5AUIA

Crystal structure of ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
96
Chain Sequence
b'ATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQSDQSFLDDDQIEKGFVLTCVAYPRSDKILTNQEEELY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Thermosynechococcus elongatus (strain bp-1)
molecule tags Electron transport
total genus 26
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5auiA00
1TJEA 1E10A 3AEEB 3SFDB 3AE3B 2WQYB 3NVWA 2BS3B 3AMZA 1J7CA 2BS2B 2K9XA 3RPFC 2CJOA 1QLBB 1ZXIA 2PKOA 2W55A 3ETRA 3HUIA 2FBWB 3B2FA 4HRSA 5G5HA 1XLNA 1PDXA 1TKEA 4USAA 1FMAD 1V97A 1A70A 1FXAA 1YQ4B 1V8CA 4C7ZA 2L83A 1JRPA 2MJDA 3ZYYX 4KX6B 2MJ3A 4ZHPA 2M56B 4YSZB 1AYFA 1ROEA 3AE6B 4HROA 1FM0D 3AEDB 1YJIA 2EKIA 2QJLA 5EE9A 1B9RA 3CWIA 1N5WA 1NVID 2KMMA 1FFUA 3HVZA 2HTME 1WGKA 1QF6A 3AB5A 1GAQB 2JQRB 3PO0A 1J7BA 3DWGC 5MPOA 1XLQA 2WU5B 2JX5A 1FIQA 3NVZA 2CJNA 2DWQA 4WQMA 3NVVA 3BIID 3AM9A 2L52A 1OQQA 1I7HA 2WDVB 4N6EB 1JWAD 2W3SA 3AV8A 2G1EA 1XLOA 1N63A 1TKGA 4IDIA 1IUEA 2M19A 1KF6B 3AEAB 1OQRA 1JROA 5EE3A 4YTMB 1FRRA 1FRDA 1WWTA 3AE1B 3AE4B 1N60A 5C3JB 2K5PA 1E0ZA 2OHFA 1KFYB 4YSYB 1ZOYB 1CJEA 4P6VF 1ZP0B 1RYJA 3AE7B 3AEFB 1JALA 2DBYA 1J7AA 2E3TA 3B2GA 3EUB2 1JQ4A 1N61A 1TKYA 1DOXA 3SFEB 1F0ZA 1T3QA 2MH7A 4YTNB 1CZPA 1E6EB 1DGJA 1VLBA 1VJKA 1TYGB 3LXFA 4YSXB 1YQ3B 3WCQA 2AX5A 2WS3B 3P63A 4JX1C 4ZHOA 4FXCA 3KWLA 3DWMA 1N5XA 2CU3A 2LEKA 1FFVA 1AWDA 3VRBB 5G5GA 3AE2B 4WWMA 1OFFA 2H89B 2WDQB 3LB8C 2W54A 3AEGB 4ZOHC 5GXGB 2PVOD 3FC4A 1JWBD 1SF0A 1WXQA 2BS4B 1VDVA 1L6UA 1NEKB 3P4PB 2Q5WD 5EE1A 2N0SB 2H88B 4US8A 2MJEA 1PFDA 3AEBB 1GPXA 2WDRB 1DOIA 5C2TB 1SIJA 1PUTA 4N59A 2WLBA 3P4SB 1YJJA 1R7SA 1NYQA 1QOBA 2K22A 3VR8B 1FXIA 4JWUC 1EWYC 4ITKA 2PVGC 3NS1A 1FO4A 4C7YA 1WYGA 3W9CB 1KRHA 1JW9D 1L5PA 2QIEB 1QOFA 3AE5B 2KAJA 1L0VB 3AE8B 3AE9B 5H92C 3SR6A 3AECB 1RM6C 1QOAA 3NVYA 1ZUD2 3ABVB 4JWSC 5AUKA 3VR9B 2B76B 2Y5CA 3AN1A 3L4PA 1NI3A 5H8YE 4A9AA 4N58A 2WU2B 1XO3A 1RFKA 1XLPA 1NENB 2ACZB 1N62A 3AH7A 1NYRA 4YTPB 3FAHA 3P1MA 5AUIA 1E7PB 1QOGA 1UWMA 2BT6A 1SB3C 4LTUA 2PIAA 3VRAB 3CIRB 3P4QB 3W5UB 4YT0B 3HRDD 1E9MA 1DOYA 5EE0A 3NRZA 1RWSA 1WRIA 2W3RA 3B9JA 4US9A 1L6VA 1QT9A 3W5VB 4YXDB 4C80A 3P4RB 2WP9B
chains in the Genus database with same CATH superfamily
1ZKHA 1C76A 4FULA 3PREA 4LNFA 3ZW3A 2K6DB 4KSKC 1NBFC 1V1PB 3VH3B 2I1KA 4RNAA 2WXKA 1R4NB 1JRPA 1L4ZB 4ZHPA 2M56B 1B9RA 3CWIA 5C23A 2HTME 1VR9A 4M8NA 4XWWA 3IHPC 3R3MA 2WDTB 1P7FA 5D2MB 4FA6A 2JUOA 1ENFA 1I7HA 2WDVB 2G1EA 2AQ2B 5D3IB 4OHJA 1FRRA 3I63C 5J2RA 3AE4B 3R2TA 3LYYA 4FBJB 1D6EC 2BBCA 4HWIB 2JZ3B 3QA8A 1L4DB 4C56C 1VCBA 5AZFA 2PPHA 3EA6A 1DGJA 1VLBA 3TSSA 1T5XD 4MACA 4EOYA 2KO3A 2LEKA 2J4XA 4KGSA 2M0XA 4M01A 1SF0A 5IP4D 4KZCA 4II2B 2H88B 1GPXA 3R8BA 3L16A 5L83A 3AE8B 2JRIB 1J19A 1K53A 2ZVOA 5AUKA 2Y5CA 3I3TB 3L4PA 3URYA 1XLPA 1N62A 4BFRA 3FAHA 5HG2A 1P3QU 2L76A 2BPSA 4W9GA 3L54A 2BWFA 2MA9B 3DDCB 3NJTA 4UDUC 4HDQA 3H1UA 1QKZA 3R2IA 4PS7A 2QILA 4DDID 2KDBA 2E6XA 2BYEA 2FCQA 1T0YA 3DPDA 2PEAA 4C7ZA 5D7GA 2KDEB 1GB4A 2QJLA 1KM7A 2WNMA 3ZNHB 3RNAC 4TUUA 4WQMA 3NUHB 3RFZB 1UF0A 1OQQA 3GS2A 4MJSB 4ANXA 2NBVB 1XLOA 1LO5D 2M19A 2GBJA 4YTMB 1E0ZA 2L7RA 3AE1B 2RPQA 1MHXA 1BXTA 4W9IA 1N61A 2KXJA 2J53A 3Q3NC 2HTHA 1KLUD 1SE9A 3ZQ4A 2KJHB 4YSXB 4HCNB 4LNNA 2ZPNA 1TS4A 2INPE 1WF9A 1FNUA 1FFVA 1OFFA 4ZYSA 1V5TA 5GXGB 2WYQA 3IVFA 2EMTA 1NEKB 2ZNVB 4GLSC 2IO1B 3O13A 2WDRB 4MELA 1DYQA 2GB1A 3HVDA 3V3XA 2AWTA 3SEBA 1WGHA 3VR8B 4MEMA 1ZXHA 3V61A 2AEHA 3H7PB 1KRHA 3L17A 2KFKB 2ZCCA 1WXSA 3AECB 4W9EA 4K3CA 4EEWA 4LJOB 1XO3A 1WX9A 3KWVA 2WXNA 3N9YC 4HPMB 1QZEA 3P1MA 4OZCA 2V3SA 4ZRQA 3LJ3A 1N6ZA 1EO6A 2DHZA 3W5VB 2ZW1A 3BINA 4GGQA 3P4RB 2Y5PA 3ZLZA 2DYBA 2K39A 4MGKE 2JXXA 2Z0DB 5D6JB 3MC9A 1YIWA 4ARCA 1WZ0A 1EU3A 1MG8A 4EE2A 4YSZB 1S3SG 3BY4B 3AEDB 3AI5A 1ET9A 1FFUA 2BGFA 4W9JA 3AB5A 3UGBB 2LZ6A 5MPOA 2JVCA 3DWGC 3ALBA 1HA5A 3X0WA 2LXCA 4FJYA 1ZW7A 1JROA 2K3UA 2RDHA 4ZYNA 3U30A 1J0GA 3KUCB 3WA0A 1JALA 1SE3A 1WYWB 4RF1A 5BMHA 1V1OA 2ZVNA 3ML8A 2WXPA 4GU2A 4FLHA 4RGNA 3TJPA 4JX1C 1Z5SB 1WJUA 2JZZA 4NY0A 3VH4B 4C00A 3ZJUA 2DNFA 3DVNU 3N30A 3ZKJC 5D94A 4RGTA 4DBGA 1R7SA 4N9F4 3RNCC 4K7WA 2WXRA 4DXFA 1L5PA 1VD2A 1ZUD2 1ZPSA 3NHEB 2INDC 1RFKA 2KFKA 1NENB 3VAWA 2MP2B 2MCNB 1D4BA 3HHMA 1GC7A 3CIRB 4HVBA 2YEPF 4M0WA 2L0TA 4YXDB 4US9A 1B1ZA 2BB6A 2CR5A 3PRPB 3DOWA 3RPFC 3R66C 2LUMA 2BB5A 4ANUA 4L1BA 4MSMB 2ONQA 4NQLB 3CMMB 1P98A 2DENB 2W82A 3PVLA 4IM0A 3X23A 4LNOA 2C7MB 4MGZE 1WGKA 2WXGA 1GAQB 1IP9A 2WU5B 5IN7A 4AJYB 1YNTE 2L52A 4N6EB 3PGEA 1R4NI 2WXOA 1C1YB 2LGSA 1ISNA 5EE3A 3KH0A 1N60A 1RAXA 2OHFA 4FADA 3VQIA 4GDKB 1H4RA 3AE7B 3W2DA 1E7VA 1F0ZA 2G4SA 2JWZA 4M00A 4W9CA 2A5UA 1F2RC 2J52A 1SJED 1AN8A 4FXCA 1JWMD 4CHKA 3H6NA 5G5GA 2M8SA 4GIVA 1HQRD 2IO3B 5FR6A 3ZNZB 1MPEA 1L6UA 3TL5A 4US8A 2JYTA 1YJJA 1K51A 4G50A 1T0QC 4W9KA 1WYGA 1WMHA 2WXFA 3GOEA 4PS3A 2WXJA 1LXDA 2CKHB 1ET6A 4GMVA 3RNGC 2HD5B 3AULA 1JWUD 4WJQA 4WWPA 4HK2A 1JMLA 1L6VA 3HM6X 3UQAA 2NPTA 4RCOA 2JPHA 4E3CA 3I5JC 5AZHA 1P7EA 2V4LA 2JXTA 2MJ3A 4J6IA 2EKIA 2LVQA 3N1ZC 4XX5A 3TEZA 3QHTA 1OQYA 2K8BA 2O6VD 1UNSA 4HEA1 3W1SC 4AQ7A 2BKRB 1ZGUB 5HFYA 4B0EA 2JT4B 5KHOA 1XCTL 4URKA 3AEAB 3BYYB 4XZ4A 2UWQA 5C3JB 1LM8B 5KHQA 1KFYB 3B08A 1ZP0B 1RYJA 5IO9A 1C9FA 5CHVC 3ZGZA 2NVUI 3EC8A 4MGIE 1V86A 2GBMA 2HJ1A 2XN9C 4X57B 2MWSB 3VHTC 1WM2A 3TEWA 1TIFA 2BF8B 1N5XA 2R2QA 4RF0A 4W9LA 2W54A 1HTOA 3OAWA 1OEYA 1VDVA 3I9V1 5D3DA 5LXIB 2JWUA 4YWGG 1SIJA 4EFOA 3ECIA 4NZLB 1PUTA 1RRBA 1GG3A 4R3DA 4GOCA 3EFCA 4RH6A 2N7DA 3DHIC 4NPNA 2IY1B 1TTNA 1QOFA 1ZDXA 1I4XA 4K3BA 4PYUA 3BZDB 1SJHD 5JHBA 4DHJB 3U7DA 3Q3MC 2J0KA 4OVVA 2WU2B 2FIDA 4TQ0A 4MSQB 4YTPB 1I4GA 3OG5A 3WIMA 2R2OA 3U7ZA 3B9JA 1E7UA 3BWUD 2NBWB 4IM3A 2KDMA 4JLCA 2C7NB 2GI9A 5T8IA 3ZUNA 3Q3FA 3FILB 2LI5A 4K81A 4E71A 2K6QA 2O2VA 4BZAA 2BYFA 3HVZA 3VUXA 4W9HA 3CSTA 1EM7A 2QMTA 3BIID 4GDLB 1F9JA 2KN4A 1NI2A 5IA7A 1EWCA 2B3AA 4ICVA 1WR1A 4EUTA 1UBIA 3H9DA 2M17A 4HPPA 1P0RA 2JF5A 3S2AA 2K5PA 4YSYB 5GMVA 3VUYA 2MHJA 2IY0B 2WGSA 2DBYA 2YVCA 5DPRA 2KQSA 2DZIA 3ZJTA 1IBXA 1CZPA 1TYGB 2WXQA 4LLGM 2KWVB 3Q8CA 4WH4A 3TEXA 1WIAA 1YQBA 1Q5WB 2BS4B 2DLBA 2DAFA 2OJWA 2KC2A 2K0PA 4CYEA 1YJ1A 3RNBC 2KTFA 1UBQA 4NQKE 4CO7A 1KTKA 3QC8B 3ENEA 2KTRB 3QQ8B 2NS5A 4DHZE 2KAJA 4NJCA 1WJ6A 4PK1A 1QOAA 2ICIA 3ABVB 3VR9B 2KC1A 3ZTDA 4JGHB 2KDIA 4B0MA 1WR6E 2MRPA 3T9LA 2D11A 3AH7A 4DXAB 5AEKB 1T6BX 1I4QA 5E6PA 3A9KA 1XT9B 1YX5B 2D3CA 5TSSA 1L0YB 2Z0EB 2BS2B 4MM3A 1PDXA 2WX1A 4RFBA 1I35A 2LGYA 3WANA 5FK9C 1IGDA 3FILA 1AYFA 1ROEA 4XDCA 1C3TA 2FCSA 2AL6A 2BW2A 1FCCC 1FXTB 4G0NB 2DX5B 2J42A 4I6NB 3P2BA 2KWCA 4F8CB 2LMCA 1JWAD 2W3SA 3APDA 3ONSA 3RMKC 1N63A 4BKSD 3L10B 4GDLA 1WWTA 3BVMA 2KZRA 1V1PA 2E3TA 3B2GA 2QDFA 4BKTA 2L1AA 2D3GA 3SDLC 2WXHA 2N7JA 2AL3A 3LXFA 2EELA 3OJ3A 4J3OD 4ZHOA 4KKIA 2VZKD 4IM2A 3ZTCA 3DBLI 3VRBB 1HE8A 2WDQB 2X8XX 4LDTD 3AEGB 1VRAB 4IW0A 1YD8U 2ON8A 2CHXA 3ZVVA 4HJKA 3P4SB 1SXTA 2OOBB 2DYMA 3V05A 1FXIA 2L00B 3NS1A 2LASA 3QARA 1JW9D 3SR6A 3WAOA 3UF8A 1PQSA 3Q8FA 1EU4A 1V49A 2KFJA 2J0MA 4FHKA 4BBNC 2V1YA 1MI0A 1K52A 3U52E 2FIFA 1M94A 1NYRA 2EMSA 2LXAA 4RMAA 4W9DA 4BBNF 4KZ0A 3I57A 4KKJA 4ACFA 1WE7A 5DPTA 2W3RA 1LQBA 1GC6A 2KOXA 3AEEB 3NOBA 2C7HA 5BO4B 1GOZA 3QWZB 1OGWA 5BMGA 2KYWA 2WXLA 1A70A 1UGMA 1EF1A 2DZJA 2IDYA 4BVUC 4RGMA 2MJDA 4HROA 1FM0D 2K8CA 1TS5A 4OVUA 2KMMA 2NTSA 1KJTA 3PZDA 1WY8A 3A4RA 4II3B 2PJHA 3WALA 1V6EA 2HJ8A 1LGRA 2KVRA 5E6NA 1OQRA 2JY6A 1OEYJ 5IKCM 1TBEA 1MHHE 2QCZA 1V81A 1MVKA 1SIFA 1E8WA 1J7AA 2LJIA 2X38A 4KGTA 2KDFB 1I4PA 4W9FA 2SAKA 2BYVE 2DZKA 4F7ZA 2C60A 2XK5B 3BYTB 5DPWA 3VFKA 4MJSA 3MC8A 3EECA 2N0SB 2VRRB 2D2QA 5C2TB 2WLBA 3T3NA 1XXGA 1AW7A 2JU6X 3AE5B 1V5OA 4A3PA 2B76B 3AN1A 1WGYA 4A90A 2YEPB 1NI3A 2OEDA 4KSLC 4REZA 3MJWA 4JQWC 2I1JA 2FAZA 1QOGA 3KYDD 4WJPA 1S1QB 5EE0A 1BT0A 1TY2A 1TJEA 2WQYB 3NVWA 1GUAB 2BS3B 3GB1A 2QC8A 1QLBB 4P7IA 3QX1A 3KQ4A 1CMXB 2N9KA 5JH5C 3JSVB 3H7PA 1V8CA 2FUG1 3N20C 1Q0WB 2VZKB 2INCC 1XD3B 4LDTB 2K25A 1QF6A 1WH3A 3IBEA 4D2KA 3DHGC 4WJNA 3AV8A 2IZVB 5DCNA 3SHQA 1YX6B 4IWOA 1KF6B 2LWPA 2HDEA 2JZPA 4XYCA 4OZAA 2MW5A 3TIXA 2J7QB 4P6VF 2CS4A 1PGXA 2JRHA 3AEFB 2Z8LA 3A33B 4S0RA 3E9SA 2VH2A 2BQQA 3L13A 4IG7B 3SFEB 4AUQC 2NMQA 2G4DB 1X1MA 2I2YA 1HZ6A 2WS3B 3DVGY 3DWMA 2N9XA 1J8CA 2FUHB 4WJOA 1TT5B 2INNE 1JWBD 2KKCA 3Q3JA 3PTFC 3P4PB 3DBLB 5BMIA 3DBSA 1Y8RC 3E56A 2V3NA 2KJRA 4N59A 1NYQA 3IT6B 3IAS1 2PVGC 1AARA 2L32A 3H7SA 3TMPB 1HZ5A 3EHVA 4NAWB 2Y3AA 2RMMA 1C79A 4L23A 2WX0A 5E6OA 2MBEA 1EUVB 2KN5A 3U2SC 3N3KB 3NS8A 2VH1A 1E7PB 2BT6A 2KK8A 3P4QB 4LK0M 1QILA 1Q10A 2MBQA 3WAPA 1OTRB 2MSED 5CHWA 3CSFA 2ASQA 4PT5A 3A9JB 2L0FA 2PMVA 4HRSA 4AWJA 4HJGE 1HEZE 3M3JA 4USAA 1XQQA 1WSPA 3AE6B 4TV3A 3A1QB 2MP2A 1WX7A 3NVZA 4MH8A 1VZ7A 2L8JA 3PPAA 2J0JA 3T8MA 4CQNA 3PRMB 1VZ8A 3VVWB 2IBIB 4HKZE 4LNKA 3A4SC 2KANA 4RGOS 4IDIA 1WXAA 1IUEA 3ZO5B 2LHDA 4BOZB 3FKYA 3EUB2 1FEHA 4DXGA 2IJ0A 2WP9B 2N1WA 1E6EB 4M02A 1TS3A 4FJVB 1V9JA 4I6PA 3JYUA 1E5WA 3DVGX 2ZCBA 3P63A 2RDGA 3QIJA 3TUOA 3AE2B 3ZDMC 4IWQA 5CX3A 4Q2JA 3UI3A 2KVZA 3GZNB 4EKUA 4JIOU 4LCDE 2AYOB 5AZGA 2BVCA 1XEEA 1STEA 4GDKA 1V80A 2SEBD 4OZBA 4A9AA 4A55A 4ARIA 4NAWA 5CHFA 3RNFC 4BAXA 2KWDA 1NDDA 3NZUA 3VRAB 4G3XB 1DOYA 4TQ1A 1H8CA 2RGFA 1SGHA 3O65B 4FHJA 2QSDA 4TKNA 5LXHA 1R4MB 2LJ5A 2DAJA 3HUIA 3V6CB 5J17A 4EZLA 3W1YA 1T0SC 3PHWB 1YQ4B 4BKGA 4WWOA 3PLUA 1P1AA 5EE9A 1I4RA 1IGCA 3PO0A 1FNWA 1WJNA 3BK1A 1XF5L 1MG4A 2ZEQA 2FNJB 4JE3B 1UZXB 2FE8A 3U8ZA 5E6JA 3BVZA 4GB9A 3H8HA 3Q8AA 4KIKB 3R7RA 1E8ZA 2QEJC 2NR2A 4WAFA 1JQ4A 4OVZA 2KQ4X 4AS1A 1YMHE 4H2AA 1BUIC 1T3QA 2LGIA 5BYSA 3SD5A 1L7YA 3PZ7A 2GOWA 2JSVX 2LD9A 3KWLA 5LLIA 4K7SA 2CU3A 1GJZA 1JWSD 2PVOD 3TBLD 3TEYA 3QJZA 5EE1A 4F1SA 2GMIC 1PGBA 1K8RB 3VTWA 3ZRCA 1K50A 1QOBA 4WAAA 1EWYC 4KVGB 3APCA 3Q69A 1D5MC 2QIEB 2KJ6A 1U4AA 4ZRIA 5H8YE 2R61A 2XEWA 4HLEA 4N58A 2LHEA 2ACZB 5FKAC 4EZKA 2QHOA 1SB3C 3PRZA 4YT0B 1UGJA 3NRZA 4IKGA 1TZ1A 3AE3B 4NNJB 2G45B 3PSEB 3QAQA 1KLVA 2CHWA 3IT4B 3NY5A 3B2FA 1SSNA 2O6VB 3R7QA 3UQBA 1FMAD 3DBRB 2V4IB 1FXAA 3GE8C 4O1NA 5IOIA 4XC2A 4A20A 2DZMA 1IYFA 5CTRC 4HXDA 4TMAB 4ZRKA 4DDGD 2MBHA 1NVID 4G11A 2GBKA 4P16A 1XLQA 2CJNA 2LFIA 2KLCA 2N1VA 2LVPA 1FNVA 4ANWA 2W9NA 3RUIB 1FRDA 3VTUA 2N4FA 5TR5A 2AQ3B 2IYDB 2D07B 1KLGD 3Q2AC 2LUEA 4IOIE 2DYOA 1TKYA 1YN4A 2MLBA 3GP7A 4KIKA 2LRUA 3EGRA 4YTNB 2CU1A 2EKEC 4XDDA 1YQ3B 2MBBB 3RULA 3OWEB 4TSSA 1AWDA 2H89B 2MX2A 4GSWA 1RFAA 1L2NA 3RCZA 4WWNA 1F2RI 1PGAA 2L3ZA 2KQ7A 1WZ3A 2K22A 2MBOA 1WGGA 4MGYE 4C7YA 1MFWA 5G2NA 3AE9B 2V3PA 1L0VB 2BKFA 1SE4A 4JWSC 1FCLA 1KOTA 1E8YA 3DBHB 1CK1A 3V6EB 3V62A 1M4VA 4RM8A 4KDIC 5HI1A 5AUIA 2HE7A 2NTTA 1PYWD 5I4DA 2PIAA 3QK0A 1E9MA 1F1HA 1RWSA 1WRIA 4DQOC 2PW9A 2IO2B 4C80A 3HM3A 1FPYA 1C78A 1I4HA 5JHAA 1E10A 3KUZA 2IGDA 1J7CA 3ETRA 3PZ8A 4HKQA 2KTRA 2XBBC 2KACA 5C1ZA 1JCKB 3DVNV 3N1XC 2O6VA 1TZOA 2PE9A 3PHXB 4ZDVA 4IWPA 4B6WA 4HCPB 4JL9A 3CF6E 2PTLA 1FIQA 1ZE3D 5HKHA 2AQ1B 2D10A 3AM9A 1TGZB 4AOFA 2WXIA 5LNK1 1D5XC 1ZOYB 1L0XB 1CJEA 4XWTA 3ZJVA 2BYTA 3ML9A 3WAMA 2NCNA 4KV2A 4LNIA 5IAAC 2WHIA 2AX5A 4HDOA 4WWMA 4M0WB 3RZFA 3T3OA 3RN9C 2BTEA 5G55A 4MDKE 3N1YC 4DHZB 1WGRA 4MH0E 4QAYA 2MJEA 1SEBD 2KX3A 2ZNVC 4A6QA 3NZ3A 3SU8X 4P1BC 3UINB 5H92C 3NG0A 2A4ZA 2D3BA 4K1RB 3VTVA 3GZNI 2XNAC 3NZSA 1UWMA 3Q14C 3VUWA 3PT2B 2K1FA 3DQVA 1Z2MA 2ZZPB 2LGDA 4PYZA 4A3OA 1WJ4A 3AMZA 2Y5BB 4IC7B 1ZXIA 2FBWB 4AP4C 4RM9A 4ZRPA 3KW5B 2KMAA 1TY0A 3L08A 3BK2A 3Q8EA 1EF5A 2RD0A 2PLPA 4S17A 1R4MI 2D5GA 2DWQA 2I38A 2RSUA 3NVVA 4EZJA 3ZNGC 4A8XC 3ZDTA 2IGGA 5HHDG 1ESFA 1LFDA 4E74A 3LDZE 2D3AA 2M4NA 1WMHB 1SE2A 3J9CA 2FCMA 2YLMA 3DCGA 2MH7A 1VJKA 3K9PB 1I42A 2RPVA 4OW0A 1VZ6A 5J18A 1FD6A 3LB8C 3EFUA 3FC4A 1WXQA 2Q5WD 1ACCA 2NPTB 3AEBB 3IFWB 2KX0A 1V2YA 3C19A 1WRDB 1WXVA 3MFGA 2KT7A 4I6LB 4P1CC 4NJ6A 4ITKA 4ZRJA 2N9LA 5FR3A 1C4PA 1GB1A 2K8HA 3P42A 3MTNB 1WE6A 4WIPA 5BYQA 1HTQA 2N9EB 3Q6BA 3Q3OC 1UD7A 1YN3A 3C8YA 4BOSC 1P9DU 2XK5A 4KGRA 4DHJD 3TCAA 2IGHA 3SFDB 3DHHC 2K9XA 2PKOA 2W55A 5G5HA 1UUPA 1F77A 2KWUB 1V97A 4WURA 4WQOB 4ASWC 2TSSA 2L83A 3AU4A 3RT3B 3ZYYX 1E90A 1BMLC 4L2YA 3ZNID 1YJIA 2JYEA 3BVGA 3OJ4B 4NJ7A 1N5WA 4C4VB 2V0GA 1F52A 3PLVA 3UIPB 1Q1OA 5JXVA 1XCQL 5DPSA 2GRIA 2WXMA 1T0RC 4KDLB 3OLMD 4XGAB 4BKSA 3DBRI 2GBRA 3V60A 2ZPYA 1TS2A 2BWES 1GNUA 3APFA 3VDZA 3MP9A 1UH6A 3JSVA 2C9WB 5L95C 4K7UA 3M62B 1Y56A 3RI7C 1WM3A 3C0RB 2RDBC 2LGXA 2PE6B 2ZW0A 3KLSX 1SBBB 4ZOHC 3HIZA 2N7EA 3MC0B 2CHZA 3KUDB 3K9OB 3PV1A 1UWXA 2MEKA 2M0AA 3RZWC 1D3ZA 1MJDA 2ZJDA 3IG3A 3RD2A 1KH0A 2N9PC 3RNEC 2LRWA 2G3QB 3VXWA 3W9CB 1CQVA 3JVZX 2L05A 2O2VB 1RM6C 5BYRA 1WGDA 4DWFA 3KYCD 4YL8A 2MQJA 4LTUA 1C77A 4B95A 1UELA 2G9HD 3HK0A 1QT9A 2RR9A 3N32A 4HPLB 1YOVB 3DBHI 2CJOA 4GN1A 3GE3C 1XLNA 1TKEA 4M8MA 3M95A 4XE0A 4KX6B 1IBXB 1WFYA 1WXMA 2WWZA 4LJPB 4AJWA 3QCAA 3MJ5A 1WX8A 2C5LC 2JQRB 1J7BA 2JX5A 4C4VA 3MHZA 2LVOA 2KHWB 2UU7A 1YN5A 2KNBA 3ZXRA 2IPKD 3U4EG 3Q8BA 3ZIMA 1TKGA 2FCNA 2V9HA 2OJRA 3B0AA 3A9JA 1QQRA 3B1LX 3IAM1 3RYTA 3ZXVA 1G6JA 3KVFB 4MT5A 2NBUA 1DOXA 4ANVA 3IXSA 2KMCA 4B9KA 4DK5A 3A1QA 2KLGA 1WI0A 4ICUA 3WCQA 3W1SA 4NAMA 3ZRFA 1IPGA 2M1MA 3A9KB 2GLSA 3JW0X 4FJZA 3L0WB 3D32A 3PS6A 1D5ZC 2IO0B 1C4AA 1PFDA 4IUMB 1DOIA 3AXCA 4MM3B 5EDSA 2Z59B 5JZEB 4GXBA 1C4CA 4JWUC 1FO4A 2REXA 1ZDVA 1HXYD 3UIOB 3NVYA 1JRUA 3M63B 3AU5A 2UYZB 4JPSA 1E8XA 3MHSD 1RLFA 2KD0A 3W5UB 4PS8A 3HRDD 2GBNA 1A5RA 4FN2A
chains in the Genus database with same CATH topology
1I4HA 1TY2A 1TJEA 1E10A 1C76A 2WQYB 2IGDA 3NVWA 2BS3B 4RCOA 3GB1A 1J7CA 1QLBB 3ETRA 3PZ8A 4HKQA 3KQ4A 1V1PB 2N9KA 4RNAA 2KACA 1JCKB 1V8CA 1P7EA 2WXKA 2FUG1 2JXTA 1JRPA 2VZKB 2MJ3A 1L4ZB 4ZHPA 2M56B 1TZOA 2EKIA 1B9RA 3CWIA 3TEZA 2HTME 1QF6A 1VR9A 4XWWA 2PTLA 1UNSA 1FIQA 1ZE3D 1P7FA 2AQ1B 4HEA1 4D2KA 4AQ7A 3AM9A 1ENFA 1I7HA 2WDVB 3AV8A 5HFYA 2G1EA 4B0EA 2AQ2B 1XCTL 5D3IB 4OHJA 1KF6B 3AEAB 3BYYB 1FRRA 2HDEA 2JZPA 2WXIA 3AE4B 3R2TA 5C3JB 4OZAA 5LNK1 1KFYB 3LYYA 1D5XC 1D6EC 1ZOYB 1L0XB 1CJEA 2BBCA 4P6VF 4XWTA 1ZP0B 1RYJA 1L4DB 1C9FA 3ZJVA 1PGXA 4C56C 3ZGZA 3AEFB 2BYTA 2Z8LA 3E9SA 3SFEB 2NMQA 2XN9C 3EA6A 2I2YA 1DGJA 1VLBA 3TSSA 1T5XD 4MACA 1HZ6A 2AX5A 2WS3B 3TEWA 3DWMA 1N5XA 2LEKA 4WWMA 2J4XA 4KGSA 4RF0A 2W54A 3T3OA 2INNE 2BTEA 1JWBD 1SF0A 1VDVA 3P4PB 3I9V1 5D3DA 5BMIA 2H88B 2JWUA 1SEBD 2MJEA 3R8BA 1GPXA 4YWGG 4A6QA 3E56A 1SIJA 3NZ3A 2V3NA 4NZLB 1PUTA 4N59A 1NYQA 4R3DA 3IT6B 3IAS1 2PVGC 4RH6A 2L32A 3AE8B 1ZDXA 1QOFA 1I4XA 5H92C 1K53A 1HZ5A 1SJHD 3BZDB 2Y3AA 4NAWB 2RMMA 5AUKA 2Y5CA 1C79A 4L23A 3L4PA 3URYA 2WU2B 1XLPA 4TQ0A 2XNAC 1N62A 3U2SC 4YTPB 3FAHA 5HG2A 1E7PB 1I4GA 1UWMA 2BT6A 3P4QB 4LK0M 3U7ZA 3B9JA 1QILA 1Q10A 4UDUC 3R2IA 3BWUD 2QILA 3AMZA 2KDMA 4PT5A 2PMVA 1ZXIA 4HRSA 2E6XA 2FBWB 4HJGE 2GI9A 1HEZE 5T8IA 4ZRPA 4USAA 3FILB 1TY0A 1WSPA 4C7ZA 5D7GA 3BK2A 3Q8EA 3AE6B 2PLPA 1GB4A 2QJLA 2WNMA 3HVZA 2D5GA 3NVZA 4MH8A 1VZ7A 4WQMA 2DWQA 3NUHB 2I38A 3NVVA 1EM7A 2QMTA 3BIID 4GDLB 3RFZB 4CQNA 2KN4A 1OQQA 3GS2A 4A8XC 1VZ8A 1EWCA 4HKZE 1XLOA 4RGOS 1LO5D 4IDIA 2IGGA 5HHDG 1ESFA 1IUEA 2M19A 4YTMB 1E0ZA 3AE1B 2K5PA 4YSYB 2LHDA 1MHXA 1BXTA 1SE2A 2DBYA 3EUB2 1FEHA 4DXGA 3J9CA 1N61A 2IJ0A 2WP9B 2J53A 1IBXA 3ZJTA 1KLUD 2MH7A 1CZPA 1E6EB 1VJKA 1TYGB 1TS3A 3ZQ4A 4YSXB 2WXQA 3P63A 1TS4A 2INPE 2RDGA 4LLGM 3TUOA 1FNUA 3Q8CA 1FFVA 2RPVA 1VZ6A 4OW0A 3AE2B 1FD6A 1OFFA 4WH4A 3LB8C 3TEXA 4ZYSA 5GXGB 3FC4A 4Q2JA 1WXQA 3UI3A 2BS4B 2DLBA 1NEKB 4GLSC 2Q5WD 3O13A 1ACCA 3AEBB 2WDRB 2K0PA 1DYQA 2GB1A 3HVDA 3V3XA 3MFGA 1KTKA 3SEBA 3VR8B 1ZXHA 4ITKA 1XEEA 1STEA 2N9LA 5FR3A 1C4PA 1KRHA 2KAJA 4NJCA 1GB1A 3AECB 3P42A 1QOAA 2ICIA 3ABVB 2SEBD 3VR9B 4OZBA 4A9AA 1XO3A 3KWVA 4B0MA 4WIPA 5BYQA 4A55A 3AH7A 2WXNA 4ARIA 1T6BX 3N9YC 3P1MA 1I4QA 4OZCA 2KWDA 4ZRQA 3VRAB 1YN3A 3C8YA 4TQ1A 1DOYA 4KGRA 3W5VB 2ZW1A 2QSDA 3P4RB 5TSSA 1L0YB 2Y5PA 2IGHA 3SFDB 2K9XA 2BS2B 2PKOA 2W55A 5G5HA 1UUPA 3HUIA 1F77A 1PDXA 4ARCA 1V97A 4WURA 4RFBA 1YQ4B 1EU3A 2TSSA 2L83A 3ZYYX 4EE2A 1BMLC 5FK9C 1IGDA 3FILA 4L2YA 4YSZB 1AYFA 1ROEA 4XDCA 3AEDB 1YJIA 2JYEA 3BVGA 5EE9A 1N5WA 2BW2A 1ET9A 1FCCC 1I4RA 2V0GA 1IGCA 1FFUA 5JXVA 3AB5A 1XCQL 5MPOA 3PO0A 3DWGC 2J42A 2GRIA 2WXMA 1FNWA 1HA5A 3BK1A 1XF5L 2LMCA 1TS2A 1JWAD 2W3SA 4JE3B 1N63A 1JROA 2FE8A 1WWTA 3BVMA 2K3UA 5E6JA 1V1PA 2RDHA 3BVZA 3MP9A 3H8HA 3Q8AA 2QEJC 1JALA 2E3TA 3B2GA 4WAFA 1JQ4A 4OVZA 2L1AA 1SE3A 4RF1A 2KQ4X 5BMHA 1Y56A 2WXHA 4AS1A 1V1OA 1YMHE 4H2AA 1BUIC 2N7JA 2WXPA 1T3QA 2LGIA 5BYSA 3LXFA 2EELA 3PZ7A 4RGNA 4J3OD 4JX1C 4KKIA 2JSVX 4ZHOA 2VZKD 3KWLA 2CU3A 3VRBB 2ZW0A 3KLSX 1JWSD 1SBBB 2WDQB 3AEGB 1VRAB 4ZOHC 2PVOD 3MC0B 3TEYA 5EE1A 1UWXA 2MEKA 2ON8A 3ZJUA 2M0AA 1PGBA 4RGTA 3P4SB 1KH0A 1R7SA 1K50A 1QOBA 1SXTA 2DYMA 3V05A 1FXIA 1EWYC 3NS1A 2WXRA 3Q69A 1D5MC 3W9CB 2QIEB 1CQVA 1JW9D 1L5PA 3SR6A 4DXFA 1RM6C 3Q8FA 1ZUD2 1EU4A 5BYRA 1ZPSA 5H8YE 2R61A 4N58A 2LHEA 1MI0A 1RFKA 1K52A 1NENB 2ACZB 5FKAC 3U52E 1NYRA 1SB3C 1C77A 4LTUA 1D4BA 2G9HD 3I57A 3CIRB 4KKJA 4YT0B 2YEPF 4M0WA 1UGJA 3NRZA 4YXDB 2W3RA 4US9A 1QT9A 4IKGA 1B1ZA 2BB6A 3AEEB 3AE3B 3RPFC 2CJOA 1GOZA 3IT4B 3B2FA 2LUMA 2BB5A 1SSNA 1XLNA 4L1BA 5BMGA 1TKEA 1FMAD 2WXLA 2V4IB 2ONQA 1A70A 1FXAA 4O1NA 2IDYA 4RGMA 2MJDA 4XE0A 4KX6B 2W82A 1IBXB 4TMAB 4HROA 1FM0D 1TS5A 1NVID 2KMMA 3MJ5A 2NTSA 1WGKA 4P16A 2WXGA 1GAQB 2JQRB 1J7BA 1XLQA 2WU5B 2JX5A 2CJNA 2LFIA 3MHZA 1YNTE 1YN5A 2L52A 4N6EB 2IPKD 1FNVA 3U4EG 2WXOA 3Q8BA 1TKGA 1OQRA 5EE3A 1FRDA 1QQRA 1N60A 2OHFA 3VQIA 3IAM1 4GDKB 1MHHE 2AQ3B 3AE7B 1MVKA 4MT5A 3W2DA 1KLGD 2LJIA 1J7AA 2X38A 4IOIE 4KGTA 2DYOA 1TKYA 1DOXA 1YN4A 3GP7A 1F0ZA 3IXSA 1I4PA 3EGRA 4YTNB 2SAKA 1F2RC 4XDDA 2J52A 1YQ3B 3WCQA 3W1SA 1SJED 4NAMA 1AN8A 4FXCA 1JWMD 3OWEB 4TSSA 1AWDA 5G5GA 2H89B 1HQRD 1D5ZC 3BYTB 1MPEA 1L6UA 1C4AA 2N0SB 4US8A 1PFDA 2JYTA 1DOIA 1F2RI 1PGAA 5C2TB 4MM3B 2WLBA 3T3NA 1YJJA 1XXGA 2K22A 1AW7A 1C4CA 1K51A 4JWUC 1FO4A 2JU6X 1ZDVA 4C7YA 1WYGA 3AE5B 2V3PA 3AE9B 1L0VB 2WXFA 1HXYD 1SE4A 2WXJA 3NVYA 4JWSC 1FCLA 2B76B 3AN1A 4A90A 2YEPB 1NI3A 1CK1A 2OEDA 4JPSA 1M4VA 4REZA 1ET6A 5HI1A 5AUIA 1QOGA 1JWUD 2NTTA 1PYWD 5I4DA 2PIAA 3W5UB 3HRDD 1E9MA 1JMLA 5EE0A 1RWSA 1WRIA 4DQOC 2PW9A 1L6VA 4C80A 1C78A 1QKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJE A;  1E10 A;  3AEE B;  3SFD B;  3AE3 B;  2WQY B;  3NVW A;  2BS3 B;  3AMZ A;  1J7C A;  2BS2 B;  2K9X A;  3RPF C;  2CJO A;  1QLB B;  1ZXI A;  2PKO A;  2W55 A;  3ETR A;  3HUI A;  2FBW B;  3B2F A;  4HRS A;  5G5H A;  1XLN A;  1PDX A;  1TKE A;  4USA A;  1FMA D;  1V97 A;  1A70 A;  1FXA A;  1YQ4 B;  1V8C A;  4C7Z A;  2L83 A;  1JRP A;  2MJD A;  3ZYY X;  4KX6 B;  2MJ3 A;  4ZHP A;  2M56 B;  4YSZ B;  1AYF A;  1ROE A;  3AE6 B;  4HRO A;  1FM0 D;  3AED B;  1YJI A;  2EKI A;  2QJL A;  5EE9 A;  1B9R A;  3CWI A;  1N5W A;  1NVI D;  2KMM A;  1FFU A;  3HVZ A;  2HTM E;  1WGK A;  1QF6 A;  3AB5 A;  1GAQ B;  2JQR B;  3PO0 A;  1J7B A;  3DWG C;  5MPO A;  1XLQ A;  2WU5 B;  2JX5 A;  1FIQ A;  3NVZ A;  2CJN A;  2DWQ A;  4WQM A;  3NVV A;  3BII D;  3AM9 A;  2L52 A;  1OQQ A;  1I7H A;  2WDV B;  4N6E B;  1JWA D;  2W3S A;  3AV8 A;  2G1E A;  1XLO A;  1N63 A;  1TKG A;  4IDI A;  1IUE A;  2M19 A;  1KF6 B;  3AEA B;  1OQR A;  1JRO A;  5EE3 A;  4YTM B;  1FRR A;  1FRD A;  1WWT A;  3AE1 B;  3AE4 B;  1N60 A;  5C3J B;  2K5P A;  1E0Z A;  2OHF A;  1KFY B;  4YSY B;  1ZOY B;  1CJE A;  4P6V F;  1ZP0 B;  1RYJ A;  3AE7 B;  3AEF B;  1JAL A;  2DBY A;  1J7A A;  2E3T A;  3B2G A;  3EUB 2;  1JQ4 A;  1N61 A;  1TKY A;  1DOX A;  3SFE B;  1F0Z A;  1T3Q A;  2MH7 A;  4YTN B;  1CZP A;  1E6E B;  1DGJ A;  1VLB A;  1VJK A;  1TYG B;  3LXF A;  4YSX B;  1YQ3 B;  3WCQ A;  2AX5 A;  2WS3 B;  3P63 A;  4JX1 C;  4ZHO A;  4FXC A;  3KWL A;  3DWM A;  1N5X A;  2CU3 A;  2LEK A;  1FFV A;  1AWD A;  3VRB B;  5G5G A;  3AE2 B;  4WWM A;  1OFF A;  2H89 B;  2WDQ B;  3LB8 C;  2W54 A;  3AEG B;  4ZOH C;  5GXG B;  2PVO D;  3FC4 A;  1JWB D;  1SF0 A;  1WXQ A;  2BS4 B;  1VDV A;  1L6U A;  1NEK B;  3P4P B;  2Q5W D;  5EE1 A;  2N0S B;  2H88 B;  4US8 A;  2MJE A;  1PFD A;  3AEB B;  1GPX A;  2WDR B;  1DOI A;  5C2T B;  1SIJ A;  1PUT A;  4N59 A;  2WLB A;  3P4S B;  1YJJ A;  1R7S A;  1NYQ A;  1QOB A;  2K22 A;  3VR8 B;  1FXI A;  4JWU C;  1EWY C;  4ITK A;  2PVG C;  3NS1 A;  1FO4 A;  4C7Y A;  1WYG A;  3W9C B;  1KRH A;  1JW9 D;  1L5P A;  2QIE B;  1QOF A;  3AE5 B;  2KAJ A;  1L0V B;  3AE8 B;  3AE9 B;  5H92 C;  3SR6 A;  3AEC B;  1RM6 C;  1QOA A;  3NVY A;  1ZUD 2;  3ABV B;  4JWS C;  5AUK A;  3VR9 B;  2B76 B;  2Y5C A;  3AN1 A;  3L4P A;  1NI3 A;  5H8Y E;  4A9A A;  4N58 A;  2WU2 B;  1XO3 A;  1RFK A;  1XLP A;  1NEN B;  2ACZ B;  1N62 A;  3AH7 A;  1NYR A;  4YTP B;  3FAH A;  3P1M A;  5AUI A;  1E7P B;  1QOG A;  1UWM A;  2BT6 A;  1SB3 C;  4LTU A;  2PIA A;  3VRA B;  3CIR B;  3P4Q B;  3W5U B;  4YT0 B;  3HRD D;  1E9M A;  1DOY A;  5EE0 A;  3NRZ A;  1RWS A;  1WRI A;  2W3R A;  3B9J A;  4US9 A;  1L6V A;  1QT9 A;  3W5V B;  4YXD B;  4C80 A;  3P4R B;  2WP9 B; 
#chains in the Genus database with same CATH topology
 1ZKH A;  1C76 A;  4FUL A;  3PRE A;  4LNF A;  3ZW3 A;  2K6D B;  4KSK C;  1NBF C;  1V1P B;  3VH3 B;  2I1K A;  4RNA A;  2WXK A;  1R4N B;  1JRP A;  1L4Z B;  4ZHP A;  2M56 B;  1B9R A;  3CWI A;  5C23 A;  2HTM E;  1VR9 A;  4M8N A;  4XWW A;  3IHP C;  3R3M A;  2WDT B;  1P7F A;  5D2M B;  4FA6 A;  2JUO A;  1ENF A;  1I7H A;  2WDV B;  2G1E A;  2AQ2 B;  5D3I B;  4OHJ A;  1FRR A;  3I63 C;  5J2R A;  3AE4 B;  3R2T A;  3LYY A;  4FBJ B;  1D6E C;  2BBC A;  4HWI B;  2JZ3 B;  3QA8 A;  1L4D B;  4C56 C;  1VCB A;  5AZF A;  2PPH A;  3EA6 A;  1DGJ A;  1VLB A;  3TSS A;  1T5X D;  4MAC A;  4EOY A;  2KO3 A;  2LEK A;  2J4X A;  4KGS A;  2M0X A;  4M01 A;  1SF0 A;  5IP4 D;  4KZC A;  4II2 B;  2H88 B;  1GPX A;  3R8B A;  3L16 A;  5L83 A;  3AE8 B;  2JRI B;  1J19 A;  1K53 A;  2ZVO A;  5AUK A;  2Y5C A;  3I3T B;  3L4P A;  3URY A;  1XLP A;  1N62 A;  4BFR A;  3FAH A;  5HG2 A;  1P3Q U;  2L76 A;  2BPS A;  4W9G A;  3L54 A;  2BWF A;  2MA9 B;  3DDC B;  3NJT A;  4UDU C;  4HDQ A;  3H1U A;  1QKZ A;  3R2I A;  4PS7 A;  2QIL A;  4DDI D;  2KDB A;  2E6X A;  2BYE A;  2FCQ A;  1T0Y A;  3DPD A;  2PEA A;  4C7Z A;  5D7G A;  2KDE B;  1GB4 A;  2QJL A;  1KM7 A;  2WNM A;  3ZNH B;  3RNA C;  4TUU A;  4WQM A;  3NUH B;  3RFZ B;  1UF0 A;  1OQQ A;  3GS2 A;  4MJS B;  4ANX A;  2NBV B;  1XLO A;  1LO5 D;  2M19 A;  2GBJ A;  4YTM B;  1E0Z A;  2L7R A;  3AE1 B;  2RPQ A;  1MHX A;  1BXT A;  4W9I A;  1N61 A;  2KXJ A;  2J53 A;  3Q3N C;  2HTH A;  1KLU D;  1SE9 A;  3ZQ4 A;  2KJH B;  4YSX B;  4HCN B;  4LNN A;  2ZPN A;  1TS4 A;  2INP E;  1WF9 A;  1FNU A;  1FFV A;  1OFF A;  4ZYS A;  1V5T A;  5GXG B;  2WYQ A;  3IVF A;  2EMT A;  1NEK B;  2ZNV B;  4GLS C;  2IO1 B;  3O13 A;  2WDR B;  4MEL A;  1DYQ A;  2GB1 A;  3HVD A;  3V3X A;  2AWT A;  3SEB A;  1WGH A;  3VR8 B;  4MEM A;  1ZXH A;  3V61 A;  2AEH A;  3H7P B;  1KRH A;  3L17 A;  2KFK B;  2ZCC A;  1WXS A;  3AEC B;  4W9E A;  4K3C A;  4EEW A;  4LJO B;  1XO3 A;  1WX9 A;  3KWV A;  2WXN A;  3N9Y C;  4HPM B;  1QZE A;  3P1M A;  4OZC A;  2V3S A;  4ZRQ A;  3LJ3 A;  1N6Z A;  1EO6 A;  2DHZ A;  3W5V B;  2ZW1 A;  3BIN A;  4GGQ A;  3P4R B;  2Y5P A;  3ZLZ A;  2DYB A;  2K39 A;  4MGK E;  2JXX A;  2Z0D B;  5D6J B;  3MC9 A;  1YIW A;  4ARC A;  1WZ0 A;  1EU3 A;  1MG8 A;  4EE2 A;  4YSZ B;  1S3S G;  3BY4 B;  3AED B;  3AI5 A;  1ET9 A;  1FFU A;  2BGF A;  4W9J A;  3AB5 A;  3UGB B;  2LZ6 A;  5MPO A;  2JVC A;  3DWG C;  3ALB A;  1HA5 A;  3X0W A;  2LXC A;  4FJY A;  1ZW7 A;  1JRO A;  2K3U A;  2RDH A;  4ZYN A;  3U30 A;  1J0G A;  3KUC B;  3WA0 A;  1JAL A;  1SE3 A;  1WYW B;  4RF1 A;  5BMH A;  1V1O A;  2ZVN A;  3ML8 A;  2WXP A;  4GU2 A;  4FLH A;  4RGN A;  3TJP A;  4JX1 C;  1Z5S B;  1WJU A;  2JZZ A;  4NY0 A;  3VH4 B;  4C00 A;  3ZJU A;  2DNF A;  3DVN U;  3N30 A;  3ZKJ C;  5D94 A;  4RGT A;  4DBG A;  1R7S A;  4N9F 4;  3RNC C;  4K7W A;  2WXR A;  4DXF A;  1L5P A;  1VD2 A;  1ZUD 2;  1ZPS A;  3NHE B;  2IND C;  1RFK A;  2KFK A;  1NEN B;  3VAW A;  2MP2 B;  2MCN B;  1D4B A;  3HHM A;  1GC7 A;  3CIR B;  4HVB A;  2YEP F;  4M0W A;  2L0T A;  4YXD B;  4US9 A;  1B1Z A;  2BB6 A;  2CR5 A;  3PRP B;  3DOW A;  3RPF C;  3R66 C;  2LUM A;  2BB5 A;  4ANU A;  4L1B A;  4MSM B;  2ONQ A;  4NQL B;  3CMM B;  1P98 A;  2DEN B;  2W82 A;  3PVL A;  4IM0 A;  3X23 A;  4LNO A;  2C7M B;  4MGZ E;  1WGK A;  2WXG A;  1GAQ B;  1IP9 A;  2WU5 B;  5IN7 A;  4AJY B;  1YNT E;  2L52 A;  4N6E B;  3PGE A;  1R4N I;  2WXO A;  1C1Y B;  2LGS A;  1ISN A;  5EE3 A;  3KH0 A;  1N60 A;  1RAX A;  2OHF A;  4FAD A;  3VQI A;  4GDK B;  1H4R A;  3AE7 B;  3W2D A;  1E7V A;  1F0Z A;  2G4S A;  2JWZ A;  4M00 A;  4W9C A;  2A5U A;  1F2R C;  2J52 A;  1SJE D;  1AN8 A;  4FXC A;  1JWM D;  4CHK A;  3H6N A;  5G5G A;  2M8S A;  4GIV A;  1HQR D;  2IO3 B;  5FR6 A;  3ZNZ B;  1MPE A;  1L6U A;  3TL5 A;  4US8 A;  2JYT A;  1YJJ A;  1K51 A;  4G50 A;  1T0Q C;  4W9K A;  1WYG A;  1WMH A;  2WXF A;  3GOE A;  4PS3 A;  2WXJ A;  1LXD A;  2CKH B;  1ET6 A;  4GMV A;  3RNG C;  2HD5 B;  3AUL A;  1JWU D;  4WJQ A;  4WWP A;  4HK2 A;  1JML A;  1L6V A;  3HM6 X;  3UQA A;  2NPT A;  4RCO A;  2JPH A;  4E3C A;  3I5J C;  5AZH A;  1P7E A;  2V4L A;  2JXT A;  2MJ3 A;  4J6I A;  2EKI A;  2LVQ A;  3N1Z C;  4XX5 A;  3TEZ A;  3QHT A;  1OQY A;  2K8B A;  2O6V D;  1UNS A;  4HEA 1;  3W1S C;  4AQ7 A;  2BKR B;  1ZGU B;  5HFY A;  4B0E A;  2JT4 B;  5KHO A;  1XCT L;  4URK A;  3AEA B;  3BYY B;  4XZ4 A;  2UWQ A;  5C3J B;  1LM8 B;  5KHQ A;  1KFY B;  3B08 A;  1ZP0 B;  1RYJ A;  5IO9 A;  1C9F A;  5CHV C;  3ZGZ A;  2NVU I;  3EC8 A;  4MGI E;  1V86 A;  2GBM A;  2HJ1 A;  2XN9 C;  4X57 B;  2MWS B;  3VHT C;  1WM2 A;  3TEW A;  1TIF A;  2BF8 B;  1N5X A;  2R2Q A;  4RF0 A;  4W9L A;  2W54 A;  1HTO A;  3OAW A;  1OEY A;  1VDV A;  3I9V 1;  5D3D A;  5LXI B;  2JWU A;  4YWG G;  1SIJ A;  4EFO A;  3ECI A;  4NZL B;  1PUT A;  1RRB A;  1GG3 A;  4R3D A;  4GOC A;  3EFC A;  4RH6 A;  2N7D A;  3DHI C;  4NPN A;  2IY1 B;  1TTN A;  1QOF A;  1ZDX A;  1I4X A;  4K3B A;  4PYU A;  3BZD B;  1SJH D;  5JHB A;  4DHJ B;  3U7D A;  3Q3M C;  2J0K A;  4OVV A;  2WU2 B;  2FID A;  4TQ0 A;  4MSQ B;  4YTP B;  1I4G A;  3OG5 A;  3WIM A;  2R2O A;  3U7Z A;  3B9J A;  1E7U A;  3BWU D;  2NBW B;  4IM3 A;  2KDM A;  4JLC A;  2C7N B;  2GI9 A;  5T8I A;  3ZUN A;  3Q3F A;  3FIL B;  2LI5 A;  4K81 A;  4E71 A;  2K6Q A;  2O2V A;  4BZA A;  2BYF A;  3HVZ A;  3VUX A;  4W9H A;  3CST A;  1EM7 A;  2QMT A;  3BII D;  4GDL B;  1F9J A;  2KN4 A;  1NI2 A;  5IA7 A;  1EWC A;  2B3A A;  4ICV A;  1WR1 A;  4EUT A;  1UBI A;  3H9D A;  2M17 A;  4HPP A;  1P0R A;  2JF5 A;  3S2A A;  2K5P A;  4YSY B;  5GMV A;  3VUY A;  2MHJ A;  2IY0 B;  2WGS A;  2DBY A;  2YVC A;  5DPR A;  2KQS A;  2DZI A;  3ZJT A;  1IBX A;  1CZP A;  1TYG B;  2WXQ A;  4LLG M;  2KWV B;  3Q8C A;  4WH4 A;  3TEX A;  1WIA A;  1YQB A;  1Q5W B;  2BS4 B;  2DLB A;  2DAF A;  2OJW A;  2KC2 A;  2K0P A;  4CYE A;  1YJ1 A;  3RNB C;  2KTF A;  1UBQ A;  4NQK E;  4CO7 A;  1KTK A;  3QC8 B;  3ENE A;  2KTR B;  3QQ8 B;  2NS5 A;  4DHZ E;  2KAJ A;  4NJC A;  1WJ6 A;  4PK1 A;  1QOA A;  2ICI A;  3ABV B;  3VR9 B;  2KC1 A;  3ZTD A;  4JGH B;  2KDI A;  4B0M A;  1WR6 E;  2MRP A;  3T9L A;  2D11 A;  3AH7 A;  4DXA B;  5AEK B;  1T6B X;  1I4Q A;  5E6P A;  3A9K A;  1XT9 B;  1YX5 B;  2D3C A;  5TSS A;  1L0Y B;  2Z0E B;  2BS2 B;  4MM3 A;  1PDX A;  2WX1 A;  4RFB A;  1I35 A;  2LGY A;  3WAN A;  5FK9 C;  1IGD A;  3FIL A;  1AYF A;  1ROE A;  4XDC A;  1C3T A;  2FCS A;  2AL6 A;  2BW2 A;  1FCC C;  1FXT B;  4G0N B;  2DX5 B;  2J42 A;  4I6N B;  3P2B A;  2KWC A;  4F8C B;  2LMC A;  1JWA D;  2W3S A;  3APD A;  3ONS A;  3RMK C;  1N63 A;  4BKS D;  3L10 B;  4GDL A;  1WWT A;  3BVM A;  2KZR A;  1V1P A;  2E3T A;  3B2G A;  2QDF A;  4BKT A;  2L1A A;  2D3G A;  3SDL C;  2WXH A;  2N7J A;  2AL3 A;  3LXF A;  2EEL A;  3OJ3 A;  4J3O D;  4ZHO A;  4KKI A;  2VZK D;  4IM2 A;  3ZTC A;  3DBL I;  3VRB B;  1HE8 A;  2WDQ B;  2X8X X;  4LDT D;  3AEG B;  1VRA B;  4IW0 A;  1YD8 U;  2ON8 A;  2CHX A;  3ZVV A;  4HJK A;  3P4S B;  1SXT A;  2OOB B;  2DYM A;  3V05 A;  1FXI A;  2L00 B;  3NS1 A;  2LAS A;  3QAR A;  1JW9 D;  3SR6 A;  3WAO A;  3UF8 A;  1PQS A;  3Q8F A;  1EU4 A;  1V49 A;  2KFJ A;  2J0M A;  4FHK A;  4BBN C;  2V1Y A;  1MI0 A;  1K52 A;  3U52 E;  2FIF A;  1M94 A;  1NYR A;  2EMS A;  2LXA A;  4RMA A;  4W9D A;  4BBN F;  4KZ0 A;  3I57 A;  4KKJ A;  4ACF A;  1WE7 A;  5DPT A;  2W3R A;  1LQB A;  1GC6 A;  2KOX A;  3AEE B;  3NOB A;  2C7H A;  5BO4 B;  1GOZ A;  3QWZ B;  1OGW A;  5BMG A;  2KYW A;  2WXL A;  1A70 A;  1UGM A;  1EF1 A;  2DZJ A;  2IDY A;  4BVU C;  4RGM A;  2MJD A;  4HRO A;  1FM0 D;  2K8C A;  1TS5 A;  4OVU A;  2KMM A;  2NTS A;  1KJT A;  3PZD A;  1WY8 A;  3A4R A;  4II3 B;  2PJH A;  3WAL A;  1V6E A;  2HJ8 A;  1LGR A;  2KVR A;  5E6N A;  1OQR A;  2JY6 A;  1OEY J;  5IKC M;  1TBE A;  1MHH E;  2QCZ A;  1V81 A;  1MVK A;  1SIF A;  1E8W A;  1J7A A;  2LJI A;  2X38 A;  4KGT A;  2KDF B;  1I4P A;  4W9F A;  2SAK A;  2BYV E;  2DZK A;  4F7Z A;  2C60 A;  2XK5 B;  3BYT B;  5DPW A;  3VFK A;  4MJS A;  3MC8 A;  3EEC A;  2N0S B;  2VRR B;  2D2Q A;  5C2T B;  2WLB A;  3T3N A;  1XXG A;  1AW7 A;  2JU6 X;  3AE5 B;  1V5O A;  4A3P A;  2B76 B;  3AN1 A;  1WGY A;  4A90 A;  2YEP B;  1NI3 A;  2OED A;  4KSL C;  4REZ A;  3MJW A;  4JQW C;  2I1J A;  2FAZ A;  1QOG A;  3KYD D;  4WJP A;  1S1Q B;  5EE0 A;  1BT0 A;  1TY2 A;  1TJE A;  2WQY B;  3NVW A;  1GUA B;  2BS3 B;  3GB1 A;  2QC8 A;  1QLB B;  4P7I A;  3QX1 A;  3KQ4 A;  1CMX B;  2N9K A;  5JH5 C;  3JSV B;  3H7P A;  1V8C A;  2FUG 1;  3N20 C;  1Q0W B;  2VZK B;  2INC C;  1XD3 B;  4LDT B;  2K25 A;  1QF6 A;  1WH3 A;  3IBE A;  4D2K A;  3DHG C;  4WJN A;  3AV8 A;  2IZV B;  5DCN A;  3SHQ A;  1YX6 B;  4IWO A;  1KF6 B;  2LWP A;  2HDE A;  2JZP A;  4XYC A;  4OZA A;  2MW5 A;  3TIX A;  2J7Q B;  4P6V F;  2CS4 A;  1PGX A;  2JRH A;  3AEF B;  2Z8L A;  3A33 B;  4S0R A;  3E9S A;  2VH2 A;  2BQQ A;  3L13 A;  4IG7 B;  3SFE B;  4AUQ C;  2NMQ A;  2G4D B;  1X1M A;  2I2Y A;  1HZ6 A;  2WS3 B;  3DVG Y;  3DWM A;  2N9X A;  1J8C A;  2FUH B;  4WJO A;  1TT5 B;  2INN E;  1JWB D;  2KKC A;  3Q3J A;  3PTF C;  3P4P B;  3DBL B;  5BMI A;  3DBS A;  1Y8R C;  3E56 A;  2V3N A;  2KJR A;  4N59 A;  1NYQ A;  3IT6 B;  3IAS 1;  2PVG C;  1AAR A;  2L32 A;  3H7S A;  3TMP B;  1HZ5 A;  3EHV A;  4NAW B;  2Y3A A;  2RMM A;  1C79 A;  4L23 A;  2WX0 A;  5E6O A;  2MBE A;  1EUV B;  2KN5 A;  3U2S C;  3N3K B;  3NS8 A;  2VH1 A;  1E7P B;  2BT6 A;  2KK8 A;  3P4Q B;  4LK0 M;  1QIL A;  1Q10 A;  2MBQ A;  3WAP A;  1OTR B;  2MSE D;  5CHW A;  3CSF A;  2ASQ A;  4PT5 A;  3A9J B;  2L0F A;  2PMV A;  4HRS A;  4AWJ A;  4HJG E;  1HEZ E;  3M3J A;  4USA A;  1XQQ A;  1WSP A;  3AE6 B;  4TV3 A;  3A1Q B;  2MP2 A;  1WX7 A;  3NVZ A;  4MH8 A;  1VZ7 A;  2L8J A;  3PPA A;  2J0J A;  3T8M A;  4CQN A;  3PRM B;  1VZ8 A;  3VVW B;  2IBI B;  4HKZ E;  4LNK A;  3A4S C;  2KAN A;  4RGO S;  4IDI A;  1WXA A;  1IUE A;  3ZO5 B;  2LHD A;  4BOZ B;  3FKY A;  3EUB 2;  1FEH A;  4DXG A;  2IJ0 A;  2WP9 B;  2N1W A;  1E6E B;  4M02 A;  1TS3 A;  4FJV B;  1V9J A;  4I6P A;  3JYU A;  1E5W A;  3DVG X;  2ZCB A;  3P63 A;  2RDG A;  3QIJ A;  3TUO A;  3AE2 B;  3ZDM C;  4IWQ A;  5CX3 A;  4Q2J A;  3UI3 A;  2KVZ A;  3GZN B;  4EKU A;  4JIO U;  4LCD E;  2AYO B;  5AZG A;  2BVC A;  1XEE A;  1STE A;  4GDK A;  1V80 A;  2SEB D;  4OZB A;  4A9A A;  4A55 A;  4ARI A;  4NAW A;  5CHF A;  3RNF C;  4BAX A;  2KWD A;  1NDD A;  3NZU A;  3VRA B;  4G3X B;  1DOY A;  4TQ1 A;  1H8C A;  2RGF A;  1SGH A;  3O65 B;  4FHJ A;  2QSD A;  4TKN A;  5LXH A;  1R4M B;  2LJ5 A;  2DAJ A;  3HUI A;  3V6C B;  5J17 A;  4EZL A;  3W1Y A;  1T0S C;  3PHW B;  1YQ4 B;  4BKG A;  4WWO A;  3PLU A;  1P1A A;  5EE9 A;  1I4R A;  1IGC A;  3PO0 A;  1FNW A;  1WJN A;  3BK1 A;  1XF5 L;  1MG4 A;  2ZEQ A;  2FNJ B;  4JE3 B;  1UZX B;  2FE8 A;  3U8Z A;  5E6J A;  3BVZ A;  4GB9 A;  3H8H A;  3Q8A A;  4KIK B;  3R7R A;  1E8Z A;  2QEJ C;  2NR2 A;  4WAF A;  1JQ4 A;  4OVZ A;  2KQ4 X;  4AS1 A;  1YMH E;  4H2A A;  1BUI C;  1T3Q A;  2LGI A;  5BYS A;  3SD5 A;  1L7Y A;  3PZ7 A;  2GOW A;  2JSV X;  2LD9 A;  3KWL A;  5LLI A;  4K7S A;  2CU3 A;  1GJZ A;  1JWS D;  2PVO D;  3TBL D;  3TEY A;  3QJZ A;  5EE1 A;  4F1S A;  2GMI C;  1PGB A;  1K8R B;  3VTW A;  3ZRC A;  1K50 A;  1QOB A;  4WAA A;  1EWY C;  4KVG B;  3APC A;  3Q69 A;  1D5M C;  2QIE B;  2KJ6 A;  1U4A A;  4ZRI A;  5H8Y E;  2R61 A;  2XEW A;  4HLE A;  4N58 A;  2LHE A;  2ACZ B;  5FKA C;  4EZK A;  2QHO A;  1SB3 C;  3PRZ A;  4YT0 B;  1UGJ A;  3NRZ A;  4IKG A;  1TZ1 A;  3AE3 B;  4NNJ B;  2G45 B;  3PSE B;  3QAQ A;  1KLV A;  2CHW A;  3IT4 B;  3NY5 A;  3B2F A;  1SSN A;  2O6V B;  3R7Q A;  3UQB A;  1FMA D;  3DBR B;  2V4I B;  1FXA A;  3GE8 C;  4O1N A;  5IOI A;  4XC2 A;  4A20 A;  2DZM A;  1IYF A;  5CTR C;  4HXD A;  4TMA B;  4ZRK A;  4DDG D;  2MBH A;  1NVI D;  4G11 A;  2GBK A;  4P16 A;  1XLQ A;  2CJN A;  2LFI A;  2KLC A;  2N1V A;  2LVP A;  1FNV A;  4ANW A;  2W9N A;  3RUI B;  1FRD A;  3VTU A;  2N4F A;  5TR5 A;  2AQ3 B;  2IYD B;  2D07 B;  1KLG D;  3Q2A C;  2LUE A;  4IOI E;  2DYO A;  1TKY A;  1YN4 A;  2MLB A;  3GP7 A;  4KIK A;  2LRU A;  3EGR A;  4YTN B;  2CU1 A;  2EKE C;  4XDD A;  1YQ3 B;  2MBB B;  3RUL A;  3OWE B;  4TSS A;  1AWD A;  2H89 B;  2MX2 A;  4GSW A;  1RFA A;  1L2N A;  3RCZ A;  4WWN A;  1F2R I;  1PGA A;  2L3Z A;  2KQ7 A;  1WZ3 A;  2K22 A;  2MBO A;  1WGG A;  4MGY E;  4C7Y A;  1MFW A;  5G2N A;  3AE9 B;  2V3P A;  1L0V B;  2BKF A;  1SE4 A;  4JWS C;  1FCL A;  1KOT A;  1E8Y A;  3DBH B;  1CK1 A;  3V6E B;  3V62 A;  1M4V A;  4RM8 A;  4KDI C;  5HI1 A;  5AUI A;  2HE7 A;  2NTT A;  1PYW D;  5I4D A;  2PIA A;  3QK0 A;  1E9M A;  1F1H A;  1RWS A;  1WRI A;  4DQO C;  2PW9 A;  2IO2 B;  4C80 A;  3HM3 A;  1FPY A;  1C78 A;  1I4H A;  5JHA A;  1E10 A;  3KUZ A;  2IGD A;  1J7C A;  3ETR A;  3PZ8 A;  4HKQ A;  2KTR A;  2XBB C;  2KAC A;  5C1Z A;  1JCK B;  3DVN V;  3N1X C;  2O6V A;  1TZO A;  2PE9 A;  3PHX B;  4ZDV A;  4IWP A;  4B6W A;  4HCP B;  4JL9 A;  3CF6 E;  2PTL A;  1FIQ A;  1ZE3 D;  5HKH A;  2AQ1 B;  2D10 A;  3AM9 A;  1TGZ B;  4AOF A;  2WXI A;  5LNK 1;  1D5X C;  1ZOY B;  1L0X B;  1CJE A;  4XWT A;  3ZJV A;  2BYT A;  3ML9 A;  3WAM A;  2NCN A;  4KV2 A;  4LNI A;  5IAA C;  2WHI A;  2AX5 A;  4HDO A;  4WWM A;  4M0W B;  3RZF A;  3T3O A;  3RN9 C;  2BTE A;  5G55 A;  4MDK E;  3N1Y C;  4DHZ B;  1WGR A;  4MH0 E;  4QAY A;  2MJE A;  1SEB D;  2KX3 A;  2ZNV C;  4A6Q A;  3NZ3 A;  3SU8 X;  4P1B C;  3UIN B;  5H92 C;  3NG0 A;  2A4Z A;  2D3B A;  4K1R B;  3VTV A;  3GZN I;  2XNA C;  3NZS A;  1UWM A;  3Q14 C;  3VUW A;  3PT2 B;  2K1F A;  3DQV A;  1Z2M A;  2ZZP B;  2LGD A;  4PYZ A;  4A3O A;  1WJ4 A;  3AMZ A;  2Y5B B;  4IC7 B;  1ZXI A;  2FBW B;  4AP4 C;  4RM9 A;  4ZRP A;  3KW5 B;  2KMA A;  1TY0 A;  3L08 A;  3BK2 A;  3Q8E A;  1EF5 A;  2RD0 A;  2PLP A;  4S17 A;  1R4M I;  2D5G A;  2DWQ A;  2I38 A;  2RSU A;  3NVV A;  4EZJ A;  3ZNG C;  4A8X C;  3ZDT A;  2IGG A;  5HHD G;  1ESF A;  1LFD A;  4E74 A;  3LDZ E;  2D3A A;  2M4N A;  1WMH B;  1SE2 A;  3J9C A;  2FCM A;  2YLM A;  3DCG A;  2MH7 A;  1VJK A;  3K9P B;  1I42 A;  2RPV A;  4OW0 A;  1VZ6 A;  5J18 A;  1FD6 A;  3LB8 C;  3EFU A;  3FC4 A;  1WXQ A;  2Q5W D;  1ACC A;  2NPT B;  3AEB B;  3IFW B;  2KX0 A;  1V2Y A;  3C19 A;  1WRD B;  1WXV A;  3MFG A;  2KT7 A;  4I6L B;  4P1C C;  4NJ6 A;  4ITK A;  4ZRJ A;  2N9L A;  5FR3 A;  1C4P A;  1GB1 A;  2K8H A;  3P42 A;  3MTN B;  1WE6 A;  4WIP A;  5BYQ A;  1HTQ A;  2N9E B;  3Q6B A;  3Q3O C;  1UD7 A;  1YN3 A;  3C8Y A;  4BOS C;  1P9D U;  2XK5 A;  4KGR A;  4DHJ D;  3TCA A;  2IGH A;  3SFD B;  3DHH C;  2K9X A;  2PKO A;  2W55 A;  5G5H A;  1UUP A;  1F77 A;  2KWU B;  1V97 A;  4WUR A;  4WQO B;  4ASW C;  2TSS A;  2L83 A;  3AU4 A;  3RT3 B;  3ZYY X;  1E90 A;  1BML C;  4L2Y A;  3ZNI D;  1YJI A;  2JYE A;  3BVG A;  3OJ4 B;  4NJ7 A;  1N5W A;  4C4V B;  2V0G A;  1F52 A;  3PLV A;  3UIP B;  1Q1O A;  5JXV A;  1XCQ L;  5DPS A;  2GRI A;  2WXM A;  1T0R C;  4KDL B;  3OLM D;  4XGA B;  4BKS A;  3DBR I;  2GBR A;  3V60 A;  2ZPY A;  1TS2 A;  2BWE S;  1GNU A;  3APF A;  3VDZ A;  3MP9 A;  1UH6 A;  3JSV A;  2C9W B;  5L95 C;  4K7U A;  3M62 B;  1Y56 A;  3RI7 C;  1WM3 A;  3C0R B;  2RDB C;  2LGX A;  2PE6 B;  2ZW0 A;  3KLS X;  1SBB B;  4ZOH C;  3HIZ A;  2N7E A;  3MC0 B;  2CHZ A;  3KUD B;  3K9O B;  3PV1 A;  1UWX A;  2MEK A;  2M0A A;  3RZW C;  1D3Z A;  1MJD A;  2ZJD A;  3IG3 A;  3RD2 A;  1KH0 A;  2N9P C;  3RNE C;  2LRW A;  2G3Q B;  3VXW A;  3W9C B;  1CQV A;  3JVZ X;  2L05 A;  2O2V B;  1RM6 C;  5BYR A;  1WGD A;  4DWF A;  3KYC D;  4YL8 A;  2MQJ A;  4LTU A;  1C77 A;  4B95 A;  1UEL A;  2G9H D;  3HK0 A;  1QT9 A;  2RR9 A;  3N32 A;  4HPL B;  1YOV B;  3DBH I;  2CJO A;  4GN1 A;  3GE3 C;  1XLN A;  1TKE A;  4M8M A;  3M95 A;  4XE0 A;  4KX6 B;  1IBX B;  1WFY A;  1WXM A;  2WWZ A;  4LJP B;  4AJW A;  3QCA A;  3MJ5 A;  1WX8 A;  2C5L C;  2JQR B;  1J7B A;  2JX5 A;  4C4V A;  3MHZ A;  2LVO A;  2KHW B;  2UU7 A;  1YN5 A;  2KNB A;  3ZXR A;  2IPK D;  3U4E G;  3Q8B A;  3ZIM A;  1TKG A;  2FCN A;  2V9H A;  2OJR A;  3B0A A;  3A9J A;  1QQR A;  3B1L X;  3IAM 1;  3RYT A;  3ZXV A;  1G6J A;  3KVF B;  4MT5 A;  2NBU A;  1DOX A;  4ANV A;  3IXS A;  2KMC A;  4B9K A;  4DK5 A;  3A1Q A;  2KLG A;  1WI0 A;  4ICU A;  3WCQ A;  3W1S A;  4NAM A;  3ZRF A;  1IPG A;  2M1M A;  3A9K B;  2GLS A;  3JW0 X;  4FJZ A;  3L0W B;  3D32 A;  3PS6 A;  1D5Z C;  2IO0 B;  1C4A A;  1PFD A;  4IUM B;  1DOI A;  3AXC A;  4MM3 B;  5EDS A;  2Z59 B;  5JZE B;  4GXB A;  1C4C A;  4JWU C;  1FO4 A;  2REX A;  1ZDV A;  1HXY D;  3UIO B;  3NVY A;  1JRU A;  3M63 B;  3AU5 A;  2UYZ B;  4JPS A;  1E8X A;  3MHS D;  1RLF A;  2KD0 A;  3W5U B;  4PS8 A;  3HRD D;  2GBN A;  1A5R A;  4FN2 A; 
#chains in the Genus database with same CATH homology
 1I4H A;  1TY2 A;  1TJE A;  1E10 A;  1C76 A;  2WQY B;  2IGD A;  3NVW A;  2BS3 B;  4RCO A;  3GB1 A;  1J7C A;  1QLB B;  3ETR A;  3PZ8 A;  4HKQ A;  3KQ4 A;  1V1P B;  2N9K A;  4RNA A;  2KAC A;  1JCK B;  1V8C A;  1P7E A;  2WXK A;  2FUG 1;  2JXT A;  1JRP A;  2VZK B;  2MJ3 A;  1L4Z B;  4ZHP A;  2M56 B;  1TZO A;  2EKI A;  1B9R A;  3CWI A;  3TEZ A;  2HTM E;  1QF6 A;  1VR9 A;  4XWW A;  2PTL A;  1UNS A;  1FIQ A;  1ZE3 D;  1P7F A;  2AQ1 B;  4HEA 1;  4D2K A;  4AQ7 A;  3AM9 A;  1ENF A;  1I7H A;  2WDV B;  3AV8 A;  5HFY A;  2G1E A;  4B0E A;  2AQ2 B;  1XCT L;  5D3I B;  4OHJ A;  1KF6 B;  3AEA B;  3BYY B;  1FRR A;  2HDE A;  2JZP A;  2WXI A;  3AE4 B;  3R2T A;  5C3J B;  4OZA A;  5LNK 1;  1KFY B;  3LYY A;  1D5X C;  1D6E C;  1ZOY B;  1L0X B;  1CJE A;  2BBC A;  4P6V F;  4XWT A;  1ZP0 B;  1RYJ A;  1L4D B;  1C9F A;  3ZJV A;  1PGX A;  4C56 C;  3ZGZ A;  3AEF B;  2BYT A;  2Z8L A;  3E9S A;  3SFE B;  2NMQ A;  2XN9 C;  3EA6 A;  2I2Y A;  1DGJ A;  1VLB A;  3TSS A;  1T5X D;  4MAC A;  1HZ6 A;  2AX5 A;  2WS3 B;  3TEW A;  3DWM A;  1N5X A;  2LEK A;  4WWM A;  2J4X A;  4KGS A;  4RF0 A;  2W54 A;  3T3O A;  2INN E;  2BTE A;  1JWB D;  1SF0 A;  1VDV A;  3P4P B;  3I9V 1;  5D3D A;  5BMI A;  2H88 B;  2JWU A;  1SEB D;  2MJE A;  3R8B A;  1GPX A;  4YWG G;  4A6Q A;  3E56 A;  1SIJ A;  3NZ3 A;  2V3N A;  4NZL B;  1PUT A;  4N59 A;  1NYQ A;  4R3D A;  3IT6 B;  3IAS 1;  2PVG C;  4RH6 A;  2L32 A;  3AE8 B;  1ZDX A;  1QOF A;  1I4X A;  5H92 C;  1K53 A;  1HZ5 A;  1SJH D;  3BZD B;  2Y3A A;  4NAW B;  2RMM A;  5AUK A;  2Y5C A;  1C79 A;  4L23 A;  3L4P A;  3URY A;  2WU2 B;  1XLP A;  4TQ0 A;  2XNA C;  1N62 A;  3U2S C;  4YTP B;  3FAH A;  5HG2 A;  1E7P B;  1I4G A;  1UWM A;  2BT6 A;  3P4Q B;  4LK0 M;  3U7Z A;  3B9J A;  1QIL A;  1Q10 A;  4UDU C;  3R2I A;  3BWU D;  2QIL A;  3AMZ A;  2KDM A;  4PT5 A;  2PMV A;  1ZXI A;  4HRS A;  2E6X A;  2FBW B;  4HJG E;  2GI9 A;  1HEZ E;  5T8I A;  4ZRP A;  4USA A;  3FIL B;  1TY0 A;  1WSP A;  4C7Z A;  5D7G A;  3BK2 A;  3Q8E A;  3AE6 B;  2PLP A;  1GB4 A;  2QJL A;  2WNM A;  3HVZ A;  2D5G A;  3NVZ A;  4MH8 A;  1VZ7 A;  4WQM A;  2DWQ A;  3NUH B;  2I38 A;  3NVV A;  1EM7 A;  2QMT A;  3BII D;  4GDL B;  3RFZ B;  4CQN A;  2KN4 A;  1OQQ A;  3GS2 A;  4A8X C;  1VZ8 A;  1EWC A;  4HKZ E;  1XLO A;  4RGO S;  1LO5 D;  4IDI A;  2IGG A;  5HHD G;  1ESF A;  1IUE A;  2M19 A;  4YTM B;  1E0Z A;  3AE1 B;  2K5P A;  4YSY B;  2LHD A;  1MHX A;  1BXT A;  1SE2 A;  2DBY A;  3EUB 2;  1FEH A;  4DXG A;  3J9C A;  1N61 A;  2IJ0 A;  2WP9 B;  2J53 A;  1IBX A;  3ZJT A;  1KLU D;  2MH7 A;  1CZP A;  1E6E B;  1VJK A;  1TYG B;  1TS3 A;  3ZQ4 A;  4YSX B;  2WXQ A;  3P63 A;  1TS4 A;  2INP E;  2RDG A;  4LLG M;  3TUO A;  1FNU A;  3Q8C A;  1FFV A;  2RPV A;  1VZ6 A;  4OW0 A;  3AE2 B;  1FD6 A;  1OFF A;  4WH4 A;  3LB8 C;  3TEX A;  4ZYS A;  5GXG B;  3FC4 A;  4Q2J A;  1WXQ A;  3UI3 A;  2BS4 B;  2DLB A;  1NEK B;  4GLS C;  2Q5W D;  3O13 A;  1ACC A;  3AEB B;  2WDR B;  2K0P A;  1DYQ A;  2GB1 A;  3HVD A;  3V3X A;  3MFG A;  1KTK A;  3SEB A;  3VR8 B;  1ZXH A;  4ITK A;  1XEE A;  1STE A;  2N9L A;  5FR3 A;  1C4P A;  1KRH A;  2KAJ A;  4NJC A;  1GB1 A;  3AEC B;  3P42 A;  1QOA A;  2ICI A;  3ABV B;  2SEB D;  3VR9 B;  4OZB A;  4A9A A;  1XO3 A;  3KWV A;  4B0M A;  4WIP A;  5BYQ A;  4A55 A;  3AH7 A;  2WXN A;  4ARI A;  1T6B X;  3N9Y C;  3P1M A;  1I4Q A;  4OZC A;  2KWD A;  4ZRQ A;  3VRA B;  1YN3 A;  3C8Y A;  4TQ1 A;  1DOY A;  4KGR A;  3W5V B;  2ZW1 A;  2QSD A;  3P4R B;  5TSS A;  1L0Y B;  2Y5P A;  2IGH A;  3SFD B;  2K9X A;  2BS2 B;  2PKO A;  2W55 A;  5G5H A;  1UUP A;  3HUI A;  1F77 A;  1PDX A;  4ARC A;  1V97 A;  4WUR A;  4RFB A;  1YQ4 B;  1EU3 A;  2TSS A;  2L83 A;  3ZYY X;  4EE2 A;  1BML C;  5FK9 C;  1IGD A;  3FIL A;  4L2Y A;  4YSZ B;  1AYF A;  1ROE A;  4XDC A;  3AED B;  1YJI A;  2JYE A;  3BVG A;  5EE9 A;  1N5W A;  2BW2 A;  1ET9 A;  1FCC C;  1I4R A;  2V0G A;  1IGC A;  1FFU A;  5JXV A;  3AB5 A;  1XCQ L;  5MPO A;  3PO0 A;  3DWG C;  2J42 A;  2GRI A;  2WXM A;  1FNW A;  1HA5 A;  3BK1 A;  1XF5 L;  2LMC A;  1TS2 A;  1JWA D;  2W3S A;  4JE3 B;  1N63 A;  1JRO A;  2FE8 A;  1WWT A;  3BVM A;  2K3U A;  5E6J A;  1V1P A;  2RDH A;  3BVZ A;  3MP9 A;  3H8H A;  3Q8A A;  2QEJ C;  1JAL A;  2E3T A;  3B2G A;  4WAF A;  1JQ4 A;  4OVZ A;  2L1A A;  1SE3 A;  4RF1 A;  2KQ4 X;  5BMH A;  1Y56 A;  2WXH A;  4AS1 A;  1V1O A;  1YMH E;  4H2A A;  1BUI C;  2N7J A;  2WXP A;  1T3Q A;  2LGI A;  5BYS A;  3LXF A;  2EEL A;  3PZ7 A;  4RGN A;  4J3O D;  4JX1 C;  4KKI A;  2JSV X;  4ZHO A;  2VZK D;  3KWL A;  2CU3 A;  3VRB B;  2ZW0 A;  3KLS X;  1JWS D;  1SBB B;  2WDQ B;  3AEG B;  1VRA B;  4ZOH C;  2PVO D;  3MC0 B;  3TEY A;  5EE1 A;  1UWX A;  2MEK A;  2ON8 A;  3ZJU A;  2M0A A;  1PGB A;  4RGT A;  3P4S B;  1KH0 A;  1R7S A;  1K50 A;  1QOB A;  1SXT A;  2DYM A;  3V05 A;  1FXI A;  1EWY C;  3NS1 A;  2WXR A;  3Q69 A;  1D5M C;  3W9C B;  2QIE B;  1CQV A;  1JW9 D;  1L5P A;  3SR6 A;  4DXF A;  1RM6 C;  3Q8F A;  1ZUD 2;  1EU4 A;  5BYR A;  1ZPS A;  5H8Y E;  2R61 A;  4N58 A;  2LHE A;  1MI0 A;  1RFK A;  1K52 A;  1NEN B;  2ACZ B;  5FKA C;  3U52 E;  1NYR A;  1SB3 C;  1C77 A;  4LTU A;  1D4B A;  2G9H D;  3I57 A;  3CIR B;  4KKJ A;  4YT0 B;  2YEP F;  4M0W A;  1UGJ A;  3NRZ A;  4YXD B;  2W3R A;  4US9 A;  1QT9 A;  4IKG A;  1B1Z A;  2BB6 A;  3AEE B;  3AE3 B;  3RPF C;  2CJO A;  1GOZ A;  3IT4 B;  3B2F A;  2LUM A;  2BB5 A;  1SSN A;  1XLN A;  4L1B A;  5BMG A;  1TKE A;  1FMA D;  2WXL A;  2V4I B;  2ONQ A;  1A70 A;  1FXA A;  4O1N A;  2IDY A;  4RGM A;  2MJD A;  4XE0 A;  4KX6 B;  2W82 A;  1IBX B;  4TMA B;  4HRO A;  1FM0 D;  1TS5 A;  1NVI D;  2KMM A;  3MJ5 A;  2NTS A;  1WGK A;  4P16 A;  2WXG A;  1GAQ B;  2JQR B;  1J7B A;  1XLQ A;  2WU5 B;  2JX5 A;  2CJN A;  2LFI A;  3MHZ A;  1YNT E;  1YN5 A;  2L52 A;  4N6E B;  2IPK D;  1FNV A;  3U4E G;  2WXO A;  3Q8B A;  1TKG A;  1OQR A;  5EE3 A;  1FRD A;  1QQR A;  1N60 A;  2OHF A;  3VQI A;  3IAM 1;  4GDK B;  1MHH E;  2AQ3 B;  3AE7 B;  1MVK A;  4MT5 A;  3W2D A;  1KLG D;  2LJI A;  1J7A A;  2X38 A;  4IOI E;  4KGT A;  2DYO A;  1TKY A;  1DOX A;  1YN4 A;  3GP7 A;  1F0Z A;  3IXS A;  1I4P A;  3EGR A;  4YTN B;  2SAK A;  1F2R C;  4XDD A;  2J52 A;  1YQ3 B;  3WCQ A;  3W1S A;  1SJE D;  4NAM A;  1AN8 A;  4FXC A;  1JWM D;  3OWE B;  4TSS A;  1AWD A;  5G5G A;  2H89 B;  1HQR D;  1D5Z C;  3BYT B;  1MPE A;  1L6U A;  1C4A A;  2N0S B;  4US8 A;  1PFD A;  2JYT A;  1DOI A;  1F2R I;  1PGA A;  5C2T B;  4MM3 B;  2WLB A;  3T3N A;  1YJJ A;  1XXG A;  2K22 A;  1AW7 A;  1C4C A;  1K51 A;  4JWU C;  1FO4 A;  2JU6 X;  1ZDV A;  4C7Y A;  1WYG A;  3AE5 B;  2V3P A;  3AE9 B;  1L0V B;  2WXF A;  1HXY D;  1SE4 A;  2WXJ A;  3NVY A;  4JWS C;  1FCL A;  2B76 B;  3AN1 A;  4A90 A;  2YEP B;  1NI3 A;  1CK1 A;  2OED A;  4JPS A;  1M4V A;  4REZ A;  1ET6 A;  5HI1 A;  5AUI A;  1QOG A;  1JWU D;  2NTT A;  1PYW D;  5I4D A;  2PIA A;  3W5U B;  3HRD D;  1E9M A;  1JML A;  5EE0 A;  1RWS A;  1WRI A;  4DQO C;  2PW9 A;  1L6V A;  4C80 A;  1C78 A;  1QKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...