3VRBB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vrbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vrbB01
2BT6A 3BIID 1ZUD2 1RM6C 1ZXIA 1AYFA 3AE6B 1QF6A 1IUEA 1RFKA 2MH7A 1J7AA 3AB5A 1L6VA 3AEGB 1ZOYB 4US8A 1RYJA 2PKOA 1SIJA 2MJEA 1E6EB 4YTNB 2PVGC 3DWGC 1J7CA 2ACZB 1N62A 3AN1A 1TYGB 1OQRA 1PFDA 3L4PA 4N59A 3SFDB 1QOFA 2JX5A 5C3JB 1PUTA 2Y5CA 3AEBB 5C2TB 5EE0A 1T3QA 4C80A 3AV8A 4IDIA 3LB8C 3AE3B 4YSXB 2K5PA 3AMZA 1XLOA 1L5PA 3VR9B 4C7YA 3HVZA 4JWUC 1A70A 2MJDA 2PIAA 1N5WA 2FBWB 1JRPA 3SFEB 4YT0B 5GXGB 3NVYA 3ZYYX 1JWBD 1L0VB 2W55A 3NVZA 2WDRB 2PVOD 3B2GA 2N0SB 4JWSC 1DOIA 1FXAA 3P4RB 3B9JA 2H88B 1E0ZA 3AE7B 3CIRB 5EE1A 5EE3A 1KRHA 3AEDB 3KWLA 2WP9B 4HROA 1L6UA 1PDXA 1YJJA 2L52A 3DWMA 3AM9A 5G5GA 1WGKA 4ZHPA 2CJOA 1N60A 3LXFA 5EE9A 3VRAB 1GT8A 1OFFA 3AECB 4USAA 1WWTA 2MJ3A 1NVID 1R7SA 1GTHA 3AEFB 3VRBB 1B9RA 1DOYA 5H8YE 1WXQA 1E9MA 3ABVB 3W5UB 4WWMA 3P4SB 4US9A 1NEKB 1JALA 2WU5B 1SF0A 1XO3A 2AX5A 2QJLA 3FC4A 4JX1C 3CF4A 2WU2B 1FMAD 5G5HA 4HRSA 1JW9D 1TKGA 1TKEA 4ZOHC 1EWYC 1YQ3B 3NS1A 4P6VF 1JWAD 2DWQA 2BS2B 2M19A 3AEEB 1YJIA 3VR8B 2K22A 1ROEA 4ZHOA 1KF6B 5H92C 1E7PB 1N5XA 2BS4B 4YXDB 1N61A 1NENB 2G1EA 3W5VB 1J7BA 1FIQA 1NI3A 1VJKA 3P4PB 1FM0D 3AE8B 2OHFA 2QIEB 1JQ4A 3HRDD 1UWMA 1QOGA 4KX6B 2KAJA 3NVWA 1N63A 1KFYB 2WQYB 1AWDA 5AUIA 1QOAA 1DOXA 4WQMA 1JROA 3AE2B 2LEKA 1CJEA 1FO4A 3SR6A 4YSYB 2HTME 3WCQA 5AUKA 1FFVA 4YSZB 1FRDA 3AE5B 3AH7A 1VLBA 3NVVA 1WYGA 2B76B 3AE1B 3HUIA 3P1MA 1GTEA 1GPXA 3AE4B 2L83A 1E10A 1ZP0B 2E3TA 1FRRA 2M56B 2W3SA 1XLPA 1I7HA 2W54A 3W9CB 1RWSA 4YTPB 3ETRA 3CWIA 2W3RA 3B2FA 2WDVB 1V8CA 2CJNA 3FAHA 3PO0A 4N58A 2H89B 1V97A 1XLNA 5MPOA 2BS3B 1QOBA 1TJEA 1TKYA 2WS3B 1FFUA 1GAQB 2CU3A 1OQQA 1SB3C 2KMMA 3EUB2 4LTUA 2WDQB 2WLBA 4A9AA 1NYQA 1QT9A 1XLQA 4FXCA 1F0ZA 1YQ4B 3RPFC 2DBYA 4C7ZA 1NYRA 3P63A 3NRZA 2JQRB 1H7XA 3AE9B 3P4QB 2Q5WD 1H7WA 1DGJA 1FXIA 1WRIA 2EKIA 4ITKA 4N6EB 3AEAB 4YTMB 1VDVA 2K9XA 1QLBB 1CZPA
chains in the Genus database with same CATH superfamily
3EFCA 2C7HA 2MH7A 4HJKA 3PLUA 3C8YA 4MT5A 3H7PB 1RLFA 1RYJA 2MJEA 2WXPA 2INDC 2V4LA 4BAXA 2JX5A 2L1AA 1Q10A 4IDIA 3TUOA 2K5PA 2N9LA 4P1BC 2IGDA 1GJZA 5HG2A 2KACA 4KIKA 1RRBA 4LNFA 3NZSA 4WIPA 2M0XA 1WRDB 2C5LC 3U52E 3DWMA 3MP9A 5BMIA 4HXDA 4DHZE 3VQIA 4J3OD 3KYDD 1NVID 2L0FA 5JHAA 3N1XC 1Y8RC 2KK8A 3P4SB 2FCSA 3Q6BA 2L00B 4JX1C 4OVVA 3RNCC 3DPDA 1E8XA 5BO4B 2DENB 1HXYD 2BS2B 3AEEB 2I2YA 1P7FA 2NVUI 1YJ1A 3I57A 2YEPF 1C79A 1SGHA 2KD0A 1AWDA 4GU2A 2MSED 4EEWA 3QWZB 5AEKB 4DXFA 2DZMA 4ZRIA 2NBWB 5FKAC 3T3NA 4BKSA 2W54A 1XLPA 3H1UA 4YTPB 1NBFC 3DVNV 2MCNB 2HTHA 3OLMD 2E6XA 3IG3A 4BVUC 4DQOC 5G55A 1I4XA 5C23A 2LASA 4G0NB 4RGMA 4LCDE 4URKA 5J18A 3H8HA 3VUWA 1TS5A 1T0SC 3MJWA 2JYEA 1V81A 3A33B 4GXBA 4ITKA 5HFYA 1J7AA 2C7MB 1E90A 1YN4A 2ZCBA 2LJIA 3RNFC 1J7CA 2ACZB 4HKQA 3KLSX 2VZKD 3GP7A 1SIFA 5LXIB 2LI5A 4CYEA 3DBLI 4LNIA 3Q3NC 1XT9B 2L05A 4FHJA 2D3AA 1P98A 4P16A 4PT5A 3CSFA 4AS1A 2NBVB 4EZKA 1EU4A 2LGIA 1I4RA 3AM9A 1C4AA 1WGKA 4GLSC 3ZTCA 5HHDG 2PMVA 4EKUA 2M4NA 1ENFA 2ASQA 4DDID 1B9RA 3ZNZB 4A55A 5H8YE 5L83A 1Z5SB 1E9MA 2I1JA 1D5XC 4PS3A 2G9HD 2B3AA 1FNVA 1TKEA 1YD8U 2JXXA 1EWYC 3M63B 2A5UA 2DWQA 3IVFA 4EZJA 3RFZB 4HCPB 1G6JA 1KF6B 3MHZA 2LVQA 1N5XA 3TJPA 4X57B 4DHJD 3Q3MC 2SAKA 3JYUA 2FCNA 1NDDA 2KANA 2PJHA 2KYWA 2K6QA 3C0RB 1JROA 4ZYSA 1V1PA 1ZGUB 2B76B 5AZHA 3MJ5A 4OVZA 1GPXA 5G2NA 2JT4B 3ETRA 5DCNA 1UZXB 3GE3C 3W1SC 1V97A 2GI9A 4BZAA 2KDMA 1CQVA 2XK5A 2GLSA 2JSVX 2Z0EB 5HKHA 2JXTA 3EA6A 3SEBA 1J19A 2L8JA 2TSSA 3NRZA 4PS8A 1GC6A 1VDVA 2DZJA 2HD5B 4C4VB 5DPWA 1LQBA 5E6NA 4BKSD 1RM6C 3DOWA 4WJNA 2KFJA 4YTNB 1N62A 1KLUD 3SFDB 5C3JB 2IZVB 1UGMA 1HZ5A 2R61A 4W9GA 2BWES 4KV2A 3AE3B 3MC8A 2LD9A 4KVGB 2FBWB 3NVYA 2ZJDA 3NZUA 5DPTA 4NJCA 5EDSA 3V3XA 1EUVB 3B9JA 2D5GA 4RH6A 2LUMA 1AW7A 2ZNVC 3PZDA 3ZXRA 1R4MB 1Z2MA 2CJOA 4GB9A 1TTNA 2BYTA 1B1ZA 3ZJTA 4ZRKA 4W9CA 2KQ4X 4EE2A 1JW9D 2WXOA 4EFOA 3IHPC 4BOZB 1SBBB 1UD7A 4XDDA 1V9JA 2NR2A 4NAWB 2WXLA 2FUHB 2CS4A 4A90A 1LM8B 2V4IB 3HVDA 3RZFA 2WXHA 4GDLA 1V2YA 1YN5A 3JW0X 3L54A 4DXAB 5D3DA 4DDGD 2LGXA 2E3TA 1FRRA 2W3SA 3W9CB 1V5OA 1XCTL 4LNKA 3PRPB 1MI0A 3CWIA 2MP2B 3PO0A 2OEDA 2KX0A 4A20A 4K7WA 1RFAA 1ET9A 1UUPA 2CU3A 3Q14C 1GUAB 3QJZA 1V6EA 4E74A 1F0ZA 1FPYA 3DVGX 3PGEA 1VCBA 4RNAA 4LNOA 3BYYB 1FXIA 2KWDA 2WYQA 3AEAB 3I5JC 1QF6A 1F52A 1C76A 2KC2A 5DPSA 3EHVA 2JRHA 1HTQA 2MW5A 2PVGC 1V1OA 3QCAA 1M94A 2KXJA 1CK1A 1KM7A 3ZXVA 3Q8FA 4YSXB 5IN7A 4PYZA 4C7YA 2C9WB 2MJDA 4K3CA 1HTOA 2IYDB 2WXMA 2XNAC 4LJOB 3A9JB 1IP9A 1FXAA 2X38A 2QEJC 3AE7B 1KRHA 4HROA 1P3QU 4C00A 1YJJA 4ZHPA 1MFWA 1LGRA 2KDEB 1UH6A 1WF9A 4WAAA 2IY1B 2LXAA 4W9HA 4AJWA 4WAFA 4ZRQA 4GDKB 1JALA 2AX5A 3O13A 5CX3A 5CHVC 3CF4A 1YMHE 5T8IA 5FR6A 2KMAA 3L17A 1XEEA 1FCCC 1BUIC 3IT4B 2J52A 2BW2A 1RAXA 1GNUA 3UIOB 4ASWC 2O2VB 3NVWA 1ZDXA 5JZEB 3AE1B 1I7HA 1TS4A 3VHTC 1TZOA 2G45B 2KOXA 1XLNA 5CHFA 3M3JA 4RGOS 4A9AA 4KKJA 2L32A 3Q3JA 4FXCA 4HDOA 1YQ4B 5TR5A 3P63A 4MM3B 2V9HA 3P4QB 2VZKB 3KQ4A 3IFWB 1TYGB 2Z59B 3TSSA 4FLHA 4G11A 3BZDB 5E6JA 4XDCA 1P7EA 3AEBB 3TBLD 1WGGA 3APFA 3NOBA 2BTEA 2NPTA 4M0WB 4JIOU 1P0RA 3VH3B 4JWUC 2PIAA 3ZNHB 3NS8A 3N1YC 3GB1A 1L0VB 1TT5B 2KQSA 4ICVA 3B2GA 2N0SB 4ZDVA 1DOIA 3OJ4B 3P4RB 2V0GA 3RYTA 3PPAA 4AUQC 1L6UA 1IYFA 1L7YA 1WX9A 5EE9A 2BYEA 4KIKB 4IWQA 1TBEA 2L7RA 2ONQA 3N1ZC 2GOWA 1L4ZB 2RD0A 1FNWA 2DYBA 3EFUA 3GZNI 2FCMA 4DHJB 4DHZB 2WU5B 1ZE3D 4A6QA 2KN4A 1PGBA 1SEBD 2Y3AA 4LJPB 1IPGA 3ALBA 4REZA 3N9YC 3N32A 2BYVE 2MA9B 4OHJA 4WJQA 4GIVA 2FE8A 3KH0A 2PPHA 1AN8A 2M1MA 4IM2A 3W2DA 2N9PC 4ICUA 3DHIC 3N3KB 1SE4A 1PGXA 2KWCA 1DYQA 4OVUA 1V8CA 4NZLB 4K1RB 2KDIA 4W9LA 3VTUA 4RF1A 2WS3B 2INNE 2NCNA 3VTWA 2FNJB 2IO1B 1QT9A 2K39A 4JPSA 4W9DA 3UQBA 3W1YA 1FD6A 5CTRC 2YEPB 4FA6A 1E8YA 2WDTB 1H7XA 2OJRA 3V60A 2RDBC 2ZZPB 4KDLB 1CZPA 4W9EA 3NHEB 4ARCA 1WXVA 3KUCB 3QX1A 1WR6E 1L6VA 2JPHA 2JUOA 2N9XA 1OQRA 1VZ8A 1QOFA 2A4ZA 1P1AA 4M01A 2IO2B 3AMZA 2C7NB 4IM3A 1L5PA 2IY0B 3DBRI 1R4NB 4M02A 1LFDA 4II3B 1N5WA 4MGKE 1SJED 2DHZA 3A1QA 5GXGB 4HPMB 2J4XA 2PVOD 4ZRPA 1VR9A 2V3PA 3T9LA 4RMAA 2JYTA 1WZ0A 4BFRA 3S2AA 1XF5L 1WM2A 2QSDA 2ZPYA 1OFFA 3DBHI 3VDZA 3Q3FA 1LXDA 2M17A 1KH0A 3NY5A 1NEKB 1XO3A 2K8HA 1XQQA 2EMTA 2LVOA 3U8ZA 5I4DA 1ROEA 4GGQA 4YL8A 5L95C 2WXFA 4YWGG 3AE8B 4HKZE 3NVVA 3AULA 3RNBC 1UBQA 1FCLA 3VXWA 2CHWA 1V1PB 1I4GA 5JH5C 4GN1A 1F1HA 2N7JA 2N7DA 1JCKB 1TIFA 4A8XC 2N1WA 2BWFA 2JQRB 2IDYA 2XK5B 1JWSD 4W9FA 2JZPA 2IO3B 3UQAA 1Q5WB 4DK5A 1L4DB 5IKCM 1JWMD 2D3GA 4GMVA 3LYYA 2WXQA 3MC9A 1PFDA 1WMHA 4WJPA 2JZZA 2BBCA 3OAWA 1KTKA 4NQLB 4QAYA 1ISNA 2XN9C 3VR9B 1V80A 3ZNGC 5LXHA 2ZVNA 1V86A 3ZYYX 4I6NB 2KFKB 1MHXA 3ZO5B 3QARA 2IBIB 2MX2A 4FN2A 3QHTA 3CIRB 3VFKA 4NPNA 4M8NA 3E9SA 2PW9A 5BYRA 1WXQA 1YQBA 4Q2JA 2O6VA 4WWOA 1WXSA 5FR3A 1SF0A 2ON8A 4H2AA 1WXAA 5D3IB 1KLVA 4KSKC 3CSTA 1C4PA 2LWPA 4ARIA 2GMIC 3VVWB 4B0EA 3ENEA 1C78A 3ZQ4A 2D3BA 3EGRA 3PZ7A 1FIQA 3MFGA 1EU3A 1UNSA 3R66C 5D6JB 3HIZA 3AE5B 4ACFA 4C56C 4PS7A 2RMMA 3U4EG 3AE4B 4XGAB 3PREA 3JSVB 4GSWA 4GDLB 1C77A 3NJTA 2WDVB 2J7QB 3R3MA 1F77A 4JGHB 2DLBA 3U7DA 4TQ1A 1F9JA 3AI5A 1NYQA 3WAMA 1CMXB 4FJYA 5BYSA 3RPFC 2IGHA 2KO3A 3A4SC 4YTMB 3TIXA 2AEHA 2DZKA 1IUEA 4MEMA 3SU8X 4HDQA 3ZDMC 2UWQA 2XEWA 2DNFA 3W1SA 4R3DA 2KWUB 1WE6A 2G3QB 1P9DU 3FILA 4LNNA 5EE0A 1T3QA 4P1CC 3ZLZA 3AU4A 5BMHA 2DAFA 3ZVVA 1X1MA 2RPVA 3H7SA 3SFEB 4G50A 1H8CA 5BMGA 1MPEA 4XC2A 2K1FA 2NS5A 2PE9A 2GBNA 3BWUD 3GOEA 3A9KA 2MEKA 1GT8A 4W9KA 2MJ3A 2GBMA 4L2YA 3VRBB 2KTRA 5TSSA 2R2QA 3X23A 2XBBC 3ZW3A 2MBQA 5D2MB 3W5UB 1TGZB 2IGGA 3M62B 3WALA 2FCQA 3ZUNA 2N7EA 2L76A 2M19A 2GBRA 2QILA 1WJ4A 3M95A 3NUHB 2WNMA 2JF5A 2WXIA 3QIJA 3DBLB 1QOGA 4MSMB 4II2B 3N20C 2O6VD 1QILA 2HTME 5AUKA 3BK2A 4YSZB 1FRDA 3OWEB 1D5ZC 4AQ7A 1C3TA 2ZW1A 1E10A 4AP4C 2W3RA 3B2FA 4N58A 4XWWA 3DVGY 1QOBA 2J0JA 3P42A 4B95A 2JVCA 2AWTA 2DBYA 4C7ZA 1NYRA 2WX1A 2HJ8A 1DGJA 2EKIA 2KQ7A 3CF6E 2KKCA 1QLBB 3PLVA 3U7ZA 3I3TB 3AE6B 2V3SA 1M4VA 5AZGA 4IM0A 1J0GA 1C1YB 2UYZB 1UWXA 2WX0A 2KVZA 4IC7B 3TMPB 4N59A 1WE7A 2KDBA 2Y5CA 3V62A 4N9F4 3UINB 4KKIA 2BB5A 1UBIA 2WDRB 2NPTB 3E56A 1S1QB 4AJYB 2VH2A 2EMSA 1XCQL 3R7QA 3QK0A 2L52A 3TEXA 4NJ7A 1HE8A 4USAA 4IUMB 5C1ZA 1HEZE 4OW0A 1E8WA 3MTNB 4MGIE 2I1KA 4US9A 1YX5B 1WIAA 3ZIMA 2MLBA 3VR8B 2N9KA 2LMCA 2GBKA 3QAQA 1YX6B 2BS4B 3HK0A 1FNUA 1ESFA 2LGDA 3P4PB 2Y5BB 2PLPA 3R8BA 5J17A 4WH4A 4M8MA 2KHWB 4KGSA 1VLBA 2L83A 3PS6A 2FUG1 2WHIA 1TS3A 2MBBB 3FAHA 1ET6A 4LDTD 1WJ6A 3DBSA 4DBGA 1XLQA 3NG0A 1XD3B 3T3OA 5J2RA 2JZ3B 3QA8A 2Q5WD 5FK9C 3FKYA 4RFBA 1ZUD2 2EKEC 2IO0B 4KGTA 1OQYA 4NQKE 4US8A 3PT2B 3DWGC 2WXNA 4E3CA 2WXGA 1HQRD 1IBXA 3V6EB 2BKFA 3Q3OC 3LB8C 3RNGC 3L16A 2LGSA 4NAMA 3RT3B 4RF0A 5CHWA 2J0MA 3DQVA 1JWBD 2FIDA 2MWSB 3VH4B 3B0AA 3RMKC 3A1QB 2AL6A 2VRRB 2KLCA 2C60A 1GTHA 3PV1A 4WJOA 4TKNA 3KW5B 1VZ7A 1FMAD 4OZCA 1WJNA 1YQ3B 4BBNC 2LVPA 1FXTB 1JWAD 1PGAA 3UIPB 2KC1A 2K22A 2YVCA 4WURA 2LHEA 4ANWA 4ANUA 1AARA 2KWVB 1FM0D 2QIEB 3HRDD 1N63A 5IA7A 5AUIA 4KDIC 4XYCA 4K7SA 1FO4A 4YSYB 4FJVB 2DZIA 1FFVA 3Q2AC 1WYGA 1GTEA 1Y56A 2I38A 1RWSA 4HWIB 3ONSA 2CJNA 4HVBA 2DYOA 3KUDB 5MPOA 1FFUA 1K53A 5E6OA 3Q8CA 3ML8A 2G4SA 2AQ2B 4KSLC 1E5WA 3PHXB 3AE9B 1S3SG 3OJ3A 3BIID 5IP4D 3RNAC 3L0WB 4F7ZA 1JRUA 5AZFA 2D10A 1E6EB 4GDKA 1GC7A 3SDLC 1NI2A 2RSUA 2QDFA 4G3XB 1I42A 3GE8C 3KVFB 2IPKD 3LDZE 2LFIA 1WJUA 1TY0A 2KJRA 3WA0A 2CR5A 5EE3A 1D3ZA 3AEDB 1OEYA 1HA5A 2UU7A 3R2TA 3IAS1 1QKZA 3EC8A 3AEFB 4AWJA 2WGSA 4RGNA 3RZWC 4TMAB 1VD2A 1EM7A 3L13A 4J6IA 1OEYJ 3U2SC 3TEZA 2M0AA 2O6VB 4OZAA 3VUXA 1N61A 1NENB 1JQ4A 3QC8B 2MBHA 4JQWC 4LK0M 1WI0A 1BXTA 3SR6A 1PYWD 1WX8A 1WGHA 1YN3A 5DPRA 2JWZA 3RULA 3CMMB 3SHQA 4B6WA 2REXA 4M0WA 3DCGA 4K3BA 3RD2A 2KMMA 3C19A 4FBJB 1UGJA 4IW0A 1C9FA 2WDQB 2WLBA 3K9OB 1MJDA 3GZNB 3UGBB 1WX7A 1KJTA 5IOIA 2J53A 2KDFB 1WM3A 3OG5A 4XWTA 1N6ZA 2LUEA 1SE9A 3ZNID 1SIJA 3RCZA 3WIMA 4ZYNA 1SE3A 4MH8A 3NZ3A 3FILB 1I4PA 4EZLA 2W55A 4WWNA 3RUIB 2KT7A 4MJSA 1A5RA 2D2QA 4FULA 1N60A 3AXCA 3AECB 1WWTA 4BKGA 3PTFC 2LXCA 1K51A 2KN5A 3HHMA 2KX3A 5IO9A 2CKHB 2D11A 4IOIE 1F2RI 3A9KB 3J9CA 2WU2B 2ZPNA 3TCAA 1TKGA 4HJGE 2Y5PA 3NS1A 2KTRB 3IAM1 4ZHOA 1ZXHA 4KGRA 4YXDB 2BPSA 2OJWA 2RPQA 1SJHD 1WH3A 1VJKA 1SSNA 1UWMA 3PRZA 3DBRB 2RDHA 2ZNVB 5D94A 2VH1A 1EO6A 2BB6A 3AE2B 2KLGA 1CJEA 2AL3A 3N30A 3UF8A 4LDTB 1WGRA 1YNTE 1T0YA 3L10B 2M56B 1YIWA 2K8BA 3V61A 1E7UA 2J42A 5LLIA 1ZKHA 4O1NA 4A3PA 3DBHB 1GAQB 2NTSA 1OQQA 4WWPA 2Z8LA 3TEWA 2YLMA 2ZCCA 1D4BA 1R4MI 2GB1A 3APCA 3PHWB 2K3UA 2KJ6A 3QQ8B 3H7PA 2BQQA 1H7WA 4F8CB 2G4DB 1AYFA 5E6PA 2WXJA 3AB5A 1TS2A 3ECIA 1MG8A 2PKOA 4ZRJA 1H4RA 1ZW7A 4MGZE 1TZ1A 1IGCA 2ZW0A 3AV8A 2J0KA 1T6BX 1J8CA 4RCOA 4YT0B 3BVMA 5BYQA 1MHHE 1GOZA 3KWLA 2PTLA 2W82A 1L0YB 1STEA 1L2NA 3LXFA 4RM8A 1DOYA 4OZBA 1YOVB 2LHDA 2MRPA 2WWZA 4ZOHC 2LRWA 4P6VF 4B9KA 3Q8EA 4L1BA 3TEYA 2D3CA 1OGWA 4UDUC 2BKRB 2G1EA 1J7BA 1WSPA 2M8SA 5JHBA 1BT0A 3I63C 2WXKA 4TV3A 2NTTA 4KZ0A 4WQMA 2HE7A 2LEKA 2N4FA 3ZGZA 3BVZA 3GS2A 3HUIA 3P1MA 2AYOB 1ZP0B 1VZ6A 2QHOA 2KMCA 4HLEA 2CHZA 3V6CB 2BS3B 2RR9A 4ANXA 4LTUA 4EOYA 1WFYA 2KFKA 2L3ZA 1QQRA 4HK2A 3WAOA 3WANA 2K9XA 1D6EC 3PSEB 2BVCA 4NNJB 2AQ1B 4W9JA 4MELA 1I35A 3HM6X 3AEGB 3PVLA 4F1SA 2MQJA 4DWFA 2FIFA 5C2TB 4XZ4A 3MHSD 4C80A 4K7UA 1T5XD 1XLOA 4D2KA 1XXGA 3PZ8A 4MSQB 1IBXB 2BGFA 1WGDA 3RN9C 3IBEA 4RM9A 1U4AA 3KYCD 4FHKA 3AU5A 2ZVOA 1E0ZA 2V1YA 4B0MA 2WP9B 5G5GA 2QCZA 3MC0B 1R7SA 5GMVA 1WY8A 3JSVA 1HZ6A 3K9PB 2MHJA 4WWMA 3ZJUA 1MG4A 1WGYA 5G5HA 4MDKE 3KUZA 4JLCA 2K0PA 2LRUA 1K52A 2KJHB 1UELA 2K25A 4BKTA 2LZ6A 1JMLA 3W5VB 1GB1A 1V49A 1FEHA 4NY0A 2V3NA 4ANVA 3VAWA 4KX6B 4RGTA 3VTVA 3APDA 4HEA1 4K81A 2JWUA 2KNBA 3DHGC 1T0QC 1IGDA 2QC8A 2CU1A 3A4RA 3EECA 1TJEA 2IJ0A 3LJ3A 1F2RC 2D07B 1OTRB 4P7IA 4C4VA 3V05A 3IT6B 4WQOB 2KZRA 2MBOA 1UF0A 4XX5A 2ICIA 1L0XB 2K6DB 2BYFA 3O65B 1ZXIA 5LNK1 4EUTA 1RFKA 3UI3A 1EF1A 3BY4B 5JXVA 1EWCA 2BF8B 2PE6B 3P2BA 3AN1A 1K50A 5HI1A 4GOCA 2RGFA 2W9NA 2LJ5A 3URYA 3BVGA 4I6LB 3HVZA 3R2IA 2HJ1A 2LGYA 1KOTA 4CQNA 4IG7B 5KHOA 2H88B 3D32A 5EE1A 1PDXA 2KVRA 1VRAB 4JL9A 3VRAB 4FADA 3IXSA 4PYUA 2CHXA 4TUUA 4HCNB 3T8MA 2INPE 3ABVB 2QJLA 3FC4A 3Q69A 5D7GA 5KHQA 4NAWA 4FJZA 2JY6A 4BBNF 4IWOA 2X8XX 1YJIA 4LLGM 5H92C 2DX5B 1JWUD 3VUYA 1NI3A 4AOFA 2NMQA 2OHFA 1SXTA 1T0RC 1WZ3A 1Q1OA 2KAJA 4PK1A 1QOAA 1GG3A 2MP2A 3WCQA 4M00A 3AH7A 1K8RB 3BK1A 1PQSA 1R4NI 1WYWB 2GBJA 3U30A 1C4CA 2AQ3B 4S17A 3B08A 2JRIB 1TKYA 4I6PA 1WXMA 3KWVA 2QMTA 2JU6X 4W9IA 3RNEC 2RDGA 3TL5A 4L23A 2Z0DB 2WXRA 3ZRCA 3BINA 1ACCA 1WRIA 1MVKA 2BT6A 3ZRFA 5IAAC 3L08A 4NJ6A 1KLGD 3H6NA 1ZOYB 2OOBB 2HDEA 3ZJVA 3L4PA 1WR1A 2MBEA 1PUTA 2ZEQA 4DXGA 3A9JA 3BYTB 3DDCB 3H9DA 1QZEA 4JE3B 3Q8AA 3RI7C 4S0RA 1A70A 1JRPA 4BOSC 2N1VA 3NVZA 1TY2A 4JWSC 1E8ZA 1LO5D 3WAPA 2EELA 1E7VA 3DVNU 4IKGA 1V5TA 2L0TA 1ZPSA 4TQ0A 3I9V1 4MACA 2GRIA 1EF5A 4MJSB 1I4QA 4XE0A 3DHHC 1WMHB 3ZTDA 2KTFA 4HRSA 3ZDTA 2NBUA 2O2VA 1SE2A 2R2OA 4MH0E 3ZKJC 4HPLB 1E7PB 2FAZA 3JVZX 4CO7A 2DYMA 3R7RA 4TSSA 1KFYB 2WQYB 1Q0WB 3ML9A 1D5MC 1DOXA 1I4HA 3B1LX 1GB4A 4MGYE 4IWPA 4KZCA 2INCC 1ZDVA 2K8CA 2PEAA 3HM3A 2N9EB 4CHKA 2H89B 3X0WA 4MM3A 2DAJA 3EUB2 1SB3C 2SEBD 4E71A 4HPPA 1BMLC 3PRMB 4N6EB 4A3OA 3Q8BA 3SD5A
chains in the Genus database with same CATH topology
3U7ZA 1AYFA 3AE6B 2WXJA 3TSSA 2MH7A 1M4VA 3AB5A 1TS2A 3C8YA 4MT5A 1RYJA 2PKOA 2MJEA 1UWXA 3BZDB 2WXPA 4N59A 5E6JA 4XDCA 1P7EA 2JX5A 1IGCA 3AEBB 2Y5CA 2L1AA 2ZW0A 2BTEA 1Q10A 3AV8A 4IDIA 3TUOA 2K5PA 1T6BX 2N9LA 4RCOA 4JWUC 2PIAA 4KKIA 2BB5A 4YT0B 2IGDA 3BVMA 3GB1A 1L0VB 5HG2A 5BYQA 2WDRB 3B2GA 2KACA 2N0SB 1MHHE 3E56A 1DOIA 4WIPA 3P4RB 2V0GA 1GOZA 1XCQL 3KWLA 3U52E 2PTLA 1L6UA 2L52A 1L0YB 2W82A 3DWMA 3MP9A 5BMIA 1STEA 3TEXA 3LXFA 5EE9A 3VQIA 4J3OD 4USAA 2ONQA 1NVID 1L4ZB 1HEZE 1DOYA 1FNWA 4OZBA 4OW0A 3P4SB 4US9A 2WU5B 1ZE3D 4A6QA 2LHDA 2KN4A 4JX1C 1PGBA 1SEBD 2Y3AA 4ZOHC 4P6VF 1HXYD 2BS2B 3AEEB 3Q8EA 4L1BA 3TEYA 3VR8B 2N9KA 2I2YA 1P7FA 2LMCA 4REZA 3I57A 3N9YC 2BS4B 2YEPF 1C79A 4UDUC 2G1EA 1J7BA 1FNUA 1WSPA 1ESFA 4OHJA 3P4PB 2FE8A 2WXKA 3W2DA 1AN8A 2NTTA 1AWDA 2PLPA 3R8BA 4WH4A 4WQMA 2LEKA 4KGSA 1SE4A 3ZGZA 3BVZA 1PGXA 4DXFA 1VLBA 3GS2A 3HUIA 3P1MA 5FKAC 2L83A 2FUG1 3T3NA 1ZP0B 1TS3A 1XLPA 2W54A 1DYQA 4YTPB 1VZ6A 1V8CA 3FAHA 4NZLB 2BS3B 2E6XA 1ET6A 4RF1A 2WS3B 2INNE 4LTUA 4DQOC 1I4XA 4RGMA 1QT9A 1XLQA 3H8HA 4JPSA 3T3OA 1QQRA 1FD6A 1TS5A 2YEPB 1H7XA 2JYEA 2Q5WD 4ITKA 5HFYA 5FK9C 2K9XA 4RFBA 1CZPA 1D6EC 1ZUD2 4ARCA 2AQ1B 1J7AA 4KGTA 1YN4A 1L6VA 3AEGB 4US8A 3DWGC 2LJIA 2WXNA 1J7CA 2ACZB 4HKQA 2WXGA 1HQRD 1OQRA 1VZ8A 2VZKD 3KLSX 3GP7A 1QOFA 1IBXA 5C2TB 4C80A 3LB8C 3AMZA 1T5XD 1XLOA 1L5PA 4NAMA 4D2KA 1XXGA 3PZ8A 4RF0A 1N5WA 1IBXB 1SJED 5GXGB 2J4XA 1JWBD 4P16A 4PT5A 2PVOD 4ZRPA 1VR9A 2V3PA 4AS1A 1E0ZA 4B0MA 1EU4A 2JYTA 2WP9B 2LGIA 1I4RA 1XF5L 3AM9A 2QSDA 1C4AA 1WGKA 4GLSC 5G5GA 5HHDG 1OFFA 2PMVA 3MC0B 1ENFA 1R7SA 1GTHA 1HZ6A 1KH0A 1B9RA 4A55A 5H8YE 1E9MA 4WWMA 3ZJUA 1NEKB 1XO3A 1D5XC 1VZ7A 1FMAD 2G9HD 4OZCA 5G5HA 1FNVA 1TKEA 1EWYC 1YQ3B 1PGAA 1JWAD 2DWQA 2K0PA 5I4DA 1K52A 3RFZB 2K22A 1ROEA 1KF6B 3MHZA 1N5XA 4WURA 2LHEA 1JMLA 2SAKA 3W5VB 1GB1A 2WXFA 1FEHA 4YWGG 1FM0D 3AE8B 2QIEB 2V3NA 3HRDD 4KX6B 4RGTA 1N63A 5AUIA 4HEA1 2JWUA 4HKZE 1JROA 4ZYSA 1FO4A 4YSYB 1FFVA 3NVVA 1V1PA 1WYGA 2B76B 1GTEA 1FCLA 3MJ5A 4OVZA 1GPXA 1Y56A 2I38A 1RWSA 3ETRA 1IGDA 2CJNA 2DYOA 1V97A 2GI9A 1V1PB 2KDMA 1I4GA 1TJEA 1CQVA 2IJ0A 5MPOA 1FFUA 2JSVX 1F2RC 1K53A 2N7JA 3Q8CA 2JXTA 1JCKB 2AQ2B 3EA6A 3V05A 4A8XC 3SEBA 3IT6B 2TSSA 3NRZA 2JQRB 2IDYA 3AE9B 1JWSD 2JZPA 1VDVA 2ICIA 1L0XB 3BIID 1ZXIA 1RM6C 5LNK1 1RFKA 3UI3A 1L4DB 1JWMD 5JXVA 1EWCA 3LYYA 1E6EB 4YTNB 2WXQA 1N62A 1KLUD 3AN1A 1PFDA 1K50A 3SFDB 5C3JB 5HI1A 2BBCA 1HZ5A 1KTKA 2R61A 3URYA 3AE3B 2XN9C 3BVGA 3VR9B 3HVZA 3R2IA 2FBWB 2IPKD 3ZYYX 3NVYA 1MHXA 4CQNA 2LFIA 4NJCA 3V3XA 3B9JA 1TY0A 2D5GA 2H88B 2LUMA 4RH6A 5EE3A 3CIRB 5EE1A 3AEDB 1AW7A 1PDXA 1HA5A 1VRAB 2CJOA 3R2TA 3IAS1 3VRAB 1QKZA 3E9SA 3IXSA 2BYTA 1B1ZA 2PW9A 3AEFB 5BYRA 3ZJTA 4RGNA 1WXQA 2INPE 4Q2JA 3ABVB 4TMAB 5FR3A 1SF0A 2KQ4X 2ON8A 2QJLA 1EM7A 3FC4A 3Q69A 4H2AA 5D3IB 5D7GA 4EE2A 1JW9D 1C4PA 3U2SC 2WXOA 4ARIA 1SBBB 3TEZA 2M0AA 1YJIA 4B0EA 4OZAA 4XDDA 4LLGM 5H92C 1C78A 3ZQ4A 1N61A 1NENB 4NAWB 1JWUD 2WXLA 3EGRA 3PZ7A 1FIQA 1NI3A 3MFGA 1EU3A 2NMQA 2OHFA 1JQ4A 1SXTA 4A90A 1UNSA 2V4IB 2KAJA 3HVDA 2WXHA 1QOAA 4LK0M 1BXTA 3SR6A 3WCQA 1PYWD 3AH7A 3AE5B 1YN5A 4C56C 3BK1A 5D3DA 2RMMA 3U4EG 3AE4B 1YN3A 1C4CA 1FRRA 2E3TA 2W3SA 3W9CB 1XCTL 2AQ3B 1MI0A 4GDLB 1C77A 3CWIA 2WDVB 3PO0A 4M0WA 2OEDA 1TKYA 1UUPA 1ET9A 1F77A 2CU3A 2KMMA 2DLBA 3KWVA 1UGJA 4TQ1A 2QMTA 2JU6X 1C9FA 2WDQB 2RDGA 2WLBA 1NYQA 5BYSA 1F0ZA 3RPFC 2J53A 2IGHA 4L23A 2WXRA 4RNAA 1ACCA 3BYYB 1FXIA 1WRIA 4XWTA 1MVKA 2KWDA 3AEAB 4YTMB 2BT6A 1QF6A 1IUEA 1C76A 1KLGD 3W1SA 1ZOYB 2HDEA 4R3DA 1SIJA 3ZJVA 2PVGC 1V1OA 3L4PA 1CK1A 1PUTA 3FILA 4DXGA 5EE0A 1T3QA 3BYTB 4JE3B 3Q8FA 3Q8AA 4YSXB 4C7YA 5BMHA 1A70A 2MJDA 1SE3A 4MH8A 1QLBB 1JRPA 2RPVA 2WXMA 3SFEB 2XNAC 3NZ3A 3FILB 1I4PA 2W55A 3NVZA 5BMGA 1MPEA 1TY2A 4JWSC 1FXAA 2X38A 2QEJC 3AE7B 1LO5D 1KRHA 2EELA 4HROA 4IKGA 1YJJA 4ZHPA 3BWUD 1N60A 2MEKA 1GT8A 1ZPSA 3AECB 4TQ0A 1WWTA 2MJ3A 4L2YA 1K51A 3I9V1 4MACA 3VRBB 2GRIA 5TSSA 1I4QA 4WAFA 4ZRQA 4GDKB 4IOIE 3W5UB 4XE0A 1JALA 1F2RI 2IGGA 2AX5A 3J9CA 3O13A 3CF4A 2WU2B 1YMHE 4HRSA 1TKGA 5T8IA 4HJGE 2Y5PA 3NS1A 3IAM1 1SE2A 2M19A 1XEEA 4ZHOA 1ZXHA 1FCCC 2QILA 1BUIC 4KGRA 3IT4B 1E7PB 3NUHB 4YXDB 2J52A 2BW2A 1SJHD 2WNMA 1VJKA 2WXIA 1SSNA 1UWMA 1QOGA 2DYMA 3NVWA 4TSSA 1ZDXA 1KFYB 2WQYB 2RDHA 1D5MC 1DOXA 2BB6A 3AE2B 1CJEA 1QILA 2HTME 1I4HA 5AUKA 3BK2A 4YSZB 1FRDA 3OWEB 1D5ZC 4AQ7A 1GB4A 1YNTE 3AE1B 2ZW1A 1E10A 1ZDVA 2M56B 1I7HA 1TS4A 1TZOA 2W3RA 3B2FA 2J42A 4N58A 2H89B 4XWWA 1XLNA 4O1NA 1QOBA 1GAQB 2NTSA 1OQQA 1SB3C 2Z8LA 3EUB2 3P42A 4RGOS 3TEWA 2SEBD 4A9AA 1D4BA 4KKJA 1BMLC 2GB1A 2L32A 4FXCA 1YQ4B 2K3UA 2DBYA 4C7ZA 1NYRA 3P63A 4MM3B 3P4QB 4N6EB 1H7WA 1DGJA 2EKIA 2VZKB 3KQ4A 3Q8BA 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BT6 A;  3BII D;  1ZUD 2;  1RM6 C;  1ZXI A;  1AYF A;  3AE6 B;  1QF6 A;  1IUE A;  1RFK A;  2MH7 A;  1J7A A;  3AB5 A;  1L6V A;  3AEG B;  1ZOY B;  4US8 A;  1RYJ A;  2PKO A;  1SIJ A;  2MJE A;  1E6E B;  4YTN B;  2PVG C;  3DWG C;  1J7C A;  2ACZ B;  1N62 A;  3AN1 A;  1TYG B;  1OQR A;  1PFD A;  3L4P A;  4N59 A;  3SFD B;  1QOF A;  2JX5 A;  5C3J B;  1PUT A;  2Y5C A;  3AEB B;  5C2T B;  5EE0 A;  1T3Q A;  4C80 A;  3AV8 A;  4IDI A;  3LB8 C;  3AE3 B;  4YSX B;  2K5P A;  3AMZ A;  1XLO A;  1L5P A;  3VR9 B;  4C7Y A;  3HVZ A;  4JWU C;  1A70 A;  2MJD A;  2PIA A;  1N5W A;  2FBW B;  1JRP A;  3SFE B;  4YT0 B;  5GXG B;  3NVY A;  3ZYY X;  1JWB D;  1L0V B;  2W55 A;  3NVZ A;  2WDR B;  2PVO D;  3B2G A;  2N0S B;  4JWS C;  1DOI A;  1FXA A;  3P4R B;  3B9J A;  2H88 B;  1E0Z A;  3AE7 B;  3CIR B;  5EE1 A;  5EE3 A;  1KRH A;  3AED B;  3KWL A;  2WP9 B;  4HRO A;  1L6U A;  1PDX A;  1YJJ A;  2L52 A;  3DWM A;  3AM9 A;  5G5G A;  1WGK A;  4ZHP A;  2CJO A;  1N60 A;  3LXF A;  5EE9 A;  3VRA B;  1GT8 A;  1OFF A;  3AEC B;  4USA A;  1WWT A;  2MJ3 A;  1NVI D;  1R7S A;  1GTH A;  3AEF B;  3VRB B;  1B9R A;  1DOY A;  5H8Y E;  1WXQ A;  1E9M A;  3ABV B;  3W5U B;  4WWM A;  3P4S B;  4US9 A;  1NEK B;  1JAL A;  2WU5 B;  1SF0 A;  1XO3 A;  2AX5 A;  2QJL A;  3FC4 A;  4JX1 C;  3CF4 A;  2WU2 B;  1FMA D;  5G5H A;  4HRS A;  1JW9 D;  1TKG A;  1TKE A;  4ZOH C;  1EWY C;  1YQ3 B;  3NS1 A;  4P6V F;  1JWA D;  2DWQ A;  2BS2 B;  2M19 A;  3AEE B;  1YJI A;  3VR8 B;  2K22 A;  1ROE A;  4ZHO A;  1KF6 B;  5H92 C;  1E7P B;  1N5X A;  2BS4 B;  4YXD B;  1N61 A;  1NEN B;  2G1E A;  3W5V B;  1J7B A;  1FIQ A;  1NI3 A;  1VJK A;  3P4P B;  1FM0 D;  3AE8 B;  2OHF A;  2QIE B;  1JQ4 A;  3HRD D;  1UWM A;  1QOG A;  4KX6 B;  2KAJ A;  3NVW A;  1N63 A;  1KFY B;  2WQY B;  1AWD A;  5AUI A;  1QOA A;  1DOX A;  4WQM A;  1JRO A;  3AE2 B;  2LEK A;  1CJE A;  1FO4 A;  3SR6 A;  4YSY B;  2HTM E;  3WCQ A;  5AUK A;  1FFV A;  4YSZ B;  1FRD A;  3AE5 B;  3AH7 A;  1VLB A;  3NVV A;  1WYG A;  2B76 B;  3AE1 B;  3HUI A;  3P1M A;  1GTE A;  1GPX A;  3AE4 B;  2L83 A;  1E10 A;  1ZP0 B;  2E3T A;  1FRR A;  2M56 B;  2W3S A;  1XLP A;  1I7H A;  2W54 A;  3W9C B;  1RWS A;  4YTP B;  3ETR A;  3CWI A;  2W3R A;  3B2F A;  2WDV B;  1V8C A;  2CJN A;  3FAH A;  3PO0 A;  4N58 A;  2H89 B;  1V97 A;  1XLN A;  5MPO A;  2BS3 B;  1QOB A;  1TJE A;  1TKY A;  2WS3 B;  1FFU A;  1GAQ B;  2CU3 A;  1OQQ A;  1SB3 C;  2KMM A;  3EUB 2;  4LTU A;  2WDQ B;  2WLB A;  4A9A A;  1NYQ A;  1QT9 A;  1XLQ A;  4FXC A;  1F0Z A;  1YQ4 B;  3RPF C;  2DBY A;  4C7Z A;  1NYR A;  3P63 A;  3NRZ A;  2JQR B;  1H7X A;  3AE9 B;  3P4Q B;  2Q5W D;  1H7W A;  1DGJ A;  1FXI A;  1WRI A;  2EKI A;  4ITK A;  4N6E B;  3AEA B;  4YTM B;  1VDV A;  2K9X A;  1QLB B;  1CZP A; 
#chains in the Genus database with same CATH topology
 3EFC A;  2C7H A;  2MH7 A;  4HJK A;  3PLU A;  3C8Y A;  4MT5 A;  3H7P B;  1RLF A;  1RYJ A;  2MJE A;  2WXP A;  2IND C;  2V4L A;  4BAX A;  2JX5 A;  2L1A A;  1Q10 A;  4IDI A;  3TUO A;  2K5P A;  2N9L A;  4P1B C;  2IGD A;  1GJZ A;  5HG2 A;  2KAC A;  4KIK A;  1RRB A;  4LNF A;  3NZS A;  4WIP A;  2M0X A;  1WRD B;  2C5L C;  3U52 E;  3DWM A;  3MP9 A;  5BMI A;  4HXD A;  4DHZ E;  3VQI A;  4J3O D;  3KYD D;  1NVI D;  2L0F A;  5JHA A;  3N1X C;  1Y8R C;  2KK8 A;  3P4S B;  2FCS A;  3Q6B A;  2L00 B;  4JX1 C;  4OVV A;  3RNC C;  3DPD A;  1E8X A;  5BO4 B;  2DEN B;  1HXY D;  2BS2 B;  3AEE B;  2I2Y A;  1P7F A;  2NVU I;  1YJ1 A;  3I57 A;  2YEP F;  1C79 A;  1SGH A;  2KD0 A;  1AWD A;  4GU2 A;  2MSE D;  4EEW A;  3QWZ B;  5AEK B;  4DXF A;  2DZM A;  4ZRI A;  2NBW B;  5FKA C;  3T3N A;  4BKS A;  2W54 A;  1XLP A;  3H1U A;  4YTP B;  1NBF C;  3DVN V;  2MCN B;  2HTH A;  3OLM D;  2E6X A;  3IG3 A;  4BVU C;  4DQO C;  5G55 A;  1I4X A;  5C23 A;  2LAS A;  4G0N B;  4RGM A;  4LCD E;  4URK A;  5J18 A;  3H8H A;  3VUW A;  1TS5 A;  1T0S C;  3MJW A;  2JYE A;  1V81 A;  3A33 B;  4GXB A;  4ITK A;  5HFY A;  1J7A A;  2C7M B;  1E90 A;  1YN4 A;  2ZCB A;  2LJI A;  3RNF C;  1J7C A;  2ACZ B;  4HKQ A;  3KLS X;  2VZK D;  3GP7 A;  1SIF A;  5LXI B;  2LI5 A;  4CYE A;  3DBL I;  4LNI A;  3Q3N C;  1XT9 B;  2L05 A;  4FHJ A;  2D3A A;  1P98 A;  4P16 A;  4PT5 A;  3CSF A;  4AS1 A;  2NBV B;  4EZK A;  1EU4 A;  2LGI A;  1I4R A;  3AM9 A;  1C4A A;  1WGK A;  4GLS C;  3ZTC A;  5HHD G;  2PMV A;  4EKU A;  2M4N A;  1ENF A;  2ASQ A;  4DDI D;  1B9R A;  3ZNZ B;  4A55 A;  5H8Y E;  5L83 A;  1Z5S B;  1E9M A;  2I1J A;  1D5X C;  4PS3 A;  2G9H D;  2B3A A;  1FNV A;  1TKE A;  1YD8 U;  2JXX A;  1EWY C;  3M63 B;  2A5U A;  2DWQ A;  3IVF A;  4EZJ A;  3RFZ B;  4HCP B;  1G6J A;  1KF6 B;  3MHZ A;  2LVQ A;  1N5X A;  3TJP A;  4X57 B;  4DHJ D;  3Q3M C;  2SAK A;  3JYU A;  2FCN A;  1NDD A;  2KAN A;  2PJH A;  2KYW A;  2K6Q A;  3C0R B;  1JRO A;  4ZYS A;  1V1P A;  1ZGU B;  2B76 B;  5AZH A;  3MJ5 A;  4OVZ A;  1GPX A;  5G2N A;  2JT4 B;  3ETR A;  5DCN A;  1UZX B;  3GE3 C;  3W1S C;  1V97 A;  2GI9 A;  4BZA A;  2KDM A;  1CQV A;  2XK5 A;  2GLS A;  2JSV X;  2Z0E B;  5HKH A;  2JXT A;  3EA6 A;  3SEB A;  1J19 A;  2L8J A;  2TSS A;  3NRZ A;  4PS8 A;  1GC6 A;  1VDV A;  2DZJ A;  2HD5 B;  4C4V B;  5DPW A;  1LQB A;  5E6N A;  4BKS D;  1RM6 C;  3DOW A;  4WJN A;  2KFJ A;  4YTN B;  1N62 A;  1KLU D;  3SFD B;  5C3J B;  2IZV B;  1UGM A;  1HZ5 A;  2R61 A;  4W9G A;  2BWE S;  4KV2 A;  3AE3 B;  3MC8 A;  2LD9 A;  4KVG B;  2FBW B;  3NVY A;  2ZJD A;  3NZU A;  5DPT A;  4NJC A;  5EDS A;  3V3X A;  1EUV B;  3B9J A;  2D5G A;  4RH6 A;  2LUM A;  1AW7 A;  2ZNV C;  3PZD A;  3ZXR A;  1R4M B;  1Z2M A;  2CJO A;  4GB9 A;  1TTN A;  2BYT A;  1B1Z A;  3ZJT A;  4ZRK A;  4W9C A;  2KQ4 X;  4EE2 A;  1JW9 D;  2WXO A;  4EFO A;  3IHP C;  4BOZ B;  1SBB B;  1UD7 A;  4XDD A;  1V9J A;  2NR2 A;  4NAW B;  2WXL A;  2FUH B;  2CS4 A;  4A90 A;  1LM8 B;  2V4I B;  3HVD A;  3RZF A;  2WXH A;  4GDL A;  1V2Y A;  1YN5 A;  3JW0 X;  3L54 A;  4DXA B;  5D3D A;  4DDG D;  2LGX A;  2E3T A;  1FRR A;  2W3S A;  3W9C B;  1V5O A;  1XCT L;  4LNK A;  3PRP B;  1MI0 A;  3CWI A;  2MP2 B;  3PO0 A;  2OED A;  2KX0 A;  4A20 A;  4K7W A;  1RFA A;  1ET9 A;  1UUP A;  2CU3 A;  3Q14 C;  1GUA B;  3QJZ A;  1V6E A;  4E74 A;  1F0Z A;  1FPY A;  3DVG X;  3PGE A;  1VCB A;  4RNA A;  4LNO A;  3BYY B;  1FXI A;  2KWD A;  2WYQ A;  3AEA B;  3I5J C;  1QF6 A;  1F52 A;  1C76 A;  2KC2 A;  5DPS A;  3EHV A;  2JRH A;  1HTQ A;  2MW5 A;  2PVG C;  1V1O A;  3QCA A;  1M94 A;  2KXJ A;  1CK1 A;  1KM7 A;  3ZXV A;  3Q8F A;  4YSX B;  5IN7 A;  4PYZ A;  4C7Y A;  2C9W B;  2MJD A;  4K3C A;  1HTO A;  2IYD B;  2WXM A;  2XNA C;  4LJO B;  3A9J B;  1IP9 A;  1FXA A;  2X38 A;  2QEJ C;  3AE7 B;  1KRH A;  4HRO A;  1P3Q U;  4C00 A;  1YJJ A;  4ZHP A;  1MFW A;  1LGR A;  2KDE B;  1UH6 A;  1WF9 A;  4WAA A;  2IY1 B;  2LXA A;  4W9H A;  4AJW A;  4WAF A;  4ZRQ A;  4GDK B;  1JAL A;  2AX5 A;  3O13 A;  5CX3 A;  5CHV C;  3CF4 A;  1YMH E;  5T8I A;  5FR6 A;  2KMA A;  3L17 A;  1XEE A;  1FCC C;  1BUI C;  3IT4 B;  2J52 A;  2BW2 A;  1RAX A;  1GNU A;  3UIO B;  4ASW C;  2O2V B;  3NVW A;  1ZDX A;  5JZE B;  3AE1 B;  1I7H A;  1TS4 A;  3VHT C;  1TZO A;  2G45 B;  2KOX A;  1XLN A;  5CHF A;  3M3J A;  4RGO S;  4A9A A;  4KKJ A;  2L32 A;  3Q3J A;  4FXC A;  4HDO A;  1YQ4 B;  5TR5 A;  3P63 A;  4MM3 B;  2V9H A;  3P4Q B;  2VZK B;  3KQ4 A;  3IFW B;  1TYG B;  2Z59 B;  3TSS A;  4FLH A;  4G11 A;  3BZD B;  5E6J A;  4XDC A;  1P7E A;  3AEB B;  3TBL D;  1WGG A;  3APF A;  3NOB A;  2BTE A;  2NPT A;  4M0W B;  4JIO U;  1P0R A;  3VH3 B;  4JWU C;  2PIA A;  3ZNH B;  3NS8 A;  3N1Y C;  3GB1 A;  1L0V B;  1TT5 B;  2KQS A;  4ICV A;  3B2G A;  2N0S B;  4ZDV A;  1DOI A;  3OJ4 B;  3P4R B;  2V0G A;  3RYT A;  3PPA A;  4AUQ C;  1L6U A;  1IYF A;  1L7Y A;  1WX9 A;  5EE9 A;  2BYE A;  4KIK B;  4IWQ A;  1TBE A;  2L7R A;  2ONQ A;  3N1Z C;  2GOW A;  1L4Z B;  2RD0 A;  1FNW A;  2DYB A;  3EFU A;  3GZN I;  2FCM A;  4DHJ B;  4DHZ B;  2WU5 B;  1ZE3 D;  4A6Q A;  2KN4 A;  1PGB A;  1SEB D;  2Y3A A;  4LJP B;  1IPG A;  3ALB A;  4REZ A;  3N9Y C;  3N32 A;  2BYV E;  2MA9 B;  4OHJ A;  4WJQ A;  4GIV A;  2FE8 A;  3KH0 A;  2PPH A;  1AN8 A;  2M1M A;  4IM2 A;  3W2D A;  2N9P C;  4ICU A;  3DHI C;  3N3K B;  1SE4 A;  1PGX A;  2KWC A;  1DYQ A;  4OVU A;  1V8C A;  4NZL B;  4K1R B;  2KDI A;  4W9L A;  3VTU A;  4RF1 A;  2WS3 B;  2INN E;  2NCN A;  3VTW A;  2FNJ B;  2IO1 B;  1QT9 A;  2K39 A;  4JPS A;  4W9D A;  3UQB A;  3W1Y A;  1FD6 A;  5CTR C;  2YEP B;  4FA6 A;  1E8Y A;  2WDT B;  1H7X A;  2OJR A;  3V60 A;  2RDB C;  2ZZP B;  4KDL B;  1CZP A;  4W9E A;  3NHE B;  4ARC A;  1WXV A;  3KUC B;  3QX1 A;  1WR6 E;  1L6V A;  2JPH A;  2JUO A;  2N9X A;  1OQR A;  1VZ8 A;  1QOF A;  2A4Z A;  1P1A A;  4M01 A;  2IO2 B;  3AMZ A;  2C7N B;  4IM3 A;  1L5P A;  2IY0 B;  3DBR I;  1R4N B;  4M02 A;  1LFD A;  4II3 B;  1N5W A;  4MGK E;  1SJE D;  2DHZ A;  3A1Q A;  5GXG B;  4HPM B;  2J4X A;  2PVO D;  4ZRP A;  1VR9 A;  2V3P A;  3T9L A;  4RMA A;  2JYT A;  1WZ0 A;  4BFR A;  3S2A A;  1XF5 L;  1WM2 A;  2QSD A;  2ZPY A;  1OFF A;  3DBH I;  3VDZ A;  3Q3F A;  1LXD A;  2M17 A;  1KH0 A;  3NY5 A;  1NEK B;  1XO3 A;  2K8H A;  1XQQ A;  2EMT A;  2LVO A;  3U8Z A;  5I4D A;  1ROE A;  4GGQ A;  4YL8 A;  5L95 C;  2WXF A;  4YWG G;  3AE8 B;  4HKZ E;  3NVV A;  3AUL A;  3RNB C;  1UBQ A;  1FCL A;  3VXW A;  2CHW A;  1V1P B;  1I4G A;  5JH5 C;  4GN1 A;  1F1H A;  2N7J A;  2N7D A;  1JCK B;  1TIF A;  4A8X C;  2N1W A;  2BWF A;  2JQR B;  2IDY A;  2XK5 B;  1JWS D;  4W9F A;  2JZP A;  2IO3 B;  3UQA A;  1Q5W B;  4DK5 A;  1L4D B;  5IKC M;  1JWM D;  2D3G A;  4GMV A;  3LYY A;  2WXQ A;  3MC9 A;  1PFD A;  1WMH A;  4WJP A;  2JZZ A;  2BBC A;  3OAW A;  1KTK A;  4NQL B;  4QAY A;  1ISN A;  2XN9 C;  3VR9 B;  1V80 A;  3ZNG C;  5LXH A;  2ZVN A;  1V86 A;  3ZYY X;  4I6N B;  2KFK B;  1MHX A;  3ZO5 B;  3QAR A;  2IBI B;  2MX2 A;  4FN2 A;  3QHT A;  3CIR B;  3VFK A;  4NPN A;  4M8N A;  3E9S A;  2PW9 A;  5BYR A;  1WXQ A;  1YQB A;  4Q2J A;  2O6V A;  4WWO A;  1WXS A;  5FR3 A;  1SF0 A;  2ON8 A;  4H2A A;  1WXA A;  5D3I B;  1KLV A;  4KSK C;  3CST A;  1C4P A;  2LWP A;  4ARI A;  2GMI C;  3VVW B;  4B0E A;  3ENE A;  1C78 A;  3ZQ4 A;  2D3B A;  3EGR A;  3PZ7 A;  1FIQ A;  3MFG A;  1EU3 A;  1UNS A;  3R66 C;  5D6J B;  3HIZ A;  3AE5 B;  4ACF A;  4C56 C;  4PS7 A;  2RMM A;  3U4E G;  3AE4 B;  4XGA B;  3PRE A;  3JSV B;  4GSW A;  4GDL B;  1C77 A;  3NJT A;  2WDV B;  2J7Q B;  3R3M A;  1F77 A;  4JGH B;  2DLB A;  3U7D A;  4TQ1 A;  1F9J A;  3AI5 A;  1NYQ A;  3WAM A;  1CMX B;  4FJY A;  5BYS A;  3RPF C;  2IGH A;  2KO3 A;  3A4S C;  4YTM B;  3TIX A;  2AEH A;  2DZK A;  1IUE A;  4MEM A;  3SU8 X;  4HDQ A;  3ZDM C;  2UWQ A;  2XEW A;  2DNF A;  3W1S A;  4R3D A;  2KWU B;  1WE6 A;  2G3Q B;  1P9D U;  3FIL A;  4LNN A;  5EE0 A;  1T3Q A;  4P1C C;  3ZLZ A;  3AU4 A;  5BMH A;  2DAF A;  3ZVV A;  1X1M A;  2RPV A;  3H7S A;  3SFE B;  4G50 A;  1H8C A;  5BMG A;  1MPE A;  4XC2 A;  2K1F A;  2NS5 A;  2PE9 A;  2GBN A;  3BWU D;  3GOE A;  3A9K A;  2MEK A;  1GT8 A;  4W9K A;  2MJ3 A;  2GBM A;  4L2Y A;  3VRB B;  2KTR A;  5TSS A;  2R2Q A;  3X23 A;  2XBB C;  3ZW3 A;  2MBQ A;  5D2M B;  3W5U B;  1TGZ B;  2IGG A;  3M62 B;  3WAL A;  2FCQ A;  3ZUN A;  2N7E A;  2L76 A;  2M19 A;  2GBR A;  2QIL A;  1WJ4 A;  3M95 A;  3NUH B;  2WNM A;  2JF5 A;  2WXI A;  3QIJ A;  3DBL B;  1QOG A;  4MSM B;  4II2 B;  3N20 C;  2O6V D;  1QIL A;  2HTM E;  5AUK A;  3BK2 A;  4YSZ B;  1FRD A;  3OWE B;  1D5Z C;  4AQ7 A;  1C3T A;  2ZW1 A;  1E10 A;  4AP4 C;  2W3R A;  3B2F A;  4N58 A;  4XWW A;  3DVG Y;  1QOB A;  2J0J A;  3P42 A;  4B95 A;  2JVC A;  2AWT A;  2DBY A;  4C7Z A;  1NYR A;  2WX1 A;  2HJ8 A;  1DGJ A;  2EKI A;  2KQ7 A;  3CF6 E;  2KKC A;  1QLB B;  3PLV A;  3U7Z A;  3I3T B;  3AE6 B;  2V3S A;  1M4V A;  5AZG A;  4IM0 A;  1J0G A;  1C1Y B;  2UYZ B;  1UWX A;  2WX0 A;  2KVZ A;  4IC7 B;  3TMP B;  4N59 A;  1WE7 A;  2KDB A;  2Y5C A;  3V62 A;  4N9F 4;  3UIN B;  4KKI A;  2BB5 A;  1UBI A;  2WDR B;  2NPT B;  3E56 A;  1S1Q B;  4AJY B;  2VH2 A;  2EMS A;  1XCQ L;  3R7Q A;  3QK0 A;  2L52 A;  3TEX A;  4NJ7 A;  1HE8 A;  4USA A;  4IUM B;  5C1Z A;  1HEZ E;  4OW0 A;  1E8W A;  3MTN B;  4MGI E;  2I1K A;  4US9 A;  1YX5 B;  1WIA A;  3ZIM A;  2MLB A;  3VR8 B;  2N9K A;  2LMC A;  2GBK A;  3QAQ A;  1YX6 B;  2BS4 B;  3HK0 A;  1FNU A;  1ESF A;  2LGD A;  3P4P B;  2Y5B B;  2PLP A;  3R8B A;  5J17 A;  4WH4 A;  4M8M A;  2KHW B;  4KGS A;  1VLB A;  2L83 A;  3PS6 A;  2FUG 1;  2WHI A;  1TS3 A;  2MBB B;  3FAH A;  1ET6 A;  4LDT D;  1WJ6 A;  3DBS A;  4DBG A;  1XLQ A;  3NG0 A;  1XD3 B;  3T3O A;  5J2R A;  2JZ3 B;  3QA8 A;  2Q5W D;  5FK9 C;  3FKY A;  4RFB A;  1ZUD 2;  2EKE C;  2IO0 B;  4KGT A;  1OQY A;  4NQK E;  4US8 A;  3PT2 B;  3DWG C;  2WXN A;  4E3C A;  2WXG A;  1HQR D;  1IBX A;  3V6E B;  2BKF A;  3Q3O C;  3LB8 C;  3RNG C;  3L16 A;  2LGS A;  4NAM A;  3RT3 B;  4RF0 A;  5CHW A;  2J0M A;  3DQV A;  1JWB D;  2FID A;  2MWS B;  3VH4 B;  3B0A A;  3RMK C;  3A1Q B;  2AL6 A;  2VRR B;  2KLC A;  2C60 A;  1GTH A;  3PV1 A;  4WJO A;  4TKN A;  3KW5 B;  1VZ7 A;  1FMA D;  4OZC A;  1WJN A;  1YQ3 B;  4BBN C;  2LVP A;  1FXT B;  1JWA D;  1PGA A;  3UIP B;  2KC1 A;  2K22 A;  2YVC A;  4WUR A;  2LHE A;  4ANW A;  4ANU A;  1AAR A;  2KWV B;  1FM0 D;  2QIE B;  3HRD D;  1N63 A;  5IA7 A;  5AUI A;  4KDI C;  4XYC A;  4K7S A;  1FO4 A;  4YSY B;  4FJV B;  2DZI A;  1FFV A;  3Q2A C;  1WYG A;  1GTE A;  1Y56 A;  2I38 A;  1RWS A;  4HWI B;  3ONS A;  2CJN A;  4HVB A;  2DYO A;  3KUD B;  5MPO A;  1FFU A;  1K53 A;  5E6O A;  3Q8C A;  3ML8 A;  2G4S A;  2AQ2 B;  4KSL C;  1E5W A;  3PHX B;  3AE9 B;  1S3S G;  3OJ3 A;  3BII D;  5IP4 D;  3RNA C;  3L0W B;  4F7Z A;  1JRU A;  5AZF A;  2D10 A;  1E6E B;  4GDK A;  1GC7 A;  3SDL C;  1NI2 A;  2RSU A;  2QDF A;  4G3X B;  1I42 A;  3GE8 C;  3KVF B;  2IPK D;  3LDZ E;  2LFI A;  1WJU A;  1TY0 A;  2KJR A;  3WA0 A;  2CR5 A;  5EE3 A;  1D3Z A;  3AED B;  1OEY A;  1HA5 A;  2UU7 A;  3R2T A;  3IAS 1;  1QKZ A;  3EC8 A;  3AEF B;  4AWJ A;  2WGS A;  4RGN A;  3RZW C;  4TMA B;  1VD2 A;  1EM7 A;  3L13 A;  4J6I A;  1OEY J;  3U2S C;  3TEZ A;  2M0A A;  2O6V B;  4OZA A;  3VUX A;  1N61 A;  1NEN B;  1JQ4 A;  3QC8 B;  2MBH A;  4JQW C;  4LK0 M;  1WI0 A;  1BXT A;  3SR6 A;  1PYW D;  1WX8 A;  1WGH A;  1YN3 A;  5DPR A;  2JWZ A;  3RUL A;  3CMM B;  3SHQ A;  4B6W A;  2REX A;  4M0W A;  3DCG A;  4K3B A;  3RD2 A;  2KMM A;  3C19 A;  4FBJ B;  1UGJ A;  4IW0 A;  1C9F A;  2WDQ B;  2WLB A;  3K9O B;  1MJD A;  3GZN B;  3UGB B;  1WX7 A;  1KJT A;  5IOI A;  2J53 A;  2KDF B;  1WM3 A;  3OG5 A;  4XWT A;  1N6Z A;  2LUE A;  1SE9 A;  3ZNI D;  1SIJ A;  3RCZ A;  3WIM A;  4ZYN A;  1SE3 A;  4MH8 A;  3NZ3 A;  3FIL B;  1I4P A;  4EZL A;  2W55 A;  4WWN A;  3RUI B;  2KT7 A;  4MJS A;  1A5R A;  2D2Q A;  4FUL A;  1N60 A;  3AXC A;  3AEC B;  1WWT A;  4BKG A;  3PTF C;  2LXC A;  1K51 A;  2KN5 A;  3HHM A;  2KX3 A;  5IO9 A;  2CKH B;  2D11 A;  4IOI E;  1F2R I;  3A9K B;  3J9C A;  2WU2 B;  2ZPN A;  3TCA A;  1TKG A;  4HJG E;  2Y5P A;  3NS1 A;  2KTR B;  3IAM 1;  4ZHO A;  1ZXH A;  4KGR A;  4YXD B;  2BPS A;  2OJW A;  2RPQ A;  1SJH D;  1WH3 A;  1VJK A;  1SSN A;  1UWM A;  3PRZ A;  3DBR B;  2RDH A;  2ZNV B;  5D94 A;  2VH1 A;  1EO6 A;  2BB6 A;  3AE2 B;  2KLG A;  1CJE A;  2AL3 A;  3N30 A;  3UF8 A;  4LDT B;  1WGR A;  1YNT E;  1T0Y A;  3L10 B;  2M56 B;  1YIW A;  2K8B A;  3V61 A;  1E7U A;  2J42 A;  5LLI A;  1ZKH A;  4O1N A;  4A3P A;  3DBH B;  1GAQ B;  2NTS A;  1OQQ A;  4WWP A;  2Z8L A;  3TEW A;  2YLM A;  2ZCC A;  1D4B A;  1R4M I;  2GB1 A;  3APC A;  3PHW B;  2K3U A;  2KJ6 A;  3QQ8 B;  3H7P A;  2BQQ A;  1H7W A;  4F8C B;  2G4D B;  1AYF A;  5E6P A;  2WXJ A;  3AB5 A;  1TS2 A;  3ECI A;  1MG8 A;  2PKO A;  4ZRJ A;  1H4R A;  1ZW7 A;  4MGZ E;  1TZ1 A;  1IGC A;  2ZW0 A;  3AV8 A;  2J0K A;  1T6B X;  1J8C A;  4RCO A;  4YT0 B;  3BVM A;  5BYQ A;  1MHH E;  1GOZ A;  3KWL A;  2PTL A;  2W82 A;  1L0Y B;  1STE A;  1L2N A;  3LXF A;  4RM8 A;  1DOY A;  4OZB A;  1YOV B;  2LHD A;  2MRP A;  2WWZ A;  4ZOH C;  2LRW A;  4P6V F;  4B9K A;  3Q8E A;  4L1B A;  3TEY A;  2D3C A;  1OGW A;  4UDU C;  2BKR B;  2G1E A;  1J7B A;  1WSP A;  2M8S A;  5JHB A;  1BT0 A;  3I63 C;  2WXK A;  4TV3 A;  2NTT A;  4KZ0 A;  4WQM A;  2HE7 A;  2LEK A;  2N4F A;  3ZGZ A;  3BVZ A;  3GS2 A;  3HUI A;  3P1M A;  2AYO B;  1ZP0 B;  1VZ6 A;  2QHO A;  2KMC A;  4HLE A;  2CHZ A;  3V6C B;  2BS3 B;  2RR9 A;  4ANX A;  4LTU A;  4EOY A;  1WFY A;  2KFK A;  2L3Z A;  1QQR A;  4HK2 A;  3WAO A;  3WAN A;  2K9X A;  1D6E C;  3PSE B;  2BVC A;  4NNJ B;  2AQ1 B;  4W9J A;  4MEL A;  1I35 A;  3HM6 X;  3AEG B;  3PVL A;  4F1S A;  2MQJ A;  4DWF A;  2FIF A;  5C2T B;  4XZ4 A;  3MHS D;  4C80 A;  4K7U A;  1T5X D;  1XLO A;  4D2K A;  1XXG A;  3PZ8 A;  4MSQ B;  1IBX B;  2BGF A;  1WGD A;  3RN9 C;  3IBE A;  4RM9 A;  1U4A A;  3KYC D;  4FHK A;  3AU5 A;  2ZVO A;  1E0Z A;  2V1Y A;  4B0M A;  2WP9 B;  5G5G A;  2QCZ A;  3MC0 B;  1R7S A;  5GMV A;  1WY8 A;  3JSV A;  1HZ6 A;  3K9P B;  2MHJ A;  4WWM A;  3ZJU A;  1MG4 A;  1WGY A;  5G5H A;  4MDK E;  3KUZ A;  4JLC A;  2K0P A;  2LRU A;  1K52 A;  2KJH B;  1UEL A;  2K25 A;  4BKT A;  2LZ6 A;  1JML A;  3W5V B;  1GB1 A;  1V49 A;  1FEH A;  4NY0 A;  2V3N A;  4ANV A;  3VAW A;  4KX6 B;  4RGT A;  3VTV A;  3APD A;  4HEA 1;  4K81 A;  2JWU A;  2KNB A;  3DHG C;  1T0Q C;  1IGD A;  2QC8 A;  2CU1 A;  3A4R A;  3EEC A;  1TJE A;  2IJ0 A;  3LJ3 A;  1F2R C;  2D07 B;  1OTR B;  4P7I A;  4C4V A;  3V05 A;  3IT6 B;  4WQO B;  2KZR A;  2MBO A;  1UF0 A;  4XX5 A;  2ICI A;  1L0X B;  2K6D B;  2BYF A;  3O65 B;  1ZXI A;  5LNK 1;  4EUT A;  1RFK A;  3UI3 A;  1EF1 A;  3BY4 B;  5JXV A;  1EWC A;  2BF8 B;  2PE6 B;  3P2B A;  3AN1 A;  1K50 A;  5HI1 A;  4GOC A;  2RGF A;  2W9N A;  2LJ5 A;  3URY A;  3BVG A;  4I6L B;  3HVZ A;  3R2I A;  2HJ1 A;  2LGY A;  1KOT A;  4CQN A;  4IG7 B;  5KHO A;  2H88 B;  3D32 A;  5EE1 A;  1PDX A;  2KVR A;  1VRA B;  4JL9 A;  3VRA B;  4FAD A;  3IXS A;  4PYU A;  2CHX A;  4TUU A;  4HCN B;  3T8M A;  2INP E;  3ABV B;  2QJL A;  3FC4 A;  3Q69 A;  5D7G A;  5KHQ A;  4NAW A;  4FJZ A;  2JY6 A;  4BBN F;  4IWO A;  2X8X X;  1YJI A;  4LLG M;  5H92 C;  2DX5 B;  1JWU D;  3VUY A;  1NI3 A;  4AOF A;  2NMQ A;  2OHF A;  1SXT A;  1T0R C;  1WZ3 A;  1Q1O A;  2KAJ A;  4PK1 A;  1QOA A;  1GG3 A;  2MP2 A;  3WCQ A;  4M00 A;  3AH7 A;  1K8R B;  3BK1 A;  1PQS A;  1R4N I;  1WYW B;  2GBJ A;  3U30 A;  1C4C A;  2AQ3 B;  4S17 A;  3B08 A;  2JRI B;  1TKY A;  4I6P A;  1WXM A;  3KWV A;  2QMT A;  2JU6 X;  4W9I A;  3RNE C;  2RDG A;  3TL5 A;  4L23 A;  2Z0D B;  2WXR A;  3ZRC A;  3BIN A;  1ACC A;  1WRI A;  1MVK A;  2BT6 A;  3ZRF A;  5IAA C;  3L08 A;  4NJ6 A;  1KLG D;  3H6N A;  1ZOY B;  2OOB B;  2HDE A;  3ZJV A;  3L4P A;  1WR1 A;  2MBE A;  1PUT A;  2ZEQ A;  4DXG A;  3A9J A;  3BYT B;  3DDC B;  3H9D A;  1QZE A;  4JE3 B;  3Q8A A;  3RI7 C;  4S0R A;  1A70 A;  1JRP A;  4BOS C;  2N1V A;  3NVZ A;  1TY2 A;  4JWS C;  1E8Z A;  1LO5 D;  3WAP A;  2EEL A;  1E7V A;  3DVN U;  4IKG A;  1V5T A;  2L0T A;  1ZPS A;  4TQ0 A;  3I9V 1;  4MAC A;  2GRI A;  1EF5 A;  4MJS B;  1I4Q A;  4XE0 A;  3DHH C;  1WMH B;  3ZTD A;  2KTF A;  4HRS A;  3ZDT A;  2NBU A;  2O2V A;  1SE2 A;  2R2O A;  4MH0 E;  3ZKJ C;  4HPL B;  1E7P B;  2FAZ A;  3JVZ X;  4CO7 A;  2DYM A;  3R7R A;  4TSS A;  1KFY B;  2WQY B;  1Q0W B;  3ML9 A;  1D5M C;  1DOX A;  1I4H A;  3B1L X;  1GB4 A;  4MGY E;  4IWP A;  4KZC A;  2INC C;  1ZDV A;  2K8C A;  2PEA A;  3HM3 A;  2N9E B;  4CHK A;  2H89 B;  3X0W A;  4MM3 A;  2DAJ A;  3EUB 2;  1SB3 C;  2SEB D;  4E71 A;  4HPP A;  1BML C;  3PRM B;  4N6E B;  4A3O A;  3Q8B A;  3SD5 A; 
#chains in the Genus database with same CATH homology
 3U7Z A;  1AYF A;  3AE6 B;  2WXJ A;  3TSS A;  2MH7 A;  1M4V A;  3AB5 A;  1TS2 A;  3C8Y A;  4MT5 A;  1RYJ A;  2PKO A;  2MJE A;  1UWX A;  3BZD B;  2WXP A;  4N59 A;  5E6J A;  4XDC A;  1P7E A;  2JX5 A;  1IGC A;  3AEB B;  2Y5C A;  2L1A A;  2ZW0 A;  2BTE A;  1Q10 A;  3AV8 A;  4IDI A;  3TUO A;  2K5P A;  1T6B X;  2N9L A;  4RCO A;  4JWU C;  2PIA A;  4KKI A;  2BB5 A;  4YT0 B;  2IGD A;  3BVM A;  3GB1 A;  1L0V B;  5HG2 A;  5BYQ A;  2WDR B;  3B2G A;  2KAC A;  2N0S B;  1MHH E;  3E56 A;  1DOI A;  4WIP A;  3P4R B;  2V0G A;  1GOZ A;  1XCQ L;  3KWL A;  3U52 E;  2PTL A;  1L6U A;  2L52 A;  1L0Y B;  2W82 A;  3DWM A;  3MP9 A;  5BMI A;  1STE A;  3TEX A;  3LXF A;  5EE9 A;  3VQI A;  4J3O D;  4USA A;  2ONQ A;  1NVI D;  1L4Z B;  1HEZ E;  1DOY A;  1FNW A;  4OZB A;  4OW0 A;  3P4S B;  4US9 A;  2WU5 B;  1ZE3 D;  4A6Q A;  2LHD A;  2KN4 A;  4JX1 C;  1PGB A;  1SEB D;  2Y3A A;  4ZOH C;  4P6V F;  1HXY D;  2BS2 B;  3AEE B;  3Q8E A;  4L1B A;  3TEY A;  3VR8 B;  2N9K A;  2I2Y A;  1P7F A;  2LMC A;  4REZ A;  3I57 A;  3N9Y C;  2BS4 B;  2YEP F;  1C79 A;  4UDU C;  2G1E A;  1J7B A;  1FNU A;  1WSP A;  1ESF A;  4OHJ A;  3P4P B;  2FE8 A;  2WXK A;  3W2D A;  1AN8 A;  2NTT A;  1AWD A;  2PLP A;  3R8B A;  4WH4 A;  4WQM A;  2LEK A;  4KGS A;  1SE4 A;  3ZGZ A;  3BVZ A;  1PGX A;  4DXF A;  1VLB A;  3GS2 A;  3HUI A;  3P1M A;  5FKA C;  2L83 A;  2FUG 1;  3T3N A;  1ZP0 B;  1TS3 A;  1XLP A;  2W54 A;  1DYQ A;  4YTP B;  1VZ6 A;  1V8C A;  3FAH A;  4NZL B;  2BS3 B;  2E6X A;  1ET6 A;  4RF1 A;  2WS3 B;  2INN E;  4LTU A;  4DQO C;  1I4X A;  4RGM A;  1QT9 A;  1XLQ A;  3H8H A;  4JPS A;  3T3O A;  1QQR A;  1FD6 A;  1TS5 A;  2YEP B;  1H7X A;  2JYE A;  2Q5W D;  4ITK A;  5HFY A;  5FK9 C;  2K9X A;  4RFB A;  1CZP A;  1D6E C;  1ZUD 2;  4ARC A;  2AQ1 B;  1J7A A;  4KGT A;  1YN4 A;  1L6V A;  3AEG B;  4US8 A;  3DWG C;  2LJI A;  2WXN A;  1J7C A;  2ACZ B;  4HKQ A;  2WXG A;  1HQR D;  1OQR A;  1VZ8 A;  2VZK D;  3KLS X;  3GP7 A;  1QOF A;  1IBX A;  5C2T B;  4C80 A;  3LB8 C;  3AMZ A;  1T5X D;  1XLO A;  1L5P A;  4NAM A;  4D2K A;  1XXG A;  3PZ8 A;  4RF0 A;  1N5W A;  1IBX B;  1SJE D;  5GXG B;  2J4X A;  1JWB D;  4P16 A;  4PT5 A;  2PVO D;  4ZRP A;  1VR9 A;  2V3P A;  4AS1 A;  1E0Z A;  4B0M A;  1EU4 A;  2JYT A;  2WP9 B;  2LGI A;  1I4R A;  1XF5 L;  3AM9 A;  2QSD A;  1C4A A;  1WGK A;  4GLS C;  5G5G A;  5HHD G;  1OFF A;  2PMV A;  3MC0 B;  1ENF A;  1R7S A;  1GTH A;  1HZ6 A;  1KH0 A;  1B9R A;  4A55 A;  5H8Y E;  1E9M A;  4WWM A;  3ZJU A;  1NEK B;  1XO3 A;  1D5X C;  1VZ7 A;  1FMA D;  2G9H D;  4OZC A;  5G5H A;  1FNV A;  1TKE A;  1EWY C;  1YQ3 B;  1PGA A;  1JWA D;  2DWQ A;  2K0P A;  5I4D A;  1K52 A;  3RFZ B;  2K22 A;  1ROE A;  1KF6 B;  3MHZ A;  1N5X A;  4WUR A;  2LHE A;  1JML A;  2SAK A;  3W5V B;  1GB1 A;  2WXF A;  1FEH A;  4YWG G;  1FM0 D;  3AE8 B;  2QIE B;  2V3N A;  3HRD D;  4KX6 B;  4RGT A;  1N63 A;  5AUI A;  4HEA 1;  2JWU A;  4HKZ E;  1JRO A;  4ZYS A;  1FO4 A;  4YSY B;  1FFV A;  3NVV A;  1V1P A;  1WYG A;  2B76 B;  1GTE A;  1FCL A;  3MJ5 A;  4OVZ A;  1GPX A;  1Y56 A;  2I38 A;  1RWS A;  3ETR A;  1IGD A;  2CJN A;  2DYO A;  1V97 A;  2GI9 A;  1V1P B;  2KDM A;  1I4G A;  1TJE A;  1CQV A;  2IJ0 A;  5MPO A;  1FFU A;  2JSV X;  1F2R C;  1K53 A;  2N7J A;  3Q8C A;  2JXT A;  1JCK B;  2AQ2 B;  3EA6 A;  3V05 A;  4A8X C;  3SEB A;  3IT6 B;  2TSS A;  3NRZ A;  2JQR B;  2IDY A;  3AE9 B;  1JWS D;  2JZP A;  1VDV A;  2ICI A;  1L0X B;  3BII D;  1ZXI A;  1RM6 C;  5LNK 1;  1RFK A;  3UI3 A;  1L4D B;  1JWM D;  5JXV A;  1EWC A;  3LYY A;  1E6E B;  4YTN B;  2WXQ A;  1N62 A;  1KLU D;  3AN1 A;  1PFD A;  1K50 A;  3SFD B;  5C3J B;  5HI1 A;  2BBC A;  1HZ5 A;  1KTK A;  2R61 A;  3URY A;  3AE3 B;  2XN9 C;  3BVG A;  3VR9 B;  3HVZ A;  3R2I A;  2FBW B;  2IPK D;  3ZYY X;  3NVY A;  1MHX A;  4CQN A;  2LFI A;  4NJC A;  3V3X A;  3B9J A;  1TY0 A;  2D5G A;  2H88 B;  2LUM A;  4RH6 A;  5EE3 A;  3CIR B;  5EE1 A;  3AED B;  1AW7 A;  1PDX A;  1HA5 A;  1VRA B;  2CJO A;  3R2T A;  3IAS 1;  3VRA B;  1QKZ A;  3E9S A;  3IXS A;  2BYT A;  1B1Z A;  2PW9 A;  3AEF B;  5BYR A;  3ZJT A;  4RGN A;  1WXQ A;  2INP E;  4Q2J A;  3ABV B;  4TMA B;  5FR3 A;  1SF0 A;  2KQ4 X;  2ON8 A;  2QJL A;  1EM7 A;  3FC4 A;  3Q69 A;  4H2A A;  5D3I B;  5D7G A;  4EE2 A;  1JW9 D;  1C4P A;  3U2S C;  2WXO A;  4ARI A;  1SBB B;  3TEZ A;  2M0A A;  1YJI A;  4B0E A;  4OZA A;  4XDD A;  4LLG M;  5H92 C;  1C78 A;  3ZQ4 A;  1N61 A;  1NEN B;  4NAW B;  1JWU D;  2WXL A;  3EGR A;  3PZ7 A;  1FIQ A;  1NI3 A;  3MFG A;  1EU3 A;  2NMQ A;  2OHF A;  1JQ4 A;  1SXT A;  4A90 A;  1UNS A;  2V4I B;  2KAJ A;  3HVD A;  2WXH A;  1QOA A;  4LK0 M;  1BXT A;  3SR6 A;  3WCQ A;  1PYW D;  3AH7 A;  3AE5 B;  1YN5 A;  4C56 C;  3BK1 A;  5D3D A;  2RMM A;  3U4E G;  3AE4 B;  1YN3 A;  1C4C A;  1FRR A;  2E3T A;  2W3S A;  3W9C B;  1XCT L;  2AQ3 B;  1MI0 A;  4GDL B;  1C77 A;  3CWI A;  2WDV B;  3PO0 A;  4M0W A;  2OED A;  1TKY A;  1UUP A;  1ET9 A;  1F77 A;  2CU3 A;  2KMM A;  2DLB A;  3KWV A;  1UGJ A;  4TQ1 A;  2QMT A;  2JU6 X;  1C9F A;  2WDQ B;  2RDG A;  2WLB A;  1NYQ A;  5BYS A;  1F0Z A;  3RPF C;  2J53 A;  2IGH A;  4L23 A;  2WXR A;  4RNA A;  1ACC A;  3BYY B;  1FXI A;  1WRI A;  4XWT A;  1MVK A;  2KWD A;  3AEA B;  4YTM B;  2BT6 A;  1QF6 A;  1IUE A;  1C76 A;  1KLG D;  3W1S A;  1ZOY B;  2HDE A;  4R3D A;  1SIJ A;  3ZJV A;  2PVG C;  1V1O A;  3L4P A;  1CK1 A;  1PUT A;  3FIL A;  4DXG A;  5EE0 A;  1T3Q A;  3BYT B;  4JE3 B;  3Q8F A;  3Q8A A;  4YSX B;  4C7Y A;  5BMH A;  1A70 A;  2MJD A;  1SE3 A;  4MH8 A;  1QLB B;  1JRP A;  2RPV A;  2WXM A;  3SFE B;  2XNA C;  3NZ3 A;  3FIL B;  1I4P A;  2W55 A;  3NVZ A;  5BMG A;  1MPE A;  1TY2 A;  4JWS C;  1FXA A;  2X38 A;  2QEJ C;  3AE7 B;  1LO5 D;  1KRH A;  2EEL A;  4HRO A;  4IKG A;  1YJJ A;  4ZHP A;  3BWU D;  1N60 A;  2MEK A;  1GT8 A;  1ZPS A;  3AEC B;  4TQ0 A;  1WWT A;  2MJ3 A;  4L2Y A;  1K51 A;  3I9V 1;  4MAC A;  3VRB B;  2GRI A;  5TSS A;  1I4Q A;  4WAF A;  4ZRQ A;  4GDK B;  4IOI E;  3W5U B;  4XE0 A;  1JAL A;  1F2R I;  2IGG A;  2AX5 A;  3J9C A;  3O13 A;  3CF4 A;  2WU2 B;  1YMH E;  4HRS A;  1TKG A;  5T8I A;  4HJG E;  2Y5P A;  3NS1 A;  3IAM 1;  1SE2 A;  2M19 A;  1XEE A;  4ZHO A;  1ZXH A;  1FCC C;  2QIL A;  1BUI C;  4KGR A;  3IT4 B;  1E7P B;  3NUH B;  4YXD B;  2J52 A;  2BW2 A;  1SJH D;  2WNM A;  1VJK A;  2WXI A;  1SSN A;  1UWM A;  1QOG A;  2DYM A;  3NVW A;  4TSS A;  1ZDX A;  1KFY B;  2WQY B;  2RDH A;  1D5M C;  1DOX A;  2BB6 A;  3AE2 B;  1CJE A;  1QIL A;  2HTM E;  1I4H A;  5AUK A;  3BK2 A;  4YSZ B;  1FRD A;  3OWE B;  1D5Z C;  4AQ7 A;  1GB4 A;  1YNT E;  3AE1 B;  2ZW1 A;  1E10 A;  1ZDV A;  2M56 B;  1I7H A;  1TS4 A;  1TZO A;  2W3R A;  3B2F A;  2J42 A;  4N58 A;  2H89 B;  4XWW A;  1XLN A;  4O1N A;  1QOB A;  1GAQ B;  2NTS A;  1OQQ A;  1SB3 C;  2Z8L A;  3EUB 2;  3P42 A;  4RGO S;  3TEW A;  2SEB D;  4A9A A;  1D4B A;  4KKJ A;  1BML C;  2GB1 A;  2L32 A;  4FXC A;  1YQ4 B;  2K3U A;  2DBY A;  4C7Z A;  1NYR A;  3P63 A;  4MM3 B;  3P4Q B;  4N6E B;  1H7W A;  1DGJ A;  2EKI A;  2VZK B;  3KQ4 A;  3Q8B A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...