2REXA

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
molecule keywords Plexin-B1
total genus 28
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rexA00
2MBEA 2K8CA 1GC6A 1WX9A 1WJUA 3CF6E 4BFRA 4WJOA 5CHVC 4W9JA 5E6PA 2FIDA 1UZXB 2PPHA 2KNBA 2KTFA 3IHPC 4ICVA 3KYDD 3QK0A 3R7RA 2IO2B 5CX3A 3L08A 4KSKC 4EZLA 3NY5A 4HWIB 3VTUA 4HDQA 3PT2B 3KYCD 4P7IA 3ZNGC 2MA9B 2GBNA 4MGKE 4TV3A 4FLHA 1EUVB 1EO6A 3TMPB 2DZMA 2K8BA 2MBQA 5E6OA 1A5RA 4TUUA 2BKFA 3AULA 1WI0A 2NR2A 1YX6B 2KMAA 4BKTA 4BKSD 2N1WA 3W1SA 4DBGA 1LXDA 4F1SA 2DZJA 3QHTA 3A33B 2NS5A 4DHZB 1RAXA 4TKNA 2RD0A 2ZCCA 1E8ZA 2LD9A 3QC8B 4MJSA 1V2YA 3SHQA 1NDDA 3DBLI 3NOBA 5TR5A 2D10A 1C3TA 2N1VA 2KFKA 1E90A 2BYFA 2R2QA 2L8JA 3CMMB 4KV2A 1KM7A 3RT3B 1L2NA 4OVUA 2JZZA 2GBJA 4TQ1A 1EF1A 4X57B 5AZFA 3AU4A 2Z0EB 3IBEA 2FAZA 2QHOA 2JY6A 4I6LB 2KC2A 4RM8A 1H4RA 3V6CB 3VDZA 2HTHA 2DENB 3QA8A 4GU2A 3PRZA 2CHWA 3PGEA 5AEKB 2V3SA 1KLVA 2K39A 3PZDA 3TL5A 2LGXA 3MTNB 2ZVNA 1Q0WB 4FHKA 1GUAB 3AU5A 3DVNV 4ZYNA 3V62A 4XZ4A 1WJ6A 1NBFC 2REXA 2LXCA 4KZ0A 5C23A 1PQSA 2KQSA 4WJPA 5IAAC 3GOEA 3VTVA 2JZ3B 3TCAA 2BWFA 5J2RA 3WA0A 4MSMB 1Z5SB 5KHQA 3PREA 4JL9A 5E6NA 4ANUA 4BKGA 2MP2A 2MQJA 1WF9A 2M0XA 3B0AA 3H7SA 4AOFA 4YL8A 4A20A 4K7UA 2O2VA 5HKHA 1AARA 2LWPA 4W9KA 4XC2A 1WGRA 3IFWB 2CKHB 3DBRI 3GZNI 3ZDTA 2C5LC 3VVWB 3H9DA 2JXXA 2VRRB 3HM6X 4FBJB 1G6JA 1GC7A 2KOXA 4MDKE 4FJYA 3D32A 3M62B 3A1QA 2N9PC 3K9OB 3A9JB 1SE9A 2CHZA 1XQQA 1CMXB 3EECA 4F7ZA 1J0GA 1WGHA 2BYEA 5LLIA 2LVOA 2MBHA 2BF8B 3UIOB 4E74A 1TGZB 3V60A 3OLMD 3A4RA 3ZVVA 2GBKA 5KHOA 2MP2B 2ZCBA 4GIVA 1L7YA 2KD0A 4HXDA 3HK0A 2I1JA 2KJ6A 2N9XA 3WANA 4WWPA 2LVPA 3WIMA 1TBEA 1WZ0A 4ANWA 3W1SC 3B1LX 2ZPYA 3PPAA 5G2NA 1WRDB 1V86A 2NVUI 4MEMA 3VHTC 1LFDA 4WJQA 4MGYE 3RZWC 4B6WA 3NZSA 4AP4C 4E71A 2IZVB 2KJHB 4M0WB 3KW5B 2DX5B 2KXJA 2FCMA 3APDA 2DYOA 1GNUA 3RUIB 3DBSA 1P0RA 2L76A 4FN2A 5D94A 2D2QA 4MSQB 4EFOA 3ECIA 1GG3A 4E3CA 1M94A 4W9HA 3Q3FA 2IO1B 1YQBA 3B08A 3ZO5B 4ANXA 2CR5A 2DAFA 2KKCA 4DDGD 2G4DB 2MBBB 3PS6A 4KIKB 3U7DA 3VFKA 4HCPB 3ZUNA 3JYUA 1WGDA 5FR6A 1P9DU 3V61A 1SIFA 4II2B 4XX5A 3PV1A 3VH4B 3ZTCA 2OJRA 1IPGA 4ANVA 4HJKA 3DBHI 2NPTB 2JUOA 3C0RB 3BINA 4F8CB 2L7RA 1IYFA 4II3B 2G45B 3VXWA 3QARA 2FCQA 2PE9A 3AXCA 1C1YB 2ASQA 4GDKB 4MGIE 3WAMA 1WXAA 2YLMA 4HK2A 3BY4B 4DHJB 5D7GA 4WWOA 3DVGX 4ZRJA 2AWTA 4NPNA 3ZTDA 2KFKB 4EKUA 1WM3A 2JPHA 5JHAA 5L83A 2LUEA 1OEYJ 4GMVA 1YD8U 2ZPNA 3N32A 3PSEB 2V1YA 2IYDB 4M8MA 4PS3A 5J17A 1H8CA 1F9JA 3IG3A 2V4LA 2WWZA 2D11A 2GBRA 3U30A 3VTWA 4EUTA 2LGDA 3KUDB 4PS7A 3LDZE 1UBIA 4GB9A 4MJSB 4PS8A 4FULA 3OJ3A 2KWVB 2Z59B 3ZW3A 4BKSA 4BOZB 3PHWB 2MSED 3A9KA 3DCGA 5D6JB 3ZNID 4B9KA 1TTNA 4DHZE 3CSFA 2BWES 4TQ0A 2N7EA 1U4AA 4IM2A 2FIFA 2MX2A 3QCAA 3X0WA 4BOSC 4HDOA 3TIXA 4URKA 1RLFA 4IM3A 1WY8A 4IWQA 3JSVB 3ZDMC 4PYUA 2KLCA 3VUXA 3QAQA 3VH3B 2YVCA 2KFJA 1S1QB 3R66C 2FUHB 4G11A 2NCNA 4GDKA 4JIOU 2J7QB 1LM8B 1VCBA 2KJRA 4A3OA 1YJ1A 3NS8A 2KDBA 1EF5A 3QJZA 4LDTB 5D2MB 2KX0A 3VQIA 5JHBA 2DHZA 1YIWA 3I3TB 3WAPA 5L95C 1WR1A 3NHEB 1Y8RC 4ZDVA 1WGYA 4GOCA 2UWQA 4B95A 1T0YA 2B3AA 2L0FA 2KO3A 2IO3B 2ZJDA 2DZKA 1V80A 4IWPA 2N4FA 4DXAB 2KZRA 3ZRFA 1WH3A 2NBWB 5AZHA 1WIAA 2K1FA 3A1QB 2D07B 3QWZB 4KZCA 3VUWA 4W9CA 4NY0A 1I35A 2CU1A 2EMSA 4K81A 3L54A 3JSVA 2XK5A 4KDLB 2KC1A 2RSUA 1OGWA 4FJZA 3OAWA 2ZEQA 1WMHB 3DPDA 4HPLB 3APFA 4NJ7A 5CHWA 1Q1OA 2IY1B 1UBQA 2BPSA 4EOYA 2DYBA 4CO7A 5DPTA 3R3MA 2GOWA 4BVUC 3HM3A 3V6EB 3EHVA 3ZRCA 5DPSA 1ZGUB 1X1MA 2MLBA 2M4NA 1E7UA 4GGQA 4LCDE 2FCNA 2KDFB 2R2OA 4G0NB 2FNJB 4IWOA 3T8MA 3UINB 3PLVA 3WAOA 1UGMA 1KJTA 2MRPA 1WXVA 2NBVB 2KHWB 3MHSD 4BBNC 1QZEA 3TJPA 5C1ZA 1E7VA 4GXBA 1J19A 2KX3A 2WX1A 4GDLB 2N9EB 4DDID 2MWSB 3H7PA 1VD2A 2NBUA 2Y5BB 2KDIA 1Q5WB 3ML8A 4JGHB 4KDIC 2KTRA 3WALA 4JLCA 3VAWA 4WWNA 1WE6A 1WZ3A 2KMCA 2AYOB 3KH0A 1YX5B 2NPTA 2IBIB 5LXHA 1JRUA 2AEHA 2UYZB 4K7WA 3MJWA 3P2BA 5DPRA 1J8CA 3H6NA 1WMHA 2I1KA 4NAWB 4HVBA 3W1YA 4AWJA 3TBLD 4KIKA 2L0TA 5G55A 3OJ4B 1WJ4A 2LXAA 1WGGA 1WR6E 2O6VB 2L05A 3QX1A 2ZVOA 1TZ1A 2XK5B 3L0WB 4GDLA 4W9FA 2BYVE 3H7PB 4MELA 3EFUA 2O2VB 4FHJA 2MBOA 1NI2A 2LVQA 2DYMA 4BBNF 3Q3JA 3K9PB 4FJVB 3SU8X 4NNJB 3PLUA 2D3GA 2N7DA 4G50A 5J18A 1ZW7A 3RYTA 4AJWA 4EZKA 3DOWA 1E8XA 1XT9B 3ONSA 1P3QU 5CHFA 3SDLC 2KDEB 3U8ZA 3RCZA 5IA7A 1WXSA 4CHKA 2LASA 4N9F4 1SGHA 1IP9A 1RFAA 4W9DA 2GBMA 3H1UA 4LJOB 3JVZX 5GMVA 2A4ZA 2JRHA 2M1MA 4IW0A 4PYZA 2A5UA 3DQVA 1HE8A 1WX7A 3T9LA 4NAWA 3PTFC 4DHJD 1E8YA 3QQ8B 4WJNA 5AZGA 1XD3B 3ZNHB 2JVCA 2IO0B 4A3PA 2KTRB 1R4NI 2PE6B 2KN5A 3KVFB 3A9JA 3EC8A 3HHMA 2PEAA 4FADA 3CSTA 1V81A 3NZUA 2MW5A 1V9JA 4KVGB 4W9LA 5DCNA 1S3SG 4HLEA 3X23A 4NQLB 3KUCB 3PRPB 4JQWC 4RMAA 1P98A 2BGFA 2JF5A 3LJ3A 2O6VA 5LXIB 4I6NB 4RM9A 1E5WA 2K8HA 2ZNVB 4AJYB 4K1RB 1Z2MA 3UGBB 3ML9A 2KWUB 4IG7B 1MG8A 2XBBC 1OTRB 2LJ5A 1WX8A 3QIJA 1WXMA 2EMTA 4ICUA 2KLGA 2XEWA 2LI5A 3O65B 4FA6A 4I6PA 3SD5A 4DK5A 4ASWC 4DWFA 2O6VD 4NQKE 2K25A 3A4SC 4M8NA 4ZRIA 2LZ6A 4CYEA 2M17A 4LDTD 3PHXB 4NJ6A 2G4SA 1FXTB 2AL6A 2HJ8A 2OOBB 4W9IA 3L17A 4IM0A 2IY0B 1R4MI 2DZIA 5EDSA 2G3QB 1WJNA 1WE7A 3VUYA 2WYQA 5JH5C 2AL3A 3APCA 1V6EA 1UH6A 2HD5B 2LRUA 3JW0X 4HPMB 4K7SA 4MGZE 4W9EA 1RRBA 2L3ZA 3A9KB 4W9GA 2JRIB 2J0MA 4IUMB 2C7HA 1UELA 3AI5A 3N30A 4GSWA 5CTRC 1ISNA 2KQ7A 3DDCB 2WDTB 3DVNU 3L10B 2KVRA 3DVGY 4J6IA 1V5TA 1D3ZA 1ZKHA 4HCNB 3IVFA 2WX0A 1OQYA 3M95A 2ZZPB 1V49A 3ENEA 1I42A 2GMIC 4EZJA 1WM2A 4IC7B 4KSLC 2LGYA 2HE7A 3UQBA 4MM3A 2ZNVC 3ZIMA 2M8SA 2KK8A 4AUQC 3ZKJC 2K6DB 2C60A 1KOTA 1E8WA 3RULA 3HIZA 3ZLZA 3L13A 4G3XB 2C7MB 2RR9A 1OEYA 3N3KB 1WYWB 3UIPB 4EEWA 4OVVA 4WQOB 2K6QA 2W9NA 3L16A 2C7NB 4ZRKA 5DPWA 2J0KA 2RGFA 2PJHA 3M63B 1V5OA 2EKEC 3S2AA 2J0JA 2CS4A 1LQBA 2BKRB 1P1AA 3RD2A 3UF8A 1K8RB 3R7QA 2JWZA 2CHXA 3M3JA 4MH0E 2LRWA 1BT0A 3UQAA 2C9WB 2FCSA 4LJPB 3PRMB 2KWCA 2L00B 2JT4B 5JZEB 2KANA 4GN1A 3KUZA 2RPQA 1WFYA 3ALBA 4WAAA 5BO4B 1GJZA 2Z0DB 3ZNZB 2MCNB 3PVLA 3RZFA 2DAJA 1UD7A
chains in the Genus database with same CATH superfamily
1VZ8A 2WXGA 1GC6A 1WX9A 5CHVC 3I9V1 4W9JA 5E6PA 2FIDA 2AQ1B 1TKYA 2PPHA 1YMHE 5CX3A 2KDMA 4EZLA 1PGXA 3VTUA 3ZNGC 4A9AA 1YNTE 4L2YA 2BYTA 3N1YC 1KRHA 3DWMA 1FEHA 1EUVB 2VZKB 1N63A 1C79A 1WGKA 5GXGB 2DZJA 3A33B 2NS5A 4DHZB 2LD9A 5IKCM 1YJIA 2W82A 3NOBA 2D10A 2KFKA 1XF5L 2WHIA 2R2QA 2L8JA 4BAXA 4KV2A 1JCKB 4OVUA 1OQRA 5AZFA 2K22A 3Q8FA 2Y5PA 3IBEA 2FAZA 3Q3NC 2WXHA 3KWLA 1QOGA 3PGEA 1V97A 3AM9A 2V3SA 3RI7C 3PZDA 2LGXA 5EE0A 1Q0WB 1GUAB 2IJ0A 3Q8CA 4MM3B 4KZ0A 1PQSA 2KQSA 1KLGD 3GOEA 1MHXA 2WXPA 3TCAA 4XDCA 1TKGA 1Z5SB 5KHQA 1ESFA 4JL9A 5E6NA 2MP2A 3IXSA 4P6VF 1AARA 2LWPA 3AE3B 3IFWB 3DBRI 3H9DA 2VRRB 3P4QB 2KOXA 4NZLB 3GP7A 4FJYA 1K50A 1GPXA 2N9PC 2N9KA 2PVOD 1XQQA 1JWMD 5LLIA 3L4PA 3V60A 1N5WA 4GIVA 1L7YA 5IP4D 2QILA 2N9XA 2KJ6A 3WANA 1WYGA 5EE9A 3B1LX 2LUMA 2NMQA 1LFDA 4WJQA 1BMLC 3BYTB 2DX5B 3GE8C 1RWSA 3APDA 1MG4A 2BS3B 3ECIA 1I4PA 3Q3FA 2IO1B 2CR5A 4KIKB 3PS6A 3VFKA 1P9DU 3V61A 4CQNA 1UWXA 1SB3C 2NPTB 3C0RB 2WQYB 4US8A 3QARA 2FCQA 1PDXA 3ZQ4A 3U52E 2YLMA 4HK2A 3BY4B 1ENFA 2AWTA 3HRDD 3N32A 1HXYD 2ZPNA 1H8CA 1F9JA 1JWBD 2WWZA 1EWCA 2GBRA 4M02A 3VTWA 4EUTA 4PS8A 3KUDB 4PS7A 3VUYA 1UBIA 3W9CB 3OJ3A 1IGCA 2Z59B 3Q3OC 3ZNID 1TTNA 4DHZE 4TQ0A 1CJEA 4J3OD 4L23A 4A55A 4BOSC 4HDOA 1WY8A 1MPEA 1PYWD 3VUXA 1I4XA 1EU3A 2FUHB 4REZA 4M01A 3RNFC 2J7QB 2KJRA 2KDBA 4KGSA 4LDTB 3LXFA 2KX0A 4JPSA 3I3TB 5L95C 3NHEB 4ZDVA 1Q10A 2ZJDA 4IWPA 2LGSA 2RDHA 2KZRA 3ZRFA 2NBWB 2WDQB 2XNAC 4LLGM 2EMSA 3L54A 2XK5A 1J7CA 3RPFC 3AE7B 1YQ4B 1FD6A 4HPLB 4NJ7A 1JALA 3R3MA 2PW9A 3HM3A 3EHVA 1D5MC 2W3SA 2M4NA 2R2OA 2WLBA 2B76B 1L6VA 4XGAB 1UWMA 2QC8A 3MHSD 1QZEA 1TKEA 3TJPA 4GXBA 1JRPA 1JQ4A 1VZ6A 2KDIA 1Q5WB 4FXCA 4JLCA 3VAWA 1WE6A 2KMCA 5HG2A 4K7WA 1J8CA 5LNK1 5DPRA 3TEXA 4KIKA 2E3TA 1WJ4A 2KACA 2ACZB 3HUIA 3SR6A 4K3BA 1T3QA 2L05A 2ZVOA 2XK5B 1UUPA 1UF0A 2GI9A 2XN9C 2BYVE 4S17A 4FHJA 1NI2A 3NVYA 2V9HA 4G50A 1ZW7A 2GRIA 5CHFA 3U8ZA 1WWTA 5IA7A 2WXRA 4CHKA 1SGHA 4C56C 1B1ZA 4LJOB 2BQQA 1MJDA 3EUB2 4A90A 2X38A 1WX7A 3T9LA 4YSXB 3PTFC 1T0RC 4N58A 2JVCA 2KTRB 2ON8A 3KVFB 3EC8A 3HHMA 4TMAB 3CSTA 5DCNA 3KUCB 3PRPB 1P98A 2JF5A 1DGJA 2WXLA 2ZNVB 1C76A 1IUEA 3ML9A 3DBHB 1OTRB 1WX8A 4FA6A 3NVZA 4I6PA 1QF6A 2KMMA 4M8NA 4CYEA 2QSDA 1ROEA 4LDTD 1A70A 2G4SA 2OOBB 2AL6A 4HKQA 2RDGA 4IM0A 4HPMB 4K7SA 1RRBA 3A9KB 4W9GA 2JRIB 3I5JC 2KN4A 5G5GA 1V1OA 5CTRC 3V3XA 1ZKHA 2K0PA 1NEKB 1T0QC 3ENEA 4IC7B 2HE7A 3UQBA 2LGIA 2K5PA 2M8SA 2K6DB 4C7YA 1E8WA 3HIZA 3ZLZA 1F2RI 1N6ZA 3N3KB 5HI1A 4EEWA 4OVVA 2GB1A 2K6QA 4ZRKA 4LNOA 2INNE 2HTME 3S2AA 4OW0A 2J0JA 3IAM1 1P1AA 4MH0E 2CHXA 2QJLA 1ZUD2 4EE2A 4DXFA 4Q2JA 1HQRD 1TY2A 2N0SB 1SSNA 2RPQA 5BO4B 2Z0DB 3Q14C 3RZFA 1UD7A 2K8CA 3J9CA 5BMGA 3E9SA 2L52A 2KNBA 2KTFA 4ICVA 1K52A 4WAFA 3W5UB 2RDBC 4KSKC 4HDQA 3PT2B 4P7IA 3PZ7A 2GBNA 1CZPA 4R3DA 4L1BA 2ONQA 1HA5A 3TMPB 2QEJC 2WXOA 4WQMA 5E6OA 3URYA 1E0ZA 3KLSX 3R2IA 4BKSD 3W1SA 4F1SA 1XCQL 4KKIA 1RAXA 2ZCCA 3QC8B 4MJSA 1D5ZC 3SHQA 1FCLA 1WSPA 1XO3A 2WXKA 4LTUA 3CMMB 4ZHPA 1C78A 4X57B 1BXTA 3HVZA 2QHOA 2JY6A 4RM8A 3VDZA 1H4RA 1FNWA 3QA8A 1KLVA 3Q3MC 2ZVNA 2INDC 3V62A 2K3UA 1WJ6A 5I4DA 2LXCA 3EA6A 1XCTL 2JZ3B 2AQ3B 1GB1A 1ZDXA 4KX6B 3PREA 1FIQA 1R4MB 1TY0A 4BKGA 4XWTA 1F0ZA 5HKHA 1VDVA 4XC2A 3N20C 4H2AA 2OHFA 3HM6X 4FBJB 3P4RB 3M62B 3A9JB 2AX5A 1VJKA 1CMXB 4F7ZA 1WGHA 2BYEA 1FNUA 1TGZB 1C4CA 2GBKA 2BTEA 2ZCBA 2KD0A 5FK9C 2I1JA 2N9LA 1FNVA 4ANWA 3WIMA 1WZ0A 1L5PA 2ZPYA 5G2NA 1V86A 2NVUI 4MEMA 1UGJA 5IOIA 4AP4C 4E71A 1ZOYB 2FCMA 2DYOA 3RUIB 2WP9B 3DBSA 2L76A 4FN2A 2D2QA 4EFOA 1KLUD 1YQBA 3B08A 2DAFA 3U7DA 5EE3A 5AUIA 3JYUA 3TEWA 1WGDA 4II2B 1NENB 3VH4B 3ZTCA 2OJRA 4ANVA 4HJKA 3DBHI 3BINA 4F8CB 2L7RA 1IYFA 4II3B 1YN3A 3ZXVA 2H88B 1R4NB 2SEBD 4RFBA 3AE6B 2ASQA 4GDKB 1WXAA 1ZE3D 3ZXRA 1YOVB 4RNAA 4ZRJA 4NPNA 4EKUA 3FAHA 4RF0A 1EM7A 3PSEB 4PS3A 3TUOA 2D11A 1XLQA 2AQ2B 3CIRB 4MJSB 1Y56A 4FULA 4BOZB 3EGRA 3PHWB 4ACFA 4MACA 4B9KA 1D5XC 3HVDA 2QIEB 2J42A 4RGOS 3ZDMC 3MHZA 1S1QB 3R66C 4G11A 2NCNA 3AEAB 2GLSA 1VCBA 1YJ1A 3NS8A 3QJZA 5JHBA 4IDIA 3VR9B 4GOCA 1KTKA 2UWQA 4B95A 1SE2A 2L0FA 2IO3B 4GLSC 1V80A 1VR9A 3MP9A 3QWZB 4KZCA 3VUWA 3AMZA 1I35A 2LFIA 2CU1A 2RPVA 1PGBA 2RSUA 2ZEQA 5FR3A 3DPDA 1Q1OA 2IY1B 1UBQA 2Y3AA 4CO7A 5DPTA 2WU5B 4BVUC 4LK0M 1ZGUB 2X8XX 4GGQA 1X1MA 2MLBA 2V3PA 4LCDE 2FCNA 2BW2A 2KWDA 1MHHE 2VH1A 3UINB 3Q8EA 3PLVA 3VR8B 1UGMA 2MRPA 1WXVA 4BBNC 5C1ZA 1E7VA 2KX3A 4GDLB 2JXTA 3H7PA 4LNIA 2VZKD 2NPTA 1I4QA 2UYZB 3OWEB 3MJWA 3P2BA 1FFVA 3H6NA 1WMHA 4NAWB 4AWJA 3TBLD 2L0TA 3BZDB 2Y5CA 4OVZA 1QOFA 1WR6E 2L1AA 4RGTA 2JYEA 4DXGA 1TS4A 2I38A 4MELA 3H7PB 1IBXB 3EFUA 1UNSA 2LVQA 2DYMA 4BBNF 3Q3JA 3K9PB 4FJVB 1VZ7A 2K9XA 2D3GA 3ZJUA 4AJWA 2BVCA 3SDLC 4LNKA 1QOBA 4N9F4 4D2KA 2M19A 4W9DA 4ZOHC 3H1UA 3JVZX 2Z8LA 3VRAB 3N9YC 2DLBA 2A5UA 3DQVA 5T8IA 1VLBA 5E6JA 4WJNA 1AWDA 1HZ5A 1JMLA 3B2GA 1R4NI 3RMKC 4KVGB 1S3SG 4YWGG 3LJ3A 4K3CA 4I6NB 4RM9A 2K8HA 4AJYB 4K1RB 1Z2MA 4IG7B 1MG8A 2XBBC 1WRIA 2DNFA 3QIJA 1WXMA 1PFDA 2KLGA 4NJCA 3O65B 3SD5A 3ZGZA 2DBYA 4DK5A 2O6VD 3NVVA 3IT6B 4NJ6A 3PHXB 1FXTB 4BZAA 3L17A 2IY0B 1R4MI 3LB8C 1WE7A 2L83A 1JROA 5JH5C 2AL3A 2HD5B 4MGZE 2UU7A 2WXFA 3GZNB 3UI3A 2WXIA 1UELA 1ISNA 2KQ7A 3DDCB 4J6IA 1V5TA 3C8YA 2WX0A 4AS1A 1I42A 1L6UA 1YN5A 2LGYA 2QCZA 3RNCC 3SFEB 3ZIMA 4LNNA 2C60A 2J52A 4YTMB 2D3CA 1P7EA 2D3AA 3DBRB 1WYWB 3U2SC 3L16A 2C7NB 1SEBD 5DPWA 3OG5A 2PJHA 1V5OA 4IKGA 3RD2A 3R7QA 3M3JA 1NYQA 2PIAA 1BT0A 1QKZA 3UQAA 1JWUD 1TT5B 2KANA 1IBXA 4GN1A 1WFYA 4WAAA 4IOIE 1GJZA 1TIFA 3ZNZB 4C00A 1WJUA 4BFRA 1M4VA 3IHPC 3QK0A 2IO2B 4B0MA 3KYCD 2MA9B 3NUHB 1GAQB 4MGKE 4OHJA 1SBBB 4FLHA 1JW9D 2DZMA 2K8BA 3TSSA 3ZJTA 1AW7A 2MBQA 2BKFA 2TSSA 3AULA 3MFGA 1YX6B 4O1NA 2KMAA 2N1WA 1LXDA 3QHTA 1V1PA 1BUIC 3MC0B 2QMTA 4TKNA 5FKAC 2RD0A 1E8ZA 1V2YA 3Q6BA 2ZW0A 1NDDA 3DBLI 5TR5A 5IO9A 1C3TA 2N1VA 1E90A 2BYFA 1HTQA 2WNMA 1LGRA 3GB1A 3RT3B 1L2NA 2LJIA 3P1MA 2JZZA 2GBJA 4TQ1A 1J7BA 2Z0EB 2H89B 1TYGB 4C4VA 4I6LB 1SIJA 4TSSA 3N1XC 2DENB 4GU2A 4XWWA 1CK1A 3PRZA 5AEKB 2VH2A 3MTNB 4FHKA 3AU5A 1N60A 2I2YA 5C23A 5BYSA 2JSVX 1ET9A 2JQRB 3AEEB 3DBLB 5BYQA 3WA0A 4MSMB 4USAA 2D3BA 2MQJA 2E6XA 1WF9A 2M0XA 5D3IB 3B0AA 4YL8A 2O2VA 1V1PB 2G9HD 4W9KA 2CKHB 4YSZB 4US9A 2JXXA 3D32A 3A1QA 2MJDA 2V4IB 1XLPA 3EECA 4HJGE 1J0GA 2SAKA 2PLPA 2MBHA 2BF8B 3UIOB 4E74A 1DOIA 3ZVVA 5KHOA 2MP2B 4HXDA 4ZRQA 3EFCA 1QT9A 4YXDB 4WWPA 2LVPA 1TBEA 2BS4B 4YTPB 1WRDB 2MH7A 1YN4A 1CQVA 4OZBA 3RZWC 4MGYE 3RNEC 3NZSA 3RNBC 3KW5B 3NRZA 1GNUA 5D94A 1GG3A 4E3CA 1M94A 4W9HA 1RM6C 2R61A 3ZO5B 4ANXA 2KKCA 2MBBB 5HHDG 3KWVA 5FR6A 1SIFA 4OZAA 3I63C 3PV1A 2ICIA 2G45B 3VXWA 1C1YB 4MGIE 4ITKA 3BVGA 5H92C 3WAMA 2CU3A 5D7GA 4DHJB 3DVGX 1MFWA 3ZTDA 2J4XA 5JHAA 2LUEA 1K51A 1OEYJ 4M8MA 3IG3A 1I4HA 3U30A 2LGDA 3LDZE 4GB9A 1QQRA 4BKSA 5BMIA 2FE8A 3RFZB 3CSFA 2FIFA 1C4AA 2MX2A 4P1CC 4PK1A 5BMHA 1RLFA 4IWQA 2KLCA 3QAQA 1L0VB 3AH7A 4GDKA 3MC9A 2ZW1A 2PMVA 2D5GA 3VQIA 2DHZA 1AN8A 3BYYB 2NTSA 1I4GA 1WGYA 1T0YA 1TJEA 2DZKA 1DOXA 3AE1B 2N4FA 4DXAB 2INPE 3LYYA 1V8CA 1WH3A 5AZHA 2WDRB 2BS2B 2D07B 4NY0A 1GB4A 1B9RA 4WIPA 2Q5WD 3JSVA 2KC1A 2WXJA 2IGGA 4FJZA 1WMHB 3APFA 4EOYA 1T0SC 2GOWA 1F77A 3ZRCA 4NAMA 5DPSA 3Q8AA 1E7UA 1FPYA 1FFUA 4IWOA 1EU4A 3PZ8A 3WAOA 1KJTA 3AEDB 2YEPB 1J19A 4N6EB 2N9EB 4DDID 3AE5B 2PTLA 1R7SA 1YQ3B 2NBUA 2Y5BB 3ML8A 4KDIC 2KTRA 4WWNA 2HJ1A 1WZ3A 1XLNA 1YX5B 1C9FA 2JU6X 5LXHA 2AEHA 5G55A 3OJ4B 2LXAA 5JXVA 3QX1A 1J7AA 1TZ1A 4YSYB 3AE2B 3P4SB 2M0AA 3BK2A 1QILA 4NNJB 1L4DB 3RNAC 3PLUA 1T5XD 2N7DA 3MJ5A 3AB5A 4M00A 4EZKA 3DOWA 3ONSA 4WH4A 2KDEB 1GOZA 1RFAA 2GBMA 1D6EC 3DHGC 3P42A 4IW0A 4KGRA 3R8BA 3AEGB 3CWIA 1HE8A 2MEKA 4NAWA 3T3NA 4DHJD 1E8YA 2WXNA 5AZGA 1XD3B 3ZNHB 2IO0B 2IPKD 1N61A 4A3PA 1FXAA 2PEAA 4FADA 1V81A 3NZUA 4W9LA 1V9JA 2MJEA 3AN1A 3AV8A 2MJ3A 4RMAA 4S0RA 2BGFA 3BIID 3U4EG 1L0XB 5LXIB 1E5WA 4JWUC 2YEPF 3W5VB 2CJNA 2EMTA 4ICUA 2XEWA 3Q8BA 4DWFA 2M17A 4W9IA 2HJ8A 4C80A 5EDSA 2G3QB 1T6BX 4UDUC 2RMMA 1UH6A 3JW0X 3ETRA 4W9EA 2L3ZA 4A6QA 2KQ4X 2JZPA 3AI5A 4GSWA 3DVNU 2KVRA 1C77A 1D3ZA 4HCNB 4ARIA 3IVFA 1OQYA 3M95A 2GMIC 2V3NA 4EZJA 4KSLC 1E10A 4HPPA 2ZNVC 2KK8A 1KOTA 3RULA 3T3OA 4G3XB 1OEYA 3UIPB 1SJHD 2W9NA 2OEDA 2J0KA 1NVID 1HEZE 3M63B 1KH0A 2EKEC 5G5HA 2CS4A 3ZJVA 1LQBA 2BKRB 1K8RB 3RNGC 4WURA 2FBWB 2L00B 2JT4B 5JZEB 4ZHOA 3ALBA 2DAJA 2MBEA 3CF6E 4WJOA 1UZXB 3KYDD 3R7RA 3Q2AC 3NG0A 2HDEA 3L08A 3NY5A 4HWIB 3GS2A 4P16A 2V0GA 2WDVB 4TV3A 1EO6A 1QOAA 1FRDA 2EKIA 3FILB 4C7ZA 3AE9B 1A5RA 4TUUA 1WI0A 1XEEA 2NR2A 4BKTA 4DBGA 1JWAD 2BB5A 3KQ4A 3ABVB 4QAYA 4XYCA 1KM7A 5IN7A 2PVGC 4ZRPA 2KAJA 3AE4B 1EF1A 3AU4A 2WXQA 1RYJA 2KC2A 3V6CB 2HTHA 1TS3A 3E56A 2BT6A 2CHWA 2K39A 3TL5A 2DWQA 3DVNV 4ZYNA 3AE8B 2WXMA 4XZ4A 1NBFC 5TSSA 2REXA 2W55A 2LHDA 4WJPA 5IAAC 3VTVA 1SE3A 2OJWA 1F52A 2BWFA 5J2RA 4ANUA 1FO4A 3H7SA 4AOFA 1FMAD 2INCC 1SXTA 4A20A 4K7UA 4YT0B 3I57A 1WGRA 3GZNI 3ZDTA 1SF0A 2C5LC 3VVWB 4XDDA 1G6JA 1GC7A 4MDKE 2EELA 3K9OB 1FM0D 1SE9A 2CHZA 1HTOA 2LVOA 5C2TB 3OLMD 1K53A 3A4RA 4PT5A 1LO5D 3HK0A 4OZCA 2IGHA 2WGSA 3R2TA 3W1SC 3WCQA 3Q69A 3PPAA 1I4RA 3VHTC 1TZOA 4B6WA 2IZVB 2KJHB 4M0WB 1HZ6A 1PUTA 3P4PB 2KXJA 1P0RA 4A8XC 1L0YB 1D4BA 4MSQB 1L4ZB 2W54A 3MC8A 5HFYA 1SE4A 4DDGD 2MHJA 2G4DB 4YTNB 4HCPB 3ZUNA 4HROA 3TEZA 4RCOA 4XX5A 1IPGA 1E6EB 3SFDB 2JUOA 1ZPSA 3SEBA 1TS5A 4MH8A 2PE9A 3AXCA 3NZ3A 2JYTA 2N7JA 4ARCA 3IAS1 5BYRA 4WWOA 2KFKB 5EE1A 3V05A 1WM3A 2JPHA 5L83A 4GMVA 1YD8U 2V1YA 2IYDB 5J17A 3W2DA 2V4LA 4RF1A 2KWVB 3ZW3A 2MSED 3A9KA 4XE0A 3DCGA 5D6JB 1AYFA 1WXQA 2BWES 5AUKA 2N7EA 1U4AA 4IM2A 3X0WA 3QCAA 3DHHC 2J53A 1ZXHA 1FCCC 4JE3B 3TIXA 5C3JB 4URKA 4IM3A 4RGNA 3JSVB 4PYUA 3VH3B 2YVCA 2KFJA 2G1EA 2QDFA 3C19A 4JIOU 1LM8B 2JX5A 4A3OA 1SJED 1EF5A 3O13A 2W3RA 4P1BC 5D2MB 1YIWA 4N59A 3WAPA 1WR1A 1Y8RC 1QLBB 2B3AA 2KO3A 1WIAA 1RFKA 2K1FA 1F2RC 3A1QB 3BK1A 4HRSA 4W9CA 2CJOA 3BVZA 4K81A 1MI0A 3DWGC 4KDLB 2M56B 3PO0A 4M0WA 1OGWA 4JWSC 3OAWA 5MPOA 1ZXIA 3B2FA 5CHWA 2BPSA 2DYBA 2IDYA 1KF6B 3V6EB 1XLOA 1FXIA 3NJTA 2KDFB 4B0EA 4G0NB 2FNJB 3T8MA 2NBVB 2KHWB 2WS3B 1YJJA 2PKOA 3BWUD 4C4VB 1N62A 2WX1A 1OFFA 1ACCA 2MWSB 3VRBB 1DOYA 1VD2A 2KVZA 4JGHB 2LMCA 1OQQA 2AYOB 3KH0A 4MT5A 2IBIB 1JRUA 2I1KA 4HVBA 3W1YA 1NYRA 3GE3C 1WGGA 1ZP0B 4RGMA 2O6VB 4HKZE 2JWUA 3L0WB 4GDLA 2KYWA 4W9FA 4KKJA 2KT7A 2O2VB 2MBOA 3DHIC 3B9JA 4JX1C 1P7FA 3SU8X 3AECB 5J18A 3RN9C 3RYTA 3U7ZA 3ZYYX 1E8XA 1XT9B 1P3QU 3RCZA 1WXSA 2LASA 1IP9A 2WU2B 5GMVA 2A4ZA 2JRHA 4PYZA 1VRAB 2M1MA 1N5XA 1FRRA 5H8YE 3QQ8B 4HEA1 1ET6A 1PGAA 1IGDA 3N1ZC 2PE6B 2KN5A 3A9JA 2MW5A 4HLEA 1NI3A 2BB6A 3X23A 4NQLB 4JQWC 2O6VA 1E7PB 3UGBB 3FKYA 1STEA 2KWUB 4DQOC 2IGDA 2LJ5A 1ZDVA 1E9MA 1EWYC 2LI5A 4ASWC 2FUG1 4RH6A 4NQKE 2K25A 3A4SC 4AQ7A 4ZRIA 2LZ6A 3AEFB 2DZIA 3FC4A 4LNFA 1WJNA 1F1HA 2WYQA 3TEYA 3APCA 1V6EA 2LRUA 3IT4B 1TS2A 3NS1A 2J0MA 4IUMB 2C7HA 3N30A 1XXGA 1JWSD 2WDTB 3L10B 3DVGY 1I7HA 3P63A 2ZZPB 1V49A 1WM2A 4MM3A 2BBCA 1C4PA 4AUQC 3ZKJC 3AEBB 3L13A 2C7MB 2RR9A 1MVKA 2NTTA 4WQOB 1DYQA 2RGFA 2LEKA 4KGTA 3NVWA 2L32A 3UF8A 3FILA 2JWZA 1KFYB 2LRWA 4WWMA 3H8HA 2C9WB 2FCSA 4LJPB 3BVMA 4ZYSA 3PRMB 2KWCA 5D3DA 3KUZA 2MCNB 3PVLA 2LHEA 3WALA
chains in the Genus database with same CATH topology
2MBEA 2K8CA 1GC6A 1WX9A 1WJUA 3CF6E 4BFRA 4WJOA 5CHVC 4W9JA 5E6PA 2FIDA 1UZXB 2PPHA 2KNBA 2KTFA 3IHPC 4ICVA 3KYDD 3QK0A 3R7RA 2IO2B 5CX3A 3L08A 4KSKC 4EZLA 3NY5A 4HWIB 3VTUA 4HDQA 3PT2B 3KYCD 4P7IA 3ZNGC 2MA9B 2GBNA 4MGKE 4TV3A 4FLHA 1EUVB 1EO6A 3TMPB 2DZMA 2K8BA 2MBQA 5E6OA 1A5RA 4TUUA 2BKFA 3AULA 1WI0A 2NR2A 1YX6B 2KMAA 4BKTA 4BKSD 2N1WA 3W1SA 4DBGA 1LXDA 4F1SA 2DZJA 3QHTA 3A33B 2NS5A 4DHZB 1RAXA 4TKNA 2RD0A 2ZCCA 1E8ZA 2LD9A 3QC8B 4MJSA 1V2YA 3SHQA 1NDDA 3DBLI 3NOBA 5TR5A 2D10A 1C3TA 2N1VA 2KFKA 1E90A 2BYFA 2R2QA 2L8JA 3CMMB 4KV2A 1KM7A 3RT3B 1L2NA 4OVUA 2JZZA 2GBJA 4TQ1A 1EF1A 4X57B 5AZFA 3AU4A 2Z0EB 3IBEA 2FAZA 2QHOA 2JY6A 4I6LB 2KC2A 4RM8A 1H4RA 3V6CB 3VDZA 2HTHA 2DENB 3QA8A 4GU2A 3PRZA 2CHWA 3PGEA 5AEKB 2V3SA 1KLVA 2K39A 3PZDA 3TL5A 2LGXA 3MTNB 2ZVNA 1Q0WB 4FHKA 1GUAB 3AU5A 3DVNV 4ZYNA 3V62A 4XZ4A 1WJ6A 1NBFC 2REXA 2LXCA 4KZ0A 5C23A 1PQSA 2KQSA 4WJPA 5IAAC 3GOEA 3VTVA 2JZ3B 3TCAA 2BWFA 5J2RA 3WA0A 4MSMB 1Z5SB 5KHQA 3PREA 4JL9A 5E6NA 4ANUA 4BKGA 2MP2A 2MQJA 1WF9A 2M0XA 3B0AA 3H7SA 4AOFA 4YL8A 4A20A 4K7UA 2O2VA 5HKHA 1AARA 2LWPA 4W9KA 4XC2A 1WGRA 3IFWB 2CKHB 3DBRI 3GZNI 3ZDTA 2C5LC 3VVWB 3H9DA 2JXXA 2VRRB 3HM6X 4FBJB 1G6JA 1GC7A 2KOXA 4MDKE 4FJYA 3D32A 3M62B 3A1QA 2N9PC 3K9OB 3A9JB 1SE9A 2CHZA 1XQQA 1CMXB 3EECA 4F7ZA 1J0GA 1WGHA 2BYEA 5LLIA 2LVOA 2MBHA 2BF8B 3UIOB 4E74A 1TGZB 3V60A 3OLMD 3A4RA 3ZVVA 2GBKA 5KHOA 2MP2B 2ZCBA 4GIVA 1L7YA 2KD0A 4HXDA 3HK0A 2I1JA 2KJ6A 2N9XA 3WANA 4WWPA 2LVPA 3WIMA 1TBEA 1WZ0A 4ANWA 3W1SC 3B1LX 2ZPYA 3PPAA 5G2NA 1WRDB 1V86A 2NVUI 4MEMA 3VHTC 1LFDA 4WJQA 4MGYE 3RZWC 4B6WA 3NZSA 4AP4C 4E71A 2IZVB 2KJHB 4M0WB 3KW5B 2DX5B 2KXJA 2FCMA 3APDA 2DYOA 1GNUA 3RUIB 3DBSA 1P0RA 2L76A 4FN2A 5D94A 2D2QA 4MSQB 4EFOA 3ECIA 1GG3A 4E3CA 1M94A 4W9HA 3Q3FA 2IO1B 1YQBA 3B08A 3ZO5B 4ANXA 2CR5A 2DAFA 2KKCA 4DDGD 2G4DB 2MBBB 3PS6A 4KIKB 3U7DA 3VFKA 4HCPB 3ZUNA 3JYUA 1WGDA 5FR6A 1P9DU 3V61A 1SIFA 4II2B 4XX5A 3PV1A 3VH4B 3ZTCA 2OJRA 1IPGA 4ANVA 4HJKA 3DBHI 2NPTB 2JUOA 3C0RB 3BINA 4F8CB 2L7RA 1IYFA 4II3B 2G45B 3VXWA 3QARA 2FCQA 2PE9A 3AXCA 1C1YB 2ASQA 4GDKB 4MGIE 3WAMA 1WXAA 2YLMA 4HK2A 3BY4B 4DHJB 5D7GA 4WWOA 3DVGX 4ZRJA 2AWTA 4NPNA 3ZTDA 2KFKB 4EKUA 1WM3A 2JPHA 5JHAA 5L83A 2LUEA 1OEYJ 4GMVA 1YD8U 2ZPNA 3N32A 3PSEB 2V1YA 2IYDB 4M8MA 4PS3A 5J17A 1H8CA 1F9JA 3IG3A 2V4LA 2WWZA 2D11A 2GBRA 3U30A 3VTWA 4EUTA 2LGDA 3KUDB 4PS7A 3LDZE 1UBIA 4GB9A 4MJSB 4PS8A 4FULA 3OJ3A 2KWVB 2Z59B 3ZW3A 4BKSA 4BOZB 3PHWB 2MSED 3A9KA 3DCGA 5D6JB 3ZNID 4B9KA 1TTNA 4DHZE 3CSFA 2BWES 4TQ0A 2N7EA 1U4AA 4IM2A 2FIFA 2MX2A 3QCAA 3X0WA 4BOSC 4HDOA 3TIXA 4URKA 1RLFA 4IM3A 1WY8A 4IWQA 3JSVB 3ZDMC 4PYUA 2KLCA 3VUXA 3QAQA 3VH3B 2YVCA 2KFJA 1S1QB 3R66C 2FUHB 4G11A 2NCNA 4GDKA 4JIOU 2J7QB 1LM8B 1VCBA 2KJRA 4A3OA 1YJ1A 3NS8A 2KDBA 1EF5A 3QJZA 4LDTB 5D2MB 2KX0A 3VQIA 5JHBA 2DHZA 1YIWA 3I3TB 3WAPA 5L95C 1WR1A 3NHEB 1Y8RC 4ZDVA 1WGYA 4GOCA 2UWQA 4B95A 1T0YA 2B3AA 2L0FA 2KO3A 2IO3B 2ZJDA 2DZKA 1V80A 4IWPA 2N4FA 4DXAB 2KZRA 3ZRFA 1WH3A 2NBWB 5AZHA 1WIAA 2K1FA 3A1QB 2D07B 3QWZB 4KZCA 3VUWA 4W9CA 4NY0A 1I35A 2CU1A 2EMSA 4K81A 3L54A 3JSVA 2XK5A 4KDLB 2KC1A 2RSUA 1OGWA 4FJZA 3OAWA 2ZEQA 1WMHB 3DPDA 4HPLB 3APFA 4NJ7A 5CHWA 1Q1OA 2IY1B 1UBQA 2BPSA 4EOYA 2DYBA 4CO7A 5DPTA 3R3MA 2GOWA 4BVUC 3HM3A 3V6EB 3EHVA 3ZRCA 5DPSA 1ZGUB 1X1MA 2MLBA 2M4NA 1E7UA 4GGQA 4LCDE 2FCNA 2KDFB 2R2OA 4G0NB 2FNJB 4IWOA 3T8MA 3UINB 3PLVA 3WAOA 1UGMA 1KJTA 2MRPA 1WXVA 2NBVB 2KHWB 3MHSD 4BBNC 1QZEA 3TJPA 5C1ZA 1E7VA 4GXBA 1J19A 2KX3A 2WX1A 4GDLB 2N9EB 4DDID 2MWSB 3H7PA 1VD2A 2NBUA 2Y5BB 2KDIA 1Q5WB 3ML8A 4JGHB 4KDIC 2KTRA 3WALA 4JLCA 3VAWA 4WWNA 1WE6A 1WZ3A 2KMCA 2AYOB 3KH0A 1YX5B 2NPTA 2IBIB 5LXHA 1JRUA 2AEHA 2UYZB 4K7WA 3MJWA 3P2BA 5DPRA 1J8CA 3H6NA 1WMHA 2I1KA 4NAWB 4HVBA 3W1YA 4AWJA 3TBLD 4KIKA 2L0TA 5G55A 3OJ4B 1WJ4A 2LXAA 1WGGA 1WR6E 2O6VB 2L05A 3QX1A 2ZVOA 1TZ1A 2XK5B 3L0WB 4GDLA 4W9FA 2BYVE 3H7PB 4MELA 3EFUA 2O2VB 4FHJA 2MBOA 1NI2A 2LVQA 2DYMA 4BBNF 3Q3JA 3K9PB 4FJVB 3SU8X 4NNJB 3PLUA 2D3GA 2N7DA 4G50A 5J18A 1ZW7A 3RYTA 4AJWA 4EZKA 3DOWA 1E8XA 1XT9B 3ONSA 1P3QU 5CHFA 3SDLC 2KDEB 3U8ZA 3RCZA 5IA7A 1WXSA 4CHKA 2LASA 4N9F4 1SGHA 1IP9A 1RFAA 4W9DA 2GBMA 3H1UA 4LJOB 3JVZX 5GMVA 2A4ZA 2JRHA 2M1MA 4IW0A 4PYZA 2A5UA 3DQVA 1HE8A 1WX7A 3T9LA 4NAWA 3PTFC 4DHJD 1E8YA 3QQ8B 4WJNA 5AZGA 1XD3B 3ZNHB 2JVCA 2IO0B 4A3PA 2KTRB 1R4NI 2PE6B 2KN5A 3KVFB 3A9JA 3EC8A 3HHMA 2PEAA 4FADA 3CSTA 1V81A 3NZUA 2MW5A 1V9JA 4KVGB 4W9LA 5DCNA 1S3SG 4HLEA 3X23A 4NQLB 3KUCB 3PRPB 4JQWC 4RMAA 1P98A 2BGFA 2JF5A 3LJ3A 2O6VA 5LXIB 4I6NB 4RM9A 1E5WA 2K8HA 2ZNVB 4AJYB 4K1RB 1Z2MA 3UGBB 3ML9A 2KWUB 4IG7B 1MG8A 2XBBC 1OTRB 2LJ5A 1WX8A 3QIJA 1WXMA 2EMTA 4ICUA 2KLGA 2XEWA 2LI5A 3O65B 4FA6A 4I6PA 3SD5A 4DK5A 4ASWC 4DWFA 2O6VD 4NQKE 2K25A 3A4SC 4M8NA 4ZRIA 2LZ6A 4CYEA 2M17A 4LDTD 3PHXB 4NJ6A 2G4SA 1FXTB 2AL6A 2HJ8A 2OOBB 4W9IA 3L17A 4IM0A 2IY0B 1R4MI 2DZIA 5EDSA 2G3QB 1WJNA 1WE7A 3VUYA 2WYQA 5JH5C 2AL3A 3APCA 1V6EA 1UH6A 2HD5B 2LRUA 3JW0X 4HPMB 4K7SA 4MGZE 4W9EA 1RRBA 2L3ZA 3A9KB 4W9GA 2JRIB 2J0MA 4IUMB 2C7HA 1UELA 3AI5A 3N30A 4GSWA 5CTRC 1ISNA 2KQ7A 3DDCB 2WDTB 3DVNU 3L10B 2KVRA 3DVGY 4J6IA 1V5TA 1D3ZA 1ZKHA 4HCNB 3IVFA 2WX0A 1OQYA 3M95A 2ZZPB 1V49A 3ENEA 1I42A 2GMIC 4EZJA 1WM2A 4IC7B 4KSLC 2LGYA 2HE7A 3UQBA 4MM3A 2ZNVC 3ZIMA 2M8SA 2KK8A 4AUQC 3ZKJC 2K6DB 2C60A 1KOTA 1E8WA 3RULA 3HIZA 3ZLZA 3L13A 4G3XB 2C7MB 2RR9A 1OEYA 3N3KB 1WYWB 3UIPB 4EEWA 4OVVA 4WQOB 2K6QA 2W9NA 3L16A 2C7NB 4ZRKA 5DPWA 2J0KA 2RGFA 2PJHA 3M63B 1V5OA 2EKEC 3S2AA 2J0JA 2CS4A 1LQBA 2BKRB 1P1AA 3RD2A 3UF8A 1K8RB 3R7QA 2JWZA 2CHXA 3M3JA 4MH0E 2LRWA 1BT0A 3UQAA 2C9WB 2FCSA 4LJPB 3PRMB 2KWCA 2L00B 2JT4B 5JZEB 2KANA 4GN1A 3KUZA 2RPQA 1WFYA 3ALBA 4WAAA 5BO4B 1GJZA 2Z0DB 3ZNZB 2MCNB 3PVLA 3RZFA 2DAJA 1UD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBE A;  2K8C A;  1GC6 A;  1WX9 A;  1WJU A;  3CF6 E;  4BFR A;  4WJO A;  5CHV C;  4W9J A;  5E6P A;  2FID A;  1UZX B;  2PPH A;  2KNB A;  2KTF A;  3IHP C;  4ICV A;  3KYD D;  3QK0 A;  3R7R A;  2IO2 B;  5CX3 A;  3L08 A;  4KSK C;  4EZL A;  3NY5 A;  4HWI B;  3VTU A;  4HDQ A;  3PT2 B;  3KYC D;  4P7I A;  3ZNG C;  2MA9 B;  2GBN A;  4MGK E;  4TV3 A;  4FLH A;  1EUV B;  1EO6 A;  3TMP B;  2DZM A;  2K8B A;  2MBQ A;  5E6O A;  1A5R A;  4TUU A;  2BKF A;  3AUL A;  1WI0 A;  2NR2 A;  1YX6 B;  2KMA A;  4BKT A;  4BKS D;  2N1W A;  3W1S A;  4DBG A;  1LXD A;  4F1S A;  2DZJ A;  3QHT A;  3A33 B;  2NS5 A;  4DHZ B;  1RAX A;  4TKN A;  2RD0 A;  2ZCC A;  1E8Z A;  2LD9 A;  3QC8 B;  4MJS A;  1V2Y A;  3SHQ A;  1NDD A;  3DBL I;  3NOB A;  5TR5 A;  2D10 A;  1C3T A;  2N1V A;  2KFK A;  1E90 A;  2BYF A;  2R2Q A;  2L8J A;  3CMM B;  4KV2 A;  1KM7 A;  3RT3 B;  1L2N A;  4OVU A;  2JZZ A;  2GBJ A;  4TQ1 A;  1EF1 A;  4X57 B;  5AZF A;  3AU4 A;  2Z0E B;  3IBE A;  2FAZ A;  2QHO A;  2JY6 A;  4I6L B;  2KC2 A;  4RM8 A;  1H4R A;  3V6C B;  3VDZ A;  2HTH A;  2DEN B;  3QA8 A;  4GU2 A;  3PRZ A;  2CHW A;  3PGE A;  5AEK B;  2V3S A;  1KLV A;  2K39 A;  3PZD A;  3TL5 A;  2LGX A;  3MTN B;  2ZVN A;  1Q0W B;  4FHK A;  1GUA B;  3AU5 A;  3DVN V;  4ZYN A;  3V62 A;  4XZ4 A;  1WJ6 A;  1NBF C;  2REX A;  2LXC A;  4KZ0 A;  5C23 A;  1PQS A;  2KQS A;  4WJP A;  5IAA C;  3GOE A;  3VTV A;  2JZ3 B;  3TCA A;  2BWF A;  5J2R A;  3WA0 A;  4MSM B;  1Z5S B;  5KHQ A;  3PRE A;  4JL9 A;  5E6N A;  4ANU A;  4BKG A;  2MP2 A;  2MQJ A;  1WF9 A;  2M0X A;  3B0A A;  3H7S A;  4AOF A;  4YL8 A;  4A20 A;  4K7U A;  2O2V A;  5HKH A;  1AAR A;  2LWP A;  4W9K A;  4XC2 A;  1WGR A;  3IFW B;  2CKH B;  3DBR I;  3GZN I;  3ZDT A;  2C5L C;  3VVW B;  3H9D A;  2JXX A;  2VRR B;  3HM6 X;  4FBJ B;  1G6J A;  1GC7 A;  2KOX A;  4MDK E;  4FJY A;  3D32 A;  3M62 B;  3A1Q A;  2N9P C;  3K9O B;  3A9J B;  1SE9 A;  2CHZ A;  1XQQ A;  1CMX B;  3EEC A;  4F7Z A;  1J0G A;  1WGH A;  2BYE A;  5LLI A;  2LVO A;  2MBH A;  2BF8 B;  3UIO B;  4E74 A;  1TGZ B;  3V60 A;  3OLM D;  3A4R A;  3ZVV A;  2GBK A;  5KHO A;  2MP2 B;  2ZCB A;  4GIV A;  1L7Y A;  2KD0 A;  4HXD A;  3HK0 A;  2I1J A;  2KJ6 A;  2N9X A;  3WAN A;  4WWP A;  2LVP A;  3WIM A;  1TBE A;  1WZ0 A;  4ANW A;  3W1S C;  3B1L X;  2ZPY A;  3PPA A;  5G2N A;  1WRD B;  1V86 A;  2NVU I;  4MEM A;  3VHT C;  1LFD A;  4WJQ A;  4MGY E;  3RZW C;  4B6W A;  3NZS A;  4AP4 C;  4E71 A;  2IZV B;  2KJH B;  4M0W B;  3KW5 B;  2DX5 B;  2KXJ A;  2FCM A;  3APD A;  2DYO A;  1GNU A;  3RUI B;  3DBS A;  1P0R A;  2L76 A;  4FN2 A;  5D94 A;  2D2Q A;  4MSQ B;  4EFO A;  3ECI A;  1GG3 A;  4E3C A;  1M94 A;  4W9H A;  3Q3F A;  2IO1 B;  1YQB A;  3B08 A;  3ZO5 B;  4ANX A;  2CR5 A;  2DAF A;  2KKC A;  4DDG D;  2G4D B;  2MBB B;  3PS6 A;  4KIK B;  3U7D A;  3VFK A;  4HCP B;  3ZUN A;  3JYU A;  1WGD A;  5FR6 A;  1P9D U;  3V61 A;  1SIF A;  4II2 B;  4XX5 A;  3PV1 A;  3VH4 B;  3ZTC A;  2OJR A;  1IPG A;  4ANV A;  4HJK A;  3DBH I;  2NPT B;  2JUO A;  3C0R B;  3BIN A;  4F8C B;  2L7R A;  1IYF A;  4II3 B;  2G45 B;  3VXW A;  3QAR A;  2FCQ A;  2PE9 A;  3AXC A;  1C1Y B;  2ASQ A;  4GDK B;  4MGI E;  3WAM A;  1WXA A;  2YLM A;  4HK2 A;  3BY4 B;  4DHJ B;  5D7G A;  4WWO A;  3DVG X;  4ZRJ A;  2AWT A;  4NPN A;  3ZTD A;  2KFK B;  4EKU A;  1WM3 A;  2JPH A;  5JHA A;  5L83 A;  2LUE A;  1OEY J;  4GMV A;  1YD8 U;  2ZPN A;  3N32 A;  3PSE B;  2V1Y A;  2IYD B;  4M8M A;  4PS3 A;  5J17 A;  1H8C A;  1F9J A;  3IG3 A;  2V4L A;  2WWZ A;  2D11 A;  2GBR A;  3U30 A;  3VTW A;  4EUT A;  2LGD A;  3KUD B;  4PS7 A;  3LDZ E;  1UBI A;  4GB9 A;  4MJS B;  4PS8 A;  4FUL A;  3OJ3 A;  2KWV B;  2Z59 B;  3ZW3 A;  4BKS A;  4BOZ B;  3PHW B;  2MSE D;  3A9K A;  3DCG A;  5D6J B;  3ZNI D;  4B9K A;  1TTN A;  4DHZ E;  3CSF A;  2BWE S;  4TQ0 A;  2N7E A;  1U4A A;  4IM2 A;  2FIF A;  2MX2 A;  3QCA A;  3X0W A;  4BOS C;  4HDO A;  3TIX A;  4URK A;  1RLF A;  4IM3 A;  1WY8 A;  4IWQ A;  3JSV B;  3ZDM C;  4PYU A;  2KLC A;  3VUX A;  3QAQ A;  3VH3 B;  2YVC A;  2KFJ A;  1S1Q B;  3R66 C;  2FUH B;  4G11 A;  2NCN A;  4GDK A;  4JIO U;  2J7Q B;  1LM8 B;  1VCB A;  2KJR A;  4A3O A;  1YJ1 A;  3NS8 A;  2KDB A;  1EF5 A;  3QJZ A;  4LDT B;  5D2M B;  2KX0 A;  3VQI A;  5JHB A;  2DHZ A;  1YIW A;  3I3T B;  3WAP A;  5L95 C;  1WR1 A;  3NHE B;  1Y8R C;  4ZDV A;  1WGY A;  4GOC A;  2UWQ A;  4B95 A;  1T0Y A;  2B3A A;  2L0F A;  2KO3 A;  2IO3 B;  2ZJD A;  2DZK A;  1V80 A;  4IWP A;  2N4F A;  4DXA B;  2KZR A;  3ZRF A;  1WH3 A;  2NBW B;  5AZH A;  1WIA A;  2K1F A;  3A1Q B;  2D07 B;  3QWZ B;  4KZC A;  3VUW A;  4W9C A;  4NY0 A;  1I35 A;  2CU1 A;  2EMS A;  4K81 A;  3L54 A;  3JSV A;  2XK5 A;  4KDL B;  2KC1 A;  2RSU A;  1OGW A;  4FJZ A;  3OAW A;  2ZEQ A;  1WMH B;  3DPD A;  4HPL B;  3APF A;  4NJ7 A;  5CHW A;  1Q1O A;  2IY1 B;  1UBQ A;  2BPS A;  4EOY A;  2DYB A;  4CO7 A;  5DPT A;  3R3M A;  2GOW A;  4BVU C;  3HM3 A;  3V6E B;  3EHV A;  3ZRC A;  5DPS A;  1ZGU B;  1X1M A;  2MLB A;  2M4N A;  1E7U A;  4GGQ A;  4LCD E;  2FCN A;  2KDF B;  2R2O A;  4G0N B;  2FNJ B;  4IWO A;  3T8M A;  3UIN B;  3PLV A;  3WAO A;  1UGM A;  1KJT A;  2MRP A;  1WXV A;  2NBV B;  2KHW B;  3MHS D;  4BBN C;  1QZE A;  3TJP A;  5C1Z A;  1E7V A;  4GXB A;  1J19 A;  2KX3 A;  2WX1 A;  4GDL B;  2N9E B;  4DDI D;  2MWS B;  3H7P A;  1VD2 A;  2NBU A;  2Y5B B;  2KDI A;  1Q5W B;  3ML8 A;  4JGH B;  4KDI C;  2KTR A;  3WAL A;  4JLC A;  3VAW A;  4WWN A;  1WE6 A;  1WZ3 A;  2KMC A;  2AYO B;  3KH0 A;  1YX5 B;  2NPT A;  2IBI B;  5LXH A;  1JRU A;  2AEH A;  2UYZ B;  4K7W A;  3MJW A;  3P2B A;  5DPR A;  1J8C A;  3H6N A;  1WMH A;  2I1K A;  4NAW B;  4HVB A;  3W1Y A;  4AWJ A;  3TBL D;  4KIK A;  2L0T A;  5G55 A;  3OJ4 B;  1WJ4 A;  2LXA A;  1WGG A;  1WR6 E;  2O6V B;  2L05 A;  3QX1 A;  2ZVO A;  1TZ1 A;  2XK5 B;  3L0W B;  4GDL A;  4W9F A;  2BYV E;  3H7P B;  4MEL A;  3EFU A;  2O2V B;  4FHJ A;  2MBO A;  1NI2 A;  2LVQ A;  2DYM A;  4BBN F;  3Q3J A;  3K9P B;  4FJV B;  3SU8 X;  4NNJ B;  3PLU A;  2D3G A;  2N7D A;  4G50 A;  5J18 A;  1ZW7 A;  3RYT A;  4AJW A;  4EZK A;  3DOW A;  1E8X A;  1XT9 B;  3ONS A;  1P3Q U;  5CHF A;  3SDL C;  2KDE B;  3U8Z A;  3RCZ A;  5IA7 A;  1WXS A;  4CHK A;  2LAS A;  4N9F 4;  1SGH A;  1IP9 A;  1RFA A;  4W9D A;  2GBM A;  3H1U A;  4LJO B;  3JVZ X;  5GMV A;  2A4Z A;  2JRH A;  2M1M A;  4IW0 A;  4PYZ A;  2A5U A;  3DQV A;  1HE8 A;  1WX7 A;  3T9L A;  4NAW A;  3PTF C;  4DHJ D;  1E8Y A;  3QQ8 B;  4WJN A;  5AZG A;  1XD3 B;  3ZNH B;  2JVC A;  2IO0 B;  4A3P A;  2KTR B;  1R4N I;  2PE6 B;  2KN5 A;  3KVF B;  3A9J A;  3EC8 A;  3HHM A;  2PEA A;  4FAD A;  3CST A;  1V81 A;  3NZU A;  2MW5 A;  1V9J A;  4KVG B;  4W9L A;  5DCN A;  1S3S G;  4HLE A;  3X23 A;  4NQL B;  3KUC B;  3PRP B;  4JQW C;  4RMA A;  1P98 A;  2BGF A;  2JF5 A;  3LJ3 A;  2O6V A;  5LXI B;  4I6N B;  4RM9 A;  1E5W A;  2K8H A;  2ZNV B;  4AJY B;  4K1R B;  1Z2M A;  3UGB B;  3ML9 A;  2KWU B;  4IG7 B;  1MG8 A;  2XBB C;  1OTR B;  2LJ5 A;  1WX8 A;  3QIJ A;  1WXM A;  2EMT A;  4ICU A;  2KLG A;  2XEW A;  2LI5 A;  3O65 B;  4FA6 A;  4I6P A;  3SD5 A;  4DK5 A;  4ASW C;  4DWF A;  2O6V D;  4NQK E;  2K25 A;  3A4S C;  4M8N A;  4ZRI A;  2LZ6 A;  4CYE A;  2M17 A;  4LDT D;  3PHX B;  4NJ6 A;  2G4S A;  1FXT B;  2AL6 A;  2HJ8 A;  2OOB B;  4W9I A;  3L17 A;  4IM0 A;  2IY0 B;  1R4M I;  2DZI A;  5EDS A;  2G3Q B;  1WJN A;  1WE7 A;  3VUY A;  2WYQ A;  5JH5 C;  2AL3 A;  3APC A;  1V6E A;  1UH6 A;  2HD5 B;  2LRU A;  3JW0 X;  4HPM B;  4K7S A;  4MGZ E;  4W9E A;  1RRB A;  2L3Z A;  3A9K B;  4W9G A;  2JRI B;  2J0M A;  4IUM B;  2C7H A;  1UEL A;  3AI5 A;  3N30 A;  4GSW A;  5CTR C;  1ISN A;  2KQ7 A;  3DDC B;  2WDT B;  3DVN U;  3L10 B;  2KVR A;  3DVG Y;  4J6I A;  1V5T A;  1D3Z A;  1ZKH A;  4HCN B;  3IVF A;  2WX0 A;  1OQY A;  3M95 A;  2ZZP B;  1V49 A;  3ENE A;  1I42 A;  2GMI C;  4EZJ A;  1WM2 A;  4IC7 B;  4KSL C;  2LGY A;  2HE7 A;  3UQB A;  4MM3 A;  2ZNV C;  3ZIM A;  2M8S A;  2KK8 A;  4AUQ C;  3ZKJ C;  2K6D B;  2C60 A;  1KOT A;  1E8W A;  3RUL A;  3HIZ A;  3ZLZ A;  3L13 A;  4G3X B;  2C7M B;  2RR9 A;  1OEY A;  3N3K B;  1WYW B;  3UIP B;  4EEW A;  4OVV A;  4WQO B;  2K6Q A;  2W9N A;  3L16 A;  2C7N B;  4ZRK A;  5DPW A;  2J0K A;  2RGF A;  2PJH A;  3M63 B;  1V5O A;  2EKE C;  3S2A A;  2J0J A;  2CS4 A;  1LQB A;  2BKR B;  1P1A A;  3RD2 A;  3UF8 A;  1K8R B;  3R7Q A;  2JWZ A;  2CHX A;  3M3J A;  4MH0 E;  2LRW A;  1BT0 A;  3UQA A;  2C9W B;  2FCS A;  4LJP B;  3PRM B;  2KWC A;  2L00 B;  2JT4 B;  5JZE B;  2KAN A;  4GN1 A;  3KUZ A;  2RPQ A;  1WFY A;  3ALB A;  4WAA A;  5BO4 B;  1GJZ A;  2Z0D B;  3ZNZ B;  2MCN B;  3PVL A;  3RZF A;  2DAJ A;  1UD7 A; 
#chains in the Genus database with same CATH topology
 1VZ8 A;  2WXG A;  1GC6 A;  1WX9 A;  5CHV C;  3I9V 1;  4W9J A;  5E6P A;  2FID A;  2AQ1 B;  1TKY A;  2PPH A;  1YMH E;  5CX3 A;  2KDM A;  4EZL A;  1PGX A;  3VTU A;  3ZNG C;  4A9A A;  1YNT E;  4L2Y A;  2BYT A;  3N1Y C;  1KRH A;  3DWM A;  1FEH A;  1EUV B;  2VZK B;  1N63 A;  1C79 A;  1WGK A;  5GXG B;  2DZJ A;  3A33 B;  2NS5 A;  4DHZ B;  2LD9 A;  5IKC M;  1YJI A;  2W82 A;  3NOB A;  2D10 A;  2KFK A;  1XF5 L;  2WHI A;  2R2Q A;  2L8J A;  4BAX A;  4KV2 A;  1JCK B;  4OVU A;  1OQR A;  5AZF A;  2K22 A;  3Q8F A;  2Y5P A;  3IBE A;  2FAZ A;  3Q3N C;  2WXH A;  3KWL A;  1QOG A;  3PGE A;  1V97 A;  3AM9 A;  2V3S A;  3RI7 C;  3PZD A;  2LGX A;  5EE0 A;  1Q0W B;  1GUA B;  2IJ0 A;  3Q8C A;  4MM3 B;  4KZ0 A;  1PQS A;  2KQS A;  1KLG D;  3GOE A;  1MHX A;  2WXP A;  3TCA A;  4XDC A;  1TKG A;  1Z5S B;  5KHQ A;  1ESF A;  4JL9 A;  5E6N A;  2MP2 A;  3IXS A;  4P6V F;  1AAR A;  2LWP A;  3AE3 B;  3IFW B;  3DBR I;  3H9D A;  2VRR B;  3P4Q B;  2KOX A;  4NZL B;  3GP7 A;  4FJY A;  1K50 A;  1GPX A;  2N9P C;  2N9K A;  2PVO D;  1XQQ A;  1JWM D;  5LLI A;  3L4P A;  3V60 A;  1N5W A;  4GIV A;  1L7Y A;  5IP4 D;  2QIL A;  2N9X A;  2KJ6 A;  3WAN A;  1WYG A;  5EE9 A;  3B1L X;  2LUM A;  2NMQ A;  1LFD A;  4WJQ A;  1BML C;  3BYT B;  2DX5 B;  3GE8 C;  1RWS A;  3APD A;  1MG4 A;  2BS3 B;  3ECI A;  1I4P A;  3Q3F A;  2IO1 B;  2CR5 A;  4KIK B;  3PS6 A;  3VFK A;  1P9D U;  3V61 A;  4CQN A;  1UWX A;  1SB3 C;  2NPT B;  3C0R B;  2WQY B;  4US8 A;  3QAR A;  2FCQ A;  1PDX A;  3ZQ4 A;  3U52 E;  2YLM A;  4HK2 A;  3BY4 B;  1ENF A;  2AWT A;  3HRD D;  3N32 A;  1HXY D;  2ZPN A;  1H8C A;  1F9J A;  1JWB D;  2WWZ A;  1EWC A;  2GBR A;  4M02 A;  3VTW A;  4EUT A;  4PS8 A;  3KUD B;  4PS7 A;  3VUY A;  1UBI A;  3W9C B;  3OJ3 A;  1IGC A;  2Z59 B;  3Q3O C;  3ZNI D;  1TTN A;  4DHZ E;  4TQ0 A;  1CJE A;  4J3O D;  4L23 A;  4A55 A;  4BOS C;  4HDO A;  1WY8 A;  1MPE A;  1PYW D;  3VUX A;  1I4X A;  1EU3 A;  2FUH B;  4REZ A;  4M01 A;  3RNF C;  2J7Q B;  2KJR A;  2KDB A;  4KGS A;  4LDT B;  3LXF A;  2KX0 A;  4JPS A;  3I3T B;  5L95 C;  3NHE B;  4ZDV A;  1Q10 A;  2ZJD A;  4IWP A;  2LGS A;  2RDH A;  2KZR A;  3ZRF A;  2NBW B;  2WDQ B;  2XNA C;  4LLG M;  2EMS A;  3L54 A;  2XK5 A;  1J7C A;  3RPF C;  3AE7 B;  1YQ4 B;  1FD6 A;  4HPL B;  4NJ7 A;  1JAL A;  3R3M A;  2PW9 A;  3HM3 A;  3EHV A;  1D5M C;  2W3S A;  2M4N A;  2R2O A;  2WLB A;  2B76 B;  1L6V A;  4XGA B;  1UWM A;  2QC8 A;  3MHS D;  1QZE A;  1TKE A;  3TJP A;  4GXB A;  1JRP A;  1JQ4 A;  1VZ6 A;  2KDI A;  1Q5W B;  4FXC A;  4JLC A;  3VAW A;  1WE6 A;  2KMC A;  5HG2 A;  4K7W A;  1J8C A;  5LNK 1;  5DPR A;  3TEX A;  4KIK A;  2E3T A;  1WJ4 A;  2KAC A;  2ACZ B;  3HUI A;  3SR6 A;  4K3B A;  1T3Q A;  2L05 A;  2ZVO A;  2XK5 B;  1UUP A;  1UF0 A;  2GI9 A;  2XN9 C;  2BYV E;  4S17 A;  4FHJ A;  1NI2 A;  3NVY A;  2V9H A;  4G50 A;  1ZW7 A;  2GRI A;  5CHF A;  3U8Z A;  1WWT A;  5IA7 A;  2WXR A;  4CHK A;  1SGH A;  4C56 C;  1B1Z A;  4LJO B;  2BQQ A;  1MJD A;  3EUB 2;  4A90 A;  2X38 A;  1WX7 A;  3T9L A;  4YSX B;  3PTF C;  1T0R C;  4N58 A;  2JVC A;  2KTR B;  2ON8 A;  3KVF B;  3EC8 A;  3HHM A;  4TMA B;  3CST A;  5DCN A;  3KUC B;  3PRP B;  1P98 A;  2JF5 A;  1DGJ A;  2WXL A;  2ZNV B;  1C76 A;  1IUE A;  3ML9 A;  3DBH B;  1OTR B;  1WX8 A;  4FA6 A;  3NVZ A;  4I6P A;  1QF6 A;  2KMM A;  4M8N A;  4CYE A;  2QSD A;  1ROE A;  4LDT D;  1A70 A;  2G4S A;  2OOB B;  2AL6 A;  4HKQ A;  2RDG A;  4IM0 A;  4HPM B;  4K7S A;  1RRB A;  3A9K B;  4W9G A;  2JRI B;  3I5J C;  2KN4 A;  5G5G A;  1V1O A;  5CTR C;  3V3X A;  1ZKH A;  2K0P A;  1NEK B;  1T0Q C;  3ENE A;  4IC7 B;  2HE7 A;  3UQB A;  2LGI A;  2K5P A;  2M8S A;  2K6D B;  4C7Y A;  1E8W A;  3HIZ A;  3ZLZ A;  1F2R I;  1N6Z A;  3N3K B;  5HI1 A;  4EEW A;  4OVV A;  2GB1 A;  2K6Q A;  4ZRK A;  4LNO A;  2INN E;  2HTM E;  3S2A A;  4OW0 A;  2J0J A;  3IAM 1;  1P1A A;  4MH0 E;  2CHX A;  2QJL A;  1ZUD 2;  4EE2 A;  4DXF A;  4Q2J A;  1HQR D;  1TY2 A;  2N0S B;  1SSN A;  2RPQ A;  5BO4 B;  2Z0D B;  3Q14 C;  3RZF A;  1UD7 A;  2K8C A;  3J9C A;  5BMG A;  3E9S A;  2L52 A;  2KNB A;  2KTF A;  4ICV A;  1K52 A;  4WAF A;  3W5U B;  2RDB C;  4KSK C;  4HDQ A;  3PT2 B;  4P7I A;  3PZ7 A;  2GBN A;  1CZP A;  4R3D A;  4L1B A;  2ONQ A;  1HA5 A;  3TMP B;  2QEJ C;  2WXO A;  4WQM A;  5E6O A;  3URY A;  1E0Z A;  3KLS X;  3R2I A;  4BKS D;  3W1S A;  4F1S A;  1XCQ L;  4KKI A;  1RAX A;  2ZCC A;  3QC8 B;  4MJS A;  1D5Z C;  3SHQ A;  1FCL A;  1WSP A;  1XO3 A;  2WXK A;  4LTU A;  3CMM B;  4ZHP A;  1C78 A;  4X57 B;  1BXT A;  3HVZ A;  2QHO A;  2JY6 A;  4RM8 A;  3VDZ A;  1H4R A;  1FNW A;  3QA8 A;  1KLV A;  3Q3M C;  2ZVN A;  2IND C;  3V62 A;  2K3U A;  1WJ6 A;  5I4D A;  2LXC A;  3EA6 A;  1XCT L;  2JZ3 B;  2AQ3 B;  1GB1 A;  1ZDX A;  4KX6 B;  3PRE A;  1FIQ A;  1R4M B;  1TY0 A;  4BKG A;  4XWT A;  1F0Z A;  5HKH A;  1VDV A;  4XC2 A;  3N20 C;  4H2A A;  2OHF A;  3HM6 X;  4FBJ B;  3P4R B;  3M62 B;  3A9J B;  2AX5 A;  1VJK A;  1CMX B;  4F7Z A;  1WGH A;  2BYE A;  1FNU A;  1TGZ B;  1C4C A;  2GBK A;  2BTE A;  2ZCB A;  2KD0 A;  5FK9 C;  2I1J A;  2N9L A;  1FNV A;  4ANW A;  3WIM A;  1WZ0 A;  1L5P A;  2ZPY A;  5G2N A;  1V86 A;  2NVU I;  4MEM A;  1UGJ A;  5IOI A;  4AP4 C;  4E71 A;  1ZOY B;  2FCM A;  2DYO A;  3RUI B;  2WP9 B;  3DBS A;  2L76 A;  4FN2 A;  2D2Q A;  4EFO A;  1KLU D;  1YQB A;  3B08 A;  2DAF A;  3U7D A;  5EE3 A;  5AUI A;  3JYU A;  3TEW A;  1WGD A;  4II2 B;  1NEN B;  3VH4 B;  3ZTC A;  2OJR A;  4ANV A;  4HJK A;  3DBH I;  3BIN A;  4F8C B;  2L7R A;  1IYF A;  4II3 B;  1YN3 A;  3ZXV A;  2H88 B;  1R4N B;  2SEB D;  4RFB A;  3AE6 B;  2ASQ A;  4GDK B;  1WXA A;  1ZE3 D;  3ZXR A;  1YOV B;  4RNA A;  4ZRJ A;  4NPN A;  4EKU A;  3FAH A;  4RF0 A;  1EM7 A;  3PSE B;  4PS3 A;  3TUO A;  2D11 A;  1XLQ A;  2AQ2 B;  3CIR B;  4MJS B;  1Y56 A;  4FUL A;  4BOZ B;  3EGR A;  3PHW B;  4ACF A;  4MAC A;  4B9K A;  1D5X C;  3HVD A;  2QIE B;  2J42 A;  4RGO S;  3ZDM C;  3MHZ A;  1S1Q B;  3R66 C;  4G11 A;  2NCN A;  3AEA B;  2GLS A;  1VCB A;  1YJ1 A;  3NS8 A;  3QJZ A;  5JHB A;  4IDI A;  3VR9 B;  4GOC A;  1KTK A;  2UWQ A;  4B95 A;  1SE2 A;  2L0F A;  2IO3 B;  4GLS C;  1V80 A;  1VR9 A;  3MP9 A;  3QWZ B;  4KZC A;  3VUW A;  3AMZ A;  1I35 A;  2LFI A;  2CU1 A;  2RPV A;  1PGB A;  2RSU A;  2ZEQ A;  5FR3 A;  3DPD A;  1Q1O A;  2IY1 B;  1UBQ A;  2Y3A A;  4CO7 A;  5DPT A;  2WU5 B;  4BVU C;  4LK0 M;  1ZGU B;  2X8X X;  4GGQ A;  1X1M A;  2MLB A;  2V3P A;  4LCD E;  2FCN A;  2BW2 A;  2KWD A;  1MHH E;  2VH1 A;  3UIN B;  3Q8E A;  3PLV A;  3VR8 B;  1UGM A;  2MRP A;  1WXV A;  4BBN C;  5C1Z A;  1E7V A;  2KX3 A;  4GDL B;  2JXT A;  3H7P A;  4LNI A;  2VZK D;  2NPT A;  1I4Q A;  2UYZ B;  3OWE B;  3MJW A;  3P2B A;  1FFV A;  3H6N A;  1WMH A;  4NAW B;  4AWJ A;  3TBL D;  2L0T A;  3BZD B;  2Y5C A;  4OVZ A;  1QOF A;  1WR6 E;  2L1A A;  4RGT A;  2JYE A;  4DXG A;  1TS4 A;  2I38 A;  4MEL A;  3H7P B;  1IBX B;  3EFU A;  1UNS A;  2LVQ A;  2DYM A;  4BBN F;  3Q3J A;  3K9P B;  4FJV B;  1VZ7 A;  2K9X A;  2D3G A;  3ZJU A;  4AJW A;  2BVC A;  3SDL C;  4LNK A;  1QOB A;  4N9F 4;  4D2K A;  2M19 A;  4W9D A;  4ZOH C;  3H1U A;  3JVZ X;  2Z8L A;  3VRA B;  3N9Y C;  2DLB A;  2A5U A;  3DQV A;  5T8I A;  1VLB A;  5E6J A;  4WJN A;  1AWD A;  1HZ5 A;  1JML A;  3B2G A;  1R4N I;  3RMK C;  4KVG B;  1S3S G;  4YWG G;  3LJ3 A;  4K3C A;  4I6N B;  4RM9 A;  2K8H A;  4AJY B;  4K1R B;  1Z2M A;  4IG7 B;  1MG8 A;  2XBB C;  1WRI A;  2DNF A;  3QIJ A;  1WXM A;  1PFD A;  2KLG A;  4NJC A;  3O65 B;  3SD5 A;  3ZGZ A;  2DBY A;  4DK5 A;  2O6V D;  3NVV A;  3IT6 B;  4NJ6 A;  3PHX B;  1FXT B;  4BZA A;  3L17 A;  2IY0 B;  1R4M I;  3LB8 C;  1WE7 A;  2L83 A;  1JRO A;  5JH5 C;  2AL3 A;  2HD5 B;  4MGZ E;  2UU7 A;  2WXF A;  3GZN B;  3UI3 A;  2WXI A;  1UEL A;  1ISN A;  2KQ7 A;  3DDC B;  4J6I A;  1V5T A;  3C8Y A;  2WX0 A;  4AS1 A;  1I42 A;  1L6U A;  1YN5 A;  2LGY A;  2QCZ A;  3RNC C;  3SFE B;  3ZIM A;  4LNN A;  2C60 A;  2J52 A;  4YTM B;  2D3C A;  1P7E A;  2D3A A;  3DBR B;  1WYW B;  3U2S C;  3L16 A;  2C7N B;  1SEB D;  5DPW A;  3OG5 A;  2PJH A;  1V5O A;  4IKG A;  3RD2 A;  3R7Q A;  3M3J A;  1NYQ A;  2PIA A;  1BT0 A;  1QKZ A;  3UQA A;  1JWU D;  1TT5 B;  2KAN A;  1IBX A;  4GN1 A;  1WFY A;  4WAA A;  4IOI E;  1GJZ A;  1TIF A;  3ZNZ B;  4C00 A;  1WJU A;  4BFR A;  1M4V A;  3IHP C;  3QK0 A;  2IO2 B;  4B0M A;  3KYC D;  2MA9 B;  3NUH B;  1GAQ B;  4MGK E;  4OHJ A;  1SBB B;  4FLH A;  1JW9 D;  2DZM A;  2K8B A;  3TSS A;  3ZJT A;  1AW7 A;  2MBQ A;  2BKF A;  2TSS A;  3AUL A;  3MFG A;  1YX6 B;  4O1N A;  2KMA A;  2N1W A;  1LXD A;  3QHT A;  1V1P A;  1BUI C;  3MC0 B;  2QMT A;  4TKN A;  5FKA C;  2RD0 A;  1E8Z A;  1V2Y A;  3Q6B A;  2ZW0 A;  1NDD A;  3DBL I;  5TR5 A;  5IO9 A;  1C3T A;  2N1V A;  1E90 A;  2BYF A;  1HTQ A;  2WNM A;  1LGR A;  3GB1 A;  3RT3 B;  1L2N A;  2LJI A;  3P1M A;  2JZZ A;  2GBJ A;  4TQ1 A;  1J7B A;  2Z0E B;  2H89 B;  1TYG B;  4C4V A;  4I6L B;  1SIJ A;  4TSS A;  3N1X C;  2DEN B;  4GU2 A;  4XWW A;  1CK1 A;  3PRZ A;  5AEK B;  2VH2 A;  3MTN B;  4FHK A;  3AU5 A;  1N60 A;  2I2Y A;  5C23 A;  5BYS A;  2JSV X;  1ET9 A;  2JQR B;  3AEE B;  3DBL B;  5BYQ A;  3WA0 A;  4MSM B;  4USA A;  2D3B A;  2MQJ A;  2E6X A;  1WF9 A;  2M0X A;  5D3I B;  3B0A A;  4YL8 A;  2O2V A;  1V1P B;  2G9H D;  4W9K A;  2CKH B;  4YSZ B;  4US9 A;  2JXX A;  3D32 A;  3A1Q A;  2MJD A;  2V4I B;  1XLP A;  3EEC A;  4HJG E;  1J0G A;  2SAK A;  2PLP A;  2MBH A;  2BF8 B;  3UIO B;  4E74 A;  1DOI A;  3ZVV A;  5KHO A;  2MP2 B;  4HXD A;  4ZRQ A;  3EFC A;  1QT9 A;  4YXD B;  4WWP A;  2LVP A;  1TBE A;  2BS4 B;  4YTP B;  1WRD B;  2MH7 A;  1YN4 A;  1CQV A;  4OZB A;  3RZW C;  4MGY E;  3RNE C;  3NZS A;  3RNB C;  3KW5 B;  3NRZ A;  1GNU A;  5D94 A;  1GG3 A;  4E3C A;  1M94 A;  4W9H A;  1RM6 C;  2R61 A;  3ZO5 B;  4ANX A;  2KKC A;  2MBB B;  5HHD G;  3KWV A;  5FR6 A;  1SIF A;  4OZA A;  3I63 C;  3PV1 A;  2ICI A;  2G45 B;  3VXW A;  1C1Y B;  4MGI E;  4ITK A;  3BVG A;  5H92 C;  3WAM A;  2CU3 A;  5D7G A;  4DHJ B;  3DVG X;  1MFW A;  3ZTD A;  2J4X A;  5JHA A;  2LUE A;  1K51 A;  1OEY J;  4M8M A;  3IG3 A;  1I4H A;  3U30 A;  2LGD A;  3LDZ E;  4GB9 A;  1QQR A;  4BKS A;  5BMI A;  2FE8 A;  3RFZ B;  3CSF A;  2FIF A;  1C4A A;  2MX2 A;  4P1C C;  4PK1 A;  5BMH A;  1RLF A;  4IWQ A;  2KLC A;  3QAQ A;  1L0V B;  3AH7 A;  4GDK A;  3MC9 A;  2ZW1 A;  2PMV A;  2D5G A;  3VQI A;  2DHZ A;  1AN8 A;  3BYY B;  2NTS A;  1I4G A;  1WGY A;  1T0Y A;  1TJE A;  2DZK A;  1DOX A;  3AE1 B;  2N4F A;  4DXA B;  2INP E;  3LYY A;  1V8C A;  1WH3 A;  5AZH A;  2WDR B;  2BS2 B;  2D07 B;  4NY0 A;  1GB4 A;  1B9R A;  4WIP A;  2Q5W D;  3JSV A;  2KC1 A;  2WXJ A;  2IGG A;  4FJZ A;  1WMH B;  3APF A;  4EOY A;  1T0S C;  2GOW A;  1F77 A;  3ZRC A;  4NAM A;  5DPS A;  3Q8A A;  1E7U A;  1FPY A;  1FFU A;  4IWO A;  1EU4 A;  3PZ8 A;  3WAO A;  1KJT A;  3AED B;  2YEP B;  1J19 A;  4N6E B;  2N9E B;  4DDI D;  3AE5 B;  2PTL A;  1R7S A;  1YQ3 B;  2NBU A;  2Y5B B;  3ML8 A;  4KDI C;  2KTR A;  4WWN A;  2HJ1 A;  1WZ3 A;  1XLN A;  1YX5 B;  1C9F A;  2JU6 X;  5LXH A;  2AEH A;  5G55 A;  3OJ4 B;  2LXA A;  5JXV A;  3QX1 A;  1J7A A;  1TZ1 A;  4YSY B;  3AE2 B;  3P4S B;  2M0A A;  3BK2 A;  1QIL A;  4NNJ B;  1L4D B;  3RNA C;  3PLU A;  1T5X D;  2N7D A;  3MJ5 A;  3AB5 A;  4M00 A;  4EZK A;  3DOW A;  3ONS A;  4WH4 A;  2KDE B;  1GOZ A;  1RFA A;  2GBM A;  1D6E C;  3DHG C;  3P42 A;  4IW0 A;  4KGR A;  3R8B A;  3AEG B;  3CWI A;  1HE8 A;  2MEK A;  4NAW A;  3T3N A;  4DHJ D;  1E8Y A;  2WXN A;  5AZG A;  1XD3 B;  3ZNH B;  2IO0 B;  2IPK D;  1N61 A;  4A3P A;  1FXA A;  2PEA A;  4FAD A;  1V81 A;  3NZU A;  4W9L A;  1V9J A;  2MJE A;  3AN1 A;  3AV8 A;  2MJ3 A;  4RMA A;  4S0R A;  2BGF A;  3BII D;  3U4E G;  1L0X B;  5LXI B;  1E5W A;  4JWU C;  2YEP F;  3W5V B;  2CJN A;  2EMT A;  4ICU A;  2XEW A;  3Q8B A;  4DWF A;  2M17 A;  4W9I A;  2HJ8 A;  4C80 A;  5EDS A;  2G3Q B;  1T6B X;  4UDU C;  2RMM A;  1UH6 A;  3JW0 X;  3ETR A;  4W9E A;  2L3Z A;  4A6Q A;  2KQ4 X;  2JZP A;  3AI5 A;  4GSW A;  3DVN U;  2KVR A;  1C77 A;  1D3Z A;  4HCN B;  4ARI A;  3IVF A;  1OQY A;  3M95 A;  2GMI C;  2V3N A;  4EZJ A;  4KSL C;  1E10 A;  4HPP A;  2ZNV C;  2KK8 A;  1KOT A;  3RUL A;  3T3O A;  4G3X B;  1OEY A;  3UIP B;  1SJH D;  2W9N A;  2OED A;  2J0K A;  1NVI D;  1HEZ E;  3M63 B;  1KH0 A;  2EKE C;  5G5H A;  2CS4 A;  3ZJV A;  1LQB A;  2BKR B;  1K8R B;  3RNG C;  4WUR A;  2FBW B;  2L00 B;  2JT4 B;  5JZE B;  4ZHO A;  3ALB A;  2DAJ A;  2MBE A;  3CF6 E;  4WJO A;  1UZX B;  3KYD D;  3R7R A;  3Q2A C;  3NG0 A;  2HDE A;  3L08 A;  3NY5 A;  4HWI B;  3GS2 A;  4P16 A;  2V0G A;  2WDV B;  4TV3 A;  1EO6 A;  1QOA A;  1FRD A;  2EKI A;  3FIL B;  4C7Z A;  3AE9 B;  1A5R A;  4TUU A;  1WI0 A;  1XEE A;  2NR2 A;  4BKT A;  4DBG A;  1JWA D;  2BB5 A;  3KQ4 A;  3ABV B;  4QAY A;  4XYC A;  1KM7 A;  5IN7 A;  2PVG C;  4ZRP A;  2KAJ A;  3AE4 B;  1EF1 A;  3AU4 A;  2WXQ A;  1RYJ A;  2KC2 A;  3V6C B;  2HTH A;  1TS3 A;  3E56 A;  2BT6 A;  2CHW A;  2K39 A;  3TL5 A;  2DWQ A;  3DVN V;  4ZYN A;  3AE8 B;  2WXM A;  4XZ4 A;  1NBF C;  5TSS A;  2REX A;  2W55 A;  2LHD A;  4WJP A;  5IAA C;  3VTV A;  1SE3 A;  2OJW A;  1F52 A;  2BWF A;  5J2R A;  4ANU A;  1FO4 A;  3H7S A;  4AOF A;  1FMA D;  2INC C;  1SXT A;  4A20 A;  4K7U A;  4YT0 B;  3I57 A;  1WGR A;  3GZN I;  3ZDT A;  1SF0 A;  2C5L C;  3VVW B;  4XDD A;  1G6J A;  1GC7 A;  4MDK E;  2EEL A;  3K9O B;  1FM0 D;  1SE9 A;  2CHZ A;  1HTO A;  2LVO A;  5C2T B;  3OLM D;  1K53 A;  3A4R A;  4PT5 A;  1LO5 D;  3HK0 A;  4OZC A;  2IGH A;  2WGS A;  3R2T A;  3W1S C;  3WCQ A;  3Q69 A;  3PPA A;  1I4R A;  3VHT C;  1TZO A;  4B6W A;  2IZV B;  2KJH B;  4M0W B;  1HZ6 A;  1PUT A;  3P4P B;  2KXJ A;  1P0R A;  4A8X C;  1L0Y B;  1D4B A;  4MSQ B;  1L4Z B;  2W54 A;  3MC8 A;  5HFY A;  1SE4 A;  4DDG D;  2MHJ A;  2G4D B;  4YTN B;  4HCP B;  3ZUN A;  4HRO A;  3TEZ A;  4RCO A;  4XX5 A;  1IPG A;  1E6E B;  3SFD B;  2JUO A;  1ZPS A;  3SEB A;  1TS5 A;  4MH8 A;  2PE9 A;  3AXC A;  3NZ3 A;  2JYT A;  2N7J A;  4ARC A;  3IAS 1;  5BYR A;  4WWO A;  2KFK B;  5EE1 A;  3V05 A;  1WM3 A;  2JPH A;  5L83 A;  4GMV A;  1YD8 U;  2V1Y A;  2IYD B;  5J17 A;  3W2D A;  2V4L A;  4RF1 A;  2KWV B;  3ZW3 A;  2MSE D;  3A9K A;  4XE0 A;  3DCG A;  5D6J B;  1AYF A;  1WXQ A;  2BWE S;  5AUK A;  2N7E A;  1U4A A;  4IM2 A;  3X0W A;  3QCA A;  3DHH C;  2J53 A;  1ZXH A;  1FCC C;  4JE3 B;  3TIX A;  5C3J B;  4URK A;  4IM3 A;  4RGN A;  3JSV B;  4PYU A;  3VH3 B;  2YVC A;  2KFJ A;  2G1E A;  2QDF A;  3C19 A;  4JIO U;  1LM8 B;  2JX5 A;  4A3O A;  1SJE D;  1EF5 A;  3O13 A;  2W3R A;  4P1B C;  5D2M B;  1YIW A;  4N59 A;  3WAP A;  1WR1 A;  1Y8R C;  1QLB B;  2B3A A;  2KO3 A;  1WIA A;  1RFK A;  2K1F A;  1F2R C;  3A1Q B;  3BK1 A;  4HRS A;  4W9C A;  2CJO A;  3BVZ A;  4K81 A;  1MI0 A;  3DWG C;  4KDL B;  2M56 B;  3PO0 A;  4M0W A;  1OGW A;  4JWS C;  3OAW A;  5MPO A;  1ZXI A;  3B2F A;  5CHW A;  2BPS A;  2DYB A;  2IDY A;  1KF6 B;  3V6E B;  1XLO A;  1FXI A;  3NJT A;  2KDF B;  4B0E A;  4G0N B;  2FNJ B;  3T8M A;  2NBV B;  2KHW B;  2WS3 B;  1YJJ A;  2PKO A;  3BWU D;  4C4V B;  1N62 A;  2WX1 A;  1OFF A;  1ACC A;  2MWS B;  3VRB B;  1DOY A;  1VD2 A;  2KVZ A;  4JGH B;  2LMC A;  1OQQ A;  2AYO B;  3KH0 A;  4MT5 A;  2IBI B;  1JRU A;  2I1K A;  4HVB A;  3W1Y A;  1NYR A;  3GE3 C;  1WGG A;  1ZP0 B;  4RGM A;  2O6V B;  4HKZ E;  2JWU A;  3L0W B;  4GDL A;  2KYW A;  4W9F A;  4KKJ A;  2KT7 A;  2O2V B;  2MBO A;  3DHI C;  3B9J A;  4JX1 C;  1P7F A;  3SU8 X;  3AEC B;  5J18 A;  3RN9 C;  3RYT A;  3U7Z A;  3ZYY X;  1E8X A;  1XT9 B;  1P3Q U;  3RCZ A;  1WXS A;  2LAS A;  1IP9 A;  2WU2 B;  5GMV A;  2A4Z A;  2JRH A;  4PYZ A;  1VRA B;  2M1M A;  1N5X A;  1FRR A;  5H8Y E;  3QQ8 B;  4HEA 1;  1ET6 A;  1PGA A;  1IGD A;  3N1Z C;  2PE6 B;  2KN5 A;  3A9J A;  2MW5 A;  4HLE A;  1NI3 A;  2BB6 A;  3X23 A;  4NQL B;  4JQW C;  2O6V A;  1E7P B;  3UGB B;  3FKY A;  1STE A;  2KWU B;  4DQO C;  2IGD A;  2LJ5 A;  1ZDV A;  1E9M A;  1EWY C;  2LI5 A;  4ASW C;  2FUG 1;  4RH6 A;  4NQK E;  2K25 A;  3A4S C;  4AQ7 A;  4ZRI A;  2LZ6 A;  3AEF B;  2DZI A;  3FC4 A;  4LNF A;  1WJN A;  1F1H A;  2WYQ A;  3TEY A;  3APC A;  1V6E A;  2LRU A;  3IT4 B;  1TS2 A;  3NS1 A;  2J0M A;  4IUM B;  2C7H A;  3N30 A;  1XXG A;  1JWS D;  2WDT B;  3L10 B;  3DVG Y;  1I7H A;  3P63 A;  2ZZP B;  1V49 A;  1WM2 A;  4MM3 A;  2BBC A;  1C4P A;  4AUQ C;  3ZKJ C;  3AEB B;  3L13 A;  2C7M B;  2RR9 A;  1MVK A;  2NTT A;  4WQO B;  1DYQ A;  2RGF A;  2LEK A;  4KGT A;  3NVW A;  2L32 A;  3UF8 A;  3FIL A;  2JWZ A;  1KFY B;  2LRW A;  4WWM A;  3H8H A;  2C9W B;  2FCS A;  4LJP B;  3BVM A;  4ZYS A;  3PRM B;  2KWC A;  5D3D A;  3KUZ A;  2MCN B;  3PVL A;  2LHE A;  3WAL A; 
#chains in the Genus database with same CATH homology
 2MBE A;  2K8C A;  1GC6 A;  1WX9 A;  1WJU A;  3CF6 E;  4BFR A;  4WJO A;  5CHV C;  4W9J A;  5E6P A;  2FID A;  1UZX B;  2PPH A;  2KNB A;  2KTF A;  3IHP C;  4ICV A;  3KYD D;  3QK0 A;  3R7R A;  2IO2 B;  5CX3 A;  3L08 A;  4KSK C;  4EZL A;  3NY5 A;  4HWI B;  3VTU A;  4HDQ A;  3PT2 B;  3KYC D;  4P7I A;  3ZNG C;  2MA9 B;  2GBN A;  4MGK E;  4TV3 A;  4FLH A;  1EUV B;  1EO6 A;  3TMP B;  2DZM A;  2K8B A;  2MBQ A;  5E6O A;  1A5R A;  4TUU A;  2BKF A;  3AUL A;  1WI0 A;  2NR2 A;  1YX6 B;  2KMA A;  4BKT A;  4BKS D;  2N1W A;  3W1S A;  4DBG A;  1LXD A;  4F1S A;  2DZJ A;  3QHT A;  3A33 B;  2NS5 A;  4DHZ B;  1RAX A;  4TKN A;  2RD0 A;  2ZCC A;  1E8Z A;  2LD9 A;  3QC8 B;  4MJS A;  1V2Y A;  3SHQ A;  1NDD A;  3DBL I;  3NOB A;  5TR5 A;  2D10 A;  1C3T A;  2N1V A;  2KFK A;  1E90 A;  2BYF A;  2R2Q A;  2L8J A;  3CMM B;  4KV2 A;  1KM7 A;  3RT3 B;  1L2N A;  4OVU A;  2JZZ A;  2GBJ A;  4TQ1 A;  1EF1 A;  4X57 B;  5AZF A;  3AU4 A;  2Z0E B;  3IBE A;  2FAZ A;  2QHO A;  2JY6 A;  4I6L B;  2KC2 A;  4RM8 A;  1H4R A;  3V6C B;  3VDZ A;  2HTH A;  2DEN B;  3QA8 A;  4GU2 A;  3PRZ A;  2CHW A;  3PGE A;  5AEK B;  2V3S A;  1KLV A;  2K39 A;  3PZD A;  3TL5 A;  2LGX A;  3MTN B;  2ZVN A;  1Q0W B;  4FHK A;  1GUA B;  3AU5 A;  3DVN V;  4ZYN A;  3V62 A;  4XZ4 A;  1WJ6 A;  1NBF C;  2REX A;  2LXC A;  4KZ0 A;  5C23 A;  1PQS A;  2KQS A;  4WJP A;  5IAA C;  3GOE A;  3VTV A;  2JZ3 B;  3TCA A;  2BWF A;  5J2R A;  3WA0 A;  4MSM B;  1Z5S B;  5KHQ A;  3PRE A;  4JL9 A;  5E6N A;  4ANU A;  4BKG A;  2MP2 A;  2MQJ A;  1WF9 A;  2M0X A;  3B0A A;  3H7S A;  4AOF A;  4YL8 A;  4A20 A;  4K7U A;  2O2V A;  5HKH A;  1AAR A;  2LWP A;  4W9K A;  4XC2 A;  1WGR A;  3IFW B;  2CKH B;  3DBR I;  3GZN I;  3ZDT A;  2C5L C;  3VVW B;  3H9D A;  2JXX A;  2VRR B;  3HM6 X;  4FBJ B;  1G6J A;  1GC7 A;  2KOX A;  4MDK E;  4FJY A;  3D32 A;  3M62 B;  3A1Q A;  2N9P C;  3K9O B;  3A9J B;  1SE9 A;  2CHZ A;  1XQQ A;  1CMX B;  3EEC A;  4F7Z A;  1J0G A;  1WGH A;  2BYE A;  5LLI A;  2LVO A;  2MBH A;  2BF8 B;  3UIO B;  4E74 A;  1TGZ B;  3V60 A;  3OLM D;  3A4R A;  3ZVV A;  2GBK A;  5KHO A;  2MP2 B;  2ZCB A;  4GIV A;  1L7Y A;  2KD0 A;  4HXD A;  3HK0 A;  2I1J A;  2KJ6 A;  2N9X A;  3WAN A;  4WWP A;  2LVP A;  3WIM A;  1TBE A;  1WZ0 A;  4ANW A;  3W1S C;  3B1L X;  2ZPY A;  3PPA A;  5G2N A;  1WRD B;  1V86 A;  2NVU I;  4MEM A;  3VHT C;  1LFD A;  4WJQ A;  4MGY E;  3RZW C;  4B6W A;  3NZS A;  4AP4 C;  4E71 A;  2IZV B;  2KJH B;  4M0W B;  3KW5 B;  2DX5 B;  2KXJ A;  2FCM A;  3APD A;  2DYO A;  1GNU A;  3RUI B;  3DBS A;  1P0R A;  2L76 A;  4FN2 A;  5D94 A;  2D2Q A;  4MSQ B;  4EFO A;  3ECI A;  1GG3 A;  4E3C A;  1M94 A;  4W9H A;  3Q3F A;  2IO1 B;  1YQB A;  3B08 A;  3ZO5 B;  4ANX A;  2CR5 A;  2DAF A;  2KKC A;  4DDG D;  2G4D B;  2MBB B;  3PS6 A;  4KIK B;  3U7D A;  3VFK A;  4HCP B;  3ZUN A;  3JYU A;  1WGD A;  5FR6 A;  1P9D U;  3V61 A;  1SIF A;  4II2 B;  4XX5 A;  3PV1 A;  3VH4 B;  3ZTC A;  2OJR A;  1IPG A;  4ANV A;  4HJK A;  3DBH I;  2NPT B;  2JUO A;  3C0R B;  3BIN A;  4F8C B;  2L7R A;  1IYF A;  4II3 B;  2G45 B;  3VXW A;  3QAR A;  2FCQ A;  2PE9 A;  3AXC A;  1C1Y B;  2ASQ A;  4GDK B;  4MGI E;  3WAM A;  1WXA A;  2YLM A;  4HK2 A;  3BY4 B;  4DHJ B;  5D7G A;  4WWO A;  3DVG X;  4ZRJ A;  2AWT A;  4NPN A;  3ZTD A;  2KFK B;  4EKU A;  1WM3 A;  2JPH A;  5JHA A;  5L83 A;  2LUE A;  1OEY J;  4GMV A;  1YD8 U;  2ZPN A;  3N32 A;  3PSE B;  2V1Y A;  2IYD B;  4M8M A;  4PS3 A;  5J17 A;  1H8C A;  1F9J A;  3IG3 A;  2V4L A;  2WWZ A;  2D11 A;  2GBR A;  3U30 A;  3VTW A;  4EUT A;  2LGD A;  3KUD B;  4PS7 A;  3LDZ E;  1UBI A;  4GB9 A;  4MJS B;  4PS8 A;  4FUL A;  3OJ3 A;  2KWV B;  2Z59 B;  3ZW3 A;  4BKS A;  4BOZ B;  3PHW B;  2MSE D;  3A9K A;  3DCG A;  5D6J B;  3ZNI D;  4B9K A;  1TTN A;  4DHZ E;  3CSF A;  2BWE S;  4TQ0 A;  2N7E A;  1U4A A;  4IM2 A;  2FIF A;  2MX2 A;  3QCA A;  3X0W A;  4BOS C;  4HDO A;  3TIX A;  4URK A;  1RLF A;  4IM3 A;  1WY8 A;  4IWQ A;  3JSV B;  3ZDM C;  4PYU A;  2KLC A;  3VUX A;  3QAQ A;  3VH3 B;  2YVC A;  2KFJ A;  1S1Q B;  3R66 C;  2FUH B;  4G11 A;  2NCN A;  4GDK A;  4JIO U;  2J7Q B;  1LM8 B;  1VCB A;  2KJR A;  4A3O A;  1YJ1 A;  3NS8 A;  2KDB A;  1EF5 A;  3QJZ A;  4LDT B;  5D2M B;  2KX0 A;  3VQI A;  5JHB A;  2DHZ A;  1YIW A;  3I3T B;  3WAP A;  5L95 C;  1WR1 A;  3NHE B;  1Y8R C;  4ZDV A;  1WGY A;  4GOC A;  2UWQ A;  4B95 A;  1T0Y A;  2B3A A;  2L0F A;  2KO3 A;  2IO3 B;  2ZJD A;  2DZK A;  1V80 A;  4IWP A;  2N4F A;  4DXA B;  2KZR A;  3ZRF A;  1WH3 A;  2NBW B;  5AZH A;  1WIA A;  2K1F A;  3A1Q B;  2D07 B;  3QWZ B;  4KZC A;  3VUW A;  4W9C A;  4NY0 A;  1I35 A;  2CU1 A;  2EMS A;  4K81 A;  3L54 A;  3JSV A;  2XK5 A;  4KDL B;  2KC1 A;  2RSU A;  1OGW A;  4FJZ A;  3OAW A;  2ZEQ A;  1WMH B;  3DPD A;  4HPL B;  3APF A;  4NJ7 A;  5CHW A;  1Q1O A;  2IY1 B;  1UBQ A;  2BPS A;  4EOY A;  2DYB A;  4CO7 A;  5DPT A;  3R3M A;  2GOW A;  4BVU C;  3HM3 A;  3V6E B;  3EHV A;  3ZRC A;  5DPS A;  1ZGU B;  1X1M A;  2MLB A;  2M4N A;  1E7U A;  4GGQ A;  4LCD E;  2FCN A;  2KDF B;  2R2O A;  4G0N B;  2FNJ B;  4IWO A;  3T8M A;  3UIN B;  3PLV A;  3WAO A;  1UGM A;  1KJT A;  2MRP A;  1WXV A;  2NBV B;  2KHW B;  3MHS D;  4BBN C;  1QZE A;  3TJP A;  5C1Z A;  1E7V A;  4GXB A;  1J19 A;  2KX3 A;  2WX1 A;  4GDL B;  2N9E B;  4DDI D;  2MWS B;  3H7P A;  1VD2 A;  2NBU A;  2Y5B B;  2KDI A;  1Q5W B;  3ML8 A;  4JGH B;  4KDI C;  2KTR A;  3WAL A;  4JLC A;  3VAW A;  4WWN A;  1WE6 A;  1WZ3 A;  2KMC A;  2AYO B;  3KH0 A;  1YX5 B;  2NPT A;  2IBI B;  5LXH A;  1JRU A;  2AEH A;  2UYZ B;  4K7W A;  3MJW A;  3P2B A;  5DPR A;  1J8C A;  3H6N A;  1WMH A;  2I1K A;  4NAW B;  4HVB A;  3W1Y A;  4AWJ A;  3TBL D;  4KIK A;  2L0T A;  5G55 A;  3OJ4 B;  1WJ4 A;  2LXA A;  1WGG A;  1WR6 E;  2O6V B;  2L05 A;  3QX1 A;  2ZVO A;  1TZ1 A;  2XK5 B;  3L0W B;  4GDL A;  4W9F A;  2BYV E;  3H7P B;  4MEL A;  3EFU A;  2O2V B;  4FHJ A;  2MBO A;  1NI2 A;  2LVQ A;  2DYM A;  4BBN F;  3Q3J A;  3K9P B;  4FJV B;  3SU8 X;  4NNJ B;  3PLU A;  2D3G A;  2N7D A;  4G50 A;  5J18 A;  1ZW7 A;  3RYT A;  4AJW A;  4EZK A;  3DOW A;  1E8X A;  1XT9 B;  3ONS A;  1P3Q U;  5CHF A;  3SDL C;  2KDE B;  3U8Z A;  3RCZ A;  5IA7 A;  1WXS A;  4CHK A;  2LAS A;  4N9F 4;  1SGH A;  1IP9 A;  1RFA A;  4W9D A;  2GBM A;  3H1U A;  4LJO B;  3JVZ X;  5GMV A;  2A4Z A;  2JRH A;  2M1M A;  4IW0 A;  4PYZ A;  2A5U A;  3DQV A;  1HE8 A;  1WX7 A;  3T9L A;  4NAW A;  3PTF C;  4DHJ D;  1E8Y A;  3QQ8 B;  4WJN A;  5AZG A;  1XD3 B;  3ZNH B;  2JVC A;  2IO0 B;  4A3P A;  2KTR B;  1R4N I;  2PE6 B;  2KN5 A;  3KVF B;  3A9J A;  3EC8 A;  3HHM A;  2PEA A;  4FAD A;  3CST A;  1V81 A;  3NZU A;  2MW5 A;  1V9J A;  4KVG B;  4W9L A;  5DCN A;  1S3S G;  4HLE A;  3X23 A;  4NQL B;  3KUC B;  3PRP B;  4JQW C;  4RMA A;  1P98 A;  2BGF A;  2JF5 A;  3LJ3 A;  2O6V A;  5LXI B;  4I6N B;  4RM9 A;  1E5W A;  2K8H A;  2ZNV B;  4AJY B;  4K1R B;  1Z2M A;  3UGB B;  3ML9 A;  2KWU B;  4IG7 B;  1MG8 A;  2XBB C;  1OTR B;  2LJ5 A;  1WX8 A;  3QIJ A;  1WXM A;  2EMT A;  4ICU A;  2KLG A;  2XEW A;  2LI5 A;  3O65 B;  4FA6 A;  4I6P A;  3SD5 A;  4DK5 A;  4ASW C;  4DWF A;  2O6V D;  4NQK E;  2K25 A;  3A4S C;  4M8N A;  4ZRI A;  2LZ6 A;  4CYE A;  2M17 A;  4LDT D;  3PHX B;  4NJ6 A;  2G4S A;  1FXT B;  2AL6 A;  2HJ8 A;  2OOB B;  4W9I A;  3L17 A;  4IM0 A;  2IY0 B;  1R4M I;  2DZI A;  5EDS A;  2G3Q B;  1WJN A;  1WE7 A;  3VUY A;  2WYQ A;  5JH5 C;  2AL3 A;  3APC A;  1V6E A;  1UH6 A;  2HD5 B;  2LRU A;  3JW0 X;  4HPM B;  4K7S A;  4MGZ E;  4W9E A;  1RRB A;  2L3Z A;  3A9K B;  4W9G A;  2JRI B;  2J0M A;  4IUM B;  2C7H A;  1UEL A;  3AI5 A;  3N30 A;  4GSW A;  5CTR C;  1ISN A;  2KQ7 A;  3DDC B;  2WDT B;  3DVN U;  3L10 B;  2KVR A;  3DVG Y;  4J6I A;  1V5T A;  1D3Z A;  1ZKH A;  4HCN B;  3IVF A;  2WX0 A;  1OQY A;  3M95 A;  2ZZP B;  1V49 A;  3ENE A;  1I42 A;  2GMI C;  4EZJ A;  1WM2 A;  4IC7 B;  4KSL C;  2LGY A;  2HE7 A;  3UQB A;  4MM3 A;  2ZNV C;  3ZIM A;  2M8S A;  2KK8 A;  4AUQ C;  3ZKJ C;  2K6D B;  2C60 A;  1KOT A;  1E8W A;  3RUL A;  3HIZ A;  3ZLZ A;  3L13 A;  4G3X B;  2C7M B;  2RR9 A;  1OEY A;  3N3K B;  1WYW B;  3UIP B;  4EEW A;  4OVV A;  4WQO B;  2K6Q A;  2W9N A;  3L16 A;  2C7N B;  4ZRK A;  5DPW A;  2J0K A;  2RGF A;  2PJH A;  3M63 B;  1V5O A;  2EKE C;  3S2A A;  2J0J A;  2CS4 A;  1LQB A;  2BKR B;  1P1A A;  3RD2 A;  3UF8 A;  1K8R B;  3R7Q A;  2JWZ A;  2CHX A;  3M3J A;  4MH0 E;  2LRW A;  1BT0 A;  3UQA A;  2C9W B;  2FCS A;  4LJP B;  3PRM B;  2KWC A;  2L00 B;  2JT4 B;  5JZE B;  2KAN A;  4GN1 A;  3KUZ A;  2RPQ A;  1WFY A;  3ALB A;  4WAA A;  5BO4 B;  1GJZ A;  2Z0D B;  3ZNZ B;  2MCN B;  3PVL A;  3RZF A;  2DAJ A;  1UD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...