4EOYA

Plasmodium falciparum atg8 in complex with plasmodium falciparum atg3 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
GMPSLKDEVSFENRVAETHKIRSKYPNRIPVVIERANRSNLPIIEKKKFLVPMNMLVGEFKFILHQHINQSAYGSNMKLFRERTIYLFVNNIVPKTGLLMQDLYEMYKDEDGYLYMEYSSESSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1 light chain 3
publication title Structural characterization and inhibition of the Plasmodium Atg8-Atg3 interaction.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transport protein
total genus 37
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eoyA00
1WJNA 4G11A 2KHWB 2CU1A 3W1YA 4KIKB 2LVQA 3ZDMC 3O65B 4EZKA 3A33B 1H8CA 1WI0A 2RR9A 1XT9B 3AXCA 1Z5SB 1P0RA 2XEWA 2FCQA 1UD7A 2ZCBA 3PHWB 4GN1A 4NPNA 5J18A 5EDSA 1PQSA 3EHVA 3U7DA 4IC7B 1Y8RC 4ZRIA 3SDLC 4ANVA 3D32A 4NJ6A 1E5WA 4MSQB 4TUUA 4FULA 5DPRA 2VRRB 2PPHA 3PRMB 4EZJA 2KC2A 1V5OA 2L00B 1M94A 1V9JA 5DPWA 2WX0A 2EMSA 4GSWA 3A9KB 3ZNZB 2MBOA 3MTNB 4K7UA 1C3TA 3PVLA 4DWFA 4YL8A 2WWZA 1U4AA 4DHZE 4K7SA 3CF6E 2BWES 4XZ4A 3JSVB 2C7NB 2K6DB 1E7VA 4IG7B 5CHFA 1YQBA 1P98A 3KUZA 2R2QA 2KTFA 2M4NA 2UWQA 2FIDA 3A4SC 5L83A 5BO4B 3X0WA 2MCNB 4CYEA 5C1ZA 3QX1A 1D3ZA 4GIVA 2JWZA 2OOBB 2IY1B 2PE6B 4HK2A 3UINB 4A3OA 4AJWA 2FAZA 1ISNA 3H7SA 3X23A 2DAFA 3A1QB 3B08A 2BPSA 1GG3A 4K1RB 3TMPB 2KDFB 2MP2A 1EF5A 3A9JA 3EC8A 1V2YA 1WMHA 3SHQA 3KUDB 2HD5B 4RM9A 3JVZX 2O2VB 5JZEB 4JGHB 5FR6A 2KQ7A 2O6VD 2LJ5A 4BKSD 3GZNI 1NI2A 1OQYA 1XQQA 1ZKHA 4MH0E 3N3KB 3V61A 1S3SG 1Q1OA 4DBGA 4B95A 4EOYA 2HJ8A 2N9PC 2ZVNA 2NPTB 2W9NA 2KN5A 3VQIA 1Q0WB 1MG8A 3PT2B 1RRBA 3ZRFA 3W1SA 3M3JA 4MJSA 2WX1A 5LXIB 2IO1B 2JZZA 3DPDA 1E8YA 3ZNHB 3QQ8B 2KDIA 5TR5A 2GMIC 5IAAC 2IZVB 4MGZE 1VCBA 4AJYB 4FBJB 2UYZB 4HJKA 5AEKB 3IG3A 4NJ7A 1GNUA 2JUOA 2YLMA 5D94A 1BT0A 5D6JB 4DDID 4KZ0A 1V5TA 2KNBA 2MA9B 3QWZB 3TL5A 4DK5A 2CHXA 1KLVA 3SD5A 4TQ0A 1RLFA 5G2NA 1Z2MA 4BKGA 2MBQA 2Y5BB 1K8RB 1UZXB 1E8XA 1WM3A 3UF8A 1T0YA 2PEAA 5CX3A 4BOZB 2K8CA 4PS7A 1AARA 3TIXA 3VAWA 3MJWA 1NBFC 3DVGX 4TV3A 4ANUA 2AWTA 2KMCA 4HWIB 5J17A 2CS4A 4W9GA 3APDA 3PSEB 3VUYA 4F7ZA 3OAWA 4DHJD 4GDLA 1KM7A 2N4FA 4W9EA 4AP4C 3NS8A 2FUHB 5DPSA 4M8MA 4IM0A 1L2NA 4KZCA 4B6WA 2KLCA 3DQVA 3UIPB 4II3B 2MSED 3ZDTA 3C0RB 2N1WA 2N9XA 4ZYNA 3ZVVA 3N32A 4MELA 3W1SC 3PGEA 2D3GA 1WZ3A 1YIWA 2BKRB 3KVFB 1A5RA 4J6IA 2GBMA 1WY8A 3WANA 1ZW7A 5JHAA 4N9F4 2AL6A 2M8SA 1WXVA 1WIAA 2BKFA 1YD8U 1WFYA 4KSKC 4WWPA 3KUCB 3I3TB 2V1YA 3T8MA 2IO3B 1R4MI 2RPQA 1I35A 2GBNA 3P2BA 3WAPA 2M1MA 2C7MB 2L0TA 2J7QB 2Z0DB 4NAWB 5C23A 3B0AA 3OJ3A 3RULA 2C5LC 1IPGA 2I1KA 3L13A 4ZRKA 4TKNA 4DHZB 3ZW3A 2I1JA 3KH0A 4FJVB 3DDCB 2NBVB 2KXJA 4WJPA 3RZFA 2KDEB 4HXDA 1P3QU 2LVPA 1WF9A 3K9PB 2D2QA 4W9JA 4W9HA 3KYDD 4LCDE 1GUAB 2MBHA 3QK0A 3A1QA 2MWSB 4OVUA 3VUWA 4I6NB 2BYEA 1VD2A 4MM3A 2KANA 5DPTA 5AZHA 3DBHI 1WJUA 4F8CB 1TZ1A 2A4ZA 2DZJA 2JXXA 4HCNB 3PLVA 3ALBA 3U30A 4NQLB 4DXAB 4EUTA 3RT3B 1TTNA 2XK5A 2ZNVB 3PHXB 1LQBA 1WX9A 2L3ZA 4W9KA 1SIFA 2JRIB 2B3AA 3WIMA 2ZCCA 1WGYA 4WJNA 4GOCA 2LVOA 4W9DA 3DBLI 2HE7A 3TCAA 1RFAA 4LJPB 4FN2A 3PV1A 2LD9A 2ZJDA 4IWOA 1P1AA 4MGYE 5JH5C 2IBIB 2NPTA 4HDOA 4MGIE 4BOSC 2JVCA 3DCGA 4IWQA 2BYVE 4AWJA 2G4DB 1V80A 3B1LX 3PLUA 1WYWB 4JQWC 2Z59B 2KX3A 5J2RA 2LWPA 1V86A 2G4SA 2O6VA 4GDKA 4BKSA 2DZKA 3AULA 1WE7A 1WX8A 2EMTA 4EZLA 3SU8X 5E6PA 5CTRC 2Z0EB 3T9LA 1R4NI 2K1FA 4FJZA 2AYOB 2NS5A 3ONSA 3WA0A 2C60A 2DYOA 3VDZA 2KZRA 2AL3A 1WXAA 2HTHA 4E3CA 2N7EA 4EFOA 4GXBA 3QIJA 2DYMA 4HVBA 4G50A 2JF5A 1LFDA 2NCNA 2D07B 2XBBC 4I6LB 3VTWA 4ZDVA 3QCAA 3ZKJC 4EEWA 4ICUA 1S1QB 2KJ6A 2ZVOA 5L95C 2L7RA 2NR2A 3H7PA 4PYZA 4RMAA 2A5UA 3HIZA 5AZGA 2WDTB 4FHJA 3VH4B 4EKUA 4BBNF 3VHTC 2MBBB 3TJPA 4AUQC 2ZPNA 2MLBA 1CMXB 2MP2B 2V4LA 3A9JB 4FADA 2KFKB 2DZIA 1WMHB 4I6PA 3M95A 3BINA 1OGWA 3ENEA 4LDTB 3RD2A 1WR1A 2J0MA 1WGRA 2IYDB 2MW5A 3EECA 4M0WB 1UH6A 3PRZA 2IY0B 4ANXA 1Q5WB 2PJHA 4BKTA 1J19A 1XD3B 2L05A 3DBSA 1WXSA 1I42A 4MSMB 1X1MA 4II2B 3ZNGC 2LXCA 2FCSA 3RCZA 4DDGD 2LASA 3APFA 3OJ4B 5CHWA 1GC7A 5KHOA 5AZFA 3Q3FA 1UBQA 2KFJA 4KIKA 3WALA 3PPAA 3VFKA 3PTFC 2K6QA 2KK8A 4MJSB 3HHMA 4NQKE 4W9CA 3K9OB 4WQOB 2NBUA 1F9JA 4ICVA 2V3SA 3VUXA 1P9DU 3Q3JA 3V6CB 2ZZPB 2R2OA 3L0WB 3NY5A 3OLMD 2G45B 4PYUA 4AOFA 3VXWA 5IA7A 5LXHA 2CHZA 3NZSA 4MEMA 4XC2A 2D11A 3ECIA 1EO6A 3VTVA 3JYUA 1WE6A 3V60A 2L0FA 2YVCA 4CHKA 5JHBA 3A9KA 4E74A 4NNJB 2K8BA 3ML9A 1YX5B 2KQSA 4FA6A 3UQBA 3ZLZA 2KLGA 4IM2A 1FXTB 3JSVA 4X57B 3ZIMA 3QHTA 4G0NB 3DVGY 2NVUI 2C9WB 4PS8A 1EF1A 1E7UA 3NHEB 1OEYJ 2DAJA 3VTUA 4GB9A 4A20A 2KD0A 1HE8A 1SE9A 1V49A 3CSFA 1E8WA 4BFRA 1ZGUB 4GMVA 3UIOB 2KO3A 4GDLB 4WWOA 2J0KA 3ZTCA 2DENB 3CMMB 3DOWA 3NZUA 5G55A 4ASWC 2M17A 3R7RA 3H9DA 3CSTA 1TBEA 2KC1A 1L7YA 3RYTA 2FNJB 1WX7A 2REXA 5GMVA 2N1VA 3L16A 2K25A 4WJOA 2O2VA 3ML8A 4A3PA 3UGBB 2MX2A 1SGHA 2KWUB 3HM6X 1WH3A 2DYBA 3NOBA 2LGXA 2IO0B 3A4RA 2KTRB 3DVNU 1V6EA 3LDZE 2ZEQA 4KV2A 3APCA 3WAOA 2JY6A 4W9FA 1IP9A 4G3XB 2LRUA 2G3QB 2KOXA 3LJ3A 4WJQA 2D10A 1QZEA 5D7GA 2LRWA 2N9EB 3GOEA 2FCMA 3R66C 4JIOU 3L54A 3ZRCA 4FHKA 1G6JA 3L17A 3PS6A 4OVVA 3R7QA 2AEHA 3PZDA 2IO2B 1GC6A 1WRDB 4LJOB 2DHZA 2WYQA 2ZNVC 1YX6B 4WWNA 4GU2A 3DVNV 1WM2A 3QARA 2DX5B 3IHPC 3KW5B 5E6NA 1NDDA 1IYFA 1H4RA 2MBEA 2N7DA 1UELA 4KDLB 2GBKA 4K7WA 3U8ZA 4HLEA 3BY4B 1EUVB 2KJHB 2OJRA 2KFKA 3L08A 4ZRJA 2LI5A 3AU4A 2KVRA 2ASQA 3RUIB 2CKHB 4LDTD 4JLCA 2J0JA 2JZ3B 2KKCA 2XK5B 2MQJA 3L10B 4BBNC 3H6NA 4HPMB 1WGHA 4CO7A 2JT4B 5CHVC 1KOTA 4GGQA 1KJTA 1JRUA 2GBJA 3RZWC 3QA8A 1WJ4A 3N30A 2M0XA 2FCNA 2RGFA 1GJZA 3S2AA 4KVGB 2ZPYA 2CR5A 1OEYA 2K39A 1WR6E 4HCPB 2CHWA 4JL9A 3KYCD 2PE9A 3IFWB 4KSLC 5HKHA 4W9LA 1C1YB 1YJ1A 2LGYA 2QHOA 2EKEC 4MDKE 3M62B 2FIFA 2BF8B 3ZTDA 1E90A 5KHQA 2O6VB 4GDKB 1WZ0A 4RM8A 2LGDA 4URKA 4WAAA 1V81A 1UBIA 3QAQA 4ANWA 3TBLD 1J0GA 4M8NA 4F1SA 1UGMA 4IUMB 3HK0A 4PS3A 4MGKE 3VH3B 2KJRA 3ZNID 4NY0A 4E71A 3VVWB 2KWVB 2LZ6A 4K81A 3PREA 3R3MA 4NAWA 2KWCA 3IVFA 4KDIC 5LLIA 3AI5A 4IW0A 2KMAA 3ZO5B 3ZUNA 3QJZA 2KX0A 1WJ6A 2DZMA 2JPHA 2LUEA 1WGDA 1J8CA 3H7PB 4P7IA 1E8ZA 5D2MB 2MRPA 1TGZB 1OTRB 3IBEA 3QC8B 4B9KA 4HPLB 1LM8B 2L8JA 4HDQA 3WAMA 2KDBA 3DBRI 3HM3A 2RSUA 2RD0A 4IM3A 1RAXA 2K8HA 2L76A 4W9IA 1WXMA 2GBRA 3PRPB 3V6EB 2BGFA 3M63B 2BYFA 3MHSD 3EFUA 4XX5A 2BWFA 2JRHA 4IWPA 5E6OA 2NBWB 1WGGA 3JW0X 1LXDA 3V62A 4FLHA 3UQAA 2C7HA 3H1UA 2LXAA 2KTRA 4FJYA 4BVUC 4DHJB 5DCNA 4TQ1A 2GOWA 3AU5A
chains in the Genus database with same CATH superfamily
1WJNA 4G11A 4YSZB 2KHWB 1TKYA 4EZKA 2VH2A 3Q8BA 2ZCBA 5EDSA 3EHVA 4ZRIA 1Y8RC 4NJ6A 4MSQB 4TUUA 4FULA 4HJGE 1T6BX 2PPHA 3PRMB 4EZJA 3ZNZB 4K7UA 4ZHPA 3I57A 4YL8A 4DHZE 4YXDB 5JXVA 3KLSX 1C76A 2Z8LA 5CHFA 3AB5A 1YQBA 3RNCC 2R2QA 2KTFA 1ZXHA 1D3ZA 1YN5A 1QOGA 5HHDG 3H7SA 3X23A 4KGTA 1HTOA 3TMPB 1D6EC 2N0SB 2BVCA 1IGCA 1V97A 5C3JB 4RM9A 2AQ2B 3RFZB 3ZYYX 1NI2A 4S0RA 2G9HD 4OHJA 1ZKHA 1S3SG 3LB8C 3Q3MC 4YTPB 3DHHC 5D3DA 2NPTB 1MPEA 2KN5A 4M01A 1RRBA 3RI7C 3M3JA 5LXIB 2WX1A 2IO1B 2N9KA 1E8YA 2KDIA 5IAAC 1BUIC 2IZVB 1UWXA 3N20C 1TY0A 1FXIA 1T5XD 2RDHA 3GB1A 1GNUA 1BT0A 5D6JB 4DDID 2KNBA 3QWZB 4RGMA 1Z2MA 1E8XA 3HVDA 2CJNA 4TSSA 1I4GA 1FFUA 1P7FA 2QMTA 4HWIB 1XO3A 1WSPA 4YSXB 2CS4A 4F7ZA 3OAWA 3NS8A 2NMQA 1L2NA 2KLCA 2MSED 3ZDTA 2B76B 2E6XA 2D3GA 1N62A 4JWSC 1YIWA 4J6IA 1WY8A 1EWCA 2WLBA 1B1ZA 1L0YB 1A70A 1WFYA 1JWAD 4KSKC 3DHGC 3I3TB 2V1YA 3T8MA 2RPQA 2J52A 1I35A 3WAPA 1R7SA 2M1MA 4XWWA 2C7MB 2DBYA 4L2YA 4ACFA 2QSDA 2J7QB 5C23A 4ZRKA 5G5GA 1KF6B 2WXKA 3DDCB 2KDEB 1P3QU 4W9JA 3AEDB 3MC8A 2W3SA 2MWSB 4I6NB 4MM3A 3NRZA 1VLBA 1FCCC 4F8CB 2Q5WD 1D4BA 2JXXA 4XWTA 5BMIA 3U30A 4NQLB 1HXYD 1TTNA 1LQBA 2L3ZA 3DBLB 1SIFA 2JRIB 2PVOD 4WJNA 1F1HA 2JXTA 4W9DA 3DBLI 2BB5A 1RFAA 4FN2A 4US8A 1P1AA 1MI0A 3NVWA 3V05A 2K5PA 1F77A 3SFDB 2IBIB 4HDOA 5AUIA 3V3XA 4KGSA 2DNFA 2VZKB 3FILB 2PIAA 4AWJA 4US9A 2DLBA 1V80A 2N9LA 2KDMA 5J2RA 4WAFA 4BKSA 2IGHA 3AULA 2EMTA 3FC4A 1BMLC 2Z0EB 4FJZA 2BW2A 3VR9B 2AYOB 3VDZA 2DYOA 1C9FA 4DQOC 1HA5A 4G50A 3VTWA 4I6LB 5H92C 4ZDVA 3QCAA 4ICUA 3TEYA 3VH4B 3VHTC 4AUQC 5C2TB 4FXCA 3L4PA 1FD6A 1I4HA 3BINA 3ENEA 1I4QA 3AV8A 2J0MA 2MW5A 2IYDB 3FKYA 3EECA 3AMZA 4II2B 2LXCA 3RCZA 4WURA 1FRRA 3Q3FA 4JX1C 4O1NA 1WGKA 3WALA 3PTFC 4H2AA 1F9JA 4REZA 1BXTA 1YJJA 2ZZPB 3B9JA 3NZSA 4XC2A 2D11A 1EO6A 1YQ3B 3JYUA 2YVCA 4CHKA 1F0ZA 1L4DB 2WXMA 2BS4B 1YX5B 2BYTA 4FA6A 5MPOA 1CQVA 5FK9C 1UWMA 3DVGY 1ZE3D 1V1OA 1EF1A 1I7HA 2L83A 3NHEB 1OEYJ 4WWMA 3VTUA 4GB9A 2WXNA 3EA6A 1HE8A 4EE2A 2KO3A 4WWOA 2J0KA 4ZOHC 2M0AA 3NZUA 4ASWC 2MEKA 3HVZA 3H9DA 1L7YA 3RYTA 2RMMA 4WJOA 4N59A 2JSVX 3J9CA 2K3UA 3ZXRA 2J42A 3A4RA 4JE3B 3APCA 4W9FA 2KOXA 2D10A 2LRWA 3DWMA 4FHKA 1G6JA 3NUHB 3NZ3A 3GS2A 1LO5D 2W82A 2DHZA 4IKGA 1JWBD 4GU2A 4WQMA 1L4ZB 5E6NA 4XE0A 2N7DA 3U2SC 2KACA 3L08A 1GB4A 3MP9A 1XLNA 2CKHB 1T0RC 1ET9A 4IDIA 2JZ3B 2XK5B 2MQJA 3L10B 4OZCA 2V3PA 1KOTA 5CHVC 3QA8A 1WJ4A 3U4EG 3N30A 4HKQA 4RGOS 4A8XC 2CR5A 4Q2JA 1WR6E 4HCPB 4YTNB 5HKHA 4KSLC 4W9LA 1C1YB 3TSSA 2EKEC 4MDKE 3M62B 4RFBA 3VRAB 1WZ0A 2LGDA 4URKA 1C4AA 1SE3A 1UBIA 3QAQA 4ANWA 4F1SA 1JWMD 1HEZE 3HK0A 3KWVA 3VH3B 3VVWB 1MHXA 3BYYB 3PREA 2AQ3B 4KDIC 3IAS1 5LLIA 4C00A 3AI5A 2BT6A 1J8CA 1WGDA 2WU2B 2MRPA 2WGSA 3QC8B 3IBEA 4B9KA 1KLUD 2RD0A 1QT9A 4IM3A 1KRHA 3GP7A 2E3TA 3Q8FA 3I63C 1XEEA 4A90A 3PRPB 3V6EB 2BGFA 4XX5A 2BWFA 2JRHA 3AH7A 3V62A 4ZYSA 5AUKA 2KTRA 2OJWA 4BVUC 1JMLA 3AU5A 2JYEA 4M02A 1E7PB 3FILA 1H8CA 1WI0A 2RR9A 4NPNA 3PHWB 2INNE 3ZGZA 1T3QA 1TJEA 1E5WA 5E6JA 1V9JA 4LK0M 2EMSA 3MTNB 3EUB2 2WWZA 4XYCA 2H88B 3AE9B 3JSVB 5IN7A 4KKJA 2LUMA 3A4SC 1JCKB 2LEKA 5BO4B 3X0WA 2MCNB 2OOBB 2FBWB 1ISNA 1N61A 2XN9C 4MM3B 2KDFB 3EC8A 2ON8A 3AE4B 2O2VB 1WYGA 1T0QC 2O6VD 1XLPA 1XQQA 3V61A 3P42A 4DBGA 4YT0B 2ZVNA 2W9NA 3C8YA 1MG8A 3PT2B 3W1SA 3ZJVA 4USAA 3AE2B 2Y5PA 1OFFA 3DPDA 3ZNHB 5TR5A 4MGZE 4HJKA 4ARCA 3IG3A 2HTME 3IT4B 4NJ7A 1SEBD 2YLMA 4KKIA 2MJEA 1V5TA 2MA9B 2CHXA 5HFYA 3SD5A 5G2NA 4BKGA 2Y5BB 1UZXB 3UF8A 1DOYA 4BOZB 2K8CA 3TIXA 1Q10A 4ANUA 1I4RA 2KN4A 1VJKA 2KMCA 2QC8A 4AS1A 3APDA 3PSEB 2BBCA 1FPYA 1YOVB 4AP4C 2XNAC 1EWYC 1WXQA 1J7BA 4IM0A 1IBXB 3CWIA 4KZCA 3DQVA 3ZVVA 1TS2A 2KYWA 3KVFB 2YEPF 3NG0A 2GBMA 3WANA 1ZW7A 1WXVA 3AEGB 2X8XX 1R4MB 4K3BA 2IO3B 1R4MI 3C19A 5HG2A 3OJ3A 3TEXA 2C5LC 4TMAB 2LHEA 4DHZB 3ZW3A 2JWUA 2L1AA 2NBVB 1VZ7A 4HXDA 2LVPA 2MJDA 3K9PB 4W9HA 3KYDD 2MBHA 3A1QA 3MC0B 1KLGD 5AZHA 1WJUA 4PT5A 2DZJA 3ALBA 4DXAB 4EUTA 3RT3B 2XK5A 2SEBD 3PHXB 3WIMA 1N5WA 4P1BC 3TEZA 5FKAC 4GOCA 4PK1A 1WRIA 3Q3OC 2WXQA 2ZJDA 3DCGA 5BMHA 2G4DB 1QOBA 4JQWC 4IOIE 2GB1A 2KX3A 3AE7B 2G4SA 2IGGA 3U7ZA 2DZKA 5T8IA 1F2RI 4UDUC 1PUTA 1UGJA 4EZLA 2LJIA 2NS5A 3ONSA 4OZBA 2C60A 3N1YC 2KZRA 3RNAC 4E3CA 4EFOA 1QLBB 3QIJA 2DYMA 4HVBA 2NCNA 2XBBC 1NEKB 4EEWA 2KJ6A 5L95C 3AEAB 2L7RA 2A5UA 5LNK1 2MBBB 2ZPNA 1CMXB 2MP2B 3A9JB 3AECB 1WMHB 3Q8AA 1WR1A 1L6UA 4M0WB 4MT5A 2PJHA 1J19A 1I42A 4MSMB 4DDGD 2FCSA 2LASA 3APFA 5CHWA 5AZFA 1K50A 3AE6B 2KFJA 2I2YA 2K6QA 4W9CA 4NQKE 2ONQA 4ICVA 2V3SA 3Q3JA 5LXHA 5IA7A 3VXWA 3V60A 2V0GA 3SEBA 4NNJB 3NS1A 4B0EA 2KLGA 3JSVA 1VDVA 4P16A 3BVMA 4X57B 4D2KA 2KMMA 1V1PB 2NVUI 4PS8A 3P63A 1RFKA 4HROA 1OQQA 4A20A 3CSFA 1SE9A 1V49A 1XLQA 4GMVA 4NZLB 3UIOB 3ZTCA 2DENB 3CMMB 5G55A 3CSTA 1TBEA 2KC1A 2FNJB 1WX7A 2LFIA 3L16A 1FXAA 2L32A 2O2VA 4NAMA 2MX2A 1DGJA 1WH3A 3NOBA 1KH0A 4A9AA 1IUEA 2KTRB 3DVNU 3WCQA 4ZRPA 3NJTA 2I38A 5D7GA 2N9EB 2Y5CA 1E0ZA 2PKOA 1UUPA 3PZDA 3KWLA 4A55A 2WYQA 1STEA 3QARA 1AYFA 5IKCM 1FM0D 2MBEA 3NVYA 1UELA 2GBKA 4K7WA 2KJHB 3O13A 3E9SA 4JLCA 4HPMB 1F2RC 4CO7A 2GI9A 1C79A 1QKZA 2K39A 1OQRA 3RNGC 1QQRA 1IBXA 2D3CA 1YJ1A 4P1CC 2FIFA 2BF8B 3ZTDA 5KHQA 2O6VB 1C78A 4RM8A 1JQ4A 1J0GA 1NENB 1VZ6A 1N63A 2SAKA 2AX5A 2K9XA 1GAQB 2AQ1B 1GOZA 3R3MA 2KWCA 1VRAB 3ZO5B 3T3OA 3QJZA 2JPHA 2LUEA 2WXGA 4P7IA 3DBRB 1OTRB 4XDDA 4HPLB 1Y56A 4HDQA 1N60A 3DBRI 3HM3A 4C7YA 3W9CB 3BWUD 2K8HA 1YN4A 1WXMA 2GBRA 3AE8B 3M63B 1FRDA 2QILA 3EFUA 4RCOA 5E6OA 1SF0A 1K52A 2NBWB 1YN3A 3AEFB 3Q8CA 3P4SB 2PMVA 2WNMA 2LXAA 4OVZA 4RGTA 1J7CA 3ETRA 4HEA1 4FJYA 3E56A 2EKIA 1SXTA 4KIKB 2LVQA 3PZ7A 4ZRQA 3ZDMC 3Q69A 1LGRA 2VH1A 4HRSA 1P0RA 1UD7A 5J18A 1GPXA 2INDC 4IC7B 3D32A 2JU6X 2VRRB 2KAJA 1V5OA 2V4IB 1ZPSA 4GSWA 2CJOA 3A9KB 2MBOA 4DWFA 2RDBC 4K7SA 2BWES 4XZ4A 3IXSA 2ZW0A 1XCQL 1P98A 5EE9A 2M4NA 5L83A 4GIVA 2JWZA 3Q3NC 2IY1B 4HK2A 4L23A 3UINB 4AJWA 2D3BA 2FAZA 2G1EA 3TEWA 3A1QB 1GG3A 1IGDA 4YSYB 2MP2A 1EF5A 3A9JA 1WMHA 2HD5B 3JVZX 5JZEB 4JGHB 1CK1A 2KQ7A 2H89B 4M0WA 2LMCA 3N3KB 1NI3A 3W2DA 1Q1OA 4ITKA 4ARIA 4B95A 4EOYA 2HJ8A 5BYQA 1FMAD 3ZJTA 1XLOA 1ZUD2 1SSNA 2JZZA 2FUG1 3QQ8B 1SJHD 4FBJB 2UYZB 3BK2A 2YEPB 5AEKB 1SIJA 2JUOA 2INCC 5D94A 1D5MC 4KZ0A 3TL5A 4DK5A 1T0SC 2MBQA 1K8RB 1T0YA 5H8YE 2JZPA 4PS7A 1AARA 4RH6A 3MJWA 3ZXVA 1EU3A 1V1PA 4TV3A 2J4XA 2AWTA 5J17A 3LYYA 4W9GA 5EE0A 5IOIA 4DHJD 2WXRA 1C77A 4W9EA 2FUHB 3KQ4A 5DPSA 4RGNA 4B6WA 2WDVB 2N1WA 2N9XA 4ZYNA 1JWUD 3N32A 4MELA 3W1SC 1WZ3A 1UF0A 3AE3B 1A5RA 2BS2B 4N9F4 2AL6A 1WIAA 1YD8U 1FO4A 4WWPA 3KUCB 2WDRB 3PO0A 4J3OD 2GBNA 3P2BA 4NAWB 1IPGA 2I1KA 3L13A 3ABVB 4C56C 4YTMB 2I1JA 3KH0A 4JPSA 4WJPA 3RZFA 1WF9A 4CQNA 2HJ1A 2Y3AA 3QK0A 3FAHA 2BYEA 1VD2A 5DPTA 2KANA 1NYRA 3HRDD 5EE3A 3W5UB 1TZ1A 3PLVA 1FEHA 3N1XC 2ZNVB 1D5XC 1WX9A 1QOAA 1WGYA 2PW9A 4LJPB 3PV1A 4IWOA 5JH5C 4MGIE 1MVKA 4BOSC 1AN8A 2BYVE 4XDCA 1YJIA 3VR8B 3PLUA 1WYWB 3I5JC 1ZOYB 2IJ0A 2LWPA 2EELA 1V86A 2O6VA 1F52A 1WE7A 1WX8A 3SU8X 5CTRC 2K1FA 3ZJUA 3R2IA 3WA0A 1E9MA 1QOFA 4LNOA 3Q8EA 2N7EA 1L0XB 2WXFA 4LNKA 2D07B 3ZKJC 3NVZA 1S1QB 2ZVOA 2BS3B 3AEEB 2NR2A 3LXFA 3DWGC 3P1MA 4PYZA 5GXGB 4A6QA 1VZ8A 5AZGA 2WDTB 4GLSC 4BBNF 2INPE 2MLBA 4FADA 5D3IB 3Q6BA 3RD2A 2ACZB 4LLGM 3EGRA 3PRZA 1Q5WB 4HPPA 3R2TA 1XD3B 4LNIA 2L05A 1TKGA 2QJLA 3OJ4B 4DXGA 3T3NA 4KIKA 3P4QB 1XXGA 3PPAA 3VFKA 2KK8A 4MJSB 3HHMA 3UI3A 1I4XA 2JX5A 3VUXA 4LNFA 2LGSA 3V6CB 2PLPA 2R2OA 1HQRD 4PYUA 4MEMA 4C7ZA 5BYRA 3A9KA 4E74A 2K8BA 3UQBA 2HDEA 1MG4A 3ZLZA 4IM2A 1FXTB 3RNEC 1KFYB 3QHTA 2C9WB 4BFRA 1E8WA 4GDLB 2M17A 3R7RA 1ENFA 3BVGA 5GMVA 2LGIA 2N1VA 2W54A 2K25A 1FNUA 3ML8A 2W3RA 4A3PA 3DHIC 2KWUB 3CIRB 4QAYA 1P7EA 2LGXA 1N5XA 3GE3C 3LDZE 2WXIA 2ZEQA 4KV2A 1N6ZA 5FR3A 1JW9D 1IP9A 2WS3B 4G3XB 3LJ3A 1QZEA 3GOEA 1JALA 3B2GA 4C4VB 2IPKD 3L17A 3PS6A 4OVVA 3IT6B 2IO2B 1DOXA 2ZNVC 1YX6B 1VR9A 5BYSA 4N58A 2DX5B 2QIEB 1HTQA 1JWSD 1NDDA 1MJDA 1H4RA 4KDLB 4BZAA 3BY4B 1EUVB 2KFKA 4ZRJA 2LI5A 2ASQA 4LDTD 2DWQA 3H6NA 3HUIA 4GGQA 1KJTA 1JRUA 2GBJA 1KTKA 2FCNA 2RGFA 3OWEB 1GJZA 1ET6A 4KVGB 1OEYA 2KWDA 1RM6C 2BQQA 5HI1A 2CHWA 1FIQA 3KYCD 3IFWB 2LGYA 3R8BA 1E90A 4GDKB 2WXJA 1V81A 2NTSA 1RWSA 3SR6A 3TBLD 1UGMA 1HZ5A 2WU5B 2KJRA 3ZNID 2LZ6A 2KT7A 4NAWA 3IVFA 1FCLA 4K3CA 4IW0A 3MHZA 3ZUNA 2KX0A 1WJ6A 3H7PB 4ZHOA 3OG5A 1LM8B 2L8JA 2BB6A 3WAMA 2RSUA 3SFEB 3N1ZC 4WIPA 4W9IA 2BYFA 3MHSD 1WGGA 3ZQ4A 4FLHA 2C7HA 3H1UA 4NJCA 4DHJB 2L52A 5E6PA 2GRIA 1YNTE 2CU1A 3W1YA 3O65B 3A33B 1XT9B 3AXCA 1Z5SB 2XEWA 2FCQA 1ACCA 4GN1A 1K51A 1PQSA 3U7DA 2D5GA 4RF1A 3SDLC 4ANVA 5TSSA 5DPRA 3RNBC 2KC2A 2L00B 1TS4A 1M94A 5DPWA 1D5ZC 2WX0A 1C3TA 4P6VF 1WWTA 3PVLA 1U4AA 3CF6E 1L6VA 2TSSA 2KQ4X 1V8CA 2C7NB 2K6DB 1E7VA 4IG7B 3U52E 2KVZA 3KUZA 2UWQA 2FIDA 2V9HA 4CYEA 5C1ZA 1TZOA 4R3DA 3QX1A 2PE6B 4A3OA 2DAFA 3B08A 2BPSA 1HZ6A 4K1RB 2D3AA 2WXOA 1V2YA 3GZNB 3KUDB 3SHQA 2IGDA 4MH8A 1FNVA 5FR6A 2LJ5A 4BKSD 2M56B 3GZNI 1M4VA 2NTTA 1OQYA 4N6EB 4MH0E 2K0PA 1SE2A 1NYQA 1CJEA 2N9PC 2V3NA 2N7JA 5I4DA 3BK1A 2JYTA 3VQIA 1Q0WB 4WH4A 3ZRFA 1XCTL 4BAXA 2PVGC 1SJED 4MJSA 2LHDA 3H8HA 2GMIC 1VCBA 4AJYB 1ESFA 2ICIA 1YQ4B 1E6EB 1C4PA 3W5VB 2OHFA 1KLVA 4TQ0A 1RLFA 4RNAA 2QDFA 1WM3A 1SE4A 2PEAA 5CX3A 3VAWA 1NBFC 3DVGX 1JROA 3VUYA 2JQRB 4B0MA 4GDLA 1KM7A 2N4FA 2MJ3A 1B9RA 4M8MA 5EE1A 1SBBB 3UIPB 4II3B 1MFWA 2WQYB 3C0RB 3PGEA 2QEJC 2BKRB 5JHAA 2M8SA 4KX6B 3PZ8A 2BKFA 3AE1B 1TIFA 1PFDA 1SB3C 2L0TA 2Z0DB 3IAM1 4YWGG 4C4VA 3B0AA 3RULA 4TKNA 1FNWA 2X38A 4FJVB 2KXJA 1ZDVA 2MH7A 2M19A 2D2QA 3DBHB 1JRPA 2PTLA 2MHJA 4LCDE 1GUAB 4OVUA 3VUWA 3DBHI 1L5PA 2A4ZA 4HCNB 4HKZE 3MJ5A 4W9KA 2B3AA 2ZCCA 3RPFC 2LVOA 2HE7A 3TCAA 1J7AA 2LD9A 4MGYE 4M00A 4DXFA 2NPTA 2JVCA 4IWQA 3Q2AC 3P4RB 3B1LX 1XF5L 3BIID 2Z59B 3BVZA 2WXPA 2UU7A 1R4NB 4GDKA 1PDXA 1L0VB 3T9LA 1R4NI 1E10A 4MACA 1QILA 2AL3A 1ZXIA 1WXAA 2HTHA 4GXBA 1GB1A 2JF5A 1LFDA 4L1BA 1C4CA 1FFVA 3H7PA 1I4PA 4RMAA 3AN1A 3HIZA 4FHJA 4EKUA 2ZW1A 1TYGB 3TJPA 2V4LA 2KFKB 2DZIA 4I6PA 1ZP0B 1CZPA 1NVID 3EFCA 3M95A 1OGWA 3URYA 4LDTB 1WGRA 2QCZA 1UH6A 1DYQA 2IY0B 3RN9C 4ANXA 4BKTA 1ZDXA 3DBSA 1WXSA 1X1MA 3ZNGC 5KHOA 1GC7A 5IO9A 1UBQA 3RNFC 4AQ7A 2OEDA 3K9OB 3AE5B 2NBUA 4WQOB 1P9DU 3RMKC 3NY5A 3L0WB 3OLMD 2G45B 4AOFA 2CHZA 2R61A 3ECIA 3VTVA 2GLSA 1WE6A 3BZDB 2L0FA 5JHBA 2WP9B 5IP4D 3NVVA 3ML9A 2KQSA 3GE8C 4XGAB 3ZIMA 4G0NB 2BTEA 1E7UA 2DAJA 3AEBB 3TUOA 1AW7A 2KD0A 1ZGUB 1TS5A 3DOWA 2VZKD 2REXA 1TT5B 2WHIA 3UGBB 1SGHA 3HM6X 2DYBA 4JWUC 2IO0B 1UNSA 2IDYA 1EM7A 4KGRA 1EU4A 1V6EA 1QF6A 1K53A 3I9V1 3WAOA 2JY6A 2LRUA 2G3QB 4WJQA 4C80A 1PGAA 1PYWD 4OZAA 3B2FA 2FCMA 3R66C 4JIOU 3L54A 1YMHE 3ZRCA 3R7QA 2AEHA 4LJOB 4S17A 1GC6A 1WRDB 3AM9A 4WWNA 3VRBB 3DVNV 1WM2A 1MHHE 3IHPC 3KW5B 1IYFA 2CU3A 3U8ZA 4HLEA 4OW0A 2OJRA 3Q14C 3MFGA 3AU4A 2KVRA 4RF0A 3RUIB 3BYTB 2J0JA 2RDGA 2KKCA 4BBNC 4LNNA 1WGHA 2JT4B 1ROEA 3RZWC 2M0XA 4LTUA 3S2AA 2ZPYA 2WXHA 2WDQB 4JL9A 2PE9A 2QHOA 5G5HA 5BMGA 1RYJA 4WAAA 1TS3A 2W55A 1AWDA 1DOIA 4M8NA 2WXLA 1TKEA 4IUMB 4PS3A 4MGKE 2FE8A 4NY0A 4E71A 2KWVB 1PGXA 2K22A 4K81A 3P4PB 2KMAA 2DZMA 1E8ZA 1PGBA 5D2MB 1TGZB 2KDBA 2RPVA 1RAXA 2L76A 3N9YC 4IWPA 1TY2A 3JW0X 1LXDA 3MC9A 3UQAA 5DCNA 2J53A 4TQ1A 2GOWA
chains in the Genus database with same CATH topology
1WJNA 4G11A 2KHWB 2CU1A 3W1YA 4KIKB 2LVQA 3ZDMC 3O65B 4EZKA 3A33B 1H8CA 1WI0A 2RR9A 1XT9B 3AXCA 1Z5SB 1P0RA 2XEWA 2FCQA 1UD7A 2ZCBA 3PHWB 4GN1A 4NPNA 5J18A 5EDSA 1PQSA 3EHVA 3U7DA 4IC7B 1Y8RC 4ZRIA 3SDLC 4ANVA 3D32A 4NJ6A 1E5WA 4MSQB 4TUUA 4FULA 5DPRA 2VRRB 2PPHA 3PRMB 4EZJA 2KC2A 1V5OA 2L00B 1M94A 1V9JA 5DPWA 2WX0A 2EMSA 4GSWA 3A9KB 3ZNZB 2MBOA 3MTNB 4K7UA 1C3TA 3PVLA 4DWFA 4YL8A 2WWZA 1U4AA 4DHZE 4K7SA 3CF6E 2BWES 4XZ4A 3JSVB 2C7NB 2K6DB 1E7VA 4IG7B 5CHFA 1YQBA 1P98A 3KUZA 2R2QA 2KTFA 2M4NA 2UWQA 2FIDA 3A4SC 5L83A 5BO4B 3X0WA 2MCNB 4CYEA 5C1ZA 3QX1A 1D3ZA 4GIVA 2JWZA 2OOBB 2IY1B 2PE6B 4HK2A 3UINB 4A3OA 4AJWA 2FAZA 1ISNA 3H7SA 3X23A 2DAFA 3A1QB 3B08A 2BPSA 1GG3A 4K1RB 3TMPB 2KDFB 2MP2A 1EF5A 3A9JA 3EC8A 1V2YA 1WMHA 3SHQA 3KUDB 2HD5B 4RM9A 3JVZX 2O2VB 5JZEB 4JGHB 5FR6A 2KQ7A 2O6VD 2LJ5A 4BKSD 3GZNI 1NI2A 1OQYA 1XQQA 1ZKHA 4MH0E 3N3KB 3V61A 1S3SG 1Q1OA 4DBGA 4B95A 4EOYA 2HJ8A 2N9PC 2ZVNA 2NPTB 2W9NA 2KN5A 3VQIA 1Q0WB 1MG8A 3PT2B 1RRBA 3ZRFA 3W1SA 3M3JA 4MJSA 2WX1A 5LXIB 2IO1B 2JZZA 3DPDA 1E8YA 3ZNHB 3QQ8B 2KDIA 5TR5A 2GMIC 5IAAC 2IZVB 4MGZE 1VCBA 4AJYB 4FBJB 2UYZB 4HJKA 5AEKB 3IG3A 4NJ7A 1GNUA 2JUOA 2YLMA 5D94A 1BT0A 5D6JB 4DDID 4KZ0A 1V5TA 2KNBA 2MA9B 3QWZB 3TL5A 4DK5A 2CHXA 1KLVA 3SD5A 4TQ0A 1RLFA 5G2NA 1Z2MA 4BKGA 2MBQA 2Y5BB 1K8RB 1UZXB 1E8XA 1WM3A 3UF8A 1T0YA 2PEAA 5CX3A 4BOZB 2K8CA 4PS7A 1AARA 3TIXA 3VAWA 3MJWA 1NBFC 3DVGX 4TV3A 4ANUA 2AWTA 2KMCA 4HWIB 5J17A 2CS4A 4W9GA 3APDA 3PSEB 3VUYA 4F7ZA 3OAWA 4DHJD 4GDLA 1KM7A 2N4FA 4W9EA 4AP4C 3NS8A 2FUHB 5DPSA 4M8MA 4IM0A 1L2NA 4KZCA 4B6WA 2KLCA 3DQVA 3UIPB 4II3B 2MSED 3ZDTA 3C0RB 2N1WA 2N9XA 4ZYNA 3ZVVA 3N32A 4MELA 3W1SC 3PGEA 2D3GA 1WZ3A 1YIWA 2BKRB 3KVFB 1A5RA 4J6IA 2GBMA 1WY8A 3WANA 1ZW7A 5JHAA 4N9F4 2AL6A 2M8SA 1WXVA 1WIAA 2BKFA 1YD8U 1WFYA 4KSKC 4WWPA 3KUCB 3I3TB 2V1YA 3T8MA 2IO3B 1R4MI 2RPQA 1I35A 2GBNA 3P2BA 3WAPA 2M1MA 2C7MB 2L0TA 2J7QB 2Z0DB 4NAWB 5C23A 3B0AA 3OJ3A 3RULA 2C5LC 1IPGA 2I1KA 3L13A 4ZRKA 4TKNA 4DHZB 3ZW3A 2I1JA 3KH0A 4FJVB 3DDCB 2NBVB 2KXJA 4WJPA 3RZFA 2KDEB 4HXDA 1P3QU 2LVPA 1WF9A 3K9PB 2D2QA 4W9JA 4W9HA 3KYDD 4LCDE 1GUAB 2MBHA 3QK0A 3A1QA 2MWSB 4OVUA 3VUWA 4I6NB 2BYEA 1VD2A 4MM3A 2KANA 5DPTA 5AZHA 3DBHI 1WJUA 4F8CB 1TZ1A 2A4ZA 2DZJA 2JXXA 4HCNB 3PLVA 3ALBA 3U30A 4NQLB 4DXAB 4EUTA 3RT3B 1TTNA 2XK5A 2ZNVB 3PHXB 1LQBA 1WX9A 2L3ZA 4W9KA 1SIFA 2JRIB 2B3AA 3WIMA 2ZCCA 1WGYA 4WJNA 4GOCA 2LVOA 4W9DA 3DBLI 2HE7A 3TCAA 1RFAA 4LJPB 4FN2A 3PV1A 2LD9A 2ZJDA 4IWOA 1P1AA 4MGYE 5JH5C 2IBIB 2NPTA 4HDOA 4MGIE 4BOSC 2JVCA 3DCGA 4IWQA 2BYVE 4AWJA 2G4DB 1V80A 3B1LX 3PLUA 1WYWB 4JQWC 2Z59B 2KX3A 5J2RA 2LWPA 1V86A 2G4SA 2O6VA 4GDKA 4BKSA 2DZKA 3AULA 1WE7A 1WX8A 2EMTA 4EZLA 3SU8X 5E6PA 5CTRC 2Z0EB 3T9LA 1R4NI 2K1FA 4FJZA 2AYOB 2NS5A 3ONSA 3WA0A 2C60A 2DYOA 3VDZA 2KZRA 2AL3A 1WXAA 2HTHA 4E3CA 2N7EA 4EFOA 4GXBA 3QIJA 2DYMA 4HVBA 4G50A 2JF5A 1LFDA 2NCNA 2D07B 2XBBC 4I6LB 3VTWA 4ZDVA 3QCAA 3ZKJC 4EEWA 4ICUA 1S1QB 2KJ6A 2ZVOA 5L95C 2L7RA 2NR2A 3H7PA 4PYZA 4RMAA 2A5UA 3HIZA 5AZGA 2WDTB 4FHJA 3VH4B 4EKUA 4BBNF 3VHTC 2MBBB 3TJPA 4AUQC 2ZPNA 2MLBA 1CMXB 2MP2B 2V4LA 3A9JB 4FADA 2KFKB 2DZIA 1WMHB 4I6PA 3M95A 3BINA 1OGWA 3ENEA 4LDTB 3RD2A 1WR1A 2J0MA 1WGRA 2IYDB 2MW5A 3EECA 4M0WB 1UH6A 3PRZA 2IY0B 4ANXA 1Q5WB 2PJHA 4BKTA 1J19A 1XD3B 2L05A 3DBSA 1WXSA 1I42A 4MSMB 1X1MA 4II2B 3ZNGC 2LXCA 2FCSA 3RCZA 4DDGD 2LASA 3APFA 3OJ4B 5CHWA 1GC7A 5KHOA 5AZFA 3Q3FA 1UBQA 2KFJA 4KIKA 3WALA 3PPAA 3VFKA 3PTFC 2K6QA 2KK8A 4MJSB 3HHMA 4NQKE 4W9CA 3K9OB 4WQOB 2NBUA 1F9JA 4ICVA 2V3SA 3VUXA 1P9DU 3Q3JA 3V6CB 2ZZPB 2R2OA 3L0WB 3NY5A 3OLMD 2G45B 4PYUA 4AOFA 3VXWA 5IA7A 5LXHA 2CHZA 3NZSA 4MEMA 4XC2A 2D11A 3ECIA 1EO6A 3VTVA 3JYUA 1WE6A 3V60A 2L0FA 2YVCA 4CHKA 5JHBA 3A9KA 4E74A 4NNJB 2K8BA 3ML9A 1YX5B 2KQSA 4FA6A 3UQBA 3ZLZA 2KLGA 4IM2A 1FXTB 3JSVA 4X57B 3ZIMA 3QHTA 4G0NB 3DVGY 2NVUI 2C9WB 4PS8A 1EF1A 1E7UA 3NHEB 1OEYJ 2DAJA 3VTUA 4GB9A 4A20A 2KD0A 1HE8A 1SE9A 1V49A 3CSFA 1E8WA 4BFRA 1ZGUB 4GMVA 3UIOB 2KO3A 4GDLB 4WWOA 2J0KA 3ZTCA 2DENB 3CMMB 3DOWA 3NZUA 5G55A 4ASWC 2M17A 3R7RA 3H9DA 3CSTA 1TBEA 2KC1A 1L7YA 3RYTA 2FNJB 1WX7A 2REXA 5GMVA 2N1VA 3L16A 2K25A 4WJOA 2O2VA 3ML8A 4A3PA 3UGBB 2MX2A 1SGHA 2KWUB 3HM6X 1WH3A 2DYBA 3NOBA 2LGXA 2IO0B 3A4RA 2KTRB 3DVNU 1V6EA 3LDZE 2ZEQA 4KV2A 3APCA 3WAOA 2JY6A 4W9FA 1IP9A 4G3XB 2LRUA 2G3QB 2KOXA 3LJ3A 4WJQA 2D10A 1QZEA 5D7GA 2LRWA 2N9EB 3GOEA 2FCMA 3R66C 4JIOU 3L54A 3ZRCA 4FHKA 1G6JA 3L17A 3PS6A 4OVVA 3R7QA 2AEHA 3PZDA 2IO2B 1GC6A 1WRDB 4LJOB 2DHZA 2WYQA 2ZNVC 1YX6B 4WWNA 4GU2A 3DVNV 1WM2A 3QARA 2DX5B 3IHPC 3KW5B 5E6NA 1NDDA 1IYFA 1H4RA 2MBEA 2N7DA 1UELA 4KDLB 2GBKA 4K7WA 3U8ZA 4HLEA 3BY4B 1EUVB 2KJHB 2OJRA 2KFKA 3L08A 4ZRJA 2LI5A 3AU4A 2KVRA 2ASQA 3RUIB 2CKHB 4LDTD 4JLCA 2J0JA 2JZ3B 2KKCA 2XK5B 2MQJA 3L10B 4BBNC 3H6NA 4HPMB 1WGHA 4CO7A 2JT4B 5CHVC 1KOTA 4GGQA 1KJTA 1JRUA 2GBJA 3RZWC 3QA8A 1WJ4A 3N30A 2M0XA 2FCNA 2RGFA 1GJZA 3S2AA 4KVGB 2ZPYA 2CR5A 1OEYA 2K39A 1WR6E 4HCPB 2CHWA 4JL9A 3KYCD 2PE9A 3IFWB 4KSLC 5HKHA 4W9LA 1C1YB 1YJ1A 2LGYA 2QHOA 2EKEC 4MDKE 3M62B 2FIFA 2BF8B 3ZTDA 1E90A 5KHQA 2O6VB 4GDKB 1WZ0A 4RM8A 2LGDA 4URKA 4WAAA 1V81A 1UBIA 3QAQA 4ANWA 3TBLD 1J0GA 4M8NA 4F1SA 1UGMA 4IUMB 3HK0A 4PS3A 4MGKE 3VH3B 2KJRA 3ZNID 4NY0A 4E71A 3VVWB 2KWVB 2LZ6A 4K81A 3PREA 3R3MA 4NAWA 2KWCA 3IVFA 4KDIC 5LLIA 3AI5A 4IW0A 2KMAA 3ZO5B 3ZUNA 3QJZA 2KX0A 1WJ6A 2DZMA 2JPHA 2LUEA 1WGDA 1J8CA 3H7PB 4P7IA 1E8ZA 5D2MB 2MRPA 1TGZB 1OTRB 3IBEA 3QC8B 4B9KA 4HPLB 1LM8B 2L8JA 4HDQA 3WAMA 2KDBA 3DBRI 3HM3A 2RSUA 2RD0A 4IM3A 1RAXA 2K8HA 2L76A 4W9IA 1WXMA 2GBRA 3PRPB 3V6EB 2BGFA 3M63B 2BYFA 3MHSD 3EFUA 4XX5A 2BWFA 2JRHA 4IWPA 5E6OA 2NBWB 1WGGA 3JW0X 1LXDA 3V62A 4FLHA 3UQAA 2C7HA 3H1UA 2LXAA 2KTRA 4FJYA 4BVUC 4DHJB 5DCNA 4TQ1A 2GOWA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJN A;  4G11 A;  2KHW B;  2CU1 A;  3W1Y A;  4KIK B;  2LVQ A;  3ZDM C;  3O65 B;  4EZK A;  3A33 B;  1H8C A;  1WI0 A;  2RR9 A;  1XT9 B;  3AXC A;  1Z5S B;  1P0R A;  2XEW A;  2FCQ A;  1UD7 A;  2ZCB A;  3PHW B;  4GN1 A;  4NPN A;  5J18 A;  5EDS A;  1PQS A;  3EHV A;  3U7D A;  4IC7 B;  1Y8R C;  4ZRI A;  3SDL C;  4ANV A;  3D32 A;  4NJ6 A;  1E5W A;  4MSQ B;  4TUU A;  4FUL A;  5DPR A;  2VRR B;  2PPH A;  3PRM B;  4EZJ A;  2KC2 A;  1V5O A;  2L00 B;  1M94 A;  1V9J A;  5DPW A;  2WX0 A;  2EMS A;  4GSW A;  3A9K B;  3ZNZ B;  2MBO A;  3MTN B;  4K7U A;  1C3T A;  3PVL A;  4DWF A;  4YL8 A;  2WWZ A;  1U4A A;  4DHZ E;  4K7S A;  3CF6 E;  2BWE S;  4XZ4 A;  3JSV B;  2C7N B;  2K6D B;  1E7V A;  4IG7 B;  5CHF A;  1YQB A;  1P98 A;  3KUZ A;  2R2Q A;  2KTF A;  2M4N A;  2UWQ A;  2FID A;  3A4S C;  5L83 A;  5BO4 B;  3X0W A;  2MCN B;  4CYE A;  5C1Z A;  3QX1 A;  1D3Z A;  4GIV A;  2JWZ A;  2OOB B;  2IY1 B;  2PE6 B;  4HK2 A;  3UIN B;  4A3O A;  4AJW A;  2FAZ A;  1ISN A;  3H7S A;  3X23 A;  2DAF A;  3A1Q B;  3B08 A;  2BPS A;  1GG3 A;  4K1R B;  3TMP B;  2KDF B;  2MP2 A;  1EF5 A;  3A9J A;  3EC8 A;  1V2Y A;  1WMH A;  3SHQ A;  3KUD B;  2HD5 B;  4RM9 A;  3JVZ X;  2O2V B;  5JZE B;  4JGH B;  5FR6 A;  2KQ7 A;  2O6V D;  2LJ5 A;  4BKS D;  3GZN I;  1NI2 A;  1OQY A;  1XQQ A;  1ZKH A;  4MH0 E;  3N3K B;  3V61 A;  1S3S G;  1Q1O A;  4DBG A;  4B95 A;  4EOY A;  2HJ8 A;  2N9P C;  2ZVN A;  2NPT B;  2W9N A;  2KN5 A;  3VQI A;  1Q0W B;  1MG8 A;  3PT2 B;  1RRB A;  3ZRF A;  3W1S A;  3M3J A;  4MJS A;  2WX1 A;  5LXI B;  2IO1 B;  2JZZ A;  3DPD A;  1E8Y A;  3ZNH B;  3QQ8 B;  2KDI A;  5TR5 A;  2GMI C;  5IAA C;  2IZV B;  4MGZ E;  1VCB A;  4AJY B;  4FBJ B;  2UYZ B;  4HJK A;  5AEK B;  3IG3 A;  4NJ7 A;  1GNU A;  2JUO A;  2YLM A;  5D94 A;  1BT0 A;  5D6J B;  4DDI D;  4KZ0 A;  1V5T A;  2KNB A;  2MA9 B;  3QWZ B;  3TL5 A;  4DK5 A;  2CHX A;  1KLV A;  3SD5 A;  4TQ0 A;  1RLF A;  5G2N A;  1Z2M A;  4BKG A;  2MBQ A;  2Y5B B;  1K8R B;  1UZX B;  1E8X A;  1WM3 A;  3UF8 A;  1T0Y A;  2PEA A;  5CX3 A;  4BOZ B;  2K8C A;  4PS7 A;  1AAR A;  3TIX A;  3VAW A;  3MJW A;  1NBF C;  3DVG X;  4TV3 A;  4ANU A;  2AWT A;  2KMC A;  4HWI B;  5J17 A;  2CS4 A;  4W9G A;  3APD A;  3PSE B;  3VUY A;  4F7Z A;  3OAW A;  4DHJ D;  4GDL A;  1KM7 A;  2N4F A;  4W9E A;  4AP4 C;  3NS8 A;  2FUH B;  5DPS A;  4M8M A;  4IM0 A;  1L2N A;  4KZC A;  4B6W A;  2KLC A;  3DQV A;  3UIP B;  4II3 B;  2MSE D;  3ZDT A;  3C0R B;  2N1W A;  2N9X A;  4ZYN A;  3ZVV A;  3N32 A;  4MEL A;  3W1S C;  3PGE A;  2D3G A;  1WZ3 A;  1YIW A;  2BKR B;  3KVF B;  1A5R A;  4J6I A;  2GBM A;  1WY8 A;  3WAN A;  1ZW7 A;  5JHA A;  4N9F 4;  2AL6 A;  2M8S A;  1WXV A;  1WIA A;  2BKF A;  1YD8 U;  1WFY A;  4KSK C;  4WWP A;  3KUC B;  3I3T B;  2V1Y A;  3T8M A;  2IO3 B;  1R4M I;  2RPQ A;  1I35 A;  2GBN A;  3P2B A;  3WAP A;  2M1M A;  2C7M B;  2L0T A;  2J7Q B;  2Z0D B;  4NAW B;  5C23 A;  3B0A A;  3OJ3 A;  3RUL A;  2C5L C;  1IPG A;  2I1K A;  3L13 A;  4ZRK A;  4TKN A;  4DHZ B;  3ZW3 A;  2I1J A;  3KH0 A;  4FJV B;  3DDC B;  2NBV B;  2KXJ A;  4WJP A;  3RZF A;  2KDE B;  4HXD A;  1P3Q U;  2LVP A;  1WF9 A;  3K9P B;  2D2Q A;  4W9J A;  4W9H A;  3KYD D;  4LCD E;  1GUA B;  2MBH A;  3QK0 A;  3A1Q A;  2MWS B;  4OVU A;  3VUW A;  4I6N B;  2BYE A;  1VD2 A;  4MM3 A;  2KAN A;  5DPT A;  5AZH A;  3DBH I;  1WJU A;  4F8C B;  1TZ1 A;  2A4Z A;  2DZJ A;  2JXX A;  4HCN B;  3PLV A;  3ALB A;  3U30 A;  4NQL B;  4DXA B;  4EUT A;  3RT3 B;  1TTN A;  2XK5 A;  2ZNV B;  3PHX B;  1LQB A;  1WX9 A;  2L3Z A;  4W9K A;  1SIF A;  2JRI B;  2B3A A;  3WIM A;  2ZCC A;  1WGY A;  4WJN A;  4GOC A;  2LVO A;  4W9D A;  3DBL I;  2HE7 A;  3TCA A;  1RFA A;  4LJP B;  4FN2 A;  3PV1 A;  2LD9 A;  2ZJD A;  4IWO A;  1P1A A;  4MGY E;  5JH5 C;  2IBI B;  2NPT A;  4HDO A;  4MGI E;  4BOS C;  2JVC A;  3DCG A;  4IWQ A;  2BYV E;  4AWJ A;  2G4D B;  1V80 A;  3B1L X;  3PLU A;  1WYW B;  4JQW C;  2Z59 B;  2KX3 A;  5J2R A;  2LWP A;  1V86 A;  2G4S A;  2O6V A;  4GDK A;  4BKS A;  2DZK A;  3AUL A;  1WE7 A;  1WX8 A;  2EMT A;  4EZL A;  3SU8 X;  5E6P A;  5CTR C;  2Z0E B;  3T9L A;  1R4N I;  2K1F A;  4FJZ A;  2AYO B;  2NS5 A;  3ONS A;  3WA0 A;  2C60 A;  2DYO A;  3VDZ A;  2KZR A;  2AL3 A;  1WXA A;  2HTH A;  4E3C A;  2N7E A;  4EFO A;  4GXB A;  3QIJ A;  2DYM A;  4HVB A;  4G50 A;  2JF5 A;  1LFD A;  2NCN A;  2D07 B;  2XBB C;  4I6L B;  3VTW A;  4ZDV A;  3QCA A;  3ZKJ C;  4EEW A;  4ICU A;  1S1Q B;  2KJ6 A;  2ZVO A;  5L95 C;  2L7R A;  2NR2 A;  3H7P A;  4PYZ A;  4RMA A;  2A5U A;  3HIZ A;  5AZG A;  2WDT B;  4FHJ A;  3VH4 B;  4EKU A;  4BBN F;  3VHT C;  2MBB B;  3TJP A;  4AUQ C;  2ZPN A;  2MLB A;  1CMX B;  2MP2 B;  2V4L A;  3A9J B;  4FAD A;  2KFK B;  2DZI A;  1WMH B;  4I6P A;  3M95 A;  3BIN A;  1OGW A;  3ENE A;  4LDT B;  3RD2 A;  1WR1 A;  2J0M A;  1WGR A;  2IYD B;  2MW5 A;  3EEC A;  4M0W B;  1UH6 A;  3PRZ A;  2IY0 B;  4ANX A;  1Q5W B;  2PJH A;  4BKT A;  1J19 A;  1XD3 B;  2L05 A;  3DBS A;  1WXS A;  1I42 A;  4MSM B;  1X1M A;  4II2 B;  3ZNG C;  2LXC A;  2FCS A;  3RCZ A;  4DDG D;  2LAS A;  3APF A;  3OJ4 B;  5CHW A;  1GC7 A;  5KHO A;  5AZF A;  3Q3F A;  1UBQ A;  2KFJ A;  4KIK A;  3WAL A;  3PPA A;  3VFK A;  3PTF C;  2K6Q A;  2KK8 A;  4MJS B;  3HHM A;  4NQK E;  4W9C A;  3K9O B;  4WQO B;  2NBU A;  1F9J A;  4ICV A;  2V3S A;  3VUX A;  1P9D U;  3Q3J A;  3V6C B;  2ZZP B;  2R2O A;  3L0W B;  3NY5 A;  3OLM D;  2G45 B;  4PYU A;  4AOF A;  3VXW A;  5IA7 A;  5LXH A;  2CHZ A;  3NZS A;  4MEM A;  4XC2 A;  2D11 A;  3ECI A;  1EO6 A;  3VTV A;  3JYU A;  1WE6 A;  3V60 A;  2L0F A;  2YVC A;  4CHK A;  5JHB A;  3A9K A;  4E74 A;  4NNJ B;  2K8B A;  3ML9 A;  1YX5 B;  2KQS A;  4FA6 A;  3UQB A;  3ZLZ A;  2KLG A;  4IM2 A;  1FXT B;  3JSV A;  4X57 B;  3ZIM A;  3QHT A;  4G0N B;  3DVG Y;  2NVU I;  2C9W B;  4PS8 A;  1EF1 A;  1E7U A;  3NHE B;  1OEY J;  2DAJ A;  3VTU A;  4GB9 A;  4A20 A;  2KD0 A;  1HE8 A;  1SE9 A;  1V49 A;  3CSF A;  1E8W A;  4BFR A;  1ZGU B;  4GMV A;  3UIO B;  2KO3 A;  4GDL B;  4WWO A;  2J0K A;  3ZTC A;  2DEN B;  3CMM B;  3DOW A;  3NZU A;  5G55 A;  4ASW C;  2M17 A;  3R7R A;  3H9D A;  3CST A;  1TBE A;  2KC1 A;  1L7Y A;  3RYT A;  2FNJ B;  1WX7 A;  2REX A;  5GMV A;  2N1V A;  3L16 A;  2K25 A;  4WJO A;  2O2V A;  3ML8 A;  4A3P A;  3UGB B;  2MX2 A;  1SGH A;  2KWU B;  3HM6 X;  1WH3 A;  2DYB A;  3NOB A;  2LGX A;  2IO0 B;  3A4R A;  2KTR B;  3DVN U;  1V6E A;  3LDZ E;  2ZEQ A;  4KV2 A;  3APC A;  3WAO A;  2JY6 A;  4W9F A;  1IP9 A;  4G3X B;  2LRU A;  2G3Q B;  2KOX A;  3LJ3 A;  4WJQ A;  2D10 A;  1QZE A;  5D7G A;  2LRW A;  2N9E B;  3GOE A;  2FCM A;  3R66 C;  4JIO U;  3L54 A;  3ZRC A;  4FHK A;  1G6J A;  3L17 A;  3PS6 A;  4OVV A;  3R7Q A;  2AEH A;  3PZD A;  2IO2 B;  1GC6 A;  1WRD B;  4LJO B;  2DHZ A;  2WYQ A;  2ZNV C;  1YX6 B;  4WWN A;  4GU2 A;  3DVN V;  1WM2 A;  3QAR A;  2DX5 B;  3IHP C;  3KW5 B;  5E6N A;  1NDD A;  1IYF A;  1H4R A;  2MBE A;  2N7D A;  1UEL A;  4KDL B;  2GBK A;  4K7W A;  3U8Z A;  4HLE A;  3BY4 B;  1EUV B;  2KJH B;  2OJR A;  2KFK A;  3L08 A;  4ZRJ A;  2LI5 A;  3AU4 A;  2KVR A;  2ASQ A;  3RUI B;  2CKH B;  4LDT D;  4JLC A;  2J0J A;  2JZ3 B;  2KKC A;  2XK5 B;  2MQJ A;  3L10 B;  4BBN C;  3H6N A;  4HPM B;  1WGH A;  4CO7 A;  2JT4 B;  5CHV C;  1KOT A;  4GGQ A;  1KJT A;  1JRU A;  2GBJ A;  3RZW C;  3QA8 A;  1WJ4 A;  3N30 A;  2M0X A;  2FCN A;  2RGF A;  1GJZ A;  3S2A A;  4KVG B;  2ZPY A;  2CR5 A;  1OEY A;  2K39 A;  1WR6 E;  4HCP B;  2CHW A;  4JL9 A;  3KYC D;  2PE9 A;  3IFW B;  4KSL C;  5HKH A;  4W9L A;  1C1Y B;  1YJ1 A;  2LGY A;  2QHO A;  2EKE C;  4MDK E;  3M62 B;  2FIF A;  2BF8 B;  3ZTD A;  1E90 A;  5KHQ A;  2O6V B;  4GDK B;  1WZ0 A;  4RM8 A;  2LGD A;  4URK A;  4WAA A;  1V81 A;  1UBI A;  3QAQ A;  4ANW A;  3TBL D;  1J0G A;  4M8N A;  4F1S A;  1UGM A;  4IUM B;  3HK0 A;  4PS3 A;  4MGK E;  3VH3 B;  2KJR A;  3ZNI D;  4NY0 A;  4E71 A;  3VVW B;  2KWV B;  2LZ6 A;  4K81 A;  3PRE A;  3R3M A;  4NAW A;  2KWC A;  3IVF A;  4KDI C;  5LLI A;  3AI5 A;  4IW0 A;  2KMA A;  3ZO5 B;  3ZUN A;  3QJZ A;  2KX0 A;  1WJ6 A;  2DZM A;  2JPH A;  2LUE A;  1WGD A;  1J8C A;  3H7P B;  4P7I A;  1E8Z A;  5D2M B;  2MRP A;  1TGZ B;  1OTR B;  3IBE A;  3QC8 B;  4B9K A;  4HPL B;  1LM8 B;  2L8J A;  4HDQ A;  3WAM A;  2KDB A;  3DBR I;  3HM3 A;  2RSU A;  2RD0 A;  4IM3 A;  1RAX A;  2K8H A;  2L76 A;  4W9I A;  1WXM A;  2GBR A;  3PRP B;  3V6E B;  2BGF A;  3M63 B;  2BYF A;  3MHS D;  3EFU A;  4XX5 A;  2BWF A;  2JRH A;  4IWP A;  5E6O A;  2NBW B;  1WGG A;  3JW0 X;  1LXD A;  3V62 A;  4FLH A;  3UQA A;  2C7H A;  3H1U A;  2LXA A;  2KTR A;  4FJY A;  4BVU C;  4DHJ B;  5DCN A;  4TQ1 A;  2GOW A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 1WJN A;  4G11 A;  4YSZ B;  2KHW B;  1TKY A;  4EZK A;  2VH2 A;  3Q8B A;  2ZCB A;  5EDS A;  3EHV A;  4ZRI A;  1Y8R C;  4NJ6 A;  4MSQ B;  4TUU A;  4FUL A;  4HJG E;  1T6B X;  2PPH A;  3PRM B;  4EZJ A;  3ZNZ B;  4K7U A;  4ZHP A;  3I57 A;  4YL8 A;  4DHZ E;  4YXD B;  5JXV A;  3KLS X;  1C76 A;  2Z8L A;  5CHF A;  3AB5 A;  1YQB A;  3RNC C;  2R2Q A;  2KTF A;  1ZXH A;  1D3Z A;  1YN5 A;  1QOG A;  5HHD G;  3H7S A;  3X23 A;  4KGT A;  1HTO A;  3TMP B;  1D6E C;  2N0S B;  2BVC A;  1IGC A;  1V97 A;  5C3J B;  4RM9 A;  2AQ2 B;  3RFZ B;  3ZYY X;  1NI2 A;  4S0R A;  2G9H D;  4OHJ A;  1ZKH A;  1S3S G;  3LB8 C;  3Q3M C;  4YTP B;  3DHH C;  5D3D A;  2NPT B;  1MPE A;  2KN5 A;  4M01 A;  1RRB A;  3RI7 C;  3M3J A;  5LXI B;  2WX1 A;  2IO1 B;  2N9K A;  1E8Y A;  2KDI A;  5IAA C;  1BUI C;  2IZV B;  1UWX A;  3N20 C;  1TY0 A;  1FXI A;  1T5X D;  2RDH A;  3GB1 A;  1GNU A;  1BT0 A;  5D6J B;  4DDI D;  2KNB A;  3QWZ B;  4RGM A;  1Z2M A;  1E8X A;  3HVD A;  2CJN A;  4TSS A;  1I4G A;  1FFU A;  1P7F A;  2QMT A;  4HWI B;  1XO3 A;  1WSP A;  4YSX B;  2CS4 A;  4F7Z A;  3OAW A;  3NS8 A;  2NMQ A;  1L2N A;  2KLC A;  2MSE D;  3ZDT A;  2B76 B;  2E6X A;  2D3G A;  1N62 A;  4JWS C;  1YIW A;  4J6I A;  1WY8 A;  1EWC A;  2WLB A;  1B1Z A;  1L0Y B;  1A70 A;  1WFY A;  1JWA D;  4KSK C;  3DHG C;  3I3T B;  2V1Y A;  3T8M A;  2RPQ A;  2J52 A;  1I35 A;  3WAP A;  1R7S A;  2M1M A;  4XWW A;  2C7M B;  2DBY A;  4L2Y A;  4ACF A;  2QSD A;  2J7Q B;  5C23 A;  4ZRK A;  5G5G A;  1KF6 B;  2WXK A;  3DDC B;  2KDE B;  1P3Q U;  4W9J A;  3AED B;  3MC8 A;  2W3S A;  2MWS B;  4I6N B;  4MM3 A;  3NRZ A;  1VLB A;  1FCC C;  4F8C B;  2Q5W D;  1D4B A;  2JXX A;  4XWT A;  5BMI A;  3U30 A;  4NQL B;  1HXY D;  1TTN A;  1LQB A;  2L3Z A;  3DBL B;  1SIF A;  2JRI B;  2PVO D;  4WJN A;  1F1H A;  2JXT A;  4W9D A;  3DBL I;  2BB5 A;  1RFA A;  4FN2 A;  4US8 A;  1P1A A;  1MI0 A;  3NVW A;  3V05 A;  2K5P A;  1F77 A;  3SFD B;  2IBI B;  4HDO A;  5AUI A;  3V3X A;  4KGS A;  2DNF A;  2VZK B;  3FIL B;  2PIA A;  4AWJ A;  4US9 A;  2DLB A;  1V80 A;  2N9L A;  2KDM A;  5J2R A;  4WAF A;  4BKS A;  2IGH A;  3AUL A;  2EMT A;  3FC4 A;  1BML C;  2Z0E B;  4FJZ A;  2BW2 A;  3VR9 B;  2AYO B;  3VDZ A;  2DYO A;  1C9F A;  4DQO C;  1HA5 A;  4G50 A;  3VTW A;  4I6L B;  5H92 C;  4ZDV A;  3QCA A;  4ICU A;  3TEY A;  3VH4 B;  3VHT C;  4AUQ C;  5C2T B;  4FXC A;  3L4P A;  1FD6 A;  1I4H A;  3BIN A;  3ENE A;  1I4Q A;  3AV8 A;  2J0M A;  2MW5 A;  2IYD B;  3FKY A;  3EEC A;  3AMZ A;  4II2 B;  2LXC A;  3RCZ A;  4WUR A;  1FRR A;  3Q3F A;  4JX1 C;  4O1N A;  1WGK A;  3WAL A;  3PTF C;  4H2A A;  1F9J A;  4REZ A;  1BXT A;  1YJJ A;  2ZZP B;  3B9J A;  3NZS A;  4XC2 A;  2D11 A;  1EO6 A;  1YQ3 B;  3JYU A;  2YVC A;  4CHK A;  1F0Z A;  1L4D B;  2WXM A;  2BS4 B;  1YX5 B;  2BYT A;  4FA6 A;  5MPO A;  1CQV A;  5FK9 C;  1UWM A;  3DVG Y;  1ZE3 D;  1V1O A;  1EF1 A;  1I7H A;  2L83 A;  3NHE B;  1OEY J;  4WWM A;  3VTU A;  4GB9 A;  2WXN A;  3EA6 A;  1HE8 A;  4EE2 A;  2KO3 A;  4WWO A;  2J0K A;  4ZOH C;  2M0A A;  3NZU A;  4ASW C;  2MEK A;  3HVZ A;  3H9D A;  1L7Y A;  3RYT A;  2RMM A;  4WJO A;  4N59 A;  2JSV X;  3J9C A;  2K3U A;  3ZXR A;  2J42 A;  3A4R A;  4JE3 B;  3APC A;  4W9F A;  2KOX A;  2D10 A;  2LRW A;  3DWM A;  4FHK A;  1G6J A;  3NUH B;  3NZ3 A;  3GS2 A;  1LO5 D;  2W82 A;  2DHZ A;  4IKG A;  1JWB D;  4GU2 A;  4WQM A;  1L4Z B;  5E6N A;  4XE0 A;  2N7D A;  3U2S C;  2KAC A;  3L08 A;  1GB4 A;  3MP9 A;  1XLN A;  2CKH B;  1T0R C;  1ET9 A;  4IDI A;  2JZ3 B;  2XK5 B;  2MQJ A;  3L10 B;  4OZC A;  2V3P A;  1KOT A;  5CHV C;  3QA8 A;  1WJ4 A;  3U4E G;  3N30 A;  4HKQ A;  4RGO S;  4A8X C;  2CR5 A;  4Q2J A;  1WR6 E;  4HCP B;  4YTN B;  5HKH A;  4KSL C;  4W9L A;  1C1Y B;  3TSS A;  2EKE C;  4MDK E;  3M62 B;  4RFB A;  3VRA B;  1WZ0 A;  2LGD A;  4URK A;  1C4A A;  1SE3 A;  1UBI A;  3QAQ A;  4ANW A;  4F1S A;  1JWM D;  1HEZ E;  3HK0 A;  3KWV A;  3VH3 B;  3VVW B;  1MHX A;  3BYY B;  3PRE A;  2AQ3 B;  4KDI C;  3IAS 1;  5LLI A;  4C00 A;  3AI5 A;  2BT6 A;  1J8C A;  1WGD A;  2WU2 B;  2MRP A;  2WGS A;  3QC8 B;  3IBE A;  4B9K A;  1KLU D;  2RD0 A;  1QT9 A;  4IM3 A;  1KRH A;  3GP7 A;  2E3T A;  3Q8F A;  3I63 C;  1XEE A;  4A90 A;  3PRP B;  3V6E B;  2BGF A;  4XX5 A;  2BWF A;  2JRH A;  3AH7 A;  3V62 A;  4ZYS A;  5AUK A;  2KTR A;  2OJW A;  4BVU C;  1JML A;  3AU5 A;  2JYE A;  4M02 A;  1E7P B;  3FIL A;  1H8C A;  1WI0 A;  2RR9 A;  4NPN A;  3PHW B;  2INN E;  3ZGZ A;  1T3Q A;  1TJE A;  1E5W A;  5E6J A;  1V9J A;  4LK0 M;  2EMS A;  3MTN B;  3EUB 2;  2WWZ A;  4XYC A;  2H88 B;  3AE9 B;  3JSV B;  5IN7 A;  4KKJ A;  2LUM A;  3A4S C;  1JCK B;  2LEK A;  5BO4 B;  3X0W A;  2MCN B;  2OOB B;  2FBW B;  1ISN A;  1N61 A;  2XN9 C;  4MM3 B;  2KDF B;  3EC8 A;  2ON8 A;  3AE4 B;  2O2V B;  1WYG A;  1T0Q C;  2O6V D;  1XLP A;  1XQQ A;  3V61 A;  3P42 A;  4DBG A;  4YT0 B;  2ZVN A;  2W9N A;  3C8Y A;  1MG8 A;  3PT2 B;  3W1S A;  3ZJV A;  4USA A;  3AE2 B;  2Y5P A;  1OFF A;  3DPD A;  3ZNH B;  5TR5 A;  4MGZ E;  4HJK A;  4ARC A;  3IG3 A;  2HTM E;  3IT4 B;  4NJ7 A;  1SEB D;  2YLM A;  4KKI A;  2MJE A;  1V5T A;  2MA9 B;  2CHX A;  5HFY A;  3SD5 A;  5G2N A;  4BKG A;  2Y5B B;  1UZX B;  3UF8 A;  1DOY A;  4BOZ B;  2K8C A;  3TIX A;  1Q10 A;  4ANU A;  1I4R A;  2KN4 A;  1VJK A;  2KMC A;  2QC8 A;  4AS1 A;  3APD A;  3PSE B;  2BBC A;  1FPY A;  1YOV B;  4AP4 C;  2XNA C;  1EWY C;  1WXQ A;  1J7B A;  4IM0 A;  1IBX B;  3CWI A;  4KZC A;  3DQV A;  3ZVV A;  1TS2 A;  2KYW A;  3KVF B;  2YEP F;  3NG0 A;  2GBM A;  3WAN A;  1ZW7 A;  1WXV A;  3AEG B;  2X8X X;  1R4M B;  4K3B A;  2IO3 B;  1R4M I;  3C19 A;  5HG2 A;  3OJ3 A;  3TEX A;  2C5L C;  4TMA B;  2LHE A;  4DHZ B;  3ZW3 A;  2JWU A;  2L1A A;  2NBV B;  1VZ7 A;  4HXD A;  2LVP A;  2MJD A;  3K9P B;  4W9H A;  3KYD D;  2MBH A;  3A1Q A;  3MC0 B;  1KLG D;  5AZH A;  1WJU A;  4PT5 A;  2DZJ A;  3ALB A;  4DXA B;  4EUT A;  3RT3 B;  2XK5 A;  2SEB D;  3PHX B;  3WIM A;  1N5W A;  4P1B C;  3TEZ A;  5FKA C;  4GOC A;  4PK1 A;  1WRI A;  3Q3O C;  2WXQ A;  2ZJD A;  3DCG A;  5BMH A;  2G4D B;  1QOB A;  4JQW C;  4IOI E;  2GB1 A;  2KX3 A;  3AE7 B;  2G4S A;  2IGG A;  3U7Z A;  2DZK A;  5T8I A;  1F2R I;  4UDU C;  1PUT A;  1UGJ A;  4EZL A;  2LJI A;  2NS5 A;  3ONS A;  4OZB A;  2C60 A;  3N1Y C;  2KZR A;  3RNA C;  4E3C A;  4EFO A;  1QLB B;  3QIJ A;  2DYM A;  4HVB A;  2NCN A;  2XBB C;  1NEK B;  4EEW A;  2KJ6 A;  5L95 C;  3AEA B;  2L7R A;  2A5U A;  5LNK 1;  2MBB B;  2ZPN A;  1CMX B;  2MP2 B;  3A9J B;  3AEC B;  1WMH B;  3Q8A A;  1WR1 A;  1L6U A;  4M0W B;  4MT5 A;  2PJH A;  1J19 A;  1I42 A;  4MSM B;  4DDG D;  2FCS A;  2LAS A;  3APF A;  5CHW A;  5AZF A;  1K50 A;  3AE6 B;  2KFJ A;  2I2Y A;  2K6Q A;  4W9C A;  4NQK E;  2ONQ A;  4ICV A;  2V3S A;  3Q3J A;  5LXH A;  5IA7 A;  3VXW A;  3V60 A;  2V0G A;  3SEB A;  4NNJ B;  3NS1 A;  4B0E A;  2KLG A;  3JSV A;  1VDV A;  4P16 A;  3BVM A;  4X57 B;  4D2K A;  2KMM A;  1V1P B;  2NVU I;  4PS8 A;  3P63 A;  1RFK A;  4HRO A;  1OQQ A;  4A20 A;  3CSF A;  1SE9 A;  1V49 A;  1XLQ A;  4GMV A;  4NZL B;  3UIO B;  3ZTC A;  2DEN B;  3CMM B;  5G55 A;  3CST A;  1TBE A;  2KC1 A;  2FNJ B;  1WX7 A;  2LFI A;  3L16 A;  1FXA A;  2L32 A;  2O2V A;  4NAM A;  2MX2 A;  1DGJ A;  1WH3 A;  3NOB A;  1KH0 A;  4A9A A;  1IUE A;  2KTR B;  3DVN U;  3WCQ A;  4ZRP A;  3NJT A;  2I38 A;  5D7G A;  2N9E B;  2Y5C A;  1E0Z A;  2PKO A;  1UUP A;  3PZD A;  3KWL A;  4A55 A;  2WYQ A;  1STE A;  3QAR A;  1AYF A;  5IKC M;  1FM0 D;  2MBE A;  3NVY A;  1UEL A;  2GBK A;  4K7W A;  2KJH B;  3O13 A;  3E9S A;  4JLC A;  4HPM B;  1F2R C;  4CO7 A;  2GI9 A;  1C79 A;  1QKZ A;  2K39 A;  1OQR A;  3RNG C;  1QQR A;  1IBX A;  2D3C A;  1YJ1 A;  4P1C C;  2FIF A;  2BF8 B;  3ZTD A;  5KHQ A;  2O6V B;  1C78 A;  4RM8 A;  1JQ4 A;  1J0G A;  1NEN B;  1VZ6 A;  1N63 A;  2SAK A;  2AX5 A;  2K9X A;  1GAQ B;  2AQ1 B;  1GOZ A;  3R3M A;  2KWC A;  1VRA B;  3ZO5 B;  3T3O A;  3QJZ A;  2JPH A;  2LUE A;  2WXG A;  4P7I A;  3DBR B;  1OTR B;  4XDD A;  4HPL B;  1Y56 A;  4HDQ A;  1N60 A;  3DBR I;  3HM3 A;  4C7Y A;  3W9C B;  3BWU D;  2K8H A;  1YN4 A;  1WXM A;  2GBR A;  3AE8 B;  3M63 B;  1FRD A;  2QIL A;  3EFU A;  4RCO A;  5E6O A;  1SF0 A;  1K52 A;  2NBW B;  1YN3 A;  3AEF B;  3Q8C A;  3P4S B;  2PMV A;  2WNM A;  2LXA A;  4OVZ A;  4RGT A;  1J7C A;  3ETR A;  4HEA 1;  4FJY A;  3E56 A;  2EKI A;  1SXT A;  4KIK B;  2LVQ A;  3PZ7 A;  4ZRQ A;  3ZDM C;  3Q69 A;  1LGR A;  2VH1 A;  4HRS A;  1P0R A;  1UD7 A;  5J18 A;  1GPX A;  2IND C;  4IC7 B;  3D32 A;  2JU6 X;  2VRR B;  2KAJ A;  1V5O A;  2V4I B;  1ZPS A;  4GSW A;  2CJO A;  3A9K B;  2MBO A;  4DWF A;  2RDB C;  4K7S A;  2BWE S;  4XZ4 A;  3IXS A;  2ZW0 A;  1XCQ L;  1P98 A;  5EE9 A;  2M4N A;  5L83 A;  4GIV A;  2JWZ A;  3Q3N C;  2IY1 B;  4HK2 A;  4L23 A;  3UIN B;  4AJW A;  2D3B A;  2FAZ A;  2G1E A;  3TEW A;  3A1Q B;  1GG3 A;  1IGD A;  4YSY B;  2MP2 A;  1EF5 A;  3A9J A;  1WMH A;  2HD5 B;  3JVZ X;  5JZE B;  4JGH B;  1CK1 A;  2KQ7 A;  2H89 B;  4M0W A;  2LMC A;  3N3K B;  1NI3 A;  3W2D A;  1Q1O A;  4ITK A;  4ARI A;  4B95 A;  4EOY A;  2HJ8 A;  5BYQ A;  1FMA D;  3ZJT A;  1XLO A;  1ZUD 2;  1SSN A;  2JZZ A;  2FUG 1;  3QQ8 B;  1SJH D;  4FBJ B;  2UYZ B;  3BK2 A;  2YEP B;  5AEK B;  1SIJ A;  2JUO A;  2INC C;  5D94 A;  1D5M C;  4KZ0 A;  3TL5 A;  4DK5 A;  1T0S C;  2MBQ A;  1K8R B;  1T0Y A;  5H8Y E;  2JZP A;  4PS7 A;  1AAR A;  4RH6 A;  3MJW A;  3ZXV A;  1EU3 A;  1V1P A;  4TV3 A;  2J4X A;  2AWT A;  5J17 A;  3LYY A;  4W9G A;  5EE0 A;  5IOI A;  4DHJ D;  2WXR A;  1C77 A;  4W9E A;  2FUH B;  3KQ4 A;  5DPS A;  4RGN A;  4B6W A;  2WDV B;  2N1W A;  2N9X A;  4ZYN A;  1JWU D;  3N32 A;  4MEL A;  3W1S C;  1WZ3 A;  1UF0 A;  3AE3 B;  1A5R A;  2BS2 B;  4N9F 4;  2AL6 A;  1WIA A;  1YD8 U;  1FO4 A;  4WWP A;  3KUC B;  2WDR B;  3PO0 A;  4J3O D;  2GBN A;  3P2B A;  4NAW B;  1IPG A;  2I1K A;  3L13 A;  3ABV B;  4C56 C;  4YTM B;  2I1J A;  3KH0 A;  4JPS A;  4WJP A;  3RZF A;  1WF9 A;  4CQN A;  2HJ1 A;  2Y3A A;  3QK0 A;  3FAH A;  2BYE A;  1VD2 A;  5DPT A;  2KAN A;  1NYR A;  3HRD D;  5EE3 A;  3W5U B;  1TZ1 A;  3PLV A;  1FEH A;  3N1X C;  2ZNV B;  1D5X C;  1WX9 A;  1QOA A;  1WGY A;  2PW9 A;  4LJP B;  3PV1 A;  4IWO A;  5JH5 C;  4MGI E;  1MVK A;  4BOS C;  1AN8 A;  2BYV E;  4XDC A;  1YJI A;  3VR8 B;  3PLU A;  1WYW B;  3I5J C;  1ZOY B;  2IJ0 A;  2LWP A;  2EEL A;  1V86 A;  2O6V A;  1F52 A;  1WE7 A;  1WX8 A;  3SU8 X;  5CTR C;  2K1F A;  3ZJU A;  3R2I A;  3WA0 A;  1E9M A;  1QOF A;  4LNO A;  3Q8E A;  2N7E A;  1L0X B;  2WXF A;  4LNK A;  2D07 B;  3ZKJ C;  3NVZ A;  1S1Q B;  2ZVO A;  2BS3 B;  3AEE B;  2NR2 A;  3LXF A;  3DWG C;  3P1M A;  4PYZ A;  5GXG B;  4A6Q A;  1VZ8 A;  5AZG A;  2WDT B;  4GLS C;  4BBN F;  2INP E;  2MLB A;  4FAD A;  5D3I B;  3Q6B A;  3RD2 A;  2ACZ B;  4LLG M;  3EGR A;  3PRZ A;  1Q5W B;  4HPP A;  3R2T A;  1XD3 B;  4LNI A;  2L05 A;  1TKG A;  2QJL A;  3OJ4 B;  4DXG A;  3T3N A;  4KIK A;  3P4Q B;  1XXG A;  3PPA A;  3VFK A;  2KK8 A;  4MJS B;  3HHM A;  3UI3 A;  1I4X A;  2JX5 A;  3VUX A;  4LNF A;  2LGS A;  3V6C B;  2PLP A;  2R2O A;  1HQR D;  4PYU A;  4MEM A;  4C7Z A;  5BYR A;  3A9K A;  4E74 A;  2K8B A;  3UQB A;  2HDE A;  1MG4 A;  3ZLZ A;  4IM2 A;  1FXT B;  3RNE C;  1KFY B;  3QHT A;  2C9W B;  4BFR A;  1E8W A;  4GDL B;  2M17 A;  3R7R A;  1ENF A;  3BVG A;  5GMV A;  2LGI A;  2N1V A;  2W54 A;  2K25 A;  1FNU A;  3ML8 A;  2W3R A;  4A3P A;  3DHI C;  2KWU B;  3CIR B;  4QAY A;  1P7E A;  2LGX A;  1N5X A;  3GE3 C;  3LDZ E;  2WXI A;  2ZEQ A;  4KV2 A;  1N6Z A;  5FR3 A;  1JW9 D;  1IP9 A;  2WS3 B;  4G3X B;  3LJ3 A;  1QZE A;  3GOE A;  1JAL A;  3B2G A;  4C4V B;  2IPK D;  3L17 A;  3PS6 A;  4OVV A;  3IT6 B;  2IO2 B;  1DOX A;  2ZNV C;  1YX6 B;  1VR9 A;  5BYS A;  4N58 A;  2DX5 B;  2QIE B;  1HTQ A;  1JWS D;  1NDD A;  1MJD A;  1H4R A;  4KDL B;  4BZA A;  3BY4 B;  1EUV B;  2KFK A;  4ZRJ A;  2LI5 A;  2ASQ A;  4LDT D;  2DWQ A;  3H6N A;  3HUI A;  4GGQ A;  1KJT A;  1JRU A;  2GBJ A;  1KTK A;  2FCN A;  2RGF A;  3OWE B;  1GJZ A;  1ET6 A;  4KVG B;  1OEY A;  2KWD A;  1RM6 C;  2BQQ A;  5HI1 A;  2CHW A;  1FIQ A;  3KYC D;  3IFW B;  2LGY A;  3R8B A;  1E90 A;  4GDK B;  2WXJ A;  1V81 A;  2NTS A;  1RWS A;  3SR6 A;  3TBL D;  1UGM A;  1HZ5 A;  2WU5 B;  2KJR A;  3ZNI D;  2LZ6 A;  2KT7 A;  4NAW A;  3IVF A;  1FCL A;  4K3C A;  4IW0 A;  3MHZ A;  3ZUN A;  2KX0 A;  1WJ6 A;  3H7P B;  4ZHO A;  3OG5 A;  1LM8 B;  2L8J A;  2BB6 A;  3WAM A;  2RSU A;  3SFE B;  3N1Z C;  4WIP A;  4W9I A;  2BYF A;  3MHS D;  1WGG A;  3ZQ4 A;  4FLH A;  2C7H A;  3H1U A;  4NJC A;  4DHJ B;  2L52 A;  5E6P A;  2GRI A;  1YNT E;  2CU1 A;  3W1Y A;  3O65 B;  3A33 B;  1XT9 B;  3AXC A;  1Z5S B;  2XEW A;  2FCQ A;  1ACC A;  4GN1 A;  1K51 A;  1PQS A;  3U7D A;  2D5G A;  4RF1 A;  3SDL C;  4ANV A;  5TSS A;  5DPR A;  3RNB C;  2KC2 A;  2L00 B;  1TS4 A;  1M94 A;  5DPW A;  1D5Z C;  2WX0 A;  1C3T A;  4P6V F;  1WWT A;  3PVL A;  1U4A A;  3CF6 E;  1L6V A;  2TSS A;  2KQ4 X;  1V8C A;  2C7N B;  2K6D B;  1E7V A;  4IG7 B;  3U52 E;  2KVZ A;  3KUZ A;  2UWQ A;  2FID A;  2V9H A;  4CYE A;  5C1Z A;  1TZO A;  4R3D A;  3QX1 A;  2PE6 B;  4A3O A;  2DAF A;  3B08 A;  2BPS A;  1HZ6 A;  4K1R B;  2D3A A;  2WXO A;  1V2Y A;  3GZN B;  3KUD B;  3SHQ A;  2IGD A;  4MH8 A;  1FNV A;  5FR6 A;  2LJ5 A;  4BKS D;  2M56 B;  3GZN I;  1M4V A;  2NTT A;  1OQY A;  4N6E B;  4MH0 E;  2K0P A;  1SE2 A;  1NYQ A;  1CJE A;  2N9P C;  2V3N A;  2N7J A;  5I4D A;  3BK1 A;  2JYT A;  3VQI A;  1Q0W B;  4WH4 A;  3ZRF A;  1XCT L;  4BAX A;  2PVG C;  1SJE D;  4MJS A;  2LHD A;  3H8H A;  2GMI C;  1VCB A;  4AJY B;  1ESF A;  2ICI A;  1YQ4 B;  1E6E B;  1C4P A;  3W5V B;  2OHF A;  1KLV A;  4TQ0 A;  1RLF A;  4RNA A;  2QDF A;  1WM3 A;  1SE4 A;  2PEA A;  5CX3 A;  3VAW A;  1NBF C;  3DVG X;  1JRO A;  3VUY A;  2JQR B;  4B0M A;  4GDL A;  1KM7 A;  2N4F A;  2MJ3 A;  1B9R A;  4M8M A;  5EE1 A;  1SBB B;  3UIP B;  4II3 B;  1MFW A;  2WQY B;  3C0R B;  3PGE A;  2QEJ C;  2BKR B;  5JHA A;  2M8S A;  4KX6 B;  3PZ8 A;  2BKF A;  3AE1 B;  1TIF A;  1PFD A;  1SB3 C;  2L0T A;  2Z0D B;  3IAM 1;  4YWG G;  4C4V A;  3B0A A;  3RUL A;  4TKN A;  1FNW A;  2X38 A;  4FJV B;  2KXJ A;  1ZDV A;  2MH7 A;  2M19 A;  2D2Q A;  3DBH B;  1JRP A;  2PTL A;  2MHJ A;  4LCD E;  1GUA B;  4OVU A;  3VUW A;  3DBH I;  1L5P A;  2A4Z A;  4HCN B;  4HKZ E;  3MJ5 A;  4W9K A;  2B3A A;  2ZCC A;  3RPF C;  2LVO A;  2HE7 A;  3TCA A;  1J7A A;  2LD9 A;  4MGY E;  4M00 A;  4DXF A;  2NPT A;  2JVC A;  4IWQ A;  3Q2A C;  3P4R B;  3B1L X;  1XF5 L;  3BII D;  2Z59 B;  3BVZ A;  2WXP A;  2UU7 A;  1R4N B;  4GDK A;  1PDX A;  1L0V B;  3T9L A;  1R4N I;  1E10 A;  4MAC A;  1QIL A;  2AL3 A;  1ZXI A;  1WXA A;  2HTH A;  4GXB A;  1GB1 A;  2JF5 A;  1LFD A;  4L1B A;  1C4C A;  1FFV A;  3H7P A;  1I4P A;  4RMA A;  3AN1 A;  3HIZ A;  4FHJ A;  4EKU A;  2ZW1 A;  1TYG B;  3TJP A;  2V4L A;  2KFK B;  2DZI A;  4I6P A;  1ZP0 B;  1CZP A;  1NVI D;  3EFC A;  3M95 A;  1OGW A;  3URY A;  4LDT B;  1WGR A;  2QCZ A;  1UH6 A;  1DYQ A;  2IY0 B;  3RN9 C;  4ANX A;  4BKT A;  1ZDX A;  3DBS A;  1WXS A;  1X1M A;  3ZNG C;  5KHO A;  1GC7 A;  5IO9 A;  1UBQ A;  3RNF C;  4AQ7 A;  2OED A;  3K9O B;  3AE5 B;  2NBU A;  4WQO B;  1P9D U;  3RMK C;  3NY5 A;  3L0W B;  3OLM D;  2G45 B;  4AOF A;  2CHZ A;  2R61 A;  3ECI A;  3VTV A;  2GLS A;  1WE6 A;  3BZD B;  2L0F A;  5JHB A;  2WP9 B;  5IP4 D;  3NVV A;  3ML9 A;  2KQS A;  3GE8 C;  4XGA B;  3ZIM A;  4G0N B;  2BTE A;  1E7U A;  2DAJ A;  3AEB B;  3TUO A;  1AW7 A;  2KD0 A;  1ZGU B;  1TS5 A;  3DOW A;  2VZK D;  2REX A;  1TT5 B;  2WHI A;  3UGB B;  1SGH A;  3HM6 X;  2DYB A;  4JWU C;  2IO0 B;  1UNS A;  2IDY A;  1EM7 A;  4KGR A;  1EU4 A;  1V6E A;  1QF6 A;  1K53 A;  3I9V 1;  3WAO A;  2JY6 A;  2LRU A;  2G3Q B;  4WJQ A;  4C80 A;  1PGA A;  1PYW D;  4OZA A;  3B2F A;  2FCM A;  3R66 C;  4JIO U;  3L54 A;  1YMH E;  3ZRC A;  3R7Q A;  2AEH A;  4LJO B;  4S17 A;  1GC6 A;  1WRD B;  3AM9 A;  4WWN A;  3VRB B;  3DVN V;  1WM2 A;  1MHH E;  3IHP C;  3KW5 B;  1IYF A;  2CU3 A;  3U8Z A;  4HLE A;  4OW0 A;  2OJR A;  3Q14 C;  3MFG A;  3AU4 A;  2KVR A;  4RF0 A;  3RUI B;  3BYT B;  2J0J A;  2RDG A;  2KKC A;  4BBN C;  4LNN A;  1WGH A;  2JT4 B;  1ROE A;  3RZW C;  2M0X A;  4LTU A;  3S2A A;  2ZPY A;  2WXH A;  2WDQ B;  4JL9 A;  2PE9 A;  2QHO A;  5G5H A;  5BMG A;  1RYJ A;  4WAA A;  1TS3 A;  2W55 A;  1AWD A;  1DOI A;  4M8N A;  2WXL A;  1TKE A;  4IUM B;  4PS3 A;  4MGK E;  2FE8 A;  4NY0 A;  4E71 A;  2KWV B;  1PGX A;  2K22 A;  4K81 A;  3P4P B;  2KMA A;  2DZM A;  1E8Z A;  1PGB A;  5D2M B;  1TGZ B;  2KDB A;  2RPV A;  1RAX A;  2L76 A;  3N9Y C;  4IWP A;  1TY2 A;  3JW0 X;  1LXD A;  3MC9 A;  3UQA A;  5DCN A;  2J53 A;  4TQ1 A;  2GOW A; 
#chains in the Genus database with same CATH homology
 1WJN A;  4G11 A;  2KHW B;  2CU1 A;  3W1Y A;  4KIK B;  2LVQ A;  3ZDM C;  3O65 B;  4EZK A;  3A33 B;  1H8C A;  1WI0 A;  2RR9 A;  1XT9 B;  3AXC A;  1Z5S B;  1P0R A;  2XEW A;  2FCQ A;  1UD7 A;  2ZCB A;  3PHW B;  4GN1 A;  4NPN A;  5J18 A;  5EDS A;  1PQS A;  3EHV A;  3U7D A;  4IC7 B;  1Y8R C;  4ZRI A;  3SDL C;  4ANV A;  3D32 A;  4NJ6 A;  1E5W A;  4MSQ B;  4TUU A;  4FUL A;  5DPR A;  2VRR B;  2PPH A;  3PRM B;  4EZJ A;  2KC2 A;  1V5O A;  2L00 B;  1M94 A;  1V9J A;  5DPW A;  2WX0 A;  2EMS A;  4GSW A;  3A9K B;  3ZNZ B;  2MBO A;  3MTN B;  4K7U A;  1C3T A;  3PVL A;  4DWF A;  4YL8 A;  2WWZ A;  1U4A A;  4DHZ E;  4K7S A;  3CF6 E;  2BWE S;  4XZ4 A;  3JSV B;  2C7N B;  2K6D B;  1E7V A;  4IG7 B;  5CHF A;  1YQB A;  1P98 A;  3KUZ A;  2R2Q A;  2KTF A;  2M4N A;  2UWQ A;  2FID A;  3A4S C;  5L83 A;  5BO4 B;  3X0W A;  2MCN B;  4CYE A;  5C1Z A;  3QX1 A;  1D3Z A;  4GIV A;  2JWZ A;  2OOB B;  2IY1 B;  2PE6 B;  4HK2 A;  3UIN B;  4A3O A;  4AJW A;  2FAZ A;  1ISN A;  3H7S A;  3X23 A;  2DAF A;  3A1Q B;  3B08 A;  2BPS A;  1GG3 A;  4K1R B;  3TMP B;  2KDF B;  2MP2 A;  1EF5 A;  3A9J A;  3EC8 A;  1V2Y A;  1WMH A;  3SHQ A;  3KUD B;  2HD5 B;  4RM9 A;  3JVZ X;  2O2V B;  5JZE B;  4JGH B;  5FR6 A;  2KQ7 A;  2O6V D;  2LJ5 A;  4BKS D;  3GZN I;  1NI2 A;  1OQY A;  1XQQ A;  1ZKH A;  4MH0 E;  3N3K B;  3V61 A;  1S3S G;  1Q1O A;  4DBG A;  4B95 A;  4EOY A;  2HJ8 A;  2N9P C;  2ZVN A;  2NPT B;  2W9N A;  2KN5 A;  3VQI A;  1Q0W B;  1MG8 A;  3PT2 B;  1RRB A;  3ZRF A;  3W1S A;  3M3J A;  4MJS A;  2WX1 A;  5LXI B;  2IO1 B;  2JZZ A;  3DPD A;  1E8Y A;  3ZNH B;  3QQ8 B;  2KDI A;  5TR5 A;  2GMI C;  5IAA C;  2IZV B;  4MGZ E;  1VCB A;  4AJY B;  4FBJ B;  2UYZ B;  4HJK A;  5AEK B;  3IG3 A;  4NJ7 A;  1GNU A;  2JUO A;  2YLM A;  5D94 A;  1BT0 A;  5D6J B;  4DDI D;  4KZ0 A;  1V5T A;  2KNB A;  2MA9 B;  3QWZ B;  3TL5 A;  4DK5 A;  2CHX A;  1KLV A;  3SD5 A;  4TQ0 A;  1RLF A;  5G2N A;  1Z2M A;  4BKG A;  2MBQ A;  2Y5B B;  1K8R B;  1UZX B;  1E8X A;  1WM3 A;  3UF8 A;  1T0Y A;  2PEA A;  5CX3 A;  4BOZ B;  2K8C A;  4PS7 A;  1AAR A;  3TIX A;  3VAW A;  3MJW A;  1NBF C;  3DVG X;  4TV3 A;  4ANU A;  2AWT A;  2KMC A;  4HWI B;  5J17 A;  2CS4 A;  4W9G A;  3APD A;  3PSE B;  3VUY A;  4F7Z A;  3OAW A;  4DHJ D;  4GDL A;  1KM7 A;  2N4F A;  4W9E A;  4AP4 C;  3NS8 A;  2FUH B;  5DPS A;  4M8M A;  4IM0 A;  1L2N A;  4KZC A;  4B6W A;  2KLC A;  3DQV A;  3UIP B;  4II3 B;  2MSE D;  3ZDT A;  3C0R B;  2N1W A;  2N9X A;  4ZYN A;  3ZVV A;  3N32 A;  4MEL A;  3W1S C;  3PGE A;  2D3G A;  1WZ3 A;  1YIW A;  2BKR B;  3KVF B;  1A5R A;  4J6I A;  2GBM A;  1WY8 A;  3WAN A;  1ZW7 A;  5JHA A;  4N9F 4;  2AL6 A;  2M8S A;  1WXV A;  1WIA A;  2BKF A;  1YD8 U;  1WFY A;  4KSK C;  4WWP A;  3KUC B;  3I3T B;  2V1Y A;  3T8M A;  2IO3 B;  1R4M I;  2RPQ A;  1I35 A;  2GBN A;  3P2B A;  3WAP A;  2M1M A;  2C7M B;  2L0T A;  2J7Q B;  2Z0D B;  4NAW B;  5C23 A;  3B0A A;  3OJ3 A;  3RUL A;  2C5L C;  1IPG A;  2I1K A;  3L13 A;  4ZRK A;  4TKN A;  4DHZ B;  3ZW3 A;  2I1J A;  3KH0 A;  4FJV B;  3DDC B;  2NBV B;  2KXJ A;  4WJP A;  3RZF A;  2KDE B;  4HXD A;  1P3Q U;  2LVP A;  1WF9 A;  3K9P B;  2D2Q A;  4W9J A;  4W9H A;  3KYD D;  4LCD E;  1GUA B;  2MBH A;  3QK0 A;  3A1Q A;  2MWS B;  4OVU A;  3VUW A;  4I6N B;  2BYE A;  1VD2 A;  4MM3 A;  2KAN A;  5DPT A;  5AZH A;  3DBH I;  1WJU A;  4F8C B;  1TZ1 A;  2A4Z A;  2DZJ A;  2JXX A;  4HCN B;  3PLV A;  3ALB A;  3U30 A;  4NQL B;  4DXA B;  4EUT A;  3RT3 B;  1TTN A;  2XK5 A;  2ZNV B;  3PHX B;  1LQB A;  1WX9 A;  2L3Z A;  4W9K A;  1SIF A;  2JRI B;  2B3A A;  3WIM A;  2ZCC A;  1WGY A;  4WJN A;  4GOC A;  2LVO A;  4W9D A;  3DBL I;  2HE7 A;  3TCA A;  1RFA A;  4LJP B;  4FN2 A;  3PV1 A;  2LD9 A;  2ZJD A;  4IWO A;  1P1A A;  4MGY E;  5JH5 C;  2IBI B;  2NPT A;  4HDO A;  4MGI E;  4BOS C;  2JVC A;  3DCG A;  4IWQ A;  2BYV E;  4AWJ A;  2G4D B;  1V80 A;  3B1L X;  3PLU A;  1WYW B;  4JQW C;  2Z59 B;  2KX3 A;  5J2R A;  2LWP A;  1V86 A;  2G4S A;  2O6V A;  4GDK A;  4BKS A;  2DZK A;  3AUL A;  1WE7 A;  1WX8 A;  2EMT A;  4EZL A;  3SU8 X;  5E6P A;  5CTR C;  2Z0E B;  3T9L A;  1R4N I;  2K1F A;  4FJZ A;  2AYO B;  2NS5 A;  3ONS A;  3WA0 A;  2C60 A;  2DYO A;  3VDZ A;  2KZR A;  2AL3 A;  1WXA A;  2HTH A;  4E3C A;  2N7E A;  4EFO A;  4GXB A;  3QIJ A;  2DYM A;  4HVB A;  4G50 A;  2JF5 A;  1LFD A;  2NCN A;  2D07 B;  2XBB C;  4I6L B;  3VTW A;  4ZDV A;  3QCA A;  3ZKJ C;  4EEW A;  4ICU A;  1S1Q B;  2KJ6 A;  2ZVO A;  5L95 C;  2L7R A;  2NR2 A;  3H7P A;  4PYZ A;  4RMA A;  2A5U A;  3HIZ A;  5AZG A;  2WDT B;  4FHJ A;  3VH4 B;  4EKU A;  4BBN F;  3VHT C;  2MBB B;  3TJP A;  4AUQ C;  2ZPN A;  2MLB A;  1CMX B;  2MP2 B;  2V4L A;  3A9J B;  4FAD A;  2KFK B;  2DZI A;  1WMH B;  4I6P A;  3M95 A;  3BIN A;  1OGW A;  3ENE A;  4LDT B;  3RD2 A;  1WR1 A;  2J0M A;  1WGR A;  2IYD B;  2MW5 A;  3EEC A;  4M0W B;  1UH6 A;  3PRZ A;  2IY0 B;  4ANX A;  1Q5W B;  2PJH A;  4BKT A;  1J19 A;  1XD3 B;  2L05 A;  3DBS A;  1WXS A;  1I42 A;  4MSM B;  1X1M A;  4II2 B;  3ZNG C;  2LXC A;  2FCS A;  3RCZ A;  4DDG D;  2LAS A;  3APF A;  3OJ4 B;  5CHW A;  1GC7 A;  5KHO A;  5AZF A;  3Q3F A;  1UBQ A;  2KFJ A;  4KIK A;  3WAL A;  3PPA A;  3VFK A;  3PTF C;  2K6Q A;  2KK8 A;  4MJS B;  3HHM A;  4NQK E;  4W9C A;  3K9O B;  4WQO B;  2NBU A;  1F9J A;  4ICV A;  2V3S A;  3VUX A;  1P9D U;  3Q3J A;  3V6C B;  2ZZP B;  2R2O A;  3L0W B;  3NY5 A;  3OLM D;  2G45 B;  4PYU A;  4AOF A;  3VXW A;  5IA7 A;  5LXH A;  2CHZ A;  3NZS A;  4MEM A;  4XC2 A;  2D11 A;  3ECI A;  1EO6 A;  3VTV A;  3JYU A;  1WE6 A;  3V60 A;  2L0F A;  2YVC A;  4CHK A;  5JHB A;  3A9K A;  4E74 A;  4NNJ B;  2K8B A;  3ML9 A;  1YX5 B;  2KQS A;  4FA6 A;  3UQB A;  3ZLZ A;  2KLG A;  4IM2 A;  1FXT B;  3JSV A;  4X57 B;  3ZIM A;  3QHT A;  4G0N B;  3DVG Y;  2NVU I;  2C9W B;  4PS8 A;  1EF1 A;  1E7U A;  3NHE B;  1OEY J;  2DAJ A;  3VTU A;  4GB9 A;  4A20 A;  2KD0 A;  1HE8 A;  1SE9 A;  1V49 A;  3CSF A;  1E8W A;  4BFR A;  1ZGU B;  4GMV A;  3UIO B;  2KO3 A;  4GDL B;  4WWO A;  2J0K A;  3ZTC A;  2DEN B;  3CMM B;  3DOW A;  3NZU A;  5G55 A;  4ASW C;  2M17 A;  3R7R A;  3H9D A;  3CST A;  1TBE A;  2KC1 A;  1L7Y A;  3RYT A;  2FNJ B;  1WX7 A;  2REX A;  5GMV A;  2N1V A;  3L16 A;  2K25 A;  4WJO A;  2O2V A;  3ML8 A;  4A3P A;  3UGB B;  2MX2 A;  1SGH A;  2KWU B;  3HM6 X;  1WH3 A;  2DYB A;  3NOB A;  2LGX A;  2IO0 B;  3A4R A;  2KTR B;  3DVN U;  1V6E A;  3LDZ E;  2ZEQ A;  4KV2 A;  3APC A;  3WAO A;  2JY6 A;  4W9F A;  1IP9 A;  4G3X B;  2LRU A;  2G3Q B;  2KOX A;  3LJ3 A;  4WJQ A;  2D10 A;  1QZE A;  5D7G A;  2LRW A;  2N9E B;  3GOE A;  2FCM A;  3R66 C;  4JIO U;  3L54 A;  3ZRC A;  4FHK A;  1G6J A;  3L17 A;  3PS6 A;  4OVV A;  3R7Q A;  2AEH A;  3PZD A;  2IO2 B;  1GC6 A;  1WRD B;  4LJO B;  2DHZ A;  2WYQ A;  2ZNV C;  1YX6 B;  4WWN A;  4GU2 A;  3DVN V;  1WM2 A;  3QAR A;  2DX5 B;  3IHP C;  3KW5 B;  5E6N A;  1NDD A;  1IYF A;  1H4R A;  2MBE A;  2N7D A;  1UEL A;  4KDL B;  2GBK A;  4K7W A;  3U8Z A;  4HLE A;  3BY4 B;  1EUV B;  2KJH B;  2OJR A;  2KFK A;  3L08 A;  4ZRJ A;  2LI5 A;  3AU4 A;  2KVR A;  2ASQ A;  3RUI B;  2CKH B;  4LDT D;  4JLC A;  2J0J A;  2JZ3 B;  2KKC A;  2XK5 B;  2MQJ A;  3L10 B;  4BBN C;  3H6N A;  4HPM B;  1WGH A;  4CO7 A;  2JT4 B;  5CHV C;  1KOT A;  4GGQ A;  1KJT A;  1JRU A;  2GBJ A;  3RZW C;  3QA8 A;  1WJ4 A;  3N30 A;  2M0X A;  2FCN A;  2RGF A;  1GJZ A;  3S2A A;  4KVG B;  2ZPY A;  2CR5 A;  1OEY A;  2K39 A;  1WR6 E;  4HCP B;  2CHW A;  4JL9 A;  3KYC D;  2PE9 A;  3IFW B;  4KSL C;  5HKH A;  4W9L A;  1C1Y B;  1YJ1 A;  2LGY A;  2QHO A;  2EKE C;  4MDK E;  3M62 B;  2FIF A;  2BF8 B;  3ZTD A;  1E90 A;  5KHQ A;  2O6V B;  4GDK B;  1WZ0 A;  4RM8 A;  2LGD A;  4URK A;  4WAA A;  1V81 A;  1UBI A;  3QAQ A;  4ANW A;  3TBL D;  1J0G A;  4M8N A;  4F1S A;  1UGM A;  4IUM B;  3HK0 A;  4PS3 A;  4MGK E;  3VH3 B;  2KJR A;  3ZNI D;  4NY0 A;  4E71 A;  3VVW B;  2KWV B;  2LZ6 A;  4K81 A;  3PRE A;  3R3M A;  4NAW A;  2KWC A;  3IVF A;  4KDI C;  5LLI A;  3AI5 A;  4IW0 A;  2KMA A;  3ZO5 B;  3ZUN A;  3QJZ A;  2KX0 A;  1WJ6 A;  2DZM A;  2JPH A;  2LUE A;  1WGD A;  1J8C A;  3H7P B;  4P7I A;  1E8Z A;  5D2M B;  2MRP A;  1TGZ B;  1OTR B;  3IBE A;  3QC8 B;  4B9K A;  4HPL B;  1LM8 B;  2L8J A;  4HDQ A;  3WAM A;  2KDB A;  3DBR I;  3HM3 A;  2RSU A;  2RD0 A;  4IM3 A;  1RAX A;  2K8H A;  2L76 A;  4W9I A;  1WXM A;  2GBR A;  3PRP B;  3V6E B;  2BGF A;  3M63 B;  2BYF A;  3MHS D;  3EFU A;  4XX5 A;  2BWF A;  2JRH A;  4IWP A;  5E6O A;  2NBW B;  1WGG A;  3JW0 X;  1LXD A;  3V62 A;  4FLH A;  3UQA A;  2C7H A;  3H1U A;  2LXA A;  2KTR A;  4FJY A;  4BVU C;  4DHJ B;  5DCN A;  4TQ1 A;  2GOW A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...