3VRBB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vrbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vrbB01
1KF6B 1FMAD 4P6VF 1B9RA 1DOXA 2B76B 1I7HA 1N5WA 1NYQA 1UWMA 1SF0A 2AX5A 3EUB2 1F0ZA 1TYGB 1XLNA 2CU3A 1QLBB 2OHFA 5EE3A 2Y5CA 3VR8B 2PVOD 3WCQA 5C3JB 4FXCA 4HROA 2K5PA 2H88B 2H89B 1T3QA 1ZUD2 4ITKA 1FXAA 1YQ3B 2K9XA 1L5PA 1L0VB 1KRHA 3HUIA 1YQ4B 4YT0B 4YSYB 4YTNB 4YTMB 1FIQA 1FRDA 3AE2B 3FC4A 4N59A 1ROEA 3B9JA 3AEGB 4YSXB 1NENB 4A9AA 1JWAD 3AE5B 1CJEA 5G5GA 3P4QB 2LEKA 1WYGA 2KAJA 3P63A 3VR9B 1WGKA 1XLQA 1VJKA 3SFEB 1DGJA 4C80A 2BS3B 3CIRB 3VRBB 4ZHOA 1NVID 2WDQB 2Q5WD 3B2FA 2CJNA 1FXIA 1NI3A 1RWSA 1N62A 3SR6A 2MH7A 1E7PB 2DBYA 2FBWB 1TKEA 2WLBA 2WU2B 4HRSA 4ZHPA 1JRPA 1ZXIA 3DWGC 3LB8C 2G1EA 1E0ZA 1N61A 1PUTA 1QOAA 3AEBB 2KMMA 3AV8A 2ACZB 3AEFB 2WU5B 3L4PA 1NYRA 3NVVA 1SB3C 4WWMA 3AE4B 1KFYB 2BS4B 3AE9B 3P4RB 5GXGB 2W55A 4USAA 1FRRA 2W3SA 1AWDA 1QOFA 3CF4A 3AEAB 1N5XA 3B2GA 3HVZA 3NVZA 3AB5A 3SFDB 1ZOYB 4JWUC 2JQRB 3W5VB 1WWTA 1VLBA 3AN1A 1H7WA 1EWYC 1N60A 3P4PB 2K22A 2PKOA 3AH7A 5EE9A 2PIAA 1FFUA 1TJEA 3LXFA 3AEDB 5C2TB 1RYJA 2MJDA 1TKYA 1L6VA 1QOGA 3AE6B 1VDVA 5G5HA 3FAHA 1GT8A 2QIEB 1YJIA 3NVYA 5AUIA 1V8CA 3AE3B 4KX6B 1CZPA 3AE1B 4IDIA 3NS1A 2WDRB 2N0SB 1OFFA 3HRDD 3PO0A 1NEKB 2E3TA 1GTEA 2HTME 4C7YA 1E10A 1SIJA 2JX5A 2WQYB 1AYFA 1DOIA 1GAQB 1N63A 4N6EB 1IUEA 1WRIA 1WXQA 1OQQA 3AE7B 1L6UA 4LTUA 1J7BA 1R7SA 5H92C 3AEEB 5MPOA 1H7XA 1JALA 1A70A 2PVGC 2CJOA 2W3RA 2WP9B 1PDXA 1YJJA 5EE1A 3P1MA 3W5UB 1QF6A 4C7ZA 2M56B 1XLOA 2BS2B 2L52A 1FFVA 2W54A 1E9MA 4ZOHC 3ZYYX 4WQMA 1DOYA 4US9A 2BT6A 2DWQA 3AMZA 3VRAB 1RFKA 2L83A 4JWSC 1FO4A 3KWLA 4JX1C 5AUKA 1GPXA 1GTHA 1JW9D 1TKGA 4N58A 1JROA 4YXDB 1PFDA 1RM6C 5EE0A 3CWIA 3DWMA 1QT9A 3AM9A 2QJLA 1ZP0B 2EKIA 3AECB 1J7CA 2M19A 4YTPB 2WS3B 2MJ3A 3ABVB 1QOBA 1V97A 4YSZB 5H8YE 4US8A 3NRZA 1JQ4A 1FM0D 1XO3A 3BIID 2WDVB 1JWBD 1XLPA 3ETRA 3W9CB 3RPFC 3AE8B 3P4SB 1E6EB 1J7AA 1OQRA 3NVWA 2MJEA
chains in the Genus database with same CATH superfamily
3Q8EA 3T9LA 2LGSA 5BMGA 1WH3A 5IKCM 2O6VB 3MP9A 2QC8A 2H88B 2H89B 3DPDA 1P98A 1L0VB 2JF5A 2IO2B 1FD6A 2GBMA 3UIOB 1MJDA 3AEGB 2XEWA 1OEYA 2DYBA 5KHOA 2WNMA 2SEBD 5IOIA 1SE3A 1HTOA 1PYWD 2QILA 4M0WA 2LJ5A 4CQNA 2CR5A 1GOZA 4RGNA 2WLBA 2DNFA 3AEBB 2KDMA 2M0XA 2CS4A 4W9JA 4PYZA 1N5XA 3B2GA 2ZZPB 4HXDA 5C1ZA 3Q8AA 2K8BA 1Y8RC 4BOSC 2IPKD 4GB9A 3VTVA 1K51A 3DHGC 1VDVA 3PREA 3R2TA 1KOTA 1GT8A 2KWVB 5G2NA 4LCDE 3S2AA 2WXGA 4MGYE 4MM3A 3NS1A 3DBHB 1E10A 1SIJA 4FJVB 4WWNA 2JY6A 4KV2A 2LGIA 3V05A 2V3NA 3W2DA 3A1QB 3X0WA 4J6IA 2LRUA 2N9KA 4WAAA 2UU7A 3H6NA 2AWTA 2D07B 1ISNA 2KMAA 2JSVX 1JROA 3URYA 1BMLC 3JSVA 2QJLA 1Q10A 2IDYA 4YSZB 1GG3A 2RR9A 1SEBD 3QWZB 1V9JA 3K9PB 1KF6B 4P6VF 4URKA 1T0QC 4MGZE 4AJWA 2J0MA 1WX7A 4DHJB 1YQ3B 3A9KB 3IHPC 5LXIB 3DHIC 2R61A 4ANUA 2EKEC 4OW0A 4X57B 3WAPA 4TV3A 3VR9B 1G6JA 2AL3A 1EM7A 1IGCA 2L7RA 1ZDXA 4NQKE 2KMCA 3C19A 2LD9A 4MJSA 2N9XA 5GMVA 1UGMA 4LJPB 3AEFB 3L4PA 2WU5B 5FR3A 4P7IA 3ML9A 1MPEA 2ZVOA 1HZ6A 3KUCB 1VCBA 4IKGA 4O1NA 3KVFB 5L95C 2L8JA 2RDHA 4JQWC 3Q3MC 1STEA 2FNJB 3L08A 2KDEB 3BVGA 1SJED 3ZRFA 3IAM1 1SE9A 3PPAA 1K53A 4LTUA 3I3TB 1WE6A 3AEEB 3DCGA 1V81A 1TTNA 1XLOA 3MFGA 1WGDA 2V4LA 4IM3A 2BKRB 2BW2A 1P9DU 2BBCA 2KVZA 4BZAA 3KWLA 1D5MC 4XZ4A 5AZFA 2KWCA 1JRUA 3A33B 4OHJA 3V6EB 1GC7A 4BKGA 3MJWA 2BTEA 5JHAA 4CYEA 4RF0A 2MQJA 1B9RA 4HPPA 3VXWA 5CTRC 4TUUA 3Q14C 4CHKA 1E8XA 2K5PA 2NR2A 1V5OA 4R3DA 1BT0A 1WM2A 2RPQA 1FXTB 2NTTA 4GMVA 4IG7B 4NAMA 3PRZA 3A9JB 3VAWA 2DZJA 3VRBB 1T0SC 3B2FA 1WF9A 2NTSA 2JWUA 2N7JA 2ZCCA 4I6LB 3KUZA 2G1EA 1E0ZA 1QOAA 2KKCA 4IWQA 3AV8A 2BVCA 3C0RB 2KJHB 4AQ7A 1WJ4A 1R4MI 3AB5A 3LJ3A 1VLBA 4Q2JA 3OJ3A 1L0YB 1UNSA 2WDTB 2FCMA 2PW9A 2RDGA 3CSTA 3NVYA 5AUIA 2NCNA 4OVVA 2NMQA 3IT6B 2AQ1B 3ML8A 4C4VB 1GJZA 1FEHA 3ZLZA 2G9HD 4BBNC 2FE8A 1VR9A 2BB6A 5HI1A 2KO3A 1Q0WB 2KANA 3OLMD 3HIZA 3M62B 2AEHA 2MBEA 2M4NA 4PT5A 2W9NA 2JRHA 3AM9A 2KHWB 2J4XA 2JYEA 1Y56A 2X8XX 2RDBC 2KN4A 3NRZA 1JQ4A 3W9CB 1UWMA 2XK5B 3Q8FA 5JZEB 4B9KA 5FR6A 4ANVA 5JH5C 4GSWA 3WCQA 2KXJA 2UYZB 1FNWA 4ITKA 3TSSA 2J7QB 1KRHA 3HUIA 1OGWA 1YQ4B 4P1CC 2M8SA 2JWZA 3A9KA 3UI3A 1I4HA 1WMHB 3UQAA 3P63A 1VZ8A 2BKFA 2BF8B 3EFUA 1YN3A 3HHMA 1NI3A 3V6CB 4DK5A 3Q3OC 2WHIA 1N61A 1S3SG 3VUYA 2R2QA 4MJSB 1I4GA 4GN1A 3WAMA 1P0RA 2BS4B 2V1YA 5D3DA 1CQVA 1WGRA 2D11A 1WWTA 4HVBA 1H7WA 3ZVVA 4XC2A 1KLGD 1K50A 4XDCA 1WXSA 4FHKA 1HXYD 4XYCA 2YLMA 4KIKA 3MC9A 1YOVB 4PYUA 3W1YA 3X23A 1C9FA 2E6XA 2JX5A 2KT7A 2NVUI 1J0GA 5BO4B 1AARA 4TQ0A 2ZCBA 1JALA 2K3UA 2ZW0A 3APDA 1TBEA 2M56B 4K3CA 1FFVA 1H4RA 4WWOA 2PEAA 4PK1A 2N9EB 3MJ5A 5AUKA 1GPXA 1TS3A 3ZNID 2GBKA 1ZE3D 1PFDA 3DWMA 4RM9A 3N20C 2BWFA 2N9PC 2C5LC 3HM6X 1HA5A 5DPSA 3EGRA 2AYOB 3WALA 4LDTB 1EF1A 4G50A 3AE8B 4EOYA 4I6NB 4HKQA 1E7UA 5BYQA 1MI0A 2WXQA 3VH4B 5TSSA 3BVMA 1V1OA 4AP4C 1ENFA 2NPTA 5DPTA 2MRPA 3OWEB 3VTWA 1L5PA 2DZIA 4KZCA 1SXTA 2WX1A 4YTNB 4YTMB 4DXAB 3B9JA 3ALBA 3M95A 2MEKA 1J8CA 1C1YB 3H7PA 3ZGZA 4FJZA 3OJ4B 1XF5L 2Q5WD 3PRPB 3C8YA 4WQOB 1RFAA 1E8YA 2MH7A 4M00A 1JRPA 1ZXIA 4NJCA 2N4FA 2DX5B 2ZJDA 1NYRA 2MW5A 3PSEB 2IGGA 1KTKA 1WI0A 3AH7A 1FFUA 3AU5A 4DXFA 3BYTB 2PMVA 5CHFA 2KYWA 1WYWB 1WXAA 1WZ0A 3ZJUA 2L00B 3HM3A 1FPYA 2WXMA 2QHOA 1AYFA 5D3IB 4N6EB 1L6UA 1H7XA 2KTRB 1R4NI 3ZTCA 4E3CA 2INCC 2ICIA 3OG5A 2IY1B 3VRAB 1EF5A 1TS5A 1XXGA 4MELA 1QZEA 4N58A 2GRIA 1DYQA 4OVUA 3NHEB 3VUXA 2D3BA 3V61A 2V9HA 3N32A 3IBEA 3ZNHB 1FM0D 2C7NB 2WDVB 1J7AA 1ZUD2 4WAFA 3VDZA 2N1VA 3RNBC 5AZHA 1T5XD 1TYGB 3A9JA 1SE4A 2OHFA 2IO3B 2EMTA 3RNGC 2N7DA 3QA8A 3TEYA 4W9HA 1T3QA 2GB1A 1T6BX 1WJUA 1C4CA 2DLBA 1FRDA 3I5JC 3RULA 1YN5A 3RFZB 3P4QB 4RGTA 4KSKC 3TJPA 4HK2A 2O2VB 3UF8A 2J52A 1L7YA 3AULA 4NAWB 2JRIB 3SD5A 1RWSA 1HQRD 2NBUA 3T3OA 1HE8A 4W9DA 2I1JA 3ZQ4A 3KW5B 5GXGB 2NBWB 2W55A 2W3SA 4N9F4 1AWDA 4GIVA 4K7SA 3AEAB 1YNTE 2Y3AA 1TY0A 3AN1A 2K1FA 1K52A 2L32A 4W9EA 4EUTA 1M94A 1V6EA 4GOCA 2FCSA 2N9LA 3PS6A 2I38A 5IAAC 1PGXA 2V0GA 2MX2A 2I1KA 4XWTA 3HK0A 4E74A 3TCAA 1YJJA 5EE1A 1C79A 2BS2B 3PHXB 3A4RA 3R66C 3SU8X 4US9A 5LNK1 4MM3B 2L83A 2QMTA 3U8ZA 4ASWC 4GLSC 2KNBA 2BGFA 1C4AA 5EE0A 3N30A 3KH0A 2R2OA 1WIAA 3AECB 1NDDA 4JE3B 3VH3B 4B6WA 1QOBA 4EFOA 1SGHA 3N1XC 3UQBA 3RYTA 3BIID 3ZW3A 1OEYJ 2MA9B 4MH8A 3DBHI 1I4RA 1T0YA 4DBGA 1RAXA 3PV1A 1ET6A 2CU3A 5EE3A 3L54A 5DPRA 4A3OA 1FXAA 2HJ8A 2SAKA 5BYSA 2NPTB 4ZYSA 4YSXB 4M0WB 1I35A 3AE5B 2GI9A 1WGKA 1VJKA 2EMSA 1GB1A 4K81A 3CSFA 1BUIC 2TSSA 1E5WA 1C3TA 2DHZA 3BVZA 2LVOA 3QQ8B 1E7VA 3L10B 2ON8A 4HEA1 3I57A 2KMMA 1T0RC 3GZNB 3Q3JA 1SB3C 3NUHB 2RPVA 1TZOA 2Y5BB 3WAOA 2JQRB 3W5VB 4GDLB 2WXNA 4BAXA 3P4PB 5EE9A 1MHXA 2W82A 4KZ0A 1QOGA 4PS3A 4KKJA 2LGYA 4P16A 4ACFA 1WFYA 2V3SA 1WGYA 4J3OD 4D2KA 4RF1A 2E3TA 5CX3A 3A1QA 2VH1A 2N1WA 1N63A 3PLVA 2CKHB 1N6ZA 1JCKB 2L1AA 2W3RA 3ZDTA 1DOYA 4TSSA 5J2RA 3QC8B 1P7EA 2HJ1A 3OAWA 4JX1C 4E71A 1GTHA 2M1MA 1ZDVA 4MT5A 3ZO5B 2LGXA 3U4EG 2KDFB 5FKAC 3L0WB 4MEMA 4NJ7A 4DWFA 3ETRA 2INPE 2KOXA 2Y5PA 4RGOS 3BZDB 3EUB2 3GZNI 2IJ0A 4FXCA 3EA6A 4A55A 4A9AA 3W1SA 1CJEA 4LNOA 5HFYA 3EECA 2KFKA 4P1BC 4C80A 5LXHA 4EE2A 1NVID 1KM7A 2KWDA 4KDLB 4OZCA 1YIWA 2I2YA 4JGHB 3RCZA 4KGSA 4NAWA 2FCNA 4TQ1A 1V2YA 2DZKA 5D7GA 5AEKB 3QCAA 2KACA 3P4RB 4USAA 1FRRA 2PE6B 1ZOYB 4JWUC 1YMHE 2FUHB 5LLIA 3PRMB 2QEJC 4LLGM 2LFIA 2VZKD 4BOZB 3KUDB 1GC6A 4HJGE 3QJZA 3TEZA 2HTME 2RD0A 3AE7B 1PGAA 1SBBB 3VTUA 1JWUD 2WP9B 3W1SC 2GBJA 3NJTA 1QQRA 4EKUA 3ZXVA 2MBQA 1R4MB 4HCPB 5T8IA 3ENEA 2KTFA 3N9YC 1TKGA 1YN4A 2RSUA 2M19A 4A8XC 1WM3A 2VZKB 3R7QA 1XLPA 1WR1A 4W9LA 3NVWA 2MJEA 3BK1A 1HZ5A 1LGRA 1I7HA 1XLNA 2O2VA 4DHZB 4NNJB 1UH6A 2Z8LA 2N7EA 3ZNZB 1R4NB 3V3XA 1AW7A 2DENB 1FIQA 2LHDA 3UGBB 2ZNVB 2WXHA 1NENB 2MWSB 3I63C 3QK0A 1SSNA 2KAJA 3ZXRA 4XX5A 4K7UA 4NPNA 4HPLB 4FLHA 4FN2A 4IC7B 3ZNGC 2D3AA 4XWWA 1I4PA 2D2QA 1KH0A 3IVFA 5BMHA 1VD2A 4A6QA 3PT2B 3DWGC 4MSQB 3Q69A 2LRWA 4LNKA 3GB1A 2WXJA 3B08A 3E56A 3PHWB 3CF4A 3HVZA 2JYTA 1VZ7A 4JPSA 1TJEA 2KC1A 1RYJA 1L6VA 4C4VA 1P3QU 4GGQA 3FAHA 4GDLA 1MFWA 4RMAA 3AE3B 2ONQA 3B0AA 4KX6B 2MHJA 4XE0A 1CZPA 2C7MB 3PO0A 1XEEA 1GTEA 2WXLA 3PLUA 1DOIA 2D5GA 4GDKA 2M0AA 1IUEA 1OQQA 1R7SA 1KJTA 2A5UA 2VRRB 1A70A 2JPHA 1L2NA 1PDXA 4GU2A 4C00A 1QF6A 2WXRA 4IUMB 4RH6A 1KLVA 3HVDA 3V60A 2DWQA 2V4IB 4KGTA 4HJKA 1SJHD 1FO4A 1ACCA 4FHJA 1TT5B 3NOBA 3Q3FA 2XK5A 3MTNB 1JWMD 3Q2AC 4FBJB 4ICUA 4REZA 3ONSA 3QHTA 4LNIA 1ESFA 1H8CA 1WJ6A 3TIXA 2LASA 2AX5A 3DVNU 1IPGA 2KWUB 3VR8B 4WURA 3M63B 5HG2A 1OTRB 1YJ1A 3P42A 4II3B 2IGHA 1WMHA 3IG3A 3KQ4A 2D10A 2LJIA 1UGJA 4K7WA 1WE7A 1ROEA 4TKNA 1JWAD 1SE2A 4LDTD 3N3KB 4BKSD 4ICVA 3T3NA 2BS3B 1MVKA 1V80A 3BY4B 3R3MA 2CJNA 3H8HA 2EELA 2MLBA 2K6QA 3DBRB 3EC8A 1TKEA 2JVCA 4HRSA 3DDCB 4PS8A 2LXCA 4K1RB 3DBLI 1WZ3A 4WJPA 3VQIA 1KFYB 2M17A 1V1PA 5DCNA 1A5RA 1IBXA 4BKTA 3SFDB 2KQ4X 5HKHA 2BYVE 3QARA 5KHQA 3H9DA 2GOWA 2L3ZA 5EDSA 3AU4A 3GE3C 2PJHA 4G3XB 4ANWA 1MHHE 3RT3B 2HE7A 2QDFA 1ET9A 2FAZA 2JU6X 1UBIA 4S17A 1J7BA 1C78A 3GE8C 5JXVA 4KSLC 2CJOA 3I9V1 4C7ZA 4EZKA 2W54A 3QX1A 3Q6BA 1RFKA 1FNVA 2MBBB 2ZPYA 2LZ6A 2KDBA 4YXDB 1RM6C 5E6JA 4NZLB 2KTRA 1WXVA 3NZ3A 1E8WA 4L2YA 4FADA 1NI2A 4US8A 2XN9C 2IBIB 5I4DA 2FIDA 4H2AA 3RPFC 1OQRA 1FMAD 1C76A 1DOXA 1NYQA 4W9FA 1N5WA 3T8MA 5C3JB 2L05A 3ZTDA 2INDC 2HTHA 5JHBA 4N59A 3BWUD 3H1UA 5BMIA 2FCQA 2LEKA 2LXAA 4DHZE 1HTQA 1WYGA 2XNAC 3TEXA 2WDQB 2B3AA 4F1SA 2MP2B 4C56C 3O13A 4G11A 3FKYA 2JUOA 2FBWB 1D5ZC 2AL6A 3NG0A 3U52E 1B1ZA 4ANXA 1LFDA 3NVVA 2Z0EB 3RI7C 3NVZA 2Z0DB 3BYYB 2WXOA 1N60A 2K8HA 2PKOA 3SEBA 4FA6A 2MJDA 2O6VD 2ZNVC 5CHWA 2DZMA 1V5TA 1V8CA 2K25A 2LWPA 4MGIE 2RGFA 4IDIA 4EZLA 2XBBC 2LUEA 2N0SB 1OFFA 1XT9B 3PZ7A 2WQYB 4JL9A 4ARIA 4WJOA 2V3PA 5TR5A 3J9CA 1GNUA 3P1MA 4HDQA 1AN8A 1PQSA 4KGRA 3N1YC 3NZUA 4MGKE 3U7DA 4DQOC 4JWSC 1IGDA 2D3CA 5D2MB 4ZRKA 1UELA 1D6EC 4B0EA 2EKIA 2JZ3B 3ZJVA 3APFA 3JSVB 1JWBD 4IWPA 2BQQA 4ZYNA 1SF0A 3RUIB 2G4SA 2KJ6A 1GB4A 2G45B 4WJNA 2K9XA 2DAJA 1ZXHA 3UINB 1XD3B 4KVGB 4CO7A 4YSYB 3PGEA 3FC4A 1UD7A 3NY5A 1I4QA 4B95A 2LHEA 4LNFA 3SFEB 1SIFA 3L13A 3WANA 3P2BA 3QAQA 4XDDA 2LMCA 3B1LX 4DDID 4EZJA 2Z59B 3RN9C 4A3PA 2ASQA 2DBYA 2JXXA 1WY8A 2KD0A 4NY0A 2ACZB 1WR6E 2MCNB 2BYEA 2MBOA 1EWYC 1V1PB 2L0TA 5E6NA 1IBXB 1XCQL 2NS5A 3AE6B 2GBRA 2OJWA 2KQSA 3LYYA 5E6OA 3KYCD 4RFBA 5H92C 3R2IA 5IO9A 3W5UB 4RM8A 3DQVA 2INNE 3GS2A 4IM2A 3IXSA 4MDKE 4EEWA 1E9MA 2REXA 2BT6A 1F1HA 4ZRPA 3DVGY 3VFKA 2IY0B 4AUQC 4F7ZA 3TUOA 2KC2A 3ZKJC 1QT9A 2GLSA 2QSDA 2ZW1A 4OZBA 2VH2A 3ECIA 4YTPB 2BPSA 2WS3B 2L76A 2MJ3A 4ZDVA 3TBLD 1WSPA 3WA0A 2MBHA 1LXDA 4DHJD 3TL5A 3DHHC 2A4ZA 4KKIA 1M4VA 4JIOU 4L1BA 3D32A 4HROA 2X38A 4WJQA 2GBNA 1HEZE 4A20A 4IWOA 2K39A 3L16A 1F9JA 1I4XA 4ARCA 2GMIC 2C60A 1XCTL 1NBFC 3VUWA 4W9KA 2WXKA 1CMXB 4M8MA 4ZHOA 2IGDA 4YL8A 1Q5WB 4MACA 3L17A 3ZJTA 1N62A 1EU4A 2LVPA 1ZW7A 3Q3NC 1LQBA 3IAS1 3DVGX 3FILB 4KDIC 4JLCA 3M3JA 4WWMA 2KJRA 5HHDG 4AS1A 1TS2A 1C4PA 4HWIB 2K22A 3RZWC 1UF0A 4FULA 1EU3A 1Q1OA 2YVCA 5FK9C 2KFJA 1OQYA 1FNUA 3AE1B 1VZ6A 4W9GA 2WDRB 2AQ3B 3JYUA 5J17A 3R8BA 1MG8A 1TGZB 2JXTA 5MPOA 4ZRIA 4LNNA 2MSED 1TIFA 2L0FA 2BWES 1WX9A 3U2SC 1ZPSA 2UWQA 1I42A 2DYMA 2KZRA 1JW9D 2G4DB 1KLUD 3KYDD 1J7CA 3ZUNA 3APCA 1TZ1A 5H8YE 3DVNV 2K6DB 2ZVNA 1XO3A 3JW0X 2CU1A 4LK0M 1EUVB 2J0JA 2FIFA 4RCOA 2KK8A 1QLBB 1IYFA 1BXTA 3LDZE 1WGHA 1PGBA 4A90A 2MP2A 4OZAA 1F2RC 4RGMA 1TS4A 2KFKB 4XGAB 3AE2B 4DXGA 3ZIMA 3GOEA 3R7RA 4L23A 1DGJA 1D5XC 2PPHA 2KVRA 4BFRA 4NJ6A 1F2RI 2IZVB 1UBQA 3UIPB 3SR6A 2K0PA 3TEWA 5C23A 5IA7A 3AE4B 3AE9B 4HLEA 3DBSA 4QAYA 3PZ8A 5CHVC 1GUAB 3ZRCA 5DPWA 1C77A 2J0KA 3GP7A 2PIAA 3LXFA 3DBLB 1V49A 1WXMA 1ZKHA 3RNEC 1IP9A 2KX0A 2LVQA 2IO1B 4W9CA 5IP4D 5L83A 5BYRA 1UWXA 3HRDD 2AQ2B 4C7YA 1L0XB 1GAQB 1WJNA 1YX6B 1WRIA 1F0ZA 2PVGC 1S1QB 4DDGD 3AI5A 2CHXA 4OVZA 4M01A 4WQMA 1XQQA 2HD5B 2KN5A 2WXPA 4GDKB 3EFCA 4S0RA 1Z5SB 3CWIA 3Q8CA 3MHZA 2OJRA 3KLSX 3ABVB 2D3GA 2JZPA 3DBRI 1WRDB 3RNFC 4F8CB 5D94A 2IO0B 4WWPA 2LUMA 1P1AA 2O6VA 2HDEA 1YQBA 2WGSA 1EWCA 4TMAB 2KQ7A 2PVOD 2J53A 4IOIE 2FUG1 1WGGA 3QIJA 4HPMB 3NS8A 3RMKC 1E90A 4BVUC 3H7SA 4BBNF 1XLQA 1MG4A 1U4AA 3CIRB 1WX8A 1J19A 1JMLA 4AOFA 1FXIA 2ZEQA 4ZRJA 1QKZA 2CHZA 1E7PB 2BYFA 4IW0A 5E6PA 2WU2B 2NBVB 3SHQA 3LB8C 1PUTA 4MSMB 4KIKB 1D4BA 2J42A 1K8RB 5D6JB 1QOFA 3FILA 1YD8U 2DAFA 4B0MA 2KLCA 2DYOA 3WIMA 2BB5A 1FCLA 2OEDA 2KX3A 2PLPA 4RNAA 1TKYA 5G5HA 1UZXB 1UUPA 1YJIA 3ZDMC 1L4DB 2PTLA 4AJYB 1NEKB 1LO5D 1D3ZA 1QILA 1X1MA 4YWGG 1WXQA 4LJOB 1RLFA 3EHVA 2YEPB 3BINA 2L52A 4G0NB 4WH4A 3ZYYX 1CK1A 4K3BA 2BYTA 4FJYA 3AMZA 4II2B 1RRBA 3MHSD 3PVLA 2KLGA 3PTFC 4I6PA 5IN7A 5J18A 1LM8B 1V97A 4GXBA 3P4SB 1YX5B 2PE9A 1JWSD 3Q8BA 2B76B 2WX0A 2G3QB 4NQLB 4HCNB 3DOWA 3TMPB 2Y5CA 2C9WB 3H7PB 4M8NA 3K9OB 1EO6A 2WXFA 2JT4B 4YT0B 1Z2MA 4PS7A 5G5GA 1VRAB 2KDIA 2YEPF 3IT4B 4WIPA 2WWZA 2LGDA 3JVZX 3SDLC 1TY2A 4BKSA 4AWJA 3RZFA 2WXIA 3U30A 4ZHPA 3BK2A 4W9IA 1L4ZB 3RNCC 3CMMB 3NZSA 3IFWB 4HDOA 3RNAC 2RMMA 2C7HA 1V86A 4HKZE 3VHTC 1P7FA 3AEDB 5C2TB 4IM0A 2QIEB 3O65B 3MC0B 4ZRQA 5G55A 2K8CA 1ZGUB 1E8ZA 3PZDA 3MC8A 2CHWA 3V62A 3AXCA 1F52A 2WYQA 3RD2A 3U7ZA 2LI5A 2ZPNA 4ZOHC 2JZZA 3CF6E 5AZGA 2QCZA 3KWVA 3VVWB 4MH0E 4M02A 3N1ZC 1ZP0B 2IYDB 3E9SA 2OOBB 3A4SC 4UDUC 1F77A 1FCCC 1E6EB
chains in the Genus database with same CATH topology
3Q8EA 3BK1A 4HKQA 1HZ5A 1I7HA 5BYQA 1MI0A 2WXQA 4KKIA 1XLNA 1M4VA 5BMGA 5TSSA 4L1BA 3BVMA 1V1OA 4HROA 3MP9A 2X38A 1ENFA 2H88B 2H89B 2Z8LA 1HEZE 3OWEB 1L5PA 1L0VB 3V3XA 1AW7A 1SXTA 4YTNB 4YTMB 1FIQA 1I4XA 2LHDA 1FD6A 4ARCA 3B9JA 3AEGB 2WXHA 1NENB 1SSNA 1XCTL 2KAJA 2MEKA 2SEBD 2WNMA 2WXKA 1SE3A 1PYWD 4ZHOA 2IGDA 2QILA 3ZGZA 4M0WA 4MACA 1XF5L 4CQNA 2Q5WD 3C8YA 3ZJTA 4XWWA 1I4PA 1GOZA 4RGNA 1N62A 1EU4A 2MH7A 1KH0A 2WLBA 5BMHA 4A6QA 1JRPA 1ZXIA 3DWGC 3IAS1 4NJCA 3FILB 3Q69A 3AEBB 2KDMA 1NYRA 3GB1A 4WWMA 2WXJA 3E56A 5HHDG 4AS1A 3CF4A 3HVZA 1N5XA 3B2GA 2JYTA 2IGGA 1TS2A 1VZ7A 3Q8AA 1KTKA 1C4PA 2K22A 3AH7A 4JPSA 2IPKD 1FFUA 1TJEA 1RYJA 1K51A 1L6VA 1EU3A 1VDVA 3R2TA 3BYTB 4DXFA 3FAHA 1GT8A 2PMVA 5FK9C 3AE3B 2ONQA 4KX6B 4XE0A 1CZPA 1FNUA 2WXGA 3AE1B 1VZ6A 3NS1A 2WDRB 3ZJUA 2AQ3B 3PO0A 1XEEA 1GTEA 2WXLA 2WXMA 1E10A 1SIJA 1AYFA 2D5GA 1DOIA 4N6EB 5D3IB 2M0AA 1IUEA 3R8BA 1OQQA 1L6UA 1R7SA 2LGIA 3V05A 2JXTA 1H7XA 5MPOA 1A70A 2V3NA 1PDXA 1QF6A 3W2DA 2WXRA 2ICIA 2N9KA 4RH6A 3HVDA 3U2SC 1ZPSA 2DWQA 2V4IB 3VRAB 1TS5A 1XXGA 2DYMA 4KGTA 1SJHD 1FO4A 1ACCA 1JW9D 2JSVX 4N58A 2GRIA 1JROA 1DYQA 3URYA 1BMLC 1KLUD 2QJLA 1J7CA 1Q10A 2IDYA 1JWMD 4YSZB 5H8YE 1SEBD 4REZA 1FM0D 1XO3A 2WDVB 1ESFA 1ZUD2 1J7AA 4WAFA 1KF6B 4P6VF 4LK0M 2AX5A 1T5XD 1TYGB 4RCOA 1SE4A 1QLBB 2OHFA 1BXTA 4WURA 3VR8B 5HG2A 3TEYA 1PGBA 1T3QA 4A90A 3P42A 2GB1A 1YQ3B 1T6BX 2IGHA 4OZAA 1C4CA 1F2RC 2R61A 3KQ4A 2LJIA 4RGMA 1TS4A 2DLBA 1UGJA 1FRDA 3AE2B 4DXGA 1ROEA 4OW0A 1YN5A 1JWAD 3RFZB 3P4QB 4RGTA 1SE2A 3VR9B 4L23A 1DGJA 1D5XC 1EM7A 3T3NA 2BS3B 1IGCA 1MVKA 2J52A 1F2RI 4NAWB 1ZDXA 2CJNA 3H8HA 1RWSA 2EELA 1HQRD 3SR6A 3T3OA 2K0PA 3TEWA 1TKEA 4HRSA 3ZQ4A 3AEFB 3L4PA 2WU5B 5FR3A 3VQIA 1MPEA 3AE4B 1KFYB 3AE9B 1V1PA 5GXGB 2W55A 1HZ6A 2W3SA 1AWDA 1IBXA 3AEAB 1YNTE 2Y3AA 3PZ8A 1TY0A 4IKGA 3SFDB 2KQ4X 4O1NA 3AN1A 1C77A 1K52A 2L32A 3GP7A 2PIAA 3LXFA 2RDHA 2N9LA 1STEA 2I38A 5BYRA 1PGXA 1UWXA 3BVGA 1SJED 3IAM1 2V0GA 1MHHE 3HRDD 2AQ2B 4C7YA 4XWTA 1K53A 1L0XB 1GAQB 1ET9A 1WRIA 2JU6X 4LTUA 1J7BA 1C78A 5JXVA 3AEEB 1F0ZA 2PVGC 2CJOA 3I9V1 1YJJA 5EE1A 1C79A 4C7ZA 4OVZA 1XLOA 3MFGA 2BS2B 2W54A 4WQMA 4US9A 5LNK1 2BW2A 4MM3B 2BBCA 1RFKA 2L83A 2QMTA 1D5MC 1FNVA 3KWLA 2WXPA 4GDKB 4GLSC 1C4AA 4YXDB 1RM6C 5EE0A 3CWIA 3Q8CA 4OHJA 5E6JA 4NZLB 3AECB 3MHZA 3NZ3A 4L2YA 4JE3B 3KLSX 3ABVB 1QOBA 2JZPA 2BTEA 4US8A 2XN9C 3BIID 5I4DA 4H2AA 3RPFC 1OQRA 2LUMA 4RF0A 4MH8A 1I4RA 1FMAD 1C76A 2HDEA 1NYQA 1B9RA 1N5WA 1DOXA 1EWCA 4TMAB 1ET6A 2CU3A 5EE3A 2PVOD 5C3JB 2J53A 4IOIE 2FUG1 2K5PA 1FXAA 2SAKA 5BYSA 4R3DA 2NTTA 3BWUD 4N59A 4ZYSA 4YSXB 5BMIA 4NAMA 3AE5B 2GI9A 2LEKA 1WYGA 1WGKA 1XLQA 1VJKA 2XNAC 1GB1A 3TEXA 3VRBB 3CIRB 1BUIC 2TSSA 2WDQB 1JMLA 3B2FA 2NTSA 1FXIA 2JWUA 2N7JA 4C56C 3O13A 3BVZA 1QKZA 1E7PB 2FBWB 1D5ZC 2WU2B 3LB8C 1E0ZA 2G1EA 2ON8A 4HEA1 3I57A 1PUTA 1QOAA 2KMMA 3U52E 1D4BA 1B1ZA 3AV8A 3NVVA 2J42A 1SB3C 3NUHB 2RPVA 1TZOA 4AQ7A 1QOFA 3FILA 3NVZA 3AB5A 3BYYB 4B0MA 2JQRB 2DYOA 4GDLB 3W5VB 1VLBA 2WXOA 2WXNA 2BB5A 4Q2JA 1FCLA 1N60A 3P4PB 1L0YB 2OEDA 2PKOA 5EE9A 1MHXA 1UNSA 2W82A 3SEBA 2PLPA 4RNAA 2MJDA 1TKYA 1QOGA 2PW9A 5G5HA 4KKJA 2RDGA 1UUPA 1YJIA 3NVYA 5AUIA 1V8CA 1L4DB 2PTLA 2NMQA 3IT6B 4P16A 2AQ1B 4IDIA 4J3OD 2N0SB 1FEHA 1OFFA 4RF1A 1NEKB 2E3TA 4D2KA 3PZ7A 1LO5D 2WQYB 2G9HD 1N63A 1QILA 4YWGG 1WXQA 4ARIA 2FE8A 1VR9A 2V3PA 1JCKB 2L1AA 2BB6A 2YEPB 2W3RA 3J9CA 5HI1A 3P1MA 1AN8A 2L52A 4WH4A 3ZYYX 4KGRA 1DOYA 1CK1A 4TSSA 2BYTA 3AMZA 4DQOC 4JWSC 1P7EA 4JX1C 1GTHA 1IGDA 4PT5A 1ZDVA 4MT5A 3AM9A 1D6EC 2J4XA 2EKIA 4B0EA 3U4EG 5FKAC 3ZJVA 2JYEA 1Y56A 1V97A 2KN4A 3NRZA 1JQ4A 3ETRA 2INPE 1JWBD 3W9CB 3P4SB 1UWMA 2Y5PA 1JWSD 3Q8BA 3Q8FA 2B76B 4RGOS 3BZDB 1SF0A 3EUB2 1GB4A 2IJ0A 2Y5CA 3WCQA 1FNWA 4FXCA 4ITKA 3TSSA 2K9XA 2WXFA 1ZXHA 3EA6A 1KRHA 3HUIA 1YQ4B 4A55A 4YT0B 4YSYB 3FC4A 1I4QA 2LHEA 4A9AA 3W1SA 3UI3A 1CJEA 5G5GA 1VRAB 1I4HA 2YEPF 5HFYA 3IT4B 3P63A 4WIPA 3SFEB 1VZ8A 4C80A 4EE2A 1NVID 1YN3A 4XDDA 2LMCA 2KWDA 1NI3A 1TY2A 4OZCA 2I2YA 2DBYA 2WXIA 4KGSA 4ZHPA 4TQ1A 3BK2A 1N61A 1L4ZB 5D7GA 2ACZB 1I4GA 2BS4B 2KACA 3P4RB 4USAA 5D3DA 1FRRA 1CQVA 1ZOYB 2RMMA 4JWUC 4HKZE 1WWTA 1H7WA 1EWYC 1YMHE 1V1PB 1KLGD 1K50A 1P7FA 4XDCA 3AEDB 2QEJC 5C2TB 1HXYD 1IBXB 1XCQL 4LLGM 3AE6B 2QIEB 2LFIA 2VZKD 3MC0B 4ZRQA 3LYYA 4HJGE 4RFBA 3TEZA 2HTME 1C9FA 2E6XA 2JX5A 3AE7B 1PGAA 5H92C 4TQ0A 3R2IA 1SBBB 1JALA 1JWUD 3W5UB 2K3UA 2WP9B 2ZW0A 3GS2A 2INNE 2M56B 3U7ZA 3IXSA 1FFVA 1QQRA 1E9MA 4ZOHC 2BT6A 5T8IA 3KWVA 4ZRPA 3N9YC 3MJ5A 5AUKA 1GPXA 1TS3A 1TKGA 3TUOA 1ZE3D 1PFDA 3DWMA 1YN4A 1QT9A 2QSDA 2ZW1A 1ZP0B 4OZBA 2M19A 4YTPB 2WS3B 2MJ3A 3E9SA 4A8XC 1HA5A 2VZKB 1F77A 3EGRA 4UDUC 1WSPA 1XLPA 1FCCC 3AE8B 1E6EB 3NVWA 2MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 B;  1FMA D;  4P6V F;  1B9R A;  1DOX A;  2B76 B;  1I7H A;  1N5W A;  1NYQ A;  1UWM A;  1SF0 A;  2AX5 A;  3EUB 2;  1F0Z A;  1TYG B;  1XLN A;  2CU3 A;  1QLB B;  2OHF A;  5EE3 A;  2Y5C A;  3VR8 B;  2PVO D;  3WCQ A;  5C3J B;  4FXC A;  4HRO A;  2K5P A;  2H88 B;  2H89 B;  1T3Q A;  1ZUD 2;  4ITK A;  1FXA A;  1YQ3 B;  2K9X A;  1L5P A;  1L0V B;  1KRH A;  3HUI A;  1YQ4 B;  4YT0 B;  4YSY B;  4YTN B;  4YTM B;  1FIQ A;  1FRD A;  3AE2 B;  3FC4 A;  4N59 A;  1ROE A;  3B9J A;  3AEG B;  4YSX B;  1NEN B;  4A9A A;  1JWA D;  3AE5 B;  1CJE A;  5G5G A;  3P4Q B;  2LEK A;  1WYG A;  2KAJ A;  3P63 A;  3VR9 B;  1WGK A;  1XLQ A;  1VJK A;  3SFE B;  1DGJ A;  4C80 A;  2BS3 B;  3CIR B;  3VRB B;  4ZHO A;  1NVI D;  2WDQ B;  2Q5W D;  3B2F A;  2CJN A;  1FXI A;  1NI3 A;  1RWS A;  1N62 A;  3SR6 A;  2MH7 A;  1E7P B;  2DBY A;  2FBW B;  1TKE A;  2WLB A;  2WU2 B;  4HRS A;  4ZHP A;  1JRP A;  1ZXI A;  3DWG C;  3LB8 C;  2G1E A;  1E0Z A;  1N61 A;  1PUT A;  1QOA A;  3AEB B;  2KMM A;  3AV8 A;  2ACZ B;  3AEF B;  2WU5 B;  3L4P A;  1NYR A;  3NVV A;  1SB3 C;  4WWM A;  3AE4 B;  1KFY B;  2BS4 B;  3AE9 B;  3P4R B;  5GXG B;  2W55 A;  4USA A;  1FRR A;  2W3S A;  1AWD A;  1QOF A;  3CF4 A;  3AEA B;  1N5X A;  3B2G A;  3HVZ A;  3NVZ A;  3AB5 A;  3SFD B;  1ZOY B;  4JWU C;  2JQR B;  3W5V B;  1WWT A;  1VLB A;  3AN1 A;  1H7W A;  1EWY C;  1N60 A;  3P4P B;  2K22 A;  2PKO A;  3AH7 A;  5EE9 A;  2PIA A;  1FFU A;  1TJE A;  3LXF A;  3AED B;  5C2T B;  1RYJ A;  2MJD A;  1TKY A;  1L6V A;  1QOG A;  3AE6 B;  1VDV A;  5G5H A;  3FAH A;  1GT8 A;  2QIE B;  1YJI A;  3NVY A;  5AUI A;  1V8C A;  3AE3 B;  4KX6 B;  1CZP A;  3AE1 B;  4IDI A;  3NS1 A;  2WDR B;  2N0S B;  1OFF A;  3HRD D;  3PO0 A;  1NEK B;  2E3T A;  1GTE A;  2HTM E;  4C7Y A;  1E10 A;  1SIJ A;  2JX5 A;  2WQY B;  1AYF A;  1DOI A;  1GAQ B;  1N63 A;  4N6E B;  1IUE A;  1WRI A;  1WXQ A;  1OQQ A;  3AE7 B;  1L6U A;  4LTU A;  1J7B A;  1R7S A;  5H92 C;  3AEE B;  5MPO A;  1H7X A;  1JAL A;  1A70 A;  2PVG C;  2CJO A;  2W3R A;  2WP9 B;  1PDX A;  1YJJ A;  5EE1 A;  3P1M A;  3W5U B;  1QF6 A;  4C7Z A;  2M56 B;  1XLO A;  2BS2 B;  2L52 A;  1FFV A;  2W54 A;  1E9M A;  4ZOH C;  3ZYY X;  4WQM A;  1DOY A;  4US9 A;  2BT6 A;  2DWQ A;  3AMZ A;  3VRA B;  1RFK A;  2L83 A;  4JWS C;  1FO4 A;  3KWL A;  4JX1 C;  5AUK A;  1GPX A;  1GTH A;  1JW9 D;  1TKG A;  4N58 A;  1JRO A;  4YXD B;  1PFD A;  1RM6 C;  5EE0 A;  3CWI A;  3DWM A;  1QT9 A;  3AM9 A;  2QJL A;  1ZP0 B;  2EKI A;  3AEC B;  1J7C A;  2M19 A;  4YTP B;  2WS3 B;  2MJ3 A;  3ABV B;  1QOB A;  1V97 A;  4YSZ B;  5H8Y E;  4US8 A;  3NRZ A;  1JQ4 A;  1FM0 D;  1XO3 A;  3BII D;  2WDV B;  1JWB D;  1XLP A;  3ETR A;  3W9C B;  3RPF C;  3AE8 B;  3P4S B;  1E6E B;  1J7A A;  1OQR A;  3NVW A;  2MJE A; 
#chains in the Genus database with same CATH topology
 3Q8E A;  3T9L A;  2LGS A;  5BMG A;  1WH3 A;  5IKC M;  2O6V B;  3MP9 A;  2QC8 A;  2H88 B;  2H89 B;  3DPD A;  1P98 A;  1L0V B;  2JF5 A;  2IO2 B;  1FD6 A;  2GBM A;  3UIO B;  1MJD A;  3AEG B;  2XEW A;  1OEY A;  2DYB A;  5KHO A;  2WNM A;  2SEB D;  5IOI A;  1SE3 A;  1HTO A;  1PYW D;  2QIL A;  4M0W A;  2LJ5 A;  4CQN A;  2CR5 A;  1GOZ A;  4RGN A;  2WLB A;  2DNF A;  3AEB B;  2KDM A;  2M0X A;  2CS4 A;  4W9J A;  4PYZ A;  1N5X A;  3B2G A;  2ZZP B;  4HXD A;  5C1Z A;  3Q8A A;  2K8B A;  1Y8R C;  4BOS C;  2IPK D;  4GB9 A;  3VTV A;  1K51 A;  3DHG C;  1VDV A;  3PRE A;  3R2T A;  1KOT A;  1GT8 A;  2KWV B;  5G2N A;  4LCD E;  3S2A A;  2WXG A;  4MGY E;  4MM3 A;  3NS1 A;  3DBH B;  1E10 A;  1SIJ A;  4FJV B;  4WWN A;  2JY6 A;  4KV2 A;  2LGI A;  3V05 A;  2V3N A;  3W2D A;  3A1Q B;  3X0W A;  4J6I A;  2LRU A;  2N9K A;  4WAA A;  2UU7 A;  3H6N A;  2AWT A;  2D07 B;  1ISN A;  2KMA A;  2JSV X;  1JRO A;  3URY A;  1BML C;  3JSV A;  2QJL A;  1Q10 A;  2IDY A;  4YSZ B;  1GG3 A;  2RR9 A;  1SEB D;  3QWZ B;  1V9J A;  3K9P B;  1KF6 B;  4P6V F;  4URK A;  1T0Q C;  4MGZ E;  4AJW A;  2J0M A;  1WX7 A;  4DHJ B;  1YQ3 B;  3A9K B;  3IHP C;  5LXI B;  3DHI C;  2R61 A;  4ANU A;  2EKE C;  4OW0 A;  4X57 B;  3WAP A;  4TV3 A;  3VR9 B;  1G6J A;  2AL3 A;  1EM7 A;  1IGC A;  2L7R A;  1ZDX A;  4NQK E;  2KMC A;  3C19 A;  2LD9 A;  4MJS A;  2N9X A;  5GMV A;  1UGM A;  4LJP B;  3AEF B;  3L4P A;  2WU5 B;  5FR3 A;  4P7I A;  3ML9 A;  1MPE A;  2ZVO A;  1HZ6 A;  3KUC B;  1VCB A;  4IKG A;  4O1N A;  3KVF B;  5L95 C;  2L8J A;  2RDH A;  4JQW C;  3Q3M C;  1STE A;  2FNJ B;  3L08 A;  2KDE B;  3BVG A;  1SJE D;  3ZRF A;  3IAM 1;  1SE9 A;  3PPA A;  1K53 A;  4LTU A;  3I3T B;  1WE6 A;  3AEE B;  3DCG A;  1V81 A;  1TTN A;  1XLO A;  3MFG A;  1WGD A;  2V4L A;  4IM3 A;  2BKR B;  2BW2 A;  1P9D U;  2BBC A;  2KVZ A;  4BZA A;  3KWL A;  1D5M C;  4XZ4 A;  5AZF A;  2KWC A;  1JRU A;  3A33 B;  4OHJ A;  3V6E B;  1GC7 A;  4BKG A;  3MJW A;  2BTE A;  5JHA A;  4CYE A;  4RF0 A;  2MQJ A;  1B9R A;  4HPP A;  3VXW A;  5CTR C;  4TUU A;  3Q14 C;  4CHK A;  1E8X A;  2K5P A;  2NR2 A;  1V5O A;  4R3D A;  1BT0 A;  1WM2 A;  2RPQ A;  1FXT B;  2NTT A;  4GMV A;  4IG7 B;  4NAM A;  3PRZ A;  3A9J B;  3VAW A;  2DZJ A;  3VRB B;  1T0S C;  3B2F A;  1WF9 A;  2NTS A;  2JWU A;  2N7J A;  2ZCC A;  4I6L B;  3KUZ A;  2G1E A;  1E0Z A;  1QOA A;  2KKC A;  4IWQ A;  3AV8 A;  2BVC A;  3C0R B;  2KJH B;  4AQ7 A;  1WJ4 A;  1R4M I;  3AB5 A;  3LJ3 A;  1VLB A;  4Q2J A;  3OJ3 A;  1L0Y B;  1UNS A;  2WDT B;  2FCM A;  2PW9 A;  2RDG A;  3CST A;  3NVY A;  5AUI A;  2NCN A;  4OVV A;  2NMQ A;  3IT6 B;  2AQ1 B;  3ML8 A;  4C4V B;  1GJZ A;  1FEH A;  3ZLZ A;  2G9H D;  4BBN C;  2FE8 A;  1VR9 A;  2BB6 A;  5HI1 A;  2KO3 A;  1Q0W B;  2KAN A;  3OLM D;  3HIZ A;  3M62 B;  2AEH A;  2MBE A;  2M4N A;  4PT5 A;  2W9N A;  2JRH A;  3AM9 A;  2KHW B;  2J4X A;  2JYE A;  1Y56 A;  2X8X X;  2RDB C;  2KN4 A;  3NRZ A;  1JQ4 A;  3W9C B;  1UWM A;  2XK5 B;  3Q8F A;  5JZE B;  4B9K A;  5FR6 A;  4ANV A;  5JH5 C;  4GSW A;  3WCQ A;  2KXJ A;  2UYZ B;  1FNW A;  4ITK A;  3TSS A;  2J7Q B;  1KRH A;  3HUI A;  1OGW A;  1YQ4 B;  4P1C C;  2M8S A;  2JWZ A;  3A9K A;  3UI3 A;  1I4H A;  1WMH B;  3UQA A;  3P63 A;  1VZ8 A;  2BKF A;  2BF8 B;  3EFU A;  1YN3 A;  3HHM A;  1NI3 A;  3V6C B;  4DK5 A;  3Q3O C;  2WHI A;  1N61 A;  1S3S G;  3VUY A;  2R2Q A;  4MJS B;  1I4G A;  4GN1 A;  3WAM A;  1P0R A;  2BS4 B;  2V1Y A;  5D3D A;  1CQV A;  1WGR A;  2D11 A;  1WWT A;  4HVB A;  1H7W A;  3ZVV A;  4XC2 A;  1KLG D;  1K50 A;  4XDC A;  1WXS A;  4FHK A;  1HXY D;  4XYC A;  2YLM A;  4KIK A;  3MC9 A;  1YOV B;  4PYU A;  3W1Y A;  3X23 A;  1C9F A;  2E6X A;  2JX5 A;  2KT7 A;  2NVU I;  1J0G A;  5BO4 B;  1AAR A;  4TQ0 A;  2ZCB A;  1JAL A;  2K3U A;  2ZW0 A;  3APD A;  1TBE A;  2M56 B;  4K3C A;  1FFV A;  1H4R A;  4WWO A;  2PEA A;  4PK1 A;  2N9E B;  3MJ5 A;  5AUK A;  1GPX A;  1TS3 A;  3ZNI D;  2GBK A;  1ZE3 D;  1PFD A;  3DWM A;  4RM9 A;  3N20 C;  2BWF A;  2N9P C;  2C5L C;  3HM6 X;  1HA5 A;  5DPS A;  3EGR A;  2AYO B;  3WAL A;  4LDT B;  1EF1 A;  4G50 A;  3AE8 B;  4EOY A;  4I6N B;  4HKQ A;  1E7U A;  5BYQ A;  1MI0 A;  2WXQ A;  3VH4 B;  5TSS A;  3BVM A;  1V1O A;  4AP4 C;  1ENF A;  2NPT A;  5DPT A;  2MRP A;  3OWE B;  3VTW A;  1L5P A;  2DZI A;  4KZC A;  1SXT A;  2WX1 A;  4YTN B;  4YTM B;  4DXA B;  3B9J A;  3ALB A;  3M95 A;  2MEK A;  1J8C A;  1C1Y B;  3H7P A;  3ZGZ A;  4FJZ A;  3OJ4 B;  1XF5 L;  2Q5W D;  3PRP B;  3C8Y A;  4WQO B;  1RFA A;  1E8Y A;  2MH7 A;  4M00 A;  1JRP A;  1ZXI A;  4NJC A;  2N4F A;  2DX5 B;  2ZJD A;  1NYR A;  2MW5 A;  3PSE B;  2IGG A;  1KTK A;  1WI0 A;  3AH7 A;  1FFU A;  3AU5 A;  4DXF A;  3BYT B;  2PMV A;  5CHF A;  2KYW A;  1WYW B;  1WXA A;  1WZ0 A;  3ZJU A;  2L00 B;  3HM3 A;  1FPY A;  2WXM A;  2QHO A;  1AYF A;  5D3I B;  4N6E B;  1L6U A;  1H7X A;  2KTR B;  1R4N I;  3ZTC A;  4E3C A;  2INC C;  2ICI A;  3OG5 A;  2IY1 B;  3VRA B;  1EF5 A;  1TS5 A;  1XXG A;  4MEL A;  1QZE A;  4N58 A;  2GRI A;  1DYQ A;  4OVU A;  3NHE B;  3VUX A;  2D3B A;  3V61 A;  2V9H A;  3N32 A;  3IBE A;  3ZNH B;  1FM0 D;  2C7N B;  2WDV B;  1J7A A;  1ZUD 2;  4WAF A;  3VDZ A;  2N1V A;  3RNB C;  5AZH A;  1T5X D;  1TYG B;  3A9J A;  1SE4 A;  2OHF A;  2IO3 B;  2EMT A;  3RNG C;  2N7D A;  3QA8 A;  3TEY A;  4W9H A;  1T3Q A;  2GB1 A;  1T6B X;  1WJU A;  1C4C A;  2DLB A;  1FRD A;  3I5J C;  3RUL A;  1YN5 A;  3RFZ B;  3P4Q B;  4RGT A;  4KSK C;  3TJP A;  4HK2 A;  2O2V B;  3UF8 A;  2J52 A;  1L7Y A;  3AUL A;  4NAW B;  2JRI B;  3SD5 A;  1RWS A;  1HQR D;  2NBU A;  3T3O A;  1HE8 A;  4W9D A;  2I1J A;  3ZQ4 A;  3KW5 B;  5GXG B;  2NBW B;  2W55 A;  2W3S A;  4N9F 4;  1AWD A;  4GIV A;  4K7S A;  3AEA B;  1YNT E;  2Y3A A;  1TY0 A;  3AN1 A;  2K1F A;  1K52 A;  2L32 A;  4W9E A;  4EUT A;  1M94 A;  1V6E A;  4GOC A;  2FCS A;  2N9L A;  3PS6 A;  2I38 A;  5IAA C;  1PGX A;  2V0G A;  2MX2 A;  2I1K A;  4XWT A;  3HK0 A;  4E74 A;  3TCA A;  1YJJ A;  5EE1 A;  1C79 A;  2BS2 B;  3PHX B;  3A4R A;  3R66 C;  3SU8 X;  4US9 A;  5LNK 1;  4MM3 B;  2L83 A;  2QMT A;  3U8Z A;  4ASW C;  4GLS C;  2KNB A;  2BGF A;  1C4A A;  5EE0 A;  3N30 A;  3KH0 A;  2R2O A;  1WIA A;  3AEC B;  1NDD A;  4JE3 B;  3VH3 B;  4B6W A;  1QOB A;  4EFO A;  1SGH A;  3N1X C;  3UQB A;  3RYT A;  3BII D;  3ZW3 A;  1OEY J;  2MA9 B;  4MH8 A;  3DBH I;  1I4R A;  1T0Y A;  4DBG A;  1RAX A;  3PV1 A;  1ET6 A;  2CU3 A;  5EE3 A;  3L54 A;  5DPR A;  4A3O A;  1FXA A;  2HJ8 A;  2SAK A;  5BYS A;  2NPT B;  4ZYS A;  4YSX B;  4M0W B;  1I35 A;  3AE5 B;  2GI9 A;  1WGK A;  1VJK A;  2EMS A;  1GB1 A;  4K81 A;  3CSF A;  1BUI C;  2TSS A;  1E5W A;  1C3T A;  2DHZ A;  3BVZ A;  2LVO A;  3QQ8 B;  1E7V A;  3L10 B;  2ON8 A;  4HEA 1;  3I57 A;  2KMM A;  1T0R C;  3GZN B;  3Q3J A;  1SB3 C;  3NUH B;  2RPV A;  1TZO A;  2Y5B B;  3WAO A;  2JQR B;  3W5V B;  4GDL B;  2WXN A;  4BAX A;  3P4P B;  5EE9 A;  1MHX A;  2W82 A;  4KZ0 A;  1QOG A;  4PS3 A;  4KKJ A;  2LGY A;  4P16 A;  4ACF A;  1WFY A;  2V3S A;  1WGY A;  4J3O D;  4D2K A;  4RF1 A;  2E3T A;  5CX3 A;  3A1Q A;  2VH1 A;  2N1W A;  1N63 A;  3PLV A;  2CKH B;  1N6Z A;  1JCK B;  2L1A A;  2W3R A;  3ZDT A;  1DOY A;  4TSS A;  5J2R A;  3QC8 B;  1P7E A;  2HJ1 A;  3OAW A;  4JX1 C;  4E71 A;  1GTH A;  2M1M A;  1ZDV A;  4MT5 A;  3ZO5 B;  2LGX A;  3U4E G;  2KDF B;  5FKA C;  3L0W B;  4MEM A;  4NJ7 A;  4DWF A;  3ETR A;  2INP E;  2KOX A;  2Y5P A;  4RGO S;  3BZD B;  3EUB 2;  3GZN I;  2IJ0 A;  4FXC A;  3EA6 A;  4A55 A;  4A9A A;  3W1S A;  1CJE A;  4LNO A;  5HFY A;  3EEC A;  2KFK A;  4P1B C;  4C80 A;  5LXH A;  4EE2 A;  1NVI D;  1KM7 A;  2KWD A;  4KDL B;  4OZC A;  1YIW A;  2I2Y A;  4JGH B;  3RCZ A;  4KGS A;  4NAW A;  2FCN A;  4TQ1 A;  1V2Y A;  2DZK A;  5D7G A;  5AEK B;  3QCA A;  2KAC A;  3P4R B;  4USA A;  1FRR A;  2PE6 B;  1ZOY B;  4JWU C;  1YMH E;  2FUH B;  5LLI A;  3PRM B;  2QEJ C;  4LLG M;  2LFI A;  2VZK D;  4BOZ B;  3KUD B;  1GC6 A;  4HJG E;  3QJZ A;  3TEZ A;  2HTM E;  2RD0 A;  3AE7 B;  1PGA A;  1SBB B;  3VTU A;  1JWU D;  2WP9 B;  3W1S C;  2GBJ A;  3NJT A;  1QQR A;  4EKU A;  3ZXV A;  2MBQ A;  1R4M B;  4HCP B;  5T8I A;  3ENE A;  2KTF A;  3N9Y C;  1TKG A;  1YN4 A;  2RSU A;  2M19 A;  4A8X C;  1WM3 A;  2VZK B;  3R7Q A;  1XLP A;  1WR1 A;  4W9L A;  3NVW A;  2MJE A;  3BK1 A;  1HZ5 A;  1LGR A;  1I7H A;  1XLN A;  2O2V A;  4DHZ B;  4NNJ B;  1UH6 A;  2Z8L A;  2N7E A;  3ZNZ B;  1R4N B;  3V3X A;  1AW7 A;  2DEN B;  1FIQ A;  2LHD A;  3UGB B;  2ZNV B;  2WXH A;  1NEN B;  2MWS B;  3I63 C;  3QK0 A;  1SSN A;  2KAJ A;  3ZXR A;  4XX5 A;  4K7U A;  4NPN A;  4HPL B;  4FLH A;  4FN2 A;  4IC7 B;  3ZNG C;  2D3A A;  4XWW A;  1I4P A;  2D2Q A;  1KH0 A;  3IVF A;  5BMH A;  1VD2 A;  4A6Q A;  3PT2 B;  3DWG C;  4MSQ B;  3Q69 A;  2LRW A;  4LNK A;  3GB1 A;  2WXJ A;  3B08 A;  3E56 A;  3PHW B;  3CF4 A;  3HVZ A;  2JYT A;  1VZ7 A;  4JPS A;  1TJE A;  2KC1 A;  1RYJ A;  1L6V A;  4C4V A;  1P3Q U;  4GGQ A;  3FAH A;  4GDL A;  1MFW A;  4RMA A;  3AE3 B;  2ONQ A;  3B0A A;  4KX6 B;  2MHJ A;  4XE0 A;  1CZP A;  2C7M B;  3PO0 A;  1XEE A;  1GTE A;  2WXL A;  3PLU A;  1DOI A;  2D5G A;  4GDK A;  2M0A A;  1IUE A;  1OQQ A;  1R7S A;  1KJT A;  2A5U A;  2VRR B;  1A70 A;  2JPH A;  1L2N A;  1PDX A;  4GU2 A;  4C00 A;  1QF6 A;  2WXR A;  4IUM B;  4RH6 A;  1KLV A;  3HVD A;  3V60 A;  2DWQ A;  2V4I B;  4KGT A;  4HJK A;  1SJH D;  1FO4 A;  1ACC A;  4FHJ A;  1TT5 B;  3NOB A;  3Q3F A;  2XK5 A;  3MTN B;  1JWM D;  3Q2A C;  4FBJ B;  4ICU A;  4REZ A;  3ONS A;  3QHT A;  4LNI A;  1ESF A;  1H8C A;  1WJ6 A;  3TIX A;  2LAS A;  2AX5 A;  3DVN U;  1IPG A;  2KWU B;  3VR8 B;  4WUR A;  3M63 B;  5HG2 A;  1OTR B;  1YJ1 A;  3P42 A;  4II3 B;  2IGH A;  1WMH A;  3IG3 A;  3KQ4 A;  2D10 A;  2LJI A;  1UGJ A;  4K7W A;  1WE7 A;  1ROE A;  4TKN A;  1JWA D;  1SE2 A;  4LDT D;  3N3K B;  4BKS D;  4ICV A;  3T3N A;  2BS3 B;  1MVK A;  1V80 A;  3BY4 B;  3R3M A;  2CJN A;  3H8H A;  2EEL A;  2MLB A;  2K6Q A;  3DBR B;  3EC8 A;  1TKE A;  2JVC A;  4HRS A;  3DDC B;  4PS8 A;  2LXC A;  4K1R B;  3DBL I;  1WZ3 A;  4WJP A;  3VQI A;  1KFY B;  2M17 A;  1V1P A;  5DCN A;  1A5R A;  1IBX A;  4BKT A;  3SFD B;  2KQ4 X;  5HKH A;  2BYV E;  3QAR A;  5KHQ A;  3H9D A;  2GOW A;  2L3Z A;  5EDS A;  3AU4 A;  3GE3 C;  2PJH A;  4G3X B;  4ANW A;  1MHH E;  3RT3 B;  2HE7 A;  2QDF A;  1ET9 A;  2FAZ A;  2JU6 X;  1UBI A;  4S17 A;  1J7B A;  1C78 A;  3GE8 C;  5JXV A;  4KSL C;  2CJO A;  3I9V 1;  4C7Z A;  4EZK A;  2W54 A;  3QX1 A;  3Q6B A;  1RFK A;  1FNV A;  2MBB B;  2ZPY A;  2LZ6 A;  2KDB A;  4YXD B;  1RM6 C;  5E6J A;  4NZL B;  2KTR A;  1WXV A;  3NZ3 A;  1E8W A;  4L2Y A;  4FAD A;  1NI2 A;  4US8 A;  2XN9 C;  2IBI B;  5I4D A;  2FID A;  4H2A A;  3RPF C;  1OQR A;  1FMA D;  1C76 A;  1DOX A;  1NYQ A;  4W9F A;  1N5W A;  3T8M A;  5C3J B;  2L05 A;  3ZTD A;  2IND C;  2HTH A;  5JHB A;  4N59 A;  3BWU D;  3H1U A;  5BMI A;  2FCQ A;  2LEK A;  2LXA A;  4DHZ E;  1HTQ A;  1WYG A;  2XNA C;  3TEX A;  2WDQ B;  2B3A A;  4F1S A;  2MP2 B;  4C56 C;  3O13 A;  4G11 A;  3FKY A;  2JUO A;  2FBW B;  1D5Z C;  2AL6 A;  3NG0 A;  3U52 E;  1B1Z A;  4ANX A;  1LFD A;  3NVV A;  2Z0E B;  3RI7 C;  3NVZ A;  2Z0D B;  3BYY B;  2WXO A;  1N60 A;  2K8H A;  2PKO A;  3SEB A;  4FA6 A;  2MJD A;  2O6V D;  2ZNV C;  5CHW A;  2DZM A;  1V5T A;  1V8C A;  2K25 A;  2LWP A;  4MGI E;  2RGF A;  4IDI A;  4EZL A;  2XBB C;  2LUE A;  2N0S B;  1OFF A;  1XT9 B;  3PZ7 A;  2WQY B;  4JL9 A;  4ARI A;  4WJO A;  2V3P A;  5TR5 A;  3J9C A;  1GNU A;  3P1M A;  4HDQ A;  1AN8 A;  1PQS A;  4KGR A;  3N1Y C;  3NZU A;  4MGK E;  3U7D A;  4DQO C;  4JWS C;  1IGD A;  2D3C A;  5D2M B;  4ZRK A;  1UEL A;  1D6E C;  4B0E A;  2EKI A;  2JZ3 B;  3ZJV A;  3APF A;  3JSV B;  1JWB D;  4IWP A;  2BQQ A;  4ZYN A;  1SF0 A;  3RUI B;  2G4S A;  2KJ6 A;  1GB4 A;  2G45 B;  4WJN A;  2K9X A;  2DAJ A;  1ZXH A;  3UIN B;  1XD3 B;  4KVG B;  4CO7 A;  4YSY B;  3PGE A;  3FC4 A;  1UD7 A;  3NY5 A;  1I4Q A;  4B95 A;  2LHE A;  4LNF A;  3SFE B;  1SIF A;  3L13 A;  3WAN A;  3P2B A;  3QAQ A;  4XDD A;  2LMC A;  3B1L X;  4DDI D;  4EZJ A;  2Z59 B;  3RN9 C;  4A3P A;  2ASQ A;  2DBY A;  2JXX A;  1WY8 A;  2KD0 A;  4NY0 A;  2ACZ B;  1WR6 E;  2MCN B;  2BYE A;  2MBO A;  1EWY C;  1V1P B;  2L0T A;  5E6N A;  1IBX B;  1XCQ L;  2NS5 A;  3AE6 B;  2GBR A;  2OJW A;  2KQS A;  3LYY A;  5E6O A;  3KYC D;  4RFB A;  5H92 C;  3R2I A;  5IO9 A;  3W5U B;  4RM8 A;  3DQV A;  2INN E;  3GS2 A;  4IM2 A;  3IXS A;  4MDK E;  4EEW A;  1E9M A;  2REX A;  2BT6 A;  1F1H A;  4ZRP A;  3DVG Y;  3VFK A;  2IY0 B;  4AUQ C;  4F7Z A;  3TUO A;  2KC2 A;  3ZKJ C;  1QT9 A;  2GLS A;  2QSD A;  2ZW1 A;  4OZB A;  2VH2 A;  3ECI A;  4YTP B;  2BPS A;  2WS3 B;  2L76 A;  2MJ3 A;  4ZDV A;  3TBL D;  1WSP A;  3WA0 A;  2MBH A;  1LXD A;  4DHJ D;  3TL5 A;  3DHH C;  2A4Z A;  4KKI A;  1M4V A;  4JIO U;  4L1B A;  3D32 A;  4HRO A;  2X38 A;  4WJQ A;  2GBN A;  1HEZ E;  4A20 A;  4IWO A;  2K39 A;  3L16 A;  1F9J A;  1I4X A;  4ARC A;  2GMI C;  2C60 A;  1XCT L;  1NBF C;  3VUW A;  4W9K A;  2WXK A;  1CMX B;  4M8M A;  4ZHO A;  2IGD A;  4YL8 A;  1Q5W B;  4MAC A;  3L17 A;  3ZJT A;  1N62 A;  1EU4 A;  2LVP A;  1ZW7 A;  3Q3N C;  1LQB A;  3IAS 1;  3DVG X;  3FIL B;  4KDI C;  4JLC A;  3M3J A;  4WWM A;  2KJR A;  5HHD G;  4AS1 A;  1TS2 A;  1C4P A;  4HWI B;  2K22 A;  3RZW C;  1UF0 A;  4FUL A;  1EU3 A;  1Q1O A;  2YVC A;  5FK9 C;  2KFJ A;  1OQY A;  1FNU A;  3AE1 B;  1VZ6 A;  4W9G A;  2WDR B;  2AQ3 B;  3JYU A;  5J17 A;  3R8B A;  1MG8 A;  1TGZ B;  2JXT A;  5MPO A;  4ZRI A;  4LNN A;  2MSE D;  1TIF A;  2L0F A;  2BWE S;  1WX9 A;  3U2S C;  1ZPS A;  2UWQ A;  1I42 A;  2DYM A;  2KZR A;  1JW9 D;  2G4D B;  1KLU D;  3KYD D;  1J7C A;  3ZUN A;  3APC A;  1TZ1 A;  5H8Y E;  3DVN V;  2K6D B;  2ZVN A;  1XO3 A;  3JW0 X;  2CU1 A;  4LK0 M;  1EUV B;  2J0J A;  2FIF A;  4RCO A;  2KK8 A;  1QLB B;  1IYF A;  1BXT A;  3LDZ E;  1WGH A;  1PGB A;  4A90 A;  2MP2 A;  4OZA A;  1F2R C;  4RGM A;  1TS4 A;  2KFK B;  4XGA B;  3AE2 B;  4DXG A;  3ZIM A;  3GOE A;  3R7R A;  4L23 A;  1DGJ A;  1D5X C;  2PPH A;  2KVR A;  4BFR A;  4NJ6 A;  1F2R I;  2IZV B;  1UBQ A;  3UIP B;  3SR6 A;  2K0P A;  3TEW A;  5C23 A;  5IA7 A;  3AE4 B;  3AE9 B;  4HLE A;  3DBS A;  4QAY A;  3PZ8 A;  5CHV C;  1GUA B;  3ZRC A;  5DPW A;  1C77 A;  2J0K A;  3GP7 A;  2PIA A;  3LXF A;  3DBL B;  1V49 A;  1WXM A;  1ZKH A;  3RNE C;  1IP9 A;  2KX0 A;  2LVQ A;  2IO1 B;  4W9C A;  5IP4 D;  5L83 A;  5BYR A;  1UWX A;  3HRD D;  2AQ2 B;  4C7Y A;  1L0X B;  1GAQ B;  1WJN A;  1YX6 B;  1WRI A;  1F0Z A;  2PVG C;  1S1Q B;  4DDG D;  3AI5 A;  2CHX A;  4OVZ A;  4M01 A;  4WQM A;  1XQQ A;  2HD5 B;  2KN5 A;  2WXP A;  4GDK B;  3EFC A;  4S0R A;  1Z5S B;  3CWI A;  3Q8C A;  3MHZ A;  2OJR A;  3KLS X;  3ABV B;  2D3G A;  2JZP A;  3DBR I;  1WRD B;  3RNF C;  4F8C B;  5D94 A;  2IO0 B;  4WWP A;  2LUM A;  1P1A A;  2O6V A;  2HDE A;  1YQB A;  2WGS A;  1EWC A;  4TMA B;  2KQ7 A;  2PVO D;  2J53 A;  4IOI E;  2FUG 1;  1WGG A;  3QIJ A;  4HPM B;  3NS8 A;  3RMK C;  1E90 A;  4BVU C;  3H7S A;  4BBN F;  1XLQ A;  1MG4 A;  1U4A A;  3CIR B;  1WX8 A;  1J19 A;  1JML A;  4AOF A;  1FXI A;  2ZEQ A;  4ZRJ A;  1QKZ A;  2CHZ A;  1E7P B;  2BYF A;  4IW0 A;  5E6P A;  2WU2 B;  2NBV B;  3SHQ A;  3LB8 C;  1PUT A;  4MSM B;  4KIK B;  1D4B A;  2J42 A;  1K8R B;  5D6J B;  1QOF A;  3FIL A;  1YD8 U;  2DAF A;  4B0M A;  2KLC A;  2DYO A;  3WIM A;  2BB5 A;  1FCL A;  2OED A;  2KX3 A;  2PLP A;  4RNA A;  1TKY A;  5G5H A;  1UZX B;  1UUP A;  1YJI A;  3ZDM C;  1L4D B;  2PTL A;  4AJY B;  1NEK B;  1LO5 D;  1D3Z A;  1QIL A;  1X1M A;  4YWG G;  1WXQ A;  4LJO B;  1RLF A;  3EHV A;  2YEP B;  3BIN A;  2L52 A;  4G0N B;  4WH4 A;  3ZYY X;  1CK1 A;  4K3B A;  2BYT A;  4FJY A;  3AMZ A;  4II2 B;  1RRB A;  3MHS D;  3PVL A;  2KLG A;  3PTF C;  4I6P A;  5IN7 A;  5J18 A;  1LM8 B;  1V97 A;  4GXB A;  3P4S B;  1YX5 B;  2PE9 A;  1JWS D;  3Q8B A;  2B76 B;  2WX0 A;  2G3Q B;  4NQL B;  4HCN B;  3DOW A;  3TMP B;  2Y5C A;  2C9W B;  3H7P B;  4M8N A;  3K9O B;  1EO6 A;  2WXF A;  2JT4 B;  4YT0 B;  1Z2M A;  4PS7 A;  5G5G A;  1VRA B;  2KDI A;  2YEP F;  3IT4 B;  4WIP A;  2WWZ A;  2LGD A;  3JVZ X;  3SDL C;  1TY2 A;  4BKS A;  4AWJ A;  3RZF A;  2WXI A;  3U30 A;  4ZHP A;  3BK2 A;  4W9I A;  1L4Z B;  3RNC C;  3CMM B;  3NZS A;  3IFW B;  4HDO A;  3RNA C;  2RMM A;  2C7H A;  1V86 A;  4HKZ E;  3VHT C;  1P7F A;  3AED B;  5C2T B;  4IM0 A;  2QIE B;  3O65 B;  3MC0 B;  4ZRQ A;  5G55 A;  2K8C A;  1ZGU B;  1E8Z A;  3PZD A;  3MC8 A;  2CHW A;  3V62 A;  3AXC A;  1F52 A;  2WYQ A;  3RD2 A;  3U7Z A;  2LI5 A;  2ZPN A;  4ZOH C;  2JZZ A;  3CF6 E;  5AZG A;  2QCZ A;  3KWV A;  3VVW B;  4MH0 E;  4M02 A;  3N1Z C;  1ZP0 B;  2IYD B;  3E9S A;  2OOB B;  3A4S C;  4UDU C;  1F77 A;  1FCC C;  1E6E B; 
#chains in the Genus database with same CATH homology
 3Q8E A;  3BK1 A;  4HKQ A;  1HZ5 A;  1I7H A;  5BYQ A;  1MI0 A;  2WXQ A;  4KKI A;  1XLN A;  1M4V A;  5BMG A;  5TSS A;  4L1B A;  3BVM A;  1V1O A;  4HRO A;  3MP9 A;  2X38 A;  1ENF A;  2H88 B;  2H89 B;  2Z8L A;  1HEZ E;  3OWE B;  1L5P A;  1L0V B;  3V3X A;  1AW7 A;  1SXT A;  4YTN B;  4YTM B;  1FIQ A;  1I4X A;  2LHD A;  1FD6 A;  4ARC A;  3B9J A;  3AEG B;  2WXH A;  1NEN B;  1SSN A;  1XCT L;  2KAJ A;  2MEK A;  2SEB D;  2WNM A;  2WXK A;  1SE3 A;  1PYW D;  4ZHO A;  2IGD A;  2QIL A;  3ZGZ A;  4M0W A;  4MAC A;  1XF5 L;  4CQN A;  2Q5W D;  3C8Y A;  3ZJT A;  4XWW A;  1I4P A;  1GOZ A;  4RGN A;  1N62 A;  1EU4 A;  2MH7 A;  1KH0 A;  2WLB A;  5BMH A;  4A6Q A;  1JRP A;  1ZXI A;  3DWG C;  3IAS 1;  4NJC A;  3FIL B;  3Q69 A;  3AEB B;  2KDM A;  1NYR A;  3GB1 A;  4WWM A;  2WXJ A;  3E56 A;  5HHD G;  4AS1 A;  3CF4 A;  3HVZ A;  1N5X A;  3B2G A;  2JYT A;  2IGG A;  1TS2 A;  1VZ7 A;  3Q8A A;  1KTK A;  1C4P A;  2K22 A;  3AH7 A;  4JPS A;  2IPK D;  1FFU A;  1TJE A;  1RYJ A;  1K51 A;  1L6V A;  1EU3 A;  1VDV A;  3R2T A;  3BYT B;  4DXF A;  3FAH A;  1GT8 A;  2PMV A;  5FK9 C;  3AE3 B;  2ONQ A;  4KX6 B;  4XE0 A;  1CZP A;  1FNU A;  2WXG A;  3AE1 B;  1VZ6 A;  3NS1 A;  2WDR B;  3ZJU A;  2AQ3 B;  3PO0 A;  1XEE A;  1GTE A;  2WXL A;  2WXM A;  1E10 A;  1SIJ A;  1AYF A;  2D5G A;  1DOI A;  4N6E B;  5D3I B;  2M0A A;  1IUE A;  3R8B A;  1OQQ A;  1L6U A;  1R7S A;  2LGI A;  3V05 A;  2JXT A;  1H7X A;  5MPO A;  1A70 A;  2V3N A;  1PDX A;  1QF6 A;  3W2D A;  2WXR A;  2ICI A;  2N9K A;  4RH6 A;  3HVD A;  3U2S C;  1ZPS A;  2DWQ A;  2V4I B;  3VRA B;  1TS5 A;  1XXG A;  2DYM A;  4KGT A;  1SJH D;  1FO4 A;  1ACC A;  1JW9 D;  2JSV X;  4N58 A;  2GRI A;  1JRO A;  1DYQ A;  3URY A;  1BML C;  1KLU D;  2QJL A;  1J7C A;  1Q10 A;  2IDY A;  1JWM D;  4YSZ B;  5H8Y E;  1SEB D;  4REZ A;  1FM0 D;  1XO3 A;  2WDV B;  1ESF A;  1ZUD 2;  1J7A A;  4WAF A;  1KF6 B;  4P6V F;  4LK0 M;  2AX5 A;  1T5X D;  1TYG B;  4RCO A;  1SE4 A;  1QLB B;  2OHF A;  1BXT A;  4WUR A;  3VR8 B;  5HG2 A;  3TEY A;  1PGB A;  1T3Q A;  4A90 A;  3P42 A;  2GB1 A;  1YQ3 B;  1T6B X;  2IGH A;  4OZA A;  1C4C A;  1F2R C;  2R61 A;  3KQ4 A;  2LJI A;  4RGM A;  1TS4 A;  2DLB A;  1UGJ A;  1FRD A;  3AE2 B;  4DXG A;  1ROE A;  4OW0 A;  1YN5 A;  1JWA D;  3RFZ B;  3P4Q B;  4RGT A;  1SE2 A;  3VR9 B;  4L23 A;  1DGJ A;  1D5X C;  1EM7 A;  3T3N A;  2BS3 B;  1IGC A;  1MVK A;  2J52 A;  1F2R I;  4NAW B;  1ZDX A;  2CJN A;  3H8H A;  1RWS A;  2EEL A;  1HQR D;  3SR6 A;  3T3O A;  2K0P A;  3TEW A;  1TKE A;  4HRS A;  3ZQ4 A;  3AEF B;  3L4P A;  2WU5 B;  5FR3 A;  3VQI A;  1MPE A;  3AE4 B;  1KFY B;  3AE9 B;  1V1P A;  5GXG B;  2W55 A;  1HZ6 A;  2W3S A;  1AWD A;  1IBX A;  3AEA B;  1YNT E;  2Y3A A;  3PZ8 A;  1TY0 A;  4IKG A;  3SFD B;  2KQ4 X;  4O1N A;  3AN1 A;  1C77 A;  1K52 A;  2L32 A;  3GP7 A;  2PIA A;  3LXF A;  2RDH A;  2N9L A;  1STE A;  2I38 A;  5BYR A;  1PGX A;  1UWX A;  3BVG A;  1SJE D;  3IAM 1;  2V0G A;  1MHH E;  3HRD D;  2AQ2 B;  4C7Y A;  4XWT A;  1K53 A;  1L0X B;  1GAQ B;  1ET9 A;  1WRI A;  2JU6 X;  4LTU A;  1J7B A;  1C78 A;  5JXV A;  3AEE B;  1F0Z A;  2PVG C;  2CJO A;  3I9V 1;  1YJJ A;  5EE1 A;  1C79 A;  4C7Z A;  4OVZ A;  1XLO A;  3MFG A;  2BS2 B;  2W54 A;  4WQM A;  4US9 A;  5LNK 1;  2BW2 A;  4MM3 B;  2BBC A;  1RFK A;  2L83 A;  2QMT A;  1D5M C;  1FNV A;  3KWL A;  2WXP A;  4GDK B;  4GLS C;  1C4A A;  4YXD B;  1RM6 C;  5EE0 A;  3CWI A;  3Q8C A;  4OHJ A;  5E6J A;  4NZL B;  3AEC B;  3MHZ A;  3NZ3 A;  4L2Y A;  4JE3 B;  3KLS X;  3ABV B;  1QOB A;  2JZP A;  2BTE A;  4US8 A;  2XN9 C;  3BII D;  5I4D A;  4H2A A;  3RPF C;  1OQR A;  2LUM A;  4RF0 A;  4MH8 A;  1I4R A;  1FMA D;  1C76 A;  2HDE A;  1NYQ A;  1B9R A;  1N5W A;  1DOX A;  1EWC A;  4TMA B;  1ET6 A;  2CU3 A;  5EE3 A;  2PVO D;  5C3J B;  2J53 A;  4IOI E;  2FUG 1;  2K5P A;  1FXA A;  2SAK A;  5BYS A;  4R3D A;  2NTT A;  3BWU D;  4N59 A;  4ZYS A;  4YSX B;  5BMI A;  4NAM A;  3AE5 B;  2GI9 A;  2LEK A;  1WYG A;  1WGK A;  1XLQ A;  1VJK A;  2XNA C;  1GB1 A;  3TEX A;  3VRB B;  3CIR B;  1BUI C;  2TSS A;  2WDQ B;  1JML A;  3B2F A;  2NTS A;  1FXI A;  2JWU A;  2N7J A;  4C56 C;  3O13 A;  3BVZ A;  1QKZ A;  1E7P B;  2FBW B;  1D5Z C;  2WU2 B;  3LB8 C;  1E0Z A;  2G1E A;  2ON8 A;  4HEA 1;  3I57 A;  1PUT A;  1QOA A;  2KMM A;  3U52 E;  1D4B A;  1B1Z A;  3AV8 A;  3NVV A;  2J42 A;  1SB3 C;  3NUH B;  2RPV A;  1TZO A;  4AQ7 A;  1QOF A;  3FIL A;  3NVZ A;  3AB5 A;  3BYY B;  4B0M A;  2JQR B;  2DYO A;  4GDL B;  3W5V B;  1VLB A;  2WXO A;  2WXN A;  2BB5 A;  4Q2J A;  1FCL A;  1N60 A;  3P4P B;  1L0Y B;  2OED A;  2PKO A;  5EE9 A;  1MHX A;  1UNS A;  2W82 A;  3SEB A;  2PLP A;  4RNA A;  2MJD A;  1TKY A;  1QOG A;  2PW9 A;  5G5H A;  4KKJ A;  2RDG A;  1UUP A;  1YJI A;  3NVY A;  5AUI A;  1V8C A;  1L4D B;  2PTL A;  2NMQ A;  3IT6 B;  4P16 A;  2AQ1 B;  4IDI A;  4J3O D;  2N0S B;  1FEH A;  1OFF A;  4RF1 A;  1NEK B;  2E3T A;  4D2K A;  3PZ7 A;  1LO5 D;  2WQY B;  2G9H D;  1N63 A;  1QIL A;  4YWG G;  1WXQ A;  4ARI A;  2FE8 A;  1VR9 A;  2V3P A;  1JCK B;  2L1A A;  2BB6 A;  2YEP B;  2W3R A;  3J9C A;  5HI1 A;  3P1M A;  1AN8 A;  2L52 A;  4WH4 A;  3ZYY X;  4KGR A;  1DOY A;  1CK1 A;  4TSS A;  2BYT A;  3AMZ A;  4DQO C;  4JWS C;  1P7E A;  4JX1 C;  1GTH A;  1IGD A;  4PT5 A;  1ZDV A;  4MT5 A;  3AM9 A;  1D6E C;  2J4X A;  2EKI A;  4B0E A;  3U4E G;  5FKA C;  3ZJV A;  2JYE A;  1Y56 A;  1V97 A;  2KN4 A;  3NRZ A;  1JQ4 A;  3ETR A;  2INP E;  1JWB D;  3W9C B;  3P4S B;  1UWM A;  2Y5P A;  1JWS D;  3Q8B A;  3Q8F A;  2B76 B;  4RGO S;  3BZD B;  1SF0 A;  3EUB 2;  1GB4 A;  2IJ0 A;  2Y5C A;  3WCQ A;  1FNW A;  4FXC A;  4ITK A;  3TSS A;  2K9X A;  2WXF A;  1ZXH A;  3EA6 A;  1KRH A;  3HUI A;  1YQ4 B;  4A55 A;  4YT0 B;  4YSY B;  3FC4 A;  1I4Q A;  2LHE A;  4A9A A;  3W1S A;  3UI3 A;  1CJE A;  5G5G A;  1VRA B;  1I4H A;  2YEP F;  5HFY A;  3IT4 B;  3P63 A;  4WIP A;  3SFE B;  1VZ8 A;  4C80 A;  4EE2 A;  1NVI D;  1YN3 A;  4XDD A;  2LMC A;  2KWD A;  1NI3 A;  1TY2 A;  4OZC A;  2I2Y A;  2DBY A;  2WXI A;  4KGS A;  4ZHP A;  4TQ1 A;  3BK2 A;  1N61 A;  1L4Z B;  5D7G A;  2ACZ B;  1I4G A;  2BS4 B;  2KAC A;  3P4R B;  4USA A;  5D3D A;  1FRR A;  1CQV A;  1ZOY B;  2RMM A;  4JWU C;  4HKZ E;  1WWT A;  1H7W A;  1EWY C;  1YMH E;  1V1P B;  1KLG D;  1K50 A;  1P7F A;  4XDC A;  3AED B;  2QEJ C;  5C2T B;  1HXY D;  1IBX B;  1XCQ L;  4LLG M;  3AE6 B;  2QIE B;  2LFI A;  2VZK D;  3MC0 B;  4ZRQ A;  3LYY A;  4HJG E;  4RFB A;  3TEZ A;  2HTM E;  1C9F A;  2E6X A;  2JX5 A;  3AE7 B;  1PGA A;  5H92 C;  4TQ0 A;  3R2I A;  1SBB B;  1JAL A;  1JWU D;  3W5U B;  2K3U A;  2WP9 B;  2ZW0 A;  3GS2 A;  2INN E;  2M56 B;  3U7Z A;  3IXS A;  1FFV A;  1QQR A;  1E9M A;  4ZOH C;  2BT6 A;  5T8I A;  3KWV A;  4ZRP A;  3N9Y C;  3MJ5 A;  5AUK A;  1GPX A;  1TS3 A;  1TKG A;  3TUO A;  1ZE3 D;  1PFD A;  3DWM A;  1YN4 A;  1QT9 A;  2QSD A;  2ZW1 A;  1ZP0 B;  4OZB A;  2M19 A;  4YTP B;  2WS3 B;  2MJ3 A;  3E9S A;  4A8X C;  1HA5 A;  2VZK B;  1F77 A;  3EGR A;  4UDU C;  1WSP A;  1XLP A;  1FCC C;  3AE8 B;  1E6E B;  3NVW A;  2MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...