2Z0EB

The crystal structure of human atg4b- lc3(1-124) complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease ATG4B
publication title The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/structural protein
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2z0eB00
3R66C 5G55A 4I6NB 2KWUB 4MDKE 2ZZPB 2JVCA 4G0NB 3TBLD 1S3SG 3R7QA 3ZUNA 4LJPB 5GMVA 4BKGA 2LGYA 1E8XA 1S1QB 4NJ7A 5KHQA 2WX0A 5AZGA 4ANUA 1GC7A 3PRZA 1WX9A 4IWQA 4YL8A 3HM6X 3RULA 3SHQA 5CHFA 1CMXB 2MA9B 4IUMB 2G45B 2MX2A 4GDKB 2AL3A 1TTNA 4N9F4 1UBIA 4AWJA 2PE6B 3PLVA 4RM8A 4GDKA 3IFWB 1WR6E 2GBRA 5TR5A 4ZDVA 4GOCA 3NOBA 4G3XB 2MSED 2KWVB 2R2QA 3APDA 1G6JA 2G4DB 1YIWA 2HJ8A 5BO4B 3VH3B 2LD9A 4AUQC 1NBFC 2JF5A 1VD2A 4ICVA 5CTRC 1WGHA 3H7SA 3VH4B 2L0FA 2LASA 4EZLA 3L54A 2DX5B 2LGDA 2C7MB 2PJHA 4URKA 2ZCBA 3AU4A 2J0JA 4W9JA 3V60A 3ZNID 2C7NB 2DZIA 4HXDA 2G3QB 2L3ZA 3CSTA 2J7QB 1SE9A 4HPLB 2JRHA 2A4ZA 1WIAA 2GBJA 4KDIC 2AYOB 4DBGA 2RD0A 2LVPA 5KHOA 1WXMA 2K1FA 2V1YA 2JY6A 4K7WA 4MH0E 3V6CB 5AZFA 3ZDTA 1WZ0A 2NR2A 3JVZX 4BVUC 2KO3A 1SIFA 4W9KA 1RAXA 3DBSA 2V4LA 4LDTD 2MBHA 3JW0X 2I1KA 3M63B 2W9NA 1V49A 1EO6A 2M4NA 1Z5SB 2KFKB 2FIFA 2O6VD 4GDLB 2KJRA 5LLIA 2QHOA 5FR6A 1SGHA 4KSKC 5IAAC 2KWCA 2WX1A 3AULA 2KFKA 3N3KB 3WAMA 4GDLA 4NAWA 1T0YA 4BBNF 4HVBA 4KDLB 2DYOA 5DCNA 3X0WA 4BBNC 2GBMA 2LWPA 4MSQB 1BT0A 4IG7B 3H7PB 4AJWA 2AL6A 4IM0A 3ML9A 4E3CA 2KDFB 2YLMA 2BF8B 3EECA 3L16A 3VAWA 1NI2A 1OGWA 2C5LC 3UQAA 3N30A 4J6IA 4K81A 1ZKHA 3H7PA 4GMVA 4ICUA 4JIOU 3VXWA 5G2NA 4W9DA 4TQ1A 4NQLB 4NJ6A 2LRWA 2GBKA 2MCNB 4NY0A 4ANWA 3DQVA 1V5OA 2ZVOA 1U4AA 4CYEA 2G4SA 2ZVNA 2KZRA 2RR9A 2DYBA 1WX7A 1WR1A 3T9LA 2L76A 2K6QA 1ZGUB 2Z0DB 3DVNV 4LCDE 1LM8B 2N9PC 1WFYA 2L05A 3VTUA 2KNBA 3VVWB 3A4SC 2XBBC 3VTWA 1WI0A 2RPQA 2RSUA 4F7ZA 5D2MB 1KJTA 2KC2A 1WE7A 2K39A 3ZDMC 2FNJB 1E8YA 3PS6A 4IM3A 2NCNA 3PRPB 2HD5B 2GOWA 2KDIA 2ZNVB 2JRIB 5J17A 4F8CB 4FHJA 3PHWB 3QAQA 2KHWB 3KYDD 2KMCA 2BWES 3U7DA 4MEMA 3VTVA 2KTFA 2KOXA 4M8NA 2L00B 1WJUA 3ZTDA 4BFRA 3DBRI 3DOWA 4PS7A 4FJYA 3V62A 1PQSA 4EKUA 4BKSA 4G11A 3L13A 2GBNA 2KDEB 4PS3A 3UGBB 3W1SC 3I3TB 2K25A 1RRBA 2K8HA 4IM2A 4KSLC 1GJZA 1NDDA 1UBQA 4E71A 4BKSD 1JRUA 3HIZA 4JL9A 1UELA 1WGGA 3RD2A 1WE6A 2M8SA 1LQBA 2JUOA 3GOEA 1AARA 3CSFA 3AXCA 1V80A 2D10A 1H4RA 3M3JA 4B6WA 4GIVA 2UYZB 3Q3JA 5LXHA 3TJPA 2LXCA 2O2VB 2DAFA 4BKTA 3TCAA 3ZW3A 5E6OA 4PYUA 5L83A 4KZ0A 5D94A 1L2NA 3MJWA 2ZEQA 4WQOB 2EMSA 3WA0A 3QA8A 4F1SA 4M8MA 4A3PA 3PTFC 2M1MA 3GZNI 2XEWA 2MBBB 2EMTA 3KW5B 2LUEA 2KFJA 3APFA 4MELA 3PHXB 5CHVC 3ZNGC 3ZVVA 3HM3A 2LJ5A 1J8CA 4P7IA 3P2BA 4W9EA 4MGZE 3MTNB 2CS4A 2JPHA 3A1QB 3QCAA 3WIMA 4FADA 5AEKB 3B08A 2BKFA 4MGKE 3DVGY 5HKHA 1Q0WB 4MM3A 4EOYA 2IY1B 2MP2B 2JWZA 5E6PA 3KUZA 2ZPYA 1QZEA 3A1QA 3QK0A 3ZO5B 4EZKA 3WAPA 3QQ8B 2ZJDA 3IVFA 2IBIB 3PLUA 2MP2A 4TKNA 1EF1A 4K7SA 4AOFA 4PS8A 1OQYA 4HDQA 5CHWA 1RFAA 3DBLI 2C7HA 1F9JA 3L10B 3WAOA 3DPDA 1YX5B 2YVCA 2KKCA 4ZRKA 2CR5A 2N4FA 4W9GA 1Q1OA 3JSVB 4GSWA 4G50A 4IC7B 4GU2A 1KOTA 2JT4B 4MJSB 3TMPB 2CKHB 1GUAB 3MHSD 4ANXA 1RLFA 3NHEB 3HK0A 2M0XA 4TV3A 3RZWC 4CHKA 3JSVA 2J0KA 3D32A 1WJ4A 2NBWB 2KX0A 4DDGD 2ZPNA 2J0MA 1UZXB 5J2RA 4WAAA 1YD8U 4FHKA 4EZJA 2FAZA 2REXA 2JZ3B 3O65B 3CMMB 4JLCA 1GG3A 4MSMB 5C23A 1WXAA 2KLGA 1E7UA 3KVFB 4HK2A 3A9JB 2D3GA 2PEAA 2UWQA 4W9CA 3DCGA 4FJVB 2N7DA 2DZKA 2WWZA 1HE8A 3B0AA 4NQKE 2OOBB 3TL5A 4AJYB 3A9JA 1R4MI 1WM3A 1UH6A 3LJ3A 3QX1A 4OVUA 1WJ6A 3PGEA 1OEYJ 4WJOA 3U30A 2KTRB 3ZLZA 3ML8A 4W9FA 2DENB 5DPTA 3KH0A 4ASWC 2NBUA 3QWZB 2MRPA 2V3SA 1GNUA 3H9DA 2FCNA 4XZ4A 4JQWC 3ECIA 3UF8A 1EUVB 1WM2A 4HCNB 4WJNA 3ALBA 1WGDA 1X1MA 2LVOA 1WY8A 3K9OB 4XX5A 4A3OA 1UD7A 4PYZA 4HWIB 3DVNU 2IY0B 4BOSC 1EF5A 3R3MA 2C60A 4DWFA 3PSEB 2I1JA 5IA7A 3R7RA 3VFKA 2KMAA 4DHJB 2KJ6A 3PREA 4TUUA 1I35A 1VCBA 4IW0A 2IZVB 2AEHA 4X57B 2IO0B 2KK8A 3EHVA 4W9LA 3ZIMA 2MBEA 2L0TA 3DBHI 3UQBA 4WJPA 3ZRFA 3M62B 4I6LB 1V6EA 4KV2A 2ZCCA 1J19A 3RCZA 4ANVA 2IO2B 2MW5A 2KC1A 3RYTA 2GMIC 1IYFA 1IPGA 1V2YA 3CF6E 4II3B 5LXIB 4MGYE 2K8CA 2B3AA 3H1UA 4W9IA 3WANA 4DXAB 2DZJA 1TGZB 2D07B 2IYDB 2JXXA 2LVQA 1Z2MA 3NS8A 4KIKB 3IHPC 5D6JB 1WYWB 2AWTA 3OAWA 1TBEA 2BYVE 5JZEB 4DHZE 2IO1B 3H6NA 2BYFA 2FCQA 2N9XA 4WWOA 3ZRCA 2C9WB 2CHWA 3BINA 4ZYNA 3N32A 3L17A 4KIKA 1ISNA 3L08A 4KZCA 3HHMA 4WJQA 2BYEA 5L95C 3IG3A 3PRMB 1Q5WB 3QC8B 5JHBA 1P3QU 3S2AA 3SD5A 2O2VA 4LJOB 2L8JA 4BOZB 3EFUA 1WGYA 2N9EB 1J0GA 2FUHB 1E8ZA 2MQJA 2LXAA 3UIPB 1WGRA 1KM7A 3NZUA 2LI5A 1L7YA 1P0RA 2HTHA 2N1VA 3OJ4B 1V86A 2RGFA 3RUIB 2NPTB 3ZNZB 4CO7A 3DDCB 2KJHB 1LXDA 3AU5A 3TIXA 2N1WA 2DYMA 3VHTC 1P1AA 3KUCB 1A5RA 4WWPA 2NPTA 4I6PA 4II2B 1XD3B 2N7EA 4NPNA 3JYUA 2KLCA 1P98A 2KN5A 1Y8RC 3X23A 3M95A 2MBOA 2IO3B 4GN1A 4ZRIA 3BY4B 4GXBA 2Z0EB 3QJZA 3W1YA 2D11A 4DHZB 4HLEA 3VUXA 2EKEC 1C1YB 2KANA 2K8BA 3NZSA 4FA6A 1V5TA 2R2OA 5D7GA 2M17A 4LDTB 2MLBA 1V9JA 3KYCD 4GB9A 3W1SA 3PVLA 4K7UA 1XQQA 4WWNA 2O6VB 3VUYA 1WX8A 3T8MA 3L0WB 3ZNHB 4MJSA 2KXJA 1V81A 2ASQA 3K9PB 3Q3FA 4GGQA 2PE9A 4FN2A 4DK5A 1YJ1A 3A4RA 1UGMA 2LZ6A 3RT3B 2O6VA 3ENEA 4JGHB 4EEWA 4W9HA 1WF9A 2DHZA 4K1RB 2ZNVC 1E5WA 2WDTB 5JH5C 2BGFA 2FCSA 1YX6B 3OJ3A 2KX3A 5EDSA 4NAWB 5C1ZA 2KQ7A 1FXTB 3QHTA 2JZZA 3ZKJC 1KLVA 3VUWA 4IWOA 2PPHA 1GC6A 4XC2A 2FCMA 2L7RA 4RM9A 1E90A 1WRDB 2BPSA 3RZFA 3ZTCA 4FULA 2Z59B 5DPRA 1WH3A 2K6DB 1ZW7A 1P9DU 5CX3A 2KDBA 4FLHA 3V6EB 3PZDA 1WJNA 2A5UA 1MG8A 1WZ3A 5J18A 4DDID 2KTRA 4TQ0A 1WMHB 2Y5BB 4A20A 1K8RB 2HE7A 4FBJB 2XK5B 4B9KA 1IP9A 1R4NI 3QARA 3PPAA 3C0RB 5E6NA 3EC8A 4HDOA 4FJZA 1WMHA 3A9KB 1YQBA 2XK5A 3PV1A 4EFOA 2LGXA 2VRRB 3LDZE 2NS5A 1OEYA 3VQIA 2CHZA 3A9KA 4NNJB 2DZMA 2MWSB 4RMAA 1OTRB 5DPWA 2FIDA 4MGIE 2DAJA 2D2QA 3APCA 3IBEA 1WXSA 1LFDA 3SDLC 4AP4C 2BKRB 1TZ1A 3SU8X 1E8WA 2NBVB 4ZRJA 3U8ZA 4E74A 4DHJD 4KVGB 1I42A 4HJKA 1M94A 1E7VA 3DVGX 1WXVA 2MBQA 3AI5A 3NY5A 1XT9B 3B1LX 2CHXA 3V61A 3KUDB 3UINB 3VDZA 3A33B 3ONSA 3WALA 4HCPB 2BWFA 5JHAA 1C3TA 3OLMD 1H8CA 2LRUA 4HPMB 5AZHA 2KQSA 3QIJA 4OVVA 1D3ZA 2NVUI 2CU1A 2KVRA 4B95A 2OJRA 2WYQA 3PT2B 4IWPA 3UIOB 2KD0A 4EUTA 4M0WB 5DPSA
chains in the Genus database with same CATH superfamily
3R66C 3RNBC 2GB1A 5KHQA 2WX0A 4M0WA 1GC7A 2PTLA 1WX9A 3AN1A 4IWQA 1K50A 3RULA 5CHFA 3TEXA 4GDKB 2LHDA 2D3CA 4AWJA 1TKEA 3PLVA 4L23A 3NOBA 2DLBA 2KWVB 4N59A 1XLQA 3APDA 2G4DB 2LEKA 2HJ1A 2J53A 2C7MB 2ZCBA 3AU4A 2J0JA 2JX5A 2W3RA 2E6XA 2J7QB 1SE9A 4HPLB 2JRHA 2WDRB 1E10A 2LVPA 2K1FA 4K7WA 2JY6A 5AZFA 1PYWD 1ZXHA 4W9KA 3DBSA 3JW0X 3GP7A 2W9NA 3ZGZA 4BZAA 3TEWA 5LLIA 2QHOA 1DOYA 5FR6A 2JYTA 2WX1A 4KDLB 3X0WA 4BBNC 1VDVA 5BMGA 4IM0A 1FPYA 1WSPA 2D3BA 1NI2A 4W9DA 5D3DA 2GBKA 4NY0A 3DQVA 4H2AA 2RR9A 1WX7A 3AEBB 1C9FA 2L76A 3SR6A 4XE0A 2N9PC 3I9V1 2RDHA 3VVWB 4ARIA 2XBBC 2K39A 4PK1A 2NCNA 3DHIC 3PRPB 1B9RA 2LFIA 2KDIA 1I7HA 2Q5WD 4FHJA 4F8CB 4OZAA 1GPXA 2KHWB 1Y56A 2L00B 2XN9C 3DOWA 3MHZA 3V62A 2JSVX 4PS3A 1D6EC 1RRBA 4E71A 4BKSD 3AE1B 1N6ZA 3RD2A 3Q2AC 1UF0A 3TJPA 2LXCA 2O2VB 3T3OA 2MJDA 3MFGA 3P4QB 1QLBB 3R8BA 2OEDA 3MJWA 4WQOB 4USAA 1RWSA 2M1MA 1UNSA 4MELA 4MM3B 1WWTA 4W9EA 3MTNB 3QCAA 3WIMA 1SXTA 1TS3A 3SFDB 4EOYA 2MP2B 2ZPYA 3QK0A 2ZJDA 3PLUA 2PKOA 4PS8A 2LJIA 3WAOA 2FUG1 1SIJA 3GS2A 1Q1OA 3KQ4A 3JSVB 1KOTA 2CKHB 1N63A 3MHSD 4ANXA 4CHKA 1E6EB 1N60A 4DDGD 1YD8U 3RNEC 3O65B 3J9CA 4XDCA 1AN8A 5C23A 1GB1A 5D3IB 1NVID 3A9JB 2D3GA 4FJVB 4HROA 3BK1A 5H92C 3TL5A 4Q2JA 1HZ5A 2BS3B 1KLUD 2LMCA 3PGEA 3ZLZA 1T3QA 3QWZB 2MRPA 3ABVB 3W5VB 2V3SA 5BYSA 3EUB2 3ECIA 3UF8A 3Q8EA 1KFYB 1UD7A 4JX1C 2MEKA 2C60A 4IOIE 2I1JA 5IA7A 1ROEA 2KMAA 3PREA 2KYWA 4TUUA 4WIPA 1I35A 2JYEA 4ARCA 3ZIMA 1XEEA 4RNAA 4PT5A 2XNAC 3ZRFA 2R61A 1N61A 1NI3A 2J4XA 4ANVA 4C80A 2WXGA 3CF6E 2B3AA 3TSSA 2IYDB 2LVQA 3NS8A 2EELA 4KIKB 1Z2MA 1V1PB 1WYWB 2AWTA 3OAWA 1QOBA 3BVZA 2BYVE 3WCQA 4LTUA 3H6NA 2WLBA 4K3CA 3N32A 3L08A 3HHMA 3NZ3A 5AUKA 1MPEA 3IG3A 1Q5WB 4WURA 1BUIC 2KQ4X 1SE3A 3BVMA 3UIPB 1WGRA 1KM7A 2HTHA 1EWCA 1TS4A 4LNIA 2RGFA 2NPTB 2BS2B 2QCZA 3PZ8A 1F2RI 2N1WA 2DYMA 2W82A 1P1AA 4WWPA 4II2B 4NPNA 1L4DB 1P98A 2IO3B 4GN1A 1FNUA 4HLEA 3VUXA 1UWMA 2KANA 2K8BA 3NZSA 5D7GA 2M17A 4LDTB 5IP4D 1V9JA 3HRDD 3PVLA 1K51A 3VUYA 3L0WB 3Q3MC 3Q69A 1YJ1A 4JGHB 1N62A 3ZXVA 4K1RB 2V9HA 3DHHC 2KX3A 2WNMA 5EDSA 5C1ZA 2JZZA 1JQ4A 3GE8C 1C78A 3DBRB 2BPSA 4FULA 3KWVA 1I4HA 1WH3A 5EE9A 4ZYSA 1P9DU 2KDBA 3V6EB 4DDID 2HE7A 2XK5B 4C7YA 2Y3AA 4LNNA 4B0MA 1E0ZA 4HDOA 4HEA1 2NS5A 1SB3C 1J7BA 2BTEA 3VQIA 2CHZA 5BMHA 4NNJB 2DZMA 2FIDA 4MGIE 2D2QA 3APCA 4GLSC 3MC0B 5E6JA 4AP4C 1SJHD 3GZNB 1TZ1A 3DWMA 1E8WA 4ZRJA 1C4AA 5JXVA 4E74A 1N5WA 2PW9A 3W5UB 4DHJD 1M94A 1WXVA 2V4IB 1XT9B 1VJKA 3UINB 1CZPA 3ONSA 4HCPB 5JHAA 1H8CA 2DBYA 4ITKA 3QIJA 4OVVA 3ETRA 1D3ZA 4B95A 1PGBA 3PT2B 2G1EA 4IWPA 5DPSA 4I6NB 2KWUB 4MDKE 2ZZPB 4G0NB 3DBLB 1YJIA 3TBLD 3VRAB 3ZUNA 4LJPB 4BKGA 1E8XA 1S1QB 4WH4A 2WGSA 3AEAB 4YL8A 2MA9B 2G45B 2MX2A 1TTNA 1UBIA 1FM0D 5C2TB 1CJEA 2PE6B 2TSSA 3TUOA 2SAKA 2GBRA 4RGTA 4XYCA 4G3XB 2MSED 2OHFA 1YIWA 2HJ8A 3VH3B 2LD9A 1NBFC 2JF5A 1KRHA 5FK9C 4MACA 1QT9A 4EZLA 2DX5B 3FILA 2PJHA 4REZA 2A4ZA 3CWIA 3CIRB 2V1YA 3V6CB 2NR2A 4P16A 3RNCC 4BVUC 2INDC 3IT6B 5IKCM 1RAXA 2ZW0A 1WRIA 1F2RC 3BYTB 2MBHA 2WDQB 2I1KA 3NUHB 1P7FA 4DXGA 3AB5A 2KFKB 4GDLB 2M56B 4DXFA 2WDVB 1SGHA 3AULA 3WAMA 3NVZA 1T0YA 3AE9B 2LWPA 4MSQB 1BT0A 3H7PB 1XCQL 1IBXA 3B2GA 1TS5A 4AJWA 1TY2A 2WXKA 2KDFB 4C00A 3L16A 3VAWA 5EE1A 4GMVA 3I63C 5G2NA 4OW0A 3SEBA 3VR9B 2MCNB 1L0XB 1V5OA 1U4AA 1FD6A 2K6QA 1ZGUB 3VTUA 1YMHE 4WAFA 1WI0A 1KLGD 1M4VA 5D2MB 1WE7A 4KGRA 1E8YA 1QF6A 5MPOA 2JRIB 1JWBD 5J17A 3PHWB 3U7DA 4MEMA 2K9XA 4M8NA 2SEBD 4D2KA 3DBRI 4US9A 4BKSA 3W1SC 2KDEB 3UGBB 2K25A 4KSLC 1XXGA 2J42A 1FNWA 2GRIA 4ACFA 1LQBA 2JUOA 4B6WA 2D10A 1H4RA 3LXFA 4C7ZA 2WP9B 3MC9A 5LXHA 3HUIA 4PYUA 4WQMA 2ZEQA 3WA0A 2WU2B 3QA8A 1HXYD 1XLNA 1VZ8A 3PTFC 3NS1A 3GZNI 2MBBB 2EMTA 1L6VA 4YSZB 3KW5B 3FAHA 3PHXB 2NTSA 3HM3A 1SF0A 3AE8B 4MGZE 3AH7A 3LB8C 1JMLA 3B08A 2BKFA 4MGKE 5HKHA 2JWZA 5E6PA 3OG5A 4BAXA 4XWTA 3A1QA 2JWUA 4EZKA 4ZRQA 3WAPA 1T5XD 4RGOS 2IBIB 3DBLI 2C7HA 2WXIA 4N6EB 2YVCA 4B0EA 3IAS1 2CR5A 4W9GA 4P6VF 4IC7B 4GU2A 2JT4B 3TMPB 1QILA 1GUAB 1MHHE 1RLFA 3NHEB 3HK0A 4AS1A 2M0XA 1NENB 3RZWC 3N20C 1WJ4A 2V0GA 4ZOHC 2ZPNA 2IPKD 4WAAA 1QOGA 3RPFC 2REXA 2JZ3B 5HHDG 4JLCA 2PVGC 2UU7A 4OZBA 3KVFB 1D5XC 1HZ6A 1XO3A 1YJJA 2PEAA 4M00A 3DCGA 2N7DA 3AE5B 2OOBB 1FCLA 4AJYB 1T0RC 2I2YA 1WJ6A 1VR9A 4RF0A 4WJOA 3U30A 4ASWC 2FCNA 1FCCC 4JQWC 1WM2A 1YOVB 1WGDA 1ZE3D 1WY8A 1J7AA 2K3UA 3DVNU 1BMLC 1EF5A 4DWFA 2WXMA 2KJ6A 3PO0A 1I4QA 1VCBA 1VLBA 2IZVB 2KK8A 2LUMA 4UDUC 4M02A 2MBEA 3UQBA 4WJPA 3I57A 2BB6A 3M62B 1V6EA 3AV8A 3E56A 2ZCCA 2WHIA 1ESFA 2KC1A 2GMIC 2BVCA 1SE4A 3GE3C 1IYFA 1IPGA 5BMIA 3VRBB 4II3B 4IKGA 4US8A 3H1UA 3WANA 3L4PA 4DXAB 4EE2A 2JXXA 1ZUD2 1OFFA 3AE7B 4DHZE 1B1ZA 4ZYNA 1ISNA 2LHEA 3ZYYX 2ACZB 4KZCA 1YNTE 1P3QU 1WGKA 2L8JA 2BBCA 2MHJA 2W55A 4YWGG 1WGYA 2IGHA 2N9EB 2WU5B 1J0GA 2KT7A 3AE3B 1MFWA 1HTOA 1IGDA 2N1VA 4YTPB 1FO4A 2VH1A 3Q8AA 4CO7A 4K3BA 2KWDA 3AU5A 3TIXA 4MT5A 3AMZA 3C19A 3KUCB 1GAQB 3U7ZA 3JYUA 2KLCA 1Y8RC 3X23A 4GXBA 3MJ5A 2D11A 1RFKA 5AUIA 1LO5D 1RYJA 1V1OA 1KTKA 4K7UA 1TS2A 4RGNA 4MJSA 3Q3FA 2ASQA 4DK5A 2O6VA 1ENFA 1F1HA 1WF9A 2DHZA 2ZNVC 1Q10A 2WDTB 1EWYC 2FCSA 3OJ3A 2KQ7A 3QHTA 4KKIA 3BK2A 4IWOA 2PPHA 3ZTCA 2L7RA 1E90A 1IBXB 1DYQA 2Z59B 4LNFA 5DPRA 1ZW7A 2JQRB 4FLHA 3PZDA 1WJNA 2A5UA 5J18A 2KTRA 3SFEB 1K8RB 3C0RB 3B9JA 1WMHA 1STEA 2QDFA 3A9KA 4A55A 3OWEB 1OTRB 3RMKC 1TT5B 2WXRA 3SU8X 3NJTA 3VR8B 3NY5A 3B1LX 3A33B 2BWFA 3BVGA 1EU3A 5AZHA 2IDYA 3Q8CA 2KD0A 3DWGC 4M0WB 4LNKA 1SSNA 5G55A 2JVCA 3R7QA 3BZDB 4NJ7A 3R2TA 4RH6A 3HM6X 2MJ3A 1CMXB 4IUMB 1ZDVA 2AL3A 3AEDB 2CJNA 4N9F4 4GDKA 2L1AA 4ZDVA 1XCTL 4GOCA 2N7JA 5BO4B 4AUQC 1VD2A 4ICVA 2IGGA 5CTRC 1WGHA 3H7SA 2LASA 3L54A 2LGDA 4W9JA 3V60A 2DZIA 4HXDA 3P63A 2G3QB 3CSTA 1WIAA 2QC8A 2GBJA 4KDIC 4DBGA 5KHOA 1DOXA 1JCKB 1WZ0A 2KDMA 4NZLB 2V4LA 3R2IA 5EE0A 2M4NA 1EO6A 2WXOA 3NVWA 4WWMA 1Z5SB 2FIFA 2O6VD 1BXTA 3AEEB 1FFUA 3DBHB 2L32A 2H89B 1C76A 2KWCA 2D5GA 4NAWA 4KGTA 2KVZA 4BBNF 4HVBA 4A6QA 2DYOA 5DCNA 4KX6B 4JE3B 1C4PA 1MJDA 3ML9A 5C3JB 3EECA 2YLMA 2BF8B 2FBWB 4CQNA 3N30A 3VXWA 4JIOU 4NQLB 2LRWA 4ANWA 3MP9A 4FXCA 2NTTA 1WR1A 1ZPSA 3N9YC 3DVNV 4LCDE 3N1XC 2L05A 3A4SC 3VTWA 2RSUA 2RPQA 2KC2A 3Q3NC 3ZDMC 3PS6A 5G5GA 2GOWA 4HKQA 2ZNVB 2QILA 5FKAC 3HVDA 1UGJA 3IAM1 1PFDA 4R3DA 2BWES 1JWUD 2KTFA 2KOXA 1KF6B 3ZTDA 1WJUA 4YTMB 4J3OD 1FXAA 4PS7A 1PQSA 4EKUA 4G11A 1ZOYB 2GBNA 4A90A 3I3TB 2K8HA 1PUTA 1L0VB 1GJZA 3PZ7A 1K53A 1JRUA 4A8XC 4JL9A 1UELA 4YTNB 1TKYA 1WGGA 2G9HD 2M8SA 4M01A 3CSFA 4GIVA 2UYZB 3Q3JA 2DAFA 5T8IA 5E6OA 5L83A 2MJEA 1MG4A 1L2NA 2EMSA 1GB4A 4M8MA 4A9AA 4A3PA 1IUEA 3APFA 5CHVC 2PLPA 1F52A 1HEZE 2CS4A 2M0AA 3RNGC 5AEKB 3DVGY 1Q0WB 4MM3A 2IY1B 1QZEA 3ZO5B 3FC4A 3QQ8B 2BS4B 3IVFA 2MP2A 4TKNA 1EF1A 4AOFA 1NEKB 3ZQ4A 5CHWA 1RFAA 5BYQA 1F9JA 1HQRD 2KKCA 1NYRA 2RDBC 4GSWA 2LGSA 4G50A 4MJSB 1DGJA 1RM6C 4TV3A 3JSVA 5IN7A 2NBWB 2KX0A 2J0MA 1UZXB 4FHKA 4JPSA 2FAZA 2ZW1A 2K22A 1GG3A 4MSMB 1FNVA 1OQRA 1WXAA 4HK2A 1ZXIA 2WXLA 4N58A 1YQ3B 1YQ4B 1HE8A 4NQKE 1T6BX 1E7PB 3A9JA 3U2SC 1WM3A 4OVUA 3LJ3A 3QX1A 1OEYJ 3ZJUA 2KTRB 3ML8A 2DENB 5DPTA 4OHJA 3KH0A 2NBUA 1MVKA 1J7CA 1GNUA 4XZ4A 4HCNB 3ALBA 3K9OB 1X1MA 2LVOA 4A3OA 1YN3A 3TEZA 1MI0A 4IDIA 2YEPF 3C8YA 4BOSC 3R3MA 2VZKB 3RNFC 2RMMA 4DHJB 5G5HA 1LGRA 4IW0A 2GLSA 1E9MA 4W9LA 2L0TA 3DBHI 3Q8BA 4I6LB 4YT0B 2H88B 4ZHOA 2AQ1B 2IO2B 2M19A 3RYTA 4S17A 1V2YA 5LXIB 4W9IA 1I4RA 1I4PA 1T0SC 2DZJA 2D07B 1AW7A 2BT6A 2INPE 3EFCA 1TBEA 4L1BA 4YSYB 5JZEB 3AE2B 2N9XA 1P7EA 4LLGM 4KIKA 3ZXRA 1V1PA 2BYEA 5L95C 3PRMB 4LJOB 4BOZB 3EFUA 5H8YE 2FUHB 1E8ZA 4OZCA 4MH8A 1L7YA 1C79A 1V86A 3AE4B 3DDCB 2KJHB 1LXDA 1CQVA 1CK1A 1L5PA 1A5RA 2NPTA 4I6PA 2QIEB 1A70A 5GXGB 2MBOA 4ZRIA 3QJZA 3W1YA 4DHZB 3NVVA 2MLBA 3EA6A 3Q6BA 3H8HA 4WWNA 3T8MA 1N5XA 2KXJA 3K9PB 2PE9A 4FN2A 3RT3B 3ENEA 4EEWA 2AQ2B 4W9HA 2CJOA 2N0SB 5JH5C 2BGFA 2JXTA 5HG2A 1YX6B 2PMVA 4NAWB 1FXIA 3ZKJC 1KLVA 3VUWA 1SBBB 1GC6A 2FCMA 3RZFA 1WRDB 1PGAA 3P4SB 5HFYA 5CX3A 1JWAD 4TQ0A 2X8XX 2Y5BB 4FBJB 4C4VA 3QARA 3EC8A 4FJZA 3KLSX 3P1MA 1JRPA 1YQBA 2XK5A 3PV1A 1ACCA 4EFOA 3NRZA 2VRRB 3LDZE 4RFBA 2MWSB 2QSDA 4RMAA 2DAJA 3IBEA 2W3SA 1WXSA 1LFDA 2HDEA 3B2FA 2NBVB 3KWLA 4KVGB 1HA5A 1F0ZA 1E7VA 3DVGX 2MBQA 3AI5A 5EE3A 3V61A 3KUDB 4LK0M 2QMTA 3WALA 1ZDXA 2LRUA 4HPMB 2ICIA 3BYYB 5TSSA 2NVUI 2KVRA 2Y5PA 1FRDA 4EUTA 1L4ZB 1S3SG 5GMVA 2LGYA 1TYGB 5AZGA 4DQOC 3O13A 4ANUA 3PRZA 3SHQA 4O1NA 3T3NA 2L52A 1D4BA 4P1BC 2Y5CA 1AWDA 1V97A 4RM8A 3IFWB 1WR6E 2PIAA 4TMAB 5TR5A 2WXQA 4RF1A 1WXQA 2R2QA 1G6JA 1T0QC 1OQQA 2DNFA 1HTQA 2NMQA 3FILB 1QKZA 2INNE 1PDXA 3VH4B 3NVYA 2L0FA 1R4MB 4URKA 3ZNID 2C7NB 4XWWA 2WXNA 2L3ZA 3LYYA 1JWMD 4NJCA 2AYOB 2RD0A 2W54A 1PGXA 1WXMA 2IGDA 2N9LA 4MH0E 3ZDTA 3JVZX 2BW2A 2KO3A 1SIFA 2OJWA 3URYA 4LDTD 3M63B 1V49A 1UWXA 2I38A 1FIQA 2KJRA 4NAMA 3RN9C 2EKIA 4KSKC 5IAAC 1ET6A 3N3KB 2KFKA 2RPVA 4GDLA 3TEYA 3MC8A 2GBMA 4IG7B 3DHGC 1K52A 2AL6A 4E3CA 2X38A 1OGWA 2C5LC 2QEJC 3UQAA 4J6IA 4K81A 1ZKHA 3H7PA 4ICUA 4ZHPA 4OVZA 4TQ1A 3W2DA 4NJ6A 2J52A 2QJLA 1IGCA 5LNK1 2ZVOA 4CYEA 2G4SA 2ZVNA 1GOZA 2KZRA 2DYBA 4LNOA 3T9LA 3E9SA 2Z0DB 2GI9A 1LM8B 1WFYA 1TY0A 3U52E 2KNBA 2WXFA 1JALA 3W9CB 3ZJVA 4F7ZA 1KJTA 4TSSA 2FNJB 3U4EG 4IM3A 1TZOA 2HD5B 1TKGA 1XLOA 5FR3A 5IO9A 2JU6X 1YN4A 2KAJA 1EU4A 2LGIA 3QAQA 3KYDD 2KMCA 1ZP0B 3IXSA 3VTVA 1L0YB 5IOIA 4BFRA 3AM9A 1NYQA 2L83A 3I5JC 4KGSA 4FJYA 2AX5A 4YXDB 3L13A 4IM2A 1NDDA 1UBQA 3Q3OC 3AEFB 3HIZA 2RDGA 3ZJTA 3RNAC 1WE6A 3GOEA 3N1ZC 1AARA 3M3JA 3AXCA 1V80A 1I4GA 4HJGE 3BWUD 4BKTA 3TCAA 2KN4A 1FRRA 3ZW3A 4HPPA 4L2YA 1SEBD 4KZ0A 5D94A 4F1SA 2JZPA 3P4PB 2XEWA 3ZNGC 2LUEA 2KFJA 1SJED 1J8CA 3ZVVA 2LJ5A 4P7IA 3P2BA 2JPHA 3A1QB 4FADA 3Q8FA 3BIID 3KUZA 2CU3A 2WXJA 2WQYB 4K7SA 2E3TA 1OQYA 4HDQA 1R4NB 4HRSA 3L10B 1AYFA 3DPDA 1YX5B 4C56C 5I4DA 4ZRKA 2N4FA 3AEGB 4XGAB 4JWSC 3GB1A 4ZRPA 2J0KA 3D32A 2K0PA 5J2RA 4EZJA 2D3AA 3CMMB 2KLGA 1E7UA 4XDDA 1FMAD 3UI3A 2UWQA 4W9CA 1KH0A 2IJ0A 2DZKA 2WWZA 3B0AA 1R4MI 1UH6A 1FEHA 4QAYA 1JW9D 4W9FA 1SE2A 4C4VB 3H9DA 2ON8A 1EUVB 4WJNA 4XX5A 4PYZA 4HWIB 1QQRA 2IY0B 2KACA 3PSEB 2AQ3B 2MH7A 3R7RA 3VFKA 4YSXB 4X57B 2AEHA 1L6UA 2IO0B 3EHVA 4S0RA 3EGRA 2INCC 5BYRA 4KV2A 2VZKD 1J19A 3RCZA 1XF5L 2MW5A 3HVZA 4HKZE 1JWSD 4MGYE 2BYTA 2K8CA 3P4RB 1TGZB 4RGMA 3NG0A 5D6JB 3IHPC 1QOFA 2IO1B 2BYFA 2FCQA 4WWOA 1JROA 3ZRCA 2C9WB 2CHWA 3BINA 3L17A 1C77A 2PVOD 4WJQA 2HTME 3QC8B 5JHBA 3S2AA 3SD5A 2O2VA 1MHXA 1D5MC 1TJEA 1VRAB 2V3NA 2MQJA 3P42A 2LXAA 1DOIA 3NZUA 2LI5A 1P0RA 3OJ4B 3RUIB 3ZNZB 2YEPB 1V8CA 2WXHA 2B76B 2VH2A 3VHTC 2V3PA 1VZ7A 1XD3B 3N1YC 2N7EA 3V3XA 2BB5A 2KN5A 2N9KA 3M95A 3BY4B 2Z0EB 4AQ7A 1QOAA 1EM7A 4KKJA 2EKEC 1C1YB 3RI7C 4FA6A 1V5TA 2R2OA 1I4XA 1YN5A 3KYCD 4GB9A 3W1SA 1XQQA 1WYGA 2O6VB 1WX8A 3ZNHB 1V81A 4GGQA 3A4RA 1UGMA 2LZ6A 1C4CA 1F77A 1E5WA 1D5ZC 1FFVA 1FXTB 1XLPA 4XC2A 4RM9A 3FKYA 2K6DB 2DWQA 2Z8LA 1ET9A 1MG8A 1WZ3A 3RFZB 1WMHB 2BQQA 4A20A 2WS3B 2FE8A 4B9KA 1IP9A 1R4NI 3PPAA 2WXPA 5E6NA 3V05A 2ONQA 3AE6B 3A9KB 4RCOA 2LGXA 1R7SA 1OEYA 1VZ6A 1TIFA 5DPWA 1UUPA 4JWUC 2K5PA 3SDLC 5HI1A 2BKRB 3Q14C 3U8ZA 3IT4B 1I42A 4HJKA 2CHXA 3VDZA 1C3TA 3OLMD 2KQSA 4P1CC 2KMMA 2CU1A 2OJRA 2WYQA 3AECB 3UIOB
chains in the Genus database with same CATH topology
3R66C 5G55A 4I6NB 2KWUB 4MDKE 2ZZPB 2JVCA 4G0NB 3TBLD 1S3SG 3R7QA 3ZUNA 4LJPB 5GMVA 4BKGA 2LGYA 1E8XA 1S1QB 4NJ7A 5KHQA 2WX0A 5AZGA 4ANUA 1GC7A 3PRZA 1WX9A 4IWQA 4YL8A 3HM6X 3RULA 3SHQA 5CHFA 1CMXB 2MA9B 4IUMB 2G45B 2MX2A 4GDKB 2AL3A 1TTNA 4N9F4 1UBIA 4AWJA 2PE6B 3PLVA 4RM8A 4GDKA 3IFWB 1WR6E 2GBRA 5TR5A 4ZDVA 4GOCA 3NOBA 4G3XB 2MSED 2KWVB 2R2QA 3APDA 1G6JA 2G4DB 1YIWA 2HJ8A 5BO4B 3VH3B 2LD9A 4AUQC 1NBFC 2JF5A 1VD2A 4ICVA 5CTRC 1WGHA 3H7SA 3VH4B 2L0FA 2LASA 4EZLA 3L54A 2DX5B 2LGDA 2C7MB 2PJHA 4URKA 2ZCBA 3AU4A 2J0JA 4W9JA 3V60A 3ZNID 2C7NB 2DZIA 4HXDA 2G3QB 2L3ZA 3CSTA 2J7QB 1SE9A 4HPLB 2JRHA 2A4ZA 1WIAA 2GBJA 4KDIC 2AYOB 4DBGA 2RD0A 2LVPA 5KHOA 1WXMA 2K1FA 2V1YA 2JY6A 4K7WA 4MH0E 3V6CB 5AZFA 3ZDTA 1WZ0A 2NR2A 3JVZX 4BVUC 2KO3A 1SIFA 4W9KA 1RAXA 3DBSA 2V4LA 4LDTD 2MBHA 3JW0X 2I1KA 3M63B 2W9NA 1V49A 1EO6A 2M4NA 1Z5SB 2KFKB 2FIFA 2O6VD 4GDLB 2KJRA 5LLIA 2QHOA 5FR6A 1SGHA 4KSKC 5IAAC 2KWCA 2WX1A 3AULA 2KFKA 3N3KB 3WAMA 4GDLA 4NAWA 1T0YA 4BBNF 4HVBA 4KDLB 2DYOA 5DCNA 3X0WA 4BBNC 2GBMA 2LWPA 4MSQB 1BT0A 4IG7B 3H7PB 4AJWA 2AL6A 4IM0A 3ML9A 4E3CA 2KDFB 2YLMA 2BF8B 3EECA 3L16A 3VAWA 1NI2A 1OGWA 2C5LC 3UQAA 3N30A 4J6IA 4K81A 1ZKHA 3H7PA 4GMVA 4ICUA 4JIOU 3VXWA 5G2NA 4W9DA 4TQ1A 4NQLB 4NJ6A 2LRWA 2GBKA 2MCNB 4NY0A 4ANWA 3DQVA 1V5OA 2ZVOA 1U4AA 4CYEA 2G4SA 2ZVNA 2KZRA 2RR9A 2DYBA 1WX7A 1WR1A 3T9LA 2L76A 2K6QA 1ZGUB 2Z0DB 3DVNV 4LCDE 1LM8B 2N9PC 1WFYA 2L05A 3VTUA 2KNBA 3VVWB 3A4SC 2XBBC 3VTWA 1WI0A 2RPQA 2RSUA 4F7ZA 5D2MB 1KJTA 2KC2A 1WE7A 2K39A 3ZDMC 2FNJB 1E8YA 3PS6A 4IM3A 2NCNA 3PRPB 2HD5B 2GOWA 2KDIA 2ZNVB 2JRIB 5J17A 4F8CB 4FHJA 3PHWB 3QAQA 2KHWB 3KYDD 2KMCA 2BWES 3U7DA 4MEMA 3VTVA 2KTFA 2KOXA 4M8NA 2L00B 1WJUA 3ZTDA 4BFRA 3DBRI 3DOWA 4PS7A 4FJYA 3V62A 1PQSA 4EKUA 4BKSA 4G11A 3L13A 2GBNA 2KDEB 4PS3A 3UGBB 3W1SC 3I3TB 2K25A 1RRBA 2K8HA 4IM2A 4KSLC 1GJZA 1NDDA 1UBQA 4E71A 4BKSD 1JRUA 3HIZA 4JL9A 1UELA 1WGGA 3RD2A 1WE6A 2M8SA 1LQBA 2JUOA 3GOEA 1AARA 3CSFA 3AXCA 1V80A 2D10A 1H4RA 3M3JA 4B6WA 4GIVA 2UYZB 3Q3JA 5LXHA 3TJPA 2LXCA 2O2VB 2DAFA 4BKTA 3TCAA 3ZW3A 5E6OA 4PYUA 5L83A 4KZ0A 5D94A 1L2NA 3MJWA 2ZEQA 4WQOB 2EMSA 3WA0A 3QA8A 4F1SA 4M8MA 4A3PA 3PTFC 2M1MA 3GZNI 2XEWA 2MBBB 2EMTA 3KW5B 2LUEA 2KFJA 3APFA 4MELA 3PHXB 5CHVC 3ZNGC 3ZVVA 3HM3A 2LJ5A 1J8CA 4P7IA 3P2BA 4W9EA 4MGZE 3MTNB 2CS4A 2JPHA 3A1QB 3QCAA 3WIMA 4FADA 5AEKB 3B08A 2BKFA 4MGKE 3DVGY 5HKHA 1Q0WB 4MM3A 4EOYA 2IY1B 2MP2B 2JWZA 5E6PA 3KUZA 2ZPYA 1QZEA 3A1QA 3QK0A 3ZO5B 4EZKA 3WAPA 3QQ8B 2ZJDA 3IVFA 2IBIB 3PLUA 2MP2A 4TKNA 1EF1A 4K7SA 4AOFA 4PS8A 1OQYA 4HDQA 5CHWA 1RFAA 3DBLI 2C7HA 1F9JA 3L10B 3WAOA 3DPDA 1YX5B 2YVCA 2KKCA 4ZRKA 2CR5A 2N4FA 4W9GA 1Q1OA 3JSVB 4GSWA 4G50A 4IC7B 4GU2A 1KOTA 2JT4B 4MJSB 3TMPB 2CKHB 1GUAB 3MHSD 4ANXA 1RLFA 3NHEB 3HK0A 2M0XA 4TV3A 3RZWC 4CHKA 3JSVA 2J0KA 3D32A 1WJ4A 2NBWB 2KX0A 4DDGD 2ZPNA 2J0MA 1UZXB 5J2RA 4WAAA 1YD8U 4FHKA 4EZJA 2FAZA 2REXA 2JZ3B 3O65B 3CMMB 4JLCA 1GG3A 4MSMB 5C23A 1WXAA 2KLGA 1E7UA 3KVFB 4HK2A 3A9JB 2D3GA 2PEAA 2UWQA 4W9CA 3DCGA 4FJVB 2N7DA 2DZKA 2WWZA 1HE8A 3B0AA 4NQKE 2OOBB 3TL5A 4AJYB 3A9JA 1R4MI 1WM3A 1UH6A 3LJ3A 3QX1A 4OVUA 1WJ6A 3PGEA 1OEYJ 4WJOA 3U30A 2KTRB 3ZLZA 3ML8A 4W9FA 2DENB 5DPTA 3KH0A 4ASWC 2NBUA 3QWZB 2MRPA 2V3SA 1GNUA 3H9DA 2FCNA 4XZ4A 4JQWC 3ECIA 3UF8A 1EUVB 1WM2A 4HCNB 4WJNA 3ALBA 1WGDA 1X1MA 2LVOA 1WY8A 3K9OB 4XX5A 4A3OA 1UD7A 4PYZA 4HWIB 3DVNU 2IY0B 4BOSC 1EF5A 3R3MA 2C60A 4DWFA 3PSEB 2I1JA 5IA7A 3R7RA 3VFKA 2KMAA 4DHJB 2KJ6A 3PREA 4TUUA 1I35A 1VCBA 4IW0A 2IZVB 2AEHA 4X57B 2IO0B 2KK8A 3EHVA 4W9LA 3ZIMA 2MBEA 2L0TA 3DBHI 3UQBA 4WJPA 3ZRFA 3M62B 4I6LB 1V6EA 4KV2A 2ZCCA 1J19A 3RCZA 4ANVA 2IO2B 2MW5A 2KC1A 3RYTA 2GMIC 1IYFA 1IPGA 1V2YA 3CF6E 4II3B 5LXIB 4MGYE 2K8CA 2B3AA 3H1UA 4W9IA 3WANA 4DXAB 2DZJA 1TGZB 2D07B 2IYDB 2JXXA 2LVQA 1Z2MA 3NS8A 4KIKB 3IHPC 5D6JB 1WYWB 2AWTA 3OAWA 1TBEA 2BYVE 5JZEB 4DHZE 2IO1B 3H6NA 2BYFA 2FCQA 2N9XA 4WWOA 3ZRCA 2C9WB 2CHWA 3BINA 4ZYNA 3N32A 3L17A 4KIKA 1ISNA 3L08A 4KZCA 3HHMA 4WJQA 2BYEA 5L95C 3IG3A 3PRMB 1Q5WB 3QC8B 5JHBA 1P3QU 3S2AA 3SD5A 2O2VA 4LJOB 2L8JA 4BOZB 3EFUA 1WGYA 2N9EB 1J0GA 2FUHB 1E8ZA 2MQJA 2LXAA 3UIPB 1WGRA 1KM7A 3NZUA 2LI5A 1L7YA 1P0RA 2HTHA 2N1VA 3OJ4B 1V86A 2RGFA 3RUIB 2NPTB 3ZNZB 4CO7A 3DDCB 2KJHB 1LXDA 3AU5A 3TIXA 2N1WA 2DYMA 3VHTC 1P1AA 3KUCB 1A5RA 4WWPA 2NPTA 4I6PA 4II2B 1XD3B 2N7EA 4NPNA 3JYUA 2KLCA 1P98A 2KN5A 1Y8RC 3X23A 3M95A 2MBOA 2IO3B 4GN1A 4ZRIA 3BY4B 4GXBA 2Z0EB 3QJZA 3W1YA 2D11A 4DHZB 4HLEA 3VUXA 2EKEC 1C1YB 2KANA 2K8BA 3NZSA 4FA6A 1V5TA 2R2OA 5D7GA 2M17A 4LDTB 2MLBA 1V9JA 3KYCD 4GB9A 3W1SA 3PVLA 4K7UA 1XQQA 4WWNA 2O6VB 3VUYA 1WX8A 3T8MA 3L0WB 3ZNHB 4MJSA 2KXJA 1V81A 2ASQA 3K9PB 3Q3FA 4GGQA 2PE9A 4FN2A 4DK5A 1YJ1A 3A4RA 1UGMA 2LZ6A 3RT3B 2O6VA 3ENEA 4JGHB 4EEWA 4W9HA 1WF9A 2DHZA 4K1RB 2ZNVC 1E5WA 2WDTB 5JH5C 2BGFA 2FCSA 1YX6B 3OJ3A 2KX3A 5EDSA 4NAWB 5C1ZA 2KQ7A 1FXTB 3QHTA 2JZZA 3ZKJC 1KLVA 3VUWA 4IWOA 2PPHA 1GC6A 4XC2A 2FCMA 2L7RA 4RM9A 1E90A 1WRDB 2BPSA 3RZFA 3ZTCA 4FULA 2Z59B 5DPRA 1WH3A 2K6DB 1ZW7A 1P9DU 5CX3A 2KDBA 4FLHA 3V6EB 3PZDA 1WJNA 2A5UA 1MG8A 1WZ3A 5J18A 4DDID 2KTRA 4TQ0A 1WMHB 2Y5BB 4A20A 1K8RB 2HE7A 4FBJB 2XK5B 4B9KA 1IP9A 1R4NI 3QARA 3PPAA 3C0RB 5E6NA 3EC8A 4HDOA 4FJZA 1WMHA 3A9KB 1YQBA 2XK5A 3PV1A 4EFOA 2LGXA 2VRRB 3LDZE 2NS5A 1OEYA 3VQIA 2CHZA 3A9KA 4NNJB 2DZMA 2MWSB 4RMAA 1OTRB 5DPWA 2FIDA 4MGIE 2DAJA 2D2QA 3APCA 3IBEA 1WXSA 1LFDA 3SDLC 4AP4C 2BKRB 1TZ1A 3SU8X 1E8WA 2NBVB 4ZRJA 3U8ZA 4E74A 4DHJD 4KVGB 1I42A 4HJKA 1M94A 1E7VA 3DVGX 1WXVA 2MBQA 3AI5A 3NY5A 1XT9B 3B1LX 2CHXA 3V61A 3KUDB 3UINB 3VDZA 3A33B 3ONSA 3WALA 4HCPB 2BWFA 5JHAA 1C3TA 3OLMD 1H8CA 2LRUA 4HPMB 5AZHA 2KQSA 3QIJA 4OVVA 1D3ZA 2NVUI 2CU1A 2KVRA 4B95A 2OJRA 2WYQA 3PT2B 4IWPA 3UIOB 2KD0A 4EUTA 4M0WB 5DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R66 C;  5G55 A;  4I6N B;  2KWU B;  4MDK E;  2ZZP B;  2JVC A;  4G0N B;  3TBL D;  1S3S G;  3R7Q A;  3ZUN A;  4LJP B;  5GMV A;  4BKG A;  2LGY A;  1E8X A;  1S1Q B;  4NJ7 A;  5KHQ A;  2WX0 A;  5AZG A;  4ANU A;  1GC7 A;  3PRZ A;  1WX9 A;  4IWQ A;  4YL8 A;  3HM6 X;  3RUL A;  3SHQ A;  5CHF A;  1CMX B;  2MA9 B;  4IUM B;  2G45 B;  2MX2 A;  4GDK B;  2AL3 A;  1TTN A;  4N9F 4;  1UBI A;  4AWJ A;  2PE6 B;  3PLV A;  4RM8 A;  4GDK A;  3IFW B;  1WR6 E;  2GBR A;  5TR5 A;  4ZDV A;  4GOC A;  3NOB A;  4G3X B;  2MSE D;  2KWV B;  2R2Q A;  3APD A;  1G6J A;  2G4D B;  1YIW A;  2HJ8 A;  5BO4 B;  3VH3 B;  2LD9 A;  4AUQ C;  1NBF C;  2JF5 A;  1VD2 A;  4ICV A;  5CTR C;  1WGH A;  3H7S A;  3VH4 B;  2L0F A;  2LAS A;  4EZL A;  3L54 A;  2DX5 B;  2LGD A;  2C7M B;  2PJH A;  4URK A;  2ZCB A;  3AU4 A;  2J0J A;  4W9J A;  3V60 A;  3ZNI D;  2C7N B;  2DZI A;  4HXD A;  2G3Q B;  2L3Z A;  3CST A;  2J7Q B;  1SE9 A;  4HPL B;  2JRH A;  2A4Z A;  1WIA A;  2GBJ A;  4KDI C;  2AYO B;  4DBG A;  2RD0 A;  2LVP A;  5KHO A;  1WXM A;  2K1F A;  2V1Y A;  2JY6 A;  4K7W A;  4MH0 E;  3V6C B;  5AZF A;  3ZDT A;  1WZ0 A;  2NR2 A;  3JVZ X;  4BVU C;  2KO3 A;  1SIF A;  4W9K A;  1RAX A;  3DBS A;  2V4L A;  4LDT D;  2MBH A;  3JW0 X;  2I1K A;  3M63 B;  2W9N A;  1V49 A;  1EO6 A;  2M4N A;  1Z5S B;  2KFK B;  2FIF A;  2O6V D;  4GDL B;  2KJR A;  5LLI A;  2QHO A;  5FR6 A;  1SGH A;  4KSK C;  5IAA C;  2KWC A;  2WX1 A;  3AUL A;  2KFK A;  3N3K B;  3WAM A;  4GDL A;  4NAW A;  1T0Y A;  4BBN F;  4HVB A;  4KDL B;  2DYO A;  5DCN A;  3X0W A;  4BBN C;  2GBM A;  2LWP A;  4MSQ B;  1BT0 A;  4IG7 B;  3H7P B;  4AJW A;  2AL6 A;  4IM0 A;  3ML9 A;  4E3C A;  2KDF B;  2YLM A;  2BF8 B;  3EEC A;  3L16 A;  3VAW A;  1NI2 A;  1OGW A;  2C5L C;  3UQA A;  3N30 A;  4J6I A;  4K81 A;  1ZKH A;  3H7P A;  4GMV A;  4ICU A;  4JIO U;  3VXW A;  5G2N A;  4W9D A;  4TQ1 A;  4NQL B;  4NJ6 A;  2LRW A;  2GBK A;  2MCN B;  4NY0 A;  4ANW A;  3DQV A;  1V5O A;  2ZVO A;  1U4A A;  4CYE A;  2G4S A;  2ZVN A;  2KZR A;  2RR9 A;  2DYB A;  1WX7 A;  1WR1 A;  3T9L A;  2L76 A;  2K6Q A;  1ZGU B;  2Z0D B;  3DVN V;  4LCD E;  1LM8 B;  2N9P C;  1WFY A;  2L05 A;  3VTU A;  2KNB A;  3VVW B;  3A4S C;  2XBB C;  3VTW A;  1WI0 A;  2RPQ A;  2RSU A;  4F7Z A;  5D2M B;  1KJT A;  2KC2 A;  1WE7 A;  2K39 A;  3ZDM C;  2FNJ B;  1E8Y A;  3PS6 A;  4IM3 A;  2NCN A;  3PRP B;  2HD5 B;  2GOW A;  2KDI A;  2ZNV B;  2JRI B;  5J17 A;  4F8C B;  4FHJ A;  3PHW B;  3QAQ A;  2KHW B;  3KYD D;  2KMC A;  2BWE S;  3U7D A;  4MEM A;  3VTV A;  2KTF A;  2KOX A;  4M8N A;  2L00 B;  1WJU A;  3ZTD A;  4BFR A;  3DBR I;  3DOW A;  4PS7 A;  4FJY A;  3V62 A;  1PQS A;  4EKU A;  4BKS A;  4G11 A;  3L13 A;  2GBN A;  2KDE B;  4PS3 A;  3UGB B;  3W1S C;  3I3T B;  2K25 A;  1RRB A;  2K8H A;  4IM2 A;  4KSL C;  1GJZ A;  1NDD A;  1UBQ A;  4E71 A;  4BKS D;  1JRU A;  3HIZ A;  4JL9 A;  1UEL A;  1WGG A;  3RD2 A;  1WE6 A;  2M8S A;  1LQB A;  2JUO A;  3GOE A;  1AAR A;  3CSF A;  3AXC A;  1V80 A;  2D10 A;  1H4R A;  3M3J A;  4B6W A;  4GIV A;  2UYZ B;  3Q3J A;  5LXH A;  3TJP A;  2LXC A;  2O2V B;  2DAF A;  4BKT A;  3TCA A;  3ZW3 A;  5E6O A;  4PYU A;  5L83 A;  4KZ0 A;  5D94 A;  1L2N A;  3MJW A;  2ZEQ A;  4WQO B;  2EMS A;  3WA0 A;  3QA8 A;  4F1S A;  4M8M A;  4A3P A;  3PTF C;  2M1M A;  3GZN I;  2XEW A;  2MBB B;  2EMT A;  3KW5 B;  2LUE A;  2KFJ A;  3APF A;  4MEL A;  3PHX B;  5CHV C;  3ZNG C;  3ZVV A;  3HM3 A;  2LJ5 A;  1J8C A;  4P7I A;  3P2B A;  4W9E A;  4MGZ E;  3MTN B;  2CS4 A;  2JPH A;  3A1Q B;  3QCA A;  3WIM A;  4FAD A;  5AEK B;  3B08 A;  2BKF A;  4MGK E;  3DVG Y;  5HKH A;  1Q0W B;  4MM3 A;  4EOY A;  2IY1 B;  2MP2 B;  2JWZ A;  5E6P A;  3KUZ A;  2ZPY A;  1QZE A;  3A1Q A;  3QK0 A;  3ZO5 B;  4EZK A;  3WAP A;  3QQ8 B;  2ZJD A;  3IVF A;  2IBI B;  3PLU A;  2MP2 A;  4TKN A;  1EF1 A;  4K7S A;  4AOF A;  4PS8 A;  1OQY A;  4HDQ A;  5CHW A;  1RFA A;  3DBL I;  2C7H A;  1F9J A;  3L10 B;  3WAO A;  3DPD A;  1YX5 B;  2YVC A;  2KKC A;  4ZRK A;  2CR5 A;  2N4F A;  4W9G A;  1Q1O A;  3JSV B;  4GSW A;  4G50 A;  4IC7 B;  4GU2 A;  1KOT A;  2JT4 B;  4MJS B;  3TMP B;  2CKH B;  1GUA B;  3MHS D;  4ANX A;  1RLF A;  3NHE B;  3HK0 A;  2M0X A;  4TV3 A;  3RZW C;  4CHK A;  3JSV A;  2J0K A;  3D32 A;  1WJ4 A;  2NBW B;  2KX0 A;  4DDG D;  2ZPN A;  2J0M A;  1UZX B;  5J2R A;  4WAA A;  1YD8 U;  4FHK A;  4EZJ A;  2FAZ A;  2REX A;  2JZ3 B;  3O65 B;  3CMM B;  4JLC A;  1GG3 A;  4MSM B;  5C23 A;  1WXA A;  2KLG A;  1E7U A;  3KVF B;  4HK2 A;  3A9J B;  2D3G A;  2PEA A;  2UWQ A;  4W9C A;  3DCG A;  4FJV B;  2N7D A;  2DZK A;  2WWZ A;  1HE8 A;  3B0A A;  4NQK E;  2OOB B;  3TL5 A;  4AJY B;  3A9J A;  1R4M I;  1WM3 A;  1UH6 A;  3LJ3 A;  3QX1 A;  4OVU A;  1WJ6 A;  3PGE A;  1OEY J;  4WJO A;  3U30 A;  2KTR B;  3ZLZ A;  3ML8 A;  4W9F A;  2DEN B;  5DPT A;  3KH0 A;  4ASW C;  2NBU A;  3QWZ B;  2MRP A;  2V3S A;  1GNU A;  3H9D A;  2FCN A;  4XZ4 A;  4JQW C;  3ECI A;  3UF8 A;  1EUV B;  1WM2 A;  4HCN B;  4WJN A;  3ALB A;  1WGD A;  1X1M A;  2LVO A;  1WY8 A;  3K9O B;  4XX5 A;  4A3O A;  1UD7 A;  4PYZ A;  4HWI B;  3DVN U;  2IY0 B;  4BOS C;  1EF5 A;  3R3M A;  2C60 A;  4DWF A;  3PSE B;  2I1J A;  5IA7 A;  3R7R A;  3VFK A;  2KMA A;  4DHJ B;  2KJ6 A;  3PRE A;  4TUU A;  1I35 A;  1VCB A;  4IW0 A;  2IZV B;  2AEH A;  4X57 B;  2IO0 B;  2KK8 A;  3EHV A;  4W9L A;  3ZIM A;  2MBE A;  2L0T A;  3DBH I;  3UQB A;  4WJP A;  3ZRF A;  3M62 B;  4I6L B;  1V6E A;  4KV2 A;  2ZCC A;  1J19 A;  3RCZ A;  4ANV A;  2IO2 B;  2MW5 A;  2KC1 A;  3RYT A;  2GMI C;  1IYF A;  1IPG A;  1V2Y A;  3CF6 E;  4II3 B;  5LXI B;  4MGY E;  2K8C A;  2B3A A;  3H1U A;  4W9I A;  3WAN A;  4DXA B;  2DZJ A;  1TGZ B;  2D07 B;  2IYD B;  2JXX A;  2LVQ A;  1Z2M A;  3NS8 A;  4KIK B;  3IHP C;  5D6J B;  1WYW B;  2AWT A;  3OAW A;  1TBE A;  2BYV E;  5JZE B;  4DHZ E;  2IO1 B;  3H6N A;  2BYF A;  2FCQ A;  2N9X A;  4WWO A;  3ZRC A;  2C9W B;  2CHW A;  3BIN A;  4ZYN A;  3N32 A;  3L17 A;  4KIK A;  1ISN A;  3L08 A;  4KZC A;  3HHM A;  4WJQ A;  2BYE A;  5L95 C;  3IG3 A;  3PRM B;  1Q5W B;  3QC8 B;  5JHB A;  1P3Q U;  3S2A A;  3SD5 A;  2O2V A;  4LJO B;  2L8J A;  4BOZ B;  3EFU A;  1WGY A;  2N9E B;  1J0G A;  2FUH B;  1E8Z A;  2MQJ A;  2LXA A;  3UIP B;  1WGR A;  1KM7 A;  3NZU A;  2LI5 A;  1L7Y A;  1P0R A;  2HTH A;  2N1V A;  3OJ4 B;  1V86 A;  2RGF A;  3RUI B;  2NPT B;  3ZNZ B;  4CO7 A;  3DDC B;  2KJH B;  1LXD A;  3AU5 A;  3TIX A;  2N1W A;  2DYM A;  3VHT C;  1P1A A;  3KUC B;  1A5R A;  4WWP A;  2NPT A;  4I6P A;  4II2 B;  1XD3 B;  2N7E A;  4NPN A;  3JYU A;  2KLC A;  1P98 A;  2KN5 A;  1Y8R C;  3X23 A;  3M95 A;  2MBO A;  2IO3 B;  4GN1 A;  4ZRI A;  3BY4 B;  4GXB A;  2Z0E B;  3QJZ A;  3W1Y A;  2D11 A;  4DHZ B;  4HLE A;  3VUX A;  2EKE C;  1C1Y B;  2KAN A;  2K8B A;  3NZS A;  4FA6 A;  1V5T A;  2R2O A;  5D7G A;  2M17 A;  4LDT B;  2MLB A;  1V9J A;  3KYC D;  4GB9 A;  3W1S A;  3PVL A;  4K7U A;  1XQQ A;  4WWN A;  2O6V B;  3VUY A;  1WX8 A;  3T8M A;  3L0W B;  3ZNH B;  4MJS A;  2KXJ A;  1V81 A;  2ASQ A;  3K9P B;  3Q3F A;  4GGQ A;  2PE9 A;  4FN2 A;  4DK5 A;  1YJ1 A;  3A4R A;  1UGM A;  2LZ6 A;  3RT3 B;  2O6V A;  3ENE A;  4JGH B;  4EEW A;  4W9H A;  1WF9 A;  2DHZ A;  4K1R B;  2ZNV C;  1E5W A;  2WDT B;  5JH5 C;  2BGF A;  2FCS A;  1YX6 B;  3OJ3 A;  2KX3 A;  5EDS A;  4NAW B;  5C1Z A;  2KQ7 A;  1FXT B;  3QHT A;  2JZZ A;  3ZKJ C;  1KLV A;  3VUW A;  4IWO A;  2PPH A;  1GC6 A;  4XC2 A;  2FCM A;  2L7R A;  4RM9 A;  1E90 A;  1WRD B;  2BPS A;  3RZF A;  3ZTC A;  4FUL A;  2Z59 B;  5DPR A;  1WH3 A;  2K6D B;  1ZW7 A;  1P9D U;  5CX3 A;  2KDB A;  4FLH A;  3V6E B;  3PZD A;  1WJN A;  2A5U A;  1MG8 A;  1WZ3 A;  5J18 A;  4DDI D;  2KTR A;  4TQ0 A;  1WMH B;  2Y5B B;  4A20 A;  1K8R B;  2HE7 A;  4FBJ B;  2XK5 B;  4B9K A;  1IP9 A;  1R4N I;  3QAR A;  3PPA A;  3C0R B;  5E6N A;  3EC8 A;  4HDO A;  4FJZ A;  1WMH A;  3A9K B;  1YQB A;  2XK5 A;  3PV1 A;  4EFO A;  2LGX A;  2VRR B;  3LDZ E;  2NS5 A;  1OEY A;  3VQI A;  2CHZ A;  3A9K A;  4NNJ B;  2DZM A;  2MWS B;  4RMA A;  1OTR B;  5DPW A;  2FID A;  4MGI E;  2DAJ A;  2D2Q A;  3APC A;  3IBE A;  1WXS A;  1LFD A;  3SDL C;  4AP4 C;  2BKR B;  1TZ1 A;  3SU8 X;  1E8W A;  2NBV B;  4ZRJ A;  3U8Z A;  4E74 A;  4DHJ D;  4KVG B;  1I42 A;  4HJK A;  1M94 A;  1E7V A;  3DVG X;  1WXV A;  2MBQ A;  3AI5 A;  3NY5 A;  1XT9 B;  3B1L X;  2CHX A;  3V61 A;  3KUD B;  3UIN B;  3VDZ A;  3A33 B;  3ONS A;  3WAL A;  4HCP B;  2BWF A;  5JHA A;  1C3T A;  3OLM D;  1H8C A;  2LRU A;  4HPM B;  5AZH A;  2KQS A;  3QIJ A;  4OVV A;  1D3Z A;  2NVU I;  2CU1 A;  2KVR A;  4B95 A;  2OJR A;  2WYQ A;  3PT2 B;  4IWP A;  3UIO B;  2KD0 A;  4EUT A;  4M0W B;  5DPS A; 
#chains in the Genus database with same CATH topology
 3R66 C;  3RNB C;  2GB1 A;  5KHQ A;  2WX0 A;  4M0W A;  1GC7 A;  2PTL A;  1WX9 A;  3AN1 A;  4IWQ A;  1K50 A;  3RUL A;  5CHF A;  3TEX A;  4GDK B;  2LHD A;  2D3C A;  4AWJ A;  1TKE A;  3PLV A;  4L23 A;  3NOB A;  2DLB A;  2KWV B;  4N59 A;  1XLQ A;  3APD A;  2G4D B;  2LEK A;  2HJ1 A;  2J53 A;  2C7M B;  2ZCB A;  3AU4 A;  2J0J A;  2JX5 A;  2W3R A;  2E6X A;  2J7Q B;  1SE9 A;  4HPL B;  2JRH A;  2WDR B;  1E10 A;  2LVP A;  2K1F A;  4K7W A;  2JY6 A;  5AZF A;  1PYW D;  1ZXH A;  4W9K A;  3DBS A;  3JW0 X;  3GP7 A;  2W9N A;  3ZGZ A;  4BZA A;  3TEW A;  5LLI A;  2QHO A;  1DOY A;  5FR6 A;  2JYT A;  2WX1 A;  4KDL B;  3X0W A;  4BBN C;  1VDV A;  5BMG A;  4IM0 A;  1FPY A;  1WSP A;  2D3B A;  1NI2 A;  4W9D A;  5D3D A;  2GBK A;  4NY0 A;  3DQV A;  4H2A A;  2RR9 A;  1WX7 A;  3AEB B;  1C9F A;  2L76 A;  3SR6 A;  4XE0 A;  2N9P C;  3I9V 1;  2RDH A;  3VVW B;  4ARI A;  2XBB C;  2K39 A;  4PK1 A;  2NCN A;  3DHI C;  3PRP B;  1B9R A;  2LFI A;  2KDI A;  1I7H A;  2Q5W D;  4FHJ A;  4F8C B;  4OZA A;  1GPX A;  2KHW B;  1Y56 A;  2L00 B;  2XN9 C;  3DOW A;  3MHZ A;  3V62 A;  2JSV X;  4PS3 A;  1D6E C;  1RRB A;  4E71 A;  4BKS D;  3AE1 B;  1N6Z A;  3RD2 A;  3Q2A C;  1UF0 A;  3TJP A;  2LXC A;  2O2V B;  3T3O A;  2MJD A;  3MFG A;  3P4Q B;  1QLB B;  3R8B A;  2OED A;  3MJW A;  4WQO B;  4USA A;  1RWS A;  2M1M A;  1UNS A;  4MEL A;  4MM3 B;  1WWT A;  4W9E A;  3MTN B;  3QCA A;  3WIM A;  1SXT A;  1TS3 A;  3SFD B;  4EOY A;  2MP2 B;  2ZPY A;  3QK0 A;  2ZJD A;  3PLU A;  2PKO A;  4PS8 A;  2LJI A;  3WAO A;  2FUG 1;  1SIJ A;  3GS2 A;  1Q1O A;  3KQ4 A;  3JSV B;  1KOT A;  2CKH B;  1N63 A;  3MHS D;  4ANX A;  4CHK A;  1E6E B;  1N60 A;  4DDG D;  1YD8 U;  3RNE C;  3O65 B;  3J9C A;  4XDC A;  1AN8 A;  5C23 A;  1GB1 A;  5D3I B;  1NVI D;  3A9J B;  2D3G A;  4FJV B;  4HRO A;  3BK1 A;  5H92 C;  3TL5 A;  4Q2J A;  1HZ5 A;  2BS3 B;  1KLU D;  2LMC A;  3PGE A;  3ZLZ A;  1T3Q A;  3QWZ B;  2MRP A;  3ABV B;  3W5V B;  2V3S A;  5BYS A;  3EUB 2;  3ECI A;  3UF8 A;  3Q8E A;  1KFY B;  1UD7 A;  4JX1 C;  2MEK A;  2C60 A;  4IOI E;  2I1J A;  5IA7 A;  1ROE A;  2KMA A;  3PRE A;  2KYW A;  4TUU A;  4WIP A;  1I35 A;  2JYE A;  4ARC A;  3ZIM A;  1XEE A;  4RNA A;  4PT5 A;  2XNA C;  3ZRF A;  2R61 A;  1N61 A;  1NI3 A;  2J4X A;  4ANV A;  4C80 A;  2WXG A;  3CF6 E;  2B3A A;  3TSS A;  2IYD B;  2LVQ A;  3NS8 A;  2EEL A;  4KIK B;  1Z2M A;  1V1P B;  1WYW B;  2AWT A;  3OAW A;  1QOB A;  3BVZ A;  2BYV E;  3WCQ A;  4LTU A;  3H6N A;  2WLB A;  4K3C A;  3N32 A;  3L08 A;  3HHM A;  3NZ3 A;  5AUK A;  1MPE A;  3IG3 A;  1Q5W B;  4WUR A;  1BUI C;  2KQ4 X;  1SE3 A;  3BVM A;  3UIP B;  1WGR A;  1KM7 A;  2HTH A;  1EWC A;  1TS4 A;  4LNI A;  2RGF A;  2NPT B;  2BS2 B;  2QCZ A;  3PZ8 A;  1F2R I;  2N1W A;  2DYM A;  2W82 A;  1P1A A;  4WWP A;  4II2 B;  4NPN A;  1L4D B;  1P98 A;  2IO3 B;  4GN1 A;  1FNU A;  4HLE A;  3VUX A;  1UWM A;  2KAN A;  2K8B A;  3NZS A;  5D7G A;  2M17 A;  4LDT B;  5IP4 D;  1V9J A;  3HRD D;  3PVL A;  1K51 A;  3VUY A;  3L0W B;  3Q3M C;  3Q69 A;  1YJ1 A;  4JGH B;  1N62 A;  3ZXV A;  4K1R B;  2V9H A;  3DHH C;  2KX3 A;  2WNM A;  5EDS A;  5C1Z A;  2JZZ A;  1JQ4 A;  3GE8 C;  1C78 A;  3DBR B;  2BPS A;  4FUL A;  3KWV A;  1I4H A;  1WH3 A;  5EE9 A;  4ZYS A;  1P9D U;  2KDB A;  3V6E B;  4DDI D;  2HE7 A;  2XK5 B;  4C7Y A;  2Y3A A;  4LNN A;  4B0M A;  1E0Z A;  4HDO A;  4HEA 1;  2NS5 A;  1SB3 C;  1J7B A;  2BTE A;  3VQI A;  2CHZ A;  5BMH A;  4NNJ B;  2DZM A;  2FID A;  4MGI E;  2D2Q A;  3APC A;  4GLS C;  3MC0 B;  5E6J A;  4AP4 C;  1SJH D;  3GZN B;  1TZ1 A;  3DWM A;  1E8W A;  4ZRJ A;  1C4A A;  5JXV A;  4E74 A;  1N5W A;  2PW9 A;  3W5U B;  4DHJ D;  1M94 A;  1WXV A;  2V4I B;  1XT9 B;  1VJK A;  3UIN B;  1CZP A;  3ONS A;  4HCP B;  5JHA A;  1H8C A;  2DBY A;  4ITK A;  3QIJ A;  4OVV A;  3ETR A;  1D3Z A;  4B95 A;  1PGB A;  3PT2 B;  2G1E A;  4IWP A;  5DPS A;  4I6N B;  2KWU B;  4MDK E;  2ZZP B;  4G0N B;  3DBL B;  1YJI A;  3TBL D;  3VRA B;  3ZUN A;  4LJP B;  4BKG A;  1E8X A;  1S1Q B;  4WH4 A;  2WGS A;  3AEA B;  4YL8 A;  2MA9 B;  2G45 B;  2MX2 A;  1TTN A;  1UBI A;  1FM0 D;  5C2T B;  1CJE A;  2PE6 B;  2TSS A;  3TUO A;  2SAK A;  2GBR A;  4RGT A;  4XYC A;  4G3X B;  2MSE D;  2OHF A;  1YIW A;  2HJ8 A;  3VH3 B;  2LD9 A;  1NBF C;  2JF5 A;  1KRH A;  5FK9 C;  4MAC A;  1QT9 A;  4EZL A;  2DX5 B;  3FIL A;  2PJH A;  4REZ A;  2A4Z A;  3CWI A;  3CIR B;  2V1Y A;  3V6C B;  2NR2 A;  4P16 A;  3RNC C;  4BVU C;  2IND C;  3IT6 B;  5IKC M;  1RAX A;  2ZW0 A;  1WRI A;  1F2R C;  3BYT B;  2MBH A;  2WDQ B;  2I1K A;  3NUH B;  1P7F A;  4DXG A;  3AB5 A;  2KFK B;  4GDL B;  2M56 B;  4DXF A;  2WDV B;  1SGH A;  3AUL A;  3WAM A;  3NVZ A;  1T0Y A;  3AE9 B;  2LWP A;  4MSQ B;  1BT0 A;  3H7P B;  1XCQ L;  1IBX A;  3B2G A;  1TS5 A;  4AJW A;  1TY2 A;  2WXK A;  2KDF B;  4C00 A;  3L16 A;  3VAW A;  5EE1 A;  4GMV A;  3I63 C;  5G2N A;  4OW0 A;  3SEB A;  3VR9 B;  2MCN B;  1L0X B;  1V5O A;  1U4A A;  1FD6 A;  2K6Q A;  1ZGU B;  3VTU A;  1YMH E;  4WAF A;  1WI0 A;  1KLG D;  1M4V A;  5D2M B;  1WE7 A;  4KGR A;  1E8Y A;  1QF6 A;  5MPO A;  2JRI B;  1JWB D;  5J17 A;  3PHW B;  3U7D A;  4MEM A;  2K9X A;  4M8N A;  2SEB D;  4D2K A;  3DBR I;  4US9 A;  4BKS A;  3W1S C;  2KDE B;  3UGB B;  2K25 A;  4KSL C;  1XXG A;  2J42 A;  1FNW A;  2GRI A;  4ACF A;  1LQB A;  2JUO A;  4B6W A;  2D10 A;  1H4R A;  3LXF A;  4C7Z A;  2WP9 B;  3MC9 A;  5LXH A;  3HUI A;  4PYU A;  4WQM A;  2ZEQ A;  3WA0 A;  2WU2 B;  3QA8 A;  1HXY D;  1XLN A;  1VZ8 A;  3PTF C;  3NS1 A;  3GZN I;  2MBB B;  2EMT A;  1L6V A;  4YSZ B;  3KW5 B;  3FAH A;  3PHX B;  2NTS A;  3HM3 A;  1SF0 A;  3AE8 B;  4MGZ E;  3AH7 A;  3LB8 C;  1JML A;  3B08 A;  2BKF A;  4MGK E;  5HKH A;  2JWZ A;  5E6P A;  3OG5 A;  4BAX A;  4XWT A;  3A1Q A;  2JWU A;  4EZK A;  4ZRQ A;  3WAP A;  1T5X D;  4RGO S;  2IBI B;  3DBL I;  2C7H A;  2WXI A;  4N6E B;  2YVC A;  4B0E A;  3IAS 1;  2CR5 A;  4W9G A;  4P6V F;  4IC7 B;  4GU2 A;  2JT4 B;  3TMP B;  1QIL A;  1GUA B;  1MHH E;  1RLF A;  3NHE B;  3HK0 A;  4AS1 A;  2M0X A;  1NEN B;  3RZW C;  3N20 C;  1WJ4 A;  2V0G A;  4ZOH C;  2ZPN A;  2IPK D;  4WAA A;  1QOG A;  3RPF C;  2REX A;  2JZ3 B;  5HHD G;  4JLC A;  2PVG C;  2UU7 A;  4OZB A;  3KVF B;  1D5X C;  1HZ6 A;  1XO3 A;  1YJJ A;  2PEA A;  4M00 A;  3DCG A;  2N7D A;  3AE5 B;  2OOB B;  1FCL A;  4AJY B;  1T0R C;  2I2Y A;  1WJ6 A;  1VR9 A;  4RF0 A;  4WJO A;  3U30 A;  4ASW C;  2FCN A;  1FCC C;  4JQW C;  1WM2 A;  1YOV B;  1WGD A;  1ZE3 D;  1WY8 A;  1J7A A;  2K3U A;  3DVN U;  1BML C;  1EF5 A;  4DWF A;  2WXM A;  2KJ6 A;  3PO0 A;  1I4Q A;  1VCB A;  1VLB A;  2IZV B;  2KK8 A;  2LUM A;  4UDU C;  4M02 A;  2MBE A;  3UQB A;  4WJP A;  3I57 A;  2BB6 A;  3M62 B;  1V6E A;  3AV8 A;  3E56 A;  2ZCC A;  2WHI A;  1ESF A;  2KC1 A;  2GMI C;  2BVC A;  1SE4 A;  3GE3 C;  1IYF A;  1IPG A;  5BMI A;  3VRB B;  4II3 B;  4IKG A;  4US8 A;  3H1U A;  3WAN A;  3L4P A;  4DXA B;  4EE2 A;  2JXX A;  1ZUD 2;  1OFF A;  3AE7 B;  4DHZ E;  1B1Z A;  4ZYN A;  1ISN A;  2LHE A;  3ZYY X;  2ACZ B;  4KZC A;  1YNT E;  1P3Q U;  1WGK A;  2L8J A;  2BBC A;  2MHJ A;  2W55 A;  4YWG G;  1WGY A;  2IGH A;  2N9E B;  2WU5 B;  1J0G A;  2KT7 A;  3AE3 B;  1MFW A;  1HTO A;  1IGD A;  2N1V A;  4YTP B;  1FO4 A;  2VH1 A;  3Q8A A;  4CO7 A;  4K3B A;  2KWD A;  3AU5 A;  3TIX A;  4MT5 A;  3AMZ A;  3C19 A;  3KUC B;  1GAQ B;  3U7Z A;  3JYU A;  2KLC A;  1Y8R C;  3X23 A;  4GXB A;  3MJ5 A;  2D11 A;  1RFK A;  5AUI A;  1LO5 D;  1RYJ A;  1V1O A;  1KTK A;  4K7U A;  1TS2 A;  4RGN A;  4MJS A;  3Q3F A;  2ASQ A;  4DK5 A;  2O6V A;  1ENF A;  1F1H A;  1WF9 A;  2DHZ A;  2ZNV C;  1Q10 A;  2WDT B;  1EWY C;  2FCS A;  3OJ3 A;  2KQ7 A;  3QHT A;  4KKI A;  3BK2 A;  4IWO A;  2PPH A;  3ZTC A;  2L7R A;  1E90 A;  1IBX B;  1DYQ A;  2Z59 B;  4LNF A;  5DPR A;  1ZW7 A;  2JQR B;  4FLH A;  3PZD A;  1WJN A;  2A5U A;  5J18 A;  2KTR A;  3SFE B;  1K8R B;  3C0R B;  3B9J A;  1WMH A;  1STE A;  2QDF A;  3A9K A;  4A55 A;  3OWE B;  1OTR B;  3RMK C;  1TT5 B;  2WXR A;  3SU8 X;  3NJT A;  3VR8 B;  3NY5 A;  3B1L X;  3A33 B;  2BWF A;  3BVG A;  1EU3 A;  5AZH A;  2IDY A;  3Q8C A;  2KD0 A;  3DWG C;  4M0W B;  4LNK A;  1SSN A;  5G55 A;  2JVC A;  3R7Q A;  3BZD B;  4NJ7 A;  3R2T A;  4RH6 A;  3HM6 X;  2MJ3 A;  1CMX B;  4IUM B;  1ZDV A;  2AL3 A;  3AED B;  2CJN A;  4N9F 4;  4GDK A;  2L1A A;  4ZDV A;  1XCT L;  4GOC A;  2N7J A;  5BO4 B;  4AUQ C;  1VD2 A;  4ICV A;  2IGG A;  5CTR C;  1WGH A;  3H7S A;  2LAS A;  3L54 A;  2LGD A;  4W9J A;  3V60 A;  2DZI A;  4HXD A;  3P63 A;  2G3Q B;  3CST A;  1WIA A;  2QC8 A;  2GBJ A;  4KDI C;  4DBG A;  5KHO A;  1DOX A;  1JCK B;  1WZ0 A;  2KDM A;  4NZL B;  2V4L A;  3R2I A;  5EE0 A;  2M4N A;  1EO6 A;  2WXO A;  3NVW A;  4WWM A;  1Z5S B;  2FIF A;  2O6V D;  1BXT A;  3AEE B;  1FFU A;  3DBH B;  2L32 A;  2H89 B;  1C76 A;  2KWC A;  2D5G A;  4NAW A;  4KGT A;  2KVZ A;  4BBN F;  4HVB A;  4A6Q A;  2DYO A;  5DCN A;  4KX6 B;  4JE3 B;  1C4P A;  1MJD A;  3ML9 A;  5C3J B;  3EEC A;  2YLM A;  2BF8 B;  2FBW B;  4CQN A;  3N30 A;  3VXW A;  4JIO U;  4NQL B;  2LRW A;  4ANW A;  3MP9 A;  4FXC A;  2NTT A;  1WR1 A;  1ZPS A;  3N9Y C;  3DVN V;  4LCD E;  3N1X C;  2L05 A;  3A4S C;  3VTW A;  2RSU A;  2RPQ A;  2KC2 A;  3Q3N C;  3ZDM C;  3PS6 A;  5G5G A;  2GOW A;  4HKQ A;  2ZNV B;  2QIL A;  5FKA C;  3HVD A;  1UGJ A;  3IAM 1;  1PFD A;  4R3D A;  2BWE S;  1JWU D;  2KTF A;  2KOX A;  1KF6 B;  3ZTD A;  1WJU A;  4YTM B;  4J3O D;  1FXA A;  4PS7 A;  1PQS A;  4EKU A;  4G11 A;  1ZOY B;  2GBN A;  4A90 A;  3I3T B;  2K8H A;  1PUT A;  1L0V B;  1GJZ A;  3PZ7 A;  1K53 A;  1JRU A;  4A8X C;  4JL9 A;  1UEL A;  4YTN B;  1TKY A;  1WGG A;  2G9H D;  2M8S A;  4M01 A;  3CSF A;  4GIV A;  2UYZ B;  3Q3J A;  2DAF A;  5T8I A;  5E6O A;  5L83 A;  2MJE A;  1MG4 A;  1L2N A;  2EMS A;  1GB4 A;  4M8M A;  4A9A A;  4A3P A;  1IUE A;  3APF A;  5CHV C;  2PLP A;  1F52 A;  1HEZ E;  2CS4 A;  2M0A A;  3RNG C;  5AEK B;  3DVG Y;  1Q0W B;  4MM3 A;  2IY1 B;  1QZE A;  3ZO5 B;  3FC4 A;  3QQ8 B;  2BS4 B;  3IVF A;  2MP2 A;  4TKN A;  1EF1 A;  4AOF A;  1NEK B;  3ZQ4 A;  5CHW A;  1RFA A;  5BYQ A;  1F9J A;  1HQR D;  2KKC A;  1NYR A;  2RDB C;  4GSW A;  2LGS A;  4G50 A;  4MJS B;  1DGJ A;  1RM6 C;  4TV3 A;  3JSV A;  5IN7 A;  2NBW B;  2KX0 A;  2J0M A;  1UZX B;  4FHK A;  4JPS A;  2FAZ A;  2ZW1 A;  2K22 A;  1GG3 A;  4MSM B;  1FNV A;  1OQR A;  1WXA A;  4HK2 A;  1ZXI A;  2WXL A;  4N58 A;  1YQ3 B;  1YQ4 B;  1HE8 A;  4NQK E;  1T6B X;  1E7P B;  3A9J A;  3U2S C;  1WM3 A;  4OVU A;  3LJ3 A;  3QX1 A;  1OEY J;  3ZJU A;  2KTR B;  3ML8 A;  2DEN B;  5DPT A;  4OHJ A;  3KH0 A;  2NBU A;  1MVK A;  1J7C A;  1GNU A;  4XZ4 A;  4HCN B;  3ALB A;  3K9O B;  1X1M A;  2LVO A;  4A3O A;  1YN3 A;  3TEZ A;  1MI0 A;  4IDI A;  2YEP F;  3C8Y A;  4BOS C;  3R3M A;  2VZK B;  3RNF C;  2RMM A;  4DHJ B;  5G5H A;  1LGR A;  4IW0 A;  2GLS A;  1E9M A;  4W9L A;  2L0T A;  3DBH I;  3Q8B A;  4I6L B;  4YT0 B;  2H88 B;  4ZHO A;  2AQ1 B;  2IO2 B;  2M19 A;  3RYT A;  4S17 A;  1V2Y A;  5LXI B;  4W9I A;  1I4R A;  1I4P A;  1T0S C;  2DZJ A;  2D07 B;  1AW7 A;  2BT6 A;  2INP E;  3EFC A;  1TBE A;  4L1B A;  4YSY B;  5JZE B;  3AE2 B;  2N9X A;  1P7E A;  4LLG M;  4KIK A;  3ZXR A;  1V1P A;  2BYE A;  5L95 C;  3PRM B;  4LJO B;  4BOZ B;  3EFU A;  5H8Y E;  2FUH B;  1E8Z A;  4OZC A;  4MH8 A;  1L7Y A;  1C79 A;  1V86 A;  3AE4 B;  3DDC B;  2KJH B;  1LXD A;  1CQV A;  1CK1 A;  1L5P A;  1A5R A;  2NPT A;  4I6P A;  2QIE B;  1A70 A;  5GXG B;  2MBO A;  4ZRI A;  3QJZ A;  3W1Y A;  4DHZ B;  3NVV A;  2MLB A;  3EA6 A;  3Q6B A;  3H8H A;  4WWN A;  3T8M A;  1N5X A;  2KXJ A;  3K9P B;  2PE9 A;  4FN2 A;  3RT3 B;  3ENE A;  4EEW A;  2AQ2 B;  4W9H A;  2CJO A;  2N0S B;  5JH5 C;  2BGF A;  2JXT A;  5HG2 A;  1YX6 B;  2PMV A;  4NAW B;  1FXI A;  3ZKJ C;  1KLV A;  3VUW A;  1SBB B;  1GC6 A;  2FCM A;  3RZF A;  1WRD B;  1PGA A;  3P4S B;  5HFY A;  5CX3 A;  1JWA D;  4TQ0 A;  2X8X X;  2Y5B B;  4FBJ B;  4C4V A;  3QAR A;  3EC8 A;  4FJZ A;  3KLS X;  3P1M A;  1JRP A;  1YQB A;  2XK5 A;  3PV1 A;  1ACC A;  4EFO A;  3NRZ A;  2VRR B;  3LDZ E;  4RFB A;  2MWS B;  2QSD A;  4RMA A;  2DAJ A;  3IBE A;  2W3S A;  1WXS A;  1LFD A;  2HDE A;  3B2F A;  2NBV B;  3KWL A;  4KVG B;  1HA5 A;  1F0Z A;  1E7V A;  3DVG X;  2MBQ A;  3AI5 A;  5EE3 A;  3V61 A;  3KUD B;  4LK0 M;  2QMT A;  3WAL A;  1ZDX A;  2LRU A;  4HPM B;  2ICI A;  3BYY B;  5TSS A;  2NVU I;  2KVR A;  2Y5P A;  1FRD A;  4EUT A;  1L4Z B;  1S3S G;  5GMV A;  2LGY A;  1TYG B;  5AZG A;  4DQO C;  3O13 A;  4ANU A;  3PRZ A;  3SHQ A;  4O1N A;  3T3N A;  2L52 A;  1D4B A;  4P1B C;  2Y5C A;  1AWD A;  1V97 A;  4RM8 A;  3IFW B;  1WR6 E;  2PIA A;  4TMA B;  5TR5 A;  2WXQ A;  4RF1 A;  1WXQ A;  2R2Q A;  1G6J A;  1T0Q C;  1OQQ A;  2DNF A;  1HTQ A;  2NMQ A;  3FIL B;  1QKZ A;  2INN E;  1PDX A;  3VH4 B;  3NVY A;  2L0F A;  1R4M B;  4URK A;  3ZNI D;  2C7N B;  4XWW A;  2WXN A;  2L3Z A;  3LYY A;  1JWM D;  4NJC A;  2AYO B;  2RD0 A;  2W54 A;  1PGX A;  1WXM A;  2IGD A;  2N9L A;  4MH0 E;  3ZDT A;  3JVZ X;  2BW2 A;  2KO3 A;  1SIF A;  2OJW A;  3URY A;  4LDT D;  3M63 B;  1V49 A;  1UWX A;  2I38 A;  1FIQ A;  2KJR A;  4NAM A;  3RN9 C;  2EKI A;  4KSK C;  5IAA C;  1ET6 A;  3N3K B;  2KFK A;  2RPV A;  4GDL A;  3TEY A;  3MC8 A;  2GBM A;  4IG7 B;  3DHG C;  1K52 A;  2AL6 A;  4E3C A;  2X38 A;  1OGW A;  2C5L C;  2QEJ C;  3UQA A;  4J6I A;  4K81 A;  1ZKH A;  3H7P A;  4ICU A;  4ZHP A;  4OVZ A;  4TQ1 A;  3W2D A;  4NJ6 A;  2J52 A;  2QJL A;  1IGC A;  5LNK 1;  2ZVO A;  4CYE A;  2G4S A;  2ZVN A;  1GOZ A;  2KZR A;  2DYB A;  4LNO A;  3T9L A;  3E9S A;  2Z0D B;  2GI9 A;  1LM8 B;  1WFY A;  1TY0 A;  3U52 E;  2KNB A;  2WXF A;  1JAL A;  3W9C B;  3ZJV A;  4F7Z A;  1KJT A;  4TSS A;  2FNJ B;  3U4E G;  4IM3 A;  1TZO A;  2HD5 B;  1TKG A;  1XLO A;  5FR3 A;  5IO9 A;  2JU6 X;  1YN4 A;  2KAJ A;  1EU4 A;  2LGI A;  3QAQ A;  3KYD D;  2KMC A;  1ZP0 B;  3IXS A;  3VTV A;  1L0Y B;  5IOI A;  4BFR A;  3AM9 A;  1NYQ A;  2L83 A;  3I5J C;  4KGS A;  4FJY A;  2AX5 A;  4YXD B;  3L13 A;  4IM2 A;  1NDD A;  1UBQ A;  3Q3O C;  3AEF B;  3HIZ A;  2RDG A;  3ZJT A;  3RNA C;  1WE6 A;  3GOE A;  3N1Z C;  1AAR A;  3M3J A;  3AXC A;  1V80 A;  1I4G A;  4HJG E;  3BWU D;  4BKT A;  3TCA A;  2KN4 A;  1FRR A;  3ZW3 A;  4HPP A;  4L2Y A;  1SEB D;  4KZ0 A;  5D94 A;  4F1S A;  2JZP A;  3P4P B;  2XEW A;  3ZNG C;  2LUE A;  2KFJ A;  1SJE D;  1J8C A;  3ZVV A;  2LJ5 A;  4P7I A;  3P2B A;  2JPH A;  3A1Q B;  4FAD A;  3Q8F A;  3BII D;  3KUZ A;  2CU3 A;  2WXJ A;  2WQY B;  4K7S A;  2E3T A;  1OQY A;  4HDQ A;  1R4N B;  4HRS A;  3L10 B;  1AYF A;  3DPD A;  1YX5 B;  4C56 C;  5I4D A;  4ZRK A;  2N4F A;  3AEG B;  4XGA B;  4JWS C;  3GB1 A;  4ZRP A;  2J0K A;  3D32 A;  2K0P A;  5J2R A;  4EZJ A;  2D3A A;  3CMM B;  2KLG A;  1E7U A;  4XDD A;  1FMA D;  3UI3 A;  2UWQ A;  4W9C A;  1KH0 A;  2IJ0 A;  2DZK A;  2WWZ A;  3B0A A;  1R4M I;  1UH6 A;  1FEH A;  4QAY A;  1JW9 D;  4W9F A;  1SE2 A;  4C4V B;  3H9D A;  2ON8 A;  1EUV B;  4WJN A;  4XX5 A;  4PYZ A;  4HWI B;  1QQR A;  2IY0 B;  2KAC A;  3PSE B;  2AQ3 B;  2MH7 A;  3R7R A;  3VFK A;  4YSX B;  4X57 B;  2AEH A;  1L6U A;  2IO0 B;  3EHV A;  4S0R A;  3EGR A;  2INC C;  5BYR A;  4KV2 A;  2VZK D;  1J19 A;  3RCZ A;  1XF5 L;  2MW5 A;  3HVZ A;  4HKZ E;  1JWS D;  4MGY E;  2BYT A;  2K8C A;  3P4R B;  1TGZ B;  4RGM A;  3NG0 A;  5D6J B;  3IHP C;  1QOF A;  2IO1 B;  2BYF A;  2FCQ A;  4WWO A;  1JRO A;  3ZRC A;  2C9W B;  2CHW A;  3BIN A;  3L17 A;  1C77 A;  2PVO D;  4WJQ A;  2HTM E;  3QC8 B;  5JHB A;  3S2A A;  3SD5 A;  2O2V A;  1MHX A;  1D5M C;  1TJE A;  1VRA B;  2V3N A;  2MQJ A;  3P42 A;  2LXA A;  1DOI A;  3NZU A;  2LI5 A;  1P0R A;  3OJ4 B;  3RUI B;  3ZNZ B;  2YEP B;  1V8C A;  2WXH A;  2B76 B;  2VH2 A;  3VHT C;  2V3P A;  1VZ7 A;  1XD3 B;  3N1Y C;  2N7E A;  3V3X A;  2BB5 A;  2KN5 A;  2N9K A;  3M95 A;  3BY4 B;  2Z0E B;  4AQ7 A;  1QOA A;  1EM7 A;  4KKJ A;  2EKE C;  1C1Y B;  3RI7 C;  4FA6 A;  1V5T A;  2R2O A;  1I4X A;  1YN5 A;  3KYC D;  4GB9 A;  3W1S A;  1XQQ A;  1WYG A;  2O6V B;  1WX8 A;  3ZNH B;  1V81 A;  4GGQ A;  3A4R A;  1UGM A;  2LZ6 A;  1C4C A;  1F77 A;  1E5W A;  1D5Z C;  1FFV A;  1FXT B;  1XLP A;  4XC2 A;  4RM9 A;  3FKY A;  2K6D B;  2DWQ A;  2Z8L A;  1ET9 A;  1MG8 A;  1WZ3 A;  3RFZ B;  1WMH B;  2BQQ A;  4A20 A;  2WS3 B;  2FE8 A;  4B9K A;  1IP9 A;  1R4N I;  3PPA A;  2WXP A;  5E6N A;  3V05 A;  2ONQ A;  3AE6 B;  3A9K B;  4RCO A;  2LGX A;  1R7S A;  1OEY A;  1VZ6 A;  1TIF A;  5DPW A;  1UUP A;  4JWU C;  2K5P A;  3SDL C;  5HI1 A;  2BKR B;  3Q14 C;  3U8Z A;  3IT4 B;  1I42 A;  4HJK A;  2CHX A;  3VDZ A;  1C3T A;  3OLM D;  2KQS A;  4P1C C;  2KMM A;  2CU1 A;  2OJR A;  2WYQ A;  3AEC B;  3UIO B; 
#chains in the Genus database with same CATH homology
 3R66 C;  5G55 A;  4I6N B;  2KWU B;  4MDK E;  2ZZP B;  2JVC A;  4G0N B;  3TBL D;  1S3S G;  3R7Q A;  3ZUN A;  4LJP B;  5GMV A;  4BKG A;  2LGY A;  1E8X A;  1S1Q B;  4NJ7 A;  5KHQ A;  2WX0 A;  5AZG A;  4ANU A;  1GC7 A;  3PRZ A;  1WX9 A;  4IWQ A;  4YL8 A;  3HM6 X;  3RUL A;  3SHQ A;  5CHF A;  1CMX B;  2MA9 B;  4IUM B;  2G45 B;  2MX2 A;  4GDK B;  2AL3 A;  1TTN A;  4N9F 4;  1UBI A;  4AWJ A;  2PE6 B;  3PLV A;  4RM8 A;  4GDK A;  3IFW B;  1WR6 E;  2GBR A;  5TR5 A;  4ZDV A;  4GOC A;  3NOB A;  4G3X B;  2MSE D;  2KWV B;  2R2Q A;  3APD A;  1G6J A;  2G4D B;  1YIW A;  2HJ8 A;  5BO4 B;  3VH3 B;  2LD9 A;  4AUQ C;  1NBF C;  2JF5 A;  1VD2 A;  4ICV A;  5CTR C;  1WGH A;  3H7S A;  3VH4 B;  2L0F A;  2LAS A;  4EZL A;  3L54 A;  2DX5 B;  2LGD A;  2C7M B;  2PJH A;  4URK A;  2ZCB A;  3AU4 A;  2J0J A;  4W9J A;  3V60 A;  3ZNI D;  2C7N B;  2DZI A;  4HXD A;  2G3Q B;  2L3Z A;  3CST A;  2J7Q B;  1SE9 A;  4HPL B;  2JRH A;  2A4Z A;  1WIA A;  2GBJ A;  4KDI C;  2AYO B;  4DBG A;  2RD0 A;  2LVP A;  5KHO A;  1WXM A;  2K1F A;  2V1Y A;  2JY6 A;  4K7W A;  4MH0 E;  3V6C B;  5AZF A;  3ZDT A;  1WZ0 A;  2NR2 A;  3JVZ X;  4BVU C;  2KO3 A;  1SIF A;  4W9K A;  1RAX A;  3DBS A;  2V4L A;  4LDT D;  2MBH A;  3JW0 X;  2I1K A;  3M63 B;  2W9N A;  1V49 A;  1EO6 A;  2M4N A;  1Z5S B;  2KFK B;  2FIF A;  2O6V D;  4GDL B;  2KJR A;  5LLI A;  2QHO A;  5FR6 A;  1SGH A;  4KSK C;  5IAA C;  2KWC A;  2WX1 A;  3AUL A;  2KFK A;  3N3K B;  3WAM A;  4GDL A;  4NAW A;  1T0Y A;  4BBN F;  4HVB A;  4KDL B;  2DYO A;  5DCN A;  3X0W A;  4BBN C;  2GBM A;  2LWP A;  4MSQ B;  1BT0 A;  4IG7 B;  3H7P B;  4AJW A;  2AL6 A;  4IM0 A;  3ML9 A;  4E3C A;  2KDF B;  2YLM A;  2BF8 B;  3EEC A;  3L16 A;  3VAW A;  1NI2 A;  1OGW A;  2C5L C;  3UQA A;  3N30 A;  4J6I A;  4K81 A;  1ZKH A;  3H7P A;  4GMV A;  4ICU A;  4JIO U;  3VXW A;  5G2N A;  4W9D A;  4TQ1 A;  4NQL B;  4NJ6 A;  2LRW A;  2GBK A;  2MCN B;  4NY0 A;  4ANW A;  3DQV A;  1V5O A;  2ZVO A;  1U4A A;  4CYE A;  2G4S A;  2ZVN A;  2KZR A;  2RR9 A;  2DYB A;  1WX7 A;  1WR1 A;  3T9L A;  2L76 A;  2K6Q A;  1ZGU B;  2Z0D B;  3DVN V;  4LCD E;  1LM8 B;  2N9P C;  1WFY A;  2L05 A;  3VTU A;  2KNB A;  3VVW B;  3A4S C;  2XBB C;  3VTW A;  1WI0 A;  2RPQ A;  2RSU A;  4F7Z A;  5D2M B;  1KJT A;  2KC2 A;  1WE7 A;  2K39 A;  3ZDM C;  2FNJ B;  1E8Y A;  3PS6 A;  4IM3 A;  2NCN A;  3PRP B;  2HD5 B;  2GOW A;  2KDI A;  2ZNV B;  2JRI B;  5J17 A;  4F8C B;  4FHJ A;  3PHW B;  3QAQ A;  2KHW B;  3KYD D;  2KMC A;  2BWE S;  3U7D A;  4MEM A;  3VTV A;  2KTF A;  2KOX A;  4M8N A;  2L00 B;  1WJU A;  3ZTD A;  4BFR A;  3DBR I;  3DOW A;  4PS7 A;  4FJY A;  3V62 A;  1PQS A;  4EKU A;  4BKS A;  4G11 A;  3L13 A;  2GBN A;  2KDE B;  4PS3 A;  3UGB B;  3W1S C;  3I3T B;  2K25 A;  1RRB A;  2K8H A;  4IM2 A;  4KSL C;  1GJZ A;  1NDD A;  1UBQ A;  4E71 A;  4BKS D;  1JRU A;  3HIZ A;  4JL9 A;  1UEL A;  1WGG A;  3RD2 A;  1WE6 A;  2M8S A;  1LQB A;  2JUO A;  3GOE A;  1AAR A;  3CSF A;  3AXC A;  1V80 A;  2D10 A;  1H4R A;  3M3J A;  4B6W A;  4GIV A;  2UYZ B;  3Q3J A;  5LXH A;  3TJP A;  2LXC A;  2O2V B;  2DAF A;  4BKT A;  3TCA A;  3ZW3 A;  5E6O A;  4PYU A;  5L83 A;  4KZ0 A;  5D94 A;  1L2N A;  3MJW A;  2ZEQ A;  4WQO B;  2EMS A;  3WA0 A;  3QA8 A;  4F1S A;  4M8M A;  4A3P A;  3PTF C;  2M1M A;  3GZN I;  2XEW A;  2MBB B;  2EMT A;  3KW5 B;  2LUE A;  2KFJ A;  3APF A;  4MEL A;  3PHX B;  5CHV C;  3ZNG C;  3ZVV A;  3HM3 A;  2LJ5 A;  1J8C A;  4P7I A;  3P2B A;  4W9E A;  4MGZ E;  3MTN B;  2CS4 A;  2JPH A;  3A1Q B;  3QCA A;  3WIM A;  4FAD A;  5AEK B;  3B08 A;  2BKF A;  4MGK E;  3DVG Y;  5HKH A;  1Q0W B;  4MM3 A;  4EOY A;  2IY1 B;  2MP2 B;  2JWZ A;  5E6P A;  3KUZ A;  2ZPY A;  1QZE A;  3A1Q A;  3QK0 A;  3ZO5 B;  4EZK A;  3WAP A;  3QQ8 B;  2ZJD A;  3IVF A;  2IBI B;  3PLU A;  2MP2 A;  4TKN A;  1EF1 A;  4K7S A;  4AOF A;  4PS8 A;  1OQY A;  4HDQ A;  5CHW A;  1RFA A;  3DBL I;  2C7H A;  1F9J A;  3L10 B;  3WAO A;  3DPD A;  1YX5 B;  2YVC A;  2KKC A;  4ZRK A;  2CR5 A;  2N4F A;  4W9G A;  1Q1O A;  3JSV B;  4GSW A;  4G50 A;  4IC7 B;  4GU2 A;  1KOT A;  2JT4 B;  4MJS B;  3TMP B;  2CKH B;  1GUA B;  3MHS D;  4ANX A;  1RLF A;  3NHE B;  3HK0 A;  2M0X A;  4TV3 A;  3RZW C;  4CHK A;  3JSV A;  2J0K A;  3D32 A;  1WJ4 A;  2NBW B;  2KX0 A;  4DDG D;  2ZPN A;  2J0M A;  1UZX B;  5J2R A;  4WAA A;  1YD8 U;  4FHK A;  4EZJ A;  2FAZ A;  2REX A;  2JZ3 B;  3O65 B;  3CMM B;  4JLC A;  1GG3 A;  4MSM B;  5C23 A;  1WXA A;  2KLG A;  1E7U A;  3KVF B;  4HK2 A;  3A9J B;  2D3G A;  2PEA A;  2UWQ A;  4W9C A;  3DCG A;  4FJV B;  2N7D A;  2DZK A;  2WWZ A;  1HE8 A;  3B0A A;  4NQK E;  2OOB B;  3TL5 A;  4AJY B;  3A9J A;  1R4M I;  1WM3 A;  1UH6 A;  3LJ3 A;  3QX1 A;  4OVU A;  1WJ6 A;  3PGE A;  1OEY J;  4WJO A;  3U30 A;  2KTR B;  3ZLZ A;  3ML8 A;  4W9F A;  2DEN B;  5DPT A;  3KH0 A;  4ASW C;  2NBU A;  3QWZ B;  2MRP A;  2V3S A;  1GNU A;  3H9D A;  2FCN A;  4XZ4 A;  4JQW C;  3ECI A;  3UF8 A;  1EUV B;  1WM2 A;  4HCN B;  4WJN A;  3ALB A;  1WGD A;  1X1M A;  2LVO A;  1WY8 A;  3K9O B;  4XX5 A;  4A3O A;  1UD7 A;  4PYZ A;  4HWI B;  3DVN U;  2IY0 B;  4BOS C;  1EF5 A;  3R3M A;  2C60 A;  4DWF A;  3PSE B;  2I1J A;  5IA7 A;  3R7R A;  3VFK A;  2KMA A;  4DHJ B;  2KJ6 A;  3PRE A;  4TUU A;  1I35 A;  1VCB A;  4IW0 A;  2IZV B;  2AEH A;  4X57 B;  2IO0 B;  2KK8 A;  3EHV A;  4W9L A;  3ZIM A;  2MBE A;  2L0T A;  3DBH I;  3UQB A;  4WJP A;  3ZRF A;  3M62 B;  4I6L B;  1V6E A;  4KV2 A;  2ZCC A;  1J19 A;  3RCZ A;  4ANV A;  2IO2 B;  2MW5 A;  2KC1 A;  3RYT A;  2GMI C;  1IYF A;  1IPG A;  1V2Y A;  3CF6 E;  4II3 B;  5LXI B;  4MGY E;  2K8C A;  2B3A A;  3H1U A;  4W9I A;  3WAN A;  4DXA B;  2DZJ A;  1TGZ B;  2D07 B;  2IYD B;  2JXX A;  2LVQ A;  1Z2M A;  3NS8 A;  4KIK B;  3IHP C;  5D6J B;  1WYW B;  2AWT A;  3OAW A;  1TBE A;  2BYV E;  5JZE B;  4DHZ E;  2IO1 B;  3H6N A;  2BYF A;  2FCQ A;  2N9X A;  4WWO A;  3ZRC A;  2C9W B;  2CHW A;  3BIN A;  4ZYN A;  3N32 A;  3L17 A;  4KIK A;  1ISN A;  3L08 A;  4KZC A;  3HHM A;  4WJQ A;  2BYE A;  5L95 C;  3IG3 A;  3PRM B;  1Q5W B;  3QC8 B;  5JHB A;  1P3Q U;  3S2A A;  3SD5 A;  2O2V A;  4LJO B;  2L8J A;  4BOZ B;  3EFU A;  1WGY A;  2N9E B;  1J0G A;  2FUH B;  1E8Z A;  2MQJ A;  2LXA A;  3UIP B;  1WGR A;  1KM7 A;  3NZU A;  2LI5 A;  1L7Y A;  1P0R A;  2HTH A;  2N1V A;  3OJ4 B;  1V86 A;  2RGF A;  3RUI B;  2NPT B;  3ZNZ B;  4CO7 A;  3DDC B;  2KJH B;  1LXD A;  3AU5 A;  3TIX A;  2N1W A;  2DYM A;  3VHT C;  1P1A A;  3KUC B;  1A5R A;  4WWP A;  2NPT A;  4I6P A;  4II2 B;  1XD3 B;  2N7E A;  4NPN A;  3JYU A;  2KLC A;  1P98 A;  2KN5 A;  1Y8R C;  3X23 A;  3M95 A;  2MBO A;  2IO3 B;  4GN1 A;  4ZRI A;  3BY4 B;  4GXB A;  2Z0E B;  3QJZ A;  3W1Y A;  2D11 A;  4DHZ B;  4HLE A;  3VUX A;  2EKE C;  1C1Y B;  2KAN A;  2K8B A;  3NZS A;  4FA6 A;  1V5T A;  2R2O A;  5D7G A;  2M17 A;  4LDT B;  2MLB A;  1V9J A;  3KYC D;  4GB9 A;  3W1S A;  3PVL A;  4K7U A;  1XQQ A;  4WWN A;  2O6V B;  3VUY A;  1WX8 A;  3T8M A;  3L0W B;  3ZNH B;  4MJS A;  2KXJ A;  1V81 A;  2ASQ A;  3K9P B;  3Q3F A;  4GGQ A;  2PE9 A;  4FN2 A;  4DK5 A;  1YJ1 A;  3A4R A;  1UGM A;  2LZ6 A;  3RT3 B;  2O6V A;  3ENE A;  4JGH B;  4EEW A;  4W9H A;  1WF9 A;  2DHZ A;  4K1R B;  2ZNV C;  1E5W A;  2WDT B;  5JH5 C;  2BGF A;  2FCS A;  1YX6 B;  3OJ3 A;  2KX3 A;  5EDS A;  4NAW B;  5C1Z A;  2KQ7 A;  1FXT B;  3QHT A;  2JZZ A;  3ZKJ C;  1KLV A;  3VUW A;  4IWO A;  2PPH A;  1GC6 A;  4XC2 A;  2FCM A;  2L7R A;  4RM9 A;  1E90 A;  1WRD B;  2BPS A;  3RZF A;  3ZTC A;  4FUL A;  2Z59 B;  5DPR A;  1WH3 A;  2K6D B;  1ZW7 A;  1P9D U;  5CX3 A;  2KDB A;  4FLH A;  3V6E B;  3PZD A;  1WJN A;  2A5U A;  1MG8 A;  1WZ3 A;  5J18 A;  4DDI D;  2KTR A;  4TQ0 A;  1WMH B;  2Y5B B;  4A20 A;  1K8R B;  2HE7 A;  4FBJ B;  2XK5 B;  4B9K A;  1IP9 A;  1R4N I;  3QAR A;  3PPA A;  3C0R B;  5E6N A;  3EC8 A;  4HDO A;  4FJZ A;  1WMH A;  3A9K B;  1YQB A;  2XK5 A;  3PV1 A;  4EFO A;  2LGX A;  2VRR B;  3LDZ E;  2NS5 A;  1OEY A;  3VQI A;  2CHZ A;  3A9K A;  4NNJ B;  2DZM A;  2MWS B;  4RMA A;  1OTR B;  5DPW A;  2FID A;  4MGI E;  2DAJ A;  2D2Q A;  3APC A;  3IBE A;  1WXS A;  1LFD A;  3SDL C;  4AP4 C;  2BKR B;  1TZ1 A;  3SU8 X;  1E8W A;  2NBV B;  4ZRJ A;  3U8Z A;  4E74 A;  4DHJ D;  4KVG B;  1I42 A;  4HJK A;  1M94 A;  1E7V A;  3DVG X;  1WXV A;  2MBQ A;  3AI5 A;  3NY5 A;  1XT9 B;  3B1L X;  2CHX A;  3V61 A;  3KUD B;  3UIN B;  3VDZ A;  3A33 B;  3ONS A;  3WAL A;  4HCP B;  2BWF A;  5JHA A;  1C3T A;  3OLM D;  1H8C A;  2LRU A;  4HPM B;  5AZH A;  2KQS A;  3QIJ A;  4OVV A;  1D3Z A;  2NVU I;  2CU1 A;  2KVR A;  4B95 A;  2OJR A;  2WYQ A;  3PT2 B;  4IWP A;  3UIO B;  2KD0 A;  4EUT A;  4M0W B;  5DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...