4EOYA

Plasmodium falciparum atg8 in complex with plasmodium falciparum atg3 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
GMPSLKDEVSFENRVAETHKIRSKYPNRIPVVIERANRSNLPIIEKKKFLVPMNMLVGEFKFILHQHINQSAYGSNMKLFRERTIYLFVNNIVPKTGLLMQDLYEMYKDEDGYLYMEYSSESSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1 light chain 3
publication title Structural characterization and inhibition of the Plasmodium Atg8-Atg3 interaction.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transport protein
total genus 37
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eoyA00
2NBUA 3IG3A 1VCBA 3RD2A 2D2QA 3DBLI 3ZO5B 1ZW7A 5JHAA 4NQKE 1HE8A 3A1QB 1E8WA 2KQ7A 4GDKB 4GMVA 3VHTC 3ZVVA 2LASA 3VQIA 1R4MI 4HWIB 4MSQB 2GBKA 5KHQA 1XT9B 4NPNA 3W1YA 1WRDB 2BF8B 3D32A 1WXSA 2L00B 2L0FA 4YL8A 4CO7A 3ZKJC 1L2NA 2GBMA 2WYQA 4ZRJA 2CR5A 1WI0A 1WGDA 2LRWA 4BOZB 5C23A 5CHWA 1E8ZA 4K7WA 1WH3A 1YX6B 1KJTA 4F1SA 2KX3A 4F8CB 3A9KA 1WY8A 2M17A 2Z0DB 3CF6E 4MGKE 4BVUC 3UINB 5DPSA 3UIOB 3TL5A 2N9EB 2REXA 3PRPB 2A5UA 2KLCA 1YX5B 2HJ8A 4B9KA 1WJUA 2J7QB 4IM3A 3KUDB 4TQ1A 2DAJA 1P3QU 2B3AA 2ZCCA 3NOBA 2ZZPB 3A9KB 4NQLB 3U8ZA 3I3TB 2DAFA 1WZ0A 4WWOA 2M1MA 2K25A 3M3JA 2KVRA 4G3XB 4WAAA 5E6PA 2KDIA 3HM3A 4NAWA 3V62A 3DBRI 3L16A 3ZTCA 4URKA 1VD2A 3CMMB 2KWVB 1LQBA 2ZEQA 1IP9A 3QARA 1XD3B 4JQWC 3WA0A 1F9JA 2BKFA 2EMSA 3L08A 4HLEA 5HKHA 2K8BA 4DHJB 3WAPA 4DWFA 3ZNID 2NVUI 2IO1B 4E74A 1UZXB 3PS6A 2LZ6A 4NAWB 3UF8A 4GXBA 4BKSD 2Y5BB 4PS8A 4ASWC 3DBHI 3ZDTA 1V49A 2KANA 3V60A 4KSLC 2LVPA 2ZCBA 2YVCA 4KZCA 2KWUB 1S1QB 3MHSD 5J18A 3UGBB 3Q3JA 5D6JB 4HDQA 4MELA 3S2AA 3V61A 2GMIC 4RM8A 2JWZA 4WJPA 4ICUA 2BYFA 3ZW3A 1UH6A 2K8HA 3PRMB 4PYZA 3TCAA 2KFKB 4F7ZA 2RR9A 4II3B 3ZLZA 2Z0EB 2N1WA 3QC8B 2NS5A 3DVNU 3DPDA 4AUQC 4K7UA 2CU1A 3QCAA 4WWPA 2RPQA 1E7VA 4WJOA 5CX3A 3VTVA 3R66C 2DX5B 4JIOU 3UQBA 3ALBA 5DPWA 2KC1A 2OOBB 4G50A 4MEMA 1IYFA 4BBNF 2N9PC 2RSUA 4GB9A 2PE9A 1WXVA 1E8XA 3EFUA 3PPAA 1WX9A 2PEAA 3ML9A 5EDSA 2MBHA 1WJ4A 4ZRKA 2MP2B 4HDOA 3DVGY 2KDFB 4BFRA 1TGZB 1RAXA 4I6NB 4PS7A 5D94A 3KUCB 2MBQA 3M95A 4NNJB 1K8RB 1WF9A 2PJHA 2XEWA 2IO0B 5DPRA 4GIVA 2CHZA 2NBWB 2JVCA 1WJNA 5DPTA 2KTRA 2O2VA 4KZ0A 4BKSA 1XQQA 2JT4B 3PLUA 4M8NA 1C3TA 3MTNB 3N3KB 1ISNA 2NPTA 2L76A 3JVZX 2KHWB 2MBOA 3NZUA 2JZ3B 3ZNHB 5E6NA 1V6EA 4ZYNA 2KTRB 2O2VB 1WMHB 2GOWA 1TZ1A 3DVNV 3PZDA 3OJ3A 4MGIE 4II2B 1U4AA 2NPTB 4ZRIA 2FIFA 4MSMB 2DZKA 2LWPA 2ZVOA 3TMPB 4G11A 4JL9A 1D3ZA 4EZJA 2IBIB 3AULA 1V5TA 4IWOA 2FNJB 2KK8A 3QWZB 4XC2A 3KH0A 2GBNA 4AOFA 1WIAA 3WANA 3ZRFA 2FCQA 4GGQA 2V1YA 4RM9A 4OVVA 4TV3A 2MQJA 2HD5B 5JZEB 3QX1A 2WX1A 3L10B 2ZPYA 3RZWC 3H7SA 2LGXA 4FLHA 1WX7A 4P7IA 1FXTB 3DBSA 1EUVB 4HCNB 2HTHA 3CSFA 4WQOB 4PS3A 3MJWA 5AZGA 2KFJA 1WXAA 4HXDA 4M0WB 1OTRB 2KQSA 3ZIMA 4FADA 4ANXA 3NY5A 4W9DA 1LXDA 3U30A 3TBLD 3W1SA 2J0MA 2LD9A 2Z59B 1UD7A 2N4FA 2KKCA 2UYZB 2M4NA 4TQ0A 2LXCA 4IUMB 4EEWA 3H9DA 4EZKA 1X1MA 1YD8U 2LVQA 3DCGA 2CKHB 2RD0A 4I6PA 3R7RA 4ANVA 1WE6A 1H4RA 2DZJA 2K6QA 4W9GA 1BT0A 3TIXA 1Q0WB 5L83A 2FCNA 2LJ5A 3TJPA 2BKRB 4DDGD 3HHMA 3SU8X 3P2BA 4KIKA 3H7PA 2LUEA 3VTUA 2KN5A 3APDA 4MGYE 5J17A 2K6DB 2MA9B 1Z5SB 3KVFB 4KDIC 3OLMD 2J0JA 3GZNI 1A5RA 1WZ3A 4I6LB 2AYOB 2L7RA 3JSVB 3VVWB 1E5WA 2KO3A 3WIMA 4NY0A 3WALA 2A4ZA 2DZMA 4HPMB 4IG7B 4J6IA 5JH5C 2WWZA 2M8SA 2ZPNA 3L13A 2WX0A 1NBFC 3H7PB 2MWSB 4KIKB 2EKEC 4PYUA 2BYEA 4A3PA 3PLVA 3A33B 2MW5A 2KFKA 2ZNVB 5E6OA 1J8CA 2FUHB 4BOSC 2XBBC 2HE7A 2D11A 4LCDE 2MX2A 2BYVE 5AZFA 3DQVA 3AU4A 3NHEB 2MLBA 2G45B 3IHPC 4HVBA 3CSTA 1I42A 5D2MB 1WM3A 3IBEA 3PT2B 2KJ6A 4AJYB 2IY0B 4DHZE 2UWQA 2ZVNA 2L05A 1Q1OA 4EUTA 4WJQA 2N9XA 2NCNA 3A9JA 2M0XA 3PHWB 1H8CA 3GOEA 1ZKHA 2FCSA 1E8YA 3SHQA 1SGHA 2KD0A 1OGWA 2MP2A 1SIFA 2KXJA 3U7DA 1GUAB 1T0YA 1WE7A 4IWQA 3ZNGC 2CHXA 3BINA 1WGYA 3A9JB 4JLCA 4BKTA 3DVGX 2DENB 3ZNZB 2KC2A 2LRUA 3RYTA 3VH3B 2KX0A 2OJRA 3K9OB 5D7GA 1RFAA 1RRBA 2DHZA 3QA8A 3X23A 5CHFA 2FAZA 2D07B 4MH0E 4NJ6A 4WWNA 2I1JA 3IVFA 3JYUA 2W9NA 2AL3A 2WDTB 4N9F4 4W9IA 3PTFC 2FIDA 4ICVA 4FN2A 4DDID 3RCZA 4GU2A 2O6VA 1Q5WB 4MJSB 3VUYA 1WMHA 4M8MA 1OEYJ 1CMXB 1R4NI 2D10A 5LLIA 3RT3B 4FBJB 3W1SC 2KTFA 4GN1A 3PGEA 5J2RA 1V9JA 1GNUA 3SD5A 5IA7A 2O6VB 4GSWA 3HK0A 5L95C 1WJ6A 1C1YB 3R7QA 3ECIA 1V80A 4B95A 3DDCB 3PREA 2IO2B 2FCMA 2G3QB 2KMCA 2JRHA 2LXAA 2CHWA 4KVGB 3VH4B 2JXXA 2DYMA 4IM0A 2MRPA 2PE6B 1WGGA 1EF1A 3B1LX 3B0AA 1P1AA 3H6NA 2AL6A 2GBJA 3AXCA 4W9KA 4TKNA 1P0RA 4W9FA 3ZRCA 5GMVA 4ZDVA 1WGRA 2C60A 1V5OA 2NR2A 2ZNVC 3DOWA 4A20A 1AARA 3QIJA 4HCPB 2AEHA 2C7HA 5AZHA 2IZVB 2EMTA 1S3SG 4W9EA 1WR6E 2IYDB 2V3SA 4CYEA 1WYWB 3R3MA 3VTWA 3X0WA 3M63B 4DBGA 1E90A 5AEKB 3LDZE 4W9HA 2AWTA 2MBBB 1GG3A 2C9WB 4HK2A 3APFA 3HM6X 4LDTB 1GC6A 5G2NA 3AI5A 4E71A 4AJWA 1MG8A 3O65B 2G4DB 1UELA 5CHVC 3HIZA 4IW0A 3RULA 3SDLC 4ANUA 3PRZA 2G4SA 3C0RB 2KNBA 1PQSA 3QQ8B 2LVOA 1UBQA 1TTNA 3VAWA 2LGDA 2KDBA 3UIPB 4DHZB 3JSVA 1V2YA 1QZEA 2L0TA 2LI5A 3BY4B 3T8MA 3VFKA 3KYDD 2IY1B 2RGFA 1L7YA 4WJNA 4CHKA 5TR5A 2K8CA 1J0GA 1EO6A 3OAWA 4AP4C 2BPSA 3VXWA 3EC8A 3PV1A 4FJVB 2O6VD 4XX5A 4EFOA 3KYCD 1I35A 3PHXB 4MM3A 2XK5A 4XZ4A 3ZTDA 1KLVA 2GBRA 4X57B 2MSED 4RMAA 2JUOA 1JRUA 3M62B 1KOTA 1V86A 1OEYA 2V4LA 4BKGA 3QAQA 4FJYA 4A3OA 2R2QA 4EOYA 3NS8A 2IO3B 4LJOB 2DZIA 4KSKC 2XK5B 4MDKE 4AWJA 2L8JA 4G0NB 2R2OA 3B08A 2L3ZA 4K7SA 3EHVA 3VUXA 3A4RA 4B6WA 2KWCA 5JHBA 4FULA 1GC7A 1TBEA 1V81A 2JPHA 2KOXA 4HJKA 4LJPB 2MCNB 1WR1A 3ENEA 1P98A 1J19A 1E7UA 2BWES 4KV2A 2CS4A 5DCNA 4EKUA 5LXIB 4KDLB 2ZJDA 1WX8A 2QHOA 4W9CA 3QJZA 2LGYA 4LDTD 2J0KA 3LJ3A 4EZLA 3EECA 1UBIA 3L54A 3WAOA 2MBEA 3PSEB 5LXHA 2KJHB 3RZFA 3AU5A 3VUWA 2C7NB 3VDZA 5BO4B 3APCA 4FJZA 5IAAC 4K81A 4MJSA 4W9JA 4DXAB 2KZRA 3L17A 3N30A 3T9LA 4JGHB 1WXMA 2C5LC 2KDEB 3Q3FA 4IWPA 2K39A 3A4SC 2K1FA 3KUZA 5FR6A 3L0WB 1YQBA 1M94A 4K1RB 1IPGA 2N7DA 1UGMA 4NJ7A 1G6JA 1NDDA 2C7MB 3ONSA 1ZGUB 4OVUA 1Y8RC 4IC7B 4TUUA 5C1ZA 3PVLA 3N32A 4GDLA 1KM7A 3ML8A 5KHOA 3RUIB 1GJZA 3QK0A 2KMAA 3QHTA 1LFDA 1WFYA 1Z2MA 2I1KA 2KJRA 4FHKA 4ANWA 3JW0X 3NZSA 1WGHA 3V6EB 3OJ4B 3KW5B 3K9PB 3H1UA 4DHJD 1WM2A 1EF5A 4MGZE 4DK5A 3UQAA 2ASQA 2PPHA 4GDLB 1OQYA 2NBVB 2DYBA 2JZZA 2N1VA 4FA6A 1YIWA 2DYOA 3ZDMC 2BGFA 4GOCA 1YJ1A 3V6CB 1RLFA 1SE9A 2JRIB 4W9LA 4E3CA 4HPLB 2VRRB 1NI2A 1LM8B 2N7EA 4FHJA 2JF5A 2JY6A 4BBNC 3A1QA 2YLMA 3IFWB 4GDKA 2BWFA 5G55A 5CTRC 2KLGA 3WAMA 2D3GA 1P9DU 3ZUNA 4IM2A
chains in the Genus database with same CATH superfamily
2JYTA 3RD2A 1N5WA 2D2QA 1QKZA 2PTLA 1R4MB 5JHAA 4UDUC 4NQKE 3ZVVA 3BVZA 2K5PA 1R4MI 1MHHE 1XT9B 2BF8B 3RNGC 1WXSA 1K53A 2D5GA 4BOZB 5C23A 1OQQA 3MFGA 1WH3A 2DLBA 2KX3A 4YTNB 3A9KA 2M17A 3PRPB 3ZYYX 5C3JB 2HJ8A 4B9KA 1WJUA 3C8YA 4TQ1A 1FFVA 2B3AA 1TIFA 4KKIA 4B0EA 4NQLB 4YTPB 2DAFA 3ZJTA 1D5MC 2M1MA 2KVRA 1KTKA 1XF5L 4NAWA 1VD2A 1QOAA 1FM0D 2ZEQA 3WA0A 3L08A 5HKHA 1TS2A 1VR9A 2IO1B 4E74A 1MVKA 1UZXB 3DWMA 3PS6A 3DBHB 2IPKD 4RGOS 1HZ5A 2Y5BB 4ASWC 3DBHI 3AEDB 2LVPA 2ACZB 3VR9B 1QLBB 4MELA 3V61A 5IOIA 5H92C 4F7ZA 1LO5D 3TCAA 2KFKB 2OJWA 4II3B 2Z0EB 2MJ3A 5FR3A 3GE8C 2NS5A 3QC8B 3DVNU 4M01A 3NVZA 3HVDA 4WJOA 1JWUD 4B0MA 3UQBA 5DPWA 1XEEA 1HTOA 3NS1A 4JWSC 1IYFA 2N9PC 1ACCA 2Y5PA 3EFUA 5EDSA 5D94A 2MBQA 4A9AA 3AECB 5DPRA 4GIVA 4JX1C 1WJNA 4BKSA 3LXFA 4KZ0A 4IOIE 2IGDA 3PLUA 3PZ7A 1IGCA 1ISNA 1I4XA 1ZXIA 4BZAA 2MBOA 3BVGA 2JZ3B 5E6NA 1V6EA 2O2VB 2WXJA 3U4EG 2WDRB 3KLSX 4II2B 2WS3B 1U4AA 4JL9A 4M02A 4IWOA 1V5TA 3QWZB 3U2SC 3GS2A 4C4VB 3ZRFA 4GGQA 2V1YA 3AEEB 4M00A 2ZPYA 3RZWC 4P7IA 1I4RA 3DBSA 2DBYA 2HTHA 4WQOB 3MJWA 3DWGC 2FBWB 1EWCA 2KQSA 4FADA 3AE1B 4ANXA 4RGMA 5BMIA 3TBLD 1UD7A 2N4FA 1YNTE 1EU4A 2WXKA 2JXTA 5I4DA 2J4XA 2LXCA 4IUMB 1HZ6A 3H9DA 3R7RA 1WE6A 3KWLA 2DZJA 4JE3B 4US8A 2ON8A 1WSPA 1SE4A 1Q0WB 3WCQA 4DDGD 2BKRB 3HHMA 3SU8X 4KIKA 5J17A 1F2RI 1WZ3A 3T3NA 2W54A 2B76B 4JWUC 1WXQA 1NBFC 2WXIA 4RGTA 4A3PA 1KLUD 5EE9A 5E6OA 2HE7A 2D11A 2WU5B 2BYVE 3Q69A 4P16A 2MLBA 2IDYA 3I5JC 3CSTA 4HVBA 5D2MB 1UNSA 1JALA 4REZA 2L05A 1UUPA 4EUTA 4WJQA 3E9SA 3PHWB 4PT5A 1H8CA 1KF6B 4ARIA 2FCSA 5D3IB 2MP2A 1SIFA 1XLPA 2W3RA 4BKTA 1WGYA 3A9JB 1TS3A 4KGTA 2DENB 1T0QC 3ZNZB 1RFAA 3QA8A 2MHJA 1T5XD 2FAZA 4NJ6A 2TSSA 4WWNA 2I1JA 2WDTB 2FIDA 4ICVA 1LGRA 4MJSB 3VUYA 3Q2AC 1ZPSA 2KTFA 3PGEA 5IA7A 5BMGA 1I4GA 3MHZA 3Q3NC 2O6VB 2YEPB 2KMCA 4KVGB 1VZ7A 2DYMA 2MRPA 5D3DA 3AXCA 4W9KA 3AMZA 4W9FA 2LFIA 2NR2A 1V5OA 2ZNVC 2LJIA 3QIJA 4HCPB 2AEHA 1S3SG 2V3SA 5IO9A 4DBGA 4HK2A 2YEPF 4AJWA 1ZE3D 4XE0A 3O13A 2LVOA 3VAWA 2KT7A 4DHZB 3JSVA 2LEKA 3I57A 4CHKA 2GB1A 1EO6A 2BPSA 3SFEB 2N9LA 1PUTA 5TSSA 4MM3A 4XZ4A 4X57B 4Q2JA 2JUOA 4HKQA 1OEYA 3NVYA 4BKGA 3RNFC 1EU3A 4WWMA 2XK5B 1L6VA 2L8JA 4K7SA 4HKZE 2ZW0A 3A4RA 2HDEA 5JHBA 1GC7A 4HJKA 2MCNB 1WR1A 2BWES 2OEDA 2WGSA 4KDLB 2D3BA 1WX8A 1TKEA 3Q8EA 4LDTD 1AW7A 3EECA 3L54A 5LXHA 2XNAC 3VDZA 3APCA 4FJZA 2INPE 4K81A 5BYQA 1BUIC 3TEYA 3L17A 4K3CA 2C5LC 3B9JA 4IWPA 2K39A 3RI7C 1VZ8A 2WXLA 1HQRD 4NJ7A 2LUMA 5IP4D 1NDDA 1VLBA 4ACFA 3N32A 1KM7A 2BS3B 5KHOA 3RUIB 5HG2A 1LFDA 4DXGA 3NZSA 4YT0B 3V6EB 3KW5B 3H1UA 4DK5A 2PPHA 4GDLB 4ZOHC 2JZZA 3AEBB 3ZDMC 2BGFA 3V6CB 1RLFA 1SE9A 1KRHA 4FHJA 2N7EA 4BBNC 1MHXA 3AE3B 3RPFC 5G55A 2M19A 4PS8A 3ZO5B 1JROA 2KQ7A 4OZBA 1SEBD 1IGDA 3W1YA 3HUIA 1WRDB 1K52A 4CO7A 2GBMA 2WYQA 2CR5A 1WGDA 5CHWA 2RDHA 1KJTA 4ZHOA 4F8CB 3CF6E 4BVUC 4MGKE 3W5VB 1C78A 4RH6A 5DPSA 3TL5A 2N9EB 3N1XC 2ZCCA 1GB4A 3U8ZA 2QSDA 4WWOA 3DBRB 2K25A 3M3JA 1XCQL 2KDIA 3V62A 3DBRI 1I4HA 2KWVB 1LQBA 4L2YA 3P63A 1T3QA 1XD3B 3QARA 4JQWC 1F9JA 3WAPA 4MT5A 2JSVX 2SAKA 1R7SA 2LZ6A 4BKSD 3J9CA 2YVCA 1RFKA 2KWUB 1S1QB 3MHSD 3UGBB 5D6JB 4XDDA 4HDQA 4TMAB 2G1EA 4OZAA 3RNAC 2GMIC 2ONQA 1SJHD 2H88B 2JWZA 4WJPA 3ZW3A 1UF0A 1C9FA 2N1WA 3DPDA 4K7UA 5C2TB 2BT6A 2RPQA 3BZDB 1C4PA 1N61A 3NUHB 5HFYA 5CX3A 3VTVA 3R2TA 3R66C 3ALBA 4DXFA 1ZP0B 3UI3A 4BBNF 2RSUA 1TT5B 3PPAA 2PEAA 3ML9A 1QOGA 4ZRKA 4DQOC 2KDFB 1TGZB 4I6NB 2BVCA 3M95A 1K8RB 2NBWB 2O2VA 1L0VB 1XQQA 4M8NA 3W5UB 3MTNB 3N3KB 2L76A 3JVZX 2SEBD 3ZNHB 4C56C 1VDVA 3DVNV 3PZDA 3PO0A 4RNAA 2JQRB 1P7FA 3E56A 2FIFA 1J7CA 2LWPA 4G11A 4EZJA 3VRBB 2KK8A 3MC9A 2G9HD 4XGAB 4WURA 2WXPA 3ZQ4A 4RM9A 2HD5B 5JZEB 1D5ZC 5EE3A 2WX1A 3BVMA 1WX7A 3ABVB 1FXTB 1N62A 4HCNB 5T8IA 4YSZB 5AZGA 3ZIMA 1OTRB 3U30A 2LD9A 2KKCA 1F0ZA 4TQ0A 4EZKA 3AE9B 2RD0A 4I6PA 1VZ6A 1H4RA 2BS2B 3TIXA 2FCNA 2LJ5A 5FK9C 3BK1A 4ZRQA 3TJPA 3VTUA 2KACA 2LMCA 4MACA 2MA9B 1Z5SB 3OLMD 4ZHPA 3WIMA 2KO3A 2QJLA 3ZJUA 4NY0A 2M0AA 4J6IA 5JH5C 2ZPNA 4PYUA 2NTSA 2PW9A 1E0ZA 1TKGA 2W55A 3DQVA 3AU4A 2IGHA 3NJTA 3V05A 1HXYD 1WM3A 3IBEA 2IY0B 3A9JA 1EWYC 3B2GA 1ZKHA 4HPPA 1JWBD 1OGWA 2KXJA 3BIID 3EUB2 2CHXA 3LYYA 3P1MA 3IAM1 2KC2A 3RYTA 4AS1A 3AEFB 3IAS1 2OJRA 3K9OB 1KLGD 4QAYA 2V0GA 4S17A 3X23A 1XLNA 1C4AA 1QOFA 4C80A 2O6VA 1Q5WB 1V1OA 1WMHA 2N7JA 2X8XX 2ZW1A 4M8MA 1OEYJ 1NEKB 1UGJA 3RT3B 1CQVA 4FBJB 3Q8CA 2N9KA 2K22A 1F2RC 4GSWA 5L95C 1WJ6A 1C1YB 3R7QA 4B95A 3DDCB 3VH4B 2JXXA 1FEHA 3C19A 2I2YA 3H6NA 2AL6A 4ITKA 2GBJA 2L83A 3ZRCA 5GMVA 2R61A 4ZDVA 1WGRA 3DHIC 3DOWA 2W82A 4P1CC 2C7HA 5AZHA 2IZVB 2EMTA 2QIEB 4W9EA 4CYEA 1L5PA 3X0WA 2WXFA 4YTMB 1TY2A 4OW0A 4WQMA 3LDZE 5G2NA 4LDTB 2C9WB 3SEBA 4E71A 1MG8A 3O65B 2LHEA 2G4DB 1UELA 5CHVC 1WYGA 3SDLC 4ANUA 2VZKB 2WXRA 3PRZA 4LNIA 3C0RB 2KWDA 5AUIA 1UBQA 1TTNA 2KDBA 4A6QA 5FKAC 1QZEA 2LI5A 2IY1B 1L7YA 2BB6A 1V97A 4WJNA 2JYEA 1J0GA 3PV1A 4EFOA 4H2AA 1KFYB 2XK5A 2GBRA 2MSED 1KOTA 2JX5A 3W2DA 3QAQA 1SF0A 2DZIA 1SXTA 1FXIA 2VH2A 4MDKE 4G0NB 2L3ZA 3EGRA 3EHVA 5BMHA 2KWCA 3IT4B 4FULA 2KOXA 3Q6BA 2JPHA 3EA6A 1FCLA 1P98A 1J19A 3TUOA 5DCNA 1Q10A 2RPVA 2ZJDA 4W9CA 4XDCA 3QJZA 2LGYA 1T6BX 3HVZA 1UBIA 4O1NA 3WAOA 4XWTA 3B2FA 3PSEB 2KJHB 5G5HA 1J7BA 2KZRA 2KDEB 1XLOA 3KUZA 1YQBA 3NZ3A 2KAJA 2N7DA 4EE2A 2LGSA 1N6ZA 2C7MB 1ZGUB 2K0PA 4IC7B 4TUUA 5C1ZA 3PVLA 2BQQA 4GDLA 3QHTA 1WFYA 1Z2MA 2I1KA 2KJRA 3VRAB 1GB1A 5LNK1 1EF5A 4MGZE 1B9RA 3UQAA 1PGBA 2N1VA 1YJ1A 2EELA 2JRIB 4W9LA 4HPLB 2YLMA 4L23A 3AE8B 5CTRC 2KLGA 1ZXHA 3IG3A 4WH4A 2UU7A 3ZXRA 3EFCA 1ZW7A 3A1QB 3VHTC 2LASA 1CJEA 1EM7A 3VQIA 4HWIB 4MSQB 5KHQA 4NPNA 1PGXA 1FMAD 2L00B 3GP7A 2L0FA 3ZJVA 1L2NA 1RM6C 4ZRJA 1WI0A 2Y5CA 1UWXA 2KYWA 4YSYB 1E8ZA 4CQNA 2DNFA 1YX6B 2PVOD 1WY8A 2Z0DB 5E6JA 1J7AA 2CJOA 2N0SB 2A5UA 2KLCA 3BYYB 2J7QB 2DAJA 1NVID 1FCCC 3I3TB 2I38A 5E6PA 4G3XB 3HM3A 1GPXA 1RWSA 3L16A 4P1BC 2M56B 4HJGE 1IP9A 1QQRA 1FNVA 2BKFA 2K8BA 4DHJB 4OVZA 2NMQA 2NVUI 3UF8A 4GXBA 1FNUA 1JWSD 1I4PA 1B1ZA 1V49A 3ZDTA 3V60A 1SIJA 2WNMA 4LTUA 4WIPA 5J18A 2V4IB 1CZPA 1A70A 3SFDB 3S2AA 4P6VF 1N5XA 2BYFA 4LNOA 4XWWA 1UH6A 4PYZA 1SSNA 4HRSA 3RNCC 2JU6X 2CU1A 3QCAA 1L4DB 1E7VA 4NJCA 3I63C 2OOBB 4G50A 3CWIA 3VR8B 4MEMA 2QMTA 3AN1A 2CJNA 1WXVA 1E8XA 1FXAA 1ET9A 1NYRA 1WX9A 2MBHA 2MP2B 2JZPA 3KUCB 4NNJB 1L0XB 1C77A 1WF9A 3R8BA 2CHZA 2JVCA 3NVVA 2J52A 5DPTA 3NG0A 1C3TA 4A55A 3N9YC 2PMVA 1PFDA 1ZUD2 2OHFA 2KTRB 1SE2A 2GOWA 1GAQB 1TZ1A 3AE2B 5BYRA 2NPTB 4ZRIA 2J53A 3TMPB 2IBIB 3BYTB 1ENFA 3AE5B 2FNJB 2BS4B 1WIAA 3IXSA 2FCQA 4TV3A 3QX1A 1TZOA 3L10B 1YN5A 2FUG1 1SE3A 3CSFA 2WLBA 2CU3A 2KFJA 1WXAA 4M0WB 2WDQB 4USAA 3NY5A 4W9DA 2J0MA 5MPOA 2Z59B 2UYZB 1YQ3B 2L32A 1YD8U 2LVQA 4C7ZA 2CKHB 4ANVA 4W9GA 1BT0A 5L83A 2BW2A 3GZNB 2LUEA 3GE3C 3MC8A 3AV8A 1JCKB 4MGYE 1FRRA 2K6DB 1I7HA 2HJ1A 2J0JA 3GZNI 1TJEA 2KMMA 1A5RA 4I6LB 2AYOB 3JSVB 3TSSA 2AX5A 1E10A 3WALA 2A4ZA 2DZMA 2RMMA 4IG7B 1BXTA 2M8SA 3H7PB 2MWSB 2Q5WD 2EKEC 2MW5A 2KFKA 1J8CA 2FUHB 3P4SB 4MM3B 4BOSC 2XBBC 2X38A 5AZFA 3NHEB 2G45B 3IHPC 2WXGA 3OG5A 3PZ8A 3PT2B 4AJYB 4DHZE 2UWQA 1JQ4A 2ZVNA 4LK0M 1Q1OA 2NCNA 3GOEA 3FILB 1MG4A 3SHQA 2KD0A 3FKYA 2H89B 3U7DA 4N6EB 1T0YA 1WE7A 4IWQA 3BINA 4JLCA 1TS4A 2QEJC 1MJDA 1RRBA 2DHZA 5CHFA 3AE6B 3IVFA 2W9NA 2KVZA 4N9F4 1T0RC 1T0SC 1NENB 3PTFC 2INCC 3RCZA 4GU2A 1R4NB 2WXNA 3AE7B 1R4NI 5LLIA 5BYSA 1ZDVA 2RDBC 1FPYA 3ETRA 1FNWA 3ECIA 2DWQA 1V80A 1DGJA 4C4VA 2G3QB 2LXAA 2BYTA 2JRHA 2CHWA 4IM0A 1I4QA 3B1LX 4C00A 4TKNA 1P0RA 1FIQA 2Y3AA 1ZOYB 2JWUA 4A20A 1QF6A 1JRPA 1FD6A 1WYWB 3R3MA 3VTWA 1QOBA 5EE0A 2WU2B 1STEA 2QC8A 4KGSA 3GB1A 4W9HA 2AWTA 3OWEB 3TEZA 1GC6A 3AI5A 1PYWD 2IJ0A 3HIZA 4IW0A 3SR6A 2ICIA 2RDGA 2KNBA 1PQSA 2GRIA 3UIPB 3RN9C 1V2YA 3KQ4A 1NYQA 2L0TA 3Q8AA 3BY4B 3T8MA 3VFKA 3KYDD 2RGFA 5TR5A 2K8CA 4BAXA 1ZDXA 3OAWA 3VXWA 4KX6B 1I35A 3ZTDA 4RMAA 2E3TA 1JRUA 3M62B 1N60A 4FJYA 4YXDB 2R2QA 2V9HA 3NS8A 2IO3B 4LJOB 4AWJA 2R2OA 1WGKA 3URYA 2QCZA 1FO4A 4B6WA 3NRZA 4A90A 1OQRA 1V81A 1TBEA 4LJPB 4HEA1 3ENEA 2HTME 3FC4A 4EKUA 2J42A 1E6EB 2BBCA 2J0KA 3LJ3A 4EZLA 1L6UA 3AH7A 3AU5A 3VUWA 1DYQA 4HROA 5IAAC 1KH0A 4MJSA 3N30A 3BK2A 3A4SC 1YN4A 1AYFA 5FR6A 1M94A 4K1RB 1IBXB 3I9V1 3LB8C 1IPGA 4LNNA 4OVUA 3ML8A 1AWDA 1GJZA 2KMAA 3P4PB 4ANWA 1QT9A 1YJJA 4WAFA 4OHJA 2ASQA 4FA6A 1YIWA 2DYOA 4GOCA 2V3NA 4E3CA 2VRRB 1NI2A 2JF5A 3A1QA 3IFWB 1UWMA 1XLQA 1DOIA 3DBLB 4IM2A 3CIRB 1YN3A 2NBUA 1JWMD 3ZGZA 1VCBA 3DBLI 3P4RB 1V1PB 1HE8A 4GMVA 1E8WA 4GDKB 4FXCA 2FE8A 1OFFA 2GBKA 3D32A 4YL8A 3ZKJC 3AM9A 4ARCA 1TYGB 2LRWA 3DHHC 4JPSA 3AB5A 4K7WA 3N20C 2QDFA 4F1SA 3UINB 3UIOB 2REXA 4LNKA 4RFBA 1YX5B 3TEXA 1GOZA 1NI3A 4IM3A 3KUDB 1P3QU 3NOBA 2ZZPB 3A9KB 1WZ0A 1SB3C 4WAAA 3RNBC 3ZTCA 4URKA 4RF1A 2E6XA 1P7EA 3CMMB 4OZCA 2EMSA 2WXMA 4HLEA 4DWFA 3ZNID 2MJEA 3U7ZA 4NAWB 2MEKA 2KANA 3V3XA 3MC0B 4KSLC 2ZCBA 4KZCA 3Q3JA 2WQYB 4C7YA 1VJKA 4RM8A 5JXVA 4ICUA 1HEZE 1XCTL 2K8HA 3PRMB 1L0YB 5IKCM 2RR9A 3ZLZA 4AUQC 1FFUA 4WWPA 2LGIA 2DX5B 4JIOU 2KC1A 2MJDA 2EKIA 4IKGA 4ZRPA 4GB9A 1XXGA 2PE9A 1IUEA 1K50A 1WJ4A 5HI1A 1WWTA 4HDOA 3DVGY 4BFRA 3P42A 1RAXA 4PS7A 3N1ZC 3RFZB 2PKOA 2PJHA 2XEWA 2IO0B 3BWUD 3L4PA 4LNFA 1MPEA 2KTRA 2JT4B 2KDMA 5G5GA 2NPTA 2KHWB 2BB5A 3NZUA 4RF0A 4ZYNA 1N63A 1WMHB 3Q14C 3OJ3A 4MGIE 2GI9A 1E7PB 3P4QB 4MSMB 2DZKA 2ZVOA 2INDC 1D3ZA 3AULA 4KGRA 3N1YC 4XC2A 3KH0A 1ESFA 2GBNA 4AOFA 3WANA 4M0WA 4OVVA 2MQJA 4TSSA 3H7SA 2LGXA 4FLHA 2PVGC 1EUVB 1D6EC 4PS3A 3KWVA 4HXDA 1HTQA 2PIAA 1V8CA 1LXDA 1F77A 3W1SA 2NTTA 2XN9C 2M4NA 4EEWA 1X1MA 3DCGA 1TKYA 2K6QA 1QILA 3P2BA 3H7PA 2KN5A 3W9CB 2WDVB 3APDA 1SBBB 5GXGB 1C79A 4KDIC 3KVFB 1FRDA 3AE4B 2W3SA 3VVWB 2L7RA 1E5WA 4AQ7A 1PGAA 1ROEA 1WRIA 4HPMB 3L13A 2WWZA 2AQ1B 4KIKB 2WX0A 1L4ZB 3H8HA 2BYEA 3PLVA 3A33B 2AQ2B 2ZNVB 3Q3OC 4RCOA 3RNEC 4XYCA 4LCDE 3MP9A 2MX2A 2KN4A 3FILA 4A8XC 3Q8BA 1MFWA 1I42A 2KJ6A 2D3AA 2N9XA 2M0XA 1YMHE 4N59A 1F1HA 3NVWA 3T3OA 1JW9D 1YQ4B 1E8YA 1JMLA 1M4VA 1SGHA 2K3UA 3TEWA 1GUAB 3ZNGC 2BTEA 3HRDD 2VZKD 3DVGX 1TS5A 2LRUA 3Q8FA 3VH3B 4NZLB 2KX0A 5D7GA 4RGNA 3AEGB 1Y56A 2D07B 4MH0E 5EE1A 4LLGM 3JYUA 2AL3A 4W9IA 4DDID 4FN2A 3U52E 1TY0A 1E9MA 2Z8LA 1SJED 1CMXB 2D10A 3W1SC 5J2RA 3DHGC 4GN1A 1V9JA 1GNUA 3SD5A 3MJ5A 3HK0A 1C76A 2WXHA 3PREA 2IO2B 2FCMA 2PE6B 1WGGA 1EF1A 2QILA 3B0AA 1P1AA 4D2KA 4GLSC 4IDIA 2C60A 3AEAB 2INNE 2D3CA 3FAHA 1AARA 1C4CA 3Q3MC 1WR6E 2IYDB 4S0RA 2KQ4X 4N58A 3M63B 5AEKB 1E90A 2MBBB 2K9XA 1GG3A 3APFA 1XO3A 3HM6X 4KKJA 1DOYA 3RULA 2G4SA 3QQ8B 2LGDA 2WP9B 4AP4C 3EC8A 4FJVB 2O6VD 4XX5A 3KYCD 2WHIA 1AN8A 3PHXB 1KLVA 5IN7A 1V86A 3ZXVA 2V4LA 1HA5A 2V3PA 2L52A 4A3OA 5H8YE 4EOYA 2PLPA 2VH1A 2MH7A 4KSKC 2IGGA 1YJIA 3B08A 1CK1A 3VUXA 2WXQA 1BMLC 1E7UA 4KV2A 2CS4A 5LXIB 2QHOA 1K51A 2MBEA 2AQ3B 3RZFA 4ZYSA 1DOXA 2C7NB 5BO4B 1IBXA 1D5XC 4MH8A 4US9A 3IT6B 4W9JA 4DXAB 3T9LA 4JGHB 1WXMA 2GLSA 3Q3FA 2L1AA 1VRAB 2K1FA 4PK1A 3L0WB 4L1BA 4R3DA 4K3BA 4NAMA 5AUKA 4J3OD 1UGMA 1G6JA 3ONSA 1Y8RC 1F52A 3R2IA 3QK0A 1RYJA 1JWAD 4FHKA 4YSXB 3JW0X 1WGHA 3OJ4B 1D4BA 3K9PB 4DHJD 1WM2A 5HHDG 1OQYA 2NBVB 2DYBA 2WXOA 1YOVB 1LM8B 2JY6A 1V1PA 4GDKA 2LHDA 2BWFA 3RMKC 1ET6A 3WAMA 1PDXA 2D3GA 1P9DU 1MI0A 4YWGG 3ZUNA
chains in the Genus database with same CATH topology
2NBUA 3IG3A 1VCBA 3RD2A 2D2QA 3DBLI 3ZO5B 1ZW7A 5JHAA 4NQKE 1HE8A 3A1QB 1E8WA 2KQ7A 4GDKB 4GMVA 3VHTC 3ZVVA 2LASA 3VQIA 1R4MI 4HWIB 4MSQB 2GBKA 5KHQA 1XT9B 4NPNA 3W1YA 1WRDB 2BF8B 3D32A 1WXSA 2L00B 2L0FA 4YL8A 4CO7A 3ZKJC 1L2NA 2GBMA 2WYQA 4ZRJA 2CR5A 1WI0A 1WGDA 2LRWA 4BOZB 5C23A 5CHWA 1E8ZA 4K7WA 1WH3A 1YX6B 1KJTA 4F1SA 2KX3A 4F8CB 3A9KA 1WY8A 2M17A 2Z0DB 3CF6E 4MGKE 4BVUC 3UINB 5DPSA 3UIOB 3TL5A 2N9EB 2REXA 3PRPB 2A5UA 2KLCA 1YX5B 2HJ8A 4B9KA 1WJUA 2J7QB 4IM3A 3KUDB 4TQ1A 2DAJA 1P3QU 2B3AA 2ZCCA 3NOBA 2ZZPB 3A9KB 4NQLB 3U8ZA 3I3TB 2DAFA 1WZ0A 4WWOA 2M1MA 2K25A 3M3JA 2KVRA 4G3XB 4WAAA 5E6PA 2KDIA 3HM3A 4NAWA 3V62A 3DBRI 3L16A 3ZTCA 4URKA 1VD2A 3CMMB 2KWVB 1LQBA 2ZEQA 1IP9A 3QARA 1XD3B 4JQWC 3WA0A 1F9JA 2BKFA 2EMSA 3L08A 4HLEA 5HKHA 2K8BA 4DHJB 3WAPA 4DWFA 3ZNID 2NVUI 2IO1B 4E74A 1UZXB 3PS6A 2LZ6A 4NAWB 3UF8A 4GXBA 4BKSD 2Y5BB 4PS8A 4ASWC 3DBHI 3ZDTA 1V49A 2KANA 3V60A 4KSLC 2LVPA 2ZCBA 2YVCA 4KZCA 2KWUB 1S1QB 3MHSD 5J18A 3UGBB 3Q3JA 5D6JB 4HDQA 4MELA 3S2AA 3V61A 2GMIC 4RM8A 2JWZA 4WJPA 4ICUA 2BYFA 3ZW3A 1UH6A 2K8HA 3PRMB 4PYZA 3TCAA 2KFKB 4F7ZA 2RR9A 4II3B 3ZLZA 2Z0EB 2N1WA 3QC8B 2NS5A 3DVNU 3DPDA 4AUQC 4K7UA 2CU1A 3QCAA 4WWPA 2RPQA 1E7VA 4WJOA 5CX3A 3VTVA 3R66C 2DX5B 4JIOU 3UQBA 3ALBA 5DPWA 2KC1A 2OOBB 4G50A 4MEMA 1IYFA 4BBNF 2N9PC 2RSUA 4GB9A 2PE9A 1WXVA 1E8XA 3EFUA 3PPAA 1WX9A 2PEAA 3ML9A 5EDSA 2MBHA 1WJ4A 4ZRKA 2MP2B 4HDOA 3DVGY 2KDFB 4BFRA 1TGZB 1RAXA 4I6NB 4PS7A 5D94A 3KUCB 2MBQA 3M95A 4NNJB 1K8RB 1WF9A 2PJHA 2XEWA 2IO0B 5DPRA 4GIVA 2CHZA 2NBWB 2JVCA 1WJNA 5DPTA 2KTRA 2O2VA 4KZ0A 4BKSA 1XQQA 2JT4B 3PLUA 4M8NA 1C3TA 3MTNB 3N3KB 1ISNA 2NPTA 2L76A 3JVZX 2KHWB 2MBOA 3NZUA 2JZ3B 3ZNHB 5E6NA 1V6EA 4ZYNA 2KTRB 2O2VB 1WMHB 2GOWA 1TZ1A 3DVNV 3PZDA 3OJ3A 4MGIE 4II2B 1U4AA 2NPTB 4ZRIA 2FIFA 4MSMB 2DZKA 2LWPA 2ZVOA 3TMPB 4G11A 4JL9A 1D3ZA 4EZJA 2IBIB 3AULA 1V5TA 4IWOA 2FNJB 2KK8A 3QWZB 4XC2A 3KH0A 2GBNA 4AOFA 1WIAA 3WANA 3ZRFA 2FCQA 4GGQA 2V1YA 4RM9A 4OVVA 4TV3A 2MQJA 2HD5B 5JZEB 3QX1A 2WX1A 3L10B 2ZPYA 3RZWC 3H7SA 2LGXA 4FLHA 1WX7A 4P7IA 1FXTB 3DBSA 1EUVB 4HCNB 2HTHA 3CSFA 4WQOB 4PS3A 3MJWA 5AZGA 2KFJA 1WXAA 4HXDA 4M0WB 1OTRB 2KQSA 3ZIMA 4FADA 4ANXA 3NY5A 4W9DA 1LXDA 3U30A 3TBLD 3W1SA 2J0MA 2LD9A 2Z59B 1UD7A 2N4FA 2KKCA 2UYZB 2M4NA 4TQ0A 2LXCA 4IUMB 4EEWA 3H9DA 4EZKA 1X1MA 1YD8U 2LVQA 3DCGA 2CKHB 2RD0A 4I6PA 3R7RA 4ANVA 1WE6A 1H4RA 2DZJA 2K6QA 4W9GA 1BT0A 3TIXA 1Q0WB 5L83A 2FCNA 2LJ5A 3TJPA 2BKRB 4DDGD 3HHMA 3SU8X 3P2BA 4KIKA 3H7PA 2LUEA 3VTUA 2KN5A 3APDA 4MGYE 5J17A 2K6DB 2MA9B 1Z5SB 3KVFB 4KDIC 3OLMD 2J0JA 3GZNI 1A5RA 1WZ3A 4I6LB 2AYOB 2L7RA 3JSVB 3VVWB 1E5WA 2KO3A 3WIMA 4NY0A 3WALA 2A4ZA 2DZMA 4HPMB 4IG7B 4J6IA 5JH5C 2WWZA 2M8SA 2ZPNA 3L13A 2WX0A 1NBFC 3H7PB 2MWSB 4KIKB 2EKEC 4PYUA 2BYEA 4A3PA 3PLVA 3A33B 2MW5A 2KFKA 2ZNVB 5E6OA 1J8CA 2FUHB 4BOSC 2XBBC 2HE7A 2D11A 4LCDE 2MX2A 2BYVE 5AZFA 3DQVA 3AU4A 3NHEB 2MLBA 2G45B 3IHPC 4HVBA 3CSTA 1I42A 5D2MB 1WM3A 3IBEA 3PT2B 2KJ6A 4AJYB 2IY0B 4DHZE 2UWQA 2ZVNA 2L05A 1Q1OA 4EUTA 4WJQA 2N9XA 2NCNA 3A9JA 2M0XA 3PHWB 1H8CA 3GOEA 1ZKHA 2FCSA 1E8YA 3SHQA 1SGHA 2KD0A 1OGWA 2MP2A 1SIFA 2KXJA 3U7DA 1GUAB 1T0YA 1WE7A 4IWQA 3ZNGC 2CHXA 3BINA 1WGYA 3A9JB 4JLCA 4BKTA 3DVGX 2DENB 3ZNZB 2KC2A 2LRUA 3RYTA 3VH3B 2KX0A 2OJRA 3K9OB 5D7GA 1RFAA 1RRBA 2DHZA 3QA8A 3X23A 5CHFA 2FAZA 2D07B 4MH0E 4NJ6A 4WWNA 2I1JA 3IVFA 3JYUA 2W9NA 2AL3A 2WDTB 4N9F4 4W9IA 3PTFC 2FIDA 4ICVA 4FN2A 4DDID 3RCZA 4GU2A 2O6VA 1Q5WB 4MJSB 3VUYA 1WMHA 4M8MA 1OEYJ 1CMXB 1R4NI 2D10A 5LLIA 3RT3B 4FBJB 3W1SC 2KTFA 4GN1A 3PGEA 5J2RA 1V9JA 1GNUA 3SD5A 5IA7A 2O6VB 4GSWA 3HK0A 5L95C 1WJ6A 1C1YB 3R7QA 3ECIA 1V80A 4B95A 3DDCB 3PREA 2IO2B 2FCMA 2G3QB 2KMCA 2JRHA 2LXAA 2CHWA 4KVGB 3VH4B 2JXXA 2DYMA 4IM0A 2MRPA 2PE6B 1WGGA 1EF1A 3B1LX 3B0AA 1P1AA 3H6NA 2AL6A 2GBJA 3AXCA 4W9KA 4TKNA 1P0RA 4W9FA 3ZRCA 5GMVA 4ZDVA 1WGRA 2C60A 1V5OA 2NR2A 2ZNVC 3DOWA 4A20A 1AARA 3QIJA 4HCPB 2AEHA 2C7HA 5AZHA 2IZVB 2EMTA 1S3SG 4W9EA 1WR6E 2IYDB 2V3SA 4CYEA 1WYWB 3R3MA 3VTWA 3X0WA 3M63B 4DBGA 1E90A 5AEKB 3LDZE 4W9HA 2AWTA 2MBBB 1GG3A 2C9WB 4HK2A 3APFA 3HM6X 4LDTB 1GC6A 5G2NA 3AI5A 4E71A 4AJWA 1MG8A 3O65B 2G4DB 1UELA 5CHVC 3HIZA 4IW0A 3RULA 3SDLC 4ANUA 3PRZA 2G4SA 3C0RB 2KNBA 1PQSA 3QQ8B 2LVOA 1UBQA 1TTNA 3VAWA 2LGDA 2KDBA 3UIPB 4DHZB 3JSVA 1V2YA 1QZEA 2L0TA 2LI5A 3BY4B 3T8MA 3VFKA 3KYDD 2IY1B 2RGFA 1L7YA 4WJNA 4CHKA 5TR5A 2K8CA 1J0GA 1EO6A 3OAWA 4AP4C 2BPSA 3VXWA 3EC8A 3PV1A 4FJVB 2O6VD 4XX5A 4EFOA 3KYCD 1I35A 3PHXB 4MM3A 2XK5A 4XZ4A 3ZTDA 1KLVA 2GBRA 4X57B 2MSED 4RMAA 2JUOA 1JRUA 3M62B 1KOTA 1V86A 1OEYA 2V4LA 4BKGA 3QAQA 4FJYA 4A3OA 2R2QA 4EOYA 3NS8A 2IO3B 4LJOB 2DZIA 4KSKC 2XK5B 4MDKE 4AWJA 2L8JA 4G0NB 2R2OA 3B08A 2L3ZA 4K7SA 3EHVA 3VUXA 3A4RA 4B6WA 2KWCA 5JHBA 4FULA 1GC7A 1TBEA 1V81A 2JPHA 2KOXA 4HJKA 4LJPB 2MCNB 1WR1A 3ENEA 1P98A 1J19A 1E7UA 2BWES 4KV2A 2CS4A 5DCNA 4EKUA 5LXIB 4KDLB 2ZJDA 1WX8A 2QHOA 4W9CA 3QJZA 2LGYA 4LDTD 2J0KA 3LJ3A 4EZLA 3EECA 1UBIA 3L54A 3WAOA 2MBEA 3PSEB 5LXHA 2KJHB 3RZFA 3AU5A 3VUWA 2C7NB 3VDZA 5BO4B 3APCA 4FJZA 5IAAC 4K81A 4MJSA 4W9JA 4DXAB 2KZRA 3L17A 3N30A 3T9LA 4JGHB 1WXMA 2C5LC 2KDEB 3Q3FA 4IWPA 2K39A 3A4SC 2K1FA 3KUZA 5FR6A 3L0WB 1YQBA 1M94A 4K1RB 1IPGA 2N7DA 1UGMA 4NJ7A 1G6JA 1NDDA 2C7MB 3ONSA 1ZGUB 4OVUA 1Y8RC 4IC7B 4TUUA 5C1ZA 3PVLA 3N32A 4GDLA 1KM7A 3ML8A 5KHOA 3RUIB 1GJZA 3QK0A 2KMAA 3QHTA 1LFDA 1WFYA 1Z2MA 2I1KA 2KJRA 4FHKA 4ANWA 3JW0X 3NZSA 1WGHA 3V6EB 3OJ4B 3KW5B 3K9PB 3H1UA 4DHJD 1WM2A 1EF5A 4MGZE 4DK5A 3UQAA 2ASQA 2PPHA 4GDLB 1OQYA 2NBVB 2DYBA 2JZZA 2N1VA 4FA6A 1YIWA 2DYOA 3ZDMC 2BGFA 4GOCA 1YJ1A 3V6CB 1RLFA 1SE9A 2JRIB 4W9LA 4E3CA 4HPLB 2VRRB 1NI2A 1LM8B 2N7EA 4FHJA 2JF5A 2JY6A 4BBNC 3A1QA 2YLMA 3IFWB 4GDKA 2BWFA 5G55A 5CTRC 2KLGA 3WAMA 2D3GA 1P9DU 3ZUNA 4IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBU A;  3IG3 A;  1VCB A;  3RD2 A;  2D2Q A;  3DBL I;  3ZO5 B;  1ZW7 A;  5JHA A;  4NQK E;  1HE8 A;  3A1Q B;  1E8W A;  2KQ7 A;  4GDK B;  4GMV A;  3VHT C;  3ZVV A;  2LAS A;  3VQI A;  1R4M I;  4HWI B;  4MSQ B;  2GBK A;  5KHQ A;  1XT9 B;  4NPN A;  3W1Y A;  1WRD B;  2BF8 B;  3D32 A;  1WXS A;  2L00 B;  2L0F A;  4YL8 A;  4CO7 A;  3ZKJ C;  1L2N A;  2GBM A;  2WYQ A;  4ZRJ A;  2CR5 A;  1WI0 A;  1WGD A;  2LRW A;  4BOZ B;  5C23 A;  5CHW A;  1E8Z A;  4K7W A;  1WH3 A;  1YX6 B;  1KJT A;  4F1S A;  2KX3 A;  4F8C B;  3A9K A;  1WY8 A;  2M17 A;  2Z0D B;  3CF6 E;  4MGK E;  4BVU C;  3UIN B;  5DPS A;  3UIO B;  3TL5 A;  2N9E B;  2REX A;  3PRP B;  2A5U A;  2KLC A;  1YX5 B;  2HJ8 A;  4B9K A;  1WJU A;  2J7Q B;  4IM3 A;  3KUD B;  4TQ1 A;  2DAJ A;  1P3Q U;  2B3A A;  2ZCC A;  3NOB A;  2ZZP B;  3A9K B;  4NQL B;  3U8Z A;  3I3T B;  2DAF A;  1WZ0 A;  4WWO A;  2M1M A;  2K25 A;  3M3J A;  2KVR A;  4G3X B;  4WAA A;  5E6P A;  2KDI A;  3HM3 A;  4NAW A;  3V62 A;  3DBR I;  3L16 A;  3ZTC A;  4URK A;  1VD2 A;  3CMM B;  2KWV B;  1LQB A;  2ZEQ A;  1IP9 A;  3QAR A;  1XD3 B;  4JQW C;  3WA0 A;  1F9J A;  2BKF A;  2EMS A;  3L08 A;  4HLE A;  5HKH A;  2K8B A;  4DHJ B;  3WAP A;  4DWF A;  3ZNI D;  2NVU I;  2IO1 B;  4E74 A;  1UZX B;  3PS6 A;  2LZ6 A;  4NAW B;  3UF8 A;  4GXB A;  4BKS D;  2Y5B B;  4PS8 A;  4ASW C;  3DBH I;  3ZDT A;  1V49 A;  2KAN A;  3V60 A;  4KSL C;  2LVP A;  2ZCB A;  2YVC A;  4KZC A;  2KWU B;  1S1Q B;  3MHS D;  5J18 A;  3UGB B;  3Q3J A;  5D6J B;  4HDQ A;  4MEL A;  3S2A A;  3V61 A;  2GMI C;  4RM8 A;  2JWZ A;  4WJP A;  4ICU A;  2BYF A;  3ZW3 A;  1UH6 A;  2K8H A;  3PRM B;  4PYZ A;  3TCA A;  2KFK B;  4F7Z A;  2RR9 A;  4II3 B;  3ZLZ A;  2Z0E B;  2N1W A;  3QC8 B;  2NS5 A;  3DVN U;  3DPD A;  4AUQ C;  4K7U A;  2CU1 A;  3QCA A;  4WWP A;  2RPQ A;  1E7V A;  4WJO A;  5CX3 A;  3VTV A;  3R66 C;  2DX5 B;  4JIO U;  3UQB A;  3ALB A;  5DPW A;  2KC1 A;  2OOB B;  4G50 A;  4MEM A;  1IYF A;  4BBN F;  2N9P C;  2RSU A;  4GB9 A;  2PE9 A;  1WXV A;  1E8X A;  3EFU A;  3PPA A;  1WX9 A;  2PEA A;  3ML9 A;  5EDS A;  2MBH A;  1WJ4 A;  4ZRK A;  2MP2 B;  4HDO A;  3DVG Y;  2KDF B;  4BFR A;  1TGZ B;  1RAX A;  4I6N B;  4PS7 A;  5D94 A;  3KUC B;  2MBQ A;  3M95 A;  4NNJ B;  1K8R B;  1WF9 A;  2PJH A;  2XEW A;  2IO0 B;  5DPR A;  4GIV A;  2CHZ A;  2NBW B;  2JVC A;  1WJN A;  5DPT A;  2KTR A;  2O2V A;  4KZ0 A;  4BKS A;  1XQQ A;  2JT4 B;  3PLU A;  4M8N A;  1C3T A;  3MTN B;  3N3K B;  1ISN A;  2NPT A;  2L76 A;  3JVZ X;  2KHW B;  2MBO A;  3NZU A;  2JZ3 B;  3ZNH B;  5E6N A;  1V6E A;  4ZYN A;  2KTR B;  2O2V B;  1WMH B;  2GOW A;  1TZ1 A;  3DVN V;  3PZD A;  3OJ3 A;  4MGI E;  4II2 B;  1U4A A;  2NPT B;  4ZRI A;  2FIF A;  4MSM B;  2DZK A;  2LWP A;  2ZVO A;  3TMP B;  4G11 A;  4JL9 A;  1D3Z A;  4EZJ A;  2IBI B;  3AUL A;  1V5T A;  4IWO A;  2FNJ B;  2KK8 A;  3QWZ B;  4XC2 A;  3KH0 A;  2GBN A;  4AOF A;  1WIA A;  3WAN A;  3ZRF A;  2FCQ A;  4GGQ A;  2V1Y A;  4RM9 A;  4OVV A;  4TV3 A;  2MQJ A;  2HD5 B;  5JZE B;  3QX1 A;  2WX1 A;  3L10 B;  2ZPY A;  3RZW C;  3H7S A;  2LGX A;  4FLH A;  1WX7 A;  4P7I A;  1FXT B;  3DBS A;  1EUV B;  4HCN B;  2HTH A;  3CSF A;  4WQO B;  4PS3 A;  3MJW A;  5AZG A;  2KFJ A;  1WXA A;  4HXD A;  4M0W B;  1OTR B;  2KQS A;  3ZIM A;  4FAD A;  4ANX A;  3NY5 A;  4W9D A;  1LXD A;  3U30 A;  3TBL D;  3W1S A;  2J0M A;  2LD9 A;  2Z59 B;  1UD7 A;  2N4F A;  2KKC A;  2UYZ B;  2M4N A;  4TQ0 A;  2LXC A;  4IUM B;  4EEW A;  3H9D A;  4EZK A;  1X1M A;  1YD8 U;  2LVQ A;  3DCG A;  2CKH B;  2RD0 A;  4I6P A;  3R7R A;  4ANV A;  1WE6 A;  1H4R A;  2DZJ A;  2K6Q A;  4W9G A;  1BT0 A;  3TIX A;  1Q0W B;  5L83 A;  2FCN A;  2LJ5 A;  3TJP A;  2BKR B;  4DDG D;  3HHM A;  3SU8 X;  3P2B A;  4KIK A;  3H7P A;  2LUE A;  3VTU A;  2KN5 A;  3APD A;  4MGY E;  5J17 A;  2K6D B;  2MA9 B;  1Z5S B;  3KVF B;  4KDI C;  3OLM D;  2J0J A;  3GZN I;  1A5R A;  1WZ3 A;  4I6L B;  2AYO B;  2L7R A;  3JSV B;  3VVW B;  1E5W A;  2KO3 A;  3WIM A;  4NY0 A;  3WAL A;  2A4Z A;  2DZM A;  4HPM B;  4IG7 B;  4J6I A;  5JH5 C;  2WWZ A;  2M8S A;  2ZPN A;  3L13 A;  2WX0 A;  1NBF C;  3H7P B;  2MWS B;  4KIK B;  2EKE C;  4PYU A;  2BYE A;  4A3P A;  3PLV A;  3A33 B;  2MW5 A;  2KFK A;  2ZNV B;  5E6O A;  1J8C A;  2FUH B;  4BOS C;  2XBB C;  2HE7 A;  2D11 A;  4LCD E;  2MX2 A;  2BYV E;  5AZF A;  3DQV A;  3AU4 A;  3NHE B;  2MLB A;  2G45 B;  3IHP C;  4HVB A;  3CST A;  1I42 A;  5D2M B;  1WM3 A;  3IBE A;  3PT2 B;  2KJ6 A;  4AJY B;  2IY0 B;  4DHZ E;  2UWQ A;  2ZVN A;  2L05 A;  1Q1O A;  4EUT A;  4WJQ A;  2N9X A;  2NCN A;  3A9J A;  2M0X A;  3PHW B;  1H8C A;  3GOE A;  1ZKH A;  2FCS A;  1E8Y A;  3SHQ A;  1SGH A;  2KD0 A;  1OGW A;  2MP2 A;  1SIF A;  2KXJ A;  3U7D A;  1GUA B;  1T0Y A;  1WE7 A;  4IWQ A;  3ZNG C;  2CHX A;  3BIN A;  1WGY A;  3A9J B;  4JLC A;  4BKT A;  3DVG X;  2DEN B;  3ZNZ B;  2KC2 A;  2LRU A;  3RYT A;  3VH3 B;  2KX0 A;  2OJR A;  3K9O B;  5D7G A;  1RFA A;  1RRB A;  2DHZ A;  3QA8 A;  3X23 A;  5CHF A;  2FAZ A;  2D07 B;  4MH0 E;  4NJ6 A;  4WWN A;  2I1J A;  3IVF A;  3JYU A;  2W9N A;  2AL3 A;  2WDT B;  4N9F 4;  4W9I A;  3PTF C;  2FID A;  4ICV A;  4FN2 A;  4DDI D;  3RCZ A;  4GU2 A;  2O6V A;  1Q5W B;  4MJS B;  3VUY A;  1WMH A;  4M8M A;  1OEY J;  1CMX B;  1R4N I;  2D10 A;  5LLI A;  3RT3 B;  4FBJ B;  3W1S C;  2KTF A;  4GN1 A;  3PGE A;  5J2R A;  1V9J A;  1GNU A;  3SD5 A;  5IA7 A;  2O6V B;  4GSW A;  3HK0 A;  5L95 C;  1WJ6 A;  1C1Y B;  3R7Q A;  3ECI A;  1V80 A;  4B95 A;  3DDC B;  3PRE A;  2IO2 B;  2FCM A;  2G3Q B;  2KMC A;  2JRH A;  2LXA A;  2CHW A;  4KVG B;  3VH4 B;  2JXX A;  2DYM A;  4IM0 A;  2MRP A;  2PE6 B;  1WGG A;  1EF1 A;  3B1L X;  3B0A A;  1P1A A;  3H6N A;  2AL6 A;  2GBJ A;  3AXC A;  4W9K A;  4TKN A;  1P0R A;  4W9F A;  3ZRC A;  5GMV A;  4ZDV A;  1WGR A;  2C60 A;  1V5O A;  2NR2 A;  2ZNV C;  3DOW A;  4A20 A;  1AAR A;  3QIJ A;  4HCP B;  2AEH A;  2C7H A;  5AZH A;  2IZV B;  2EMT A;  1S3S G;  4W9E A;  1WR6 E;  2IYD B;  2V3S A;  4CYE A;  1WYW B;  3R3M A;  3VTW A;  3X0W A;  3M63 B;  4DBG A;  1E90 A;  5AEK B;  3LDZ E;  4W9H A;  2AWT A;  2MBB B;  1GG3 A;  2C9W B;  4HK2 A;  3APF A;  3HM6 X;  4LDT B;  1GC6 A;  5G2N A;  3AI5 A;  4E71 A;  4AJW A;  1MG8 A;  3O65 B;  2G4D B;  1UEL A;  5CHV C;  3HIZ A;  4IW0 A;  3RUL A;  3SDL C;  4ANU A;  3PRZ A;  2G4S A;  3C0R B;  2KNB A;  1PQS A;  3QQ8 B;  2LVO A;  1UBQ A;  1TTN A;  3VAW A;  2LGD A;  2KDB A;  3UIP B;  4DHZ B;  3JSV A;  1V2Y A;  1QZE A;  2L0T A;  2LI5 A;  3BY4 B;  3T8M A;  3VFK A;  3KYD D;  2IY1 B;  2RGF A;  1L7Y A;  4WJN A;  4CHK A;  5TR5 A;  2K8C A;  1J0G A;  1EO6 A;  3OAW A;  4AP4 C;  2BPS A;  3VXW A;  3EC8 A;  3PV1 A;  4FJV B;  2O6V D;  4XX5 A;  4EFO A;  3KYC D;  1I35 A;  3PHX B;  4MM3 A;  2XK5 A;  4XZ4 A;  3ZTD A;  1KLV A;  2GBR A;  4X57 B;  2MSE D;  4RMA A;  2JUO A;  1JRU A;  3M62 B;  1KOT A;  1V86 A;  1OEY A;  2V4L A;  4BKG A;  3QAQ A;  4FJY A;  4A3O A;  2R2Q A;  4EOY A;  3NS8 A;  2IO3 B;  4LJO B;  2DZI A;  4KSK C;  2XK5 B;  4MDK E;  4AWJ A;  2L8J A;  4G0N B;  2R2O A;  3B08 A;  2L3Z A;  4K7S A;  3EHV A;  3VUX A;  3A4R A;  4B6W A;  2KWC A;  5JHB A;  4FUL A;  1GC7 A;  1TBE A;  1V81 A;  2JPH A;  2KOX A;  4HJK A;  4LJP B;  2MCN B;  1WR1 A;  3ENE A;  1P98 A;  1J19 A;  1E7U A;  2BWE S;  4KV2 A;  2CS4 A;  5DCN A;  4EKU A;  5LXI B;  4KDL B;  2ZJD A;  1WX8 A;  2QHO A;  4W9C A;  3QJZ A;  2LGY A;  4LDT D;  2J0K A;  3LJ3 A;  4EZL A;  3EEC A;  1UBI A;  3L54 A;  3WAO A;  2MBE A;  3PSE B;  5LXH A;  2KJH B;  3RZF A;  3AU5 A;  3VUW A;  2C7N B;  3VDZ A;  5BO4 B;  3APC A;  4FJZ A;  5IAA C;  4K81 A;  4MJS A;  4W9J A;  4DXA B;  2KZR A;  3L17 A;  3N30 A;  3T9L A;  4JGH B;  1WXM A;  2C5L C;  2KDE B;  3Q3F A;  4IWP A;  2K39 A;  3A4S C;  2K1F A;  3KUZ A;  5FR6 A;  3L0W B;  1YQB A;  1M94 A;  4K1R B;  1IPG A;  2N7D A;  1UGM A;  4NJ7 A;  1G6J A;  1NDD A;  2C7M B;  3ONS A;  1ZGU B;  4OVU A;  1Y8R C;  4IC7 B;  4TUU A;  5C1Z A;  3PVL A;  3N32 A;  4GDL A;  1KM7 A;  3ML8 A;  5KHO A;  3RUI B;  1GJZ A;  3QK0 A;  2KMA A;  3QHT A;  1LFD A;  1WFY A;  1Z2M A;  2I1K A;  2KJR A;  4FHK A;  4ANW A;  3JW0 X;  3NZS A;  1WGH A;  3V6E B;  3OJ4 B;  3KW5 B;  3K9P B;  3H1U A;  4DHJ D;  1WM2 A;  1EF5 A;  4MGZ E;  4DK5 A;  3UQA A;  2ASQ A;  2PPH A;  4GDL B;  1OQY A;  2NBV B;  2DYB A;  2JZZ A;  2N1V A;  4FA6 A;  1YIW A;  2DYO A;  3ZDM C;  2BGF A;  4GOC A;  1YJ1 A;  3V6C B;  1RLF A;  1SE9 A;  2JRI B;  4W9L A;  4E3C A;  4HPL B;  2VRR B;  1NI2 A;  1LM8 B;  2N7E A;  4FHJ A;  2JF5 A;  2JY6 A;  4BBN C;  3A1Q A;  2YLM A;  3IFW B;  4GDK A;  2BWF A;  5G55 A;  5CTR C;  2KLG A;  3WAM A;  2D3G A;  1P9D U;  3ZUN A;  4IM2 A; 
#chains in the Genus database with same CATH topology
 2JYT A;  3RD2 A;  1N5W A;  2D2Q A;  1QKZ A;  2PTL A;  1R4M B;  5JHA A;  4UDU C;  4NQK E;  3ZVV A;  3BVZ A;  2K5P A;  1R4M I;  1MHH E;  1XT9 B;  2BF8 B;  3RNG C;  1WXS A;  1K53 A;  2D5G A;  4BOZ B;  5C23 A;  1OQQ A;  3MFG A;  1WH3 A;  2DLB A;  2KX3 A;  4YTN B;  3A9K A;  2M17 A;  3PRP B;  3ZYY X;  5C3J B;  2HJ8 A;  4B9K A;  1WJU A;  3C8Y A;  4TQ1 A;  1FFV A;  2B3A A;  1TIF A;  4KKI A;  4B0E A;  4NQL B;  4YTP B;  2DAF A;  3ZJT A;  1D5M C;  2M1M A;  2KVR A;  1KTK A;  1XF5 L;  4NAW A;  1VD2 A;  1QOA A;  1FM0 D;  2ZEQ A;  3WA0 A;  3L08 A;  5HKH A;  1TS2 A;  1VR9 A;  2IO1 B;  4E74 A;  1MVK A;  1UZX B;  3DWM A;  3PS6 A;  3DBH B;  2IPK D;  4RGO S;  1HZ5 A;  2Y5B B;  4ASW C;  3DBH I;  3AED B;  2LVP A;  2ACZ B;  3VR9 B;  1QLB B;  4MEL A;  3V61 A;  5IOI A;  5H92 C;  4F7Z A;  1LO5 D;  3TCA A;  2KFK B;  2OJW A;  4II3 B;  2Z0E B;  2MJ3 A;  5FR3 A;  3GE8 C;  2NS5 A;  3QC8 B;  3DVN U;  4M01 A;  3NVZ A;  3HVD A;  4WJO A;  1JWU D;  4B0M A;  3UQB A;  5DPW A;  1XEE A;  1HTO A;  3NS1 A;  4JWS C;  1IYF A;  2N9P C;  1ACC A;  2Y5P A;  3EFU A;  5EDS A;  5D94 A;  2MBQ A;  4A9A A;  3AEC B;  5DPR A;  4GIV A;  4JX1 C;  1WJN A;  4BKS A;  3LXF A;  4KZ0 A;  4IOI E;  2IGD A;  3PLU A;  3PZ7 A;  1IGC A;  1ISN A;  1I4X A;  1ZXI A;  4BZA A;  2MBO A;  3BVG A;  2JZ3 B;  5E6N A;  1V6E A;  2O2V B;  2WXJ A;  3U4E G;  2WDR B;  3KLS X;  4II2 B;  2WS3 B;  1U4A A;  4JL9 A;  4M02 A;  4IWO A;  1V5T A;  3QWZ B;  3U2S C;  3GS2 A;  4C4V B;  3ZRF A;  4GGQ A;  2V1Y A;  3AEE B;  4M00 A;  2ZPY A;  3RZW C;  4P7I A;  1I4R A;  3DBS A;  2DBY A;  2HTH A;  4WQO B;  3MJW A;  3DWG C;  2FBW B;  1EWC A;  2KQS A;  4FAD A;  3AE1 B;  4ANX A;  4RGM A;  5BMI A;  3TBL D;  1UD7 A;  2N4F A;  1YNT E;  1EU4 A;  2WXK A;  2JXT A;  5I4D A;  2J4X A;  2LXC A;  4IUM B;  1HZ6 A;  3H9D A;  3R7R A;  1WE6 A;  3KWL A;  2DZJ A;  4JE3 B;  4US8 A;  2ON8 A;  1WSP A;  1SE4 A;  1Q0W B;  3WCQ A;  4DDG D;  2BKR B;  3HHM A;  3SU8 X;  4KIK A;  5J17 A;  1F2R I;  1WZ3 A;  3T3N A;  2W54 A;  2B76 B;  4JWU C;  1WXQ A;  1NBF C;  2WXI A;  4RGT A;  4A3P A;  1KLU D;  5EE9 A;  5E6O A;  2HE7 A;  2D11 A;  2WU5 B;  2BYV E;  3Q69 A;  4P16 A;  2MLB A;  2IDY A;  3I5J C;  3CST A;  4HVB A;  5D2M B;  1UNS A;  1JAL A;  4REZ A;  2L05 A;  1UUP A;  4EUT A;  4WJQ A;  3E9S A;  3PHW B;  4PT5 A;  1H8C A;  1KF6 B;  4ARI A;  2FCS A;  5D3I B;  2MP2 A;  1SIF A;  1XLP A;  2W3R A;  4BKT A;  1WGY A;  3A9J B;  1TS3 A;  4KGT A;  2DEN B;  1T0Q C;  3ZNZ B;  1RFA A;  3QA8 A;  2MHJ A;  1T5X D;  2FAZ A;  4NJ6 A;  2TSS A;  4WWN A;  2I1J A;  2WDT B;  2FID A;  4ICV A;  1LGR A;  4MJS B;  3VUY A;  3Q2A C;  1ZPS A;  2KTF A;  3PGE A;  5IA7 A;  5BMG A;  1I4G A;  3MHZ A;  3Q3N C;  2O6V B;  2YEP B;  2KMC A;  4KVG B;  1VZ7 A;  2DYM A;  2MRP A;  5D3D A;  3AXC A;  4W9K A;  3AMZ A;  4W9F A;  2LFI A;  2NR2 A;  1V5O A;  2ZNV C;  2LJI A;  3QIJ A;  4HCP B;  2AEH A;  1S3S G;  2V3S A;  5IO9 A;  4DBG A;  4HK2 A;  2YEP F;  4AJW A;  1ZE3 D;  4XE0 A;  3O13 A;  2LVO A;  3VAW A;  2KT7 A;  4DHZ B;  3JSV A;  2LEK A;  3I57 A;  4CHK A;  2GB1 A;  1EO6 A;  2BPS A;  3SFE B;  2N9L A;  1PUT A;  5TSS A;  4MM3 A;  4XZ4 A;  4X57 B;  4Q2J A;  2JUO A;  4HKQ A;  1OEY A;  3NVY A;  4BKG A;  3RNF C;  1EU3 A;  4WWM A;  2XK5 B;  1L6V A;  2L8J A;  4K7S A;  4HKZ E;  2ZW0 A;  3A4R A;  2HDE A;  5JHB A;  1GC7 A;  4HJK A;  2MCN B;  1WR1 A;  2BWE S;  2OED A;  2WGS A;  4KDL B;  2D3B A;  1WX8 A;  1TKE A;  3Q8E A;  4LDT D;  1AW7 A;  3EEC A;  3L54 A;  5LXH A;  2XNA C;  3VDZ A;  3APC A;  4FJZ A;  2INP E;  4K81 A;  5BYQ A;  1BUI C;  3TEY A;  3L17 A;  4K3C A;  2C5L C;  3B9J A;  4IWP A;  2K39 A;  3RI7 C;  1VZ8 A;  2WXL A;  1HQR D;  4NJ7 A;  2LUM A;  5IP4 D;  1NDD A;  1VLB A;  4ACF A;  3N32 A;  1KM7 A;  2BS3 B;  5KHO A;  3RUI B;  5HG2 A;  1LFD A;  4DXG A;  3NZS A;  4YT0 B;  3V6E B;  3KW5 B;  3H1U A;  4DK5 A;  2PPH A;  4GDL B;  4ZOH C;  2JZZ A;  3AEB B;  3ZDM C;  2BGF A;  3V6C B;  1RLF A;  1SE9 A;  1KRH A;  4FHJ A;  2N7E A;  4BBN C;  1MHX A;  3AE3 B;  3RPF C;  5G55 A;  2M19 A;  4PS8 A;  3ZO5 B;  1JRO A;  2KQ7 A;  4OZB A;  1SEB D;  1IGD A;  3W1Y A;  3HUI A;  1WRD B;  1K52 A;  4CO7 A;  2GBM A;  2WYQ A;  2CR5 A;  1WGD A;  5CHW A;  2RDH A;  1KJT A;  4ZHO A;  4F8C B;  3CF6 E;  4BVU C;  4MGK E;  3W5V B;  1C78 A;  4RH6 A;  5DPS A;  3TL5 A;  2N9E B;  3N1X C;  2ZCC A;  1GB4 A;  3U8Z A;  2QSD A;  4WWO A;  3DBR B;  2K25 A;  3M3J A;  1XCQ L;  2KDI A;  3V62 A;  3DBR I;  1I4H A;  2KWV B;  1LQB A;  4L2Y A;  3P63 A;  1T3Q A;  1XD3 B;  3QAR A;  4JQW C;  1F9J A;  3WAP A;  4MT5 A;  2JSV X;  2SAK A;  1R7S A;  2LZ6 A;  4BKS D;  3J9C A;  2YVC A;  1RFK A;  2KWU B;  1S1Q B;  3MHS D;  3UGB B;  5D6J B;  4XDD A;  4HDQ A;  4TMA B;  2G1E A;  4OZA A;  3RNA C;  2GMI C;  2ONQ A;  1SJH D;  2H88 B;  2JWZ A;  4WJP A;  3ZW3 A;  1UF0 A;  1C9F A;  2N1W A;  3DPD A;  4K7U A;  5C2T B;  2BT6 A;  2RPQ A;  3BZD B;  1C4P A;  1N61 A;  3NUH B;  5HFY A;  5CX3 A;  3VTV A;  3R2T A;  3R66 C;  3ALB A;  4DXF A;  1ZP0 B;  3UI3 A;  4BBN F;  2RSU A;  1TT5 B;  3PPA A;  2PEA A;  3ML9 A;  1QOG A;  4ZRK A;  4DQO C;  2KDF B;  1TGZ B;  4I6N B;  2BVC A;  3M95 A;  1K8R B;  2NBW B;  2O2V A;  1L0V B;  1XQQ A;  4M8N A;  3W5U B;  3MTN B;  3N3K B;  2L76 A;  3JVZ X;  2SEB D;  3ZNH B;  4C56 C;  1VDV A;  3DVN V;  3PZD A;  3PO0 A;  4RNA A;  2JQR B;  1P7F A;  3E56 A;  2FIF A;  1J7C A;  2LWP A;  4G11 A;  4EZJ A;  3VRB B;  2KK8 A;  3MC9 A;  2G9H D;  4XGA B;  4WUR A;  2WXP A;  3ZQ4 A;  4RM9 A;  2HD5 B;  5JZE B;  1D5Z C;  5EE3 A;  2WX1 A;  3BVM A;  1WX7 A;  3ABV B;  1FXT B;  1N62 A;  4HCN B;  5T8I A;  4YSZ B;  5AZG A;  3ZIM A;  1OTR B;  3U30 A;  2LD9 A;  2KKC A;  1F0Z A;  4TQ0 A;  4EZK A;  3AE9 B;  2RD0 A;  4I6P A;  1VZ6 A;  1H4R A;  2BS2 B;  3TIX A;  2FCN A;  2LJ5 A;  5FK9 C;  3BK1 A;  4ZRQ A;  3TJP A;  3VTU A;  2KAC A;  2LMC A;  4MAC A;  2MA9 B;  1Z5S B;  3OLM D;  4ZHP A;  3WIM A;  2KO3 A;  2QJL A;  3ZJU A;  4NY0 A;  2M0A A;  4J6I A;  5JH5 C;  2ZPN A;  4PYU A;  2NTS A;  2PW9 A;  1E0Z A;  1TKG A;  2W55 A;  3DQV A;  3AU4 A;  2IGH A;  3NJT A;  3V05 A;  1HXY D;  1WM3 A;  3IBE A;  2IY0 B;  3A9J A;  1EWY C;  3B2G A;  1ZKH A;  4HPP A;  1JWB D;  1OGW A;  2KXJ A;  3BII D;  3EUB 2;  2CHX A;  3LYY A;  3P1M A;  3IAM 1;  2KC2 A;  3RYT A;  4AS1 A;  3AEF B;  3IAS 1;  2OJR A;  3K9O B;  1KLG D;  4QAY A;  2V0G A;  4S17 A;  3X23 A;  1XLN A;  1C4A A;  1QOF A;  4C80 A;  2O6V A;  1Q5W B;  1V1O A;  1WMH A;  2N7J A;  2X8X X;  2ZW1 A;  4M8M A;  1OEY J;  1NEK B;  1UGJ A;  3RT3 B;  1CQV A;  4FBJ B;  3Q8C A;  2N9K A;  2K22 A;  1F2R C;  4GSW A;  5L95 C;  1WJ6 A;  1C1Y B;  3R7Q A;  4B95 A;  3DDC B;  3VH4 B;  2JXX A;  1FEH A;  3C19 A;  2I2Y A;  3H6N A;  2AL6 A;  4ITK A;  2GBJ A;  2L83 A;  3ZRC A;  5GMV A;  2R61 A;  4ZDV A;  1WGR A;  3DHI C;  3DOW A;  2W82 A;  4P1C C;  2C7H A;  5AZH A;  2IZV B;  2EMT A;  2QIE B;  4W9E A;  4CYE A;  1L5P A;  3X0W A;  2WXF A;  4YTM B;  1TY2 A;  4OW0 A;  4WQM A;  3LDZ E;  5G2N A;  4LDT B;  2C9W B;  3SEB A;  4E71 A;  1MG8 A;  3O65 B;  2LHE A;  2G4D B;  1UEL A;  5CHV C;  1WYG A;  3SDL C;  4ANU A;  2VZK B;  2WXR A;  3PRZ A;  4LNI A;  3C0R B;  2KWD A;  5AUI A;  1UBQ A;  1TTN A;  2KDB A;  4A6Q A;  5FKA C;  1QZE A;  2LI5 A;  2IY1 B;  1L7Y A;  2BB6 A;  1V97 A;  4WJN A;  2JYE A;  1J0G A;  3PV1 A;  4EFO A;  4H2A A;  1KFY B;  2XK5 A;  2GBR A;  2MSE D;  1KOT A;  2JX5 A;  3W2D A;  3QAQ A;  1SF0 A;  2DZI A;  1SXT A;  1FXI A;  2VH2 A;  4MDK E;  4G0N B;  2L3Z A;  3EGR A;  3EHV A;  5BMH A;  2KWC A;  3IT4 B;  4FUL A;  2KOX A;  3Q6B A;  2JPH A;  3EA6 A;  1FCL A;  1P98 A;  1J19 A;  3TUO A;  5DCN A;  1Q10 A;  2RPV A;  2ZJD A;  4W9C A;  4XDC A;  3QJZ A;  2LGY A;  1T6B X;  3HVZ A;  1UBI A;  4O1N A;  3WAO A;  4XWT A;  3B2F A;  3PSE B;  2KJH B;  5G5H A;  1J7B A;  2KZR A;  2KDE B;  1XLO A;  3KUZ A;  1YQB A;  3NZ3 A;  2KAJ A;  2N7D A;  4EE2 A;  2LGS A;  1N6Z A;  2C7M B;  1ZGU B;  2K0P A;  4IC7 B;  4TUU A;  5C1Z A;  3PVL A;  2BQQ A;  4GDL A;  3QHT A;  1WFY A;  1Z2M A;  2I1K A;  2KJR A;  3VRA B;  1GB1 A;  5LNK 1;  1EF5 A;  4MGZ E;  1B9R A;  3UQA A;  1PGB A;  2N1V A;  1YJ1 A;  2EEL A;  2JRI B;  4W9L A;  4HPL B;  2YLM A;  4L23 A;  3AE8 B;  5CTR C;  2KLG A;  1ZXH A;  3IG3 A;  4WH4 A;  2UU7 A;  3ZXR A;  3EFC A;  1ZW7 A;  3A1Q B;  3VHT C;  2LAS A;  1CJE A;  1EM7 A;  3VQI A;  4HWI B;  4MSQ B;  5KHQ A;  4NPN A;  1PGX A;  1FMA D;  2L00 B;  3GP7 A;  2L0F A;  3ZJV A;  1L2N A;  1RM6 C;  4ZRJ A;  1WI0 A;  2Y5C A;  1UWX A;  2KYW A;  4YSY B;  1E8Z A;  4CQN A;  2DNF A;  1YX6 B;  2PVO D;  1WY8 A;  2Z0D B;  5E6J A;  1J7A A;  2CJO A;  2N0S B;  2A5U A;  2KLC A;  3BYY B;  2J7Q B;  2DAJ A;  1NVI D;  1FCC C;  3I3T B;  2I38 A;  5E6P A;  4G3X B;  3HM3 A;  1GPX A;  1RWS A;  3L16 A;  4P1B C;  2M56 B;  4HJG E;  1IP9 A;  1QQR A;  1FNV A;  2BKF A;  2K8B A;  4DHJ B;  4OVZ A;  2NMQ A;  2NVU I;  3UF8 A;  4GXB A;  1FNU A;  1JWS D;  1I4P A;  1B1Z A;  1V49 A;  3ZDT A;  3V60 A;  1SIJ A;  2WNM A;  4LTU A;  4WIP A;  5J18 A;  2V4I B;  1CZP A;  1A70 A;  3SFD B;  3S2A A;  4P6V F;  1N5X A;  2BYF A;  4LNO A;  4XWW A;  1UH6 A;  4PYZ A;  1SSN A;  4HRS A;  3RNC C;  2JU6 X;  2CU1 A;  3QCA A;  1L4D B;  1E7V A;  4NJC A;  3I63 C;  2OOB B;  4G50 A;  3CWI A;  3VR8 B;  4MEM A;  2QMT A;  3AN1 A;  2CJN A;  1WXV A;  1E8X A;  1FXA A;  1ET9 A;  1NYR A;  1WX9 A;  2MBH A;  2MP2 B;  2JZP A;  3KUC B;  4NNJ B;  1L0X B;  1C77 A;  1WF9 A;  3R8B A;  2CHZ A;  2JVC A;  3NVV A;  2J52 A;  5DPT A;  3NG0 A;  1C3T A;  4A55 A;  3N9Y C;  2PMV A;  1PFD A;  1ZUD 2;  2OHF A;  2KTR B;  1SE2 A;  2GOW A;  1GAQ B;  1TZ1 A;  3AE2 B;  5BYR A;  2NPT B;  4ZRI A;  2J53 A;  3TMP B;  2IBI B;  3BYT B;  1ENF A;  3AE5 B;  2FNJ B;  2BS4 B;  1WIA A;  3IXS A;  2FCQ A;  4TV3 A;  3QX1 A;  1TZO A;  3L10 B;  1YN5 A;  2FUG 1;  1SE3 A;  3CSF A;  2WLB A;  2CU3 A;  2KFJ A;  1WXA A;  4M0W B;  2WDQ B;  4USA A;  3NY5 A;  4W9D A;  2J0M A;  5MPO A;  2Z59 B;  2UYZ B;  1YQ3 B;  2L32 A;  1YD8 U;  2LVQ A;  4C7Z A;  2CKH B;  4ANV A;  4W9G A;  1BT0 A;  5L83 A;  2BW2 A;  3GZN B;  2LUE A;  3GE3 C;  3MC8 A;  3AV8 A;  1JCK B;  4MGY E;  1FRR A;  2K6D B;  1I7H A;  2HJ1 A;  2J0J A;  3GZN I;  1TJE A;  2KMM A;  1A5R A;  4I6L B;  2AYO B;  3JSV B;  3TSS A;  2AX5 A;  1E10 A;  3WAL A;  2A4Z A;  2DZM A;  2RMM A;  4IG7 B;  1BXT A;  2M8S A;  3H7P B;  2MWS B;  2Q5W D;  2EKE C;  2MW5 A;  2KFK A;  1J8C A;  2FUH B;  3P4S B;  4MM3 B;  4BOS C;  2XBB C;  2X38 A;  5AZF A;  3NHE B;  2G45 B;  3IHP C;  2WXG A;  3OG5 A;  3PZ8 A;  3PT2 B;  4AJY B;  4DHZ E;  2UWQ A;  1JQ4 A;  2ZVN A;  4LK0 M;  1Q1O A;  2NCN A;  3GOE A;  3FIL B;  1MG4 A;  3SHQ A;  2KD0 A;  3FKY A;  2H89 B;  3U7D A;  4N6E B;  1T0Y A;  1WE7 A;  4IWQ A;  3BIN A;  4JLC A;  1TS4 A;  2QEJ C;  1MJD A;  1RRB A;  2DHZ A;  5CHF A;  3AE6 B;  3IVF A;  2W9N A;  2KVZ A;  4N9F 4;  1T0R C;  1T0S C;  1NEN B;  3PTF C;  2INC C;  3RCZ A;  4GU2 A;  1R4N B;  2WXN A;  3AE7 B;  1R4N I;  5LLI A;  5BYS A;  1ZDV A;  2RDB C;  1FPY A;  3ETR A;  1FNW A;  3ECI A;  2DWQ A;  1V80 A;  1DGJ A;  4C4V A;  2G3Q B;  2LXA A;  2BYT A;  2JRH A;  2CHW A;  4IM0 A;  1I4Q A;  3B1L X;  4C00 A;  4TKN A;  1P0R A;  1FIQ A;  2Y3A A;  1ZOY B;  2JWU A;  4A20 A;  1QF6 A;  1JRP A;  1FD6 A;  1WYW B;  3R3M A;  3VTW A;  1QOB A;  5EE0 A;  2WU2 B;  1STE A;  2QC8 A;  4KGS A;  3GB1 A;  4W9H A;  2AWT A;  3OWE B;  3TEZ A;  1GC6 A;  3AI5 A;  1PYW D;  2IJ0 A;  3HIZ A;  4IW0 A;  3SR6 A;  2ICI A;  2RDG A;  2KNB A;  1PQS A;  2GRI A;  3UIP B;  3RN9 C;  1V2Y A;  3KQ4 A;  1NYQ A;  2L0T A;  3Q8A A;  3BY4 B;  3T8M A;  3VFK A;  3KYD D;  2RGF A;  5TR5 A;  2K8C A;  4BAX A;  1ZDX A;  3OAW A;  3VXW A;  4KX6 B;  1I35 A;  3ZTD A;  4RMA A;  2E3T A;  1JRU A;  3M62 B;  1N60 A;  4FJY A;  4YXD B;  2R2Q A;  2V9H A;  3NS8 A;  2IO3 B;  4LJO B;  4AWJ A;  2R2O A;  1WGK A;  3URY A;  2QCZ A;  1FO4 A;  4B6W A;  3NRZ A;  4A90 A;  1OQR A;  1V81 A;  1TBE A;  4LJP B;  4HEA 1;  3ENE A;  2HTM E;  3FC4 A;  4EKU A;  2J42 A;  1E6E B;  2BBC A;  2J0K A;  3LJ3 A;  4EZL A;  1L6U A;  3AH7 A;  3AU5 A;  3VUW A;  1DYQ A;  4HRO A;  5IAA C;  1KH0 A;  4MJS A;  3N30 A;  3BK2 A;  3A4S C;  1YN4 A;  1AYF A;  5FR6 A;  1M94 A;  4K1R B;  1IBX B;  3I9V 1;  3LB8 C;  1IPG A;  4LNN A;  4OVU A;  3ML8 A;  1AWD A;  1GJZ A;  2KMA A;  3P4P B;  4ANW A;  1QT9 A;  1YJJ A;  4WAF A;  4OHJ A;  2ASQ A;  4FA6 A;  1YIW A;  2DYO A;  4GOC A;  2V3N A;  4E3C A;  2VRR B;  1NI2 A;  2JF5 A;  3A1Q A;  3IFW B;  1UWM A;  1XLQ A;  1DOI A;  3DBL B;  4IM2 A;  3CIR B;  1YN3 A;  2NBU A;  1JWM D;  3ZGZ A;  1VCB A;  3DBL I;  3P4R B;  1V1P B;  1HE8 A;  4GMV A;  1E8W A;  4GDK B;  4FXC A;  2FE8 A;  1OFF A;  2GBK A;  3D32 A;  4YL8 A;  3ZKJ C;  3AM9 A;  4ARC A;  1TYG B;  2LRW A;  3DHH C;  4JPS A;  3AB5 A;  4K7W A;  3N20 C;  2QDF A;  4F1S A;  3UIN B;  3UIO B;  2REX A;  4LNK A;  4RFB A;  1YX5 B;  3TEX A;  1GOZ A;  1NI3 A;  4IM3 A;  3KUD B;  1P3Q U;  3NOB A;  2ZZP B;  3A9K B;  1WZ0 A;  1SB3 C;  4WAA A;  3RNB C;  3ZTC A;  4URK A;  4RF1 A;  2E6X A;  1P7E A;  3CMM B;  4OZC A;  2EMS A;  2WXM A;  4HLE A;  4DWF A;  3ZNI D;  2MJE A;  3U7Z A;  4NAW B;  2MEK A;  2KAN A;  3V3X A;  3MC0 B;  4KSL C;  2ZCB A;  4KZC A;  3Q3J A;  2WQY B;  4C7Y A;  1VJK A;  4RM8 A;  5JXV A;  4ICU A;  1HEZ E;  1XCT L;  2K8H A;  3PRM B;  1L0Y B;  5IKC M;  2RR9 A;  3ZLZ A;  4AUQ C;  1FFU A;  4WWP A;  2LGI A;  2DX5 B;  4JIO U;  2KC1 A;  2MJD A;  2EKI A;  4IKG A;  4ZRP A;  4GB9 A;  1XXG A;  2PE9 A;  1IUE A;  1K50 A;  1WJ4 A;  5HI1 A;  1WWT A;  4HDO A;  3DVG Y;  4BFR A;  3P42 A;  1RAX A;  4PS7 A;  3N1Z C;  3RFZ B;  2PKO A;  2PJH A;  2XEW A;  2IO0 B;  3BWU D;  3L4P A;  4LNF A;  1MPE A;  2KTR A;  2JT4 B;  2KDM A;  5G5G A;  2NPT A;  2KHW B;  2BB5 A;  3NZU A;  4RF0 A;  4ZYN A;  1N63 A;  1WMH B;  3Q14 C;  3OJ3 A;  4MGI E;  2GI9 A;  1E7P B;  3P4Q B;  4MSM B;  2DZK A;  2ZVO A;  2IND C;  1D3Z A;  3AUL A;  4KGR A;  3N1Y C;  4XC2 A;  3KH0 A;  1ESF A;  2GBN A;  4AOF A;  3WAN A;  4M0W A;  4OVV A;  2MQJ A;  4TSS A;  3H7S A;  2LGX A;  4FLH A;  2PVG C;  1EUV B;  1D6E C;  4PS3 A;  3KWV A;  4HXD A;  1HTQ A;  2PIA A;  1V8C A;  1LXD A;  1F77 A;  3W1S A;  2NTT A;  2XN9 C;  2M4N A;  4EEW A;  1X1M A;  3DCG A;  1TKY A;  2K6Q A;  1QIL A;  3P2B A;  3H7P A;  2KN5 A;  3W9C B;  2WDV B;  3APD A;  1SBB B;  5GXG B;  1C79 A;  4KDI C;  3KVF B;  1FRD A;  3AE4 B;  2W3S A;  3VVW B;  2L7R A;  1E5W A;  4AQ7 A;  1PGA A;  1ROE A;  1WRI A;  4HPM B;  3L13 A;  2WWZ A;  2AQ1 B;  4KIK B;  2WX0 A;  1L4Z B;  3H8H A;  2BYE A;  3PLV A;  3A33 B;  2AQ2 B;  2ZNV B;  3Q3O C;  4RCO A;  3RNE C;  4XYC A;  4LCD E;  3MP9 A;  2MX2 A;  2KN4 A;  3FIL A;  4A8X C;  3Q8B A;  1MFW A;  1I42 A;  2KJ6 A;  2D3A A;  2N9X A;  2M0X A;  1YMH E;  4N59 A;  1F1H A;  3NVW A;  3T3O A;  1JW9 D;  1YQ4 B;  1E8Y A;  1JML A;  1M4V A;  1SGH A;  2K3U A;  3TEW A;  1GUA B;  3ZNG C;  2BTE A;  3HRD D;  2VZK D;  3DVG X;  1TS5 A;  2LRU A;  3Q8F A;  3VH3 B;  4NZL B;  2KX0 A;  5D7G A;  4RGN A;  3AEG B;  1Y56 A;  2D07 B;  4MH0 E;  5EE1 A;  4LLG M;  3JYU A;  2AL3 A;  4W9I A;  4DDI D;  4FN2 A;  3U52 E;  1TY0 A;  1E9M A;  2Z8L A;  1SJE D;  1CMX B;  2D10 A;  3W1S C;  5J2R A;  3DHG C;  4GN1 A;  1V9J A;  1GNU A;  3SD5 A;  3MJ5 A;  3HK0 A;  1C76 A;  2WXH A;  3PRE A;  2IO2 B;  2FCM A;  2PE6 B;  1WGG A;  1EF1 A;  2QIL A;  3B0A A;  1P1A A;  4D2K A;  4GLS C;  4IDI A;  2C60 A;  3AEA B;  2INN E;  2D3C A;  3FAH A;  1AAR A;  1C4C A;  3Q3M C;  1WR6 E;  2IYD B;  4S0R A;  2KQ4 X;  4N58 A;  3M63 B;  5AEK B;  1E90 A;  2MBB B;  2K9X A;  1GG3 A;  3APF A;  1XO3 A;  3HM6 X;  4KKJ A;  1DOY A;  3RUL A;  2G4S A;  3QQ8 B;  2LGD A;  2WP9 B;  4AP4 C;  3EC8 A;  4FJV B;  2O6V D;  4XX5 A;  3KYC D;  2WHI A;  1AN8 A;  3PHX B;  1KLV A;  5IN7 A;  1V86 A;  3ZXV A;  2V4L A;  1HA5 A;  2V3P A;  2L52 A;  4A3O A;  5H8Y E;  4EOY A;  2PLP A;  2VH1 A;  2MH7 A;  4KSK C;  2IGG A;  1YJI A;  3B08 A;  1CK1 A;  3VUX A;  2WXQ A;  1BML C;  1E7U A;  4KV2 A;  2CS4 A;  5LXI B;  2QHO A;  1K51 A;  2MBE A;  2AQ3 B;  3RZF A;  4ZYS A;  1DOX A;  2C7N B;  5BO4 B;  1IBX A;  1D5X C;  4MH8 A;  4US9 A;  3IT6 B;  4W9J A;  4DXA B;  3T9L A;  4JGH B;  1WXM A;  2GLS A;  3Q3F A;  2L1A A;  1VRA B;  2K1F A;  4PK1 A;  3L0W B;  4L1B A;  4R3D A;  4K3B A;  4NAM A;  5AUK A;  4J3O D;  1UGM A;  1G6J A;  3ONS A;  1Y8R C;  1F52 A;  3R2I A;  3QK0 A;  1RYJ A;  1JWA D;  4FHK A;  4YSX B;  3JW0 X;  1WGH A;  3OJ4 B;  1D4B A;  3K9P B;  4DHJ D;  1WM2 A;  5HHD G;  1OQY A;  2NBV B;  2DYB A;  2WXO A;  1YOV B;  1LM8 B;  2JY6 A;  1V1P A;  4GDK A;  2LHD A;  2BWF A;  3RMK C;  1ET6 A;  3WAM A;  1PDX A;  2D3G A;  1P9D U;  1MI0 A;  4YWG G;  3ZUN A; 
#chains in the Genus database with same CATH homology
 2NBU A;  3IG3 A;  1VCB A;  3RD2 A;  2D2Q A;  3DBL I;  3ZO5 B;  1ZW7 A;  5JHA A;  4NQK E;  1HE8 A;  3A1Q B;  1E8W A;  2KQ7 A;  4GDK B;  4GMV A;  3VHT C;  3ZVV A;  2LAS A;  3VQI A;  1R4M I;  4HWI B;  4MSQ B;  2GBK A;  5KHQ A;  1XT9 B;  4NPN A;  3W1Y A;  1WRD B;  2BF8 B;  3D32 A;  1WXS A;  2L00 B;  2L0F A;  4YL8 A;  4CO7 A;  3ZKJ C;  1L2N A;  2GBM A;  2WYQ A;  4ZRJ A;  2CR5 A;  1WI0 A;  1WGD A;  2LRW A;  4BOZ B;  5C23 A;  5CHW A;  1E8Z A;  4K7W A;  1WH3 A;  1YX6 B;  1KJT A;  4F1S A;  2KX3 A;  4F8C B;  3A9K A;  1WY8 A;  2M17 A;  2Z0D B;  3CF6 E;  4MGK E;  4BVU C;  3UIN B;  5DPS A;  3UIO B;  3TL5 A;  2N9E B;  2REX A;  3PRP B;  2A5U A;  2KLC A;  1YX5 B;  2HJ8 A;  4B9K A;  1WJU A;  2J7Q B;  4IM3 A;  3KUD B;  4TQ1 A;  2DAJ A;  1P3Q U;  2B3A A;  2ZCC A;  3NOB A;  2ZZP B;  3A9K B;  4NQL B;  3U8Z A;  3I3T B;  2DAF A;  1WZ0 A;  4WWO A;  2M1M A;  2K25 A;  3M3J A;  2KVR A;  4G3X B;  4WAA A;  5E6P A;  2KDI A;  3HM3 A;  4NAW A;  3V62 A;  3DBR I;  3L16 A;  3ZTC A;  4URK A;  1VD2 A;  3CMM B;  2KWV B;  1LQB A;  2ZEQ A;  1IP9 A;  3QAR A;  1XD3 B;  4JQW C;  3WA0 A;  1F9J A;  2BKF A;  2EMS A;  3L08 A;  4HLE A;  5HKH A;  2K8B A;  4DHJ B;  3WAP A;  4DWF A;  3ZNI D;  2NVU I;  2IO1 B;  4E74 A;  1UZX B;  3PS6 A;  2LZ6 A;  4NAW B;  3UF8 A;  4GXB A;  4BKS D;  2Y5B B;  4PS8 A;  4ASW C;  3DBH I;  3ZDT A;  1V49 A;  2KAN A;  3V60 A;  4KSL C;  2LVP A;  2ZCB A;  2YVC A;  4KZC A;  2KWU B;  1S1Q B;  3MHS D;  5J18 A;  3UGB B;  3Q3J A;  5D6J B;  4HDQ A;  4MEL A;  3S2A A;  3V61 A;  2GMI C;  4RM8 A;  2JWZ A;  4WJP A;  4ICU A;  2BYF A;  3ZW3 A;  1UH6 A;  2K8H A;  3PRM B;  4PYZ A;  3TCA A;  2KFK B;  4F7Z A;  2RR9 A;  4II3 B;  3ZLZ A;  2Z0E B;  2N1W A;  3QC8 B;  2NS5 A;  3DVN U;  3DPD A;  4AUQ C;  4K7U A;  2CU1 A;  3QCA A;  4WWP A;  2RPQ A;  1E7V A;  4WJO A;  5CX3 A;  3VTV A;  3R66 C;  2DX5 B;  4JIO U;  3UQB A;  3ALB A;  5DPW A;  2KC1 A;  2OOB B;  4G50 A;  4MEM A;  1IYF A;  4BBN F;  2N9P C;  2RSU A;  4GB9 A;  2PE9 A;  1WXV A;  1E8X A;  3EFU A;  3PPA A;  1WX9 A;  2PEA A;  3ML9 A;  5EDS A;  2MBH A;  1WJ4 A;  4ZRK A;  2MP2 B;  4HDO A;  3DVG Y;  2KDF B;  4BFR A;  1TGZ B;  1RAX A;  4I6N B;  4PS7 A;  5D94 A;  3KUC B;  2MBQ A;  3M95 A;  4NNJ B;  1K8R B;  1WF9 A;  2PJH A;  2XEW A;  2IO0 B;  5DPR A;  4GIV A;  2CHZ A;  2NBW B;  2JVC A;  1WJN A;  5DPT A;  2KTR A;  2O2V A;  4KZ0 A;  4BKS A;  1XQQ A;  2JT4 B;  3PLU A;  4M8N A;  1C3T A;  3MTN B;  3N3K B;  1ISN A;  2NPT A;  2L76 A;  3JVZ X;  2KHW B;  2MBO A;  3NZU A;  2JZ3 B;  3ZNH B;  5E6N A;  1V6E A;  4ZYN A;  2KTR B;  2O2V B;  1WMH B;  2GOW A;  1TZ1 A;  3DVN V;  3PZD A;  3OJ3 A;  4MGI E;  4II2 B;  1U4A A;  2NPT B;  4ZRI A;  2FIF A;  4MSM B;  2DZK A;  2LWP A;  2ZVO A;  3TMP B;  4G11 A;  4JL9 A;  1D3Z A;  4EZJ A;  2IBI B;  3AUL A;  1V5T A;  4IWO A;  2FNJ B;  2KK8 A;  3QWZ B;  4XC2 A;  3KH0 A;  2GBN A;  4AOF A;  1WIA A;  3WAN A;  3ZRF A;  2FCQ A;  4GGQ A;  2V1Y A;  4RM9 A;  4OVV A;  4TV3 A;  2MQJ A;  2HD5 B;  5JZE B;  3QX1 A;  2WX1 A;  3L10 B;  2ZPY A;  3RZW C;  3H7S A;  2LGX A;  4FLH A;  1WX7 A;  4P7I A;  1FXT B;  3DBS A;  1EUV B;  4HCN B;  2HTH A;  3CSF A;  4WQO B;  4PS3 A;  3MJW A;  5AZG A;  2KFJ A;  1WXA A;  4HXD A;  4M0W B;  1OTR B;  2KQS A;  3ZIM A;  4FAD A;  4ANX A;  3NY5 A;  4W9D A;  1LXD A;  3U30 A;  3TBL D;  3W1S A;  2J0M A;  2LD9 A;  2Z59 B;  1UD7 A;  2N4F A;  2KKC A;  2UYZ B;  2M4N A;  4TQ0 A;  2LXC A;  4IUM B;  4EEW A;  3H9D A;  4EZK A;  1X1M A;  1YD8 U;  2LVQ A;  3DCG A;  2CKH B;  2RD0 A;  4I6P A;  3R7R A;  4ANV A;  1WE6 A;  1H4R A;  2DZJ A;  2K6Q A;  4W9G A;  1BT0 A;  3TIX A;  1Q0W B;  5L83 A;  2FCN A;  2LJ5 A;  3TJP A;  2BKR B;  4DDG D;  3HHM A;  3SU8 X;  3P2B A;  4KIK A;  3H7P A;  2LUE A;  3VTU A;  2KN5 A;  3APD A;  4MGY E;  5J17 A;  2K6D B;  2MA9 B;  1Z5S B;  3KVF B;  4KDI C;  3OLM D;  2J0J A;  3GZN I;  1A5R A;  1WZ3 A;  4I6L B;  2AYO B;  2L7R A;  3JSV B;  3VVW B;  1E5W A;  2KO3 A;  3WIM A;  4NY0 A;  3WAL A;  2A4Z A;  2DZM A;  4HPM B;  4IG7 B;  4J6I A;  5JH5 C;  2WWZ A;  2M8S A;  2ZPN A;  3L13 A;  2WX0 A;  1NBF C;  3H7P B;  2MWS B;  4KIK B;  2EKE C;  4PYU A;  2BYE A;  4A3P A;  3PLV A;  3A33 B;  2MW5 A;  2KFK A;  2ZNV B;  5E6O A;  1J8C A;  2FUH B;  4BOS C;  2XBB C;  2HE7 A;  2D11 A;  4LCD E;  2MX2 A;  2BYV E;  5AZF A;  3DQV A;  3AU4 A;  3NHE B;  2MLB A;  2G45 B;  3IHP C;  4HVB A;  3CST A;  1I42 A;  5D2M B;  1WM3 A;  3IBE A;  3PT2 B;  2KJ6 A;  4AJY B;  2IY0 B;  4DHZ E;  2UWQ A;  2ZVN A;  2L05 A;  1Q1O A;  4EUT A;  4WJQ A;  2N9X A;  2NCN A;  3A9J A;  2M0X A;  3PHW B;  1H8C A;  3GOE A;  1ZKH A;  2FCS A;  1E8Y A;  3SHQ A;  1SGH A;  2KD0 A;  1OGW A;  2MP2 A;  1SIF A;  2KXJ A;  3U7D A;  1GUA B;  1T0Y A;  1WE7 A;  4IWQ A;  3ZNG C;  2CHX A;  3BIN A;  1WGY A;  3A9J B;  4JLC A;  4BKT A;  3DVG X;  2DEN B;  3ZNZ B;  2KC2 A;  2LRU A;  3RYT A;  3VH3 B;  2KX0 A;  2OJR A;  3K9O B;  5D7G A;  1RFA A;  1RRB A;  2DHZ A;  3QA8 A;  3X23 A;  5CHF A;  2FAZ A;  2D07 B;  4MH0 E;  4NJ6 A;  4WWN A;  2I1J A;  3IVF A;  3JYU A;  2W9N A;  2AL3 A;  2WDT B;  4N9F 4;  4W9I A;  3PTF C;  2FID A;  4ICV A;  4FN2 A;  4DDI D;  3RCZ A;  4GU2 A;  2O6V A;  1Q5W B;  4MJS B;  3VUY A;  1WMH A;  4M8M A;  1OEY J;  1CMX B;  1R4N I;  2D10 A;  5LLI A;  3RT3 B;  4FBJ B;  3W1S C;  2KTF A;  4GN1 A;  3PGE A;  5J2R A;  1V9J A;  1GNU A;  3SD5 A;  5IA7 A;  2O6V B;  4GSW A;  3HK0 A;  5L95 C;  1WJ6 A;  1C1Y B;  3R7Q A;  3ECI A;  1V80 A;  4B95 A;  3DDC B;  3PRE A;  2IO2 B;  2FCM A;  2G3Q B;  2KMC A;  2JRH A;  2LXA A;  2CHW A;  4KVG B;  3VH4 B;  2JXX A;  2DYM A;  4IM0 A;  2MRP A;  2PE6 B;  1WGG A;  1EF1 A;  3B1L X;  3B0A A;  1P1A A;  3H6N A;  2AL6 A;  2GBJ A;  3AXC A;  4W9K A;  4TKN A;  1P0R A;  4W9F A;  3ZRC A;  5GMV A;  4ZDV A;  1WGR A;  2C60 A;  1V5O A;  2NR2 A;  2ZNV C;  3DOW A;  4A20 A;  1AAR A;  3QIJ A;  4HCP B;  2AEH A;  2C7H A;  5AZH A;  2IZV B;  2EMT A;  1S3S G;  4W9E A;  1WR6 E;  2IYD B;  2V3S A;  4CYE A;  1WYW B;  3R3M A;  3VTW A;  3X0W A;  3M63 B;  4DBG A;  1E90 A;  5AEK B;  3LDZ E;  4W9H A;  2AWT A;  2MBB B;  1GG3 A;  2C9W B;  4HK2 A;  3APF A;  3HM6 X;  4LDT B;  1GC6 A;  5G2N A;  3AI5 A;  4E71 A;  4AJW A;  1MG8 A;  3O65 B;  2G4D B;  1UEL A;  5CHV C;  3HIZ A;  4IW0 A;  3RUL A;  3SDL C;  4ANU A;  3PRZ A;  2G4S A;  3C0R B;  2KNB A;  1PQS A;  3QQ8 B;  2LVO A;  1UBQ A;  1TTN A;  3VAW A;  2LGD A;  2KDB A;  3UIP B;  4DHZ B;  3JSV A;  1V2Y A;  1QZE A;  2L0T A;  2LI5 A;  3BY4 B;  3T8M A;  3VFK A;  3KYD D;  2IY1 B;  2RGF A;  1L7Y A;  4WJN A;  4CHK A;  5TR5 A;  2K8C A;  1J0G A;  1EO6 A;  3OAW A;  4AP4 C;  2BPS A;  3VXW A;  3EC8 A;  3PV1 A;  4FJV B;  2O6V D;  4XX5 A;  4EFO A;  3KYC D;  1I35 A;  3PHX B;  4MM3 A;  2XK5 A;  4XZ4 A;  3ZTD A;  1KLV A;  2GBR A;  4X57 B;  2MSE D;  4RMA A;  2JUO A;  1JRU A;  3M62 B;  1KOT A;  1V86 A;  1OEY A;  2V4L A;  4BKG A;  3QAQ A;  4FJY A;  4A3O A;  2R2Q A;  4EOY A;  3NS8 A;  2IO3 B;  4LJO B;  2DZI A;  4KSK C;  2XK5 B;  4MDK E;  4AWJ A;  2L8J A;  4G0N B;  2R2O A;  3B08 A;  2L3Z A;  4K7S A;  3EHV A;  3VUX A;  3A4R A;  4B6W A;  2KWC A;  5JHB A;  4FUL A;  1GC7 A;  1TBE A;  1V81 A;  2JPH A;  2KOX A;  4HJK A;  4LJP B;  2MCN B;  1WR1 A;  3ENE A;  1P98 A;  1J19 A;  1E7U A;  2BWE S;  4KV2 A;  2CS4 A;  5DCN A;  4EKU A;  5LXI B;  4KDL B;  2ZJD A;  1WX8 A;  2QHO A;  4W9C A;  3QJZ A;  2LGY A;  4LDT D;  2J0K A;  3LJ3 A;  4EZL A;  3EEC A;  1UBI A;  3L54 A;  3WAO A;  2MBE A;  3PSE B;  5LXH A;  2KJH B;  3RZF A;  3AU5 A;  3VUW A;  2C7N B;  3VDZ A;  5BO4 B;  3APC A;  4FJZ A;  5IAA C;  4K81 A;  4MJS A;  4W9J A;  4DXA B;  2KZR A;  3L17 A;  3N30 A;  3T9L A;  4JGH B;  1WXM A;  2C5L C;  2KDE B;  3Q3F A;  4IWP A;  2K39 A;  3A4S C;  2K1F A;  3KUZ A;  5FR6 A;  3L0W B;  1YQB A;  1M94 A;  4K1R B;  1IPG A;  2N7D A;  1UGM A;  4NJ7 A;  1G6J A;  1NDD A;  2C7M B;  3ONS A;  1ZGU B;  4OVU A;  1Y8R C;  4IC7 B;  4TUU A;  5C1Z A;  3PVL A;  3N32 A;  4GDL A;  1KM7 A;  3ML8 A;  5KHO A;  3RUI B;  1GJZ A;  3QK0 A;  2KMA A;  3QHT A;  1LFD A;  1WFY A;  1Z2M A;  2I1K A;  2KJR A;  4FHK A;  4ANW A;  3JW0 X;  3NZS A;  1WGH A;  3V6E B;  3OJ4 B;  3KW5 B;  3K9P B;  3H1U A;  4DHJ D;  1WM2 A;  1EF5 A;  4MGZ E;  4DK5 A;  3UQA A;  2ASQ A;  2PPH A;  4GDL B;  1OQY A;  2NBV B;  2DYB A;  2JZZ A;  2N1V A;  4FA6 A;  1YIW A;  2DYO A;  3ZDM C;  2BGF A;  4GOC A;  1YJ1 A;  3V6C B;  1RLF A;  1SE9 A;  2JRI B;  4W9L A;  4E3C A;  4HPL B;  2VRR B;  1NI2 A;  1LM8 B;  2N7E A;  4FHJ A;  2JF5 A;  2JY6 A;  4BBN C;  3A1Q A;  2YLM A;  3IFW B;  4GDK A;  2BWF A;  5G55 A;  5CTR C;  2KLG A;  3WAM A;  2D3G A;  1P9D U;  3ZUN A;  4IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...