5L95C

Crystal structure of human uba5 in complex with ufm1 and amp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
VSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme 5
publication title Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 18
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5l95C00
4MGZE 4W9CA 5TR5A 3NY5A 4ASWC 4F1SA 5JHBA 1OGWA 3H7SA 1XQQA 1GNUA 3NOBA 1L2NA 1LM8B 4JIOU 4F8CB 4RM9A 1K8RB 4TQ0A 3QAQA 4CO7A 2L3ZA 2LXCA 4G0NB 1WH3A 2IY1B 1BT0A 3R3MA 2NBVB 4DK5A 3A9KB 2XK5B 4IC7B 1ZW7A 1RFAA 4M8MA 5J17A 2LVOA 3PZDA 2V1YA 2MWSB 4BKTA 1E8WA 1WJUA 2FAZA 3PRMB 3EC8A 3M63B 2K6QA 2FCQA 2GBMA 1E5WA 2IY0B 3SD5A 1YX5B 2C7NB 3NZUA 1V6EA 1FXTB 4NJ6A 2O6VA 2KVRA 5D2MB 1UBQA 4NNJB 4W9IA 2MBQA 3VFKA 5D7GA 2AWTA 2PPHA 2Y5BB 1I35A 2N1VA 3M95A 2XK5A 4W9HA 3VQIA 1NDDA 1V5TA 2CHXA 5GMVA 3CMMB 2FIDA 4K81A 2NS5A 3VAWA 3UQAA 3Q3FA 2ZZPB 4NJ7A 5LXIB 4DWFA 3CF6E 3V60A 3KUZA 4FA6A 1X1MA 3DBSA 4DHJD 4IM2A 2LI5A 1VD2A 4RMAA 1PQSA 2NVUI 3JSVA 1RRBA 2JZZA 3QX1A 3IBEA 3L0WB 2ZCBA 2IYDB 3BINA 2CHZA 2J0MA 2V4LA 2NR2A 2A4ZA 3PT2B 1V5OA 1WJ6A 2DZJA 4HDQA 4WJPA 2M17A 4B9KA 1WZ3A 4GDKB 1WXMA 4HPLB 2RD0A 2KTRB 4ZRKA 3DOWA 3ZTCA 3KVFB 4IWOA 4IWQA 5AEKB 1JRUA 1D3ZA 3HK0A 2AL3A 2KJ6A 4NQLB 5AZGA 2J0JA 2ZEQA 4GIVA 3DVGY 1WGRA 3JW0X 2LRUA 5HKHA 3APCA 2G4DB 2KDIA 1Q1OA 1V2YA 2KMCA 3W1SA 4A3OA 2KTFA 4HJKA 4XC2A 2LD9A 4KSKC 4KDIC 3QA8A 3TJPA 4DBGA 1WM3A 1EO6A 4BKGA 2KX3A 4AWJA 1V81A 2JF5A 4AJWA 4WJQA 4GGQA 5JH5C 3EFUA 4PYZA 4ZYNA 2LVQA 4XX5A 2JWZA 2LXAA 4AJYB 3R7RA 1OTRB 4J6IA 4LDTB 3ZDMC 2KJHB 3MHSD 3VTVA 4ANXA 2HTHA 4YL8A 4I6NB 2ZNVC 4MELA 1U4AA 2RGFA 2K25A 3PREA 3RCZA 3ZVVA 2KOXA 1WMHA 5DPTA 4KVGB 3U30A 3VUWA 4G3XB 3WANA 2K39A 3X23A 3L17A 2C5LC 2LWPA 2G4SA 3SHQA 2WWZA 2MQJA 4NAWB 2MRPA 4BKSA 3WAMA 5E6OA 3RZFA 4FHJA 2YLMA 1WGDA 2KLCA 3ZRFA 2LGYA 1YX6B 2RPQA 4N9F4 3T9LA 5BO4B 4IWPA 2JZ3B 3KYDD 1H4RA 1RLFA 2KN5A 4I6PA 2K8CA 3APDA 4FADA 3U8ZA 2NBUA 4II3B 3BY4B 3RUIB 2ZCCA 3P2BA 4KIKB 4W9FA 1WXSA 4W9KA 3PTFC 3QHTA 1TBEA 1YQBA 2BWFA 1C3TA 3IFWB 4M0WB 1H8CA 2MCNB 4FN2A 4NAWA 2MSED 2N9PC 2HD5B 3PHWB 2KJRA 4LCDE 3ZW3A 2WDTB 1Y8RC 4ZRJA 3OLMD 2JPHA 2KWCA 1E90A 1KJTA 1UELA 3K9PB 3VTWA 2REXA 2L7RA 4PYUA 4P7IA 2O6VB 2R2OA 4K1RB 4PS3A 5DPSA 2DZMA 1WYWB 2L76A 4MSQB 4KIKA 2C7MB 3ALBA 3I3TB 2OOBB 2DZKA 2LGDA 2AEHA 2L0FA 2G3QB 2MBHA 3LJ3A 2IO0B 4JQWC 3PRPB 2IBIB 1WM2A 3V61A 2M0XA 3TBLD 3CSFA 2XBBC 4ICUA 2JUOA 5KHOA 2PJHA 2ZVNA 1GC6A 4EZKA 2KK8A 2KANA 4FJYA 4CYEA 3JSVB 1R4MI 3EECA 2DX5B 4A3PA 3ZUNA 2LUEA 3DVNV 4MEMA 2DAJA 3NHEB 2MX2A 3DDCB 1OQYA 2KFKA 2J7QB 2YVCA 1A5RA 1M94A 5E6NA 4F7ZA 1IYFA 2EKEC 3ZKJC 1KLVA 2N9XA 3K9OB 1RAXA 2BKFA 2DZIA 5IA7A 3V6CB 2JVCA 4KDLB 4EZJA 3PGEA 3L08A 4K7UA 2XEWA 3H7PA 2GBRA 2KDBA 4W9DA 4B6WA 1YD8U 3L13A 1CMXB 1P9DU 2NPTA 4GDLB 4GOCA 2LJ5A 1VCBA 3A4RA 4KSLC 1V80A 3U7DA 3VUXA 3TL5A 1T0YA 3ZNGC 4M8NA 1WE7A 4BBNC 5C1ZA 2N4FA 2BYEA 1IP9A 3ZRCA 1J8CA 2KC1A 4K7SA 2J0KA 2IO2B 3GZNI 3ZTDA 5LXHA 2K8BA 3IHPC 4B95A 5DPRA 3A4SC 3SDLC 4NY0A 4ZRIA 2C60A 1WIAA 3APFA 2FIFA 2L0TA 2MBEA 2QHOA 3TIXA 4BFRA 4FJZA 2KDEB 2ZJDA 5CHWA 2M1MA 4NPNA 4GDLA 3L54A 2O6VD 1GG3A 3DPDA 3VHTC 1F9JA 3H9DA 1KM7A 3UINB 5DPWA 2BPSA 3VVWB 4I6LB 2HJ8A 2D07B 4IM3A 3QIJA 1WX8A 1XD3B 2BWES 4EFOA 1WXVA 2Z59B 3ML8A 4MDKE 3ZNZB 4AUQC 4JGHB 1Z2MA 4KZCA 1WJNA 2MLBA 3DBRI 2D3GA 2M8SA 1WMHB 3JVZX 4G50A 1WGHA 4ANVA 1E7UA 3QQ8B 2UWQA 3OAWA 3DVGX 2KWUB 3ZO5B 1P0RA 2DENB 2ASQA 2ZNVB 3DCGA 3WIMA 1WX7A 4DHZB 4HXDA 3QK0A 2BKRB 2DYMA 3DQVA 5L83A 1UBIA 1XT9B 2L8JA 4RM8A 4EUTA 2JXXA 2V3SA 2CU1A 4II2B 2D11A 4MH0E 5CHVC 1P3QU 3WAPA 2IZVB 4KZ0A 2GOWA 2RR9A 4HDOA 5CX3A 5G55A 4URKA 4A20A 2MP2B 2MBBB 1SIFA 3JYUA 4LJPB 3V6EB 3MTNB 2DYBA 3KUCB 4MSMB 3RULA 3HM6X 3VUYA 1Z5SB 1WR1A 4ANWA 4MM3A 4DHZE 2UYZB 1S1QB 3QWZB 1J0GA 4ICVA 5C23A 2AL6A 2KQSA 2MBOA 2KQ7A 2O2VB 4FHKA 2LVPA 3B1LX 2LRWA 2C7HA 4KV2A 2W9NA 2JRHA 3ENEA 2Z0DB 2MA9B 4WJNA 1OEYJ 2C9WB 5L95C 3L16A 4GXBA 4MJSA 3QC8B 5CHFA 4BBNF 3AULA 2FUHB 2MP2A 1WFYA 3A9JB 4AOFA 3PSEB 1KOTA 4LJOB 3HM3A 1C1YB 3NS8A 3KYCD 4WWNA 2VRRB 2FCMA 2B3AA 4WAAA 1LFDA 3VXWA 2BYVE 2O2VA 2L00B 1EF1A 3RD2A 1LQBA 2KNBA 4DHJB 3MJWA 3T8MA 2KC2A 1WY8A 2WX0A 3IVFA 3B0AA 3NZSA 4FJVB 4XZ4A 2ZPYA 2KFKB 2DAFA 5JZEB 4GB9A 3KH0A 2D10A 1V49A 1TGZB 1ZGUB 1LXDA 4X57B 4BKSD 3A9JA 3PVLA 3PLUA 1WX9A 3A1QB 3H7PB 5JHAA 4GN1A 3ZLZA 5D94A 1NI2A 2NPTB 4E3CA 3HHMA 2D2QA 2L05A 1GJZA 1UGMA 1UH6A 4LDTD 1YJ1A 1WR6E 2K1FA 4TQ1A 3TMPB 3LDZE 3B08A 3VDZA 3ONSA 4HLEA 3GOEA 1WJ4A 5LLIA 2CS4A 1P1AA 2N7DA 3O65B 2MW5A 2ZPNA 3ZDTA 1E8YA 1V9JA 2PE9A 1WXAA 3V62A 1UD7A 4ANUA 2BF8B 2GBJA 2KDFB 3A1QA 5CTRC 5AZHA 1NBFC 5J2RA 4DDID 2DHZA 1WI0A 2ZVOA 3QCAA 4HCPB 4HPMB 4BOSC 3QJZA 4IM0A 3TCAA 3R7QA 2KFJA 3C0RB 4K7WA 3RT3B 3RYTA 2JT4B 3SU8X 4EZLA 1HE8A 2I1KA 4IW0A 2FCNA 3Q3JA 4E71A 1YIWA 3M3JA 4NQKE 4E74A 3PHXB 4BVUC 2LZ6A 3N32A 3A9KA 4W9EA 3ZNHB 2DYOA 3DBHI 4TKNA 1WGYA 1OEYA 4EOYA 1UZXB 3UIOB 2N7EA 3UIPB 2FCSA 2G45B 3PS6A 3AI5A 4MGYE 2R2QA 4W9JA 3R66C 1E8XA 1ISNA 3AU5A 1EF5A 2EMSA 4WJOA 3KW5B 2KWVB 4HWIB 4JLCA 3WA0A 4MGKE 1MG8A 3UQBA 5FR6A 2JRIB 2KXJA 2FNJB 1V86A 2CKHB 2KKCA 3VTUA 2I1JA 1IPGA 4FULA 1WE6A 1SGHA 3M62B 3DBLI 4MGIE 4W9LA 3AXCA 4OVVA 2BGFA 2LASA 3QARA 2RSUA 4G11A 2KX0A 3UGBB 2AYOB 3H1UA 1R4NI 3WALA 4PS8A 3ZNID 3DVNU 1S3SG 1SE9A 3W1SC 2KD0A 3A33B 4GMVA 4EKUA 1G6JA 2GBKA 1P98A 4WWPA 2N1WA 3RZWC 3VH3B 1AARA 4DDGD 3N3KB 2A5UA 3D32A 4FBJB 3W1YA 2K8HA 5G2NA 3N30A 3CSTA 4MJSB 2PEAA 1GUAB 5J18A 4TUUA 5E6PA 4GDKA 3ZIMA 2HE7A 2CHWA 1QZEA 1WF9A 2GBNA 2KTRA 3PRZA 3WAOA 2EMTA 4JL9A 1I42A 3UF8A 5D6JB 5KHQA 1GC7A 2GMIC 2KHWB 2JY6A 4GU2A 4IUMB 2IO3B 1WGGA 4OVUA 1ZKHA 4W9GA 2IO1B 5AZFA 4ZDVA 4HVBA 1E8ZA 4PS7A 2KZRA 5DCNA 1WZ0A 2KMAA 4AP4C 2Z0EB 2KLGA 1EUVB 3X0WA 1E7VA 1TTNA 3ML9A 4DXAB 3ECIA 1Q0WB 4GSWA 4IG7B 2WX1A 2NBWB 3S2AA 4EEWA 1J19A 2LGXA 2CR5A 3L10B 3PV1A 1L7YA 1WRDB 4BOZB 3VH4B 2BYFA 5IAAC 4CHKA 2N9EB 3H6NA 3PPAA 2NCNA 4WQOB 1Q5WB 4HK2A 3KUDB 1TZ1A 4FLHA 2PE6B 3AU4A 4WWOA 2M4NA 3OJ3A 2K6DB 3OJ4B 4TV3A 5EDSA 2WYQA 3EHVA 4HCNB 2OJRA 2KO3A 3HIZA 3IG3A 3PLVA
chains in the Genus database with same CATH superfamily
1OGWA 2JZPA 4RM9A 3QAQA 5BYRA 2LXCA 3Q3OC 3NS1A 2IJ0A 5BYQA 2LGIA 2VH2A 3BK1A 1ZW7A 3ZJTA 2LVOA 1E8WA 1WJUA 2FAZA 3EC8A 1IUEA 1E5WA 2QMTA 1YX5B 2C7NB 4CQNA 2EELA 1I4HA 2O6VA 1JCKB 3NVWA 5D7GA 2W54A 1ZDVA 2PPHA 2Y5BB 4C4VB 4KGTA 2N1VA 3M95A 3VQIA 2MJEA 4RGMA 1XEEA 3URYA 3VAWA 3UQAA 3GE3C 1FRDA 2BS3B 3RPFC 2BBCA 3CF6E 4FA6A 1X1MA 1TKEA 1VD2A 4RMAA 3JSVA 1RRBA 3IBEA 2JXTA 2A4ZA 1L6VA 4ZYSA 4B9KA 2KTRB 1ROEA 1VZ7A 3DOWA 2RDGA 5AEKB 3PZ7A 5AZGA 2J0JA 4ZHOA 4GIVA 1WGRA 3JW0X 1QF6A 3NUHB 1Q1OA 4A3OA 5BMGA 4LNFA 2TSSA 3QA8A 3TJPA 4AWJA 1N5XA 2JF5A 2NTSA 4GGQA 5JH5C 4XX5A 4AJYB 3ZXVA 3R7RA 1EM7A 4ANXA 3VTVA 2HTHA 1IBXA 4I6NB 2QILA 2HDEA 4NZLB 5DPTA 2D3AA 3U30A 3X23A 3L17A 1TY0A 1YMHE 1ZE3D 4NAWB 4B0EA 2BVCA 2FE8A 2RPQA 1YX6B 3KQ4A 4IWPA 3U8ZA 3Q8FA 5G5GA 3O13A 4RF1A 4OZAA 4YSYB 3IFWB 4M0WB 2KT7A 1FNUA 2KJRA 3OLMD 3VTWA 1KJTA 3ETRA 2REXA 4PYUA 2O6VB 2R2OA 4PS3A 3EGRA 1WYWB 3NZ3A 3V3XA 2QCZA 2QDFA 3I3TB 2L0FA 2MBHA 4JQWC 2WXGA 2IBIB 1WM2A 1MHXA 3TBLD 5I4DA 2JUOA 2ZVNA 2M0AA 2GB1A 3RNEC 1TIFA 1E7PB 3JSVB 3ZUNA 2DAJA 3NHEB 1YJJA 2QEJC 3K9OB 4US8A 1J7AA 2JVCA 4KDLB 4K7UA 1JW9D 3AECB 3DHHC 2KDMA 3AB5A 3L13A 1P9DU 2NPTA 1N61A 1VCBA 1JWMD 1WSPA 3Q8AA 3Q2AC 4BBNC 1J8CA 2BYEA 3P4SB 1GB1A 3UI3A 3HVZA 3P63A 3GZNI 1MFWA 5IO9A 3AH7A 1OQQA 3A4SC 2FIFA 3TIXA 2ZJDA 2M1MA 4LTUA 4GDLA 1JWSD 1XLOA 3U2SC 1RM6C 4I6LB 2D07B 3N1ZC 3QIJA 4EFOA 1FXAA 3ZNZB 4MDKE 2YEPB 4KZCA 3BVMA 3AMZA 2D3GA 1FCCC 3QQ8B 4LNNA 2KWUB 2ASQA 2ZNVB 2JU6X 1ESFA 4A90A 2BKRB 3DQVA 1XT9B 3ZQ4A 2OEDA 2V3SA 3N20C 2D11A 2GOWA 5CX3A 2WXPA 2MP2B 2VZKB 3MTNB 1CK1A 2BS4B 2AQ3B 3VUYA 1Z5SB 4DHZE 3DHIC 3QWZB 5C23A 2EKIA 1L0XB 2MA9B 4WJNA 4BBNF 5CHFA 3H8HA 1XXGA 3IT6B 3BWUD 2M56B 4AOFA 3PSEB 4LJOB 1AWDA 2BTEA 4BZAA 2VRRB 3IAS1 1T0QC 2L00B 3P1MA 1EF1A 1F52A 3RD2A 2KNBA 1YN4A 3Q3MC 1KRHA 1RFKA 5JZEB 3KH0A 4YSZB 1TGZB 1ZGUB 4BKSD 3A9JA 3PLUA 4IDIA 1BXTA 5D94A 1NI2A 2NPTB 1SE3A 4XYCA 3HHMA 1QOGA 2D2QA 2L05A 1GJZA 1UGMA 1UH6A 4MT5A 1YJ1A 2K1FA 2JSVX 4FXCA 3ABVB 4TQ1A 3B08A 3VDZA 3TEZA 3W5VB 2GRIA 4OHJA 4WWMA 2R61A 2LMCA 3O65B 2MW5A 1E8YA 2PTLA 1UD7A 2BF8B 1EU3A 2KDFB 3P4PB 5AZHA 4P6VF 2DHZA 2ZVOA 3QCAA 4HCPB 4HPMB 3QJZA 2FBWB 3R7QA 3C0RB 4K7WA 3RYTA 4EZLA 1HE8A 5EE9A 2FCNA 1V1PA 2G9HD 2N7JA 2HTME 1YIWA 3W2DA 4NQKE 5EE3A 5G5HA 1C76A 4TKNA 1FD6A 2FCSA 3PS6A 5TSSA 3AI5A 4MGYE 3RFZB 1GAQB 1YOVB 2R2QA 1E8XA 1SF0A 4YT0B 1UF0A 4WJOA 3BYYB 4HEA1 3KW5B 2KWVB 4HWIB 3WA0A 1MG8A 2MJDA 1XLPA 2CKHB 2CU3A 2KKCA 4XDDA 2I1JA 2KAJA 3M62B 3DBLI 4W9LA 4OVVA 4G11A 1DYQA 2KX0A 3DVNU 2KVZA 4WAFA 1TT5B 2KD0A 3ZGZA 3VH3B 1AARA 1YN3A 5G2NA 1P7FA 1CQVA 1A70A 2PEAA 2Z8LA 5J18A 5E6PA 1HTQA 1N5WA 5HHDG 2CHWA 3P42A 1WF9A 3UF8A 4GU2A 2KHWB 2JY6A 3Q8BA 1WGGA 4OVUA 1ZKHA 4XDCA 3DWMA 5AZFA 3OG5A 4H2AA 4DXGA 3N1XC 1L4DB 2BS2B 1YN5A 1XO3A 1EUVB 1T3QA 1MPEA 1E7VA 1Q0WB 4GSWA 1K52A 2LGXA 4MH8A 2BYFA 5IAAC 2W82A 2B76B 4WQOB 2V3PA 4HK2A 1TZ1A 4FLHA 3AU4A 4WWOA 4NJCA 3DBLB 2KQ4X 1SJHD 4MGZE 5TR5A 1VJKA 3NY5A 3OWEB 4ASWC 3VRAB 2INPE 1ZOYB 1JRPA 4CO7A 1V1PB 3AE6B 4G0NB 2IY1B 1XLNA 1E9MA 4DK5A 1QOAA 2VZKD 1FRRA 1RFAA 5J17A 2MWSB 4BKTA 3B2FA 3PRMB 3M63B 2FCQA 1L5PA 1HZ6A 2GBMA 2PIAA 2DWQA 3NZUA 1VZ6A 1FXTB 4NJ6A 5D2MB 1UBQA 4NNJB 1L6UA 4S0RA 3AE9B 4REZA 2AWTA 4QAYA 1EU4A 3L4PA 3N9YC 1FEHA 1FNVA 1NDDA 5GMVA 2CHXA 3MFGA 3CMMB 1N60A 3Q3FA 4NJ7A 5LXIB 3KUZA 2K0PA 2JQRB 1PQSA 2NVUI 4UDUC 2W3SA 3I63C 4LNOA 2J0MA 2V4LA 1D4BA 4HDQA 2KWDA 1WZ3A 1WXMA 4HPLB 4ZRKA 5EE0A 4NAMA 4IWQA 4RFBA 3AE5B 3HK0A 5BMIA 5H8YE 1SSNA 2HJ1A 5HKHA 1QQRA 2G4DB 2J52A 1V2YA 1IGDA 4M00A 4HJKA 5H92C 4KSKC 1WM3A 2KX3A 4WURA 5EE1A 4WJQA 1WWTA 2JWZA 2LXAA 3B9JA 1XLQA 3ZDMC 2ZNVC 1U4AA 3RCZA 1WMHA 3WANA 1FM0D 2K39A 1CZPA 2C5LC 2MQJA 3AE1B 4BKSA 5E6OA 4FHJA 1GB4A 2G1EA 2Y5PA 2YLMA 2X38A 2BT6A 3ZRFA 2LGYA 1TYGB 2NMQA 2K8CA 2NBUA 2ZCCA 2UU7A 4KIKB 1PFDA 4KKIA 3PTFC 3CWIA 3V05A 2WS3B 1H8CA 4OZCA 4NAWA 2HD5B 3PHWB 3KWVA 4LCDE 1KFYB 2JPHA 2KWCA 1E90A 2KMMA 4P7IA 4RGOS 5DPSA 2J4XA 1JWAD 2DZKA 3GB1A 3LJ3A 3PRPB 1KTKA 4M0WA 2D3BA 2BQQA 1NEKB 2I2YA 4JWUC 2KK8A 2YEPF 2MHJA 2LUEA 2MX2A 1A5RA 2KFKA 2J7QB 2YVCA 4F7ZA 3ZKJC 1C78A 3PGEA 2XEWA 2WQYB 2QIEB 2GBRA 3H7PA 4B6WA 4OZBA 5E6JA 4GOCA 3U7DA 1SEBD 4N59A 3VUXA 4OVZA 4M8NA 5IP4D 2N4FA 1IP9A 1Y56A 2ON8A 2IO2B 2MJ3A 3ZTDA 3IHPC 2XNAC 5DPRA 1K50A 1WIAA 2MBEA 2QHOA 4M02A 2KDEB 4OW0A 1GG3A 1NYRA 3AE7B 1KM7A 3UINB 3NJTA 1DOIA 1FNWA 1F77A 1WX8A 1XD3B 2Z59B 3AE3B 1Z2MA 2BYTA 2MLBA 3DBRI 1WMHB 4ANVA 3U7ZA 3ZO5B 1MI0A 2ONQA 4MACA 4DHZB 3QK0A 5T8IA 1LGRA 2DYMA 1UBIA 2L8JA 2N9KA 2WP9B 3R2TA 4RM8A 1ENFA 2JXXA 1FFVA 3NRZA 1PDXA 4II2B 4MH0E 3ZJVA 2IZVB 4KZ0A 3DHGC 1QOFA 3V6EB 3KUCB 3RULA 4MSMB 1RYJA 1WR1A 4MM3A 1QOBA 4ICVA 2AL6A 3PO0A 2MBOA 3B1LX 4KV2A 2CJNA 3ENEA 3QC8B 2V9HA 2FUHB 2MP2A 1FPYA 5LNK1 1WFYA 1KOTA 2DLBA 3HM3A 3RI7C 2N9LA 3HUIA 3KYCD 5JXVA 2FCMA 4WAAA 1LFDA 3VXWA 4JE3B 4DHJB 1ZP0B 3B0AA 4FJVB 3DBRB 2ZPYA 2KFKB 2DAFA 2D10A 3U52E 1LXDA 4X57B 2WXRA 1AYFA 3H7PB 3MC9A 5JHAA 2XN9C 2WXJA 4E3CA 4C80A 4KGSA 1QILA 2WXMA 3GOEA 1PYWD 1UGJA 2CS4A 1P1AA 1C4PA 1AW7A 1V9JA 3T3OA 1C9FA 5CTRC 4YTPB 1NBFC 4ARIA 3W5UB 2KFJA 3SU8X 3RT3B 2H88B 2I1KA 3Q3JA 1M4VA 1KF6B 4E71A 5C2TB 1T0RC 3PHXB 3A9KA 4W9EA 3DBHI 2N7EA 5D3DA 3FC4A 1NENB 1ISNA 1UNSA 1F2RI 3AU5A 2EMSA 3T3NA 3UQBA 2JRIB 5C3JB 2FNJB 1V86A 3BZDB 1SE2A 3VTUA 1FFUA 4FULA 2WXQA 2RMMA 4MGIE 3AXCA 2LASA 3QARA 1I4GA 3AEGB 1R4NI 4MM3B 4RCOA 3ZNID 1S3SG 3W1SC 3W9CB 2GBKA 1P98A 3AEAB 1TY2A 4DDGD 2A5UA 4XWWA 1C4AA 2IPKD 2WXFA 1B9RA 1QZEA 2EMTA 5D6JB 2ICIA 3CIRB 3ZXRA 4ZDVA 5D3IB 2JYEA 2W55A 3GZNB 3R8BA 3SFDB 2KMAA 4AP4C 2KLGA 5BMHA 3DBHB 3X0WA 1TTNA 3ECIA 1FO4A 1D5MC 2LUMA 2WX1A 3B2GA 3S2AA 4EEWA 3TEWA 2WXKA 3PV1A 4XE0A 2NCNA 1NVID 3BIID 2M19A 2LJIA 2PE6B 1CJEA 2M4NA 1TJEA 3C19A 3OJ3A 4C7ZA 5EDSA 2WYQA 3HIZA 1R4NB 4W9CA 4F1SA 3H7SA 2WHIA 2LHDA 2Y3AA 3NOBA 4JIOU 2X8XX 3GS2A 4F8CB 3TEXA 3R3MA 1BT0A 2NBVB 4ZRPA 3A9KB 2XK5B 2ZW1A 2WXHA 1MG4A 4M01A 2K6QA 1V8CA 3SD5A 1N6ZA 4YXDB 1V6EA 4P1CC 2MBQA 3VFKA 1FCLA 1YJIA 4A6QA 2BW2A 5HFYA 1RWSA 2FIDA 2ZZPB 4RGNA 3I5JC 4IKGA 1WXQA 3V60A 1MJDA 3DBSA 4DHJD 3IT4B 2JZZA 4JX1C 3Q6BA 2ZCBA 2MH7A 2IYDB 3BINA 2CHZA 3PT2B 1V5OA 1WJ6A 2DZJA 4N58A 4WJPA 2M17A 2SEBD 1L0VB 1DOYA 2L32A 3Q14C 1L0YB 5GXGB 3KVFB 3ZJUA 1JRUA 1D3ZA 2ZEQA 2KN4A 3DVGY 3APCA 3Q69A 2KDIA 3W1SA 1D5XC 2KTFA 3MP9A 2LD9A 4KDIC 1EO6A 4BKGA 1V81A 3LXFA 4XGAB 2E6XA 1OTRB 4J6IA 2KJHB 5IOIA 4MELA 2K25A 3ZVVA 4D2KA 4YWGG 4KVGB 1K51A 1E6EB 1FXIA 2AX5A 2RDHA 1UWXA 2LWPA 3SHQA 4US9A 3RN9C 1WGDA 4K3CA 2WU2B 2PLPA 2JZ3B 3KYDD 1RLFA 2GLSA 2KN5A 4I6PA 4FADA 3APDA 4II3B 3BY4B 4W9FA 1WXSA 1JALA 1C3TA 5BYSA 1VZ8A 1SJED 1ZXHA 1IGCA 3ZW3A 2WDTB 1V1OA 3K9PB 1HA5A 4K1RB 2DZMA 4MSQB 2L76A 4KIKA 4YSXB 2C7MB 1B1ZA 2LGDA 4A9AA 2PW9A 2IO0B 3V61A 2M0XA 4WH4A 3FKYA 1SE4A 2XBBC 2K9XA 4ICUA 1HZ5A 5KHOA 2PJHA 1GC6A 4FJYA 3VR8B 3EECA 4A3PA 3DVNV 4MEMA 1VR9A 1FMAD 1NYQA 2GI9A 3DDCB 1OQYA 4JWSC 1M94A 1IYFA 2EKEC 1STEA 2N9XA 2BKFA 2WLBA 1DGJA 1HQRD 2KDBA 2L52A 3TUOA 1TS3A 4KSLC 1WE7A 5C1ZA 1UUPA 2KC1A 5AUKA 2ACZB 3RNCC 2K8BA 2K5PA 4B95A 3SDLC 1T6BX 4ZRIA 3APFA 1AN8A 2L0TA 4BFRA 4FJZA 1ACCA 4NPNA 1F1HA 5HG2A 3VHTC 2MEKA 5DPWA 2BWES 1WXVA 4AUQC 1WJNA 2ZW0A 5MPOA 3JVZX 4Q2JA 1WGHA 3BYTB 3IAM1 3SR6A 1EWYC 3DVGX 1P0RA 2DENB 3DCGA 3KWLA 1WX7A 4HXDA 5L83A 4HPPA 1Q10A 3Q8EA 1ZDXA 2CU1A 3WAPA 5IKCM 4HDOA 4URKA 3AE8B 5G55A 1ZUD2 2WDQB 4A20A 3N1YC 1SIFA 2K22A 4LJPB 1C77A 2D5GA 2DYBA 3AEDB 3HM6X 1OQRA 1S1QB 2UYZB 4HROA 2KQSA 2O2VB 1PGAA 2LVPA 4AS1A 2C7HA 3BK2A 2W9NA 2Z0DB 4ZOHC 1OEYJ 3GE8C 2J53A 4C00A 3RNBC 1C1YB 3NS8A 3AEBB 3NG0A 1FIQA 1PUTA 1LQBA 3T8MA 2KC2A 2WX0A 4GB9A 1L4ZB 2LHEA 1V49A 1F2RC 1VRAB 3PVLA 3A1QB 2KACA 4GN1A 4A55A 3LB8C 2V4IB 3ZYYX 1PGXA 1HEZE 3ONSA 4L2YA 1WJ4A 5LLIA 4A8XC 1HTOA 3RMKC 1C4CA 3EUB2 2ZPNA 1E10A 2PE9A 1WXAA 3V62A 4ANUA 2GBJA 5FR3A 4DDID 4AQ7A 1WI0A 4IM0A 3TCAA 2WXOA 4P1BC 2JT4B 1XCQL 4IW0A 2J42A 1T5XD 3M3JA 2W3RA 2LZ6A 1SXTA 2L83A 3ZNHB 4K3BA 1OEYA 3UIPB 1N62A 2IGHA 4WIPA 2N0SB 4RF0A 4MGKE 1YQ4B 5FR6A 2KXJA 1IPGA 1WE6A 1YNTE 2WDRB 2BGFA 1N63A 3UGBB 3H1UA 3WALA 2CJOA 3A33B 1G6JA 3AE4B 1WRIA 4S17A 1GOZA 4WWPA 3N3KB 2VH1A 4FBJB 3N30A 3RNAC 3CSTA 4C7YA 1GUAB 2RDBC 1QLBB 1SIJA 4ZRQA 2JX5A 4GDKA 2GBNA 3PRZA 3WAOA 1I42A 4HKZE 1GC7A 4KX6B 4YTNB 4HVBA 1XCTL 5DCNA 1WZ0A 3TSSA 2Z0EB 1TS2A 1YQ3B 4DXAB 3ML9A 2NBWB 2LGSA 3BVGA 1ET6A 1TZOA 3L10B 3P4RB 1WRDB 4BOZB 3VH4B 4CHKA 2N9EB 3H6NA 3PPAA 4LNIA 4LLGM 3AV8A 1Q5WB 3KUDB 2I38A 3HRDD 3AEFB 1F0ZA 3OJ4B 2D3CA 3EHVA 4HCNB 3SEBA 2OJRA 3PLVA 5JHBA 1XQQA 1GNUA 1L2NA 1LM8B 1K8RB 3PZ8A 4TQ0A 2L3ZA 4L1BA 1WH3A 4KGRA 4IC7B 4M8MA 1SB3C 3PZDA 2V1YA 3R2IA 1T0SC 1I4PA 1GPXA 2IY0B 2WDVB 2INCC 2DBYA 1ET9A 4PK1A 2KVRA 4W9IA 2QJLA 3BVZA 1I35A 4TSSA 2XK5A 4GLSC 4W9HA 1V5TA 3MHZA 4R3DA 1JMLA 4K81A 2NS5A 4DWFA 2OHFA 1KLUD 4IM2A 2LI5A 4RH6A 3QX1A 3L0WB 2WXLA 4ARCA 2NR2A 3C8YA 4GDKB 2RD0A 1ZXIA 3ZTCA 4IWOA 2AL3A 2KJ6A 4NQLB 3VR9B 2L1AA 4ZHPA 2LRUA 1IBXB 2LFIA 2KMCA 1UWMA 4XC2A 4DBGA 4JPSA 4AJWA 3EFUA 4PYZA 5FKAC 4ZYNA 2WXIA 2LVQA 1DOXA 4C56C 4LDTB 2WXNA 3MHSD 3NVVA 4YL8A 3AE2B 2RGFA 3PREA 2KOXA 3VUWA 4G3XB 1K53A 2G4SA 1HXYD 2WWZA 2MRPA 4ITKA 4RNAA 3WAMA 3RZFA 2KLCA 3T9LA 4J3OD 1OFFA 4N9F4 5BO4B 1H4RA 1QT9A 3RUIB 3P2BA 1EWCA 4W9KA 3QHTA 3KLSX 1P7EA 1TBEA 1YQBA 2BWFA 4O1NA 4EE2A 1XF5L 3IXSA 2MCNB 4FN2A 2MSED 2N9PC 1VLBA 1Y8RC 4ZRJA 1UELA 2L7RA 4LNKA 3FAHA 3Q8CA 1ZPSA 1JWUD 3ALBA 1E0ZA 2OOBB 2AEHA 2G3QB 3MC8A 2LEKA 3AEEB 1J7BA 3CSFA 4EZKA 2KANA 5FK9C 4CYEA 1R4MI 2DX5B 1TS4A 4DXFA 1C79A 5E6NA 1KLVA 1RAXA 2DZIA 3NVZA 5IA7A 3V6CB 4EZJA 3L08A 3LYYA 5IN7A 4P16A 4W9DA 1YD8U 1CMXB 4GDLB 5HI1A 2LJ5A 3A4RA 1V80A 3TL5A 1T0YA 3ZNGC 3ZRCA 2QC8A 1J7CA 4K7SA 2J0KA 4HKQA 5LXHA 4ACFA 4NY0A 2C60A 3E56A 1TKYA 1I4RA 5CHWA 1KH0A 3SFEB 2WNMA 3L54A 2O6VD 3DPDA 1F9JA 3H9DA 2KYWA 2BPSA 3VVWB 2HJ8A 4IM3A 3I9V1 3ML8A 4JGHB 1MHHE 3Q3NC 2M8SA 4G50A 1E7UA 2UWQA 3OAWA 3WIMA 2Y5CA 2PKOA 2FUG1 2WU5B 4EUTA 1R4MB 5CHVC 1P3QU 2RR9A 1NI3A 3HVDA 1JQ4A 2MBBB 3JYUA 3NVYA 4ANWA 2QSDA 2H89B 1J0GA 4FHKA 2KQ7A 4HRSA 2PVOD 1WYGA 2LRWA 4KKJA 2JRHA 2C9WB 5L95C 3L16A 4GXBA 4MJSA 1I4XA 3AULA 2NTTA 3A9JB 1LO5D 2INNE 1D6EC 4WWNA 2INDC 2B3AA 1TKGA 4L23A 3AM9A 2BYVE 2O2VA 3P4QB 1KLGD 3MJWA 1WY8A 2V3NA 3IVFA 3NZSA 4XZ4A 4WQMA 4BAXA 2OJWA 1WX9A 2E3TA 2JWUA 3ZLZA 2WGSA 2V0GA 4LDTD 2BB6A 1WR6E 2K3UA 3TMPB 3LDZE 2DNFA 4HLEA 1SBBB 3FILA 2PVGC 2N7DA 3ZDTA 3A1QA 5AUIA 4TMAB 1JROA 4YTMB 4BOSC 3RNFC 3MC0B 1PGBA 3EA6A 4DQOC 4E74A 4BVUC 3N32A 2IGDA 2DYOA 1WGYA 4RGTA 4EOYA 1UZXB 2BB5A 3UIOB 2G45B 2AQ1B 1JWBD 4PT5A 1I4QA 4W9JA 3R66C 3EFCA 1EF5A 4JLCA 3U4EG 4C4VA 3GP7A 1SGHA 2JYTA 3AN1A 1WGKA 3E9SA 2RSUA 2AYOB 4PS8A 1SE9A 1D5ZC 3RNGC 4USAA 4GMVA 4EKUA 2N1WA 4IOIE 3RZWC 3WCQA 3D32A 3W1YA 2K8HA 1QKZA 4MJSB 2IDYA 4TUUA 3ZIMA 1I7HA 2HE7A 2RPVA 2AQ2B 2KTRA 1TS5A 4JL9A 3MJ5A 4B0MA 3I57A 5KHQA 2GMIC 4IUMB 4LK0M 2IO3B 3VRBB 4W9GA 4HJGE 2IO1B 1BUIC 1E8ZA 1V97A 4PS7A 4XWTA 1MVKA 2KZRA 2SAKA 1BMLC 2PMVA 1VDVA 4IG7B 1R7SA 1J19A 2CR5A 1L7YA 3TEYA 2IGGA 3FILB 3DWGC 4N6EB 2Q5WD 2K6DB 4TV3A 2KO3A 3IG3A 3J9CA 5J2RA
chains in the Genus database with same CATH topology
4MGZE 4W9CA 5TR5A 3NY5A 4ASWC 4F1SA 5JHBA 1OGWA 3H7SA 1XQQA 1GNUA 3NOBA 1L2NA 1LM8B 4JIOU 4F8CB 4RM9A 1K8RB 4TQ0A 3QAQA 4CO7A 2L3ZA 2LXCA 4G0NB 1WH3A 2IY1B 1BT0A 3R3MA 2NBVB 4DK5A 3A9KB 2XK5B 4IC7B 1ZW7A 1RFAA 4M8MA 5J17A 2LVOA 3PZDA 2V1YA 2MWSB 4BKTA 1E8WA 1WJUA 2FAZA 3PRMB 3EC8A 3M63B 2K6QA 2FCQA 2GBMA 1E5WA 2IY0B 3SD5A 1YX5B 2C7NB 3NZUA 1V6EA 1FXTB 4NJ6A 2O6VA 2KVRA 5D2MB 1UBQA 4NNJB 4W9IA 2MBQA 3VFKA 5D7GA 2AWTA 2PPHA 2Y5BB 1I35A 2N1VA 3M95A 2XK5A 4W9HA 3VQIA 1NDDA 1V5TA 2CHXA 5GMVA 3CMMB 2FIDA 4K81A 2NS5A 3VAWA 3UQAA 3Q3FA 2ZZPB 4NJ7A 5LXIB 4DWFA 3CF6E 3V60A 3KUZA 4FA6A 1X1MA 3DBSA 4DHJD 4IM2A 2LI5A 1VD2A 4RMAA 1PQSA 2NVUI 3JSVA 1RRBA 2JZZA 3QX1A 3IBEA 3L0WB 2ZCBA 2IYDB 3BINA 2CHZA 2J0MA 2V4LA 2NR2A 2A4ZA 3PT2B 1V5OA 1WJ6A 2DZJA 4HDQA 4WJPA 2M17A 4B9KA 1WZ3A 4GDKB 1WXMA 4HPLB 2RD0A 2KTRB 4ZRKA 3DOWA 3ZTCA 3KVFB 4IWOA 4IWQA 5AEKB 1JRUA 1D3ZA 3HK0A 2AL3A 2KJ6A 4NQLB 5AZGA 2J0JA 2ZEQA 4GIVA 3DVGY 1WGRA 3JW0X 2LRUA 5HKHA 3APCA 2G4DB 2KDIA 1Q1OA 1V2YA 2KMCA 3W1SA 4A3OA 2KTFA 4HJKA 4XC2A 2LD9A 4KSKC 4KDIC 3QA8A 3TJPA 4DBGA 1WM3A 1EO6A 4BKGA 2KX3A 4AWJA 1V81A 2JF5A 4AJWA 4WJQA 4GGQA 5JH5C 3EFUA 4PYZA 4ZYNA 2LVQA 4XX5A 2JWZA 2LXAA 4AJYB 3R7RA 1OTRB 4J6IA 4LDTB 3ZDMC 2KJHB 3MHSD 3VTVA 4ANXA 2HTHA 4YL8A 4I6NB 2ZNVC 4MELA 1U4AA 2RGFA 2K25A 3PREA 3RCZA 3ZVVA 2KOXA 1WMHA 5DPTA 4KVGB 3U30A 3VUWA 4G3XB 3WANA 2K39A 3X23A 3L17A 2C5LC 2LWPA 2G4SA 3SHQA 2WWZA 2MQJA 4NAWB 2MRPA 4BKSA 3WAMA 5E6OA 3RZFA 4FHJA 2YLMA 1WGDA 2KLCA 3ZRFA 2LGYA 1YX6B 2RPQA 4N9F4 3T9LA 5BO4B 4IWPA 2JZ3B 3KYDD 1H4RA 1RLFA 2KN5A 4I6PA 2K8CA 3APDA 4FADA 3U8ZA 2NBUA 4II3B 3BY4B 3RUIB 2ZCCA 3P2BA 4KIKB 4W9FA 1WXSA 4W9KA 3PTFC 3QHTA 1TBEA 1YQBA 2BWFA 1C3TA 3IFWB 4M0WB 1H8CA 2MCNB 4FN2A 4NAWA 2MSED 2N9PC 2HD5B 3PHWB 2KJRA 4LCDE 3ZW3A 2WDTB 1Y8RC 4ZRJA 3OLMD 2JPHA 2KWCA 1E90A 1KJTA 1UELA 3K9PB 3VTWA 2REXA 2L7RA 4PYUA 4P7IA 2O6VB 2R2OA 4K1RB 4PS3A 5DPSA 2DZMA 1WYWB 2L76A 4MSQB 4KIKA 2C7MB 3ALBA 3I3TB 2OOBB 2DZKA 2LGDA 2AEHA 2L0FA 2G3QB 2MBHA 3LJ3A 2IO0B 4JQWC 3PRPB 2IBIB 1WM2A 3V61A 2M0XA 3TBLD 3CSFA 2XBBC 4ICUA 2JUOA 5KHOA 2PJHA 2ZVNA 1GC6A 4EZKA 2KK8A 2KANA 4FJYA 4CYEA 3JSVB 1R4MI 3EECA 2DX5B 4A3PA 3ZUNA 2LUEA 3DVNV 4MEMA 2DAJA 3NHEB 2MX2A 3DDCB 1OQYA 2KFKA 2J7QB 2YVCA 1A5RA 1M94A 5E6NA 4F7ZA 1IYFA 2EKEC 3ZKJC 1KLVA 2N9XA 3K9OB 1RAXA 2BKFA 2DZIA 5IA7A 3V6CB 2JVCA 4KDLB 4EZJA 3PGEA 3L08A 4K7UA 2XEWA 3H7PA 2GBRA 2KDBA 4W9DA 4B6WA 1YD8U 3L13A 1CMXB 1P9DU 2NPTA 4GDLB 4GOCA 2LJ5A 1VCBA 3A4RA 4KSLC 1V80A 3U7DA 3VUXA 3TL5A 1T0YA 3ZNGC 4M8NA 1WE7A 4BBNC 5C1ZA 2N4FA 2BYEA 1IP9A 3ZRCA 1J8CA 2KC1A 4K7SA 2J0KA 2IO2B 3GZNI 3ZTDA 5LXHA 2K8BA 3IHPC 4B95A 5DPRA 3A4SC 3SDLC 4NY0A 4ZRIA 2C60A 1WIAA 3APFA 2FIFA 2L0TA 2MBEA 2QHOA 3TIXA 4BFRA 4FJZA 2KDEB 2ZJDA 5CHWA 2M1MA 4NPNA 4GDLA 3L54A 2O6VD 1GG3A 3DPDA 3VHTC 1F9JA 3H9DA 1KM7A 3UINB 5DPWA 2BPSA 3VVWB 4I6LB 2HJ8A 2D07B 4IM3A 3QIJA 1WX8A 1XD3B 2BWES 4EFOA 1WXVA 2Z59B 3ML8A 4MDKE 3ZNZB 4AUQC 4JGHB 1Z2MA 4KZCA 1WJNA 2MLBA 3DBRI 2D3GA 2M8SA 1WMHB 3JVZX 4G50A 1WGHA 4ANVA 1E7UA 3QQ8B 2UWQA 3OAWA 3DVGX 2KWUB 3ZO5B 1P0RA 2DENB 2ASQA 2ZNVB 3DCGA 3WIMA 1WX7A 4DHZB 4HXDA 3QK0A 2BKRB 2DYMA 3DQVA 5L83A 1UBIA 1XT9B 2L8JA 4RM8A 4EUTA 2JXXA 2V3SA 2CU1A 4II2B 2D11A 4MH0E 5CHVC 1P3QU 3WAPA 2IZVB 4KZ0A 2GOWA 2RR9A 4HDOA 5CX3A 5G55A 4URKA 4A20A 2MP2B 2MBBB 1SIFA 3JYUA 4LJPB 3V6EB 3MTNB 2DYBA 3KUCB 4MSMB 3RULA 3HM6X 3VUYA 1Z5SB 1WR1A 4ANWA 4MM3A 4DHZE 2UYZB 1S1QB 3QWZB 1J0GA 4ICVA 5C23A 2AL6A 2KQSA 2MBOA 2KQ7A 2O2VB 4FHKA 2LVPA 3B1LX 2LRWA 2C7HA 4KV2A 2W9NA 2JRHA 3ENEA 2Z0DB 2MA9B 4WJNA 1OEYJ 2C9WB 5L95C 3L16A 4GXBA 4MJSA 3QC8B 5CHFA 4BBNF 3AULA 2FUHB 2MP2A 1WFYA 3A9JB 4AOFA 3PSEB 1KOTA 4LJOB 3HM3A 1C1YB 3NS8A 3KYCD 4WWNA 2VRRB 2FCMA 2B3AA 4WAAA 1LFDA 3VXWA 2BYVE 2O2VA 2L00B 1EF1A 3RD2A 1LQBA 2KNBA 4DHJB 3MJWA 3T8MA 2KC2A 1WY8A 2WX0A 3IVFA 3B0AA 3NZSA 4FJVB 4XZ4A 2ZPYA 2KFKB 2DAFA 5JZEB 4GB9A 3KH0A 2D10A 1V49A 1TGZB 1ZGUB 1LXDA 4X57B 4BKSD 3A9JA 3PVLA 3PLUA 1WX9A 3A1QB 3H7PB 5JHAA 4GN1A 3ZLZA 5D94A 1NI2A 2NPTB 4E3CA 3HHMA 2D2QA 2L05A 1GJZA 1UGMA 1UH6A 4LDTD 1YJ1A 1WR6E 2K1FA 4TQ1A 3TMPB 3LDZE 3B08A 3VDZA 3ONSA 4HLEA 3GOEA 1WJ4A 5LLIA 2CS4A 1P1AA 2N7DA 3O65B 2MW5A 2ZPNA 3ZDTA 1E8YA 1V9JA 2PE9A 1WXAA 3V62A 1UD7A 4ANUA 2BF8B 2GBJA 2KDFB 3A1QA 5CTRC 5AZHA 1NBFC 5J2RA 4DDID 2DHZA 1WI0A 2ZVOA 3QCAA 4HCPB 4HPMB 4BOSC 3QJZA 4IM0A 3TCAA 3R7QA 2KFJA 3C0RB 4K7WA 3RT3B 3RYTA 2JT4B 3SU8X 4EZLA 1HE8A 2I1KA 4IW0A 2FCNA 3Q3JA 4E71A 1YIWA 3M3JA 4NQKE 4E74A 3PHXB 4BVUC 2LZ6A 3N32A 3A9KA 4W9EA 3ZNHB 2DYOA 3DBHI 4TKNA 1WGYA 1OEYA 4EOYA 1UZXB 3UIOB 2N7EA 3UIPB 2FCSA 2G45B 3PS6A 3AI5A 4MGYE 2R2QA 4W9JA 3R66C 1E8XA 1ISNA 3AU5A 1EF5A 2EMSA 4WJOA 3KW5B 2KWVB 4HWIB 4JLCA 3WA0A 4MGKE 1MG8A 3UQBA 5FR6A 2JRIB 2KXJA 2FNJB 1V86A 2CKHB 2KKCA 3VTUA 2I1JA 1IPGA 4FULA 1WE6A 1SGHA 3M62B 3DBLI 4MGIE 4W9LA 3AXCA 4OVVA 2BGFA 2LASA 3QARA 2RSUA 4G11A 2KX0A 3UGBB 2AYOB 3H1UA 1R4NI 3WALA 4PS8A 3ZNID 3DVNU 1S3SG 1SE9A 3W1SC 2KD0A 3A33B 4GMVA 4EKUA 1G6JA 2GBKA 1P98A 4WWPA 2N1WA 3RZWC 3VH3B 1AARA 4DDGD 3N3KB 2A5UA 3D32A 4FBJB 3W1YA 2K8HA 5G2NA 3N30A 3CSTA 4MJSB 2PEAA 1GUAB 5J18A 4TUUA 5E6PA 4GDKA 3ZIMA 2HE7A 2CHWA 1QZEA 1WF9A 2GBNA 2KTRA 3PRZA 3WAOA 2EMTA 4JL9A 1I42A 3UF8A 5D6JB 5KHQA 1GC7A 2GMIC 2KHWB 2JY6A 4GU2A 4IUMB 2IO3B 1WGGA 4OVUA 1ZKHA 4W9GA 2IO1B 5AZFA 4ZDVA 4HVBA 1E8ZA 4PS7A 2KZRA 5DCNA 1WZ0A 2KMAA 4AP4C 2Z0EB 2KLGA 1EUVB 3X0WA 1E7VA 1TTNA 3ML9A 4DXAB 3ECIA 1Q0WB 4GSWA 4IG7B 2WX1A 2NBWB 3S2AA 4EEWA 1J19A 2LGXA 2CR5A 3L10B 3PV1A 1L7YA 1WRDB 4BOZB 3VH4B 2BYFA 5IAAC 4CHKA 2N9EB 3H6NA 3PPAA 2NCNA 4WQOB 1Q5WB 4HK2A 3KUDB 1TZ1A 4FLHA 2PE6B 3AU4A 4WWOA 2M4NA 3OJ3A 2K6DB 3OJ4B 4TV3A 5EDSA 2WYQA 3EHVA 4HCNB 2OJRA 2KO3A 3HIZA 3IG3A 3PLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGZ E;  4W9C A;  5TR5 A;  3NY5 A;  4ASW C;  4F1S A;  5JHB A;  1OGW A;  3H7S A;  1XQQ A;  1GNU A;  3NOB A;  1L2N A;  1LM8 B;  4JIO U;  4F8C B;  4RM9 A;  1K8R B;  4TQ0 A;  3QAQ A;  4CO7 A;  2L3Z A;  2LXC A;  4G0N B;  1WH3 A;  2IY1 B;  1BT0 A;  3R3M A;  2NBV B;  4DK5 A;  3A9K B;  2XK5 B;  4IC7 B;  1ZW7 A;  1RFA A;  4M8M A;  5J17 A;  2LVO A;  3PZD A;  2V1Y A;  2MWS B;  4BKT A;  1E8W A;  1WJU A;  2FAZ A;  3PRM B;  3EC8 A;  3M63 B;  2K6Q A;  2FCQ A;  2GBM A;  1E5W A;  2IY0 B;  3SD5 A;  1YX5 B;  2C7N B;  3NZU A;  1V6E A;  1FXT B;  4NJ6 A;  2O6V A;  2KVR A;  5D2M B;  1UBQ A;  4NNJ B;  4W9I A;  2MBQ A;  3VFK A;  5D7G A;  2AWT A;  2PPH A;  2Y5B B;  1I35 A;  2N1V A;  3M95 A;  2XK5 A;  4W9H A;  3VQI A;  1NDD A;  1V5T A;  2CHX A;  5GMV A;  3CMM B;  2FID A;  4K81 A;  2NS5 A;  3VAW A;  3UQA A;  3Q3F A;  2ZZP B;  4NJ7 A;  5LXI B;  4DWF A;  3CF6 E;  3V60 A;  3KUZ A;  4FA6 A;  1X1M A;  3DBS A;  4DHJ D;  4IM2 A;  2LI5 A;  1VD2 A;  4RMA A;  1PQS A;  2NVU I;  3JSV A;  1RRB A;  2JZZ A;  3QX1 A;  3IBE A;  3L0W B;  2ZCB A;  2IYD B;  3BIN A;  2CHZ A;  2J0M A;  2V4L A;  2NR2 A;  2A4Z A;  3PT2 B;  1V5O A;  1WJ6 A;  2DZJ A;  4HDQ A;  4WJP A;  2M17 A;  4B9K A;  1WZ3 A;  4GDK B;  1WXM A;  4HPL B;  2RD0 A;  2KTR B;  4ZRK A;  3DOW A;  3ZTC A;  3KVF B;  4IWO A;  4IWQ A;  5AEK B;  1JRU A;  1D3Z A;  3HK0 A;  2AL3 A;  2KJ6 A;  4NQL B;  5AZG A;  2J0J A;  2ZEQ A;  4GIV A;  3DVG Y;  1WGR A;  3JW0 X;  2LRU A;  5HKH A;  3APC A;  2G4D B;  2KDI A;  1Q1O A;  1V2Y A;  2KMC A;  3W1S A;  4A3O A;  2KTF A;  4HJK A;  4XC2 A;  2LD9 A;  4KSK C;  4KDI C;  3QA8 A;  3TJP A;  4DBG A;  1WM3 A;  1EO6 A;  4BKG A;  2KX3 A;  4AWJ A;  1V81 A;  2JF5 A;  4AJW A;  4WJQ A;  4GGQ A;  5JH5 C;  3EFU A;  4PYZ A;  4ZYN A;  2LVQ A;  4XX5 A;  2JWZ A;  2LXA A;  4AJY B;  3R7R A;  1OTR B;  4J6I A;  4LDT B;  3ZDM C;  2KJH B;  3MHS D;  3VTV A;  4ANX A;  2HTH A;  4YL8 A;  4I6N B;  2ZNV C;  4MEL A;  1U4A A;  2RGF A;  2K25 A;  3PRE A;  3RCZ A;  3ZVV A;  2KOX A;  1WMH A;  5DPT A;  4KVG B;  3U30 A;  3VUW A;  4G3X B;  3WAN A;  2K39 A;  3X23 A;  3L17 A;  2C5L C;  2LWP A;  2G4S A;  3SHQ A;  2WWZ A;  2MQJ A;  4NAW B;  2MRP A;  4BKS A;  3WAM A;  5E6O A;  3RZF A;  4FHJ A;  2YLM A;  1WGD A;  2KLC A;  3ZRF A;  2LGY A;  1YX6 B;  2RPQ A;  4N9F 4;  3T9L A;  5BO4 B;  4IWP A;  2JZ3 B;  3KYD D;  1H4R A;  1RLF A;  2KN5 A;  4I6P A;  2K8C A;  3APD A;  4FAD A;  3U8Z A;  2NBU A;  4II3 B;  3BY4 B;  3RUI B;  2ZCC A;  3P2B A;  4KIK B;  4W9F A;  1WXS A;  4W9K A;  3PTF C;  3QHT A;  1TBE A;  1YQB A;  2BWF A;  1C3T A;  3IFW B;  4M0W B;  1H8C A;  2MCN B;  4FN2 A;  4NAW A;  2MSE D;  2N9P C;  2HD5 B;  3PHW B;  2KJR A;  4LCD E;  3ZW3 A;  2WDT B;  1Y8R C;  4ZRJ A;  3OLM D;  2JPH A;  2KWC A;  1E90 A;  1KJT A;  1UEL A;  3K9P B;  3VTW A;  2REX A;  2L7R A;  4PYU A;  4P7I A;  2O6V B;  2R2O A;  4K1R B;  4PS3 A;  5DPS A;  2DZM A;  1WYW B;  2L76 A;  4MSQ B;  4KIK A;  2C7M B;  3ALB A;  3I3T B;  2OOB B;  2DZK A;  2LGD A;  2AEH A;  2L0F A;  2G3Q B;  2MBH A;  3LJ3 A;  2IO0 B;  4JQW C;  3PRP B;  2IBI B;  1WM2 A;  3V61 A;  2M0X A;  3TBL D;  3CSF A;  2XBB C;  4ICU A;  2JUO A;  5KHO A;  2PJH A;  2ZVN A;  1GC6 A;  4EZK A;  2KK8 A;  2KAN A;  4FJY A;  4CYE A;  3JSV B;  1R4M I;  3EEC A;  2DX5 B;  4A3P A;  3ZUN A;  2LUE A;  3DVN V;  4MEM A;  2DAJ A;  3NHE B;  2MX2 A;  3DDC B;  1OQY A;  2KFK A;  2J7Q B;  2YVC A;  1A5R A;  1M94 A;  5E6N A;  4F7Z A;  1IYF A;  2EKE C;  3ZKJ C;  1KLV A;  2N9X A;  3K9O B;  1RAX A;  2BKF A;  2DZI A;  5IA7 A;  3V6C B;  2JVC A;  4KDL B;  4EZJ A;  3PGE A;  3L08 A;  4K7U A;  2XEW A;  3H7P A;  2GBR A;  2KDB A;  4W9D A;  4B6W A;  1YD8 U;  3L13 A;  1CMX B;  1P9D U;  2NPT A;  4GDL B;  4GOC A;  2LJ5 A;  1VCB A;  3A4R A;  4KSL C;  1V80 A;  3U7D A;  3VUX A;  3TL5 A;  1T0Y A;  3ZNG C;  4M8N A;  1WE7 A;  4BBN C;  5C1Z A;  2N4F A;  2BYE A;  1IP9 A;  3ZRC A;  1J8C A;  2KC1 A;  4K7S A;  2J0K A;  2IO2 B;  3GZN I;  3ZTD A;  5LXH A;  2K8B A;  3IHP C;  4B95 A;  5DPR A;  3A4S C;  3SDL C;  4NY0 A;  4ZRI A;  2C60 A;  1WIA A;  3APF A;  2FIF A;  2L0T A;  2MBE A;  2QHO A;  3TIX A;  4BFR A;  4FJZ A;  2KDE B;  2ZJD A;  5CHW A;  2M1M A;  4NPN A;  4GDL A;  3L54 A;  2O6V D;  1GG3 A;  3DPD A;  3VHT C;  1F9J A;  3H9D A;  1KM7 A;  3UIN B;  5DPW A;  2BPS A;  3VVW B;  4I6L B;  2HJ8 A;  2D07 B;  4IM3 A;  3QIJ A;  1WX8 A;  1XD3 B;  2BWE S;  4EFO A;  1WXV A;  2Z59 B;  3ML8 A;  4MDK E;  3ZNZ B;  4AUQ C;  4JGH B;  1Z2M A;  4KZC A;  1WJN A;  2MLB A;  3DBR I;  2D3G A;  2M8S A;  1WMH B;  3JVZ X;  4G50 A;  1WGH A;  4ANV A;  1E7U A;  3QQ8 B;  2UWQ A;  3OAW A;  3DVG X;  2KWU B;  3ZO5 B;  1P0R A;  2DEN B;  2ASQ A;  2ZNV B;  3DCG A;  3WIM A;  1WX7 A;  4DHZ B;  4HXD A;  3QK0 A;  2BKR B;  2DYM A;  3DQV A;  5L83 A;  1UBI A;  1XT9 B;  2L8J A;  4RM8 A;  4EUT A;  2JXX A;  2V3S A;  2CU1 A;  4II2 B;  2D11 A;  4MH0 E;  5CHV C;  1P3Q U;  3WAP A;  2IZV B;  4KZ0 A;  2GOW A;  2RR9 A;  4HDO A;  5CX3 A;  5G55 A;  4URK A;  4A20 A;  2MP2 B;  2MBB B;  1SIF A;  3JYU A;  4LJP B;  3V6E B;  3MTN B;  2DYB A;  3KUC B;  4MSM B;  3RUL A;  3HM6 X;  3VUY A;  1Z5S B;  1WR1 A;  4ANW A;  4MM3 A;  4DHZ E;  2UYZ B;  1S1Q B;  3QWZ B;  1J0G A;  4ICV A;  5C23 A;  2AL6 A;  2KQS A;  2MBO A;  2KQ7 A;  2O2V B;  4FHK A;  2LVP A;  3B1L X;  2LRW A;  2C7H A;  4KV2 A;  2W9N A;  2JRH A;  3ENE A;  2Z0D B;  2MA9 B;  4WJN A;  1OEY J;  2C9W B;  5L95 C;  3L16 A;  4GXB A;  4MJS A;  3QC8 B;  5CHF A;  4BBN F;  3AUL A;  2FUH B;  2MP2 A;  1WFY A;  3A9J B;  4AOF A;  3PSE B;  1KOT A;  4LJO B;  3HM3 A;  1C1Y B;  3NS8 A;  3KYC D;  4WWN A;  2VRR B;  2FCM A;  2B3A A;  4WAA A;  1LFD A;  3VXW A;  2BYV E;  2O2V A;  2L00 B;  1EF1 A;  3RD2 A;  1LQB A;  2KNB A;  4DHJ B;  3MJW A;  3T8M A;  2KC2 A;  1WY8 A;  2WX0 A;  3IVF A;  3B0A A;  3NZS A;  4FJV B;  4XZ4 A;  2ZPY A;  2KFK B;  2DAF A;  5JZE B;  4GB9 A;  3KH0 A;  2D10 A;  1V49 A;  1TGZ B;  1ZGU B;  1LXD A;  4X57 B;  4BKS D;  3A9J A;  3PVL A;  3PLU A;  1WX9 A;  3A1Q B;  3H7P B;  5JHA A;  4GN1 A;  3ZLZ A;  5D94 A;  1NI2 A;  2NPT B;  4E3C A;  3HHM A;  2D2Q A;  2L05 A;  1GJZ A;  1UGM A;  1UH6 A;  4LDT D;  1YJ1 A;  1WR6 E;  2K1F A;  4TQ1 A;  3TMP B;  3LDZ E;  3B08 A;  3VDZ A;  3ONS A;  4HLE A;  3GOE A;  1WJ4 A;  5LLI A;  2CS4 A;  1P1A A;  2N7D A;  3O65 B;  2MW5 A;  2ZPN A;  3ZDT A;  1E8Y A;  1V9J A;  2PE9 A;  1WXA A;  3V62 A;  1UD7 A;  4ANU A;  2BF8 B;  2GBJ A;  2KDF B;  3A1Q A;  5CTR C;  5AZH A;  1NBF C;  5J2R A;  4DDI D;  2DHZ A;  1WI0 A;  2ZVO A;  3QCA A;  4HCP B;  4HPM B;  4BOS C;  3QJZ A;  4IM0 A;  3TCA A;  3R7Q A;  2KFJ A;  3C0R B;  4K7W A;  3RT3 B;  3RYT A;  2JT4 B;  3SU8 X;  4EZL A;  1HE8 A;  2I1K A;  4IW0 A;  2FCN A;  3Q3J A;  4E71 A;  1YIW A;  3M3J A;  4NQK E;  4E74 A;  3PHX B;  4BVU C;  2LZ6 A;  3N32 A;  3A9K A;  4W9E A;  3ZNH B;  2DYO A;  3DBH I;  4TKN A;  1WGY A;  1OEY A;  4EOY A;  1UZX B;  3UIO B;  2N7E A;  3UIP B;  2FCS A;  2G45 B;  3PS6 A;  3AI5 A;  4MGY E;  2R2Q A;  4W9J A;  3R66 C;  1E8X A;  1ISN A;  3AU5 A;  1EF5 A;  2EMS A;  4WJO A;  3KW5 B;  2KWV B;  4HWI B;  4JLC A;  3WA0 A;  4MGK E;  1MG8 A;  3UQB A;  5FR6 A;  2JRI B;  2KXJ A;  2FNJ B;  1V86 A;  2CKH B;  2KKC A;  3VTU A;  2I1J A;  1IPG A;  4FUL A;  1WE6 A;  1SGH A;  3M62 B;  3DBL I;  4MGI E;  4W9L A;  3AXC A;  4OVV A;  2BGF A;  2LAS A;  3QAR A;  2RSU A;  4G11 A;  2KX0 A;  3UGB B;  2AYO B;  3H1U A;  1R4N I;  3WAL A;  4PS8 A;  3ZNI D;  3DVN U;  1S3S G;  1SE9 A;  3W1S C;  2KD0 A;  3A33 B;  4GMV A;  4EKU A;  1G6J A;  2GBK A;  1P98 A;  4WWP A;  2N1W A;  3RZW C;  3VH3 B;  1AAR A;  4DDG D;  3N3K B;  2A5U A;  3D32 A;  4FBJ B;  3W1Y A;  2K8H A;  5G2N A;  3N30 A;  3CST A;  4MJS B;  2PEA A;  1GUA B;  5J18 A;  4TUU A;  5E6P A;  4GDK A;  3ZIM A;  2HE7 A;  2CHW A;  1QZE A;  1WF9 A;  2GBN A;  2KTR A;  3PRZ A;  3WAO A;  2EMT A;  4JL9 A;  1I42 A;  3UF8 A;  5D6J B;  5KHQ A;  1GC7 A;  2GMI C;  2KHW B;  2JY6 A;  4GU2 A;  4IUM B;  2IO3 B;  1WGG A;  4OVU A;  1ZKH A;  4W9G A;  2IO1 B;  5AZF A;  4ZDV A;  4HVB A;  1E8Z A;  4PS7 A;  2KZR A;  5DCN A;  1WZ0 A;  2KMA A;  4AP4 C;  2Z0E B;  2KLG A;  1EUV B;  3X0W A;  1E7V A;  1TTN A;  3ML9 A;  4DXA B;  3ECI A;  1Q0W B;  4GSW A;  4IG7 B;  2WX1 A;  2NBW B;  3S2A A;  4EEW A;  1J19 A;  2LGX A;  2CR5 A;  3L10 B;  3PV1 A;  1L7Y A;  1WRD B;  4BOZ B;  3VH4 B;  2BYF A;  5IAA C;  4CHK A;  2N9E B;  3H6N A;  3PPA A;  2NCN A;  4WQO B;  1Q5W B;  4HK2 A;  3KUD B;  1TZ1 A;  4FLH A;  2PE6 B;  3AU4 A;  4WWO A;  2M4N A;  3OJ3 A;  2K6D B;  3OJ4 B;  4TV3 A;  5EDS A;  2WYQ A;  3EHV A;  4HCN B;  2OJR A;  2KO3 A;  3HIZ A;  3IG3 A;  3PLV A; 
#chains in the Genus database with same CATH topology
 1OGW A;  2JZP A;  4RM9 A;  3QAQ A;  5BYR A;  2LXC A;  3Q3O C;  3NS1 A;  2IJ0 A;  5BYQ A;  2LGI A;  2VH2 A;  3BK1 A;  1ZW7 A;  3ZJT A;  2LVO A;  1E8W A;  1WJU A;  2FAZ A;  3EC8 A;  1IUE A;  1E5W A;  2QMT A;  1YX5 B;  2C7N B;  4CQN A;  2EEL A;  1I4H A;  2O6V A;  1JCK B;  3NVW A;  5D7G A;  2W54 A;  1ZDV A;  2PPH A;  2Y5B B;  4C4V B;  4KGT A;  2N1V A;  3M95 A;  3VQI A;  2MJE A;  4RGM A;  1XEE A;  3URY A;  3VAW A;  3UQA A;  3GE3 C;  1FRD A;  2BS3 B;  3RPF C;  2BBC A;  3CF6 E;  4FA6 A;  1X1M A;  1TKE A;  1VD2 A;  4RMA A;  3JSV A;  1RRB A;  3IBE A;  2JXT A;  2A4Z A;  1L6V A;  4ZYS A;  4B9K A;  2KTR B;  1ROE A;  1VZ7 A;  3DOW A;  2RDG A;  5AEK B;  3PZ7 A;  5AZG A;  2J0J A;  4ZHO A;  4GIV A;  1WGR A;  3JW0 X;  1QF6 A;  3NUH B;  1Q1O A;  4A3O A;  5BMG A;  4LNF A;  2TSS A;  3QA8 A;  3TJP A;  4AWJ A;  1N5X A;  2JF5 A;  2NTS A;  4GGQ A;  5JH5 C;  4XX5 A;  4AJY B;  3ZXV A;  3R7R A;  1EM7 A;  4ANX A;  3VTV A;  2HTH A;  1IBX A;  4I6N B;  2QIL A;  2HDE A;  4NZL B;  5DPT A;  2D3A A;  3U30 A;  3X23 A;  3L17 A;  1TY0 A;  1YMH E;  1ZE3 D;  4NAW B;  4B0E A;  2BVC A;  2FE8 A;  2RPQ A;  1YX6 B;  3KQ4 A;  4IWP A;  3U8Z A;  3Q8F A;  5G5G A;  3O13 A;  4RF1 A;  4OZA A;  4YSY B;  3IFW B;  4M0W B;  2KT7 A;  1FNU A;  2KJR A;  3OLM D;  3VTW A;  1KJT A;  3ETR A;  2REX A;  4PYU A;  2O6V B;  2R2O A;  4PS3 A;  3EGR A;  1WYW B;  3NZ3 A;  3V3X A;  2QCZ A;  2QDF A;  3I3T B;  2L0F A;  2MBH A;  4JQW C;  2WXG A;  2IBI B;  1WM2 A;  1MHX A;  3TBL D;  5I4D A;  2JUO A;  2ZVN A;  2M0A A;  2GB1 A;  3RNE C;  1TIF A;  1E7P B;  3JSV B;  3ZUN A;  2DAJ A;  3NHE B;  1YJJ A;  2QEJ C;  3K9O B;  4US8 A;  1J7A A;  2JVC A;  4KDL B;  4K7U A;  1JW9 D;  3AEC B;  3DHH C;  2KDM A;  3AB5 A;  3L13 A;  1P9D U;  2NPT A;  1N61 A;  1VCB A;  1JWM D;  1WSP A;  3Q8A A;  3Q2A C;  4BBN C;  1J8C A;  2BYE A;  3P4S B;  1GB1 A;  3UI3 A;  3HVZ A;  3P63 A;  3GZN I;  1MFW A;  5IO9 A;  3AH7 A;  1OQQ A;  3A4S C;  2FIF A;  3TIX A;  2ZJD A;  2M1M A;  4LTU A;  4GDL A;  1JWS D;  1XLO A;  3U2S C;  1RM6 C;  4I6L B;  2D07 B;  3N1Z C;  3QIJ A;  4EFO A;  1FXA A;  3ZNZ B;  4MDK E;  2YEP B;  4KZC A;  3BVM A;  3AMZ A;  2D3G A;  1FCC C;  3QQ8 B;  4LNN A;  2KWU B;  2ASQ A;  2ZNV B;  2JU6 X;  1ESF A;  4A90 A;  2BKR B;  3DQV A;  1XT9 B;  3ZQ4 A;  2OED A;  2V3S A;  3N20 C;  2D11 A;  2GOW A;  5CX3 A;  2WXP A;  2MP2 B;  2VZK B;  3MTN B;  1CK1 A;  2BS4 B;  2AQ3 B;  3VUY A;  1Z5S B;  4DHZ E;  3DHI C;  3QWZ B;  5C23 A;  2EKI A;  1L0X B;  2MA9 B;  4WJN A;  4BBN F;  5CHF A;  3H8H A;  1XXG A;  3IT6 B;  3BWU D;  2M56 B;  4AOF A;  3PSE B;  4LJO B;  1AWD A;  2BTE A;  4BZA A;  2VRR B;  3IAS 1;  1T0Q C;  2L00 B;  3P1M A;  1EF1 A;  1F52 A;  3RD2 A;  2KNB A;  1YN4 A;  3Q3M C;  1KRH A;  1RFK A;  5JZE B;  3KH0 A;  4YSZ B;  1TGZ B;  1ZGU B;  4BKS D;  3A9J A;  3PLU A;  4IDI A;  1BXT A;  5D94 A;  1NI2 A;  2NPT B;  1SE3 A;  4XYC A;  3HHM A;  1QOG A;  2D2Q A;  2L05 A;  1GJZ A;  1UGM A;  1UH6 A;  4MT5 A;  1YJ1 A;  2K1F A;  2JSV X;  4FXC A;  3ABV B;  4TQ1 A;  3B08 A;  3VDZ A;  3TEZ A;  3W5V B;  2GRI A;  4OHJ A;  4WWM A;  2R61 A;  2LMC A;  3O65 B;  2MW5 A;  1E8Y A;  2PTL A;  1UD7 A;  2BF8 B;  1EU3 A;  2KDF B;  3P4P B;  5AZH A;  4P6V F;  2DHZ A;  2ZVO A;  3QCA A;  4HCP B;  4HPM B;  3QJZ A;  2FBW B;  3R7Q A;  3C0R B;  4K7W A;  3RYT A;  4EZL A;  1HE8 A;  5EE9 A;  2FCN A;  1V1P A;  2G9H D;  2N7J A;  2HTM E;  1YIW A;  3W2D A;  4NQK E;  5EE3 A;  5G5H A;  1C76 A;  4TKN A;  1FD6 A;  2FCS A;  3PS6 A;  5TSS A;  3AI5 A;  4MGY E;  3RFZ B;  1GAQ B;  1YOV B;  2R2Q A;  1E8X A;  1SF0 A;  4YT0 B;  1UF0 A;  4WJO A;  3BYY B;  4HEA 1;  3KW5 B;  2KWV B;  4HWI B;  3WA0 A;  1MG8 A;  2MJD A;  1XLP A;  2CKH B;  2CU3 A;  2KKC A;  4XDD A;  2I1J A;  2KAJ A;  3M62 B;  3DBL I;  4W9L A;  4OVV A;  4G11 A;  1DYQ A;  2KX0 A;  3DVN U;  2KVZ A;  4WAF A;  1TT5 B;  2KD0 A;  3ZGZ A;  3VH3 B;  1AAR A;  1YN3 A;  5G2N A;  1P7F A;  1CQV A;  1A70 A;  2PEA A;  2Z8L A;  5J18 A;  5E6P A;  1HTQ A;  1N5W A;  5HHD G;  2CHW A;  3P42 A;  1WF9 A;  3UF8 A;  4GU2 A;  2KHW B;  2JY6 A;  3Q8B A;  1WGG A;  4OVU A;  1ZKH A;  4XDC A;  3DWM A;  5AZF A;  3OG5 A;  4H2A A;  4DXG A;  3N1X C;  1L4D B;  2BS2 B;  1YN5 A;  1XO3 A;  1EUV B;  1T3Q A;  1MPE A;  1E7V A;  1Q0W B;  4GSW A;  1K52 A;  2LGX A;  4MH8 A;  2BYF A;  5IAA C;  2W82 A;  2B76 B;  4WQO B;  2V3P A;  4HK2 A;  1TZ1 A;  4FLH A;  3AU4 A;  4WWO A;  4NJC A;  3DBL B;  2KQ4 X;  1SJH D;  4MGZ E;  5TR5 A;  1VJK A;  3NY5 A;  3OWE B;  4ASW C;  3VRA B;  2INP E;  1ZOY B;  1JRP A;  4CO7 A;  1V1P B;  3AE6 B;  4G0N B;  2IY1 B;  1XLN A;  1E9M A;  4DK5 A;  1QOA A;  2VZK D;  1FRR A;  1RFA A;  5J17 A;  2MWS B;  4BKT A;  3B2F A;  3PRM B;  3M63 B;  2FCQ A;  1L5P A;  1HZ6 A;  2GBM A;  2PIA A;  2DWQ A;  3NZU A;  1VZ6 A;  1FXT B;  4NJ6 A;  5D2M B;  1UBQ A;  4NNJ B;  1L6U A;  4S0R A;  3AE9 B;  4REZ A;  2AWT A;  4QAY A;  1EU4 A;  3L4P A;  3N9Y C;  1FEH A;  1FNV A;  1NDD A;  5GMV A;  2CHX A;  3MFG A;  3CMM B;  1N60 A;  3Q3F A;  4NJ7 A;  5LXI B;  3KUZ A;  2K0P A;  2JQR B;  1PQS A;  2NVU I;  4UDU C;  2W3S A;  3I63 C;  4LNO A;  2J0M A;  2V4L A;  1D4B A;  4HDQ A;  2KWD A;  1WZ3 A;  1WXM A;  4HPL B;  4ZRK A;  5EE0 A;  4NAM A;  4IWQ A;  4RFB A;  3AE5 B;  3HK0 A;  5BMI A;  5H8Y E;  1SSN A;  2HJ1 A;  5HKH A;  1QQR A;  2G4D B;  2J52 A;  1V2Y A;  1IGD A;  4M00 A;  4HJK A;  5H92 C;  4KSK C;  1WM3 A;  2KX3 A;  4WUR A;  5EE1 A;  4WJQ A;  1WWT A;  2JWZ A;  2LXA A;  3B9J A;  1XLQ A;  3ZDM C;  2ZNV C;  1U4A A;  3RCZ A;  1WMH A;  3WAN A;  1FM0 D;  2K39 A;  1CZP A;  2C5L C;  2MQJ A;  3AE1 B;  4BKS A;  5E6O A;  4FHJ A;  1GB4 A;  2G1E A;  2Y5P A;  2YLM A;  2X38 A;  2BT6 A;  3ZRF A;  2LGY A;  1TYG B;  2NMQ A;  2K8C A;  2NBU A;  2ZCC A;  2UU7 A;  4KIK B;  1PFD A;  4KKI A;  3PTF C;  3CWI A;  3V05 A;  2WS3 B;  1H8C A;  4OZC A;  4NAW A;  2HD5 B;  3PHW B;  3KWV A;  4LCD E;  1KFY B;  2JPH A;  2KWC A;  1E90 A;  2KMM A;  4P7I A;  4RGO S;  5DPS A;  2J4X A;  1JWA D;  2DZK A;  3GB1 A;  3LJ3 A;  3PRP B;  1KTK A;  4M0W A;  2D3B A;  2BQQ A;  1NEK B;  2I2Y A;  4JWU C;  2KK8 A;  2YEP F;  2MHJ A;  2LUE A;  2MX2 A;  1A5R A;  2KFK A;  2J7Q B;  2YVC A;  4F7Z A;  3ZKJ C;  1C78 A;  3PGE A;  2XEW A;  2WQY B;  2QIE B;  2GBR A;  3H7P A;  4B6W A;  4OZB A;  5E6J A;  4GOC A;  3U7D A;  1SEB D;  4N59 A;  3VUX A;  4OVZ A;  4M8N A;  5IP4 D;  2N4F A;  1IP9 A;  1Y56 A;  2ON8 A;  2IO2 B;  2MJ3 A;  3ZTD A;  3IHP C;  2XNA C;  5DPR A;  1K50 A;  1WIA A;  2MBE A;  2QHO A;  4M02 A;  2KDE B;  4OW0 A;  1GG3 A;  1NYR A;  3AE7 B;  1KM7 A;  3UIN B;  3NJT A;  1DOI A;  1FNW A;  1F77 A;  1WX8 A;  1XD3 B;  2Z59 B;  3AE3 B;  1Z2M A;  2BYT A;  2MLB A;  3DBR I;  1WMH B;  4ANV A;  3U7Z A;  3ZO5 B;  1MI0 A;  2ONQ A;  4MAC A;  4DHZ B;  3QK0 A;  5T8I A;  1LGR A;  2DYM A;  1UBI A;  2L8J A;  2N9K A;  2WP9 B;  3R2T A;  4RM8 A;  1ENF A;  2JXX A;  1FFV A;  3NRZ A;  1PDX A;  4II2 B;  4MH0 E;  3ZJV A;  2IZV B;  4KZ0 A;  3DHG C;  1QOF A;  3V6E B;  3KUC B;  3RUL A;  4MSM B;  1RYJ A;  1WR1 A;  4MM3 A;  1QOB A;  4ICV A;  2AL6 A;  3PO0 A;  2MBO A;  3B1L X;  4KV2 A;  2CJN A;  3ENE A;  3QC8 B;  2V9H A;  2FUH B;  2MP2 A;  1FPY A;  5LNK 1;  1WFY A;  1KOT A;  2DLB A;  3HM3 A;  3RI7 C;  2N9L A;  3HUI A;  3KYC D;  5JXV A;  2FCM A;  4WAA A;  1LFD A;  3VXW A;  4JE3 B;  4DHJ B;  1ZP0 B;  3B0A A;  4FJV B;  3DBR B;  2ZPY A;  2KFK B;  2DAF A;  2D10 A;  3U52 E;  1LXD A;  4X57 B;  2WXR A;  1AYF A;  3H7P B;  3MC9 A;  5JHA A;  2XN9 C;  2WXJ A;  4E3C A;  4C80 A;  4KGS A;  1QIL A;  2WXM A;  3GOE A;  1PYW D;  1UGJ A;  2CS4 A;  1P1A A;  1C4P A;  1AW7 A;  1V9J A;  3T3O A;  1C9F A;  5CTR C;  4YTP B;  1NBF C;  4ARI A;  3W5U B;  2KFJ A;  3SU8 X;  3RT3 B;  2H88 B;  2I1K A;  3Q3J A;  1M4V A;  1KF6 B;  4E71 A;  5C2T B;  1T0R C;  3PHX B;  3A9K A;  4W9E A;  3DBH I;  2N7E A;  5D3D A;  3FC4 A;  1NEN B;  1ISN A;  1UNS A;  1F2R I;  3AU5 A;  2EMS A;  3T3N A;  3UQB A;  2JRI B;  5C3J B;  2FNJ B;  1V86 A;  3BZD B;  1SE2 A;  3VTU A;  1FFU A;  4FUL A;  2WXQ A;  2RMM A;  4MGI E;  3AXC A;  2LAS A;  3QAR A;  1I4G A;  3AEG B;  1R4N I;  4MM3 B;  4RCO A;  3ZNI D;  1S3S G;  3W1S C;  3W9C B;  2GBK A;  1P98 A;  3AEA B;  1TY2 A;  4DDG D;  2A5U A;  4XWW A;  1C4A A;  2IPK D;  2WXF A;  1B9R A;  1QZE A;  2EMT A;  5D6J B;  2ICI A;  3CIR B;  3ZXR A;  4ZDV A;  5D3I B;  2JYE A;  2W55 A;  3GZN B;  3R8B A;  3SFD B;  2KMA A;  4AP4 C;  2KLG A;  5BMH A;  3DBH B;  3X0W A;  1TTN A;  3ECI A;  1FO4 A;  1D5M C;  2LUM A;  2WX1 A;  3B2G A;  3S2A A;  4EEW A;  3TEW A;  2WXK A;  3PV1 A;  4XE0 A;  2NCN A;  1NVI D;  3BII D;  2M19 A;  2LJI A;  2PE6 B;  1CJE A;  2M4N A;  1TJE A;  3C19 A;  3OJ3 A;  4C7Z A;  5EDS A;  2WYQ A;  3HIZ A;  1R4N B;  4W9C A;  4F1S A;  3H7S A;  2WHI A;  2LHD A;  2Y3A A;  3NOB A;  4JIO U;  2X8X X;  3GS2 A;  4F8C B;  3TEX A;  3R3M A;  1BT0 A;  2NBV B;  4ZRP A;  3A9K B;  2XK5 B;  2ZW1 A;  2WXH A;  1MG4 A;  4M01 A;  2K6Q A;  1V8C A;  3SD5 A;  1N6Z A;  4YXD B;  1V6E A;  4P1C C;  2MBQ A;  3VFK A;  1FCL A;  1YJI A;  4A6Q A;  2BW2 A;  5HFY A;  1RWS A;  2FID A;  2ZZP B;  4RGN A;  3I5J C;  4IKG A;  1WXQ A;  3V60 A;  1MJD A;  3DBS A;  4DHJ D;  3IT4 B;  2JZZ A;  4JX1 C;  3Q6B A;  2ZCB A;  2MH7 A;  2IYD B;  3BIN A;  2CHZ A;  3PT2 B;  1V5O A;  1WJ6 A;  2DZJ A;  4N58 A;  4WJP A;  2M17 A;  2SEB D;  1L0V B;  1DOY A;  2L32 A;  3Q14 C;  1L0Y B;  5GXG B;  3KVF B;  3ZJU A;  1JRU A;  1D3Z A;  2ZEQ A;  2KN4 A;  3DVG Y;  3APC A;  3Q69 A;  2KDI A;  3W1S A;  1D5X C;  2KTF A;  3MP9 A;  2LD9 A;  4KDI C;  1EO6 A;  4BKG A;  1V81 A;  3LXF A;  4XGA B;  2E6X A;  1OTR B;  4J6I A;  2KJH B;  5IOI A;  4MEL A;  2K25 A;  3ZVV A;  4D2K A;  4YWG G;  4KVG B;  1K51 A;  1E6E B;  1FXI A;  2AX5 A;  2RDH A;  1UWX A;  2LWP A;  3SHQ A;  4US9 A;  3RN9 C;  1WGD A;  4K3C A;  2WU2 B;  2PLP A;  2JZ3 B;  3KYD D;  1RLF A;  2GLS A;  2KN5 A;  4I6P A;  4FAD A;  3APD A;  4II3 B;  3BY4 B;  4W9F A;  1WXS A;  1JAL A;  1C3T A;  5BYS A;  1VZ8 A;  1SJE D;  1ZXH A;  1IGC A;  3ZW3 A;  2WDT B;  1V1O A;  3K9P B;  1HA5 A;  4K1R B;  2DZM A;  4MSQ B;  2L76 A;  4KIK A;  4YSX B;  2C7M B;  1B1Z A;  2LGD A;  4A9A A;  2PW9 A;  2IO0 B;  3V61 A;  2M0X A;  4WH4 A;  3FKY A;  1SE4 A;  2XBB C;  2K9X A;  4ICU A;  1HZ5 A;  5KHO A;  2PJH A;  1GC6 A;  4FJY A;  3VR8 B;  3EEC A;  4A3P A;  3DVN V;  4MEM A;  1VR9 A;  1FMA D;  1NYQ A;  2GI9 A;  3DDC B;  1OQY A;  4JWS C;  1M94 A;  1IYF A;  2EKE C;  1STE A;  2N9X A;  2BKF A;  2WLB A;  1DGJ A;  1HQR D;  2KDB A;  2L52 A;  3TUO A;  1TS3 A;  4KSL C;  1WE7 A;  5C1Z A;  1UUP A;  2KC1 A;  5AUK A;  2ACZ B;  3RNC C;  2K8B A;  2K5P A;  4B95 A;  3SDL C;  1T6B X;  4ZRI A;  3APF A;  1AN8 A;  2L0T A;  4BFR A;  4FJZ A;  1ACC A;  4NPN A;  1F1H A;  5HG2 A;  3VHT C;  2MEK A;  5DPW A;  2BWE S;  1WXV A;  4AUQ C;  1WJN A;  2ZW0 A;  5MPO A;  3JVZ X;  4Q2J A;  1WGH A;  3BYT B;  3IAM 1;  3SR6 A;  1EWY C;  3DVG X;  1P0R A;  2DEN B;  3DCG A;  3KWL A;  1WX7 A;  4HXD A;  5L83 A;  4HPP A;  1Q10 A;  3Q8E A;  1ZDX A;  2CU1 A;  3WAP A;  5IKC M;  4HDO A;  4URK A;  3AE8 B;  5G55 A;  1ZUD 2;  2WDQ B;  4A20 A;  3N1Y C;  1SIF A;  2K22 A;  4LJP B;  1C77 A;  2D5G A;  2DYB A;  3AED B;  3HM6 X;  1OQR A;  1S1Q B;  2UYZ B;  4HRO A;  2KQS A;  2O2V B;  1PGA A;  2LVP A;  4AS1 A;  2C7H A;  3BK2 A;  2W9N A;  2Z0D B;  4ZOH C;  1OEY J;  3GE8 C;  2J53 A;  4C00 A;  3RNB C;  1C1Y B;  3NS8 A;  3AEB B;  3NG0 A;  1FIQ A;  1PUT A;  1LQB A;  3T8M A;  2KC2 A;  2WX0 A;  4GB9 A;  1L4Z B;  2LHE A;  1V49 A;  1F2R C;  1VRA B;  3PVL A;  3A1Q B;  2KAC A;  4GN1 A;  4A55 A;  3LB8 C;  2V4I B;  3ZYY X;  1PGX A;  1HEZ E;  3ONS A;  4L2Y A;  1WJ4 A;  5LLI A;  4A8X C;  1HTO A;  3RMK C;  1C4C A;  3EUB 2;  2ZPN A;  1E10 A;  2PE9 A;  1WXA A;  3V62 A;  4ANU A;  2GBJ A;  5FR3 A;  4DDI D;  4AQ7 A;  1WI0 A;  4IM0 A;  3TCA A;  2WXO A;  4P1B C;  2JT4 B;  1XCQ L;  4IW0 A;  2J42 A;  1T5X D;  3M3J A;  2W3R A;  2LZ6 A;  1SXT A;  2L83 A;  3ZNH B;  4K3B A;  1OEY A;  3UIP B;  1N62 A;  2IGH A;  4WIP A;  2N0S B;  4RF0 A;  4MGK E;  1YQ4 B;  5FR6 A;  2KXJ A;  1IPG A;  1WE6 A;  1YNT E;  2WDR B;  2BGF A;  1N63 A;  3UGB B;  3H1U A;  3WAL A;  2CJO A;  3A33 B;  1G6J A;  3AE4 B;  1WRI A;  4S17 A;  1GOZ A;  4WWP A;  3N3K B;  2VH1 A;  4FBJ B;  3N30 A;  3RNA C;  3CST A;  4C7Y A;  1GUA B;  2RDB C;  1QLB B;  1SIJ A;  4ZRQ A;  2JX5 A;  4GDK A;  2GBN A;  3PRZ A;  3WAO A;  1I42 A;  4HKZ E;  1GC7 A;  4KX6 B;  4YTN B;  4HVB A;  1XCT L;  5DCN A;  1WZ0 A;  3TSS A;  2Z0E B;  1TS2 A;  1YQ3 B;  4DXA B;  3ML9 A;  2NBW B;  2LGS A;  3BVG A;  1ET6 A;  1TZO A;  3L10 B;  3P4R B;  1WRD B;  4BOZ B;  3VH4 B;  4CHK A;  2N9E B;  3H6N A;  3PPA A;  4LNI A;  4LLG M;  3AV8 A;  1Q5W B;  3KUD B;  2I38 A;  3HRD D;  3AEF B;  1F0Z A;  3OJ4 B;  2D3C A;  3EHV A;  4HCN B;  3SEB A;  2OJR A;  3PLV A;  5JHB A;  1XQQ A;  1GNU A;  1L2N A;  1LM8 B;  1K8R B;  3PZ8 A;  4TQ0 A;  2L3Z A;  4L1B A;  1WH3 A;  4KGR A;  4IC7 B;  4M8M A;  1SB3 C;  3PZD A;  2V1Y A;  3R2I A;  1T0S C;  1I4P A;  1GPX A;  2IY0 B;  2WDV B;  2INC C;  2DBY A;  1ET9 A;  4PK1 A;  2KVR A;  4W9I A;  2QJL A;  3BVZ A;  1I35 A;  4TSS A;  2XK5 A;  4GLS C;  4W9H A;  1V5T A;  3MHZ A;  4R3D A;  1JML A;  4K81 A;  2NS5 A;  4DWF A;  2OHF A;  1KLU D;  4IM2 A;  2LI5 A;  4RH6 A;  3QX1 A;  3L0W B;  2WXL A;  4ARC A;  2NR2 A;  3C8Y A;  4GDK B;  2RD0 A;  1ZXI A;  3ZTC A;  4IWO A;  2AL3 A;  2KJ6 A;  4NQL B;  3VR9 B;  2L1A A;  4ZHP A;  2LRU A;  1IBX B;  2LFI A;  2KMC A;  1UWM A;  4XC2 A;  4DBG A;  4JPS A;  4AJW A;  3EFU A;  4PYZ A;  5FKA C;  4ZYN A;  2WXI A;  2LVQ A;  1DOX A;  4C56 C;  4LDT B;  2WXN A;  3MHS D;  3NVV A;  4YL8 A;  3AE2 B;  2RGF A;  3PRE A;  2KOX A;  3VUW A;  4G3X B;  1K53 A;  2G4S A;  1HXY D;  2WWZ A;  2MRP A;  4ITK A;  4RNA A;  3WAM A;  3RZF A;  2KLC A;  3T9L A;  4J3O D;  1OFF A;  4N9F 4;  5BO4 B;  1H4R A;  1QT9 A;  3RUI B;  3P2B A;  1EWC A;  4W9K A;  3QHT A;  3KLS X;  1P7E A;  1TBE A;  1YQB A;  2BWF A;  4O1N A;  4EE2 A;  1XF5 L;  3IXS A;  2MCN B;  4FN2 A;  2MSE D;  2N9P C;  1VLB A;  1Y8R C;  4ZRJ A;  1UEL A;  2L7R A;  4LNK A;  3FAH A;  3Q8C A;  1ZPS A;  1JWU D;  3ALB A;  1E0Z A;  2OOB B;  2AEH A;  2G3Q B;  3MC8 A;  2LEK A;  3AEE B;  1J7B A;  3CSF A;  4EZK A;  2KAN A;  5FK9 C;  4CYE A;  1R4M I;  2DX5 B;  1TS4 A;  4DXF A;  1C79 A;  5E6N A;  1KLV A;  1RAX A;  2DZI A;  3NVZ A;  5IA7 A;  3V6C B;  4EZJ A;  3L08 A;  3LYY A;  5IN7 A;  4P16 A;  4W9D A;  1YD8 U;  1CMX B;  4GDL B;  5HI1 A;  2LJ5 A;  3A4R A;  1V80 A;  3TL5 A;  1T0Y A;  3ZNG C;  3ZRC A;  2QC8 A;  1J7C A;  4K7S A;  2J0K A;  4HKQ A;  5LXH A;  4ACF A;  4NY0 A;  2C60 A;  3E56 A;  1TKY A;  1I4R A;  5CHW A;  1KH0 A;  3SFE B;  2WNM A;  3L54 A;  2O6V D;  3DPD A;  1F9J A;  3H9D A;  2KYW A;  2BPS A;  3VVW B;  2HJ8 A;  4IM3 A;  3I9V 1;  3ML8 A;  4JGH B;  1MHH E;  3Q3N C;  2M8S A;  4G50 A;  1E7U A;  2UWQ A;  3OAW A;  3WIM A;  2Y5C A;  2PKO A;  2FUG 1;  2WU5 B;  4EUT A;  1R4M B;  5CHV C;  1P3Q U;  2RR9 A;  1NI3 A;  3HVD A;  1JQ4 A;  2MBB B;  3JYU A;  3NVY A;  4ANW A;  2QSD A;  2H89 B;  1J0G A;  4FHK A;  2KQ7 A;  4HRS A;  2PVO D;  1WYG A;  2LRW A;  4KKJ A;  2JRH A;  2C9W B;  5L95 C;  3L16 A;  4GXB A;  4MJS A;  1I4X A;  3AUL A;  2NTT A;  3A9J B;  1LO5 D;  2INN E;  1D6E C;  4WWN A;  2IND C;  2B3A A;  1TKG A;  4L23 A;  3AM9 A;  2BYV E;  2O2V A;  3P4Q B;  1KLG D;  3MJW A;  1WY8 A;  2V3N A;  3IVF A;  3NZS A;  4XZ4 A;  4WQM A;  4BAX A;  2OJW A;  1WX9 A;  2E3T A;  2JWU A;  3ZLZ A;  2WGS A;  2V0G A;  4LDT D;  2BB6 A;  1WR6 E;  2K3U A;  3TMP B;  3LDZ E;  2DNF A;  4HLE A;  1SBB B;  3FIL A;  2PVG C;  2N7D A;  3ZDT A;  3A1Q A;  5AUI A;  4TMA B;  1JRO A;  4YTM B;  4BOS C;  3RNF C;  3MC0 B;  1PGB A;  3EA6 A;  4DQO C;  4E74 A;  4BVU C;  3N32 A;  2IGD A;  2DYO A;  1WGY A;  4RGT A;  4EOY A;  1UZX B;  2BB5 A;  3UIO B;  2G45 B;  2AQ1 B;  1JWB D;  4PT5 A;  1I4Q A;  4W9J A;  3R66 C;  3EFC A;  1EF5 A;  4JLC A;  3U4E G;  4C4V A;  3GP7 A;  1SGH A;  2JYT A;  3AN1 A;  1WGK A;  3E9S A;  2RSU A;  2AYO B;  4PS8 A;  1SE9 A;  1D5Z C;  3RNG C;  4USA A;  4GMV A;  4EKU A;  2N1W A;  4IOI E;  3RZW C;  3WCQ A;  3D32 A;  3W1Y A;  2K8H A;  1QKZ A;  4MJS B;  2IDY A;  4TUU A;  3ZIM A;  1I7H A;  2HE7 A;  2RPV A;  2AQ2 B;  2KTR A;  1TS5 A;  4JL9 A;  3MJ5 A;  4B0M A;  3I57 A;  5KHQ A;  2GMI C;  4IUM B;  4LK0 M;  2IO3 B;  3VRB B;  4W9G A;  4HJG E;  2IO1 B;  1BUI C;  1E8Z A;  1V97 A;  4PS7 A;  4XWT A;  1MVK A;  2KZR A;  2SAK A;  1BML C;  2PMV A;  1VDV A;  4IG7 B;  1R7S A;  1J19 A;  2CR5 A;  1L7Y A;  3TEY A;  2IGG A;  3FIL B;  3DWG C;  4N6E B;  2Q5W D;  2K6D B;  4TV3 A;  2KO3 A;  3IG3 A;  3J9C A;  5J2R A; 
#chains in the Genus database with same CATH homology
 4MGZ E;  4W9C A;  5TR5 A;  3NY5 A;  4ASW C;  4F1S A;  5JHB A;  1OGW A;  3H7S A;  1XQQ A;  1GNU A;  3NOB A;  1L2N A;  1LM8 B;  4JIO U;  4F8C B;  4RM9 A;  1K8R B;  4TQ0 A;  3QAQ A;  4CO7 A;  2L3Z A;  2LXC A;  4G0N B;  1WH3 A;  2IY1 B;  1BT0 A;  3R3M A;  2NBV B;  4DK5 A;  3A9K B;  2XK5 B;  4IC7 B;  1ZW7 A;  1RFA A;  4M8M A;  5J17 A;  2LVO A;  3PZD A;  2V1Y A;  2MWS B;  4BKT A;  1E8W A;  1WJU A;  2FAZ A;  3PRM B;  3EC8 A;  3M63 B;  2K6Q A;  2FCQ A;  2GBM A;  1E5W A;  2IY0 B;  3SD5 A;  1YX5 B;  2C7N B;  3NZU A;  1V6E A;  1FXT B;  4NJ6 A;  2O6V A;  2KVR A;  5D2M B;  1UBQ A;  4NNJ B;  4W9I A;  2MBQ A;  3VFK A;  5D7G A;  2AWT A;  2PPH A;  2Y5B B;  1I35 A;  2N1V A;  3M95 A;  2XK5 A;  4W9H A;  3VQI A;  1NDD A;  1V5T A;  2CHX A;  5GMV A;  3CMM B;  2FID A;  4K81 A;  2NS5 A;  3VAW A;  3UQA A;  3Q3F A;  2ZZP B;  4NJ7 A;  5LXI B;  4DWF A;  3CF6 E;  3V60 A;  3KUZ A;  4FA6 A;  1X1M A;  3DBS A;  4DHJ D;  4IM2 A;  2LI5 A;  1VD2 A;  4RMA A;  1PQS A;  2NVU I;  3JSV A;  1RRB A;  2JZZ A;  3QX1 A;  3IBE A;  3L0W B;  2ZCB A;  2IYD B;  3BIN A;  2CHZ A;  2J0M A;  2V4L A;  2NR2 A;  2A4Z A;  3PT2 B;  1V5O A;  1WJ6 A;  2DZJ A;  4HDQ A;  4WJP A;  2M17 A;  4B9K A;  1WZ3 A;  4GDK B;  1WXM A;  4HPL B;  2RD0 A;  2KTR B;  4ZRK A;  3DOW A;  3ZTC A;  3KVF B;  4IWO A;  4IWQ A;  5AEK B;  1JRU A;  1D3Z A;  3HK0 A;  2AL3 A;  2KJ6 A;  4NQL B;  5AZG A;  2J0J A;  2ZEQ A;  4GIV A;  3DVG Y;  1WGR A;  3JW0 X;  2LRU A;  5HKH A;  3APC A;  2G4D B;  2KDI A;  1Q1O A;  1V2Y A;  2KMC A;  3W1S A;  4A3O A;  2KTF A;  4HJK A;  4XC2 A;  2LD9 A;  4KSK C;  4KDI C;  3QA8 A;  3TJP A;  4DBG A;  1WM3 A;  1EO6 A;  4BKG A;  2KX3 A;  4AWJ A;  1V81 A;  2JF5 A;  4AJW A;  4WJQ A;  4GGQ A;  5JH5 C;  3EFU A;  4PYZ A;  4ZYN A;  2LVQ A;  4XX5 A;  2JWZ A;  2LXA A;  4AJY B;  3R7R A;  1OTR B;  4J6I A;  4LDT B;  3ZDM C;  2KJH B;  3MHS D;  3VTV A;  4ANX A;  2HTH A;  4YL8 A;  4I6N B;  2ZNV C;  4MEL A;  1U4A A;  2RGF A;  2K25 A;  3PRE A;  3RCZ A;  3ZVV A;  2KOX A;  1WMH A;  5DPT A;  4KVG B;  3U30 A;  3VUW A;  4G3X B;  3WAN A;  2K39 A;  3X23 A;  3L17 A;  2C5L C;  2LWP A;  2G4S A;  3SHQ A;  2WWZ A;  2MQJ A;  4NAW B;  2MRP A;  4BKS A;  3WAM A;  5E6O A;  3RZF A;  4FHJ A;  2YLM A;  1WGD A;  2KLC A;  3ZRF A;  2LGY A;  1YX6 B;  2RPQ A;  4N9F 4;  3T9L A;  5BO4 B;  4IWP A;  2JZ3 B;  3KYD D;  1H4R A;  1RLF A;  2KN5 A;  4I6P A;  2K8C A;  3APD A;  4FAD A;  3U8Z A;  2NBU A;  4II3 B;  3BY4 B;  3RUI B;  2ZCC A;  3P2B A;  4KIK B;  4W9F A;  1WXS A;  4W9K A;  3PTF C;  3QHT A;  1TBE A;  1YQB A;  2BWF A;  1C3T A;  3IFW B;  4M0W B;  1H8C A;  2MCN B;  4FN2 A;  4NAW A;  2MSE D;  2N9P C;  2HD5 B;  3PHW B;  2KJR A;  4LCD E;  3ZW3 A;  2WDT B;  1Y8R C;  4ZRJ A;  3OLM D;  2JPH A;  2KWC A;  1E90 A;  1KJT A;  1UEL A;  3K9P B;  3VTW A;  2REX A;  2L7R A;  4PYU A;  4P7I A;  2O6V B;  2R2O A;  4K1R B;  4PS3 A;  5DPS A;  2DZM A;  1WYW B;  2L76 A;  4MSQ B;  4KIK A;  2C7M B;  3ALB A;  3I3T B;  2OOB B;  2DZK A;  2LGD A;  2AEH A;  2L0F A;  2G3Q B;  2MBH A;  3LJ3 A;  2IO0 B;  4JQW C;  3PRP B;  2IBI B;  1WM2 A;  3V61 A;  2M0X A;  3TBL D;  3CSF A;  2XBB C;  4ICU A;  2JUO A;  5KHO A;  2PJH A;  2ZVN A;  1GC6 A;  4EZK A;  2KK8 A;  2KAN A;  4FJY A;  4CYE A;  3JSV B;  1R4M I;  3EEC A;  2DX5 B;  4A3P A;  3ZUN A;  2LUE A;  3DVN V;  4MEM A;  2DAJ A;  3NHE B;  2MX2 A;  3DDC B;  1OQY A;  2KFK A;  2J7Q B;  2YVC A;  1A5R A;  1M94 A;  5E6N A;  4F7Z A;  1IYF A;  2EKE C;  3ZKJ C;  1KLV A;  2N9X A;  3K9O B;  1RAX A;  2BKF A;  2DZI A;  5IA7 A;  3V6C B;  2JVC A;  4KDL B;  4EZJ A;  3PGE A;  3L08 A;  4K7U A;  2XEW A;  3H7P A;  2GBR A;  2KDB A;  4W9D A;  4B6W A;  1YD8 U;  3L13 A;  1CMX B;  1P9D U;  2NPT A;  4GDL B;  4GOC A;  2LJ5 A;  1VCB A;  3A4R A;  4KSL C;  1V80 A;  3U7D A;  3VUX A;  3TL5 A;  1T0Y A;  3ZNG C;  4M8N A;  1WE7 A;  4BBN C;  5C1Z A;  2N4F A;  2BYE A;  1IP9 A;  3ZRC A;  1J8C A;  2KC1 A;  4K7S A;  2J0K A;  2IO2 B;  3GZN I;  3ZTD A;  5LXH A;  2K8B A;  3IHP C;  4B95 A;  5DPR A;  3A4S C;  3SDL C;  4NY0 A;  4ZRI A;  2C60 A;  1WIA A;  3APF A;  2FIF A;  2L0T A;  2MBE A;  2QHO A;  3TIX A;  4BFR A;  4FJZ A;  2KDE B;  2ZJD A;  5CHW A;  2M1M A;  4NPN A;  4GDL A;  3L54 A;  2O6V D;  1GG3 A;  3DPD A;  3VHT C;  1F9J A;  3H9D A;  1KM7 A;  3UIN B;  5DPW A;  2BPS A;  3VVW B;  4I6L B;  2HJ8 A;  2D07 B;  4IM3 A;  3QIJ A;  1WX8 A;  1XD3 B;  2BWE S;  4EFO A;  1WXV A;  2Z59 B;  3ML8 A;  4MDK E;  3ZNZ B;  4AUQ C;  4JGH B;  1Z2M A;  4KZC A;  1WJN A;  2MLB A;  3DBR I;  2D3G A;  2M8S A;  1WMH B;  3JVZ X;  4G50 A;  1WGH A;  4ANV A;  1E7U A;  3QQ8 B;  2UWQ A;  3OAW A;  3DVG X;  2KWU B;  3ZO5 B;  1P0R A;  2DEN B;  2ASQ A;  2ZNV B;  3DCG A;  3WIM A;  1WX7 A;  4DHZ B;  4HXD A;  3QK0 A;  2BKR B;  2DYM A;  3DQV A;  5L83 A;  1UBI A;  1XT9 B;  2L8J A;  4RM8 A;  4EUT A;  2JXX A;  2V3S A;  2CU1 A;  4II2 B;  2D11 A;  4MH0 E;  5CHV C;  1P3Q U;  3WAP A;  2IZV B;  4KZ0 A;  2GOW A;  2RR9 A;  4HDO A;  5CX3 A;  5G55 A;  4URK A;  4A20 A;  2MP2 B;  2MBB B;  1SIF A;  3JYU A;  4LJP B;  3V6E B;  3MTN B;  2DYB A;  3KUC B;  4MSM B;  3RUL A;  3HM6 X;  3VUY A;  1Z5S B;  1WR1 A;  4ANW A;  4MM3 A;  4DHZ E;  2UYZ B;  1S1Q B;  3QWZ B;  1J0G A;  4ICV A;  5C23 A;  2AL6 A;  2KQS A;  2MBO A;  2KQ7 A;  2O2V B;  4FHK A;  2LVP A;  3B1L X;  2LRW A;  2C7H A;  4KV2 A;  2W9N A;  2JRH A;  3ENE A;  2Z0D B;  2MA9 B;  4WJN A;  1OEY J;  2C9W B;  5L95 C;  3L16 A;  4GXB A;  4MJS A;  3QC8 B;  5CHF A;  4BBN F;  3AUL A;  2FUH B;  2MP2 A;  1WFY A;  3A9J B;  4AOF A;  3PSE B;  1KOT A;  4LJO B;  3HM3 A;  1C1Y B;  3NS8 A;  3KYC D;  4WWN A;  2VRR B;  2FCM A;  2B3A A;  4WAA A;  1LFD A;  3VXW A;  2BYV E;  2O2V A;  2L00 B;  1EF1 A;  3RD2 A;  1LQB A;  2KNB A;  4DHJ B;  3MJW A;  3T8M A;  2KC2 A;  1WY8 A;  2WX0 A;  3IVF A;  3B0A A;  3NZS A;  4FJV B;  4XZ4 A;  2ZPY A;  2KFK B;  2DAF A;  5JZE B;  4GB9 A;  3KH0 A;  2D10 A;  1V49 A;  1TGZ B;  1ZGU B;  1LXD A;  4X57 B;  4BKS D;  3A9J A;  3PVL A;  3PLU A;  1WX9 A;  3A1Q B;  3H7P B;  5JHA A;  4GN1 A;  3ZLZ A;  5D94 A;  1NI2 A;  2NPT B;  4E3C A;  3HHM A;  2D2Q A;  2L05 A;  1GJZ A;  1UGM A;  1UH6 A;  4LDT D;  1YJ1 A;  1WR6 E;  2K1F A;  4TQ1 A;  3TMP B;  3LDZ E;  3B08 A;  3VDZ A;  3ONS A;  4HLE A;  3GOE A;  1WJ4 A;  5LLI A;  2CS4 A;  1P1A A;  2N7D A;  3O65 B;  2MW5 A;  2ZPN A;  3ZDT A;  1E8Y A;  1V9J A;  2PE9 A;  1WXA A;  3V62 A;  1UD7 A;  4ANU A;  2BF8 B;  2GBJ A;  2KDF B;  3A1Q A;  5CTR C;  5AZH A;  1NBF C;  5J2R A;  4DDI D;  2DHZ A;  1WI0 A;  2ZVO A;  3QCA A;  4HCP B;  4HPM B;  4BOS C;  3QJZ A;  4IM0 A;  3TCA A;  3R7Q A;  2KFJ A;  3C0R B;  4K7W A;  3RT3 B;  3RYT A;  2JT4 B;  3SU8 X;  4EZL A;  1HE8 A;  2I1K A;  4IW0 A;  2FCN A;  3Q3J A;  4E71 A;  1YIW A;  3M3J A;  4NQK E;  4E74 A;  3PHX B;  4BVU C;  2LZ6 A;  3N32 A;  3A9K A;  4W9E A;  3ZNH B;  2DYO A;  3DBH I;  4TKN A;  1WGY A;  1OEY A;  4EOY A;  1UZX B;  3UIO B;  2N7E A;  3UIP B;  2FCS A;  2G45 B;  3PS6 A;  3AI5 A;  4MGY E;  2R2Q A;  4W9J A;  3R66 C;  1E8X A;  1ISN A;  3AU5 A;  1EF5 A;  2EMS A;  4WJO A;  3KW5 B;  2KWV B;  4HWI B;  4JLC A;  3WA0 A;  4MGK E;  1MG8 A;  3UQB A;  5FR6 A;  2JRI B;  2KXJ A;  2FNJ B;  1V86 A;  2CKH B;  2KKC A;  3VTU A;  2I1J A;  1IPG A;  4FUL A;  1WE6 A;  1SGH A;  3M62 B;  3DBL I;  4MGI E;  4W9L A;  3AXC A;  4OVV A;  2BGF A;  2LAS A;  3QAR A;  2RSU A;  4G11 A;  2KX0 A;  3UGB B;  2AYO B;  3H1U A;  1R4N I;  3WAL A;  4PS8 A;  3ZNI D;  3DVN U;  1S3S G;  1SE9 A;  3W1S C;  2KD0 A;  3A33 B;  4GMV A;  4EKU A;  1G6J A;  2GBK A;  1P98 A;  4WWP A;  2N1W A;  3RZW C;  3VH3 B;  1AAR A;  4DDG D;  3N3K B;  2A5U A;  3D32 A;  4FBJ B;  3W1Y A;  2K8H A;  5G2N A;  3N30 A;  3CST A;  4MJS B;  2PEA A;  1GUA B;  5J18 A;  4TUU A;  5E6P A;  4GDK A;  3ZIM A;  2HE7 A;  2CHW A;  1QZE A;  1WF9 A;  2GBN A;  2KTR A;  3PRZ A;  3WAO A;  2EMT A;  4JL9 A;  1I42 A;  3UF8 A;  5D6J B;  5KHQ A;  1GC7 A;  2GMI C;  2KHW B;  2JY6 A;  4GU2 A;  4IUM B;  2IO3 B;  1WGG A;  4OVU A;  1ZKH A;  4W9G A;  2IO1 B;  5AZF A;  4ZDV A;  4HVB A;  1E8Z A;  4PS7 A;  2KZR A;  5DCN A;  1WZ0 A;  2KMA A;  4AP4 C;  2Z0E B;  2KLG A;  1EUV B;  3X0W A;  1E7V A;  1TTN A;  3ML9 A;  4DXA B;  3ECI A;  1Q0W B;  4GSW A;  4IG7 B;  2WX1 A;  2NBW B;  3S2A A;  4EEW A;  1J19 A;  2LGX A;  2CR5 A;  3L10 B;  3PV1 A;  1L7Y A;  1WRD B;  4BOZ B;  3VH4 B;  2BYF A;  5IAA C;  4CHK A;  2N9E B;  3H6N A;  3PPA A;  2NCN A;  4WQO B;  1Q5W B;  4HK2 A;  3KUD B;  1TZ1 A;  4FLH A;  2PE6 B;  3AU4 A;  4WWO A;  2M4N A;  3OJ3 A;  2K6D B;  3OJ4 B;  4TV3 A;  5EDS A;  2WYQ A;  3EHV A;  4HCN B;  2OJR A;  2KO3 A;  3HIZ A;  3IG3 A;  3PLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...