3VRBB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vrbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vrbB01
5EE0A 1TKGA 1DOIA 3NRZA 1ZUD2 1YQ4B 1DGJA 1NYRA 2PKOA 1GPXA 1GTHA 4YT0B 2PVGC 5AUKA 2BS2B 4C7ZA 1FXIA 5EE9A 3ZYYX 1XLNA 3NS1A 2WDVB 2WDQB 2N0SB 1FFVA 4FXCA 1DOXA 2Q5WD 4YXDB 3AE8B 1PDXA 1JRPA 4N6EB 1SB3C 2B76B 2E3TA 2W55A 3LXFA 1PFDA 1E9MA 1JROA 3SR6A 1NVID 1NI3A 1GTEA 1FMAD 3DWMA 3AE6B 3P4PB 1E7PB 1QOFA 2HTME 1V97A 4A9AA 3KWLA 3SFEB 1FXAA 3HRDD 1KRHA 1UWMA 4WWMA 3SFDB 2MH7A 1N60A 1L0VB 3AN1A 3L4PA 1NENB 4HROA 4P6VF 1N5XA 5C3JB 3VR9B 4JWSC 1WRIA 2LEKA 4YTNB 1V8CA 1YJJA 1VJKA 2QJLA 2H89B 1T3QA 1TJEA 3B9JA 1ROEA 1JQ4A 1TKEA 3AE5B 3AV8A 4LTUA 1NEKB 2BS3B 2KAJA 5GXGB 3LB8C 2WDRB 2L52A 4ZHPA 2CJOA 2W3SA 1J7AA 1SIJA 2BS4B 1FIQA 1XLOA 4US9A 1WXQA 2EKIA 1L5PA 3W9CB 1N62A 2WLBA 1RM6C 1FM0D 3NVWA 2ACZB 1VLBA 2OHFA 1WWTA 2WU2B 2MJEA 3NVZA 1FFUA 2AX5A 1XLPA 2W54A 3AEFB 5EE1A 2WP9B 1J7BA 1QF6A 2MJDA 3FAHA 2M19A 3P63A 1DOYA 1NYQA 1GT8A 4YSYB 3P4QB 2M56B 4JWUC 3DWGC 4USAA 3W5VB 2QIEB 1QOBA 2WS3B 3AH7A 3BIID 2MJ3A 1JW9D 2FBWB 3ABVB 3AEEB 4C80A 3W5UB 1PUTA 1A70A 1SF0A 2JX5A 1CJEA 2PVOD 3HVZA 1GAQB 2JQRB 1L6VA 3NVYA 2PIAA 5G5HA 2WQYB 4C7YA 1RYJA 1YJIA 1WGKA 3EUB2 3AB5A 4N59A 5EE3A 1E10A 1KF6B 1E0ZA 1JWBD 4YTMB 3CF4A 3AE2B 3AEAB 1CZPA 1XLQA 3VRAB 4WQMA 1AWDA 1QLBB 2H88B 2CJNA 4US8A 3VR8B 3PO0A 1N63A 1RWSA 4N58A 2K9XA 1OQRA 5C2TB 3AEBB 4YSZB 1YQ3B 1B9RA 3AE9B 1ZXIA 1EWYC 5AUIA 3AEDB 4KX6B 2W3RA 1OQQA 1N61A 2DBYA 3AM9A 3AECB 2Y5CA 4ITKA 1KFYB 5H92C 1R7SA 1RFKA 2L83A 3B2GA 3AE1B 5H8YE 2KMMA 4YTPB 1TKYA 1VDVA 4IDIA 1FRDA 1OFFA 3AE4B 3P4RB 3CIRB 1QOGA 3AEGB 2BT6A 3AMZA 3AE7B 3HUIA 3NVVA 4HRSA 1WYGA 3RPFC 1JWAD 1H7XA 1FRRA 1TYGB 3VRBB 2K22A 3FC4A 1H7WA 1JALA 4ZOHC 2K5PA 3P1MA 4ZHOA 2DWQA 1E6EB 3CWIA 3ETRA 5MPOA 1QOAA 1F0ZA 3P4SB 4YSXB 1AYFA 1FO4A 2CU3A 1ZOYB 2G1EA 1I7HA 1XO3A 3WCQA 3B2FA 2WU5B 3AE3B 1IUEA 1QT9A 5G5GA 1J7CA 1L6UA 4JX1C 1N5WA 1ZP0B
chains in the Genus database with same CATH superfamily
4HJKA 4ACFA 4C56C 3Q3OC 3JVZX 2BBCA 3MP9A 5EE9A 1XLNA 4RM9A 5FR6A 3PRZA 4IM0A 5DPWA 3JYUA 3V6EB 1D3ZA 1XQQA 4REZA 1ENFA 1VZ6A 3A1QA 4KSKC 1T0RC 4HROA 2XK5A 3VR9B 2J42A 3PS6A 3FILB 2GOWA 1J19A 3C8YA 1L7YA 3QC8B 1TGZB 3ZO5B 4BBNC 1NEKB 1SE4A 2KAJA 1ZPSA 1C4PA 1WI0A 3ZXRA 2V3SA 3QAQA 1C1YB 1GT8A 3P4QB 4JWUC 3W5VB 5DPSA 1GNUA 2PVOD 2N9LA 2G4DB 4ICVA 2PIAA 2WQYB 1C79A 2LGIA 3LDZE 3ZIMA 2J7QB 2ONQA 3PO0A 1VRAB 4WIPA 2K0PA 4WH4A 1WH3A 1ISNA 5G2NA 3JW0X 2BVCA 2ZNVC 1WE7A 1F52A 4ASWC 4DHJB 2AQ1B 3QARA 2WXFA 2JRIB 4IWOA 2MW5A 1JWSD 1I7HA 1V5OA 2LRWA 3OJ3A 5AUKA 3RNBC 5LXIB 1IBXB 2BQQA 4MM3B 3DVGX 3W1SA 2E3TA 2DAFA 1MG8A 4NJCA 1WGHA 3KWLA 4MT5A 1FXAA 3Q14C 3I9V1 2MBHA 4P6VF 5D3DA 1WXSA 2GBRA 1RFAA 2DHZA 4W9EA 4GXBA 4ANWA 2WXOA 4IOIE 1XF5L 3QJZA 3V05A 1I4QA 4L23A 1XLOA 4US9A 1Q5WB 2LGYA 3Q2AC 5FR3A 1HE8A 1LXDA 1MFWA 2L32A 3ZNGC 1TS5A 4B0EA 1C4CA 2WX0A 3GB1A 2MJ3A 2WXPA 1PUTA 4GN1A 2J0KA 1L6VA 3NVYA 1WZ3A 1CK1A 3AE2B 4HXDA 3RD2A 2KWVB 3DHHC 2IJ0A 2K9XA 4HVBA 1TS3A 4FULA 5AUIA 2G9HD 4W9FA 2ON8A 4TMAB 5IP4D 3RN9C 1IPGA 3AE1B 3RNFC 4F7ZA 4BAXA 1MPEA 2DENB 1UELA 1WYGA 2DLBA 5IKCM 1WY8A 2BWES 1F0ZA 4IWQA 1GOZA 5D6JB 2FCNA 2Z0EB 4RGMA 4RCOA 3RNGC 2K25A 4CO7A 1LM8B 2PVGC 4G0NB 4HDQA 2WDVB 2GI9A 4HPLB 4KGSA 3RCZA 1GTEA 1FCCC 1FMAD 2PTLA 2KMAA 1QOFA 1VZ7A 1XCQL 4JLCA 2MH7A 3Q8CA 1UGMA 4GU2A 3DQVA 4MGIE 3A1QB 1MI0A 4A90A 3DVNV 2DZMA 2KXJA 1SE3A 1VJKA 3DOWA 3M95A 1VD2A 2XK5B 2GBNA 3MTNB 4HPMB 3VUWA 3AV8A 1HZ5A 3VTVA 3B1LX 2MA9B 2JSVX 1RLFA 2CJOA 1WGRA 1QZEA 4R3DA 2JYTA 4AQ7A 4B95A 2OHFA 4AJYB 1P9DU 3V3XA 3ZKJC 3AH7A 1M4VA 2K8HA 1FEHA 3NZ3A 2RPQA 2DYBA 4IM2A 4OZBA 4MDKE 1WGKA 4KDLB 4N59A 1UUPA 2VH1A 2D07B 2LJIA 1FCLA 2IGGA 3K9OB 1RWSA 1OQRA 3HVDA 4CYEA 2MBOA 3KVFB 4P7IA 1WXVA 3EC8A 4JGHB 3AECB 2IDYA 1WE6A 3JSVA 2V3PA 2CR5A 2MHJA 1JWAD 2CKHB 2M17A 3FC4A 2K22A 5FKAC 1E6EB 1WJNA 3IAS1 2YLMA 2JZ3B 4IW0A 4DK5A 2CU3A 1L4DB 4C4VA 4X57B 3ZQ4A 4RNAA 4K81A 2V4LA 3V62A 4J3OD 3Q3JA 5TSSA 4AS1A 2LVQA 3QCAA 2LHEA 3UI3A 4EUTA 5CHVC 2AQ3B 1D5MC 2KQ7A 4BBNF 2C7MB 5CHWA 4BVUC 3NG0A 1E7PB 2HTME 2Y5PA 1SGHA 2KDEB 1N60A 1L0VB 5LNK1 1JCKB 3L08A 1TIFA 1N5XA 2L0FA 3WAOA 1YJJA 2IBIB 2WX1A 1T3QA 3W1YA 4MH0E 2IPKD 5GXGB 1D6EC 3BK1A 3LYYA 1HQRD 2QCZA 3MC0B 4LLGM 3W9CB 3T8MA 2FIDA 2ACZB 2OEDA 4IWPA 1I4RA 1J7BA 1AN8A 4OVVA 1SF0A 3HVZA 1WYWB 3X23A 4BOZB 1MJDA 2JY6A 3R7QA 1UZXB 3VH3B 3BZDB 1Q0WB 3KYCD 2CJNA 3WAPA 3AE9B 3MJWA 3BVMA 4F8CB 4EKUA 1EU4A 2DBYA 2QMTA 1YQBA 1QOGA 1Q1OA 1YN5A 4W9HA 4YSXB 2BYVE 3AE3B 3DBSA 3P42A 5BO4B 1V1PB 4JX1C 4HK2A 3R8BA 3SD5A 3I57A 4GDKA 2PKOA 5CX3A 2KTRB 4HDOA 5D2MB 5HI1A 4XZ4A 3V6CB 2NBVB 3N9YC 2JXXA 2MBEA 1T0QC 1V81A 1HXYD 4FBJB 4NY0A 3UQBA 1YX6B 2EMSA 1XCTL 3L4PA 1T0SC 4B0MA 3PZDA 1BUIC 2N9KA 2KX3A 3TSSA 3CSTA 3KWVA 1LQBA 1H4RA 4MGYE 5E6PA 2I1JA 2RMMA 4WJQA 1L0XB 2R61A 1QQRA 5L83A 1WXAA 1TTNA 2GBKA 2KX0A 1TY0A 2BYTA 4EFOA 1GJZA 3I63C 2MWSB 1PGXA 2GBMA 3OLMD 1V2YA 3DHIC 1E5WA 1JWBD 4YTMB 2QDFA 4LNOA 2AL6A 2LUMA 4US8A 4KGTA 2MP2A 2KZRA 2L8JA 5J18A 4NPNA 4K3CA 1KTKA 4ITKA 3QX1A 4WAAA 4KKJA 1Y56A 3B2GA 2OJRA 1S3SG 4D2KA 2XNAC 4DXGA 3DBHI 3JSVB 2N7EA 4RGOS 2DNFA 1WX9A 2AWTA 3E9SA 3P4SB 4IKGA 3N30A 1X1MA 1K52A 2DZJA 5G5GA 5IAAC 4C4VB 3CSFA 1YQ4B 4EE2A 3W2DA 2BYEA 2D2QA 1IP9A 1FFVA 2LWPA 2ZCBA 3RMKC 1M94A 1NVID 2JPHA 2BKRB 1C9FA 2GMIC 4AUQC 1NI2A 1UF0A 2XEWA 1UH6A 3MHZA 2X38A 2INNE 2WXHA 2K8CA 5DPTA 2WXGA 1KLGD 4GLSC 3B9JA 1SEBD 1ROEA 3AE5B 2KWCA 4MACA 1RRBA 3U8ZA 1I4XA 2IO3B 5C23A 1VLBA 1P7FA 2MJEA 1FFUA 1ZXHA 3ZNID 3FAHA 4WURA 4W9CA 2ZCCA 5HG2A 4BKSD 2C7HA 2R2OA 1GAQB 3R3MA 2BGFA 1KJTA 4LNKA 3MC8A 3V61A 4XGAB 3DDCB 3PTFC 2KQSA 4JE3B 1WSPA 1Z5SB 2D5GA 4LJOB 3O13A 1YN3A 4YSZB 2K8BA 3Q8BA 2NTTA 3BVGA 2KJRA 4QAYA 4KX6B 2GB1A 1I4GA 2HJ1A 4HEA1 2WGSA 2K1FA 3QQ8B 1GG3A 4XX5A 3IVFA 1LO5D 3ECIA 2WNMA 3Q8AA 2KDFB 3B2FA 3RT3B 3T3OA 2DZIA 1PDXA 2LXAA 2R2QA 4DDGD 4BFRA 2INDC 4LJPB 2UYZB 3IT6B 4GDKB 4WAFA 1OEYA 4YXDB 1R4NI 4JIOU 2ZEQA 2WXMA 2RDHA 4I6PA 1WJUA 4A3PA 2WXKA 4BZAA 3KUCB 2FAZA 4GSWA 5IOIA 5JHBA 4TQ1A 4RF0A 2QJLA 2DZKA 4K3BA 1FNUA 4ARCA 1YD8U 4W9LA 4DWFA 3VUXA 2RD0A 3C0RB 4B6WA 1L5PA 2KDMA 3ZTCA 1N62A 4PS3A 1QILA 3X0WA 3TIXA 3AEFB 3RUIB 1WIAA 4NAWA 2HJ8A 2EMTA 2LFIA 4ARIA 3PVLA 2L7RA 3Q6BA 2NR2A 1WX7A 4II2B 5G5HA 2D10A 1EWCA 3R2IA 4KSLC 3AEAB 1KH0A 2KJHB 2X8XX 4WQMA 1PGBA 1B9RA 1V80A 1VCBA 2UWQA 4XDDA 2MP2B 2KFJA 3KUZA 4FADA 4EZLA 3AM9A 2M1MA 2IO2B 4LNNA 4ZRIA 4IUMB 2LJ5A 2WXLA 1JALA 3L54A 3P1MA 2AEHA 5MPOA 3M3JA 2IO1B 1J7CA 1PQSA 3NRZA 2KD0A 3AI5A 2RDBC 2NS5A 2FUHB 3H1UA 2BS2B 3QK0A 1TT5B 4M0WB 3LXFA 2B76B 2W55A 3APFA 2LUEA 2KTFA 3CF6E 4A9AA 3TMPB 2C60A 1V1PA 1I4PA 2KVZA 3AN1A 2NMQA 2QEJC 3AXCA 3PSEB 2KLCA 1E8XA 2HTHA 3ML8A 3QWZB 2JRHA 2KTRA 3LB8C 2WDRB 3RYTA 2KYWA 1UWXA 2JT4B 1SIJA 3OAWA 4PT5A 3LJ3A 1J8CA 2NTSA 4W9KA 2BB6A 3A4RA 3ZTDA 1QF6A 2WP9B 2G45B 4K7SA 2KO3A 5C1ZA 1JWMD 4NQKE 3ZJTA 2IY1B 1C3TA 4AOFA 2LHDA 1C4AA 2O6VB 3OJ4B 1E10A 1KF6B 1Y8RC 3I3TB 3H7SA 4TUUA 1BT0A 1ZE3D 2I2YA 4WJOA 1P7EA 2LZ6A 4EZJA 5LXHA 2KNBA 1YMHE 1EWYC 2DX5B 4G11A 3RNEC 4XWTA 1JMLA 2REXA 1LFDA 4YTPB 1OFFA 3Q8FA 1Z2MA 1I42A 5AZHA 1FRRA 2WXIA 2ZVNA 3DPDA 3UIPB 2MCNB 3GOEA 1E8ZA 3U2SC 3ZJUA 1WXMA 4BKSA 1TKGA 1IGCA 4YT0B 2WHIA 3PZ7A 1FXIA 1WGGA 2WYQA 2WDTB 1DOXA 2FUG1 4N6EB 2CU1A 3EHVA 1KLVA 1SJHD 3DWMA 2BF8B 2HD5B 1V97A 3I5JC 1UWMA 1EUVB 2D3AA 2WWZA 4MJSB 4YWGG 4KVGB 1WRIA 4FJZA 3URYA 3ZLZA 1F2RI 1I35A 4YTNB 4PS7A 3RNAC 1PGAA 4XYCA 1E90A 2BS3B 4MSQB 5IO9A 1UGJA 1J7AA 1WXQA 1P3QU 2DAJA 1B1ZA 2O6VD 2WLBA 3UQAA 3TEWA 4OHJA 2YVCA 5E6JA 3ZDTA 1ESFA 3NVZA 1XLPA 2DYOA 3B08A 3U7ZA 3H8HA 1NYQA 3SHQA 4A20A 4DHZB 2PEAA 4NAWB 3ABVB 2N1WA 1A70A 1WJ4A 1A5RA 2LXCA 2IY0B 3L13A 2J4XA 1C77A 5J17A 1T6BX 3HIZA 3N32A 5D3IB 3QIJA 2JYEA 3U7DA 3SDLC 2ZPNA 2W3RA 2BTEA 2V9HA 3NHEB 4G50A 5E6NA 3WANA 2ASQA 2LD9A 1F9JA 2QSDA 4RMAA 2GRIA 2JXTA 1OTRB 3T3NA 2D3GA 3PRMB 3NVVA 3GP7A 3AMZA 4KDIC 4K7UA 1BXTA 2KFKA 4ZOHC 3CWIA 2K3UA 2KN5A 3BYYB 3IFWB 3ZRFA 4W9GA 1VZ8A 1GPXA 3IXSA 1TBEA 1Q10A 4DDID 3DVNU 5HHDG 5T8IA 2KN4A 3J9CA 3Q3MC 1RAXA 1T0YA 2L05A 2MQJA 1GC6A 3H9DA 4HLEA 1I4HA 4ZRPA 2GLSA 4K1RB 4A55A 3PRPB 4ZRKA 2HE7A 2KT7A 4GDLB 5KHOA 4MEMA 3IAM1 2H89B 5D94A 1JRUA 1NBFC 1D5XC 5JZEB 1V5TA 4CHKA 2INPE 4AP4C 5BMIA 3ZRCA 4HCNB 1N6ZA 3KLSX 4DQOC 1WGDA 2L1AA 3VUYA 1DOYA 2KK8A 2INCC 5JHAA 3A9JA 1JW9D 2FBWB 4TV3A 1R4MI 2CS4A 4HCPB 2KANA 4XC2A 1SIFA 2ZW0A 4ANVA 3M63B 2JWZA 1N63A 4N58A 2N9PC 4BKGA 4W9DA 2KC2A 4URKA 3U52E 1P1AA 1N61A 5H92C 4PS8A 1F2RC 2L83A 1TKYA 1JWUD 2BPSA 4IDIA 3CIRB 3GE3C 2BT6A 2MSED 3VRBB 2PLPA 1H8CA 3H6NA 2JUOA 3HK0A 1AYFA 1FO4A 2AYOB 2IGHA 1WMHA 2WU5B 4P1CC 3Q3NC 1DOIA 1WM2A 3ZDMC 1GTHA 1WR1A 2N0SB 3OWEB 3QA8A 3T9LA 5HFYA 2MEKA 4FJYA 2L3ZA 1JRPA 3TEZA 1ET6A 1WJ6A 4NJ6A 2KOXA 2M8SA 3VAWA 2Z8LA 4WWMA 1XXGA 3QHTA 3SFDB 3A9KA 2O2VB 1FNVA 3BVZA 2D3CA 1D5ZC 5D7GA 2Z59B 2CHZA 1IGDA 1SSNA 2N4FA 4M0WA 3ALBA 2RR9A 3EA6A 2IGDA 4GIVA 2ZW1A 3AU5A 4WWPA 1STEA 5BMHA 1FIQA 5CTRC 1BMLC 5EDSA 3APCA 3NJTA 5IN7A 3DBHB 2FIFA 4EOYA 5EE1A 2W54A 2E6XA 2KDIA 3HHMA 2QIEB 2BW2A 2MBQA 4C00A 2PE9A 1YNTE 3VFKA 2QHOA 3L0WB 3MJ5A 1GC7A 4HKQA 2W9NA 1RYJA 4LK0M 2PPHA 3AB5A 2V1YA 1CZPA 1XLQA 2FCQA 4LDTD 2MRPA 3EECA 3RZWC 5TR5A 1V6EA 1ZXIA 5GMVA 3ZXVA 3AEDB 3K9PB 1GB1A 1T5XD 3PHWB 4I6NB 1R7SA 5BYSA 4TQ0A 2O6VA 2N7JA 3RPFC 5AZGA 1TYGB 4RGNA 1H7WA 1TZOA 2BB5A 4WWOA 2HDEA 2KFKB 4BOSC 4IG7B 4B9KA 5E6OA 4XE0A 3AU4A 1N5WA 2A5UA 1TS2A 2RDGA 3BWUD 3VTWA 5L95C 3O65B 5BYRA 2KHWB 3A4SC 2KLGA 4C7ZA 1XD3B 2V4IB 1P98A 3GS2A 3BINA 2N1VA 4PYZA 4WQOB 1FD6A 3VVWB 1E9MA 1JROA 2N9XA 4PYUA 2EELA 2KC1A 4FN2A 1V86A 2SAKA 3AE6B 1XEEA 2XBBC 3RULA 3HM6X 1IYFA 1WF9A 2M0AA 3PPAA 5BYQA 5C3JB 4JWSC 3R7RA 1TJEA 3DCGA 3UGBB 2PJHA 4ZRJA 2L52A 2L0TA 4II3B 4GB9A 2JU6X 2Y5BB 3NZUA 4N9F4 4LNIA 2RPVA 3AULA 2PE6B 3R66C 3H7PA 1KOTA 2KDBA 4WWNA 2UU7A 4MJSA 2AX5A 5I4DA 4MSMB 3TUOA 4ICUA 1AW7A 3DWGC 3PZ8A 3BIID 4L2YA 3ZNHB 4A3OA 4HJGE 3L17A 3A9JB 2EKEC 4NZLB 5JH5C 1YJIA 5EE3A 1OGWA 1YX5B 2LRUA 1R4NB 1AWDA 3NS8A 1WZ0A 2JZZA 2CHWA 2BKFA 3ONSA 3WA0A 1KFYB 4RH6A 4F1SA 4OW0A 1MVKA 1UNSA 1ZKHA 2NBUA 3P4RB 4AWJA 4MGKE 1E7UA 3L16A 1EF1A 3ZJVA 2K5PA 3ZW3A 3P2BA 1G6JA 2KACA 4RGTA 1WMHB 2C9WB 1ZP0B 3N20C 4WJPA 1ZUD2 1NYRA 3VTUA 1ZDXA 1ZGUB 1WFYA 2VH2A 3AE8B 5G55A 2FE8A 4RM8A 2J0JA 3GE8C 1PFDA 1ZW7A 1KLUD 4DHZE 4LNFA 1KRHA 4UDUC 2MBBB 4KZ0A 2C5LC 4M00A 2XN9C 4J6IA 2L76A 3ZUNA 1SE9A 4TSSA 1EO6A 3A9KB 3TEXA 2LEKA 2LGSA 4OVZA 1TKEA 4M8NA 1AARA 1V49A 2LMCA 2VRRB 4DHJD 2NCNA 1J0GA 2L00B 3V60A 1FM0D 3NVWA 3KQ4A 1GUAB 2N7DA 4GDLA 4M02A 2LI5A 3GZNI 3PLUA 2NVUI 1EM7A 2JQRB 3ENEA 4JPSA 1MHHE 4RF1A 2NPTA 4GGQA 3EUB2 1E0ZA 2YEPF 4IM3A 3EGRA 3VRAB 4IC7B 1UBQA 2RSUA 3DHGC 3VR8B 5KHQA 3TJPA 1V1OA 3A33B 3UINB 1EU3A 3NY5A 2Y3AA 1S1QB 2J52A 2KMCA 2FCMA 4ANUA 3GZNB 5H8YE 1V9JA 1VDVA 2W82A 4FHKA 3NUHB 4HRSA 1SJED 4FA6A 2OOBB 2G1EA 1IUEA 3M62B 3E56A 3ZYYX 2CHXA 5IA7A 4A6QA 2LGDA 2SEBD 3KH0A 3VQIA 4JL9A 2AQ2B 1K50A 2VZKB 4HKZE 2MLBA 1NI3A 2B3AA 1F1HA 4RFBA 3SFEB 3Q69A 3Q3FA 2A4ZA 3DBLI 2QC8A 1V8CA 1L2NA 1PYWD 3KYDD 2KKCA 4ZYSA 1JQ4A 4ZDVA 2V3NA 2QILA 1EF5A 3EFCA 4W9JA 4P1BC 1WRDB 5DCNA 4G3XB 4OZAA 2BS4B 2IYDB 2M4NA 3IBEA 3U30A 4E71A 1XT9B 1C76A 1RM6C 3H7PB 1E8WA 2O2VA 4KIKA 3P63A 3APDA 4YSYB 1HTQA 4NQLB 1E8YA 2IO0B 2IZVB 3DBLB 4S0RA 4L1BA 5BMGA 4OZCA 4YL8A 3VDZA 3MC9A 2D11A 4HWIB 3EFUA 2G4SA 4TKNA 5LLIA 2WXQA 1DYQA 4XWWA 1CQVA 4GMVA 2V0GA 1UD7A 3ML9A 1CMXB 1WR6E 1HEZE 4XDCA 5C2TB 3AEBB 3VXWA 2J0MA 4FJVB 3WAMA 4A8XC 2JVCA 2LVPA 4CQNA 2KWDA 3PLVA 1FPYA 2YEPB 3RI7C 3C19A 3AE4B 3OG5A 2AL3A 3HUIA 3AEGB 3TL5A 2VZKD 2DYMA 3Q8EA 4HPPA 3L10B 1QOAA 3ZGZA 4ANXA 3R2TA 3SEBA 1XO3A 1QT9A 1L6UA 3RZFA 3VHTC 1HZ6A 2ZVOA 2FNJB 1DGJA 2ICIA 1KM7A 3ZVVA 2OJWA 3U4EG 1GB4A 1D4BA 2WDQB 1ZDVA 4FXCA 4P16A 3HM3A 1TZ1A 3IHPC 1SB3C 3PT2B 2WXJA 1HTOA 1OQYA 5AZFA 2FCSA 3P4PB 1VR9A 3HRDD 3NZSA 3SU8X 1MHXA 4S17A 3FILA 1NENB 2NBWB 5CHFA 3ZNZB 3PV1A 1K8RB 4JQWC 3TCAA 1YN4A 4LTUA 5J2RA 4ZHPA 2W3SA 2BWFA 2JWUA 2GBJA 3BY4B 3WIMA 1SXTA 4NNJB 4FLHA 1MG4A 2MJDA 2M19A 4USAA 1QOBA 2WS3B 3PREA 2JF5A 1QKZA 2TSSA 3RFZB 4ZRQA 1SE2A 3CMMB 2JX5A 4EEWA 2LVOA 4FHJA 2KQ4X 2JZPA 3TEYA 4GOCA 2N9EB 2BYFA 1K53A 1FNWA 4OVUA 2NPTB 3IG3A 3RNCC 3UF8A 4EZKA 2RGFA 1K51A 3D32A 3DVGY 4PK1A 1RFKA 3N1YC 4BKTA 1OEYJ 2KWUB 2D3BA 4ZHOA 3ETRA 1ZOYB 3WCQA 5JXVA 5DPRA 4ZYNA 1YIWA 4KZCA 5EE0A 1IBXA 5AEKB 1HA5A 3NOBA 4MM3A 3N1ZC 3NS1A 2I1KA 1C78A 4O1NA 2Q5WD 1R4MB 3UIOB 4MELA 1L4ZB 2C7NB 3SR6A 3W1SC 2K6DB 3N3KB 2Z0DB 3WALA 1WM3A 3FKYA 4LDTB 2PW9A 2I38A 4MH8A 4LCDE 5HKHA 1YJ1A 5FK9C 1FXTB 1SBBB 2M0XA 2LASA 4DBGA 1P0RA 2ZZPB 2K6QA 1WGYA 4H2AA 4W9IA 3BYTB 1ET9A 4M01A 1U4AA 2MX2A 2EKIA 4DXFA 4KKIA 2G3QB 2WXNA 1WWTA 2WU2B 1YOVB 3DBRI 3N1XC 2M56B 2ZJDA 4KIKB 2WXRA 1L0YB 2PMVA 2LGXA 3AEEB 2KJ6A 3W5UB 4C80A 4MGZE 4M8MA 1CJEA 4WJNA 2ZNVB 3BK2A 1NDDA 4NJ7A 1LGRA 3KW5B 3MHSD 2J53A 4C7YA 1ACCA 3IT4B 3CF4A 3B0AA 3S2AA 1UBIA 2K39A 4AJWA 3VH4B 1QLBB 2H88B 4DXAB 1F77A 1YQ3B 1TY2A 3DBRB 4E74A 3TBLD 2ZPYA 1E7VA 1OQQA 4I6LB 4KGRA 3PGEA 2Y5CA 4NAMA 4Q2JA 3KUDB 2KMMA 1FRDA 3AE7B 1TS4A 1H7XA 2KVRA 3MFGA 4E3CA 2DWQA 4KV2A 4K7WA 3PHXB 1WX8A
chains in the Genus database with same CATH topology
3R8BA 1TKGA 1ZUD2 1NYRA 3I57A 2PKOA 4C56C 1IGCA 1ZDXA 4YT0B 3PZ7A 2BBCA 1FXIA 3MP9A 5EE9A 1XLNA 1DOXA 3AE8B 2FUG1 5HI1A 2FE8A 4N6EB 3N9YC 1PFDA 1SJHD 3DWMA 1HXYD 1KLUD 1V97A 4REZA 1ENFA 1KRHA 1UWMA 1VZ6A 4UDUC 2XN9C 1XCTL 3L4PA 4YWGG 4HROA 4TSSA 3VR9B 2J42A 1WRIA 3TEXA 2LEKA 3URYA 1F2RI 4YTNB 3FILB 4B0MA 3C8YA 4OVZA 1PGAA 1BUIC 1TKEA 2N9KA 1NEKB 2BS3B 1SE4A 2KAJA 1ZPSA 3TSSA 2LMCA 3KWVA 1UGJA 1J7AA 1C4PA 1WXQA 2RMMA 1B1ZA 1L0XB 2R61A 2WLBA 1QQRA 3TEWA 1FM0D 3NVWA 3KQ4A 4OHJA 5E6JA 1ESFA 3NVZA 1XLPA 2DYOA 3U7ZA 3H8HA 1NYQA 1GT8A 3P4QB 4JWUC 3W5VB 1TY0A 2BYTA 4NAWB 3ABVB 1A70A 1EM7A 2PVOD 2JQRB 2N9LA 4JPSA 1MHHE 2PIAA 2J4XA 2WQYB 1C77A 4RF1A 1PGXA 3EUB2 1E0ZA 2YEPF 1C79A 2LGIA 1JWBD 4YTMB 3EGRA 1T6BX 3VRAB 5D3IB 2LUMA 4US8A 3VR8B 2ONQA 2JYEA 3PO0A 4KGTA 1V1OA 1EU3A 1VRAB 2W3RA 4WIPA 2K0PA 2Y3AA 4WH4A 2J52A 2BTEA 1KTKA 4ITKA 2QSDA 4KKJA 1Y56A 2GRIA 2JXTA 3B2GA 5H8YE 1VDVA 2W82A 3T3NA 3NUHB 3NVVA 3GP7A 4HRSA 3AMZA 1SJED 2AQ1B 4D2KA 2XNAC 4DXGA 2WXFA 1BXTA 4RGOS 4ZOHC 3CWIA 3E9SA 2K3UA 3P4SB 1JWSD 4IKGA 2G1EA 3BYYB 1I7HA 1K52A 1IUEA 5G5GA 3E56A 3ZYYX 1VZ8A 1YQ4B 4A6QA 1GPXA 4EE2A 2SEBD 5AUKA 3IXSA 3W2DA 1IBXB 1Q10A 1FFVA 4MM3B 5HHDG 5T8IA 3VQIA 2AQ2B 1K50A 2KN4A 3J9CA 3W1SA 2VZKB 4HKZE 2E3TA 1NVID 1NI3A 4NJCA 1I4HA 4ZRPA 4RFBA 3KWLA 4MT5A 4A55A 3SFEB 1FXAA 1C9FA 3Q69A 3I9V1 3MHZA 2X38A 2INNE 4P6VF 2WXHA 5D3DA 4GDLB 1V8CA 3IAM1 1PYWD 2WXGA 1KLGD 4GLSC 2H89B 2WXOA 3B9JA 1SEBD 4IOIE 4ZYSA 1ROEA 1XF5L 1JQ4A 3AE5B 2V3NA 2QILA 1D5XC 4MACA 3V05A 1I4QA 4L23A 4OZAA 2BS4B 1XLOA 4US9A 1I4XA 2INPE 5BMIA 1C76A 1RM6C 5FR3A 1VLBA 1P7FA 3KLSX 2MJEA 1FFUA 4DQOC 2L32A 1ZXHA 3FAHA 2L1AA 3P63A 4WURA 1DOYA 4YSYB 1TS5A 4B0EA 1C4CA 3GB1A 2MJ3A 2WXPA 1JW9D 5HG2A 2FBWB 4L1BA 5BMGA 4OZCA 1PUTA 1GAQB 1L6VA 3NVYA 1CK1A 2WXQA 3AE2B 1DYQA 4XWWA 4JE3B 1CQVA 1WSPA 2ZW0A 2D5GA 2V0GA 2IJ0A 3O13A 1N63A 4N58A 2K9XA 1HEZE 4XDCA 5C2TB 3AEBB 4YSZB 1YN3A 1TS3A 3Q8BA 2NTTA 3BVGA 5AUIA 3U52E 4A8XC 4CQNA 4KX6B 2G9HD 2GB1A 2KWDA 2ON8A 4TMAB 1N61A 5H92C 1F2RC 2YEPB 2L83A 3AE1B 1I4GA 1TKYA 1JWUD 4IDIA 4HEA1 3AE4B 1MPEA 3CIRB 3HUIA 3AEGB 2BT6A 1WYGA 2DLBA 2VZKD 3VRBB 2PLPA 2DYMA 3Q8EA 1F0ZA 1QOAA 1GOZA 1LO5D 3ZGZA 1AYFA 2WNMA 3Q8AA 3R2TA 1FO4A 2IGHA 3SEBA 1XO3A 3B2FA 2WU5B 1QT9A 4RGMA 3T3OA 1PDXA 1L6UA 4RCOA 1HZ6A 1DOIA 1DGJA 2ICIA 1GTHA 2PVGC 3IT6B 3U4EG 4GDKB 1GB4A 1D4BA 2WDVB 4WAFA 2WDQB 1ZDVA 2N0SB 3OWEB 4FXCA 4P16A 5HFYA 4YXDB 2MEKA 2GI9A 1JRPA 4KGSA 3TEZA 1ET6A 1SB3C 2WXJA 2WXMA 2RDHA 1GTEA 1FCCC 1FMAD 2PTLA 3P4PB 2WXKA 2Z8LA 1QOFA 1VZ7A 1VR9A 4WWMA 1XXGA 1XCQL 3HRDD 3SFDB 2MH7A 3Q8CA 1MHXA 1FNVA 3BVZA 1D5ZC 1NENB 1MI0A 3FILA 5D7GA 4A90A 4TQ1A 1IGDA 4RF0A 2QJLA 1SE3A 1SSNA 1VJKA 1FNUA 4M0WA 4ARCA 3AV8A 1HZ5A 1YN4A 3EA6A 4LTUA 2IGDA 2ZW1A 2JSVX 1STEA 4ZHPA 2CJOA 2W3SA 2JWUA 5BMHA 1FIQA 1BMLC 4R3DA 1L5PA 2KDMA 1N62A 2JYTA 4AQ7A 1QILA 2OHFA 3V3XA 1SXTA 5EE1A 2W54A 3AEFB 2E6XA 2MJDA 2M19A 4USAA 2QIEB 1QOBA 2WS3B 3AH7A 1M4VA 2LFIA 1QKZA 2TSSA 2BW2A 3RFZB 4ZRQA 1SE2A 1FEHA 1YNTE 4ARIA 2JX5A 3NZ3A 2KQ4X 3MJ5A 2JZPA 4HKQA 5G5HA 4OZBA 3TEYA 1RYJA 1EWCA 1WGKA 4LK0M 3AB5A 3R2IA 4N59A 1UUPA 3AEAB 1CZPA 1FNWA 1K53A 1KH0A 1XLQA 2LJIA 1FCLA 4WQMA 2IGGA 1PGBA 1RWSA 1OQRA 3HVDA 1B9RA 1K51A 1ZXIA 4XDDA 3AEDB 1GB1A 1T5XD 3AM9A 3AECB 2IDYA 1R7SA 1RFKA 5BYSA 2V3PA 4TQ0A 2N7JA 3RPFC 1JWAD 1TYGB 2K22A 3FC4A 4RGNA 1H7WA 1JALA 2WXLA 5FKAC 3P1MA 4ZHOA 1E6EB 3ETRA 1TZOA 5MPOA 2BB5A 3IAS1 2HDEA 2CU3A 1ZOYB 1L4DB 3WCQA 5JXVA 1J7CA 4XE0A 3ZQ4A 4RNAA 1N5WA 1TS2A 2RDGA 3BWUD 3NRZA 5EE0A 1IBXA 5BYRA 4J3OD 1HA5A 5TSSA 4AS1A 2BS2B 4C7ZA 2V4IB 3NS1A 3GS2A 4O1NA 1C78A 2Q5WD 2LHEA 3UI3A 1FD6A 3LXFA 2B76B 2AQ3B 2W55A 1D5MC 1E9MA 1JROA 1L4ZB 3SR6A 2EELA 2SAKA 3AE6B 1XEEA 1E7PB 2HTME 2Y5PA 4A9AA 2PW9A 2I38A 4MH8A 1V1PA 1I4PA 1N60A 1L0VB 5LNK1 2M0AA 1JCKB 3AN1A 2NMQA 2QEJC 1N5XA 5C3JB 4JWSC 5BYQA 5FK9C 1YJJA 1SBBB 1T3QA 1TJEA 2IPKD 5GXGB 4H2AA 1D6EC 3BK1A 3LB8C 3LYYA 1HQRD 2WDRB 2L52A 1ET9A 3BYTB 3MC0B 2JU6X 1UWXA 4LLGM 1SIJA 4PT5A 2RPVA 2EKIA 3W9CB 4DXFA 2NTSA 4KKIA 2ACZB 2BB6A 2OEDA 2WXNA 1WWTA 2WU2B 1I4RA 2AX5A 1QF6A 5I4DA 2WP9B 1J7BA 3TUOA 2M56B 1AW7A 3DWGC 3PZ8A 2WXRA 1L0YB 1AN8A 3BIID 2PMVA 4L2YA 1JWMD 3AEEB 4C80A 3W5UB 4HJGE 3ZJTA 1SF0A 1CJEA 4NZLB 3HVZA 3BK2A 2LHDA 2J53A 4C7YA 1YJIA 1ACCA 1C4AA 5EE3A 1E10A 1KF6B 3IT4B 3CF4A 3BZDB 1ZE3D 2I2YA 1AWDA 1QLBB 2H88B 2CJNA 1P7EA 1F77A 1YQ3B 1TY2A 3AE9B 1YMHE 1EWYC 3BVMA 1OQQA 4KGRA 1EU4A 2DBYA 2Y5CA 4XWTA 1KFYB 4NAMA 2QMTA 4Q2JA 4RH6A 1JMLA 4OW0A 2KMMA 4YTPB 1MVKA 1UNSA 1FRDA 1OFFA 3P4RB 1QOGA 3Q8FA 3AE7B 1YN5A 1TS4A 3ZJVA 1H7XA 3MFGA 1FRRA 2WXIA 2K5PA 2DWQA 4YSXB 2KACA 4RGTA 3AE3B 3P42A 3U2SC 3ZJUA 1V1PB 4JX1C 1ZP0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE0 A;  1TKG A;  1DOI A;  3NRZ A;  1ZUD 2;  1YQ4 B;  1DGJ A;  1NYR A;  2PKO A;  1GPX A;  1GTH A;  4YT0 B;  2PVG C;  5AUK A;  2BS2 B;  4C7Z A;  1FXI A;  5EE9 A;  3ZYY X;  1XLN A;  3NS1 A;  2WDV B;  2WDQ B;  2N0S B;  1FFV A;  4FXC A;  1DOX A;  2Q5W D;  4YXD B;  3AE8 B;  1PDX A;  1JRP A;  4N6E B;  1SB3 C;  2B76 B;  2E3T A;  2W55 A;  3LXF A;  1PFD A;  1E9M A;  1JRO A;  3SR6 A;  1NVI D;  1NI3 A;  1GTE A;  1FMA D;  3DWM A;  3AE6 B;  3P4P B;  1E7P B;  1QOF A;  2HTM E;  1V97 A;  4A9A A;  3KWL A;  3SFE B;  1FXA A;  3HRD D;  1KRH A;  1UWM A;  4WWM A;  3SFD B;  2MH7 A;  1N60 A;  1L0V B;  3AN1 A;  3L4P A;  1NEN B;  4HRO A;  4P6V F;  1N5X A;  5C3J B;  3VR9 B;  4JWS C;  1WRI A;  2LEK A;  4YTN B;  1V8C A;  1YJJ A;  1VJK A;  2QJL A;  2H89 B;  1T3Q A;  1TJE A;  3B9J A;  1ROE A;  1JQ4 A;  1TKE A;  3AE5 B;  3AV8 A;  4LTU A;  1NEK B;  2BS3 B;  2KAJ A;  5GXG B;  3LB8 C;  2WDR B;  2L52 A;  4ZHP A;  2CJO A;  2W3S A;  1J7A A;  1SIJ A;  2BS4 B;  1FIQ A;  1XLO A;  4US9 A;  1WXQ A;  2EKI A;  1L5P A;  3W9C B;  1N62 A;  2WLB A;  1RM6 C;  1FM0 D;  3NVW A;  2ACZ B;  1VLB A;  2OHF A;  1WWT A;  2WU2 B;  2MJE A;  3NVZ A;  1FFU A;  2AX5 A;  1XLP A;  2W54 A;  3AEF B;  5EE1 A;  2WP9 B;  1J7B A;  1QF6 A;  2MJD A;  3FAH A;  2M19 A;  3P63 A;  1DOY A;  1NYQ A;  1GT8 A;  4YSY B;  3P4Q B;  2M56 B;  4JWU C;  3DWG C;  4USA A;  3W5V B;  2QIE B;  1QOB A;  2WS3 B;  3AH7 A;  3BII D;  2MJ3 A;  1JW9 D;  2FBW B;  3ABV B;  3AEE B;  4C80 A;  3W5U B;  1PUT A;  1A70 A;  1SF0 A;  2JX5 A;  1CJE A;  2PVO D;  3HVZ A;  1GAQ B;  2JQR B;  1L6V A;  3NVY A;  2PIA A;  5G5H A;  2WQY B;  4C7Y A;  1RYJ A;  1YJI A;  1WGK A;  3EUB 2;  3AB5 A;  4N59 A;  5EE3 A;  1E10 A;  1KF6 B;  1E0Z A;  1JWB D;  4YTM B;  3CF4 A;  3AE2 B;  3AEA B;  1CZP A;  1XLQ A;  3VRA B;  4WQM A;  1AWD A;  1QLB B;  2H88 B;  2CJN A;  4US8 A;  3VR8 B;  3PO0 A;  1N63 A;  1RWS A;  4N58 A;  2K9X A;  1OQR A;  5C2T B;  3AEB B;  4YSZ B;  1YQ3 B;  1B9R A;  3AE9 B;  1ZXI A;  1EWY C;  5AUI A;  3AED B;  4KX6 B;  2W3R A;  1OQQ A;  1N61 A;  2DBY A;  3AM9 A;  3AEC B;  2Y5C A;  4ITK A;  1KFY B;  5H92 C;  1R7S A;  1RFK A;  2L83 A;  3B2G A;  3AE1 B;  5H8Y E;  2KMM A;  4YTP B;  1TKY A;  1VDV A;  4IDI A;  1FRD A;  1OFF A;  3AE4 B;  3P4R B;  3CIR B;  1QOG A;  3AEG B;  2BT6 A;  3AMZ A;  3AE7 B;  3HUI A;  3NVV A;  4HRS A;  1WYG A;  3RPF C;  1JWA D;  1H7X A;  1FRR A;  1TYG B;  3VRB B;  2K22 A;  3FC4 A;  1H7W A;  1JAL A;  4ZOH C;  2K5P A;  3P1M A;  4ZHO A;  2DWQ A;  1E6E B;  3CWI A;  3ETR A;  5MPO A;  1QOA A;  1F0Z A;  3P4S B;  4YSX B;  1AYF A;  1FO4 A;  2CU3 A;  1ZOY B;  2G1E A;  1I7H A;  1XO3 A;  3WCQ A;  3B2F A;  2WU5 B;  3AE3 B;  1IUE A;  1QT9 A;  5G5G A;  1J7C A;  1L6U A;  4JX1 C;  1N5W A;  1ZP0 B; 
#chains in the Genus database with same CATH topology
 4HJK A;  4ACF A;  4C56 C;  3Q3O C;  3JVZ X;  2BBC A;  3MP9 A;  5EE9 A;  1XLN A;  4RM9 A;  5FR6 A;  3PRZ A;  4IM0 A;  5DPW A;  3JYU A;  3V6E B;  1D3Z A;  1XQQ A;  4REZ A;  1ENF A;  1VZ6 A;  3A1Q A;  4KSK C;  1T0R C;  4HRO A;  2XK5 A;  3VR9 B;  2J42 A;  3PS6 A;  3FIL B;  2GOW A;  1J19 A;  3C8Y A;  1L7Y A;  3QC8 B;  1TGZ B;  3ZO5 B;  4BBN C;  1NEK B;  1SE4 A;  2KAJ A;  1ZPS A;  1C4P A;  1WI0 A;  3ZXR A;  2V3S A;  3QAQ A;  1C1Y B;  1GT8 A;  3P4Q B;  4JWU C;  3W5V B;  5DPS A;  1GNU A;  2PVO D;  2N9L A;  2G4D B;  4ICV A;  2PIA A;  2WQY B;  1C79 A;  2LGI A;  3LDZ E;  3ZIM A;  2J7Q B;  2ONQ A;  3PO0 A;  1VRA B;  4WIP A;  2K0P A;  4WH4 A;  1WH3 A;  1ISN A;  5G2N A;  3JW0 X;  2BVC A;  2ZNV C;  1WE7 A;  1F52 A;  4ASW C;  4DHJ B;  2AQ1 B;  3QAR A;  2WXF A;  2JRI B;  4IWO A;  2MW5 A;  1JWS D;  1I7H A;  1V5O A;  2LRW A;  3OJ3 A;  5AUK A;  3RNB C;  5LXI B;  1IBX B;  2BQQ A;  4MM3 B;  3DVG X;  3W1S A;  2E3T A;  2DAF A;  1MG8 A;  4NJC A;  1WGH A;  3KWL A;  4MT5 A;  1FXA A;  3Q14 C;  3I9V 1;  2MBH A;  4P6V F;  5D3D A;  1WXS A;  2GBR A;  1RFA A;  2DHZ A;  4W9E A;  4GXB A;  4ANW A;  2WXO A;  4IOI E;  1XF5 L;  3QJZ A;  3V05 A;  1I4Q A;  4L23 A;  1XLO A;  4US9 A;  1Q5W B;  2LGY A;  3Q2A C;  5FR3 A;  1HE8 A;  1LXD A;  1MFW A;  2L32 A;  3ZNG C;  1TS5 A;  4B0E A;  1C4C A;  2WX0 A;  3GB1 A;  2MJ3 A;  2WXP A;  1PUT A;  4GN1 A;  2J0K A;  1L6V A;  3NVY A;  1WZ3 A;  1CK1 A;  3AE2 B;  4HXD A;  3RD2 A;  2KWV B;  3DHH C;  2IJ0 A;  2K9X A;  4HVB A;  1TS3 A;  4FUL A;  5AUI A;  2G9H D;  4W9F A;  2ON8 A;  4TMA B;  5IP4 D;  3RN9 C;  1IPG A;  3AE1 B;  3RNF C;  4F7Z A;  4BAX A;  1MPE A;  2DEN B;  1UEL A;  1WYG A;  2DLB A;  5IKC M;  1WY8 A;  2BWE S;  1F0Z A;  4IWQ A;  1GOZ A;  5D6J B;  2FCN A;  2Z0E B;  4RGM A;  4RCO A;  3RNG C;  2K25 A;  4CO7 A;  1LM8 B;  2PVG C;  4G0N B;  4HDQ A;  2WDV B;  2GI9 A;  4HPL B;  4KGS A;  3RCZ A;  1GTE A;  1FCC C;  1FMA D;  2PTL A;  2KMA A;  1QOF A;  1VZ7 A;  1XCQ L;  4JLC A;  2MH7 A;  3Q8C A;  1UGM A;  4GU2 A;  3DQV A;  4MGI E;  3A1Q B;  1MI0 A;  4A90 A;  3DVN V;  2DZM A;  2KXJ A;  1SE3 A;  1VJK A;  3DOW A;  3M95 A;  1VD2 A;  2XK5 B;  2GBN A;  3MTN B;  4HPM B;  3VUW A;  3AV8 A;  1HZ5 A;  3VTV A;  3B1L X;  2MA9 B;  2JSV X;  1RLF A;  2CJO A;  1WGR A;  1QZE A;  4R3D A;  2JYT A;  4AQ7 A;  4B95 A;  2OHF A;  4AJY B;  1P9D U;  3V3X A;  3ZKJ C;  3AH7 A;  1M4V A;  2K8H A;  1FEH A;  3NZ3 A;  2RPQ A;  2DYB A;  4IM2 A;  4OZB A;  4MDK E;  1WGK A;  4KDL B;  4N59 A;  1UUP A;  2VH1 A;  2D07 B;  2LJI A;  1FCL A;  2IGG A;  3K9O B;  1RWS A;  1OQR A;  3HVD A;  4CYE A;  2MBO A;  3KVF B;  4P7I A;  1WXV A;  3EC8 A;  4JGH B;  3AEC B;  2IDY A;  1WE6 A;  3JSV A;  2V3P A;  2CR5 A;  2MHJ A;  1JWA D;  2CKH B;  2M17 A;  3FC4 A;  2K22 A;  5FKA C;  1E6E B;  1WJN A;  3IAS 1;  2YLM A;  2JZ3 B;  4IW0 A;  4DK5 A;  2CU3 A;  1L4D B;  4C4V A;  4X57 B;  3ZQ4 A;  4RNA A;  4K81 A;  2V4L A;  3V62 A;  4J3O D;  3Q3J A;  5TSS A;  4AS1 A;  2LVQ A;  3QCA A;  2LHE A;  3UI3 A;  4EUT A;  5CHV C;  2AQ3 B;  1D5M C;  2KQ7 A;  4BBN F;  2C7M B;  5CHW A;  4BVU C;  3NG0 A;  1E7P B;  2HTM E;  2Y5P A;  1SGH A;  2KDE B;  1N60 A;  1L0V B;  5LNK 1;  1JCK B;  3L08 A;  1TIF A;  1N5X A;  2L0F A;  3WAO A;  1YJJ A;  2IBI B;  2WX1 A;  1T3Q A;  3W1Y A;  4MH0 E;  2IPK D;  5GXG B;  1D6E C;  3BK1 A;  3LYY A;  1HQR D;  2QCZ A;  3MC0 B;  4LLG M;  3W9C B;  3T8M A;  2FID A;  2ACZ B;  2OED A;  4IWP A;  1I4R A;  1J7B A;  1AN8 A;  4OVV A;  1SF0 A;  3HVZ A;  1WYW B;  3X23 A;  4BOZ B;  1MJD A;  2JY6 A;  3R7Q A;  1UZX B;  3VH3 B;  3BZD B;  1Q0W B;  3KYC D;  2CJN A;  3WAP A;  3AE9 B;  3MJW A;  3BVM A;  4F8C B;  4EKU A;  1EU4 A;  2DBY A;  2QMT A;  1YQB A;  1QOG A;  1Q1O A;  1YN5 A;  4W9H A;  4YSX B;  2BYV E;  3AE3 B;  3DBS A;  3P42 A;  5BO4 B;  1V1P B;  4JX1 C;  4HK2 A;  3R8B A;  3SD5 A;  3I57 A;  4GDK A;  2PKO A;  5CX3 A;  2KTR B;  4HDO A;  5D2M B;  5HI1 A;  4XZ4 A;  3V6C B;  2NBV B;  3N9Y C;  2JXX A;  2MBE A;  1T0Q C;  1V81 A;  1HXY D;  4FBJ B;  4NY0 A;  3UQB A;  1YX6 B;  2EMS A;  1XCT L;  3L4P A;  1T0S C;  4B0M A;  3PZD A;  1BUI C;  2N9K A;  2KX3 A;  3TSS A;  3CST A;  3KWV A;  1LQB A;  1H4R A;  4MGY E;  5E6P A;  2I1J A;  2RMM A;  4WJQ A;  1L0X B;  2R61 A;  1QQR A;  5L83 A;  1WXA A;  1TTN A;  2GBK A;  2KX0 A;  1TY0 A;  2BYT A;  4EFO A;  1GJZ A;  3I63 C;  2MWS B;  1PGX A;  2GBM A;  3OLM D;  1V2Y A;  3DHI C;  1E5W A;  1JWB D;  4YTM B;  2QDF A;  4LNO A;  2AL6 A;  2LUM A;  4US8 A;  4KGT A;  2MP2 A;  2KZR A;  2L8J A;  5J18 A;  4NPN A;  4K3C A;  1KTK A;  4ITK A;  3QX1 A;  4WAA A;  4KKJ A;  1Y56 A;  3B2G A;  2OJR A;  1S3S G;  4D2K A;  2XNA C;  4DXG A;  3DBH I;  3JSV B;  2N7E A;  4RGO S;  2DNF A;  1WX9 A;  2AWT A;  3E9S A;  3P4S B;  4IKG A;  3N30 A;  1X1M A;  1K52 A;  2DZJ A;  5G5G A;  5IAA C;  4C4V B;  3CSF A;  1YQ4 B;  4EE2 A;  3W2D A;  2BYE A;  2D2Q A;  1IP9 A;  1FFV A;  2LWP A;  2ZCB A;  3RMK C;  1M94 A;  1NVI D;  2JPH A;  2BKR B;  1C9F A;  2GMI C;  4AUQ C;  1NI2 A;  1UF0 A;  2XEW A;  1UH6 A;  3MHZ A;  2X38 A;  2INN E;  2WXH A;  2K8C A;  5DPT A;  2WXG A;  1KLG D;  4GLS C;  3B9J A;  1SEB D;  1ROE A;  3AE5 B;  2KWC A;  4MAC A;  1RRB A;  3U8Z A;  1I4X A;  2IO3 B;  5C23 A;  1VLB A;  1P7F A;  2MJE A;  1FFU A;  1ZXH A;  3ZNI D;  3FAH A;  4WUR A;  4W9C A;  2ZCC A;  5HG2 A;  4BKS D;  2C7H A;  2R2O A;  1GAQ B;  3R3M A;  2BGF A;  1KJT A;  4LNK A;  3MC8 A;  3V61 A;  4XGA B;  3DDC B;  3PTF C;  2KQS A;  4JE3 B;  1WSP A;  1Z5S B;  2D5G A;  4LJO B;  3O13 A;  1YN3 A;  4YSZ B;  2K8B A;  3Q8B A;  2NTT A;  3BVG A;  2KJR A;  4QAY A;  4KX6 B;  2GB1 A;  1I4G A;  2HJ1 A;  4HEA 1;  2WGS A;  2K1F A;  3QQ8 B;  1GG3 A;  4XX5 A;  3IVF A;  1LO5 D;  3ECI A;  2WNM A;  3Q8A A;  2KDF B;  3B2F A;  3RT3 B;  3T3O A;  2DZI A;  1PDX A;  2LXA A;  2R2Q A;  4DDG D;  4BFR A;  2IND C;  4LJP B;  2UYZ B;  3IT6 B;  4GDK B;  4WAF A;  1OEY A;  4YXD B;  1R4N I;  4JIO U;  2ZEQ A;  2WXM A;  2RDH A;  4I6P A;  1WJU A;  4A3P A;  2WXK A;  4BZA A;  3KUC B;  2FAZ A;  4GSW A;  5IOI A;  5JHB A;  4TQ1 A;  4RF0 A;  2QJL A;  2DZK A;  4K3B A;  1FNU A;  4ARC A;  1YD8 U;  4W9L A;  4DWF A;  3VUX A;  2RD0 A;  3C0R B;  4B6W A;  1L5P A;  2KDM A;  3ZTC A;  1N62 A;  4PS3 A;  1QIL A;  3X0W A;  3TIX A;  3AEF B;  3RUI B;  1WIA A;  4NAW A;  2HJ8 A;  2EMT A;  2LFI A;  4ARI A;  3PVL A;  2L7R A;  3Q6B A;  2NR2 A;  1WX7 A;  4II2 B;  5G5H A;  2D10 A;  1EWC A;  3R2I A;  4KSL C;  3AEA B;  1KH0 A;  2KJH B;  2X8X X;  4WQM A;  1PGB A;  1B9R A;  1V80 A;  1VCB A;  2UWQ A;  4XDD A;  2MP2 B;  2KFJ A;  3KUZ A;  4FAD A;  4EZL A;  3AM9 A;  2M1M A;  2IO2 B;  4LNN A;  4ZRI A;  4IUM B;  2LJ5 A;  2WXL A;  1JAL A;  3L54 A;  3P1M A;  2AEH A;  5MPO A;  3M3J A;  2IO1 B;  1J7C A;  1PQS A;  3NRZ A;  2KD0 A;  3AI5 A;  2RDB C;  2NS5 A;  2FUH B;  3H1U A;  2BS2 B;  3QK0 A;  1TT5 B;  4M0W B;  3LXF A;  2B76 B;  2W55 A;  3APF A;  2LUE A;  2KTF A;  3CF6 E;  4A9A A;  3TMP B;  2C60 A;  1V1P A;  1I4P A;  2KVZ A;  3AN1 A;  2NMQ A;  2QEJ C;  3AXC A;  3PSE B;  2KLC A;  1E8X A;  2HTH A;  3ML8 A;  3QWZ B;  2JRH A;  2KTR A;  3LB8 C;  2WDR B;  3RYT A;  2KYW A;  1UWX A;  2JT4 B;  1SIJ A;  3OAW A;  4PT5 A;  3LJ3 A;  1J8C A;  2NTS A;  4W9K A;  2BB6 A;  3A4R A;  3ZTD A;  1QF6 A;  2WP9 B;  2G45 B;  4K7S A;  2KO3 A;  5C1Z A;  1JWM D;  4NQK E;  3ZJT A;  2IY1 B;  1C3T A;  4AOF A;  2LHD A;  1C4A A;  2O6V B;  3OJ4 B;  1E10 A;  1KF6 B;  1Y8R C;  3I3T B;  3H7S A;  4TUU A;  1BT0 A;  1ZE3 D;  2I2Y A;  4WJO A;  1P7E A;  2LZ6 A;  4EZJ A;  5LXH A;  2KNB A;  1YMH E;  1EWY C;  2DX5 B;  4G11 A;  3RNE C;  4XWT A;  1JML A;  2REX A;  1LFD A;  4YTP B;  1OFF A;  3Q8F A;  1Z2M A;  1I42 A;  5AZH A;  1FRR A;  2WXI A;  2ZVN A;  3DPD A;  3UIP B;  2MCN B;  3GOE A;  1E8Z A;  3U2S C;  3ZJU A;  1WXM A;  4BKS A;  1TKG A;  1IGC A;  4YT0 B;  2WHI A;  3PZ7 A;  1FXI A;  1WGG A;  2WYQ A;  2WDT B;  1DOX A;  2FUG 1;  4N6E B;  2CU1 A;  3EHV A;  1KLV A;  1SJH D;  3DWM A;  2BF8 B;  2HD5 B;  1V97 A;  3I5J C;  1UWM A;  1EUV B;  2D3A A;  2WWZ A;  4MJS B;  4YWG G;  4KVG B;  1WRI A;  4FJZ A;  3URY A;  3ZLZ A;  1F2R I;  1I35 A;  4YTN B;  4PS7 A;  3RNA C;  1PGA A;  4XYC A;  1E90 A;  2BS3 B;  4MSQ B;  5IO9 A;  1UGJ A;  1J7A A;  1WXQ A;  1P3Q U;  2DAJ A;  1B1Z A;  2O6V D;  2WLB A;  3UQA A;  3TEW A;  4OHJ A;  2YVC A;  5E6J A;  3ZDT A;  1ESF A;  3NVZ A;  1XLP A;  2DYO A;  3B08 A;  3U7Z A;  3H8H A;  1NYQ A;  3SHQ A;  4A20 A;  4DHZ B;  2PEA A;  4NAW B;  3ABV B;  2N1W A;  1A70 A;  1WJ4 A;  1A5R A;  2LXC A;  2IY0 B;  3L13 A;  2J4X A;  1C77 A;  5J17 A;  1T6B X;  3HIZ A;  3N32 A;  5D3I B;  3QIJ A;  2JYE A;  3U7D A;  3SDL C;  2ZPN A;  2W3R A;  2BTE A;  2V9H A;  3NHE B;  4G50 A;  5E6N A;  3WAN A;  2ASQ A;  2LD9 A;  1F9J A;  2QSD A;  4RMA A;  2GRI A;  2JXT A;  1OTR B;  3T3N A;  2D3G A;  3PRM B;  3NVV A;  3GP7 A;  3AMZ A;  4KDI C;  4K7U A;  1BXT A;  2KFK A;  4ZOH C;  3CWI A;  2K3U A;  2KN5 A;  3BYY B;  3IFW B;  3ZRF A;  4W9G A;  1VZ8 A;  1GPX A;  3IXS A;  1TBE A;  1Q10 A;  4DDI D;  3DVN U;  5HHD G;  5T8I A;  2KN4 A;  3J9C A;  3Q3M C;  1RAX A;  1T0Y A;  2L05 A;  2MQJ A;  1GC6 A;  3H9D A;  4HLE A;  1I4H A;  4ZRP A;  2GLS A;  4K1R B;  4A55 A;  3PRP B;  4ZRK A;  2HE7 A;  2KT7 A;  4GDL B;  5KHO A;  4MEM A;  3IAM 1;  2H89 B;  5D94 A;  1JRU A;  1NBF C;  1D5X C;  5JZE B;  1V5T A;  4CHK A;  2INP E;  4AP4 C;  5BMI A;  3ZRC A;  4HCN B;  1N6Z A;  3KLS X;  4DQO C;  1WGD A;  2L1A A;  3VUY A;  1DOY A;  2KK8 A;  2INC C;  5JHA A;  3A9J A;  1JW9 D;  2FBW B;  4TV3 A;  1R4M I;  2CS4 A;  4HCP B;  2KAN A;  4XC2 A;  1SIF A;  2ZW0 A;  4ANV A;  3M63 B;  2JWZ A;  1N63 A;  4N58 A;  2N9P C;  4BKG A;  4W9D A;  2KC2 A;  4URK A;  3U52 E;  1P1A A;  1N61 A;  5H92 C;  4PS8 A;  1F2R C;  2L83 A;  1TKY A;  1JWU D;  2BPS A;  4IDI A;  3CIR B;  3GE3 C;  2BT6 A;  2MSE D;  3VRB B;  2PLP A;  1H8C A;  3H6N A;  2JUO A;  3HK0 A;  1AYF A;  1FO4 A;  2AYO B;  2IGH A;  1WMH A;  2WU5 B;  4P1C C;  3Q3N C;  1DOI A;  1WM2 A;  3ZDM C;  1GTH A;  1WR1 A;  2N0S B;  3OWE B;  3QA8 A;  3T9L A;  5HFY A;  2MEK A;  4FJY A;  2L3Z A;  1JRP A;  3TEZ A;  1ET6 A;  1WJ6 A;  4NJ6 A;  2KOX A;  2M8S A;  3VAW A;  2Z8L A;  4WWM A;  1XXG A;  3QHT A;  3SFD B;  3A9K A;  2O2V B;  1FNV A;  3BVZ A;  2D3C A;  1D5Z C;  5D7G A;  2Z59 B;  2CHZ A;  1IGD A;  1SSN A;  2N4F A;  4M0W A;  3ALB A;  2RR9 A;  3EA6 A;  2IGD A;  4GIV A;  2ZW1 A;  3AU5 A;  4WWP A;  1STE A;  5BMH A;  1FIQ A;  5CTR C;  1BML C;  5EDS A;  3APC A;  3NJT A;  5IN7 A;  3DBH B;  2FIF A;  4EOY A;  5EE1 A;  2W54 A;  2E6X A;  2KDI A;  3HHM A;  2QIE B;  2BW2 A;  2MBQ A;  4C00 A;  2PE9 A;  1YNT E;  3VFK A;  2QHO A;  3L0W B;  3MJ5 A;  1GC7 A;  4HKQ A;  2W9N A;  1RYJ A;  4LK0 M;  2PPH A;  3AB5 A;  2V1Y A;  1CZP A;  1XLQ A;  2FCQ A;  4LDT D;  2MRP A;  3EEC A;  3RZW C;  5TR5 A;  1V6E A;  1ZXI A;  5GMV A;  3ZXV A;  3AED B;  3K9P B;  1GB1 A;  1T5X D;  3PHW B;  4I6N B;  1R7S A;  5BYS A;  4TQ0 A;  2O6V A;  2N7J A;  3RPF C;  5AZG A;  1TYG B;  4RGN A;  1H7W A;  1TZO A;  2BB5 A;  4WWO A;  2HDE A;  2KFK B;  4BOS C;  4IG7 B;  4B9K A;  5E6O A;  4XE0 A;  3AU4 A;  1N5W A;  2A5U A;  1TS2 A;  2RDG A;  3BWU D;  3VTW A;  5L95 C;  3O65 B;  5BYR A;  2KHW B;  3A4S C;  2KLG A;  4C7Z A;  1XD3 B;  2V4I B;  1P98 A;  3GS2 A;  3BIN A;  2N1V A;  4PYZ A;  4WQO B;  1FD6 A;  3VVW B;  1E9M A;  1JRO A;  2N9X A;  4PYU A;  2EEL A;  2KC1 A;  4FN2 A;  1V86 A;  2SAK A;  3AE6 B;  1XEE A;  2XBB C;  3RUL A;  3HM6 X;  1IYF A;  1WF9 A;  2M0A A;  3PPA A;  5BYQ A;  5C3J B;  4JWS C;  3R7R A;  1TJE A;  3DCG A;  3UGB B;  2PJH A;  4ZRJ A;  2L52 A;  2L0T A;  4II3 B;  4GB9 A;  2JU6 X;  2Y5B B;  3NZU A;  4N9F 4;  4LNI A;  2RPV A;  3AUL A;  2PE6 B;  3R66 C;  3H7P A;  1KOT A;  2KDB A;  4WWN A;  2UU7 A;  4MJS A;  2AX5 A;  5I4D A;  4MSM B;  3TUO A;  4ICU A;  1AW7 A;  3DWG C;  3PZ8 A;  3BII D;  4L2Y A;  3ZNH B;  4A3O A;  4HJG E;  3L17 A;  3A9J B;  2EKE C;  4NZL B;  5JH5 C;  1YJI A;  5EE3 A;  1OGW A;  1YX5 B;  2LRU A;  1R4N B;  1AWD A;  3NS8 A;  1WZ0 A;  2JZZ A;  2CHW A;  2BKF A;  3ONS A;  3WA0 A;  1KFY B;  4RH6 A;  4F1S A;  4OW0 A;  1MVK A;  1UNS A;  1ZKH A;  2NBU A;  3P4R B;  4AWJ A;  4MGK E;  1E7U A;  3L16 A;  1EF1 A;  3ZJV A;  2K5P A;  3ZW3 A;  3P2B A;  1G6J A;  2KAC A;  4RGT A;  1WMH B;  2C9W B;  1ZP0 B;  3N20 C;  4WJP A;  1ZUD 2;  1NYR A;  3VTU A;  1ZDX A;  1ZGU B;  1WFY A;  2VH2 A;  3AE8 B;  5G55 A;  2FE8 A;  4RM8 A;  2J0J A;  3GE8 C;  1PFD A;  1ZW7 A;  1KLU D;  4DHZ E;  4LNF A;  1KRH A;  4UDU C;  2MBB B;  4KZ0 A;  2C5L C;  4M00 A;  2XN9 C;  4J6I A;  2L76 A;  3ZUN A;  1SE9 A;  4TSS A;  1EO6 A;  3A9K B;  3TEX A;  2LEK A;  2LGS A;  4OVZ A;  1TKE A;  4M8N A;  1AAR A;  1V49 A;  2LMC A;  2VRR B;  4DHJ D;  2NCN A;  1J0G A;  2L00 B;  3V60 A;  1FM0 D;  3NVW A;  3KQ4 A;  1GUA B;  2N7D A;  4GDL A;  4M02 A;  2LI5 A;  3GZN I;  3PLU A;  2NVU I;  1EM7 A;  2JQR B;  3ENE A;  4JPS A;  1MHH E;  4RF1 A;  2NPT A;  4GGQ A;  3EUB 2;  1E0Z A;  2YEP F;  4IM3 A;  3EGR A;  3VRA B;  4IC7 B;  1UBQ A;  2RSU A;  3DHG C;  3VR8 B;  5KHQ A;  3TJP A;  1V1O A;  3A33 B;  3UIN B;  1EU3 A;  3NY5 A;  2Y3A A;  1S1Q B;  2J52 A;  2KMC A;  2FCM A;  4ANU A;  3GZN B;  5H8Y E;  1V9J A;  1VDV A;  2W82 A;  4FHK A;  3NUH B;  4HRS A;  1SJE D;  4FA6 A;  2OOB B;  2G1E A;  1IUE A;  3M62 B;  3E56 A;  3ZYY X;  2CHX A;  5IA7 A;  4A6Q A;  2LGD A;  2SEB D;  3KH0 A;  3VQI A;  4JL9 A;  2AQ2 B;  1K50 A;  2VZK B;  4HKZ E;  2MLB A;  1NI3 A;  2B3A A;  1F1H A;  4RFB A;  3SFE B;  3Q69 A;  3Q3F A;  2A4Z A;  3DBL I;  2QC8 A;  1V8C A;  1L2N A;  1PYW D;  3KYD D;  2KKC A;  4ZYS A;  1JQ4 A;  4ZDV A;  2V3N A;  2QIL A;  1EF5 A;  3EFC A;  4W9J A;  4P1B C;  1WRD B;  5DCN A;  4G3X B;  4OZA A;  2BS4 B;  2IYD B;  2M4N A;  3IBE A;  3U30 A;  4E71 A;  1XT9 B;  1C76 A;  1RM6 C;  3H7P B;  1E8W A;  2O2V A;  4KIK A;  3P63 A;  3APD A;  4YSY B;  1HTQ A;  4NQL B;  1E8Y A;  2IO0 B;  2IZV B;  3DBL B;  4S0R A;  4L1B A;  5BMG A;  4OZC A;  4YL8 A;  3VDZ A;  3MC9 A;  2D11 A;  4HWI B;  3EFU A;  2G4S A;  4TKN A;  5LLI A;  2WXQ A;  1DYQ A;  4XWW A;  1CQV A;  4GMV A;  2V0G A;  1UD7 A;  3ML9 A;  1CMX B;  1WR6 E;  1HEZ E;  4XDC A;  5C2T B;  3AEB B;  3VXW A;  2J0M A;  4FJV B;  3WAM A;  4A8X C;  2JVC A;  2LVP A;  4CQN A;  2KWD A;  3PLV A;  1FPY A;  2YEP B;  3RI7 C;  3C19 A;  3AE4 B;  3OG5 A;  2AL3 A;  3HUI A;  3AEG B;  3TL5 A;  2VZK D;  2DYM A;  3Q8E A;  4HPP A;  3L10 B;  1QOA A;  3ZGZ A;  4ANX A;  3R2T A;  3SEB A;  1XO3 A;  1QT9 A;  1L6U A;  3RZF A;  3VHT C;  1HZ6 A;  2ZVO A;  2FNJ B;  1DGJ A;  2ICI A;  1KM7 A;  3ZVV A;  2OJW A;  3U4E G;  1GB4 A;  1D4B A;  2WDQ B;  1ZDV A;  4FXC A;  4P16 A;  3HM3 A;  1TZ1 A;  3IHP C;  1SB3 C;  3PT2 B;  2WXJ A;  1HTO A;  1OQY A;  5AZF A;  2FCS A;  3P4P B;  1VR9 A;  3HRD D;  3NZS A;  3SU8 X;  1MHX A;  4S17 A;  3FIL A;  1NEN B;  2NBW B;  5CHF A;  3ZNZ B;  3PV1 A;  1K8R B;  4JQW C;  3TCA A;  1YN4 A;  4LTU A;  5J2R A;  4ZHP A;  2W3S A;  2BWF A;  2JWU A;  2GBJ A;  3BY4 B;  3WIM A;  1SXT A;  4NNJ B;  4FLH A;  1MG4 A;  2MJD A;  2M19 A;  4USA A;  1QOB A;  2WS3 B;  3PRE A;  2JF5 A;  1QKZ A;  2TSS A;  3RFZ B;  4ZRQ A;  1SE2 A;  3CMM B;  2JX5 A;  4EEW A;  2LVO A;  4FHJ A;  2KQ4 X;  2JZP A;  3TEY A;  4GOC A;  2N9E B;  2BYF A;  1K53 A;  1FNW A;  4OVU A;  2NPT B;  3IG3 A;  3RNC C;  3UF8 A;  4EZK A;  2RGF A;  1K51 A;  3D32 A;  3DVG Y;  4PK1 A;  1RFK A;  3N1Y C;  4BKT A;  1OEY J;  2KWU B;  2D3B A;  4ZHO A;  3ETR A;  1ZOY B;  3WCQ A;  5JXV A;  5DPR A;  4ZYN A;  1YIW A;  4KZC A;  5EE0 A;  1IBX A;  5AEK B;  1HA5 A;  3NOB A;  4MM3 A;  3N1Z C;  3NS1 A;  2I1K A;  1C78 A;  4O1N A;  2Q5W D;  1R4M B;  3UIO B;  4MEL A;  1L4Z B;  2C7N B;  3SR6 A;  3W1S C;  2K6D B;  3N3K B;  2Z0D B;  3WAL A;  1WM3 A;  3FKY A;  4LDT B;  2PW9 A;  2I38 A;  4MH8 A;  4LCD E;  5HKH A;  1YJ1 A;  5FK9 C;  1FXT B;  1SBB B;  2M0X A;  2LAS A;  4DBG A;  1P0R A;  2ZZP B;  2K6Q A;  1WGY A;  4H2A A;  4W9I A;  3BYT B;  1ET9 A;  4M01 A;  1U4A A;  2MX2 A;  2EKI A;  4DXF A;  4KKI A;  2G3Q B;  2WXN A;  1WWT A;  2WU2 B;  1YOV B;  3DBR I;  3N1X C;  2M56 B;  2ZJD A;  4KIK B;  2WXR A;  1L0Y B;  2PMV A;  2LGX A;  3AEE B;  2KJ6 A;  3W5U B;  4C80 A;  4MGZ E;  4M8M A;  1CJE A;  4WJN A;  2ZNV B;  3BK2 A;  1NDD A;  4NJ7 A;  1LGR A;  3KW5 B;  3MHS D;  2J53 A;  4C7Y A;  1ACC A;  3IT4 B;  3CF4 A;  3B0A A;  3S2A A;  1UBI A;  2K39 A;  4AJW A;  3VH4 B;  1QLB B;  2H88 B;  4DXA B;  1F77 A;  1YQ3 B;  1TY2 A;  3DBR B;  4E74 A;  3TBL D;  2ZPY A;  1E7V A;  1OQQ A;  4I6L B;  4KGR A;  3PGE A;  2Y5C A;  4NAM A;  4Q2J A;  3KUD B;  2KMM A;  1FRD A;  3AE7 B;  1TS4 A;  1H7X A;  2KVR A;  3MFG A;  4E3C A;  2DWQ A;  4KV2 A;  4K7W A;  3PHX B;  1WX8 A; 
#chains in the Genus database with same CATH homology
 3R8B A;  1TKG A;  1ZUD 2;  1NYR A;  3I57 A;  2PKO A;  4C56 C;  1IGC A;  1ZDX A;  4YT0 B;  3PZ7 A;  2BBC A;  1FXI A;  3MP9 A;  5EE9 A;  1XLN A;  1DOX A;  3AE8 B;  2FUG 1;  5HI1 A;  2FE8 A;  4N6E B;  3N9Y C;  1PFD A;  1SJH D;  3DWM A;  1HXY D;  1KLU D;  1V97 A;  4REZ A;  1ENF A;  1KRH A;  1UWM A;  1VZ6 A;  4UDU C;  2XN9 C;  1XCT L;  3L4P A;  4YWG G;  4HRO A;  4TSS A;  3VR9 B;  2J42 A;  1WRI A;  3TEX A;  2LEK A;  3URY A;  1F2R I;  4YTN B;  3FIL B;  4B0M A;  3C8Y A;  4OVZ A;  1PGA A;  1BUI C;  1TKE A;  2N9K A;  1NEK B;  2BS3 B;  1SE4 A;  2KAJ A;  1ZPS A;  3TSS A;  2LMC A;  3KWV A;  1UGJ A;  1J7A A;  1C4P A;  1WXQ A;  2RMM A;  1B1Z A;  1L0X B;  2R61 A;  2WLB A;  1QQR A;  3TEW A;  1FM0 D;  3NVW A;  3KQ4 A;  4OHJ A;  5E6J A;  1ESF A;  3NVZ A;  1XLP A;  2DYO A;  3U7Z A;  3H8H A;  1NYQ A;  1GT8 A;  3P4Q B;  4JWU C;  3W5V B;  1TY0 A;  2BYT A;  4NAW B;  3ABV B;  1A70 A;  1EM7 A;  2PVO D;  2JQR B;  2N9L A;  4JPS A;  1MHH E;  2PIA A;  2J4X A;  2WQY B;  1C77 A;  4RF1 A;  1PGX A;  3EUB 2;  1E0Z A;  2YEP F;  1C79 A;  2LGI A;  1JWB D;  4YTM B;  3EGR A;  1T6B X;  3VRA B;  5D3I B;  2LUM A;  4US8 A;  3VR8 B;  2ONQ A;  2JYE A;  3PO0 A;  4KGT A;  1V1O A;  1EU3 A;  1VRA B;  2W3R A;  4WIP A;  2K0P A;  2Y3A A;  4WH4 A;  2J52 A;  2BTE A;  1KTK A;  4ITK A;  2QSD A;  4KKJ A;  1Y56 A;  2GRI A;  2JXT A;  3B2G A;  5H8Y E;  1VDV A;  2W82 A;  3T3N A;  3NUH B;  3NVV A;  3GP7 A;  4HRS A;  3AMZ A;  1SJE D;  2AQ1 B;  4D2K A;  2XNA C;  4DXG A;  2WXF A;  1BXT A;  4RGO S;  4ZOH C;  3CWI A;  3E9S A;  2K3U A;  3P4S B;  1JWS D;  4IKG A;  2G1E A;  3BYY B;  1I7H A;  1K52 A;  1IUE A;  5G5G A;  3E56 A;  3ZYY X;  1VZ8 A;  1YQ4 B;  4A6Q A;  1GPX A;  4EE2 A;  2SEB D;  5AUK A;  3IXS A;  3W2D A;  1IBX B;  1Q10 A;  1FFV A;  4MM3 B;  5HHD G;  5T8I A;  3VQI A;  2AQ2 B;  1K50 A;  2KN4 A;  3J9C A;  3W1S A;  2VZK B;  4HKZ E;  2E3T A;  1NVI D;  1NI3 A;  4NJC A;  1I4H A;  4ZRP A;  4RFB A;  3KWL A;  4MT5 A;  4A55 A;  3SFE B;  1FXA A;  1C9F A;  3Q69 A;  3I9V 1;  3MHZ A;  2X38 A;  2INN E;  4P6V F;  2WXH A;  5D3D A;  4GDL B;  1V8C A;  3IAM 1;  1PYW D;  2WXG A;  1KLG D;  4GLS C;  2H89 B;  2WXO A;  3B9J A;  1SEB D;  4IOI E;  4ZYS A;  1ROE A;  1XF5 L;  1JQ4 A;  3AE5 B;  2V3N A;  2QIL A;  1D5X C;  4MAC A;  3V05 A;  1I4Q A;  4L23 A;  4OZA A;  2BS4 B;  1XLO A;  4US9 A;  1I4X A;  2INP E;  5BMI A;  1C76 A;  1RM6 C;  5FR3 A;  1VLB A;  1P7F A;  3KLS X;  2MJE A;  1FFU A;  4DQO C;  2L32 A;  1ZXH A;  3FAH A;  2L1A A;  3P63 A;  4WUR A;  1DOY A;  4YSY B;  1TS5 A;  4B0E A;  1C4C A;  3GB1 A;  2MJ3 A;  2WXP A;  1JW9 D;  5HG2 A;  2FBW B;  4L1B A;  5BMG A;  4OZC A;  1PUT A;  1GAQ B;  1L6V A;  3NVY A;  1CK1 A;  2WXQ A;  3AE2 B;  1DYQ A;  4XWW A;  4JE3 B;  1CQV A;  1WSP A;  2ZW0 A;  2D5G A;  2V0G A;  2IJ0 A;  3O13 A;  1N63 A;  4N58 A;  2K9X A;  1HEZ E;  4XDC A;  5C2T B;  3AEB B;  4YSZ B;  1YN3 A;  1TS3 A;  3Q8B A;  2NTT A;  3BVG A;  5AUI A;  3U52 E;  4A8X C;  4CQN A;  4KX6 B;  2G9H D;  2GB1 A;  2KWD A;  2ON8 A;  4TMA B;  1N61 A;  5H92 C;  1F2R C;  2YEP B;  2L83 A;  3AE1 B;  1I4G A;  1TKY A;  1JWU D;  4IDI A;  4HEA 1;  3AE4 B;  1MPE A;  3CIR B;  3HUI A;  3AEG B;  2BT6 A;  1WYG A;  2DLB A;  2VZK D;  3VRB B;  2PLP A;  2DYM A;  3Q8E A;  1F0Z A;  1QOA A;  1GOZ A;  1LO5 D;  3ZGZ A;  1AYF A;  2WNM A;  3Q8A A;  3R2T A;  1FO4 A;  2IGH A;  3SEB A;  1XO3 A;  3B2F A;  2WU5 B;  1QT9 A;  4RGM A;  3T3O A;  1PDX A;  1L6U A;  4RCO A;  1HZ6 A;  1DOI A;  1DGJ A;  2ICI A;  1GTH A;  2PVG C;  3IT6 B;  3U4E G;  4GDK B;  1GB4 A;  1D4B A;  2WDV B;  4WAF A;  2WDQ B;  1ZDV A;  2N0S B;  3OWE B;  4FXC A;  4P16 A;  5HFY A;  4YXD B;  2MEK A;  2GI9 A;  1JRP A;  4KGS A;  3TEZ A;  1ET6 A;  1SB3 C;  2WXJ A;  2WXM A;  2RDH A;  1GTE A;  1FCC C;  1FMA D;  2PTL A;  3P4P B;  2WXK A;  2Z8L A;  1QOF A;  1VZ7 A;  1VR9 A;  4WWM A;  1XXG A;  1XCQ L;  3HRD D;  3SFD B;  2MH7 A;  3Q8C A;  1MHX A;  1FNV A;  3BVZ A;  1D5Z C;  1NEN B;  1MI0 A;  3FIL A;  5D7G A;  4A90 A;  4TQ1 A;  1IGD A;  4RF0 A;  2QJL A;  1SE3 A;  1SSN A;  1VJK A;  1FNU A;  4M0W A;  4ARC A;  3AV8 A;  1HZ5 A;  1YN4 A;  3EA6 A;  4LTU A;  2IGD A;  2ZW1 A;  2JSV X;  1STE A;  4ZHP A;  2CJO A;  2W3S A;  2JWU A;  5BMH A;  1FIQ A;  1BML C;  4R3D A;  1L5P A;  2KDM A;  1N62 A;  2JYT A;  4AQ7 A;  1QIL A;  2OHF A;  3V3X A;  1SXT A;  5EE1 A;  2W54 A;  3AEF B;  2E6X A;  2MJD A;  2M19 A;  4USA A;  2QIE B;  1QOB A;  2WS3 B;  3AH7 A;  1M4V A;  2LFI A;  1QKZ A;  2TSS A;  2BW2 A;  3RFZ B;  4ZRQ A;  1SE2 A;  1FEH A;  1YNT E;  4ARI A;  2JX5 A;  3NZ3 A;  2KQ4 X;  3MJ5 A;  2JZP A;  4HKQ A;  5G5H A;  4OZB A;  3TEY A;  1RYJ A;  1EWC A;  1WGK A;  4LK0 M;  3AB5 A;  3R2I A;  4N59 A;  1UUP A;  3AEA B;  1CZP A;  1FNW A;  1K53 A;  1KH0 A;  1XLQ A;  2LJI A;  1FCL A;  4WQM A;  2IGG A;  1PGB A;  1RWS A;  1OQR A;  3HVD A;  1B9R A;  1K51 A;  1ZXI A;  4XDD A;  3AED B;  1GB1 A;  1T5X D;  3AM9 A;  3AEC B;  2IDY A;  1R7S A;  1RFK A;  5BYS A;  2V3P A;  4TQ0 A;  2N7J A;  3RPF C;  1JWA D;  1TYG B;  2K22 A;  3FC4 A;  4RGN A;  1H7W A;  1JAL A;  2WXL A;  5FKA C;  3P1M A;  4ZHO A;  1E6E B;  3ETR A;  1TZO A;  5MPO A;  2BB5 A;  3IAS 1;  2HDE A;  2CU3 A;  1ZOY B;  1L4D B;  3WCQ A;  5JXV A;  1J7C A;  4XE0 A;  3ZQ4 A;  4RNA A;  1N5W A;  1TS2 A;  2RDG A;  3BWU D;  3NRZ A;  5EE0 A;  1IBX A;  5BYR A;  4J3O D;  1HA5 A;  5TSS A;  4AS1 A;  2BS2 B;  4C7Z A;  2V4I B;  3NS1 A;  3GS2 A;  4O1N A;  1C78 A;  2Q5W D;  2LHE A;  3UI3 A;  1FD6 A;  3LXF A;  2B76 B;  2AQ3 B;  2W55 A;  1D5M C;  1E9M A;  1JRO A;  1L4Z B;  3SR6 A;  2EEL A;  2SAK A;  3AE6 B;  1XEE A;  1E7P B;  2HTM E;  2Y5P A;  4A9A A;  2PW9 A;  2I38 A;  4MH8 A;  1V1P A;  1I4P A;  1N60 A;  1L0V B;  5LNK 1;  2M0A A;  1JCK B;  3AN1 A;  2NMQ A;  2QEJ C;  1N5X A;  5C3J B;  4JWS C;  5BYQ A;  5FK9 C;  1YJJ A;  1SBB B;  1T3Q A;  1TJE A;  2IPK D;  5GXG B;  4H2A A;  1D6E C;  3BK1 A;  3LB8 C;  3LYY A;  1HQR D;  2WDR B;  2L52 A;  1ET9 A;  3BYT B;  3MC0 B;  2JU6 X;  1UWX A;  4LLG M;  1SIJ A;  4PT5 A;  2RPV A;  2EKI A;  3W9C B;  4DXF A;  2NTS A;  4KKI A;  2ACZ B;  2BB6 A;  2OED A;  2WXN A;  1WWT A;  2WU2 B;  1I4R A;  2AX5 A;  1QF6 A;  5I4D A;  2WP9 B;  1J7B A;  3TUO A;  2M56 B;  1AW7 A;  3DWG C;  3PZ8 A;  2WXR A;  1L0Y B;  1AN8 A;  3BII D;  2PMV A;  4L2Y A;  1JWM D;  3AEE B;  4C80 A;  3W5U B;  4HJG E;  3ZJT A;  1SF0 A;  1CJE A;  4NZL B;  3HVZ A;  3BK2 A;  2LHD A;  2J53 A;  4C7Y A;  1YJI A;  1ACC A;  1C4A A;  5EE3 A;  1E10 A;  1KF6 B;  3IT4 B;  3CF4 A;  3BZD B;  1ZE3 D;  2I2Y A;  1AWD A;  1QLB B;  2H88 B;  2CJN A;  1P7E A;  1F77 A;  1YQ3 B;  1TY2 A;  3AE9 B;  1YMH E;  1EWY C;  3BVM A;  1OQQ A;  4KGR A;  1EU4 A;  2DBY A;  2Y5C A;  4XWT A;  1KFY B;  4NAM A;  2QMT A;  4Q2J A;  4RH6 A;  1JML A;  4OW0 A;  2KMM A;  4YTP B;  1MVK A;  1UNS A;  1FRD A;  1OFF A;  3P4R B;  1QOG A;  3Q8F A;  3AE7 B;  1YN5 A;  1TS4 A;  3ZJV A;  1H7X A;  3MFG A;  1FRR A;  2WXI A;  2K5P A;  2DWQ A;  4YSX B;  2KAC A;  4RGT A;  3AE3 B;  3P42 A;  3U2S C;  3ZJU A;  1V1P B;  4JX1 C;  1ZP0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...