5AUIA

Crystal structure of ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
96
Chain Sequence
ATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQSDQSFLDDDQIEKGFVLTCVAYPRSDKILTNQEEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Thermosynechococcus elongatus (strain bp-1)
molecule tags Electron transport
molecule keywords Ferredoxin-1
total genus 26
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5auiA00
3W5UB 4C80A 2WDRB 1ZXIA 3HVZA 4KX6B 4N59A 1DGJA 1FFUA 1FIQA 1QOFA 1E10A 2K22A 5GXGB 1ROEA 1VDVA 3AE1B 1WXQA 1OFFA 4USAA 1F0ZA 2FBWB 1N5XA 1XLQA 2W3SA 3NVVA 1FXIA 3SFDB 1L5PA 1RYJA 3W9CB 1B9RA 1QLBB 2WQYB 3HUIA 4ZHOA 3P4SB 3NVZA 1VLBA 2DBYA 1N62A 3NS1A 3AEDB 3NVWA 3AEBB 3AE6B 2W3RA 3RPFC 2BS2B 3AB5A 1ZOYB 3AE2B 3W5VB 1SB3C 1FMAD 1TYGB 1TKYA 4YXDB 5EE0A 1PUTA 2KAJA 2MJEA 3AECB 1XLOA 4YTNB 1DOXA 5EE1A 4LTUA 5EE3A 1N5WA 2W55A 5H8YE 5C3JB 1NYQA 1IUEA 2MJ3A 4WQMA 1XO3A 5C2TB 2PIAA 2L52A 1KFYB 1WRIA 2K5PA 2PKOA 2EKIA 3AV8A 1JROA 4C7YA 1KRHA 1T3QA 3B2GA 1RM6C 2PVOD 3AEFB 2PVGC 1E7PB 2WS3B 2QJLA 3HRDD 1J7CA 1KF6B 3B9JA 1ZUD2 3P4PB 1E0ZA 2DWQA 3VRAB 5MPOA 3AE4B 2WDQB 5AUIA 1L6VA 1JWAD 2M19A 1V8CA 1NEKB 3P63A 3PO0A 4YSXB 3ABVB 3SFEB 1OQRA 3AE8B 3AMZA 4P6VF 1SF0A 2CJOA 3VR8B 4ZHPA 3BIID 2JQRB 1PFDA 2CJNA 3LB8C 1N63A 2ACZB 2M56B 4YT0B 1E9MA 1RWSA 1XLPA 3P4RB 3ZYYX 1NENB 2LEKA 3KWLA 1FRRA 1UWMA 2L83A 1FXAA 1DOYA 5H92C 1GPXA 1ZP0B 1NVID 3AEEB 3ETRA 1GAQB 2N0SB 2E3TA 2B76B 1FM0D 3CWIA 3FC4A 3FAHA 1FO4A 1CJEA 3AE9B 1L6UA 3SR6A 1JQ4A 4ZOHC 4FXCA 1WYGA 2AX5A 1JRPA 2MH7A 2HTME 3P4QB 1A70A 2WU5B 2Y5CA 1PDXA 4HROA 3NVYA 2W54A 1OQQA 2H89B 4JWUC 4YTPB 3B2FA 2CU3A 2JX5A 4US8A 2MJDA 4ITKA 3WCQA 2G1EA 3AM9A 1XLNA 4N58A 5G5HA 1VJKA 1I7HA 1NI3A 1JALA 1QOBA 1NYRA 2BT6A 2WP9B 3AEGB 3CIRB 1YQ4B 1YJIA 3AE3B 1E6EB 3EUB2 4WWMA 4YTMB 1YQ3B 3AEAB 2OHFA 3DWMA 1TKGA 1DOIA 5AUKA 1N61A 1JW9D 1R7SA 5EE9A 1AWDA 4YSZB 1EWYC 1CZPA 1JWBD 4N6EB 2QIEB 4JWSC 4YSYB 3AH7A 3P1MA 1J7AA 2WU2B 2Q5WD 2H88B 3AN1A 1YJJA 1J7BA 1L0VB 5G5GA 1V97A 3VRBB 2KMMA 4A9AA 2BS4B 1QF6A 3AE7B 3NRZA 2BS3B 1QT9A 1TKEA 1TJEA 1QOGA 1WGKA 1WWTA 4HRSA 3AE5B 1FFVA 1QOAA 4JX1C 1RFKA 4US9A 3VR9B 1N60A 4IDIA 4C7ZA 1SIJA 2K9XA 1AYFA 2WDVB 2WLBA 3LXFA 3L4PA 1FRDA 3DWGC
chains in the Genus database with same CATH superfamily
4HVBA 1ZXIA 3HVZA 1QOFA 3ZTCA 3AE1B 1F0ZA 4USAA 1N5XA 2BYVE 1L5PA 3ZIMA 1WGRA 3Q3JA 4GB9A 4W9JA 1WJUA 1NI2A 3PRPB 3Q8EA 4YXDB 2J52A 3AECB 2BVCA 4A55A 1HTQA 2W55A 3ZKJC 4AWJA 2BW2A 5IAAC 3ZNGC 1V1PB 2JXTA 1UH6A 3PHWB 2NR2A 3VTUA 3IXSA 1XCTL 4II2B 2LWPA 3VUWA 3Q14C 1GOZA 2KN5A 1JWMD 1E7VA 2D10A 4ZYNA 1KLGD 2KKCA 3PZ7A 1OQRA 1P7FA 1BMLC 4HWIB 3U52E 1BXTA 4OW0A 2LEKA 2KJRA 2WGSA 3MJ5A 2L83A 3BVGA 1UBIA 3RNGC 4W9LA 4TQ1A 4GDKB 4FXCA 3VTWA 1ZDXA 3WAOA 5E6PA 3L16A 2JVCA 5CTRC 5G55A 3AEGB 3I3TB 1E6EB 2NVUI 1FCLA 2D3AA 2KVZA 3UQAA 5EE9A 4YSZB 1L4ZB 3AH7A 3CMMB 3VRBB 3I57A 2Z8LA 2PE9A 1WGKA 2O6VB 4F8CB 4C7ZA 1SIJA 3L0WB 1FRDA 2NBWB 4OVVA 2DENB 3ZDMC 4E71A 1WXQA 1PGXA 4ARIA 3NVVA 1V5OA 1XLQA 1DYQA 4B6WA 1PGAA 3NS1A 2KC2A 4DHZE 2ZCCA 5JZEB 4LJOB 3AE2B 4GDLB 1SB3C 2FE8A 1Q5WB 2L1AA 2N4FA 4TMAB 2MQJA 1N5WA 4ANXA 4LNKA 2ZPNA 1WXVA 2INPE 2ZVOA 3ZRFA 1RFAA 2M4NA 2K8HA 1VZ6A 4BBNC 4L23A 2JPHA 3SEBA 2OJWA 2RDBC 3V61A 3I63C 3TEYA 2KOXA 4OHJA 3AV8A 1GUAB 2QJLA 2M1MA 3ECIA 1ZUD2 4GDLA 3JSVB 2M19A 2NBVB 4A20A 1IP9A 2ZVNA 4LNOA 1HQRD 1FNVA 2G4SA 4WJPA 2V3NA 3P4RB 3Q8CA 1Q1OA 2FUHB 2N1VA 4NQKE 3SDLC 2N9PC 3AEEB 1GAQB 4W9FA 2C9WB 3FAHA 2RR9A 3DBHI 3M95A 2V4LA 1A70A 4J3OD 1D4BA 3GZNB 3M62B 4XDDA 4B95A 4IKGA 5G2NA 1JALA 2BT6A 2KFKB 4REZA 3PHXB 2KQ7A 1AWDA 1ET6A 1LXDA 3A9JA 4HK2A 2PPHA 1I35A 3WANA 1MG8A 2KMMA 3Q3MC 1I4QA 1WH3A 4FA6A 2R61A 4MGKE 3PZ8A 3ZW3A 5DPWA 4MJSB 2V3PA 4WJQA 2KMCA 4W9EA 4KDIC 3L13A 2BS2B 5JXVA 2MP2B 4LTUA 5C3JB 2L0TA 2IO0B 1T5XD 4K7WA 4RGNA 2DAJA 2ZPYA 2FCQA 4FADA 3ZNID 5T8IA 3KYDD 2WXRA 2DYBA 1E0ZA 2WDQB 1NEKB 1LGRA 4YSXB 1E5WA 1FNUA 3LB8C 1STEA 3IBEA 1FRRA 3RNAC 2MLBA 4NNJB 4JLCA 1D5XC 2ZZPB 1WGDA 1C1YB 3AU5A 3RULA 4LDTB 2UYZB 1VZ7A 2CHXA 1OQQA 4CYEA 2XK5B 3VH3B 3HIZA 1C3TA 1VJKA 5GXGB 1WE6A 4WWMA 2KWDA 2LASA 3R3MA 5AUKA 3I5JC 1EUVB 4HDQA 2BYFA 2LRUA 1CZPA 3KVFB 3U7DA 2NMQA 2Q5WD 3W1YA 2BS3B 2KACA 2LZ6A 2M0XA 1KTKA 2FCMA 1P9DU 3LYYA 3BWUD 2OJRA 4YWGG 3ZVVA 5L95C 1OFFA 1V5TA 2VH1A 1WX9A 3HUIA 3D32A 3EA6A 4KIKA 4A6QA 1ZOYB 3OWEB 4WJOA 4OVUA 4GN1A 3AU4A 5J18A 2IPKD 5EE3A 5FR3A 3VAWA 1WRDB 5D2MB 1VR9A 3VDZA 1XO3A 2N9EB 4NPNA 3V05A 1EM7A 4WWNA 4C7YA 2MA9B 1SE2A 3EHVA 4NAWB 1YX5B 2KO3A 3RYTA 3B9JA 3P4PB 1FNWA 4C4VA 3VQIA 3ABVB 4P6VF 3NS8A 3RT3B 3MHZA 5H92C 1GPXA 2KWVB 4KSLC 4NAMA 1GG3A 3QC8B 2CU3A 4AJWA 3QA8A 4K7UA 4WQOB 2JXXA 4J6IA 3KW5B 4I6PA 4BVUC 3A1QB 2WXMA 4N6EB 2MBEA 4K1RB 2BB6A 2KDEB 1L0VB 3DBRB 3JVZX 4KGSA 5HI1A 1PYWD 4BKSD 1QOGA 4US9A 1F2RI 1TGZB 5KHQA 4MT5A 4LK0M 4AOFA 2QDFA 4HJKA 2LUMA 3KUCB 3W5UB 2WXJA 3WIMA 1YIWA 3UGBB 2K22A 2W3SA 2WXHA 4II3B 4I6NB 1SGHA 4ZRJA 3RZFA 2IYDB 3RPFC 1WR6E 4AJYB 4HCNB 4EKUA 1UELA 1R4NB 4L1BA 2QMTA 4FHJA 2JWZA 5E6JA 1JWUD 1TS5A 3PLUA 4ARCA 5AZFA 4KKJA 2KTRA 3P42A 1R4MB 2PIAA 4RGTA 2L52A 2MEKA 2WNMA 2LHEA 2INNE 3ENEA 5DCNA 3AXCA 1WXMA 2J0JA 4M01A 3B2GA 2J0KA 2RSUA 1J7CA 1KF6B 4KSKC 2SEBD 1Z5SB 4KZ0A 5AUIA 4W9IA 3P63A 2KX3A 2K39A 2KWUB 2KTFA 3AMZA 2LVQA 1SF0A 4MSQB 4WWPA 3VR8B 4ZHPA 2JQRB 2CJNA 1XCQL 3TBLD 1BT0A 1PQSA 2MSED 3PRZA 4DXGA 2B76B 3QK0A 1KJTA 1FO4A 4A3OA 2QEJC 5AZHA 2M8SA 3U2SC 2AX5A 3T9LA 4KDLB 3NVYA 3NZ3A 5HKHA 2MWSB 2MBQA 4IUMB 3TMPB 1F77A 3UIOB 4MGYE 1YJIA 1YQ3B 2IGHA 2IO2B 1SIFA 3DBLB 1LO5D 4YSYB 4AS1A 4DBGA 4RCOA 4DDID 3PVLA 4P16A 3A4SC 1KOTA 3AE5B 4EZLA 3KUDB 5CX3A 4AQ7A 3DWGC 5TR5A 3PZDA 5CHVC 1VDVA 3QHTA 4C00A 1FXIA 3TEWA 1SJHD 2RPQA 3VFKA 1WY8A 4C4VB 3AE6B 2KT7A 2L0FA 4LCDE 4W9CA 3TCAA 4ASWC 3W5VB 3HHMA 2JYTA 4MJSA 3C19A 2KAJA 4S17A 3QARA 1E8WA 1L7YA 3L10B 5H8YE 3IAM1 4PT5A 5LXIB 2LXAA 2XBBC 1KLUD 4A3PA 3MC9A 2BYEA 2UU7A 4TKNA 2CHWA 2LVOA 2DWQA 1GC6A 3Q6BA 4PYUA 5DPRA 1ET9A 2BGFA 4GLSC 1E7UA 2WHIA 2CJOA 2KFJA 2WXGA 1UGJA 1PFDA 2BWFA 5LLIA 1UWMA 5IKCM 2N9KA 4W9HA 4LJPB 2ZCBA 3ZUNA 2KWCA 2KHWB 3SHQA 2TSSA 2KDFB 2O2VB 2OOBB 1P1AA 2FIDA 2H89B 2J42A 5E6OA 3IT4B 1WM2A 1NI3A 3ZQ4A 3ZRCA 2ZW0A 1DOIA 1WZ3A 4P1BC 3Q8BA 3T8MA 1XD3B 3RZWC 4DQOC 4N9F4 5G5GA 2I1KA 1V97A 3W2DA 1OGWA 3N32A 1TJEA 4IDIA 3LXFA 4RM9A 3DVNU 1EO6A 2WXFA 2R2QA 3J9CA 4NJ7A 4F7ZA 1E10A 4OVZA 2GBRA 3BYYB 1G6JA 3NUHB 2FBWB 4PS3A 1D3ZA 4TUUA 2DZKA 1WJ4A 5HG2A 2IGDA 5CHWA 3N3KB 2PEAA 3KYCD 5EE0A 4FJVB 1P0RA 3W1SC 3QJZA 4M8NA 2AQ1B 2C60A 3ALBA 1OEYJ 3ZNHB 2WXIA 4M0WA 3DHHC 1P3QU 4ZRIA 3UIPB 1HE8A 2BKRB 1E7PB 2QHOA 2ZNVC 3HRDD 2L7RA 1GB4A 4MH8A 3VVWB 2DZJA 4FHKA 3EFCA 4KIKB 4NQLB 4KKIA 3ZJVA 5BYQA 3GZNI 1JMLA 3ZTDA 4H2AA 2E3TA 1YJ1A 1XF5L 4HROA 2HTME 2LGYA 4IWQA 4TQ0A 3C0RB 4YTPB 4ZYSA 3AM9A 4MSMB 1XLNA 1HZ6A 2JT4B 2V9HA 2BQQA 2HJ1A 1YOVB 3PV1A 3SR6A 1UZXB 3BVMA 3PLVA 4DK5A 2IO1B 1TS3A 2D11A 3NRZA 3A1QA 3K9PB 1WWTA 4HRSA 4ANWA 3TIXA 2N9XA 3R7RA 3WAMA 2YEPF 3FKYA 3DBHB 2WXNA 4RF1A 2KLCA 1YD8U 1YNTE 2RMMA 2NCNA 2DLBA 2KFKA 1N62A 2JRIB 4GGQA 3NVWA 4DXFA 1T6BX 2DYOA 3H7PB 3I9V1 1WJNA 2WDTB 2KK8A 2V0GA 4KGRA 3IHPC 5EE1A 4M8MA 1K8RB 1V49A 2MJ3A 4TSSA 1P98A 4W9DA 1MFWA 2PKOA 1AARA 3CSTA 1Q0WB 3HM6X 1C78A 1KRHA 2Y5BB 3RN9C 2ZJDA 2V3SA 2HD5B 1UGMA 2INDC 2J4XA 3VH4B 4IWPA 4EE2A 2LFIA 2NPTB 3N1ZC 3KWLA 2KC1A 2JRHA 2GOWA 2GRIA 1MHHE 2NTTA 3N20C 3GE8C 2HE7A 5IO9A 2MH7A 3P4QB 1P7EA 3GS2A 2KVRA 4WWOA 1WXSA 1QKZA 2N7DA 1MHXA 3ZJUA 4N58A 5IP4D 3ZXRA 4DDGD 3H6NA 1M94A 2IJ0A 2OHFA 3M63B 1H8CA 1EWYC 1JWBD 4M00A 3P1MA 4B0EA 1V2YA 2B3AA 2H88B 2RD0A 1J7BA 4HPPA 2YLMA 3A4RA 1TKEA 3PREA 3NG0A 2W82A 2FCNA 1B1ZA 3TL5A 4URKA 2D3BA 3NZSA 2WX1A 4P7IA 4ACFA 2MW5A 1WXAA 1U4AA 2Y3AA 1TY0A 1B9RA 2JZZA 3DQVA 1QLBB 2WQYB 4ZHOA 2CR5A 2JZ3B 5AEKB 4EZKA 1NDDA 5LXHA 2VZKD 3AEDB 3KUZA 1WMHA 3BK2A 5TSSA 3N1YC 2VZKB 1V81A 1I4HA 3IT6B 5BYSA 1I4PA 3B08A 3Q69A 1PUTA 3JW0X 3MHSD 4CHKA 1TZOA 3ZNZB 2L05A 3W1SA 2BKFA 1HXYD 1N6ZA 3OAWA 2JZPA 4GSWA 2LD9A 2KANA 1KFYB 1HEZE 4FULA 1NBFC 1ENFA 3GP7A 1VCBA 4I6LB 3U4EG 4LNIA 2WYQA 2ZNVB 2PVGC 2XN9C 2EELA 4ICVA 2D2QA 1IYFA 1ZE3D 3VRAB 2O6VA 2LGSA 3IAS1 1WF9A 4FJZA 2IDYA 2AWTA 3TEZA 2M56B 1RWSA 2DYMA 2DZMA 1UD7A 4WIPA 2N9LA 1C4PA 1IBXB 2KJ6A 1CK1A 2N0SB 3CWIA 2O6VD 2DX5B 3DOWA 1L6UA 1XT9B 1XXGA 1YMHE 5C23A 2QCZA 4WURA 4RGMA 1IBXA 1SXTA 4LDTD 1ZGUB 3DBRI 5HHDG 1K52A 1R4MI 1T0RC 3IFWB 3R2IA 1NYRA 1OEYA 1S3SG 4B0MA 2K6DB 3AE3B 1DOXA 1E90A 1WX7A 1CMXB 4JWSC 5DPTA 4FJYA 1J7AA 3AN1A 2WXOA 1ZKHA 2LUEA 4BFRA 2D5GA 3RNFC 4DXAB 1AYFA 3E9SA 4JIOU 2GBJA 4XE0A 4W9KA 2R2OA 4CO7A 4X57B 2KDBA 2NBUA 1V9JA 3SFDB 2V1YA 3AULA 1MVKA 3W9CB 3GB1A 4HJGE 3H1UA 1IPGA 5BMIA 1E8XA 3R7QA 1K50A 2K8CA 2BWES 2XK5A 4XX5A 4IC7B 2GI9A 4S0RA 2LVPA 1MPEA 4MGIE 1NYQA 2QILA 4LNFA 4W9GA 4WQMA 2KQ4X 2CU1A 1WRIA 4JGHB 1Y8RC 1JROA 1EF1A 4XYCA 1C4CA 3U30A 2MP2A 4TV3A 1D6EC 1UUPA 1IGDA 3Q3FA 3R8BA 1TS2A 3PRMB 5IA7A 1PGBA 2E6XA 3T3NA 2AQ3B 2C7HA 3U8ZA 3LDZE 2MCNB 4AP4C 3DHIC 4ANUA 3ZDTA 1NVID 4IM0A 3ETRA 4FBJB 4JQWC 3AE9B 3APDA 3NHEB 2DAFA 5D3IB 1GC7A 2PJHA 4ZRKA 3FILB 4EFOA 2WU5B 3DPDA 1PDXA 4R3DA 4K3CA 4JWUC 2WXPA 3DDCB 4EUTA 5EDSA 3B1LX 2LJIA 4QAYA 5D3DA 3Q8AA 4GMVA 1CQVA 3QX1A 5FKAC 3AE7B 3QCAA 3RNBC 1TY2A 3MC0B 1QOAA 2GLSA 3RCZA 4G50A 3EC8A 3HK0A 4G3XB 2I1JA 2IO3B 3BY4B 4NJ6A 4FN2A 2A4ZA 2AQ2B 3KWVA 3RI7C 1MG4A 3DBLI 4P1CC 1OQYA 2BF8B 3AEBB 3PT2B 3B0AA 3AB5A 1ISNA 4IWOA 3ZO5B 3ZGZA 2SAKA 2DZIA 2EMTA 3RMKC 4WAFA 1QQRA 1Q10A 3FILA 1RAXA 4HPLB 2KLGA 4IM3A 2MBBB 2EKIA 4D2KA 1FXTB 4GXBA 5BMHA 4XGAB 5MPOA 3EGRA 3IG3A 2JF5A 2LHDA 3SFEB 3AE8B 3URYA 3A9JB 1YN4A 3KH0A 1H4RA 1E9MA 3RD2A 1XQQA 2JY6A 1V1OA 4PK1A 1F9JA 3GOEA 2FUG1 2UWQA 2AL3A 4OZCA 3VXWA 1AN8A 2M17A 5IOIA 3TUOA 1JRPA 2Y5CA 1SBBB 2K3UA 3Q3NC 1M4VA 1UBQA 2C7MB 4LNNA 2MJDA 1ESFA 4ZRQA 2WP9B 3R66C 1UNSA 1JRUA 3EUB2 4RF0A 1WJ6A 1EU4A 4PYZA 2X38A 4UDUC 3PPAA 2BB5A 3A9KA 4K81A 4PS8A 4A9AA 3ZXVA 1SEBD 4BKGA 1T0SC 4JX1C 1RFKA 2WXLA 1FD6A 2WLBA 1E8YA 1EWCA 1I42A 4N59A 4JL9A 1DGJA 2BPSA 3A9KB 2PMVA 2K25A 2L76A 5FR6A 2NPTA 1KM7A 3V60A 2Y5PA 2W9NA 3KQ4A 1Z2MA 2YVCA 1VLBA 2MHJA 3TEXA 5LNK1 1A5RA 1I4XA 2QSDA 1TYGB 2IGGA 2VRRB 4BBNF 2MJEA 3OJ4B 4YTNB 3L54A 1L2NA 2FCSA 4K3BA 4KV2A 2L8JA 3KLSX 1GJZA 1YX6B 2GMIC 1HTOA 4DHZB 1MJDA 3V3XA 3S2AA 1SE4A 3AEFB 1YN3A 2X8XX 1JWAD 3N30A 2LGXA 1WSPA 1D5ZC 3SU8X 5L83A 3BZDB 2MBHA 1XLPA 4HEA1 2WX0A 2G9HD 4BAXA 4WH4A 4L2YA 1FM0D 2IBIB 1ZPSA 3UI3A 2ASQA 2J53A 1C76A 4ZOHC 3OLMD 4MELA 4KZCA 3PTFC 1RRBA 4XC2A 2L32A 4MEMA 3H7PA 2JX5A 2AYOB 4MM3B 4IG7B 1I7HA 3Q2AC 1SJED 3H7SA 3PGEA 3CSFA 3DWMA 4HKQA 4RNAA 1L4DB 3ZLZA 3HM3A 2HDEA 3HVDA 3QQ8B 3EFUA 1J0GA 2L3ZA 4MDKE 4LLGM 4EOYA 2BYTA 3DBSA 1QT9A 2KJHB 1C79A 4B9KA 4RGOS 2L00B 5C1ZA 1L0YB 3X0WA 1J8CA 2BBCA 1WFYA 2WDRB 2D3GA 2A5UA 3DVNV 4E3CA 4RMAA 1ROEA 4G0NB 4OZBA 2C5LC 2JYEA 1YQBA 3NVZA 3QWZB 2AL6A 2KYWA 2W3RA 2ICIA 1C77A 1TKYA 2KN4A 2ONQA 1FEHA 3MC8A 3L08A 4NAWA 1RLFA 1JCKB 1F1HA 1OTRB 2DNFA 5C2TB 4XWWA 3U7ZA 3K9OB 1SE9A 4KVGB 3O65B 3E56A 1T3QA 1V6EA 3EECA 3NY5A 5J2RA 3ML9A 1L6VA 1V8CA 1VD2A 4WAAA 3NZUA 4GOCA 4K7SA 4FLHA 3OJ3A 2ACZB 2PTLA 2QC8A 1WGGA 3ONSA 2GBMA 4BZAA 1DOYA 4C56C 1MI0A 1CJEA 3VHTC 1JQ4A 4CQNA 1E8ZA 5JHAA 2W54A 1D5MC 3WCQA 1QOBA 1QF6A 2VH2A 3AEAB 1WGHA 4DHJD 1N61A 2D07B 5BMGA 3BYTB 1JW9D 1WR1A 2IY1B 4BKTA 3ML8A 4E74A 1UWXA 2LMCA 2LXCA 2ZW1A 2HJ8A 2N7JA 4KX6B 2LI5A 2IY0B 2MRPA 2M0AA 3BINA 2EKEC 1RYJA 5JHBA 1C4AA 2Z59B 3P2BA 4M02A 5HFYA 2GB1A 2WXKA 3L17A 1EF5A 3TJPA 2WWZA 5CHFA 1VZ8A 2O2VA 2G3QB 2JU6X 1TBEA 4RM8A 3VUXA 2KMAA 4MGZE 1YN5A 1C9FA 2KZRA 2K6QA 2K5PA 1WI0A 2LGDA 2N7EA 4MACA 2NTSA 4IM2A 3T3OA 4YL8A 5BO4B 2WS3B 4ICUA 3V6CB 3ZJTA 1I4GA 3AE4B 5GMVA 3APCA 2RPVA 1J19A 3VUYA 3PS6A 1N63A 4KGTA 1WX8A 1JWSD 3MJWA 2KNBA 3MTNB 3MFGA 4PS7A 1T0YA 1VRAB 5JH5C 2V4IB 3WA0A 2WXQA 1F52A 1ZDVA 3UF8A 3WALA 3DVGY 2ZEQA 2KX0A 1WYWB 4XWTA 2JSVX 3UQBA 1T0QC 2LGIA 1KH0A 4US8A 4ITKA 4MH0E 4GIVA 1WMHB 1WM3A 3RFZB 1YQ4B 1TS4A 2KQSA 2CKHB 4A8XC 2RDGA 2G45B 1R7SA 2N1WA 4OZAA 3VTVA 4G11A 3BK1A 2QIEB 3NOBA 1HZ5A 2GBKA 4RH6A 2KXJA 1I4RA 2GBNA 2BS4B 4IW0A 2LJ5A 1TT5B 3X23A 2PW9A 4C80A 2KD0A 2EMSA 3Q8FA 3SD5A 3P4SB 4HPMB 2DBYA 1TIFA 4XDCA 2AEHA 4XZ4A 3N9YC 4HCPB 4O1NA 3A33B 4ZDVA 4HXDA 1XLOA 2I2YA 3V6EB 1S1QB 1AW7A 5DPSA 2IZVB 3BVZA 3TSSA 4EEWA 5FK9C 3RUIB 1TZ1A 3C8YA 2PVOD 2PLPA 1K53A 1SE3A 4WJNA 1X1MA 4JE3B 2CHZA 2INCC 4M0WB 5D94A 2BTEA 1GNUA 2PE6B 3PO0A 1LM8B 5BYRA 2YEPB 1LFDA 3BIID 2Z0EB 1TTNA 2KDIA 5I4DA 3ZYYX 4DWFA 2ON8A 1FXAA 3QIJA 4DHJB 4BOZB 4HLEA 2KTRB 3FC4A 1SSNA 2FAZA 1V80A 3MP9A 2DHZA 1BUIC 4GU2A 1XEEA 2MBOA 3V62A 1WE7A 2OEDA 2G1EA 2JWUA 2KDMA 3R2TA 3JYUA 1WGYA 4YTMB 1WIAA 3H8HA 3WAPA 2C7NB 4Q2JA 5AZGA 1YJJA 4BOSC 2D3CA 4JPSA 4ANVA 2MX2A 2K8BA 2K9XA 3L4PA 5E6NA 4NZLB 1FFUA 1FIQA 1HA5A 1V1PA 4HDOA 4EZJA 4IOIE 3AI5A 3UINB 3O13A 4ZRPA 1QILA 3H9DA 4F1SA 4AUQC 1FMAD 3M3JA 2HTHA 1IGCA 1QZEA 3N1XC 5D6JB 3OG5A 5IN7A 1IUEA 2XEWA 4RFBA 1L0XB 2FNJB 1LQBA 1EU3A 1KLVA 1Y56A 5KHOA 2FIFA 2REXA 5D7GA 1RM6C 2JUOA 3RNEC 1ZXHA 3LJ3A 2RGFA 2XNAC 3RNCC 4YT0B 1NENB 4NY0A 3IVFA 3Q3OC 1ZP0B 3DVGX 1F2RC 3CF6E 1GB1A 1ZW7A 1R4NI 1WYGA 2K1FA 1UF0A 2G4DB 2Z0DB 1V86A 2NS5A 4A90A 1FPYA 3B2FA 2RDHA 2J0MA 2K0PA 4NJCA 5G5HA 3VR9B 3CIRB 2LRWA 4HKZE 1TKGA 3QAQA 4GDKA 3DCGA 3JSVA 4MM3A 2J7QB 2WU2B 3DHGC 5J17A 1FCCC 4BKSA 2CS4A 2I38A 3PSEB 1ACCA 1FFVA 1K51A 1N60A 3NJTA 3GE3C 2WDVB 1WZ0A 3APFA
chains in the Genus database with same CATH topology
3W5UB 2WXJA 2WDRB 1ZXIA 3HVZA 1QOFA 2K22A 1ROEA 3AE1B 1F0ZA 4USAA 1N5XA 2W3SA 2WXHA 1TY0A 2Y3AA 4OZBA 2JYEA 1L5PA 1B9RA 1QLBB 2WQYB 4ZHOA 3NVZA 2VZKD 3AEDB 2W3RA 3BK2A 5TSSA 2ICIA 3RPFC 2VZKB 1I4HA 3Q8EA 3IT6B 5BYSA 1I4PA 4YXDB 4L1BA 1C77A 1TKYA 3Q69A 2QMTA 1PUTA 2J52A 5E6JA 3AECB 1JWUD 2KN4A 1TZOA 1TS5A 1FEHA 2ONQA 4A55A 3W1SA 2W55A 4ARCA 1HXYD 4KKJA 2JZPA 2BW2A 3P42A 1JCKB 5C2TB 2PIAA 4RGTA 4XWWA 2L52A 2MEKA 1KFYB 2WNMA 1HEZE 3U7ZA 2LHEA 1V1PB 2INNE 2JXTA 1ENFA 3GP7A 3E56A 3U4EG 1T3QA 3B2GA 2PVGC 2XN9C 2EELA 3IXSA 1XCTL 1J7CA 1KF6B 1ZE3D 2SEBD 3VRAB 1GOZA 5AUIA 1L6VA 1JWMD 1V8CA 3P63A 1KLGD 3PZ7A 3IAS1 1OQRA 1P7FA 3AMZA 1BMLC 1SF0A 2IDYA 3VR8B 4ZHPA 2JQRB 2CJNA 1XCQL 3U52E 3TEZA 2ACZB 2PTLA 1BXTA 2M56B 1RWSA 4OW0A 2DYMA 2LEKA 4WIPA 2N9LA 1C4PA 3MJ5A 2L83A 3BVGA 1IBXB 1CK1A 1DOYA 4C56C 1MI0A 4DXGA 2N0SB 3CWIA 2B76B 1FO4A 1CJEA 4TQ1A 1L6UA 2QEJC 1JQ4A 1XXGA 1YMHE 4FXCA 4GDKB 3U2SC 4CQNA 2AX5A 4WURA 3NVYA 3NZ3A 4RGMA 1IBXA 2W54A 1SXTA 1ZDXA 1D5MC 3WCQA 5HHDG 1F77A 1K52A 3R2IA 1QOBA 1NYRA 3AEGB 1QF6A 4B0MA 1YJIA 3AE3B 1E6EB 1DOXA 1YQ3B 2IGHA 3AEAB 1FCLA 1N61A 5BMGA 3BYTB 1JW9D 5EE9A 4YSZB 4JWSC 1LO5D 4YSYB 4AS1A 1L4ZB 3AH7A 1J7AA 3AN1A 3VRBB 2WXOA 1UWXA 3I57A 2Z8LA 2LMCA 4RCOA 2D5GA 1WGKA 4P16A 3AE5B 2ZW1A 4C7ZA 1SIJA 1AYFA 3E9SA 1FRDA 2N7JA 4XE0A 4AQ7A 3DWGC 4KX6B 1VDVA 1WXQA 2M0AA 1PGXA 4ARIA 3NVVA 1XLQA 1FXIA 3SFDB 1DYQA 1RYJA 3W9CB 1C4AA 1MVKA 3GB1A 3TEWA 1SJHD 4HJGE 1PGAA 5BMIA 3NS1A 5HFYA 1K50A 3AE6B 2GB1A 2WXKA 3AE2B 4GDLB 3W5VB 1VZ8A 1SB3C 2FE8A 2JYTA 2KAJA 2JU6X 2GI9A 2L1AA 4TMAB 1MPEA 1N5WA 5H8YE 1YN5A 2INPE 1NYQA 2QILA 3IAM1 1C9FA 4PT5A 1VZ6A 4WQMA 4L23A 3SEBA 2KQ4X 2K5PA 1WRIA 4MACA 2NTSA 1KLUD 3TEYA 4OHJA 3AV8A 1JROA 3T3OA 1C4CA 1D6EC 2WS3B 2QJLA 3ZJTA 1ZUD2 1I4GA 1UUPA 2DWQA 1IGDA 3AE4B 3R8BA 2M19A 1TS2A 1ET9A 4GLSC 2RPVA 1PGBA 2E6XA 2CJOA 3T3NA 2AQ3B 2WXGA 1UGJA 1PFDA 1HQRD 1FNVA 1N63A 4KGTA 2V3NA 3P4RB 3Q8CA 1JWSD 1UWMA 3MFGA 1VRAB 2N9KA 1NVID 3AEEB 2V4IB 1GAQB 3ETRA 2WXQA 3FAHA 1ZDVA 3AE9B 2TSSA 5D3IB 4XWTA 2JSVX 3FILB 1A70A 2WU5B 1PDXA 4R3DA 4J3OD 2H89B 4JWUC 2LGIA 1D4BA 1KH0A 2J42A 2WXPA 4US8A 4ITKA 4XDDA 4IKGA 3IT4B 1NI3A 1JALA 2BT6A 3ZQ4A 3RFZB 1YQ4B 1TS4A 2LJIA 2ZW0A 1DOIA 4A8XC 4REZA 3Q8BA 2RDGA 5D3DA 1R7SA 4OZAA 1AWDA 1ET6A 3Q8AA 3BK1A 2QIEB 1HZ5A 1CQVA 5FKAC 4DQOC 4RH6A 5G5GA 1V97A 3W2DA 1I4RA 2KMMA 2BS4B 3AE7B 1TY2A 1TJEA 1I4QA 3MC0B 1QOAA 4IDIA 3LXFA 2PW9A 4C80A 2R61A 2WXFA 3J9CA 1E10A 4OVZA 3PZ8A 3Q8FA 3BYYB 3NUHB 2FBWB 2AQ2B 3KWVA 2V3PA 3P4SB 2DBYA 4XDCA 3N9YC 5HG2A 4O1NA 2IGDA 3AEBB 2BS2B 3AB5A 5JXVA 3ZGZA 5EE0A 2SAKA 1XLOA 2I2YA 4LTUA 5C3JB 1T5XD 2AQ1B 4WAFA 1QQRA 1Q10A 2WXIA 1AW7A 3FILA 4M0WA 4RGNA 3BVZA 3TSSA 5FK9C 2EKIA 5T8IA 4D2KA 3C8YA 2PVOD 2PLPA 1K53A 1E7PB 1SE3A 2WXRA 3HRDD 5BMHA 1E0ZA 1GB4A 5MPOA 4JE3B 2WDQB 3EGRA 4MH8A 2BTEA 1NEKB 2LHDA 3PO0A 4YSXB 3SFEB 5BYRA 3AE8B 3URYA 2YEPB 1FNUA 3BIID 1YN4A 3LB8C 1STEA 1E9MA 4KKIA 5I4DA 3ZYYX 3ZJVA 1V1OA 2ON8A 5BYQA 1FRRA 1JMLA 1FXAA 4H2AA 2E3TA 1SSNA 3FC4A 2FUG1 4OZCA 3MP9A 1AN8A 1BUIC 1D5XC 1XEEA 1XF5L 3TUOA 1JRPA 4HROA 2HTME 1VZ7A 2Y5CA 1SBBB 2K3UA 1M4VA 4TQ0A 1OQQA 4YTPB 2MJDA 4ZYSA 2OEDA 2G1EA 3AM9A 1XLNA 1ESFA 1HZ6A 2JWUA 2KDMA 3R2TA 1VJKA 4ZRQA 2WP9B 5GXGB 3SR6A 1UNSA 4WWMA 3EUB2 4RF0A 2KWDA 4YTMB 1EU4A 5AUKA 3BVMA 3H8HA 1CZPA 2X38A 4UDUC 4Q2JA 2BB5A 2NMQA 2Q5WD 1YJJA 4A9AA 1TS3A 1SEBD 3NRZA 2KACA 2BS3B 4JPSA 1WWTA 4HRSA 4JX1C 1KTKA 1RFKA 2WXLA 1FD6A 2K9XA 2WLBA 3L4PA 1EWCA 2YEPF 3LYYA 4NZLB 2WXNA 4N59A 1DGJA 1FFUA 1FIQA 3BWUD 2PMVA 4RF1A 1HA5A 4YWGG 1V1PA 1OFFA 4IOIE 1YNTE 2RMMA 2Y5PA 2DLBA 3HUIA 3KQ4A 3O13A 4ZRPA 1QILA 1VLBA 1N62A 3TEXA 5LNK1 3EA6A 3NVWA 4DXFA 4A6QA 1T6BX 2DYOA 1I4XA 1ZOYB 3OWEB 2QSDA 1FMAD 1TYGB 2IGGA 3I9V1 2V0GA 1IGCA 2MJEA 4KGRA 4YTNB 5EE1A 2IPKD 5EE3A 5FR3A 1IUEA 2MJ3A 4RFBA 4TSSA 1VR9A 1L0XB 1XO3A 3KLSX 3V05A 1EU3A 2PKOA 1EM7A 1Y56A 4C7YA 1C78A 3V3XA 1KRHA 1SE2A 5D7GA 1RM6C 1SE4A 3AEFB 4NAWB 1YN3A 3B9JA 3P4PB 1ZXHA 1JWAD 1FNWA 3VQIA 3ABVB 1WSPA 1D5ZC 2J4XA 4P6VF 3BZDB 2XNAC 4EE2A 2LFIA 4YT0B 1XLPA 1NENB 3KWLA 4HEA1 3MHZA 2G9HD 2GRIA 4WH4A 5H92C 1ZP0B 1GPXA 1F2RC 1MHHE 2NTTA 1FM0D 4L2YA 1ZPSA 3UI3A 1GB1A 2J53A 4NAMA 1C76A 4ZOHC 1WYGA 2MH7A 3P4QB 1P7EA 2L32A 3GS2A 4A90A 3B2FA 2CU3A 1QKZA 2JX5A 2RDHA 4MM3B 1MHXA 2K0PA 4NJCA 3ZJUA 4N58A 5G5HA 1I7HA 3VR9B 1SJED 3CIRB 2IJ0A 2OHFA 3DWMA 1TKGA 4HKZE 4HKQA 4RNAA 1L4DB 1EWYC 1JWBD 2WXMA 4N6EB 2HDEA 3HVDA 2BB6A 2WU2B 3P1MA 4B0EA 2H88B 1J7BA 1L0VB 4KGSA 1FCCC 5HI1A 4LLGM 2BYTA 1PYWD 1QT9A 1TKEA 2I38A 1QOGA 1C79A 4US9A 2W82A 1ACCA 1FFVA 1F2RI 1K51A 1N60A 1B1ZA 1L0YB 4LK0M 4MT5A 4RGOS 2WDVB 2BBCA 2LUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U B;  4C80 A;  2WDR B;  1ZXI A;  3HVZ A;  4KX6 B;  4N59 A;  1DGJ A;  1FFU A;  1FIQ A;  1QOF A;  1E10 A;  2K22 A;  5GXG B;  1ROE A;  1VDV A;  3AE1 B;  1WXQ A;  1OFF A;  4USA A;  1F0Z A;  2FBW B;  1N5X A;  1XLQ A;  2W3S A;  3NVV A;  1FXI A;  3SFD B;  1L5P A;  1RYJ A;  3W9C B;  1B9R A;  1QLB B;  2WQY B;  3HUI A;  4ZHO A;  3P4S B;  3NVZ A;  1VLB A;  2DBY A;  1N62 A;  3NS1 A;  3AED B;  3NVW A;  3AEB B;  3AE6 B;  2W3R A;  3RPF C;  2BS2 B;  3AB5 A;  1ZOY B;  3AE2 B;  3W5V B;  1SB3 C;  1FMA D;  1TYG B;  1TKY A;  4YXD B;  5EE0 A;  1PUT A;  2KAJ A;  2MJE A;  3AEC B;  1XLO A;  4YTN B;  1DOX A;  5EE1 A;  4LTU A;  5EE3 A;  1N5W A;  2W55 A;  5H8Y E;  5C3J B;  1NYQ A;  1IUE A;  2MJ3 A;  4WQM A;  1XO3 A;  5C2T B;  2PIA A;  2L52 A;  1KFY B;  1WRI A;  2K5P A;  2PKO A;  2EKI A;  3AV8 A;  1JRO A;  4C7Y A;  1KRH A;  1T3Q A;  3B2G A;  1RM6 C;  2PVO D;  3AEF B;  2PVG C;  1E7P B;  2WS3 B;  2QJL A;  3HRD D;  1J7C A;  1KF6 B;  3B9J A;  1ZUD 2;  3P4P B;  1E0Z A;  2DWQ A;  3VRA B;  5MPO A;  3AE4 B;  2WDQ B;  5AUI A;  1L6V A;  1JWA D;  2M19 A;  1V8C A;  1NEK B;  3P63 A;  3PO0 A;  4YSX B;  3ABV B;  3SFE B;  1OQR A;  3AE8 B;  3AMZ A;  4P6V F;  1SF0 A;  2CJO A;  3VR8 B;  4ZHP A;  3BII D;  2JQR B;  1PFD A;  2CJN A;  3LB8 C;  1N63 A;  2ACZ B;  2M56 B;  4YT0 B;  1E9M A;  1RWS A;  1XLP A;  3P4R B;  3ZYY X;  1NEN B;  2LEK A;  3KWL A;  1FRR A;  1UWM A;  2L83 A;  1FXA A;  1DOY A;  5H92 C;  1GPX A;  1ZP0 B;  1NVI D;  3AEE B;  3ETR A;  1GAQ B;  2N0S B;  2E3T A;  2B76 B;  1FM0 D;  3CWI A;  3FC4 A;  3FAH A;  1FO4 A;  1CJE A;  3AE9 B;  1L6U A;  3SR6 A;  1JQ4 A;  4ZOH C;  4FXC A;  1WYG A;  2AX5 A;  1JRP A;  2MH7 A;  2HTM E;  3P4Q B;  1A70 A;  2WU5 B;  2Y5C A;  1PDX A;  4HRO A;  3NVY A;  2W54 A;  1OQQ A;  2H89 B;  4JWU C;  4YTP B;  3B2F A;  2CU3 A;  2JX5 A;  4US8 A;  2MJD A;  4ITK A;  3WCQ A;  2G1E A;  3AM9 A;  1XLN A;  4N58 A;  5G5H A;  1VJK A;  1I7H A;  1NI3 A;  1JAL A;  1QOB A;  1NYR A;  2BT6 A;  2WP9 B;  3AEG B;  3CIR B;  1YQ4 B;  1YJI A;  3AE3 B;  1E6E B;  3EUB 2;  4WWM A;  4YTM B;  1YQ3 B;  3AEA B;  2OHF A;  3DWM A;  1TKG A;  1DOI A;  5AUK A;  1N61 A;  1JW9 D;  1R7S A;  5EE9 A;  1AWD A;  4YSZ B;  1EWY C;  1CZP A;  1JWB D;  4N6E B;  2QIE B;  4JWS C;  4YSY B;  3AH7 A;  3P1M A;  1J7A A;  2WU2 B;  2Q5W D;  2H88 B;  3AN1 A;  1YJJ A;  1J7B A;  1L0V B;  5G5G A;  1V97 A;  3VRB B;  2KMM A;  4A9A A;  2BS4 B;  1QF6 A;  3AE7 B;  3NRZ A;  2BS3 B;  1QT9 A;  1TKE A;  1TJE A;  1QOG A;  1WGK A;  1WWT A;  4HRS A;  3AE5 B;  1FFV A;  1QOA A;  4JX1 C;  1RFK A;  4US9 A;  3VR9 B;  1N60 A;  4IDI A;  4C7Z A;  1SIJ A;  2K9X A;  1AYF A;  2WDV B;  2WLB A;  3LXF A;  3L4P A;  1FRD A;  3DWG C; 
#chains in the Genus database with same CATH topology
 4HVB A;  1ZXI A;  3HVZ A;  1QOF A;  3ZTC A;  3AE1 B;  1F0Z A;  4USA A;  1N5X A;  2BYV E;  1L5P A;  3ZIM A;  1WGR A;  3Q3J A;  4GB9 A;  4W9J A;  1WJU A;  1NI2 A;  3PRP B;  3Q8E A;  4YXD B;  2J52 A;  3AEC B;  2BVC A;  4A55 A;  1HTQ A;  2W55 A;  3ZKJ C;  4AWJ A;  2BW2 A;  5IAA C;  3ZNG C;  1V1P B;  2JXT A;  1UH6 A;  3PHW B;  2NR2 A;  3VTU A;  3IXS A;  1XCT L;  4II2 B;  2LWP A;  3VUW A;  3Q14 C;  1GOZ A;  2KN5 A;  1JWM D;  1E7V A;  2D10 A;  4ZYN A;  1KLG D;  2KKC A;  3PZ7 A;  1OQR A;  1P7F A;  1BML C;  4HWI B;  3U52 E;  1BXT A;  4OW0 A;  2LEK A;  2KJR A;  2WGS A;  3MJ5 A;  2L83 A;  3BVG A;  1UBI A;  3RNG C;  4W9L A;  4TQ1 A;  4GDK B;  4FXC A;  3VTW A;  1ZDX A;  3WAO A;  5E6P A;  3L16 A;  2JVC A;  5CTR C;  5G55 A;  3AEG B;  3I3T B;  1E6E B;  2NVU I;  1FCL A;  2D3A A;  2KVZ A;  3UQA A;  5EE9 A;  4YSZ B;  1L4Z B;  3AH7 A;  3CMM B;  3VRB B;  3I57 A;  2Z8L A;  2PE9 A;  1WGK A;  2O6V B;  4F8C B;  4C7Z A;  1SIJ A;  3L0W B;  1FRD A;  2NBW B;  4OVV A;  2DEN B;  3ZDM C;  4E71 A;  1WXQ A;  1PGX A;  4ARI A;  3NVV A;  1V5O A;  1XLQ A;  1DYQ A;  4B6W A;  1PGA A;  3NS1 A;  2KC2 A;  4DHZ E;  2ZCC A;  5JZE B;  4LJO B;  3AE2 B;  4GDL B;  1SB3 C;  2FE8 A;  1Q5W B;  2L1A A;  2N4F A;  4TMA B;  2MQJ A;  1N5W A;  4ANX A;  4LNK A;  2ZPN A;  1WXV A;  2INP E;  2ZVO A;  3ZRF A;  1RFA A;  2M4N A;  2K8H A;  1VZ6 A;  4BBN C;  4L23 A;  2JPH A;  3SEB A;  2OJW A;  2RDB C;  3V61 A;  3I63 C;  3TEY A;  2KOX A;  4OHJ A;  3AV8 A;  1GUA B;  2QJL A;  2M1M A;  3ECI A;  1ZUD 2;  4GDL A;  3JSV B;  2M19 A;  2NBV B;  4A20 A;  1IP9 A;  2ZVN A;  4LNO A;  1HQR D;  1FNV A;  2G4S A;  4WJP A;  2V3N A;  3P4R B;  3Q8C A;  1Q1O A;  2FUH B;  2N1V A;  4NQK E;  3SDL C;  2N9P C;  3AEE B;  1GAQ B;  4W9F A;  2C9W B;  3FAH A;  2RR9 A;  3DBH I;  3M95 A;  2V4L A;  1A70 A;  4J3O D;  1D4B A;  3GZN B;  3M62 B;  4XDD A;  4B95 A;  4IKG A;  5G2N A;  1JAL A;  2BT6 A;  2KFK B;  4REZ A;  3PHX B;  2KQ7 A;  1AWD A;  1ET6 A;  1LXD A;  3A9J A;  4HK2 A;  2PPH A;  1I35 A;  3WAN A;  1MG8 A;  2KMM A;  3Q3M C;  1I4Q A;  1WH3 A;  4FA6 A;  2R61 A;  4MGK E;  3PZ8 A;  3ZW3 A;  5DPW A;  4MJS B;  2V3P A;  4WJQ A;  2KMC A;  4W9E A;  4KDI C;  3L13 A;  2BS2 B;  5JXV A;  2MP2 B;  4LTU A;  5C3J B;  2L0T A;  2IO0 B;  1T5X D;  4K7W A;  4RGN A;  2DAJ A;  2ZPY A;  2FCQ A;  4FAD A;  3ZNI D;  5T8I A;  3KYD D;  2WXR A;  2DYB A;  1E0Z A;  2WDQ B;  1NEK B;  1LGR A;  4YSX B;  1E5W A;  1FNU A;  3LB8 C;  1STE A;  3IBE A;  1FRR A;  3RNA C;  2MLB A;  4NNJ B;  4JLC A;  1D5X C;  2ZZP B;  1WGD A;  1C1Y B;  3AU5 A;  3RUL A;  4LDT B;  2UYZ B;  1VZ7 A;  2CHX A;  1OQQ A;  4CYE A;  2XK5 B;  3VH3 B;  3HIZ A;  1C3T A;  1VJK A;  5GXG B;  1WE6 A;  4WWM A;  2KWD A;  2LAS A;  3R3M A;  5AUK A;  3I5J C;  1EUV B;  4HDQ A;  2BYF A;  2LRU A;  1CZP A;  3KVF B;  3U7D A;  2NMQ A;  2Q5W D;  3W1Y A;  2BS3 B;  2KAC A;  2LZ6 A;  2M0X A;  1KTK A;  2FCM A;  1P9D U;  3LYY A;  3BWU D;  2OJR A;  4YWG G;  3ZVV A;  5L95 C;  1OFF A;  1V5T A;  2VH1 A;  1WX9 A;  3HUI A;  3D32 A;  3EA6 A;  4KIK A;  4A6Q A;  1ZOY B;  3OWE B;  4WJO A;  4OVU A;  4GN1 A;  3AU4 A;  5J18 A;  2IPK D;  5EE3 A;  5FR3 A;  3VAW A;  1WRD B;  5D2M B;  1VR9 A;  3VDZ A;  1XO3 A;  2N9E B;  4NPN A;  3V05 A;  1EM7 A;  4WWN A;  4C7Y A;  2MA9 B;  1SE2 A;  3EHV A;  4NAW B;  1YX5 B;  2KO3 A;  3RYT A;  3B9J A;  3P4P B;  1FNW A;  4C4V A;  3VQI A;  3ABV B;  4P6V F;  3NS8 A;  3RT3 B;  3MHZ A;  5H92 C;  1GPX A;  2KWV B;  4KSL C;  4NAM A;  1GG3 A;  3QC8 B;  2CU3 A;  4AJW A;  3QA8 A;  4K7U A;  4WQO B;  2JXX A;  4J6I A;  3KW5 B;  4I6P A;  4BVU C;  3A1Q B;  2WXM A;  4N6E B;  2MBE A;  4K1R B;  2BB6 A;  2KDE B;  1L0V B;  3DBR B;  3JVZ X;  4KGS A;  5HI1 A;  1PYW D;  4BKS D;  1QOG A;  4US9 A;  1F2R I;  1TGZ B;  5KHQ A;  4MT5 A;  4LK0 M;  4AOF A;  2QDF A;  4HJK A;  2LUM A;  3KUC B;  3W5U B;  2WXJ A;  3WIM A;  1YIW A;  3UGB B;  2K22 A;  2W3S A;  2WXH A;  4II3 B;  4I6N B;  1SGH A;  4ZRJ A;  3RZF A;  2IYD B;  3RPF C;  1WR6 E;  4AJY B;  4HCN B;  4EKU A;  1UEL A;  1R4N B;  4L1B A;  2QMT A;  4FHJ A;  2JWZ A;  5E6J A;  1JWU D;  1TS5 A;  3PLU A;  4ARC A;  5AZF A;  4KKJ A;  2KTR A;  3P42 A;  1R4M B;  2PIA A;  4RGT A;  2L52 A;  2MEK A;  2WNM A;  2LHE A;  2INN E;  3ENE A;  5DCN A;  3AXC A;  1WXM A;  2J0J A;  4M01 A;  3B2G A;  2J0K A;  2RSU A;  1J7C A;  1KF6 B;  4KSK C;  2SEB D;  1Z5S B;  4KZ0 A;  5AUI A;  4W9I A;  3P63 A;  2KX3 A;  2K39 A;  2KWU B;  2KTF A;  3AMZ A;  2LVQ A;  1SF0 A;  4MSQ B;  4WWP A;  3VR8 B;  4ZHP A;  2JQR B;  2CJN A;  1XCQ L;  3TBL D;  1BT0 A;  1PQS A;  2MSE D;  3PRZ A;  4DXG A;  2B76 B;  3QK0 A;  1KJT A;  1FO4 A;  4A3O A;  2QEJ C;  5AZH A;  2M8S A;  3U2S C;  2AX5 A;  3T9L A;  4KDL B;  3NVY A;  3NZ3 A;  5HKH A;  2MWS B;  2MBQ A;  4IUM B;  3TMP B;  1F77 A;  3UIO B;  4MGY E;  1YJI A;  1YQ3 B;  2IGH A;  2IO2 B;  1SIF A;  3DBL B;  1LO5 D;  4YSY B;  4AS1 A;  4DBG A;  4RCO A;  4DDI D;  3PVL A;  4P16 A;  3A4S C;  1KOT A;  3AE5 B;  4EZL A;  3KUD B;  5CX3 A;  4AQ7 A;  3DWG C;  5TR5 A;  3PZD A;  5CHV C;  1VDV A;  3QHT A;  4C00 A;  1FXI A;  3TEW A;  1SJH D;  2RPQ A;  3VFK A;  1WY8 A;  4C4V B;  3AE6 B;  2KT7 A;  2L0F A;  4LCD E;  4W9C A;  3TCA A;  4ASW C;  3W5V B;  3HHM A;  2JYT A;  4MJS A;  3C19 A;  2KAJ A;  4S17 A;  3QAR A;  1E8W A;  1L7Y A;  3L10 B;  5H8Y E;  3IAM 1;  4PT5 A;  5LXI B;  2LXA A;  2XBB C;  1KLU D;  4A3P A;  3MC9 A;  2BYE A;  2UU7 A;  4TKN A;  2CHW A;  2LVO A;  2DWQ A;  1GC6 A;  3Q6B A;  4PYU A;  5DPR A;  1ET9 A;  2BGF A;  4GLS C;  1E7U A;  2WHI A;  2CJO A;  2KFJ A;  2WXG A;  1UGJ A;  1PFD A;  2BWF A;  5LLI A;  1UWM A;  5IKC M;  2N9K A;  4W9H A;  4LJP B;  2ZCB A;  3ZUN A;  2KWC A;  2KHW B;  3SHQ A;  2TSS A;  2KDF B;  2O2V B;  2OOB B;  1P1A A;  2FID A;  2H89 B;  2J42 A;  5E6O A;  3IT4 B;  1WM2 A;  1NI3 A;  3ZQ4 A;  3ZRC A;  2ZW0 A;  1DOI A;  1WZ3 A;  4P1B C;  3Q8B A;  3T8M A;  1XD3 B;  3RZW C;  4DQO C;  4N9F 4;  5G5G A;  2I1K A;  1V97 A;  3W2D A;  1OGW A;  3N32 A;  1TJE A;  4IDI A;  3LXF A;  4RM9 A;  3DVN U;  1EO6 A;  2WXF A;  2R2Q A;  3J9C A;  4NJ7 A;  4F7Z A;  1E10 A;  4OVZ A;  2GBR A;  3BYY B;  1G6J A;  3NUH B;  2FBW B;  4PS3 A;  1D3Z A;  4TUU A;  2DZK A;  1WJ4 A;  5HG2 A;  2IGD A;  5CHW A;  3N3K B;  2PEA A;  3KYC D;  5EE0 A;  4FJV B;  1P0R A;  3W1S C;  3QJZ A;  4M8N A;  2AQ1 B;  2C60 A;  3ALB A;  1OEY J;  3ZNH B;  2WXI A;  4M0W A;  3DHH C;  1P3Q U;  4ZRI A;  3UIP B;  1HE8 A;  2BKR B;  1E7P B;  2QHO A;  2ZNV C;  3HRD D;  2L7R A;  1GB4 A;  4MH8 A;  3VVW B;  2DZJ A;  4FHK A;  3EFC A;  4KIK B;  4NQL B;  4KKI A;  3ZJV A;  5BYQ A;  3GZN I;  1JML A;  3ZTD A;  4H2A A;  2E3T A;  1YJ1 A;  1XF5 L;  4HRO A;  2HTM E;  2LGY A;  4IWQ A;  4TQ0 A;  3C0R B;  4YTP B;  4ZYS A;  3AM9 A;  4MSM B;  1XLN A;  1HZ6 A;  2JT4 B;  2V9H A;  2BQQ A;  2HJ1 A;  1YOV B;  3PV1 A;  3SR6 A;  1UZX B;  3BVM A;  3PLV A;  4DK5 A;  2IO1 B;  1TS3 A;  2D11 A;  3NRZ A;  3A1Q A;  3K9P B;  1WWT A;  4HRS A;  4ANW A;  3TIX A;  2N9X A;  3R7R A;  3WAM A;  2YEP F;  3FKY A;  3DBH B;  2WXN A;  4RF1 A;  2KLC A;  1YD8 U;  1YNT E;  2RMM A;  2NCN A;  2DLB A;  2KFK A;  1N62 A;  2JRI B;  4GGQ A;  3NVW A;  4DXF A;  1T6B X;  2DYO A;  3H7P B;  3I9V 1;  1WJN A;  2WDT B;  2KK8 A;  2V0G A;  4KGR A;  3IHP C;  5EE1 A;  4M8M A;  1K8R B;  1V49 A;  2MJ3 A;  4TSS A;  1P98 A;  4W9D A;  1MFW A;  2PKO A;  1AAR A;  3CST A;  1Q0W B;  3HM6 X;  1C78 A;  1KRH A;  2Y5B B;  3RN9 C;  2ZJD A;  2V3S A;  2HD5 B;  1UGM A;  2IND C;  2J4X A;  3VH4 B;  4IWP A;  4EE2 A;  2LFI A;  2NPT B;  3N1Z C;  3KWL A;  2KC1 A;  2JRH A;  2GOW A;  2GRI A;  1MHH E;  2NTT A;  3N20 C;  3GE8 C;  2HE7 A;  5IO9 A;  2MH7 A;  3P4Q B;  1P7E A;  3GS2 A;  2KVR A;  4WWO A;  1WXS A;  1QKZ A;  2N7D A;  1MHX A;  3ZJU A;  4N58 A;  5IP4 D;  3ZXR A;  4DDG D;  3H6N A;  1M94 A;  2IJ0 A;  2OHF A;  3M63 B;  1H8C A;  1EWY C;  1JWB D;  4M00 A;  3P1M A;  4B0E A;  1V2Y A;  2B3A A;  2H88 B;  2RD0 A;  1J7B A;  4HPP A;  2YLM A;  3A4R A;  1TKE A;  3PRE A;  3NG0 A;  2W82 A;  2FCN A;  1B1Z A;  3TL5 A;  4URK A;  2D3B A;  3NZS A;  2WX1 A;  4P7I A;  4ACF A;  2MW5 A;  1WXA A;  1U4A A;  2Y3A A;  1TY0 A;  1B9R A;  2JZZ A;  3DQV A;  1QLB B;  2WQY B;  4ZHO A;  2CR5 A;  2JZ3 B;  5AEK B;  4EZK A;  1NDD A;  5LXH A;  2VZK D;  3AED B;  3KUZ A;  1WMH A;  3BK2 A;  5TSS A;  3N1Y C;  2VZK B;  1V81 A;  1I4H A;  3IT6 B;  5BYS A;  1I4P A;  3B08 A;  3Q69 A;  1PUT A;  3JW0 X;  3MHS D;  4CHK A;  1TZO A;  3ZNZ B;  2L05 A;  3W1S A;  2BKF A;  1HXY D;  1N6Z A;  3OAW A;  2JZP A;  4GSW A;  2LD9 A;  2KAN A;  1KFY B;  1HEZ E;  4FUL A;  1NBF C;  1ENF A;  3GP7 A;  1VCB A;  4I6L B;  3U4E G;  4LNI A;  2WYQ A;  2ZNV B;  2PVG C;  2XN9 C;  2EEL A;  4ICV A;  2D2Q A;  1IYF A;  1ZE3 D;  3VRA B;  2O6V A;  2LGS A;  3IAS 1;  1WF9 A;  4FJZ A;  2IDY A;  2AWT A;  3TEZ A;  2M56 B;  1RWS A;  2DYM A;  2DZM A;  1UD7 A;  4WIP A;  2N9L A;  1C4P A;  1IBX B;  2KJ6 A;  1CK1 A;  2N0S B;  3CWI A;  2O6V D;  2DX5 B;  3DOW A;  1L6U A;  1XT9 B;  1XXG A;  1YMH E;  5C23 A;  2QCZ A;  4WUR A;  4RGM A;  1IBX A;  1SXT A;  4LDT D;  1ZGU B;  3DBR I;  5HHD G;  1K52 A;  1R4M I;  1T0R C;  3IFW B;  3R2I A;  1NYR A;  1OEY A;  1S3S G;  4B0M A;  2K6D B;  3AE3 B;  1DOX A;  1E90 A;  1WX7 A;  1CMX B;  4JWS C;  5DPT A;  4FJY A;  1J7A A;  3AN1 A;  2WXO A;  1ZKH A;  2LUE A;  4BFR A;  2D5G A;  3RNF C;  4DXA B;  1AYF A;  3E9S A;  4JIO U;  2GBJ A;  4XE0 A;  4W9K A;  2R2O A;  4CO7 A;  4X57 B;  2KDB A;  2NBU A;  1V9J A;  3SFD B;  2V1Y A;  3AUL A;  1MVK A;  3W9C B;  3GB1 A;  4HJG E;  3H1U A;  1IPG A;  5BMI A;  1E8X A;  3R7Q A;  1K50 A;  2K8C A;  2BWE S;  2XK5 A;  4XX5 A;  4IC7 B;  2GI9 A;  4S0R A;  2LVP A;  1MPE A;  4MGI E;  1NYQ A;  2QIL A;  4LNF A;  4W9G A;  4WQM A;  2KQ4 X;  2CU1 A;  1WRI A;  4JGH B;  1Y8R C;  1JRO A;  1EF1 A;  4XYC A;  1C4C A;  3U30 A;  2MP2 A;  4TV3 A;  1D6E C;  1UUP A;  1IGD A;  3Q3F A;  3R8B A;  1TS2 A;  3PRM B;  5IA7 A;  1PGB A;  2E6X A;  3T3N A;  2AQ3 B;  2C7H A;  3U8Z A;  3LDZ E;  2MCN B;  4AP4 C;  3DHI C;  4ANU A;  3ZDT A;  1NVI D;  4IM0 A;  3ETR A;  4FBJ B;  4JQW C;  3AE9 B;  3APD A;  3NHE B;  2DAF A;  5D3I B;  1GC7 A;  2PJH A;  4ZRK A;  3FIL B;  4EFO A;  2WU5 B;  3DPD A;  1PDX A;  4R3D A;  4K3C A;  4JWU C;  2WXP A;  3DDC B;  4EUT A;  5EDS A;  3B1L X;  2LJI A;  4QAY A;  5D3D A;  3Q8A A;  4GMV A;  1CQV A;  3QX1 A;  5FKA C;  3AE7 B;  3QCA A;  3RNB C;  1TY2 A;  3MC0 B;  1QOA A;  2GLS A;  3RCZ A;  4G50 A;  3EC8 A;  3HK0 A;  4G3X B;  2I1J A;  2IO3 B;  3BY4 B;  4NJ6 A;  4FN2 A;  2A4Z A;  2AQ2 B;  3KWV A;  3RI7 C;  1MG4 A;  3DBL I;  4P1C C;  1OQY A;  2BF8 B;  3AEB B;  3PT2 B;  3B0A A;  3AB5 A;  1ISN A;  4IWO A;  3ZO5 B;  3ZGZ A;  2SAK A;  2DZI A;  2EMT A;  3RMK C;  4WAF A;  1QQR A;  1Q10 A;  3FIL A;  1RAX A;  4HPL B;  2KLG A;  4IM3 A;  2MBB B;  2EKI A;  4D2K A;  1FXT B;  4GXB A;  5BMH A;  4XGA B;  5MPO A;  3EGR A;  3IG3 A;  2JF5 A;  2LHD A;  3SFE B;  3AE8 B;  3URY A;  3A9J B;  1YN4 A;  3KH0 A;  1H4R A;  1E9M A;  3RD2 A;  1XQQ A;  2JY6 A;  1V1O A;  4PK1 A;  1F9J A;  3GOE A;  2FUG 1;  2UWQ A;  2AL3 A;  4OZC A;  3VXW A;  1AN8 A;  2M17 A;  5IOI A;  3TUO A;  1JRP A;  2Y5C A;  1SBB B;  2K3U A;  3Q3N C;  1M4V A;  1UBQ A;  2C7M B;  4LNN A;  2MJD A;  1ESF A;  4ZRQ A;  2WP9 B;  3R66 C;  1UNS A;  1JRU A;  3EUB 2;  4RF0 A;  1WJ6 A;  1EU4 A;  4PYZ A;  2X38 A;  4UDU C;  3PPA A;  2BB5 A;  3A9K A;  4K81 A;  4PS8 A;  4A9A A;  3ZXV A;  1SEB D;  4BKG A;  1T0S C;  4JX1 C;  1RFK A;  2WXL A;  1FD6 A;  2WLB A;  1E8Y A;  1EWC A;  1I42 A;  4N59 A;  4JL9 A;  1DGJ A;  2BPS A;  3A9K B;  2PMV A;  2K25 A;  2L76 A;  5FR6 A;  2NPT A;  1KM7 A;  3V60 A;  2Y5P A;  2W9N A;  3KQ4 A;  1Z2M A;  2YVC A;  1VLB A;  2MHJ A;  3TEX A;  5LNK 1;  1A5R A;  1I4X A;  2QSD A;  1TYG B;  2IGG A;  2VRR B;  4BBN F;  2MJE A;  3OJ4 B;  4YTN B;  3L54 A;  1L2N A;  2FCS A;  4K3B A;  4KV2 A;  2L8J A;  3KLS X;  1GJZ A;  1YX6 B;  2GMI C;  1HTO A;  4DHZ B;  1MJD A;  3V3X A;  3S2A A;  1SE4 A;  3AEF B;  1YN3 A;  2X8X X;  1JWA D;  3N30 A;  2LGX A;  1WSP A;  1D5Z C;  3SU8 X;  5L83 A;  3BZD B;  2MBH A;  1XLP A;  4HEA 1;  2WX0 A;  2G9H D;  4BAX A;  4WH4 A;  4L2Y A;  1FM0 D;  2IBI B;  1ZPS A;  3UI3 A;  2ASQ A;  2J53 A;  1C76 A;  4ZOH C;  3OLM D;  4MEL A;  4KZC A;  3PTF C;  1RRB A;  4XC2 A;  2L32 A;  4MEM A;  3H7P A;  2JX5 A;  2AYO B;  4MM3 B;  4IG7 B;  1I7H A;  3Q2A C;  1SJE D;  3H7S A;  3PGE A;  3CSF A;  3DWM A;  4HKQ A;  4RNA A;  1L4D B;  3ZLZ A;  3HM3 A;  2HDE A;  3HVD A;  3QQ8 B;  3EFU A;  1J0G A;  2L3Z A;  4MDK E;  4LLG M;  4EOY A;  2BYT A;  3DBS A;  1QT9 A;  2KJH B;  1C79 A;  4B9K A;  4RGO S;  2L00 B;  5C1Z A;  1L0Y B;  3X0W A;  1J8C A;  2BBC A;  1WFY A;  2WDR B;  2D3G A;  2A5U A;  3DVN V;  4E3C A;  4RMA A;  1ROE A;  4G0N B;  4OZB A;  2C5L C;  2JYE A;  1YQB A;  3NVZ A;  3QWZ B;  2AL6 A;  2KYW A;  2W3R A;  2ICI A;  1C77 A;  1TKY A;  2KN4 A;  2ONQ A;  1FEH A;  3MC8 A;  3L08 A;  4NAW A;  1RLF A;  1JCK B;  1F1H A;  1OTR B;  2DNF A;  5C2T B;  4XWW A;  3U7Z A;  3K9O B;  1SE9 A;  4KVG B;  3O65 B;  3E56 A;  1T3Q A;  1V6E A;  3EEC A;  3NY5 A;  5J2R A;  3ML9 A;  1L6V A;  1V8C A;  1VD2 A;  4WAA A;  3NZU A;  4GOC A;  4K7S A;  4FLH A;  3OJ3 A;  2ACZ B;  2PTL A;  2QC8 A;  1WGG A;  3ONS A;  2GBM A;  4BZA A;  1DOY A;  4C56 C;  1MI0 A;  1CJE A;  3VHT C;  1JQ4 A;  4CQN A;  1E8Z A;  5JHA A;  2W54 A;  1D5M C;  3WCQ A;  1QOB A;  1QF6 A;  2VH2 A;  3AEA B;  1WGH A;  4DHJ D;  1N61 A;  2D07 B;  5BMG A;  3BYT B;  1JW9 D;  1WR1 A;  2IY1 B;  4BKT A;  3ML8 A;  4E74 A;  1UWX A;  2LMC A;  2LXC A;  2ZW1 A;  2HJ8 A;  2N7J A;  4KX6 B;  2LI5 A;  2IY0 B;  2MRP A;  2M0A A;  3BIN A;  2EKE C;  1RYJ A;  5JHB A;  1C4A A;  2Z59 B;  3P2B A;  4M02 A;  5HFY A;  2GB1 A;  2WXK A;  3L17 A;  1EF5 A;  3TJP A;  2WWZ A;  5CHF A;  1VZ8 A;  2O2V A;  2G3Q B;  2JU6 X;  1TBE A;  4RM8 A;  3VUX A;  2KMA A;  4MGZ E;  1YN5 A;  1C9F A;  2KZR A;  2K6Q A;  2K5P A;  1WI0 A;  2LGD A;  2N7E A;  4MAC A;  2NTS A;  4IM2 A;  3T3O A;  4YL8 A;  5BO4 B;  2WS3 B;  4ICU A;  3V6C B;  3ZJT A;  1I4G A;  3AE4 B;  5GMV A;  3APC A;  2RPV A;  1J19 A;  3VUY A;  3PS6 A;  1N63 A;  4KGT A;  1WX8 A;  1JWS D;  3MJW A;  2KNB A;  3MTN B;  3MFG A;  4PS7 A;  1T0Y A;  1VRA B;  5JH5 C;  2V4I B;  3WA0 A;  2WXQ A;  1F52 A;  1ZDV A;  3UF8 A;  3WAL A;  3DVG Y;  2ZEQ A;  2KX0 A;  1WYW B;  4XWT A;  2JSV X;  3UQB A;  1T0Q C;  2LGI A;  1KH0 A;  4US8 A;  4ITK A;  4MH0 E;  4GIV A;  1WMH B;  1WM3 A;  3RFZ B;  1YQ4 B;  1TS4 A;  2KQS A;  2CKH B;  4A8X C;  2RDG A;  2G45 B;  1R7S A;  2N1W A;  4OZA A;  3VTV A;  4G11 A;  3BK1 A;  2QIE B;  3NOB A;  1HZ5 A;  2GBK A;  4RH6 A;  2KXJ A;  1I4R A;  2GBN A;  2BS4 B;  4IW0 A;  2LJ5 A;  1TT5 B;  3X23 A;  2PW9 A;  4C80 A;  2KD0 A;  2EMS A;  3Q8F A;  3SD5 A;  3P4S B;  4HPM B;  2DBY A;  1TIF A;  4XDC A;  2AEH A;  4XZ4 A;  3N9Y C;  4HCP B;  4O1N A;  3A33 B;  4ZDV A;  4HXD A;  1XLO A;  2I2Y A;  3V6E B;  1S1Q B;  1AW7 A;  5DPS A;  2IZV B;  3BVZ A;  3TSS A;  4EEW A;  5FK9 C;  3RUI B;  1TZ1 A;  3C8Y A;  2PVO D;  2PLP A;  1K53 A;  1SE3 A;  4WJN A;  1X1M A;  4JE3 B;  2CHZ A;  2INC C;  4M0W B;  5D94 A;  2BTE A;  1GNU A;  2PE6 B;  3PO0 A;  1LM8 B;  5BYR A;  2YEP B;  1LFD A;  3BII D;  2Z0E B;  1TTN A;  2KDI A;  5I4D A;  3ZYY X;  4DWF A;  2ON8 A;  1FXA A;  3QIJ A;  4DHJ B;  4BOZ B;  4HLE A;  2KTR B;  3FC4 A;  1SSN A;  2FAZ A;  1V80 A;  3MP9 A;  2DHZ A;  1BUI C;  4GU2 A;  1XEE A;  2MBO A;  3V62 A;  1WE7 A;  2OED A;  2G1E A;  2JWU A;  2KDM A;  3R2T A;  3JYU A;  1WGY A;  4YTM B;  1WIA A;  3H8H A;  3WAP A;  2C7N B;  4Q2J A;  5AZG A;  1YJJ A;  4BOS C;  2D3C A;  4JPS A;  4ANV A;  2MX2 A;  2K8B A;  2K9X A;  3L4P A;  5E6N A;  4NZL B;  1FFU A;  1FIQ A;  1HA5 A;  1V1P A;  4HDO A;  4EZJ A;  4IOI E;  3AI5 A;  3UIN B;  3O13 A;  4ZRP A;  1QIL A;  3H9D A;  4F1S A;  4AUQ C;  1FMA D;  3M3J A;  2HTH A;  1IGC A;  1QZE A;  3N1X C;  5D6J B;  3OG5 A;  5IN7 A;  1IUE A;  2XEW A;  4RFB A;  1L0X B;  2FNJ B;  1LQB A;  1EU3 A;  1KLV A;  1Y56 A;  5KHO A;  2FIF A;  2REX A;  5D7G A;  1RM6 C;  2JUO A;  3RNE C;  1ZXH A;  3LJ3 A;  2RGF A;  2XNA C;  3RNC C;  4YT0 B;  1NEN B;  4NY0 A;  3IVF A;  3Q3O C;  1ZP0 B;  3DVG X;  1F2R C;  3CF6 E;  1GB1 A;  1ZW7 A;  1R4N I;  1WYG A;  2K1F A;  1UF0 A;  2G4D B;  2Z0D B;  1V86 A;  2NS5 A;  4A90 A;  1FPY A;  3B2F A;  2RDH A;  2J0M A;  2K0P A;  4NJC A;  5G5H A;  3VR9 B;  3CIR B;  2LRW A;  4HKZ E;  1TKG A;  3QAQ A;  4GDK A;  3DCG A;  3JSV A;  4MM3 A;  2J7Q B;  2WU2 B;  3DHG C;  5J17 A;  1FCC C;  4BKS A;  2CS4 A;  2I38 A;  3PSE B;  1ACC A;  1FFV A;  1K51 A;  1N60 A;  3NJT A;  3GE3 C;  2WDV B;  1WZ0 A;  3APF A; 
#chains in the Genus database with same CATH homology
 3W5U B;  2WXJ A;  2WDR B;  1ZXI A;  3HVZ A;  1QOF A;  2K22 A;  1ROE A;  3AE1 B;  1F0Z A;  4USA A;  1N5X A;  2W3S A;  2WXH A;  1TY0 A;  2Y3A A;  4OZB A;  2JYE A;  1L5P A;  1B9R A;  1QLB B;  2WQY B;  4ZHO A;  3NVZ A;  2VZK D;  3AED B;  2W3R A;  3BK2 A;  5TSS A;  2ICI A;  3RPF C;  2VZK B;  1I4H A;  3Q8E A;  3IT6 B;  5BYS A;  1I4P A;  4YXD B;  4L1B A;  1C77 A;  1TKY A;  3Q69 A;  2QMT A;  1PUT A;  2J52 A;  5E6J A;  3AEC B;  1JWU D;  2KN4 A;  1TZO A;  1TS5 A;  1FEH A;  2ONQ A;  4A55 A;  3W1S A;  2W55 A;  4ARC A;  1HXY D;  4KKJ A;  2JZP A;  2BW2 A;  3P42 A;  1JCK B;  5C2T B;  2PIA A;  4RGT A;  4XWW A;  2L52 A;  2MEK A;  1KFY B;  2WNM A;  1HEZ E;  3U7Z A;  2LHE A;  1V1P B;  2INN E;  2JXT A;  1ENF A;  3GP7 A;  3E56 A;  3U4E G;  1T3Q A;  3B2G A;  2PVG C;  2XN9 C;  2EEL A;  3IXS A;  1XCT L;  1J7C A;  1KF6 B;  1ZE3 D;  2SEB D;  3VRA B;  1GOZ A;  5AUI A;  1L6V A;  1JWM D;  1V8C A;  3P63 A;  1KLG D;  3PZ7 A;  3IAS 1;  1OQR A;  1P7F A;  3AMZ A;  1BML C;  1SF0 A;  2IDY A;  3VR8 B;  4ZHP A;  2JQR B;  2CJN A;  1XCQ L;  3U52 E;  3TEZ A;  2ACZ B;  2PTL A;  1BXT A;  2M56 B;  1RWS A;  4OW0 A;  2DYM A;  2LEK A;  4WIP A;  2N9L A;  1C4P A;  3MJ5 A;  2L83 A;  3BVG A;  1IBX B;  1CK1 A;  1DOY A;  4C56 C;  1MI0 A;  4DXG A;  2N0S B;  3CWI A;  2B76 B;  1FO4 A;  1CJE A;  4TQ1 A;  1L6U A;  2QEJ C;  1JQ4 A;  1XXG A;  1YMH E;  4FXC A;  4GDK B;  3U2S C;  4CQN A;  2AX5 A;  4WUR A;  3NVY A;  3NZ3 A;  4RGM A;  1IBX A;  2W54 A;  1SXT A;  1ZDX A;  1D5M C;  3WCQ A;  5HHD G;  1F77 A;  1K52 A;  3R2I A;  1QOB A;  1NYR A;  3AEG B;  1QF6 A;  4B0M A;  1YJI A;  3AE3 B;  1E6E B;  1DOX A;  1YQ3 B;  2IGH A;  3AEA B;  1FCL A;  1N61 A;  5BMG A;  3BYT B;  1JW9 D;  5EE9 A;  4YSZ B;  4JWS C;  1LO5 D;  4YSY B;  4AS1 A;  1L4Z B;  3AH7 A;  1J7A A;  3AN1 A;  3VRB B;  2WXO A;  1UWX A;  3I57 A;  2Z8L A;  2LMC A;  4RCO A;  2D5G A;  1WGK A;  4P16 A;  3AE5 B;  2ZW1 A;  4C7Z A;  1SIJ A;  1AYF A;  3E9S A;  1FRD A;  2N7J A;  4XE0 A;  4AQ7 A;  3DWG C;  4KX6 B;  1VDV A;  1WXQ A;  2M0A A;  1PGX A;  4ARI A;  3NVV A;  1XLQ A;  1FXI A;  3SFD B;  1DYQ A;  1RYJ A;  3W9C B;  1C4A A;  1MVK A;  3GB1 A;  3TEW A;  1SJH D;  4HJG E;  1PGA A;  5BMI A;  3NS1 A;  5HFY A;  1K50 A;  3AE6 B;  2GB1 A;  2WXK A;  3AE2 B;  4GDL B;  3W5V B;  1VZ8 A;  1SB3 C;  2FE8 A;  2JYT A;  2KAJ A;  2JU6 X;  2GI9 A;  2L1A A;  4TMA B;  1MPE A;  1N5W A;  5H8Y E;  1YN5 A;  2INP E;  1NYQ A;  2QIL A;  3IAM 1;  1C9F A;  4PT5 A;  1VZ6 A;  4WQM A;  4L23 A;  3SEB A;  2KQ4 X;  2K5P A;  1WRI A;  4MAC A;  2NTS A;  1KLU D;  3TEY A;  4OHJ A;  3AV8 A;  1JRO A;  3T3O A;  1C4C A;  1D6E C;  2WS3 B;  2QJL A;  3ZJT A;  1ZUD 2;  1I4G A;  1UUP A;  2DWQ A;  1IGD A;  3AE4 B;  3R8B A;  2M19 A;  1TS2 A;  1ET9 A;  4GLS C;  2RPV A;  1PGB A;  2E6X A;  2CJO A;  3T3N A;  2AQ3 B;  2WXG A;  1UGJ A;  1PFD A;  1HQR D;  1FNV A;  1N63 A;  4KGT A;  2V3N A;  3P4R B;  3Q8C A;  1JWS D;  1UWM A;  3MFG A;  1VRA B;  2N9K A;  1NVI D;  3AEE B;  2V4I B;  1GAQ B;  3ETR A;  2WXQ A;  3FAH A;  1ZDV A;  3AE9 B;  2TSS A;  5D3I B;  4XWT A;  2JSV X;  3FIL B;  1A70 A;  2WU5 B;  1PDX A;  4R3D A;  4J3O D;  2H89 B;  4JWU C;  2LGI A;  1D4B A;  1KH0 A;  2J42 A;  2WXP A;  4US8 A;  4ITK A;  4XDD A;  4IKG A;  3IT4 B;  1NI3 A;  1JAL A;  2BT6 A;  3ZQ4 A;  3RFZ B;  1YQ4 B;  1TS4 A;  2LJI A;  2ZW0 A;  1DOI A;  4A8X C;  4REZ A;  3Q8B A;  2RDG A;  5D3D A;  1R7S A;  4OZA A;  1AWD A;  1ET6 A;  3Q8A A;  3BK1 A;  2QIE B;  1HZ5 A;  1CQV A;  5FKA C;  4DQO C;  4RH6 A;  5G5G A;  1V97 A;  3W2D A;  1I4R A;  2KMM A;  2BS4 B;  3AE7 B;  1TY2 A;  1TJE A;  1I4Q A;  3MC0 B;  1QOA A;  4IDI A;  3LXF A;  2PW9 A;  4C80 A;  2R61 A;  2WXF A;  3J9C A;  1E10 A;  4OVZ A;  3PZ8 A;  3Q8F A;  3BYY B;  3NUH B;  2FBW B;  2AQ2 B;  3KWV A;  2V3P A;  3P4S B;  2DBY A;  4XDC A;  3N9Y C;  5HG2 A;  4O1N A;  2IGD A;  3AEB B;  2BS2 B;  3AB5 A;  5JXV A;  3ZGZ A;  5EE0 A;  2SAK A;  1XLO A;  2I2Y A;  4LTU A;  5C3J B;  1T5X D;  2AQ1 B;  4WAF A;  1QQR A;  1Q10 A;  2WXI A;  1AW7 A;  3FIL A;  4M0W A;  4RGN A;  3BVZ A;  3TSS A;  5FK9 C;  2EKI A;  5T8I A;  4D2K A;  3C8Y A;  2PVO D;  2PLP A;  1K53 A;  1E7P B;  1SE3 A;  2WXR A;  3HRD D;  5BMH A;  1E0Z A;  1GB4 A;  5MPO A;  4JE3 B;  2WDQ B;  3EGR A;  4MH8 A;  2BTE A;  1NEK B;  2LHD A;  3PO0 A;  4YSX B;  3SFE B;  5BYR A;  3AE8 B;  3URY A;  2YEP B;  1FNU A;  3BII D;  1YN4 A;  3LB8 C;  1STE A;  1E9M A;  4KKI A;  5I4D A;  3ZYY X;  3ZJV A;  1V1O A;  2ON8 A;  5BYQ A;  1FRR A;  1JML A;  1FXA A;  4H2A A;  2E3T A;  1SSN A;  3FC4 A;  2FUG 1;  4OZC A;  3MP9 A;  1AN8 A;  1BUI C;  1D5X C;  1XEE A;  1XF5 L;  3TUO A;  1JRP A;  4HRO A;  2HTM E;  1VZ7 A;  2Y5C A;  1SBB B;  2K3U A;  1M4V A;  4TQ0 A;  1OQQ A;  4YTP B;  2MJD A;  4ZYS A;  2OED A;  2G1E A;  3AM9 A;  1XLN A;  1ESF A;  1HZ6 A;  2JWU A;  2KDM A;  3R2T A;  1VJK A;  4ZRQ A;  2WP9 B;  5GXG B;  3SR6 A;  1UNS A;  4WWM A;  3EUB 2;  4RF0 A;  2KWD A;  4YTM B;  1EU4 A;  5AUK A;  3BVM A;  3H8H A;  1CZP A;  2X38 A;  4UDU C;  4Q2J A;  2BB5 A;  2NMQ A;  2Q5W D;  1YJJ A;  4A9A A;  1TS3 A;  1SEB D;  3NRZ A;  2KAC A;  2BS3 B;  4JPS A;  1WWT A;  4HRS A;  4JX1 C;  1KTK A;  1RFK A;  2WXL A;  1FD6 A;  2K9X A;  2WLB A;  3L4P A;  1EWC A;  2YEP F;  3LYY A;  4NZL B;  2WXN A;  4N59 A;  1DGJ A;  1FFU A;  1FIQ A;  3BWU D;  2PMV A;  4RF1 A;  1HA5 A;  4YWG G;  1V1P A;  1OFF A;  4IOI E;  1YNT E;  2RMM A;  2Y5P A;  2DLB A;  3HUI A;  3KQ4 A;  3O13 A;  4ZRP A;  1QIL A;  1VLB A;  1N62 A;  3TEX A;  5LNK 1;  3EA6 A;  3NVW A;  4DXF A;  4A6Q A;  1T6B X;  2DYO A;  1I4X A;  1ZOY B;  3OWE B;  2QSD A;  1FMA D;  1TYG B;  2IGG A;  3I9V 1;  2V0G A;  1IGC A;  2MJE A;  4KGR A;  4YTN B;  5EE1 A;  2IPK D;  5EE3 A;  5FR3 A;  1IUE A;  2MJ3 A;  4RFB A;  4TSS A;  1VR9 A;  1L0X B;  1XO3 A;  3KLS X;  3V05 A;  1EU3 A;  2PKO A;  1EM7 A;  1Y56 A;  4C7Y A;  1C78 A;  3V3X A;  1KRH A;  1SE2 A;  5D7G A;  1RM6 C;  1SE4 A;  3AEF B;  4NAW B;  1YN3 A;  3B9J A;  3P4P B;  1ZXH A;  1JWA D;  1FNW A;  3VQI A;  3ABV B;  1WSP A;  1D5Z C;  2J4X A;  4P6V F;  3BZD B;  2XNA C;  4EE2 A;  2LFI A;  4YT0 B;  1XLP A;  1NEN B;  3KWL A;  4HEA 1;  3MHZ A;  2G9H D;  2GRI A;  4WH4 A;  5H92 C;  1ZP0 B;  1GPX A;  1F2R C;  1MHH E;  2NTT A;  1FM0 D;  4L2Y A;  1ZPS A;  3UI3 A;  1GB1 A;  2J53 A;  4NAM A;  1C76 A;  4ZOH C;  1WYG A;  2MH7 A;  3P4Q B;  1P7E A;  2L32 A;  3GS2 A;  4A90 A;  3B2F A;  2CU3 A;  1QKZ A;  2JX5 A;  2RDH A;  4MM3 B;  1MHX A;  2K0P A;  4NJC A;  3ZJU A;  4N58 A;  5G5H A;  1I7H A;  3VR9 B;  1SJE D;  3CIR B;  2IJ0 A;  2OHF A;  3DWM A;  1TKG A;  4HKZ E;  4HKQ A;  4RNA A;  1L4D B;  1EWY C;  1JWB D;  2WXM A;  4N6E B;  2HDE A;  3HVD A;  2BB6 A;  2WU2 B;  3P1M A;  4B0E A;  2H88 B;  1J7B A;  1L0V B;  4KGS A;  1FCC C;  5HI1 A;  4LLG M;  2BYT A;  1PYW D;  1QT9 A;  1TKE A;  2I38 A;  1QOG A;  1C79 A;  4US9 A;  2W82 A;  1ACC A;  1FFV A;  1F2R I;  1K51 A;  1N60 A;  1B1Z A;  1L0Y B;  4LK0 M;  4MT5 A;  4RGO S;  2WDV B;  2BBC A;  2LUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...