5C3JB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c3jB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c3jB01
1TKEA 1XLNA 2L52A 3P4QB 1FXAA 3LXFA 4P6VF 2DWQA 4ZOHC 4YXDB 1ROEA 5EE1A 4JWSC 2WP9B 3RPFC 2B76B 1WXQA 3L4PA 5H8YE 4N6EB 3W5UB 3NVVA 1IUEA 1NVID 1E0ZA 5EE9A 1RWSA 1YJIA 2W3SA 2CU3A 2HTME 1AYFA 1EWYC 2BT6A 1YQ4B 3AB5A 5GXGB 1JRPA 3ZYYX 3AE9B 5G5HA 1QLBB 3AE5B 2CJOA 3W9CB 1OQQA 2WDQB 3SFDB 1ZUD2 3DWGC 1UWMA 2MJDA 3AN1A 3FC4A 3NVYA 3AEAB 1N62A 1YJJA 2PVOD 1E10A 5MPOA 4YSYB 3AV8A 1KFYB 2K22A 2Q5WD 2JX5A 1J7AA 1H7WA 2ACZB 3AEFB 4C7ZA 1ZP0B 1L6VA 4ITKA 3CF4A 3P4SB 3P63A 2H89B 4US9A 3AEEB 1H7XA 1VJKA 1GT8A 3AM9A 1L0VB 1TKYA 3PO0A 1FM0D 4IDIA 1B9RA 1T3QA 1YQ3B 2E3TA 1JQ4A 1FRDA 3AE7B 5AUKA 4C7YA 1GTHA 2H88B 5C3JB 1RM6C 3CIRB 2G1EA 3NRZA 3AE1B 5EE3A 3ETRA 3HRDD 1AWDA 1FO4A 3AEBB 2Y5CA 2WQYB 1E9MA 1FMAD 2DBYA 2K5PA 1PFDA 2WU5B 2AX5A 1I7HA 5C2TB 1FFVA 1R7SA 1E7PB 4YTPB 2KAJA 3B2FA 3VR9B 2WU2B 2WDRB 1FXIA 3VRBB 1QOFA 1XLOA 1WYGA 2FBWB 3NVZA 2WLBA 1A70A 1WWTA 1V8CA 4N59A 3AE2B 2W3RA 1GPXA 2BS2B 3P4PB 3WCQA 2N0SB 3W5VB 4YTMB 1CZPA 1RFKA 1XLQA 4WWMA 1XO3A 2L83A 4KX6B 1PDXA 4ZHPA 3AEDB 3B9JA 3HUIA 1WRIA 3P4RB 1FFUA 2OHFA 2MH7A 3P1MA 2MJ3A 1F0ZA 1NYQA 1ZOYB 3SFEB 1JW9D 1JROA 3AE4B 1KRHA 1NI3A 5H92C 2M56B 3FAHA 3HVZA 3KWLA 4FXCA 1E6EB 5AUIA 1N61A 1GTEA 3AMZA 2M19A 1DGJA 2PIAA 2EKIA 1QOGA 1TYGB 2BS4B 3VR8B 1JALA 3AH7A 3LB8C 1QOAA 1SF0A 5G5GA 4US8A 4YSXB 3B2GA 3AEGB 1N5WA 2JQRB 1TJEA 3NVWA 2WDVB 1JWBD 1L6UA 1N63A 3AE8B 2PKOA 1JWAD 2QJLA 4JWUC 4A9AA 1PUTA 1DOXA 1FIQA 1TKGA 4HROA 2QIEB 4HRSA 1QF6A 1J7CA 1QOBA 3AECB 1SIJA 3ABVB 1VDVA 2LEKA 4YTNB 1SB3C 2W54A 3CWIA 2CJNA 4LTUA 1N5XA 1OFFA 1DOYA 1VLBA 3AE6B 1DOIA 1V97A 2K9XA 2WS3B 4YSZB 3BIID 1KF6B 3AE3B 3VRAB 1GAQB 1L5PA 1NYRA 1ZXIA 3EUB2 4N58A 2BS3B 5EE0A 4C80A 1OQRA 4YT0B 1N60A 1XLPA 2PVGC 4JX1C 3NS1A 3SR6A 1J7BA 3DWMA 1QT9A 2W55A 1FRRA 4WQMA 4USAA 4ZHOA 1CJEA 2MJEA 1WGKA 1NEKB 1NENB 2KMMA 1RYJA
chains in the Genus database with same CATH superfamily
3ZNGC 1I4XA 2XN9C 3BVMA 2INPE 1WXMA 3L4PA 3PVLA 4HPMB 4ACFA 3R66C 4W9DA 2C7NB 2BF8B 4A8XC 5G5HA 3QWZB 2PVOD 1YJJA 2V1YA 3MP9A 1FNUA 4IM0A 2K22A 1FNVA 3IT6B 3Q8FA 2DZMA 3TIXA 1VZ6A 5BO4B 3AE1B 1Y8RC 3U52E 4PS3A 4WJOA 1C79A 5G55A 1BT0A 3T3NA 3QHTA 3BVGA 1L7YA 4GSWA 2C9WB 3RFZB 2ZCCA 1V8CA 4IM2A 2FIFA 1YQBA 2QSDA 2ZW1A 3PHWB 5L95C 4FHJA 4TQ1A 5DPTA 3P4RB 2MBBB 3RULA 5GMVA 1UF0A 4FXCA 2KN5A 3ONSA 3PS6A 4EUTA 5FKAC 2O2VA 2ZCBA 4KDLB 1WGYA 1JRUA 2D3CA 3AEGB 1N5WA 3I3TB 1MHXA 1JWBD 1WGHA 1LGRA 1I42A 3LJ3A 3KUZA 4IG7B 1VD2A 1QOBA 4KGRA 2MSED 1NBFC 2LXAA 1C78A 3Q3NC 3OJ3A 2KLGA 2PVGC 3NS1A 1UELA 2VH1A 1J7BA 2KTRA 1WIAA 4YL8A 4N59A 3CF6E 2OOBB 3P4QB 1E7UA 5JH5C 1NDDA 2L1AA 2NBVB 5EDSA 5BYQA 2MBEA 2JF5A 1YD8U 2HE7A 2WDTB 2KQSA 3VTUA 1IUEA 1OEYJ 4M8MA 2N7EA 1WM3A 4FBJB 4EZKA 5HG2A 5D6JB 2KFKA 2L7RA 2A5UA 3DHGC 2WYQA 1TTNA 2REXA 1NI2A 4C7ZA 2B3AA 2QMTA 1L0VB 4NJ6A 2E3TA 1FD6A 4DXAB 2K3UA 1FO4A 2DBYA 1WXSA 2E6XA 1GUAB 2KAJA 2QEJC 3S2AA 1FXIA 1WYGA 3I5JC 4M01A 4IW0A 4S0RA 2KK8A 2FE8A 4MM3A 3P4PB 4HCNB 2GBNA 3W5VB 1J0GA 4A55A 3A9KA 5LNK1 2LRWA 1YIWA 5CTRC 1JW9D 3AE4B 3L16A 4HCPB 3UQAA 4JIOU 1LQBA 3QA8A 1EUVB 2IJ0A 3PPAA 5G5GA 2DAFA 4TV3A 2WXLA 2BYVE 3RI7C 3ZJUA 4XE0A 1JWAD 2FUHB 2Z0DB 3PV1A 3R3MA 5DCNA 2XK5A 1MI0A 2PE6B 2J0JA 3N32A 1TY0A 1ZE3D 1GAQB 2KFJA 1N60A 3BYTB 4DHZE 3PGEA 3RMKC 2L52A 1N6ZA 3GZNI 4P1CC 2WXPA 1WSPA 2DAJA 3C8YA 3JW0X 2CR5A 4OZCA 3V3XA 2K6QA 1RWSA 1I4QA 5G2NA 3UIOB 4CHKA 2N9PC 3W9CB 2LVOA 3I9V1 4BOZB 1UWMA 5J17A 3K9OB 1C1YB 1P98A 1MFWA 2DYMA 1QZEA 3DPDA 2WXIA 4ITKA 2GBRA 4ICUA 2L05A 5IN7A 2O2VB 3X0WA 4CQNA 3IXSA 1WZ0A 1WE6A 4NAMA 5BMIA 2PE9A 2D3AA 2X8XX 2N7JA 4OZBA 4RGOS 3ML9A 2TSSA 2G3QB 1AARA 5HI1A 1UH6A 4OZAA 4W9EA 2MX2A 1WZ3A 4QAYA 1ZGUB 3RZFA 1WRIA 1FFUA 4RNAA 3RUIB 1F0ZA 2KTRB 3L13A 1OGWA 1C9FA 3AMZA 2M19A 4M0WA 1TYGB 4KIKB 3LB8C 1F9JA 3KWVA 4HLEA 1EF5A 1S3SG 2RGFA 4ZRIA 4S17A 1EM7A 2DYBA 2LGSA 3DBLB 3CSTA 3IFWB 4WURA 1YOVB 1SB3C 2KFKB 1GC7A 1FCLA 1T0YA 4XDDA 3K9PB 3ZTCA 4PK1A 3AE3B 3N9YC 2K25A 4IC7B 3H7PA 1F2RC 3V60A 1UD7A 1SE2A 3NY5A 3V6EB 3VH4B 5HFYA 1RYJA 3LXFA 2PLPA 1WGDA 1CMXB 2D2QA 4WIPA 3Q8EA 4FADA 5HHDG 4MM3B 2JZPA 2HTME 3EFCA 1OTRB 2LASA 2MCNB 1FXTB 2LJIA 3DWGC 1UNSA 1I4HA 5MPOA 1WY8A 4MSMB 1V9JA 4BKSD 1L6VA 2JYEA 2WXHA 3HIZA 2KJ6A 3N30A 2ZW0A 4M02A 2LGYA 4KSKC 3AEBB 1WE7A 4TQ0A 2XK5B 4DDID 2WXGA 1VR9A 1I4RA 1GPXA 1SJHD 3DHIC 4KDIC 1XO3A 3TEZA 3EFUA 4ZHPA 2WWZA 2JU6X 1XEEA 1RRBA 3B08A 3RNGC 3URYA 4GU2A 2J7QB 1SE9A 1WI0A 4BKSA 3KWLA 3SU8X 2BWES 5DPRA 1HTQA 2LHDA 1TT5B 3DBLI 1T6BX 2BGFA 3ZW3A 4W9KA 5CX3A 4XGAB 2BB5A 4HRSA 4X57B 1J7CA 3VQIA 2AQ1B 2KWUB 4YTNB 2QC8A 2GBJA 3KW5B 5AZFA 4LDTD 4RGNA 2WS3B 3OWEB 2FCSA 3DDCB 3GOEA 1MG8A 1ZDXA 4LNKA 2IGHA 2R2QA 1EWCA 3PTFC 2ZJDA 5IKCM 1C4AA 4ZHOA 2MJEA 3I57A 1FXAA 2NR2A 1GNUA 4YXDB 1ROEA 3PZ8A 2FNJB 3RPFC 3MTNB 2KYWA 1IGCA 3NVVA 2I1JA 2HJ8A 4AUQC 4WWPA 1E0ZA 2ONQA 3IAS1 2KXJA 4CO7A 2BT6A 1KJTA 3TJPA 3R2IA 3H6NA 3M3JA 4MELA 3NZUA 2KWCA 2KWDA 3ZNID 3GP7A 3EHVA 4RF0A 2Q5WD 1E8WA 2A4ZA 4DWFA 1L4ZB 1V49A 1B9RA 3U30A 2GRIA 3CIRB 3M95A 4HJGE 3I63C 2MBOA 3A1QA 2Y5CA 3VAWA 1XLOA 4BBNC 5D2MB 5LLIA 3ZXRA 2N0SB 1K53A 2ON8A 3QCAA 4J3OD 4L23A 4K7SA 3N20C 3DHHC 3HUIA 3WAOA 2OHFA 2JZ3B 3DBHB 3SFEB 4AJWA 1KRHA 2IY1B 1YN3A 4LJOB 2D3GA 3IHPC 5E6JA 1TY2A 3NG0A 2GOWA 1WJ4A 1ESFA 1N63A 4R3DA 2VRRB 2HJ1A 2QIEB 3HM3A 3ABVB 3PRPB 4EE2A 1P0RA 2W82A 4O1NA 1L2NA 2J0KA 2D3BA 2K9XA 4YSZB 2CHZA 1E7VA 3VTWA 5BMGA 2YVCA 2MBHA 1WGKA 1NENB 2KMMA 1GJZA 4P6VF 2NS5A 3Q8AA 1I4GA 1YN4A 2B76B 5J18A 1RAXA 2DZJA 3U8ZA 4RF1A 3EECA 1YQ4B 3AB5A 4D2KA 4M8NA 3AE9B 2XEWA 3VH3B 4B0EA 2CJOA 3Q14C 2K8BA 2NCNA 4EZJA 1KFYB 4BOSC 3KUCB 2C7HA 2XBBC 2LVPA 1GT8A 4LNFA 4NNJB 2Y5BB 3Q3FA 2CKHB 4ASWC 3FILA 3BK2A 2GMIC 1SEBD 2K5PA 1UGJA 2WU5B 1I7HA 1FFVA 1TZOA 4RH6A 4MH0E 2JSVX 2MW5A 4BKTA 4MJSA 1PDXA 2GBKA 3BZDB 5LXIB 3DBHI 4A6QA 2ZNVB 3TEXA 2PJHA 4OHJA 2NPTA 1PGAA 1GTEA 1L0YB 2L8JA 3DOWA 4NAWA 3U7ZA 2JPHA 3W1SC 3H1UA 3ENEA 4K7WA 4IOIE 2PKOA 1ZKHA 1HZ6A 1PQSA 2KMAA 1T0QC 3TEWA 3NUHB 4HPPA 3AECB 3ZKJC 4LDTB 4LCDE 3SEBA 3RCZA 4RCOA 4MDKE 3UQBA 1KTKA 3B1LX 4K7UA 3OG5A 1Y56A 2IPKD 1F52A 1P9DU 2NBWB 3T8MA 2L76A 2UU7A 3APFA 4OVUA 4XWWA 4A3PA 2WP9B 3HHMA 3MC8A 2NMQA 3DVGY 4HWIB 2V4IB 3ZJTA 3QX1A 1WH3A 4KSLC 3V05A 3E9SA 5IAAC 4YSYB 2WGSA 4WJPA 1J7AA 3CF4A 3JSVA 3P2BA 4IDIA 2L0FA 4WH4A 1YQ3B 3AE7B 2ZPYA 4B6WA 1V5OA 2D10A 2WX0A 1HXYD 2M0XA 2W9NA 3ZDMC 3QARA 3IG3A 4AS1A 4RGMA 1PGXA 4I6PA 4LNOA 3T3OA 1TS4A 2NVUI 2MJ3A 2N4FA 1HTOA 3BWUD 3RD2A 4MGIE 4BVUC 1CK1A 3HVZA 1C76A 1WR6E 1J19A 3PRMB 3W1YA 4K81A 2IO0B 3DCGA 3HK0A 4US8A 3ZRFA 2IY0B 3QQ8B 3B2GA 4HXDA 1Z2MA 4G11A 1MPEA 2HDEA 4TUUA 1HZ5A 2JVCA 2KHWB 3T9LA 5I4DA 4Q2JA 1KF6B 5EE0A 1WX9A 1J8CA 4W9FA 1WYWB 2V3PA 2PTLA 4JLCA 2Z59B 2YLMA 3FILB 2IO2B 1ACCA 2SAKA 3KH0A 4PS8A 1TKEA 3A4RA 5BYRA 3RT3B 4OVZA 3ZNHB 4N6EB 3L0WB 2Z8LA 4MJSB 4ANWA 3HM6X 4PYZA 1RFAA 2ASQA 3U4EG 1U4AA 3H7SA 1ZPSA 4B95A 1P1AA 1T0RC 3HVDA 1A5RA 2NPTB 4WQOB 2VZKD 3BINA 3AEFB 3RN9C 4HK2A 2BTEA 2BYTA 2H88B 2G1EA 3HRDD 2MQJA 1D5ZC 4GMVA 4NZLB 3WALA 1ZXHA 2NBUA 2WLBA 5IO9A 2JT4B 1CZPA 2LHEA 2N9KA 4KX6B 1V2YA 2DX5B 3BK1A 4AQ7A 1GOZA 2KT7A 2QILA 2OEDA 3GS2A 1AN8A 2N9EB 1DGJA 2EKIA 4WWNA 1SE3A 4AP4C 2KDBA 3VR8B 4FJYA 1TJEA 3CSFA 2QJLA 4DQOC 5AEKB 4C4VA 4DXFA 1TKGA 1QQRA 4HROA 1VZ7A 1TS2A 1BXTA 3CWIA 1ENFA 2RD0A 5TR5A 1WJNA 2BQQA 2KANA 3ZXVA 1DOYA 4ZRQA 5KHOA 3Q8BA 3N1XC 3EUB2 2LJ5A 2BS3B 3JSVB 4ARIA 1IBXA 2IO1B 2KOXA 2DHZA 3ML8A 1V86A 3VUWA 1DOXA 1M94A 4ZOHC 5T8IA 4B9KA 3QK0A 4JWSC 5J2RA 1C4CA 1F77A 2UWQA 4RM9A 1WJUA 3ZIMA 1YJIA 2I1KA 1UGMA 1Q1OA 4L1BA 2MP2A 2K8CA 3L54A 1OQQA 2WX1A 3NVYA 1LO5D 1UWXA 3AEAB 1D6EC 4C56C 1ZDVA 3OAWA 3CMMB 3VXWA 1XT9B 2ACZB 1ZP0B 1K50A 2RMMA 3P63A 2D07B 1H7XA 1VJKA 3AM9A 5E6PA 2PPHA 3UGBB 1FRDA 2RDHA 3H9DA 3R7QA 2O6VA 1AWDA 3EA6A 5BYSA 2AQ2B 3VFKA 3B2FA 4YTPB 3A9KB 3VR9B 2V4LA 2FBWB 4REZA 1D4BA 2K8HA 1LFDA 4WWMA 4FLHA 3Q6BA 3MJWA 2INNE 3AULA 3ZTDA 2WXQA 3N1YC 2BBCA 2N9LA 3E56A 1OEYA 2D5GA 3NZ3A 1K52A 3WANA 1QOGA 4J6IA 2WHIA 3AH7A 4IWOA 4JE3B 2GLSA 2KQ7A 3W1SA 2C5LC 3IBEA 2N1VA 3QC8B 2NTSA 3QAQA 4IWQA 4ZDVA 4FN2A 1VCBA 2KX3A 3BIID 4W9IA 3MHZA 3BYYB 4LK0M 2KDIA 2FUG1 4TKNA 3L17A 4WAAA 3PREA 2LGIA 1I4PA 2ZPNA 4IKGA 3MC0B 4AJYB 4DDGD 3BY4B 2WXJA 2KDEB 3MHSD 3AE5B 3SFDB 3FKYA 2MJDA 2V9HA 5C23A 1LM8B 2VZKB 4WJNA 4N9F4 1FNWA 4MT5A 3TMPB 1P3QU 4E74A 4US9A 4KV2A 3U7DA 1TKYA 2RDGA 2KO3A 1GTHA 5C3JB 4ICVA 1HE8A 2DLBA 1XF5L 2WQYB 4C4VB 1SE4A 4MSQB 3ECIA 1ISNA 2WDRB 1OQYA 1KLGD 1UBQA 1YX6B 1V1OA 3WCQA 2K1FA 2FAZA 1V5TA 4PS7A 2GBMA 4M0WB 2C60A 3ZLZA 3P1MA 1IBXB 3EGRA 4UDUC 3VUYA 1TZ1A 1NI3A 2DZKA 1K51A 2J53A 4MH8A 3AI5A 4JGHB 4W9HA 3NS8A 3RNFC 1L6UA 2J42A 2KDMA 2MP2B 3DVNV 1M4VA 4KGSA 2LEKA 3H7PB 5D94A 3PT2B 2J52A 5DPSA 5KHQA 1MJDA 2LD9A 1NYRA 3AXCA 1IP9A 3OJ4B 2IO3B 1T5XD 3PSEB 4GDKA 4GOCA 4JX1C 3TSSA 1Q5WB 1E8XA 3DWMA 3DQVA 1WXVA 2GI9A 2KQ4X 1CJEA 4KGTA 1KLVA 3JYUA 1D5MC 1PYWD 2XNAC 4PYUA 2V3SA 1MHHE 2OJRA 4A3OA 3W5UB 1V80A 2K0PA 5BMHA 1NVID 3Q69A 4GN1A 5LXHA 3ZYYX 2LGDA 3A33B 5CHVC 3FC4A 2M8SA 2M4NA 2CHXA 4XWTA 3P4SB 1BMLC 2IGGA 2QDFA 1BUIC 3VTVA 4FA6A 1TBEA 4EFOA 4HDOA 2KMCA 3W2DA 2AL3A 5JHBA 2LI5A 3Q3OC 4F1SA 3TCAA 2BS2B 1WJ6A 2KC2A 1RFKA 1WGRA 3M62B 2C7MB 2AWTA 4MEMA 4PT5A 2EMSA 2SEBD 1SGHA 2KJRA 1KH0A 3KYDD 2ZEQA 4ZYNA 5JXVA 1WR1A 3VVWB 1V81A 5AZHA 4ZYSA 4E71A 4ANVA 2G4DB 2KWVB 3PZDA 2WDVB 4A9AA 4KVGB 1FIQA 2N1WA 4DXGA 2JY6A 4P16A 4XC2A 2JWZA 2ZVNA 2HTHA 3WA0A 3RNAC 4XYCA 3PLUA 4USAA 2BW2A 5AUKA 1SIFA 2WXOA 1PGBA 2R61A 2BWFA 3O65B 1G6JA 2KACA 3VHTC 1WX8A 3P42A 3O13A 2IBIB 4ZRPA 2NTTA 2HD5B 1AYFA 4RMAA 3M63B 3LDZE 1FPYA 1JWSD 1YJ1A 2FCNA 3GE3C 4KZCA 2JRHA 1B1ZA 1RLFA 3A1QB 2GB1A 3C19A 3NOBA 3AEEB 2M1MA 1F1HA 1FM0D 1FCCC 2N7DA 2LUMA 2JYTA 5EE3A 3ETRA 4XZ4A 1WRDB 2RPQA 3AU5A 3ZUNA 1FMAD 1E5WA 1PFDA 3ZRCA 3ZQ4A 4JPSA 4GIVA 1XXGA 3KVFB 3V6CB 2DENB 1SJED 3D32A 4II3B 3RNBC 3Q8CA 3TEYA 3AEDB 2KZRA 2KLCA 3NHEB 4GDKB 3B0AA 1JROA 3DBSA 4TMAB 2ZNVC 3PHXB 1UZXB 1E6EB 5AUIA 2CS4A 2PMVA 2JRIB 2BS4B 3SHQA 4HJKA 4AWJA 2JQRB 4ARCA 4OVVA 4L2YA 4ANXA 5IA7A 1TGZB 4WJQA 4P7IA 4KIKA 3GZNB 4JQWC 5D7GA 2KX0A 4WAFA 2CJNA 3SDLC 1N5XA 3L08A 4RGTA 1EF1A 1OFFA 2RPVA 4FJZA 1ET9A 5FK9C 1L5PA 1ZXIA 4N58A 1Q10A 1OQRA 3V61A 4A90A 4F8CB 1VZ8A 2BYFA 2PEAA 3RNEC 1P7EA 4ZRKA 3UIPB 3PLVA 1E8YA 4GB9A 3VUXA 1JWMD 2MLBA 1EWYC 4W9JA 1QLBB 3GB1A 2WDQB 3AN1A 1MVKA 4NY0A 4BFRA 2L00B 2LXCA 3APCA 2JX5A 1HQRD 5JZEB 4MGKE 2H89B 2ICIA 1KOTA 1JQ4A 3PZ7A 2IYDB 2QHOA 1RM6C 1UBIA 1HA5A 2JXTA 2KVRA 1R7SA 2KDFB 4WWOA 1WGGA 1A70A 3TUOA 1T0SC 2VH2A 2W3RA 4I6NB 4YTMB 3TL5A 2L83A 2JXXA 2KVZA 5JHAA 2MWSB 4NAWB 3MJ5A 1NYQA 2J0MA 1XCTL 4LJPB 1WX7A 2LGXA 2JWUA 4HDQA 1TIFA 4DBGA 2PIAA 2LZ6A 2DYOA 3SD5A 1SF0A 5HKHA 4YSXB 1KM7A 1YNTE 2D11A 3NVWA 4TSSA 2EELA 2I38A 3N3KB 4F7ZA 2KJHB 2R2OA 3KYCD 3AU4A 5FR6A 2AL6A 4DHJD 1MG4A 3UINB 2L32A 1AW7A 2RDBC 2Y5PA 1DOIA 1SBBB 3APDA 4EKUA 4RM8A 4YT0B 3WAMA 2N9XA 4LNIA 1Q0WB 1LXDA 1QT9A 3KQ4A 1C77A 2DZIA 4WQMA 1QILA 1XLNA 3ZDTA 4EEWA 1WXQA 4IUMB 4C00A 1STEA 4LLGM 2MBQA 4GDLA 1YX5B 3LYYA 4KKJA 2V0GA 2WNMA 5GXGB 3DBRB 1N62A 1H4RA 1V6EA 4G0NB 1H7WA 1YMHE 2O6VD 1T3QA 1I35A 5D3IB 3Q3JA 4XX5A 2MA9B 1E9MA 2KTFA 5IP4D 4HVBA 2AX5A 2Y3AA 2UYZB 3L10B 4MACA 1IGDA 2WU2B 1GB4A 3VRBB 3NVZA 1C4PA 1WWTA 4YWGG 2L3ZA 3R2TA 2I2YA 1JWUD 1S1QB 4E3CA 3H8HA 1XQQA 2OJWA 1HEZE 3B9JA 1R4NB 2BKFA 1TS3A 4HEA1 4W9GA 4KZ0A 1V1PA 2G9HD 3FAHA 2KNBA 3ZVVA 2JZZA 2V3NA 1JALA 4DK5A 1TS5A 3KUDB 1K8RB 2BVCA 4II2B 3RZWC 3RYTA 4K1RB 3OLMD 4NJ7A 4MGYE 2LVQA 3UI3A 2IGDA 1SIJA 2WXFA 4W9LA 3ZJVA 1F2RI 4HPLB 3VRAB 2M0AA 2RR9A 1GC6A 3PRZA 3U2SC 4KKIA 1IYFA 3IVFA 2CHWA 5L83A 3RNCC 2ZZPB 5D3DA 2AQ3B 4GXBA 4BAXA 2FIDA 4K3BA 5EE1A 2DWQA 1UUPA 2EKEC 2LRUA 5H8YE 2K6DB 2KKCA 2WXMA 3JVZX 1C3TA 5EE9A 5E6OA 2CU3A 2MHJA 4HKZE 1JRPA 3DBRI 2J4XA 2AEHA 4P1BC 1WMHA 3BVZA 2IDYA 2CU1A 1WFYA 2BB6A 1CQVA 3A9JA 3PO0A 4EOYA 4NJCA 4C7YA 1SXTA 3NRZA 4W9CA 1Z5SB 2AYOB 1D5XC 4LNNA 5C2TB 1E90A 1SSNA 1E7PB 1YN5A 2EMTA 4RFBA 1EU4A 2PW9A 5CHWA 4NQLB 1XLQA 1R4NI 1ZW7A 2LMCA 2QCZA 4B0MA 4M00A 2MH7A 4DHZB 4BBNF 5DPWA 1D3ZA 1H8CA 1P7FA 1QOAA 2Z0EB 5IOIA 3X23A 4ZRJA 1WXAA 4G50A 4ANUA 1JMLA 3NJTA 4G3XB 4JWUC 4GDLB 4GGQA 1PUTA 5AZGA 1JCKB 4DHJB 3WIMA 4K3CA 2YEPB 1L0XB 1VDVA 4LTUA 2X38A 2L0TA 3IT4B 3AE6B 4XDCA 2MEKA 1V97A 3R7RA 1GG3A 1XLPA 2IZVB 3KLSX 3SR6A 4BKGA 3ZGZA 4FULA 1FRRA 1R4MB 4HKQA 1NEKB 2YEPF 1FEHA 2LFIA 2JUOA 5C1ZA 4IWPA 3R8BA 2FCMA 1X1MA 1XCQL 2W3SA 3IAM1 1EO6A 2INCC 4AOFA 2FCQA 4H2AA 5FR3A 3DVGX 3ZO5B 2BYEA 2DNFA 1GB1A 1ZUD2 3WAPA 2KN4A 1E10A 2WXRA 3MFGA 3AV8A 1V1PB 2O6VB 2KD0A 3V62A 1E8ZA 4URKA 1ET6A 2G4SA 2MRPA 3ALBA 2WXNA 2BPSA 4NPNA 1WF9A 1L4DB 3J9CA 3ZNZB 3NZSA 4GLSC 1QOFA 4MGZE 4A20A 3AE2B 3Q2AC 1IPGA 2KC1A 4BZAA 3VDZA 1VRAB 5CHFA 3UF8A 4OW0A 4I6LB 2M17A 3QIJA 2K39A 1ZOYB 5H92C 2M56B 2RSUA 1DYQA 1N61A 4FHKA 3C0RB 3TBLD 3MC9A 3N1ZC 1KLUD 3QJZA 2INDC 3AE8B 3EC8A 2G45B 2ZVOA 4NQKE 4IM3A 4JL9A 1QF6A 1QKZA 2LUEA 1WMHB 2W54A 5E6NA 3A4SC 3GE8C 1VLBA 1XD3B 4EZLA 4C80A 4FJVB 1EU3A 3A9JB 2BKRB 1R4MI 3DVNU 2WXKA 1WM2A 4CYEA 2W55A 2LWPA 3Q3MC 5TSSA
chains in the Genus database with same CATH topology
1P7EA 1I4XA 3I57A 2XN9C 1FXAA 4ZOHC 3BVMA 4YXDB 1ROEA 3PZ8A 5T8IA 2INPE 4JWSC 3RPFC 3L4PA 1IGCA 1C4CA 1F77A 3NVVA 1E0ZA 1JWMD 2ONQA 3IAS1 1YJIA 1EWYC 2BT6A 4A8XC 4L1BA 3R2IA 5G5HA 1QLBB 3GB1A 1OQQA 2WDQB 3AN1A 3NVYA 1MVKA 1LO5D 1UWXA 3AEAB 2KWDA 1YJJA 2PVOD 3GP7A 1D6EC 4C56C 1ZDVA 3MP9A 4RF0A 1FNUA 2K22A 1FNVA 2Q5WD 2JX5A 3IT6B 1HQRD 3Q8FA 2ACZB 1ZP0B 1VZ6A 1K50A 2RMMA 1L4ZB 3P63A 2H89B 1H7XA 2ICIA 1VJKA 3AM9A 1B9RA 1JQ4A 3PZ7A 1FRDA 2RDHA 1RM6C 2GRIA 3CIRB 3AE1B 4HJGE 3U52E 1AWDA 3EA6A 2Y5CA 2AQ2B 1HA5A 5BYSA 1C79A 2JXTA 1R7SA 3B2FA 4YTPB 3VR9B 3T3NA 1XLOA 2FBWB 3BVGA 4REZA 1D4BA 3RFZB 1A70A 3TUOA 1V8CA 2W3RA 2N0SB 4YTMB 1K53A 2ON8A 2QSDA 2ZW1A 4J3OD 2L83A 4L23A 4WWMA 3HUIA 4TQ1A 2INNE 4NAWB 3P4RB 2OHFA 2WXQA 3MJ5A 2BBCA 2N9LA 3E56A 1NYQA 3SFEB 1KRHA 1XCTL 2D5GA 1YN3A 3NZ3A 1K52A 5E6JA 2JWUA 4FXCA 1TY2A 2PIAA 5FKAC 1QOGA 2DYOA 3AH7A 1ESFA 1SF0A 4YSXB 3AEGB 1N5WA 1YNTE 3NVWA 4TSSA 1MHXA 1JWBD 1N63A 4JE3B 4R3DA 2EELA 2I38A 3W1SA 2NTSA 2QIEB 1QOBA 4KGRA 3ABVB 2L32A 4EE2A 2W82A 4O1NA 1AW7A 2Y5PA 1DOIA 2K9XA 4YSZB 3BIID 1SBBB 1C78A 4YT0B 2PVGC 3NS1A 3MHZA 5BMGA 3BYYB 1J7BA 4LK0M 1QT9A 3KQ4A 1C77A 4WQMA 2FUG1 4N59A 1WGKA 1QILA 1NENB 2KMMA 1XLNA 3P4QB 4P6VF 2L1AA 3Q8AA 1I4GA 1YN4A 2LGIA 5BYQA 2B76B 1WXQA 1I4PA 1STEA 4LLGM 4IKGA 3MC0B 1IUEA 2WXJA 4RF1A 3LYYA 4KKJA 1YQ4B 2WNMA 3AB5A 4D2KA 5GXGB 2V0GA 3AE9B 4B0EA 3AE5B 2CJOA 5HG2A 3SFDB 2MJDA 1N62A 2VZKB 1FNWA 4MT5A 1KFYB 1H7WA 1YMHE 4C7ZA 4US9A 2QMTA 1GT8A 1L0VB 1TKYA 2RDGA 1T3QA 2E3TA 1FD6A 1GTHA 5C3JB 5D3IB 3FILA 2DLBA 2K3UA 3BK2A 1XF5L 1FO4A 2WQYB 1SEBD 1E9MA 1SE4A 1UGJA 2DBYA 2E6XA 2K5PA 2WU5B 2AX5A 1TZOA 1I7HA 1FFVA 2KAJA 2QEJC 2Y3AA 4MACA 1IGDA 2WU2B 2WDRB 1FXIA 3VRBB 1WYGA 3NVZA 4RH6A 1GB4A 1C4PA 2JSVX 2FE8A 1KLGD 1WWTA 4YWGG 3R2TA 2I2YA 3P4PB 1JWUD 1V1OA 3WCQA 3W5VB 3H8HA 1PDXA 4A55A 1HEZE 3B9JA 5LNK1 3BZDB 4A6QA 3P1MA 1IBXB 3EGRA 4UDUC 3TEXA 4OHJA 1TS3A 1JW9D 1NI3A 3AE4B 4HEA1 1V1PA 1K51A 1PGAA 2G9HD 2J53A 3FAHA 4MH8A 1GTEA 1L0YB 3U7ZA 2V3NA 1JALA 2IJ0A 5G5GA 1TS5A 2WXLA 4IOIE 1L6UA 3ZJUA 2J42A 2PKOA 4XE0A 1JWAD 1HZ6A 2KDMA 3TEWA 3UI3A 3NUHB 2IGDA 1SIJA 3AECB 2WXFA 1M4VA 4KGSA 1MI0A 2LEKA 3SEBA 2J52A 3ZJVA 1F2RI 1TY0A 4RCOA 1ZE3D 3VRAB 1GAQB 1KTKA 1NYRA 2M0AA 3U2SC 4KKIA 1N60A 1T5XD 4JX1C 3TSSA 1Y56A 2IPKD 3BYTB 3DWMA 5D3DA 2AQ3B 2GI9A 2KQ4X 1CJEA 4KGTA 1D5MC 2L52A 1PYWD 5EE1A 2DWQA 4XWWA 2XNAC 1UUPA 2WP9B 2WXPA 1WSPA 3C8YA 2NMQA 5H8YE 1MHHE 3W5UB 2K0PA 2WXMA 4OZCA 1NVID 3V3XA 5BMHA 5EE9A 1RWSA 2V4IB 3Q69A 3ZJTA 1I4QA 2CU3A 4HKZE 1JRPA 3ZYYX 2J4XA 3W9CB 3V05A 3E9SA 3FC4A 3I9V1 3BVZA 1UWMA 2IDYA 4YSYB 2DYMA 4XWTA 1J7AA 2BB6A 4ITKA 2WXIA 3CF4A 3P4SB 1BMLC 4IDIA 1CQVA 3PO0A 2IGGA 4CQNA 3IXSA 4WH4A 1YQ3B 3AE7B 1BUIC 4NJCA 4C7YA 4NAMA 1SXTA 3NRZA 5BMIA 1D5XC 1HXYD 2N7JA 3W2DA 4OZBA 4RGOS 5C2TB 1SSNA 1YN5A 1E7PB 2TSSA 5HI1A 4RFBA 4AS1A 4OZAA 1EU4A 4RGMA 1PGXA 2BS2B 2PW9A 1RFKA 1XLQA 3T3OA 2LMCA 4B0MA 1WRIA 4PT5A 1TS4A 2SEBD 1FFUA 2MH7A 4RNAA 2MJ3A 1F0ZA 1KH0A 3BWUD 1CK1A 3HVZA 1C76A 5JXVA 1C9FA 3AMZA 2M19A 4M0WA 1P7FA 4ZYSA 1TYGB 3LB8C 4US8A 1QOAA 3B2GA 3KWVA 1JMLA 2WDVB 4JWUC 4A9AA 4GDLB 1PUTA 1JCKB 1FIQA 1MPEA 1EM7A 4DXGA 2YEPB 4WURA 1L0XB 4P16A 1VDVA 2HDEA 1SB3C 1HZ5A 4LTUA 2X38A 1FCLA 4XDDA 3IT4B 3AE6B 5I4DA 4XDCA 2MEKA 1V97A 4Q2JA 1KF6B 3AE3B 3N9YC 5EE0A 1XLPA 3KLSX 1F2RC 3SR6A 1SE2A 3ZGZA 1FRRA 2V3PA 2PTLA 4USAA 3FILB 5HFYA 4HKQA 1NEKB 2BW2A 1ACCA 1RYJA 2SAKA 1TKEA 2WXOA 5AUKA 2YEPF 3LXFA 1PGBA 2PLPA 2R61A 2KACA 5BYRA 4WIPA 4OVZA 1FEHA 3Q8EA 3P42A 2LFIA 3O13A 5HHDG 4N6EB 4MM3B 2JZPA 4ZRPA 3R8BA 2NTTA 2Z8LA 1XCQL 2W3SA 3IAM1 2HTME 1AYFA 5FR3A 4H2AA 3U4EG 2LJIA 1JWSD 3DWGC 1ZUD2 1GB1A 2KN4A 1UNSA 1ZPSA 1I4HA 1E10A 2WXRA 3MFGA 5MPOA 3HVDA 3AV8A 1V1PB 1B1ZA 2VZKD 3AEFB 2GB1A 1L6VA 2JYEA 2WXHA 3AEEB 2BTEA 1FM0D 1ET6A 1FCCC 2LUMA 2ZW0A 2BYTA 2H88B 2WXNA 2G1EA 2JYTA 5EE3A 3ETRA 3HRDD 3AEBB 1L4DB 1FMAD 3J9CA 1PFDA 3ZQ4A 1D5ZC 4GLSC 4NZLB 1QOFA 4JPSA 4TQ0A 1ZXHA 1XXGA 2WXGA 2WLBA 1VR9A 1I4RA 3AE2B 1GPXA 1SJHD 1SJED 1CZPA 2LHEA 1XO3A 2N9KA 4KX6B 1VRAB 3Q8CA 3AEDB 4ZHPA 3TEYA 3TEZA 2JU6X 1XEEA 4OW0A 3BK1A 4AQ7A 4GDKB 1GOZA 3URYA 1ZOYB 1JROA 2QILA 4TMAB 5H92C 2OEDA 3GS2A 2M56B 1AN8A 3KWLA 1DYQA 1E6EB 5AUIA 1N61A 1DGJA 2PMVA 2EKIA 1SE3A 2LHDA 2BS4B 3VR8B 1KLUD 2JQRB 1TJEA 4ARCA 3AE8B 2QJLA 4L2YA 4DQOC 4DXFA 1T6BX 1TKGA 1QQRA 4HROA 1VZ7A 2BB5A 4HRSA 1QF6A 1J7CA 1TS2A 2AQ1B 1QKZA 3VQIA 5D7GA 1BXTA 2W54A 4YTNB 3CWIA 4WAFA 1ENFA 2CJNA 1N5XA 4RGTA 1OFFA 2RPVA 1VLBA 1DOYA 4ZRQA 4RGNA 1ET9A 2WS3B 3OWEB 3Q8BA 5FK9C 1L5PA 1ZXIA 3EUB2 4N58A 2BS3B 1Q10A 4C80A 1OQRA 1ZDXA 1EU3A 4A90A 4ARIA 2WXKA 2IGHA 1IBXA 1EWCA 1C4AA 2W55A 1VZ8A 5TSSA 4ZHOA 2MJEA 1DOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKE A;  1XLN A;  2L52 A;  3P4Q B;  1FXA A;  3LXF A;  4P6V F;  2DWQ A;  4ZOH C;  4YXD B;  1ROE A;  5EE1 A;  4JWS C;  2WP9 B;  3RPF C;  2B76 B;  1WXQ A;  3L4P A;  5H8Y E;  4N6E B;  3W5U B;  3NVV A;  1IUE A;  1NVI D;  1E0Z A;  5EE9 A;  1RWS A;  1YJI A;  2W3S A;  2CU3 A;  2HTM E;  1AYF A;  1EWY C;  2BT6 A;  1YQ4 B;  3AB5 A;  5GXG B;  1JRP A;  3ZYY X;  3AE9 B;  5G5H A;  1QLB B;  3AE5 B;  2CJO A;  3W9C B;  1OQQ A;  2WDQ B;  3SFD B;  1ZUD 2;  3DWG C;  1UWM A;  2MJD A;  3AN1 A;  3FC4 A;  3NVY A;  3AEA B;  1N62 A;  1YJJ A;  2PVO D;  1E10 A;  5MPO A;  4YSY B;  3AV8 A;  1KFY B;  2K22 A;  2Q5W D;  2JX5 A;  1J7A A;  1H7W A;  2ACZ B;  3AEF B;  4C7Z A;  1ZP0 B;  1L6V A;  4ITK A;  3CF4 A;  3P4S B;  3P63 A;  2H89 B;  4US9 A;  3AEE B;  1H7X A;  1VJK A;  1GT8 A;  3AM9 A;  1L0V B;  1TKY A;  3PO0 A;  1FM0 D;  4IDI A;  1B9R A;  1T3Q A;  1YQ3 B;  2E3T A;  1JQ4 A;  1FRD A;  3AE7 B;  5AUK A;  4C7Y A;  1GTH A;  2H88 B;  5C3J B;  1RM6 C;  3CIR B;  2G1E A;  3NRZ A;  3AE1 B;  5EE3 A;  3ETR A;  3HRD D;  1AWD A;  1FO4 A;  3AEB B;  2Y5C A;  2WQY B;  1E9M A;  1FMA D;  2DBY A;  2K5P A;  1PFD A;  2WU5 B;  2AX5 A;  1I7H A;  5C2T B;  1FFV A;  1R7S A;  1E7P B;  4YTP B;  2KAJ A;  3B2F A;  3VR9 B;  2WU2 B;  2WDR B;  1FXI A;  3VRB B;  1QOF A;  1XLO A;  1WYG A;  2FBW B;  3NVZ A;  2WLB A;  1A70 A;  1WWT A;  1V8C A;  4N59 A;  3AE2 B;  2W3R A;  1GPX A;  2BS2 B;  3P4P B;  3WCQ A;  2N0S B;  3W5V B;  4YTM B;  1CZP A;  1RFK A;  1XLQ A;  4WWM A;  1XO3 A;  2L83 A;  4KX6 B;  1PDX A;  4ZHP A;  3AED B;  3B9J A;  3HUI A;  1WRI A;  3P4R B;  1FFU A;  2OHF A;  2MH7 A;  3P1M A;  2MJ3 A;  1F0Z A;  1NYQ A;  1ZOY B;  3SFE B;  1JW9 D;  1JRO A;  3AE4 B;  1KRH A;  1NI3 A;  5H92 C;  2M56 B;  3FAH A;  3HVZ A;  3KWL A;  4FXC A;  1E6E B;  5AUI A;  1N61 A;  1GTE A;  3AMZ A;  2M19 A;  1DGJ A;  2PIA A;  2EKI A;  1QOG A;  1TYG B;  2BS4 B;  3VR8 B;  1JAL A;  3AH7 A;  3LB8 C;  1QOA A;  1SF0 A;  5G5G A;  4US8 A;  4YSX B;  3B2G A;  3AEG B;  1N5W A;  2JQR B;  1TJE A;  3NVW A;  2WDV B;  1JWB D;  1L6U A;  1N63 A;  3AE8 B;  2PKO A;  1JWA D;  2QJL A;  4JWU C;  4A9A A;  1PUT A;  1DOX A;  1FIQ A;  1TKG A;  4HRO A;  2QIE B;  4HRS A;  1QF6 A;  1J7C A;  1QOB A;  3AEC B;  1SIJ A;  3ABV B;  1VDV A;  2LEK A;  4YTN B;  1SB3 C;  2W54 A;  3CWI A;  2CJN A;  4LTU A;  1N5X A;  1OFF A;  1DOY A;  1VLB A;  3AE6 B;  1DOI A;  1V97 A;  2K9X A;  2WS3 B;  4YSZ B;  3BII D;  1KF6 B;  3AE3 B;  3VRA B;  1GAQ B;  1L5P A;  1NYR A;  1ZXI A;  3EUB 2;  4N58 A;  2BS3 B;  5EE0 A;  4C80 A;  1OQR A;  4YT0 B;  1N60 A;  1XLP A;  2PVG C;  4JX1 C;  3NS1 A;  3SR6 A;  1J7B A;  3DWM A;  1QT9 A;  2W55 A;  1FRR A;  4WQM A;  4USA A;  4ZHO A;  1CJE A;  2MJE A;  1WGK A;  1NEK B;  1NEN B;  2KMM A;  1RYJ A; 
#chains in the Genus database with same CATH topology
 3ZNG C;  1I4X A;  2XN9 C;  3BVM A;  2INP E;  1WXM A;  3L4P A;  3PVL A;  4HPM B;  4ACF A;  3R66 C;  4W9D A;  2C7N B;  2BF8 B;  4A8X C;  5G5H A;  3QWZ B;  2PVO D;  1YJJ A;  2V1Y A;  3MP9 A;  1FNU A;  4IM0 A;  2K22 A;  1FNV A;  3IT6 B;  3Q8F A;  2DZM A;  3TIX A;  1VZ6 A;  5BO4 B;  3AE1 B;  1Y8R C;  3U52 E;  4PS3 A;  4WJO A;  1C79 A;  5G55 A;  1BT0 A;  3T3N A;  3QHT A;  3BVG A;  1L7Y A;  4GSW A;  2C9W B;  3RFZ B;  2ZCC A;  1V8C A;  4IM2 A;  2FIF A;  1YQB A;  2QSD A;  2ZW1 A;  3PHW B;  5L95 C;  4FHJ A;  4TQ1 A;  5DPT A;  3P4R B;  2MBB B;  3RUL A;  5GMV A;  1UF0 A;  4FXC A;  2KN5 A;  3ONS A;  3PS6 A;  4EUT A;  5FKA C;  2O2V A;  2ZCB A;  4KDL B;  1WGY A;  1JRU A;  2D3C A;  3AEG B;  1N5W A;  3I3T B;  1MHX A;  1JWB D;  1WGH A;  1LGR A;  1I42 A;  3LJ3 A;  3KUZ A;  4IG7 B;  1VD2 A;  1QOB A;  4KGR A;  2MSE D;  1NBF C;  2LXA A;  1C78 A;  3Q3N C;  3OJ3 A;  2KLG A;  2PVG C;  3NS1 A;  1UEL A;  2VH1 A;  1J7B A;  2KTR A;  1WIA A;  4YL8 A;  4N59 A;  3CF6 E;  2OOB B;  3P4Q B;  1E7U A;  5JH5 C;  1NDD A;  2L1A A;  2NBV B;  5EDS A;  5BYQ A;  2MBE A;  2JF5 A;  1YD8 U;  2HE7 A;  2WDT B;  2KQS A;  3VTU A;  1IUE A;  1OEY J;  4M8M A;  2N7E A;  1WM3 A;  4FBJ B;  4EZK A;  5HG2 A;  5D6J B;  2KFK A;  2L7R A;  2A5U A;  3DHG C;  2WYQ A;  1TTN A;  2REX A;  1NI2 A;  4C7Z A;  2B3A A;  2QMT A;  1L0V B;  4NJ6 A;  2E3T A;  1FD6 A;  4DXA B;  2K3U A;  1FO4 A;  2DBY A;  1WXS A;  2E6X A;  1GUA B;  2KAJ A;  2QEJ C;  3S2A A;  1FXI A;  1WYG A;  3I5J C;  4M01 A;  4IW0 A;  4S0R A;  2KK8 A;  2FE8 A;  4MM3 A;  3P4P B;  4HCN B;  2GBN A;  3W5V B;  1J0G A;  4A55 A;  3A9K A;  5LNK 1;  2LRW A;  1YIW A;  5CTR C;  1JW9 D;  3AE4 B;  3L16 A;  4HCP B;  3UQA A;  4JIO U;  1LQB A;  3QA8 A;  1EUV B;  2IJ0 A;  3PPA A;  5G5G A;  2DAF A;  4TV3 A;  2WXL A;  2BYV E;  3RI7 C;  3ZJU A;  4XE0 A;  1JWA D;  2FUH B;  2Z0D B;  3PV1 A;  3R3M A;  5DCN A;  2XK5 A;  1MI0 A;  2PE6 B;  2J0J A;  3N32 A;  1TY0 A;  1ZE3 D;  1GAQ B;  2KFJ A;  1N60 A;  3BYT B;  4DHZ E;  3PGE A;  3RMK C;  2L52 A;  1N6Z A;  3GZN I;  4P1C C;  2WXP A;  1WSP A;  2DAJ A;  3C8Y A;  3JW0 X;  2CR5 A;  4OZC A;  3V3X A;  2K6Q A;  1RWS A;  1I4Q A;  5G2N A;  3UIO B;  4CHK A;  2N9P C;  3W9C B;  2LVO A;  3I9V 1;  4BOZ B;  1UWM A;  5J17 A;  3K9O B;  1C1Y B;  1P98 A;  1MFW A;  2DYM A;  1QZE A;  3DPD A;  2WXI A;  4ITK A;  2GBR A;  4ICU A;  2L05 A;  5IN7 A;  2O2V B;  3X0W A;  4CQN A;  3IXS A;  1WZ0 A;  1WE6 A;  4NAM A;  5BMI A;  2PE9 A;  2D3A A;  2X8X X;  2N7J A;  4OZB A;  4RGO S;  3ML9 A;  2TSS A;  2G3Q B;  1AAR A;  5HI1 A;  1UH6 A;  4OZA A;  4W9E A;  2MX2 A;  1WZ3 A;  4QAY A;  1ZGU B;  3RZF A;  1WRI A;  1FFU A;  4RNA A;  3RUI B;  1F0Z A;  2KTR B;  3L13 A;  1OGW A;  1C9F A;  3AMZ A;  2M19 A;  4M0W A;  1TYG B;  4KIK B;  3LB8 C;  1F9J A;  3KWV A;  4HLE A;  1EF5 A;  1S3S G;  2RGF A;  4ZRI A;  4S17 A;  1EM7 A;  2DYB A;  2LGS A;  3DBL B;  3CST A;  3IFW B;  4WUR A;  1YOV B;  1SB3 C;  2KFK B;  1GC7 A;  1FCL A;  1T0Y A;  4XDD A;  3K9P B;  3ZTC A;  4PK1 A;  3AE3 B;  3N9Y C;  2K25 A;  4IC7 B;  3H7P A;  1F2R C;  3V60 A;  1UD7 A;  1SE2 A;  3NY5 A;  3V6E B;  3VH4 B;  5HFY A;  1RYJ A;  3LXF A;  2PLP A;  1WGD A;  1CMX B;  2D2Q A;  4WIP A;  3Q8E A;  4FAD A;  5HHD G;  4MM3 B;  2JZP A;  2HTM E;  3EFC A;  1OTR B;  2LAS A;  2MCN B;  1FXT B;  2LJI A;  3DWG C;  1UNS A;  1I4H A;  5MPO A;  1WY8 A;  4MSM B;  1V9J A;  4BKS D;  1L6V A;  2JYE A;  2WXH A;  3HIZ A;  2KJ6 A;  3N30 A;  2ZW0 A;  4M02 A;  2LGY A;  4KSK C;  3AEB B;  1WE7 A;  4TQ0 A;  2XK5 B;  4DDI D;  2WXG A;  1VR9 A;  1I4R A;  1GPX A;  1SJH D;  3DHI C;  4KDI C;  1XO3 A;  3TEZ A;  3EFU A;  4ZHP A;  2WWZ A;  2JU6 X;  1XEE A;  1RRB A;  3B08 A;  3RNG C;  3URY A;  4GU2 A;  2J7Q B;  1SE9 A;  1WI0 A;  4BKS A;  3KWL A;  3SU8 X;  2BWE S;  5DPR A;  1HTQ A;  2LHD A;  1TT5 B;  3DBL I;  1T6B X;  2BGF A;  3ZW3 A;  4W9K A;  5CX3 A;  4XGA B;  2BB5 A;  4HRS A;  4X57 B;  1J7C A;  3VQI A;  2AQ1 B;  2KWU B;  4YTN B;  2QC8 A;  2GBJ A;  3KW5 B;  5AZF A;  4LDT D;  4RGN A;  2WS3 B;  3OWE B;  2FCS A;  3DDC B;  3GOE A;  1MG8 A;  1ZDX A;  4LNK A;  2IGH A;  2R2Q A;  1EWC A;  3PTF C;  2ZJD A;  5IKC M;  1C4A A;  4ZHO A;  2MJE A;  3I57 A;  1FXA A;  2NR2 A;  1GNU A;  4YXD B;  1ROE A;  3PZ8 A;  2FNJ B;  3RPF C;  3MTN B;  2KYW A;  1IGC A;  3NVV A;  2I1J A;  2HJ8 A;  4AUQ C;  4WWP A;  1E0Z A;  2ONQ A;  3IAS 1;  2KXJ A;  4CO7 A;  2BT6 A;  1KJT A;  3TJP A;  3R2I A;  3H6N A;  3M3J A;  4MEL A;  3NZU A;  2KWC A;  2KWD A;  3ZNI D;  3GP7 A;  3EHV A;  4RF0 A;  2Q5W D;  1E8W A;  2A4Z A;  4DWF A;  1L4Z B;  1V49 A;  1B9R A;  3U30 A;  2GRI A;  3CIR B;  3M95 A;  4HJG E;  3I63 C;  2MBO A;  3A1Q A;  2Y5C A;  3VAW A;  1XLO A;  4BBN C;  5D2M B;  5LLI A;  3ZXR A;  2N0S B;  1K53 A;  2ON8 A;  3QCA A;  4J3O D;  4L23 A;  4K7S A;  3N20 C;  3DHH C;  3HUI A;  3WAO A;  2OHF A;  2JZ3 B;  3DBH B;  3SFE B;  4AJW A;  1KRH A;  2IY1 B;  1YN3 A;  4LJO B;  2D3G A;  3IHP C;  5E6J A;  1TY2 A;  3NG0 A;  2GOW A;  1WJ4 A;  1ESF A;  1N63 A;  4R3D A;  2VRR B;  2HJ1 A;  2QIE B;  3HM3 A;  3ABV B;  3PRP B;  4EE2 A;  1P0R A;  2W82 A;  4O1N A;  1L2N A;  2J0K A;  2D3B A;  2K9X A;  4YSZ B;  2CHZ A;  1E7V A;  3VTW A;  5BMG A;  2YVC A;  2MBH A;  1WGK A;  1NEN B;  2KMM A;  1GJZ A;  4P6V F;  2NS5 A;  3Q8A A;  1I4G A;  1YN4 A;  2B76 B;  5J18 A;  1RAX A;  2DZJ A;  3U8Z A;  4RF1 A;  3EEC A;  1YQ4 B;  3AB5 A;  4D2K A;  4M8N A;  3AE9 B;  2XEW A;  3VH3 B;  4B0E A;  2CJO A;  3Q14 C;  2K8B A;  2NCN A;  4EZJ A;  1KFY B;  4BOS C;  3KUC B;  2C7H A;  2XBB C;  2LVP A;  1GT8 A;  4LNF A;  4NNJ B;  2Y5B B;  3Q3F A;  2CKH B;  4ASW C;  3FIL A;  3BK2 A;  2GMI C;  1SEB D;  2K5P A;  1UGJ A;  2WU5 B;  1I7H A;  1FFV A;  1TZO A;  4RH6 A;  4MH0 E;  2JSV X;  2MW5 A;  4BKT A;  4MJS A;  1PDX A;  2GBK A;  3BZD B;  5LXI B;  3DBH I;  4A6Q A;  2ZNV B;  3TEX A;  2PJH A;  4OHJ A;  2NPT A;  1PGA A;  1GTE A;  1L0Y B;  2L8J A;  3DOW A;  4NAW A;  3U7Z A;  2JPH A;  3W1S C;  3H1U A;  3ENE A;  4K7W A;  4IOI E;  2PKO A;  1ZKH A;  1HZ6 A;  1PQS A;  2KMA A;  1T0Q C;  3TEW A;  3NUH B;  4HPP A;  3AEC B;  3ZKJ C;  4LDT B;  4LCD E;  3SEB A;  3RCZ A;  4RCO A;  4MDK E;  3UQB A;  1KTK A;  3B1L X;  4K7U A;  3OG5 A;  1Y56 A;  2IPK D;  1F52 A;  1P9D U;  2NBW B;  3T8M A;  2L76 A;  2UU7 A;  3APF A;  4OVU A;  4XWW A;  4A3P A;  2WP9 B;  3HHM A;  3MC8 A;  2NMQ A;  3DVG Y;  4HWI B;  2V4I B;  3ZJT A;  3QX1 A;  1WH3 A;  4KSL C;  3V05 A;  3E9S A;  5IAA C;  4YSY B;  2WGS A;  4WJP A;  1J7A A;  3CF4 A;  3JSV A;  3P2B A;  4IDI A;  2L0F A;  4WH4 A;  1YQ3 B;  3AE7 B;  2ZPY A;  4B6W A;  1V5O A;  2D10 A;  2WX0 A;  1HXY D;  2M0X A;  2W9N A;  3ZDM C;  3QAR A;  3IG3 A;  4AS1 A;  4RGM A;  1PGX A;  4I6P A;  4LNO A;  3T3O A;  1TS4 A;  2NVU I;  2MJ3 A;  2N4F A;  1HTO A;  3BWU D;  3RD2 A;  4MGI E;  4BVU C;  1CK1 A;  3HVZ A;  1C76 A;  1WR6 E;  1J19 A;  3PRM B;  3W1Y A;  4K81 A;  2IO0 B;  3DCG A;  3HK0 A;  4US8 A;  3ZRF A;  2IY0 B;  3QQ8 B;  3B2G A;  4HXD A;  1Z2M A;  4G11 A;  1MPE A;  2HDE A;  4TUU A;  1HZ5 A;  2JVC A;  2KHW B;  3T9L A;  5I4D A;  4Q2J A;  1KF6 B;  5EE0 A;  1WX9 A;  1J8C A;  4W9F A;  1WYW B;  2V3P A;  2PTL A;  4JLC A;  2Z59 B;  2YLM A;  3FIL B;  2IO2 B;  1ACC A;  2SAK A;  3KH0 A;  4PS8 A;  1TKE A;  3A4R A;  5BYR A;  3RT3 B;  4OVZ A;  3ZNH B;  4N6E B;  3L0W B;  2Z8L A;  4MJS B;  4ANW A;  3HM6 X;  4PYZ A;  1RFA A;  2ASQ A;  3U4E G;  1U4A A;  3H7S A;  1ZPS A;  4B95 A;  1P1A A;  1T0R C;  3HVD A;  1A5R A;  2NPT B;  4WQO B;  2VZK D;  3BIN A;  3AEF B;  3RN9 C;  4HK2 A;  2BTE A;  2BYT A;  2H88 B;  2G1E A;  3HRD D;  2MQJ A;  1D5Z C;  4GMV A;  4NZL B;  3WAL A;  1ZXH A;  2NBU A;  2WLB A;  5IO9 A;  2JT4 B;  1CZP A;  2LHE A;  2N9K A;  4KX6 B;  1V2Y A;  2DX5 B;  3BK1 A;  4AQ7 A;  1GOZ A;  2KT7 A;  2QIL A;  2OED A;  3GS2 A;  1AN8 A;  2N9E B;  1DGJ A;  2EKI A;  4WWN A;  1SE3 A;  4AP4 C;  2KDB A;  3VR8 B;  4FJY A;  1TJE A;  3CSF A;  2QJL A;  4DQO C;  5AEK B;  4C4V A;  4DXF A;  1TKG A;  1QQR A;  4HRO A;  1VZ7 A;  1TS2 A;  1BXT A;  3CWI A;  1ENF A;  2RD0 A;  5TR5 A;  1WJN A;  2BQQ A;  2KAN A;  3ZXV A;  1DOY A;  4ZRQ A;  5KHO A;  3Q8B A;  3N1X C;  3EUB 2;  2LJ5 A;  2BS3 B;  3JSV B;  4ARI A;  1IBX A;  2IO1 B;  2KOX A;  2DHZ A;  3ML8 A;  1V86 A;  3VUW A;  1DOX A;  1M94 A;  4ZOH C;  5T8I A;  4B9K A;  3QK0 A;  4JWS C;  5J2R A;  1C4C A;  1F77 A;  2UWQ A;  4RM9 A;  1WJU A;  3ZIM A;  1YJI A;  2I1K A;  1UGM A;  1Q1O A;  4L1B A;  2MP2 A;  2K8C A;  3L54 A;  1OQQ A;  2WX1 A;  3NVY A;  1LO5 D;  1UWX A;  3AEA B;  1D6E C;  4C56 C;  1ZDV A;  3OAW A;  3CMM B;  3VXW A;  1XT9 B;  2ACZ B;  1ZP0 B;  1K50 A;  2RMM A;  3P63 A;  2D07 B;  1H7X A;  1VJK A;  3AM9 A;  5E6P A;  2PPH A;  3UGB B;  1FRD A;  2RDH A;  3H9D A;  3R7Q A;  2O6V A;  1AWD A;  3EA6 A;  5BYS A;  2AQ2 B;  3VFK A;  3B2F A;  4YTP B;  3A9K B;  3VR9 B;  2V4L A;  2FBW B;  4REZ A;  1D4B A;  2K8H A;  1LFD A;  4WWM A;  4FLH A;  3Q6B A;  3MJW A;  2INN E;  3AUL A;  3ZTD A;  2WXQ A;  3N1Y C;  2BBC A;  2N9L A;  3E56 A;  1OEY A;  2D5G A;  3NZ3 A;  1K52 A;  3WAN A;  1QOG A;  4J6I A;  2WHI A;  3AH7 A;  4IWO A;  4JE3 B;  2GLS A;  2KQ7 A;  3W1S A;  2C5L C;  3IBE A;  2N1V A;  3QC8 B;  2NTS A;  3QAQ A;  4IWQ A;  4ZDV A;  4FN2 A;  1VCB A;  2KX3 A;  3BII D;  4W9I A;  3MHZ A;  3BYY B;  4LK0 M;  2KDI A;  2FUG 1;  4TKN A;  3L17 A;  4WAA A;  3PRE A;  2LGI A;  1I4P A;  2ZPN A;  4IKG A;  3MC0 B;  4AJY B;  4DDG D;  3BY4 B;  2WXJ A;  2KDE B;  3MHS D;  3AE5 B;  3SFD B;  3FKY A;  2MJD A;  2V9H A;  5C23 A;  1LM8 B;  2VZK B;  4WJN A;  4N9F 4;  1FNW A;  4MT5 A;  3TMP B;  1P3Q U;  4E74 A;  4US9 A;  4KV2 A;  3U7D A;  1TKY A;  2RDG A;  2KO3 A;  1GTH A;  5C3J B;  4ICV A;  1HE8 A;  2DLB A;  1XF5 L;  2WQY B;  4C4V B;  1SE4 A;  4MSQ B;  3ECI A;  1ISN A;  2WDR B;  1OQY A;  1KLG D;  1UBQ A;  1YX6 B;  1V1O A;  3WCQ A;  2K1F A;  2FAZ A;  1V5T A;  4PS7 A;  2GBM A;  4M0W B;  2C60 A;  3ZLZ A;  3P1M A;  1IBX B;  3EGR A;  4UDU C;  3VUY A;  1TZ1 A;  1NI3 A;  2DZK A;  1K51 A;  2J53 A;  4MH8 A;  3AI5 A;  4JGH B;  4W9H A;  3NS8 A;  3RNF C;  1L6U A;  2J42 A;  2KDM A;  2MP2 B;  3DVN V;  1M4V A;  4KGS A;  2LEK A;  3H7P B;  5D94 A;  3PT2 B;  2J52 A;  5DPS A;  5KHQ A;  1MJD A;  2LD9 A;  1NYR A;  3AXC A;  1IP9 A;  3OJ4 B;  2IO3 B;  1T5X D;  3PSE B;  4GDK A;  4GOC A;  4JX1 C;  3TSS A;  1Q5W B;  1E8X A;  3DWM A;  3DQV A;  1WXV A;  2GI9 A;  2KQ4 X;  1CJE A;  4KGT A;  1KLV A;  3JYU A;  1D5M C;  1PYW D;  2XNA C;  4PYU A;  2V3S A;  1MHH E;  2OJR A;  4A3O A;  3W5U B;  1V80 A;  2K0P A;  5BMH A;  1NVI D;  3Q69 A;  4GN1 A;  5LXH A;  3ZYY X;  2LGD A;  3A33 B;  5CHV C;  3FC4 A;  2M8S A;  2M4N A;  2CHX A;  4XWT A;  3P4S B;  1BML C;  2IGG A;  2QDF A;  1BUI C;  3VTV A;  4FA6 A;  1TBE A;  4EFO A;  4HDO A;  2KMC A;  3W2D A;  2AL3 A;  5JHB A;  2LI5 A;  3Q3O C;  4F1S A;  3TCA A;  2BS2 B;  1WJ6 A;  2KC2 A;  1RFK A;  1WGR A;  3M62 B;  2C7M B;  2AWT A;  4MEM A;  4PT5 A;  2EMS A;  2SEB D;  1SGH A;  2KJR A;  1KH0 A;  3KYD D;  2ZEQ A;  4ZYN A;  5JXV A;  1WR1 A;  3VVW B;  1V81 A;  5AZH A;  4ZYS A;  4E71 A;  4ANV A;  2G4D B;  2KWV B;  3PZD A;  2WDV B;  4A9A A;  4KVG B;  1FIQ A;  2N1W A;  4DXG A;  2JY6 A;  4P16 A;  4XC2 A;  2JWZ A;  2ZVN A;  2HTH A;  3WA0 A;  3RNA C;  4XYC A;  3PLU A;  4USA A;  2BW2 A;  5AUK A;  1SIF A;  2WXO A;  1PGB A;  2R61 A;  2BWF A;  3O65 B;  1G6J A;  2KAC A;  3VHT C;  1WX8 A;  3P42 A;  3O13 A;  2IBI B;  4ZRP A;  2NTT A;  2HD5 B;  1AYF A;  4RMA A;  3M63 B;  3LDZ E;  1FPY A;  1JWS D;  1YJ1 A;  2FCN A;  3GE3 C;  4KZC A;  2JRH A;  1B1Z A;  1RLF A;  3A1Q B;  2GB1 A;  3C19 A;  3NOB A;  3AEE B;  2M1M A;  1F1H A;  1FM0 D;  1FCC C;  2N7D A;  2LUM A;  2JYT A;  5EE3 A;  3ETR A;  4XZ4 A;  1WRD B;  2RPQ A;  3AU5 A;  3ZUN A;  1FMA D;  1E5W A;  1PFD A;  3ZRC A;  3ZQ4 A;  4JPS A;  4GIV A;  1XXG A;  3KVF B;  3V6C B;  2DEN B;  1SJE D;  3D32 A;  4II3 B;  3RNB C;  3Q8C A;  3TEY A;  3AED B;  2KZR A;  2KLC A;  3NHE B;  4GDK B;  3B0A A;  1JRO A;  3DBS A;  4TMA B;  2ZNV C;  3PHX B;  1UZX B;  1E6E B;  5AUI A;  2CS4 A;  2PMV A;  2JRI B;  2BS4 B;  3SHQ A;  4HJK A;  4AWJ A;  2JQR B;  4ARC A;  4OVV A;  4L2Y A;  4ANX A;  5IA7 A;  1TGZ B;  4WJQ A;  4P7I A;  4KIK A;  3GZN B;  4JQW C;  5D7G A;  2KX0 A;  4WAF A;  2CJN A;  3SDL C;  1N5X A;  3L08 A;  4RGT A;  1EF1 A;  1OFF A;  2RPV A;  4FJZ A;  1ET9 A;  5FK9 C;  1L5P A;  1ZXI A;  4N58 A;  1Q10 A;  1OQR A;  3V61 A;  4A90 A;  4F8C B;  1VZ8 A;  2BYF A;  2PEA A;  3RNE C;  1P7E A;  4ZRK A;  3UIP B;  3PLV A;  1E8Y A;  4GB9 A;  3VUX A;  1JWM D;  2MLB A;  1EWY C;  4W9J A;  1QLB B;  3GB1 A;  2WDQ B;  3AN1 A;  1MVK A;  4NY0 A;  4BFR A;  2L00 B;  2LXC A;  3APC A;  2JX5 A;  1HQR D;  5JZE B;  4MGK E;  2H89 B;  2ICI A;  1KOT A;  1JQ4 A;  3PZ7 A;  2IYD B;  2QHO A;  1RM6 C;  1UBI A;  1HA5 A;  2JXT A;  2KVR A;  1R7S A;  2KDF B;  4WWO A;  1WGG A;  1A70 A;  3TUO A;  1T0S C;  2VH2 A;  2W3R A;  4I6N B;  4YTM B;  3TL5 A;  2L83 A;  2JXX A;  2KVZ A;  5JHA A;  2MWS B;  4NAW B;  3MJ5 A;  1NYQ A;  2J0M A;  1XCT L;  4LJP B;  1WX7 A;  2LGX A;  2JWU A;  4HDQ A;  1TIF A;  4DBG A;  2PIA A;  2LZ6 A;  2DYO A;  3SD5 A;  1SF0 A;  5HKH A;  4YSX B;  1KM7 A;  1YNT E;  2D11 A;  3NVW A;  4TSS A;  2EEL A;  2I38 A;  3N3K B;  4F7Z A;  2KJH B;  2R2O A;  3KYC D;  3AU4 A;  5FR6 A;  2AL6 A;  4DHJ D;  1MG4 A;  3UIN B;  2L32 A;  1AW7 A;  2RDB C;  2Y5P A;  1DOI A;  1SBB B;  3APD A;  4EKU A;  4RM8 A;  4YT0 B;  3WAM A;  2N9X A;  4LNI A;  1Q0W B;  1LXD A;  1QT9 A;  3KQ4 A;  1C77 A;  2DZI A;  4WQM A;  1QIL A;  1XLN A;  3ZDT A;  4EEW A;  1WXQ A;  4IUM B;  4C00 A;  1STE A;  4LLG M;  2MBQ A;  4GDL A;  1YX5 B;  3LYY A;  4KKJ A;  2V0G A;  2WNM A;  5GXG B;  3DBR B;  1N62 A;  1H4R A;  1V6E A;  4G0N B;  1H7W A;  1YMH E;  2O6V D;  1T3Q A;  1I35 A;  5D3I B;  3Q3J A;  4XX5 A;  2MA9 B;  1E9M A;  2KTF A;  5IP4 D;  4HVB A;  2AX5 A;  2Y3A A;  2UYZ B;  3L10 B;  4MAC A;  1IGD A;  2WU2 B;  1GB4 A;  3VRB B;  3NVZ A;  1C4P A;  1WWT A;  4YWG G;  2L3Z A;  3R2T A;  2I2Y A;  1JWU D;  1S1Q B;  4E3C A;  3H8H A;  1XQQ A;  2OJW A;  1HEZ E;  3B9J A;  1R4N B;  2BKF A;  1TS3 A;  4HEA 1;  4W9G A;  4KZ0 A;  1V1P A;  2G9H D;  3FAH A;  2KNB A;  3ZVV A;  2JZZ A;  2V3N A;  1JAL A;  4DK5 A;  1TS5 A;  3KUD B;  1K8R B;  2BVC A;  4II2 B;  3RZW C;  3RYT A;  4K1R B;  3OLM D;  4NJ7 A;  4MGY E;  2LVQ A;  3UI3 A;  2IGD A;  1SIJ A;  2WXF A;  4W9L A;  3ZJV A;  1F2R I;  4HPL B;  3VRA B;  2M0A A;  2RR9 A;  1GC6 A;  3PRZ A;  3U2S C;  4KKI A;  1IYF A;  3IVF A;  2CHW A;  5L83 A;  3RNC C;  2ZZP B;  5D3D A;  2AQ3 B;  4GXB A;  4BAX A;  2FID A;  4K3B A;  5EE1 A;  2DWQ A;  1UUP A;  2EKE C;  2LRU A;  5H8Y E;  2K6D B;  2KKC A;  2WXM A;  3JVZ X;  1C3T A;  5EE9 A;  5E6O A;  2CU3 A;  2MHJ A;  4HKZ E;  1JRP A;  3DBR I;  2J4X A;  2AEH A;  4P1B C;  1WMH A;  3BVZ A;  2IDY A;  2CU1 A;  1WFY A;  2BB6 A;  1CQV A;  3A9J A;  3PO0 A;  4EOY A;  4NJC A;  4C7Y A;  1SXT A;  3NRZ A;  4W9C A;  1Z5S B;  2AYO B;  1D5X C;  4LNN A;  5C2T B;  1E90 A;  1SSN A;  1E7P B;  1YN5 A;  2EMT A;  4RFB A;  1EU4 A;  2PW9 A;  5CHW A;  4NQL B;  1XLQ A;  1R4N I;  1ZW7 A;  2LMC A;  2QCZ A;  4B0M A;  4M00 A;  2MH7 A;  4DHZ B;  4BBN F;  5DPW A;  1D3Z A;  1H8C A;  1P7F A;  1QOA A;  2Z0E B;  5IOI A;  3X23 A;  4ZRJ A;  1WXA A;  4G50 A;  4ANU A;  1JML A;  3NJT A;  4G3X B;  4JWU C;  4GDL B;  4GGQ A;  1PUT A;  5AZG A;  1JCK B;  4DHJ B;  3WIM A;  4K3C A;  2YEP B;  1L0X B;  1VDV A;  4LTU A;  2X38 A;  2L0T A;  3IT4 B;  3AE6 B;  4XDC A;  2MEK A;  1V97 A;  3R7R A;  1GG3 A;  1XLP A;  2IZV B;  3KLS X;  3SR6 A;  4BKG A;  3ZGZ A;  4FUL A;  1FRR A;  1R4M B;  4HKQ A;  1NEK B;  2YEP F;  1FEH A;  2LFI A;  2JUO A;  5C1Z A;  4IWP A;  3R8B A;  2FCM A;  1X1M A;  1XCQ L;  2W3S A;  3IAM 1;  1EO6 A;  2INC C;  4AOF A;  2FCQ A;  4H2A A;  5FR3 A;  3DVG X;  3ZO5 B;  2BYE A;  2DNF A;  1GB1 A;  1ZUD 2;  3WAP A;  2KN4 A;  1E10 A;  2WXR A;  3MFG A;  3AV8 A;  1V1P B;  2O6V B;  2KD0 A;  3V62 A;  1E8Z A;  4URK A;  1ET6 A;  2G4S A;  2MRP A;  3ALB A;  2WXN A;  2BPS A;  4NPN A;  1WF9 A;  1L4D B;  3J9C A;  3ZNZ B;  3NZS A;  4GLS C;  1QOF A;  4MGZ E;  4A20 A;  3AE2 B;  3Q2A C;  1IPG A;  2KC1 A;  4BZA A;  3VDZ A;  1VRA B;  5CHF A;  3UF8 A;  4OW0 A;  4I6L B;  2M17 A;  3QIJ A;  2K39 A;  1ZOY B;  5H92 C;  2M56 B;  2RSU A;  1DYQ A;  1N61 A;  4FHK A;  3C0R B;  3TBL D;  3MC9 A;  3N1Z C;  1KLU D;  3QJZ A;  2IND C;  3AE8 B;  3EC8 A;  2G45 B;  2ZVO A;  4NQK E;  4IM3 A;  4JL9 A;  1QF6 A;  1QKZ A;  2LUE A;  1WMH B;  2W54 A;  5E6N A;  3A4S C;  3GE8 C;  1VLB A;  1XD3 B;  4EZL A;  4C80 A;  4FJV B;  1EU3 A;  3A9J B;  2BKR B;  1R4M I;  3DVN U;  2WXK A;  1WM2 A;  4CYE A;  2W55 A;  2LWP A;  3Q3M C;  5TSS A; 
#chains in the Genus database with same CATH homology
 1P7E A;  1I4X A;  3I57 A;  2XN9 C;  1FXA A;  4ZOH C;  3BVM A;  4YXD B;  1ROE A;  3PZ8 A;  5T8I A;  2INP E;  4JWS C;  3RPF C;  3L4P A;  1IGC A;  1C4C A;  1F77 A;  3NVV A;  1E0Z A;  1JWM D;  2ONQ A;  3IAS 1;  1YJI A;  1EWY C;  2BT6 A;  4A8X C;  4L1B A;  3R2I A;  5G5H A;  1QLB B;  3GB1 A;  1OQQ A;  2WDQ B;  3AN1 A;  3NVY A;  1MVK A;  1LO5 D;  1UWX A;  3AEA B;  2KWD A;  1YJJ A;  2PVO D;  3GP7 A;  1D6E C;  4C56 C;  1ZDV A;  3MP9 A;  4RF0 A;  1FNU A;  2K22 A;  1FNV A;  2Q5W D;  2JX5 A;  3IT6 B;  1HQR D;  3Q8F A;  2ACZ B;  1ZP0 B;  1VZ6 A;  1K50 A;  2RMM A;  1L4Z B;  3P63 A;  2H89 B;  1H7X A;  2ICI A;  1VJK A;  3AM9 A;  1B9R A;  1JQ4 A;  3PZ7 A;  1FRD A;  2RDH A;  1RM6 C;  2GRI A;  3CIR B;  3AE1 B;  4HJG E;  3U52 E;  1AWD A;  3EA6 A;  2Y5C A;  2AQ2 B;  1HA5 A;  5BYS A;  1C79 A;  2JXT A;  1R7S A;  3B2F A;  4YTP B;  3VR9 B;  3T3N A;  1XLO A;  2FBW B;  3BVG A;  4REZ A;  1D4B A;  3RFZ B;  1A70 A;  3TUO A;  1V8C A;  2W3R A;  2N0S B;  4YTM B;  1K53 A;  2ON8 A;  2QSD A;  2ZW1 A;  4J3O D;  2L83 A;  4L23 A;  4WWM A;  3HUI A;  4TQ1 A;  2INN E;  4NAW B;  3P4R B;  2OHF A;  2WXQ A;  3MJ5 A;  2BBC A;  2N9L A;  3E56 A;  1NYQ A;  3SFE B;  1KRH A;  1XCT L;  2D5G A;  1YN3 A;  3NZ3 A;  1K52 A;  5E6J A;  2JWU A;  4FXC A;  1TY2 A;  2PIA A;  5FKA C;  1QOG A;  2DYO A;  3AH7 A;  1ESF A;  1SF0 A;  4YSX B;  3AEG B;  1N5W A;  1YNT E;  3NVW A;  4TSS A;  1MHX A;  1JWB D;  1N63 A;  4JE3 B;  4R3D A;  2EEL A;  2I38 A;  3W1S A;  2NTS A;  2QIE B;  1QOB A;  4KGR A;  3ABV B;  2L32 A;  4EE2 A;  2W82 A;  4O1N A;  1AW7 A;  2Y5P A;  1DOI A;  2K9X A;  4YSZ B;  3BII D;  1SBB B;  1C78 A;  4YT0 B;  2PVG C;  3NS1 A;  3MHZ A;  5BMG A;  3BYY B;  1J7B A;  4LK0 M;  1QT9 A;  3KQ4 A;  1C77 A;  4WQM A;  2FUG 1;  4N59 A;  1WGK A;  1QIL A;  1NEN B;  2KMM A;  1XLN A;  3P4Q B;  4P6V F;  2L1A A;  3Q8A A;  1I4G A;  1YN4 A;  2LGI A;  5BYQ A;  2B76 B;  1WXQ A;  1I4P A;  1STE A;  4LLG M;  4IKG A;  3MC0 B;  1IUE A;  2WXJ A;  4RF1 A;  3LYY A;  4KKJ A;  1YQ4 B;  2WNM A;  3AB5 A;  4D2K A;  5GXG B;  2V0G A;  3AE9 B;  4B0E A;  3AE5 B;  2CJO A;  5HG2 A;  3SFD B;  2MJD A;  1N62 A;  2VZK B;  1FNW A;  4MT5 A;  1KFY B;  1H7W A;  1YMH E;  4C7Z A;  4US9 A;  2QMT A;  1GT8 A;  1L0V B;  1TKY A;  2RDG A;  1T3Q A;  2E3T A;  1FD6 A;  1GTH A;  5C3J B;  5D3I B;  3FIL A;  2DLB A;  2K3U A;  3BK2 A;  1XF5 L;  1FO4 A;  2WQY B;  1SEB D;  1E9M A;  1SE4 A;  1UGJ A;  2DBY A;  2E6X A;  2K5P A;  2WU5 B;  2AX5 A;  1TZO A;  1I7H A;  1FFV A;  2KAJ A;  2QEJ C;  2Y3A A;  4MAC A;  1IGD A;  2WU2 B;  2WDR B;  1FXI A;  3VRB B;  1WYG A;  3NVZ A;  4RH6 A;  1GB4 A;  1C4P A;  2JSV X;  2FE8 A;  1KLG D;  1WWT A;  4YWG G;  3R2T A;  2I2Y A;  3P4P B;  1JWU D;  1V1O A;  3WCQ A;  3W5V B;  3H8H A;  1PDX A;  4A55 A;  1HEZ E;  3B9J A;  5LNK 1;  3BZD B;  4A6Q A;  3P1M A;  1IBX B;  3EGR A;  4UDU C;  3TEX A;  4OHJ A;  1TS3 A;  1JW9 D;  1NI3 A;  3AE4 B;  4HEA 1;  1V1P A;  1K51 A;  1PGA A;  2G9H D;  2J53 A;  3FAH A;  4MH8 A;  1GTE A;  1L0Y B;  3U7Z A;  2V3N A;  1JAL A;  2IJ0 A;  5G5G A;  1TS5 A;  2WXL A;  4IOI E;  1L6U A;  3ZJU A;  2J42 A;  2PKO A;  4XE0 A;  1JWA D;  1HZ6 A;  2KDM A;  3TEW A;  3UI3 A;  3NUH B;  2IGD A;  1SIJ A;  3AEC B;  2WXF A;  1M4V A;  4KGS A;  1MI0 A;  2LEK A;  3SEB A;  2J52 A;  3ZJV A;  1F2R I;  1TY0 A;  4RCO A;  1ZE3 D;  3VRA B;  1GAQ B;  1KTK A;  1NYR A;  2M0A A;  3U2S C;  4KKI A;  1N60 A;  1T5X D;  4JX1 C;  3TSS A;  1Y56 A;  2IPK D;  3BYT B;  3DWM A;  5D3D A;  2AQ3 B;  2GI9 A;  2KQ4 X;  1CJE A;  4KGT A;  1D5M C;  2L52 A;  1PYW D;  5EE1 A;  2DWQ A;  4XWW A;  2XNA C;  1UUP A;  2WP9 B;  2WXP A;  1WSP A;  3C8Y A;  2NMQ A;  5H8Y E;  1MHH E;  3W5U B;  2K0P A;  2WXM A;  4OZC A;  1NVI D;  3V3X A;  5BMH A;  5EE9 A;  1RWS A;  2V4I B;  3Q69 A;  3ZJT A;  1I4Q A;  2CU3 A;  4HKZ E;  1JRP A;  3ZYY X;  2J4X A;  3W9C B;  3V05 A;  3E9S A;  3FC4 A;  3I9V 1;  3BVZ A;  1UWM A;  2IDY A;  4YSY B;  2DYM A;  4XWT A;  1J7A A;  2BB6 A;  4ITK A;  2WXI A;  3CF4 A;  3P4S B;  1BML C;  4IDI A;  1CQV A;  3PO0 A;  2IGG A;  4CQN A;  3IXS A;  4WH4 A;  1YQ3 B;  3AE7 B;  1BUI C;  4NJC A;  4C7Y A;  4NAM A;  1SXT A;  3NRZ A;  5BMI A;  1D5X C;  1HXY D;  2N7J A;  3W2D A;  4OZB A;  4RGO S;  5C2T B;  1SSN A;  1YN5 A;  1E7P B;  2TSS A;  5HI1 A;  4RFB A;  4AS1 A;  4OZA A;  1EU4 A;  4RGM A;  1PGX A;  2BS2 B;  2PW9 A;  1RFK A;  1XLQ A;  3T3O A;  2LMC A;  4B0M A;  1WRI A;  4PT5 A;  1TS4 A;  2SEB D;  1FFU A;  2MH7 A;  4RNA A;  2MJ3 A;  1F0Z A;  1KH0 A;  3BWU D;  1CK1 A;  3HVZ A;  1C76 A;  5JXV A;  1C9F A;  3AMZ A;  2M19 A;  4M0W A;  1P7F A;  4ZYS A;  1TYG B;  3LB8 C;  4US8 A;  1QOA A;  3B2G A;  3KWV A;  1JML A;  2WDV B;  4JWU C;  4A9A A;  4GDL B;  1PUT A;  1JCK B;  1FIQ A;  1MPE A;  1EM7 A;  4DXG A;  2YEP B;  4WUR A;  1L0X B;  4P16 A;  1VDV A;  2HDE A;  1SB3 C;  1HZ5 A;  4LTU A;  2X38 A;  1FCL A;  4XDD A;  3IT4 B;  3AE6 B;  5I4D A;  4XDC A;  2MEK A;  1V97 A;  4Q2J A;  1KF6 B;  3AE3 B;  3N9Y C;  5EE0 A;  1XLP A;  3KLS X;  1F2R C;  3SR6 A;  1SE2 A;  3ZGZ A;  1FRR A;  2V3P A;  2PTL A;  4USA A;  3FIL B;  5HFY A;  4HKQ A;  1NEK B;  2BW2 A;  1ACC A;  1RYJ A;  2SAK A;  1TKE A;  2WXO A;  5AUK A;  2YEP F;  3LXF A;  1PGB A;  2PLP A;  2R61 A;  2KAC A;  5BYR A;  4WIP A;  4OVZ A;  1FEH A;  3Q8E A;  3P42 A;  2LFI A;  3O13 A;  5HHD G;  4N6E B;  4MM3 B;  2JZP A;  4ZRP A;  3R8B A;  2NTT A;  2Z8L A;  1XCQ L;  2W3S A;  3IAM 1;  2HTM E;  1AYF A;  5FR3 A;  4H2A A;  3U4E G;  2LJI A;  1JWS D;  3DWG C;  1ZUD 2;  1GB1 A;  2KN4 A;  1UNS A;  1ZPS A;  1I4H A;  1E10 A;  2WXR A;  3MFG A;  5MPO A;  3HVD A;  3AV8 A;  1V1P B;  1B1Z A;  2VZK D;  3AEF B;  2GB1 A;  1L6V A;  2JYE A;  2WXH A;  3AEE B;  2BTE A;  1FM0 D;  1ET6 A;  1FCC C;  2LUM A;  2ZW0 A;  2BYT A;  2H88 B;  2WXN A;  2G1E A;  2JYT A;  5EE3 A;  3ETR A;  3HRD D;  3AEB B;  1L4D B;  1FMA D;  3J9C A;  1PFD A;  3ZQ4 A;  1D5Z C;  4GLS C;  4NZL B;  1QOF A;  4JPS A;  4TQ0 A;  1ZXH A;  1XXG A;  2WXG A;  2WLB A;  1VR9 A;  1I4R A;  3AE2 B;  1GPX A;  1SJH D;  1SJE D;  1CZP A;  2LHE A;  1XO3 A;  2N9K A;  4KX6 B;  1VRA B;  3Q8C A;  3AED B;  4ZHP A;  3TEY A;  3TEZ A;  2JU6 X;  1XEE A;  4OW0 A;  3BK1 A;  4AQ7 A;  4GDK B;  1GOZ A;  3URY A;  1ZOY B;  1JRO A;  2QIL A;  4TMA B;  5H92 C;  2OED A;  3GS2 A;  2M56 B;  1AN8 A;  3KWL A;  1DYQ A;  1E6E B;  5AUI A;  1N61 A;  1DGJ A;  2PMV A;  2EKI A;  1SE3 A;  2LHD A;  2BS4 B;  3VR8 B;  1KLU D;  2JQR B;  1TJE A;  4ARC A;  3AE8 B;  2QJL A;  4L2Y A;  4DQO C;  4DXF A;  1T6B X;  1TKG A;  1QQR A;  4HRO A;  1VZ7 A;  2BB5 A;  4HRS A;  1QF6 A;  1J7C A;  1TS2 A;  2AQ1 B;  1QKZ A;  3VQI A;  5D7G A;  1BXT A;  2W54 A;  4YTN B;  3CWI A;  4WAF A;  1ENF A;  2CJN A;  1N5X A;  4RGT A;  1OFF A;  2RPV A;  1VLB A;  1DOY A;  4ZRQ A;  4RGN A;  1ET9 A;  2WS3 B;  3OWE B;  3Q8B A;  5FK9 C;  1L5P A;  1ZXI A;  3EUB 2;  4N58 A;  2BS3 B;  1Q10 A;  4C80 A;  1OQR A;  1ZDX A;  1EU3 A;  4A90 A;  4ARI A;  2WXK A;  2IGH A;  1IBX A;  1EWC A;  1C4A A;  2W55 A;  1VZ8 A;  5TSS A;  4ZHO A;  2MJE A;  1DOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...