5AUIA

Crystal structure of ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
96
Chain Sequence
ATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQSDQSFLDDDQIEKGFVLTCVAYPRSDKILTNQEEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-1
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Thermosynechococcus elongatus (strain bp-1)
total genus 26
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5auiA00
2WDQB 1ZOYB 1J7AA 3BIID 3P63A 3P4RB 2HTME 1IUEA 1N61A 1NVID 3AE1B 3NVZA 2W3RA 3NVWA 1QT9A 1V97A 4ITKA 4ZHPA 1DOXA 1RYJA 1RWSA 2G1EA 2QJLA 3AMZA 3FAHA 1AWDA 2DWQA 2WS3B 3DWMA 1V8CA 1E6EB 4P6VF 3VRBB 3AE3B 1B9RA 1XLQA 1VDVA 1RFKA 4A9AA 4LTUA 3KWLA 3EUB2 2PKOA 1NEKB 5AUIA 4YTNB 1SF0A 1WGKA 2W54A 3AE2B 1JWAD 1NYRA 1TKGA 1I7HA 1YQ4B 1PFDA 3ABVB 4FXCA 1QOAA 1N5XA 4N6EB 1SB3C 3AE5B 2WLBA 1QLBB 2K9XA 3L4PA 1DOIA 2BS3B 1FIQA 1E9MA 4JWUC 5EE1A 4WQMA 3AH7A 4C7YA 1UWMA 2B76B 4YSZB 2Y5CA 4YTPB 4US9A 1YJIA 1L6VA 4KX6B 1QOFA 2L83A 3P4QB 5C2TB 3AE4B 2BS4B 2M19A 5AUKA 1TYGB 1ROEA 2JQRB 2ACZB 4YXDB 1F0ZA 1WRIA 1XLNA 1ZUD2 2LEKA 2EKIA 2WU2B 1EWYC 5EE9A 1E7PB 3CWIA 1QOGA 1KFYB 5H92C 1FXIA 1NYQA 2W3SA 1JALA 4US8A 1L6UA 5C3JB 1RM6C 3AV8A 2MJDA 3P4SB 1JROA 1N62A 1XLOA 3VRAB 3W9CB 1E0ZA 3AE9B 3AEAB 1YJJA 3ZYYX 3B9JA 5G5GA 4YSXB 1YQ3B 4YSYB 5EE0A 1L5PA 2PIAA 4ZOHC 1E10A 1TKYA 4WWMA 1XLPA 4ZHOA 3WCQA 1A70A 1L0VB 1WXQA 2WU5B 4HRSA 4USAA 3HVZA 1N5WA 3AN1A 2H89B 3AE7B 1CZPA 2MH7A 3W5VB 1DGJA 2BS2B 3AEDB 2KMMA 2DBYA 1JW9D 1T3QA 2H88B 1WWTA 2Q5WD 2W55A 3AM9A 1XO3A 1CJEA 3NS1A 1JWBD 1ZXIA 2OHFA 3PO0A 2WP9B 3LB8C 1FRRA 1N60A 2K22A 3VR9B 1FMAD 1VJKA 1R7SA 1NENB 2L52A 2M56B 3AE6B 4IDIA 1GPXA 5H8YE 3B2GA 3FC4A 3P1MA 1WYGA 4N58A 2KAJA 5MPOA 2WDRB 1AYFA 3AEGB 4HROA 5G5HA 2FBWB 4C7ZA 5EE3A 4YTMB 5GXGB 2JX5A 1KF6B 1PDXA 3NVVA 1FRDA 3VR8B 3CIRB 1JRPA 3W5UB 1J7CA 2K5PA 4N59A 2PVGC 1FM0D 1PUTA 1SIJA 1VLBA 3DWGC 3NVYA 3RPFC 3HRDD 1FO4A 1JQ4A 1FFVA 3P4PB 1NI3A 1J7BA 3AE8B 3LXFA 1GAQB 3AEEB 4C80A 3AEFB 1QF6A 2N0SB 4JWSC 3NRZA 3SFDB 2CJOA 2E3TA 1TJEA 1ZP0B 1OQQA 2MJEA 1FXAA 1QOBA 2WDVB 3AECB 3B2FA 2MJ3A 4JX1C 2BT6A 1OQRA 2AX5A 2QIEB 2WQYB 3AB5A 2CU3A 1FFUA 1DOYA 1N63A 3AEBB 2PVOD 4YT0B 3ETRA 3HUIA 3SFEB 3SR6A 1OFFA 1KRHA 1TKEA 2CJNA
chains in the Genus database with same CATH superfamily
4NAWB 4KDIC 3NVZA 3NVWA 2FIFA 3L17A 1L2NA 2BWES 2QCZA 4IWOA 5CHVC 1NEKB 4ZRKA 4GOCA 4NAWA 2NBUA 3VTVA 1HZ6A 3ABVB 3ZVVA 3AE5B 4IG7B 2NCNA 5LXHA 5D2MB 2JQRB 1XD3B 4EOYA 2LEKA 2DHZA 2RDGA 3LJ3A 2WXPA 2IO3B 2GMIC 3I63C 4K7SA 5AZGA 1JROA 1WGRA 3CF6E 3AE9B 3ZYYX 5G5GA 4TUUA 1V5TA 2CHWA 4P1BC 2WU5B 2ZEQA 1P0RA 3L13A 2LXAA 1PGAA 1S3SG 4FJVB 2WHIA 3TUOA 1FRRA 2LVPA 3Q69A 3EGRA 4J6IA 2C5LC 4K3BA 3RNCC 2WXMA 1YOVB 3V6EB 1JWSD 2NTTA 5D7GA 5CHFA 1YQBA 1C9FA 1ZDXA 2V4IB 2LGXA 5E6OA 1EWCA 3VQIA 1XQQA 5J17A 5DPWA 3LXFA 4JQWC 1L0YB 3S2AA 2PMVA 3DBRI 3PHWB 4JX1C 1OQRA 2DAFA 2CU1A 1FFUA 1WMHB 4IWQA 2L0FA 3VXWA 4C56C 1IBXA 3Q14C 4RMAA 2JRHA 3PLVA 4KGTA 1E8ZA 3RNAC 2Y5BB 3ENEA 1RWSA 2KT7A 2D3GA 2X38A 1WJUA 4HXDA 5G55A 5E6JA 2N7JA 4W9GA 3EFUA 4M02A 1XXGA 3P4QB 3AE4B 5IOIA 2R2QA 1CMXB 2JU6X 2JWUA 1E7PB 1SIFA 2L05A 1FNUA 2J4XA 1N62A 2LGDA 2C60A 2KX0A 4XWWA 4P7IA 5TR5A 1EM7A 2PJHA 2H89B 3AE7B 2I1KA 4LNNA 2K6DB 4W9KA 3H7SA 1I4PA 3MP9A 1TZOA 3ZXRA 4B6WA 3W2DA 1VJKA 3T8MA 4DHJD 1SXTA 4OZAA 3P1MA 4L2YA 1EUVB 1GB1A 3BVZA 3NJTA 3ML8A 1WGYA 2LZ6A 1FNWA 2ZCBA 1EO6A 1TGZB 2O6VB 3U2SC 4M8MA 1C1YB 1XF5L 2N9EB 4ZRIA 4RGOS 4DDGD 4HJKA 2CKHB 2M0XA 2LRUA 2N7DA 2N9PC 2JT4B 2K8HA 4M0WB 4RH6A 1F2RI 2AX5A 1UBIA 1TIFA 4LNKA 2JXXA 2LGIA 4ANWA 3L16A 3Q3JA 1N61A 1WGHA 2KDMA 4M0WA 1D5XC 2G1EA 2WS3B 1V8CA 3QQ8B 4MGKE 3N9YC 3MHZA 4PK1A 4EUTA 3EUB2 3UQAA 5GMVA 4JIOU 1GC7A 5E6PA 2HE7A 4IWPA 4ZRQA 1R4MI 3JSVB 5AUKA 1ROEA 4I6PA 1WXMA 2WXHA 3MC0B 5H92C 3R3MA 4OZCA 3A33B 1FD6A 1JALA 1L6UA 1J0GA 4HPMB 1NDDA 4NZLB 4PS8A 2GBNA 4RCOA 1V5OA 1ZE3D 2KD0A 3R2TA 1Z2MA 2NMQA 3ZNZB 5KHQA 2BB5A 3KYDD 4B0MA 4FN2A 2IO1B 3PRMB 3B1LX 4GDKB 2KZRA 2BGFA 4ANXA 5BYQA 2BB6A 3NZUA 1GOZA 2KNBA 3IT4B 1MG4A 2AWTA 1KF6B 1R4MB 1WSPA 1J7CA 2PVGC 1TS4A 3KVFB 5D3IB 4W9LA 3ZRFA 3KWVA 3V60A 4XWTA 2NPTB 3IFWB 1MI0A 1UELA 3E9SA 3NRZA 2IJ0A 4JLCA 3GZNI 2K8CA 2WXKA 2BT6A 4E3CA 2WQYB 1DYQA 2KWVB 2CHXA 1KLVA 2BYFA 2KJHB 2PVOD 4G3XB 2MWSB 3VTUA 5CX3A 3NZSA 4JE3B 3A1QB 3AE1B 2I38A 3N1YC 1RYJA 4P6VF 4A6QA 1EU3A 3APDA 3WAMA 1J19A 2DENB 4URKA 2GBKA 2FCSA 1WX7A 3A1QA 2PPHA 2NR2A 4LDTD 4CYEA 4RM8A 2KDIA 2Z0EB 1V49A 1M4VA 4WQMA 1VZ6A 2FCNA 1YJIA 4L1BA 2ZCCA 1I4XA 1WRIA 2EKIA 4AWJA 1AARA 2WXOA 3UIPB 2IDYA 3W9CB 3A9JA 2HDEA 1WI0A 4YSYB 2JXTA 1UZXB 1OEYA 3AI5A 3GB1A 2RPQA 3B08A 1KM7A 1ZKHA 4MGZE 3Q6BA 1FMAD 3Q8CA 5IKCM 2GBMA 2MA9B 2QEJC 3QAQA 1WE6A 5H8YE 1KLGD 4IC7B 4TV3A 5MPOA 3P2BA 3RNBC 3URYA 1T0YA 2V3PA 2L7RA 2DX5B 1MVKA 2Y3AA 3W5UB 4KGRA 4RF1A 3NS8A 4BKSA 3R7RA 1FPYA 1WXAA 1YJ1A 1WY8A 2LVQA 2MEKA 4BOSC 5C1ZA 2DLBA 5CHWA 2PE9A 1UBQA 3UI3A 4HKZE 5C23A 2C9WB 1HZ5A 2KTRB 4KDLB 1D4BA 4KKJA 1C77A 4KSLC 2ICIA 3VH3B 4XE0A 4W9IA 1ZPSA 3C19A 3W1SA 1ZDVA 1BUIC 2NS5A 3AE3B 4W9DA 1A5RA 4ANVA 4MM3B 2KXJA 2KWUB 1JWAD 2GBRA 3A4SC 1I7HA 4JWUC 4MM3A 3RZWC 3IT6B 3DHHC 1SJED 2RD0A 2RDHA 2WXFA 1QQRA 1KFYB 2W3SA 1D6EC 1Q1OA 4YWGG 2G4SA 2KMCA 4BFRA 3RI7C 4ZYNA 4ZHOA 3Q8FA 1TS5A 2Y5PA 1ISNA 4MGYE 2PLPA 1JW9D 5IAAC 1WWTA 5JHBA 1LGRA 3WAOA 2OHFA 4ZRJA 2WXGA 3DHIC 2ON8A 2J42A 2KAJA 1CQVA 2DYBA 1SJHD 2B3AA 4HPPA 3T3OA 3I5JC 3MC9A 1ACCA 2HJ1A 2QC8A 2C7MB 4BOZB 4WAAA 1L4DB 4G50A 3ZLZA 3QHTA 3MC8A 1TJEA 4MJSA 1OQQA 4WWOA 3NG0A 1UGJA 2NTSA 2G3QB 4KV2A 4AS1A 3UF8A 3HUIA 3ZTCA 4LCDE 4DDID 2GI9A 2KFJA 3QC8B 2BF8B 1IUEA 3DVGY 5JXVA 4KGSA 2N9KA 3PV1A 3E56A 2ZVOA 1WZ0A 2K1FA 3M3JA 5AUIA 1VR9A 2BWFA 2IYDB 2IY0B 1Q5WB 2HJ8A 4PS3A 4LK0M 1F52A 2ZVNA 1UH6A 3VH4B 4XC2A 2WXNA 3TL5A 1TYGB 2MSED 4E71A 5JH5C 2KTFA 3VUWA 3DQVA 1HQRD 1RM6C 3A4RA 1V2YA 4B9KA 2WGSA 2PIAA 2AYOB 4NNJB 2DNFA 5BO4B 2BS2B 4M01A 1WZ3A 4PYZA 3Q3OC 1LQBA 3AM9A 4N9F4 3LB8C 2SEBD 1U4AA 4W9JA 3KQ4A 4I6NB 1KTKA 1R7SA 4MT5A 1C3TA 1AN8A 4N58A 2INNE 3ZGZA 3SHQA 3PTFC 2KO3A 2WXLA 3NUHB 2LGSA 2ZJDA 3NVVA 1QZEA 1SE9A 1ZGUB 1FM0D 1VRAB 3KYCD 3I57A 1FFVA 1TT5B 3VAWA 4RGTA 4FHJA 2K25A 3P42A 2WDVB 1QOBA 3B2FA 4P1CC 1E8XA 3SD5A 2LGYA 2BKRB 4RGNA 1ZOYB 2WYQA 4TSSA 3P4RB 2HTME 3AU4A 3DBLI 4OVVA 2LJIA 4RFBA 3NHEB 5BMHA 3DWMA 1E6EB 3AULA 4XZ4A 5EDSA 2OJRA 1FCCC 4A9AA 1M94A 5FR3A 4QAYA 3AE2B 1WJ4A 2AEHA 3RCZA 2EELA 5BYRA 1QLBB 1FIQA 4MH0E 1YN4A 2L76A 2MQJA 2Y5CA 4TMAB 3AXCA 2R2OA 5C2TB 2D3BA 1F0ZA 1WMHA 2KOXA 2JZ3B 3TEWA 1RAXA 4WJNA 3AV8A 5JZEB 4MSMB 2IGGA 2L00B 2ZNVC 3ZXVA 4B95A 5L95C 1PYWD 4WIPA 1C79A 3MTNB 4C4VB 3DBLB 1PQSA 5BMGA 1VZ8A 2KMMA 3K9OB 4S0RA 1F77A 1MFWA 3DBRB 4BBNC 2L8JA 1SE2A 1WX8A 3VR9B 4IUMB 2O6VD 3TEXA 4ARCA 3AE6B 3APCA 1JMLA 1LM8B 3IAS1 3MJ5A 2FBWB 1YIWA 2LUMA 1FRDA 4FJYA 4A8XC 4MGIE 3TIXA 4XDCA 4GU2A 2N9LA 4NJ6A 4ANUA 1UF0A 4OW0A 2E3TA 2MJEA 4RGMA 3AB5A 4XGAB 1CK1A 3HIZA 2D5GA 1J8CA 1SGHA 4HLEA 3GP7A 3W1SC 3VFKA 4WQOB 3ZTDA 1T0SC 2AQ2B 2N4FA 4HEA1 2LRWA 4IW0A 2NBVB 2AQ3B 2KQ4X 1ET6A 3X0WA 1XLQA 4LTUA 2G4DB 1E7UA 4IOIE 2WNMA 4W9EA 2KDEB 2LJ5A 2MW5A 4FXCA 3ECIA 2XEWA 3ZO5B 1D5MC 2O6VA 4WWPA 2ONQA 1S1QB 3GOEA 2L0TA 2W9NA 2J0MA 1FXTB 4KX6B 4YXDB 2KWCA 1T0QC 2DZIA 4MELA 1C4AA 3CWIA 5IN7A 2C7NB 1MHHE 4NY0A 3N32A 4GDLB 2OEDA 2N9XA 4D2KA 2M8SA 1OQYA 1TTNA 3DHGC 3V62A 4ICUA 2LVOA 2QDFA 3AEDB 4YL8A 4DHJB 1GNUA 3APFA 3PPAA 2WP9B 1BXTA 2BYVE 1TZ1A 2L32A 1VD2A 5AZFA 2A4ZA 5HHDG 1NENB 2PW9A 4CHKA 4KSKC 3FKYA 3MJWA 2INDC 2WDRB 3JSVA 4HDOA 4C7ZA 3H8HA 4NQLB 3BVGA 3VR8B 3BK1A 1PUTA 1JCKB 2DZMA 1MJDA 2KX3A 3P4PB 1GAQB 2FUHB 2XN9C 3AEEB 4BBNF 2DZJA 2GOWA 3PRZA 3EA6A 3KUDB 1ZP0B 2L1AA 3Q8AA 4IM3A 3HM3A 4PS7A 2CU3A 2LMCA 1DOYA 2DYMA 2IGDA 4YT0B 3BIID 2V1YA 4E74A 4GDKA 2K6QA 3O65B 4ITKA 4M00A 4FULA 2XK5B 3HM6X 1V1OA 1K52A 5KHOA 1ET9A 4AP4C 1YQ4B 4F8CB 3NOBA 4ARIA 4GSWA 1WGGA 3M95A 2XK5A 2BYEA 2NPTA 3ZJUA 3L4PA 4NAMA 2GRIA 1UWMA 3AU5A 4GGQA 4LJPB 1V1PB 2L83A 3ZIMA 2ASQA 3WIMA 4XYCA 2V3SA 3RUIB 3KUCB 1LXDA 3M62B 1Y8RC 4J3OD 4A55A 4KVGB 1FXIA 1NYQA 2J52A 4FBJB 3EHVA 1I4QA 3V05A 3VRAB 3OG5A 1L5PA 4TQ0A 2IY1B 4BKSD 4LNIA 4FHKA 1L0VB 4LNOA 2GLSA 3ZNHB 4FA6A 4WJPA 4MEMA 5HFYA 3DPDA 1AW7A 3ZRCA 3D32A 4KKIA 2JF5A 3UQBA 4PYUA 4BKTA 3GZNB 4DK5A 4EZLA 1H8CA 1FCLA 3C8YA 3QWZB 2FIDA 2KLCA 2JX5A 4L23A 3WANA 4K7WA 3O13A 3PVLA 3TSSA 3T3NA 4WURA 1NI3A 4MH8A 1BT0A 2N0SB 3I3TB 4JWSC 4WAFA 2LXCA 2MJ3A 2E6XA 2QIEB 1OFFA 3RN9C 4A3OA 3SR6A 2J0JA 5BYSA 1TKEA 2W3RA 2RR9A 5J18A 4JGHB 4HDQA 1HXYD 3B0AA 3VRBB 1WRDB 2JUOA 4PT5A 4YTNB 3DVNU 4AQ7A 1F1HA 4XX5A 1SB3C 1YMHE 3EECA 4ZYSA 1E9MA 5LXIB 2ZPYA 3X23A 2VZKD 2CR5A 1XLNA 2KQ7A 2HTHA 2KTRA 2I1JA 1MPEA 4EZKA 1WR1A 1C78A 3BYTB 1E0ZA 4TQ1A 2QMTA 4ZDVA 2C7HA 4HJGE 2YEPF 5IA7A 3PZ8A 3WCQA 5IO9A 4W9CA 3U30A 4RNAA 2JPHA 4GB9A 3AN1A 1CZPA 2JSVX 2M1MA 2IGHA 2MHJA 4K1RB 2JVCA 5DPSA 4R3DA 1KLUD 2UYZB 1YX6B 2M56B 2XNAC 1AYFA 2V0GA 2Z0DB 5D94A 1ZXHA 3CIRB 2O2VB 4N59A 3HRDD 1T0RC 5LLIA 1V9JA 1MHXA 1I4HA 2Z59B 1WXVA 3AEFB 1TBEA 4W9HA 2KACA 1N63A 3VUXA 3OAWA 1GB4A 3SFEB 5EE1A 5AZHA 1D3ZA 5DCNA 2BQQA 1I35A 4FJZA 2QJLA 2RSUA 4DXGA 4A20A 1STEA 4H2AA 2CHZA 3ZNID 4CO7A 2D3CA 2IZVB 3RT3B 4BAXA 1N5XA 4N6EB 3BINA 1UD7A 1RLFA 1P98A 2KN5A 4GIVA 4KIKB 4A90A 1XEEA 2LASA 2LWPA 1L6VA 2TSSA 3M63B 3H6NA 1IGDA 4B0EA 3PZ7A 2K0PA 1JWUD 1P3QU 5IP4D 3DVGX 3P4SB 2MBOA 3OWEB 5BMIA 1A70A 2REXA 1K50A 3HVZA 3H9DA 4KZCA 2ZZPB 2KFKB 3W5VB 1G6JA 2FUG1 3ALBA 3U4EG 2K39A 4AJWA 3PRPB 1Q10A 2VH1A 1TY0A 1L7YA 2DYOA 3PLUA 1GC6A 1WYGA 3RZFA 5J2RA 1WM3A 1Z5SB 2LD9A 2K5PA 3RPFC 1SIJA 2OOBB 3FILB 1GUAB 1V80A 1J7BA 4DXAB 5JHAA 2NVUI 2V9HA 1RFAA 3EC8A 3SFDB 4Q2JA 3N1ZC 4II3B 3BVMA 4ACFA 1I4RA 1OGWA 1EF5A 3FILA 1YD8U 3IG3A 2J0KA 1Y56A 1NVID 3ONSA 3U8ZA 1WIAA 1HTQA 1E8WA 3FAHA 3R66C 3LDZE 1RFKA 2BTEA 1WE7A 3PHXB 1WGKA 3K9PB 1VCBA 1QKZA 2OJWA 3H1UA 2EMSA 1Q0WB 3SDLC 1C4PA 5FK9C 4AJYB 5DPRA 4C7YA 3PS6A 3W1YA 3LYYA 3DBSA 4DQOC 2RDBC 4GXBA 2KKCA 2INCC 3L0WB 1T6BX 1TS2A 5EE9A 1ESFA 3QCAA 1WM2A 4US8A 1P1AA 2MJDA 3CSTA 1JRUA 3AEAB 1YJJA 2YLMA 1WH3A 4ZRPA 5LNK1 3PGEA 4FLHA 2RMMA 4HRSA 4O1NA 3DDCB 4TKNA 5G2NA 4K7UA 3TCAA 4AOFA 1IBXB 1T3QA 2LI5A 1ZXIA 3VDZA 1UUPA 4EEWA 2KANA 2DAJA 3L54A 4DWFA 2VRRB 2G45B 3SEBA 3BK2A 2G9HD 3FC4A 2X8XX 4JPSA 2CS4A 2PEAA 3Q3NC 3QARA 1UNSA 2KMAA 2MLBA 2LFIA 1JRPA 4MACA 2IO0B 1D5ZC 4EKUA 2BYTA 3BY4B 4HCPB 1SE4A 3HK0A 3WALA 1QF6A 2KDFB 2D10A 3VHTC 2ZPNA 4OVUA 2EMTA 3Q3FA 1XCQL 4P16A 3ZW3A 2AL3A 2VH2A 4C4VA 2A5UA 3DCGA 3ETRA 3VVWB 1EU4A 1EF1A 2FE8A 2JYEA 2JZPA 4KZ0A 3ZJTA 1K51A 2KJ6A 2WXRA 3SU8X 2JY6A 3QIJA 2MCNB 2KC2A 1WR6E 4NQKE 3DBHI 1VDVA 4WJQA 1LO5D 2LUEA 4WJOA 2PKOA 1WYWB 3TEYA 3IXSA 1R4NI 2W54A 4DBGA 4HPLB 2KYWA 2KLGA 2QHOA 2WLBA 2WWZA 1X1MA 1DOIA 3U7DA 1PGXA 3AH7A 4YSZB 5I4DA 4K3CA 4ICVA 1ZW7A 3QA8A 2PTLA 1EWYC 5HKHA 1QILA 4X57B 3KH0A 4MDKE 2AL6A 1XLOA 2M4NA 3UIOB 5EE0A 5T8IA 4A3PA 1TS3A 3Q8EA 2BPSA 3OJ3A 1E5WA 3EFCA 3JVZX 4S17A 1WXSA 4LJOB 4W9FA 3L10B 1IP9A 1DGJA 2DBYA 2GB1A 2H88B 2FCQA 3DBHB 1HE8A 3I9V1 3ML9A 1N60A 2MP2B 4K81A 1R4NB 4IM2A 1GPXA 1SE3A 3GE8C 1UGMA 5EE3A 1WFYA 3IAM1 5GXGB 1SSNA 4LLGM 3WA0A 4OZBA 2V4LA 2MP2A 4M8NA 3JYUA 1P7FA 4GDLA 1JWMD 2K8BA 3BZDB 2N1VA 1FXAA 2JWZA 1IPGA 4F7ZA 1VZ7A 2MX2A 1XT9B 2BBCA 1KRHA 2N1WA 2JYTA 1DOXA 1N6ZA 1AWDA 2WXQA 3CSFA 3Q2AC 1RRBA 3KWLA 4RM9A 1YN5A 2IPKD 3PREA 3BWUD 2KK8A 3R2IA 4REZA 5L83A 1TKGA 1PFDA 2YVCA 3ZDTA 3BYYB 2EKEC 2IBIB 4AUQC 2BS3B 2WXIA 2B76B 3ZDMC 2RPVA 2RGFA 3RULA 1FEHA 4BKGA 2BS4B 1OEYJ 1WF9A 2KJRA 4LNFA 2WU2B 2JRIB 4EE2A 1GG3A 4YSXB 3B9JA 2KVRA 2KWDA 4C00A 4ZOHC 1L4ZB 1TKYA 5CTRC 3R7QA 4EFOA 2BKFA 1PGBA 3J9CA 3HVDA 3U52E 1WJNA 1C4CA 3PZDA 2QILA 4I6LB 3TEZA 1CJEA 3RNFC 2IO2B 2K22A 3PSEB 4HWIB 3RD2A 4G0NB 3B2GA 3Q8BA 3GE3C 4BZAA 1V1PA 4NPNA 4GN1A 2KQSA 1E7VA 1VLBA 3NVYA 3DWGC 2SAKA 2D07B 1FO4A 2FNJB 1JQ4A 2UU7A 1YN3A 3AE8B 2J7QB 3N20C 3RNEC 3RMKC 3UINB 5TSSA 3DOWA 3N3KB 5FKAC 4ASWC 3U7ZA 3RFZB 4II2B 2V3NA 2WDQB 2FCMA 3A9JB 1LFDA 3N30A 5D6JB 1V97A 1WJ6A 4ZHPA 4HK2A 1B9RA 2KC1A 2ZNVB 1WX9A 3L08A 2FAZA 3WAPA 1SF0A 1UWXA 2LHEA 4OHJA 3VTWA 2K9XA 3N1XC 4YTPB 4F1SA 5DPTA 1QOFA 2JZZA 1FNVA 2KVZA 2M19A 2WX0A 2ACZB 2D2QA 1TY2A 2M0AA 1ZUD2 5HG2A 4EZJA 4LDTB 1XCTL 3UGBB 2ZW0A 2DZKA 4DXFA 1YQ3B 1H4RA 2UWQA 4GLSC 1E10A 2L3ZA 2KHWB 3KUZA 1E90A 1N5WA 2MH7A 3V3XA 1WGDA 1NI2A 3NZ3A 2Q5WD 2W55A 3NS1A 2GBJA 3C0RB 3PO0A 2MBBB 3ZJVA 5AEKB 3KW5B 2HD5B 2L52A 4IDIA 3JW0X 2BVCA 2R61A 3MFGA 2INPE 1GJZA 1PDXA 1HTOA 3NY5A 4HCNB 3TBLD 4NJ7A 2BW2A 2MBEA 3DVNV 5FR6A 1V6EA 1V86A 4XDDA 2CJOA 1T5XD 4MSQB 2KN4A 3AEBB 3GS2A 3ZNGC 1YX5B 1YNTE 2WDTB 3HHMA 3IBEA 2CJNA 3ZQ4A 2J53A 1KOTA 1J7AA 3P63A 1K53A 4OVZA 1SEBD 1QT9A 4WWNA 2K3UA 4IKGA 3KLSX 4BVUC 3AMZA 2DWQA 1IYFA 1ENFA 5E6NA 4G11A 1KH0A 2NBWB 2LHDA 4DHZB 2WXJA 4IM0A 4UDUC 2O2VA 1NYRA 3RNGC 1QOAA 4HVBA 2ZW1A 4FADA 2VZKB 1OTRB 2KDBA 3TMPB 1B1ZA 4US9A 2N7EA 3R8BA 4JL9A 3MHSD 3OLMD 3V61A 1QOGA 1HEZE 1MG8A 4RF0A 1IGCA 2PE6B 2W82A 1P7EA 4MJSB 4CQNA 4WWMA 3QJZA 1KJTA 1XLPA 3V6CB 3ZUNA 3Q3MC 1WXQA 3H7PB 1NBFC 4USAA 2Z8LA 3IHPC 3A9KB 4GMVA 2D11A 1C76A 3TJPA 1HA5A 3QK0A 3VUYA 1XO3A 2MBHA 1JWBD 3H7PA 3RYTA 2M17A 1E8YA 2I2YA 4KIKA 1V81A 3A9KA 1I4GA 1P9DU 3AEGB 4HROA 5G5HA 4YTMB 4WH4A 3PT2B 1SBBB 2MRPA 1F9JA 3OJ4B 1BMLC 3QX1A 4NJCA 2XBBC 4C80A 1K8RB 2YEPB 2QSDA 5C3JB 3AECB 3T9LA 2AQ1B 4HKQA 1L0XB 4DHZE 2WX1A 5HI1A 1I42A 3IVFA 2MBQA 3ZKJC 2D3AA 3CMMB 2KFKA 1F2RC 5D3DA
chains in the Genus database with same CATH topology
1EU4A 3BIID 4NAWB 1C77A 2FE8A 2JZPA 2JYEA 3NVZA 3NVWA 1K51A 2WXRA 3ZJTA 4ITKA 2ICIA 4XE0A 1ZPSA 3W1SA 1ZDVA 1BUIC 3AE3B 1VDVA 1V1OA 1LO5D 2PKOA 1NEKB 4MM3B 3TEYA 3IXSA 1K52A 1ET9A 2W54A 1HZ6A 1JWAD 1YQ4B 1I7HA 3ABVB 4ARIA 3AE5B 2WLBA 3ZJUA 3L4PA 1DOIA 4JWUC 4NAMA 2GRIA 1PGXA 3AH7A 1UWMA 4YSZB 5I4DA 1V1PB 2L83A 3IT6B 2JQRB 1SJED 2PTLA 2LEKA 2RDHA 2RDGA 1EWYC 2WXFA 4J3OD 1QILA 1KFYB 1QQRA 4A55A 2WXPA 1FXIA 1NYQA 2J52A 2W3SA 1D6EC 4YWGG 1I4QA 3V05A 3VRAB 1JROA 1XLOA 3AE9B 3ZYYX 5G5GA 5EE0A 5T8IA 1L5PA 4TQ0A 1TS3A 3Q8EA 4ZHOA 3Q8FA 1L0VB 2WU5B 1TS5A 2Y5PA 1PGAA 5HFYA 2PLPA 1DGJA 1AW7A 2DBYA 1JW9D 2GB1A 2H88B 1WWTA 4KKIA 3TUOA 3I9V1 2OHFA 1FRRA 1N60A 3Q69A 3EGRA 2WXGA 1FCLA 3C8YA 2ON8A 1GPXA 2J42A 1SE3A 2KAJA 2WXMA 1CQVA 5EE3A 1SJHD 3IAM1 5GXGB 1SSNA 2JX5A 4L23A 1JWSD 3T3OA 2NTTA 5D7GA 1ACCA 4LLGM 3O13A 4OZBA 1C9FA 1ZDXA 3TSSA 2V4IB 3T3NA 4WURA 1L4DB 1EWCA 1P7FA 3VQIA 1NI3A 4MH8A 3LXFA 1L0YB 2PMVA 1JWMD 2N0SB 4JWSC 3BZDB 1TJEA 1OQQA 4WAFA 1FXAA 4JX1C 2MJ3A 1UGJA 1OQRA 2E6XA 2NTSA 2QIEB 1FFUA 1VZ7A 4AS1A 4C56C 1IBXA 3HUIA 2BBCA 3SR6A 5BYSA 1KRHA 1TKEA 4KGTA 2GI9A 1IUEA 2W3RA 2JYTA 5JXVA 1DOXA 4KGSA 1RWSA 2N9KA 1HXYD 3E56A 3VRBB 1AWDA 2WXQA 2X38A 3KWLA 1YN5A 4PT5A 2IPKD 5AUIA 4YTNB 3BWUD 1VR9A 5E6JA 3R2IA 4REZA 1TKGA 2N7JA 1PFDA 4AQ7A 3BYYB 1SB3C 4LK0M 1YMHE 2BS3B 4ZYSA 1E9MA 2WXIA 2B76B 1XXGA 2RPVA 1FEHA 2WXNA 3P4QB 3AE4B 2BS4B 1TYGB 2VZKD 1XLNA 2WU2B 2JU6X 2JWUA 1E7PB 4EE2A 1MPEA 1FNUA 1HQRD 1C78A 1RM6C 2J4XA 1N62A 3BYTB 1E0ZA 4TQ1A 2QMTA 4YSXB 3B9JA 4HJGE 2KWDA 2YEPF 2PIAA 4ZOHC 4XWWA 1L4ZB 1TKYA 3PZ8A 3WCQA 4RNAA 1PGBA 1EM7A 3J9CA 3AN1A 3HVDA 2H89B 3AE7B 1CZPA 2JSVX 3U52E 2BS2B 2IGHA 1C4CA 2QILA 3AM9A 3TEZA 1CJEA 1I4PA 3MP9A 1TZOA 3LB8C 2SEBD 3KQ4A 3W2DA 4R3DA 2K22A 1VJKA 1KTKA 1KLUD 1R7SA 4MT5A 2M56B 1SXTA 3B2GA 2XNAC 4OZAA 3Q8BA 3P1MA 1AN8A 4N58A 2INNE 4L2YA 3ZGZA 1AYFA 1V1PA 2V0GA 2WXLA 3BVZA 3NUHB 1GB1A 1ZXHA 3NVVA 3CIRB 4N59A 1FM0D 1VRAB 1VLBA 3DWGC 3NVYA 1FNWA 2SAKA 3HRDD 1FO4A 3I57A 1JQ4A 1FFVA 1YN3A 3U2SC 1MHXA 4RGTA 1I4HA 3AE8B 1XF5L 4RGOS 3AEFB 3P42A 2WDVB 1QOBA 3B2FA 4RH6A 1F2RI 2AX5A 2KACA 1N63A 5TSSA 5FKAC 3U7ZA 2LGIA 3RFZB 1GB4A 3SFEB 5EE1A 2V3NA 4RGNA 2WDQB 1ZOYB 4TSSA 3P4RB 2HTME 1N61A 2KDMA 4M0WA 1V97A 4ZHPA 2LJIA 4RFBA 1D5XC 2G1EA 2QJLA 5BMHA 3DWMA 2WS3B 1B9RA 1V8CA 1E6EB 4DXGA 1STEA 4H2AA 3N9YC 3MHZA 1FCCC 4A9AA 3EUB2 5FR3A 1SF0A 1UWXA 3AE2B 2LHEA 1N5XA 4OHJA 4N6EB 2EELA 4ZRQA 5BYRA 1QLBB 2K9XA 1FIQA 1YN4A 4A90A 1XEEA 2Y5CA 4YTPB 4TMAB 1L6VA 1QOFA 2TSSA 5C2TB 1FNVA 5AUKA 2M19A 1F0ZA 1ROEA 2ACZB 1IGDA 1TY2A 4B0EA 2M0AA 1ZUD2 5HG2A 3PZ7A 2K0PA 2WXHA 3MC0B 5H92C 1JWUD 4OZCA 3TEWA 1XCTL 1FD6A 1JALA 1L6UA 2ZW0A 3AV8A 4DXFA 3P4SB 4NZLB 3OWEB 2IGGA 1YQ3B 5BMIA 1PYWD 4GLSC 4RCOA 4WIPA 1E10A 1ZE3D 1C79A 1A70A 3R2TA 1K50A 2NMQA 1N5WA 3HVZA 5BMGA 2MH7A 2BB5A 3V3XA 3W5VB 4B0MA 1VZ8A 2KMMA 2FUG1 1F77A 3NZ3A 2Q5WD 3U4EG 2W55A 3NS1A 1SE2A 3PO0A 4GDKB 1Q10A 3ZJVA 3VR9B 1TY0A 5BYQA 2BB6A 3TEXA 4ARCA 2L52A 2DYOA 3AE6B 1JMLA 4IDIA 3IAS1 1WYGA 1GOZA 2R61A 3MFGA 2INPE 3MJ5A 2FBWB 2LUMA 3IT4B 1KF6B 1PDXA 1FRDA 1WSPA 4A8XC 1J7CA 2K5PA 3RPFC 2PVGC 1SIJA 1TS4A 5D3IB 3FILB 3KWVA 4XWTA 4XDCA 2BW2A 1J7BA 2N9LA 1MI0A 4OW0A 3E9SA 3NRZA 2IJ0A 4XDDA 4Q2JA 3SFDB 2CJOA 2E3TA 2MJEA 1T5XD 4RGMA 2WXKA 2BT6A 2WQYB 2KN4A 1DYQA 1F2RC 3AB5A 3BVMA 1CK1A 1I4RA 3AEBB 3GS2A 2PVOD 3FILA 1YNTE 2D5GA 3GP7A 2CJNA 3ZQ4A 2J53A 1J7AA 3P63A 4JE3B 1K53A 1Y56A 1NVID 2I38A 3AE1B 2AQ2B 4OVZA 1SEBD 4HEA1 1QT9A 1D4BA 2K3UA 4IKGA 1RYJA 3KLSX 3AMZA 3FAHA 2DWQA 4P6VF 2AQ3B 2KQ4X 1ENFA 4A6QA 1ET6A 1XLQA 1EU3A 1RFKA 4LTUA 1KH0A 2BTEA 2LHDA 2WXJA 1WGKA 4IOIE 2WNMA 4UDUC 1NYRA 4FXCA 1QOAA 1QKZA 2ZW1A 1D5MC 2ONQA 2VZKB 1C4PA 5FK9C 1M4VA 4WQMA 1VZ6A 4C7YA 1B1ZA 4US9A 3R8BA 1YJIA 4KX6B 4L1BA 4YXDB 3LYYA 4DQOC 1I4XA 1WRIA 1T6BX 1TS2A 2EKIA 1C4AA 5EE9A 2WXOA 1ESFA 3CWIA 1QOGA 2IDYA 1HEZE 4RF0A 1IGCA 1MHHE 4GDLB 4US8A 2OEDA 2W82A 2MJDA 3W9CB 2HDEA 3AEAB 1YJJA 1P7EA 4YSYB 4D2KA 4ZRPA 5LNK1 4CQNA 4WWMA 1XLPA 2JXTA 1WXQA 3GB1A 2RMMA 4HRSA 4O1NA 4USAA 2Z8LA 1IBXB 3AEDB 1C76A 1HA5A 1T3QA 1XO3A 1JWBD 1ZXIA 2WP9B 1BXTA 1UUPA 2L32A 1FMAD 5HHDG 3Q8CA 3SEBA 1NENB 3BK2A 2QEJC 2PW9A 2I2YA 2G9HD 5H8YE 3FC4A 1KLGD 4JPSA 1I4GA 5MPOA 2WDRB 3AEGB 4HROA 5G5HA 1UNSA 3H8HA 3URYA 4WH4A 4C7ZA 2V3PA 4YTMB 3BVGA 3VR8B 1MVKA 2Y3AA 2LFIA 1JRPA 3BK1A 3W5UB 1PUTA 4KGRA 1JCKB 4MACA 4RF1A 1D5ZC 1SBBB 2BYTA 1BMLC 4NJCA 1SE4A 3P4PB 1GAQB 2XN9C 3AEEB 2MEKA 4C80A 1QF6A 3EA6A 2YEPB 2DLBA 2QSDA 3AECB 1ZP0B 2L1AA 5C3JB 3Q8AA 3UI3A 2AQ1B 1XCQL 4HKZE 4P16A 4HKQA 1L0XB 2CU3A 2LMCA 5HI1A 1DOYA 2DYMA 1HZ5A 2IGDA 4YT0B 3ETRA 1OFFA 4KKJA 5D3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  1ZOY B;  1J7A A;  3BII D;  3P63 A;  3P4R B;  2HTM E;  1IUE A;  1N61 A;  1NVI D;  3AE1 B;  3NVZ A;  2W3R A;  3NVW A;  1QT9 A;  1V97 A;  4ITK A;  4ZHP A;  1DOX A;  1RYJ A;  1RWS A;  2G1E A;  2QJL A;  3AMZ A;  3FAH A;  1AWD A;  2DWQ A;  2WS3 B;  3DWM A;  1V8C A;  1E6E B;  4P6V F;  3VRB B;  3AE3 B;  1B9R A;  1XLQ A;  1VDV A;  1RFK A;  4A9A A;  4LTU A;  3KWL A;  3EUB 2;  2PKO A;  1NEK B;  5AUI A;  4YTN B;  1SF0 A;  1WGK A;  2W54 A;  3AE2 B;  1JWA D;  1NYR A;  1TKG A;  1I7H A;  1YQ4 B;  1PFD A;  3ABV B;  4FXC A;  1QOA A;  1N5X A;  4N6E B;  1SB3 C;  3AE5 B;  2WLB A;  1QLB B;  2K9X A;  3L4P A;  1DOI A;  2BS3 B;  1FIQ A;  1E9M A;  4JWU C;  5EE1 A;  4WQM A;  3AH7 A;  4C7Y A;  1UWM A;  2B76 B;  4YSZ B;  2Y5C A;  4YTP B;  4US9 A;  1YJI A;  1L6V A;  4KX6 B;  1QOF A;  2L83 A;  3P4Q B;  5C2T B;  3AE4 B;  2BS4 B;  2M19 A;  5AUK A;  1TYG B;  1ROE A;  2JQR B;  2ACZ B;  4YXD B;  1F0Z A;  1WRI A;  1XLN A;  1ZUD 2;  2LEK A;  2EKI A;  2WU2 B;  1EWY C;  5EE9 A;  1E7P B;  3CWI A;  1QOG A;  1KFY B;  5H92 C;  1FXI A;  1NYQ A;  2W3S A;  1JAL A;  4US8 A;  1L6U A;  5C3J B;  1RM6 C;  3AV8 A;  2MJD A;  3P4S B;  1JRO A;  1N62 A;  1XLO A;  3VRA B;  3W9C B;  1E0Z A;  3AE9 B;  3AEA B;  1YJJ A;  3ZYY X;  3B9J A;  5G5G A;  4YSX B;  1YQ3 B;  4YSY B;  5EE0 A;  1L5P A;  2PIA A;  4ZOH C;  1E10 A;  1TKY A;  4WWM A;  1XLP A;  4ZHO A;  3WCQ A;  1A70 A;  1L0V B;  1WXQ A;  2WU5 B;  4HRS A;  4USA A;  3HVZ A;  1N5W A;  3AN1 A;  2H89 B;  3AE7 B;  1CZP A;  2MH7 A;  3W5V B;  1DGJ A;  2BS2 B;  3AED B;  2KMM A;  2DBY A;  1JW9 D;  1T3Q A;  2H88 B;  1WWT A;  2Q5W D;  2W55 A;  3AM9 A;  1XO3 A;  1CJE A;  3NS1 A;  1JWB D;  1ZXI A;  2OHF A;  3PO0 A;  2WP9 B;  3LB8 C;  1FRR A;  1N60 A;  2K22 A;  3VR9 B;  1FMA D;  1VJK A;  1R7S A;  1NEN B;  2L52 A;  2M56 B;  3AE6 B;  4IDI A;  1GPX A;  5H8Y E;  3B2G A;  3FC4 A;  3P1M A;  1WYG A;  4N58 A;  2KAJ A;  5MPO A;  2WDR B;  1AYF A;  3AEG B;  4HRO A;  5G5H A;  2FBW B;  4C7Z A;  5EE3 A;  4YTM B;  5GXG B;  2JX5 A;  1KF6 B;  1PDX A;  3NVV A;  1FRD A;  3VR8 B;  3CIR B;  1JRP A;  3W5U B;  1J7C A;  2K5P A;  4N59 A;  2PVG C;  1FM0 D;  1PUT A;  1SIJ A;  1VLB A;  3DWG C;  3NVY A;  3RPF C;  3HRD D;  1FO4 A;  1JQ4 A;  1FFV A;  3P4P B;  1NI3 A;  1J7B A;  3AE8 B;  3LXF A;  1GAQ B;  3AEE B;  4C80 A;  3AEF B;  1QF6 A;  2N0S B;  4JWS C;  3NRZ A;  3SFD B;  2CJO A;  2E3T A;  1TJE A;  1ZP0 B;  1OQQ A;  2MJE A;  1FXA A;  1QOB A;  2WDV B;  3AEC B;  3B2F A;  2MJ3 A;  4JX1 C;  2BT6 A;  1OQR A;  2AX5 A;  2QIE B;  2WQY B;  3AB5 A;  2CU3 A;  1FFU A;  1DOY A;  1N63 A;  3AEB B;  2PVO D;  4YT0 B;  3ETR A;  3HUI A;  3SFE B;  3SR6 A;  1OFF A;  1KRH A;  1TKE A;  2CJN A; 
#chains in the Genus database with same CATH topology
 4NAW B;  4KDI C;  3NVZ A;  3NVW A;  2FIF A;  3L17 A;  1L2N A;  2BWE S;  2QCZ A;  4IWO A;  5CHV C;  1NEK B;  4ZRK A;  4GOC A;  4NAW A;  2NBU A;  3VTV A;  1HZ6 A;  3ABV B;  3ZVV A;  3AE5 B;  4IG7 B;  2NCN A;  5LXH A;  5D2M B;  2JQR B;  1XD3 B;  4EOY A;  2LEK A;  2DHZ A;  2RDG A;  3LJ3 A;  2WXP A;  2IO3 B;  2GMI C;  3I63 C;  4K7S A;  5AZG A;  1JRO A;  1WGR A;  3CF6 E;  3AE9 B;  3ZYY X;  5G5G A;  4TUU A;  1V5T A;  2CHW A;  4P1B C;  2WU5 B;  2ZEQ A;  1P0R A;  3L13 A;  2LXA A;  1PGA A;  1S3S G;  4FJV B;  2WHI A;  3TUO A;  1FRR A;  2LVP A;  3Q69 A;  3EGR A;  4J6I A;  2C5L C;  4K3B A;  3RNC C;  2WXM A;  1YOV B;  3V6E B;  1JWS D;  2NTT A;  5D7G A;  5CHF A;  1YQB A;  1C9F A;  1ZDX A;  2V4I B;  2LGX A;  5E6O A;  1EWC A;  3VQI A;  1XQQ A;  5J17 A;  5DPW A;  3LXF A;  4JQW C;  1L0Y B;  3S2A A;  2PMV A;  3DBR I;  3PHW B;  4JX1 C;  1OQR A;  2DAF A;  2CU1 A;  1FFU A;  1WMH B;  4IWQ A;  2L0F A;  3VXW A;  4C56 C;  1IBX A;  3Q14 C;  4RMA A;  2JRH A;  3PLV A;  4KGT A;  1E8Z A;  3RNA C;  2Y5B B;  3ENE A;  1RWS A;  2KT7 A;  2D3G A;  2X38 A;  1WJU A;  4HXD A;  5G55 A;  5E6J A;  2N7J A;  4W9G A;  3EFU A;  4M02 A;  1XXG A;  3P4Q B;  3AE4 B;  5IOI A;  2R2Q A;  1CMX B;  2JU6 X;  2JWU A;  1E7P B;  1SIF A;  2L05 A;  1FNU A;  2J4X A;  1N62 A;  2LGD A;  2C60 A;  2KX0 A;  4XWW A;  4P7I A;  5TR5 A;  1EM7 A;  2PJH A;  2H89 B;  3AE7 B;  2I1K A;  4LNN A;  2K6D B;  4W9K A;  3H7S A;  1I4P A;  3MP9 A;  1TZO A;  3ZXR A;  4B6W A;  3W2D A;  1VJK A;  3T8M A;  4DHJ D;  1SXT A;  4OZA A;  3P1M A;  4L2Y A;  1EUV B;  1GB1 A;  3BVZ A;  3NJT A;  3ML8 A;  1WGY A;  2LZ6 A;  1FNW A;  2ZCB A;  1EO6 A;  1TGZ B;  2O6V B;  3U2S C;  4M8M A;  1C1Y B;  1XF5 L;  2N9E B;  4ZRI A;  4RGO S;  4DDG D;  4HJK A;  2CKH B;  2M0X A;  2LRU A;  2N7D A;  2N9P C;  2JT4 B;  2K8H A;  4M0W B;  4RH6 A;  1F2R I;  2AX5 A;  1UBI A;  1TIF A;  4LNK A;  2JXX A;  2LGI A;  4ANW A;  3L16 A;  3Q3J A;  1N61 A;  1WGH A;  2KDM A;  4M0W A;  1D5X C;  2G1E A;  2WS3 B;  1V8C A;  3QQ8 B;  4MGK E;  3N9Y C;  3MHZ A;  4PK1 A;  4EUT A;  3EUB 2;  3UQA A;  5GMV A;  4JIO U;  1GC7 A;  5E6P A;  2HE7 A;  4IWP A;  4ZRQ A;  1R4M I;  3JSV B;  5AUK A;  1ROE A;  4I6P A;  1WXM A;  2WXH A;  3MC0 B;  5H92 C;  3R3M A;  4OZC A;  3A33 B;  1FD6 A;  1JAL A;  1L6U A;  1J0G A;  4HPM B;  1NDD A;  4NZL B;  4PS8 A;  2GBN A;  4RCO A;  1V5O A;  1ZE3 D;  2KD0 A;  3R2T A;  1Z2M A;  2NMQ A;  3ZNZ B;  5KHQ A;  2BB5 A;  3KYD D;  4B0M A;  4FN2 A;  2IO1 B;  3PRM B;  3B1L X;  4GDK B;  2KZR A;  2BGF A;  4ANX A;  5BYQ A;  2BB6 A;  3NZU A;  1GOZ A;  2KNB A;  3IT4 B;  1MG4 A;  2AWT A;  1KF6 B;  1R4M B;  1WSP A;  1J7C A;  2PVG C;  1TS4 A;  3KVF B;  5D3I B;  4W9L A;  3ZRF A;  3KWV A;  3V60 A;  4XWT A;  2NPT B;  3IFW B;  1MI0 A;  1UEL A;  3E9S A;  3NRZ A;  2IJ0 A;  4JLC A;  3GZN I;  2K8C A;  2WXK A;  2BT6 A;  4E3C A;  2WQY B;  1DYQ A;  2KWV B;  2CHX A;  1KLV A;  2BYF A;  2KJH B;  2PVO D;  4G3X B;  2MWS B;  3VTU A;  5CX3 A;  3NZS A;  4JE3 B;  3A1Q B;  3AE1 B;  2I38 A;  3N1Y C;  1RYJ A;  4P6V F;  4A6Q A;  1EU3 A;  3APD A;  3WAM A;  1J19 A;  2DEN B;  4URK A;  2GBK A;  2FCS A;  1WX7 A;  3A1Q A;  2PPH A;  2NR2 A;  4LDT D;  4CYE A;  4RM8 A;  2KDI A;  2Z0E B;  1V49 A;  1M4V A;  4WQM A;  1VZ6 A;  2FCN A;  1YJI A;  4L1B A;  2ZCC A;  1I4X A;  1WRI A;  2EKI A;  4AWJ A;  1AAR A;  2WXO A;  3UIP B;  2IDY A;  3W9C B;  3A9J A;  2HDE A;  1WI0 A;  4YSY B;  2JXT A;  1UZX B;  1OEY A;  3AI5 A;  3GB1 A;  2RPQ A;  3B08 A;  1KM7 A;  1ZKH A;  4MGZ E;  3Q6B A;  1FMA D;  3Q8C A;  5IKC M;  2GBM A;  2MA9 B;  2QEJ C;  3QAQ A;  1WE6 A;  5H8Y E;  1KLG D;  4IC7 B;  4TV3 A;  5MPO A;  3P2B A;  3RNB C;  3URY A;  1T0Y A;  2V3P A;  2L7R A;  2DX5 B;  1MVK A;  2Y3A A;  3W5U B;  4KGR A;  4RF1 A;  3NS8 A;  4BKS A;  3R7R A;  1FPY A;  1WXA A;  1YJ1 A;  1WY8 A;  2LVQ A;  2MEK A;  4BOS C;  5C1Z A;  2DLB A;  5CHW A;  2PE9 A;  1UBQ A;  3UI3 A;  4HKZ E;  5C23 A;  2C9W B;  1HZ5 A;  2KTR B;  4KDL B;  1D4B A;  4KKJ A;  1C77 A;  4KSL C;  2ICI A;  3VH3 B;  4XE0 A;  4W9I A;  1ZPS A;  3C19 A;  3W1S A;  1ZDV A;  1BUI C;  2NS5 A;  3AE3 B;  4W9D A;  1A5R A;  4ANV A;  4MM3 B;  2KXJ A;  2KWU B;  1JWA D;  2GBR A;  3A4S C;  1I7H A;  4JWU C;  4MM3 A;  3RZW C;  3IT6 B;  3DHH C;  1SJE D;  2RD0 A;  2RDH A;  2WXF A;  1QQR A;  1KFY B;  2W3S A;  1D6E C;  1Q1O A;  4YWG G;  2G4S A;  2KMC A;  4BFR A;  3RI7 C;  4ZYN A;  4ZHO A;  3Q8F A;  1TS5 A;  2Y5P A;  1ISN A;  4MGY E;  2PLP A;  1JW9 D;  5IAA C;  1WWT A;  5JHB A;  1LGR A;  3WAO A;  2OHF A;  4ZRJ A;  2WXG A;  3DHI C;  2ON8 A;  2J42 A;  2KAJ A;  1CQV A;  2DYB A;  1SJH D;  2B3A A;  4HPP A;  3T3O A;  3I5J C;  3MC9 A;  1ACC A;  2HJ1 A;  2QC8 A;  2C7M B;  4BOZ B;  4WAA A;  1L4D B;  4G50 A;  3ZLZ A;  3QHT A;  3MC8 A;  1TJE A;  4MJS A;  1OQQ A;  4WWO A;  3NG0 A;  1UGJ A;  2NTS A;  2G3Q B;  4KV2 A;  4AS1 A;  3UF8 A;  3HUI A;  3ZTC A;  4LCD E;  4DDI D;  2GI9 A;  2KFJ A;  3QC8 B;  2BF8 B;  1IUE A;  3DVG Y;  5JXV A;  4KGS A;  2N9K A;  3PV1 A;  3E56 A;  2ZVO A;  1WZ0 A;  2K1F A;  3M3J A;  5AUI A;  1VR9 A;  2BWF A;  2IYD B;  2IY0 B;  1Q5W B;  2HJ8 A;  4PS3 A;  4LK0 M;  1F52 A;  2ZVN A;  1UH6 A;  3VH4 B;  4XC2 A;  2WXN A;  3TL5 A;  1TYG B;  2MSE D;  4E71 A;  5JH5 C;  2KTF A;  3VUW A;  3DQV A;  1HQR D;  1RM6 C;  3A4R A;  1V2Y A;  4B9K A;  2WGS A;  2PIA A;  2AYO B;  4NNJ B;  2DNF A;  5BO4 B;  2BS2 B;  4M01 A;  1WZ3 A;  4PYZ A;  3Q3O C;  1LQB A;  3AM9 A;  4N9F 4;  3LB8 C;  2SEB D;  1U4A A;  4W9J A;  3KQ4 A;  4I6N B;  1KTK A;  1R7S A;  4MT5 A;  1C3T A;  1AN8 A;  4N58 A;  2INN E;  3ZGZ A;  3SHQ A;  3PTF C;  2KO3 A;  2WXL A;  3NUH B;  2LGS A;  2ZJD A;  3NVV A;  1QZE A;  1SE9 A;  1ZGU B;  1FM0 D;  1VRA B;  3KYC D;  3I57 A;  1FFV A;  1TT5 B;  3VAW A;  4RGT A;  4FHJ A;  2K25 A;  3P42 A;  2WDV B;  1QOB A;  3B2F A;  4P1C C;  1E8X A;  3SD5 A;  2LGY A;  2BKR B;  4RGN A;  1ZOY B;  2WYQ A;  4TSS A;  3P4R B;  2HTM E;  3AU4 A;  3DBL I;  4OVV A;  2LJI A;  4RFB A;  3NHE B;  5BMH A;  3DWM A;  1E6E B;  3AUL A;  4XZ4 A;  5EDS A;  2OJR A;  1FCC C;  4A9A A;  1M94 A;  5FR3 A;  4QAY A;  3AE2 B;  1WJ4 A;  2AEH A;  3RCZ A;  2EEL A;  5BYR A;  1QLB B;  1FIQ A;  4MH0 E;  1YN4 A;  2L76 A;  2MQJ A;  2Y5C A;  4TMA B;  3AXC A;  2R2O A;  5C2T B;  2D3B A;  1F0Z A;  1WMH A;  2KOX A;  2JZ3 B;  3TEW A;  1RAX A;  4WJN A;  3AV8 A;  5JZE B;  4MSM B;  2IGG A;  2L00 B;  2ZNV C;  3ZXV A;  4B95 A;  5L95 C;  1PYW D;  4WIP A;  1C79 A;  3MTN B;  4C4V B;  3DBL B;  1PQS A;  5BMG A;  1VZ8 A;  2KMM A;  3K9O B;  4S0R A;  1F77 A;  1MFW A;  3DBR B;  4BBN C;  2L8J A;  1SE2 A;  1WX8 A;  3VR9 B;  4IUM B;  2O6V D;  3TEX A;  4ARC A;  3AE6 B;  3APC A;  1JML A;  1LM8 B;  3IAS 1;  3MJ5 A;  2FBW B;  1YIW A;  2LUM A;  1FRD A;  4FJY A;  4A8X C;  4MGI E;  3TIX A;  4XDC A;  4GU2 A;  2N9L A;  4NJ6 A;  4ANU A;  1UF0 A;  4OW0 A;  2E3T A;  2MJE A;  4RGM A;  3AB5 A;  4XGA B;  1CK1 A;  3HIZ A;  2D5G A;  1J8C A;  1SGH A;  4HLE A;  3GP7 A;  3W1S C;  3VFK A;  4WQO B;  3ZTD A;  1T0S C;  2AQ2 B;  2N4F A;  4HEA 1;  2LRW A;  4IW0 A;  2NBV B;  2AQ3 B;  2KQ4 X;  1ET6 A;  3X0W A;  1XLQ A;  4LTU A;  2G4D B;  1E7U A;  4IOI E;  2WNM A;  4W9E A;  2KDE B;  2LJ5 A;  2MW5 A;  4FXC A;  3ECI A;  2XEW A;  3ZO5 B;  1D5M C;  2O6V A;  4WWP A;  2ONQ A;  1S1Q B;  3GOE A;  2L0T A;  2W9N A;  2J0M A;  1FXT B;  4KX6 B;  4YXD B;  2KWC A;  1T0Q C;  2DZI A;  4MEL A;  1C4A A;  3CWI A;  5IN7 A;  2C7N B;  1MHH E;  4NY0 A;  3N32 A;  4GDL B;  2OED A;  2N9X A;  4D2K A;  2M8S A;  1OQY A;  1TTN A;  3DHG C;  3V62 A;  4ICU A;  2LVO A;  2QDF A;  3AED B;  4YL8 A;  4DHJ B;  1GNU A;  3APF A;  3PPA A;  2WP9 B;  1BXT A;  2BYV E;  1TZ1 A;  2L32 A;  1VD2 A;  5AZF A;  2A4Z A;  5HHD G;  1NEN B;  2PW9 A;  4CHK A;  4KSK C;  3FKY A;  3MJW A;  2IND C;  2WDR B;  3JSV A;  4HDO A;  4C7Z A;  3H8H A;  4NQL B;  3BVG A;  3VR8 B;  3BK1 A;  1PUT A;  1JCK B;  2DZM A;  1MJD A;  2KX3 A;  3P4P B;  1GAQ B;  2FUH B;  2XN9 C;  3AEE B;  4BBN F;  2DZJ A;  2GOW A;  3PRZ A;  3EA6 A;  3KUD B;  1ZP0 B;  2L1A A;  3Q8A A;  4IM3 A;  3HM3 A;  4PS7 A;  2CU3 A;  2LMC A;  1DOY A;  2DYM A;  2IGD A;  4YT0 B;  3BII D;  2V1Y A;  4E74 A;  4GDK A;  2K6Q A;  3O65 B;  4ITK A;  4M00 A;  4FUL A;  2XK5 B;  3HM6 X;  1V1O A;  1K52 A;  5KHO A;  1ET9 A;  4AP4 C;  1YQ4 B;  4F8C B;  3NOB A;  4ARI A;  4GSW A;  1WGG A;  3M95 A;  2XK5 A;  2BYE A;  2NPT A;  3ZJU A;  3L4P A;  4NAM A;  2GRI A;  1UWM A;  3AU5 A;  4GGQ A;  4LJP B;  1V1P B;  2L83 A;  3ZIM A;  2ASQ A;  3WIM A;  4XYC A;  2V3S A;  3RUI B;  3KUC B;  1LXD A;  3M62 B;  1Y8R C;  4J3O D;  4A55 A;  4KVG B;  1FXI A;  1NYQ A;  2J52 A;  4FBJ B;  3EHV A;  1I4Q A;  3V05 A;  3VRA B;  3OG5 A;  1L5P A;  4TQ0 A;  2IY1 B;  4BKS D;  4LNI A;  4FHK A;  1L0V B;  4LNO A;  2GLS A;  3ZNH B;  4FA6 A;  4WJP A;  4MEM A;  5HFY A;  3DPD A;  1AW7 A;  3ZRC A;  3D32 A;  4KKI A;  2JF5 A;  3UQB A;  4PYU A;  4BKT A;  3GZN B;  4DK5 A;  4EZL A;  1H8C A;  1FCL A;  3C8Y A;  3QWZ B;  2FID A;  2KLC A;  2JX5 A;  4L23 A;  3WAN A;  4K7W A;  3O13 A;  3PVL A;  3TSS A;  3T3N A;  4WUR A;  1NI3 A;  4MH8 A;  1BT0 A;  2N0S B;  3I3T B;  4JWS C;  4WAF A;  2LXC A;  2MJ3 A;  2E6X A;  2QIE B;  1OFF A;  3RN9 C;  4A3O A;  3SR6 A;  2J0J A;  5BYS A;  1TKE A;  2W3R A;  2RR9 A;  5J18 A;  4JGH B;  4HDQ A;  1HXY D;  3B0A A;  3VRB B;  1WRD B;  2JUO A;  4PT5 A;  4YTN B;  3DVN U;  4AQ7 A;  1F1H A;  4XX5 A;  1SB3 C;  1YMH E;  3EEC A;  4ZYS A;  1E9M A;  5LXI B;  2ZPY A;  3X23 A;  2VZK D;  2CR5 A;  1XLN A;  2KQ7 A;  2HTH A;  2KTR A;  2I1J A;  1MPE A;  4EZK A;  1WR1 A;  1C78 A;  3BYT B;  1E0Z A;  4TQ1 A;  2QMT A;  4ZDV A;  2C7H A;  4HJG E;  2YEP F;  5IA7 A;  3PZ8 A;  3WCQ A;  5IO9 A;  4W9C A;  3U30 A;  4RNA A;  2JPH A;  4GB9 A;  3AN1 A;  1CZP A;  2JSV X;  2M1M A;  2IGH A;  2MHJ A;  4K1R B;  2JVC A;  5DPS A;  4R3D A;  1KLU D;  2UYZ B;  1YX6 B;  2M56 B;  2XNA C;  1AYF A;  2V0G A;  2Z0D B;  5D94 A;  1ZXH A;  3CIR B;  2O2V B;  4N59 A;  3HRD D;  1T0R C;  5LLI A;  1V9J A;  1MHX A;  1I4H A;  2Z59 B;  1WXV A;  3AEF B;  1TBE A;  4W9H A;  2KAC A;  1N63 A;  3VUX A;  3OAW A;  1GB4 A;  3SFE B;  5EE1 A;  5AZH A;  1D3Z A;  5DCN A;  2BQQ A;  1I35 A;  4FJZ A;  2QJL A;  2RSU A;  4DXG A;  4A20 A;  1STE A;  4H2A A;  2CHZ A;  3ZNI D;  4CO7 A;  2D3C A;  2IZV B;  3RT3 B;  4BAX A;  1N5X A;  4N6E B;  3BIN A;  1UD7 A;  1RLF A;  1P98 A;  2KN5 A;  4GIV A;  4KIK B;  4A90 A;  1XEE A;  2LAS A;  2LWP A;  1L6V A;  2TSS A;  3M63 B;  3H6N A;  1IGD A;  4B0E A;  3PZ7 A;  2K0P A;  1JWU D;  1P3Q U;  5IP4 D;  3DVG X;  3P4S B;  2MBO A;  3OWE B;  5BMI A;  1A70 A;  2REX A;  1K50 A;  3HVZ A;  3H9D A;  4KZC A;  2ZZP B;  2KFK B;  3W5V B;  1G6J A;  2FUG 1;  3ALB A;  3U4E G;  2K39 A;  4AJW A;  3PRP B;  1Q10 A;  2VH1 A;  1TY0 A;  1L7Y A;  2DYO A;  3PLU A;  1GC6 A;  1WYG A;  3RZF A;  5J2R A;  1WM3 A;  1Z5S B;  2LD9 A;  2K5P A;  3RPF C;  1SIJ A;  2OOB B;  3FIL B;  1GUA B;  1V80 A;  1J7B A;  4DXA B;  5JHA A;  2NVU I;  2V9H A;  1RFA A;  3EC8 A;  3SFD B;  4Q2J A;  3N1Z C;  4II3 B;  3BVM A;  4ACF A;  1I4R A;  1OGW A;  1EF5 A;  3FIL A;  1YD8 U;  3IG3 A;  2J0K A;  1Y56 A;  1NVI D;  3ONS A;  3U8Z A;  1WIA A;  1HTQ A;  1E8W A;  3FAH A;  3R66 C;  3LDZ E;  1RFK A;  2BTE A;  1WE7 A;  3PHX B;  1WGK A;  3K9P B;  1VCB A;  1QKZ A;  2OJW A;  3H1U A;  2EMS A;  1Q0W B;  3SDL C;  1C4P A;  5FK9 C;  4AJY B;  5DPR A;  4C7Y A;  3PS6 A;  3W1Y A;  3LYY A;  3DBS A;  4DQO C;  2RDB C;  4GXB A;  2KKC A;  2INC C;  3L0W B;  1T6B X;  1TS2 A;  5EE9 A;  1ESF A;  3QCA A;  1WM2 A;  4US8 A;  1P1A A;  2MJD A;  3CST A;  1JRU A;  3AEA B;  1YJJ A;  2YLM A;  1WH3 A;  4ZRP A;  5LNK 1;  3PGE A;  4FLH A;  2RMM A;  4HRS A;  4O1N A;  3DDC B;  4TKN A;  5G2N A;  4K7U A;  3TCA A;  4AOF A;  1IBX B;  1T3Q A;  2LI5 A;  1ZXI A;  3VDZ A;  1UUP A;  4EEW A;  2KAN A;  2DAJ A;  3L54 A;  4DWF A;  2VRR B;  2G45 B;  3SEB A;  3BK2 A;  2G9H D;  3FC4 A;  2X8X X;  4JPS A;  2CS4 A;  2PEA A;  3Q3N C;  3QAR A;  1UNS A;  2KMA A;  2MLB A;  2LFI A;  1JRP A;  4MAC A;  2IO0 B;  1D5Z C;  4EKU A;  2BYT A;  3BY4 B;  4HCP B;  1SE4 A;  3HK0 A;  3WAL A;  1QF6 A;  2KDF B;  2D10 A;  3VHT C;  2ZPN A;  4OVU A;  2EMT A;  3Q3F A;  1XCQ L;  4P16 A;  3ZW3 A;  2AL3 A;  2VH2 A;  4C4V A;  2A5U A;  3DCG A;  3ETR A;  3VVW B;  1EU4 A;  1EF1 A;  2FE8 A;  2JYE A;  2JZP A;  4KZ0 A;  3ZJT A;  1K51 A;  2KJ6 A;  2WXR A;  3SU8 X;  2JY6 A;  3QIJ A;  2MCN B;  2KC2 A;  1WR6 E;  4NQK E;  3DBH I;  1VDV A;  4WJQ A;  1LO5 D;  2LUE A;  4WJO A;  2PKO A;  1WYW B;  3TEY A;  3IXS A;  1R4N I;  2W54 A;  4DBG A;  4HPL B;  2KYW A;  2KLG A;  2QHO A;  2WLB A;  2WWZ A;  1X1M A;  1DOI A;  3U7D A;  1PGX A;  3AH7 A;  4YSZ B;  5I4D A;  4K3C A;  4ICV A;  1ZW7 A;  3QA8 A;  2PTL A;  1EWY C;  5HKH A;  1QIL A;  4X57 B;  3KH0 A;  4MDK E;  2AL6 A;  1XLO A;  2M4N A;  3UIO B;  5EE0 A;  5T8I A;  4A3P A;  1TS3 A;  3Q8E A;  2BPS A;  3OJ3 A;  1E5W A;  3EFC A;  3JVZ X;  4S17 A;  1WXS A;  4LJO B;  4W9F A;  3L10 B;  1IP9 A;  1DGJ A;  2DBY A;  2GB1 A;  2H88 B;  2FCQ A;  3DBH B;  1HE8 A;  3I9V 1;  3ML9 A;  1N60 A;  2MP2 B;  4K81 A;  1R4N B;  4IM2 A;  1GPX A;  1SE3 A;  3GE8 C;  1UGM A;  5EE3 A;  1WFY A;  3IAM 1;  5GXG B;  1SSN A;  4LLG M;  3WA0 A;  4OZB A;  2V4L A;  2MP2 A;  4M8N A;  3JYU A;  1P7F A;  4GDL A;  1JWM D;  2K8B A;  3BZD B;  2N1V A;  1FXA A;  2JWZ A;  1IPG A;  4F7Z A;  1VZ7 A;  2MX2 A;  1XT9 B;  2BBC A;  1KRH A;  2N1W A;  2JYT A;  1DOX A;  1N6Z A;  1AWD A;  2WXQ A;  3CSF A;  3Q2A C;  1RRB A;  3KWL A;  4RM9 A;  1YN5 A;  2IPK D;  3PRE A;  3BWU D;  2KK8 A;  3R2I A;  4REZ A;  5L83 A;  1TKG A;  1PFD A;  2YVC A;  3ZDT A;  3BYY B;  2EKE C;  2IBI B;  4AUQ C;  2BS3 B;  2WXI A;  2B76 B;  3ZDM C;  2RPV A;  2RGF A;  3RUL A;  1FEH A;  4BKG A;  2BS4 B;  1OEY J;  1WF9 A;  2KJR A;  4LNF A;  2WU2 B;  2JRI B;  4EE2 A;  1GG3 A;  4YSX B;  3B9J A;  2KVR A;  2KWD A;  4C00 A;  4ZOH C;  1L4Z B;  1TKY A;  5CTR C;  3R7Q A;  4EFO A;  2BKF A;  1PGB A;  3J9C A;  3HVD A;  3U52 E;  1WJN A;  1C4C A;  3PZD A;  2QIL A;  4I6L B;  3TEZ A;  1CJE A;  3RNF C;  2IO2 B;  2K22 A;  3PSE B;  4HWI B;  3RD2 A;  4G0N B;  3B2G A;  3Q8B A;  3GE3 C;  4BZA A;  1V1P A;  4NPN A;  4GN1 A;  2KQS A;  1E7V A;  1VLB A;  3NVY A;  3DWG C;  2SAK A;  2D07 B;  1FO4 A;  2FNJ B;  1JQ4 A;  2UU7 A;  1YN3 A;  3AE8 B;  2J7Q B;  3N20 C;  3RNE C;  3RMK C;  3UIN B;  5TSS A;  3DOW A;  3N3K B;  5FKA C;  4ASW C;  3U7Z A;  3RFZ B;  4II2 B;  2V3N A;  2WDQ B;  2FCM A;  3A9J B;  1LFD A;  3N30 A;  5D6J B;  1V97 A;  1WJ6 A;  4ZHP A;  4HK2 A;  1B9R A;  2KC1 A;  2ZNV B;  1WX9 A;  3L08 A;  2FAZ A;  3WAP A;  1SF0 A;  1UWX A;  2LHE A;  4OHJ A;  3VTW A;  2K9X A;  3N1X C;  4YTP B;  4F1S A;  5DPT A;  1QOF A;  2JZZ A;  1FNV A;  2KVZ A;  2M19 A;  2WX0 A;  2ACZ B;  2D2Q A;  1TY2 A;  2M0A A;  1ZUD 2;  5HG2 A;  4EZJ A;  4LDT B;  1XCT L;  3UGB B;  2ZW0 A;  2DZK A;  4DXF A;  1YQ3 B;  1H4R A;  2UWQ A;  4GLS C;  1E10 A;  2L3Z A;  2KHW B;  3KUZ A;  1E90 A;  1N5W A;  2MH7 A;  3V3X A;  1WGD A;  1NI2 A;  3NZ3 A;  2Q5W D;  2W55 A;  3NS1 A;  2GBJ A;  3C0R B;  3PO0 A;  2MBB B;  3ZJV A;  5AEK B;  3KW5 B;  2HD5 B;  2L52 A;  4IDI A;  3JW0 X;  2BVC A;  2R61 A;  3MFG A;  2INP E;  1GJZ A;  1PDX A;  1HTO A;  3NY5 A;  4HCN B;  3TBL D;  4NJ7 A;  2BW2 A;  2MBE A;  3DVN V;  5FR6 A;  1V6E A;  1V86 A;  4XDD A;  2CJO A;  1T5X D;  4MSQ B;  2KN4 A;  3AEB B;  3GS2 A;  3ZNG C;  1YX5 B;  1YNT E;  2WDT B;  3HHM A;  3IBE A;  2CJN A;  3ZQ4 A;  2J53 A;  1KOT A;  1J7A A;  3P63 A;  1K53 A;  4OVZ A;  1SEB D;  1QT9 A;  4WWN A;  2K3U A;  4IKG A;  3KLS X;  4BVU C;  3AMZ A;  2DWQ A;  1IYF A;  1ENF A;  5E6N A;  4G11 A;  1KH0 A;  2NBW B;  2LHD A;  4DHZ B;  2WXJ A;  4IM0 A;  4UDU C;  2O2V A;  1NYR A;  3RNG C;  1QOA A;  4HVB A;  2ZW1 A;  4FAD A;  2VZK B;  1OTR B;  2KDB A;  3TMP B;  1B1Z A;  4US9 A;  2N7E A;  3R8B A;  4JL9 A;  3MHS D;  3OLM D;  3V61 A;  1QOG A;  1HEZ E;  1MG8 A;  4RF0 A;  1IGC A;  2PE6 B;  2W82 A;  1P7E A;  4MJS B;  4CQN A;  4WWM A;  3QJZ A;  1KJT A;  1XLP A;  3V6C B;  3ZUN A;  3Q3M C;  1WXQ A;  3H7P B;  1NBF C;  4USA A;  2Z8L A;  3IHP C;  3A9K B;  4GMV A;  2D11 A;  1C76 A;  3TJP A;  1HA5 A;  3QK0 A;  3VUY A;  1XO3 A;  2MBH A;  1JWB D;  3H7P A;  3RYT A;  2M17 A;  1E8Y A;  2I2Y A;  4KIK A;  1V81 A;  3A9K A;  1I4G A;  1P9D U;  3AEG B;  4HRO A;  5G5H A;  4YTM B;  4WH4 A;  3PT2 B;  1SBB B;  2MRP A;  1F9J A;  3OJ4 B;  1BML C;  3QX1 A;  4NJC A;  2XBB C;  4C80 A;  1K8R B;  2YEP B;  2QSD A;  5C3J B;  3AEC B;  3T9L A;  2AQ1 B;  4HKQ A;  1L0X B;  4DHZ E;  2WX1 A;  5HI1 A;  1I42 A;  3IVF A;  2MBQ A;  3ZKJ C;  2D3A A;  3CMM B;  2KFK A;  1F2R C;  5D3D A; 
#chains in the Genus database with same CATH homology
 1EU4 A;  3BII D;  4NAW B;  1C77 A;  2FE8 A;  2JZP A;  2JYE A;  3NVZ A;  3NVW A;  1K51 A;  2WXR A;  3ZJT A;  4ITK A;  2ICI A;  4XE0 A;  1ZPS A;  3W1S A;  1ZDV A;  1BUI C;  3AE3 B;  1VDV A;  1V1O A;  1LO5 D;  2PKO A;  1NEK B;  4MM3 B;  3TEY A;  3IXS A;  1K52 A;  1ET9 A;  2W54 A;  1HZ6 A;  1JWA D;  1YQ4 B;  1I7H A;  3ABV B;  4ARI A;  3AE5 B;  2WLB A;  3ZJU A;  3L4P A;  1DOI A;  4JWU C;  4NAM A;  2GRI A;  1PGX A;  3AH7 A;  1UWM A;  4YSZ B;  5I4D A;  1V1P B;  2L83 A;  3IT6 B;  2JQR B;  1SJE D;  2PTL A;  2LEK A;  2RDH A;  2RDG A;  1EWY C;  2WXF A;  4J3O D;  1QIL A;  1KFY B;  1QQR A;  4A55 A;  2WXP A;  1FXI A;  1NYQ A;  2J52 A;  2W3S A;  1D6E C;  4YWG G;  1I4Q A;  3V05 A;  3VRA B;  1JRO A;  1XLO A;  3AE9 B;  3ZYY X;  5G5G A;  5EE0 A;  5T8I A;  1L5P A;  4TQ0 A;  1TS3 A;  3Q8E A;  4ZHO A;  3Q8F A;  1L0V B;  2WU5 B;  1TS5 A;  2Y5P A;  1PGA A;  5HFY A;  2PLP A;  1DGJ A;  1AW7 A;  2DBY A;  1JW9 D;  2GB1 A;  2H88 B;  1WWT A;  4KKI A;  3TUO A;  3I9V 1;  2OHF A;  1FRR A;  1N60 A;  3Q69 A;  3EGR A;  2WXG A;  1FCL A;  3C8Y A;  2ON8 A;  1GPX A;  2J42 A;  1SE3 A;  2KAJ A;  2WXM A;  1CQV A;  5EE3 A;  1SJH D;  3IAM 1;  5GXG B;  1SSN A;  2JX5 A;  4L23 A;  1JWS D;  3T3O A;  2NTT A;  5D7G A;  1ACC A;  4LLG M;  3O13 A;  4OZB A;  1C9F A;  1ZDX A;  3TSS A;  2V4I B;  3T3N A;  4WUR A;  1L4D B;  1EWC A;  1P7F A;  3VQI A;  1NI3 A;  4MH8 A;  3LXF A;  1L0Y B;  2PMV A;  1JWM D;  2N0S B;  4JWS C;  3BZD B;  1TJE A;  1OQQ A;  4WAF A;  1FXA A;  4JX1 C;  2MJ3 A;  1UGJ A;  1OQR A;  2E6X A;  2NTS A;  2QIE B;  1FFU A;  1VZ7 A;  4AS1 A;  4C56 C;  1IBX A;  3HUI A;  2BBC A;  3SR6 A;  5BYS A;  1KRH A;  1TKE A;  4KGT A;  2GI9 A;  1IUE A;  2W3R A;  2JYT A;  5JXV A;  1DOX A;  4KGS A;  1RWS A;  2N9K A;  1HXY D;  3E56 A;  3VRB B;  1AWD A;  2WXQ A;  2X38 A;  3KWL A;  1YN5 A;  4PT5 A;  2IPK D;  5AUI A;  4YTN B;  3BWU D;  1VR9 A;  5E6J A;  3R2I A;  4REZ A;  1TKG A;  2N7J A;  1PFD A;  4AQ7 A;  3BYY B;  1SB3 C;  4LK0 M;  1YMH E;  2BS3 B;  4ZYS A;  1E9M A;  2WXI A;  2B76 B;  1XXG A;  2RPV A;  1FEH A;  2WXN A;  3P4Q B;  3AE4 B;  2BS4 B;  1TYG B;  2VZK D;  1XLN A;  2WU2 B;  2JU6 X;  2JWU A;  1E7P B;  4EE2 A;  1MPE A;  1FNU A;  1HQR D;  1C78 A;  1RM6 C;  2J4X A;  1N62 A;  3BYT B;  1E0Z A;  4TQ1 A;  2QMT A;  4YSX B;  3B9J A;  4HJG E;  2KWD A;  2YEP F;  2PIA A;  4ZOH C;  4XWW A;  1L4Z B;  1TKY A;  3PZ8 A;  3WCQ A;  4RNA A;  1PGB A;  1EM7 A;  3J9C A;  3AN1 A;  3HVD A;  2H89 B;  3AE7 B;  1CZP A;  2JSV X;  3U52 E;  2BS2 B;  2IGH A;  1C4C A;  2QIL A;  3AM9 A;  3TEZ A;  1CJE A;  1I4P A;  3MP9 A;  1TZO A;  3LB8 C;  2SEB D;  3KQ4 A;  3W2D A;  4R3D A;  2K22 A;  1VJK A;  1KTK A;  1KLU D;  1R7S A;  4MT5 A;  2M56 B;  1SXT A;  3B2G A;  2XNA C;  4OZA A;  3Q8B A;  3P1M A;  1AN8 A;  4N58 A;  2INN E;  4L2Y A;  3ZGZ A;  1AYF A;  1V1P A;  2V0G A;  2WXL A;  3BVZ A;  3NUH B;  1GB1 A;  1ZXH A;  3NVV A;  3CIR B;  4N59 A;  1FM0 D;  1VRA B;  1VLB A;  3DWG C;  3NVY A;  1FNW A;  2SAK A;  3HRD D;  1FO4 A;  3I57 A;  1JQ4 A;  1FFV A;  1YN3 A;  3U2S C;  1MHX A;  4RGT A;  1I4H A;  3AE8 B;  1XF5 L;  4RGO S;  3AEF B;  3P42 A;  2WDV B;  1QOB A;  3B2F A;  4RH6 A;  1F2R I;  2AX5 A;  2KAC A;  1N63 A;  5TSS A;  5FKA C;  3U7Z A;  2LGI A;  3RFZ B;  1GB4 A;  3SFE B;  5EE1 A;  2V3N A;  4RGN A;  2WDQ B;  1ZOY B;  4TSS A;  3P4R B;  2HTM E;  1N61 A;  2KDM A;  4M0W A;  1V97 A;  4ZHP A;  2LJI A;  4RFB A;  1D5X C;  2G1E A;  2QJL A;  5BMH A;  3DWM A;  2WS3 B;  1B9R A;  1V8C A;  1E6E B;  4DXG A;  1STE A;  4H2A A;  3N9Y C;  3MHZ A;  1FCC C;  4A9A A;  3EUB 2;  5FR3 A;  1SF0 A;  1UWX A;  3AE2 B;  2LHE A;  1N5X A;  4OHJ A;  4N6E B;  2EEL A;  4ZRQ A;  5BYR A;  1QLB B;  2K9X A;  1FIQ A;  1YN4 A;  4A90 A;  1XEE A;  2Y5C A;  4YTP B;  4TMA B;  1L6V A;  1QOF A;  2TSS A;  5C2T B;  1FNV A;  5AUK A;  2M19 A;  1F0Z A;  1ROE A;  2ACZ B;  1IGD A;  1TY2 A;  4B0E A;  2M0A A;  1ZUD 2;  5HG2 A;  3PZ7 A;  2K0P A;  2WXH A;  3MC0 B;  5H92 C;  1JWU D;  4OZC A;  3TEW A;  1XCT L;  1FD6 A;  1JAL A;  1L6U A;  2ZW0 A;  3AV8 A;  4DXF A;  3P4S B;  4NZL B;  3OWE B;  2IGG A;  1YQ3 B;  5BMI A;  1PYW D;  4GLS C;  4RCO A;  4WIP A;  1E10 A;  1ZE3 D;  1C79 A;  1A70 A;  3R2T A;  1K50 A;  2NMQ A;  1N5W A;  3HVZ A;  5BMG A;  2MH7 A;  2BB5 A;  3V3X A;  3W5V B;  4B0M A;  1VZ8 A;  2KMM A;  2FUG 1;  1F77 A;  3NZ3 A;  2Q5W D;  3U4E G;  2W55 A;  3NS1 A;  1SE2 A;  3PO0 A;  4GDK B;  1Q10 A;  3ZJV A;  3VR9 B;  1TY0 A;  5BYQ A;  2BB6 A;  3TEX A;  4ARC A;  2L52 A;  2DYO A;  3AE6 B;  1JML A;  4IDI A;  3IAS 1;  1WYG A;  1GOZ A;  2R61 A;  3MFG A;  2INP E;  3MJ5 A;  2FBW B;  2LUM A;  3IT4 B;  1KF6 B;  1PDX A;  1FRD A;  1WSP A;  4A8X C;  1J7C A;  2K5P A;  3RPF C;  2PVG C;  1SIJ A;  1TS4 A;  5D3I B;  3FIL B;  3KWV A;  4XWT A;  4XDC A;  2BW2 A;  1J7B A;  2N9L A;  1MI0 A;  4OW0 A;  3E9S A;  3NRZ A;  2IJ0 A;  4XDD A;  4Q2J A;  3SFD B;  2CJO A;  2E3T A;  2MJE A;  1T5X D;  4RGM A;  2WXK A;  2BT6 A;  2WQY B;  2KN4 A;  1DYQ A;  1F2R C;  3AB5 A;  3BVM A;  1CK1 A;  1I4R A;  3AEB B;  3GS2 A;  2PVO D;  3FIL A;  1YNT E;  2D5G A;  3GP7 A;  2CJN A;  3ZQ4 A;  2J53 A;  1J7A A;  3P63 A;  4JE3 B;  1K53 A;  1Y56 A;  1NVI D;  2I38 A;  3AE1 B;  2AQ2 B;  4OVZ A;  1SEB D;  4HEA 1;  1QT9 A;  1D4B A;  2K3U A;  4IKG A;  1RYJ A;  3KLS X;  3AMZ A;  3FAH A;  2DWQ A;  4P6V F;  2AQ3 B;  2KQ4 X;  1ENF A;  4A6Q A;  1ET6 A;  1XLQ A;  1EU3 A;  1RFK A;  4LTU A;  1KH0 A;  2BTE A;  2LHD A;  2WXJ A;  1WGK A;  4IOI E;  2WNM A;  4UDU C;  1NYR A;  4FXC A;  1QOA A;  1QKZ A;  2ZW1 A;  1D5M C;  2ONQ A;  2VZK B;  1C4P A;  5FK9 C;  1M4V A;  4WQM A;  1VZ6 A;  4C7Y A;  1B1Z A;  4US9 A;  3R8B A;  1YJI A;  4KX6 B;  4L1B A;  4YXD B;  3LYY A;  4DQO C;  1I4X A;  1WRI A;  1T6B X;  1TS2 A;  2EKI A;  1C4A A;  5EE9 A;  2WXO A;  1ESF A;  3CWI A;  1QOG A;  2IDY A;  1HEZ E;  4RF0 A;  1IGC A;  1MHH E;  4GDL B;  4US8 A;  2OED A;  2W82 A;  2MJD A;  3W9C B;  2HDE A;  3AEA B;  1YJJ A;  1P7E A;  4YSY B;  4D2K A;  4ZRP A;  5LNK 1;  4CQN A;  4WWM A;  1XLP A;  2JXT A;  1WXQ A;  3GB1 A;  2RMM A;  4HRS A;  4O1N A;  4USA A;  2Z8L A;  1IBX B;  3AED B;  1C76 A;  1HA5 A;  1T3Q A;  1XO3 A;  1JWB D;  1ZXI A;  2WP9 B;  1BXT A;  1UUP A;  2L32 A;  1FMA D;  5HHD G;  3Q8C A;  3SEB A;  1NEN B;  3BK2 A;  2QEJ C;  2PW9 A;  2I2Y A;  2G9H D;  5H8Y E;  3FC4 A;  1KLG D;  4JPS A;  1I4G A;  5MPO A;  2WDR B;  3AEG B;  4HRO A;  5G5H A;  1UNS A;  3H8H A;  3URY A;  4WH4 A;  4C7Z A;  2V3P A;  4YTM B;  3BVG A;  3VR8 B;  1MVK A;  2Y3A A;  2LFI A;  1JRP A;  3BK1 A;  3W5U B;  1PUT A;  4KGR A;  1JCK B;  4MAC A;  4RF1 A;  1D5Z C;  1SBB B;  2BYT A;  1BML C;  4NJC A;  1SE4 A;  3P4P B;  1GAQ B;  2XN9 C;  3AEE B;  2MEK A;  4C80 A;  1QF6 A;  3EA6 A;  2YEP B;  2DLB A;  2QSD A;  3AEC B;  1ZP0 B;  2L1A A;  5C3J B;  3Q8A A;  3UI3 A;  2AQ1 B;  1XCQ L;  4HKZ E;  4P16 A;  4HKQ A;  1L0X B;  2CU3 A;  2LMC A;  5HI1 A;  1DOY A;  2DYM A;  1HZ5 A;  2IGD A;  4YT0 B;  3ETR A;  1OFF A;  4KKJ A;  5D3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...