1F2RC

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-ACTIVATED DNASE
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rC00
2I2YA 2J53A 4GLSC 5HI1A 3FILA 1F2RI 1MPEA 2QSDA 1HZ5A 4MACA 2N9LA 2IGGA 4OZBA 5HFYA 1K51A 2JWUA 4HKZE 5BMHA 5HG2A 2RPVA 2ON8A 1GB1A 5HHDG 1MHXA 1YNTE 2LHEA 2PW9A 4IKGA 2LHDA 5BMGA 3GB1A 1IBXA 1XCTL 2KQ4X 1HZ6A 1C9FA 1EM7A 1KH0A 2IGHA 1P7EA 4KGTA 1K52A 3UI3A 1QKZA 2NMQA 5JXVA 2N9KA 1PGBA 2JSVX 2KN4A 1P7FA 2LUMA 2JZPA 2KACA 3FILB 4D2KA 1IGCA 4OZCA 1MVKA 2ZW0A 1K50A 4HJGE 3V3XA 2JU6X 3MP9A 1MI0A 2OEDA 1XF5L 1Q10A 2K0PA 1UWXA 1ZXHA 1K53A 2PLPA 1F2RC 2N7JA 4KGRA 1FCCC 2PTLA 1PGAA 1YMHE 1IBXB 1JMLA 2IGDA 2EELA 4OZAA 2JXTA 2J52A 2GB1A 2GI9A 2ONQA 1FCLA 4KGSA 2ZW1A 1XCQL 1D4BA 2KWDA 2LGIA 1IGDA 1FD6A 5BMIA 1MHHE 4WH4A 1HEZE 1GB4A 2QMTA 2RMMA 2KDMA 1PGXA 4IOIE 2I38A
chains in the Genus database with same CATH superfamily
3DBRB 3PREA 2KJ6A 3D32A 3FKYA 4GLSC 3IG3A 1WRIA 3R66C 3DVNV 2D07B 4P1BC 2KJHB 2C7MB 3NUHB 1T5XD 2IO0B 2N7DA 1WR1A 2OJWA 4CYEA 3SU8X 2IGGA 4OZBA 1TJEA 2XBBC 3WAOA 1MG8A 3ML8A 1S1QB 2K1FA 2ON8A 3TEZA 4BZAA 2WDQB 4C7ZA 1UELA 1N6ZA 2IY0B 4LDTD 4OW0A 3E9SA 3NZ3A 4HPLB 1C9FA 3AB5A 2M8SA 2RDHA 4K3BA 4EZLA 3Q8AA 3DBSA 4RNAA 3RZWC 2KMMA 1I4RA 2MHJA 1WX9A 1YJ1A 1YOVB 2LD9A 1VD2A 2BTEA 2ZVNA 5KHOA 1WJNA 3TMPB 3N20C 1TY0A 1Y8RC 4JPSA 1JRPA 2D10A 4ZRPA 2WP9B 3EECA 1F9JA 4HRSA 5J18A 2MP2B 2D3AA 2KVZA 4KGRA 4O1NA 2LI5A 2MSED 5EE0A 4A6QA 1WGKA 4M02A 4M8NA 5GXGB 3NS8A 2M4NA 4W9DA 3BK2A 2K5PA 4TUUA 4BKTA 3QHTA 3VRAB 5IN7A 4F8CB 3QIJA 2QJLA 3MHSD 2L0FA 4NAWA 4HPPA 1CJEA 1I7HA 1Q5WB 5EE1A 4WH4A 1SBBB 3RZFA 1D5MC 2KK8A 2WHIA 4HCNB 4M0WB 2KVRA 3AM9A 3EFCA 2O2VB 2M19A 3ZTCA 4G0NB 2KTRB 3QX1A 2IPKD 3FC4A 3P4PB 1P1AA 4ZRIA 3VHTC 3MJ5A 2NPTB 4EKUA 2V4IB 5D6JB 2IBIB 2L0TA 2LUEA 2G9HD 3A4RA 3NVVA 2QCZA 1AYFA 2NCNA 2D3BA 1FRRA 1NEKB 3N1YC 2R2OA 2Z0DB 2LGYA 4PS3A 1L6VA 2PE6B 2EMTA 4HVBA 3Q2AC 3RNAC 4WAFA 2O6VD 2Y5BB 3QA8A 5DPRA 1TS3A 1A70A 2L52A 1P7FA 4FADA 4NY0A 3P4SB 2ICIA 4GDKB 1V1PA 4D2KA 3FILB 2GBNA 2KTFA 3L54A 4OZCA 3PHWB 2M17A 3MP9A 2BS4B 2OJRA 4L23A 2NBVB 2PLPA 3VR9B 5KHQA 3QCAA 1WMHA 1J8CA 1RAXA 2M56B 2RDBC 3A9JA 3TSSA 4F7ZA 5E6NA 4ZRQA 1E8YA 4I6NB 2G4DB 2KXJA 4B0EA 1QQRA 2LASA 3AE3B 1C77A 3W1SC 3BVZA 2WS3B 5IKCM 3IXSA 3HM6X 4W9GA 1AARA 3E56A 4GB9A 2WXJA 5HI1A 3ZO5B 2Z59B 4RGOS 3SEBA 4IW0A 3AN1A 3A9KB 3IAS1 5BYSA 3CSFA 1VJKA 1V80A 3R7QA 4ANVA 2PW9A 1WM3A 2UWQA 3APFA 1IBXA 2CHWA 4XDCA 3JSVB 4BKSA 3DCGA 2AQ1B 4K81A 1ISNA 1NENB 4OVUA 4TSSA 5TSSA 4MT5A 4WAAA 2A4ZA 3W9CB 1KJTA 2FAZA 1T0QC 2D2QA 4YSZB 2AL6A 1UGJA 2WXHA 3AU5A 1IGCA 3R2TA 1JWBD 4AOFA 1QOGA 4IWQA 1ZXHA 3A1QA 2NS5A 4BOZB 4JE3B 2KAJA 4AJYB 1WXMA 3UINB 4IM2A 4AUQC 1JALA 2KWVB 1AN8A 1V49A 2LMCA 2WDRB 5JH5C 4NZLB 1YN4A 2KOXA 3ZJTA 1X1MA 4JWSC 4OVZA 5I4DA 1YJIA 2ZCCA 1KRHA 4C56C 3M95A 4FULA 4PS8A 3ZXVA 4C80A 3AE4B 4LK0M 1FEHA 2LVPA 3PGEA 5HFYA 4HKZE 4MELA 3IVFA 1YQ4B 3P4QB 3Q14C 1IPGA 2ZVOA 4MGIE 2KHWB 1OQYA 3ML9A 4C4VA 3PS6A 3DHIC 2KD0A 4GDLA 4S0RA 3HRDD 1EM7A 2KLCA 3IT6B 1V86A 1FRDA 2B76B 4NAWB 2WX1A 1I35A 2XK5A 2KN5A 5GMVA 2W82A 3V05A 1TS5A 4K7WA 1QKZA 4K7UA 1TIFA 3Q3JA 4K7SA 3P2BA 3ECIA 2L32A 3PO0A 2CU1A 1D3ZA 1VR9A 3CWIA 4M01A 3K9PB 3U52E 3GS2A 3L0WB 4XZ4A 3SFEB 2CJOA 4BVUC 2K0PA 1F0ZA 2GRIA 3DBRI 1L4DB 2Z0EB 1G6JA 2FCMA 1V9JA 1OQRA 3OWEB 4MM3B 1N63A 3AE2B 2GLSA 2ZNVB 3ONSA 4IC7B 2JVCA 3ZRFA 2JXTA 3C0RB 1R4MB 4IUMB 3H6NA 2DAJA 1GAQB 1VCBA 1XCQL 2K8BA 3BIID 3DOWA 3AULA 2KKCA 2K3UA 3AE5B 2DYOA 4A55A 1OFFA 1E8XA 2AYOB 3AEEB 2INNE 1MG4A 2C60A 2WX0A 4OVVA 4ARIA 1TBEA 2CU3A 2O6VA 2QEJC 1XLNA 1FFVA 3OLMD 3ZJVA 2WXLA 1WMHB 4II2B 2RPVA 1GB1A 3ZKJC 1MHXA 1SB3C 3A9JB 3KUZA 3OJ3A 3Q69A 3IBEA 3GB1A 4RCOA 4DDGD 4QAYA 3AE9B 4JLCA 4E74A 3C19A 3PSEB 5JHBA 2JYTA 3SR6A 1SE3A 2LWPA 3RNFC 1Q0WB 4NQLB 2NBUA 1D5XC 4IWOA 4GSWA 4X57B 2WXPA 2DZKA 2FIDA 4RM9A 1EWYC 2LJ5A 2LUMA 4CO7A 2CHZA 4NQKE 3GOEA 3FAHA 3BYYB 5AEKB 2YEPF 3TUOA 5IAAC 3VTUA 2JU6X 3VAWA 1MI0A 4ANWA 2BKRB 3ENEA 2GOWA 3QJZA 1OEYA 2E6XA 4KZCA 4IG7B 1CK1A 1WSPA 2HE7A 3ZYYX 1PGAA 2DX5B 2KDIA 1IBXB 3KW5B 3Q6BA 1ZDXA 1WX7A 2KX3A 3APDA 2J52A 1GG3A 3MC8A 1QOBA 3KH0A 2NVUI 4JQWC 1N5WA 2BB6A 4M8MA 5IO9A 3Q8EA 4ZOHC 3Q3NC 3IAM1 2DBYA 1P0RA 2DWQA 5BMIA 3V62A 2Y3AA 3SD5A 3R3MA 4TV3A 1UGMA 2FUG1 1GB4A 4G3XB 4XC2A 1WIAA 1XEEA 1FFUA 2L83A 1I4HA 1HTOA 4AWJA 1UD7A 2TSSA 2KO3A 1RM6C 4WIPA 1HZ5A 4J3OD 3EUB2 5LLIA 3TCAA 5LXHA 3EFUA 4MACA 2MBEA 1U4AA 4MSQB 2WXFA 2IDYA 4HDQA 3ZVVA 1WJ6A 3QARA 1RFAA 1N60A 4HXDA 1TZOA 5DPWA 3Q8CA 3BVMA 3UI3A 1QLBB 3I57A 4FJYA 2Z8LA 5JXVA 1PGBA 2K39A 5LNK1 5G5GA 3RMKC 3DWMA 4DK5A 2I1KA 4KSLC 2GBRA 4EFOA 4IDIA 4MDKE 2WDVB 4HJGE 1WF9A 2WXRA 2JYEA 3RPFC 5L95C 2HDEA 1NI2A 3I63C 4WQOB 4YT0B 4A3PA 4C4VB 4MH8A 1ENFA 4B9KA 4DBGA 2GBMA 2KFKA 2CS4A 4ARCA 1ZE3D 3DHHC 2AWTA 3NVYA 1YJJA 2GB1A 3GE8C 3B2FA 2WYQA 4KIKB 5IP4D 4A20A 2IZVB 4F1SA 3V6CB 1WFYA 3NVZA 3ABVB 4BBNF 2ZNVC 2PIAA 2PE9A 1UH6A 2VH1A 2V3PA 4DXAB 1A5RA 1KFYB 2H89B 1R7SA 3AEAB 5C23A 2BT6A 3H7PB 4DHJB 3KWLA 4MSMB 3AE6B 3L08A 2J0KA 4HWIB 3NZSA 1AWDA 1L5PA 3RNCC 1GOZA 4J6IA 1TY2A 2DHZA 2MBOA 5BO4B 2KJRA 4KKIA 1SE9A 2K25A 2WNMA 3GZNI 4L1BA 1C76A 3PVLA 2HD5B 1UNSA 1FXIA 2J0MA 3WIMA 4MH0E 2V0GA 2PEAA 2LRUA 3Q3FA 1FMAD 3H9DA 4HPMB 4C00A 3NOBA 2O6VB 1FNVA 2N9PC 3M62B 3ZQ4A 1YIWA 4PK1A 5FK9C 2MRPA 4ZHPA 1V2YA 2WXKA 1Y56A 1MJDA 2FE8A 2FCSA 1V81A 2FBWB 1F2RC 3I9V1 4ASWC 4BOSC 1V6EA 2V9HA 2YVCA 2K8HA 2VZKB 4URKA 3RI7C 2K8CA 4MGYE 4I6LB 2WU2B 3TEWA 3ZIMA 4RFBA 3HM3A 3PLVA 5FKAC 4W9HA 4W9LA 2ZW1A 3JYUA 2JRIB 2LGIA 3ZNZB 3DPDA 2J42A 4E71A 3DBLB 2CHXA 4FHKA 4ZYSA 3NRZA 2BB5A 3DBHB 3U8ZA 4W9KA 1T6BX 1B9RA 3PLUA 1WRDB 2LJIA 1L4ZB 3SFDB 5IOIA 4DQOC 2JZZA 2BWFA 3U4EG 2HTHA 3WA0A 3KUCB 2N4FA 3UF8A 2INDC 1N61A 3TIXA 3VUWA 2KT7A 2IO3B 3J9CA 2BYFA 1L0VB 4M00A 1T0YA 1RLFA 3AEFB 2KQ4X 1HZ6A 1GC7A 3HVDA 1STEA 3BY4B 1ROEA 1P7EA 4MGKE 4S17A 2L00B 2KWUB 5CHWA 1V1OA 4YL8A 4PYZA 1R4MI 1SE2A 4FN2A 1XT9B 1UBQA 3T3NA 2KACA 3L16A 1NYQA 3MTNB 3N1XC 4YTPB 2R2QA 4KSKC 3V60A 2OEDA 3TJPA 2WXNA 3Q8FA 1ZUD2 1K53A 1I4PA 4ZYNA 4AQ7A 2IYDB 2V3NA 2G45B 1E7VA 1J19A 1TYGB 4XWTA 5E6PA 3NVWA 1AW7A 2KMCA 1WE7A 3CF6E 3OAWA 1C4AA 1JWSD 1IGDA 1V5TA 2FUHB 4BFRA 1KLVA 1CMXB 1TZ1A 3N30A 5E6JA 5MPOA 4JGHB 1SEBD 3GZNB 2KQSA 3AECB 5J17A 3B08A 2NBWB 1PGXA 2LZ6A 2QILA 4FHJA 4N6EB 4RF0A 1TKEA 1QT9A 1WZ0A 2WWZA 4II3B 1F2RI 5DCNA 4HEA1 2LGDA 3QK0A 4ITKA 1E90A 4CQNA 1Z5SB 2JXXA 1SXTA 1JQ4A 3VFKA 2JF5A 1WY8A 3UIPB 2LHEA 5J2RA 1EF1A 2C7NB 2YEPB 4OHJA 5BMGA 2K22A 2RD0A 4UDUC 1KH0A 1WR6E 1YX6B 2LXCA 2V4LA 4KVGB 2L05A 2DZMA 1GUAB 4A90A 4GGQA 4RF1A 2WLBA 3BZDB 4A3OA 2BYVE 4IWPA 3LYYA 3P63A 2MEKA 2B3AA 2CJNA 2ZCBA 3WAPA 3KYCD 2MCNB 3RNBC 2ZZPB 1ACCA 3AEGB 3KVFB 3UQAA 1E7UA 2WU5B 3LDZE 3ZTDA 3MC9A 1IP9A 1H4RA 1RRBA 1PUTA 1KM7A 1XF5L 4GU2A 1E8WA 3DDCB 2N7JA 1EU4A 2BVCA 2R61A 4W9FA 1J7CA 1C3TA 1D6EC 1F77A 3GP7A 1YMHE 5AUKA 5E6OA 4EZKA 1V8CA 5EE9A 5C3JB 4USAA 3VUXA 4EOYA 4ZRKA 3W5VB 2RDGA 3NS1A 4RGTA 5AZFA 1WGYA 2JX5A 3ZW3A 5JZEB 4ZRJA 2FNJB 3TEYA 3BINA 2JPHA 1ESFA 1C4CA 1SSNA 1C79A 3U7DA 2QMTA 5IA7A 4ICVA 3ZNHB 3PTFC 4W9CA 2AL3A 4HDOA 2J7QB 3TL5A 1XO3A 4W9IA 4NJ6A 1JWMD 2JUOA 3HHMA 5FR6A 3AEBB 2N0SB 2X8XX 4MJSA 4R3DA 3I3TB 2RPQA 2KC1A 1V1PB 4JWUC 4IKGA 1WYGA 2KX0A 2VRRB 2QHOA 4AP4C 3T9LA 1OTRB 4WQMA 1RWSA 4M0WA 4KGTA 2C9WB 2O2VA 1QILA 2HJ1A 2KTRA 3KQ4A 4I6PA 2KANA 4YTMB 2OOBB 1I4GA 1UZXB 4REZA 4JIOU 4BAXA 1E5WA 4A9AA 2KN4A 3LXFA 3L10B 1WGDA 2LGSA 4GXBA 1LM8B 1ZW7A 2FIFA 4XDDA 4DDID 2JZPA 2WXMA 3A4SC 4HLEA 3PRZA 1J7BA 4MEMA 4WJPA 1J7AA 1JWUD 3HIZA 5AZHA 2DYBA 1C78A 4GIVA 3ZNID 1Q1OA 3PRPB 2DLBA 1V97A 2JWZA 3PZ8A 3W2DA 1CZPA 5AZGA 1XLPA 2JRHA 2EELA 2KQ7A 3VTWA 3MFGA 4DWFA 3EC8A 1EF5A 1S3SG 3ZJUA 1PFDA 2JY6A 1BUIC 3B9JA 2X38A 4GDKA 2ONQA 2MQJA 2D3CA 1LXDA 3PHXB 2KWDA 5CTRC 5EDSA 4NJCA 1XQQA 1JWAD 5D7GA 1OQQA 3T8MA 2MJ3A 2KDMA 4IOIE 1N62A 1D5ZC 2DZJA 2BYTA 3PT2B 1SE4A 5BYRA 1QF6A 3N9YC 2QSDA 4TQ1A 2AX5A 2GMIC 3ZRCA 3VDZA 2REXA 4EUTA 5HG2A 1PQSA 1SIJA 3HK0A 4KV2A 4WJQA 5HHDG 3O13A 1BXTA 2QDFA 3QWZB 3BK1A 1NDDA 4WWPA 5CHFA 1EO6A 2UYZB 1M4VA 2LHDA 1QZEA 3DWGC 1SGHA 1FO4A 4DXFA 1H8CA 2MA9B 3A1QB 2ZPYA 4LNIA 4XYCA 4BKSD 3S2AA 3AE8B 2NTTA 3A9KA 1E9MA 2G4SA 2NTSA 1ZPSA 3X0WA 3RCZA 4WURA 5CHVC 3IHPC 2K6QA 4EE2A 4P1CC 2JQRB 2M1MA 2ZW0A 3DBLI 1P9DU 3I5JC 5D2MB 3DBHI 3NY5A 4YSYB 3JSVA 4LDTB 1UWXA 3VTVA 2BGFA 1YN5A 4RGMA 1WXSA 1WXVA 4HK2A 1WX8A 3TEXA 1GNUA 2N1VA 3OG5A 4LJPB 4RM8A 2KNBA 1GPXA 3DVGY 3X23A 1NBFC 1C4PA 2UU7A 4KDIC 2KZRA 3NHEB 2AQ2B 3ZGZA 2Y5PA 2HTME 3BWUD 3R7RA 1JROA 3U2SC 3QQ8B 2I38A 3LB8C 4GDLB 1HTQA 2PMVA 3APCA 4P16A 2XK5B 4LTUA 2MX2A 4CHKA 1FNUA 2N9LA 2J0JA 2GBKA 4GMVA 3AI5A 4H2AA 2AQ3B 1EUVB 1YNTE 3SDLC 1BMLC 2MWSB 1OGWA 2E3TA 2D3GA 3C8YA 5AUIA 1FIQA 2K6DB 2IGHA 3BYTB 4GN1A 3ALBA 1K52A 2LFIA 2WDTB 2YLMA 2WGSA 4HCPB 3NJTA 2H88B 2KWCA 3KUDB 2CKHB 2RSUA 3DHGC 4NJ7A 1RFKA 2RR9A 1MVKA 5DPSA 1K50A 2PVGC 2MBBB 1IUEA 2PPHA 4MJSB 1YQ3B 2JT4B 2INPE 4WWNA 4NAMA 5TR5A 2BYEA 1WWTA 5FR3A 3UGBB 3MHZA 4MGZE 4DHJD 1FCCC 2PTLA 4ANUA 3M63B 3Q3OC 1SJED 3QAQA 1HXYD 2D5GA 3ZDTA 4OZAA 2WXQA 2QIEB 1ZP0B 3TBLD 2MJEA 5D3IB 4BBNC 4L2YA 1WI0A 1WXAA 4G11A 4ICUA 4KKJA 2BBCA 3CSTA 3N3KB 3M3JA 1ZGUB 3NZUA 3L4PA 1MHHE 1HEZE 2EKIA 1WYWB 4MM3A 1MFWA 1V5OA 1FXTB 1XD3B 1N5XA 4C7YA 1VZ6A 2J53A 2KMAA 2MLBA 1XLQA 4ZDVA 2BWES 3VRBB 2V1YA 1DOXA 2L8JA 3ZLZA 1GC6A 2JWUA 4FBJB 3B0AA 1VDVA 1WZ3A 2DAFA 3A33B 3OJ4B 2IO1B 4E3CA 4ACFA 3CIRB 1KLUD 1DOYA 3EHVA 2FCQA 2VZKD 4HJKA 2PVOD 1YX5B 2A5UA 3W5UB 4PYUA 3AV8A 2L7RA 5D94A 2BS3B 3NG0A 3KYDD 3QC8B 1KOTA 4KX6B 1F52A 2Q5WD 4FA6A 3AE1B 3UQBA 3Q8BA 1L6UA 1EWCA 2MH7A 1TT5B 1TGZB 4KDLB 4WWOA 4LCDE 1UF0A 3PPAA 2VH2A 2WXGA 4N9F4 2N1WA 5H92C 3U7ZA 1Q10A 3H1UA 4LNFA 3U30A 3WANA 5CX3A 5JHAA 1LQBA 3CMMB 3PRMB 4P6VF 1P3QU 1L0YB 3DVNU 4YTNB 4KGSA 3RUIB 2W54A 5G5HA 2WXOA 3HUIA 1J0GA 5T8IA 1ZXIA 1FD6A 2W3RA 2L76A 5DPTA 2W55A 3RNGC 1F1HA 2RGFA 1VRAB 3PV1A 2ASQA 2IJ0A 4XX5A 1WGHA 2MW5A 2GBJA 1E0ZA 2PJHA 1T3QA 4B95A 2KC2A 4TQ0A 3URYA 2SAKA 3VH4B 2LVQA 1I4QA 2HJ8A 2QC8A 3B2GA 5EE3A 3IT4B 1C1YB 4LLGM 3WAMA 4DXGA 4XE0A 2ZJDA 2V3SA 4XWWA 1E8ZA 2BQQA 4B6WA 3P42A 3VXWA 1ZKHA 2LXAA 1OEYJ 1WM2A 2BS2B 1FNWA 3W1SA 2DYMA 1JCKB 4IM3A 4AJWA 1T0SC 1NI3A 1JW9D 2C5LC 3P4RB 1WXQA 1M94A 4RMAA 4EZJA 1BT0A 3EGRA 1RYJA 2EMSA 2KFKB 4WJOA 3R8BA 1XXGA 1LO5D 3RN9C 3V3XA 1ET6A 3BVGA 2DZIA 4YSXB 5L83A 2MBHA 5D3DA 5HKHA 4YXDB 4BKGA 1WGRA 3Q3MC 3V61A 1E6EB 3IFWB 1E7PB 4LNOA 4WJNA 2M0AA 3RNEC 4GOCA 3W1YA 2LRWA 3VQIA 4W9EA 1DOIA 1VZ7A 2PKOA 1PDXA 3ZXRA 1WJUA 2XNAC 1TTNA 2KDEB 2FCNA 4LNNA 3PZDA 2G1EA 3ZUNA 1YN3A 1PYWD 4HROA 4PT5A 1HQRD 2EKEC 4EEWA 2BKFA 2XEWA 1SJHD 2W3SA 1L0XB 3ZDMC 1KTKA 4NNJB 3KLSX 2WXIA 2M0XA 2DENB 2I2YA 5C2TB 4TKNA 1R4NI 3H7SA 1TS4A 1MPEA 4FJZA 3PZ7A 4B0MA 2L1AA 3L13A 3AXCA 4XGAB 2K9XA 4FJVB 1K51A 4KIKA 1VLBA 4IM0A 1UBIA 1UWMA 3V6EB 2MP2A 1LGRA 3O65B 1P98A 1FPYA 1B1ZA 2G3QB 4WWMA 1DGJA 4LJOB 4RH6A 3H7PA 4N58A 4FLHA 3N1ZC 2KLGA 4PS7A 3AMZA 2C7HA 3JVZX 2N9KA 1EU3A 4N59A 1FXAA 2N9XA 2JSVX 1YQBA 4Q2JA 2LEKA 1LFDA 1TKYA 1FM0D 3RFZB 1HA5A 4JX1C 1JRUA 1T0RC 2D11A 2N9EB 3H8HA 4G50A 3VVWB 1VZ8A 2N7EA 4KZ0A 1Z2MA 3R2IA 4HKQA 3ZNGC 1YD8U 1IYFA 2NPTA 4US9A 1JMLA 2IGDA 1TS2A 1SIFA 1TKGA 2LGXA 3ETRA 3RD2A 1E10A 3GE3C 4P7IA 1CQVA 4NPNA 3DQVA 1L2NA 2KYWA 2XN9C 4DHZE 3AEDB 3VH3B 4RGNA 4US8A 3P1MA 2RMMA 2CR5A 3WCQA 3JW0X 3B1LX 2MJDA 1KF6B 5G55A 1WGGA 3FILA 1WJ4A 3LJ3A 2ACZB 1K8RB 1QOAA 5G2NA 4LNKA 2SEBD 3N32A 2ZPNA 2AEHA 5BMHA 3RYTA 1ZOYB 1I42A 1ET9A 4DHZB 3L17A 4K3CA 2INCC 3UIOB 1XCTL 3AH7A 2BPSA 1UUPA 1KLGD 2KDBA 1XLOA 1QOFA 2DNFA 3EA6A 2BF8B 2JZ3B 4K1RB 2NMQA 3K9OB 1L7YA 2BW2A 4FXCA 2J4XA 3MC0B 4ANXA 2ZEQA 2LVOA 1WH3A 2KDFB 2I1JA 1NVID 4ZHOA 3HVZA 2NR2A 1SF0A 3MJWA 3VUYA 3T3OA 1DYQA 3DVGX 1R4NB 3SHQA 1I4XA 4A8XC 4JL9A 4YWGG 1ZDVA 3RT3B 3AU4A 3RULA 4AS1A 4W9JA 2WQYB 2GI9A 3KWVA 5C1ZA 1FCLA 2MBQA 1NYRA 5LXIB 1D4BA 2KFJA 4TMAB 1GJZA 2W9NA 2IY1B 2OHFA 2IO2B 2L3ZA 1WE6A 5BYQA 2Y5CA 3WALA 3AE7B 1HE8A 3VR8B 5H8YE
chains in the Genus database with same CATH topology
1N5XA 2INNE 1TKEA 4RF0A 4C7YA 1QT9A 1VZ6A 2J53A 4GLSC 1WRIA 1F2RI 4ARIA 2CU3A 3NUHB 1T5XD 2QEJC 1XLQA 1XLNA 1FFVA 3VRBB 4HEA1 1DOXA 3ZJVA 2WXLA 2IGGA 4OZBA 2JWUA 1TJEA 4ITKA 1VDVA 2RPVA 2ON8A 3TEZA 1GB1A 4CQNA 1MHXA 1SB3C 1SXTA 1JQ4A 2WDQB 4C7ZA 2LHEA 2YEPB 4OHJA 3Q69A 3CIRB 5BMGA 2K22A 1KLUD 3GB1A 4OW0A 3E9SA 1DOYA 4RCOA 3AE9B 3NZ3A 4UDUC 1C9FA 2JYTA 3SR6A 1KH0A 3AB5A 2RDHA 1SE3A 2VZKD 2PVOD 3Q8AA 3W5UB 4RNAA 3AV8A 4A90A 1D5XC 2BS3B 2KMMA 1I4RA 2WXPA 4KX6B 4RF1A 2WLBA 2Q5WD 3BZDB 1EWYC 3LYYA 2LUMA 3AE1B 3P63A 2BTEA 2MEKA 3Q8BA 1L6UA 2CJNA 1EWCA 2MH7A 1TY0A 3FAHA 3BYYB 1ACCA 3AEGB 2YEPF 3TUOA 4JPSA 1JRPA 2WU5B 2JU6X 2WXGA 1MI0A 4ZRPA 1PUTA 5H92C 1XF5L 3U7ZA 1Q10A 2WP9B 2E6XA 4HRSA 2N7JA 1CK1A 1EU4A 1WSPA 4KGRA 2R61A 1J7CA 4O1NA 3ZYYX 1PGAA 1D6EC 1F77A 3GP7A 1YMHE 1IBXB 5EE0A 5AUKA 4A6QA 1WGKA 1V8CA 1ZDXA 5EE9A 5GXGB 5C3JB 4P6VF 4USAA 2J52A 1QOBA 3W5VB 2RDGA 3BK2A 2K5PA 3NS1A 4RGTA 1L0YB 2JX5A 4YTNB 3VRAB 4KGSA 1N5WA 2BB6A 2W54A 5G5HA 2WXOA 3HUIA 3TEYA 5T8IA 3Q8EA 2QJLA 4ZOHC 1ZXIA 3IAM1 2DBYA 2W3RA 1FD6A 2DWQA 1ESFA 1CJEA 1I7HA 5BMIA 2Y3AA 1C4CA 1SSNA 1C79A 2W55A 5EE1A 4WH4A 1SBBB 2FUG1 2QMTA 1GB4A 1VRAB 1D5MC 2IJ0A 1XEEA 1FFUA 2L83A 1I4HA 3AM9A 1E0ZA 1XO3A 1T3QA 2M19A 2TSSA 1RM6C 4TQ0A 4WIPA 1HZ5A 4J3OD 2IPKD 3EUB2 3URYA 3FC4A 2SAKA 4MACA 3P4PB 1I4QA 1JWMD 3B2GA 3MJ5A 5EE3A 3IT4B 2V4IB 4LLGM 4DXGA 3AEBB 4XE0A 2N0SB 4XWWA 4R3DA 2WXFA 2G9HD 2IDYA 1V1PB 3P42A 4JWUC 3NVVA 1AYFA 4IKGA 2BS2B 1FNWA 1WYGA 3W1SA 1FRRA 2DYMA 1NEKB 1JCKB 1N60A 4WQMA 1RWSA 4M0WA 4KGTA 1L6VA 1NI3A 1TZOA 1JW9D 1QILA 3P4RB 3Q8CA 1WXQA 3BVMA 3UI3A 1QLBB 3I57A 3KQ4A 4YTMB 4WAFA 1I4GA 2Z8LA 4REZA 5JXVA 3EGRA 1RYJA 4A9AA 1PGBA 1TS3A 5LNK1 1A70A 2KN4A 2L52A 3LXFA 1P7FA 5G5GA 3P4SB 2ICIA 3DWMA 4XDDA 4GDKB 1V1PA 2JZPA 4D2KA 3FILB 2WXMA 3R8BA 4OZCA 4IDIA 1XXGA 2WDVB 1J7BA 1J7AA 1LO5D 1JWUD 4HJGE 3V3XA 2WXRA 3MP9A 1ET6A 1C78A 2BS4B 2JYEA 3BVGA 4L23A 4YSXB 3RPFC 5D3DA 2DLBA 1V97A 3PZ8A 3W2DA 2HDEA 2PLPA 4YXDB 1CZPA 4YT0B 3VR9B 1E6EB 1E7PB 1ENFA 4MH8A 1XLPA 2M0AA 2EELA 3MFGA 3ZJUA 2M56B 1PFDA 4ARCA 1ZE3D 3VQIA 1BUIC 3B9JA 2X38A 3NVYA 1DOIA 1YJJA 3TSSA 1VZ7A 2GB1A 4ZRQA 2PKOA 2ONQA 1PDXA 3B2FA 2XNAC 2KWDA 4NJCA 2G1EA 1YN3A 1PYWD 4B0EA 4HROA 1JWAD 3NVZA 1QQRA 3ABVB 4PT5A 1HQRD 1C77A 3AE3B 5D7GA 2PIAA 1OQQA 3BVZA 2WS3B 2MJ3A 1SJHD 2W3SA 3IXSA 1L0XB 2KDMA 1KTKA 2V3PA 4IOIE 1N62A 1KFYB 2H89B 2WXIA 1D5ZC 1R7SA 3AEAB 3KLSX 2I2YA 2BYTA 5C2TB 2BT6A 3E56A 1SE4A 2WXJA 5BYRA 1QF6A 1TS4A 3N9YC 5HI1A 3KWLA 1MPEA 2QSDA 4TQ1A 3PZ7A 4B0MA 2L1AA 4RGOS 2AX5A 3AE6B 2K9XA 3SEBA 3AN1A 1K51A 1VLBA 3IAS1 5HG2A 5BYSA 1SIJA 1VJKA 5HHDG 1AWDA 1L5PA 3O13A 1BXTA 1GOZA 1UWMA 3BK1A 1TY2A 2PW9A 1M4VA 1B1ZA 2LHDA 3DWGC 1IBXA 4WWMA 4KKIA 4XDCA 1FO4A 4DXFA 1DGJA 2WNMA 4RH6A 2AQ1B 1NENB 4N58A 4TSSA 4L1BA 1C76A 1UNSA 5TSSA 1FXIA 4MT5A 3AE8B 3AMZA 2V0GA 3W9CB 2N9KA 2NTTA 1EU3A 4N59A 1FXAA 1E9MA 2JSVX 2NTSA 1ZPSA 4Q2JA 1FMAD 2LEKA 4YSZB 1UGJA 4WURA 2WXHA 1TKYA 4EE2A 1FNVA 1FM0D 3ZQ4A 1IGCA 2JQRB 5FK9C 4ZHPA 2ZW0A 3RFZB 3R2TA 1HA5A 4JX1C 2WXKA 1JWBD 3H8HA 4YSYB 1QOGA 1Y56A 1VZ8A 2FE8A 1UWXA 2FBWB 1ZXHA 3R2IA 1YN5A 1F2RC 3I9V1 4RGMA 4HKQA 4JE3B 4US9A 2VZKB 1JMLA 3TEXA 2IGDA 1TS2A 2KAJA 2WU2B 3TEWA 1TKGA 1GPXA 4RFBA 3ETRA 5FKAC 1C4PA 1E10A 1JALA 1CQVA 1AN8A 2LMCA 2ZW1A 2XN9C 2LGIA 2WDRB 2AQ2B 3AEDB 3ZGZA 2J42A 2Y5PA 4RGNA 4ZYSA 3NRZA 2BB5A 4US8A 2HTME 3P1MA 3BWUD 1T6BX 1JROA 4NZLB 1YN4A 3U2SC 1B9RA 2RMMA 2LJIA 1L4ZB 3SFDB 2I38A 3LB8C 3ZJTA 4GDLB 4DQOC 4JWSC 4OVZA 3WCQA 5I4DA 2MJDA 1YJIA 2PMVA 1KF6B 1KRHA 4C56C 3FILA 3U4EG 4P16A 2ACZB 4LTUA 1QOAA 1FNUA 2N9LA 4C80A 3AE4B 2SEBD 4LK0M 1FEHA 5HFYA 4HKZE 5BMHA 1N61A 1YQ4B 4H2AA 2AQ3B 1ZOYB 3P4QB 1ET9A 1YNTE 1BMLC 3J9CA 1L0VB 2E3TA 3C8YA 5AUIA 1FIQA 1XCTL 3AEFB 2KQ4X 1HZ6A 3HVDA 3AH7A 3HRDD 1EM7A 1STEA 1ROEA 2IGHA 1P7EA 1UUPA 3IT6B 1KLGD 1FRDA 3BYTB 2B76B 4NAWB 1K52A 1QOFA 1XLOA 3EA6A 2W82A 1V1OA 2LFIA 3V05A 1TS5A 1QKZA 2NMQA 2BW2A 1SE2A 4FXCA 2J4XA 2H88B 3MC0B 3T3NA 3PO0A 2L32A 2KACA 1VR9A 1RFKA 3CWIA 1NYQA 1MVKA 1K50A 4YTPB 3U52E 2PVGC 3GS2A 1NVID 4ZHOA 3SFEB 3HVZA 1IUEA 2OEDA 2CJOA 1SF0A 2K0PA 2WXNA 1YQ3B 1F0ZA 3Q8FA 1ZUD2 1K53A 2GRIA 1I4PA 1L4DB 2INPE 4NAMA 1WWTA 5FR3A 1OQRA 4AQ7A 3T3OA 1DYQA 3MHZA 3OWEB 4MM3B 1N63A 2V3NA 1I4XA 1FCCC 2PTLA 4A8XC 3AE2B 4YWGG 1SJED 1ZDVA 1HXYD 2D5GA 4OZAA 2JXTA 2WXQA 1TYGB 4XWTA 2QIEB 3NVWA 1AW7A 4AS1A 1ZP0B 2WQYB 1GAQB 2MJEA 2GI9A 3KWVA 5D3IB 4L2YA 1FCLA 1NYRA 1XCQL 1D4BA 1C4AA 1JWSD 1IGDA 4TMAB 4KKJA 2OHFA 3BIID 2BBCA 5E6JA 5MPOA 2K3UA 3AE5B 2DYOA 1SEBD 4A55A 1OFFA 3L4PA 1MHHE 2Y5CA 3AECB 5BYQA 1HEZE 2EKIA 3AE7B 3VR8B 5H8YE 1PGXA 2QILA 3AEEB 4N6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2Y A;  2J53 A;  4GLS C;  5HI1 A;  3FIL A;  1F2R I;  1MPE A;  2QSD A;  1HZ5 A;  4MAC A;  2N9L A;  2IGG A;  4OZB A;  5HFY A;  1K51 A;  2JWU A;  4HKZ E;  5BMH A;  5HG2 A;  2RPV A;  2ON8 A;  1GB1 A;  5HHD G;  1MHX A;  1YNT E;  2LHE A;  2PW9 A;  4IKG A;  2LHD A;  5BMG A;  3GB1 A;  1IBX A;  1XCT L;  2KQ4 X;  1HZ6 A;  1C9F A;  1EM7 A;  1KH0 A;  2IGH A;  1P7E A;  4KGT A;  1K52 A;  3UI3 A;  1QKZ A;  2NMQ A;  5JXV A;  2N9K A;  1PGB A;  2JSV X;  2KN4 A;  1P7F A;  2LUM A;  2JZP A;  2KAC A;  3FIL B;  4D2K A;  1IGC A;  4OZC A;  1MVK A;  2ZW0 A;  1K50 A;  4HJG E;  3V3X A;  2JU6 X;  3MP9 A;  1MI0 A;  2OED A;  1XF5 L;  1Q10 A;  2K0P A;  1UWX A;  1ZXH A;  1K53 A;  2PLP A;  1F2R C;  2N7J A;  4KGR A;  1FCC C;  2PTL A;  1PGA A;  1YMH E;  1IBX B;  1JML A;  2IGD A;  2EEL A;  4OZA A;  2JXT A;  2J52 A;  2GB1 A;  2GI9 A;  2ONQ A;  1FCL A;  4KGS A;  2ZW1 A;  1XCQ L;  1D4B A;  2KWD A;  2LGI A;  1IGD A;  1FD6 A;  5BMI A;  1MHH E;  4WH4 A;  1HEZ E;  1GB4 A;  2QMT A;  2RMM A;  2KDM A;  1PGX A;  4IOI E;  2I38 A; 
#chains in the Genus database with same CATH topology
 3DBR B;  3PRE A;  2KJ6 A;  3D32 A;  3FKY A;  4GLS C;  3IG3 A;  1WRI A;  3R66 C;  3DVN V;  2D07 B;  4P1B C;  2KJH B;  2C7M B;  3NUH B;  1T5X D;  2IO0 B;  2N7D A;  1WR1 A;  2OJW A;  4CYE A;  3SU8 X;  2IGG A;  4OZB A;  1TJE A;  2XBB C;  3WAO A;  1MG8 A;  3ML8 A;  1S1Q B;  2K1F A;  2ON8 A;  3TEZ A;  4BZA A;  2WDQ B;  4C7Z A;  1UEL A;  1N6Z A;  2IY0 B;  4LDT D;  4OW0 A;  3E9S A;  3NZ3 A;  4HPL B;  1C9F A;  3AB5 A;  2M8S A;  2RDH A;  4K3B A;  4EZL A;  3Q8A A;  3DBS A;  4RNA A;  3RZW C;  2KMM A;  1I4R A;  2MHJ A;  1WX9 A;  1YJ1 A;  1YOV B;  2LD9 A;  1VD2 A;  2BTE A;  2ZVN A;  5KHO A;  1WJN A;  3TMP B;  3N20 C;  1TY0 A;  1Y8R C;  4JPS A;  1JRP A;  2D10 A;  4ZRP A;  2WP9 B;  3EEC A;  1F9J A;  4HRS A;  5J18 A;  2MP2 B;  2D3A A;  2KVZ A;  4KGR A;  4O1N A;  2LI5 A;  2MSE D;  5EE0 A;  4A6Q A;  1WGK A;  4M02 A;  4M8N A;  5GXG B;  3NS8 A;  2M4N A;  4W9D A;  3BK2 A;  2K5P A;  4TUU A;  4BKT A;  3QHT A;  3VRA B;  5IN7 A;  4F8C B;  3QIJ A;  2QJL A;  3MHS D;  2L0F A;  4NAW A;  4HPP A;  1CJE A;  1I7H A;  1Q5W B;  5EE1 A;  4WH4 A;  1SBB B;  3RZF A;  1D5M C;  2KK8 A;  2WHI A;  4HCN B;  4M0W B;  2KVR A;  3AM9 A;  3EFC A;  2O2V B;  2M19 A;  3ZTC A;  4G0N B;  2KTR B;  3QX1 A;  2IPK D;  3FC4 A;  3P4P B;  1P1A A;  4ZRI A;  3VHT C;  3MJ5 A;  2NPT B;  4EKU A;  2V4I B;  5D6J B;  2IBI B;  2L0T A;  2LUE A;  2G9H D;  3A4R A;  3NVV A;  2QCZ A;  1AYF A;  2NCN A;  2D3B A;  1FRR A;  1NEK B;  3N1Y C;  2R2O A;  2Z0D B;  2LGY A;  4PS3 A;  1L6V A;  2PE6 B;  2EMT A;  4HVB A;  3Q2A C;  3RNA C;  4WAF A;  2O6V D;  2Y5B B;  3QA8 A;  5DPR A;  1TS3 A;  1A70 A;  2L52 A;  1P7F A;  4FAD A;  4NY0 A;  3P4S B;  2ICI A;  4GDK B;  1V1P A;  4D2K A;  3FIL B;  2GBN A;  2KTF A;  3L54 A;  4OZC A;  3PHW B;  2M17 A;  3MP9 A;  2BS4 B;  2OJR A;  4L23 A;  2NBV B;  2PLP A;  3VR9 B;  5KHQ A;  3QCA A;  1WMH A;  1J8C A;  1RAX A;  2M56 B;  2RDB C;  3A9J A;  3TSS A;  4F7Z A;  5E6N A;  4ZRQ A;  1E8Y A;  4I6N B;  2G4D B;  2KXJ A;  4B0E A;  1QQR A;  2LAS A;  3AE3 B;  1C77 A;  3W1S C;  3BVZ A;  2WS3 B;  5IKC M;  3IXS A;  3HM6 X;  4W9G A;  1AAR A;  3E56 A;  4GB9 A;  2WXJ A;  5HI1 A;  3ZO5 B;  2Z59 B;  4RGO S;  3SEB A;  4IW0 A;  3AN1 A;  3A9K B;  3IAS 1;  5BYS A;  3CSF A;  1VJK A;  1V80 A;  3R7Q A;  4ANV A;  2PW9 A;  1WM3 A;  2UWQ A;  3APF A;  1IBX A;  2CHW A;  4XDC A;  3JSV B;  4BKS A;  3DCG A;  2AQ1 B;  4K81 A;  1ISN A;  1NEN B;  4OVU A;  4TSS A;  5TSS A;  4MT5 A;  4WAA A;  2A4Z A;  3W9C B;  1KJT A;  2FAZ A;  1T0Q C;  2D2Q A;  4YSZ B;  2AL6 A;  1UGJ A;  2WXH A;  3AU5 A;  1IGC A;  3R2T A;  1JWB D;  4AOF A;  1QOG A;  4IWQ A;  1ZXH A;  3A1Q A;  2NS5 A;  4BOZ B;  4JE3 B;  2KAJ A;  4AJY B;  1WXM A;  3UIN B;  4IM2 A;  4AUQ C;  1JAL A;  2KWV B;  1AN8 A;  1V49 A;  2LMC A;  2WDR B;  5JH5 C;  4NZL B;  1YN4 A;  2KOX A;  3ZJT A;  1X1M A;  4JWS C;  4OVZ A;  5I4D A;  1YJI A;  2ZCC A;  1KRH A;  4C56 C;  3M95 A;  4FUL A;  4PS8 A;  3ZXV A;  4C80 A;  3AE4 B;  4LK0 M;  1FEH A;  2LVP A;  3PGE A;  5HFY A;  4HKZ E;  4MEL A;  3IVF A;  1YQ4 B;  3P4Q B;  3Q14 C;  1IPG A;  2ZVO A;  4MGI E;  2KHW B;  1OQY A;  3ML9 A;  4C4V A;  3PS6 A;  3DHI C;  2KD0 A;  4GDL A;  4S0R A;  3HRD D;  1EM7 A;  2KLC A;  3IT6 B;  1V86 A;  1FRD A;  2B76 B;  4NAW B;  2WX1 A;  1I35 A;  2XK5 A;  2KN5 A;  5GMV A;  2W82 A;  3V05 A;  1TS5 A;  4K7W A;  1QKZ A;  4K7U A;  1TIF A;  3Q3J A;  4K7S A;  3P2B A;  3ECI A;  2L32 A;  3PO0 A;  2CU1 A;  1D3Z A;  1VR9 A;  3CWI A;  4M01 A;  3K9P B;  3U52 E;  3GS2 A;  3L0W B;  4XZ4 A;  3SFE B;  2CJO A;  4BVU C;  2K0P A;  1F0Z A;  2GRI A;  3DBR I;  1L4D B;  2Z0E B;  1G6J A;  2FCM A;  1V9J A;  1OQR A;  3OWE B;  4MM3 B;  1N63 A;  3AE2 B;  2GLS A;  2ZNV B;  3ONS A;  4IC7 B;  2JVC A;  3ZRF A;  2JXT A;  3C0R B;  1R4M B;  4IUM B;  3H6N A;  2DAJ A;  1GAQ B;  1VCB A;  1XCQ L;  2K8B A;  3BII D;  3DOW A;  3AUL A;  2KKC A;  2K3U A;  3AE5 B;  2DYO A;  4A55 A;  1OFF A;  1E8X A;  2AYO B;  3AEE B;  2INN E;  1MG4 A;  2C60 A;  2WX0 A;  4OVV A;  4ARI A;  1TBE A;  2CU3 A;  2O6V A;  2QEJ C;  1XLN A;  1FFV A;  3OLM D;  3ZJV A;  2WXL A;  1WMH B;  4II2 B;  2RPV A;  1GB1 A;  3ZKJ C;  1MHX A;  1SB3 C;  3A9J B;  3KUZ A;  3OJ3 A;  3Q69 A;  3IBE A;  3GB1 A;  4RCO A;  4DDG D;  4QAY A;  3AE9 B;  4JLC A;  4E74 A;  3C19 A;  3PSE B;  5JHB A;  2JYT A;  3SR6 A;  1SE3 A;  2LWP A;  3RNF C;  1Q0W B;  4NQL B;  2NBU A;  1D5X C;  4IWO A;  4GSW A;  4X57 B;  2WXP A;  2DZK A;  2FID A;  4RM9 A;  1EWY C;  2LJ5 A;  2LUM A;  4CO7 A;  2CHZ A;  4NQK E;  3GOE A;  3FAH A;  3BYY B;  5AEK B;  2YEP F;  3TUO A;  5IAA C;  3VTU A;  2JU6 X;  3VAW A;  1MI0 A;  4ANW A;  2BKR B;  3ENE A;  2GOW A;  3QJZ A;  1OEY A;  2E6X A;  4KZC A;  4IG7 B;  1CK1 A;  1WSP A;  2HE7 A;  3ZYY X;  1PGA A;  2DX5 B;  2KDI A;  1IBX B;  3KW5 B;  3Q6B A;  1ZDX A;  1WX7 A;  2KX3 A;  3APD A;  2J52 A;  1GG3 A;  3MC8 A;  1QOB A;  3KH0 A;  2NVU I;  4JQW C;  1N5W A;  2BB6 A;  4M8M A;  5IO9 A;  3Q8E A;  4ZOH C;  3Q3N C;  3IAM 1;  2DBY A;  1P0R A;  2DWQ A;  5BMI A;  3V62 A;  2Y3A A;  3SD5 A;  3R3M A;  4TV3 A;  1UGM A;  2FUG 1;  1GB4 A;  4G3X B;  4XC2 A;  1WIA A;  1XEE A;  1FFU A;  2L83 A;  1I4H A;  1HTO A;  4AWJ A;  1UD7 A;  2TSS A;  2KO3 A;  1RM6 C;  4WIP A;  1HZ5 A;  4J3O D;  3EUB 2;  5LLI A;  3TCA A;  5LXH A;  3EFU A;  4MAC A;  2MBE A;  1U4A A;  4MSQ B;  2WXF A;  2IDY A;  4HDQ A;  3ZVV A;  1WJ6 A;  3QAR A;  1RFA A;  1N60 A;  4HXD A;  1TZO A;  5DPW A;  3Q8C A;  3BVM A;  3UI3 A;  1QLB B;  3I57 A;  4FJY A;  2Z8L A;  5JXV A;  1PGB A;  2K39 A;  5LNK 1;  5G5G A;  3RMK C;  3DWM A;  4DK5 A;  2I1K A;  4KSL C;  2GBR A;  4EFO A;  4IDI A;  4MDK E;  2WDV B;  4HJG E;  1WF9 A;  2WXR A;  2JYE A;  3RPF C;  5L95 C;  2HDE A;  1NI2 A;  3I63 C;  4WQO B;  4YT0 B;  4A3P A;  4C4V B;  4MH8 A;  1ENF A;  4B9K A;  4DBG A;  2GBM A;  2KFK A;  2CS4 A;  4ARC A;  1ZE3 D;  3DHH C;  2AWT A;  3NVY A;  1YJJ A;  2GB1 A;  3GE8 C;  3B2F A;  2WYQ A;  4KIK B;  5IP4 D;  4A20 A;  2IZV B;  4F1S A;  3V6C B;  1WFY A;  3NVZ A;  3ABV B;  4BBN F;  2ZNV C;  2PIA A;  2PE9 A;  1UH6 A;  2VH1 A;  2V3P A;  4DXA B;  1A5R A;  1KFY B;  2H89 B;  1R7S A;  3AEA B;  5C23 A;  2BT6 A;  3H7P B;  4DHJ B;  3KWL A;  4MSM B;  3AE6 B;  3L08 A;  2J0K A;  4HWI B;  3NZS A;  1AWD A;  1L5P A;  3RNC C;  1GOZ A;  4J6I A;  1TY2 A;  2DHZ A;  2MBO A;  5BO4 B;  2KJR A;  4KKI A;  1SE9 A;  2K25 A;  2WNM A;  3GZN I;  4L1B A;  1C76 A;  3PVL A;  2HD5 B;  1UNS A;  1FXI A;  2J0M A;  3WIM A;  4MH0 E;  2V0G A;  2PEA A;  2LRU A;  3Q3F A;  1FMA D;  3H9D A;  4HPM B;  4C00 A;  3NOB A;  2O6V B;  1FNV A;  2N9P C;  3M62 B;  3ZQ4 A;  1YIW A;  4PK1 A;  5FK9 C;  2MRP A;  4ZHP A;  1V2Y A;  2WXK A;  1Y56 A;  1MJD A;  2FE8 A;  2FCS A;  1V81 A;  2FBW B;  1F2R C;  3I9V 1;  4ASW C;  4BOS C;  1V6E A;  2V9H A;  2YVC A;  2K8H A;  2VZK B;  4URK A;  3RI7 C;  2K8C A;  4MGY E;  4I6L B;  2WU2 B;  3TEW A;  3ZIM A;  4RFB A;  3HM3 A;  3PLV A;  5FKA C;  4W9H A;  4W9L A;  2ZW1 A;  3JYU A;  2JRI B;  2LGI A;  3ZNZ B;  3DPD A;  2J42 A;  4E71 A;  3DBL B;  2CHX A;  4FHK A;  4ZYS A;  3NRZ A;  2BB5 A;  3DBH B;  3U8Z A;  4W9K A;  1T6B X;  1B9R A;  3PLU A;  1WRD B;  2LJI A;  1L4Z B;  3SFD B;  5IOI A;  4DQO C;  2JZZ A;  2BWF A;  3U4E G;  2HTH A;  3WA0 A;  3KUC B;  2N4F A;  3UF8 A;  2IND C;  1N61 A;  3TIX A;  3VUW A;  2KT7 A;  2IO3 B;  3J9C A;  2BYF A;  1L0V B;  4M00 A;  1T0Y A;  1RLF A;  3AEF B;  2KQ4 X;  1HZ6 A;  1GC7 A;  3HVD A;  1STE A;  3BY4 B;  1ROE A;  1P7E A;  4MGK E;  4S17 A;  2L00 B;  2KWU B;  5CHW A;  1V1O A;  4YL8 A;  4PYZ A;  1R4M I;  1SE2 A;  4FN2 A;  1XT9 B;  1UBQ A;  3T3N A;  2KAC A;  3L16 A;  1NYQ A;  3MTN B;  3N1X C;  4YTP B;  2R2Q A;  4KSK C;  3V60 A;  2OED A;  3TJP A;  2WXN A;  3Q8F A;  1ZUD 2;  1K53 A;  1I4P A;  4ZYN A;  4AQ7 A;  2IYD B;  2V3N A;  2G45 B;  1E7V A;  1J19 A;  1TYG B;  4XWT A;  5E6P A;  3NVW A;  1AW7 A;  2KMC A;  1WE7 A;  3CF6 E;  3OAW A;  1C4A A;  1JWS D;  1IGD A;  1V5T A;  2FUH B;  4BFR A;  1KLV A;  1CMX B;  1TZ1 A;  3N30 A;  5E6J A;  5MPO A;  4JGH B;  1SEB D;  3GZN B;  2KQS A;  3AEC B;  5J17 A;  3B08 A;  2NBW B;  1PGX A;  2LZ6 A;  2QIL A;  4FHJ A;  4N6E B;  4RF0 A;  1TKE A;  1QT9 A;  1WZ0 A;  2WWZ A;  4II3 B;  1F2R I;  5DCN A;  4HEA 1;  2LGD A;  3QK0 A;  4ITK A;  1E90 A;  4CQN A;  1Z5S B;  2JXX A;  1SXT A;  1JQ4 A;  3VFK A;  2JF5 A;  1WY8 A;  3UIP B;  2LHE A;  5J2R A;  1EF1 A;  2C7N B;  2YEP B;  4OHJ A;  5BMG A;  2K22 A;  2RD0 A;  4UDU C;  1KH0 A;  1WR6 E;  1YX6 B;  2LXC A;  2V4L A;  4KVG B;  2L05 A;  2DZM A;  1GUA B;  4A90 A;  4GGQ A;  4RF1 A;  2WLB A;  3BZD B;  4A3O A;  2BYV E;  4IWP A;  3LYY A;  3P63 A;  2MEK A;  2B3A A;  2CJN A;  2ZCB A;  3WAP A;  3KYC D;  2MCN B;  3RNB C;  2ZZP B;  1ACC A;  3AEG B;  3KVF B;  3UQA A;  1E7U A;  2WU5 B;  3LDZ E;  3ZTD A;  3MC9 A;  1IP9 A;  1H4R A;  1RRB A;  1PUT A;  1KM7 A;  1XF5 L;  4GU2 A;  1E8W A;  3DDC B;  2N7J A;  1EU4 A;  2BVC A;  2R61 A;  4W9F A;  1J7C A;  1C3T A;  1D6E C;  1F77 A;  3GP7 A;  1YMH E;  5AUK A;  5E6O A;  4EZK A;  1V8C A;  5EE9 A;  5C3J B;  4USA A;  3VUX A;  4EOY A;  4ZRK A;  3W5V B;  2RDG A;  3NS1 A;  4RGT A;  5AZF A;  1WGY A;  2JX5 A;  3ZW3 A;  5JZE B;  4ZRJ A;  2FNJ B;  3TEY A;  3BIN A;  2JPH A;  1ESF A;  1C4C A;  1SSN A;  1C79 A;  3U7D A;  2QMT A;  5IA7 A;  4ICV A;  3ZNH B;  3PTF C;  4W9C A;  2AL3 A;  4HDO A;  2J7Q B;  3TL5 A;  1XO3 A;  4W9I A;  4NJ6 A;  1JWM D;  2JUO A;  3HHM A;  5FR6 A;  3AEB B;  2N0S B;  2X8X X;  4MJS A;  4R3D A;  3I3T B;  2RPQ A;  2KC1 A;  1V1P B;  4JWU C;  4IKG A;  1WYG A;  2KX0 A;  2VRR B;  2QHO A;  4AP4 C;  3T9L A;  1OTR B;  4WQM A;  1RWS A;  4M0W A;  4KGT A;  2C9W B;  2O2V A;  1QIL A;  2HJ1 A;  2KTR A;  3KQ4 A;  4I6P A;  2KAN A;  4YTM B;  2OOB B;  1I4G A;  1UZX B;  4REZ A;  4JIO U;  4BAX A;  1E5W A;  4A9A A;  2KN4 A;  3LXF A;  3L10 B;  1WGD A;  2LGS A;  4GXB A;  1LM8 B;  1ZW7 A;  2FIF A;  4XDD A;  4DDI D;  2JZP A;  2WXM A;  3A4S C;  4HLE A;  3PRZ A;  1J7B A;  4MEM A;  4WJP A;  1J7A A;  1JWU D;  3HIZ A;  5AZH A;  2DYB A;  1C78 A;  4GIV A;  3ZNI D;  1Q1O A;  3PRP B;  2DLB A;  1V97 A;  2JWZ A;  3PZ8 A;  3W2D A;  1CZP A;  5AZG A;  1XLP A;  2JRH A;  2EEL A;  2KQ7 A;  3VTW A;  3MFG A;  4DWF A;  3EC8 A;  1EF5 A;  1S3S G;  3ZJU A;  1PFD A;  2JY6 A;  1BUI C;  3B9J A;  2X38 A;  4GDK A;  2ONQ A;  2MQJ A;  2D3C A;  1LXD A;  3PHX B;  2KWD A;  5CTR C;  5EDS A;  4NJC A;  1XQQ A;  1JWA D;  5D7G A;  1OQQ A;  3T8M A;  2MJ3 A;  2KDM A;  4IOI E;  1N62 A;  1D5Z C;  2DZJ A;  2BYT A;  3PT2 B;  1SE4 A;  5BYR A;  1QF6 A;  3N9Y C;  2QSD A;  4TQ1 A;  2AX5 A;  2GMI C;  3ZRC A;  3VDZ A;  2REX A;  4EUT A;  5HG2 A;  1PQS A;  1SIJ A;  3HK0 A;  4KV2 A;  4WJQ A;  5HHD G;  3O13 A;  1BXT A;  2QDF A;  3QWZ B;  3BK1 A;  1NDD A;  4WWP A;  5CHF A;  1EO6 A;  2UYZ B;  1M4V A;  2LHD A;  1QZE A;  3DWG C;  1SGH A;  1FO4 A;  4DXF A;  1H8C A;  2MA9 B;  3A1Q B;  2ZPY A;  4LNI A;  4XYC A;  4BKS D;  3S2A A;  3AE8 B;  2NTT A;  3A9K A;  1E9M A;  2G4S A;  2NTS A;  1ZPS A;  3X0W A;  3RCZ A;  4WUR A;  5CHV C;  3IHP C;  2K6Q A;  4EE2 A;  4P1C C;  2JQR B;  2M1M A;  2ZW0 A;  3DBL I;  1P9D U;  3I5J C;  5D2M B;  3DBH I;  3NY5 A;  4YSY B;  3JSV A;  4LDT B;  1UWX A;  3VTV A;  2BGF A;  1YN5 A;  4RGM A;  1WXS A;  1WXV A;  4HK2 A;  1WX8 A;  3TEX A;  1GNU A;  2N1V A;  3OG5 A;  4LJP B;  4RM8 A;  2KNB A;  1GPX A;  3DVG Y;  3X23 A;  1NBF C;  1C4P A;  2UU7 A;  4KDI C;  2KZR A;  3NHE B;  2AQ2 B;  3ZGZ A;  2Y5P A;  2HTM E;  3BWU D;  3R7R A;  1JRO A;  3U2S C;  3QQ8 B;  2I38 A;  3LB8 C;  4GDL B;  1HTQ A;  2PMV A;  3APC A;  4P16 A;  2XK5 B;  4LTU A;  2MX2 A;  4CHK A;  1FNU A;  2N9L A;  2J0J A;  2GBK A;  4GMV A;  3AI5 A;  4H2A A;  2AQ3 B;  1EUV B;  1YNT E;  3SDL C;  1BML C;  2MWS B;  1OGW A;  2E3T A;  2D3G A;  3C8Y A;  5AUI A;  1FIQ A;  2K6D B;  2IGH A;  3BYT B;  4GN1 A;  3ALB A;  1K52 A;  2LFI A;  2WDT B;  2YLM A;  2WGS A;  4HCP B;  3NJT A;  2H88 B;  2KWC A;  3KUD B;  2CKH B;  2RSU A;  3DHG C;  4NJ7 A;  1RFK A;  2RR9 A;  1MVK A;  5DPS A;  1K50 A;  2PVG C;  2MBB B;  1IUE A;  2PPH A;  4MJS B;  1YQ3 B;  2JT4 B;  2INP E;  4WWN A;  4NAM A;  5TR5 A;  2BYE A;  1WWT A;  5FR3 A;  3UGB B;  3MHZ A;  4MGZ E;  4DHJ D;  1FCC C;  2PTL A;  4ANU A;  3M63 B;  3Q3O C;  1SJE D;  3QAQ A;  1HXY D;  2D5G A;  3ZDT A;  4OZA A;  2WXQ A;  2QIE B;  1ZP0 B;  3TBL D;  2MJE A;  5D3I B;  4BBN C;  4L2Y A;  1WI0 A;  1WXA A;  4G11 A;  4ICU A;  4KKJ A;  2BBC A;  3CST A;  3N3K B;  3M3J A;  1ZGU B;  3NZU A;  3L4P A;  1MHH E;  1HEZ E;  2EKI A;  1WYW B;  4MM3 A;  1MFW A;  1V5O A;  1FXT B;  1XD3 B;  1N5X A;  4C7Y A;  1VZ6 A;  2J53 A;  2KMA A;  2MLB A;  1XLQ A;  4ZDV A;  2BWE S;  3VRB B;  2V1Y A;  1DOX A;  2L8J A;  3ZLZ A;  1GC6 A;  2JWU A;  4FBJ B;  3B0A A;  1VDV A;  1WZ3 A;  2DAF A;  3A33 B;  3OJ4 B;  2IO1 B;  4E3C A;  4ACF A;  3CIR B;  1KLU D;  1DOY A;  3EHV A;  2FCQ A;  2VZK D;  4HJK A;  2PVO D;  1YX5 B;  2A5U A;  3W5U B;  4PYU A;  3AV8 A;  2L7R A;  5D94 A;  2BS3 B;  3NG0 A;  3KYD D;  3QC8 B;  1KOT A;  4KX6 B;  1F52 A;  2Q5W D;  4FA6 A;  3AE1 B;  3UQB A;  3Q8B A;  1L6U A;  1EWC A;  2MH7 A;  1TT5 B;  1TGZ B;  4KDL B;  4WWO A;  4LCD E;  1UF0 A;  3PPA A;  2VH2 A;  2WXG A;  4N9F 4;  2N1W A;  5H92 C;  3U7Z A;  1Q10 A;  3H1U A;  4LNF A;  3U30 A;  3WAN A;  5CX3 A;  5JHA A;  1LQB A;  3CMM B;  3PRM B;  4P6V F;  1P3Q U;  1L0Y B;  3DVN U;  4YTN B;  4KGS A;  3RUI B;  2W54 A;  5G5H A;  2WXO A;  3HUI A;  1J0G A;  5T8I A;  1ZXI A;  1FD6 A;  2W3R A;  2L76 A;  5DPT A;  2W55 A;  3RNG C;  1F1H A;  2RGF A;  1VRA B;  3PV1 A;  2ASQ A;  2IJ0 A;  4XX5 A;  1WGH A;  2MW5 A;  2GBJ A;  1E0Z A;  2PJH A;  1T3Q A;  4B95 A;  2KC2 A;  4TQ0 A;  3URY A;  2SAK A;  3VH4 B;  2LVQ A;  1I4Q A;  2HJ8 A;  2QC8 A;  3B2G A;  5EE3 A;  3IT4 B;  1C1Y B;  4LLG M;  3WAM A;  4DXG A;  4XE0 A;  2ZJD A;  2V3S A;  4XWW A;  1E8Z A;  2BQQ A;  4B6W A;  3P42 A;  3VXW A;  1ZKH A;  2LXA A;  1OEY J;  1WM2 A;  2BS2 B;  1FNW A;  3W1S A;  2DYM A;  1JCK B;  4IM3 A;  4AJW A;  1T0S C;  1NI3 A;  1JW9 D;  2C5L C;  3P4R B;  1WXQ A;  1M94 A;  4RMA A;  4EZJ A;  1BT0 A;  3EGR A;  1RYJ A;  2EMS A;  2KFK B;  4WJO A;  3R8B A;  1XXG A;  1LO5 D;  3RN9 C;  3V3X A;  1ET6 A;  3BVG A;  2DZI A;  4YSX B;  5L83 A;  2MBH A;  5D3D A;  5HKH A;  4YXD B;  4BKG A;  1WGR A;  3Q3M C;  3V61 A;  1E6E B;  3IFW B;  1E7P B;  4LNO A;  4WJN A;  2M0A A;  3RNE C;  4GOC A;  3W1Y A;  2LRW A;  3VQI A;  4W9E A;  1DOI A;  1VZ7 A;  2PKO A;  1PDX A;  3ZXR A;  1WJU A;  2XNA C;  1TTN A;  2KDE B;  2FCN A;  4LNN A;  3PZD A;  2G1E A;  3ZUN A;  1YN3 A;  1PYW D;  4HRO A;  4PT5 A;  1HQR D;  2EKE C;  4EEW A;  2BKF A;  2XEW A;  1SJH D;  2W3S A;  1L0X B;  3ZDM C;  1KTK A;  4NNJ B;  3KLS X;  2WXI A;  2M0X A;  2DEN B;  2I2Y A;  5C2T B;  4TKN A;  1R4N I;  3H7S A;  1TS4 A;  1MPE A;  4FJZ A;  3PZ7 A;  4B0M A;  2L1A A;  3L13 A;  3AXC A;  4XGA B;  2K9X A;  4FJV B;  1K51 A;  4KIK A;  1VLB A;  4IM0 A;  1UBI A;  1UWM A;  3V6E B;  2MP2 A;  1LGR A;  3O65 B;  1P98 A;  1FPY A;  1B1Z A;  2G3Q B;  4WWM A;  1DGJ A;  4LJO B;  4RH6 A;  3H7P A;  4N58 A;  4FLH A;  3N1Z C;  2KLG A;  4PS7 A;  3AMZ A;  2C7H A;  3JVZ X;  2N9K A;  1EU3 A;  4N59 A;  1FXA A;  2N9X A;  2JSV X;  1YQB A;  4Q2J A;  2LEK A;  1LFD A;  1TKY A;  1FM0 D;  3RFZ B;  1HA5 A;  4JX1 C;  1JRU A;  1T0R C;  2D11 A;  2N9E B;  3H8H A;  4G50 A;  3VVW B;  1VZ8 A;  2N7E A;  4KZ0 A;  1Z2M A;  3R2I A;  4HKQ A;  3ZNG C;  1YD8 U;  1IYF A;  2NPT A;  4US9 A;  1JML A;  2IGD A;  1TS2 A;  1SIF A;  1TKG A;  2LGX A;  3ETR A;  3RD2 A;  1E10 A;  3GE3 C;  4P7I A;  1CQV A;  4NPN A;  3DQV A;  1L2N A;  2KYW A;  2XN9 C;  4DHZ E;  3AED B;  3VH3 B;  4RGN A;  4US8 A;  3P1M A;  2RMM A;  2CR5 A;  3WCQ A;  3JW0 X;  3B1L X;  2MJD A;  1KF6 B;  5G55 A;  1WGG A;  3FIL A;  1WJ4 A;  3LJ3 A;  2ACZ B;  1K8R B;  1QOA A;  5G2N A;  4LNK A;  2SEB D;  3N32 A;  2ZPN A;  2AEH A;  5BMH A;  3RYT A;  1ZOY B;  1I42 A;  1ET9 A;  4DHZ B;  3L17 A;  4K3C A;  2INC C;  3UIO B;  1XCT L;  3AH7 A;  2BPS A;  1UUP A;  1KLG D;  2KDB A;  1XLO A;  1QOF A;  2DNF A;  3EA6 A;  2BF8 B;  2JZ3 B;  4K1R B;  2NMQ A;  3K9O B;  1L7Y A;  2BW2 A;  4FXC A;  2J4X A;  3MC0 B;  4ANX A;  2ZEQ A;  2LVO A;  1WH3 A;  2KDF B;  2I1J A;  1NVI D;  4ZHO A;  3HVZ A;  2NR2 A;  1SF0 A;  3MJW A;  3VUY A;  3T3O A;  1DYQ A;  3DVG X;  1R4N B;  3SHQ A;  1I4X A;  4A8X C;  4JL9 A;  4YWG G;  1ZDV A;  3RT3 B;  3AU4 A;  3RUL A;  4AS1 A;  4W9J A;  2WQY B;  2GI9 A;  3KWV A;  5C1Z A;  1FCL A;  2MBQ A;  1NYR A;  5LXI B;  1D4B A;  2KFJ A;  4TMA B;  1GJZ A;  2W9N A;  2IY1 B;  2OHF A;  2IO2 B;  2L3Z A;  1WE6 A;  5BYQ A;  2Y5C A;  3WAL A;  3AE7 B;  1HE8 A;  3VR8 B;  5H8Y E; 
#chains in the Genus database with same CATH homology
 1N5X A;  2INN E;  1TKE A;  4RF0 A;  4C7Y A;  1QT9 A;  1VZ6 A;  2J53 A;  4GLS C;  1WRI A;  1F2R I;  4ARI A;  2CU3 A;  3NUH B;  1T5X D;  2QEJ C;  1XLQ A;  1XLN A;  1FFV A;  3VRB B;  4HEA 1;  1DOX A;  3ZJV A;  2WXL A;  2IGG A;  4OZB A;  2JWU A;  1TJE A;  4ITK A;  1VDV A;  2RPV A;  2ON8 A;  3TEZ A;  1GB1 A;  4CQN A;  1MHX A;  1SB3 C;  1SXT A;  1JQ4 A;  2WDQ B;  4C7Z A;  2LHE A;  2YEP B;  4OHJ A;  3Q69 A;  3CIR B;  5BMG A;  2K22 A;  1KLU D;  3GB1 A;  4OW0 A;  3E9S A;  1DOY A;  4RCO A;  3AE9 B;  3NZ3 A;  4UDU C;  1C9F A;  2JYT A;  3SR6 A;  1KH0 A;  3AB5 A;  2RDH A;  1SE3 A;  2VZK D;  2PVO D;  3Q8A A;  3W5U B;  4RNA A;  3AV8 A;  4A90 A;  1D5X C;  2BS3 B;  2KMM A;  1I4R A;  2WXP A;  4KX6 B;  4RF1 A;  2WLB A;  2Q5W D;  3BZD B;  1EWY C;  3LYY A;  2LUM A;  3AE1 B;  3P63 A;  2BTE A;  2MEK A;  3Q8B A;  1L6U A;  2CJN A;  1EWC A;  2MH7 A;  1TY0 A;  3FAH A;  3BYY B;  1ACC A;  3AEG B;  2YEP F;  3TUO A;  4JPS A;  1JRP A;  2WU5 B;  2JU6 X;  2WXG A;  1MI0 A;  4ZRP A;  1PUT A;  5H92 C;  1XF5 L;  3U7Z A;  1Q10 A;  2WP9 B;  2E6X A;  4HRS A;  2N7J A;  1CK1 A;  1EU4 A;  1WSP A;  4KGR A;  2R61 A;  1J7C A;  4O1N A;  3ZYY X;  1PGA A;  1D6E C;  1F77 A;  3GP7 A;  1YMH E;  1IBX B;  5EE0 A;  5AUK A;  4A6Q A;  1WGK A;  1V8C A;  1ZDX A;  5EE9 A;  5GXG B;  5C3J B;  4P6V F;  4USA A;  2J52 A;  1QOB A;  3W5V B;  2RDG A;  3BK2 A;  2K5P A;  3NS1 A;  4RGT A;  1L0Y B;  2JX5 A;  4YTN B;  3VRA B;  4KGS A;  1N5W A;  2BB6 A;  2W54 A;  5G5H A;  2WXO A;  3HUI A;  3TEY A;  5T8I A;  3Q8E A;  2QJL A;  4ZOH C;  1ZXI A;  3IAM 1;  2DBY A;  2W3R A;  1FD6 A;  2DWQ A;  1ESF A;  1CJE A;  1I7H A;  5BMI A;  2Y3A A;  1C4C A;  1SSN A;  1C79 A;  2W55 A;  5EE1 A;  4WH4 A;  1SBB B;  2FUG 1;  2QMT A;  1GB4 A;  1VRA B;  1D5M C;  2IJ0 A;  1XEE A;  1FFU A;  2L83 A;  1I4H A;  3AM9 A;  1E0Z A;  1XO3 A;  1T3Q A;  2M19 A;  2TSS A;  1RM6 C;  4TQ0 A;  4WIP A;  1HZ5 A;  4J3O D;  2IPK D;  3EUB 2;  3URY A;  3FC4 A;  2SAK A;  4MAC A;  3P4P B;  1I4Q A;  1JWM D;  3B2G A;  3MJ5 A;  5EE3 A;  3IT4 B;  2V4I B;  4LLG M;  4DXG A;  3AEB B;  4XE0 A;  2N0S B;  4XWW A;  4R3D A;  2WXF A;  2G9H D;  2IDY A;  1V1P B;  3P42 A;  4JWU C;  3NVV A;  1AYF A;  4IKG A;  2BS2 B;  1FNW A;  1WYG A;  3W1S A;  1FRR A;  2DYM A;  1NEK B;  1JCK B;  1N60 A;  4WQM A;  1RWS A;  4M0W A;  4KGT A;  1L6V A;  1NI3 A;  1TZO A;  1JW9 D;  1QIL A;  3P4R B;  3Q8C A;  1WXQ A;  3BVM A;  3UI3 A;  1QLB B;  3I57 A;  3KQ4 A;  4YTM B;  4WAF A;  1I4G A;  2Z8L A;  4REZ A;  5JXV A;  3EGR A;  1RYJ A;  4A9A A;  1PGB A;  1TS3 A;  5LNK 1;  1A70 A;  2KN4 A;  2L52 A;  3LXF A;  1P7F A;  5G5G A;  3P4S B;  2ICI A;  3DWM A;  4XDD A;  4GDK B;  1V1P A;  2JZP A;  4D2K A;  3FIL B;  2WXM A;  3R8B A;  4OZC A;  4IDI A;  1XXG A;  2WDV B;  1J7B A;  1J7A A;  1LO5 D;  1JWU D;  4HJG E;  3V3X A;  2WXR A;  3MP9 A;  1ET6 A;  1C78 A;  2BS4 B;  2JYE A;  3BVG A;  4L23 A;  4YSX B;  3RPF C;  5D3D A;  2DLB A;  1V97 A;  3PZ8 A;  3W2D A;  2HDE A;  2PLP A;  4YXD B;  1CZP A;  4YT0 B;  3VR9 B;  1E6E B;  1E7P B;  1ENF A;  4MH8 A;  1XLP A;  2M0A A;  2EEL A;  3MFG A;  3ZJU A;  2M56 B;  1PFD A;  4ARC A;  1ZE3 D;  3VQI A;  1BUI C;  3B9J A;  2X38 A;  3NVY A;  1DOI A;  1YJJ A;  3TSS A;  1VZ7 A;  2GB1 A;  4ZRQ A;  2PKO A;  2ONQ A;  1PDX A;  3B2F A;  2XNA C;  2KWD A;  4NJC A;  2G1E A;  1YN3 A;  1PYW D;  4B0E A;  4HRO A;  1JWA D;  3NVZ A;  1QQR A;  3ABV B;  4PT5 A;  1HQR D;  1C77 A;  3AE3 B;  5D7G A;  2PIA A;  1OQQ A;  3BVZ A;  2WS3 B;  2MJ3 A;  1SJH D;  2W3S A;  3IXS A;  1L0X B;  2KDM A;  1KTK A;  2V3P A;  4IOI E;  1N62 A;  1KFY B;  2H89 B;  2WXI A;  1D5Z C;  1R7S A;  3AEA B;  3KLS X;  2I2Y A;  2BYT A;  5C2T B;  2BT6 A;  3E56 A;  1SE4 A;  2WXJ A;  5BYR A;  1QF6 A;  1TS4 A;  3N9Y C;  5HI1 A;  3KWL A;  1MPE A;  2QSD A;  4TQ1 A;  3PZ7 A;  4B0M A;  2L1A A;  4RGO S;  2AX5 A;  3AE6 B;  2K9X A;  3SEB A;  3AN1 A;  1K51 A;  1VLB A;  3IAS 1;  5HG2 A;  5BYS A;  1SIJ A;  1VJK A;  5HHD G;  1AWD A;  1L5P A;  3O13 A;  1BXT A;  1GOZ A;  1UWM A;  3BK1 A;  1TY2 A;  2PW9 A;  1M4V A;  1B1Z A;  2LHD A;  3DWG C;  1IBX A;  4WWM A;  4KKI A;  4XDC A;  1FO4 A;  4DXF A;  1DGJ A;  2WNM A;  4RH6 A;  2AQ1 B;  1NEN B;  4N58 A;  4TSS A;  4L1B A;  1C76 A;  1UNS A;  5TSS A;  1FXI A;  4MT5 A;  3AE8 B;  3AMZ A;  2V0G A;  3W9C B;  2N9K A;  2NTT A;  1EU3 A;  4N59 A;  1FXA A;  1E9M A;  2JSV X;  2NTS A;  1ZPS A;  4Q2J A;  1FMA D;  2LEK A;  4YSZ B;  1UGJ A;  4WUR A;  2WXH A;  1TKY A;  4EE2 A;  1FNV A;  1FM0 D;  3ZQ4 A;  1IGC A;  2JQR B;  5FK9 C;  4ZHP A;  2ZW0 A;  3RFZ B;  3R2T A;  1HA5 A;  4JX1 C;  2WXK A;  1JWB D;  3H8H A;  4YSY B;  1QOG A;  1Y56 A;  1VZ8 A;  2FE8 A;  1UWX A;  2FBW B;  1ZXH A;  3R2I A;  1YN5 A;  1F2R C;  3I9V 1;  4RGM A;  4HKQ A;  4JE3 B;  4US9 A;  2VZK B;  1JML A;  3TEX A;  2IGD A;  1TS2 A;  2KAJ A;  2WU2 B;  3TEW A;  1TKG A;  1GPX A;  4RFB A;  3ETR A;  5FKA C;  1C4P A;  1E10 A;  1JAL A;  1CQV A;  1AN8 A;  2LMC A;  2ZW1 A;  2XN9 C;  2LGI A;  2WDR B;  2AQ2 B;  3AED B;  3ZGZ A;  2J42 A;  2Y5P A;  4RGN A;  4ZYS A;  3NRZ A;  2BB5 A;  4US8 A;  2HTM E;  3P1M A;  3BWU D;  1T6B X;  1JRO A;  4NZL B;  1YN4 A;  3U2S C;  1B9R A;  2RMM A;  2LJI A;  1L4Z B;  3SFD B;  2I38 A;  3LB8 C;  3ZJT A;  4GDL B;  4DQO C;  4JWS C;  4OVZ A;  3WCQ A;  5I4D A;  2MJD A;  1YJI A;  2PMV A;  1KF6 B;  1KRH A;  4C56 C;  3FIL A;  3U4E G;  4P16 A;  2ACZ B;  4LTU A;  1QOA A;  1FNU A;  2N9L A;  4C80 A;  3AE4 B;  2SEB D;  4LK0 M;  1FEH A;  5HFY A;  4HKZ E;  5BMH A;  1N61 A;  1YQ4 B;  4H2A A;  2AQ3 B;  1ZOY B;  3P4Q B;  1ET9 A;  1YNT E;  1BML C;  3J9C A;  1L0V B;  2E3T A;  3C8Y A;  5AUI A;  1FIQ A;  1XCT L;  3AEF B;  2KQ4 X;  1HZ6 A;  3HVD A;  3AH7 A;  3HRD D;  1EM7 A;  1STE A;  1ROE A;  2IGH A;  1P7E A;  1UUP A;  3IT6 B;  1KLG D;  1FRD A;  3BYT B;  2B76 B;  4NAW B;  1K52 A;  1QOF A;  1XLO A;  3EA6 A;  2W82 A;  1V1O A;  2LFI A;  3V05 A;  1TS5 A;  1QKZ A;  2NMQ A;  2BW2 A;  1SE2 A;  4FXC A;  2J4X A;  2H88 B;  3MC0 B;  3T3N A;  3PO0 A;  2L32 A;  2KAC A;  1VR9 A;  1RFK A;  3CWI A;  1NYQ A;  1MVK A;  1K50 A;  4YTP B;  3U52 E;  2PVG C;  3GS2 A;  1NVI D;  4ZHO A;  3SFE B;  3HVZ A;  1IUE A;  2OED A;  2CJO A;  1SF0 A;  2K0P A;  2WXN A;  1YQ3 B;  1F0Z A;  3Q8F A;  1ZUD 2;  1K53 A;  2GRI A;  1I4P A;  1L4D B;  2INP E;  4NAM A;  1WWT A;  5FR3 A;  1OQR A;  4AQ7 A;  3T3O A;  1DYQ A;  3MHZ A;  3OWE B;  4MM3 B;  1N63 A;  2V3N A;  1I4X A;  1FCC C;  2PTL A;  4A8X C;  3AE2 B;  4YWG G;  1SJE D;  1ZDV A;  1HXY D;  2D5G A;  4OZA A;  2JXT A;  2WXQ A;  1TYG B;  4XWT A;  2QIE B;  3NVW A;  1AW7 A;  4AS1 A;  1ZP0 B;  2WQY B;  1GAQ B;  2MJE A;  2GI9 A;  3KWV A;  5D3I B;  4L2Y A;  1FCL A;  1NYR A;  1XCQ L;  1D4B A;  1C4A A;  1JWS D;  1IGD A;  4TMA B;  4KKJ A;  2OHF A;  3BII D;  2BBC A;  5E6J A;  5MPO A;  2K3U A;  3AE5 B;  2DYO A;  1SEB D;  4A55 A;  1OFF A;  3L4P A;  1MHH E;  2Y5C A;  3AEC B;  5BYQ A;  1HEZ E;  2EKI A;  3AE7 B;  3VR8 B;  5H8Y E;  1PGX A;  2QIL A;  3AEE B;  4N6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...