULA 2IY0B 4N9F4 2LD9A 1V86A 5CX3A 2XBBC 1D3ZA 4LCDE 3QC8B 3U7DA 3PGEA 4DXAB 3L0WB 1WJ6A 2ZEQA 4IW0A 5AZGA 4NQLB 2LJ5A 4TV3A 1Q0WB 3KUZA 4GDLA 2I1JA 3VDZA 4B9KA 2K8CA 4DK5A 1WR6E 3SU8X 5D2MB 2IO2B 2G4DB 4NPNA 3AU5A 4XC2A 3PREA 2R2OA 4FHJA 2JRIB 1WE7A 4MSMB 4EZLA 1WFYA 2KJ6A 4KDIC 4NJ6A 3WALA 1J8CA 1NDDA 1XD3B 2DZIA 2L0TA 3UGBB 3CMMB 1OEYJ 2PE6B 2ZNVB 3V6CB 1IYFA 1E5WA 3IHPC 2JF5A 3DPDA 2DYOA 1F9JA 4BOZB 3ZTDA 4PYZA 3C0RB 1V2YA 5JH5C 2KZRA 2N7EA 3B0AA 3RUIB 5L95C 2NBUA 3T8MA 1LXDA 2DZJA 2KJHB 4MGZE 2XEWA 2ZVNA 2K8BA 3DCGA 2KDIA 2KTRB 3ECIA 4BOSC 4X57B 3M3JA 5LXHA 3A9KA 2KFKB 4G50A 2KFJA 1MG8A 3L16A 4JQWC 1J0GA 3SHQA 2N4FA 5E6OA 3VHTC 2KDEB 2LXAA 2N1VA 1WZ3A 2JWZA 4CHKA 2ZJDA 1V6EA 4F7ZA 2RGFA 2FIFA 5G55A 4JL9A 3JW0X 4W9GA 2BWFA 4GIVA 2AEHA 4HK2A 3N3KB 3MHSD 1WMHB 3X0WA 3UIPB 3PZDA 1WX9A 1IPGA 2KC1A 2HTHA 2KMAA 1WM2A 3AULA 2MCNB 2JVCA 3SD5A 3NOBA 4FJYA 2CS4A 1JRUA 3K9OB 2NBWB 1J19A 2N7DA 3X23A 1GC7A 2A5UA 3RCZA 1CMXB 1PQSA 4YL8A 4MM3A 1KOTA 2KD0A 2UYZB 1KM7A 3AXCA 3R66C 4BBNF 4GSWA 1TTNA 4JLCA 2KC2A 1WGGA 2L76A 3HM6X 4CO7A 4MGIE 1WR1A 4FADA 1S3SG 1WMHA 1WJ4A 2C7NB 5TR5A 2FCNA 4ZYNA 5J17A 3KW5B 3HHMA 1UGMA 1WGRA 5G2NA 3P2BA 3PVLA 2AYOB 2GOWA 4K7UA 3DBHI 3V6EB 4MDKE 3UQAA 3S2AA 4HJKA 2LZ6A 3U30A 2LVPA 2YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Y A;  1Q5W B;  3QA8 A;  2EMT A;  2C60 A;  3ZNH B;  1P9D U;  2KTF A;  2M0X A;  3ZRF A;  3UQB A;  3EHV A;  4AJY B;  1Z5S B;  2QHO A;  3H1U A;  3PLV A;  2MX2 A;  4RM9 A;  3ZKJ C;  4XZ4 A;  2KQ7 A;  1V81 A;  2MQJ A;  3DVN V;  4MJS A;  4HVB A;  4BKS A;  3A33 B;  4IWO A;  5J2R A;  4NAW A;  2EMS A;  1GUA B;  1V5T A;  1YX5 B;  2FCQ A;  3H7S A;  3PLU A;  2KKC A;  4BKS D;  2CHX A;  3TJP A;  5D94 A;  3UF8 A;  1RFA A;  3VTU A;  2KAN A;  4WWN A;  2WYQ A;  3ENE A;  5CHV C;  4HXD A;  2CU1 A;  4K1R B;  2N9X A;  1L2N A;  4IC7 B;  3ZNG C;  4BFR A;  4GDL B;  2NR2 A;  2D11 A;  1WZ0 A;  1EUV B;  3MJW A;  4DDG D;  4TQ1 A;  3L13 A;  2JZ3 B;  1LM8 B;  1AAR A;  2JY6 A;  3EFU A;  3AI5 A;  2XK5 B;  1V80 A;  3QQ8 B;  3V61 A;  3VH4 B;  3VXW A;  3PPA A;  4KZC A;  2FID A;  4MGK E;  3TBL D;  3QIJ A;  1E8X A;  4FA6 A;  2WX1 A;  4IG7 B;  2N9E B;  2JRH A;  4WWP A;  3IBE A;  3ZLZ A;  4I6N B;  4W9C A;  3QCA A;  2ZPN A;  1L7Y A;  4KSL C;  1YJ1 A;  2BKR B;  1EF1 A;  2M17 A;  3ZNZ B;  5C23 A;  4AUQ C;  4LJO B;  2L7R A;  2PE9 A;  3ZDT A;  2DZM A;  2C9W B;  3DVG Y;  3MTN B;  2EKE C;  4E3C A;  2MRP A;  2PEA A;  3KH0 A;  3W1Y A;  2GBK A;  2LGD A;  2W9N A;  1M94 A;  1E7U A;  1GJZ A;  2XK5 A;  2K39 A;  1WE6 A;  3NZU A;  1OQY A;  3A9K B;  3CST A;  3KUC B;  2BPS A;  1UZX B;  4I6P A;  4G3X B;  2CHZ A;  2LRU A;  1R4N I;  4ASW C;  3QAR A;  2ASQ A;  2BWE S;  3ZRC A;  2J0J A;  2Z0E B;  2JPH A;  2RPQ A;  5D6J B;  3DVN U;  4GOC A;  2L3Z A;  2HJ8 A;  5L83 A;  3H7P A;  2IZV B;  2D3G A;  4M8N A;  5AZH A;  2FCS A;  3NHE B;  3TIX A;  2ZCC A;  3JVZ X;  3RZF A;  4DHJ D;  2KLG A;  4KIK B;  4W9H A;  4BBN C;  3RT3 B;  3VTW A;  2PJH A;  2RSU A;  5DPS A;  3KYC D;  1RRB A;  3JSV A;  3LJ3 A;  1K8R B;  3VFK A;  4HLE A;  4F1S A;  3NY5 A;  1E90 A;  3ONS A;  2BYF A;  2R2Q A;  3V62 A;  4AOF A;  4TUU A;  2ZCB A;  1Q1O A;  2KLC A;  2Y5B B;  4RM8 A;  2DYB A;  2RD0 A;  5DCN A;  3WAP A;  2JT4 B;  1ISN A;  4KVG B;  5D7G A;  2OOB B;  1TBE A;  2LI5 A;  2I1K A;  3BIN A;  4ZDV A;  1LFD A;  3PTF C;  4MSQ B;  2IO0 B;  2JZZ A;  1C3T A;  1EO6 A;  3HM3 A;  2LAS A;  4KIK A;  3Q3F A;  5CHW A;  3APC A;  1SE9 A;  4HDQ A;  5DPR A;  5GMV A;  3DOW A;  5HKH A;  2DEN B;  3DVG X;  2IBI B;  3OJ3 A;  1NI2 A;  2FAZ A;  3APF A;  3SDL C;  5FR6 A;  3IG3 A;  3H6N A;  1TGZ B;  1U4A A;  1TZ1 A;  4W9D A;  3PT2 B;  2MSE D;  4W9F A;  1GG3 A;  2V4L A;  2A4Z A;  4EKU A;  1WXM A;  3DBS A;  4ANW A;  1UH6 A;  1RLF A;  2K6Q A;  2LGX A;  4XX5 A;  4A3O A;  4BKT A;  4II2 B;  2KVR A;  4FN2 A;  2IY1 B;  3EC8 A;  4MJS B;  5E6N A;  4DHZ B;  2K8H A;  3ZW3 A;  1OGW A;  3QX1 A;  2DX5 B;  4NAW B;  4OVU A;  3TMP B;  2REX A;  2JUO A;  5IA7 A;  4K81 A;  2KN5 A;  2K6D B;  3VTV A;  4IWP A;  3QK0 A;  3ZIM A;  4I6L B;  2GBN A;  4HWI B;  4TQ0 A;  3PS6 A;  2V3S A;  3VUY A;  3A4R A;  4W9J A;  3R3M A;  5JZE B;  1WJU A;  2O2V A;  4E71 A;  1KLV A;  4F8C B;  1YD8 U;  4MEM A;  2KXJ A;  3PHX B;  2Z0D B;  2O6V B;  5LXI B;  4ICV A;  3U8Z A;  3VUW A;  3ZVV A;  4W9L A;  4WJN A;  3WAO A;  1FXT B;  2DAJ A;  2KOX A;  4ZRI A;  4DDI D;  3AU4 A;  1WXS A;  3DBL I;  4HPM B;  4II3 B;  2NCN A;  3WAN A;  4AP4 C;  1P98 A;  1VCB A;  4GDK A;  5IAA C;  2FCM A;  1OEY A;  1E8W A;  1ZKH A;  4ICU A;  4W9K A;  3ZNI D;  1G6J A;  2D07 B;  1I35 A;  2LVO A;  4P7I A;  2DYM A;  2CHW A;  3A4S C;  3ALB A;  5LLI A;  4NQK E;  5DPW A;  2DAF A;  1WJN A;  4K7S A;  2MBB B;  4ANU A;  4MEL A;  3L54 A;  3QAQ A;  2KJR A;  2O6V A;  1UBI A;  2IO1 B;  1WXV A;  4GGQ A;  1RAX A;  4HCN B;  2GBJ A;  2AL3 A;  2O6V D;  3A9J B;  4PS3 A;  4EZJ A;  4LDT D;  5DPT A;  4WAA A;  3V60 A;  5KHO A;  1V5O A;  4IWQ A;  5JHB A;  2AWT A;  1P3Q U;  2BF8 B;  4EOY A;  2L8J A;  2KX3 A;  2MW5 A;  2IYD B;  2MBH A;  2C7H A;  3GOE A;  4A20 A;  2RR9 A;  3PSE B;  4RMA A;  1P1A A;  3L17 A;  2KWV B;  4KSK C;  4NJ7 A;  4WJP A;  3H7P B;  3L08 A;  1WYW B;  1GNU A;  2GMI C;  4GMV A;  2NS5 A;  4HDO A;  1HE8 A;  4W9I A;  4EEW A;  3LDZ E;  1WGH A;  3OJ4 B;  3RD2 A;  2GBR A;  4DHJ B;  3QWZ B;  4G0N B;  3UIN B;  1EF5 A;  3QHT A;  4KZ0 A;  1IP9 A;  3A1Q B;  1C1Y B;  3A9J A;  1P0R A;  1WH3 A;  4HPL B;  3GZN I;  3PHW B;  3JSV B;  2PPH A;  2B3A A;  2NPT B;  4A3P A;  4DWF A;  1YQB A;  4W9E A;  3I3T B;  4FBJ B;  4B95 A;  3PV1 A;  2KO3 A;  5JHA A;  4IUM B;  3UIO B;  1WF9 A;  2M8S A;  4GB9 A;  2GBM A;  2MP2 B;  3ZUN A;  2KMC A;  3D32 A;  4OVV A;  3BY4 B;  2K25 A;  3KUD B;  3TL5 A;  2KWC A;  4NY0 A;  2KQS A;  2L00 B;  3DDC B;  4M0W B;  4EZK A;  3A1Q A;  3IVF A;  2G4S A;  3EEC A;  1E8Z A;  3R7R A;  2LRW A;  2Z59 B;  2NPT A;  4IM3 A;  2M1M A;  4HCP B;  4PS7 A;  4AWJ A;  2MWS B;  3CSF A;  4WJO A;  3K9P B;  2WDT B;  3PRP B;  4ANV A;  4E74 A;  4TKN A;  3ML8 A;  2WWZ A;  2MP2 A;  1OTR B;  4K7W A;  3PRZ A;  2D10 A;  2J0K A;  2LUE A;  1XT9 B;  1WXA A;  3TCA A;  2BGF A;  2CKH B;  2D2Q A;  2K1F A;  1WX8 A;  3O65 B;  2WX0 A;  3ML9 A;  2MBQ A;  4WQO B;  2C7M B;  3H9D A;  2KHW B;  2LVQ A;  4IM0 A;  4FHK A;  3Q3J A;  3WAM A;  4ANX A;  1WM3 A;  1ZGU B;  3OAW A;  2KDB A;  3VVW B;  2MLB A;  3L10 B;  5AEK B;  5KHQ A;  2CR5 A;  3CF6 E;  1I42 A;  3NZS A;  4CYE A;  1T0Y A;  2IO3 B;  2LXC A;  5C1Z A;  2HD5 B;  3B1L X;  1WGY A;  1XQQ A;  3DBR I;  4WWO A;  2M4N A;  1YIW A;  3N30 A;  3KYD D;  4ZRJ A;  2N9P C;  1UEL A;  4JIO U;  2J0M A;  3RUL A;  2O2V B;  3WA0 A;  1S1Q B;  2L05 A;  4KDL B;  4DBG A;  2KTR A;  4M8M A;  2JXX A;  1WY8 A;  4KV2 A;  3W1S A;  2ZVO A;  4URK A;  2DZK A;  1WRD B;  2MBO A;  2KFK A;  3QJZ A;  4PS8 A;  3ZTC A;  4BKG A;  3VUX A;  2BYV E;  2G45 B;  3T9L A;  1WX7 A;  2NVU I;  2FUH B;  4GU2 A;  1KJT A;  1UD7 A;  1V49 A;  1ZW7 A;  3VAW A;  1E8Y A;  2VRR B;  4DHZ E;  3R7Q A;  1WI0 A;  3N32 A;  3HK0 A;  4ZRK A;  1Y8R C;  2BKF A;  4GDK B;  2FNJ B;  3ZDM C;  2MBE A;  2NBV B;  4EUT A;  4FJZ A;  2BYE A;  2MA9 B;  2OJR A;  2ZZP B;  4LJP B;  3APD A;  4LDT B;  1BT0 A;  2HE7 A;  3ZO5 B;  2AL6 A;  1LQB A;  4AJW A;  2KX0 A;  1R4M I;  1WIA A;  4PYU A;  4WJQ A;  1H4R A;  1UBQ A;  1YX6 B;  2KK8 A;  2J7Q B;  2LGY A;  2KWU B;  3OLM D;  3M62 B;  3PRM B;  2UWQ A;  4FLH A;  1V9J A;  3M63 B;  2N1W A;  1WGD A;  5CHF A;  3B08 A;  3VQI A;  4GN1 A;  3VH3 B;  5J18 A;  4EFO A;  1QZE A;  2L0F A;  2ZNV C;  1Z2M A;  5AZF A;  1A5R A;  4FJV B;  2DHZ A;  3RZW C;  3WIM A;  3IFW B;  2KDF B;  3NS8 A;  2ZPY A;  4IM2 A;  1SIF A;  1X1M A;  1GC6 A;  2G3Q B;  4G11 A;  1VD2 A;  4GXB A;  4MGY E;  4J6I A;  5E6P A;  5EDS A;  4B6W A;  2YLM A;  4JGH B;  1H8C A;  2C5L C;  2KNB A;  3HIZ A;  3W1S C;  1SGH A;  3DQV A;  3JYU A;  3KVF B;  4NNJ B;  1NBF C;  5CTR C;  4BVU C;  2LWP A;  3M95 A;  1E7V A;  4MH0 E;  5BO4 B;  3RYT A;  4FUL A;  2IY0 B;  4N9F 4;  2LD9 A;  1V86 A;  5CX3 A;  2XBB C;  1D3Z A;  4LCD E;  3QC8 B;  3U7D A;  3PGE A;  4DXA B;  3L0W B;  1WJ6 A;  2ZEQ A;  4IW0 A;  5AZG A;  4NQL B;  2LJ5 A;  4TV3 A;  1Q0W B;  3KUZ A;  4GDL A;  2I1J A;  3VDZ A;  4B9K A;  2K8C A;  4DK5 A;  1WR6 E;  3SU8 X;  5D2M B;  2IO2 B;  2G4D B;  4NPN A;  3AU5 A;  4XC2 A;  3PRE A;  2R2O A;  4FHJ A;  2JRI B;  1WE7 A;  4MSM B;  4EZL A;  1WFY A;  2KJ6 A;  4KDI C;  4NJ6 A;  3WAL A;  1J8C A;  1NDD A;  1XD3 B;  2DZI A;  2L0T A;  3UGB B;  3CMM B;  1OEY J;  2PE6 B;  2ZNV B;  3V6C B;  1IYF A;  1E5W A;  3IHP C;  2JF5 A;  3DPD A;  2DYO A;  1F9J A;  4BOZ B;  3ZTD A;  4PYZ A;  3C0R B;  1V2Y A;  5JH5 C;  2KZR A;  2N7E A;  3B0A A;  3RUI B;  5L95 C;  2NBU A;  3T8M A;  1LXD A;  2DZJ A;  2KJH B;  4MGZ E;  2XEW A;  2ZVN A;  2K8B A;  3DCG A;  2KDI A;  2KTR B;  3ECI A;  4BOS C;  4X57 B;  3M3J A;  5LXH A;  3A9K A;  2KFK B;  4G50 A;  2KFJ A;  1MG8 A;  3L16 A;  4JQW C;  1J0G A;  3SHQ A;  2N4F A;  5E6O A;  3VHT C;  2KDE B;  2LXA A;  2N1V A;  1WZ3 A;  2JWZ A;  4CHK A;  2ZJD A;  1V6E A;  4F7Z A;  2RGF A;  2FIF A;  5G55 A;  4JL9 A;  3JW0 X;  4W9G A;  2BWF A;  4GIV A;  2AEH A;  4HK2 A;  3N3K B;  3MHS D;  1WMH B;  3X0W A;  3UIP B;  3PZD A;  1WX9 A;  1IPG A;  2KC1 A;  2HTH A;  2KMA A;  1WM2 A;  3AUL A;  2MCN B;  2JVC A;  3SD5 A;  3NOB A;  4FJY A;  2CS4 A;  1JRU A;  3K9O B;  2NBW B;  1J19 A;  2N7D A;  3X23 A;  1GC7 A;  2A5U A;  3RCZ A;  1CMX B;  1PQS A;  4YL8 A;  4MM3 A;  1KOT A;  2KD0 A;  2UYZ B;  1KM7 A;  3AXC A;  3R66 C;  4BBN F;  4GSW A;  1TTN A;  4JLC A;  2KC2 A;  1WGG A;  2L76 A;  3HM6 X;  4CO7 A;  4MGI E;  1WR1 A;  4FAD A;  1S3S G;  1WMH A;  1WJ4 A;  2C7N B;  5TR5 A;  2FCN A;  4ZYN A;  5J17 A;  3KW5 B;  3HHM A;  1UGM A;  1WGR A;  5G2N A;  3P2B A;  3PVL A;  2AYO B;  2GOW A;  4K7U A;  3DBH I;  3V6E B;  4MDK E;  3UQA A;  3S2A A;  4HJK A;  2LZ6 A;  3U30 A;  2LVP A;  2YVC A; 
#chains in the Genus database with same CATH topology
 3MC8 A;  3W5U B;  3UQB A;  3EHV A;  3H1U A;  3TSS A;  3ZKJ C;  2KQ7 A;  1V5T A;  3GE8 C;  4RH6 A;  1GB4 A;  1XLO A;  2CHX A;  3TJP A;  3UF8 A;  1NEK B;  5BYQ A;  1LGR A;  1XCT L;  4M01 A;  2KAN A;  4WWN A;  2WYQ A;  5CHV C;  2ZW1 A;  2N9X A;  3GE3 C;  1SE2 A;  2Y5C A;  3B2F A;  1FNW A;  1P7E A;  1LM8 B;  1YN3 A;  2JY6 A;  3EFU A;  4K3C A;  3QQ8 B;  3VH4 B;  4KZC A;  2X38 A;  4MGK E;  3QIJ A;  5I4D A;  4LK0 M;  2IGH A;  4WIP A;  2BKR B;  1VZ6 A;  3AEC B;  2TSS A;  2GBK A;  2LGD A;  2W9N A;  5BMI A;  1WE6 A;  3NZU A;  5BMH A;  3CST A;  1C4C A;  2LHD A;  4G3X B;  4NZL B;  2CHZ A;  2LRU A;  1L0Y B;  2PW9 A;  2BWE S;  2J0J A;  4K3B A;  2L83 A;  2RPQ A;  2MJE A;  2HJ8 A;  4MH8 A;  2IZV B;  2FCS A;  1YN5 A;  3Q8E A;  2E3T A;  1B1Z A;  4US8 A;  1F52 A;  1P7F A;  1TS2 A;  2PJH A;  5DPS A;  3I57 A;  1I7H A;  1RRB A;  3JSV A;  3LJ3 A;  3VFK A;  2RPV A;  3NS1 A;  4TUU A;  2WXK A;  1KH0 A;  2KLC A;  2ZCB A;  2JT4 B;  5D7G A;  2I1K A;  3BIN A;  4CQN A;  1ZXH A;  1ZXI A;  2FE8 A;  4MSQ B;  2J52 A;  2JZZ A;  1C3T A;  1EO6 A;  3APC A;  1SE9 A;  5GMV A;  1T0R C;  1ZDV A;  1ZPS A;  1K53 A;  1TJE A;  1TGZ B;  2AX5 A;  2CU3 A;  1GG3 A;  4P1C C;  4WH4 A;  2QIL A;  3DBS A;  4YWG G;  1RLF A;  2LGX A;  4II2 B;  2IY1 B;  3EC8 A;  4NAW B;  1ZUD 2;  1BXT A;  2RDB C;  2K6D B;  1HXY D;  1HA5 A;  4I6L B;  4TQ0 A;  2YEP B;  2G9H D;  3VUY A;  1B9R A;  3B9J A;  4A55 A;  2O2V A;  3RNE C;  2KXJ A;  2SAK A;  2O6V B;  1FXT B;  4JX1 C;  4ZRI A;  1WXS A;  3AEA B;  1YJI A;  2NCN A;  3I63 C;  4AP4 C;  3ZNI D;  2V3N A;  5LLI A;  3QAQ A;  4YT0 B;  2ONQ A;  2BTE A;  1PYW D;  2IO1 B;  4GGQ A;  4XWW A;  4PS3 A;  3A9J B;  5DPT A;  2ACZ B;  4WAA A;  5KHO A;  2PTL A;  2JWU A;  3KWV A;  2BF8 B;  2FUG 1;  4YTP B;  2IYD B;  3PSE B;  2BW2 A;  2W82 A;  1F0Z A;  4NJ7 A;  3FIL B;  3L08 A;  4YTM B;  5HHD G;  3R2T A;  2NS5 A;  3Q69 A;  3OJ4 B;  4G0N B;  3UIN B;  1FEH A;  4KZ0 A;  1WH3 A;  3CWI A;  3GZN I;  3RPF C;  1YQB A;  3I3T B;  2AQ1 B;  2NTS A;  4B95 A;  5JHA A;  2WXL A;  4OVV A;  3TL5 A;  1CK1 A;  4NY0 A;  2E6X A;  2L00 B;  4M0W B;  3A1Q A;  3IVF A;  3IT4 B;  3EEC A;  4JWU C;  3R7R A;  3KQ4 A;  4PS7 A;  2MWS B;  2XN9 C;  3K9P B;  3C19 A;  4KGR A;  4E74 A;  4KX6 B;  1FXI A;  1IBX B;  2D3C A;  4TKN A;  3ML8 A;  4HKZ E;  2MP2 A;  1OTR B;  2J0K A;  3HVD A;  1XT9 B;  1WXA A;  1WX8 A;  2INN E;  2QSD A;  2D5G A;  3N1X C;  4WQO B;  4ANX A;  4FHK A;  1C9F A;  3EFC A;  1T5X D;  2KDB A;  3VVW B;  2MLB A;  3L10 B;  5AEK B;  2I2Y A;  3CF6 E;  2LEK A;  2VH1 A;  3U52 E;  1I42 A;  4PK1 A;  1T0Y A;  2IO3 B;  3Q3M C;  1XQQ A;  2M4N A;  2N9P C;  2K3U A;  2GB1 A;  3Q3O C;  2J53 A;  4DBG A;  1WY8 A;  2DZK A;  2MBO A;  2KFK A;  4C4V A;  3NZ3 A;  4BKG A;  2G45 B;  3T9L A;  3E9S A;  1TKY A;  1KJT A;  2N9L A;  2VRR B;  4KKJ A;  1QQR A;  2BKF A;  3VR8 B;  2Z8L A;  4MT5 A;  2BYE A;  1I4G A;  2DWQ A;  2AL6 A;  2B76 B;  1R4M I;  1SSN A;  1K51 A;  1H4R A;  1YX6 B;  4L2Y A;  3PRM B;  3AE4 B;  3RNC C;  3NVY A;  2MEK A;  1EU3 A;  2LFI A;  1Z2M A;  1KLU D;  1PGB A;  4A6Q A;  1X1M A;  2G3Q B;  4G11 A;  1GC6 A;  4GXB A;  5E6P A;  2BS3 B;  1UF0 A;  1KFY B;  1SGH A;  4NNJ B;  4O1N A;  5CTR C;  4P16 A;  1FXA A;  5BO4 B;  2V4I B;  4C00 A;  5T8I A;  2BVC A;  1PGX A;  2KT7 A;  5CX3 A;  5FR3 A;  3U7D A;  3ZGZ A;  4DXA B;  1WJ6 A;  2ZEQ A;  5AZG A;  2LJ5 A;  4B9K A;  4A90 A;  1QLB B;  2G4D B;  3PRE A;  2JZP A;  4FHJ A;  3ABV B;  4EZL A;  2W54 A;  2KJ6 A;  1XD3 B;  2DZI A;  3OG5 A;  3CMM B;  3MC0 B;  3BII D;  1E5W A;  2JF5 A;  4LNO A;  1JRO A;  4EE2 A;  3DHG C;  1VLB A;  2NBU A;  2L1A A;  4WQM A;  3ZJU A;  4MGZ E;  1WSP A;  2ZVN A;  2KTR B;  5LXH A;  1PDX A;  1SF0 A;  3M3J A;  3A9K A;  1MG8 A;  1J0G A;  3SHQ A;  3BYY B;  5E6O A;  2M0A A;  1D5Z C;  1RWS A;  1TS4 A;  3UI3 A;  4JL9 A;  1F2R C;  3DWG C;  4YXD B;  1L0X B;  3VRB B;  4HK2 A;  3MHS D;  1WMH B;  3V05 A;  3PZD A;  1WX9 A;  2KC1 A;  2N9K A;  1WM2 A;  3AUL A;  2MCN B;  2EKI A;  1YNT E;  1JRU A;  2K22 A;  4PT5 A;  3K9O B;  2NBW B;  1J19 A;  3AE1 B;  3RCZ A;  4YL8 A;  1KOT A;  3AXC A;  4BBN F;  4GSW A;  1WGG A;  4CO7 A;  2MH7 A;  4FAD A;  5GXG B;  1E6E B;  1WJ4 A;  2KVZ A;  2BS4 B;  3KW5 B;  1J7B A;  5G2N A;  3PVL A;  3AE3 B;  3DBH I;  2BS2 B;  3Q8F A;  3S2A A;  2IDY A;  2LVP A;  1Q5W B;  4A9A A;  1D6E C;  3AEE B;  3ZNH B;  1P9D U;  4ZHP A;  1JW9 D;  3ZRF A;  3GS2 A;  2QHO A;  3VRA B;  4XZ4 A;  1V81 A;  2MQJ A;  3MC9 A;  1OFF A;  4BKS A;  2EMS A;  1GUA B;  1YX5 B;  1R7S A;  2WLB A;  3H7S A;  4XWT A;  3VTU A;  3ENE A;  1KRH A;  4NJC A;  4K1R B;  4A8X C;  1L2N A;  4IC7 B;  3ZNG C;  4BFR A;  4GDL B;  2NR2 A;  2MJ3 A;  1WZ0 A;  1EUV B;  1JQ4 A;  4TQ1 A;  2JZ3 B;  1V80 A;  2AQ3 B;  2WXH A;  1KTK A;  3V61 A;  1FFU A;  3PPA A;  3AE8 B;  1N60 A;  1JWU D;  2ZW0 A;  3PZ8 A;  2N9E B;  3RI7 C;  4WWP A;  5G5G A;  3ZLZ A;  5HI1 A;  2IJ0 A;  2N7J A;  2ZPN A;  1L7Y A;  1ET9 A;  3ZNZ B;  4AUQ C;  1C77 A;  2JXT A;  2C9W B;  3KH0 A;  4B0E A;  1OQR A;  2XK5 A;  1PFD A;  2KAJ A;  2DLB A;  2BYT A;  3BK1 A;  1UZX B;  4DXF A;  4I6P A;  2PVO D;  3FAH A;  3ZRC A;  2Z0E B;  2L3Z A;  5L83 A;  3H7P A;  2D3G A;  5AZH A;  1QOG A;  4BAX A;  3NHE B;  1D5M C;  3TIX A;  3RZF A;  4DHJ D;  5TSS A;  4BBN C;  1XF5 L;  1F2R I;  1ENF A;  3RT3 B;  1E0Z A;  2QJL A;  3CIR B;  4ARI A;  4HLE A;  1E90 A;  3ONS A;  4S17 A;  2R2Q A;  4L1B A;  4AOF A;  3TEW A;  2BB5 A;  5DCN A;  2DYB A;  2RD0 A;  2MHJ A;  3WAP A;  1ISN A;  1E10 A;  3SEB A;  3IXS A;  1J7C A;  1JWB D;  2LAS A;  4KIK A;  5CHW A;  1PGA A;  2WXJ A;  4HDQ A;  4OZB A;  2L32 A;  1NI2 A;  1DGJ A;  3PO0 A;  3SDL C;  3IAM 1;  5FR6 A;  3IG3 A;  4W9F A;  2MSE D;  2CJN A;  5EE3 A;  5EE1 A;  1WXM A;  5IN7 A;  1UH6 A;  4MJS B;  1T6B X;  4ZOH C;  4REZ A;  3VTV A;  3QK0 A;  2WDV B;  3U7Z A;  2GBN A;  4HWI B;  4LNN A;  2V3S A;  2K5P A;  4RCO A;  4IOI E;  5AUI A;  3PHX B;  2LGS A;  5LXI B;  4M02 A;  4ICV A;  1NI3 A;  3ZVV A;  4WJN A;  2DAJ A;  2KOX A;  3OWE B;  4HPM B;  4YSZ B;  2WXI A;  5IAA C;  3ZQ4 A;  2FCM A;  1OEY A;  1E8W A;  1BUI C;  1G6J A;  2FBW B;  2LVO A;  2DYM A;  3A4S C;  3W9C B;  3ALB A;  4NQK E;  2MBB B;  3L54 A;  1ZOY B;  2D3A A;  1WXV A;  4JE3 B;  2O6V D;  1EU4 A;  3V60 A;  4IWQ A;  3RNF C;  2JSV X;  1YOV B;  5D3D A;  2KX3 A;  1P1A A;  3L17 A;  4KSK C;  1GNU A;  2GMI C;  4HDO A;  2J42 A;  3LDZ E;  3RD2 A;  4DHJ B;  1EF5 A;  5D3I B;  1IP9 A;  4RFB A;  3A1Q B;  4RF1 A;  4L23 A;  4HPL B;  2WNM A;  4A3P A;  5FK9 C;  4OZC A;  4FBJ B;  3TEY A;  3PV1 A;  1YMH E;  2KO3 A;  4IUM B;  4R3D A;  2M8S A;  4GB9 A;  2MP2 B;  3ZUN A;  2KMC A;  3RNB C;  2K25 A;  1T0S C;  1MHX A;  2KQS A;  1MG4 A;  1TS5 A;  2G4S A;  2NPT A;  4XYC A;  4AWJ A;  1TY0 A;  2BBC A;  2LUE A;  1QOA A;  2MBQ A;  2C7M B;  3H9D A;  4GLS C;  3DWM A;  5KHQ A;  5LNK 1;  2CR5 A;  4CYE A;  2Y5P A;  5C1Z A;  4XDC A;  3N30 A;  3KYD D;  4JIO U;  2J0M A;  1FCC C;  3V3X A;  1HZ5 A;  1N5X A;  1V1P A;  2L05 A;  1TT5 B;  2JXX A;  4KV2 A;  3W1S A;  4B0M A;  4C80 A;  2WXP A;  1V1O A;  1L4Z B;  1V49 A;  1E8Y A;  1UWM A;  4ZRK A;  4GDK B;  2FNJ B;  2W3R A;  4RNA A;  2MBE A;  1WXQ A;  2MA9 B;  3HUI A;  5E6J A;  4OW0 A;  3APD A;  2HE7 A;  4AJW A;  3BVM A;  4WJQ A;  1WGK A;  2IPK D;  2KK8 A;  2WXR A;  1FO4 A;  2KWU B;  4USA A;  4FLH A;  3KLS X;  4YSX B;  4FXC A;  3P1M A;  3AMZ A;  4GN1 A;  3VH3 B;  2BQQ A;  4WUR A;  5J18 A;  2JX5 A;  1QZE A;  3NJT A;  1GOZ A;  2ZNV C;  4BZA A;  4ZHO A;  1I4X A;  3IFW B;  4IM2 A;  1VD2 A;  2WGS A;  5EDS A;  2WXN A;  4B6W A;  1H8C A;  3W1S C;  1QKZ A;  4BVU C;  4JPS A;  3NG0 A;  1HEZ E;  1WWT A;  3RYT A;  4J3O D;  4N9F 4;  2LD9 A;  1V86 A;  3P4P B;  4IW0 A;  4TMA B;  1Q0W B;  2D3B A;  2KN4 A;  2K8C A;  3P4S B;  4UDU C;  1RM6 C;  5D2M B;  4XC2 A;  3AU5 A;  3N1Z C;  3AEF B;  3ZXR A;  3Q14 C;  1CZP A;  1SE3 A;  1WFY A;  4NJ6 A;  1NDD A;  4D2K A;  3NUH B;  1VDV A;  3V6C B;  1IYF A;  2DYO A;  1XXG A;  4PYZ A;  1V2Y A;  5JH5 C;  2KZR A;  2N7E A;  1VR9 A;  3RUI B;  1LXD A;  2KJH B;  3E56 A;  1UGJ A;  2WS3 B;  2JYT A;  2KAC A;  3TEZ A;  3U4E G;  4BOS C;  2KFJ A;  3L16 A;  1ROE A;  2N4F A;  3FC4 A;  2LXA A;  2HTM E;  4YTN B;  1TZO A;  4IKG A;  2JWZ A;  1V6E A;  4F7Z A;  5C2T B;  3JW0 X;  3AE9 B;  4W9G A;  2BB6 A;  1RFK A;  5FKA C;  5BYR A;  1IPG A;  1VRA B;  2JVC A;  1N61 A;  3SD5 A;  4C7Y A;  2N7D A;  1GC7 A;  1D4B A;  1JRP A;  1KM7 A;  2JYE A;  1TTN A;  2KQ4 X;  2YEP F;  3HM6 X;  2QCZ A;  2W55 A;  1JAL A;  4ITK A;  1ZP0 B;  1QT9 A;  5TR5 A;  2LMC A;  3HHM A;  3P2B A;  2AYO B;  4K7U A;  4MDK E;  3BVZ A;  1XLN A;  3UQA A;  2LZ6 A;  3U30 A;  2V1Y A;  2EMT A;  2KTF A;  2M0X A;  4AJY B;  2MX2 A;  1PUT A;  1L0V B;  4NAW A;  1SJH D;  3PLU A;  2KKC A;  2MJD A;  5D94 A;  4TSS A;  1RFA A;  3VR9 B;  2UU7 A;  3P63 A;  4HRO A;  3MJW A;  2EEL A;  4DDG D;  3L13 A;  2HJ1 A;  1FRD A;  3AI5 A;  3AE5 B;  2XK5 B;  4QAY A;  2FID A;  3TBL D;  1E8X A;  3AM9 A;  2M17 A;  1DOI A;  1Y56 A;  2PE9 A;  2GI9 A;  3DVG Y;  3MTN B;  2EKE C;  2HDE A;  3W1Y A;  1M94 A;  1TKG A;  2OED A;  1VZ7 A;  2BPS A;  4IDI A;  3DHH C;  4HRS A;  1HZ6 A;  4YSY B;  1FMA D;  2ASQ A;  3FIL A;  3AH7 A;  4C56 C;  2KLG A;  4KIK B;  4W9H A;  3VTW A;  2RSU A;  1K8R B;  3TUO A;  4F1S A;  2WXO A;  3LXF A;  2Y3A A;  4MM3 B;  4RM8 A;  2Y5B B;  2OOB B;  3P4R B;  3Q8C A;  3W2D A;  4RGO S;  2WXF A;  1LFD A;  3PTF C;  3EUB 2;  2ICI A;  3DOW A;  3AE6 B;  3DVG X;  1IBX A;  3APF A;  3H6N A;  1FIQ A;  5HFY A;  1U4A A;  1TZ1 A;  3I9V 1;  2DBY A;  4EKU A;  2K6Q A;  4XX5 A;  5G5H A;  4XDD A;  4A3O A;  4BKT A;  2KVR A;  1XCQ L;  4DHZ B;  3TMP B;  1K50 A;  4XE0 A;  2REX A;  4LTU A;  2JUO A;  4N6E B;  5IA7 A;  1R4N B;  2KN5 A;  4LNK A;  4IWP A;  4M00 A;  3NVZ A;  3O13 A;  4W9J A;  5JZE B;  2IGD A;  1UWX A;  4E71 A;  3Q3N C;  2IGG A;  2Z0D B;  3U8Z A;  3RNG C;  3WAO A;  1V97 A;  4H2A A;  3AU4 A;  1DOX A;  2W3S A;  4II3 B;  3TEX A;  3J9C A;  3WAN A;  1P98 A;  4W9K A;  1VJK A;  1I35 A;  1BML C;  1L4D B;  4HJG E;  2CHW A;  5DPW A;  2WXM A;  4MEL A;  2KJR A;  1UBI A;  2KDM A;  3MFG A;  2GBJ A;  4LDT D;  1IGC A;  4P6V F;  4RF0 A;  5JHB A;  1D5X C;  4DQO C;  2MW5 A;  2C7H A;  4A20 A;  4RMA A;  1ZE3 D;  4WJP A;  2KWV B;  1WYW B;  1F77 A;  4LLG M;  2JU6 X;  3QHT A;  4WAF A;  3N1Y C;  1NYR A;  1P0R A;  1AW7 A;  3JSV B;  2B3A A;  2NPT B;  2L52 A;  4DWF A;  2QC8 A;  2R61 A;  5H92 C;  1NEN B;  1WF9 A;  3D32 A;  3BY4 B;  3KUD B;  1N5W A;  1I4P A;  4EZK A;  2WQY B;  3DBL B;  2LRW A;  2Z59 B;  4IM3 A;  2WXG A;  1STE A;  2RMM A;  1I4Q A;  2WWZ A;  4K7W A;  3PRZ A;  2D2Q A;  3ML9 A;  5C3J B;  4IM0 A;  1ZGU B;  3OAW A;  1UNS A;  3RMK C;  3N9Y C;  2JQR B;  3NZS A;  3B1L X;  4WWO A;  1YIW A;  3SFD B;  4ZRJ A;  2PLP A;  2O2V B;  3WA0 A;  4AQ7 A;  1I4R A;  2KTR A;  4URK A;  1QOB A;  1WRD B;  1SXT A;  3DHI C;  3VUX A;  1MI0 A;  2NVU I;  1FD6 A;  4DHZ E;  4ACF A;  3N32 A;  3HK0 A;  1Y8R C;  2OHF A;  2INP E;  1MJD A;  4FJZ A;  2RDH A;  4LJP B;  4LDT B;  1BT0 A;  3HVZ A;  3ZO5 B;  1LQB A;  2KX0 A;  4PYU A;  2NMQ A;  4RGM A;  2LGY A;  3H8H A;  3OLM D;  1KLG D;  2UWQ A;  5CHF A;  1TY2 A;  3B08 A;  2V0G A;  4EFO A;  4RGN A;  3AEG B;  2L0F A;  4ZRQ A;  3EGR A;  5AZF A;  3HRD D;  2LUM A;  3ZJT A;  1QOF A;  2DHZ A;  2V9H A;  4N59 A;  3NS8 A;  2ZPY A;  1SIF A;  1FPY A;  3DBR B;  1JWS D;  4NAM A;  4JGH B;  2KNB A;  1N6Z A;  1TS3 A;  1EWC A;  3AED B;  3JYU A;  1NBF C;  2LWP A;  3M95 A;  1E7V A;  4OHJ A;  4FUL A;  3LB8 C;  4LCD E;  1QIL A;  1C76 A;  1XEE A;  3L0W B;  4TV3 A;  1XLQ A;  3BK2 A;  3KUZ A;  4GDL A;  2I1J A;  3VDZ A;  4DK5 A;  3R2I A;  4NPN A;  1WYG A;  2R2O A;  3DBH B;  2J4X A;  1WE7 A;  4MSM B;  3GP7 A;  3WAL A;  1J8C A;  2DNF A;  1OEY J;  2PE6 B;  3Q8A A;  4BOZ B;  1LO5 D;  1F9J A;  3ZTD A;  3C0R B;  2PMV A;  2WDR B;  3T8M A;  1GB1 A;  2XEW A;  3AN1 A;  2K8B A;  3ECI A;  4P1B C;  2OJW A;  2KFK B;  4C4V B;  4JQW C;  1DOY A;  1JWM D;  2KDE B;  3NVV A;  1WZ3 A;  1T3Q A;  2RGF A;  3T3N A;  1V8C A;  2FIF A;  1YQ4 B;  1AWD A;  2BWF A;  2AEH A;  3N3K B;  3X0W A;  3UIP B;  1E9M A;  2HTH A;  3NRZ A;  2QIE B;  1SE4 A;  3NOB A;  4FJY A;  1C79 A;  3X23 A;  2Q5W D;  2KD0 A;  3R66 C;  1FNV A;  4JLC A;  1AN8 A;  1ESF A;  1WR1 A;  2ON8 A;  2C7N B;  2FCN A;  4ZYN A;  3SR6 A;  1WGR A;  1YN4 A;  1XLP A;  2GOW A;  3ETR A;  4MAC A;  3V6E B;  1C78 A;  3I5J C;  2YVC A;  3IAS 1;  3QA8 A;  2C60 A;  5IKC M;  4RGT A;  1UUP A;  3RNA C;  1Z5S B;  3PLV A;  4RM9 A;  2V3P A;  3DVN V;  4MJS A;  4HVB A;  2M56 B;  5J2R A;  3A33 B;  4IWO A;  2FCQ A;  4BKS D;  1SJE D;  1FNU A;  4HXD A;  2CU1 A;  1YJJ A;  2D11 A;  1L6U A;  4AS1 A;  4JWS C;  1AAR A;  2XNA C;  3GB1 A;  3KWL A;  3VXW A;  2INC C;  3AV8 A;  2WU5 B;  4FA6 A;  1GPX A;  2WX1 A;  4IG7 B;  1ZDX A;  2JRH A;  5IP4 D;  3IBE A;  3LYY A;  4I6N B;  4W9C A;  3QCA A;  4KSL C;  1YJ1 A;  1EF1 A;  5C23 A;  4LJO B;  2L7R A;  3ZDT A;  2H88 B;  2DZM A;  4LNI A;  4E3C A;  1MHH E;  2MRP A;  2N0S B;  2PEA A;  5IO9 A;  1E7U A;  1GJZ A;  1C4A A;  2K39 A;  1OQY A;  3A9K B;  3KUC B;  3P4Q B;  1R4N I;  4ASW C;  3QAR A;  5D6J B;  2JPH A;  3DVN U;  4GOC A;  1ACC A;  4M8N A;  1M4V A;  1CQV A;  2QEJ C;  2ZCC A;  1MVK A;  3JVZ X;  3KYC D;  5H8Y E;  3NY5 A;  2BYF A;  3V62 A;  1Q1O A;  4ZYS A;  3BWU D;  4KVG B;  1YQ3 B;  1TBE A;  2LI5 A;  4ZDV A;  2PKO A;  2IO0 B;  3HM3 A;  3Q3F A;  5DPR A;  2KYW A;  5HKH A;  1NVI D;  1JML A;  2DEN B;  2IBI B;  3OJ3 A;  1JCK B;  2BT6 A;  2FAZ A;  3AE2 B;  4HKQ A;  4W9D A;  3PT2 B;  3ZXV A;  2V4L A;  2A4Z A;  4ANW A;  1A70 A;  4FN2 A;  1MFW A;  5E6N A;  2K8H A;  3ZW3 A;  1OGW A;  3QX1 A;  2DX5 B;  4OVU A;  4K81 A;  3BYT B;  3ZIM A;  1TKE A;  3PS6 A;  3A4R A;  1FM0 D;  4WWM A;  3R3M A;  1WJU A;  1KLV A;  5EE0 A;  4F8C B;  5HG2 A;  1YD8 U;  4MEM A;  1N62 A;  3VUW A;  4W9L A;  2PIA A;  5BMG A;  4DDI D;  3DBL I;  1QF6 A;  1VCB A;  4GDK A;  4ICU A;  1ZKH A;  2D07 B;  4DXG A;  4P7I A;  1SB3 C;  2DAF A;  1WJN A;  4K7S A;  4ANU A;  3AE7 B;  2O6V A;  1VZ8 A;  1RAX A;  4HCN B;  2AL3 A;  1SBB B;  1J7A A;  4EZJ A;  1V5O A;  2LJI A;  2AWT A;  4ZRP A;  1P3Q U;  3P42 A;  4EOY A;  2L8J A;  2MBH A;  3GOE A;  3URY A;  4N58 A;  2RR9 A;  3U2S C;  2I38 A;  3H7P B;  1IUE A;  4GMV A;  1HE8 A;  4W9I A;  4EEW A;  3IT6 B;  1WGH A;  2GBR A;  4KKI A;  3QWZ B;  2K9X A;  1C1Y B;  3A9J A;  1EM7 A;  1EWY C;  2QDF A;  1FCL A;  3PHW B;  2WU2 B;  3C8Y A;  2PPH A;  4W9E A;  2PVG C;  3NVW A;  2M19 A;  2VZK D;  3UIO B;  3WCQ A;  2GBM A;  1DYQ A;  4C7Z A;  1SEB D;  2KWC A;  3DDC B;  3PZ7 A;  1MPE A;  2AQ2 B;  2VH2 A;  5EE9 A;  1E8Z A;  4OZA A;  2M1M A;  4HCP B;  4WJO A;  1OQQ A;  3CSF A;  2WDT B;  3PRP B;  4ANV A;  4ARC A;  1NYQ A;  1Q10 A;  2D10 A;  3TCA A;  2BGF A;  2CKH B;  2K1F A;  3O65 B;  1TYG B;  2WX0 A;  2KMM A;  2KHW B;  4HEA 1;  2LVQ A;  3WAM A;  4M0W A;  3Q3J A;  1WM3 A;  1L5P A;  1KF6 B;  2LXC A;  2HD5 B;  1WGY A;  3DBR I;  3SFE B;  1UEL A;  1E7P B;  2H89 B;  3RUL A;  1S1Q B;  4KDL B;  4M8M A;  2ZVO A;  3QJZ A;  4PS8 A;  5IOI A;  3GZN B;  2BYV E;  4S0R A;  1WX7 A;  2X8X X;  2FUH B;  4GU2 A;  1UD7 A;  1ZW7 A;  3VAW A;  3R7Q A;  1WI0 A;  3AB5 A;  4KGS A;  3ZDM C;  2LHE A;  3MJ5 A;  1SIJ A;  2NBV B;  4EUT A;  4KGT A;  2OJR A;  2ZZP B;  1N63 A;  2WP9 B;  1WIA A;  1UBQ A;  4LNF A;  2J7Q B;  1I4H A;  3M62 B;  5MPO A;  1V9J A;  3M63 B;  2N1W A;  1WGD A;  3VQI A;  4US9 A;  2SEB D;  5AUK A;  1A5R A;  4FJV B;  3T3O A;  3B2G A;  3RZW C;  3WIM A;  1CJE A;  1RYJ A;  2KDF B;  3Q8B A;  2GRI A;  4MGY E;  1TIF A;  4J6I A;  4Q2J A;  4XGA B;  3RFZ B;  2VZK B;  2YLM A;  2C5L C;  1JWA D;  3BZD B;  3HIZ A;  3DQV A;  3KVF B;  3W5V B;  3MP9 A;  4MH0 E;  1WRI A;  2IY0 B;  2IND C;  2XBB C;  1K52 A;  1D3Z A;  3QC8 B;  3PGE A;  4NQL B;  2NTT A;  1IGD A;  2G1E A;  1ET6 A;  1WR6 E;  3AEB B;  3Q6B A;  3SU8 X;  2IO2 B;  2QMT A;  1L6V A;  1R4M B;  2RDG A;  2JRI B;  3Q2A C;  1XO3 A;  4KDI C;  2L0T A;  3UGB B;  2ZNV B;  1T0Q C;  3IHP C;  3DPD A;  1HTO A;  3EA6 A;  3B0A A;  5L95 C;  2DZJ A;  2WXQ A;  3ZYY X;  2KWD A;  4HPP A;  2CJO A;  1V1P B;  2GLS A;  3DCG A;  2KDI A;  4X57 B;  4G50 A;  1C4P A;  3VHT C;  2N1V A;  4CHK A;  2ZJD A;  5BYS A;  5G55 A;  1F1H A;  2K0P A;  3ZJV A;  1HQR D;  4GIV A;  3R8B A;  2KMA A;  3MHZ A;  1AYF A;  2CS4 A;  1GAQ B;  2A5U A;  1CMX B;  1HTQ A;  1PQS A;  2LGI A;  4MM3 A;  2UYZ B;  4OVZ A;  2KC2 A;  2L76 A;  4MGI E;  3N20 C;  1S3S G;  1WMH A;  3L4P A;  3BVG A;  1FFV A;  2WDQ B;  5J17 A;  1UGM A;  5JXV A;  3RN9 C;  3FKY A;  1FRR A;  2WHI A;  4HJK A;  3ZTC A; 
#chains in the Genus database with same CATH homology
 2V1Y A;  1Q5W B;  3QA8 A;  2EMT A;  2C60 A;  3ZNH B;  1P9D U;  2KTF A;  2M0X A;  3ZRF A;  3UQB A;  3EHV A;  4AJY B;  1Z5S B;  2QHO A;  3H1U A;  3PLV A;  2MX2 A;  4RM9 A;  3ZKJ C;  4XZ4 A;  2KQ7 A;  1V81 A;  2MQJ A;  3DVN V;  4MJS A;  4HVB A;  4BKS A;  3A33 B;  4IWO A;  5J2R A;  4NAW A;  2EMS A;  1GUA B;  1V5T A;  1YX5 B;  2FCQ A;  3H7S A;  3PLU A;  2KKC A;  4BKS D;  2CHX A;  3TJP A;  5D94 A;  3UF8 A;  1RFA A;  3VTU A;  2KAN A;  4WWN A;  2WYQ A;  3ENE A;  5CHV C;  4HXD A;  2CU1 A;  4K1R B;  2N9X A;  1L2N A;  4IC7 B;  3ZNG C;  4BFR A;  4GDL B;  2NR2 A;  2D11 A;  1WZ0 A;  1EUV B;  3MJW A;  4DDG D;  4TQ1 A;  3L13 A;  2JZ3 B;  1LM8 B;  1AAR A;  2JY6 A;  3EFU A;  3AI5 A;  2XK5 B;  1V80 A;  3QQ8 B;  3V61 A;  3VH4 B;  3VXW A;  3PPA A;  4KZC A;  2FID A;  4MGK E;  3TBL D;  3QIJ A;  1E8X A;  4FA6 A;  2WX1 A;  4IG7 B;  2N9E B;  2JRH A;  4WWP A;  3IBE A;  3ZLZ A;  4I6N B;  4W9C A;  3QCA A;  2ZPN A;  1L7Y A;  4KSL C;  1YJ1 A;  2BKR B;  1EF1 A;  2M17 A;  3ZNZ B;  5C23 A;  4AUQ C;  4LJO B;  2L7R A;  2PE9 A;  3ZDT A;  2DZM A;  2C9W B;  3DVG Y;  3MTN B;  2EKE C;  4E3C A;  2MRP A;  2PEA A;  3KH0 A;  3W1Y A;  2GBK A;  2LGD A;  2W9N A;  1M94 A;  1E7U A;  1GJZ A;  2XK5 A;  2K39 A;  1WE6 A;  3NZU A;  1OQY A;  3A9K B;  3CST A;  3KUC B;  2BPS A;  1UZX B;  4I6P A;  4G3X B;  2CHZ A;  2LRU A;  1R4N I;  4ASW C;  3QAR A;  2ASQ A;  2BWE S;  3ZRC A;  2J0J A;  2Z0E B;  2JPH A;  2RPQ A;  5D6J B;  3DVN U;  4GOC A;  2L3Z A;  2HJ8 A;  5L83 A;  3H7P A;  2IZV B;  2D3G A;  4M8N A;  5AZH A;  2FCS A;  3NHE B;  3TIX A;  2ZCC A;  3JVZ X;  3RZF A;  4DHJ D;  2KLG A;  4KIK B;  4W9H A;  4BBN C;  3RT3 B;  3VTW A;  2PJH A;  2RSU A;  5DPS A;  3KYC D;  1RRB A;  3JSV A;  3LJ3 A;  1K8R B;  3VFK A;  4HLE A;  4F1S A;  3NY5 A;  1E90 A;  3ONS A;  2BYF A;  2R2Q A;  3V62 A;  4AOF A;  4TUU A;  2ZCB A;  1Q1O A;  2KLC A;  2Y5B B;  4RM8 A;  2DYB A;  2RD0 A;  5DCN A;  3WAP A;  2JT4 B;  1ISN A;  4KVG B;  5D7G A;  2OOB B;  1TBE A;  2LI5 A;  2I1K A;  3BIN A;  4ZDV A;  1LFD A;  3PTF C;  4MSQ B;  2IO0 B;  2JZZ A;  1C3T A;  1EO6 A;  3HM3 A;  2LAS A;  4KIK A;  3Q3F A;  5CHW A;  3APC A;  1SE9 A;  4HDQ A;  5DPR A;  5GMV A;  3DOW A;  5HKH A;  2DEN B;  3DVG X;  2IBI B;  3OJ3 A;  1NI2 A;  2FAZ A;  3APF A;  3SDL C;  5FR6 A;  3IG3 A;  3H6N A;  1TGZ B;  1U4A A;  1TZ1 A;  4W9D A;  3PT2 B;  2MSE D;  4W9F A;  1GG3 A;  2V4L A;  2A4Z A;  4EKU A;  1WXM A;  3DBS A;  4ANW A;  1UH6 A;  1RLF A;  2K6Q A;  2LGX A;  4XX5 A;  4A3O A;  4BKT A;  4II2 B;  2KVR A;  4FN2 A;  2IY1 B;  3EC8 A;  4MJS B;  5E6N A;  4DHZ B;  2K8H A;  3ZW3 A;  1OGW A;  3QX1 A;  2DX5 B;  4NAW B;  4OVU A;  3TMP B;  2REX A;  2JUO A;  5IA7 A;  4K81 A;  2KN5 A;  2K6D B;  3VTV A;  4IWP A;  3QK0 A;  3ZIM A;  4I6L B;  2GBN A;  4HWI B;  4TQ0 A;  3PS6 A;  2V3S A;  3VUY A;  3A4R A;  4W9J A;  3R3M A;  5JZE B;  1WJU A;  2O2V A;  4E71 A;  1KLV A;  4F8C B;  1YD8 U;  4MEM A;  2KXJ A;  3PHX B;  2Z0D B;  2O6V B;  5LXI B;  4ICV A;  3U8Z A;  3VUW A;  3ZVV A;  4W9L A;  4WJN A;  3WAO A;  1FXT B;  2DAJ A;  2KOX A;  4ZRI A;  4DDI D;  3AU4 A;  1WXS A;  3DBL I;  4HPM B;  4II3 B;  2NCN A;  3WAN A;  4AP4 C;  1P98 A;  1VCB A;  4GDK A;  5IAA C;  2FCM A;  1OEY A;  1E8W A;  1ZKH A;  4ICU A;  4W9K A;  3ZNI D;  1G6J A;  2D07 B;  1I35 A;  2LVO A;  4P7I A;  2DYM A;  2CHW A;  3A4S C;  3ALB A;  5LLI A;  4NQK E;  5DPW A;  2DAF A;  1WJN A;  4K7S A;  2MBB B;  4ANU A;  4MEL A;  3L54 A;  3QAQ A;  2KJR A;  2O6V A;  1UBI A;  2IO1 B;  1WXV A;  4GGQ A;  1RAX A;  4HCN B;  2GBJ A;  2AL3 A;  2O6V D;  3A9J B;  4PS3 A;  4EZJ A;  4LDT D;  5DPT A;  4WAA A;  3V60 A;  5KHO A;  1V5O A;  4IWQ A;  5JHB A;  2AWT A;  1P3Q U;  2BF8 B;  4EOY A;  2L8J A;  2KX3 A;  2MW5 A;  2IYD B;  2MBH A;  2C7H A;  3GOE A;  4A20 A;  2RR9 A;  3PSE B;  4RMA A;  1P1A A;  3L17 A;  2KWV B;  4KSK C;  4NJ7 A;  4WJP A;  3H7P B;  3L08 A;  1WYW B;  1GNU A;  2GMI C;  4GMV A;  2NS5 A;  4HDO A;  1HE8 A;  4W9I A;  4EEW A;  3LDZ E;  1WGH A;  3OJ4 B;  3RD2 A;  2GBR A;  4DHJ B;  3QWZ B;  4G0N B;  3UIN B;  1EF5 A;  3QHT A;  4KZ0 A;  1IP9 A;  3A1Q B;  1C1Y B;  3A9J A;  1P0R A;  1WH3 A;  4HPL B;  3GZN I;  3PHW B;  3JSV B;  2PPH A;  2B3A A;  2NPT B;  4A3P A;  4DWF A;  1YQB A;  4W9E A;  3I3T B;  4FBJ B;  4B95 A;  3PV1 A;  2KO3 A;  5JHA A;  4IUM B;  3UIO B;  1WF9 A;  2M8S A;  4GB9 A;  2GBM A;  2MP2 B;  3ZUN A;  2KMC A;  3D32 A;  4OVV A;  3BY4 B;  2K25 A;  3KUD B;  3TL5 A;  2KWC A;  4NY0 A;  2KQS A;  2L00 B;  3DDC B;  4M0W B;  4EZK A;  3A1Q A;  3IVF A;  2G4S A;  3EEC A;  1E8Z A;  3R7R A;  2LRW A;  2Z59 B;  2NPT A;  4IM3 A;  2M1M A;  4HCP B;  4PS7 A;  4AWJ A;  2MWS B;  3CSF A;  4WJO A;  3K9P B;  2WDT B;  3PRP B;  4ANV A;  4E74 A;  4TKN A;  3ML8 A;  2WWZ A;  2MP2 A;  1OTR B;  4K7W A;  3PRZ A;  2D10 A;  2J0K A;  2LUE A;  1XT9 B;  1WXA A;  3TCA A;  2BGF A;  2CKH B;  2D2Q A;  2K1F A;  1WX8 A;  3O65 B;  2WX0 A;  3ML9 A;  2MBQ A;  4WQO B;  2C7M B;  3H9D A;  2KHW B;  2LVQ A;  4IM0 A;  4FHK A;  3Q3J A;  3WAM A;  4ANX A;  1WM3 A;  1ZGU B;  3OAW A;  2KDB A;  3VVW B;  2MLB A;  3L10 B;  5AEK B;  5KHQ A;  2CR5 A;  3CF6 E;  1I42 A;  3NZS A;  4CYE A;  1T0Y A;  2IO3 B;  2LXC A;  5C1Z A;  2HD5 B;  3B1L X;  1WGY A;  1XQQ A;  3DBR I;  4WWO A;  2M4N A;  1YIW A;  3N30 A;  3KYD D;  4ZRJ A;  2N9P C;  1UEL A;  4JIO U;  2J0M A;  3RUL A;  2O2V B;  3WA0 A;  1S1Q B;  2L05 A;  4KDL B;  4DBG A;  2KTR A;  4M8M A;  2JXX A;  1WY8 A;  4KV2 A;  3W1S A;  2ZVO A;  4URK A;  2DZK A;  1WRD B;  2MBO A;  2KFK A;  3QJZ A;  4PS8 A;  3ZTC A;  4BKG A;  3VUX A;  2BYV E;  2G45 B;  3T9L A;  1WX7 A;  2NVU I;  2FUH B;  4GU2 A;  1KJT A;  1UD7 A;  1V49 A;  1ZW7 A;  3VAW A;  1E8Y A;  2VRR B;  4DHZ E;  3R7Q A;  1WI0 A;  3N32 A;  3HK0 A;  4ZRK A;  1Y8R C;  2BKF A;  4GDK B;  2FNJ B;  3ZDM C;  2MBE A;  2NBV B;  4EUT A;  4FJZ A;  2BYE A;  2MA9 B;  2OJR A;  2ZZP B;  4LJP B;  3APD A;  4LDT B;  1BT0 A;  2HE7 A;  3ZO5 B;  2AL6 A;  1LQB A;  4AJW A;  2KX0 A;  1R4M I;  1WIA A;  4PYU A;  4WJQ A;  1H4R A;  1UBQ A;  1YX6 B;  2KK8 A;  2J7Q B;  2LGY A;  2KWU B;  3OLM D;  3M62 B;  3PRM B;  2UWQ A;  4FLH A;  1V9J A;  3M63 B;  2N1W A;  1WGD A;  5CHF A;  3B08 A;  3VQI A;  4GN1 A;  3VH3 B;  5J18 A;  4EFO A;  1QZE A;  2L0F A;  2ZNV C;  1Z2M A;  5AZF A;  1A5R A;  4FJV B;  2DHZ A;  3RZW C;  3WIM A;  3IFW B;  2KDF B;  3NS8 A;  2ZPY A;  4IM2 A;  1SIF A;  1X1M A;  1GC6 A;  2G3Q B;  4G11 A;  1VD2 A;  4GXB A;  4MGY E;  4J6I A;  5E6P A;  5EDS A;  4B6W A;  2YLM A;  4JGH B;  1H8C A;  2C5L C;  2KNB A;  3HIZ A;  3W1S C;  1SGH A;  3DQV A;  3JYU A;  3KVF B;  4NNJ B;  1NBF C;  5CTR C;  4BVU C;  2LWP A;  3M95 A;  1E7V A;  4MH0 E;  5BO4 B;  3RYT A;  4FUL A;  2IY0 B;  4N9F 4;  2LD9 A;  1V86 A;  5CX3 A;  2XBB C;  1D3Z A;  4LCD E;  3QC8 B;  3U7D A;  3PGE A;  4DXA B;  3L0W B;  1WJ6 A;  2ZEQ A;  4IW0 A;  5AZG A;  4NQL B;  2LJ5 A;  4TV3 A;  1Q0W B;  3KUZ A;  4GDL A;  2I1J A;  3VDZ A;  4B9K A;  2K8C A;  4DK5 A;  1WR6 E;  3SU8 X;  5D2M B;  2IO2 B;  2G4D B;  4NPN A;  3AU5 A;  4XC2 A;  3PRE A;  2R2O A;  4FHJ A;  2JRI B;  1WE7 A;  4MSM B;  4EZL A;  1WFY A;  2KJ6 A;  4KDI C;  4NJ6 A;  3WAL A;  1J8C A;  1NDD A;  1XD3 B;  2DZI A;  2L0T A;  3UGB B;  3CMM B;  1OEY J;  2PE6 B;  2ZNV B;  3V6C B;  1IYF A;  1E5W A;  3IHP C;  2JF5 A;  3DPD A;  2DYO A;  1F9J A;  4BOZ B;  3ZTD A;  4PYZ A;  3C0R B;  1V2Y A;  5JH5 C;  2KZR A;  2N7E A;  3B0A A;  3RUI B;  5L95 C;  2NBU A;  3T8M A;  1LXD A;  2DZJ A;  2KJH B;  4MGZ E;  2XEW A;  2ZVN A;  2K8B A;  3DCG A;  2KDI A;  2KTR B;  3ECI A;  4BOS C;  4X57 B;  3M3J A;  5LXH A;  3A9K A;  2KFK B;  4G50 A;  2KFJ A;  1MG8 A;  3L16 A;  4JQW C;  1J0G A;  3SHQ A;  2N4F A;  5E6O A;  3VHT C;  2KDE B;  2LXA A;  2N1V A;  1WZ3 A;  2JWZ A;  4CHK A;  2ZJD A;  1V6E A;  4F7Z A;  2RGF A;  2FIF A;  5G55 A;  4JL9 A;  3JW0 X;  4W9G A;  2BWF A;  4GIV A;  2AEH A;  4HK2 A;  3N3K B;  3MHS D;  1WMH B;  3X0W A;  3UIP B;  3PZD A;  1WX9 A;  1IPG A;  2KC1 A;  2HTH A;  2KMA A;  1WM2 A;  3AUL A;  2MCN B;  2JVC A;  3SD5 A;  3NOB A;  4FJY A;  2CS4 A;  1JRU A;  3K9O B;  2NBW B;  1J19 A;  2N7D A;  3X23 A;  1GC7 A;  2A5U A;  3RCZ A;  1CMX B;  1PQS A;  4YL8 A;  4MM3 A;  1KOT A;  2KD0 A;  2UYZ B;  1KM7 A;  3AXC A;  3R66 C;  4BBN F;  4GSW A;  1TTN A;  4JLC A;  2KC2 A;  1WGG A;  2L76 A;  3HM6 X;  4CO7 A;  4MGI E;  1WR1 A;  4FAD A;  1S3S G;  1WMH A;  1WJ4 A;  2C7N B;  5TR5 A;  2FCN A;  4ZYN A;  5J17 A;  3KW5 B;  3HHM A;  1UGM A;  1WGR A;  5G2N A;  3P2B A;  3PVL A;  2AYO B;  2GOW A;  4K7U A;  3DBH I;  3V6E B;  4MDK E;  3UQA A;  3S2A A;  4HJK A;  2LZ6 A;  3U30 A;  2LVP A;  2YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...