5C3JB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c3jB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c3jB01
4A9AA 4ZOHC 1PUTA 4ZHOA 3ABVB 1QOAA 1YQ3B 3AEGB 1ZXIA 1RM6C 4C7YA 1N61A 1KRHA 1V97A 1UWMA 4ITKA 1E0ZA 2CJOA 1FO4A 4JWUC 2W3SA 1DOYA 1WGKA 3W9CB 1XLNA 4US8A 3AMZA 1SIJA 2H89B 1A70A 1NI3A 3P4SB 2JX5A 3NRZA 3FC4A 1H7XA 3W5UB 3AV8A 2DBYA 2BS2B 3CWIA 3VRBB 1FXIA 1JRPA 2K22A 1YJJA 1ZUD2 1VLBA 3B2GA 3AEDB 1FRDA 4IDIA 4US9A 1ZP0B 2N0SB 2L83A 3L4PA 1XLQA 3AEBB 1TKGA 2MJEA 2M19A 3AH7A 1AWDA 1VDVA 2WDQB 1YQ4B 3NS1A 1SB3C 1N5XA 2BT6A 1EWYC 4JWSC 2M56B 5AUIA 2MJ3A 4ZHPA 1FFVA 1E9MA 1TKEA 2LEKA 2QJLA 1AYFA 1F0ZA 1JROA 2PVOD 4FXCA 3VRAB 5H8YE 1JQ4A 3AE8B 1CZPA 2CU3A 1FMAD 2BS4B 3DWMA 4YTPB 1B9RA 1RYJA 2PKOA 1NYQA 1PDXA 4WQMA 4P6VF 3AE4B 4C7ZA 1R7SA 3P4PB 1FXAA 1DOXA 4HRSA 3AB5A 4WWMA 2H88B 1OFFA 1SF0A 1TKYA 1FFUA 3RPFC 3P4QB 4HROA 1GTHA 3AE1B 4KX6B 2WLBA 1J7AA 1IUEA 3BIID 3LXFA 2BS3B 1QOFA 1QT9A 2PIAA 5G5HA 3W5VB 3CIRB 3SR6A 3VR9B 5G5GA 1L5PA 3AE3B 1JALA 4N6EB 3SFDB 1RFKA 2WQYB 1L0VB 2K9XA 1E7PB 2Y5CA 1QLBB 1JW9D 1TJEA 4YTMB 2CJNA 2W54A 4N59A 4JX1C 5EE1A 2W55A 2ACZB 1NYRA 4USAA 1YJIA 3AE6B 3LB8C 3ZYYX 1XLPA 1VJKA 2KAJA 1N60A 1RWSA 3PO0A 1WXQA 2G1EA 3NVWA 2EKIA 3EUB2 2WS3B 1H7WA 4YSZB 2WDVB 3P1MA 1J7BA 1OQRA 1GTEA 3AEEB 4YT0B 2WDRB 1WWTA 1XO3A 2JQRB 2E3TA 1FM0D 5EE3A 1L6UA 5AUKA 3KWLA 1NENB 5C2TB 2OHFA 3DWGC 1QF6A 3AE5B 1NVID 1E6EB 3AECB 3AN1A 1WYGA 3AE9B 1FRRA 1WRIA 1ROEA 2AX5A 3P63A 3SFEB 4LTUA 5EE9A 3AEFB 3NVZA 1GT8A 2WP9B 1OQQA 5H92C 3ETRA 1PFDA 3CF4A 3NVYA 1DGJA 3WCQA 2KMMA 2WU5B 5C3JB 2HTME 1GAQB 1JWAD 3HUIA 1GPXA 1J7CA 3AE7B 1DOIA 4YTNB 2Q5WD 2PVGC 1I7HA 4YSYB 2DWQA 1JWBD 3AE2B 1NEKB 1N5WA 5GXGB 3VR8B 2B76B 1ZOYB 2WU2B 3B9JA 1KFYB 1QOBA 2MJDA 3HRDD 5EE0A 1XLOA 5MPOA 2L52A 1QOGA 2QIEB 2MH7A 3HVZA 4C80A 3P4RB 1FIQA 1KF6B 4N58A 2FBWB 3AM9A 3NVVA 3AEAB 1TYGB 3B2FA 1T3QA 1N63A 3FAHA 2K5PA 1CJEA 1E10A 4YSXB 1V8CA 4YXDB 1N62A 2W3RA 1L6VA
chains in the Genus database with same CATH superfamily
3AEGB 3C0RB 1V97A 4RGMA 5T8IA 3AMZA 4BOSC 3P4SB 4GSWA 2L76A 2J52A 4LNKA 2HJ8A 1R4MI 2FAZA 2LHEA 4OVZA 2K22A 1S3SG 4RCOA 1VLBA 1SEBD 4A90A 2KTFA 3IG3A 1ZKHA 4TKNA 4XGAB 4DDID 5HHDG 4HJKA 1UD7A 3WAMA 2LVQA 2MP2A 2QHOA 3B0AA 4PS8A 4FHKA 4XX5A 3T3NA 3DWMA 1TZ1A 1UNSA 1P3QU 2ZZPB 2NS5A 4NPNA 2PEAA 1XCQL 1JWSD 1SF0A 1TKYA 2HE7A 2ZNVC 4HPPA 5I4DA 1QT9A 4RGOS 3W2DA 2LWPA 3SFDB 2Y5BB 3QX1A 1E7PB 2Y5CA 4ARCA 2CR5A 1WJNA 1N60A 1H7WA 3ZO5B 1WJ6A 2GLSA 5IOIA 1WXVA 2ZJDA 2LI5A 4BKSA 4B9KA 2LMCA 4MM3A 4E71A 5DPRA 2K39A 5L83A 1JWUD 3BVGA 1WGYA 3ZRFA 3ZXVA 2R2QA 1HEZE 2DNFA 4II2B 2RMMA 3IFWB 1C77A 4FULA 3SDLC 2WXPA 4UDUC 2J0KA 3ABVB 1ZE3D 3WA0A 3R66C 3TJPA 4HPLB 2PE6B 2QC8A 4ITKA 1CMXB 2W3SA 1XLNA 2N9EB 2YLMA 3NRZA 3IHPC 4Q2JA 1WMHB 2DZMA 2DBYA 1GC6A 3GE3C 5C1ZA 1J0GA 1FRDA 2D3AA 3NUHB 4MGYE 2IO0B 3AH7A 4W9CA 4KVGB 2REXA 2M56B 4ZHPA 1FNWA 2N4FA 4ZRIA 2E6XA 1VR9A 4HCPB 1IGCA 2ICIA 1FXTB 1UGJA 1PGAA 2MBEA 4OZCA 2KTRB 1HXYD 2NTTA 2KDFB 2LD9A 3J9CA 2OEDA 4W9HA 3AU4A 2NTSA 3OJ4B 3LXFA 2KDBA 4FN2A 1TY2A 3VR9B 3A4RA 5AEKB 4N6EB 4WAAA 2C5LC 2FE8A 3Q14C 3V62A 3Q3JA 2CJNA 5EE1A 1G6JA 1F9JA 2PPHA 4USAA 4KKJA 4M0WB 2JRHA 2AQ1B 2G1EA 4CYEA 1IBXB 2BWFA 1LXDA 3B1LX 3ZGZA 1WM3A 3A9JA 2SAKA 3CSFA 4AP4C 5AUKA 1ZDXA 4RMAA 2OHFA 1RLFA 3AE5B 3L13A 2NR2A 2LGIA 3AEFB 1E5WA 3GOEA 1PGBA 4NJCA 2C60A 1UZXB 3DVGX 2WXJA 1JWBD 2RDHA 4D2KA 3S2AA 1WSPA 3PLVA 1VRAB 4C80A 3BWUD 1F52A 2KC1A 2D3BA 1WGDA 1T3QA 1WE7A 1CQVA 1D5ZC 2EMTA 4EZLA 1PUTA 2NVUI 2AEHA 1GG3A 1KRHA 2KJ6A 4MSQB 3RMKC 3KVFB 1ZXHA 1TS3A 3I57A 2J53A 1PQSA 1I4RA 1MI0A 2LJ5A 2IGHA 4FJYA 1SE2A 1Q0WB 4NZLB 5AZHA 2MBHA 1FCLA 2L3ZA 3VUWA 1D5XC 5FKAC 2KHWB 1SE9A 1C78A 1FFVA 4DWFA 2LUMA 4M8MA 3NZUA 1TGZB 3GZNI 1SIFA 3N9YC 3OG5A 3VRAB 4YWGG 3A4SC 2BS4B 4JIOU 1UWXA 5JHAA 2BKFA 2YEPF 2L32A 1FFUA 3AE1B 1T5XD 1ISNA 1FNUA 1L0YB 4OVVA 3PSEB 2K9XA 2K1FA 5D6JB 1CK1A 2LGDA 4K1RB 3ZJTA 5BYRA 1F2RC 3V6CB 3QARA 1J7BA 4YT0B 5EE3A 1FM0D 1NENB 2IY1B 3NZSA 4IOIE 1C4AA 1NVID 3APCA 1SGHA 1QILA 1ROEA 3SFEB 5JZEB 4C00A 4F8CB 3CF4A 2MQJA 3WCQA 2WU5B 2J7QB 2DX5B 1QZEA 3K9PB 2RDBC 3ZLZA 1ZOYB 4HPMB 3Q3NC 1EU4A 1KLVA 2L52A 3Q3FA 1DYQA 5LNK1 2WXNA 2K5PA 1M4VA 1WZ3A 1V8CA 3PTFC 4OZBA 2ZEQA 1L4ZB 2EMSA 3GE8C 2ZNVB 3W1SC 5D3IB 1YNTE 3DVGY 4L2YA 1NI3A 2IBIB 2QMTA 4A3OA 5CHFA 1V5OA 4MJSB 3B2GA 3K9OB 2LZ6A 4W9EA 3UIPB 1XLQA 4DXAB 3Q3MC 3NS1A 1SB3C 3TUOA 3UF8A 2CHXA 3DPDA 4R3DA 3R8BA 4ICUA 2PVOD 2HJ1A 3Q69A 5IAAC 4XZ4A 2G45B 4NAWA 3SU8X 4II3B 2OJWA 4H2AA 1KLGD 1EUVB 3DDCB 4A9AA 4IM0A 3W5VB 3PV1A 1L5PA 3ZDMC 2ZCCA 2MBOA 3R7QA 1E8ZA 5DCNA 2UU7A 3AU5A 3BK2A 2ZVOA 1RWSA 4GMVA 4MGKE 2V9HA 2JQRB 2E3TA 2Y3AA 1EO6A 3GP7A 4M8NA 3AECB 3B08A 3AE9B 3TIXA 2AX5A 1WX9A 4P7IA 1X1MA 2LUEA 2K6DB 3PGEA 4LNFA 3A1QB 3H9DA 1J7CA 2INCC 3M63B 3JW0X 3L10B 4YSYB 4NQLB 3A33B 4A55A 1QOBA 1UELA 4KGRA 4DHZB 2G3QB 3PS6A 1N62A 3SHQA 4RGTA 1NBFC 2GBRA 2KDMA 4NJ7A 2ASQA 2KQ7A 1WGKA 2MW5A 1SIJA 3NG0A 1H7XA 2MCNB 1HTQA 2MBQA 3Q8CA 3T3OA 3QIJA 3BINA 2XEWA 3AEDB 4WH4A 4WAFA 4BBNF 3L4PA 1YQBA 3KWVA 1PGXA 1VDVA 4ZDVA 2FUHB 1N5XA 4OVUA 5D94A 4S0RA 5IP4D 1F0ZA 3BZDB 1HTOA 4YTPB 2O2VA 1RYJA 3QA8A 2DAFA 2X8XX 1FXAA 1V81A 3BVMA 2NBUA 1I4HA 2DZJA 3N3KB 3ZQ4A 4QAYA 1Q10A 2KVZA 1WF9A 3PZDA 5TSSA 3TMPB 3LYYA 2ACZB 4P1BC 4WURA 5G55A 2OOBB 4GOCA 4NJ6A 2MHJA 3ZJVA 1UBQA 1QF6A 4IWOA 1E90A 1C79A 3RZWC 2DYMA 3ZVVA 3PRZA 2AWTA 1DGJA 1TS4A 2INDC 1E7UA 3HUIA 1L4DB 2VH1A 2PJHA 1I7HA 2JU6X 2J0JA 3KLSX 1WI0A 2WU2B 1KFYB 2MJDA 4GDKB 3NZ3A 1KF6B 3N20C 4KDLB 2AL3A 2JZPA 3EGRA 3P2BA 5EDSA 2A5UA 4OW0A 4GU2A 3Q8BA 3NOBA 2JX5A 2KWCA 1I35A 2D10A 1VZ8A 3RUIB 1M94A 1H4RA 2V1YA 2Z8LA 3T9LA 3VDZA 3I5JC 4B0MA 4FADA 1AWDA 3HM6X 5JHBA 5C23A 4KSKC 1WXMA 2QJLA 3I3TB 1AYFA 1JROA 4NAMA 2OJRA 1FMAD 3DVNU 1H8CA 4WQMA 4HDOA 3EHVA 3RCZA 2WXHA 1BT0A 4BZAA 1V86A 3H7PB 1GNUA 2V4IB 4KSLC 4W9DA 4KDIC 2R61A 4DXFA 1SXTA 3RD2A 3PO0A 3ONSA 1TIFA 2IDYA 3AEEB 3RNCC 2LGXA 2BPSA 1L6UA 4LNOA 2D3GA 1D6EC 5J2RA 1UBIA 2KN4A 1UGMA 1P7EA 1OQQA 1PYWD 1L2NA 1JWAD 4A20A 2DHZA 3A9KB 4YTNB 1LO5D 5HFYA 2HDEA 3AULA 2RDGA 2D2QA 1GJZA 1JWMD 4EZKA 3ALBA 4ARIA 3PREA 3AEAB 4DDGD 2PE9A 1E10A 4M02A 2FCMA 4L1BA 1P1AA 2BB6A 4ANVA 2V3PA 1WJ4A 2LRUA 2ZVNA 2GOWA 2IYDB 4F7ZA 1I42A 3M95A 4KIKB 2K25A 2K8CA 1JMLA 4IDIA 2N0SB 2O6VA 4GIVA 2M19A 1YQ4B 2JSVX 1EWYC 1P0RA 1OEYA 4W9IA 2LEKA 3ZDTA 2MBBB 4WJPA 2I1KA 4MT5A 3DOWA 4HEA1 4GLSC 3H6NA 4MACA 3H1UA 1NYQA 5GMVA 1ENFA 4PYUA 4P16A 4HRSA 1WY8A 1BXTA 1C76A 1EM7A 3BIID 3DCGA 2KFJA 1F77A 2G4DB 2MEKA 1YN4A 2M17A 4FJVB 3N1YC 2W54A 3O65B 3AE6B 2XK5A 1HZ5A 2KAJA 4W9FA 2EKIA 3P1MA 2KVRA 4F1SA 2GBKA 4TMAB 3KW5B 1FRRA 4DK5A 4JLCA 3GS2A 3Q2AC 3QC8B 2DENB 2WP9B 3Q8FA 4M01A 3ETRA 2GI9A 1A5RA 4IG7B 1WGHA 2KFKB 1N5WA 1FCCC 4LJOB 2RPQA 4IKGA 3U52E 2JXTA 4B95A 4I6NB 4CHKA 2LGYA 4PYZA 5IKCM 4MGIE 1C1YB 2CJOA 1MJDA 2JUOA 3Q8EA 4WJNA 4XDCA 1RRBA 2NPTB 3HM3A 5LLIA 2WXKA 1D3ZA 2FNJB 2MJEA 5G2NA 4OHJA 5JH5C 1FNVA 2I1JA 4C4VA 2JYTA 3MFGA 3IAS1 4RF0A 4NQKE 2PKOA 3VHTC 3RYTA 3ZNZB 2GRIA 1WRDB 3WAOA 4LCDE 3VTVA 1C9FA 3RPFC 1IUEA 1C3TA 3MC9A 4EE2A 2WXQA 4MDKE 2BYTA 1JW9D 1B1ZA 4YTMB 2K8HA 2RGFA 3FILA 1NYRA 3CSTA 3LB8C 4DBGA 2V0GA 2KNBA 5E6JA 4GN1A 5CTRC 2KOXA 2PLPA 4LJPB 4LNIA 4BBNC 4XYCA 2KD0A 3T8MA 1WRIA 4A3PA 1C4PA 3ZKJC 3VTUA 1I4PA 3MC0B 1WJUA 1DOIA 2Q5WD 3DBRB 2C9WB 4I6PA 1TS2A 1GB4A 1K52A 3HVDA 4IM2A 2QSDA 5FR3A 1P98A 1GB1A 3P42A 2LXAA 2W3RA 5LXHA 3DBLB 4OZAA 4ZOHC 1QOAA 1P7FA 1ZXIA 1UF0A 3R3MA 4G11A 5CHVC 1AW7A 1E0ZA 2KQSA 1ET9A 1E8YA 3TEXA 4TQ1A 2K3UA 4LLGM 2MP2B 1ACCA 5BMHA 4DXGA 1ESFA 1HA5A 3IVFA 1K50A 1LM8B 4XE0A 4C56C 2W9NA 2FCSA 2KMAA 1WM2A 3ZJUA 1BUIC 4E3CA 2PW9A 3JVZX 2BT6A 2DAJA 2N9KA 4BAXA 1FEHA 5BYQA 3RNGC 1JQ4A 3RNEC 1B9RA 4ACFA 1PDXA 1TT5B 2NCNA 3VTWA 4DQOC 2B3AA 4W9JA 1IGDA 2RR9A 2YEPB 2LRWA 3P4QB 2PIAA 3AI5A 3IXSA 5G5GA 4CQNA 4LK0M 1WXAA 1L0VB 4NNJB 2JYEA 1D4BA 1QLBB 1YMHE 2QCZA 2W82A 2LFIA 2WHIA 4RM9A 2JZZA 1OEYJ 3VXWA 4MM3B 3ZYYX 4RGNA 1XLPA 5DPSA 4L23A 4A6QA 4MH0E 4S17A 2KO3A 4JQWC 3QHTA 3ZTCA 5BYSA 1K53A 3DWGC 3I63C 2CU1A 1EF5A 4MELA 2LVOA 2NMQA 2INPE 2BYVE 1YD8U 2LHDA 3SD5A 3A9KA 1YN3A 5J18A 4K7WA 2L8JA 4WJOA 5AZFA 3RZFA 2M8SA 2KYWA 4BKTA 3NVVA 4AQ7A 3MJ5A 3ZW3A 1OTRB 3PRPB 3VUXA 1I4QA 2M0AA 1ZGUB 4XDDA 3QQ8B 2BYFA 3C19A 1WX8A 2KQ4X 1RM6C 3RULA 2VH2A 3ZTDA 3C8YA 4EOYA 5FR6A 2TSSA 1XT9B 5BMIA 5JXVA 4JGHB 3QK0A 4IW0A 4J3OD 3APDA 1D5MC 2EKEC 2IY0B 1WMHA 3RT3B 2KACA 2KANA 2XBBC 1YOVB 2JWUA 3KYCD 3IT6B 2KLCA 3RNFC 1LGRA 4TV3A 4ANWA 1GTHA 1SBBB 3A9JB 2LGSA 1JALA 1RFKA 3R2TA 4IC7B 4REZA 2LVPA 4EZJA 4CO7A 2IO1B 2KTRA 2BWES 2MSED 2KK8A 5BO4B 4NY0A 3VVWB 3Q3OC 1WXQA 1ET6A 4W9LA 3UI3A 2WDVB 2WXMA 3EC8A 4HVBA 3V60A 1KOTA 4FA6A 1WFYA 1FPYA 4PT5A 3VH4B 1GT8A 3DBSA 2WX1A 1K51A 1NI2A 2KFKA 4M0WA 4K81A 3NVYA 1MPEA 2ZPYA 5D2MB 2D07B 2GMIC 3CMMB 2KXJA 1IBXA 2BTEA 2DWQA 4MEMA 4HKZE 3RNAC 2NBVB 4HJGE 4HXDA 3B9JA 4WJQA 4ASWC 5IO9A 2V3SA 2LJIA 1T0SC 2R2OA 2KDEB 2KT7A 4RF1A 2BW2A 1AARA 4BKSD 1N61A 1WR1A 3MP9A 4WWPA 3PT2B 2NPTA 1MHXA 4WIPA 2WXLA 1JRPA 2L0TA 2KX3A 1SE3A 4US9A 2LASA 2BQQA 1GC7A 4N9F4 4ANXA 3DBRI 1E8WA 4WQOB 1MVKA 4GB9A 1VZ7A 1E9MA 4PS3A 4FXCA 3L0WB 3AXCA 4IM3A 1VD2A 1ZPSA 1TZOA 3AB5A 1E7VA 3PHWB 3R7RA 1EWCA 3AE3B 1MHHE 3UQBA 4IWPA 3VUYA 2BGFA 2WGSA 2RPVA 3NVWA 3EUB2 3RFZB 2KLGA 4ZRPA 5C2TB 3DHIC 2KN5A 2L7RA 2CKHB 3ZNGC 1QKZA 3NVZA 1YX5B 3U4EG 1SJHD 5C3JB 4GDLB 2J0MA 4TSSA 2JT4B 4PK1A 1I4GA 2KZRA 5MPOA 3HVZA 2MH7A 3KQ4A 3N32A 1AN8A 2HD5B 2L05A 3N30A 3ZIMA 3EFUA 3QCAA 2IZVB 2WXIA 4LDTD 1T0YA 1WGGA 3W9CB 2C7MB 4I6LB 1GUAB 3DBHB 2BS2B 4HDQA 2L00B 3L08A 1YJJA 2FCNA 3VFKA 1ZP0B 3LJ3A 4NAWB 2WDQB 2L0FA 2Z0DB 2JF5A 3EECA 5AUIA 2N1WA 4W9KA 4KGSA 2FUG1 2IGDA 3WALA 4EUTA 1WE6A 1XEEA 1CZPA 4MJSA 2BKRB 3IBEA 4AJWA 1R7SA 2DYBA 2GBNA 2Z0EB 3DVNV 1OFFA 1Q5WB 2BYEA 2N9PC 3D32A 4BVUC 3TL5A 4HROA 4KX6B 4FLHA 1QOFA 3HHMA 1TS5A 4HKQA 2N9XA 1XF5L 5HI1A 3TSSA 1K8RB 1Z5SB 4HK2A 3H7SA 4RFBA 1YX6B 3ML9A 5CHWA 1F1HA 2VZKD 2RD0A 2WXGA 1QQRA 3UGBB 1R4NB 1VZ6A 3X0WA 1SSNA 1WYGA 1T0RC 2BB5A 2KWDA 2FCQA 5H92C 5CX3A 2KMMA 2HTME 1GAQB 1XXGA 1GPXA 1S1QB 2JY6A 1L0XB 1NEKB 1IYFA 4P1CC 4BKGA 4DHJD 2KJRA 1V9JA 4EFOA 3BYYB 3GB1A 2KWVB 1UUPA 4AUQC 4LNNA 4YSXB 3A1QA 1V6EA 2BVCA 1YQ3B 4KZCA 1UWMA 2GB1A 1KTKA 3ML8A 2XN9C 3URYA 1FO4A 3U30A 3JSVB 2WWZA 4XC2A 2C7HA 2ZW0A 3W5UB 3CWIA 1V2YA 1FXIA 5IN7A 2O2VB 2CHWA 2BBCA 1HE8A 1Y56A 3E9SA 1FD6A 4JWSC 2D5GA 2KMCA 2UWQA 2X38A 3PZ7A 2MRPA 3AE8B 4B6WA 4A8XC 3AE4B 4C7ZA 3O13A 3P4PB 3E56A 2JZ3B 4FJZA 2WLBA 1YN5A 4B0EA 5G5HA 3SR6A 2K8BA 2ONQA 1V1PB 2WQYB 1N6ZA 3QWZB 2V4LA 1WR6E 3PRMB 1OQYA 2MLBA 3U2SC 4G50A 4E74A 1GTEA 1IPGA 3UIOB 2HTHA 4BFRA 1L7YA 1RFAA 2YVCA 4XWTA 2M4NA 3QJZA 1F2RI 1U4AA 2DLBA 3QAQA 2IPKD 3L16A 3ECIA 4FBJB 3APFA 4MH8A 4XWWA 1XD3B 3PZ8A 2WXFA 5GXGB 2B76B 2AL6A 2IGGA 2NBWB 4IWQA 5TR5A 5J17A 2FBWB 5L95C 2GBJA 3FAHA 3B2FA 3DHGC 5E6OA 4YXDB 1MG4A 3UQAA 5DPWA 4ZHOA 1J8CA 4C7YA 5E6NA 1I4XA 5D7GA 4JWUC 2INNE 4US8A 5BMGA 2H89B 4GDKA 4IUMB 2WX0A 1V80A 1E8XA 2Y5PA 1ZDVA 2N9LA 3AEBB 1LFDA 3CF6E 3U8ZA 1ZW7A 3HIZA 4JE3B 2D11A 3MC8A 3OLMD 3RN9C 4HCNB 4K3CA 3ZUNA 4RH6A 4G3XB 4ZYSA 3ZRCA 4P6VF 5HKHA 3TCAA 1XCTL 2KDIA 5E6PA 2LXCA 1C4CA 2G9HD 5D3DA 2FIDA 1J7AA 2QEJC 2BS3B 3DBHI 3PHXB 3NY5A 2AQ3B 3N1XC 2JPHA 1TJEA 4N59A 1IP9A 1YJIA 3Q6BA 3H7PA 2WS3B 4YSZB 3L54A 1XO3A 1WWTA 1TY0A 2JVCA 4K3BA 3OAWA 2PTLA 3HK0A 1V5TA 2IO3B 3BY4B 1E6EB 3AN1A 4WWOA 5EE9A 3P63A 4GDLA 2FIFA 1WYWB 3M3JA 3W1SA 1R4MB 4AWJA 3FKYA 4TQ0A 2QDFA 2ZPNA 2ZCBA 1JRUA 3WIMA 1GOZA 1RAXA 3RI7C 4K7SA 5EE0A 1QOGA 1TYGB 2N7EA 4EKUA 1N63A 3WANA 2MX2A 1L6VA 3KUCB 3PLUA 2DYOA 1Z2MA 2O6VB 2SEBD 2KJHB 3U7DA 3ZNID 3ZNHB 4W9GA 1R4NI 2G4SA 4ZYNA 4GXBA 1KM7A 1DOYA 4ZRJA 4M00A 2IJ0A 3ENEA 3FC4A 3IAM1 2QILA 2A4ZA 3AV8A 1UH6A 2CHZA 3BYTB 3NHEB 2JWZA 3VRBB 3LDZE 1ZUD2 2WNMA 3EFCA 3X23A 1JCKB 4AJYB 3RNBC 2N7JA 4KKIA 5IA7A 3DQVA 3W1YA 4AOFA 2I2YA 1WZ0A 2WXOA 2MJ3A 2KKCA 4TUUA 4KIKA 2JRIB 1J19A 1KLUD 4BOZB 2CU3A 2WYQA 3NJTA 2KX0A 4JPSA 2XK5B 1DOXA 2JXXA 2H88B 4WWMA 4ANUA 2L1AA 4X57B 4KZ0A 1TBEA 3SEBA 3KYDD 4J6IA 1T6BX 3OJ3A 3KUDB 4JX1C 3TEZA 2WXRA 3M62B 1OQRA 3KWLA 2J42A 3WAPA 4JL9A 1V1OA 5KHOA 2VRRB 4K7UA 2K0PA 2UYZB 4LTUA 2K6QA 2EELA 1PFDA 4O1NA 3VQIA 2IO2B 3JYUA 4HWIB 4RM8A 2PVGC 4LDTB 3TEWA 2I38A 4G0NB 3BVZA 3Q8AA 3P4RB 1FIQA 1YIWA 4N58A 2ON8A 1V49A 1P9DU 1YJ1A 4KGTA 2Z59B 2AYOB 2CS4A 3JSVA 4FHJA 1TTNA 1VCBA 4AS1A 4C4VB 3TEYA 3TBLD 3U7ZA 1A70A 2N1VA 3IT4B 3OWEB 3BK1A 4PS7A 4EEWA 1STEA 2XNAC 2MWSB 2L83A 2GBMA 2KWUB 5DPTA 1TKGA 4MGZE 1Q1OA 1BMLC 2MA9B 3L17A 1EU3A 3UINB 1EF1A 3EA6A 4RNAA 4YL8A 1TKEA 3ZXRA 1HZ6A 2WDTB 2V3NA 4DHZE 5H8YE 5FK9C 1WH3A 3FILB 1WXSA 2PMVA 2M0XA 3MHSD 1V1PA 1NDDA 4WWNA 2O6VD 2VZKB 3H8HA 4ICVA 4ZRQA 3VAWA 1OGWA 1WX7A 2BF8B 3CIRB 1LQBA 2DZIA 1MG8A 2AQ2B 3PVLA 2W55A 3DHHC 2C7NB 3VH3B 3DBLI 1VJKA 1T0QC 4ZRKA 3PPAA 3NS8A 2WDRB 3V3XA 5HG2A 3MJWA 1HQRD 4DHJB 3V61A 1Y8RC 5AZGA 2M1MA 4HLEA 3MTNB 2ZW1A 3V6EB 1WGRA 4GGQA 3V05A 3R2IA 2DZKA 2KC2A 3KUZA 1WIAA 3AE7B 2J4XA 4URKA 3AE2B 1KJTA 4MSMB 1MFWA 3KH0A 3VR8B 5KHQA 2RSUA 3HRDD 2QIEB 5LXIB 1SJED 3I9V1 3GZNB 1SE4A 3AM9A 4KV2A 2N7DA 1XQQA 1CJEA 2D3CA 3N1ZC 3MHZA 1XLOA 1KH0A
chains in the Genus database with same CATH topology
4OZAA 4ZOHC 4RGTA 1QOAA 1P7FA 1YQ3B 3AEGB 1ZXIA 2KDMA 1V97A 1AW7A 4RGMA 1UWMA 2GB1A 1KTKA 5T8IA 2XN9C 3URYA 1FO4A 1ET9A 3TEXA 1WGKA 4TQ1A 3AMZA 1SIJA 3P4SB 2K3UA 4LLGM 1H7XA 2ZW0A 3W5UB 2J52A 3Q8CA 1ACCA 5BMHA 3T3OA 3CWIA 2LHEA 4OVZA 4DXGA 1FXIA 1ESFA 2K22A 4RCOA 1HA5A 1VLBA 1K50A 3AEDB 1SEBD 2BBCA 4WH4A 4XE0A 4WAFA 4C56C 3L4PA 3ZJUA 1BUIC 4A90A 1Y56A 3KWVA 1PGXA 3E9SA 1VDVA 2PW9A 1FD6A 1N5XA 2BT6A 4JWSC 2N9KA 5HHDG 2D5GA 1FEHA 5BYQA 2X38A 3PZ7A 1F0ZA 3T3NA 3BZDB 1JQ4A 3AE8B 3DWMA 4YTPB 1UNSA 1RYJA 1B9RA 1PDXA 4A8XC 3AE4B 4C7ZA 3O13A 3P4PB 1FXAA 3E56A 3BVMA 1XCQL 4DQOC 1IGDA 1I4HA 1JWSD 1SF0A 1TKYA 2YEPB 3P4QB 2WLBA 1YN5A 5I4DA 4B0EA 2PIAA 1QT9A 4RGOS 5G5HA 3W2DA 3SR6A 3ZQ4A 1E0ZA 3IXSA 5G5GA 1Q10A 2ONQA 4CQNA 3SFDB 1V1PB 2WQYB 4LK0M 1L0VB 2JYEA 1D4BA 1E7PB 2Y5CA 1QLBB 5TSSA 1YMHE 4ARCA 2W82A 2LFIA 3LYYA 2ACZB 4MM3B 3ZYYX 4RGNA 1XLPA 4WURA 1N60A 4L23A 3U2SC 4A6QA 1H7WA 1GTEA 3ZJVA 5BYSA 1K53A 3DWGC 1QF6A 1C79A 4XWTA 2NMQA 2INPE 2DYMA 2LHDA 1F2RI 2LMCA 1YN3A 1DGJA 1TS4A 2DLBA 2IPKD 3HUIA 1L4DB 4MH8A 1JWUD 3BVGA 4XWWA 1I7HA 2JU6X 3PZ8A 2WXFA 3KLSX 5GXGB 2B76B 2WU2B 1KFYB 2IGGA 2MJDA 4GDKB 3NZ3A 1KF6B 1HEZE 2FBWB 2RMMA 3NVVA 3FAHA 4AQ7A 3B2FA 3MJ5A 1C77A 1I4QA 2M0AA 4YXDB 2WXPA 2JZPA 4XDDA 4UDUC 3EGRA 4ZHOA 3ABVB 1ZE3D 4OW0A 2KQ4X 1RM6C 4C7YA 1I4XA 4ITKA 5D7GA 4JWUC 2INNE 2W3SA 3Q8BA 1XLNA 3C8YA 4US8A 5BMGA 2H89B 2JX5A 3NRZA 4Q2JA 1VZ8A 2TSSA 2DBYA 5BMIA 2Z8LA 5JXVA 2Y5PA 1ZDVA 1FRDA 3NUHB 4J3OD 2N9LA 3AEBB 4B0MA 3AH7A 1AWDA 2M56B 4ZHPA 1D5MC 1FNWA 4JE3B 2QJLA 1AYFA 2E6XA 2KACA 1VR9A 1JROA 1IGCA 4NAMA 2ICIA 1UGJA 1PGAA 1FMAD 2JWUA 4OZCA 4RH6A 4WQMA 4ZYSA 1HXYD 2NTTA 4P6VF 3IT6B 1XCTL 3J9CA 2OEDA 2WXHA 1C4CA 2G9HD 2NTSA 5D3DA 1GTHA 1SBBB 2V4IB 3LXFA 1J7AA 2QEJC 2BS3B 1TY2A 3VR9B 1JALA 4N6EB 1RFKA 3R2TA 4REZA 2AQ3B 2FE8A 1TJEA 2R61A 2CJNA 4DXFA 4N59A 5EE1A 4USAA 1YJIA 4KKJA 1SXTA 3PO0A 2AQ1B 1WXQA 1ET6A 2G1EA 2WS3B 1IBXB 4YSZB 2IDYA 2WDVB 3UI3A 2WXMA 1XO3A 3ZGZA 3AEEB 1TY0A 1WWTA 2SAKA 5AUKA 1L6UA 2PTLA 1ZDXA 1D6EC 2OHFA 3AE5B 1E6EB 3AN1A 2KN4A 2LGIA 3P63A 5EE9A 4PT5A 3AEFB 1GT8A 1P7EA 3W1SA 1K51A 1OQQA 1PGBA 4M0WA 4NJCA 3NVYA 1PYWD 1MPEA 4TQ0A 1JWAD 1IBXA 2BTEA 4YTNB 1LO5D 5HFYA 2WXJA 2DWQA 1JWBD 2RDHA 4HKZE 4D2KA 2HDEA 1GOZA 4HJGE 1WSPA 3B9JA 2RDGA 5EE0A 1VRAB 1QOGA 3BWUD 4C80A 1JWMD 4ARIA 3AEAB 1TYGB 1T3QA 1N63A 1E10A 1CQVA 2LJIA 1L6VA 1D5ZC 1PUTA 4RF1A 4L1BA 2DYOA 2BW2A 2SEBD 2BB6A 1N61A 1KRHA 3MP9A 2V3PA 1DOYA 1MHXA 2IJ0A 3FC4A 1ZXHA 1TS3A 3I57A 2J53A 2QILA 3IAM1 4WIPA 1I4RA 3AV8A 1MI0A 3BYTB 2WXLA 2IGHA 3VRBB 1JRPA 1ZUD2 1JMLA 1SE3A 2WNMA 1SE2A 1JCKB 4IDIA 4NZLB 2N0SB 2N7JA 4KKIA 4US9A 1FCLA 2M19A 1YQ4B 2I2YA 2JSVX 1EWYC 1D5XC 1MVKA 2WXOA 5FKAC 2MJ3A 1VZ7A 1C78A 1FFVA 2LUMA 1E9MA 2LEKA 4MT5A 4HEA1 3N9YC 4GLSC 4FXCA 3VRAB 1KLUD 4YWGG 2CU3A 2BS4B 4MACA 1NYQA 1ZPSA 1TZOA 4JPSA 1UWXA 1ENFA 4P16A 4HRSA 2YEPF 3AB5A 1DOXA 1BXTA 2H88B 4WWMA 2L32A 1C76A 1EM7A 2L1AA 1FFUA 3AE1B 3BIID 1T5XD 1F77A 1EWCA 1FNUA 3SEBA 1L0YB 3AE3B 1MHHE 2MEKA 2K9XA 1T6BX 1YN4A 2W54A 4JX1C 1CK1A 3TEZA 3AE6B 2WXRA 3ZJTA 5BYRA 1F2RC 1HZ5A 2KAJA 2RPVA 3NVWA 2EKIA 3EUB2 3RFZB 3P1MA 1J7BA 1OQRA 4YT0B 4ZRPA 5EE3A 1FM0D 3KWLA 1NENB 5C2TB 4IOIE 2J42A 1C4AA 1NVID 4TMAB 1V1OA 1FRRA 1QILA 1ROEA 2K0PA 1QKZA 3SFEB 3GS2A 4LTUA 3NVZA 3U4EG 2EELA 2WP9B 3Q8FA 3ETRA 1PFDA 2GI9A 1SJHD 3CF4A 4O1NA 3VQIA 3WCQA 2WU5B 5C3JB 4GDLB 4TSSA 2PVGC 3TEWA 1N5WA 2I38A 1I4GA 1ZOYB 1FCCC 5MPOA 3BVZA 3Q8AA 1EU4A 1XLOA 2L52A 3HVZA 4IKGA 2MH7A 3P4RB 1FIQA 4N58A 3U52E 1DYQA 5LNK1 2ON8A 3KQ4A 1AN8A 2WXNA 2JXTA 2K5PA 1M4VA 1V8CA 4KGTA 4OZBA 1L4ZB 5D3IB 1YNTE 4AS1A 2WXIA 2CJOA 3TEYA 3W9CB 3U7ZA 3Q8EA 1A70A 4L2YA 1NI3A 3IT4B 3OWEB 2QMTA 3BK1A 4XDCA 2BS2B 1STEA 1YJJA 3B2GA 2XNAC 2WXKA 1ZP0B 2L83A 1XLQA 1TKGA 2MJEA 4NAWB 1BMLC 4OHJA 2WDQB 1EU3A 1FNVA 3NS1A 1SB3C 3TUOA 5AUIA 3EA6A 4R3DA 3R8BA 4RNAA 4KGSA 1TKEA 2JYTA 2FUG1 3MFGA 3IAS1 2IGDA 4RF0A 1HZ6A 2PVOD 2V3NA 3Q69A 5H8YE 1XEEA 1CZPA 5FK9C 2PKOA 3FILB 1R7SA 2GRIA 2PMVA 1OFFA 1V1PA 1C9FA 4H2AA 3RPFC 1KLGD 4HROA 4KX6B 2VZKB 3H8HA 1IUEA 4ZRQA 4A9AA 1QOFA 3W5VB 4EE2A 3CIRB 2WXQA 1TS5A 1L5PA 4HKQA 2BYTA 1JW9D 1XF5L 1B1ZA 4YTMB 5HI1A 2AQ2B 3TSSA 3FILA 2W55A 1NYRA 3LB8C 3BK2A 4RFBA 2V0GA 5E6JA 1VJKA 1RWSA 2VZKD 2PLPA 2WXGA 2WDRB 1QQRA 2JQRB 2E3TA 3V3XA 2Y3AA 5HG2A 1VZ6A 1HQRD 3GP7A 3AECB 1SSNA 1WYGA 3AE9B 1WRIA 2AX5A 2BB5A 1C4PA 2KWDA 5H92C 2ZW1A 2KMMA 1I4PA 3MC0B 2HTME 1GAQB 1XXGA 3V05A 3R2IA 1GPXA 1J7CA 3AE7B 1DOIA 1L0XB 2Q5WD 2J4XA 4YSYB 3AE2B 1NEKB 3VR8B 1TS2A 4A55A 1QOBA 3HRDD 1GB4A 1K52A 2QIEB 3BYYB 3HVDA 3GB1A 4KGRA 1UUPA 1SJED 3I9V1 2QSDA 1SE4A 3AM9A 5FR3A 1CJEA 1GB1A 4YSXB 3P42A 3MHZA 1N62A 2W3RA 1KH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9A A;  4ZOH C;  1PUT A;  4ZHO A;  3ABV B;  1QOA A;  1YQ3 B;  3AEG B;  1ZXI A;  1RM6 C;  4C7Y A;  1N61 A;  1KRH A;  1V97 A;  1UWM A;  4ITK A;  1E0Z A;  2CJO A;  1FO4 A;  4JWU C;  2W3S A;  1DOY A;  1WGK A;  3W9C B;  1XLN A;  4US8 A;  3AMZ A;  1SIJ A;  2H89 B;  1A70 A;  1NI3 A;  3P4S B;  2JX5 A;  3NRZ A;  3FC4 A;  1H7X A;  3W5U B;  3AV8 A;  2DBY A;  2BS2 B;  3CWI A;  3VRB B;  1FXI A;  1JRP A;  2K22 A;  1YJJ A;  1ZUD 2;  1VLB A;  3B2G A;  3AED B;  1FRD A;  4IDI A;  4US9 A;  1ZP0 B;  2N0S B;  2L83 A;  3L4P A;  1XLQ A;  3AEB B;  1TKG A;  2MJE A;  2M19 A;  3AH7 A;  1AWD A;  1VDV A;  2WDQ B;  1YQ4 B;  3NS1 A;  1SB3 C;  1N5X A;  2BT6 A;  1EWY C;  4JWS C;  2M56 B;  5AUI A;  2MJ3 A;  4ZHP A;  1FFV A;  1E9M A;  1TKE A;  2LEK A;  2QJL A;  1AYF A;  1F0Z A;  1JRO A;  2PVO D;  4FXC A;  3VRA B;  5H8Y E;  1JQ4 A;  3AE8 B;  1CZP A;  2CU3 A;  1FMA D;  2BS4 B;  3DWM A;  4YTP B;  1B9R A;  1RYJ A;  2PKO A;  1NYQ A;  1PDX A;  4WQM A;  4P6V F;  3AE4 B;  4C7Z A;  1R7S A;  3P4P B;  1FXA A;  1DOX A;  4HRS A;  3AB5 A;  4WWM A;  2H88 B;  1OFF A;  1SF0 A;  1TKY A;  1FFU A;  3RPF C;  3P4Q B;  4HRO A;  1GTH A;  3AE1 B;  4KX6 B;  2WLB A;  1J7A A;  1IUE A;  3BII D;  3LXF A;  2BS3 B;  1QOF A;  1QT9 A;  2PIA A;  5G5H A;  3W5V B;  3CIR B;  3SR6 A;  3VR9 B;  5G5G A;  1L5P A;  3AE3 B;  1JAL A;  4N6E B;  3SFD B;  1RFK A;  2WQY B;  1L0V B;  2K9X A;  1E7P B;  2Y5C A;  1QLB B;  1JW9 D;  1TJE A;  4YTM B;  2CJN A;  2W54 A;  4N59 A;  4JX1 C;  5EE1 A;  2W55 A;  2ACZ B;  1NYR A;  4USA A;  1YJI A;  3AE6 B;  3LB8 C;  3ZYY X;  1XLP A;  1VJK A;  2KAJ A;  1N60 A;  1RWS A;  3PO0 A;  1WXQ A;  2G1E A;  3NVW A;  2EKI A;  3EUB 2;  2WS3 B;  1H7W A;  4YSZ B;  2WDV B;  3P1M A;  1J7B A;  1OQR A;  1GTE A;  3AEE B;  4YT0 B;  2WDR B;  1WWT A;  1XO3 A;  2JQR B;  2E3T A;  1FM0 D;  5EE3 A;  1L6U A;  5AUK A;  3KWL A;  1NEN B;  5C2T B;  2OHF A;  3DWG C;  1QF6 A;  3AE5 B;  1NVI D;  1E6E B;  3AEC B;  3AN1 A;  1WYG A;  3AE9 B;  1FRR A;  1WRI A;  1ROE A;  2AX5 A;  3P63 A;  3SFE B;  4LTU A;  5EE9 A;  3AEF B;  3NVZ A;  1GT8 A;  2WP9 B;  1OQQ A;  5H92 C;  3ETR A;  1PFD A;  3CF4 A;  3NVY A;  1DGJ A;  3WCQ A;  2KMM A;  2WU5 B;  5C3J B;  2HTM E;  1GAQ B;  1JWA D;  3HUI A;  1GPX A;  1J7C A;  3AE7 B;  1DOI A;  4YTN B;  2Q5W D;  2PVG C;  1I7H A;  4YSY B;  2DWQ A;  1JWB D;  3AE2 B;  1NEK B;  1N5W A;  5GXG B;  3VR8 B;  2B76 B;  1ZOY B;  2WU2 B;  3B9J A;  1KFY B;  1QOB A;  2MJD A;  3HRD D;  5EE0 A;  1XLO A;  5MPO A;  2L52 A;  1QOG A;  2QIE B;  2MH7 A;  3HVZ A;  4C80 A;  3P4R B;  1FIQ A;  1KF6 B;  4N58 A;  2FBW B;  3AM9 A;  3NVV A;  3AEA B;  1TYG B;  3B2F A;  1T3Q A;  1N63 A;  3FAH A;  2K5P A;  1CJE A;  1E10 A;  4YSX B;  1V8C A;  4YXD B;  1N62 A;  2W3R A;  1L6V A; 
#chains in the Genus database with same CATH topology
 3AEG B;  3C0R B;  1V97 A;  4RGM A;  5T8I A;  3AMZ A;  4BOS C;  3P4S B;  4GSW A;  2L76 A;  2J52 A;  4LNK A;  2HJ8 A;  1R4M I;  2FAZ A;  2LHE A;  4OVZ A;  2K22 A;  1S3S G;  4RCO A;  1VLB A;  1SEB D;  4A90 A;  2KTF A;  3IG3 A;  1ZKH A;  4TKN A;  4XGA B;  4DDI D;  5HHD G;  4HJK A;  1UD7 A;  3WAM A;  2LVQ A;  2MP2 A;  2QHO A;  3B0A A;  4PS8 A;  4FHK A;  4XX5 A;  3T3N A;  3DWM A;  1TZ1 A;  1UNS A;  1P3Q U;  2ZZP B;  2NS5 A;  4NPN A;  2PEA A;  1XCQ L;  1JWS D;  1SF0 A;  1TKY A;  2HE7 A;  2ZNV C;  4HPP A;  5I4D A;  1QT9 A;  4RGO S;  3W2D A;  2LWP A;  3SFD B;  2Y5B B;  3QX1 A;  1E7P B;  2Y5C A;  4ARC A;  2CR5 A;  1WJN A;  1N60 A;  1H7W A;  3ZO5 B;  1WJ6 A;  2GLS A;  5IOI A;  1WXV A;  2ZJD A;  2LI5 A;  4BKS A;  4B9K A;  2LMC A;  4MM3 A;  4E71 A;  5DPR A;  2K39 A;  5L83 A;  1JWU D;  3BVG A;  1WGY A;  3ZRF A;  3ZXV A;  2R2Q A;  1HEZ E;  2DNF A;  4II2 B;  2RMM A;  3IFW B;  1C77 A;  4FUL A;  3SDL C;  2WXP A;  4UDU C;  2J0K A;  3ABV B;  1ZE3 D;  3WA0 A;  3R66 C;  3TJP A;  4HPL B;  2PE6 B;  2QC8 A;  4ITK A;  1CMX B;  2W3S A;  1XLN A;  2N9E B;  2YLM A;  3NRZ A;  3IHP C;  4Q2J A;  1WMH B;  2DZM A;  2DBY A;  1GC6 A;  3GE3 C;  5C1Z A;  1J0G A;  1FRD A;  2D3A A;  3NUH B;  4MGY E;  2IO0 B;  3AH7 A;  4W9C A;  4KVG B;  2REX A;  2M56 B;  4ZHP A;  1FNW A;  2N4F A;  4ZRI A;  2E6X A;  1VR9 A;  4HCP B;  1IGC A;  2ICI A;  1FXT B;  1UGJ A;  1PGA A;  2MBE A;  4OZC A;  2KTR B;  1HXY D;  2NTT A;  2KDF B;  2LD9 A;  3J9C A;  2OED A;  4W9H A;  3AU4 A;  2NTS A;  3OJ4 B;  3LXF A;  2KDB A;  4FN2 A;  1TY2 A;  3VR9 B;  3A4R A;  5AEK B;  4N6E B;  4WAA A;  2C5L C;  2FE8 A;  3Q14 C;  3V62 A;  3Q3J A;  2CJN A;  5EE1 A;  1G6J A;  1F9J A;  2PPH A;  4USA A;  4KKJ A;  4M0W B;  2JRH A;  2AQ1 B;  2G1E A;  4CYE A;  1IBX B;  2BWF A;  1LXD A;  3B1L X;  3ZGZ A;  1WM3 A;  3A9J A;  2SAK A;  3CSF A;  4AP4 C;  5AUK A;  1ZDX A;  4RMA A;  2OHF A;  1RLF A;  3AE5 B;  3L13 A;  2NR2 A;  2LGI A;  3AEF B;  1E5W A;  3GOE A;  1PGB A;  4NJC A;  2C60 A;  1UZX B;  3DVG X;  2WXJ A;  1JWB D;  2RDH A;  4D2K A;  3S2A A;  1WSP A;  3PLV A;  1VRA B;  4C80 A;  3BWU D;  1F52 A;  2KC1 A;  2D3B A;  1WGD A;  1T3Q A;  1WE7 A;  1CQV A;  1D5Z C;  2EMT A;  4EZL A;  1PUT A;  2NVU I;  2AEH A;  1GG3 A;  1KRH A;  2KJ6 A;  4MSQ B;  3RMK C;  3KVF B;  1ZXH A;  1TS3 A;  3I57 A;  2J53 A;  1PQS A;  1I4R A;  1MI0 A;  2LJ5 A;  2IGH A;  4FJY A;  1SE2 A;  1Q0W B;  4NZL B;  5AZH A;  2MBH A;  1FCL A;  2L3Z A;  3VUW A;  1D5X C;  5FKA C;  2KHW B;  1SE9 A;  1C78 A;  1FFV A;  4DWF A;  2LUM A;  4M8M A;  3NZU A;  1TGZ B;  3GZN I;  1SIF A;  3N9Y C;  3OG5 A;  3VRA B;  4YWG G;  3A4S C;  2BS4 B;  4JIO U;  1UWX A;  5JHA A;  2BKF A;  2YEP F;  2L32 A;  1FFU A;  3AE1 B;  1T5X D;  1ISN A;  1FNU A;  1L0Y B;  4OVV A;  3PSE B;  2K9X A;  2K1F A;  5D6J B;  1CK1 A;  2LGD A;  4K1R B;  3ZJT A;  5BYR A;  1F2R C;  3V6C B;  3QAR A;  1J7B A;  4YT0 B;  5EE3 A;  1FM0 D;  1NEN B;  2IY1 B;  3NZS A;  4IOI E;  1C4A A;  1NVI D;  3APC A;  1SGH A;  1QIL A;  1ROE A;  3SFE B;  5JZE B;  4C00 A;  4F8C B;  3CF4 A;  2MQJ A;  3WCQ A;  2WU5 B;  2J7Q B;  2DX5 B;  1QZE A;  3K9P B;  2RDB C;  3ZLZ A;  1ZOY B;  4HPM B;  3Q3N C;  1EU4 A;  1KLV A;  2L52 A;  3Q3F A;  1DYQ A;  5LNK 1;  2WXN A;  2K5P A;  1M4V A;  1WZ3 A;  1V8C A;  3PTF C;  4OZB A;  2ZEQ A;  1L4Z B;  2EMS A;  3GE8 C;  2ZNV B;  3W1S C;  5D3I B;  1YNT E;  3DVG Y;  4L2Y A;  1NI3 A;  2IBI B;  2QMT A;  4A3O A;  5CHF A;  1V5O A;  4MJS B;  3B2G A;  3K9O B;  2LZ6 A;  4W9E A;  3UIP B;  1XLQ A;  4DXA B;  3Q3M C;  3NS1 A;  1SB3 C;  3TUO A;  3UF8 A;  2CHX A;  3DPD A;  4R3D A;  3R8B A;  4ICU A;  2PVO D;  2HJ1 A;  3Q69 A;  5IAA C;  4XZ4 A;  2G45 B;  4NAW A;  3SU8 X;  4II3 B;  2OJW A;  4H2A A;  1KLG D;  1EUV B;  3DDC B;  4A9A A;  4IM0 A;  3W5V B;  3PV1 A;  1L5P A;  3ZDM C;  2ZCC A;  2MBO A;  3R7Q A;  1E8Z A;  5DCN A;  2UU7 A;  3AU5 A;  3BK2 A;  2ZVO A;  1RWS A;  4GMV A;  4MGK E;  2V9H A;  2JQR B;  2E3T A;  2Y3A A;  1EO6 A;  3GP7 A;  4M8N A;  3AEC B;  3B08 A;  3AE9 B;  3TIX A;  2AX5 A;  1WX9 A;  4P7I A;  1X1M A;  2LUE A;  2K6D B;  3PGE A;  4LNF A;  3A1Q B;  3H9D A;  1J7C A;  2INC C;  3M63 B;  3JW0 X;  3L10 B;  4YSY B;  4NQL B;  3A33 B;  4A55 A;  1QOB A;  1UEL A;  4KGR A;  4DHZ B;  2G3Q B;  3PS6 A;  1N62 A;  3SHQ A;  4RGT A;  1NBF C;  2GBR A;  2KDM A;  4NJ7 A;  2ASQ A;  2KQ7 A;  1WGK A;  2MW5 A;  1SIJ A;  3NG0 A;  1H7X A;  2MCN B;  1HTQ A;  2MBQ A;  3Q8C A;  3T3O A;  3QIJ A;  3BIN A;  2XEW A;  3AED B;  4WH4 A;  4WAF A;  4BBN F;  3L4P A;  1YQB A;  3KWV A;  1PGX A;  1VDV A;  4ZDV A;  2FUH B;  1N5X A;  4OVU A;  5D94 A;  4S0R A;  5IP4 D;  1F0Z A;  3BZD B;  1HTO A;  4YTP B;  2O2V A;  1RYJ A;  3QA8 A;  2DAF A;  2X8X X;  1FXA A;  1V81 A;  3BVM A;  2NBU A;  1I4H A;  2DZJ A;  3N3K B;  3ZQ4 A;  4QAY A;  1Q10 A;  2KVZ A;  1WF9 A;  3PZD A;  5TSS A;  3TMP B;  3LYY A;  2ACZ B;  4P1B C;  4WUR A;  5G55 A;  2OOB B;  4GOC A;  4NJ6 A;  2MHJ A;  3ZJV A;  1UBQ A;  1QF6 A;  4IWO A;  1E90 A;  1C79 A;  3RZW C;  2DYM A;  3ZVV A;  3PRZ A;  2AWT A;  1DGJ A;  1TS4 A;  2IND C;  1E7U A;  3HUI A;  1L4D B;  2VH1 A;  2PJH A;  1I7H A;  2JU6 X;  2J0J A;  3KLS X;  1WI0 A;  2WU2 B;  1KFY B;  2MJD A;  4GDK B;  3NZ3 A;  1KF6 B;  3N20 C;  4KDL B;  2AL3 A;  2JZP A;  3EGR A;  3P2B A;  5EDS A;  2A5U A;  4OW0 A;  4GU2 A;  3Q8B A;  3NOB A;  2JX5 A;  2KWC A;  1I35 A;  2D10 A;  1VZ8 A;  3RUI B;  1M94 A;  1H4R A;  2V1Y A;  2Z8L A;  3T9L A;  3VDZ A;  3I5J C;  4B0M A;  4FAD A;  1AWD A;  3HM6 X;  5JHB A;  5C23 A;  4KSK C;  1WXM A;  2QJL A;  3I3T B;  1AYF A;  1JRO A;  4NAM A;  2OJR A;  1FMA D;  3DVN U;  1H8C A;  4WQM A;  4HDO A;  3EHV A;  3RCZ A;  2WXH A;  1BT0 A;  4BZA A;  1V86 A;  3H7P B;  1GNU A;  2V4I B;  4KSL C;  4W9D A;  4KDI C;  2R61 A;  4DXF A;  1SXT A;  3RD2 A;  3PO0 A;  3ONS A;  1TIF A;  2IDY A;  3AEE B;  3RNC C;  2LGX A;  2BPS A;  1L6U A;  4LNO A;  2D3G A;  1D6E C;  5J2R A;  1UBI A;  2KN4 A;  1UGM A;  1P7E A;  1OQQ A;  1PYW D;  1L2N A;  1JWA D;  4A20 A;  2DHZ A;  3A9K B;  4YTN B;  1LO5 D;  5HFY A;  2HDE A;  3AUL A;  2RDG A;  2D2Q A;  1GJZ A;  1JWM D;  4EZK A;  3ALB A;  4ARI A;  3PRE A;  3AEA B;  4DDG D;  2PE9 A;  1E10 A;  4M02 A;  2FCM A;  4L1B A;  1P1A A;  2BB6 A;  4ANV A;  2V3P A;  1WJ4 A;  2LRU A;  2ZVN A;  2GOW A;  2IYD B;  4F7Z A;  1I42 A;  3M95 A;  4KIK B;  2K25 A;  2K8C A;  1JML A;  4IDI A;  2N0S B;  2O6V A;  4GIV A;  2M19 A;  1YQ4 B;  2JSV X;  1EWY C;  1P0R A;  1OEY A;  4W9I A;  2LEK A;  3ZDT A;  2MBB B;  4WJP A;  2I1K A;  4MT5 A;  3DOW A;  4HEA 1;  4GLS C;  3H6N A;  4MAC A;  3H1U A;  1NYQ A;  5GMV A;  1ENF A;  4PYU A;  4P16 A;  4HRS A;  1WY8 A;  1BXT A;  1C76 A;  1EM7 A;  3BII D;  3DCG A;  2KFJ A;  1F77 A;  2G4D B;  2MEK A;  1YN4 A;  2M17 A;  4FJV B;  3N1Y C;  2W54 A;  3O65 B;  3AE6 B;  2XK5 A;  1HZ5 A;  2KAJ A;  4W9F A;  2EKI A;  3P1M A;  2KVR A;  4F1S A;  2GBK A;  4TMA B;  3KW5 B;  1FRR A;  4DK5 A;  4JLC A;  3GS2 A;  3Q2A C;  3QC8 B;  2DEN B;  2WP9 B;  3Q8F A;  4M01 A;  3ETR A;  2GI9 A;  1A5R A;  4IG7 B;  1WGH A;  2KFK B;  1N5W A;  1FCC C;  4LJO B;  2RPQ A;  4IKG A;  3U52 E;  2JXT A;  4B95 A;  4I6N B;  4CHK A;  2LGY A;  4PYZ A;  5IKC M;  4MGI E;  1C1Y B;  2CJO A;  1MJD A;  2JUO A;  3Q8E A;  4WJN A;  4XDC A;  1RRB A;  2NPT B;  3HM3 A;  5LLI A;  2WXK A;  1D3Z A;  2FNJ B;  2MJE A;  5G2N A;  4OHJ A;  5JH5 C;  1FNV A;  2I1J A;  4C4V A;  2JYT A;  3MFG A;  3IAS 1;  4RF0 A;  4NQK E;  2PKO A;  3VHT C;  3RYT A;  3ZNZ B;  2GRI A;  1WRD B;  3WAO A;  4LCD E;  3VTV A;  1C9F A;  3RPF C;  1IUE A;  1C3T A;  3MC9 A;  4EE2 A;  2WXQ A;  4MDK E;  2BYT A;  1JW9 D;  1B1Z A;  4YTM B;  2K8H A;  2RGF A;  3FIL A;  1NYR A;  3CST A;  3LB8 C;  4DBG A;  2V0G A;  2KNB A;  5E6J A;  4GN1 A;  5CTR C;  2KOX A;  2PLP A;  4LJP B;  4LNI A;  4BBN C;  4XYC A;  2KD0 A;  3T8M A;  1WRI A;  4A3P A;  1C4P A;  3ZKJ C;  3VTU A;  1I4P A;  3MC0 B;  1WJU A;  1DOI A;  2Q5W D;  3DBR B;  2C9W B;  4I6P A;  1TS2 A;  1GB4 A;  1K52 A;  3HVD A;  4IM2 A;  2QSD A;  5FR3 A;  1P98 A;  1GB1 A;  3P42 A;  2LXA A;  2W3R A;  5LXH A;  3DBL B;  4OZA A;  4ZOH C;  1QOA A;  1P7F A;  1ZXI A;  1UF0 A;  3R3M A;  4G11 A;  5CHV C;  1AW7 A;  1E0Z A;  2KQS A;  1ET9 A;  1E8Y A;  3TEX A;  4TQ1 A;  2K3U A;  4LLG M;  2MP2 B;  1ACC A;  5BMH A;  4DXG A;  1ESF A;  1HA5 A;  3IVF A;  1K50 A;  1LM8 B;  4XE0 A;  4C56 C;  2W9N A;  2FCS A;  2KMA A;  1WM2 A;  3ZJU A;  1BUI C;  4E3C A;  2PW9 A;  3JVZ X;  2BT6 A;  2DAJ A;  2N9K A;  4BAX A;  1FEH A;  5BYQ A;  3RNG C;  1JQ4 A;  3RNE C;  1B9R A;  4ACF A;  1PDX A;  1TT5 B;  2NCN A;  3VTW A;  4DQO C;  2B3A A;  4W9J A;  1IGD A;  2RR9 A;  2YEP B;  2LRW A;  3P4Q B;  2PIA A;  3AI5 A;  3IXS A;  5G5G A;  4CQN A;  4LK0 M;  1WXA A;  1L0V B;  4NNJ B;  2JYE A;  1D4B A;  1QLB B;  1YMH E;  2QCZ A;  2W82 A;  2LFI A;  2WHI A;  4RM9 A;  2JZZ A;  1OEY J;  3VXW A;  4MM3 B;  3ZYY X;  4RGN A;  1XLP A;  5DPS A;  4L23 A;  4A6Q A;  4MH0 E;  4S17 A;  2KO3 A;  4JQW C;  3QHT A;  3ZTC A;  5BYS A;  1K53 A;  3DWG C;  3I63 C;  2CU1 A;  1EF5 A;  4MEL A;  2LVO A;  2NMQ A;  2INP E;  2BYV E;  1YD8 U;  2LHD A;  3SD5 A;  3A9K A;  1YN3 A;  5J18 A;  4K7W A;  2L8J A;  4WJO A;  5AZF A;  3RZF A;  2M8S A;  2KYW A;  4BKT A;  3NVV A;  4AQ7 A;  3MJ5 A;  3ZW3 A;  1OTR B;  3PRP B;  3VUX A;  1I4Q A;  2M0A A;  1ZGU B;  4XDD A;  3QQ8 B;  2BYF A;  3C19 A;  1WX8 A;  2KQ4 X;  1RM6 C;  3RUL A;  2VH2 A;  3ZTD A;  3C8Y A;  4EOY A;  5FR6 A;  2TSS A;  1XT9 B;  5BMI A;  5JXV A;  4JGH B;  3QK0 A;  4IW0 A;  4J3O D;  3APD A;  1D5M C;  2EKE C;  2IY0 B;  1WMH A;  3RT3 B;  2KAC A;  2KAN A;  2XBB C;  1YOV B;  2JWU A;  3KYC D;  3IT6 B;  2KLC A;  3RNF C;  1LGR A;  4TV3 A;  4ANW A;  1GTH A;  1SBB B;  3A9J B;  2LGS A;  1JAL A;  1RFK A;  3R2T A;  4IC7 B;  4REZ A;  2LVP A;  4EZJ A;  4CO7 A;  2IO1 B;  2KTR A;  2BWE S;  2MSE D;  2KK8 A;  5BO4 B;  4NY0 A;  3VVW B;  3Q3O C;  1WXQ A;  1ET6 A;  4W9L A;  3UI3 A;  2WDV B;  2WXM A;  3EC8 A;  4HVB A;  3V60 A;  1KOT A;  4FA6 A;  1WFY A;  1FPY A;  4PT5 A;  3VH4 B;  1GT8 A;  3DBS A;  2WX1 A;  1K51 A;  1NI2 A;  2KFK A;  4M0W A;  4K81 A;  3NVY A;  1MPE A;  2ZPY A;  5D2M B;  2D07 B;  2GMI C;  3CMM B;  2KXJ A;  1IBX A;  2BTE A;  2DWQ A;  4MEM A;  4HKZ E;  3RNA C;  2NBV B;  4HJG E;  4HXD A;  3B9J A;  4WJQ A;  4ASW C;  5IO9 A;  2V3S A;  2LJI A;  1T0S C;  2R2O A;  2KDE B;  2KT7 A;  4RF1 A;  2BW2 A;  1AAR A;  4BKS D;  1N61 A;  1WR1 A;  3MP9 A;  4WWP A;  3PT2 B;  2NPT A;  1MHX A;  4WIP A;  2WXL A;  1JRP A;  2L0T A;  2KX3 A;  1SE3 A;  4US9 A;  2LAS A;  2BQQ A;  1GC7 A;  4N9F 4;  4ANX A;  3DBR I;  1E8W A;  4WQO B;  1MVK A;  4GB9 A;  1VZ7 A;  1E9M A;  4PS3 A;  4FXC A;  3L0W B;  3AXC A;  4IM3 A;  1VD2 A;  1ZPS A;  1TZO A;  3AB5 A;  1E7V A;  3PHW B;  3R7R A;  1EWC A;  3AE3 B;  1MHH E;  3UQB A;  4IWP A;  3VUY A;  2BGF A;  2WGS A;  2RPV A;  3NVW A;  3EUB 2;  3RFZ B;  2KLG A;  4ZRP A;  5C2T B;  3DHI C;  2KN5 A;  2L7R A;  2CKH B;  3ZNG C;  1QKZ A;  3NVZ A;  1YX5 B;  3U4E G;  1SJH D;  5C3J B;  4GDL B;  2J0M A;  4TSS A;  2JT4 B;  4PK1 A;  1I4G A;  2KZR A;  5MPO A;  3HVZ A;  2MH7 A;  3KQ4 A;  3N32 A;  1AN8 A;  2HD5 B;  2L05 A;  3N30 A;  3ZIM A;  3EFU A;  3QCA A;  2IZV B;  2WXI A;  4LDT D;  1T0Y A;  1WGG A;  3W9C B;  2C7M B;  4I6L B;  1GUA B;  3DBH B;  2BS2 B;  4HDQ A;  2L00 B;  3L08 A;  1YJJ A;  2FCN A;  3VFK A;  1ZP0 B;  3LJ3 A;  4NAW B;  2WDQ B;  2L0F A;  2Z0D B;  2JF5 A;  3EEC A;  5AUI A;  2N1W A;  4W9K A;  4KGS A;  2FUG 1;  2IGD A;  3WAL A;  4EUT A;  1WE6 A;  1XEE A;  1CZP A;  4MJS A;  2BKR B;  3IBE A;  4AJW A;  1R7S A;  2DYB A;  2GBN A;  2Z0E B;  3DVN V;  1OFF A;  1Q5W B;  2BYE A;  2N9P C;  3D32 A;  4BVU C;  3TL5 A;  4HRO A;  4KX6 B;  4FLH A;  1QOF A;  3HHM A;  1TS5 A;  4HKQ A;  2N9X A;  1XF5 L;  5HI1 A;  3TSS A;  1K8R B;  1Z5S B;  4HK2 A;  3H7S A;  4RFB A;  1YX6 B;  3ML9 A;  5CHW A;  1F1H A;  2VZK D;  2RD0 A;  2WXG A;  1QQR A;  3UGB B;  1R4N B;  1VZ6 A;  3X0W A;  1SSN A;  1WYG A;  1T0R C;  2BB5 A;  2KWD A;  2FCQ A;  5H92 C;  5CX3 A;  2KMM A;  2HTM E;  1GAQ B;  1XXG A;  1GPX A;  1S1Q B;  2JY6 A;  1L0X B;  1NEK B;  1IYF A;  4P1C C;  4BKG A;  4DHJ D;  2KJR A;  1V9J A;  4EFO A;  3BYY B;  3GB1 A;  2KWV B;  1UUP A;  4AUQ C;  4LNN A;  4YSX B;  3A1Q A;  1V6E A;  2BVC A;  1YQ3 B;  4KZC A;  1UWM A;  2GB1 A;  1KTK A;  3ML8 A;  2XN9 C;  3URY A;  1FO4 A;  3U30 A;  3JSV B;  2WWZ A;  4XC2 A;  2C7H A;  2ZW0 A;  3W5U B;  3CWI A;  1V2Y A;  1FXI A;  5IN7 A;  2O2V B;  2CHW A;  2BBC A;  1HE8 A;  1Y56 A;  3E9S A;  1FD6 A;  4JWS C;  2D5G A;  2KMC A;  2UWQ A;  2X38 A;  3PZ7 A;  2MRP A;  3AE8 B;  4B6W A;  4A8X C;  3AE4 B;  4C7Z A;  3O13 A;  3P4P B;  3E56 A;  2JZ3 B;  4FJZ A;  2WLB A;  1YN5 A;  4B0E A;  5G5H A;  3SR6 A;  2K8B A;  2ONQ A;  1V1P B;  2WQY B;  1N6Z A;  3QWZ B;  2V4L A;  1WR6 E;  3PRM B;  1OQY A;  2MLB A;  3U2S C;  4G50 A;  4E74 A;  1GTE A;  1IPG A;  3UIO B;  2HTH A;  4BFR A;  1L7Y A;  1RFA A;  2YVC A;  4XWT A;  2M4N A;  3QJZ A;  1F2R I;  1U4A A;  2DLB A;  3QAQ A;  2IPK D;  3L16 A;  3ECI A;  4FBJ B;  3APF A;  4MH8 A;  4XWW A;  1XD3 B;  3PZ8 A;  2WXF A;  5GXG B;  2B76 B;  2AL6 A;  2IGG A;  2NBW B;  4IWQ A;  5TR5 A;  5J17 A;  2FBW B;  5L95 C;  2GBJ A;  3FAH A;  3B2F A;  3DHG C;  5E6O A;  4YXD B;  1MG4 A;  3UQA A;  5DPW A;  4ZHO A;  1J8C A;  4C7Y A;  5E6N A;  1I4X A;  5D7G A;  4JWU C;  2INN E;  4US8 A;  5BMG A;  2H89 B;  4GDK A;  4IUM B;  2WX0 A;  1V80 A;  1E8X A;  2Y5P A;  1ZDV A;  2N9L A;  3AEB B;  1LFD A;  3CF6 E;  3U8Z A;  1ZW7 A;  3HIZ A;  4JE3 B;  2D11 A;  3MC8 A;  3OLM D;  3RN9 C;  4HCN B;  4K3C A;  3ZUN A;  4RH6 A;  4G3X B;  4ZYS A;  3ZRC A;  4P6V F;  5HKH A;  3TCA A;  1XCT L;  2KDI A;  5E6P A;  2LXC A;  1C4C A;  2G9H D;  5D3D A;  2FID A;  1J7A A;  2QEJ C;  2BS3 B;  3DBH I;  3PHX B;  3NY5 A;  2AQ3 B;  3N1X C;  2JPH A;  1TJE A;  4N59 A;  1IP9 A;  1YJI A;  3Q6B A;  3H7P A;  2WS3 B;  4YSZ B;  3L54 A;  1XO3 A;  1WWT A;  1TY0 A;  2JVC A;  4K3B A;  3OAW A;  2PTL A;  3HK0 A;  1V5T A;  2IO3 B;  3BY4 B;  1E6E B;  3AN1 A;  4WWO A;  5EE9 A;  3P63 A;  4GDL A;  2FIF A;  1WYW B;  3M3J A;  3W1S A;  1R4M B;  4AWJ A;  3FKY A;  4TQ0 A;  2QDF A;  2ZPN A;  2ZCB A;  1JRU A;  3WIM A;  1GOZ A;  1RAX A;  3RI7 C;  4K7S A;  5EE0 A;  1QOG A;  1TYG B;  2N7E A;  4EKU A;  1N63 A;  3WAN A;  2MX2 A;  1L6V A;  3KUC B;  3PLU A;  2DYO A;  1Z2M A;  2O6V B;  2SEB D;  2KJH B;  3U7D A;  3ZNI D;  3ZNH B;  4W9G A;  1R4N I;  2G4S A;  4ZYN A;  4GXB A;  1KM7 A;  1DOY A;  4ZRJ A;  4M00 A;  2IJ0 A;  3ENE A;  3FC4 A;  3IAM 1;  2QIL A;  2A4Z A;  3AV8 A;  1UH6 A;  2CHZ A;  3BYT B;  3NHE B;  2JWZ A;  3VRB B;  3LDZ E;  1ZUD 2;  2WNM A;  3EFC A;  3X23 A;  1JCK B;  4AJY B;  3RNB C;  2N7J A;  4KKI A;  5IA7 A;  3DQV A;  3W1Y A;  4AOF A;  2I2Y A;  1WZ0 A;  2WXO A;  2MJ3 A;  2KKC A;  4TUU A;  4KIK A;  2JRI B;  1J19 A;  1KLU D;  4BOZ B;  2CU3 A;  2WYQ A;  3NJT A;  2KX0 A;  4JPS A;  2XK5 B;  1DOX A;  2JXX A;  2H88 B;  4WWM A;  4ANU A;  2L1A A;  4X57 B;  4KZ0 A;  1TBE A;  3SEB A;  3KYD D;  4J6I A;  1T6B X;  3OJ3 A;  3KUD B;  4JX1 C;  3TEZ A;  2WXR A;  3M62 B;  1OQR A;  3KWL A;  2J42 A;  3WAP A;  4JL9 A;  1V1O A;  5KHO A;  2VRR B;  4K7U A;  2K0P A;  2UYZ B;  4LTU A;  2K6Q A;  2EEL A;  1PFD A;  4O1N A;  3VQI A;  2IO2 B;  3JYU A;  4HWI B;  4RM8 A;  2PVG C;  4LDT B;  3TEW A;  2I38 A;  4G0N B;  3BVZ A;  3Q8A A;  3P4R B;  1FIQ A;  1YIW A;  4N58 A;  2ON8 A;  1V49 A;  1P9D U;  1YJ1 A;  4KGT A;  2Z59 B;  2AYO B;  2CS4 A;  3JSV A;  4FHJ A;  1TTN A;  1VCB A;  4AS1 A;  4C4V B;  3TEY A;  3TBL D;  3U7Z A;  1A70 A;  2N1V A;  3IT4 B;  3OWE B;  3BK1 A;  4PS7 A;  4EEW A;  1STE A;  2XNA C;  2MWS B;  2L83 A;  2GBM A;  2KWU B;  5DPT A;  1TKG A;  4MGZ E;  1Q1O A;  1BML C;  2MA9 B;  3L17 A;  1EU3 A;  3UIN B;  1EF1 A;  3EA6 A;  4RNA A;  4YL8 A;  1TKE A;  3ZXR A;  1HZ6 A;  2WDT B;  2V3N A;  4DHZ E;  5H8Y E;  5FK9 C;  1WH3 A;  3FIL B;  1WXS A;  2PMV A;  2M0X A;  3MHS D;  1V1P A;  1NDD A;  4WWN A;  2O6V D;  2VZK B;  3H8H A;  4ICV A;  4ZRQ A;  3VAW A;  1OGW A;  1WX7 A;  2BF8 B;  3CIR B;  1LQB A;  2DZI A;  1MG8 A;  2AQ2 B;  3PVL A;  2W55 A;  3DHH C;  2C7N B;  3VH3 B;  3DBL I;  1VJK A;  1T0Q C;  4ZRK A;  3PPA A;  3NS8 A;  2WDR B;  3V3X A;  5HG2 A;  3MJW A;  1HQR D;  4DHJ B;  3V61 A;  1Y8R C;  5AZG A;  2M1M A;  4HLE A;  3MTN B;  2ZW1 A;  3V6E B;  1WGR A;  4GGQ A;  3V05 A;  3R2I A;  2DZK A;  2KC2 A;  3KUZ A;  1WIA A;  3AE7 B;  2J4X A;  4URK A;  3AE2 B;  1KJT A;  4MSM B;  1MFW A;  3KH0 A;  3VR8 B;  5KHQ A;  2RSU A;  3HRD D;  2QIE B;  5LXI B;  1SJE D;  3I9V 1;  3GZN B;  1SE4 A;  3AM9 A;  4KV2 A;  2N7D A;  1XQQ A;  1CJE A;  2D3C A;  3N1Z C;  3MHZ A;  1XLO A;  1KH0 A; 
#chains in the Genus database with same CATH homology
 4OZA A;  4ZOH C;  4RGT A;  1QOA A;  1P7F A;  1YQ3 B;  3AEG B;  1ZXI A;  2KDM A;  1V97 A;  1AW7 A;  4RGM A;  1UWM A;  2GB1 A;  1KTK A;  5T8I A;  2XN9 C;  3URY A;  1FO4 A;  1ET9 A;  3TEX A;  1WGK A;  4TQ1 A;  3AMZ A;  1SIJ A;  3P4S B;  2K3U A;  4LLG M;  1H7X A;  2ZW0 A;  3W5U B;  2J52 A;  3Q8C A;  1ACC A;  5BMH A;  3T3O A;  3CWI A;  2LHE A;  4OVZ A;  4DXG A;  1FXI A;  1ESF A;  2K22 A;  4RCO A;  1HA5 A;  1VLB A;  1K50 A;  3AED B;  1SEB D;  2BBC A;  4WH4 A;  4XE0 A;  4WAF A;  4C56 C;  3L4P A;  3ZJU A;  1BUI C;  4A90 A;  1Y56 A;  3KWV A;  1PGX A;  3E9S A;  1VDV A;  2PW9 A;  1FD6 A;  1N5X A;  2BT6 A;  4JWS C;  2N9K A;  5HHD G;  2D5G A;  1FEH A;  5BYQ A;  2X38 A;  3PZ7 A;  1F0Z A;  3T3N A;  3BZD B;  1JQ4 A;  3AE8 B;  3DWM A;  4YTP B;  1UNS A;  1RYJ A;  1B9R A;  1PDX A;  4A8X C;  3AE4 B;  4C7Z A;  3O13 A;  3P4P B;  1FXA A;  3E56 A;  3BVM A;  1XCQ L;  4DQO C;  1IGD A;  1I4H A;  1JWS D;  1SF0 A;  1TKY A;  2YEP B;  3P4Q B;  2WLB A;  1YN5 A;  5I4D A;  4B0E A;  2PIA A;  1QT9 A;  4RGO S;  5G5H A;  3W2D A;  3SR6 A;  3ZQ4 A;  1E0Z A;  3IXS A;  5G5G A;  1Q10 A;  2ONQ A;  4CQN A;  3SFD B;  1V1P B;  2WQY B;  4LK0 M;  1L0V B;  2JYE A;  1D4B A;  1E7P B;  2Y5C A;  1QLB B;  5TSS A;  1YMH E;  4ARC A;  2W82 A;  2LFI A;  3LYY A;  2ACZ B;  4MM3 B;  3ZYY X;  4RGN A;  1XLP A;  4WUR A;  1N60 A;  4L23 A;  3U2S C;  4A6Q A;  1H7W A;  1GTE A;  3ZJV A;  5BYS A;  1K53 A;  3DWG C;  1QF6 A;  1C79 A;  4XWT A;  2NMQ A;  2INP E;  2DYM A;  2LHD A;  1F2R I;  2LMC A;  1YN3 A;  1DGJ A;  1TS4 A;  2DLB A;  2IPK D;  3HUI A;  1L4D B;  4MH8 A;  1JWU D;  3BVG A;  4XWW A;  1I7H A;  2JU6 X;  3PZ8 A;  2WXF A;  3KLS X;  5GXG B;  2B76 B;  2WU2 B;  1KFY B;  2IGG A;  2MJD A;  4GDK B;  3NZ3 A;  1KF6 B;  1HEZ E;  2FBW B;  2RMM A;  3NVV A;  3FAH A;  4AQ7 A;  3B2F A;  3MJ5 A;  1C77 A;  1I4Q A;  2M0A A;  4YXD B;  2WXP A;  2JZP A;  4XDD A;  4UDU C;  3EGR A;  4ZHO A;  3ABV B;  1ZE3 D;  4OW0 A;  2KQ4 X;  1RM6 C;  4C7Y A;  1I4X A;  4ITK A;  5D7G A;  4JWU C;  2INN E;  2W3S A;  3Q8B A;  1XLN A;  3C8Y A;  4US8 A;  5BMG A;  2H89 B;  2JX5 A;  3NRZ A;  4Q2J A;  1VZ8 A;  2TSS A;  2DBY A;  5BMI A;  2Z8L A;  5JXV A;  2Y5P A;  1ZDV A;  1FRD A;  3NUH B;  4J3O D;  2N9L A;  3AEB B;  4B0M A;  3AH7 A;  1AWD A;  2M56 B;  4ZHP A;  1D5M C;  1FNW A;  4JE3 B;  2QJL A;  1AYF A;  2E6X A;  2KAC A;  1VR9 A;  1JRO A;  1IGC A;  4NAM A;  2ICI A;  1UGJ A;  1PGA A;  1FMA D;  2JWU A;  4OZC A;  4RH6 A;  4WQM A;  4ZYS A;  1HXY D;  2NTT A;  4P6V F;  3IT6 B;  1XCT L;  3J9C A;  2OED A;  2WXH A;  1C4C A;  2G9H D;  2NTS A;  5D3D A;  1GTH A;  1SBB B;  2V4I B;  3LXF A;  1J7A A;  2QEJ C;  2BS3 B;  1TY2 A;  3VR9 B;  1JAL A;  4N6E B;  1RFK A;  3R2T A;  4REZ A;  2AQ3 B;  2FE8 A;  1TJE A;  2R61 A;  2CJN A;  4DXF A;  4N59 A;  5EE1 A;  4USA A;  1YJI A;  4KKJ A;  1SXT A;  3PO0 A;  2AQ1 B;  1WXQ A;  1ET6 A;  2G1E A;  2WS3 B;  1IBX B;  4YSZ B;  2IDY A;  2WDV B;  3UI3 A;  2WXM A;  1XO3 A;  3ZGZ A;  3AEE B;  1TY0 A;  1WWT A;  2SAK A;  5AUK A;  1L6U A;  2PTL A;  1ZDX A;  1D6E C;  2OHF A;  3AE5 B;  1E6E B;  3AN1 A;  2KN4 A;  2LGI A;  3P63 A;  5EE9 A;  4PT5 A;  3AEF B;  1GT8 A;  1P7E A;  3W1S A;  1K51 A;  1OQQ A;  1PGB A;  4M0W A;  4NJC A;  3NVY A;  1PYW D;  1MPE A;  4TQ0 A;  1JWA D;  1IBX A;  2BTE A;  4YTN B;  1LO5 D;  5HFY A;  2WXJ A;  2DWQ A;  1JWB D;  2RDH A;  4HKZ E;  4D2K A;  2HDE A;  1GOZ A;  4HJG E;  1WSP A;  3B9J A;  2RDG A;  5EE0 A;  1VRA B;  1QOG A;  3BWU D;  4C80 A;  1JWM D;  4ARI A;  3AEA B;  1TYG B;  1T3Q A;  1N63 A;  1E10 A;  1CQV A;  2LJI A;  1L6V A;  1D5Z C;  1PUT A;  4RF1 A;  4L1B A;  2DYO A;  2BW2 A;  2SEB D;  2BB6 A;  1N61 A;  1KRH A;  3MP9 A;  2V3P A;  1DOY A;  1MHX A;  2IJ0 A;  3FC4 A;  1ZXH A;  1TS3 A;  3I57 A;  2J53 A;  2QIL A;  3IAM 1;  4WIP A;  1I4R A;  3AV8 A;  1MI0 A;  3BYT B;  2WXL A;  2IGH A;  3VRB B;  1JRP A;  1ZUD 2;  1JML A;  1SE3 A;  2WNM A;  1SE2 A;  1JCK B;  4IDI A;  4NZL B;  2N0S B;  2N7J A;  4KKI A;  4US9 A;  1FCL A;  2M19 A;  1YQ4 B;  2I2Y A;  2JSV X;  1EWY C;  1D5X C;  1MVK A;  2WXO A;  5FKA C;  2MJ3 A;  1VZ7 A;  1C78 A;  1FFV A;  2LUM A;  1E9M A;  2LEK A;  4MT5 A;  4HEA 1;  3N9Y C;  4GLS C;  4FXC A;  3VRA B;  1KLU D;  4YWG G;  2CU3 A;  2BS4 B;  4MAC A;  1NYQ A;  1ZPS A;  1TZO A;  4JPS A;  1UWX A;  1ENF A;  4P16 A;  4HRS A;  2YEP F;  3AB5 A;  1DOX A;  1BXT A;  2H88 B;  4WWM A;  2L32 A;  1C76 A;  1EM7 A;  2L1A A;  1FFU A;  3AE1 B;  3BII D;  1T5X D;  1F77 A;  1EWC A;  1FNU A;  3SEB A;  1L0Y B;  3AE3 B;  1MHH E;  2MEK A;  2K9X A;  1T6B X;  1YN4 A;  2W54 A;  4JX1 C;  1CK1 A;  3TEZ A;  3AE6 B;  2WXR A;  3ZJT A;  5BYR A;  1F2R C;  1HZ5 A;  2KAJ A;  2RPV A;  3NVW A;  2EKI A;  3EUB 2;  3RFZ B;  3P1M A;  1J7B A;  1OQR A;  4YT0 B;  4ZRP A;  5EE3 A;  1FM0 D;  3KWL A;  1NEN B;  5C2T B;  4IOI E;  2J42 A;  1C4A A;  1NVI D;  4TMA B;  1V1O A;  1FRR A;  1QIL A;  1ROE A;  2K0P A;  1QKZ A;  3SFE B;  3GS2 A;  4LTU A;  3NVZ A;  3U4E G;  2EEL A;  2WP9 B;  3Q8F A;  3ETR A;  1PFD A;  2GI9 A;  1SJH D;  3CF4 A;  4O1N A;  3VQI A;  3WCQ A;  2WU5 B;  5C3J B;  4GDL B;  4TSS A;  2PVG C;  3TEW A;  1N5W A;  2I38 A;  1I4G A;  1ZOY B;  1FCC C;  5MPO A;  3BVZ A;  3Q8A A;  1EU4 A;  1XLO A;  2L52 A;  3HVZ A;  4IKG A;  2MH7 A;  3P4R B;  1FIQ A;  4N58 A;  3U52 E;  1DYQ A;  5LNK 1;  2ON8 A;  3KQ4 A;  1AN8 A;  2WXN A;  2JXT A;  2K5P A;  1M4V A;  1V8C A;  4KGT A;  4OZB A;  1L4Z B;  5D3I B;  1YNT E;  4AS1 A;  2WXI A;  2CJO A;  3TEY A;  3W9C B;  3U7Z A;  3Q8E A;  1A70 A;  4L2Y A;  1NI3 A;  3IT4 B;  3OWE B;  2QMT A;  3BK1 A;  4XDC A;  2BS2 B;  1STE A;  1YJJ A;  3B2G A;  2XNA C;  2WXK A;  1ZP0 B;  2L83 A;  1XLQ A;  1TKG A;  2MJE A;  4NAW B;  1BML C;  4OHJ A;  2WDQ B;  1EU3 A;  1FNV A;  3NS1 A;  1SB3 C;  3TUO A;  5AUI A;  3EA6 A;  4R3D A;  3R8B A;  4RNA A;  4KGS A;  1TKE A;  2JYT A;  2FUG 1;  3MFG A;  3IAS 1;  2IGD A;  4RF0 A;  1HZ6 A;  2PVO D;  2V3N A;  3Q69 A;  5H8Y E;  1XEE A;  1CZP A;  5FK9 C;  2PKO A;  3FIL B;  1R7S A;  2GRI A;  2PMV A;  1OFF A;  1V1P A;  1C9F A;  4H2A A;  3RPF C;  1KLG D;  4HRO A;  4KX6 B;  2VZK B;  3H8H A;  1IUE A;  4ZRQ A;  4A9A A;  1QOF A;  3W5V B;  4EE2 A;  3CIR B;  2WXQ A;  1TS5 A;  1L5P A;  4HKQ A;  2BYT A;  1JW9 D;  1XF5 L;  1B1Z A;  4YTM B;  5HI1 A;  2AQ2 B;  3TSS A;  3FIL A;  2W55 A;  1NYR A;  3LB8 C;  3BK2 A;  4RFB A;  2V0G A;  5E6J A;  1VJK A;  1RWS A;  2VZK D;  2PLP A;  2WXG A;  2WDR B;  1QQR A;  2JQR B;  2E3T A;  3V3X A;  2Y3A A;  5HG2 A;  1VZ6 A;  1HQR D;  3GP7 A;  3AEC B;  1SSN A;  1WYG A;  3AE9 B;  1WRI A;  2AX5 A;  2BB5 A;  1C4P A;  2KWD A;  5H92 C;  2ZW1 A;  2KMM A;  1I4P A;  3MC0 B;  2HTM E;  1GAQ B;  1XXG A;  3V05 A;  3R2I A;  1GPX A;  1J7C A;  3AE7 B;  1DOI A;  1L0X B;  2Q5W D;  2J4X A;  4YSY B;  3AE2 B;  1NEK B;  3VR8 B;  1TS2 A;  4A55 A;  1QOB A;  3HRD D;  1GB4 A;  1K52 A;  2QIE B;  3BYY B;  3HVD A;  3GB1 A;  4KGR A;  1UUP A;  1SJE D;  3I9V 1;  2QSD A;  1SE4 A;  3AM9 A;  5FR3 A;  1CJE A;  1GB1 A;  4YSX B;  3P42 A;  3MHZ A;  1N62 A;  2W3R A;  1KH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...