5L95C

Crystal structure of human uba5 in complex with ufm1 and amp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
VSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Ubiquitin-like modifier-activating enzyme 5
publication title Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5l95C00
1TBEA 4GDKB 5J2RA 3AU4A 4TKNA 2J0KA 3M62B 4PS8A 1WGRA 4BKSD 2V4LA 4LDTB 3ZKJC 2KTRA 3L08A 3A1QB 3H9DA 4EZLA 2KMCA 4IWOA 3PRPB 4K7WA 3ZUNA 2MRPA 4FJYA 3ZW3A 2Z59B 3QAQA 3UGBB 4ZDVA 5EDSA 5C1ZA 1V5OA 2KTRB 2I1KA 1GC6A 1WE6A 3IHPC 1WM3A 3EFUA 4FHKA 2FNJB 4EEWA 3QJZA 4G50A 1C3TA 3LJ3A 4W9GA 2DZMA 3VXWA 2N9EB 3ML9A 3R3MA 4KIKB 4NQLB 5BO4B 3ZNHB 5TR5A 1GG3A 1V86A 3BINA 4IM2A 2IZVB 3DDCB 3PSEB 3VAWA 3PV1A 4AJWA 1HE8A 2EKEC 2BPSA 4HCNB 2L0FA 4YL8A 3TCAA 4W9KA 2ZJDA 2IY1B 2KK8A 4BBNC 1GJZA 3WALA 2K25A 5C23A 5JZEB 2JRIB 3MTNB 2OJRA 2N1VA 2DAFA 3WA0A 4FN2A 2LRWA 4W9CA 2KX3A 1YX5B 2LWPA 2Z0DB 2JZZA 3UQBA 4LJOB 1E90A 4LJPB 4NQKE 4PYUA 2RD0A 1M94A 2MBBB 1EUVB 3K9OB 4IWQA 2FCNA 3SHQA 1E8YA 2NVUI 4HJKA 4JL9A 4KSLC 2NBUA 3QHTA 4HWIB 4WJPA 1TZ1A 2BGFA 3V6EB 1XQQA 2IO0B 1EF5A 3BY4B 3ML8A 2MP2A 3QWZB 4KV2A 3EECA 2N9PC 2OOBB 2DZIA 4ANXA 3N3KB 5L83A 1IPGA 3VTVA 4E71A 2IO3B 2MW5A 4IC7B 5JH5C 4AJYB 4HK2A 4FBJB 2MP2B 2M8SA 2B3AA 3PZDA 3ZDMC 3SD5A 4EFOA 1V6EA 3PRMB 2MWSB 3RUIB 2IBIB 1NDDA 1Q5WB 4EZKA 2N1WA 2CHZA 3DQVA 3HK0A 1P0RA 4HPLB 4GGQA 4M8MA 2MBHA 2R2OA 2M0XA 2LGYA 2NR2A 2WWZA 3ZNZB 1WM2A 2KQSA 1YIWA 4ASWC 3RULA 3UIOB 1BT0A 1EF1A 4IUMB 2VRRB 1E7UA 3KW5B 1V9JA 1S1QB 2KDIA 5AZGA 1E8WA 1H8CA 2KMAA 2KO3A 1WXSA 3DVGX 5DPTA 2DX5B 1J8CA 3APFA 1UD7A 1R4NI 2O6VA 3VTWA 5DPWA 4MGZE 1LM8B 3VUWA 1WJUA 4ZRKA 2A4ZA 4XX5A 2KNBA 2KJHB 1LQBA 1YJ1A 1WXMA 2O6VB 3VHTC 4X57B 1OEYJ 4MEMA 3U7DA 1UBIA 3QARA 2PPHA 3IFWB 2WX1A 4K81A 1GNUA 4GSWA 4IM0A 2DENB 2CU1A 3ONSA 3UF8A 3U8ZA 1P98A 2JF5A 3HHMA 4FJVB 1SE9A 3VH4B 2G45B 4G11A 4BKSA 1Z5SB 3B1LX 3Q3FA 2D07B 2CHXA 3QCAA 4W9DA 3VTUA 2C9WB 2JWZA 2HE7A 2QHOA 2W9NA 2KLCA 2V3SA 4BVUC 2MQJA 4MH0E 5JHBA 3UQAA 3I3TB 2J0JA 3M3JA 3NZSA 4MGIE 4B6WA 2NBWB 2IO2B 4M8NA 3A9KA 2CR5A 3WIMA 2JUOA 2K8HA 2PJHA 4W9IA 1TGZB 2L76A 3T9LA 4W9EA 1Y8RC 2AYOB 3NS8A 1NI2A 2JY6A 3A9KB 4EZJA 2D11A 2XBBC 2NS5A 2BWES 5D6JB 5DCNA 5CHWA 2GMIC 2DYMA 3X23A 5CTRC 2KJRA 3PHXB 4JQWC 4RM9A 5D94A 2IO1B 3NOBA 2MA9B 2J0MA 1L2NA 4HDOA 2HD5B 3PGEA 2G4SA 3OJ3A 3H6NA 3M95A 5AZHA 3JYUA 4NJ7A 4G3XB 4E74A 2MLBA 3L16A 4FLHA 3DVNU 3HM6X 2M17A 3TMPB 4BKTA 1WE7A 4KSKC 3ZNGC 4NNJB 3APDA 3VVWB 5CX3A 2G4DB 3ECIA 2K6DB 3SDLC 3ZTDA 3JVZX 2KJ6A 3NZUA 2ZEQA 4G0NB 3PLUA 4E3CA 3QQ8B 4XZ4A 3S2AA 4DHJD 1L7YA 3QIJA 1UBQA 3RT3B 1WMHA 3UIPB 2AEHA 4BFRA 2M1MA 4B9KA 1V5TA 1WZ3A 3K9PB 5E6NA 1RFAA 4F1SA 2KDFB 1KLVA 4TUUA 3AULA 4NY0A 4GOCA 4NAWA 5G2NA 3ZDTA 2WX0A 1WMHB 4HCPB 4AOFA 1T0YA 3GOEA 2DZJA 4CO7A 3VQIA 5LLIA 4FJZA 4LDTD 4NJ6A 4WJNA 1KOTA 3OJ4B 2ZZPB 1NBFC 3L13A 3JSVA 2JXXA 5G55A 2LJ5A 3WAOA 1K8RB 2Z0EB 2LD9A 3DCGA 2REXA 4IW0A 2KZRA 4MGYE 1EO6A 2RSUA 3JSVB 2N7DA 4KZ0A 4IG7B 2YLMA 1Q1OA 3A4SC 4ICUA 3VH3B 2IYDB 3ZLZA 1WR1A 2K8CA 2L05A 4I6LB 1ZW7A 1E8ZA 1PQSA 2LUEA 1WF9A 2R2QA 3B0AA 2RPQA 3M63B 4OVUA 5D2MB 3TBLD 4BOZB 4EUTA 5AZFA 5D7GA 3DBRI 1I42A 2MBQA 3L17A 2LZ6A 3NY5A 4AUQC 1UZXB 3CSTA 4K7UA 3V61A 2NBVB 2DAJA 1VCBA 1E8XA 3RYTA 5LXIB 2HTHA 3MJWA 1E5WA 2FUHB 4MSQB 5HKHA 1LFDA 4KDIC 1XT9B 4JLCA 2L7RA 2LRUA 4A20A 4BOSC 4FADA 5IA7A 2KXJA 4HLEA 5JHAA 3PREA 2C5LC 2A5UA 4MGKE 3OAWA 3A9JA 1WZ0A 3KVFB 2ASQA 1GC7A 2FIFA 1FXTB 1JRUA 3LDZE 2UYZB 3W1SA 4W9LA 2NCNA 2KANA 3RZWC 3T8MA 2DZKA 2CKHB 3H1UA 4HDQA 2KC1A 3KH0A 2LVOA 2PE9A 5FR6A 2C7MB 3VFKA 1WGDA 1WYWB 2FIDA 2KVRA 4EOYA 2L8JA 2L00B 3WAMA 4AP4C 3PVLA 1YD8U 2N4FA 3PTFC 1P3QU 2ZNVC 4MJSA 2YVCA 3A4RA 2KWCA 2KQ7A 3IVFA 3QK0A 3CF6E 2GOWA 2RR9A 3CMMB 3KYCD 4JIOU 4DBGA 2BYEA 4P7IA 3IBEA 3U30A 1V2YA 1G6JA 4MJSB 3PLVA 2HJ8A 4DDID 4GU2A 3O65B 1Z2MA 4DHZB 4JGHB 4ANVA 3TL5A 2M4NA 3DOWA 4MM3A 5E6PA 4DHZE 2G3QB 2IY0B 2BKRB 2JT4B 3PRZA 1V49A 3ZVVA 5GMVA 3N30A 3W1SC 2ZPNA 3CSFA 2LVPA 3VDZA 1IYFA 1V80A 3RCZA 2DYBA 1OQYA 4W9JA 3NHEB 3DPDA 1WR6E 2KKCA 4GXBA 4IM3A 3D32A 1D3ZA 2ZCCA 1F9JA 1SIFA 2V1YA 2FCMA 3OLMD 1YQBA 4M0WB 4CHKA 1WFYA 4K7SA 3PHWB 2GBNA 1UH6A 2BWFA 5KHOA 4GN1A 4DHJB 2LVQA 4RM8A 2ZPYA 2K1FA 2JVCA 4GDKA 5LXHA 4WWOA 1QZEA 1OTRB 4GB9A 4K1RB 3Q3JA 3AI5A 4WQOB 4HPMB 2D2QA 4ZRIA 3WAPA 3ZRCA 4AWJA 2KC2A 3ZNID 2BKFA 4PS7A 3R7RA 4KVGB 3W1YA 2I1JA 4F7ZA 2XK5A 4W9HA 1RLFA 1S3SG 3H7PA 2LI5A 3TJPA 1I35A 3V6CB 2KD0A 2EMSA 1LXDA 1C1YB 4HVBA 3KUDB 4HXDA 2XK5B 5L95C 4KIKA 2WYQA 1YX6B 3H7PB 4II3B 1WX8A 3DVGY 1J19A 2C60A 2MBOA 4J6IA 2KFKA 2LGXA 3P2BA 4ZRJA 1WXVA 2JRHA 3PT2B 4NAWB 3X0WA 1WY8A 1R4MI 1OEYA 5KHQA 5AEKB 2KFKB 1WJ4A 4IWPA 3UINB 2KFJA 3H7SA 3ALBA 4GIVA 3VUYA 3AXCA 1A5RA 5J17A 4FHJA 1J0GA 4B95A 4DK5A 2L3ZA 2KDEB 2C7NB 4BKGA 3RD2A 3RZFA 3PPAA 4I6NB 2K8BA 2GBJA 4W9FA 3V62A 5J18A 3L0WB 1WXAA 2FCSA 2XEWA 4CYEA 4WAAA 1XD3B 4DDGD 1WX9A 2MX2A 2KN5A 3A33B 3HIZA 2J7QB 4WWPA 2ZCBA 1WX7A 2FAZA 2GBRA 1RRBA 2AL3A 1E7VA 3EC8A 4TQ1A 3KYDD 1MG8A 1X1MA 3ZTCA 3C0RB 2BYFA 2JPHA 4ANUA 1CMXB 4WJQA 2N9XA 3KUZA 4TQ0A 3DBSA 4GDLA 2D3GA 3ENEA 4LCDE 3DBLI 4FULA 1UELA 3QA8A 4F8CB 1Q0WB 2ZNVB 4A3PA 4GDLB 1SGHA 4NPNA 3KUCB 3DVNV 3APCA 3JW0X 4MSMB 3VUXA 2C7HA 2LASA 4MDKE 1ZGUB 2KTFA 2AL6A 2D10A 1KJTA 4I6PA 4ICVA 3QC8B 2L0TA 2BF8B 3ZIMA 4RMAA 4ANWA 3A9JB 1H4RA 2MSED 1GUAB 2GBMA 3DBHI 2EMTA 3N32A 5IAAC 3ZO5B 4II2B 3V60A 4EKUA 2NPTA 3QX1A 1IP9A 2KX0A 5CHVC 5E6OA 1WGYA 2LXAA 1WGGA 2KOXA 1WH3A 1V81A 2DHZA 4FA6A 2KHWB 4WWNA 3R7QA 2FCQA 2NPTB 2ZVNA 2BYVE 1ISNA 1U4AA 4OVVA 3B08A 5DPRA 5DPSA 2ZVOA 1OGWA 1VD2A 1RAXA 3WANA 3MHSD 2K6QA 1AARA 4KDLB 4ZYNA 4N9F4 4URKA 2UWQA 2LXCA 2Y5BB 1WIAA 4GMVA 2CHWA 3PS6A 1UGMA 2JZ3B 2N7EA 3GZNI 3R66C 1TTNA 4PYZA 2K39A 1WI0A 4BBNF 2RGFA 1P9DU 2DYOA 4XC2A 2LGDA 4PS3A 4A3OA 2KWUB 2O6VD 2PEAA 3IG3A 4DXAB 4TV3A 5CHFA 3EHVA 1WGHA 1WRDB 1ZKHA 3L54A 1WJNA 2KWVB 2CS4A 2O2VA 2MCNB 2KLGA 4MELA 3SU8X 1KM7A 4KZCA 2MBEA 3HM3A 3TIXA 4DWFA 2PE6B 3L10B 2AWTA 4WJOA 1P1AA 2O2VB 3ZRFA 1WJ6A 2GBKA 3AU5A 3A1QA 2WDTB 2KDBA
chains in the Genus database with same CATH superfamily
3VRBB 2J0KA 4XDDA 3EFCA 3ZKJC 1XCTL 2KTRA 2KMCA 1YNTE 4K7WA 2MRPA 4FJYA 3ZW3A 3QAQA 1ZXHA 3I5JC 5EDSA 4M00A 2CJNA 3QJZA 2BS4B 4C56C 2JSVX 3ZNHB 1GG3A 4IM2A 3DDCB 1BXTA 3PSEB 1JW9D 4JPSA 2FBWB 2BPSA 2BT6A 2IY1B 3WALA 3AEGB 1QT9A 2K25A 2JRIB 1FRRA 4FN2A 4W9CA 1TS3A 4CQNA 2RD0A 2MBBB 2HDEA 4IWQA 3SHQA 2DBYA 1E8YA 4HJKA 2PTLA 4B0MA 3V6EB 5IP4D 2W82A 3BY4B 2MP2A 1UGJA 1QOBA 1PYWD 3AE5B 2J42A 2X38A 3LB8C 3PZDA 1V6EA 3PRMB 2NTSA 2JWUA 1MHXA 3IAS1 4EZKA 2N1WA 3HK0A 1P0RA 4HPLB 4GGQA 2NR2A 4TSSA 1NI3A 2VRRB 4JX1C 2BTEA 1HZ6A 1NVID 3NVVA 3NVYA 3I9V1 2KO3A 3DVGX 2N0SB 4DQOC 2XN9C 4OZAA 4ZRKA 2O6VB 1OEYJ 4P16A 3QARA 1DOIA 1YQ4B 3U8ZA 4FJVB 1SE9A 3AE3B 4G11A 1Z5SB 2VZKB 3B1LX 4RGNA 3QCAA 1J7BA 1ZDXA 4N59A 2C9WB 2JWZA 4LNIA 2W9NA 4BVUC 1LGRA 3NZSA 4MGIE 2IO2B 1I4HA 1TKGA 1V97A 4W9IA 4XDCA 2QEJC 3A9KB 2XBBC 2NS5A 3AMZA 5D6JB 4ACFA 2DYMA 4C00A 3VRAB 4JQWC 1ZDVA 3TEXA 2QC8A 1GAQB 1L2NA 4HDOA 1V1PA 3R8BA 4NJ7A 3L16A 2LJIA 3DVNU 3TMPB 1B9RA 1WE7A 3VVWB 4LNNA 4YWGG 5CX3A 1XCQL 3ECIA 4A9AA 3NZUA 2KJ6A 2ZEQA 3PLUA 4E3CA 3RT3B 4RCOA 1WMHA 1ZP0B 4NJCA 3K9PB 4OW0A 2K22A 1KLVA 5G2NA 2WX0A 1T0YA 1FPYA 1YN3A 4LDTD 4NJ6A 2ZZPB 2M19A 1WWTA 1K8RB 2Z0EB 1QF6A 3DCGA 2REXA 3JSVB 2WLBA 4YT0B 3BZDB 3AM9A 3VH3B 4ICUA 3ZLZA 1C9FA 1E8ZA 2R2QA 4EUTA 4BOZB 2HTME 1TS5A 3L17A 1V8CA 1UZXB 3V61A 1JROA 2HTHA 2FUHB 3DWMA 2MH7A 4KDIC 3BWUD 3V3XA 2KXJA 2LGSA 5JHAA 2C5LC 3Q8BA 1GC7A 2WXQA 2R61A 1E9MA 1IGDA 2KANA 3RZWC 2K0PA 2KC1A 2PE9A 4ZRQA 3VFKA 5I4DA 2L00B 3PVLA 1YD8U 2N4FA 2D3CA 2G1EA 3PTFC 2ZNVC 2KWCA 4L2YA 3HVZA 1FCLA 4P7IA 1TZOA 1LO5D 4XWWA 4MM3B 2DYBA 2WXPA 1OQYA 3NHEB 4ZHOA 2IGDA 1SIFA 2FCMA 3OLMD 4M0WB 4K7SA 1NYQA 5KHOA 2KYWA 1OFFA 1ESFA 4RM8A 1SJED 3TEWA 4GDKA 4QAYA 5LXHA 3DHGC 1CQVA 1OTRB 3Q3JA 2XK5A 4W9HA 1L0XB 1S3SG 3NJTA 2LI5A 3TJPA 5E6JA 3BYYB 4HVBA 1YX6B 4II3B 1WX8A 1FFVA 1J19A 2PW9A 2MBOA 4J6IA 2WXOA 3Q8AA 1CJEA 2QIEB 1AYFA 2H89B 3AXCA 5J17A 4B95A 3PPAA 2K8BA 3V62A 3L0WB 1WXAA 1TS4A 1KTKA 4WAAA 2MX2A 3A33B 2J7QB 4WWPA 1JRPA 2ZCBA 3N20C 1RRBA 2AL3A 4TQ1A 3KYDD 1MG8A 1X1MA 3C0RB 2JPHA 1CMXB 1N5WA 2N9XA 3KUZA 3VR9B 3DBLI 3U7ZA 3FILB 3QA8A 1SGHA 4RNAA 2LASA 4MDKE 1VDVA 1T0RC 1SBBB 1ZGUB 2KTFA 1I4XA 3RNFC 4I6PA 4LTUA 2DWQA 3ZIMA 3A9JB 5IAAC 1HEZE 3V60A 3AEDB 2MEKA 1WGYA 2LXAA 1WGGA 2KOXA 1PGAA 2W3RA 4FA6A 2KHWB 4WWNA 4JWSC 1MG4A 4OVVA 2KACA 2FE8A 1VD2A 3LXFA 3MHSD 2BS2B 3GE8C 2LMCA 3IT4B 2N7EA 3RNBC 5BYQA 3PO0A 4XC2A 3IG3A 1WRDB 3L54A 1WJNA 2O2VA 2CS4A 4N58A 4MACA 1SIJA 2KLGA 4KZCA 1P1AA 2I38A 3GS2A 1XLQA 3ZYYX 2V4LA 2RPVA 2KT7A 1NYRA 3L08A 3A1QB 1R4NB 3H9DA 1JWSD 3UGBB 5C1ZA 3RMKC 2KTRB 2INDC 2I1KA 1GC6A 4EEWA 3EFUA 2FNJB 2H88B 4D2KA 1C3TA 3LJ3A 4WAFA 5HI1A 2WXIA 4W9GA 2BVCA 1P7FA 3R3MA 4WURA 3TSSA 3AV8A 4AJWA 1HE8A 4YL8A 2L0FA 3TCAA 4W9KA 4BBNC 1L0YB 2V3NA 5C23A 2DLBA 1T5XD 3MTNB 2N1VA 2DAFA 2KX3A 1GOZA 2Z0DB 4LJOB 4LJPB 4NQKE 1M4VA 1M94A 1EUVB 4JL9A 3SR6A 2TSSA 2BGFA 1XQQA 3QWZB 3U2SC 2OOBB 1HA5A 2DZIA 2MJDA 4E71A 2INPE 4IC7B 4FBJB 2MP2B 2M8SA 1VRAB 4EFOA 1ET6A 1R7SA 2MWSB 4M02A 1NDDA 1HQRD 2CHZA 3DQVA 1FNWA 4M8MA 2FUG1 1WM2A 2KQSA 4ASWC 3RULA 3Q3MC 3UIOB 1BT0A 1EF1A 4RFBA 1D5XC 4ARIA 4P1BC 5LNK1 4S17A 2KDIA 2WHIA 3SFDB 1I7HA 4MGZE 2V0GA 3VUWA 2KNBA 1TS2A 2KJHB 2IPKD 3GB1A 5AUIA 2Z8LA 4IDIA 1TIFA 2PPHA 1JWUD 5FK9C 1GNUA 4GSWA 2CU1A 3ONSA 3UF8A 3T3OA 2EKIA 3AEFB 3HHMA 5H8YE 5AUKA 3VH4B 2B76B 2WXKA 5HG2A 2D07B 4KGSA 2QHOA 1TJEA 4MH0E 3MJ5A 3I3TB 1E10A 4M8NA 3VR8B 3EA6A 3WIMA 4Q2JA 2JUOA 2K8HA 2PJHA 3B2GA 3HVDA 3NRZA 3RPFC 4W9EA 1Y8RC 4EZJA 1C78A 4KKIA 2GMIC 5CHWA 5CTRC 3T3NA 2KJRA 2WNMA 3AE7B 3PHXB 1HTQA 2IO1B 3AEBB 2MA9B 2G4SA 3OJ3A 1ZUD2 5AZHA 4E74A 4LLGM 4FLHA 3KLSX 3HM6X 2MJ3A 2M17A 4GLSC 4KSKC 3ZNGC 4NNJB 3RI7C 5BMIA 2G4DB 4FXCA 4R3DA 3ZTDA 3JVZX 2RMMA 1WYGA 3QIJA 1UBQA 1OQQA 2JYEA 4YTMB 4F1SA 2KDFB 4TUUA 3AULA 4GOCA 4NAWA 1WMHB 1D6EC 1CZPA 3GOEA 4CO7A 3VQIA 5LLIA 1PUTA 2BQQA 1P7EA 1C4PA 3ZGZA 4M01A 2JXXA 3WAOA 4YXDB 3HRDD 4WH4A 2RSUA 3Q6BA 4KZ0A 1V1OA 2MHJA 4XE0A 1YOVB 3A4SC 2IYDB 4HROA 3FC4A 1WF9A 3M63B 5D2MB 2M56B 4OVUA 5AZFA 2LHEA 2W54A 4RF0A 1I42A 1IGCA 1RM6C 4XGAB 4AUQC 3CSTA 2DAJA 1E8XA 1TY0A 3AEAB 2V3PA 1BUIC 2VH1A 5IA7A 2INNE 3PREA 1L4ZB 2ASQA 2ZW1A 5G5HA 3W2DA 1JRUA 1QOAA 3LDZE 3W1SA 4W9LA 2JZPA 4L1BA 2DZKA 1N63A 5FR6A 4XWTA 1WGDA 1TKYA 3CWIA 1P3QU 4MJSA 3IVFA 4DBGA 2BYEA 3IBEA 1G6JA 2HJ8A 1PGBA 2J52A 3O65B 3P1MA 4ANVA 3TL5A 2WDVB 3BVMA 5E6PA 2ONQA 1PGXA 3EUB2 1JALA 2ZPNA 2IGGA 4WWMA 1WR6E 3D32A 3RNAC 1D3ZA 1YQBA 1WFYA 4MH8A 1ET9A 1UUPA 1UH6A 1OQRA 4WWOA 1QZEA 4J3OD 4YSYB 4A90A 4AWJA 2KC2A 4PS7A 2I1JA 2JX5A 1RLFA 3H7PA 1UWMA 3C19A 2W55A 2XK5B 5L95C 2GLSA 3DVGY 2LGXA 2WU5B 2L32A 1WXVA 3W5VB 2JRHA 3X0WA 1OEYA 2KN4A 5KHQA 2ICIA 5AEKB 1WJ4A 4IWPA 3OWEB 2KFJA 1SE4A 3UINB 3H7SA 5MPOA 4FHJA 1L6VA 1DGJA 3ZXVA 3DWGC 1DYQA 1HZ5A 2KVZA 5JXVA 1WX9A 4HRSA 1XLOA 4OHJA 1WX7A 2GBRA 1E7VA 5EE0A 4XYCA 1K52A 3ZTCA 4NZLB 3RNCC 3P4RB 2IGHA 1ZE3D 4TQ0A 4GDLA 4LCDE 2L83A 5FKAC 1Q0WB 2ZNVB 3KUCB 3DVNV 5IO9A 2WDRB 3P4QB 1PFDA 2WXFA 1KJTA 1RYJA 1C79A 2ACZB 2BF8B 3KQ4A 2N7JA 4RMAA 2PVOD 4A6QA 1GUAB 1VLBA 3ZO5B 3QX1A 2KX0A 5CHVC 4US8A 1KH0A 1QQRA 3CIRB 1KLGD 2BBCA 2ZVNA 2BYVE 1FXAA 4RGOS 5DPRA 3B08A 5DPSA 3TEZA 2INCC 1J7CA 2K6QA 3B9JA 4ZYNA 4N9F4 5IKCM 4URKA 2LXCA 2Y5BB 1WIAA 2CHWA 1VZ7A 3ZJTA 2WXRA 3PS6A 2LUMA 3P4SB 1FNUA 1JWAD 2RGFA 4ZHPA 1P9DU 2SAKA 4S0RA 4HEA1 4C4VB 4P6VF 4DXAB 4TV3A 5CHFA 2PLPA 5H92C 3ZJVA 3SU8X 2MBEA 2KWDA 4DWFA 3L10B 2O2VB 3ZRFA 1WJ6A 2GBKA 3DHIC 5IN7A 2WDTB 1TBEA 3AU4A 1T6BX 3M62B 2YEPB 4LDTB 1C76A 1N5XA 3Q69A 4EZLA 4IWOA 2Z59B 4ZDVA 3IHPC 1WE6A 3BK1A 2WXJA 2RDHA 1SXTA 2DZMA 3ML9A 4KIKB 4NQLB 4HPPA 2CJOA 5TR5A 1V86A 3PV1A 1WGKA 2EKEC 2KK8A 3BYTB 1A70A 5JZEB 3WA0A 3NVZA 1FIQA 1YX5B 3UQBA 2JZZA 1SB3C 1E90A 4PYUA 4P1CC 1EU3A 5HHDG 5G5GA 2FCNA 3NZ3A 4KSLC 1ROEA 4HWIB 4WJPA 1TZ1A 1ZXIA 4PK1A 2IO0B 3TUOA 3EECA 2N9PC 4ANXA 3N3KB 5L83A 2MW5A 4AJYB 2B3AA 3ZDMC 3SD5A 1MPEA 3N1XC 3RUIB 2IBIB 1IBXB 1C77A 1YN4A 3NG0A 2R2OA 2M0XA 2LGYA 3ZNZB 1YIWA 1C4CA 1F0ZA 1E7UA 1V9JA 1S1QB 3AN1A 2QSDA 1HXYD 5AZGA 1H8CA 2KMAA 1WXSA 2N9KA 2DX5B 1GPXA 3APFA 1UD7A 2I2YA 1R4NI 4HKZE 3VTWA 1NENB 1LM8B 2QMTA 4XX5A 1LQBA 1WXMA 4X57B 1F2RC 3IFWB 2WX1A 4K81A 4ARCA 4IM0A 2IJ0A 2DENB 1VZ8A 2G45B 4BKSA 3Q3FA 4W9DA 2CHXA 3VTUA 3V05A 2V3SA 1KRHA 1I4RA 2MQJA 5JHBA 5GXGB 3UQAA 2J0JA 1SJHD 3M3JA 4B6WA 1TGZB 5T8IA 4A55A 2AYOB 1SE2A 3NS8A 2JY6A 5DCNA 1E7PB 3X23A 1I4GA 1AW7A 3R2IA 2J0MA 3C8YA 3PGEA 2K3UA 3JYUA 2MLBA 4MT5A 4O1NA 3APDA 4HJGE 2K6DB 5BMGA 3QQ8B 1F52A 4XZ4A 4BFRA 2OJWA 4B9KA 3MC0B 1ZPSA 4AOFA 4NY0A 4UDUC 2AQ3B 4C80A 1I4QA 2DZJA 1QOFA 2GB1A 4FJZA 3RNGC 1KOTA 3N1ZC 3OJ4B 1I4PA 2K9XA 3AEEB 1NBFC 2WGSA 5G55A 2LD9A 3P4PB 4IW0A 4TMAB 2KZRA 4RGTA 3AE1B 3Q2AC 2E6XA 1ENFA 4ZOHC 4K3CA 1JCKB 4I6LB 1ZW7A 3B0AA 1PQSA 1SF0A 2RPQA 1D4BA 2K5PA 5D7GA 3DBRI 1Q10A 2BB5A 2AQ1B 2NBVB 1VCBA 3FAHA 4ZYSA 1WXQA 4YTNB 1E5WA 1E0ZA 1XT9B 4JLCA 2L7RA 2LRUA 1FMAD 1YJJA 4N6EB 1K53A 2KAJA 2A5UA 3OAWA 3A9JA 3KVFB 2FIFA 5D3DA 2UYZB 2NCNA 3L4PA 3P42A 2RDBC 3BIID 3H1UA 3BVGA 5IOIA 2LVOA 1T0SC 4ITKA 2C7MB 2GI9A 4EOYA 3WAMA 2WU2B 1SE3A 1CK1A 1MVKA 3A4RA 2WS3B 2GOWA 2RR9A 4JIOU 3U30A 1V2YA 1VZ6A 3IAM1 3DBRB 4MJSB 3PLVA 4DDID 4GU2A 2WXMA 1Z2MA 4DHZB 4JGHB 1C4AA 2WXLA 2M4NA 3DOWA 2JT4B 1V49A 5GMVA 3N30A 2YEPF 3W1SC 5EE3A 3VDZA 1IYFA 1V80A 3RCZA 3Q8FA 4W9JA 1B1ZA 4OZBA 2OHFA 2ZCCA 2V1YA 4CHKA 3TEYA 4GN1A 2PKOA 1HTOA 2K1FA 1V1PB 4K1RB 4WQOB 4HPMB 3WAPA 3ZRCA 1KFYB 3R7RA 4KVGB 2LEKA 4WQMA 1YMHE 3V6CB 2EMSA 1C1YB 3KUDB 4HXDA 2WXHA 4NAMA 2KDMA 3B2FA 1QOGA 3H7PB 2PVGC 2KFKA 4ZRJA 3PT2B 3GZNB 2LHDA 2W3SA 1E6EB 3AE8B 1FFUA 1D5MC 1A5RA 1JWBD 2V4IB 2BB6A 4DK5A 2L3ZA 2QJLA 2KDEB 3RD2A 1UWXA 4W9FA 2FCSA 2OEDA 1NEKB 2KN5A 3HIZA 3MC8A 4KGTA 1TY2A 1YJIA 4WJQA 4KGRA 1MI0A 3DBSA 2D3GA 3ENEA 4FULA 1UELA 4OVZA 4GDLB 1TKEA 3U4EG 3JW0X 3APCA 2X8XX 1WRIA 4MSMB 3VUXA 5BYRA 2NMQA 2C7HA 3IT6B 3Q14C 3MHZA 2WXGA 2D3AA 1WSPA 1FD6A 4ICVA 3QC8B 4YSZB 1F1HA 2GBMA 2MJEA 3N32A 2VH2A 4EKUA 2NPTA 3NVWA 4AQ7A 4A8XC 1IP9A 1XLPA 5E6OA 1YQ3B 5C3JB 2Y3AA 3AECB 2DHZA 5HFYA 3SEBA 3R7QA 2FCQA 4BZAA 1ISNA 1U4AA 1VJKA 1RAXA 1AARA 2RDGA 4RGMA 4LNOA 3RNEC 3MC9A 2JZ3B 3R66C 1WI0A 4BBNF 2BS3B 4PS3A 4A3OA 3ZXRA 5EE1A 2MCNB 1BMLC 4MELA 3TIXA 2PE6B 2GRIA 4WJOA 4L23A 3AH7A 3Q8CA 3KWLA 1T3QA 4GDKB 5J2RA 4TKNA 1AWDA 1WGRA 4PS8A 4BKSD 4WIPA 4BAXA 3PRPB 1UF0A 2J53A 3ZUNA 2JYTA 1V5OA 2WQYB 4FHKA 1WM3A 4AS1A 4G50A 3VXWA 2N9EB 5BYSA 5BO4B 1VR9A 2J4XA 3BINA 4B0EA 2IZVB 3VAWA 2D3BA 4HCNB 2ZJDA 3Q8EA 1GJZA 4RF1A 2OJRA 2QILA 1KLUD 2LRWA 3FKYA 1EWYC 2LFIA 2LWPA 3MP9A 3K9OB 2EELA 2BW2A 1FO4A 2NVUI 2NBUA 3QHTA 5EE9A 3P63A 3UI3A 1XF5L 1F77A 1EF5A 3ML8A 4KV2A 2QCZA 1DOXA 1AN8A 4US9A 1IPGA 3VTVA 5JH5C 2IO3B 4RH6A 4HK2A 3OG5A 1DOYA 4PT5A 1Q5WB 2KMMA 1XO3A 3I57A 2MBHA 2CU3A 2WWZA 5D3IB 1SEBD 4IUMB 3ETRA 4C7YA 3RN9C 3KW5B 3AE2B 1E8WA 4USAA 5DPTA 2D5GA 1J8CA 2O6VA 3EGRA 5DPWA 1WJUA 2A4ZA 5BMHA 1YJ1A 3VHTC 3HUIA 4JE3B 4MEMA 3U7DA 1UBIA 4KX6B 3IXSA 2WXNA 4REZA 1MJDA 1P98A 2JF5A 1TYGB 3AE4B 2AX5A 2HE7A 1YN5A 2KLCA 2L1AA 2V9HA 2E3TA 2NBWB 3A9KA 3URYA 3ABVB 2CR5A 2WDQB 2L76A 3T9LA 3ZJUA 3O13A 1NI2A 4HKQA 2D11A 2BWES 4IKGA 3MFGA 3AE6B 2QDFA 4RM9A 5D94A 3NOBA 4K3BA 2HD5B 4IOIE 3H6NA 3M95A 3NS1A 4G3XB 4BKTA 3R2TA 2JU6X 3SDLC 4G0NB 2KQ4X 3S2AA 4DHJD 1L7YA 3UIPB 2AEHA 2M1MA 1V5TA 1N60A 1WZ3A 5E6NA 1RFAA 1F2RI 3ZDTA 3I63C 4HCPB 1MHHE 3LYYA 3Q3OC 4WJNA 4DXFA 1MFWA 3N9YC 1TT5B 2M0AA 3L13A 2N9LA 3JSVA 2LJ5A 3GP7A 4MGYE 1EO6A 5FR3A 2N7DA 5TSSA 4IG7B 2YLMA 3KWVA 1Q1OA 2UU7A 1WR1A 2K8CA 2L05A 3U52E 2LUEA 1L6UA 3TBLD 2MBQA 2LGIA 2LZ6A 3NY5A 4KKJA 4K7UA 3BVZA 1KF6B 3N1YC 5LXIB 3RYTA 3MJWA 4MSQB 5HKHA 1LFDA 2Q5WD 1IUEA 4A20A 4BOSC 4FADA 4HLEA 4MGKE 1STEA 1WZ0A 1QILA 1FXTB 1L4DB 2ON8A 3T8MA 4H2AA 4HDQA 2CKHB 1N6ZA 4EE2A 3KH0A 1QKZA 1WYWB 3W9CB 3AB5A 2FIDA 2KVRA 2L8JA 2IDYA 4AP4C 1FEHA 2XNAC 1GB4A 2YVCA 2KQ7A 3QK0A 3CF6E 3KYCD 3CMMB 3E9SA 1K50A 1EM7A 3E56A 2L52A 1RFKA 1ACCA 4MM3A 4DHZE 1J7AA 2G3QB 2IY0B 2PMVA 2BKRB 3PRZA 3ZVVA 3DBLB 3CSFA 2LVPA 4M0WA 4C4VA 3DPDA 1ZOYB 4LNKA 2KKCA 4GXBA 2SEBD 4IM3A 1F9JA 1EWCA 3PHWB 2GBNA 2BWFA 3J9CA 4DHJB 2LVQA 2ZPYA 2JVCA 3WCQA 1JQ4A 1D5ZC 1L5PA 1N62A 3W5UB 4GB9A 3AI5A 2D2QA 4ZRIA 3ZNID 2BKFA 4JWUC 3W1YA 3SFEB 4F7ZA 4LNFA 2Y5CA 1QLBB 1I35A 2KD0A 1LXDA 4KIKA 2WYQA 1Y56A 3BK2A 2C60A 3P2BA 4NAWB 1WY8A 1R4MI 2KFKB 1JMLA 3DHHC 1FM0D 3ALBA 4GIVA 3VUYA 4OZCA 1J0GA 2HJ1A 4DXGA 2C7NB 4BKGA 2G9HD 3RZFA 4I6NB 2GBJA 5J18A 3RFZB 1FRDA 2XEWA 4CYEA 4DDGD 1XD3B 3NUHB 4YSXB 2FAZA 3EC8A 2BYFA 4ANUA 3FILA 2JQRB 3ZQ4A 3PZ7A 1K51A 2NTTA 4F8CB 1RWSA 1IBXA 1T0QC 4A3PA 3AE9B 4NPNA 1JWMD 1XLNA 2WP9B 1N61A 1R4MB 3Q3NC 1UNSA 2AL6A 2D10A 2Y5PA 5C2TB 2L0TA 4ANWA 1H4RA 2MSED 3H8HA 3DBHI 2EMTA 2JXTA 4II2B 4ZRPA 4LK0M 3GE3C 1WH3A 1XXGA 1FCCC 1V81A 2NPTB 3PZ8A 2BYTA 1FNVA 2ZVOA 1OGWA 3WANA 4KDLB 2UWQA 4GMVA 2ZW0A 1GB1A 1UGMA 1L0VB 3GZNI 1TTNA 4PYZA 1XEEA 2K39A 2DYOA 2LGDA 2DNFA 2KWUB 2O6VD 2PEAA 1FXIA 3EHVA 1WGHA 1ZKHA 2KWVB 1EU4A 1KM7A 1PDXA 3DBHB 2AQ2B 3HM3A 4C7ZA 4YTPB 1SSNA 2AWTA 2PIAA 2VZKD 3AU5A 3A1QA 2KDBA
chains in the Genus database with same CATH topology
1TBEA 4GDKB 5J2RA 3AU4A 4TKNA 2J0KA 3M62B 4PS8A 1WGRA 4BKSD 2V4LA 4LDTB 3ZKJC 2KTRA 3L08A 3A1QB 3H9DA 4EZLA 2KMCA 4IWOA 3PRPB 4K7WA 3ZUNA 2MRPA 4FJYA 3ZW3A 2Z59B 3QAQA 3UGBB 4ZDVA 5EDSA 5C1ZA 1V5OA 2KTRB 2I1KA 1GC6A 1WE6A 3IHPC 1WM3A 3EFUA 4FHKA 2FNJB 4EEWA 3QJZA 4G50A 1C3TA 3LJ3A 4W9GA 2DZMA 3VXWA 2N9EB 3ML9A 3R3MA 4KIKB 4NQLB 5BO4B 3ZNHB 5TR5A 1GG3A 1V86A 3BINA 4IM2A 2IZVB 3DDCB 3PSEB 3VAWA 3PV1A 4AJWA 1HE8A 2EKEC 2BPSA 4HCNB 2L0FA 4YL8A 3TCAA 4W9KA 2ZJDA 2IY1B 2KK8A 4BBNC 1GJZA 3WALA 2K25A 5C23A 5JZEB 2JRIB 3MTNB 2OJRA 2N1VA 2DAFA 3WA0A 4FN2A 2LRWA 4W9CA 2KX3A 1YX5B 2LWPA 2Z0DB 2JZZA 3UQBA 4LJOB 1E90A 4LJPB 4NQKE 4PYUA 2RD0A 1M94A 2MBBB 1EUVB 3K9OB 4IWQA 2FCNA 3SHQA 1E8YA 2NVUI 4HJKA 4JL9A 4KSLC 2NBUA 3QHTA 4HWIB 4WJPA 1TZ1A 2BGFA 3V6EB 1XQQA 2IO0B 1EF5A 3BY4B 3ML8A 2MP2A 3QWZB 4KV2A 3EECA 2N9PC 2OOBB 2DZIA 4ANXA 3N3KB 5L83A 1IPGA 3VTVA 4E71A 2IO3B 2MW5A 4IC7B 5JH5C 4AJYB 4HK2A 4FBJB 2MP2B 2M8SA 2B3AA 3PZDA 3ZDMC 3SD5A 4EFOA 1V6EA 3PRMB 2MWSB 3RUIB 2IBIB 1NDDA 1Q5WB 4EZKA 2N1WA 2CHZA 3DQVA 3HK0A 1P0RA 4HPLB 4GGQA 4M8MA 2MBHA 2R2OA 2M0XA 2LGYA 2NR2A 2WWZA 3ZNZB 1WM2A 2KQSA 1YIWA 4ASWC 3RULA 3UIOB 1BT0A 1EF1A 4IUMB 2VRRB 1E7UA 3KW5B 1V9JA 1S1QB 2KDIA 5AZGA 1E8WA 1H8CA 2KMAA 2KO3A 1WXSA 3DVGX 5DPTA 2DX5B 1J8CA 3APFA 1UD7A 1R4NI 2O6VA 3VTWA 5DPWA 4MGZE 1LM8B 3VUWA 1WJUA 4ZRKA 2A4ZA 4XX5A 2KNBA 2KJHB 1LQBA 1YJ1A 1WXMA 2O6VB 3VHTC 4X57B 1OEYJ 4MEMA 3U7DA 1UBIA 3QARA 2PPHA 3IFWB 2WX1A 4K81A 1GNUA 4GSWA 4IM0A 2DENB 2CU1A 3ONSA 3UF8A 3U8ZA 1P98A 2JF5A 3HHMA 4FJVB 1SE9A 3VH4B 2G45B 4G11A 4BKSA 1Z5SB 3B1LX 3Q3FA 2D07B 2CHXA 3QCAA 4W9DA 3VTUA 2C9WB 2JWZA 2HE7A 2QHOA 2W9NA 2KLCA 2V3SA 4BVUC 2MQJA 4MH0E 5JHBA 3UQAA 3I3TB 2J0JA 3M3JA 3NZSA 4MGIE 4B6WA 2NBWB 2IO2B 4M8NA 3A9KA 2CR5A 3WIMA 2JUOA 2K8HA 2PJHA 4W9IA 1TGZB 2L76A 3T9LA 4W9EA 1Y8RC 2AYOB 3NS8A 1NI2A 2JY6A 3A9KB 4EZJA 2D11A 2XBBC 2NS5A 2BWES 5D6JB 5DCNA 5CHWA 2GMIC 2DYMA 3X23A 5CTRC 2KJRA 3PHXB 4JQWC 4RM9A 5D94A 2IO1B 3NOBA 2MA9B 2J0MA 1L2NA 4HDOA 2HD5B 3PGEA 2G4SA 3OJ3A 3H6NA 3M95A 5AZHA 3JYUA 4NJ7A 4G3XB 4E74A 2MLBA 3L16A 4FLHA 3DVNU 3HM6X 2M17A 3TMPB 4BKTA 1WE7A 4KSKC 3ZNGC 4NNJB 3APDA 3VVWB 5CX3A 2G4DB 3ECIA 2K6DB 3SDLC 3ZTDA 3JVZX 2KJ6A 3NZUA 2ZEQA 4G0NB 3PLUA 4E3CA 3QQ8B 4XZ4A 3S2AA 4DHJD 1L7YA 3QIJA 1UBQA 3RT3B 1WMHA 3UIPB 2AEHA 4BFRA 2M1MA 4B9KA 1V5TA 1WZ3A 3K9PB 5E6NA 1RFAA 4F1SA 2KDFB 1KLVA 4TUUA 3AULA 4NY0A 4GOCA 4NAWA 5G2NA 3ZDTA 2WX0A 1WMHB 4HCPB 4AOFA 1T0YA 3GOEA 2DZJA 4CO7A 3VQIA 5LLIA 4FJZA 4LDTD 4NJ6A 4WJNA 1KOTA 3OJ4B 2ZZPB 1NBFC 3L13A 3JSVA 2JXXA 5G55A 2LJ5A 3WAOA 1K8RB 2Z0EB 2LD9A 3DCGA 2REXA 4IW0A 2KZRA 4MGYE 1EO6A 2RSUA 3JSVB 2N7DA 4KZ0A 4IG7B 2YLMA 1Q1OA 3A4SC 4ICUA 3VH3B 2IYDB 3ZLZA 1WR1A 2K8CA 2L05A 4I6LB 1ZW7A 1E8ZA 1PQSA 2LUEA 1WF9A 2R2QA 3B0AA 2RPQA 3M63B 4OVUA 5D2MB 3TBLD 4BOZB 4EUTA 5AZFA 5D7GA 3DBRI 1I42A 2MBQA 3L17A 2LZ6A 3NY5A 4AUQC 1UZXB 3CSTA 4K7UA 3V61A 2NBVB 2DAJA 1VCBA 1E8XA 3RYTA 5LXIB 2HTHA 3MJWA 1E5WA 2FUHB 4MSQB 5HKHA 1LFDA 4KDIC 1XT9B 4JLCA 2L7RA 2LRUA 4A20A 4BOSC 4FADA 5IA7A 2KXJA 4HLEA 5JHAA 3PREA 2C5LC 2A5UA 4MGKE 3OAWA 3A9JA 1WZ0A 3KVFB 2ASQA 1GC7A 2FIFA 1FXTB 1JRUA 3LDZE 2UYZB 3W1SA 4W9LA 2NCNA 2KANA 3RZWC 3T8MA 2DZKA 2CKHB 3H1UA 4HDQA 2KC1A 3KH0A 2LVOA 2PE9A 5FR6A 2C7MB 3VFKA 1WGDA 1WYWB 2FIDA 2KVRA 4EOYA 2L8JA 2L00B 3WAMA 4AP4C 3PVLA 1YD8U 2N4FA 3PTFC 1P3QU 2ZNVC 4MJSA 2YVCA 3A4RA 2KWCA 2KQ7A 3IVFA 3QK0A 3CF6E 2GOWA 2RR9A 3CMMB 3KYCD 4JIOU 4DBGA 2BYEA 4P7IA 3IBEA 3U30A 1V2YA 1G6JA 4MJSB 3PLVA 2HJ8A 4DDID 4GU2A 3O65B 1Z2MA 4DHZB 4JGHB 4ANVA 3TL5A 2M4NA 3DOWA 4MM3A 5E6PA 4DHZE 2G3QB 2IY0B 2BKRB 2JT4B 3PRZA 1V49A 3ZVVA 5GMVA 3N30A 3W1SC 2ZPNA 3CSFA 2LVPA 3VDZA 1IYFA 1V80A 3RCZA 2DYBA 1OQYA 4W9JA 3NHEB 3DPDA 1WR6E 2KKCA 4GXBA 4IM3A 3D32A 1D3ZA 2ZCCA 1F9JA 1SIFA 2V1YA 2FCMA 3OLMD 1YQBA 4M0WB 4CHKA 1WFYA 4K7SA 3PHWB 2GBNA 1UH6A 2BWFA 5KHOA 4GN1A 4DHJB 2LVQA 4RM8A 2ZPYA 2K1FA 2JVCA 4GDKA 5LXHA 4WWOA 1QZEA 1OTRB 4GB9A 4K1RB 3Q3JA 3AI5A 4WQOB 4HPMB 2D2QA 4ZRIA 3WAPA 3ZRCA 4AWJA 2KC2A 3ZNID 2BKFA 4PS7A 3R7RA 4KVGB 3W1YA 2I1JA 4F7ZA 2XK5A 4W9HA 1RLFA 1S3SG 3H7PA 2LI5A 3TJPA 1I35A 3V6CB 2KD0A 2EMSA 1LXDA 1C1YB 4HVBA 3KUDB 4HXDA 2XK5B 5L95C 4KIKA 2WYQA 1YX6B 3H7PB 4II3B 1WX8A 3DVGY 1J19A 2C60A 2MBOA 4J6IA 2KFKA 2LGXA 3P2BA 4ZRJA 1WXVA 2JRHA 3PT2B 4NAWB 3X0WA 1WY8A 1R4MI 1OEYA 5KHQA 5AEKB 2KFKB 1WJ4A 4IWPA 3UINB 2KFJA 3H7SA 3ALBA 4GIVA 3VUYA 3AXCA 1A5RA 5J17A 4FHJA 1J0GA 4B95A 4DK5A 2L3ZA 2KDEB 2C7NB 4BKGA 3RD2A 3RZFA 3PPAA 4I6NB 2K8BA 2GBJA 4W9FA 3V62A 5J18A 3L0WB 1WXAA 2FCSA 2XEWA 4CYEA 4WAAA 1XD3B 4DDGD 1WX9A 2MX2A 2KN5A 3A33B 3HIZA 2J7QB 4WWPA 2ZCBA 1WX7A 2FAZA 2GBRA 1RRBA 2AL3A 1E7VA 3EC8A 4TQ1A 3KYDD 1MG8A 1X1MA 3ZTCA 3C0RB 2BYFA 2JPHA 4ANUA 1CMXB 4WJQA 2N9XA 3KUZA 4TQ0A 3DBSA 4GDLA 2D3GA 3ENEA 4LCDE 3DBLI 4FULA 1UELA 3QA8A 4F8CB 1Q0WB 2ZNVB 4A3PA 4GDLB 1SGHA 4NPNA 3KUCB 3DVNV 3APCA 3JW0X 4MSMB 3VUXA 2C7HA 2LASA 4MDKE 1ZGUB 2KTFA 2AL6A 2D10A 1KJTA 4I6PA 4ICVA 3QC8B 2L0TA 2BF8B 3ZIMA 4RMAA 4ANWA 3A9JB 1H4RA 2MSED 1GUAB 2GBMA 3DBHI 2EMTA 3N32A 5IAAC 3ZO5B 4II2B 3V60A 4EKUA 2NPTA 3QX1A 1IP9A 2KX0A 5CHVC 5E6OA 1WGYA 2LXAA 1WGGA 2KOXA 1WH3A 1V81A 2DHZA 4FA6A 2KHWB 4WWNA 3R7QA 2FCQA 2NPTB 2ZVNA 2BYVE 1ISNA 1U4AA 4OVVA 3B08A 5DPRA 5DPSA 2ZVOA 1OGWA 1VD2A 1RAXA 3WANA 3MHSD 2K6QA 1AARA 4KDLB 4ZYNA 4N9F4 4URKA 2UWQA 2LXCA 2Y5BB 1WIAA 4GMVA 2CHWA 3PS6A 1UGMA 2JZ3B 2N7EA 3GZNI 3R66C 1TTNA 4PYZA 2K39A 1WI0A 4BBNF 2RGFA 1P9DU 2DYOA 4XC2A 2LGDA 4PS3A 4A3OA 2KWUB 2O6VD 2PEAA 3IG3A 4DXAB 4TV3A 5CHFA 3EHVA 1WGHA 1WRDB 1ZKHA 3L54A 1WJNA 2KWVB 2CS4A 2O2VA 2MCNB 2KLGA 4MELA 3SU8X 1KM7A 4KZCA 2MBEA 3HM3A 3TIXA 4DWFA 2PE6B 3L10B 2AWTA 4WJOA 1P1AA 2O2VB 3ZRFA 1WJ6A 2GBKA 3AU5A 3A1QA 2WDTB 2KDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBE A;  4GDK B;  5J2R A;  3AU4 A;  4TKN A;  2J0K A;  3M62 B;  4PS8 A;  1WGR A;  4BKS D;  2V4L A;  4LDT B;  3ZKJ C;  2KTR A;  3L08 A;  3A1Q B;  3H9D A;  4EZL A;  2KMC A;  4IWO A;  3PRP B;  4K7W A;  3ZUN A;  2MRP A;  4FJY A;  3ZW3 A;  2Z59 B;  3QAQ A;  3UGB B;  4ZDV A;  5EDS A;  5C1Z A;  1V5O A;  2KTR B;  2I1K A;  1GC6 A;  1WE6 A;  3IHP C;  1WM3 A;  3EFU A;  4FHK A;  2FNJ B;  4EEW A;  3QJZ A;  4G50 A;  1C3T A;  3LJ3 A;  4W9G A;  2DZM A;  3VXW A;  2N9E B;  3ML9 A;  3R3M A;  4KIK B;  4NQL B;  5BO4 B;  3ZNH B;  5TR5 A;  1GG3 A;  1V86 A;  3BIN A;  4IM2 A;  2IZV B;  3DDC B;  3PSE B;  3VAW A;  3PV1 A;  4AJW A;  1HE8 A;  2EKE C;  2BPS A;  4HCN B;  2L0F A;  4YL8 A;  3TCA A;  4W9K A;  2ZJD A;  2IY1 B;  2KK8 A;  4BBN C;  1GJZ A;  3WAL A;  2K25 A;  5C23 A;  5JZE B;  2JRI B;  3MTN B;  2OJR A;  2N1V A;  2DAF A;  3WA0 A;  4FN2 A;  2LRW A;  4W9C A;  2KX3 A;  1YX5 B;  2LWP A;  2Z0D B;  2JZZ A;  3UQB A;  4LJO B;  1E90 A;  4LJP B;  4NQK E;  4PYU A;  2RD0 A;  1M94 A;  2MBB B;  1EUV B;  3K9O B;  4IWQ A;  2FCN A;  3SHQ A;  1E8Y A;  2NVU I;  4HJK A;  4JL9 A;  4KSL C;  2NBU A;  3QHT A;  4HWI B;  4WJP A;  1TZ1 A;  2BGF A;  3V6E B;  1XQQ A;  2IO0 B;  1EF5 A;  3BY4 B;  3ML8 A;  2MP2 A;  3QWZ B;  4KV2 A;  3EEC A;  2N9P C;  2OOB B;  2DZI A;  4ANX A;  3N3K B;  5L83 A;  1IPG A;  3VTV A;  4E71 A;  2IO3 B;  2MW5 A;  4IC7 B;  5JH5 C;  4AJY B;  4HK2 A;  4FBJ B;  2MP2 B;  2M8S A;  2B3A A;  3PZD A;  3ZDM C;  3SD5 A;  4EFO A;  1V6E A;  3PRM B;  2MWS B;  3RUI B;  2IBI B;  1NDD A;  1Q5W B;  4EZK A;  2N1W A;  2CHZ A;  3DQV A;  3HK0 A;  1P0R A;  4HPL B;  4GGQ A;  4M8M A;  2MBH A;  2R2O A;  2M0X A;  2LGY A;  2NR2 A;  2WWZ A;  3ZNZ B;  1WM2 A;  2KQS A;  1YIW A;  4ASW C;  3RUL A;  3UIO B;  1BT0 A;  1EF1 A;  4IUM B;  2VRR B;  1E7U A;  3KW5 B;  1V9J A;  1S1Q B;  2KDI A;  5AZG A;  1E8W A;  1H8C A;  2KMA A;  2KO3 A;  1WXS A;  3DVG X;  5DPT A;  2DX5 B;  1J8C A;  3APF A;  1UD7 A;  1R4N I;  2O6V A;  3VTW A;  5DPW A;  4MGZ E;  1LM8 B;  3VUW A;  1WJU A;  4ZRK A;  2A4Z A;  4XX5 A;  2KNB A;  2KJH B;  1LQB A;  1YJ1 A;  1WXM A;  2O6V B;  3VHT C;  4X57 B;  1OEY J;  4MEM A;  3U7D A;  1UBI A;  3QAR A;  2PPH A;  3IFW B;  2WX1 A;  4K81 A;  1GNU A;  4GSW A;  4IM0 A;  2DEN B;  2CU1 A;  3ONS A;  3UF8 A;  3U8Z A;  1P98 A;  2JF5 A;  3HHM A;  4FJV B;  1SE9 A;  3VH4 B;  2G45 B;  4G11 A;  4BKS A;  1Z5S B;  3B1L X;  3Q3F A;  2D07 B;  2CHX A;  3QCA A;  4W9D A;  3VTU A;  2C9W B;  2JWZ A;  2HE7 A;  2QHO A;  2W9N A;  2KLC A;  2V3S A;  4BVU C;  2MQJ A;  4MH0 E;  5JHB A;  3UQA A;  3I3T B;  2J0J A;  3M3J A;  3NZS A;  4MGI E;  4B6W A;  2NBW B;  2IO2 B;  4M8N A;  3A9K A;  2CR5 A;  3WIM A;  2JUO A;  2K8H A;  2PJH A;  4W9I A;  1TGZ B;  2L76 A;  3T9L A;  4W9E A;  1Y8R C;  2AYO B;  3NS8 A;  1NI2 A;  2JY6 A;  3A9K B;  4EZJ A;  2D11 A;  2XBB C;  2NS5 A;  2BWE S;  5D6J B;  5DCN A;  5CHW A;  2GMI C;  2DYM A;  3X23 A;  5CTR C;  2KJR A;  3PHX B;  4JQW C;  4RM9 A;  5D94 A;  2IO1 B;  3NOB A;  2MA9 B;  2J0M A;  1L2N A;  4HDO A;  2HD5 B;  3PGE A;  2G4S A;  3OJ3 A;  3H6N A;  3M95 A;  5AZH A;  3JYU A;  4NJ7 A;  4G3X B;  4E74 A;  2MLB A;  3L16 A;  4FLH A;  3DVN U;  3HM6 X;  2M17 A;  3TMP B;  4BKT A;  1WE7 A;  4KSK C;  3ZNG C;  4NNJ B;  3APD A;  3VVW B;  5CX3 A;  2G4D B;  3ECI A;  2K6D B;  3SDL C;  3ZTD A;  3JVZ X;  2KJ6 A;  3NZU A;  2ZEQ A;  4G0N B;  3PLU A;  4E3C A;  3QQ8 B;  4XZ4 A;  3S2A A;  4DHJ D;  1L7Y A;  3QIJ A;  1UBQ A;  3RT3 B;  1WMH A;  3UIP B;  2AEH A;  4BFR A;  2M1M A;  4B9K A;  1V5T A;  1WZ3 A;  3K9P B;  5E6N A;  1RFA A;  4F1S A;  2KDF B;  1KLV A;  4TUU A;  3AUL A;  4NY0 A;  4GOC A;  4NAW A;  5G2N A;  3ZDT A;  2WX0 A;  1WMH B;  4HCP B;  4AOF A;  1T0Y A;  3GOE A;  2DZJ A;  4CO7 A;  3VQI A;  5LLI A;  4FJZ A;  4LDT D;  4NJ6 A;  4WJN A;  1KOT A;  3OJ4 B;  2ZZP B;  1NBF C;  3L13 A;  3JSV A;  2JXX A;  5G55 A;  2LJ5 A;  3WAO A;  1K8R B;  2Z0E B;  2LD9 A;  3DCG A;  2REX A;  4IW0 A;  2KZR A;  4MGY E;  1EO6 A;  2RSU A;  3JSV B;  2N7D A;  4KZ0 A;  4IG7 B;  2YLM A;  1Q1O A;  3A4S C;  4ICU A;  3VH3 B;  2IYD B;  3ZLZ A;  1WR1 A;  2K8C A;  2L05 A;  4I6L B;  1ZW7 A;  1E8Z A;  1PQS A;  2LUE A;  1WF9 A;  2R2Q A;  3B0A A;  2RPQ A;  3M63 B;  4OVU A;  5D2M B;  3TBL D;  4BOZ B;  4EUT A;  5AZF A;  5D7G A;  3DBR I;  1I42 A;  2MBQ A;  3L17 A;  2LZ6 A;  3NY5 A;  4AUQ C;  1UZX B;  3CST A;  4K7U A;  3V61 A;  2NBV B;  2DAJ A;  1VCB A;  1E8X A;  3RYT A;  5LXI B;  2HTH A;  3MJW A;  1E5W A;  2FUH B;  4MSQ B;  5HKH A;  1LFD A;  4KDI C;  1XT9 B;  4JLC A;  2L7R A;  2LRU A;  4A20 A;  4BOS C;  4FAD A;  5IA7 A;  2KXJ A;  4HLE A;  5JHA A;  3PRE A;  2C5L C;  2A5U A;  4MGK E;  3OAW A;  3A9J A;  1WZ0 A;  3KVF B;  2ASQ A;  1GC7 A;  2FIF A;  1FXT B;  1JRU A;  3LDZ E;  2UYZ B;  3W1S A;  4W9L A;  2NCN A;  2KAN A;  3RZW C;  3T8M A;  2DZK A;  2CKH B;  3H1U A;  4HDQ A;  2KC1 A;  3KH0 A;  2LVO A;  2PE9 A;  5FR6 A;  2C7M B;  3VFK A;  1WGD A;  1WYW B;  2FID A;  2KVR A;  4EOY A;  2L8J A;  2L00 B;  3WAM A;  4AP4 C;  3PVL A;  1YD8 U;  2N4F A;  3PTF C;  1P3Q U;  2ZNV C;  4MJS A;  2YVC A;  3A4R A;  2KWC A;  2KQ7 A;  3IVF A;  3QK0 A;  3CF6 E;  2GOW A;  2RR9 A;  3CMM B;  3KYC D;  4JIO U;  4DBG A;  2BYE A;  4P7I A;  3IBE A;  3U30 A;  1V2Y A;  1G6J A;  4MJS B;  3PLV A;  2HJ8 A;  4DDI D;  4GU2 A;  3O65 B;  1Z2M A;  4DHZ B;  4JGH B;  4ANV A;  3TL5 A;  2M4N A;  3DOW A;  4MM3 A;  5E6P A;  4DHZ E;  2G3Q B;  2IY0 B;  2BKR B;  2JT4 B;  3PRZ A;  1V49 A;  3ZVV A;  5GMV A;  3N30 A;  3W1S C;  2ZPN A;  3CSF A;  2LVP A;  3VDZ A;  1IYF A;  1V80 A;  3RCZ A;  2DYB A;  1OQY A;  4W9J A;  3NHE B;  3DPD A;  1WR6 E;  2KKC A;  4GXB A;  4IM3 A;  3D32 A;  1D3Z A;  2ZCC A;  1F9J A;  1SIF A;  2V1Y A;  2FCM A;  3OLM D;  1YQB A;  4M0W B;  4CHK A;  1WFY A;  4K7S A;  3PHW B;  2GBN A;  1UH6 A;  2BWF A;  5KHO A;  4GN1 A;  4DHJ B;  2LVQ A;  4RM8 A;  2ZPY A;  2K1F A;  2JVC A;  4GDK A;  5LXH A;  4WWO A;  1QZE A;  1OTR B;  4GB9 A;  4K1R B;  3Q3J A;  3AI5 A;  4WQO B;  4HPM B;  2D2Q A;  4ZRI A;  3WAP A;  3ZRC A;  4AWJ A;  2KC2 A;  3ZNI D;  2BKF A;  4PS7 A;  3R7R A;  4KVG B;  3W1Y A;  2I1J A;  4F7Z A;  2XK5 A;  4W9H A;  1RLF A;  1S3S G;  3H7P A;  2LI5 A;  3TJP A;  1I35 A;  3V6C B;  2KD0 A;  2EMS A;  1LXD A;  1C1Y B;  4HVB A;  3KUD B;  4HXD A;  2XK5 B;  5L95 C;  4KIK A;  2WYQ A;  1YX6 B;  3H7P B;  4II3 B;  1WX8 A;  3DVG Y;  1J19 A;  2C60 A;  2MBO A;  4J6I A;  2KFK A;  2LGX A;  3P2B A;  4ZRJ A;  1WXV A;  2JRH A;  3PT2 B;  4NAW B;  3X0W A;  1WY8 A;  1R4M I;  1OEY A;  5KHQ A;  5AEK B;  2KFK B;  1WJ4 A;  4IWP A;  3UIN B;  2KFJ A;  3H7S A;  3ALB A;  4GIV A;  3VUY A;  3AXC A;  1A5R A;  5J17 A;  4FHJ A;  1J0G A;  4B95 A;  4DK5 A;  2L3Z A;  2KDE B;  2C7N B;  4BKG A;  3RD2 A;  3RZF A;  3PPA A;  4I6N B;  2K8B A;  2GBJ A;  4W9F A;  3V62 A;  5J18 A;  3L0W B;  1WXA A;  2FCS A;  2XEW A;  4CYE A;  4WAA A;  1XD3 B;  4DDG D;  1WX9 A;  2MX2 A;  2KN5 A;  3A33 B;  3HIZ A;  2J7Q B;  4WWP A;  2ZCB A;  1WX7 A;  2FAZ A;  2GBR A;  1RRB A;  2AL3 A;  1E7V A;  3EC8 A;  4TQ1 A;  3KYD D;  1MG8 A;  1X1M A;  3ZTC A;  3C0R B;  2BYF A;  2JPH A;  4ANU A;  1CMX B;  4WJQ A;  2N9X A;  3KUZ A;  4TQ0 A;  3DBS A;  4GDL A;  2D3G A;  3ENE A;  4LCD E;  3DBL I;  4FUL A;  1UEL A;  3QA8 A;  4F8C B;  1Q0W B;  2ZNV B;  4A3P A;  4GDL B;  1SGH A;  4NPN A;  3KUC B;  3DVN V;  3APC A;  3JW0 X;  4MSM B;  3VUX A;  2C7H A;  2LAS A;  4MDK E;  1ZGU B;  2KTF A;  2AL6 A;  2D10 A;  1KJT A;  4I6P A;  4ICV A;  3QC8 B;  2L0T A;  2BF8 B;  3ZIM A;  4RMA A;  4ANW A;  3A9J B;  1H4R A;  2MSE D;  1GUA B;  2GBM A;  3DBH I;  2EMT A;  3N32 A;  5IAA C;  3ZO5 B;  4II2 B;  3V60 A;  4EKU A;  2NPT A;  3QX1 A;  1IP9 A;  2KX0 A;  5CHV C;  5E6O A;  1WGY A;  2LXA A;  1WGG A;  2KOX A;  1WH3 A;  1V81 A;  2DHZ A;  4FA6 A;  2KHW B;  4WWN A;  3R7Q A;  2FCQ A;  2NPT B;  2ZVN A;  2BYV E;  1ISN A;  1U4A A;  4OVV A;  3B08 A;  5DPR A;  5DPS A;  2ZVO A;  1OGW A;  1VD2 A;  1RAX A;  3WAN A;  3MHS D;  2K6Q A;  1AAR A;  4KDL B;  4ZYN A;  4N9F 4;  4URK A;  2UWQ A;  2LXC A;  2Y5B B;  1WIA A;  4GMV A;  2CHW A;  3PS6 A;  1UGM A;  2JZ3 B;  2N7E A;  3GZN I;  3R66 C;  1TTN A;  4PYZ A;  2K39 A;  1WI0 A;  4BBN F;  2RGF A;  1P9D U;  2DYO A;  4XC2 A;  2LGD A;  4PS3 A;  4A3O A;  2KWU B;  2O6V D;  2PEA A;  3IG3 A;  4DXA B;  4TV3 A;  5CHF A;  3EHV A;  1WGH A;  1WRD B;  1ZKH A;  3L54 A;  1WJN A;  2KWV B;  2CS4 A;  2O2V A;  2MCN B;  2KLG A;  4MEL A;  3SU8 X;  1KM7 A;  4KZC A;  2MBE A;  3HM3 A;  3TIX A;  4DWF A;  2PE6 B;  3L10 B;  2AWT A;  4WJO A;  1P1A A;  2O2V B;  3ZRF A;  1WJ6 A;  2GBK A;  3AU5 A;  3A1Q A;  2WDT B;  2KDB A; 
#chains in the Genus database with same CATH topology
 3VRB B;  2J0K A;  4XDD A;  3EFC A;  3ZKJ C;  1XCT L;  2KTR A;  2KMC A;  1YNT E;  4K7W A;  2MRP A;  4FJY A;  3ZW3 A;  3QAQ A;  1ZXH A;  3I5J C;  5EDS A;  4M00 A;  2CJN A;  3QJZ A;  2BS4 B;  4C56 C;  2JSV X;  3ZNH B;  1GG3 A;  4IM2 A;  3DDC B;  1BXT A;  3PSE B;  1JW9 D;  4JPS A;  2FBW B;  2BPS A;  2BT6 A;  2IY1 B;  3WAL A;  3AEG B;  1QT9 A;  2K25 A;  2JRI B;  1FRR A;  4FN2 A;  4W9C A;  1TS3 A;  4CQN A;  2RD0 A;  2MBB B;  2HDE A;  4IWQ A;  3SHQ A;  2DBY A;  1E8Y A;  4HJK A;  2PTL A;  4B0M A;  3V6E B;  5IP4 D;  2W82 A;  3BY4 B;  2MP2 A;  1UGJ A;  1QOB A;  1PYW D;  3AE5 B;  2J42 A;  2X38 A;  3LB8 C;  3PZD A;  1V6E A;  3PRM B;  2NTS A;  2JWU A;  1MHX A;  3IAS 1;  4EZK A;  2N1W A;  3HK0 A;  1P0R A;  4HPL B;  4GGQ A;  2NR2 A;  4TSS A;  1NI3 A;  2VRR B;  4JX1 C;  2BTE A;  1HZ6 A;  1NVI D;  3NVV A;  3NVY A;  3I9V 1;  2KO3 A;  3DVG X;  2N0S B;  4DQO C;  2XN9 C;  4OZA A;  4ZRK A;  2O6V B;  1OEY J;  4P16 A;  3QAR A;  1DOI A;  1YQ4 B;  3U8Z A;  4FJV B;  1SE9 A;  3AE3 B;  4G11 A;  1Z5S B;  2VZK B;  3B1L X;  4RGN A;  3QCA A;  1J7B A;  1ZDX A;  4N59 A;  2C9W B;  2JWZ A;  4LNI A;  2W9N A;  4BVU C;  1LGR A;  3NZS A;  4MGI E;  2IO2 B;  1I4H A;  1TKG A;  1V97 A;  4W9I A;  4XDC A;  2QEJ C;  3A9K B;  2XBB C;  2NS5 A;  3AMZ A;  5D6J B;  4ACF A;  2DYM A;  4C00 A;  3VRA B;  4JQW C;  1ZDV A;  3TEX A;  2QC8 A;  1GAQ B;  1L2N A;  4HDO A;  1V1P A;  3R8B A;  4NJ7 A;  3L16 A;  2LJI A;  3DVN U;  3TMP B;  1B9R A;  1WE7 A;  3VVW B;  4LNN A;  4YWG G;  5CX3 A;  1XCQ L;  3ECI A;  4A9A A;  3NZU A;  2KJ6 A;  2ZEQ A;  3PLU A;  4E3C A;  3RT3 B;  4RCO A;  1WMH A;  1ZP0 B;  4NJC A;  3K9P B;  4OW0 A;  2K22 A;  1KLV A;  5G2N A;  2WX0 A;  1T0Y A;  1FPY A;  1YN3 A;  4LDT D;  4NJ6 A;  2ZZP B;  2M19 A;  1WWT A;  1K8R B;  2Z0E B;  1QF6 A;  3DCG A;  2REX A;  3JSV B;  2WLB A;  4YT0 B;  3BZD B;  3AM9 A;  3VH3 B;  4ICU A;  3ZLZ A;  1C9F A;  1E8Z A;  2R2Q A;  4EUT A;  4BOZ B;  2HTM E;  1TS5 A;  3L17 A;  1V8C A;  1UZX B;  3V61 A;  1JRO A;  2HTH A;  2FUH B;  3DWM A;  2MH7 A;  4KDI C;  3BWU D;  3V3X A;  2KXJ A;  2LGS A;  5JHA A;  2C5L C;  3Q8B A;  1GC7 A;  2WXQ A;  2R61 A;  1E9M A;  1IGD A;  2KAN A;  3RZW C;  2K0P A;  2KC1 A;  2PE9 A;  4ZRQ A;  3VFK A;  5I4D A;  2L00 B;  3PVL A;  1YD8 U;  2N4F A;  2D3C A;  2G1E A;  3PTF C;  2ZNV C;  2KWC A;  4L2Y A;  3HVZ A;  1FCL A;  4P7I A;  1TZO A;  1LO5 D;  4XWW A;  4MM3 B;  2DYB A;  2WXP A;  1OQY A;  3NHE B;  4ZHO A;  2IGD A;  1SIF A;  2FCM A;  3OLM D;  4M0W B;  4K7S A;  1NYQ A;  5KHO A;  2KYW A;  1OFF A;  1ESF A;  4RM8 A;  1SJE D;  3TEW A;  4GDK A;  4QAY A;  5LXH A;  3DHG C;  1CQV A;  1OTR B;  3Q3J A;  2XK5 A;  4W9H A;  1L0X B;  1S3S G;  3NJT A;  2LI5 A;  3TJP A;  5E6J A;  3BYY B;  4HVB A;  1YX6 B;  4II3 B;  1WX8 A;  1FFV A;  1J19 A;  2PW9 A;  2MBO A;  4J6I A;  2WXO A;  3Q8A A;  1CJE A;  2QIE B;  1AYF A;  2H89 B;  3AXC A;  5J17 A;  4B95 A;  3PPA A;  2K8B A;  3V62 A;  3L0W B;  1WXA A;  1TS4 A;  1KTK A;  4WAA A;  2MX2 A;  3A33 B;  2J7Q B;  4WWP A;  1JRP A;  2ZCB A;  3N20 C;  1RRB A;  2AL3 A;  4TQ1 A;  3KYD D;  1MG8 A;  1X1M A;  3C0R B;  2JPH A;  1CMX B;  1N5W A;  2N9X A;  3KUZ A;  3VR9 B;  3DBL I;  3U7Z A;  3FIL B;  3QA8 A;  1SGH A;  4RNA A;  2LAS A;  4MDK E;  1VDV A;  1T0R C;  1SBB B;  1ZGU B;  2KTF A;  1I4X A;  3RNF C;  4I6P A;  4LTU A;  2DWQ A;  3ZIM A;  3A9J B;  5IAA C;  1HEZ E;  3V60 A;  3AED B;  2MEK A;  1WGY A;  2LXA A;  1WGG A;  2KOX A;  1PGA A;  2W3R A;  4FA6 A;  2KHW B;  4WWN A;  4JWS C;  1MG4 A;  4OVV A;  2KAC A;  2FE8 A;  1VD2 A;  3LXF A;  3MHS D;  2BS2 B;  3GE8 C;  2LMC A;  3IT4 B;  2N7E A;  3RNB C;  5BYQ A;  3PO0 A;  4XC2 A;  3IG3 A;  1WRD B;  3L54 A;  1WJN A;  2O2V A;  2CS4 A;  4N58 A;  4MAC A;  1SIJ A;  2KLG A;  4KZC A;  1P1A A;  2I38 A;  3GS2 A;  1XLQ A;  3ZYY X;  2V4L A;  2RPV A;  2KT7 A;  1NYR A;  3L08 A;  3A1Q B;  1R4N B;  3H9D A;  1JWS D;  3UGB B;  5C1Z A;  3RMK C;  2KTR B;  2IND C;  2I1K A;  1GC6 A;  4EEW A;  3EFU A;  2FNJ B;  2H88 B;  4D2K A;  1C3T A;  3LJ3 A;  4WAF A;  5HI1 A;  2WXI A;  4W9G A;  2BVC A;  1P7F A;  3R3M A;  4WUR A;  3TSS A;  3AV8 A;  4AJW A;  1HE8 A;  4YL8 A;  2L0F A;  3TCA A;  4W9K A;  4BBN C;  1L0Y B;  2V3N A;  5C23 A;  2DLB A;  1T5X D;  3MTN B;  2N1V A;  2DAF A;  2KX3 A;  1GOZ A;  2Z0D B;  4LJO B;  4LJP B;  4NQK E;  1M4V A;  1M94 A;  1EUV B;  4JL9 A;  3SR6 A;  2TSS A;  2BGF A;  1XQQ A;  3QWZ B;  3U2S C;  2OOB B;  1HA5 A;  2DZI A;  2MJD A;  4E71 A;  2INP E;  4IC7 B;  4FBJ B;  2MP2 B;  2M8S A;  1VRA B;  4EFO A;  1ET6 A;  1R7S A;  2MWS B;  4M02 A;  1NDD A;  1HQR D;  2CHZ A;  3DQV A;  1FNW A;  4M8M A;  2FUG 1;  1WM2 A;  2KQS A;  4ASW C;  3RUL A;  3Q3M C;  3UIO B;  1BT0 A;  1EF1 A;  4RFB A;  1D5X C;  4ARI A;  4P1B C;  5LNK 1;  4S17 A;  2KDI A;  2WHI A;  3SFD B;  1I7H A;  4MGZ E;  2V0G A;  3VUW A;  2KNB A;  1TS2 A;  2KJH B;  2IPK D;  3GB1 A;  5AUI A;  2Z8L A;  4IDI A;  1TIF A;  2PPH A;  1JWU D;  5FK9 C;  1GNU A;  4GSW A;  2CU1 A;  3ONS A;  3UF8 A;  3T3O A;  2EKI A;  3AEF B;  3HHM A;  5H8Y E;  5AUK A;  3VH4 B;  2B76 B;  2WXK A;  5HG2 A;  2D07 B;  4KGS A;  2QHO A;  1TJE A;  4MH0 E;  3MJ5 A;  3I3T B;  1E10 A;  4M8N A;  3VR8 B;  3EA6 A;  3WIM A;  4Q2J A;  2JUO A;  2K8H A;  2PJH A;  3B2G A;  3HVD A;  3NRZ A;  3RPF C;  4W9E A;  1Y8R C;  4EZJ A;  1C78 A;  4KKI A;  2GMI C;  5CHW A;  5CTR C;  3T3N A;  2KJR A;  2WNM A;  3AE7 B;  3PHX B;  1HTQ A;  2IO1 B;  3AEB B;  2MA9 B;  2G4S A;  3OJ3 A;  1ZUD 2;  5AZH A;  4E74 A;  4LLG M;  4FLH A;  3KLS X;  3HM6 X;  2MJ3 A;  2M17 A;  4GLS C;  4KSK C;  3ZNG C;  4NNJ B;  3RI7 C;  5BMI A;  2G4D B;  4FXC A;  4R3D A;  3ZTD A;  3JVZ X;  2RMM A;  1WYG A;  3QIJ A;  1UBQ A;  1OQQ A;  2JYE A;  4YTM B;  4F1S A;  2KDF B;  4TUU A;  3AUL A;  4GOC A;  4NAW A;  1WMH B;  1D6E C;  1CZP A;  3GOE A;  4CO7 A;  3VQI A;  5LLI A;  1PUT A;  2BQQ A;  1P7E A;  1C4P A;  3ZGZ A;  4M01 A;  2JXX A;  3WAO A;  4YXD B;  3HRD D;  4WH4 A;  2RSU A;  3Q6B A;  4KZ0 A;  1V1O A;  2MHJ A;  4XE0 A;  1YOV B;  3A4S C;  2IYD B;  4HRO A;  3FC4 A;  1WF9 A;  3M63 B;  5D2M B;  2M56 B;  4OVU A;  5AZF A;  2LHE A;  2W54 A;  4RF0 A;  1I42 A;  1IGC A;  1RM6 C;  4XGA B;  4AUQ C;  3CST A;  2DAJ A;  1E8X A;  1TY0 A;  3AEA B;  2V3P A;  1BUI C;  2VH1 A;  5IA7 A;  2INN E;  3PRE A;  1L4Z B;  2ASQ A;  2ZW1 A;  5G5H A;  3W2D A;  1JRU A;  1QOA A;  3LDZ E;  3W1S A;  4W9L A;  2JZP A;  4L1B A;  2DZK A;  1N63 A;  5FR6 A;  4XWT A;  1WGD A;  1TKY A;  3CWI A;  1P3Q U;  4MJS A;  3IVF A;  4DBG A;  2BYE A;  3IBE A;  1G6J A;  2HJ8 A;  1PGB A;  2J52 A;  3O65 B;  3P1M A;  4ANV A;  3TL5 A;  2WDV B;  3BVM A;  5E6P A;  2ONQ A;  1PGX A;  3EUB 2;  1JAL A;  2ZPN A;  2IGG A;  4WWM A;  1WR6 E;  3D32 A;  3RNA C;  1D3Z A;  1YQB A;  1WFY A;  4MH8 A;  1ET9 A;  1UUP A;  1UH6 A;  1OQR A;  4WWO A;  1QZE A;  4J3O D;  4YSY B;  4A90 A;  4AWJ A;  2KC2 A;  4PS7 A;  2I1J A;  2JX5 A;  1RLF A;  3H7P A;  1UWM A;  3C19 A;  2W55 A;  2XK5 B;  5L95 C;  2GLS A;  3DVG Y;  2LGX A;  2WU5 B;  2L32 A;  1WXV A;  3W5V B;  2JRH A;  3X0W A;  1OEY A;  2KN4 A;  5KHQ A;  2ICI A;  5AEK B;  1WJ4 A;  4IWP A;  3OWE B;  2KFJ A;  1SE4 A;  3UIN B;  3H7S A;  5MPO A;  4FHJ A;  1L6V A;  1DGJ A;  3ZXV A;  3DWG C;  1DYQ A;  1HZ5 A;  2KVZ A;  5JXV A;  1WX9 A;  4HRS A;  1XLO A;  4OHJ A;  1WX7 A;  2GBR A;  1E7V A;  5EE0 A;  4XYC A;  1K52 A;  3ZTC A;  4NZL B;  3RNC C;  3P4R B;  2IGH A;  1ZE3 D;  4TQ0 A;  4GDL A;  4LCD E;  2L83 A;  5FKA C;  1Q0W B;  2ZNV B;  3KUC B;  3DVN V;  5IO9 A;  2WDR B;  3P4Q B;  1PFD A;  2WXF A;  1KJT A;  1RYJ A;  1C79 A;  2ACZ B;  2BF8 B;  3KQ4 A;  2N7J A;  4RMA A;  2PVO D;  4A6Q A;  1GUA B;  1VLB A;  3ZO5 B;  3QX1 A;  2KX0 A;  5CHV C;  4US8 A;  1KH0 A;  1QQR A;  3CIR B;  1KLG D;  2BBC A;  2ZVN A;  2BYV E;  1FXA A;  4RGO S;  5DPR A;  3B08 A;  5DPS A;  3TEZ A;  2INC C;  1J7C A;  2K6Q A;  3B9J A;  4ZYN A;  4N9F 4;  5IKC M;  4URK A;  2LXC A;  2Y5B B;  1WIA A;  2CHW A;  1VZ7 A;  3ZJT A;  2WXR A;  3PS6 A;  2LUM A;  3P4S B;  1FNU A;  1JWA D;  2RGF A;  4ZHP A;  1P9D U;  2SAK A;  4S0R A;  4HEA 1;  4C4V B;  4P6V F;  4DXA B;  4TV3 A;  5CHF A;  2PLP A;  5H92 C;  3ZJV A;  3SU8 X;  2MBE A;  2KWD A;  4DWF A;  3L10 B;  2O2V B;  3ZRF A;  1WJ6 A;  2GBK A;  3DHI C;  5IN7 A;  2WDT B;  1TBE A;  3AU4 A;  1T6B X;  3M62 B;  2YEP B;  4LDT B;  1C76 A;  1N5X A;  3Q69 A;  4EZL A;  4IWO A;  2Z59 B;  4ZDV A;  3IHP C;  1WE6 A;  3BK1 A;  2WXJ A;  2RDH A;  1SXT A;  2DZM A;  3ML9 A;  4KIK B;  4NQL B;  4HPP A;  2CJO A;  5TR5 A;  1V86 A;  3PV1 A;  1WGK A;  2EKE C;  2KK8 A;  3BYT B;  1A70 A;  5JZE B;  3WA0 A;  3NVZ A;  1FIQ A;  1YX5 B;  3UQB A;  2JZZ A;  1SB3 C;  1E90 A;  4PYU A;  4P1C C;  1EU3 A;  5HHD G;  5G5G A;  2FCN A;  3NZ3 A;  4KSL C;  1ROE A;  4HWI B;  4WJP A;  1TZ1 A;  1ZXI A;  4PK1 A;  2IO0 B;  3TUO A;  3EEC A;  2N9P C;  4ANX A;  3N3K B;  5L83 A;  2MW5 A;  4AJY B;  2B3A A;  3ZDM C;  3SD5 A;  1MPE A;  3N1X C;  3RUI B;  2IBI B;  1IBX B;  1C77 A;  1YN4 A;  3NG0 A;  2R2O A;  2M0X A;  2LGY A;  3ZNZ B;  1YIW A;  1C4C A;  1F0Z A;  1E7U A;  1V9J A;  1S1Q B;  3AN1 A;  2QSD A;  1HXY D;  5AZG A;  1H8C A;  2KMA A;  1WXS A;  2N9K A;  2DX5 B;  1GPX A;  3APF A;  1UD7 A;  2I2Y A;  1R4N I;  4HKZ E;  3VTW A;  1NEN B;  1LM8 B;  2QMT A;  4XX5 A;  1LQB A;  1WXM A;  4X57 B;  1F2R C;  3IFW B;  2WX1 A;  4K81 A;  4ARC A;  4IM0 A;  2IJ0 A;  2DEN B;  1VZ8 A;  2G45 B;  4BKS A;  3Q3F A;  4W9D A;  2CHX A;  3VTU A;  3V05 A;  2V3S A;  1KRH A;  1I4R A;  2MQJ A;  5JHB A;  5GXG B;  3UQA A;  2J0J A;  1SJH D;  3M3J A;  4B6W A;  1TGZ B;  5T8I A;  4A55 A;  2AYO B;  1SE2 A;  3NS8 A;  2JY6 A;  5DCN A;  1E7P B;  3X23 A;  1I4G A;  1AW7 A;  3R2I A;  2J0M A;  3C8Y A;  3PGE A;  2K3U A;  3JYU A;  2MLB A;  4MT5 A;  4O1N A;  3APD A;  4HJG E;  2K6D B;  5BMG A;  3QQ8 B;  1F52 A;  4XZ4 A;  4BFR A;  2OJW A;  4B9K A;  3MC0 B;  1ZPS A;  4AOF A;  4NY0 A;  4UDU C;  2AQ3 B;  4C80 A;  1I4Q A;  2DZJ A;  1QOF A;  2GB1 A;  4FJZ A;  3RNG C;  1KOT A;  3N1Z C;  3OJ4 B;  1I4P A;  2K9X A;  3AEE B;  1NBF C;  2WGS A;  5G55 A;  2LD9 A;  3P4P B;  4IW0 A;  4TMA B;  2KZR A;  4RGT A;  3AE1 B;  3Q2A C;  2E6X A;  1ENF A;  4ZOH C;  4K3C A;  1JCK B;  4I6L B;  1ZW7 A;  3B0A A;  1PQS A;  1SF0 A;  2RPQ A;  1D4B A;  2K5P A;  5D7G A;  3DBR I;  1Q10 A;  2BB5 A;  2AQ1 B;  2NBV B;  1VCB A;  3FAH A;  4ZYS A;  1WXQ A;  4YTN B;  1E5W A;  1E0Z A;  1XT9 B;  4JLC A;  2L7R A;  2LRU A;  1FMA D;  1YJJ A;  4N6E B;  1K53 A;  2KAJ A;  2A5U A;  3OAW A;  3A9J A;  3KVF B;  2FIF A;  5D3D A;  2UYZ B;  2NCN A;  3L4P A;  3P42 A;  2RDB C;  3BII D;  3H1U A;  3BVG A;  5IOI A;  2LVO A;  1T0S C;  4ITK A;  2C7M B;  2GI9 A;  4EOY A;  3WAM A;  2WU2 B;  1SE3 A;  1CK1 A;  1MVK A;  3A4R A;  2WS3 B;  2GOW A;  2RR9 A;  4JIO U;  3U30 A;  1V2Y A;  1VZ6 A;  3IAM 1;  3DBR B;  4MJS B;  3PLV A;  4DDI D;  4GU2 A;  2WXM A;  1Z2M A;  4DHZ B;  4JGH B;  1C4A A;  2WXL A;  2M4N A;  3DOW A;  2JT4 B;  1V49 A;  5GMV A;  3N30 A;  2YEP F;  3W1S C;  5EE3 A;  3VDZ A;  1IYF A;  1V80 A;  3RCZ A;  3Q8F A;  4W9J A;  1B1Z A;  4OZB A;  2OHF A;  2ZCC A;  2V1Y A;  4CHK A;  3TEY A;  4GN1 A;  2PKO A;  1HTO A;  2K1F A;  1V1P B;  4K1R B;  4WQO B;  4HPM B;  3WAP A;  3ZRC A;  1KFY B;  3R7R A;  4KVG B;  2LEK A;  4WQM A;  1YMH E;  3V6C B;  2EMS A;  1C1Y B;  3KUD B;  4HXD A;  2WXH A;  4NAM A;  2KDM A;  3B2F A;  1QOG A;  3H7P B;  2PVG C;  2KFK A;  4ZRJ A;  3PT2 B;  3GZN B;  2LHD A;  2W3S A;  1E6E B;  3AE8 B;  1FFU A;  1D5M C;  1A5R A;  1JWB D;  2V4I B;  2BB6 A;  4DK5 A;  2L3Z A;  2QJL A;  2KDE B;  3RD2 A;  1UWX A;  4W9F A;  2FCS A;  2OED A;  1NEK B;  2KN5 A;  3HIZ A;  3MC8 A;  4KGT A;  1TY2 A;  1YJI A;  4WJQ A;  4KGR A;  1MI0 A;  3DBS A;  2D3G A;  3ENE A;  4FUL A;  1UEL A;  4OVZ A;  4GDL B;  1TKE A;  3U4E G;  3JW0 X;  3APC A;  2X8X X;  1WRI A;  4MSM B;  3VUX A;  5BYR A;  2NMQ A;  2C7H A;  3IT6 B;  3Q14 C;  3MHZ A;  2WXG A;  2D3A A;  1WSP A;  1FD6 A;  4ICV A;  3QC8 B;  4YSZ B;  1F1H A;  2GBM A;  2MJE A;  3N32 A;  2VH2 A;  4EKU A;  2NPT A;  3NVW A;  4AQ7 A;  4A8X C;  1IP9 A;  1XLP A;  5E6O A;  1YQ3 B;  5C3J B;  2Y3A A;  3AEC B;  2DHZ A;  5HFY A;  3SEB A;  3R7Q A;  2FCQ A;  4BZA A;  1ISN A;  1U4A A;  1VJK A;  1RAX A;  1AAR A;  2RDG A;  4RGM A;  4LNO A;  3RNE C;  3MC9 A;  2JZ3 B;  3R66 C;  1WI0 A;  4BBN F;  2BS3 B;  4PS3 A;  4A3O A;  3ZXR A;  5EE1 A;  2MCN B;  1BML C;  4MEL A;  3TIX A;  2PE6 B;  2GRI A;  4WJO A;  4L23 A;  3AH7 A;  3Q8C A;  3KWL A;  1T3Q A;  4GDK B;  5J2R A;  4TKN A;  1AWD A;  1WGR A;  4PS8 A;  4BKS D;  4WIP A;  4BAX A;  3PRP B;  1UF0 A;  2J53 A;  3ZUN A;  2JYT A;  1V5O A;  2WQY B;  4FHK A;  1WM3 A;  4AS1 A;  4G50 A;  3VXW A;  2N9E B;  5BYS A;  5BO4 B;  1VR9 A;  2J4X A;  3BIN A;  4B0E A;  2IZV B;  3VAW A;  2D3B A;  4HCN B;  2ZJD A;  3Q8E A;  1GJZ A;  4RF1 A;  2OJR A;  2QIL A;  1KLU D;  2LRW A;  3FKY A;  1EWY C;  2LFI A;  2LWP A;  3MP9 A;  3K9O B;  2EEL A;  2BW2 A;  1FO4 A;  2NVU I;  2NBU A;  3QHT A;  5EE9 A;  3P63 A;  3UI3 A;  1XF5 L;  1F77 A;  1EF5 A;  3ML8 A;  4KV2 A;  2QCZ A;  1DOX A;  1AN8 A;  4US9 A;  1IPG A;  3VTV A;  5JH5 C;  2IO3 B;  4RH6 A;  4HK2 A;  3OG5 A;  1DOY A;  4PT5 A;  1Q5W B;  2KMM A;  1XO3 A;  3I57 A;  2MBH A;  2CU3 A;  2WWZ A;  5D3I B;  1SEB D;  4IUM B;  3ETR A;  4C7Y A;  3RN9 C;  3KW5 B;  3AE2 B;  1E8W A;  4USA A;  5DPT A;  2D5G A;  1J8C A;  2O6V A;  3EGR A;  5DPW A;  1WJU A;  2A4Z A;  5BMH A;  1YJ1 A;  3VHT C;  3HUI A;  4JE3 B;  4MEM A;  3U7D A;  1UBI A;  4KX6 B;  3IXS A;  2WXN A;  4REZ A;  1MJD A;  1P98 A;  2JF5 A;  1TYG B;  3AE4 B;  2AX5 A;  2HE7 A;  1YN5 A;  2KLC A;  2L1A A;  2V9H A;  2E3T A;  2NBW B;  3A9K A;  3URY A;  3ABV B;  2CR5 A;  2WDQ B;  2L76 A;  3T9L A;  3ZJU A;  3O13 A;  1NI2 A;  4HKQ A;  2D11 A;  2BWE S;  4IKG A;  3MFG A;  3AE6 B;  2QDF A;  4RM9 A;  5D94 A;  3NOB A;  4K3B A;  2HD5 B;  4IOI E;  3H6N A;  3M95 A;  3NS1 A;  4G3X B;  4BKT A;  3R2T A;  2JU6 X;  3SDL C;  4G0N B;  2KQ4 X;  3S2A A;  4DHJ D;  1L7Y A;  3UIP B;  2AEH A;  2M1M A;  1V5T A;  1N60 A;  1WZ3 A;  5E6N A;  1RFA A;  1F2R I;  3ZDT A;  3I63 C;  4HCP B;  1MHH E;  3LYY A;  3Q3O C;  4WJN A;  4DXF A;  1MFW A;  3N9Y C;  1TT5 B;  2M0A A;  3L13 A;  2N9L A;  3JSV A;  2LJ5 A;  3GP7 A;  4MGY E;  1EO6 A;  5FR3 A;  2N7D A;  5TSS A;  4IG7 B;  2YLM A;  3KWV A;  1Q1O A;  2UU7 A;  1WR1 A;  2K8C A;  2L05 A;  3U52 E;  2LUE A;  1L6U A;  3TBL D;  2MBQ A;  2LGI A;  2LZ6 A;  3NY5 A;  4KKJ A;  4K7U A;  3BVZ A;  1KF6 B;  3N1Y C;  5LXI B;  3RYT A;  3MJW A;  4MSQ B;  5HKH A;  1LFD A;  2Q5W D;  1IUE A;  4A20 A;  4BOS C;  4FAD A;  4HLE A;  4MGK E;  1STE A;  1WZ0 A;  1QIL A;  1FXT B;  1L4D B;  2ON8 A;  3T8M A;  4H2A A;  4HDQ A;  2CKH B;  1N6Z A;  4EE2 A;  3KH0 A;  1QKZ A;  1WYW B;  3W9C B;  3AB5 A;  2FID A;  2KVR A;  2L8J A;  2IDY A;  4AP4 C;  1FEH A;  2XNA C;  1GB4 A;  2YVC A;  2KQ7 A;  3QK0 A;  3CF6 E;  3KYC D;  3CMM B;  3E9S A;  1K50 A;  1EM7 A;  3E56 A;  2L52 A;  1RFK A;  1ACC A;  4MM3 A;  4DHZ E;  1J7A A;  2G3Q B;  2IY0 B;  2PMV A;  2BKR B;  3PRZ A;  3ZVV A;  3DBL B;  3CSF A;  2LVP A;  4M0W A;  4C4V A;  3DPD A;  1ZOY B;  4LNK A;  2KKC A;  4GXB A;  2SEB D;  4IM3 A;  1F9J A;  1EWC A;  3PHW B;  2GBN A;  2BWF A;  3J9C A;  4DHJ B;  2LVQ A;  2ZPY A;  2JVC A;  3WCQ A;  1JQ4 A;  1D5Z C;  1L5P A;  1N62 A;  3W5U B;  4GB9 A;  3AI5 A;  2D2Q A;  4ZRI A;  3ZNI D;  2BKF A;  4JWU C;  3W1Y A;  3SFE B;  4F7Z A;  4LNF A;  2Y5C A;  1QLB B;  1I35 A;  2KD0 A;  1LXD A;  4KIK A;  2WYQ A;  1Y56 A;  3BK2 A;  2C60 A;  3P2B A;  4NAW B;  1WY8 A;  1R4M I;  2KFK B;  1JML A;  3DHH C;  1FM0 D;  3ALB A;  4GIV A;  3VUY A;  4OZC A;  1J0G A;  2HJ1 A;  4DXG A;  2C7N B;  4BKG A;  2G9H D;  3RZF A;  4I6N B;  2GBJ A;  5J18 A;  3RFZ B;  1FRD A;  2XEW A;  4CYE A;  4DDG D;  1XD3 B;  3NUH B;  4YSX B;  2FAZ A;  3EC8 A;  2BYF A;  4ANU A;  3FIL A;  2JQR B;  3ZQ4 A;  3PZ7 A;  1K51 A;  2NTT A;  4F8C B;  1RWS A;  1IBX A;  1T0Q C;  4A3P A;  3AE9 B;  4NPN A;  1JWM D;  1XLN A;  2WP9 B;  1N61 A;  1R4M B;  3Q3N C;  1UNS A;  2AL6 A;  2D10 A;  2Y5P A;  5C2T B;  2L0T A;  4ANW A;  1H4R A;  2MSE D;  3H8H A;  3DBH I;  2EMT A;  2JXT A;  4II2 B;  4ZRP A;  4LK0 M;  3GE3 C;  1WH3 A;  1XXG A;  1FCC C;  1V81 A;  2NPT B;  3PZ8 A;  2BYT A;  1FNV A;  2ZVO A;  1OGW A;  3WAN A;  4KDL B;  2UWQ A;  4GMV A;  2ZW0 A;  1GB1 A;  1UGM A;  1L0V B;  3GZN I;  1TTN A;  4PYZ A;  1XEE A;  2K39 A;  2DYO A;  2LGD A;  2DNF A;  2KWU B;  2O6V D;  2PEA A;  1FXI A;  3EHV A;  1WGH A;  1ZKH A;  2KWV B;  1EU4 A;  1KM7 A;  1PDX A;  3DBH B;  2AQ2 B;  3HM3 A;  4C7Z A;  4YTP B;  1SSN A;  2AWT A;  2PIA A;  2VZK D;  3AU5 A;  3A1Q A;  2KDB A; 
#chains in the Genus database with same CATH homology
 1TBE A;  4GDK B;  5J2R A;  3AU4 A;  4TKN A;  2J0K A;  3M62 B;  4PS8 A;  1WGR A;  4BKS D;  2V4L A;  4LDT B;  3ZKJ C;  2KTR A;  3L08 A;  3A1Q B;  3H9D A;  4EZL A;  2KMC A;  4IWO A;  3PRP B;  4K7W A;  3ZUN A;  2MRP A;  4FJY A;  3ZW3 A;  2Z59 B;  3QAQ A;  3UGB B;  4ZDV A;  5EDS A;  5C1Z A;  1V5O A;  2KTR B;  2I1K A;  1GC6 A;  1WE6 A;  3IHP C;  1WM3 A;  3EFU A;  4FHK A;  2FNJ B;  4EEW A;  3QJZ A;  4G50 A;  1C3T A;  3LJ3 A;  4W9G A;  2DZM A;  3VXW A;  2N9E B;  3ML9 A;  3R3M A;  4KIK B;  4NQL B;  5BO4 B;  3ZNH B;  5TR5 A;  1GG3 A;  1V86 A;  3BIN A;  4IM2 A;  2IZV B;  3DDC B;  3PSE B;  3VAW A;  3PV1 A;  4AJW A;  1HE8 A;  2EKE C;  2BPS A;  4HCN B;  2L0F A;  4YL8 A;  3TCA A;  4W9K A;  2ZJD A;  2IY1 B;  2KK8 A;  4BBN C;  1GJZ A;  3WAL A;  2K25 A;  5C23 A;  5JZE B;  2JRI B;  3MTN B;  2OJR A;  2N1V A;  2DAF A;  3WA0 A;  4FN2 A;  2LRW A;  4W9C A;  2KX3 A;  1YX5 B;  2LWP A;  2Z0D B;  2JZZ A;  3UQB A;  4LJO B;  1E90 A;  4LJP B;  4NQK E;  4PYU A;  2RD0 A;  1M94 A;  2MBB B;  1EUV B;  3K9O B;  4IWQ A;  2FCN A;  3SHQ A;  1E8Y A;  2NVU I;  4HJK A;  4JL9 A;  4KSL C;  2NBU A;  3QHT A;  4HWI B;  4WJP A;  1TZ1 A;  2BGF A;  3V6E B;  1XQQ A;  2IO0 B;  1EF5 A;  3BY4 B;  3ML8 A;  2MP2 A;  3QWZ B;  4KV2 A;  3EEC A;  2N9P C;  2OOB B;  2DZI A;  4ANX A;  3N3K B;  5L83 A;  1IPG A;  3VTV A;  4E71 A;  2IO3 B;  2MW5 A;  4IC7 B;  5JH5 C;  4AJY B;  4HK2 A;  4FBJ B;  2MP2 B;  2M8S A;  2B3A A;  3PZD A;  3ZDM C;  3SD5 A;  4EFO A;  1V6E A;  3PRM B;  2MWS B;  3RUI B;  2IBI B;  1NDD A;  1Q5W B;  4EZK A;  2N1W A;  2CHZ A;  3DQV A;  3HK0 A;  1P0R A;  4HPL B;  4GGQ A;  4M8M A;  2MBH A;  2R2O A;  2M0X A;  2LGY A;  2NR2 A;  2WWZ A;  3ZNZ B;  1WM2 A;  2KQS A;  1YIW A;  4ASW C;  3RUL A;  3UIO B;  1BT0 A;  1EF1 A;  4IUM B;  2VRR B;  1E7U A;  3KW5 B;  1V9J A;  1S1Q B;  2KDI A;  5AZG A;  1E8W A;  1H8C A;  2KMA A;  2KO3 A;  1WXS A;  3DVG X;  5DPT A;  2DX5 B;  1J8C A;  3APF A;  1UD7 A;  1R4N I;  2O6V A;  3VTW A;  5DPW A;  4MGZ E;  1LM8 B;  3VUW A;  1WJU A;  4ZRK A;  2A4Z A;  4XX5 A;  2KNB A;  2KJH B;  1LQB A;  1YJ1 A;  1WXM A;  2O6V B;  3VHT C;  4X57 B;  1OEY J;  4MEM A;  3U7D A;  1UBI A;  3QAR A;  2PPH A;  3IFW B;  2WX1 A;  4K81 A;  1GNU A;  4GSW A;  4IM0 A;  2DEN B;  2CU1 A;  3ONS A;  3UF8 A;  3U8Z A;  1P98 A;  2JF5 A;  3HHM A;  4FJV B;  1SE9 A;  3VH4 B;  2G45 B;  4G11 A;  4BKS A;  1Z5S B;  3B1L X;  3Q3F A;  2D07 B;  2CHX A;  3QCA A;  4W9D A;  3VTU A;  2C9W B;  2JWZ A;  2HE7 A;  2QHO A;  2W9N A;  2KLC A;  2V3S A;  4BVU C;  2MQJ A;  4MH0 E;  5JHB A;  3UQA A;  3I3T B;  2J0J A;  3M3J A;  3NZS A;  4MGI E;  4B6W A;  2NBW B;  2IO2 B;  4M8N A;  3A9K A;  2CR5 A;  3WIM A;  2JUO A;  2K8H A;  2PJH A;  4W9I A;  1TGZ B;  2L76 A;  3T9L A;  4W9E A;  1Y8R C;  2AYO B;  3NS8 A;  1NI2 A;  2JY6 A;  3A9K B;  4EZJ A;  2D11 A;  2XBB C;  2NS5 A;  2BWE S;  5D6J B;  5DCN A;  5CHW A;  2GMI C;  2DYM A;  3X23 A;  5CTR C;  2KJR A;  3PHX B;  4JQW C;  4RM9 A;  5D94 A;  2IO1 B;  3NOB A;  2MA9 B;  2J0M A;  1L2N A;  4HDO A;  2HD5 B;  3PGE A;  2G4S A;  3OJ3 A;  3H6N A;  3M95 A;  5AZH A;  3JYU A;  4NJ7 A;  4G3X B;  4E74 A;  2MLB A;  3L16 A;  4FLH A;  3DVN U;  3HM6 X;  2M17 A;  3TMP B;  4BKT A;  1WE7 A;  4KSK C;  3ZNG C;  4NNJ B;  3APD A;  3VVW B;  5CX3 A;  2G4D B;  3ECI A;  2K6D B;  3SDL C;  3ZTD A;  3JVZ X;  2KJ6 A;  3NZU A;  2ZEQ A;  4G0N B;  3PLU A;  4E3C A;  3QQ8 B;  4XZ4 A;  3S2A A;  4DHJ D;  1L7Y A;  3QIJ A;  1UBQ A;  3RT3 B;  1WMH A;  3UIP B;  2AEH A;  4BFR A;  2M1M A;  4B9K A;  1V5T A;  1WZ3 A;  3K9P B;  5E6N A;  1RFA A;  4F1S A;  2KDF B;  1KLV A;  4TUU A;  3AUL A;  4NY0 A;  4GOC A;  4NAW A;  5G2N A;  3ZDT A;  2WX0 A;  1WMH B;  4HCP B;  4AOF A;  1T0Y A;  3GOE A;  2DZJ A;  4CO7 A;  3VQI A;  5LLI A;  4FJZ A;  4LDT D;  4NJ6 A;  4WJN A;  1KOT A;  3OJ4 B;  2ZZP B;  1NBF C;  3L13 A;  3JSV A;  2JXX A;  5G55 A;  2LJ5 A;  3WAO A;  1K8R B;  2Z0E B;  2LD9 A;  3DCG A;  2REX A;  4IW0 A;  2KZR A;  4MGY E;  1EO6 A;  2RSU A;  3JSV B;  2N7D A;  4KZ0 A;  4IG7 B;  2YLM A;  1Q1O A;  3A4S C;  4ICU A;  3VH3 B;  2IYD B;  3ZLZ A;  1WR1 A;  2K8C A;  2L05 A;  4I6L B;  1ZW7 A;  1E8Z A;  1PQS A;  2LUE A;  1WF9 A;  2R2Q A;  3B0A A;  2RPQ A;  3M63 B;  4OVU A;  5D2M B;  3TBL D;  4BOZ B;  4EUT A;  5AZF A;  5D7G A;  3DBR I;  1I42 A;  2MBQ A;  3L17 A;  2LZ6 A;  3NY5 A;  4AUQ C;  1UZX B;  3CST A;  4K7U A;  3V61 A;  2NBV B;  2DAJ A;  1VCB A;  1E8X A;  3RYT A;  5LXI B;  2HTH A;  3MJW A;  1E5W A;  2FUH B;  4MSQ B;  5HKH A;  1LFD A;  4KDI C;  1XT9 B;  4JLC A;  2L7R A;  2LRU A;  4A20 A;  4BOS C;  4FAD A;  5IA7 A;  2KXJ A;  4HLE A;  5JHA A;  3PRE A;  2C5L C;  2A5U A;  4MGK E;  3OAW A;  3A9J A;  1WZ0 A;  3KVF B;  2ASQ A;  1GC7 A;  2FIF A;  1FXT B;  1JRU A;  3LDZ E;  2UYZ B;  3W1S A;  4W9L A;  2NCN A;  2KAN A;  3RZW C;  3T8M A;  2DZK A;  2CKH B;  3H1U A;  4HDQ A;  2KC1 A;  3KH0 A;  2LVO A;  2PE9 A;  5FR6 A;  2C7M B;  3VFK A;  1WGD A;  1WYW B;  2FID A;  2KVR A;  4EOY A;  2L8J A;  2L00 B;  3WAM A;  4AP4 C;  3PVL A;  1YD8 U;  2N4F A;  3PTF C;  1P3Q U;  2ZNV C;  4MJS A;  2YVC A;  3A4R A;  2KWC A;  2KQ7 A;  3IVF A;  3QK0 A;  3CF6 E;  2GOW A;  2RR9 A;  3CMM B;  3KYC D;  4JIO U;  4DBG A;  2BYE A;  4P7I A;  3IBE A;  3U30 A;  1V2Y A;  1G6J A;  4MJS B;  3PLV A;  2HJ8 A;  4DDI D;  4GU2 A;  3O65 B;  1Z2M A;  4DHZ B;  4JGH B;  4ANV A;  3TL5 A;  2M4N A;  3DOW A;  4MM3 A;  5E6P A;  4DHZ E;  2G3Q B;  2IY0 B;  2BKR B;  2JT4 B;  3PRZ A;  1V49 A;  3ZVV A;  5GMV A;  3N30 A;  3W1S C;  2ZPN A;  3CSF A;  2LVP A;  3VDZ A;  1IYF A;  1V80 A;  3RCZ A;  2DYB A;  1OQY A;  4W9J A;  3NHE B;  3DPD A;  1WR6 E;  2KKC A;  4GXB A;  4IM3 A;  3D32 A;  1D3Z A;  2ZCC A;  1F9J A;  1SIF A;  2V1Y A;  2FCM A;  3OLM D;  1YQB A;  4M0W B;  4CHK A;  1WFY A;  4K7S A;  3PHW B;  2GBN A;  1UH6 A;  2BWF A;  5KHO A;  4GN1 A;  4DHJ B;  2LVQ A;  4RM8 A;  2ZPY A;  2K1F A;  2JVC A;  4GDK A;  5LXH A;  4WWO A;  1QZE A;  1OTR B;  4GB9 A;  4K1R B;  3Q3J A;  3AI5 A;  4WQO B;  4HPM B;  2D2Q A;  4ZRI A;  3WAP A;  3ZRC A;  4AWJ A;  2KC2 A;  3ZNI D;  2BKF A;  4PS7 A;  3R7R A;  4KVG B;  3W1Y A;  2I1J A;  4F7Z A;  2XK5 A;  4W9H A;  1RLF A;  1S3S G;  3H7P A;  2LI5 A;  3TJP A;  1I35 A;  3V6C B;  2KD0 A;  2EMS A;  1LXD A;  1C1Y B;  4HVB A;  3KUD B;  4HXD A;  2XK5 B;  5L95 C;  4KIK A;  2WYQ A;  1YX6 B;  3H7P B;  4II3 B;  1WX8 A;  3DVG Y;  1J19 A;  2C60 A;  2MBO A;  4J6I A;  2KFK A;  2LGX A;  3P2B A;  4ZRJ A;  1WXV A;  2JRH A;  3PT2 B;  4NAW B;  3X0W A;  1WY8 A;  1R4M I;  1OEY A;  5KHQ A;  5AEK B;  2KFK B;  1WJ4 A;  4IWP A;  3UIN B;  2KFJ A;  3H7S A;  3ALB A;  4GIV A;  3VUY A;  3AXC A;  1A5R A;  5J17 A;  4FHJ A;  1J0G A;  4B95 A;  4DK5 A;  2L3Z A;  2KDE B;  2C7N B;  4BKG A;  3RD2 A;  3RZF A;  3PPA A;  4I6N B;  2K8B A;  2GBJ A;  4W9F A;  3V62 A;  5J18 A;  3L0W B;  1WXA A;  2FCS A;  2XEW A;  4CYE A;  4WAA A;  1XD3 B;  4DDG D;  1WX9 A;  2MX2 A;  2KN5 A;  3A33 B;  3HIZ A;  2J7Q B;  4WWP A;  2ZCB A;  1WX7 A;  2FAZ A;  2GBR A;  1RRB A;  2AL3 A;  1E7V A;  3EC8 A;  4TQ1 A;  3KYD D;  1MG8 A;  1X1M A;  3ZTC A;  3C0R B;  2BYF A;  2JPH A;  4ANU A;  1CMX B;  4WJQ A;  2N9X A;  3KUZ A;  4TQ0 A;  3DBS A;  4GDL A;  2D3G A;  3ENE A;  4LCD E;  3DBL I;  4FUL A;  1UEL A;  3QA8 A;  4F8C B;  1Q0W B;  2ZNV B;  4A3P A;  4GDL B;  1SGH A;  4NPN A;  3KUC B;  3DVN V;  3APC A;  3JW0 X;  4MSM B;  3VUX A;  2C7H A;  2LAS A;  4MDK E;  1ZGU B;  2KTF A;  2AL6 A;  2D10 A;  1KJT A;  4I6P A;  4ICV A;  3QC8 B;  2L0T A;  2BF8 B;  3ZIM A;  4RMA A;  4ANW A;  3A9J B;  1H4R A;  2MSE D;  1GUA B;  2GBM A;  3DBH I;  2EMT A;  3N32 A;  5IAA C;  3ZO5 B;  4II2 B;  3V60 A;  4EKU A;  2NPT A;  3QX1 A;  1IP9 A;  2KX0 A;  5CHV C;  5E6O A;  1WGY A;  2LXA A;  1WGG A;  2KOX A;  1WH3 A;  1V81 A;  2DHZ A;  4FA6 A;  2KHW B;  4WWN A;  3R7Q A;  2FCQ A;  2NPT B;  2ZVN A;  2BYV E;  1ISN A;  1U4A A;  4OVV A;  3B08 A;  5DPR A;  5DPS A;  2ZVO A;  1OGW A;  1VD2 A;  1RAX A;  3WAN A;  3MHS D;  2K6Q A;  1AAR A;  4KDL B;  4ZYN A;  4N9F 4;  4URK A;  2UWQ A;  2LXC A;  2Y5B B;  1WIA A;  4GMV A;  2CHW A;  3PS6 A;  1UGM A;  2JZ3 B;  2N7E A;  3GZN I;  3R66 C;  1TTN A;  4PYZ A;  2K39 A;  1WI0 A;  4BBN F;  2RGF A;  1P9D U;  2DYO A;  4XC2 A;  2LGD A;  4PS3 A;  4A3O A;  2KWU B;  2O6V D;  2PEA A;  3IG3 A;  4DXA B;  4TV3 A;  5CHF A;  3EHV A;  1WGH A;  1WRD B;  1ZKH A;  3L54 A;  1WJN A;  2KWV B;  2CS4 A;  2O2V A;  2MCN B;  2KLG A;  4MEL A;  3SU8 X;  1KM7 A;  4KZC A;  2MBE A;  3HM3 A;  3TIX A;  4DWF A;  2PE6 B;  3L10 B;  2AWT A;  4WJO A;  1P1A A;  2O2V B;  3ZRF A;  1WJ6 A;  2GBK A;  3AU5 A;  3A1Q A;  2WDT B;  2KDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...