2MA9B

Hiv-1 vif socs-box and elongin bc solution structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virion infectivity factor
publication title Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/protein binding
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ma9B00
2DYBA 4E74A 1WE7A 4FHJA 5HKHA 4HXDA 4W9HA 4BBNF 4KSLC 3A9KB 1YIWA 2KDBA 3PHXB 3RT3B 4P7IA 4IUMB 2EKEC 3SHQA 3V61A 3ECIA 2CU1A 1VD2A 2NBWB 3V6EB 4RM8A 1D3ZA 3GZNI 3UIPB 1UBQA 2LGYA 1J0GA 3DBLI 2MBBB 2Z0EB 1C1YB 3X23A 1IP9A 4ICVA 1GG3A 2M8SA 1KOTA 1UZXB 1YQBA 1V6EA 2ZPYA 2K6QA 3RYTA 3EFUA 4G0NB 2IZVB 3QJZA 4BFRA 4OVVA 3KYCD 1ZKHA 1NBFC 3U8ZA 3VUYA 2ZVOA 1E8WA 1YD8U 2LWPA 5LLIA 3PZDA 2G4DB 2GBJA 2Y5BB 2WWZA 2D10A 2KKCA 1QZEA 4HCPB 1U4AA 2A5UA 2DZMA 4GDKB 2D3GA 4I6LB 4ANUA 4FBJB 4KDIC 3WIMA 2V3SA 3AULA 3KW5B 4I6PA 4MGIE 1WGGA 2MW5A 2KJHB 1H8CA 2ZNVC 2OOBB 2J0MA 2KNBA 2LGXA 3OLMD 5E6OA 3UINB 4MELA 3ZDTA 1UD7A 2NCNA 4BKGA 3ZW3A 2ZCCA 3EC8A 1CMXB 2KMCA 3VH3B 1E5WA 2YLMA 3TL5A 3RZWC 4ASWC 2JPHA 2D2QA 3NOBA 3APCA 3DVGY 3D32A 5TR5A 4AJWA 1WR1A 3ONSA 1R4NI 3R66C 3H1UA 2BYVE 2WYQA 4CO7A 4E3CA 5LXHA 3NS8A 3A1QB 2KDEB 1E7UA 1EUVB 2DZIA 1TBEA 2YVCA 3VTWA 4KZCA 5CHVC 2O2VA 3DQVA 5JHBA 4EOYA 2IYDB 3V62A 3VUWA 4FN2A 5JZEB 2LRUA 1TGZB 4K7SA 3AU4A 4G11A 2O2VB 5AZGA 3VTUA 2BF8B 1GUAB 2PPHA 3L17A 4URKA 2MSED 1IPGA 2JWZA 3RUIB 1AARA 1OGWA 4W9EA 3VFKA 4AWJA 1L7YA 5DPRA 2FCQA 5DPTA 3JSVA 5JHAA 3KH0A 1BT0A 2FCMA 2K6DB 2L7RA 1WJ4A 5DPSA 3U30A 2FAZA 1X1MA 1VCBA 2LGDA 1A5RA 3IBEA 3HM6X 4MGZE 2BPSA 2MQJA 4W9KA 2UWQA 4WWNA 4HLEA 3H9DA 2EMSA 4EFOA 5E6PA 2RPQA 1E7VA 2KFKA 2G4SA 4NAWB 4XC2A 1XQQA 3CSFA 4HDQA 3ZO5B 2A4ZA 2D07B 2KLGA 3L10B 2MX2A 2KTRB 2BWFA 4IC7B 3WAMA 1WY8A 3M63B 2C7NB 3LDZE 2KHWB 3DBSA 4K81A 3HM3A 4F1SA 3JW0X 1G6JA 2LD9A 2ZNVB 2NPTA 1WX7A 2ASQA 1RFAA 1WMHB 2FUHB 3T8MA 4JGHB 2CHWA 1E8ZA 2GBMA 4A3PA 2HTHA 4W9JA 3QARA 4GB9A 1ZW7A 4WAAA 3ML8A 5E6NA 4GIVA 4M0WB 4KZ0A 1WX8A 5G55A 4LJOB 3APFA 2ZCBA 5DPWA 1R4MI 1WZ0A 2K8BA 4JLCA 2KZRA 4TV3A 1WXMA 1V80A 2FCSA 2DX5B 4FJVB 1E8YA 3M62B 4AOFA 3PGEA 4HJKA 3EHVA 2JZ3B 3O65B 5D94A 1E90A 4KV2A 4FA6A 3QWZB 5LXIB 3A4RA 3QHTA 3PRZA 1F9JA 2OJRA 4GDLA 3WAPA 2LASA 3S2AA 2WDTB 2KOXA 2XK5A 1P9DU 4B9KA 4MGKE 3V6CB 3CMMB 2BKFA 4ZRJA 2LXCA 4A20A 2KFJA 1WI0A 2N1WA 2KX0A 2WX0A 1WYWB 3ENEA 2NBVB 4IWPA 4HWIB 4NY0A 1E8XA 2L0TA 2O6VA 5G2NA 1H4RA 2AL6A 4BVUC 3L54A 3W1YA 4EKUA 2KDFB 3HIZA 4PYZA 1Y8RC 1HE8A 2N9XA 3VHTC 4JIOU 4HK2A 1K8RB 2N4FA 2RR9A 3N32A 3PVLA 3QIJA 4K7WA 4PS3A 3ZRFA 4ANWA 2XBBC 3DBHI 2BYFA 2CHXA 1LXDA 1UH6A 2I1JA 2LZ6A 3MJWA 3PRPB 4HCNB 3APDA 3ZTDA 2LVPA 2MCNB 3TMPB 2V1YA 3SDLC 4JL9A 4TQ1A 3DDCB 4KIKA 1WJNA 4BBNC 4ZRIA 3ZTCA 5AEKB 4FJYA 1WF9A 4FULA 1S1QB 4G3XB 3UIOB 3K9PB 2D11A 3ZNHB 3GOEA 4MDKE 1MG8A 2KJ6A 3QX1A 2LJ5A 2CKHB 3KYDD 5BO4B 2EMTA 1FXTB 1OQYA 3NHEB 3ZDMC 3TCAA 3VDZA 1V5OA 2K39A 4HVBA 1SIFA 3NZUA 1LFDA 2PE9A 4W9IA 1J19A 4W9FA 2NVUI 1RAXA 3VUXA 4PS8A 4ICUA 1EO6A 1GC6A 2AL3A 1P0RA 1OEYA 3H7SA 5J2RA 1WGRA 2K8CA 4KVGB 2GBRA 2LRWA 3IG3A 1P3QU 1Q0WB 4W9GA 2JF5A 1V9JA 2KWCA 2N9PC 3H7PA 2LI5A 2M0XA 3CF6E 1P98A 2VRRB 2HD5B 2R2QA 4A3OA 4DHZB 2DYMA 4X57B 2IO0B 4IM0A 3KUZA 4TQ0A 2FIDA 2GMIC 2JY6A 3HK0A 3PHWB 3N3KB 1ISNA 1UBIA 4NPNA 3UF8A 1P1AA 3WANA 4DBGA 5IA7A 2AWTA 4DHJD 3W1SC 2KC1A 2BGFA 2C60A 2J7QB 4BKSA 4DHZE 2UYZB 4HDOA 4IM2A 4LJPB 4FJZA 3JSVB 3UQAA 1KLVA 4GN1A 2KVRA 4BOZB 3ZNGC 3DBRI 3QA8A 3LJ3A 4PS7A 4IG7B 3RD2A 3L0WB 4GOCA 2KMAA 3HHMA 5L83A 4WQOB 2KK8A 3PLVA 1UGMA 2N1VA 2NR2A 4HPLB 3M3JA 1WGYA 1Q5WB 4PYUA 1I42A 2N7EA 2O6VD 3PREA 1EF5A 1S3SG 4EUTA 2KFKB 3AXCA 3DPDA 1GC7A 3K9OB 4ZYNA 5KHQA 5CHFA 3PLUA 4GXBA 1WJ6A 2DENB 2CS4A 1OTRB 4LCDE 2MWSB 3QC8B 4MM3A 3ZNZB 4FLHA 3AU5A 4DXAB 2AEHA 5CX3A 2FCNA 1WXAA 3I3TB 4IM3A 2KQSA 3VQIA 1C3TA 4ANVA 4OVUA 2KN5A 2PEAA 2G3QB 4GGQA 2NPTB 3C0RB 4XZ4A 3X0WA 3DOWA 3AI5A 2GBKA 2MRPA 3H6NA 4WJNA 4DDGD 3QCAA 1YJ1A 3JVZX 4M8NA 5C23A 3BY4B 3WA0A 1Z2MA 2DAFA 3NZSA 4II2B 3MHSD 3ZRCA 3SU8X 3M95A 4AUQC 4ZDVA 3RULA 3QK0A 5EDSA 2IO3B 2JXXA 4MGYE 3NY5A 3TIXA 4II3B 1WX9A 1LM8B 1WGHA 2IO1B 3A9JA 2B3AA 1EF1A 2KXJA 2KDIA 4W9DA 4DHJB 4EZJA 3A9JB 3MTNB 1SE9A 1WZ3A 4GDLB 3W1SA 4TKNA 2WX1A 3N30A 2C5LC 2L0FA 2XK5B 1YX5B 4FHKA 4NQLB 1OEYJ 1LQBA 3A9KA 3Q3JA 3B1LX 3VTVA 3EECA 5C1ZA 3QAQA 4MSMB 2JRIB 4DDID 2N9EB 3A4SC 2CHZA 4J6IA 4HPMB 4MEMA 2O6VB 2DYOA 2V4LA 1M94A 4MH0E 2L8JA 3CSTA 4K1RB 4BKSD 2FNJB 2R2OA 1WE6A 1JRUA 2ZJDA 4K7UA 5AZFA 4AP4C 2MA9B 4TUUA 1WXVA 3PSEB 5J18A 2KTFA 3OJ3A 4WJOA 2GBNA 3ALBA 4G50A 2KC2A 2JUOA 2KO3A 2JVCA 2DZKA 2JRHA 2MLBA 3OJ4B 2BKRB 4B95A 3DVGX 4EZKA 3UGBB 3SD5A 2I1KA 2MP2A 4KIKB 3JYUA 5D2MB 1ZGUB 1WH3A 2M17A 4B6WA 2MBHA 4IWOA 4GDKA 2MP2B 2XEWA 4MJSA 1RRBA 5GMVA 2GOWA 4F8CB 2REXA 3ZVVA 2KANA 4MSQB 3U7DA 3KUDB 3Q3FA 2RGFA 4MJSB 3VVWB 4WJPA 1NDDA 4JQWC 4KSKC 2IY1B 2L3ZA 1XT9B 1RLFA 1WRDB 4RM9A 1SGHA 1T0YA 3ZNID 4NQKE 2BYEA 4WWOA 3R3MA 3VH4B 1TTNA 3R7QA 2LUEA 2N7DA 3RZFA 4DK5A 4CHKA 1GNUA 2KWVB 2L05A 3L13A 4LDTD 5AZHA 4GU2A 4W9LA 3V60A 1WM3A 3A1QA 2FIFA 2KQ7A 1NI2A 2M4NA 3H7PB 4KDLB 4RMAA 5D6JB 4ANXA 2LVQA 4I6NB 5IAAC 2ZPNA 4AJYB 2RD0A 3A33B 4NJ7A 4FADA 4WJQA 2C7MB 1WJUA 1WXSA 4XX5A 4YL8A 2IBIB 2Z59B 3ZUNA 3VXWA 1I35A 3ML9A 1J8CA 1Q1OA 2KD0A 5DCNA 4ZRKA 2KJRA 2KLCA 4NJ6A 4NNJB 3R7RA 5L95C 1GJZA 2QHOA 5KHOA 2AYOB 3KUCB 5J17A 2K1FA 2ZZPB 3IHPC 4IW0A 2DAJA 1WGDA 3VAWA 2DZJA 4BKTA 3PS6A 1Z5SB 1WR6E 2J0KA 3DVNU 1WFYA 1V86A 2J0JA 3KVFB 1V2YA 2MBEA 1WIAA 5D7GA 3IFWB 3WALA 2CR5A 3DVNV 2ZEQA 2PE6B 4NAWA 2M1MA 1L2NA 2L00B 2RSUA 3T9LA 2C9WB 3L16A 2KWUB 1PQSA 3B08A 2KTRA 3ZIMA 2K25A 3IVFA 4F7ZA 2JZZA 2MBQA 2C7HA 2L76A 3PTFC 3WAOA 1YX6B 2K8HA 2PJHA 3B0AA 2JT4B 3ZLZA 4BOSC 5CHWA 4N9F4 1KJTA 4EZLA 1UELA 4W9CA 4M8MA 3P2BA 3OAWA 4GMVA 3TJPA 2KX3A 3BINA 3ZKJC 2HJ8A 2DHZA 1WMHA 3TBLD 2NBUA 2G45B 2NS5A 3PT2B 3PRMB 4IWQA 4E71A 1TZ1A 3PV1A 3QQ8B 4LDTB 2IY0B 1V49A 1XD3B 2Z0DB 2HE7A 4GSWA 2MBOA 3DCGA 1V81A 3UQBA 1WM2A 1V5TA 1KM7A 5FR6A 4EEWA 5CTRC 2LVOA 2W9NA 3RCZA 4DWFA 2IO2B 3L08A 4CYEA 2BWES 3PPAA 5JH5C 4WWPA 2LXAA 1IYFA 2ZVNA
chains in the Genus database with same CATH superfamily
2DLBA 1NI3A 4W9HA 1YIWA 1KLGD 2BT6A 4WQMA 2BS2B 3SHQA 3V61A 3NVZA 3ECIA 2CU1A 2NBWB 3V6EB 4RM8A 1D3ZA 3GZNI 3UIPB 3MHZA 4WAFA 1C1YB 1MFWA 3IT4B 1UZXB 1CQVA 1YQBA 2ZPYA 2K6QA 3RYTA 4G0NB 2IZVB 2N7JA 1NBFC 5LLIA 2LWPA 3NVWA 3PZDA 3DWMA 2Y5BB 2WU5B 2DNFA 4HCPB 4I6LB 2ONQA 5BYQA 1AWDA 3AULA 4I6PA 2MW5A 1UGJA 2KJHB 2J0MA 2WXKA 1QILA 2NCNA 3U4EG 5HHDG 1CMXB 2KMCA 1E5WA 3TL5A 3RZWC 2KQ4X 1K53A 2D2QA 1I4HA 2WGSA 3DVGY 1TKYA 5TR5A 2L52A 2BYVE 4YWGG 4E3CA 1VDVA 4HJGE 1E7UA 2DZIA 1EUVB 2KDEB 4XYCA 2Y3AA 3AEFB 1TGZB 4URKA 1PUTA 3RUIB 1JWUD 1AARA 1M4VA 4W9EA 3RFZB 5EE0A 5DPTA 5BMHA 1AYFA 1WJ4A 2GB1A 1TS2A 1X1MA 1VCBA 4HLEA 1R4NB 2CJOA 1L6UA 1F77A 1XO3A 3OWEB 2D07B 3GP7A 2BWFA 4GLSC 2LFIA 3TUOA 4F1SA 4CQNA 2B76B 1SBBB 1GB4A 1RFAA 1MVKA 1YN5A 1ZE3D 2HTHA 3QARA 4GB9A 4GIVA 2WS3B 1C76A 1FXAA 1E6EB 3IT6B 1R4MI 4JLCA 1WXMA 2AQ1B 1V80A 4FJVB 1E8YA 5D94A 1V97A 4FA6A 3QWZB 1L0VB 1F2RI 4GDLA 1L0XB 5AUIA 2KOXA 4RCOA 1QOGA 4B9KA 4MGKE 3TEWA 1D6EC 2LXCA 4B0MA 3L4PA 2KFJA 4KGRA 2WX0A 2L0TA 2O6VA 1L6VA 1H4RA 1ZPSA 3W1YA 1QLBB 3B2GA 4HK2A 3PVLA 1IGDA 5E6JA 2MEKA 2XBBC 3DBHI 1SE2A 1UH6A 2I1JA 4ZOHC 3PRPB 3ZTDA 3BIID 2LVPA 3SDLC 3DDCB 5AEKB 1ZUD2 4FULA 1S1QB 4G3XB 3FILA 3K9PB 4ITKA 1TZOA 1IBXA 3LYYA 2CKHB 2AX5A 4XDDA 1FXTB 3TCAA 3N1ZC 2K39A 3N1XC 1SIFA 1LFDA 4W9IA 2KWDA 5JXVA 4PK1A 4ICUA 1EO6A 1P0RA 4KVGB 1UWXA 2LRWA 4J3OD 2N9PC 2R2QA 1YMHE 2DYMA 3DHHC 1BUIC 4IM0A 4TQ0A 3HK0A 3UF8A 3WANA 1FRDA 4DHJD 1SE4A 2BGFA 2J7QB 4BKSA 2K0PA 3VRBB 4GN1A 3LJ3A 3ZXVA 1D4BA 2KK8A 1UGMA 2J4XA 2UU7A 4ARCA 2PMVA 3PREA 1E0ZA 1EF5A 4DXGA 3RNAC 2ACZB 1C77A 4LCDE 3QC8B 3AU5A 1K51A 5CX3A 2FCNA 3NJTA 4NAMA 4IM3A 1C3TA 2KN5A 2PEAA 2G3QB 3X0WA 3C0RB 3HUIA 2MJ3A 3H6NA 3QCAA 1CZPA 1SB3C 1PGAA 4M8NA 2K22A 3AEBB 4II2B 3MHSD 3ZRCA 3QK0A 3NY5A 1OQQA 3A9JA 4M02A 4PT5A 2B3AA 2KXJA 1FFUA 4DHJB 1T6BX 3W5UB 1ZXIA 1MG4A 2X8XX 1YN4A 3A9KA 4YTPB 2N9EB 2INDC 1DOIA 1DOYA 1C78A 4K1RB 2R2OA 3AE7B 1WE6A 2ZJDA 2QEJC 4AP4C 4TUUA 1WXVA 5J18A 3OJ3A 3P42A 3ALBA 4G50A 2J52A 2KO3A 2JRHA 2MLBA 1V1PB 3MP9A 2HJ1A 2BKRB 3UGBB 4OHJA 2QSDA 2I1KA 3SD5A 4KIKB 4K3BA 1FNVA 4H2AA 3JYUA 2OHFA 1ZGUB 1WH3A 2M17A 5HG2A 2M0AA 4YSXB 2MP2B 4MJSA 1N5WA 1C4PA 2REXA 3ZVVA 1AN8A 3U7DA 3Q3FA 2RGFA 2CU3A 4WJPA 4KSKC 2ZW0A 5EE9A 4RM9A 2KAJA 4WWOA 3W5VB 2KWVB 1ET6A 4GU2A 4W9LA 1YJIA 4KDLB 2FIFA 1FEHA 4RMAA 2JU6X 4AJYB 2RD0A 4NJ7A 3W2DA 1WJUA 4XX5A 4YL8A 1XLOA 1I35A 1ROEA 1XLQA 2KLCA 1WWTA 5KHOA 1SEBD 1TY0A 1KLUD 3KUCB 5J17A 2K1FA 4IW0A 2DAJA 1XCTL 2D5GA 2QIEB 4BKTA 1Z5SB 2JQRB 3FC4A 1V86A 1SJHD 2M19A 3AB5A 2ZEQA 1V1OA 2M1MA 1WRIA 3Q2AC 2RSUA 3NG0A 2C9WB 4MACA 1PQSA 4F7ZA 2JZZA 2MHJA 2K8HA 3B0AA 1L5PA 5EE1A 3OAWA 4GMVA 3TJPA 2KX3A 1ET9A 3BVMA 1PYWD 2HJ8A 2NBUA 2G45B 3PT2B 4EE2A 1TZ1A 4M0WA 2D3BA 4JE3B 1V49A 1XD3B 1QOFA 2Z0DB 3MJ5A 3RI7C 3GS2A 1V81A 1UF0A 1T0SC 3UQBA 1WM2A 1V5TA 1KM7A 2EKIA 4RGOS 5CTRC 2W9NA 3L08A 1UUPA 2BWES 3PPAA 4WWPA 2BYTA 2JWUA 2MH7A 2DYBA 4O1NA 5HKHA 1HA5A 2WXIA 4JPSA 1UWMA 2WU2B 1R7SA 3RT3B 2WXNA 1VD2A 3CIRB 1UBQA 3TEYA 1J0GA 3DBLI 2L83A 2MBBB 4ICVA 1PGXA 1GG3A 1KF6B 3EFUA 4BFRA 3U8ZA 1E8WA 1YD8U 2W54A 1ENFA 2KYWA 4A6QA 5I4DA 2INCC 2KKCA 1QZEA 2A5UA 4ANUA 2D3GA 4FBJB 4KDIC 1DYQA 1D5ZC 2ZNVC 2INPE 3CWIA 2LGXA 4MELA 4BKGA 3EGRA 3ZW3A 2ZCCA 3H8HA 3MC0B 1E7PB 3D32A 3WCQA 4AJWA 1WR1A 2R61A 2PLPA 5LXHA 2ICIA 1TBEA 3DQVA 5JHBA 2K5PA 3V62A 2JSVX 4FN2A 5AZGA 4K7SA 4AQ7A 2PPHA 2JWZA 3R2IA 4US8A 2PIAA 2PVOD 1OGWA 1VZ8A 2FCQA 5DPRA 1YQ3B 3JSVA 3I5JC 3KH0A 1BT0A 2FCMA 2L7RA 3IBEA 3HM6X 3I9V1 2MQJA 4C00A 2QC8A 1BXTA 1T5XD 3P63A 4HROA 4MT5A 2KFKA 2G4SA 1FNWA 2BS3B 2MX2A 4IC7B 4L2YA 4M00A 3M63B 3LDZE 2IGGA 4R3DA 1YJJA 3JW0X 1QKZA 3N20C 2I2YA 1WMHB 4KX6B 3T8MA 2CHWA 1E8ZA 1GOZA 1JMLA 4A3PA 3NRZA 1TT5B 3APFA 2ZCBA 3BZDB 1KRHA 3W9CB 2K8BA 2KZRA 3IAS1 3TEXA 3M62B 4AOFA 1E90A 5LXIB 4NZLB 3PRZA 3Q3MC 4RF0A 1CK1A 3WAPA 2WDTB 1P9DU 4KKJA 4IWPA 4NY0A 5G2NA 2AL6A 3L54A 2AQ3B 1R4MB 1HE8A 3U2SC 2V9HA 1K8RB 2N4FA 3QIJA 4K7WA 4US9A 2W82A 1LO5D 1NVID 3MJWA 4A55A 1Q10A 2MCNB 4NJCA 2V1YA 4TQ1A 1WJNA 4YSYB 2G9HD 4FJYA 1ZDXA 3DWGC 1WF9A 3UIOB 1F52A 2D11A 1TS3A 5GXGB 4C80A 3QX1A 1FXIA 5BO4B 1OQYA 4HVBA 3NZUA 2PE9A 1J19A 3IXSA 2NVUI 2BBCA 3VUXA 2AL3A 2LEKA 1RM6C 1XEEA 1WGRA 2GBRA 3IG3A 3DBHB 1P3QU 4LK0M 3NVVA 2JF5A 1V9JA 2PVGC 2M0XA 3CF6E 1JCKB 4DHZB 4X57B 2IO0B 3FAHA 2JY6A 2GMIC 3PHWB 4DBGA 1PFDA 3AMZA 2WDRB 2J53A 3ZQ4A 2KC1A 2V3NA 3UQAA 4FJZA 2LMCA 3DBRI 4PS7A 4GOCA 2L32A 2W3SA 4KKIA 3VR8B 4PYUA 4EUTA 1L0YB 2D3CA 5BYSA 2ON8A 5CHFA 2X38A 1WJ6A 2XNAC 2FE8A 2CS4A 3ZNZB 1TY2A 3I3TB 3VQIA 4N59A 2NPTB 4XZ4A 2MRPA 4RGMA 1YJ1A 2OJWA 2VZKD 4RNAA 1Z2MA 3AE8B 3M95A 1QOAA 3RULA 3TIXA 1FIQA 1WGHA 4BAXA 1EF1A 4ARIA 4W9DA 3A9JB 1WZ3A 3MFGA 1ZDVA 2C5LC 2JZPA 2L0FA 2XK5B 1P7EA 4FHKA 1LQBA 3Q3JA 5C1ZA 3EECA 3RNEC 2JRIB 1NYRA 5IKCM 4J6IA 4MEMA 5BMIA 2DYOA 1M94A 1J7BA 1T0RC 2WXMA 3TSSA 4K3CA 2GBNA 2WDQB 4LLGM 2DZKA 3OJ4B 2KACA 4WWMA 4B95A 3DVGX 1ZP0B 2INNE 2MBHA 2VZKB 5AUKA 2WXRA 3R8BA 3VVWB 3KUDB 4MJSB 1IGCA 4USAA 1XT9B 3KWVA 4A8XC 1F0ZA 4OZBA 4C4VB 1SGHA 1T0YA 1GPXA 4JWUC 4NQKE 1TTNA 3R7QA 4DK5A 3RZFA 3L13A 5AZHA 3P4PB 3H7PB 1SE3A 4ANXA 4I6NB 3A33B 1AW7A 4WJQA 4LNIA 1I7HA 2IBIB 1DOXA 1J8CA 2KD0A 2KJRA 1SSNA 1FD6A 3R7RA 5L95C 2QHOA 3V3XA 2AYOB 1N61A 3BK2A 2E6XA 3SFEB 2ZZPB 1B1ZA 2CJNA 2DZJA 1KTKA 3PS6A 1WFYA 3KVFB 2MBEA 1JW9D 2JYEA 5D7GA 3IFWB 2J42A 3DVNV 2GLSA 3T9LA 1I4QA 1OQRA 1C4CA 2LJIA 4MM3B 1MHHE 3IVFA 3PTFC 1WYGA 4BOSC 5CHWA 1UELA 5D3IB 4ZRQA 1I4XA 2W3RA 3ZKJC 3I57A 2N9LA 1L4ZB 2QCZA 4E71A 1SXTA 3PV1A 1FRRA 4M01A 3URYA 2HE7A 3DCGA 3AE3B 4EEWA 2LVOA 4DWFA 3KWLA 1C9FA 2LXAA 3BYTB 4S0RA 4E74A 4FHJA 3DHIC 4KSLC 2KDBA 3PHXB 4IUMB 3ZXRA 1UNSA 3AE9B 5LNK1 1IP9A 1JWMD 3X23A 1WXQA 1YQ4B 3E56A 1V6EA 3QJZA 5IN7A 3KYCD 1ZKHA 3VUYA 2ZVOA 2QMTA 2G4DB 2WHIA 2GBJA 2WWZA 1FFVA 2D10A 2DZMA 4GDKB 2V3SA 3KW5B 1N62A 4MGIE 1WGGA 3AEEB 4HPPA 2BB5A 2OOBB 4WIPA 2KNBA 4YT0B 5E6OA 3UINB 3RNGC 5C3JB 3VH3B 3DBLB 5BYRA 2YLMA 2JPHA 3APCA 1EU3A 1VZ6A 3R66C 1TIFA 3H1UA 2WYQA 4CO7A 3A1QB 4KZCA 2O2VA 2IYDB 3VUWA 2WXHA 5JZEB 2LRUA 4G11A 3VTUA 1GUAB 1ZOYB 3RNFC 4ZYSA 4AWJA 3GB1A 5JHAA 5DPSA 2FBWB 4TMAB 1JRPA 3U30A 3V05A 1EU4A 4ZRPA 2LGDA 1A5RA 4MGZE 5H8YE 2BPSA 4W9KA 4WWNA 2UWQA 5MPOA 3H9DA 2IJ0A 2WP9B 2H89B 2EMSA 1E9MA 3OG5A 2PW9A 3TEZA 4NAWB 1XQQA 3CSFA 2A4ZA 3AH7A 3L10B 2KTRB 4C7YA 3WAMA 1WY8A 4K81A 4LNKA 1I4PA 2ZNVB 1WX7A 2FUHB 2BVCA 2GBMA 2DBYA 4WAAA 3ML8A 4KZ0A 5G55A 4LJOB 3Q8FA 5T8IA 1WZ0A 1RWSA 4TV3A 3EA6A 2FCSA 3P4SB 3AEDB 1SIJA 2JZ3B 2Y5PA 1STEA 3QHTA 1TS4A 1VR9A 1F9JA 2OJRA 4HKZE 3LB8C 3S2AA 2JYTA 4LNNA 4HEA1 1FNUA 3AECB 2IGHA 4ZRJA 2BKFA 2LHEA 4DQOC 1WI0A 2N1WA 2KX0A 3AV8A 1WYWB 4HWIB 4QAYA 2BTEA 2KDFB 2WXQA 1Y8RC 2N9XA 2LGIA 3VHTC 3O13A 4JIOU 1QQRA 3ZRFA 4ANWA 2TSSA 3SR6A 2NTSA 1ACCA 2CHXA 1LXDA 1JQ4A 2LZ6A 3AM9A 4HCNB 1V1PA 4XWTA 3TMPB 2GRIA 4JL9A 4KIKA 4ZRIA 3ZTCA 1HTOA 4LTUA 4HKQA 3HRDD 1J7CA 2WXFA 3AE5B 3GOEA 4MDKE 1C4AA 1MG8A 3AE6B 2KJ6A 1N60A 1XXGA 2LJ5A 2ZW1A 5G5HA 3VDZA 1JWBD 1TKGA 4YXDB 1RAXA 1GC6A 5J2RA 3GE3C 4OW0A 4OZCA 2IGDA 4W9GA 1RFKA 2KWCA 3LXFA 1VRAB 1P98A 1SJED 2VRRB 1UBIA 3P1MA 4NPNA 1P1AA 3KQ4A 3Q3OC 2AWTA 3W1SC 4DHZE 1SF0A 4HDOA 1KLVA 2KVRA 4IG7B 3RD2A 3L0WB 2KMAA 4RH6A 3HHMA 3PLVA 1WSPA 2NR2A 4HPLB 3M3JA 1WGYA 1Q5WB 1I42A 2O6VD 1MPEA 3DPDA 3Q8CA 3C19A 2QDFA 1KH0A 3K9OB 4ZYNA 3ZJUA 2WNMA 4GXBA 2DENB 1OTRB 4C56C 1OFFA 2MWSB 1GAQB 4FLHA 4DXAB 5IO9A 2WXOA 1WXAA 2KQSA 4XWWA 3B9JA 4ANVA 4OVUA 2MJDA 2GBKA 2GI9A 4WJNA 4DDGD 1P7FA 3DBRB 4YTNB 3BY4B 3MC8A 3WA0A 3P4QB 3ZYYX 2DAFA 3NZSA 3SU8X 4ZDVA 2IO3B 2JXXA 4II3B 1NYQA 1LM8B 2IO1B 1XLNA 3NUHB 2YEPB 4EZJA 3MTNB 4GDLB 3W1SA 4TKNA 3N30A 4MH8A 1YX5B 4NQLB 1OEYJ 4MSMB 4DDID 3A4SC 1ESFA 2O6VB 3Q14C 3T3NA 2V4LA 4MH0E 2KMMA 3CSTA 4BKSD 2FNJB 1D5XC 1XCQL 4UDUC 1A70A 4K7UA 1FO4A 3PSEB 5H92C 2KTFA 2KC2A 2JUOA 2JVCA 2M56B 1FCLA 4XGAB 2WQYB 1JWSD 4IWOA 3FILB 2XEWA 3ZJTA 2GOWA 2V3PA 1IBXB 4P1CC 1N63A 2KT7A 1NDDA 4JQWC 2IY1B 2L3ZA 2I38A 4B0EA 3NZ3A 1WRDB 1YNTE 2BYEA 3VH4B 1FCCC 4CHKA 1GNUA 2L05A 1QT9A 2Q5WD 2H88B 3V60A 1WM3A 3BVZA 2KQ7A 1NI2A 5D6JB 2QJLA 2LVQA 2ZPNA 1HEZE 2C7MB 2RDHA 2Z59B 3ZUNA 3VXWA 3ML9A 3RNCC 4NJ6A 2G1EA 4P6VF 1GJZA 5G5GA 3IHPC 4FXCA 2J0JA 1V2YA 4DXFA 2CR5A 2K3UA 1HQRD 1L2NA 4WURA 2L00B 4A90A 2KWUB 3ZIMA 2K25A 2C7HA 2L76A 3WAOA 1YX6B 2JT4B 2QILA 3P4RB 3ZLZA 4EZLA 1KJTA 2FUG1 1FPYA 4W9CA 4M8MA 1IUEA 2WXLA 3P2BA 1F2RC 3Q3NC 1WMHA 4RFBA 3PRMB 4IWQA 1WGKA 3QQ8B 5HFYA 2IY0B 2NTTA 4GSWA 2MBOA 3AEAB 1LGRA 2L1AA 1JALA 3RCZA 1B9RA 2IO2B 2XN9C 1TS5A 1WE7A 4HXDA 4BBNF 3A9KB 1MHXA 4P7IA 2EKEC 2SAKA 1T0QC 4P16A 2LGYA 2Z0EB 4L23A 3ZJVA 2M8SA 3SFDB 1KOTA 2V0GA 2N0SB 5IOIA 4OVVA 1F1HA 3RPFC 1K50A 4KGSA 1JROA 3Q69A 1U4AA 4REZA 3WIMA 1H8CA 3U7ZA 3IAM1 3OLMD 3BVGA 3ZDTA 1UD7A 3RNBC 3EC8A 4ASWC 3NOBA 3ONSA 3C8YA 5D3DA 1R4NI 2VH1A 5FK9C 1TYGB 1NENB 3J9CA 5FKAC 4ZHOA 3NS8A 3AE2B 3PZ7A 3VTWA 2YVCA 3HVZA 5CHVC 1EWYC 2D3AA 4EOYA 3I63C 3Q8AA 3NS1A 1QOBA 3AU4A 2O2VB 2BF8B 3L17A 2MSED 4WH4A 1IPGA 1CJEA 3VFKA 1L7YA 4IOIE 2WXJA 2K6DB 2FAZA 1VLBA 3ABVB 2E3TA 3SEBA 4EFOA 5E6PA 2RPQA 3UI3A 1E7VA 4XC2A 4HDQA 2V4IB 3ZO5B 2KLGA 1Y56A 1XLPA 4S17A 1PGBA 2C7NB 4OVZA 3Q8BA 2KHWB 3DBSA 1FMAD 3HM3A 1G6JA 4XE0A 2LD9A 3FKYA 1N6ZA 2NPTA 2ASQA 1RYJA 4LNFA 4RGNA 1E10A 4JGHB 4W9JA 3PO0A 1VJKA 1ZW7A 5E6NA 4C7ZA 1V8CA 4M0WB 1WX8A 3AE4B 2Z8LA 3VR9B 5DPWA 1QF6A 2AQ2B 1N5XA 2DX5B 3PGEA 4HJKA 3EHVA 3O65B 4RGTA 4KV2A 3A4RA 2HDEA 4N58A 1BMLC 2LASA 4JX1C 2XK5A 3V6CB 3CMMB 4A20A 2RPVA 3R2TA 3ETRA 3ENEA 2NBVB 1E8XA 2BW2A 4BVUC 2KVZA 1PDXA 4EKUA 3HIZA 4PYZA 4IDIA 2RR9A 3N32A 4PS3A 1D5MC 2BYFA 3Q6BA 3AEGB 3APDA 4BBNC 4KGTA 2RDBC 3ZNHB 1HZ6A 2EELA 3KYDD 2EMTA 3NHEB 3ZDMC 5EE3A 1V5OA 2KDMA 3BYYB 4W9FA 4C4VA 4PS8A 1T3QA 1OEYA 3H7SA 2K8CA 2K9XA 1JWAD 1Q0WB 3H7PA 2LI5A 4JWSC 2HD5B 2KN4A 4A3OA 3KUZA 2FIDA 3BWUD 1K52A 4N6EB 3N3KB 1ISNA 5IA7A 3RN9C 2C60A 2UYZB 4IM2A 4LJPB 3JSVB 4BOZB 1YOVB 3ZNGC 3QA8A 2WDVB 5L83A 4WQOB 2LUMA 4YSZB 2N1VA 3RMKC 2N7EA 1HXYD 1S3SG 5IP4D 2KFKB 3AXCA 1GC7A 1HTQA 5KHQA 3PLUA 1C79A 3AN1A 4MM3A 3N1YC 3E9SA 2AEHA 4A9AA 4ACFA 2RDGA 4GGQA 3DOWA 2SEBD 3EFCA 3AI5A 3AE1B 1YN3A 1MJDA 2WLBA 3JVZX 5C23A 4YTMB 3VRAB 4AUQC 5EDSA 2MJEA 4MGYE 4OZAA 3Q8EA 1WX9A 4P1BC 1EM7A 2PKOA 2KDIA 2N9KA 1FM0D 1SE9A 2BS4B 2PTLA 2WX1A 4TSSA 3B1LX 3VTVA 3QAQA 2BB6A 2LGSA 2CHZA 4HPMB 4LNOA 1ZXHA 2L8JA 3ZGZA 1JRUA 1DGJA 2LHDA 5AZFA 2MA9B 4WJOA 1TKEA 2DWQA 4EZKA 3T3OA 2MP2A 3B2FA 1TJEA 1NEKB 5D2MB 4B6WA 4GDKA 2YEPF 1RRBA 5GMVA 5TSSA 4F8CB 5FR3A 2KANA 4MSQB 1RLFA 3EUB2 4ZHPA 3ZNID 3GZNB 4XDCA 3R3MA 5HI1A 2LUEA 2N7DA 4D2KA 3GE8C 4LDTD 1HZ5A 3KLSX 4L1BA 3A1QA 2M4NA 4AS1A 2RMMA 5IAAC 3BK1A 4FADA 2OEDA 2WXGA 1J7AA 1WXSA 3DHGC 2IDYA 3NVYA 4IKGA 1Q1OA 5DCNA 4ZRKA 3N9YC 4NNJB 2VH2A 3HVDA 4Q2JA 1L4DB 2BQQA 1WGDA 1XF5L 3VAWA 2JX5A 1WR6E 2J0KA 3DVNU 1EWCA 3PZ8A 1WIAA 3WALA 2PE6B 5C2TB 4NAWA 2IPKD 2HTME 1GB1A 3L16A 3B08A 2KTRA 4RF1A 2MBQA 2JXTA 2PJHA 4N9F4 1KFYB 3BINA 1MI0A 2DHZA 4BZAA 3TBLD 2NS5A 2NMQA 2W55A 4LDTB 2WXPA 5BMGA 1I4RA 2Y5CA 3MC9A 5FR6A 1I4GA 4CYEA 5JH5C 1VZ7A 4HRSA 1IYFA 2ZVNA 3U52E
chains in the Genus database with same CATH topology
2DYBA 4E74A 1WE7A 4FHJA 5HKHA 4HXDA 4W9HA 4BBNF 4KSLC 3A9KB 1YIWA 2KDBA 3PHXB 3RT3B 4P7IA 4IUMB 2EKEC 3SHQA 3V61A 3ECIA 2CU1A 1VD2A 2NBWB 3V6EB 4RM8A 1D3ZA 3GZNI 3UIPB 1UBQA 2LGYA 1J0GA 3DBLI 2MBBB 2Z0EB 1C1YB 3X23A 1IP9A 4ICVA 1GG3A 2M8SA 1KOTA 1UZXB 1YQBA 1V6EA 2ZPYA 2K6QA 3RYTA 3EFUA 4G0NB 2IZVB 3QJZA 4BFRA 4OVVA 3KYCD 1ZKHA 1NBFC 3U8ZA 3VUYA 2ZVOA 1E8WA 1YD8U 2LWPA 5LLIA 3PZDA 2G4DB 2GBJA 2Y5BB 2WWZA 2D10A 2KKCA 1QZEA 4HCPB 1U4AA 2A5UA 2DZMA 4GDKB 2D3GA 4I6LB 4ANUA 4FBJB 4KDIC 3WIMA 2V3SA 3AULA 3KW5B 4I6PA 4MGIE 1WGGA 2MW5A 2KJHB 1H8CA 2ZNVC 2OOBB 2J0MA 2KNBA 2LGXA 3OLMD 5E6OA 3UINB 4MELA 3ZDTA 1UD7A 2NCNA 4BKGA 3ZW3A 2ZCCA 3EC8A 1CMXB 2KMCA 3VH3B 1E5WA 2YLMA 3TL5A 3RZWC 4ASWC 2JPHA 2D2QA 3NOBA 3APCA 3DVGY 3D32A 5TR5A 4AJWA 1WR1A 3ONSA 1R4NI 3R66C 3H1UA 2BYVE 2WYQA 4CO7A 4E3CA 5LXHA 3NS8A 3A1QB 2KDEB 1E7UA 1EUVB 2DZIA 1TBEA 2YVCA 3VTWA 4KZCA 5CHVC 2O2VA 3DQVA 5JHBA 4EOYA 2IYDB 3V62A 3VUWA 4FN2A 5JZEB 2LRUA 1TGZB 4K7SA 3AU4A 4G11A 2O2VB 5AZGA 3VTUA 2BF8B 1GUAB 2PPHA 3L17A 4URKA 2MSED 1IPGA 2JWZA 3RUIB 1AARA 1OGWA 4W9EA 3VFKA 4AWJA 1L7YA 5DPRA 2FCQA 5DPTA 3JSVA 5JHAA 3KH0A 1BT0A 2FCMA 2K6DB 2L7RA 1WJ4A 5DPSA 3U30A 2FAZA 1X1MA 1VCBA 2LGDA 1A5RA 3IBEA 3HM6X 4MGZE 2BPSA 2MQJA 4W9KA 2UWQA 4WWNA 4HLEA 3H9DA 2EMSA 4EFOA 5E6PA 2RPQA 1E7VA 2KFKA 2G4SA 4NAWB 4XC2A 1XQQA 3CSFA 4HDQA 3ZO5B 2A4ZA 2D07B 2KLGA 3L10B 2MX2A 2KTRB 2BWFA 4IC7B 3WAMA 1WY8A 3M63B 2C7NB 3LDZE 2KHWB 3DBSA 4K81A 3HM3A 4F1SA 3JW0X 1G6JA 2LD9A 2ZNVB 2NPTA 1WX7A 2ASQA 1RFAA 1WMHB 2FUHB 3T8MA 4JGHB 2CHWA 1E8ZA 2GBMA 4A3PA 2HTHA 4W9JA 3QARA 4GB9A 1ZW7A 4WAAA 3ML8A 5E6NA 4GIVA 4M0WB 4KZ0A 1WX8A 5G55A 4LJOB 3APFA 2ZCBA 5DPWA 1R4MI 1WZ0A 2K8BA 4JLCA 2KZRA 4TV3A 1WXMA 1V80A 2FCSA 2DX5B 4FJVB 1E8YA 3M62B 4AOFA 3PGEA 4HJKA 3EHVA 2JZ3B 3O65B 5D94A 1E90A 4KV2A 4FA6A 3QWZB 5LXIB 3A4RA 3QHTA 3PRZA 1F9JA 2OJRA 4GDLA 3WAPA 2LASA 3S2AA 2WDTB 2KOXA 2XK5A 1P9DU 4B9KA 4MGKE 3V6CB 3CMMB 2BKFA 4ZRJA 2LXCA 4A20A 2KFJA 1WI0A 2N1WA 2KX0A 2WX0A 1WYWB 3ENEA 2NBVB 4IWPA 4HWIB 4NY0A 1E8XA 2L0TA 2O6VA 5G2NA 1H4RA 2AL6A 4BVUC 3L54A 3W1YA 4EKUA 2KDFB 3HIZA 4PYZA 1Y8RC 1HE8A 2N9XA 3VHTC 4JIOU 4HK2A 1K8RB 2N4FA 2RR9A 3N32A 3PVLA 3QIJA 4K7WA 4PS3A 3ZRFA 4ANWA 2XBBC 3DBHI 2BYFA 2CHXA 1LXDA 1UH6A 2I1JA 2LZ6A 3MJWA 3PRPB 4HCNB 3APDA 3ZTDA 2LVPA 2MCNB 3TMPB 2V1YA 3SDLC 4JL9A 4TQ1A 3DDCB 4KIKA 1WJNA 4BBNC 4ZRIA 3ZTCA 5AEKB 4FJYA 1WF9A 4FULA 1S1QB 4G3XB 3UIOB 3K9PB 2D11A 3ZNHB 3GOEA 4MDKE 1MG8A 2KJ6A 3QX1A 2LJ5A 2CKHB 3KYDD 5BO4B 2EMTA 1FXTB 1OQYA 3NHEB 3ZDMC 3TCAA 3VDZA 1V5OA 2K39A 4HVBA 1SIFA 3NZUA 1LFDA 2PE9A 4W9IA 1J19A 4W9FA 2NVUI 1RAXA 3VUXA 4PS8A 4ICUA 1EO6A 1GC6A 2AL3A 1P0RA 1OEYA 3H7SA 5J2RA 1WGRA 2K8CA 4KVGB 2GBRA 2LRWA 3IG3A 1P3QU 1Q0WB 4W9GA 2JF5A 1V9JA 2KWCA 2N9PC 3H7PA 2LI5A 2M0XA 3CF6E 1P98A 2VRRB 2HD5B 2R2QA 4A3OA 4DHZB 2DYMA 4X57B 2IO0B 4IM0A 3KUZA 4TQ0A 2FIDA 2GMIC 2JY6A 3HK0A 3PHWB 3N3KB 1ISNA 1UBIA 4NPNA 3UF8A 1P1AA 3WANA 4DBGA 5IA7A 2AWTA 4DHJD 3W1SC 2KC1A 2BGFA 2C60A 2J7QB 4BKSA 4DHZE 2UYZB 4HDOA 4IM2A 4LJPB 4FJZA 3JSVB 3UQAA 1KLVA 4GN1A 2KVRA 4BOZB 3ZNGC 3DBRI 3QA8A 3LJ3A 4PS7A 4IG7B 3RD2A 3L0WB 4GOCA 2KMAA 3HHMA 5L83A 4WQOB 2KK8A 3PLVA 1UGMA 2N1VA 2NR2A 4HPLB 3M3JA 1WGYA 1Q5WB 4PYUA 1I42A 2N7EA 2O6VD 3PREA 1EF5A 1S3SG 4EUTA 2KFKB 3AXCA 3DPDA 1GC7A 3K9OB 4ZYNA 5KHQA 5CHFA 3PLUA 4GXBA 1WJ6A 2DENB 2CS4A 1OTRB 4LCDE 2MWSB 3QC8B 4MM3A 3ZNZB 4FLHA 3AU5A 4DXAB 2AEHA 5CX3A 2FCNA 1WXAA 3I3TB 4IM3A 2KQSA 3VQIA 1C3TA 4ANVA 4OVUA 2KN5A 2PEAA 2G3QB 4GGQA 2NPTB 3C0RB 4XZ4A 3X0WA 3DOWA 3AI5A 2GBKA 2MRPA 3H6NA 4WJNA 4DDGD 3QCAA 1YJ1A 3JVZX 4M8NA 5C23A 3BY4B 3WA0A 1Z2MA 2DAFA 3NZSA 4II2B 3MHSD 3ZRCA 3SU8X 3M95A 4AUQC 4ZDVA 3RULA 3QK0A 5EDSA 2IO3B 2JXXA 4MGYE 3NY5A 3TIXA 4II3B 1WX9A 1LM8B 1WGHA 2IO1B 3A9JA 2B3AA 1EF1A 2KXJA 2KDIA 4W9DA 4DHJB 4EZJA 3A9JB 3MTNB 1SE9A 1WZ3A 4GDLB 3W1SA 4TKNA 2WX1A 3N30A 2C5LC 2L0FA 2XK5B 1YX5B 4FHKA 4NQLB 1OEYJ 1LQBA 3A9KA 3Q3JA 3B1LX 3VTVA 3EECA 5C1ZA 3QAQA 4MSMB 2JRIB 4DDID 2N9EB 3A4SC 2CHZA 4J6IA 4HPMB 4MEMA 2O6VB 2DYOA 2V4LA 1M94A 4MH0E 2L8JA 3CSTA 4K1RB 4BKSD 2FNJB 2R2OA 1WE6A 1JRUA 2ZJDA 4K7UA 5AZFA 4AP4C 2MA9B 4TUUA 1WXVA 3PSEB 5J18A 2KTFA 3OJ3A 4WJOA 2GBNA 3ALBA 4G50A 2KC2A 2JUOA 2KO3A 2JVCA 2DZKA 2JRHA 2MLBA 3OJ4B 2BKRB 4B95A 3DVGX 4EZKA 3UGBB 3SD5A 2I1KA 2MP2A 4KIKB 3JYUA 5D2MB 1ZGUB 1WH3A 2M17A 4B6WA 2MBHA 4IWOA 4GDKA 2MP2B 2XEWA 4MJSA 1RRBA 5GMVA 2GOWA 4F8CB 2REXA 3ZVVA 2KANA 4MSQB 3U7DA 3KUDB 3Q3FA 2RGFA 4MJSB 3VVWB 4WJPA 1NDDA 4JQWC 4KSKC 2IY1B 2L3ZA 1XT9B 1RLFA 1WRDB 4RM9A 1SGHA 1T0YA 3ZNID 4NQKE 2BYEA 4WWOA 3R3MA 3VH4B 1TTNA 3R7QA 2LUEA 2N7DA 3RZFA 4DK5A 4CHKA 1GNUA 2KWVB 2L05A 3L13A 4LDTD 5AZHA 4GU2A 4W9LA 3V60A 1WM3A 3A1QA 2FIFA 2KQ7A 1NI2A 2M4NA 3H7PB 4KDLB 4RMAA 5D6JB 4ANXA 2LVQA 4I6NB 5IAAC 2ZPNA 4AJYB 2RD0A 3A33B 4NJ7A 4FADA 4WJQA 2C7MB 1WJUA 1WXSA 4XX5A 4YL8A 2IBIB 2Z59B 3ZUNA 3VXWA 1I35A 3ML9A 1J8CA 1Q1OA 2KD0A 5DCNA 4ZRKA 2KJRA 2KLCA 4NJ6A 4NNJB 3R7RA 5L95C 1GJZA 2QHOA 5KHOA 2AYOB 3KUCB 5J17A 2K1FA 2ZZPB 3IHPC 4IW0A 2DAJA 1WGDA 3VAWA 2DZJA 4BKTA 3PS6A 1Z5SB 1WR6E 2J0KA 3DVNU 1WFYA 1V86A 2J0JA 3KVFB 1V2YA 2MBEA 1WIAA 5D7GA 3IFWB 3WALA 2CR5A 3DVNV 2ZEQA 2PE6B 4NAWA 2M1MA 1L2NA 2L00B 2RSUA 3T9LA 2C9WB 3L16A 2KWUB 1PQSA 3B08A 2KTRA 3ZIMA 2K25A 3IVFA 4F7ZA 2JZZA 2MBQA 2C7HA 2L76A 3PTFC 3WAOA 1YX6B 2K8HA 2PJHA 3B0AA 2JT4B 3ZLZA 4BOSC 5CHWA 4N9F4 1KJTA 4EZLA 1UELA 4W9CA 4M8MA 3P2BA 3OAWA 4GMVA 3TJPA 2KX3A 3BINA 3ZKJC 2HJ8A 2DHZA 1WMHA 3TBLD 2NBUA 2G45B 2NS5A 3PT2B 3PRMB 4IWQA 4E71A 1TZ1A 3PV1A 3QQ8B 4LDTB 2IY0B 1V49A 1XD3B 2Z0DB 2HE7A 4GSWA 2MBOA 3DCGA 1V81A 3UQBA 1WM2A 1V5TA 1KM7A 5FR6A 4EEWA 5CTRC 2LVOA 2W9NA 3RCZA 4DWFA 2IO2B 3L08A 4CYEA 2BWES 3PPAA 5JH5C 4WWPA 2LXAA 1IYFA 2ZVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  4E74 A;  1WE7 A;  4FHJ A;  5HKH A;  4HXD A;  4W9H A;  4BBN F;  4KSL C;  3A9K B;  1YIW A;  2KDB A;  3PHX B;  3RT3 B;  4P7I A;  4IUM B;  2EKE C;  3SHQ A;  3V61 A;  3ECI A;  2CU1 A;  1VD2 A;  2NBW B;  3V6E B;  4RM8 A;  1D3Z A;  3GZN I;  3UIP B;  1UBQ A;  2LGY A;  1J0G A;  3DBL I;  2MBB B;  2Z0E B;  1C1Y B;  3X23 A;  1IP9 A;  4ICV A;  1GG3 A;  2M8S A;  1KOT A;  1UZX B;  1YQB A;  1V6E A;  2ZPY A;  2K6Q A;  3RYT A;  3EFU A;  4G0N B;  2IZV B;  3QJZ A;  4BFR A;  4OVV A;  3KYC D;  1ZKH A;  1NBF C;  3U8Z A;  3VUY A;  2ZVO A;  1E8W A;  1YD8 U;  2LWP A;  5LLI A;  3PZD A;  2G4D B;  2GBJ A;  2Y5B B;  2WWZ A;  2D10 A;  2KKC A;  1QZE A;  4HCP B;  1U4A A;  2A5U A;  2DZM A;  4GDK B;  2D3G A;  4I6L B;  4ANU A;  4FBJ B;  4KDI C;  3WIM A;  2V3S A;  3AUL A;  3KW5 B;  4I6P A;  4MGI E;  1WGG A;  2MW5 A;  2KJH B;  1H8C A;  2ZNV C;  2OOB B;  2J0M A;  2KNB A;  2LGX A;  3OLM D;  5E6O A;  3UIN B;  4MEL A;  3ZDT A;  1UD7 A;  2NCN A;  4BKG A;  3ZW3 A;  2ZCC A;  3EC8 A;  1CMX B;  2KMC A;  3VH3 B;  1E5W A;  2YLM A;  3TL5 A;  3RZW C;  4ASW C;  2JPH A;  2D2Q A;  3NOB A;  3APC A;  3DVG Y;  3D32 A;  5TR5 A;  4AJW A;  1WR1 A;  3ONS A;  1R4N I;  3R66 C;  3H1U A;  2BYV E;  2WYQ A;  4CO7 A;  4E3C A;  5LXH A;  3NS8 A;  3A1Q B;  2KDE B;  1E7U A;  1EUV B;  2DZI A;  1TBE A;  2YVC A;  3VTW A;  4KZC A;  5CHV C;  2O2V A;  3DQV A;  5JHB A;  4EOY A;  2IYD B;  3V62 A;  3VUW A;  4FN2 A;  5JZE B;  2LRU A;  1TGZ B;  4K7S A;  3AU4 A;  4G11 A;  2O2V B;  5AZG A;  3VTU A;  2BF8 B;  1GUA B;  2PPH A;  3L17 A;  4URK A;  2MSE D;  1IPG A;  2JWZ A;  3RUI B;  1AAR A;  1OGW A;  4W9E A;  3VFK A;  4AWJ A;  1L7Y A;  5DPR A;  2FCQ A;  5DPT A;  3JSV A;  5JHA A;  3KH0 A;  1BT0 A;  2FCM A;  2K6D B;  2L7R A;  1WJ4 A;  5DPS A;  3U30 A;  2FAZ A;  1X1M A;  1VCB A;  2LGD A;  1A5R A;  3IBE A;  3HM6 X;  4MGZ E;  2BPS A;  2MQJ A;  4W9K A;  2UWQ A;  4WWN A;  4HLE A;  3H9D A;  2EMS A;  4EFO A;  5E6P A;  2RPQ A;  1E7V A;  2KFK A;  2G4S A;  4NAW B;  4XC2 A;  1XQQ A;  3CSF A;  4HDQ A;  3ZO5 B;  2A4Z A;  2D07 B;  2KLG A;  3L10 B;  2MX2 A;  2KTR B;  2BWF A;  4IC7 B;  3WAM A;  1WY8 A;  3M63 B;  2C7N B;  3LDZ E;  2KHW B;  3DBS A;  4K81 A;  3HM3 A;  4F1S A;  3JW0 X;  1G6J A;  2LD9 A;  2ZNV B;  2NPT A;  1WX7 A;  2ASQ A;  1RFA A;  1WMH B;  2FUH B;  3T8M A;  4JGH B;  2CHW A;  1E8Z A;  2GBM A;  4A3P A;  2HTH A;  4W9J A;  3QAR A;  4GB9 A;  1ZW7 A;  4WAA A;  3ML8 A;  5E6N A;  4GIV A;  4M0W B;  4KZ0 A;  1WX8 A;  5G55 A;  4LJO B;  3APF A;  2ZCB A;  5DPW A;  1R4M I;  1WZ0 A;  2K8B A;  4JLC A;  2KZR A;  4TV3 A;  1WXM A;  1V80 A;  2FCS A;  2DX5 B;  4FJV B;  1E8Y A;  3M62 B;  4AOF A;  3PGE A;  4HJK A;  3EHV A;  2JZ3 B;  3O65 B;  5D94 A;  1E90 A;  4KV2 A;  4FA6 A;  3QWZ B;  5LXI B;  3A4R A;  3QHT A;  3PRZ A;  1F9J A;  2OJR A;  4GDL A;  3WAP A;  2LAS A;  3S2A A;  2WDT B;  2KOX A;  2XK5 A;  1P9D U;  4B9K A;  4MGK E;  3V6C B;  3CMM B;  2BKF A;  4ZRJ A;  2LXC A;  4A20 A;  2KFJ A;  1WI0 A;  2N1W A;  2KX0 A;  2WX0 A;  1WYW B;  3ENE A;  2NBV B;  4IWP A;  4HWI B;  4NY0 A;  1E8X A;  2L0T A;  2O6V A;  5G2N A;  1H4R A;  2AL6 A;  4BVU C;  3L54 A;  3W1Y A;  4EKU A;  2KDF B;  3HIZ A;  4PYZ A;  1Y8R C;  1HE8 A;  2N9X A;  3VHT C;  4JIO U;  4HK2 A;  1K8R B;  2N4F A;  2RR9 A;  3N32 A;  3PVL A;  3QIJ A;  4K7W A;  4PS3 A;  3ZRF A;  4ANW A;  2XBB C;  3DBH I;  2BYF A;  2CHX A;  1LXD A;  1UH6 A;  2I1J A;  2LZ6 A;  3MJW A;  3PRP B;  4HCN B;  3APD A;  3ZTD A;  2LVP A;  2MCN B;  3TMP B;  2V1Y A;  3SDL C;  4JL9 A;  4TQ1 A;  3DDC B;  4KIK A;  1WJN A;  4BBN C;  4ZRI A;  3ZTC A;  5AEK B;  4FJY A;  1WF9 A;  4FUL A;  1S1Q B;  4G3X B;  3UIO B;  3K9P B;  2D11 A;  3ZNH B;  3GOE A;  4MDK E;  1MG8 A;  2KJ6 A;  3QX1 A;  2LJ5 A;  2CKH B;  3KYD D;  5BO4 B;  2EMT A;  1FXT B;  1OQY A;  3NHE B;  3ZDM C;  3TCA A;  3VDZ A;  1V5O A;  2K39 A;  4HVB A;  1SIF A;  3NZU A;  1LFD A;  2PE9 A;  4W9I A;  1J19 A;  4W9F A;  2NVU I;  1RAX A;  3VUX A;  4PS8 A;  4ICU A;  1EO6 A;  1GC6 A;  2AL3 A;  1P0R A;  1OEY A;  3H7S A;  5J2R A;  1WGR A;  2K8C A;  4KVG B;  2GBR A;  2LRW A;  3IG3 A;  1P3Q U;  1Q0W B;  4W9G A;  2JF5 A;  1V9J A;  2KWC A;  2N9P C;  3H7P A;  2LI5 A;  2M0X A;  3CF6 E;  1P98 A;  2VRR B;  2HD5 B;  2R2Q A;  4A3O A;  4DHZ B;  2DYM A;  4X57 B;  2IO0 B;  4IM0 A;  3KUZ A;  4TQ0 A;  2FID A;  2GMI C;  2JY6 A;  3HK0 A;  3PHW B;  3N3K B;  1ISN A;  1UBI A;  4NPN A;  3UF8 A;  1P1A A;  3WAN A;  4DBG A;  5IA7 A;  2AWT A;  4DHJ D;  3W1S C;  2KC1 A;  2BGF A;  2C60 A;  2J7Q B;  4BKS A;  4DHZ E;  2UYZ B;  4HDO A;  4IM2 A;  4LJP B;  4FJZ A;  3JSV B;  3UQA A;  1KLV A;  4GN1 A;  2KVR A;  4BOZ B;  3ZNG C;  3DBR I;  3QA8 A;  3LJ3 A;  4PS7 A;  4IG7 B;  3RD2 A;  3L0W B;  4GOC A;  2KMA A;  3HHM A;  5L83 A;  4WQO B;  2KK8 A;  3PLV A;  1UGM A;  2N1V A;  2NR2 A;  4HPL B;  3M3J A;  1WGY A;  1Q5W B;  4PYU A;  1I42 A;  2N7E A;  2O6V D;  3PRE A;  1EF5 A;  1S3S G;  4EUT A;  2KFK B;  3AXC A;  3DPD A;  1GC7 A;  3K9O B;  4ZYN A;  5KHQ A;  5CHF A;  3PLU A;  4GXB A;  1WJ6 A;  2DEN B;  2CS4 A;  1OTR B;  4LCD E;  2MWS B;  3QC8 B;  4MM3 A;  3ZNZ B;  4FLH A;  3AU5 A;  4DXA B;  2AEH A;  5CX3 A;  2FCN A;  1WXA A;  3I3T B;  4IM3 A;  2KQS A;  3VQI A;  1C3T A;  4ANV A;  4OVU A;  2KN5 A;  2PEA A;  2G3Q B;  4GGQ A;  2NPT B;  3C0R B;  4XZ4 A;  3X0W A;  3DOW A;  3AI5 A;  2GBK A;  2MRP A;  3H6N A;  4WJN A;  4DDG D;  3QCA A;  1YJ1 A;  3JVZ X;  4M8N A;  5C23 A;  3BY4 B;  3WA0 A;  1Z2M A;  2DAF A;  3NZS A;  4II2 B;  3MHS D;  3ZRC A;  3SU8 X;  3M95 A;  4AUQ C;  4ZDV A;  3RUL A;  3QK0 A;  5EDS A;  2IO3 B;  2JXX A;  4MGY E;  3NY5 A;  3TIX A;  4II3 B;  1WX9 A;  1LM8 B;  1WGH A;  2IO1 B;  3A9J A;  2B3A A;  1EF1 A;  2KXJ A;  2KDI A;  4W9D A;  4DHJ B;  4EZJ A;  3A9J B;  3MTN B;  1SE9 A;  1WZ3 A;  4GDL B;  3W1S A;  4TKN A;  2WX1 A;  3N30 A;  2C5L C;  2L0F A;  2XK5 B;  1YX5 B;  4FHK A;  4NQL B;  1OEY J;  1LQB A;  3A9K A;  3Q3J A;  3B1L X;  3VTV A;  3EEC A;  5C1Z A;  3QAQ A;  4MSM B;  2JRI B;  4DDI D;  2N9E B;  3A4S C;  2CHZ A;  4J6I A;  4HPM B;  4MEM A;  2O6V B;  2DYO A;  2V4L A;  1M94 A;  4MH0 E;  2L8J A;  3CST A;  4K1R B;  4BKS D;  2FNJ B;  2R2O A;  1WE6 A;  1JRU A;  2ZJD A;  4K7U A;  5AZF A;  4AP4 C;  2MA9 B;  4TUU A;  1WXV A;  3PSE B;  5J18 A;  2KTF A;  3OJ3 A;  4WJO A;  2GBN A;  3ALB A;  4G50 A;  2KC2 A;  2JUO A;  2KO3 A;  2JVC A;  2DZK A;  2JRH A;  2MLB A;  3OJ4 B;  2BKR B;  4B95 A;  3DVG X;  4EZK A;  3UGB B;  3SD5 A;  2I1K A;  2MP2 A;  4KIK B;  3JYU A;  5D2M B;  1ZGU B;  1WH3 A;  2M17 A;  4B6W A;  2MBH A;  4IWO A;  4GDK A;  2MP2 B;  2XEW A;  4MJS A;  1RRB A;  5GMV A;  2GOW A;  4F8C B;  2REX A;  3ZVV A;  2KAN A;  4MSQ B;  3U7D A;  3KUD B;  3Q3F A;  2RGF A;  4MJS B;  3VVW B;  4WJP A;  1NDD A;  4JQW C;  4KSK C;  2IY1 B;  2L3Z A;  1XT9 B;  1RLF A;  1WRD B;  4RM9 A;  1SGH A;  1T0Y A;  3ZNI D;  4NQK E;  2BYE A;  4WWO A;  3R3M A;  3VH4 B;  1TTN A;  3R7Q A;  2LUE A;  2N7D A;  3RZF A;  4DK5 A;  4CHK A;  1GNU A;  2KWV B;  2L05 A;  3L13 A;  4LDT D;  5AZH A;  4GU2 A;  4W9L A;  3V60 A;  1WM3 A;  3A1Q A;  2FIF A;  2KQ7 A;  1NI2 A;  2M4N A;  3H7P B;  4KDL B;  4RMA A;  5D6J B;  4ANX A;  2LVQ A;  4I6N B;  5IAA C;  2ZPN A;  4AJY B;  2RD0 A;  3A33 B;  4NJ7 A;  4FAD A;  4WJQ A;  2C7M B;  1WJU A;  1WXS A;  4XX5 A;  4YL8 A;  2IBI B;  2Z59 B;  3ZUN A;  3VXW A;  1I35 A;  3ML9 A;  1J8C A;  1Q1O A;  2KD0 A;  5DCN A;  4ZRK A;  2KJR A;  2KLC A;  4NJ6 A;  4NNJ B;  3R7R A;  5L95 C;  1GJZ A;  2QHO A;  5KHO A;  2AYO B;  3KUC B;  5J17 A;  2K1F A;  2ZZP B;  3IHP C;  4IW0 A;  2DAJ A;  1WGD A;  3VAW A;  2DZJ A;  4BKT A;  3PS6 A;  1Z5S B;  1WR6 E;  2J0K A;  3DVN U;  1WFY A;  1V86 A;  2J0J A;  3KVF B;  1V2Y A;  2MBE A;  1WIA A;  5D7G A;  3IFW B;  3WAL A;  2CR5 A;  3DVN V;  2ZEQ A;  2PE6 B;  4NAW A;  2M1M A;  1L2N A;  2L00 B;  2RSU A;  3T9L A;  2C9W B;  3L16 A;  2KWU B;  1PQS A;  3B08 A;  2KTR A;  3ZIM A;  2K25 A;  3IVF A;  4F7Z A;  2JZZ A;  2MBQ A;  2C7H A;  2L76 A;  3PTF C;  3WAO A;  1YX6 B;  2K8H A;  2PJH A;  3B0A A;  2JT4 B;  3ZLZ A;  4BOS C;  5CHW A;  4N9F 4;  1KJT A;  4EZL A;  1UEL A;  4W9C A;  4M8M A;  3P2B A;  3OAW A;  4GMV A;  3TJP A;  2KX3 A;  3BIN A;  3ZKJ C;  2HJ8 A;  2DHZ A;  1WMH A;  3TBL D;  2NBU A;  2G45 B;  2NS5 A;  3PT2 B;  3PRM B;  4IWQ A;  4E71 A;  1TZ1 A;  3PV1 A;  3QQ8 B;  4LDT B;  2IY0 B;  1V49 A;  1XD3 B;  2Z0D B;  2HE7 A;  4GSW A;  2MBO A;  3DCG A;  1V81 A;  3UQB A;  1WM2 A;  1V5T A;  1KM7 A;  5FR6 A;  4EEW A;  5CTR C;  2LVO A;  2W9N A;  3RCZ A;  4DWF A;  2IO2 B;  3L08 A;  4CYE A;  2BWE S;  3PPA A;  5JH5 C;  4WWP A;  2LXA A;  1IYF A;  2ZVN A; 
#chains in the Genus database with same CATH topology
 2DLB A;  1NI3 A;  4W9H A;  1YIW A;  1KLG D;  2BT6 A;  4WQM A;  2BS2 B;  3SHQ A;  3V61 A;  3NVZ A;  3ECI A;  2CU1 A;  2NBW B;  3V6E B;  4RM8 A;  1D3Z A;  3GZN I;  3UIP B;  3MHZ A;  4WAF A;  1C1Y B;  1MFW A;  3IT4 B;  1UZX B;  1CQV A;  1YQB A;  2ZPY A;  2K6Q A;  3RYT A;  4G0N B;  2IZV B;  2N7J A;  1NBF C;  5LLI A;  2LWP A;  3NVW A;  3PZD A;  3DWM A;  2Y5B B;  2WU5 B;  2DNF A;  4HCP B;  4I6L B;  2ONQ A;  5BYQ A;  1AWD A;  3AUL A;  4I6P A;  2MW5 A;  1UGJ A;  2KJH B;  2J0M A;  2WXK A;  1QIL A;  2NCN A;  3U4E G;  5HHD G;  1CMX B;  2KMC A;  1E5W A;  3TL5 A;  3RZW C;  2KQ4 X;  1K53 A;  2D2Q A;  1I4H A;  2WGS A;  3DVG Y;  1TKY A;  5TR5 A;  2L52 A;  2BYV E;  4YWG G;  4E3C A;  1VDV A;  4HJG E;  1E7U A;  2DZI A;  1EUV B;  2KDE B;  4XYC A;  2Y3A A;  3AEF B;  1TGZ B;  4URK A;  1PUT A;  3RUI B;  1JWU D;  1AAR A;  1M4V A;  4W9E A;  3RFZ B;  5EE0 A;  5DPT A;  5BMH A;  1AYF A;  1WJ4 A;  2GB1 A;  1TS2 A;  1X1M A;  1VCB A;  4HLE A;  1R4N B;  2CJO A;  1L6U A;  1F77 A;  1XO3 A;  3OWE B;  2D07 B;  3GP7 A;  2BWF A;  4GLS C;  2LFI A;  3TUO A;  4F1S A;  4CQN A;  2B76 B;  1SBB B;  1GB4 A;  1RFA A;  1MVK A;  1YN5 A;  1ZE3 D;  2HTH A;  3QAR A;  4GB9 A;  4GIV A;  2WS3 B;  1C76 A;  1FXA A;  1E6E B;  3IT6 B;  1R4M I;  4JLC A;  1WXM A;  2AQ1 B;  1V80 A;  4FJV B;  1E8Y A;  5D94 A;  1V97 A;  4FA6 A;  3QWZ B;  1L0V B;  1F2R I;  4GDL A;  1L0X B;  5AUI A;  2KOX A;  4RCO A;  1QOG A;  4B9K A;  4MGK E;  3TEW A;  1D6E C;  2LXC A;  4B0M A;  3L4P A;  2KFJ A;  4KGR A;  2WX0 A;  2L0T A;  2O6V A;  1L6V A;  1H4R A;  1ZPS A;  3W1Y A;  1QLB B;  3B2G A;  4HK2 A;  3PVL A;  1IGD A;  5E6J A;  2MEK A;  2XBB C;  3DBH I;  1SE2 A;  1UH6 A;  2I1J A;  4ZOH C;  3PRP B;  3ZTD A;  3BII D;  2LVP A;  3SDL C;  3DDC B;  5AEK B;  1ZUD 2;  4FUL A;  1S1Q B;  4G3X B;  3FIL A;  3K9P B;  4ITK A;  1TZO A;  1IBX A;  3LYY A;  2CKH B;  2AX5 A;  4XDD A;  1FXT B;  3TCA A;  3N1Z C;  2K39 A;  3N1X C;  1SIF A;  1LFD A;  4W9I A;  2KWD A;  5JXV A;  4PK1 A;  4ICU A;  1EO6 A;  1P0R A;  4KVG B;  1UWX A;  2LRW A;  4J3O D;  2N9P C;  2R2Q A;  1YMH E;  2DYM A;  3DHH C;  1BUI C;  4IM0 A;  4TQ0 A;  3HK0 A;  3UF8 A;  3WAN A;  1FRD A;  4DHJ D;  1SE4 A;  2BGF A;  2J7Q B;  4BKS A;  2K0P A;  3VRB B;  4GN1 A;  3LJ3 A;  3ZXV A;  1D4B A;  2KK8 A;  1UGM A;  2J4X A;  2UU7 A;  4ARC A;  2PMV A;  3PRE A;  1E0Z A;  1EF5 A;  4DXG A;  3RNA C;  2ACZ B;  1C77 A;  4LCD E;  3QC8 B;  3AU5 A;  1K51 A;  5CX3 A;  2FCN A;  3NJT A;  4NAM A;  4IM3 A;  1C3T A;  2KN5 A;  2PEA A;  2G3Q B;  3X0W A;  3C0R B;  3HUI A;  2MJ3 A;  3H6N A;  3QCA A;  1CZP A;  1SB3 C;  1PGA A;  4M8N A;  2K22 A;  3AEB B;  4II2 B;  3MHS D;  3ZRC A;  3QK0 A;  3NY5 A;  1OQQ A;  3A9J A;  4M02 A;  4PT5 A;  2B3A A;  2KXJ A;  1FFU A;  4DHJ B;  1T6B X;  3W5U B;  1ZXI A;  1MG4 A;  2X8X X;  1YN4 A;  3A9K A;  4YTP B;  2N9E B;  2IND C;  1DOI A;  1DOY A;  1C78 A;  4K1R B;  2R2O A;  3AE7 B;  1WE6 A;  2ZJD A;  2QEJ C;  4AP4 C;  4TUU A;  1WXV A;  5J18 A;  3OJ3 A;  3P42 A;  3ALB A;  4G50 A;  2J52 A;  2KO3 A;  2JRH A;  2MLB A;  1V1P B;  3MP9 A;  2HJ1 A;  2BKR B;  3UGB B;  4OHJ A;  2QSD A;  2I1K A;  3SD5 A;  4KIK B;  4K3B A;  1FNV A;  4H2A A;  3JYU A;  2OHF A;  1ZGU B;  1WH3 A;  2M17 A;  5HG2 A;  2M0A A;  4YSX B;  2MP2 B;  4MJS A;  1N5W A;  1C4P A;  2REX A;  3ZVV A;  1AN8 A;  3U7D A;  3Q3F A;  2RGF A;  2CU3 A;  4WJP A;  4KSK C;  2ZW0 A;  5EE9 A;  4RM9 A;  2KAJ A;  4WWO A;  3W5V B;  2KWV B;  1ET6 A;  4GU2 A;  4W9L A;  1YJI A;  4KDL B;  2FIF A;  1FEH A;  4RMA A;  2JU6 X;  4AJY B;  2RD0 A;  4NJ7 A;  3W2D A;  1WJU A;  4XX5 A;  4YL8 A;  1XLO A;  1I35 A;  1ROE A;  1XLQ A;  2KLC A;  1WWT A;  5KHO A;  1SEB D;  1TY0 A;  1KLU D;  3KUC B;  5J17 A;  2K1F A;  4IW0 A;  2DAJ A;  1XCT L;  2D5G A;  2QIE B;  4BKT A;  1Z5S B;  2JQR B;  3FC4 A;  1V86 A;  1SJH D;  2M19 A;  3AB5 A;  2ZEQ A;  1V1O A;  2M1M A;  1WRI A;  3Q2A C;  2RSU A;  3NG0 A;  2C9W B;  4MAC A;  1PQS A;  4F7Z A;  2JZZ A;  2MHJ A;  2K8H A;  3B0A A;  1L5P A;  5EE1 A;  3OAW A;  4GMV A;  3TJP A;  2KX3 A;  1ET9 A;  3BVM A;  1PYW D;  2HJ8 A;  2NBU A;  2G45 B;  3PT2 B;  4EE2 A;  1TZ1 A;  4M0W A;  2D3B A;  4JE3 B;  1V49 A;  1XD3 B;  1QOF A;  2Z0D B;  3MJ5 A;  3RI7 C;  3GS2 A;  1V81 A;  1UF0 A;  1T0S C;  3UQB A;  1WM2 A;  1V5T A;  1KM7 A;  2EKI A;  4RGO S;  5CTR C;  2W9N A;  3L08 A;  1UUP A;  2BWE S;  3PPA A;  4WWP A;  2BYT A;  2JWU A;  2MH7 A;  2DYB A;  4O1N A;  5HKH A;  1HA5 A;  2WXI A;  4JPS A;  1UWM A;  2WU2 B;  1R7S A;  3RT3 B;  2WXN A;  1VD2 A;  3CIR B;  1UBQ A;  3TEY A;  1J0G A;  3DBL I;  2L83 A;  2MBB B;  4ICV A;  1PGX A;  1GG3 A;  1KF6 B;  3EFU A;  4BFR A;  3U8Z A;  1E8W A;  1YD8 U;  2W54 A;  1ENF A;  2KYW A;  4A6Q A;  5I4D A;  2INC C;  2KKC A;  1QZE A;  2A5U A;  4ANU A;  2D3G A;  4FBJ B;  4KDI C;  1DYQ A;  1D5Z C;  2ZNV C;  2INP E;  3CWI A;  2LGX A;  4MEL A;  4BKG A;  3EGR A;  3ZW3 A;  2ZCC A;  3H8H A;  3MC0 B;  1E7P B;  3D32 A;  3WCQ A;  4AJW A;  1WR1 A;  2R61 A;  2PLP A;  5LXH A;  2ICI A;  1TBE A;  3DQV A;  5JHB A;  2K5P A;  3V62 A;  2JSV X;  4FN2 A;  5AZG A;  4K7S A;  4AQ7 A;  2PPH A;  2JWZ A;  3R2I A;  4US8 A;  2PIA A;  2PVO D;  1OGW A;  1VZ8 A;  2FCQ A;  5DPR A;  1YQ3 B;  3JSV A;  3I5J C;  3KH0 A;  1BT0 A;  2FCM A;  2L7R A;  3IBE A;  3HM6 X;  3I9V 1;  2MQJ A;  4C00 A;  2QC8 A;  1BXT A;  1T5X D;  3P63 A;  4HRO A;  4MT5 A;  2KFK A;  2G4S A;  1FNW A;  2BS3 B;  2MX2 A;  4IC7 B;  4L2Y A;  4M00 A;  3M63 B;  3LDZ E;  2IGG A;  4R3D A;  1YJJ A;  3JW0 X;  1QKZ A;  3N20 C;  2I2Y A;  1WMH B;  4KX6 B;  3T8M A;  2CHW A;  1E8Z A;  1GOZ A;  1JML A;  4A3P A;  3NRZ A;  1TT5 B;  3APF A;  2ZCB A;  3BZD B;  1KRH A;  3W9C B;  2K8B A;  2KZR A;  3IAS 1;  3TEX A;  3M62 B;  4AOF A;  1E90 A;  5LXI B;  4NZL B;  3PRZ A;  3Q3M C;  4RF0 A;  1CK1 A;  3WAP A;  2WDT B;  1P9D U;  4KKJ A;  4IWP A;  4NY0 A;  5G2N A;  2AL6 A;  3L54 A;  2AQ3 B;  1R4M B;  1HE8 A;  3U2S C;  2V9H A;  1K8R B;  2N4F A;  3QIJ A;  4K7W A;  4US9 A;  2W82 A;  1LO5 D;  1NVI D;  3MJW A;  4A55 A;  1Q10 A;  2MCN B;  4NJC A;  2V1Y A;  4TQ1 A;  1WJN A;  4YSY B;  2G9H D;  4FJY A;  1ZDX A;  3DWG C;  1WF9 A;  3UIO B;  1F52 A;  2D11 A;  1TS3 A;  5GXG B;  4C80 A;  3QX1 A;  1FXI A;  5BO4 B;  1OQY A;  4HVB A;  3NZU A;  2PE9 A;  1J19 A;  3IXS A;  2NVU I;  2BBC A;  3VUX A;  2AL3 A;  2LEK A;  1RM6 C;  1XEE A;  1WGR A;  2GBR A;  3IG3 A;  3DBH B;  1P3Q U;  4LK0 M;  3NVV A;  2JF5 A;  1V9J A;  2PVG C;  2M0X A;  3CF6 E;  1JCK B;  4DHZ B;  4X57 B;  2IO0 B;  3FAH A;  2JY6 A;  2GMI C;  3PHW B;  4DBG A;  1PFD A;  3AMZ A;  2WDR B;  2J53 A;  3ZQ4 A;  2KC1 A;  2V3N A;  3UQA A;  4FJZ A;  2LMC A;  3DBR I;  4PS7 A;  4GOC A;  2L32 A;  2W3S A;  4KKI A;  3VR8 B;  4PYU A;  4EUT A;  1L0Y B;  2D3C A;  5BYS A;  2ON8 A;  5CHF A;  2X38 A;  1WJ6 A;  2XNA C;  2FE8 A;  2CS4 A;  3ZNZ B;  1TY2 A;  3I3T B;  3VQI A;  4N59 A;  2NPT B;  4XZ4 A;  2MRP A;  4RGM A;  1YJ1 A;  2OJW A;  2VZK D;  4RNA A;  1Z2M A;  3AE8 B;  3M95 A;  1QOA A;  3RUL A;  3TIX A;  1FIQ A;  1WGH A;  4BAX A;  1EF1 A;  4ARI A;  4W9D A;  3A9J B;  1WZ3 A;  3MFG A;  1ZDV A;  2C5L C;  2JZP A;  2L0F A;  2XK5 B;  1P7E A;  4FHK A;  1LQB A;  3Q3J A;  5C1Z A;  3EEC A;  3RNE C;  2JRI B;  1NYR A;  5IKC M;  4J6I A;  4MEM A;  5BMI A;  2DYO A;  1M94 A;  1J7B A;  1T0R C;  2WXM A;  3TSS A;  4K3C A;  2GBN A;  2WDQ B;  4LLG M;  2DZK A;  3OJ4 B;  2KAC A;  4WWM A;  4B95 A;  3DVG X;  1ZP0 B;  2INN E;  2MBH A;  2VZK B;  5AUK A;  2WXR A;  3R8B A;  3VVW B;  3KUD B;  4MJS B;  1IGC A;  4USA A;  1XT9 B;  3KWV A;  4A8X C;  1F0Z A;  4OZB A;  4C4V B;  1SGH A;  1T0Y A;  1GPX A;  4JWU C;  4NQK E;  1TTN A;  3R7Q A;  4DK5 A;  3RZF A;  3L13 A;  5AZH A;  3P4P B;  3H7P B;  1SE3 A;  4ANX A;  4I6N B;  3A33 B;  1AW7 A;  4WJQ A;  4LNI A;  1I7H A;  2IBI B;  1DOX A;  1J8C A;  2KD0 A;  2KJR A;  1SSN A;  1FD6 A;  3R7R A;  5L95 C;  2QHO A;  3V3X A;  2AYO B;  1N61 A;  3BK2 A;  2E6X A;  3SFE B;  2ZZP B;  1B1Z A;  2CJN A;  2DZJ A;  1KTK A;  3PS6 A;  1WFY A;  3KVF B;  2MBE A;  1JW9 D;  2JYE A;  5D7G A;  3IFW B;  2J42 A;  3DVN V;  2GLS A;  3T9L A;  1I4Q A;  1OQR A;  1C4C A;  2LJI A;  4MM3 B;  1MHH E;  3IVF A;  3PTF C;  1WYG A;  4BOS C;  5CHW A;  1UEL A;  5D3I B;  4ZRQ A;  1I4X A;  2W3R A;  3ZKJ C;  3I57 A;  2N9L A;  1L4Z B;  2QCZ A;  4E71 A;  1SXT A;  3PV1 A;  1FRR A;  4M01 A;  3URY A;  2HE7 A;  3DCG A;  3AE3 B;  4EEW A;  2LVO A;  4DWF A;  3KWL A;  1C9F A;  2LXA A;  3BYT B;  4S0R A;  4E74 A;  4FHJ A;  3DHI C;  4KSL C;  2KDB A;  3PHX B;  4IUM B;  3ZXR A;  1UNS A;  3AE9 B;  5LNK 1;  1IP9 A;  1JWM D;  3X23 A;  1WXQ A;  1YQ4 B;  3E56 A;  1V6E A;  3QJZ A;  5IN7 A;  3KYC D;  1ZKH A;  3VUY A;  2ZVO A;  2QMT A;  2G4D B;  2WHI A;  2GBJ A;  2WWZ A;  1FFV A;  2D10 A;  2DZM A;  4GDK B;  2V3S A;  3KW5 B;  1N62 A;  4MGI E;  1WGG A;  3AEE B;  4HPP A;  2BB5 A;  2OOB B;  4WIP A;  2KNB A;  4YT0 B;  5E6O A;  3UIN B;  3RNG C;  5C3J B;  3VH3 B;  3DBL B;  5BYR A;  2YLM A;  2JPH A;  3APC A;  1EU3 A;  1VZ6 A;  3R66 C;  1TIF A;  3H1U A;  2WYQ A;  4CO7 A;  3A1Q B;  4KZC A;  2O2V A;  2IYD B;  3VUW A;  2WXH A;  5JZE B;  2LRU A;  4G11 A;  3VTU A;  1GUA B;  1ZOY B;  3RNF C;  4ZYS A;  4AWJ A;  3GB1 A;  5JHA A;  5DPS A;  2FBW B;  4TMA B;  1JRP A;  3U30 A;  3V05 A;  1EU4 A;  4ZRP A;  2LGD A;  1A5R A;  4MGZ E;  5H8Y E;  2BPS A;  4W9K A;  4WWN A;  2UWQ A;  5MPO A;  3H9D A;  2IJ0 A;  2WP9 B;  2H89 B;  2EMS A;  1E9M A;  3OG5 A;  2PW9 A;  3TEZ A;  4NAW B;  1XQQ A;  3CSF A;  2A4Z A;  3AH7 A;  3L10 B;  2KTR B;  4C7Y A;  3WAM A;  1WY8 A;  4K81 A;  4LNK A;  1I4P A;  2ZNV B;  1WX7 A;  2FUH B;  2BVC A;  2GBM A;  2DBY A;  4WAA A;  3ML8 A;  4KZ0 A;  5G55 A;  4LJO B;  3Q8F A;  5T8I A;  1WZ0 A;  1RWS A;  4TV3 A;  3EA6 A;  2FCS A;  3P4S B;  3AED B;  1SIJ A;  2JZ3 B;  2Y5P A;  1STE A;  3QHT A;  1TS4 A;  1VR9 A;  1F9J A;  2OJR A;  4HKZ E;  3LB8 C;  3S2A A;  2JYT A;  4LNN A;  4HEA 1;  1FNU A;  3AEC B;  2IGH A;  4ZRJ A;  2BKF A;  2LHE A;  4DQO C;  1WI0 A;  2N1W A;  2KX0 A;  3AV8 A;  1WYW B;  4HWI B;  4QAY A;  2BTE A;  2KDF B;  2WXQ A;  1Y8R C;  2N9X A;  2LGI A;  3VHT C;  3O13 A;  4JIO U;  1QQR A;  3ZRF A;  4ANW A;  2TSS A;  3SR6 A;  2NTS A;  1ACC A;  2CHX A;  1LXD A;  1JQ4 A;  2LZ6 A;  3AM9 A;  4HCN B;  1V1P A;  4XWT A;  3TMP B;  2GRI A;  4JL9 A;  4KIK A;  4ZRI A;  3ZTC A;  1HTO A;  4LTU A;  4HKQ A;  3HRD D;  1J7C A;  2WXF A;  3AE5 B;  3GOE A;  4MDK E;  1C4A A;  1MG8 A;  3AE6 B;  2KJ6 A;  1N60 A;  1XXG A;  2LJ5 A;  2ZW1 A;  5G5H A;  3VDZ A;  1JWB D;  1TKG A;  4YXD B;  1RAX A;  1GC6 A;  5J2R A;  3GE3 C;  4OW0 A;  4OZC A;  2IGD A;  4W9G A;  1RFK A;  2KWC A;  3LXF A;  1VRA B;  1P98 A;  1SJE D;  2VRR B;  1UBI A;  3P1M A;  4NPN A;  1P1A A;  3KQ4 A;  3Q3O C;  2AWT A;  3W1S C;  4DHZ E;  1SF0 A;  4HDO A;  1KLV A;  2KVR A;  4IG7 B;  3RD2 A;  3L0W B;  2KMA A;  4RH6 A;  3HHM A;  3PLV A;  1WSP A;  2NR2 A;  4HPL B;  3M3J A;  1WGY A;  1Q5W B;  1I42 A;  2O6V D;  1MPE A;  3DPD A;  3Q8C A;  3C19 A;  2QDF A;  1KH0 A;  3K9O B;  4ZYN A;  3ZJU A;  2WNM A;  4GXB A;  2DEN B;  1OTR B;  4C56 C;  1OFF A;  2MWS B;  1GAQ B;  4FLH A;  4DXA B;  5IO9 A;  2WXO A;  1WXA A;  2KQS A;  4XWW A;  3B9J A;  4ANV A;  4OVU A;  2MJD A;  2GBK A;  2GI9 A;  4WJN A;  4DDG D;  1P7F A;  3DBR B;  4YTN B;  3BY4 B;  3MC8 A;  3WA0 A;  3P4Q B;  3ZYY X;  2DAF A;  3NZS A;  3SU8 X;  4ZDV A;  2IO3 B;  2JXX A;  4II3 B;  1NYQ A;  1LM8 B;  2IO1 B;  1XLN A;  3NUH B;  2YEP B;  4EZJ A;  3MTN B;  4GDL B;  3W1S A;  4TKN A;  3N30 A;  4MH8 A;  1YX5 B;  4NQL B;  1OEY J;  4MSM B;  4DDI D;  3A4S C;  1ESF A;  2O6V B;  3Q14 C;  3T3N A;  2V4L A;  4MH0 E;  2KMM A;  3CST A;  4BKS D;  2FNJ B;  1D5X C;  1XCQ L;  4UDU C;  1A70 A;  4K7U A;  1FO4 A;  3PSE B;  5H92 C;  2KTF A;  2KC2 A;  2JUO A;  2JVC A;  2M56 B;  1FCL A;  4XGA B;  2WQY B;  1JWS D;  4IWO A;  3FIL B;  2XEW A;  3ZJT A;  2GOW A;  2V3P A;  1IBX B;  4P1C C;  1N63 A;  2KT7 A;  1NDD A;  4JQW C;  2IY1 B;  2L3Z A;  2I38 A;  4B0E A;  3NZ3 A;  1WRD B;  1YNT E;  2BYE A;  3VH4 B;  1FCC C;  4CHK A;  1GNU A;  2L05 A;  1QT9 A;  2Q5W D;  2H88 B;  3V60 A;  1WM3 A;  3BVZ A;  2KQ7 A;  1NI2 A;  5D6J B;  2QJL A;  2LVQ A;  2ZPN A;  1HEZ E;  2C7M B;  2RDH A;  2Z59 B;  3ZUN A;  3VXW A;  3ML9 A;  3RNC C;  4NJ6 A;  2G1E A;  4P6V F;  1GJZ A;  5G5G A;  3IHP C;  4FXC A;  2J0J A;  1V2Y A;  4DXF A;  2CR5 A;  2K3U A;  1HQR D;  1L2N A;  4WUR A;  2L00 B;  4A90 A;  2KWU B;  3ZIM A;  2K25 A;  2C7H A;  2L76 A;  3WAO A;  1YX6 B;  2JT4 B;  2QIL A;  3P4R B;  3ZLZ A;  4EZL A;  1KJT A;  2FUG 1;  1FPY A;  4W9C A;  4M8M A;  1IUE A;  2WXL A;  3P2B A;  1F2R C;  3Q3N C;  1WMH A;  4RFB A;  3PRM B;  4IWQ A;  1WGK A;  3QQ8 B;  5HFY A;  2IY0 B;  2NTT A;  4GSW A;  2MBO A;  3AEA B;  1LGR A;  2L1A A;  1JAL A;  3RCZ A;  1B9R A;  2IO2 B;  2XN9 C;  1TS5 A;  1WE7 A;  4HXD A;  4BBN F;  3A9K B;  1MHX A;  4P7I A;  2EKE C;  2SAK A;  1T0Q C;  4P16 A;  2LGY A;  2Z0E B;  4L23 A;  3ZJV A;  2M8S A;  3SFD B;  1KOT A;  2V0G A;  2N0S B;  5IOI A;  4OVV A;  1F1H A;  3RPF C;  1K50 A;  4KGS A;  1JRO A;  3Q69 A;  1U4A A;  4REZ A;  3WIM A;  1H8C A;  3U7Z A;  3IAM 1;  3OLM D;  3BVG A;  3ZDT A;  1UD7 A;  3RNB C;  3EC8 A;  4ASW C;  3NOB A;  3ONS A;  3C8Y A;  5D3D A;  1R4N I;  2VH1 A;  5FK9 C;  1TYG B;  1NEN B;  3J9C A;  5FKA C;  4ZHO A;  3NS8 A;  3AE2 B;  3PZ7 A;  3VTW A;  2YVC A;  3HVZ A;  5CHV C;  1EWY C;  2D3A A;  4EOY A;  3I63 C;  3Q8A A;  3NS1 A;  1QOB A;  3AU4 A;  2O2V B;  2BF8 B;  3L17 A;  2MSE D;  4WH4 A;  1IPG A;  1CJE A;  3VFK A;  1L7Y A;  4IOI E;  2WXJ A;  2K6D B;  2FAZ A;  1VLB A;  3ABV B;  2E3T A;  3SEB A;  4EFO A;  5E6P A;  2RPQ A;  3UI3 A;  1E7V A;  4XC2 A;  4HDQ A;  2V4I B;  3ZO5 B;  2KLG A;  1Y56 A;  1XLP A;  4S17 A;  1PGB A;  2C7N B;  4OVZ A;  3Q8B A;  2KHW B;  3DBS A;  1FMA D;  3HM3 A;  1G6J A;  4XE0 A;  2LD9 A;  3FKY A;  1N6Z A;  2NPT A;  2ASQ A;  1RYJ A;  4LNF A;  4RGN A;  1E10 A;  4JGH B;  4W9J A;  3PO0 A;  1VJK A;  1ZW7 A;  5E6N A;  4C7Z A;  1V8C A;  4M0W B;  1WX8 A;  3AE4 B;  2Z8L A;  3VR9 B;  5DPW A;  1QF6 A;  2AQ2 B;  1N5X A;  2DX5 B;  3PGE A;  4HJK A;  3EHV A;  3O65 B;  4RGT A;  4KV2 A;  3A4R A;  2HDE A;  4N58 A;  1BML C;  2LAS A;  4JX1 C;  2XK5 A;  3V6C B;  3CMM B;  4A20 A;  2RPV A;  3R2T A;  3ETR A;  3ENE A;  2NBV B;  1E8X A;  2BW2 A;  4BVU C;  2KVZ A;  1PDX A;  4EKU A;  3HIZ A;  4PYZ A;  4IDI A;  2RR9 A;  3N32 A;  4PS3 A;  1D5M C;  2BYF A;  3Q6B A;  3AEG B;  3APD A;  4BBN C;  4KGT A;  2RDB C;  3ZNH B;  1HZ6 A;  2EEL A;  3KYD D;  2EMT A;  3NHE B;  3ZDM C;  5EE3 A;  1V5O A;  2KDM A;  3BYY B;  4W9F A;  4C4V A;  4PS8 A;  1T3Q A;  1OEY A;  3H7S A;  2K8C A;  2K9X A;  1JWA D;  1Q0W B;  3H7P A;  2LI5 A;  4JWS C;  2HD5 B;  2KN4 A;  4A3O A;  3KUZ A;  2FID A;  3BWU D;  1K52 A;  4N6E B;  3N3K B;  1ISN A;  5IA7 A;  3RN9 C;  2C60 A;  2UYZ B;  4IM2 A;  4LJP B;  3JSV B;  4BOZ B;  1YOV B;  3ZNG C;  3QA8 A;  2WDV B;  5L83 A;  4WQO B;  2LUM A;  4YSZ B;  2N1V A;  3RMK C;  2N7E A;  1HXY D;  1S3S G;  5IP4 D;  2KFK B;  3AXC A;  1GC7 A;  1HTQ A;  5KHQ A;  3PLU A;  1C79 A;  3AN1 A;  4MM3 A;  3N1Y C;  3E9S A;  2AEH A;  4A9A A;  4ACF A;  2RDG A;  4GGQ A;  3DOW A;  2SEB D;  3EFC A;  3AI5 A;  3AE1 B;  1YN3 A;  1MJD A;  2WLB A;  3JVZ X;  5C23 A;  4YTM B;  3VRA B;  4AUQ C;  5EDS A;  2MJE A;  4MGY E;  4OZA A;  3Q8E A;  1WX9 A;  4P1B C;  1EM7 A;  2PKO A;  2KDI A;  2N9K A;  1FM0 D;  1SE9 A;  2BS4 B;  2PTL A;  2WX1 A;  4TSS A;  3B1L X;  3VTV A;  3QAQ A;  2BB6 A;  2LGS A;  2CHZ A;  4HPM B;  4LNO A;  1ZXH A;  2L8J A;  3ZGZ A;  1JRU A;  1DGJ A;  2LHD A;  5AZF A;  2MA9 B;  4WJO A;  1TKE A;  2DWQ A;  4EZK A;  3T3O A;  2MP2 A;  3B2F A;  1TJE A;  1NEK B;  5D2M B;  4B6W A;  4GDK A;  2YEP F;  1RRB A;  5GMV A;  5TSS A;  4F8C B;  5FR3 A;  2KAN A;  4MSQ B;  1RLF A;  3EUB 2;  4ZHP A;  3ZNI D;  3GZN B;  4XDC A;  3R3M A;  5HI1 A;  2LUE A;  2N7D A;  4D2K A;  3GE8 C;  4LDT D;  1HZ5 A;  3KLS X;  4L1B A;  3A1Q A;  2M4N A;  4AS1 A;  2RMM A;  5IAA C;  3BK1 A;  4FAD A;  2OED A;  2WXG A;  1J7A A;  1WXS A;  3DHG C;  2IDY A;  3NVY A;  4IKG A;  1Q1O A;  5DCN A;  4ZRK A;  3N9Y C;  4NNJ B;  2VH2 A;  3HVD A;  4Q2J A;  1L4D B;  2BQQ A;  1WGD A;  1XF5 L;  3VAW A;  2JX5 A;  1WR6 E;  2J0K A;  3DVN U;  1EWC A;  3PZ8 A;  1WIA A;  3WAL A;  2PE6 B;  5C2T B;  4NAW A;  2IPK D;  2HTM E;  1GB1 A;  3L16 A;  3B08 A;  2KTR A;  4RF1 A;  2MBQ A;  2JXT A;  2PJH A;  4N9F 4;  1KFY B;  3BIN A;  1MI0 A;  2DHZ A;  4BZA A;  3TBL D;  2NS5 A;  2NMQ A;  2W55 A;  4LDT B;  2WXP A;  5BMG A;  1I4R A;  2Y5C A;  3MC9 A;  5FR6 A;  1I4G A;  4CYE A;  5JH5 C;  1VZ7 A;  4HRS A;  1IYF A;  2ZVN A;  3U52 E; 
#chains in the Genus database with same CATH homology
 2DYB A;  4E74 A;  1WE7 A;  4FHJ A;  5HKH A;  4HXD A;  4W9H A;  4BBN F;  4KSL C;  3A9K B;  1YIW A;  2KDB A;  3PHX B;  3RT3 B;  4P7I A;  4IUM B;  2EKE C;  3SHQ A;  3V61 A;  3ECI A;  2CU1 A;  1VD2 A;  2NBW B;  3V6E B;  4RM8 A;  1D3Z A;  3GZN I;  3UIP B;  1UBQ A;  2LGY A;  1J0G A;  3DBL I;  2MBB B;  2Z0E B;  1C1Y B;  3X23 A;  1IP9 A;  4ICV A;  1GG3 A;  2M8S A;  1KOT A;  1UZX B;  1YQB A;  1V6E A;  2ZPY A;  2K6Q A;  3RYT A;  3EFU A;  4G0N B;  2IZV B;  3QJZ A;  4BFR A;  4OVV A;  3KYC D;  1ZKH A;  1NBF C;  3U8Z A;  3VUY A;  2ZVO A;  1E8W A;  1YD8 U;  2LWP A;  5LLI A;  3PZD A;  2G4D B;  2GBJ A;  2Y5B B;  2WWZ A;  2D10 A;  2KKC A;  1QZE A;  4HCP B;  1U4A A;  2A5U A;  2DZM A;  4GDK B;  2D3G A;  4I6L B;  4ANU A;  4FBJ B;  4KDI C;  3WIM A;  2V3S A;  3AUL A;  3KW5 B;  4I6P A;  4MGI E;  1WGG A;  2MW5 A;  2KJH B;  1H8C A;  2ZNV C;  2OOB B;  2J0M A;  2KNB A;  2LGX A;  3OLM D;  5E6O A;  3UIN B;  4MEL A;  3ZDT A;  1UD7 A;  2NCN A;  4BKG A;  3ZW3 A;  2ZCC A;  3EC8 A;  1CMX B;  2KMC A;  3VH3 B;  1E5W A;  2YLM A;  3TL5 A;  3RZW C;  4ASW C;  2JPH A;  2D2Q A;  3NOB A;  3APC A;  3DVG Y;  3D32 A;  5TR5 A;  4AJW A;  1WR1 A;  3ONS A;  1R4N I;  3R66 C;  3H1U A;  2BYV E;  2WYQ A;  4CO7 A;  4E3C A;  5LXH A;  3NS8 A;  3A1Q B;  2KDE B;  1E7U A;  1EUV B;  2DZI A;  1TBE A;  2YVC A;  3VTW A;  4KZC A;  5CHV C;  2O2V A;  3DQV A;  5JHB A;  4EOY A;  2IYD B;  3V62 A;  3VUW A;  4FN2 A;  5JZE B;  2LRU A;  1TGZ B;  4K7S A;  3AU4 A;  4G11 A;  2O2V B;  5AZG A;  3VTU A;  2BF8 B;  1GUA B;  2PPH A;  3L17 A;  4URK A;  2MSE D;  1IPG A;  2JWZ A;  3RUI B;  1AAR A;  1OGW A;  4W9E A;  3VFK A;  4AWJ A;  1L7Y A;  5DPR A;  2FCQ A;  5DPT A;  3JSV A;  5JHA A;  3KH0 A;  1BT0 A;  2FCM A;  2K6D B;  2L7R A;  1WJ4 A;  5DPS A;  3U30 A;  2FAZ A;  1X1M A;  1VCB A;  2LGD A;  1A5R A;  3IBE A;  3HM6 X;  4MGZ E;  2BPS A;  2MQJ A;  4W9K A;  2UWQ A;  4WWN A;  4HLE A;  3H9D A;  2EMS A;  4EFO A;  5E6P A;  2RPQ A;  1E7V A;  2KFK A;  2G4S A;  4NAW B;  4XC2 A;  1XQQ A;  3CSF A;  4HDQ A;  3ZO5 B;  2A4Z A;  2D07 B;  2KLG A;  3L10 B;  2MX2 A;  2KTR B;  2BWF A;  4IC7 B;  3WAM A;  1WY8 A;  3M63 B;  2C7N B;  3LDZ E;  2KHW B;  3DBS A;  4K81 A;  3HM3 A;  4F1S A;  3JW0 X;  1G6J A;  2LD9 A;  2ZNV B;  2NPT A;  1WX7 A;  2ASQ A;  1RFA A;  1WMH B;  2FUH B;  3T8M A;  4JGH B;  2CHW A;  1E8Z A;  2GBM A;  4A3P A;  2HTH A;  4W9J A;  3QAR A;  4GB9 A;  1ZW7 A;  4WAA A;  3ML8 A;  5E6N A;  4GIV A;  4M0W B;  4KZ0 A;  1WX8 A;  5G55 A;  4LJO B;  3APF A;  2ZCB A;  5DPW A;  1R4M I;  1WZ0 A;  2K8B A;  4JLC A;  2KZR A;  4TV3 A;  1WXM A;  1V80 A;  2FCS A;  2DX5 B;  4FJV B;  1E8Y A;  3M62 B;  4AOF A;  3PGE A;  4HJK A;  3EHV A;  2JZ3 B;  3O65 B;  5D94 A;  1E90 A;  4KV2 A;  4FA6 A;  3QWZ B;  5LXI B;  3A4R A;  3QHT A;  3PRZ A;  1F9J A;  2OJR A;  4GDL A;  3WAP A;  2LAS A;  3S2A A;  2WDT B;  2KOX A;  2XK5 A;  1P9D U;  4B9K A;  4MGK E;  3V6C B;  3CMM B;  2BKF A;  4ZRJ A;  2LXC A;  4A20 A;  2KFJ A;  1WI0 A;  2N1W A;  2KX0 A;  2WX0 A;  1WYW B;  3ENE A;  2NBV B;  4IWP A;  4HWI B;  4NY0 A;  1E8X A;  2L0T A;  2O6V A;  5G2N A;  1H4R A;  2AL6 A;  4BVU C;  3L54 A;  3W1Y A;  4EKU A;  2KDF B;  3HIZ A;  4PYZ A;  1Y8R C;  1HE8 A;  2N9X A;  3VHT C;  4JIO U;  4HK2 A;  1K8R B;  2N4F A;  2RR9 A;  3N32 A;  3PVL A;  3QIJ A;  4K7W A;  4PS3 A;  3ZRF A;  4ANW A;  2XBB C;  3DBH I;  2BYF A;  2CHX A;  1LXD A;  1UH6 A;  2I1J A;  2LZ6 A;  3MJW A;  3PRP B;  4HCN B;  3APD A;  3ZTD A;  2LVP A;  2MCN B;  3TMP B;  2V1Y A;  3SDL C;  4JL9 A;  4TQ1 A;  3DDC B;  4KIK A;  1WJN A;  4BBN C;  4ZRI A;  3ZTC A;  5AEK B;  4FJY A;  1WF9 A;  4FUL A;  1S1Q B;  4G3X B;  3UIO B;  3K9P B;  2D11 A;  3ZNH B;  3GOE A;  4MDK E;  1MG8 A;  2KJ6 A;  3QX1 A;  2LJ5 A;  2CKH B;  3KYD D;  5BO4 B;  2EMT A;  1FXT B;  1OQY A;  3NHE B;  3ZDM C;  3TCA A;  3VDZ A;  1V5O A;  2K39 A;  4HVB A;  1SIF A;  3NZU A;  1LFD A;  2PE9 A;  4W9I A;  1J19 A;  4W9F A;  2NVU I;  1RAX A;  3VUX A;  4PS8 A;  4ICU A;  1EO6 A;  1GC6 A;  2AL3 A;  1P0R A;  1OEY A;  3H7S A;  5J2R A;  1WGR A;  2K8C A;  4KVG B;  2GBR A;  2LRW A;  3IG3 A;  1P3Q U;  1Q0W B;  4W9G A;  2JF5 A;  1V9J A;  2KWC A;  2N9P C;  3H7P A;  2LI5 A;  2M0X A;  3CF6 E;  1P98 A;  2VRR B;  2HD5 B;  2R2Q A;  4A3O A;  4DHZ B;  2DYM A;  4X57 B;  2IO0 B;  4IM0 A;  3KUZ A;  4TQ0 A;  2FID A;  2GMI C;  2JY6 A;  3HK0 A;  3PHW B;  3N3K B;  1ISN A;  1UBI A;  4NPN A;  3UF8 A;  1P1A A;  3WAN A;  4DBG A;  5IA7 A;  2AWT A;  4DHJ D;  3W1S C;  2KC1 A;  2BGF A;  2C60 A;  2J7Q B;  4BKS A;  4DHZ E;  2UYZ B;  4HDO A;  4IM2 A;  4LJP B;  4FJZ A;  3JSV B;  3UQA A;  1KLV A;  4GN1 A;  2KVR A;  4BOZ B;  3ZNG C;  3DBR I;  3QA8 A;  3LJ3 A;  4PS7 A;  4IG7 B;  3RD2 A;  3L0W B;  4GOC A;  2KMA A;  3HHM A;  5L83 A;  4WQO B;  2KK8 A;  3PLV A;  1UGM A;  2N1V A;  2NR2 A;  4HPL B;  3M3J A;  1WGY A;  1Q5W B;  4PYU A;  1I42 A;  2N7E A;  2O6V D;  3PRE A;  1EF5 A;  1S3S G;  4EUT A;  2KFK B;  3AXC A;  3DPD A;  1GC7 A;  3K9O B;  4ZYN A;  5KHQ A;  5CHF A;  3PLU A;  4GXB A;  1WJ6 A;  2DEN B;  2CS4 A;  1OTR B;  4LCD E;  2MWS B;  3QC8 B;  4MM3 A;  3ZNZ B;  4FLH A;  3AU5 A;  4DXA B;  2AEH A;  5CX3 A;  2FCN A;  1WXA A;  3I3T B;  4IM3 A;  2KQS A;  3VQI A;  1C3T A;  4ANV A;  4OVU A;  2KN5 A;  2PEA A;  2G3Q B;  4GGQ A;  2NPT B;  3C0R B;  4XZ4 A;  3X0W A;  3DOW A;  3AI5 A;  2GBK A;  2MRP A;  3H6N A;  4WJN A;  4DDG D;  3QCA A;  1YJ1 A;  3JVZ X;  4M8N A;  5C23 A;  3BY4 B;  3WA0 A;  1Z2M A;  2DAF A;  3NZS A;  4II2 B;  3MHS D;  3ZRC A;  3SU8 X;  3M95 A;  4AUQ C;  4ZDV A;  3RUL A;  3QK0 A;  5EDS A;  2IO3 B;  2JXX A;  4MGY E;  3NY5 A;  3TIX A;  4II3 B;  1WX9 A;  1LM8 B;  1WGH A;  2IO1 B;  3A9J A;  2B3A A;  1EF1 A;  2KXJ A;  2KDI A;  4W9D A;  4DHJ B;  4EZJ A;  3A9J B;  3MTN B;  1SE9 A;  1WZ3 A;  4GDL B;  3W1S A;  4TKN A;  2WX1 A;  3N30 A;  2C5L C;  2L0F A;  2XK5 B;  1YX5 B;  4FHK A;  4NQL B;  1OEY J;  1LQB A;  3A9K A;  3Q3J A;  3B1L X;  3VTV A;  3EEC A;  5C1Z A;  3QAQ A;  4MSM B;  2JRI B;  4DDI D;  2N9E B;  3A4S C;  2CHZ A;  4J6I A;  4HPM B;  4MEM A;  2O6V B;  2DYO A;  2V4L A;  1M94 A;  4MH0 E;  2L8J A;  3CST A;  4K1R B;  4BKS D;  2FNJ B;  2R2O A;  1WE6 A;  1JRU A;  2ZJD A;  4K7U A;  5AZF A;  4AP4 C;  2MA9 B;  4TUU A;  1WXV A;  3PSE B;  5J18 A;  2KTF A;  3OJ3 A;  4WJO A;  2GBN A;  3ALB A;  4G50 A;  2KC2 A;  2JUO A;  2KO3 A;  2JVC A;  2DZK A;  2JRH A;  2MLB A;  3OJ4 B;  2BKR B;  4B95 A;  3DVG X;  4EZK A;  3UGB B;  3SD5 A;  2I1K A;  2MP2 A;  4KIK B;  3JYU A;  5D2M B;  1ZGU B;  1WH3 A;  2M17 A;  4B6W A;  2MBH A;  4IWO A;  4GDK A;  2MP2 B;  2XEW A;  4MJS A;  1RRB A;  5GMV A;  2GOW A;  4F8C B;  2REX A;  3ZVV A;  2KAN A;  4MSQ B;  3U7D A;  3KUD B;  3Q3F A;  2RGF A;  4MJS B;  3VVW B;  4WJP A;  1NDD A;  4JQW C;  4KSK C;  2IY1 B;  2L3Z A;  1XT9 B;  1RLF A;  1WRD B;  4RM9 A;  1SGH A;  1T0Y A;  3ZNI D;  4NQK E;  2BYE A;  4WWO A;  3R3M A;  3VH4 B;  1TTN A;  3R7Q A;  2LUE A;  2N7D A;  3RZF A;  4DK5 A;  4CHK A;  1GNU A;  2KWV B;  2L05 A;  3L13 A;  4LDT D;  5AZH A;  4GU2 A;  4W9L A;  3V60 A;  1WM3 A;  3A1Q A;  2FIF A;  2KQ7 A;  1NI2 A;  2M4N A;  3H7P B;  4KDL B;  4RMA A;  5D6J B;  4ANX A;  2LVQ A;  4I6N B;  5IAA C;  2ZPN A;  4AJY B;  2RD0 A;  3A33 B;  4NJ7 A;  4FAD A;  4WJQ A;  2C7M B;  1WJU A;  1WXS A;  4XX5 A;  4YL8 A;  2IBI B;  2Z59 B;  3ZUN A;  3VXW A;  1I35 A;  3ML9 A;  1J8C A;  1Q1O A;  2KD0 A;  5DCN A;  4ZRK A;  2KJR A;  2KLC A;  4NJ6 A;  4NNJ B;  3R7R A;  5L95 C;  1GJZ A;  2QHO A;  5KHO A;  2AYO B;  3KUC B;  5J17 A;  2K1F A;  2ZZP B;  3IHP C;  4IW0 A;  2DAJ A;  1WGD A;  3VAW A;  2DZJ A;  4BKT A;  3PS6 A;  1Z5S B;  1WR6 E;  2J0K A;  3DVN U;  1WFY A;  1V86 A;  2J0J A;  3KVF B;  1V2Y A;  2MBE A;  1WIA A;  5D7G A;  3IFW B;  3WAL A;  2CR5 A;  3DVN V;  2ZEQ A;  2PE6 B;  4NAW A;  2M1M A;  1L2N A;  2L00 B;  2RSU A;  3T9L A;  2C9W B;  3L16 A;  2KWU B;  1PQS A;  3B08 A;  2KTR A;  3ZIM A;  2K25 A;  3IVF A;  4F7Z A;  2JZZ A;  2MBQ A;  2C7H A;  2L76 A;  3PTF C;  3WAO A;  1YX6 B;  2K8H A;  2PJH A;  3B0A A;  2JT4 B;  3ZLZ A;  4BOS C;  5CHW A;  4N9F 4;  1KJT A;  4EZL A;  1UEL A;  4W9C A;  4M8M A;  3P2B A;  3OAW A;  4GMV A;  3TJP A;  2KX3 A;  3BIN A;  3ZKJ C;  2HJ8 A;  2DHZ A;  1WMH A;  3TBL D;  2NBU A;  2G45 B;  2NS5 A;  3PT2 B;  3PRM B;  4IWQ A;  4E71 A;  1TZ1 A;  3PV1 A;  3QQ8 B;  4LDT B;  2IY0 B;  1V49 A;  1XD3 B;  2Z0D B;  2HE7 A;  4GSW A;  2MBO A;  3DCG A;  1V81 A;  3UQB A;  1WM2 A;  1V5T A;  1KM7 A;  5FR6 A;  4EEW A;  5CTR C;  2LVO A;  2W9N A;  3RCZ A;  4DWF A;  2IO2 B;  3L08 A;  4CYE A;  2BWE S;  3PPA A;  5JH5 C;  4WWP A;  2LXA A;  1IYF A;  2ZVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...