1F2RC

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords CASPASE-ACTIVATED DNASE
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rC00
1IBXA 5HI1A 1UWXA 5HG2A 1FCCC 1FCLA 2EELA 5BMHA 1K52A 1MHXA 4IKGA 2N7JA 3V3XA 1QKZA 1D4BA 1MPEA 1HZ5A 5BMGA 2NMQA 2RMMA 2KACA 2KDMA 5HFYA 1PGXA 2IGGA 2QMTA 2KWDA 2ZW1A 3FILB 2KQ4X 1P7EA 5HHDG 1IGDA 2J53A 4KGSA 1XCQL 4OZAA 2J52A 2ZW0A 2OEDA 2ONQA 2LUMA 3UI3A 2I2YA 3MP9A 2GI9A 4D2KA 1F2RI 4KGRA 2JXTA 1K50A 1P7FA 2QSDA 1K51A 1XF5L 1YMHE 1IBXB 2IGDA 2KN4A 3GB1A 1MHHE 2GB1A 5JXVA 2JSVX 4KGTA 1PGAA 2JWUA 4MACA 4HKZE 1F2RC 2N9LA 4IOIE 2N9KA 2ON8A 2PLPA 1K53A 2LGIA 1MI0A 1EM7A 4WH4A 3FILA 2IGHA 5BMIA 2I38A 2PTLA 1GB4A 1Q10A 1GB1A 1MVKA 1FD6A 1ZXHA 1IGCA 1HZ6A 2K0PA 2PW9A 1XCTL 2RPVA 2JZPA 2LHDA 4OZCA 1PGBA 1YNTE 1HEZE 1JMLA 1KH0A 4OZBA 2JU6X 2LHEA 4GLSC 1C9FA 4HJGE
chains in the Genus database with same CATH superfamily
1IBXA 4G3XB 3RZFA 2D3CA 4JPSA 3U8ZA 5DPWA 3L13A 2LASA 4TV3A 3P2BA 5FR6A 3U4EG 2WXJA 4FJYA 2LVQA 2WXPA 1WM2A 2QILA 2KDMA 1WXQA 3M62B 2WDTB 2MP2B 1SBBB 3A1QB 5AZGA 1XO3A 3N3KB 2ZW1A 1L0VB 1OEYA 2QCZA 1P7EA 4RMAA 2D3AA 4XX5A 4C00A 1KOTA 4A8XC 1NYQA 3M63B 1R4NB 2QHOA 2V9HA 3L4PA 3AN1A 1KFYB 1TKEA 2Z0EB 5IKCM 1ET6A 3AE4B 5I4DA 2WLBA 2QSDA 3U30A 1SE3A 1FPYA 2K9XA 3IAS1 5D3IB 2G4SA 1IBXB 3Q3OC 3I57A 3EGRA 2AX5A 4KGTA 1V1PB 3L16A 2N9LA 1YN4A 1LO5D 4WURA 2UU7A 1ESFA 3U7ZA 1ZXIA 3ZJUA 2L32A 4R3DA 4W9LA 4A20A 5LNK1 1WGDA 3RNFC 4NAWB 1FFUA 2BB5A 3N32A 4G0NB 1Q10A 4II2B 1JWUD 1ZE3D 2C9WB 2AEHA 2WXQA 4LJOB 3UGBB 3DHHC 3GS2A 1YJ1A 1JWMD 2MH7A 3SHQA 1VZ8A 2BTEA 1R7SA 1XLOA 4ANXA 1NI2A 3NVWA 1N6ZA 1V1PA 2NPTA 2RD0A 1WYGA 2BKFA 2DLBA 3HM6X 3SFDB 4LDTD 2EELA 3HHMA 3R3MA 4DXAB 4ZRKA 2NMQA 2RMMA 3ZDMC 3EECA 2I1JA 5AEKB 2JF5A 2IGGA 4OVUA 3AE9B 3UINB 2KWDA 1I4PA 2KQ4X 3ZLZA 2WXFA 3PZDA 1XCQL 1LQBA 2ZW0A 2LUEA 3GE8C 2Z0DB 4E71A 4P7IA 4WJPA 2D3GA 3KUCB 1P7FA 4FN2A 4W9JA 4BOSC 1ZKHA 4ZDVA 1I4QA 4OVZA 4TMAB 1VD2A 3BVGA 5BYQA 3AV8A 3Q69A 4IM2A 5EE9A 2OHFA 4RGMA 3B9JA 2C5LC 2XEWA 3ZQ4A 2IO0B 5CHVC 3RMKC 4AWJA 4HXDA 3W5UB 3PS6A 4HEA1 1LFDA 3B2GA 3TEWA 1AN8A 5DPSA 4GIVA 2J4XA 1WM3A 1WSPA 2CHWA 1JCKB 1ZGUB 1LM8B 1TKGA 1PGBA 3DBLI 3Q14C 3TMPB 3SU8X 4W9HA 3AU4A 1JMLA 1V97A 2WXIA 2KLCA 2BYVE 4HDQA 3TL5A 3TUOA 1WJ6A 1T0QC 1M4VA 1F9JA 4C7YA 2MBOA 4TSSA 2OJRA 1WX9A 4BBNF 4A90A 4LNNA 1HZ5A 3H6NA 3L17A 4DBGA 2B3AA 2QMTA 1D5XC 3ML9A 3FILB 4NNJB 1NENB 4EZJA 4KKIA 1V9JA 3ZGZA 1A70A 1OTRB 1WE6A 2DYBA 3AEBB 3ZKJC 2K25A 2WXMA 4A9AA 4GB9A 3MC0B 2WYQA 1DOXA 3HRDD 2DZJA 3KWLA 1K51A 1FRDA 3ZDTA 2A4ZA 3GB1A 4EEWA 4BKSD 3WAMA 2LEKA 3RI7C 2AQ2B 1UD7A 4ARIA 4HCPB 5G55A 1FNVA 3Q2AC 4MM3A 1GPXA 2JVCA 2DX5B 3OJ4B 1Q5WB 2KWCA 1WGRA 3PSEB 4KIKB 2LGIA 4C7ZA 1YX6B 3B0AA 1SJHD 1EM7A 2G4DB 3QC8B 1ZPSA 3FILA 5L83A 1LXDA 3BVMA 3APFA 2K6QA 2VH2A 4A3PA 2JXXA 2Y5BB 3OWEB 3WANA 3QIJA 2K8CA 3VR9B 3KQ4A 3IHPC 1RRBA 4K7UA 2REXA 5BYSA 1Z2MA 4MJSB 3RFZB 5HI1A 2BKRB 4JLCA 2LJIA 2W9NA 3HUIA 4LCDE 3Q3FA 3L0WB 2BWES 4W9IA 4WWMA 1MPEA 2MP2A 4MGKE 3P42A 4W9DA 2QC8A 3Q8AA 1PGXA 4IM3A 1EUVB 2DNFA 2X8XX 4HDOA 4ZRJA 4TUUA 3Q8BA 2HTHA 1D3ZA 2J53A 3UI3A 1YJJA 2KQ7A 3W5VB 4MSQB 2KDBA 1HA5A 3PV1A 2ZVOA 4I6NB 3AE2B 1K50A 4GMVA 3QWZB 1WMHB 3ONSA 3Q6BA 3ZIMA 2ZNVC 4N6EB 1WXMA 4ICVA 4MH8A 4NQKE 2N1WA 3EUB2 2JYTA 2KC1A 1TKYA 4BFRA 5J18A 3KH0A 4ZYSA 4FULA 2HJ8A 3IT4B 4EZLA 3AEFB 2GBKA 1MJDA 4KVGB 4P6VF 3RD2A 4AP4C 1MI0A 2KXJA 2PMVA 2KVRA 3AE6B 2I38A 2K3UA 2IO2B 1TY0A 1ISNA 2LZ6A 3DVNV 1JRPA 1E5WA 2INDC 3LJ3A 3V61A 2AWTA 4ZRQA 2KLGA 4RF0A 5LXIB 1ENFA 2LI5A 1J0GA 4HLEA 2KJHB 1NI3A 5H8YE 3OG5A 3PZ7A 4DWFA 1EU4A 5D2MB 1J7AA 5IOIA 4OZBA 4G11A 1BXTA 3RCZA 3VTUA 1C9FA 2R61A 2CS4A 1FXIA 3JW0X 3MTNB 1YQ3B 1E8ZA 1QKZA 4CHKA 4L2YA 2JQRB 1VZ7A 4ZHPA 3H7PB 4KKJA 2DYMA 3A33B 2JZZA 1AWDA 4H2AA 2BS3B 5D94A 1HXYD 2OEDA 3RN9C 2LFIA 3VUWA 1QOBA 3ZXVA 4C56C 1V6EA 2KD0A 2IYDB 4DDID 3IBEA 3KYDD 1AW7A 1D6EC 3A4SC 1YMHE 4DHJD 1YQBA 4P1BC 2D3BA 2KDFB 5IO9A 3NVVA 2BYTA 1T6BX 2AL6A 3DBHI 4OHJA 4F7ZA 2WXOA 2N9KA 4REZA 3ZRFA 1ZP0B 2ICIA 2NR2A 1VZ6A 2ZNVB 4HWIB 3Q8EA 1MG8A 3VVWB 2QJLA 1EF5A 4HRSA 2AL3A 4BAXA 3VH4B 1XXGA 4FHJA 2INNE 5G5HA 4ZRIA 2IO1B 2CJOA 1C79A 3AE1B 2PEAA 1L0YB 2NBUA 3C0RB 2O6VD 2C7HA 2WS3B 1XLNA 2BBCA 3LYYA 2B76B 3B08A 1I35A 2FCMA 1WWTA 3N20C 3BK1A 3DDCB 2ZZPB 4JQWC 4GLSC 1BT0A 3C19A 2BVCA 2C7MB 2KMAA 2G1EA 1TS5A 4F1SA 1E9MA 2LJ5A 4RCOA 2RDGA 3EA6A 1K52A 2DZMA 4GN1A 2JT4B 1JRUA 1FNUA 1WGGA 1QQRA 1T5XD 4I6PA 1XD3B 4CO7A 2IY1B 2A5UA 1T0YA 1C4PA 3TEZA 3VRAB 3DHIC 3BYTB 1SE2A 1E10A 2QIEB 5JH5C 5AUIA 4RGNA 2GOWA 5AUKA 3U7DA 4O1NA 2O6VB 2V1YA 4WWPA 3UIOB 1OEYJ 5E6JA 3NS1A 4JWUC 1E7UA 3W1YA 1E0ZA 1WJUA 2KNBA 1MG4A 3BVZA 1V49A 1HE8A 3KWVA 1U4AA 2L8JA 2SEBD 1IPGA 2PLPA 3AMZA 3IAM1 4Q2JA 1EWYC 2D5GA 1WJNA 1WXVA 1NDDA 4XDCA 3PVLA 4RF1A 1Z5SB 4TKNA 4NAWA 4FLHA 4ANUA 5FK9C 1IGCA 4XE0A 2I1KA 2CHXA 4M01A 1YD8U 4W9GA 1L0XB 4K7SA 2LHDA 2LGSA 2E3TA 1NVID 3WAPA 3WAOA 1KH0A 3N1ZC 1CQVA 1B9RA 4LDTB 3TCAA 1XLPA 4HJGE 3FAHA 4W9KA 1UGMA 4GDKA 3RZWC 2WDRB 2MBHA 4HKQA 4G50A 2L00B 2M0AA 4IKGA 1RFKA 5IP4D 1D4BA 1SE9A 2WX0A 4FADA 1A5RA 2YEPB 1L7YA 2J0MA 3BIID 2XBBC 5AZFA 3ETRA 1D5MC 1UZXB 2BQQA 3VUYA 2MJ3A 4WIPA 1ZDXA 1L4ZB 1FEHA 2BT6A 4ANVA 1C4CA 4LTUA 3ZRCA 4GXBA 3I5JC 1GNUA 3H8HA 4N59A 4AUQC 2MCNB 3P4RB 4P16A 3U52E 1L4DB 4GDKB 2V0GA 2L52A 2LXCA 4B9KA 4PT5A 2PIAA 2JSVX 3ML8A 1C3TA 2WQYB 2JWUA 3RUIB 1Q0WB 2LVOA 4HKZE 4C80A 3N9YC 3EFUA 4BKSA 1N63A 1K53A 4GGQA 1TBEA 5KHOA 2FCNA 2O2VB 4KZ0A 4YSYB 3ZJVA 3VTWA 3ZUNA 2FCQA 1WYWB 1RM6C 2FUG1 3UQBA 2IY0B 1FD6A 3QA8A 2XK5B 3EFCA 3V60A 2DZKA 1V5TA 1XT9B 2WDQB 1QLBB 4IC7B 3VRBB 1EF1A 1YNTE 1J19A 1N61A 1GJZA 2KZRA 1JWBD 3EHVA 3A9KA 1TIFA 3AM9A 1XLQA 2W3SA 2J0KA 3NVYA 3R66C 2FIFA 4LK0M 5HG2A 3R7RA 1C76A 2BF8B 3QJZA 3NHEB 1EWCA 2K22A 2RSUA 3RT3B 2LGXA 2PJHA 3NJTA 1WJ4A 3ZNHB 2MSED 3W1SC 1E8WA 1L2NA 5TSSA 1PFDA 4IW0A 1VCBA 4B6WA 2L0FA 2J7QB 4USAA 2OOBB 4NZLB 2V4LA 2KC2A 5IAAC 2N7DA 1KLUD 4DDGD 4IWQA 1V1OA 4FJVB 1OGWA 3EC8A 1P1AA 4K3CA 4OW0A 2CKHB 2ONQA 5H92C 4JE3B 1WRIA 5EE0A 4WJQA 1F2RI 2K1FA 3A9KB 2ZVNA 1SIFA 2ZEQA 5DPRA 2X38A 1X1MA 3A4RA 4YSXB 2N9XA 1MHHE 2MBEA 4N9F4 3B2FA 3AU5A 3R2IA 1ZW7A 2Y5CA 4KDIC 2JRHA 1T0SC 3BYYB 1F1HA 2KVZA 3Q3JA 4ASWC 3X0WA 1FMAD 2H88B 2MW5A 1YJIA 1OQYA 1SF0A 2KMMA 3RNEC 5BYRA 5JZEB 2SAKA 4XYCA 2O2VA 3VFKA 1KRHA 3AECB 1K8RB 1GB1A 2KTFA 1FXTB 5DCNA 3DBSA 4NJ6A 2BGFA 2PW9A 2EKIA 3IG3A 1NBFC 1TS2A 2G9HD 1JWAD 1NYRA 2G45B 1E6EB 4FBJB 2TSSA 3A9JA 3MC8A 3R8BA 1HEZE 1OQQA 3X23A 3VR8B 2LHEA 4LNOA 2DAJA 5JHAA 2BYEA 4KSLC 1PYWD 3PLVA 4ICUA 3ZW3A 3N1XC 1MHXA 2RGFA 4YTNB 1HTQA 1SGHA 2YVCA 3J9CA 4XDDA 5C1ZA 3WCQA 3OAWA 3S2AA 4US9A 2DWQA 5CHWA 3Q3NC 1TJEA 3PT2B 2W55A 1AYFA 2V3PA 1C4AA 3H7SA 4M00A 1ACCA 5D7GA 3A9JB 2Q5WD 3ZTDA 2DYOA 1TS4A 3NZUA 2NBWB 2WU2B 1WMHA 1PUTA 5CX3A 2LXAA 3MC9A 4MDKE 1ZDVA 3O65B 1TZ1A 2NPTB 2KOXA 1GOZA 4BKTA 4IOIE 1TTNA 5HKHA 3Q8FA 1H8CA 1KF6B 1WI0A 2ZJDA 2M4NA 2KANA 4ZOHC 1WE7A 1UBQA 3DWGC 1FIQA 1Q1OA 4HVBA 3PREA 1L6VA 4AJWA 1L5PA 1GB4A 2N9EB 1YN5A 2KFKB 4HCNB 3LXFA 3ECIA 2VH1A 3DBRB 3DBHB 1EU3A 4OZCA 4ITKA 1I4GA 4L1BA 4FA6A 3ZNID 3DVNU 2O6VA 3DPDA 3MJ5A 2JU6X 3P4QB 1YIWA 2ASQA 2LGDA 5EE1A 3P63A 1FCCC 1FCLA 1WF9A 4DHZB 1E90A 2KFJA 1I4HA 1RFAA 4B0MA 4PYUA 1RLFA 1PQSA 4GDLA 1UF0A 4WWNA 2N1VA 4BKGA 1KLGD 2GMIC 1R4MI 1TYGB 2FNJB 2MQJA 4KSKC 3VH3B 2LGYA 3CIRB 4MGZE 5IA7A 4QAYA 3ZNGC 2MJEA 3AEAB 4ARCA 2H89B 3I3TB 1QOGA 3TJPA 5E6NA 4RGOS 4S17A 3SR6A 1WIAA 2PE6B 4KGRA 1ZUD2 2N9PC 2WXKA 2ZCCA 3T3OA 3DOWA 4S0RA 4YT0B 2KJ6A 1MFWA 2WXGA 2AYOB 3I9V1 2LD9A 3DBRI 2WNMA 2W82A 2YLMA 3QQ8B 2MLBA 1G6JA 2LRUA 2HTME 3PGEA 1C1YB 2WXNA 2Z59B 4ZYNA 1SB3C 2IPKD 3P4PB 1ET9A 4IG7B 2BWFA 2BYFA 2IO3B 5BMIA 2BB6A 3W9CB 4HJKA 4NPNA 3NUHB 2JWZA 3GP7A 3K9PB 4HPLB 2RR9A 2J0JA 2L7RA 4MT5A 3BY4B 4MELA 1ZXHA 2N4FA 1R4MB 4BOZB 3UQAA 5TR5A 1DOYA 2FBWB 4US8A 2AQ3B 1YOVB 2BS4B 4K1RB 2KWUB 4AQ7A 3VTVA 1TZOA 2INPE 2M1MA 1WFYA 3VAWA 2R2QA 2AQ1B 1HTOA 3HVDA 4C4VA 2KO3A 1DOIA 1RAXA 4XGAB 3TIXA 1HQRD 3I63C 2D10A 2W3RA 3AEGB 3QCAA 2VRRB 4IUMB 1QF6A 4JIOU 5J2RA 4XC2A 5CHFA 1E7VA 2WXRA 1DGJA 4EFOA 1GUAB 1IGDA 2NVUI 3SDLC 5GMVA 3KUZA 2PKOA 1I42A 2DAFA 4KDLB 2QDFA 2LUMA 3MP9A 2L05A 1GC6A 3CSFA 2L83A 4HPMB 1WX7A 4GSWA 5J17A 4MEMA 1T3QA 1VJKA 1QOAA 4YWGG 3MFGA 2KQSA 4II3B 4GU2A 4E3CA 3V6EB 4MACA 1STEA 4YSZB 2DENB 1KTKA 2ON8A 4K3BA 1I7HA 3T3NA 3TSSA 3T9LA 3U2SC 2G3QB 4OVVA 4URKA 1ZOYB 4PK1A 2L1AA 2PVGC 3BINA 4CYEA 3PTFC 2LMCA 1ROEA 2K0PA 2K8HA 1OQRA 2KX3A 2D11A 3UIPB 1XCTL 2RPVA 3ALBA 1WXAA 1CJEA 4FHKA 1FNWA 5KHQA 2V3SA 4ACFA 3APDA 3PRPB 1LGRA 1N60A 4BVUC 2ZPYA 1M94A 4DXFA 1N5WA 1KJTA 5BMHA 2JY6A 4KIKA 2RPQA 4C4VB 4EKUA 4TQ0A 1KLVA 3BWUD 1S1QB 2NTTA 3JYUA 3A1QA 4B95A 4DK5A 3SEBA 2CU3A 1GC7A 1OFFA 1V8CA 3DBLB 3PHWB 3TEYA 1E8XA 2RDHA 3P1MA 3IFWB 1WRDB 2CJNA 2M0XA 2KK8A 3VQIA 4OZAA 4YXDB 3GZNI 3CSTA 2D2QA 3WALA 4WAAA 5C2TB 4WQMA 2L0TA 3RYTA 2DHZA 2JXTA 1JWSD 4YTPB 1J8CA 2M8SA 4JGHB 4LJPB 4BZAA 1FM0D 3VXWA 3RNAC 4EOYA 5FR3A 5MPOA 2WX1A 3MHZA 5CTRC 3PZ8A 5LLIA 1PDXA 3PPAA 2MJDA 5JHBA 3AB5A 2M56B 4AOFA 4M8NA 1V5OA 3RULA 5E6PA 2D07B 2BPSA 2R2OA 1TS3A 4K7WA 2HD5B 3QK0A 2C60A 3GZNB 3KYCD 4EUTA 2KHWB 2QEJC 2N7EA 2KFKA 4IDIA 5AZHA 3APCA 3KVFB 1UELA 4PS7A 2ZPNA 3RNGC 5LXHA 1T0RC 2J42A 1HZ6A 1NEKB 1I4XA 5DPTA 4UDUC 3HK0A 3TEXA 1YX5B 2V3NA 3GE3C 3ZO5B 4X57B 3H1UA 1V81A 2WHIA 4XZ4A 1XEEA 3PHXB 4N58A 4A6QA 1S3SG 4GDLB 3AEEB 3V3XA 4ZHOA 3QX1A 1B1ZA 4EE2A 3W2DA 3UF8A 4W9CA 1SJED 3K9OB 4MSMB 2INCC 3ZJTA 4L23A 1JW9D 3JSVA 4KGSA 2V4IB 2MBQA 3DQVA 5G2NA 1QOFA 3AI5A 4M02A 2WDVB 1AARA 1Y56A 1P98A 2KN5A 3AE5B 1WR1A 1UUPA 3CMMB 1H4RA 3AULA 2KMCA 2W54A 4W9FA 4E74A 3C8YA 2LVPA 4P1CC 2IJ0A 2GB1A 4NJ7A 1DYQA 5JXVA 4DQOC 3TBLD 1JALA 1PGAA 2KWVB 3V62A 2Y5PA 4NY0A 1N62A 1TGZB 2NCNA 1WGHA 4MGIE 1F77A 3DVGX 2YEPF 1WH3A 5E6OA 2JRIB 4NJCA 4PYZA 2FIDA 3JSVB 3ABVB 3WIMA 3ZNZB 2EMTA 2JX5A 2PTLA 2GRIA 3AEDB 1WGKA 1WXSA 4JX1C 1MVKA 2JZ3B 3NRZA 1JROA 2K5PA 5G5GA 4XWTA 4DXGA 1CK1A 2BS2B 2KDEB 5D6JB 1VDVA 2JPHA 3SFEB 2KAJA 4PS8A 4A3OA 1GAQB 3SD5A 2GBJA 3ENEA 1SEBD 4ZRPA 1WX8A 5C3JB 2KJRA 1CMXB 2KT7A 3NY5A 1UGJA 2RDBC 2OJWA 3NS8A 2Z8LA 3DWMA 1SXTA 2L3ZA 4EZKA 2KACA 3VDZA 2WXLA 4GOCA 4NAMA 3ZVVA 3H7PA 2KDIA 4B0EA 1WZ3A 2ZCBA 1FO4A 2CU1A 2JUOA 1EO6A 2HJ1A 2KTRB 2GI9A 3ZYYX 4YTMB 3NZ3A 3O13A 1I4RA 4KX6B 3FC4A 2C7NB 3NG0A 2PE9A 1CZPA 2LRWA 1XF5L 1RYJA 1FXAA 4LNKA 1TY2A 5GXGB 4HK2A 3LDZE 1F0ZA 3LB8C 1BMLC 4JL9A 1F2RC 3ZXRA 2FAZA 1SIJA 4J6IA 4RH6A 1YN3A 1V80A 4FXCA 4MGYE 1WGYA 1WY8A 4M0WB 5FKAC 2IGHA 1N5XA 2NBVB 2N0SB 4KV2A 2BW2A 2WXHA 4RGTA 2XK5A 2KTRA 1IUEA 3AE7B 1WZ0A 3WA0A 4RFBA 4WJOA 1VLBA 3FKYA 3Q3MC 1E8YA 4WJNA 3MHSD 3D32A 4J3OD 1V2YA 5EE3A 3DCGA 4DHZE 3N1YC 3NVZA 4HPPA 3N30A 1UWMA 2HDEA 4IM0A 2FE8A 1UH6A 1UWXA 4FJZA 4YL8A 1F52A 3KUDB 2MX2A 2WU5B 4M0WA 3B1LX 5HFYA 2KYWA 1V86A 4PS3A 1GG3A 2KKCA 3V6CB 3VUXA 5IN7A 4W9EA 1VR9A 2J52A 3QARA 2I2YA 3RNCC 2GLSA 4D2KA 2WWZA 4TQ1A 2MWSB 2K6DB 3GOEA 1SE4A 3KW5B 1D5ZC 1SSNA 2XNAC 2IGDA 4LNIA 4MJSA 2WGSA 3E56A 1TT5B 2PPHA 2L76A 1VRAB 2IZVB 2MA9B 5C23A 1UNSA 3ZTCA 1QT9A 3DVGY 2PVOD 3RNBC 1R4NI 3URYA 2K8BA 3PRMB 2KX0A 3L54A 4LLGM 4MH0E 4JWSC 4RM8A 3AH7A 3AXCA 2UYZB 3NZSA 3AE3B 3HM3A 4WWOA 3BK2A 2UWQA 1WR6E 3CF6E 2LWPA 5T8IA 3HVZA 1BUIC 3IXSA 3R7QA 2JZPA 5L95C 3E9SA 3QAQA 3MJWA 3M95A 2JYEA 4RM9A 1Y8RC 1QILA 2GBRA 1IYFA 3PLUA 3NOBA 2MHJA 1JQ4A 3L08A 3RPFC 4CQNA 2VZKD 3BZDB 3W1SA 3AE8B 1KM7A 3IVFA 4IWOA 2NTSA 2N7JA 1P0RA 3L10B 2VZKB 2NS5A 2XN9C 2IBIB 5BMGA 2FUHB 4DHJB 1RWSA 1FRRA 1P9DU 1QZEA 3CWIA 2WP9B 2GBNA 1C78A 1P3QU 3IT6B 5HHDG 3KLSX 4M8MA 2EMSA 1C77A 1XQQA 1J7CA 2ACZB 3VHTC 2CR5A 2MEKA 2FCSA 2DZIA 2MBBB 1J7BA 2M17A 4ANWA 2M19A 2KN4A 3Q8CA 3QHTA 3PO0A 3HIZA 4K81A 4NQLB 2HE7A 2DBYA 2EKEC 3V05A 4A55A 1YQ4B 4MM3B 3H9DA 3P4SB 5EDSA 1E7PB 2MRPA 4WH4A 3R2TA 4F8CB 4HROA 4LNFA 3PRZA 1IP9A 4WAFA 4WQOB 4RNAA 4IWPA 1L6UA 3DHGC 3M3JA 2K39A 2GBMA 4KZCA 2Y3AA 5D3DA 3OLMD 1UBIA 4I6LB 2E6XA 3T8MA 5BO4B 1FFVA 4BBNC 2CHZA 4AJYB 4AS1A 3JVZX 2IDYA 3OJ3A 4XWWA
chains in the Genus database with same CATH topology
1IBXA 2R61A 1PYWD 4A6QA 1FXIA 4JPSA 4GDLB 1MHXA 1YQ3B 4YTNB 3U4EG 3AEEB 1QKZA 2WXJA 3V3XA 4L2YA 4ZHOA 2JQRB 1VZ7A 2WXPA 4ZHPA 1B1ZA 2KDMA 2QILA 3J9CA 1WXQA 4EE2A 3W2DA 4XDDA 3WCQA 1SBBB 4KKJA 2DYMA 1SJED 1AWDA 4H2AA 1XO3A 2DWQA 4US9A 3ZJTA 2ZW1A 1L0VB 4L23A 1JW9D 1TJEA 1P7EA 2BS3B 2W55A 1AYFA 2V3PA 4A8XC 1HXYD 1C4AA 4KGSA 1NYQA 2V4IB 1QOFA 2OEDA 2LFIA 1ACCA 3AN1A 2WDVB 3L4PA 5D7GA 1Y56A 1QOBA 1KFYB 4C56C 3AE5B 1TKEA 2Q5WD 1UUPA 1ET6A 3AE4B 5I4DA 2DYOA 2WLBA 2QSDA 1TS4A 2W54A 1AW7A 1D6EC 1SE3A 2K9XA 3IAS1 1YMHE 5D3IB 1IBXB 3C8YA 2WU2B 2IJ0A 1PUTA 2GB1A 5JXVA 1DYQA 1ZDVA 3NVVA 2BYTA 4DQOC 3I57A 1T6BX 3EGRA 2AX5A 1JALA 4KGTA 4OHJA 1PGAA 1V1PB 2Y5PA 1GOZA 1N62A 2N9LA 2WXOA 4IOIE 1YN4A 2N9KA 4REZA 1LO5D 1ZP0B 2ICIA 4WURA 1F77A 1VZ6A 3Q8FA 2YEPF 3Q8EA 1ESFA 2QJLA 1KF6B 3U7ZA 1ZXIA 3ZJUA 4HRSA 4ZOHC 2L32A 4R3DA 1XXGA 5LNK1 4NJCA 2INNE 3DWGC 1FIQA 4NAWB 1FFUA 2BB5A 3ABVB 2JX5A 5G5HA 1L6VA 2PTLA 2CJOA 1C79A 1L5PA 2GRIA 3AEDB 1WGKA 3AE1B 1GB4A 1Q10A 1L0YB 1JWUD 1MVKA 3NRZA 4JX1C 1JROA 1YN5A 2K5PA 1ZE3D 5G5GA 2WXQA 4XWTA 4DXGA 3LXFA 1CK1A 2BS2B 2WS3B 1XLNA 2BBCA 3GS2A 1EU3A 3LYYA 1JWMD 4OZCA 2B76B 2MH7A 4ITKA 1VDVA 1VZ8A 1WWTA 1I4GA 4L1BA 3SFEB 2KAJA 2BTEA 1R7SA 3BK1A 1XLOA 3MJ5A 2JU6X 1GAQB 3P4QB 4GLSC 3NVWA 1SEBD 1V1PA 5EE1A 4ZRPA 1WYGA 2G1EA 1TS5A 2DLBA 5C3JB 3P63A 1E9MA 1FCCC 4RCOA 3SFDB 2RDGA 3EA6A 2EELA 1FCLA 1K52A 1UGJA 1I4HA 4B0MA 2Z8LA 3DWMA 1FNUA 1SXTA 1QQRA 1T5XD 2NMQA 2KACA 2RMMA 1KLGD 2WXLA 1TYGB 2IGGA 3AE9B 3CIRB 2KWDA 1C4PA 3TEZA 1I4PA 2KQ4X 4NAMA 2MJEA 2WXFA 3VRAB 3AEAB 4B0EA 4ARCA 2H89B 3BYTB 1SE2A 1QOGA 1E10A 1FO4A 2QIEB 1XCQL 2ZW0A 4RGOS 5AUIA 4RGNA 3SR6A 2GI9A 5AUKA 3ZYYX 4O1NA 4YTMB 4KGRA 3NZ3A 1ZUD2 3O13A 2WXKA 1I4RA 4KX6B 3FC4A 1P7FA 3NS1A 5E6JA 3T3OA 1CZPA 4JWUC 1XF5L 4YT0B 1RYJA 1E0ZA 1FXAA 2WXGA 1TY2A 5GXGB 3BVZA 1I4QA 3I9V1 4OVZA 3KWVA 2WNMA 4TMAB 2W82A 3BVGA 5BYQA 3LB8C 1F0ZA 3AV8A 3Q69A 1BMLC 2SEBD 1F2RC 5EE9A 2OHFA 4RGMA 1SIJA 3B9JA 2PLPA 2HTME 3ZQ4A 3AMZA 4RH6A 1YN3A 2WXNA 3IAM1 4Q2JA 1EWYC 1SB3C 2IPKD 4FXCA 3P4PB 1ET9A 2D5GA 3W5UB 4HEA1 5FKAC 2IGHA 1N5XA 2N0SB 5BMIA 4XDCA 2BB6A 3W9CB 3NUHB 3B2GA 2BW2A 2WXHA 4RF1A 3GP7A 4RGTA 3TEWA 1AN8A 1IUEA 3AE7B 4MT5A 5FK9C 1ZXHA 1IGCA 4XE0A 4RFBA 2J4XA 1WSPA 1VLBA 1JCKB 1L0XB 2FBWB 1DOYA 2LHDA 1TKGA 1PGBA 4US8A 2AQ3B 2E3TA 1NVID 2BS4B 4J3OD 4AQ7A 5EE3A 1JMLA 1V97A 2WXIA 1KH0A 3NVZA 1CQVA 1B9RA 1TZOA 2INPE 1UWMA 2AQ1B 3TUOA 2HDEA 1XLPA 2FE8A 4HJGE 3FAHA 1UWXA 3HVDA 1M4VA 1DOIA 4C7YA 2WDRB 1HQRD 4HKQA 2W3RA 3AEGB 4TSSA 2M0AA 4A90A 4IKGA 2WU5B 1RFKA 1QF6A 1D4BA 1HZ5A 4M0WA 2YEPB 3BIID 5HFYA 2QMTA 3ETRA 1D5MC 1DGJA 2WXRA 2MJ3A 4WIPA 1D5XC 3FILB 1NENB 1ZDXA 4KKIA 1L4ZB 1IGDA 1FEHA 2BT6A 3ZGZA 2PKOA 1C4CA 1A70A 4LTUA 1VR9A 2J52A 3AEBB 2LUMA 2I2YA 3MP9A 4D2KA 2WXMA 2L83A 4A9AA 3H8HA 3MC0B 1DOXA 4N59A 3HRDD 3KWLA 4TQ1A 1T3QA 3P4RB 4P16A 1K51A 3U52E 1SE4A 1QOAA 1FRDA 1D5ZC 1L4DB 1SSNA 1VJKA 2IGDA 2XNAC 4GDKB 3GB1A 3MFGA 4YWGG 2V0GA 2L52A 2LEKA 4PT5A 2AQ2B 2JSVX 2PIAA 2WQYB 4ARIA 2JWUA 4MACA 1STEA 4HKZE 1FNVA 3E56A 3N9YC 4C80A 4YSZB 1GPXA 1KTKA 1VRAB 2ON8A 1N63A 1K53A 1UNSA 2LGIA 4C7ZA 1I7HA 3T3NA 1QT9A 2PVOD 3TSSA 1SJHD 1EM7A 3URYA 3U2SC 4YSYB 3ZJVA 1ZPSA 3FILA 4LLGM 1ZOYB 4JWSC 3AH7A 1RM6C 3BVMA 2L1AA 2PVGC 3AE3B 2FUG1 3BK2A 1FD6A 2LMCA 1ROEA 3OWEB 2K0PA 1OQRA 5T8IA 3HVZA 1XCTL 3VR9B 2WDQB 2RPVA 1BUIC 3IXSA 1QLBB 2JZPA 3E9SA 3KQ4A 3VRBB 1YNTE 1CJEA 1N61A 1FNWA 2JYEA 1JWBD 3AM9A 1N60A 5BYSA 1XLQA 2W3SA 3NVYA 4DXFA 3RFZB 1QILA 5HI1A 4LK0M 5HG2A 1N5WA 1JQ4A 1C76A 5BMHA 3RPFC 4CQNA 1EWCA 2K22A 2LJIA 2VZKD 3BZDB 3HUIA 3W1SA 3AE8B 4WWMA 2NTSA 2N7JA 5TSSA 2VZKB 4TQ0A 1MPEA 2XN9C 1PFDA 5BMGA 3BWUD 2NTTA 3P42A 4USAA 3Q8AA 4NZLB 1RWSA 1PGXA 2CU3A 3SEBA 1FRRA 3CWIA 2WP9B 1OFFA 1V8CA 1KLUD 3TEYA 1C78A 2RDHA 3IT6B 1V1OA 5HHDG 3P1MA 3KLSX 3Q8BA 2CJNA 1C77A 2J53A 3VQIA 1J7CA 4OZAA 4YXDB 2ACZB 4OW0A 3UI3A 1YJJA 2ONQA 5H92C 4JE3B 3W5VB 1WRIA 2MEKA 5EE0A 1HA5A 1F2RI 5C2TB 4WQMA 2JXTA 1J7BA 1JWSD 3AE2B 1K50A 4YTPB 2M19A 2X38A 1FM0D 2KN4A 3Q8CA 1MHHE 3MHZA 4YSXB 5FR3A 4N6EB 5MPOA 3B2FA 3PO0A 3R2IA 4MH8A 3PZ8A 3EUB2 1PDXA 2JYTA 2Y5CA 1TKYA 2MJDA 3BYYB 4ZYSA 3AB5A 2DBYA 2M56B 3IT4B 3V05A 4A55A 1YQ4B 1FMAD 4MM3B 2H88B 1TS3A 3AEFB 1YJIA 4P6VF 1SF0A 3P4SB 1MI0A 1E7PB 2KMMA 4WH4A 2PMVA 3R2TA 4HROA 5BYRA 3AE6B 2QEJC 2I38A 2SAKA 2K3UA 1TY0A 4IDIA 1KRHA 4WAFA 4RNAA 1JRPA 1L6UA 3AECB 1GB1A 2J42A 1HZ6A 1NEKB 1I4XA 4ZRQA 4UDUC 2Y3AA 4RF0A 3TEXA 2PW9A 5D3DA 2EKIA 1ENFA 1TS2A 2V3NA 2G9HD 1NI3A 1JWAD 3PZ7A 5H8YE 1NYRA 1E6EB 1EU4A 2TSSA 2E6XA 3R8BA 1HEZE 1J7AA 1OQQA 1FFVA 3VR8B 4OZBA 1BXTA 2LHEA 4AS1A 1XEEA 1C9FA 2IDYA 4N58A 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBX A;  5HI1 A;  1UWX A;  5HG2 A;  1FCC C;  1FCL A;  2EEL A;  5BMH A;  1K52 A;  1MHX A;  4IKG A;  2N7J A;  3V3X A;  1QKZ A;  1D4B A;  1MPE A;  1HZ5 A;  5BMG A;  2NMQ A;  2RMM A;  2KAC A;  2KDM A;  5HFY A;  1PGX A;  2IGG A;  2QMT A;  2KWD A;  2ZW1 A;  3FIL B;  2KQ4 X;  1P7E A;  5HHD G;  1IGD A;  2J53 A;  4KGS A;  1XCQ L;  4OZA A;  2J52 A;  2ZW0 A;  2OED A;  2ONQ A;  2LUM A;  3UI3 A;  2I2Y A;  3MP9 A;  2GI9 A;  4D2K A;  1F2R I;  4KGR A;  2JXT A;  1K50 A;  1P7F A;  2QSD A;  1K51 A;  1XF5 L;  1YMH E;  1IBX B;  2IGD A;  2KN4 A;  3GB1 A;  1MHH E;  2GB1 A;  5JXV A;  2JSV X;  4KGT A;  1PGA A;  2JWU A;  4MAC A;  4HKZ E;  1F2R C;  2N9L A;  4IOI E;  2N9K A;  2ON8 A;  2PLP A;  1K53 A;  2LGI A;  1MI0 A;  1EM7 A;  4WH4 A;  3FIL A;  2IGH A;  5BMI A;  2I38 A;  2PTL A;  1GB4 A;  1Q10 A;  1GB1 A;  1MVK A;  1FD6 A;  1ZXH A;  1IGC A;  1HZ6 A;  2K0P A;  2PW9 A;  1XCT L;  2RPV A;  2JZP A;  2LHD A;  4OZC A;  1PGB A;  1YNT E;  1HEZ E;  1JML A;  1KH0 A;  4OZB A;  2JU6 X;  2LHE A;  4GLS C;  1C9F A;  4HJG E; 
#chains in the Genus database with same CATH topology
 1IBX A;  4G3X B;  3RZF A;  2D3C A;  4JPS A;  3U8Z A;  5DPW A;  3L13 A;  2LAS A;  4TV3 A;  3P2B A;  5FR6 A;  3U4E G;  2WXJ A;  4FJY A;  2LVQ A;  2WXP A;  1WM2 A;  2QIL A;  2KDM A;  1WXQ A;  3M62 B;  2WDT B;  2MP2 B;  1SBB B;  3A1Q B;  5AZG A;  1XO3 A;  3N3K B;  2ZW1 A;  1L0V B;  1OEY A;  2QCZ A;  1P7E A;  4RMA A;  2D3A A;  4XX5 A;  4C00 A;  1KOT A;  4A8X C;  1NYQ A;  3M63 B;  1R4N B;  2QHO A;  2V9H A;  3L4P A;  3AN1 A;  1KFY B;  1TKE A;  2Z0E B;  5IKC M;  1ET6 A;  3AE4 B;  5I4D A;  2WLB A;  2QSD A;  3U30 A;  1SE3 A;  1FPY A;  2K9X A;  3IAS 1;  5D3I B;  2G4S A;  1IBX B;  3Q3O C;  3I57 A;  3EGR A;  2AX5 A;  4KGT A;  1V1P B;  3L16 A;  2N9L A;  1YN4 A;  1LO5 D;  4WUR A;  2UU7 A;  1ESF A;  3U7Z A;  1ZXI A;  3ZJU A;  2L32 A;  4R3D A;  4W9L A;  4A20 A;  5LNK 1;  1WGD A;  3RNF C;  4NAW B;  1FFU A;  2BB5 A;  3N32 A;  4G0N B;  1Q10 A;  4II2 B;  1JWU D;  1ZE3 D;  2C9W B;  2AEH A;  2WXQ A;  4LJO B;  3UGB B;  3DHH C;  3GS2 A;  1YJ1 A;  1JWM D;  2MH7 A;  3SHQ A;  1VZ8 A;  2BTE A;  1R7S A;  1XLO A;  4ANX A;  1NI2 A;  3NVW A;  1N6Z A;  1V1P A;  2NPT A;  2RD0 A;  1WYG A;  2BKF A;  2DLB A;  3HM6 X;  3SFD B;  4LDT D;  2EEL A;  3HHM A;  3R3M A;  4DXA B;  4ZRK A;  2NMQ A;  2RMM A;  3ZDM C;  3EEC A;  2I1J A;  5AEK B;  2JF5 A;  2IGG A;  4OVU A;  3AE9 B;  3UIN B;  2KWD A;  1I4P A;  2KQ4 X;  3ZLZ A;  2WXF A;  3PZD A;  1XCQ L;  1LQB A;  2ZW0 A;  2LUE A;  3GE8 C;  2Z0D B;  4E71 A;  4P7I A;  4WJP A;  2D3G A;  3KUC B;  1P7F A;  4FN2 A;  4W9J A;  4BOS C;  1ZKH A;  4ZDV A;  1I4Q A;  4OVZ A;  4TMA B;  1VD2 A;  3BVG A;  5BYQ A;  3AV8 A;  3Q69 A;  4IM2 A;  5EE9 A;  2OHF A;  4RGM A;  3B9J A;  2C5L C;  2XEW A;  3ZQ4 A;  2IO0 B;  5CHV C;  3RMK C;  4AWJ A;  4HXD A;  3W5U B;  3PS6 A;  4HEA 1;  1LFD A;  3B2G A;  3TEW A;  1AN8 A;  5DPS A;  4GIV A;  2J4X A;  1WM3 A;  1WSP A;  2CHW A;  1JCK B;  1ZGU B;  1LM8 B;  1TKG A;  1PGB A;  3DBL I;  3Q14 C;  3TMP B;  3SU8 X;  4W9H A;  3AU4 A;  1JML A;  1V97 A;  2WXI A;  2KLC A;  2BYV E;  4HDQ A;  3TL5 A;  3TUO A;  1WJ6 A;  1T0Q C;  1M4V A;  1F9J A;  4C7Y A;  2MBO A;  4TSS A;  2OJR A;  1WX9 A;  4BBN F;  4A90 A;  4LNN A;  1HZ5 A;  3H6N A;  3L17 A;  4DBG A;  2B3A A;  2QMT A;  1D5X C;  3ML9 A;  3FIL B;  4NNJ B;  1NEN B;  4EZJ A;  4KKI A;  1V9J A;  3ZGZ A;  1A70 A;  1OTR B;  1WE6 A;  2DYB A;  3AEB B;  3ZKJ C;  2K25 A;  2WXM A;  4A9A A;  4GB9 A;  3MC0 B;  2WYQ A;  1DOX A;  3HRD D;  2DZJ A;  3KWL A;  1K51 A;  1FRD A;  3ZDT A;  2A4Z A;  3GB1 A;  4EEW A;  4BKS D;  3WAM A;  2LEK A;  3RI7 C;  2AQ2 B;  1UD7 A;  4ARI A;  4HCP B;  5G55 A;  1FNV A;  3Q2A C;  4MM3 A;  1GPX A;  2JVC A;  2DX5 B;  3OJ4 B;  1Q5W B;  2KWC A;  1WGR A;  3PSE B;  4KIK B;  2LGI A;  4C7Z A;  1YX6 B;  3B0A A;  1SJH D;  1EM7 A;  2G4D B;  3QC8 B;  1ZPS A;  3FIL A;  5L83 A;  1LXD A;  3BVM A;  3APF A;  2K6Q A;  2VH2 A;  4A3P A;  2JXX A;  2Y5B B;  3OWE B;  3WAN A;  3QIJ A;  2K8C A;  3VR9 B;  3KQ4 A;  3IHP C;  1RRB A;  4K7U A;  2REX A;  5BYS A;  1Z2M A;  4MJS B;  3RFZ B;  5HI1 A;  2BKR B;  4JLC A;  2LJI A;  2W9N A;  3HUI A;  4LCD E;  3Q3F A;  3L0W B;  2BWE S;  4W9I A;  4WWM A;  1MPE A;  2MP2 A;  4MGK E;  3P42 A;  4W9D A;  2QC8 A;  3Q8A A;  1PGX A;  4IM3 A;  1EUV B;  2DNF A;  2X8X X;  4HDO A;  4ZRJ A;  4TUU A;  3Q8B A;  2HTH A;  1D3Z A;  2J53 A;  3UI3 A;  1YJJ A;  2KQ7 A;  3W5V B;  4MSQ B;  2KDB A;  1HA5 A;  3PV1 A;  2ZVO A;  4I6N B;  3AE2 B;  1K50 A;  4GMV A;  3QWZ B;  1WMH B;  3ONS A;  3Q6B A;  3ZIM A;  2ZNV C;  4N6E B;  1WXM A;  4ICV A;  4MH8 A;  4NQK E;  2N1W A;  3EUB 2;  2JYT A;  2KC1 A;  1TKY A;  4BFR A;  5J18 A;  3KH0 A;  4ZYS A;  4FUL A;  2HJ8 A;  3IT4 B;  4EZL A;  3AEF B;  2GBK A;  1MJD A;  4KVG B;  4P6V F;  3RD2 A;  4AP4 C;  1MI0 A;  2KXJ A;  2PMV A;  2KVR A;  3AE6 B;  2I38 A;  2K3U A;  2IO2 B;  1TY0 A;  1ISN A;  2LZ6 A;  3DVN V;  1JRP A;  1E5W A;  2IND C;  3LJ3 A;  3V61 A;  2AWT A;  4ZRQ A;  2KLG A;  4RF0 A;  5LXI B;  1ENF A;  2LI5 A;  1J0G A;  4HLE A;  2KJH B;  1NI3 A;  5H8Y E;  3OG5 A;  3PZ7 A;  4DWF A;  1EU4 A;  5D2M B;  1J7A A;  5IOI A;  4OZB A;  4G11 A;  1BXT A;  3RCZ A;  3VTU A;  1C9F A;  2R61 A;  2CS4 A;  1FXI A;  3JW0 X;  3MTN B;  1YQ3 B;  1E8Z A;  1QKZ A;  4CHK A;  4L2Y A;  2JQR B;  1VZ7 A;  4ZHP A;  3H7P B;  4KKJ A;  2DYM A;  3A33 B;  2JZZ A;  1AWD A;  4H2A A;  2BS3 B;  5D94 A;  1HXY D;  2OED A;  3RN9 C;  2LFI A;  3VUW A;  1QOB A;  3ZXV A;  4C56 C;  1V6E A;  2KD0 A;  2IYD B;  4DDI D;  3IBE A;  3KYD D;  1AW7 A;  1D6E C;  3A4S C;  1YMH E;  4DHJ D;  1YQB A;  4P1B C;  2D3B A;  2KDF B;  5IO9 A;  3NVV A;  2BYT A;  1T6B X;  2AL6 A;  3DBH I;  4OHJ A;  4F7Z A;  2WXO A;  2N9K A;  4REZ A;  3ZRF A;  1ZP0 B;  2ICI A;  2NR2 A;  1VZ6 A;  2ZNV B;  4HWI B;  3Q8E A;  1MG8 A;  3VVW B;  2QJL A;  1EF5 A;  4HRS A;  2AL3 A;  4BAX A;  3VH4 B;  1XXG A;  4FHJ A;  2INN E;  5G5H A;  4ZRI A;  2IO1 B;  2CJO A;  1C79 A;  3AE1 B;  2PEA A;  1L0Y B;  2NBU A;  3C0R B;  2O6V D;  2C7H A;  2WS3 B;  1XLN A;  2BBC A;  3LYY A;  2B76 B;  3B08 A;  1I35 A;  2FCM A;  1WWT A;  3N20 C;  3BK1 A;  3DDC B;  2ZZP B;  4JQW C;  4GLS C;  1BT0 A;  3C19 A;  2BVC A;  2C7M B;  2KMA A;  2G1E A;  1TS5 A;  4F1S A;  1E9M A;  2LJ5 A;  4RCO A;  2RDG A;  3EA6 A;  1K52 A;  2DZM A;  4GN1 A;  2JT4 B;  1JRU A;  1FNU A;  1WGG A;  1QQR A;  1T5X D;  4I6P A;  1XD3 B;  4CO7 A;  2IY1 B;  2A5U A;  1T0Y A;  1C4P A;  3TEZ A;  3VRA B;  3DHI C;  3BYT B;  1SE2 A;  1E10 A;  2QIE B;  5JH5 C;  5AUI A;  4RGN A;  2GOW A;  5AUK A;  3U7D A;  4O1N A;  2O6V B;  2V1Y A;  4WWP A;  3UIO B;  1OEY J;  5E6J A;  3NS1 A;  4JWU C;  1E7U A;  3W1Y A;  1E0Z A;  1WJU A;  2KNB A;  1MG4 A;  3BVZ A;  1V49 A;  1HE8 A;  3KWV A;  1U4A A;  2L8J A;  2SEB D;  1IPG A;  2PLP A;  3AMZ A;  3IAM 1;  4Q2J A;  1EWY C;  2D5G A;  1WJN A;  1WXV A;  1NDD A;  4XDC A;  3PVL A;  4RF1 A;  1Z5S B;  4TKN A;  4NAW A;  4FLH A;  4ANU A;  5FK9 C;  1IGC A;  4XE0 A;  2I1K A;  2CHX A;  4M01 A;  1YD8 U;  4W9G A;  1L0X B;  4K7S A;  2LHD A;  2LGS A;  2E3T A;  1NVI D;  3WAP A;  3WAO A;  1KH0 A;  3N1Z C;  1CQV A;  1B9R A;  4LDT B;  3TCA A;  1XLP A;  4HJG E;  3FAH A;  4W9K A;  1UGM A;  4GDK A;  3RZW C;  2WDR B;  2MBH A;  4HKQ A;  4G50 A;  2L00 B;  2M0A A;  4IKG A;  1RFK A;  5IP4 D;  1D4B A;  1SE9 A;  2WX0 A;  4FAD A;  1A5R A;  2YEP B;  1L7Y A;  2J0M A;  3BII D;  2XBB C;  5AZF A;  3ETR A;  1D5M C;  1UZX B;  2BQQ A;  3VUY A;  2MJ3 A;  4WIP A;  1ZDX A;  1L4Z B;  1FEH A;  2BT6 A;  4ANV A;  1C4C A;  4LTU A;  3ZRC A;  4GXB A;  3I5J C;  1GNU A;  3H8H A;  4N59 A;  4AUQ C;  2MCN B;  3P4R B;  4P16 A;  3U52 E;  1L4D B;  4GDK B;  2V0G A;  2L52 A;  2LXC A;  4B9K A;  4PT5 A;  2PIA A;  2JSV X;  3ML8 A;  1C3T A;  2WQY B;  2JWU A;  3RUI B;  1Q0W B;  2LVO A;  4HKZ E;  4C80 A;  3N9Y C;  3EFU A;  4BKS A;  1N63 A;  1K53 A;  4GGQ A;  1TBE A;  5KHO A;  2FCN A;  2O2V B;  4KZ0 A;  4YSY B;  3ZJV A;  3VTW A;  3ZUN A;  2FCQ A;  1WYW B;  1RM6 C;  2FUG 1;  3UQB A;  2IY0 B;  1FD6 A;  3QA8 A;  2XK5 B;  3EFC A;  3V60 A;  2DZK A;  1V5T A;  1XT9 B;  2WDQ B;  1QLB B;  4IC7 B;  3VRB B;  1EF1 A;  1YNT E;  1J19 A;  1N61 A;  1GJZ A;  2KZR A;  1JWB D;  3EHV A;  3A9K A;  1TIF A;  3AM9 A;  1XLQ A;  2W3S A;  2J0K A;  3NVY A;  3R66 C;  2FIF A;  4LK0 M;  5HG2 A;  3R7R A;  1C76 A;  2BF8 B;  3QJZ A;  3NHE B;  1EWC A;  2K22 A;  2RSU A;  3RT3 B;  2LGX A;  2PJH A;  3NJT A;  1WJ4 A;  3ZNH B;  2MSE D;  3W1S C;  1E8W A;  1L2N A;  5TSS A;  1PFD A;  4IW0 A;  1VCB A;  4B6W A;  2L0F A;  2J7Q B;  4USA A;  2OOB B;  4NZL B;  2V4L A;  2KC2 A;  5IAA C;  2N7D A;  1KLU D;  4DDG D;  4IWQ A;  1V1O A;  4FJV B;  1OGW A;  3EC8 A;  1P1A A;  4K3C A;  4OW0 A;  2CKH B;  2ONQ A;  5H92 C;  4JE3 B;  1WRI A;  5EE0 A;  4WJQ A;  1F2R I;  2K1F A;  3A9K B;  2ZVN A;  1SIF A;  2ZEQ A;  5DPR A;  2X38 A;  1X1M A;  3A4R A;  4YSX B;  2N9X A;  1MHH E;  2MBE A;  4N9F 4;  3B2F A;  3AU5 A;  3R2I A;  1ZW7 A;  2Y5C A;  4KDI C;  2JRH A;  1T0S C;  3BYY B;  1F1H A;  2KVZ A;  3Q3J A;  4ASW C;  3X0W A;  1FMA D;  2H88 B;  2MW5 A;  1YJI A;  1OQY A;  1SF0 A;  2KMM A;  3RNE C;  5BYR A;  5JZE B;  2SAK A;  4XYC A;  2O2V A;  3VFK A;  1KRH A;  3AEC B;  1K8R B;  1GB1 A;  2KTF A;  1FXT B;  5DCN A;  3DBS A;  4NJ6 A;  2BGF A;  2PW9 A;  2EKI A;  3IG3 A;  1NBF C;  1TS2 A;  2G9H D;  1JWA D;  1NYR A;  2G45 B;  1E6E B;  4FBJ B;  2TSS A;  3A9J A;  3MC8 A;  3R8B A;  1HEZ E;  1OQQ A;  3X23 A;  3VR8 B;  2LHE A;  4LNO A;  2DAJ A;  5JHA A;  2BYE A;  4KSL C;  1PYW D;  3PLV A;  4ICU A;  3ZW3 A;  3N1X C;  1MHX A;  2RGF A;  4YTN B;  1HTQ A;  1SGH A;  2YVC A;  3J9C A;  4XDD A;  5C1Z A;  3WCQ A;  3OAW A;  3S2A A;  4US9 A;  2DWQ A;  5CHW A;  3Q3N C;  1TJE A;  3PT2 B;  2W55 A;  1AYF A;  2V3P A;  1C4A A;  3H7S A;  4M00 A;  1ACC A;  5D7G A;  3A9J B;  2Q5W D;  3ZTD A;  2DYO A;  1TS4 A;  3NZU A;  2NBW B;  2WU2 B;  1WMH A;  1PUT A;  5CX3 A;  2LXA A;  3MC9 A;  4MDK E;  1ZDV A;  3O65 B;  1TZ1 A;  2NPT B;  2KOX A;  1GOZ A;  4BKT A;  4IOI E;  1TTN A;  5HKH A;  3Q8F A;  1H8C A;  1KF6 B;  1WI0 A;  2ZJD A;  2M4N A;  2KAN A;  4ZOH C;  1WE7 A;  1UBQ A;  3DWG C;  1FIQ A;  1Q1O A;  4HVB A;  3PRE A;  1L6V A;  4AJW A;  1L5P A;  1GB4 A;  2N9E B;  1YN5 A;  2KFK B;  4HCN B;  3LXF A;  3ECI A;  2VH1 A;  3DBR B;  3DBH B;  1EU3 A;  4OZC A;  4ITK A;  1I4G A;  4L1B A;  4FA6 A;  3ZNI D;  3DVN U;  2O6V A;  3DPD A;  3MJ5 A;  2JU6 X;  3P4Q B;  1YIW A;  2ASQ A;  2LGD A;  5EE1 A;  3P63 A;  1FCC C;  1FCL A;  1WF9 A;  4DHZ B;  1E90 A;  2KFJ A;  1I4H A;  1RFA A;  4B0M A;  4PYU A;  1RLF A;  1PQS A;  4GDL A;  1UF0 A;  4WWN A;  2N1V A;  4BKG A;  1KLG D;  2GMI C;  1R4M I;  1TYG B;  2FNJ B;  2MQJ A;  4KSK C;  3VH3 B;  2LGY A;  3CIR B;  4MGZ E;  5IA7 A;  4QAY A;  3ZNG C;  2MJE A;  3AEA B;  4ARC A;  2H89 B;  3I3T B;  1QOG A;  3TJP A;  5E6N A;  4RGO S;  4S17 A;  3SR6 A;  1WIA A;  2PE6 B;  4KGR A;  1ZUD 2;  2N9P C;  2WXK A;  2ZCC A;  3T3O A;  3DOW A;  4S0R A;  4YT0 B;  2KJ6 A;  1MFW A;  2WXG A;  2AYO B;  3I9V 1;  2LD9 A;  3DBR I;  2WNM A;  2W82 A;  2YLM A;  3QQ8 B;  2MLB A;  1G6J A;  2LRU A;  2HTM E;  3PGE A;  1C1Y B;  2WXN A;  2Z59 B;  4ZYN A;  1SB3 C;  2IPK D;  3P4P B;  1ET9 A;  4IG7 B;  2BWF A;  2BYF A;  2IO3 B;  5BMI A;  2BB6 A;  3W9C B;  4HJK A;  4NPN A;  3NUH B;  2JWZ A;  3GP7 A;  3K9P B;  4HPL B;  2RR9 A;  2J0J A;  2L7R A;  4MT5 A;  3BY4 B;  4MEL A;  1ZXH A;  2N4F A;  1R4M B;  4BOZ B;  3UQA A;  5TR5 A;  1DOY A;  2FBW B;  4US8 A;  2AQ3 B;  1YOV B;  2BS4 B;  4K1R B;  2KWU B;  4AQ7 A;  3VTV A;  1TZO A;  2INP E;  2M1M A;  1WFY A;  3VAW A;  2R2Q A;  2AQ1 B;  1HTO A;  3HVD A;  4C4V A;  2KO3 A;  1DOI A;  1RAX A;  4XGA B;  3TIX A;  1HQR D;  3I63 C;  2D10 A;  2W3R A;  3AEG B;  3QCA A;  2VRR B;  4IUM B;  1QF6 A;  4JIO U;  5J2R A;  4XC2 A;  5CHF A;  1E7V A;  2WXR A;  1DGJ A;  4EFO A;  1GUA B;  1IGD A;  2NVU I;  3SDL C;  5GMV A;  3KUZ A;  2PKO A;  1I42 A;  2DAF A;  4KDL B;  2QDF A;  2LUM A;  3MP9 A;  2L05 A;  1GC6 A;  3CSF A;  2L83 A;  4HPM B;  1WX7 A;  4GSW A;  5J17 A;  4MEM A;  1T3Q A;  1VJK A;  1QOA A;  4YWG G;  3MFG A;  2KQS A;  4II3 B;  4GU2 A;  4E3C A;  3V6E B;  4MAC A;  1STE A;  4YSZ B;  2DEN B;  1KTK A;  2ON8 A;  4K3B A;  1I7H A;  3T3N A;  3TSS A;  3T9L A;  3U2S C;  2G3Q B;  4OVV A;  4URK A;  1ZOY B;  4PK1 A;  2L1A A;  2PVG C;  3BIN A;  4CYE A;  3PTF C;  2LMC A;  1ROE A;  2K0P A;  2K8H A;  1OQR A;  2KX3 A;  2D11 A;  3UIP B;  1XCT L;  2RPV A;  3ALB A;  1WXA A;  1CJE A;  4FHK A;  1FNW A;  5KHQ A;  2V3S A;  4ACF A;  3APD A;  3PRP B;  1LGR A;  1N60 A;  4BVU C;  2ZPY A;  1M94 A;  4DXF A;  1N5W A;  1KJT A;  5BMH A;  2JY6 A;  4KIK A;  2RPQ A;  4C4V B;  4EKU A;  4TQ0 A;  1KLV A;  3BWU D;  1S1Q B;  2NTT A;  3JYU A;  3A1Q A;  4B95 A;  4DK5 A;  3SEB A;  2CU3 A;  1GC7 A;  1OFF A;  1V8C A;  3DBL B;  3PHW B;  3TEY A;  1E8X A;  2RDH A;  3P1M A;  3IFW B;  1WRD B;  2CJN A;  2M0X A;  2KK8 A;  3VQI A;  4OZA A;  4YXD B;  3GZN I;  3CST A;  2D2Q A;  3WAL A;  4WAA A;  5C2T B;  4WQM A;  2L0T A;  3RYT A;  2DHZ A;  2JXT A;  1JWS D;  4YTP B;  1J8C A;  2M8S A;  4JGH B;  4LJP B;  4BZA A;  1FM0 D;  3VXW A;  3RNA C;  4EOY A;  5FR3 A;  5MPO A;  2WX1 A;  3MHZ A;  5CTR C;  3PZ8 A;  5LLI A;  1PDX A;  3PPA A;  2MJD A;  5JHB A;  3AB5 A;  2M56 B;  4AOF A;  4M8N A;  1V5O A;  3RUL A;  5E6P A;  2D07 B;  2BPS A;  2R2O A;  1TS3 A;  4K7W A;  2HD5 B;  3QK0 A;  2C60 A;  3GZN B;  3KYC D;  4EUT A;  2KHW B;  2QEJ C;  2N7E A;  2KFK A;  4IDI A;  5AZH A;  3APC A;  3KVF B;  1UEL A;  4PS7 A;  2ZPN A;  3RNG C;  5LXH A;  1T0R C;  2J42 A;  1HZ6 A;  1NEK B;  1I4X A;  5DPT A;  4UDU C;  3HK0 A;  3TEX A;  1YX5 B;  2V3N A;  3GE3 C;  3ZO5 B;  4X57 B;  3H1U A;  1V81 A;  2WHI A;  4XZ4 A;  1XEE A;  3PHX B;  4N58 A;  4A6Q A;  1S3S G;  4GDL B;  3AEE B;  3V3X A;  4ZHO A;  3QX1 A;  1B1Z A;  4EE2 A;  3W2D A;  3UF8 A;  4W9C A;  1SJE D;  3K9O B;  4MSM B;  2INC C;  3ZJT A;  4L23 A;  1JW9 D;  3JSV A;  4KGS A;  2V4I B;  2MBQ A;  3DQV A;  5G2N A;  1QOF A;  3AI5 A;  4M02 A;  2WDV B;  1AAR A;  1Y56 A;  1P98 A;  2KN5 A;  3AE5 B;  1WR1 A;  1UUP A;  3CMM B;  1H4R A;  3AUL A;  2KMC A;  2W54 A;  4W9F A;  4E74 A;  3C8Y A;  2LVP A;  4P1C C;  2IJ0 A;  2GB1 A;  4NJ7 A;  1DYQ A;  5JXV A;  4DQO C;  3TBL D;  1JAL A;  1PGA A;  2KWV B;  3V62 A;  2Y5P A;  4NY0 A;  1N62 A;  1TGZ B;  2NCN A;  1WGH A;  4MGI E;  1F77 A;  3DVG X;  2YEP F;  1WH3 A;  5E6O A;  2JRI B;  4NJC A;  4PYZ A;  2FID A;  3JSV B;  3ABV B;  3WIM A;  3ZNZ B;  2EMT A;  2JX5 A;  2PTL A;  2GRI A;  3AED B;  1WGK A;  1WXS A;  4JX1 C;  1MVK A;  2JZ3 B;  3NRZ A;  1JRO A;  2K5P A;  5G5G A;  4XWT A;  4DXG A;  1CK1 A;  2BS2 B;  2KDE B;  5D6J B;  1VDV A;  2JPH A;  3SFE B;  2KAJ A;  4PS8 A;  4A3O A;  1GAQ B;  3SD5 A;  2GBJ A;  3ENE A;  1SEB D;  4ZRP A;  1WX8 A;  5C3J B;  2KJR A;  1CMX B;  2KT7 A;  3NY5 A;  1UGJ A;  2RDB C;  2OJW A;  3NS8 A;  2Z8L A;  3DWM A;  1SXT A;  2L3Z A;  4EZK A;  2KAC A;  3VDZ A;  2WXL A;  4GOC A;  4NAM A;  3ZVV A;  3H7P A;  2KDI A;  4B0E A;  1WZ3 A;  2ZCB A;  1FO4 A;  2CU1 A;  2JUO A;  1EO6 A;  2HJ1 A;  2KTR B;  2GI9 A;  3ZYY X;  4YTM B;  3NZ3 A;  3O13 A;  1I4R A;  4KX6 B;  3FC4 A;  2C7N B;  3NG0 A;  2PE9 A;  1CZP A;  2LRW A;  1XF5 L;  1RYJ A;  1FXA A;  4LNK A;  1TY2 A;  5GXG B;  4HK2 A;  3LDZ E;  1F0Z A;  3LB8 C;  1BML C;  4JL9 A;  1F2R C;  3ZXR A;  2FAZ A;  1SIJ A;  4J6I A;  4RH6 A;  1YN3 A;  1V80 A;  4FXC A;  4MGY E;  1WGY A;  1WY8 A;  4M0W B;  5FKA C;  2IGH A;  1N5X A;  2NBV B;  2N0S B;  4KV2 A;  2BW2 A;  2WXH A;  4RGT A;  2XK5 A;  2KTR A;  1IUE A;  3AE7 B;  1WZ0 A;  3WA0 A;  4RFB A;  4WJO A;  1VLB A;  3FKY A;  3Q3M C;  1E8Y A;  4WJN A;  3MHS D;  3D32 A;  4J3O D;  1V2Y A;  5EE3 A;  3DCG A;  4DHZ E;  3N1Y C;  3NVZ A;  4HPP A;  3N30 A;  1UWM A;  2HDE A;  4IM0 A;  2FE8 A;  1UH6 A;  1UWX A;  4FJZ A;  4YL8 A;  1F52 A;  3KUD B;  2MX2 A;  2WU5 B;  4M0W A;  3B1L X;  5HFY A;  2KYW A;  1V86 A;  4PS3 A;  1GG3 A;  2KKC A;  3V6C B;  3VUX A;  5IN7 A;  4W9E A;  1VR9 A;  2J52 A;  3QAR A;  2I2Y A;  3RNC C;  2GLS A;  4D2K A;  2WWZ A;  4TQ1 A;  2MWS B;  2K6D B;  3GOE A;  1SE4 A;  3KW5 B;  1D5Z C;  1SSN A;  2XNA C;  2IGD A;  4LNI A;  4MJS A;  2WGS A;  3E56 A;  1TT5 B;  2PPH A;  2L76 A;  1VRA B;  2IZV B;  2MA9 B;  5C23 A;  1UNS A;  3ZTC A;  1QT9 A;  3DVG Y;  2PVO D;  3RNB C;  1R4N I;  3URY A;  2K8B A;  3PRM B;  2KX0 A;  3L54 A;  4LLG M;  4MH0 E;  4JWS C;  4RM8 A;  3AH7 A;  3AXC A;  2UYZ B;  3NZS A;  3AE3 B;  3HM3 A;  4WWO A;  3BK2 A;  2UWQ A;  1WR6 E;  3CF6 E;  2LWP A;  5T8I A;  3HVZ A;  1BUI C;  3IXS A;  3R7Q A;  2JZP A;  5L95 C;  3E9S A;  3QAQ A;  3MJW A;  3M95 A;  2JYE A;  4RM9 A;  1Y8R C;  1QIL A;  2GBR A;  1IYF A;  3PLU A;  3NOB A;  2MHJ A;  1JQ4 A;  3L08 A;  3RPF C;  4CQN A;  2VZK D;  3BZD B;  3W1S A;  3AE8 B;  1KM7 A;  3IVF A;  4IWO A;  2NTS A;  2N7J A;  1P0R A;  3L10 B;  2VZK B;  2NS5 A;  2XN9 C;  2IBI B;  5BMG A;  2FUH B;  4DHJ B;  1RWS A;  1FRR A;  1P9D U;  1QZE A;  3CWI A;  2WP9 B;  2GBN A;  1C78 A;  1P3Q U;  3IT6 B;  5HHD G;  3KLS X;  4M8M A;  2EMS A;  1C77 A;  1XQQ A;  1J7C A;  2ACZ B;  3VHT C;  2CR5 A;  2MEK A;  2FCS A;  2DZI A;  2MBB B;  1J7B A;  2M17 A;  4ANW A;  2M19 A;  2KN4 A;  3Q8C A;  3QHT A;  3PO0 A;  3HIZ A;  4K81 A;  4NQL B;  2HE7 A;  2DBY A;  2EKE C;  3V05 A;  4A55 A;  1YQ4 B;  4MM3 B;  3H9D A;  3P4S B;  5EDS A;  1E7P B;  2MRP A;  4WH4 A;  3R2T A;  4F8C B;  4HRO A;  4LNF A;  3PRZ A;  1IP9 A;  4WAF A;  4WQO B;  4RNA A;  4IWP A;  1L6U A;  3DHG C;  3M3J A;  2K39 A;  2GBM A;  4KZC A;  2Y3A A;  5D3D A;  3OLM D;  1UBI A;  4I6L B;  2E6X A;  3T8M A;  5BO4 B;  1FFV A;  4BBN C;  2CHZ A;  4AJY B;  4AS1 A;  3JVZ X;  2IDY A;  3OJ3 A;  4XWW A; 
#chains in the Genus database with same CATH homology
 1IBX A;  2R61 A;  1PYW D;  4A6Q A;  1FXI A;  4JPS A;  4GDL B;  1MHX A;  1YQ3 B;  4YTN B;  3U4E G;  3AEE B;  1QKZ A;  2WXJ A;  3V3X A;  4L2Y A;  4ZHO A;  2JQR B;  1VZ7 A;  2WXP A;  4ZHP A;  1B1Z A;  2KDM A;  2QIL A;  3J9C A;  1WXQ A;  4EE2 A;  3W2D A;  4XDD A;  3WCQ A;  1SBB B;  4KKJ A;  2DYM A;  1SJE D;  1AWD A;  4H2A A;  1XO3 A;  2DWQ A;  4US9 A;  3ZJT A;  2ZW1 A;  1L0V B;  4L23 A;  1JW9 D;  1TJE A;  1P7E A;  2BS3 B;  2W55 A;  1AYF A;  2V3P A;  4A8X C;  1HXY D;  1C4A A;  4KGS A;  1NYQ A;  2V4I B;  1QOF A;  2OED A;  2LFI A;  1ACC A;  3AN1 A;  2WDV B;  3L4P A;  5D7G A;  1Y56 A;  1QOB A;  1KFY B;  4C56 C;  3AE5 B;  1TKE A;  2Q5W D;  1UUP A;  1ET6 A;  3AE4 B;  5I4D A;  2DYO A;  2WLB A;  2QSD A;  1TS4 A;  2W54 A;  1AW7 A;  1D6E C;  1SE3 A;  2K9X A;  3IAS 1;  1YMH E;  5D3I B;  1IBX B;  3C8Y A;  2WU2 B;  2IJ0 A;  1PUT A;  2GB1 A;  5JXV A;  1DYQ A;  1ZDV A;  3NVV A;  2BYT A;  4DQO C;  3I57 A;  1T6B X;  3EGR A;  2AX5 A;  1JAL A;  4KGT A;  4OHJ A;  1PGA A;  1V1P B;  2Y5P A;  1GOZ A;  1N62 A;  2N9L A;  2WXO A;  4IOI E;  1YN4 A;  2N9K A;  4REZ A;  1LO5 D;  1ZP0 B;  2ICI A;  4WUR A;  1F77 A;  1VZ6 A;  3Q8F A;  2YEP F;  3Q8E A;  1ESF A;  2QJL A;  1KF6 B;  3U7Z A;  1ZXI A;  3ZJU A;  4HRS A;  4ZOH C;  2L32 A;  4R3D A;  1XXG A;  5LNK 1;  4NJC A;  2INN E;  3DWG C;  1FIQ A;  4NAW B;  1FFU A;  2BB5 A;  3ABV B;  2JX5 A;  5G5H A;  1L6V A;  2PTL A;  2CJO A;  1C79 A;  1L5P A;  2GRI A;  3AED B;  1WGK A;  3AE1 B;  1GB4 A;  1Q10 A;  1L0Y B;  1JWU D;  1MVK A;  3NRZ A;  4JX1 C;  1JRO A;  1YN5 A;  2K5P A;  1ZE3 D;  5G5G A;  2WXQ A;  4XWT A;  4DXG A;  3LXF A;  1CK1 A;  2BS2 B;  2WS3 B;  1XLN A;  2BBC A;  3GS2 A;  1EU3 A;  3LYY A;  1JWM D;  4OZC A;  2B76 B;  2MH7 A;  4ITK A;  1VDV A;  1VZ8 A;  1WWT A;  1I4G A;  4L1B A;  3SFE B;  2KAJ A;  2BTE A;  1R7S A;  3BK1 A;  1XLO A;  3MJ5 A;  2JU6 X;  1GAQ B;  3P4Q B;  4GLS C;  3NVW A;  1SEB D;  1V1P A;  5EE1 A;  4ZRP A;  1WYG A;  2G1E A;  1TS5 A;  2DLB A;  5C3J B;  3P63 A;  1E9M A;  1FCC C;  4RCO A;  3SFD B;  2RDG A;  3EA6 A;  2EEL A;  1FCL A;  1K52 A;  1UGJ A;  1I4H A;  4B0M A;  2Z8L A;  3DWM A;  1FNU A;  1SXT A;  1QQR A;  1T5X D;  2NMQ A;  2KAC A;  2RMM A;  1KLG D;  2WXL A;  1TYG B;  2IGG A;  3AE9 B;  3CIR B;  2KWD A;  1C4P A;  3TEZ A;  1I4P A;  2KQ4 X;  4NAM A;  2MJE A;  2WXF A;  3VRA B;  3AEA B;  4B0E A;  4ARC A;  2H89 B;  3BYT B;  1SE2 A;  1QOG A;  1E10 A;  1FO4 A;  2QIE B;  1XCQ L;  2ZW0 A;  4RGO S;  5AUI A;  4RGN A;  3SR6 A;  2GI9 A;  5AUK A;  3ZYY X;  4O1N A;  4YTM B;  4KGR A;  3NZ3 A;  1ZUD 2;  3O13 A;  2WXK A;  1I4R A;  4KX6 B;  3FC4 A;  1P7F A;  3NS1 A;  5E6J A;  3T3O A;  1CZP A;  4JWU C;  1XF5 L;  4YT0 B;  1RYJ A;  1E0Z A;  1FXA A;  2WXG A;  1TY2 A;  5GXG B;  3BVZ A;  1I4Q A;  3I9V 1;  4OVZ A;  3KWV A;  2WNM A;  4TMA B;  2W82 A;  3BVG A;  5BYQ A;  3LB8 C;  1F0Z A;  3AV8 A;  3Q69 A;  1BML C;  2SEB D;  1F2R C;  5EE9 A;  2OHF A;  4RGM A;  1SIJ A;  3B9J A;  2PLP A;  2HTM E;  3ZQ4 A;  3AMZ A;  4RH6 A;  1YN3 A;  2WXN A;  3IAM 1;  4Q2J A;  1EWY C;  1SB3 C;  2IPK D;  4FXC A;  3P4P B;  1ET9 A;  2D5G A;  3W5U B;  4HEA 1;  5FKA C;  2IGH A;  1N5X A;  2N0S B;  5BMI A;  4XDC A;  2BB6 A;  3W9C B;  3NUH B;  3B2G A;  2BW2 A;  2WXH A;  4RF1 A;  3GP7 A;  4RGT A;  3TEW A;  1AN8 A;  1IUE A;  3AE7 B;  4MT5 A;  5FK9 C;  1ZXH A;  1IGC A;  4XE0 A;  4RFB A;  2J4X A;  1WSP A;  1VLB A;  1JCK B;  1L0X B;  2FBW B;  1DOY A;  2LHD A;  1TKG A;  1PGB A;  4US8 A;  2AQ3 B;  2E3T A;  1NVI D;  2BS4 B;  4J3O D;  4AQ7 A;  5EE3 A;  1JML A;  1V97 A;  2WXI A;  1KH0 A;  3NVZ A;  1CQV A;  1B9R A;  1TZO A;  2INP E;  1UWM A;  2AQ1 B;  3TUO A;  2HDE A;  1XLP A;  2FE8 A;  4HJG E;  3FAH A;  1UWX A;  3HVD A;  1M4V A;  1DOI A;  4C7Y A;  2WDR B;  1HQR D;  4HKQ A;  2W3R A;  3AEG B;  4TSS A;  2M0A A;  4A90 A;  4IKG A;  2WU5 B;  1RFK A;  1QF6 A;  1D4B A;  1HZ5 A;  4M0W A;  2YEP B;  3BII D;  5HFY A;  2QMT A;  3ETR A;  1D5M C;  1DGJ A;  2WXR A;  2MJ3 A;  4WIP A;  1D5X C;  3FIL B;  1NEN B;  1ZDX A;  4KKI A;  1L4Z B;  1IGD A;  1FEH A;  2BT6 A;  3ZGZ A;  2PKO A;  1C4C A;  1A70 A;  4LTU A;  1VR9 A;  2J52 A;  3AEB B;  2LUM A;  2I2Y A;  3MP9 A;  4D2K A;  2WXM A;  2L83 A;  4A9A A;  3H8H A;  3MC0 B;  1DOX A;  4N59 A;  3HRD D;  3KWL A;  4TQ1 A;  1T3Q A;  3P4R B;  4P16 A;  1K51 A;  3U52 E;  1SE4 A;  1QOA A;  1FRD A;  1D5Z C;  1L4D B;  1SSN A;  1VJK A;  2IGD A;  2XNA C;  4GDK B;  3GB1 A;  3MFG A;  4YWG G;  2V0G A;  2L52 A;  2LEK A;  4PT5 A;  2AQ2 B;  2JSV X;  2PIA A;  2WQY B;  4ARI A;  2JWU A;  4MAC A;  1STE A;  4HKZ E;  1FNV A;  3E56 A;  3N9Y C;  4C80 A;  4YSZ B;  1GPX A;  1KTK A;  1VRA B;  2ON8 A;  1N63 A;  1K53 A;  1UNS A;  2LGI A;  4C7Z A;  1I7H A;  3T3N A;  1QT9 A;  2PVO D;  3TSS A;  1SJH D;  1EM7 A;  3URY A;  3U2S C;  4YSY B;  3ZJV A;  1ZPS A;  3FIL A;  4LLG M;  1ZOY B;  4JWS C;  3AH7 A;  1RM6 C;  3BVM A;  2L1A A;  2PVG C;  3AE3 B;  2FUG 1;  3BK2 A;  1FD6 A;  2LMC A;  1ROE A;  3OWE B;  2K0P A;  1OQR A;  5T8I A;  3HVZ A;  1XCT L;  3VR9 B;  2WDQ B;  2RPV A;  1BUI C;  3IXS A;  1QLB B;  2JZP A;  3E9S A;  3KQ4 A;  3VRB B;  1YNT E;  1CJE A;  1N61 A;  1FNW A;  2JYE A;  1JWB D;  3AM9 A;  1N60 A;  5BYS A;  1XLQ A;  2W3S A;  3NVY A;  4DXF A;  3RFZ B;  1QIL A;  5HI1 A;  4LK0 M;  5HG2 A;  1N5W A;  1JQ4 A;  1C76 A;  5BMH A;  3RPF C;  4CQN A;  1EWC A;  2K22 A;  2LJI A;  2VZK D;  3BZD B;  3HUI A;  3W1S A;  3AE8 B;  4WWM A;  2NTS A;  2N7J A;  5TSS A;  2VZK B;  4TQ0 A;  1MPE A;  2XN9 C;  1PFD A;  5BMG A;  3BWU D;  2NTT A;  3P42 A;  4USA A;  3Q8A A;  4NZL B;  1RWS A;  1PGX A;  2CU3 A;  3SEB A;  1FRR A;  3CWI A;  2WP9 B;  1OFF A;  1V8C A;  1KLU D;  3TEY A;  1C78 A;  2RDH A;  3IT6 B;  1V1O A;  5HHD G;  3P1M A;  3KLS X;  3Q8B A;  2CJN A;  1C77 A;  2J53 A;  3VQI A;  1J7C A;  4OZA A;  4YXD B;  2ACZ B;  4OW0 A;  3UI3 A;  1YJJ A;  2ONQ A;  5H92 C;  4JE3 B;  3W5V B;  1WRI A;  2MEK A;  5EE0 A;  1HA5 A;  1F2R I;  5C2T B;  4WQM A;  2JXT A;  1J7B A;  1JWS D;  3AE2 B;  1K50 A;  4YTP B;  2M19 A;  2X38 A;  1FM0 D;  2KN4 A;  3Q8C A;  1MHH E;  3MHZ A;  4YSX B;  5FR3 A;  4N6E B;  5MPO A;  3B2F A;  3PO0 A;  3R2I A;  4MH8 A;  3PZ8 A;  3EUB 2;  1PDX A;  2JYT A;  2Y5C A;  1TKY A;  2MJD A;  3BYY B;  4ZYS A;  3AB5 A;  2DBY A;  2M56 B;  3IT4 B;  3V05 A;  4A55 A;  1YQ4 B;  1FMA D;  4MM3 B;  2H88 B;  1TS3 A;  3AEF B;  1YJI A;  4P6V F;  1SF0 A;  3P4S B;  1MI0 A;  1E7P B;  2KMM A;  4WH4 A;  2PMV A;  3R2T A;  4HRO A;  5BYR A;  3AE6 B;  2QEJ C;  2I38 A;  2SAK A;  2K3U A;  1TY0 A;  4IDI A;  1KRH A;  4WAF A;  4RNA A;  1JRP A;  1L6U A;  3AEC B;  1GB1 A;  2J42 A;  1HZ6 A;  1NEK B;  1I4X A;  4ZRQ A;  4UDU C;  2Y3A A;  4RF0 A;  3TEX A;  2PW9 A;  5D3D A;  2EKI A;  1ENF A;  1TS2 A;  2V3N A;  2G9H D;  1NI3 A;  1JWA D;  3PZ7 A;  5H8Y E;  1NYR A;  1E6E B;  1EU4 A;  2TSS A;  2E6X A;  3R8B A;  1HEZ E;  1J7A A;  1OQQ A;  1FFV A;  3VR8 B;  4OZB A;  1BXT A;  2LHE A;  4AS1 A;  1XEE A;  1C9F A;  2IDY A;  4N58 A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...