1DOIA

2fe-2s ferredoxin from haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
PTVEYLNYEVVDDNGWDMYDDDVFGEASDMDLDDEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVLEGDIDMDMQQILSDEEVEDKNVRLTCIGSPDADEVKIVYNAKHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords 2FE-2S FERREDOXIN
publication title Insights into protein adaptation to a saturated salt environment from the crystal structure of a halophilic 2Fe-2S ferredoxin.
pubmed doi rcsb
total genus 36
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1996-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doiA00
4JWUC 1ZOYB 1QLBB 2WQYB 1J7AA 2LEKA 2MJEA 3ETRA 4WWMA 3AE7B 4C7YA 3AE8B 4C7ZA 4ZHPA 1JRPA 2L83A 1TYGB 1WRIA 3P63A 1V97A 3DWMA 1FRRA 1VJKA 2W3RA 1YQ4B 4KX6B 2BS3B 5H8YE 3RPFC 3AEFB 4US8A 1TKGA 3AH7A 3AEAB 4YSYB 3NVYA 5EE1A 4YSXB 1E6EB 4YXDB 2CU3A 1DOYA 1OQQA 1E9MA 3L4PA 3NVWA 2K9XA 3AE2B 3W9CB 2PIAA 2M19A 1FRDA 1KRHA 5G5HA 1L6UA 3B9JA 1NYRA 3VRAB 1UWMA 1WWTA 3CIRB 4LTUA 3SFEB 1N63A 3SR6A 2M56B 1JALA 1N61A 1GAQB 4N6EB 1XLQA 1JWBD 2FBWB 2Y5CA 3NVZA 2KAJA 2JX5A 2N0SB 3NVVA 3HVZA 3AV8A 3FAHA 1GPXA 3AEDB 2PVGC 3AE9B 2MJ3A 4N58A 1NI3A 3B2FA 4ZOHC 2WU5B 4US9A 4YTNB 5EE9A 1RM6C 2H89B 4C80A 1PDXA 2WS3B 3AECB 5G5GA 4YTMB 1DGJA 2CJNA 2H88B 3AEGB 2EKIA 2W55A 1N5XA 5C3JB 2W54A 2OHFA 1L5PA 2K22A 2BS2B 1FXAA 2HTME 4HRSA 3PO0A 3AN1A 1NENB 1E10A 1RFKA 4ITKA 1QF6A 3W5VB 3HRDD 1N60A 1ZP0B 2DWQA 1FM0D 1WXQA 1XO3A 1XLOA 1WYGA 1YJIA 3BIID 1RWSA 1XLNA 2E3TA 2WLBA 4N59A 1FFUA 1QOGA 2WDRB 4FXCA 1NVID 2WU2B 1TKYA 5AUKA 3EUB2 3P1MA 1OFFA 1DOXA 3AE1B 4JX1C 1YJJA 1KF6B 1XLPA 1YQ3B 4WQMA 3NRZA 3P4RB 1I7HA 1J7CA 1FXIA 3LXFA 1VLBA 3CWIA 3VR9B 3NS1A 5AUIA 2PVOD 3P4SB 1AYFA 2Q5WD 3AE5B 4JWSC 1F0ZA 3LB8C 3KWLA 1NYQA 1AWDA 1JQ4A 1VDVA 3DWGC 1QOAA 5EE3A 1E7PB 1WGKA 3W5UB 1ZXIA 1PFDA 3B2GA 2WP9B 1N62A 3AE6B 3P4PB 1JW9D 2MH7A 1L0VB 1N5WA 1V8CA 3AE3B 5MPOA 2BT6A 1FO4A 1E0ZA 2PKOA 1TJEA 1JROA 1QOFA 1CJEA 1R7SA 2K5PA 1FFVA 5H92C 2AX5A 1CZPA 1T3QA 3AE4B 3VR8B 3FC4A 2W3SA 1EWYC 1SB3C 5EE0A 3WCQA 1A70A 2ACZB 2WDQB 2KMMA 4USAA 3AB5A 1RYJA 3AEEB 3HUIA 2CJOA 2QIEB 1JWAD 1ROEA 1TKEA 1FMAD 3AMZA 4A9AA 1FIQA 3AM9A 3AEBB 4HROA 1J7BA 1SIJA 2B76B 2MJDA 1L6VA 5GXGB 1B9RA 3ZYYX 4YSZB 1NEKB 2WDVB 3P4QB 4ZHOA 2BS4B 1PUTA 1SF0A 1KFYB 1QT9A 4YTPB 2DBYA 3SFDB 3ABVB 4P6VF 5C2TB 1ZUD2 2L52A 2JQRB 1QOBA 4YT0B 1OQRA 3VRBB 1IUEA 2G1EA 4IDIA 1DOIA 2QJLA
chains in the Genus database with same CATH superfamily
1SE2A 2WQYB 4ZHPA 2LD9A 1TYGB 4RGNA 4EKUA 3IXSA 2Y3AA 2YLMA 2ZW0A 4XE0A 5LNK1 2HDEA 3TUOA 5IOIA 2PIAA 2FCMA 3B9JA 3MHZA 1N61A 3DBLB 1P9DU 3VH4B 5DPWA 4XGAB 3HVZA 2NVUI 2I1KA 3DVGX 2VZKD 4EUTA 2QILA 1WXSA 3U7ZA 5E6PA 3QA8A 3V6EB 3APCA 3N1YC 2HTME 3V62A 4S0RA 4OHJA 1FCCC 1WE6A 1RWSA 2IO3B 2JWZA 4HDQA 1QOGA 4FHJA 1YX5B 4NAMA 5DCNA 5AZHA 1OFFA 1MG4A 2L32A 1YJJA 2D10A 2MX2A 5D7GA 3VR9B 5AUIA 2RSUA 1UGJA 3ZJTA 4MT5A 1F0ZA 2G4DB 4KSLC 2Y5PA 1S1QB 4HDOA 1E7PB 1AN8A 2WP9B 1C1YB 2MH7A 1L0VB 2M4NA 3A4RA 3UIPB 3Q3FA 4K7SA 5EE0A 5TR5A 2WDQB 2HTHA 3AB5A 2NMQA 1JWAD 4ZYSA 2MSED 1ACCA 3AEBB 2RR9A 1FXTB 1R4MB 5J18A 3ECIA 4KGRA 1SF0A 3IVFA 4G0NB 3R2TA 4DHJD 2WXKA 2BYFA 3EFUA 3BK2A 1WM2A 3RUIB 3IG3A 4FJYA 4J6IA 3P63A 4DDID 2KLGA 4XYCA 4K7UA 3QCAA 1WMHB 1WGYA 3APFA 5EE1A 1RAXA 2Y5BB 4AUQC 5G5HA 3CIRB 1WF9A 3MFGA 4FADA 2L1AA 1XLQA 1FNVA 2KFKB 2RDGA 4BOSC 3U2SC 4GLSC 1L7YA 3TJPA 2KWCA 1UBIA 2LHDA 3AEGB 2O6VA 1WFYA 4XC2A 1QILA 2LASA 1RFKA 1ZP0B 1I35A 4BAXA 3BK1A 2NBWB 3URYA 3ZGZA 1JRUA 5BO4B 3PRMB 4FJVB 2GBJA 3IAM1 3AI5A 4IUMB 4GN1A 2VZKB 2PMVA 1GB4A 1HA5A 3PHWB 2KC2A 2L0FA 1PGXA 1UWXA 4IW0A 2OOBB 2PEAA 1CZPA 2I1JA 4DHZB 4K1RB 1U4AA 2KZRA 2N7JA 4KZ0A 1XCTL 2MJDA 3Q14C 5E6OA 1TIFA 4JPSA 3SFDB 2M0AA 3TEWA 4P6VF 3MHSD 1Q10A 2KACA 2GLSA 1EO6A 1DOIA 4C7YA 3UINB 3NZUA 2DHZA 1KH0A 2K6DB 2MBBB 3Q6BA 5I4DA 1I4XA 5TSSA 3KQ4A 2R2OA 5CHWA 1ESFA 2KMCA 4MGIE 3GOEA 3KLSX 2BGFA 4HKZE 4GMVA 2OEDA 5G55A 1JWBD 3TSSA 1IP9A 2JX5A 3NVVA 2C7HA 3VVWB 3AEDB 1TY2A 3DBHB 4I6PA 2BYTA 1C79A 1JMLA 4DHJB 3OAWA 1TTNA 1ENFA 1PDXA 3R8BA 3JSVB 4KSKC 2ICIA 1QQRA 3W1SA 2FAZA 1SGHA 2IY0B 1FM0D 4G11A 2J52A 1C3TA 1GC7A 3FILB 3AE1B 4K3BA 4HWIB 3AE5B 2MA9B 2QHOA 3RN9C 1V80A 1ZDXA 3N1ZC 1UZXB 1V8CA 3Q8EA 2PKOA 4NQLB 1TZOA 1C4PA 4DXAB 5CHVC 2LGIA 3VTUA 2L8JA 3SEBA 2DAFA 1PQSA 4KKJA 2MP2B 1LFDA 3PZDA 3MP9A 1UGMA 4D2KA 2X38A 4WJPA 1I4RA 3QC8B 3L0WB 4Q2JA 1RFAA 4DXGA 1XD3B 1FPYA 2K6QA 4NY0A 1QOBA 4HCPB 2OJWA 2J0KA 3ZQ4A 2K8HA 2JZPA 4M0WA 1UD7A 1ZOYB 2JZ3B 4A3PA 4WAFA 4GGQA 2IO1B 3QWZB 2I2YA 3U7DA 3RZFA 3R7RA 2LJIA 4FULA 2LUEA 4YSYB 2DENB 1GG3A 1N6ZA 1DOYA 4C4VA 2JT4B 3H7PA 3WAOA 2M19A 1FRDA 1UNSA 3AU4A 4KZCA 3SFEB 4AS1A 3WIMA 4A8XC 4B9KA 1EF5A 2BYVE 3MC9A 1Z2MA 2GRIA 3L08A 3B08A 2EKEC 5AEKB 5C3JB 1BXTA 4JL9A 2KOXA 1WXAA 1XEEA 5C23A 3D32A 3ENEA 4RGTA 3GB1A 4LLGM 3HRDD 2LMCA 2NBUA 2R2QA 1SIFA 3ZKJC 1XLNA 1FFUA 4MGYE 4BKSA 1YN5A 2KFKA 3X0WA 2OJRA 1XLPA 4REZA 1JWMD 2LGDA 2PVOD 2KWVB 1UBQA 2K1FA 4P7IA 3Q8CA 4ZRIA 2IGGA 3AE3B 2BT6A 1E0ZA 4IWPA 2GOWA 1YOVB 4HPLB 4IM0A 1TGZB 2ACZB 2YEPB 1V2YA 1ROEA 1VCBA 5T8IA 2Z0EB 2V4LA 2ZVNA 3L54A 5CTRC 1SE9A 1LXDA 1M94A 3NG0A 5C2TB 3TEYA 4TSSA 3EHVA 3VRBB 3ZIMA 4KV2A 1WJ4A 2K8CA 1OGWA 2LEKA 3ETRA 4C56C 4IKGA 1C77A 3AEFB 2SAKA 3A1QB 4WWPA 5D3DA 3A9KA 4PS8A 3W9CB 4ZRQA 4BOZB 1NYRA 3L10B 4LJPB 4W9GA 2LVQA 2Y5CA 3PRZA 4DQOC 2D5GA 1HXYD 1XXGA 3RI7C 2H88B 5J2RA 1WY8A 1AARA 1MVKA 1GB1A 1WGDA 4CQNA 4M01A 2CHWA 2LHEA 1E10A 2JU6X 5BYRA 1I4GA 2RD0A 2WLBA 1WSPA 3ZJUA 2BF8B 5AUKA 3NJTA 2J0JA 1BMLC 4P1BC 1P98A 1VDVA 3DWGC 3I63C 4KVGB 3P42A 4HLEA 1PFDA 3AU5A 5MPOA 1UELA 1KLGD 2AEHA 5BMHA 3FILA 4EFOA 2V1YA 1R4NI 1P7EA 2FNJB 2V3NA 4EZKA 2J7QB 2D3AA 1TS4A 3AMZA 2GMIC 1B9RA 2L3ZA 3ZYYX 2EMTA 1KFYB 1QT9A 2DYOA 1L0YB 3NOBA 5D2MB 4LNOA 2EMSA 1HQRD 1KLUD 3M63B 1SSNA 5CX3A 2MJEA 5D6JB 3PLUA 4HJGE 3RPFC 2MP2A 1IBXB 2RPVA 4NAWA 4NQKE 3J9CA 2DLBA 1QZEA 4BKSD 1GAQB 4KDIC 4RNAA 4NJ7A 2KDBA 3AV8A 2PVGC 2GBRA 1P0RA 3TIXA 4US9A 5JHAA 3HM6X 1VR9A 2K22A 3DBLI 2K25A 1E8YA 1MG8A 3ZNGC 5JZEB 1N60A 1LQBA 2HD5B 1A5RA 2RDBC 1TKYA 3P1MA 3Q3NC 4JX1C 2KDFB 2DZKA 2I38A 1GJZA 3ONSA 2Q5WD 3LB8C 3T9LA 2XN9C 3GE8C 4MGZE 4F1SA 3KWVA 3S2AA 4P16A 1ZKHA 4KKIA 4RMAA 1WRDB 4XZ4A 3QHTA 3AEEB 1MI0A 3HUIA 2IZVB 2ZCBA 1FIQA 1T6BX 4HROA 5CHFA 1F1HA 2WDVB 4LK0M 3P4QB 4B0EA 3N32A 2N9EB 4YTPB 4ANWA 3CF6E 2G1EA 4TV3A 1L4DB 2KFJA 1QLBB 4M0WB 3ALBA 3TBLD 4MELA 2KANA 1F52A 1R4MI 4DHZE 3BINA 1YNTE 3AEAB 1GUAB 2CU3A 5JHBA 1PGBA 2K3UA 3ZW3A 4C4VB 3H7PB 3VRAB 4W9IA 1L6UA 3UI3A 1JALA 1VZ7A 3E9SA 4ZRPA 3N1XC 3Q3MC 2M8SA 3VQIA 2IYDB 1ZDVA 4ZOHC 2LZ6A 3UF8A 3Q3OC 4FLHA 4TQ0A 4NZLB 2LXAA 4OVVA 2PW9A 4PYZA 3LJ3A 2BS2B 2LGYA 1VZ8A 2MBEA 3A1QA 4GOCA 2BB5A 1YX6B 3VUWA 1LM8B 4L23A 4IOIE 1PGAA 4C00A 3IFWB 1BUIC 4GSWA 2IY1B 2A5UA 2BWES 2QDFA 3N9YC 1YQ3B 4WQMA 2DZJA 3NUHB 3ZXRA 1MHXA 4WWOA 2UWQA 4LNNA 1OEYA 2KK8A 3RNGC 1WGRA 3GZNB 3DVNU 1LGRA 2FIFA 1ZXIA 2N7EA 1UUPA 3U52E 1E8ZA 1WX9A 3QARA 4EOYA 1JROA 2KO3A 5IN7A 1T3QA 3WAMA 2MQJA 2PTLA 2KJRA 3O65B 2QIEB 2KC1A 2KX0A 4OVZA 3BVZA 5BYSA 4B0MA 3C8YA 5BMIA 2N9LA 1D5ZC 3R3MA 2XK5A 2KDEB 1L4ZB 3KUZA 1UH6A 3RT3B 2DZIA 1OQYA 1IUEA 4BVUC 4B6WA 3E56A 2JPHA 4KGSA 3Q8FA 4XDDA 4GIVA 4TQ1A 3T3NA 2AQ2B 1FRRA 4G50A 2C5LC 4KX6B 1HTOA 1VRAB 4A90A 4NJCA 3A9KB 4C7ZA 1E7VA 4N6EB 2FBWB 2AL6A 4URKA 2FCQA 1GPXA 4N58A 3H8HA 4IWQA 1Z5SB 4C80A 1SE3A 3RD2A 4K3CA 3PTFC 3X23A 2KMAA 2OHFA 1L5PA 2PJHA 1WR1A 2INPE 4OZCA 1IBXA 2CHXA 3DBHI 2KTRA 2DWQA 3PS6A 2PE6B 4LJOB 4WIPA 2AL3A 4AQ7A 3BZDB 1X1MA 4TUUA 3IHPC 3EUB2 2UU7A 1V86A 2WXJA 4JE3B 1C76A 1TT5B 2M17A 1P3QU 2DAJA 3K9PB 3DHIC 4CO7A 3M95A 3N30A 2N9PC 2MEKA 1R7SA 3PHXB 4PT5A 2NPTA 5BYQA 4I6NB 4ZRKA 2V0GA 2NTTA 4M8NA 4NPNA 1NI2A 2ZPNA 2K39A 4KIKB 3HK0A 2WX0A 4BKTA 2RMMA 1C9FA 4MEMA 2ZPYA 1ET6A 2DBYA 1WJNA 3JVZX 4J3OD 4M00A 5KHOA 4RGMA 3AE8B 1MPEA 2ZJDA 4II2B 3B1LX 4TKNA 4AWJA 4W9HA 3KYDD 2KDMA 1WI0A 4NAWB 1OQQA 3NY5A 3L4PA 2LI5A 1WWTA 1QKZA 2M56B 3EC8A 1CK1A 4AJWA 1V9JA 3Q8AA 1T0YA 1FNWA 1YD8U 1J0GA 1GOZA 1EF1A 2JZZA 3AE9B 3DPDA 2J42A 3DVNV 3PZ8A 5EE9A 3Q3JA 1J8CA 4HKQA 3RNCC 2BYEA 3RFZB 1K50A 1KLVA 3N3KB 2N4FA 1I4QA 4PK1A 1K52A 1Q1OA 3V3XA 1T5XD 1HEZE 1JWUD 4DK5A 1VZ6A 4EE2A 1UF0A 1DOXA 2WNMA 4MH0E 3N20C 2QC8A 4AJYB 4ZDVA 3VTVA 1HE8A 4W9LA 3P4PB 1E8XA 4LNFA 3V60A 1CJEA 4FN2A 2IJ0A 2L76A 2D3GA 1V1PA 1SB3C 4ASWC 3UGBB 3U30A 2CJOA 3NZ3A 5JXVA 5J17A 3A33B 2KKCA 3ZUNA 3O13A 1D3ZA 2L05A 4E3CA 5IO9A 3TEZA 2INCC 1PUTA 3OJ3A 1KJTA 2NS5A 2SEBD 4W9DA 2DZMA 2PLPA 2LRWA 2CR5A 4L1BA 1E7UA 2GB1A 1TY0A 2B3AA 4KGTA 1NBFC 4OZAA 2WDTB 4BZAA 2BPSA 4H2AA 2K9XA 3AE2B 5L95C 1KRHA 3NS8A 4HK2A 2MW5A 1ZPSA 4M02A 2WXPA 3CSFA 4OVUA 4HJKA 2D07B 3L17A 4EZLA 2MJ3A 2O2VA 1YMHE 1S3SG 2W55A 1SE4A 3TEXA 2INDC 2LVOA 4HRSA 3W1SC 3AN1A 1WJUA 3KVFB 5LXHA 3JYUA 1XLOA 3BIID 3ML8A 1FD6A 2IPKD 2WDRB 4GB9A 2BWFA 3HIZA 2IDYA 3NS1A 1CQVA 1WX8A 4WJQA 4CYEA 1XT9B 2ZVOA 1V1OA 2BBCA 5HHDG 2PE9A 4MJSA 2ON8A 1MJDA 2KJHB 3VR8B 2W3SA 1EWYC 2IGHA 1WIAA 1Y8RC 1HTQA 4IG7B 1F9JA 3ZVVA 3QJZA 3UQAA 1L6VA 2KVRA 3B0AA 3U8ZA 2XK5B 3OLMD 5EDSA 2D11A 4X57B 2JXXA 1K51A 1T0QC 1WXMA 2G9HD 1K53A 2HE7A 3AE7B 3BYYB 3MJ5A 1WRIA 3VAWA 1VJKA 2GI9A 1CMXB 5L83A 4US8A 3AH7A 4KIKA 4WURA 4ANUA 2AYOB 3DHHC 3IBEA 1E8WA 2ZW1A 3OG5A 2G45B 3EECA 2WX1A 3NZSA 3WA0A 4WH4A 4BFRA 3Q2AC 1K8RB 5HFYA 1DYQA 2C60A 2CJNA 1SEBD 2EKIA 3I3TB 2VRRB 3H1UA 2WHIA 3ZLZA 1WM3A 4F7ZA 1SJED 1B1ZA 4WQOB 2KTRB 4B95A 3L16A 2KWUB 2E3TA 2WXNA 1JWSD 4LDTD 2N7DA 1KF6B 3P4RB 1I7HA 3IT6B 1HZ5A 3VUXA 5FK9C 2L7RA 1I42A 2WXLA 1H4RA 3P2BA 4ZYNA 1EU3A 4W9CA 4RFBA 4WJNA 1HZ6A 3PLVA 3RNFC 1YIWA 2AX5A 3Q69A 2BQQA 2NPTB 2IBIB 3AE4B 3DBRB 3BWUD 1SXTA 2K8BA 4EEWA 2LRUA 2JRHA 2JF5A 2NBVB 4LNIA 2KN5A 1TS2A 5DPRA 1SIJA 4AOFA 3IAS1 4A3OA 4ZHOA 4XWWA 2LFIA 2JQRB 1YJ1A 4WAAA 2ONQA 1OEYJ 2KN4A 2LGXA 4WWNA 4A6QA 2W3RA 3TL5A 2KX3A 3A9JA 1FEHA 1F2RC 5E6JA 1EU4A 2NCNA 4MSQB 2MRPA 2HJ8A 3Q8BA 4S17A 2PPHA 4M8MA 3VH3B 1FCLA 3MC8A 2MBHA 3CMMB 4PYUA 4ACFA 2H89B 2WS3B 5G5GA 4YTMB 2GBNA 4K7WA 2D3BA 2FIDA 3I57A 1C4CA 2JUOA 4YL8A 1V6EA 3EA6A 1I4PA 5HI1A 1G6JA 1KTKA 4O1NA 2Z0DB 1I4HA 1YQBA 1NVID 2KXJA 1ZXHA 2DYBA 4HXDA 2DYMA 3PV1A 1V81A 1IYFA 3PREA 4K81A 2RPQA 3M62B 2LVPA 1QOAA 5EE3A 1KM7A 2WXGA 5D94A 3APDA 1N62A 2WGSA 1JW9D 3VFKA 4FHKA 2MHJA 1C78A 4JQWC 3VXWA 4OW0A 1FFVA 3DDCB 3KYCD 4OZBA 2L00B 3FC4A 1M4VA 3GZNI 4G3XB 1V1PB 3WCQA 1A70A 3H9DA 4MACA 2YVCA 4ICVA 4DDGD 4LDTB 2VH2A 3RCZA 3AM9A 1C4AA 1E5WA 2RDHA 2C7MB 4RM9A 1NEKB 4BKGA 1V5TA 4I6LB 4RCOA 2QMTA 5GMVA 3SU8X 1JCKB 4MSMB 2ZNVB 3ZNID 2ZZPB 3DHGC 3GS2A 1JRPA 2J0MA 2L83A 4GDKA 1Q5WB 2RGFA 3H6NA 4XWTA 1FNUA 5H8YE 1V49A 2KT7A 2NTSA 2D3CA 3NVYA 1E6EB 3RZWC 1WH3A 1ISNA 3NVWA 1F77A 5E6NA 4FA6A 4N9F4 4IWOA 2ZEQA 3MC0B 1XCQL 1IGCA 1XF5L 4UDUC 3K9OB 2WXIA 2BKRB 3VHTC 2N0SB 4HPPA 2WXQA 3GP7A 4YTNB 1H8CA 2O2VB 1F2RI 2C7NB 3U4EG 3KW5B 2W54A 2TSSA 4GXBA 4JIOU 1FXAA 3PO0A 4MM3A 2JWUA 1QF6A 3FKYA 3ZNHB 5AZFA 1WYGA 3DBSA 3KH0A 2MBQA 2X8XX 4N59A 2JVCA 2DNFA 3V05A 3VDZA 1VD2A 5IP4D 2XEWA 1FXIA 3CWIA 4XDCA 2BKFA 1NYQA 2KDIA 4HPMB 2CU1A 1T0RC 1ZGUB 2W82A 3AE6B 3QQ8B 1WE7A 1N5WA 2EELA 2R61A 3ZXVA 1D5XC 1QOFA 1TJEA 3EGRA 3RMKC 4MJSB 3SHQA 4F8CB 3ZDMC 1WXVA 3PT2B 3ZNZB 2INNE 3QK0A 2GBKA 4RM8A 1XQQA 3RNAC 4DWFA 2A4ZA 3V61A 4IC7B 2QCZA 2KWDA 5GXGB 1TZ1A 3MTNB 4TMAB 2JRIB 2KTFA 4YWGG 3OWEB 1J19A 1YN3A 2KJ6A 1D6EC 4HVBA 2QJLA 5KHQA 4JWUC 4LNKA 1Y56A 4ARIA 4A55A 3R7QA 4HEA1 2CKHB 1P7FA 2CS4A 3AULA 4MH8A 5IA7A 2FCNA 3WANA 2Z59B 5IKCM 1E9MA 2HJ1A 1WZ0A 1D4BA 2WXMA 3TMPB 1ET9A 4LTUA 1N63A 2JXTA 2V3SA 4JGHB 5D3IB 3W1YA 2KAJA 4E74A 4QAYA 5DPSA 5HG2A 3RYTA 1NI3A 3B2FA 3AECB 2WXFA 2V3PA 1BT0A 2AWTA 3IT4B 2MWSB 4ITKA 3DVGY 1WJ6A 4R3DA 1AW7A 4W9FA 4GDLB 5FR6A 3QX1A 4FXCA 4A20A 1WR6E 4ARCA 2WU2B 4BBNC 4RF1A 3ML9A 1J7CA 3LXFA 2KHWB 3P4SB 4NJ6A 2W9NA 1AWDA 4PS3A 1GNUA 4E71A 2KVZA 2ZCCA 3HM3A 3B2GA 3SD5A 3RNEC 3PSEB 3BVGA 3I5JC 2IO2B 4II3B 3ZDTA 1L0XB 2O6VD 4USAA 2N9KA 1RYJA 1TBEA 4AP4C 1TKEA 2LUMA 3A4SC 3LYYA 2GBMA 4YSZB 5FR3A 4DBGA 2BS4B 3BY4B 1WYWB 2LJ5A 1Q0WB 2L52A 4YT0B 1OQRA 4IDIA 2AQ1B 2K0PA 3PRPB 4ICUA 3AXCA 1E90A 3DCGA 4NNJB 3ZTCA 1V97A 3RNBC 2UYZB 2LXCA 2BS3B 1WMHA 2QSDA 2BW2A 1WZ3A 1TKGA 3A9JB 4YSXB 4YXDB 3QIJA 4RGOS 2MCNB 3CSTA 2BTEA 4ANXA 1UWMA 1P1AA 3SR6A 3R66C 2REXA 3NVZA 4GU2A 2IO0B 2WU5B 4W9KA 4PS7A 1RM6C 3SDLC 1N5XA 1ZW7A 1SJHD 2KQ4X 3C0RB 2LGSA 2AQ3B 2KLCA 5DPTA 1NENB 1YN4A 4FJZA 2JSVX 1LO5D 2N1VA 1EM7A 2BVCA 5JH5C 2FUHB 1XO3A 3C19A 3PPAA 1MHHE 3VUYA 3HHMA 3ZRCA 5LXIB 3BYTB 3NRZA 1VLBA 4FBJB 1AYFA 3KWLA 1JQ4A 3NHEB 3HVDA 2V9HA 1WX7A 1L2NA 3DOWA 2L0TA 2N9XA 3ZO5B 3H7SA 4RF0A 3I9V1 2BB6A 5IAAC 2KQSA 4IM3A 1KOTA 1FMAD 1RLFA 3UIOB 3T8MA 3V6CB 2FUG1 4W9JA 1GC6A 4KDLB 2WXRA 2KQ7A 3ABVB 1NDDA 3KUDB 1TS5A 4XX5A 3KUCB 3QAQA 1IGDA 3M3JA 3ZTDA 3VTWA 2M1MA 3W2DA 1J7AA 3PZ7A 4WWMA 2LWPA 2QEJC 5HKHA 4GDKB 3DWMA 2O6VB 2M0XA 1YQ4B 4L2YA 4IM2A 4DXFA 3BVMA 2KD0A 2JYEA 2E6XA 1WGHA 2WXOA 1WGGA 3OJ4B 4RH6A 5G2NA 3UQBA 1SBBB 4WJOA 2NR2A 1STEA 3EFCA 1MFWA 2N1WA 2CHZA 2IGDA 3FAHA 3WAPA 3T3OA 1D5MC 2DX5B 3PVLA 4EZJA 1DGJA 1T0SC 2MBOA 4W9EA 3JSVA 4JLCA 3JW0X 2FE8A 4MM3B 3LDZE 3RULA 1TS3A 2JY6A 3W5VB 4CHKA 1WXQA 2FCSA 1YJIA 4ANVA 5BMGA 1ZE3D 2YEPF 2G4SA 5LLIA 3WALA 2VH1A 5AZGA 2J53A 2KNBA 2MLBA 4JWSC 3TCAA 3MJWA 2JYTA 2XBBC 4MDKE 3GE3C 5FKAC 3ZJVA 2XNAC 1WGKA 3W5UB 1R4NB 2C9WB 1FO4A 3R2IA 2KYWA 2V4IB 4GDLA 1EWCA 4HCNB 5H92C 2K5PA 2G3QB 1IPGA 3DQVA 1V5OA 2WXHA 2KMMA 4P1CC 2WWZA 4ZRJA 1PYWD 1RRBA 4A9AA 2D2QA 2J4XA 1J7BA 2B76B 3DBRI 2WYQA 3PGEA 5C1ZA 1EUVB 3ZRFA 2Z8LA 1OTRB 2ASQA 2ZNVC 1ZUD2 4BBNF 4MGKE 3L13A 4LCDE
chains in the Genus database with same CATH topology
3GS2A 1SE2A 2WQYB 4RGMA 4ZHPA 2LEKA 4C56C 3ETRA 3AE8B 4IKGA 1MPEA 1JRPA 2L83A 1TYGB 1C77A 4XWTA 1FNUA 5H8YE 4RGNA 2NTSA 3AEFB 3IXSA 3NVYA 2Y3AA 2ZW0A 1E6EB 2SAKA 4XE0A 5LNK1 2KDMA 2HDEA 4NAWB 1OQQA 5D3DA 3NVWA 1F77A 3L4PA 3TUOA 3W9CB 2PIAA 4ZRQA 3B9JA 1XCQL 1NYRA 3MC0B 3MHZA 1WWTA 1QKZA 1IGCA 1XF5L 2M56B 1N61A 4UDUC 1CK1A 2WXIA 2Y5CA 3Q8AA 4DQOC 1FNWA 2D5GA 2N0SB 1GOZA 3HVZA 2WXQA 3GP7A 1HXYD 3AE9B 4YTNB 1XXGA 1F2RI 2J42A 3PZ8A 5EE9A 3U4EG 2VZKD 2H88B 2QILA 4HKQA 3RFZB 3U7ZA 1MVKA 2W54A 1K50A 1GB1A 4CQNA 2TSSA 1I4QA 1FXAA 2HTME 1K52A 3PO0A 2LHEA 1E10A 2JU6X 2JWUA 1QF6A 5BYRA 3V3XA 1I4GA 4OHJA 1FCCC 1T5XD 1WYGA 1HEZE 1JWUD 1RWSA 2WLBA 1WSPA 4N59A 3ZJUA 1QOGA 1VZ6A 3V05A 4EE2A 4NAMA 5AUKA 1OFFA 1DOXA 2L32A 1YJJA 2WNMA 1BMLC 5D7GA 1FXIA 3VR9B 3CWIA 5AUIA 1UGJA 3ZJTA 4MT5A 4XDCA 1F0ZA 1NYQA 1VDVA 3DWGC 2Y5PA 3P42A 1E7PB 2W82A 1PFDA 1AN8A 2WP9B 3AE6B 3P4PB 2MH7A 1L0VB 1N5WA 2EELA 2R61A 5MPOA 1D5XC 1KLGD 1CJEA 1QOFA 1TJEA 3EGRA 2IJ0A 5BMHA 3FILA 1V1PA 1SB3C 5EE0A 2WDQB 2INNE 1P7EA 3AB5A 2NMQA 2V3NA 2CJOA 3NZ3A 1JWAD 4ZYSA 5JXVA 1TS4A 3AMZA 3O13A 1ACCA 3AEBB 2KWDA 5GXGB 1B9RA 3ZYYX 3TEZA 4TMAB 4KGRA 1PUTA 4YWGG 1SF0A 1KFYB 1QT9A 3OWEB 2DYOA 1L0YB 1YN3A 2SEBD 1D6EC 3R2TA 2QJLA 2WXKA 2PLPA 3BK2A 1HQRD 1KLUD 4JWUC 4L1BA 1Y56A 1SSNA 2MJEA 4ARIA 4A55A 2GB1A 1TY0A 3P63A 4HEA1 4HJGE 1P7FA 3RPFC 4KGTA 4MH8A 1IBXB 2RPVA 4OZAA 5EE1A 1E9MA 3J9CA 2K9XA 3AE2B 4H2AA 1D4BA 5G5HA 1KRHA 2DLBA 2WXMA 1ET9A 3CIRB 4LTUA 1N63A 1ZPSA 2WXPA 3MFGA 2L1AA 1GAQB 2JXTA 1XLQA 1FNVA 4RNAA 5D3IB 2KAJA 5HG2A 3AV8A 2RDGA 2PVGC 3U2SC 2MJ3A 1NI3A 3B2FA 4US9A 4GLSC 3AECB 2WXFA 1YMHE 2V3PA 3AEGB 2LHDA 2W55A 1SE4A 3TEXA 1VR9A 2K22A 4HRSA 1QILA 3IT4B 3AN1A 1RFKA 4ITKA 4R3DA 1AW7A 1N60A 1ZP0B 4GDLB 1XLOA 3BK1A 3BIID 1FD6A 2IPKD 2WDRB 4FXCA 3URYA 3ZGZA 4ARCA 2WU2B 1TKYA 3P1MA 4RF1A 4JX1C 2IDYA 3IAM1 1J7CA 3LXFA 2I38A 3NS1A 3P4SB 1CQVA 2Q5WD 3LB8C 1AWDA 2VZKB 2PMVA 2XN9C 1GB4A 1HA5A 1V1OA 2BBCA 3B2GA 3KWVA 5HHDG 1PGXA 1UWXA 3BVGA 4P16A 4KKIA 2ON8A 1L0XB 1CZPA 3VR8B 2W3SA 1EWYC 2IGHA 4USAA 2N9KA 1RYJA 3AEEB 1MI0A 3HUIA 2N7JA 1TKEA 2LUMA 3LYYA 4US8A 1FIQA 1T6BX 4HROA 1XCTL 2MJDA 1L6VA 4YSZB 2WDVB 5FR3A 4LK0M 3P4QB 2BS4B 4JPSA 4B0EA 4YTPB 3SFDB 2M0AA 3TEWA 4P6VF 1Q10A 2KACA 2L52A 4YT0B 1OQRA 2G1EA 4IDIA 2K0PA 2AQ1B 1DOIA 1L4DB 1K51A 1QLBB 4C7YA 2G9HD 1K53A 3AE7B 3BYYB 3MJ5A 1WRIA 1V97A 1KH0A 1VJKA 2GI9A 1I4XA 5I4DA 2BS3B 2QSDA 2BW2A 5TSSA 3KQ4A 1TKGA 1YNTE 3AEAB 3AH7A 4WURA 4YSXB 4YXDB 1ESFA 2CU3A 1PGBA 4RGOS 2K3UA 3VRAB 1L6UA 3KLSX 2BTEA 4HKZE 3UI3A 1UWMA 2ZW1A 3SR6A 1JALA 2OEDA 1VZ7A 3E9SA 4ZRPA 4WH4A 1JWBD 3TSSA 3NVZA 2JX5A 3NVVA 3VQIA 5HFYA 1ZDVA 3AEDB 1TY2A 4ZOHC 1DYQA 2BYTA 2WU5B 1C79A 1JMLA 4TQ0A 1RM6C 1ENFA 1PDXA 4NZLB 2CJNA 1SEBD 2EKIA 1N5XA 1SJHD 2KQ4X 2PW9A 3R8BA 2BS2B 2AQ3B 2ICIA 1VZ8A 1NENB 1SJED 1QQRA 1B1ZA 1YN4A 2BB5A 3W1SA 2JSVX 1LO5D 4L23A 1EM7A 4IOIE 1FM0D 1PGAA 1XO3A 2J52A 2E3TA 2WXNA 3FILB 1JWSD 1BUIC 1MHHE 3AE1B 3N9YC 3BYTB 1KF6B 1YQ3B 4WQMA 3NRZA 3P4RB 1I7HA 3IT6B 3NUHB 1HZ5A 1VLBA 1MHXA 5FK9C 1AYFA 3AE5B 3KWLA 1JQ4A 2WXLA 1ZDXA 1EU3A 1ZXIA 4RFBA 1UUPA 3U52E 3HVDA 1HZ6A 1V8CA 3Q8EA 2PKOA 1JROA 2AX5A 3Q69A 1TZOA 1C4PA 1T3QA 3AE4B 3BWUD 4RF0A 1SXTA 2LGIA 2PTLA 3I9V1 2BB6A 3SEBA 2QIEB 4KKJA 1FMAD 4OVZA 1TS2A 3BVZA 5BYSA 4B0MA 2FUG1 1SIJA 3MP9A 3C8YA 4D2KA 2X38A 5BMIA 1I4RA 2N9LA 3IAS1 1D5ZC 2WXRA 4ZHOA 4Q2JA 4XWWA 1L4ZB 3ABVB 2LFIA 4DXGA 2JQRB 1QOBA 1TS5A 1IUEA 3E56A 3ZQ4A 1IGDA 2JZPA 4M0WA 1ZOYB 2ONQA 4KGSA 3W2DA 1J7AA 3PZ7A 3Q8FA 2KN4A 4WWMA 2QEJC 4XDDA 3T3NA 4TQ1A 4WAFA 4A6QA 4GDKB 2AQ2B 3DWMA 1FRRA 2W3RA 1YQ4B 4KX6B 2I2YA 4L2YA 2LJIA 1FEHA 4YSYB 3BVMA 4DXFA 1F2RC 5E6JA 2JYEA 2E6XA 1VRAB 2WXOA 4RH6A 1EU4A 1DOYA 1SBBB 4A90A 4NJCA 4C7ZA 2M19A 1FRDA 1UNSA 3Q8BA 1STEA 3SFEB 4AS1A 1FCLA 4A8XC 2IGDA 4N6EB 2FBWB 3FAHA 2GRIA 3T3OA 4N58A 1D5MC 3H8HA 1GPXA 2H89B 4C80A 1SE3A 2WS3B 5G5GA 4YTMB 1DGJA 3I57A 5C3JB 1C4CA 1BXTA 2OHFA 3EA6A 1L5PA 1I4PA 1XEEA 2INPE 1IBXA 4OZCA 2FE8A 4RGTA 3GB1A 4MM3B 4LLGM 1TS3A 3HRDD 5HI1A 3W5VB 1KTKA 4O1NA 2DWQA 2LMCA 1WXQA 1YJIA 1XLNA 4WIPA 1I4HA 5BMGA 1FFUA 4AQ7A 3BZDB 1ZE3D 1NVID 2YEPF 1YN5A 1ZXHA 3EUB2 1XLPA 2WXJA 2DYMA 4JE3B 4REZA 1C76A 1JWMD 2J53A 2PVOD 4JWSC 2JYTA 1QOAA 5FKAC 5EE3A 3Q8CA 3ZJVA 2XNAC 2WXGA 1WGKA 3W5UB 1N62A 1JW9D 2IGGA 3AE3B 2BT6A 3R2IA 2V4IB 1FO4A 1E0ZA 2MEKA 1C78A 1EWCA 1R7SA 5H92C 2K5PA 1FFVA 4OW0A 4PT5A 4OZBA 5BYQA 3FC4A 1M4VA 2WXHA 1V1PB 3WCQA 1A70A 4MACA 2ACZB 2KMMA 2V0GA 2YEPB 2NTTA 1ROEA 1PYWD 5T8IA 4A9AA 3AM9A 1C4AA 2J4XA 2RDHA 1J7BA 2B76B 1NEKB 2RMMA 1C9FA 1ET6A 2Z8LA 4RCOA 2QMTA 2DBYA 1JCKB 1ZUD2 5C2TB 3TEYA 4TSSA 3VRBB 4J3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWU C;  1ZOY B;  1QLB B;  2WQY B;  1J7A A;  2LEK A;  2MJE A;  3ETR A;  4WWM A;  3AE7 B;  4C7Y A;  3AE8 B;  4C7Z A;  4ZHP A;  1JRP A;  2L83 A;  1TYG B;  1WRI A;  3P63 A;  1V97 A;  3DWM A;  1FRR A;  1VJK A;  2W3R A;  1YQ4 B;  4KX6 B;  2BS3 B;  5H8Y E;  3RPF C;  3AEF B;  4US8 A;  1TKG A;  3AH7 A;  3AEA B;  4YSY B;  3NVY A;  5EE1 A;  4YSX B;  1E6E B;  4YXD B;  2CU3 A;  1DOY A;  1OQQ A;  1E9M A;  3L4P A;  3NVW A;  2K9X A;  3AE2 B;  3W9C B;  2PIA A;  2M19 A;  1FRD A;  1KRH A;  5G5H A;  1L6U A;  3B9J A;  1NYR A;  3VRA B;  1UWM A;  1WWT A;  3CIR B;  4LTU A;  3SFE B;  1N63 A;  3SR6 A;  2M56 B;  1JAL A;  1N61 A;  1GAQ B;  4N6E B;  1XLQ A;  1JWB D;  2FBW B;  2Y5C A;  3NVZ A;  2KAJ A;  2JX5 A;  2N0S B;  3NVV A;  3HVZ A;  3AV8 A;  3FAH A;  1GPX A;  3AED B;  2PVG C;  3AE9 B;  2MJ3 A;  4N58 A;  1NI3 A;  3B2F A;  4ZOH C;  2WU5 B;  4US9 A;  4YTN B;  5EE9 A;  1RM6 C;  2H89 B;  4C80 A;  1PDX A;  2WS3 B;  3AEC B;  5G5G A;  4YTM B;  1DGJ A;  2CJN A;  2H88 B;  3AEG B;  2EKI A;  2W55 A;  1N5X A;  5C3J B;  2W54 A;  2OHF A;  1L5P A;  2K22 A;  2BS2 B;  1FXA A;  2HTM E;  4HRS A;  3PO0 A;  3AN1 A;  1NEN B;  1E10 A;  1RFK A;  4ITK A;  1QF6 A;  3W5V B;  3HRD D;  1N60 A;  1ZP0 B;  2DWQ A;  1FM0 D;  1WXQ A;  1XO3 A;  1XLO A;  1WYG A;  1YJI A;  3BII D;  1RWS A;  1XLN A;  2E3T A;  2WLB A;  4N59 A;  1FFU A;  1QOG A;  2WDR B;  4FXC A;  1NVI D;  2WU2 B;  1TKY A;  5AUK A;  3EUB 2;  3P1M A;  1OFF A;  1DOX A;  3AE1 B;  4JX1 C;  1YJJ A;  1KF6 B;  1XLP A;  1YQ3 B;  4WQM A;  3NRZ A;  3P4R B;  1I7H A;  1J7C A;  1FXI A;  3LXF A;  1VLB A;  3CWI A;  3VR9 B;  3NS1 A;  5AUI A;  2PVO D;  3P4S B;  1AYF A;  2Q5W D;  3AE5 B;  4JWS C;  1F0Z A;  3LB8 C;  3KWL A;  1NYQ A;  1AWD A;  1JQ4 A;  1VDV A;  3DWG C;  1QOA A;  5EE3 A;  1E7P B;  1WGK A;  3W5U B;  1ZXI A;  1PFD A;  3B2G A;  2WP9 B;  1N62 A;  3AE6 B;  3P4P B;  1JW9 D;  2MH7 A;  1L0V B;  1N5W A;  1V8C A;  3AE3 B;  5MPO A;  2BT6 A;  1FO4 A;  1E0Z A;  2PKO A;  1TJE A;  1JRO A;  1QOF A;  1CJE A;  1R7S A;  2K5P A;  1FFV A;  5H92 C;  2AX5 A;  1CZP A;  1T3Q A;  3AE4 B;  3VR8 B;  3FC4 A;  2W3S A;  1EWY C;  1SB3 C;  5EE0 A;  3WCQ A;  1A70 A;  2ACZ B;  2WDQ B;  2KMM A;  4USA A;  3AB5 A;  1RYJ A;  3AEE B;  3HUI A;  2CJO A;  2QIE B;  1JWA D;  1ROE A;  1TKE A;  1FMA D;  3AMZ A;  4A9A A;  1FIQ A;  3AM9 A;  3AEB B;  4HRO A;  1J7B A;  1SIJ A;  2B76 B;  2MJD A;  1L6V A;  5GXG B;  1B9R A;  3ZYY X;  4YSZ B;  1NEK B;  2WDV B;  3P4Q B;  4ZHO A;  2BS4 B;  1PUT A;  1SF0 A;  1KFY B;  1QT9 A;  4YTP B;  2DBY A;  3SFD B;  3ABV B;  4P6V F;  5C2T B;  1ZUD 2;  2L52 A;  2JQR B;  1QOB A;  4YT0 B;  1OQR A;  3VRB B;  1IUE A;  2G1E A;  4IDI A;  1DOI A;  2QJL A; 
#chains in the Genus database with same CATH topology
 1SE2 A;  2WQY B;  4ZHP A;  2LD9 A;  1TYG B;  4RGN A;  4EKU A;  3IXS A;  2Y3A A;  2YLM A;  2ZW0 A;  4XE0 A;  5LNK 1;  2HDE A;  3TUO A;  5IOI A;  2PIA A;  2FCM A;  3B9J A;  3MHZ A;  1N61 A;  3DBL B;  1P9D U;  3VH4 B;  5DPW A;  4XGA B;  3HVZ A;  2NVU I;  2I1K A;  3DVG X;  2VZK D;  4EUT A;  2QIL A;  1WXS A;  3U7Z A;  5E6P A;  3QA8 A;  3V6E B;  3APC A;  3N1Y C;  2HTM E;  3V62 A;  4S0R A;  4OHJ A;  1FCC C;  1WE6 A;  1RWS A;  2IO3 B;  2JWZ A;  4HDQ A;  1QOG A;  4FHJ A;  1YX5 B;  4NAM A;  5DCN A;  5AZH A;  1OFF A;  1MG4 A;  2L32 A;  1YJJ A;  2D10 A;  2MX2 A;  5D7G A;  3VR9 B;  5AUI A;  2RSU A;  1UGJ A;  3ZJT A;  4MT5 A;  1F0Z A;  2G4D B;  4KSL C;  2Y5P A;  1S1Q B;  4HDO A;  1E7P B;  1AN8 A;  2WP9 B;  1C1Y B;  2MH7 A;  1L0V B;  2M4N A;  3A4R A;  3UIP B;  3Q3F A;  4K7S A;  5EE0 A;  5TR5 A;  2WDQ B;  2HTH A;  3AB5 A;  2NMQ A;  1JWA D;  4ZYS A;  2MSE D;  1ACC A;  3AEB B;  2RR9 A;  1FXT B;  1R4M B;  5J18 A;  3ECI A;  4KGR A;  1SF0 A;  3IVF A;  4G0N B;  3R2T A;  4DHJ D;  2WXK A;  2BYF A;  3EFU A;  3BK2 A;  1WM2 A;  3RUI B;  3IG3 A;  4FJY A;  4J6I A;  3P63 A;  4DDI D;  2KLG A;  4XYC A;  4K7U A;  3QCA A;  1WMH B;  1WGY A;  3APF A;  5EE1 A;  1RAX A;  2Y5B B;  4AUQ C;  5G5H A;  3CIR B;  1WF9 A;  3MFG A;  4FAD A;  2L1A A;  1XLQ A;  1FNV A;  2KFK B;  2RDG A;  4BOS C;  3U2S C;  4GLS C;  1L7Y A;  3TJP A;  2KWC A;  1UBI A;  2LHD A;  3AEG B;  2O6V A;  1WFY A;  4XC2 A;  1QIL A;  2LAS A;  1RFK A;  1ZP0 B;  1I35 A;  4BAX A;  3BK1 A;  2NBW B;  3URY A;  3ZGZ A;  1JRU A;  5BO4 B;  3PRM B;  4FJV B;  2GBJ A;  3IAM 1;  3AI5 A;  4IUM B;  4GN1 A;  2VZK B;  2PMV A;  1GB4 A;  1HA5 A;  3PHW B;  2KC2 A;  2L0F A;  1PGX A;  1UWX A;  4IW0 A;  2OOB B;  2PEA A;  1CZP A;  2I1J A;  4DHZ B;  4K1R B;  1U4A A;  2KZR A;  2N7J A;  4KZ0 A;  1XCT L;  2MJD A;  3Q14 C;  5E6O A;  1TIF A;  4JPS A;  3SFD B;  2M0A A;  3TEW A;  4P6V F;  3MHS D;  1Q10 A;  2KAC A;  2GLS A;  1EO6 A;  1DOI A;  4C7Y A;  3UIN B;  3NZU A;  2DHZ A;  1KH0 A;  2K6D B;  2MBB B;  3Q6B A;  5I4D A;  1I4X A;  5TSS A;  3KQ4 A;  2R2O A;  5CHW A;  1ESF A;  2KMC A;  4MGI E;  3GOE A;  3KLS X;  2BGF A;  4HKZ E;  4GMV A;  2OED A;  5G55 A;  1JWB D;  3TSS A;  1IP9 A;  2JX5 A;  3NVV A;  2C7H A;  3VVW B;  3AED B;  1TY2 A;  3DBH B;  4I6P A;  2BYT A;  1C79 A;  1JML A;  4DHJ B;  3OAW A;  1TTN A;  1ENF A;  1PDX A;  3R8B A;  3JSV B;  4KSK C;  2ICI A;  1QQR A;  3W1S A;  2FAZ A;  1SGH A;  2IY0 B;  1FM0 D;  4G11 A;  2J52 A;  1C3T A;  1GC7 A;  3FIL B;  3AE1 B;  4K3B A;  4HWI B;  3AE5 B;  2MA9 B;  2QHO A;  3RN9 C;  1V80 A;  1ZDX A;  3N1Z C;  1UZX B;  1V8C A;  3Q8E A;  2PKO A;  4NQL B;  1TZO A;  1C4P A;  4DXA B;  5CHV C;  2LGI A;  3VTU A;  2L8J A;  3SEB A;  2DAF A;  1PQS A;  4KKJ A;  2MP2 B;  1LFD A;  3PZD A;  3MP9 A;  1UGM A;  4D2K A;  2X38 A;  4WJP A;  1I4R A;  3QC8 B;  3L0W B;  4Q2J A;  1RFA A;  4DXG A;  1XD3 B;  1FPY A;  2K6Q A;  4NY0 A;  1QOB A;  4HCP B;  2OJW A;  2J0K A;  3ZQ4 A;  2K8H A;  2JZP A;  4M0W A;  1UD7 A;  1ZOY B;  2JZ3 B;  4A3P A;  4WAF A;  4GGQ A;  2IO1 B;  3QWZ B;  2I2Y A;  3U7D A;  3RZF A;  3R7R A;  2LJI A;  4FUL A;  2LUE A;  4YSY B;  2DEN B;  1GG3 A;  1N6Z A;  1DOY A;  4C4V A;  2JT4 B;  3H7P A;  3WAO A;  2M19 A;  1FRD A;  1UNS A;  3AU4 A;  4KZC A;  3SFE B;  4AS1 A;  3WIM A;  4A8X C;  4B9K A;  1EF5 A;  2BYV E;  3MC9 A;  1Z2M A;  2GRI A;  3L08 A;  3B08 A;  2EKE C;  5AEK B;  5C3J B;  1BXT A;  4JL9 A;  2KOX A;  1WXA A;  1XEE A;  5C23 A;  3D32 A;  3ENE A;  4RGT A;  3GB1 A;  4LLG M;  3HRD D;  2LMC A;  2NBU A;  2R2Q A;  1SIF A;  3ZKJ C;  1XLN A;  1FFU A;  4MGY E;  4BKS A;  1YN5 A;  2KFK A;  3X0W A;  2OJR A;  1XLP A;  4REZ A;  1JWM D;  2LGD A;  2PVO D;  2KWV B;  1UBQ A;  2K1F A;  4P7I A;  3Q8C A;  4ZRI A;  2IGG A;  3AE3 B;  2BT6 A;  1E0Z A;  4IWP A;  2GOW A;  1YOV B;  4HPL B;  4IM0 A;  1TGZ B;  2ACZ B;  2YEP B;  1V2Y A;  1ROE A;  1VCB A;  5T8I A;  2Z0E B;  2V4L A;  2ZVN A;  3L54 A;  5CTR C;  1SE9 A;  1LXD A;  1M94 A;  3NG0 A;  5C2T B;  3TEY A;  4TSS A;  3EHV A;  3VRB B;  3ZIM A;  4KV2 A;  1WJ4 A;  2K8C A;  1OGW A;  2LEK A;  3ETR A;  4C56 C;  4IKG A;  1C77 A;  3AEF B;  2SAK A;  3A1Q B;  4WWP A;  5D3D A;  3A9K A;  4PS8 A;  3W9C B;  4ZRQ A;  4BOZ B;  1NYR A;  3L10 B;  4LJP B;  4W9G A;  2LVQ A;  2Y5C A;  3PRZ A;  4DQO C;  2D5G A;  1HXY D;  1XXG A;  3RI7 C;  2H88 B;  5J2R A;  1WY8 A;  1AAR A;  1MVK A;  1GB1 A;  1WGD A;  4CQN A;  4M01 A;  2CHW A;  2LHE A;  1E10 A;  2JU6 X;  5BYR A;  1I4G A;  2RD0 A;  2WLB A;  1WSP A;  3ZJU A;  2BF8 B;  5AUK A;  3NJT A;  2J0J A;  1BML C;  4P1B C;  1P98 A;  1VDV A;  3DWG C;  3I63 C;  4KVG B;  3P42 A;  4HLE A;  1PFD A;  3AU5 A;  5MPO A;  1UEL A;  1KLG D;  2AEH A;  5BMH A;  3FIL A;  4EFO A;  2V1Y A;  1R4N I;  1P7E A;  2FNJ B;  2V3N A;  4EZK A;  2J7Q B;  2D3A A;  1TS4 A;  3AMZ A;  2GMI C;  1B9R A;  2L3Z A;  3ZYY X;  2EMT A;  1KFY B;  1QT9 A;  2DYO A;  1L0Y B;  3NOB A;  5D2M B;  4LNO A;  2EMS A;  1HQR D;  1KLU D;  3M63 B;  1SSN A;  5CX3 A;  2MJE A;  5D6J B;  3PLU A;  4HJG E;  3RPF C;  2MP2 A;  1IBX B;  2RPV A;  4NAW A;  4NQK E;  3J9C A;  2DLB A;  1QZE A;  4BKS D;  1GAQ B;  4KDI C;  4RNA A;  4NJ7 A;  2KDB A;  3AV8 A;  2PVG C;  2GBR A;  1P0R A;  3TIX A;  4US9 A;  5JHA A;  3HM6 X;  1VR9 A;  2K22 A;  3DBL I;  2K25 A;  1E8Y A;  1MG8 A;  3ZNG C;  5JZE B;  1N60 A;  1LQB A;  2HD5 B;  1A5R A;  2RDB C;  1TKY A;  3P1M A;  3Q3N C;  4JX1 C;  2KDF B;  2DZK A;  2I38 A;  1GJZ A;  3ONS A;  2Q5W D;  3LB8 C;  3T9L A;  2XN9 C;  3GE8 C;  4MGZ E;  4F1S A;  3KWV A;  3S2A A;  4P16 A;  1ZKH A;  4KKI A;  4RMA A;  1WRD B;  4XZ4 A;  3QHT A;  3AEE B;  1MI0 A;  3HUI A;  2IZV B;  2ZCB A;  1FIQ A;  1T6B X;  4HRO A;  5CHF A;  1F1H A;  2WDV B;  4LK0 M;  3P4Q B;  4B0E A;  3N32 A;  2N9E B;  4YTP B;  4ANW A;  3CF6 E;  2G1E A;  4TV3 A;  1L4D B;  2KFJ A;  1QLB B;  4M0W B;  3ALB A;  3TBL D;  4MEL A;  2KAN A;  1F52 A;  1R4M I;  4DHZ E;  3BIN A;  1YNT E;  3AEA B;  1GUA B;  2CU3 A;  5JHB A;  1PGB A;  2K3U A;  3ZW3 A;  4C4V B;  3H7P B;  3VRA B;  4W9I A;  1L6U A;  3UI3 A;  1JAL A;  1VZ7 A;  3E9S A;  4ZRP A;  3N1X C;  3Q3M C;  2M8S A;  3VQI A;  2IYD B;  1ZDV A;  4ZOH C;  2LZ6 A;  3UF8 A;  3Q3O C;  4FLH A;  4TQ0 A;  4NZL B;  2LXA A;  4OVV A;  2PW9 A;  4PYZ A;  3LJ3 A;  2BS2 B;  2LGY A;  1VZ8 A;  2MBE A;  3A1Q A;  4GOC A;  2BB5 A;  1YX6 B;  3VUW A;  1LM8 B;  4L23 A;  4IOI E;  1PGA A;  4C00 A;  3IFW B;  1BUI C;  4GSW A;  2IY1 B;  2A5U A;  2BWE S;  2QDF A;  3N9Y C;  1YQ3 B;  4WQM A;  2DZJ A;  3NUH B;  3ZXR A;  1MHX A;  4WWO A;  2UWQ A;  4LNN A;  1OEY A;  2KK8 A;  3RNG C;  1WGR A;  3GZN B;  3DVN U;  1LGR A;  2FIF A;  1ZXI A;  2N7E A;  1UUP A;  3U52 E;  1E8Z A;  1WX9 A;  3QAR A;  4EOY A;  1JRO A;  2KO3 A;  5IN7 A;  1T3Q A;  3WAM A;  2MQJ A;  2PTL A;  2KJR A;  3O65 B;  2QIE B;  2KC1 A;  2KX0 A;  4OVZ A;  3BVZ A;  5BYS A;  4B0M A;  3C8Y A;  5BMI A;  2N9L A;  1D5Z C;  3R3M A;  2XK5 A;  2KDE B;  1L4Z B;  3KUZ A;  1UH6 A;  3RT3 B;  2DZI A;  1OQY A;  1IUE A;  4BVU C;  4B6W A;  3E56 A;  2JPH A;  4KGS A;  3Q8F A;  4XDD A;  4GIV A;  4TQ1 A;  3T3N A;  2AQ2 B;  1FRR A;  4G50 A;  2C5L C;  4KX6 B;  1HTO A;  1VRA B;  4A90 A;  4NJC A;  3A9K B;  4C7Z A;  1E7V A;  4N6E B;  2FBW B;  2AL6 A;  4URK A;  2FCQ A;  1GPX A;  4N58 A;  3H8H A;  4IWQ A;  1Z5S B;  4C80 A;  1SE3 A;  3RD2 A;  4K3C A;  3PTF C;  3X23 A;  2KMA A;  2OHF A;  1L5P A;  2PJH A;  1WR1 A;  2INP E;  4OZC A;  1IBX A;  2CHX A;  3DBH I;  2KTR A;  2DWQ A;  3PS6 A;  2PE6 B;  4LJO B;  4WIP A;  2AL3 A;  4AQ7 A;  3BZD B;  1X1M A;  4TUU A;  3IHP C;  3EUB 2;  2UU7 A;  1V86 A;  2WXJ A;  4JE3 B;  1C76 A;  1TT5 B;  2M17 A;  1P3Q U;  2DAJ A;  3K9P B;  3DHI C;  4CO7 A;  3M95 A;  3N30 A;  2N9P C;  2MEK A;  1R7S A;  3PHX B;  4PT5 A;  2NPT A;  5BYQ A;  4I6N B;  4ZRK A;  2V0G A;  2NTT A;  4M8N A;  4NPN A;  1NI2 A;  2ZPN A;  2K39 A;  4KIK B;  3HK0 A;  2WX0 A;  4BKT A;  2RMM A;  1C9F A;  4MEM A;  2ZPY A;  1ET6 A;  2DBY A;  1WJN A;  3JVZ X;  4J3O D;  4M00 A;  5KHO A;  4RGM A;  3AE8 B;  1MPE A;  2ZJD A;  4II2 B;  3B1L X;  4TKN A;  4AWJ A;  4W9H A;  3KYD D;  2KDM A;  1WI0 A;  4NAW B;  1OQQ A;  3NY5 A;  3L4P A;  2LI5 A;  1WWT A;  1QKZ A;  2M56 B;  3EC8 A;  1CK1 A;  4AJW A;  1V9J A;  3Q8A A;  1T0Y A;  1FNW A;  1YD8 U;  1J0G A;  1GOZ A;  1EF1 A;  2JZZ A;  3AE9 B;  3DPD A;  2J42 A;  3DVN V;  3PZ8 A;  5EE9 A;  3Q3J A;  1J8C A;  4HKQ A;  3RNC C;  2BYE A;  3RFZ B;  1K50 A;  1KLV A;  3N3K B;  2N4F A;  1I4Q A;  4PK1 A;  1K52 A;  1Q1O A;  3V3X A;  1T5X D;  1HEZ E;  1JWU D;  4DK5 A;  1VZ6 A;  4EE2 A;  1UF0 A;  1DOX A;  2WNM A;  4MH0 E;  3N20 C;  2QC8 A;  4AJY B;  4ZDV A;  3VTV A;  1HE8 A;  4W9L A;  3P4P B;  1E8X A;  4LNF A;  3V60 A;  1CJE A;  4FN2 A;  2IJ0 A;  2L76 A;  2D3G A;  1V1P A;  1SB3 C;  4ASW C;  3UGB B;  3U30 A;  2CJO A;  3NZ3 A;  5JXV A;  5J17 A;  3A33 B;  2KKC A;  3ZUN A;  3O13 A;  1D3Z A;  2L05 A;  4E3C A;  5IO9 A;  3TEZ A;  2INC C;  1PUT A;  3OJ3 A;  1KJT A;  2NS5 A;  2SEB D;  4W9D A;  2DZM A;  2PLP A;  2LRW A;  2CR5 A;  4L1B A;  1E7U A;  2GB1 A;  1TY0 A;  2B3A A;  4KGT A;  1NBF C;  4OZA A;  2WDT B;  4BZA A;  2BPS A;  4H2A A;  2K9X A;  3AE2 B;  5L95 C;  1KRH A;  3NS8 A;  4HK2 A;  2MW5 A;  1ZPS A;  4M02 A;  2WXP A;  3CSF A;  4OVU A;  4HJK A;  2D07 B;  3L17 A;  4EZL A;  2MJ3 A;  2O2V A;  1YMH E;  1S3S G;  2W55 A;  1SE4 A;  3TEX A;  2IND C;  2LVO A;  4HRS A;  3W1S C;  3AN1 A;  1WJU A;  3KVF B;  5LXH A;  3JYU A;  1XLO A;  3BII D;  3ML8 A;  1FD6 A;  2IPK D;  2WDR B;  4GB9 A;  2BWF A;  3HIZ A;  2IDY A;  3NS1 A;  1CQV A;  1WX8 A;  4WJQ A;  4CYE A;  1XT9 B;  2ZVO A;  1V1O A;  2BBC A;  5HHD G;  2PE9 A;  4MJS A;  2ON8 A;  1MJD A;  2KJH B;  3VR8 B;  2W3S A;  1EWY C;  2IGH A;  1WIA A;  1Y8R C;  1HTQ A;  4IG7 B;  1F9J A;  3ZVV A;  3QJZ A;  3UQA A;  1L6V A;  2KVR A;  3B0A A;  3U8Z A;  2XK5 B;  3OLM D;  5EDS A;  2D11 A;  4X57 B;  2JXX A;  1K51 A;  1T0Q C;  1WXM A;  2G9H D;  1K53 A;  2HE7 A;  3AE7 B;  3BYY B;  3MJ5 A;  1WRI A;  3VAW A;  1VJK A;  2GI9 A;  1CMX B;  5L83 A;  4US8 A;  3AH7 A;  4KIK A;  4WUR A;  4ANU A;  2AYO B;  3DHH C;  3IBE A;  1E8W A;  2ZW1 A;  3OG5 A;  2G45 B;  3EEC A;  2WX1 A;  3NZS A;  3WA0 A;  4WH4 A;  4BFR A;  3Q2A C;  1K8R B;  5HFY A;  1DYQ A;  2C60 A;  2CJN A;  1SEB D;  2EKI A;  3I3T B;  2VRR B;  3H1U A;  2WHI A;  3ZLZ A;  1WM3 A;  4F7Z A;  1SJE D;  1B1Z A;  4WQO B;  2KTR B;  4B95 A;  3L16 A;  2KWU B;  2E3T A;  2WXN A;  1JWS D;  4LDT D;  2N7D A;  1KF6 B;  3P4R B;  1I7H A;  3IT6 B;  1HZ5 A;  3VUX A;  5FK9 C;  2L7R A;  1I42 A;  2WXL A;  1H4R A;  3P2B A;  4ZYN A;  1EU3 A;  4W9C A;  4RFB A;  4WJN A;  1HZ6 A;  3PLV A;  3RNF C;  1YIW A;  2AX5 A;  3Q69 A;  2BQQ A;  2NPT B;  2IBI B;  3AE4 B;  3DBR B;  3BWU D;  1SXT A;  2K8B A;  4EEW A;  2LRU A;  2JRH A;  2JF5 A;  2NBV B;  4LNI A;  2KN5 A;  1TS2 A;  5DPR A;  1SIJ A;  4AOF A;  3IAS 1;  4A3O A;  4ZHO A;  4XWW A;  2LFI A;  2JQR B;  1YJ1 A;  4WAA A;  2ONQ A;  1OEY J;  2KN4 A;  2LGX A;  4WWN A;  4A6Q A;  2W3R A;  3TL5 A;  2KX3 A;  3A9J A;  1FEH A;  1F2R C;  5E6J A;  1EU4 A;  2NCN A;  4MSQ B;  2MRP A;  2HJ8 A;  3Q8B A;  4S17 A;  2PPH A;  4M8M A;  3VH3 B;  1FCL A;  3MC8 A;  2MBH A;  3CMM B;  4PYU A;  4ACF A;  2H89 B;  2WS3 B;  5G5G A;  4YTM B;  2GBN A;  4K7W A;  2D3B A;  2FID A;  3I57 A;  1C4C A;  2JUO A;  4YL8 A;  1V6E A;  3EA6 A;  1I4P A;  5HI1 A;  1G6J A;  1KTK A;  4O1N A;  2Z0D B;  1I4H A;  1YQB A;  1NVI D;  2KXJ A;  1ZXH A;  2DYB A;  4HXD A;  2DYM A;  3PV1 A;  1V81 A;  1IYF A;  3PRE A;  4K81 A;  2RPQ A;  3M62 B;  2LVP A;  1QOA A;  5EE3 A;  1KM7 A;  2WXG A;  5D94 A;  3APD A;  1N62 A;  2WGS A;  1JW9 D;  3VFK A;  4FHK A;  2MHJ A;  1C78 A;  4JQW C;  3VXW A;  4OW0 A;  1FFV A;  3DDC B;  3KYC D;  4OZB A;  2L00 B;  3FC4 A;  1M4V A;  3GZN I;  4G3X B;  1V1P B;  3WCQ A;  1A70 A;  3H9D A;  4MAC A;  2YVC A;  4ICV A;  4DDG D;  4LDT B;  2VH2 A;  3RCZ A;  3AM9 A;  1C4A A;  1E5W A;  2RDH A;  2C7M B;  4RM9 A;  1NEK B;  4BKG A;  1V5T A;  4I6L B;  4RCO A;  2QMT A;  5GMV A;  3SU8 X;  1JCK B;  4MSM B;  2ZNV B;  3ZNI D;  2ZZP B;  3DHG C;  3GS2 A;  1JRP A;  2J0M A;  2L83 A;  4GDK A;  1Q5W B;  2RGF A;  3H6N A;  4XWT A;  1FNU A;  5H8Y E;  1V49 A;  2KT7 A;  2NTS A;  2D3C A;  3NVY A;  1E6E B;  3RZW C;  1WH3 A;  1ISN A;  3NVW A;  1F77 A;  5E6N A;  4FA6 A;  4N9F 4;  4IWO A;  2ZEQ A;  3MC0 B;  1XCQ L;  1IGC A;  1XF5 L;  4UDU C;  3K9O B;  2WXI A;  2BKR B;  3VHT C;  2N0S B;  4HPP A;  2WXQ A;  3GP7 A;  4YTN B;  1H8C A;  2O2V B;  1F2R I;  2C7N B;  3U4E G;  3KW5 B;  2W54 A;  2TSS A;  4GXB A;  4JIO U;  1FXA A;  3PO0 A;  4MM3 A;  2JWU A;  1QF6 A;  3FKY A;  3ZNH B;  5AZF A;  1WYG A;  3DBS A;  3KH0 A;  2MBQ A;  2X8X X;  4N59 A;  2JVC A;  2DNF A;  3V05 A;  3VDZ A;  1VD2 A;  5IP4 D;  2XEW A;  1FXI A;  3CWI A;  4XDC A;  2BKF A;  1NYQ A;  2KDI A;  4HPM B;  2CU1 A;  1T0R C;  1ZGU B;  2W82 A;  3AE6 B;  3QQ8 B;  1WE7 A;  1N5W A;  2EEL A;  2R61 A;  3ZXV A;  1D5X C;  1QOF A;  1TJE A;  3EGR A;  3RMK C;  4MJS B;  3SHQ A;  4F8C B;  3ZDM C;  1WXV A;  3PT2 B;  3ZNZ B;  2INN E;  3QK0 A;  2GBK A;  4RM8 A;  1XQQ A;  3RNA C;  4DWF A;  2A4Z A;  3V61 A;  4IC7 B;  2QCZ A;  2KWD A;  5GXG B;  1TZ1 A;  3MTN B;  4TMA B;  2JRI B;  2KTF A;  4YWG G;  3OWE B;  1J19 A;  1YN3 A;  2KJ6 A;  1D6E C;  4HVB A;  2QJL A;  5KHQ A;  4JWU C;  4LNK A;  1Y56 A;  4ARI A;  4A55 A;  3R7Q A;  4HEA 1;  2CKH B;  1P7F A;  2CS4 A;  3AUL A;  4MH8 A;  5IA7 A;  2FCN A;  3WAN A;  2Z59 B;  5IKC M;  1E9M A;  2HJ1 A;  1WZ0 A;  1D4B A;  2WXM A;  3TMP B;  1ET9 A;  4LTU A;  1N63 A;  2JXT A;  2V3S A;  4JGH B;  5D3I B;  3W1Y A;  2KAJ A;  4E74 A;  4QAY A;  5DPS A;  5HG2 A;  3RYT A;  1NI3 A;  3B2F A;  3AEC B;  2WXF A;  2V3P A;  1BT0 A;  2AWT A;  3IT4 B;  2MWS B;  4ITK A;  3DVG Y;  1WJ6 A;  4R3D A;  1AW7 A;  4W9F A;  4GDL B;  5FR6 A;  3QX1 A;  4FXC A;  4A20 A;  1WR6 E;  4ARC A;  2WU2 B;  4BBN C;  4RF1 A;  3ML9 A;  1J7C A;  3LXF A;  2KHW B;  3P4S B;  4NJ6 A;  2W9N A;  1AWD A;  4PS3 A;  1GNU A;  4E71 A;  2KVZ A;  2ZCC A;  3HM3 A;  3B2G A;  3SD5 A;  3RNE C;  3PSE B;  3BVG A;  3I5J C;  2IO2 B;  4II3 B;  3ZDT A;  1L0X B;  2O6V D;  4USA A;  2N9K A;  1RYJ A;  1TBE A;  4AP4 C;  1TKE A;  2LUM A;  3A4S C;  3LYY A;  2GBM A;  4YSZ B;  5FR3 A;  4DBG A;  2BS4 B;  3BY4 B;  1WYW B;  2LJ5 A;  1Q0W B;  2L52 A;  4YT0 B;  1OQR A;  4IDI A;  2AQ1 B;  2K0P A;  3PRP B;  4ICU A;  3AXC A;  1E90 A;  3DCG A;  4NNJ B;  3ZTC A;  1V97 A;  3RNB C;  2UYZ B;  2LXC A;  2BS3 B;  1WMH A;  2QSD A;  2BW2 A;  1WZ3 A;  1TKG A;  3A9J B;  4YSX B;  4YXD B;  3QIJ A;  4RGO S;  2MCN B;  3CST A;  2BTE A;  4ANX A;  1UWM A;  1P1A A;  3SR6 A;  3R66 C;  2REX A;  3NVZ A;  4GU2 A;  2IO0 B;  2WU5 B;  4W9K A;  4PS7 A;  1RM6 C;  3SDL C;  1N5X A;  1ZW7 A;  1SJH D;  2KQ4 X;  3C0R B;  2LGS A;  2AQ3 B;  2KLC A;  5DPT A;  1NEN B;  1YN4 A;  4FJZ A;  2JSV X;  1LO5 D;  2N1V A;  1EM7 A;  2BVC A;  5JH5 C;  2FUH B;  1XO3 A;  3C19 A;  3PPA A;  1MHH E;  3VUY A;  3HHM A;  3ZRC A;  5LXI B;  3BYT B;  3NRZ A;  1VLB A;  4FBJ B;  1AYF A;  3KWL A;  1JQ4 A;  3NHE B;  3HVD A;  2V9H A;  1WX7 A;  1L2N A;  3DOW A;  2L0T A;  2N9X A;  3ZO5 B;  3H7S A;  4RF0 A;  3I9V 1;  2BB6 A;  5IAA C;  2KQS A;  4IM3 A;  1KOT A;  1FMA D;  1RLF A;  3UIO B;  3T8M A;  3V6C B;  2FUG 1;  4W9J A;  1GC6 A;  4KDL B;  2WXR A;  2KQ7 A;  3ABV B;  1NDD A;  3KUD B;  1TS5 A;  4XX5 A;  3KUC B;  3QAQ A;  1IGD A;  3M3J A;  3ZTD A;  3VTW A;  2M1M A;  3W2D A;  1J7A A;  3PZ7 A;  4WWM A;  2LWP A;  2QEJ C;  5HKH A;  4GDK B;  3DWM A;  2O6V B;  2M0X A;  1YQ4 B;  4L2Y A;  4IM2 A;  4DXF A;  3BVM A;  2KD0 A;  2JYE A;  2E6X A;  1WGH A;  2WXO A;  1WGG A;  3OJ4 B;  4RH6 A;  5G2N A;  3UQB A;  1SBB B;  4WJO A;  2NR2 A;  1STE A;  3EFC A;  1MFW A;  2N1W A;  2CHZ A;  2IGD A;  3FAH A;  3WAP A;  3T3O A;  1D5M C;  2DX5 B;  3PVL A;  4EZJ A;  1DGJ A;  1T0S C;  2MBO A;  4W9E A;  3JSV A;  4JLC A;  3JW0 X;  2FE8 A;  4MM3 B;  3LDZ E;  3RUL A;  1TS3 A;  2JY6 A;  3W5V B;  4CHK A;  1WXQ A;  2FCS A;  1YJI A;  4ANV A;  5BMG A;  1ZE3 D;  2YEP F;  2G4S A;  5LLI A;  3WAL A;  2VH1 A;  5AZG A;  2J53 A;  2KNB A;  2MLB A;  4JWS C;  3TCA A;  3MJW A;  2JYT A;  2XBB C;  4MDK E;  3GE3 C;  5FKA C;  3ZJV A;  2XNA C;  1WGK A;  3W5U B;  1R4N B;  2C9W B;  1FO4 A;  3R2I A;  2KYW A;  2V4I B;  4GDL A;  1EWC A;  4HCN B;  5H92 C;  2K5P A;  2G3Q B;  1IPG A;  3DQV A;  1V5O A;  2WXH A;  2KMM A;  4P1C C;  2WWZ A;  4ZRJ A;  1PYW D;  1RRB A;  4A9A A;  2D2Q A;  2J4X A;  1J7B A;  2B76 B;  3DBR I;  2WYQ A;  3PGE A;  5C1Z A;  1EUV B;  3ZRF A;  2Z8L A;  1OTR B;  2ASQ A;  2ZNV C;  1ZUD 2;  4BBN F;  4MGK E;  3L13 A;  4LCD E; 
#chains in the Genus database with same CATH homology
 3GS2 A;  1SE2 A;  2WQY B;  4RGM A;  4ZHP A;  2LEK A;  4C56 C;  3ETR A;  3AE8 B;  4IKG A;  1MPE A;  1JRP A;  2L83 A;  1TYG B;  1C77 A;  4XWT A;  1FNU A;  5H8Y E;  4RGN A;  2NTS A;  3AEF B;  3IXS A;  3NVY A;  2Y3A A;  2ZW0 A;  1E6E B;  2SAK A;  4XE0 A;  5LNK 1;  2KDM A;  2HDE A;  4NAW B;  1OQQ A;  5D3D A;  3NVW A;  1F77 A;  3L4P A;  3TUO A;  3W9C B;  2PIA A;  4ZRQ A;  3B9J A;  1XCQ L;  1NYR A;  3MC0 B;  3MHZ A;  1WWT A;  1QKZ A;  1IGC A;  1XF5 L;  2M56 B;  1N61 A;  4UDU C;  1CK1 A;  2WXI A;  2Y5C A;  3Q8A A;  4DQO C;  1FNW A;  2D5G A;  2N0S B;  1GOZ A;  3HVZ A;  2WXQ A;  3GP7 A;  1HXY D;  3AE9 B;  4YTN B;  1XXG A;  1F2R I;  2J42 A;  3PZ8 A;  5EE9 A;  3U4E G;  2VZK D;  2H88 B;  2QIL A;  4HKQ A;  3RFZ B;  3U7Z A;  1MVK A;  2W54 A;  1K50 A;  1GB1 A;  4CQN A;  2TSS A;  1I4Q A;  1FXA A;  2HTM E;  1K52 A;  3PO0 A;  2LHE A;  1E10 A;  2JU6 X;  2JWU A;  1QF6 A;  5BYR A;  3V3X A;  1I4G A;  4OHJ A;  1FCC C;  1T5X D;  1WYG A;  1HEZ E;  1JWU D;  1RWS A;  2WLB A;  1WSP A;  4N59 A;  3ZJU A;  1QOG A;  1VZ6 A;  3V05 A;  4EE2 A;  4NAM A;  5AUK A;  1OFF A;  1DOX A;  2L32 A;  1YJJ A;  2WNM A;  1BML C;  5D7G A;  1FXI A;  3VR9 B;  3CWI A;  5AUI A;  1UGJ A;  3ZJT A;  4MT5 A;  4XDC A;  1F0Z A;  1NYQ A;  1VDV A;  3DWG C;  2Y5P A;  3P42 A;  1E7P B;  2W82 A;  1PFD A;  1AN8 A;  2WP9 B;  3AE6 B;  3P4P B;  2MH7 A;  1L0V B;  1N5W A;  2EEL A;  2R61 A;  5MPO A;  1D5X C;  1KLG D;  1CJE A;  1QOF A;  1TJE A;  3EGR A;  2IJ0 A;  5BMH A;  3FIL A;  1V1P A;  1SB3 C;  5EE0 A;  2WDQ B;  2INN E;  1P7E A;  3AB5 A;  2NMQ A;  2V3N A;  2CJO A;  3NZ3 A;  1JWA D;  4ZYS A;  5JXV A;  1TS4 A;  3AMZ A;  3O13 A;  1ACC A;  3AEB B;  2KWD A;  5GXG B;  1B9R A;  3ZYY X;  3TEZ A;  4TMA B;  4KGR A;  1PUT A;  4YWG G;  1SF0 A;  1KFY B;  1QT9 A;  3OWE B;  2DYO A;  1L0Y B;  1YN3 A;  2SEB D;  1D6E C;  3R2T A;  2QJL A;  2WXK A;  2PLP A;  3BK2 A;  1HQR D;  1KLU D;  4JWU C;  4L1B A;  1Y56 A;  1SSN A;  2MJE A;  4ARI A;  4A55 A;  2GB1 A;  1TY0 A;  3P63 A;  4HEA 1;  4HJG E;  1P7F A;  3RPF C;  4KGT A;  4MH8 A;  1IBX B;  2RPV A;  4OZA A;  5EE1 A;  1E9M A;  3J9C A;  2K9X A;  3AE2 B;  4H2A A;  1D4B A;  5G5H A;  1KRH A;  2DLB A;  2WXM A;  1ET9 A;  3CIR B;  4LTU A;  1N63 A;  1ZPS A;  2WXP A;  3MFG A;  2L1A A;  1GAQ B;  2JXT A;  1XLQ A;  1FNV A;  4RNA A;  5D3I B;  2KAJ A;  5HG2 A;  3AV8 A;  2RDG A;  2PVG C;  3U2S C;  2MJ3 A;  1NI3 A;  3B2F A;  4US9 A;  4GLS C;  3AEC B;  2WXF A;  1YMH E;  2V3P A;  3AEG B;  2LHD A;  2W55 A;  1SE4 A;  3TEX A;  1VR9 A;  2K22 A;  4HRS A;  1QIL A;  3IT4 B;  3AN1 A;  1RFK A;  4ITK A;  4R3D A;  1AW7 A;  1N60 A;  1ZP0 B;  4GDL B;  1XLO A;  3BK1 A;  3BII D;  1FD6 A;  2IPK D;  2WDR B;  4FXC A;  3URY A;  3ZGZ A;  4ARC A;  2WU2 B;  1TKY A;  3P1M A;  4RF1 A;  4JX1 C;  2IDY A;  3IAM 1;  1J7C A;  3LXF A;  2I38 A;  3NS1 A;  3P4S B;  1CQV A;  2Q5W D;  3LB8 C;  1AWD A;  2VZK B;  2PMV A;  2XN9 C;  1GB4 A;  1HA5 A;  1V1O A;  2BBC A;  3B2G A;  3KWV A;  5HHD G;  1PGX A;  1UWX A;  3BVG A;  4P16 A;  4KKI A;  2ON8 A;  1L0X B;  1CZP A;  3VR8 B;  2W3S A;  1EWY C;  2IGH A;  4USA A;  2N9K A;  1RYJ A;  3AEE B;  1MI0 A;  3HUI A;  2N7J A;  1TKE A;  2LUM A;  3LYY A;  4US8 A;  1FIQ A;  1T6B X;  4HRO A;  1XCT L;  2MJD A;  1L6V A;  4YSZ B;  2WDV B;  5FR3 A;  4LK0 M;  3P4Q B;  2BS4 B;  4JPS A;  4B0E A;  4YTP B;  3SFD B;  2M0A A;  3TEW A;  4P6V F;  1Q10 A;  2KAC A;  2L52 A;  4YT0 B;  1OQR A;  2G1E A;  4IDI A;  2K0P A;  2AQ1 B;  1DOI A;  1L4D B;  1K51 A;  1QLB B;  4C7Y A;  2G9H D;  1K53 A;  3AE7 B;  3BYY B;  3MJ5 A;  1WRI A;  1V97 A;  1KH0 A;  1VJK A;  2GI9 A;  1I4X A;  5I4D A;  2BS3 B;  2QSD A;  2BW2 A;  5TSS A;  3KQ4 A;  1TKG A;  1YNT E;  3AEA B;  3AH7 A;  4WUR A;  4YSX B;  4YXD B;  1ESF A;  2CU3 A;  1PGB A;  4RGO S;  2K3U A;  3VRA B;  1L6U A;  3KLS X;  2BTE A;  4HKZ E;  3UI3 A;  1UWM A;  2ZW1 A;  3SR6 A;  1JAL A;  2OED A;  1VZ7 A;  3E9S A;  4ZRP A;  4WH4 A;  1JWB D;  3TSS A;  3NVZ A;  2JX5 A;  3NVV A;  3VQI A;  5HFY A;  1ZDV A;  3AED B;  1TY2 A;  4ZOH C;  1DYQ A;  2BYT A;  2WU5 B;  1C79 A;  1JML A;  4TQ0 A;  1RM6 C;  1ENF A;  1PDX A;  4NZL B;  2CJN A;  1SEB D;  2EKI A;  1N5X A;  1SJH D;  2KQ4 X;  2PW9 A;  3R8B A;  2BS2 B;  2AQ3 B;  2ICI A;  1VZ8 A;  1NEN B;  1SJE D;  1QQR A;  1B1Z A;  1YN4 A;  2BB5 A;  3W1S A;  2JSV X;  1LO5 D;  4L23 A;  1EM7 A;  4IOI E;  1FM0 D;  1PGA A;  1XO3 A;  2J52 A;  2E3T A;  2WXN A;  3FIL B;  1JWS D;  1BUI C;  1MHH E;  3AE1 B;  3N9Y C;  3BYT B;  1KF6 B;  1YQ3 B;  4WQM A;  3NRZ A;  3P4R B;  1I7H A;  3IT6 B;  3NUH B;  1HZ5 A;  1VLB A;  1MHX A;  5FK9 C;  1AYF A;  3AE5 B;  3KWL A;  1JQ4 A;  2WXL A;  1ZDX A;  1EU3 A;  1ZXI A;  4RFB A;  1UUP A;  3U52 E;  3HVD A;  1HZ6 A;  1V8C A;  3Q8E A;  2PKO A;  1JRO A;  2AX5 A;  3Q69 A;  1TZO A;  1C4P A;  1T3Q A;  3AE4 B;  3BWU D;  4RF0 A;  1SXT A;  2LGI A;  2PTL A;  3I9V 1;  2BB6 A;  3SEB A;  2QIE B;  4KKJ A;  1FMA D;  4OVZ A;  1TS2 A;  3BVZ A;  5BYS A;  4B0M A;  2FUG 1;  1SIJ A;  3MP9 A;  3C8Y A;  4D2K A;  2X38 A;  5BMI A;  1I4R A;  2N9L A;  3IAS 1;  1D5Z C;  2WXR A;  4ZHO A;  4Q2J A;  4XWW A;  1L4Z B;  3ABV B;  2LFI A;  4DXG A;  2JQR B;  1QOB A;  1TS5 A;  1IUE A;  3E56 A;  3ZQ4 A;  1IGD A;  2JZP A;  4M0W A;  1ZOY B;  2ONQ A;  4KGS A;  3W2D A;  1J7A A;  3PZ7 A;  3Q8F A;  2KN4 A;  4WWM A;  2QEJ C;  4XDD A;  3T3N A;  4TQ1 A;  4WAF A;  4A6Q A;  4GDK B;  2AQ2 B;  3DWM A;  1FRR A;  2W3R A;  1YQ4 B;  4KX6 B;  2I2Y A;  4L2Y A;  2LJI A;  1FEH A;  4YSY B;  3BVM A;  4DXF A;  1F2R C;  5E6J A;  2JYE A;  2E6X A;  1VRA B;  2WXO A;  4RH6 A;  1EU4 A;  1DOY A;  1SBB B;  4A90 A;  4NJC A;  4C7Z A;  2M19 A;  1FRD A;  1UNS A;  3Q8B A;  1STE A;  3SFE B;  4AS1 A;  1FCL A;  4A8X C;  2IGD A;  4N6E B;  2FBW B;  3FAH A;  2GRI A;  3T3O A;  4N58 A;  1D5M C;  3H8H A;  1GPX A;  2H89 B;  4C80 A;  1SE3 A;  2WS3 B;  5G5G A;  4YTM B;  1DGJ A;  3I57 A;  5C3J B;  1C4C A;  1BXT A;  2OHF A;  3EA6 A;  1L5P A;  1I4P A;  1XEE A;  2INP E;  1IBX A;  4OZC A;  2FE8 A;  4RGT A;  3GB1 A;  4MM3 B;  4LLG M;  1TS3 A;  3HRD D;  5HI1 A;  3W5V B;  1KTK A;  4O1N A;  2DWQ A;  2LMC A;  1WXQ A;  1YJI A;  1XLN A;  4WIP A;  1I4H A;  5BMG A;  1FFU A;  4AQ7 A;  3BZD B;  1ZE3 D;  1NVI D;  2YEP F;  1YN5 A;  1ZXH A;  3EUB 2;  1XLP A;  2WXJ A;  2DYM A;  4JE3 B;  4REZ A;  1C76 A;  1JWM D;  2J53 A;  2PVO D;  4JWS C;  2JYT A;  1QOA A;  5FKA C;  5EE3 A;  3Q8C A;  3ZJV A;  2XNA C;  2WXG A;  1WGK A;  3W5U B;  1N62 A;  1JW9 D;  2IGG A;  3AE3 B;  2BT6 A;  3R2I A;  2V4I B;  1FO4 A;  1E0Z A;  2MEK A;  1C78 A;  1EWC A;  1R7S A;  5H92 C;  2K5P A;  1FFV A;  4OW0 A;  4PT5 A;  4OZB A;  5BYQ A;  3FC4 A;  1M4V A;  2WXH A;  1V1P B;  3WCQ A;  1A70 A;  4MAC A;  2ACZ B;  2KMM A;  2V0G A;  2YEP B;  2NTT A;  1ROE A;  1PYW D;  5T8I A;  4A9A A;  3AM9 A;  1C4A A;  2J4X A;  2RDH A;  1J7B A;  2B76 B;  1NEK B;  2RMM A;  1C9F A;  1ET6 A;  2Z8L A;  4RCO A;  2QMT A;  2DBY A;  1JCK B;  1ZUD 2;  5C2T B;  3TEY A;  4TSS A;  3VRB B;  4J3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...