5AUIA

Crystal structure of ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
96
Chain Sequence
ATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQSDQSFLDDDQIEKGFVLTCVAYPRSDKILTNQEEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Thermosynechococcus elongatus (strain bp-1)
molecule tags Electron transport
total genus 26
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5auiA00
1YJIA 3AE5B 4A9AA 1QLBB 4YTNB 4YTPB 1RWSA 1GPXA 1FXAA 3W5UB 1TKGA 1N5XA 2K9XA 5G5HA 2FBWB 2WU5B 1PFDA 1NYRA 2CJNA 2WS3B 2OHFA 1EWYC 2M19A 1RFKA 1KFYB 2DWQA 3HVZA 1DOXA 3NS1A 3PO0A 1NENB 1E10A 2H88B 1VLBA 4JX1C 3NVZA 1E0ZA 1I7HA 1N63A 3BIID 4USAA 5EE0A 3W9CB 3P4RB 1DOIA 1NYQA 3NVWA 4N58A 5AUKA 1QT9A 1FXIA 1WRIA 1VDVA 1L5PA 2N0SB 1UWMA 3EUB2 3FAHA 4LTUA 1ZXIA 4WWMA 1JW9D 2K5PA 2W55A 3AV8A 4ZOHC 3AE8B 3ETRA 1KF6B 1WYGA 3CWIA 3AE3B 1JROA 3AEGB 4C80A 1F0ZA 4IDIA 2KMMA 3AEEB 3AB5A 1XLOA 2K22A 3AM9A 2JX5A 3SFEB 2B76B 2L83A 1JWAD 1B9RA 1ROEA 2G1EA 1GAQB 1NI3A 3FC4A 1RM6C 3RPFC 3NVVA 3VR8B 2WDQB 1SB3C 3P63A 4N59A 1QOFA 2BT6A 2QJLA 1TKYA 1J7AA 1L0VB 1ZOYB 2L52A 2E3TA 3AEBB 4KX6B 1FM0D 2MJ3A 2WDRB 1JRPA 1N5WA 3VRAB 5EE9A 1WXQA 1SIJA 3AN1A 3KWLA 1PDXA 1QOBA 4YXDB 2H89B 4C7YA 2LEKA 2WLBA 1V97A 3ZYYX 1N61A 4WQMA 3AEAB 1T3QA 1TYGB 1J7CA 3DWMA 2WDVB 1CZPA 1DGJA 2CJOA 3NRZA 3P4PB 2MH7A 4YTMB 3P1MA 4US8A 2W3RA 4YSYB 1A70A 3AE7B 1FMAD 3AE4B 3B9JA 3P4SB 3AE9B 3VRBB 1XLNA 3VR9B 1YJJA 1N62A 1SF0A 5C2TB 3L4PA 3AEDB 1CJEA 1FRDA 5GXGB 2WU2B 3LXFA 1V8CA 2DBYA 3HUIA 1E9MA 3SR6A 4P6VF 2CU3A 3AE6B 3CIRB 3NVYA 5H8YE 3ABVB 2JQRB 3DWGC 5EE3A 4N6EB 4YSZB 1J7BA 4JWUC 2W54A 2AX5A 2Y5CA 1QF6A 2BS2B 3AE1B 1WWTA 1JWBD 2PKOA 2W3SA 2WP9B 1JALA 2MJDA 4JWSC 4US9A 4YT0B 1ZP0B 2M56B 3P4QB 3SFDB 1FO4A 1FIQA 2WQYB 1FFUA 4FXCA 1OFFA 2MJEA 4C7ZA 1KRHA 3AMZA 4ZHOA 1JQ4A 1FRRA 1NVID 2QIEB 2PIAA 3HRDD 5AUIA 5H92C 1XLQA 3B2GA 2Q5WD 4HRSA 1QOAA 2BS4B 3LB8C 1TJEA 1PUTA 3AECB 5G5GA 5C3JB 5MPOA 1DOYA 1XLPA 1N60A 3AH7A 1FFVA 3B2FA 1TKEA 2EKIA 4YSXB 1OQRA 1IUEA 1ZUD2 1AYFA 1L6UA 2ACZB 2PVGC 1E6EB 4HROA 1YQ3B 5EE1A 1WGKA 3W5VB 2BS3B 3AEFB 1YQ4B 2KAJA 3WCQA 1XO3A 1RYJA 1E7PB 1AWDA 1VJKA 4ITKA 2PVOD 1NEKB 1QOGA 3AE2B 2HTME 4ZHPA 1R7SA 1L6VA 1OQQA
chains in the Genus database with same CATH superfamily
3ZIMA 1FXAA 4XYCA 4B0EA 4XDDA 1NYRA 3PVLA 1DOXA 4P7IA 1QQRA 4OZBA 5TSSA 2LRUA 4TV3A 2MA9B 1YMHE 3BIID 1ESFA 1VDVA 1OGWA 4WWMA 2WXFA 4XE0A 5CX3A 1NDDA 3AE3B 2OJRA 3L54A 4RH6A 2VZKB 2KTRB 1V80A 3GB1A 4FHKA 1OEYJ 2JRHA 2WXKA 3FC4A 1TY0A 3Q14C 1ZGUB 1V1PB 3TEXA 2KFKB 2LHDA 2WDRB 1WJNA 2LMCA 3D32A 3BVGA 4HKQA 2GBJA 3DWMA 1MG8A 1YN5A 4DK5A 2JPHA 3Q8CA 1WZ0A 1T0RC 1YOVB 1TZ1A 3L4PA 3AEDB 2KQSA 2JUOA 3RUIB 1FRDA 3PS6A 2D5GA 4RGMA 3WAMA 1VZ6A 5JHAA 4URKA 2BBCA 2JQRB 3T9LA 2J52A 4GXBA 4GDLA 4ANVA 2DZMA 2WP9B 2G45B 2ZCCA 3MP9A 3TEWA 1FIQA 2HDEA 5D7GA 2MJEA 4C7ZA 1JQ4A 2KDEB 2W82A 4ZRJA 3R66C 2PPHA 2PJHA 3U7ZA 4OZCA 2A4ZA 4PK1A 4WH4A 2KQ7A 4KV2A 3TJPA 1WR1A 1AN8A 4G0NB 2WDTB 3W5VB 3AEFB 2KAJA 4PYZA 2VRRB 2KLCA 1KTKA 3KUDB 4WAFA 1OQQA 2DAJA 2IY0B 4FULA 3AXCA 4NY0A 3ZNHB 2L05A 2Z0EB 1H4RA 3CSTA 3HM3A 3UQBA 3N3KB 1V81A 2LGDA 3V61A 2PW9A 1KFYB 2NTTA 3PHWB 4IW0A 3L13A 1N63A 1Z5SB 1P1AA 3N20C 2WXPA 1L2NA 3PSEB 3DHIC 3ZLZA 2A5UA 1NI2A 3ZNZB 4OVZA 1OTRB 1GB4A 2FCMA 1YQBA 1D3ZA 3MC0B 4HK2A 2C7NB 3KWVA 2IGHA 2LZ6A 4PYUA 1GC6A 5HG2A 2DYBA 3V60A 2FCQA 4GDLB 2MP2A 4F1SA 4PT5A 3DHGC 2NPTB 5IA7A 4MGYE 2REXA 1WX8A 3VTVA 1WXQA 3KYCD 4F8CB 2CR5A 4KIKB 4LNFA 2WDVB 4KGSA 1V9JA 1N62A 1E8ZA 4W9EA 3JVZX 1Q0WB 1GOZA 4NNJB 2O6VB 4HJGE 1J0GA 5LXHA 2LXCA 2C9WB 2Y5CA 2IBIB 1WF9A 3HIZA 4GU2A 3GP7A 2I2YA 4BOZB 1WJUA 1SBBB 4UDUC 5AZHA 2PVGC 1WMHB 2WXMA 2IZVB 1WRDB 5IN7A 2EELA 2I1JA 5KHOA 2I38A 3TCAA 2AL6A 3AULA 4GB9A 2V0GA 1RWSA 2NMQA 4WIPA 1MI0A 5E6JA 2RDHA 1RFKA 1E7VA 2SAKA 3ZTCA 2KFJA 2X38A 4LJPB 4MACA 1B1ZA 3VH3B 2KWCA 2FE8A 4BBNF 2ZW1A 1PQSA 3TL5A 3CF6E 4GSWA 3ECIA 4EZJA 2Z59B 2JWZA 2CS4A 3AEGB 2E6XA 4IDIA 1H8CA 5HKHA 2K22A 1ACCA 1I4XA 1XT9B 4D2KA 3A1QA 1GAQB 3O65B 3WAPA 3C0RB 2WXRA 4N59A 4BBNC 2KYWA 4Q2JA 4WJQA 1PGBA 5IAAC 3I57A 4MH0E 3GE3C 2DENB 2W3RA 1XLNA 4R3DA 3UIPB 4EUTA 3IHPC 4LNKA 2KO3A 1V8CA 3PHXB 5D3IB 3E56A 4MGZE 3CIRB 3ABVB 1P9DU 2WNMA 5EE3A 1D5ZC 2D11A 3Q8FA 2KXJA 4MH8A 3AE1B 1WWTA 2INDC 4YT0B 4K7UA 1R4NI 4L23A 3MC8A 5FR6A 4KDIC 1K52A 3HRDD 3UI3A 1VD2A 4LLGM 3B2GA 2N9PC 4PS7A 1WGRA 4KGTA 5J18A 4MSMB 3VHTC 2V4IB 2D2QA 1CK1A 1G6JA 3H7PB 3MC9A 2IJ0A 2DX5B 3A1QB 4MDKE 1L6VA 3QK0A 4E71A 3OWEB 2FBWB 3JSVB 1SE9A 2IO3B 1NENB 1MFWA 4WWPA 3I9V1 1YN4A 3HHMA 2HE7A 2AYOB 3PLVA 4G50A 5AUKA 3N1ZC 1QT9A 2CHWA 4YL8A 3K9PB 4KSLC 4MM3A 1JW9D 3AV8A 4B6WA 3ETRA 3VAWA 3RNCC 4LJOB 1V5OA 1XQQA 4AP4C 4M0WB 1FNWA 3SFEB 1JCKB 4CHKA 2ZZPB 1RM6C 1TZOA 3A33B 4IC7B 4RM9A 2WHIA 1WSPA 2GBKA 1KLVA 1JRPA 4RCOA 3WIMA 2GMIC 3R3MA 3V6CB 3FILB 4YWGG 1QZEA 2ZNVB 4XWTA 2RGFA 4YTMB 4W9HA 4YSYB 3P4SB 3DVNV 3AE9B 5GMVA 2LVQA 4W9JA 4I6NB 1CJEA 2LJ5A 3QCAA 1MJDA 2GOWA 4W9GA 2KDFB 1V6EA 1E90A 3PLUA 3PZ7A 3RNAC 4EEWA 2W3SA 3DVGX 2FUHB 2MJDA 1ZP0B 4DQOC 4EFOA 1GC7A 2BQQA 4XDCA 2QIEB 2KWUB 3ZUNA 3TMPB 1QOAA 1PUTA 1WE6A 2M1MA 4IM2A 4ZRKA 4RGOS 1AYFA 3GOEA 4QAYA 2WGSA 2EMSA 5CHWA 3AE2B 3PT2B 2KHWB 4IM3A 1DYQA 3APDA 3W5UB 1IBXA 3PRMB 2FCNA 2K9XA 3H8HA 1HZ5A 4FN2A 3HM6X 3TUOA 5J2RA 1SXTA 1E0ZA 4HLEA 1NYQA 4JPSA 1ZPSA 3Q3OC 2KDMA 2IGGA 4ARCA 2KTFA 1C78A 1K53A 1KF6B 3ZQ4A 4K3BA 1I4PA 2D3GA 4W9DA 3AM9A 1C9FA 4A20A 1HXYD 4DDID 4K81A 2K0PA 2W9NA 3QWZB 4BKTA 3CMMB 1JWUD 1UGMA 1L0VB 2IYDB 4KX6B 1HEZE 3ZVVA 1WGDA 3VDZA 1WXSA 2QCZA 1F52A 1T3QA 1CZPA 3Q8AA 2CJOA 2UYZB 3P4PB 4ZRIA 3RMKC 2VH1A 4OVUA 5T8IA 1LM8B 3L08A 1F2RC 1M94A 4HPPA 4W9CA 4KGRA 2IY1B 2MX2A 2KDIA 2G4DB 2AEHA 2PLPA 4FBJB 3BVZA 3JYUA 2JU6X 3NS8A 4GIVA 2MHJA 3ZKJC 1QF6A 2ZNVC 2K6QA 2FIDA 4BKSA 3VUXA 2QSDA 1E5WA 2FIFA 2NBVB 4HCNB 1E8YA 5AUIA 2CKHB 2ZPNA 1XLQA 1SE4A 3NZUA 2MEKA 5LLIA 2ZVNA 3B0AA 3UQAA 5C23A 1F1HA 4BOSC 2KX3A 3PPAA 4L1BA 2KTRA 5EE1A 1WGKA 4RGTA 3GZNI 2BS3B 4ITKA 3ZJVA 2HTME 1WI0A 1WH3A 3DBLI 5GXGB 3DBHB 1QLBB 1V1PA 3BYTB 4LCDE 2KFKA 1PFDA 3N9YC 2M19A 2HJ8A 2Y3AA 3PO0A 3R7RA 3L17A 1KLUD 3BWUD 3RNFC 3E9SA 3NVZA 1JMLA 3DBRI 4OVVA 1Q1OA 3W9CB 4N58A 4ZRPA 2JT4B 2DNFA 5CHVC 2KNBA 2ASQA 3UINB 2LFIA 2W55A 4ZOHC 3IAM1 2KN5A 4PS8A 2BW2A 4K7WA 2GBNA 1T6BX 2CHXA 2B76B 5CHFA 3I63C 3AU5A 1WX9A 3APCA 3I5JC 2L0FA 3EFCA 2JVCA 2L52A 4FADA 2E3TA 2KMCA 1TS5A 1K51A 5BMGA 2QEJC 3SU8X 4IOIE 4US8A 2FNJB 1QILA 1I4GA 1SE2A 5HHDG 3TEZA 4WJOA 4ACFA 2XK5B 1UGJA 5DPRA 2M0AA 4GOCA 2DBYA 3SR6A 4AJYB 3URYA 3L16A 4NAMA 1ENFA 4YSZB 3H9DA 5BYRA 1S3SG 3OJ3A 3NZSA 1JALA 2JRIB 3SFDB 1IGCA 2KOXA 3RT3B 2WX0A 1D5MC 1CQVA 1EWCA 3Q8BA 1T0YA 3TIXA 1FXTB 3IG3A 2UWQA 2ACZB 1F9JA 2N9EB 2V3SA 4HCPB 1UF0A 2K8CA 1JWMD 1EUVB 2D3BA 1XCQL 5IO9A 1NEKB 3V62A 2NPTA 2QDFA 2LUEA 1GJZA 2L76A 2M4NA 5L83A 1YJIA 3V05A 4A9AA 4CO7A 1ET6A 4RGNA 4MGIE 4W9IA 1WM2A 2XEWA 2WU5B 4JL9A 3A9KB 1EWYC 1K8RB 3KH0A 4KIKA 4IM0A 5FK9C 3B08A 1ZDXA 1I7HA 4KZ0A 4TQ1A 2BKFA 1L5PA 4LTUA 1ZXIA 1HE8A 1GNUA 1MHXA 1SEBD 4WJPA 3ZGZA 1C3TA 2KACA 2KK8A 2FAZA 2V3PA 2O6VA 2KWDA 1L0YB 2L0TA 3VVWB 2BYFA 2G1EA 1V2YA 4TUUA 1NI3A 5JXVA 1BMLC 1SB3C 3P63A 4KVGB 3R7QA 1D4BA 2BKRB 2C5LC 1P7EA 4MT5A 2C7MB 3AU4A 2K39A 2L32A 1V49A 1IYFA 4AS1A 1WMHA 3KW5B 4WAAA 3AE7B 3VRBB 3WAOA 1KOTA 2D3AA 1SF0A 2INPE 2V3NA 2MW5A 5JHBA 2LGIA 2KMAA 2WU2B 2O2VB 1HQRD 4IUMB 4XC2A 2LUMA 4US9A 4RFBA 2M56B 2L7RA 2VZKD 2DZJA 3Q3MC 3IAS1 4ZHOA 3QQ8B 2M17A 4OW0A 2EKEC 4A3OA 4FJVB 1TGZB 5E6OA 3BVMA 2DHZA 4GLSC 1P98A 2MBEA 1L6UA 1L4ZB 4WURA 1E6EB 2AL3A 3M63B 2K6DB 3WCQA 4WJNA 1QOGA 4WWOA 4RMAA 3VXWA 3GE8C 3N30A 4YTPB 1GPXA 3VTWA 3DVNU 1N5XA 2OHFA 1I4HA 1LXDA 3NS1A 3KYDD 3DDCB 2RDBC 3S2AA 2MBOA 3MHSD 3U8ZA 2LRWA 2SEBD 5BYSA 3CWIA 3SHQA 2K8BA 5J17A 2KN4A 5IP4D 2L83A 3NVVA 3DQVA 4K3CA 2FUG1 2QJLA 2KVRA 4M01A 1XCTL 3KUZA 4XX5A 3AN1A 3APFA 4A55A 1PDXA 2H89B 2BVCA 3ZYYX 4DXAB 3Q8EA 4AJWA 4P1CC 3H7PA 3IT6B 3Q6BA 4K7SA 5G55A 3L10B 4BAXA 4ASWC 3JSVA 1JRUA 2N1WA 4W9KA 3T3NA 1Y56A 2DLBA 2PKOA 4EOYA 3PRZA 2J0MA 1FFUA 2KD0A 4ZDVA 1FRRA 2NBUA 4REZA 2JY6A 1I42A 2PE9A 2BS4B 3LB8C 5BMIA 3R2TA 5C1ZA 3B2FA 2G3QB 3Q69A 1ZUD2 1WY8A 3B1LX 2KC2A 4ZRQA 1WM3A 2DZIA 4M0WA 1T0QC 2UU7A 4C00A 4KKIA 1VJKA 1OEYA 4C56C 4DHJB 2M0XA 3DOWA 3RZFA 4JIOU 3WA0A 1TKGA 2LHEA 1LGRA 3GS2A 2DWQA 1AARA 3FILA 4FJYA 1VR9A 4AUQC 5LXIB 2FCSA 1R4NB 3NG0A 4L2YA 4USAA 2HTHA 3UGBB 3NUHB 1RAXA 4X57B 2J42A 2N4FA 1WGYA 3NJTA 1UD7A 1R4MI 3ZRCA 4TMAB 1RFAA 2JXTA 4EE2A 3P2BA 1ZE3D 2JYEA 3OG5A 3VR8B 1QOFA 2WXGA 1ZOYB 5DPWA 4HKZE 1N5WA 5EE9A 2WLBA 3UF8A 1J7CA 2KT7A 3DHHC 2B3AA 2N7EA 2K8HA 2YEPF 1NBFC 1FMAD 3AE4B 4S17A 1ZKHA 3NY5A 3X23A 2JZPA 1FEHA 5AEKB 3LXFA 5H8YE 4O1NA 2RDGA 2BS2B 2MBHA 3ZXVA 3PZ8A 1FO4A 4I6PA 1F77A 4RNAA 3PREA 2L8JA 2WXQA 3AECB 1ISNA 1N60A 3W1SC 2V4LA 4LNNA 5JH5C 4AQ7A 1XF5L 1AW7A 4B95A 2J0KA 3IXSA 2NS5A 1B9RA 3IBEA 5DPTA 2Z8LA 4YTNB 1YJ1A 1EM7A 3QIJA 2WS3B 2WYQA 1TS4A 4XZ4A 1BXTA 1LFDA 1P0RA 3U4EG 2WX1A 1E8XA 4NJ7A 2D07B 5EE0A 1DOIA 2CHZA 2ZCBA 2N0SB 1UWMA 1LQBA 3DVGY 1EF1A 3ENEA 1EO6A 4J6IA 1JROA 4JQWC 4IG7B 3N1XC 1UNSA 2KMMA 2KJRA 2JX5A 3LJ3A 1ROEA 4A90A 1WGHA 3RPFC 2KJ6A 2LVOA 3MJ5A 1TKYA 1IGDA 3U30A 5BMHA 1TY2A 4ANWA 1KLGD 1ZDVA 1L0XB 1FPYA 1TS3A 1TYGB 1DGJA 2V1YA 3LYYA 2INCC 1YD8U 2Y5PA 3VR9B 2M8SA 2MSED 3M95A 3KUCB 1ZXHA 2GBMA 4RF1A 3NVYA 4A8XC 3QC8B 1VZ7A 4H2AA 2RD0A 1JWBD 4JWSC 4BVUC 4K1RB 2WQYB 4LDTD 2WXIA 1FCCC 3VH4B 2PE6B 1BT0A 5C3JB 1XLPA 1TKEA 2Y5BB 1CMXB 5BYQA 1PGAA 5D2MB 1TBEA 2BPSA 1E8WA 3SDLC 4BKGA 3M3JA 1Q5WB 5CTRC 3VUWA 2BYVE 2JZZA 3EC8A 3NOBA 3H6NA 2MQJA 4IWOA 3HVZA 3KVFB 1VLBA 4JX1C 5LNK1 2BYEA 1UWXA 3FKYA 3A9JB 2PMVA 2XK5A 2K5PA 2NTSA 3QA8A 3AB5A 1MG4A 1TS2A 4ZYNA 3GZNB 2LXAA 2AQ1B 4W9FA 4IKGA 4FJZA 3DBLB 1M4VA 3TSSA 1I4RA 3N1YC 4NAWA 4G3XB 2V9HA 2LWPA 4G11A 3VRAB 2KLGA 3AEAB 1WGGA 3DBRB 2MH7A 4B9KA 3L0WB 3C19A 4RF0A 2MBQA 2YVCA 3I3TB 4XWWA 1N6ZA 3CSFA 3AE6B 1BUIC 4WWNA 2KJHB 4DWFA 2AX5A 3A9KA 3ZW3A 1C77A 1KM7A 1I4QA 2HJ1A 1C4AA 3P4QB 4FXCA 5L95C 1NVID 1TT5B 4AOFA 1D6EC 2LI5A 2L3ZA 4M02A 4DXGA 5E6NA 4FLHA 1OQRA 2OOBB 3BINA 4P1BC 3TBLD 4HWIB 1XO3A 3P42A 2WXJA 2PVOD 3PGEA 2WXLA 3QJZA 5G2NA 2BTEA 4NAWB 1Y8RC 1E10A 3N32A 2J7QB 4HVBA 4ZYSA 2GB1A 2RR9A 4GDKA 2N9LA 2LD9A 2D3CA 4MJSB 3T8MA 2N9XA 1JWSD 1VRAB 2O2VA 3ZXRA 5FKAC 2J53A 2DYMA 3PV1A 3QARA 2BB6A 2LASA 3Q3JA 2PTLA 2BYTA 3AEBB 3TEYA 2INNE 1EU3A 1RRBA 5JZEB 1EF5A 3KWLA 4I6LB 1T5XD 3OLMD 2XN9C 1WXAA 1A70A 3A4SC 3ZNID 2KC1A 3LDZE 1PGXA 3PZDA 3VFKA 1UELA 4EZLA 1VCBA 3BZDB 3VUYA 4N6EB 1YX5B 3OJ4B 4KDLB 5DCNA 1WR6E 3ALBA 2LGSA 2ON8A 1HZ6A 3RNGC 2K1FA 2QHOA 3AMZA 1LO5D 2PIAA 2KX0A 4GDKB 4HRSA 3RD2A 4JLCA 5MPOA 4NQKE 4BKSD 1SSNA 4HPLB 1UZXB 1YNTE 1WX7A 1V5TA 1YQ4B 2DAFA 1RYJA 2IDYA 1C79A 2NVUI 2BF8B 3MFGA 1HA5A 5HI1A 2ZEQA 4ICUA 2CJNA 3ZTDA 1SGHA 4S0RA 5IKCM 1TIFA 1HTQA 4M00A 2EMTA 3FAHA 1I35A 4KZCA 2GRIA 1GB1A 2ONQA 1J19A 2R61A 3QX1A 4C80A 1F0ZA 4JGHB 4AWJA 3W1SA 4M8NA 1RLFA 3RFZB 1PYWD 2JF5A 2KWVB 5E6PA 4XGAB 1UH6A 2J4XA 2JXXA 1SIJA 3H7SA 2AWTA 1MVKA 4IWQA 2LEKA 3V6EB 4LNIA 4EZKA 2GI9A 2K25A 4A3PA 1L4DB 3P1MA 4GMVA 4IWPA 4NJ6A 4W9LA 1IP9A 2KZRA 5D6JB 5C2TB 2ZVOA 1TTNA 3EHVA 1GUAB 2CU3A 2R2OA 3PTFC 1WXMA 4DHZB 2IO0B 1J7BA 1GG3A 4JWUC 2BGFA 2K3UA 1QKZA 2MP2B 3SD5A 1V1OA 2LGYA 2YEPB 3Q2AC 2YLMA 3OAWA 3Q3NC 4DDGD 1WZ3A 4KKJA 1WIAA 2R2QA 1FFVA 3ZNGC 1WJ4A 2EKIA 4YSXB 4TQ0A 1YQ3B 3KLSX 4GN1A 1FNUA 1E7PB 1AWDA 2L00B 1SJHD 4ZHPA 2D10A 2KVZA 5I4DA 2WWZA 4TSSA 1YN3A 3IVFA 1E7UA 2ZW0A 5G5HA 5IOIA 4DBGA 2I1KA 1UBIA 3J9CA 2BWES 4HXDA 3DBSA 3P4RB 3NVWA 4HDQA 3JW0X 2X8XX 3HK0A 3EUB2 2L1AA 4HJKA 5HFYA 3ZJUA 5FR3A 2C60A 4DXFA 1UBQA 2MLBA 3NHEB 2O6VD 2HD5B 1J7AA 2JYTA 3EECA 2WXOA 3QAQA 1P3QU 1N61A 4WQMA 4EKUA 2IPKD 2WXNA 3X0WA 2ICIA 5AZFA 4LNOA 3NZ3A 1IPGA 4FHJA 1R4MB 4NPNA 3MTNB 3RNBC 4HPMB 5D94A 3VQIA 3RZWC 3DWGC 4RM8A 3PRPB 2LJIA 2W54A 2QC8A 2KKCA 3RN9C 1SE3A 3T3OA 5KHQA 1ZW7A 2J0JA 1KRHA 2ZJDA 1V86A 4MELA 1DOYA 5G5GA 4N9F4 4MEMA 1C76A 3AH7A 2JWUA 2NBWB 4KSKC 1SJED 3RYTA 3K9OB 4P16A 4F7ZA 3U2SC 3WANA 1OQYA 2QILA 1MPEA 1F2RI 3AE5B 3EGRA 4ICVA 1VZ8A 4LK0M 4LDTB 2C7HA 2BWFA 1STEA 2KDBA 4OHJA 1WE7A 4PS3A 1WRIA 3WALA 1D5XC 1WYGA 2KQ4X 3ZDTA 1EU4A 1XLOA 2XNAC 5EDSA 1FD6A 4JE3B 4MGKE 1P7FA 3RI7C 2LGXA 2MCNB 3BK2A 4NJCA 4C4VA 4CQNA 1FM0D 2MJ3A 4DHJD 3M62B 1QOBA 4YXDB 4ANUA 2MBBB 2JSVX 3ML9A 2TSSA 1C1YB 1YJJA 3EA6A 3V3XA 1J8CA 4MM3B 2QMTA 3HUIA 4WQOB 2RPQA 1YX6B 1XEEA 3UIOB 3Q3FA 1S1QB 1T0SC 4HDOA 3R2IA 4M8MA 1XD3B 3MJWA 2PEAA 2MWSB 3A9JA 3ML8A 4BFRA 2Q5WD 1TJEA 3C8YA 4A6QA 4II3B 2NCNA 5BO4B 3ZDMC 4ARIA 2N7DA 1X1MA 3U52E 2G9HD 4II2B 4J3OD 3BK1A 4HROA 2OJWA 2N7JA 1R7SA 3DCGA 3DPDA 1Q10A 3BY4B 4C4VB 2DYOA 2IO2B 5AZGA 2NR2A 1KJTA 2H88B 4MSQB 3RCZA 4CYEA 2DZKA 2KANA 1FXIA 3W1YA 2GLSA 2RSUA 4DHZE 1YIWA 3EFUA 2N1VA 3U7DA 3AE8B 5TR5A 1FNVA 1WJ6A 1Z2MA 5D3DA 3AEEB 1L7YA 2XBBC 2WXHA 5DPSA 1C4CA 1UUPA 2AQ3B 1WXVA 3RNEC 1JWAD 4NQLB 1SIFA 1KH0A 2WDQB 3IFWB 2BT6A 1IBXB 2VH2A 4GGQA 3AI5A 4C7YA 4E3CA 1K50A 1V97A 4ANXA 2AQ2B 3KQ4A 3NRZA 4NZLB 3ZJTA 3VTUA 1XXGA 3O13A 2ZPYA 3B9JA 3BYYB 3ZO5B 3ZRFA 1FCLA 3IT4B 3ONSA 3DBHI 3RULA 1E9MA 1WYWB 2OEDA 4P6VF 1C4PA 2JZ3B 4TKNA 3QHTA 2G4SA 1HTOA 3SEBA 2Z0DB 1A5RA 2CU1A 1OFFA 2LVPA 2BB5A 4BZAA 3HVDA 2IGDA 2RPVA 5H92C 3A4RA 3MHZA 2IO1B 1WFYA 2RMMA 4MJSA 1MHHE 1ET9A 3H1UA 1IUEA 3R8BA 4E74A 4HEA1 2GBRA 1U4AA 3W2DA 4FA6A 2N9KA 4OZAA 2MRPA 4B0MA
chains in the Genus database with same CATH topology
5HI1A 1DYQA 1FXAA 3W5UB 4B0EA 1IBXA 4XDDA 1TKGA 2K9XA 2LHEA 3H8HA 1HZ5A 1NYRA 2CJNA 3GS2A 3TUOA 2DWQA 1DOXA 3FILA 1VR9A 1SXTA 1QQRA 4OZBA 5TSSA 1E0ZA 1YMHE 3BIID 4L2YA 4USAA 1ESFA 1NYQA 4JPSA 1ZPSA 3NUHB 1VDVA 2KDMA 2IGGA 3FAHA 4WWMA 2WXFA 4ARCA 2GRIA 1GB1A 2J42A 2ONQA 4XE0A 1C78A 1K53A 2R61A 1KF6B 3ZQ4A 3AE3B 4C80A 1I4PA 1F0ZA 4TMAB 4RH6A 2VZKB 3W1SA 3AM9A 3GB1A 1C9FA 2JXTA 4EE2A 3RFZB 1PYWD 1HXYD 1ZE3D 2WXKA 3FC4A 1TY0A 2JYEA 2K0PA 3VR8B 1JWUD 1V1PB 1QOFA 2WXGA 2J4XA 1ZOYB 1L0VB 3TEXA 4KX6B 2LHDA 1HEZE 2WDRB 1N5WA 4HKZE 5EE9A 2LMCA 1SIJA 3BVGA 1MVKA 2LEKA 2WLBA 4HKQA 2GI9A 1J7CA 1T3QA 3DWMA 1YN5A 1L4DB 1CZPA 3Q8AA 2CJOA 2YEPF 3P4PB 3Q8CA 3P1MA 1FMAD 3AE4B 5T8IA 1F2RC 2JZPA 1FEHA 3L4PA 5C2TB 3AEDB 1FRDA 4KGRA 3LXFA 2D5GA 4RGMA 2CU3A 2PLPA 1VZ6A 5H8YE 2BBCA 3BVZA 2JQRB 4O1NA 2JU6X 2J52A 1J7BA 2RDGA 4JWUC 2K3UA 1QF6A 2BS2B 1QKZA 2WP9B 3PZ8A 3MP9A 3TEWA 1FO4A 1FIQA 2HDEA 5D7GA 1F77A 2MJEA 2QSDA 4C7ZA 1V1OA 1JQ4A 2W82A 4RNAA 2YEPB 5AUIA 1XLQA 2WXQA 1SE4A 4KKJA 3AECB 2MEKA 1N60A 1FFVA 3U7ZA 2EKIA 4YSXB 4OZCA 4WH4A 4TQ0A 1AN8A 1YQ3B 3KLSX 4L1BA 5EE1A 1WGKA 4RGTA 3W5VB 4AQ7A 2BS3B 3AEFB 2KAJA 1XF5L 1AW7A 1FNUA 1E7PB 1AWDA 4ITKA 3ZJVA 1SJHD 2HTME 3IXSA 4ZHPA 1KTKA 4WAFA 5GXGB 1OQQA 1B9RA 5I4DA 1QLBB 1V1PA 3BYTB 2Z8LA 4TSSA 4YTNB 1YN3A 2ZW0A 5G5HA 1EM7A 1PFDA 2WS3B 3N9YC 2M19A 2PW9A 1TS4A 1KFYB 2Y3AA 1BXTA 3PO0A 3U4EG 1KLUD 2NTTA 3BWUD 3J9CA 3E9SA 3NVZA 1JMLA 1N63A 5EE0A 3W9CB 3P4RB 1DOIA 2WXPA 3NVWA 4N58A 4ZRPA 2N0SB 1UWMA 3EUB2 2LFIA 2W55A 2L1AA 5HFYA 3ZJUA 4ZOHC 3IAM1 4OVZA 1GB4A 2BW2A 1JROA 5FR3A 1UNSA 2KMMA 3MC0B 3KWVA 1T6BX 2IGHA 5HG2A 2JX5A 2B76B 1ROEA 4GDLB 4A90A 4DXFA 4PT5A 3RPFC 3MJ5A 1TKYA 1J7AA 1IGDA 2L52A 2JYTA 2E3TA 5BMHA 1WXQA 2WXOA 1TY2A 1TS5A 1K51A 1N61A 4WQMA 1KLGD 1ZDVA 5BMGA 1L0XB 1TS3A 1TYGB 2QEJC 2WDVB 2IPKD 4IOIE 2WXNA 1DGJA 4KGSA 3LYYA 4US8A 1QILA 1I4GA 1SE2A 2ICIA 5HHDG 3TEZA 2Y5PA 3VR9B 1N62A 3NZ3A 1UGJA 2M0AA 2DBYA 3SR6A 1ZXHA 1GOZA 4RF1A 3NVYA 3URYA 3VQIA 4NAMA 1ENFA 4HJGE 4YSZB 3DWGC 5BYRA 2LJIA 2W54A 4A8XC 2Y5CA 1VZ7A 4H2AA 1JWBD 4JWSC 1JALA 3SFDB 1SE3A 1IGCA 2WQYB 3T3OA 1KRHA 2WXIA 1FCCC 1D5MC 3GP7A 1CQVA 1EWCA 1DOYA 2I2YA 5G5GA 5C3JB 1XLPA 3Q8BA 1C76A 3AH7A 2JWUA 1TKEA 1SJED 1SBBB 4UDUC 4P16A 2ACZB 2PVGC 5BYQA 2WXMA 1PGAA 3U2SC 1JWMD 1XCQL 1NEKB 2EELA 2QILA 1MPEA 1F2RI 2I38A 1YJIA 3AE5B 3EGRA 3V05A 4A9AA 2V0GA 1RWSA 1VZ8A 4LK0M 2NMQA 1ET6A 4RGNA 4WIPA 2WU5B 1MI0A 5E6JA 2RDHA 1EWYC 1RFKA 3HVZA 5FK9C 2SAKA 1ZDXA 1VLBA 4JX1C 1STEA 2X38A 5LNK1 1I7HA 4MACA 1B1ZA 1UWXA 4OHJA 2FE8A 2ZW1A 4TQ1A 1WRIA 1L5PA 2PMVA 4LTUA 1ZXIA 2K5PA 1D5XC 1MHXA 1SEBD 2NTSA 3ZGZA 1WYGA 2KQ4X 3AEGB 2E6XA 4IDIA 2KACA 1EU4A 2V3PA 3AB5A 1TS2A 1XLOA 2XNAC 2K22A 1ACCA 2KWDA 2AQ1B 1L0YB 1I4XA 1FD6A 4JE3B 2G1EA 4D2KA 1GAQB 1NI3A 1P7FA 4IKGA 5JXVA 1BMLC 1SB3C 2WXRA 1M4VA 3P63A 1D4BA 4N59A 4Q2JA 1P7EA 3TSSA 3BK2A 1I4RA 4MT5A 4NJCA 4CQNA 1PGBA 1FM0D 2MJ3A 3VRAB 2L32A 1QOBA 4YXDB 3AEAB 3I57A 4AS1A 2JSVX 2MH7A 2TSSA 2W3RA 3AE7B 3VRBB 4RF0A 1XLNA 1YJJA 3EA6A 3V3XA 1SF0A 2INPE 2V3NA 4MM3B 2LGIA 4R3DA 2QMTA 4XWWA 2WU2B 1V8CA 3HUIA 5D3IB 3E56A 3AE6B 1HQRD 1BUIC 3CIRB 3ABVB 2WNMA 5EE3A 1D5ZC 3Q8FA 1XEEA 2AX5A 4MH8A 1C77A 1WWTA 2LUMA 3AE1B 1I4QA 4US9A 4YT0B 4RFBA 1C4AA 2M56B 3P4QB 3R2IA 4FXCA 2VZKD 4L23A 3IAS1 4ZHOA 1K52A 1NVID 3HRDD 4OW0A 3UI3A 4LLGM 3B2GA 2Q5WD 1D6EC 1TJEA 4DXGA 3C8YA 4A6QA 4ARIA 3U52E 4KGTA 1OQRA 2G9HD 3BVMA 4GLSC 1L6UA 3BK1A 1L4ZB 4J3OD 1E6EB 2V4IB 4HROA 4WURA 1CK1A 2N7JA 3WCQA 2IJ0A 1XO3A 3P42A 2WXJA 2PVOD 1QOGA 2WXLA 1R7SA 1L6VA 2BTEA 1Q10A 4YTPB 1GPXA 1N5XA 3OWEB 2FBWB 4NAWB 2DYOA 2OHFA 1I4HA 3NS1A 1E10A 1NENB 2H88B 3I9V1 1YN4A 4ZYSA 5AUKA 2GB1A 1QT9A 1FXIA 2N9LA 1JW9D 3AV8A 2SEBD 3AE8B 5BYSA 3ETRA 3CWIA 1JWSD 1FNVA 1VRAB 5D3DA 3AEEB 2KN4A 2WXHA 5FKAC 1C4CA 1FNWA 3SFEB 1UUPA 2AQ3B 2DYMA 2J53A 1JCKB 2L83A 1JWAD 2BB6A 1RM6C 1TZOA 1KH0A 3NVVA 2WDQB 2PTLA 1WSPA 2BT6A 2FUG1 2QJLA 3AEBB 3TEYA 2BYTA 1IBXB 2INNE 1JRPA 1XCTL 1EU3A 4RCOA 3AN1A 3KWLA 4A55A 1PDXA 2H89B 4C7YA 1K50A 1T5XD 1V97A 3FILB 3ZYYX 4YWGG 2AQ2B 3Q8EA 2XN9C 3KQ4A 4XWTA 3NRZA 4NZLB 4YTMB 3ZJTA 1XXGA 3O13A 4YSYB 1A70A 3B9JA 3BYYB 3P4SB 1FCLA 3AE9B 3IT6B 1PGXA 3IT4B 1CJEA 1E9MA 2OEDA 4P6VF 3BZDB 1C4PA 4N6EB 3PZ7A 3T3NA 1Y56A 2DLBA 2PKOA 2W3SA 3SEBA 2MJDA 1ZP0B 4DQOC 2ON8A 1HZ6A 1FFUA 1OFFA 4XDCA 3AMZA 1LO5D 1FRRA 2BB5A 2QIEB 2PIAA 4REZA 3HVDA 2IGDA 2RPVA 4GDKB 5H92C 4HRSA 3MHZA 1QOAA 2BS4B 3LB8C 1PUTA 5MPOA 5BMIA 3R2TA 2RMMA 3B2FA 1SSNA 1MHHE 1ET9A 3Q69A 4RGOS 1ZUD2 1IUEA 3R8BA 1YNTE 1AYFA 4HEA1 4ZRQA 3W2DA 4M0WA 2N9KA 1YQ4B 1RYJA 4KKIA 2IDYA 1C79A 1VJKA 4OZAA 3AE2B 4C56C 3MFGA 1HA5A 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJI A;  3AE5 B;  4A9A A;  1QLB B;  4YTN B;  4YTP B;  1RWS A;  1GPX A;  1FXA A;  3W5U B;  1TKG A;  1N5X A;  2K9X A;  5G5H A;  2FBW B;  2WU5 B;  1PFD A;  1NYR A;  2CJN A;  2WS3 B;  2OHF A;  1EWY C;  2M19 A;  1RFK A;  1KFY B;  2DWQ A;  3HVZ A;  1DOX A;  3NS1 A;  3PO0 A;  1NEN B;  1E10 A;  2H88 B;  1VLB A;  4JX1 C;  3NVZ A;  1E0Z A;  1I7H A;  1N63 A;  3BII D;  4USA A;  5EE0 A;  3W9C B;  3P4R B;  1DOI A;  1NYQ A;  3NVW A;  4N58 A;  5AUK A;  1QT9 A;  1FXI A;  1WRI A;  1VDV A;  1L5P A;  2N0S B;  1UWM A;  3EUB 2;  3FAH A;  4LTU A;  1ZXI A;  4WWM A;  1JW9 D;  2K5P A;  2W55 A;  3AV8 A;  4ZOH C;  3AE8 B;  3ETR A;  1KF6 B;  1WYG A;  3CWI A;  3AE3 B;  1JRO A;  3AEG B;  4C80 A;  1F0Z A;  4IDI A;  2KMM A;  3AEE B;  3AB5 A;  1XLO A;  2K22 A;  3AM9 A;  2JX5 A;  3SFE B;  2B76 B;  2L83 A;  1JWA D;  1B9R A;  1ROE A;  2G1E A;  1GAQ B;  1NI3 A;  3FC4 A;  1RM6 C;  3RPF C;  3NVV A;  3VR8 B;  2WDQ B;  1SB3 C;  3P63 A;  4N59 A;  1QOF A;  2BT6 A;  2QJL A;  1TKY A;  1J7A A;  1L0V B;  1ZOY B;  2L52 A;  2E3T A;  3AEB B;  4KX6 B;  1FM0 D;  2MJ3 A;  2WDR B;  1JRP A;  1N5W A;  3VRA B;  5EE9 A;  1WXQ A;  1SIJ A;  3AN1 A;  3KWL A;  1PDX A;  1QOB A;  4YXD B;  2H89 B;  4C7Y A;  2LEK A;  2WLB A;  1V97 A;  3ZYY X;  1N61 A;  4WQM A;  3AEA B;  1T3Q A;  1TYG B;  1J7C A;  3DWM A;  2WDV B;  1CZP A;  1DGJ A;  2CJO A;  3NRZ A;  3P4P B;  2MH7 A;  4YTM B;  3P1M A;  4US8 A;  2W3R A;  4YSY B;  1A70 A;  3AE7 B;  1FMA D;  3AE4 B;  3B9J A;  3P4S B;  3AE9 B;  3VRB B;  1XLN A;  3VR9 B;  1YJJ A;  1N62 A;  1SF0 A;  5C2T B;  3L4P A;  3AED B;  1CJE A;  1FRD A;  5GXG B;  2WU2 B;  3LXF A;  1V8C A;  2DBY A;  3HUI A;  1E9M A;  3SR6 A;  4P6V F;  2CU3 A;  3AE6 B;  3CIR B;  3NVY A;  5H8Y E;  3ABV B;  2JQR B;  3DWG C;  5EE3 A;  4N6E B;  4YSZ B;  1J7B A;  4JWU C;  2W54 A;  2AX5 A;  2Y5C A;  1QF6 A;  2BS2 B;  3AE1 B;  1WWT A;  1JWB D;  2PKO A;  2W3S A;  2WP9 B;  1JAL A;  2MJD A;  4JWS C;  4US9 A;  4YT0 B;  1ZP0 B;  2M56 B;  3P4Q B;  3SFD B;  1FO4 A;  1FIQ A;  2WQY B;  1FFU A;  4FXC A;  1OFF A;  2MJE A;  4C7Z A;  1KRH A;  3AMZ A;  4ZHO A;  1JQ4 A;  1FRR A;  1NVI D;  2QIE B;  2PIA A;  3HRD D;  5AUI A;  5H92 C;  1XLQ A;  3B2G A;  2Q5W D;  4HRS A;  1QOA A;  2BS4 B;  3LB8 C;  1TJE A;  1PUT A;  3AEC B;  5G5G A;  5C3J B;  5MPO A;  1DOY A;  1XLP A;  1N60 A;  3AH7 A;  1FFV A;  3B2F A;  1TKE A;  2EKI A;  4YSX B;  1OQR A;  1IUE A;  1ZUD 2;  1AYF A;  1L6U A;  2ACZ B;  2PVG C;  1E6E B;  4HRO A;  1YQ3 B;  5EE1 A;  1WGK A;  3W5V B;  2BS3 B;  3AEF B;  1YQ4 B;  2KAJ A;  3WCQ A;  1XO3 A;  1RYJ A;  1E7P B;  1AWD A;  1VJK A;  4ITK A;  2PVO D;  1NEK B;  1QOG A;  3AE2 B;  2HTM E;  4ZHP A;  1R7S A;  1L6V A;  1OQQ A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  1FXA A;  4XYC A;  4B0E A;  4XDD A;  1NYR A;  3PVL A;  1DOX A;  4P7I A;  1QQR A;  4OZB A;  5TSS A;  2LRU A;  4TV3 A;  2MA9 B;  1YMH E;  3BII D;  1ESF A;  1VDV A;  1OGW A;  4WWM A;  2WXF A;  4XE0 A;  5CX3 A;  1NDD A;  3AE3 B;  2OJR A;  3L54 A;  4RH6 A;  2VZK B;  2KTR B;  1V80 A;  3GB1 A;  4FHK A;  1OEY J;  2JRH A;  2WXK A;  3FC4 A;  1TY0 A;  3Q14 C;  1ZGU B;  1V1P B;  3TEX A;  2KFK B;  2LHD A;  2WDR B;  1WJN A;  2LMC A;  3D32 A;  3BVG A;  4HKQ A;  2GBJ A;  3DWM A;  1MG8 A;  1YN5 A;  4DK5 A;  2JPH A;  3Q8C A;  1WZ0 A;  1T0R C;  1YOV B;  1TZ1 A;  3L4P A;  3AED B;  2KQS A;  2JUO A;  3RUI B;  1FRD A;  3PS6 A;  2D5G A;  4RGM A;  3WAM A;  1VZ6 A;  5JHA A;  4URK A;  2BBC A;  2JQR B;  3T9L A;  2J52 A;  4GXB A;  4GDL A;  4ANV A;  2DZM A;  2WP9 B;  2G45 B;  2ZCC A;  3MP9 A;  3TEW A;  1FIQ A;  2HDE A;  5D7G A;  2MJE A;  4C7Z A;  1JQ4 A;  2KDE B;  2W82 A;  4ZRJ A;  3R66 C;  2PPH A;  2PJH A;  3U7Z A;  4OZC A;  2A4Z A;  4PK1 A;  4WH4 A;  2KQ7 A;  4KV2 A;  3TJP A;  1WR1 A;  1AN8 A;  4G0N B;  2WDT B;  3W5V B;  3AEF B;  2KAJ A;  4PYZ A;  2VRR B;  2KLC A;  1KTK A;  3KUD B;  4WAF A;  1OQQ A;  2DAJ A;  2IY0 B;  4FUL A;  3AXC A;  4NY0 A;  3ZNH B;  2L05 A;  2Z0E B;  1H4R A;  3CST A;  3HM3 A;  3UQB A;  3N3K B;  1V81 A;  2LGD A;  3V61 A;  2PW9 A;  1KFY B;  2NTT A;  3PHW B;  4IW0 A;  3L13 A;  1N63 A;  1Z5S B;  1P1A A;  3N20 C;  2WXP A;  1L2N A;  3PSE B;  3DHI C;  3ZLZ A;  2A5U A;  1NI2 A;  3ZNZ B;  4OVZ A;  1OTR B;  1GB4 A;  2FCM A;  1YQB A;  1D3Z A;  3MC0 B;  4HK2 A;  2C7N B;  3KWV A;  2IGH A;  2LZ6 A;  4PYU A;  1GC6 A;  5HG2 A;  2DYB A;  3V60 A;  2FCQ A;  4GDL B;  2MP2 A;  4F1S A;  4PT5 A;  3DHG C;  2NPT B;  5IA7 A;  4MGY E;  2REX A;  1WX8 A;  3VTV A;  1WXQ A;  3KYC D;  4F8C B;  2CR5 A;  4KIK B;  4LNF A;  2WDV B;  4KGS A;  1V9J A;  1N62 A;  1E8Z A;  4W9E A;  3JVZ X;  1Q0W B;  1GOZ A;  4NNJ B;  2O6V B;  4HJG E;  1J0G A;  5LXH A;  2LXC A;  2C9W B;  2Y5C A;  2IBI B;  1WF9 A;  3HIZ A;  4GU2 A;  3GP7 A;  2I2Y A;  4BOZ B;  1WJU A;  1SBB B;  4UDU C;  5AZH A;  2PVG C;  1WMH B;  2WXM A;  2IZV B;  1WRD B;  5IN7 A;  2EEL A;  2I1J A;  5KHO A;  2I38 A;  3TCA A;  2AL6 A;  3AUL A;  4GB9 A;  2V0G A;  1RWS A;  2NMQ A;  4WIP A;  1MI0 A;  5E6J A;  2RDH A;  1RFK A;  1E7V A;  2SAK A;  3ZTC A;  2KFJ A;  2X38 A;  4LJP B;  4MAC A;  1B1Z A;  3VH3 B;  2KWC A;  2FE8 A;  4BBN F;  2ZW1 A;  1PQS A;  3TL5 A;  3CF6 E;  4GSW A;  3ECI A;  4EZJ A;  2Z59 B;  2JWZ A;  2CS4 A;  3AEG B;  2E6X A;  4IDI A;  1H8C A;  5HKH A;  2K22 A;  1ACC A;  1I4X A;  1XT9 B;  4D2K A;  3A1Q A;  1GAQ B;  3O65 B;  3WAP A;  3C0R B;  2WXR A;  4N59 A;  4BBN C;  2KYW A;  4Q2J A;  4WJQ A;  1PGB A;  5IAA C;  3I57 A;  4MH0 E;  3GE3 C;  2DEN B;  2W3R A;  1XLN A;  4R3D A;  3UIP B;  4EUT A;  3IHP C;  4LNK A;  2KO3 A;  1V8C A;  3PHX B;  5D3I B;  3E56 A;  4MGZ E;  3CIR B;  3ABV B;  1P9D U;  2WNM A;  5EE3 A;  1D5Z C;  2D11 A;  3Q8F A;  2KXJ A;  4MH8 A;  3AE1 B;  1WWT A;  2IND C;  4YT0 B;  4K7U A;  1R4N I;  4L23 A;  3MC8 A;  5FR6 A;  4KDI C;  1K52 A;  3HRD D;  3UI3 A;  1VD2 A;  4LLG M;  3B2G A;  2N9P C;  4PS7 A;  1WGR A;  4KGT A;  5J18 A;  4MSM B;  3VHT C;  2V4I B;  2D2Q A;  1CK1 A;  1G6J A;  3H7P B;  3MC9 A;  2IJ0 A;  2DX5 B;  3A1Q B;  4MDK E;  1L6V A;  3QK0 A;  4E71 A;  3OWE B;  2FBW B;  3JSV B;  1SE9 A;  2IO3 B;  1NEN B;  1MFW A;  4WWP A;  3I9V 1;  1YN4 A;  3HHM A;  2HE7 A;  2AYO B;  3PLV A;  4G50 A;  5AUK A;  3N1Z C;  1QT9 A;  2CHW A;  4YL8 A;  3K9P B;  4KSL C;  4MM3 A;  1JW9 D;  3AV8 A;  4B6W A;  3ETR A;  3VAW A;  3RNC C;  4LJO B;  1V5O A;  1XQQ A;  4AP4 C;  4M0W B;  1FNW A;  3SFE B;  1JCK B;  4CHK A;  2ZZP B;  1RM6 C;  1TZO A;  3A33 B;  4IC7 B;  4RM9 A;  2WHI A;  1WSP A;  2GBK A;  1KLV A;  1JRP A;  4RCO A;  3WIM A;  2GMI C;  3R3M A;  3V6C B;  3FIL B;  4YWG G;  1QZE A;  2ZNV B;  4XWT A;  2RGF A;  4YTM B;  4W9H A;  4YSY B;  3P4S B;  3DVN V;  3AE9 B;  5GMV A;  2LVQ A;  4W9J A;  4I6N B;  1CJE A;  2LJ5 A;  3QCA A;  1MJD A;  2GOW A;  4W9G A;  2KDF B;  1V6E A;  1E90 A;  3PLU A;  3PZ7 A;  3RNA C;  4EEW A;  2W3S A;  3DVG X;  2FUH B;  2MJD A;  1ZP0 B;  4DQO C;  4EFO A;  1GC7 A;  2BQQ A;  4XDC A;  2QIE B;  2KWU B;  3ZUN A;  3TMP B;  1QOA A;  1PUT A;  1WE6 A;  2M1M A;  4IM2 A;  4ZRK A;  4RGO S;  1AYF A;  3GOE A;  4QAY A;  2WGS A;  2EMS A;  5CHW A;  3AE2 B;  3PT2 B;  2KHW B;  4IM3 A;  1DYQ A;  3APD A;  3W5U B;  1IBX A;  3PRM B;  2FCN A;  2K9X A;  3H8H A;  1HZ5 A;  4FN2 A;  3HM6 X;  3TUO A;  5J2R A;  1SXT A;  1E0Z A;  4HLE A;  1NYQ A;  4JPS A;  1ZPS A;  3Q3O C;  2KDM A;  2IGG A;  4ARC A;  2KTF A;  1C78 A;  1K53 A;  1KF6 B;  3ZQ4 A;  4K3B A;  1I4P A;  2D3G A;  4W9D A;  3AM9 A;  1C9F A;  4A20 A;  1HXY D;  4DDI D;  4K81 A;  2K0P A;  2W9N A;  3QWZ B;  4BKT A;  3CMM B;  1JWU D;  1UGM A;  1L0V B;  2IYD B;  4KX6 B;  1HEZ E;  3ZVV A;  1WGD A;  3VDZ A;  1WXS A;  2QCZ A;  1F52 A;  1T3Q A;  1CZP A;  3Q8A A;  2CJO A;  2UYZ B;  3P4P B;  4ZRI A;  3RMK C;  2VH1 A;  4OVU A;  5T8I A;  1LM8 B;  3L08 A;  1F2R C;  1M94 A;  4HPP A;  4W9C A;  4KGR A;  2IY1 B;  2MX2 A;  2KDI A;  2G4D B;  2AEH A;  2PLP A;  4FBJ B;  3BVZ A;  3JYU A;  2JU6 X;  3NS8 A;  4GIV A;  2MHJ A;  3ZKJ C;  1QF6 A;  2ZNV C;  2K6Q A;  2FID A;  4BKS A;  3VUX A;  2QSD A;  1E5W A;  2FIF A;  2NBV B;  4HCN B;  1E8Y A;  5AUI A;  2CKH B;  2ZPN A;  1XLQ A;  1SE4 A;  3NZU A;  2MEK A;  5LLI A;  2ZVN A;  3B0A A;  3UQA A;  5C23 A;  1F1H A;  4BOS C;  2KX3 A;  3PPA A;  4L1B A;  2KTR A;  5EE1 A;  1WGK A;  4RGT A;  3GZN I;  2BS3 B;  4ITK A;  3ZJV A;  2HTM E;  1WI0 A;  1WH3 A;  3DBL I;  5GXG B;  3DBH B;  1QLB B;  1V1P A;  3BYT B;  4LCD E;  2KFK A;  1PFD A;  3N9Y C;  2M19 A;  2HJ8 A;  2Y3A A;  3PO0 A;  3R7R A;  3L17 A;  1KLU D;  3BWU D;  3RNF C;  3E9S A;  3NVZ A;  1JML A;  3DBR I;  4OVV A;  1Q1O A;  3W9C B;  4N58 A;  4ZRP A;  2JT4 B;  2DNF A;  5CHV C;  2KNB A;  2ASQ A;  3UIN B;  2LFI A;  2W55 A;  4ZOH C;  3IAM 1;  2KN5 A;  4PS8 A;  2BW2 A;  4K7W A;  2GBN A;  1T6B X;  2CHX A;  2B76 B;  5CHF A;  3I63 C;  3AU5 A;  1WX9 A;  3APC A;  3I5J C;  2L0F A;  3EFC A;  2JVC A;  2L52 A;  4FAD A;  2E3T A;  2KMC A;  1TS5 A;  1K51 A;  5BMG A;  2QEJ C;  3SU8 X;  4IOI E;  4US8 A;  2FNJ B;  1QIL A;  1I4G A;  1SE2 A;  5HHD G;  3TEZ A;  4WJO A;  4ACF A;  2XK5 B;  1UGJ A;  5DPR A;  2M0A A;  4GOC A;  2DBY A;  3SR6 A;  4AJY B;  3URY A;  3L16 A;  4NAM A;  1ENF A;  4YSZ B;  3H9D A;  5BYR A;  1S3S G;  3OJ3 A;  3NZS A;  1JAL A;  2JRI B;  3SFD B;  1IGC A;  2KOX A;  3RT3 B;  2WX0 A;  1D5M C;  1CQV A;  1EWC A;  3Q8B A;  1T0Y A;  3TIX A;  1FXT B;  3IG3 A;  2UWQ A;  2ACZ B;  1F9J A;  2N9E B;  2V3S A;  4HCP B;  1UF0 A;  2K8C A;  1JWM D;  1EUV B;  2D3B A;  1XCQ L;  5IO9 A;  1NEK B;  3V62 A;  2NPT A;  2QDF A;  2LUE A;  1GJZ A;  2L76 A;  2M4N A;  5L83 A;  1YJI A;  3V05 A;  4A9A A;  4CO7 A;  1ET6 A;  4RGN A;  4MGI E;  4W9I A;  1WM2 A;  2XEW A;  2WU5 B;  4JL9 A;  3A9K B;  1EWY C;  1K8R B;  3KH0 A;  4KIK A;  4IM0 A;  5FK9 C;  3B08 A;  1ZDX A;  1I7H A;  4KZ0 A;  4TQ1 A;  2BKF A;  1L5P A;  4LTU A;  1ZXI A;  1HE8 A;  1GNU A;  1MHX A;  1SEB D;  4WJP A;  3ZGZ A;  1C3T A;  2KAC A;  2KK8 A;  2FAZ A;  2V3P A;  2O6V A;  2KWD A;  1L0Y B;  2L0T A;  3VVW B;  2BYF A;  2G1E A;  1V2Y A;  4TUU A;  1NI3 A;  5JXV A;  1BML C;  1SB3 C;  3P63 A;  4KVG B;  3R7Q A;  1D4B A;  2BKR B;  2C5L C;  1P7E A;  4MT5 A;  2C7M B;  3AU4 A;  2K39 A;  2L32 A;  1V49 A;  1IYF A;  4AS1 A;  1WMH A;  3KW5 B;  4WAA A;  3AE7 B;  3VRB B;  3WAO A;  1KOT A;  2D3A A;  1SF0 A;  2INP E;  2V3N A;  2MW5 A;  5JHB A;  2LGI A;  2KMA A;  2WU2 B;  2O2V B;  1HQR D;  4IUM B;  4XC2 A;  2LUM A;  4US9 A;  4RFB A;  2M56 B;  2L7R A;  2VZK D;  2DZJ A;  3Q3M C;  3IAS 1;  4ZHO A;  3QQ8 B;  2M17 A;  4OW0 A;  2EKE C;  4A3O A;  4FJV B;  1TGZ B;  5E6O A;  3BVM A;  2DHZ A;  4GLS C;  1P98 A;  2MBE A;  1L6U A;  1L4Z B;  4WUR A;  1E6E B;  2AL3 A;  3M63 B;  2K6D B;  3WCQ A;  4WJN A;  1QOG A;  4WWO A;  4RMA A;  3VXW A;  3GE8 C;  3N30 A;  4YTP B;  1GPX A;  3VTW A;  3DVN U;  1N5X A;  2OHF A;  1I4H A;  1LXD A;  3NS1 A;  3KYD D;  3DDC B;  2RDB C;  3S2A A;  2MBO A;  3MHS D;  3U8Z A;  2LRW A;  2SEB D;  5BYS A;  3CWI A;  3SHQ A;  2K8B A;  5J17 A;  2KN4 A;  5IP4 D;  2L83 A;  3NVV A;  3DQV A;  4K3C A;  2FUG 1;  2QJL A;  2KVR A;  4M01 A;  1XCT L;  3KUZ A;  4XX5 A;  3AN1 A;  3APF A;  4A55 A;  1PDX A;  2H89 B;  2BVC A;  3ZYY X;  4DXA B;  3Q8E A;  4AJW A;  4P1C C;  3H7P A;  3IT6 B;  3Q6B A;  4K7S A;  5G55 A;  3L10 B;  4BAX A;  4ASW C;  3JSV A;  1JRU A;  2N1W A;  4W9K A;  3T3N A;  1Y56 A;  2DLB A;  2PKO A;  4EOY A;  3PRZ A;  2J0M A;  1FFU A;  2KD0 A;  4ZDV A;  1FRR A;  2NBU A;  4REZ A;  2JY6 A;  1I42 A;  2PE9 A;  2BS4 B;  3LB8 C;  5BMI A;  3R2T A;  5C1Z A;  3B2F A;  2G3Q B;  3Q69 A;  1ZUD 2;  1WY8 A;  3B1L X;  2KC2 A;  4ZRQ A;  1WM3 A;  2DZI A;  4M0W A;  1T0Q C;  2UU7 A;  4C00 A;  4KKI A;  1VJK A;  1OEY A;  4C56 C;  4DHJ B;  2M0X A;  3DOW A;  3RZF A;  4JIO U;  3WA0 A;  1TKG A;  2LHE A;  1LGR A;  3GS2 A;  2DWQ A;  1AAR A;  3FIL A;  4FJY A;  1VR9 A;  4AUQ C;  5LXI B;  2FCS A;  1R4N B;  3NG0 A;  4L2Y A;  4USA A;  2HTH A;  3UGB B;  3NUH B;  1RAX A;  4X57 B;  2J42 A;  2N4F A;  1WGY A;  3NJT A;  1UD7 A;  1R4M I;  3ZRC A;  4TMA B;  1RFA A;  2JXT A;  4EE2 A;  3P2B A;  1ZE3 D;  2JYE A;  3OG5 A;  3VR8 B;  1QOF A;  2WXG A;  1ZOY B;  5DPW A;  4HKZ E;  1N5W A;  5EE9 A;  2WLB A;  3UF8 A;  1J7C A;  2KT7 A;  3DHH C;  2B3A A;  2N7E A;  2K8H A;  2YEP F;  1NBF C;  1FMA D;  3AE4 B;  4S17 A;  1ZKH A;  3NY5 A;  3X23 A;  2JZP A;  1FEH A;  5AEK B;  3LXF A;  5H8Y E;  4O1N A;  2RDG A;  2BS2 B;  2MBH A;  3ZXV A;  3PZ8 A;  1FO4 A;  4I6P A;  1F77 A;  4RNA A;  3PRE A;  2L8J A;  2WXQ A;  3AEC B;  1ISN A;  1N60 A;  3W1S C;  2V4L A;  4LNN A;  5JH5 C;  4AQ7 A;  1XF5 L;  1AW7 A;  4B95 A;  2J0K A;  3IXS A;  2NS5 A;  1B9R A;  3IBE A;  5DPT A;  2Z8L A;  4YTN B;  1YJ1 A;  1EM7 A;  3QIJ A;  2WS3 B;  2WYQ A;  1TS4 A;  4XZ4 A;  1BXT A;  1LFD A;  1P0R A;  3U4E G;  2WX1 A;  1E8X A;  4NJ7 A;  2D07 B;  5EE0 A;  1DOI A;  2CHZ A;  2ZCB A;  2N0S B;  1UWM A;  1LQB A;  3DVG Y;  1EF1 A;  3ENE A;  1EO6 A;  4J6I A;  1JRO A;  4JQW C;  4IG7 B;  3N1X C;  1UNS A;  2KMM A;  2KJR A;  2JX5 A;  3LJ3 A;  1ROE A;  4A90 A;  1WGH A;  3RPF C;  2KJ6 A;  2LVO A;  3MJ5 A;  1TKY A;  1IGD A;  3U30 A;  5BMH A;  1TY2 A;  4ANW A;  1KLG D;  1ZDV A;  1L0X B;  1FPY A;  1TS3 A;  1TYG B;  1DGJ A;  2V1Y A;  3LYY A;  2INC C;  1YD8 U;  2Y5P A;  3VR9 B;  2M8S A;  2MSE D;  3M95 A;  3KUC B;  1ZXH A;  2GBM A;  4RF1 A;  3NVY A;  4A8X C;  3QC8 B;  1VZ7 A;  4H2A A;  2RD0 A;  1JWB D;  4JWS C;  4BVU C;  4K1R B;  2WQY B;  4LDT D;  2WXI A;  1FCC C;  3VH4 B;  2PE6 B;  1BT0 A;  5C3J B;  1XLP A;  1TKE A;  2Y5B B;  1CMX B;  5BYQ A;  1PGA A;  5D2M B;  1TBE A;  2BPS A;  1E8W A;  3SDL C;  4BKG A;  3M3J A;  1Q5W B;  5CTR C;  3VUW A;  2BYV E;  2JZZ A;  3EC8 A;  3NOB A;  3H6N A;  2MQJ A;  4IWO A;  3HVZ A;  3KVF B;  1VLB A;  4JX1 C;  5LNK 1;  2BYE A;  1UWX A;  3FKY A;  3A9J B;  2PMV A;  2XK5 A;  2K5P A;  2NTS A;  3QA8 A;  3AB5 A;  1MG4 A;  1TS2 A;  4ZYN A;  3GZN B;  2LXA A;  2AQ1 B;  4W9F A;  4IKG A;  4FJZ A;  3DBL B;  1M4V A;  3TSS A;  1I4R A;  3N1Y C;  4NAW A;  4G3X B;  2V9H A;  2LWP A;  4G11 A;  3VRA B;  2KLG A;  3AEA B;  1WGG A;  3DBR B;  2MH7 A;  4B9K A;  3L0W B;  3C19 A;  4RF0 A;  2MBQ A;  2YVC A;  3I3T B;  4XWW A;  1N6Z A;  3CSF A;  3AE6 B;  1BUI C;  4WWN A;  2KJH B;  4DWF A;  2AX5 A;  3A9K A;  3ZW3 A;  1C77 A;  1KM7 A;  1I4Q A;  2HJ1 A;  1C4A A;  3P4Q B;  4FXC A;  5L95 C;  1NVI D;  1TT5 B;  4AOF A;  1D6E C;  2LI5 A;  2L3Z A;  4M02 A;  4DXG A;  5E6N A;  4FLH A;  1OQR A;  2OOB B;  3BIN A;  4P1B C;  3TBL D;  4HWI B;  1XO3 A;  3P42 A;  2WXJ A;  2PVO D;  3PGE A;  2WXL A;  3QJZ A;  5G2N A;  2BTE A;  4NAW B;  1Y8R C;  1E10 A;  3N32 A;  2J7Q B;  4HVB A;  4ZYS A;  2GB1 A;  2RR9 A;  4GDK A;  2N9L A;  2LD9 A;  2D3C A;  4MJS B;  3T8M A;  2N9X A;  1JWS D;  1VRA B;  2O2V A;  3ZXR A;  5FKA C;  2J53 A;  2DYM A;  3PV1 A;  3QAR A;  2BB6 A;  2LAS A;  3Q3J A;  2PTL A;  2BYT A;  3AEB B;  3TEY A;  2INN E;  1EU3 A;  1RRB A;  5JZE B;  1EF5 A;  3KWL A;  4I6L B;  1T5X D;  3OLM D;  2XN9 C;  1WXA A;  1A70 A;  3A4S C;  3ZNI D;  2KC1 A;  3LDZ E;  1PGX A;  3PZD A;  3VFK A;  1UEL A;  4EZL A;  1VCB A;  3BZD B;  3VUY A;  4N6E B;  1YX5 B;  3OJ4 B;  4KDL B;  5DCN A;  1WR6 E;  3ALB A;  2LGS A;  2ON8 A;  1HZ6 A;  3RNG C;  2K1F A;  2QHO A;  3AMZ A;  1LO5 D;  2PIA A;  2KX0 A;  4GDK B;  4HRS A;  3RD2 A;  4JLC A;  5MPO A;  4NQK E;  4BKS D;  1SSN A;  4HPL B;  1UZX B;  1YNT E;  1WX7 A;  1V5T A;  1YQ4 B;  2DAF A;  1RYJ A;  2IDY A;  1C79 A;  2NVU I;  2BF8 B;  3MFG A;  1HA5 A;  5HI1 A;  2ZEQ A;  4ICU A;  2CJN A;  3ZTD A;  1SGH A;  4S0R A;  5IKC M;  1TIF A;  1HTQ A;  4M00 A;  2EMT A;  3FAH A;  1I35 A;  4KZC A;  2GRI A;  1GB1 A;  2ONQ A;  1J19 A;  2R61 A;  3QX1 A;  4C80 A;  1F0Z A;  4JGH B;  4AWJ A;  3W1S A;  4M8N A;  1RLF A;  3RFZ B;  1PYW D;  2JF5 A;  2KWV B;  5E6P A;  4XGA B;  1UH6 A;  2J4X A;  2JXX A;  1SIJ A;  3H7S A;  2AWT A;  1MVK A;  4IWQ A;  2LEK A;  3V6E B;  4LNI A;  4EZK A;  2GI9 A;  2K25 A;  4A3P A;  1L4D B;  3P1M A;  4GMV A;  4IWP A;  4NJ6 A;  4W9L A;  1IP9 A;  2KZR A;  5D6J B;  5C2T B;  2ZVO A;  1TTN A;  3EHV A;  1GUA B;  2CU3 A;  2R2O A;  3PTF C;  1WXM A;  4DHZ B;  2IO0 B;  1J7B A;  1GG3 A;  4JWU C;  2BGF A;  2K3U A;  1QKZ A;  2MP2 B;  3SD5 A;  1V1O A;  2LGY A;  2YEP B;  3Q2A C;  2YLM A;  3OAW A;  3Q3N C;  4DDG D;  1WZ3 A;  4KKJ A;  1WIA A;  2R2Q A;  1FFV A;  3ZNG C;  1WJ4 A;  2EKI A;  4YSX B;  4TQ0 A;  1YQ3 B;  3KLS X;  4GN1 A;  1FNU A;  1E7P B;  1AWD A;  2L00 B;  1SJH D;  4ZHP A;  2D10 A;  2KVZ A;  5I4D A;  2WWZ A;  4TSS A;  1YN3 A;  3IVF A;  1E7U A;  2ZW0 A;  5G5H A;  5IOI A;  4DBG A;  2I1K A;  1UBI A;  3J9C A;  2BWE S;  4HXD A;  3DBS A;  3P4R B;  3NVW A;  4HDQ A;  3JW0 X;  2X8X X;  3HK0 A;  3EUB 2;  2L1A A;  4HJK A;  5HFY A;  3ZJU A;  5FR3 A;  2C60 A;  4DXF A;  1UBQ A;  2MLB A;  3NHE B;  2O6V D;  2HD5 B;  1J7A A;  2JYT A;  3EEC A;  2WXO A;  3QAQ A;  1P3Q U;  1N61 A;  4WQM A;  4EKU A;  2IPK D;  2WXN A;  3X0W A;  2ICI A;  5AZF A;  4LNO A;  3NZ3 A;  1IPG A;  4FHJ A;  1R4M B;  4NPN A;  3MTN B;  3RNB C;  4HPM B;  5D94 A;  3VQI A;  3RZW C;  3DWG C;  4RM8 A;  3PRP B;  2LJI A;  2W54 A;  2QC8 A;  2KKC A;  3RN9 C;  1SE3 A;  3T3O A;  5KHQ A;  1ZW7 A;  2J0J A;  1KRH A;  2ZJD A;  1V86 A;  4MEL A;  1DOY A;  5G5G A;  4N9F 4;  4MEM A;  1C76 A;  3AH7 A;  2JWU A;  2NBW B;  4KSK C;  1SJE D;  3RYT A;  3K9O B;  4P16 A;  4F7Z A;  3U2S C;  3WAN A;  1OQY A;  2QIL A;  1MPE A;  1F2R I;  3AE5 B;  3EGR A;  4ICV A;  1VZ8 A;  4LK0 M;  4LDT B;  2C7H A;  2BWF A;  1STE A;  2KDB A;  4OHJ A;  1WE7 A;  4PS3 A;  1WRI A;  3WAL A;  1D5X C;  1WYG A;  2KQ4 X;  3ZDT A;  1EU4 A;  1XLO A;  2XNA C;  5EDS A;  1FD6 A;  4JE3 B;  4MGK E;  1P7F A;  3RI7 C;  2LGX A;  2MCN B;  3BK2 A;  4NJC A;  4C4V A;  4CQN A;  1FM0 D;  2MJ3 A;  4DHJ D;  3M62 B;  1QOB A;  4YXD B;  4ANU A;  2MBB B;  2JSV X;  3ML9 A;  2TSS A;  1C1Y B;  1YJJ A;  3EA6 A;  3V3X A;  1J8C A;  4MM3 B;  2QMT A;  3HUI A;  4WQO B;  2RPQ A;  1YX6 B;  1XEE A;  3UIO B;  3Q3F A;  1S1Q B;  1T0S C;  4HDO A;  3R2I A;  4M8M A;  1XD3 B;  3MJW A;  2PEA A;  2MWS B;  3A9J A;  3ML8 A;  4BFR A;  2Q5W D;  1TJE A;  3C8Y A;  4A6Q A;  4II3 B;  2NCN A;  5BO4 B;  3ZDM C;  4ARI A;  2N7D A;  1X1M A;  3U52 E;  2G9H D;  4II2 B;  4J3O D;  3BK1 A;  4HRO A;  2OJW A;  2N7J A;  1R7S A;  3DCG A;  3DPD A;  1Q10 A;  3BY4 B;  4C4V B;  2DYO A;  2IO2 B;  5AZG A;  2NR2 A;  1KJT A;  2H88 B;  4MSQ B;  3RCZ A;  4CYE A;  2DZK A;  2KAN A;  1FXI A;  3W1Y A;  2GLS A;  2RSU A;  4DHZ E;  1YIW A;  3EFU A;  2N1V A;  3U7D A;  3AE8 B;  5TR5 A;  1FNV A;  1WJ6 A;  1Z2M A;  5D3D A;  3AEE B;  1L7Y A;  2XBB C;  2WXH A;  5DPS A;  1C4C A;  1UUP A;  2AQ3 B;  1WXV A;  3RNE C;  1JWA D;  4NQL B;  1SIF A;  1KH0 A;  2WDQ B;  3IFW B;  2BT6 A;  1IBX B;  2VH2 A;  4GGQ A;  3AI5 A;  4C7Y A;  4E3C A;  1K50 A;  1V97 A;  4ANX A;  2AQ2 B;  3KQ4 A;  3NRZ A;  4NZL B;  3ZJT A;  3VTU A;  1XXG A;  3O13 A;  2ZPY A;  3B9J A;  3BYY B;  3ZO5 B;  3ZRF A;  1FCL A;  3IT4 B;  3ONS A;  3DBH I;  3RUL A;  1E9M A;  1WYW B;  2OED A;  4P6V F;  1C4P A;  2JZ3 B;  4TKN A;  3QHT A;  2G4S A;  1HTO A;  3SEB A;  2Z0D B;  1A5R A;  2CU1 A;  1OFF A;  2LVP A;  2BB5 A;  4BZA A;  3HVD A;  2IGD A;  2RPV A;  5H92 C;  3A4R A;  3MHZ A;  2IO1 B;  1WFY A;  2RMM A;  4MJS A;  1MHH E;  1ET9 A;  3H1U A;  1IUE A;  3R8B A;  4E74 A;  4HEA 1;  2GBR A;  1U4A A;  3W2D A;  4FA6 A;  2N9K A;  4OZA A;  2MRP A;  4B0M A; 
#chains in the Genus database with same CATH homology
 5HI1 A;  1DYQ A;  1FXA A;  3W5U B;  4B0E A;  1IBX A;  4XDD A;  1TKG A;  2K9X A;  2LHE A;  3H8H A;  1HZ5 A;  1NYR A;  2CJN A;  3GS2 A;  3TUO A;  2DWQ A;  1DOX A;  3FIL A;  1VR9 A;  1SXT A;  1QQR A;  4OZB A;  5TSS A;  1E0Z A;  1YMH E;  3BII D;  4L2Y A;  4USA A;  1ESF A;  1NYQ A;  4JPS A;  1ZPS A;  3NUH B;  1VDV A;  2KDM A;  2IGG A;  3FAH A;  4WWM A;  2WXF A;  4ARC A;  2GRI A;  1GB1 A;  2J42 A;  2ONQ A;  4XE0 A;  1C78 A;  1K53 A;  2R61 A;  1KF6 B;  3ZQ4 A;  3AE3 B;  4C80 A;  1I4P A;  1F0Z A;  4TMA B;  4RH6 A;  2VZK B;  3W1S A;  3AM9 A;  3GB1 A;  1C9F A;  2JXT A;  4EE2 A;  3RFZ B;  1PYW D;  1HXY D;  1ZE3 D;  2WXK A;  3FC4 A;  1TY0 A;  2JYE A;  2K0P A;  3VR8 B;  1JWU D;  1V1P B;  1QOF A;  2WXG A;  2J4X A;  1ZOY B;  1L0V B;  3TEX A;  4KX6 B;  2LHD A;  1HEZ E;  2WDR B;  1N5W A;  4HKZ E;  5EE9 A;  2LMC A;  1SIJ A;  3BVG A;  1MVK A;  2LEK A;  2WLB A;  4HKQ A;  2GI9 A;  1J7C A;  1T3Q A;  3DWM A;  1YN5 A;  1L4D B;  1CZP A;  3Q8A A;  2CJO A;  2YEP F;  3P4P B;  3Q8C A;  3P1M A;  1FMA D;  3AE4 B;  5T8I A;  1F2R C;  2JZP A;  1FEH A;  3L4P A;  5C2T B;  3AED B;  1FRD A;  4KGR A;  3LXF A;  2D5G A;  4RGM A;  2CU3 A;  2PLP A;  1VZ6 A;  5H8Y E;  2BBC A;  3BVZ A;  2JQR B;  4O1N A;  2JU6 X;  2J52 A;  1J7B A;  2RDG A;  4JWU C;  2K3U A;  1QF6 A;  2BS2 B;  1QKZ A;  2WP9 B;  3PZ8 A;  3MP9 A;  3TEW A;  1FO4 A;  1FIQ A;  2HDE A;  5D7G A;  1F77 A;  2MJE A;  2QSD A;  4C7Z A;  1V1O A;  1JQ4 A;  2W82 A;  4RNA A;  2YEP B;  5AUI A;  1XLQ A;  2WXQ A;  1SE4 A;  4KKJ A;  3AEC B;  2MEK A;  1N60 A;  1FFV A;  3U7Z A;  2EKI A;  4YSX B;  4OZC A;  4WH4 A;  4TQ0 A;  1AN8 A;  1YQ3 B;  3KLS X;  4L1B A;  5EE1 A;  1WGK A;  4RGT A;  3W5V B;  4AQ7 A;  2BS3 B;  3AEF B;  2KAJ A;  1XF5 L;  1AW7 A;  1FNU A;  1E7P B;  1AWD A;  4ITK A;  3ZJV A;  1SJH D;  2HTM E;  3IXS A;  4ZHP A;  1KTK A;  4WAF A;  5GXG B;  1OQQ A;  1B9R A;  5I4D A;  1QLB B;  1V1P A;  3BYT B;  2Z8L A;  4TSS A;  4YTN B;  1YN3 A;  2ZW0 A;  5G5H A;  1EM7 A;  1PFD A;  2WS3 B;  3N9Y C;  2M19 A;  2PW9 A;  1TS4 A;  1KFY B;  2Y3A A;  1BXT A;  3PO0 A;  3U4E G;  1KLU D;  2NTT A;  3BWU D;  3J9C A;  3E9S A;  3NVZ A;  1JML A;  1N63 A;  5EE0 A;  3W9C B;  3P4R B;  1DOI A;  2WXP A;  3NVW A;  4N58 A;  4ZRP A;  2N0S B;  1UWM A;  3EUB 2;  2LFI A;  2W55 A;  2L1A A;  5HFY A;  3ZJU A;  4ZOH C;  3IAM 1;  4OVZ A;  1GB4 A;  2BW2 A;  1JRO A;  5FR3 A;  1UNS A;  2KMM A;  3MC0 B;  3KWV A;  1T6B X;  2IGH A;  5HG2 A;  2JX5 A;  2B76 B;  1ROE A;  4GDL B;  4A90 A;  4DXF A;  4PT5 A;  3RPF C;  3MJ5 A;  1TKY A;  1J7A A;  1IGD A;  2L52 A;  2JYT A;  2E3T A;  5BMH A;  1WXQ A;  2WXO A;  1TY2 A;  1TS5 A;  1K51 A;  1N61 A;  4WQM A;  1KLG D;  1ZDV A;  5BMG A;  1L0X B;  1TS3 A;  1TYG B;  2QEJ C;  2WDV B;  2IPK D;  4IOI E;  2WXN A;  1DGJ A;  4KGS A;  3LYY A;  4US8 A;  1QIL A;  1I4G A;  1SE2 A;  2ICI A;  5HHD G;  3TEZ A;  2Y5P A;  3VR9 B;  1N62 A;  3NZ3 A;  1UGJ A;  2M0A A;  2DBY A;  3SR6 A;  1ZXH A;  1GOZ A;  4RF1 A;  3NVY A;  3URY A;  3VQI A;  4NAM A;  1ENF A;  4HJG E;  4YSZ B;  3DWG C;  5BYR A;  2LJI A;  2W54 A;  4A8X C;  2Y5C A;  1VZ7 A;  4H2A A;  1JWB D;  4JWS C;  1JAL A;  3SFD B;  1SE3 A;  1IGC A;  2WQY B;  3T3O A;  1KRH A;  2WXI A;  1FCC C;  1D5M C;  3GP7 A;  1CQV A;  1EWC A;  1DOY A;  2I2Y A;  5G5G A;  5C3J B;  1XLP A;  3Q8B A;  1C76 A;  3AH7 A;  2JWU A;  1TKE A;  1SJE D;  1SBB B;  4UDU C;  4P16 A;  2ACZ B;  2PVG C;  5BYQ A;  2WXM A;  1PGA A;  3U2S C;  1JWM D;  1XCQ L;  1NEK B;  2EEL A;  2QIL A;  1MPE A;  1F2R I;  2I38 A;  1YJI A;  3AE5 B;  3EGR A;  3V05 A;  4A9A A;  2V0G A;  1RWS A;  1VZ8 A;  4LK0 M;  2NMQ A;  1ET6 A;  4RGN A;  4WIP A;  2WU5 B;  1MI0 A;  5E6J A;  2RDH A;  1EWY C;  1RFK A;  3HVZ A;  5FK9 C;  2SAK A;  1ZDX A;  1VLB A;  4JX1 C;  1STE A;  2X38 A;  5LNK 1;  1I7H A;  4MAC A;  1B1Z A;  1UWX A;  4OHJ A;  2FE8 A;  2ZW1 A;  4TQ1 A;  1WRI A;  1L5P A;  2PMV A;  4LTU A;  1ZXI A;  2K5P A;  1D5X C;  1MHX A;  1SEB D;  2NTS A;  3ZGZ A;  1WYG A;  2KQ4 X;  3AEG B;  2E6X A;  4IDI A;  2KAC A;  1EU4 A;  2V3P A;  3AB5 A;  1TS2 A;  1XLO A;  2XNA C;  2K22 A;  1ACC A;  2KWD A;  2AQ1 B;  1L0Y B;  1I4X A;  1FD6 A;  4JE3 B;  2G1E A;  4D2K A;  1GAQ B;  1NI3 A;  1P7F A;  4IKG A;  5JXV A;  1BML C;  1SB3 C;  2WXR A;  1M4V A;  3P63 A;  1D4B A;  4N59 A;  4Q2J A;  1P7E A;  3TSS A;  3BK2 A;  1I4R A;  4MT5 A;  4NJC A;  4CQN A;  1PGB A;  1FM0 D;  2MJ3 A;  3VRA B;  2L32 A;  1QOB A;  4YXD B;  3AEA B;  3I57 A;  4AS1 A;  2JSV X;  2MH7 A;  2TSS A;  2W3R A;  3AE7 B;  3VRB B;  4RF0 A;  1XLN A;  1YJJ A;  3EA6 A;  3V3X A;  1SF0 A;  2INP E;  2V3N A;  4MM3 B;  2LGI A;  4R3D A;  2QMT A;  4XWW A;  2WU2 B;  1V8C A;  3HUI A;  5D3I B;  3E56 A;  3AE6 B;  1HQR D;  1BUI C;  3CIR B;  3ABV B;  2WNM A;  5EE3 A;  1D5Z C;  3Q8F A;  1XEE A;  2AX5 A;  4MH8 A;  1C77 A;  1WWT A;  2LUM A;  3AE1 B;  1I4Q A;  4US9 A;  4YT0 B;  4RFB A;  1C4A A;  2M56 B;  3P4Q B;  3R2I A;  4FXC A;  2VZK D;  4L23 A;  3IAS 1;  4ZHO A;  1K52 A;  1NVI D;  3HRD D;  4OW0 A;  3UI3 A;  4LLG M;  3B2G A;  2Q5W D;  1D6E C;  1TJE A;  4DXG A;  3C8Y A;  4A6Q A;  4ARI A;  3U52 E;  4KGT A;  1OQR A;  2G9H D;  3BVM A;  4GLS C;  1L6U A;  3BK1 A;  1L4Z B;  4J3O D;  1E6E B;  2V4I B;  4HRO A;  4WUR A;  1CK1 A;  2N7J A;  3WCQ A;  2IJ0 A;  1XO3 A;  3P42 A;  2WXJ A;  2PVO D;  1QOG A;  2WXL A;  1R7S A;  1L6V A;  2BTE A;  1Q10 A;  4YTP B;  1GPX A;  1N5X A;  3OWE B;  2FBW B;  4NAW B;  2DYO A;  2OHF A;  1I4H A;  3NS1 A;  1E10 A;  1NEN B;  2H88 B;  3I9V 1;  1YN4 A;  4ZYS A;  5AUK A;  2GB1 A;  1QT9 A;  1FXI A;  2N9L A;  1JW9 D;  3AV8 A;  2SEB D;  3AE8 B;  5BYS A;  3ETR A;  3CWI A;  1JWS D;  1FNV A;  1VRA B;  5D3D A;  3AEE B;  2KN4 A;  2WXH A;  5FKA C;  1C4C A;  1FNW A;  3SFE B;  1UUP A;  2AQ3 B;  2DYM A;  2J53 A;  1JCK B;  2L83 A;  1JWA D;  2BB6 A;  1RM6 C;  1TZO A;  1KH0 A;  3NVV A;  2WDQ B;  2PTL A;  1WSP A;  2BT6 A;  2FUG 1;  2QJL A;  3AEB B;  3TEY A;  2BYT A;  1IBX B;  2INN E;  1JRP A;  1XCT L;  1EU3 A;  4RCO A;  3AN1 A;  3KWL A;  4A55 A;  1PDX A;  2H89 B;  4C7Y A;  1K50 A;  1T5X D;  1V97 A;  3FIL B;  3ZYY X;  4YWG G;  2AQ2 B;  3Q8E A;  2XN9 C;  3KQ4 A;  4XWT A;  3NRZ A;  4NZL B;  4YTM B;  3ZJT A;  1XXG A;  3O13 A;  4YSY B;  1A70 A;  3B9J A;  3BYY B;  3P4S B;  1FCL A;  3AE9 B;  3IT6 B;  1PGX A;  3IT4 B;  1CJE A;  1E9M A;  2OED A;  4P6V F;  3BZD B;  1C4P A;  4N6E B;  3PZ7 A;  3T3N A;  1Y56 A;  2DLB A;  2PKO A;  2W3S A;  3SEB A;  2MJD A;  1ZP0 B;  4DQO C;  2ON8 A;  1HZ6 A;  1FFU A;  1OFF A;  4XDC A;  3AMZ A;  1LO5 D;  1FRR A;  2BB5 A;  2QIE B;  2PIA A;  4REZ A;  3HVD A;  2IGD A;  2RPV A;  4GDK B;  5H92 C;  4HRS A;  3MHZ A;  1QOA A;  2BS4 B;  3LB8 C;  1PUT A;  5MPO A;  5BMI A;  3R2T A;  2RMM A;  3B2F A;  1SSN A;  1MHH E;  1ET9 A;  3Q69 A;  4RGO S;  1ZUD 2;  1IUE A;  3R8B A;  1YNT E;  1AYF A;  4HEA 1;  4ZRQ A;  3W2D A;  4M0W A;  2N9K A;  1YQ4 B;  1RYJ A;  4KKI A;  2IDY A;  1C79 A;  1VJK A;  4OZA A;  3AE2 B;  4C56 C;  3MFG A;  1HA5 A;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...