1NENB

Complex ii (succinate dehydrogenase) from e. coli with dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1nenB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nenB01
2MJ3A 4HRSA 1GAQB 3P63A 1IUEA 1SF0A 2PVGC 3FAHA 3HUIA 4ZHPA 1N5WA 2BS3B 1WGKA 1T3QA 2KAJA 1NI3A 2WU2B 2KMMA 3NVVA 1N60A 1TYGB 3B2GA 1SIJA 4YSYB 1XLOA 4C80A 1FO4A 1GPXA 1WRIA 2B76B 3AE6B 1ZUD2 2PVOD 4JWSC 2MJDA 3AEGB 1FXIA 1E10A 3W5UB 3VR8B 3P4QB 1JALA 1XO3A 1XLQA 3W5VB 1J7AA 1FRRA 3AB5A 3AE5B 3AE8B 4ITKA 3ABVB 3AE7B 3SFEB 5C2TB 1EWYC 2W3SA 1OQQA 1PFDA 3NVZA 1N5XA 1J7CA 4YTPB 2K22A 2MJEA 3SFDB 3P1MA 5G5HA 1CZPA 2M19A 1YJJA 3AECB 3AEBB 1E9MA 1JRPA 1J7BA 3RPFC 3LXFA 4US9A 5EE9A 4WQMA 3KWLA 3B2FA 1GTHA 1QOGA 1YQ3B 1E7PB 2BS2B 1H7WA 4LTUA 2BT6A 1YQ4B 5H8YE 2QJLA 4HROA 4ZHOA 1FRDA 2WU5B 1DOYA 2WDVB 1FFVA 3CWIA 1XLPA 3P4SB 1QOBA 3AEAB 3DWMA 2PKOA 2HTME 3P4PB 3EUB2 5G5GA 1ZP0B 5AUKA 1JW9D 4N59A 5C3JB 3NVWA 2WP9B 4US8A 5MPOA 4C7YA 2N0SB 1H7XA 1F0ZA 1PDXA 4YSXB 3P4RB 1FMAD 1V8CA 2WQYB 2L52A 2FBWB 1N61A 2L83A 2BS4B 3AH7A 3ZYYX 3AE4B 1RYJA 1N62A 2CU3A 2JQRB 4C7ZA 3AE1B 1SB3C 2JX5A 1FIQA 1FXAA 5AUIA 3L4PA 2AX5A 3LB8C 1R7SA 1NEKB 1A70A 3AEFB 1AYFA 1TKGA 1JWAD 5EE0A 1KRHA 1DOXA 1KF6B 2H88B 3AE3B 2E3TA 4N58A 2H89B 1WYGA 4IDIA 1TKYA 1QOFA 2W55A 1QLBB 1TJEA 1FM0D 1KFYB 1WXQA 3AMZA 3NRZA 4YTNB 1NYQA 1L5PA 1NYRA 1VLBA 3DWGC 2WLBA 1YJIA 4P6VF 3HVZA 5GXGB 1QOAA 1ZOYB 1XLNA 2CJOA 1OQRA 1FFUA 1TKEA 1JQ4A 2CJNA 1OFFA 1DGJA 3AEDB 3AN1A 5H92C 3FC4A 4YXDB 1QT9A 1VJKA 2WDRB 2EKIA 3NS1A 1PUTA 4N6EB 1N63A 3SR6A 1QF6A 3VRAB 1ROEA 1GT8A 2K5PA 3ETRA 4USAA 4YTMB 1GTEA 4WWMA 1ZXIA 3B9JA 3CF4A 2DBYA 2K9XA 4YSZB 2MH7A 1L6UA 4A9AA 1NENB 5EE3A 2G1EA 2W54A 1JROA 2Y5CA 4ZOHC 3NVYA 2WS3B 1RM6C 4JWUC 3VRBB 3BIID 3W9CB 3AE9B 1I7HA 3VR9B 1B9RA 3AE2B 1VDVA 1CJEA 5EE1A 1E6EB 2DWQA 3AV8A 1DOIA 2ACZB 1L0VB 2Q5WD 4KX6B 2LEKA 1AWDA 1RFKA 2PIAA 2W3RA 4JX1C 3CIRB 2WDQB 1NVID 1UWMA 3AEEB 4YT0B 1WWTA 3PO0A 2M56B 4FXCA 3WCQA 1E0ZA 3HRDD 1L6VA 1RWSA 2OHFA 2QIEB 1JWBD 3AM9A 1V97A
chains in the Genus database with same CATH superfamily
2C60A 1L2NA 3SD5A 4XZ4A 1C4CA 4TKNA 4HK2A 5BO4B 2KHWB 3ML9A 1J7AA 3TEXA 3MC0B 3EGRA 5C2TB 1OQQA 1PFDA 2LWPA 3SFDB 1WZ3A 5D94A 4HVBA 4KGRA 2ONQA 3Q8CA 2IBIB 2BT6A 2RGFA 1J19A 2LGYA 2WNMA 2PE9A 3V61A 1Z2MA 1WI0A 3EUB2 3PGEA 3DBLI 1SEBD 1TT5B 3A9KA 4ASWC 2A5UA 4LNIA 1V8CA 2JXXA 1N61A 4HJGE 2BS4B 2ZZPB 3AE1B 1V80A 2RR9A 3RFZB 1E8YA 3KUZA 2O6VA 1KRHA 2GLSA 4RFBA 3QCAA 3I63C 1FCLA 1LXDA 1WXSA 2KOXA 1NYRA 1VZ7A 1I4PA 2MP2B 3HVDA 2IJ0A 1ZOYB 2JPHA 2N7JA 3Q8EA 4RCOA 4EEWA 4IW0A 3FC4A 2JT4B 2EELA 2LRUA 2WXMA 3VRAB 2DYBA 4A9AA 2G1EA 3W9CB 1WMHB 3AE2B 2YEPB 2DWQA 2ACZB 2KVZA 1VD2A 2D5GA 2M0AA 2PW9A 2WDQB 4C4VA 4ANWA 4X57B 2OHFA 1VCBA 1S1QB 2LASA 2TSSA 3DHIC 3P63A 4B9KA 1V6EA 4B0MA 4AWJA 4JWSC 3ZTDA 3VUXA 2HJ1A 3P4QB 1JALA 1WH3A 5CTRC 4DHJB 5D2MB 2V4IB 1WGDA 2KX3A 2DNFA 1YJJA 2M19A 3PLUA 3TBLD 5HKHA 2AQ3B 4LK0M 4IM3A 1GTHA 2WWZA 4FHJA 3ECIA 4LTUA 1YQ4B 2L8JA 1C3TA 3M95A 2V3PA 2HE7A 4EFOA 1K8RB 4MGKE 1ZDXA 2L1AA 4ZRIA 3RD2A 2N7DA 3AE4B 4A90A 1SB3C 4HPPA 4RF1A 3RYTA 2RDBC 4E3CA 2I2YA 3HM3A 2V1YA 4ZYNA 2FNJB 3KQ4A 4S0RA 5GMVA 3M3JA 5BMGA 3N1ZC 2YVCA 4ARIA 3H7PA 2FE8A 5KHQA 1QOAA 3AULA 4IG7B 5T8IA 3RNGC 2GMIC 4KIKA 2BB6A 1WGHA 3AEDB 2WXHA 3HM6X 2SAKA 4JL9A 3BVZA 3BYTB 2V9HA 2BB5A 1NENB 2ZW0A 3I3TB 3N20C 2C7MB 1WR1A 5C1ZA 2W3RA 5BYQA 3U30A 3U4EG 1WWTA 2KANA 2MBBB 3U2SC 1V97A 1SF0A 4ZRQA 1N5WA 2LVQA 1T3QA 1NI3A 4A55A 2QILA 1F9JA 1XT9B 4WAFA 1HZ5A 1XLOA 4M0WB 3N3KB 1LQBA 3V3XA 3PHXB 3QQ8B 2LXCA 2Y5PA 2MRPA 3NVZA 2WYQA 4M02A 4IUMB 4HLEA 2WXRA 1DOYA 2L00B 1E8WA 5DPSA 1M94A 3SEBA 3RNBC 5IA7A 1YMHE 2IGHA 1SE3A 2J0KA 2UWQA 2QSDA 3A9JA 2JWZA 1ISNA 4F8CB 1XCTL 1FXAA 5AZFA 1BUIC 1E8XA 1NBFC 1DOXA 1JWAD 5LLIA 1GC7A 5TR5A 1TKYA 2INPE 1JWSD 1KFYB 1IPGA 2DAJA 2G3QB 4YTNB 1I4XA 2BWES 3UI3A 2LVOA 4WWOA 1NI2A 4QAYA 1V5OA 2NS5A 4YXDB 3UIPB 1EWCA 2GB1A 4N6EB 4P16A 1ET6A 2L3ZA 2KMCA 2KVRA 3UIOB 3ZJUA 1P0RA 2R2OA 2PE6B 3PZ8A 4HDOA 3QX1A 4PYUA 1JROA 3ZXVA 3PZ7A 4JWUC 4MEMA 2QC8A 1WGYA 2LVPA 1L0VB 2ZJDA 2R61A 2NBVB 5DCNA 2YLMA 2LUMA 4GU2A 2KC2A 4N58A 2M4NA 2MJ3A 4S17A 2WX1A 3K9OB 3HUIA 4MT5A 1WGKA 4BBNC 2CHWA 2WU2B 1ESFA 3EFCA 4JPSA 2XN9C 5G55A 1WRIA 1WSPA 2FCQA 3PLVA 1L4ZB 4ICUA 2C7NB 2KYWA 3H9DA 3AE5B 2W3SA 3KVFB 2A4ZA 4MGZE 3C8YA 4DHZB 4RGOS 3WIMA 3R66C 1CZPA 2OEDA 1WX9A 4OZBA 1HXYD 2N7EA 3RPFC 4IWQA 3L16A 2JRIB 2CR5A 1YQ3B 2O6VD 5H8YE 2BKFA 1FFVA 2J7QB 2FUHB 4NPNA 3R7QA 5DPWA 4AJWA 2HTME 4TMAB 4JLCA 2D07B 2X8XX 1GNUA 1MFWA 2L52A 3Q3MC 2I1JA 4HKQA 2DZJA 1UELA 4TQ1A 1V2YA 2AX5A 1JWMD 2XNAC 1TZOA 1C78A 3J9CA 1BT0A 4P6VF 1NYQA 1FXTB 1S3SG 2O2VA 1FNWA 3MJWA 3Q3NC 1FNVA 2KDEB 3WA0A 1TKEA 1UZXB 1XQQA 2IYDB 1T0QC 2WDRB 3W2DA 1N63A 3SR6A 1QF6A 1OQYA 2K5PA 5BMHA 4J6IA 3WAOA 3PS6A 3ZRCA 4GDKA 3IAS1 3VRBB 1Q5WB 2KFKB 1CJEA 4ICVA 2Q5WD 1AWDA 4MM3B 1NVID 1E5WA 1PGAA 4DDGD 4NY0A 1CQVA 1GAQB 4ANXA 4D2KA 2MQJA 2CKHB 4RF0A 5FK9C 2KMMA 3P2BA 2PEAA 4FADA 2JYEA 5J17A 4BOSC 2BYVE 4TV3A 1FXIA 3VR8B 1XO3A 4ACFA 2KTFA 5E6OA 1F1HA 2JVCA 4HEA1 4TUUA 1E7VA 3WALA 2JSVX 2ZW1A 2I38A 2MJEA 3MC8A 3PT2B 1JRPA 1J7BA 3OG5A 4YWGG 2KDFB 3CMMB 1JMLA 1T0SC 3JSVA 1T5XD 3QAQA 2EKEC 3GZNB 2WDVB 1P7FA 2DX5B 3DOWA 2QHOA 1SSNA 1TTNA 4XWWA 2ON8A 3PV1A 1JW9D 1EU3A 2KT7A 1QZEA 3ZYYX 1ENFA 4NZLB 2JQRB 3RN9C 1UWXA 5D7GA 4OHJA 1WXVA 1L4DB 3DHGC 5JHAA 2HTHA 4REZA 3FILA 3UF8A 2DZMA 2G9HD 2Z0EB 3IHPC 1FM0D 1WXQA 3QIJA 4KZ0A 3ZNZB 5J18A 2WX0A 2KDIA 2K1FA 4LNKA 2Z0DB 1VZ6A 2DZKA 4L23A 3AN1A 4DK5A 3ZQ4A 5D3IB 3DBHB 3ZNGC 1I4RA 3B9JA 4BFRA 4WIPA 1D5XC 2W54A 3TEWA 1SIFA 2J42A 1HEZE 3AE9B 1EF5A 3TL5A 1B9RA 2CU1A 1IBXB 1C1YB 4LJOB 4W9FA 4B95A 2BYFA 5I4DA 3H7SA 2D11A 4YT0B 2FCNA 3WCQA 2ZCCA 3LJ3A 4HRSA 4ZDVA 3TJPA 2Z59B 2IY1B 4GIVA 2J52A 3O13A 1V9JA 4LDTB 2IGDA 2GOWA 2LJ5A 2KACA 4YSYB 3BINA 3AE6B 3VFKA 2CHZA 1TY2A 1OTRB 1V1PA 1QQRA 4ZYSA 3IAM1 4ITKA 3TIXA 4A3PA 4DXAB 1D3ZA 1C79A 1SE2A 4EE2A 3QARA 2EMSA 3Q3JA 2JU6X 1QOBA 2PKOA 2VZKB 1GOZA 1ZP0B 3L10B 3K9PB 2WHIA 1XF5L 3EFUA 3AXCA 3P4RB 3AH7A 1RYJA 3MTNB 4AOFA 3TEZA 2MP2A 5AUIA 3DVGY 1BXTA 3O65B 1H4RA 1UBIA 2MX2A 3QJZA 3IG3A 1MPEA 3DWGC 4W9DA 1IP9A 2V0GA 1E7UA 1H8CA 2FIFA 2CJOA 3RI7C 2WXKA 1WFYA 1WMHA 4E74A 4AUQC 2PMVA 1BMLC 3PSEB 2RSUA 3ZLZA 2BKRB 3BY4B 1WGRA 3BK1A 1D5MC 1M4VA 3NVYA 3RULA 1RM6C 3VQIA 3HHMA 3CSFA 3ZDTA 3QWZB 1SXTA 3SDLC 3TCAA 3TSSA 5HFYA 2LI5A 2IO0B 2MLBA 3AM9A 1RLFA 3ZVVA 3V6EB 2G4SA 1HE8A 3GS2A 1YOVB 5LXIB 2OJRA 1PGXA 4CHKA 1MHHE 4L1BA 4BOZB 2IPKD 3AEGB 1E10A 1FRRA 2HDEA 1EWYC 2KLCA 1KJTA 4XDCA 1I4GA 3AECB 2VH1A 1V81A 3KWLA 3MHZA 1E7PB 1WE6A 4ZHOA 2LGXA 1FCCC 3KYDD 1FRDA 4HROA 4RMAA 4KV2A 1WIAA 4I6PA 4IWPA 3IVFA 4URKA 1WRDB 4O1NA 4N59A 5C3JB 1OEYA 3APFA 2L83A 2FBWB 1EF1A 4M01A 3NOBA 2GBMA 4KKIA 2KZRA 2BW2A 3L4PA 4TSSA 2WXQA 1NEKB 3BYYB 3DVGX 1KF6B 2H88B 2DAFA 2ZEQA 3A1QB 3N30A 3ZXRA 2NTTA 5D6JB 5IOIA 1LFDA 1MG4A 4NNJB 1FFUA 4KZCA 1DGJA 1TY0A 3T9LA 1VJKA 2BF8B 3GZNI 3ZJTA 1ZPSA 3RMKC 3VH4B 3B08A 1ZW7A 1KM7A 5JZEB 2GI9A 1V5TA 3UQBA 2N9EB 1OEYJ 3Q8AA 3OLMD 4KSKC 2C5LC 2WS3B 3LYYA 3GE3C 3QC8B 1WXAA 3HIZA 3PTFC 3ZUNA 3NY5A 4RM9A 1UWMA 3PRZA 4XE0A 4M0WA 3PO0A 4HKZE 1L6VA 1F52A 2ZNVB 2JF5A 2N9LA 1GB1A 3W1SC 3NZUA 4A8XC 2BS3B 3B1LX 2WDTB 2UU7A 2I1KA 4C80A 1RRBA 2DZIA 4FJYA 1LGRA 1U4AA 4W9LA 4OZAA 3W5UB 2HJ8A 3KUDB 4EZLA 1YQBA 3AB5A 5IO9A 1NDDA 1P9DU 3I9V1 2N9KA 3DBHI 3RZFA 1V1OA 2MBQA 5FKAC 1Q10A 4JIOU 3IXSA 4NJCA 2CS4A 3KH0A 1WGGA 3CWIA 4MH8A 4RNAA 3APCA 1AW7A 5G5GA 1R4MB 1ZDVA 1C4PA 3OJ3A 3RCZA 5CHWA 5JHBA 2WXLA 3ZW3A 1JWUD 3L08A 3I57A 1SE4A 4W9EA 1PGBA 3M62B 3AEFB 3H7PB 2KN4A 4HJKA 3NHEB 1GUAB 4ANVA 1K52A 1P98A 2K0PA 1L5PA 2JY6A 2FCMA 3HVZA 3MJ5A 1XLNA 4GOCA 2NBUA 2B3AA 2AQ1B 2PPHA 4H2AA 4KDIC 1T0YA 2DYMA 1QT9A 3PVLA 2JWUA 3DHHC 2GBNA 1ROEA 2KWDA 3ZTCA 4USAA 1WF9A 3IFWB 1ZXIA 4IM0A 3T8MA 4YSZB 5EE3A 1MHXA 1TS5A 2Y5CA 2JZ3B 5L95C 2LGIA 2OJWA 3TEYA 3AI5A 1VRAB 2BYEA 3Q69A 1Y8RC 4MJSB 1E6EB 4XX5A 2XK5B 3Q3FA 3ZIMA 2IO2B 4KVGB 3DBSA 3ZGZA 1XEEA 2J0MA 1L0XB 3P42A 4ZHPA 4OW0A 2J53A 1WXMA 2GBRA 1N60A 1FO4A 1P1AA 2KQ7A 4A20A 1GJZA 2MJDA 5AEKB 2WXJA 4WJOA 3SHQA 3VTVA 2BWFA 4MGIE 3V60A 2KK8A 2DENB 3P1MA 3U7DA 2D2QA 2HD5B 4B0EA 3IBEA 5AZHA 1KOTA 3RNEC 2KMAA 2G4DB 3A9JB 3A33B 4F7ZA 2NPTB 4DXFA 3ALBA 3U52E 3OJ4B 2N0SB 1UD7A 4YSXB 1FMAD 4PYZA 2AWTA 1J8CA 3JW0X 1K53A 3Q14C 3WANA 1HTQA 2GRIA 3LB8C 3M63B 1R7SA 1A70A 1WJ4A 4J3OD 4A6QA 2E3TA 2INNE 3KLSX 5CX3A 1D4BA 2VH2A 5E6PA 2LFIA 2KDMA 2IZVB 4FHKA 4ANUA 2KX0A 1E8ZA 2KFKA 4OZCA 5IN7A 2QEJC 2JZZA 2KQ4X 4RGNA 3CSTA 4MM3A 1UF0A 1WM3A 4XYCA 1LO5D 3CF4A 4P7IA 1I4QA 1HTOA 3C0RB 5CHFA 3H1UA 4W9HA 4CYEA 4MGYE 4N9F4 3D32A 1ET9A 3AEEB 2EMTA 4LJPB 1RFAA 2L7RA 2N9XA 3MP9A 2PVGC 3N9YC 1L0YB 2KAJA 2WXNA 2ZVNA 1LM8B 4W9JA 4ARCA 5TSSA 2B76B 4GMVA 2BTEA 3VAWA 4GXBA 3VVWB 3UQAA 1YNTE 5L83A 3B0AA 4RH6A 3VUYA 4YTPB 3AU5A 2E6XA 5G5HA 1YIWA 1MJDA 2M17A 4US9A 3NS8A 2INDC 1XLPA 2J0JA 2NBWB 4RGTA 3ML8A 2LGDA 2D3BA 2QCZA 3TUOA 4WURA 4FJVB 3URYA 2BGFA 3ZO5B 1C4AA 2L32A 1RAXA 2JXTA 3R2IA 1YN3A 2NVUI 1FIQA 2Y3AA 2RDGA 1YJ1A 2LZ6A 3NZ3A 4IOIE 3BZDB 4MACA 4FN2A 5LXHA 2W55A 3NJTA 2AQ2B 1WY8A 2M8SA 5CHVC 2KWCA 1C77A 1R4NB 4OVUA 1JQ4A 2RD0A 2MBOA 1K51A 2LHDA 5BMIA 2V3NA 4BKTA 3DPDA 4YTMB 1J0GA 2K9XA 1KLVA 1UGJA 2OOBB 1R4MI 3BVMA 2MBEA 3MHSD 3RNAC 2M0XA 2ZVOA 4LNOA 4G11A 1X1MA 1GC6A 4HXDA 1G6JA 1N6ZA 3Q3OC 2XBBC 1E0ZA 3V62A 2MHJA 2KJ6A 2KTRB 1JWBD 5FR3A 3GP7A 1IUEA 4DQOC 1TS2A 1EUVB 4WAAA 4GDLB 3DCGA 2MCNB 4CO7A 2LD9A 1GG3A 5LNK1 1YN5A 4HWIB 4XGAB 3W5VB 2ZCBA 2AL6A 1UBQA 1CMXB 2KO3A 2BQQA 2FCSA 4RGMA 3VTUA 3LXFA 2N1WA 4ZRKA 4IKGA 2K3UA 3P4SB 4RM8A 4BKSA 2X38A 5IP4D 3A4RA 3WAMA 4P1CC 3BVGA 2N9PC 3PRMB 5MPOA 4US8A 4K7WA 4C7YA 3TMPB 2FAZA 4NAWB 4F1SA 3PZDA 3FILB 4K7SA 3RUIB 1N62A 4AS1A 4IM2A 1KLUD 4AQ7A 2AL3A 4KGTA 2PLPA 4PS3A 2LXAA 4ZRJA 4KDLB 1JRUA 1WM2A 4IC7B 2XEWA 2D3AA 2NR2A 1VLBA 1YJIA 2NTSA 3X23A 2ASQA 2K39A 1GT8A 4G3XB 4M00A 1YX6B 3Q8FA 3VH3B 3UGBB 2L0TA 3VR9B 1SBBB 1F2RI 1ZKHA 2D10A 4HPLB 2M56B 3HK0A 1EO6A 2MEKA 3HRDD 4BBNF 4E71A 2Z8LA 1XCQL 4B6WA 1V1PB 4Q2JA 1GPXA 1TIFA 1AARA 2L0FA 2WGSA 3E9SA 5BYSA 3DVNU 3Q8BA 1UGMA 4GLSC 3UINB 3DBRB 2C9WB 5BYRA 3H6NA 4WQMA 1QOGA 1TZ1A 2INCC 2RMMA 2V3SA 2LJIA 2WXGA 2QJLA 5J2RA 1WE7A 1WJNA 3C19A 4G50A 1ZGUB 2G45B 1EU4A 1F0ZA 3A1QA 4C00A 1C76A 3ONSA 2CU3A 3GOEA 1V49A 1VZ8A 4MH0E 2IDYA 4MSQB 1TKGA 1KLGD 1WJ6A 3A9KB 4LNNA 2BPSA 1MG8A 3V05A 1IYFA 4BKGA 5DPRA 2WLBA 1OQRA 4WWPA 1HQRD 1PYWD 1WYWB 2O6VB 1EM7A 2M1MA 2PTLA 3ETRA 2CHXA 2FUG1 2KWUB 4MSMB 2DHZA 4II2B 3BK2A 1XD3B 2IY0B 3JVZX 1UUPA 2K8CA 3W1SA 1D5ZC 1KH0A 1E90A 3ZDMC 4EZJA 3WAPA 2W9NA 4BVUC 3NVVA 3N32A 4GB9A 2LUEA 2MW5A 3DDCB 4C4VB 2PVOD 1HZ6A 4W9CA 3QHTA 1R4NI 2ZNVC 4PS7A 3RT3B 3RNCC 2JZPA 3ABVB 1YN4A 4M8NA 1TS4A 3L0WB 1MI0A 1H7WA 4EZKA 3Q6BA 1ACCA 4W9KA 3AU4A 3AEAB 2GBJA 4K3CA 1PDXA 4R3DA 3IT6B 2WQYB 3Q2AC 1TS3A 3VXWA 3EC8A 2JX5A 4OVZA 4HPMB 5JH5C 4PT5A 4WWNA 4KSLC 4W9GA 5EE0A 1FPYA 2J4XA 4XC2A 1FNUA 2RPQA 1KTKA 3NRZA 2ZPNA 4K7UA 3N1YC 4LDTD 5KHOA 1HA5A 1IGCA 5GXGB 4XDDA 1AN8A 1DYQA 2KKCA 2WXPA 4EUTA 4MJSA 4AP4C 2XK5A 5D3DA 5E6NA 4WWMA 3L17A 1L6UA 1MVKA 2N4FA 3GB1A 4NQKE 4KIKB 1CK1A 1I7HA 4XWTA 1I4HA 4OVVA 2IO3B 1WR6E 5JXVA 3CIRB 2D3CA 2VZKD 2REXA 1RWSA 2NCNA 3PREA 4ZOHC 1SE9A 2SEBD 4LNFA 1WX8A 4BKSD 4GN1A 3B2GA 3VHTC 3QA8A 4K81A 2L76A 5IKCM 1UH6A 3AE8B 3AE7B 3SFEB 4W9IA 4TQ0A 2NPTA 2IO1B 4K3BA 2GBKA 2K8BA 4FLHA 2KDBA 2WU5B 2PJHA 1A5RA 3DWMA 3X0WA 3L13A 3VTWA 4EKUA 4DBGA 3NVWA 4GSWA 4DHZE 1YD8U 3N1XC 2L05A 1L7YA 4AJYB 1SJED 2BVCA 2FIDA 3NUHB 1WJUA 4EOYA 2LRWA 5AZGA 3NG0A 1WZ0A 3AE3B 1Q0WB 2KJRA 2H89B 2C7HA 4II3B 4JGHB 1ZXHA 4IDIA 2QDFA 4MDKE 3AMZA 1F2RC 1XXGA 3R3MA 4WJNA 2LGSA 2KWVB 2DLBA 2KJHB 3U8ZA 3DBRI 4FA6A 4WH4A 2W82A 1PQSA 5H92C 4YL8A 3NS1A 3L54A 1P3QU 1PUTA 2RPVA 3QK0A 3NZSA 4BZAA 1Z5SB 3ZNID 2MH7A 4JE3B 2WXIA 2WXOA 3KW5B 4NAMA 3ZJVA 1VDVA 3A4SC 1TGZB 4NJ7A 5EE1A 4WJQA 3W1YA 1RFKA 3DBLB 4LCDE 4P1BC 1GB4A 2AEHA 2QIEB 2YEPF 4DHJD 3FAHA 4NJ6A 1TBEA 2NMQA 3V6CB 1P7EA 3H8HA 1TYGB 2K25A 1SIJA 3S2AA 4BAXA 3GE8C 3OAWA 5HG2A 4HCPB 4PK1A 3R7RA 1WX7A 1J7CA 2KFJA 2IGGA 1VR9A 2BS2B 4GGQA 1SJHD 3T3OA 1ZE3D 2LMCA 2MBHA 4WQOB 4KKJA 3SU8X 3E56A 1UNSA 4PS8A 3P4PB 5AUKA 2KNBA 3CF6E 1C9FA 1H7XA 3KUCB 2K8HA 1Y56A 3OWEB 3RZWC 4A3OA 1QILA 4C7ZA 4I6LB 3ZRFA 3U7ZA 2D3GA 2KC1A 2DYOA 4FULA 2K6DB 1STEA 1T0RC 2VRRB 1QOFA 1TJEA 3FKYA 1OGWA 3ENEA 2N1VA 1K50A 2CJNA 3ZKJC 2MSED 2EKIA 2ZPYA 3DVNV 4FBJB 2MA9B 4IWOA 2O2VB 2DBYA 2KTRA 3BWUD 1IGDA 3R8BA 3I5JC 5EDSA 4LLGM 2QMTA 3BIID 2K6QA 4NQLB 4GDLA 2LHEA 1DOIA 2KN5A 4JX1C 2MWSB 4FXCA 4UDUC 2KXJA 1D6EC 1F77A 1IBXA 2KLGA 4GDKB 3EA6A 4ZRPA 5G2NA 1B1ZA 3VUWA 5C23A 1ZUD2 3RNFC 1XLQA 3EHVA 1YX5B 1N5XA 2K22A 4JQWC 1I42A 3AEBB 1E9MA 5EE9A 3JYUA 5FR6A 4NAWA 3B2FA 5E6JA 2UYZB 2Y5BB 4MELA 3MFGA 2AYOB 3R2TA 2WP9B 4HDQA 2JUOA 3JSVB 2KD0A 2BBCA 3EECA 3DQVA 3KWVA 5HI1A 2BYTA 4DDID 4L2YA 1AYFA 1I35A 3VDZA 1WYGA 1QKZA 3PPAA 1SGHA 1QLBB 5HHDG 4G0NB 2RDHA 2V4LA 2JYTA 3ZNHB 4K1RB 1FEHA 4C56C 1OFFA 2WXFA 3LDZE 3T3NA 3PRPB 1JCKB 5IAAC 3PHWB 1GTEA 2JRHA 4KGSA 4CQNA 4I6NB 3APDA 3KYCD 2R2QA 4HCNB 2ICIA 4M8MA 1FD6A 1Q1OA 1T6BX 3AV8A 3IT4B 4FJZA 4KX6B 2LEKA 2PIAA 4DXGA 4DWFA 4WJPA 3MC9A 1V86A 2KQSA 5DPTA
chains in the Genus database with same CATH topology
1XEEA 1CQVA 1GAQB 4D2KA 1L0XB 4RF0A 3P42A 5FK9C 4ZHPA 4OW0A 2J53A 3NVVA 2KMMA 1C4CA 1N60A 1FO4A 2JYEA 2PVOD 1HZ6A 2MJDA 1FXIA 3VR8B 1XO3A 2WXJA 1J7AA 3TEXA 4HEA1 3MC0B 3EGRA 2JZPA 3ABVB 5C2TB 1YN4A 1OQQA 2JSVX 1PFDA 2ZW1A 2I38A 2MJEA 3SFDB 3P1MA 1JRPA 1J7BA 1TS4A 4KGRA 4YWGG 2ONQA 4B0EA 1MI0A 1JMLA 3Q8CA 1H7WA 2BT6A 1T5XD 2WNMA 2WDVB 1P7FA 1ACCA 1SSNA 3AEAB 3EUB2 4XWWA 2ON8A 4DXFA 1SEBD 1JW9D 3U52E 2N0SB 1EU3A 1PDXA 4YSXB 1FMAD 4R3DA 1V8CA 2WQYB 3IT6B 3ZYYX 1N61A 4HJGE 2BS4B 1ENFA 1TS3A 2JQRB 4NZLB 3AE1B 3RFZB 2JX5A 1UWXA 4OVZA 5D7GA 1K53A 4OHJA 1L4DB 2GRIA 3LB8C 4PT5A 4REZA 1R7SA 1A70A 5EE0A 1KRHA 2J4XA 3FILA 4J3OD 2E3TA 4RFBA 2INNE 3KLSX 4A6QA 1FCLA 2G9HD 1D4BA 1FNUA 1FM0D 1KTKA 1WXQA 3NRZA 1NYRA 1VZ7A 1I4PA 1HA5A 2LFIA 2KDMA 3HVDA 1IGCA 2IJ0A 5GXGB 4XDDA 1ZOYB 1AN8A 1DYQA 1VZ6A 2N7JA 2WXPA 3Q8EA 4L23A 4RCOA 3AN1A 4OZCA 2QEJC 3FC4A 3ZQ4A 2KQ4X 4RGNA 5D3IB 2EELA 5D3DA 2WXMA 3VRAB 1I4RA 4WWMA 1LO5D 3B9JA 3CF4A 1I4QA 1L6UA 1MVKA 4A9AA 3GB1A 4WIPA 1D5XC 2G1EA 2W54A 3TEWA 3W9CB 2J42A 1HEZE 3AE9B 1CK1A 1I7HA 4XWTA 1B9RA 1I4HA 3AE2B 2YEPB 1IBXB 2DWQA 2ACZB 2D5GA 2M0AA 5I4DA 5JXVA 3CIRB 2WDQB 1ET9A 2PW9A 3AEEB 4YT0B 3WCQA 2VZKD 1RWSA 2OHFA 3MP9A 4ZOHC 4HRSA 2TSSA 3P63A 2PVGC 2SEBD 3N9YC 2J52A 1L0YB 2KAJA 3O13A 2WXNA 4B0MA 2IGDA 3B2GA 2KACA 4ARCA 4YSYB 5TSSA 2B76B 3AE6B 4JWSC 2BTEA 1TY2A 3P4QB 1JALA 1V1PA 1QQRA 4ZYSA 3IAM1 3AE8B 1YNTE 4ITKA 3AE7B 3SFEB 4RH6A 4TQ0A 4YTPB 2V4IB 2E6XA 5G5HA 2M19A 1YJJA 2AQ3B 4US9A 4LK0M 1C79A 1SE2A 4EE2A 1GTHA 4LTUA 1YQ4B 2WU5B 1XLPA 2V3PA 2JU6X 1QOBA 3DWMA 2PKOA 4RGTA 2VZKB 1GOZA 1ZP0B 1XF5L 3TUOA 1ZDXA 3NVWA 4WURA 3URYA 2L1AA 3P4RB 1C4AA 2L32A 3AH7A 3AE4B 2JXTA 1RYJA 3R2IA 3TEZA 4A90A 1SB3C 4RF1A 1SJED 1YN3A 1FIQA 2I2YA 2Y3AA 2RDGA 5AUIA 3NUHB 4IOIE 3NZ3A 3BZDB 4MACA 1BXTA 3AE3B 2H89B 3KQ4A 1ZXHA 4IDIA 2W55A 5BMGA 3AMZA 4ARIA 1MPEA 3DWGC 2AQ2B 1F2RC 1XXGA 2V0GA 2FE8A 1QOAA 2DLBA 2CJOA 1C77A 1JQ4A 5T8IA 2WXKA 1K51A 2BB6A 4WH4A 3AEDB 2W82A 2WXHA 5H92C 2PMVA 2LHDA 2SAKA 2V3NA 5BMIA 1BMLC 3NS1A 1PUTA 2RPVA 3BVZA 3BYTB 4YTMB 2BB5A 2K9XA 2MH7A 4JE3B 2WXIA 1UGJA 1NENB 2WXOA 3BK1A 1D5MC 3BVMA 2ZW0A 1M4VA 3NVYA 4NAMA 1RM6C 3VQIA 3ZJVA 1VDVA 5EE1A 1SXTA 2W3RA 5BYQA 3TSSA 1RFKA 5HFYA 3U4EG 1WWTA 1E0ZA 1GB4A 2QIEB 1JWBD 3AM9A 1V97A 2YEPF 3U2SC 5FR3A 3GP7A 1IUEA 1SF0A 4DQOC 4ZRQA 1TS2A 3FAHA 3GS2A 2NMQA 1N5WA 1T3QA 1NI3A 4GDLB 4A55A 1P7EA 2QILA 3H8HA 1TYGB 1SIJA 1HZ5A 1XLOA 4WAFA 1PGXA 1MHHE 5LNK1 1YN5A 4L1BA 2IPKD 3AEGB 1E10A 3V3XA 3W5VB 1FRRA 5HG2A 2HDEA 1EWYC 2Y5PA 3NVZA 4XDCA 1J7CA 1I4GA 3AECB 2IGGA 4RGMA 3LXFA 1VR9A 3KWLA 3MHZA 1E7PB 2BS2B 2WXRA 1SJHD 4IKGA 3T3OA 4ZHOA 4HROA 1FCCC 1ZE3D 1FRDA 2LMCA 1DOYA 2K3UA 3P4SB 2X38A 4KKJA 3E56A 3BVGA 1UNSA 3P4PB 4O1NA 5AUKA 4N59A 5C3JB 4US8A 5MPOA 1C9FA 3SEBA 4C7YA 1H7XA 1YMHE 2IGHA 1SE3A 4NAWB 2L83A 2FBWB 1Y56A 3FILB 2QSDA 3OWEB 4KKIA 1N62A 4AS1A 1QILA 4C7ZA 1KLUD 4AQ7A 2BW2A 1XCTL 1FXAA 4KGTA 1BUIC 2PLPA 3L4PA 4TSSA 3U7ZA 2WXQA 2DYOA 1NEKB 3BYYB 1DOXA 1JWAD 1STEA 1KF6B 2H88B 1TKYA 2INPE 1QOFA 1TJEA 1JWSD 1KFYB 2NTTA 4YTNB 1VLBA 1YJIA 1I4XA 3UI3A 2NTSA 1FFUA 1K50A 2CJNA 1DGJA 1TY0A 4YXDB 1VJKA 2EKIA 1EWCA 2GB1A 4N6EB 4P16A 3ZJTA 1ET6A 1GT8A 1ZPSA 3ZJUA 2DBYA 3PZ8A 3Q8FA 3BWUD 2GI9A 1IGDA 3R8BA 1JROA 3Q8AA 4LLGM 2QMTA 2WS3B 3PZ7A 4JWUC 3LYYA 3BIID 3VR9B 2LHEA 1DOIA 1SBBB 1L0VB 2R61A 1F2RI 4JX1C 1UWMA 4XE0A 4FXCA 4UDUC 4M0WA 3PO0A 1D6EC 2M56B 2MEKA 3HRDD 1L6VA 4HKZE 2LUMA 2Z8LA 2N9LA 4N58A 1F77A 2MJ3A 1IBXA 1GB1A 4GDKB 1XCQL 3HUIA 4A8XC 4MT5A 1WGKA 2BS3B 3EA6A 4ZRPA 2WU2B 1V1PB 1B1ZA 1ESFA 4Q2JA 4JPSA 2XN9C 1GPXA 4C80A 1WRIA 1WSPA 1ZUD2 3E9SA 1L4ZB 4OZAA 3W5UB 5BYSA 1XLQA 3Q8BA 3AB5A 3AE5B 4GLSC 2W3SA 3C8YA 3I9V1 1N5XA 2N9KA 4RGOS 2K22A 1CZPA 2OEDA 4OZBA 1V1OA 1HXYD 3AEBB 1E9MA 5BYRA 5FKAC 3RPFC 1Q10A 5EE9A 4WQMA 3B2FA 1QOGA 5E6JA 1YQ3B 3IXSA 2RMMA 4NJCA 2LJIA 5H8YE 2WXGA 2QJLA 3CWIA 1FFVA 4MH8A 4RNAA 3MFGA 2HTME 1AW7A 5G5GA 3R2TA 1ZDVA 4TMAB 1C4PA 2WP9B 1EU4A 1F0ZA 2L52A 1C76A 2BBCA 2CU3A 4HKQA 2WXLA 1JWUD 1VZ8A 5HI1A 3KWVA 2IDYA 2BYTA 3I57A 1SE4A 4L2YA 4TQ1A 1PGBA 2AX5A 1TKGA 3AEFB 1AYFA 1KLGD 2KN4A 1JWMD 2XNAC 1WYGA 1QKZA 1TZOA 1C78A 1QLBB 3J9CA 3V05A 5HHDG 1K52A 2K0PA 2RDHA 1NYQA 1L5PA 4P6VF 2JYTA 2WLBA 1FNWA 3HVZA 3MJ5A 1FNVA 1XLNA 1OQRA 1TKEA 2AQ1B 1HQRD 1FEHA 1PYWD 4C56C 4H2AA 1OFFA 2DYMA 1QT9A 2WXFA 3T3NA 2WDRB 3W2DA 1JCKB 1EM7A 1N63A 2PTLA 2JWUA 3SR6A 1QF6A 2KWDA 1ROEA 2K5PA 3ETRA 4USAA 1GTEA 5BMHA 1ZXIA 4KGSA 4CQNA 2FUG1 4YSZB 5EE3A 1MHXA 2ICIA 1TS5A 2Y5CA 1FD6A 3IAS1 2LGIA 3VRBB 3TEYA 1VRAB 3BK2A 3Q69A 1CJEA 1E6EB 1T6BX 3AV8A 3IT4B 2Q5WD 4KX6B 2LEKA 1AWDA 1UUPA 2PIAA 4MM3B 4DXGA 1NVID 3W1SA 1D5ZC 1KH0A 1PGAA 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ3 A;  4HRS A;  1GAQ B;  3P63 A;  1IUE A;  1SF0 A;  2PVG C;  3FAH A;  3HUI A;  4ZHP A;  1N5W A;  2BS3 B;  1WGK A;  1T3Q A;  2KAJ A;  1NI3 A;  2WU2 B;  2KMM A;  3NVV A;  1N60 A;  1TYG B;  3B2G A;  1SIJ A;  4YSY B;  1XLO A;  4C80 A;  1FO4 A;  1GPX A;  1WRI A;  2B76 B;  3AE6 B;  1ZUD 2;  2PVO D;  4JWS C;  2MJD A;  3AEG B;  1FXI A;  1E10 A;  3W5U B;  3VR8 B;  3P4Q B;  1JAL A;  1XO3 A;  1XLQ A;  3W5V B;  1J7A A;  1FRR A;  3AB5 A;  3AE5 B;  3AE8 B;  4ITK A;  3ABV B;  3AE7 B;  3SFE B;  5C2T B;  1EWY C;  2W3S A;  1OQQ A;  1PFD A;  3NVZ A;  1N5X A;  1J7C A;  4YTP B;  2K22 A;  2MJE A;  3SFD B;  3P1M A;  5G5H A;  1CZP A;  2M19 A;  1YJJ A;  3AEC B;  3AEB B;  1E9M A;  1JRP A;  1J7B A;  3RPF C;  3LXF A;  4US9 A;  5EE9 A;  4WQM A;  3KWL A;  3B2F A;  1GTH A;  1QOG A;  1YQ3 B;  1E7P B;  2BS2 B;  1H7W A;  4LTU A;  2BT6 A;  1YQ4 B;  5H8Y E;  2QJL A;  4HRO A;  4ZHO A;  1FRD A;  2WU5 B;  1DOY A;  2WDV B;  1FFV A;  3CWI A;  1XLP A;  3P4S B;  1QOB A;  3AEA B;  3DWM A;  2PKO A;  2HTM E;  3P4P B;  3EUB 2;  5G5G A;  1ZP0 B;  5AUK A;  1JW9 D;  4N59 A;  5C3J B;  3NVW A;  2WP9 B;  4US8 A;  5MPO A;  4C7Y A;  2N0S B;  1H7X A;  1F0Z A;  1PDX A;  4YSX B;  3P4R B;  1FMA D;  1V8C A;  2WQY B;  2L52 A;  2FBW B;  1N61 A;  2L83 A;  2BS4 B;  3AH7 A;  3ZYY X;  3AE4 B;  1RYJ A;  1N62 A;  2CU3 A;  2JQR B;  4C7Z A;  3AE1 B;  1SB3 C;  2JX5 A;  1FIQ A;  1FXA A;  5AUI A;  3L4P A;  2AX5 A;  3LB8 C;  1R7S A;  1NEK B;  1A70 A;  3AEF B;  1AYF A;  1TKG A;  1JWA D;  5EE0 A;  1KRH A;  1DOX A;  1KF6 B;  2H88 B;  3AE3 B;  2E3T A;  4N58 A;  2H89 B;  1WYG A;  4IDI A;  1TKY A;  1QOF A;  2W55 A;  1QLB B;  1TJE A;  1FM0 D;  1KFY B;  1WXQ A;  3AMZ A;  3NRZ A;  4YTN B;  1NYQ A;  1L5P A;  1NYR A;  1VLB A;  3DWG C;  2WLB A;  1YJI A;  4P6V F;  3HVZ A;  5GXG B;  1QOA A;  1ZOY B;  1XLN A;  2CJO A;  1OQR A;  1FFU A;  1TKE A;  1JQ4 A;  2CJN A;  1OFF A;  1DGJ A;  3AED B;  3AN1 A;  5H92 C;  3FC4 A;  4YXD B;  1QT9 A;  1VJK A;  2WDR B;  2EKI A;  3NS1 A;  1PUT A;  4N6E B;  1N63 A;  3SR6 A;  1QF6 A;  3VRA B;  1ROE A;  1GT8 A;  2K5P A;  3ETR A;  4USA A;  4YTM B;  1GTE A;  4WWM A;  1ZXI A;  3B9J A;  3CF4 A;  2DBY A;  2K9X A;  4YSZ B;  2MH7 A;  1L6U A;  4A9A A;  1NEN B;  5EE3 A;  2G1E A;  2W54 A;  1JRO A;  2Y5C A;  4ZOH C;  3NVY A;  2WS3 B;  1RM6 C;  4JWU C;  3VRB B;  3BII D;  3W9C B;  3AE9 B;  1I7H A;  3VR9 B;  1B9R A;  3AE2 B;  1VDV A;  1CJE A;  5EE1 A;  1E6E B;  2DWQ A;  3AV8 A;  1DOI A;  2ACZ B;  1L0V B;  2Q5W D;  4KX6 B;  2LEK A;  1AWD A;  1RFK A;  2PIA A;  2W3R A;  4JX1 C;  3CIR B;  2WDQ B;  1NVI D;  1UWM A;  3AEE B;  4YT0 B;  1WWT A;  3PO0 A;  2M56 B;  4FXC A;  3WCQ A;  1E0Z A;  3HRD D;  1L6V A;  1RWS A;  2OHF A;  2QIE B;  1JWB D;  3AM9 A;  1V97 A; 
#chains in the Genus database with same CATH topology
 2C60 A;  1L2N A;  3SD5 A;  4XZ4 A;  1C4C A;  4TKN A;  4HK2 A;  5BO4 B;  2KHW B;  3ML9 A;  1J7A A;  3TEX A;  3MC0 B;  3EGR A;  5C2T B;  1OQQ A;  1PFD A;  2LWP A;  3SFD B;  1WZ3 A;  5D94 A;  4HVB A;  4KGR A;  2ONQ A;  3Q8C A;  2IBI B;  2BT6 A;  2RGF A;  1J19 A;  2LGY A;  2WNM A;  2PE9 A;  3V61 A;  1Z2M A;  1WI0 A;  3EUB 2;  3PGE A;  3DBL I;  1SEB D;  1TT5 B;  3A9K A;  4ASW C;  2A5U A;  4LNI A;  1V8C A;  2JXX A;  1N61 A;  4HJG E;  2BS4 B;  2ZZP B;  3AE1 B;  1V80 A;  2RR9 A;  3RFZ B;  1E8Y A;  3KUZ A;  2O6V A;  1KRH A;  2GLS A;  4RFB A;  3QCA A;  3I63 C;  1FCL A;  1LXD A;  1WXS A;  2KOX A;  1NYR A;  1VZ7 A;  1I4P A;  2MP2 B;  3HVD A;  2IJ0 A;  1ZOY B;  2JPH A;  2N7J A;  3Q8E A;  4RCO A;  4EEW A;  4IW0 A;  3FC4 A;  2JT4 B;  2EEL A;  2LRU A;  2WXM A;  3VRA B;  2DYB A;  4A9A A;  2G1E A;  3W9C B;  1WMH B;  3AE2 B;  2YEP B;  2DWQ A;  2ACZ B;  2KVZ A;  1VD2 A;  2D5G A;  2M0A A;  2PW9 A;  2WDQ B;  4C4V A;  4ANW A;  4X57 B;  2OHF A;  1VCB A;  1S1Q B;  2LAS A;  2TSS A;  3DHI C;  3P63 A;  4B9K A;  1V6E A;  4B0M A;  4AWJ A;  4JWS C;  3ZTD A;  3VUX A;  2HJ1 A;  3P4Q B;  1JAL A;  1WH3 A;  5CTR C;  4DHJ B;  5D2M B;  2V4I B;  1WGD A;  2KX3 A;  2DNF A;  1YJJ A;  2M19 A;  3PLU A;  3TBL D;  5HKH A;  2AQ3 B;  4LK0 M;  4IM3 A;  1GTH A;  2WWZ A;  4FHJ A;  3ECI A;  4LTU A;  1YQ4 B;  2L8J A;  1C3T A;  3M95 A;  2V3P A;  2HE7 A;  4EFO A;  1K8R B;  4MGK E;  1ZDX A;  2L1A A;  4ZRI A;  3RD2 A;  2N7D A;  3AE4 B;  4A90 A;  1SB3 C;  4HPP A;  4RF1 A;  3RYT A;  2RDB C;  4E3C A;  2I2Y A;  3HM3 A;  2V1Y A;  4ZYN A;  2FNJ B;  3KQ4 A;  4S0R A;  5GMV A;  3M3J A;  5BMG A;  3N1Z C;  2YVC A;  4ARI A;  3H7P A;  2FE8 A;  5KHQ A;  1QOA A;  3AUL A;  4IG7 B;  5T8I A;  3RNG C;  2GMI C;  4KIK A;  2BB6 A;  1WGH A;  3AED B;  2WXH A;  3HM6 X;  2SAK A;  4JL9 A;  3BVZ A;  3BYT B;  2V9H A;  2BB5 A;  1NEN B;  2ZW0 A;  3I3T B;  3N20 C;  2C7M B;  1WR1 A;  5C1Z A;  2W3R A;  5BYQ A;  3U30 A;  3U4E G;  1WWT A;  2KAN A;  2MBB B;  3U2S C;  1V97 A;  1SF0 A;  4ZRQ A;  1N5W A;  2LVQ A;  1T3Q A;  1NI3 A;  4A55 A;  2QIL A;  1F9J A;  1XT9 B;  4WAF A;  1HZ5 A;  1XLO A;  4M0W B;  3N3K B;  1LQB A;  3V3X A;  3PHX B;  3QQ8 B;  2LXC A;  2Y5P A;  2MRP A;  3NVZ A;  2WYQ A;  4M02 A;  4IUM B;  4HLE A;  2WXR A;  1DOY A;  2L00 B;  1E8W A;  5DPS A;  1M94 A;  3SEB A;  3RNB C;  5IA7 A;  1YMH E;  2IGH A;  1SE3 A;  2J0K A;  2UWQ A;  2QSD A;  3A9J A;  2JWZ A;  1ISN A;  4F8C B;  1XCT L;  1FXA A;  5AZF A;  1BUI C;  1E8X A;  1NBF C;  1DOX A;  1JWA D;  5LLI A;  1GC7 A;  5TR5 A;  1TKY A;  2INP E;  1JWS D;  1KFY B;  1IPG A;  2DAJ A;  2G3Q B;  4YTN B;  1I4X A;  2BWE S;  3UI3 A;  2LVO A;  4WWO A;  1NI2 A;  4QAY A;  1V5O A;  2NS5 A;  4YXD B;  3UIP B;  1EWC A;  2GB1 A;  4N6E B;  4P16 A;  1ET6 A;  2L3Z A;  2KMC A;  2KVR A;  3UIO B;  3ZJU A;  1P0R A;  2R2O A;  2PE6 B;  3PZ8 A;  4HDO A;  3QX1 A;  4PYU A;  1JRO A;  3ZXV A;  3PZ7 A;  4JWU C;  4MEM A;  2QC8 A;  1WGY A;  2LVP A;  1L0V B;  2ZJD A;  2R61 A;  2NBV B;  5DCN A;  2YLM A;  2LUM A;  4GU2 A;  2KC2 A;  4N58 A;  2M4N A;  2MJ3 A;  4S17 A;  2WX1 A;  3K9O B;  3HUI A;  4MT5 A;  1WGK A;  4BBN C;  2CHW A;  2WU2 B;  1ESF A;  3EFC A;  4JPS A;  2XN9 C;  5G55 A;  1WRI A;  1WSP A;  2FCQ A;  3PLV A;  1L4Z B;  4ICU A;  2C7N B;  2KYW A;  3H9D A;  3AE5 B;  2W3S A;  3KVF B;  2A4Z A;  4MGZ E;  3C8Y A;  4DHZ B;  4RGO S;  3WIM A;  3R66 C;  1CZP A;  2OED A;  1WX9 A;  4OZB A;  1HXY D;  2N7E A;  3RPF C;  4IWQ A;  3L16 A;  2JRI B;  2CR5 A;  1YQ3 B;  2O6V D;  5H8Y E;  2BKF A;  1FFV A;  2J7Q B;  2FUH B;  4NPN A;  3R7Q A;  5DPW A;  4AJW A;  2HTM E;  4TMA B;  4JLC A;  2D07 B;  2X8X X;  1GNU A;  1MFW A;  2L52 A;  3Q3M C;  2I1J A;  4HKQ A;  2DZJ A;  1UEL A;  4TQ1 A;  1V2Y A;  2AX5 A;  1JWM D;  2XNA C;  1TZO A;  1C78 A;  3J9C A;  1BT0 A;  4P6V F;  1NYQ A;  1FXT B;  1S3S G;  2O2V A;  1FNW A;  3MJW A;  3Q3N C;  1FNV A;  2KDE B;  3WA0 A;  1TKE A;  1UZX B;  1XQQ A;  2IYD B;  1T0Q C;  2WDR B;  3W2D A;  1N63 A;  3SR6 A;  1QF6 A;  1OQY A;  2K5P A;  5BMH A;  4J6I A;  3WAO A;  3PS6 A;  3ZRC A;  4GDK A;  3IAS 1;  3VRB B;  1Q5W B;  2KFK B;  1CJE A;  4ICV A;  2Q5W D;  1AWD A;  4MM3 B;  1NVI D;  1E5W A;  1PGA A;  4DDG D;  4NY0 A;  1CQV A;  1GAQ B;  4ANX A;  4D2K A;  2MQJ A;  2CKH B;  4RF0 A;  5FK9 C;  2KMM A;  3P2B A;  2PEA A;  4FAD A;  2JYE A;  5J17 A;  4BOS C;  2BYV E;  4TV3 A;  1FXI A;  3VR8 B;  1XO3 A;  4ACF A;  2KTF A;  5E6O A;  1F1H A;  2JVC A;  4HEA 1;  4TUU A;  1E7V A;  3WAL A;  2JSV X;  2ZW1 A;  2I38 A;  2MJE A;  3MC8 A;  3PT2 B;  1JRP A;  1J7B A;  3OG5 A;  4YWG G;  2KDF B;  3CMM B;  1JML A;  1T0S C;  3JSV A;  1T5X D;  3QAQ A;  2EKE C;  3GZN B;  2WDV B;  1P7F A;  2DX5 B;  3DOW A;  2QHO A;  1SSN A;  1TTN A;  4XWW A;  2ON8 A;  3PV1 A;  1JW9 D;  1EU3 A;  2KT7 A;  1QZE A;  3ZYY X;  1ENF A;  4NZL B;  2JQR B;  3RN9 C;  1UWX A;  5D7G A;  4OHJ A;  1WXV A;  1L4D B;  3DHG C;  5JHA A;  2HTH A;  4REZ A;  3FIL A;  3UF8 A;  2DZM A;  2G9H D;  2Z0E B;  3IHP C;  1FM0 D;  1WXQ A;  3QIJ A;  4KZ0 A;  3ZNZ B;  5J18 A;  2WX0 A;  2KDI A;  2K1F A;  4LNK A;  2Z0D B;  1VZ6 A;  2DZK A;  4L23 A;  3AN1 A;  4DK5 A;  3ZQ4 A;  5D3I B;  3DBH B;  3ZNG C;  1I4R A;  3B9J A;  4BFR A;  4WIP A;  1D5X C;  2W54 A;  3TEW A;  1SIF A;  2J42 A;  1HEZ E;  3AE9 B;  1EF5 A;  3TL5 A;  1B9R A;  2CU1 A;  1IBX B;  1C1Y B;  4LJO B;  4W9F A;  4B95 A;  2BYF A;  5I4D A;  3H7S A;  2D11 A;  4YT0 B;  2FCN A;  3WCQ A;  2ZCC A;  3LJ3 A;  4HRS A;  4ZDV A;  3TJP A;  2Z59 B;  2IY1 B;  4GIV A;  2J52 A;  3O13 A;  1V9J A;  4LDT B;  2IGD A;  2GOW A;  2LJ5 A;  2KAC A;  4YSY B;  3BIN A;  3AE6 B;  3VFK A;  2CHZ A;  1TY2 A;  1OTR B;  1V1P A;  1QQR A;  4ZYS A;  3IAM 1;  4ITK A;  3TIX A;  4A3P A;  4DXA B;  1D3Z A;  1C79 A;  1SE2 A;  4EE2 A;  3QAR A;  2EMS A;  3Q3J A;  2JU6 X;  1QOB A;  2PKO A;  2VZK B;  1GOZ A;  1ZP0 B;  3L10 B;  3K9P B;  2WHI A;  1XF5 L;  3EFU A;  3AXC A;  3P4R B;  3AH7 A;  1RYJ A;  3MTN B;  4AOF A;  3TEZ A;  2MP2 A;  5AUI A;  3DVG Y;  1BXT A;  3O65 B;  1H4R A;  1UBI A;  2MX2 A;  3QJZ A;  3IG3 A;  1MPE A;  3DWG C;  4W9D A;  1IP9 A;  2V0G A;  1E7U A;  1H8C A;  2FIF A;  2CJO A;  3RI7 C;  2WXK A;  1WFY A;  1WMH A;  4E74 A;  4AUQ C;  2PMV A;  1BML C;  3PSE B;  2RSU A;  3ZLZ A;  2BKR B;  3BY4 B;  1WGR A;  3BK1 A;  1D5M C;  1M4V A;  3NVY A;  3RUL A;  1RM6 C;  3VQI A;  3HHM A;  3CSF A;  3ZDT A;  3QWZ B;  1SXT A;  3SDL C;  3TCA A;  3TSS A;  5HFY A;  2LI5 A;  2IO0 B;  2MLB A;  3AM9 A;  1RLF A;  3ZVV A;  3V6E B;  2G4S A;  1HE8 A;  3GS2 A;  1YOV B;  5LXI B;  2OJR A;  1PGX A;  4CHK A;  1MHH E;  4L1B A;  4BOZ B;  2IPK D;  3AEG B;  1E10 A;  1FRR A;  2HDE A;  1EWY C;  2KLC A;  1KJT A;  4XDC A;  1I4G A;  3AEC B;  2VH1 A;  1V81 A;  3KWL A;  3MHZ A;  1E7P B;  1WE6 A;  4ZHO A;  2LGX A;  1FCC C;  3KYD D;  1FRD A;  4HRO A;  4RMA A;  4KV2 A;  1WIA A;  4I6P A;  4IWP A;  3IVF A;  4URK A;  1WRD B;  4O1N A;  4N59 A;  5C3J B;  1OEY A;  3APF A;  2L83 A;  2FBW B;  1EF1 A;  4M01 A;  3NOB A;  2GBM A;  4KKI A;  2KZR A;  2BW2 A;  3L4P A;  4TSS A;  2WXQ A;  1NEK B;  3BYY B;  3DVG X;  1KF6 B;  2H88 B;  2DAF A;  2ZEQ A;  3A1Q B;  3N30 A;  3ZXR A;  2NTT A;  5D6J B;  5IOI A;  1LFD A;  1MG4 A;  4NNJ B;  1FFU A;  4KZC A;  1DGJ A;  1TY0 A;  3T9L A;  1VJK A;  2BF8 B;  3GZN I;  3ZJT A;  1ZPS A;  3RMK C;  3VH4 B;  3B08 A;  1ZW7 A;  1KM7 A;  5JZE B;  2GI9 A;  1V5T A;  3UQB A;  2N9E B;  1OEY J;  3Q8A A;  3OLM D;  4KSK C;  2C5L C;  2WS3 B;  3LYY A;  3GE3 C;  3QC8 B;  1WXA A;  3HIZ A;  3PTF C;  3ZUN A;  3NY5 A;  4RM9 A;  1UWM A;  3PRZ A;  4XE0 A;  4M0W A;  3PO0 A;  4HKZ E;  1L6V A;  1F52 A;  2ZNV B;  2JF5 A;  2N9L A;  1GB1 A;  3W1S C;  3NZU A;  4A8X C;  2BS3 B;  3B1L X;  2WDT B;  2UU7 A;  2I1K A;  4C80 A;  1RRB A;  2DZI A;  4FJY A;  1LGR A;  1U4A A;  4W9L A;  4OZA A;  3W5U B;  2HJ8 A;  3KUD B;  4EZL A;  1YQB A;  3AB5 A;  5IO9 A;  1NDD A;  1P9D U;  3I9V 1;  2N9K A;  3DBH I;  3RZF A;  1V1O A;  2MBQ A;  5FKA C;  1Q10 A;  4JIO U;  3IXS A;  4NJC A;  2CS4 A;  3KH0 A;  1WGG A;  3CWI A;  4MH8 A;  4RNA A;  3APC A;  1AW7 A;  5G5G A;  1R4M B;  1ZDV A;  1C4P A;  3OJ3 A;  3RCZ A;  5CHW A;  5JHB A;  2WXL A;  3ZW3 A;  1JWU D;  3L08 A;  3I57 A;  1SE4 A;  4W9E A;  1PGB A;  3M62 B;  3AEF B;  3H7P B;  2KN4 A;  4HJK A;  3NHE B;  1GUA B;  4ANV A;  1K52 A;  1P98 A;  2K0P A;  1L5P A;  2JY6 A;  2FCM A;  3HVZ A;  3MJ5 A;  1XLN A;  4GOC A;  2NBU A;  2B3A A;  2AQ1 B;  2PPH A;  4H2A A;  4KDI C;  1T0Y A;  2DYM A;  1QT9 A;  3PVL A;  2JWU A;  3DHH C;  2GBN A;  1ROE A;  2KWD A;  3ZTC A;  4USA A;  1WF9 A;  3IFW B;  1ZXI A;  4IM0 A;  3T8M A;  4YSZ B;  5EE3 A;  1MHX A;  1TS5 A;  2Y5C A;  2JZ3 B;  5L95 C;  2LGI A;  2OJW A;  3TEY A;  3AI5 A;  1VRA B;  2BYE A;  3Q69 A;  1Y8R C;  4MJS B;  1E6E B;  4XX5 A;  2XK5 B;  3Q3F A;  3ZIM A;  2IO2 B;  4KVG B;  3DBS A;  3ZGZ A;  1XEE A;  2J0M A;  1L0X B;  3P42 A;  4ZHP A;  4OW0 A;  2J53 A;  1WXM A;  2GBR A;  1N60 A;  1FO4 A;  1P1A A;  2KQ7 A;  4A20 A;  1GJZ A;  2MJD A;  5AEK B;  2WXJ A;  4WJO A;  3SHQ A;  3VTV A;  2BWF A;  4MGI E;  3V60 A;  2KK8 A;  2DEN B;  3P1M A;  3U7D A;  2D2Q A;  2HD5 B;  4B0E A;  3IBE A;  5AZH A;  1KOT A;  3RNE C;  2KMA A;  2G4D B;  3A9J B;  3A33 B;  4F7Z A;  2NPT B;  4DXF A;  3ALB A;  3U52 E;  3OJ4 B;  2N0S B;  1UD7 A;  4YSX B;  1FMA D;  4PYZ A;  2AWT A;  1J8C A;  3JW0 X;  1K53 A;  3Q14 C;  3WAN A;  1HTQ A;  2GRI A;  3LB8 C;  3M63 B;  1R7S A;  1A70 A;  1WJ4 A;  4J3O D;  4A6Q A;  2E3T A;  2INN E;  3KLS X;  5CX3 A;  1D4B A;  2VH2 A;  5E6P A;  2LFI A;  2KDM A;  2IZV B;  4FHK A;  4ANU A;  2KX0 A;  1E8Z A;  2KFK A;  4OZC A;  5IN7 A;  2QEJ C;  2JZZ A;  2KQ4 X;  4RGN A;  3CST A;  4MM3 A;  1UF0 A;  1WM3 A;  4XYC A;  1LO5 D;  3CF4 A;  4P7I A;  1I4Q A;  1HTO A;  3C0R B;  5CHF A;  3H1U A;  4W9H A;  4CYE A;  4MGY E;  4N9F 4;  3D32 A;  1ET9 A;  3AEE B;  2EMT A;  4LJP B;  1RFA A;  2L7R A;  2N9X A;  3MP9 A;  2PVG C;  3N9Y C;  1L0Y B;  2KAJ A;  2WXN A;  2ZVN A;  1LM8 B;  4W9J A;  4ARC A;  5TSS A;  2B76 B;  4GMV A;  2BTE A;  3VAW A;  4GXB A;  3VVW B;  3UQA A;  1YNT E;  5L83 A;  3B0A A;  4RH6 A;  3VUY A;  4YTP B;  3AU5 A;  2E6X A;  5G5H A;  1YIW A;  1MJD A;  2M17 A;  4US9 A;  3NS8 A;  2IND C;  1XLP A;  2J0J A;  2NBW B;  4RGT A;  3ML8 A;  2LGD A;  2D3B A;  2QCZ A;  3TUO A;  4WUR A;  4FJV B;  3URY A;  2BGF A;  3ZO5 B;  1C4A A;  2L32 A;  1RAX A;  2JXT A;  3R2I A;  1YN3 A;  2NVU I;  1FIQ A;  2Y3A A;  2RDG A;  1YJ1 A;  2LZ6 A;  3NZ3 A;  4IOI E;  3BZD B;  4MAC A;  4FN2 A;  5LXH A;  2W55 A;  3NJT A;  2AQ2 B;  1WY8 A;  2M8S A;  5CHV C;  2KWC A;  1C77 A;  1R4N B;  4OVU A;  1JQ4 A;  2RD0 A;  2MBO A;  1K51 A;  2LHD A;  5BMI A;  2V3N A;  4BKT A;  3DPD A;  4YTM B;  1J0G A;  2K9X A;  1KLV A;  1UGJ A;  2OOB B;  1R4M I;  3BVM A;  2MBE A;  3MHS D;  3RNA C;  2M0X A;  2ZVO A;  4LNO A;  4G11 A;  1X1M A;  1GC6 A;  4HXD A;  1G6J A;  1N6Z A;  3Q3O C;  2XBB C;  1E0Z A;  3V62 A;  2MHJ A;  2KJ6 A;  2KTR B;  1JWB D;  5FR3 A;  3GP7 A;  1IUE A;  4DQO C;  1TS2 A;  1EUV B;  4WAA A;  4GDL B;  3DCG A;  2MCN B;  4CO7 A;  2LD9 A;  1GG3 A;  5LNK 1;  1YN5 A;  4HWI B;  4XGA B;  3W5V B;  2ZCB A;  2AL6 A;  1UBQ A;  1CMX B;  2KO3 A;  2BQQ A;  2FCS A;  4RGM A;  3VTU A;  3LXF A;  2N1W A;  4ZRK A;  4IKG A;  2K3U A;  3P4S B;  4RM8 A;  4BKS A;  2X38 A;  5IP4 D;  3A4R A;  3WAM A;  4P1C C;  3BVG A;  2N9P C;  3PRM B;  5MPO A;  4US8 A;  4K7W A;  4C7Y A;  3TMP B;  2FAZ A;  4NAW B;  4F1S A;  3PZD A;  3FIL B;  4K7S A;  3RUI B;  1N62 A;  4AS1 A;  4IM2 A;  1KLU D;  4AQ7 A;  2AL3 A;  4KGT A;  2PLP A;  4PS3 A;  2LXA A;  4ZRJ A;  4KDL B;  1JRU A;  1WM2 A;  4IC7 B;  2XEW A;  2D3A A;  2NR2 A;  1VLB A;  1YJI A;  2NTS A;  3X23 A;  2ASQ A;  2K39 A;  1GT8 A;  4G3X B;  4M00 A;  1YX6 B;  3Q8F A;  3VH3 B;  3UGB B;  2L0T A;  3VR9 B;  1SBB B;  1F2R I;  1ZKH A;  2D10 A;  4HPL B;  2M56 B;  3HK0 A;  1EO6 A;  2MEK A;  3HRD D;  4BBN F;  4E71 A;  2Z8L A;  1XCQ L;  4B6W A;  1V1P B;  4Q2J A;  1GPX A;  1TIF A;  1AAR A;  2L0F A;  2WGS A;  3E9S A;  5BYS A;  3DVN U;  3Q8B A;  1UGM A;  4GLS C;  3UIN B;  3DBR B;  2C9W B;  5BYR A;  3H6N A;  4WQM A;  1QOG A;  1TZ1 A;  2INC C;  2RMM A;  2V3S A;  2LJI A;  2WXG A;  2QJL A;  5J2R A;  1WE7 A;  1WJN A;  3C19 A;  4G50 A;  1ZGU B;  2G45 B;  1EU4 A;  1F0Z A;  3A1Q A;  4C00 A;  1C76 A;  3ONS A;  2CU3 A;  3GOE A;  1V49 A;  1VZ8 A;  4MH0 E;  2IDY A;  4MSQ B;  1TKG A;  1KLG D;  1WJ6 A;  3A9K B;  4LNN A;  2BPS A;  1MG8 A;  3V05 A;  1IYF A;  4BKG A;  5DPR A;  2WLB A;  1OQR A;  4WWP A;  1HQR D;  1PYW D;  1WYW B;  2O6V B;  1EM7 A;  2M1M A;  2PTL A;  3ETR A;  2CHX A;  2FUG 1;  2KWU B;  4MSM B;  2DHZ A;  4II2 B;  3BK2 A;  1XD3 B;  2IY0 B;  3JVZ X;  1UUP A;  2K8C A;  3W1S A;  1D5Z C;  1KH0 A;  1E90 A;  3ZDM C;  4EZJ A;  3WAP A;  2W9N A;  4BVU C;  3NVV A;  3N32 A;  4GB9 A;  2LUE A;  2MW5 A;  3DDC B;  4C4V B;  2PVO D;  1HZ6 A;  4W9C A;  3QHT A;  1R4N I;  2ZNV C;  4PS7 A;  3RT3 B;  3RNC C;  2JZP A;  3ABV B;  1YN4 A;  4M8N A;  1TS4 A;  3L0W B;  1MI0 A;  1H7W A;  4EZK A;  3Q6B A;  1ACC A;  4W9K A;  3AU4 A;  3AEA B;  2GBJ A;  4K3C A;  1PDX A;  4R3D A;  3IT6 B;  2WQY B;  3Q2A C;  1TS3 A;  3VXW A;  3EC8 A;  2JX5 A;  4OVZ A;  4HPM B;  5JH5 C;  4PT5 A;  4WWN A;  4KSL C;  4W9G A;  5EE0 A;  1FPY A;  2J4X A;  4XC2 A;  1FNU A;  2RPQ A;  1KTK A;  3NRZ A;  2ZPN A;  4K7U A;  3N1Y C;  4LDT D;  5KHO A;  1HA5 A;  1IGC A;  5GXG B;  4XDD A;  1AN8 A;  1DYQ A;  2KKC A;  2WXP A;  4EUT A;  4MJS A;  4AP4 C;  2XK5 A;  5D3D A;  5E6N A;  4WWM A;  3L17 A;  1L6U A;  1MVK A;  2N4F A;  3GB1 A;  4NQK E;  4KIK B;  1CK1 A;  1I7H A;  4XWT A;  1I4H A;  4OVV A;  2IO3 B;  1WR6 E;  5JXV A;  3CIR B;  2D3C A;  2VZK D;  2REX A;  1RWS A;  2NCN A;  3PRE A;  4ZOH C;  1SE9 A;  2SEB D;  4LNF A;  1WX8 A;  4BKS D;  4GN1 A;  3B2G A;  3VHT C;  3QA8 A;  4K81 A;  2L76 A;  5IKC M;  1UH6 A;  3AE8 B;  3AE7 B;  3SFE B;  4W9I A;  4TQ0 A;  2NPT A;  2IO1 B;  4K3B A;  2GBK A;  2K8B A;  4FLH A;  2KDB A;  2WU5 B;  2PJH A;  1A5R A;  3DWM A;  3X0W A;  3L13 A;  3VTW A;  4EKU A;  4DBG A;  3NVW A;  4GSW A;  4DHZ E;  1YD8 U;  3N1X C;  2L05 A;  1L7Y A;  4AJY B;  1SJE D;  2BVC A;  2FID A;  3NUH B;  1WJU A;  4EOY A;  2LRW A;  5AZG A;  3NG0 A;  1WZ0 A;  3AE3 B;  1Q0W B;  2KJR A;  2H89 B;  2C7H A;  4II3 B;  4JGH B;  1ZXH A;  4IDI A;  2QDF A;  4MDK E;  3AMZ A;  1F2R C;  1XXG A;  3R3M A;  4WJN A;  2LGS A;  2KWV B;  2DLB A;  2KJH B;  3U8Z A;  3DBR I;  4FA6 A;  4WH4 A;  2W82 A;  1PQS A;  5H92 C;  4YL8 A;  3NS1 A;  3L54 A;  1P3Q U;  1PUT A;  2RPV A;  3QK0 A;  3NZS A;  4BZA A;  1Z5S B;  3ZNI D;  2MH7 A;  4JE3 B;  2WXI A;  2WXO A;  3KW5 B;  4NAM A;  3ZJV A;  1VDV A;  3A4S C;  1TGZ B;  4NJ7 A;  5EE1 A;  4WJQ A;  3W1Y A;  1RFK A;  3DBL B;  4LCD E;  4P1B C;  1GB4 A;  2AEH A;  2QIE B;  2YEP F;  4DHJ D;  3FAH A;  4NJ6 A;  1TBE A;  2NMQ A;  3V6C B;  1P7E A;  3H8H A;  1TYG B;  2K25 A;  1SIJ A;  3S2A A;  4BAX A;  3GE8 C;  3OAW A;  5HG2 A;  4HCP B;  4PK1 A;  3R7R A;  1WX7 A;  1J7C A;  2KFJ A;  2IGG A;  1VR9 A;  2BS2 B;  4GGQ A;  1SJH D;  3T3O A;  1ZE3 D;  2LMC A;  2MBH A;  4WQO B;  4KKJ A;  3SU8 X;  3E56 A;  1UNS A;  4PS8 A;  3P4P B;  5AUK A;  2KNB A;  3CF6 E;  1C9F A;  1H7X A;  3KUC B;  2K8H A;  1Y56 A;  3OWE B;  3RZW C;  4A3O A;  1QIL A;  4C7Z A;  4I6L B;  3ZRF A;  3U7Z A;  2D3G A;  2KC1 A;  2DYO A;  4FUL A;  2K6D B;  1STE A;  1T0R C;  2VRR B;  1QOF A;  1TJE A;  3FKY A;  1OGW A;  3ENE A;  2N1V A;  1K50 A;  2CJN A;  3ZKJ C;  2MSE D;  2EKI A;  2ZPY A;  3DVN V;  4FBJ B;  2MA9 B;  4IWO A;  2O2V B;  2DBY A;  2KTR A;  3BWU D;  1IGD A;  3R8B A;  3I5J C;  5EDS A;  4LLG M;  2QMT A;  3BII D;  2K6Q A;  4NQL B;  4GDL A;  2LHE A;  1DOI A;  2KN5 A;  4JX1 C;  2MWS B;  4FXC A;  4UDU C;  2KXJ A;  1D6E C;  1F77 A;  1IBX A;  2KLG A;  4GDK B;  3EA6 A;  4ZRP A;  5G2N A;  1B1Z A;  3VUW A;  5C23 A;  1ZUD 2;  3RNF C;  1XLQ A;  3EHV A;  1YX5 B;  1N5X A;  2K22 A;  4JQW C;  1I42 A;  3AEB B;  1E9M A;  5EE9 A;  3JYU A;  5FR6 A;  4NAW A;  3B2F A;  5E6J A;  2UYZ B;  2Y5B B;  4MEL A;  3MFG A;  2AYO B;  3R2T A;  2WP9 B;  4HDQ A;  2JUO A;  3JSV B;  2KD0 A;  2BBC A;  3EEC A;  3DQV A;  3KWV A;  5HI1 A;  2BYT A;  4DDI D;  4L2Y A;  1AYF A;  1I35 A;  3VDZ A;  1WYG A;  1QKZ A;  3PPA A;  1SGH A;  1QLB B;  5HHD G;  4G0N B;  2RDH A;  2V4L A;  2JYT A;  3ZNH B;  4K1R B;  1FEH A;  4C56 C;  1OFF A;  2WXF A;  3LDZ E;  3T3N A;  3PRP B;  1JCK B;  5IAA C;  3PHW B;  1GTE A;  2JRH A;  4KGS A;  4CQN A;  4I6N B;  3APD A;  3KYC D;  2R2Q A;  4HCN B;  2ICI A;  4M8M A;  1FD6 A;  1Q1O A;  1T6B X;  3AV8 A;  3IT4 B;  4FJZ A;  4KX6 B;  2LEK A;  2PIA A;  4DXG A;  4DWF A;  4WJP A;  3MC9 A;  1V86 A;  2KQS A;  5DPT A; 
#chains in the Genus database with same CATH homology
 1XEE A;  1CQV A;  1GAQ B;  4D2K A;  1L0X B;  4RF0 A;  3P42 A;  5FK9 C;  4ZHP A;  4OW0 A;  2J53 A;  3NVV A;  2KMM A;  1C4C A;  1N60 A;  1FO4 A;  2JYE A;  2PVO D;  1HZ6 A;  2MJD A;  1FXI A;  3VR8 B;  1XO3 A;  2WXJ A;  1J7A A;  3TEX A;  4HEA 1;  3MC0 B;  3EGR A;  2JZP A;  3ABV B;  5C2T B;  1YN4 A;  1OQQ A;  2JSV X;  1PFD A;  2ZW1 A;  2I38 A;  2MJE A;  3SFD B;  3P1M A;  1JRP A;  1J7B A;  1TS4 A;  4KGR A;  4YWG G;  2ONQ A;  4B0E A;  1MI0 A;  1JML A;  3Q8C A;  1H7W A;  2BT6 A;  1T5X D;  2WNM A;  2WDV B;  1P7F A;  1ACC A;  1SSN A;  3AEA B;  3EUB 2;  4XWW A;  2ON8 A;  4DXF A;  1SEB D;  1JW9 D;  3U52 E;  2N0S B;  1EU3 A;  1PDX A;  4YSX B;  1FMA D;  4R3D A;  1V8C A;  2WQY B;  3IT6 B;  3ZYY X;  1N61 A;  4HJG E;  2BS4 B;  1ENF A;  1TS3 A;  2JQR B;  4NZL B;  3AE1 B;  3RFZ B;  2JX5 A;  1UWX A;  4OVZ A;  5D7G A;  1K53 A;  4OHJ A;  1L4D B;  2GRI A;  3LB8 C;  4PT5 A;  4REZ A;  1R7S A;  1A70 A;  5EE0 A;  1KRH A;  2J4X A;  3FIL A;  4J3O D;  2E3T A;  4RFB A;  2INN E;  3KLS X;  4A6Q A;  1FCL A;  2G9H D;  1D4B A;  1FNU A;  1FM0 D;  1KTK A;  1WXQ A;  3NRZ A;  1NYR A;  1VZ7 A;  1I4P A;  1HA5 A;  2LFI A;  2KDM A;  3HVD A;  1IGC A;  2IJ0 A;  5GXG B;  4XDD A;  1ZOY B;  1AN8 A;  1DYQ A;  1VZ6 A;  2N7J A;  2WXP A;  3Q8E A;  4L23 A;  4RCO A;  3AN1 A;  4OZC A;  2QEJ C;  3FC4 A;  3ZQ4 A;  2KQ4 X;  4RGN A;  5D3I B;  2EEL A;  5D3D A;  2WXM A;  3VRA B;  1I4R A;  4WWM A;  1LO5 D;  3B9J A;  3CF4 A;  1I4Q A;  1L6U A;  1MVK A;  4A9A A;  3GB1 A;  4WIP A;  1D5X C;  2G1E A;  2W54 A;  3TEW A;  3W9C B;  2J42 A;  1HEZ E;  3AE9 B;  1CK1 A;  1I7H A;  4XWT A;  1B9R A;  1I4H A;  3AE2 B;  2YEP B;  1IBX B;  2DWQ A;  2ACZ B;  2D5G A;  2M0A A;  5I4D A;  5JXV A;  3CIR B;  2WDQ B;  1ET9 A;  2PW9 A;  3AEE B;  4YT0 B;  3WCQ A;  2VZK D;  1RWS A;  2OHF A;  3MP9 A;  4ZOH C;  4HRS A;  2TSS A;  3P63 A;  2PVG C;  2SEB D;  3N9Y C;  2J52 A;  1L0Y B;  2KAJ A;  3O13 A;  2WXN A;  4B0M A;  2IGD A;  3B2G A;  2KAC A;  4ARC A;  4YSY B;  5TSS A;  2B76 B;  3AE6 B;  4JWS C;  2BTE A;  1TY2 A;  3P4Q B;  1JAL A;  1V1P A;  1QQR A;  4ZYS A;  3IAM 1;  3AE8 B;  1YNT E;  4ITK A;  3AE7 B;  3SFE B;  4RH6 A;  4TQ0 A;  4YTP B;  2V4I B;  2E6X A;  5G5H A;  2M19 A;  1YJJ A;  2AQ3 B;  4US9 A;  4LK0 M;  1C79 A;  1SE2 A;  4EE2 A;  1GTH A;  4LTU A;  1YQ4 B;  2WU5 B;  1XLP A;  2V3P A;  2JU6 X;  1QOB A;  3DWM A;  2PKO A;  4RGT A;  2VZK B;  1GOZ A;  1ZP0 B;  1XF5 L;  3TUO A;  1ZDX A;  3NVW A;  4WUR A;  3URY A;  2L1A A;  3P4R B;  1C4A A;  2L32 A;  3AH7 A;  3AE4 B;  2JXT A;  1RYJ A;  3R2I A;  3TEZ A;  4A90 A;  1SB3 C;  4RF1 A;  1SJE D;  1YN3 A;  1FIQ A;  2I2Y A;  2Y3A A;  2RDG A;  5AUI A;  3NUH B;  4IOI E;  3NZ3 A;  3BZD B;  4MAC A;  1BXT A;  3AE3 B;  2H89 B;  3KQ4 A;  1ZXH A;  4IDI A;  2W55 A;  5BMG A;  3AMZ A;  4ARI A;  1MPE A;  3DWG C;  2AQ2 B;  1F2R C;  1XXG A;  2V0G A;  2FE8 A;  1QOA A;  2DLB A;  2CJO A;  1C77 A;  1JQ4 A;  5T8I A;  2WXK A;  1K51 A;  2BB6 A;  4WH4 A;  3AED B;  2W82 A;  2WXH A;  5H92 C;  2PMV A;  2LHD A;  2SAK A;  2V3N A;  5BMI A;  1BML C;  3NS1 A;  1PUT A;  2RPV A;  3BVZ A;  3BYT B;  4YTM B;  2BB5 A;  2K9X A;  2MH7 A;  4JE3 B;  2WXI A;  1UGJ A;  1NEN B;  2WXO A;  3BK1 A;  1D5M C;  3BVM A;  2ZW0 A;  1M4V A;  3NVY A;  4NAM A;  1RM6 C;  3VQI A;  3ZJV A;  1VDV A;  5EE1 A;  1SXT A;  2W3R A;  5BYQ A;  3TSS A;  1RFK A;  5HFY A;  3U4E G;  1WWT A;  1E0Z A;  1GB4 A;  2QIE B;  1JWB D;  3AM9 A;  1V97 A;  2YEP F;  3U2S C;  5FR3 A;  3GP7 A;  1IUE A;  1SF0 A;  4DQO C;  4ZRQ A;  1TS2 A;  3FAH A;  3GS2 A;  2NMQ A;  1N5W A;  1T3Q A;  1NI3 A;  4GDL B;  4A55 A;  1P7E A;  2QIL A;  3H8H A;  1TYG B;  1SIJ A;  1HZ5 A;  1XLO A;  4WAF A;  1PGX A;  1MHH E;  5LNK 1;  1YN5 A;  4L1B A;  2IPK D;  3AEG B;  1E10 A;  3V3X A;  3W5V B;  1FRR A;  5HG2 A;  2HDE A;  1EWY C;  2Y5P A;  3NVZ A;  4XDC A;  1J7C A;  1I4G A;  3AEC B;  2IGG A;  4RGM A;  3LXF A;  1VR9 A;  3KWL A;  3MHZ A;  1E7P B;  2BS2 B;  2WXR A;  1SJH D;  4IKG A;  3T3O A;  4ZHO A;  4HRO A;  1FCC C;  1ZE3 D;  1FRD A;  2LMC A;  1DOY A;  2K3U A;  3P4S B;  2X38 A;  4KKJ A;  3E56 A;  3BVG A;  1UNS A;  3P4P B;  4O1N A;  5AUK A;  4N59 A;  5C3J B;  4US8 A;  5MPO A;  1C9F A;  3SEB A;  4C7Y A;  1H7X A;  1YMH E;  2IGH A;  1SE3 A;  4NAW B;  2L83 A;  2FBW B;  1Y56 A;  3FIL B;  2QSD A;  3OWE B;  4KKI A;  1N62 A;  4AS1 A;  1QIL A;  4C7Z A;  1KLU D;  4AQ7 A;  2BW2 A;  1XCT L;  1FXA A;  4KGT A;  1BUI C;  2PLP A;  3L4P A;  4TSS A;  3U7Z A;  2WXQ A;  2DYO A;  1NEK B;  3BYY B;  1DOX A;  1JWA D;  1STE A;  1KF6 B;  2H88 B;  1TKY A;  2INP E;  1QOF A;  1TJE A;  1JWS D;  1KFY B;  2NTT A;  4YTN B;  1VLB A;  1YJI A;  1I4X A;  3UI3 A;  2NTS A;  1FFU A;  1K50 A;  2CJN A;  1DGJ A;  1TY0 A;  4YXD B;  1VJK A;  2EKI A;  1EWC A;  2GB1 A;  4N6E B;  4P16 A;  3ZJT A;  1ET6 A;  1GT8 A;  1ZPS A;  3ZJU A;  2DBY A;  3PZ8 A;  3Q8F A;  3BWU D;  2GI9 A;  1IGD A;  3R8B A;  1JRO A;  3Q8A A;  4LLG M;  2QMT A;  2WS3 B;  3PZ7 A;  4JWU C;  3LYY A;  3BII D;  3VR9 B;  2LHE A;  1DOI A;  1SBB B;  1L0V B;  2R61 A;  1F2R I;  4JX1 C;  1UWM A;  4XE0 A;  4FXC A;  4UDU C;  4M0W A;  3PO0 A;  1D6E C;  2M56 B;  2MEK A;  3HRD D;  1L6V A;  4HKZ E;  2LUM A;  2Z8L A;  2N9L A;  4N58 A;  1F77 A;  2MJ3 A;  1IBX A;  1GB1 A;  4GDK B;  1XCQ L;  3HUI A;  4A8X C;  4MT5 A;  1WGK A;  2BS3 B;  3EA6 A;  4ZRP A;  2WU2 B;  1V1P B;  1B1Z A;  1ESF A;  4Q2J A;  4JPS A;  2XN9 C;  1GPX A;  4C80 A;  1WRI A;  1WSP A;  1ZUD 2;  3E9S A;  1L4Z B;  4OZA A;  3W5U B;  5BYS A;  1XLQ A;  3Q8B A;  3AB5 A;  3AE5 B;  4GLS C;  2W3S A;  3C8Y A;  3I9V 1;  1N5X A;  2N9K A;  4RGO S;  2K22 A;  1CZP A;  2OED A;  4OZB A;  1V1O A;  1HXY D;  3AEB B;  1E9M A;  5BYR A;  5FKA C;  3RPF C;  1Q10 A;  5EE9 A;  4WQM A;  3B2F A;  1QOG A;  5E6J A;  1YQ3 B;  3IXS A;  2RMM A;  4NJC A;  2LJI A;  5H8Y E;  2WXG A;  2QJL A;  3CWI A;  1FFV A;  4MH8 A;  4RNA A;  3MFG A;  2HTM E;  1AW7 A;  5G5G A;  3R2T A;  1ZDV A;  4TMA B;  1C4P A;  2WP9 B;  1EU4 A;  1F0Z A;  2L52 A;  1C76 A;  2BBC A;  2CU3 A;  4HKQ A;  2WXL A;  1JWU D;  1VZ8 A;  5HI1 A;  3KWV A;  2IDY A;  2BYT A;  3I57 A;  1SE4 A;  4L2Y A;  4TQ1 A;  1PGB A;  2AX5 A;  1TKG A;  3AEF B;  1AYF A;  1KLG D;  2KN4 A;  1JWM D;  2XNA C;  1WYG A;  1QKZ A;  1TZO A;  1C78 A;  1QLB B;  3J9C A;  3V05 A;  5HHD G;  1K52 A;  2K0P A;  2RDH A;  1NYQ A;  1L5P A;  4P6V F;  2JYT A;  2WLB A;  1FNW A;  3HVZ A;  3MJ5 A;  1FNV A;  1XLN A;  1OQR A;  1TKE A;  2AQ1 B;  1HQR D;  1FEH A;  1PYW D;  4C56 C;  4H2A A;  1OFF A;  2DYM A;  1QT9 A;  2WXF A;  3T3N A;  2WDR B;  3W2D A;  1JCK B;  1EM7 A;  1N63 A;  2PTL A;  2JWU A;  3SR6 A;  1QF6 A;  2KWD A;  1ROE A;  2K5P A;  3ETR A;  4USA A;  1GTE A;  5BMH A;  1ZXI A;  4KGS A;  4CQN A;  2FUG 1;  4YSZ B;  5EE3 A;  1MHX A;  2ICI A;  1TS5 A;  2Y5C A;  1FD6 A;  3IAS 1;  2LGI A;  3VRB B;  3TEY A;  1VRA B;  3BK2 A;  3Q69 A;  1CJE A;  1E6E B;  1T6B X;  3AV8 A;  3IT4 B;  2Q5W D;  4KX6 B;  2LEK A;  1AWD A;  1UUP A;  2PIA A;  4MM3 B;  4DXG A;  1NVI D;  3W1S A;  1D5Z C;  1KH0 A;  1PGA A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...