1F2RC

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
molecule keywords CASPASE-ACTIVATED DNASE
molecule tags Dna binding protein
source organism Mus musculus
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rC00
1PGXA 1FCCC 1GB1A 2GI9A 1IGCA 5JXVA 4KGTA 2NMQA 1K53A 2JU6X 5HI1A 1F2RC 2IGHA 3UI3A 1MHHE 2ONQA 2I2YA 2PW9A 1D4BA 1MI0A 2ZW0A 2K0PA 1FCLA 1C9FA 2LUMA 1UWXA 2JWUA 5BMHA 4IOIE 2IGGA 2JXTA 1K51A 1HEZE 4D2KA 4GLSC 2J52A 2J53A 1F2RI 4HJGE 1YMHE 1XF5L 4OZAA 2I38A 2LGIA 5HHDG 1MHXA 2JZPA 1JMLA 1P7FA 1EM7A 3GB1A 2GB1A 5BMGA 2QMTA 1KH0A 2LHDA 2ZW1A 1IGDA 3V3XA 5BMIA 3FILA 2ON8A 1Q10A 1MVKA 2EELA 1HZ6A 3FILB 4KGSA 1IBXA 5HG2A 2OEDA 1MPEA 4KGRA 1FD6A 1XCTL 1P7EA 1PGBA 2N7JA 4IKGA 2LHEA 2KQ4X 2KACA 2N9KA 1K52A 2RPVA 1XCQL 2N9LA 4OZBA 3MP9A 2IGDA 1K50A 1PGAA 1QKZA 2PLPA 2JSVX 4HKZE 1ZXHA 4MACA 2RMMA 1YNTE 2KWDA 2QSDA 1GB4A 1IBXB 2KN4A 4OZCA 4WH4A 2KDMA 5HFYA 2PTLA 1HZ5A
chains in the Genus database with same CATH superfamily
4RGOS 4L1BA 5KHQA 3U2SC 2FBWB 2LEKA 4W9FA 4A20A 4WWNA 3APFA 3Q6BA 1TIFA 4GDLB 2BKRB 1TY0A 1C9FA 3HM3A 4BVUC 2XEWA 3EECA 4OVVA 2BYFA 4P1CC 3AEEB 1I4PA 1SIFA 4PS3A 3H8HA 1Z2MA 2NPTB 2WXOA 2WXHA 2HD5B 3U30A 1S1QB 3IT6B 1XF5L 1C3TA 2G4DB 1C1YB 1QOGA 5JHAA 3VRAB 1ET6A 3Q3NC 3VH3B 1VRAB 4YSYB 1XT9B 1WM3A 2QMTA 4ACFA 4C4VA 1L0XB 3A9JB 3V3XA 2KVRA 2KN5A 1RFAA 3B0AA 4WWMA 1NDDA 1SB3C 3ML9A 2WU2B 1ZDXA 3ENEA 3SDLC 5TR5A 1WZ0A 3HUIA 2JYTA 4ANVA 3DVGY 1UZXB 5E6PA 1M4VA 1ZDVA 2CU1A 2XK5A 2KJ6A 3HK0A 4JPSA 3AM9A 2W9NA 2HJ8A 3V6CB 1CQVA 2N1VA 2KT7A 3SD5A 2PTLA 3X0WA 2JRHA 5DPRA 1OGWA 2YLMA 3IBEA 4WJOA 3NS8A 2N1WA 1BMLC 4L2YA 1WJNA 4YTPB 3SFEB 4LNNA 2L8JA 4JGHB 3D32A 3KLSX 2AQ2B 3T3NA 1LGRA 1P98A 1TS3A 1UWXA 4JWUC 1F77A 4EOYA 1Y8RC 1SE9A 1UBQA 1QOBA 2MRPA 2IO0B 2JPHA 3AI5A 2I1KA 1K51A 3WCQA 1I35A 2KD0A 3CSTA 2J52A 5J2RA 1F2RI 3GS2A 2BYEA 1WJ6A 4DHJB 3PRPB 4JIOU 3ZNID 3DBSA 3OJ4B 2MP2B 3EGRA 1P7FA 1UH6A 5IO9A 3BYTB 2MBBB 4ZDVA 3L08A 2KDFB 1WGKA 2R61A 1P0RA 2D3CA 3H7PA 1QQRA 3MC9A 4NY0A 4WQOB 1N6ZA 5LLIA 4ZRQA 5IN7A 4IM2A 2DX5B 1ET9A 3DOWA 1SXTA 4BOZB 1RLFA 1YQBA 1ESFA 1MPEA 3JSVB 4MEMA 1WXSA 1GNUA 3ZTDA 2N9KA 4RM8A 3ZJUA 3Q69A 3RNCC 1A70A 3RFZB 2LUEA 3AB5A 2Y5BB 3MC0B 2CS4A 3MHSD 3RNAC 4FHJA 2K9XA 4KZ0A 3NS1A 4FLHA 2IO1B 4HWIB 3VTWA 1DOIA 3BWUD 1AN8A 1DYQA 4M0WA 4W9IA 2KMAA 2KN4A 2KWCA 2LRUA 4ANXA 2X8XX 4CO7A 3U4EG 3R66C 1I4GA 4HPMB 1AYFA 4KKIA 1QZEA 2ONQA 2NBUA 3RNFC 2KO3A 1N62A 1D4BA 2MJEA 2VH2A 4G3XB 1FCLA 1WXMA 1CJEA 2Z0DB 3OG5A 4IOIE 3L4PA 2R2OA 2IYDB 4G0NB 3X23A 4ITKA 1KLGD 1F9JA 4HCPB 2OOBB 1L4ZB 1V1OA 3W1SC 4MJSB 2ASQA 4A8XC 1BUIC 1Q5WB 4P1BC 2DZIA 2KQ7A 2LGIA 3ZDMC 1JMLA 4GXBA 1EO6A 1NI2A 1I4XA 2I1JA 1HXYD 4JQWC 4HRSA 2Y3AA 3BK1A 5G55A 4FHKA 1E5WA 1WX9A 4GB9A 3VHTC 3VFKA 1KLVA 1MG4A 4RCOA 2L0FA 1HE8A 3RMKC 4ICUA 2WX0A 4ZRIA 1F1HA 2WXQA 4C7ZA 4XDDA 2JYEA 3MFGA 1TKEA 3TMPB 2V3PA 2WWZA 2IZVB 1JRPA 2MJ3A 3EC8A 3C8YA 3MP9A 5AUKA 3W2DA 4YXDB 2PLPA 2O6VA 4URKA 1OQYA 2AQ3B 2QSDA 2VRRB 2LGYA 3S2AA 3WALA 2KDMA 2RGFA 3ZRFA 3K9PB 2JY6A 2PKOA 5DPTA 2KYWA 2B76B 2M8SA 1VCBA 1D5XC 1ACCA 2IJ0A 3C0RB 1XLOA 2JU6X 5I4DA 5TSSA 2ZPNA 4WJNA 3VRBB 2VH1A 3NJTA 2IO2B 4EZKA 2DYOA 3TBLD 1UD7A 2W82A 4FA6A 5IA7A 2NTTA 2L76A 1UGJA 3SFDB 1N5XA 3KH0A 3BIID 2JXTA 1HEZE 4EEWA 3ZVVA 4GLSC 2LGDA 2LVQA 3AE6B 2BS3B 2KJRA 3MJ5A 1WXVA 4OZAA 2JQRB 4NJ7A 1WMHB 1TJEA 1TT5B 4DBGA 3BVGA 2H88B 3VTVA 2GBMA 2K8HA 3A9KA 3L13A 1IGDA 4IM3A 1FM0D 3FILA 2K3UA 3NG0A 1N60A 3Q3FA 4HDOA 1HZ6A 1TZOA 2ZCBA 4GSWA 4BOSC 5AEKB 2JZ3B 4MELA 3TIXA 1WI0A 4NJ6A 2K39A 2DYBA 1IBXA 3VQIA 4PS8A 4XC2A 1D3ZA 1QT9A 1EWCA 1P7EA 1PGBA 2REXA 3E56A 1R4NB 1E90A 2KACA 2PIAA 1CK1A 1U4AA 1JW9D 2N9LA 3AE8B 2CHZA 3AE2B 2RPQA 3EFUA 4AJYB 3AV8A 2G4SA 1PGAA 2C9WB 1VD2A 1ZOYB 4S0RA 2HJ1A 3Q8EA 4DHZE 4MGIE 4FADA 1I4HA 2O2VB 1HQRD 3FAHA 2DENB 3ECIA 1PGXA 4LNKA 1FCCC 1GOZA 2V1YA 3U7DA 1WE7A 2NPTA 3CWIA 3W1YA 3RPFC 3I57A 2D11A 5HI1A 4BBNF 2IGHA 3N9YC 1EU4A 3VUYA 3AMZA 4KZCA 2D07B 1UELA 1JQ4A 3AEDB 2CR5A 2OJRA 2JWUA 1E8YA 3M3JA 2AEHA 3KVFB 4ARIA 4EKUA 2JWZA 2GOWA 4REZA 4E3CA 3AH7A 4MM3B 1YMHE 3PZ8A 1L6UA 2I38A 3IG3A 1E7UA 5IAAC 2D3AA 2MSED 4WQMA 1TY2A 2WDTB 2MJDA 1GC7A 2CKHB 3IAS1 3ALBA 5AZHA 5HKHA 1WSPA 3E9SA 2BBCA 4LDTD 3V61A 2NS5A 2EKIA 4HKQA 2DZMA 4H2AA 1RWSA 1C79A 2D10A 3ONSA 1FXIA 2C60A 1WGDA 3PSEB 3KWVA 3UQBA 1BT0A 2LXCA 1IPGA 4ZHOA 3QX1A 2K8BA 2Q5WD 4CYEA 3RD2A 4NPNA 3AE9B 2A5UA 4DXAB 4BZAA 1E9MA 1GC6A 3R2IA 2MCNB 2KNBA 1HZ5A 1XLQA 4XX5A 1SBBB 4TV3A 1V1PB 4GOCA 1STEA 1NYQA 1C76A 2QILA 5KHOA 2KDIA 2L00B 2O6VD 3DBLB 2PE9A 1B9RA 1WR1A 3UI3A 2CJNA 2MP2A 1ISNA 2ZW0A 2K0PA 4B0EA 3TCAA 1QF6A 4TMAB 2N7EA 1TGZB 2LJIA 1JRUA 1WF9A 2BWFA 2FCNA 2WHIA 4Q2JA 2LI5A 5AUIA 4M01A 2UWQA 4XWWA 4IG7B 3JSVA 1AARA 4NZLB 3PV1A 3VDZA 1OFFA 2GB1A 4ZYSA 5DPSA 2ZNVC 1V80A 4IW0A 2FCMA 4XZ4A 3PT2B 2E6XA 3CSFA 3V6EB 2LVPA 1ZPSA 2PVGC 3NZUA 2JVCA 2MQJA 2FUHB 2JX5A 4B95A 4OW0A 2OEDA 5D3IB 2KFKA 2FCSA 1WGGA 2BWES 4NNJB 1WYGA 1L5PA 1K52A 1SJHD 1YQ3B 4HPLB 1KFYB 3MHZA 1OQRA 3OLMD 1E7VA 3KYCD 2WXNA 4L23A 4RFBA 1MJDA 2BKFA 4PYUA 2JRIB 1R4NI 1JWBD 3EHVA 2ACZB 2MWSB 4A6QA 2D2QA 3W9CB 2V0GA 1PDXA 1WIAA 4DHZB 3KUZA 4LK0M 1R4MI 3HVDA 3T3OA 2WDVB 2KAJA 4E71A 4KIKA 2L83A 2PVOD 1FIQA 1D5ZC 5EDSA 2WXPA 4P16A 4BFRA 3WA0A 1H4RA 3PO0A 1FFUA 1OQQA 4KVGB 2QIEB 3APCA 2MBOA 3B2GA 1JWMD 2EMTA 1G6JA 4W9GA 3AE3B 1SSNA 4XWTA 2RDHA 1KOTA 2M4NA 4WJQA 1WY8A 1YX6B 4LLGM 4O1NA 1N5WA 4G11A 4EZJA 2K6QA 1CZPA 2QEJC 1L7YA 1TTNA 1VZ6A 1D5MC 3ZKJC 2UU7A 1MG8A 3SEBA 1KH0A 1WGRA 1FRDA 1WX8A 3DCGA 5IP4D 1ROEA 3GE3C 3Q8FA 2ZNVB 4M8NA 3KW5B 4ICVA 2ON8A 2MHJA 3I63C 3IHPC 3V60A 4KGSA 2W3SA 5J17A 4KV2A 1TYGB 3PRZA 3ZNZB 1MFWA 4ZRKA 4A3OA 2L05A 1TS4A 4KKJA 3EFCA 5C23A 3ZJVA 2L1AA 2KK8A 1LXDA 2M0AA 1J7BA 2ZPYA 1QKZA 3RCZA 1C4PA 2JSVX 1EU3A 4MH0E 5CHWA 3DHGC 4IWPA 1F52A 1S3SG 2KDEB 3ZDTA 3A4RA 4FXCA 2K8CA 1VJKA 1SGHA 4US8A 1WJ4A 4MH8A 2IY0B 3Q3OC 2PEAA 3TEZA 3VUWA 3W1SA 4EUTA 4ZHPA 2BGFA 3PVLA 3GZNB 1WRDB 2PW9A 3NUHB 1JWUD 1Q0WB 4RM9A 5CHVC 3AEFB 1TBEA 2KZRA 3DBLI 1HA5A 4MDKE 4D2KA 4NAMA 4K3BA 3EUB2 3CIRB 2WXGA 5JZEB 3A1QB 2INNE 1UWMA 2LXAA 3Q14C 3PRMB 4DK5A 1WGHA 1XXGA 2IPKD 4XDCA 1JWAD 1E0ZA 2BT6A 4C4VB 4FN2A 1ZKHA 2N0SB 4ANUA 4N9F4 2X38A 1QOFA 3Q3JA 1FFVA 5CHFA 3HVZA 4ZRPA 5D2MB 5BYQA 1NENB 3N3KB 1T0RC 4KX6B 2C5LC 4LJOB 2BYTA 4M00A 1WE6A 2RDGA 2MH7A 4F8CB 3UF8A 3N32A 3T9LA 3B08A 3RYTA 3LYYA 3AU4A 2D3BA 4W9KA 3EA6A 4BBNC 2BPSA 1YD8U 2L32A 2IGDA 2XK5B 3W5VB 3TEWA 3HHMA 3IT4B 4MACA 2RMMA 1PQSA 2KWDA 3M95A 5CX3A 1FXTB 2YVCA 4WH4A 3ZYYX 3Q8BA 3HM6X 1GG3A 1KJTA 2XBBC 2KJHB 1C4CA 1UBIA 1J7AA 2WXRA 3L17A 2FIDA 1B1ZA 4GDKB 2TSSA 1QLBB 4C7YA 2BVCA 4TQ0A 1YN3A 1WR6E 4A3PA 2J7QB 1WXAA 3K9OB 4YSXB 5BMHA 1F0ZA 4A90A 1J19A 1YJJA 3KYDD 3Q8AA 4IWQA 4MSMB 1ZP0B 2MX2A 2ZJDA 2LGXA 1ZGUB 2YEPB 3ML8A 2DLBA 4XYCA 4NAWA 2DBYA 3P1MA 5GXGB 3M63B 3VUXA 2LASA 3NZ3A 1JCKB 5D3DA 2NTSA 2GBNA 4IC7B 1GUAB 3R7QA 2KKCA 3H7PB 4TKNA 3AN1A 3I5JC 2MBQA 1IUEA 1T6BX 1SJED 2EMSA 2D5GA 3H9DA 5HG2A 4YTMB 2WNMA 4DDGD 2KTRB 1XQQA 2BS4B 1LM8B 1RRBA 2KMMA 2YEPF 5L95C 2AL6A 2DZJA 1FEHA 4BKSA 2R2QA 3WAOA 2QC8A 3ZQ4A 1HTQA 2WU5B 1UUPA 4RF1A 1SE3A 1OEYJ 4FBJB 2CHXA 2JUOA 5IOIA 4OZCA 1R7SA 3RNEC 2AQ1B 5G5GA 3VR9B 5D94A 3QHTA 2LFIA 2BB5A 4ARCA 1SE2A 4NQLB 2OJWA 3ZLZA 4HEA1 1J0GA 3BVZA 4GDLA 3DHHC 4UDUC 1KTKA 3L16A 3LJ3A 2LUMA 1OTRB 1DOXA 1Z5SB 4II3B 2XNAC 4R3DA 3V05A 4YL8A 4M02A 4S17A 2KC1A 2VZKD 1EF5A 2WXKA 3P2BA 4DWFA 2WGSA 3GZNI 3N1ZC 3NHEB 2FIFA 1ENFA 2IY1B 3MTNB 4LDTB 3ZNGC 1MHXA 1SEBD 1M94A 5G2NA 1V2YA 1T0QC 4JL9A 2E3TA 3ETRA 3QJZA 2M1MA 4MSQB 4WAFA 3JW0X 2LHDA 2MBEA 2WX1A 3A9JA 2WS3B 1YJIA 1FPYA 3CF6E 3AE4B 2XN9C 2RDBC 3B9JA 3P4PB 2WP9B 1E7PB 4AQ7A 1NYRA 5BYSA 3PHWB 2Y5PA 4NJCA 1VZ8A 2GMIC 2LZ6A 4JWSC 1FMAD 1L2NA 2H89B 3HIZA 4ZOHC 1XCQL 3DVNV 1Q1OA 2QDFA 1L0YB 1T0YA 2M19A 1VZ7A 3QA8A 1TS2A 1RAXA 2J0JA 4HKZE 4ASWC 2AWTA 3N1XC 2O6VB 3ZTCA 1DOYA 4PK1A 4GU2A 4A9AA 2Z8LA 3AEBB 2Z59B 4C56C 3DBRB 5G5HA 4PYZA 3V62A 4B0MA 3AEAB 5EE0A 2LGSA 3BZDB 2MA9B 4DDID 2L3ZA 1J8CA 3L0WB 2IBIB 2I2YA 2WDRB 2DAFA 2FNJB 3WAPA 4DQOC 4EE2A 5MPOA 1KLUD 2Y5CA 4AUQC 2NR2A 1SE4A 4AP4C 5FR6A 4B9KA 2KOXA 2D3GA 4IWOA 3NVYA 2BTEA 2KXJA 2J53A 4E74A 1ZXIA 4W9HA 3DBHB 2KMCA 2G1EA 5H92C 1K8RB 3KUCB 3LXFA 2JZPA 3GE8C 3H6NA 1I7HA 2G3QB 2KWVB 2BB6A 2MLBA 4II2B 1WX7A 3QIJA 1I42A 1FRRA 3A9KB 3B2FA 2BF8B 3QC8B 4YT0B 1KF6B 3FILB 2HTME 2CU3A 2CJOA 3OAWA 1E8WA 4N6EB 1AWDA 2JT4B 3PZ7A 3AEGB 1YN5A 2ZVNA 3R8BA 2N7JA 4FULA 2MBHA 4IKGA 2RSUA 1FNWA 4XE0A 5LXIB 3ZJTA 1RYJA 3QCAA 2ZZPB 3NOBA 2G45B 3ZNHB 1V8CA 1RM6C 3BY4B 3SU8X 3SHQA 3VAWA 3MJWA 3AECB 4RNAA 2KHWB 4BKSD 2C7HA 1WYWB 2PPHA 3HRDD 5EE9A 1K53A 1LQBA 4P7IA 3PPAA 3A1QA 2V4IB 5E6NA 1T5XD 1FO4A 3Q3MC 3BYYB 1I4RA 2IGGA 3QQ8B 1YIWA 4FJVB 3M62B 4W9JA 2K1FA 1NEKB 3PHXB 2BW2A 3P4QB 4MJSA 3PLUA 2JZZA 2LRWA 2NBVB 1L6VA 3T8MA 2RD0A 1XD3B 1QILA 1FNUA 2L7RA 1V6EA 3IXSA 3URYA 4AS1A 3OWEB 2BYVE 3ABVB 2HDEA 2GBRA 3UINB 1WH3A 4A55A 2ZW1A 3BINA 2KX0A 4N58A 1OEYA 3DDCB 3L10B 5JHBA 4BKGA 4GGQA 4MGZE 3RI7C 4HJKA 2KFJA 4W9CA 3SR6A 3L54A 3JYUA 3W5UB 1Y56A 4LTUA 5C1ZA 4GIVA 1VDVA 1C4AA 2LHEA 3RULA 1PUTA 3WAMA 1WWTA 2RPVA 4MT5A 2LVOA 2NCNA 4GDKA 3KWLA 3AULA 4CQNA 2AYOB 4RH6A 4K7SA 3NRZA 4AOFA 4YSZB 1WM2A 2RR9A 3N20C 3UIOB 1C78A 2WXJA 2MW5A 3ZGZA 1KRHA 5E6JA 1L4DB 2GI9A 4B6WA 1YX5B 4KGTA 4TUUA 2M0XA 3DHIC 1GAQB 5H8YE 5DPWA 1V5OA 3A33B 4RGTA 1YN4A 3A4SC 5BYRA 1I4QA 2PJHA 3DBRI 2DWQA 1UGMA 4I6LB 3RUIB 4K3CA 2W54A 3DQVA 2DAJA 1QOAA 4HDQA 1P9DU 2J4XA 2V9HA 3PZDA 1IYFA 3AE7B 2K22A 2FE8A 1TKYA 3QARA 1PYWD 1WMHA 2JXXA 2KTRA 5BO4B 3VR8B 5JH5C 3PREA 2K6DB 1NI3A 4HVBA 4DHJD 1N63A 1RFKA 5D7GA 1YOVB 3TEXA 2AX5A 4GMVA 4KDLB 3DBHI 4RF0A 1T3QA 4K7UA 3IAM1 4I6NB 2G9HD 1TS5A 3TEYA 3JVZX 5C2TB 2WQYB 2LMCA 2KFKB 2KLCA 3N30A 3TL5A 3WIMA 3KQ4A 2KQ4X 3O65B 1EWYC 2W3RA 3NY5A 3NVWA 1SIJA 4WAAA 3P4SB 3U7ZA 5AZGA 1SF0A 2DZKA 2N9PC 4OVUA 3J9CA 1CMXB 5DCNA 3VH4B 1ZXHA 3H7SA 4DXFA 4I6PA 3TSSA 3U8ZA 1WRIA 4K81A 2DHZA 1YJ1A 5E6OA 1GB4A 2KX3A 2O2VA 2N9EB 1ZE3D 4NQKE 4PS7A 2INDC 2ZCCA 4EZLA 1H8CA 2KANA 1IGCA 2N9XA 5JXVA 2ZEQA 3GP7A 4F1SA 4F7ZA 2NMQA 4XGAB 1YQ4B 4ZRJA 2WXIA 1TZ1A 3WANA 4KIKB 4ANWA 5C3JB 4HROA 1MI0A 2QJLA 3FKYA 2C7NB 2FUG1 3IFWB 4TQ1A 2GLSA 2GBJA 1JROA 1P3QU 2BS2B 1V5TA 1WJUA 3AU5A 4J3OD 1JALA 3LB8C 4IUMB 2QCZA 4C80A 4EFOA 2WXLA 4WIPA 3UGBB 4YTNB 3Q8CA 4X57B 4MM3A 2JF5A 2KVZA 2DYMA 1X1MA 2M17A 1KM7A 4JE3B 4FJZA 4FJYA 1L0VB 3DPDA 2V3NA 1GPXA 3P42A 3QWZB 1EM7A 3GB1A 3OJ3A 3NZSA 5BMGA 4TSSA 4HCNB 3RNBC 4AJWA 3ZO5B 1AW7A 2ZVOA 4GN1A 4JX1C 1MVKA 2C7MB 1N61A 3P63A 4HLEA 4HPPA 3VXWA 5LNK1 2M56B 5FKAC 1DGJA 3PLVA 1V86A 2UYZB 3MC8A 1TKGA 2CHWA 4LCDE 3ZRCA 4K1RB 4W9EA 4WJPA 3I9V1 3N1YC 2NBWB 5LXHA 4AWJA 5HFYA 1V1PA 2WXMA 3Q2AC 1GB1A 4HK2A 1XLNA 3RZFA 2N7DA 2OHFA 1F2RC 3GOEA 4G50A 1E6EB 1VLBA 2Z0EB 3VTUA 4KSLC 4ZYNA 5CTRC 3APDA 3BK2A 2VZKB 3U52E 2GBKA 1LO5D 1WFYA 4M0WB 3ZXVA 3TUOA 1HTOA 2J42A 5L83A 3PS6A 1FXAA 3UIPB 3AE1B 3RN9C 2IO3B 2FAZA 3DWGC 2NVUI 3QK0A 4KDIC 4BAXA 3NVZA 3PTFC 2DNFA 1WGYA 4BKTA 3DVNU 2PE6B 4CHKA 3LDZE 2J0KA 4PT5A 4QAYA 4C00A 4YWGG 1EUVB 4RGMA 3DWMA 5BMIA 1R4MB 1Q10A 2EELA 1A5RA 1D6EC 3ZW3A 1ZW7A 2WYQA 4HXDA 4LNOA 2KWUB 2LWPA 1PFDA 1XCTL 1VR9A 1FNVA 1P1AA 2K25A 2A4ZA 5GMVA 2INCC 2FCQA 2WDQB 2N4FA 4IDIA 3TJPA 2W55A 4P6VF 2MEKA 5AZFA 4W9LA 4J6IA 2V4LA 1V97A 4LNIA 5IKCM 4OVZA 2EKEC 4US9A 1J7CA 2AL3A 1V9JA 2L52A 1EF1A 3P4RB 2J0MA 1MHHE 3ZIMA 5EE1A 3DVGX 1E10A 4RGNA 3RNGC 1WZ3A 3IVFA 3I3TB 4JLCA 3C19A 1UNSA 1V81A 1C77A 3O13A 1T0SC 1XO3A 2V3SA 2WXFA 1WXQA 3BVMA 2QHOA 2SEBD 3UQAA 2IDYA 5T8IA 1UF0A 3R2TA 4RMAA 4HJGE 2B3AA 2KTFA 1E8XA 3NVVA 1BXTA 3R7RA 1ZUD2 5HHDG 4NAWB 2GRIA 2SAKA 2HTHA 2KC2A 5J18A 4LJPB 2ICIA 4USAA 4LNFA 1XEEA 2LJ5A 4WWPA 2KDBA 4OHJA 3ZXRA 2K5PA 3H1UA 3AE5B 2BQQA 3ZUNA 4KGRA 2PMVA 3R3MA 4IM0A 4WWOA 1FD6A 3VVWB 1JWSD 3CMMB 3RZWC 4WURA 1IP9A 1XLPA 4KSKC 5FR3A 4N59A 3RT3B 1E8ZA 1NBFC 4MGKE 5EE3A 2LD9A 4MGYE 1V49A 1LFDA 2HE7A 2KQSA 4DXGA 3FC4A 4OZBA 2WLBA 3AXCA 1K50A 1NVID 2L0TA 4M8MA 3KUDB 3B1LX 5D6JB 1GJZA 1YNTE 2INPE 3PGEA 4W9DA 1IBXB 5FK9C 2KLGA 3QAQA 4K7WA
chains in the Genus database with same CATH topology
1KRHA 4RGOS 1PGXA 3Q8BA 1FCCC 5E6JA 1L4DB 4L1BA 1GOZA 2GI9A 3U2SC 2FBWB 3CWIA 1C4CA 4KGTA 2LEKA 3RPFC 1J7AA 2WXRA 3I57A 5HI1A 2IGHA 3N9YC 1B1ZA 4GDKB 1GAQB 5H8YE 2TSSA 1EU4A 1QLBB 4GDLB 4C7YA 3AMZA 4RGTA 1YN4A 4TQ0A 1TY0A 5BYRA 1YN3A 1I4QA 1C9FA 1JQ4A 3AEDB 2JWUA 4YSXB 5BMHA 1F0ZA 4A90A 2DWQA 1YJJA 3AEEB 1I4PA 3Q8AA 4ARIA 3H8HA 1ZP0B 2W54A 1QOAA 4REZA 2J4XA 2WXOA 2WXHA 2YEPB 3AE7B 2DLBA 2K22A 2FE8A 3ZGZA 3AH7A 4MM3B 3IT6B 1YMHE 1XF5L 3PZ8A 1L6UA 1TKYA 1PYWD 2I38A 1QOGA 3VR8B 3VRAB 1ET6A 4WQMA 2DBYA 3P1MA 5GXGB 1VRAB 4YSYB 1TY2A 3NZ3A 1JCKB 5D3DA 2QMTA 2MJDA 2NTSA 1NI3A 3IAS1 1L0XB 1N63A 1WSPA 1RFKA 3E9SA 3V3XA 3AN1A 2BBCA 5D7GA 2EKIA 1IUEA 2AX5A 3TEXA 4HKQA 1T6BX 1SJED 4H2AA 4WWMA 2D5GA 4RF0A 1RWSA 1C79A 1SB3C 1T3QA 3IAM1 5HG2A 2WU2B 4YTMB 2G9HD 2WNMA 1TS5A 1FXIA 1ZDXA 3TEYA 5C2TB 2WQYB 2LMCA 3KQ4A 2KQ4X 3KWVA 1EWYC 2BS4B 2W3RA 2KMMA 3NVWA 3HUIA 1SIJA 3P4SB 2JYTA 2YEPF 3U7ZA 1SF0A 1FEHA 4ZHOA 3J9CA 1M4VA 1ZDVA 2Q5WD 1ZXHA 3ZQ4A 2WU5B 1UUPA 4RF1A 3AE9B 4DXFA 3TSSA 4JPSA 3AM9A 1WRIA 1SE3A 1GB4A 1CQVA 1E9MA 3R2IA 4OZCA 1R7SA 1ZE3D 2PTLA 2AQ1B 1HZ5A 1XLQA 5G5GA 3VR9B 2LFIA 1SBBB 2BB5A 1V1PB 1IGCA 4ARCA 1SE2A 5JXVA 1STEA 1NYQA 1C76A 2QILA 3GP7A 2NMQA 1B9RA 1YQ4B 1BMLC 4L2YA 3UI3A 4HEA1 2CJNA 2WXIA 3BVZA 4YTPB 4UDUC 3SFEB 5C3JB 1KTKA 4HROA 1MI0A 2QJLA 2ZW0A 2K0PA 3KLSX 2FUG1 4B0EA 2AQ2B 2LUMA 4TQ1A 3T3NA 1TS3A 1UWXA 1DOXA 1JROA 4JWUC 1F77A 1QF6A 2BS2B 2XNAC 4R3DA 4TMAB 3V05A 1QOBA 2LJIA 1JALA 4J3OD 3LB8C 4C80A 2WXLA 4WIPA 4YTNB 1K51A 3Q8CA 3WCQA 2VZKD 2J52A 4Q2JA 2WXKA 2DYMA 5AUIA 1F2RI 3GS2A 4XWWA 1ENFA 4JE3B 1L0VB 4NZLB 2V3NA 1MHXA 1OFFA 1GPXA 3EGRA 3P42A 1SEBD 1P7FA 1EM7A 3BYTB 3GB1A 2E3TA 2GB1A 3ETRA 5BMGA 4TSSA 4ZYSA 4WAFA 1WGKA 2R61A 2LHDA 2E6XA 2WS3B 1YJIA 1AW7A 1ZPSA 1QQRA 2PVGC 4JX1C 3AE4B 1MVKA 2XN9C 3B9JA 4ZRQA 3P4PB 1N61A 2WP9B 2JX5A 1ET9A 1SXTA 1E7PB 3P63A 1ESFA 4AQ7A 1NYRA 5BYSA 4OW0A 2OEDA 2Y5PA 1MPEA 4NJCA 5D3IB 1VZ8A 5FR3A 2N9KA 4JWSC 1FMAD 1WYGA 5LNK1 3ZJUA 1L5PA 2M56B 1K52A 3Q69A 5FKAC 1A70A 3RFZB 2H89B 3AB5A 1SJHD 4ZOHC 1DGJA 1XCQL 1YQ3B 1KFYB 3MHZA 1L0YB 1OQRA 3MC0B 2M19A 1VZ7A 1TS2A 2K9XA 4HKZE 2WXNA 3NS1A 1TKGA 4L23A 4RFBA 1DOIA 3BWUD 1AN8A 1DOYA 3I9V1 1DYQA 4M0WA 4A9AA 2KN4A 1JWBD 2Z8LA 5HFYA 2ACZB 3AEBB 4A6QA 1V1PA 3W9CB 4C56C 2WXMA 2V0GA 1GB1A 3U4EG 1PDXA 5G5HA 1I4GA 1XLNA 4LK0M 4B0MA 1AYFA 3AEAB 3HVDA 4KKIA 5EE0A 3BZDB 3T3OA 2OHFA 2WDVB 1F2RC 2KAJA 1E6EB 1VLBA 2L83A 2ONQA 2PVOD 1N62A 1FIQA 1D5ZC 2I2YA 2WDRB 2WXPA 1D4BA 2MJEA 3BK2A 2VZKB 3U52E 4P16A 1FCLA 1LO5D 1CJEA 3PO0A 1FFUA 1OQQA 4DQOC 2QIEB 4IOIE 3L4PA 3TUOA 4EE2A 2J42A 3B2GA 5MPOA 1FXAA 1JWMD 1KLUD 2Y5CA 3AE3B 4ITKA 1SSNA 1KLGD 2RDHA 3AE1B 4XWTA 1SE4A 1L4ZB 1V1OA 2BTEA 3NVYA 4A8XC 2J53A 1BUIC 3DWGC 1ZXIA 4LLGM 4O1NA 3NVZA 1N5WA 2LGIA 2G1EA 1CZPA 5H92C 3LXFA 2JZPA 1JMLA 1I7HA 2QEJC 1I4XA 1VZ6A 1HXYD 1D5MC 2BB6A 4PT5A 4HRSA 3SEBA 2Y3AA 3BK1A 1KH0A 4YWGG 1FRDA 4RGMA 1ROEA 3DWMA 1FRRA 3Q8FA 5BMIA 3B2FA 4YT0B 2ON8A 1Q10A 2EELA 1KF6B 3FILB 2HTME 2CU3A 4RCOA 2CJOA 1D6EC 4N6EB 4KGSA 2W3SA 1AWDA 1TYGB 3PZ7A 3AEGB 1PFDA 1XCTL 1YN5A 1VR9A 2WXQA 3R8BA 1TS4A 1FNVA 4XDDA 4C7ZA 2N7JA 4KKJA 2JYEA 4IKGA 3MFGA 1TKEA 3ZJVA 2L1AA 1FNWA 2WDQB 2V3PA 4XE0A 1JRPA 2MJ3A 3C8YA 2M0AA 1J7BA 3MP9A 1RYJA 4IDIA 5AUKA 3W2DA 1QKZA 4YXDB 3ZJTA 2W55A 2PLPA 4P6VF 1C4PA 2JSVX 2MEKA 1V8CA 1EU3A 1RM6C 2AQ3B 2QSDA 1V97A 2KDMA 2PKOA 4FXCA 4OVZA 3AECB 4RNAA 1VJKA 4US9A 4US8A 1J7CA 2B76B 4MH8A 3HRDD 5EE9A 2L52A 1D5XC 1ACCA 1K53A 2IJ0A 3P4RB 1XLOA 2JU6X 5I4DA 5TSSA 3TEZA 1MHHE 3W1SA 3VRBB 5EE1A 1E10A 2V4IB 4RGNA 4ZHPA 1T5XD 2PW9A 3NUHB 1FO4A 1JWUD 2DYOA 3BYYB 1I4RA 2W82A 1UNSA 2IGGA 2NTTA 1C77A 3AEFB 1UGJA 3O13A 3SFDB 1N5XA 3BIID 1XO3A 2JXTA 2WXFA 1NEKB 1WXQA 1HA5A 2SEBD 3BVMA 2BW2A 3P4QB 1HEZE 2IDYA 5T8IA 4GLSC 4D2KA 4NAMA 3R2TA 3AE6B 1L6VA 2BS3B 4HJGE 3MJ5A 3EUB2 3CIRB 2WXGA 4OZAA 3NVVA 2INNE 1BXTA 2JQRB 1UWMA 1ZUD2 5HHDG 1QILA 1FNUA 4NAWB 2GRIA 3IXSA 1TJEA 3URYA 4AS1A 2SAKA 3BVGA 1XXGA 2H88B 2IPKD 3OWEB 4XDCA 3ABVB 2HDEA 1JWAD 2ICIA 4A55A 1E0ZA 2BT6A 4USAA 1XEEA 2ZW1A 1IGDA 4N58A 1FM0D 2N0SB 3FILA 2K3UA 1N60A 1HZ6A 1TZOA 2X38A 4OHJA 1QOFA 2K5PA 1FFVA 3AE5B 3HVZA 4ZRPA 1IBXA 3VQIA 5BYQA 3SR6A 3W5UB 1NENB 4KGRA 2PMVA 4KX6B 1Y56A 4LTUA 1FD6A 2BYTA 1JWSD 4WURA 1QT9A 1XLPA 1EWCA 1P7EA 1PGBA 1VDVA 3E56A 2RDGA 2MH7A 1C4AA 2LHEA 2KACA 4N59A 1PUTA 2PIAA 1CK1A 5EE3A 1JW9D 1WWTA 2RPVA 3LYYA 4MT5A 2N9LA 4DXGA 3AE8B 3FC4A 4OZBA 2WLBA 3AE2B 3EA6A 3KWLA 2L32A 2IGDA 1K50A 3AV8A 1PGAA 1NVID 4CQNA 3W5VB 1ZOYB 3TEWA 3IT4B 4MACA 4RH6A 2RMMA 1YNTE 3NRZA 3Q8EA 2INPE 2KWDA 1IBXB 5FK9C 4YSZB 1I4HA 1C78A 2WXJA 4WH4A 1HQRD 3ZYYX 3FAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGX A;  1FCC C;  1GB1 A;  2GI9 A;  1IGC A;  5JXV A;  4KGT A;  2NMQ A;  1K53 A;  2JU6 X;  5HI1 A;  1F2R C;  2IGH A;  3UI3 A;  1MHH E;  2ONQ A;  2I2Y A;  2PW9 A;  1D4B A;  1MI0 A;  2ZW0 A;  2K0P A;  1FCL A;  1C9F A;  2LUM A;  1UWX A;  2JWU A;  5BMH A;  4IOI E;  2IGG A;  2JXT A;  1K51 A;  1HEZ E;  4D2K A;  4GLS C;  2J52 A;  2J53 A;  1F2R I;  4HJG E;  1YMH E;  1XF5 L;  4OZA A;  2I38 A;  2LGI A;  5HHD G;  1MHX A;  2JZP A;  1JML A;  1P7F A;  1EM7 A;  3GB1 A;  2GB1 A;  5BMG A;  2QMT A;  1KH0 A;  2LHD A;  2ZW1 A;  1IGD A;  3V3X A;  5BMI A;  3FIL A;  2ON8 A;  1Q10 A;  1MVK A;  2EEL A;  1HZ6 A;  3FIL B;  4KGS A;  1IBX A;  5HG2 A;  2OED A;  1MPE A;  4KGR A;  1FD6 A;  1XCT L;  1P7E A;  1PGB A;  2N7J A;  4IKG A;  2LHE A;  2KQ4 X;  2KAC A;  2N9K A;  1K52 A;  2RPV A;  1XCQ L;  2N9L A;  4OZB A;  3MP9 A;  2IGD A;  1K50 A;  1PGA A;  1QKZ A;  2PLP A;  2JSV X;  4HKZ E;  1ZXH A;  4MAC A;  2RMM A;  1YNT E;  2KWD A;  2QSD A;  1GB4 A;  1IBX B;  2KN4 A;  4OZC A;  4WH4 A;  2KDM A;  5HFY A;  2PTL A;  1HZ5 A; 
#chains in the Genus database with same CATH topology
 4RGO S;  4L1B A;  5KHQ A;  3U2S C;  2FBW B;  2LEK A;  4W9F A;  4A20 A;  4WWN A;  3APF A;  3Q6B A;  1TIF A;  4GDL B;  2BKR B;  1TY0 A;  1C9F A;  3HM3 A;  4BVU C;  2XEW A;  3EEC A;  4OVV A;  2BYF A;  4P1C C;  3AEE B;  1I4P A;  1SIF A;  4PS3 A;  3H8H A;  1Z2M A;  2NPT B;  2WXO A;  2WXH A;  2HD5 B;  3U30 A;  1S1Q B;  3IT6 B;  1XF5 L;  1C3T A;  2G4D B;  1C1Y B;  1QOG A;  5JHA A;  3VRA B;  1ET6 A;  3Q3N C;  3VH3 B;  1VRA B;  4YSY B;  1XT9 B;  1WM3 A;  2QMT A;  4ACF A;  4C4V A;  1L0X B;  3A9J B;  3V3X A;  2KVR A;  2KN5 A;  1RFA A;  3B0A A;  4WWM A;  1NDD A;  1SB3 C;  3ML9 A;  2WU2 B;  1ZDX A;  3ENE A;  3SDL C;  5TR5 A;  1WZ0 A;  3HUI A;  2JYT A;  4ANV A;  3DVG Y;  1UZX B;  5E6P A;  1M4V A;  1ZDV A;  2CU1 A;  2XK5 A;  2KJ6 A;  3HK0 A;  4JPS A;  3AM9 A;  2W9N A;  2HJ8 A;  3V6C B;  1CQV A;  2N1V A;  2KT7 A;  3SD5 A;  2PTL A;  3X0W A;  2JRH A;  5DPR A;  1OGW A;  2YLM A;  3IBE A;  4WJO A;  3NS8 A;  2N1W A;  1BML C;  4L2Y A;  1WJN A;  4YTP B;  3SFE B;  4LNN A;  2L8J A;  4JGH B;  3D32 A;  3KLS X;  2AQ2 B;  3T3N A;  1LGR A;  1P98 A;  1TS3 A;  1UWX A;  4JWU C;  1F77 A;  4EOY A;  1Y8R C;  1SE9 A;  1UBQ A;  1QOB A;  2MRP A;  2IO0 B;  2JPH A;  3AI5 A;  2I1K A;  1K51 A;  3WCQ A;  1I35 A;  2KD0 A;  3CST A;  2J52 A;  5J2R A;  1F2R I;  3GS2 A;  2BYE A;  1WJ6 A;  4DHJ B;  3PRP B;  4JIO U;  3ZNI D;  3DBS A;  3OJ4 B;  2MP2 B;  3EGR A;  1P7F A;  1UH6 A;  5IO9 A;  3BYT B;  2MBB B;  4ZDV A;  3L08 A;  2KDF B;  1WGK A;  2R61 A;  1P0R A;  2D3C A;  3H7P A;  1QQR A;  3MC9 A;  4NY0 A;  4WQO B;  1N6Z A;  5LLI A;  4ZRQ A;  5IN7 A;  4IM2 A;  2DX5 B;  1ET9 A;  3DOW A;  1SXT A;  4BOZ B;  1RLF A;  1YQB A;  1ESF A;  1MPE A;  3JSV B;  4MEM A;  1WXS A;  1GNU A;  3ZTD A;  2N9K A;  4RM8 A;  3ZJU A;  3Q69 A;  3RNC C;  1A70 A;  3RFZ B;  2LUE A;  3AB5 A;  2Y5B B;  3MC0 B;  2CS4 A;  3MHS D;  3RNA C;  4FHJ A;  2K9X A;  4KZ0 A;  3NS1 A;  4FLH A;  2IO1 B;  4HWI B;  3VTW A;  1DOI A;  3BWU D;  1AN8 A;  1DYQ A;  4M0W A;  4W9I A;  2KMA A;  2KN4 A;  2KWC A;  2LRU A;  4ANX A;  2X8X X;  4CO7 A;  3U4E G;  3R66 C;  1I4G A;  4HPM B;  1AYF A;  4KKI A;  1QZE A;  2ONQ A;  2NBU A;  3RNF C;  2KO3 A;  1N62 A;  1D4B A;  2MJE A;  2VH2 A;  4G3X B;  1FCL A;  1WXM A;  1CJE A;  2Z0D B;  3OG5 A;  4IOI E;  3L4P A;  2R2O A;  2IYD B;  4G0N B;  3X23 A;  4ITK A;  1KLG D;  1F9J A;  4HCP B;  2OOB B;  1L4Z B;  1V1O A;  3W1S C;  4MJS B;  2ASQ A;  4A8X C;  1BUI C;  1Q5W B;  4P1B C;  2DZI A;  2KQ7 A;  2LGI A;  3ZDM C;  1JML A;  4GXB A;  1EO6 A;  1NI2 A;  1I4X A;  2I1J A;  1HXY D;  4JQW C;  4HRS A;  2Y3A A;  3BK1 A;  5G55 A;  4FHK A;  1E5W A;  1WX9 A;  4GB9 A;  3VHT C;  3VFK A;  1KLV A;  1MG4 A;  4RCO A;  2L0F A;  1HE8 A;  3RMK C;  4ICU A;  2WX0 A;  4ZRI A;  1F1H A;  2WXQ A;  4C7Z A;  4XDD A;  2JYE A;  3MFG A;  1TKE A;  3TMP B;  2V3P A;  2WWZ A;  2IZV B;  1JRP A;  2MJ3 A;  3EC8 A;  3C8Y A;  3MP9 A;  5AUK A;  3W2D A;  4YXD B;  2PLP A;  2O6V A;  4URK A;  1OQY A;  2AQ3 B;  2QSD A;  2VRR B;  2LGY A;  3S2A A;  3WAL A;  2KDM A;  2RGF A;  3ZRF A;  3K9P B;  2JY6 A;  2PKO A;  5DPT A;  2KYW A;  2B76 B;  2M8S A;  1VCB A;  1D5X C;  1ACC A;  2IJ0 A;  3C0R B;  1XLO A;  2JU6 X;  5I4D A;  5TSS A;  2ZPN A;  4WJN A;  3VRB B;  2VH1 A;  3NJT A;  2IO2 B;  4EZK A;  2DYO A;  3TBL D;  1UD7 A;  2W82 A;  4FA6 A;  5IA7 A;  2NTT A;  2L76 A;  1UGJ A;  3SFD B;  1N5X A;  3KH0 A;  3BII D;  2JXT A;  1HEZ E;  4EEW A;  3ZVV A;  4GLS C;  2LGD A;  2LVQ A;  3AE6 B;  2BS3 B;  2KJR A;  3MJ5 A;  1WXV A;  4OZA A;  2JQR B;  4NJ7 A;  1WMH B;  1TJE A;  1TT5 B;  4DBG A;  3BVG A;  2H88 B;  3VTV A;  2GBM A;  2K8H A;  3A9K A;  3L13 A;  1IGD A;  4IM3 A;  1FM0 D;  3FIL A;  2K3U A;  3NG0 A;  1N60 A;  3Q3F A;  4HDO A;  1HZ6 A;  1TZO A;  2ZCB A;  4GSW A;  4BOS C;  5AEK B;  2JZ3 B;  4MEL A;  3TIX A;  1WI0 A;  4NJ6 A;  2K39 A;  2DYB A;  1IBX A;  3VQI A;  4PS8 A;  4XC2 A;  1D3Z A;  1QT9 A;  1EWC A;  1P7E A;  1PGB A;  2REX A;  3E56 A;  1R4N B;  1E90 A;  2KAC A;  2PIA A;  1CK1 A;  1U4A A;  1JW9 D;  2N9L A;  3AE8 B;  2CHZ A;  3AE2 B;  2RPQ A;  3EFU A;  4AJY B;  3AV8 A;  2G4S A;  1PGA A;  2C9W B;  1VD2 A;  1ZOY B;  4S0R A;  2HJ1 A;  3Q8E A;  4DHZ E;  4MGI E;  4FAD A;  1I4H A;  2O2V B;  1HQR D;  3FAH A;  2DEN B;  3ECI A;  1PGX A;  4LNK A;  1FCC C;  1GOZ A;  2V1Y A;  3U7D A;  1WE7 A;  2NPT A;  3CWI A;  3W1Y A;  3RPF C;  3I57 A;  2D11 A;  5HI1 A;  4BBN F;  2IGH A;  3N9Y C;  1EU4 A;  3VUY A;  3AMZ A;  4KZC A;  2D07 B;  1UEL A;  1JQ4 A;  3AED B;  2CR5 A;  2OJR A;  2JWU A;  1E8Y A;  3M3J A;  2AEH A;  3KVF B;  4ARI A;  4EKU A;  2JWZ A;  2GOW A;  4REZ A;  4E3C A;  3AH7 A;  4MM3 B;  1YMH E;  3PZ8 A;  1L6U A;  2I38 A;  3IG3 A;  1E7U A;  5IAA C;  2D3A A;  2MSE D;  4WQM A;  1TY2 A;  2WDT B;  2MJD A;  1GC7 A;  2CKH B;  3IAS 1;  3ALB A;  5AZH A;  5HKH A;  1WSP A;  3E9S A;  2BBC A;  4LDT D;  3V61 A;  2NS5 A;  2EKI A;  4HKQ A;  2DZM A;  4H2A A;  1RWS A;  1C79 A;  2D10 A;  3ONS A;  1FXI A;  2C60 A;  1WGD A;  3PSE B;  3KWV A;  3UQB A;  1BT0 A;  2LXC A;  1IPG A;  4ZHO A;  3QX1 A;  2K8B A;  2Q5W D;  4CYE A;  3RD2 A;  4NPN A;  3AE9 B;  2A5U A;  4DXA B;  4BZA A;  1E9M A;  1GC6 A;  3R2I A;  2MCN B;  2KNB A;  1HZ5 A;  1XLQ A;  4XX5 A;  1SBB B;  4TV3 A;  1V1P B;  4GOC A;  1STE A;  1NYQ A;  1C76 A;  2QIL A;  5KHO A;  2KDI A;  2L00 B;  2O6V D;  3DBL B;  2PE9 A;  1B9R A;  1WR1 A;  3UI3 A;  2CJN A;  2MP2 A;  1ISN A;  2ZW0 A;  2K0P A;  4B0E A;  3TCA A;  1QF6 A;  4TMA B;  2N7E A;  1TGZ B;  2LJI A;  1JRU A;  1WF9 A;  2BWF A;  2FCN A;  2WHI A;  4Q2J A;  2LI5 A;  5AUI A;  4M01 A;  2UWQ A;  4XWW A;  4IG7 B;  3JSV A;  1AAR A;  4NZL B;  3PV1 A;  3VDZ A;  1OFF A;  2GB1 A;  4ZYS A;  5DPS A;  2ZNV C;  1V80 A;  4IW0 A;  2FCM A;  4XZ4 A;  3PT2 B;  2E6X A;  3CSF A;  3V6E B;  2LVP A;  1ZPS A;  2PVG C;  3NZU A;  2JVC A;  2MQJ A;  2FUH B;  2JX5 A;  4B95 A;  4OW0 A;  2OED A;  5D3I B;  2KFK A;  2FCS A;  1WGG A;  2BWE S;  4NNJ B;  1WYG A;  1L5P A;  1K52 A;  1SJH D;  1YQ3 B;  4HPL B;  1KFY B;  3MHZ A;  1OQR A;  3OLM D;  1E7V A;  3KYC D;  2WXN A;  4L23 A;  4RFB A;  1MJD A;  2BKF A;  4PYU A;  2JRI B;  1R4N I;  1JWB D;  3EHV A;  2ACZ B;  2MWS B;  4A6Q A;  2D2Q A;  3W9C B;  2V0G A;  1PDX A;  1WIA A;  4DHZ B;  3KUZ A;  4LK0 M;  1R4M I;  3HVD A;  3T3O A;  2WDV B;  2KAJ A;  4E71 A;  4KIK A;  2L83 A;  2PVO D;  1FIQ A;  1D5Z C;  5EDS A;  2WXP A;  4P16 A;  4BFR A;  3WA0 A;  1H4R A;  3PO0 A;  1FFU A;  1OQQ A;  4KVG B;  2QIE B;  3APC A;  2MBO A;  3B2G A;  1JWM D;  2EMT A;  1G6J A;  4W9G A;  3AE3 B;  1SSN A;  4XWT A;  2RDH A;  1KOT A;  2M4N A;  4WJQ A;  1WY8 A;  1YX6 B;  4LLG M;  4O1N A;  1N5W A;  4G11 A;  4EZJ A;  2K6Q A;  1CZP A;  2QEJ C;  1L7Y A;  1TTN A;  1VZ6 A;  1D5M C;  3ZKJ C;  2UU7 A;  1MG8 A;  3SEB A;  1KH0 A;  1WGR A;  1FRD A;  1WX8 A;  3DCG A;  5IP4 D;  1ROE A;  3GE3 C;  3Q8F A;  2ZNV B;  4M8N A;  3KW5 B;  4ICV A;  2ON8 A;  2MHJ A;  3I63 C;  3IHP C;  3V60 A;  4KGS A;  2W3S A;  5J17 A;  4KV2 A;  1TYG B;  3PRZ A;  3ZNZ B;  1MFW A;  4ZRK A;  4A3O A;  2L05 A;  1TS4 A;  4KKJ A;  3EFC A;  5C23 A;  3ZJV A;  2L1A A;  2KK8 A;  1LXD A;  2M0A A;  1J7B A;  2ZPY A;  1QKZ A;  3RCZ A;  1C4P A;  2JSV X;  1EU3 A;  4MH0 E;  5CHW A;  3DHG C;  4IWP A;  1F52 A;  1S3S G;  2KDE B;  3ZDT A;  3A4R A;  4FXC A;  2K8C A;  1VJK A;  1SGH A;  4US8 A;  1WJ4 A;  4MH8 A;  2IY0 B;  3Q3O C;  2PEA A;  3TEZ A;  3VUW A;  3W1S A;  4EUT A;  4ZHP A;  2BGF A;  3PVL A;  3GZN B;  1WRD B;  2PW9 A;  3NUH B;  1JWU D;  1Q0W B;  4RM9 A;  5CHV C;  3AEF B;  1TBE A;  2KZR A;  3DBL I;  1HA5 A;  4MDK E;  4D2K A;  4NAM A;  4K3B A;  3EUB 2;  3CIR B;  2WXG A;  5JZE B;  3A1Q B;  2INN E;  1UWM A;  2LXA A;  3Q14 C;  3PRM B;  4DK5 A;  1WGH A;  1XXG A;  2IPK D;  4XDC A;  1JWA D;  1E0Z A;  2BT6 A;  4C4V B;  4FN2 A;  1ZKH A;  2N0S B;  4ANU A;  4N9F 4;  2X38 A;  1QOF A;  3Q3J A;  1FFV A;  5CHF A;  3HVZ A;  4ZRP A;  5D2M B;  5BYQ A;  1NEN B;  3N3K B;  1T0R C;  4KX6 B;  2C5L C;  4LJO B;  2BYT A;  4M00 A;  1WE6 A;  2RDG A;  2MH7 A;  4F8C B;  3UF8 A;  3N32 A;  3T9L A;  3B08 A;  3RYT A;  3LYY A;  3AU4 A;  2D3B A;  4W9K A;  3EA6 A;  4BBN C;  2BPS A;  1YD8 U;  2L32 A;  2IGD A;  2XK5 B;  3W5V B;  3TEW A;  3HHM A;  3IT4 B;  4MAC A;  2RMM A;  1PQS A;  2KWD A;  3M95 A;  5CX3 A;  1FXT B;  2YVC A;  4WH4 A;  3ZYY X;  3Q8B A;  3HM6 X;  1GG3 A;  1KJT A;  2XBB C;  2KJH B;  1C4C A;  1UBI A;  1J7A A;  2WXR A;  3L17 A;  2FID A;  1B1Z A;  4GDK B;  2TSS A;  1QLB B;  4C7Y A;  2BVC A;  4TQ0 A;  1YN3 A;  1WR6 E;  4A3P A;  2J7Q B;  1WXA A;  3K9O B;  4YSX B;  5BMH A;  1F0Z A;  4A90 A;  1J19 A;  1YJJ A;  3KYD D;  3Q8A A;  4IWQ A;  4MSM B;  1ZP0 B;  2MX2 A;  2ZJD A;  2LGX A;  1ZGU B;  2YEP B;  3ML8 A;  2DLB A;  4XYC A;  4NAW A;  2DBY A;  3P1M A;  5GXG B;  3M63 B;  3VUX A;  2LAS A;  3NZ3 A;  1JCK B;  5D3D A;  2NTS A;  2GBN A;  4IC7 B;  1GUA B;  3R7Q A;  2KKC A;  3H7P B;  4TKN A;  3AN1 A;  3I5J C;  2MBQ A;  1IUE A;  1T6B X;  1SJE D;  2EMS A;  2D5G A;  3H9D A;  5HG2 A;  4YTM B;  2WNM A;  4DDG D;  2KTR B;  1XQQ A;  2BS4 B;  1LM8 B;  1RRB A;  2KMM A;  2YEP F;  5L95 C;  2AL6 A;  2DZJ A;  1FEH A;  4BKS A;  2R2Q A;  3WAO A;  2QC8 A;  3ZQ4 A;  1HTQ A;  2WU5 B;  1UUP A;  4RF1 A;  1SE3 A;  1OEY J;  4FBJ B;  2CHX A;  2JUO A;  5IOI A;  4OZC A;  1R7S A;  3RNE C;  2AQ1 B;  5G5G A;  3VR9 B;  5D94 A;  3QHT A;  2LFI A;  2BB5 A;  4ARC A;  1SE2 A;  4NQL B;  2OJW A;  3ZLZ A;  4HEA 1;  1J0G A;  3BVZ A;  4GDL A;  3DHH C;  4UDU C;  1KTK A;  3L16 A;  3LJ3 A;  2LUM A;  1OTR B;  1DOX A;  1Z5S B;  4II3 B;  2XNA C;  4R3D A;  3V05 A;  4YL8 A;  4M02 A;  4S17 A;  2KC1 A;  2VZK D;  1EF5 A;  2WXK A;  3P2B A;  4DWF A;  2WGS A;  3GZN I;  3N1Z C;  3NHE B;  2FIF A;  1ENF A;  2IY1 B;  3MTN B;  4LDT B;  3ZNG C;  1MHX A;  1SEB D;  1M94 A;  5G2N A;  1V2Y A;  1T0Q C;  4JL9 A;  2E3T A;  3ETR A;  3QJZ A;  2M1M A;  4MSQ B;  4WAF A;  3JW0 X;  2LHD A;  2MBE A;  2WX1 A;  3A9J A;  2WS3 B;  1YJI A;  1FPY A;  3CF6 E;  3AE4 B;  2XN9 C;  2RDB C;  3B9J A;  3P4P B;  2WP9 B;  1E7P B;  4AQ7 A;  1NYR A;  5BYS A;  3PHW B;  2Y5P A;  4NJC A;  1VZ8 A;  2GMI C;  2LZ6 A;  4JWS C;  1FMA D;  1L2N A;  2H89 B;  3HIZ A;  4ZOH C;  1XCQ L;  3DVN V;  1Q1O A;  2QDF A;  1L0Y B;  1T0Y A;  2M19 A;  1VZ7 A;  3QA8 A;  1TS2 A;  1RAX A;  2J0J A;  4HKZ E;  4ASW C;  2AWT A;  3N1X C;  2O6V B;  3ZTC A;  1DOY A;  4PK1 A;  4GU2 A;  4A9A A;  2Z8L A;  3AEB B;  2Z59 B;  4C56 C;  3DBR B;  5G5H A;  4PYZ A;  3V62 A;  4B0M A;  3AEA B;  5EE0 A;  2LGS A;  3BZD B;  2MA9 B;  4DDI D;  2L3Z A;  1J8C A;  3L0W B;  2IBI B;  2I2Y A;  2WDR B;  2DAF A;  2FNJ B;  3WAP A;  4DQO C;  4EE2 A;  5MPO A;  1KLU D;  2Y5C A;  4AUQ C;  2NR2 A;  1SE4 A;  4AP4 C;  5FR6 A;  4B9K A;  2KOX A;  2D3G A;  4IWO A;  3NVY A;  2BTE A;  2KXJ A;  2J53 A;  4E74 A;  1ZXI A;  4W9H A;  3DBH B;  2KMC A;  2G1E A;  5H92 C;  1K8R B;  3KUC B;  3LXF A;  2JZP A;  3GE8 C;  3H6N A;  1I7H A;  2G3Q B;  2KWV B;  2BB6 A;  2MLB A;  4II2 B;  1WX7 A;  3QIJ A;  1I42 A;  1FRR A;  3A9K B;  3B2F A;  2BF8 B;  3QC8 B;  4YT0 B;  1KF6 B;  3FIL B;  2HTM E;  2CU3 A;  2CJO A;  3OAW A;  1E8W A;  4N6E B;  1AWD A;  2JT4 B;  3PZ7 A;  3AEG B;  1YN5 A;  2ZVN A;  3R8B A;  2N7J A;  4FUL A;  2MBH A;  4IKG A;  2RSU A;  1FNW A;  4XE0 A;  5LXI B;  3ZJT A;  1RYJ A;  3QCA A;  2ZZP B;  3NOB A;  2G45 B;  3ZNH B;  1V8C A;  1RM6 C;  3BY4 B;  3SU8 X;  3SHQ A;  3VAW A;  3MJW A;  3AEC B;  4RNA A;  2KHW B;  4BKS D;  2C7H A;  1WYW B;  2PPH A;  3HRD D;  5EE9 A;  1K53 A;  1LQB A;  4P7I A;  3PPA A;  3A1Q A;  2V4I B;  5E6N A;  1T5X D;  1FO4 A;  3Q3M C;  3BYY B;  1I4R A;  2IGG A;  3QQ8 B;  1YIW A;  4FJV B;  3M62 B;  4W9J A;  2K1F A;  1NEK B;  3PHX B;  2BW2 A;  3P4Q B;  4MJS A;  3PLU A;  2JZZ A;  2LRW A;  2NBV B;  1L6V A;  3T8M A;  2RD0 A;  1XD3 B;  1QIL A;  1FNU A;  2L7R A;  1V6E A;  3IXS A;  3URY A;  4AS1 A;  3OWE B;  2BYV E;  3ABV B;  2HDE A;  2GBR A;  3UIN B;  1WH3 A;  4A55 A;  2ZW1 A;  3BIN A;  2KX0 A;  4N58 A;  1OEY A;  3DDC B;  3L10 B;  5JHB A;  4BKG A;  4GGQ A;  4MGZ E;  3RI7 C;  4HJK A;  2KFJ A;  4W9C A;  3SR6 A;  3L54 A;  3JYU A;  3W5U B;  1Y56 A;  4LTU A;  5C1Z A;  4GIV A;  1VDV A;  1C4A A;  2LHE A;  3RUL A;  1PUT A;  3WAM A;  1WWT A;  2RPV A;  4MT5 A;  2LVO A;  2NCN A;  4GDK A;  3KWL A;  3AUL A;  4CQN A;  2AYO B;  4RH6 A;  4K7S A;  3NRZ A;  4AOF A;  4YSZ B;  1WM2 A;  2RR9 A;  3N20 C;  3UIO B;  1C78 A;  2WXJ A;  2MW5 A;  3ZGZ A;  1KRH A;  5E6J A;  1L4D B;  2GI9 A;  4B6W A;  1YX5 B;  4KGT A;  4TUU A;  2M0X A;  3DHI C;  1GAQ B;  5H8Y E;  5DPW A;  1V5O A;  3A33 B;  4RGT A;  1YN4 A;  3A4S C;  5BYR A;  1I4Q A;  2PJH A;  3DBR I;  2DWQ A;  1UGM A;  4I6L B;  3RUI B;  4K3C A;  2W54 A;  3DQV A;  2DAJ A;  1QOA A;  4HDQ A;  1P9D U;  2J4X A;  2V9H A;  3PZD A;  1IYF A;  3AE7 B;  2K22 A;  2FE8 A;  1TKY A;  3QAR A;  1PYW D;  1WMH A;  2JXX A;  2KTR A;  5BO4 B;  3VR8 B;  5JH5 C;  3PRE A;  2K6D B;  1NI3 A;  4HVB A;  4DHJ D;  1N63 A;  1RFK A;  5D7G A;  1YOV B;  3TEX A;  2AX5 A;  4GMV A;  4KDL B;  3DBH I;  4RF0 A;  1T3Q A;  4K7U A;  3IAM 1;  4I6N B;  2G9H D;  1TS5 A;  3TEY A;  3JVZ X;  5C2T B;  2WQY B;  2LMC A;  2KFK B;  2KLC A;  3N30 A;  3TL5 A;  3WIM A;  3KQ4 A;  2KQ4 X;  3O65 B;  1EWY C;  2W3R A;  3NY5 A;  3NVW A;  1SIJ A;  4WAA A;  3P4S B;  3U7Z A;  5AZG A;  1SF0 A;  2DZK A;  2N9P C;  4OVU A;  3J9C A;  1CMX B;  5DCN A;  3VH4 B;  1ZXH A;  3H7S A;  4DXF A;  4I6P A;  3TSS A;  3U8Z A;  1WRI A;  4K81 A;  2DHZ A;  1YJ1 A;  5E6O A;  1GB4 A;  2KX3 A;  2O2V A;  2N9E B;  1ZE3 D;  4NQK E;  4PS7 A;  2IND C;  2ZCC A;  4EZL A;  1H8C A;  2KAN A;  1IGC A;  2N9X A;  5JXV A;  2ZEQ A;  3GP7 A;  4F1S A;  4F7Z A;  2NMQ A;  4XGA B;  1YQ4 B;  4ZRJ A;  2WXI A;  1TZ1 A;  3WAN A;  4KIK B;  4ANW A;  5C3J B;  4HRO A;  1MI0 A;  2QJL A;  3FKY A;  2C7N B;  2FUG 1;  3IFW B;  4TQ1 A;  2GLS A;  2GBJ A;  1JRO A;  1P3Q U;  2BS2 B;  1V5T A;  1WJU A;  3AU5 A;  4J3O D;  1JAL A;  3LB8 C;  4IUM B;  2QCZ A;  4C80 A;  4EFO A;  2WXL A;  4WIP A;  3UGB B;  4YTN B;  3Q8C A;  4X57 B;  4MM3 A;  2JF5 A;  2KVZ A;  2DYM A;  1X1M A;  2M17 A;  1KM7 A;  4JE3 B;  4FJZ A;  4FJY A;  1L0V B;  3DPD A;  2V3N A;  1GPX A;  3P42 A;  3QWZ B;  1EM7 A;  3GB1 A;  3OJ3 A;  3NZS A;  5BMG A;  4TSS A;  4HCN B;  3RNB C;  4AJW A;  3ZO5 B;  1AW7 A;  2ZVO A;  4GN1 A;  4JX1 C;  1MVK A;  2C7M B;  1N61 A;  3P63 A;  4HLE A;  4HPP A;  3VXW A;  5LNK 1;  2M56 B;  5FKA C;  1DGJ A;  3PLV A;  1V86 A;  2UYZ B;  3MC8 A;  1TKG A;  2CHW A;  4LCD E;  3ZRC A;  4K1R B;  4W9E A;  4WJP A;  3I9V 1;  3N1Y C;  2NBW B;  5LXH A;  4AWJ A;  5HFY A;  1V1P A;  2WXM A;  3Q2A C;  1GB1 A;  4HK2 A;  1XLN A;  3RZF A;  2N7D A;  2OHF A;  1F2R C;  3GOE A;  4G50 A;  1E6E B;  1VLB A;  2Z0E B;  3VTU A;  4KSL C;  4ZYN A;  5CTR C;  3APD A;  3BK2 A;  2VZK B;  3U52 E;  2GBK A;  1LO5 D;  1WFY A;  4M0W B;  3ZXV A;  3TUO A;  1HTO A;  2J42 A;  5L83 A;  3PS6 A;  1FXA A;  3UIP B;  3AE1 B;  3RN9 C;  2IO3 B;  2FAZ A;  3DWG C;  2NVU I;  3QK0 A;  4KDI C;  4BAX A;  3NVZ A;  3PTF C;  2DNF A;  1WGY A;  4BKT A;  3DVN U;  2PE6 B;  4CHK A;  3LDZ E;  2J0K A;  4PT5 A;  4QAY A;  4C00 A;  4YWG G;  1EUV B;  4RGM A;  3DWM A;  5BMI A;  1R4M B;  1Q10 A;  2EEL A;  1A5R A;  1D6E C;  3ZW3 A;  1ZW7 A;  2WYQ A;  4HXD A;  4LNO A;  2KWU B;  2LWP A;  1PFD A;  1XCT L;  1VR9 A;  1FNV A;  1P1A A;  2K25 A;  2A4Z A;  5GMV A;  2INC C;  2FCQ A;  2WDQ B;  2N4F A;  4IDI A;  3TJP A;  2W55 A;  4P6V F;  2MEK A;  5AZF A;  4W9L A;  4J6I A;  2V4L A;  1V97 A;  4LNI A;  5IKC M;  4OVZ A;  2EKE C;  4US9 A;  1J7C A;  2AL3 A;  1V9J A;  2L52 A;  1EF1 A;  3P4R B;  2J0M A;  1MHH E;  3ZIM A;  5EE1 A;  3DVG X;  1E10 A;  4RGN A;  3RNG C;  1WZ3 A;  3IVF A;  3I3T B;  4JLC A;  3C19 A;  1UNS A;  1V81 A;  1C77 A;  3O13 A;  1T0S C;  1XO3 A;  2V3S A;  2WXF A;  1WXQ A;  3BVM A;  2QHO A;  2SEB D;  3UQA A;  2IDY A;  5T8I A;  1UF0 A;  3R2T A;  4RMA A;  4HJG E;  2B3A A;  2KTF A;  1E8X A;  3NVV A;  1BXT A;  3R7R A;  1ZUD 2;  5HHD G;  4NAW B;  2GRI A;  2SAK A;  2HTH A;  2KC2 A;  5J18 A;  4LJP B;  2ICI A;  4USA A;  4LNF A;  1XEE A;  2LJ5 A;  4WWP A;  2KDB A;  4OHJ A;  3ZXR A;  2K5P A;  3H1U A;  3AE5 B;  2BQQ A;  3ZUN A;  4KGR A;  2PMV A;  3R3M A;  4IM0 A;  4WWO A;  1FD6 A;  3VVW B;  1JWS D;  3CMM B;  3RZW C;  4WUR A;  1IP9 A;  1XLP A;  4KSK C;  5FR3 A;  4N59 A;  3RT3 B;  1E8Z A;  1NBF C;  4MGK E;  5EE3 A;  2LD9 A;  4MGY E;  1V49 A;  1LFD A;  2HE7 A;  2KQS A;  4DXG A;  3FC4 A;  4OZB A;  2WLB A;  3AXC A;  1K50 A;  1NVI D;  2L0T A;  4M8M A;  3KUD B;  3B1L X;  5D6J B;  1GJZ A;  1YNT E;  2INP E;  3PGE A;  4W9D A;  1IBX B;  5FK9 C;  2KLG A;  3QAQ A;  4K7W A; 
#chains in the Genus database with same CATH homology
 1KRH A;  4RGO S;  1PGX A;  3Q8B A;  1FCC C;  5E6J A;  1L4D B;  4L1B A;  1GOZ A;  2GI9 A;  3U2S C;  2FBW B;  3CWI A;  1C4C A;  4KGT A;  2LEK A;  3RPF C;  1J7A A;  2WXR A;  3I57 A;  5HI1 A;  2IGH A;  3N9Y C;  1B1Z A;  4GDK B;  1GAQ B;  5H8Y E;  2TSS A;  1EU4 A;  1QLB B;  4GDL B;  4C7Y A;  3AMZ A;  4RGT A;  1YN4 A;  4TQ0 A;  1TY0 A;  5BYR A;  1YN3 A;  1I4Q A;  1C9F A;  1JQ4 A;  3AED B;  2JWU A;  4YSX B;  5BMH A;  1F0Z A;  4A90 A;  2DWQ A;  1YJJ A;  3AEE B;  1I4P A;  3Q8A A;  4ARI A;  3H8H A;  1ZP0 B;  2W54 A;  1QOA A;  4REZ A;  2J4X A;  2WXO A;  2WXH A;  2YEP B;  3AE7 B;  2DLB A;  2K22 A;  2FE8 A;  3ZGZ A;  3AH7 A;  4MM3 B;  3IT6 B;  1YMH E;  1XF5 L;  3PZ8 A;  1L6U A;  1TKY A;  1PYW D;  2I38 A;  1QOG A;  3VR8 B;  3VRA B;  1ET6 A;  4WQM A;  2DBY A;  3P1M A;  5GXG B;  1VRA B;  4YSY B;  1TY2 A;  3NZ3 A;  1JCK B;  5D3D A;  2QMT A;  2MJD A;  2NTS A;  1NI3 A;  3IAS 1;  1L0X B;  1N63 A;  1WSP A;  1RFK A;  3E9S A;  3V3X A;  3AN1 A;  2BBC A;  5D7G A;  2EKI A;  1IUE A;  2AX5 A;  3TEX A;  4HKQ A;  1T6B X;  1SJE D;  4H2A A;  4WWM A;  2D5G A;  4RF0 A;  1RWS A;  1C79 A;  1SB3 C;  1T3Q A;  3IAM 1;  5HG2 A;  2WU2 B;  4YTM B;  2G9H D;  2WNM A;  1TS5 A;  1FXI A;  1ZDX A;  3TEY A;  5C2T B;  2WQY B;  2LMC A;  3KQ4 A;  2KQ4 X;  3KWV A;  1EWY C;  2BS4 B;  2W3R A;  2KMM A;  3NVW A;  3HUI A;  1SIJ A;  3P4S B;  2JYT A;  2YEP F;  3U7Z A;  1SF0 A;  1FEH A;  4ZHO A;  3J9C A;  1M4V A;  1ZDV A;  2Q5W D;  1ZXH A;  3ZQ4 A;  2WU5 B;  1UUP A;  4RF1 A;  3AE9 B;  4DXF A;  3TSS A;  4JPS A;  3AM9 A;  1WRI A;  1SE3 A;  1GB4 A;  1CQV A;  1E9M A;  3R2I A;  4OZC A;  1R7S A;  1ZE3 D;  2PTL A;  2AQ1 B;  1HZ5 A;  1XLQ A;  5G5G A;  3VR9 B;  2LFI A;  1SBB B;  2BB5 A;  1V1P B;  1IGC A;  4ARC A;  1SE2 A;  5JXV A;  1STE A;  1NYQ A;  1C76 A;  2QIL A;  3GP7 A;  2NMQ A;  1B9R A;  1YQ4 B;  1BML C;  4L2Y A;  3UI3 A;  4HEA 1;  2CJN A;  2WXI A;  3BVZ A;  4YTP B;  4UDU C;  3SFE B;  5C3J B;  1KTK A;  4HRO A;  1MI0 A;  2QJL A;  2ZW0 A;  2K0P A;  3KLS X;  2FUG 1;  4B0E A;  2AQ2 B;  2LUM A;  4TQ1 A;  3T3N A;  1TS3 A;  1UWX A;  1DOX A;  1JRO A;  4JWU C;  1F77 A;  1QF6 A;  2BS2 B;  2XNA C;  4R3D A;  4TMA B;  3V05 A;  1QOB A;  2LJI A;  1JAL A;  4J3O D;  3LB8 C;  4C80 A;  2WXL A;  4WIP A;  4YTN B;  1K51 A;  3Q8C A;  3WCQ A;  2VZK D;  2J52 A;  4Q2J A;  2WXK A;  2DYM A;  5AUI A;  1F2R I;  3GS2 A;  4XWW A;  1ENF A;  4JE3 B;  1L0V B;  4NZL B;  2V3N A;  1MHX A;  1OFF A;  1GPX A;  3EGR A;  3P42 A;  1SEB D;  1P7F A;  1EM7 A;  3BYT B;  3GB1 A;  2E3T A;  2GB1 A;  3ETR A;  5BMG A;  4TSS A;  4ZYS A;  4WAF A;  1WGK A;  2R61 A;  2LHD A;  2E6X A;  2WS3 B;  1YJI A;  1AW7 A;  1ZPS A;  1QQR A;  2PVG C;  4JX1 C;  3AE4 B;  1MVK A;  2XN9 C;  3B9J A;  4ZRQ A;  3P4P B;  1N61 A;  2WP9 B;  2JX5 A;  1ET9 A;  1SXT A;  1E7P B;  3P63 A;  1ESF A;  4AQ7 A;  1NYR A;  5BYS A;  4OW0 A;  2OED A;  2Y5P A;  1MPE A;  4NJC A;  5D3I B;  1VZ8 A;  5FR3 A;  2N9K A;  4JWS C;  1FMA D;  1WYG A;  5LNK 1;  3ZJU A;  1L5P A;  2M56 B;  1K52 A;  3Q69 A;  5FKA C;  1A70 A;  3RFZ B;  2H89 B;  3AB5 A;  1SJH D;  4ZOH C;  1DGJ A;  1XCQ L;  1YQ3 B;  1KFY B;  3MHZ A;  1L0Y B;  1OQR A;  3MC0 B;  2M19 A;  1VZ7 A;  1TS2 A;  2K9X A;  4HKZ E;  2WXN A;  3NS1 A;  1TKG A;  4L23 A;  4RFB A;  1DOI A;  3BWU D;  1AN8 A;  1DOY A;  3I9V 1;  1DYQ A;  4M0W A;  4A9A A;  2KN4 A;  1JWB D;  2Z8L A;  5HFY A;  2ACZ B;  3AEB B;  4A6Q A;  1V1P A;  3W9C B;  4C56 C;  2WXM A;  2V0G A;  1GB1 A;  3U4E G;  1PDX A;  5G5H A;  1I4G A;  1XLN A;  4LK0 M;  4B0M A;  1AYF A;  3AEA B;  3HVD A;  4KKI A;  5EE0 A;  3BZD B;  3T3O A;  2OHF A;  2WDV B;  1F2R C;  2KAJ A;  1E6E B;  1VLB A;  2L83 A;  2ONQ A;  2PVO D;  1N62 A;  1FIQ A;  1D5Z C;  2I2Y A;  2WDR B;  2WXP A;  1D4B A;  2MJE A;  3BK2 A;  2VZK B;  3U52 E;  4P16 A;  1FCL A;  1LO5 D;  1CJE A;  3PO0 A;  1FFU A;  1OQQ A;  4DQO C;  2QIE B;  4IOI E;  3L4P A;  3TUO A;  4EE2 A;  2J42 A;  3B2G A;  5MPO A;  1FXA A;  1JWM D;  1KLU D;  2Y5C A;  3AE3 B;  4ITK A;  1SSN A;  1KLG D;  2RDH A;  3AE1 B;  4XWT A;  1SE4 A;  1L4Z B;  1V1O A;  2BTE A;  3NVY A;  4A8X C;  2J53 A;  1BUI C;  3DWG C;  1ZXI A;  4LLG M;  4O1N A;  3NVZ A;  1N5W A;  2LGI A;  2G1E A;  1CZP A;  5H92 C;  3LXF A;  2JZP A;  1JML A;  1I7H A;  2QEJ C;  1I4X A;  1VZ6 A;  1HXY D;  1D5M C;  2BB6 A;  4PT5 A;  4HRS A;  3SEB A;  2Y3A A;  3BK1 A;  1KH0 A;  4YWG G;  1FRD A;  4RGM A;  1ROE A;  3DWM A;  1FRR A;  3Q8F A;  5BMI A;  3B2F A;  4YT0 B;  2ON8 A;  1Q10 A;  2EEL A;  1KF6 B;  3FIL B;  2HTM E;  2CU3 A;  4RCO A;  2CJO A;  1D6E C;  4N6E B;  4KGS A;  2W3S A;  1AWD A;  1TYG B;  3PZ7 A;  3AEG B;  1PFD A;  1XCT L;  1YN5 A;  1VR9 A;  2WXQ A;  3R8B A;  1TS4 A;  1FNV A;  4XDD A;  4C7Z A;  2N7J A;  4KKJ A;  2JYE A;  4IKG A;  3MFG A;  1TKE A;  3ZJV A;  2L1A A;  1FNW A;  2WDQ B;  2V3P A;  4XE0 A;  1JRP A;  2MJ3 A;  3C8Y A;  2M0A A;  1J7B A;  3MP9 A;  1RYJ A;  4IDI A;  5AUK A;  3W2D A;  1QKZ A;  4YXD B;  3ZJT A;  2W55 A;  2PLP A;  4P6V F;  1C4P A;  2JSV X;  2MEK A;  1V8C A;  1EU3 A;  1RM6 C;  2AQ3 B;  2QSD A;  1V97 A;  2KDM A;  2PKO A;  4FXC A;  4OVZ A;  3AEC B;  4RNA A;  1VJK A;  4US9 A;  4US8 A;  1J7C A;  2B76 B;  4MH8 A;  3HRD D;  5EE9 A;  2L52 A;  1D5X C;  1ACC A;  1K53 A;  2IJ0 A;  3P4R B;  1XLO A;  2JU6 X;  5I4D A;  5TSS A;  3TEZ A;  1MHH E;  3W1S A;  3VRB B;  5EE1 A;  1E10 A;  2V4I B;  4RGN A;  4ZHP A;  1T5X D;  2PW9 A;  3NUH B;  1FO4 A;  1JWU D;  2DYO A;  3BYY B;  1I4R A;  2W82 A;  1UNS A;  2IGG A;  2NTT A;  1C77 A;  3AEF B;  1UGJ A;  3O13 A;  3SFD B;  1N5X A;  3BII D;  1XO3 A;  2JXT A;  2WXF A;  1NEK B;  1WXQ A;  1HA5 A;  2SEB D;  3BVM A;  2BW2 A;  3P4Q B;  1HEZ E;  2IDY A;  5T8I A;  4GLS C;  4D2K A;  4NAM A;  3R2T A;  3AE6 B;  1L6V A;  2BS3 B;  4HJG E;  3MJ5 A;  3EUB 2;  3CIR B;  2WXG A;  4OZA A;  3NVV A;  2INN E;  1BXT A;  2JQR B;  1UWM A;  1ZUD 2;  5HHD G;  1QIL A;  1FNU A;  4NAW B;  2GRI A;  3IXS A;  1TJE A;  3URY A;  4AS1 A;  2SAK A;  3BVG A;  1XXG A;  2H88 B;  2IPK D;  3OWE B;  4XDC A;  3ABV B;  2HDE A;  1JWA D;  2ICI A;  4A55 A;  1E0Z A;  2BT6 A;  4USA A;  1XEE A;  2ZW1 A;  1IGD A;  4N58 A;  1FM0 D;  2N0S B;  3FIL A;  2K3U A;  1N60 A;  1HZ6 A;  1TZO A;  2X38 A;  4OHJ A;  1QOF A;  2K5P A;  1FFV A;  3AE5 B;  3HVZ A;  4ZRP A;  1IBX A;  3VQI A;  5BYQ A;  3SR6 A;  3W5U B;  1NEN B;  4KGR A;  2PMV A;  4KX6 B;  1Y56 A;  4LTU A;  1FD6 A;  2BYT A;  1JWS D;  4WUR A;  1QT9 A;  1XLP A;  1EWC A;  1P7E A;  1PGB A;  1VDV A;  3E56 A;  2RDG A;  2MH7 A;  1C4A A;  2LHE A;  2KAC A;  4N59 A;  1PUT A;  2PIA A;  1CK1 A;  5EE3 A;  1JW9 D;  1WWT A;  2RPV A;  3LYY A;  4MT5 A;  2N9L A;  4DXG A;  3AE8 B;  3FC4 A;  4OZB A;  2WLB A;  3AE2 B;  3EA6 A;  3KWL A;  2L32 A;  2IGD A;  1K50 A;  3AV8 A;  1PGA A;  1NVI D;  4CQN A;  3W5V B;  1ZOY B;  3TEW A;  3IT4 B;  4MAC A;  4RH6 A;  2RMM A;  1YNT E;  3NRZ A;  3Q8E A;  2INP E;  2KWD A;  1IBX B;  5FK9 C;  4YSZ B;  1I4H A;  1C78 A;  2WXJ A;  4WH4 A;  1HQR D;  3ZYY X;  3FAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...