2Z0EB

The crystal structure of human atg4b- lc3(1-124) complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease ATG4B
publication title The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/structural protein
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2z0eB00
3SDLC 1F9JA 1V80A 1UBIA 4HVBA 2AL3A 1J19A 2K8BA 2NCNA 1WXMA 2VRRB 4HDOA 1P1AA 3JSVB 4MJSA 3RCZA 2KD0A 4HK2A 3ZNHB 2LGDA 1WI0A 2JVCA 3A9JB 3OJ3A 4IW0A 5D6JB 2EMSA 4FHKA 4ANXA 2MLBA 4NQKE 3ONSA 3PZDA 2RR9A 3A9KA 5LXHA 4ICUA 3PLVA 2CHZA 3PPAA 1LXDA 2PEAA 4OVUA 4TV3A 4YL8A 5TR5A 2HJ8A 2IY0B 3UIOB 1BT0A 3K9OB 3DCGA 4FULA 3DBHI 3PT2B 1WJNA 3VDZA 5JZEB 4PYUA 4IM0A 1WM3A 3EC8A 5AZFA 4I6PA 2LZ6A 4N9F4 2KTFA 1OTRB 4K7WA 4K81A 2LJ5A 4F1SA 3S2AA 2NBWB 4RM9A 1UD7A 5L83A 4XZ4A 3P2BA 2L05A 2KC2A 1WJ4A 2KWCA 5FR6A 1GC7A 2HD5B 4W9FA 2JZZA 2D3GA 3MHSD 3T9LA 2LD9A 5D94A 5CHVC 5LLIA 3ZNZB 3KUCB 5DCNA 3ZO5B 2MP2A 1V6EA 3A4RA 3PRPB 3ZTDA 1SIFA 3ZLZA 3PRMB 5KHOA 4KIKA 2R2OA 1GG3A 4KZCA 4MGZE 2FNJB 3PLUA 4TKNA 3PRZA 4A3PA 4BFRA 3VTWA 3ZIMA 2PJHA 1EF5A 4MJSB 2D10A 4GGQA 4GDKA 3CSFA 4X57B 2KLCA 3U8ZA 4PYZA 5JH5C 4BKTA 2J0MA 2DZIA 3L0WB 2O6VA 4GDLA 3V62A 2BYFA 3WALA 3A9KB 3WANA 4AP4C 5J2RA 2V4LA 4EOYA 3R7RA 3H7PA 3KVFB 1WFYA 1NDDA 1WXSA 4W9KA 3RZFA 2W9NA 1QZEA 1FXTB 4EFOA 4E71A 5IA7A 4XC2A 1V5OA 4IC7B 3BY4B 3HM3A 3DPDA 4W9HA 3V60A 5AZGA 5C23A 3LDZE 2NVUI 4NJ6A 3RYTA 3ZKJC 1RRBA 4LJOB 1V49A 4BVUC 1ZGUB 2FUHB 2KJHB 4WWOA 2L8JA 2DX5B 3D32A 1S3SG 3SD5A 2LUEA 4ANWA 4W9JA 2FIFA 2MP2B 2FCMA 4PS8A 4HLEA 3UQBA 1C1YB 4LCDE 2ZNVB 1S1QB 3GZNI 3K9PB 4KIKB 4WWNA 2GBKA 1WX9A 4WQOB 4DDGD 1PQSA 4W9EA 1E8YA 2G4SA 2K6QA 1OEYA 5EDSA 2AL6A 1WR1A 2G4DB 1WZ3A 1EF1A 3NHEB 4WJPA 1C3TA 3CF6E 3QHTA 2DAFA 4G3XB 2GBMA 2YLMA 4K1RB 2MBEA 2MRPA 4WJOA 1KLVA 3UGBB 1HE8A 2L0TA 2LI5A 2N9PC 2O6VB 2ZEQA 3L16A 4GDLB 4GN1A 1CMXB 4HPMB 4P7IA 4FADA 2ZVNA 3GOEA 3HM6X 4LDTD 4HWIB 4BOZB 2GBNA 4WAAA 3H7PB 5BO4B 2JY6A 4KSKC 4EUTA 2IBIB 2O6VD 3V61A 3JYUA 4G11A 3UQAA 3R66C 3QAQA 2JRHA 1M94A 2DYOA 3WA0A 4HJKA 4W9GA 3ML8A 2BYVE 4LJPB 3IFWB 2MCNB 2I1JA 4II3B 4CHKA 4TQ0A 1TGZB 1J0GA 1XT9B 3L17A 2D11A 3VTVA 2B3AA 5D2MB 2IO2B 3QWZB 3I3TB 2RGFA 1EUVB 2DYBA 4A20A 3QA8A 4DHJB 3DOWA 4FLHA 1ZKHA 2KO3A 5JHBA 2N4FA 3SU8X 3U7DA 1LQBA 4DHJD 4G0NB 4OVVA 3AULA 2WWZA 4M8NA 1WX8A 2KX0A 2DZJA 2DZKA 4A3OA 2AWTA 3VTUA 2ASQA 1WYWB 3WAMA 1V81A 3Q3JA 3ZVVA 3M62B 4HCPB 1WZ0A 4GU2A 4TQ1A 2I1KA 1EO6A 2LRUA 1UZXB 1E5WA 5E6NA 2BYEA 3PTFC 2BKRB 2LGYA 1A5RA 1E7VA 2K1FA 3B1LX 1IYFA 4URKA 3PSEB 1YIWA 3IBEA 4PS7A 3QARA 1WMHA 2MBOA 2ZZPB 2MSED 4MSQB 5IAAC 1WJ6A 2KNBA 1Y8RC 3APFA 5DPSA 3LJ3A 4MSMB 4DHZB 2KJ6A 2REXA 3QCAA 1KOTA 2ZPNA 4DXAB 4W9CA 3IG3A 3HK0A 3EHVA 3DVNV 2Z59B 1T0YA 3X0WA 2IO3B 2GOWA 4MEMA 3TL5A 3EFUA 4MDKE 1OEYJ 2V3SA 2AEHA 2ZVOA 1OQYA 1WJUA 3B08A 3DDCB 1H8CA 4HXDA 5DPTA 3L13A 1LFDA 2WDTB 3H7SA 3M63B 3N3KB 3NZUA 1GC6A 1RAXA 1WIAA 2CKHB 2NPTA 2IZVB 4JLCA 2J0KA 4M0WB 3NY5A 4HPLB 2LWPA 2MA9B 3UINB 2L7RA 3IVFA 4W9LA 2IYDB 1IP9A 2WX1A 2XK5A 1GNUA 2N7DA 2N1VA 4NNJB 3M3JA 3SHQA 3VUWA 4AUQC 2MX2A 2GBJA 3KYDD 1XD3B 3NS8A 4GMVA 2WX0A 2DYMA 4IWPA 1GUAB 2FCSA 5DPWA 2J7QB 2C9WB 1L2NA 4EZJA 3V6EB 2OOBB 4KVGB 1WMHB 3OJ4B 4BBNC 3ZRCA 5J18A 1WY8A 1YJ1A 3H1UA 2FCNA 2PPHA 4GXBA 2Z0DB 4FBJB 1NI2A 2CHXA 3TBLD 4IUMB 3MJWA 3TJPA 2JXXA 3ENEA 3PHWB 2L3ZA 3QK0A 3N32A 2FCQA 2L0FA 2LXAA 2A5UA 1UELA 3N30A 3VUXA 2K8HA 2MBQA 2KXJA 2KDIA 1AARA 1E90A 2M0XA 1Z5SB 1Q1OA 4RM8A 1KJTA 2KJRA 2KDFB 4FN2A 4II2B 2NPTB 5CHWA 3PREA 4DBGA 3VXWA 5JHAA 3QC8B 2KX3A 5E6OA 2RPQA 1RLFA 2C7HA 1WGYA 2M17A 4DWFA 5LXIB 4FJZA 2JZ3B 2DZMA 2ZCCA 3DQVA 2O2VB 4EEWA 2XK5B 2LXCA 1WGDA 1WF9A 3WAOA 4K7UA 3Q3FA 2KDEB 2BWES 1JRUA 2KQSA 2BKFA 4IWQA 4NPNA 2KK8A 4MM3A 4DK5A 1WM2A 3KUZA 4KDIC 2KMAA 5CTRC 3UF8A 3PS6A 3W1SC 2GMIC 3VAWA 4B9KA 2D07B 3AU4A 4FHJA 3WAPA 1V9JA 1WR6E 2KQ7A 2L76A 2MWSB 2MBBB 2FAZA 2MBHA 3JW0X 3L10B 4XX5A 5E6PA 4FJVB 5AEKB 4EKUA 1IPGA 3AXCA 3V6CB 1VD2A 3A1QA 2KFJA 4ZYNA 1UGMA 2BF8B 1I42A 5GMVA 3VHTC 4IM2A 4WWPA 2OJRA 3PGEA 4KSLC 2ZJDA 3ECIA 2Y5BB 3R7QA 2EMTA 3RULA 2WYQA 2JWZA 3M95A 3QJZA 2RD0A 2NBVB 4IG7B 2NS5A 1WGRA 3VFKA 1OGWA 2KN5A 1P3QU 2LRWA 3QIJA 3RD2A 4B6WA 4CYEA 1E7UA 2DHZA 1V86A 3ZDTA 4M8MA 4BOSC 1P0RA 1YQBA 5C1ZA 2KDBA 3BINA 1Q5WB 3KH0A 3PHXB 2ZCBA 3KW5B 2J0JA 2BGFA 2KWUB 3ML9A 3PVLA 4I6LB 3VUYA 3T8MA 1H4RA 1MG8A 2C7MB 1GJZA 4MELA 2JF5A 2KZRA 4MGYE 2K25A 3IHPC 4KV2A 2N1WA 3CSTA 3QX1A 1V2YA 2XEWA 4JQWC 2KWVB 3OAWA 4TUUA 1WE6A 2RSUA 4JGHB 4W9IA 3ZUNA 4ANVA 2XBBC 4GB9A 5AZHA 2FIDA 3NZSA 1WXAA 4DHZE 3DVGY 5DPRA 4AJYB 4BKSA 3A4SC 3DBLI 4NAWA 2KFKA 3W1SA 1YD8U 3PV1A 2JPHA 2EKEC 3A1QB 4HDQA 3ZNGC 4BKGA 3HIZA 2JT4B 2LVOA 2HTHA 3L08A 1P98A 2MW5A 1D3ZA 4PS3A 2KHWB 1WRDB 1E8WA 3RUIB 3W1YA 3ZRFA 2QHOA 4AJWA 2O2VA 4EZLA 2C5LC 1J8CA 5G2NA 2CHWA 3AU5A 3APCA 4ASWC 1R4NI 2DAJA 2K39A 3ZNID 2NR2A 3R3MA 4ZRKA 4NY0A 4I6NB 2KVRA 4B95A 1G6JA 2HE7A 2IO0B 2LGXA 5HKHA 4ANUA 2KTRA 2PE6B 3HHMA 4ZRIA 2CS4A 1KM7A 3O65B 1WE7A 1UBQA 2IY1B 2K6DB 3APDA 1WGHA 4BBNF 5G55A 3JVZX 4NQLB 1VCBA 2G45B 4W9DA 2M8SA 1TTNA 4HCNB 1YX5B 2LVPA 1XQQA 2PE9A 4JL9A 2MQJA 2KC1A 4MGKE 4GIVA 2KANA 1WXVA 3B0AA 3ZTCA 2BPSA 5KHQA 2BWFA 1R4MI 2R2QA 4WJQA 4AWJA 2AYOB 4F8CB 1YX6B 4JIOU 2YVCA 3RZWC 4F7ZA 3ZW3A 4CO7A 3TIXA 2GBRA 4GSWA 4G50A 2L00B 4FJYA 4MH0E 4NAWB 5CX3A 2KFKB 5CHFA 4ZRJA 3ZDMC 1X1MA 2UYZB 1UH6A 4BKSD 1I35A 2A4ZA 2ZPYA 4FA6A 3DBRI 3H6NA 2JUOA 2N9XA 2JRIB 2KOXA 3DBSA 3NOBA 3UIPB 1Q0WB 3QQ8B 4E74A 1L7YA 4ZDVA 3RT3B 3JSVA 2NBUA 1U4AA 3MTNB 4KDLB 3TMPB 2M1MA 5J17A 3A9JA 3WIMA 3CMMB 1P9DU 5D7GA 2KMCA 3TCAA 2N7EA 4AOFA 1SE9A 2CU1A 4WJNA 1ISNA 1RFAA 2G3QB 4RMAA 2IO1B 4GDKB 2KTRB 1LM8B 3KUDB 4J6IA 3VVWB 4K7SA 1NBFC 1TBEA 2V1YA 1K8RB 1ZW7A 1WGGA 4LDTB 1WX7A 2M4NA 3ALBA 1E8XA 3A33B 3VH4B 2C60A 2KLGA 1WH3A 4KZ0A 4MGIE 2ZNVC 3KYCD 4IWOA 2C7NB 2LASA 3VQIA 2LVQA 3OLMD 3C0RB 4ICVA 2CR5A 2N9EB 4E3CA 1SGHA 2Z0EB 1V5TA 3AI5A 4GOCA 3VH3B 3U30A 5L95C 4NJ7A 3L54A 3H9DA 2DENB 4DDID 2K8CA 3DVGX 2UWQA 1TZ1A 1E8ZA 2KKCA 3DVNU 4IM3A 3X23A 2D2QA 3EECA 1Z2MA 4EZKA
chains in the Genus database with same CATH superfamily
3MFGA 1F9JA 4HVBA 2AL3A 3GP7A 3JSVB 2KD0A 1XLQA 1WI0A 3VR8B 3AM9A 3VR9B 1KF6B 4ANXA 2MLBA 1TJEA 5LXHA 2CHZA 4YL8A 5G5GA 3VDZA 1FEHA 1WJNA 2MJEA 4N9F4 1OTRB 3ABVB 4YWGG 5GXGB 3P2BA 2D5GA 1QT9A 2KYWA 1ET9A 2G1EA 5CHVC 3N1YC 4WURA 2MP2A 1V6EA 1C4CA 4YSXB 1K53A 3ZLZA 4TMAB 3PRMB 5KHOA 4YTPB 3VTWA 1WGKA 1TYGB 4GGQA 4GDKA 1N61A 4PYZA 5JH5C 4GDLA 3WALA 3A9KB 3BIID 3RNAC 1AYFA 3KVFB 2K0PA 3EFCA 3RZFA 5IA7A 3HM3A 3ZKJC 1XXGA 1RRBA 4LJOB 1FM0D 1JWMD 3NVVA 2DNFA 3BZDB 5H92C 1TS4A 2DX5B 3HRDD 1S3SG 2CJNA 4PS8A 1C1YB 2ZNVB 3IAM1 4C7YA 4W9EA 2K6QA 1WZ3A 3QHTA 3AE3B 2EELA 1I7HA 2MBEA 2MRPA 3Q8AA 4WJOA 3UGBB 2LI5A 4HPMB 2ZVNA 1SJED 2W3SA 2YEPB 1F2RC 4HPPA 4BOZB 4KSKC 3GB1A 2O6VD 3Q14C 4HROA 1GB4A 3JYUA 3UQAA 1M94A 3ML8A 2BYVE 3C8YA 4CHKA 3L17A 2IO2B 3I3TB 2RGFA 3ZJVA 1Y56A 3ZXRA 2DYBA 3AE5B 1LQBA 4G0NB 3P63A 2WWZA 4M8NA 1WX8A 4YT0B 2DZKA 4A3OA 3WAMA 4GU2A 1HEZE 4HJGE 2LRUA 2B76B 2BYEA 3PTFC 4USAA 1WYGA 2K1FA 4URKA 1YIWA 3IBEA 2PLPA 2ZZPB 5IAAC 1N60A 1Y8RC 3APFA 4DHZB 2VZKB 3QCAA 4DXAB 3Q8FA 4W9CA 1QOBA 3IG3A 1NVID 3X0WA 2PVOD 2GOWA 3TL5A 2ZVOA 3B08A 3DDCB 3H7SA 2WDTB 3Q3OC 2LHDA 3TEWA 1K52A 2RDGA 4JLCA 5BMIA 2V4IB 3NY5A 4HPLB 1L4ZB 3IVFA 1IP9A 5IKCM 4ARCA 2XK5A 4KGRA 4C56C 3MC8A 4JPSA 2MX2A 2KDMA 3Q8EA 4GMVA 4OZCA 4IWPA 5DPWA 2J7QB 4IOIE 4A9AA 4EZJA 2OOBB 3ZRCA 1YJ1A 3H1UA 4GXBA 2Z0DB 2NTSA 2QIEB 2CHXA 4IUMB 3TJPA 2JXXA 3ENEA 3PHWB 2X38A 1N63A 3QK0A 3IAS1 1HQRD 1Q10A 4EE2A 4ZRPA 2KXJA 2WQYB 2KDIA 1AARA 4RM8A 2CU3A 2KDFB 4II2B 2G9HD 3VXWA 4DBGA 1KTKA 5FR3A 2WP9B 1FCLA 3BVMA 1L0XB 1YN3A 1JROA 2BW2A 1JWSD 2D3AA 1N6ZA 1F52A 2WXPA 3FILB 4MM3A 4DK5A 1L6VA 5CTRC 3UF8A 3PS6A 3W1SC 1XCQL 2KMMA 3AU4A 3H8HA 4FHJA 3WAPA 1WR6E 1JQ4A 2KQ7A 3DWMA 1QOFA 5E6PA 3L10B 1RWSA 2MJDA 2IDYA 2WXLA 2W54A 3A1QA 4ZYNA 1UGMA 1I42A 5GMVA 2OJRA 3RULA 1FXIA 2RD0A 2NBVB 1C4PA 1HA5A 3VFKA 3AEDB 3ZDTA 1YQBA 2PKOA 4D2KA 3J9CA 2JX5A 5C1ZA 4O1NA 3VUYA 1SXTA 2BQQA 1PGAA 4TUUA 1WE6A 2QJLA 2RSUA 4GB9A 1YJIA 4C00A 4DHZE 3I5JC 4RH6A 5DPRA 1ZPSA 2JPHA 3ZNGC 5TSSA 4WH4A 3BVZA 4M02A 2QHOA 4AJWA 1MFWA 5G2NA 3W5UB 1YMHE 3APCA 1N5WA 4ZRKA 4NY0A 4I6NB 2HE7A 4ANUA 3P4QB 2KTRA 2PE6B 3HHMA 1YOVB 2CS4A 1KM7A 2IY1B 1B1ZA 4XGAB 4YSZB 4NQLB 4HCNB 1YQ4B 1HTQA 2KANA 4RF0A 1FFVA 2V3NA 2V9HA 2R2QA 1JWBD 2QCZA 4F8CB 5HFYA 3RZWC 4GSWA 4G50A 1V1OA 5CX3A 2UYZB 1UH6A 3DBRI 1PGBA 4KDLB 4XE0A 3WIMA 1V1PB 3TCAA 1UNSA 2MEKA 1FNUA 1SE9A 2CU1A 2RDBC 1ISNA 1FFUA 1IBXA 1RFAA 4XYCA 1E10A 3VVWB 5AUKA 1L0VB 1T0QC 3EUB2 1E8XA 2M19A 1WRIA 4YSYB 2KLGA 4KZ0A 2W3RA 4NJCA 1L0YB 2ZNVC 3KYCD 3BYYB 3VQIA 2BS4B 4LTUA 2N9EB 4GOCA 2Z0EB 2J4XA 3U30A 3ZJUA 3DVNU 4IM3A 1Z2MA 2KACA 3SDLC 3T3NA 2NCNA 1WXMA 4MJSA 3V05A 1P1AA 3ZQ4A 2LMCA 3ZNHB 3A9JB 3OJ3A 4LNIA 5D6JB 2KQ4X 4FHKA 4NQKE 1D4BA 4ICUA 3PLVA 4TV3A 2XNAC 3UIOB 1I4PA 2IGHA 4LNKA 4PYUA 4IM0A 4RCOA 3HUIA 4QAYA 2KTFA 4F1SA 3PZ7A 3N9YC 2Y5CA 4YTMB 2KC2A 2KWCA 5FR6A 1GC7A 2JZZA 3MP9A 2LD9A 5LLIA 2WXIA 5H8YE 3RNBC 5DCNA 3ZO5B 2DBYA 3NS1A 3R2TA 3PRPB 4WIPA 3ZTDA 1SIFA 2IJ0A 1MI0A 2FNJB 4TKNA 3T3OA 2PJHA 1EF5A 4X57B 2PMVA 2WXKA 3NG0A 2INCC 1T5XD 1FO4A 4BKTA 2J0MA 1RM6C 2DZIA 2O6VA 3TUOA 1T0SC 3WANA 3AECB 3H7PA 1WFYA 1NDDA 4MT5A 4W9KA 1P7EA 2E6XA 1UWMA 1D5ZC 4W9HA 3V60A 5AZGA 2KWDA 3LDZE 2NVUI 1ZP0B 3AE4B 1K50A 4WWOA 1QOGA 2JQRB 4ANWA 2MP2B 2FCMA 3UQBA 4LCDE 1SE3A 1P7FA 1DOYA 3DHGC 1PQSA 4RGNA 1WR1A 2G4DB 3NHEB 5G5HA 1JWUD 2DAFA 4G3XB 2GBMA 1ZDVA 5EE3A 1KLVA 2Y5PA 2NTTA 2N9PC 4OVZA 2V0GA 4GDLB 1VJKA 1CMXB 4A6QA 3DBRB 5BO4B 1QKZA 4EUTA 4RGOS 1FNVA 3QAQA 2DYOA 4RGMA 3WA0A 4HJKA 4W9GA 4LJPB 2I1JA 1R7SA 1WSPA 1GPXA 4IDIA 2B3AA 4A20A 4DHJB 3DOWA 2YEPF 4FLHA 1ZKHA 2N4FA 3Q2AC 3SU8X 3U7DA 1ESFA 2N0SB 4YTNB 2DZJA 3GE3C 2AWTA 1C77A 1V81A 1WZ0A 4TQ1A 1UZXB 5E6NA 1YN5A 1GOZA 3RFZB 4PS7A 3QARA 4MSQB 1JCKB 3RPFC 1DOXA 2D3BA 1UUPA 2REXA 1PUTA 3AEAB 2ZPNA 1C4AA 1N62A 3HK0A 1T0YA 4MEMA 4MDKE 1OQYA 1WJUA 3AE2B 3OG5A 1AW7A 3L13A 3M63B 3TEZA 1RAXA 1WIAA 2CKHB 2IZVB 2HJ1A 3OWEB 1SBBB 2J42A 2MA9B 3UINB 1KRHA 4W9LA 1L6UA 2IYDB 2QEJC 3AH7A 2WX1A 1GNUA 4NNJB 3M3JA 3WCQA 2X8XX 1KLGD 2SAKA 2GBJA 1B9RA 2WXRA 2DYMA 2C9WB 1L2NA 3BK1A 3OJ4B 1NENB 1WXQA 1CK1A 1ZDXA 3MJWA 3PZ8A 5BYSA 1ENFA 2FCQA 3VUXA 1UELA 1WWTA 2K8HA 2MBQA 1E90A 2M0XA 1Z5SB 1Q1OA 1C79A 2KJRA 5CHWA 3PREA 3QC8B 1JRPA 2JU6X 2C7HA 2JZ3B 3LYYA 2DZMA 2XK5B 2WS3B 2LXCA 1WF9A 4K7UA 3Q3FA 4K3CA 2EKIA 4NPNA 1WM2A 2GB1A 2KMAA 1D5XC 4LK0M 5HG2A 1YJJA 1D5MC 2MBBB 2MBHA 2L83A 1EWYC 1IPGA 3AXCA 4N58A 3V6CB 3VHTC 4KSLC 3R7QA 2JXTA 1OFFA 1NI3A 4IG7B 1WGRA 1FIQA 1OGWA 2KN5A 1P3QU 3QIJA 1E7UA 1F1HA 1V86A 2WXHA 1MHXA 1RYJA 1TS5A 3BINA 3PHXB 3KW5B 5EE9A 1KFYB 2J0JA 3PVLA 2BB6A 2C7MB 1GJZA 4US8A 4BZAA 2K25A 3IHPC 4MM3B 3CSTA 3QX1A 1V2YA 1C9FA 2KWVB 2E3TA 1KH0A 4ANVA 2XBBC 1E9MA 3NZSA 2KFKA 2AQ2B 3A1QB 2PW9A 1VRAB 2HTHA 1P98A 3ETRA 1D3ZA 3MC9A 1TS2A 2KHWB 3ZRFA 4LNOA 2CHWA 3AU5A 1VZ6A 1R4NI 3R3MA 2CJOA 2KVRA 3BWUD 2IO0B 5BYQA 2LGXA 2QDFA 4ZRIA 3TSSA 3O65B 3APDA 3JVZX 2K5PA 3W5VB 4L2YA 2WXQA 2PE9A 4JL9A 4MGKE 3B0AA 3UI3A 3V3XA 4WJQA 4AWJA 3O13A 1NYQA 2INDC 3TIXA 4S0RA 3ZDMC 4ZRJA 1SJHD 1X1MA 1FNWA 2A4ZA 2WU5B 3ZGZA 2JUOA 3DBSA 2JRIB 1LGRA 3KQ4A 4ZDVA 3RT3B 2PIAA 1P9DU 4AOFA 2WDRB 4L1BA 2KTRB 1LM8B 2W82A 1NBFC 1TBEA 4XDCA 1WGGA 1WX7A 3ALBA 3L4PA 1C78A 4JX1C 1I4HA 1WH3A 4MGIE 3AEEB 5FK9C 2LASA 2WNMA 3CWIA 3B2FA 2V3PA 3VH3B 1IGDA 2PTLA 3ZYYX 5L95C 4ZYSA 3L54A 3H9DA 1DGJA 1JWAD 2M56B 2SEBD 1TZ1A 1E8ZA 2KKCA 2PVGC 1FRDA 2D2QA 3EECA 4EZKA 1UBIA 2FBWB 2K8BA 2VRRB 3RCZA 1AN8A 2JVCA 4IW0A 2EMSA 3N1XC 3ONSA 1IBXB 2AX5A 2L1AA 4OVUA 1LXDA 5TR5A 2HJ8A 2OJWA 1BT0A 5EE1A 3DCGA 4OZAA 3DBHI 3PT2B 5JZEB 4ZHOA 1PYWD 1T6BX 2LZ6A 2ZW0A 4K7WA 2LJ5A 2NBWB 1UD7A 1L4DB 2L05A 1WJ4A 2OEDA 2HD5B 1V97A 2D3GA 1SF0A 3T9LA 5D94A 4KKIA 4OZBA 4KIKA 2R2OA 4MGZE 3PLUA 2BTEA 4OW0A 3ZIMA 1TT5B 4MJSB 2D10A 3P4SB 3U8ZA 1EU4A 3L0WB 4M01A 3V62A 1QILA 4AP4C 1FCCC 2V4LA 4EFOA 4NZLB 4E71A 4XC2A 1YQ3B 1V5OA 1R4NB 2WU2B 3BY4B 4IC7B 2D3CA 2LFIA 5D3DA 1TS3A 1V49A 3NVYA 1ZGUB 2FUHB 2KJHB 2L8JA 4RF1A 3SD5A 2J52A 1HZ6A 1OQRA 4W9JA 2FIFA 3FAHA 1TIFA 4WWMA 4WWNA 2GBKA 1WX9A 4DDGD 2BS3B 1E8YA 2G4SA 3GE8C 1OEYA 2RPVA 2VH1A 1C3TA 4L23A 2DWQA 2YLMA 4PT5A 3I9V1 3VRAB 2O6VB 2ZEQA 4GN1A 3GOEA 4LDTD 3H7PB 2JY6A 3V61A 3AMZA 1XCTL 1SB3C 3Q6BA 4A8XC 3R66C 2JRHA 3IFWB 4II3B 4TQ0A 1TGZB 1YNTE 2L52A 1I4GA 3QWZB 1EUVB 1J7AA 3HVZA 2KO3A 1J7CA 4M0WA 1BMLC 1PDXA 2KX0A 2LGIA 3VTUA 2ASQA 3ZVVA 3M62B 1EO6A 2RMMA 2HDEA 3C19A 2QC8A 3IXSA 1ZOYB 1CJEA 5BMHA 1TY0A 1WMHA 2DLBA 2KNBA 3AE8B 5DPSA 3LJ3A 4MSMB 2KJ6A 3P4PB 1TZOA 4P6VF 1SE2A 2Z59B 1SE4A 2IO3B 2KVZA 2AEHA 3R2IA 4US9A 4UDUC 5DPTA 3DBHB 1LFDA 1V8CA 1GC6A 1ZXHA 1TY2A 2NPTA 5E6JA 2J0KA 1QOAA 2L7RA 4KKJA 1ACCA 3RNCC 3U4EG 2N7DA 2N1VA 1VZ8A 3SHQA 3KYDD 1XD3B 2WGSA 3RNGC 1GUAB 2JSVX 2OHFA 4KVGB 4HKQA 4K3BA 4BBNC 2N7JA 2BBCA 4FBJB 4IKGA 4N59A 1NI2A 2INNE 3TBLD 5IN7A 1A70A 3AEFB 2IPKD 1JMLA 3N32A 2L0FA 2N9KA 2A5UA 2JZPA 3N30A 4XWTA 5EE0A 1KJTA 2Q5WD 2JWUA 5E6OA 2RPQA 4ACFA 1WGYA 2GI9A 4FJZA 3AEBB 3NVWA 1DOIA 2KDEB 3W9CB 2KQSA 4DQOC 3KLSX 2KK8A 3KUZA 4KDIC 1MJDA 3FC4A 2LEKA 2GMIC 4B9KA 2D07B 3AE7B 4TSSA 1E0ZA 2MWSB 2FAZA 3JW0X 4XX5A 1ET6A 4LNNA 2JYEA 1IUEA 5AEKB 4EKUA 2MJ3A 1VD2A 2KFJA 3P42A 3SFEB 1N5XA 4IM2A 3PGEA 2ZJDA 3ECIA 3LXFA 3M95A 3QJZA 3ZJTA 2WDQB 5IP4D 5LNK1 4MH8A 4B6WA 2LRWA 3RD2A 4CYEA 3PO0A 2DHZA 4A90A 1P0RA 3DHIC 3ML9A 1ZXIA 1DYQA 4I6LB 4LLGM 1TKEA 3P4RB 1MG8A 4MELA 2JF5A 4KV2A 2XEWA 4JQWC 4JGHB 4W9IA 2R61A 3AE9B 5D3IB 1XEEA 2FIDA 3MJ5A 3A4SC 3SEBA 3DBLI 4NAWA 3W1SA 1YD8U 3PV1A 3HIZA 2INPE 2JT4B 2WXFA 1F77A 2LVOA 4PS3A 1WRDB 1E8WA 2K22A 4A55A 4YXDB 1MPEA 1F0ZA 4ASWC 2K39A 3ZNID 1G6JA 5HKHA 4GLSC 1HZ5A 3EGRA 4RNAA 1UBQA 5FKAC 2IGDA 1WGHA 4BBNF 2BT6A 1VCBA 2G45B 4W9DA 1MVKA 2KT7A 4HKZE 1YX5B 2LVPA 3MC0B 1SEBD 2MQJA 2KC1A 1WXVA 3ZTCA 3TEXA 2BPSA 5KHQA 1R4MI 1EWCA 2AYOB 4JIOU 2YVCA 4F7ZA 3ZW3A 4FJYA 2KFKB 5CHFA 1QQRA 3U2SC 1CQVA 4BKSD 2NMQA 2K3UA 2ZPYA 2N9XA 4NAMA 1VLBA 3NOBA 1AWDA 1PGXA 1L7YA 4XWWA 3JSVA 2NBUA 3AE6B 3TMPB 2JYTA 2M1MA 5J17A 3CMMB 2Y3AA 5D7GA 4CQNA 2WXJA 4WJNA 3LB8C 2BVCA 4J6IA 3KUDB 4BAXA 4AS1A 2H89B 4LDTB 1SSNA 3A33B 2C60A 5IOIA 2ZW1A 4IWOA 2C7NB 2GRIA 1XLNA 4REZA 2LVQA 3OLMD 1VZ7A 4C7ZA 3C0RB 4ICVA 1SGHA 1OQQA 1V5TA 2QSDA 2UU7A 2LGSA 4NJ7A 3RNEC 1E6EB 3DVGX 2UWQA 3X23A 1D6EC 4AQ7A 1V80A 1J19A 4HDOA 4WQMA 1KLUD 4HK2A 2LGDA 1M4VA 3PZDA 2RR9A 3A9KA 5MPOA 3NVZA 3PPAA 2PEAA 2IY0B 4ZOHC 3K9OB 4FULA 5BYRA 1LO5D 3SR6A 3AN1A 5JXVA 1WM3A 3EC8A 5AZFA 4I6PA 2WDVB 4K81A 3R8BA 2ACZB 3S2AA 4RM9A 5L83A 4XZ4A 4WAFA 2I38A 4W9FA 3MHSD 3I57A 4P16A 3ZNZB 3ZXVA 2GLSA 3KUCB 4KGTA 3A4RA 1GG3A 4KZCA 1MG4A 3PRZA 4JE3B 4A3PA 4BFRA 2BYTA 2TSSA 3NZ3A 3CSFA 3DBLB 2KLCA 1XLOA 3I63C 3HVDA 2BYFA 3SFDB 1F2RI 5J2RA 4EOYA 3R7RA 1WXSA 3U7ZA 1I4XA 2W9NA 1QZEA 1FXTB 3DPDA 4C4VB 5C23A 4P1CC 4S17A 4HRSA 4NJ6A 4H2AA 1VR9A 3RYTA 4BVUC 1EM7A 1FRRA 3D32A 2LUEA 1TKGA 3KWVA 3GS2A 4HLEA 1XLPA 3K9PB 1S1QB 3GZNI 4KIKB 1L5PA 4WQOB 1ZUD2 3BVGA 3RMKC 3CIRB 1R4MB 5EDSA 2AL6A 5HI1A 1EF1A 4WJPA 3CF6E 4ARIA 4K1RB 1T3QA 1HE8A 2L0TA 4ITKA 2LUMA 3L16A 4KX6B 4P7IA 4FADA 1UGJA 3HM6X 4HWIB 2GBNA 4WAAA 2QILA 2IBIB 4G11A 3IT4B 3B9JA 4KGSA 2MCNB 1J0GA 1XT9B 3AV8A 2M0AA 2D11A 2WHIA 3VTVA 1T0RC 5D2MB 3NRZA 3IT6B 3QA8A 4ZHPA 5JHBA 1K51A 1JW9D 4DHJD 4OVVA 3AULA 5HHDG 3RI7C 3N1ZC 4JWUC 1WYWB 3RNFC 3DWGC 3Q3JA 1J7BA 4HCPB 2I1KA 4JWSC 3BYTB 3EA6A 1E5WA 4XDDA 2BKRB 4PK1A 2LGYA 1A5RA 4C4VA 1E7VA 4OHJA 4ZRQA 1IYFA 3B1LX 4LNFA 2BS2B 3PSEB 2BB5A 2MBOA 2MSED 2H88B 1WJ6A 3TEYA 1NEKB 1I4RA 3Q8CA 1KOTA 1I4QA 2J53A 3EHVA 3DVNV 3EFUA 3Q8BA 1OEYJ 2V3SA 3RN9C 2RDHA 1H8CA 4HXDA 3N3KB 3NZUA 5BMGA 2LHEA 4M0WB 2LWPA 1FXAA 3FKYA 2FE8A 3VUWA 2Z8LA 4AUQC 3FILA 1BXTA 3NS8A 3BK2A 2WX0A 4HEA1 1E7PB 2FCSA 2ICIA 3V6EB 2WXMA 2K9XA 1WMHB 5J18A 1WY8A 1QF6A 2FCNA 2PPHA 2FUG1 2VH2A 2L3ZA 2WLBA 1QLBB 3VRBB 2LXAA 4MACA 3NJTA 2ON8A 1FMAD 4FN2A 5JHAA 2NPTB 2AQ1B 4DXGA 2KX3A 4R3DA 1RLFA 2M17A 4DWFA 5LXIB 2ZCCA 2HTME 3DQVA 2O2VB 4EEWA 1WGDA 3WAOA 5I4DA 2BWES 1JRUA 3NUHB 4RGTA 2BKFA 4IWQA 1STEA 2WXOA 3GZNB 3VAWA 2IGGA 1V9JA 2L76A 1C76A 4B0MA 4FJVB 2L32A 1HTOA 4C80A 3N20C 1VDVA 3AE1B 2BF8B 1IGCA 2WXGA 4WWPA 2Y5BB 3Q3MC 2EMTA 1XF5L 2WYQA 2JWZA 5C3JB 2NS5A 3DHHC 4Q2JA 4M8MA 4BOSC 2KDBA 4RFBA 1Q5WB 3KH0A 3W2DA 2ZCBA 2BGFA 2KWUB 3T8MA 1H4RA 2KZRA 2LJIA 4MGYE 2N1WA 1HXYD 1CZPA 3OAWA 1BUIC 3ZUNA 3AB5A 1UF0A 1JALA 5AZHA 1WXAA 2VZKD 3DVGY 4AJYB 4BKSA 5C2TB 4M00A 2EKEC 4HDQA 4BKGA 1TKYA 3L08A 2MW5A 3AEGB 3RUIB 3W1YA 3P1MA 1UWXA 2O2VA 4EZLA 2C5LC 1J8CA 4DXFA 1GAQB 2DAJA 1V1PA 2NR2A 4FXCA 4B0EA 4B95A 1FPYA 3E56A 3E9SA 2WXNA 1RFKA 1WE7A 2K6DB 5G55A 1YN4A 2KN4A 2M8SA 1TTNA 5IO9A 2I2YA 1XQQA 4N6EB 4GIVA 2W55A 1NYRA 2BWFA 3B2GA 2MHJA 1YX6B 5AUIA 4CO7A 2AQ3B 2GBRA 2L00B 2MH7A 4MH0E 2N9LA 4NAWB 2KAJA 1I35A 4FA6A 3KWLA 3H6NA 2KOXA 3UIPB 1Q0WB 3QQ8B 4E74A 1XO3A 1MHHE 1U4AA 3MTNB 3A9JA 3URYA 2KMCA 2N7EA 2QMTA 1EU3A 2G3QB 4RMAA 2IO1B 4GDKB 2XN9C 1SIJA 4K7SA 2V1YA 1K8RB 1ZW7A 2M4NA 4J3OD 3VH4B 4P1BC 1PFDA 3MHZA 3Q3NC 5T8IA 3U52E 2CR5A 4E3CA 3AI5A 1FD6A 1ROEA 2ONQA 1GB1A 3Q69A 1ZE3D 2DENB 4DDID 2K8CA
chains in the Genus database with same CATH topology
3SDLC 1F9JA 1V80A 1UBIA 4HVBA 2AL3A 1J19A 2K8BA 2NCNA 1WXMA 2VRRB 4HDOA 1P1AA 3JSVB 4MJSA 3RCZA 2KD0A 4HK2A 3ZNHB 2LGDA 1WI0A 2JVCA 3A9JB 3OJ3A 4IW0A 5D6JB 2EMSA 4FHKA 4ANXA 2MLBA 4NQKE 3ONSA 3PZDA 2RR9A 3A9KA 5LXHA 4ICUA 3PLVA 2CHZA 3PPAA 1LXDA 2PEAA 4OVUA 4TV3A 4YL8A 5TR5A 2HJ8A 2IY0B 3UIOB 1BT0A 3K9OB 3DCGA 4FULA 3DBHI 3PT2B 1WJNA 3VDZA 5JZEB 4PYUA 4IM0A 1WM3A 3EC8A 5AZFA 4I6PA 2LZ6A 4N9F4 2KTFA 1OTRB 4K7WA 4K81A 2LJ5A 4F1SA 3S2AA 2NBWB 4RM9A 1UD7A 5L83A 4XZ4A 3P2BA 2L05A 2KC2A 1WJ4A 2KWCA 5FR6A 1GC7A 2HD5B 4W9FA 2JZZA 2D3GA 3MHSD 3T9LA 2LD9A 5D94A 5CHVC 5LLIA 3ZNZB 3KUCB 5DCNA 3ZO5B 2MP2A 1V6EA 3A4RA 3PRPB 3ZTDA 1SIFA 3ZLZA 3PRMB 5KHOA 4KIKA 2R2OA 1GG3A 4KZCA 4MGZE 2FNJB 3PLUA 4TKNA 3PRZA 4A3PA 4BFRA 3VTWA 3ZIMA 2PJHA 1EF5A 4MJSB 2D10A 4GGQA 4GDKA 3CSFA 4X57B 2KLCA 3U8ZA 4PYZA 5JH5C 4BKTA 2J0MA 2DZIA 3L0WB 2O6VA 4GDLA 3V62A 2BYFA 3WALA 3A9KB 3WANA 4AP4C 5J2RA 2V4LA 4EOYA 3R7RA 3H7PA 3KVFB 1WFYA 1NDDA 1WXSA 4W9KA 3RZFA 2W9NA 1QZEA 1FXTB 4EFOA 4E71A 5IA7A 4XC2A 1V5OA 4IC7B 3BY4B 3HM3A 3DPDA 4W9HA 3V60A 5AZGA 5C23A 3LDZE 2NVUI 4NJ6A 3RYTA 3ZKJC 1RRBA 4LJOB 1V49A 4BVUC 1ZGUB 2FUHB 2KJHB 4WWOA 2L8JA 2DX5B 3D32A 1S3SG 3SD5A 2LUEA 4ANWA 4W9JA 2FIFA 2MP2B 2FCMA 4PS8A 4HLEA 3UQBA 1C1YB 4LCDE 2ZNVB 1S1QB 3GZNI 3K9PB 4KIKB 4WWNA 2GBKA 1WX9A 4WQOB 4DDGD 1PQSA 4W9EA 1E8YA 2G4SA 2K6QA 1OEYA 5EDSA 2AL6A 1WR1A 2G4DB 1WZ3A 1EF1A 3NHEB 4WJPA 1C3TA 3CF6E 3QHTA 2DAFA 4G3XB 2GBMA 2YLMA 4K1RB 2MBEA 2MRPA 4WJOA 1KLVA 3UGBB 1HE8A 2L0TA 2LI5A 2N9PC 2O6VB 2ZEQA 3L16A 4GDLB 4GN1A 1CMXB 4HPMB 4P7IA 4FADA 2ZVNA 3GOEA 3HM6X 4LDTD 4HWIB 4BOZB 2GBNA 4WAAA 3H7PB 5BO4B 2JY6A 4KSKC 4EUTA 2IBIB 2O6VD 3V61A 3JYUA 4G11A 3UQAA 3R66C 3QAQA 2JRHA 1M94A 2DYOA 3WA0A 4HJKA 4W9GA 3ML8A 2BYVE 4LJPB 3IFWB 2MCNB 2I1JA 4II3B 4CHKA 4TQ0A 1TGZB 1J0GA 1XT9B 3L17A 2D11A 3VTVA 2B3AA 5D2MB 2IO2B 3QWZB 3I3TB 2RGFA 1EUVB 2DYBA 4A20A 3QA8A 4DHJB 3DOWA 4FLHA 1ZKHA 2KO3A 5JHBA 2N4FA 3SU8X 3U7DA 1LQBA 4DHJD 4G0NB 4OVVA 3AULA 2WWZA 4M8NA 1WX8A 2KX0A 2DZJA 2DZKA 4A3OA 2AWTA 3VTUA 2ASQA 1WYWB 3WAMA 1V81A 3Q3JA 3ZVVA 3M62B 4HCPB 1WZ0A 4GU2A 4TQ1A 2I1KA 1EO6A 2LRUA 1UZXB 1E5WA 5E6NA 2BYEA 3PTFC 2BKRB 2LGYA 1A5RA 1E7VA 2K1FA 3B1LX 1IYFA 4URKA 3PSEB 1YIWA 3IBEA 4PS7A 3QARA 1WMHA 2MBOA 2ZZPB 2MSED 4MSQB 5IAAC 1WJ6A 2KNBA 1Y8RC 3APFA 5DPSA 3LJ3A 4MSMB 4DHZB 2KJ6A 2REXA 3QCAA 1KOTA 2ZPNA 4DXAB 4W9CA 3IG3A 3HK0A 3EHVA 3DVNV 2Z59B 1T0YA 3X0WA 2IO3B 2GOWA 4MEMA 3TL5A 3EFUA 4MDKE 1OEYJ 2V3SA 2AEHA 2ZVOA 1OQYA 1WJUA 3B08A 3DDCB 1H8CA 4HXDA 5DPTA 3L13A 1LFDA 2WDTB 3H7SA 3M63B 3N3KB 3NZUA 1GC6A 1RAXA 1WIAA 2CKHB 2NPTA 2IZVB 4JLCA 2J0KA 4M0WB 3NY5A 4HPLB 2LWPA 2MA9B 3UINB 2L7RA 3IVFA 4W9LA 2IYDB 1IP9A 2WX1A 2XK5A 1GNUA 2N7DA 2N1VA 4NNJB 3M3JA 3SHQA 3VUWA 4AUQC 2MX2A 2GBJA 3KYDD 1XD3B 3NS8A 4GMVA 2WX0A 2DYMA 4IWPA 1GUAB 2FCSA 5DPWA 2J7QB 2C9WB 1L2NA 4EZJA 3V6EB 2OOBB 4KVGB 1WMHB 3OJ4B 4BBNC 3ZRCA 5J18A 1WY8A 1YJ1A 3H1UA 2FCNA 2PPHA 4GXBA 2Z0DB 4FBJB 1NI2A 2CHXA 3TBLD 4IUMB 3MJWA 3TJPA 2JXXA 3ENEA 3PHWB 2L3ZA 3QK0A 3N32A 2FCQA 2L0FA 2LXAA 2A5UA 1UELA 3N30A 3VUXA 2K8HA 2MBQA 2KXJA 2KDIA 1AARA 1E90A 2M0XA 1Z5SB 1Q1OA 4RM8A 1KJTA 2KJRA 2KDFB 4FN2A 4II2B 2NPTB 5CHWA 3PREA 4DBGA 3VXWA 5JHAA 3QC8B 2KX3A 5E6OA 2RPQA 1RLFA 2C7HA 1WGYA 2M17A 4DWFA 5LXIB 4FJZA 2JZ3B 2DZMA 2ZCCA 3DQVA 2O2VB 4EEWA 2XK5B 2LXCA 1WGDA 1WF9A 3WAOA 4K7UA 3Q3FA 2KDEB 2BWES 1JRUA 2KQSA 2BKFA 4IWQA 4NPNA 2KK8A 4MM3A 4DK5A 1WM2A 3KUZA 4KDIC 2KMAA 5CTRC 3UF8A 3PS6A 3W1SC 2GMIC 3VAWA 4B9KA 2D07B 3AU4A 4FHJA 3WAPA 1V9JA 1WR6E 2KQ7A 2L76A 2MWSB 2MBBB 2FAZA 2MBHA 3JW0X 3L10B 4XX5A 5E6PA 4FJVB 5AEKB 4EKUA 1IPGA 3AXCA 3V6CB 1VD2A 3A1QA 2KFJA 4ZYNA 1UGMA 2BF8B 1I42A 5GMVA 3VHTC 4IM2A 4WWPA 2OJRA 3PGEA 4KSLC 2ZJDA 3ECIA 2Y5BB 3R7QA 2EMTA 3RULA 2WYQA 2JWZA 3M95A 3QJZA 2RD0A 2NBVB 4IG7B 2NS5A 1WGRA 3VFKA 1OGWA 2KN5A 1P3QU 2LRWA 3QIJA 3RD2A 4B6WA 4CYEA 1E7UA 2DHZA 1V86A 3ZDTA 4M8MA 4BOSC 1P0RA 1YQBA 5C1ZA 2KDBA 3BINA 1Q5WB 3KH0A 3PHXB 2ZCBA 3KW5B 2J0JA 2BGFA 2KWUB 3ML9A 3PVLA 4I6LB 3VUYA 3T8MA 1H4RA 1MG8A 2C7MB 1GJZA 4MELA 2JF5A 2KZRA 4MGYE 2K25A 3IHPC 4KV2A 2N1WA 3CSTA 3QX1A 1V2YA 2XEWA 4JQWC 2KWVB 3OAWA 4TUUA 1WE6A 2RSUA 4JGHB 4W9IA 3ZUNA 4ANVA 2XBBC 4GB9A 5AZHA 2FIDA 3NZSA 1WXAA 4DHZE 3DVGY 5DPRA 4AJYB 4BKSA 3A4SC 3DBLI 4NAWA 2KFKA 3W1SA 1YD8U 3PV1A 2JPHA 2EKEC 3A1QB 4HDQA 3ZNGC 4BKGA 3HIZA 2JT4B 2LVOA 2HTHA 3L08A 1P98A 2MW5A 1D3ZA 4PS3A 2KHWB 1WRDB 1E8WA 3RUIB 3W1YA 3ZRFA 2QHOA 4AJWA 2O2VA 4EZLA 2C5LC 1J8CA 5G2NA 2CHWA 3AU5A 3APCA 4ASWC 1R4NI 2DAJA 2K39A 3ZNID 2NR2A 3R3MA 4ZRKA 4NY0A 4I6NB 2KVRA 4B95A 1G6JA 2HE7A 2IO0B 2LGXA 5HKHA 4ANUA 2KTRA 2PE6B 3HHMA 4ZRIA 2CS4A 1KM7A 3O65B 1WE7A 1UBQA 2IY1B 2K6DB 3APDA 1WGHA 4BBNF 5G55A 3JVZX 4NQLB 1VCBA 2G45B 4W9DA 2M8SA 1TTNA 4HCNB 1YX5B 2LVPA 1XQQA 2PE9A 4JL9A 2MQJA 2KC1A 4MGKE 4GIVA 2KANA 1WXVA 3B0AA 3ZTCA 2BPSA 5KHQA 2BWFA 1R4MI 2R2QA 4WJQA 4AWJA 2AYOB 4F8CB 1YX6B 4JIOU 2YVCA 3RZWC 4F7ZA 3ZW3A 4CO7A 3TIXA 2GBRA 4GSWA 4G50A 2L00B 4FJYA 4MH0E 4NAWB 5CX3A 2KFKB 5CHFA 4ZRJA 3ZDMC 1X1MA 2UYZB 1UH6A 4BKSD 1I35A 2A4ZA 2ZPYA 4FA6A 3DBRI 3H6NA 2JUOA 2N9XA 2JRIB 2KOXA 3DBSA 3NOBA 3UIPB 1Q0WB 3QQ8B 4E74A 1L7YA 4ZDVA 3RT3B 3JSVA 2NBUA 1U4AA 3MTNB 4KDLB 3TMPB 2M1MA 5J17A 3A9JA 3WIMA 3CMMB 1P9DU 5D7GA 2KMCA 3TCAA 2N7EA 4AOFA 1SE9A 2CU1A 4WJNA 1ISNA 1RFAA 2G3QB 4RMAA 2IO1B 4GDKB 2KTRB 1LM8B 3KUDB 4J6IA 3VVWB 4K7SA 1NBFC 1TBEA 2V1YA 1K8RB 1ZW7A 1WGGA 4LDTB 1WX7A 2M4NA 3ALBA 1E8XA 3A33B 3VH4B 2C60A 2KLGA 1WH3A 4KZ0A 4MGIE 2ZNVC 3KYCD 4IWOA 2C7NB 2LASA 3VQIA 2LVQA 3OLMD 3C0RB 4ICVA 2CR5A 2N9EB 4E3CA 1SGHA 2Z0EB 1V5TA 3AI5A 4GOCA 3VH3B 3U30A 5L95C 4NJ7A 3L54A 3H9DA 2DENB 4DDID 2K8CA 3DVGX 2UWQA 1TZ1A 1E8ZA 2KKCA 3DVNU 4IM3A 3X23A 2D2QA 3EECA 1Z2MA 4EZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDL C;  1F9J A;  1V80 A;  1UBI A;  4HVB A;  2AL3 A;  1J19 A;  2K8B A;  2NCN A;  1WXM A;  2VRR B;  4HDO A;  1P1A A;  3JSV B;  4MJS A;  3RCZ A;  2KD0 A;  4HK2 A;  3ZNH B;  2LGD A;  1WI0 A;  2JVC A;  3A9J B;  3OJ3 A;  4IW0 A;  5D6J B;  2EMS A;  4FHK A;  4ANX A;  2MLB A;  4NQK E;  3ONS A;  3PZD A;  2RR9 A;  3A9K A;  5LXH A;  4ICU A;  3PLV A;  2CHZ A;  3PPA A;  1LXD A;  2PEA A;  4OVU A;  4TV3 A;  4YL8 A;  5TR5 A;  2HJ8 A;  2IY0 B;  3UIO B;  1BT0 A;  3K9O B;  3DCG A;  4FUL A;  3DBH I;  3PT2 B;  1WJN A;  3VDZ A;  5JZE B;  4PYU A;  4IM0 A;  1WM3 A;  3EC8 A;  5AZF A;  4I6P A;  2LZ6 A;  4N9F 4;  2KTF A;  1OTR B;  4K7W A;  4K81 A;  2LJ5 A;  4F1S A;  3S2A A;  2NBW B;  4RM9 A;  1UD7 A;  5L83 A;  4XZ4 A;  3P2B A;  2L05 A;  2KC2 A;  1WJ4 A;  2KWC A;  5FR6 A;  1GC7 A;  2HD5 B;  4W9F A;  2JZZ A;  2D3G A;  3MHS D;  3T9L A;  2LD9 A;  5D94 A;  5CHV C;  5LLI A;  3ZNZ B;  3KUC B;  5DCN A;  3ZO5 B;  2MP2 A;  1V6E A;  3A4R A;  3PRP B;  3ZTD A;  1SIF A;  3ZLZ A;  3PRM B;  5KHO A;  4KIK A;  2R2O A;  1GG3 A;  4KZC A;  4MGZ E;  2FNJ B;  3PLU A;  4TKN A;  3PRZ A;  4A3P A;  4BFR A;  3VTW A;  3ZIM A;  2PJH A;  1EF5 A;  4MJS B;  2D10 A;  4GGQ A;  4GDK A;  3CSF A;  4X57 B;  2KLC A;  3U8Z A;  4PYZ A;  5JH5 C;  4BKT A;  2J0M A;  2DZI A;  3L0W B;  2O6V A;  4GDL A;  3V62 A;  2BYF A;  3WAL A;  3A9K B;  3WAN A;  4AP4 C;  5J2R A;  2V4L A;  4EOY A;  3R7R A;  3H7P A;  3KVF B;  1WFY A;  1NDD A;  1WXS A;  4W9K A;  3RZF A;  2W9N A;  1QZE A;  1FXT B;  4EFO A;  4E71 A;  5IA7 A;  4XC2 A;  1V5O A;  4IC7 B;  3BY4 B;  3HM3 A;  3DPD A;  4W9H A;  3V60 A;  5AZG A;  5C23 A;  3LDZ E;  2NVU I;  4NJ6 A;  3RYT A;  3ZKJ C;  1RRB A;  4LJO B;  1V49 A;  4BVU C;  1ZGU B;  2FUH B;  2KJH B;  4WWO A;  2L8J A;  2DX5 B;  3D32 A;  1S3S G;  3SD5 A;  2LUE A;  4ANW A;  4W9J A;  2FIF A;  2MP2 B;  2FCM A;  4PS8 A;  4HLE A;  3UQB A;  1C1Y B;  4LCD E;  2ZNV B;  1S1Q B;  3GZN I;  3K9P B;  4KIK B;  4WWN A;  2GBK A;  1WX9 A;  4WQO B;  4DDG D;  1PQS A;  4W9E A;  1E8Y A;  2G4S A;  2K6Q A;  1OEY A;  5EDS A;  2AL6 A;  1WR1 A;  2G4D B;  1WZ3 A;  1EF1 A;  3NHE B;  4WJP A;  1C3T A;  3CF6 E;  3QHT A;  2DAF A;  4G3X B;  2GBM A;  2YLM A;  4K1R B;  2MBE A;  2MRP A;  4WJO A;  1KLV A;  3UGB B;  1HE8 A;  2L0T A;  2LI5 A;  2N9P C;  2O6V B;  2ZEQ A;  3L16 A;  4GDL B;  4GN1 A;  1CMX B;  4HPM B;  4P7I A;  4FAD A;  2ZVN A;  3GOE A;  3HM6 X;  4LDT D;  4HWI B;  4BOZ B;  2GBN A;  4WAA A;  3H7P B;  5BO4 B;  2JY6 A;  4KSK C;  4EUT A;  2IBI B;  2O6V D;  3V61 A;  3JYU A;  4G11 A;  3UQA A;  3R66 C;  3QAQ A;  2JRH A;  1M94 A;  2DYO A;  3WA0 A;  4HJK A;  4W9G A;  3ML8 A;  2BYV E;  4LJP B;  3IFW B;  2MCN B;  2I1J A;  4II3 B;  4CHK A;  4TQ0 A;  1TGZ B;  1J0G A;  1XT9 B;  3L17 A;  2D11 A;  3VTV A;  2B3A A;  5D2M B;  2IO2 B;  3QWZ B;  3I3T B;  2RGF A;  1EUV B;  2DYB A;  4A20 A;  3QA8 A;  4DHJ B;  3DOW A;  4FLH A;  1ZKH A;  2KO3 A;  5JHB A;  2N4F A;  3SU8 X;  3U7D A;  1LQB A;  4DHJ D;  4G0N B;  4OVV A;  3AUL A;  2WWZ A;  4M8N A;  1WX8 A;  2KX0 A;  2DZJ A;  2DZK A;  4A3O A;  2AWT A;  3VTU A;  2ASQ A;  1WYW B;  3WAM A;  1V81 A;  3Q3J A;  3ZVV A;  3M62 B;  4HCP B;  1WZ0 A;  4GU2 A;  4TQ1 A;  2I1K A;  1EO6 A;  2LRU A;  1UZX B;  1E5W A;  5E6N A;  2BYE A;  3PTF C;  2BKR B;  2LGY A;  1A5R A;  1E7V A;  2K1F A;  3B1L X;  1IYF A;  4URK A;  3PSE B;  1YIW A;  3IBE A;  4PS7 A;  3QAR A;  1WMH A;  2MBO A;  2ZZP B;  2MSE D;  4MSQ B;  5IAA C;  1WJ6 A;  2KNB A;  1Y8R C;  3APF A;  5DPS A;  3LJ3 A;  4MSM B;  4DHZ B;  2KJ6 A;  2REX A;  3QCA A;  1KOT A;  2ZPN A;  4DXA B;  4W9C A;  3IG3 A;  3HK0 A;  3EHV A;  3DVN V;  2Z59 B;  1T0Y A;  3X0W A;  2IO3 B;  2GOW A;  4MEM A;  3TL5 A;  3EFU A;  4MDK E;  1OEY J;  2V3S A;  2AEH A;  2ZVO A;  1OQY A;  1WJU A;  3B08 A;  3DDC B;  1H8C A;  4HXD A;  5DPT A;  3L13 A;  1LFD A;  2WDT B;  3H7S A;  3M63 B;  3N3K B;  3NZU A;  1GC6 A;  1RAX A;  1WIA A;  2CKH B;  2NPT A;  2IZV B;  4JLC A;  2J0K A;  4M0W B;  3NY5 A;  4HPL B;  2LWP A;  2MA9 B;  3UIN B;  2L7R A;  3IVF A;  4W9L A;  2IYD B;  1IP9 A;  2WX1 A;  2XK5 A;  1GNU A;  2N7D A;  2N1V A;  4NNJ B;  3M3J A;  3SHQ A;  3VUW A;  4AUQ C;  2MX2 A;  2GBJ A;  3KYD D;  1XD3 B;  3NS8 A;  4GMV A;  2WX0 A;  2DYM A;  4IWP A;  1GUA B;  2FCS A;  5DPW A;  2J7Q B;  2C9W B;  1L2N A;  4EZJ A;  3V6E B;  2OOB B;  4KVG B;  1WMH B;  3OJ4 B;  4BBN C;  3ZRC A;  5J18 A;  1WY8 A;  1YJ1 A;  3H1U A;  2FCN A;  2PPH A;  4GXB A;  2Z0D B;  4FBJ B;  1NI2 A;  2CHX A;  3TBL D;  4IUM B;  3MJW A;  3TJP A;  2JXX A;  3ENE A;  3PHW B;  2L3Z A;  3QK0 A;  3N32 A;  2FCQ A;  2L0F A;  2LXA A;  2A5U A;  1UEL A;  3N30 A;  3VUX A;  2K8H A;  2MBQ A;  2KXJ A;  2KDI A;  1AAR A;  1E90 A;  2M0X A;  1Z5S B;  1Q1O A;  4RM8 A;  1KJT A;  2KJR A;  2KDF B;  4FN2 A;  4II2 B;  2NPT B;  5CHW A;  3PRE A;  4DBG A;  3VXW A;  5JHA A;  3QC8 B;  2KX3 A;  5E6O A;  2RPQ A;  1RLF A;  2C7H A;  1WGY A;  2M17 A;  4DWF A;  5LXI B;  4FJZ A;  2JZ3 B;  2DZM A;  2ZCC A;  3DQV A;  2O2V B;  4EEW A;  2XK5 B;  2LXC A;  1WGD A;  1WF9 A;  3WAO A;  4K7U A;  3Q3F A;  2KDE B;  2BWE S;  1JRU A;  2KQS A;  2BKF A;  4IWQ A;  4NPN A;  2KK8 A;  4MM3 A;  4DK5 A;  1WM2 A;  3KUZ A;  4KDI C;  2KMA A;  5CTR C;  3UF8 A;  3PS6 A;  3W1S C;  2GMI C;  3VAW A;  4B9K A;  2D07 B;  3AU4 A;  4FHJ A;  3WAP A;  1V9J A;  1WR6 E;  2KQ7 A;  2L76 A;  2MWS B;  2MBB B;  2FAZ A;  2MBH A;  3JW0 X;  3L10 B;  4XX5 A;  5E6P A;  4FJV B;  5AEK B;  4EKU A;  1IPG A;  3AXC A;  3V6C B;  1VD2 A;  3A1Q A;  2KFJ A;  4ZYN A;  1UGM A;  2BF8 B;  1I42 A;  5GMV A;  3VHT C;  4IM2 A;  4WWP A;  2OJR A;  3PGE A;  4KSL C;  2ZJD A;  3ECI A;  2Y5B B;  3R7Q A;  2EMT A;  3RUL A;  2WYQ A;  2JWZ A;  3M95 A;  3QJZ A;  2RD0 A;  2NBV B;  4IG7 B;  2NS5 A;  1WGR A;  3VFK A;  1OGW A;  2KN5 A;  1P3Q U;  2LRW A;  3QIJ A;  3RD2 A;  4B6W A;  4CYE A;  1E7U A;  2DHZ A;  1V86 A;  3ZDT A;  4M8M A;  4BOS C;  1P0R A;  1YQB A;  5C1Z A;  2KDB A;  3BIN A;  1Q5W B;  3KH0 A;  3PHX B;  2ZCB A;  3KW5 B;  2J0J A;  2BGF A;  2KWU B;  3ML9 A;  3PVL A;  4I6L B;  3VUY A;  3T8M A;  1H4R A;  1MG8 A;  2C7M B;  1GJZ A;  4MEL A;  2JF5 A;  2KZR A;  4MGY E;  2K25 A;  3IHP C;  4KV2 A;  2N1W A;  3CST A;  3QX1 A;  1V2Y A;  2XEW A;  4JQW C;  2KWV B;  3OAW A;  4TUU A;  1WE6 A;  2RSU A;  4JGH B;  4W9I A;  3ZUN A;  4ANV A;  2XBB C;  4GB9 A;  5AZH A;  2FID A;  3NZS A;  1WXA A;  4DHZ E;  3DVG Y;  5DPR A;  4AJY B;  4BKS A;  3A4S C;  3DBL I;  4NAW A;  2KFK A;  3W1S A;  1YD8 U;  3PV1 A;  2JPH A;  2EKE C;  3A1Q B;  4HDQ A;  3ZNG C;  4BKG A;  3HIZ A;  2JT4 B;  2LVO A;  2HTH A;  3L08 A;  1P98 A;  2MW5 A;  1D3Z A;  4PS3 A;  2KHW B;  1WRD B;  1E8W A;  3RUI B;  3W1Y A;  3ZRF A;  2QHO A;  4AJW A;  2O2V A;  4EZL A;  2C5L C;  1J8C A;  5G2N A;  2CHW A;  3AU5 A;  3APC A;  4ASW C;  1R4N I;  2DAJ A;  2K39 A;  3ZNI D;  2NR2 A;  3R3M A;  4ZRK A;  4NY0 A;  4I6N B;  2KVR A;  4B95 A;  1G6J A;  2HE7 A;  2IO0 B;  2LGX A;  5HKH A;  4ANU A;  2KTR A;  2PE6 B;  3HHM A;  4ZRI A;  2CS4 A;  1KM7 A;  3O65 B;  1WE7 A;  1UBQ A;  2IY1 B;  2K6D B;  3APD A;  1WGH A;  4BBN F;  5G55 A;  3JVZ X;  4NQL B;  1VCB A;  2G45 B;  4W9D A;  2M8S A;  1TTN A;  4HCN B;  1YX5 B;  2LVP A;  1XQQ A;  2PE9 A;  4JL9 A;  2MQJ A;  2KC1 A;  4MGK E;  4GIV A;  2KAN A;  1WXV A;  3B0A A;  3ZTC A;  2BPS A;  5KHQ A;  2BWF A;  1R4M I;  2R2Q A;  4WJQ A;  4AWJ A;  2AYO B;  4F8C B;  1YX6 B;  4JIO U;  2YVC A;  3RZW C;  4F7Z A;  3ZW3 A;  4CO7 A;  3TIX A;  2GBR A;  4GSW A;  4G50 A;  2L00 B;  4FJY A;  4MH0 E;  4NAW B;  5CX3 A;  2KFK B;  5CHF A;  4ZRJ A;  3ZDM C;  1X1M A;  2UYZ B;  1UH6 A;  4BKS D;  1I35 A;  2A4Z A;  2ZPY A;  4FA6 A;  3DBR I;  3H6N A;  2JUO A;  2N9X A;  2JRI B;  2KOX A;  3DBS A;  3NOB A;  3UIP B;  1Q0W B;  3QQ8 B;  4E74 A;  1L7Y A;  4ZDV A;  3RT3 B;  3JSV A;  2NBU A;  1U4A A;  3MTN B;  4KDL B;  3TMP B;  2M1M A;  5J17 A;  3A9J A;  3WIM A;  3CMM B;  1P9D U;  5D7G A;  2KMC A;  3TCA A;  2N7E A;  4AOF A;  1SE9 A;  2CU1 A;  4WJN A;  1ISN A;  1RFA A;  2G3Q B;  4RMA A;  2IO1 B;  4GDK B;  2KTR B;  1LM8 B;  3KUD B;  4J6I A;  3VVW B;  4K7S A;  1NBF C;  1TBE A;  2V1Y A;  1K8R B;  1ZW7 A;  1WGG A;  4LDT B;  1WX7 A;  2M4N A;  3ALB A;  1E8X A;  3A33 B;  3VH4 B;  2C60 A;  2KLG A;  1WH3 A;  4KZ0 A;  4MGI E;  2ZNV C;  3KYC D;  4IWO A;  2C7N B;  2LAS A;  3VQI A;  2LVQ A;  3OLM D;  3C0R B;  4ICV A;  2CR5 A;  2N9E B;  4E3C A;  1SGH A;  2Z0E B;  1V5T A;  3AI5 A;  4GOC A;  3VH3 B;  3U30 A;  5L95 C;  4NJ7 A;  3L54 A;  3H9D A;  2DEN B;  4DDI D;  2K8C A;  3DVG X;  2UWQ A;  1TZ1 A;  1E8Z A;  2KKC A;  3DVN U;  4IM3 A;  3X23 A;  2D2Q A;  3EEC A;  1Z2M A;  4EZK A; 
#chains in the Genus database with same CATH topology
 3MFG A;  1F9J A;  4HVB A;  2AL3 A;  3GP7 A;  3JSV B;  2KD0 A;  1XLQ A;  1WI0 A;  3VR8 B;  3AM9 A;  3VR9 B;  1KF6 B;  4ANX A;  2MLB A;  1TJE A;  5LXH A;  2CHZ A;  4YL8 A;  5G5G A;  3VDZ A;  1FEH A;  1WJN A;  2MJE A;  4N9F 4;  1OTR B;  3ABV B;  4YWG G;  5GXG B;  3P2B A;  2D5G A;  1QT9 A;  2KYW A;  1ET9 A;  2G1E A;  5CHV C;  3N1Y C;  4WUR A;  2MP2 A;  1V6E A;  1C4C A;  4YSX B;  1K53 A;  3ZLZ A;  4TMA B;  3PRM B;  5KHO A;  4YTP B;  3VTW A;  1WGK A;  1TYG B;  4GGQ A;  4GDK A;  1N61 A;  4PYZ A;  5JH5 C;  4GDL A;  3WAL A;  3A9K B;  3BII D;  3RNA C;  1AYF A;  3KVF B;  2K0P A;  3EFC A;  3RZF A;  5IA7 A;  3HM3 A;  3ZKJ C;  1XXG A;  1RRB A;  4LJO B;  1FM0 D;  1JWM D;  3NVV A;  2DNF A;  3BZD B;  5H92 C;  1TS4 A;  2DX5 B;  3HRD D;  1S3S G;  2CJN A;  4PS8 A;  1C1Y B;  2ZNV B;  3IAM 1;  4C7Y A;  4W9E A;  2K6Q A;  1WZ3 A;  3QHT A;  3AE3 B;  2EEL A;  1I7H A;  2MBE A;  2MRP A;  3Q8A A;  4WJO A;  3UGB B;  2LI5 A;  4HPM B;  2ZVN A;  1SJE D;  2W3S A;  2YEP B;  1F2R C;  4HPP A;  4BOZ B;  4KSK C;  3GB1 A;  2O6V D;  3Q14 C;  4HRO A;  1GB4 A;  3JYU A;  3UQA A;  1M94 A;  3ML8 A;  2BYV E;  3C8Y A;  4CHK A;  3L17 A;  2IO2 B;  3I3T B;  2RGF A;  3ZJV A;  1Y56 A;  3ZXR A;  2DYB A;  3AE5 B;  1LQB A;  4G0N B;  3P63 A;  2WWZ A;  4M8N A;  1WX8 A;  4YT0 B;  2DZK A;  4A3O A;  3WAM A;  4GU2 A;  1HEZ E;  4HJG E;  2LRU A;  2B76 B;  2BYE A;  3PTF C;  4USA A;  1WYG A;  2K1F A;  4URK A;  1YIW A;  3IBE A;  2PLP A;  2ZZP B;  5IAA C;  1N60 A;  1Y8R C;  3APF A;  4DHZ B;  2VZK B;  3QCA A;  4DXA B;  3Q8F A;  4W9C A;  1QOB A;  3IG3 A;  1NVI D;  3X0W A;  2PVO D;  2GOW A;  3TL5 A;  2ZVO A;  3B08 A;  3DDC B;  3H7S A;  2WDT B;  3Q3O C;  2LHD A;  3TEW A;  1K52 A;  2RDG A;  4JLC A;  5BMI A;  2V4I B;  3NY5 A;  4HPL B;  1L4Z B;  3IVF A;  1IP9 A;  5IKC M;  4ARC A;  2XK5 A;  4KGR A;  4C56 C;  3MC8 A;  4JPS A;  2MX2 A;  2KDM A;  3Q8E A;  4GMV A;  4OZC A;  4IWP A;  5DPW A;  2J7Q B;  4IOI E;  4A9A A;  4EZJ A;  2OOB B;  3ZRC A;  1YJ1 A;  3H1U A;  4GXB A;  2Z0D B;  2NTS A;  2QIE B;  2CHX A;  4IUM B;  3TJP A;  2JXX A;  3ENE A;  3PHW B;  2X38 A;  1N63 A;  3QK0 A;  3IAS 1;  1HQR D;  1Q10 A;  4EE2 A;  4ZRP A;  2KXJ A;  2WQY B;  2KDI A;  1AAR A;  4RM8 A;  2CU3 A;  2KDF B;  4II2 B;  2G9H D;  3VXW A;  4DBG A;  1KTK A;  5FR3 A;  2WP9 B;  1FCL A;  3BVM A;  1L0X B;  1YN3 A;  1JRO A;  2BW2 A;  1JWS D;  2D3A A;  1N6Z A;  1F52 A;  2WXP A;  3FIL B;  4MM3 A;  4DK5 A;  1L6V A;  5CTR C;  3UF8 A;  3PS6 A;  3W1S C;  1XCQ L;  2KMM A;  3AU4 A;  3H8H A;  4FHJ A;  3WAP A;  1WR6 E;  1JQ4 A;  2KQ7 A;  3DWM A;  1QOF A;  5E6P A;  3L10 B;  1RWS A;  2MJD A;  2IDY A;  2WXL A;  2W54 A;  3A1Q A;  4ZYN A;  1UGM A;  1I42 A;  5GMV A;  2OJR A;  3RUL A;  1FXI A;  2RD0 A;  2NBV B;  1C4P A;  1HA5 A;  3VFK A;  3AED B;  3ZDT A;  1YQB A;  2PKO A;  4D2K A;  3J9C A;  2JX5 A;  5C1Z A;  4O1N A;  3VUY A;  1SXT A;  2BQQ A;  1PGA A;  4TUU A;  1WE6 A;  2QJL A;  2RSU A;  4GB9 A;  1YJI A;  4C00 A;  4DHZ E;  3I5J C;  4RH6 A;  5DPR A;  1ZPS A;  2JPH A;  3ZNG C;  5TSS A;  4WH4 A;  3BVZ A;  4M02 A;  2QHO A;  4AJW A;  1MFW A;  5G2N A;  3W5U B;  1YMH E;  3APC A;  1N5W A;  4ZRK A;  4NY0 A;  4I6N B;  2HE7 A;  4ANU A;  3P4Q B;  2KTR A;  2PE6 B;  3HHM A;  1YOV B;  2CS4 A;  1KM7 A;  2IY1 B;  1B1Z A;  4XGA B;  4YSZ B;  4NQL B;  4HCN B;  1YQ4 B;  1HTQ A;  2KAN A;  4RF0 A;  1FFV A;  2V3N A;  2V9H A;  2R2Q A;  1JWB D;  2QCZ A;  4F8C B;  5HFY A;  3RZW C;  4GSW A;  4G50 A;  1V1O A;  5CX3 A;  2UYZ B;  1UH6 A;  3DBR I;  1PGB A;  4KDL B;  4XE0 A;  3WIM A;  1V1P B;  3TCA A;  1UNS A;  2MEK A;  1FNU A;  1SE9 A;  2CU1 A;  2RDB C;  1ISN A;  1FFU A;  1IBX A;  1RFA A;  4XYC A;  1E10 A;  3VVW B;  5AUK A;  1L0V B;  1T0Q C;  3EUB 2;  1E8X A;  2M19 A;  1WRI A;  4YSY B;  2KLG A;  4KZ0 A;  2W3R A;  4NJC A;  1L0Y B;  2ZNV C;  3KYC D;  3BYY B;  3VQI A;  2BS4 B;  4LTU A;  2N9E B;  4GOC A;  2Z0E B;  2J4X A;  3U30 A;  3ZJU A;  3DVN U;  4IM3 A;  1Z2M A;  2KAC A;  3SDL C;  3T3N A;  2NCN A;  1WXM A;  4MJS A;  3V05 A;  1P1A A;  3ZQ4 A;  2LMC A;  3ZNH B;  3A9J B;  3OJ3 A;  4LNI A;  5D6J B;  2KQ4 X;  4FHK A;  4NQK E;  1D4B A;  4ICU A;  3PLV A;  4TV3 A;  2XNA C;  3UIO B;  1I4P A;  2IGH A;  4LNK A;  4PYU A;  4IM0 A;  4RCO A;  3HUI A;  4QAY A;  2KTF A;  4F1S A;  3PZ7 A;  3N9Y C;  2Y5C A;  4YTM B;  2KC2 A;  2KWC A;  5FR6 A;  1GC7 A;  2JZZ A;  3MP9 A;  2LD9 A;  5LLI A;  2WXI A;  5H8Y E;  3RNB C;  5DCN A;  3ZO5 B;  2DBY A;  3NS1 A;  3R2T A;  3PRP B;  4WIP A;  3ZTD A;  1SIF A;  2IJ0 A;  1MI0 A;  2FNJ B;  4TKN A;  3T3O A;  2PJH A;  1EF5 A;  4X57 B;  2PMV A;  2WXK A;  3NG0 A;  2INC C;  1T5X D;  1FO4 A;  4BKT A;  2J0M A;  1RM6 C;  2DZI A;  2O6V A;  3TUO A;  1T0S C;  3WAN A;  3AEC B;  3H7P A;  1WFY A;  1NDD A;  4MT5 A;  4W9K A;  1P7E A;  2E6X A;  1UWM A;  1D5Z C;  4W9H A;  3V60 A;  5AZG A;  2KWD A;  3LDZ E;  2NVU I;  1ZP0 B;  3AE4 B;  1K50 A;  4WWO A;  1QOG A;  2JQR B;  4ANW A;  2MP2 B;  2FCM A;  3UQB A;  4LCD E;  1SE3 A;  1P7F A;  1DOY A;  3DHG C;  1PQS A;  4RGN A;  1WR1 A;  2G4D B;  3NHE B;  5G5H A;  1JWU D;  2DAF A;  4G3X B;  2GBM A;  1ZDV A;  5EE3 A;  1KLV A;  2Y5P A;  2NTT A;  2N9P C;  4OVZ A;  2V0G A;  4GDL B;  1VJK A;  1CMX B;  4A6Q A;  3DBR B;  5BO4 B;  1QKZ A;  4EUT A;  4RGO S;  1FNV A;  3QAQ A;  2DYO A;  4RGM A;  3WA0 A;  4HJK A;  4W9G A;  4LJP B;  2I1J A;  1R7S A;  1WSP A;  1GPX A;  4IDI A;  2B3A A;  4A20 A;  4DHJ B;  3DOW A;  2YEP F;  4FLH A;  1ZKH A;  2N4F A;  3Q2A C;  3SU8 X;  3U7D A;  1ESF A;  2N0S B;  4YTN B;  2DZJ A;  3GE3 C;  2AWT A;  1C77 A;  1V81 A;  1WZ0 A;  4TQ1 A;  1UZX B;  5E6N A;  1YN5 A;  1GOZ A;  3RFZ B;  4PS7 A;  3QAR A;  4MSQ B;  1JCK B;  3RPF C;  1DOX A;  2D3B A;  1UUP A;  2REX A;  1PUT A;  3AEA B;  2ZPN A;  1C4A A;  1N62 A;  3HK0 A;  1T0Y A;  4MEM A;  4MDK E;  1OQY A;  1WJU A;  3AE2 B;  3OG5 A;  1AW7 A;  3L13 A;  3M63 B;  3TEZ A;  1RAX A;  1WIA A;  2CKH B;  2IZV B;  2HJ1 A;  3OWE B;  1SBB B;  2J42 A;  2MA9 B;  3UIN B;  1KRH A;  4W9L A;  1L6U A;  2IYD B;  2QEJ C;  3AH7 A;  2WX1 A;  1GNU A;  4NNJ B;  3M3J A;  3WCQ A;  2X8X X;  1KLG D;  2SAK A;  2GBJ A;  1B9R A;  2WXR A;  2DYM A;  2C9W B;  1L2N A;  3BK1 A;  3OJ4 B;  1NEN B;  1WXQ A;  1CK1 A;  1ZDX A;  3MJW A;  3PZ8 A;  5BYS A;  1ENF A;  2FCQ A;  3VUX A;  1UEL A;  1WWT A;  2K8H A;  2MBQ A;  1E90 A;  2M0X A;  1Z5S B;  1Q1O A;  1C79 A;  2KJR A;  5CHW A;  3PRE A;  3QC8 B;  1JRP A;  2JU6 X;  2C7H A;  2JZ3 B;  3LYY A;  2DZM A;  2XK5 B;  2WS3 B;  2LXC A;  1WF9 A;  4K7U A;  3Q3F A;  4K3C A;  2EKI A;  4NPN A;  1WM2 A;  2GB1 A;  2KMA A;  1D5X C;  4LK0 M;  5HG2 A;  1YJJ A;  1D5M C;  2MBB B;  2MBH A;  2L83 A;  1EWY C;  1IPG A;  3AXC A;  4N58 A;  3V6C B;  3VHT C;  4KSL C;  3R7Q A;  2JXT A;  1OFF A;  1NI3 A;  4IG7 B;  1WGR A;  1FIQ A;  1OGW A;  2KN5 A;  1P3Q U;  3QIJ A;  1E7U A;  1F1H A;  1V86 A;  2WXH A;  1MHX A;  1RYJ A;  1TS5 A;  3BIN A;  3PHX B;  3KW5 B;  5EE9 A;  1KFY B;  2J0J A;  3PVL A;  2BB6 A;  2C7M B;  1GJZ A;  4US8 A;  4BZA A;  2K25 A;  3IHP C;  4MM3 B;  3CST A;  3QX1 A;  1V2Y A;  1C9F A;  2KWV B;  2E3T A;  1KH0 A;  4ANV A;  2XBB C;  1E9M A;  3NZS A;  2KFK A;  2AQ2 B;  3A1Q B;  2PW9 A;  1VRA B;  2HTH A;  1P98 A;  3ETR A;  1D3Z A;  3MC9 A;  1TS2 A;  2KHW B;  3ZRF A;  4LNO A;  2CHW A;  3AU5 A;  1VZ6 A;  1R4N I;  3R3M A;  2CJO A;  2KVR A;  3BWU D;  2IO0 B;  5BYQ A;  2LGX A;  2QDF A;  4ZRI A;  3TSS A;  3O65 B;  3APD A;  3JVZ X;  2K5P A;  3W5V B;  4L2Y A;  2WXQ A;  2PE9 A;  4JL9 A;  4MGK E;  3B0A A;  3UI3 A;  3V3X A;  4WJQ A;  4AWJ A;  3O13 A;  1NYQ A;  2IND C;  3TIX A;  4S0R A;  3ZDM C;  4ZRJ A;  1SJH D;  1X1M A;  1FNW A;  2A4Z A;  2WU5 B;  3ZGZ A;  2JUO A;  3DBS A;  2JRI B;  1LGR A;  3KQ4 A;  4ZDV A;  3RT3 B;  2PIA A;  1P9D U;  4AOF A;  2WDR B;  4L1B A;  2KTR B;  1LM8 B;  2W82 A;  1NBF C;  1TBE A;  4XDC A;  1WGG A;  1WX7 A;  3ALB A;  3L4P A;  1C78 A;  4JX1 C;  1I4H A;  1WH3 A;  4MGI E;  3AEE B;  5FK9 C;  2LAS A;  2WNM A;  3CWI A;  3B2F A;  2V3P A;  3VH3 B;  1IGD A;  2PTL A;  3ZYY X;  5L95 C;  4ZYS A;  3L54 A;  3H9D A;  1DGJ A;  1JWA D;  2M56 B;  2SEB D;  1TZ1 A;  1E8Z A;  2KKC A;  2PVG C;  1FRD A;  2D2Q A;  3EEC A;  4EZK A;  1UBI A;  2FBW B;  2K8B A;  2VRR B;  3RCZ A;  1AN8 A;  2JVC A;  4IW0 A;  2EMS A;  3N1X C;  3ONS A;  1IBX B;  2AX5 A;  2L1A A;  4OVU A;  1LXD A;  5TR5 A;  2HJ8 A;  2OJW A;  1BT0 A;  5EE1 A;  3DCG A;  4OZA A;  3DBH I;  3PT2 B;  5JZE B;  4ZHO A;  1PYW D;  1T6B X;  2LZ6 A;  2ZW0 A;  4K7W A;  2LJ5 A;  2NBW B;  1UD7 A;  1L4D B;  2L05 A;  1WJ4 A;  2OED A;  2HD5 B;  1V97 A;  2D3G A;  1SF0 A;  3T9L A;  5D94 A;  4KKI A;  4OZB A;  4KIK A;  2R2O A;  4MGZ E;  3PLU A;  2BTE A;  4OW0 A;  3ZIM A;  1TT5 B;  4MJS B;  2D10 A;  3P4S B;  3U8Z A;  1EU4 A;  3L0W B;  4M01 A;  3V62 A;  1QIL A;  4AP4 C;  1FCC C;  2V4L A;  4EFO A;  4NZL B;  4E71 A;  4XC2 A;  1YQ3 B;  1V5O A;  1R4N B;  2WU2 B;  3BY4 B;  4IC7 B;  2D3C A;  2LFI A;  5D3D A;  1TS3 A;  1V49 A;  3NVY A;  1ZGU B;  2FUH B;  2KJH B;  2L8J A;  4RF1 A;  3SD5 A;  2J52 A;  1HZ6 A;  1OQR A;  4W9J A;  2FIF A;  3FAH A;  1TIF A;  4WWM A;  4WWN A;  2GBK A;  1WX9 A;  4DDG D;  2BS3 B;  1E8Y A;  2G4S A;  3GE8 C;  1OEY A;  2RPV A;  2VH1 A;  1C3T A;  4L23 A;  2DWQ A;  2YLM A;  4PT5 A;  3I9V 1;  3VRA B;  2O6V B;  2ZEQ A;  4GN1 A;  3GOE A;  4LDT D;  3H7P B;  2JY6 A;  3V61 A;  3AMZ A;  1XCT L;  1SB3 C;  3Q6B A;  4A8X C;  3R66 C;  2JRH A;  3IFW B;  4II3 B;  4TQ0 A;  1TGZ B;  1YNT E;  2L52 A;  1I4G A;  3QWZ B;  1EUV B;  1J7A A;  3HVZ A;  2KO3 A;  1J7C A;  4M0W A;  1BML C;  1PDX A;  2KX0 A;  2LGI A;  3VTU A;  2ASQ A;  3ZVV A;  3M62 B;  1EO6 A;  2RMM A;  2HDE A;  3C19 A;  2QC8 A;  3IXS A;  1ZOY B;  1CJE A;  5BMH A;  1TY0 A;  1WMH A;  2DLB A;  2KNB A;  3AE8 B;  5DPS A;  3LJ3 A;  4MSM B;  2KJ6 A;  3P4P B;  1TZO A;  4P6V F;  1SE2 A;  2Z59 B;  1SE4 A;  2IO3 B;  2KVZ A;  2AEH A;  3R2I A;  4US9 A;  4UDU C;  5DPT A;  3DBH B;  1LFD A;  1V8C A;  1GC6 A;  1ZXH A;  1TY2 A;  2NPT A;  5E6J A;  2J0K A;  1QOA A;  2L7R A;  4KKJ A;  1ACC A;  3RNC C;  3U4E G;  2N7D A;  2N1V A;  1VZ8 A;  3SHQ A;  3KYD D;  1XD3 B;  2WGS A;  3RNG C;  1GUA B;  2JSV X;  2OHF A;  4KVG B;  4HKQ A;  4K3B A;  4BBN C;  2N7J A;  2BBC A;  4FBJ B;  4IKG A;  4N59 A;  1NI2 A;  2INN E;  3TBL D;  5IN7 A;  1A70 A;  3AEF B;  2IPK D;  1JML A;  3N32 A;  2L0F A;  2N9K A;  2A5U A;  2JZP A;  3N30 A;  4XWT A;  5EE0 A;  1KJT A;  2Q5W D;  2JWU A;  5E6O A;  2RPQ A;  4ACF A;  1WGY A;  2GI9 A;  4FJZ A;  3AEB B;  3NVW A;  1DOI A;  2KDE B;  3W9C B;  2KQS A;  4DQO C;  3KLS X;  2KK8 A;  3KUZ A;  4KDI C;  1MJD A;  3FC4 A;  2LEK A;  2GMI C;  4B9K A;  2D07 B;  3AE7 B;  4TSS A;  1E0Z A;  2MWS B;  2FAZ A;  3JW0 X;  4XX5 A;  1ET6 A;  4LNN A;  2JYE A;  1IUE A;  5AEK B;  4EKU A;  2MJ3 A;  1VD2 A;  2KFJ A;  3P42 A;  3SFE B;  1N5X A;  4IM2 A;  3PGE A;  2ZJD A;  3ECI A;  3LXF A;  3M95 A;  3QJZ A;  3ZJT A;  2WDQ B;  5IP4 D;  5LNK 1;  4MH8 A;  4B6W A;  2LRW A;  3RD2 A;  4CYE A;  3PO0 A;  2DHZ A;  4A90 A;  1P0R A;  3DHI C;  3ML9 A;  1ZXI A;  1DYQ A;  4I6L B;  4LLG M;  1TKE A;  3P4R B;  1MG8 A;  4MEL A;  2JF5 A;  4KV2 A;  2XEW A;  4JQW C;  4JGH B;  4W9I A;  2R61 A;  3AE9 B;  5D3I B;  1XEE A;  2FID A;  3MJ5 A;  3A4S C;  3SEB A;  3DBL I;  4NAW A;  3W1S A;  1YD8 U;  3PV1 A;  3HIZ A;  2INP E;  2JT4 B;  2WXF A;  1F77 A;  2LVO A;  4PS3 A;  1WRD B;  1E8W A;  2K22 A;  4A55 A;  4YXD B;  1MPE A;  1F0Z A;  4ASW C;  2K39 A;  3ZNI D;  1G6J A;  5HKH A;  4GLS C;  1HZ5 A;  3EGR A;  4RNA A;  1UBQ A;  5FKA C;  2IGD A;  1WGH A;  4BBN F;  2BT6 A;  1VCB A;  2G45 B;  4W9D A;  1MVK A;  2KT7 A;  4HKZ E;  1YX5 B;  2LVP A;  3MC0 B;  1SEB D;  2MQJ A;  2KC1 A;  1WXV A;  3ZTC A;  3TEX A;  2BPS A;  5KHQ A;  1R4M I;  1EWC A;  2AYO B;  4JIO U;  2YVC A;  4F7Z A;  3ZW3 A;  4FJY A;  2KFK B;  5CHF A;  1QQR A;  3U2S C;  1CQV A;  4BKS D;  2NMQ A;  2K3U A;  2ZPY A;  2N9X A;  4NAM A;  1VLB A;  3NOB A;  1AWD A;  1PGX A;  1L7Y A;  4XWW A;  3JSV A;  2NBU A;  3AE6 B;  3TMP B;  2JYT A;  2M1M A;  5J17 A;  3CMM B;  2Y3A A;  5D7G A;  4CQN A;  2WXJ A;  4WJN A;  3LB8 C;  2BVC A;  4J6I A;  3KUD B;  4BAX A;  4AS1 A;  2H89 B;  4LDT B;  1SSN A;  3A33 B;  2C60 A;  5IOI A;  2ZW1 A;  4IWO A;  2C7N B;  2GRI A;  1XLN A;  4REZ A;  2LVQ A;  3OLM D;  1VZ7 A;  4C7Z A;  3C0R B;  4ICV A;  1SGH A;  1OQQ A;  1V5T A;  2QSD A;  2UU7 A;  2LGS A;  4NJ7 A;  3RNE C;  1E6E B;  3DVG X;  2UWQ A;  3X23 A;  1D6E C;  4AQ7 A;  1V80 A;  1J19 A;  4HDO A;  4WQM A;  1KLU D;  4HK2 A;  2LGD A;  1M4V A;  3PZD A;  2RR9 A;  3A9K A;  5MPO A;  3NVZ A;  3PPA A;  2PEA A;  2IY0 B;  4ZOH C;  3K9O B;  4FUL A;  5BYR A;  1LO5 D;  3SR6 A;  3AN1 A;  5JXV A;  1WM3 A;  3EC8 A;  5AZF A;  4I6P A;  2WDV B;  4K81 A;  3R8B A;  2ACZ B;  3S2A A;  4RM9 A;  5L83 A;  4XZ4 A;  4WAF A;  2I38 A;  4W9F A;  3MHS D;  3I57 A;  4P16 A;  3ZNZ B;  3ZXV A;  2GLS A;  3KUC B;  4KGT A;  3A4R A;  1GG3 A;  4KZC A;  1MG4 A;  3PRZ A;  4JE3 B;  4A3P A;  4BFR A;  2BYT A;  2TSS A;  3NZ3 A;  3CSF A;  3DBL B;  2KLC A;  1XLO A;  3I63 C;  3HVD A;  2BYF A;  3SFD B;  1F2R I;  5J2R A;  4EOY A;  3R7R A;  1WXS A;  3U7Z A;  1I4X A;  2W9N A;  1QZE A;  1FXT B;  3DPD A;  4C4V B;  5C23 A;  4P1C C;  4S17 A;  4HRS A;  4NJ6 A;  4H2A A;  1VR9 A;  3RYT A;  4BVU C;  1EM7 A;  1FRR A;  3D32 A;  2LUE A;  1TKG A;  3KWV A;  3GS2 A;  4HLE A;  1XLP A;  3K9P B;  1S1Q B;  3GZN I;  4KIK B;  1L5P A;  4WQO B;  1ZUD 2;  3BVG A;  3RMK C;  3CIR B;  1R4M B;  5EDS A;  2AL6 A;  5HI1 A;  1EF1 A;  4WJP A;  3CF6 E;  4ARI A;  4K1R B;  1T3Q A;  1HE8 A;  2L0T A;  4ITK A;  2LUM A;  3L16 A;  4KX6 B;  4P7I A;  4FAD A;  1UGJ A;  3HM6 X;  4HWI B;  2GBN A;  4WAA A;  2QIL A;  2IBI B;  4G11 A;  3IT4 B;  3B9J A;  4KGS A;  2MCN B;  1J0G A;  1XT9 B;  3AV8 A;  2M0A A;  2D11 A;  2WHI A;  3VTV A;  1T0R C;  5D2M B;  3NRZ A;  3IT6 B;  3QA8 A;  4ZHP A;  5JHB A;  1K51 A;  1JW9 D;  4DHJ D;  4OVV A;  3AUL A;  5HHD G;  3RI7 C;  3N1Z C;  4JWU C;  1WYW B;  3RNF C;  3DWG C;  3Q3J A;  1J7B A;  4HCP B;  2I1K A;  4JWS C;  3BYT B;  3EA6 A;  1E5W A;  4XDD A;  2BKR B;  4PK1 A;  2LGY A;  1A5R A;  4C4V A;  1E7V A;  4OHJ A;  4ZRQ A;  1IYF A;  3B1L X;  4LNF A;  2BS2 B;  3PSE B;  2BB5 A;  2MBO A;  2MSE D;  2H88 B;  1WJ6 A;  3TEY A;  1NEK B;  1I4R A;  3Q8C A;  1KOT A;  1I4Q A;  2J53 A;  3EHV A;  3DVN V;  3EFU A;  3Q8B A;  1OEY J;  2V3S A;  3RN9 C;  2RDH A;  1H8C A;  4HXD A;  3N3K B;  3NZU A;  5BMG A;  2LHE A;  4M0W B;  2LWP A;  1FXA A;  3FKY A;  2FE8 A;  3VUW A;  2Z8L A;  4AUQ C;  3FIL A;  1BXT A;  3NS8 A;  3BK2 A;  2WX0 A;  4HEA 1;  1E7P B;  2FCS A;  2ICI A;  3V6E B;  2WXM A;  2K9X A;  1WMH B;  5J18 A;  1WY8 A;  1QF6 A;  2FCN A;  2PPH A;  2FUG 1;  2VH2 A;  2L3Z A;  2WLB A;  1QLB B;  3VRB B;  2LXA A;  4MAC A;  3NJT A;  2ON8 A;  1FMA D;  4FN2 A;  5JHA A;  2NPT B;  2AQ1 B;  4DXG A;  2KX3 A;  4R3D A;  1RLF A;  2M17 A;  4DWF A;  5LXI B;  2ZCC A;  2HTM E;  3DQV A;  2O2V B;  4EEW A;  1WGD A;  3WAO A;  5I4D A;  2BWE S;  1JRU A;  3NUH B;  4RGT A;  2BKF A;  4IWQ A;  1STE A;  2WXO A;  3GZN B;  3VAW A;  2IGG A;  1V9J A;  2L76 A;  1C76 A;  4B0M A;  4FJV B;  2L32 A;  1HTO A;  4C80 A;  3N20 C;  1VDV A;  3AE1 B;  2BF8 B;  1IGC A;  2WXG A;  4WWP A;  2Y5B B;  3Q3M C;  2EMT A;  1XF5 L;  2WYQ A;  2JWZ A;  5C3J B;  2NS5 A;  3DHH C;  4Q2J A;  4M8M A;  4BOS C;  2KDB A;  4RFB A;  1Q5W B;  3KH0 A;  3W2D A;  2ZCB A;  2BGF A;  2KWU B;  3T8M A;  1H4R A;  2KZR A;  2LJI A;  4MGY E;  2N1W A;  1HXY D;  1CZP A;  3OAW A;  1BUI C;  3ZUN A;  3AB5 A;  1UF0 A;  1JAL A;  5AZH A;  1WXA A;  2VZK D;  3DVG Y;  4AJY B;  4BKS A;  5C2T B;  4M00 A;  2EKE C;  4HDQ A;  4BKG A;  1TKY A;  3L08 A;  2MW5 A;  3AEG B;  3RUI B;  3W1Y A;  3P1M A;  1UWX A;  2O2V A;  4EZL A;  2C5L C;  1J8C A;  4DXF A;  1GAQ B;  2DAJ A;  1V1P A;  2NR2 A;  4FXC A;  4B0E A;  4B95 A;  1FPY A;  3E56 A;  3E9S A;  2WXN A;  1RFK A;  1WE7 A;  2K6D B;  5G55 A;  1YN4 A;  2KN4 A;  2M8S A;  1TTN A;  5IO9 A;  2I2Y A;  1XQQ A;  4N6E B;  4GIV A;  2W55 A;  1NYR A;  2BWF A;  3B2G A;  2MHJ A;  1YX6 B;  5AUI A;  4CO7 A;  2AQ3 B;  2GBR A;  2L00 B;  2MH7 A;  4MH0 E;  2N9L A;  4NAW B;  2KAJ A;  1I35 A;  4FA6 A;  3KWL A;  3H6N A;  2KOX A;  3UIP B;  1Q0W B;  3QQ8 B;  4E74 A;  1XO3 A;  1MHH E;  1U4A A;  3MTN B;  3A9J A;  3URY A;  2KMC A;  2N7E A;  2QMT A;  1EU3 A;  2G3Q B;  4RMA A;  2IO1 B;  4GDK B;  2XN9 C;  1SIJ A;  4K7S A;  2V1Y A;  1K8R B;  1ZW7 A;  2M4N A;  4J3O D;  3VH4 B;  4P1B C;  1PFD A;  3MHZ A;  3Q3N C;  5T8I A;  3U52 E;  2CR5 A;  4E3C A;  3AI5 A;  1FD6 A;  1ROE A;  2ONQ A;  1GB1 A;  3Q69 A;  1ZE3 D;  2DEN B;  4DDI D;  2K8C A; 
#chains in the Genus database with same CATH homology
 3SDL C;  1F9J A;  1V80 A;  1UBI A;  4HVB A;  2AL3 A;  1J19 A;  2K8B A;  2NCN A;  1WXM A;  2VRR B;  4HDO A;  1P1A A;  3JSV B;  4MJS A;  3RCZ A;  2KD0 A;  4HK2 A;  3ZNH B;  2LGD A;  1WI0 A;  2JVC A;  3A9J B;  3OJ3 A;  4IW0 A;  5D6J B;  2EMS A;  4FHK A;  4ANX A;  2MLB A;  4NQK E;  3ONS A;  3PZD A;  2RR9 A;  3A9K A;  5LXH A;  4ICU A;  3PLV A;  2CHZ A;  3PPA A;  1LXD A;  2PEA A;  4OVU A;  4TV3 A;  4YL8 A;  5TR5 A;  2HJ8 A;  2IY0 B;  3UIO B;  1BT0 A;  3K9O B;  3DCG A;  4FUL A;  3DBH I;  3PT2 B;  1WJN A;  3VDZ A;  5JZE B;  4PYU A;  4IM0 A;  1WM3 A;  3EC8 A;  5AZF A;  4I6P A;  2LZ6 A;  4N9F 4;  2KTF A;  1OTR B;  4K7W A;  4K81 A;  2LJ5 A;  4F1S A;  3S2A A;  2NBW B;  4RM9 A;  1UD7 A;  5L83 A;  4XZ4 A;  3P2B A;  2L05 A;  2KC2 A;  1WJ4 A;  2KWC A;  5FR6 A;  1GC7 A;  2HD5 B;  4W9F A;  2JZZ A;  2D3G A;  3MHS D;  3T9L A;  2LD9 A;  5D94 A;  5CHV C;  5LLI A;  3ZNZ B;  3KUC B;  5DCN A;  3ZO5 B;  2MP2 A;  1V6E A;  3A4R A;  3PRP B;  3ZTD A;  1SIF A;  3ZLZ A;  3PRM B;  5KHO A;  4KIK A;  2R2O A;  1GG3 A;  4KZC A;  4MGZ E;  2FNJ B;  3PLU A;  4TKN A;  3PRZ A;  4A3P A;  4BFR A;  3VTW A;  3ZIM A;  2PJH A;  1EF5 A;  4MJS B;  2D10 A;  4GGQ A;  4GDK A;  3CSF A;  4X57 B;  2KLC A;  3U8Z A;  4PYZ A;  5JH5 C;  4BKT A;  2J0M A;  2DZI A;  3L0W B;  2O6V A;  4GDL A;  3V62 A;  2BYF A;  3WAL A;  3A9K B;  3WAN A;  4AP4 C;  5J2R A;  2V4L A;  4EOY A;  3R7R A;  3H7P A;  3KVF B;  1WFY A;  1NDD A;  1WXS A;  4W9K A;  3RZF A;  2W9N A;  1QZE A;  1FXT B;  4EFO A;  4E71 A;  5IA7 A;  4XC2 A;  1V5O A;  4IC7 B;  3BY4 B;  3HM3 A;  3DPD A;  4W9H A;  3V60 A;  5AZG A;  5C23 A;  3LDZ E;  2NVU I;  4NJ6 A;  3RYT A;  3ZKJ C;  1RRB A;  4LJO B;  1V49 A;  4BVU C;  1ZGU B;  2FUH B;  2KJH B;  4WWO A;  2L8J A;  2DX5 B;  3D32 A;  1S3S G;  3SD5 A;  2LUE A;  4ANW A;  4W9J A;  2FIF A;  2MP2 B;  2FCM A;  4PS8 A;  4HLE A;  3UQB A;  1C1Y B;  4LCD E;  2ZNV B;  1S1Q B;  3GZN I;  3K9P B;  4KIK B;  4WWN A;  2GBK A;  1WX9 A;  4WQO B;  4DDG D;  1PQS A;  4W9E A;  1E8Y A;  2G4S A;  2K6Q A;  1OEY A;  5EDS A;  2AL6 A;  1WR1 A;  2G4D B;  1WZ3 A;  1EF1 A;  3NHE B;  4WJP A;  1C3T A;  3CF6 E;  3QHT A;  2DAF A;  4G3X B;  2GBM A;  2YLM A;  4K1R B;  2MBE A;  2MRP A;  4WJO A;  1KLV A;  3UGB B;  1HE8 A;  2L0T A;  2LI5 A;  2N9P C;  2O6V B;  2ZEQ A;  3L16 A;  4GDL B;  4GN1 A;  1CMX B;  4HPM B;  4P7I A;  4FAD A;  2ZVN A;  3GOE A;  3HM6 X;  4LDT D;  4HWI B;  4BOZ B;  2GBN A;  4WAA A;  3H7P B;  5BO4 B;  2JY6 A;  4KSK C;  4EUT A;  2IBI B;  2O6V D;  3V61 A;  3JYU A;  4G11 A;  3UQA A;  3R66 C;  3QAQ A;  2JRH A;  1M94 A;  2DYO A;  3WA0 A;  4HJK A;  4W9G A;  3ML8 A;  2BYV E;  4LJP B;  3IFW B;  2MCN B;  2I1J A;  4II3 B;  4CHK A;  4TQ0 A;  1TGZ B;  1J0G A;  1XT9 B;  3L17 A;  2D11 A;  3VTV A;  2B3A A;  5D2M B;  2IO2 B;  3QWZ B;  3I3T B;  2RGF A;  1EUV B;  2DYB A;  4A20 A;  3QA8 A;  4DHJ B;  3DOW A;  4FLH A;  1ZKH A;  2KO3 A;  5JHB A;  2N4F A;  3SU8 X;  3U7D A;  1LQB A;  4DHJ D;  4G0N B;  4OVV A;  3AUL A;  2WWZ A;  4M8N A;  1WX8 A;  2KX0 A;  2DZJ A;  2DZK A;  4A3O A;  2AWT A;  3VTU A;  2ASQ A;  1WYW B;  3WAM A;  1V81 A;  3Q3J A;  3ZVV A;  3M62 B;  4HCP B;  1WZ0 A;  4GU2 A;  4TQ1 A;  2I1K A;  1EO6 A;  2LRU A;  1UZX B;  1E5W A;  5E6N A;  2BYE A;  3PTF C;  2BKR B;  2LGY A;  1A5R A;  1E7V A;  2K1F A;  3B1L X;  1IYF A;  4URK A;  3PSE B;  1YIW A;  3IBE A;  4PS7 A;  3QAR A;  1WMH A;  2MBO A;  2ZZP B;  2MSE D;  4MSQ B;  5IAA C;  1WJ6 A;  2KNB A;  1Y8R C;  3APF A;  5DPS A;  3LJ3 A;  4MSM B;  4DHZ B;  2KJ6 A;  2REX A;  3QCA A;  1KOT A;  2ZPN A;  4DXA B;  4W9C A;  3IG3 A;  3HK0 A;  3EHV A;  3DVN V;  2Z59 B;  1T0Y A;  3X0W A;  2IO3 B;  2GOW A;  4MEM A;  3TL5 A;  3EFU A;  4MDK E;  1OEY J;  2V3S A;  2AEH A;  2ZVO A;  1OQY A;  1WJU A;  3B08 A;  3DDC B;  1H8C A;  4HXD A;  5DPT A;  3L13 A;  1LFD A;  2WDT B;  3H7S A;  3M63 B;  3N3K B;  3NZU A;  1GC6 A;  1RAX A;  1WIA A;  2CKH B;  2NPT A;  2IZV B;  4JLC A;  2J0K A;  4M0W B;  3NY5 A;  4HPL B;  2LWP A;  2MA9 B;  3UIN B;  2L7R A;  3IVF A;  4W9L A;  2IYD B;  1IP9 A;  2WX1 A;  2XK5 A;  1GNU A;  2N7D A;  2N1V A;  4NNJ B;  3M3J A;  3SHQ A;  3VUW A;  4AUQ C;  2MX2 A;  2GBJ A;  3KYD D;  1XD3 B;  3NS8 A;  4GMV A;  2WX0 A;  2DYM A;  4IWP A;  1GUA B;  2FCS A;  5DPW A;  2J7Q B;  2C9W B;  1L2N A;  4EZJ A;  3V6E B;  2OOB B;  4KVG B;  1WMH B;  3OJ4 B;  4BBN C;  3ZRC A;  5J18 A;  1WY8 A;  1YJ1 A;  3H1U A;  2FCN A;  2PPH A;  4GXB A;  2Z0D B;  4FBJ B;  1NI2 A;  2CHX A;  3TBL D;  4IUM B;  3MJW A;  3TJP A;  2JXX A;  3ENE A;  3PHW B;  2L3Z A;  3QK0 A;  3N32 A;  2FCQ A;  2L0F A;  2LXA A;  2A5U A;  1UEL A;  3N30 A;  3VUX A;  2K8H A;  2MBQ A;  2KXJ A;  2KDI A;  1AAR A;  1E90 A;  2M0X A;  1Z5S B;  1Q1O A;  4RM8 A;  1KJT A;  2KJR A;  2KDF B;  4FN2 A;  4II2 B;  2NPT B;  5CHW A;  3PRE A;  4DBG A;  3VXW A;  5JHA A;  3QC8 B;  2KX3 A;  5E6O A;  2RPQ A;  1RLF A;  2C7H A;  1WGY A;  2M17 A;  4DWF A;  5LXI B;  4FJZ A;  2JZ3 B;  2DZM A;  2ZCC A;  3DQV A;  2O2V B;  4EEW A;  2XK5 B;  2LXC A;  1WGD A;  1WF9 A;  3WAO A;  4K7U A;  3Q3F A;  2KDE B;  2BWE S;  1JRU A;  2KQS A;  2BKF A;  4IWQ A;  4NPN A;  2KK8 A;  4MM3 A;  4DK5 A;  1WM2 A;  3KUZ A;  4KDI C;  2KMA A;  5CTR C;  3UF8 A;  3PS6 A;  3W1S C;  2GMI C;  3VAW A;  4B9K A;  2D07 B;  3AU4 A;  4FHJ A;  3WAP A;  1V9J A;  1WR6 E;  2KQ7 A;  2L76 A;  2MWS B;  2MBB B;  2FAZ A;  2MBH A;  3JW0 X;  3L10 B;  4XX5 A;  5E6P A;  4FJV B;  5AEK B;  4EKU A;  1IPG A;  3AXC A;  3V6C B;  1VD2 A;  3A1Q A;  2KFJ A;  4ZYN A;  1UGM A;  2BF8 B;  1I42 A;  5GMV A;  3VHT C;  4IM2 A;  4WWP A;  2OJR A;  3PGE A;  4KSL C;  2ZJD A;  3ECI A;  2Y5B B;  3R7Q A;  2EMT A;  3RUL A;  2WYQ A;  2JWZ A;  3M95 A;  3QJZ A;  2RD0 A;  2NBV B;  4IG7 B;  2NS5 A;  1WGR A;  3VFK A;  1OGW A;  2KN5 A;  1P3Q U;  2LRW A;  3QIJ A;  3RD2 A;  4B6W A;  4CYE A;  1E7U A;  2DHZ A;  1V86 A;  3ZDT A;  4M8M A;  4BOS C;  1P0R A;  1YQB A;  5C1Z A;  2KDB A;  3BIN A;  1Q5W B;  3KH0 A;  3PHX B;  2ZCB A;  3KW5 B;  2J0J A;  2BGF A;  2KWU B;  3ML9 A;  3PVL A;  4I6L B;  3VUY A;  3T8M A;  1H4R A;  1MG8 A;  2C7M B;  1GJZ A;  4MEL A;  2JF5 A;  2KZR A;  4MGY E;  2K25 A;  3IHP C;  4KV2 A;  2N1W A;  3CST A;  3QX1 A;  1V2Y A;  2XEW A;  4JQW C;  2KWV B;  3OAW A;  4TUU A;  1WE6 A;  2RSU A;  4JGH B;  4W9I A;  3ZUN A;  4ANV A;  2XBB C;  4GB9 A;  5AZH A;  2FID A;  3NZS A;  1WXA A;  4DHZ E;  3DVG Y;  5DPR A;  4AJY B;  4BKS A;  3A4S C;  3DBL I;  4NAW A;  2KFK A;  3W1S A;  1YD8 U;  3PV1 A;  2JPH A;  2EKE C;  3A1Q B;  4HDQ A;  3ZNG C;  4BKG A;  3HIZ A;  2JT4 B;  2LVO A;  2HTH A;  3L08 A;  1P98 A;  2MW5 A;  1D3Z A;  4PS3 A;  2KHW B;  1WRD B;  1E8W A;  3RUI B;  3W1Y A;  3ZRF A;  2QHO A;  4AJW A;  2O2V A;  4EZL A;  2C5L C;  1J8C A;  5G2N A;  2CHW A;  3AU5 A;  3APC A;  4ASW C;  1R4N I;  2DAJ A;  2K39 A;  3ZNI D;  2NR2 A;  3R3M A;  4ZRK A;  4NY0 A;  4I6N B;  2KVR A;  4B95 A;  1G6J A;  2HE7 A;  2IO0 B;  2LGX A;  5HKH A;  4ANU A;  2KTR A;  2PE6 B;  3HHM A;  4ZRI A;  2CS4 A;  1KM7 A;  3O65 B;  1WE7 A;  1UBQ A;  2IY1 B;  2K6D B;  3APD A;  1WGH A;  4BBN F;  5G55 A;  3JVZ X;  4NQL B;  1VCB A;  2G45 B;  4W9D A;  2M8S A;  1TTN A;  4HCN B;  1YX5 B;  2LVP A;  1XQQ A;  2PE9 A;  4JL9 A;  2MQJ A;  2KC1 A;  4MGK E;  4GIV A;  2KAN A;  1WXV A;  3B0A A;  3ZTC A;  2BPS A;  5KHQ A;  2BWF A;  1R4M I;  2R2Q A;  4WJQ A;  4AWJ A;  2AYO B;  4F8C B;  1YX6 B;  4JIO U;  2YVC A;  3RZW C;  4F7Z A;  3ZW3 A;  4CO7 A;  3TIX A;  2GBR A;  4GSW A;  4G50 A;  2L00 B;  4FJY A;  4MH0 E;  4NAW B;  5CX3 A;  2KFK B;  5CHF A;  4ZRJ A;  3ZDM C;  1X1M A;  2UYZ B;  1UH6 A;  4BKS D;  1I35 A;  2A4Z A;  2ZPY A;  4FA6 A;  3DBR I;  3H6N A;  2JUO A;  2N9X A;  2JRI B;  2KOX A;  3DBS A;  3NOB A;  3UIP B;  1Q0W B;  3QQ8 B;  4E74 A;  1L7Y A;  4ZDV A;  3RT3 B;  3JSV A;  2NBU A;  1U4A A;  3MTN B;  4KDL B;  3TMP B;  2M1M A;  5J17 A;  3A9J A;  3WIM A;  3CMM B;  1P9D U;  5D7G A;  2KMC A;  3TCA A;  2N7E A;  4AOF A;  1SE9 A;  2CU1 A;  4WJN A;  1ISN A;  1RFA A;  2G3Q B;  4RMA A;  2IO1 B;  4GDK B;  2KTR B;  1LM8 B;  3KUD B;  4J6I A;  3VVW B;  4K7S A;  1NBF C;  1TBE A;  2V1Y A;  1K8R B;  1ZW7 A;  1WGG A;  4LDT B;  1WX7 A;  2M4N A;  3ALB A;  1E8X A;  3A33 B;  3VH4 B;  2C60 A;  2KLG A;  1WH3 A;  4KZ0 A;  4MGI E;  2ZNV C;  3KYC D;  4IWO A;  2C7N B;  2LAS A;  3VQI A;  2LVQ A;  3OLM D;  3C0R B;  4ICV A;  2CR5 A;  2N9E B;  4E3C A;  1SGH A;  2Z0E B;  1V5T A;  3AI5 A;  4GOC A;  3VH3 B;  3U30 A;  5L95 C;  4NJ7 A;  3L54 A;  3H9D A;  2DEN B;  4DDI D;  2K8C A;  3DVG X;  2UWQ A;  1TZ1 A;  1E8Z A;  2KKC A;  3DVN U;  4IM3 A;  3X23 A;  2D2Q A;  3EEC A;  1Z2M A;  4EZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...