2REXA

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
molecule keywords Plexin-B1
total genus 28
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rexA00
2WX0A 4HXDA 1CMXB 3KUDB 3PLUA 2FAZA 1WMHA 4FA6A 2XBBC 4PYZA 2KJRA 4WJQA 3RZWC 4WQOB 3KUCB 3DCGA 4DHJD 4W9GA 3TL5A 3PRZA 2KK8A 4TKNA 2EMTA 3APDA 5C1ZA 2LXCA 3DVGY 3RZFA 3N30A 2KFKA 2J0MA 4I6NB 1KM7A 2OJRA 2JT4B 2GBJA 2KDBA 4ICVA 3UQAA 5L95C 2RSUA 3VTUA 3I3TB 4IC7B 1WJUA 4KZCA 2D10A 2QHOA 3L0WB 4BOSC 4TQ1A 2I1JA 3U8ZA 2UYZB 2LRUA 3C0RB 3R3MA 1IP9A 3PTFC 2EMSA 2PE9A 1WGHA 4HK2A 4OVVA 2ZPNA 3DBRI 3KYDD 4NQLB 2K8BA 3CF6E 4FN2A 4KV2A 2FCSA 1L2NA 3DVNU 4AWJA 4W9LA 1WE6A 3PHXB 3UGBB 2JWZA 2K6QA 1E90A 3PREA 2O6VA 2KX3A 4LJPB 1HE8A 4AOFA 2KD0A 2L05A 3AU5A 1EO6A 4BBNF 1I42A 4M0WB 4FJVB 3ECIA 4DDGD 4HLEA 3CSTA 3R7RA 3R7QA 4ZRJA 3R66C 2FCNA 1YJ1A 3ML8A 5DPTA 4EZJA 3EFUA 3IHPC 3VHTC 2ZEQA 3ZW3A 3DOWA 3Q3FA 3CSFA 4CO7A 3PPAA 4EEWA 4HJKA 3PS6A 4CHKA 3D32A 2C7NB 3B1LX 4DK5A 1Y8RC 3CMMB 4PYUA 2ZNVB 3QIJA 3M95A 1V2YA 3ZNID 2L0TA 5CTRC 4BKGA 1TZ1A 2R2QA 3P2BA 1WGRA 3IVFA 2FIDA 2MBHA 2JY6A 2M0XA 2MW5A 3VTWA 1T0YA 2LUEA 2RD0A 4HPLB 4NQKE 2N9EB 3ZKJC 4BKSA 2I1KA 2JF5A 2KX0A 1Q1OA 2AL3A 1GNUA 4IM3A 3L13A 2MA9B 3WAPA 1S1QB 2B3AA 1OQYA 2DAFA 2G4DB 3AULA 1E8YA 1WI0A 2N9XA 4DDID 4DHJB 4ANXA 4W9JA 1WZ0A 2KLCA 3A33B 4IWOA 2V3SA 5AZGA 3ZRCA 3VDZA 3ZDMC 4JL9A 2J7QB 2KLGA 3O65B 2KO3A 3RCZA 3ZVVA 1ZGUB 4IW0A 4PS8A 5EDSA 2MLBA 4LJOB 3VUYA 4BFRA 4F7ZA 2O2VB 3QJZA 2DZMA 1SIFA 4GXBA 4DWFA 2W9NA 2KFKB 1WH3A 1RRBA 2KMAA 4G11A 3PZDA 3LDZE 2HTHA 2KHWB 4GMVA 3UF8A 3PGEA 1KOTA 4WJPA 1GJZA 2KWUB 4URKA 2KTRA 3ZNZB 2YLMA 3V60A 3QHTA 2G45B 1H8CA 1OEYJ 3M63B 2DYBA 2GBNA 2KTRB 5JZEB 1Z2MA 3V62A 1WE7A 2BKFA 3OJ4B 2JRHA 3MJWA 5FR6A 2RPQA 3ZTCA 1LM8B 1WGYA 3KVFB 2NVUI 3WANA 2DZJA 1OGWA 4W9HA 1WXAA 2PPHA 1C1YB 2MBOA 3ZNGC 5E6OA 1NI2A 4HDOA 3PRPB 2ZCBA 2BPSA 3RYTA 5AEKB 4I6LB 4AJWA 4AJYB 3QAQA 5JHBA 1WFYA 1UH6A 1V5TA 3H1UA 3OAWA 2DYMA 3NZUA 4KIKA 3IFWB 2MBEA 5LXIB 2LRWA 2V1YA 3VTVA 3EECA 1R4NI 3PSEB 3APFA 1WF9A 3H7PA 1P1AA 4MEMA 3W1SA 1SE9A 2N9PC 2ZZPB 3DQVA 3HM6X 3PRMB 4GDLB 5AZHA 2DYOA 4RM9A 3H7PB 4E3CA 3ALBA 4BKTA 1E8WA 2J0KA 2OOBB 3ONSA 2Z0DB 3TBLD 3X0WA 2Z59B 4MGKE 4E74A 5E6PA 4OVUA 3U7DA 4FBJB 2LGXA 1P0RA 1E7UA 3WIMA 4GU2A 4KDIC 2O6VD 2D07B 1OEYA 5GMVA 1WYWB 2KDFB 3DVGX 5D94A 3M62B 2FUHB 4IM0A 3W1YA 3HIZA 4DHZE 2N7EA 4F1SA 4ZRIA 3NZSA 4MSQB 2PEAA 3A1QB 3GZNI 5CX3A 3DDCB 1Q5WB 2KC1A 3N3KB 4W9FA 1WGDA 2LVPA 4KVGB 2JRIB 1RAXA 2KWCA 3JSVA 2LD9A 1OTRB 2D11A 2DZKA 2LVOA 5CHVC 4IWQA 4KIKB 4GOCA 3UINB 4RMAA 2LZ6A 2RGFA 5C23A 2BYEA 1J8CA 4IUMB 2JZZA 2ZJDA 2RR9A 3PVLA 5TR5A 2K1FA 5J18A 4GSWA 4ASWC 1LFDA 3M3JA 3ZRFA 4NY0A 4K7WA 1E7VA 3N32A 4XC2A 3VVWB 4HDQA 2PJHA 2KC2A 4GGQA 3T8MA 1G6JA 2ZVNA 3VH4B 4ZDVA 4LCDE 4ZYNA 2IBIB 2KFJA 4FADA 3B0AA 2CR5A 3DBLI 3SD5A 3WAMA 2NBVB 1S3SG 3L54A 1IYFA 5D6JB 1D3ZA 2A5UA 5KHQA 4LDTB 4BKSD 2CHXA 4IM2A 4JLCA 2CU1A 2LJ5A 3ZLZA 4RM8A 5DPSA 3PT2B 1WR6E 3QX1A 4DXAB 1EF1A 1XT9B 5D7GA 2GBKA 1UBQA 1V49A 5IAAC 2FCMA 3NHEB 4WWNA 2IO3B 2K8HA 3DBHI 4GIVA 4HCNB 3ZO5B 4BVUC 1P3QU 2C9WB 2KWVB 1X1MA 3H6NA 2FNJB 3VAWA 4DHZB 5CHFA 5BO4B 2IY0B 2NR2A 4W9IA 3KW5B 4MSMB 4HPMB 4K7UA 1SGHA 2KQSA 4JIOU 4KZ0A 4MGIE 4P7IA 2K39A 5IA7A 3DPDA 1C3TA 3IBEA 4ANWA 3VH3B 1PQSA 2KXJA 3OLMD 1Q0WB 2GBMA 2ZNVC 2EKEC 2ZCCA 1WM3A 3H7SA 4EZKA 1NDDA 2K25A 5DPWA 4GDKB 1TBEA 2DHZA 1GG3A 2L7RA 3X23A 5J2RA 3SDLC 1V80A 2G4SA 5HKHA 2LASA 1UBIA 2NBWB 2JXXA 2O6VB 5KHOA 2YVCA 4ANVA 1E5WA 1WR1A 1LXDA 3ZIMA 2ZPYA 3SU8X 4FHJA 5DPRA 3RT3B 1V9JA 3DVNV 4MH0E 1WJ4A 4AUQC 2CHWA 4ICUA 3BY4B 4TV3A 3V61A 5J17A 4CYEA 1GC7A 2AYOB 2NPTA 1EF5A 1XD3B 4X57B 3A4RA 1RLFA 1WX8A 1EUVB 2KDEB 4N9F4 2JPHA 4TQ0A 1WM2A 2C7HA 3GOEA 4WWOA 1WJ6A 4M8MA 1E8XA 4JGHB 3MHSD 3HHMA 2AL6A 1YX5B 3KUZA 3V6EB 3ZUNA 4GB9A 4F8CB 2WDTB 3EHVA 1GUAB 4K7SA 2CHZA 3S2AA 4G3XB 2M4NA 3EC8A 2BWFA 4MGYE 4K81A 2GBRA 3RUIB 4PS3A 2IO1B 4MDKE 3B08A 2KMCA 1VCBA 2G3QB 4BOZB 1K8RB 1UELA 1UGMA 2MP2A 1WY8A 3RULA 4EOYA 1H4RA 4NNJB 1WRDB 3UIPB 1M94A 1XQQA 2N4FA 2XK5B 2BF8B 1UZXB 1ZKHA 4JQWC 4XZ4A 1V86A 1I35A 2MBQA 1U4AA 2MCNB 4A3OA 3QARA 1V5OA 2PE6B 3TCAA 2D3GA 4FLHA 5L83A 5CHWA 1Z5SB 2KVRA 3BINA 5G2NA 3AI5A 4ANUA 2MRPA 3PHWB 3QWZB 2NCNA 4HCPB 1KJTA 4WJOA 3L10B 2NPTB 2JUOA 3QC8B 2KOXA 3DBSA 1WZ3A 2N1VA 4HWIB 2AWTA 1IPGA 2KJHB 1JRUA 3L08A 2L00B 4BBNC 1L7YA 2IO0B 4FJYA 2D2QA 1J19A 2HJ8A 4FHKA 2MBBB 4KDLB 3WAOA 3K9PB 1FXTB 2FCQA 4A3PA 3PV1A 3WALA 4GDLA 3APCA 2WX1A 1NBFC 2Y5BB 4NPNA 4EFOA 4G50A 2ASQA 2J0JA 4M8NA 2LI5A 1V81A 3L16A 4IWPA 2IY1B 3A4SC 3KH0A 4I6PA 3L17A 1WXSA 2IO2B 1J0GA 2KTFA 2ZVOA 2KDIA 1QZEA 2N7DA 3MTNB 2KJ6A 3TJPA 4E71A 3H9DA 4J6IA 2IYDB 4MJSA 1E8ZA 2DAJA 1WXVA 3A1QA 4II2B 3A9KB 2WYQA 1YQBA 4NJ6A 3KYCD 3AXCA 3JVZX 4KSLC 3LJ3A 4LDTD 4W9KA 1ZW7A 2LXAA 2KNBA 3PLVA 4FULA 3NOBA 3QQ8B 3ZNHB 4NJ7A 2CS4A 2LVQA 3UIOB 2L76A 3IG3A 3JW0X 4MELA 3AU4A 2V4LA 1ISNA 2BGFA 4W9EA 2BYFA 3TIXA 2O2VA 4YL8A 4KSKC 3HM3A 2MP2B 3Q3JA 4WAAA 1WX7A 5JH5C 4EZLA 3UQBA 2KANA 5D2MB 1YIWA 5JHAA 4EKUA 2LWPA 2VRRB 1A5RA 2C7MB 2KN5A 2C60A 2JZ3B 3JYUA 1KLVA 5LLIA 5E6NA 1LQBA 1MG8A 4A20A 2DENB 3T9LA 3WA0A 3QA8A 2AEHA 4K1RB 2MQJA 2HD5B 4G0NB 4NAWB 2K6DB 4EUTA 2HE7A 2Z0EB 4WWPA 4B9KA 4XX5A 3JSVB 3OJ3A 1VD2A 1WMHB 2KZRA 4ZRKA 2N1WA 4MGZE 4W9DA 3NY5A 2DZIA 2KQ7A 3QCAA 2DX5B 4GN1A 4PS7A 5DCNA 3SHQA 3V6CB 2NBUA 1BT0A 2BKRB 2LGYA 1RFAA 1P98A 4HVBA 4AP4C 2IZVB 2WWZA 2FIFA 1WGGA 3ZDTA 2M1MA 2BWES 2KKCA 3RD2A 4IG7B 4W9CA 2LGDA 1YX6B 4MM3A 1P9DU 2L3ZA 3VUXA 4WJNA 3A9JA 4II3B 5G55A 2JVCA 2R2OA 2XEWA 3VUWA 2M17A 2CKHB 1YD8U 2L8JA 3NS8A 3K9OB 2UWQA 2MX2A 2L0FA 3A9JB 3ENEA 4GDKA 3VXWA 1WX9A 5LXHA 3QK0A 1AARA 4MJSB 2GMIC 1V6EA 4FJZA 1WXMA 1GC6A 3TMPB 5AZFA 4NAWA 2GOWA 2XK5A 3A9KA 1WIAA 2C5LC 3ML9A 4B95A 1F9JA 3W1SC 2NS5A 4TUUA 3VFKA 2MSED 2BYVE 3U30A 4DBGA 3ZTDA 4B6WA 2M8SA 3VQIA 1R4MI 1TGZB 1WJNA 1TTNA 2A4ZA 2REXA 2K8CA 1UD7A 3HK0A 2MWSB
chains in the Genus database with same CATH superfamily
3PLUA 2FAZA 1WMHA 4RFBA 4FA6A 2KYWA 4OZBA 1OQRA 2QMTA 3RZFA 2XN9C 2J0MA 3UQAA 5L95C 2RSUA 5D3IB 3I3TB 4A6QA 2D10A 5H92C 4L23A 3GE8C 1XLPA 2UYZB 3AECB 1GOZA 3AE3B 4HK2A 3ZXRA 3DBRI 2IGHA 5EE3A 4JX1C 3B9JA 2OHFA 1XLNA 4YWGG 3PREA 2KD0A 4XGAB 4FJVB 1OQQA 1WXQA 1MG4A 1QOBA 3R66C 2FCNA 4KKJA 2ZEQA 2KQ4X 3URYA 1R7SA 3PS6A 5E6JA 4DK5A 1MI0A 1Y8RC 3CMMB 4PYUA 1GAQB 2FIDA 2M0XA 2MW5A 3NZ3A 1T0YA 2RD0A 3VTWA 3KWVA 2N9EB 3R2IA 4YSYB 3ZKJC 2JF5A 1GNUA 2BW2A 3AULA 1WI0A 1V97A 2LMCA 4XWWA 1CK1A 4OZCA 4IW0A 1FXIA 2RDGA 5EDSA 3VUYA 2DZMA 2W9NA 1WH3A 2NMQA 2WGSA 2FE8A 4GMVA 3RNGC 3UF8A 5BMGA 1KOTA 4HKZE 2E6XA 3V60A 1Z2MA 2BKFA 1JWSD 3GZNB 3MJWA 4YSZB 3CIRB 1C1YB 2MBOA 5E6OA 2KACA 4HDOA 3OWEB 2ZCBA 5AEKB 5JHBA 2W55A 3OAWA 4KIKA 3IFWB 2BS3B 3EECA 4YTPB 4MEMA 2ONQA 3DQVA 3PRMB 3O13A 5AZHA 3ETRA 4E3CA 1JWUD 4NJCA 4BKTA 2J0KA 3X0WA 1FIQA 4MGKE 2LGXA 4KDIC 1NEKB 2INPE 1WYWB 3DVGX 3ZJVA 4DHZE 4F1SA 2I2YA 3DDCB 1Q5WB 4KVGB 1OTRB 1L0VB 2N0SB 1FEHA 4GOCA 4RMAA 1V1OA 4OHJA 4LNIA 1JALA 3FILB 3B2FA 1SB3C 2LGSA 2MEKA 3M3JA 3ZRFA 4NY0A 2VZKD 2HDEA 4LLGM 4DQOC 1XLQA 1G6JA 2ZVNA 3P4QB 4LCDE 1KRHA 1WSPA 3WAMA 1VLBA 5KHQA 2CHXA 4IM2A 5BMIA 1XT9B 2JU6X 5IAAC 2FCMA 4HCNB 3DBLB 4BVUC 4YSXB 4K3BA 2NR2A 3TEZA 4MSMB 4K7UA 5BMHA 2KQSA 1FFVA 1JMLA 5IA7A 3VH3B 5LNK1 1Q0WB 2GBMA 2V3NA 1WM3A 4EZKA 4RGMA 1ZPSA 4GDKB 2WXRA 1V80A 2LASA 1WR1A 3V05A 2ZPYA 2INCC 3RT3B 5IP4D 4AUQC 2CHWA 2JXTA 1GC7A 2NPTA 4RNAA 1WX8A 2K22A 3N9YC 4TQ0A 1WM2A 3DBRB 3GOEA 1WJ6A 1E8XA 4JGHB 3MHSD 3Q2AC 3HHMA 2AL6A 3KUZA 3V6EB 3Q3MC 3ZUNA 4GB9A 4F8CB 2WDTB 4K7SA 2CHZA 1R4MB 1FD6A 4G3XB 1SJED 4MGYE 2GBRA 1N5WA 2IO1B 4MDKE 1FRDA 1YN5A 5IKCM 2WQYB 4EOYA 1M94A 1UZXB 1ZKHA 4JQWC 2NTSA 3SFDB 2MBQA 4Q2JA 3QARA 5L83A 3C8YA 3BINA 5G2NA 3AI5A 3PHWB 4HCPB 2NCNA 1KJTA 1V8CA 3L10B 2IJ0A 2NPTB 2AX5A 3QC8B 2KOXA 4HWIB 2AWTA 2KJHB 1JRUA 3L08A 2D2QA 2HJ8A 1F2RI 2AQ2B 3K9PB 4A3PA 1FFUA 3PV1A 1E6EB 2L52A 4HKQA 3P4PB 1CZPA 2Y5BB 1VR9A 2ASQA 4C7YA 2LI5A 3L16A 4I6PA 1WXSA 1T0QC 2KTFA 2ZVOA 4RF0A 2KJ6A 3H9DA 5TSSA 2DAJA 3A9KB 2WYQA 4KSLC 4LDTD 4FULA 5AUKA 3NOBA 1QILA 3UIOB 2SAKA 2WU5B 3VR8B 4WWMA 3HRDD 2BGFA 4IDIA 2JYTA 1UWXA 1K53A 1ZDXA 3HM3A 5JH5C 3C19A 2J42A 3UQBA 4EKUA 1WWTA 2VRRB 2E3TA 2KN5A 4HPPA 3JYUA 3PZ8A 2PW9A 2JX5A 4G0NB 4K3CA 2Z0EB 1WMHB 5HFYA 2KZRA 4ZRKA 1SF0A 1VZ8A 4ZHOA 2WDQB 1N60A 1QKZA 3QCAA 2DX5B 4LNKA 4AP4C 4N59A 2WWZA 4MM3B 2FIFA 1WGGA 3ZDTA 2Y5PA 1LO5D 1C4AA 1D5MC 2HTME 4TSSA 4II3B 2CKHB 2M17A 3NS8A 3MHZA 1KLGD 1J7CA 2G9HD 2MX2A 2L0FA 3A9JB 5LXHA 3ZJTA 4MJSB 4FJZA 3MC9A 2NS5A 3VFKA 4HRSA 4YTMB 4RF1A 1R4MI 2EELA 2K8CA 1UD7A 1T0RC 2WXQA 3KUDB 2XBBC 1YNTE 1HA5A 2NTTA 1PUTA 3DWMA 2DLBA 1TKEA 3PRZA 1AN8A 2GBJA 4GLSC 3VTUA 1FNVA 4IC7B 1WJUA 4KZCA 2LFIA 2LHDA 4BOSC 4TQ1A 1MFWA 1K51A 2QDFA 1IP9A 3PTFC 3U52E 2PE9A 1JRPA 2PVOD 4OVVA 2ZPNA 4NQLB 1P7FA 4HEA1 2L05A 1J7BA 1EO6A 3PZ7A 1XF5L 3DWGC 4M0WB 4OZAA 1E7PB 2W82A 1JW9D 1ZXIA 3EFUA 2WXGA 3ZW3A 3DOWA 3Q3FA 4HJKA 3D32A 1E10A 4MH8A 3BK1A 5FKAC 4AS1A 1N61A 4BKGA 1TZ1A 1MJDA 2H88B 2MBHA 2WXFA 1IUEA 4HPLB 5HI1A 4NQKE 4ARCA 3AEDB 3AEGB 3L13A 2MA9B 2G4DB 1UF0A 2QC8A 2N9XA 4W9JA 4IWOA 1IBXB 4JL9A 3IT6B 1ZGUB 1Q10A 2BTEA 1AW7A 2MLBA 4D2KA 3DHGC 4F7ZA 3Q14C 1TKYA 1SIFA 4DWFA 2KFKB 2WLBA 4HJGE 2L83A 3IAM1 2WDRB 1TYGB 3LDZE 2HTHA 3PGEA 1GJZA 2WP9B 5EE9A 1SIJA 2KTRA 2YLMA 1SBBB 2G45B 1H8CA 3GP7A 3M63B 2KTRB 2IGDA 5JZEB 3V62A 2QCZA 3OJ4B 2KWDA 3RN9C 3KVFB 4C80A 3HUIA 2G1EA 3VR9B 1TS4A 3QAQA 2KVZA 1V5TA 5LXIB 2LRWA 3VTVA 1EU4A 3PSEB 3LYYA 3H7PA 3W1SA 1P1AA 3FILA 1EWYC 2N7JA 1VZ7A 1BMLC 3U7DA 4GU2A 2BQQA 2D3AA 3ZJUA 2GRIA 2WXJA 5D94A 4A8XC 2FUHB 4ZYSA 1L4DB 3A1QB 1NVID 3N3KB 4W9FA 2LVPA 2KWCA 3I5JC 2LD9A 2DZKA 4US8A 4OVZA 3RNEC 1B9RA 2LZ6A 2RGFA 5C23A 3AE1B 2BYEA 5TR5A 4OW0A 5D3DA 3P4SB 3P63A 4K7WA 1B1ZA 3N32A 3VVWB 2YEPF 3T8MA 3GB1A 4ZYNA 2KFJA 3TEYA 3TUOA 1VZ6A 3EUB2 1IYFA 2Z8LA 1C79A 1TKGA 2CU1A 4JLCA 2LJ5A 3ZLZA 4B0MA 1EF1A 2GBKA 1UBQA 3NHEB 4GIVA 3ABVB 2KWVB 4O1NA 2FNJB 4S17A 1JROA 4MGIE 2QIEB 4KZ0A 3DPDA 3SFEB 4US9A 2ZNVC 3Q69A 4LNNA 2DHZA 5C2TB 3SDLC 5HKHA 1MVKA 1WGKA 2JXXA 5KHOA 2YVCA 2D3BA 3N20C 5J17A 3BY4B 5EE0A 1IBXA 1HTOA 1HEZE 3GS2A 1EF5A 1XD3B 4X57B 3A4RA 1RLFA 1SE4A 2C7HA 1OFFA 1T3QA 4M8MA 1KF6B 3R8BA 3W2DA 3AEBB 3EHVA 5T8IA 3E9SA 2M19A 3AM9A 3KLSX 2M4NA 1C9FA 3EC8A 3AE7B 1FRRA 1CQVA 3OG5A 1QLBB 1VCBA 2G3QB 3ZXVA 1UGMA 1H4RA 1WRDB 1XQQA 2XK5B 4XZ4A 1HTQA 1V86A 1U4AA 4XDDA 2MCNB 5CHWA 4XE0A 2JUOA 3AE6B 4RCOA 1IPGA 4BBNC 2V9HA 4FJYA 1UUPA 1J19A 4KDLB 2MJDA 2N9LA 1V1PA 4N6EB 4EFOA 2J0JA 4IWPA 1LGRA 2IO2B 2N7DA 3MTNB 2GLSA 1WXVA 2JWUA 1JWMD 1QOAA 3KYCD 3AXCA 3Q8AA 4WIPA 2LXAA 2L76A 2RPVA 3JW0X 2GI9A 2M0AA 3BZDB 1ISNA 1YQ4B 1I4HA 4JWSC 2BYFA 1TY2A 2O2VA 4KSKC 2MP2B 3Q3JA 4EZLA 3T3NA 5D2MB 1MPEA 2LWPA 2X38A 2C7MB 4XWTA 2C60A 3EA6A 5LLIA 2ZW1A 1LQBA 4A20A 3WA0A 2AEHA 3FAHA 1IGDA 2HE7A 2ICIA 4XX5A 3JSVB 3OJ3A 4IKGA 3BIID 2PLPA 4W9DA 2WU2B 4M00A 3AE8B 5DCNA 3N1ZC 3NG0A 2MHJA 1DGJA 4MM3A 2L32A 2BYTA 4WJNA 4RGNA 5BYQA 2XEWA 1C78A 3VUWA 2L8JA 4GDKA 1WX9A 1AARA 2GMIC 3AN1A 1WXMA 1GC6A 1EU3A 1F9JA 2ON8A 5G5HA 3U30A 4DBGA 2Y5CA 2M8SA 3VQIA 1WJNA 1TGZB 5HG2A 2MWSB 1QOGA 2WX0A 4HXDA 1CMXB 1MHXA 2IGGA 3NVYA 4PYZA 1TS3A 3W9CB 1FCCC 3DCGA 4ACFA 4W9GA 2KK8A 4TKNA 3APDA 2LXCA 3DVGY 1YN4A 2IDYA 2V0GA 3N30A 4I6NB 1KM7A 1ZE3D 2OJRA 3CWIA 1SEBD 1PFDA 4JPSA 4LTUA 2QHOA 3L0WB 1FO4A 4B0EA 2I1JA 4WH4A 5IN7A 1N6ZA 3R3MA 4LK0M 4C4VA 3NJTA 2LGIA 3KYDD 4WAFA 4FN2A 1I4GA 2FCSA 1L2NA 4AWJA 3UGBB 1RFKA 1E90A 3VRBB 4LJPB 1HE8A 4AOFA 4PT5A 1XCQL 4ZRQA 3V3XA 3ECIA 4DDGD 3DBHB 3R7RA 4ZRJA 4WQMA 1YJ1A 3ML8A 4EZJA 3L4PA 3VHTC 5IOIA 1PGAA 1YN3A 4CO7A 1XO3A 3HVDA 3B1LX 1I4XA 2ZNVB 1TZOA 3U2SC 3M95A 2DWQA 2L0TA 3AV8A 5CTRC 3ZNID 3P2BA 1WGRA 3IVFA 1N5XA 2LUEA 2JZPA 1FM0D 2YEPB 4BKSA 2I1KA 1Q1OA 2WXOA 4DDID 1S1QB 2B3AA 1OQYA 2ACZB 2DAFA 2QILA 1C77A 4P6VF 2BT6A 3ZRCA 5AZGA 2V3SA 2J7QB 3O65B 1UGJA 3ZVVA 3RNFC 2K0PA 4PS8A 2R61A 4LJOB 4BFRA 2O2VB 1ESFA 3BWUD 1RRBA 2KMAA 2WXHA 3PZDA 1TT5B 2KHWB 2M56B 1BXTA 1UWMA 3P1MA 4WJPA 4URKA 2FUG1 1OEYJ 3MC8A 1IGCA 1T6BX 2GBNA 2OJWA 1WE7A 2JRHA 3FKYA 3T3OA 4ZOHC 1D6EC 2NVUI 3WANA 2DZJA 1F2RC 1WXAA 1D4BA 1NI2A 3PRPB 3RYTA 1WYGA 3H1UA 2JQRB 3MJ5A 2MBEA 2WXKA 2V1YA 1JCKB 4TMAB 3APFA 1WF9A 2DNFA 1TJEA 3HM6X 1SXTA 3DHIC 4GDLB 2DYOA 4RM9A 3H7PB 4A90A 3ALBA 1E8WA 2OOBB 2Z59B 4E74A 4OVUA 4FBJB 1P0RA 1E7UA 2BB5A 2D07B 1OEYA 5GMVA 3SEBA 3MP9A 3TEXA 3M62B 2N7EA 3TSSA 2BS2B 4MSQB 4M0WA 2PEAA 1RAXA 1YQ3B 3JSVA 2LVOA 5CHVC 1RYJA 4IWQA 3PO0A 3UINB 4EE2A 4IOIE 1J8CA 4IUMB 2JZZA 1GPXA 3P42A 2ZJDA 2RR9A 3N1YC 2K1FA 5J18A 4XYCA 4ASWC 2WHIA 2IPKD 1E7VA 1VDVA 4LNOA 2PJHA 4GGQA 2XNAC 4ZDVA 2IBIB 4FADA 3DBLI 2NBVB 1S3SG 1ET6A 5D6JB 2A5UA 1DOYA 2J53A 4NAMA 5DPSA 5MPOA 2CJNA 3QX1A 5D7GA 1V49A 1YJIA 2IO3B 2K8HA 2WS3B 3NRZA 3VAWA 1X1MA 1K50A 4DXFA 4DHZB 2IY0B 4W9IA 3KW5B 4L1BA 1TY0A 1SGHA 4P7IA 3IBEA 4ANWA 1PQSA 4LNFA 4WURA 2EKEC 3I9V1 4P1CC 3H7SA 5DPWA 3Q6BA 1GG3A 2G4SA 1UBIA 2NBWB 4ANVA 1E5WA 2ZW0A 5DPRA 3RMKC 4ICUA 4QAYA 2AYOB 2RMMA 3I63C 2KDEB 2CJOA 4WWOA 2AQ1B 1J7AA 4DXGA 2K5PA 1I4QA 4KGSA 1ET9A 3E56A 4K81A 3RUIB 3B08A 2KMCA 3MFGA 2WXNA 1K8RB 1UELA 1WY8A 4NNJB 3UIPB 2N4FA 2OEDA 3Q8EA 1I35A 2JYEA 4ITKA 5FK9C 2PE6B 3TCAA 2D3GA 4C7ZA 3QWZB 1FNUA 3RNBC 3BVGA 2KDMA 1C4CA 3DBSA 4ARIA 2L00B 1ZDVA 2MBBB 3WAOA 3MC0B 1FXTB 2FCQA 4ZRPA 2PKOA 3WALA 1JQ4A 1P7EA 2WX1A 1NBFC 1PDXA 1L6UA 4G50A 1L0XB 4M8NA 1V81A 2IY1B 3KH0A 3L17A 2V3PA 4BZAA 2KDIA 1QZEA 2INDC 2LUMA 3TJPA 4MJSA 3ZGZA 3SR6A 3A1QA 1ZUD2 4II2B 1YQBA 4NJ6A 1BUIC 3LJ3A 4W9KA 1ZW7A 2KNBA 3PLVA 3P4RB 3ZNHB 3QQ8B 4NJ7A 2CS4A 2LVQA 3IG3A 1SSNA 4MELA 3AU4A 2V4LA 3W5VB 4PK1A 2PIAA 1NYQA 1WX7A 3AE2B 1Y56A 1YIWA 1T0SC 2RDBC 2JZ3B 3RFZB 5E6NA 4MT5A 1TIFA 3NS1A 3QA8A 4K1RB 4FXCA 2MQJA 2HD5B 2K6DB 1MHHE 4WWPA 4B9KA 4MGZE 1EWCA 2KAJA 1FMAD 3AEFB 3NY5A 2K9XA 3SHQA 1BT0A 1RFAA 4HVBA 2IZVB 1KH0A 1N63A 4NZLB 2BWES 3RD2A 4IG7B 4A9AA 2LGDA 1DOIA 1P9DU 3FC4A 2X8XX 4M01A 5G55A 2JVCA 2R2OA 4L2YA 1ROEA 3ENEA 3QK0A 1V6EA 3TMPB 5AZFA 2L1AA 4NAWA 2LHEA 1L4ZB 2XK5A 3A9KA 4YXDB 1WIAA 3NVZA 3ML9A 1KTKA 3W1SC 4TUUA 2MSED 2WXMA 2REXA 3HK0A 5BYRA 2UU7A 1SE2A 1AWDA 1KFYB 2KJRA 4WJQA 3RZWC 3U4EG 4WQOB 3KUCB 4DHJD 1YMHE 3BVZA 1JWAD 4C00A 3TL5A 2EMTA 5C1ZA 2KFKA 4ICVA 2JT4B 2KDBA 1V1PB 3RI7C 5JXVA 2KMMA 3U8ZA 5H8YE 2LRUA 3C0RB 2TSSA 3KWLA 1F52A 2EMSA 1WGHA 3LXFA 2K8BA 3CF6E 4KV2A 3DVNU 4C4VB 3BYTB 1WE6A 3AEAB 3PHXB 4W9LA 2KT7A 3J9CA 2JWZA 4J3OD 1ZOYB 2K6QA 2O6VA 2KX3A 4S0RA 1M4VA 1QQRA 1D5ZC 3AU5A 4H2AA 4BBNF 1I42A 1HZ6A 4KKIA 2VH2A 2BB6A 4HLEA 3CSTA 4N58A 3R7QA 2VH1A 5DPTA 3IHPC 4YTNB 3B2GA 1K52A 3CSFA 3PPAA 4EEWA 4CHKA 2C7NB 2D5GA 3BK2A 1NI3A 1RWSA 3IXSA 3QIJA 1V2YA 4USAA 2R2QA 3NVWA 1CJEA 2JY6A 2KX0A 2WXIA 4IM3A 2AL3A 2PVGC 4MACA 3AE4B 3WAPA 4DHJB 1E8YA 1VRAB 1ACCA 4ANXA 1WZ0A 2KLCA 3A33B 3VDZA 1F1HA 2KLGA 3WCQA 2KO3A 3RCZA 2HJ1A 3KQ4A 3QJZA 4GXBA 3LB8C 4G11A 1C76A 3AEEB 5I4DA 2LEKA 2J52A 2PTLA 2PMVA 2KWUB 3ZNZB 3QHTA 2DYBA 4RGOS 1JWBD 5FR6A 2RPQA 3ZTCA 2Q5WD 1LM8B 1WGYA 4HROA 4M02A 1OGWA 4W9HA 2PPHA 3AB5A 2QJLA 3ZNGC 2AQ3B 2BPSA 4I6LB 4AJWA 4A55A 4AJYB 4R3DA 1WFYA 1VJKA 1UH6A 2DYMA 3NZUA 4RH6A 1GB1A 3RNAC 1R4NI 1SE9A 2N9PC 2ZZPB 3VRAB 4AQ7A 3ONSA 3TBLD 2Z0DB 1T5XD 5E6PA 2CU3A 1E0ZA 3AH7A 3WIMA 3DHHC 2KN4A 2O6VD 3Q8FA 2KDFB 2BVCA 4IM0A 3W1YA 3HIZA 4ZRIA 3NZSA 3GZNI 5CX3A 2KC1A 2EKIA 1WGDA 2JRIB 1L0YB 1ZXHA 2D11A 2GB1A 4KIKB 3Q8BA 3IAS1 4JE3B 3PVLA 1AYFA 3BYYB 1YOVB 2BBCA 4GSWA 1TS2A 1LFDA 2DBYA 5G5GA 1HQRD 4XC2A 4HDQA 3AE9B 2KC2A 4ZHPA 3VH4B 3B0AA 2CR5A 3N1XC 3SD5A 2MJEA 3L54A 2I38A 1D5XC 1A70A 1D3ZA 3ZYYX 2FBWB 4LDTB 4BKSD 1I4PA 4RM8A 2WXPA 3PT2B 1WR6E 1PGXA 4DXAB 2Y3AA 1KLUD 1PYWD 4WWNA 3DBHI 1DYQA 4XDCA 3ZO5B 1P3QU 2C9WB 3H6NA 1FNWA 4JWUC 5CHFA 5BO4B 5EE1A 4HPMB 1I4RA 4JIOU 2QEJC 2K39A 3NUHB 1N62A 3AE5B 1C3TA 2KXJA 1L6VA 3OLMD 2ZCCA 1NDDA 2K25A 1SJHD 1FPYA 1TBEA 5J2RA 2L7RA 3X23A 1ENFA 2O6VB 4UDUC 1XLOA 1DOXA 1LXDA 3ZIMA 3SU8X 4FHJA 1QOFA 1V9JA 1R4NB 3DVNV 4MH0E 1WJ4A 2B76B 1XEEA 4TV3A 3V61A 4CYEA 1I7HA 1EUVB 1XCTL 4N9F4 2JPHA 2MH7A 4C56C 1GB4A 1EM7A 2QSDA 1FCLA 1YX5B 2W3RA 1GUAB 2JSVX 3S2AA 2BWFA 1TS5A 4PS3A 4BOZB 4KGRA 2MP2A 3RULA 3TEWA 2BF8B 1YJJA 2WNMA 5FR3A 4A3OA 3GE3C 1V5OA 2LJIA 1L5PA 4FLHA 1Z5SB 2KVRA 4ANUA 2MRPA 2BS4B 1HZ5A 4WJOA 3UI3A 4P1BC 1WZ3A 2N1VA 1F77A 1L7YA 2IO0B 2H89B 4FHKA 4RGTA 5C3JB 1F0ZA 4YT0B 4GDLA 3APCA 3RPFC 4NPNA 1SE3A 3A4SC 4KX6B 1J0GA 1QF6A 3EFCA 4E71A 4J6IA 2IYDB 3U7ZA 1E8ZA 2WXLA 3JVZX 2WDVB 5HHDG 2D3CA 3RNCC 2W54A 4W9EA 1WRIA 3HVZA 3ZQ4A 3TIXA 4YL8A 1HXYD 2N9KA 4WAAA 1STEA 3NVVA 2KANA 3I57A 3W5UB 5JHAA 1A5RA 1XXGA 1KLVA 3R2TA 1MG8A 2DENB 3T9LA 1FXAA 4P16A 3Q3OC 5AUIA 3EGRA 4NAWB 2K3UA 4EUTA 1PGBA 3BVMA 1VD2A 1ZP0B 2N1WA 4REZA 2INNE 3IT4B 2DZIA 2KQ7A 4GN1A 5BYSA 4PS7A 3V6CB 2NBUA 2BKRB 2LGYA 1E9MA 1P98A 1QT9A 1NYRA 2M1MA 2KKCA 5GXGB 2J4XA 4W9CA 3Q8CA 1YX6B 3AMZA 2L3ZA 2SEBD 3VUXA 3A9JA 4KGTA 1C4PA 1YD8U 3VXWA 3K9OB 2UWQA 2RDHA 2VZKB 1UNSA 1RM6C 2GOWA 5IO9A 2MJ3A 4BAXA 2C5LC 2V4IB 4B95A 4CQNA 2BYVE 3ZTDA 4B6WA 3ZDMC 1TTNA 2A4ZA 3H8HA 2W3SA 3Q3NC 1NENB
chains in the Genus database with same CATH topology
2WX0A 4HXDA 1CMXB 3KUDB 3PLUA 2FAZA 1WMHA 4FA6A 2XBBC 4PYZA 2KJRA 4WJQA 3RZWC 4WQOB 3KUCB 3DCGA 4DHJD 4W9GA 3TL5A 3PRZA 2KK8A 4TKNA 2EMTA 3APDA 5C1ZA 2LXCA 3DVGY 3RZFA 3N30A 2KFKA 2J0MA 4I6NB 1KM7A 2OJRA 2JT4B 2GBJA 2KDBA 4ICVA 3UQAA 5L95C 2RSUA 3VTUA 3I3TB 4IC7B 1WJUA 4KZCA 2D10A 2QHOA 3L0WB 4BOSC 4TQ1A 2I1JA 3U8ZA 2UYZB 2LRUA 3C0RB 3R3MA 1IP9A 3PTFC 2EMSA 2PE9A 1WGHA 4HK2A 4OVVA 2ZPNA 3DBRI 3KYDD 4NQLB 2K8BA 3CF6E 4FN2A 4KV2A 2FCSA 1L2NA 3DVNU 4AWJA 4W9LA 1WE6A 3PHXB 3UGBB 2JWZA 2K6QA 1E90A 3PREA 2O6VA 2KX3A 4LJPB 1HE8A 4AOFA 2KD0A 2L05A 3AU5A 1EO6A 4BBNF 1I42A 4M0WB 4FJVB 3ECIA 4DDGD 4HLEA 3CSTA 3R7RA 3R7QA 4ZRJA 3R66C 2FCNA 1YJ1A 3ML8A 5DPTA 4EZJA 3EFUA 3IHPC 3VHTC 2ZEQA 3ZW3A 3DOWA 3Q3FA 3CSFA 4CO7A 3PPAA 4EEWA 4HJKA 3PS6A 4CHKA 3D32A 2C7NB 3B1LX 4DK5A 1Y8RC 3CMMB 4PYUA 2ZNVB 3QIJA 3M95A 1V2YA 3ZNID 2L0TA 5CTRC 4BKGA 1TZ1A 2R2QA 3P2BA 1WGRA 3IVFA 2FIDA 2MBHA 2JY6A 2M0XA 2MW5A 3VTWA 1T0YA 2LUEA 2RD0A 4HPLB 4NQKE 2N9EB 3ZKJC 4BKSA 2I1KA 2JF5A 2KX0A 1Q1OA 2AL3A 1GNUA 4IM3A 3L13A 2MA9B 3WAPA 1S1QB 2B3AA 1OQYA 2DAFA 2G4DB 3AULA 1E8YA 1WI0A 2N9XA 4DDID 4DHJB 4ANXA 4W9JA 1WZ0A 2KLCA 3A33B 4IWOA 2V3SA 5AZGA 3ZRCA 3VDZA 3ZDMC 4JL9A 2J7QB 2KLGA 3O65B 2KO3A 3RCZA 3ZVVA 1ZGUB 4IW0A 4PS8A 5EDSA 2MLBA 4LJOB 3VUYA 4BFRA 4F7ZA 2O2VB 3QJZA 2DZMA 1SIFA 4GXBA 4DWFA 2W9NA 2KFKB 1WH3A 1RRBA 2KMAA 4G11A 3PZDA 3LDZE 2HTHA 2KHWB 4GMVA 3UF8A 3PGEA 1KOTA 4WJPA 1GJZA 2KWUB 4URKA 2KTRA 3ZNZB 2YLMA 3V60A 3QHTA 2G45B 1H8CA 1OEYJ 3M63B 2DYBA 2GBNA 2KTRB 5JZEB 1Z2MA 3V62A 1WE7A 2BKFA 3OJ4B 2JRHA 3MJWA 5FR6A 2RPQA 3ZTCA 1LM8B 1WGYA 3KVFB 2NVUI 3WANA 2DZJA 1OGWA 4W9HA 1WXAA 2PPHA 1C1YB 2MBOA 3ZNGC 5E6OA 1NI2A 4HDOA 3PRPB 2ZCBA 2BPSA 3RYTA 5AEKB 4I6LB 4AJWA 4AJYB 3QAQA 5JHBA 1WFYA 1UH6A 1V5TA 3H1UA 3OAWA 2DYMA 3NZUA 4KIKA 3IFWB 2MBEA 5LXIB 2LRWA 2V1YA 3VTVA 3EECA 1R4NI 3PSEB 3APFA 1WF9A 3H7PA 1P1AA 4MEMA 3W1SA 1SE9A 2N9PC 2ZZPB 3DQVA 3HM6X 3PRMB 4GDLB 5AZHA 2DYOA 4RM9A 3H7PB 4E3CA 3ALBA 4BKTA 1E8WA 2J0KA 2OOBB 3ONSA 2Z0DB 3TBLD 3X0WA 2Z59B 4MGKE 4E74A 5E6PA 4OVUA 3U7DA 4FBJB 2LGXA 1P0RA 1E7UA 3WIMA 4GU2A 4KDIC 2O6VD 2D07B 1OEYA 5GMVA 1WYWB 2KDFB 3DVGX 5D94A 3M62B 2FUHB 4IM0A 3W1YA 3HIZA 4DHZE 2N7EA 4F1SA 4ZRIA 3NZSA 4MSQB 2PEAA 3A1QB 3GZNI 5CX3A 3DDCB 1Q5WB 2KC1A 3N3KB 4W9FA 1WGDA 2LVPA 4KVGB 2JRIB 1RAXA 2KWCA 3JSVA 2LD9A 1OTRB 2D11A 2DZKA 2LVOA 5CHVC 4IWQA 4KIKB 4GOCA 3UINB 4RMAA 2LZ6A 2RGFA 5C23A 2BYEA 1J8CA 4IUMB 2JZZA 2ZJDA 2RR9A 3PVLA 5TR5A 2K1FA 5J18A 4GSWA 4ASWC 1LFDA 3M3JA 3ZRFA 4NY0A 4K7WA 1E7VA 3N32A 4XC2A 3VVWB 4HDQA 2PJHA 2KC2A 4GGQA 3T8MA 1G6JA 2ZVNA 3VH4B 4ZDVA 4LCDE 4ZYNA 2IBIB 2KFJA 4FADA 3B0AA 2CR5A 3DBLI 3SD5A 3WAMA 2NBVB 1S3SG 3L54A 1IYFA 5D6JB 1D3ZA 2A5UA 5KHQA 4LDTB 4BKSD 2CHXA 4IM2A 4JLCA 2CU1A 2LJ5A 3ZLZA 4RM8A 5DPSA 3PT2B 1WR6E 3QX1A 4DXAB 1EF1A 1XT9B 5D7GA 2GBKA 1UBQA 1V49A 5IAAC 2FCMA 3NHEB 4WWNA 2IO3B 2K8HA 3DBHI 4GIVA 4HCNB 3ZO5B 4BVUC 1P3QU 2C9WB 2KWVB 1X1MA 3H6NA 2FNJB 3VAWA 4DHZB 5CHFA 5BO4B 2IY0B 2NR2A 4W9IA 3KW5B 4MSMB 4HPMB 4K7UA 1SGHA 2KQSA 4JIOU 4KZ0A 4MGIE 4P7IA 2K39A 5IA7A 3DPDA 1C3TA 3IBEA 4ANWA 3VH3B 1PQSA 2KXJA 3OLMD 1Q0WB 2GBMA 2ZNVC 2EKEC 2ZCCA 1WM3A 3H7SA 4EZKA 1NDDA 2K25A 5DPWA 4GDKB 1TBEA 2DHZA 1GG3A 2L7RA 3X23A 5J2RA 3SDLC 1V80A 2G4SA 5HKHA 2LASA 1UBIA 2NBWB 2JXXA 2O6VB 5KHOA 2YVCA 4ANVA 1E5WA 1WR1A 1LXDA 3ZIMA 2ZPYA 3SU8X 4FHJA 5DPRA 3RT3B 1V9JA 3DVNV 4MH0E 1WJ4A 4AUQC 2CHWA 4ICUA 3BY4B 4TV3A 3V61A 5J17A 4CYEA 1GC7A 2AYOB 2NPTA 1EF5A 1XD3B 4X57B 3A4RA 1RLFA 1WX8A 1EUVB 2KDEB 4N9F4 2JPHA 4TQ0A 1WM2A 2C7HA 3GOEA 4WWOA 1WJ6A 4M8MA 1E8XA 4JGHB 3MHSD 3HHMA 2AL6A 1YX5B 3KUZA 3V6EB 3ZUNA 4GB9A 4F8CB 2WDTB 3EHVA 1GUAB 4K7SA 2CHZA 3S2AA 4G3XB 2M4NA 3EC8A 2BWFA 4MGYE 4K81A 2GBRA 3RUIB 4PS3A 2IO1B 4MDKE 3B08A 2KMCA 1VCBA 2G3QB 4BOZB 1K8RB 1UELA 1UGMA 2MP2A 1WY8A 3RULA 4EOYA 1H4RA 4NNJB 1WRDB 3UIPB 1M94A 1XQQA 2N4FA 2XK5B 2BF8B 1UZXB 1ZKHA 4JQWC 4XZ4A 1V86A 1I35A 2MBQA 1U4AA 2MCNB 4A3OA 3QARA 1V5OA 2PE6B 3TCAA 2D3GA 4FLHA 5L83A 5CHWA 1Z5SB 2KVRA 3BINA 5G2NA 3AI5A 4ANUA 2MRPA 3PHWB 3QWZB 2NCNA 4HCPB 1KJTA 4WJOA 3L10B 2NPTB 2JUOA 3QC8B 2KOXA 3DBSA 1WZ3A 2N1VA 4HWIB 2AWTA 1IPGA 2KJHB 1JRUA 3L08A 2L00B 4BBNC 1L7YA 2IO0B 4FJYA 2D2QA 1J19A 2HJ8A 4FHKA 2MBBB 4KDLB 3WAOA 3K9PB 1FXTB 2FCQA 4A3PA 3PV1A 3WALA 4GDLA 3APCA 2WX1A 1NBFC 2Y5BB 4NPNA 4EFOA 4G50A 2ASQA 2J0JA 4M8NA 2LI5A 1V81A 3L16A 4IWPA 2IY1B 3A4SC 3KH0A 4I6PA 3L17A 1WXSA 2IO2B 1J0GA 2KTFA 2ZVOA 2KDIA 1QZEA 2N7DA 3MTNB 2KJ6A 3TJPA 4E71A 3H9DA 4J6IA 2IYDB 4MJSA 1E8ZA 2DAJA 1WXVA 3A1QA 4II2B 3A9KB 2WYQA 1YQBA 4NJ6A 3KYCD 3AXCA 3JVZX 4KSLC 3LJ3A 4LDTD 4W9KA 1ZW7A 2LXAA 2KNBA 3PLVA 4FULA 3NOBA 3QQ8B 3ZNHB 4NJ7A 2CS4A 2LVQA 3UIOB 2L76A 3IG3A 3JW0X 4MELA 3AU4A 2V4LA 1ISNA 2BGFA 4W9EA 2BYFA 3TIXA 2O2VA 4YL8A 4KSKC 3HM3A 2MP2B 3Q3JA 4WAAA 1WX7A 5JH5C 4EZLA 3UQBA 2KANA 5D2MB 1YIWA 5JHAA 4EKUA 2LWPA 2VRRB 1A5RA 2C7MB 2KN5A 2C60A 2JZ3B 3JYUA 1KLVA 5LLIA 5E6NA 1LQBA 1MG8A 4A20A 2DENB 3T9LA 3WA0A 3QA8A 2AEHA 4K1RB 2MQJA 2HD5B 4G0NB 4NAWB 2K6DB 4EUTA 2HE7A 2Z0EB 4WWPA 4B9KA 4XX5A 3JSVB 3OJ3A 1VD2A 1WMHB 2KZRA 4ZRKA 2N1WA 4MGZE 4W9DA 3NY5A 2DZIA 2KQ7A 3QCAA 2DX5B 4GN1A 4PS7A 5DCNA 3SHQA 3V6CB 2NBUA 1BT0A 2BKRB 2LGYA 1RFAA 1P98A 4HVBA 4AP4C 2IZVB 2WWZA 2FIFA 1WGGA 3ZDTA 2M1MA 2BWES 2KKCA 3RD2A 4IG7B 4W9CA 2LGDA 1YX6B 4MM3A 1P9DU 2L3ZA 3VUXA 4WJNA 3A9JA 4II3B 5G55A 2JVCA 2R2OA 2XEWA 3VUWA 2M17A 2CKHB 1YD8U 2L8JA 3NS8A 3K9OB 2UWQA 2MX2A 2L0FA 3A9JB 3ENEA 4GDKA 3VXWA 1WX9A 5LXHA 3QK0A 1AARA 4MJSB 2GMIC 1V6EA 4FJZA 1WXMA 1GC6A 3TMPB 5AZFA 4NAWA 2GOWA 2XK5A 3A9KA 1WIAA 2C5LC 3ML9A 4B95A 1F9JA 3W1SC 2NS5A 4TUUA 3VFKA 2MSED 2BYVE 3U30A 4DBGA 3ZTDA 4B6WA 2M8SA 3VQIA 1R4MI 1TGZB 1WJNA 1TTNA 2A4ZA 2REXA 2K8CA 1UD7A 3HK0A 2MWSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX0 A;  4HXD A;  1CMX B;  3KUD B;  3PLU A;  2FAZ A;  1WMH A;  4FA6 A;  2XBB C;  4PYZ A;  2KJR A;  4WJQ A;  3RZW C;  4WQO B;  3KUC B;  3DCG A;  4DHJ D;  4W9G A;  3TL5 A;  3PRZ A;  2KK8 A;  4TKN A;  2EMT A;  3APD A;  5C1Z A;  2LXC A;  3DVG Y;  3RZF A;  3N30 A;  2KFK A;  2J0M A;  4I6N B;  1KM7 A;  2OJR A;  2JT4 B;  2GBJ A;  2KDB A;  4ICV A;  3UQA A;  5L95 C;  2RSU A;  3VTU A;  3I3T B;  4IC7 B;  1WJU A;  4KZC A;  2D10 A;  2QHO A;  3L0W B;  4BOS C;  4TQ1 A;  2I1J A;  3U8Z A;  2UYZ B;  2LRU A;  3C0R B;  3R3M A;  1IP9 A;  3PTF C;  2EMS A;  2PE9 A;  1WGH A;  4HK2 A;  4OVV A;  2ZPN A;  3DBR I;  3KYD D;  4NQL B;  2K8B A;  3CF6 E;  4FN2 A;  4KV2 A;  2FCS A;  1L2N A;  3DVN U;  4AWJ A;  4W9L A;  1WE6 A;  3PHX B;  3UGB B;  2JWZ A;  2K6Q A;  1E90 A;  3PRE A;  2O6V A;  2KX3 A;  4LJP B;  1HE8 A;  4AOF A;  2KD0 A;  2L05 A;  3AU5 A;  1EO6 A;  4BBN F;  1I42 A;  4M0W B;  4FJV B;  3ECI A;  4DDG D;  4HLE A;  3CST A;  3R7R A;  3R7Q A;  4ZRJ A;  3R66 C;  2FCN A;  1YJ1 A;  3ML8 A;  5DPT A;  4EZJ A;  3EFU A;  3IHP C;  3VHT C;  2ZEQ A;  3ZW3 A;  3DOW A;  3Q3F A;  3CSF A;  4CO7 A;  3PPA A;  4EEW A;  4HJK A;  3PS6 A;  4CHK A;  3D32 A;  2C7N B;  3B1L X;  4DK5 A;  1Y8R C;  3CMM B;  4PYU A;  2ZNV B;  3QIJ A;  3M95 A;  1V2Y A;  3ZNI D;  2L0T A;  5CTR C;  4BKG A;  1TZ1 A;  2R2Q A;  3P2B A;  1WGR A;  3IVF A;  2FID A;  2MBH A;  2JY6 A;  2M0X A;  2MW5 A;  3VTW A;  1T0Y A;  2LUE A;  2RD0 A;  4HPL B;  4NQK E;  2N9E B;  3ZKJ C;  4BKS A;  2I1K A;  2JF5 A;  2KX0 A;  1Q1O A;  2AL3 A;  1GNU A;  4IM3 A;  3L13 A;  2MA9 B;  3WAP A;  1S1Q B;  2B3A A;  1OQY A;  2DAF A;  2G4D B;  3AUL A;  1E8Y A;  1WI0 A;  2N9X A;  4DDI D;  4DHJ B;  4ANX A;  4W9J A;  1WZ0 A;  2KLC A;  3A33 B;  4IWO A;  2V3S A;  5AZG A;  3ZRC A;  3VDZ A;  3ZDM C;  4JL9 A;  2J7Q B;  2KLG A;  3O65 B;  2KO3 A;  3RCZ A;  3ZVV A;  1ZGU B;  4IW0 A;  4PS8 A;  5EDS A;  2MLB A;  4LJO B;  3VUY A;  4BFR A;  4F7Z A;  2O2V B;  3QJZ A;  2DZM A;  1SIF A;  4GXB A;  4DWF A;  2W9N A;  2KFK B;  1WH3 A;  1RRB A;  2KMA A;  4G11 A;  3PZD A;  3LDZ E;  2HTH A;  2KHW B;  4GMV A;  3UF8 A;  3PGE A;  1KOT A;  4WJP A;  1GJZ A;  2KWU B;  4URK A;  2KTR A;  3ZNZ B;  2YLM A;  3V60 A;  3QHT A;  2G45 B;  1H8C A;  1OEY J;  3M63 B;  2DYB A;  2GBN A;  2KTR B;  5JZE B;  1Z2M A;  3V62 A;  1WE7 A;  2BKF A;  3OJ4 B;  2JRH A;  3MJW A;  5FR6 A;  2RPQ A;  3ZTC A;  1LM8 B;  1WGY A;  3KVF B;  2NVU I;  3WAN A;  2DZJ A;  1OGW A;  4W9H A;  1WXA A;  2PPH A;  1C1Y B;  2MBO A;  3ZNG C;  5E6O A;  1NI2 A;  4HDO A;  3PRP B;  2ZCB A;  2BPS A;  3RYT A;  5AEK B;  4I6L B;  4AJW A;  4AJY B;  3QAQ A;  5JHB A;  1WFY A;  1UH6 A;  1V5T A;  3H1U A;  3OAW A;  2DYM A;  3NZU A;  4KIK A;  3IFW B;  2MBE A;  5LXI B;  2LRW A;  2V1Y A;  3VTV A;  3EEC A;  1R4N I;  3PSE B;  3APF A;  1WF9 A;  3H7P A;  1P1A A;  4MEM A;  3W1S A;  1SE9 A;  2N9P C;  2ZZP B;  3DQV A;  3HM6 X;  3PRM B;  4GDL B;  5AZH A;  2DYO A;  4RM9 A;  3H7P B;  4E3C A;  3ALB A;  4BKT A;  1E8W A;  2J0K A;  2OOB B;  3ONS A;  2Z0D B;  3TBL D;  3X0W A;  2Z59 B;  4MGK E;  4E74 A;  5E6P A;  4OVU A;  3U7D A;  4FBJ B;  2LGX A;  1P0R A;  1E7U A;  3WIM A;  4GU2 A;  4KDI C;  2O6V D;  2D07 B;  1OEY A;  5GMV A;  1WYW B;  2KDF B;  3DVG X;  5D94 A;  3M62 B;  2FUH B;  4IM0 A;  3W1Y A;  3HIZ A;  4DHZ E;  2N7E A;  4F1S A;  4ZRI A;  3NZS A;  4MSQ B;  2PEA A;  3A1Q B;  3GZN I;  5CX3 A;  3DDC B;  1Q5W B;  2KC1 A;  3N3K B;  4W9F A;  1WGD A;  2LVP A;  4KVG B;  2JRI B;  1RAX A;  2KWC A;  3JSV A;  2LD9 A;  1OTR B;  2D11 A;  2DZK A;  2LVO A;  5CHV C;  4IWQ A;  4KIK B;  4GOC A;  3UIN B;  4RMA A;  2LZ6 A;  2RGF A;  5C23 A;  2BYE A;  1J8C A;  4IUM B;  2JZZ A;  2ZJD A;  2RR9 A;  3PVL A;  5TR5 A;  2K1F A;  5J18 A;  4GSW A;  4ASW C;  1LFD A;  3M3J A;  3ZRF A;  4NY0 A;  4K7W A;  1E7V A;  3N32 A;  4XC2 A;  3VVW B;  4HDQ A;  2PJH A;  2KC2 A;  4GGQ A;  3T8M A;  1G6J A;  2ZVN A;  3VH4 B;  4ZDV A;  4LCD E;  4ZYN A;  2IBI B;  2KFJ A;  4FAD A;  3B0A A;  2CR5 A;  3DBL I;  3SD5 A;  3WAM A;  2NBV B;  1S3S G;  3L54 A;  1IYF A;  5D6J B;  1D3Z A;  2A5U A;  5KHQ A;  4LDT B;  4BKS D;  2CHX A;  4IM2 A;  4JLC A;  2CU1 A;  2LJ5 A;  3ZLZ A;  4RM8 A;  5DPS A;  3PT2 B;  1WR6 E;  3QX1 A;  4DXA B;  1EF1 A;  1XT9 B;  5D7G A;  2GBK A;  1UBQ A;  1V49 A;  5IAA C;  2FCM A;  3NHE B;  4WWN A;  2IO3 B;  2K8H A;  3DBH I;  4GIV A;  4HCN B;  3ZO5 B;  4BVU C;  1P3Q U;  2C9W B;  2KWV B;  1X1M A;  3H6N A;  2FNJ B;  3VAW A;  4DHZ B;  5CHF A;  5BO4 B;  2IY0 B;  2NR2 A;  4W9I A;  3KW5 B;  4MSM B;  4HPM B;  4K7U A;  1SGH A;  2KQS A;  4JIO U;  4KZ0 A;  4MGI E;  4P7I A;  2K39 A;  5IA7 A;  3DPD A;  1C3T A;  3IBE A;  4ANW A;  3VH3 B;  1PQS A;  2KXJ A;  3OLM D;  1Q0W B;  2GBM A;  2ZNV C;  2EKE C;  2ZCC A;  1WM3 A;  3H7S A;  4EZK A;  1NDD A;  2K25 A;  5DPW A;  4GDK B;  1TBE A;  2DHZ A;  1GG3 A;  2L7R A;  3X23 A;  5J2R A;  3SDL C;  1V80 A;  2G4S A;  5HKH A;  2LAS A;  1UBI A;  2NBW B;  2JXX A;  2O6V B;  5KHO A;  2YVC A;  4ANV A;  1E5W A;  1WR1 A;  1LXD A;  3ZIM A;  2ZPY A;  3SU8 X;  4FHJ A;  5DPR A;  3RT3 B;  1V9J A;  3DVN V;  4MH0 E;  1WJ4 A;  4AUQ C;  2CHW A;  4ICU A;  3BY4 B;  4TV3 A;  3V61 A;  5J17 A;  4CYE A;  1GC7 A;  2AYO B;  2NPT A;  1EF5 A;  1XD3 B;  4X57 B;  3A4R A;  1RLF A;  1WX8 A;  1EUV B;  2KDE B;  4N9F 4;  2JPH A;  4TQ0 A;  1WM2 A;  2C7H A;  3GOE A;  4WWO A;  1WJ6 A;  4M8M A;  1E8X A;  4JGH B;  3MHS D;  3HHM A;  2AL6 A;  1YX5 B;  3KUZ A;  3V6E B;  3ZUN A;  4GB9 A;  4F8C B;  2WDT B;  3EHV A;  1GUA B;  4K7S A;  2CHZ A;  3S2A A;  4G3X B;  2M4N A;  3EC8 A;  2BWF A;  4MGY E;  4K81 A;  2GBR A;  3RUI B;  4PS3 A;  2IO1 B;  4MDK E;  3B08 A;  2KMC A;  1VCB A;  2G3Q B;  4BOZ B;  1K8R B;  1UEL A;  1UGM A;  2MP2 A;  1WY8 A;  3RUL A;  4EOY A;  1H4R A;  4NNJ B;  1WRD B;  3UIP B;  1M94 A;  1XQQ A;  2N4F A;  2XK5 B;  2BF8 B;  1UZX B;  1ZKH A;  4JQW C;  4XZ4 A;  1V86 A;  1I35 A;  2MBQ A;  1U4A A;  2MCN B;  4A3O A;  3QAR A;  1V5O A;  2PE6 B;  3TCA A;  2D3G A;  4FLH A;  5L83 A;  5CHW A;  1Z5S B;  2KVR A;  3BIN A;  5G2N A;  3AI5 A;  4ANU A;  2MRP A;  3PHW B;  3QWZ B;  2NCN A;  4HCP B;  1KJT A;  4WJO A;  3L10 B;  2NPT B;  2JUO A;  3QC8 B;  2KOX A;  3DBS A;  1WZ3 A;  2N1V A;  4HWI B;  2AWT A;  1IPG A;  2KJH B;  1JRU A;  3L08 A;  2L00 B;  4BBN C;  1L7Y A;  2IO0 B;  4FJY A;  2D2Q A;  1J19 A;  2HJ8 A;  4FHK A;  2MBB B;  4KDL B;  3WAO A;  3K9P B;  1FXT B;  2FCQ A;  4A3P A;  3PV1 A;  3WAL A;  4GDL A;  3APC A;  2WX1 A;  1NBF C;  2Y5B B;  4NPN A;  4EFO A;  4G50 A;  2ASQ A;  2J0J A;  4M8N A;  2LI5 A;  1V81 A;  3L16 A;  4IWP A;  2IY1 B;  3A4S C;  3KH0 A;  4I6P A;  3L17 A;  1WXS A;  2IO2 B;  1J0G A;  2KTF A;  2ZVO A;  2KDI A;  1QZE A;  2N7D A;  3MTN B;  2KJ6 A;  3TJP A;  4E71 A;  3H9D A;  4J6I A;  2IYD B;  4MJS A;  1E8Z A;  2DAJ A;  1WXV A;  3A1Q A;  4II2 B;  3A9K B;  2WYQ A;  1YQB A;  4NJ6 A;  3KYC D;  3AXC A;  3JVZ X;  4KSL C;  3LJ3 A;  4LDT D;  4W9K A;  1ZW7 A;  2LXA A;  2KNB A;  3PLV A;  4FUL A;  3NOB A;  3QQ8 B;  3ZNH B;  4NJ7 A;  2CS4 A;  2LVQ A;  3UIO B;  2L76 A;  3IG3 A;  3JW0 X;  4MEL A;  3AU4 A;  2V4L A;  1ISN A;  2BGF A;  4W9E A;  2BYF A;  3TIX A;  2O2V A;  4YL8 A;  4KSK C;  3HM3 A;  2MP2 B;  3Q3J A;  4WAA A;  1WX7 A;  5JH5 C;  4EZL A;  3UQB A;  2KAN A;  5D2M B;  1YIW A;  5JHA A;  4EKU A;  2LWP A;  2VRR B;  1A5R A;  2C7M B;  2KN5 A;  2C60 A;  2JZ3 B;  3JYU A;  1KLV A;  5LLI A;  5E6N A;  1LQB A;  1MG8 A;  4A20 A;  2DEN B;  3T9L A;  3WA0 A;  3QA8 A;  2AEH A;  4K1R B;  2MQJ A;  2HD5 B;  4G0N B;  4NAW B;  2K6D B;  4EUT A;  2HE7 A;  2Z0E B;  4WWP A;  4B9K A;  4XX5 A;  3JSV B;  3OJ3 A;  1VD2 A;  1WMH B;  2KZR A;  4ZRK A;  2N1W A;  4MGZ E;  4W9D A;  3NY5 A;  2DZI A;  2KQ7 A;  3QCA A;  2DX5 B;  4GN1 A;  4PS7 A;  5DCN A;  3SHQ A;  3V6C B;  2NBU A;  1BT0 A;  2BKR B;  2LGY A;  1RFA A;  1P98 A;  4HVB A;  4AP4 C;  2IZV B;  2WWZ A;  2FIF A;  1WGG A;  3ZDT A;  2M1M A;  2BWE S;  2KKC A;  3RD2 A;  4IG7 B;  4W9C A;  2LGD A;  1YX6 B;  4MM3 A;  1P9D U;  2L3Z A;  3VUX A;  4WJN A;  3A9J A;  4II3 B;  5G55 A;  2JVC A;  2R2O A;  2XEW A;  3VUW A;  2M17 A;  2CKH B;  1YD8 U;  2L8J A;  3NS8 A;  3K9O B;  2UWQ A;  2MX2 A;  2L0F A;  3A9J B;  3ENE A;  4GDK A;  3VXW A;  1WX9 A;  5LXH A;  3QK0 A;  1AAR A;  4MJS B;  2GMI C;  1V6E A;  4FJZ A;  1WXM A;  1GC6 A;  3TMP B;  5AZF A;  4NAW A;  2GOW A;  2XK5 A;  3A9K A;  1WIA A;  2C5L C;  3ML9 A;  4B95 A;  1F9J A;  3W1S C;  2NS5 A;  4TUU A;  3VFK A;  2MSE D;  2BYV E;  3U30 A;  4DBG A;  3ZTD A;  4B6W A;  2M8S A;  3VQI A;  1R4M I;  1TGZ B;  1WJN A;  1TTN A;  2A4Z A;  2REX A;  2K8C A;  1UD7 A;  3HK0 A;  2MWS B; 
#chains in the Genus database with same CATH topology
 3PLU A;  2FAZ A;  1WMH A;  4RFB A;  4FA6 A;  2KYW A;  4OZB A;  1OQR A;  2QMT A;  3RZF A;  2XN9 C;  2J0M A;  3UQA A;  5L95 C;  2RSU A;  5D3I B;  3I3T B;  4A6Q A;  2D10 A;  5H92 C;  4L23 A;  3GE8 C;  1XLP A;  2UYZ B;  3AEC B;  1GOZ A;  3AE3 B;  4HK2 A;  3ZXR A;  3DBR I;  2IGH A;  5EE3 A;  4JX1 C;  3B9J A;  2OHF A;  1XLN A;  4YWG G;  3PRE A;  2KD0 A;  4XGA B;  4FJV B;  1OQQ A;  1WXQ A;  1MG4 A;  1QOB A;  3R66 C;  2FCN A;  4KKJ A;  2ZEQ A;  2KQ4 X;  3URY A;  1R7S A;  3PS6 A;  5E6J A;  4DK5 A;  1MI0 A;  1Y8R C;  3CMM B;  4PYU A;  1GAQ B;  2FID A;  2M0X A;  2MW5 A;  3NZ3 A;  1T0Y A;  2RD0 A;  3VTW A;  3KWV A;  2N9E B;  3R2I A;  4YSY B;  3ZKJ C;  2JF5 A;  1GNU A;  2BW2 A;  3AUL A;  1WI0 A;  1V97 A;  2LMC A;  4XWW A;  1CK1 A;  4OZC A;  4IW0 A;  1FXI A;  2RDG A;  5EDS A;  3VUY A;  2DZM A;  2W9N A;  1WH3 A;  2NMQ A;  2WGS A;  2FE8 A;  4GMV A;  3RNG C;  3UF8 A;  5BMG A;  1KOT A;  4HKZ E;  2E6X A;  3V60 A;  1Z2M A;  2BKF A;  1JWS D;  3GZN B;  3MJW A;  4YSZ B;  3CIR B;  1C1Y B;  2MBO A;  5E6O A;  2KAC A;  4HDO A;  3OWE B;  2ZCB A;  5AEK B;  5JHB A;  2W55 A;  3OAW A;  4KIK A;  3IFW B;  2BS3 B;  3EEC A;  4YTP B;  4MEM A;  2ONQ A;  3DQV A;  3PRM B;  3O13 A;  5AZH A;  3ETR A;  4E3C A;  1JWU D;  4NJC A;  4BKT A;  2J0K A;  3X0W A;  1FIQ A;  4MGK E;  2LGX A;  4KDI C;  1NEK B;  2INP E;  1WYW B;  3DVG X;  3ZJV A;  4DHZ E;  4F1S A;  2I2Y A;  3DDC B;  1Q5W B;  4KVG B;  1OTR B;  1L0V B;  2N0S B;  1FEH A;  4GOC A;  4RMA A;  1V1O A;  4OHJ A;  4LNI A;  1JAL A;  3FIL B;  3B2F A;  1SB3 C;  2LGS A;  2MEK A;  3M3J A;  3ZRF A;  4NY0 A;  2VZK D;  2HDE A;  4LLG M;  4DQO C;  1XLQ A;  1G6J A;  2ZVN A;  3P4Q B;  4LCD E;  1KRH A;  1WSP A;  3WAM A;  1VLB A;  5KHQ A;  2CHX A;  4IM2 A;  5BMI A;  1XT9 B;  2JU6 X;  5IAA C;  2FCM A;  4HCN B;  3DBL B;  4BVU C;  4YSX B;  4K3B A;  2NR2 A;  3TEZ A;  4MSM B;  4K7U A;  5BMH A;  2KQS A;  1FFV A;  1JML A;  5IA7 A;  3VH3 B;  5LNK 1;  1Q0W B;  2GBM A;  2V3N A;  1WM3 A;  4EZK A;  4RGM A;  1ZPS A;  4GDK B;  2WXR A;  1V80 A;  2LAS A;  1WR1 A;  3V05 A;  2ZPY A;  2INC C;  3RT3 B;  5IP4 D;  4AUQ C;  2CHW A;  2JXT A;  1GC7 A;  2NPT A;  4RNA A;  1WX8 A;  2K22 A;  3N9Y C;  4TQ0 A;  1WM2 A;  3DBR B;  3GOE A;  1WJ6 A;  1E8X A;  4JGH B;  3MHS D;  3Q2A C;  3HHM A;  2AL6 A;  3KUZ A;  3V6E B;  3Q3M C;  3ZUN A;  4GB9 A;  4F8C B;  2WDT B;  4K7S A;  2CHZ A;  1R4M B;  1FD6 A;  4G3X B;  1SJE D;  4MGY E;  2GBR A;  1N5W A;  2IO1 B;  4MDK E;  1FRD A;  1YN5 A;  5IKC M;  2WQY B;  4EOY A;  1M94 A;  1UZX B;  1ZKH A;  4JQW C;  2NTS A;  3SFD B;  2MBQ A;  4Q2J A;  3QAR A;  5L83 A;  3C8Y A;  3BIN A;  5G2N A;  3AI5 A;  3PHW B;  4HCP B;  2NCN A;  1KJT A;  1V8C A;  3L10 B;  2IJ0 A;  2NPT B;  2AX5 A;  3QC8 B;  2KOX A;  4HWI B;  2AWT A;  2KJH B;  1JRU A;  3L08 A;  2D2Q A;  2HJ8 A;  1F2R I;  2AQ2 B;  3K9P B;  4A3P A;  1FFU A;  3PV1 A;  1E6E B;  2L52 A;  4HKQ A;  3P4P B;  1CZP A;  2Y5B B;  1VR9 A;  2ASQ A;  4C7Y A;  2LI5 A;  3L16 A;  4I6P A;  1WXS A;  1T0Q C;  2KTF A;  2ZVO A;  4RF0 A;  2KJ6 A;  3H9D A;  5TSS A;  2DAJ A;  3A9K B;  2WYQ A;  4KSL C;  4LDT D;  4FUL A;  5AUK A;  3NOB A;  1QIL A;  3UIO B;  2SAK A;  2WU5 B;  3VR8 B;  4WWM A;  3HRD D;  2BGF A;  4IDI A;  2JYT A;  1UWX A;  1K53 A;  1ZDX A;  3HM3 A;  5JH5 C;  3C19 A;  2J42 A;  3UQB A;  4EKU A;  1WWT A;  2VRR B;  2E3T A;  2KN5 A;  4HPP A;  3JYU A;  3PZ8 A;  2PW9 A;  2JX5 A;  4G0N B;  4K3C A;  2Z0E B;  1WMH B;  5HFY A;  2KZR A;  4ZRK A;  1SF0 A;  1VZ8 A;  4ZHO A;  2WDQ B;  1N60 A;  1QKZ A;  3QCA A;  2DX5 B;  4LNK A;  4AP4 C;  4N59 A;  2WWZ A;  4MM3 B;  2FIF A;  1WGG A;  3ZDT A;  2Y5P A;  1LO5 D;  1C4A A;  1D5M C;  2HTM E;  4TSS A;  4II3 B;  2CKH B;  2M17 A;  3NS8 A;  3MHZ A;  1KLG D;  1J7C A;  2G9H D;  2MX2 A;  2L0F A;  3A9J B;  5LXH A;  3ZJT A;  4MJS B;  4FJZ A;  3MC9 A;  2NS5 A;  3VFK A;  4HRS A;  4YTM B;  4RF1 A;  1R4M I;  2EEL A;  2K8C A;  1UD7 A;  1T0R C;  2WXQ A;  3KUD B;  2XBB C;  1YNT E;  1HA5 A;  2NTT A;  1PUT A;  3DWM A;  2DLB A;  1TKE A;  3PRZ A;  1AN8 A;  2GBJ A;  4GLS C;  3VTU A;  1FNV A;  4IC7 B;  1WJU A;  4KZC A;  2LFI A;  2LHD A;  4BOS C;  4TQ1 A;  1MFW A;  1K51 A;  2QDF A;  1IP9 A;  3PTF C;  3U52 E;  2PE9 A;  1JRP A;  2PVO D;  4OVV A;  2ZPN A;  4NQL B;  1P7F A;  4HEA 1;  2L05 A;  1J7B A;  1EO6 A;  3PZ7 A;  1XF5 L;  3DWG C;  4M0W B;  4OZA A;  1E7P B;  2W82 A;  1JW9 D;  1ZXI A;  3EFU A;  2WXG A;  3ZW3 A;  3DOW A;  3Q3F A;  4HJK A;  3D32 A;  1E10 A;  4MH8 A;  3BK1 A;  5FKA C;  4AS1 A;  1N61 A;  4BKG A;  1TZ1 A;  1MJD A;  2H88 B;  2MBH A;  2WXF A;  1IUE A;  4HPL B;  5HI1 A;  4NQK E;  4ARC A;  3AED B;  3AEG B;  3L13 A;  2MA9 B;  2G4D B;  1UF0 A;  2QC8 A;  2N9X A;  4W9J A;  4IWO A;  1IBX B;  4JL9 A;  3IT6 B;  1ZGU B;  1Q10 A;  2BTE A;  1AW7 A;  2MLB A;  4D2K A;  3DHG C;  4F7Z A;  3Q14 C;  1TKY A;  1SIF A;  4DWF A;  2KFK B;  2WLB A;  4HJG E;  2L83 A;  3IAM 1;  2WDR B;  1TYG B;  3LDZ E;  2HTH A;  3PGE A;  1GJZ A;  2WP9 B;  5EE9 A;  1SIJ A;  2KTR A;  2YLM A;  1SBB B;  2G45 B;  1H8C A;  3GP7 A;  3M63 B;  2KTR B;  2IGD A;  5JZE B;  3V62 A;  2QCZ A;  3OJ4 B;  2KWD A;  3RN9 C;  3KVF B;  4C80 A;  3HUI A;  2G1E A;  3VR9 B;  1TS4 A;  3QAQ A;  2KVZ A;  1V5T A;  5LXI B;  2LRW A;  3VTV A;  1EU4 A;  3PSE B;  3LYY A;  3H7P A;  3W1S A;  1P1A A;  3FIL A;  1EWY C;  2N7J A;  1VZ7 A;  1BML C;  3U7D A;  4GU2 A;  2BQQ A;  2D3A A;  3ZJU A;  2GRI A;  2WXJ A;  5D94 A;  4A8X C;  2FUH B;  4ZYS A;  1L4D B;  3A1Q B;  1NVI D;  3N3K B;  4W9F A;  2LVP A;  2KWC A;  3I5J C;  2LD9 A;  2DZK A;  4US8 A;  4OVZ A;  3RNE C;  1B9R A;  2LZ6 A;  2RGF A;  5C23 A;  3AE1 B;  2BYE A;  5TR5 A;  4OW0 A;  5D3D A;  3P4S B;  3P63 A;  4K7W A;  1B1Z A;  3N32 A;  3VVW B;  2YEP F;  3T8M A;  3GB1 A;  4ZYN A;  2KFJ A;  3TEY A;  3TUO A;  1VZ6 A;  3EUB 2;  1IYF A;  2Z8L A;  1C79 A;  1TKG A;  2CU1 A;  4JLC A;  2LJ5 A;  3ZLZ A;  4B0M A;  1EF1 A;  2GBK A;  1UBQ A;  3NHE B;  4GIV A;  3ABV B;  2KWV B;  4O1N A;  2FNJ B;  4S17 A;  1JRO A;  4MGI E;  2QIE B;  4KZ0 A;  3DPD A;  3SFE B;  4US9 A;  2ZNV C;  3Q69 A;  4LNN A;  2DHZ A;  5C2T B;  3SDL C;  5HKH A;  1MVK A;  1WGK A;  2JXX A;  5KHO A;  2YVC A;  2D3B A;  3N20 C;  5J17 A;  3BY4 B;  5EE0 A;  1IBX A;  1HTO A;  1HEZ E;  3GS2 A;  1EF5 A;  1XD3 B;  4X57 B;  3A4R A;  1RLF A;  1SE4 A;  2C7H A;  1OFF A;  1T3Q A;  4M8M A;  1KF6 B;  3R8B A;  3W2D A;  3AEB B;  3EHV A;  5T8I A;  3E9S A;  2M19 A;  3AM9 A;  3KLS X;  2M4N A;  1C9F A;  3EC8 A;  3AE7 B;  1FRR A;  1CQV A;  3OG5 A;  1QLB B;  1VCB A;  2G3Q B;  3ZXV A;  1UGM A;  1H4R A;  1WRD B;  1XQQ A;  2XK5 B;  4XZ4 A;  1HTQ A;  1V86 A;  1U4A A;  4XDD A;  2MCN B;  5CHW A;  4XE0 A;  2JUO A;  3AE6 B;  4RCO A;  1IPG A;  4BBN C;  2V9H A;  4FJY A;  1UUP A;  1J19 A;  4KDL B;  2MJD A;  2N9L A;  1V1P A;  4N6E B;  4EFO A;  2J0J A;  4IWP A;  1LGR A;  2IO2 B;  2N7D A;  3MTN B;  2GLS A;  1WXV A;  2JWU A;  1JWM D;  1QOA A;  3KYC D;  3AXC A;  3Q8A A;  4WIP A;  2LXA A;  2L76 A;  2RPV A;  3JW0 X;  2GI9 A;  2M0A A;  3BZD B;  1ISN A;  1YQ4 B;  1I4H A;  4JWS C;  2BYF A;  1TY2 A;  2O2V A;  4KSK C;  2MP2 B;  3Q3J A;  4EZL A;  3T3N A;  5D2M B;  1MPE A;  2LWP A;  2X38 A;  2C7M B;  4XWT A;  2C60 A;  3EA6 A;  5LLI A;  2ZW1 A;  1LQB A;  4A20 A;  3WA0 A;  2AEH A;  3FAH A;  1IGD A;  2HE7 A;  2ICI A;  4XX5 A;  3JSV B;  3OJ3 A;  4IKG A;  3BII D;  2PLP A;  4W9D A;  2WU2 B;  4M00 A;  3AE8 B;  5DCN A;  3N1Z C;  3NG0 A;  2MHJ A;  1DGJ A;  4MM3 A;  2L32 A;  2BYT A;  4WJN A;  4RGN A;  5BYQ A;  2XEW A;  1C78 A;  3VUW A;  2L8J A;  4GDK A;  1WX9 A;  1AAR A;  2GMI C;  3AN1 A;  1WXM A;  1GC6 A;  1EU3 A;  1F9J A;  2ON8 A;  5G5H A;  3U30 A;  4DBG A;  2Y5C A;  2M8S A;  3VQI A;  1WJN A;  1TGZ B;  5HG2 A;  2MWS B;  1QOG A;  2WX0 A;  4HXD A;  1CMX B;  1MHX A;  2IGG A;  3NVY A;  4PYZ A;  1TS3 A;  3W9C B;  1FCC C;  3DCG A;  4ACF A;  4W9G A;  2KK8 A;  4TKN A;  3APD A;  2LXC A;  3DVG Y;  1YN4 A;  2IDY A;  2V0G A;  3N30 A;  4I6N B;  1KM7 A;  1ZE3 D;  2OJR A;  3CWI A;  1SEB D;  1PFD A;  4JPS A;  4LTU A;  2QHO A;  3L0W B;  1FO4 A;  4B0E A;  2I1J A;  4WH4 A;  5IN7 A;  1N6Z A;  3R3M A;  4LK0 M;  4C4V A;  3NJT A;  2LGI A;  3KYD D;  4WAF A;  4FN2 A;  1I4G A;  2FCS A;  1L2N A;  4AWJ A;  3UGB B;  1RFK A;  1E90 A;  3VRB B;  4LJP B;  1HE8 A;  4AOF A;  4PT5 A;  1XCQ L;  4ZRQ A;  3V3X A;  3ECI A;  4DDG D;  3DBH B;  3R7R A;  4ZRJ A;  4WQM A;  1YJ1 A;  3ML8 A;  4EZJ A;  3L4P A;  3VHT C;  5IOI A;  1PGA A;  1YN3 A;  4CO7 A;  1XO3 A;  3HVD A;  3B1L X;  1I4X A;  2ZNV B;  1TZO A;  3U2S C;  3M95 A;  2DWQ A;  2L0T A;  3AV8 A;  5CTR C;  3ZNI D;  3P2B A;  1WGR A;  3IVF A;  1N5X A;  2LUE A;  2JZP A;  1FM0 D;  2YEP B;  4BKS A;  2I1K A;  1Q1O A;  2WXO A;  4DDI D;  1S1Q B;  2B3A A;  1OQY A;  2ACZ B;  2DAF A;  2QIL A;  1C77 A;  4P6V F;  2BT6 A;  3ZRC A;  5AZG A;  2V3S A;  2J7Q B;  3O65 B;  1UGJ A;  3ZVV A;  3RNF C;  2K0P A;  4PS8 A;  2R61 A;  4LJO B;  4BFR A;  2O2V B;  1ESF A;  3BWU D;  1RRB A;  2KMA A;  2WXH A;  3PZD A;  1TT5 B;  2KHW B;  2M56 B;  1BXT A;  1UWM A;  3P1M A;  4WJP A;  4URK A;  2FUG 1;  1OEY J;  3MC8 A;  1IGC A;  1T6B X;  2GBN A;  2OJW A;  1WE7 A;  2JRH A;  3FKY A;  3T3O A;  4ZOH C;  1D6E C;  2NVU I;  3WAN A;  2DZJ A;  1F2R C;  1WXA A;  1D4B A;  1NI2 A;  3PRP B;  3RYT A;  1WYG A;  3H1U A;  2JQR B;  3MJ5 A;  2MBE A;  2WXK A;  2V1Y A;  1JCK B;  4TMA B;  3APF A;  1WF9 A;  2DNF A;  1TJE A;  3HM6 X;  1SXT A;  3DHI C;  4GDL B;  2DYO A;  4RM9 A;  3H7P B;  4A90 A;  3ALB A;  1E8W A;  2OOB B;  2Z59 B;  4E74 A;  4OVU A;  4FBJ B;  1P0R A;  1E7U A;  2BB5 A;  2D07 B;  1OEY A;  5GMV A;  3SEB A;  3MP9 A;  3TEX A;  3M62 B;  2N7E A;  3TSS A;  2BS2 B;  4MSQ B;  4M0W A;  2PEA A;  1RAX A;  1YQ3 B;  3JSV A;  2LVO A;  5CHV C;  1RYJ A;  4IWQ A;  3PO0 A;  3UIN B;  4EE2 A;  4IOI E;  1J8C A;  4IUM B;  2JZZ A;  1GPX A;  3P42 A;  2ZJD A;  2RR9 A;  3N1Y C;  2K1F A;  5J18 A;  4XYC A;  4ASW C;  2WHI A;  2IPK D;  1E7V A;  1VDV A;  4LNO A;  2PJH A;  4GGQ A;  2XNA C;  4ZDV A;  2IBI B;  4FAD A;  3DBL I;  2NBV B;  1S3S G;  1ET6 A;  5D6J B;  2A5U A;  1DOY A;  2J53 A;  4NAM A;  5DPS A;  5MPO A;  2CJN A;  3QX1 A;  5D7G A;  1V49 A;  1YJI A;  2IO3 B;  2K8H A;  2WS3 B;  3NRZ A;  3VAW A;  1X1M A;  1K50 A;  4DXF A;  4DHZ B;  2IY0 B;  4W9I A;  3KW5 B;  4L1B A;  1TY0 A;  1SGH A;  4P7I A;  3IBE A;  4ANW A;  1PQS A;  4LNF A;  4WUR A;  2EKE C;  3I9V 1;  4P1C C;  3H7S A;  5DPW A;  3Q6B A;  1GG3 A;  2G4S A;  1UBI A;  2NBW B;  4ANV A;  1E5W A;  2ZW0 A;  5DPR A;  3RMK C;  4ICU A;  4QAY A;  2AYO B;  2RMM A;  3I63 C;  2KDE B;  2CJO A;  4WWO A;  2AQ1 B;  1J7A A;  4DXG A;  2K5P A;  1I4Q A;  4KGS A;  1ET9 A;  3E56 A;  4K81 A;  3RUI B;  3B08 A;  2KMC A;  3MFG A;  2WXN A;  1K8R B;  1UEL A;  1WY8 A;  4NNJ B;  3UIP B;  2N4F A;  2OED A;  3Q8E A;  1I35 A;  2JYE A;  4ITK A;  5FK9 C;  2PE6 B;  3TCA A;  2D3G A;  4C7Z A;  3QWZ B;  1FNU A;  3RNB C;  3BVG A;  2KDM A;  1C4C A;  3DBS A;  4ARI A;  2L00 B;  1ZDV A;  2MBB B;  3WAO A;  3MC0 B;  1FXT B;  2FCQ A;  4ZRP A;  2PKO A;  3WAL A;  1JQ4 A;  1P7E A;  2WX1 A;  1NBF C;  1PDX A;  1L6U A;  4G50 A;  1L0X B;  4M8N A;  1V81 A;  2IY1 B;  3KH0 A;  3L17 A;  2V3P A;  4BZA A;  2KDI A;  1QZE A;  2IND C;  2LUM A;  3TJP A;  4MJS A;  3ZGZ A;  3SR6 A;  3A1Q A;  1ZUD 2;  4II2 B;  1YQB A;  4NJ6 A;  1BUI C;  3LJ3 A;  4W9K A;  1ZW7 A;  2KNB A;  3PLV A;  3P4R B;  3ZNH B;  3QQ8 B;  4NJ7 A;  2CS4 A;  2LVQ A;  3IG3 A;  1SSN A;  4MEL A;  3AU4 A;  2V4L A;  3W5V B;  4PK1 A;  2PIA A;  1NYQ A;  1WX7 A;  3AE2 B;  1Y56 A;  1YIW A;  1T0S C;  2RDB C;  2JZ3 B;  3RFZ B;  5E6N A;  4MT5 A;  1TIF A;  3NS1 A;  3QA8 A;  4K1R B;  4FXC A;  2MQJ A;  2HD5 B;  2K6D B;  1MHH E;  4WWP A;  4B9K A;  4MGZ E;  1EWC A;  2KAJ A;  1FMA D;  3AEF B;  3NY5 A;  2K9X A;  3SHQ A;  1BT0 A;  1RFA A;  4HVB A;  2IZV B;  1KH0 A;  1N63 A;  4NZL B;  2BWE S;  3RD2 A;  4IG7 B;  4A9A A;  2LGD A;  1DOI A;  1P9D U;  3FC4 A;  2X8X X;  4M01 A;  5G55 A;  2JVC A;  2R2O A;  4L2Y A;  1ROE A;  3ENE A;  3QK0 A;  1V6E A;  3TMP B;  5AZF A;  2L1A A;  4NAW A;  2LHE A;  1L4Z B;  2XK5 A;  3A9K A;  4YXD B;  1WIA A;  3NVZ A;  3ML9 A;  1KTK A;  3W1S C;  4TUU A;  2MSE D;  2WXM A;  2REX A;  3HK0 A;  5BYR A;  2UU7 A;  1SE2 A;  1AWD A;  1KFY B;  2KJR A;  4WJQ A;  3RZW C;  3U4E G;  4WQO B;  3KUC B;  4DHJ D;  1YMH E;  3BVZ A;  1JWA D;  4C00 A;  3TL5 A;  2EMT A;  5C1Z A;  2KFK A;  4ICV A;  2JT4 B;  2KDB A;  1V1P B;  3RI7 C;  5JXV A;  2KMM A;  3U8Z A;  5H8Y E;  2LRU A;  3C0R B;  2TSS A;  3KWL A;  1F52 A;  2EMS A;  1WGH A;  3LXF A;  2K8B A;  3CF6 E;  4KV2 A;  3DVN U;  4C4V B;  3BYT B;  1WE6 A;  3AEA B;  3PHX B;  4W9L A;  2KT7 A;  3J9C A;  2JWZ A;  4J3O D;  1ZOY B;  2K6Q A;  2O6V A;  2KX3 A;  4S0R A;  1M4V A;  1QQR A;  1D5Z C;  3AU5 A;  4H2A A;  4BBN F;  1I42 A;  1HZ6 A;  4KKI A;  2VH2 A;  2BB6 A;  4HLE A;  3CST A;  4N58 A;  3R7Q A;  2VH1 A;  5DPT A;  3IHP C;  4YTN B;  3B2G A;  1K52 A;  3CSF A;  3PPA A;  4EEW A;  4CHK A;  2C7N B;  2D5G A;  3BK2 A;  1NI3 A;  1RWS A;  3IXS A;  3QIJ A;  1V2Y A;  4USA A;  2R2Q A;  3NVW A;  1CJE A;  2JY6 A;  2KX0 A;  2WXI A;  4IM3 A;  2AL3 A;  2PVG C;  4MAC A;  3AE4 B;  3WAP A;  4DHJ B;  1E8Y A;  1VRA B;  1ACC A;  4ANX A;  1WZ0 A;  2KLC A;  3A33 B;  3VDZ A;  1F1H A;  2KLG A;  3WCQ A;  2KO3 A;  3RCZ A;  2HJ1 A;  3KQ4 A;  3QJZ A;  4GXB A;  3LB8 C;  4G11 A;  1C76 A;  3AEE B;  5I4D A;  2LEK A;  2J52 A;  2PTL A;  2PMV A;  2KWU B;  3ZNZ B;  3QHT A;  2DYB A;  4RGO S;  1JWB D;  5FR6 A;  2RPQ A;  3ZTC A;  2Q5W D;  1LM8 B;  1WGY A;  4HRO A;  4M02 A;  1OGW A;  4W9H A;  2PPH A;  3AB5 A;  2QJL A;  3ZNG C;  2AQ3 B;  2BPS A;  4I6L B;  4AJW A;  4A55 A;  4AJY B;  4R3D A;  1WFY A;  1VJK A;  1UH6 A;  2DYM A;  3NZU A;  4RH6 A;  1GB1 A;  3RNA C;  1R4N I;  1SE9 A;  2N9P C;  2ZZP B;  3VRA B;  4AQ7 A;  3ONS A;  3TBL D;  2Z0D B;  1T5X D;  5E6P A;  2CU3 A;  1E0Z A;  3AH7 A;  3WIM A;  3DHH C;  2KN4 A;  2O6V D;  3Q8F A;  2KDF B;  2BVC A;  4IM0 A;  3W1Y A;  3HIZ A;  4ZRI A;  3NZS A;  3GZN I;  5CX3 A;  2KC1 A;  2EKI A;  1WGD A;  2JRI B;  1L0Y B;  1ZXH A;  2D11 A;  2GB1 A;  4KIK B;  3Q8B A;  3IAS 1;  4JE3 B;  3PVL A;  1AYF A;  3BYY B;  1YOV B;  2BBC A;  4GSW A;  1TS2 A;  1LFD A;  2DBY A;  5G5G A;  1HQR D;  4XC2 A;  4HDQ A;  3AE9 B;  2KC2 A;  4ZHP A;  3VH4 B;  3B0A A;  2CR5 A;  3N1X C;  3SD5 A;  2MJE A;  3L54 A;  2I38 A;  1D5X C;  1A70 A;  1D3Z A;  3ZYY X;  2FBW B;  4LDT B;  4BKS D;  1I4P A;  4RM8 A;  2WXP A;  3PT2 B;  1WR6 E;  1PGX A;  4DXA B;  2Y3A A;  1KLU D;  1PYW D;  4WWN A;  3DBH I;  1DYQ A;  4XDC A;  3ZO5 B;  1P3Q U;  2C9W B;  3H6N A;  1FNW A;  4JWU C;  5CHF A;  5BO4 B;  5EE1 A;  4HPM B;  1I4R A;  4JIO U;  2QEJ C;  2K39 A;  3NUH B;  1N62 A;  3AE5 B;  1C3T A;  2KXJ A;  1L6V A;  3OLM D;  2ZCC A;  1NDD A;  2K25 A;  1SJH D;  1FPY A;  1TBE A;  5J2R A;  2L7R A;  3X23 A;  1ENF A;  2O6V B;  4UDU C;  1XLO A;  1DOX A;  1LXD A;  3ZIM A;  3SU8 X;  4FHJ A;  1QOF A;  1V9J A;  1R4N B;  3DVN V;  4MH0 E;  1WJ4 A;  2B76 B;  1XEE A;  4TV3 A;  3V61 A;  4CYE A;  1I7H A;  1EUV B;  1XCT L;  4N9F 4;  2JPH A;  2MH7 A;  4C56 C;  1GB4 A;  1EM7 A;  2QSD A;  1FCL A;  1YX5 B;  2W3R A;  1GUA B;  2JSV X;  3S2A A;  2BWF A;  1TS5 A;  4PS3 A;  4BOZ B;  4KGR A;  2MP2 A;  3RUL A;  3TEW A;  2BF8 B;  1YJJ A;  2WNM A;  5FR3 A;  4A3O A;  3GE3 C;  1V5O A;  2LJI A;  1L5P A;  4FLH A;  1Z5S B;  2KVR A;  4ANU A;  2MRP A;  2BS4 B;  1HZ5 A;  4WJO A;  3UI3 A;  4P1B C;  1WZ3 A;  2N1V A;  1F77 A;  1L7Y A;  2IO0 B;  2H89 B;  4FHK A;  4RGT A;  5C3J B;  1F0Z A;  4YT0 B;  4GDL A;  3APC A;  3RPF C;  4NPN A;  1SE3 A;  3A4S C;  4KX6 B;  1J0G A;  1QF6 A;  3EFC A;  4E71 A;  4J6I A;  2IYD B;  3U7Z A;  1E8Z A;  2WXL A;  3JVZ X;  2WDV B;  5HHD G;  2D3C A;  3RNC C;  2W54 A;  4W9E A;  1WRI A;  3HVZ A;  3ZQ4 A;  3TIX A;  4YL8 A;  1HXY D;  2N9K A;  4WAA A;  1STE A;  3NVV A;  2KAN A;  3I57 A;  3W5U B;  5JHA A;  1A5R A;  1XXG A;  1KLV A;  3R2T A;  1MG8 A;  2DEN B;  3T9L A;  1FXA A;  4P16 A;  3Q3O C;  5AUI A;  3EGR A;  4NAW B;  2K3U A;  4EUT A;  1PGB A;  3BVM A;  1VD2 A;  1ZP0 B;  2N1W A;  4REZ A;  2INN E;  3IT4 B;  2DZI A;  2KQ7 A;  4GN1 A;  5BYS A;  4PS7 A;  3V6C B;  2NBU A;  2BKR B;  2LGY A;  1E9M A;  1P98 A;  1QT9 A;  1NYR A;  2M1M A;  2KKC A;  5GXG B;  2J4X A;  4W9C A;  3Q8C A;  1YX6 B;  3AMZ A;  2L3Z A;  2SEB D;  3VUX A;  3A9J A;  4KGT A;  1C4P A;  1YD8 U;  3VXW A;  3K9O B;  2UWQ A;  2RDH A;  2VZK B;  1UNS A;  1RM6 C;  2GOW A;  5IO9 A;  2MJ3 A;  4BAX A;  2C5L C;  2V4I B;  4B95 A;  4CQN A;  2BYV E;  3ZTD A;  4B6W A;  3ZDM C;  1TTN A;  2A4Z A;  3H8H A;  2W3S A;  3Q3N C;  1NEN B; 
#chains in the Genus database with same CATH homology
 2WX0 A;  4HXD A;  1CMX B;  3KUD B;  3PLU A;  2FAZ A;  1WMH A;  4FA6 A;  2XBB C;  4PYZ A;  2KJR A;  4WJQ A;  3RZW C;  4WQO B;  3KUC B;  3DCG A;  4DHJ D;  4W9G A;  3TL5 A;  3PRZ A;  2KK8 A;  4TKN A;  2EMT A;  3APD A;  5C1Z A;  2LXC A;  3DVG Y;  3RZF A;  3N30 A;  2KFK A;  2J0M A;  4I6N B;  1KM7 A;  2OJR A;  2JT4 B;  2GBJ A;  2KDB A;  4ICV A;  3UQA A;  5L95 C;  2RSU A;  3VTU A;  3I3T B;  4IC7 B;  1WJU A;  4KZC A;  2D10 A;  2QHO A;  3L0W B;  4BOS C;  4TQ1 A;  2I1J A;  3U8Z A;  2UYZ B;  2LRU A;  3C0R B;  3R3M A;  1IP9 A;  3PTF C;  2EMS A;  2PE9 A;  1WGH A;  4HK2 A;  4OVV A;  2ZPN A;  3DBR I;  3KYD D;  4NQL B;  2K8B A;  3CF6 E;  4FN2 A;  4KV2 A;  2FCS A;  1L2N A;  3DVN U;  4AWJ A;  4W9L A;  1WE6 A;  3PHX B;  3UGB B;  2JWZ A;  2K6Q A;  1E90 A;  3PRE A;  2O6V A;  2KX3 A;  4LJP B;  1HE8 A;  4AOF A;  2KD0 A;  2L05 A;  3AU5 A;  1EO6 A;  4BBN F;  1I42 A;  4M0W B;  4FJV B;  3ECI A;  4DDG D;  4HLE A;  3CST A;  3R7R A;  3R7Q A;  4ZRJ A;  3R66 C;  2FCN A;  1YJ1 A;  3ML8 A;  5DPT A;  4EZJ A;  3EFU A;  3IHP C;  3VHT C;  2ZEQ A;  3ZW3 A;  3DOW A;  3Q3F A;  3CSF A;  4CO7 A;  3PPA A;  4EEW A;  4HJK A;  3PS6 A;  4CHK A;  3D32 A;  2C7N B;  3B1L X;  4DK5 A;  1Y8R C;  3CMM B;  4PYU A;  2ZNV B;  3QIJ A;  3M95 A;  1V2Y A;  3ZNI D;  2L0T A;  5CTR C;  4BKG A;  1TZ1 A;  2R2Q A;  3P2B A;  1WGR A;  3IVF A;  2FID A;  2MBH A;  2JY6 A;  2M0X A;  2MW5 A;  3VTW A;  1T0Y A;  2LUE A;  2RD0 A;  4HPL B;  4NQK E;  2N9E B;  3ZKJ C;  4BKS A;  2I1K A;  2JF5 A;  2KX0 A;  1Q1O A;  2AL3 A;  1GNU A;  4IM3 A;  3L13 A;  2MA9 B;  3WAP A;  1S1Q B;  2B3A A;  1OQY A;  2DAF A;  2G4D B;  3AUL A;  1E8Y A;  1WI0 A;  2N9X A;  4DDI D;  4DHJ B;  4ANX A;  4W9J A;  1WZ0 A;  2KLC A;  3A33 B;  4IWO A;  2V3S A;  5AZG A;  3ZRC A;  3VDZ A;  3ZDM C;  4JL9 A;  2J7Q B;  2KLG A;  3O65 B;  2KO3 A;  3RCZ A;  3ZVV A;  1ZGU B;  4IW0 A;  4PS8 A;  5EDS A;  2MLB A;  4LJO B;  3VUY A;  4BFR A;  4F7Z A;  2O2V B;  3QJZ A;  2DZM A;  1SIF A;  4GXB A;  4DWF A;  2W9N A;  2KFK B;  1WH3 A;  1RRB A;  2KMA A;  4G11 A;  3PZD A;  3LDZ E;  2HTH A;  2KHW B;  4GMV A;  3UF8 A;  3PGE A;  1KOT A;  4WJP A;  1GJZ A;  2KWU B;  4URK A;  2KTR A;  3ZNZ B;  2YLM A;  3V60 A;  3QHT A;  2G45 B;  1H8C A;  1OEY J;  3M63 B;  2DYB A;  2GBN A;  2KTR B;  5JZE B;  1Z2M A;  3V62 A;  1WE7 A;  2BKF A;  3OJ4 B;  2JRH A;  3MJW A;  5FR6 A;  2RPQ A;  3ZTC A;  1LM8 B;  1WGY A;  3KVF B;  2NVU I;  3WAN A;  2DZJ A;  1OGW A;  4W9H A;  1WXA A;  2PPH A;  1C1Y B;  2MBO A;  3ZNG C;  5E6O A;  1NI2 A;  4HDO A;  3PRP B;  2ZCB A;  2BPS A;  3RYT A;  5AEK B;  4I6L B;  4AJW A;  4AJY B;  3QAQ A;  5JHB A;  1WFY A;  1UH6 A;  1V5T A;  3H1U A;  3OAW A;  2DYM A;  3NZU A;  4KIK A;  3IFW B;  2MBE A;  5LXI B;  2LRW A;  2V1Y A;  3VTV A;  3EEC A;  1R4N I;  3PSE B;  3APF A;  1WF9 A;  3H7P A;  1P1A A;  4MEM A;  3W1S A;  1SE9 A;  2N9P C;  2ZZP B;  3DQV A;  3HM6 X;  3PRM B;  4GDL B;  5AZH A;  2DYO A;  4RM9 A;  3H7P B;  4E3C A;  3ALB A;  4BKT A;  1E8W A;  2J0K A;  2OOB B;  3ONS A;  2Z0D B;  3TBL D;  3X0W A;  2Z59 B;  4MGK E;  4E74 A;  5E6P A;  4OVU A;  3U7D A;  4FBJ B;  2LGX A;  1P0R A;  1E7U A;  3WIM A;  4GU2 A;  4KDI C;  2O6V D;  2D07 B;  1OEY A;  5GMV A;  1WYW B;  2KDF B;  3DVG X;  5D94 A;  3M62 B;  2FUH B;  4IM0 A;  3W1Y A;  3HIZ A;  4DHZ E;  2N7E A;  4F1S A;  4ZRI A;  3NZS A;  4MSQ B;  2PEA A;  3A1Q B;  3GZN I;  5CX3 A;  3DDC B;  1Q5W B;  2KC1 A;  3N3K B;  4W9F A;  1WGD A;  2LVP A;  4KVG B;  2JRI B;  1RAX A;  2KWC A;  3JSV A;  2LD9 A;  1OTR B;  2D11 A;  2DZK A;  2LVO A;  5CHV C;  4IWQ A;  4KIK B;  4GOC A;  3UIN B;  4RMA A;  2LZ6 A;  2RGF A;  5C23 A;  2BYE A;  1J8C A;  4IUM B;  2JZZ A;  2ZJD A;  2RR9 A;  3PVL A;  5TR5 A;  2K1F A;  5J18 A;  4GSW A;  4ASW C;  1LFD A;  3M3J A;  3ZRF A;  4NY0 A;  4K7W A;  1E7V A;  3N32 A;  4XC2 A;  3VVW B;  4HDQ A;  2PJH A;  2KC2 A;  4GGQ A;  3T8M A;  1G6J A;  2ZVN A;  3VH4 B;  4ZDV A;  4LCD E;  4ZYN A;  2IBI B;  2KFJ A;  4FAD A;  3B0A A;  2CR5 A;  3DBL I;  3SD5 A;  3WAM A;  2NBV B;  1S3S G;  3L54 A;  1IYF A;  5D6J B;  1D3Z A;  2A5U A;  5KHQ A;  4LDT B;  4BKS D;  2CHX A;  4IM2 A;  4JLC A;  2CU1 A;  2LJ5 A;  3ZLZ A;  4RM8 A;  5DPS A;  3PT2 B;  1WR6 E;  3QX1 A;  4DXA B;  1EF1 A;  1XT9 B;  5D7G A;  2GBK A;  1UBQ A;  1V49 A;  5IAA C;  2FCM A;  3NHE B;  4WWN A;  2IO3 B;  2K8H A;  3DBH I;  4GIV A;  4HCN B;  3ZO5 B;  4BVU C;  1P3Q U;  2C9W B;  2KWV B;  1X1M A;  3H6N A;  2FNJ B;  3VAW A;  4DHZ B;  5CHF A;  5BO4 B;  2IY0 B;  2NR2 A;  4W9I A;  3KW5 B;  4MSM B;  4HPM B;  4K7U A;  1SGH A;  2KQS A;  4JIO U;  4KZ0 A;  4MGI E;  4P7I A;  2K39 A;  5IA7 A;  3DPD A;  1C3T A;  3IBE A;  4ANW A;  3VH3 B;  1PQS A;  2KXJ A;  3OLM D;  1Q0W B;  2GBM A;  2ZNV C;  2EKE C;  2ZCC A;  1WM3 A;  3H7S A;  4EZK A;  1NDD A;  2K25 A;  5DPW A;  4GDK B;  1TBE A;  2DHZ A;  1GG3 A;  2L7R A;  3X23 A;  5J2R A;  3SDL C;  1V80 A;  2G4S A;  5HKH A;  2LAS A;  1UBI A;  2NBW B;  2JXX A;  2O6V B;  5KHO A;  2YVC A;  4ANV A;  1E5W A;  1WR1 A;  1LXD A;  3ZIM A;  2ZPY A;  3SU8 X;  4FHJ A;  5DPR A;  3RT3 B;  1V9J A;  3DVN V;  4MH0 E;  1WJ4 A;  4AUQ C;  2CHW A;  4ICU A;  3BY4 B;  4TV3 A;  3V61 A;  5J17 A;  4CYE A;  1GC7 A;  2AYO B;  2NPT A;  1EF5 A;  1XD3 B;  4X57 B;  3A4R A;  1RLF A;  1WX8 A;  1EUV B;  2KDE B;  4N9F 4;  2JPH A;  4TQ0 A;  1WM2 A;  2C7H A;  3GOE A;  4WWO A;  1WJ6 A;  4M8M A;  1E8X A;  4JGH B;  3MHS D;  3HHM A;  2AL6 A;  1YX5 B;  3KUZ A;  3V6E B;  3ZUN A;  4GB9 A;  4F8C B;  2WDT B;  3EHV A;  1GUA B;  4K7S A;  2CHZ A;  3S2A A;  4G3X B;  2M4N A;  3EC8 A;  2BWF A;  4MGY E;  4K81 A;  2GBR A;  3RUI B;  4PS3 A;  2IO1 B;  4MDK E;  3B08 A;  2KMC A;  1VCB A;  2G3Q B;  4BOZ B;  1K8R B;  1UEL A;  1UGM A;  2MP2 A;  1WY8 A;  3RUL A;  4EOY A;  1H4R A;  4NNJ B;  1WRD B;  3UIP B;  1M94 A;  1XQQ A;  2N4F A;  2XK5 B;  2BF8 B;  1UZX B;  1ZKH A;  4JQW C;  4XZ4 A;  1V86 A;  1I35 A;  2MBQ A;  1U4A A;  2MCN B;  4A3O A;  3QAR A;  1V5O A;  2PE6 B;  3TCA A;  2D3G A;  4FLH A;  5L83 A;  5CHW A;  1Z5S B;  2KVR A;  3BIN A;  5G2N A;  3AI5 A;  4ANU A;  2MRP A;  3PHW B;  3QWZ B;  2NCN A;  4HCP B;  1KJT A;  4WJO A;  3L10 B;  2NPT B;  2JUO A;  3QC8 B;  2KOX A;  3DBS A;  1WZ3 A;  2N1V A;  4HWI B;  2AWT A;  1IPG A;  2KJH B;  1JRU A;  3L08 A;  2L00 B;  4BBN C;  1L7Y A;  2IO0 B;  4FJY A;  2D2Q A;  1J19 A;  2HJ8 A;  4FHK A;  2MBB B;  4KDL B;  3WAO A;  3K9P B;  1FXT B;  2FCQ A;  4A3P A;  3PV1 A;  3WAL A;  4GDL A;  3APC A;  2WX1 A;  1NBF C;  2Y5B B;  4NPN A;  4EFO A;  4G50 A;  2ASQ A;  2J0J A;  4M8N A;  2LI5 A;  1V81 A;  3L16 A;  4IWP A;  2IY1 B;  3A4S C;  3KH0 A;  4I6P A;  3L17 A;  1WXS A;  2IO2 B;  1J0G A;  2KTF A;  2ZVO A;  2KDI A;  1QZE A;  2N7D A;  3MTN B;  2KJ6 A;  3TJP A;  4E71 A;  3H9D A;  4J6I A;  2IYD B;  4MJS A;  1E8Z A;  2DAJ A;  1WXV A;  3A1Q A;  4II2 B;  3A9K B;  2WYQ A;  1YQB A;  4NJ6 A;  3KYC D;  3AXC A;  3JVZ X;  4KSL C;  3LJ3 A;  4LDT D;  4W9K A;  1ZW7 A;  2LXA A;  2KNB A;  3PLV A;  4FUL A;  3NOB A;  3QQ8 B;  3ZNH B;  4NJ7 A;  2CS4 A;  2LVQ A;  3UIO B;  2L76 A;  3IG3 A;  3JW0 X;  4MEL A;  3AU4 A;  2V4L A;  1ISN A;  2BGF A;  4W9E A;  2BYF A;  3TIX A;  2O2V A;  4YL8 A;  4KSK C;  3HM3 A;  2MP2 B;  3Q3J A;  4WAA A;  1WX7 A;  5JH5 C;  4EZL A;  3UQB A;  2KAN A;  5D2M B;  1YIW A;  5JHA A;  4EKU A;  2LWP A;  2VRR B;  1A5R A;  2C7M B;  2KN5 A;  2C60 A;  2JZ3 B;  3JYU A;  1KLV A;  5LLI A;  5E6N A;  1LQB A;  1MG8 A;  4A20 A;  2DEN B;  3T9L A;  3WA0 A;  3QA8 A;  2AEH A;  4K1R B;  2MQJ A;  2HD5 B;  4G0N B;  4NAW B;  2K6D B;  4EUT A;  2HE7 A;  2Z0E B;  4WWP A;  4B9K A;  4XX5 A;  3JSV B;  3OJ3 A;  1VD2 A;  1WMH B;  2KZR A;  4ZRK A;  2N1W A;  4MGZ E;  4W9D A;  3NY5 A;  2DZI A;  2KQ7 A;  3QCA A;  2DX5 B;  4GN1 A;  4PS7 A;  5DCN A;  3SHQ A;  3V6C B;  2NBU A;  1BT0 A;  2BKR B;  2LGY A;  1RFA A;  1P98 A;  4HVB A;  4AP4 C;  2IZV B;  2WWZ A;  2FIF A;  1WGG A;  3ZDT A;  2M1M A;  2BWE S;  2KKC A;  3RD2 A;  4IG7 B;  4W9C A;  2LGD A;  1YX6 B;  4MM3 A;  1P9D U;  2L3Z A;  3VUX A;  4WJN A;  3A9J A;  4II3 B;  5G55 A;  2JVC A;  2R2O A;  2XEW A;  3VUW A;  2M17 A;  2CKH B;  1YD8 U;  2L8J A;  3NS8 A;  3K9O B;  2UWQ A;  2MX2 A;  2L0F A;  3A9J B;  3ENE A;  4GDK A;  3VXW A;  1WX9 A;  5LXH A;  3QK0 A;  1AAR A;  4MJS B;  2GMI C;  1V6E A;  4FJZ A;  1WXM A;  1GC6 A;  3TMP B;  5AZF A;  4NAW A;  2GOW A;  2XK5 A;  3A9K A;  1WIA A;  2C5L C;  3ML9 A;  4B95 A;  1F9J A;  3W1S C;  2NS5 A;  4TUU A;  3VFK A;  2MSE D;  2BYV E;  3U30 A;  4DBG A;  3ZTD A;  4B6W A;  2M8S A;  3VQI A;  1R4M I;  1TGZ B;  1WJN A;  1TTN A;  2A4Z A;  2REX A;  2K8C A;  1UD7 A;  3HK0 A;  2MWS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...