2N7JA

Sidechain chi1 distribution in b3 domain of protein g from extensive sets of residual dipolar couplings
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Immunoglobulin G-binding protein G
publication title Side Chain Conformational Distributions of a Small Protein Derived from Model-Free Analysis of a Large Set of Residual Dipolar Couplings.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n7jA00
3GB1A 2LUMA 2KACA 4HKZE 1XF5L 2KWDA 5BMHA 2LHEA 4WH4A 1XCTL 1HZ6A 4OZCA 1GB4A 2ONQA 1F2RI 5JXVA 2OEDA 1QKZA 1YNTE 1P7EA 2ZW1A 5BMGA 1F2RC 2EELA 1PGAA 1UWXA 4IOIE 4D2KA 1XCQL 4HJGE 1IBXA 1K53A 4IKGA 1FD6A 2QMTA 2KQ4X 2JWUA 1KH0A 1MHXA 1FCCC 1PGBA 2IGGA 1ZXHA 3FILB 1K51A 1K50A 1Q10A 2IGHA 1GB1A 5HHDG 3MP9A 2N9KA 2LHDA 2GB1A 1D4BA 2KN4A 1FCLA 1K52A 2K0PA 1JMLA 2J53A 1HEZE 4OZBA 4KGSA 2NMQA 4KGRA 1PGXA 2JXTA 2RMMA 3UI3A 2ON8A 5HFYA 2PLPA 2I2YA 1EM7A 2JZPA 1MVKA 2IGDA 4MACA 2RPVA 1HZ5A 4GLSC 1IBXB 1MPEA 1IGDA 2LGIA 1C9FA 2JU6X 5BMIA 5HG2A 3FILA 1P7FA 2N9LA 2N7JA 2PW9A 2I38A 5HI1A 2PTLA 2ZW0A 1YMHE 2GI9A 4OZAA 2J52A 1IGCA 1MI0A 2KDMA 1MHHE 2JSVX 4KGTA 2QSDA 3V3XA
chains in the Genus database with same CATH superfamily
5KHOA 3L0WB 1TS2A 2DZMA 2HD5B 1XCTL 3HM3A 3RNEC 4LNKA 4OZCA 4TV3A 4BAXA 2KLGA 2WDTB 4N6EB 2XBBC 4RM8A 4XYCA 3O65B 4WJOA 3MFGA 2L0FA 3A1QB 1K53A 4A20A 3VHTC 3Q14C 1KTKA 2BS2B 3SDLC 3OG5A 5FKAC 1KF6B 3Q2AC 5LLIA 3DVGX 3NRZA 3N30A 4OVUA 1ZP0B 2KC1A 2KAJA 2WXMA 1PYWD 1XT9B 3FKYA 4YSZB 3NS1A 3L16A 1I35A 5AEKB 2J0KA 1RFKA 2WDQB 2DHZA 4C00A 2BYFA 3LB8C 1VCBA 2CKHB 3DWMA 1ET6A 4RNAA 3ONSA 1LQBA 3R7RA 1TIFA 5E6NA 4IWPA 2LGIA 3AE6B 2KYWA 3HVZA 2QILA 3BYYB 4GGQA 3V62A 3ALBA 1STEA 2KJ6A 3W5UB 3EGRA 3M62B 1HE8A 2CR5A 2AL3A 4NAMA 3ZJVA 3N9YC 4DDID 3AE9B 5H92C 2ZPNA 1WY8A 2KACA 4P1BC 2FBWB 3AE5B 4M01A 4RCOA 2NS5A 4W9CA 3TMPB 1JW9D 2A5UA 3H7PB 4HCNB 3RNFC 3OLMD 1EU4A 3EC8A 3DHHC 1E8WA 1LO5D 1PGAA 3OWEB 1GC6A 2KKCA 3V6EB 2MH7A 3UF8A 3IT4B 1V5OA 2JT4B 1DOXA 4W9JA 3TBLD 1AYFA 4WJQA 4KZCA 3V60A 3AMZA 4JE3B 2Y5BB 4FJVB 3OJ4B 3BVGA 1ESFA 4FLHA 4W9GA 3MC0B 2D2QA 3SU8X 2FAZA 4KX6B 4OHJA 1QOGA 2LI5A 1T0YA 1R4MI 3M95A 1V1OA 3AE7B 3LXFA 3R8BA 3NVVA 3A9JA 2FUHB 4DXFA 4WJPA 4AWJA 2K6DB 3CSFA 4ZHOA 1MVKA 2FCMA 3HIZA 2QJLA 1EF5A 2WNMA 1HZ5A 2V1YA 4BOSC 1MPEA 1SB3C 4P6VF 4DXAB 2IPKD 3Q3MC 3GE3C 1L7YA 1UUPA 3NS8A 4IW0A 4B9KA 1V81A 1VZ8A 1CJEA 2ZW0A 3BVMA 1SIJA 1YX6B 2DAFA 2J52A 1VD2A 1WWTA 3OJ3A 4HXDA 4US8A 1IGCA 2KWCA 3AULA 3N1ZC 4FADA 1UF0A 2HTHA 2JSVX 2PEAA 1HTOA 1QILA 4BFRA 1U4AA 4C80A 5D3IB 4YTMB 3A9KB 1HZ6A 2WU2B 4L2YA 2JWZA 1YNTE 1ROEA 4MH8A 1M94A 2RDBC 2BGFA 1OTRB 1L4DB 3A33B 1UWXA 4X57B 2V0GA 3U52E 2W55A 2IZVB 1XO3A 2QEJC 3EFUA 4B0MA 4P16A 4A8XC 5JZEB 4EFOA 1ZW7A 4K1RB 2MP2B 1C3TA 1SBBB 4ZRPA 1FMAD 1V2YA 2G9HD 4NY0A 4FXCA 2G4SA 2L52A 1WM2A 4TUUA 2KD0A 3L54A 1J8CA 2L05A 2QHOA 1NI3A 1VR9A 2HTME 3DVGY 1EUVB 4GDKA 5HFYA 1ZE3D 1M4VA 2LXAA 4KZ0A 2V9HA 1Z2MA 4K7UA 5IKCM 1PFDA 3TEYA 2IO3B 1P1AA 2LRWA 1FRDA 3ZLZA 1CMXB 1XLOA 2DENB 4IG7B 4RGTA 1RYJA 2KZRA 3U8ZA 1R7SA 2LMCA 2BF8B 4BKSD 3A9JB 1WR6E 2K6QA 1YMHE 3DVNV 4DDGD 2CJNA 2D3CA 3CMMB 3RUIB 2BT6A 1VLBA 4WAFA 4E74A 2L7RA 2KTRA 5AUIA 4MGIE 4NAWA 4XZ4A 1KRHA 2EELA 4ZDVA 2BYEA 2MX2A 5LXHA 4JGHB 4OVZA 3UQBA 2JVCA 3ECIA 1QOBA 4MELA 1XLPA 2IDYA 3AI5A 5BYRA 3T3NA 5EE1A 4GOCA 4TQ1A 4M02A 1HQRD 3GOEA 3ZDTA 4YXDB 2NVUI 1Q10A 4PS7A 1KLVA 2GRIA 4DK5A 1E9MA 2HJ1A 1C76A 2QIEB 2GB1A 3QC8B 4MSMB 3ZTDA 3KYCD 2ZCBA 1JWBD 1TYGB 1N6ZA 3R2TA 1MG4A 2V3SA 2KWVB 4M8NA 1D5MC 2KO3A 1WGDA 3DDCB 3VAWA 1VJKA 2NMQA 3PHXB 2KN5A 1AN8A 2J42A 2PLPA 4B0EA 4F7ZA 4S17A 4MACA 3ZNID 2WXPA 5FK9C 2Z0EB 4WWMA 1UWMA 2CS4A 4KKJA 1FNUA 4BBNC 3AU5A 2M0XA 3VTUA 3PO0A 2N9LA 2I38A 2V4IB 4MM3B 2PIAA 1SXTA 4ZRJA 2DBYA 4XX5A 2C7HA 3MC8A 2L32A 2MWSB 1E5WA 2BW2A 1V80A 3VDZA 2WX1A 1NBFC 2ZJDA 4ANXA 2WQYB 4WQOB 2ASQA 3AV8A 3WCQA 1GPXA 3B0AA 1GNUA 2WU5B 3H9DA 2L8JA 3APDA 4G3XB 2WXJA 1YX5B 3P4RB 4HLEA 4ZYSA 2K8CA 2CU1A 2WXKA 2KTRB 1NYQA 1UGJA 1A70A 1YJ1A 4M0WB 3PRMB 1SJHD 2D07B 4CYEA 3AXCA 4F1SA 1YJJA 1FEHA 1N61A 2INPE 1DGJA 4EOYA 2WXOA 4LCDE 3VR9B 4P7IA 3PRPB 3M63B 5BYQA 4C7ZA 3DHGC 1J19A 3TL5A 5C23A 1FIQA 4M00A 1TS5A 3NOBA 2R2OA 4B95A 1P98A 3S2AA 3TSSA 2KLCA 2MHJA 2A4ZA 2JXTA 3UI3A 2C9WB 2C5LC 3NY5A 3JYUA 3RPFC 4HDOA 3T9LA 3RNGC 1IGDA 2W9NA 1E8YA 3IFWB 2FIFA 3TCAA 3MHSD 4ZOHC 2HE7A 2VZKD 3UIOB 1WFYA 3RFZB 5CTRC 3VTWA 4FHJA 2W54A 2WXNA 1CK1A 5JHBA 4CHKA 2Z59B 1MI0A 4KVGB 1MHHE 2VZKB 4LJOB 4ANVA 1E10A 4KGTA 2W82A 1TKGA 2H89B 5BMHA 1R4MB 1AWDA 3NG0A 1QLBB 1SE3A 2N1WA 1D6EC 2N4FA 3I5JC 3W2DA 3ZNZB 2LRUA 3ETRA 4NJ7A 2ZVOA 3AB5A 4IOIE 3IXSA 1FD6A 1C4CA 2NTTA 4HJKA 4BBNF 1PGBA 1EWCA 3W5VB 2IGGA 1XQQA 2WXHA 3UGBB 4AS1A 1GOZA 2N7DA 4RH6A 4F8CB 2KANA 4HPMB 4DHZE 5DPSA 1P0RA 1C79A 3N3KB 2O6VD 2YEPF 1YN3A 4GIVA 3B9JA 3N1XC 2FNJB 3BIID 3I9V1 4K81A 4BKTA 2MBQA 1UD7A 2KK8A 4K7SA 3E9SA 4MDKE 4USAA 2O6VB 1V1PB 3VUXA 4JWSC 1YOVB 3U7ZA 2G4DB 4WURA 1EM7A 3EUB2 4N59A 2B76B 3N1YC 5E6JA 2XNAC 1J7AA 2JPHA 4MGKE 3ZTCA 1JCKB 3MJWA 3PREA 4C4VB 4Q2JA 2KMMA 1BUIC 2JRIB 3T8MA 4GSWA 1JROA 3AM9A 3R66C 3EHVA 2BTEA 1V97A 4GN1A 1FFUA 1P7FA 3DBRB 1TZOA 1N62A 1EWYC 4IWQA 3GP7A 3Q3NC 2PW9A 3C8YA 2RGFA 2AYOB 1P3QU 3P4QB 3VFKA 1WYWB 4W9FA 5BYSA 5DPWA 1VRAB 2L1AA 3BK1A 3MJ5A 1JWSD 2GBJA 3WIMA 1PDXA 1KFYB 5TR5A 5C1ZA 2JZ3B 3HK0A 1SSNA 3ENEA 2KC2A 3PS6A 2PMVA 1QKZA 4AQ7A 3IG3A 4YWGG 1I4RA 3ZJTA 5J2RA 2BS4B 4HVBA 2WDRB 3IHPC 3DCGA 2D5GA 4YTNB 2JWUA 4REZA 3VQIA 4M8MA 1V5TA 3FILB 1F52A 3SHQA 1K8RB 3H1UA 3C19A 2ICIA 4GU2A 3SFDB 1WZ0A 2N9XA 5IOIA 3ZRFA 2LHDA 4RF1A 3NVWA 4HRSA 2Y3AA 2M1MA 2DYMA 2KJHB 4LK0M 1OFFA 1RRBA 4RGMA 2EMSA 2ZZPB 2G45B 3VTVA 3WANA 2RMMA 1QZEA 4NJCA 1SE9A 2IGDA 4KSLC 2WDVB 2RPVA 4KSKC 5FR3A 1TS4A 1LM8B 4HPPA 3VUWA 2FCSA 1GUAB 4IC7B 5HG2A 2N9EB 4ITKA 3H7SA 4YTPB 2KX3A 3TEXA 2N7JA 2NPTA 3K9OB 4FHKA 2H88B 3R7QA 4NZLB 4XC2A 2KDMA 1L0VB 5L83A 2BVCA 2E3TA 3W1SC 1J7BA 3GZNI 2WXIA 2D11A 3I57A 2FE8A 2D3BA 2KFKA 4JIOU 2KOXA 3AE8B 4HKQA 4L1BA 1EU3A 4B6WA 5JXVA 2WXGA 1T3QA 3NHEB 3Q8AA 5AZFA 3K9PB 5DPTA 3ZNGC 5D7GA 2IO1B 3ZW3A 1YD8U 4MJSA 3JSVA 1C4AA 1RM6C 3ZJUA 4D2KA 3RNAC 4UDUC 1WXQA 1LGRA 1ENFA 2KQ4X 4FJYA 4XWTA 1EO6A 3ZKJC 2KWUB 1L4ZB 4E71A 2BWFA 3PT2B 4GMVA 2MLBA 4DHZB 2EMTA 2BYTA 3H6NA 3ABVB 4MGYE 1UZXB 1N60A 2JY6A 3CSTA 3GS2A 1BT0A 1TKYA 2YLMA 4JLCA 2ZEQA 4OVVA 3BWUD 1TKEA 3DHIC 1HEZE 4BZAA 3UQAA 3PHWB 1F77A 4RF0A 1CQVA 4KDIC 3CWIA 3BVZA 3R3MA 2VRRB 1ZGUB 2FIDA 3Q3FA 3I63C 4FA6A 2QCZA 3JVZX 2MBBB 5C2TB 3DBHB 2PE6B 2MJ3A 4QAYA 3N32A 5C3JB 2DZIA 4FN2A 4KIKA 2K25A 2DYBA 3SFEB 2IBIB 2GMIC 4DHJD 1V49A 3U4EG 5HI1A 1I4GA 4W9HA 4IM2A 1NENB 3VH3B 4ICVA 5EE9A 2TSSA 3QHTA 3DBLI 3AE3B 1Y8RC 2EKEC 3GB1A 3TEZA 4DHJB 3OAWA 2WXQA 1IP9A 1JQ4A 1L0XB 3PGEA 4J3OD 1X1MA 3NVZA 3ZGZA 5AZGA 2N0SB 3A4RA 3P63A 4WWOA 3FAHA 1IYFA 2I1JA 2N9PC 4G11A 2LVPA 4HJGE 1IBXA 1WGRA 1UH6A 2D3AA 5LNK1 3HRDD 3WAPA 1SJED 2WXFA 1OQYA 2LGYA 1WE6A 3AEBB 1K51A 2FUG1 3KLSX 2NCNA 1HA5A 1PUTA 3RD2A 1TY2A 2HJ8A 2YEPB 1HXYD 2KVZA 4FBJB 2PKOA 4MJSB 1NYRA 2IO0B 4YSXB 3APFA 3NZUA 3ZVVA 1JMLA 2I1KA 2M4NA 3KYDD 2J53A 5HKHA 4NQLB 4RM9A 5IA7A 4GB9A 4JWUC 4PK1A 3PTFC 4ANWA 1VZ6A 2JX5A 3B2GA 3IAS1 2CJOA 2ON8A 4PT5A 4XWWA 2JZZA 4YSYB 2X8XX 3VH4B 3RNBC 3BY4B 4LNIA 2WXRA 4AUQC 2K3UA 4XDCA 1MG8A 2PVGC 2N7EA 2DNFA 3QWZB 3ZYYX 2GI9A 4LTUA 4RGNA 4NQKE 4EZLA 3KWLA 1SE2A 1WGKA 1DYQA 2SEBD 2C60A 5CHFA 4AJWA 3URYA 2CHZA 3BK2A 3ZXRA 4KIKB 2K1FA 1DOIA 1JWUD 1BXTA 4YL8A 1YN4A 4GDKB 4A9AA 2ZW1A 4CQNA 1VDVA 2ZNVB 2DZKA 2MBEA 1WMHA 2NR2A 1ZOYB 2BQQA 1NEKB 1C4PA 3V61A 1E90A 3L08A 2AQ1B 3IVFA 1K50A 1BMLC 2LXCA 1WE7A 4ARCA 3ZXVA 3QK0A 1VZ7A 2KDFB 2AL6A 4MT5A 1D5XC 2BKFA 2XEWA 2GOWA 1D4BA 3TJPA 2PPHA 3KUCB 1JRPA 4HCPB 2FCQA 1V6EA 2D3GA 2K22A 2GBNA 1F0ZA 1R4NI 1AW7A 3AEFB 2BKRB 2GLSA 3P1MA 5AUKA 2DZJA 4A90A 4NAWB 2JYTA 3PLVA 3AE4B 3RN9C 4GDLA 1OGWA 2K5PA 4TSSA 1E0ZA 2KJRA 2WWZA 3U2SC 1OEYJ 2KDEB 2X38A 3Q3JA 1E7UA 3HVDA 3ZIMA 2PE9A 3FC4A 5EDSA 3ZQ4A 4WAAA 3TEWA 2LVQA 2OJRA 3DWGC 1YIWA 3BZDB 1C1YB 2INNE 1FXIA 2JRHA 4WWNA 5MPOA 1OQQA 4A3OA 4PS3A 3V3XA 2E6XA 1ET9A 3AEDB 4HKZE 2G3QB 1WRIA 1XF5L 4C7YA 5JH5C 2DYOA 3QX1A 2JQRB 1XXGA 3QAQA 2L76A 2NBUA 1WX9A 2LASA 4H2AA 5LXIB 1F2RC 4K3BA 3RNCC 1T0SC 2R61A 3PV1A 3W1SA 2UWQA 2QMTA 1F9JA 4IWOA 3UINB 2K8BA 1FCCC 4O1NA 5CX3A 1FPYA 2Y5PA 1V8CA 3RMKC 2OJWA 1B9RA 3RZWC 3U30A 4AOFA 1L2NA 2M17A 1GB1A 1QOFA 4FULA 1QF6A 4PS8A 1WXAA 1SEBD 3MTNB 2J0MA 5EE3A 1XD3B 3PZ8A 2K0PA 2BBCA 4MGZE 1ZUD2 3GZNB 4ZHPA 3RYTA 4EE2A 2NBWB 4II3B 4I6NB 5J17A 5D6JB 5GXGB 4DQOC 3R2IA 2Z8LA 3H7PA 5TSSA 3PSEB 2JZPA 1RFAA 1UNSA 2GBRA 2J4XA 1LFDA 2ACZB 1P9DU 4HDQA 4HROA 2W3SA 2RDHA 2BPSA 1WJ4A 2WYQA 4KV2A 1UELA 5T8IA 1Q1OA 4WWPA 1FM0D 2JYEA 1WM3A 2LWPA 3L4PA 2KT7A 1ZPSA 3Q6BA 4OZAA 1TS3A 3NZ3A 4GXBA 4GDLB 2RDGA 2Y5CA 4ZRQA 5E6PA 4LJPB 5IAAC 3M3JA 2LHEA 1PQSA 4HPLB 1I42A 1WJUA 1FFVA 4N58A 1F2RI 5H8YE 2G1EA 2ZPYA 1WX8A 1EF1A 4PYUA 4JX1C 5BMGA 4TMAB 2M56B 2AWTA 3B2FA 3RZFA 1T0QC 3J9CA 3HM6X 1L5PA 3UIPB 3TUOA 1WYGA 3IT6B 1WGHA 1SGHA 2N1VA 3W1YA 2DWQA 1FNVA 4CO7A 3RCZA 2IGHA 2MQJA 2HDEA 3KW5B 2N9KA 1YJIA 2KTFA 1L0YB 3DPDA 3NUHB 4EZJA 5IP4D 4FJZA 1K52A 3DBLB 2MJDA 1RLFA 3Q3OC 2LJIA 1ISNA 2NTSA 1A5RA 4WQMA 1KM7A 4XE0A 3A9KA 1T6BX 1QOAA 1I4QA 2KMAA 5CHVC 3CIRB 3VVWB 1PGXA 4ZRKA 1Q0WB 3L17A 3NZSA 2D10A 1L6VA 1GC7A 3VXWA 2KXJA 3RULA 2JU6X 3X23A 2KVRA 1E6EB 2M19A 4IM3A 2INCC 2MP2A 2Z0DB 1H4RA 2GBMA 2J7QB 4JQWC 1TT5B 1C78A 2PTLA 5D94A 4MSQB 2L0TA 3SD5A 3LDZE 1AARA 2SAKA 4TQ0A 1TY0A 1FNWA 2FCNA 2YVCA 3NJTA 2R2QA 4XGAB 3AEAB 2OOBB 5G55A 3MHZA 2L3ZA 4S0RA 1NDDA 2OEDA 2REXA 1WXVA 2K8HA 2KQSA 2KNBA 2ZVNA 3IAM1 4IM0A 4US9A 2PJHA 4AP4C 5JHAA 2RD0A 2WXLA 4EUTA 2PVOD 3JW0X 3N20C 1MJDA 1Y56A 1JALA 2DAJA 3EFCA 2KDIA 1C77A 1I7HA 3IBEA 2XK5A 2V3NA 4I6PA 1FO4A 2AEHA 1WXSA 5L95C 1L6UA 1TTNA 2UYZB 4WIPA 2O2VA 1FXAA 3MP9A 5EE0A 1RWSA 2MSED 4LNOA 1QT9A 1FCLA 2WLBA 3PLUA 2XN9C 1KLUD 4BKSA 3Q8FA 1IPGA 1JWMD 2IO2B 2DLBA 2IYDB 3Q69A 1N5XA 2BB6A 1XEEA 4W9IA 4W9LA 5FR6A 2Q5WD 5GMVA 3NVYA 2WS3B 4K3CA 4LLGM 1YQ4B 3MC9A 4E3CA 2V4LA 1Z5SB 3EECA 2B3AA 4HK2A 1H8CA 3Q8CA 1UBIA 2KQ7A 1ACCA 2LEKA 4HWIB 3X0WA 4PYZA 2IY0B 1RAXA 3EA6A 2VH1A 3ZO5B 3AU4A 4NJ6A 1WSPA 3PZDA 4JL9A 2LUMA 4URKA 3DBRI 2KWDA 3KQ4A 1S1QB 2AQ2B 3V6CB 2VH2A 3P4PB 4W9KA 5AZHA 3WA0A 1KLGD 1NVID 1R4NB 4A3PA 2ZCCA 3SR6A 1NI2A 1P7EA 1V86A 3AECB 2NBVB 3B1LX 4WJNA 1ZKHA 4A55A 4A6QA 2CU3A 1WXMA 5G5GA 2BB5A 1MHXA 2LJ5A 1N5WA 4W9DA 3WAOA 3D32A 2JXXA 1WH3A 3ML9A 1SIFA 2M8SA 2K9XA 1TJEA 4EZKA 2NPTB 2CHXA 4LNNA 2IY1B 4MM3A 5DPRA 5HHDG 4TKNA 3W9CB 4LNFA 1T0RC 3QQ8B 3V05A 1QQRA 4IUMB 3DOWA 4DXGA 2KFKB 4C56C 4RGOS 4HEA1 4OZBA 1Q5WB 2INDC 2XK5B 3LJ3A 4BKGA 2KDBA 3QARA 1I4XA 2MJEA 4KGSA 3WAMA 3VUYA 2JUOA 4KGRA 4BOZB 1ZDXA 3I3TB 4G50A 5KHQA 2O2VB 2I2YA 2W3RA 2L83A 2LD9A 1WR1A 3JSVB 2BS3B 1N63A 2WHIA 4ZRIA 4ARIA 4G0NB 4P1CC 4ASWC 2MCNB 4ICUA 2QDFA 3APCA 3KUZA 4OW0A 1T5XD 4M0WA 2RSUA 1YQBA 3Q8EA 3ZNHB 1I4PA 1GJZA 3E56A 3QJZA 3C0RB 4WH4A 3L13A 2V3PA 3B08A 4II2B 1MFWA 4I6LB 2MBOA 1YN5A 1F1HA 3KWVA 4DBGA 5G2NA 2LGSA 3VRBB 4MEMA 3AEEB 4ACFA 2LFIA 4YT0B 2MA9B 2WX0A 1V9JA 3PPAA 1UBQA 3H8HA 1GG3A 5IN7A 1XCQL 1B1ZA 1WGGA 2IJ0A 2LGDA 1KH0A 2WP9B 2LVOA 2MRPA 1ZXHA 2C7NB 3TIXA 3QCAA 3KVFB 1ZDVA 2WGSA 2MEKA 4RMAA 3U7DA 3VR8B 4N9F4 1IUEA 1D5ZC 4ANUA 3O13A 1E8ZA 2KN4A 3RI7C 4NPNA 3QIJA 2GBKA 5D2MB 2J0JA 5E6OA 3LYYA 3CF6E 3T3OA 1WRDB 3DBSA 4KDLB 1WJ6A 2JF5A 3DVNU 4LDTD 4IDIA 1IBXB 2AQ3B 1WGYA 3SEBA 2MW5A 1C9FA 2LZ6A 2CHWA 2KHWB 5BMIA 3PZ7A 2KFJA 1E7PB 3A4SC 4LDTB 3RT3B 3VRAB 3DBHI 3AH7A 3KH0A 2OHFA 2DX5B 1WX7A 3A1QA 3ML8A 2QSDA 5I4DA 1SF0A 2UU7A 1WJNA 2K39A 2LUEA 1DOYA 2EKIA 2O6VA 1GB4A 1V1PA 2ONQA 1UGMA 3PRZA 1OEYA 2KX0A 1TZ1A 4AJYB 3GE8C 1HTQA 2KMCA 3ZDMC 1KJTA 4EKUA 1WF9A 3WALA 4RFBA 4KKIA 4IKGA 1KOTA 1WIAA 4C4VA 3P2BA 4K7WA 4L23A 1JRUA 3QA8A 5CHWA 1JWAD 1WZ3A 3P4SB 1TBEA 2BWES 3KUDB 1CZPA 3ZUNA 2QC8A 2AX5A 3AE1B 2ZNVC 2C7MB 1I4HA 1FRRA 3AEGB 1XLQA 3P42A 3L10B 5BO4B 2MBHA 4NNJB 1LXDA 3HUIA 1E8XA 5DCNA 2RR9A 1WI0A 1S3SG 1GAQB 4ZYNA 5J18A 1SE4A 1YQ3B 3BINA 3PVLA 2M0AA 5G5HA 1WMHB 1D3ZA 3DQVA 3AE2B 4GLSC 4W9EA 2L00B 3ZRCA 3BYTB 3AN1A 4J6IA 1TGZB 1ZXIA 2LGXA 1E7VA 4JPSA 3FILA 4EEWA 5IO9A 5D3DA 2BYVE 3Q8BA 1XLNA 3HHMA 2RPQA 4DWFA 1J0GA 1OQRA 1J7CA 4BVUC 4XDDA 1FXTB 4MH0E 4R3DA 1G6JA
chains in the Genus database with same CATH topology
3GB1A 3AEAB 3TEZA 1TS2A 2WXQA 1XCTL 2WQYB 1JQ4A 3MHZA 4OZCA 1L0XB 3AV8A 4N6EB 3WCQA 4J3OD 1GPXA 3NVZA 3ZGZA 2OEDA 2WU5B 2N0SB 3MFGA 3P63A 3FAHA 3IAM1 4US9A 4HJGE 1IBXA 2WXJA 1K53A 3P4RB 2WXLA 5LNK1 4ZYSA 3HRDD 2PVOD 1KTKA 1SJED 2BS2B 2WXFA 5FKAC 1KF6B 1Y56A 1JALA 2WXKA 3AEBB 1K51A 1NYQA 1UGJA 2FUG1 1A70A 1C77A 1I7HA 2V3NA 3KLSX 3NRZA 1FO4A 1SJHD 1HA5A 1PUTA 1TY2A 1ZP0B 2KAJA 2YEPB 1L6UA 2WXMA 1HXYD 4WIPA 1PYWD 1FXAA 2PKOA 1YJJA 3MP9A 5EE0A 1FEHA 1RWSA 1NYRA 1N61A 4YSZB 3NS1A 2INPE 1DGJA 2WXOA 1QT9A 4YSXB 1FCLA 2WLBA 3VR9B 2XN9C 1KLUD 3Q8FA 5BYQA 4C7ZA 1JWMD 1RFKA 1JMLA 2J53A 2WDQB 1FIQA 1TS5A 2DLBA 4JWUC 3TSSA 3LB8C 3Q69A 1N5XA 1VZ6A 2BB6A 2JX5A 3B2GA 3DWMA 2JXTA 3IAS1 3UI3A 1ET6A 2CJOA 2ON8A 4PT5A 1XEEA 2Q5WD 4RNAA 4XWWA 3RPFC 3NVYA 2WS3B 4YSYB 4LLGM 1YQ4B 1IGDA 2LGIA 3AE6B 4ZOHC 3HVZA 2VZKD 3Q8CA 2WXRA 2QILA 2K3UA 3BYYB 4XDCA 2PVGC 1ACCA 2LEKA 3RFZB 1STEA 2W54A 2WXNA 3ZYYX 1CK1A 2GI9A 3W5UB 3EGRA 4LTUA 4RGNA 3KWLA 1SE2A 1WGKA 3EA6A 1DYQA 2SEBD 1MI0A 4NAMA 3ZJVA 1MHHE 2VZKB 3N9YC 1WSPA 3AE9B 1E10A 4KGTA 5H92C 2W82A 3URYA 2LUMA 1TKGA 2H89B 2KACA 2FBWB 3BK2A 3AE5B 2KWDA 5BMHA 3KQ4A 4RCOA 1DOIA 1AWDA 1QLBB 1SE3A 2AQ2B 3P4PB 1KLGD 1D6EC 1JW9D 1JWUD 1BXTA 1NVID 1YN4A 4GDKB 3SR6A 3W2DA 1P7EA 3AECB 4A9AA 2ZW1A 4CQNA 3ETRA 1VDVA 1EU4A 1LO5D 3AB5A 1PGAA 4A55A 3OWEB 4A6QA 1ZOYB 2CU3A 4IOIE 5G5GA 3IXSA 1FD6A 2BB5A 1C4CA 2MH7A 2NTTA 1NEKB 1MHXA 1N5WA 1PGBA 3IT4B 1C4PA 1EWCA 3W5VB 2IGGA 1DOXA 2WXHA 4AS1A 1AYFA 2K9XA 2AQ1B 1GOZA 1TJEA 3AMZA 1K50A 4RH6A 1BMLC 4JE3B 4ARCA 3BVGA 1ESFA 1VZ7A 3MC0B 4MT5A 5HHDG 1D5XC 1C79A 3W9CB 2YEPF 1YN3A 4KX6B 1D4BA 3V05A 1QQRA 3B9JA 4OHJA 1QOGA 3BIID 3I9V1 1JRPA 4DXGA 4C56C 4RGOS 4HEA1 4OZBA 2K22A 3E9SA 4USAA 1V1OA 1V1PB 3AE7B 1I4XA 2MJEA 4KGSA 3LXFA 1F0ZA 1AW7A 3AEFB 3R8BA 3NVVA 4JWSC 4DXFA 3P1MA 4KGRA 5AUKA 1ZDXA 3U7ZA 4A90A 4NAWB 2I2YA 4WURA 1EM7A 2JYTA 3EUB2 4N59A 1MVKA 2B76B 2W3RA 2L83A 3AE4B 5E6JA 4ZHOA 2XNAC 2BS3B 1J7AA 2K5PA 2QJLA 4TSSA 1E0ZA 2WNMA 1HZ5A 1JCKB 1N63A 3U2SC 1MPEA 1SB3C 2X38A 4P6VF 4Q2JA 4ARIA 2KMMA 1BUIC 2IPKD 3HVDA 1JROA 3AM9A 2BTEA 1UUPA 1V97A 3FC4A 1FFUA 1P7FA 1TZOA 1N62A 1EWYC 4OW0A 1T5XD 3ZQ4A 3TEWA 3GP7A 2PW9A 3C8YA 4M0WA 1VZ8A 3DWGC 1CJEA 3BZDB 2ZW0A 3BVMA 2INNE 1FXIA 5MPOA 1SIJA 2J52A 3Q8EA 1OQQA 1WWTA 4US8A 1IGCA 3P4QB 1I4PA 2JSVX 5BYSA 1VRAB 2L1AA 3BK1A 3V3XA 2E6XA 1ET9A 3MJ5A 1JWSD 3AEDB 3E56A 1QILA 4HKZE 4C7YA 1WRIA 1XF5L 4C80A 5D3IB 2DYOA 4WH4A 2V3PA 1PDXA 4YTMB 1KFYB 1HZ6A 2WU2B 2JQRB 1XXGA 1SSNA 4L2YA 1YN5A 3KWVA 2PMVA 3VRBB 3AEEB 1QKZA 1ROEA 1YNTE 4MH8A 4AQ7A 2LFIA 4YT0B 4YWGG 1I4RA 4H2AA 3ZJTA 2BS4B 1F2RC 2R61A 3H8HA 1L4DB 2WDRB 1UWXA 3W1SA 2V0GA 1XCQL 1B1ZA 2IJ0A 2W55A 2D5GA 3U52E 1XO3A 4YTNB 2QMTA 2JWUA 2QEJC 4B0MA 1KH0A 2WP9B 1FCCC 4REZA 3VQIA 4O1NA 4P16A 2Y5PA 4A8XC 1ZXHA 1V8CA 3FILB 1B9RA 1ZDVA 1SBBB 2MEKA 4ZRPA 2ICIA 1FMAD 3SFDB 1GB1A 1QOFA 2G9HD 3VR8B 1IUEA 1QF6A 1D5ZC 2LHDA 1SEBD 3O13A 3NVWA 2KN4A 4FXCA 4RF1A 5EE3A 2L52A 4HRSA 2Y3AA 3PZ8A 2K0PA 2BBCA 2DYMA 1ZUD2 4LK0M 1OFFA 4ZHPA 4EE2A 4RGMA 3LYYA 1NI3A 1VR9A 3T3OA 2HTME 5GXGB 2RMMA 4DQOC 4NJCA 3R2IA 1ZE3D 2Z8LA 5TSSA 1M4VA 5HFYA 2JZPA 2IGDA 2WDVB 2RPVA 5FR3A 1UNSA 1TS4A 4IDIA 2J4XA 2ACZB 1IBXB 1PFDA 4HROA 2W3SA 2AQ3B 3TEYA 2RDHA 3SEBA 1C9FA 1FRDA 1XLOA 5BMIA 4RGTA 5T8IA 1RYJA 5HG2A 4ITKA 3PZ7A 1R7SA 1E7PB 1FM0D 2LMCA 4YTPB 2JYEA 3TEXA 2N7JA 3L4PA 1YMHE 2H88B 1ZPSA 4OZAA 3VRAB 1TS3A 3NZ3A 4GDLB 3AH7A 4NZLB 2RDGA 2OHFA 2CJNA 2KDMA 2Y5CA 1L0VB 4ZRQA 2QSDA 2BT6A 5I4DA 1SF0A 2E3TA 1J7BA 2WXIA 1VLBA 4WAFA 3I57A 2FE8A 2LHEA 3AE8B 4HKQA 1FFVA 4N58A 1DOYA 2EKIA 5AUIA 1GB4A 1V1PA 2ONQA 1F2RI 5H8YE 4L1BA 1EU3A 2G1EA 5JXVA 2WXGA 1T3QA 3Q8AA 5D7GA 4JX1C 5BMGA 1KRHA 4TMAB 2EELA 2M56B 1C4AA 1RM6C 3B2FA 4RFBA 3ZJUA 4OVZA 4KKIA 4D2KA 4UDUC 1WXQA 4IKGA 2KQ4X 1ENFA 1QOBA 3J9CA 4L23A 4XWTA 1XLPA 1L5PA 2IDYA 5BYRA 3TUOA 3T3NA 1L4ZB 5EE1A 1WYGA 2BYTA 3ABVB 3IT6B 4TQ1A 1JWAD 3P4SB 1HQRD 4YXDB 2DWQA 1FNVA 1Q10A 1N60A 2IGHA 2GRIA 3GS2A 2HDEA 1CZPA 1TKYA 1E9MA 2AX5A 3AE1B 2N9KA 1C76A 2QIEB 1YJIA 2GB1A 1I4HA 1L0YB 3NUHB 1FRRA 3AEGB 1JWBD 1K52A 1TKEA 1TYGB 3BWUD 2MJDA 3R2TA 2LJIA 1XLQA 2NTSA 3P42A 1HEZE 4WQMA 4XE0A 1D5MC 1T6BX 1QOAA 1F77A 4RF0A 3HUIA 1I4QA 1VJKA 3CIRB 2NMQA 1PGXA 1GAQB 1CQVA 3CWIA 1AN8A 3BVZA 1SE4A 1YQ3B 2J42A 2PLPA 4B0EA 4MACA 2M0AA 5G5HA 2WXPA 5FK9C 4WWMA 5C2TB 3AE2B 1L6VA 2MJ3A 4GLSC 1UWMA 3BYTB 3AN1A 4KKJA 1FNUA 5C3JB 2JU6X 1ZXIA 4JPSA 1E6EB 2M19A 3FILA 3PO0A 2N9LA 5D3DA 3SFEB 3Q8BA 1XLNA 2I38A 2V4IB 4MM3B 3U4EG 1C78A 1OQRA 2PTLA 2PIAA 1I4GA 1SXTA 5HI1A 1NENB 1J7CA 2DBYA 4XDDA 2SAKA 4TQ0A 1TY0A 2L32A 1FNWA 2TSSA 5EE9A 4R3DA 2BW2A 3AE3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GB1 A;  2LUM A;  2KAC A;  4HKZ E;  1XF5 L;  2KWD A;  5BMH A;  2LHE A;  4WH4 A;  1XCT L;  1HZ6 A;  4OZC A;  1GB4 A;  2ONQ A;  1F2R I;  5JXV A;  2OED A;  1QKZ A;  1YNT E;  1P7E A;  2ZW1 A;  5BMG A;  1F2R C;  2EEL A;  1PGA A;  1UWX A;  4IOI E;  4D2K A;  1XCQ L;  4HJG E;  1IBX A;  1K53 A;  4IKG A;  1FD6 A;  2QMT A;  2KQ4 X;  2JWU A;  1KH0 A;  1MHX A;  1FCC C;  1PGB A;  2IGG A;  1ZXH A;  3FIL B;  1K51 A;  1K50 A;  1Q10 A;  2IGH A;  1GB1 A;  5HHD G;  3MP9 A;  2N9K A;  2LHD A;  2GB1 A;  1D4B A;  2KN4 A;  1FCL A;  1K52 A;  2K0P A;  1JML A;  2J53 A;  1HEZ E;  4OZB A;  4KGS A;  2NMQ A;  4KGR A;  1PGX A;  2JXT A;  2RMM A;  3UI3 A;  2ON8 A;  5HFY A;  2PLP A;  2I2Y A;  1EM7 A;  2JZP A;  1MVK A;  2IGD A;  4MAC A;  2RPV A;  1HZ5 A;  4GLS C;  1IBX B;  1MPE A;  1IGD A;  2LGI A;  1C9F A;  2JU6 X;  5BMI A;  5HG2 A;  3FIL A;  1P7F A;  2N9L A;  2N7J A;  2PW9 A;  2I38 A;  5HI1 A;  2PTL A;  2ZW0 A;  1YMH E;  2GI9 A;  4OZA A;  2J52 A;  1IGC A;  1MI0 A;  2KDM A;  1MHH E;  2JSV X;  4KGT A;  2QSD A;  3V3X A; 
#chains in the Genus database with same CATH topology
 5KHO A;  3L0W B;  1TS2 A;  2DZM A;  2HD5 B;  1XCT L;  3HM3 A;  3RNE C;  4LNK A;  4OZC A;  4TV3 A;  4BAX A;  2KLG A;  2WDT B;  4N6E B;  2XBB C;  4RM8 A;  4XYC A;  3O65 B;  4WJO A;  3MFG A;  2L0F A;  3A1Q B;  1K53 A;  4A20 A;  3VHT C;  3Q14 C;  1KTK A;  2BS2 B;  3SDL C;  3OG5 A;  5FKA C;  1KF6 B;  3Q2A C;  5LLI A;  3DVG X;  3NRZ A;  3N30 A;  4OVU A;  1ZP0 B;  2KC1 A;  2KAJ A;  2WXM A;  1PYW D;  1XT9 B;  3FKY A;  4YSZ B;  3NS1 A;  3L16 A;  1I35 A;  5AEK B;  2J0K A;  1RFK A;  2WDQ B;  2DHZ A;  4C00 A;  2BYF A;  3LB8 C;  1VCB A;  2CKH B;  3DWM A;  1ET6 A;  4RNA A;  3ONS A;  1LQB A;  3R7R A;  1TIF A;  5E6N A;  4IWP A;  2LGI A;  3AE6 B;  2KYW A;  3HVZ A;  2QIL A;  3BYY B;  4GGQ A;  3V62 A;  3ALB A;  1STE A;  2KJ6 A;  3W5U B;  3EGR A;  3M62 B;  1HE8 A;  2CR5 A;  2AL3 A;  4NAM A;  3ZJV A;  3N9Y C;  4DDI D;  3AE9 B;  5H92 C;  2ZPN A;  1WY8 A;  2KAC A;  4P1B C;  2FBW B;  3AE5 B;  4M01 A;  4RCO A;  2NS5 A;  4W9C A;  3TMP B;  1JW9 D;  2A5U A;  3H7P B;  4HCN B;  3RNF C;  3OLM D;  1EU4 A;  3EC8 A;  3DHH C;  1E8W A;  1LO5 D;  1PGA A;  3OWE B;  1GC6 A;  2KKC A;  3V6E B;  2MH7 A;  3UF8 A;  3IT4 B;  1V5O A;  2JT4 B;  1DOX A;  4W9J A;  3TBL D;  1AYF A;  4WJQ A;  4KZC A;  3V60 A;  3AMZ A;  4JE3 B;  2Y5B B;  4FJV B;  3OJ4 B;  3BVG A;  1ESF A;  4FLH A;  4W9G A;  3MC0 B;  2D2Q A;  3SU8 X;  2FAZ A;  4KX6 B;  4OHJ A;  1QOG A;  2LI5 A;  1T0Y A;  1R4M I;  3M95 A;  1V1O A;  3AE7 B;  3LXF A;  3R8B A;  3NVV A;  3A9J A;  2FUH B;  4DXF A;  4WJP A;  4AWJ A;  2K6D B;  3CSF A;  4ZHO A;  1MVK A;  2FCM A;  3HIZ A;  2QJL A;  1EF5 A;  2WNM A;  1HZ5 A;  2V1Y A;  4BOS C;  1MPE A;  1SB3 C;  4P6V F;  4DXA B;  2IPK D;  3Q3M C;  3GE3 C;  1L7Y A;  1UUP A;  3NS8 A;  4IW0 A;  4B9K A;  1V81 A;  1VZ8 A;  1CJE A;  2ZW0 A;  3BVM A;  1SIJ A;  1YX6 B;  2DAF A;  2J52 A;  1VD2 A;  1WWT A;  3OJ3 A;  4HXD A;  4US8 A;  1IGC A;  2KWC A;  3AUL A;  3N1Z C;  4FAD A;  1UF0 A;  2HTH A;  2JSV X;  2PEA A;  1HTO A;  1QIL A;  4BFR A;  1U4A A;  4C80 A;  5D3I B;  4YTM B;  3A9K B;  1HZ6 A;  2WU2 B;  4L2Y A;  2JWZ A;  1YNT E;  1ROE A;  4MH8 A;  1M94 A;  2RDB C;  2BGF A;  1OTR B;  1L4D B;  3A33 B;  1UWX A;  4X57 B;  2V0G A;  3U52 E;  2W55 A;  2IZV B;  1XO3 A;  2QEJ C;  3EFU A;  4B0M A;  4P16 A;  4A8X C;  5JZE B;  4EFO A;  1ZW7 A;  4K1R B;  2MP2 B;  1C3T A;  1SBB B;  4ZRP A;  1FMA D;  1V2Y A;  2G9H D;  4NY0 A;  4FXC A;  2G4S A;  2L52 A;  1WM2 A;  4TUU A;  2KD0 A;  3L54 A;  1J8C A;  2L05 A;  2QHO A;  1NI3 A;  1VR9 A;  2HTM E;  3DVG Y;  1EUV B;  4GDK A;  5HFY A;  1ZE3 D;  1M4V A;  2LXA A;  4KZ0 A;  2V9H A;  1Z2M A;  4K7U A;  5IKC M;  1PFD A;  3TEY A;  2IO3 B;  1P1A A;  2LRW A;  1FRD A;  3ZLZ A;  1CMX B;  1XLO A;  2DEN B;  4IG7 B;  4RGT A;  1RYJ A;  2KZR A;  3U8Z A;  1R7S A;  2LMC A;  2BF8 B;  4BKS D;  3A9J B;  1WR6 E;  2K6Q A;  1YMH E;  3DVN V;  4DDG D;  2CJN A;  2D3C A;  3CMM B;  3RUI B;  2BT6 A;  1VLB A;  4WAF A;  4E74 A;  2L7R A;  2KTR A;  5AUI A;  4MGI E;  4NAW A;  4XZ4 A;  1KRH A;  2EEL A;  4ZDV A;  2BYE A;  2MX2 A;  5LXH A;  4JGH B;  4OVZ A;  3UQB A;  2JVC A;  3ECI A;  1QOB A;  4MEL A;  1XLP A;  2IDY A;  3AI5 A;  5BYR A;  3T3N A;  5EE1 A;  4GOC A;  4TQ1 A;  4M02 A;  1HQR D;  3GOE A;  3ZDT A;  4YXD B;  2NVU I;  1Q10 A;  4PS7 A;  1KLV A;  2GRI A;  4DK5 A;  1E9M A;  2HJ1 A;  1C76 A;  2QIE B;  2GB1 A;  3QC8 B;  4MSM B;  3ZTD A;  3KYC D;  2ZCB A;  1JWB D;  1TYG B;  1N6Z A;  3R2T A;  1MG4 A;  2V3S A;  2KWV B;  4M8N A;  1D5M C;  2KO3 A;  1WGD A;  3DDC B;  3VAW A;  1VJK A;  2NMQ A;  3PHX B;  2KN5 A;  1AN8 A;  2J42 A;  2PLP A;  4B0E A;  4F7Z A;  4S17 A;  4MAC A;  3ZNI D;  2WXP A;  5FK9 C;  2Z0E B;  4WWM A;  1UWM A;  2CS4 A;  4KKJ A;  1FNU A;  4BBN C;  3AU5 A;  2M0X A;  3VTU A;  3PO0 A;  2N9L A;  2I38 A;  2V4I B;  4MM3 B;  2PIA A;  1SXT A;  4ZRJ A;  2DBY A;  4XX5 A;  2C7H A;  3MC8 A;  2L32 A;  2MWS B;  1E5W A;  2BW2 A;  1V80 A;  3VDZ A;  2WX1 A;  1NBF C;  2ZJD A;  4ANX A;  2WQY B;  4WQO B;  2ASQ A;  3AV8 A;  3WCQ A;  1GPX A;  3B0A A;  1GNU A;  2WU5 B;  3H9D A;  2L8J A;  3APD A;  4G3X B;  2WXJ A;  1YX5 B;  3P4R B;  4HLE A;  4ZYS A;  2K8C A;  2CU1 A;  2WXK A;  2KTR B;  1NYQ A;  1UGJ A;  1A70 A;  1YJ1 A;  4M0W B;  3PRM B;  1SJH D;  2D07 B;  4CYE A;  3AXC A;  4F1S A;  1YJJ A;  1FEH A;  1N61 A;  2INP E;  1DGJ A;  4EOY A;  2WXO A;  4LCD E;  3VR9 B;  4P7I A;  3PRP B;  3M63 B;  5BYQ A;  4C7Z A;  3DHG C;  1J19 A;  3TL5 A;  5C23 A;  1FIQ A;  4M00 A;  1TS5 A;  3NOB A;  2R2O A;  4B95 A;  1P98 A;  3S2A A;  3TSS A;  2KLC A;  2MHJ A;  2A4Z A;  2JXT A;  3UI3 A;  2C9W B;  2C5L C;  3NY5 A;  3JYU A;  3RPF C;  4HDO A;  3T9L A;  3RNG C;  1IGD A;  2W9N A;  1E8Y A;  3IFW B;  2FIF A;  3TCA A;  3MHS D;  4ZOH C;  2HE7 A;  2VZK D;  3UIO B;  1WFY A;  3RFZ B;  5CTR C;  3VTW A;  4FHJ A;  2W54 A;  2WXN A;  1CK1 A;  5JHB A;  4CHK A;  2Z59 B;  1MI0 A;  4KVG B;  1MHH E;  2VZK B;  4LJO B;  4ANV A;  1E10 A;  4KGT A;  2W82 A;  1TKG A;  2H89 B;  5BMH A;  1R4M B;  1AWD A;  3NG0 A;  1QLB B;  1SE3 A;  2N1W A;  1D6E C;  2N4F A;  3I5J C;  3W2D A;  3ZNZ B;  2LRU A;  3ETR A;  4NJ7 A;  2ZVO A;  3AB5 A;  4IOI E;  3IXS A;  1FD6 A;  1C4C A;  2NTT A;  4HJK A;  4BBN F;  1PGB A;  1EWC A;  3W5V B;  2IGG A;  1XQQ A;  2WXH A;  3UGB B;  4AS1 A;  1GOZ A;  2N7D A;  4RH6 A;  4F8C B;  2KAN A;  4HPM B;  4DHZ E;  5DPS A;  1P0R A;  1C79 A;  3N3K B;  2O6V D;  2YEP F;  1YN3 A;  4GIV A;  3B9J A;  3N1X C;  2FNJ B;  3BII D;  3I9V 1;  4K81 A;  4BKT A;  2MBQ A;  1UD7 A;  2KK8 A;  4K7S A;  3E9S A;  4MDK E;  4USA A;  2O6V B;  1V1P B;  3VUX A;  4JWS C;  1YOV B;  3U7Z A;  2G4D B;  4WUR A;  1EM7 A;  3EUB 2;  4N59 A;  2B76 B;  3N1Y C;  5E6J A;  2XNA C;  1J7A A;  2JPH A;  4MGK E;  3ZTC A;  1JCK B;  3MJW A;  3PRE A;  4C4V B;  4Q2J A;  2KMM A;  1BUI C;  2JRI B;  3T8M A;  4GSW A;  1JRO A;  3AM9 A;  3R66 C;  3EHV A;  2BTE A;  1V97 A;  4GN1 A;  1FFU A;  1P7F A;  3DBR B;  1TZO A;  1N62 A;  1EWY C;  4IWQ A;  3GP7 A;  3Q3N C;  2PW9 A;  3C8Y A;  2RGF A;  2AYO B;  1P3Q U;  3P4Q B;  3VFK A;  1WYW B;  4W9F A;  5BYS A;  5DPW A;  1VRA B;  2L1A A;  3BK1 A;  3MJ5 A;  1JWS D;  2GBJ A;  3WIM A;  1PDX A;  1KFY B;  5TR5 A;  5C1Z A;  2JZ3 B;  3HK0 A;  1SSN A;  3ENE A;  2KC2 A;  3PS6 A;  2PMV A;  1QKZ A;  4AQ7 A;  3IG3 A;  4YWG G;  1I4R A;  3ZJT A;  5J2R A;  2BS4 B;  4HVB A;  2WDR B;  3IHP C;  3DCG A;  2D5G A;  4YTN B;  2JWU A;  4REZ A;  3VQI A;  4M8M A;  1V5T A;  3FIL B;  1F52 A;  3SHQ A;  1K8R B;  3H1U A;  3C19 A;  2ICI A;  4GU2 A;  3SFD B;  1WZ0 A;  2N9X A;  5IOI A;  3ZRF A;  2LHD A;  4RF1 A;  3NVW A;  4HRS A;  2Y3A A;  2M1M A;  2DYM A;  2KJH B;  4LK0 M;  1OFF A;  1RRB A;  4RGM A;  2EMS A;  2ZZP B;  2G45 B;  3VTV A;  3WAN A;  2RMM A;  1QZE A;  4NJC A;  1SE9 A;  2IGD A;  4KSL C;  2WDV B;  2RPV A;  4KSK C;  5FR3 A;  1TS4 A;  1LM8 B;  4HPP A;  3VUW A;  2FCS A;  1GUA B;  4IC7 B;  5HG2 A;  2N9E B;  4ITK A;  3H7S A;  4YTP B;  2KX3 A;  3TEX A;  2N7J A;  2NPT A;  3K9O B;  4FHK A;  2H88 B;  3R7Q A;  4NZL B;  4XC2 A;  2KDM A;  1L0V B;  5L83 A;  2BVC A;  2E3T A;  3W1S C;  1J7B A;  3GZN I;  2WXI A;  2D11 A;  3I57 A;  2FE8 A;  2D3B A;  2KFK A;  4JIO U;  2KOX A;  3AE8 B;  4HKQ A;  4L1B A;  1EU3 A;  4B6W A;  5JXV A;  2WXG A;  1T3Q A;  3NHE B;  3Q8A A;  5AZF A;  3K9P B;  5DPT A;  3ZNG C;  5D7G A;  2IO1 B;  3ZW3 A;  1YD8 U;  4MJS A;  3JSV A;  1C4A A;  1RM6 C;  3ZJU A;  4D2K A;  3RNA C;  4UDU C;  1WXQ A;  1LGR A;  1ENF A;  2KQ4 X;  4FJY A;  4XWT A;  1EO6 A;  3ZKJ C;  2KWU B;  1L4Z B;  4E71 A;  2BWF A;  3PT2 B;  4GMV A;  2MLB A;  4DHZ B;  2EMT A;  2BYT A;  3H6N A;  3ABV B;  4MGY E;  1UZX B;  1N60 A;  2JY6 A;  3CST A;  3GS2 A;  1BT0 A;  1TKY A;  2YLM A;  4JLC A;  2ZEQ A;  4OVV A;  3BWU D;  1TKE A;  3DHI C;  1HEZ E;  4BZA A;  3UQA A;  3PHW B;  1F77 A;  4RF0 A;  1CQV A;  4KDI C;  3CWI A;  3BVZ A;  3R3M A;  2VRR B;  1ZGU B;  2FID A;  3Q3F A;  3I63 C;  4FA6 A;  2QCZ A;  3JVZ X;  2MBB B;  5C2T B;  3DBH B;  2PE6 B;  2MJ3 A;  4QAY A;  3N32 A;  5C3J B;  2DZI A;  4FN2 A;  4KIK A;  2K25 A;  2DYB A;  3SFE B;  2IBI B;  2GMI C;  4DHJ D;  1V49 A;  3U4E G;  5HI1 A;  1I4G A;  4W9H A;  4IM2 A;  1NEN B;  3VH3 B;  4ICV A;  5EE9 A;  2TSS A;  3QHT A;  3DBL I;  3AE3 B;  1Y8R C;  2EKE C;  3GB1 A;  3TEZ A;  4DHJ B;  3OAW A;  2WXQ A;  1IP9 A;  1JQ4 A;  1L0X B;  3PGE A;  4J3O D;  1X1M A;  3NVZ A;  3ZGZ A;  5AZG A;  2N0S B;  3A4R A;  3P63 A;  4WWO A;  3FAH A;  1IYF A;  2I1J A;  2N9P C;  4G11 A;  2LVP A;  4HJG E;  1IBX A;  1WGR A;  1UH6 A;  2D3A A;  5LNK 1;  3HRD D;  3WAP A;  1SJE D;  2WXF A;  1OQY A;  2LGY A;  1WE6 A;  3AEB B;  1K51 A;  2FUG 1;  3KLS X;  2NCN A;  1HA5 A;  1PUT A;  3RD2 A;  1TY2 A;  2HJ8 A;  2YEP B;  1HXY D;  2KVZ A;  4FBJ B;  2PKO A;  4MJS B;  1NYR A;  2IO0 B;  4YSX B;  3APF A;  3NZU A;  3ZVV A;  1JML A;  2I1K A;  2M4N A;  3KYD D;  2J53 A;  5HKH A;  4NQL B;  4RM9 A;  5IA7 A;  4GB9 A;  4JWU C;  4PK1 A;  3PTF C;  4ANW A;  1VZ6 A;  2JX5 A;  3B2G A;  3IAS 1;  2CJO A;  2ON8 A;  4PT5 A;  4XWW A;  2JZZ A;  4YSY B;  2X8X X;  3VH4 B;  3RNB C;  3BY4 B;  4LNI A;  2WXR A;  4AUQ C;  2K3U A;  4XDC A;  1MG8 A;  2PVG C;  2N7E A;  2DNF A;  3QWZ B;  3ZYY X;  2GI9 A;  4LTU A;  4RGN A;  4NQK E;  4EZL A;  3KWL A;  1SE2 A;  1WGK A;  1DYQ A;  2SEB D;  2C60 A;  5CHF A;  4AJW A;  3URY A;  2CHZ A;  3BK2 A;  3ZXR A;  4KIK B;  2K1F A;  1DOI A;  1JWU D;  1BXT A;  4YL8 A;  1YN4 A;  4GDK B;  4A9A A;  2ZW1 A;  4CQN A;  1VDV A;  2ZNV B;  2DZK A;  2MBE A;  1WMH A;  2NR2 A;  1ZOY B;  2BQQ A;  1NEK B;  1C4P A;  3V61 A;  1E90 A;  3L08 A;  2AQ1 B;  3IVF A;  1K50 A;  1BML C;  2LXC A;  1WE7 A;  4ARC A;  3ZXV A;  3QK0 A;  1VZ7 A;  2KDF B;  2AL6 A;  4MT5 A;  1D5X C;  2BKF A;  2XEW A;  2GOW A;  1D4B A;  3TJP A;  2PPH A;  3KUC B;  1JRP A;  4HCP B;  2FCQ A;  1V6E A;  2D3G A;  2K22 A;  2GBN A;  1F0Z A;  1R4N I;  1AW7 A;  3AEF B;  2BKR B;  2GLS A;  3P1M A;  5AUK A;  2DZJ A;  4A90 A;  4NAW B;  2JYT A;  3PLV A;  3AE4 B;  3RN9 C;  4GDL A;  1OGW A;  2K5P A;  4TSS A;  1E0Z A;  2KJR A;  2WWZ A;  3U2S C;  1OEY J;  2KDE B;  2X38 A;  3Q3J A;  1E7U A;  3HVD A;  3ZIM A;  2PE9 A;  3FC4 A;  5EDS A;  3ZQ4 A;  4WAA A;  3TEW A;  2LVQ A;  2OJR A;  3DWG C;  1YIW A;  3BZD B;  1C1Y B;  2INN E;  1FXI A;  2JRH A;  4WWN A;  5MPO A;  1OQQ A;  4A3O A;  4PS3 A;  3V3X A;  2E6X A;  1ET9 A;  3AED B;  4HKZ E;  2G3Q B;  1WRI A;  1XF5 L;  4C7Y A;  5JH5 C;  2DYO A;  3QX1 A;  2JQR B;  1XXG A;  3QAQ A;  2L76 A;  2NBU A;  1WX9 A;  2LAS A;  4H2A A;  5LXI B;  1F2R C;  4K3B A;  3RNC C;  1T0S C;  2R61 A;  3PV1 A;  3W1S A;  2UWQ A;  2QMT A;  1F9J A;  4IWO A;  3UIN B;  2K8B A;  1FCC C;  4O1N A;  5CX3 A;  1FPY A;  2Y5P A;  1V8C A;  3RMK C;  2OJW A;  1B9R A;  3RZW C;  3U30 A;  4AOF A;  1L2N A;  2M17 A;  1GB1 A;  1QOF A;  4FUL A;  1QF6 A;  4PS8 A;  1WXA A;  1SEB D;  3MTN B;  2J0M A;  5EE3 A;  1XD3 B;  3PZ8 A;  2K0P A;  2BBC A;  4MGZ E;  1ZUD 2;  3GZN B;  4ZHP A;  3RYT A;  4EE2 A;  2NBW B;  4II3 B;  4I6N B;  5J17 A;  5D6J B;  5GXG B;  4DQO C;  3R2I A;  2Z8L A;  3H7P A;  5TSS A;  3PSE B;  2JZP A;  1RFA A;  1UNS A;  2GBR A;  2J4X A;  1LFD A;  2ACZ B;  1P9D U;  4HDQ A;  4HRO A;  2W3S A;  2RDH A;  2BPS A;  1WJ4 A;  2WYQ A;  4KV2 A;  1UEL A;  5T8I A;  1Q1O A;  4WWP A;  1FM0 D;  2JYE A;  1WM3 A;  2LWP A;  3L4P A;  2KT7 A;  1ZPS A;  3Q6B A;  4OZA A;  1TS3 A;  3NZ3 A;  4GXB A;  4GDL B;  2RDG A;  2Y5C A;  4ZRQ A;  5E6P A;  4LJP B;  5IAA C;  3M3J A;  2LHE A;  1PQS A;  4HPL B;  1I42 A;  1WJU A;  1FFV A;  4N58 A;  1F2R I;  5H8Y E;  2G1E A;  2ZPY A;  1WX8 A;  1EF1 A;  4PYU A;  4JX1 C;  5BMG A;  4TMA B;  2M56 B;  2AWT A;  3B2F A;  3RZF A;  1T0Q C;  3J9C A;  3HM6 X;  1L5P A;  3UIP B;  3TUO A;  1WYG A;  3IT6 B;  1WGH A;  1SGH A;  2N1V A;  3W1Y A;  2DWQ A;  1FNV A;  4CO7 A;  3RCZ A;  2IGH A;  2MQJ A;  2HDE A;  3KW5 B;  2N9K A;  1YJI A;  2KTF A;  1L0Y B;  3DPD A;  3NUH B;  4EZJ A;  5IP4 D;  4FJZ A;  1K52 A;  3DBL B;  2MJD A;  1RLF A;  3Q3O C;  2LJI A;  1ISN A;  2NTS A;  1A5R A;  4WQM A;  1KM7 A;  4XE0 A;  3A9K A;  1T6B X;  1QOA A;  1I4Q A;  2KMA A;  5CHV C;  3CIR B;  3VVW B;  1PGX A;  4ZRK A;  1Q0W B;  3L17 A;  3NZS A;  2D10 A;  1L6V A;  1GC7 A;  3VXW A;  2KXJ A;  3RUL A;  2JU6 X;  3X23 A;  2KVR A;  1E6E B;  2M19 A;  4IM3 A;  2INC C;  2MP2 A;  2Z0D B;  1H4R A;  2GBM A;  2J7Q B;  4JQW C;  1TT5 B;  1C78 A;  2PTL A;  5D94 A;  4MSQ B;  2L0T A;  3SD5 A;  3LDZ E;  1AAR A;  2SAK A;  4TQ0 A;  1TY0 A;  1FNW A;  2FCN A;  2YVC A;  3NJT A;  2R2Q A;  4XGA B;  3AEA B;  2OOB B;  5G55 A;  3MHZ A;  2L3Z A;  4S0R A;  1NDD A;  2OED A;  2REX A;  1WXV A;  2K8H A;  2KQS A;  2KNB A;  2ZVN A;  3IAM 1;  4IM0 A;  4US9 A;  2PJH A;  4AP4 C;  5JHA A;  2RD0 A;  2WXL A;  4EUT A;  2PVO D;  3JW0 X;  3N20 C;  1MJD A;  1Y56 A;  1JAL A;  2DAJ A;  3EFC A;  2KDI A;  1C77 A;  1I7H A;  3IBE A;  2XK5 A;  2V3N A;  4I6P A;  1FO4 A;  2AEH A;  1WXS A;  5L95 C;  1L6U A;  1TTN A;  2UYZ B;  4WIP A;  2O2V A;  1FXA A;  3MP9 A;  5EE0 A;  1RWS A;  2MSE D;  4LNO A;  1QT9 A;  1FCL A;  2WLB A;  3PLU A;  2XN9 C;  1KLU D;  4BKS A;  3Q8F A;  1IPG A;  1JWM D;  2IO2 B;  2DLB A;  2IYD B;  3Q69 A;  1N5X A;  2BB6 A;  1XEE A;  4W9I A;  4W9L A;  5FR6 A;  2Q5W D;  5GMV A;  3NVY A;  2WS3 B;  4K3C A;  4LLG M;  1YQ4 B;  3MC9 A;  4E3C A;  2V4L A;  1Z5S B;  3EEC A;  2B3A A;  4HK2 A;  1H8C A;  3Q8C A;  1UBI A;  2KQ7 A;  1ACC A;  2LEK A;  4HWI B;  3X0W A;  4PYZ A;  2IY0 B;  1RAX A;  3EA6 A;  2VH1 A;  3ZO5 B;  3AU4 A;  4NJ6 A;  1WSP A;  3PZD A;  4JL9 A;  2LUM A;  4URK A;  3DBR I;  2KWD A;  3KQ4 A;  1S1Q B;  2AQ2 B;  3V6C B;  2VH2 A;  3P4P B;  4W9K A;  5AZH A;  3WA0 A;  1KLG D;  1NVI D;  1R4N B;  4A3P A;  2ZCC A;  3SR6 A;  1NI2 A;  1P7E A;  1V86 A;  3AEC B;  2NBV B;  3B1L X;  4WJN A;  1ZKH A;  4A55 A;  4A6Q A;  2CU3 A;  1WXM A;  5G5G A;  2BB5 A;  1MHX A;  2LJ5 A;  1N5W A;  4W9D A;  3WAO A;  3D32 A;  2JXX A;  1WH3 A;  3ML9 A;  1SIF A;  2M8S A;  2K9X A;  1TJE A;  4EZK A;  2NPT B;  2CHX A;  4LNN A;  2IY1 B;  4MM3 A;  5DPR A;  5HHD G;  4TKN A;  3W9C B;  4LNF A;  1T0R C;  3QQ8 B;  3V05 A;  1QQR A;  4IUM B;  3DOW A;  4DXG A;  2KFK B;  4C56 C;  4RGO S;  4HEA 1;  4OZB A;  1Q5W B;  2IND C;  2XK5 B;  3LJ3 A;  4BKG A;  2KDB A;  3QAR A;  1I4X A;  2MJE A;  4KGS A;  3WAM A;  3VUY A;  2JUO A;  4KGR A;  4BOZ B;  1ZDX A;  3I3T B;  4G50 A;  5KHQ A;  2O2V B;  2I2Y A;  2W3R A;  2L83 A;  2LD9 A;  1WR1 A;  3JSV B;  2BS3 B;  1N63 A;  2WHI A;  4ZRI A;  4ARI A;  4G0N B;  4P1C C;  4ASW C;  2MCN B;  4ICU A;  2QDF A;  3APC A;  3KUZ A;  4OW0 A;  1T5X D;  4M0W A;  2RSU A;  1YQB A;  3Q8E A;  3ZNH B;  1I4P A;  1GJZ A;  3E56 A;  3QJZ A;  3C0R B;  4WH4 A;  3L13 A;  2V3P A;  3B08 A;  4II2 B;  1MFW A;  4I6L B;  2MBO A;  1YN5 A;  1F1H A;  3KWV A;  4DBG A;  5G2N A;  2LGS A;  3VRB B;  4MEM A;  3AEE B;  4ACF A;  2LFI A;  4YT0 B;  2MA9 B;  2WX0 A;  1V9J A;  3PPA A;  1UBQ A;  3H8H A;  1GG3 A;  5IN7 A;  1XCQ L;  1B1Z A;  1WGG A;  2IJ0 A;  2LGD A;  1KH0 A;  2WP9 B;  2LVO A;  2MRP A;  1ZXH A;  2C7N B;  3TIX A;  3QCA A;  3KVF B;  1ZDV A;  2WGS A;  2MEK A;  4RMA A;  3U7D A;  3VR8 B;  4N9F 4;  1IUE A;  1D5Z C;  4ANU A;  3O13 A;  1E8Z A;  2KN4 A;  3RI7 C;  4NPN A;  3QIJ A;  2GBK A;  5D2M B;  2J0J A;  5E6O A;  3LYY A;  3CF6 E;  3T3O A;  1WRD B;  3DBS A;  4KDL B;  1WJ6 A;  2JF5 A;  3DVN U;  4LDT D;  4IDI A;  1IBX B;  2AQ3 B;  1WGY A;  3SEB A;  2MW5 A;  1C9F A;  2LZ6 A;  2CHW A;  2KHW B;  5BMI A;  3PZ7 A;  2KFJ A;  1E7P B;  3A4S C;  4LDT B;  3RT3 B;  3VRA B;  3DBH I;  3AH7 A;  3KH0 A;  2OHF A;  2DX5 B;  1WX7 A;  3A1Q A;  3ML8 A;  2QSD A;  5I4D A;  1SF0 A;  2UU7 A;  1WJN A;  2K39 A;  2LUE A;  1DOY A;  2EKI A;  2O6V A;  1GB4 A;  1V1P A;  2ONQ A;  1UGM A;  3PRZ A;  1OEY A;  2KX0 A;  1TZ1 A;  4AJY B;  3GE8 C;  1HTQ A;  2KMC A;  3ZDM C;  1KJT A;  4EKU A;  1WF9 A;  3WAL A;  4RFB A;  4KKI A;  4IKG A;  1KOT A;  1WIA A;  4C4V A;  3P2B A;  4K7W A;  4L23 A;  1JRU A;  3QA8 A;  5CHW A;  1JWA D;  1WZ3 A;  3P4S B;  1TBE A;  2BWE S;  3KUD B;  1CZP A;  3ZUN A;  2QC8 A;  2AX5 A;  3AE1 B;  2ZNV C;  2C7M B;  1I4H A;  1FRR A;  3AEG B;  1XLQ A;  3P42 A;  3L10 B;  5BO4 B;  2MBH A;  4NNJ B;  1LXD A;  3HUI A;  1E8X A;  5DCN A;  2RR9 A;  1WI0 A;  1S3S G;  1GAQ B;  4ZYN A;  5J18 A;  1SE4 A;  1YQ3 B;  3BIN A;  3PVL A;  2M0A A;  5G5H A;  1WMH B;  1D3Z A;  3DQV A;  3AE2 B;  4GLS C;  4W9E A;  2L00 B;  3ZRC A;  3BYT B;  3AN1 A;  4J6I A;  1TGZ B;  1ZXI A;  2LGX A;  1E7V A;  4JPS A;  3FIL A;  4EEW A;  5IO9 A;  5D3D A;  2BYV E;  3Q8B A;  1XLN A;  3HHM A;  2RPQ A;  4DWF A;  1J0G A;  1OQR A;  1J7C A;  4BVU C;  4XDD A;  1FXT B;  4MH0 E;  4R3D A;  1G6J A; 
#chains in the Genus database with same CATH homology
 3GB1 A;  3AEA B;  3TEZ A;  1TS2 A;  2WXQ A;  1XCT L;  2WQY B;  1JQ4 A;  3MHZ A;  4OZC A;  1L0X B;  3AV8 A;  4N6E B;  3WCQ A;  4J3O D;  1GPX A;  3NVZ A;  3ZGZ A;  2OED A;  2WU5 B;  2N0S B;  3MFG A;  3P63 A;  3FAH A;  3IAM 1;  4US9 A;  4HJG E;  1IBX A;  2WXJ A;  1K53 A;  3P4R B;  2WXL A;  5LNK 1;  4ZYS A;  3HRD D;  2PVO D;  1KTK A;  1SJE D;  2BS2 B;  2WXF A;  5FKA C;  1KF6 B;  1Y56 A;  1JAL A;  2WXK A;  3AEB B;  1K51 A;  1NYQ A;  1UGJ A;  2FUG 1;  1A70 A;  1C77 A;  1I7H A;  2V3N A;  3KLS X;  3NRZ A;  1FO4 A;  1SJH D;  1HA5 A;  1PUT A;  1TY2 A;  1ZP0 B;  2KAJ A;  2YEP B;  1L6U A;  2WXM A;  1HXY D;  4WIP A;  1PYW D;  1FXA A;  2PKO A;  1YJJ A;  3MP9 A;  5EE0 A;  1FEH A;  1RWS A;  1NYR A;  1N61 A;  4YSZ B;  3NS1 A;  2INP E;  1DGJ A;  2WXO A;  1QT9 A;  4YSX B;  1FCL A;  2WLB A;  3VR9 B;  2XN9 C;  1KLU D;  3Q8F A;  5BYQ A;  4C7Z A;  1JWM D;  1RFK A;  1JML A;  2J53 A;  2WDQ B;  1FIQ A;  1TS5 A;  2DLB A;  4JWU C;  3TSS A;  3LB8 C;  3Q69 A;  1N5X A;  1VZ6 A;  2BB6 A;  2JX5 A;  3B2G A;  3DWM A;  2JXT A;  3IAS 1;  3UI3 A;  1ET6 A;  2CJO A;  2ON8 A;  4PT5 A;  1XEE A;  2Q5W D;  4RNA A;  4XWW A;  3RPF C;  3NVY A;  2WS3 B;  4YSY B;  4LLG M;  1YQ4 B;  1IGD A;  2LGI A;  3AE6 B;  4ZOH C;  3HVZ A;  2VZK D;  3Q8C A;  2WXR A;  2QIL A;  2K3U A;  3BYY B;  4XDC A;  2PVG C;  1ACC A;  2LEK A;  3RFZ B;  1STE A;  2W54 A;  2WXN A;  3ZYY X;  1CK1 A;  2GI9 A;  3W5U B;  3EGR A;  4LTU A;  4RGN A;  3KWL A;  1SE2 A;  1WGK A;  3EA6 A;  1DYQ A;  2SEB D;  1MI0 A;  4NAM A;  3ZJV A;  1MHH E;  2VZK B;  3N9Y C;  1WSP A;  3AE9 B;  1E10 A;  4KGT A;  5H92 C;  2W82 A;  3URY A;  2LUM A;  1TKG A;  2H89 B;  2KAC A;  2FBW B;  3BK2 A;  3AE5 B;  2KWD A;  5BMH A;  3KQ4 A;  4RCO A;  1DOI A;  1AWD A;  1QLB B;  1SE3 A;  2AQ2 B;  3P4P B;  1KLG D;  1D6E C;  1JW9 D;  1JWU D;  1BXT A;  1NVI D;  1YN4 A;  4GDK B;  3SR6 A;  3W2D A;  1P7E A;  3AEC B;  4A9A A;  2ZW1 A;  4CQN A;  3ETR A;  1VDV A;  1EU4 A;  1LO5 D;  3AB5 A;  1PGA A;  4A55 A;  3OWE B;  4A6Q A;  1ZOY B;  2CU3 A;  4IOI E;  5G5G A;  3IXS A;  1FD6 A;  2BB5 A;  1C4C A;  2MH7 A;  2NTT A;  1NEK B;  1MHX A;  1N5W A;  1PGB A;  3IT4 B;  1C4P A;  1EWC A;  3W5V B;  2IGG A;  1DOX A;  2WXH A;  4AS1 A;  1AYF A;  2K9X A;  2AQ1 B;  1GOZ A;  1TJE A;  3AMZ A;  1K50 A;  4RH6 A;  1BML C;  4JE3 B;  4ARC A;  3BVG A;  1ESF A;  1VZ7 A;  3MC0 B;  4MT5 A;  5HHD G;  1D5X C;  1C79 A;  3W9C B;  2YEP F;  1YN3 A;  4KX6 B;  1D4B A;  3V05 A;  1QQR A;  3B9J A;  4OHJ A;  1QOG A;  3BII D;  3I9V 1;  1JRP A;  4DXG A;  4C56 C;  4RGO S;  4HEA 1;  4OZB A;  2K22 A;  3E9S A;  4USA A;  1V1O A;  1V1P B;  3AE7 B;  1I4X A;  2MJE A;  4KGS A;  3LXF A;  1F0Z A;  1AW7 A;  3AEF B;  3R8B A;  3NVV A;  4JWS C;  4DXF A;  3P1M A;  4KGR A;  5AUK A;  1ZDX A;  3U7Z A;  4A90 A;  4NAW B;  2I2Y A;  4WUR A;  1EM7 A;  2JYT A;  3EUB 2;  4N59 A;  1MVK A;  2B76 B;  2W3R A;  2L83 A;  3AE4 B;  5E6J A;  4ZHO A;  2XNA C;  2BS3 B;  1J7A A;  2K5P A;  2QJL A;  4TSS A;  1E0Z A;  2WNM A;  1HZ5 A;  1JCK B;  1N63 A;  3U2S C;  1MPE A;  1SB3 C;  2X38 A;  4P6V F;  4Q2J A;  4ARI A;  2KMM A;  1BUI C;  2IPK D;  3HVD A;  1JRO A;  3AM9 A;  2BTE A;  1UUP A;  1V97 A;  3FC4 A;  1FFU A;  1P7F A;  1TZO A;  1N62 A;  1EWY C;  4OW0 A;  1T5X D;  3ZQ4 A;  3TEW A;  3GP7 A;  2PW9 A;  3C8Y A;  4M0W A;  1VZ8 A;  3DWG C;  1CJE A;  3BZD B;  2ZW0 A;  3BVM A;  2INN E;  1FXI A;  5MPO A;  1SIJ A;  2J52 A;  3Q8E A;  1OQQ A;  1WWT A;  4US8 A;  1IGC A;  3P4Q B;  1I4P A;  2JSV X;  5BYS A;  1VRA B;  2L1A A;  3BK1 A;  3V3X A;  2E6X A;  1ET9 A;  3MJ5 A;  1JWS D;  3AED B;  3E56 A;  1QIL A;  4HKZ E;  4C7Y A;  1WRI A;  1XF5 L;  4C80 A;  5D3I B;  2DYO A;  4WH4 A;  2V3P A;  1PDX A;  4YTM B;  1KFY B;  1HZ6 A;  2WU2 B;  2JQR B;  1XXG A;  1SSN A;  4L2Y A;  1YN5 A;  3KWV A;  2PMV A;  3VRB B;  3AEE B;  1QKZ A;  1ROE A;  1YNT E;  4MH8 A;  4AQ7 A;  2LFI A;  4YT0 B;  4YWG G;  1I4R A;  4H2A A;  3ZJT A;  2BS4 B;  1F2R C;  2R61 A;  3H8H A;  1L4D B;  2WDR B;  1UWX A;  3W1S A;  2V0G A;  1XCQ L;  1B1Z A;  2IJ0 A;  2W55 A;  2D5G A;  3U52 E;  1XO3 A;  4YTN B;  2QMT A;  2JWU A;  2QEJ C;  4B0M A;  1KH0 A;  2WP9 B;  1FCC C;  4REZ A;  3VQI A;  4O1N A;  4P16 A;  2Y5P A;  4A8X C;  1ZXH A;  1V8C A;  3FIL B;  1B9R A;  1ZDV A;  1SBB B;  2MEK A;  4ZRP A;  2ICI A;  1FMA D;  3SFD B;  1GB1 A;  1QOF A;  2G9H D;  3VR8 B;  1IUE A;  1QF6 A;  1D5Z C;  2LHD A;  1SEB D;  3O13 A;  3NVW A;  2KN4 A;  4FXC A;  4RF1 A;  5EE3 A;  2L52 A;  4HRS A;  2Y3A A;  3PZ8 A;  2K0P A;  2BBC A;  2DYM A;  1ZUD 2;  4LK0 M;  1OFF A;  4ZHP A;  4EE2 A;  4RGM A;  3LYY A;  1NI3 A;  1VR9 A;  3T3O A;  2HTM E;  5GXG B;  2RMM A;  4DQO C;  4NJC A;  3R2I A;  1ZE3 D;  2Z8L A;  5TSS A;  1M4V A;  5HFY A;  2JZP A;  2IGD A;  2WDV B;  2RPV A;  5FR3 A;  1UNS A;  1TS4 A;  4IDI A;  2J4X A;  2ACZ B;  1IBX B;  1PFD A;  4HRO A;  2W3S A;  2AQ3 B;  3TEY A;  2RDH A;  3SEB A;  1C9F A;  1FRD A;  1XLO A;  5BMI A;  4RGT A;  5T8I A;  1RYJ A;  5HG2 A;  4ITK A;  3PZ7 A;  1R7S A;  1E7P B;  1FM0 D;  2LMC A;  4YTP B;  2JYE A;  3TEX A;  2N7J A;  3L4P A;  1YMH E;  2H88 B;  1ZPS A;  4OZA A;  3VRA B;  1TS3 A;  3NZ3 A;  4GDL B;  3AH7 A;  4NZL B;  2RDG A;  2OHF A;  2CJN A;  2KDM A;  2Y5C A;  1L0V B;  4ZRQ A;  2QSD A;  2BT6 A;  5I4D A;  1SF0 A;  2E3T A;  1J7B A;  2WXI A;  1VLB A;  4WAF A;  3I57 A;  2FE8 A;  2LHE A;  3AE8 B;  4HKQ A;  1FFV A;  4N58 A;  1DOY A;  2EKI A;  5AUI A;  1GB4 A;  1V1P A;  2ONQ A;  1F2R I;  5H8Y E;  4L1B A;  1EU3 A;  2G1E A;  5JXV A;  2WXG A;  1T3Q A;  3Q8A A;  5D7G A;  4JX1 C;  5BMG A;  1KRH A;  4TMA B;  2EEL A;  2M56 B;  1C4A A;  1RM6 C;  3B2F A;  4RFB A;  3ZJU A;  4OVZ A;  4KKI A;  4D2K A;  4UDU C;  1WXQ A;  4IKG A;  2KQ4 X;  1ENF A;  1QOB A;  3J9C A;  4L23 A;  4XWT A;  1XLP A;  1L5P A;  2IDY A;  5BYR A;  3TUO A;  3T3N A;  1L4Z B;  5EE1 A;  1WYG A;  2BYT A;  3ABV B;  3IT6 B;  4TQ1 A;  1JWA D;  3P4S B;  1HQR D;  4YXD B;  2DWQ A;  1FNV A;  1Q10 A;  1N60 A;  2IGH A;  2GRI A;  3GS2 A;  2HDE A;  1CZP A;  1TKY A;  1E9M A;  2AX5 A;  3AE1 B;  2N9K A;  1C76 A;  2QIE B;  1YJI A;  2GB1 A;  1I4H A;  1L0Y B;  3NUH B;  1FRR A;  3AEG B;  1JWB D;  1K52 A;  1TKE A;  1TYG B;  3BWU D;  2MJD A;  3R2T A;  2LJI A;  1XLQ A;  2NTS A;  3P42 A;  1HEZ E;  4WQM A;  4XE0 A;  1D5M C;  1T6B X;  1QOA A;  1F77 A;  4RF0 A;  3HUI A;  1I4Q A;  1VJK A;  3CIR B;  2NMQ A;  1PGX A;  1GAQ B;  1CQV A;  3CWI A;  1AN8 A;  3BVZ A;  1SE4 A;  1YQ3 B;  2J42 A;  2PLP A;  4B0E A;  4MAC A;  2M0A A;  5G5H A;  2WXP A;  5FK9 C;  4WWM A;  5C2T B;  3AE2 B;  1L6V A;  2MJ3 A;  4GLS C;  1UWM A;  3BYT B;  3AN1 A;  4KKJ A;  1FNU A;  5C3J B;  2JU6 X;  1ZXI A;  4JPS A;  1E6E B;  2M19 A;  3FIL A;  3PO0 A;  2N9L A;  5D3D A;  3SFE B;  3Q8B A;  1XLN A;  2I38 A;  2V4I B;  4MM3 B;  3U4E G;  1C78 A;  1OQR A;  2PTL A;  2PIA A;  1I4G A;  1SXT A;  5HI1 A;  1NEN B;  1J7C A;  2DBY A;  4XDD A;  2SAK A;  4TQ0 A;  1TY0 A;  2L32 A;  1FNW A;  2TSS A;  5EE9 A;  4R3D A;  2BW2 A;  3AE3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...