3VRBB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vrbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vrbB01
3HRDD 1DGJA 1SB3C 4YSZB 1GTEA 1TKGA 2JX5A 2K5PA 4N59A 4WWMA 1TJEA 1TKYA 5H8YE 1E7PB 5G5HA 4A9AA 2WDRB 1PFDA 1T3QA 2CJNA 1DOYA 3AEBB 3FAHA 1J7CA 3ZYYX 4JX1C 3FC4A 3L4PA 1XLPA 3AEEB 1N63A 4ZOHC 1NI3A 4ITKA 2BS4B 3EUB2 1QOFA 3AB5A 1N5WA 1WWTA 1N60A 1FIQA 2BT6A 1NENB 2MJEA 2H88B 3AEDB 3KWLA 2WDQB 2M19A 1GPXA 2DWQA 3WCQA 1F0ZA 3AE8B 5AUKA 3NRZA 3W5VB 2WLBA 3AE9B 4P6VF 4N6EB 1JWBD 2CU3A 3AE5B 2WP9B 3AEFB 1OFFA 4JWUC 1PUTA 1XLNA 2LEKA 3AE7B 1VJKA 2G1EA 3P1MA 1AWDA 1FRDA 2MJDA 3CIRB 1KF6B 1QOGA 1NEKB 5EE0A 1TKEA 1NYQA 2KAJA 1JW9D 4IDIA 3AE1B 1XO3A 1FM0D 3P63A 4ZHOA 1L6UA 4HROA 1CJEA 1V8CA 1E10A 5EE3A 1SIJA 1PDXA 1QLBB 2BS3B 1KRHA 3NVZA 1GT8A 3VR8B 2PKOA 1J7BA 2L52A 4US8A 2K9XA 1QOBA 4KX6B 2B76B 1WRIA 2K22A 2PVOD 1N62A 3NVWA 2WS3B 1SF0A 3AN1A 3AEGB 4YXDB 1A70A 1V97A 3VRAB 2W55A 3BIID 1IUEA 1EWYC 3LXFA 1FO4A 3P4SB 3B2GA 4JWSC 3P4RB 1RM6C 1QF6A 1FXAA 1RYJA 2MH7A 1I7HA 3AE4B 1DOIA 1FMAD 1FRRA 1NYRA 1ROEA 1XLQA 2AX5A 4HRSA 3SFEB 4N58A 1N61A 1OQRA 3PO0A 3HVZA 1B9RA 1WGKA 1WYGA 3NVYA 2EKIA 2PVGC 2Q5WD 5EE1A 3SR6A 2WQYB 1RFKA 1JALA 1CZPA 1DOXA 1XLOA 1FXIA 2KMMA 2PIAA 4US9A 3W5UB 2W3RA 3AEAB 3P4QB 2OHFA 1H7WA 3NS1A 1L6VA 5C3JB 3AM9A 3P4PB 1JWAD 5H92C 2FBWB 3ABVB 5AUIA 4YSXB 1J7AA 2WU5B 2M56B 3NVVA 4WQMA 3VRBB 1H7XA 1GTHA 2ACZB 1FFVA 3CF4A 1YQ3B 2BS2B 2HTME 2WDVB 1GAQB 2Y5CA 1QT9A 4YTMB 4YTNB 3AMZA 3AE2B 3W9CB 2DBYA 1YJJA 5MPOA 1UWMA 4YT0B 2MJ3A 2W3SA 3AECB 2QIEB 3B9JA 3AE6B 1OQQA 3SFDB 1E0ZA 5C2TB 1RWSA 4LTUA 4C80A 4C7YA 3CWIA 1JQ4A 2L83A 3LB8C 1VLBA 1R7SA 1YQ4B 3DWGC 1ZUD2 1QOAA 1TYGB 1NVID 3AH7A 4FXCA 5EE9A 1JRPA 5G5GA 1JROA 1WXQA 3HUIA 1ZXIA 3ETRA 1E9MA 1L5PA 2N0SB 1YJIA 2E3TA 4YTPB 3B2FA 3DWMA 3RPFC 1VDVA 1AYFA 2H89B 1E6EB 1N5XA 2CJOA 1KFYB 2JQRB 4USAA 3AE3B 3AV8A 1L0VB 3VR9B 5GXGB 2QJLA 4C7ZA 4YSYB 2W54A 2WU2B 1FFUA 4ZHPA 1ZP0B 1ZOYB
chains in the Genus database with same CATH superfamily
1D6EC 4N59A 1V81A 2CR5A 1E7PB 4ZRJA 2QEJC 1T3QA 4EFOA 3AB5A 4MSMB 5IO9A 2KHWB 1WXVA 1TS2A 4IM0A 1G6JA 3PREA 1J0GA 4K1RB 3FKYA 3ALBA 3WAPA 4IKGA 3IG3A 1MFWA 3KW5B 2WXJA 3QA8A 3P1MA 4N9F4 3CIRB 2KJHB 1TKEA 4IDIA 3AE1B 3N1XC 1NI2A 1XQQA 3QJZA 4F8CB 4MGKE 3TCAA 5FKAC 4WAFA 3RUIB 1N62A 1MPEA 1VZ7A 1YMHE 5EDSA 2JZZA 3Q8FA 2BB5A 1FRRA 1ROEA 2J53A 3Q14C 2KN4A 2K8HA 3RT3B 2IYDB 3AU5A 3C0RB 2HE7A 2L0FA 1JALA 5AZGA 2KMMA 2BYFA 1WF9A 3RNGC 4OVZA 2INCC 4HK2A 3DBRI 4LJPB 2BYVE 4RMAA 1KH0A 1UUPA 4RCOA 1L0XB 3ZTCA 4HEA1 1UWMA 4HLEA 2JSVX 2VZKB 4R3DA 1WM3A 3ZGZA 4RM9A 2G45B 1L5PA 1ZE3D 3RPFC 2ASQA 4USAA 3NZ3A 4G0NB 5DPWA 2WXNA 2L00B 3PSEB 4ZHPA 2IO3B 2KYWA 1TIFA 3V6EB 1DGJA 1GTEA 1I4HA 2QMTA 1SE9A 3B08A 2C9WB 1IYFA 3W1SC 2C5LC 1LGRA 1YX6B 3DQVA 4JX1C 5CHWA 2Y3AA 3EUB2 1N60A 4S17A 1JWMD 2ZW1A 1HZ6A 4KV2A 3R3MA 1EU3A 1D4BA 4GDKB 2LXCA 4G50A 4W9KA 3U7DA 4M0WB 4EZLA 1QOGA 1T0RC 1XO3A 3P42A 4EOYA 5BMIA 3QC8B 3OG5A 4KKJA 5C23A 4A3OA 1J7BA 4CO7A 4KDLB 2K6DB 3BIID 2ON8A 1E8YA 2PJHA 3CF6E 4ICVA 2AQ3B 4NNJB 4REZA 4ANUA 5G5HA 2KWDA 3NG0A 1XLQA 4W9GA 3X0WA 3HVZA 1C4AA 1IBXA 4IW0A 2WXMA 1UBIA 4NJ6A 5AZHA 2MHJA 4JGHB 2Y5BB 4ANWA 3Q3FA 2WYQA 4XZ4A 3H9DA 5H92C 1C78A 2LZ6A 2N7JA 2KDBA 3CF4A 1K52A 1P0RA 2HTME 1IBXB 2W9NA 5HG2A 3ENEA 1PGBA 3EGRA 4DDGD 4GMVA 2IJ0A 2INNE 3ZTDA 2KXJA 3CWIA 3H1UA 3DBHI 2DYOA 1PGAA 3JSVA 4M00A 1KOTA 1PQSA 1JMLA 3KLSX 3IHPC 2W54A 2XBBC 4YSZB 3TMPB 4WWPA 1N6ZA 3RI7C 5IKCM 1AN8A 1WJUA 1CK1A 2KC2A 4ANXA 4ZRIA 4ZYSA 1P9DU 3AEEB 1WSPA 1A5RA 4LNKA 2C7MB 1SE4A 1UZXB 4QAYA 4NAWB 4GDLB 2KKCA 2IBIB 2SAKA 3I9V1 2KACA 3VUWA 4HPPA 4KGTA 2OJRA 1SE3A 3Q8AA 5EE3A 5JZEB 2Z0EB 3GOEA 1Q5WB 3M95A 3CMMB 1P1AA 1JCKB 1TS3A 1GB1A 1H8CA 2V9HA 3V6CB 2AQ1B 2IDYA 3KQ4A 5HFYA 2JT4B 4DHZE 1TY2A 1OTRB 3HHMA 4EZJA 2W82A 2A5UA 2LGSA 1MI0A 3C19A 4FHJA 2FAZA 3AM9A 2JF5A 2LGXA 2WXKA 4LNFA 2KQ4X 2WXFA 2VRRB 4YTNB 2NCNA 2X38A 3UQBA 4NJCA 1WGYA 1C4PA 2KVZA 2W3SA 4FJZA 2DZKA 3ZNGC 3B9JA 2QIEB 1OQQA 2K1FA 4LTUA 1XXGA 3A9JA 4HPLB 1Z5SB 2G4DB 4GDLA 3T3OA 3JW0X 1ZXIA 1TZ1A 2KWCA 3SEBA 1GOZA 3KUDB 5H8YE 4ASWC 4P16A 2QDFA 3D32A 4W9LA 2WDTB 5JXVA 2V3SA 3RNBC 2ONQA 2MJEA 4DDID 1L7YA 4RNAA 2GLSA 2DWQA 4B6WA 2J7QB 4N6EB 1Z2MA 3TL5A 1P7FA 4DHJD 4XWTA 4C4VB 3QHTA 2HDEA 1KRHA 4WQOB 3VUYA 2IY0B 3U4EG 3ZNHB 1A70A 2V4IB 1BUIC 1FO4A 4S0RA 2TSSA 2CS4A 1TZOA 3JVZX 3ZO5B 4XE0A 2C7NB 1FMAD 1TY0A 3VXWA 1KLUD 1ENFA 1DOXA 4WJNA 4TQ0A 2FBWB 4YSXB 3NVVA 3HM3A 2Z0DB 2VH1A 3L08A 4XDDA 4YTMB 3Q6BA 3SU8X 5E6PA 2N9XA 1OEYJ 2V3PA 2PMVA 3TSSA 1E8ZA 3Q3NC 1T0SC 3B2FA 2WX1A 3EFUA 4LLGM 1BT0A 3RNFC 1EF5A 2D10A 3WAMA 2JPHA 2WXPA 4ANVA 3HRDD 1IGDA 4KGRA 3TBLD 2JWZA 2BVCA 1B1ZA 2J0MA 2NS5A 2D3BA 1PYWD 2JRHA 4OZBA 5LXIB 2KMAA 2G9HD 2OJWA 2M19A 4MM3A 2KO3A 1OGWA 1YIWA 2WWZA 1RFAA 3H8HA 1PUTA 4TV3A 1VJKA 2KOXA 2MJDA 2ICIA 2MP2B 4ZRKA 2O2VA 4ZHOA 4MACA 1V8CA 2K3UA 4KDIC 1PDXA 1I42A 2CHWA 1JRUA 2M17A 3RNCC 1EM7A 4LNNA 1LFDA 3AEGB 3PZ7A 3KUZA 3MP9A 3EA6A 2C60A 2BYEA 4ZYNA 1B9RA 1SJHD 1XLOA 1S3SG 1V1OA 2KTFA 4L1BA 3T8MA 2SEBD 1T0YA 1XEEA 2ZNVC 5AUIA 2WU5B 4FN2A 5J2RA 2KD0A 1GTHA 2N1WA 2N9KA 3VVWB 3PRZA 2KT7A 4YWGG 1WX8A 3IXSA 1ET6A 4PS8A 3SFDB 4C80A 3RYTA 2KFKA 1QOAA 1TYGB 3AH7A 3AXCA 3QAQA 3S2AA 4WURA 1WXAA 3L13A 1AYFA 5E6JA 4PT5A 4C7ZA 2PIAA 4WJPA 2YEPF 2IGDA 1R4MB 3Q2AC 5KHQA 1V1PA 5CTRC 1Q0WB 2CHZA 4G11A 1F0ZA 2MEKA 1QILA 3TIXA 2D5GA 1TTNA 3V3XA 3AEFB 2MBHA 2JU6X 5LLIA 4W9JA 1AWDA 2LASA 4I6NB 2KX3A 2WXHA 3VQIA 1E10A 1ZKHA 3U52E 3UGBB 3ZLZA 4AJWA 1WMHA 4MGYE 1WRIA 4II2B 3VRAB 3MC0B 1JWSD 2HJ1A 1GJZA 2IY1B 3U30A 4K81A 2EKIA 1BMLC 2PE6B 2V0GA 4M8MA 1KM7A 4IWQA 2JXXA 4DXFA 2KWUB 3GB1A 3RMKC 4MGIE 4W9EA 1SGHA 3KVFB 4KKIA 3ZRCA 2HJ8A 4IG7B 1RLFA 1CQVA 4OW0A 2MP2A 2LXAA 1WXMA 2KWVB 2AYOB 3HK0A 2JWUA 5G5GA 2IGHA 3ETRA 3NUHB 1VDVA 1E6EB 2DENB 1JWUD 2NBWB 1V5OA 4MT5A 3PGEA 2I2YA 3BVGA 1OQYA 3MHSD 1WR6E 3O65B 1STEA 4MEMA 1WJ4A 3FAHA 1SBBB 4MGZE 2BS4B 2IO1B 1N5WA 1WWTA 2J42A 3IT6B 2IZVB 3DHIC 1Y56A 4NQKE 3DPDA 3WCQA 5JHAA 3ZRFA 5IN7A 5IP4D 1UNSA 4JWUC 3ML8A 1ACCA 1WJ6A 4GB9A 3N20C 4KZ0A 3ZW3A 2N9PC 2FCNA 4K3CA 2LJIA 4CQNA 4NY0A 2BPSA 1WGRA 1E5WA 3R2IA 2J52A 4FADA 4XDCA 1J19A 2KN5A 3WA0A 2PKOA 3JSVB 3QARA 1IP9A 2DZIA 4TKNA 3HM6X 3N1ZC 4P7IA 3APFA 2O6VA 2BQQA 3PRPB 1F9JA 1QQRA 4JPSA 2NMQA 4BBNC 3NVYA 2DAFA 1E8XA 1RFKA 4P1BC 1CZPA 2LGIA 3OWEB 2NPTA 1H7WA 1FCCC 5C3JB 3NJTA 2M56B 5D3DA 2C7HA 4K7WA 2DYMA 4XWWA 1MVKA 1WRDB 4FJVB 3MTNB 1E90A 2VH2A 3RZFA 2RPVA 4AJYB 1MG8A 2KQ7A 2EMSA 1JQ4A 1FCLA 3IAS1 1MHHE 1OEYA 1ZUD2 5J18A 4OVUA 5HKHA 3N3KB 1E7UA 4HJKA 3ZVVA 1FFUA 2XNAC 1FPYA 3RD2A 2JX5A 5TR5A 1U4AA 4NPNA 3L17A 4FHKA 2ZPYA 3MC8A 2NR2A 3VTVA 1TGZB 4WJOA 1YN4A 2GRIA 3GS2A 4CHKA 1YOVB 2RDGA 1V49A 1XF5L 1QOFA 1QZEA 1LM8B 1WX9A 1NENB 1EUVB 4WWNA 2WDQB 3ZQ4A 4I6LB 1D5MC 3DVNV 3AE9B 1E7VA 4P6VF 1L4ZB 4RGTA 1XLNA 2KDEB 1WFYA 2K8BA 3N9YC 4PS3A 1NEKB 1XCTL 2EKEC 1FM0D 2CKHB 2RDBC 4HROA 1AW7A 3NOBA 2E6XA 3N30A 1F77A 2KZRA 3JYUA 4KX6B 2B76B 5D3IB 4A55A 5FR6A 3UIPB 4LDTB 1ZDXA 3P4SB 4GSWA 4K7UA 3SD5A 3AE4B 4HJGE 2AX5A 1HZ5A 1N61A 4AP4C 3Q69A 1YD8U 1WGKA 2R2OA 1WYGA 2FIDA 2DNFA 1FXIA 2JVCA 4US9A 3PHXB 4ZRPA 4GOCA 2NBUA 1TS5A 2XK5A 4TMAB 4HWIB 2OOBB 1NBFC 4W9HA 1GAQB 3AMZA 3AE2B 2J0KA 2B3AA 1WGDA 1ZPSA 1UELA 4DHJB 2NTSA 4K3BA 3L16A 4I6PA 1R7SA 4GIVA 3R7QA 2LRUA 4NAWA 4DXGA 4MJSB 4HKZE 1C4CA 2FIFA 3BWUD 3MC9A 4W9FA 1SJED 2WXOA 1N5XA 2M0AA 3L10B 3VR9B 1SSNA 2NBVB 3N1YC 3X23A 2YEPB 1KLVA 2GBMA 4MH8A 1BXTA 1EO6A 1SEBD 2FCSA 1TJEA 5DPSA 4ARCA 2ZVNA 2PW9A 2GI9A 2AL6A 2QSDA 3VUXA 3OJ4B 4L23A 1FIQA 2MBEA 2BGFA 2MBOA 4PK1A 2JRIB 2KFKB 4PYZA 2DAJA 3PLVA 4XX5A 2K25A 2WP9B 2D3AA 4FBJB 1C1YB 1F2RI 2MA9B 4KVGB 2LUEA 2HD5B 1SIJA 3UIOB 1QLBB 3ZDTA 2L3ZA 4C7YA 4NQLB 2PVOD 4XYCA 1V97A 2WXIA 3ZNID 3PVLA 4JWSC 3VHTC 1ZDVA 4N58A 2WXQA 2M8SA 2Q5WD 1WY8A 1YN5A 2GBJA 1D5ZC 2BWFA 4AS1A 2XK5B 4RF1A 2GBKA 3APDA 1J7AA 5CX3A 3VRBB 4RGOS 4IC7B 2Z59B 1XCQL 3RCZA 2BS2B 2X8XX 3OJ3A 1I4RA 3B0AA 3N32A 2K6QA 3DDCB 2CHXA 3HIZA 3WAOA 3W9CB 1YN3A 1YJJA 4HXDA 1MHXA 3UF8A 3AI5A 3AECB 3AE6B 3WANA 4DBGA 4GN1A 2KTRB 1UGJA 4HVBA 4EUTA 3DWGC 2RSUA 4UDUC 4F1SA 4FXCA 3V60A 4IM3A 4J6IA 3A1QB 3TEZA 4HKQA 4PYUA 4C56C 2DHZA 1ESFA 1L0VB 2MW5A 4ACFA 2INDC 3H7PB 2KANA 2K5PA 5L83A 3M3JA 2WDRB 1I4QA 3OLMD 3AEBB 2K39A 1J7CA 3AU4A 3L4PA 4ZOHC 1NI3A 1WYWB 4BBNF 2UWQA 3AE8B 3BYYB 2N7DA 5AZFA 2LHEA 3BVMA 2CU3A 4RF0A 3TJPA 2LEKA 4PS7A 1HTOA 4OZAA 2OEDA 4EKUA 2Y5PA 3ZJVA 1LO5D 4DQOC 1WIAA 1D5XC 2QILA 5DCNA 1GC7A 2R2QA 2LJ5A 1FXAA 1TS4A 2MH7A 1NYRA 2BKFA 5HI1A 1C9FA 3SFEB 3V62A 3IFWB 3TUOA 1V6EA 2INPE 2WQYB 3L0WB 2ZW0A 4EZKA 2QCZA 1VD2A 1EF1A 2LRWA 3CSFA 3ML9A 5L95C 2KK8A 4XGAB 2WDVB 2KNBA 4HDOA 3KWVA 3PS6A 3EECA 3LB8C 4JLCA 3HVDA 4BOZB 2D3CA 1NDDA 2JUOA 3ZNZB 2E3TA 2PLPA 3FILA 4BAXA 3QQ8B 4DXAB 1Y8RC 3AE3B 3DBHB 2KFJA 4GDKA 1TKGA 2UU7A 1WGHA 4LNIA 4A9AA 2LUMA 3T9LA 2FE8A 4M02A 4ITKA 3TEYA 3TEWA 3CSTA 1YJ1A 2MRPA 3DVGY 4MJSA 4FA6A 2L0TA 5AUKA 3A9JB 2WLBA 2DYBA 1HEZE 4B95A 4TUUA 2IGGA 4LCDE 3QIJA 5E6NA 1FNWA 4FULA 4WAAA 1NYQA 5EE0A 1JW9D 4WH4A 5BO4B 4EEWA 5D7GA 5TSSA 2JZPA 4TQ1A 2I1KA 2M1MA 3NVZA 1GT8A 3AN1A 1ZXHA 1J8CA 3Q8EA 3ZJTA 1SXTA 1I7HA 3WALA 1DOIA 4HRSA 1GNUA 3PO0A 1C3TA 2GBNA 3H6NA 3IAM1 1SE2A 2FCQA 4D2KA 2W3RA 1GUAB 3MJ5A 2OHFA 4GLSC 3Q3OC 3ZIMA 3R66C 2PTLA 2PPHA 4X57B 3PT2B 4KIKA 2MX2A 2LD9A 4JIOU 3QX1A 3DHHC 4MDKE 4BOSC 1R4MI 2DBYA 5MPOA 2XEWA 2G4SA 4HCPB 5C2TB 3K9OB 1WZ3A 3GE8C 2RD0A 3PTFC 4BZAA 2FNJB 4B9KA 4FLHA 4E74A 2N7EA 3HUIA 1CMXB 2J4XA 3Q3JA 4RFBA 4F7ZA 2JY6A 1KFYB 4DHZB 2BBCA 2N9EB 4IWOA 2MBQA 3E9SA 2AQ2B 1ZP0B 2ZEQA 3IVFA 2L8JA 1DYQA 3PRMB 4MELA 1V86A 5D6JB 3ZYYX 2LGYA 3GZNB 4BKTA 1FXTB 2FCMA 1WE7A 3VFKA 3NRZA 2IO2B 3BZDB 5DPRA 1JWBD 3DVGX 2G1EA 1KTKA 2IPKD 2LVPA 4FJYA 1KF6B 2M4NA 2KAJA 4BKSD 2R61A 2MLBA 2V1YA 3MHZA 4G3XB 5I4DA 3PZDA 4HCNB 1F2RC 3QK0A 4US8A 1QOBA 4YXDB 1H4RA 1I4GA 1F1HA 3B2GA 3I63C 3M63B 2JXTA 2KVRA 4E3CA 3RNEC 5G2NA 2DLBA 1VCBA 1PGXA 1YQBA 2ZVOA 2ZZPB 2ZCCA 1GG3A 1YX5B 3NS1A 5DPTA 4DK5A 1C77A 4JE3B 5D2MB 1R4NB 2ACZB 4LJOB 2KDIA 3SDLC 2RGFA 2Z8LA 1UD7A 5IA7A 1V9JA 3O13A 3H7SA 2KLCA 4XC2A 1E0ZA 1RWSA 2L83A 5FK9C 2AL3A 1YQ4B 3AULA 5HHDG 5EE9A 1NVID 4RGMA 5BYQA 3LYYA 3KYDD 1E8WA 3UINB 3KH0A 4RM8A 3PHWB 2JQRB 2H89B 2ZJDA 5LNK1 1UGMA 1KJTA 2QJLA 1GB4A 3ECIA 4LNOA 4WWMA 1ET9A 1TKYA 3PPAA 3TEXA 5FR3A 2QHOA 5T8IA 3VH3B 3BY4B 3FC4A 1XLPA 3GE3C 3LDZE 1VZ6A 2H88B 4OZCA 3A1QA 3RNAC 4DWFA 1C76A 1GPXA 1K50A 2WGSA 1M4VA 4C00A 3GZNI 3VH4B 5BMHA 2RPQA 2KDFB 3I3TB 3R7RA 1I4PA 3AE7B 3UQAA 3DCGA 3NZUA 1FNVA 2ZNVB 1IGCA 3DBLB 3IT4B 3T3NA 2KDMA 1CJEA 3A4SC 4KSLC 2BS3B 3QCAA 2K9XA 2JYEA 3RFZB 3LXFA 1HTQA 1KLGD 3DVNU 1RM6C 1QF6A 1WE6A 2PEAA 3I5JC 3DBLI 4ZDVA 1OQRA 2J0JA 3MFGA 4BVUC 5IOIA 2HTHA 2L76A 3P2BA 5IAAC 1L6VA 4KSKC 4YL8A 4P1CC 1UWXA 2NPTB 1WMHB 2V4LA 4ARIA 1L2NA 2WXGA 3E56A 3APCA 2LFIA 3ZDMC 5E6OA 3VTUA 2O6VB 3A9KA 2MJ3A 2D2QA 1IPGA 2MQJA 1TT5B 3J9CA 4KGSA 1R4NI 1VLBA 1C79A 4B0MA 1JRPA 1JROA 2BTEA 1WXQA 1L4DB 3DWMA 5BYRA 4CYEA 4RGNA 1K8RB 5J17A 3AV8A 4BKSA 3SHQA 3L54A 1X1MA 1ZOYB 3VTWA 4J3OD 4BFRA 2KJ6A 2WXRA 1Q1OA 2M0XA 3BK2A 4M8NA 1WZ0A 2VZKD 4GGQA 4HPMB 4A8XC 1UH6A 1RAXA 2FUG1 3KWLA 3WIMA 3LJ3A 1I35A 2JYTA 3W5VB 2EELA 1AARA 1WJNA 1T5XD 4OVVA 3BVZA 2GB1A 2LVOA 1HQRD 1UF0A 1L6UA 1WR1A 1VRAB 3PLUA 4NJ7A 2DZMA 4M01A 2DX5B 1SF0A 3RULA 1IUEA 1EWYC 3GP7A 1M94A 3QWZB 1I4XA 4L2YA 2GBRA 4JQWC 3V05A 1T6BX 3EC8A 3Q3MC 2CU1A 4KIKB 5GMVA 2V3NA 4JL9A 2BB6A 1V80A 3DBRB 3ABVB 3I57A 2RMMA 1H7XA 4NZLB 1SIFA 3VDZA 2KC1A 3K9PB 1YQ3B 1WXSA 5JH5C 2Y5CA 1QT9A 1ZW7A 4W9CA 2O2VB 1VR9A 1XD3B 3W2DA 2KX0A 2L32A 1MG4A 2N1VA 2ZCBA 1XT9B 2WHIA 4MM3B 3U7ZA 1E9MA 2K0PA 2MBBB 1YJIA 2N0SB 4YTPB 2YVCA 3DBSA 1FEHA 5GXGB 4MH0E 4A3PA 4E71A 1EU4A 4BKGA 2FUHB 3R2TA 2LGDA 1WX7A 1PFDA 3BYTB 5G55A 2CJNA 2D3GA 3RN9C 3KYCD 2LWPA 3EHVA 1N63A 4II3B 2RDHA 4WJQA 1FD6A 3AEDB 4IOIE 3NHEB 3DHGC 1RRBA 3ZUNA 4A20A 3V61A 2IO0B 1V5TA 1T0QC 2MSED 4WIPA 1FRDA 3RZWC 2LVQA 1HE8A 4GU2A 4K7SA 3FILB 1TBEA 3DOWA 2KQSA 4Q2JA 1WI0A 3VR8B 2L52A 3MJWA 2K22A 2L1AA 2WS3B 2ZPNA 4W9DA 2W55A 4IM2A 3B1LX 4OHJA 3A9KB 3P4RB 1ISNA 1RYJA 2KLGA 3U2SC 5LXHA 1WM2A 3BK1A 2KMCA 2GOWA 3W5UB 3AEAB 3P4QB 4H2AA 3ZXVA 3P4PB 2L7RA 1JWAD 3NZSA 2G3QB 2AWTA 1QKZA 4HDQA 4LDTD 1FFVA 3URYA 2BKRB 4C4VA 5C1ZA 2JZ3B 4AWJA 2KJRA 2NVUI 1K53A 3C8YA 1FNUA 4O1NA 1V2YA 2D11A 3NS8A 4URKA 1S1QB 4MSQB 4B0EA 2UYZB 3PZ8A 2AEHA 2LMCA 2GMIC 2LHDA 4KZCA 2EMTA 4GXBA 1K51A 1LXDA 1ZGUB 1LQBA 4LK0M 4A6QA 2I38A 5BYSA 2LI5A 4YSYB 4M0WA 2WU2B 1SB3C 2N4FA 4A90A 2MWSB 5BMGA 3Q8CA 2DZJA 1DOYA 1P7EA 3ONSA 1Q10A 3R8BA 2BT6A 4TSSA 2QC8A 1WGGA 2I1JA 4AQ7A 5KHOA 4W9IA 3AE5B 1OFFA 5JHBA 3IBEA 3ZXRA 4AOFA 2BWES 3H7PA 3ZJUA 2N9LA 3P63A 2BF8B 2O6VD 3PV1A 1WH3A 1YNTE 1P3QU 1MJDA 2PE9A 3A4RA 3NY5A 1GC6A 3NVWA 2KTRA 5CHFA 3M62B 2D07B 4IWPA 4AUQC 5EE1A 2PVGC 3SR6A 3KUCB 4WWOA 4NAMA 4RH6A 2WXLA 3U8ZA 1L0YB 1VZ8A 3BINA 2WX0A 3OAWA 3W1YA 2YLMA 4ICUA 1HXYD 4WQMA 1UBQA 1F52A 2RR9A 1HA5A 4ZRQA 2XN9C 4EE2A 3VAWA 2BW2A 2WNMA 4IUMB 1D3ZA 3A33B 4YT0B 2BYTA 3EFCA 2NTTA 3W1SA 1EWCA 3Q8BA 5AEKB 1P98A 5D94A 3UI3A 2K8CA 2L05A 2MCNB 3ZKJC 2A4ZA 2CJOA 5CHVC 2REXA 1V1PB
chains in the Genus database with same CATH topology
2WXPA 3HRDD 4MH8A 1D6EC 1BXTA 1IGDA 4KGRA 1SEBD 4N59A 4WWMA 1ET9A 1TJEA 1TKYA 3TEXA 5FR3A 1E7PB 4ARCA 1B1ZA 2QEJC 2PW9A 5T8IA 2GI9A 1T3QA 2QSDA 3FC4A 1XLPA 1PYWD 4OZBA 3AB5A 4L23A 1FIQA 1VZ6A 2H88B 4OZCA 1TS2A 2G9HD 2M19A 1C76A 1GPXA 1K50A 1M4VA 5BMHA 4IKGA 2WXJA 2WP9B 3H8HA 1PUTA 1I4PA 3AE7B 1VJKA 3P1MA 2MJDA 1F2RI 3CIRB 2ICIA 1FNVA 1TKEA 1IGCA 4IDIA 3AE1B 3IT4B 3T3NA 2KDMA 4ZHOA 4MACA 1CJEA 1V8CA 2K3UA 1SIJA 1PDXA 1QLBB 2BS3B 2K9XA 4C7YA 5FKAC 1EM7A 2PVOD 4WAFA 1N62A 2JYEA 3AEGB 1MPEA 1V97A 3LXFA 3PZ7A 3RFZB 1VZ7A 3MP9A 2WXIA 1YMHE 1KLGD 4JWSC 1RM6C 1QF6A 3EA6A 3Q8FA 2BB5A 1FRRA 1ROEA 1ZDVA 2J53A 4N58A 2WXQA 2KN4A 1OQRA 3MFGA 1B9RA 2Q5WD 1JALA 1YN5A 1SJHD 1XLOA 2KMMA 1D5ZC 1V1OA 4L1BA 4AS1A 2SEBD 1L6VA 4RF1A 4OVZA 1XEEA 5AUIA 1UWXA 1J7AA 2WU5B 3VRBB 4RGOS 1GTHA 4ARIA 1XCQL 2N9KA 2WXGA 2BS2B 1KH0A 1UUPA 3E56A 1L0XB 4RCOA 2LFIA 1I4RA 4HEA1 3W9CB 1YN3A 1YJJA 1MHXA 4YWGG 1UWMA 2MJ3A 3IXSA 1ET6A 3AECB 3AE6B 2JSVX 3SFDB 3J9CA 4KGSA 4C80A 1UGJA 2VZKB 4R3DA 1VLBA 1C79A 3DWGC 4B0MA 3ZGZA 4UDUC 1QOAA 1TYGB 3AH7A 4FXCA 1JRPA 1JROA 2BTEA 1WXQA 4WURA 1L4DB 1L5PA 3DWMA 5BYRA 3TEZA 4HKQA 1ZE3D 3RPFC 1AYFA 4RGNA 4USAA 4C56C 1ESFA 5E6JA 3NZ3A 4PT5A 3AV8A 1L0VB 4C7ZA 2WXNA 4ZHPA 2PIAA 1ZOYB 2YEPF 1DGJA 1GTEA 2K5PA 1I4HA 2QMTA 2IGDA 4J3OD 2WXRA 2WDRB 1I4QA 1V1PA 3AEBB 3BK2A 1J7CA 4JX1C 3L4PA 2VZKD 4A8XC 4ZOHC 1NI3A 2Y3AA 3EUB2 1N60A 2FUG1 1JWMD 3KWLA 2ZW1A 2JYTA 1F0ZA 3AE8B 1HZ6A 2MEKA 3BYYB 3W5VB 1QILA 2EELA 2LHEA 3BVMA 2D5GA 1EU3A 3V3XA 2CU3A 3AEFB 4RF0A 1D4BA 2JU6X 1T5XD 2LEKA 4GDKB 3BVZA 2GB1A 1AWDA 1HQRD 1QOGA 1XO3A 3P42A 4OZAA 2OEDA 1L6UA 1VRAB 2WXHA 3VQIA 2Y5PA 1E10A 3U52E 5BMIA 3ZJVA 1LO5D 4KKJA 4DQOC 1J7BA 1WRIA 1D5XC 1SF0A 2QILA 3VRAB 3BIID 1IUEA 1EWYC 1JWSD 2ON8A 3GP7A 3MC0B 1I4XA 4L2YA 2AQ3B 1FXAA 1TS4A 4REZA 2MH7A 1NYRA 5G5HA 3V05A 2KWDA 5HI1A 1XLQA 1T6BX 1C9FA 3SFEB 3HVZA 3TUOA 1C4AA 1IBXA 2EKIA 1BMLC 2INPE 2WQYB 2WXMA 2V0GA 2ZW0A 2V3NA 2BB6A 5H92C 4DXFA 3ABVB 3I57A 1C78A 2N7JA 2RMMA 1H7XA 3GB1A 4NZLB 3CF4A 1K52A 1YQ3B 4KKIA 2HTME 2WDVB 2Y5CA 1IBXB 1QT9A 5HG2A 1PGBA 1CQVA 3EGRA 4OW0A 1VR9A 3KWVA 2IJ0A 2INNE 3W2DA 2L32A 3CWIA 3LB8C 2JWUA 2DYOA 3HVDA 1PGAA 5G5GA 4MM3B 3U7ZA 2IGHA 3ETRA 3NUHB 1E9MA 2K0PA 2N0SB 1YJIA 2E3TA 4YTPB 1JMLA 2PLPA 3FILA 3KLSX 1VDVA 1E6EB 1FEHA 3AE3B 1JWUD 5GXGB 2W54A 4MT5A 2I2YA 3BVGA 1EU4A 1TKGA 4YSZB 3R2TA 1STEA 4A9AA 3BYTB 1PFDA 1AN8A 1CK1A 2LUMA 2CJNA 3FAHA 4ZYSA 1SBBB 2FE8A 3AEEB 1WSPA 1N63A 4ITKA 2BS4B 1SE4A 1N5WA 1WWTA 3TEYA 2J42A 2RDHA 3IT6B 3TEWA 3AEDB 1FD6A 4IOIE 1Y56A 4NAWB 3WCQA 4GDLB 5AUKA 2WLBA 1HEZE 1UNSA 4JWUC 2SAKA 2IGGA 3I9V1 1ACCA 4WIPA 2KACA 1FRDA 1FNWA 5EE0A 1NYQA 1JW9D 2LJIA 4WH4A 4CQNA 4KGTA 5D7GA 3FILB 5TSSA 3R2IA 2JZPA 3Q8AA 1SE3A 4TQ1A 5EE3A 2J52A 4Q2JA 3NVZA 4XDCA 1GT8A 3VR8B 2PKOA 2L52A 2K22A 2L1AA 2WS3B 3AN1A 2W55A 1ZXHA 3Q8EA 1JCKB 3ZJTA 4OHJA 1TS3A 1GB1A 3P4RB 1SXTA 2AQ1B 2IDYA 1RYJA 1I7HA 3U2SC 1DOIA 3KQ4A 4HRSA 5HFYA 1QQRA 3PO0A 1TY2A 4JPSA 2NMQA 3NVYA 3BK1A 3IAM1 1RFKA 1SE2A 4D2KA 1CZPA 2W82A 2LGIA 3W5UB 1MI0A 2W3RA 3OWEB 3AEAB 3MJ5A 3P4QB 2OHFA 4GLSC 4H2AA 1H7WA 1FCCC 5C3JB 3AM9A 3P4PB 2PTLA 1JWAD 2WXKA 2M56B 5D3DA 1QKZA 1FFVA 2KQ4X 3URYA 2WXFA 2DYMA 4XWWA 1MVKA 4YTNB 2X38A 4NJCA 1K53A 2RPVA 2DBYA 1C4PA 3C8YA 5MPOA 2W3SA 1FNUA 3B9JA 2QIEB 4O1NA 1OQQA 5C2TB 1JQ4A 4LTUA 4B0EA 1FCLA 3IAS1 1MHHE 1XXGA 2LMCA 3PZ8A 1ZUD2 2LHDA 3HUIA 3T3OA 2J4XA 1ZXIA 1K51A 4A6QA 4LK0M 4RFBA 2I38A 5BYSA 1KFYB 2BBCA 4YSYB 3E9SA 2AQ2B 4M0WA 2WU2B 1FFUA 1ZP0B 2XNAC 1SB3C 2JX5A 3SEBA 1GOZA 5H8YE 1DYQA 4A90A 5BMGA 3Q8CA 1DOYA 1YN4A 2GRIA 3GS2A 3ZYYX 4P16A 1P7EA 2RDGA 1XF5L 1QOFA 5JXVA 1Q10A 3R8BA 2ONQA 2BT6A 1NENB 2MJEA 4TSSA 4RNAA 2WDQB 2DWQA 3ZQ4A 3NRZA 4AQ7A 3BZDB 1D5MC 3AE9B 4P6VF 1L4ZB 4N6EB 1JWBD 4RGTA 3AE5B 1OFFA 1XLNA 2G1EA 1KTKA 1P7FA 2IPKD 3N9YC 1KF6B 1NEKB 1XCTL 3ZJUA 2KAJA 2N9LA 2R61A 1FM0D 3P63A 4XWTA 3MHZA 4HROA 1AW7A 5I4DA 2HDEA 1YNTE 2E6XA 1KRHA 1F2RC 1F77A 4US8A 3U4EG 1QOBA 4KX6B 2B76B 3NVWA 5D3IB 4A55A 1A70A 4YXDB 2V4IB 1BUIC 1FO4A 1ZDXA 2TSSA 3P4SB 1I4GA 3B2GA 2JXTA 1TZOA 4XE0A 3AE4B 1FMAD 1TY0A 4HJGE 2AX5A 2DLBA 1HZ5A 1N61A 1PGXA 3Q69A 1WGKA 1WYGA 5EE1A 2PVGC 3SR6A 1KLUD 1ENFA 4NAMA 1DOXA 4RH6A 1FXIA 4US9A 2WXLA 1L0YB 1VZ8A 4TQ0A 3NS1A 4ZRPA 1C77A 2FBWB 4YSXB 1HXYD 1TS5A 4JE3B 3NVVA 4TMAB 4WQMA 2ACZB 4XDDA 1GAQB 4YTMB 3AMZA 1HA5A 2Z8LA 3AE2B 4ZRQA 2XN9C 4EE2A 2BW2A 1ZPSA 2WNMA 3O13A 4YT0B 2V3PA 2BYTA 2NTSA 1E0ZA 2PMVA 1RWSA 2NTTA 3W1SA 1EWCA 2L83A 3Q8BA 5FK9C 1R7SA 1YQ4B 5HHDG 3TSSA 5EE9A 1NVID 4RGMA 5BYQA 3UI3A 3LYYA 4DXGA 4HKZE 1C4CA 3B2FA 3BWUD 1SJED 2JQRB 1N5XA 2H89B 2CJOA 2WXOA 2M0AA 4LLGM 5LNK1 3VR9B 1SSNA 2QJLA 1GB4A 2YEPB 1V1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRD D;  1DGJ A;  1SB3 C;  4YSZ B;  1GTE A;  1TKG A;  2JX5 A;  2K5P A;  4N59 A;  4WWM A;  1TJE A;  1TKY A;  5H8Y E;  1E7P B;  5G5H A;  4A9A A;  2WDR B;  1PFD A;  1T3Q A;  2CJN A;  1DOY A;  3AEB B;  3FAH A;  1J7C A;  3ZYY X;  4JX1 C;  3FC4 A;  3L4P A;  1XLP A;  3AEE B;  1N63 A;  4ZOH C;  1NI3 A;  4ITK A;  2BS4 B;  3EUB 2;  1QOF A;  3AB5 A;  1N5W A;  1WWT A;  1N60 A;  1FIQ A;  2BT6 A;  1NEN B;  2MJE A;  2H88 B;  3AED B;  3KWL A;  2WDQ B;  2M19 A;  1GPX A;  2DWQ A;  3WCQ A;  1F0Z A;  3AE8 B;  5AUK A;  3NRZ A;  3W5V B;  2WLB A;  3AE9 B;  4P6V F;  4N6E B;  1JWB D;  2CU3 A;  3AE5 B;  2WP9 B;  3AEF B;  1OFF A;  4JWU C;  1PUT A;  1XLN A;  2LEK A;  3AE7 B;  1VJK A;  2G1E A;  3P1M A;  1AWD A;  1FRD A;  2MJD A;  3CIR B;  1KF6 B;  1QOG A;  1NEK B;  5EE0 A;  1TKE A;  1NYQ A;  2KAJ A;  1JW9 D;  4IDI A;  3AE1 B;  1XO3 A;  1FM0 D;  3P63 A;  4ZHO A;  1L6U A;  4HRO A;  1CJE A;  1V8C A;  1E10 A;  5EE3 A;  1SIJ A;  1PDX A;  1QLB B;  2BS3 B;  1KRH A;  3NVZ A;  1GT8 A;  3VR8 B;  2PKO A;  1J7B A;  2L52 A;  4US8 A;  2K9X A;  1QOB A;  4KX6 B;  2B76 B;  1WRI A;  2K22 A;  2PVO D;  1N62 A;  3NVW A;  2WS3 B;  1SF0 A;  3AN1 A;  3AEG B;  4YXD B;  1A70 A;  1V97 A;  3VRA B;  2W55 A;  3BII D;  1IUE A;  1EWY C;  3LXF A;  1FO4 A;  3P4S B;  3B2G A;  4JWS C;  3P4R B;  1RM6 C;  1QF6 A;  1FXA A;  1RYJ A;  2MH7 A;  1I7H A;  3AE4 B;  1DOI A;  1FMA D;  1FRR A;  1NYR A;  1ROE A;  1XLQ A;  2AX5 A;  4HRS A;  3SFE B;  4N58 A;  1N61 A;  1OQR A;  3PO0 A;  3HVZ A;  1B9R A;  1WGK A;  1WYG A;  3NVY A;  2EKI A;  2PVG C;  2Q5W D;  5EE1 A;  3SR6 A;  2WQY B;  1RFK A;  1JAL A;  1CZP A;  1DOX A;  1XLO A;  1FXI A;  2KMM A;  2PIA A;  4US9 A;  3W5U B;  2W3R A;  3AEA B;  3P4Q B;  2OHF A;  1H7W A;  3NS1 A;  1L6V A;  5C3J B;  3AM9 A;  3P4P B;  1JWA D;  5H92 C;  2FBW B;  3ABV B;  5AUI A;  4YSX B;  1J7A A;  2WU5 B;  2M56 B;  3NVV A;  4WQM A;  3VRB B;  1H7X A;  1GTH A;  2ACZ B;  1FFV A;  3CF4 A;  1YQ3 B;  2BS2 B;  2HTM E;  2WDV B;  1GAQ B;  2Y5C A;  1QT9 A;  4YTM B;  4YTN B;  3AMZ A;  3AE2 B;  3W9C B;  2DBY A;  1YJJ A;  5MPO A;  1UWM A;  4YT0 B;  2MJ3 A;  2W3S A;  3AEC B;  2QIE B;  3B9J A;  3AE6 B;  1OQQ A;  3SFD B;  1E0Z A;  5C2T B;  1RWS A;  4LTU A;  4C80 A;  4C7Y A;  3CWI A;  1JQ4 A;  2L83 A;  3LB8 C;  1VLB A;  1R7S A;  1YQ4 B;  3DWG C;  1ZUD 2;  1QOA A;  1TYG B;  1NVI D;  3AH7 A;  4FXC A;  5EE9 A;  1JRP A;  5G5G A;  1JRO A;  1WXQ A;  3HUI A;  1ZXI A;  3ETR A;  1E9M A;  1L5P A;  2N0S B;  1YJI A;  2E3T A;  4YTP B;  3B2F A;  3DWM A;  3RPF C;  1VDV A;  1AYF A;  2H89 B;  1E6E B;  1N5X A;  2CJO A;  1KFY B;  2JQR B;  4USA A;  3AE3 B;  3AV8 A;  1L0V B;  3VR9 B;  5GXG B;  2QJL A;  4C7Z A;  4YSY B;  2W54 A;  2WU2 B;  1FFU A;  4ZHP A;  1ZP0 B;  1ZOY B; 
#chains in the Genus database with same CATH topology
 1D6E C;  4N59 A;  1V81 A;  2CR5 A;  1E7P B;  4ZRJ A;  2QEJ C;  1T3Q A;  4EFO A;  3AB5 A;  4MSM B;  5IO9 A;  2KHW B;  1WXV A;  1TS2 A;  4IM0 A;  1G6J A;  3PRE A;  1J0G A;  4K1R B;  3FKY A;  3ALB A;  3WAP A;  4IKG A;  3IG3 A;  1MFW A;  3KW5 B;  2WXJ A;  3QA8 A;  3P1M A;  4N9F 4;  3CIR B;  2KJH B;  1TKE A;  4IDI A;  3AE1 B;  3N1X C;  1NI2 A;  1XQQ A;  3QJZ A;  4F8C B;  4MGK E;  3TCA A;  5FKA C;  4WAF A;  3RUI B;  1N62 A;  1MPE A;  1VZ7 A;  1YMH E;  5EDS A;  2JZZ A;  3Q8F A;  2BB5 A;  1FRR A;  1ROE A;  2J53 A;  3Q14 C;  2KN4 A;  2K8H A;  3RT3 B;  2IYD B;  3AU5 A;  3C0R B;  2HE7 A;  2L0F A;  1JAL A;  5AZG A;  2KMM A;  2BYF A;  1WF9 A;  3RNG C;  4OVZ A;  2INC C;  4HK2 A;  3DBR I;  4LJP B;  2BYV E;  4RMA A;  1KH0 A;  1UUP A;  4RCO A;  1L0X B;  3ZTC A;  4HEA 1;  1UWM A;  4HLE A;  2JSV X;  2VZK B;  4R3D A;  1WM3 A;  3ZGZ A;  4RM9 A;  2G45 B;  1L5P A;  1ZE3 D;  3RPF C;  2ASQ A;  4USA A;  3NZ3 A;  4G0N B;  5DPW A;  2WXN A;  2L00 B;  3PSE B;  4ZHP A;  2IO3 B;  2KYW A;  1TIF A;  3V6E B;  1DGJ A;  1GTE A;  1I4H A;  2QMT A;  1SE9 A;  3B08 A;  2C9W B;  1IYF A;  3W1S C;  2C5L C;  1LGR A;  1YX6 B;  3DQV A;  4JX1 C;  5CHW A;  2Y3A A;  3EUB 2;  1N60 A;  4S17 A;  1JWM D;  2ZW1 A;  1HZ6 A;  4KV2 A;  3R3M A;  1EU3 A;  1D4B A;  4GDK B;  2LXC A;  4G50 A;  4W9K A;  3U7D A;  4M0W B;  4EZL A;  1QOG A;  1T0R C;  1XO3 A;  3P42 A;  4EOY A;  5BMI A;  3QC8 B;  3OG5 A;  4KKJ A;  5C23 A;  4A3O A;  1J7B A;  4CO7 A;  4KDL B;  2K6D B;  3BII D;  2ON8 A;  1E8Y A;  2PJH A;  3CF6 E;  4ICV A;  2AQ3 B;  4NNJ B;  4REZ A;  4ANU A;  5G5H A;  2KWD A;  3NG0 A;  1XLQ A;  4W9G A;  3X0W A;  3HVZ A;  1C4A A;  1IBX A;  4IW0 A;  2WXM A;  1UBI A;  4NJ6 A;  5AZH A;  2MHJ A;  4JGH B;  2Y5B B;  4ANW A;  3Q3F A;  2WYQ A;  4XZ4 A;  3H9D A;  5H92 C;  1C78 A;  2LZ6 A;  2N7J A;  2KDB A;  3CF4 A;  1K52 A;  1P0R A;  2HTM E;  1IBX B;  2W9N A;  5HG2 A;  3ENE A;  1PGB A;  3EGR A;  4DDG D;  4GMV A;  2IJ0 A;  2INN E;  3ZTD A;  2KXJ A;  3CWI A;  3H1U A;  3DBH I;  2DYO A;  1PGA A;  3JSV A;  4M00 A;  1KOT A;  1PQS A;  1JML A;  3KLS X;  3IHP C;  2W54 A;  2XBB C;  4YSZ B;  3TMP B;  4WWP A;  1N6Z A;  3RI7 C;  5IKC M;  1AN8 A;  1WJU A;  1CK1 A;  2KC2 A;  4ANX A;  4ZRI A;  4ZYS A;  1P9D U;  3AEE B;  1WSP A;  1A5R A;  4LNK A;  2C7M B;  1SE4 A;  1UZX B;  4QAY A;  4NAW B;  4GDL B;  2KKC A;  2IBI B;  2SAK A;  3I9V 1;  2KAC A;  3VUW A;  4HPP A;  4KGT A;  2OJR A;  1SE3 A;  3Q8A A;  5EE3 A;  5JZE B;  2Z0E B;  3GOE A;  1Q5W B;  3M95 A;  3CMM B;  1P1A A;  1JCK B;  1TS3 A;  1GB1 A;  1H8C A;  2V9H A;  3V6C B;  2AQ1 B;  2IDY A;  3KQ4 A;  5HFY A;  2JT4 B;  4DHZ E;  1TY2 A;  1OTR B;  3HHM A;  4EZJ A;  2W82 A;  2A5U A;  2LGS A;  1MI0 A;  3C19 A;  4FHJ A;  2FAZ A;  3AM9 A;  2JF5 A;  2LGX A;  2WXK A;  4LNF A;  2KQ4 X;  2WXF A;  2VRR B;  4YTN B;  2NCN A;  2X38 A;  3UQB A;  4NJC A;  1WGY A;  1C4P A;  2KVZ A;  2W3S A;  4FJZ A;  2DZK A;  3ZNG C;  3B9J A;  2QIE B;  1OQQ A;  2K1F A;  4LTU A;  1XXG A;  3A9J A;  4HPL B;  1Z5S B;  2G4D B;  4GDL A;  3T3O A;  3JW0 X;  1ZXI A;  1TZ1 A;  2KWC A;  3SEB A;  1GOZ A;  3KUD B;  5H8Y E;  4ASW C;  4P16 A;  2QDF A;  3D32 A;  4W9L A;  2WDT B;  5JXV A;  2V3S A;  3RNB C;  2ONQ A;  2MJE A;  4DDI D;  1L7Y A;  4RNA A;  2GLS A;  2DWQ A;  4B6W A;  2J7Q B;  4N6E B;  1Z2M A;  3TL5 A;  1P7F A;  4DHJ D;  4XWT A;  4C4V B;  3QHT A;  2HDE A;  1KRH A;  4WQO B;  3VUY A;  2IY0 B;  3U4E G;  3ZNH B;  1A70 A;  2V4I B;  1BUI C;  1FO4 A;  4S0R A;  2TSS A;  2CS4 A;  1TZO A;  3JVZ X;  3ZO5 B;  4XE0 A;  2C7N B;  1FMA D;  1TY0 A;  3VXW A;  1KLU D;  1ENF A;  1DOX A;  4WJN A;  4TQ0 A;  2FBW B;  4YSX B;  3NVV A;  3HM3 A;  2Z0D B;  2VH1 A;  3L08 A;  4XDD A;  4YTM B;  3Q6B A;  3SU8 X;  5E6P A;  2N9X A;  1OEY J;  2V3P A;  2PMV A;  3TSS A;  1E8Z A;  3Q3N C;  1T0S C;  3B2F A;  2WX1 A;  3EFU A;  4LLG M;  1BT0 A;  3RNF C;  1EF5 A;  2D10 A;  3WAM A;  2JPH A;  2WXP A;  4ANV A;  3HRD D;  1IGD A;  4KGR A;  3TBL D;  2JWZ A;  2BVC A;  1B1Z A;  2J0M A;  2NS5 A;  2D3B A;  1PYW D;  2JRH A;  4OZB A;  5LXI B;  2KMA A;  2G9H D;  2OJW A;  2M19 A;  4MM3 A;  2KO3 A;  1OGW A;  1YIW A;  2WWZ A;  1RFA A;  3H8H A;  1PUT A;  4TV3 A;  1VJK A;  2KOX A;  2MJD A;  2ICI A;  2MP2 B;  4ZRK A;  2O2V A;  4ZHO A;  4MAC A;  1V8C A;  2K3U A;  4KDI C;  1PDX A;  1I42 A;  2CHW A;  1JRU A;  2M17 A;  3RNC C;  1EM7 A;  4LNN A;  1LFD A;  3AEG B;  3PZ7 A;  3KUZ A;  3MP9 A;  3EA6 A;  2C60 A;  2BYE A;  4ZYN A;  1B9R A;  1SJH D;  1XLO A;  1S3S G;  1V1O A;  2KTF A;  4L1B A;  3T8M A;  2SEB D;  1T0Y A;  1XEE A;  2ZNV C;  5AUI A;  2WU5 B;  4FN2 A;  5J2R A;  2KD0 A;  1GTH A;  2N1W A;  2N9K A;  3VVW B;  3PRZ A;  2KT7 A;  4YWG G;  1WX8 A;  3IXS A;  1ET6 A;  4PS8 A;  3SFD B;  4C80 A;  3RYT A;  2KFK A;  1QOA A;  1TYG B;  3AH7 A;  3AXC A;  3QAQ A;  3S2A A;  4WUR A;  1WXA A;  3L13 A;  1AYF A;  5E6J A;  4PT5 A;  4C7Z A;  2PIA A;  4WJP A;  2YEP F;  2IGD A;  1R4M B;  3Q2A C;  5KHQ A;  1V1P A;  5CTR C;  1Q0W B;  2CHZ A;  4G11 A;  1F0Z A;  2MEK A;  1QIL A;  3TIX A;  2D5G A;  1TTN A;  3V3X A;  3AEF B;  2MBH A;  2JU6 X;  5LLI A;  4W9J A;  1AWD A;  2LAS A;  4I6N B;  2KX3 A;  2WXH A;  3VQI A;  1E10 A;  1ZKH A;  3U52 E;  3UGB B;  3ZLZ A;  4AJW A;  1WMH A;  4MGY E;  1WRI A;  4II2 B;  3VRA B;  3MC0 B;  1JWS D;  2HJ1 A;  1GJZ A;  2IY1 B;  3U30 A;  4K81 A;  2EKI A;  1BML C;  2PE6 B;  2V0G A;  4M8M A;  1KM7 A;  4IWQ A;  2JXX A;  4DXF A;  2KWU B;  3GB1 A;  3RMK C;  4MGI E;  4W9E A;  1SGH A;  3KVF B;  4KKI A;  3ZRC A;  2HJ8 A;  4IG7 B;  1RLF A;  1CQV A;  4OW0 A;  2MP2 A;  2LXA A;  1WXM A;  2KWV B;  2AYO B;  3HK0 A;  2JWU A;  5G5G A;  2IGH A;  3ETR A;  3NUH B;  1VDV A;  1E6E B;  2DEN B;  1JWU D;  2NBW B;  1V5O A;  4MT5 A;  3PGE A;  2I2Y A;  3BVG A;  1OQY A;  3MHS D;  1WR6 E;  3O65 B;  1STE A;  4MEM A;  1WJ4 A;  3FAH A;  1SBB B;  4MGZ E;  2BS4 B;  2IO1 B;  1N5W A;  1WWT A;  2J42 A;  3IT6 B;  2IZV B;  3DHI C;  1Y56 A;  4NQK E;  3DPD A;  3WCQ A;  5JHA A;  3ZRF A;  5IN7 A;  5IP4 D;  1UNS A;  4JWU C;  3ML8 A;  1ACC A;  1WJ6 A;  4GB9 A;  3N20 C;  4KZ0 A;  3ZW3 A;  2N9P C;  2FCN A;  4K3C A;  2LJI A;  4CQN A;  4NY0 A;  2BPS A;  1WGR A;  1E5W A;  3R2I A;  2J52 A;  4FAD A;  4XDC A;  1J19 A;  2KN5 A;  3WA0 A;  2PKO A;  3JSV B;  3QAR A;  1IP9 A;  2DZI A;  4TKN A;  3HM6 X;  3N1Z C;  4P7I A;  3APF A;  2O6V A;  2BQQ A;  3PRP B;  1F9J A;  1QQR A;  4JPS A;  2NMQ A;  4BBN C;  3NVY A;  2DAF A;  1E8X A;  1RFK A;  4P1B C;  1CZP A;  2LGI A;  3OWE B;  2NPT A;  1H7W A;  1FCC C;  5C3J B;  3NJT A;  2M56 B;  5D3D A;  2C7H A;  4K7W A;  2DYM A;  4XWW A;  1MVK A;  1WRD B;  4FJV B;  3MTN B;  1E90 A;  2VH2 A;  3RZF A;  2RPV A;  4AJY B;  1MG8 A;  2KQ7 A;  2EMS A;  1JQ4 A;  1FCL A;  3IAS 1;  1MHH E;  1OEY A;  1ZUD 2;  5J18 A;  4OVU A;  5HKH A;  3N3K B;  1E7U A;  4HJK A;  3ZVV A;  1FFU A;  2XNA C;  1FPY A;  3RD2 A;  2JX5 A;  5TR5 A;  1U4A A;  4NPN A;  3L17 A;  4FHK A;  2ZPY A;  3MC8 A;  2NR2 A;  3VTV A;  1TGZ B;  4WJO A;  1YN4 A;  2GRI A;  3GS2 A;  4CHK A;  1YOV B;  2RDG A;  1V49 A;  1XF5 L;  1QOF A;  1QZE A;  1LM8 B;  1WX9 A;  1NEN B;  1EUV B;  4WWN A;  2WDQ B;  3ZQ4 A;  4I6L B;  1D5M C;  3DVN V;  3AE9 B;  1E7V A;  4P6V F;  1L4Z B;  4RGT A;  1XLN A;  2KDE B;  1WFY A;  2K8B A;  3N9Y C;  4PS3 A;  1NEK B;  1XCT L;  2EKE C;  1FM0 D;  2CKH B;  2RDB C;  4HRO A;  1AW7 A;  3NOB A;  2E6X A;  3N30 A;  1F77 A;  2KZR A;  3JYU A;  4KX6 B;  2B76 B;  5D3I B;  4A55 A;  5FR6 A;  3UIP B;  4LDT B;  1ZDX A;  3P4S B;  4GSW A;  4K7U A;  3SD5 A;  3AE4 B;  4HJG E;  2AX5 A;  1HZ5 A;  1N61 A;  4AP4 C;  3Q69 A;  1YD8 U;  1WGK A;  2R2O A;  1WYG A;  2FID A;  2DNF A;  1FXI A;  2JVC A;  4US9 A;  3PHX B;  4ZRP A;  4GOC A;  2NBU A;  1TS5 A;  2XK5 A;  4TMA B;  4HWI B;  2OOB B;  1NBF C;  4W9H A;  1GAQ B;  3AMZ A;  3AE2 B;  2J0K A;  2B3A A;  1WGD A;  1ZPS A;  1UEL A;  4DHJ B;  2NTS A;  4K3B A;  3L16 A;  4I6P A;  1R7S A;  4GIV A;  3R7Q A;  2LRU A;  4NAW A;  4DXG A;  4MJS B;  4HKZ E;  1C4C A;  2FIF A;  3BWU D;  3MC9 A;  4W9F A;  1SJE D;  2WXO A;  1N5X A;  2M0A A;  3L10 B;  3VR9 B;  1SSN A;  2NBV B;  3N1Y C;  3X23 A;  2YEP B;  1KLV A;  2GBM A;  4MH8 A;  1BXT A;  1EO6 A;  1SEB D;  2FCS A;  1TJE A;  5DPS A;  4ARC A;  2ZVN A;  2PW9 A;  2GI9 A;  2AL6 A;  2QSD A;  3VUX A;  3OJ4 B;  4L23 A;  1FIQ A;  2MBE A;  2BGF A;  2MBO A;  4PK1 A;  2JRI B;  2KFK B;  4PYZ A;  2DAJ A;  3PLV A;  4XX5 A;  2K25 A;  2WP9 B;  2D3A A;  4FBJ B;  1C1Y B;  1F2R I;  2MA9 B;  4KVG B;  2LUE A;  2HD5 B;  1SIJ A;  3UIO B;  1QLB B;  3ZDT A;  2L3Z A;  4C7Y A;  4NQL B;  2PVO D;  4XYC A;  1V97 A;  2WXI A;  3ZNI D;  3PVL A;  4JWS C;  3VHT C;  1ZDV A;  4N58 A;  2WXQ A;  2M8S A;  2Q5W D;  1WY8 A;  1YN5 A;  2GBJ A;  1D5Z C;  2BWF A;  4AS1 A;  2XK5 B;  4RF1 A;  2GBK A;  3APD A;  1J7A A;  5CX3 A;  3VRB B;  4RGO S;  4IC7 B;  2Z59 B;  1XCQ L;  3RCZ A;  2BS2 B;  2X8X X;  3OJ3 A;  1I4R A;  3B0A A;  3N32 A;  2K6Q A;  3DDC B;  2CHX A;  3HIZ A;  3WAO A;  3W9C B;  1YN3 A;  1YJJ A;  4HXD A;  1MHX A;  3UF8 A;  3AI5 A;  3AEC B;  3AE6 B;  3WAN A;  4DBG A;  4GN1 A;  2KTR B;  1UGJ A;  4HVB A;  4EUT A;  3DWG C;  2RSU A;  4UDU C;  4F1S A;  4FXC A;  3V60 A;  4IM3 A;  4J6I A;  3A1Q B;  3TEZ A;  4HKQ A;  4PYU A;  4C56 C;  2DHZ A;  1ESF A;  1L0V B;  2MW5 A;  4ACF A;  2IND C;  3H7P B;  2KAN A;  2K5P A;  5L83 A;  3M3J A;  2WDR B;  1I4Q A;  3OLM D;  3AEB B;  2K39 A;  1J7C A;  3AU4 A;  3L4P A;  4ZOH C;  1NI3 A;  1WYW B;  4BBN F;  2UWQ A;  3AE8 B;  3BYY B;  2N7D A;  5AZF A;  2LHE A;  3BVM A;  2CU3 A;  4RF0 A;  3TJP A;  2LEK A;  4PS7 A;  1HTO A;  4OZA A;  2OED A;  4EKU A;  2Y5P A;  3ZJV A;  1LO5 D;  4DQO C;  1WIA A;  1D5X C;  2QIL A;  5DCN A;  1GC7 A;  2R2Q A;  2LJ5 A;  1FXA A;  1TS4 A;  2MH7 A;  1NYR A;  2BKF A;  5HI1 A;  1C9F A;  3SFE B;  3V62 A;  3IFW B;  3TUO A;  1V6E A;  2INP E;  2WQY B;  3L0W B;  2ZW0 A;  4EZK A;  2QCZ A;  1VD2 A;  1EF1 A;  2LRW A;  3CSF A;  3ML9 A;  5L95 C;  2KK8 A;  4XGA B;  2WDV B;  2KNB A;  4HDO A;  3KWV A;  3PS6 A;  3EEC A;  3LB8 C;  4JLC A;  3HVD A;  4BOZ B;  2D3C A;  1NDD A;  2JUO A;  3ZNZ B;  2E3T A;  2PLP A;  3FIL A;  4BAX A;  3QQ8 B;  4DXA B;  1Y8R C;  3AE3 B;  3DBH B;  2KFJ A;  4GDK A;  1TKG A;  2UU7 A;  1WGH A;  4LNI A;  4A9A A;  2LUM A;  3T9L A;  2FE8 A;  4M02 A;  4ITK A;  3TEY A;  3TEW A;  3CST A;  1YJ1 A;  2MRP A;  3DVG Y;  4MJS A;  4FA6 A;  2L0T A;  5AUK A;  3A9J B;  2WLB A;  2DYB A;  1HEZ E;  4B95 A;  4TUU A;  2IGG A;  4LCD E;  3QIJ A;  5E6N A;  1FNW A;  4FUL A;  4WAA A;  1NYQ A;  5EE0 A;  1JW9 D;  4WH4 A;  5BO4 B;  4EEW A;  5D7G A;  5TSS A;  2JZP A;  4TQ1 A;  2I1K A;  2M1M A;  3NVZ A;  1GT8 A;  3AN1 A;  1ZXH A;  1J8C A;  3Q8E A;  3ZJT A;  1SXT A;  1I7H A;  3WAL A;  1DOI A;  4HRS A;  1GNU A;  3PO0 A;  1C3T A;  2GBN A;  3H6N A;  3IAM 1;  1SE2 A;  2FCQ A;  4D2K A;  2W3R A;  1GUA B;  3MJ5 A;  2OHF A;  4GLS C;  3Q3O C;  3ZIM A;  3R66 C;  2PTL A;  2PPH A;  4X57 B;  3PT2 B;  4KIK A;  2MX2 A;  2LD9 A;  4JIO U;  3QX1 A;  3DHH C;  4MDK E;  4BOS C;  1R4M I;  2DBY A;  5MPO A;  2XEW A;  2G4S A;  4HCP B;  5C2T B;  3K9O B;  1WZ3 A;  3GE8 C;  2RD0 A;  3PTF C;  4BZA A;  2FNJ B;  4B9K A;  4FLH A;  4E74 A;  2N7E A;  3HUI A;  1CMX B;  2J4X A;  3Q3J A;  4RFB A;  4F7Z A;  2JY6 A;  1KFY B;  4DHZ B;  2BBC A;  2N9E B;  4IWO A;  2MBQ A;  3E9S A;  2AQ2 B;  1ZP0 B;  2ZEQ A;  3IVF A;  2L8J A;  1DYQ A;  3PRM B;  4MEL A;  1V86 A;  5D6J B;  3ZYY X;  2LGY A;  3GZN B;  4BKT A;  1FXT B;  2FCM A;  1WE7 A;  3VFK A;  3NRZ A;  2IO2 B;  3BZD B;  5DPR A;  1JWB D;  3DVG X;  2G1E A;  1KTK A;  2IPK D;  2LVP A;  4FJY A;  1KF6 B;  2M4N A;  2KAJ A;  4BKS D;  2R61 A;  2MLB A;  2V1Y A;  3MHZ A;  4G3X B;  5I4D A;  3PZD A;  4HCN B;  1F2R C;  3QK0 A;  4US8 A;  1QOB A;  4YXD B;  1H4R A;  1I4G A;  1F1H A;  3B2G A;  3I63 C;  3M63 B;  2JXT A;  2KVR A;  4E3C A;  3RNE C;  5G2N A;  2DLB A;  1VCB A;  1PGX A;  1YQB A;  2ZVO A;  2ZZP B;  2ZCC A;  1GG3 A;  1YX5 B;  3NS1 A;  5DPT A;  4DK5 A;  1C77 A;  4JE3 B;  5D2M B;  1R4N B;  2ACZ B;  4LJO B;  2KDI A;  3SDL C;  2RGF A;  2Z8L A;  1UD7 A;  5IA7 A;  1V9J A;  3O13 A;  3H7S A;  2KLC A;  4XC2 A;  1E0Z A;  1RWS A;  2L83 A;  5FK9 C;  2AL3 A;  1YQ4 B;  3AUL A;  5HHD G;  5EE9 A;  1NVI D;  4RGM A;  5BYQ A;  3LYY A;  3KYD D;  1E8W A;  3UIN B;  3KH0 A;  4RM8 A;  3PHW B;  2JQR B;  2H89 B;  2ZJD A;  5LNK 1;  1UGM A;  1KJT A;  2QJL A;  1GB4 A;  3ECI A;  4LNO A;  4WWM A;  1ET9 A;  1TKY A;  3PPA A;  3TEX A;  5FR3 A;  2QHO A;  5T8I A;  3VH3 B;  3BY4 B;  3FC4 A;  1XLP A;  3GE3 C;  3LDZ E;  1VZ6 A;  2H88 B;  4OZC A;  3A1Q A;  3RNA C;  4DWF A;  1C76 A;  1GPX A;  1K50 A;  2WGS A;  1M4V A;  4C00 A;  3GZN I;  3VH4 B;  5BMH A;  2RPQ A;  2KDF B;  3I3T B;  3R7R A;  1I4P A;  3AE7 B;  3UQA A;  3DCG A;  3NZU A;  1FNV A;  2ZNV B;  1IGC A;  3DBL B;  3IT4 B;  3T3N A;  2KDM A;  1CJE A;  3A4S C;  4KSL C;  2BS3 B;  3QCA A;  2K9X A;  2JYE A;  3RFZ B;  3LXF A;  1HTQ A;  1KLG D;  3DVN U;  1RM6 C;  1QF6 A;  1WE6 A;  2PEA A;  3I5J C;  3DBL I;  4ZDV A;  1OQR A;  2J0J A;  3MFG A;  4BVU C;  5IOI A;  2HTH A;  2L76 A;  3P2B A;  5IAA C;  1L6V A;  4KSK C;  4YL8 A;  4P1C C;  1UWX A;  2NPT B;  1WMH B;  2V4L A;  4ARI A;  1L2N A;  2WXG A;  3E56 A;  3APC A;  2LFI A;  3ZDM C;  5E6O A;  3VTU A;  2O6V B;  3A9K A;  2MJ3 A;  2D2Q A;  1IPG A;  2MQJ A;  1TT5 B;  3J9C A;  4KGS A;  1R4N I;  1VLB A;  1C79 A;  4B0M A;  1JRP A;  1JRO A;  2BTE A;  1WXQ A;  1L4D B;  3DWM A;  5BYR A;  4CYE A;  4RGN A;  1K8R B;  5J17 A;  3AV8 A;  4BKS A;  3SHQ A;  3L54 A;  1X1M A;  1ZOY B;  3VTW A;  4J3O D;  4BFR A;  2KJ6 A;  2WXR A;  1Q1O A;  2M0X A;  3BK2 A;  4M8N A;  1WZ0 A;  2VZK D;  4GGQ A;  4HPM B;  4A8X C;  1UH6 A;  1RAX A;  2FUG 1;  3KWL A;  3WIM A;  3LJ3 A;  1I35 A;  2JYT A;  3W5V B;  2EEL A;  1AAR A;  1WJN A;  1T5X D;  4OVV A;  3BVZ A;  2GB1 A;  2LVO A;  1HQR D;  1UF0 A;  1L6U A;  1WR1 A;  1VRA B;  3PLU A;  4NJ7 A;  2DZM A;  4M01 A;  2DX5 B;  1SF0 A;  3RUL A;  1IUE A;  1EWY C;  3GP7 A;  1M94 A;  3QWZ B;  1I4X A;  4L2Y A;  2GBR A;  4JQW C;  3V05 A;  1T6B X;  3EC8 A;  3Q3M C;  2CU1 A;  4KIK B;  5GMV A;  2V3N A;  4JL9 A;  2BB6 A;  1V80 A;  3DBR B;  3ABV B;  3I57 A;  2RMM A;  1H7X A;  4NZL B;  1SIF A;  3VDZ A;  2KC1 A;  3K9P B;  1YQ3 B;  1WXS A;  5JH5 C;  2Y5C A;  1QT9 A;  1ZW7 A;  4W9C A;  2O2V B;  1VR9 A;  1XD3 B;  3W2D A;  2KX0 A;  2L32 A;  1MG4 A;  2N1V A;  2ZCB A;  1XT9 B;  2WHI A;  4MM3 B;  3U7Z A;  1E9M A;  2K0P A;  2MBB B;  1YJI A;  2N0S B;  4YTP B;  2YVC A;  3DBS A;  1FEH A;  5GXG B;  4MH0 E;  4A3P A;  4E71 A;  1EU4 A;  4BKG A;  2FUH B;  3R2T A;  2LGD A;  1WX7 A;  1PFD A;  3BYT B;  5G55 A;  2CJN A;  2D3G A;  3RN9 C;  3KYC D;  2LWP A;  3EHV A;  1N63 A;  4II3 B;  2RDH A;  4WJQ A;  1FD6 A;  3AED B;  4IOI E;  3NHE B;  3DHG C;  1RRB A;  3ZUN A;  4A20 A;  3V61 A;  2IO0 B;  1V5T A;  1T0Q C;  2MSE D;  4WIP A;  1FRD A;  3RZW C;  2LVQ A;  1HE8 A;  4GU2 A;  4K7S A;  3FIL B;  1TBE A;  3DOW A;  2KQS A;  4Q2J A;  1WI0 A;  3VR8 B;  2L52 A;  3MJW A;  2K22 A;  2L1A A;  2WS3 B;  2ZPN A;  4W9D A;  2W55 A;  4IM2 A;  3B1L X;  4OHJ A;  3A9K B;  3P4R B;  1ISN A;  1RYJ A;  2KLG A;  3U2S C;  5LXH A;  1WM2 A;  3BK1 A;  2KMC A;  2GOW A;  3W5U B;  3AEA B;  3P4Q B;  4H2A A;  3ZXV A;  3P4P B;  2L7R A;  1JWA D;  3NZS A;  2G3Q B;  2AWT A;  1QKZ A;  4HDQ A;  4LDT D;  1FFV A;  3URY A;  2BKR B;  4C4V A;  5C1Z A;  2JZ3 B;  4AWJ A;  2KJR A;  2NVU I;  1K53 A;  3C8Y A;  1FNU A;  4O1N A;  1V2Y A;  2D11 A;  3NS8 A;  4URK A;  1S1Q B;  4MSQ B;  4B0E A;  2UYZ B;  3PZ8 A;  2AEH A;  2LMC A;  2GMI C;  2LHD A;  4KZC A;  2EMT A;  4GXB A;  1K51 A;  1LXD A;  1ZGU B;  1LQB A;  4LK0 M;  4A6Q A;  2I38 A;  5BYS A;  2LI5 A;  4YSY B;  4M0W A;  2WU2 B;  1SB3 C;  2N4F A;  4A90 A;  2MWS B;  5BMG A;  3Q8C A;  2DZJ A;  1DOY A;  1P7E A;  3ONS A;  1Q10 A;  3R8B A;  2BT6 A;  4TSS A;  2QC8 A;  1WGG A;  2I1J A;  4AQ7 A;  5KHO A;  4W9I A;  3AE5 B;  1OFF A;  5JHB A;  3IBE A;  3ZXR A;  4AOF A;  2BWE S;  3H7P A;  3ZJU A;  2N9L A;  3P63 A;  2BF8 B;  2O6V D;  3PV1 A;  1WH3 A;  1YNT E;  1P3Q U;  1MJD A;  2PE9 A;  3A4R A;  3NY5 A;  1GC6 A;  3NVW A;  2KTR A;  5CHF A;  3M62 B;  2D07 B;  4IWP A;  4AUQ C;  5EE1 A;  2PVG C;  3SR6 A;  3KUC B;  4WWO A;  4NAM A;  4RH6 A;  2WXL A;  3U8Z A;  1L0Y B;  1VZ8 A;  3BIN A;  2WX0 A;  3OAW A;  3W1Y A;  2YLM A;  4ICU A;  1HXY D;  4WQM A;  1UBQ A;  1F52 A;  2RR9 A;  1HA5 A;  4ZRQ A;  2XN9 C;  4EE2 A;  3VAW A;  2BW2 A;  2WNM A;  4IUM B;  1D3Z A;  3A33 B;  4YT0 B;  2BYT A;  3EFC A;  2NTT A;  3W1S A;  1EWC A;  3Q8B A;  5AEK B;  1P98 A;  5D94 A;  3UI3 A;  2K8C A;  2L05 A;  2MCN B;  3ZKJ C;  2A4Z A;  2CJO A;  5CHV C;  2REX A;  1V1P B; 
#chains in the Genus database with same CATH homology
 2WXP A;  3HRD D;  4MH8 A;  1D6E C;  1BXT A;  1IGD A;  4KGR A;  1SEB D;  4N59 A;  4WWM A;  1ET9 A;  1TJE A;  1TKY A;  3TEX A;  5FR3 A;  1E7P B;  4ARC A;  1B1Z A;  2QEJ C;  2PW9 A;  5T8I A;  2GI9 A;  1T3Q A;  2QSD A;  3FC4 A;  1XLP A;  1PYW D;  4OZB A;  3AB5 A;  4L23 A;  1FIQ A;  1VZ6 A;  2H88 B;  4OZC A;  1TS2 A;  2G9H D;  2M19 A;  1C76 A;  1GPX A;  1K50 A;  1M4V A;  5BMH A;  4IKG A;  2WXJ A;  2WP9 B;  3H8H A;  1PUT A;  1I4P A;  3AE7 B;  1VJK A;  3P1M A;  2MJD A;  1F2R I;  3CIR B;  2ICI A;  1FNV A;  1TKE A;  1IGC A;  4IDI A;  3AE1 B;  3IT4 B;  3T3N A;  2KDM A;  4ZHO A;  4MAC A;  1CJE A;  1V8C A;  2K3U A;  1SIJ A;  1PDX A;  1QLB B;  2BS3 B;  2K9X A;  4C7Y A;  5FKA C;  1EM7 A;  2PVO D;  4WAF A;  1N62 A;  2JYE A;  3AEG B;  1MPE A;  1V97 A;  3LXF A;  3PZ7 A;  3RFZ B;  1VZ7 A;  3MP9 A;  2WXI A;  1YMH E;  1KLG D;  4JWS C;  1RM6 C;  1QF6 A;  3EA6 A;  3Q8F A;  2BB5 A;  1FRR A;  1ROE A;  1ZDV A;  2J53 A;  4N58 A;  2WXQ A;  2KN4 A;  1OQR A;  3MFG A;  1B9R A;  2Q5W D;  1JAL A;  1YN5 A;  1SJH D;  1XLO A;  2KMM A;  1D5Z C;  1V1O A;  4L1B A;  4AS1 A;  2SEB D;  1L6V A;  4RF1 A;  4OVZ A;  1XEE A;  5AUI A;  1UWX A;  1J7A A;  2WU5 B;  3VRB B;  4RGO S;  1GTH A;  4ARI A;  1XCQ L;  2N9K A;  2WXG A;  2BS2 B;  1KH0 A;  1UUP A;  3E56 A;  1L0X B;  4RCO A;  2LFI A;  1I4R A;  4HEA 1;  3W9C B;  1YN3 A;  1YJJ A;  1MHX A;  4YWG G;  1UWM A;  2MJ3 A;  3IXS A;  1ET6 A;  3AEC B;  3AE6 B;  2JSV X;  3SFD B;  3J9C A;  4KGS A;  4C80 A;  1UGJ A;  2VZK B;  4R3D A;  1VLB A;  1C79 A;  3DWG C;  4B0M A;  3ZGZ A;  4UDU C;  1QOA A;  1TYG B;  3AH7 A;  4FXC A;  1JRP A;  1JRO A;  2BTE A;  1WXQ A;  4WUR A;  1L4D B;  1L5P A;  3DWM A;  5BYR A;  3TEZ A;  4HKQ A;  1ZE3 D;  3RPF C;  1AYF A;  4RGN A;  4USA A;  4C56 C;  1ESF A;  5E6J A;  3NZ3 A;  4PT5 A;  3AV8 A;  1L0V B;  4C7Z A;  2WXN A;  4ZHP A;  2PIA A;  1ZOY B;  2YEP F;  1DGJ A;  1GTE A;  2K5P A;  1I4H A;  2QMT A;  2IGD A;  4J3O D;  2WXR A;  2WDR B;  1I4Q A;  1V1P A;  3AEB B;  3BK2 A;  1J7C A;  4JX1 C;  3L4P A;  2VZK D;  4A8X C;  4ZOH C;  1NI3 A;  2Y3A A;  3EUB 2;  1N60 A;  2FUG 1;  1JWM D;  3KWL A;  2ZW1 A;  2JYT A;  1F0Z A;  3AE8 B;  1HZ6 A;  2MEK A;  3BYY B;  3W5V B;  1QIL A;  2EEL A;  2LHE A;  3BVM A;  2D5G A;  1EU3 A;  3V3X A;  2CU3 A;  3AEF B;  4RF0 A;  1D4B A;  2JU6 X;  1T5X D;  2LEK A;  4GDK B;  3BVZ A;  2GB1 A;  1AWD A;  1HQR D;  1QOG A;  1XO3 A;  3P42 A;  4OZA A;  2OED A;  1L6U A;  1VRA B;  2WXH A;  3VQI A;  2Y5P A;  1E10 A;  3U52 E;  5BMI A;  3ZJV A;  1LO5 D;  4KKJ A;  4DQO C;  1J7B A;  1WRI A;  1D5X C;  1SF0 A;  2QIL A;  3VRA B;  3BII D;  1IUE A;  1EWY C;  1JWS D;  2ON8 A;  3GP7 A;  3MC0 B;  1I4X A;  4L2Y A;  2AQ3 B;  1FXA A;  1TS4 A;  4REZ A;  2MH7 A;  1NYR A;  5G5H A;  3V05 A;  2KWD A;  5HI1 A;  1XLQ A;  1T6B X;  1C9F A;  3SFE B;  3HVZ A;  3TUO A;  1C4A A;  1IBX A;  2EKI A;  1BML C;  2INP E;  2WQY B;  2WXM A;  2V0G A;  2ZW0 A;  2V3N A;  2BB6 A;  5H92 C;  4DXF A;  3ABV B;  3I57 A;  1C78 A;  2N7J A;  2RMM A;  1H7X A;  3GB1 A;  4NZL B;  3CF4 A;  1K52 A;  1YQ3 B;  4KKI A;  2HTM E;  2WDV B;  2Y5C A;  1IBX B;  1QT9 A;  5HG2 A;  1PGB A;  1CQV A;  3EGR A;  4OW0 A;  1VR9 A;  3KWV A;  2IJ0 A;  2INN E;  3W2D A;  2L32 A;  3CWI A;  3LB8 C;  2JWU A;  2DYO A;  3HVD A;  1PGA A;  5G5G A;  4MM3 B;  3U7Z A;  2IGH A;  3ETR A;  3NUH B;  1E9M A;  2K0P A;  2N0S B;  1YJI A;  2E3T A;  4YTP B;  1JML A;  2PLP A;  3FIL A;  3KLS X;  1VDV A;  1E6E B;  1FEH A;  3AE3 B;  1JWU D;  5GXG B;  2W54 A;  4MT5 A;  2I2Y A;  3BVG A;  1EU4 A;  1TKG A;  4YSZ B;  3R2T A;  1STE A;  4A9A A;  3BYT B;  1PFD A;  1AN8 A;  1CK1 A;  2LUM A;  2CJN A;  3FAH A;  4ZYS A;  1SBB B;  2FE8 A;  3AEE B;  1WSP A;  1N63 A;  4ITK A;  2BS4 B;  1SE4 A;  1N5W A;  1WWT A;  3TEY A;  2J42 A;  2RDH A;  3IT6 B;  3TEW A;  3AED B;  1FD6 A;  4IOI E;  1Y56 A;  4NAW B;  3WCQ A;  4GDL B;  5AUK A;  2WLB A;  1HEZ E;  1UNS A;  4JWU C;  2SAK A;  2IGG A;  3I9V 1;  1ACC A;  4WIP A;  2KAC A;  1FRD A;  1FNW A;  5EE0 A;  1NYQ A;  1JW9 D;  2LJI A;  4WH4 A;  4CQN A;  4KGT A;  5D7G A;  3FIL B;  5TSS A;  3R2I A;  2JZP A;  3Q8A A;  1SE3 A;  4TQ1 A;  5EE3 A;  2J52 A;  4Q2J A;  3NVZ A;  4XDC A;  1GT8 A;  3VR8 B;  2PKO A;  2L52 A;  2K22 A;  2L1A A;  2WS3 B;  3AN1 A;  2W55 A;  1ZXH A;  3Q8E A;  1JCK B;  3ZJT A;  4OHJ A;  1TS3 A;  1GB1 A;  3P4R B;  1SXT A;  2AQ1 B;  2IDY A;  1RYJ A;  1I7H A;  3U2S C;  1DOI A;  3KQ4 A;  4HRS A;  5HFY A;  1QQR A;  3PO0 A;  1TY2 A;  4JPS A;  2NMQ A;  3NVY A;  3BK1 A;  3IAM 1;  1RFK A;  1SE2 A;  4D2K A;  1CZP A;  2W82 A;  2LGI A;  3W5U B;  1MI0 A;  2W3R A;  3OWE B;  3AEA B;  3MJ5 A;  3P4Q B;  2OHF A;  4GLS C;  4H2A A;  1H7W A;  1FCC C;  5C3J B;  3AM9 A;  3P4P B;  2PTL A;  1JWA D;  2WXK A;  2M56 B;  5D3D A;  1QKZ A;  1FFV A;  2KQ4 X;  3URY A;  2WXF A;  2DYM A;  4XWW A;  1MVK A;  4YTN B;  2X38 A;  4NJC A;  1K53 A;  2RPV A;  2DBY A;  1C4P A;  3C8Y A;  5MPO A;  2W3S A;  1FNU A;  3B9J A;  2QIE B;  4O1N A;  1OQQ A;  5C2T B;  1JQ4 A;  4LTU A;  4B0E A;  1FCL A;  3IAS 1;  1MHH E;  1XXG A;  2LMC A;  3PZ8 A;  1ZUD 2;  2LHD A;  3HUI A;  3T3O A;  2J4X A;  1ZXI A;  1K51 A;  4A6Q A;  4LK0 M;  4RFB A;  2I38 A;  5BYS A;  1KFY B;  2BBC A;  4YSY B;  3E9S A;  2AQ2 B;  4M0W A;  2WU2 B;  1FFU A;  1ZP0 B;  2XNA C;  1SB3 C;  2JX5 A;  3SEB A;  1GOZ A;  5H8Y E;  1DYQ A;  4A90 A;  5BMG A;  3Q8C A;  1DOY A;  1YN4 A;  2GRI A;  3GS2 A;  3ZYY X;  4P16 A;  1P7E A;  2RDG A;  1XF5 L;  1QOF A;  5JXV A;  1Q10 A;  3R8B A;  2ONQ A;  2BT6 A;  1NEN B;  2MJE A;  4TSS A;  4RNA A;  2WDQ B;  2DWQ A;  3ZQ4 A;  3NRZ A;  4AQ7 A;  3BZD B;  1D5M C;  3AE9 B;  4P6V F;  1L4Z B;  4N6E B;  1JWB D;  4RGT A;  3AE5 B;  1OFF A;  1XLN A;  2G1E A;  1KTK A;  1P7F A;  2IPK D;  3N9Y C;  1KF6 B;  1NEK B;  1XCT L;  3ZJU A;  2KAJ A;  2N9L A;  2R61 A;  1FM0 D;  3P63 A;  4XWT A;  3MHZ A;  4HRO A;  1AW7 A;  5I4D A;  2HDE A;  1YNT E;  2E6X A;  1KRH A;  1F2R C;  1F77 A;  4US8 A;  3U4E G;  1QOB A;  4KX6 B;  2B76 B;  3NVW A;  5D3I B;  4A55 A;  1A70 A;  4YXD B;  2V4I B;  1BUI C;  1FO4 A;  1ZDX A;  2TSS A;  3P4S B;  1I4G A;  3B2G A;  2JXT A;  1TZO A;  4XE0 A;  3AE4 B;  1FMA D;  1TY0 A;  4HJG E;  2AX5 A;  2DLB A;  1HZ5 A;  1N61 A;  1PGX A;  3Q69 A;  1WGK A;  1WYG A;  5EE1 A;  2PVG C;  3SR6 A;  1KLU D;  1ENF A;  4NAM A;  1DOX A;  4RH6 A;  1FXI A;  4US9 A;  2WXL A;  1L0Y B;  1VZ8 A;  4TQ0 A;  3NS1 A;  4ZRP A;  1C77 A;  2FBW B;  4YSX B;  1HXY D;  1TS5 A;  4JE3 B;  3NVV A;  4TMA B;  4WQM A;  2ACZ B;  4XDD A;  1GAQ B;  4YTM B;  3AMZ A;  1HA5 A;  2Z8L A;  3AE2 B;  4ZRQ A;  2XN9 C;  4EE2 A;  2BW2 A;  1ZPS A;  2WNM A;  3O13 A;  4YT0 B;  2V3P A;  2BYT A;  2NTS A;  1E0Z A;  2PMV A;  1RWS A;  2NTT A;  3W1S A;  1EWC A;  2L83 A;  3Q8B A;  5FK9 C;  1R7S A;  1YQ4 B;  5HHD G;  3TSS A;  5EE9 A;  1NVI D;  4RGM A;  5BYQ A;  3UI3 A;  3LYY A;  4DXG A;  4HKZ E;  1C4C A;  3B2F A;  3BWU D;  1SJE D;  2JQR B;  1N5X A;  2H89 B;  2CJO A;  2WXO A;  2M0A A;  4LLG M;  5LNK 1;  3VR9 B;  1SSN A;  2QJL A;  1GB4 A;  2YEP B;  1V1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...