2Z0EB

The crystal structure of human atg4b- lc3(1-124) complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/structural protein
molecule keywords Cysteine protease ATG4B
publication title The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2z0eB00
3ONSA 2K6QA 3KVFB 4LDTB 2AWTA 2CHXA 4TKNA 2PE9A 3IFWB 4GXBA 3RUIB 1KLVA 2LASA 4B6WA 3M62B 3LDZE 1K8RB 2DYBA 4MSMB 4TQ0A 1P98A 3HHMA 4G0NB 3L0WB 2LD9A 1TTNA 2LVQA 3VH4B 1KOTA 5LLIA 1OEYA 5CX3A 3TJPA 4HPMB 2L7RA 4MGYE 1WM2A 2KX0A 3DPDA 1WFYA 4KDIC 3V62A 4GDLB 2L76A 2J0MA 2Z0DB 2BWES 3AI5A 4GSWA 3OLMD 3LJ3A 1WX9A 3IHPC 3L10B 1J8CA 2ZPNA 2EMSA 3W1SA 5J17A 2GOWA 2ZNVB 1WGHA 2FCQA 3A4SC 2BGFA 3K9OB 1GC6A 1E8XA 4ICVA 3VUYA 4F1SA 1WX7A 5DPSA 3VTUA 2NCNA 3DVGX 4DHJB 2DYOA 2WWZA 2BKFA 2KXJA 1SIFA 2G4DB 1WY8A 4YL8A 4A3OA 2KTFA 2MW5A 3MHSD 2LZ6A 3RD2A 3V6EB 4BOSC 2JUOA 1WJ4A 4RM9A 3JVZX 3DVNU 3WAPA 2KANA 3DBSA 1UBIA 4GDKA 2C60A 2QHOA 4ICUA 2D3GA 3JYUA 4K7SA 2K8CA 1ZKHA 3GOEA 3A9KB 4HPLB 2AYOB 3RYTA 4KDLB 4MSQB 1V80A 4MELA 3D32A 3M95A 3NOBA 2G3QB 4GDKB 5EDSA 4PS3A 1YIWA 2KK8A 3NZSA 4HK2A 4A3PA 2ZVOA 4HJKA 3HM6X 3T8MA 3BINA 2JZZA 4P7IA 3PTFC 3MJWA 1WMHA 2M0XA 4IM2A 1XT9B 4EZJA 2KFKA 2M4NA 4HDQA 1C3TA 1M94A 2UYZB 4PS7A 1QZEA 4W9DA 2WYQA 4HDOA 4ZRKA 4BVUC 2CU1A 4NNJB 2R2QA 4JLCA 3B1LX 3OAWA 5AZGA 5DCNA 3Q3JA 3S2AA 2KFKB 2BYVE 3NY5A 4KSKC 3DVGY 2KJ6A 3DDCB 1WGGA 4NPNA 4ANVA 2MX2A 3ML9A 1WH3A 2NBVB 5TR5A 1V5TA 3VXWA 5KHOA 5JHBA 3PVLA 1WR1A 5CHFA 4KSLC 1RFAA 3QARA 2JT4B 3X23A 4OVVA 2Z59B 1IPGA 4HVBA 2LGXA 1WF9A 2PEAA 3PS6A 3RULA 5BO4B 2JF5A 3DBLI 4G3XB 4MEMA 1Z5SB 2V4LA 1E7VA 3APFA 2YVCA 1EF5A 2JRIB 3ZDMC 1WJNA 4DDGD 4BKGA 2B3AA 4W9KA 4BKSD 1CMXB 4WWPA 3NZUA 4HLEA 2BPSA 1IP9A 2K39A 3ENEA 2O6VD 2L0FA 2O2VB 2J0JA 4BBNC 1X1MA 1E5WA 4IW0A 4W9IA 3R7QA 2KDBA 1EF1A 3ZTCA 2IBIB 2JWZA 2ZEQA 4NAWB 3WIMA 4FLHA 1RLFA 3VUWA 2JZ3B 2MBHA 2K6DB 2KHWB 5E6NA 2DX5B 3DOWA 3L16A 4XX5A 3EC8A 2LRWA 3PT2B 4AWJA 4RMAA 2LRUA 3R3MA 1U4AA 3M3JA 1OGWA 5J2RA 1V86A 4IM0A 3PSEB 4IUMB 4TUUA 4GDLA 4RM8A 3VTWA 1UZXB 1UD7A 2JVCA 3PGEA 1OTRB 1WI0A 3KW5B 1E8YA 2KJHB 3EFUA 1WXVA 2PJHA 4FHJA 4EEWA 2CHZA 1WZ3A 2RD0A 3DCGA 3H7SA 4DDID 4MJSA 2HTHA 3VDZA 3QX1A 3WALA 5CTRC 1ZGUB 4K81A 4WJPA 1NI2A 2K25A 3RT3B 2HE7A 2C7NB 3V61A 3L17A 3SDLC 4EKUA 4W9GA 1GNUA 1YQBA 4I6PA 2KFJA 4MJSB 4DHZE 4E74A 2IO0B 2C7MB 4E71A 2KWUB 2MA9B 4HWIB 2RR9A 4FA6A 2V3SA 2XK5A 1YJ1A 3KH0A 3W1YA 1LXDA 1WXAA 2MP2B 4JL9A 1P0RA 4CYEA 3A9KA 3APDA 2RSUA 3WANA 4N9F4 5D94A 5DPRA 3VFKA 2LXAA 3L13A 1UELA 5G2NA 2IY0B 4ZYNA 2LXCA 1TGZB 3AU5A 4IM3A 3SHQA 2N7DA 2ZVNA 2PPHA 2NVUI 2IYDB 2LGDA 1V49A 1Y8RC 2UWQA 2XK5B 4WQOB 2KDEB 4MDKE 3UF8A 1BT0A 2D11A 5AZHA 5AEKB 5LXIB 5FR6A 2DENB 2KDFB 4GN1A 3UINB 3ZNHB 2KZRA 2MBBB 1EO6A 2ZJDA 2JRHA 3KUZA 3KUDB 3NHEB 5L95C 1TBEA 4M0WB 2NPTB 3ZUNA 2JXXA 3A33B 3CF6E 2MBQA 4GB9A 3V6CB 2KN5A 4WWNA 3L54A 2CKHB 1H8CA 2KO3A 4LJOB 4M8MA 1NDDA 1KM7A 2KMCA 3L08A 2KC2A 2VRRB 1XQQA 2HD5B 3P2BA 4W9JA 3VVWB 3QA8A 4MGZE 2PE6B 3DQVA 2L05A 4K1RB 5C23A 4FULA 2DZIA 2LUEA 2GBNA 3M63B 3O65B 4EZKA 1LFDA 4IWOA 2C9WB 1ZW7A 4DBGA 1WX8A 3ZLZA 1A5RA 4MH0E 1H4RA 5DPWA 2GBJA 2FIFA 4W9CA 4FBJB 3ZRCA 3AULA 2K8BA 3TMPB 4OVUA 4AP4C 2D10A 4BKSA 2I1KA 4W9EA 4ASWC 3UIPB 3A9JB 1G6JA 3WAOA 2O6VA 1LQBA 4E3CA 2EKEC 3N3KB 3X0WA 2YLMA 1WGYA 2IZVB 4IWPA 3W1SC 3JSVA 2BKRB 1GG3A 1PQSA 4DXAB 2AL6A 3UGBB 4I6LB 1D3ZA 3NS8A 2LVOA 3PZDA 2CR5A 4ZRIA 3ZO5B 1IYFA 3GZNI 1MG8A 1P3QU 1RRBA 4X57B 1I42A 2LGYA 3IVFA 2O2VA 3ZTDA 2O6VB 4F8CB 4JQWC 2ASQA 4W9LA 2GMIC 2XBBC 4NAWA 1P1AA 5IAAC 2M8SA 3JSVB 4BBNF 2IO2B 2KMAA 1V2YA 1UBQA 1V9JA 1S3SG 1Z2MA 3H9DA 3HIZA 3TCAA 4EOYA 2MRPA 1E8WA 2MWSB 2A4ZA 2KTRA 1WRDB 3C0RB 3R66C 2KJRA 5AZFA 2EMTA 4WWOA 3ZNID 2G4SA 2IY1B 5LXHA 2DHZA 4B9KA 3QWZB 2OJRA 4EFOA 5CHWA 1L7YA 5D7GA 3A1QA 1SE9A 3K9PB 3ML8A 4DHZB 3SU8X 5D2MB 2KTRB 2AL3A 1UH6A 2CHWA 2FCNA 4J6IA 4BOZB 4NJ7A 2DYMA 1RAXA 1V5OA 2FAZA 4M8NA 2KLGA 4II3B 3KUCB 3VHTC 2G45B 3QK0A 3A1QB 3BY4B 2GBRA 1ISNA 3QAQA 4EUTA 4G11A 2W9NA 4ANUA 1WYWB 3B08A 3OJ4B 4AUQC 1E8ZA 3IG3A 3KYCD 2MBOA 3DBRI 2N7EA 4TQ1A 3QIJA 4II2B 4AOFA 2NR2A 2KDIA 3PV1A 3PRMB 4KIKB 2GBMA 1V81A 3WA0A 3ZNGC 2WX1A 2KWVB 3APCA 2FCMA 1WJ6A 3Q3FA 3TIXA 2C7HA 4LCDE 2MP2A 4ANWA 1TZ1A 2MBEA 5CHVC 2D2QA 2NS5A 5E6PA 1WR6E 4K7UA 2LWPA 4PYUA 1SGHA 2ZCBA 4HCPB 4JIOU 5JH5C 4NQKE 5J18A 4GGQA 3QHTA 2R2OA 4XC2A 1WE6A 2DAFA 2K8HA 3QQ8B 1T0YA 2DZMA 4LJPB 4K7WA 4FADA 4JGHB 4DWFA 2RGFA 2N1VA 1WXMA 3U7DA 2KVRA 4LDTD 3UQAA 1WGRA 1NBFC 2L3ZA 2ZPYA 4ZRJA 3ZIMA 3N30A 2NPTA 3VH3B 3TL5A 3VAWA 2L0TA 4KV2A 2J7QB 1YD8U 2LVPA 5DPTA 1F9JA 4PS8A 1KJTA 1S1QB 1E7UA 4W9HA 3KYDD 3CSTA 2LI5A 3QCAA 3DVNV 2A5UA 3R7RA 2Y5BB 4GU2A 5C1ZA 3PHXB 1Q1OA 2DZJA 3H7PA 4PYZA 1Q5WB 5GMVA 1I35A 2BF8B 2M1MA 4IC7B 2DAJA 2N4FA 2KOXA 2BWFA 4MM3A 3PLVA 4A20A 4NY0A 2KX3A 1V6EA 4F7ZA 3U30A 1VD2A 3VUXA 4DHJD 3B0AA 2WX0A 2KNBA 2HJ8A 3PHWB 3UQBA 3H7PB 4ANXA 1YX5B 3A9JA 5G55A 4WJQA 2N1WA 2REXA 3U8ZA 1AARA 3ALBA 1WM3A 1LM8B 2KQSA 4GIVA 2Z0EB 3PREA 4DK5A 2KLCA 2IO1B 1WJUA 3AXCA 3N32A 2D07B 1R4NI 2ZNVC 3ZVVA 4CHKA 1J0GA 3H6NA 3DBHI 1FXTB 4TV3A 1GC7A 4MGKE 3TBLD 2ZZPB 1GUAB 1XD3B 3ZRFA 1L2NA 4WJOA 4MGIE 3RZWC 5JHAA 5E6OA 3UIOB 2RPQA 4IWQA 3ECIA 3IBEA 2GBKA 3EHVA 3PLUA 2FUHB 4XZ4A 2NBWB 2AEHA 2KKCA 3VTVA 3ZDTA 3ZKJC 2FIDA 4KZCA 1UGMA 1YX6B 2M17A 3V60A 4GOCA 4CO7A 2KD0A 1WMHB 3HK0A 5D6JB 3SD5A 5KHQA 1WE7A 2JPHA 3ZW3A 5HKHA 4AJYB 4HCNB 3RCZA 2I1JA 3QC8B 4BKTA 1JRUA 2C5LC 2XEWA 4WJNA 2KQ7A 4GMVA 2BYFA 2K1FA 2N9XA 4KZ0A 3EECA 3T9LA 1WIAA 1WXSA 3JW0X 1E90A 2JY6A 4B95A 4FJYA 3PPAA 2J0KA 4I6NB 3WAMA 2CS4A 4IG7B 1P9DU 2KC1A 2N9EB 2NBUA 4BFRA 2L00B 1WGDA 2FCSA 4WAAA 2L8JA 3CSFA 1R4MI 3PRPB 2MLBA 3VQIA 2MCNB 1C1YB 2WDTB 4URKA 3MTNB 2N9PC 4KVGB 1HE8A 5IA7A 4ZDVA 1EUVB 1J19A 2IO3B 1Q0WB 2KWCA 2V1YA 3ZNZB 3PRZA 3CMMB 4FHKA 2FNJB 4KIKA 1OQYA 1WZ0A 2LJ5A 2ZCCA 1GJZA 1VCBA 5JZEB 4W9FA 3H1UA 4EZLA 2BYEA 2DZKA 3AU4A 3A4RA 1OEYJ 3OJ3A 3I3TB 4FJZA 2MSED 4FJVB 4AJWA 4NQLB 2MQJA 4G50A 3RZFA 5L83A 4HXDA 2OOBB 4FN2A 4NJ6A 3QJZA 3HM3A
chains in the Genus database with same CATH superfamily
2ZW1A 4TKNA 2PE9A 4GXBA 1KTKA 3LDZE 3ABVB 4MSMB 1MG4A 4TQ0A 4MT5A 1XLOA 3TJPA 1CQVA 4HPMB 4GDLB 2J0MA 1QT9A 3RMKC 1EU3A 1WX9A 2BB5A 3IHPC 3L10B 3T3NA 2ZPNA 2EMSA 1WGHA 1MPEA 1I4HA 3VUYA 2BKFA 3V3XA 1L4DB 4YL8A 1RM6C 4A3OA 4PK1A 1K53A 1WJ4A 4RM9A 3AEBB 2KANA 2WXPA 1UUPA 1JW9D 2K8CA 3RYTA 2HTME 3Q8AA 1FRRA 4MELA 3D32A 1I4PA 4KKIA 1JMLA 4PS3A 4A3PA 2ZVOA 2JZZA 1WMHA 4IM2A 1XT9B 2VH1A 4EZJA 3P4RB 2UYZB 2H89B 4ZRKA 2WXIA 1NVID 4JLCA 3OAWA 5AZGA 2IPKD 5DCNA 3S2AA 2NMQA 3DDCB 2KVZA 1QILA 1WH3A 5KHOA 3BK2A 3QARA 3SR6A 2JT4B 4OVVA 1D6EC 2Z59B 1IPGA 3AE7B 4EE2A 1WF9A 1GPXA 1FFUA 3J9CA 5E6JA 3DBLI 1ZXIA 4MEMA 1E7VA 2B3AA 3Q3MC 4HLEA 2K39A 1PGAA 3ZTCA 2KDBA 1EF1A 4P16A 4NAWB 3WIMA 4B0EA 4FLHA 3VUWA 1R4MB 3BVZA 2DX5B 3EC8A 3VRAB 2BQQA 3MJ5A 3AE1B 3IT6B 4AWJA 1D4BA 2M56B 2W3SA 1YNTE 1UWXA 1TS3A 2VZKB 1E8YA 1MFWA 4FHJA 1WZ3A 3R8BA 1NEKB 1PUTA 1NI2A 3VR8B 3RT3B 2BS3B 3SDLC 2LHDA 1TY0A 1YQBA 2KFJA 1KLUD 2KWUB 4HWIB 2RR9A 1I4XA 2V3SA 3W1YA 1P0RA 4CYEA 3APDA 2RSUA 5DPRA 3VFKA 4RCOA 2LXAA 1C78A 1T3QA 2LXCA 4JWUC 2NVUI 2IYDB 4WQOB 1MI0A 4MDKE 5AZHA 3EUB2 4GN1A 3LB8C 1EO6A 2BB6A 2ZJDA 3KUZA 3KUDB 5L95C 1TBEA 2NPTB 3NS1A 3RPFC 4WWNA 3E9SA 1YN3A 2MHJA 2WXLA 2KC2A 3VVWB 3P2BA 2HD5B 3QA8A 4MGZE 2ACZB 3PO0A 2Z8LA 3P4SB 4EZKA 2C9WB 4DBGA 3SFDB 4W9CA 5D3DA 3TMPB 3U4EG 2I1KA 4ASWC 1VDVA 1D5XC 2O6VA 2RDBC 4S0RA 4E3CA 3N3KB 4ZOHC 4DXGA 1F0ZA 3AEGB 3UGBB 4O1NA 3NS8A 3GZNI 1P3QU 2IGHA 2O6VB 2ASQA 4W9LA 2M8SA 4BBNF 2KMAA 2ZW0A 1V9JA 3HIZA 3R2IA 1V1OA 2KTRA 5AZFA 1WRDB 3P63A 3ZNID 2IY1B 5LXHA 2DHZA 3GE3C 1L6UA 3AEDB 2DWQA 4EFOA 5CHWA 1L7YA 1HTOA 2KQ4X 3TEYA 3ML8A 2D3AA 2KTRB 2LGSA 2FCNA 4US9A 5EE1A 5G5GA 3AB5A 4GLSC 4N6EB 3BY4B 4EUTA 1ISNA 4ANUA 1HEZE 3B08A 2L32A 2MBOA 1WSPA 3PV1A 3PRMB 2RDGA 3BWUD 3WA0A 3APCA 1WJ6A 2C7HA 2MP2A 3Q3NC 1TS2A 1QQRA 4K7UA 1SGHA 2ZCBA 4HCPB 5FR3A 5JH5C 4ARIA 5J18A 4GGQA 2K8HA 3DBRB 1WWTA 4DWFA 1AWDA 3U7DA 4RGTA 1EU4A 4ZRJA 1C9FA 3RNGC 4YTMB 4M0WA 1PGXA 3VAWA 2L0TA 4KV2A 1F9JA 2A5UA 5C1ZA 2MH7A 2PMVA 2BF8B 2KYWA 3IXSA 4HKZE 3AE4B 1IBXA 1F52A 5HHDG 2AQ2B 2HJ8A 1YX5B 2QILA 3A9JA 2Z0EB 1KFYB 3N32A 4A8XC 1R4NI 2NTTA 1FXTB 4P1BC 4ZRQA 3ZRFA 3RZWC 3NVYA 3UIOB 2KT7A 3HVZA 1JWMD 3DHIC 3ECIA 1CK1A 3EHVA 2AEHA 3C19A 4M02A 3ZKJC 2KD0A 5D6JB 3HK0A 4L23A 5KHQA 2ONQA 4AJYB 1JRUA 3Q6BA 4M00A 1SSNA 1DYQA 4RF0A 2DBYA 1E90A 1OQRA 2WGSA 3U2SC 3WAMA 4IG7B 2IJ0A 1P9DU 4BFRA 5MPOA 4LNIA 2MCNB 4URKA 4KVGB 1J19A 1JRPA 1Q0WB 2YEPB 4KIKA 1HA5A 1VR9A 4CQNA 4YSXB 4C7YA 1FCLA 2X38A 2BYEA 2DZKA 3OJ3A 3A4RA 5C3JB 4AJWA 2WXKA 2IDYA 2QIEB 2MQJA 4G50A 4RFBA 2INNE 4HXDA 4XYCA 2KWDA 5BMHA 3ONSA 1LO5D 2YEPF 4YWGG 2AWTA 1XLQA 3BYYB 4RGOS 3RUIB 1KLVA 2LASA 2W3RA 3M62B 1V97A 2IGDA 2D3BA 2DYBA 5BMGA 1JWSD 1P98A 2AQ3B 4G0NB 2LD9A 1KOTA 2QC8A 4MGYE 1WM2A 3DPDA 4KDIC 3V62A 2L76A 4MACA 2Z0DB 2BWES 3AI5A 3OLMD 2VZKD 3W1SA 1FXIA 2GOWA 2ZNVB 2FCQA 4ICVA 3A4SC 2BGFA 3K9OB 1TY2A 1C4PA 4F1SA 1WX7A 3I57A 2DYOA 1YQ4B 2KXJA 1SIFA 1XCQL 1WY8A 1J7AA 2KAJA 4RGNA 2MW5A 2KDMA 1YMHE 3ZYYX 2LZ6A 1QOGA 3DBSA 2C60A 4K3CA 2QHOA 2D3GA 2AYOB 2WDRB 3AECB 1E10A 4MSQB 3NOBA 2M19A 2G3QB 3AE3B 5EDSA 4RF1A 3GP7A 4XWTA 4HK2A 1PGBA 3NUHB 1C76A 4Q2JA 1C3TA 1M94A 1QZEA 4W9DA 4HDOA 3TEZA 2B76B 1SF0A 4LTUA 3B1LX 4ZHPA 5G5HA 1D5ZC 2BYVE 3FAHA 3DVGY 4NPNA 4BZAA 4WAFA 4ANVA 5TR5A 3VXWA 1FXAA 3TUOA 4YSYB 1NYRA 1WR1A 1RFAA 3X23A 2LGXA 3RULA 4USAA 1VRAB 5BO4B 2Y5CA 2QCZA 2V4LA 2JRIB 1WJNA 4W9KA 2Y3AA 2PTLA 1CMXB 2GB1A 3NZUA 2BPSA 3ENEA 2O6VD 2L0FA 2O2VB 2J0JA 1N5XA 3OWEB 2ZEQA 1FNVA 4L2YA 3SEBA 1ZDVA 1KLGD 1HZ5A 1HXYD 3DBLB 2MBHA 1XO3A 5E6NA 3L16A 1K51A 3PT2B 1V1PB 2RDHA 2G9HD 4HPPA 2EELA 4IM0A 4IUMB 4GDLA 1EM7A 3VTWA 2JVCA 3MFGA 2CU3A 1L4ZB 3EFUA 4EEWA 1SE3A 2CHZA 5H92C 2RD0A 4DDID 1E0ZA 3QX1A 1DOXA 3CWIA 4WJPA 3NJTA 2K25A 3V61A 1CZPA 4EKUA 1UNSA 2INPE 1GNUA 3LYYA 4E74A 1F1HA 2MA9B 2WP9B 4C7ZA 4FA6A 3U7ZA 2QDFA 2XK5A 3KH0A 4KGSA 5HG2A 4JL9A 4N9F4 2K5PA 1N60A 3TEWA 1T6BX 3RNEC 5G2NA 3P4PB 4ZYNA 5EE9A 4IM3A 2XK5B 1V49A 3UF8A 1BT0A 5LXIB 1NI3A 2KZRA 3NZ3A 2K3UA 3CF6E 3SFEB 3DHGC 2WDVB 4LJOB 1KM7A 1D3ZA 3L08A 1XQQA 5IO9A 2R61A 3I5JC 3DQVA 1VZ8A 3HUIA 4IWOA 1WX8A 1A5RA 5T8IA 4OZCA 3AULA 2KN4A 2WNMA 4AP4C 2D10A 4BKSA 2PVGC 1LQBA 1WGYA 3W1SC 4IWPA 2GI9A 1PQSA 4DXAB 3AH7A 2LVOA 3PZDA 1IYFA 1MG8A 1JROA 2LGYA 3ZTDA 2GMIC 4NAWA 4XDCA 2IO2B 4OW0A 1Z2MA 1RFKA 2MJ3A 3TCAA 4EOYA 1D5MC 5IP4D 2MWSB 3Q2AC 2A4ZA 3R66C 2KJRA 3O13A 4WWOA 2G4SA 1I7HA 3GZNB 3KLSX 4A9AA 4ZRPA 4B9KA 2OJRA 1FD6A 1SE9A 2N7JA 4DHZB 1WGKA 3SU8X 2CHWA 1XLPA 4IDIA 1N62A 4BOZB 1L5PA 2M0AA 3N1ZC 1V5OA 2FAZA 2KLGA 5BYSA 2BT6A 1GB1A 4G11A 2W9NA 3U52E 1YJIA 2AX5A 3OJ4B 3IG3A 4II2B 2NR2A 1V81A 4N58A 3ZNGC 2KWVB 4LCDE 5CHVC 2OEDA 2D2QA 2NS5A 5E6PA 4YT0B 3QHTA 2R2OA 4LJPB 4B0MA 4JGHB 1ZPSA 4A90A 1ZP0B 3MC8A 2KVRA 3UQAA 1WGRA 1NBFC 2L3ZA 2NPTA 3VH3B 3TL5A 2J7QB 2LVPA 4PS8A 1KJTA 3P42A 1E7UA 4W9HA 3CSTA 5HI1A 3DVNV 1OFFA 4WIPA 3R7RA 2Y5BB 4GU2A 1JQ4A 4KKJA 2M1MA 2DAJA 4N59A 4F7ZA 1FFVA 3U30A 1VD2A 2DNFA 2BW2A 1C77A 2KNBA 2WHIA 3PHWB 2IGGA 4WH4A 2JX5A 5IOIA 5FKAC 2N1WA 3U8ZA 1FO4A 1KH0A 2KLCA 1WJUA 2LEKA 4CHKA 3DBHI 3NVZA 3NVVA 4WJOA 5JHAA 2SAKA 2KMMA 2N9LA 4HKQA 4IWQA 2RPQA 1T5XD 3IBEA 2GBKA 3PLUA 2BTEA 2MJEA 3H8HA 1FNUA 4XZ4A 2KKCA 1R4NB 1UGMA 1YX6B 3P4QB 1WE7A 3I9V1 1QKZA 4BKTA 2C5LC 3RN9C 2KQ7A 4GMVA 2BYFA 3KQ4A 4KZ0A 3T9LA 2L83A 4B95A 3Q8EA 3PPAA 2J0KA 2TSSA 2L00B 1STEA 4WAAA 3CSFA 1R4MI 2K22A 3MC0B 2N9PC 5IA7A 4L1BA 1YOVB 4XE0A 1FCCC 2WQYB 3ZNZB 2ON8A 3CMMB 1JWBD 2Y5PA 1ZE3D 2LJ5A 1GJZA 1TYGB 2BS4B 1ROEA 4FJZA 2X8XX 2MSED 3BYTB 3AMZA 3RZFA 5L83A 4C80A 3KWVA 4LNNA 2K6QA 2PLPA 1N61A 1UWMA 4LDTB 4ZYSA 1K8RB 4P1CC 5I4DA 4TSSA 2Q5WD 1L0XB 1TTNA 5LLIA 3AV8A 5CX3A 4C4VA 2L7RA 2KX0A 1RWSA 4YXDB 1WFYA 4XGAB 4GSWA 1GC6A 1E8XA 2JU6X 4C4VB 2NCNA 2FE8A 1TIFA 2G4DB 3HRDD 2H88B 2OHFA 2V3NA 5AUKA 4AQ7A 3V6EB 3WAPA 3DVNU 1UBIA 2JYTA 5FK9C 4ICUA 1MHHE 2LUMA 3JYUA 1ZKHA 3GOEA 3A9KB 1B9RA 2SEBD 4HJGE 1V80A 3M95A 2JSVX 3GS2A 3BVGA 2UU7A 4FXCA 3HM6X 3BINA 4P7IA 5GXGB 3MJWA 2KFKA 2M4NA 1NENB 1QOAA 4HDQA 3GE8C 3Q3OC 2XNAC 4BVUC 2CU1A 1E6EB 3Q3JA 2JXTA 1J7BA 2KFKB 3NY5A 2MX2A 3ML9A 2NBVB 1DOIA 1V5TA 1SEBD 5JHBA 5CHFA 1A70A 4KSLC 2FBWB 4HVBA 3PS6A 2JF5A 1B1ZA 3GB1A 1XXGA 2YVCA 4TMAB 2WXMA 4MH8A 1LGRA 4BKGA 4BKSD 5BYQA 2VH2A 4YSZB 1E7PB 1WYGA 4NJCA 4BBNC 3IAS1 2IBIB 1EWCA 1RLFA 2JZ3B 2K6DB 2KHWB 3DOWA 4XX5A 5TSSA 2LRWA 2LRUA 3R3MA 1YN5A 1U4AA 3M3JA 3ZJVA 1FMAD 1F2RC 1UD7A 1UZXB 2PKOA 3N20C 1XF5L 3KW5B 1WXVA 3DCGA 4MJSA 3VDZA 3WALA 5CTRC 2QJLA 3VR9B 4M01A 3TSSA 1GB4A 1ET9A 1TS4A 4I6PA 4MJSB 4DHZE 3AN1A 2FUG1 2IO0B 2C7MB 4E71A 1IUEA 1K52A 3N9YC 1LXDA 1WRIA 2IY0B 2D3CA 2ZVNA 1QF6A 2UWQA 1Y8RC 2KDEB 2D11A 4WURA 1XCTL 1N63A 3AEEB 3ZNHB 2MBBB 2JRHA 3NHEB 3FKYA 1JCKB 3IT4B 2MBQA 3E56A 2KN5A 2BYTA 3L54A 2CKHB 1SJHD 1H8CA 2KO3A 1NDDA 2KMCA 4W9JA 2PE6B 2L05A 1NYQA 2DZIA 2LUEA 3O65B 1LFDA 2HJ1A 4JWSC 4MH0E 1H4RA 5DPWA 2FIFA 4FBJB 1VZ7A 1N5WA 4NZLB 2K8BA 5H8YE 4OVUA 1AYFA 3ZJTA 1FIQA 3UIPB 1SE4A 2EKEC 2YLMA 2IZVB 3JSVA 2BKRB 2AL6A 4HEA1 3ZO5B 1RRBA 4X57B 1I42A 2O2VA 2JWUA 5IAAC 3JSVB 2WXHA 1V2YA 1UBQA 2J42A 3H9DA 2GRIA 2E6XA 2MRPA 2QEJC 4AS1A 1V1PA 4AOFA 3C0RB 3EFCA 1IGCA 1QLBB 2K0PA 3QWZB 1VJKA 1KRHA 5D7GA 3A1QA 3AE2B 4US8A 1T0SC 2JYEA 3P1MA 3W2DA 3AE9B 1UH6A 4J6IA 1FPYA 4NJ7A 1Y56A 1RAXA 3DHHC 4M8NA 1YJJA 2WXGA 1ENFA 4II3B 3KUCB 2G45B 3A1QB 3QAQA 2ICIA 1WYWB 3KYCD 4P6VF 1MJDA 4TQ1A 3QIJA 2WXOA 2KDIA 1SB3C 2GBMA 2I38A 3Q3FA 1TT5B 4IOIE 1TZ1A 2MBEA 1WR6E 4PYUA 2LWPA 4HROA 4JIOU 4R3DA 4NQKE 4XC2A 1WE6A 2DZMA 1QOBA 4FADA 3IAM1 2RGFA 1WXMA 4LDTD 1AN8A 3RFZB 3N30A 4OVZA 1C4CA 3AE5B 1YD8U 5DPTA 2BVCA 1S1QB 2CJNA 3PHXB 1Q1OA 3H7PA 4PYZA 1Q5WB 2V0GA 5GMVA 4IC7B 1J7CA 4PT5A 2N4FA 1SXTA 2N9KA 1RYJA 3PLVA 4NY0A 2KX3A 3VUXA 5LNK1 2N0SB 3H7PB 2BS2B 4WJQA 4GIVA 1LM8B 2KQSA 3KWLA 3PREA 2D07B 1GAQB 2ZNVC 1GOZA 4TV3A 2J53A 4MGKE 2W55A 1TKYA 1GUAB 1L2NA 1EWYC 4MGIE 3BZDB 1UF0A 5E6OA 3Q14C 1BUIC 3N1XC 3BIID 2RPVA 1DGJA 2FUHB 2FIDA 3DBHB 2M17A 1WMHB 5HKHA 1HQRD 4HCNB 2XEWA 2K1FA 1FRDA 1WIAA 2JY6A 4HRSA 2INCC 4I6NB 2CS4A 3OG5A 2N9EB 2NBUA 1WGDA 2FCSA 3PRPB 1ZXHA 1PDXA 1HE8A 2W54A 4K3BA 1EUVB 2IO3B 2KWCA 2V1YA 3DWMA 3PRZA 4ITKA 4UDUC 1TKEA 5JZEB 1SBBB 4YTPB 3RNBC 4W9FA 3H1UA 3EA6A 3AU4A 2KACA 4FJVB 2L1AA 5IN7A 4NJ6A 3QJZA 3HM3A 1SJED 4ZHOA 5AUIA 3KVFB 2CHXA 4DXFA 3IFWB 4B6WA 4OZBA 2HDEA 3RNFC 3HHMA 3L0WB 2LVQA 3VH4B 1OEYA 2JZPA 2LMCA 1L0VB 2WLBA 3LJ3A 1J8CA 5J17A 3MC9A 5DPSA 3VTUA 3DVGX 4DHJB 2WWZA 4JX1C 4KGTA 5C2TB 2KTFA 3MHSD 4BOSC 3RD2A 2JUOA 3JVZX 2GLSA 1P7FA 5IKCM 4GDKA 3ZJUA 3Q8FA 4ACFA 4K7SA 3VRBB 4HPLB 2INDC 3V05A 4KDLB 2MEKA 1KF6B 4GDKB 1YIWA 1Q10A 2KK8A 2LJIA 3NZSA 4HJKA 3T8MA 1T0RC 1FNWA 3PTFC 2M0XA 4LNFA 1XEEA 4PS7A 3HVDA 2WYQA 4NNJB 1PYWD 2R2QA 4KSKC 4C56C 2KJ6A 1WGGA 2PIAA 4LNOA 3W5UB 3WCQA 3FC4A 3PVLA 1ESFA 2PEAA 3AEAB 4G3XB 1Z5SB 1PFDA 3APFA 3NVWA 1EF5A 3ZDMC 4DDGD 3MHZA 5EE3A 4YTNB 4WWPA 1L0YB 2LHEA 1IP9A 1V8CA 1X1MA 1E5WA 4IW0A 4W9IA 3R7QA 2JWZA 3RNCC 1I4RA 2QSDA 4IKGA 4J3OD 1ZUD2 3ZXRA 4RMAA 2EKIA 1XLNA 1OGWA 5J2RA 1V86A 2OJWA 3PSEB 4TUUA 4RM8A 3NRZA 3PGEA 1OTRB 1WI0A 2KJHB 2PJHA 3DWGC 5BMIA 1C79A 4LLGM 3H7SA 3R2TA 2HTHA 2WXRA 3C8YA 1ZGUB 4K81A 2HE7A 1YN4A 2C7NB 3L17A 1VZ6A 4W9GA 2G1EA 4DQOC 1YJ1A 1WXAA 2MP2B 1P7EA 2PVOD 3A9KA 3WANA 5D94A 4OZAA 3L13A 2WXFA 1UELA 3B2GA 1L6VA 1HZ6A 1TGZB 3AU5A 3SHQA 2N7DA 4QAYA 2WXNA 2PPHA 2LGDA 3ZQ4A 5AEKB 3BK1A 5FR6A 2DENB 2KDFB 3UINB 4A55A 2DLBA 4JPSA 3URYA 4M0WB 1YQ3B 3ZUNA 1BXTA 2JXXA 3A33B 5EE0A 4GB9A 3UI3A 3V6CB 3RI7C 5JXVA 2RMMA 4M8MA 4XDDA 2VRRB 3ETRA 4RNAA 4K1RB 5C23A 4FULA 3ZGZA 2GBNA 3M63B 4LNKA 4WQMA 2L52A 1ZW7A 3ZLZA 1IBXB 2GBJA 2V4IB 2WU5B 3ZRCA 2D5GA 1VLBA 3LXFA 4W9EA 2BBCA 3A9JB 4RH6A 2J52A 1G6JA 3WAOA 1IGDA 3X0WA 1F2RI 4H2AA 1GG3A 4KGRA 1FEHA 4I6LB 3PZ8A 4ZRIA 1TKGA 2CR5A 3IVFA 4F8CB 4JQWC 3Q69A 1TJEA 1TZOA 1P1AA 2XBBC 1I4GA 1S3SG 1R7SA 3NG0A 3RNAC 2J4XA 1E8WA 3FILA 2EMTA 1TS5A 2W82A 3B9JA 1F77A 1MHXA 3W9CB 2I2YA 1C4AA 3K9PB 3ZXVA 1OQQA 5D2MB 2AL3A 2AQ1B 3FILB 4S17A 2DYMA 1DOYA 3VHTC 3QK0A 2GBRA 3Q8CA 1ZOYB 4AUQC 1E8ZA 2E3TA 3DBRI 2N7EA 2MJDA 3AEFB 4KIKB 2WDQB 4OHJA 2WX1A 3N1YC 2FCMA 3TIXA 2WU2B 4A6QA 4ANWA 1E9MA 4WWMA 1SIJA 1UGJA 1HTQA 3L4PA 1JWAD 2K9XA 2DAFA 3QQ8B 1T0YA 1ACCA 4K7WA 2N1VA 2QMTA 1N6ZA 2ZPYA 4NAMA 3AE8B 3ZIMA 3W5VB 1AW7A 3EGRA 4LK0M 3KYDD 2LI5A 3QCAA 2PW9A 2DZJA 3TEXA 5D3IB 2LGIA 1I35A 3AE6B 2KOXA 2BWFA 4MM3A 4A20A 5HFYA 1V6EA 3MP9A 3PZ7A 4DHJD 3B0AA 2WX0A 3UQBA 1MVKA 4ARCA 4ANXA 5G55A 3CIRB 2REXA 1AARA 1BMLC 1WM3A 3ALBA 4JE3B 2NTSA 3AM9A 5BYRA 4KX6B 4DK5A 4MM3B 2IO1B 3AXCA 3ZVVA 1J0GA 3H6NA 1JALA 1GC7A 1QOFA 3TBLD 2ZZPB 1XD3B 1ET6A 1M4VA 1CJEA 2NBWB 4D2KA 4BAXA 3VTVA 2WS3B 3ZDTA 4KZCA 3V60A 4GOCA 1FM0D 4CO7A 3T3OA 3SD5A 2CJOA 4RGMA 2JPHA 3ZW3A 3RCZA 2I1JA 3QC8B 2V3PA 3BVMA 4WJNA 1I4QA 3I63C 3Q8BA 2N9XA 1JWUD 2WXQA 3EECA 3B2FA 1WXSA 3JW0X 4FJYA 1ZDXA 2LFIA 2KC1A 2JQRB 1WXQA 2L8JA 2MLBA 3VQIA 2V9HA 1C1YB 2WDTB 3MTNB 4ZDVA 1K50A 4FHKA 2FNJB 4XWWA 2XN9C 1OQYA 1WZ0A 2ZCCA 2WXJA 1SE2A 1VCBA 4REZA 4EZLA 4C00A 1OEYJ 3I3TB 4NQLB 1T0QC 2OOBB 4FN2A
chains in the Genus database with same CATH topology
3ONSA 2K6QA 3KVFB 4LDTB 2AWTA 2CHXA 4TKNA 2PE9A 3IFWB 4GXBA 3RUIB 1KLVA 2LASA 4B6WA 3M62B 3LDZE 1K8RB 2DYBA 4MSMB 4TQ0A 1P98A 3HHMA 4G0NB 3L0WB 2LD9A 1TTNA 2LVQA 3VH4B 1KOTA 5LLIA 1OEYA 5CX3A 3TJPA 4HPMB 2L7RA 4MGYE 1WM2A 2KX0A 3DPDA 1WFYA 4KDIC 3V62A 4GDLB 2L76A 2J0MA 2Z0DB 2BWES 3AI5A 4GSWA 3OLMD 3LJ3A 1WX9A 3IHPC 3L10B 1J8CA 2ZPNA 2EMSA 3W1SA 5J17A 2GOWA 2ZNVB 1WGHA 2FCQA 3A4SC 2BGFA 3K9OB 1GC6A 1E8XA 4ICVA 3VUYA 4F1SA 1WX7A 5DPSA 3VTUA 2NCNA 3DVGX 4DHJB 2DYOA 2WWZA 2BKFA 2KXJA 1SIFA 2G4DB 1WY8A 4YL8A 4A3OA 2KTFA 2MW5A 3MHSD 2LZ6A 3RD2A 3V6EB 4BOSC 2JUOA 1WJ4A 4RM9A 3JVZX 3DVNU 3WAPA 2KANA 3DBSA 1UBIA 4GDKA 2C60A 2QHOA 4ICUA 2D3GA 3JYUA 4K7SA 2K8CA 1ZKHA 3GOEA 3A9KB 4HPLB 2AYOB 3RYTA 4KDLB 4MSQB 1V80A 4MELA 3D32A 3M95A 3NOBA 2G3QB 4GDKB 5EDSA 4PS3A 1YIWA 2KK8A 3NZSA 4HK2A 4A3PA 2ZVOA 4HJKA 3HM6X 3T8MA 3BINA 2JZZA 4P7IA 3PTFC 3MJWA 1WMHA 2M0XA 4IM2A 1XT9B 4EZJA 2KFKA 2M4NA 4HDQA 1C3TA 1M94A 2UYZB 4PS7A 1QZEA 4W9DA 2WYQA 4HDOA 4ZRKA 4BVUC 2CU1A 4NNJB 2R2QA 4JLCA 3B1LX 3OAWA 5AZGA 5DCNA 3Q3JA 3S2AA 2KFKB 2BYVE 3NY5A 4KSKC 3DVGY 2KJ6A 3DDCB 1WGGA 4NPNA 4ANVA 2MX2A 3ML9A 1WH3A 2NBVB 5TR5A 1V5TA 3VXWA 5KHOA 5JHBA 3PVLA 1WR1A 5CHFA 4KSLC 1RFAA 3QARA 2JT4B 3X23A 4OVVA 2Z59B 1IPGA 4HVBA 2LGXA 1WF9A 2PEAA 3PS6A 3RULA 5BO4B 2JF5A 3DBLI 4G3XB 4MEMA 1Z5SB 2V4LA 1E7VA 3APFA 2YVCA 1EF5A 2JRIB 3ZDMC 1WJNA 4DDGD 4BKGA 2B3AA 4W9KA 4BKSD 1CMXB 4WWPA 3NZUA 4HLEA 2BPSA 1IP9A 2K39A 3ENEA 2O6VD 2L0FA 2O2VB 2J0JA 4BBNC 1X1MA 1E5WA 4IW0A 4W9IA 3R7QA 2KDBA 1EF1A 3ZTCA 2IBIB 2JWZA 2ZEQA 4NAWB 3WIMA 4FLHA 1RLFA 3VUWA 2JZ3B 2MBHA 2K6DB 2KHWB 5E6NA 2DX5B 3DOWA 3L16A 4XX5A 3EC8A 2LRWA 3PT2B 4AWJA 4RMAA 2LRUA 3R3MA 1U4AA 3M3JA 1OGWA 5J2RA 1V86A 4IM0A 3PSEB 4IUMB 4TUUA 4GDLA 4RM8A 3VTWA 1UZXB 1UD7A 2JVCA 3PGEA 1OTRB 1WI0A 3KW5B 1E8YA 2KJHB 3EFUA 1WXVA 2PJHA 4FHJA 4EEWA 2CHZA 1WZ3A 2RD0A 3DCGA 3H7SA 4DDID 4MJSA 2HTHA 3VDZA 3QX1A 3WALA 5CTRC 1ZGUB 4K81A 4WJPA 1NI2A 2K25A 3RT3B 2HE7A 2C7NB 3V61A 3L17A 3SDLC 4EKUA 4W9GA 1GNUA 1YQBA 4I6PA 2KFJA 4MJSB 4DHZE 4E74A 2IO0B 2C7MB 4E71A 2KWUB 2MA9B 4HWIB 2RR9A 4FA6A 2V3SA 2XK5A 1YJ1A 3KH0A 3W1YA 1LXDA 1WXAA 2MP2B 4JL9A 1P0RA 4CYEA 3A9KA 3APDA 2RSUA 3WANA 4N9F4 5D94A 5DPRA 3VFKA 2LXAA 3L13A 1UELA 5G2NA 2IY0B 4ZYNA 2LXCA 1TGZB 3AU5A 4IM3A 3SHQA 2N7DA 2ZVNA 2PPHA 2NVUI 2IYDB 2LGDA 1V49A 1Y8RC 2UWQA 2XK5B 4WQOB 2KDEB 4MDKE 3UF8A 1BT0A 2D11A 5AZHA 5AEKB 5LXIB 5FR6A 2DENB 2KDFB 4GN1A 3UINB 3ZNHB 2KZRA 2MBBB 1EO6A 2ZJDA 2JRHA 3KUZA 3KUDB 3NHEB 5L95C 1TBEA 4M0WB 2NPTB 3ZUNA 2JXXA 3A33B 3CF6E 2MBQA 4GB9A 3V6CB 2KN5A 4WWNA 3L54A 2CKHB 1H8CA 2KO3A 4LJOB 4M8MA 1NDDA 1KM7A 2KMCA 3L08A 2KC2A 2VRRB 1XQQA 2HD5B 3P2BA 4W9JA 3VVWB 3QA8A 4MGZE 2PE6B 3DQVA 2L05A 4K1RB 5C23A 4FULA 2DZIA 2LUEA 2GBNA 3M63B 3O65B 4EZKA 1LFDA 4IWOA 2C9WB 1ZW7A 4DBGA 1WX8A 3ZLZA 1A5RA 4MH0E 1H4RA 5DPWA 2GBJA 2FIFA 4W9CA 4FBJB 3ZRCA 3AULA 2K8BA 3TMPB 4OVUA 4AP4C 2D10A 4BKSA 2I1KA 4W9EA 4ASWC 3UIPB 3A9JB 1G6JA 3WAOA 2O6VA 1LQBA 4E3CA 2EKEC 3N3KB 3X0WA 2YLMA 1WGYA 2IZVB 4IWPA 3W1SC 3JSVA 2BKRB 1GG3A 1PQSA 4DXAB 2AL6A 3UGBB 4I6LB 1D3ZA 3NS8A 2LVOA 3PZDA 2CR5A 4ZRIA 3ZO5B 1IYFA 3GZNI 1MG8A 1P3QU 1RRBA 4X57B 1I42A 2LGYA 3IVFA 2O2VA 3ZTDA 2O6VB 4F8CB 4JQWC 2ASQA 4W9LA 2GMIC 2XBBC 4NAWA 1P1AA 5IAAC 2M8SA 3JSVB 4BBNF 2IO2B 2KMAA 1V2YA 1UBQA 1V9JA 1S3SG 1Z2MA 3H9DA 3HIZA 3TCAA 4EOYA 2MRPA 1E8WA 2MWSB 2A4ZA 2KTRA 1WRDB 3C0RB 3R66C 2KJRA 5AZFA 2EMTA 4WWOA 3ZNID 2G4SA 2IY1B 5LXHA 2DHZA 4B9KA 3QWZB 2OJRA 4EFOA 5CHWA 1L7YA 5D7GA 3A1QA 1SE9A 3K9PB 3ML8A 4DHZB 3SU8X 5D2MB 2KTRB 2AL3A 1UH6A 2CHWA 2FCNA 4J6IA 4BOZB 4NJ7A 2DYMA 1RAXA 1V5OA 2FAZA 4M8NA 2KLGA 4II3B 3KUCB 3VHTC 2G45B 3QK0A 3A1QB 3BY4B 2GBRA 1ISNA 3QAQA 4EUTA 4G11A 2W9NA 4ANUA 1WYWB 3B08A 3OJ4B 4AUQC 1E8ZA 3IG3A 3KYCD 2MBOA 3DBRI 2N7EA 4TQ1A 3QIJA 4II2B 4AOFA 2NR2A 2KDIA 3PV1A 3PRMB 4KIKB 2GBMA 1V81A 3WA0A 3ZNGC 2WX1A 2KWVB 3APCA 2FCMA 1WJ6A 3Q3FA 3TIXA 2C7HA 4LCDE 2MP2A 4ANWA 1TZ1A 2MBEA 5CHVC 2D2QA 2NS5A 5E6PA 1WR6E 4K7UA 2LWPA 4PYUA 1SGHA 2ZCBA 4HCPB 4JIOU 5JH5C 4NQKE 5J18A 4GGQA 3QHTA 2R2OA 4XC2A 1WE6A 2DAFA 2K8HA 3QQ8B 1T0YA 2DZMA 4LJPB 4K7WA 4FADA 4JGHB 4DWFA 2RGFA 2N1VA 1WXMA 3U7DA 2KVRA 4LDTD 3UQAA 1WGRA 1NBFC 2L3ZA 2ZPYA 4ZRJA 3ZIMA 3N30A 2NPTA 3VH3B 3TL5A 3VAWA 2L0TA 4KV2A 2J7QB 1YD8U 2LVPA 5DPTA 1F9JA 4PS8A 1KJTA 1S1QB 1E7UA 4W9HA 3KYDD 3CSTA 2LI5A 3QCAA 3DVNV 2A5UA 3R7RA 2Y5BB 4GU2A 5C1ZA 3PHXB 1Q1OA 2DZJA 3H7PA 4PYZA 1Q5WB 5GMVA 1I35A 2BF8B 2M1MA 4IC7B 2DAJA 2N4FA 2KOXA 2BWFA 4MM3A 3PLVA 4A20A 4NY0A 2KX3A 1V6EA 4F7ZA 3U30A 1VD2A 3VUXA 4DHJD 3B0AA 2WX0A 2KNBA 2HJ8A 3PHWB 3UQBA 3H7PB 4ANXA 1YX5B 3A9JA 5G55A 4WJQA 2N1WA 2REXA 3U8ZA 1AARA 3ALBA 1WM3A 1LM8B 2KQSA 4GIVA 2Z0EB 3PREA 4DK5A 2KLCA 2IO1B 1WJUA 3AXCA 3N32A 2D07B 1R4NI 2ZNVC 3ZVVA 4CHKA 1J0GA 3H6NA 3DBHI 1FXTB 4TV3A 1GC7A 4MGKE 3TBLD 2ZZPB 1GUAB 1XD3B 3ZRFA 1L2NA 4WJOA 4MGIE 3RZWC 5JHAA 5E6OA 3UIOB 2RPQA 4IWQA 3ECIA 3IBEA 2GBKA 3EHVA 3PLUA 2FUHB 4XZ4A 2NBWB 2AEHA 2KKCA 3VTVA 3ZDTA 3ZKJC 2FIDA 4KZCA 1UGMA 1YX6B 2M17A 3V60A 4GOCA 4CO7A 2KD0A 1WMHB 3HK0A 5D6JB 3SD5A 5KHQA 1WE7A 2JPHA 3ZW3A 5HKHA 4AJYB 4HCNB 3RCZA 2I1JA 3QC8B 4BKTA 1JRUA 2C5LC 2XEWA 4WJNA 2KQ7A 4GMVA 2BYFA 2K1FA 2N9XA 4KZ0A 3EECA 3T9LA 1WIAA 1WXSA 3JW0X 1E90A 2JY6A 4B95A 4FJYA 3PPAA 2J0KA 4I6NB 3WAMA 2CS4A 4IG7B 1P9DU 2KC1A 2N9EB 2NBUA 4BFRA 2L00B 1WGDA 2FCSA 4WAAA 2L8JA 3CSFA 1R4MI 3PRPB 2MLBA 3VQIA 2MCNB 1C1YB 2WDTB 4URKA 3MTNB 2N9PC 4KVGB 1HE8A 5IA7A 4ZDVA 1EUVB 1J19A 2IO3B 1Q0WB 2KWCA 2V1YA 3ZNZB 3PRZA 3CMMB 4FHKA 2FNJB 4KIKA 1OQYA 1WZ0A 2LJ5A 2ZCCA 1GJZA 1VCBA 5JZEB 4W9FA 3H1UA 4EZLA 2BYEA 2DZKA 3AU4A 3A4RA 1OEYJ 3OJ3A 3I3TB 4FJZA 2MSED 4FJVB 4AJWA 4NQLB 2MQJA 4G50A 3RZFA 5L83A 4HXDA 2OOBB 4FN2A 4NJ6A 3QJZA 3HM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONS A;  2K6Q A;  3KVF B;  4LDT B;  2AWT A;  2CHX A;  4TKN A;  2PE9 A;  3IFW B;  4GXB A;  3RUI B;  1KLV A;  2LAS A;  4B6W A;  3M62 B;  3LDZ E;  1K8R B;  2DYB A;  4MSM B;  4TQ0 A;  1P98 A;  3HHM A;  4G0N B;  3L0W B;  2LD9 A;  1TTN A;  2LVQ A;  3VH4 B;  1KOT A;  5LLI A;  1OEY A;  5CX3 A;  3TJP A;  4HPM B;  2L7R A;  4MGY E;  1WM2 A;  2KX0 A;  3DPD A;  1WFY A;  4KDI C;  3V62 A;  4GDL B;  2L76 A;  2J0M A;  2Z0D B;  2BWE S;  3AI5 A;  4GSW A;  3OLM D;  3LJ3 A;  1WX9 A;  3IHP C;  3L10 B;  1J8C A;  2ZPN A;  2EMS A;  3W1S A;  5J17 A;  2GOW A;  2ZNV B;  1WGH A;  2FCQ A;  3A4S C;  2BGF A;  3K9O B;  1GC6 A;  1E8X A;  4ICV A;  3VUY A;  4F1S A;  1WX7 A;  5DPS A;  3VTU A;  2NCN A;  3DVG X;  4DHJ B;  2DYO A;  2WWZ A;  2BKF A;  2KXJ A;  1SIF A;  2G4D B;  1WY8 A;  4YL8 A;  4A3O A;  2KTF A;  2MW5 A;  3MHS D;  2LZ6 A;  3RD2 A;  3V6E B;  4BOS C;  2JUO A;  1WJ4 A;  4RM9 A;  3JVZ X;  3DVN U;  3WAP A;  2KAN A;  3DBS A;  1UBI A;  4GDK A;  2C60 A;  2QHO A;  4ICU A;  2D3G A;  3JYU A;  4K7S A;  2K8C A;  1ZKH A;  3GOE A;  3A9K B;  4HPL B;  2AYO B;  3RYT A;  4KDL B;  4MSQ B;  1V80 A;  4MEL A;  3D32 A;  3M95 A;  3NOB A;  2G3Q B;  4GDK B;  5EDS A;  4PS3 A;  1YIW A;  2KK8 A;  3NZS A;  4HK2 A;  4A3P A;  2ZVO A;  4HJK A;  3HM6 X;  3T8M A;  3BIN A;  2JZZ A;  4P7I A;  3PTF C;  3MJW A;  1WMH A;  2M0X A;  4IM2 A;  1XT9 B;  4EZJ A;  2KFK A;  2M4N A;  4HDQ A;  1C3T A;  1M94 A;  2UYZ B;  4PS7 A;  1QZE A;  4W9D A;  2WYQ A;  4HDO A;  4ZRK A;  4BVU C;  2CU1 A;  4NNJ B;  2R2Q A;  4JLC A;  3B1L X;  3OAW A;  5AZG A;  5DCN A;  3Q3J A;  3S2A A;  2KFK B;  2BYV E;  3NY5 A;  4KSK C;  3DVG Y;  2KJ6 A;  3DDC B;  1WGG A;  4NPN A;  4ANV A;  2MX2 A;  3ML9 A;  1WH3 A;  2NBV B;  5TR5 A;  1V5T A;  3VXW A;  5KHO A;  5JHB A;  3PVL A;  1WR1 A;  5CHF A;  4KSL C;  1RFA A;  3QAR A;  2JT4 B;  3X23 A;  4OVV A;  2Z59 B;  1IPG A;  4HVB A;  2LGX A;  1WF9 A;  2PEA A;  3PS6 A;  3RUL A;  5BO4 B;  2JF5 A;  3DBL I;  4G3X B;  4MEM A;  1Z5S B;  2V4L A;  1E7V A;  3APF A;  2YVC A;  1EF5 A;  2JRI B;  3ZDM C;  1WJN A;  4DDG D;  4BKG A;  2B3A A;  4W9K A;  4BKS D;  1CMX B;  4WWP A;  3NZU A;  4HLE A;  2BPS A;  1IP9 A;  2K39 A;  3ENE A;  2O6V D;  2L0F A;  2O2V B;  2J0J A;  4BBN C;  1X1M A;  1E5W A;  4IW0 A;  4W9I A;  3R7Q A;  2KDB A;  1EF1 A;  3ZTC A;  2IBI B;  2JWZ A;  2ZEQ A;  4NAW B;  3WIM A;  4FLH A;  1RLF A;  3VUW A;  2JZ3 B;  2MBH A;  2K6D B;  2KHW B;  5E6N A;  2DX5 B;  3DOW A;  3L16 A;  4XX5 A;  3EC8 A;  2LRW A;  3PT2 B;  4AWJ A;  4RMA A;  2LRU A;  3R3M A;  1U4A A;  3M3J A;  1OGW A;  5J2R A;  1V86 A;  4IM0 A;  3PSE B;  4IUM B;  4TUU A;  4GDL A;  4RM8 A;  3VTW A;  1UZX B;  1UD7 A;  2JVC A;  3PGE A;  1OTR B;  1WI0 A;  3KW5 B;  1E8Y A;  2KJH B;  3EFU A;  1WXV A;  2PJH A;  4FHJ A;  4EEW A;  2CHZ A;  1WZ3 A;  2RD0 A;  3DCG A;  3H7S A;  4DDI D;  4MJS A;  2HTH A;  3VDZ A;  3QX1 A;  3WAL A;  5CTR C;  1ZGU B;  4K81 A;  4WJP A;  1NI2 A;  2K25 A;  3RT3 B;  2HE7 A;  2C7N B;  3V61 A;  3L17 A;  3SDL C;  4EKU A;  4W9G A;  1GNU A;  1YQB A;  4I6P A;  2KFJ A;  4MJS B;  4DHZ E;  4E74 A;  2IO0 B;  2C7M B;  4E71 A;  2KWU B;  2MA9 B;  4HWI B;  2RR9 A;  4FA6 A;  2V3S A;  2XK5 A;  1YJ1 A;  3KH0 A;  3W1Y A;  1LXD A;  1WXA A;  2MP2 B;  4JL9 A;  1P0R A;  4CYE A;  3A9K A;  3APD A;  2RSU A;  3WAN A;  4N9F 4;  5D94 A;  5DPR A;  3VFK A;  2LXA A;  3L13 A;  1UEL A;  5G2N A;  2IY0 B;  4ZYN A;  2LXC A;  1TGZ B;  3AU5 A;  4IM3 A;  3SHQ A;  2N7D A;  2ZVN A;  2PPH A;  2NVU I;  2IYD B;  2LGD A;  1V49 A;  1Y8R C;  2UWQ A;  2XK5 B;  4WQO B;  2KDE B;  4MDK E;  3UF8 A;  1BT0 A;  2D11 A;  5AZH A;  5AEK B;  5LXI B;  5FR6 A;  2DEN B;  2KDF B;  4GN1 A;  3UIN B;  3ZNH B;  2KZR A;  2MBB B;  1EO6 A;  2ZJD A;  2JRH A;  3KUZ A;  3KUD B;  3NHE B;  5L95 C;  1TBE A;  4M0W B;  2NPT B;  3ZUN A;  2JXX A;  3A33 B;  3CF6 E;  2MBQ A;  4GB9 A;  3V6C B;  2KN5 A;  4WWN A;  3L54 A;  2CKH B;  1H8C A;  2KO3 A;  4LJO B;  4M8M A;  1NDD A;  1KM7 A;  2KMC A;  3L08 A;  2KC2 A;  2VRR B;  1XQQ A;  2HD5 B;  3P2B A;  4W9J A;  3VVW B;  3QA8 A;  4MGZ E;  2PE6 B;  3DQV A;  2L05 A;  4K1R B;  5C23 A;  4FUL A;  2DZI A;  2LUE A;  2GBN A;  3M63 B;  3O65 B;  4EZK A;  1LFD A;  4IWO A;  2C9W B;  1ZW7 A;  4DBG A;  1WX8 A;  3ZLZ A;  1A5R A;  4MH0 E;  1H4R A;  5DPW A;  2GBJ A;  2FIF A;  4W9C A;  4FBJ B;  3ZRC A;  3AUL A;  2K8B A;  3TMP B;  4OVU A;  4AP4 C;  2D10 A;  4BKS A;  2I1K A;  4W9E A;  4ASW C;  3UIP B;  3A9J B;  1G6J A;  3WAO A;  2O6V A;  1LQB A;  4E3C A;  2EKE C;  3N3K B;  3X0W A;  2YLM A;  1WGY A;  2IZV B;  4IWP A;  3W1S C;  3JSV A;  2BKR B;  1GG3 A;  1PQS A;  4DXA B;  2AL6 A;  3UGB B;  4I6L B;  1D3Z A;  3NS8 A;  2LVO A;  3PZD A;  2CR5 A;  4ZRI A;  3ZO5 B;  1IYF A;  3GZN I;  1MG8 A;  1P3Q U;  1RRB A;  4X57 B;  1I42 A;  2LGY A;  3IVF A;  2O2V A;  3ZTD A;  2O6V B;  4F8C B;  4JQW C;  2ASQ A;  4W9L A;  2GMI C;  2XBB C;  4NAW A;  1P1A A;  5IAA C;  2M8S A;  3JSV B;  4BBN F;  2IO2 B;  2KMA A;  1V2Y A;  1UBQ A;  1V9J A;  1S3S G;  1Z2M A;  3H9D A;  3HIZ A;  3TCA A;  4EOY A;  2MRP A;  1E8W A;  2MWS B;  2A4Z A;  2KTR A;  1WRD B;  3C0R B;  3R66 C;  2KJR A;  5AZF A;  2EMT A;  4WWO A;  3ZNI D;  2G4S A;  2IY1 B;  5LXH A;  2DHZ A;  4B9K A;  3QWZ B;  2OJR A;  4EFO A;  5CHW A;  1L7Y A;  5D7G A;  3A1Q A;  1SE9 A;  3K9P B;  3ML8 A;  4DHZ B;  3SU8 X;  5D2M B;  2KTR B;  2AL3 A;  1UH6 A;  2CHW A;  2FCN A;  4J6I A;  4BOZ B;  4NJ7 A;  2DYM A;  1RAX A;  1V5O A;  2FAZ A;  4M8N A;  2KLG A;  4II3 B;  3KUC B;  3VHT C;  2G45 B;  3QK0 A;  3A1Q B;  3BY4 B;  2GBR A;  1ISN A;  3QAQ A;  4EUT A;  4G11 A;  2W9N A;  4ANU A;  1WYW B;  3B08 A;  3OJ4 B;  4AUQ C;  1E8Z A;  3IG3 A;  3KYC D;  2MBO A;  3DBR I;  2N7E A;  4TQ1 A;  3QIJ A;  4II2 B;  4AOF A;  2NR2 A;  2KDI A;  3PV1 A;  3PRM B;  4KIK B;  2GBM A;  1V81 A;  3WA0 A;  3ZNG C;  2WX1 A;  2KWV B;  3APC A;  2FCM A;  1WJ6 A;  3Q3F A;  3TIX A;  2C7H A;  4LCD E;  2MP2 A;  4ANW A;  1TZ1 A;  2MBE A;  5CHV C;  2D2Q A;  2NS5 A;  5E6P A;  1WR6 E;  4K7U A;  2LWP A;  4PYU A;  1SGH A;  2ZCB A;  4HCP B;  4JIO U;  5JH5 C;  4NQK E;  5J18 A;  4GGQ A;  3QHT A;  2R2O A;  4XC2 A;  1WE6 A;  2DAF A;  2K8H A;  3QQ8 B;  1T0Y A;  2DZM A;  4LJP B;  4K7W A;  4FAD A;  4JGH B;  4DWF A;  2RGF A;  2N1V A;  1WXM A;  3U7D A;  2KVR A;  4LDT D;  3UQA A;  1WGR A;  1NBF C;  2L3Z A;  2ZPY A;  4ZRJ A;  3ZIM A;  3N30 A;  2NPT A;  3VH3 B;  3TL5 A;  3VAW A;  2L0T A;  4KV2 A;  2J7Q B;  1YD8 U;  2LVP A;  5DPT A;  1F9J A;  4PS8 A;  1KJT A;  1S1Q B;  1E7U A;  4W9H A;  3KYD D;  3CST A;  2LI5 A;  3QCA A;  3DVN V;  2A5U A;  3R7R A;  2Y5B B;  4GU2 A;  5C1Z A;  3PHX B;  1Q1O A;  2DZJ A;  3H7P A;  4PYZ A;  1Q5W B;  5GMV A;  1I35 A;  2BF8 B;  2M1M A;  4IC7 B;  2DAJ A;  2N4F A;  2KOX A;  2BWF A;  4MM3 A;  3PLV A;  4A20 A;  4NY0 A;  2KX3 A;  1V6E A;  4F7Z A;  3U30 A;  1VD2 A;  3VUX A;  4DHJ D;  3B0A A;  2WX0 A;  2KNB A;  2HJ8 A;  3PHW B;  3UQB A;  3H7P B;  4ANX A;  1YX5 B;  3A9J A;  5G55 A;  4WJQ A;  2N1W A;  2REX A;  3U8Z A;  1AAR A;  3ALB A;  1WM3 A;  1LM8 B;  2KQS A;  4GIV A;  2Z0E B;  3PRE A;  4DK5 A;  2KLC A;  2IO1 B;  1WJU A;  3AXC A;  3N32 A;  2D07 B;  1R4N I;  2ZNV C;  3ZVV A;  4CHK A;  1J0G A;  3H6N A;  3DBH I;  1FXT B;  4TV3 A;  1GC7 A;  4MGK E;  3TBL D;  2ZZP B;  1GUA B;  1XD3 B;  3ZRF A;  1L2N A;  4WJO A;  4MGI E;  3RZW C;  5JHA A;  5E6O A;  3UIO B;  2RPQ A;  4IWQ A;  3ECI A;  3IBE A;  2GBK A;  3EHV A;  3PLU A;  2FUH B;  4XZ4 A;  2NBW B;  2AEH A;  2KKC A;  3VTV A;  3ZDT A;  3ZKJ C;  2FID A;  4KZC A;  1UGM A;  1YX6 B;  2M17 A;  3V60 A;  4GOC A;  4CO7 A;  2KD0 A;  1WMH B;  3HK0 A;  5D6J B;  3SD5 A;  5KHQ A;  1WE7 A;  2JPH A;  3ZW3 A;  5HKH A;  4AJY B;  4HCN B;  3RCZ A;  2I1J A;  3QC8 B;  4BKT A;  1JRU A;  2C5L C;  2XEW A;  4WJN A;  2KQ7 A;  4GMV A;  2BYF A;  2K1F A;  2N9X A;  4KZ0 A;  3EEC A;  3T9L A;  1WIA A;  1WXS A;  3JW0 X;  1E90 A;  2JY6 A;  4B95 A;  4FJY A;  3PPA A;  2J0K A;  4I6N B;  3WAM A;  2CS4 A;  4IG7 B;  1P9D U;  2KC1 A;  2N9E B;  2NBU A;  4BFR A;  2L00 B;  1WGD A;  2FCS A;  4WAA A;  2L8J A;  3CSF A;  1R4M I;  3PRP B;  2MLB A;  3VQI A;  2MCN B;  1C1Y B;  2WDT B;  4URK A;  3MTN B;  2N9P C;  4KVG B;  1HE8 A;  5IA7 A;  4ZDV A;  1EUV B;  1J19 A;  2IO3 B;  1Q0W B;  2KWC A;  2V1Y A;  3ZNZ B;  3PRZ A;  3CMM B;  4FHK A;  2FNJ B;  4KIK A;  1OQY A;  1WZ0 A;  2LJ5 A;  2ZCC A;  1GJZ A;  1VCB A;  5JZE B;  4W9F A;  3H1U A;  4EZL A;  2BYE A;  2DZK A;  3AU4 A;  3A4R A;  1OEY J;  3OJ3 A;  3I3T B;  4FJZ A;  2MSE D;  4FJV B;  4AJW A;  4NQL B;  2MQJ A;  4G50 A;  3RZF A;  5L83 A;  4HXD A;  2OOB B;  4FN2 A;  4NJ6 A;  3QJZ A;  3HM3 A; 
#chains in the Genus database with same CATH topology
 2ZW1 A;  4TKN A;  2PE9 A;  4GXB A;  1KTK A;  3LDZ E;  3ABV B;  4MSM B;  1MG4 A;  4TQ0 A;  4MT5 A;  1XLO A;  3TJP A;  1CQV A;  4HPM B;  4GDL B;  2J0M A;  1QT9 A;  3RMK C;  1EU3 A;  1WX9 A;  2BB5 A;  3IHP C;  3L10 B;  3T3N A;  2ZPN A;  2EMS A;  1WGH A;  1MPE A;  1I4H A;  3VUY A;  2BKF A;  3V3X A;  1L4D B;  4YL8 A;  1RM6 C;  4A3O A;  4PK1 A;  1K53 A;  1WJ4 A;  4RM9 A;  3AEB B;  2KAN A;  2WXP A;  1UUP A;  1JW9 D;  2K8C A;  3RYT A;  2HTM E;  3Q8A A;  1FRR A;  4MEL A;  3D32 A;  1I4P A;  4KKI A;  1JML A;  4PS3 A;  4A3P A;  2ZVO A;  2JZZ A;  1WMH A;  4IM2 A;  1XT9 B;  2VH1 A;  4EZJ A;  3P4R B;  2UYZ B;  2H89 B;  4ZRK A;  2WXI A;  1NVI D;  4JLC A;  3OAW A;  5AZG A;  2IPK D;  5DCN A;  3S2A A;  2NMQ A;  3DDC B;  2KVZ A;  1QIL A;  1WH3 A;  5KHO A;  3BK2 A;  3QAR A;  3SR6 A;  2JT4 B;  4OVV A;  1D6E C;  2Z59 B;  1IPG A;  3AE7 B;  4EE2 A;  1WF9 A;  1GPX A;  1FFU A;  3J9C A;  5E6J A;  3DBL I;  1ZXI A;  4MEM A;  1E7V A;  2B3A A;  3Q3M C;  4HLE A;  2K39 A;  1PGA A;  3ZTC A;  2KDB A;  1EF1 A;  4P16 A;  4NAW B;  3WIM A;  4B0E A;  4FLH A;  3VUW A;  1R4M B;  3BVZ A;  2DX5 B;  3EC8 A;  3VRA B;  2BQQ A;  3MJ5 A;  3AE1 B;  3IT6 B;  4AWJ A;  1D4B A;  2M56 B;  2W3S A;  1YNT E;  1UWX A;  1TS3 A;  2VZK B;  1E8Y A;  1MFW A;  4FHJ A;  1WZ3 A;  3R8B A;  1NEK B;  1PUT A;  1NI2 A;  3VR8 B;  3RT3 B;  2BS3 B;  3SDL C;  2LHD A;  1TY0 A;  1YQB A;  2KFJ A;  1KLU D;  2KWU B;  4HWI B;  2RR9 A;  1I4X A;  2V3S A;  3W1Y A;  1P0R A;  4CYE A;  3APD A;  2RSU A;  5DPR A;  3VFK A;  4RCO A;  2LXA A;  1C78 A;  1T3Q A;  2LXC A;  4JWU C;  2NVU I;  2IYD B;  4WQO B;  1MI0 A;  4MDK E;  5AZH A;  3EUB 2;  4GN1 A;  3LB8 C;  1EO6 A;  2BB6 A;  2ZJD A;  3KUZ A;  3KUD B;  5L95 C;  1TBE A;  2NPT B;  3NS1 A;  3RPF C;  4WWN A;  3E9S A;  1YN3 A;  2MHJ A;  2WXL A;  2KC2 A;  3VVW B;  3P2B A;  2HD5 B;  3QA8 A;  4MGZ E;  2ACZ B;  3PO0 A;  2Z8L A;  3P4S B;  4EZK A;  2C9W B;  4DBG A;  3SFD B;  4W9C A;  5D3D A;  3TMP B;  3U4E G;  2I1K A;  4ASW C;  1VDV A;  1D5X C;  2O6V A;  2RDB C;  4S0R A;  4E3C A;  3N3K B;  4ZOH C;  4DXG A;  1F0Z A;  3AEG B;  3UGB B;  4O1N A;  3NS8 A;  3GZN I;  1P3Q U;  2IGH A;  2O6V B;  2ASQ A;  4W9L A;  2M8S A;  4BBN F;  2KMA A;  2ZW0 A;  1V9J A;  3HIZ A;  3R2I A;  1V1O A;  2KTR A;  5AZF A;  1WRD B;  3P63 A;  3ZNI D;  2IY1 B;  5LXH A;  2DHZ A;  3GE3 C;  1L6U A;  3AED B;  2DWQ A;  4EFO A;  5CHW A;  1L7Y A;  1HTO A;  2KQ4 X;  3TEY A;  3ML8 A;  2D3A A;  2KTR B;  2LGS A;  2FCN A;  4US9 A;  5EE1 A;  5G5G A;  3AB5 A;  4GLS C;  4N6E B;  3BY4 B;  4EUT A;  1ISN A;  4ANU A;  1HEZ E;  3B08 A;  2L32 A;  2MBO A;  1WSP A;  3PV1 A;  3PRM B;  2RDG A;  3BWU D;  3WA0 A;  3APC A;  1WJ6 A;  2C7H A;  2MP2 A;  3Q3N C;  1TS2 A;  1QQR A;  4K7U A;  1SGH A;  2ZCB A;  4HCP B;  5FR3 A;  5JH5 C;  4ARI A;  5J18 A;  4GGQ A;  2K8H A;  3DBR B;  1WWT A;  4DWF A;  1AWD A;  3U7D A;  4RGT A;  1EU4 A;  4ZRJ A;  1C9F A;  3RNG C;  4YTM B;  4M0W A;  1PGX A;  3VAW A;  2L0T A;  4KV2 A;  1F9J A;  2A5U A;  5C1Z A;  2MH7 A;  2PMV A;  2BF8 B;  2KYW A;  3IXS A;  4HKZ E;  3AE4 B;  1IBX A;  1F52 A;  5HHD G;  2AQ2 B;  2HJ8 A;  1YX5 B;  2QIL A;  3A9J A;  2Z0E B;  1KFY B;  3N32 A;  4A8X C;  1R4N I;  2NTT A;  1FXT B;  4P1B C;  4ZRQ A;  3ZRF A;  3RZW C;  3NVY A;  3UIO B;  2KT7 A;  3HVZ A;  1JWM D;  3DHI C;  3ECI A;  1CK1 A;  3EHV A;  2AEH A;  3C19 A;  4M02 A;  3ZKJ C;  2KD0 A;  5D6J B;  3HK0 A;  4L23 A;  5KHQ A;  2ONQ A;  4AJY B;  1JRU A;  3Q6B A;  4M00 A;  1SSN A;  1DYQ A;  4RF0 A;  2DBY A;  1E90 A;  1OQR A;  2WGS A;  3U2S C;  3WAM A;  4IG7 B;  2IJ0 A;  1P9D U;  4BFR A;  5MPO A;  4LNI A;  2MCN B;  4URK A;  4KVG B;  1J19 A;  1JRP A;  1Q0W B;  2YEP B;  4KIK A;  1HA5 A;  1VR9 A;  4CQN A;  4YSX B;  4C7Y A;  1FCL A;  2X38 A;  2BYE A;  2DZK A;  3OJ3 A;  3A4R A;  5C3J B;  4AJW A;  2WXK A;  2IDY A;  2QIE B;  2MQJ A;  4G50 A;  4RFB A;  2INN E;  4HXD A;  4XYC A;  2KWD A;  5BMH A;  3ONS A;  1LO5 D;  2YEP F;  4YWG G;  2AWT A;  1XLQ A;  3BYY B;  4RGO S;  3RUI B;  1KLV A;  2LAS A;  2W3R A;  3M62 B;  1V97 A;  2IGD A;  2D3B A;  2DYB A;  5BMG A;  1JWS D;  1P98 A;  2AQ3 B;  4G0N B;  2LD9 A;  1KOT A;  2QC8 A;  4MGY E;  1WM2 A;  3DPD A;  4KDI C;  3V62 A;  2L76 A;  4MAC A;  2Z0D B;  2BWE S;  3AI5 A;  3OLM D;  2VZK D;  3W1S A;  1FXI A;  2GOW A;  2ZNV B;  2FCQ A;  4ICV A;  3A4S C;  2BGF A;  3K9O B;  1TY2 A;  1C4P A;  4F1S A;  1WX7 A;  3I57 A;  2DYO A;  1YQ4 B;  2KXJ A;  1SIF A;  1XCQ L;  1WY8 A;  1J7A A;  2KAJ A;  4RGN A;  2MW5 A;  2KDM A;  1YMH E;  3ZYY X;  2LZ6 A;  1QOG A;  3DBS A;  2C60 A;  4K3C A;  2QHO A;  2D3G A;  2AYO B;  2WDR B;  3AEC B;  1E10 A;  4MSQ B;  3NOB A;  2M19 A;  2G3Q B;  3AE3 B;  5EDS A;  4RF1 A;  3GP7 A;  4XWT A;  4HK2 A;  1PGB A;  3NUH B;  1C76 A;  4Q2J A;  1C3T A;  1M94 A;  1QZE A;  4W9D A;  4HDO A;  3TEZ A;  2B76 B;  1SF0 A;  4LTU A;  3B1L X;  4ZHP A;  5G5H A;  1D5Z C;  2BYV E;  3FAH A;  3DVG Y;  4NPN A;  4BZA A;  4WAF A;  4ANV A;  5TR5 A;  3VXW A;  1FXA A;  3TUO A;  4YSY B;  1NYR A;  1WR1 A;  1RFA A;  3X23 A;  2LGX A;  3RUL A;  4USA A;  1VRA B;  5BO4 B;  2Y5C A;  2QCZ A;  2V4L A;  2JRI B;  1WJN A;  4W9K A;  2Y3A A;  2PTL A;  1CMX B;  2GB1 A;  3NZU A;  2BPS A;  3ENE A;  2O6V D;  2L0F A;  2O2V B;  2J0J A;  1N5X A;  3OWE B;  2ZEQ A;  1FNV A;  4L2Y A;  3SEB A;  1ZDV A;  1KLG D;  1HZ5 A;  1HXY D;  3DBL B;  2MBH A;  1XO3 A;  5E6N A;  3L16 A;  1K51 A;  3PT2 B;  1V1P B;  2RDH A;  2G9H D;  4HPP A;  2EEL A;  4IM0 A;  4IUM B;  4GDL A;  1EM7 A;  3VTW A;  2JVC A;  3MFG A;  2CU3 A;  1L4Z B;  3EFU A;  4EEW A;  1SE3 A;  2CHZ A;  5H92 C;  2RD0 A;  4DDI D;  1E0Z A;  3QX1 A;  1DOX A;  3CWI A;  4WJP A;  3NJT A;  2K25 A;  3V61 A;  1CZP A;  4EKU A;  1UNS A;  2INP E;  1GNU A;  3LYY A;  4E74 A;  1F1H A;  2MA9 B;  2WP9 B;  4C7Z A;  4FA6 A;  3U7Z A;  2QDF A;  2XK5 A;  3KH0 A;  4KGS A;  5HG2 A;  4JL9 A;  4N9F 4;  2K5P A;  1N60 A;  3TEW A;  1T6B X;  3RNE C;  5G2N A;  3P4P B;  4ZYN A;  5EE9 A;  4IM3 A;  2XK5 B;  1V49 A;  3UF8 A;  1BT0 A;  5LXI B;  1NI3 A;  2KZR A;  3NZ3 A;  2K3U A;  3CF6 E;  3SFE B;  3DHG C;  2WDV B;  4LJO B;  1KM7 A;  1D3Z A;  3L08 A;  1XQQ A;  5IO9 A;  2R61 A;  3I5J C;  3DQV A;  1VZ8 A;  3HUI A;  4IWO A;  1WX8 A;  1A5R A;  5T8I A;  4OZC A;  3AUL A;  2KN4 A;  2WNM A;  4AP4 C;  2D10 A;  4BKS A;  2PVG C;  1LQB A;  1WGY A;  3W1S C;  4IWP A;  2GI9 A;  1PQS A;  4DXA B;  3AH7 A;  2LVO A;  3PZD A;  1IYF A;  1MG8 A;  1JRO A;  2LGY A;  3ZTD A;  2GMI C;  4NAW A;  4XDC A;  2IO2 B;  4OW0 A;  1Z2M A;  1RFK A;  2MJ3 A;  3TCA A;  4EOY A;  1D5M C;  5IP4 D;  2MWS B;  3Q2A C;  2A4Z A;  3R66 C;  2KJR A;  3O13 A;  4WWO A;  2G4S A;  1I7H A;  3GZN B;  3KLS X;  4A9A A;  4ZRP A;  4B9K A;  2OJR A;  1FD6 A;  1SE9 A;  2N7J A;  4DHZ B;  1WGK A;  3SU8 X;  2CHW A;  1XLP A;  4IDI A;  1N62 A;  4BOZ B;  1L5P A;  2M0A A;  3N1Z C;  1V5O A;  2FAZ A;  2KLG A;  5BYS A;  2BT6 A;  1GB1 A;  4G11 A;  2W9N A;  3U52 E;  1YJI A;  2AX5 A;  3OJ4 B;  3IG3 A;  4II2 B;  2NR2 A;  1V81 A;  4N58 A;  3ZNG C;  2KWV B;  4LCD E;  5CHV C;  2OED A;  2D2Q A;  2NS5 A;  5E6P A;  4YT0 B;  3QHT A;  2R2O A;  4LJP B;  4B0M A;  4JGH B;  1ZPS A;  4A90 A;  1ZP0 B;  3MC8 A;  2KVR A;  3UQA A;  1WGR A;  1NBF C;  2L3Z A;  2NPT A;  3VH3 B;  3TL5 A;  2J7Q B;  2LVP A;  4PS8 A;  1KJT A;  3P42 A;  1E7U A;  4W9H A;  3CST A;  5HI1 A;  3DVN V;  1OFF A;  4WIP A;  3R7R A;  2Y5B B;  4GU2 A;  1JQ4 A;  4KKJ A;  2M1M A;  2DAJ A;  4N59 A;  4F7Z A;  1FFV A;  3U30 A;  1VD2 A;  2DNF A;  2BW2 A;  1C77 A;  2KNB A;  2WHI A;  3PHW B;  2IGG A;  4WH4 A;  2JX5 A;  5IOI A;  5FKA C;  2N1W A;  3U8Z A;  1FO4 A;  1KH0 A;  2KLC A;  1WJU A;  2LEK A;  4CHK A;  3DBH I;  3NVZ A;  3NVV A;  4WJO A;  5JHA A;  2SAK A;  2KMM A;  2N9L A;  4HKQ A;  4IWQ A;  2RPQ A;  1T5X D;  3IBE A;  2GBK A;  3PLU A;  2BTE A;  2MJE A;  3H8H A;  1FNU A;  4XZ4 A;  2KKC A;  1R4N B;  1UGM A;  1YX6 B;  3P4Q B;  1WE7 A;  3I9V 1;  1QKZ A;  4BKT A;  2C5L C;  3RN9 C;  2KQ7 A;  4GMV A;  2BYF A;  3KQ4 A;  4KZ0 A;  3T9L A;  2L83 A;  4B95 A;  3Q8E A;  3PPA A;  2J0K A;  2TSS A;  2L00 B;  1STE A;  4WAA A;  3CSF A;  1R4M I;  2K22 A;  3MC0 B;  2N9P C;  5IA7 A;  4L1B A;  1YOV B;  4XE0 A;  1FCC C;  2WQY B;  3ZNZ B;  2ON8 A;  3CMM B;  1JWB D;  2Y5P A;  1ZE3 D;  2LJ5 A;  1GJZ A;  1TYG B;  2BS4 B;  1ROE A;  4FJZ A;  2X8X X;  2MSE D;  3BYT B;  3AMZ A;  3RZF A;  5L83 A;  4C80 A;  3KWV A;  4LNN A;  2K6Q A;  2PLP A;  1N61 A;  1UWM A;  4LDT B;  4ZYS A;  1K8R B;  4P1C C;  5I4D A;  4TSS A;  2Q5W D;  1L0X B;  1TTN A;  5LLI A;  3AV8 A;  5CX3 A;  4C4V A;  2L7R A;  2KX0 A;  1RWS A;  4YXD B;  1WFY A;  4XGA B;  4GSW A;  1GC6 A;  1E8X A;  2JU6 X;  4C4V B;  2NCN A;  2FE8 A;  1TIF A;  2G4D B;  3HRD D;  2H88 B;  2OHF A;  2V3N A;  5AUK A;  4AQ7 A;  3V6E B;  3WAP A;  3DVN U;  1UBI A;  2JYT A;  5FK9 C;  4ICU A;  1MHH E;  2LUM A;  3JYU A;  1ZKH A;  3GOE A;  3A9K B;  1B9R A;  2SEB D;  4HJG E;  1V80 A;  3M95 A;  2JSV X;  3GS2 A;  3BVG A;  2UU7 A;  4FXC A;  3HM6 X;  3BIN A;  4P7I A;  5GXG B;  3MJW A;  2KFK A;  2M4N A;  1NEN B;  1QOA A;  4HDQ A;  3GE8 C;  3Q3O C;  2XNA C;  4BVU C;  2CU1 A;  1E6E B;  3Q3J A;  2JXT A;  1J7B A;  2KFK B;  3NY5 A;  2MX2 A;  3ML9 A;  2NBV B;  1DOI A;  1V5T A;  1SEB D;  5JHB A;  5CHF A;  1A70 A;  4KSL C;  2FBW B;  4HVB A;  3PS6 A;  2JF5 A;  1B1Z A;  3GB1 A;  1XXG A;  2YVC A;  4TMA B;  2WXM A;  4MH8 A;  1LGR A;  4BKG A;  4BKS D;  5BYQ A;  2VH2 A;  4YSZ B;  1E7P B;  1WYG A;  4NJC A;  4BBN C;  3IAS 1;  2IBI B;  1EWC A;  1RLF A;  2JZ3 B;  2K6D B;  2KHW B;  3DOW A;  4XX5 A;  5TSS A;  2LRW A;  2LRU A;  3R3M A;  1YN5 A;  1U4A A;  3M3J A;  3ZJV A;  1FMA D;  1F2R C;  1UD7 A;  1UZX B;  2PKO A;  3N20 C;  1XF5 L;  3KW5 B;  1WXV A;  3DCG A;  4MJS A;  3VDZ A;  3WAL A;  5CTR C;  2QJL A;  3VR9 B;  4M01 A;  3TSS A;  1GB4 A;  1ET9 A;  1TS4 A;  4I6P A;  4MJS B;  4DHZ E;  3AN1 A;  2FUG 1;  2IO0 B;  2C7M B;  4E71 A;  1IUE A;  1K52 A;  3N9Y C;  1LXD A;  1WRI A;  2IY0 B;  2D3C A;  2ZVN A;  1QF6 A;  2UWQ A;  1Y8R C;  2KDE B;  2D11 A;  4WUR A;  1XCT L;  1N63 A;  3AEE B;  3ZNH B;  2MBB B;  2JRH A;  3NHE B;  3FKY A;  1JCK B;  3IT4 B;  2MBQ A;  3E56 A;  2KN5 A;  2BYT A;  3L54 A;  2CKH B;  1SJH D;  1H8C A;  2KO3 A;  1NDD A;  2KMC A;  4W9J A;  2PE6 B;  2L05 A;  1NYQ A;  2DZI A;  2LUE A;  3O65 B;  1LFD A;  2HJ1 A;  4JWS C;  4MH0 E;  1H4R A;  5DPW A;  2FIF A;  4FBJ B;  1VZ7 A;  1N5W A;  4NZL B;  2K8B A;  5H8Y E;  4OVU A;  1AYF A;  3ZJT A;  1FIQ A;  3UIP B;  1SE4 A;  2EKE C;  2YLM A;  2IZV B;  3JSV A;  2BKR B;  2AL6 A;  4HEA 1;  3ZO5 B;  1RRB A;  4X57 B;  1I42 A;  2O2V A;  2JWU A;  5IAA C;  3JSV B;  2WXH A;  1V2Y A;  1UBQ A;  2J42 A;  3H9D A;  2GRI A;  2E6X A;  2MRP A;  2QEJ C;  4AS1 A;  1V1P A;  4AOF A;  3C0R B;  3EFC A;  1IGC A;  1QLB B;  2K0P A;  3QWZ B;  1VJK A;  1KRH A;  5D7G A;  3A1Q A;  3AE2 B;  4US8 A;  1T0S C;  2JYE A;  3P1M A;  3W2D A;  3AE9 B;  1UH6 A;  4J6I A;  1FPY A;  4NJ7 A;  1Y56 A;  1RAX A;  3DHH C;  4M8N A;  1YJJ A;  2WXG A;  1ENF A;  4II3 B;  3KUC B;  2G45 B;  3A1Q B;  3QAQ A;  2ICI A;  1WYW B;  3KYC D;  4P6V F;  1MJD A;  4TQ1 A;  3QIJ A;  2WXO A;  2KDI A;  1SB3 C;  2GBM A;  2I38 A;  3Q3F A;  1TT5 B;  4IOI E;  1TZ1 A;  2MBE A;  1WR6 E;  4PYU A;  2LWP A;  4HRO A;  4JIO U;  4R3D A;  4NQK E;  4XC2 A;  1WE6 A;  2DZM A;  1QOB A;  4FAD A;  3IAM 1;  2RGF A;  1WXM A;  4LDT D;  1AN8 A;  3RFZ B;  3N30 A;  4OVZ A;  1C4C A;  3AE5 B;  1YD8 U;  5DPT A;  2BVC A;  1S1Q B;  2CJN A;  3PHX B;  1Q1O A;  3H7P A;  4PYZ A;  1Q5W B;  2V0G A;  5GMV A;  4IC7 B;  1J7C A;  4PT5 A;  2N4F A;  1SXT A;  2N9K A;  1RYJ A;  3PLV A;  4NY0 A;  2KX3 A;  3VUX A;  5LNK 1;  2N0S B;  3H7P B;  2BS2 B;  4WJQ A;  4GIV A;  1LM8 B;  2KQS A;  3KWL A;  3PRE A;  2D07 B;  1GAQ B;  2ZNV C;  1GOZ A;  4TV3 A;  2J53 A;  4MGK E;  2W55 A;  1TKY A;  1GUA B;  1L2N A;  1EWY C;  4MGI E;  3BZD B;  1UF0 A;  5E6O A;  3Q14 C;  1BUI C;  3N1X C;  3BII D;  2RPV A;  1DGJ A;  2FUH B;  2FID A;  3DBH B;  2M17 A;  1WMH B;  5HKH A;  1HQR D;  4HCN B;  2XEW A;  2K1F A;  1FRD A;  1WIA A;  2JY6 A;  4HRS A;  2INC C;  4I6N B;  2CS4 A;  3OG5 A;  2N9E B;  2NBU A;  1WGD A;  2FCS A;  3PRP B;  1ZXH A;  1PDX A;  1HE8 A;  2W54 A;  4K3B A;  1EUV B;  2IO3 B;  2KWC A;  2V1Y A;  3DWM A;  3PRZ A;  4ITK A;  4UDU C;  1TKE A;  5JZE B;  1SBB B;  4YTP B;  3RNB C;  4W9F A;  3H1U A;  3EA6 A;  3AU4 A;  2KAC A;  4FJV B;  2L1A A;  5IN7 A;  4NJ6 A;  3QJZ A;  3HM3 A;  1SJE D;  4ZHO A;  5AUI A;  3KVF B;  2CHX A;  4DXF A;  3IFW B;  4B6W A;  4OZB A;  2HDE A;  3RNF C;  3HHM A;  3L0W B;  2LVQ A;  3VH4 B;  1OEY A;  2JZP A;  2LMC A;  1L0V B;  2WLB A;  3LJ3 A;  1J8C A;  5J17 A;  3MC9 A;  5DPS A;  3VTU A;  3DVG X;  4DHJ B;  2WWZ A;  4JX1 C;  4KGT A;  5C2T B;  2KTF A;  3MHS D;  4BOS C;  3RD2 A;  2JUO A;  3JVZ X;  2GLS A;  1P7F A;  5IKC M;  4GDK A;  3ZJU A;  3Q8F A;  4ACF A;  4K7S A;  3VRB B;  4HPL B;  2IND C;  3V05 A;  4KDL B;  2MEK A;  1KF6 B;  4GDK B;  1YIW A;  1Q10 A;  2KK8 A;  2LJI A;  3NZS A;  4HJK A;  3T8M A;  1T0R C;  1FNW A;  3PTF C;  2M0X A;  4LNF A;  1XEE A;  4PS7 A;  3HVD A;  2WYQ A;  4NNJ B;  1PYW D;  2R2Q A;  4KSK C;  4C56 C;  2KJ6 A;  1WGG A;  2PIA A;  4LNO A;  3W5U B;  3WCQ A;  3FC4 A;  3PVL A;  1ESF A;  2PEA A;  3AEA B;  4G3X B;  1Z5S B;  1PFD A;  3APF A;  3NVW A;  1EF5 A;  3ZDM C;  4DDG D;  3MHZ A;  5EE3 A;  4YTN B;  4WWP A;  1L0Y B;  2LHE A;  1IP9 A;  1V8C A;  1X1M A;  1E5W A;  4IW0 A;  4W9I A;  3R7Q A;  2JWZ A;  3RNC C;  1I4R A;  2QSD A;  4IKG A;  4J3O D;  1ZUD 2;  3ZXR A;  4RMA A;  2EKI A;  1XLN A;  1OGW A;  5J2R A;  1V86 A;  2OJW A;  3PSE B;  4TUU A;  4RM8 A;  3NRZ A;  3PGE A;  1OTR B;  1WI0 A;  2KJH B;  2PJH A;  3DWG C;  5BMI A;  1C79 A;  4LLG M;  3H7S A;  3R2T A;  2HTH A;  2WXR A;  3C8Y A;  1ZGU B;  4K81 A;  2HE7 A;  1YN4 A;  2C7N B;  3L17 A;  1VZ6 A;  4W9G A;  2G1E A;  4DQO C;  1YJ1 A;  1WXA A;  2MP2 B;  1P7E A;  2PVO D;  3A9K A;  3WAN A;  5D94 A;  4OZA A;  3L13 A;  2WXF A;  1UEL A;  3B2G A;  1L6V A;  1HZ6 A;  1TGZ B;  3AU5 A;  3SHQ A;  2N7D A;  4QAY A;  2WXN A;  2PPH A;  2LGD A;  3ZQ4 A;  5AEK B;  3BK1 A;  5FR6 A;  2DEN B;  2KDF B;  3UIN B;  4A55 A;  2DLB A;  4JPS A;  3URY A;  4M0W B;  1YQ3 B;  3ZUN A;  1BXT A;  2JXX A;  3A33 B;  5EE0 A;  4GB9 A;  3UI3 A;  3V6C B;  3RI7 C;  5JXV A;  2RMM A;  4M8M A;  4XDD A;  2VRR B;  3ETR A;  4RNA A;  4K1R B;  5C23 A;  4FUL A;  3ZGZ A;  2GBN A;  3M63 B;  4LNK A;  4WQM A;  2L52 A;  1ZW7 A;  3ZLZ A;  1IBX B;  2GBJ A;  2V4I B;  2WU5 B;  3ZRC A;  2D5G A;  1VLB A;  3LXF A;  4W9E A;  2BBC A;  3A9J B;  4RH6 A;  2J52 A;  1G6J A;  3WAO A;  1IGD A;  3X0W A;  1F2R I;  4H2A A;  1GG3 A;  4KGR A;  1FEH A;  4I6L B;  3PZ8 A;  4ZRI A;  1TKG A;  2CR5 A;  3IVF A;  4F8C B;  4JQW C;  3Q69 A;  1TJE A;  1TZO A;  1P1A A;  2XBB C;  1I4G A;  1S3S G;  1R7S A;  3NG0 A;  3RNA C;  2J4X A;  1E8W A;  3FIL A;  2EMT A;  1TS5 A;  2W82 A;  3B9J A;  1F77 A;  1MHX A;  3W9C B;  2I2Y A;  1C4A A;  3K9P B;  3ZXV A;  1OQQ A;  5D2M B;  2AL3 A;  2AQ1 B;  3FIL B;  4S17 A;  2DYM A;  1DOY A;  3VHT C;  3QK0 A;  2GBR A;  3Q8C A;  1ZOY B;  4AUQ C;  1E8Z A;  2E3T A;  3DBR I;  2N7E A;  2MJD A;  3AEF B;  4KIK B;  2WDQ B;  4OHJ A;  2WX1 A;  3N1Y C;  2FCM A;  3TIX A;  2WU2 B;  4A6Q A;  4ANW A;  1E9M A;  4WWM A;  1SIJ A;  1UGJ A;  1HTQ A;  3L4P A;  1JWA D;  2K9X A;  2DAF A;  3QQ8 B;  1T0Y A;  1ACC A;  4K7W A;  2N1V A;  2QMT A;  1N6Z A;  2ZPY A;  4NAM A;  3AE8 B;  3ZIM A;  3W5V B;  1AW7 A;  3EGR A;  4LK0 M;  3KYD D;  2LI5 A;  3QCA A;  2PW9 A;  2DZJ A;  3TEX A;  5D3I B;  2LGI A;  1I35 A;  3AE6 B;  2KOX A;  2BWF A;  4MM3 A;  4A20 A;  5HFY A;  1V6E A;  3MP9 A;  3PZ7 A;  4DHJ D;  3B0A A;  2WX0 A;  3UQB A;  1MVK A;  4ARC A;  4ANX A;  5G55 A;  3CIR B;  2REX A;  1AAR A;  1BML C;  1WM3 A;  3ALB A;  4JE3 B;  2NTS A;  3AM9 A;  5BYR A;  4KX6 B;  4DK5 A;  4MM3 B;  2IO1 B;  3AXC A;  3ZVV A;  1J0G A;  3H6N A;  1JAL A;  1GC7 A;  1QOF A;  3TBL D;  2ZZP B;  1XD3 B;  1ET6 A;  1M4V A;  1CJE A;  2NBW B;  4D2K A;  4BAX A;  3VTV A;  2WS3 B;  3ZDT A;  4KZC A;  3V60 A;  4GOC A;  1FM0 D;  4CO7 A;  3T3O A;  3SD5 A;  2CJO A;  4RGM A;  2JPH A;  3ZW3 A;  3RCZ A;  2I1J A;  3QC8 B;  2V3P A;  3BVM A;  4WJN A;  1I4Q A;  3I63 C;  3Q8B A;  2N9X A;  1JWU D;  2WXQ A;  3EEC A;  3B2F A;  1WXS A;  3JW0 X;  4FJY A;  1ZDX A;  2LFI A;  2KC1 A;  2JQR B;  1WXQ A;  2L8J A;  2MLB A;  3VQI A;  2V9H A;  1C1Y B;  2WDT B;  3MTN B;  4ZDV A;  1K50 A;  4FHK A;  2FNJ B;  4XWW A;  2XN9 C;  1OQY A;  1WZ0 A;  2ZCC A;  2WXJ A;  1SE2 A;  1VCB A;  4REZ A;  4EZL A;  4C00 A;  1OEY J;  3I3T B;  4NQL B;  1T0Q C;  2OOB B;  4FN2 A; 
#chains in the Genus database with same CATH homology
 3ONS A;  2K6Q A;  3KVF B;  4LDT B;  2AWT A;  2CHX A;  4TKN A;  2PE9 A;  3IFW B;  4GXB A;  3RUI B;  1KLV A;  2LAS A;  4B6W A;  3M62 B;  3LDZ E;  1K8R B;  2DYB A;  4MSM B;  4TQ0 A;  1P98 A;  3HHM A;  4G0N B;  3L0W B;  2LD9 A;  1TTN A;  2LVQ A;  3VH4 B;  1KOT A;  5LLI A;  1OEY A;  5CX3 A;  3TJP A;  4HPM B;  2L7R A;  4MGY E;  1WM2 A;  2KX0 A;  3DPD A;  1WFY A;  4KDI C;  3V62 A;  4GDL B;  2L76 A;  2J0M A;  2Z0D B;  2BWE S;  3AI5 A;  4GSW A;  3OLM D;  3LJ3 A;  1WX9 A;  3IHP C;  3L10 B;  1J8C A;  2ZPN A;  2EMS A;  3W1S A;  5J17 A;  2GOW A;  2ZNV B;  1WGH A;  2FCQ A;  3A4S C;  2BGF A;  3K9O B;  1GC6 A;  1E8X A;  4ICV A;  3VUY A;  4F1S A;  1WX7 A;  5DPS A;  3VTU A;  2NCN A;  3DVG X;  4DHJ B;  2DYO A;  2WWZ A;  2BKF A;  2KXJ A;  1SIF A;  2G4D B;  1WY8 A;  4YL8 A;  4A3O A;  2KTF A;  2MW5 A;  3MHS D;  2LZ6 A;  3RD2 A;  3V6E B;  4BOS C;  2JUO A;  1WJ4 A;  4RM9 A;  3JVZ X;  3DVN U;  3WAP A;  2KAN A;  3DBS A;  1UBI A;  4GDK A;  2C60 A;  2QHO A;  4ICU A;  2D3G A;  3JYU A;  4K7S A;  2K8C A;  1ZKH A;  3GOE A;  3A9K B;  4HPL B;  2AYO B;  3RYT A;  4KDL B;  4MSQ B;  1V80 A;  4MEL A;  3D32 A;  3M95 A;  3NOB A;  2G3Q B;  4GDK B;  5EDS A;  4PS3 A;  1YIW A;  2KK8 A;  3NZS A;  4HK2 A;  4A3P A;  2ZVO A;  4HJK A;  3HM6 X;  3T8M A;  3BIN A;  2JZZ A;  4P7I A;  3PTF C;  3MJW A;  1WMH A;  2M0X A;  4IM2 A;  1XT9 B;  4EZJ A;  2KFK A;  2M4N A;  4HDQ A;  1C3T A;  1M94 A;  2UYZ B;  4PS7 A;  1QZE A;  4W9D A;  2WYQ A;  4HDO A;  4ZRK A;  4BVU C;  2CU1 A;  4NNJ B;  2R2Q A;  4JLC A;  3B1L X;  3OAW A;  5AZG A;  5DCN A;  3Q3J A;  3S2A A;  2KFK B;  2BYV E;  3NY5 A;  4KSK C;  3DVG Y;  2KJ6 A;  3DDC B;  1WGG A;  4NPN A;  4ANV A;  2MX2 A;  3ML9 A;  1WH3 A;  2NBV B;  5TR5 A;  1V5T A;  3VXW A;  5KHO A;  5JHB A;  3PVL A;  1WR1 A;  5CHF A;  4KSL C;  1RFA A;  3QAR A;  2JT4 B;  3X23 A;  4OVV A;  2Z59 B;  1IPG A;  4HVB A;  2LGX A;  1WF9 A;  2PEA A;  3PS6 A;  3RUL A;  5BO4 B;  2JF5 A;  3DBL I;  4G3X B;  4MEM A;  1Z5S B;  2V4L A;  1E7V A;  3APF A;  2YVC A;  1EF5 A;  2JRI B;  3ZDM C;  1WJN A;  4DDG D;  4BKG A;  2B3A A;  4W9K A;  4BKS D;  1CMX B;  4WWP A;  3NZU A;  4HLE A;  2BPS A;  1IP9 A;  2K39 A;  3ENE A;  2O6V D;  2L0F A;  2O2V B;  2J0J A;  4BBN C;  1X1M A;  1E5W A;  4IW0 A;  4W9I A;  3R7Q A;  2KDB A;  1EF1 A;  3ZTC A;  2IBI B;  2JWZ A;  2ZEQ A;  4NAW B;  3WIM A;  4FLH A;  1RLF A;  3VUW A;  2JZ3 B;  2MBH A;  2K6D B;  2KHW B;  5E6N A;  2DX5 B;  3DOW A;  3L16 A;  4XX5 A;  3EC8 A;  2LRW A;  3PT2 B;  4AWJ A;  4RMA A;  2LRU A;  3R3M A;  1U4A A;  3M3J A;  1OGW A;  5J2R A;  1V86 A;  4IM0 A;  3PSE B;  4IUM B;  4TUU A;  4GDL A;  4RM8 A;  3VTW A;  1UZX B;  1UD7 A;  2JVC A;  3PGE A;  1OTR B;  1WI0 A;  3KW5 B;  1E8Y A;  2KJH B;  3EFU A;  1WXV A;  2PJH A;  4FHJ A;  4EEW A;  2CHZ A;  1WZ3 A;  2RD0 A;  3DCG A;  3H7S A;  4DDI D;  4MJS A;  2HTH A;  3VDZ A;  3QX1 A;  3WAL A;  5CTR C;  1ZGU B;  4K81 A;  4WJP A;  1NI2 A;  2K25 A;  3RT3 B;  2HE7 A;  2C7N B;  3V61 A;  3L17 A;  3SDL C;  4EKU A;  4W9G A;  1GNU A;  1YQB A;  4I6P A;  2KFJ A;  4MJS B;  4DHZ E;  4E74 A;  2IO0 B;  2C7M B;  4E71 A;  2KWU B;  2MA9 B;  4HWI B;  2RR9 A;  4FA6 A;  2V3S A;  2XK5 A;  1YJ1 A;  3KH0 A;  3W1Y A;  1LXD A;  1WXA A;  2MP2 B;  4JL9 A;  1P0R A;  4CYE A;  3A9K A;  3APD A;  2RSU A;  3WAN A;  4N9F 4;  5D94 A;  5DPR A;  3VFK A;  2LXA A;  3L13 A;  1UEL A;  5G2N A;  2IY0 B;  4ZYN A;  2LXC A;  1TGZ B;  3AU5 A;  4IM3 A;  3SHQ A;  2N7D A;  2ZVN A;  2PPH A;  2NVU I;  2IYD B;  2LGD A;  1V49 A;  1Y8R C;  2UWQ A;  2XK5 B;  4WQO B;  2KDE B;  4MDK E;  3UF8 A;  1BT0 A;  2D11 A;  5AZH A;  5AEK B;  5LXI B;  5FR6 A;  2DEN B;  2KDF B;  4GN1 A;  3UIN B;  3ZNH B;  2KZR A;  2MBB B;  1EO6 A;  2ZJD A;  2JRH A;  3KUZ A;  3KUD B;  3NHE B;  5L95 C;  1TBE A;  4M0W B;  2NPT B;  3ZUN A;  2JXX A;  3A33 B;  3CF6 E;  2MBQ A;  4GB9 A;  3V6C B;  2KN5 A;  4WWN A;  3L54 A;  2CKH B;  1H8C A;  2KO3 A;  4LJO B;  4M8M A;  1NDD A;  1KM7 A;  2KMC A;  3L08 A;  2KC2 A;  2VRR B;  1XQQ A;  2HD5 B;  3P2B A;  4W9J A;  3VVW B;  3QA8 A;  4MGZ E;  2PE6 B;  3DQV A;  2L05 A;  4K1R B;  5C23 A;  4FUL A;  2DZI A;  2LUE A;  2GBN A;  3M63 B;  3O65 B;  4EZK A;  1LFD A;  4IWO A;  2C9W B;  1ZW7 A;  4DBG A;  1WX8 A;  3ZLZ A;  1A5R A;  4MH0 E;  1H4R A;  5DPW A;  2GBJ A;  2FIF A;  4W9C A;  4FBJ B;  3ZRC A;  3AUL A;  2K8B A;  3TMP B;  4OVU A;  4AP4 C;  2D10 A;  4BKS A;  2I1K A;  4W9E A;  4ASW C;  3UIP B;  3A9J B;  1G6J A;  3WAO A;  2O6V A;  1LQB A;  4E3C A;  2EKE C;  3N3K B;  3X0W A;  2YLM A;  1WGY A;  2IZV B;  4IWP A;  3W1S C;  3JSV A;  2BKR B;  1GG3 A;  1PQS A;  4DXA B;  2AL6 A;  3UGB B;  4I6L B;  1D3Z A;  3NS8 A;  2LVO A;  3PZD A;  2CR5 A;  4ZRI A;  3ZO5 B;  1IYF A;  3GZN I;  1MG8 A;  1P3Q U;  1RRB A;  4X57 B;  1I42 A;  2LGY A;  3IVF A;  2O2V A;  3ZTD A;  2O6V B;  4F8C B;  4JQW C;  2ASQ A;  4W9L A;  2GMI C;  2XBB C;  4NAW A;  1P1A A;  5IAA C;  2M8S A;  3JSV B;  4BBN F;  2IO2 B;  2KMA A;  1V2Y A;  1UBQ A;  1V9J A;  1S3S G;  1Z2M A;  3H9D A;  3HIZ A;  3TCA A;  4EOY A;  2MRP A;  1E8W A;  2MWS B;  2A4Z A;  2KTR A;  1WRD B;  3C0R B;  3R66 C;  2KJR A;  5AZF A;  2EMT A;  4WWO A;  3ZNI D;  2G4S A;  2IY1 B;  5LXH A;  2DHZ A;  4B9K A;  3QWZ B;  2OJR A;  4EFO A;  5CHW A;  1L7Y A;  5D7G A;  3A1Q A;  1SE9 A;  3K9P B;  3ML8 A;  4DHZ B;  3SU8 X;  5D2M B;  2KTR B;  2AL3 A;  1UH6 A;  2CHW A;  2FCN A;  4J6I A;  4BOZ B;  4NJ7 A;  2DYM A;  1RAX A;  1V5O A;  2FAZ A;  4M8N A;  2KLG A;  4II3 B;  3KUC B;  3VHT C;  2G45 B;  3QK0 A;  3A1Q B;  3BY4 B;  2GBR A;  1ISN A;  3QAQ A;  4EUT A;  4G11 A;  2W9N A;  4ANU A;  1WYW B;  3B08 A;  3OJ4 B;  4AUQ C;  1E8Z A;  3IG3 A;  3KYC D;  2MBO A;  3DBR I;  2N7E A;  4TQ1 A;  3QIJ A;  4II2 B;  4AOF A;  2NR2 A;  2KDI A;  3PV1 A;  3PRM B;  4KIK B;  2GBM A;  1V81 A;  3WA0 A;  3ZNG C;  2WX1 A;  2KWV B;  3APC A;  2FCM A;  1WJ6 A;  3Q3F A;  3TIX A;  2C7H A;  4LCD E;  2MP2 A;  4ANW A;  1TZ1 A;  2MBE A;  5CHV C;  2D2Q A;  2NS5 A;  5E6P A;  1WR6 E;  4K7U A;  2LWP A;  4PYU A;  1SGH A;  2ZCB A;  4HCP B;  4JIO U;  5JH5 C;  4NQK E;  5J18 A;  4GGQ A;  3QHT A;  2R2O A;  4XC2 A;  1WE6 A;  2DAF A;  2K8H A;  3QQ8 B;  1T0Y A;  2DZM A;  4LJP B;  4K7W A;  4FAD A;  4JGH B;  4DWF A;  2RGF A;  2N1V A;  1WXM A;  3U7D A;  2KVR A;  4LDT D;  3UQA A;  1WGR A;  1NBF C;  2L3Z A;  2ZPY A;  4ZRJ A;  3ZIM A;  3N30 A;  2NPT A;  3VH3 B;  3TL5 A;  3VAW A;  2L0T A;  4KV2 A;  2J7Q B;  1YD8 U;  2LVP A;  5DPT A;  1F9J A;  4PS8 A;  1KJT A;  1S1Q B;  1E7U A;  4W9H A;  3KYD D;  3CST A;  2LI5 A;  3QCA A;  3DVN V;  2A5U A;  3R7R A;  2Y5B B;  4GU2 A;  5C1Z A;  3PHX B;  1Q1O A;  2DZJ A;  3H7P A;  4PYZ A;  1Q5W B;  5GMV A;  1I35 A;  2BF8 B;  2M1M A;  4IC7 B;  2DAJ A;  2N4F A;  2KOX A;  2BWF A;  4MM3 A;  3PLV A;  4A20 A;  4NY0 A;  2KX3 A;  1V6E A;  4F7Z A;  3U30 A;  1VD2 A;  3VUX A;  4DHJ D;  3B0A A;  2WX0 A;  2KNB A;  2HJ8 A;  3PHW B;  3UQB A;  3H7P B;  4ANX A;  1YX5 B;  3A9J A;  5G55 A;  4WJQ A;  2N1W A;  2REX A;  3U8Z A;  1AAR A;  3ALB A;  1WM3 A;  1LM8 B;  2KQS A;  4GIV A;  2Z0E B;  3PRE A;  4DK5 A;  2KLC A;  2IO1 B;  1WJU A;  3AXC A;  3N32 A;  2D07 B;  1R4N I;  2ZNV C;  3ZVV A;  4CHK A;  1J0G A;  3H6N A;  3DBH I;  1FXT B;  4TV3 A;  1GC7 A;  4MGK E;  3TBL D;  2ZZP B;  1GUA B;  1XD3 B;  3ZRF A;  1L2N A;  4WJO A;  4MGI E;  3RZW C;  5JHA A;  5E6O A;  3UIO B;  2RPQ A;  4IWQ A;  3ECI A;  3IBE A;  2GBK A;  3EHV A;  3PLU A;  2FUH B;  4XZ4 A;  2NBW B;  2AEH A;  2KKC A;  3VTV A;  3ZDT A;  3ZKJ C;  2FID A;  4KZC A;  1UGM A;  1YX6 B;  2M17 A;  3V60 A;  4GOC A;  4CO7 A;  2KD0 A;  1WMH B;  3HK0 A;  5D6J B;  3SD5 A;  5KHQ A;  1WE7 A;  2JPH A;  3ZW3 A;  5HKH A;  4AJY B;  4HCN B;  3RCZ A;  2I1J A;  3QC8 B;  4BKT A;  1JRU A;  2C5L C;  2XEW A;  4WJN A;  2KQ7 A;  4GMV A;  2BYF A;  2K1F A;  2N9X A;  4KZ0 A;  3EEC A;  3T9L A;  1WIA A;  1WXS A;  3JW0 X;  1E90 A;  2JY6 A;  4B95 A;  4FJY A;  3PPA A;  2J0K A;  4I6N B;  3WAM A;  2CS4 A;  4IG7 B;  1P9D U;  2KC1 A;  2N9E B;  2NBU A;  4BFR A;  2L00 B;  1WGD A;  2FCS A;  4WAA A;  2L8J A;  3CSF A;  1R4M I;  3PRP B;  2MLB A;  3VQI A;  2MCN B;  1C1Y B;  2WDT B;  4URK A;  3MTN B;  2N9P C;  4KVG B;  1HE8 A;  5IA7 A;  4ZDV A;  1EUV B;  1J19 A;  2IO3 B;  1Q0W B;  2KWC A;  2V1Y A;  3ZNZ B;  3PRZ A;  3CMM B;  4FHK A;  2FNJ B;  4KIK A;  1OQY A;  1WZ0 A;  2LJ5 A;  2ZCC A;  1GJZ A;  1VCB A;  5JZE B;  4W9F A;  3H1U A;  4EZL A;  2BYE A;  2DZK A;  3AU4 A;  3A4R A;  1OEY J;  3OJ3 A;  3I3T B;  4FJZ A;  2MSE D;  4FJV B;  4AJW A;  4NQL B;  2MQJ A;  4G50 A;  3RZF A;  5L83 A;  4HXD A;  2OOB B;  4FN2 A;  4NJ6 A;  3QJZ A;  3HM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...