1NENB

Complex ii (succinate dehydrogenase) from e. coli with dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 59
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1nenB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nenB01
3LXFA 1XLOA 1R7SA 3AE3B 1ZXIA 5C2TB 2M56B 3HVZA 1YQ4B 1JWAD 1FFUA 4HROA 1E7PB 1E0ZA 4FXCA 5H8YE 3NVWA 1V97A 1JALA 2BT6A 3ABVB 1PUTA 1UWMA 5EE1A 3ZYYX 1YJJA 3B2FA 2W3SA 4C80A 1QF6A 1H7WA 5MPOA 1F0ZA 4KX6B 3WCQA 1V8CA 2W55A 1FMAD 1FFVA 3AE9B 1KF6B 1KFYB 1NYQA 1NYRA 1YQ3B 4YTMB 1SIJA 3W9CB 3HUIA 1VLBA 2MJDA 4P6VF 2JQRB 3NS1A 1NI3A 1OQQA 3BIID 2OHFA 3HRDD 1DOIA 4WQMA 5G5HA 1N61A 3AE7B 1XLNA 3AEGB 3VR8B 3AEFB 4YTNB 2E3TA 2ACZB 2QIEB 2DWQA 1TKGA 5EE0A 1FO4A 3RPFC 1JW9D 3AE4B 2DBYA 2MH7A 1JROA 2PVGC 3P4QB 2G1EA 3AEEB 1E9MA 1TJEA 1TKYA 2PKOA 3AN1A 3P4RB 4YXDB 5C3JB 1GAQB 2Y5CA 1ZP0B 3NRZA 4WWMA 2WQYB 1E10A 3PO0A 1JRPA 3P4SB 1OFFA 1RWSA 1YJIA 3CWIA 4JWSC 5AUIA 2WU2B 2MJ3A 4ZOHC 2EKIA 1L6VA 3AEBB 1N62A 3FAHA 1VDVA 4A9AA 1N5WA 1FXIA 2JX5A 1NENB 1WWTA 2AX5A 2CJNA 1T3QA 2LEKA 3B2GA 1RM6C 1QT9A 2KMMA 3AMZA 1ZUD2 1NVID 1GTEA 1AYFA 2MJEA 4US8A 1TKEA 1J7CA 1RFKA 3SFDB 2BS2B 3ETRA 1FIQA 1RYJA 1WXQA 3NVVA 2BS3B 3DWMA 1OQRA 2WDVB 1XO3A 3NVYA 4JX1C 2H88B 2KAJA 3KWLA 3W5VB 3AE6B 3VR9B 2WDQB 3VRBB 2H89B 4YSZB 1WGKA 1QLBB 4HRSA 3P1MA 1DOYA 1J7BA 4US9A 5G5GA 4ZHOA 2N0SB 1NEKB 2L83A 2W54A 1QOBA 4C7ZA 3P4PB 4ITKA 3CIRB 4YTPB 3AE1B 3B9JA 5AUKA 1JQ4A 2WU5B 1DGJA 1SF0A 1SB3C 4YT0B 1IUEA 3SR6A 2K22A 2WS3B 1FXAA 4YSYB 1E6EB 2PIAA 1CZPA 5H92C 4C7YA 1L0VB 2K9XA 3AM9A 3L4PA 3AE8B 4N6EB 5GXGB 3AH7A 4N59A 2M19A 2B76B 1EWYC 3DWGC 2CU3A 1N63A 1VJKA 5EE9A 4LTUA 4N58A 2QJLA 1AWDA 1WRIA 2K5PA 3AECB 2W3RA 3LB8C 3AEAB 3FC4A 2Q5WD 3AEDB 4YSXB 2FBWB 1CJEA 2CJOA 4IDIA 1PFDA 3NVZA 1ROEA 5EE3A 1DOXA 1FM0D 1I7HA 2WP9B 3CF4A 1XLQA 1N5XA 4USAA 3VRAB 1GTHA 1L6UA 2BS4B 1GT8A 2WDRB 1QOGA 3P63A 4ZHPA 1J7AA 1FRDA 2HTME 2WLBA 1QOAA 3AB5A 1GPXA 1ZOYB 1L5PA 1N60A 2PVOD 3AV8A 1JWBD 1PDXA 1A70A 1FRRA 1KRHA 1H7XA 1XLPA 1B9RA 3AE2B 3AE5B 3SFEB 1WYGA 3EUB2 2L52A 1TYGB 4JWUC 3W5UB 1QOFA
chains in the Genus database with same CATH superfamily
1LM8B 3APFA 3VAWA 3UQAA 4B0MA 2KT7A 1MPEA 1V97A 3URYA 1UZXB 5FKAC 5MPOA 3WCQA 3KH0A 1NYQA 3W9CB 2NTTA 2N9XA 2RD0A 2O6VD 3HRDD 5G5HA 2GBNA 1EM7A 3AEGB 2V9HA 2ACZB 3ZJUA 2G9HD 1ISNA 1YQBA 2G1EA 3BY4B 4RM8A 3IXSA 5EDSA 3P4SB 1RWSA 4A9AA 1WI0A 2KTRB 2XN9C 2REXA 1TZOA 3DVNV 4US8A 3CMMB 2AEHA 1FIQA 2DHZA 2WXLA 2K25A 5BMIA 1YN5A 3DHHC 3RUIB 3AE6B 4KDLB 2L76A 4XWWA 2KHWB 1E90A 3LDZE 3L0WB 2JYEA 4YL8A 4S0RA 5BO4B 4AQ7A 1T0RC 3DBSA 2A5UA 2NCNA 1IUEA 2KYWA 1F2RI 1TIFA 1IP9A 2N1VA 4C7YA 2KLGA 3AE8B 4AP4C 1YN4A 4HKQA 3A4SC 4WURA 4JL9A 2ASQA 1EF1A 3ZW3A 2WXNA 3VH3B 2V3NA 2IDYA 2CHWA 2CJOA 2M0XA 1I4GA 1I7HA 4DXAB 4FHJA 2QMTA 3UGBB 1PGXA 3IVFA 2PVOD 2KWDA 2N7EA 1FRRA 5JXVA 1CMXB 2MQJA 3AE2B 3SFEB 2LD9A 4OVZA 2DZJA 3VDZA 3HK0A 2M56B 3H9DA 4LNKA 2J52A 2G4DB 2PTLA 3Q8FA 2J0MA 4KX6B 1V1OA 1WXVA 1WR1A 3B08A 1KFYB 4YTMB 2Y5PA 4M8NA 3SU8X 4NY0A 2DX5B 1OQQA 3BIID 2OHFA 2XEWA 3MC8A 4IM0A 2N9LA 1LXDA 3KQ4A 1X1MA 5CHWA 1SE4A 2C7HA 3R7QA 2JY6A 3ZJVA 2LFIA 2MH7A 3AN1A 2E6XA 3DBHB 4QAYA 1OFFA 4GSWA 1P9DU 1YJIA 4W9DA 5BYSA 3R3MA 1WM2A 1A5RA 1NENB 2WHIA 3APCA 3SHQA 2KMMA 4B0EA 3Q3FA 4DHZB 4RGOS 4ZRIA 1XT9B 2YEPF 2FCMA 4EUTA 3UQBA 1TS4A 5JHAA 3W5VB 5LNK1 2NMQA 4WJQA 4KZ0A 2H89B 3ZTDA 4DWFA 4PYUA 2JZPA 4LDTB 2MX2A 4ITKA 2PE6B 3DBRB 2FCNA 1UF0A 2AYOB 2O2VA 4M02A 3DPDA 4ANWA 3HVDA 2MW5A 4WIPA 2OJRA 4WWNA 5LXHA 2K9XA 2LVPA 2D3CA 2KWUB 1WIAA 4LLGM 3AEAB 4RH6A 2DLBA 1VZ8A 1Z2MA 2KACA 4MDKE 2LHDA 2LZ6A 3NS8A 3JVZX 5G2NA 2KQ4X 3AB5A 3Q8BA 1QOAA 1L5PA 3AV8A 3LJ3A 1A70A 1TYGB 1LFDA 2WX1A 1F9JA 2YEPB 1E0ZA 5H8YE 3PZ7A 1ENFA 4EKUA 2MA9B 4NAMA 4RGMA 3I57A 1WGGA 4HVBA 1WRDB 2QC8A 2J0JA 4A8XC 4HEA1 4I6LB 3U8ZA 2L8JA 2CHXA 3ZDTA 1SGHA 2E3TA 3ZRFA 2BQQA 3A9KA 2LGIA 2Y5CA 3N3KB 1XEEA 3ZNGC 4JWSC 2LVOA 2BYVE 3AEBB 2NS5A 4IM2A 4IW0A 5C1ZA 4DDID 1YOVB 2I2YA 3UIOB 2LUEA 5JHBA 5AZHA 3K9PB 2LGYA 1Y8RC 2WXKA 4KKIA 3BINA 3SD5A 1L7YA 2WX0A 1KLVA 3BVMA 4HDQA 4NJ7A 2TSSA 5D94A 4MJSA 3UF8A 2MEKA 2JWUA 4XE0A 3ZJTA 2DYOA 1R4MI 5D3DA 4RFBA 1P98A 4DHJB 3BK2A 4ANXA 1Q0WB 3IAM1 4B95A 1VR9A 1WGRA 2LJIA 2D10A 4DQOC 2C7MB 4OVVA 3V6CB 3W5UB 1PGAA 1R7SA 2C60A 1FFUA 1FNUA 4GDKA 3NVWA 1YIWA 1GC7A 4TQ1A 4NJ6A 1WJ4A 2CHZA 5FK9C 1Q10A 2Y5BB 1KF6B 2O2VB 1B1ZA 1SEBD 2RDHA 2LRWA 4K7SA 3TEWA 2W82A 2PJHA 2DWQA 4BAXA 1HEZE 2HJ1A 2PKOA 1TKYA 1VCBA 3RN9C 3PS6A 1V5OA 4WJPA 3RNAC 3RT3B 4AOFA 4BKSA 4R3DA 2C7NB 5J18A 4HPLB 2AX5A 5E6JA 3GOEA 3TMPB 2MBBB 3AULA 2Z0DB 1TKEA 1IBXA 3TBLD 4W9EA 1RFKA 4NJCA 2KQ7A 3OLMD 3PHXB 4RGNA 1U4AA 1TY2A 4MSMB 3KWLA 2GB1A 4KGSA 4HCNB 4K7WA 4AJYB 3R8BA 4TSSA 2JXTA 2RSUA 4HPPA 4Q2JA 2KDBA 2GBJA 4K1RB 2WXQA 1P0RA 3H7PA 3R2IA 2GRIA 2N7DA 2ZW1A 3A9KB 4MSQB 1SE2A 3PLVA 1GJZA 4FHKA 3PHWB 3VRAB 5CHVC 1T0SC 1FXTB 1I42A 2IGHA 1NDDA 3RYTA 4KIKA 5DCNA 3DBLB 4I6PA 2DAJA 1YQ4B 2YVCA 5D3IB 3JYUA 2W9NA 3L54A 3Q6BA 1H8CA 4E71A 1P1AA 2WXPA 5T8IA 5D7GA 3NOBA 1VLBA 3BYYB 1MHXA 4MJSB 4MELA 3ECIA 3QA8A 3AU4A 3QHTA 4MT5A 2QIEB 1TKGA 1ZPSA 2DZIA 3P4QB 1R4NI 1YNTE 4CYEA 5E6NA 1WZ3A 1L4DB 4ARCA 2JX5A 2INDC 2BBCA 3Q3MC 2IYDB 3V61A 1E7UA 1UGJA 4GDKB 1P7FA 2H88B 3B1LX 2L83A 3P4PB 4TUUA 1EWCA 1SE3A 3UIPB 5AEKB 1T6BX 2JPHA 3DHGC 3TEZA 1E6EB 2LVQA 1M4VA 3N20C 1OTRB 1L0VB 4M8MA 2KMCA 2ZVOA 2PMVA 2VZKB 4N58A 2PE9A 1YX5B 3MJWA 1H4RA 1V5TA 4GGQA 4EEWA 4A20A 4NAWA 3U2SC 1IBXB 1JWUD 4XC2A 1QOFA 3AE3B 4XX5A 4MGKE 3QCAA 1K51A 4BZAA 1VZ6A 2BT6A 3ZVVA 3Q8EA 1OQYA 2M1MA 3EA6A 4FJVB 1YMHE 1V8CA 2W55A 5LLIA 4OVUA 2IO2B 2O6VA 4XDCA 1YQ3B 2JXXA 2V4LA 1V6EA 2G45B 4RF0A 1XLNA 4M0WA 1NI2A 3H7PB 1JW9D 2OEDA 4P7IA 4GB9A 3MJ5A 1IGDA 3TEXA 4ASWC 3Q69A 1I4RA 3GE8C 3PO0A 3MHSD 2LXCA 3IFWB 3M62B 3BWUD 2J0KA 3GP7A 1N5WA 3X0WA 3CF6E 4H2AA 1UD7A 2QSDA 3KUDB 3HIZA 3VUYA 3GZNB 1UBQA 3I63C 1EUVB 2KC1A 4RCOA 3NVVA 1SBBB 1OQRA 2L3ZA 1XO3A 2CS4A 3NVYA 3SEBA 3PZ8A 4KDIC 3NZSA 3X23A 1WGKA 2MP2A 1DOYA 2BWES 4X57B 4ZHOA 5G55A 1NEKB 4WWPA 1JWMD 4ICUA 1VZ7A 2Z0EB 3TJPA 1TS2A 1WH3A 4DDGD 4MH0E 2K22A 3CSTA 1WX9A 4C00A 3A4RA 4WAAA 3L10B 2BB5A 2MCNB 1N63A 1YN3A 1I4QA 1S3SG 2GOWA 3BVGA 2V3SA 2K5PA 3A9JA 1E8XA 2L05A 2Z59B 2WP9B 3CF4A 3H1UA 1GTHA 3RNGC 1M94A 2ZCCA 3P63A 3Q8CA 4DXGA 4LDTD 2BKRB 1F52A 2J4XA 4KV2A 2IY0B 2GBKA 4EE2A 4YWGG 4BBNF 4A3PA 1VD2A 2JZZA 2N7JA 3EC8A 3PRMB 3NUHB 1WM3A 4EOYA 4K81A 1S1QB 1ZE3D 3ML9A 2WXJA 4LNNA 3V6EB 1H7WA 1XQQA 2KFJA 2I38A 3Q3OC 3OAWA 1NBFC 4ICVA 4FADA 4NNJB 2JF5A 2JSVX 3NZUA 3NZ3A 2BGFA 1C76A 2L00B 5EE0A 3L08A 3EECA 1JRPA 4I6NB 1TZ1A 1L6VA 1N62A 3BK1A 5D2MB 2KD0A 4JE3B 4NAWB 3ZTCA 3RULA 2LEKA 1RM6C 3VTUA 4WJNA 3KVFB 1D6EC 2M0AA 4KSLC 3DWMA 1BXTA 2VH2A 2KAJA 1BT0A 1F77A 2JVCA 1Z5SB 4UDUC 3GE3C 1QLBB 4HRSA 4EFOA 2LGSA 2BVCA 2KWVB 4P16A 3ZRCA 1FCCC 3FKYA 4TV3A 5BYQA 3AE1B 4AWJA 1SF0A 3QARA 2IGDA 1V81A 4M0WB 3HHMA 3PZDA 4GN1A 3DWGC 2L1AA 2GI9A 4LJPB 1WE6A 1WJNA 3C0RB 2LASA 4REZA 3AECB 1AN8A 3DBHI 4GU2A 4W9HA 2JZ3B 2D3AA 2AWTA 1HZ5A 1BUIC 1AARA 2VH1A 5LXIB 1GPXA 3PSEB 1N60A 2DNFA 4OW0A 1PDXA 3UINB 1HE8A 3TSSA 2WYQA 1JRUA 5CX3A 2L0TA 4K3CA 2AL3A 3LXFA 1XLOA 3EFUA 2MBOA 1QKZA 1C1YB 2MP2B 2JRIB 3H6NA 1SJED 3B2FA 1HQRD 4M00A 4DHJD 4F7ZA 3ZIMA 2GBRA 2NPTA 1SIJA 2N9PC 3C8YA 3ZDMC 4IWQA 4ACFA 2INPE 1GOZA 1LO5D 3TEYA 4YTNB 3EHVA 4ZRPA 1SJHD 2DBYA 2INNE 1JROA 4KGRA 4XWTA 3A9JB 3RNCC 3P4RB 1GAQB 2DENB 5I4DA 3DQVA 5FR6A 1RRBA 1ACCA 4ZYNA 4AS1A 2WU2B 1C4CA 2MJ3A 3RCZA 4MGIE 1VDVA 4KSKC 4LNIA 2CJNA 2SEBD 2EMTA 2M8SA 1HZ6A 2J7QB 4G3XB 4TKNA 1T0QC 3V05A 1RYJA 5IN7A 2D11A 2KNBA 2K39A 5DPRA 2D5GA 2W54A 1C4PA 3NHEB 1L0XB 3O65B 4YT0B 2BTEA 5JZEB 3U4EG 2EMSA 3U7ZA 2KN5A 3L4PA 3WIMA 5EE9A 3DVGY 2PPHA 2ZEQA 3LB8C 2CR5A 3HM3A 2FBWB 1V80A 3DVNU 4HXDA 1N5XA 2KK8A 3NY5A 5KHQA 2FIDA 2WDRB 3CSFA 2J42A 4NQKE 1QILA 2DZMA 5HFYA 4URKA 1JWSD 4N9F4 2NTSA 4A55A 5HKHA 3QIJA 3ZNID 5AZGA 1E7PB 4KVGB 2IO3B 2XNAC 1ET6A 1GC6A 1F0ZA 2XK5A 1D4BA 2N9EB 4RM9A 3AU5A 1WF9A 3HUIA 1WSPA 3HM6X 3U52E 1OEYJ 1XF5L 5L83A 1JMLA 1V1PA 4TQ0A 1Q1OA 4FLHA 3AE4B 4MGYE 1DYQA 3L13A 3P2BA 2DZKA 3NRZA 4WWMA 2PLPA 1EU3A 4WQOB 4IWPA 5IOIA 1XXGA 4HJKA 1FXIA 3AMZA 3T9LA 4NQLB 3N1YC 1YJ1A 3ZO5B 5HG2A 1J7CA 5IKCM 4G0NB 2N9KA 2ZW0A 2OOBB 4S17A 2IPKD 2WDVB 2GMIC 3GB1A 1UUPA 4YSZB 3WAMA 1J7BA 4HWIB 1KTKA 3PRZA 3VUXA 3CIRB 2NPTB 3N1XC 1ZXHA 2EKEC 3N9YC 3WANA 4N6EB 4ANVA 2CU3A 4IUMB 2KMAA 2X38A 3VH4B 2IGGA 3RI7C 2JYTA 1CJEA 2BF8B 1STEA 1DOXA 1L6UA 5FR3A 1EO6A 3VTWA 3C19A 4HKZE 1K52A 1WY8A 2M4NA 1XLPA 2MBQA 3M63B 3AI5A 3SDLC 2MBEA 3QQ8B 2VRRB 2MRPA 4GIVA 1JWAD 4HROA 2VZKD 1WR6E 2JWZA 5E6OA 3ZYYX 2UYZB 4BKSD 1MI0A 2DYBA 2BYFA 2MJDA 1NI3A 4PK1A 3TUOA 1DOIA 5DPTA 4WWOA 5AZFA 2QDFA 4C4VA 4G50A 2XBBC 3KW5B 2WXOA 2NR2A 1T5XD 1C9FA 1JCKB 3MC0B 4ZDVA 2N4FA 4W9GA 3FAHA 2SAKA 3W1SA 2KO3A 2ZNVB 1GB4A 2KOXA 1ZUD2 1E8ZA 2K8CA 4P1BC 3DBLI 2BS2B 4RNAA 1R4NB 1FNWA 4WJOA 3DHIC 3S2AA 1SIFA 3KYDD 4KGTA 2J53A 2ZPNA 3MTNB 4JGHB 2XK5B 4IWOA 1ZKHA 3BZDB 4BFRA 4MH8A 2WXRA 1QZEA 1MFWA 3ZQ4A 4EZJA 4YSYB 5H92C 1V1PB 1SSNA 3AM9A 4FA6A 5BMGA 5CHFA 1RFAA 4DHZE 2IY1B 1VJKA 4CO7A 4FBJB 4E3CA 2KVRA 3V60A 3M3JA 2OJWA 5CTRC 2KX3A 4DXFA 3ZXRA 1QQRA 4D2KA 1GT8A 2KN4A 1ZOYB 3V3XA 3DCGA 1KRHA 3EUB2 3PTFC 2CU1A 1WYWB 2JRHA 4W9JA 4LJOB 4FXCA 1JALA 3ABVB 3ZNHB 4RF1A 2V1YA 2NBUA 4C80A 1GNUA 1TS3A 2KQSA 3ZLZA 1N61A 2K0PA 3J9CA 1IGCA 3R66C 1BMLC 4NPNA 2ONQA 3BYTB 1E9MA 2LWPA 2QILA 2ZPYA 5AUIA 2IJ0A 1J19A 1RAXA 1MG4A 3SFDB 3FILA 4OZCA 4OZBA 2QEJC 1GG3A 3IT6B 3VR9B 2AQ1B 2BWFA 3R2TA 4GXBA 2LXAA 1WXSA 2MWSB 4US9A 1QOBA 3EGRA 3PT2B 1JQ4A 4L1BA 4IC7B 4B9KA 2WS3B 4GLSC 1Y56A 3E9SA 4KIKB 3VHTC 2KJ6A 1ESFA 4C4VB 3IBEA 4JIOU 1GUAB 3NJTA 2KKCA 1WRIA 2ZNVC 3VQIA 2KDIA 3FC4A 5EE3A 1FM0D 3IAS1 2KDEB 4HDOA 4MEMA 1UWXA 2QHOA 2R2QA 2KFKA 2FUHB 2MHJA 1WYGA 2FE8A 2KZRA 2L52A 3GZNI 4EZLA 3HVZA 4MM3A 2R2OA 1E8WA 3ZKJC 1V2YA 1UGMA 2IZVB 2NBVB 1UWMA 1YJJA 1K53A 2RR9A 2W3SA 3PLUA 5GMVA 1E7VA 1TTNA 1GB1A 3ALBA 3NS1A 3AXCA 3OJ4B 3DOWA 4NZLB 3AE7B 5HHDG 2KLCA 1N6ZA 4HPMB 4BVUC 1D5XC 3B0AA 5J2RA 3OWEB 1KH0A 4LCDE 4YXDB 2ZJDA 3MP9A 2BW2A 2AL6A 4LK0M 2WGSA 1MHHE 2KVZA 1FD6A 2FNJB 1P7EA 1V49A 2WXIA 3B2GA 4BKGA 1GTEA 2MJEA 2ICIA 1TT5B 1WXQA 2BS3B 2AQ2B 2HE7A 1EF5A 3TIXA 3N1ZC 1WFYA 5BMHA 1KM7A 3I5JC 4BOZB 1C79A 4PT5A 2KJRA 5AUKA 2WU5B 2KDMA 3ONSA 3SR6A 4W9KA 1CZPA 3K9OB 2HJ8A 1WJUA 4CHKA 4N59A 4ZYSA 3N32A 3Q8AA 2B3AA 5DPWA 1K50A 1AWDA 3QJZA 3AEDB 4HJGE 4F8CB 3M95A 4IOIE 2WWZA 3QAQA 4W9LA 2O6VB 1I4XA 3RZWC 3WALA 3O13A 3JSVA 1H7XA 1P3QU 3KUZA 3PGEA 3FILB 5TR5A 4B6WA 1UH6A 4IG7B 4P1CC 1LGRA 2FAZA 2GLSA 4AUQC 2BYEA 1F1HA 1NYRA 4P6VF 2KANA 4K3BA 3Q3NC 2BYTA 2G3QB 4JPSA 3VUWA 3KUCB 3W1SC 3T8MA 1TJEA 3A33B 1K8RB 1CQVA 4GMVA 4RMAA 3T3OA 3WAPA 5TSSA 4BKTA 1AW7A 3KLSX 3W2DA 3DBRI 1T3QA 2KFKB 1XCTL 2K6DB 3UI3A 1C3TA 4MM3B 4HLEA 2WXMA 2K1FA 1MVKA 5DPSA 1F2RC 3VRBB 1OGWA 1V86A 3P1MA 1G6JA 4C7ZA 1I4PA 2R61A 1SB3C 4HCPB 2L7RA 3P42A 1FXAA 3QWZB 2PIAA 5IO9A 3TL5A 4FJYA 2M19A 3VXWA 2B76B 5C23A 2ON8A 4ANUA 1T0YA 4XZ4A 3U7DA 1Q5WB 2LGDA 5JH5C 3ENEA 3KWVA 1PFDA 4GDLA 1ROEA 2RDGA 4TMAB 1FCLA 2KXJA 1XLQA 4OZAA 1QOGA 3IHPC 2KTFA 4MACA 1JWBD 5IP4D 2GBMA 4GOCA 1B9RA 2A4ZA 1PYWD 2L32A 1ZXIA 5C2TB 2AQ3B 1WX8A 2MLBA 5BYRA 4ARIA 5IAAC 3QK0A 5KHOA 3H8HA 2D07B 2JU6X 4G11A 2NBWB 3A1QA 3ZUNA 3VFKA 2KJHB 4HK2A 3AE9B 3PREA 2KC2A 3LYYA 1KLUD 4BBNC 2BPSA 4LNOA 3I3TB 2K3UA 2LUMA 1D5MC 5L95C 3AEFB 1HA5A 3RD2A 1R4MB 3RPFC 4ZRJA 2PVGC 2HDEA 3MFGA 4W9CA 3AEEB 2LI5A 1MJDA 3DVGX 5C3JB 2INCC 3MHZA 2WQYB 1E10A 3APDA 1WZ0A 3V62A 2EKIA 2N1WA 5D6JB 2ZCBA 3JSVB 2JT4B 1AYFA 2KX0A 2K6QA 1WE7A 4PS8A 3DDCB 2C5LC 2PW9A 2V4IB 3OJ3A 2L0FA 3Q3JA 2NVUI 2WDQB 1KJTA 3TCAA 4C56C 2RMMA 2G4SA 2IO0B 1ZGUB 3RZFA 3KYCD 3AH7A 3N30A 3VTVA 1ZDXA 3RNEC 3VVWB 4E74A 2ZZPB 4DK5A 1C4AA 2I1KA 4YSXB 2Z8LA 4IDIA 1TGZB 1WJ6A 3NVZA 1UELA 3H7SA 2EELA 4ZHPA 1J7AA 1FRDA 2HTME 2WLBA 2YLMA 4BOSC 4PS3A 2BKFA 2FCQA 4FN2A 1WMHA 1C77A 2RPQA 1PUTA 1PGBA 3PPAA 2Y3AA 1QF6A 2I1JA 2HTHA 1FMAD 3W1YA 1FFVA 4W9IA 3BVZA 4LNFA 4RGTA 1J8CA 2JQRB 2FUG1 4ZRKA 1L4ZB 4WQMA 3EFCA 3ML8A 1IYFA 3U30A 2FIFA 2LGXA 2LHEA 1FO4A 2LMCA 1SE9A 2FCSA 5HI1A 4GDLB 2WXGA 1ZP0B 1D5ZC 2BB6A 3CWIA 5E6PA 1OEYA 2QCZA 1KLGD 1WWTA 5EE1A 3ZNZB 1HTQA 1QT9A 3GS2A 4KZCA 1E5WA 4XDDA 2WDTB 3RMKC 2PEAA 1WGDA 1RLFA 4JX1C 1UNSA 3IT4B 3RNFC 3Q2AC 4K7UA 2WXFA 4IM3A 4W9FA 3T3NA 4O1NA 3RFZB 3A1QB 1XCQL 1WXAA 3MC9A 4J6IA 2N0SB 3ZXVA 4F1SA 2DAFA 2DYMA 3L17A 3B9JA 3L16A 4XGAB 3R7RA 2KWCA 4FJZA 4MGZE 2K8HA 5GXGB 4L2YA 2V3PA 4OHJA 1FPYA 2D3GA 4LTUA 2QJLA 2LRUA 1YD8U 2Q5WD 3ZGZA 2CKHB 2UWQA 1TBEA 2MBHA 2IBIB 3E56A 4USAA 1C78A 1CK1A 3D32A 2KTRA 4JWUC 2ZVNA 2M17A 4II3B 4M01A 1XD3B 5IA7A 2IO1B 2V0GA 4WH4A 2RPVA 4PYZA 1E8YA 4DBGA 4ZRQA 1ET9A 2WXHA 4L23A 1VRAB 2HD5B 2MSED 4IKGA 1FNVA 4A3OA 1D3ZA 3QX1A 4KKJA 1L0YB 3VR8B 1WGHA 4WAFA 3WA0A 1HXYD 1TS5A 2WNMA 4AJWA 3I9V1 4CQNA 2C9WB 1J0GA 4EZKA 4A6QA 4II2B 4ZOHC 2KDFB 1UBIA 1KOTA 1NVID 3IG3A 2RDBC 1HTOA 1SXTA 1FEHA 4FULA 2D3BA 3ETRA 3NG0A 1WMHB 1EU4A 2K8BA 4XYCA 5G5GA 1MG8A 4J3OD 3RNBC 4YTPB 2D2QA 2LJ5A 3QC8B 1WXMA 2UU7A 1DGJA 4JQWC 1TY0A 2RGFA 4PS7A 3WAOA 1L2NA 5J17A 1PQSA 3PV1A 1EWYC 1YX6B 2JUOA 1V9JA 1LQBA 1WGYA 2W3RA 3PVLA 3JW0X 3Q14C 4A90A 3PRPB 1I4HA 1ZDVA 4JLCA 1WX7A 2BS4B 1ZW7A 3OG5A 3AE5B 2X8XX 1IPGA 1I35A
chains in the Genus database with same CATH topology
1YQ4B 5D3IB 1E7PB 4B0MA 1MPEA 1V97A 2XNAC 1ET6A 3URYA 5FKAC 5MPOA 2WXPA 1F0ZA 3WCQA 5T8IA 5D7GA 1D4BA 1NYQA 1NYRA 3W9CB 2NTTA 3HUIA 1VLBA 3BYYB 1MHXA 4P6VF 1WSPA 3U52E 1XF5L 3HRDD 5G5HA 1EM7A 2BYTA 1JMLA 3AEGB 4MT5A 1V1PA 4JPSA 2ACZB 2QIEB 4TQ0A 2G9HD 3ZJUA 1TKGA 1ZPSA 3AE4B 3P4QB 2G1EA 1TJEA 1CQVA 1DYQA 1YNTE 3T3OA 3NRZA 4WWMA 5TSSA 3IXSA 2PLPA 3P4SB 1RWSA 1AW7A 3KLSX 1EU3A 4A9AA 1L4DB 3W2DA 1XXGA 1FXIA 4ARCA 2JX5A 3AMZA 1T3QA 2XN9C 2BBCA 1TZOA 5HG2A 4US8A 1J7CA 1XCTL 3UI3A 2N9KA 2ZW0A 1FIQA 4MM3B 1UGJA 2IPKD 2WXMA 2WXLA 1MVKA 5BMIA 1YN5A 2WDVB 4GDKB 1P7FA 3GB1A 2H88B 3AE6B 1F2RC 1UUPA 3VRBB 4XWWA 4YSZB 3P1MA 1J7BA 1KTKA 2JYEA 2L83A 4C7ZA 3P4PB 3CIRB 1I4PA 2R61A 4AQ7A 1EWCA 1SE3A 1SB3C 1ZXHA 1IUEA 1T6BX 1F2RI 3P42A 1FXAA 3N9YC 1E6EB 3TEZA 1M4VA 2PIAA 4C7YA 1L0VB 4N6EB 3AE8B 2PMVA 1YN4A 4HKQA 2M19A 4WURA 2B76B 2VZKB 2CU3A 2X38A 2ON8A 2WXNA 4N58A 2V3NA 2IGGA 2IDYA 2JYTA 1CJEA 1STEA 2CJOA 3KWVA 1PFDA 1DOXA 1ROEA 1I4GA 2RDGA 1I7HA 4TMAB 1FCLA 1XLQA 2QMTA 4OZAA 1QOGA 1L6UA 5FR3A 1PGXA 4HKZE 4MACA 1K52A 2PVOD 3U2SC 1JWBD 2KWDA 1FRRA 5JXVA 1XLPA 1B9RA 3AE2B 3SFEB 1IBXB 1JWUD 1PYWD 4OVZA 1QOFA 2L32A 3AE3B 1ZXIA 5C2TB 2AQ3B 2M56B 1JWAD 4HROA 2J52A 5BYRA 4ARIA 1K51A 2VZKD 2PTLA 1VZ6A 2BT6A 3H8HA 3ZYYX 2JU6X 3Q8EA 3Q8FA 3EA6A 4KX6B 1YMHE 1V8CA 1V1OA 2W55A 3AE9B 1KFYB 1MI0A 4XDCA 1YQ3B 4YTMB 2Y5PA 3LYYA 1KLUD 2MJDA 1NI3A 1OQQA 2K3UA 2LUMA 2OHFA 3BIID 1DOIA 4RF0A 3TUOA 1D5MC 1XLNA 2N9LA 4M0WA 3KQ4A 3AEFB 1HA5A 1SE4A 3RPFC 3ZJVA 1JW9D 2OEDA 2LFIA 2MH7A 3MJ5A 2PVGC 2HDEA 3MFGA 3AEEB 2WXOA 3AN1A 1T5XD 2E6XA 1IGDA 3TEXA 1C9FA 5C3JB 1JCKB 3MC0B 3Q69A 1I4RA 3MHZA 2WQYB 1E10A 3PO0A 1OFFA 1YJIA 5BYSA 2EKIA 3FAHA 3BWUD 3GP7A 2SAKA 3W1SA 1N5WA 1GB4A 4H2AA 1NENB 2QSDA 2KMMA 4B0EA 1ZUD2 1AYFA 4RGOS 2YEPF 2BS2B 4RCOA 3NVVA 4RNAA 1SBBB 1FNWA 1OQRA 1TS4A 1XO3A 3NVYA 3SEBA 3PZ8A 2PW9A 3W5VB 5LNK1 2V4IB 2NMQA 4KGTA 2WDQB 2J53A 2H89B 1WGKA 1DOYA 2JZPA 4ZHOA 1NEKB 4C56C 2RMMA 3BZDB 4ITKA 1JWMD 4MH8A 1VZ7A 2WXRA 1TS2A 3ZQ4A 2K22A 4YSYB 3HVDA 4WIPA 5H92C 1V1PB 1SSNA 2K9XA 3AM9A 3AH7A 5BMGA 2BB5A 1ZDXA 1N63A 1VJKA 1YN3A 1I4QA 4LLGM 3BVGA 2K5PA 3AEAB 4RH6A 1C4AA 2DLBA 1VZ8A 4YSXB 2KACA 2Z8LA 4IDIA 3NVZA 2WP9B 3CF4A 2LHDA 4DXFA 1QQRA 4D2KA 1GTHA 4DXGA 3Q8CA 1GT8A 2EELA 3P63A 4ZHPA 1J7AA 1FRDA 2HTME 2KQ4X 1QOAA 2KN4A 2WLBA 3AB5A 1ZOYB 1L5PA 3Q8BA 3V3XA 3AV8A 1A70A 2J4XA 1KRHA 4EE2A 3EUB2 1TYGB 4YWGG 2N7JA 2YEPB 3NUHB 1E0ZA 4FXCA 3PZ7A 5H8YE 1ENFA 1C77A 1JALA 1ZE3D 4NAMA 3ABVB 1PUTA 4RGMA 3I57A 4RF1A 1PGBA 2WXJA 2Y3AA 4C80A 1QF6A 1H7WA 2I38A 1TS3A 1FMAD 1FFVA 3BVZA 4RGTA 2JQRB 2FUG1 1L4ZB 4A8XC 4HEA1 2JSVX 4WQMA 3NZ3A 1N61A 1C76A 2K0PA 3J9CA 1IGCA 2E3TA 1BMLC 2LHEA 5EE0A 1FO4A 2LMCA 2ONQA 3BYTB 1E9MA 5HI1A 2LGIA 2QILA 4GDLB 2Y5CA 2WXGA 1ZP0B 1D5ZC 1JRPA 1XEEA 2BB6A 3CWIA 4JWSC 5AUIA 2IJ0A 1L6VA 3AEBB 1N62A 3BK1A 4JE3B 4NAWB 1KLGD 1WWTA 5EE1A 2LEKA 1RM6C 1QT9A 3GS2A 2I2YA 4XDDA 3SFDB 3FILA 1D6EC 2M0AA 4OZCA 3DWMA 4OZBA 1BXTA 2QEJC 4JX1C 1UNSA 2KAJA 3IT6B 3IT4B 3VR9B 1F77A 2AQ1B 2WXFA 3R2TA 4UDUC 3T3NA 4O1NA 3RFZB 1QLBB 4HRSA 1XCQL 2WXKA 4KKIA 4P16A 4US9A 2N0SB 1QOBA 1FCCC 2DYMA 3EGRA 5BYQA 3AE1B 3B9JA 3BVMA 1JQ4A 1SF0A 4L1BA 2TSSA 2IGDA 2WS3B 2MEKA 4GLSC 1Y56A 3E9SA 2JWUA 4XE0A 5GXGB 1ESFA 3ZJTA 3DWGC 2DYOA 2L1AA 4L2YA 2V3PA 4OHJA 2GI9A 5D3DA 4RFBA 4LTUA 2QJLA 1WRIA 4REZA 3AECB 3BK2A 3FC4A 1AN8A 2Q5WD 3VQIA 3ZGZA 3IAM1 5EE3A 1FM0D 3IAS1 1HZ5A 1VR9A 1BUIC 3E56A 2LJIA 4USAA 1C78A 1CK1A 1UWXA 4DQOC 1GPXA 1N60A 4OW0A 1PDXA 3TSSA 1WYGA 2FE8A 2L52A 4JWUC 3W5UB 1PGAA 1XLOA 1R7SA 3HVZA 3LXFA 1FFUA 1FNUA 3NVWA 1QKZA 2V0GA 4WH4A 4TQ1A 2RPVA 1UWMA 1YJJA 1SJED 3B2FA 1K53A 4ZRQA 1HQRD 2W3SA 1ET9A 1Q10A 2WXHA 4L23A 5FK9C 1VRAB 1KF6B 1SIJA 1FNVA 4IKGA 1B1ZA 1SEBD 3C8YA 2RDHA 1GB1A 3NS1A 3TEWA 2INPE 1GOZA 1LO5D 4NZLB 5HHDG 3AE7B 2W82A 4KKJA 1L0YB 3VR8B 3TEYA 4YTNB 4WAFA 2DWQA 4ZRPA 1HXYD 1D5XC 1SJHD 1TS5A 2WNMA 3OWEB 2DBYA 2INNE 1JROA 1HEZE 4KGRA 4XWTA 2PKOA 1TKYA 3I9V1 1KH0A 4CQNA 3P4RB 4YXDB 3MP9A 1GAQB 5I4DA 2BW2A 4LK0M 1MHHE 4A6QA 1FD6A 1ACCA 4AS1A 2WU2B 1C4CA 2MJ3A 1P7EA 4ZOHC 4R3DA 1VDVA 2CJNA 2AX5A 2SEBD 2WXIA 3B2GA 5E6JA 1HZ6A 1NVID 1GTEA 2MJEA 2ICIA 1SXTA 1TKEA 1FEHA 1IBXA 1RFKA 3V05A 4NJCA 3ETRA 1RYJA 1WXQA 2BS3B 4RGNA 2AQ2B 1EU4A 1TY2A 3KWLA 2GB1A 5BMHA 5G5GA 2D5GA 2W54A 4J3OD 1C4PA 4KGSA 1L0XB 4YTPB 1C79A 4PT5A 5AUKA 3R8BA 2WU5B 1DGJA 4TSSA 1TY0A 2JXTA 2KDMA 4YT0B 2BTEA 3SR6A 3U4EG 3U7ZA 1CZPA 4Q2JA 3L4PA 2WXQA 4N59A 4ZYSA 1EWYC 3R2IA 2GRIA 2ZW1A 5EE9A 3Q8AA 1SE2A 1K50A 1AWDA 2W3RA 3LB8C 3AEDB 4HJGE 4A90A 2FBWB 4IOIE 1I4HA 1ZDVA 1N5XA 3VRAB 2BS4B 2WDRB 1I4XA 3O13A 2J42A 1QILA 2IGHA 5HFYA 1H7XA 1JWSD 3AE5B 2NTSA 4A55A 3FILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXF A;  1XLO A;  1R7S A;  3AE3 B;  1ZXI A;  5C2T B;  2M56 B;  3HVZ A;  1YQ4 B;  1JWA D;  1FFU A;  4HRO A;  1E7P B;  1E0Z A;  4FXC A;  5H8Y E;  3NVW A;  1V97 A;  1JAL A;  2BT6 A;  3ABV B;  1PUT A;  1UWM A;  5EE1 A;  3ZYY X;  1YJJ A;  3B2F A;  2W3S A;  4C80 A;  1QF6 A;  1H7W A;  5MPO A;  1F0Z A;  4KX6 B;  3WCQ A;  1V8C A;  2W55 A;  1FMA D;  1FFV A;  3AE9 B;  1KF6 B;  1KFY B;  1NYQ A;  1NYR A;  1YQ3 B;  4YTM B;  1SIJ A;  3W9C B;  3HUI A;  1VLB A;  2MJD A;  4P6V F;  2JQR B;  3NS1 A;  1NI3 A;  1OQQ A;  3BII D;  2OHF A;  3HRD D;  1DOI A;  4WQM A;  5G5H A;  1N61 A;  3AE7 B;  1XLN A;  3AEG B;  3VR8 B;  3AEF B;  4YTN B;  2E3T A;  2ACZ B;  2QIE B;  2DWQ A;  1TKG A;  5EE0 A;  1FO4 A;  3RPF C;  1JW9 D;  3AE4 B;  2DBY A;  2MH7 A;  1JRO A;  2PVG C;  3P4Q B;  2G1E A;  3AEE B;  1E9M A;  1TJE A;  1TKY A;  2PKO A;  3AN1 A;  3P4R B;  4YXD B;  5C3J B;  1GAQ B;  2Y5C A;  1ZP0 B;  3NRZ A;  4WWM A;  2WQY B;  1E10 A;  3PO0 A;  1JRP A;  3P4S B;  1OFF A;  1RWS A;  1YJI A;  3CWI A;  4JWS C;  5AUI A;  2WU2 B;  2MJ3 A;  4ZOH C;  2EKI A;  1L6V A;  3AEB B;  1N62 A;  3FAH A;  1VDV A;  4A9A A;  1N5W A;  1FXI A;  2JX5 A;  1NEN B;  1WWT A;  2AX5 A;  2CJN A;  1T3Q A;  2LEK A;  3B2G A;  1RM6 C;  1QT9 A;  2KMM A;  3AMZ A;  1ZUD 2;  1NVI D;  1GTE A;  1AYF A;  2MJE A;  4US8 A;  1TKE A;  1J7C A;  1RFK A;  3SFD B;  2BS2 B;  3ETR A;  1FIQ A;  1RYJ A;  1WXQ A;  3NVV A;  2BS3 B;  3DWM A;  1OQR A;  2WDV B;  1XO3 A;  3NVY A;  4JX1 C;  2H88 B;  2KAJ A;  3KWL A;  3W5V B;  3AE6 B;  3VR9 B;  2WDQ B;  3VRB B;  2H89 B;  4YSZ B;  1WGK A;  1QLB B;  4HRS A;  3P1M A;  1DOY A;  1J7B A;  4US9 A;  5G5G A;  4ZHO A;  2N0S B;  1NEK B;  2L83 A;  2W54 A;  1QOB A;  4C7Z A;  3P4P B;  4ITK A;  3CIR B;  4YTP B;  3AE1 B;  3B9J A;  5AUK A;  1JQ4 A;  2WU5 B;  1DGJ A;  1SF0 A;  1SB3 C;  4YT0 B;  1IUE A;  3SR6 A;  2K22 A;  2WS3 B;  1FXA A;  4YSY B;  1E6E B;  2PIA A;  1CZP A;  5H92 C;  4C7Y A;  1L0V B;  2K9X A;  3AM9 A;  3L4P A;  3AE8 B;  4N6E B;  5GXG B;  3AH7 A;  4N59 A;  2M19 A;  2B76 B;  1EWY C;  3DWG C;  2CU3 A;  1N63 A;  1VJK A;  5EE9 A;  4LTU A;  4N58 A;  2QJL A;  1AWD A;  1WRI A;  2K5P A;  3AEC B;  2W3R A;  3LB8 C;  3AEA B;  3FC4 A;  2Q5W D;  3AED B;  4YSX B;  2FBW B;  1CJE A;  2CJO A;  4IDI A;  1PFD A;  3NVZ A;  1ROE A;  5EE3 A;  1DOX A;  1FM0 D;  1I7H A;  2WP9 B;  3CF4 A;  1XLQ A;  1N5X A;  4USA A;  3VRA B;  1GTH A;  1L6U A;  2BS4 B;  1GT8 A;  2WDR B;  1QOG A;  3P63 A;  4ZHP A;  1J7A A;  1FRD A;  2HTM E;  2WLB A;  1QOA A;  3AB5 A;  1GPX A;  1ZOY B;  1L5P A;  1N60 A;  2PVO D;  3AV8 A;  1JWB D;  1PDX A;  1A70 A;  1FRR A;  1KRH A;  1H7X A;  1XLP A;  1B9R A;  3AE2 B;  3AE5 B;  3SFE B;  1WYG A;  3EUB 2;  2L52 A;  1TYG B;  4JWU C;  3W5U B;  1QOF A; 
#chains in the Genus database with same CATH topology
 1LM8 B;  3APF A;  3VAW A;  3UQA A;  4B0M A;  2KT7 A;  1MPE A;  1V97 A;  3URY A;  1UZX B;  5FKA C;  5MPO A;  3WCQ A;  3KH0 A;  1NYQ A;  3W9C B;  2NTT A;  2N9X A;  2RD0 A;  2O6V D;  3HRD D;  5G5H A;  2GBN A;  1EM7 A;  3AEG B;  2V9H A;  2ACZ B;  3ZJU A;  2G9H D;  1ISN A;  1YQB A;  2G1E A;  3BY4 B;  4RM8 A;  3IXS A;  5EDS A;  3P4S B;  1RWS A;  4A9A A;  1WI0 A;  2KTR B;  2XN9 C;  2REX A;  1TZO A;  3DVN V;  4US8 A;  3CMM B;  2AEH A;  1FIQ A;  2DHZ A;  2WXL A;  2K25 A;  5BMI A;  1YN5 A;  3DHH C;  3RUI B;  3AE6 B;  4KDL B;  2L76 A;  4XWW A;  2KHW B;  1E90 A;  3LDZ E;  3L0W B;  2JYE A;  4YL8 A;  4S0R A;  5BO4 B;  4AQ7 A;  1T0R C;  3DBS A;  2A5U A;  2NCN A;  1IUE A;  2KYW A;  1F2R I;  1TIF A;  1IP9 A;  2N1V A;  4C7Y A;  2KLG A;  3AE8 B;  4AP4 C;  1YN4 A;  4HKQ A;  3A4S C;  4WUR A;  4JL9 A;  2ASQ A;  1EF1 A;  3ZW3 A;  2WXN A;  3VH3 B;  2V3N A;  2IDY A;  2CHW A;  2CJO A;  2M0X A;  1I4G A;  1I7H A;  4DXA B;  4FHJ A;  2QMT A;  3UGB B;  1PGX A;  3IVF A;  2PVO D;  2KWD A;  2N7E A;  1FRR A;  5JXV A;  1CMX B;  2MQJ A;  3AE2 B;  3SFE B;  2LD9 A;  4OVZ A;  2DZJ A;  3VDZ A;  3HK0 A;  2M56 B;  3H9D A;  4LNK A;  2J52 A;  2G4D B;  2PTL A;  3Q8F A;  2J0M A;  4KX6 B;  1V1O A;  1WXV A;  1WR1 A;  3B08 A;  1KFY B;  4YTM B;  2Y5P A;  4M8N A;  3SU8 X;  4NY0 A;  2DX5 B;  1OQQ A;  3BII D;  2OHF A;  2XEW A;  3MC8 A;  4IM0 A;  2N9L A;  1LXD A;  3KQ4 A;  1X1M A;  5CHW A;  1SE4 A;  2C7H A;  3R7Q A;  2JY6 A;  3ZJV A;  2LFI A;  2MH7 A;  3AN1 A;  2E6X A;  3DBH B;  4QAY A;  1OFF A;  4GSW A;  1P9D U;  1YJI A;  4W9D A;  5BYS A;  3R3M A;  1WM2 A;  1A5R A;  1NEN B;  2WHI A;  3APC A;  3SHQ A;  2KMM A;  4B0E A;  3Q3F A;  4DHZ B;  4RGO S;  4ZRI A;  1XT9 B;  2YEP F;  2FCM A;  4EUT A;  3UQB A;  1TS4 A;  5JHA A;  3W5V B;  5LNK 1;  2NMQ A;  4WJQ A;  4KZ0 A;  2H89 B;  3ZTD A;  4DWF A;  4PYU A;  2JZP A;  4LDT B;  2MX2 A;  4ITK A;  2PE6 B;  3DBR B;  2FCN A;  1UF0 A;  2AYO B;  2O2V A;  4M02 A;  3DPD A;  4ANW A;  3HVD A;  2MW5 A;  4WIP A;  2OJR A;  4WWN A;  5LXH A;  2K9X A;  2LVP A;  2D3C A;  2KWU B;  1WIA A;  4LLG M;  3AEA B;  4RH6 A;  2DLB A;  1VZ8 A;  1Z2M A;  2KAC A;  4MDK E;  2LHD A;  2LZ6 A;  3NS8 A;  3JVZ X;  5G2N A;  2KQ4 X;  3AB5 A;  3Q8B A;  1QOA A;  1L5P A;  3AV8 A;  3LJ3 A;  1A70 A;  1TYG B;  1LFD A;  2WX1 A;  1F9J A;  2YEP B;  1E0Z A;  5H8Y E;  3PZ7 A;  1ENF A;  4EKU A;  2MA9 B;  4NAM A;  4RGM A;  3I57 A;  1WGG A;  4HVB A;  1WRD B;  2QC8 A;  2J0J A;  4A8X C;  4HEA 1;  4I6L B;  3U8Z A;  2L8J A;  2CHX A;  3ZDT A;  1SGH A;  2E3T A;  3ZRF A;  2BQQ A;  3A9K A;  2LGI A;  2Y5C A;  3N3K B;  1XEE A;  3ZNG C;  4JWS C;  2LVO A;  2BYV E;  3AEB B;  2NS5 A;  4IM2 A;  4IW0 A;  5C1Z A;  4DDI D;  1YOV B;  2I2Y A;  3UIO B;  2LUE A;  5JHB A;  5AZH A;  3K9P B;  2LGY A;  1Y8R C;  2WXK A;  4KKI A;  3BIN A;  3SD5 A;  1L7Y A;  2WX0 A;  1KLV A;  3BVM A;  4HDQ A;  4NJ7 A;  2TSS A;  5D94 A;  4MJS A;  3UF8 A;  2MEK A;  2JWU A;  4XE0 A;  3ZJT A;  2DYO A;  1R4M I;  5D3D A;  4RFB A;  1P98 A;  4DHJ B;  3BK2 A;  4ANX A;  1Q0W B;  3IAM 1;  4B95 A;  1VR9 A;  1WGR A;  2LJI A;  2D10 A;  4DQO C;  2C7M B;  4OVV A;  3V6C B;  3W5U B;  1PGA A;  1R7S A;  2C60 A;  1FFU A;  1FNU A;  4GDK A;  3NVW A;  1YIW A;  1GC7 A;  4TQ1 A;  4NJ6 A;  1WJ4 A;  2CHZ A;  5FK9 C;  1Q10 A;  2Y5B B;  1KF6 B;  2O2V B;  1B1Z A;  1SEB D;  2RDH A;  2LRW A;  4K7S A;  3TEW A;  2W82 A;  2PJH A;  2DWQ A;  4BAX A;  1HEZ E;  2HJ1 A;  2PKO A;  1TKY A;  1VCB A;  3RN9 C;  3PS6 A;  1V5O A;  4WJP A;  3RNA C;  3RT3 B;  4AOF A;  4BKS A;  4R3D A;  2C7N B;  5J18 A;  4HPL B;  2AX5 A;  5E6J A;  3GOE A;  3TMP B;  2MBB B;  3AUL A;  2Z0D B;  1TKE A;  1IBX A;  3TBL D;  4W9E A;  1RFK A;  4NJC A;  2KQ7 A;  3OLM D;  3PHX B;  4RGN A;  1U4A A;  1TY2 A;  4MSM B;  3KWL A;  2GB1 A;  4KGS A;  4HCN B;  4K7W A;  4AJY B;  3R8B A;  4TSS A;  2JXT A;  2RSU A;  4HPP A;  4Q2J A;  2KDB A;  2GBJ A;  4K1R B;  2WXQ A;  1P0R A;  3H7P A;  3R2I A;  2GRI A;  2N7D A;  2ZW1 A;  3A9K B;  4MSQ B;  1SE2 A;  3PLV A;  1GJZ A;  4FHK A;  3PHW B;  3VRA B;  5CHV C;  1T0S C;  1FXT B;  1I42 A;  2IGH A;  1NDD A;  3RYT A;  4KIK A;  5DCN A;  3DBL B;  4I6P A;  2DAJ A;  1YQ4 B;  2YVC A;  5D3I B;  3JYU A;  2W9N A;  3L54 A;  3Q6B A;  1H8C A;  4E71 A;  1P1A A;  2WXP A;  5T8I A;  5D7G A;  3NOB A;  1VLB A;  3BYY B;  1MHX A;  4MJS B;  4MEL A;  3ECI A;  3QA8 A;  3AU4 A;  3QHT A;  4MT5 A;  2QIE B;  1TKG A;  1ZPS A;  2DZI A;  3P4Q B;  1R4N I;  1YNT E;  4CYE A;  5E6N A;  1WZ3 A;  1L4D B;  4ARC A;  2JX5 A;  2IND C;  2BBC A;  3Q3M C;  2IYD B;  3V61 A;  1E7U A;  1UGJ A;  4GDK B;  1P7F A;  2H88 B;  3B1L X;  2L83 A;  3P4P B;  4TUU A;  1EWC A;  1SE3 A;  3UIP B;  5AEK B;  1T6B X;  2JPH A;  3DHG C;  3TEZ A;  1E6E B;  2LVQ A;  1M4V A;  3N20 C;  1OTR B;  1L0V B;  4M8M A;  2KMC A;  2ZVO A;  2PMV A;  2VZK B;  4N58 A;  2PE9 A;  1YX5 B;  3MJW A;  1H4R A;  1V5T A;  4GGQ A;  4EEW A;  4A20 A;  4NAW A;  3U2S C;  1IBX B;  1JWU D;  4XC2 A;  1QOF A;  3AE3 B;  4XX5 A;  4MGK E;  3QCA A;  1K51 A;  4BZA A;  1VZ6 A;  2BT6 A;  3ZVV A;  3Q8E A;  1OQY A;  2M1M A;  3EA6 A;  4FJV B;  1YMH E;  1V8C A;  2W55 A;  5LLI A;  4OVU A;  2IO2 B;  2O6V A;  4XDC A;  1YQ3 B;  2JXX A;  2V4L A;  1V6E A;  2G45 B;  4RF0 A;  1XLN A;  4M0W A;  1NI2 A;  3H7P B;  1JW9 D;  2OED A;  4P7I A;  4GB9 A;  3MJ5 A;  1IGD A;  3TEX A;  4ASW C;  3Q69 A;  1I4R A;  3GE8 C;  3PO0 A;  3MHS D;  2LXC A;  3IFW B;  3M62 B;  3BWU D;  2J0K A;  3GP7 A;  1N5W A;  3X0W A;  3CF6 E;  4H2A A;  1UD7 A;  2QSD A;  3KUD B;  3HIZ A;  3VUY A;  3GZN B;  1UBQ A;  3I63 C;  1EUV B;  2KC1 A;  4RCO A;  3NVV A;  1SBB B;  1OQR A;  2L3Z A;  1XO3 A;  2CS4 A;  3NVY A;  3SEB A;  3PZ8 A;  4KDI C;  3NZS A;  3X23 A;  1WGK A;  2MP2 A;  1DOY A;  2BWE S;  4X57 B;  4ZHO A;  5G55 A;  1NEK B;  4WWP A;  1JWM D;  4ICU A;  1VZ7 A;  2Z0E B;  3TJP A;  1TS2 A;  1WH3 A;  4DDG D;  4MH0 E;  2K22 A;  3CST A;  1WX9 A;  4C00 A;  3A4R A;  4WAA A;  3L10 B;  2BB5 A;  2MCN B;  1N63 A;  1YN3 A;  1I4Q A;  1S3S G;  2GOW A;  3BVG A;  2V3S A;  2K5P A;  3A9J A;  1E8X A;  2L05 A;  2Z59 B;  2WP9 B;  3CF4 A;  3H1U A;  1GTH A;  3RNG C;  1M94 A;  2ZCC A;  3P63 A;  3Q8C A;  4DXG A;  4LDT D;  2BKR B;  1F52 A;  2J4X A;  4KV2 A;  2IY0 B;  2GBK A;  4EE2 A;  4YWG G;  4BBN F;  4A3P A;  1VD2 A;  2JZZ A;  2N7J A;  3EC8 A;  3PRM B;  3NUH B;  1WM3 A;  4EOY A;  4K81 A;  1S1Q B;  1ZE3 D;  3ML9 A;  2WXJ A;  4LNN A;  3V6E B;  1H7W A;  1XQQ A;  2KFJ A;  2I38 A;  3Q3O C;  3OAW A;  1NBF C;  4ICV A;  4FAD A;  4NNJ B;  2JF5 A;  2JSV X;  3NZU A;  3NZ3 A;  2BGF A;  1C76 A;  2L00 B;  5EE0 A;  3L08 A;  3EEC A;  1JRP A;  4I6N B;  1TZ1 A;  1L6V A;  1N62 A;  3BK1 A;  5D2M B;  2KD0 A;  4JE3 B;  4NAW B;  3ZTC A;  3RUL A;  2LEK A;  1RM6 C;  3VTU A;  4WJN A;  3KVF B;  1D6E C;  2M0A A;  4KSL C;  3DWM A;  1BXT A;  2VH2 A;  2KAJ A;  1BT0 A;  1F77 A;  2JVC A;  1Z5S B;  4UDU C;  3GE3 C;  1QLB B;  4HRS A;  4EFO A;  2LGS A;  2BVC A;  2KWV B;  4P16 A;  3ZRC A;  1FCC C;  3FKY A;  4TV3 A;  5BYQ A;  3AE1 B;  4AWJ A;  1SF0 A;  3QAR A;  2IGD A;  1V81 A;  4M0W B;  3HHM A;  3PZD A;  4GN1 A;  3DWG C;  2L1A A;  2GI9 A;  4LJP B;  1WE6 A;  1WJN A;  3C0R B;  2LAS A;  4REZ A;  3AEC B;  1AN8 A;  3DBH I;  4GU2 A;  4W9H A;  2JZ3 B;  2D3A A;  2AWT A;  1HZ5 A;  1BUI C;  1AAR A;  2VH1 A;  5LXI B;  1GPX A;  3PSE B;  1N60 A;  2DNF A;  4OW0 A;  1PDX A;  3UIN B;  1HE8 A;  3TSS A;  2WYQ A;  1JRU A;  5CX3 A;  2L0T A;  4K3C A;  2AL3 A;  3LXF A;  1XLO A;  3EFU A;  2MBO A;  1QKZ A;  1C1Y B;  2MP2 B;  2JRI B;  3H6N A;  1SJE D;  3B2F A;  1HQR D;  4M00 A;  4DHJ D;  4F7Z A;  3ZIM A;  2GBR A;  2NPT A;  1SIJ A;  2N9P C;  3C8Y A;  3ZDM C;  4IWQ A;  4ACF A;  2INP E;  1GOZ A;  1LO5 D;  3TEY A;  4YTN B;  3EHV A;  4ZRP A;  1SJH D;  2DBY A;  2INN E;  1JRO A;  4KGR A;  4XWT A;  3A9J B;  3RNC C;  3P4R B;  1GAQ B;  2DEN B;  5I4D A;  3DQV A;  5FR6 A;  1RRB A;  1ACC A;  4ZYN A;  4AS1 A;  2WU2 B;  1C4C A;  2MJ3 A;  3RCZ A;  4MGI E;  1VDV A;  4KSK C;  4LNI A;  2CJN A;  2SEB D;  2EMT A;  2M8S A;  1HZ6 A;  2J7Q B;  4G3X B;  4TKN A;  1T0Q C;  3V05 A;  1RYJ A;  5IN7 A;  2D11 A;  2KNB A;  2K39 A;  5DPR A;  2D5G A;  2W54 A;  1C4P A;  3NHE B;  1L0X B;  3O65 B;  4YT0 B;  2BTE A;  5JZE B;  3U4E G;  2EMS A;  3U7Z A;  2KN5 A;  3L4P A;  3WIM A;  5EE9 A;  3DVG Y;  2PPH A;  2ZEQ A;  3LB8 C;  2CR5 A;  3HM3 A;  2FBW B;  1V80 A;  3DVN U;  4HXD A;  1N5X A;  2KK8 A;  3NY5 A;  5KHQ A;  2FID A;  2WDR B;  3CSF A;  2J42 A;  4NQK E;  1QIL A;  2DZM A;  5HFY A;  4URK A;  1JWS D;  4N9F 4;  2NTS A;  4A55 A;  5HKH A;  3QIJ A;  3ZNI D;  5AZG A;  1E7P B;  4KVG B;  2IO3 B;  2XNA C;  1ET6 A;  1GC6 A;  1F0Z A;  2XK5 A;  1D4B A;  2N9E B;  4RM9 A;  3AU5 A;  1WF9 A;  3HUI A;  1WSP A;  3HM6 X;  3U52 E;  1OEY J;  1XF5 L;  5L83 A;  1JML A;  1V1P A;  4TQ0 A;  1Q1O A;  4FLH A;  3AE4 B;  4MGY E;  1DYQ A;  3L13 A;  3P2B A;  2DZK A;  3NRZ A;  4WWM A;  2PLP A;  1EU3 A;  4WQO B;  4IWP A;  5IOI A;  1XXG A;  4HJK A;  1FXI A;  3AMZ A;  3T9L A;  4NQL B;  3N1Y C;  1YJ1 A;  3ZO5 B;  5HG2 A;  1J7C A;  5IKC M;  4G0N B;  2N9K A;  2ZW0 A;  2OOB B;  4S17 A;  2IPK D;  2WDV B;  2GMI C;  3GB1 A;  1UUP A;  4YSZ B;  3WAM A;  1J7B A;  4HWI B;  1KTK A;  3PRZ A;  3VUX A;  3CIR B;  2NPT B;  3N1X C;  1ZXH A;  2EKE C;  3N9Y C;  3WAN A;  4N6E B;  4ANV A;  2CU3 A;  4IUM B;  2KMA A;  2X38 A;  3VH4 B;  2IGG A;  3RI7 C;  2JYT A;  1CJE A;  2BF8 B;  1STE A;  1DOX A;  1L6U A;  5FR3 A;  1EO6 A;  3VTW A;  3C19 A;  4HKZ E;  1K52 A;  1WY8 A;  2M4N A;  1XLP A;  2MBQ A;  3M63 B;  3AI5 A;  3SDL C;  2MBE A;  3QQ8 B;  2VRR B;  2MRP A;  4GIV A;  1JWA D;  4HRO A;  2VZK D;  1WR6 E;  2JWZ A;  5E6O A;  3ZYY X;  2UYZ B;  4BKS D;  1MI0 A;  2DYB A;  2BYF A;  2MJD A;  1NI3 A;  4PK1 A;  3TUO A;  1DOI A;  5DPT A;  4WWO A;  5AZF A;  2QDF A;  4C4V A;  4G50 A;  2XBB C;  3KW5 B;  2WXO A;  2NR2 A;  1T5X D;  1C9F A;  1JCK B;  3MC0 B;  4ZDV A;  2N4F A;  4W9G A;  3FAH A;  2SAK A;  3W1S A;  2KO3 A;  2ZNV B;  1GB4 A;  2KOX A;  1ZUD 2;  1E8Z A;  2K8C A;  4P1B C;  3DBL I;  2BS2 B;  4RNA A;  1R4N B;  1FNW A;  4WJO A;  3DHI C;  3S2A A;  1SIF A;  3KYD D;  4KGT A;  2J53 A;  2ZPN A;  3MTN B;  4JGH B;  2XK5 B;  4IWO A;  1ZKH A;  3BZD B;  4BFR A;  4MH8 A;  2WXR A;  1QZE A;  1MFW A;  3ZQ4 A;  4EZJ A;  4YSY B;  5H92 C;  1V1P B;  1SSN A;  3AM9 A;  4FA6 A;  5BMG A;  5CHF A;  1RFA A;  4DHZ E;  2IY1 B;  1VJK A;  4CO7 A;  4FBJ B;  4E3C A;  2KVR A;  3V60 A;  3M3J A;  2OJW A;  5CTR C;  2KX3 A;  4DXF A;  3ZXR A;  1QQR A;  4D2K A;  1GT8 A;  2KN4 A;  1ZOY B;  3V3X A;  3DCG A;  1KRH A;  3EUB 2;  3PTF C;  2CU1 A;  1WYW B;  2JRH A;  4W9J A;  4LJO B;  4FXC A;  1JAL A;  3ABV B;  3ZNH B;  4RF1 A;  2V1Y A;  2NBU A;  4C80 A;  1GNU A;  1TS3 A;  2KQS A;  3ZLZ A;  1N61 A;  2K0P A;  3J9C A;  1IGC A;  3R66 C;  1BML C;  4NPN A;  2ONQ A;  3BYT B;  1E9M A;  2LWP A;  2QIL A;  2ZPY A;  5AUI A;  2IJ0 A;  1J19 A;  1RAX A;  1MG4 A;  3SFD B;  3FIL A;  4OZC A;  4OZB A;  2QEJ C;  1GG3 A;  3IT6 B;  3VR9 B;  2AQ1 B;  2BWF A;  3R2T A;  4GXB A;  2LXA A;  1WXS A;  2MWS B;  4US9 A;  1QOB A;  3EGR A;  3PT2 B;  1JQ4 A;  4L1B A;  4IC7 B;  4B9K A;  2WS3 B;  4GLS C;  1Y56 A;  3E9S A;  4KIK B;  3VHT C;  2KJ6 A;  1ESF A;  4C4V B;  3IBE A;  4JIO U;  1GUA B;  3NJT A;  2KKC A;  1WRI A;  2ZNV C;  3VQI A;  2KDI A;  3FC4 A;  5EE3 A;  1FM0 D;  3IAS 1;  2KDE B;  4HDO A;  4MEM A;  1UWX A;  2QHO A;  2R2Q A;  2KFK A;  2FUH B;  2MHJ A;  1WYG A;  2FE8 A;  2KZR A;  2L52 A;  3GZN I;  4EZL A;  3HVZ A;  4MM3 A;  2R2O A;  1E8W A;  3ZKJ C;  1V2Y A;  1UGM A;  2IZV B;  2NBV B;  1UWM A;  1YJJ A;  1K53 A;  2RR9 A;  2W3S A;  3PLU A;  5GMV A;  1E7V A;  1TTN A;  1GB1 A;  3ALB A;  3NS1 A;  3AXC A;  3OJ4 B;  3DOW A;  4NZL B;  3AE7 B;  5HHD G;  2KLC A;  1N6Z A;  4HPM B;  4BVU C;  1D5X C;  3B0A A;  5J2R A;  3OWE B;  1KH0 A;  4LCD E;  4YXD B;  2ZJD A;  3MP9 A;  2BW2 A;  2AL6 A;  4LK0 M;  2WGS A;  1MHH E;  2KVZ A;  1FD6 A;  2FNJ B;  1P7E A;  1V49 A;  2WXI A;  3B2G A;  4BKG A;  1GTE A;  2MJE A;  2ICI A;  1TT5 B;  1WXQ A;  2BS3 B;  2AQ2 B;  2HE7 A;  1EF5 A;  3TIX A;  3N1Z C;  1WFY A;  5BMH A;  1KM7 A;  3I5J C;  4BOZ B;  1C79 A;  4PT5 A;  2KJR A;  5AUK A;  2WU5 B;  2KDM A;  3ONS A;  3SR6 A;  4W9K A;  1CZP A;  3K9O B;  2HJ8 A;  1WJU A;  4CHK A;  4N59 A;  4ZYS A;  3N32 A;  3Q8A A;  2B3A A;  5DPW A;  1K50 A;  1AWD A;  3QJZ A;  3AED B;  4HJG E;  4F8C B;  3M95 A;  4IOI E;  2WWZ A;  3QAQ A;  4W9L A;  2O6V B;  1I4X A;  3RZW C;  3WAL A;  3O13 A;  3JSV A;  1H7X A;  1P3Q U;  3KUZ A;  3PGE A;  3FIL B;  5TR5 A;  4B6W A;  1UH6 A;  4IG7 B;  4P1C C;  1LGR A;  2FAZ A;  2GLS A;  4AUQ C;  2BYE A;  1F1H A;  1NYR A;  4P6V F;  2KAN A;  4K3B A;  3Q3N C;  2BYT A;  2G3Q B;  4JPS A;  3VUW A;  3KUC B;  3W1S C;  3T8M A;  1TJE A;  3A33 B;  1K8R B;  1CQV A;  4GMV A;  4RMA A;  3T3O A;  3WAP A;  5TSS A;  4BKT A;  1AW7 A;  3KLS X;  3W2D A;  3DBR I;  1T3Q A;  2KFK B;  1XCT L;  2K6D B;  3UI3 A;  1C3T A;  4MM3 B;  4HLE A;  2WXM A;  2K1F A;  1MVK A;  5DPS A;  1F2R C;  3VRB B;  1OGW A;  1V86 A;  3P1M A;  1G6J A;  4C7Z A;  1I4P A;  2R61 A;  1SB3 C;  4HCP B;  2L7R A;  3P42 A;  1FXA A;  3QWZ B;  2PIA A;  5IO9 A;  3TL5 A;  4FJY A;  2M19 A;  3VXW A;  2B76 B;  5C23 A;  2ON8 A;  4ANU A;  1T0Y A;  4XZ4 A;  3U7D A;  1Q5W B;  2LGD A;  5JH5 C;  3ENE A;  3KWV A;  1PFD A;  4GDL A;  1ROE A;  2RDG A;  4TMA B;  1FCL A;  2KXJ A;  1XLQ A;  4OZA A;  1QOG A;  3IHP C;  2KTF A;  4MAC A;  1JWB D;  5IP4 D;  2GBM A;  4GOC A;  1B9R A;  2A4Z A;  1PYW D;  2L32 A;  1ZXI A;  5C2T B;  2AQ3 B;  1WX8 A;  2MLB A;  5BYR A;  4ARI A;  5IAA C;  3QK0 A;  5KHO A;  3H8H A;  2D07 B;  2JU6 X;  4G11 A;  2NBW B;  3A1Q A;  3ZUN A;  3VFK A;  2KJH B;  4HK2 A;  3AE9 B;  3PRE A;  2KC2 A;  3LYY A;  1KLU D;  4BBN C;  2BPS A;  4LNO A;  3I3T B;  2K3U A;  2LUM A;  1D5M C;  5L95 C;  3AEF B;  1HA5 A;  3RD2 A;  1R4M B;  3RPF C;  4ZRJ A;  2PVG C;  2HDE A;  3MFG A;  4W9C A;  3AEE B;  2LI5 A;  1MJD A;  3DVG X;  5C3J B;  2INC C;  3MHZ A;  2WQY B;  1E10 A;  3APD A;  1WZ0 A;  3V62 A;  2EKI A;  2N1W A;  5D6J B;  2ZCB A;  3JSV B;  2JT4 B;  1AYF A;  2KX0 A;  2K6Q A;  1WE7 A;  4PS8 A;  3DDC B;  2C5L C;  2PW9 A;  2V4I B;  3OJ3 A;  2L0F A;  3Q3J A;  2NVU I;  2WDQ B;  1KJT A;  3TCA A;  4C56 C;  2RMM A;  2G4S A;  2IO0 B;  1ZGU B;  3RZF A;  3KYC D;  3AH7 A;  3N30 A;  3VTV A;  1ZDX A;  3RNE C;  3VVW B;  4E74 A;  2ZZP B;  4DK5 A;  1C4A A;  2I1K A;  4YSX B;  2Z8L A;  4IDI A;  1TGZ B;  1WJ6 A;  3NVZ A;  1UEL A;  3H7S A;  2EEL A;  4ZHP A;  1J7A A;  1FRD A;  2HTM E;  2WLB A;  2YLM A;  4BOS C;  4PS3 A;  2BKF A;  2FCQ A;  4FN2 A;  1WMH A;  1C77 A;  2RPQ A;  1PUT A;  1PGB A;  3PPA A;  2Y3A A;  1QF6 A;  2I1J A;  2HTH A;  1FMA D;  3W1Y A;  1FFV A;  4W9I A;  3BVZ A;  4LNF A;  4RGT A;  1J8C A;  2JQR B;  2FUG 1;  4ZRK A;  1L4Z B;  4WQM A;  3EFC A;  3ML8 A;  1IYF A;  3U30 A;  2FIF A;  2LGX A;  2LHE A;  1FO4 A;  2LMC A;  1SE9 A;  2FCS A;  5HI1 A;  4GDL B;  2WXG A;  1ZP0 B;  1D5Z C;  2BB6 A;  3CWI A;  5E6P A;  1OEY A;  2QCZ A;  1KLG D;  1WWT A;  5EE1 A;  3ZNZ B;  1HTQ A;  1QT9 A;  3GS2 A;  4KZC A;  1E5W A;  4XDD A;  2WDT B;  3RMK C;  2PEA A;  1WGD A;  1RLF A;  4JX1 C;  1UNS A;  3IT4 B;  3RNF C;  3Q2A C;  4K7U A;  2WXF A;  4IM3 A;  4W9F A;  3T3N A;  4O1N A;  3RFZ B;  3A1Q B;  1XCQ L;  1WXA A;  3MC9 A;  4J6I A;  2N0S B;  3ZXV A;  4F1S A;  2DAF A;  2DYM A;  3L17 A;  3B9J A;  3L16 A;  4XGA B;  3R7R A;  2KWC A;  4FJZ A;  4MGZ E;  2K8H A;  5GXG B;  4L2Y A;  2V3P A;  4OHJ A;  1FPY A;  2D3G A;  4LTU A;  2QJL A;  2LRU A;  1YD8 U;  2Q5W D;  3ZGZ A;  2CKH B;  2UWQ A;  1TBE A;  2MBH A;  2IBI B;  3E56 A;  4USA A;  1C78 A;  1CK1 A;  3D32 A;  2KTR A;  4JWU C;  2ZVN A;  2M17 A;  4II3 B;  4M01 A;  1XD3 B;  5IA7 A;  2IO1 B;  2V0G A;  4WH4 A;  2RPV A;  4PYZ A;  1E8Y A;  4DBG A;  4ZRQ A;  1ET9 A;  2WXH A;  4L23 A;  1VRA B;  2HD5 B;  2MSE D;  4IKG A;  1FNV A;  4A3O A;  1D3Z A;  3QX1 A;  4KKJ A;  1L0Y B;  3VR8 B;  1WGH A;  4WAF A;  3WA0 A;  1HXY D;  1TS5 A;  2WNM A;  4AJW A;  3I9V 1;  4CQN A;  2C9W B;  1J0G A;  4EZK A;  4A6Q A;  4II2 B;  4ZOH C;  2KDF B;  1UBI A;  1KOT A;  1NVI D;  3IG3 A;  2RDB C;  1HTO A;  1SXT A;  1FEH A;  4FUL A;  2D3B A;  3ETR A;  3NG0 A;  1WMH B;  1EU4 A;  2K8B A;  4XYC A;  5G5G A;  1MG8 A;  4J3O D;  3RNB C;  4YTP B;  2D2Q A;  2LJ5 A;  3QC8 B;  1WXM A;  2UU7 A;  1DGJ A;  4JQW C;  1TY0 A;  2RGF A;  4PS7 A;  3WAO A;  1L2N A;  5J17 A;  1PQS A;  3PV1 A;  1EWY C;  1YX6 B;  2JUO A;  1V9J A;  1LQB A;  1WGY A;  2W3R A;  3PVL A;  3JW0 X;  3Q14 C;  4A90 A;  3PRP B;  1I4H A;  1ZDV A;  4JLC A;  1WX7 A;  2BS4 B;  1ZW7 A;  3OG5 A;  3AE5 B;  2X8X X;  1IPG A;  1I35 A; 
#chains in the Genus database with same CATH homology
 1YQ4 B;  5D3I B;  1E7P B;  4B0M A;  1MPE A;  1V97 A;  2XNA C;  1ET6 A;  3URY A;  5FKA C;  5MPO A;  2WXP A;  1F0Z A;  3WCQ A;  5T8I A;  5D7G A;  1D4B A;  1NYQ A;  1NYR A;  3W9C B;  2NTT A;  3HUI A;  1VLB A;  3BYY B;  1MHX A;  4P6V F;  1WSP A;  3U52 E;  1XF5 L;  3HRD D;  5G5H A;  1EM7 A;  2BYT A;  1JML A;  3AEG B;  4MT5 A;  1V1P A;  4JPS A;  2ACZ B;  2QIE B;  4TQ0 A;  2G9H D;  3ZJU A;  1TKG A;  1ZPS A;  3AE4 B;  3P4Q B;  2G1E A;  1TJE A;  1CQV A;  1DYQ A;  1YNT E;  3T3O A;  3NRZ A;  4WWM A;  5TSS A;  3IXS A;  2PLP A;  3P4S B;  1RWS A;  1AW7 A;  3KLS X;  1EU3 A;  4A9A A;  1L4D B;  3W2D A;  1XXG A;  1FXI A;  4ARC A;  2JX5 A;  3AMZ A;  1T3Q A;  2XN9 C;  2BBC A;  1TZO A;  5HG2 A;  4US8 A;  1J7C A;  1XCT L;  3UI3 A;  2N9K A;  2ZW0 A;  1FIQ A;  4MM3 B;  1UGJ A;  2IPK D;  2WXM A;  2WXL A;  1MVK A;  5BMI A;  1YN5 A;  2WDV B;  4GDK B;  1P7F A;  3GB1 A;  2H88 B;  3AE6 B;  1F2R C;  1UUP A;  3VRB B;  4XWW A;  4YSZ B;  3P1M A;  1J7B A;  1KTK A;  2JYE A;  2L83 A;  4C7Z A;  3P4P B;  3CIR B;  1I4P A;  2R61 A;  4AQ7 A;  1EWC A;  1SE3 A;  1SB3 C;  1ZXH A;  1IUE A;  1T6B X;  1F2R I;  3P42 A;  1FXA A;  3N9Y C;  1E6E B;  3TEZ A;  1M4V A;  2PIA A;  4C7Y A;  1L0V B;  4N6E B;  3AE8 B;  2PMV A;  1YN4 A;  4HKQ A;  2M19 A;  4WUR A;  2B76 B;  2VZK B;  2CU3 A;  2X38 A;  2ON8 A;  2WXN A;  4N58 A;  2V3N A;  2IGG A;  2IDY A;  2JYT A;  1CJE A;  1STE A;  2CJO A;  3KWV A;  1PFD A;  1DOX A;  1ROE A;  1I4G A;  2RDG A;  1I7H A;  4TMA B;  1FCL A;  1XLQ A;  2QMT A;  4OZA A;  1QOG A;  1L6U A;  5FR3 A;  1PGX A;  4HKZ E;  4MAC A;  1K52 A;  2PVO D;  3U2S C;  1JWB D;  2KWD A;  1FRR A;  5JXV A;  1XLP A;  1B9R A;  3AE2 B;  3SFE B;  1IBX B;  1JWU D;  1PYW D;  4OVZ A;  1QOF A;  2L32 A;  3AE3 B;  1ZXI A;  5C2T B;  2AQ3 B;  2M56 B;  1JWA D;  4HRO A;  2J52 A;  5BYR A;  4ARI A;  1K51 A;  2VZK D;  2PTL A;  1VZ6 A;  2BT6 A;  3H8H A;  3ZYY X;  2JU6 X;  3Q8E A;  3Q8F A;  3EA6 A;  4KX6 B;  1YMH E;  1V8C A;  1V1O A;  2W55 A;  3AE9 B;  1KFY B;  1MI0 A;  4XDC A;  1YQ3 B;  4YTM B;  2Y5P A;  3LYY A;  1KLU D;  2MJD A;  1NI3 A;  1OQQ A;  2K3U A;  2LUM A;  2OHF A;  3BII D;  1DOI A;  4RF0 A;  3TUO A;  1D5M C;  1XLN A;  2N9L A;  4M0W A;  3KQ4 A;  3AEF B;  1HA5 A;  1SE4 A;  3RPF C;  3ZJV A;  1JW9 D;  2OED A;  2LFI A;  2MH7 A;  3MJ5 A;  2PVG C;  2HDE A;  3MFG A;  3AEE B;  2WXO A;  3AN1 A;  1T5X D;  2E6X A;  1IGD A;  3TEX A;  1C9F A;  5C3J B;  1JCK B;  3MC0 B;  3Q69 A;  1I4R A;  3MHZ A;  2WQY B;  1E10 A;  3PO0 A;  1OFF A;  1YJI A;  5BYS A;  2EKI A;  3FAH A;  3BWU D;  3GP7 A;  2SAK A;  3W1S A;  1N5W A;  1GB4 A;  4H2A A;  1NEN B;  2QSD A;  2KMM A;  4B0E A;  1ZUD 2;  1AYF A;  4RGO S;  2YEP F;  2BS2 B;  4RCO A;  3NVV A;  4RNA A;  1SBB B;  1FNW A;  1OQR A;  1TS4 A;  1XO3 A;  3NVY A;  3SEB A;  3PZ8 A;  2PW9 A;  3W5V B;  5LNK 1;  2V4I B;  2NMQ A;  4KGT A;  2WDQ B;  2J53 A;  2H89 B;  1WGK A;  1DOY A;  2JZP A;  4ZHO A;  1NEK B;  4C56 C;  2RMM A;  3BZD B;  4ITK A;  1JWM D;  4MH8 A;  1VZ7 A;  2WXR A;  1TS2 A;  3ZQ4 A;  2K22 A;  4YSY B;  3HVD A;  4WIP A;  5H92 C;  1V1P B;  1SSN A;  2K9X A;  3AM9 A;  3AH7 A;  5BMG A;  2BB5 A;  1ZDX A;  1N63 A;  1VJK A;  1YN3 A;  1I4Q A;  4LLG M;  3BVG A;  2K5P A;  3AEA B;  4RH6 A;  1C4A A;  2DLB A;  1VZ8 A;  4YSX B;  2KAC A;  2Z8L A;  4IDI A;  3NVZ A;  2WP9 B;  3CF4 A;  2LHD A;  4DXF A;  1QQR A;  4D2K A;  1GTH A;  4DXG A;  3Q8C A;  1GT8 A;  2EEL A;  3P63 A;  4ZHP A;  1J7A A;  1FRD A;  2HTM E;  2KQ4 X;  1QOA A;  2KN4 A;  2WLB A;  3AB5 A;  1ZOY B;  1L5P A;  3Q8B A;  3V3X A;  3AV8 A;  1A70 A;  2J4X A;  1KRH A;  4EE2 A;  3EUB 2;  1TYG B;  4YWG G;  2N7J A;  2YEP B;  3NUH B;  1E0Z A;  4FXC A;  3PZ7 A;  5H8Y E;  1ENF A;  1C77 A;  1JAL A;  1ZE3 D;  4NAM A;  3ABV B;  1PUT A;  4RGM A;  3I57 A;  4RF1 A;  1PGB A;  2WXJ A;  2Y3A A;  4C80 A;  1QF6 A;  1H7W A;  2I38 A;  1TS3 A;  1FMA D;  1FFV A;  3BVZ A;  4RGT A;  2JQR B;  2FUG 1;  1L4Z B;  4A8X C;  4HEA 1;  2JSV X;  4WQM A;  3NZ3 A;  1N61 A;  1C76 A;  2K0P A;  3J9C A;  1IGC A;  2E3T A;  1BML C;  2LHE A;  5EE0 A;  1FO4 A;  2LMC A;  2ONQ A;  3BYT B;  1E9M A;  5HI1 A;  2LGI A;  2QIL A;  4GDL B;  2Y5C A;  2WXG A;  1ZP0 B;  1D5Z C;  1JRP A;  1XEE A;  2BB6 A;  3CWI A;  4JWS C;  5AUI A;  2IJ0 A;  1L6V A;  3AEB B;  1N62 A;  3BK1 A;  4JE3 B;  4NAW B;  1KLG D;  1WWT A;  5EE1 A;  2LEK A;  1RM6 C;  1QT9 A;  3GS2 A;  2I2Y A;  4XDD A;  3SFD B;  3FIL A;  1D6E C;  2M0A A;  4OZC A;  3DWM A;  4OZB A;  1BXT A;  2QEJ C;  4JX1 C;  1UNS A;  2KAJ A;  3IT6 B;  3IT4 B;  3VR9 B;  1F77 A;  2AQ1 B;  2WXF A;  3R2T A;  4UDU C;  3T3N A;  4O1N A;  3RFZ B;  1QLB B;  4HRS A;  1XCQ L;  2WXK A;  4KKI A;  4P16 A;  4US9 A;  2N0S B;  1QOB A;  1FCC C;  2DYM A;  3EGR A;  5BYQ A;  3AE1 B;  3B9J A;  3BVM A;  1JQ4 A;  1SF0 A;  4L1B A;  2TSS A;  2IGD A;  2WS3 B;  2MEK A;  4GLS C;  1Y56 A;  3E9S A;  2JWU A;  4XE0 A;  5GXG B;  1ESF A;  3ZJT A;  3DWG C;  2DYO A;  2L1A A;  4L2Y A;  2V3P A;  4OHJ A;  2GI9 A;  5D3D A;  4RFB A;  4LTU A;  2QJL A;  1WRI A;  4REZ A;  3AEC B;  3BK2 A;  3FC4 A;  1AN8 A;  2Q5W D;  3VQI A;  3ZGZ A;  3IAM 1;  5EE3 A;  1FM0 D;  3IAS 1;  1HZ5 A;  1VR9 A;  1BUI C;  3E56 A;  2LJI A;  4USA A;  1C78 A;  1CK1 A;  1UWX A;  4DQO C;  1GPX A;  1N60 A;  4OW0 A;  1PDX A;  3TSS A;  1WYG A;  2FE8 A;  2L52 A;  4JWU C;  3W5U B;  1PGA A;  1XLO A;  1R7S A;  3HVZ A;  3LXF A;  1FFU A;  1FNU A;  3NVW A;  1QKZ A;  2V0G A;  4WH4 A;  4TQ1 A;  2RPV A;  1UWM A;  1YJJ A;  1SJE D;  3B2F A;  1K53 A;  4ZRQ A;  1HQR D;  2W3S A;  1ET9 A;  1Q10 A;  2WXH A;  4L23 A;  5FK9 C;  1VRA B;  1KF6 B;  1SIJ A;  1FNV A;  4IKG A;  1B1Z A;  1SEB D;  3C8Y A;  2RDH A;  1GB1 A;  3NS1 A;  3TEW A;  2INP E;  1GOZ A;  1LO5 D;  4NZL B;  5HHD G;  3AE7 B;  2W82 A;  4KKJ A;  1L0Y B;  3VR8 B;  3TEY A;  4YTN B;  4WAF A;  2DWQ A;  4ZRP A;  1HXY D;  1D5X C;  1SJH D;  1TS5 A;  2WNM A;  3OWE B;  2DBY A;  2INN E;  1JRO A;  1HEZ E;  4KGR A;  4XWT A;  2PKO A;  1TKY A;  3I9V 1;  1KH0 A;  4CQN A;  3P4R B;  4YXD B;  3MP9 A;  1GAQ B;  5I4D A;  2BW2 A;  4LK0 M;  1MHH E;  4A6Q A;  1FD6 A;  1ACC A;  4AS1 A;  2WU2 B;  1C4C A;  2MJ3 A;  1P7E A;  4ZOH C;  4R3D A;  1VDV A;  2CJN A;  2AX5 A;  2SEB D;  2WXI A;  3B2G A;  5E6J A;  1HZ6 A;  1NVI D;  1GTE A;  2MJE A;  2ICI A;  1SXT A;  1TKE A;  1FEH A;  1IBX A;  1RFK A;  3V05 A;  4NJC A;  3ETR A;  1RYJ A;  1WXQ A;  2BS3 B;  4RGN A;  2AQ2 B;  1EU4 A;  1TY2 A;  3KWL A;  2GB1 A;  5BMH A;  5G5G A;  2D5G A;  2W54 A;  4J3O D;  1C4P A;  4KGS A;  1L0X B;  4YTP B;  1C79 A;  4PT5 A;  5AUK A;  3R8B A;  2WU5 B;  1DGJ A;  4TSS A;  1TY0 A;  2JXT A;  2KDM A;  4YT0 B;  2BTE A;  3SR6 A;  3U4E G;  3U7Z A;  1CZP A;  4Q2J A;  3L4P A;  2WXQ A;  4N59 A;  4ZYS A;  1EWY C;  3R2I A;  2GRI A;  2ZW1 A;  5EE9 A;  3Q8A A;  1SE2 A;  1K50 A;  1AWD A;  2W3R A;  3LB8 C;  3AED B;  4HJG E;  4A90 A;  2FBW B;  4IOI E;  1I4H A;  1ZDV A;  1N5X A;  3VRA B;  2BS4 B;  2WDR B;  1I4X A;  3O13 A;  2J42 A;  1QIL A;  2IGH A;  5HFY A;  1H7X A;  1JWS D;  3AE5 B;  2NTS A;  4A55 A;  3FIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...