5C3JB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c3jB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c3jB01
3AH7A 3P4SB 3B2FA 5G5HA 2WU2B 5C2TB 3VRBB 3P4PB 2Q5WD 5EE1A 4YT0B 3CF4A 2N0SB 1YJJA 3AE2B 3BIID 1AWDA 1WWTA 4YTPB 1J7BA 3PO0A 2WDRB 1YQ4B 1SF0A 1ZUD2 1NEKB 3B9JA 3AMZA 1XLOA 3AE3B 2QJLA 1QOFA 2MJDA 3AEGB 1KF6B 3AE1B 1FXIA 2L52A 2K22A 2OHFA 1QOGA 1YJIA 1QOAA 2WS3B 3VRAB 1NI3A 2PVGC 3FC4A 1PDXA 2BS3B 1GAQB 2L83A 2BS2B 1GPXA 1EWYC 1OQRA 2K9XA 3HRDD 5GXGB 1DOXA 4N6EB 1F0ZA 3AE9B 1JWAD 3DWGC 3W9CB 1WXQA 3NS1A 1NENB 3W5UB 2KAJA 1V8CA 1TKYA 2HTME 1N63A 2M56B 1QOBA 2W3RA 3AB5A 3HUIA 1E10A 1I7HA 2DWQA 4LTUA 5MPOA 2PIAA 1J7CA 1E9MA 1J7AA 3ETRA 5H92C 2CU3A 2BS4B 3NVZA 5C3JB 1UWMA 4FXCA 4USAA 2PKOA 1QF6A 1JWBD 4YSZB 2BT6A 1VDVA 3AE4B 1GTHA 5EE0A 2W3SA 3AECB 3AM9A 2JX5A 1GTEA 1JROA 1DGJA 4ZHPA 1E6EB 1WGKA 1OQQA 1RFKA 1XLQA 4KX6B 2LEKA 1R7SA 2AX5A 3AE5B 1A70A 2JQRB 1DOYA 2G1EA 1FXAA 3LXFA 5AUIA 3SFEB 1XLPA 1NYQA 1RWSA 4JWUC 1B9RA 3CWIA 5EE3A 4IDIA 3ABVB 5EE9A 1WRIA 3AE7B 4WWMA 4HRSA 3B2GA 1TYGB 3L4PA 3SFDB 1RM6C 3EUB2 2WDVB 2WU5B 1E0ZA 1CJEA 1JW9D 2MJEA 2W55A 1WYGA 1L6VA 2KMMA 4JWSC 1ZXIA 4C7YA 3DWMA 1L6UA 4P6VF 4US9A 1VLBA 2EKIA 3AV8A 3W5VB 3WCQA 3NVWA 3ZYYX 4YTMB 3AE6B 2PVOD 2H89B 1FMAD 4C7ZA 3FAHA 1FO4A 1N5XA 1FFUA 5H8YE 1PUTA 1L5PA 4N58A 1TKGA 1L0VB 1T3QA 1FFVA 1VJKA 3CIRB 1FM0D 1N5WA 3NVVA 3P4QB 2WLBA 2CJOA 4JX1C 3AEEB 1TKEA 2Y5CA 1CZPA 4ITKA 1KFYB 2M19A 1YQ3B 1NVID 4A9AA 2FBWB 1QLBB 3VR9B 2B76B 4N59A 2E3TA 5G5GA 1XO3A 4YXDB 3AE8B 3HVZA 3AEAB 1JRPA 1FRRA 3AEFB 1NYRA 2DBYA 3KWLA 1IUEA 1XLNA 1JQ4A 3AEBB 1N61A 1SIJA 3P63A 1QT9A 2W54A 3NVYA 4WQMA 2ACZB 2QIEB 3SR6A 2MH7A 4HROA 1H7WA 3P1MA 1SB3C 1TJEA 1OFFA 1ZOYB 4YSXB 1DOIA 1N60A 1E7PB 1ROEA 1KRHA 2MJ3A 3LB8C 4ZOHC 1PFDA 1FIQA 1GT8A 3VR8B 2K5PA 4YSYB 2CJNA 4C80A 4US8A 2WDQB 1RYJA 1H7XA 3AN1A 5AUKA 1V97A 2WP9B 2H88B 1AYFA 2WQYB 1ZP0B 1N62A 1FRDA 3RPFC 4YTNB 3NRZA 1JALA 4ZHOA 3AEDB 3P4RB
chains in the Genus database with same CATH superfamily
2PW9A 2Q5WD 4CQNA 1IGCA 1VZ6A 1FNUA 2IDYA 2NR2A 4YTPB 1SF0A 4LNFA 5DPTA 1KF6B 1R4NB 3RN9C 2L52A 4YWGG 3QCAA 4FULA 4GMVA 3L16A 3HM3A 5GXGB 3UI3A 2EMSA 1V80A 2N1WA 1E10A 3DBRI 2DWQA 4XYCA 2JZPA 1P7EA 2AEHA 3OWEB 2KMAA 2PKOA 4B9KA 4DHZE 2DZMA 5LLIA 3R7RA 2WWZA 5D3DA 4KSKC 1PGXA 1DGJA 2PMVA 1OQQA 2IO3B 2KN5A 4O1NA 4W9DA 3V05A 5AUIA 1WGRA 3SFEB 1RWSA 3TJPA 3A4RA 3NS8A 1PGAA 3DHIC 2GB1A 2IO0B 1GB4A 2G4SA 2L3ZA 1KH0A 3EUB2 2WU5B 1ZE3D 1L0YB 3QAQA 2N9LA 5BYRA 4FN2A 4LJPB 2X8XX 4N58A 1Q10A 4KIKA 1JWUD 2VZKB 3ONSA 2O6VB 2DYBA 4WWPA 5JHBA 4EEWA 4N59A 3WALA 4LK0M 3HVZA 3AEAB 3IVFA 3KWLA 3ZNZB 4M01A 3PTFC 3ZJTA 5BO4B 1J19A 1OFFA 1G6JA 4FA6A 1FIQA 2DYOA 2AYOB 4C80A 1T0SC 2KX3A 2WP9B 1WJUA 3NRZA 5AZGA 1BUIC 1IGDA 2D5GA 3DDCB 3HK0A 2LHDA 1IYFA 2KDBA 2QHOA 3R66C 1ZGUB 3NY5A 4MT5A 1ENFA 1GJZA 2DNFA 2MBQA 2KHWB 4ZDVA 3DWGC 4HXDA 1WM2A 2JSVX 2JT4B 3HUIA 2BQQA 4C00A 2C5LC 2JZ3B 2G4DB 3GS2A 2L76A 1CMXB 4FXCA 2PTLA 2HJ8A 2YLMA 1Z5SB 1IPGA 3EECA 3QC8B 1XCQL 1NYQA 4A90A 3Q3MC 2WXLA 3IT6B 3KH0A 1E7VA 3P2BA 2IJ0A 1XT9B 2JWUA 2NBVB 4RGMA 4IWPA 1L6UA 2C60A 1WIAA 3N1ZC 4G0NB 2Y5BB 1ACCA 1YX5B 4WJNA 4DXAB 4RGTA 4JQWC 2QMTA 2M19A 1CQVA 2FIFA 2DHZA 5LNK1 1WJ4A 2K3UA 3T9LA 4W9CA 1C1YB 1JQ4A 1SIJA 1C77A 1F2RC 1QT9A 3RUIB 3URYA 2IGDA 1STEA 3JYUA 1ZKHA 5GMVA 2PE6B 1AYFA 2N9KA 1A5RA 2BTEA 2JU6X 2WNMA 2I2YA 4AQ7A 2CS4A 4KIKB 5D3IB 1WMHB 1WWTA 3IAS1 4EKUA 3B9JA 3PT2B 4LDTB 3ZXVA 3DBHI 3EA6A 1C76A 2UU7A 3AE1B 2PVGC 1UUPA 3APFA 2V4IB 2KQ4X 2KYWA 3PZ8A 3HRDD 4XDDA 4B0EA 1NENB 4AJYB 1PYWD 2KWVB 1WX9A 2BPSA 3Q3FA 5H92C 1TZ1A 3V62A 2CU3A 2BT6A 5EE0A 3MJWA 1Z2MA 1GTEA 1F1HA 2AQ3B 3U8ZA 1GC6A 1C79A 2AX5A 2A4ZA 4MM3B 3UQAA 3GZNB 1L7YA 4KKJA 1F2RI 1SEBD 4KSLC 2GI9A 4HRSA 2V4LA 3M3JA 2WDVB 3GP7A 1YD8U 2FNJB 2LZ6A 3FILB 4RF0A 3RNAC 4GSWA 1J0GA 2KMMA 4JWSC 4OZBA 4P7IA 4CHKA 3AV8A 3ZYYX 3ZUNA 2PVOD 1YN4A 2H89B 2PLPA 5H8YE 2NPTA 3ZJVA 5L95C 3DBLB 1CZPA 3M62B 2AWTA 4DXFA 4ZRJA 3VR9B 2B76B 4IM0A 3EHVA 2GBJA 3ZDMC 1FRRA 3AEFB 4HPMB 1C9FA 1XLNA 3DVNV 3P63A 3U2SC 5JZEB 3V6CB 1KLUD 2BVCA 3LB8C 2BB6A 2J0KA 3I5JC 3MTNB 4K3CA 3A1QB 1ZP0B 2WX0A 1ISNA 2WGSA 3CSTA 2NPTB 1P98A 1AWDA 3QX1A 4BKSA 2MRPA 4XDCA 2J52A 3MHSD 3VRAB 2K0PA 1PDXA 3QARA 1I42A 2L83A 4LLGM 3BWUD 4D2KA 3PGEA 2C9WB 2NTTA 2FUHB 4AWJA 3LDZE 2GRIA 3NVZA 2L8JA 1XQQA 3Q14C 4USAA 4YSZB 1VDVA 3ZNHB 2VZKD 4GXBA 3Q8FA 2RPVA 5E6OA 3AECB 1L2NA 1SE9A 4OVZA 1XLQA 2JQRB 1A70A 1M4VA 1S1QB 3ENEA 4WWMA 1TYGB 5CHFA 4TQ0A 4ZRIA 4IWOA 2RD0A 1ZXIA 1MG8A 3VQIA 1T5XD 3VTWA 1V9JA 2KK8A 2D07B 3FAHA 3V61A 1TKGA 2UYZB 2RDBC 1NVID 4GDLA 2FBWB 2ASQA 4GN1A 4C56C 1VD2A 3M95A 3KW5B 4F7ZA 3DVNU 4JGHB 2V0GA 1L4DB 2XEWA 2WXOA 2WHIA 2I38A 3VUXA 3ZQ4A 5T8IA 2RPQA 3N1XC 1N60A 4YSXB 2Z0DB 2BWFA 1ZPSA 3H7SA 1TT5B 3VAWA 5JXVA 1RYJA 2LWPA 2N7JA 3RPFC 1RAXA 2J0MA 4NJ6A 2KFJA 2O6VA 3T3NA 5G5HA 5C2TB 5EE1A 2KFKB 2MX2A 3BIID 2KX0A 3B1LX 3KQ4A 1XLOA 3VVWB 1QOFA 2KVZA 3M63B 1YJIA 4RNAA 5AEKB 4M00A 1RRBA 5D6JB 2ZJDA 3EC8A 5D94A 1NBFC 1P7FA 4HDQA 2BS2B 2BBCA 1GG3A 1FD6A 3KYCD 1WJNA 2MQJA 2KAJA 1EM7A 3UIOB 2INNE 2W3RA 5FK9C 1IBXB 1SBBB 3ZTDA 1E9MA 4ANXA 5C3JB 1AN8A 3N20C 4HEA1 2BYFA 1I35A 5TR5A 3UF8A 4DHZB 2D3GA 2M0AA 5FR3A 4ARIA 1E8YA 3RFZB 3IXSA 3BK1A 3ECIA 2VRRB 2MJEA 3TEZA 2M1MA 1QKZA 4TV3A 1WMHA 2QDFA 2K8HA 1TY2A 4RM8A 4C4VA 1F77A 2IZVB 5BMIA 3ZTCA 3AE6B 1BT0A 4EOYA 1FM0D 3TEYA 1TKEA 3PLUA 3B0AA 4MH0E 1QLBB 3MJ5A 4DQOC 4LDTD 1WZ3A 1V49A 4WQMA 1TS3A 4HPPA 4HROA 1D5MC 1H7WA 2G45B 3WANA 4BOZB 4MELA 3J9CA 5TSSA 3RNEC 3KUCB 4TMAB 4HLEA 2L32A 3QK0A 2WU2B 4E74A 2DZIA 1V6EA 2D11A 4IC7B 1KM7A 2GOWA 2KD0A 3Q3NC 4II3B 4WJQA 2OJWA 3E56A 1WR1A 3Q69A 4MGIE 2HD5B 4P16A 2EMTA 1L0XB 3AB5A 2IY0B 1YQBA 4MGYE 3N1YC 3ETRA 2KTRB 3PVLA 1QF6A 3AE4B 1FEHA 3I57A 1WGKA 4KGSA 2DAFA 4JWUC 2ZCBA 4IDIA 3ABVB 3T3OA 2WXGA 1KLVA 1LQBA 1WRIA 3AE7B 4WQOB 2EKEC 3APDA 4HDOA 1V1PB 3I9V1 4FJVB 1WGHA 2MBHA 3EFUA 1SE2A 3TL5A 2ON8A 5HG2A 3O13A 5LXHA 3R7QA 1EF1A 3SHQA 4CYEA 3V3XA 1WZ0A 3ZVVA 3OG5A 3R2TA 1FO4A 2IBIB 2BWES 5J18A 3ZJUA 4ZRPA 3BVMA 3IG3A 1VRAB 2M8SA 1WXSA 1KFYB 3JSVB 2V3SA 1P3QU 2NBWB 2V1YA 3A1QA 2DLBA 3ZXRA 2LGDA 4YL8A 4ZRQA 1MI0A 2ACZB 4DK5A 3VHTC 4NY0A 2MEKA 4RH6A 2L05A 1GT8A 1E8WA 2MP2A 4TUUA 2IO1B 2UWQA 1E8XA 2KACA 3NOBA 2GLSA 3AH7A 3VUYA 1I4RA 1RLFA 3VRBB 5KHQA 1YX6B 1YJJA 3AE2B 4WWOA 4M02A 3VH4B 1HXYD 2XK5A 3RNFC 3NUHB 2WS3B 1XCTL 1ZXHA 4ACFA 1WE7A 2PPHA 3PRZA 2JRHA 3L08A 2I1KA 2KZRA 2ZVOA 5MPOA 1EWCA 2KMCA 3Q2AC 1HA5A 4W9HA 3VTVA 1UBQA 4K7WA 1KOTA 3S2AA 3PZ7A 5AZFA 2IYDB 1TS4A 2KANA 3LXFA 1V81A 2NTSA 2WXHA 4DWFA 5EE9A 3RD2A 3L4PA 1UGMA 4E71A 4JE3B 3U7ZA 1XF5L 1WXMA 1HE8A 4KKIA 3KLSX 2XBBC 4JIOU 4US9A 1Y8RC 3VTUA 4TQ1A 3Q3JA 4MJSA 4ITKA 3U7DA 1YQ3B 1FPYA 5FKAC 4B0MA 4WH4A 2L00B 4K7SA 2K1FA 2L1AA 1I4QA 2DBYA 3RT3B 4BVUC 4MSMB 1FNWA 4J6IA 3RZFA 1JWMD 3BZDB 1B1ZA 3BVZA 3VH3B 2GBMA 5L83A 2K5PA 2LMCA 4YSYB 4GIVA 3C0RB 1GC7A 1SE4A 2D3AA 2LGYA 1N62A 1FNVA 4ZHOA 4A9AA 4NQKE 4ANVA 1XD3B 1XEEA 3PZDA 1MVKA 1UELA 1AARA 2KLCA 5G2NA 2KC2A 4K3BA 3ZO5B 1WRDB 2RDHA 3T8MA 1HEZE 1MHHE 3PSEB 1UNSA 4WJOA 4TKNA 4GDLB 2IO2B 1V5TA 4BFRA 4II2B 1EWYC 5J17A 3X0WA 4IUMB 4ASWC 3AE9B 1V8CA 2GMIC 4I6NB 1LFDA 3OLMD 3ZRFA 3NHEB 1ESFA 2NBUA 4P1CC 4JL9A 1JROA 4K1RB 1E6EB 4S17A 3WAMA 2DZKA 4HKQA 1T0QC 2N9XA 4NAWA 4EZKA 3HHMA 4NJCA 2ZPYA 1RM6C 3RULA 5E6JA 2BKFA 2CHZA 4BZAA 1L6VA 4H2AA 4IG7B 4JPSA 1VLBA 2EKIA 3W5VB 5IA7A 4YTMB 4RF1A 2M17A 1DYQA 4KDLB 2SAKA 3PLVA 1WR6E 3HM6X 2K25A 3CIRB 1DOXA 3W9CB 1Q0WB 2Y5CA 2KDFB 3LYYA 4BBNC 1OEYJ 2V3PA 2LJ5A 4MGZE 2MCNB 4A8XC 1WM3A 5DPWA 1JCKB 2W54A 4WIPA 3AULA 2ZW1A 4KZ0A 2CKHB 4NJ7A 4PYUA 2QEJC 1Q5WB 1V97A 1I4GA 3A9JA 4GDKA 3U52E 4K7UA 3P4SB 2NCNA 2RR9A 1EU3A 5E6PA 4DXGA 3UIPB 3W1SA 2Z59B 2D2QA 1TS2A 3OJ3A 4NZLB 4NPNA 2K22A 1MHXA 3PRMB 3TMPB 2R2QA 1JWAD 3NS1A 4RCOA 1TKYA 2MSED 1XXGA 3WA0A 4MGKE 1LXDA 4GB9A 3GB1A 3X23A 4KV2A 2BYEA 4M8NA 2FAZA 1M94A 3L13A 2ZVNA 4LNKA 1RFKA 2WXKA 1YIWA 4WURA 2G1EA 3DBRB 1XLPA 1KLGD 2JF5A 3N32A 1TBEA 1QQRA 4P1BC 3TSSA 3GE3C 3IFWB 3DWMA 1OGWA 3DVGY 1R4NI 2LXCA 1FMAD 3D32A 3TIXA 2I1JA 1PUTA 1VJKA 4J3OD 2WLBA 1I4XA 5G5GA 5G55A 1D5XC 1MFWA 1V2YA 3FKYA 3AEBB 4F1SA 1PGBA 3I63C 4R3DA 3DPDA 1TJEA 5D7GA 4NNJB 4ZOHC 2AL3A 3AI5A 2MJ3A 3N9YC 2DYMA 3WAPA 4WAFA 4BAXA 1P9DU 2M0XA 2JRIB 2H88B 2WQYB 1MG4A 2K8CA 2LUMA 1JALA 3KYDD 3P4RB 4PYZA 2KC1A 1UBIA 3A9KA 1FXTB 4OZCA 3PO0A 1YQ4B 1F9JA 4W9IA 1H4RA 2LRWA 2MJDA 2C7NB 2KJ6A 3TCAA 1MJDA 1QOAA 4RMAA 3MC9A 4RGOS 1GAQB 2KQSA 2MP2B 2MBOA 2MW5A 3V6EB 4ICVA 3ZNID 2IPKD 4REZA 4B95A 5BMHA 1J7CA 3PV1A 2BS4B 3WAOA 1OTRB 4N9F4 2W3SA 3AM9A 2WX1A 2O2VA 1QILA 2LEKA 1MPEA 3UQBA 3N30A 2JUOA 2VH2A 1P1AA 5DPRA 1YJ1A 5IOIA 1C78A 2DZJA 3MFGA 4ICUA 3ZKJC 1ET6A 3N3KB 4MJSB 3KUZA 4KZCA 2L0TA 1WGYA 4NQLB 2KTRA 1K52A 2E6XA 2Z8LA 3L17A 3Q8BA 3WCQA 3NVWA 3PREA 3Q8AA 2PE9A 4KVGB 3SDLC 3P42A 2CJOA 3AEEB 1YOVB 1JMLA 1KJTA 2L0FA 4OVVA 4NAWB 1J8CA 1N6ZA 4TSSA 2WXQA 3L0WB 2SEBD 4BBNF 1NYRA 4HKZE 2LJIA 2MH7A 1E5WA 1R4MI 3P1MA 5JH5C 4IW0A 3W1SC 4M0WB 2J42A 2JY6A 2BYTA 1HZ6A 1H7XA 4KGTA 2D10A 2D3BA 2WXMA 2D3CA 2O2VB 2JZZA 2R2OA 3B2FA 2JYTA 5LXIB 3IAM1 1FCCC 3BY4B 3UGBB 1ZDXA 1V1PA 2QJLA 3O65B 2INPE 2LUEA 2WYQA 4LJOB 4OHJA 2XN9C 4KGRA 4BOSC 3PPAA 5HI1A 1JWSD 1S3SG 1HQRD 2ZCCA 2N9EB 2HTME 2K8BA 2R61A 2KVRA 3ZW3A 4F8CB 2NMQA 3IHPC 3KUDB 3NZ3A 3L10B 1D4BA 2FCSA 1SXTA 1NI2A 4ZHPA 1K8RB 4W9GA 3H7PB 5BYSA 1WX7A 1SJED 4FHJA 2WDTB 4G11A 2G3QB 1HTOA 2IGGA 1WFYA 1JW9D 2REXA 4AOFA 1WF9A 3KVFB 2ZEQA 2INDC 3VDZA 2IY1B 2JPHA 1FFUA 4PK1A 1L5PA 3Q8EA 4WAAA 1N5WA 3NVVA 1I4HA 2FE8A 2LXAA 5D2MB 4I6LB 2N1VA 4PS3A 1GNUA 1JRPA 2JVCA 1IUEA 4DHJD 3BYYB 4MDKE 2N9PC 2N4FA 3NZUA 1R4MB 3Q3OC 5DCNA 1X1MA 2KLGA 4YTNB 3RI7C 1V1OA 3BK2A 3DHHC 4URKA 1GB1A 2N0SB 3B08A 3IT4B 4HVBA 1WE6A 2NVUI 2W82A 2WDRB 2AQ1B 1NEKB 3GOEA 2JWZA 2YVCA 2AQ2B 1NI3A 2K6QA 4IOIE 5EDSA 1WXVA 4FJZA 1C4CA 4XE0A 1KTKA 3QJZA 1WYWB 2N7DA 2DX5B 3GZNI 2MBBB 2M56B 3H1UA 1I7HA 4LTUA 5CHWA 2PIAA 2VH1A 5KHOA 1VZ8A 3BYTB 1UWMA 3V60A 4ANWA 3U4EG 3H9DA 3FILA 3ALBA 3PHWB 1K50A 2OOBB 2ZW0A 5E6NA 4MEMA 4OW0A 1V5OA 2RSUA 2V9HA 3SD5A 3JSVA 1B9RA 1BMLC 4G50A 2V3NA 3SFDB 2K6DB 1D5ZC 1CK1A 4IWQA 4MACA 2KXJA 4C7YA 3VXWA 3DOWA 1FCLA 3AXCA 4EZLA 1ET9A 1C4AA 4WJPA 2QILA 2MA9B 2KFKA 1YNTE 2WXFA 5HFYA 4Q2JA 1T0YA 3K9PB 1TIFA 3ZIMA 4FBJB 4YXDB 3AE8B 5IN7A 2NS5A 4A6QA 4C4VB 2RGFA 4MH8A 4E3CA 4HPLB 2Y3AA 3RNCC 3SR6A 2QIEB 2INCC 1T6BX 1I4PA 2KOXA 2MLBA 4A20A 1U4AA 3CF6E 3W1YA 3ZDTA 2CJNA 2WDQB 3DVGX 2JXXA 4W9FA 4B6WA 2KJRA 2BKRB 1HZ5A 1WGDA 5IP4D 3DBHB 5J2RA 4NAMA 3RZWC 1AW7A 2QC8A 4HK2A 4XX5A 4ANUA 1RFAA 4OZAA 3APCA 4L2YA 1ZUD2 2PJHA 2FCNA 3AE3B 3MC0B 4BKTA 3FC4A 2KWDA 1D3ZA 2WXJA 4A55A 2ICIA 1V86A 4IKGA 3R8BA 2QCZA 2LGIA 3AU4A 3JVZX 4IM2A 2G9HD 3ZGZA 4A3PA 4XWWA 1J7AA 4JLCA 3NJTA 2J4XA 4K81A 4M8MA 1IBXA 2J53A 2KNBA 2JX5A 1TY0A 2BW2A 2KDEB 3L54A 2KO3A 3U30A 1EUVB 4KX6B 1VZ7A 2JYEA 1DOYA 1TTNA 1YN5A 3I3TB 1SE3A 2LVPA 1CJEA 4XWTA 2MHJA 4DBGA 4FADA 4S0RA 1UGJA 2YEPF 1N5XA 5BMGA 1L0VB 2MWSB 4M0WA 3TEWA 2ZNVC 2CR5A 2Y5PA 3W2DA 1XO3A 1C4PA 1WGGA 2MBEA 2B3AA 4LNIA 4W9KA 1EF5A 3K9OB 3NVYA 3A4SC 1SB3C 1ZOYB 3PRPB 2LD9A 3ZLZA 2L7RA 1WY8A 4GDKB 1NDDA 5FR6A 2M4NA 3AU5A 3CF4A 2FUG1 4X57B 1UWXA 4XZ4A 2OJRA 2KN4A 3ML9A 4XC2A 5HKHA 4RM9A 2J0JA 2OHFA 3A9JB 4L1BA 2OEDA 2LASA 3RMKC 3RYTA 1K53A 3RCZA 1SJHD 4FJYA 4N6EB 4IM3A 3W5UB 3MHZA 3QHTA 3HVDA 1ZW7A 2CHXA 2XK5B 4HJGE 4MSQB 2HE7A 3QA8A 2WXNA 4FLHA 2LFIA 1UF0A 3VFKA 3WIMA 2A5UA 1F52A 4FHKA 4BKSD 2HTHA 3CMMB 5CTRC 3TBLD 1R7SA 3AE5B 2KDMA 1FXAA 5EE3A 3H7PA 4DDID 1K51A 2GBNA 4OVUA 1WYGA 4I6PA 3E9SA 4L23A 3A9KB 1VR9A 1YN3A 3DBSA 4P6VF 3TEXA 4BKGA 3TUOA 4ZYNA 5IAAC 3JW0X 3P4QB 2HJ1A 3ML8A 1PQSA 2LVQA 4W9LA 1L4ZB 5I4DA 5AZHA 2KWUB 2LGXA 2FIDA 1UZXB 1ZDVA 4HCPB 4US8A 5DPSA 2ZNVB 3BINA 2KQ7A 3OAWA 3P4PB 4HWIB 4YT0B 4KDIC 4LNNA 5JHAA 4GLSC 4PS8A 3AMZA 4HJKA 4LCDE 1GOZA 3HIZA 1QOGA 4XGAB 5BYQA 2BS3B 5HHDG 1BXTA 2ONQA 2TSSA 2LVOA 1LGRA 1JRUA 2FCQA 3EFCA 2KT7A 2X38A 1QOBA 3ZNGC 5IKCM 3DCGA 4PS7A 1LO5D 1HTQA 2LHEA 3C8YA 3DQVA 3LJ3A 1GTHA 1TZOA 5CHVC 3DHGC 1QZEA 2BGFA 2KJHB 4DHJB 3QQ8B 3SEBA 1IP9A 5IO9A 1E90A 2KKCA 4RGNA 3GE8C 4EE2A 1E0ZA 2CHWA 2W55A 3MC8A 2Z0EB 2EELA 2XNAC 1LM8B 1T0RC 2DAJA 3C19A 4C7ZA 4MM3A 1T3QA 1FFVA 1WI0A 1Y56A 1TGZB 3ZRCA 1Q1OA 2E3TA 1TS5A 2PEAA 4LNOA 3MP9A 3KWVA 5CX3A 1N61A 5C1ZA 4RFBA 2WXPA 3EGRA 1ROEA 4A3OA 4EFOA 3UINB 2BB5A 3VR8B 2WXIA 3AN1A 4DDGD 2N7EA 1WSPA 2KTFA 2GBKA 1C3TA 2KDIA 1EU4A 1OEYA 3AEDB 2JXTA 2LI5A 4HCNB 1WJ6A 1WXAA 2CU1A 3DBLI 4AJWA 1GUAB 2C7HA 4W9EA 4ZYSA 3QWZB 4EZJA 1J7BA 2C7MB 2BYVE 2HDEA 4QAYA 3CSFA 3AEGB 3RNBC 1FXIA 1YMHE 3PHXB 3Q8CA 1GPXA 1OQRA 2K9XA 4ZRKA 1F0ZA 2QSDA 1WXQA 4CO7A 1N63A 2J7QB 1VCBA 3PS6A 4UDUC 1D6EC 4GU2A 1SGHA 4WWNA 1JWBD 2FCMA 3H6NA 4GOCA 3NZSA 4GGQA 3QIJA 2GBRA 4PT5A 2LGSA 3CWIA 3B2GA 4AP4C 1WX8A 2O6VD 2DENB 2RDGA 1OQYA 3BVGA 2YEPB 4W9JA 2K39A 1E8ZA 1WH3A 3R2IA 5C23A 2AL6A 2IGHA 2RMMA 4AUQC 3VUWA 2ZPNA 3OJ4B 1SSNA 4EUTA 4JX1C 1EO6A 3NG0A 2WXRA 2LRUA 2BF8B 1E7UA 3H8HA 2KWCA 3A33B 3Q6BA 1UD7A 1H8CA 1SIFA 1DOIA 1E7PB 1KRHA 3IBEA 1P0RA 1PFDA 4ARCA 4G3XB 2ZZPB 2W9NA 5AUKA 4AS1A 1UH6A 1FRDA 3SU8X 3R3MA 3RNGC
chains in the Genus database with same CATH topology
3P4SB 4NAMA 3T3NA 5G5HA 2PW9A 5C2TB 1EU3A 1AW7A 2Q5WD 1IGCA 5EE1A 4CQNA 1VZ6A 4DXGA 1FNUA 2IDYA 3BIID 4YTPB 3KQ4A 4OZAA 3W1SA 1SF0A 1ZUD2 4L2YA 1XLOA 3AE3B 1QOFA 1KF6B 1TS2A 3MC0B 4NZLB 2L52A 2K22A 1MHXA 1YJIA 4RNAA 3FC4A 2KWDA 4YWGG 2WXJA 4A55A 2ICIA 1P7FA 2BS2B 2BBCA 5GXGB 3UI3A 1FD6A 1JWAD 4IKGA 3R8BA 3NS1A 2KAJA 4RCOA 1EM7A 1TKYA 2LGIA 2INNE 2W3RA 1XXGA 5FK9C 1E10A 2DWQA 2G9HD 1IBXB 2JZPA 3ZGZA 1SBBB 4XWWA 1E9MA 1J7AA 1P7EA 2J4XA 5C3JB 1AN8A 3GB1A 3OWEB 4HEA1 1IBXA 2PKOA 2J53A 5D3DA 2JX5A 1TY0A 1PGXA 2BW2A 1DGJA 1OQQA 1RFKA 1VZ7A 4KX6B 2JYEA 2WXKA 4O1NA 3V05A 1DOYA 4WURA 2G1EA 2M0AA 5AUIA 5FR3A 3SFEB 1XLPA 4ARIA 1RWSA 3RFZB 1KLGD 1PGAA 1YN5A 2GB1A 3IXSA 3BK1A 1GB4A 1QQRA 1KH0A 1SE3A 3TSSA 3EUB2 2WU5B 1CJEA 1ZE3D 4XWTA 2MJEA 3TEZA 1QKZA 1L0YB 1TY2A 3DWMA 2N9LA 5BYRA 1F77A 5BMIA 1UGJA 3AE6B 1FMAD 2YEPF 1N5XA 5BMGA 1PUTA 4N58A 1Q10A 1L0VB 1VJKA 4J3OD 1FM0D 1JWUD 2VZKB 2WLBA 3TEYA 1TKEA 1I4XA 4M0WA 3TEWA 1QLBB 4N59A 2Y5PA 3MJ5A 5G5GA 3W2DA 1XO3A 4LK0M 4DQOC 1C4PA 3HVZA 3AEAB 1D5XC 3KWLA 3AEBB 4WQMA 1PGBA 1TS3A 3NVYA 3ZJTA 4HROA 1D5MC 1H7WA 4R3DA 1SB3C 1TJEA 5D7GA 1OFFA 1ZOYB 4ZOHC 2MJ3A 3N9YC 2DYMA 1FIQA 4WAFA 2DYOA 4C80A 3J9CA 5TSSA 2WP9B 2H88B 4GDKB 2WQYB 2LUMA 3NRZA 1JALA 1BUIC 4TMAB 1IGDA 3P4RB 2L32A 2WU2B 2D5GA 2LHDA 3CF4A 2FUG1 4OZCA 3PO0A 1UWXA 4MT5A 1YQ4B 2KN4A 2MJDA 1ENFA 2OHFA 1QOAA 4RGOS 4L1BA 2OEDA 1GAQB 3E56A 3Q69A 1K53A 1SJHD 4N6EB 3DWGC 4P16A 1L0XB 2JSVX 3MHZA 2IPKD 4REZA 3W5UB 3AB5A 3HUIA 3HVDA 5BMHA 1J7CA 3GS2A 3ETRA 4HJGE 2BS4B 2WXNA 4FXCA 2PTLA 1QF6A 2LFIA 3AE4B 2W3SA 3AM9A 1FEHA 3I57A 1WGKA 1QILA 4KGSA 2LEKA 1MPEA 1R7SA 3AE5B 2KDMA 1XCQL 1FXAA 1NYQA 4A90A 4JWUC 5EE3A 4IDIA 3ABVB 2WXLA 1C78A 2WXGA 3T3OA 1WRIA 3MFGA 3AE7B 1ET6A 3IT6B 1K51A 2IJ0A 2JWUA 1V1PB 3I9V1 1WYGA 1K52A 4RGMA 1SE2A 3E9SA 2E6XA 2ON8A 4L23A 5HG2A 1L6UA 1VR9A 1YN3A 2Z8LA 3O13A 3Q8BA 4P6VF 3WCQA 3NVWA 3V3XA 3R2TA 3Q8AA 1FO4A 3TEXA 3ZJUA 3TUOA 1ACCA 3BVMA 4ZRPA 1VRAB 3P42A 4RGTA 3P4QB 2CJOA 3AEEB 2QMTA 1KFYB 2M19A 1JMLA 4NAWB 1CQVA 4TSSA 2WXQA 2DLBA 5LNK1 1L4ZB 2K3UA 2SEBD 1NYRA 4HKZE 5I4DA 4ZRQA 1JQ4A 1SIJA 2LJIA 1C77A 1F2RC 1QT9A 1MI0A 2ACZB 2MH7A 3P1MA 3URYA 2IGDA 1ZDVA 1STEA 2MEKA 4RH6A 1GT8A 2J42A 2BYTA 4US8A 1HZ6A 1H7XA 4KGTA 1AYFA 2KACA 2N9KA 2BTEA 2JU6X 2WNMA 2WXMA 2I2YA 4AQ7A 3AH7A 3B2FA 2JYTA 1I4RA 3IAM1 3VRBB 3P4PB 1FCCC 5D3IB 4YT0B 1YJJA 3AE2B 1WWTA 1ZDXA 4GLSC 1V1PA 3AMZA 3B9JA 3IAS1 1HXYD 2QJLA 3EA6A 3NUHB 1C76A 3AE1B 1GOZA 2INPE 1QOGA 2PVGC 2WS3B 4OHJA 1UUPA 5BYQA 2XN9C 2BS3B 4KGRA 2V4IB 1XCTL 2KQ4X 5HHDG 1BXTA 2ONQA 5HI1A 1ZXHA 1JWSD 3PZ8A 2TSSA 1HQRD 3HRDD 4XDDA 4B0EA 1NENB 2HTME 2X38A 1PYWD 1QOBA 2R61A 5MPOA 1EWCA 5H92C 1LO5D 2CU3A 1HA5A 2LHEA 3C8YA 2NMQA 2BT6A 1GTHA 5EE0A 1TZOA 3PZ7A 3NZ3A 1D4BA 1GTEA 1SXTA 2AQ3B 4ZHPA 1C79A 2AX5A 1TS4A 5BYSA 3LXFA 4MM3B 2NTSA 1SJED 2WXHA 4KKJA 1F2RI 1SEBD 5EE9A 3SEBA 4RGNA 2GI9A 4HRSA 4EE2A 3L4PA 1E0ZA 2WDVB 3GP7A 2IGGA 1JW9D 2W55A 4JE3B 3U7ZA 3FILB 4RF0A 1XF5L 2KMMA 4JWSC 4KKIA 4OZBA 3KLSX 2EELA 4US9A 3AV8A 2XNAC 3ZYYX 2PVOD 1YN4A 2H89B 2PLPA 4C7ZA 4TQ1A 1FFUA 5H8YE 1L5PA 1T3QA 3ZJVA 1FFVA 3Q8EA 1N5WA 1Y56A 3NVVA 1I4HA 4ITKA 1CZPA 4B0MA 1YQ3B 2FE8A 5FKAC 4DXFA 4WH4A 3VR9B 2B76B 2E3TA 1TS5A 2L1AA 1I4QA 3MP9A 3KWVA 1JRPA 1FRRA 3AEFB 1C9FA 2DBYA 1IUEA 1XLNA 1N61A 3P63A 4RFBA 3U2SC 2WXPA 3BYYB 3EGRA 1KLUD 1FNWA 1JWMD 3LB8C 2BB6A 3BZDB 1ROEA 1B1ZA 3BVZA 2BB5A 3VR8B 2K5PA 2LMCA 2WXIA 4YSYB 3AN1A 1SE4A 1WSPA 1ZP0B 1N62A 1FNVA 4YTNB 1V1OA 1EU4A 3BK2A 4ZHOA 3AEDB 2JXTA 4A9AA 1GB1A 1XEEA 1MVKA 2N0SB 3IT4B 4ZYSA 1AWDA 2W82A 1J7BA 2WDRB 2AQ1B 2HDEA 1NEKB 4XDCA 2RDHA 3AEGB 1FXIA 2AQ2B 1HEZE 2J52A 1MHHE 3VRAB 1NI3A 1UNSA 1YMHE 2K0PA 1PDXA 4IOIE 2L83A 4GDLB 1C4CA 3Q8CA 4XE0A 4LLGM 1KTKA 1GPXA 1EWYC 1OQRA 2K9XA 3BWUD 4D2KA 3AE9B 1F0ZA 2QSDA 1WXQA 1V8CA 1N63A 2M56B 2NTTA 1I7HA 4LTUA 2PIAA 4UDUC 2GRIA 1VZ8A 1D6EC 3NVZA 3BYTB 1UWMA 4USAA 1ESFA 1JWBD 4YSZB 3U4EG 1VDVA 2VZKD 3FILA 2RPVA 3Q8FA 3AECB 1K50A 2ZW0A 1JROA 4OW0A 1E6EB 4OVZA 1XLQA 2JQRB 1A70A 1M4VA 4PT5A 4HKQA 1B9RA 1BMLC 3CWIA 4NJCA 4WWMA 3B2GA 1TYGB 2V3NA 3SFDB 1RM6C 4TQ0A 1D5ZC 5E6JA 1CK1A 4MACA 1L6VA 1ZXIA 4C7YA 3VQIA 1T5XD 2RDGA 4H2AA 4JPSA 3BVGA 1VLBA 2EKIA 2YEPB 3W5VB 1FCLA 4YTMB 1ET9A 3R2IA 1C4AA 4RF1A 3FAHA 1DYQA 2IGHA 2QILA 2RMMA 2SAKA 1TKGA 1SSNA 3CIRB 1DOXA 3W9CB 1YNTE 4JX1C 2WXFA 2Y5CA 3LYYA 4Q2JA 5HFYA 1NVID 2FBWB 2V3PA 4C56C 2WXRA 4A8XC 4YXDB 3AE8B 3H8HA 4A6QA 4MH8A 2V0GA 1L4DB 2WXOA 2Y3AA 1JCKB 2W54A 4WIPA 2I38A 3SR6A 2QIEB 2ZW1A 3ZQ4A 5T8IA 1T6BX 1I4PA 1N60A 4YSXB 1DOIA 1E7PB 1KRHA 2QEJC 1PFDA 4ARCA 1ZPSA 2CJNA 5JXVA 2WDQB 1RYJA 5AUKA 1V97A 2N7JA 4AS1A 1I4GA 3RPFC 1FRDA 1HZ5A 2PMVA 3U52E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH7 A;  3P4S B;  3B2F A;  5G5H A;  2WU2 B;  5C2T B;  3VRB B;  3P4P B;  2Q5W D;  5EE1 A;  4YT0 B;  3CF4 A;  2N0S B;  1YJJ A;  3AE2 B;  3BII D;  1AWD A;  1WWT A;  4YTP B;  1J7B A;  3PO0 A;  2WDR B;  1YQ4 B;  1SF0 A;  1ZUD 2;  1NEK B;  3B9J A;  3AMZ A;  1XLO A;  3AE3 B;  2QJL A;  1QOF A;  2MJD A;  3AEG B;  1KF6 B;  3AE1 B;  1FXI A;  2L52 A;  2K22 A;  2OHF A;  1QOG A;  1YJI A;  1QOA A;  2WS3 B;  3VRA B;  1NI3 A;  2PVG C;  3FC4 A;  1PDX A;  2BS3 B;  1GAQ B;  2L83 A;  2BS2 B;  1GPX A;  1EWY C;  1OQR A;  2K9X A;  3HRD D;  5GXG B;  1DOX A;  4N6E B;  1F0Z A;  3AE9 B;  1JWA D;  3DWG C;  3W9C B;  1WXQ A;  3NS1 A;  1NEN B;  3W5U B;  2KAJ A;  1V8C A;  1TKY A;  2HTM E;  1N63 A;  2M56 B;  1QOB A;  2W3R A;  3AB5 A;  3HUI A;  1E10 A;  1I7H A;  2DWQ A;  4LTU A;  5MPO A;  2PIA A;  1J7C A;  1E9M A;  1J7A A;  3ETR A;  5H92 C;  2CU3 A;  2BS4 B;  3NVZ A;  5C3J B;  1UWM A;  4FXC A;  4USA A;  2PKO A;  1QF6 A;  1JWB D;  4YSZ B;  2BT6 A;  1VDV A;  3AE4 B;  1GTH A;  5EE0 A;  2W3S A;  3AEC B;  3AM9 A;  2JX5 A;  1GTE A;  1JRO A;  1DGJ A;  4ZHP A;  1E6E B;  1WGK A;  1OQQ A;  1RFK A;  1XLQ A;  4KX6 B;  2LEK A;  1R7S A;  2AX5 A;  3AE5 B;  1A70 A;  2JQR B;  1DOY A;  2G1E A;  1FXA A;  3LXF A;  5AUI A;  3SFE B;  1XLP A;  1NYQ A;  1RWS A;  4JWU C;  1B9R A;  3CWI A;  5EE3 A;  4IDI A;  3ABV B;  5EE9 A;  1WRI A;  3AE7 B;  4WWM A;  4HRS A;  3B2G A;  1TYG B;  3L4P A;  3SFD B;  1RM6 C;  3EUB 2;  2WDV B;  2WU5 B;  1E0Z A;  1CJE A;  1JW9 D;  2MJE A;  2W55 A;  1WYG A;  1L6V A;  2KMM A;  4JWS C;  1ZXI A;  4C7Y A;  3DWM A;  1L6U A;  4P6V F;  4US9 A;  1VLB A;  2EKI A;  3AV8 A;  3W5V B;  3WCQ A;  3NVW A;  3ZYY X;  4YTM B;  3AE6 B;  2PVO D;  2H89 B;  1FMA D;  4C7Z A;  3FAH A;  1FO4 A;  1N5X A;  1FFU A;  5H8Y E;  1PUT A;  1L5P A;  4N58 A;  1TKG A;  1L0V B;  1T3Q A;  1FFV A;  1VJK A;  3CIR B;  1FM0 D;  1N5W A;  3NVV A;  3P4Q B;  2WLB A;  2CJO A;  4JX1 C;  3AEE B;  1TKE A;  2Y5C A;  1CZP A;  4ITK A;  1KFY B;  2M19 A;  1YQ3 B;  1NVI D;  4A9A A;  2FBW B;  1QLB B;  3VR9 B;  2B76 B;  4N59 A;  2E3T A;  5G5G A;  1XO3 A;  4YXD B;  3AE8 B;  3HVZ A;  3AEA B;  1JRP A;  1FRR A;  3AEF B;  1NYR A;  2DBY A;  3KWL A;  1IUE A;  1XLN A;  1JQ4 A;  3AEB B;  1N61 A;  1SIJ A;  3P63 A;  1QT9 A;  2W54 A;  3NVY A;  4WQM A;  2ACZ B;  2QIE B;  3SR6 A;  2MH7 A;  4HRO A;  1H7W A;  3P1M A;  1SB3 C;  1TJE A;  1OFF A;  1ZOY B;  4YSX B;  1DOI A;  1N60 A;  1E7P B;  1ROE A;  1KRH A;  2MJ3 A;  3LB8 C;  4ZOH C;  1PFD A;  1FIQ A;  1GT8 A;  3VR8 B;  2K5P A;  4YSY B;  2CJN A;  4C80 A;  4US8 A;  2WDQ B;  1RYJ A;  1H7X A;  3AN1 A;  5AUK A;  1V97 A;  2WP9 B;  2H88 B;  1AYF A;  2WQY B;  1ZP0 B;  1N62 A;  1FRD A;  3RPF C;  4YTN B;  3NRZ A;  1JAL A;  4ZHO A;  3AED B;  3P4R B; 
#chains in the Genus database with same CATH topology
 2PW9 A;  2Q5W D;  4CQN A;  1IGC A;  1VZ6 A;  1FNU A;  2IDY A;  2NR2 A;  4YTP B;  1SF0 A;  4LNF A;  5DPT A;  1KF6 B;  1R4N B;  3RN9 C;  2L52 A;  4YWG G;  3QCA A;  4FUL A;  4GMV A;  3L16 A;  3HM3 A;  5GXG B;  3UI3 A;  2EMS A;  1V80 A;  2N1W A;  1E10 A;  3DBR I;  2DWQ A;  4XYC A;  2JZP A;  1P7E A;  2AEH A;  3OWE B;  2KMA A;  2PKO A;  4B9K A;  4DHZ E;  2DZM A;  5LLI A;  3R7R A;  2WWZ A;  5D3D A;  4KSK C;  1PGX A;  1DGJ A;  2PMV A;  1OQQ A;  2IO3 B;  2KN5 A;  4O1N A;  4W9D A;  3V05 A;  5AUI A;  1WGR A;  3SFE B;  1RWS A;  3TJP A;  3A4R A;  3NS8 A;  1PGA A;  3DHI C;  2GB1 A;  2IO0 B;  1GB4 A;  2G4S A;  2L3Z A;  1KH0 A;  3EUB 2;  2WU5 B;  1ZE3 D;  1L0Y B;  3QAQ A;  2N9L A;  5BYR A;  4FN2 A;  4LJP B;  2X8X X;  4N58 A;  1Q10 A;  4KIK A;  1JWU D;  2VZK B;  3ONS A;  2O6V B;  2DYB A;  4WWP A;  5JHB A;  4EEW A;  4N59 A;  3WAL A;  4LK0 M;  3HVZ A;  3AEA B;  3IVF A;  3KWL A;  3ZNZ B;  4M01 A;  3PTF C;  3ZJT A;  5BO4 B;  1J19 A;  1OFF A;  1G6J A;  4FA6 A;  1FIQ A;  2DYO A;  2AYO B;  4C80 A;  1T0S C;  2KX3 A;  2WP9 B;  1WJU A;  3NRZ A;  5AZG A;  1BUI C;  1IGD A;  2D5G A;  3DDC B;  3HK0 A;  2LHD A;  1IYF A;  2KDB A;  2QHO A;  3R66 C;  1ZGU B;  3NY5 A;  4MT5 A;  1ENF A;  1GJZ A;  2DNF A;  2MBQ A;  2KHW B;  4ZDV A;  3DWG C;  4HXD A;  1WM2 A;  2JSV X;  2JT4 B;  3HUI A;  2BQQ A;  4C00 A;  2C5L C;  2JZ3 B;  2G4D B;  3GS2 A;  2L76 A;  1CMX B;  4FXC A;  2PTL A;  2HJ8 A;  2YLM A;  1Z5S B;  1IPG A;  3EEC A;  3QC8 B;  1XCQ L;  1NYQ A;  4A90 A;  3Q3M C;  2WXL A;  3IT6 B;  3KH0 A;  1E7V A;  3P2B A;  2IJ0 A;  1XT9 B;  2JWU A;  2NBV B;  4RGM A;  4IWP A;  1L6U A;  2C60 A;  1WIA A;  3N1Z C;  4G0N B;  2Y5B B;  1ACC A;  1YX5 B;  4WJN A;  4DXA B;  4RGT A;  4JQW C;  2QMT A;  2M19 A;  1CQV A;  2FIF A;  2DHZ A;  5LNK 1;  1WJ4 A;  2K3U A;  3T9L A;  4W9C A;  1C1Y B;  1JQ4 A;  1SIJ A;  1C77 A;  1F2R C;  1QT9 A;  3RUI B;  3URY A;  2IGD A;  1STE A;  3JYU A;  1ZKH A;  5GMV A;  2PE6 B;  1AYF A;  2N9K A;  1A5R A;  2BTE A;  2JU6 X;  2WNM A;  2I2Y A;  4AQ7 A;  2CS4 A;  4KIK B;  5D3I B;  1WMH B;  1WWT A;  3IAS 1;  4EKU A;  3B9J A;  3PT2 B;  4LDT B;  3ZXV A;  3DBH I;  3EA6 A;  1C76 A;  2UU7 A;  3AE1 B;  2PVG C;  1UUP A;  3APF A;  2V4I B;  2KQ4 X;  2KYW A;  3PZ8 A;  3HRD D;  4XDD A;  4B0E A;  1NEN B;  4AJY B;  1PYW D;  2KWV B;  1WX9 A;  2BPS A;  3Q3F A;  5H92 C;  1TZ1 A;  3V62 A;  2CU3 A;  2BT6 A;  5EE0 A;  3MJW A;  1Z2M A;  1GTE A;  1F1H A;  2AQ3 B;  3U8Z A;  1GC6 A;  1C79 A;  2AX5 A;  2A4Z A;  4MM3 B;  3UQA A;  3GZN B;  1L7Y A;  4KKJ A;  1F2R I;  1SEB D;  4KSL C;  2GI9 A;  4HRS A;  2V4L A;  3M3J A;  2WDV B;  3GP7 A;  1YD8 U;  2FNJ B;  2LZ6 A;  3FIL B;  4RF0 A;  3RNA C;  4GSW A;  1J0G A;  2KMM A;  4JWS C;  4OZB A;  4P7I A;  4CHK A;  3AV8 A;  3ZYY X;  3ZUN A;  2PVO D;  1YN4 A;  2H89 B;  2PLP A;  5H8Y E;  2NPT A;  3ZJV A;  5L95 C;  3DBL B;  1CZP A;  3M62 B;  2AWT A;  4DXF A;  4ZRJ A;  3VR9 B;  2B76 B;  4IM0 A;  3EHV A;  2GBJ A;  3ZDM C;  1FRR A;  3AEF B;  4HPM B;  1C9F A;  1XLN A;  3DVN V;  3P63 A;  3U2S C;  5JZE B;  3V6C B;  1KLU D;  2BVC A;  3LB8 C;  2BB6 A;  2J0K A;  3I5J C;  3MTN B;  4K3C A;  3A1Q B;  1ZP0 B;  2WX0 A;  1ISN A;  2WGS A;  3CST A;  2NPT B;  1P98 A;  1AWD A;  3QX1 A;  4BKS A;  2MRP A;  4XDC A;  2J52 A;  3MHS D;  3VRA B;  2K0P A;  1PDX A;  3QAR A;  1I42 A;  2L83 A;  4LLG M;  3BWU D;  4D2K A;  3PGE A;  2C9W B;  2NTT A;  2FUH B;  4AWJ A;  3LDZ E;  2GRI A;  3NVZ A;  2L8J A;  1XQQ A;  3Q14 C;  4USA A;  4YSZ B;  1VDV A;  3ZNH B;  2VZK D;  4GXB A;  3Q8F A;  2RPV A;  5E6O A;  3AEC B;  1L2N A;  1SE9 A;  4OVZ A;  1XLQ A;  2JQR B;  1A70 A;  1M4V A;  1S1Q B;  3ENE A;  4WWM A;  1TYG B;  5CHF A;  4TQ0 A;  4ZRI A;  4IWO A;  2RD0 A;  1ZXI A;  1MG8 A;  3VQI A;  1T5X D;  3VTW A;  1V9J A;  2KK8 A;  2D07 B;  3FAH A;  3V61 A;  1TKG A;  2UYZ B;  2RDB C;  1NVI D;  4GDL A;  2FBW B;  2ASQ A;  4GN1 A;  4C56 C;  1VD2 A;  3M95 A;  3KW5 B;  4F7Z A;  3DVN U;  4JGH B;  2V0G A;  1L4D B;  2XEW A;  2WXO A;  2WHI A;  2I38 A;  3VUX A;  3ZQ4 A;  5T8I A;  2RPQ A;  3N1X C;  1N60 A;  4YSX B;  2Z0D B;  2BWF A;  1ZPS A;  3H7S A;  1TT5 B;  3VAW A;  5JXV A;  1RYJ A;  2LWP A;  2N7J A;  3RPF C;  1RAX A;  2J0M A;  4NJ6 A;  2KFJ A;  2O6V A;  3T3N A;  5G5H A;  5C2T B;  5EE1 A;  2KFK B;  2MX2 A;  3BII D;  2KX0 A;  3B1L X;  3KQ4 A;  1XLO A;  3VVW B;  1QOF A;  2KVZ A;  3M63 B;  1YJI A;  4RNA A;  5AEK B;  4M00 A;  1RRB A;  5D6J B;  2ZJD A;  3EC8 A;  5D94 A;  1NBF C;  1P7F A;  4HDQ A;  2BS2 B;  2BBC A;  1GG3 A;  1FD6 A;  3KYC D;  1WJN A;  2MQJ A;  2KAJ A;  1EM7 A;  3UIO B;  2INN E;  2W3R A;  5FK9 C;  1IBX B;  1SBB B;  3ZTD A;  1E9M A;  4ANX A;  5C3J B;  1AN8 A;  3N20 C;  4HEA 1;  2BYF A;  1I35 A;  5TR5 A;  3UF8 A;  4DHZ B;  2D3G A;  2M0A A;  5FR3 A;  4ARI A;  1E8Y A;  3RFZ B;  3IXS A;  3BK1 A;  3ECI A;  2VRR B;  2MJE A;  3TEZ A;  2M1M A;  1QKZ A;  4TV3 A;  1WMH A;  2QDF A;  2K8H A;  1TY2 A;  4RM8 A;  4C4V A;  1F77 A;  2IZV B;  5BMI A;  3ZTC A;  3AE6 B;  1BT0 A;  4EOY A;  1FM0 D;  3TEY A;  1TKE A;  3PLU A;  3B0A A;  4MH0 E;  1QLB B;  3MJ5 A;  4DQO C;  4LDT D;  1WZ3 A;  1V49 A;  4WQM A;  1TS3 A;  4HPP A;  4HRO A;  1D5M C;  1H7W A;  2G45 B;  3WAN A;  4BOZ B;  4MEL A;  3J9C A;  5TSS A;  3RNE C;  3KUC B;  4TMA B;  4HLE A;  2L32 A;  3QK0 A;  2WU2 B;  4E74 A;  2DZI A;  1V6E A;  2D11 A;  4IC7 B;  1KM7 A;  2GOW A;  2KD0 A;  3Q3N C;  4II3 B;  4WJQ A;  2OJW A;  3E56 A;  1WR1 A;  3Q69 A;  4MGI E;  2HD5 B;  4P16 A;  2EMT A;  1L0X B;  3AB5 A;  2IY0 B;  1YQB A;  4MGY E;  3N1Y C;  3ETR A;  2KTR B;  3PVL A;  1QF6 A;  3AE4 B;  1FEH A;  3I57 A;  1WGK A;  4KGS A;  2DAF A;  4JWU C;  2ZCB A;  4IDI A;  3ABV B;  3T3O A;  2WXG A;  1KLV A;  1LQB A;  1WRI A;  3AE7 B;  4WQO B;  2EKE C;  3APD A;  4HDO A;  1V1P B;  3I9V 1;  4FJV B;  1WGH A;  2MBH A;  3EFU A;  1SE2 A;  3TL5 A;  2ON8 A;  5HG2 A;  3O13 A;  5LXH A;  3R7Q A;  1EF1 A;  3SHQ A;  4CYE A;  3V3X A;  1WZ0 A;  3ZVV A;  3OG5 A;  3R2T A;  1FO4 A;  2IBI B;  2BWE S;  5J18 A;  3ZJU A;  4ZRP A;  3BVM A;  3IG3 A;  1VRA B;  2M8S A;  1WXS A;  1KFY B;  3JSV B;  2V3S A;  1P3Q U;  2NBW B;  2V1Y A;  3A1Q A;  2DLB A;  3ZXR A;  2LGD A;  4YL8 A;  4ZRQ A;  1MI0 A;  2ACZ B;  4DK5 A;  3VHT C;  4NY0 A;  2MEK A;  4RH6 A;  2L05 A;  1GT8 A;  1E8W A;  2MP2 A;  4TUU A;  2IO1 B;  2UWQ A;  1E8X A;  2KAC A;  3NOB A;  2GLS A;  3AH7 A;  3VUY A;  1I4R A;  1RLF A;  3VRB B;  5KHQ A;  1YX6 B;  1YJJ A;  3AE2 B;  4WWO A;  4M02 A;  3VH4 B;  1HXY D;  2XK5 A;  3RNF C;  3NUH B;  2WS3 B;  1XCT L;  1ZXH A;  4ACF A;  1WE7 A;  2PPH A;  3PRZ A;  2JRH A;  3L08 A;  2I1K A;  2KZR A;  2ZVO A;  5MPO A;  1EWC A;  2KMC A;  3Q2A C;  1HA5 A;  4W9H A;  3VTV A;  1UBQ A;  4K7W A;  1KOT A;  3S2A A;  3PZ7 A;  5AZF A;  2IYD B;  1TS4 A;  2KAN A;  3LXF A;  1V81 A;  2NTS A;  2WXH A;  4DWF A;  5EE9 A;  3RD2 A;  3L4P A;  1UGM A;  4E71 A;  4JE3 B;  3U7Z A;  1XF5 L;  1WXM A;  1HE8 A;  4KKI A;  3KLS X;  2XBB C;  4JIO U;  4US9 A;  1Y8R C;  3VTU A;  4TQ1 A;  3Q3J A;  4MJS A;  4ITK A;  3U7D A;  1YQ3 B;  1FPY A;  5FKA C;  4B0M A;  4WH4 A;  2L00 B;  4K7S A;  2K1F A;  2L1A A;  1I4Q A;  2DBY A;  3RT3 B;  4BVU C;  4MSM B;  1FNW A;  4J6I A;  3RZF A;  1JWM D;  3BZD B;  1B1Z A;  3BVZ A;  3VH3 B;  2GBM A;  5L83 A;  2K5P A;  2LMC A;  4YSY B;  4GIV A;  3C0R B;  1GC7 A;  1SE4 A;  2D3A A;  2LGY A;  1N62 A;  1FNV A;  4ZHO A;  4A9A A;  4NQK E;  4ANV A;  1XD3 B;  1XEE A;  3PZD A;  1MVK A;  1UEL A;  1AAR A;  2KLC A;  5G2N A;  2KC2 A;  4K3B A;  3ZO5 B;  1WRD B;  2RDH A;  3T8M A;  1HEZ E;  1MHH E;  3PSE B;  1UNS A;  4WJO A;  4TKN A;  4GDL B;  2IO2 B;  1V5T A;  4BFR A;  4II2 B;  1EWY C;  5J17 A;  3X0W A;  4IUM B;  4ASW C;  3AE9 B;  1V8C A;  2GMI C;  4I6N B;  1LFD A;  3OLM D;  3ZRF A;  3NHE B;  1ESF A;  2NBU A;  4P1C C;  4JL9 A;  1JRO A;  4K1R B;  1E6E B;  4S17 A;  3WAM A;  2DZK A;  4HKQ A;  1T0Q C;  2N9X A;  4NAW A;  4EZK A;  3HHM A;  4NJC A;  2ZPY A;  1RM6 C;  3RUL A;  5E6J A;  2BKF A;  2CHZ A;  4BZA A;  1L6V A;  4H2A A;  4IG7 B;  4JPS A;  1VLB A;  2EKI A;  3W5V B;  5IA7 A;  4YTM B;  4RF1 A;  2M17 A;  1DYQ A;  4KDL B;  2SAK A;  3PLV A;  1WR6 E;  3HM6 X;  2K25 A;  3CIR B;  1DOX A;  3W9C B;  1Q0W B;  2Y5C A;  2KDF B;  3LYY A;  4BBN C;  1OEY J;  2V3P A;  2LJ5 A;  4MGZ E;  2MCN B;  4A8X C;  1WM3 A;  5DPW A;  1JCK B;  2W54 A;  4WIP A;  3AUL A;  2ZW1 A;  4KZ0 A;  2CKH B;  4NJ7 A;  4PYU A;  2QEJ C;  1Q5W B;  1V97 A;  1I4G A;  3A9J A;  4GDK A;  3U52 E;  4K7U A;  3P4S B;  2NCN A;  2RR9 A;  1EU3 A;  5E6P A;  4DXG A;  3UIP B;  3W1S A;  2Z59 B;  2D2Q A;  1TS2 A;  3OJ3 A;  4NZL B;  4NPN A;  2K22 A;  1MHX A;  3PRM B;  3TMP B;  2R2Q A;  1JWA D;  3NS1 A;  4RCO A;  1TKY A;  2MSE D;  1XXG A;  3WA0 A;  4MGK E;  1LXD A;  4GB9 A;  3GB1 A;  3X23 A;  4KV2 A;  2BYE A;  4M8N A;  2FAZ A;  1M94 A;  3L13 A;  2ZVN A;  4LNK A;  1RFK A;  2WXK A;  1YIW A;  4WUR A;  2G1E A;  3DBR B;  1XLP A;  1KLG D;  2JF5 A;  3N32 A;  1TBE A;  1QQR A;  4P1B C;  3TSS A;  3GE3 C;  3IFW B;  3DWM A;  1OGW A;  3DVG Y;  1R4N I;  2LXC A;  1FMA D;  3D32 A;  3TIX A;  2I1J A;  1PUT A;  1VJK A;  4J3O D;  2WLB A;  1I4X A;  5G5G A;  5G55 A;  1D5X C;  1MFW A;  1V2Y A;  3FKY A;  3AEB B;  4F1S A;  1PGB A;  3I63 C;  4R3D A;  3DPD A;  1TJE A;  5D7G A;  4NNJ B;  4ZOH C;  2AL3 A;  3AI5 A;  2MJ3 A;  3N9Y C;  2DYM A;  3WAP A;  4WAF A;  4BAX A;  1P9D U;  2M0X A;  2JRI B;  2H88 B;  2WQY B;  1MG4 A;  2K8C A;  2LUM A;  1JAL A;  3KYD D;  3P4R B;  4PYZ A;  2KC1 A;  1UBI A;  3A9K A;  1FXT B;  4OZC A;  3PO0 A;  1YQ4 B;  1F9J A;  4W9I A;  1H4R A;  2LRW A;  2MJD A;  2C7N B;  2KJ6 A;  3TCA A;  1MJD A;  1QOA A;  4RMA A;  3MC9 A;  4RGO S;  1GAQ B;  2KQS A;  2MP2 B;  2MBO A;  2MW5 A;  3V6E B;  4ICV A;  3ZNI D;  2IPK D;  4REZ A;  4B95 A;  5BMH A;  1J7C A;  3PV1 A;  2BS4 B;  3WAO A;  1OTR B;  4N9F 4;  2W3S A;  3AM9 A;  2WX1 A;  2O2V A;  1QIL A;  2LEK A;  1MPE A;  3UQB A;  3N30 A;  2JUO A;  2VH2 A;  1P1A A;  5DPR A;  1YJ1 A;  5IOI A;  1C78 A;  2DZJ A;  3MFG A;  4ICU A;  3ZKJ C;  1ET6 A;  3N3K B;  4MJS B;  3KUZ A;  4KZC A;  2L0T A;  1WGY A;  4NQL B;  2KTR A;  1K52 A;  2E6X A;  2Z8L A;  3L17 A;  3Q8B A;  3WCQ A;  3NVW A;  3PRE A;  3Q8A A;  2PE9 A;  4KVG B;  3SDL C;  3P42 A;  2CJO A;  3AEE B;  1YOV B;  1JML A;  1KJT A;  2L0F A;  4OVV A;  4NAW B;  1J8C A;  1N6Z A;  4TSS A;  2WXQ A;  3L0W B;  2SEB D;  4BBN F;  1NYR A;  4HKZ E;  2LJI A;  2MH7 A;  1E5W A;  1R4M I;  3P1M A;  5JH5 C;  4IW0 A;  3W1S C;  4M0W B;  2J42 A;  2JY6 A;  2BYT A;  1HZ6 A;  1H7X A;  4KGT A;  2D10 A;  2D3B A;  2WXM A;  2D3C A;  2O2V B;  2JZZ A;  2R2O A;  3B2F A;  2JYT A;  5LXI B;  3IAM 1;  1FCC C;  3BY4 B;  3UGB B;  1ZDX A;  1V1P A;  2QJL A;  3O65 B;  2INP E;  2LUE A;  2WYQ A;  4LJO B;  4OHJ A;  2XN9 C;  4KGR A;  4BOS C;  3PPA A;  5HI1 A;  1JWS D;  1S3S G;  1HQR D;  2ZCC A;  2N9E B;  2HTM E;  2K8B A;  2R61 A;  2KVR A;  3ZW3 A;  4F8C B;  2NMQ A;  3IHP C;  3KUD B;  3NZ3 A;  3L10 B;  1D4B A;  2FCS A;  1SXT A;  1NI2 A;  4ZHP A;  1K8R B;  4W9G A;  3H7P B;  5BYS A;  1WX7 A;  1SJE D;  4FHJ A;  2WDT B;  4G11 A;  2G3Q B;  1HTO A;  2IGG A;  1WFY A;  1JW9 D;  2REX A;  4AOF A;  1WF9 A;  3KVF B;  2ZEQ A;  2IND C;  3VDZ A;  2IY1 B;  2JPH A;  1FFU A;  4PK1 A;  1L5P A;  3Q8E A;  4WAA A;  1N5W A;  3NVV A;  1I4H A;  2FE8 A;  2LXA A;  5D2M B;  4I6L B;  2N1V A;  4PS3 A;  1GNU A;  1JRP A;  2JVC A;  1IUE A;  4DHJ D;  3BYY B;  4MDK E;  2N9P C;  2N4F A;  3NZU A;  1R4M B;  3Q3O C;  5DCN A;  1X1M A;  2KLG A;  4YTN B;  3RI7 C;  1V1O A;  3BK2 A;  3DHH C;  4URK A;  1GB1 A;  2N0S B;  3B08 A;  3IT4 B;  4HVB A;  1WE6 A;  2NVU I;  2W82 A;  2WDR B;  2AQ1 B;  1NEK B;  3GOE A;  2JWZ A;  2YVC A;  2AQ2 B;  1NI3 A;  2K6Q A;  4IOI E;  5EDS A;  1WXV A;  4FJZ A;  1C4C A;  4XE0 A;  1KTK A;  3QJZ A;  1WYW B;  2N7D A;  2DX5 B;  3GZN I;  2MBB B;  2M56 B;  3H1U A;  1I7H A;  4LTU A;  5CHW A;  2PIA A;  2VH1 A;  5KHO A;  1VZ8 A;  3BYT B;  1UWM A;  3V60 A;  4ANW A;  3U4E G;  3H9D A;  3FIL A;  3ALB A;  3PHW B;  1K50 A;  2OOB B;  2ZW0 A;  5E6N A;  4MEM A;  4OW0 A;  1V5O A;  2RSU A;  2V9H A;  3SD5 A;  3JSV A;  1B9R A;  1BML C;  4G50 A;  2V3N A;  3SFD B;  2K6D B;  1D5Z C;  1CK1 A;  4IWQ A;  4MAC A;  2KXJ A;  4C7Y A;  3VXW A;  3DOW A;  1FCL A;  3AXC A;  4EZL A;  1ET9 A;  1C4A A;  4WJP A;  2QIL A;  2MA9 B;  2KFK A;  1YNT E;  2WXF A;  5HFY A;  4Q2J A;  1T0Y A;  3K9P B;  1TIF A;  3ZIM A;  4FBJ B;  4YXD B;  3AE8 B;  5IN7 A;  2NS5 A;  4A6Q A;  4C4V B;  2RGF A;  4MH8 A;  4E3C A;  4HPL B;  2Y3A A;  3RNC C;  3SR6 A;  2QIE B;  2INC C;  1T6B X;  1I4P A;  2KOX A;  2MLB A;  4A20 A;  1U4A A;  3CF6 E;  3W1Y A;  3ZDT A;  2CJN A;  2WDQ B;  3DVG X;  2JXX A;  4W9F A;  4B6W A;  2KJR A;  2BKR B;  1HZ5 A;  1WGD A;  5IP4 D;  3DBH B;  5J2R A;  4NAM A;  3RZW C;  1AW7 A;  2QC8 A;  4HK2 A;  4XX5 A;  4ANU A;  1RFA A;  4OZA A;  3APC A;  4L2Y A;  1ZUD 2;  2PJH A;  2FCN A;  3AE3 B;  3MC0 B;  4BKT A;  3FC4 A;  2KWD A;  1D3Z A;  2WXJ A;  4A55 A;  2ICI A;  1V86 A;  4IKG A;  3R8B A;  2QCZ A;  2LGI A;  3AU4 A;  3JVZ X;  4IM2 A;  2G9H D;  3ZGZ A;  4A3P A;  4XWW A;  1J7A A;  4JLC A;  3NJT A;  2J4X A;  4K81 A;  4M8M A;  1IBX A;  2J53 A;  2KNB A;  2JX5 A;  1TY0 A;  2BW2 A;  2KDE B;  3L54 A;  2KO3 A;  3U30 A;  1EUV B;  4KX6 B;  1VZ7 A;  2JYE A;  1DOY A;  1TTN A;  1YN5 A;  3I3T B;  1SE3 A;  2LVP A;  1CJE A;  4XWT A;  2MHJ A;  4DBG A;  4FAD A;  4S0R A;  1UGJ A;  2YEP F;  1N5X A;  5BMG A;  1L0V B;  2MWS B;  4M0W A;  3TEW A;  2ZNV C;  2CR5 A;  2Y5P A;  3W2D A;  1XO3 A;  1C4P A;  1WGG A;  2MBE A;  2B3A A;  4LNI A;  4W9K A;  1EF5 A;  3K9O B;  3NVY A;  3A4S C;  1SB3 C;  1ZOY B;  3PRP B;  2LD9 A;  3ZLZ A;  2L7R A;  1WY8 A;  4GDK B;  1NDD A;  5FR6 A;  2M4N A;  3AU5 A;  3CF4 A;  2FUG 1;  4X57 B;  1UWX A;  4XZ4 A;  2OJR A;  2KN4 A;  3ML9 A;  4XC2 A;  5HKH A;  4RM9 A;  2J0J A;  2OHF A;  3A9J B;  4L1B A;  2OED A;  2LAS A;  3RMK C;  3RYT A;  1K53 A;  3RCZ A;  1SJH D;  4FJY A;  4N6E B;  4IM3 A;  3W5U B;  3MHZ A;  3QHT A;  3HVD A;  1ZW7 A;  2CHX A;  2XK5 B;  4HJG E;  4MSQ B;  2HE7 A;  3QA8 A;  2WXN A;  4FLH A;  2LFI A;  1UF0 A;  3VFK A;  3WIM A;  2A5U A;  1F52 A;  4FHK A;  4BKS D;  2HTH A;  3CMM B;  5CTR C;  3TBL D;  1R7S A;  3AE5 B;  2KDM A;  1FXA A;  5EE3 A;  3H7P A;  4DDI D;  1K51 A;  2GBN A;  4OVU A;  1WYG A;  4I6P A;  3E9S A;  4L23 A;  3A9K B;  1VR9 A;  1YN3 A;  3DBS A;  4P6V F;  3TEX A;  4BKG A;  3TUO A;  4ZYN A;  5IAA C;  3JW0 X;  3P4Q B;  2HJ1 A;  3ML8 A;  1PQS A;  2LVQ A;  4W9L A;  1L4Z B;  5I4D A;  5AZH A;  2KWU B;  2LGX A;  2FID A;  1UZX B;  1ZDV A;  4HCP B;  4US8 A;  5DPS A;  2ZNV B;  3BIN A;  2KQ7 A;  3OAW A;  3P4P B;  4HWI B;  4YT0 B;  4KDI C;  4LNN A;  5JHA A;  4GLS C;  4PS8 A;  3AMZ A;  4HJK A;  4LCD E;  1GOZ A;  3HIZ A;  1QOG A;  4XGA B;  5BYQ A;  2BS3 B;  5HHD G;  1BXT A;  2ONQ A;  2TSS A;  2LVO A;  1LGR A;  1JRU A;  2FCQ A;  3EFC A;  2KT7 A;  2X38 A;  1QOB A;  3ZNG C;  5IKC M;  3DCG A;  4PS7 A;  1LO5 D;  1HTQ A;  2LHE A;  3C8Y A;  3DQV A;  3LJ3 A;  1GTH A;  1TZO A;  5CHV C;  3DHG C;  1QZE A;  2BGF A;  2KJH B;  4DHJ B;  3QQ8 B;  3SEB A;  1IP9 A;  5IO9 A;  1E90 A;  2KKC A;  4RGN A;  3GE8 C;  4EE2 A;  1E0Z A;  2CHW A;  2W55 A;  3MC8 A;  2Z0E B;  2EEL A;  2XNA C;  1LM8 B;  1T0R C;  2DAJ A;  3C19 A;  4C7Z A;  4MM3 A;  1T3Q A;  1FFV A;  1WI0 A;  1Y56 A;  1TGZ B;  3ZRC A;  1Q1O A;  2E3T A;  1TS5 A;  2PEA A;  4LNO A;  3MP9 A;  3KWV A;  5CX3 A;  1N61 A;  5C1Z A;  4RFB A;  2WXP A;  3EGR A;  1ROE A;  4A3O A;  4EFO A;  3UIN B;  2BB5 A;  3VR8 B;  2WXI A;  3AN1 A;  4DDG D;  2N7E A;  1WSP A;  2KTF A;  2GBK A;  1C3T A;  2KDI A;  1EU4 A;  1OEY A;  3AED B;  2JXT A;  2LI5 A;  4HCN B;  1WJ6 A;  1WXA A;  2CU1 A;  3DBL I;  4AJW A;  1GUA B;  2C7H A;  4W9E A;  4ZYS A;  3QWZ B;  4EZJ A;  1J7B A;  2C7M B;  2BYV E;  2HDE A;  4QAY A;  3CSF A;  3AEG B;  3RNB C;  1FXI A;  1YMH E;  3PHX B;  3Q8C A;  1GPX A;  1OQR A;  2K9X A;  4ZRK A;  1F0Z A;  2QSD A;  1WXQ A;  4CO7 A;  1N63 A;  2J7Q B;  1VCB A;  3PS6 A;  4UDU C;  1D6E C;  4GU2 A;  1SGH A;  4WWN A;  1JWB D;  2FCM A;  3H6N A;  4GOC A;  3NZS A;  4GGQ A;  3QIJ A;  2GBR A;  4PT5 A;  2LGS A;  3CWI A;  3B2G A;  4AP4 C;  1WX8 A;  2O6V D;  2DEN B;  2RDG A;  1OQY A;  3BVG A;  2YEP B;  4W9J A;  2K39 A;  1E8Z A;  1WH3 A;  3R2I A;  5C23 A;  2AL6 A;  2IGH A;  2RMM A;  4AUQ C;  3VUW A;  2ZPN A;  3OJ4 B;  1SSN A;  4EUT A;  4JX1 C;  1EO6 A;  3NG0 A;  2WXR A;  2LRU A;  2BF8 B;  1E7U A;  3H8H A;  2KWC A;  3A33 B;  3Q6B A;  1UD7 A;  1H8C A;  1SIF A;  1DOI A;  1E7P B;  1KRH A;  3IBE A;  1P0R A;  1PFD A;  4ARC A;  4G3X B;  2ZZP B;  2W9N A;  5AUK A;  4AS1 A;  1UH6 A;  1FRD A;  3SU8 X;  3R3M A;  3RNG C; 
#chains in the Genus database with same CATH homology
 3P4S B;  4NAM A;  3T3N A;  5G5H A;  2PW9 A;  5C2T B;  1EU3 A;  1AW7 A;  2Q5W D;  1IGC A;  5EE1 A;  4CQN A;  1VZ6 A;  4DXG A;  1FNU A;  2IDY A;  3BII D;  4YTP B;  3KQ4 A;  4OZA A;  3W1S A;  1SF0 A;  1ZUD 2;  4L2Y A;  1XLO A;  3AE3 B;  1QOF A;  1KF6 B;  1TS2 A;  3MC0 B;  4NZL B;  2L52 A;  2K22 A;  1MHX A;  1YJI A;  4RNA A;  3FC4 A;  2KWD A;  4YWG G;  2WXJ A;  4A55 A;  2ICI A;  1P7F A;  2BS2 B;  2BBC A;  5GXG B;  3UI3 A;  1FD6 A;  1JWA D;  4IKG A;  3R8B A;  3NS1 A;  2KAJ A;  4RCO A;  1EM7 A;  1TKY A;  2LGI A;  2INN E;  2W3R A;  1XXG A;  5FK9 C;  1E10 A;  2DWQ A;  2G9H D;  1IBX B;  2JZP A;  3ZGZ A;  1SBB B;  4XWW A;  1E9M A;  1J7A A;  1P7E A;  2J4X A;  5C3J B;  1AN8 A;  3GB1 A;  3OWE B;  4HEA 1;  1IBX A;  2PKO A;  2J53 A;  5D3D A;  2JX5 A;  1TY0 A;  1PGX A;  2BW2 A;  1DGJ A;  1OQQ A;  1RFK A;  1VZ7 A;  4KX6 B;  2JYE A;  2WXK A;  4O1N A;  3V05 A;  1DOY A;  4WUR A;  2G1E A;  2M0A A;  5AUI A;  5FR3 A;  3SFE B;  1XLP A;  4ARI A;  1RWS A;  3RFZ B;  1KLG D;  1PGA A;  1YN5 A;  2GB1 A;  3IXS A;  3BK1 A;  1GB4 A;  1QQR A;  1KH0 A;  1SE3 A;  3TSS A;  3EUB 2;  2WU5 B;  1CJE A;  1ZE3 D;  4XWT A;  2MJE A;  3TEZ A;  1QKZ A;  1L0Y B;  1TY2 A;  3DWM A;  2N9L A;  5BYR A;  1F77 A;  5BMI A;  1UGJ A;  3AE6 B;  1FMA D;  2YEP F;  1N5X A;  5BMG A;  1PUT A;  4N58 A;  1Q10 A;  1L0V B;  1VJK A;  4J3O D;  1FM0 D;  1JWU D;  2VZK B;  2WLB A;  3TEY A;  1TKE A;  1I4X A;  4M0W A;  3TEW A;  1QLB B;  4N59 A;  2Y5P A;  3MJ5 A;  5G5G A;  3W2D A;  1XO3 A;  4LK0 M;  4DQO C;  1C4P A;  3HVZ A;  3AEA B;  1D5X C;  3KWL A;  3AEB B;  4WQM A;  1PGB A;  1TS3 A;  3NVY A;  3ZJT A;  4HRO A;  1D5M C;  1H7W A;  4R3D A;  1SB3 C;  1TJE A;  5D7G A;  1OFF A;  1ZOY B;  4ZOH C;  2MJ3 A;  3N9Y C;  2DYM A;  1FIQ A;  4WAF A;  2DYO A;  4C80 A;  3J9C A;  5TSS A;  2WP9 B;  2H88 B;  4GDK B;  2WQY B;  2LUM A;  3NRZ A;  1JAL A;  1BUI C;  4TMA B;  1IGD A;  3P4R B;  2L32 A;  2WU2 B;  2D5G A;  2LHD A;  3CF4 A;  2FUG 1;  4OZC A;  3PO0 A;  1UWX A;  4MT5 A;  1YQ4 B;  2KN4 A;  2MJD A;  1ENF A;  2OHF A;  1QOA A;  4RGO S;  4L1B A;  2OED A;  1GAQ B;  3E56 A;  3Q69 A;  1K53 A;  1SJH D;  4N6E B;  3DWG C;  4P16 A;  1L0X B;  2JSV X;  3MHZ A;  2IPK D;  4REZ A;  3W5U B;  3AB5 A;  3HUI A;  3HVD A;  5BMH A;  1J7C A;  3GS2 A;  3ETR A;  4HJG E;  2BS4 B;  2WXN A;  4FXC A;  2PTL A;  1QF6 A;  2LFI A;  3AE4 B;  2W3S A;  3AM9 A;  1FEH A;  3I57 A;  1WGK A;  1QIL A;  4KGS A;  2LEK A;  1MPE A;  1R7S A;  3AE5 B;  2KDM A;  1XCQ L;  1FXA A;  1NYQ A;  4A90 A;  4JWU C;  5EE3 A;  4IDI A;  3ABV B;  2WXL A;  1C78 A;  2WXG A;  3T3O A;  1WRI A;  3MFG A;  3AE7 B;  1ET6 A;  3IT6 B;  1K51 A;  2IJ0 A;  2JWU A;  1V1P B;  3I9V 1;  1WYG A;  1K52 A;  4RGM A;  1SE2 A;  3E9S A;  2E6X A;  2ON8 A;  4L23 A;  5HG2 A;  1L6U A;  1VR9 A;  1YN3 A;  2Z8L A;  3O13 A;  3Q8B A;  4P6V F;  3WCQ A;  3NVW A;  3V3X A;  3R2T A;  3Q8A A;  1FO4 A;  3TEX A;  3ZJU A;  3TUO A;  1ACC A;  3BVM A;  4ZRP A;  1VRA B;  3P42 A;  4RGT A;  3P4Q B;  2CJO A;  3AEE B;  2QMT A;  1KFY B;  2M19 A;  1JML A;  4NAW B;  1CQV A;  4TSS A;  2WXQ A;  2DLB A;  5LNK 1;  1L4Z B;  2K3U A;  2SEB D;  1NYR A;  4HKZ E;  5I4D A;  4ZRQ A;  1JQ4 A;  1SIJ A;  2LJI A;  1C77 A;  1F2R C;  1QT9 A;  1MI0 A;  2ACZ B;  2MH7 A;  3P1M A;  3URY A;  2IGD A;  1ZDV A;  1STE A;  2MEK A;  4RH6 A;  1GT8 A;  2J42 A;  2BYT A;  4US8 A;  1HZ6 A;  1H7X A;  4KGT A;  1AYF A;  2KAC A;  2N9K A;  2BTE A;  2JU6 X;  2WNM A;  2WXM A;  2I2Y A;  4AQ7 A;  3AH7 A;  3B2F A;  2JYT A;  1I4R A;  3IAM 1;  3VRB B;  3P4P B;  1FCC C;  5D3I B;  4YT0 B;  1YJJ A;  3AE2 B;  1WWT A;  1ZDX A;  4GLS C;  1V1P A;  3AMZ A;  3B9J A;  3IAS 1;  1HXY D;  2QJL A;  3EA6 A;  3NUH B;  1C76 A;  3AE1 B;  1GOZ A;  2INP E;  1QOG A;  2PVG C;  2WS3 B;  4OHJ A;  1UUP A;  5BYQ A;  2XN9 C;  2BS3 B;  4KGR A;  2V4I B;  1XCT L;  2KQ4 X;  5HHD G;  1BXT A;  2ONQ A;  5HI1 A;  1ZXH A;  1JWS D;  3PZ8 A;  2TSS A;  1HQR D;  3HRD D;  4XDD A;  4B0E A;  1NEN B;  2HTM E;  2X38 A;  1PYW D;  1QOB A;  2R61 A;  5MPO A;  1EWC A;  5H92 C;  1LO5 D;  2CU3 A;  1HA5 A;  2LHE A;  3C8Y A;  2NMQ A;  2BT6 A;  1GTH A;  5EE0 A;  1TZO A;  3PZ7 A;  3NZ3 A;  1D4B A;  1GTE A;  1SXT A;  2AQ3 B;  4ZHP A;  1C79 A;  2AX5 A;  1TS4 A;  5BYS A;  3LXF A;  4MM3 B;  2NTS A;  1SJE D;  2WXH A;  4KKJ A;  1F2R I;  1SEB D;  5EE9 A;  3SEB A;  4RGN A;  2GI9 A;  4HRS A;  4EE2 A;  3L4P A;  1E0Z A;  2WDV B;  3GP7 A;  2IGG A;  1JW9 D;  2W55 A;  4JE3 B;  3U7Z A;  3FIL B;  4RF0 A;  1XF5 L;  2KMM A;  4JWS C;  4KKI A;  4OZB A;  3KLS X;  2EEL A;  4US9 A;  3AV8 A;  2XNA C;  3ZYY X;  2PVO D;  1YN4 A;  2H89 B;  2PLP A;  4C7Z A;  4TQ1 A;  1FFU A;  5H8Y E;  1L5P A;  1T3Q A;  3ZJV A;  1FFV A;  3Q8E A;  1N5W A;  1Y56 A;  3NVV A;  1I4H A;  4ITK A;  1CZP A;  4B0M A;  1YQ3 B;  2FE8 A;  5FKA C;  4DXF A;  4WH4 A;  3VR9 B;  2B76 B;  2E3T A;  1TS5 A;  2L1A A;  1I4Q A;  3MP9 A;  3KWV A;  1JRP A;  1FRR A;  3AEF B;  1C9F A;  2DBY A;  1IUE A;  1XLN A;  1N61 A;  3P63 A;  4RFB A;  3U2S C;  2WXP A;  3BYY B;  3EGR A;  1KLU D;  1FNW A;  1JWM D;  3LB8 C;  2BB6 A;  3BZD B;  1ROE A;  1B1Z A;  3BVZ A;  2BB5 A;  3VR8 B;  2K5P A;  2LMC A;  2WXI A;  4YSY B;  3AN1 A;  1SE4 A;  1WSP A;  1ZP0 B;  1N62 A;  1FNV A;  4YTN B;  1V1O A;  1EU4 A;  3BK2 A;  4ZHO A;  3AED B;  2JXT A;  4A9A A;  1GB1 A;  1XEE A;  1MVK A;  2N0S B;  3IT4 B;  4ZYS A;  1AWD A;  2W82 A;  1J7B A;  2WDR B;  2AQ1 B;  2HDE A;  1NEK B;  4XDC A;  2RDH A;  3AEG B;  1FXI A;  2AQ2 B;  1HEZ E;  2J52 A;  1MHH E;  3VRA B;  1NI3 A;  1UNS A;  1YMH E;  2K0P A;  1PDX A;  4IOI E;  2L83 A;  4GDL B;  1C4C A;  3Q8C A;  4XE0 A;  4LLG M;  1KTK A;  1GPX A;  1EWY C;  1OQR A;  2K9X A;  3BWU D;  4D2K A;  3AE9 B;  1F0Z A;  2QSD A;  1WXQ A;  1V8C A;  1N63 A;  2M56 B;  2NTT A;  1I7H A;  4LTU A;  2PIA A;  4UDU C;  2GRI A;  1VZ8 A;  1D6E C;  3NVZ A;  3BYT B;  1UWM A;  4USA A;  1ESF A;  1JWB D;  4YSZ B;  3U4E G;  1VDV A;  2VZK D;  3FIL A;  2RPV A;  3Q8F A;  3AEC B;  1K50 A;  2ZW0 A;  1JRO A;  4OW0 A;  1E6E B;  4OVZ A;  1XLQ A;  2JQR B;  1A70 A;  1M4V A;  4PT5 A;  4HKQ A;  1B9R A;  1BML C;  3CWI A;  4NJC A;  4WWM A;  3B2G A;  1TYG B;  2V3N A;  3SFD B;  1RM6 C;  4TQ0 A;  1D5Z C;  5E6J A;  1CK1 A;  4MAC A;  1L6V A;  1ZXI A;  4C7Y A;  3VQI A;  1T5X D;  2RDG A;  4H2A A;  4JPS A;  3BVG A;  1VLB A;  2EKI A;  2YEP B;  3W5V B;  1FCL A;  4YTM B;  1ET9 A;  3R2I A;  1C4A A;  4RF1 A;  3FAH A;  1DYQ A;  2IGH A;  2QIL A;  2RMM A;  2SAK A;  1TKG A;  1SSN A;  3CIR B;  1DOX A;  3W9C B;  1YNT E;  4JX1 C;  2WXF A;  2Y5C A;  3LYY A;  4Q2J A;  5HFY A;  1NVI D;  2FBW B;  2V3P A;  4C56 C;  2WXR A;  4A8X C;  4YXD B;  3AE8 B;  3H8H A;  4A6Q A;  4MH8 A;  2V0G A;  1L4D B;  2WXO A;  2Y3A A;  1JCK B;  2W54 A;  4WIP A;  2I38 A;  3SR6 A;  2QIE B;  2ZW1 A;  3ZQ4 A;  5T8I A;  1T6B X;  1I4P A;  1N60 A;  4YSX B;  1DOI A;  1E7P B;  1KRH A;  2QEJ C;  1PFD A;  4ARC A;  1ZPS A;  2CJN A;  5JXV A;  2WDQ B;  1RYJ A;  5AUK A;  1V97 A;  2N7J A;  4AS1 A;  1I4G A;  3RPF C;  1FRD A;  1HZ5 A;  2PMV A;  3U52 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...