4EOYA

Plasmodium falciparum atg8 in complex with plasmodium falciparum atg3 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
GMPSLKDEVSFENRVAETHKIRSKYPNRIPVVIERANRSNLPIIEKKKFLVPMNMLVGEFKFILHQHINQSAYGSNMKLFRERTIYLFVNNIVPKTGLLMQDLYEMYKDEDGYLYMEYSSESSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Microtubule-associated protein 1 light chain 3
publication title Structural characterization and inhibition of the Plasmodium Atg8-Atg3 interaction.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 37
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eoyA00
3A1QA 3L10B 4I6NB 1WRDB 2O6VA 2CHWA 2ZNVC 1EUVB 3DVNU 4NPNA 2KTFA 3B1LX 2L0TA 4JGHB 2V1YA 1J19A 4TKNA 2NR2A 3A9JB 1E7VA 2KZRA 2OOBB 2KX0A 1E8XA 2N7DA 4MGZE 4XX5A 5LXIB 1V81A 1KOTA 4CO7A 1LFDA 3A9KA 4FADA 1KM7A 3LJ3A 3N32A 4BOSC 2N4FA 1Z2MA 4II2B 3NZUA 2FUHB 3L13A 1E90A 4HPLB 5D2MB 4K1RB 2MRPA 2FIDA 2CHZA 2DYOA 1GC7A 1NI2A 1UBIA 4AJYB 3VXWA 2EKEC 1TBEA 2O2VA 3AXCA 3PSEB 3V6CB 2BKRB 2ZVNA 3QAQA 4MEMA 4AUQC 4BBNC 4JIOU 3M95A 2LWPA 1WF9A 2IZVB 1WJNA 4E71A 4F1SA 1L2NA 3H9DA 2KVRA 4W9CA 3O65B 2G4SA 1KJTA 4GDLA 3VQIA 1GG3A 4ICUA 4W9JA 3HM6X 3PTFC 4RM9A 1IP9A 4K7SA 2MW5A 3T9LA 5FR6A 2C7MB 4DK5A 3QHTA 4MJSB 3R7QA 4LDTD 2W9NA 4FLHA 3AU4A 2XK5A 4HDQA 3V60A 2D10A 5E6OA 3TJPA 2MP2A 3JVZX 2DENB 3SHQA 3T8MA 4DHZE 3QWZB 2C60A 2KO3A 5JHBA 2MX2A 2BWFA 1F9JA 3NS8A 2IYDB 2KFKA 2JZ3B 2LXCA 3PT2B 4BVUC 4PS7A 3MJWA 3APFA 3RD2A 2A4ZA 3CF6E 5G55A 1SE9A 2LUEA 4GMVA 4X57B 5AEKB 4KSLC 3UQAA 2ZCCA 4NQLB 3ZIMA 5HKHA 1D3ZA 2KLGA 3UINB 4GB9A 3DBLI 3R3MA 5IAAC 1YX6B 3VDZA 1WR1A 3DBHI 2KDFB 2V3SA 3ZNGC 2MWSB 4HXDA 2XEWA 2MLBA 5DPSA 4M8MA 4GN1A 3A9JA 1LM8B 2RGFA 1GNUA 1SGHA 2BWES 3CSFA 3L08A 2KN5A 2NBUA 2MA9B 1GUAB 4WJQA 4NJ6A 4WWNA 4KSKC 1IPGA 3KUCB 3WAMA 2MBOA 2CHXA 3DBRI 1WJ4A 4E3CA 2L7RA 2QHOA 4ZRJA 1WGRA 2R2QA 3UGBB 2KK8A 1Y8RC 3H6NA 1WE6A 1Q1OA 3RUIB 4PS3A 3OJ4B 1G6JA 2WDTB 3ZW3A 4XZ4A 2JRHA 3IG3A 3DVGX 1UELA 3UIPB 4EOYA 1E8WA 3PRPB 3W1SA 1C3TA 5J18A 3H7PB 2L0FA 2AL3A 3APCA 2M8SA 2DYMA 3TBLD 1RAXA 1YX5B 2GBJA 3BY4B 2D11A 2NS5A 2JUOA 4PS8A 3RYTA 1WGDA 1WMHB 4W9LA 4HCPB 1WXSA 2GBRA 4FJZA 4MJSA 5LXHA 2HTHA 2GBMA 2L3ZA 5LLIA 2DX5B 4HDOA 1L7YA 3NHEB 4IUMB 3DPDA 3W1SC 2CU1A 2L76A 2MBEA 1LQBA 3B08A 1UH6A 4GOCA 3DDCB 3GOEA 3QIJA 4JL9A 1P9DU 2M17A 1FXTB 3IFWB 2IO1B 4HWIB 2K8BA 2K8CA 3VTWA 4E74A 4OVVA 2RSUA 3JSVB 4GIVA 1S3SG 1M94A 4II3B 4ZRIA 2REXA 1OTRB 2CR5A 1ISNA 2N9EB 4KV2A 4MDKE 1OQYA 5E6NA 2GOWA 1WIAA 2Z0EB 3MHSD 2KQSA 2Z59B 2C9WB 1WFYA 4TQ1A 4FJVB 3RZWC 2WX1A 2IO0B 4B6WA 4IWOA 4ASWC 3KH0A 3EC8A 3TL5A 1GJZA 2PE9A 1V86A 1V5TA 1WM2A 1AARA 2ZPNA 3AULA 4HPMB 3M3JA 4MGKE 4M0WB 3N3KB 4M8NA 5L83A 3VH4B 1WI0A 4FBJB 4GXBA 5E6PA 3RCZA 1V5OA 2N1WA 4KVGB 2KWVB 4CHKA 1NDDA 2GMIC 2KQ7A 2KWUB 3KW5B 4KIKB 3A4RA 1WR6E 2MBQA 2AWTA 5D7GA 1MG8A 3M62B 4XC2A 3VUXA 2IY0B 2Y5BB 2KDIA 3PRZA 4ANWA 2ZCBA 2J0JA 5DPWA 1YJ1A 1J0GA 2M1MA 5L95C 2JVCA 3VVWB 3VFKA 3L54A 5AZFA 4JQWC 1WX9A 4LCDE 1V6EA 4DWFA 1ZGUB 3QK0A 4KDLB 3ZRFA 2A5UA 2RD0A 3ENEA 3R66C 1H4RA 3K9PB 3TMPB 3QARA 1XQQA 4HVBA 4AJWA 1SIFA 1WYWB 3H7PA 4NQKE 1OEYA 4EUTA 1WJUA 2R2OA 4G11A 3ZRCA 2M4NA 3PV1A 5D94A 4G50A 3DBSA 2KWCA 3V61A 5C23A 1WXAA 3HM3A 1WMHA 3K9OB 2BYFA 2OJRA 3UF8A 1RLFA 1ZKHA 2C5LC 2MSED 2LD9A 4BKSA 3QX1A 2FCSA 2PE6B 3R7RA 1VD2A 3PPAA 3RULA 5JHAA 2ZNVB 2VRRB 2ZPYA 3JYUA 3I3TB 2BGFA 3Q3JA 1K8RB 2KC2A 1WGGA 4WJOA 2MCNB 3JSVA 3WALA 2V4LA 2L05A 3QQ8B 4MELA 2LGXA 1BT0A 2N1VA 3VUWA 4P7IA 4EZKA 1QZEA 1WY8A 4K7UA 1V49A 4IWPA 4HCNB 2HJ8A 4TV3A 2DZIA 2ZJDA 5DPTA 4WWPA 2J7QB 2LI5A 1TZ1A 3DCGA 4I6LB 1V80A 2K8HA 1R4NI 2LVOA 4BKSD 2DAJA 1EF1A 2FCNA 5AZHA 5CHWA 1WE7A 3ZO5B 1P3QU 3GZNI 1X1MA 3X23A 2FNJB 1H8CA 3HK0A 3DQVA 2HE7A 4KIKA 1JRUA 2K25A 3VTVA 3U7DA 3QC8B 1TTNA 3ML8A 1UZXB 3PLVA 3DVGY 2AYOB 5DCNA 1Q0WB 4KZ0A 1Q5WB 3VHTC 4EZLA 3P2BA 4EZJA 2B3AA 4HK2A 4K81A 2JF5A 1UD7A 1WJ6A 2BYVE 2D07B 4W9KA 2KC1A 3ONSA 4B95A 3WAOA 1E8ZA 3HHMA 5G2NA 2JZZA 4AOFA 4DXAB 1S1QB 3LDZE 2UWQA 4N9F4 4YL8A 1WH3A 2ZEQA 1P0RA 1V9JA 3KVFB 4MSQB 3RT3B 1WXMA 3IBEA 4W9HA 3PHWB 2L00B 3Q3FA 4W9EA 2NPTB 3WIMA 2KKCA 3X0WA 2RR9A 5BO4B 4IWQA 2LZ6A 2BPSA 4J6IA 3VAWA 4ANUA 4IG7B 3BINA 3CMMB 3V6EB 2KOXA 3ML9A 5JZEB 2MBHA 2Z0DB 3QJZA 2FAZA 3PLUA 2JWZA 5D6JB 1YIWA 2DHZA 4IM0A 1E8YA 4RMAA 2PPHA 2DZMA 1XT9B 1RFAA 2FCMA 2KLCA 3C0RB 1IYFA 2JPHA 4GDKB 2AEHA 4WWOA 2ZVOA 4MGYE 2RPQA 3ZNHB 4EFOA 1U4AA 4HJKA 4URKA 4TQ0A 3MTNB 2JRIB 1CMXB 2BKFA 1E7UA 2LXAA 5EDSA 4DDID 3ZDTA 4W9IA 1PQSA 2KJRA 3PS6A 2XBBC 4JLCA 3ECIA 4MM3A 1WX8A 1OGWA 2KD0A 3QA8A 5CHFA 3WA0A 2FCQA 2KMAA 2WWZA 3B0AA 2KHWB 4ANVA 5J17A 2EMTA 2M0XA 4A3OA 5KHOA 2LGYA 4NJ7A 2WX0A 2KTRB 2CS4A 2NBVB 2JT4B 4FN2A 4KZCA 4AP4C 5TR5A 3ZLZA 2UYZB 5CTRC 4CYEA 4DHJB 2KX3A 2DAFA 2ASQA 3KYDD 3N30A 4FHJA 1GC6A 3JW0X 3L16A 3D32A 1WZ0A 3OAWA 2LRWA 3KUDB 3ZVVA 2HD5B 1YQBA 2BF8B 2O6VD 2PEAA 1XD3B 1ZW7A 3VUYA 3OLMD 5GMVA 1YD8U 2IO2B 4RM8A 4F8CB 1P98A 4ZYNA 2I1JA 4G0NB 3IHPC 2BYEA 2G45B 2MBBB 3HIZA 3CSTA 5JH5C 4DHZB 1P1AA 2N9PC 2IO3B 3U30A 3ZDMC 1WGHA 3ZUNA 5IA7A 4WJNA 2KDBA 2J0MA 4NAWB 3DVNV 3U8ZA 3V62A 1EF5A 3NZSA 2NPTA 4IM3A 1I35A 1KLVA 4IC7B 4PYZA 4EEWA 2JXXA 2C7HA 1OEYJ 3ZKJC 4DDGD 3QCAA 4TUUA 3AI5A 3PHXB 2IBIB 4WJPA 5KHQA 3L0WB 2EMSA 1WGYA 2K39A 2KDEB 2CKHB 4B9KA 1I42A 3WAPA 3L17A 2J0KA 3TCAA 1WXVA 3A1QB 4A3PA 2G3QB 1RRBA 4NNJB 2AL6A 2O6VB 3A4SC 4FULA 3UQBA 3VTUA 4BFRA 3DOWA 1V2YA 4A20A 3IVFA 3ZTDA 2LVQA 3PVLA 5J2RA 4BKGA 2NBWB 2D2QA 4GDKA 1NBFC 3KUZA 4FHKA 3ZNID 4KDIC 1A5RA 3W1YA 2LASA 3A33B 2NCNA 3VH3B 3SDLC 3A9KB 3OJ3A 3UIOB 2KJ6A 4AWJA 2LGDA 4BBNF 4FA6A 3PREA 2PJHA 3NY5A 4LDTB 3S2AA 3SU8X 4IW0A 4W9FA 2FIFA 3PGEA 3H1UA 4LJOB 2MQJA 2KXJA 1UBQA 3KYCD 4LJPB 1WX7A 2NVUI 2O2VB 4G3XB 1J8CA 2JY6A 3EFUA 2KNBA 4BKTA 4IM2A 2LRUA 4PYUA 1C1YB 2KTRA 1LXDA 4K7WA 5CHVC 2KJHB 4ICVA 3H7SA 4ZRKA 4GDLB 2G4DB 2LJ5A 1E5WA 4GSWA 4W9GA 3TIXA 2L8JA 1TGZB 4F7ZA 2K1FA 1Z5SB 2N7EA 1UGMA 2KMCA 3ZTCA 4OVUA 2GBNA 3AU5A 1EO6A 2I1KA 4HLEA 3RZFA 3WANA 1VCBA 2N9XA 2XK5B 2K6DB 3SD5A 3PZDA 3NOBA 2D3GA 2YVCA 2MP2B 4NY0A 4MGIE 5CX3A 3EHVA 4MSMB 4BOZB 2KFJA 3PRMB 4EKUA 2WYQA 4MH0E 2LVPA 1R4MI 3EECA 4W9DA 3ZNZB 2KFKB 4NAWA 4GU2A 3ALBA 1HE8A 2K6QA 5DPRA 4ANXA 1T0YA 2GBKA 4ZDVA 1WZ3A 3M63B 4DHJD 2DZJA 4FJYA 2YLMA 4DBGA 4GGQA 4I6PA 4WAAA 3APDA 2DZKA 2DYBA 1WM3A 2IY1B 4WQOB 5C1ZA 5AZGA 2KANA 2C7NB 2ZZPB
chains in the Genus database with same CATH superfamily
4YXDB 2K0PA 3SFEB 2W3SA 3E56A 1J19A 3AE3B 2NR2A 3O13A 1E7VA 2KZRA 2OOBB 2KX0A 2VZKD 1KM7A 2BBCA 2CU3A 3L13A 4HPLB 2V3PA 2DYOA 1UBIA 3GS2A 3VXWA 1EU4A 3QAQA 2R61A 2LWPA 4F1SA 3LXFA 1L2NA 3CWIA 3VQIA 3RNFC 3PTFC 4K7SA 2MW5A 5FR6A 2C7MB 2FE8A 3R7QA 1F0ZA 2WNMA 1VZ7A 2K9XA 4ZHPA 5E6OA 2MP2A 2KWDA 2WU2B 3AE6B 2LHDA 2KN4A 5G55A 3UQAA 1HTQA 4GMVA 2LUEA 4MH8A 4NQLB 5HKHA 2JSVX 4RGTA 2KLGA 3UINB 2MEKA 3DBLI 2WXKA 3VDZA 1IGCA 3DBHI 2KDFB 4K3CA 2WXQA 1J7AA 2MLBA 2X8XX 4YSZB 1LM8B 2K5PA 3BYTB 3L08A 2KN5A 1I4QA 3Q8FA 3KUCB 3WAMA 2CHXA 2L7RA 3AE9B 1Y8RC 1C4AA 4PS3A 1G6JA 4MT5A 2BS3B 3MFGA 3IG3A 3RN9C 3DVGX 1UELA 3ETRA 3PRPB 1C3TA 2QILA 2QMTA 3APCA 4Q2JA 1PGAA 1YX5B 4JPSA 4PS8A 1KF6B 1WGDA 4MJSA 2L3ZA 2DX5B 4HDOA 1QOBA 1SEBD 3IFWB 3VTWA 4OVVA 1FRRA 2QIEB 4KV2A 2QDFA 3NVVA 2B76B 2Z59B 4TQ1A 3TEXA 2IO0B 1JROA 4ZRPA 1GJZA 1ZE3D 1V86A 4XGAB 5BMGA 4M8NA 2WDRB 4KIKB 2MBQA 5D7GA 4HRSA 4XC2A 3VUXA 2W82A 5DPWA 2ZCBA 3OG5A 2WU5B 3V3XA 3BIID 3R2TA 1T5XD 2M1MA 3NVYA 3AEEB 4S17A 4AS1A 3FILA 4JQWC 1T0RC 4DWFA 1QF6A 2W54A 2INNE 2W55A 2RD0A 2KACA 3QARA 1XQQA 4HVBA 1WYWB 3H7PA 4C56C 2YEPB 4JX1C 3DBSA 3HM3A 1MFWA 3UF8A 1EWYC 4BKSA 2PE6B 1L5PA 2ZNVB 1JWMD 1DGJA 2ZPYA 3I3TB 2BGFA 3AEFB 1FCLA 2KC2A 1D5XC 3AE8B 1BT0A 2N1VA 1NEKB 3VUWA 4K7UA 2BYTA 1V49A 4HCNB 5DPTA 2LI5A 4JE3B 3GE3C 1EF1A 2FCNA 1WE7A 3ZO5B 1P3QU 1IGDA 1L6UA 2FNJB 3MC0B 4WH4A 1XCQL 4IKGA 4A55A 2ACZB 1MI0A 1K50A 3DVGY 1RM6C 3DHHC 1Q5WB 1QOFA 2RPVA 3UI3A 2BYVE 2D07B 4W9KA 2KC1A 4OVZA 4P1CC 3HHMA 1F77A 4AOFA 4DXAB 4PT5A 2XN9C 3LB8C 1V9JA 4MSQB 3RT3B 1N5WA 3IBEA 2L00B 3BK1A 4W9EA 3X0WA 3LYYA 5BO4B 1UF0A 3SEBA 4J6IA 4IG7B 5JZEB 2QC8A 1DOIA 2PMVA 2DHZA 3MJ5A 4BAXA 4JWUC 5E6JA 1FD6A 1RFAA 2KLCA 1U4AA 4URKA 1CMXB 3T3OA 2LXAA 4ACFA 4DDID 3AMZA 1TS3A 2IJ0A 1L0VB 1WX8A 5CHFA 2KMAA 4ANVA 4NJ7A 3VRAB 3N9YC 3RI7C 4P16A 5TR5A 2UYZB 1F52A 4AQ7A 3KYDD 2DAFA 4FHJA 1GC6A 3KUDB 2HD5B 2PEAA 1DYQA 3KWVA 1YD8U 1C79A 1C4CA 4ZYNA 3IHPC 3URYA 2G45B 3HIZA 4DHZB 2VZKB 2IO3B 3ZDMC 2DNFA 3DVNV 1I4HA 3NZSA 4KGTA 1OEYJ 4TUUA 5BYSA 3PHXB 1QQRA 1NENB 3L17A 3TCAA 1KTKA 2G3QB 1RRBA 1YQ4B 3A4SC 1WGKA 4WWMA 1V2YA 4A20A 3IVFA 3ZTDA 2LVQA 5J2RA 1FXIA 2D2QA 2LASA 2M0AA 1XLNA 3BYYB 2LGDA 2RMMA 4FA6A 2JQRB 2PW9A 3SU8X 1B1ZA 3H1UA 1SF0A 1MJDA 1QILA 1L0YB 1JCKB 4LJPB 2BQQA 2O2VB 1JWBD 1TY2A 2JY6A 3RNCC 1JW9D 3MC9A 4IM2A 2LRUA 4PYUA 1C1YB 2KTRA 4K7WA 1XF5L 5CHVC 4ICVA 4GDLB 1E5WA 4B0EA 2GLSA 1EM7A 1JMLA 2JYEA 2N7EA 2KMCA 4RNAA 2I1KA 2XK5B 4L23A 3PZDA 2E6XA 3V05A 4MGIE 1SBBB 4MSMB 1KLUD 1HXYD 2LVPA 4W9DA 2LUMA 1HE8A 1T0YA 4ZDVA 1WZ3A 2MHJA 4RFBA 4DHJD 2DYBA 4WQOB 2C7NB 2ZZPB 1FMAD 3A1QA 2J53A 2O6VA 2CHWA 1ACCA 4NPNA 2BS4B 1ZP0B 3AE1B 4JGHB 4NZLB 1E8XA 4XX5A 1KOTA 3HVZA 3N32A 4BOSC 1VDVA 5D2MB 1YN3A 4K1RB 2MRPA 2CHZA 1MHXA 1GC7A 2EKEC 1TBEA 3AB5A 3AXCA 1N6ZA 2AQ1B 2ZVNA 4BBNC 2BT6A 4JIOU 3M95A 2MJDA 1WJNA 4E71A 2KVRA 4HJGE 2G4SA 1GG3A 1QLBB 3RNEC 3HM6X 4RM9A 2RDGA 1HTOA 3QHTA 4LDTD 3AU4A 4HDQA 2D10A 5IOIA 1OQRA 4USAA 3QWZB 2D3AA 2C60A 2KO3A 1F9JA 1WSPA 5HI1A 2IYDB 4LNOA 2JZ3B 4WIPA 3PT2B 2LEKA 4TMAB 3J9CA 3MJWA 1C77A 2Q5WD 1XXGA 1ROEA 2Y3AA 3ZIMA 1FNUA 3R3MA 5IAAC 1WR1A 1AN8A 2BTEA 2CJNA 5D3DA 5DPSA 2RGFA 3B2FA 1HA5A 1GNUA 1SGHA 4WJQA 2V0GA 4NJ6A 4KSKC 3PO0A 4E3CA 2QHOA 2R2QA 3UGBB 1WE6A 1Q1OA 4CQNA 3BZDB 3ZW3A 1TZOA 3UIPB 2M8SA 2DYMA 1RAXA 2SAKA 2D11A 2NS5A 1WMHB 4W9LA 5BYQA 1L7YA 3W1SC 2G1EA 2KMMA 5TSSA 3KWLA 2CU1A 2MBEA 3B08A 1V1OA 1BXTA 2M17A 2K8CA 4GIVA 1S3SG 1QKZA 2CR5A 2N9EB 5E6NA 1WIAA 3DBLB 2C9WB 1WFYA 1UNSA 3DBHB 3RZWC 1XO3A 2IGGA 2WXJA 3EC8A 3TL5A 2JU6X 1TS4A 3AULA 3NVWA 3M3JA 4MACA 3DWMA 1N5XA 1F2RI 1UGJA 2N7JA 4GXBA 5E6PA 1KLGD 4CHKA 4WQMA 1NDDA 1WR6E 2Y5BB 1SJED 2KDIA 3NJTA 1ET9A 3VRBB 4BZAA 3VVWB 3VFKA 3OWEB 1WX9A 4D2KA 1BUIC 2BW2A 2PKOA 4C80A 4AJWA 2L1AA 1SIFA 1V1PB 1XLQA 4EUTA 1E0ZA 3PV1A 1STEA 3AN1A 4G50A 1TT5B 2YEPF 4LNNA 2BYFA 2OJRA 2C5LC 1VZ6A 2LD9A 1CZPA 1TJEA 1T6BX 3T3NA 2GI9A 2FCSA 3R7RA 1VD2A 4PK1A 3PPAA 3RULA 3JYUA 5I4DA 3Q3JA 1K8RB 4WJOA 1ZXHA 2V4LA 2L05A 3I57A 3FAHA 4OZAA 1JALA 2HJ8A 2DZIA 4WWPA 3DCGA 4MM3B 2K3UA 1V80A 2K8HA 2AX5A 5AZHA 1X1MA 3X23A 1QOGA 4KIKA 1T0SC 2K25A 3VTVA 3R8BA 3IT4B 1R7SA 3QC8B 1TTNA 1UZXB 3ZQ4A 5DCNA 1C76A 4KZ0A 3VHTC 4EZLA 1C78A 4L2YA 4K81A 2KAJA 2JF5A 1UD7A 4ARCA 3AH7A 4B95A 3WAOA 5G2NA 4TSSA 1B9RA 2Z8LA 4RCOA 4YL8A 3LDZE 4N9F4 1P0RA 3KVFB 1WXMA 3NS1A 4W9HA 4LNKA 4RF1A 3ZJUA 3Q3FA 3E9SA 5FR3A 3WIMA 1C4PA 2BPSA 2WDQB 1HQRD 3V6EB 1XCTL 3ML9A 2JWZA 1A70A 3DHGC 2JPHA 2KYWA 3EUB2 3NRZA 4GDKB 4MGYE 2RPQA 2VH2A 3RPFC 4HJKA 1LGRA 1K52A 1E7UA 4EE2A 3ZDTA 1SE2A 4QAYA 4JLCA 2N9KA 1FCCC 3B0AA 2KHWB 4ZYSA 2EMTA 2M0XA 1XLOA 4A3OA 5KHOA 2WX0A 2CS4A 2NBVB 4KZCA 1HZ5A 2V9HA 4AP4C 1SE4A 4DHJB 4N6EB 2KX3A 2ASQA 5D3IB 3U2SC 2WQYB 3JW0X 3D32A 3GE8C 4DXGA 2O6VD 3VUYA 5GMVA 1CQVA 1XLPA 1UUPA 4G0NB 2MBBB 1GPXA 1J7CA 1UWXA 1EU3A 4WJNA 2J0MA 4NAWB 1TIFA 1EF5A 1I35A 1KLVA 4IC7B 4EEWA 4DDGD 5KHQA 5BYRA 4WJPA 1FM0D 2EMSA 4B9KA 2KDEB 1D6EC 1IBXB 2H88B 5IP4D 4A3PA 4FULA 1V8CA 1KFYB 1D5ZC 3DOWA 4BKGA 2NBWB 1NBFC 3ZGZA 4FHKA 1FFVA 4US9A 3ZNID 1A5RA 3BVMA 3P4QB 3W1YA 3VH3B 3SDLC 2H89B 3A9KB 3OJ3A 1N60A 4BBNF 2PJHA 3S2AA 4LDTB 1QOAA 3PGEA 5EE0A 2KXJA 1UBQA 3KYCD 1IUEA 1TY0A 2NVUI 2L83A 4BKTA 1FFUA 2JXTA 2KJHB 3I9V1 4ZRKA 2G4DB 4GSWA 1L4ZB 4LLGM 1YJIA 2K1FA 4ZRQA 5HFYA 4OVUA 2FUG1 2GBNA 3AU5A 3FKYA 4HLEA 1I7HA 2K6DB 5H92C 4NY0A 5CX3A 3EHVA 2KFJA 3AE2B 3PRMB 4EKUA 1JWUD 1FIQA 1R4MI 4LK0M 4C4VB 2KFKB 2WXRA 2GBKA 2EKIA 1YJJA 4FJYA 1I4RA 2MJ3A 2WXMA 1Q10A 4WAAA 2DZKA 5AZGA 1JRPA 2D3BA 5H8YE 4I6NB 2ZNVC 5IKCM 3WCQA 5MPOA 2HTME 2IGDA 3A9JB 2N7DA 4MGZE 5LXIB 1V81A 2N4FA 3NZUA 1N62A 2WDVB 4P6VF 1VRAB 2LGIA 2O2VA 3PSEB 3V6CB 4MEMA 4AUQC 1TKEA 1V97A 2OEDA 3KLSX 4W9CA 3O65B 4GDLA 1IP9A 3EGRA 3T9LA 2WXNA 2LJIA 3TUOA 1ZUD2 3N1XC 2XK5A 3V60A 4XWTA 2ZW1A 3SHQA 2DBYA 4DHZE 2IPKD 3SFDB 1WWTA 2BWFA 2MH7A 3NS8A 3TEZA 2LXCA 2X38A 4PS7A 1N61A 2A4ZA 5AEKB 2ICIA 4X57B 1ESFA 2ZCCA 3Q8BA 1FXAA 3Q3MC 3CIRB 1D3ZA 4HKQA 2SEBD 3CSFA 2NBUA 1GB1A 2L32A 4WWNA 4A9AA 1IPGA 1FNWA 2G9HD 1T3QA 2MBOA 3DBRI 3C8YA 4ZRJA 3U52E 3H6NA 3Q8EA 1NYQA 2K22A 3P4RB 3TSSA 2NMQA 1E8WA 3W1SA 4A90A 5J18A 1FNVA 2JYTA 2PTLA 4LNIA 2JZPA 3BY4B 2JUOA 2NTSA 4HCPB 1TS5A 1J7BA 2HTHA 2GBMA 1SB3C 1AYFA 4IUMB 1M4VA 3DPDA 1OQQA 2WP9B 2L76A 1UH6A 3AE5B 4GOCA 4H2AA 2J4XA 5HHDG 4JL9A 1FXTB 4HWIB 2IO1B 4E74A 3HUIA 3GB1A 1PGBA 3JSVB 4II3B 1OTRB 4MDKE 2GOWA 2KQSA 5C3JB 4FJVB 2WX1A 3EA6A 4B6WA 4IWOA 3KH0A 1TS2A 2PE9A 1WM2A 1AARA 4HPMB 4MGKE 1I4PA 1P7FA 4M0WB 2HJ1A 4FBJB 1WI0A 4LTUA 1V5OA 2N1WA 2KWVB 2KQ7A 3KW5B 2Y5PA 2AWTA 3M62B 2WHIA 1YJ1A 1J0GA 3NZ3A 4IOIE 1L4DB 2JVCA 5AZFA 4LCDE 2LGSA 4KDLB 3ZRFA 2A5UA 3R66C 3TMPB 3MC8A 4NQKE 1DOYA 1OEYA 3ZYYX 5D94A 4HEA1 1WXAA 1WMHA 3BVGA 1RLFA 1YN5A 2MSED 3QX1A 4P1BC 3B9JA 4N59A 1TKGA 1WGGA 3BVZA 1SJHD 3QQ8B 2LGXA 3C19A 4P7IA 4EZKA 1QZEA 1WY8A 4ARIA 4IWPA 4A6QA 4TV3A 3RMKC 1FPYA 1TZ1A 4I6LB 1R4NI 2LVOA 4BKSD 4K3BA 2DAJA 5CHWA 3FC4A 3GZNI 1H8CA 4RH6A 3DQVA 2AQ3B 4US8A 2J52A 4C7ZA 3U7DA 3P4PB 2OJWA 2VH1A 2D3CA 4OW0A 4EZJA 1WJ6A 3ONSA 2XNAC 4XDCA 2UWQA 4C00A 2M19A 1V1PA 2NPTB 4IWQA 2RDBC 2LZ6A 4RGOS 1JQ4A 4ZHOA 3CMMB 2KOXA 2Z0DB 3QJZA 2FAZA 3PLUA 1YIWA 4IM0A 4RMAA 2PPHA 3W2DA 4O1NA 1JWAD 1E10A 2FCMA 3MHZA 2BB6A 2AEHA 4WWOA 2ZVOA 3ZNHB 4EFOA 2QCZA 4TQ0A 4YT0B 5EDSA 4W9IA 2KJRA 3PS6A 1VLBA 4NJCA 3ECIA 4MM3A 2WXFA 1OGWA 1VZ8A 3IAM1 3WA0A 2QEJC 2JT4B 2D5GA 5IO9A 4FN2A 1F2RC 3ZLZA 5CTRC 1I4XA 2LHEA 1T0QC 3L16A 3VR8B 1WZ0A 2LRWA 3ZVVA 1YQBA 2BF8B 1P7EA 1XD3B 4B0MA 1ZW7A 3OLMD 3BK2A 2IO2B 4RM8A 1P98A 3H8HA 2MJEA 2I1JA 1YOVB 2E3TA 4FXCA 1WGHA 1KRHA 1UWMA 2KDBA 2PIAA 3U8ZA 5C2TB 3V62A 3ZJTA 2JX5A 1PGXA 1MHHE 2C7HA 3ZKJC 3AI5A 2IBIB 4OZBA 2PVGC 1WGYA 2K39A 4M02A 1FO4A 3WAPA 3RNAC 2J0KA 3DHIC 1WXVA 4C7YA 4NNJB 2AL6A 2FBWB 3UQBA 3VTUA 4BFRA 2UU7A 4GDKA 2NTTA 4KDIC 3A33B 4YTPB 4M01A 1SSNA 4AWJA 5EE3A 4WAFA 3NY5A 4JWSC 4W9FA 2M56B 4A8XC 1GAQB 2OHFA 1AWDA 4G3XB 1J8CA 3EFUA 2KNBA 3NUHB 1LXDA 3H7SA 1E9MA 3RNBC 1TGZB 4F7ZA 1NYRA 1Z5SB 2WLBA 2GB1A 1EO6A 4YSXB 3RZFA 3WANA 1VCBA 3SD5A 3HRDD 2D3GA 2YVCA 2MP2B 3AEAB 2TSSA 2WYQA 4MH0E 1RWSA 3EECA 2Y5CA 4NAWA 4GU2A 5FK9C 5FKAC 2DZJA 2YLMA 4GGQA 4I6PA 3APDA 1WM3A 5C1ZA 4M8MA 1IBXA 3L10B 2WXHA 1WRDB 3N1YC 1EUVB 3DVNU 2KTFA 1SIJA 2PVOD 2L0TA 3B1LX 2V1YA 4TKNA 4CO7A 1LFDA 3A9KA 4FADA 3LJ3A 1Z2MA 3EFCA 4HPPA 4II2B 2FUHB 1E90A 1WRIA 3I63C 1L6VA 1YQ3B 2FIDA 4GLSC 1YNTE 1NI2A 4AJYB 3SR6A 2BKRB 1WF9A 2IZVB 3H9DA 1KJTA 4ICUA 4W9JA 1VR9A 3AM9A 4DK5A 2V4IB 3Q69A 4MJSB 3AEDB 2ZW0A 2W9NA 4FLHA 2KDMA 3TJPA 1R4MB 3JVZX 2DENB 3T8MA 3Q3OC 5JHBA 3AE7B 2MX2A 2INPE 4C4VA 3N1ZC 4M00A 2KFKA 4KKJA 4BVUC 4KX6B 3APFA 3RD2A 3CF6E 1SE9A 4KSLC 5IN7A 3Q8CA 1TYGB 3AEBB 4XWWA 4GB9A 1YX6B 2DWQA 4KGRA 3ZNGC 2V3SA 2WXIA 4WURA 2LFIA 2MWSB 4HXDA 5HG2A 2XEWA 5JXVA 4GN1A 3A9JA 3NG0A 2BWES 2MA9B 1GUAB 1WJ4A 1WGRA 3FILB 2KK8A 3RUIB 3OJ4B 2WDTB 2V3NA 4XZ4A 2JRHA 1MG4A 1Y56A 3L4PA 4EOYA 3H7PB 3KQ4A 2L0FA 3AEGB 2AL3A 3TBLD 1K51A 1AW7A 2GBJA 3PZ7A 1YN4A 2L52A 1ZPSA 3RYTA 1WXSA 2GBRA 4FJZA 5LXHA 2RDHA 1DOXA 5LLIA 3DWGC 3VR9B 3NHEB 1LQBA 3Q6BA 5G5HA 3DDCB 5G5GA 3GOEA 3QIJA 1P9DU 2K8BA 2RSUA 1M94A 4ZRIA 3RFZB 3MP9A 2REXA 1ISNA 2QSDA 1OQYA 2Z0EB 3MHSD 5AUKA 2PLPA 3W5UB 4OZCA 4ZOHC 4ASWC 1SE3A 3TEWA 1V5TA 2ZPNA 5AUIA 3N3KB 5L83A 1KH0A 3VH4B 3RCZA 4KVGB 2AQ2B 2GMIC 2KWUB 4HROA 3A4RA 3U7ZA 1MG8A 3DBRB 1C9FA 2IY0B 3PRZA 4ANWA 2J0JA 2BVCA 5GXGB 3AECB 4UDUC 3U4EG 5T8IA 2WXLA 5L95C 3IT6B 1NI3A 3L54A 3AE4B 1V6EA 1ZGUB 1XEEA 1RFKA 3QK0A 4XDDA 3ENEA 1H4RA 3K9PB 1EWCA 1QT9A 2ONQA 3P42A 1WJUA 2R2OA 1ZOYB 1D5MC 4G11A 3ZRCA 2M4NA 2I2YA 2KWCA 3V61A 1FEHA 1OFFA 5C23A 3K9OB 4XYCA 1ZKHA 2DLBA 4RF0A 2WGSA 2EELA 2WS3B 5JHAA 2VRRB 1ZDVA 3AV8A 1JWSD 2MCNB 3JSVA 4IDIA 3WALA 1YMHE 4MELA 2INCC 1GOZA 1HZ6A 5BMHA 5EE1A 5LNK1 3W5VB 2ZJDA 2J7QB 1I4GA 1MVKA 4M0WA 3P1MA 1MPEA 3HK0A 2HE7A 4N58A 1JRUA 1CJEA 2QJLA 3ML8A 3PLVA 2AYOB 1Q0WB 2LMCA 3Q14C 1ZXIA 3BWUD 3P2BA 2B3AA 4HK2A 1BMLC 1D4BA 1E8ZA 2JZZA 1GB4A 1S1QB 1WH3A 2ZEQA 5BMIA 4R3DA 1FRDA 3PHWB 2KKCA 2RR9A 3IAS1 2HDEA 3VAWA 4ANUA 3PZ8A 1E6EB 5EE9A 3BINA 1E7PB 1CK1A 3ABVB 2MBHA 5D6JB 1E8YA 2DZMA 1XT9B 4HKZE 3NVZA 2WXOA 3C0RB 3ZJVA 1IYFA 1VJKA 1ET6A 3MTNB 2JRIB 4KKIA 3I5JC 1K53A 2BKFA 2KQ4X 1R4NB 4KGSA 1PQSA 3IXSA 2BB5A 2XBBC 3GZNB 4NAMA 2KD0A 2N0SB 3QA8A 4S0RA 2FCQA 2IDYA 2WWZA 2JWUA 5J17A 3W9CB 2LGYA 2KTRB 1WXQA 4CYEA 3Q2AC 3Q8AA 3N30A 4RGMA 4REZA 3OAWA 3Q3NC 2W3RA 2I38A 3P63A 4YTNB 4YSYB 4F8CB 2BYEA 1N63A 3CSTA 5JH5C 1P1AA 2N9PC 3U30A 3R2IA 3ZUNA 5IA7A 2NPTA 4IM3A 1F1HA 2INDC 3GP7A 4PYZA 2WXGA 2JXXA 3P4SB 3QCAA 3L0WB 2CKHB 2ON8A 1I42A 4OHJA 1ENFA 3A1QB 4XE0A 2O6VB 1NVID 3PVLA 1ZDXA 3KUZA 4YTMB 2NCNA 1RYJA 2CJOA 3B2GA 3HVDA 3UIOB 2KJ6A 1PFDA 4YWGG 3PREA 1TKYA 4RGNA 2IGHA 2N9LA 4IW0A 2FIFA 1SXTA 4LJOB 2MQJA 1WX7A 1PYWD 2KVZA 3ZXVA 2WXPA 4ITKA 1HEZE 4L1BA 4DQOC 3RNGC 4W9GA 2LJ5A 1WYGA 1PDXA 3TIXA 1PUTA 2L8JA 2BS2B 3TEYA 1UGMA 3ZTCA 2GRIA 4LNFA 2N9XA 3NOBA 4BOZB 4J3OD 1LO5D 3ZXRA 1L0XB 3ZNZB 3ALBA 2K6QA 5DPRA 4ANXA 3M63B 3N20C 2J42A 4DBGA 4DXFA 2KT7A 2IY1B 2KANA
chains in the Genus database with same CATH topology
3A1QA 3L10B 4I6NB 1WRDB 2O6VA 2CHWA 2ZNVC 1EUVB 3DVNU 4NPNA 2KTFA 3B1LX 2L0TA 4JGHB 2V1YA 1J19A 4TKNA 2NR2A 3A9JB 1E7VA 2KZRA 2OOBB 2KX0A 1E8XA 2N7DA 4MGZE 4XX5A 5LXIB 1V81A 1KOTA 4CO7A 1LFDA 3A9KA 4FADA 1KM7A 3LJ3A 3N32A 4BOSC 2N4FA 1Z2MA 4II2B 3NZUA 2FUHB 3L13A 1E90A 4HPLB 5D2MB 4K1RB 2MRPA 2FIDA 2CHZA 2DYOA 1GC7A 1NI2A 1UBIA 4AJYB 3VXWA 2EKEC 1TBEA 2O2VA 3AXCA 3PSEB 3V6CB 2BKRB 2ZVNA 3QAQA 4MEMA 4AUQC 4BBNC 4JIOU 3M95A 2LWPA 1WF9A 2IZVB 1WJNA 4E71A 4F1SA 1L2NA 3H9DA 2KVRA 4W9CA 3O65B 2G4SA 1KJTA 4GDLA 3VQIA 1GG3A 4ICUA 4W9JA 3HM6X 3PTFC 4RM9A 1IP9A 4K7SA 2MW5A 3T9LA 5FR6A 2C7MB 4DK5A 3QHTA 4MJSB 3R7QA 4LDTD 2W9NA 4FLHA 3AU4A 2XK5A 4HDQA 3V60A 2D10A 5E6OA 3TJPA 2MP2A 3JVZX 2DENB 3SHQA 3T8MA 4DHZE 3QWZB 2C60A 2KO3A 5JHBA 2MX2A 2BWFA 1F9JA 3NS8A 2IYDB 2KFKA 2JZ3B 2LXCA 3PT2B 4BVUC 4PS7A 3MJWA 3APFA 3RD2A 2A4ZA 3CF6E 5G55A 1SE9A 2LUEA 4GMVA 4X57B 5AEKB 4KSLC 3UQAA 2ZCCA 4NQLB 3ZIMA 5HKHA 1D3ZA 2KLGA 3UINB 4GB9A 3DBLI 3R3MA 5IAAC 1YX6B 3VDZA 1WR1A 3DBHI 2KDFB 2V3SA 3ZNGC 2MWSB 4HXDA 2XEWA 2MLBA 5DPSA 4M8MA 4GN1A 3A9JA 1LM8B 2RGFA 1GNUA 1SGHA 2BWES 3CSFA 3L08A 2KN5A 2NBUA 2MA9B 1GUAB 4WJQA 4NJ6A 4WWNA 4KSKC 1IPGA 3KUCB 3WAMA 2MBOA 2CHXA 3DBRI 1WJ4A 4E3CA 2L7RA 2QHOA 4ZRJA 1WGRA 2R2QA 3UGBB 2KK8A 1Y8RC 3H6NA 1WE6A 1Q1OA 3RUIB 4PS3A 3OJ4B 1G6JA 2WDTB 3ZW3A 4XZ4A 2JRHA 3IG3A 3DVGX 1UELA 3UIPB 4EOYA 1E8WA 3PRPB 3W1SA 1C3TA 5J18A 3H7PB 2L0FA 2AL3A 3APCA 2M8SA 2DYMA 3TBLD 1RAXA 1YX5B 2GBJA 3BY4B 2D11A 2NS5A 2JUOA 4PS8A 3RYTA 1WGDA 1WMHB 4W9LA 4HCPB 1WXSA 2GBRA 4FJZA 4MJSA 5LXHA 2HTHA 2GBMA 2L3ZA 5LLIA 2DX5B 4HDOA 1L7YA 3NHEB 4IUMB 3DPDA 3W1SC 2CU1A 2L76A 2MBEA 1LQBA 3B08A 1UH6A 4GOCA 3DDCB 3GOEA 3QIJA 4JL9A 1P9DU 2M17A 1FXTB 3IFWB 2IO1B 4HWIB 2K8BA 2K8CA 3VTWA 4E74A 4OVVA 2RSUA 3JSVB 4GIVA 1S3SG 1M94A 4II3B 4ZRIA 2REXA 1OTRB 2CR5A 1ISNA 2N9EB 4KV2A 4MDKE 1OQYA 5E6NA 2GOWA 1WIAA 2Z0EB 3MHSD 2KQSA 2Z59B 2C9WB 1WFYA 4TQ1A 4FJVB 3RZWC 2WX1A 2IO0B 4B6WA 4IWOA 4ASWC 3KH0A 3EC8A 3TL5A 1GJZA 2PE9A 1V86A 1V5TA 1WM2A 1AARA 2ZPNA 3AULA 4HPMB 3M3JA 4MGKE 4M0WB 3N3KB 4M8NA 5L83A 3VH4B 1WI0A 4FBJB 4GXBA 5E6PA 3RCZA 1V5OA 2N1WA 4KVGB 2KWVB 4CHKA 1NDDA 2GMIC 2KQ7A 2KWUB 3KW5B 4KIKB 3A4RA 1WR6E 2MBQA 2AWTA 5D7GA 1MG8A 3M62B 4XC2A 3VUXA 2IY0B 2Y5BB 2KDIA 3PRZA 4ANWA 2ZCBA 2J0JA 5DPWA 1YJ1A 1J0GA 2M1MA 5L95C 2JVCA 3VVWB 3VFKA 3L54A 5AZFA 4JQWC 1WX9A 4LCDE 1V6EA 4DWFA 1ZGUB 3QK0A 4KDLB 3ZRFA 2A5UA 2RD0A 3ENEA 3R66C 1H4RA 3K9PB 3TMPB 3QARA 1XQQA 4HVBA 4AJWA 1SIFA 1WYWB 3H7PA 4NQKE 1OEYA 4EUTA 1WJUA 2R2OA 4G11A 3ZRCA 2M4NA 3PV1A 5D94A 4G50A 3DBSA 2KWCA 3V61A 5C23A 1WXAA 3HM3A 1WMHA 3K9OB 2BYFA 2OJRA 3UF8A 1RLFA 1ZKHA 2C5LC 2MSED 2LD9A 4BKSA 3QX1A 2FCSA 2PE6B 3R7RA 1VD2A 3PPAA 3RULA 5JHAA 2ZNVB 2VRRB 2ZPYA 3JYUA 3I3TB 2BGFA 3Q3JA 1K8RB 2KC2A 1WGGA 4WJOA 2MCNB 3JSVA 3WALA 2V4LA 2L05A 3QQ8B 4MELA 2LGXA 1BT0A 2N1VA 3VUWA 4P7IA 4EZKA 1QZEA 1WY8A 4K7UA 1V49A 4IWPA 4HCNB 2HJ8A 4TV3A 2DZIA 2ZJDA 5DPTA 4WWPA 2J7QB 2LI5A 1TZ1A 3DCGA 4I6LB 1V80A 2K8HA 1R4NI 2LVOA 4BKSD 2DAJA 1EF1A 2FCNA 5AZHA 5CHWA 1WE7A 3ZO5B 1P3QU 3GZNI 1X1MA 3X23A 2FNJB 1H8CA 3HK0A 3DQVA 2HE7A 4KIKA 1JRUA 2K25A 3VTVA 3U7DA 3QC8B 1TTNA 3ML8A 1UZXB 3PLVA 3DVGY 2AYOB 5DCNA 1Q0WB 4KZ0A 1Q5WB 3VHTC 4EZLA 3P2BA 4EZJA 2B3AA 4HK2A 4K81A 2JF5A 1UD7A 1WJ6A 2BYVE 2D07B 4W9KA 2KC1A 3ONSA 4B95A 3WAOA 1E8ZA 3HHMA 5G2NA 2JZZA 4AOFA 4DXAB 1S1QB 3LDZE 2UWQA 4N9F4 4YL8A 1WH3A 2ZEQA 1P0RA 1V9JA 3KVFB 4MSQB 3RT3B 1WXMA 3IBEA 4W9HA 3PHWB 2L00B 3Q3FA 4W9EA 2NPTB 3WIMA 2KKCA 3X0WA 2RR9A 5BO4B 4IWQA 2LZ6A 2BPSA 4J6IA 3VAWA 4ANUA 4IG7B 3BINA 3CMMB 3V6EB 2KOXA 3ML9A 5JZEB 2MBHA 2Z0DB 3QJZA 2FAZA 3PLUA 2JWZA 5D6JB 1YIWA 2DHZA 4IM0A 1E8YA 4RMAA 2PPHA 2DZMA 1XT9B 1RFAA 2FCMA 2KLCA 3C0RB 1IYFA 2JPHA 4GDKB 2AEHA 4WWOA 2ZVOA 4MGYE 2RPQA 3ZNHB 4EFOA 1U4AA 4HJKA 4URKA 4TQ0A 3MTNB 2JRIB 1CMXB 2BKFA 1E7UA 2LXAA 5EDSA 4DDID 3ZDTA 4W9IA 1PQSA 2KJRA 3PS6A 2XBBC 4JLCA 3ECIA 4MM3A 1WX8A 1OGWA 2KD0A 3QA8A 5CHFA 3WA0A 2FCQA 2KMAA 2WWZA 3B0AA 2KHWB 4ANVA 5J17A 2EMTA 2M0XA 4A3OA 5KHOA 2LGYA 4NJ7A 2WX0A 2KTRB 2CS4A 2NBVB 2JT4B 4FN2A 4KZCA 4AP4C 5TR5A 3ZLZA 2UYZB 5CTRC 4CYEA 4DHJB 2KX3A 2DAFA 2ASQA 3KYDD 3N30A 4FHJA 1GC6A 3JW0X 3L16A 3D32A 1WZ0A 3OAWA 2LRWA 3KUDB 3ZVVA 2HD5B 1YQBA 2BF8B 2O6VD 2PEAA 1XD3B 1ZW7A 3VUYA 3OLMD 5GMVA 1YD8U 2IO2B 4RM8A 4F8CB 1P98A 4ZYNA 2I1JA 4G0NB 3IHPC 2BYEA 2G45B 2MBBB 3HIZA 3CSTA 5JH5C 4DHZB 1P1AA 2N9PC 2IO3B 3U30A 3ZDMC 1WGHA 3ZUNA 5IA7A 4WJNA 2KDBA 2J0MA 4NAWB 3DVNV 3U8ZA 3V62A 1EF5A 3NZSA 2NPTA 4IM3A 1I35A 1KLVA 4IC7B 4PYZA 4EEWA 2JXXA 2C7HA 1OEYJ 3ZKJC 4DDGD 3QCAA 4TUUA 3AI5A 3PHXB 2IBIB 4WJPA 5KHQA 3L0WB 2EMSA 1WGYA 2K39A 2KDEB 2CKHB 4B9KA 1I42A 3WAPA 3L17A 2J0KA 3TCAA 1WXVA 3A1QB 4A3PA 2G3QB 1RRBA 4NNJB 2AL6A 2O6VB 3A4SC 4FULA 3UQBA 3VTUA 4BFRA 3DOWA 1V2YA 4A20A 3IVFA 3ZTDA 2LVQA 3PVLA 5J2RA 4BKGA 2NBWB 2D2QA 4GDKA 1NBFC 3KUZA 4FHKA 3ZNID 4KDIC 1A5RA 3W1YA 2LASA 3A33B 2NCNA 3VH3B 3SDLC 3A9KB 3OJ3A 3UIOB 2KJ6A 4AWJA 2LGDA 4BBNF 4FA6A 3PREA 2PJHA 3NY5A 4LDTB 3S2AA 3SU8X 4IW0A 4W9FA 2FIFA 3PGEA 3H1UA 4LJOB 2MQJA 2KXJA 1UBQA 3KYCD 4LJPB 1WX7A 2NVUI 2O2VB 4G3XB 1J8CA 2JY6A 3EFUA 2KNBA 4BKTA 4IM2A 2LRUA 4PYUA 1C1YB 2KTRA 1LXDA 4K7WA 5CHVC 2KJHB 4ICVA 3H7SA 4ZRKA 4GDLB 2G4DB 2LJ5A 1E5WA 4GSWA 4W9GA 3TIXA 2L8JA 1TGZB 4F7ZA 2K1FA 1Z5SB 2N7EA 1UGMA 2KMCA 3ZTCA 4OVUA 2GBNA 3AU5A 1EO6A 2I1KA 4HLEA 3RZFA 3WANA 1VCBA 2N9XA 2XK5B 2K6DB 3SD5A 3PZDA 3NOBA 2D3GA 2YVCA 2MP2B 4NY0A 4MGIE 5CX3A 3EHVA 4MSMB 4BOZB 2KFJA 3PRMB 4EKUA 2WYQA 4MH0E 2LVPA 1R4MI 3EECA 4W9DA 3ZNZB 2KFKB 4NAWA 4GU2A 3ALBA 1HE8A 2K6QA 5DPRA 4ANXA 1T0YA 2GBKA 4ZDVA 1WZ3A 3M63B 4DHJD 2DZJA 4FJYA 2YLMA 4DBGA 4GGQA 4I6PA 4WAAA 3APDA 2DZKA 2DYBA 1WM3A 2IY1B 4WQOB 5C1ZA 5AZGA 2KANA 2C7NB 2ZZPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Q A;  3L10 B;  4I6N B;  1WRD B;  2O6V A;  2CHW A;  2ZNV C;  1EUV B;  3DVN U;  4NPN A;  2KTF A;  3B1L X;  2L0T A;  4JGH B;  2V1Y A;  1J19 A;  4TKN A;  2NR2 A;  3A9J B;  1E7V A;  2KZR A;  2OOB B;  2KX0 A;  1E8X A;  2N7D A;  4MGZ E;  4XX5 A;  5LXI B;  1V81 A;  1KOT A;  4CO7 A;  1LFD A;  3A9K A;  4FAD A;  1KM7 A;  3LJ3 A;  3N32 A;  4BOS C;  2N4F A;  1Z2M A;  4II2 B;  3NZU A;  2FUH B;  3L13 A;  1E90 A;  4HPL B;  5D2M B;  4K1R B;  2MRP A;  2FID A;  2CHZ A;  2DYO A;  1GC7 A;  1NI2 A;  1UBI A;  4AJY B;  3VXW A;  2EKE C;  1TBE A;  2O2V A;  3AXC A;  3PSE B;  3V6C B;  2BKR B;  2ZVN A;  3QAQ A;  4MEM A;  4AUQ C;  4BBN C;  4JIO U;  3M95 A;  2LWP A;  1WF9 A;  2IZV B;  1WJN A;  4E71 A;  4F1S A;  1L2N A;  3H9D A;  2KVR A;  4W9C A;  3O65 B;  2G4S A;  1KJT A;  4GDL A;  3VQI A;  1GG3 A;  4ICU A;  4W9J A;  3HM6 X;  3PTF C;  4RM9 A;  1IP9 A;  4K7S A;  2MW5 A;  3T9L A;  5FR6 A;  2C7M B;  4DK5 A;  3QHT A;  4MJS B;  3R7Q A;  4LDT D;  2W9N A;  4FLH A;  3AU4 A;  2XK5 A;  4HDQ A;  3V60 A;  2D10 A;  5E6O A;  3TJP A;  2MP2 A;  3JVZ X;  2DEN B;  3SHQ A;  3T8M A;  4DHZ E;  3QWZ B;  2C60 A;  2KO3 A;  5JHB A;  2MX2 A;  2BWF A;  1F9J A;  3NS8 A;  2IYD B;  2KFK A;  2JZ3 B;  2LXC A;  3PT2 B;  4BVU C;  4PS7 A;  3MJW A;  3APF A;  3RD2 A;  2A4Z A;  3CF6 E;  5G55 A;  1SE9 A;  2LUE A;  4GMV A;  4X57 B;  5AEK B;  4KSL C;  3UQA A;  2ZCC A;  4NQL B;  3ZIM A;  5HKH A;  1D3Z A;  2KLG A;  3UIN B;  4GB9 A;  3DBL I;  3R3M A;  5IAA C;  1YX6 B;  3VDZ A;  1WR1 A;  3DBH I;  2KDF B;  2V3S A;  3ZNG C;  2MWS B;  4HXD A;  2XEW A;  2MLB A;  5DPS A;  4M8M A;  4GN1 A;  3A9J A;  1LM8 B;  2RGF A;  1GNU A;  1SGH A;  2BWE S;  3CSF A;  3L08 A;  2KN5 A;  2NBU A;  2MA9 B;  1GUA B;  4WJQ A;  4NJ6 A;  4WWN A;  4KSK C;  1IPG A;  3KUC B;  3WAM A;  2MBO A;  2CHX A;  3DBR I;  1WJ4 A;  4E3C A;  2L7R A;  2QHO A;  4ZRJ A;  1WGR A;  2R2Q A;  3UGB B;  2KK8 A;  1Y8R C;  3H6N A;  1WE6 A;  1Q1O A;  3RUI B;  4PS3 A;  3OJ4 B;  1G6J A;  2WDT B;  3ZW3 A;  4XZ4 A;  2JRH A;  3IG3 A;  3DVG X;  1UEL A;  3UIP B;  4EOY A;  1E8W A;  3PRP B;  3W1S A;  1C3T A;  5J18 A;  3H7P B;  2L0F A;  2AL3 A;  3APC A;  2M8S A;  2DYM A;  3TBL D;  1RAX A;  1YX5 B;  2GBJ A;  3BY4 B;  2D11 A;  2NS5 A;  2JUO A;  4PS8 A;  3RYT A;  1WGD A;  1WMH B;  4W9L A;  4HCP B;  1WXS A;  2GBR A;  4FJZ A;  4MJS A;  5LXH A;  2HTH A;  2GBM A;  2L3Z A;  5LLI A;  2DX5 B;  4HDO A;  1L7Y A;  3NHE B;  4IUM B;  3DPD A;  3W1S C;  2CU1 A;  2L76 A;  2MBE A;  1LQB A;  3B08 A;  1UH6 A;  4GOC A;  3DDC B;  3GOE A;  3QIJ A;  4JL9 A;  1P9D U;  2M17 A;  1FXT B;  3IFW B;  2IO1 B;  4HWI B;  2K8B A;  2K8C A;  3VTW A;  4E74 A;  4OVV A;  2RSU A;  3JSV B;  4GIV A;  1S3S G;  1M94 A;  4II3 B;  4ZRI A;  2REX A;  1OTR B;  2CR5 A;  1ISN A;  2N9E B;  4KV2 A;  4MDK E;  1OQY A;  5E6N A;  2GOW A;  1WIA A;  2Z0E B;  3MHS D;  2KQS A;  2Z59 B;  2C9W B;  1WFY A;  4TQ1 A;  4FJV B;  3RZW C;  2WX1 A;  2IO0 B;  4B6W A;  4IWO A;  4ASW C;  3KH0 A;  3EC8 A;  3TL5 A;  1GJZ A;  2PE9 A;  1V86 A;  1V5T A;  1WM2 A;  1AAR A;  2ZPN A;  3AUL A;  4HPM B;  3M3J A;  4MGK E;  4M0W B;  3N3K B;  4M8N A;  5L83 A;  3VH4 B;  1WI0 A;  4FBJ B;  4GXB A;  5E6P A;  3RCZ A;  1V5O A;  2N1W A;  4KVG B;  2KWV B;  4CHK A;  1NDD A;  2GMI C;  2KQ7 A;  2KWU B;  3KW5 B;  4KIK B;  3A4R A;  1WR6 E;  2MBQ A;  2AWT A;  5D7G A;  1MG8 A;  3M62 B;  4XC2 A;  3VUX A;  2IY0 B;  2Y5B B;  2KDI A;  3PRZ A;  4ANW A;  2ZCB A;  2J0J A;  5DPW A;  1YJ1 A;  1J0G A;  2M1M A;  5L95 C;  2JVC A;  3VVW B;  3VFK A;  3L54 A;  5AZF A;  4JQW C;  1WX9 A;  4LCD E;  1V6E A;  4DWF A;  1ZGU B;  3QK0 A;  4KDL B;  3ZRF A;  2A5U A;  2RD0 A;  3ENE A;  3R66 C;  1H4R A;  3K9P B;  3TMP B;  3QAR A;  1XQQ A;  4HVB A;  4AJW A;  1SIF A;  1WYW B;  3H7P A;  4NQK E;  1OEY A;  4EUT A;  1WJU A;  2R2O A;  4G11 A;  3ZRC A;  2M4N A;  3PV1 A;  5D94 A;  4G50 A;  3DBS A;  2KWC A;  3V61 A;  5C23 A;  1WXA A;  3HM3 A;  1WMH A;  3K9O B;  2BYF A;  2OJR A;  3UF8 A;  1RLF A;  1ZKH A;  2C5L C;  2MSE D;  2LD9 A;  4BKS A;  3QX1 A;  2FCS A;  2PE6 B;  3R7R A;  1VD2 A;  3PPA A;  3RUL A;  5JHA A;  2ZNV B;  2VRR B;  2ZPY A;  3JYU A;  3I3T B;  2BGF A;  3Q3J A;  1K8R B;  2KC2 A;  1WGG A;  4WJO A;  2MCN B;  3JSV A;  3WAL A;  2V4L A;  2L05 A;  3QQ8 B;  4MEL A;  2LGX A;  1BT0 A;  2N1V A;  3VUW A;  4P7I A;  4EZK A;  1QZE A;  1WY8 A;  4K7U A;  1V49 A;  4IWP A;  4HCN B;  2HJ8 A;  4TV3 A;  2DZI A;  2ZJD A;  5DPT A;  4WWP A;  2J7Q B;  2LI5 A;  1TZ1 A;  3DCG A;  4I6L B;  1V80 A;  2K8H A;  1R4N I;  2LVO A;  4BKS D;  2DAJ A;  1EF1 A;  2FCN A;  5AZH A;  5CHW A;  1WE7 A;  3ZO5 B;  1P3Q U;  3GZN I;  1X1M A;  3X23 A;  2FNJ B;  1H8C A;  3HK0 A;  3DQV A;  2HE7 A;  4KIK A;  1JRU A;  2K25 A;  3VTV A;  3U7D A;  3QC8 B;  1TTN A;  3ML8 A;  1UZX B;  3PLV A;  3DVG Y;  2AYO B;  5DCN A;  1Q0W B;  4KZ0 A;  1Q5W B;  3VHT C;  4EZL A;  3P2B A;  4EZJ A;  2B3A A;  4HK2 A;  4K81 A;  2JF5 A;  1UD7 A;  1WJ6 A;  2BYV E;  2D07 B;  4W9K A;  2KC1 A;  3ONS A;  4B95 A;  3WAO A;  1E8Z A;  3HHM A;  5G2N A;  2JZZ A;  4AOF A;  4DXA B;  1S1Q B;  3LDZ E;  2UWQ A;  4N9F 4;  4YL8 A;  1WH3 A;  2ZEQ A;  1P0R A;  1V9J A;  3KVF B;  4MSQ B;  3RT3 B;  1WXM A;  3IBE A;  4W9H A;  3PHW B;  2L00 B;  3Q3F A;  4W9E A;  2NPT B;  3WIM A;  2KKC A;  3X0W A;  2RR9 A;  5BO4 B;  4IWQ A;  2LZ6 A;  2BPS A;  4J6I A;  3VAW A;  4ANU A;  4IG7 B;  3BIN A;  3CMM B;  3V6E B;  2KOX A;  3ML9 A;  5JZE B;  2MBH A;  2Z0D B;  3QJZ A;  2FAZ A;  3PLU A;  2JWZ A;  5D6J B;  1YIW A;  2DHZ A;  4IM0 A;  1E8Y A;  4RMA A;  2PPH A;  2DZM A;  1XT9 B;  1RFA A;  2FCM A;  2KLC A;  3C0R B;  1IYF A;  2JPH A;  4GDK B;  2AEH A;  4WWO A;  2ZVO A;  4MGY E;  2RPQ A;  3ZNH B;  4EFO A;  1U4A A;  4HJK A;  4URK A;  4TQ0 A;  3MTN B;  2JRI B;  1CMX B;  2BKF A;  1E7U A;  2LXA A;  5EDS A;  4DDI D;  3ZDT A;  4W9I A;  1PQS A;  2KJR A;  3PS6 A;  2XBB C;  4JLC A;  3ECI A;  4MM3 A;  1WX8 A;  1OGW A;  2KD0 A;  3QA8 A;  5CHF A;  3WA0 A;  2FCQ A;  2KMA A;  2WWZ A;  3B0A A;  2KHW B;  4ANV A;  5J17 A;  2EMT A;  2M0X A;  4A3O A;  5KHO A;  2LGY A;  4NJ7 A;  2WX0 A;  2KTR B;  2CS4 A;  2NBV B;  2JT4 B;  4FN2 A;  4KZC A;  4AP4 C;  5TR5 A;  3ZLZ A;  2UYZ B;  5CTR C;  4CYE A;  4DHJ B;  2KX3 A;  2DAF A;  2ASQ A;  3KYD D;  3N30 A;  4FHJ A;  1GC6 A;  3JW0 X;  3L16 A;  3D32 A;  1WZ0 A;  3OAW A;  2LRW A;  3KUD B;  3ZVV A;  2HD5 B;  1YQB A;  2BF8 B;  2O6V D;  2PEA A;  1XD3 B;  1ZW7 A;  3VUY A;  3OLM D;  5GMV A;  1YD8 U;  2IO2 B;  4RM8 A;  4F8C B;  1P98 A;  4ZYN A;  2I1J A;  4G0N B;  3IHP C;  2BYE A;  2G45 B;  2MBB B;  3HIZ A;  3CST A;  5JH5 C;  4DHZ B;  1P1A A;  2N9P C;  2IO3 B;  3U30 A;  3ZDM C;  1WGH A;  3ZUN A;  5IA7 A;  4WJN A;  2KDB A;  2J0M A;  4NAW B;  3DVN V;  3U8Z A;  3V62 A;  1EF5 A;  3NZS A;  2NPT A;  4IM3 A;  1I35 A;  1KLV A;  4IC7 B;  4PYZ A;  4EEW A;  2JXX A;  2C7H A;  1OEY J;  3ZKJ C;  4DDG D;  3QCA A;  4TUU A;  3AI5 A;  3PHX B;  2IBI B;  4WJP A;  5KHQ A;  3L0W B;  2EMS A;  1WGY A;  2K39 A;  2KDE B;  2CKH B;  4B9K A;  1I42 A;  3WAP A;  3L17 A;  2J0K A;  3TCA A;  1WXV A;  3A1Q B;  4A3P A;  2G3Q B;  1RRB A;  4NNJ B;  2AL6 A;  2O6V B;  3A4S C;  4FUL A;  3UQB A;  3VTU A;  4BFR A;  3DOW A;  1V2Y A;  4A20 A;  3IVF A;  3ZTD A;  2LVQ A;  3PVL A;  5J2R A;  4BKG A;  2NBW B;  2D2Q A;  4GDK A;  1NBF C;  3KUZ A;  4FHK A;  3ZNI D;  4KDI C;  1A5R A;  3W1Y A;  2LAS A;  3A33 B;  2NCN A;  3VH3 B;  3SDL C;  3A9K B;  3OJ3 A;  3UIO B;  2KJ6 A;  4AWJ A;  2LGD A;  4BBN F;  4FA6 A;  3PRE A;  2PJH A;  3NY5 A;  4LDT B;  3S2A A;  3SU8 X;  4IW0 A;  4W9F A;  2FIF A;  3PGE A;  3H1U A;  4LJO B;  2MQJ A;  2KXJ A;  1UBQ A;  3KYC D;  4LJP B;  1WX7 A;  2NVU I;  2O2V B;  4G3X B;  1J8C A;  2JY6 A;  3EFU A;  2KNB A;  4BKT A;  4IM2 A;  2LRU A;  4PYU A;  1C1Y B;  2KTR A;  1LXD A;  4K7W A;  5CHV C;  2KJH B;  4ICV A;  3H7S A;  4ZRK A;  4GDL B;  2G4D B;  2LJ5 A;  1E5W A;  4GSW A;  4W9G A;  3TIX A;  2L8J A;  1TGZ B;  4F7Z A;  2K1F A;  1Z5S B;  2N7E A;  1UGM A;  2KMC A;  3ZTC A;  4OVU A;  2GBN A;  3AU5 A;  1EO6 A;  2I1K A;  4HLE A;  3RZF A;  3WAN A;  1VCB A;  2N9X A;  2XK5 B;  2K6D B;  3SD5 A;  3PZD A;  3NOB A;  2D3G A;  2YVC A;  2MP2 B;  4NY0 A;  4MGI E;  5CX3 A;  3EHV A;  4MSM B;  4BOZ B;  2KFJ A;  3PRM B;  4EKU A;  2WYQ A;  4MH0 E;  2LVP A;  1R4M I;  3EEC A;  4W9D A;  3ZNZ B;  2KFK B;  4NAW A;  4GU2 A;  3ALB A;  1HE8 A;  2K6Q A;  5DPR A;  4ANX A;  1T0Y A;  2GBK A;  4ZDV A;  1WZ3 A;  3M63 B;  4DHJ D;  2DZJ A;  4FJY A;  2YLM A;  4DBG A;  4GGQ A;  4I6P A;  4WAA A;  3APD A;  2DZK A;  2DYB A;  1WM3 A;  2IY1 B;  4WQO B;  5C1Z A;  5AZG A;  2KAN A;  2C7N B;  2ZZP B; 
#chains in the Genus database with same CATH topology
 4YXD B;  2K0P A;  3SFE B;  2W3S A;  3E56 A;  1J19 A;  3AE3 B;  2NR2 A;  3O13 A;  1E7V A;  2KZR A;  2OOB B;  2KX0 A;  2VZK D;  1KM7 A;  2BBC A;  2CU3 A;  3L13 A;  4HPL B;  2V3P A;  2DYO A;  1UBI A;  3GS2 A;  3VXW A;  1EU4 A;  3QAQ A;  2R61 A;  2LWP A;  4F1S A;  3LXF A;  1L2N A;  3CWI A;  3VQI A;  3RNF C;  3PTF C;  4K7S A;  2MW5 A;  5FR6 A;  2C7M B;  2FE8 A;  3R7Q A;  1F0Z A;  2WNM A;  1VZ7 A;  2K9X A;  4ZHP A;  5E6O A;  2MP2 A;  2KWD A;  2WU2 B;  3AE6 B;  2LHD A;  2KN4 A;  5G55 A;  3UQA A;  1HTQ A;  4GMV A;  2LUE A;  4MH8 A;  4NQL B;  5HKH A;  2JSV X;  4RGT A;  2KLG A;  3UIN B;  2MEK A;  3DBL I;  2WXK A;  3VDZ A;  1IGC A;  3DBH I;  2KDF B;  4K3C A;  2WXQ A;  1J7A A;  2MLB A;  2X8X X;  4YSZ B;  1LM8 B;  2K5P A;  3BYT B;  3L08 A;  2KN5 A;  1I4Q A;  3Q8F A;  3KUC B;  3WAM A;  2CHX A;  2L7R A;  3AE9 B;  1Y8R C;  1C4A A;  4PS3 A;  1G6J A;  4MT5 A;  2BS3 B;  3MFG A;  3IG3 A;  3RN9 C;  3DVG X;  1UEL A;  3ETR A;  3PRP B;  1C3T A;  2QIL A;  2QMT A;  3APC A;  4Q2J A;  1PGA A;  1YX5 B;  4JPS A;  4PS8 A;  1KF6 B;  1WGD A;  4MJS A;  2L3Z A;  2DX5 B;  4HDO A;  1QOB A;  1SEB D;  3IFW B;  3VTW A;  4OVV A;  1FRR A;  2QIE B;  4KV2 A;  2QDF A;  3NVV A;  2B76 B;  2Z59 B;  4TQ1 A;  3TEX A;  2IO0 B;  1JRO A;  4ZRP A;  1GJZ A;  1ZE3 D;  1V86 A;  4XGA B;  5BMG A;  4M8N A;  2WDR B;  4KIK B;  2MBQ A;  5D7G A;  4HRS A;  4XC2 A;  3VUX A;  2W82 A;  5DPW A;  2ZCB A;  3OG5 A;  2WU5 B;  3V3X A;  3BII D;  3R2T A;  1T5X D;  2M1M A;  3NVY A;  3AEE B;  4S17 A;  4AS1 A;  3FIL A;  4JQW C;  1T0R C;  4DWF A;  1QF6 A;  2W54 A;  2INN E;  2W55 A;  2RD0 A;  2KAC A;  3QAR A;  1XQQ A;  4HVB A;  1WYW B;  3H7P A;  4C56 C;  2YEP B;  4JX1 C;  3DBS A;  3HM3 A;  1MFW A;  3UF8 A;  1EWY C;  4BKS A;  2PE6 B;  1L5P A;  2ZNV B;  1JWM D;  1DGJ A;  2ZPY A;  3I3T B;  2BGF A;  3AEF B;  1FCL A;  2KC2 A;  1D5X C;  3AE8 B;  1BT0 A;  2N1V A;  1NEK B;  3VUW A;  4K7U A;  2BYT A;  1V49 A;  4HCN B;  5DPT A;  2LI5 A;  4JE3 B;  3GE3 C;  1EF1 A;  2FCN A;  1WE7 A;  3ZO5 B;  1P3Q U;  1IGD A;  1L6U A;  2FNJ B;  3MC0 B;  4WH4 A;  1XCQ L;  4IKG A;  4A55 A;  2ACZ B;  1MI0 A;  1K50 A;  3DVG Y;  1RM6 C;  3DHH C;  1Q5W B;  1QOF A;  2RPV A;  3UI3 A;  2BYV E;  2D07 B;  4W9K A;  2KC1 A;  4OVZ A;  4P1C C;  3HHM A;  1F77 A;  4AOF A;  4DXA B;  4PT5 A;  2XN9 C;  3LB8 C;  1V9J A;  4MSQ B;  3RT3 B;  1N5W A;  3IBE A;  2L00 B;  3BK1 A;  4W9E A;  3X0W A;  3LYY A;  5BO4 B;  1UF0 A;  3SEB A;  4J6I A;  4IG7 B;  5JZE B;  2QC8 A;  1DOI A;  2PMV A;  2DHZ A;  3MJ5 A;  4BAX A;  4JWU C;  5E6J A;  1FD6 A;  1RFA A;  2KLC A;  1U4A A;  4URK A;  1CMX B;  3T3O A;  2LXA A;  4ACF A;  4DDI D;  3AMZ A;  1TS3 A;  2IJ0 A;  1L0V B;  1WX8 A;  5CHF A;  2KMA A;  4ANV A;  4NJ7 A;  3VRA B;  3N9Y C;  3RI7 C;  4P16 A;  5TR5 A;  2UYZ B;  1F52 A;  4AQ7 A;  3KYD D;  2DAF A;  4FHJ A;  1GC6 A;  3KUD B;  2HD5 B;  2PEA A;  1DYQ A;  3KWV A;  1YD8 U;  1C79 A;  1C4C A;  4ZYN A;  3IHP C;  3URY A;  2G45 B;  3HIZ A;  4DHZ B;  2VZK B;  2IO3 B;  3ZDM C;  2DNF A;  3DVN V;  1I4H A;  3NZS A;  4KGT A;  1OEY J;  4TUU A;  5BYS A;  3PHX B;  1QQR A;  1NEN B;  3L17 A;  3TCA A;  1KTK A;  2G3Q B;  1RRB A;  1YQ4 B;  3A4S C;  1WGK A;  4WWM A;  1V2Y A;  4A20 A;  3IVF A;  3ZTD A;  2LVQ A;  5J2R A;  1FXI A;  2D2Q A;  2LAS A;  2M0A A;  1XLN A;  3BYY B;  2LGD A;  2RMM A;  4FA6 A;  2JQR B;  2PW9 A;  3SU8 X;  1B1Z A;  3H1U A;  1SF0 A;  1MJD A;  1QIL A;  1L0Y B;  1JCK B;  4LJP B;  2BQQ A;  2O2V B;  1JWB D;  1TY2 A;  2JY6 A;  3RNC C;  1JW9 D;  3MC9 A;  4IM2 A;  2LRU A;  4PYU A;  1C1Y B;  2KTR A;  4K7W A;  1XF5 L;  5CHV C;  4ICV A;  4GDL B;  1E5W A;  4B0E A;  2GLS A;  1EM7 A;  1JML A;  2JYE A;  2N7E A;  2KMC A;  4RNA A;  2I1K A;  2XK5 B;  4L23 A;  3PZD A;  2E6X A;  3V05 A;  4MGI E;  1SBB B;  4MSM B;  1KLU D;  1HXY D;  2LVP A;  4W9D A;  2LUM A;  1HE8 A;  1T0Y A;  4ZDV A;  1WZ3 A;  2MHJ A;  4RFB A;  4DHJ D;  2DYB A;  4WQO B;  2C7N B;  2ZZP B;  1FMA D;  3A1Q A;  2J53 A;  2O6V A;  2CHW A;  1ACC A;  4NPN A;  2BS4 B;  1ZP0 B;  3AE1 B;  4JGH B;  4NZL B;  1E8X A;  4XX5 A;  1KOT A;  3HVZ A;  3N32 A;  4BOS C;  1VDV A;  5D2M B;  1YN3 A;  4K1R B;  2MRP A;  2CHZ A;  1MHX A;  1GC7 A;  2EKE C;  1TBE A;  3AB5 A;  3AXC A;  1N6Z A;  2AQ1 B;  2ZVN A;  4BBN C;  2BT6 A;  4JIO U;  3M95 A;  2MJD A;  1WJN A;  4E71 A;  2KVR A;  4HJG E;  2G4S A;  1GG3 A;  1QLB B;  3RNE C;  3HM6 X;  4RM9 A;  2RDG A;  1HTO A;  3QHT A;  4LDT D;  3AU4 A;  4HDQ A;  2D10 A;  5IOI A;  1OQR A;  4USA A;  3QWZ B;  2D3A A;  2C60 A;  2KO3 A;  1F9J A;  1WSP A;  5HI1 A;  2IYD B;  4LNO A;  2JZ3 B;  4WIP A;  3PT2 B;  2LEK A;  4TMA B;  3J9C A;  3MJW A;  1C77 A;  2Q5W D;  1XXG A;  1ROE A;  2Y3A A;  3ZIM A;  1FNU A;  3R3M A;  5IAA C;  1WR1 A;  1AN8 A;  2BTE A;  2CJN A;  5D3D A;  5DPS A;  2RGF A;  3B2F A;  1HA5 A;  1GNU A;  1SGH A;  4WJQ A;  2V0G A;  4NJ6 A;  4KSK C;  3PO0 A;  4E3C A;  2QHO A;  2R2Q A;  3UGB B;  1WE6 A;  1Q1O A;  4CQN A;  3BZD B;  3ZW3 A;  1TZO A;  3UIP B;  2M8S A;  2DYM A;  1RAX A;  2SAK A;  2D11 A;  2NS5 A;  1WMH B;  4W9L A;  5BYQ A;  1L7Y A;  3W1S C;  2G1E A;  2KMM A;  5TSS A;  3KWL A;  2CU1 A;  2MBE A;  3B08 A;  1V1O A;  1BXT A;  2M17 A;  2K8C A;  4GIV A;  1S3S G;  1QKZ A;  2CR5 A;  2N9E B;  5E6N A;  1WIA A;  3DBL B;  2C9W B;  1WFY A;  1UNS A;  3DBH B;  3RZW C;  1XO3 A;  2IGG A;  2WXJ A;  3EC8 A;  3TL5 A;  2JU6 X;  1TS4 A;  3AUL A;  3NVW A;  3M3J A;  4MAC A;  3DWM A;  1N5X A;  1F2R I;  1UGJ A;  2N7J A;  4GXB A;  5E6P A;  1KLG D;  4CHK A;  4WQM A;  1NDD A;  1WR6 E;  2Y5B B;  1SJE D;  2KDI A;  3NJT A;  1ET9 A;  3VRB B;  4BZA A;  3VVW B;  3VFK A;  3OWE B;  1WX9 A;  4D2K A;  1BUI C;  2BW2 A;  2PKO A;  4C80 A;  4AJW A;  2L1A A;  1SIF A;  1V1P B;  1XLQ A;  4EUT A;  1E0Z A;  3PV1 A;  1STE A;  3AN1 A;  4G50 A;  1TT5 B;  2YEP F;  4LNN A;  2BYF A;  2OJR A;  2C5L C;  1VZ6 A;  2LD9 A;  1CZP A;  1TJE A;  1T6B X;  3T3N A;  2GI9 A;  2FCS A;  3R7R A;  1VD2 A;  4PK1 A;  3PPA A;  3RUL A;  3JYU A;  5I4D A;  3Q3J A;  1K8R B;  4WJO A;  1ZXH A;  2V4L A;  2L05 A;  3I57 A;  3FAH A;  4OZA A;  1JAL A;  2HJ8 A;  2DZI A;  4WWP A;  3DCG A;  4MM3 B;  2K3U A;  1V80 A;  2K8H A;  2AX5 A;  5AZH A;  1X1M A;  3X23 A;  1QOG A;  4KIK A;  1T0S C;  2K25 A;  3VTV A;  3R8B A;  3IT4 B;  1R7S A;  3QC8 B;  1TTN A;  1UZX B;  3ZQ4 A;  5DCN A;  1C76 A;  4KZ0 A;  3VHT C;  4EZL A;  1C78 A;  4L2Y A;  4K81 A;  2KAJ A;  2JF5 A;  1UD7 A;  4ARC A;  3AH7 A;  4B95 A;  3WAO A;  5G2N A;  4TSS A;  1B9R A;  2Z8L A;  4RCO A;  4YL8 A;  3LDZ E;  4N9F 4;  1P0R A;  3KVF B;  1WXM A;  3NS1 A;  4W9H A;  4LNK A;  4RF1 A;  3ZJU A;  3Q3F A;  3E9S A;  5FR3 A;  3WIM A;  1C4P A;  2BPS A;  2WDQ B;  1HQR D;  3V6E B;  1XCT L;  3ML9 A;  2JWZ A;  1A70 A;  3DHG C;  2JPH A;  2KYW A;  3EUB 2;  3NRZ A;  4GDK B;  4MGY E;  2RPQ A;  2VH2 A;  3RPF C;  4HJK A;  1LGR A;  1K52 A;  1E7U A;  4EE2 A;  3ZDT A;  1SE2 A;  4QAY A;  4JLC A;  2N9K A;  1FCC C;  3B0A A;  2KHW B;  4ZYS A;  2EMT A;  2M0X A;  1XLO A;  4A3O A;  5KHO A;  2WX0 A;  2CS4 A;  2NBV B;  4KZC A;  1HZ5 A;  2V9H A;  4AP4 C;  1SE4 A;  4DHJ B;  4N6E B;  2KX3 A;  2ASQ A;  5D3I B;  3U2S C;  2WQY B;  3JW0 X;  3D32 A;  3GE8 C;  4DXG A;  2O6V D;  3VUY A;  5GMV A;  1CQV A;  1XLP A;  1UUP A;  4G0N B;  2MBB B;  1GPX A;  1J7C A;  1UWX A;  1EU3 A;  4WJN A;  2J0M A;  4NAW B;  1TIF A;  1EF5 A;  1I35 A;  1KLV A;  4IC7 B;  4EEW A;  4DDG D;  5KHQ A;  5BYR A;  4WJP A;  1FM0 D;  2EMS A;  4B9K A;  2KDE B;  1D6E C;  1IBX B;  2H88 B;  5IP4 D;  4A3P A;  4FUL A;  1V8C A;  1KFY B;  1D5Z C;  3DOW A;  4BKG A;  2NBW B;  1NBF C;  3ZGZ A;  4FHK A;  1FFV A;  4US9 A;  3ZNI D;  1A5R A;  3BVM A;  3P4Q B;  3W1Y A;  3VH3 B;  3SDL C;  2H89 B;  3A9K B;  3OJ3 A;  1N60 A;  4BBN F;  2PJH A;  3S2A A;  4LDT B;  1QOA A;  3PGE A;  5EE0 A;  2KXJ A;  1UBQ A;  3KYC D;  1IUE A;  1TY0 A;  2NVU I;  2L83 A;  4BKT A;  1FFU A;  2JXT A;  2KJH B;  3I9V 1;  4ZRK A;  2G4D B;  4GSW A;  1L4Z B;  4LLG M;  1YJI A;  2K1F A;  4ZRQ A;  5HFY A;  4OVU A;  2FUG 1;  2GBN A;  3AU5 A;  3FKY A;  4HLE A;  1I7H A;  2K6D B;  5H92 C;  4NY0 A;  5CX3 A;  3EHV A;  2KFJ A;  3AE2 B;  3PRM B;  4EKU A;  1JWU D;  1FIQ A;  1R4M I;  4LK0 M;  4C4V B;  2KFK B;  2WXR A;  2GBK A;  2EKI A;  1YJJ A;  4FJY A;  1I4R A;  2MJ3 A;  2WXM A;  1Q10 A;  4WAA A;  2DZK A;  5AZG A;  1JRP A;  2D3B A;  5H8Y E;  4I6N B;  2ZNV C;  5IKC M;  3WCQ A;  5MPO A;  2HTM E;  2IGD A;  3A9J B;  2N7D A;  4MGZ E;  5LXI B;  1V81 A;  2N4F A;  3NZU A;  1N62 A;  2WDV B;  4P6V F;  1VRA B;  2LGI A;  2O2V A;  3PSE B;  3V6C B;  4MEM A;  4AUQ C;  1TKE A;  1V97 A;  2OED A;  3KLS X;  4W9C A;  3O65 B;  4GDL A;  1IP9 A;  3EGR A;  3T9L A;  2WXN A;  2LJI A;  3TUO A;  1ZUD 2;  3N1X C;  2XK5 A;  3V60 A;  4XWT A;  2ZW1 A;  3SHQ A;  2DBY A;  4DHZ E;  2IPK D;  3SFD B;  1WWT A;  2BWF A;  2MH7 A;  3NS8 A;  3TEZ A;  2LXC A;  2X38 A;  4PS7 A;  1N61 A;  2A4Z A;  5AEK B;  2ICI A;  4X57 B;  1ESF A;  2ZCC A;  3Q8B A;  1FXA A;  3Q3M C;  3CIR B;  1D3Z A;  4HKQ A;  2SEB D;  3CSF A;  2NBU A;  1GB1 A;  2L32 A;  4WWN A;  4A9A A;  1IPG A;  1FNW A;  2G9H D;  1T3Q A;  2MBO A;  3DBR I;  3C8Y A;  4ZRJ A;  3U52 E;  3H6N A;  3Q8E A;  1NYQ A;  2K22 A;  3P4R B;  3TSS A;  2NMQ A;  1E8W A;  3W1S A;  4A90 A;  5J18 A;  1FNV A;  2JYT A;  2PTL A;  4LNI A;  2JZP A;  3BY4 B;  2JUO A;  2NTS A;  4HCP B;  1TS5 A;  1J7B A;  2HTH A;  2GBM A;  1SB3 C;  1AYF A;  4IUM B;  1M4V A;  3DPD A;  1OQQ A;  2WP9 B;  2L76 A;  1UH6 A;  3AE5 B;  4GOC A;  4H2A A;  2J4X A;  5HHD G;  4JL9 A;  1FXT B;  4HWI B;  2IO1 B;  4E74 A;  3HUI A;  3GB1 A;  1PGB A;  3JSV B;  4II3 B;  1OTR B;  4MDK E;  2GOW A;  2KQS A;  5C3J B;  4FJV B;  2WX1 A;  3EA6 A;  4B6W A;  4IWO A;  3KH0 A;  1TS2 A;  2PE9 A;  1WM2 A;  1AAR A;  4HPM B;  4MGK E;  1I4P A;  1P7F A;  4M0W B;  2HJ1 A;  4FBJ B;  1WI0 A;  4LTU A;  1V5O A;  2N1W A;  2KWV B;  2KQ7 A;  3KW5 B;  2Y5P A;  2AWT A;  3M62 B;  2WHI A;  1YJ1 A;  1J0G A;  3NZ3 A;  4IOI E;  1L4D B;  2JVC A;  5AZF A;  4LCD E;  2LGS A;  4KDL B;  3ZRF A;  2A5U A;  3R66 C;  3TMP B;  3MC8 A;  4NQK E;  1DOY A;  1OEY A;  3ZYY X;  5D94 A;  4HEA 1;  1WXA A;  1WMH A;  3BVG A;  1RLF A;  1YN5 A;  2MSE D;  3QX1 A;  4P1B C;  3B9J A;  4N59 A;  1TKG A;  1WGG A;  3BVZ A;  1SJH D;  3QQ8 B;  2LGX A;  3C19 A;  4P7I A;  4EZK A;  1QZE A;  1WY8 A;  4ARI A;  4IWP A;  4A6Q A;  4TV3 A;  3RMK C;  1FPY A;  1TZ1 A;  4I6L B;  1R4N I;  2LVO A;  4BKS D;  4K3B A;  2DAJ A;  5CHW A;  3FC4 A;  3GZN I;  1H8C A;  4RH6 A;  3DQV A;  2AQ3 B;  4US8 A;  2J52 A;  4C7Z A;  3U7D A;  3P4P B;  2OJW A;  2VH1 A;  2D3C A;  4OW0 A;  4EZJ A;  1WJ6 A;  3ONS A;  2XNA C;  4XDC A;  2UWQ A;  4C00 A;  2M19 A;  1V1P A;  2NPT B;  4IWQ A;  2RDB C;  2LZ6 A;  4RGO S;  1JQ4 A;  4ZHO A;  3CMM B;  2KOX A;  2Z0D B;  3QJZ A;  2FAZ A;  3PLU A;  1YIW A;  4IM0 A;  4RMA A;  2PPH A;  3W2D A;  4O1N A;  1JWA D;  1E10 A;  2FCM A;  3MHZ A;  2BB6 A;  2AEH A;  4WWO A;  2ZVO A;  3ZNH B;  4EFO A;  2QCZ A;  4TQ0 A;  4YT0 B;  5EDS A;  4W9I A;  2KJR A;  3PS6 A;  1VLB A;  4NJC A;  3ECI A;  4MM3 A;  2WXF A;  1OGW A;  1VZ8 A;  3IAM 1;  3WA0 A;  2QEJ C;  2JT4 B;  2D5G A;  5IO9 A;  4FN2 A;  1F2R C;  3ZLZ A;  5CTR C;  1I4X A;  2LHE A;  1T0Q C;  3L16 A;  3VR8 B;  1WZ0 A;  2LRW A;  3ZVV A;  1YQB A;  2BF8 B;  1P7E A;  1XD3 B;  4B0M A;  1ZW7 A;  3OLM D;  3BK2 A;  2IO2 B;  4RM8 A;  1P98 A;  3H8H A;  2MJE A;  2I1J A;  1YOV B;  2E3T A;  4FXC A;  1WGH A;  1KRH A;  1UWM A;  2KDB A;  2PIA A;  3U8Z A;  5C2T B;  3V62 A;  3ZJT A;  2JX5 A;  1PGX A;  1MHH E;  2C7H A;  3ZKJ C;  3AI5 A;  2IBI B;  4OZB A;  2PVG C;  1WGY A;  2K39 A;  4M02 A;  1FO4 A;  3WAP A;  3RNA C;  2J0K A;  3DHI C;  1WXV A;  4C7Y A;  4NNJ B;  2AL6 A;  2FBW B;  3UQB A;  3VTU A;  4BFR A;  2UU7 A;  4GDK A;  2NTT A;  4KDI C;  3A33 B;  4YTP B;  4M01 A;  1SSN A;  4AWJ A;  5EE3 A;  4WAF A;  3NY5 A;  4JWS C;  4W9F A;  2M56 B;  4A8X C;  1GAQ B;  2OHF A;  1AWD A;  4G3X B;  1J8C A;  3EFU A;  2KNB A;  3NUH B;  1LXD A;  3H7S A;  1E9M A;  3RNB C;  1TGZ B;  4F7Z A;  1NYR A;  1Z5S B;  2WLB A;  2GB1 A;  1EO6 A;  4YSX B;  3RZF A;  3WAN A;  1VCB A;  3SD5 A;  3HRD D;  2D3G A;  2YVC A;  2MP2 B;  3AEA B;  2TSS A;  2WYQ A;  4MH0 E;  1RWS A;  3EEC A;  2Y5C A;  4NAW A;  4GU2 A;  5FK9 C;  5FKA C;  2DZJ A;  2YLM A;  4GGQ A;  4I6P A;  3APD A;  1WM3 A;  5C1Z A;  4M8M A;  1IBX A;  3L10 B;  2WXH A;  1WRD B;  3N1Y C;  1EUV B;  3DVN U;  2KTF A;  1SIJ A;  2PVO D;  2L0T A;  3B1L X;  2V1Y A;  4TKN A;  4CO7 A;  1LFD A;  3A9K A;  4FAD A;  3LJ3 A;  1Z2M A;  3EFC A;  4HPP A;  4II2 B;  2FUH B;  1E90 A;  1WRI A;  3I63 C;  1L6V A;  1YQ3 B;  2FID A;  4GLS C;  1YNT E;  1NI2 A;  4AJY B;  3SR6 A;  2BKR B;  1WF9 A;  2IZV B;  3H9D A;  1KJT A;  4ICU A;  4W9J A;  1VR9 A;  3AM9 A;  4DK5 A;  2V4I B;  3Q69 A;  4MJS B;  3AED B;  2ZW0 A;  2W9N A;  4FLH A;  2KDM A;  3TJP A;  1R4M B;  3JVZ X;  2DEN B;  3T8M A;  3Q3O C;  5JHB A;  3AE7 B;  2MX2 A;  2INP E;  4C4V A;  3N1Z C;  4M00 A;  2KFK A;  4KKJ A;  4BVU C;  4KX6 B;  3APF A;  3RD2 A;  3CF6 E;  1SE9 A;  4KSL C;  5IN7 A;  3Q8C A;  1TYG B;  3AEB B;  4XWW A;  4GB9 A;  1YX6 B;  2DWQ A;  4KGR A;  3ZNG C;  2V3S A;  2WXI A;  4WUR A;  2LFI A;  2MWS B;  4HXD A;  5HG2 A;  2XEW A;  5JXV A;  4GN1 A;  3A9J A;  3NG0 A;  2BWE S;  2MA9 B;  1GUA B;  1WJ4 A;  1WGR A;  3FIL B;  2KK8 A;  3RUI B;  3OJ4 B;  2WDT B;  2V3N A;  4XZ4 A;  2JRH A;  1MG4 A;  1Y56 A;  3L4P A;  4EOY A;  3H7P B;  3KQ4 A;  2L0F A;  3AEG B;  2AL3 A;  3TBL D;  1K51 A;  1AW7 A;  2GBJ A;  3PZ7 A;  1YN4 A;  2L52 A;  1ZPS A;  3RYT A;  1WXS A;  2GBR A;  4FJZ A;  5LXH A;  2RDH A;  1DOX A;  5LLI A;  3DWG C;  3VR9 B;  3NHE B;  1LQB A;  3Q6B A;  5G5H A;  3DDC B;  5G5G A;  3GOE A;  3QIJ A;  1P9D U;  2K8B A;  2RSU A;  1M94 A;  4ZRI A;  3RFZ B;  3MP9 A;  2REX A;  1ISN A;  2QSD A;  1OQY A;  2Z0E B;  3MHS D;  5AUK A;  2PLP A;  3W5U B;  4OZC A;  4ZOH C;  4ASW C;  1SE3 A;  3TEW A;  1V5T A;  2ZPN A;  5AUI A;  3N3K B;  5L83 A;  1KH0 A;  3VH4 B;  3RCZ A;  4KVG B;  2AQ2 B;  2GMI C;  2KWU B;  4HRO A;  3A4R A;  3U7Z A;  1MG8 A;  3DBR B;  1C9F A;  2IY0 B;  3PRZ A;  4ANW A;  2J0J A;  2BVC A;  5GXG B;  3AEC B;  4UDU C;  3U4E G;  5T8I A;  2WXL A;  5L95 C;  3IT6 B;  1NI3 A;  3L54 A;  3AE4 B;  1V6E A;  1ZGU B;  1XEE A;  1RFK A;  3QK0 A;  4XDD A;  3ENE A;  1H4R A;  3K9P B;  1EWC A;  1QT9 A;  2ONQ A;  3P42 A;  1WJU A;  2R2O A;  1ZOY B;  1D5M C;  4G11 A;  3ZRC A;  2M4N A;  2I2Y A;  2KWC A;  3V61 A;  1FEH A;  1OFF A;  5C23 A;  3K9O B;  4XYC A;  1ZKH A;  2DLB A;  4RF0 A;  2WGS A;  2EEL A;  2WS3 B;  5JHA A;  2VRR B;  1ZDV A;  3AV8 A;  1JWS D;  2MCN B;  3JSV A;  4IDI A;  3WAL A;  1YMH E;  4MEL A;  2INC C;  1GOZ A;  1HZ6 A;  5BMH A;  5EE1 A;  5LNK 1;  3W5V B;  2ZJD A;  2J7Q B;  1I4G A;  1MVK A;  4M0W A;  3P1M A;  1MPE A;  3HK0 A;  2HE7 A;  4N58 A;  1JRU A;  1CJE A;  2QJL A;  3ML8 A;  3PLV A;  2AYO B;  1Q0W B;  2LMC A;  3Q14 C;  1ZXI A;  3BWU D;  3P2B A;  2B3A A;  4HK2 A;  1BML C;  1D4B A;  1E8Z A;  2JZZ A;  1GB4 A;  1S1Q B;  1WH3 A;  2ZEQ A;  5BMI A;  4R3D A;  1FRD A;  3PHW B;  2KKC A;  2RR9 A;  3IAS 1;  2HDE A;  3VAW A;  4ANU A;  3PZ8 A;  1E6E B;  5EE9 A;  3BIN A;  1E7P B;  1CK1 A;  3ABV B;  2MBH A;  5D6J B;  1E8Y A;  2DZM A;  1XT9 B;  4HKZ E;  3NVZ A;  2WXO A;  3C0R B;  3ZJV A;  1IYF A;  1VJK A;  1ET6 A;  3MTN B;  2JRI B;  4KKI A;  3I5J C;  1K53 A;  2BKF A;  2KQ4 X;  1R4N B;  4KGS A;  1PQS A;  3IXS A;  2BB5 A;  2XBB C;  3GZN B;  4NAM A;  2KD0 A;  2N0S B;  3QA8 A;  4S0R A;  2FCQ A;  2IDY A;  2WWZ A;  2JWU A;  5J17 A;  3W9C B;  2LGY A;  2KTR B;  1WXQ A;  4CYE A;  3Q2A C;  3Q8A A;  3N30 A;  4RGM A;  4REZ A;  3OAW A;  3Q3N C;  2W3R A;  2I38 A;  3P63 A;  4YTN B;  4YSY B;  4F8C B;  2BYE A;  1N63 A;  3CST A;  5JH5 C;  1P1A A;  2N9P C;  3U30 A;  3R2I A;  3ZUN A;  5IA7 A;  2NPT A;  4IM3 A;  1F1H A;  2IND C;  3GP7 A;  4PYZ A;  2WXG A;  2JXX A;  3P4S B;  3QCA A;  3L0W B;  2CKH B;  2ON8 A;  1I42 A;  4OHJ A;  1ENF A;  3A1Q B;  4XE0 A;  2O6V B;  1NVI D;  3PVL A;  1ZDX A;  3KUZ A;  4YTM B;  2NCN A;  1RYJ A;  2CJO A;  3B2G A;  3HVD A;  3UIO B;  2KJ6 A;  1PFD A;  4YWG G;  3PRE A;  1TKY A;  4RGN A;  2IGH A;  2N9L A;  4IW0 A;  2FIF A;  1SXT A;  4LJO B;  2MQJ A;  1WX7 A;  1PYW D;  2KVZ A;  3ZXV A;  2WXP A;  4ITK A;  1HEZ E;  4L1B A;  4DQO C;  3RNG C;  4W9G A;  2LJ5 A;  1WYG A;  1PDX A;  3TIX A;  1PUT A;  2L8J A;  2BS2 B;  3TEY A;  1UGM A;  3ZTC A;  2GRI A;  4LNF A;  2N9X A;  3NOB A;  4BOZ B;  4J3O D;  1LO5 D;  3ZXR A;  1L0X B;  3ZNZ B;  3ALB A;  2K6Q A;  5DPR A;  4ANX A;  3M63 B;  3N20 C;  2J42 A;  4DBG A;  4DXF A;  2KT7 A;  2IY1 B;  2KAN A; 
#chains in the Genus database with same CATH homology
 3A1Q A;  3L10 B;  4I6N B;  1WRD B;  2O6V A;  2CHW A;  2ZNV C;  1EUV B;  3DVN U;  4NPN A;  2KTF A;  3B1L X;  2L0T A;  4JGH B;  2V1Y A;  1J19 A;  4TKN A;  2NR2 A;  3A9J B;  1E7V A;  2KZR A;  2OOB B;  2KX0 A;  1E8X A;  2N7D A;  4MGZ E;  4XX5 A;  5LXI B;  1V81 A;  1KOT A;  4CO7 A;  1LFD A;  3A9K A;  4FAD A;  1KM7 A;  3LJ3 A;  3N32 A;  4BOS C;  2N4F A;  1Z2M A;  4II2 B;  3NZU A;  2FUH B;  3L13 A;  1E90 A;  4HPL B;  5D2M B;  4K1R B;  2MRP A;  2FID A;  2CHZ A;  2DYO A;  1GC7 A;  1NI2 A;  1UBI A;  4AJY B;  3VXW A;  2EKE C;  1TBE A;  2O2V A;  3AXC A;  3PSE B;  3V6C B;  2BKR B;  2ZVN A;  3QAQ A;  4MEM A;  4AUQ C;  4BBN C;  4JIO U;  3M95 A;  2LWP A;  1WF9 A;  2IZV B;  1WJN A;  4E71 A;  4F1S A;  1L2N A;  3H9D A;  2KVR A;  4W9C A;  3O65 B;  2G4S A;  1KJT A;  4GDL A;  3VQI A;  1GG3 A;  4ICU A;  4W9J A;  3HM6 X;  3PTF C;  4RM9 A;  1IP9 A;  4K7S A;  2MW5 A;  3T9L A;  5FR6 A;  2C7M B;  4DK5 A;  3QHT A;  4MJS B;  3R7Q A;  4LDT D;  2W9N A;  4FLH A;  3AU4 A;  2XK5 A;  4HDQ A;  3V60 A;  2D10 A;  5E6O A;  3TJP A;  2MP2 A;  3JVZ X;  2DEN B;  3SHQ A;  3T8M A;  4DHZ E;  3QWZ B;  2C60 A;  2KO3 A;  5JHB A;  2MX2 A;  2BWF A;  1F9J A;  3NS8 A;  2IYD B;  2KFK A;  2JZ3 B;  2LXC A;  3PT2 B;  4BVU C;  4PS7 A;  3MJW A;  3APF A;  3RD2 A;  2A4Z A;  3CF6 E;  5G55 A;  1SE9 A;  2LUE A;  4GMV A;  4X57 B;  5AEK B;  4KSL C;  3UQA A;  2ZCC A;  4NQL B;  3ZIM A;  5HKH A;  1D3Z A;  2KLG A;  3UIN B;  4GB9 A;  3DBL I;  3R3M A;  5IAA C;  1YX6 B;  3VDZ A;  1WR1 A;  3DBH I;  2KDF B;  2V3S A;  3ZNG C;  2MWS B;  4HXD A;  2XEW A;  2MLB A;  5DPS A;  4M8M A;  4GN1 A;  3A9J A;  1LM8 B;  2RGF A;  1GNU A;  1SGH A;  2BWE S;  3CSF A;  3L08 A;  2KN5 A;  2NBU A;  2MA9 B;  1GUA B;  4WJQ A;  4NJ6 A;  4WWN A;  4KSK C;  1IPG A;  3KUC B;  3WAM A;  2MBO A;  2CHX A;  3DBR I;  1WJ4 A;  4E3C A;  2L7R A;  2QHO A;  4ZRJ A;  1WGR A;  2R2Q A;  3UGB B;  2KK8 A;  1Y8R C;  3H6N A;  1WE6 A;  1Q1O A;  3RUI B;  4PS3 A;  3OJ4 B;  1G6J A;  2WDT B;  3ZW3 A;  4XZ4 A;  2JRH A;  3IG3 A;  3DVG X;  1UEL A;  3UIP B;  4EOY A;  1E8W A;  3PRP B;  3W1S A;  1C3T A;  5J18 A;  3H7P B;  2L0F A;  2AL3 A;  3APC A;  2M8S A;  2DYM A;  3TBL D;  1RAX A;  1YX5 B;  2GBJ A;  3BY4 B;  2D11 A;  2NS5 A;  2JUO A;  4PS8 A;  3RYT A;  1WGD A;  1WMH B;  4W9L A;  4HCP B;  1WXS A;  2GBR A;  4FJZ A;  4MJS A;  5LXH A;  2HTH A;  2GBM A;  2L3Z A;  5LLI A;  2DX5 B;  4HDO A;  1L7Y A;  3NHE B;  4IUM B;  3DPD A;  3W1S C;  2CU1 A;  2L76 A;  2MBE A;  1LQB A;  3B08 A;  1UH6 A;  4GOC A;  3DDC B;  3GOE A;  3QIJ A;  4JL9 A;  1P9D U;  2M17 A;  1FXT B;  3IFW B;  2IO1 B;  4HWI B;  2K8B A;  2K8C A;  3VTW A;  4E74 A;  4OVV A;  2RSU A;  3JSV B;  4GIV A;  1S3S G;  1M94 A;  4II3 B;  4ZRI A;  2REX A;  1OTR B;  2CR5 A;  1ISN A;  2N9E B;  4KV2 A;  4MDK E;  1OQY A;  5E6N A;  2GOW A;  1WIA A;  2Z0E B;  3MHS D;  2KQS A;  2Z59 B;  2C9W B;  1WFY A;  4TQ1 A;  4FJV B;  3RZW C;  2WX1 A;  2IO0 B;  4B6W A;  4IWO A;  4ASW C;  3KH0 A;  3EC8 A;  3TL5 A;  1GJZ A;  2PE9 A;  1V86 A;  1V5T A;  1WM2 A;  1AAR A;  2ZPN A;  3AUL A;  4HPM B;  3M3J A;  4MGK E;  4M0W B;  3N3K B;  4M8N A;  5L83 A;  3VH4 B;  1WI0 A;  4FBJ B;  4GXB A;  5E6P A;  3RCZ A;  1V5O A;  2N1W A;  4KVG B;  2KWV B;  4CHK A;  1NDD A;  2GMI C;  2KQ7 A;  2KWU B;  3KW5 B;  4KIK B;  3A4R A;  1WR6 E;  2MBQ A;  2AWT A;  5D7G A;  1MG8 A;  3M62 B;  4XC2 A;  3VUX A;  2IY0 B;  2Y5B B;  2KDI A;  3PRZ A;  4ANW A;  2ZCB A;  2J0J A;  5DPW A;  1YJ1 A;  1J0G A;  2M1M A;  5L95 C;  2JVC A;  3VVW B;  3VFK A;  3L54 A;  5AZF A;  4JQW C;  1WX9 A;  4LCD E;  1V6E A;  4DWF A;  1ZGU B;  3QK0 A;  4KDL B;  3ZRF A;  2A5U A;  2RD0 A;  3ENE A;  3R66 C;  1H4R A;  3K9P B;  3TMP B;  3QAR A;  1XQQ A;  4HVB A;  4AJW A;  1SIF A;  1WYW B;  3H7P A;  4NQK E;  1OEY A;  4EUT A;  1WJU A;  2R2O A;  4G11 A;  3ZRC A;  2M4N A;  3PV1 A;  5D94 A;  4G50 A;  3DBS A;  2KWC A;  3V61 A;  5C23 A;  1WXA A;  3HM3 A;  1WMH A;  3K9O B;  2BYF A;  2OJR A;  3UF8 A;  1RLF A;  1ZKH A;  2C5L C;  2MSE D;  2LD9 A;  4BKS A;  3QX1 A;  2FCS A;  2PE6 B;  3R7R A;  1VD2 A;  3PPA A;  3RUL A;  5JHA A;  2ZNV B;  2VRR B;  2ZPY A;  3JYU A;  3I3T B;  2BGF A;  3Q3J A;  1K8R B;  2KC2 A;  1WGG A;  4WJO A;  2MCN B;  3JSV A;  3WAL A;  2V4L A;  2L05 A;  3QQ8 B;  4MEL A;  2LGX A;  1BT0 A;  2N1V A;  3VUW A;  4P7I A;  4EZK A;  1QZE A;  1WY8 A;  4K7U A;  1V49 A;  4IWP A;  4HCN B;  2HJ8 A;  4TV3 A;  2DZI A;  2ZJD A;  5DPT A;  4WWP A;  2J7Q B;  2LI5 A;  1TZ1 A;  3DCG A;  4I6L B;  1V80 A;  2K8H A;  1R4N I;  2LVO A;  4BKS D;  2DAJ A;  1EF1 A;  2FCN A;  5AZH A;  5CHW A;  1WE7 A;  3ZO5 B;  1P3Q U;  3GZN I;  1X1M A;  3X23 A;  2FNJ B;  1H8C A;  3HK0 A;  3DQV A;  2HE7 A;  4KIK A;  1JRU A;  2K25 A;  3VTV A;  3U7D A;  3QC8 B;  1TTN A;  3ML8 A;  1UZX B;  3PLV A;  3DVG Y;  2AYO B;  5DCN A;  1Q0W B;  4KZ0 A;  1Q5W B;  3VHT C;  4EZL A;  3P2B A;  4EZJ A;  2B3A A;  4HK2 A;  4K81 A;  2JF5 A;  1UD7 A;  1WJ6 A;  2BYV E;  2D07 B;  4W9K A;  2KC1 A;  3ONS A;  4B95 A;  3WAO A;  1E8Z A;  3HHM A;  5G2N A;  2JZZ A;  4AOF A;  4DXA B;  1S1Q B;  3LDZ E;  2UWQ A;  4N9F 4;  4YL8 A;  1WH3 A;  2ZEQ A;  1P0R A;  1V9J A;  3KVF B;  4MSQ B;  3RT3 B;  1WXM A;  3IBE A;  4W9H A;  3PHW B;  2L00 B;  3Q3F A;  4W9E A;  2NPT B;  3WIM A;  2KKC A;  3X0W A;  2RR9 A;  5BO4 B;  4IWQ A;  2LZ6 A;  2BPS A;  4J6I A;  3VAW A;  4ANU A;  4IG7 B;  3BIN A;  3CMM B;  3V6E B;  2KOX A;  3ML9 A;  5JZE B;  2MBH A;  2Z0D B;  3QJZ A;  2FAZ A;  3PLU A;  2JWZ A;  5D6J B;  1YIW A;  2DHZ A;  4IM0 A;  1E8Y A;  4RMA A;  2PPH A;  2DZM A;  1XT9 B;  1RFA A;  2FCM A;  2KLC A;  3C0R B;  1IYF A;  2JPH A;  4GDK B;  2AEH A;  4WWO A;  2ZVO A;  4MGY E;  2RPQ A;  3ZNH B;  4EFO A;  1U4A A;  4HJK A;  4URK A;  4TQ0 A;  3MTN B;  2JRI B;  1CMX B;  2BKF A;  1E7U A;  2LXA A;  5EDS A;  4DDI D;  3ZDT A;  4W9I A;  1PQS A;  2KJR A;  3PS6 A;  2XBB C;  4JLC A;  3ECI A;  4MM3 A;  1WX8 A;  1OGW A;  2KD0 A;  3QA8 A;  5CHF A;  3WA0 A;  2FCQ A;  2KMA A;  2WWZ A;  3B0A A;  2KHW B;  4ANV A;  5J17 A;  2EMT A;  2M0X A;  4A3O A;  5KHO A;  2LGY A;  4NJ7 A;  2WX0 A;  2KTR B;  2CS4 A;  2NBV B;  2JT4 B;  4FN2 A;  4KZC A;  4AP4 C;  5TR5 A;  3ZLZ A;  2UYZ B;  5CTR C;  4CYE A;  4DHJ B;  2KX3 A;  2DAF A;  2ASQ A;  3KYD D;  3N30 A;  4FHJ A;  1GC6 A;  3JW0 X;  3L16 A;  3D32 A;  1WZ0 A;  3OAW A;  2LRW A;  3KUD B;  3ZVV A;  2HD5 B;  1YQB A;  2BF8 B;  2O6V D;  2PEA A;  1XD3 B;  1ZW7 A;  3VUY A;  3OLM D;  5GMV A;  1YD8 U;  2IO2 B;  4RM8 A;  4F8C B;  1P98 A;  4ZYN A;  2I1J A;  4G0N B;  3IHP C;  2BYE A;  2G45 B;  2MBB B;  3HIZ A;  3CST A;  5JH5 C;  4DHZ B;  1P1A A;  2N9P C;  2IO3 B;  3U30 A;  3ZDM C;  1WGH A;  3ZUN A;  5IA7 A;  4WJN A;  2KDB A;  2J0M A;  4NAW B;  3DVN V;  3U8Z A;  3V62 A;  1EF5 A;  3NZS A;  2NPT A;  4IM3 A;  1I35 A;  1KLV A;  4IC7 B;  4PYZ A;  4EEW A;  2JXX A;  2C7H A;  1OEY J;  3ZKJ C;  4DDG D;  3QCA A;  4TUU A;  3AI5 A;  3PHX B;  2IBI B;  4WJP A;  5KHQ A;  3L0W B;  2EMS A;  1WGY A;  2K39 A;  2KDE B;  2CKH B;  4B9K A;  1I42 A;  3WAP A;  3L17 A;  2J0K A;  3TCA A;  1WXV A;  3A1Q B;  4A3P A;  2G3Q B;  1RRB A;  4NNJ B;  2AL6 A;  2O6V B;  3A4S C;  4FUL A;  3UQB A;  3VTU A;  4BFR A;  3DOW A;  1V2Y A;  4A20 A;  3IVF A;  3ZTD A;  2LVQ A;  3PVL A;  5J2R A;  4BKG A;  2NBW B;  2D2Q A;  4GDK A;  1NBF C;  3KUZ A;  4FHK A;  3ZNI D;  4KDI C;  1A5R A;  3W1Y A;  2LAS A;  3A33 B;  2NCN A;  3VH3 B;  3SDL C;  3A9K B;  3OJ3 A;  3UIO B;  2KJ6 A;  4AWJ A;  2LGD A;  4BBN F;  4FA6 A;  3PRE A;  2PJH A;  3NY5 A;  4LDT B;  3S2A A;  3SU8 X;  4IW0 A;  4W9F A;  2FIF A;  3PGE A;  3H1U A;  4LJO B;  2MQJ A;  2KXJ A;  1UBQ A;  3KYC D;  4LJP B;  1WX7 A;  2NVU I;  2O2V B;  4G3X B;  1J8C A;  2JY6 A;  3EFU A;  2KNB A;  4BKT A;  4IM2 A;  2LRU A;  4PYU A;  1C1Y B;  2KTR A;  1LXD A;  4K7W A;  5CHV C;  2KJH B;  4ICV A;  3H7S A;  4ZRK A;  4GDL B;  2G4D B;  2LJ5 A;  1E5W A;  4GSW A;  4W9G A;  3TIX A;  2L8J A;  1TGZ B;  4F7Z A;  2K1F A;  1Z5S B;  2N7E A;  1UGM A;  2KMC A;  3ZTC A;  4OVU A;  2GBN A;  3AU5 A;  1EO6 A;  2I1K A;  4HLE A;  3RZF A;  3WAN A;  1VCB A;  2N9X A;  2XK5 B;  2K6D B;  3SD5 A;  3PZD A;  3NOB A;  2D3G A;  2YVC A;  2MP2 B;  4NY0 A;  4MGI E;  5CX3 A;  3EHV A;  4MSM B;  4BOZ B;  2KFJ A;  3PRM B;  4EKU A;  2WYQ A;  4MH0 E;  2LVP A;  1R4M I;  3EEC A;  4W9D A;  3ZNZ B;  2KFK B;  4NAW A;  4GU2 A;  3ALB A;  1HE8 A;  2K6Q A;  5DPR A;  4ANX A;  1T0Y A;  2GBK A;  4ZDV A;  1WZ3 A;  3M63 B;  4DHJ D;  2DZJ A;  4FJY A;  2YLM A;  4DBG A;  4GGQ A;  4I6P A;  4WAA A;  3APD A;  2DZK A;  2DYB A;  1WM3 A;  2IY1 B;  4WQO B;  5C1Z A;  5AZG A;  2KAN A;  2C7N B;  2ZZP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...