2REXA

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/lipoprotein
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rexA00
3UIPB 2BYFA 3SD5A 4DXAB 4CYEA 2O6VD 3PLVA 3ENEA 2K8BA 4GOCA 2KTFA 3UGBB 1KLVA 4XX5A 3L13A 2ZCBA 1TGZB 1Q0WB 1NI2A 3T9LA 2EMTA 2D07B 4AJYB 1JRUA 4EEWA 2V4LA 4HCNB 1SE9A 1WRDB 1V5OA 1YJ1A 3PRPB 4K7UA 4DBGA 3A1QB 5D2MB 4A3PA 1E8YA 3VH4B 5JH5C 1V6EA 3B0AA 1P98A 2D11A 2ZZPB 4MDKE 4CHKA 4PYUA 1RRBA 2IO2B 2W9NA 2DZMA 2D3GA 1UBQA 2IYDB 4TKNA 1M94A 3U8ZA 4GMVA 1F9JA 3DDCB 2OJRA 2CU1A 3JSVA 5JZEB 5DPWA 2K25A 4I6PA 2KDIA 3A4RA 2LD9A 2R2OA 3B08A 1WIAA 2KO3A 3ZNID 3WAPA 4ANVA 5LLIA 2DAFA 2KTRA 3MJWA 2IY1B 2I1JA 4G3XB 4IM2A 3IG3A 4MGYE 5D7GA 4BOZB 1LM8B 1D3ZA 1R4MI 1KM7A 2L0FA 4HPLB 4FADA 1GC6A 4NAWA 4HPMB 4WJOA 2VRRB 5C23A 4JLCA 4W9EA 4W9GA 3A9KA 2KN5A 4BOSC 2MBOA 3ML9A 4ZRIA 3S2AA 5LXIB 3TIXA 2MRPA 1WH3A 4F8CB 2WDTB 4HDOA 3QCAA 2FIFA 4LDTB 2KMAA 3VTVA 2B3AA 4NJ7A 1WF9A 3ZNZB 4G0NB 3BINA 2K6QA 4KVGB 4XZ4A 4FHJA 2R2QA 4KZ0A 4X57B 4EOYA 1WR6E 2ZNVB 3TMPB 3PLUA 1P1AA 2GMIC 2KC1A 2KD0A 2L8JA 2Z59B 4MEMA 2YLMA 2GBKA 1HE8A 3DPDA 3QHTA 4NQKE 4XC2A 1V9JA 1QZEA 2KFKB 4TQ1A 4YL8A 5EDSA 3VAWA 3ZIMA 4WJPA 2K8CA 2KWVB 2NPTB 4K1RB 4FJVB 1WFYA 1XD3B 1LXDA 2N1WA 3L10B 2FCQA 2KNBA 2L00B 3RULA 2J7QB 4WWOA 2KVRA 4RM9A 3L0WB 5CX3A 3VDZA 1OTRB 3ZNHB 4LJOB 3KH0A 3A9JA 5FR6A 5LXHA 4ICUA 3V62A 4MJSB 3PT2B 1WE6A 4MGIE 4WWNA 3HHMA 5J2RA 2O6VA 3JYUA 3P2BA 1S1QB 1WXSA 2WYQA 2RSUA 5CHWA 2N9PC 4IM3A 4M8NA 2C9WB 2HTHA 3RZFA 3ZTDA 3DBLI 3VUYA 2DAJA 1YD8U 4BBNF 4TUUA 3UQAA 3QARA 2HJ8A 3RYTA 3VTWA 2JZ3B 1V2YA 2N9EB 2KDFB 3M62B 2I1KA 1RFAA 3C0RB 2BWFA 1WYWB 4I6NB 2KHWB 3OJ4B 4HK2A 2KMCA 2KFJA 2CS4A 1XQQA 2KWUB 1NDDA 2GOWA 4WQOB 2IZVB 4W9KA 3PVLA 3L54A 5CHFA 2JT4B 4DK5A 4W9CA 4JGHB 2BPSA 1BT0A 1YIWA 3PSEB 4HLEA 3PHWB 4B9KA 1SGHA 4DHJB 3O65B 1WGHA 2BKRB 4MGZE 2XBBC 1WM2A 1RAXA 3H6NA 3M3JA 4IWQA 3A33B 4AP4C 1J19A 3ALBA 4GGQA 2L0TA 4BKSD 4GDLB 4GU2A 1H8CA 4DHJD 2LGDA 2BYVE 1Z5SB 3T8MA 2FCNA 1WXVA 3APFA 2ZEQA 3CSFA 2JPHA 2LVQA 2KJHB 4G50A 4AJWA 1C3TA 1WJNA 4EZLA 4URKA 1L7YA 2KLGA 2NBVB 4NQLB 5E6NA 2BGFA 3ZRFA 1IPGA 4TQ0A 2LRUA 2M8SA 3CF6E 2FCSA 3DQVA 3RZWC 2JRHA 4N9F4 4E71A 2DYMA 2AYOB 2FIDA 2DZKA 1EUVB 3BY4B 4GXBA 4W9JA 3TBLD 2UYZB 3NHEB 2IBIB 3U30A 5DCNA 2KLCA 2NBWB 5L95C 2L76A 5IA7A 2M1MA 3R66C 2KJRA 4M0WB 1ISNA 1WXAA 1PQSA 5BO4B 3ZRCA 5JHAA 2KZRA 1WGRA 4KSLC 4LCDE 5C1ZA 2ZPNA 1YX5B 1WGYA 2KC2A 3QQ8B 4NPNA 3CSTA 1Q5WB 4PS7A 1OEYJ 1WR1A 1Y8RC 3IHPC 1E8ZA 2JY6A 2Z0DB 3H9DA 3R3MA 4FHKA 4CO7A 1UD7A 4W9DA 3QA8A 2CHZA 2M4NA 3H7PA 3VVWB 2O2VB 4W9IA 2KFKA 4MM3A 3SDLC 2D2QA 4KSKC 3I3TB 2KDEB 2KQSA 2NPTA 4K7WA 2CHXA 3PRZA 4TV3A 2KOXA 3AU4A 1WMHB 1T0YA 5E6PA 1E7VA 2RPQA 2MW5A 1FXTB 2AEHA 3L17A 2CKHB 1V81A 1WGGA 1WJUA 2G4SA 3GOEA 1GG3A 4MSMB 3PZDA 4DDID 1X1MA 3NZUA 1GUAB 4HWIB 3RT3B 4IWPA 2ZJDA 3K9OB 3WAMA 3PHXB 4RM8A 2V1YA 4F7ZA 4MJSA 2KANA 4KZCA 2PE6B 3H7SA 3NY5A 2JWZA 4PYZA 3KUCB 5AZGA 4W9LA 4ASWC 2M17A 4BKGA 1EF1A 2LRWA 3U7DA 3TL5A 1V49A 2MBEA 1S3SG 2KDBA 4FJYA 3X0WA 4MGKE 2CR5A 1R4NI 2LWPA 2IO3B 3D32A 1UBIA 3VHTC 2LASA 4E74A 4PS3A 2MQJA 2M0XA 2DYOA 1KJTA 4K81A 4AUQC 2EKEC 4HVBA 4NY0A 5D6JB 3VTUA 4BBNC 2AL6A 2MSED 2FCMA 1SIFA 3QK0A 2JF5A 2NS5A 3WA0A 4ZRJA 3UF8A 2LXCA 3KVFB 2XK5B 2MCNB 1P9DU 1K8RB 4I6LB 4BKSA 2C7NB 1V5TA 3V61A 2ZVOA 5AZHA 3ZKJC 2JZZA 2ZCCA 3EFUA 3PREA 2FUHB 4W9HA 3ML8A 2DZJA 2KKCA 2HD5B 4KV2A 2XEWA 3PS6A 1VCBA 4HXDA 3OAWA 3NS8A 1GC7A 2K39A 4GDLA 1AARA 2C7HA 4DHZB 3QAQA 3KYDD 1E5WA 2KX3A 3JW0X 2Z0EB 5CTRC 3NOBA 5DPRA 3VQIA 3WIMA 3PGEA 3APDA 3N32A 3Q3JA 4IC7B 2LJ5A 4FLHA 3AXCA 2KK8A 4WAAA 1LFDA 4MH0E 4BVUC 1OGWA 2LVPA 3R7RA 2DENB 4ANUA 1UGMA 2BF8B 2PEAA 2JVCA 3A1QA 4EFOA 3W1SA 4BKTA 3PRMB 3LJ3A 3QIJA 3PV1A 4BFRA 3V60A 3RD2A 2KWCA 4LJPB 1A5RA 1MG8A 1E8XA 4KIKB 1H4RA 3QJZA 4GIVA 4EKUA 1IP9A 1Q1OA 2L7RA 3ZDMC 2RGFA 2IO1B 3APCA 4DWFA 2BYEA 2GBJA 1ZGUB 1V86A 2PPHA 2HE7A 3K9PB 4ANXA 3EC8A 4E3CA 2ZVNA 1WZ0A 5AZFA 4GB9A 4JIOU 3ZVVA 1I35A 2LUEA 2IO0B 2JUOA 3WANA 3KUZA 4A3OA 1WE7A 2O2VA 3SHQA 1TTNA 1P0RA 1LQBA 2MBQA 2AWTA 3DOWA 3MTNB 1GNUA 2A5UA 1WMHA 5AEKB 2KX0A 2LXAA 5J17A 4II2B 2UWQA 1OQYA 2NCNA 1U4AA 3V6CB 3ZO5B 5JHBA 3SU8X 2MP2B 2C7MB 2GBRA 4GDKB 4EZJA 3ZUNA 1WY8A 3OJ3A 3VXWA 3L16A 3KYCD 5CHVC 2DYBA 1E90A 2PJHA 3ONSA 4HDQA 2G3QB 4OVVA 5J18A 5L83A 1XT9B 4WJNA 3TJPA 1WX8A 1Z2MA 2PE9A 3NZSA 4B95A 1UZXB 2D10A 5KHQA 4ZYNA 2N7EA 3LDZE 2GBNA 1NBFC 3UQBA 3PPAA 1G6JA 2ASQA 3N30A 1OEYA 4FN2A 2KQ7A 2KXJA 2RR9A 3VH3B 4KDIC 3UINB 1WJ6A 3QX1A 1TBEA 4DHZE 1P3QU 1UH6A 2C60A 4WWPA 2OOBB 2DX5B 3M63B 2J0MA 2L05A 3L08A 2MBHA 5IAAC 4AOFA 4EZKA 2EMSA 2MX2A 2ZNVC 3X23A 2LGYA 1J0GA 3MHSD 4P7IA 1YX6B 2L3ZA 2XK5A 2V3SA 2FNJB 1WGDA 4F1SA 4A20A 3ZW3A 4IWOA 2K8HA 3JSVB 1WM3A 4JQWC 3PTFC 3QWZB 3EHVA 1L2NA 5DPTA 4IUMB 4ICVA 3VUWA 2AL3A 2LI5A 2MLBA 3JVZX 4NJ6A 5G2NA 2WWZA 3AULA 3TCAA 4ANWA 1VD2A 2JRIB 5D94A 2N9XA 3AI5A 4G11A 2KTRB 3IFWB 5HKHA 4LDTD 3WAOA 4HJKA 5G55A 1ZW7A 2MBBB 5TR5A 2NR2A 1EF5A 3HM3A 3VUXA 2MWSB 2N1VA 3RUIB 3HM6X 4NAWB 3IBEA 1E7UA 2KJ6A 3H7PB 1WI0A 4HCPB 3R7QA 1GJZA 1EO6A 2MA9B 4RMAA 3IVFA 3A9KB 4FULA 5DPSA 3ZDTA 1IYFA 3ECIA 2J0JA 3ZNGC 2BWES 2N7DA 3DBSA 3DVNV 3EECA 2REXA 2LGXA 2LVOA 3DVGY 4OVUA 3M95A 4GN1A 3DBHI 3V6EB 2FAZA 3HK0A 2BKFA 3KUDB 4KIKA 1I42A 2G45B 3Q3FA 1KOTA 4II3B 3CMMB 3N3KB 4IM0A 1ZKHA 3DVNU 3KW5B 2N4FA 1YQBA 2GBMA 2DZIA 3AU5A 5E6OA 4IG7B 2WX1A 1WZ3A 2RD0A 1RLFA 2K6DB 3A4SC 1WX7A 2QHOA 4PS8A 1WXMA 4AWJA 2J0KA 4GSWA 3QC8B 2ZPYA 1J8CA 1CMXB 4DDGD 2YVCA 3GZNI 4IW0A 3WALA 2NBUA 4ZRKA 4W9FA 1WX9A 3W1YA 3RCZA 3DBRI 3H1UA 4B6WA 2NVUI 3HIZA 4JL9A 4MELA 4K7SA 2LZ6A 2K1FA 4NNJB 1WJ4A 3VFKA 3DVGX 4EUTA 2A4ZA 3ZLZA 2MP2A 4MSQB 4ZDVA 1C1YB 2CHWA 3A9JB 4GDKA 5GMVA 2DHZA 3OLMD 3B1LX 4FA6A 1V80A 2O6VB 2G4DB 2IY0B 1UELA 2C5LC 2WX0A 4FJZA 3DCGA 4M8MA 3UIOB 3ZTCA 2JXXA 2Y5BB 1E8WA 4KDLB 4FBJB 4WJQA 1TZ1A 3W1SC 4J6IA 5KHOA
chains in the Genus database with same CATH superfamily
3SD5A 5HG2A 4CYEA 1BMLC 3PLVA 2PIAA 3L13A 2EMTA 1AN8A 1JRUA 2WHIA 3BYYB 3A1QB 2D3CA 5JH5C 1F1HA 5FR3A 4PYUA 1RRBA 2W9NA 2DZMA 3DBHB 3GP7A 4PK1A 3U8ZA 3DDCB 3JSVA 5DPWA 2K25A 2N0SB 2R2OA 3B08A 1WIAA 4NAMA 5LLIA 2KTRA 1TKYA 2IY1B 4P6VF 2BS4B 1FEHA 1R4MI 1KM7A 4HPLB 4NAWA 5C23A 2KN5A 1YJIA 1WH3A 1HXYD 1SEBD 2KMAA 2V0GA 2B3AA 2K6QA 4KVGB 4EOYA 1P1AA 2GMIC 2L8JA 1UGJA 3EFCA 2L83A 5BMGA 2YLMA 3QHTA 3DPDA 3Q8CA 4IDIA 4XC2A 4TQ1A 4YL8A 3RFZB 4YTNB 2KN4A 2K8CA 2NPTB 4K1RB 1WFYA 1VJKA 3ZGZA 1LXDA 2N1WA 1UUPA 2J7QB 4WWOA 2IPKD 2KVRA 4RM9A 4ZHPA 3PO0A 3C8YA 3A9JA 5FR6A 4MJSB 4MGIE 2GB1A 3JYUA 1WXSA 5CHWA 2N9PC 4IM3A 1L4DB 1JQ4A 3VUYA 2DAJA 4A9AA 4OZCA 4TUUA 2ICIA 3RYTA 3VTWA 3M62B 1FRRA 1WYWB 1OFFA 1I4QA 2GOWA 1JWAD 1F2RI 4W9CA 2BPSA 3NVWA 1I7HA 4B9KA 3DHHC 3O65B 1WGHA 2BKRB 4TSSA 1V97A 1V1PA 3AE6B 3M3JA 1QOGA 4ZHOA 4IWQA 4C7YA 4GGQA 2BYVE 3DWGC 4B0MA 4CQNA 2JPHA 1C3TA 1WJNA 3ZYYX 4URKA 1L7YA 3IXSA 2BGFA 3VRBB 1ZXIA 2DYMA 2DZKA 4S17A 1DOYA 2WXFA 3ETRA 2UYZB 3NHEB 3MC8A 4ZRPA 5AUIA 2KLCA 2M1MA 3R66C 2KJRA 5BO4B 2HTME 3ZRCA 5C1ZA 1YNTE 2PKOA 2ZPNA 1YX5B 3R2IA 2KC2A 3Q3OC 3I5JC 4NPNA 3CSTA 1Q5WB 4PS7A 3Q6BA 2INNE 1JMLA 1VDVA 3Q3NC 1D5ZC 5C3JB 3QA8A 2I38A 3VVWB 4W9IA 2KFKA 1TS2A 4K7WA 3N1XC 3PRZA 3AU4A 1FXTB 1VZ7A 3L17A 2LMCA 1WYGA 1V81A 3Q8EA 4DQOC 3NZUA 3RT3B 4OZBA 3WAMA 1GPXA 2V1YA 1ACCA 3GB1A 2E6XA 1T0QC 1QQRA 5AZGA 4C4VB 4W9LA 2D5GA 2LRWA 4N58A 1PGAA 1V49A 3TL5A 3X0WA 4YSYB 2MQJA 2DYOA 4WQMA 4NY0A 4BBNC 2MSED 2JF5A 1QILA 3KVFB 2XK5B 2WLBA 1P9DU 1K8RB 4BKSA 3V61A 5BYSA 2JZZA 1XLNA 3PREA 2HD5B 2PVOD 2HJ1A 3PS6A 4HXDA 2GI9A 1TZOA 4ITKA 1LGRA 4DHZB 3QAQA 4HKQA 2KX3A 3WIMA 4YTPB 1N62A 1ZDXA 2LEKA 1MHHE 4MH0E 1OGWA 4KX6B 2DENB 2JVCA 3A1QA 4EFOA 1JRPA 3U4EG 4BKTA 3O13A 3QIJA 4KIKB 4YSXB 4M0WA 3RNAC 2WNMA 2LFIA 1KH0A 2RDBC 1Q1OA 2IGGA 2RMMA 2GBJA 2KYWA 2HE7A 3EC8A 2WDQB 2IO0B 4RNAA 2AQ2B 1YQ4B 3KUZA 4A3OA 1WE7A 4K3CA 2O2VA 1P0RA 4ACFA 2H88B 1SE2A 3DOWA 1NI3A 2LXAA 5J17A 1U4AA 3ZO5B 3R8BA 3AEAB 4S0RA 2WQYB 3OJ3A 4JWUC 5FKAC 1C9FA 1C4PA 2INCC 5L83A 4WJNA 1WX8A 5GXGB 3N1ZC 1XXGA 2MEKA 2D10A 2WU2B 3AE8B 1L6VA 2AQ1B 1WJ6A 2J0MA 3L08A 2MBHA 1F2RC 4AOFA 4IOIE 1YX6B 2V3SA 3ZW3A 3JSVB 4L23A 2PTLA 3PTFC 3QWZB 3EHVA 1N63A 3VUWA 2AL3A 4LNOA 4NJ6A 3TCAA 1VD2A 4DXFA 2N9XA 5EE9A 3AI5A 2KTRB 4WWMA 1JWMD 3AV8A 5TR5A 2LUMA 1EF5A 1XLQA 1VRAB 4NAWB 3IBEA 3AEGB 4RMAA 4FULA 3ZDTA 2OJWA 3ECIA 2KWDA 2BWES 2LGXA 3DVGY 3C19A 4JPSA 4OVUA 3AE2B 1MJDA 1HQRD 3M95A 3DBHI 3V6EB 3KUDB 3NRZA 1ZDVA 3Q3FA 1KLUD 1KOTA 4RFBA 3CMMB 4YSZB 1XCQL 2DZIA 2RD0A 1RLFA 4LNFA 1WX7A 2QHOA 2GRIA 4PS8A 3WCQA 5I4DA 3QC8B 2YVCA 4ZRKA 4W9FA 3H1UA 4KGSA 2FUG1 1MVKA 2IGHA 2WXIA 2LZ6A 1WJ4A 2WS3B 3ZLZA 1GAQB 1C1YB 3A9JB 3OLMD 2G4DB 4FJZA 4M8MA 3UIOB 1E8WA 4FBJB 3W1SC 3MP9A 1SE4A 2YEPB 2K8BA 2KTFA 4ZOHC 3V05A 1TIFA 1TGZB 1RYJA 1NI2A 3BK2A 4AJYB 4HCNB 1YJ1A 1V5OA 5D2MB 1RWSA 3VH4B 1V6EA 1V1PB 4MDKE 4CHKA 2IO2B 1CK1A 2IGDA 4TKNA 3TEYA 4C4VA 3A4RA 3AE7B 4ANVA 1XO3A 3MJWA 1YN4A 4A6QA 1EWCA 4BOZB 1D3ZA 4FADA 4WJOA 2N9LA 1QOFA 1F52A 5LXIB 4DXGA 3QCAA 2FIFA 3DBRB 3NVVA 4NJ7A 1WF9A 3ZNZB 3Q8FA 1SBBB 3TEXA 4FHJA 4JE3B 1PYWD 2ZNVB 1KF6B 2KD0A 2JXTA 4XWWA 3V3XA 2KFKB 2M56B 2BB6A 3ZIMA 2BW2A 4XGAB 4FJVB 4QAYA 4A90A 5FK9C 1XD3B 2KQ4X 2RPVA 3L10B 1N5XA 1ZPSA 1JWBD 3ZNHB 3IAS1 4ICUA 3V62A 4A8XC 1WE6A 3N9YC 5J2RA 2O6VA 5H92C 2WYQA 3T3NA 2RSUA 3RZFA 3ZTDA 3P42A 1YD8U 1D4BA 1FCLA 1V2YA 2N9EB 3C0RB 2KHWB 3OJ4B 2KWUB 1NDDA 2INDC 2IZVB 3PVLA 1K53A 3MHZA 3PSEB 3IAM1 3PHWB 4B0EA 1SB3C 3KWLA 1RAXA 4C7ZA 3A33B 3W5VB 2PLPA 1J19A 2L0TA 4BKSD 4GU2A 4O1NA 2LGDA 2WXQA 1Z5SB 3GS2A 2FCNA 1PUTA 4LTUA 4NQLB 4N59A 4TQ0A 2LRUA 2M8SA 3CF6E 2FCSA 2BQQA 2JRHA 4N9F4 2ZW0A 3BY4B 1DYQA 2UU7A 2WDVB 3RNCC 1UF0A 1HZ5A 2K9XA 2NBWB 5L95C 5IA7A 4M0WB 1ISNA 2KZRA 1WGRA 4KSLC 4LCDE 2CU3A 4HPPA 1E9MA 3NUHB 4L2YA 3Q2AC 2W55A 1L5PA 1E8ZA 2DNFA 3H9DA 2LHDA 4BAXA 4CO7A 4EE2A 1UD7A 2M4NA 3RNFC 4KGRA 2NMQA 2O2VB 4WURA 5IO9A 4AQ7A 1EU4A 3SDLC 4KSKC 1PDXA 4RF1A 4TV3A 2KOXA 3EA6A 3P4RB 2MW5A 4ARIA 4XE0A 1N60A 3MC9A 1HTOA 2LHEA 1X1MA 4DDID 1AYFA 3K9OB 1P7EA 3PHXB 4RM8A 3ZQ4A 4F7ZA 2WP9B 4KZCA 2PE6B 3NY5A 4PYZA 3U7ZA 2LGSA 3PZ7A 1XLPA 1R4NI 1LO5D 3D32A 3VHTC 3W5UB 4PS3A 5D6JB 3VTUA 2FCMA 1SIFA 2NS5A 2MCNB 2C7NB 1V5TA 2HDEA 1GB4A 3NVYA 4W9HA 2DZJA 2KKCA 5BMIA 4KV2A 2XEWA 1XLOA 1GC7A 2K39A 4GDLA 2JWUA 2C7HA 3KYDD 5CTRC 3PGEA 3AXCA 1LFDA 4BVUC 2LVPA 3R7RA 2BF8B 1MG4A 3W1SA 1TS5A 1I4HA 3B2FA 4L1BA 3AMZA 1MI0A 3LJ3A 5JXVA 4JX1C 2X38A 2KWCA 1A5RA 1E8XA 4GIVA 2L1AA 4EKUA 2L7RA 2Z8LA 3B2GA 3OG5A 1QOBA 1OQQA 2RGFA 3U52E 2BYEA 5IKCM 3URYA 1FXIA 5AZFA 1I35A 3BVMA 2LUEA 3BVGA 2ONQA 4M00A 3SHQA 1TTNA 3RNEC 4NZLB 3PZ8A 4H2AA 2AWTA 1PGBA 2J52A 3EGRA 1GNUA 3NG0A 5AEKB 2KX0A 4II2B 1D6EC 4WH4A 1FPYA 2C7MB 1FFUA 1OQRA 4EZJA 3L16A 2DYBA 1E90A 4TMAB 4HDQA 4OVVA 5J18A 2PE9A 2N7EA 1G6JA 2KQ7A 2J4XA 2GLSA 3UINB 3QX1A 1L4ZB 1TBEA 1P3QU 2C60A 1K51A 3M63B 2L05A 2J42A 5IAAC 4EZKA 1UNSA 2EMSA 1FRDA 2MX2A 3X23A 1J0GA 2LGYA 3BVZA 2FE8A 1WGDA 2JSVX 4A20A 3IT6B 4IUMB 1L0VB 3JVZX 5G2NA 3AULA 4G11A 3IFWB 5HKHA 4LDTD 5BYQA 4FXCA 1ZW7A 2NR2A 2MWSB 4XWTA 1E7UA 3H7PB 4HCPB 1GJZA 2VH1A 3U2SC 3LYYA 4MM3B 2JX5A 4WAFA 1ZP0B 3H8HA 3KWVA 2FAZA 3Q3MC 1FNVA 1XCTL 2QSDA 3DVNU 3FILA 1YQBA 4IG7B 1YJJA 2K6DB 3A4SC 1WXMA 4AWJA 2QJLA 2ZPYA 1CMXB 1JCKB 2ON8A 3MC0B 4IW0A 3WALA 2X8XX 2PMVA 3DBRI 2NVUI 2L52A 1R4MB 3HIZA 4MELA 1TS4A 4NNJB 3T3OA 2EKIA 2A4ZA 1QOAA 4MSQB 4GDKA 2DHZA 4LLGM 3B1LX 1V80A 4LNKA 2O6VB 1UELA 2W82A 2BBCA 5KHOA 3UIPB 2BYFA 2O6VD 3FC4A 3ENEA 4GOCA 1JW9D 3UGBB 5EE1A 2ZCBA 3T9LA 5IP4D 1C76A 2DLBA 2V4LA 1L6UA 3GE3C 1C4CA 3PRPB 4KKIA 2Y5PA 1E8YA 3DHGC 2ZZPB 1UBQA 4GMVA 2WXKA 5JZEB 4I6PA 2KDIA 2LD9A 4RF0A 3ZNID 3WAPA 4C56C 1FM0D 2DAFA 2I1JA 4G3XB 3IG3A 1L0XB 2VRRB 4JLCA 4UDUC 2MBOA 3S2AA 4ZRIA 2QC8A 2MRPA 2WXPA 2WDTB 4HDOA 3VTVA 4K3BA 2BT6A 4XZ4A 2L32A 1YMHE 3ZJUA 2AQ3B 2KC1A 1JALA 2N9KA 2Z59B 1HE8A 4NQKE 2LGIA 1V9JA 1TT5B 3VAWA 2W54A 2OHFA 1D5MC 1B1ZA 1L0YB 2JYTA 2WXJA 2VH2A 1MFWA 2FCQA 2NTTA 1QLBB 3RULA 5D3DA 5CX3A 3KH0A 3AE9B 3HHMA 1S1QB 2SAKA 1RFKA 4M8NA 2C9WB 1VR9A 2HTHA 1D5XC 1IGCA 4RGOS 3UQAA 5D3IB 1T0SC 2BWFA 5IOIA 3AECB 4HRSA 4HK2A 2VZKB 2KFJA 2CS4A 1XQQA 4WQOB 2QIEB 4W9KA 3L54A 4DK5A 3CIRB 4JGHB 1YIWA 1T5XD 4BZAA 2QEJC 2VZKD 1WM2A 3LB8C 3H6NA 2Y5CA 5HHDG 1TY2A 4OZAA 1DOXA 4GDLB 1H8CA 3T8MA 1WXVA 4KGTA 4P16A 3CSFA 4G50A 4EZLA 2KLGA 3AB5A 2KVZA 1DGJA 3ZRFA 3AE4B 4XDCA 5BYRA 1ENFA 2FIDA 1EUVB 1JWUD 4W9JA 3TBLD 3P63A 1JWSD 4REZA 1I4GA 2YEPF 4MACA 1WXAA 1PQSA 5JHAA 2K0PA 2R61A 1F0ZA 3R3MA 3P4QB 1TYGB 4P1CC 4W9DA 3DBLB 3H7PA 1FFVA 5LNK1 4MM3A 2D2QA 1C79A 3ZXRA 3I3TB 2KDEB 2KQSA 2CHXA 1I4XA 3HVDA 5E6PA 1E7VA 2RPQA 3Q14C 1WGGA 1WJUA 2K22A 2G4SA 1GG3A 4MSMB 5G5HA 4HWIB 4WIPA 2ZJDA 1J7CA 2J53A 2KANA 3TUOA 1P7FA 2JWZA 2WXHA 1NYQA 4Q2JA 1GB1A 4RGTA 4BKGA 1EF1A 1WRIA 2MBEA 1K50A 4MGKE 1V1OA 2CR5A 2PVGC 2IO3B 1UBIA 2ZW1A 4ZRQA 3RMKC 4AUQC 1T0RC 2EKEC 1BUIC 2EELA 4RH6A 2AL6A 2KACA 1YOVB 3E56A 3QK0A 4JWSC 3WA0A 1V8CA 3SEBA 2KMMA 1C77A 2ZVOA 3ZKJC 1FD6A 3ML8A 3MJ5A 5BMHA 2H89B 3NS8A 3OAWA 4ARCA 1XF5L 1IUEA 1MPEA 1E5WA 2Z0EB 3NOBA 4C00A 3AEFB 3N32A 2LJ5A 2DWQA 4XYCA 1EWYC 4WAAA 1UGMA 2PEAA 1VZ6A 5H8YE 5AUKA 3PRMB 4BFRA 3RD2A 2KDMA 3NZ3A 1IP9A 3HUIA 4DWFA 1ZGUB 1V86A 2PPHA 3FILB 3K9PB 4ANXA 4E3CA 1KRHA 2ZVNA 3ZVVA 3RPFC 2JUOA 4HJGE 3BWUD 4GLSC 1LQBA 3AEEB 1WMHA 2UWQA 2NCNA 3V6CB 1CQVA 2GBRA 4GDKB 2TSSA 5CHVC 1WSPA 2V3PA 3ONSA 2G3QB 3TJPA 1Z2MA 4LK0M 3NZSA 1UZXB 2GBNA 3DHIC 2ASQA 1HA5A 1OEYA 4FN2A 2MJDA 2RR9A 3NS1A 3VH3B 4KDIC 3MFGA 1TS3A 4IKGA 4DHZE 1UH6A 3ABVB 4WWPA 2DX5B 3BK1A 1ZXHA 3MHSD 2FNJB 2M0AA 4F1SA 4IWOA 1WM3A 3NJTA 5DPTA 4ICVA 2LI5A 4ANWA 2WWZA 5D94A 1T3QA 1QF6A 2BYTA 5G55A 2MBBB 3HM3A 3VUXA 2V9HA 5MPOA 3RUIB 3HM6X 2QMTA 1WI0A 1EO6A 5DPSA 1E7PB 1IYFA 2WXGA 2J0JA 3ZNGC 3DVNV 4P1BC 1ZE3D 1SSNA 3NVZA 3HK0A 4II3B 3P1MA 1TKGA 1SF0A 3BZDB 1K52A 1ESFA 1ROEA 3P4SB 5E6OA 2WX1A 3L4PA 3VRAB 4A55A 2J0KA 1WWTA 3RN9C 1FMAD 3W1YA 1WX9A 3RCZA 4B6WA 1ZOYB 2K1FA 3RNBC 4YT0B 3DVGX 4EUTA 2NTSA 2MP2A 4ZDVA 3RNGC 2CHWA 5E6JA 5GMVA 2JQRB 4FA6A 2KT7A 2IY0B 2K5PA 3VR9B 1NVID 2W3RA 2Y5BB 1SE3A 1TZ1A 2QCZA 3P4PB 4DXAB 1Y56A 1E10A 3TEZA 4YWGG 3AE1B 4XX5A 1KLVA 1SJHD 4YTMB 1Q0WB 3I9V1 1R7SA 2D07B 4EEWA 2WXMA 1SE9A 1WRDB 4K7UA 4DBGA 4A3PA 3SR6A 3B0AA 1P98A 2D11A 2ACZB 3BYTB 2D3GA 4PT5A 2IYDB 1M94A 3LXFA 3OWEB 1F9JA 2OJRA 2CU1A 3IT4B 2KO3A 1YQ3B 2JZPA 1SXTA 4XDDA 3Q8AA 2BTEA 4IM2A 4MGYE 5D7GA 1LM8B 2L0FA 2IJ0A 1GC6A 4HPMB 4MT5A 4W9EA 4W9GA 4HROA 3A9KA 4BOSC 3ML9A 2I2YA 3GZNB 3KLSX 3TIXA 2E3TA 1CZPA 4LDTB 1NYRA 1JROA 4G0NB 3BINA 3W2DA 2R2QA 4KZ0A 4X57B 1IBXA 1WR6E 3TEWA 5HI1A 3TMPB 3PLUA 4HKZE 4LNNA 1E0ZA 4MEMA 2RDHA 2GBKA 1J7AA 1QZEA 3VR8B 5EDSA 4WJPA 1T6BX 2KWVB 2PW9A 1DOIA 1N5WA 3EUB2 3KQ4A 2KNBA 2L00B 3GE8C 2V3NA 4HEA1 3VDZA 3L0WB 1OTRB 4LJOB 3CWIA 5LXHA 3I63C 1ZUD2 3PT2B 4WWNA 3P2BA 3RI7C 4D2KA 2QDFA 3DBLI 4BBNF 3QARA 2HJ8A 2JYEA 2JZ3B 2KDFB 1TKEA 2I1KA 1RFAA 3AEBB 4I6NB 3AE3B 2KMCA 4RGNA 5CHFA 2JT4B 2D3BA 1BT0A 5T8IA 4HLEA 1XEEA 1SGHA 1CJEA 4DHJB 4MGZE 2XBBC 4AP4C 1VZ8A 3W9CB 3ALBA 2BVCA 1YN5A 4DHJD 4M02A 3SFEB 1UWXA 3APFA 1TY0A 2ZEQA 2BB5A 2LVQA 2KJHB 5TSSA 4AJWA 4ZYSA 3FKYA 1E6EB 2QILA 2NBVB 5E6NA 1IPGA 3DQVA 3RZWC 4E71A 2AYOB 1C4AA 2MH7A 2BS2B 4GXBA 1R4NB 2IBIB 3DWMA 3U30A 5DCNA 2L76A 3ZJVA 1SIJA 1WGYA 3QQ8B 1OEYJ 1WR1A 1Y8RC 3IHPC 2JY6A 2Z0DB 4FHKA 2CHZA 1YN3A 2K3UA 1ET9A 2G1EA 4MH8A 2NPTA 3TSSA 4USAA 1WMHB 1T0YA 4J3OD 2AEHA 4LNIA 2AX5A 2CKHB 2BS3B 3GOEA 3PZDA 2WXOA 1NEKB 1FO4A 1KTKA 1GUAB 4IWPA 4MJSA 2WU5B 3E9SA 3H7SA 2XN9C 3KUCB 3AN1A 3N20C 2WXNA 4ASWC 2M17A 1PGXA 2V4IB 3U7DA 1FCCC 1S3SG 2KDBA 4FJYA 3I57A 2LWPA 1FNUA 2LASA 4E74A 2M0XA 1M4VA 4K81A 1KJTA 1NENB 4HVBA 5EE0A 1WGKA 4US9A 1B9RA 2WXRA 3HRDD 4ZRJA 3UF8A 2LXCA 1N6ZA 3AE5B 1AW7A 4I6LB 5AZHA 2ZCCA 3EFUA 4YXDB 2FUHB 3B9JA 1I4PA 1C78A 1VCBA 1HTQA 3Q69A 1AARA 1QT9A 2JU6X 3JW0X 3VQIA 5DPRA 3APDA 3Q3JA 4IC7B 3N1YC 4FLHA 2KK8A 1ET6A 5IN7A 4ANUA 1FXAA 3PV1A 1F77A 4AS1A 3V60A 4NJCA 4LJPB 1MG8A 1H4RA 3QJZA 3ZDMC 2CJOA 2FBWB 2WGSA 2IO1B 3AM9A 3APCA 2W3SA 1TJEA 1WZ0A 4GB9A 4JIOU 5G5GA 4US8A 3WANA 3ZXVA 1IGDA 1VLBA 1UWMA 2MBQA 1KFYB 3MTNB 2A5UA 1EM7A 1WXQA 1OQYA 2IDYA 3AEDB 1KLGD 5JHBA 3SU8X 2MP2B 2G9HD 4KKJA 2M19A 3AH7A 3ZUNA 1WY8A 3VXWA 3KYCD 3J9CA 2PJHA 1XT9B 1PFDA 4B95A 1BXTA 5KHQA 4ZYNA 3LDZE 1NBFC 3UQBA 4N6EB 3PPAA 3N30A 2KXJA 2CJNA 4RCOA 4R3DA 2XNAC 3HVZA 2SEBD 1STEA 2OOBB 2MHJA 2ZNVC 3R2TA 4P7IA 2L3ZA 1EU3A 2XK5A 1I4RA 3SFDB 2MJEA 2K8HA 5HFYA 4JQWC 1L2NA 2Y3AA 2MLBA 2JRIB 3FAHA 2D3AA 2Q5WD 3WAOA 4HJKA 1FNWA 4RGMA 2N1VA 1AWDA 2KJ6A 3R7QA 2MA9B 3IVFA 1HZ6A 3A9KB 4C80A 2MJ3A 2DBYA 2N7DA 3DBSA 3EECA 2REXA 4M01A 2LVOA 4GN1A 1GOZA 1N61A 2BKFA 4KIKA 1I42A 2G45B 1IBXB 5C2TB 3N3KB 4IM0A 1ZKHA 3KW5B 2KAJA 2N4FA 2GBMA 3AU5A 3BIID 1WZ3A 1SJED 1QKZA 4GSWA 1J8CA 1Q10A 2B76B 4OHJA 4DDGD 3GZNI 2NBUA 2OEDA 2N7JA 4JL9A 4K7SA 4OVZA 3VFKA 1HEZE 1RM6C 3UI3A 1MHXA 1J7BA 1A70A 4OW0A 3ZJTA 1FIQA 3Q8BA 2C5LC 2RDGA 2WDRB 2WX0A 5EE3A 3DCGA 2LJIA 3ZTCA 2JXXA 2INPE 4KDLB 4WJQA 4J6IA 4F8CB 2WXLA
chains in the Genus database with same CATH topology
3UIPB 2BYFA 3SD5A 4DXAB 4CYEA 2O6VD 3PLVA 3ENEA 2K8BA 4GOCA 2KTFA 3UGBB 1KLVA 4XX5A 3L13A 2ZCBA 1TGZB 1Q0WB 1NI2A 3T9LA 2EMTA 2D07B 4AJYB 1JRUA 4EEWA 2V4LA 4HCNB 1SE9A 1WRDB 1V5OA 1YJ1A 3PRPB 4K7UA 4DBGA 3A1QB 5D2MB 4A3PA 1E8YA 3VH4B 5JH5C 1V6EA 3B0AA 1P98A 2D11A 2ZZPB 4MDKE 4CHKA 4PYUA 1RRBA 2IO2B 2W9NA 2DZMA 2D3GA 1UBQA 2IYDB 4TKNA 1M94A 3U8ZA 4GMVA 1F9JA 3DDCB 2OJRA 2CU1A 3JSVA 5JZEB 5DPWA 2K25A 4I6PA 2KDIA 3A4RA 2LD9A 2R2OA 3B08A 1WIAA 2KO3A 3ZNID 3WAPA 4ANVA 5LLIA 2DAFA 2KTRA 3MJWA 2IY1B 2I1JA 4G3XB 4IM2A 3IG3A 4MGYE 5D7GA 4BOZB 1LM8B 1D3ZA 1R4MI 1KM7A 2L0FA 4HPLB 4FADA 1GC6A 4NAWA 4HPMB 4WJOA 2VRRB 5C23A 4JLCA 4W9EA 4W9GA 3A9KA 2KN5A 4BOSC 2MBOA 3ML9A 4ZRIA 3S2AA 5LXIB 3TIXA 2MRPA 1WH3A 4F8CB 2WDTB 4HDOA 3QCAA 2FIFA 4LDTB 2KMAA 3VTVA 2B3AA 4NJ7A 1WF9A 3ZNZB 4G0NB 3BINA 2K6QA 4KVGB 4XZ4A 4FHJA 2R2QA 4KZ0A 4X57B 4EOYA 1WR6E 2ZNVB 3TMPB 3PLUA 1P1AA 2GMIC 2KC1A 2KD0A 2L8JA 2Z59B 4MEMA 2YLMA 2GBKA 1HE8A 3DPDA 3QHTA 4NQKE 4XC2A 1V9JA 1QZEA 2KFKB 4TQ1A 4YL8A 5EDSA 3VAWA 3ZIMA 4WJPA 2K8CA 2KWVB 2NPTB 4K1RB 4FJVB 1WFYA 1XD3B 1LXDA 2N1WA 3L10B 2FCQA 2KNBA 2L00B 3RULA 2J7QB 4WWOA 2KVRA 4RM9A 3L0WB 5CX3A 3VDZA 1OTRB 3ZNHB 4LJOB 3KH0A 3A9JA 5FR6A 5LXHA 4ICUA 3V62A 4MJSB 3PT2B 1WE6A 4MGIE 4WWNA 3HHMA 5J2RA 2O6VA 3JYUA 3P2BA 1S1QB 1WXSA 2WYQA 2RSUA 5CHWA 2N9PC 4IM3A 4M8NA 2C9WB 2HTHA 3RZFA 3ZTDA 3DBLI 3VUYA 2DAJA 1YD8U 4BBNF 4TUUA 3UQAA 3QARA 2HJ8A 3RYTA 3VTWA 2JZ3B 1V2YA 2N9EB 2KDFB 3M62B 2I1KA 1RFAA 3C0RB 2BWFA 1WYWB 4I6NB 2KHWB 3OJ4B 4HK2A 2KMCA 2KFJA 2CS4A 1XQQA 2KWUB 1NDDA 2GOWA 4WQOB 2IZVB 4W9KA 3PVLA 3L54A 5CHFA 2JT4B 4DK5A 4W9CA 4JGHB 2BPSA 1BT0A 1YIWA 3PSEB 4HLEA 3PHWB 4B9KA 1SGHA 4DHJB 3O65B 1WGHA 2BKRB 4MGZE 2XBBC 1WM2A 1RAXA 3H6NA 3M3JA 4IWQA 3A33B 4AP4C 1J19A 3ALBA 4GGQA 2L0TA 4BKSD 4GDLB 4GU2A 1H8CA 4DHJD 2LGDA 2BYVE 1Z5SB 3T8MA 2FCNA 1WXVA 3APFA 2ZEQA 3CSFA 2JPHA 2LVQA 2KJHB 4G50A 4AJWA 1C3TA 1WJNA 4EZLA 4URKA 1L7YA 2KLGA 2NBVB 4NQLB 5E6NA 2BGFA 3ZRFA 1IPGA 4TQ0A 2LRUA 2M8SA 3CF6E 2FCSA 3DQVA 3RZWC 2JRHA 4N9F4 4E71A 2DYMA 2AYOB 2FIDA 2DZKA 1EUVB 3BY4B 4GXBA 4W9JA 3TBLD 2UYZB 3NHEB 2IBIB 3U30A 5DCNA 2KLCA 2NBWB 5L95C 2L76A 5IA7A 2M1MA 3R66C 2KJRA 4M0WB 1ISNA 1WXAA 1PQSA 5BO4B 3ZRCA 5JHAA 2KZRA 1WGRA 4KSLC 4LCDE 5C1ZA 2ZPNA 1YX5B 1WGYA 2KC2A 3QQ8B 4NPNA 3CSTA 1Q5WB 4PS7A 1OEYJ 1WR1A 1Y8RC 3IHPC 1E8ZA 2JY6A 2Z0DB 3H9DA 3R3MA 4FHKA 4CO7A 1UD7A 4W9DA 3QA8A 2CHZA 2M4NA 3H7PA 3VVWB 2O2VB 4W9IA 2KFKA 4MM3A 3SDLC 2D2QA 4KSKC 3I3TB 2KDEB 2KQSA 2NPTA 4K7WA 2CHXA 3PRZA 4TV3A 2KOXA 3AU4A 1WMHB 1T0YA 5E6PA 1E7VA 2RPQA 2MW5A 1FXTB 2AEHA 3L17A 2CKHB 1V81A 1WGGA 1WJUA 2G4SA 3GOEA 1GG3A 4MSMB 3PZDA 4DDID 1X1MA 3NZUA 1GUAB 4HWIB 3RT3B 4IWPA 2ZJDA 3K9OB 3WAMA 3PHXB 4RM8A 2V1YA 4F7ZA 4MJSA 2KANA 4KZCA 2PE6B 3H7SA 3NY5A 2JWZA 4PYZA 3KUCB 5AZGA 4W9LA 4ASWC 2M17A 4BKGA 1EF1A 2LRWA 3U7DA 3TL5A 1V49A 2MBEA 1S3SG 2KDBA 4FJYA 3X0WA 4MGKE 2CR5A 1R4NI 2LWPA 2IO3B 3D32A 1UBIA 3VHTC 2LASA 4E74A 4PS3A 2MQJA 2M0XA 2DYOA 1KJTA 4K81A 4AUQC 2EKEC 4HVBA 4NY0A 5D6JB 3VTUA 4BBNC 2AL6A 2MSED 2FCMA 1SIFA 3QK0A 2JF5A 2NS5A 3WA0A 4ZRJA 3UF8A 2LXCA 3KVFB 2XK5B 2MCNB 1P9DU 1K8RB 4I6LB 4BKSA 2C7NB 1V5TA 3V61A 2ZVOA 5AZHA 3ZKJC 2JZZA 2ZCCA 3EFUA 3PREA 2FUHB 4W9HA 3ML8A 2DZJA 2KKCA 2HD5B 4KV2A 2XEWA 3PS6A 1VCBA 4HXDA 3OAWA 3NS8A 1GC7A 2K39A 4GDLA 1AARA 2C7HA 4DHZB 3QAQA 3KYDD 1E5WA 2KX3A 3JW0X 2Z0EB 5CTRC 3NOBA 5DPRA 3VQIA 3WIMA 3PGEA 3APDA 3N32A 3Q3JA 4IC7B 2LJ5A 4FLHA 3AXCA 2KK8A 4WAAA 1LFDA 4MH0E 4BVUC 1OGWA 2LVPA 3R7RA 2DENB 4ANUA 1UGMA 2BF8B 2PEAA 2JVCA 3A1QA 4EFOA 3W1SA 4BKTA 3PRMB 3LJ3A 3QIJA 3PV1A 4BFRA 3V60A 3RD2A 2KWCA 4LJPB 1A5RA 1MG8A 1E8XA 4KIKB 1H4RA 3QJZA 4GIVA 4EKUA 1IP9A 1Q1OA 2L7RA 3ZDMC 2RGFA 2IO1B 3APCA 4DWFA 2BYEA 2GBJA 1ZGUB 1V86A 2PPHA 2HE7A 3K9PB 4ANXA 3EC8A 4E3CA 2ZVNA 1WZ0A 5AZFA 4GB9A 4JIOU 3ZVVA 1I35A 2LUEA 2IO0B 2JUOA 3WANA 3KUZA 4A3OA 1WE7A 2O2VA 3SHQA 1TTNA 1P0RA 1LQBA 2MBQA 2AWTA 3DOWA 3MTNB 1GNUA 2A5UA 1WMHA 5AEKB 2KX0A 2LXAA 5J17A 4II2B 2UWQA 1OQYA 2NCNA 1U4AA 3V6CB 3ZO5B 5JHBA 3SU8X 2MP2B 2C7MB 2GBRA 4GDKB 4EZJA 3ZUNA 1WY8A 3OJ3A 3VXWA 3L16A 3KYCD 5CHVC 2DYBA 1E90A 2PJHA 3ONSA 4HDQA 2G3QB 4OVVA 5J18A 5L83A 1XT9B 4WJNA 3TJPA 1WX8A 1Z2MA 2PE9A 3NZSA 4B95A 1UZXB 2D10A 5KHQA 4ZYNA 2N7EA 3LDZE 2GBNA 1NBFC 3UQBA 3PPAA 1G6JA 2ASQA 3N30A 1OEYA 4FN2A 2KQ7A 2KXJA 2RR9A 3VH3B 4KDIC 3UINB 1WJ6A 3QX1A 1TBEA 4DHZE 1P3QU 1UH6A 2C60A 4WWPA 2OOBB 2DX5B 3M63B 2J0MA 2L05A 3L08A 2MBHA 5IAAC 4AOFA 4EZKA 2EMSA 2MX2A 2ZNVC 3X23A 2LGYA 1J0GA 3MHSD 4P7IA 1YX6B 2L3ZA 2XK5A 2V3SA 2FNJB 1WGDA 4F1SA 4A20A 3ZW3A 4IWOA 2K8HA 3JSVB 1WM3A 4JQWC 3PTFC 3QWZB 3EHVA 1L2NA 5DPTA 4IUMB 4ICVA 3VUWA 2AL3A 2LI5A 2MLBA 3JVZX 4NJ6A 5G2NA 2WWZA 3AULA 3TCAA 4ANWA 1VD2A 2JRIB 5D94A 2N9XA 3AI5A 4G11A 2KTRB 3IFWB 5HKHA 4LDTD 3WAOA 4HJKA 5G55A 1ZW7A 2MBBB 5TR5A 2NR2A 1EF5A 3HM3A 3VUXA 2MWSB 2N1VA 3RUIB 3HM6X 4NAWB 3IBEA 1E7UA 2KJ6A 3H7PB 1WI0A 4HCPB 3R7QA 1GJZA 1EO6A 2MA9B 4RMAA 3IVFA 3A9KB 4FULA 5DPSA 3ZDTA 1IYFA 3ECIA 2J0JA 3ZNGC 2BWES 2N7DA 3DBSA 3DVNV 3EECA 2REXA 2LGXA 2LVOA 3DVGY 4OVUA 3M95A 4GN1A 3DBHI 3V6EB 2FAZA 3HK0A 2BKFA 3KUDB 4KIKA 1I42A 2G45B 3Q3FA 1KOTA 4II3B 3CMMB 3N3KB 4IM0A 1ZKHA 3DVNU 3KW5B 2N4FA 1YQBA 2GBMA 2DZIA 3AU5A 5E6OA 4IG7B 2WX1A 1WZ3A 2RD0A 1RLFA 2K6DB 3A4SC 1WX7A 2QHOA 4PS8A 1WXMA 4AWJA 2J0KA 4GSWA 3QC8B 2ZPYA 1J8CA 1CMXB 4DDGD 2YVCA 3GZNI 4IW0A 3WALA 2NBUA 4ZRKA 4W9FA 1WX9A 3W1YA 3RCZA 3DBRI 3H1UA 4B6WA 2NVUI 3HIZA 4JL9A 4MELA 4K7SA 2LZ6A 2K1FA 4NNJB 1WJ4A 3VFKA 3DVGX 4EUTA 2A4ZA 3ZLZA 2MP2A 4MSQB 4ZDVA 1C1YB 2CHWA 3A9JB 4GDKA 5GMVA 2DHZA 3OLMD 3B1LX 4FA6A 1V80A 2O6VB 2G4DB 2IY0B 1UELA 2C5LC 2WX0A 4FJZA 3DCGA 4M8MA 3UIOB 3ZTCA 2JXXA 2Y5BB 1E8WA 4KDLB 4FBJB 4WJQA 1TZ1A 3W1SC 4J6IA 5KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP B;  2BYF A;  3SD5 A;  4DXA B;  4CYE A;  2O6V D;  3PLV A;  3ENE A;  2K8B A;  4GOC A;  2KTF A;  3UGB B;  1KLV A;  4XX5 A;  3L13 A;  2ZCB A;  1TGZ B;  1Q0W B;  1NI2 A;  3T9L A;  2EMT A;  2D07 B;  4AJY B;  1JRU A;  4EEW A;  2V4L A;  4HCN B;  1SE9 A;  1WRD B;  1V5O A;  1YJ1 A;  3PRP B;  4K7U A;  4DBG A;  3A1Q B;  5D2M B;  4A3P A;  1E8Y A;  3VH4 B;  5JH5 C;  1V6E A;  3B0A A;  1P98 A;  2D11 A;  2ZZP B;  4MDK E;  4CHK A;  4PYU A;  1RRB A;  2IO2 B;  2W9N A;  2DZM A;  2D3G A;  1UBQ A;  2IYD B;  4TKN A;  1M94 A;  3U8Z A;  4GMV A;  1F9J A;  3DDC B;  2OJR A;  2CU1 A;  3JSV A;  5JZE B;  5DPW A;  2K25 A;  4I6P A;  2KDI A;  3A4R A;  2LD9 A;  2R2O A;  3B08 A;  1WIA A;  2KO3 A;  3ZNI D;  3WAP A;  4ANV A;  5LLI A;  2DAF A;  2KTR A;  3MJW A;  2IY1 B;  2I1J A;  4G3X B;  4IM2 A;  3IG3 A;  4MGY E;  5D7G A;  4BOZ B;  1LM8 B;  1D3Z A;  1R4M I;  1KM7 A;  2L0F A;  4HPL B;  4FAD A;  1GC6 A;  4NAW A;  4HPM B;  4WJO A;  2VRR B;  5C23 A;  4JLC A;  4W9E A;  4W9G A;  3A9K A;  2KN5 A;  4BOS C;  2MBO A;  3ML9 A;  4ZRI A;  3S2A A;  5LXI B;  3TIX A;  2MRP A;  1WH3 A;  4F8C B;  2WDT B;  4HDO A;  3QCA A;  2FIF A;  4LDT B;  2KMA A;  3VTV A;  2B3A A;  4NJ7 A;  1WF9 A;  3ZNZ B;  4G0N B;  3BIN A;  2K6Q A;  4KVG B;  4XZ4 A;  4FHJ A;  2R2Q A;  4KZ0 A;  4X57 B;  4EOY A;  1WR6 E;  2ZNV B;  3TMP B;  3PLU A;  1P1A A;  2GMI C;  2KC1 A;  2KD0 A;  2L8J A;  2Z59 B;  4MEM A;  2YLM A;  2GBK A;  1HE8 A;  3DPD A;  3QHT A;  4NQK E;  4XC2 A;  1V9J A;  1QZE A;  2KFK B;  4TQ1 A;  4YL8 A;  5EDS A;  3VAW A;  3ZIM A;  4WJP A;  2K8C A;  2KWV B;  2NPT B;  4K1R B;  4FJV B;  1WFY A;  1XD3 B;  1LXD A;  2N1W A;  3L10 B;  2FCQ A;  2KNB A;  2L00 B;  3RUL A;  2J7Q B;  4WWO A;  2KVR A;  4RM9 A;  3L0W B;  5CX3 A;  3VDZ A;  1OTR B;  3ZNH B;  4LJO B;  3KH0 A;  3A9J A;  5FR6 A;  5LXH A;  4ICU A;  3V62 A;  4MJS B;  3PT2 B;  1WE6 A;  4MGI E;  4WWN A;  3HHM A;  5J2R A;  2O6V A;  3JYU A;  3P2B A;  1S1Q B;  1WXS A;  2WYQ A;  2RSU A;  5CHW A;  2N9P C;  4IM3 A;  4M8N A;  2C9W B;  2HTH A;  3RZF A;  3ZTD A;  3DBL I;  3VUY A;  2DAJ A;  1YD8 U;  4BBN F;  4TUU A;  3UQA A;  3QAR A;  2HJ8 A;  3RYT A;  3VTW A;  2JZ3 B;  1V2Y A;  2N9E B;  2KDF B;  3M62 B;  2I1K A;  1RFA A;  3C0R B;  2BWF A;  1WYW B;  4I6N B;  2KHW B;  3OJ4 B;  4HK2 A;  2KMC A;  2KFJ A;  2CS4 A;  1XQQ A;  2KWU B;  1NDD A;  2GOW A;  4WQO B;  2IZV B;  4W9K A;  3PVL A;  3L54 A;  5CHF A;  2JT4 B;  4DK5 A;  4W9C A;  4JGH B;  2BPS A;  1BT0 A;  1YIW A;  3PSE B;  4HLE A;  3PHW B;  4B9K A;  1SGH A;  4DHJ B;  3O65 B;  1WGH A;  2BKR B;  4MGZ E;  2XBB C;  1WM2 A;  1RAX A;  3H6N A;  3M3J A;  4IWQ A;  3A33 B;  4AP4 C;  1J19 A;  3ALB A;  4GGQ A;  2L0T A;  4BKS D;  4GDL B;  4GU2 A;  1H8C A;  4DHJ D;  2LGD A;  2BYV E;  1Z5S B;  3T8M A;  2FCN A;  1WXV A;  3APF A;  2ZEQ A;  3CSF A;  2JPH A;  2LVQ A;  2KJH B;  4G50 A;  4AJW A;  1C3T A;  1WJN A;  4EZL A;  4URK A;  1L7Y A;  2KLG A;  2NBV B;  4NQL B;  5E6N A;  2BGF A;  3ZRF A;  1IPG A;  4TQ0 A;  2LRU A;  2M8S A;  3CF6 E;  2FCS A;  3DQV A;  3RZW C;  2JRH A;  4N9F 4;  4E71 A;  2DYM A;  2AYO B;  2FID A;  2DZK A;  1EUV B;  3BY4 B;  4GXB A;  4W9J A;  3TBL D;  2UYZ B;  3NHE B;  2IBI B;  3U30 A;  5DCN A;  2KLC A;  2NBW B;  5L95 C;  2L76 A;  5IA7 A;  2M1M A;  3R66 C;  2KJR A;  4M0W B;  1ISN A;  1WXA A;  1PQS A;  5BO4 B;  3ZRC A;  5JHA A;  2KZR A;  1WGR A;  4KSL C;  4LCD E;  5C1Z A;  2ZPN A;  1YX5 B;  1WGY A;  2KC2 A;  3QQ8 B;  4NPN A;  3CST A;  1Q5W B;  4PS7 A;  1OEY J;  1WR1 A;  1Y8R C;  3IHP C;  1E8Z A;  2JY6 A;  2Z0D B;  3H9D A;  3R3M A;  4FHK A;  4CO7 A;  1UD7 A;  4W9D A;  3QA8 A;  2CHZ A;  2M4N A;  3H7P A;  3VVW B;  2O2V B;  4W9I A;  2KFK A;  4MM3 A;  3SDL C;  2D2Q A;  4KSK C;  3I3T B;  2KDE B;  2KQS A;  2NPT A;  4K7W A;  2CHX A;  3PRZ A;  4TV3 A;  2KOX A;  3AU4 A;  1WMH B;  1T0Y A;  5E6P A;  1E7V A;  2RPQ A;  2MW5 A;  1FXT B;  2AEH A;  3L17 A;  2CKH B;  1V81 A;  1WGG A;  1WJU A;  2G4S A;  3GOE A;  1GG3 A;  4MSM B;  3PZD A;  4DDI D;  1X1M A;  3NZU A;  1GUA B;  4HWI B;  3RT3 B;  4IWP A;  2ZJD A;  3K9O B;  3WAM A;  3PHX B;  4RM8 A;  2V1Y A;  4F7Z A;  4MJS A;  2KAN A;  4KZC A;  2PE6 B;  3H7S A;  3NY5 A;  2JWZ A;  4PYZ A;  3KUC B;  5AZG A;  4W9L A;  4ASW C;  2M17 A;  4BKG A;  1EF1 A;  2LRW A;  3U7D A;  3TL5 A;  1V49 A;  2MBE A;  1S3S G;  2KDB A;  4FJY A;  3X0W A;  4MGK E;  2CR5 A;  1R4N I;  2LWP A;  2IO3 B;  3D32 A;  1UBI A;  3VHT C;  2LAS A;  4E74 A;  4PS3 A;  2MQJ A;  2M0X A;  2DYO A;  1KJT A;  4K81 A;  4AUQ C;  2EKE C;  4HVB A;  4NY0 A;  5D6J B;  3VTU A;  4BBN C;  2AL6 A;  2MSE D;  2FCM A;  1SIF A;  3QK0 A;  2JF5 A;  2NS5 A;  3WA0 A;  4ZRJ A;  3UF8 A;  2LXC A;  3KVF B;  2XK5 B;  2MCN B;  1P9D U;  1K8R B;  4I6L B;  4BKS A;  2C7N B;  1V5T A;  3V61 A;  2ZVO A;  5AZH A;  3ZKJ C;  2JZZ A;  2ZCC A;  3EFU A;  3PRE A;  2FUH B;  4W9H A;  3ML8 A;  2DZJ A;  2KKC A;  2HD5 B;  4KV2 A;  2XEW A;  3PS6 A;  1VCB A;  4HXD A;  3OAW A;  3NS8 A;  1GC7 A;  2K39 A;  4GDL A;  1AAR A;  2C7H A;  4DHZ B;  3QAQ A;  3KYD D;  1E5W A;  2KX3 A;  3JW0 X;  2Z0E B;  5CTR C;  3NOB A;  5DPR A;  3VQI A;  3WIM A;  3PGE A;  3APD A;  3N32 A;  3Q3J A;  4IC7 B;  2LJ5 A;  4FLH A;  3AXC A;  2KK8 A;  4WAA A;  1LFD A;  4MH0 E;  4BVU C;  1OGW A;  2LVP A;  3R7R A;  2DEN B;  4ANU A;  1UGM A;  2BF8 B;  2PEA A;  2JVC A;  3A1Q A;  4EFO A;  3W1S A;  4BKT A;  3PRM B;  3LJ3 A;  3QIJ A;  3PV1 A;  4BFR A;  3V60 A;  3RD2 A;  2KWC A;  4LJP B;  1A5R A;  1MG8 A;  1E8X A;  4KIK B;  1H4R A;  3QJZ A;  4GIV A;  4EKU A;  1IP9 A;  1Q1O A;  2L7R A;  3ZDM C;  2RGF A;  2IO1 B;  3APC A;  4DWF A;  2BYE A;  2GBJ A;  1ZGU B;  1V86 A;  2PPH A;  2HE7 A;  3K9P B;  4ANX A;  3EC8 A;  4E3C A;  2ZVN A;  1WZ0 A;  5AZF A;  4GB9 A;  4JIO U;  3ZVV A;  1I35 A;  2LUE A;  2IO0 B;  2JUO A;  3WAN A;  3KUZ A;  4A3O A;  1WE7 A;  2O2V A;  3SHQ A;  1TTN A;  1P0R A;  1LQB A;  2MBQ A;  2AWT A;  3DOW A;  3MTN B;  1GNU A;  2A5U A;  1WMH A;  5AEK B;  2KX0 A;  2LXA A;  5J17 A;  4II2 B;  2UWQ A;  1OQY A;  2NCN A;  1U4A A;  3V6C B;  3ZO5 B;  5JHB A;  3SU8 X;  2MP2 B;  2C7M B;  2GBR A;  4GDK B;  4EZJ A;  3ZUN A;  1WY8 A;  3OJ3 A;  3VXW A;  3L16 A;  3KYC D;  5CHV C;  2DYB A;  1E90 A;  2PJH A;  3ONS A;  4HDQ A;  2G3Q B;  4OVV A;  5J18 A;  5L83 A;  1XT9 B;  4WJN A;  3TJP A;  1WX8 A;  1Z2M A;  2PE9 A;  3NZS A;  4B95 A;  1UZX B;  2D10 A;  5KHQ A;  4ZYN A;  2N7E A;  3LDZ E;  2GBN A;  1NBF C;  3UQB A;  3PPA A;  1G6J A;  2ASQ A;  3N30 A;  1OEY A;  4FN2 A;  2KQ7 A;  2KXJ A;  2RR9 A;  3VH3 B;  4KDI C;  3UIN B;  1WJ6 A;  3QX1 A;  1TBE A;  4DHZ E;  1P3Q U;  1UH6 A;  2C60 A;  4WWP A;  2OOB B;  2DX5 B;  3M63 B;  2J0M A;  2L05 A;  3L08 A;  2MBH A;  5IAA C;  4AOF A;  4EZK A;  2EMS A;  2MX2 A;  2ZNV C;  3X23 A;  2LGY A;  1J0G A;  3MHS D;  4P7I A;  1YX6 B;  2L3Z A;  2XK5 A;  2V3S A;  2FNJ B;  1WGD A;  4F1S A;  4A20 A;  3ZW3 A;  4IWO A;  2K8H A;  3JSV B;  1WM3 A;  4JQW C;  3PTF C;  3QWZ B;  3EHV A;  1L2N A;  5DPT A;  4IUM B;  4ICV A;  3VUW A;  2AL3 A;  2LI5 A;  2MLB A;  3JVZ X;  4NJ6 A;  5G2N A;  2WWZ A;  3AUL A;  3TCA A;  4ANW A;  1VD2 A;  2JRI B;  5D94 A;  2N9X A;  3AI5 A;  4G11 A;  2KTR B;  3IFW B;  5HKH A;  4LDT D;  3WAO A;  4HJK A;  5G55 A;  1ZW7 A;  2MBB B;  5TR5 A;  2NR2 A;  1EF5 A;  3HM3 A;  3VUX A;  2MWS B;  2N1V A;  3RUI B;  3HM6 X;  4NAW B;  3IBE A;  1E7U A;  2KJ6 A;  3H7P B;  1WI0 A;  4HCP B;  3R7Q A;  1GJZ A;  1EO6 A;  2MA9 B;  4RMA A;  3IVF A;  3A9K B;  4FUL A;  5DPS A;  3ZDT A;  1IYF A;  3ECI A;  2J0J A;  3ZNG C;  2BWE S;  2N7D A;  3DBS A;  3DVN V;  3EEC A;  2REX A;  2LGX A;  2LVO A;  3DVG Y;  4OVU A;  3M95 A;  4GN1 A;  3DBH I;  3V6E B;  2FAZ A;  3HK0 A;  2BKF A;  3KUD B;  4KIK A;  1I42 A;  2G45 B;  3Q3F A;  1KOT A;  4II3 B;  3CMM B;  3N3K B;  4IM0 A;  1ZKH A;  3DVN U;  3KW5 B;  2N4F A;  1YQB A;  2GBM A;  2DZI A;  3AU5 A;  5E6O A;  4IG7 B;  2WX1 A;  1WZ3 A;  2RD0 A;  1RLF A;  2K6D B;  3A4S C;  1WX7 A;  2QHO A;  4PS8 A;  1WXM A;  4AWJ A;  2J0K A;  4GSW A;  3QC8 B;  2ZPY A;  1J8C A;  1CMX B;  4DDG D;  2YVC A;  3GZN I;  4IW0 A;  3WAL A;  2NBU A;  4ZRK A;  4W9F A;  1WX9 A;  3W1Y A;  3RCZ A;  3DBR I;  3H1U A;  4B6W A;  2NVU I;  3HIZ A;  4JL9 A;  4MEL A;  4K7S A;  2LZ6 A;  2K1F A;  4NNJ B;  1WJ4 A;  3VFK A;  3DVG X;  4EUT A;  2A4Z A;  3ZLZ A;  2MP2 A;  4MSQ B;  4ZDV A;  1C1Y B;  2CHW A;  3A9J B;  4GDK A;  5GMV A;  2DHZ A;  3OLM D;  3B1L X;  4FA6 A;  1V80 A;  2O6V B;  2G4D B;  2IY0 B;  1UEL A;  2C5L C;  2WX0 A;  4FJZ A;  3DCG A;  4M8M A;  3UIO B;  3ZTC A;  2JXX A;  2Y5B B;  1E8W A;  4KDL B;  4FBJ B;  4WJQ A;  1TZ1 A;  3W1S C;  4J6I A;  5KHO A; 
#chains in the Genus database with same CATH topology
 3SD5 A;  5HG2 A;  4CYE A;  1BML C;  3PLV A;  2PIA A;  3L13 A;  2EMT A;  1AN8 A;  1JRU A;  2WHI A;  3BYY B;  3A1Q B;  2D3C A;  5JH5 C;  1F1H A;  5FR3 A;  4PYU A;  1RRB A;  2W9N A;  2DZM A;  3DBH B;  3GP7 A;  4PK1 A;  3U8Z A;  3DDC B;  3JSV A;  5DPW A;  2K25 A;  2N0S B;  2R2O A;  3B08 A;  1WIA A;  4NAM A;  5LLI A;  2KTR A;  1TKY A;  2IY1 B;  4P6V F;  2BS4 B;  1FEH A;  1R4M I;  1KM7 A;  4HPL B;  4NAW A;  5C23 A;  2KN5 A;  1YJI A;  1WH3 A;  1HXY D;  1SEB D;  2KMA A;  2V0G A;  2B3A A;  2K6Q A;  4KVG B;  4EOY A;  1P1A A;  2GMI C;  2L8J A;  1UGJ A;  3EFC A;  2L83 A;  5BMG A;  2YLM A;  3QHT A;  3DPD A;  3Q8C A;  4IDI A;  4XC2 A;  4TQ1 A;  4YL8 A;  3RFZ B;  4YTN B;  2KN4 A;  2K8C A;  2NPT B;  4K1R B;  1WFY A;  1VJK A;  3ZGZ A;  1LXD A;  2N1W A;  1UUP A;  2J7Q B;  4WWO A;  2IPK D;  2KVR A;  4RM9 A;  4ZHP A;  3PO0 A;  3C8Y A;  3A9J A;  5FR6 A;  4MJS B;  4MGI E;  2GB1 A;  3JYU A;  1WXS A;  5CHW A;  2N9P C;  4IM3 A;  1L4D B;  1JQ4 A;  3VUY A;  2DAJ A;  4A9A A;  4OZC A;  4TUU A;  2ICI A;  3RYT A;  3VTW A;  3M62 B;  1FRR A;  1WYW B;  1OFF A;  1I4Q A;  2GOW A;  1JWA D;  1F2R I;  4W9C A;  2BPS A;  3NVW A;  1I7H A;  4B9K A;  3DHH C;  3O65 B;  1WGH A;  2BKR B;  4TSS A;  1V97 A;  1V1P A;  3AE6 B;  3M3J A;  1QOG A;  4ZHO A;  4IWQ A;  4C7Y A;  4GGQ A;  2BYV E;  3DWG C;  4B0M A;  4CQN A;  2JPH A;  1C3T A;  1WJN A;  3ZYY X;  4URK A;  1L7Y A;  3IXS A;  2BGF A;  3VRB B;  1ZXI A;  2DYM A;  2DZK A;  4S17 A;  1DOY A;  2WXF A;  3ETR A;  2UYZ B;  3NHE B;  3MC8 A;  4ZRP A;  5AUI A;  2KLC A;  2M1M A;  3R66 C;  2KJR A;  5BO4 B;  2HTM E;  3ZRC A;  5C1Z A;  1YNT E;  2PKO A;  2ZPN A;  1YX5 B;  3R2I A;  2KC2 A;  3Q3O C;  3I5J C;  4NPN A;  3CST A;  1Q5W B;  4PS7 A;  3Q6B A;  2INN E;  1JML A;  1VDV A;  3Q3N C;  1D5Z C;  5C3J B;  3QA8 A;  2I38 A;  3VVW B;  4W9I A;  2KFK A;  1TS2 A;  4K7W A;  3N1X C;  3PRZ A;  3AU4 A;  1FXT B;  1VZ7 A;  3L17 A;  2LMC A;  1WYG A;  1V81 A;  3Q8E A;  4DQO C;  3NZU A;  3RT3 B;  4OZB A;  3WAM A;  1GPX A;  2V1Y A;  1ACC A;  3GB1 A;  2E6X A;  1T0Q C;  1QQR A;  5AZG A;  4C4V B;  4W9L A;  2D5G A;  2LRW A;  4N58 A;  1PGA A;  1V49 A;  3TL5 A;  3X0W A;  4YSY B;  2MQJ A;  2DYO A;  4WQM A;  4NY0 A;  4BBN C;  2MSE D;  2JF5 A;  1QIL A;  3KVF B;  2XK5 B;  2WLB A;  1P9D U;  1K8R B;  4BKS A;  3V61 A;  5BYS A;  2JZZ A;  1XLN A;  3PRE A;  2HD5 B;  2PVO D;  2HJ1 A;  3PS6 A;  4HXD A;  2GI9 A;  1TZO A;  4ITK A;  1LGR A;  4DHZ B;  3QAQ A;  4HKQ A;  2KX3 A;  3WIM A;  4YTP B;  1N62 A;  1ZDX A;  2LEK A;  1MHH E;  4MH0 E;  1OGW A;  4KX6 B;  2DEN B;  2JVC A;  3A1Q A;  4EFO A;  1JRP A;  3U4E G;  4BKT A;  3O13 A;  3QIJ A;  4KIK B;  4YSX B;  4M0W A;  3RNA C;  2WNM A;  2LFI A;  1KH0 A;  2RDB C;  1Q1O A;  2IGG A;  2RMM A;  2GBJ A;  2KYW A;  2HE7 A;  3EC8 A;  2WDQ B;  2IO0 B;  4RNA A;  2AQ2 B;  1YQ4 B;  3KUZ A;  4A3O A;  1WE7 A;  4K3C A;  2O2V A;  1P0R A;  4ACF A;  2H88 B;  1SE2 A;  3DOW A;  1NI3 A;  2LXA A;  5J17 A;  1U4A A;  3ZO5 B;  3R8B A;  3AEA B;  4S0R A;  2WQY B;  3OJ3 A;  4JWU C;  5FKA C;  1C9F A;  1C4P A;  2INC C;  5L83 A;  4WJN A;  1WX8 A;  5GXG B;  3N1Z C;  1XXG A;  2MEK A;  2D10 A;  2WU2 B;  3AE8 B;  1L6V A;  2AQ1 B;  1WJ6 A;  2J0M A;  3L08 A;  2MBH A;  1F2R C;  4AOF A;  4IOI E;  1YX6 B;  2V3S A;  3ZW3 A;  3JSV B;  4L23 A;  2PTL A;  3PTF C;  3QWZ B;  3EHV A;  1N63 A;  3VUW A;  2AL3 A;  4LNO A;  4NJ6 A;  3TCA A;  1VD2 A;  4DXF A;  2N9X A;  5EE9 A;  3AI5 A;  2KTR B;  4WWM A;  1JWM D;  3AV8 A;  5TR5 A;  2LUM A;  1EF5 A;  1XLQ A;  1VRA B;  4NAW B;  3IBE A;  3AEG B;  4RMA A;  4FUL A;  3ZDT A;  2OJW A;  3ECI A;  2KWD A;  2BWE S;  2LGX A;  3DVG Y;  3C19 A;  4JPS A;  4OVU A;  3AE2 B;  1MJD A;  1HQR D;  3M95 A;  3DBH I;  3V6E B;  3KUD B;  3NRZ A;  1ZDV A;  3Q3F A;  1KLU D;  1KOT A;  4RFB A;  3CMM B;  4YSZ B;  1XCQ L;  2DZI A;  2RD0 A;  1RLF A;  4LNF A;  1WX7 A;  2QHO A;  2GRI A;  4PS8 A;  3WCQ A;  5I4D A;  3QC8 B;  2YVC A;  4ZRK A;  4W9F A;  3H1U A;  4KGS A;  2FUG 1;  1MVK A;  2IGH A;  2WXI A;  2LZ6 A;  1WJ4 A;  2WS3 B;  3ZLZ A;  1GAQ B;  1C1Y B;  3A9J B;  3OLM D;  2G4D B;  4FJZ A;  4M8M A;  3UIO B;  1E8W A;  4FBJ B;  3W1S C;  3MP9 A;  1SE4 A;  2YEP B;  2K8B A;  2KTF A;  4ZOH C;  3V05 A;  1TIF A;  1TGZ B;  1RYJ A;  1NI2 A;  3BK2 A;  4AJY B;  4HCN B;  1YJ1 A;  1V5O A;  5D2M B;  1RWS A;  3VH4 B;  1V6E A;  1V1P B;  4MDK E;  4CHK A;  2IO2 B;  1CK1 A;  2IGD A;  4TKN A;  3TEY A;  4C4V A;  3A4R A;  3AE7 B;  4ANV A;  1XO3 A;  3MJW A;  1YN4 A;  4A6Q A;  1EWC A;  4BOZ B;  1D3Z A;  4FAD A;  4WJO A;  2N9L A;  1QOF A;  1F52 A;  5LXI B;  4DXG A;  3QCA A;  2FIF A;  3DBR B;  3NVV A;  4NJ7 A;  1WF9 A;  3ZNZ B;  3Q8F A;  1SBB B;  3TEX A;  4FHJ A;  4JE3 B;  1PYW D;  2ZNV B;  1KF6 B;  2KD0 A;  2JXT A;  4XWW A;  3V3X A;  2KFK B;  2M56 B;  2BB6 A;  3ZIM A;  2BW2 A;  4XGA B;  4FJV B;  4QAY A;  4A90 A;  5FK9 C;  1XD3 B;  2KQ4 X;  2RPV A;  3L10 B;  1N5X A;  1ZPS A;  1JWB D;  3ZNH B;  3IAS 1;  4ICU A;  3V62 A;  4A8X C;  1WE6 A;  3N9Y C;  5J2R A;  2O6V A;  5H92 C;  2WYQ A;  3T3N A;  2RSU A;  3RZF A;  3ZTD A;  3P42 A;  1YD8 U;  1D4B A;  1FCL A;  1V2Y A;  2N9E B;  3C0R B;  2KHW B;  3OJ4 B;  2KWU B;  1NDD A;  2IND C;  2IZV B;  3PVL A;  1K53 A;  3MHZ A;  3PSE B;  3IAM 1;  3PHW B;  4B0E A;  1SB3 C;  3KWL A;  1RAX A;  4C7Z A;  3A33 B;  3W5V B;  2PLP A;  1J19 A;  2L0T A;  4BKS D;  4GU2 A;  4O1N A;  2LGD A;  2WXQ A;  1Z5S B;  3GS2 A;  2FCN A;  1PUT A;  4LTU A;  4NQL B;  4N59 A;  4TQ0 A;  2LRU A;  2M8S A;  3CF6 E;  2FCS A;  2BQQ A;  2JRH A;  4N9F 4;  2ZW0 A;  3BY4 B;  1DYQ A;  2UU7 A;  2WDV B;  3RNC C;  1UF0 A;  1HZ5 A;  2K9X A;  2NBW B;  5L95 C;  5IA7 A;  4M0W B;  1ISN A;  2KZR A;  1WGR A;  4KSL C;  4LCD E;  2CU3 A;  4HPP A;  1E9M A;  3NUH B;  4L2Y A;  3Q2A C;  2W55 A;  1L5P A;  1E8Z A;  2DNF A;  3H9D A;  2LHD A;  4BAX A;  4CO7 A;  4EE2 A;  1UD7 A;  2M4N A;  3RNF C;  4KGR A;  2NMQ A;  2O2V B;  4WUR A;  5IO9 A;  4AQ7 A;  1EU4 A;  3SDL C;  4KSK C;  1PDX A;  4RF1 A;  4TV3 A;  2KOX A;  3EA6 A;  3P4R B;  2MW5 A;  4ARI A;  4XE0 A;  1N60 A;  3MC9 A;  1HTO A;  2LHE A;  1X1M A;  4DDI D;  1AYF A;  3K9O B;  1P7E A;  3PHX B;  4RM8 A;  3ZQ4 A;  4F7Z A;  2WP9 B;  4KZC A;  2PE6 B;  3NY5 A;  4PYZ A;  3U7Z A;  2LGS A;  3PZ7 A;  1XLP A;  1R4N I;  1LO5 D;  3D32 A;  3VHT C;  3W5U B;  4PS3 A;  5D6J B;  3VTU A;  2FCM A;  1SIF A;  2NS5 A;  2MCN B;  2C7N B;  1V5T A;  2HDE A;  1GB4 A;  3NVY A;  4W9H A;  2DZJ A;  2KKC A;  5BMI A;  4KV2 A;  2XEW A;  1XLO A;  1GC7 A;  2K39 A;  4GDL A;  2JWU A;  2C7H A;  3KYD D;  5CTR C;  3PGE A;  3AXC A;  1LFD A;  4BVU C;  2LVP A;  3R7R A;  2BF8 B;  1MG4 A;  3W1S A;  1TS5 A;  1I4H A;  3B2F A;  4L1B A;  3AMZ A;  1MI0 A;  3LJ3 A;  5JXV A;  4JX1 C;  2X38 A;  2KWC A;  1A5R A;  1E8X A;  4GIV A;  2L1A A;  4EKU A;  2L7R A;  2Z8L A;  3B2G A;  3OG5 A;  1QOB A;  1OQQ A;  2RGF A;  3U52 E;  2BYE A;  5IKC M;  3URY A;  1FXI A;  5AZF A;  1I35 A;  3BVM A;  2LUE A;  3BVG A;  2ONQ A;  4M00 A;  3SHQ A;  1TTN A;  3RNE C;  4NZL B;  3PZ8 A;  4H2A A;  2AWT A;  1PGB A;  2J52 A;  3EGR A;  1GNU A;  3NG0 A;  5AEK B;  2KX0 A;  4II2 B;  1D6E C;  4WH4 A;  1FPY A;  2C7M B;  1FFU A;  1OQR A;  4EZJ A;  3L16 A;  2DYB A;  1E90 A;  4TMA B;  4HDQ A;  4OVV A;  5J18 A;  2PE9 A;  2N7E A;  1G6J A;  2KQ7 A;  2J4X A;  2GLS A;  3UIN B;  3QX1 A;  1L4Z B;  1TBE A;  1P3Q U;  2C60 A;  1K51 A;  3M63 B;  2L05 A;  2J42 A;  5IAA C;  4EZK A;  1UNS A;  2EMS A;  1FRD A;  2MX2 A;  3X23 A;  1J0G A;  2LGY A;  3BVZ A;  2FE8 A;  1WGD A;  2JSV X;  4A20 A;  3IT6 B;  4IUM B;  1L0V B;  3JVZ X;  5G2N A;  3AUL A;  4G11 A;  3IFW B;  5HKH A;  4LDT D;  5BYQ A;  4FXC A;  1ZW7 A;  2NR2 A;  2MWS B;  4XWT A;  1E7U A;  3H7P B;  4HCP B;  1GJZ A;  2VH1 A;  3U2S C;  3LYY A;  4MM3 B;  2JX5 A;  4WAF A;  1ZP0 B;  3H8H A;  3KWV A;  2FAZ A;  3Q3M C;  1FNV A;  1XCT L;  2QSD A;  3DVN U;  3FIL A;  1YQB A;  4IG7 B;  1YJJ A;  2K6D B;  3A4S C;  1WXM A;  4AWJ A;  2QJL A;  2ZPY A;  1CMX B;  1JCK B;  2ON8 A;  3MC0 B;  4IW0 A;  3WAL A;  2X8X X;  2PMV A;  3DBR I;  2NVU I;  2L52 A;  1R4M B;  3HIZ A;  4MEL A;  1TS4 A;  4NNJ B;  3T3O A;  2EKI A;  2A4Z A;  1QOA A;  4MSQ B;  4GDK A;  2DHZ A;  4LLG M;  3B1L X;  1V80 A;  4LNK A;  2O6V B;  1UEL A;  2W82 A;  2BBC A;  5KHO A;  3UIP B;  2BYF A;  2O6V D;  3FC4 A;  3ENE A;  4GOC A;  1JW9 D;  3UGB B;  5EE1 A;  2ZCB A;  3T9L A;  5IP4 D;  1C76 A;  2DLB A;  2V4L A;  1L6U A;  3GE3 C;  1C4C A;  3PRP B;  4KKI A;  2Y5P A;  1E8Y A;  3DHG C;  2ZZP B;  1UBQ A;  4GMV A;  2WXK A;  5JZE B;  4I6P A;  2KDI A;  2LD9 A;  4RF0 A;  3ZNI D;  3WAP A;  4C56 C;  1FM0 D;  2DAF A;  2I1J A;  4G3X B;  3IG3 A;  1L0X B;  2VRR B;  4JLC A;  4UDU C;  2MBO A;  3S2A A;  4ZRI A;  2QC8 A;  2MRP A;  2WXP A;  2WDT B;  4HDO A;  3VTV A;  4K3B A;  2BT6 A;  4XZ4 A;  2L32 A;  1YMH E;  3ZJU A;  2AQ3 B;  2KC1 A;  1JAL A;  2N9K A;  2Z59 B;  1HE8 A;  4NQK E;  2LGI A;  1V9J A;  1TT5 B;  3VAW A;  2W54 A;  2OHF A;  1D5M C;  1B1Z A;  1L0Y B;  2JYT A;  2WXJ A;  2VH2 A;  1MFW A;  2FCQ A;  2NTT A;  1QLB B;  3RUL A;  5D3D A;  5CX3 A;  3KH0 A;  3AE9 B;  3HHM A;  1S1Q B;  2SAK A;  1RFK A;  4M8N A;  2C9W B;  1VR9 A;  2HTH A;  1D5X C;  1IGC A;  4RGO S;  3UQA A;  5D3I B;  1T0S C;  2BWF A;  5IOI A;  3AEC B;  4HRS A;  4HK2 A;  2VZK B;  2KFJ A;  2CS4 A;  1XQQ A;  4WQO B;  2QIE B;  4W9K A;  3L54 A;  4DK5 A;  3CIR B;  4JGH B;  1YIW A;  1T5X D;  4BZA A;  2QEJ C;  2VZK D;  1WM2 A;  3LB8 C;  3H6N A;  2Y5C A;  5HHD G;  1TY2 A;  4OZA A;  1DOX A;  4GDL B;  1H8C A;  3T8M A;  1WXV A;  4KGT A;  4P16 A;  3CSF A;  4G50 A;  4EZL A;  2KLG A;  3AB5 A;  2KVZ A;  1DGJ A;  3ZRF A;  3AE4 B;  4XDC A;  5BYR A;  1ENF A;  2FID A;  1EUV B;  1JWU D;  4W9J A;  3TBL D;  3P63 A;  1JWS D;  4REZ A;  1I4G A;  2YEP F;  4MAC A;  1WXA A;  1PQS A;  5JHA A;  2K0P A;  2R61 A;  1F0Z A;  3R3M A;  3P4Q B;  1TYG B;  4P1C C;  4W9D A;  3DBL B;  3H7P A;  1FFV A;  5LNK 1;  4MM3 A;  2D2Q A;  1C79 A;  3ZXR A;  3I3T B;  2KDE B;  2KQS A;  2CHX A;  1I4X A;  3HVD A;  5E6P A;  1E7V A;  2RPQ A;  3Q14 C;  1WGG A;  1WJU A;  2K22 A;  2G4S A;  1GG3 A;  4MSM B;  5G5H A;  4HWI B;  4WIP A;  2ZJD A;  1J7C A;  2J53 A;  2KAN A;  3TUO A;  1P7F A;  2JWZ A;  2WXH A;  1NYQ A;  4Q2J A;  1GB1 A;  4RGT A;  4BKG A;  1EF1 A;  1WRI A;  2MBE A;  1K50 A;  4MGK E;  1V1O A;  2CR5 A;  2PVG C;  2IO3 B;  1UBI A;  2ZW1 A;  4ZRQ A;  3RMK C;  4AUQ C;  1T0R C;  2EKE C;  1BUI C;  2EEL A;  4RH6 A;  2AL6 A;  2KAC A;  1YOV B;  3E56 A;  3QK0 A;  4JWS C;  3WA0 A;  1V8C A;  3SEB A;  2KMM A;  1C77 A;  2ZVO A;  3ZKJ C;  1FD6 A;  3ML8 A;  3MJ5 A;  5BMH A;  2H89 B;  3NS8 A;  3OAW A;  4ARC A;  1XF5 L;  1IUE A;  1MPE A;  1E5W A;  2Z0E B;  3NOB A;  4C00 A;  3AEF B;  3N32 A;  2LJ5 A;  2DWQ A;  4XYC A;  1EWY C;  4WAA A;  1UGM A;  2PEA A;  1VZ6 A;  5H8Y E;  5AUK A;  3PRM B;  4BFR A;  3RD2 A;  2KDM A;  3NZ3 A;  1IP9 A;  3HUI A;  4DWF A;  1ZGU B;  1V86 A;  2PPH A;  3FIL B;  3K9P B;  4ANX A;  4E3C A;  1KRH A;  2ZVN A;  3ZVV A;  3RPF C;  2JUO A;  4HJG E;  3BWU D;  4GLS C;  1LQB A;  3AEE B;  1WMH A;  2UWQ A;  2NCN A;  3V6C B;  1CQV A;  2GBR A;  4GDK B;  2TSS A;  5CHV C;  1WSP A;  2V3P A;  3ONS A;  2G3Q B;  3TJP A;  1Z2M A;  4LK0 M;  3NZS A;  1UZX B;  2GBN A;  3DHI C;  2ASQ A;  1HA5 A;  1OEY A;  4FN2 A;  2MJD A;  2RR9 A;  3NS1 A;  3VH3 B;  4KDI C;  3MFG A;  1TS3 A;  4IKG A;  4DHZ E;  1UH6 A;  3ABV B;  4WWP A;  2DX5 B;  3BK1 A;  1ZXH A;  3MHS D;  2FNJ B;  2M0A A;  4F1S A;  4IWO A;  1WM3 A;  3NJT A;  5DPT A;  4ICV A;  2LI5 A;  4ANW A;  2WWZ A;  5D94 A;  1T3Q A;  1QF6 A;  2BYT A;  5G55 A;  2MBB B;  3HM3 A;  3VUX A;  2V9H A;  5MPO A;  3RUI B;  3HM6 X;  2QMT A;  1WI0 A;  1EO6 A;  5DPS A;  1E7P B;  1IYF A;  2WXG A;  2J0J A;  3ZNG C;  3DVN V;  4P1B C;  1ZE3 D;  1SSN A;  3NVZ A;  3HK0 A;  4II3 B;  3P1M A;  1TKG A;  1SF0 A;  3BZD B;  1K52 A;  1ESF A;  1ROE A;  3P4S B;  5E6O A;  2WX1 A;  3L4P A;  3VRA B;  4A55 A;  2J0K A;  1WWT A;  3RN9 C;  1FMA D;  3W1Y A;  1WX9 A;  3RCZ A;  4B6W A;  1ZOY B;  2K1F A;  3RNB C;  4YT0 B;  3DVG X;  4EUT A;  2NTS A;  2MP2 A;  4ZDV A;  3RNG C;  2CHW A;  5E6J A;  5GMV A;  2JQR B;  4FA6 A;  2KT7 A;  2IY0 B;  2K5P A;  3VR9 B;  1NVI D;  2W3R A;  2Y5B B;  1SE3 A;  1TZ1 A;  2QCZ A;  3P4P B;  4DXA B;  1Y56 A;  1E10 A;  3TEZ A;  4YWG G;  3AE1 B;  4XX5 A;  1KLV A;  1SJH D;  4YTM B;  1Q0W B;  3I9V 1;  1R7S A;  2D07 B;  4EEW A;  2WXM A;  1SE9 A;  1WRD B;  4K7U A;  4DBG A;  4A3P A;  3SR6 A;  3B0A A;  1P98 A;  2D11 A;  2ACZ B;  3BYT B;  2D3G A;  4PT5 A;  2IYD B;  1M94 A;  3LXF A;  3OWE B;  1F9J A;  2OJR A;  2CU1 A;  3IT4 B;  2KO3 A;  1YQ3 B;  2JZP A;  1SXT A;  4XDD A;  3Q8A A;  2BTE A;  4IM2 A;  4MGY E;  5D7G A;  1LM8 B;  2L0F A;  2IJ0 A;  1GC6 A;  4HPM B;  4MT5 A;  4W9E A;  4W9G A;  4HRO A;  3A9K A;  4BOS C;  3ML9 A;  2I2Y A;  3GZN B;  3KLS X;  3TIX A;  2E3T A;  1CZP A;  4LDT B;  1NYR A;  1JRO A;  4G0N B;  3BIN A;  3W2D A;  2R2Q A;  4KZ0 A;  4X57 B;  1IBX A;  1WR6 E;  3TEW A;  5HI1 A;  3TMP B;  3PLU A;  4HKZ E;  4LNN A;  1E0Z A;  4MEM A;  2RDH A;  2GBK A;  1J7A A;  1QZE A;  3VR8 B;  5EDS A;  4WJP A;  1T6B X;  2KWV B;  2PW9 A;  1DOI A;  1N5W A;  3EUB 2;  3KQ4 A;  2KNB A;  2L00 B;  3GE8 C;  2V3N A;  4HEA 1;  3VDZ A;  3L0W B;  1OTR B;  4LJO B;  3CWI A;  5LXH A;  3I63 C;  1ZUD 2;  3PT2 B;  4WWN A;  3P2B A;  3RI7 C;  4D2K A;  2QDF A;  3DBL I;  4BBN F;  3QAR A;  2HJ8 A;  2JYE A;  2JZ3 B;  2KDF B;  1TKE A;  2I1K A;  1RFA A;  3AEB B;  4I6N B;  3AE3 B;  2KMC A;  4RGN A;  5CHF A;  2JT4 B;  2D3B A;  1BT0 A;  5T8I A;  4HLE A;  1XEE A;  1SGH A;  1CJE A;  4DHJ B;  4MGZ E;  2XBB C;  4AP4 C;  1VZ8 A;  3W9C B;  3ALB A;  2BVC A;  1YN5 A;  4DHJ D;  4M02 A;  3SFE B;  1UWX A;  3APF A;  1TY0 A;  2ZEQ A;  2BB5 A;  2LVQ A;  2KJH B;  5TSS A;  4AJW A;  4ZYS A;  3FKY A;  1E6E B;  2QIL A;  2NBV B;  5E6N A;  1IPG A;  3DQV A;  3RZW C;  4E71 A;  2AYO B;  1C4A A;  2MH7 A;  2BS2 B;  4GXB A;  1R4N B;  2IBI B;  3DWM A;  3U30 A;  5DCN A;  2L76 A;  3ZJV A;  1SIJ A;  1WGY A;  3QQ8 B;  1OEY J;  1WR1 A;  1Y8R C;  3IHP C;  2JY6 A;  2Z0D B;  4FHK A;  2CHZ A;  1YN3 A;  2K3U A;  1ET9 A;  2G1E A;  4MH8 A;  2NPT A;  3TSS A;  4USA A;  1WMH B;  1T0Y A;  4J3O D;  2AEH A;  4LNI A;  2AX5 A;  2CKH B;  2BS3 B;  3GOE A;  3PZD A;  2WXO A;  1NEK B;  1FO4 A;  1KTK A;  1GUA B;  4IWP A;  4MJS A;  2WU5 B;  3E9S A;  3H7S A;  2XN9 C;  3KUC B;  3AN1 A;  3N20 C;  2WXN A;  4ASW C;  2M17 A;  1PGX A;  2V4I B;  3U7D A;  1FCC C;  1S3S G;  2KDB A;  4FJY A;  3I57 A;  2LWP A;  1FNU A;  2LAS A;  4E74 A;  2M0X A;  1M4V A;  4K81 A;  1KJT A;  1NEN B;  4HVB A;  5EE0 A;  1WGK A;  4US9 A;  1B9R A;  2WXR A;  3HRD D;  4ZRJ A;  3UF8 A;  2LXC A;  1N6Z A;  3AE5 B;  1AW7 A;  4I6L B;  5AZH A;  2ZCC A;  3EFU A;  4YXD B;  2FUH B;  3B9J A;  1I4P A;  1C78 A;  1VCB A;  1HTQ A;  3Q69 A;  1AAR A;  1QT9 A;  2JU6 X;  3JW0 X;  3VQI A;  5DPR A;  3APD A;  3Q3J A;  4IC7 B;  3N1Y C;  4FLH A;  2KK8 A;  1ET6 A;  5IN7 A;  4ANU A;  1FXA A;  3PV1 A;  1F77 A;  4AS1 A;  3V60 A;  4NJC A;  4LJP B;  1MG8 A;  1H4R A;  3QJZ A;  3ZDM C;  2CJO A;  2FBW B;  2WGS A;  2IO1 B;  3AM9 A;  3APC A;  2W3S A;  1TJE A;  1WZ0 A;  4GB9 A;  4JIO U;  5G5G A;  4US8 A;  3WAN A;  3ZXV A;  1IGD A;  1VLB A;  1UWM A;  2MBQ A;  1KFY B;  3MTN B;  2A5U A;  1EM7 A;  1WXQ A;  1OQY A;  2IDY A;  3AED B;  1KLG D;  5JHB A;  3SU8 X;  2MP2 B;  2G9H D;  4KKJ A;  2M19 A;  3AH7 A;  3ZUN A;  1WY8 A;  3VXW A;  3KYC D;  3J9C A;  2PJH A;  1XT9 B;  1PFD A;  4B95 A;  1BXT A;  5KHQ A;  4ZYN A;  3LDZ E;  1NBF C;  3UQB A;  4N6E B;  3PPA A;  3N30 A;  2KXJ A;  2CJN A;  4RCO A;  4R3D A;  2XNA C;  3HVZ A;  2SEB D;  1STE A;  2OOB B;  2MHJ A;  2ZNV C;  3R2T A;  4P7I A;  2L3Z A;  1EU3 A;  2XK5 A;  1I4R A;  3SFD B;  2MJE A;  2K8H A;  5HFY A;  4JQW C;  1L2N A;  2Y3A A;  2MLB A;  2JRI B;  3FAH A;  2D3A A;  2Q5W D;  3WAO A;  4HJK A;  1FNW A;  4RGM A;  2N1V A;  1AWD A;  2KJ6 A;  3R7Q A;  2MA9 B;  3IVF A;  1HZ6 A;  3A9K B;  4C80 A;  2MJ3 A;  2DBY A;  2N7D A;  3DBS A;  3EEC A;  2REX A;  4M01 A;  2LVO A;  4GN1 A;  1GOZ A;  1N61 A;  2BKF A;  4KIK A;  1I42 A;  2G45 B;  1IBX B;  5C2T B;  3N3K B;  4IM0 A;  1ZKH A;  3KW5 B;  2KAJ A;  2N4F A;  2GBM A;  3AU5 A;  3BII D;  1WZ3 A;  1SJE D;  1QKZ A;  4GSW A;  1J8C A;  1Q10 A;  2B76 B;  4OHJ A;  4DDG D;  3GZN I;  2NBU A;  2OED A;  2N7J A;  4JL9 A;  4K7S A;  4OVZ A;  3VFK A;  1HEZ E;  1RM6 C;  3UI3 A;  1MHX A;  1J7B A;  1A70 A;  4OW0 A;  3ZJT A;  1FIQ A;  3Q8B A;  2C5L C;  2RDG A;  2WDR B;  2WX0 A;  5EE3 A;  3DCG A;  2LJI A;  3ZTC A;  2JXX A;  2INP E;  4KDL B;  4WJQ A;  4J6I A;  4F8C B;  2WXL A; 
#chains in the Genus database with same CATH homology
 3UIP B;  2BYF A;  3SD5 A;  4DXA B;  4CYE A;  2O6V D;  3PLV A;  3ENE A;  2K8B A;  4GOC A;  2KTF A;  3UGB B;  1KLV A;  4XX5 A;  3L13 A;  2ZCB A;  1TGZ B;  1Q0W B;  1NI2 A;  3T9L A;  2EMT A;  2D07 B;  4AJY B;  1JRU A;  4EEW A;  2V4L A;  4HCN B;  1SE9 A;  1WRD B;  1V5O A;  1YJ1 A;  3PRP B;  4K7U A;  4DBG A;  3A1Q B;  5D2M B;  4A3P A;  1E8Y A;  3VH4 B;  5JH5 C;  1V6E A;  3B0A A;  1P98 A;  2D11 A;  2ZZP B;  4MDK E;  4CHK A;  4PYU A;  1RRB A;  2IO2 B;  2W9N A;  2DZM A;  2D3G A;  1UBQ A;  2IYD B;  4TKN A;  1M94 A;  3U8Z A;  4GMV A;  1F9J A;  3DDC B;  2OJR A;  2CU1 A;  3JSV A;  5JZE B;  5DPW A;  2K25 A;  4I6P A;  2KDI A;  3A4R A;  2LD9 A;  2R2O A;  3B08 A;  1WIA A;  2KO3 A;  3ZNI D;  3WAP A;  4ANV A;  5LLI A;  2DAF A;  2KTR A;  3MJW A;  2IY1 B;  2I1J A;  4G3X B;  4IM2 A;  3IG3 A;  4MGY E;  5D7G A;  4BOZ B;  1LM8 B;  1D3Z A;  1R4M I;  1KM7 A;  2L0F A;  4HPL B;  4FAD A;  1GC6 A;  4NAW A;  4HPM B;  4WJO A;  2VRR B;  5C23 A;  4JLC A;  4W9E A;  4W9G A;  3A9K A;  2KN5 A;  4BOS C;  2MBO A;  3ML9 A;  4ZRI A;  3S2A A;  5LXI B;  3TIX A;  2MRP A;  1WH3 A;  4F8C B;  2WDT B;  4HDO A;  3QCA A;  2FIF A;  4LDT B;  2KMA A;  3VTV A;  2B3A A;  4NJ7 A;  1WF9 A;  3ZNZ B;  4G0N B;  3BIN A;  2K6Q A;  4KVG B;  4XZ4 A;  4FHJ A;  2R2Q A;  4KZ0 A;  4X57 B;  4EOY A;  1WR6 E;  2ZNV B;  3TMP B;  3PLU A;  1P1A A;  2GMI C;  2KC1 A;  2KD0 A;  2L8J A;  2Z59 B;  4MEM A;  2YLM A;  2GBK A;  1HE8 A;  3DPD A;  3QHT A;  4NQK E;  4XC2 A;  1V9J A;  1QZE A;  2KFK B;  4TQ1 A;  4YL8 A;  5EDS A;  3VAW A;  3ZIM A;  4WJP A;  2K8C A;  2KWV B;  2NPT B;  4K1R B;  4FJV B;  1WFY A;  1XD3 B;  1LXD A;  2N1W A;  3L10 B;  2FCQ A;  2KNB A;  2L00 B;  3RUL A;  2J7Q B;  4WWO A;  2KVR A;  4RM9 A;  3L0W B;  5CX3 A;  3VDZ A;  1OTR B;  3ZNH B;  4LJO B;  3KH0 A;  3A9J A;  5FR6 A;  5LXH A;  4ICU A;  3V62 A;  4MJS B;  3PT2 B;  1WE6 A;  4MGI E;  4WWN A;  3HHM A;  5J2R A;  2O6V A;  3JYU A;  3P2B A;  1S1Q B;  1WXS A;  2WYQ A;  2RSU A;  5CHW A;  2N9P C;  4IM3 A;  4M8N A;  2C9W B;  2HTH A;  3RZF A;  3ZTD A;  3DBL I;  3VUY A;  2DAJ A;  1YD8 U;  4BBN F;  4TUU A;  3UQA A;  3QAR A;  2HJ8 A;  3RYT A;  3VTW A;  2JZ3 B;  1V2Y A;  2N9E B;  2KDF B;  3M62 B;  2I1K A;  1RFA A;  3C0R B;  2BWF A;  1WYW B;  4I6N B;  2KHW B;  3OJ4 B;  4HK2 A;  2KMC A;  2KFJ A;  2CS4 A;  1XQQ A;  2KWU B;  1NDD A;  2GOW A;  4WQO B;  2IZV B;  4W9K A;  3PVL A;  3L54 A;  5CHF A;  2JT4 B;  4DK5 A;  4W9C A;  4JGH B;  2BPS A;  1BT0 A;  1YIW A;  3PSE B;  4HLE A;  3PHW B;  4B9K A;  1SGH A;  4DHJ B;  3O65 B;  1WGH A;  2BKR B;  4MGZ E;  2XBB C;  1WM2 A;  1RAX A;  3H6N A;  3M3J A;  4IWQ A;  3A33 B;  4AP4 C;  1J19 A;  3ALB A;  4GGQ A;  2L0T A;  4BKS D;  4GDL B;  4GU2 A;  1H8C A;  4DHJ D;  2LGD A;  2BYV E;  1Z5S B;  3T8M A;  2FCN A;  1WXV A;  3APF A;  2ZEQ A;  3CSF A;  2JPH A;  2LVQ A;  2KJH B;  4G50 A;  4AJW A;  1C3T A;  1WJN A;  4EZL A;  4URK A;  1L7Y A;  2KLG A;  2NBV B;  4NQL B;  5E6N A;  2BGF A;  3ZRF A;  1IPG A;  4TQ0 A;  2LRU A;  2M8S A;  3CF6 E;  2FCS A;  3DQV A;  3RZW C;  2JRH A;  4N9F 4;  4E71 A;  2DYM A;  2AYO B;  2FID A;  2DZK A;  1EUV B;  3BY4 B;  4GXB A;  4W9J A;  3TBL D;  2UYZ B;  3NHE B;  2IBI B;  3U30 A;  5DCN A;  2KLC A;  2NBW B;  5L95 C;  2L76 A;  5IA7 A;  2M1M A;  3R66 C;  2KJR A;  4M0W B;  1ISN A;  1WXA A;  1PQS A;  5BO4 B;  3ZRC A;  5JHA A;  2KZR A;  1WGR A;  4KSL C;  4LCD E;  5C1Z A;  2ZPN A;  1YX5 B;  1WGY A;  2KC2 A;  3QQ8 B;  4NPN A;  3CST A;  1Q5W B;  4PS7 A;  1OEY J;  1WR1 A;  1Y8R C;  3IHP C;  1E8Z A;  2JY6 A;  2Z0D B;  3H9D A;  3R3M A;  4FHK A;  4CO7 A;  1UD7 A;  4W9D A;  3QA8 A;  2CHZ A;  2M4N A;  3H7P A;  3VVW B;  2O2V B;  4W9I A;  2KFK A;  4MM3 A;  3SDL C;  2D2Q A;  4KSK C;  3I3T B;  2KDE B;  2KQS A;  2NPT A;  4K7W A;  2CHX A;  3PRZ A;  4TV3 A;  2KOX A;  3AU4 A;  1WMH B;  1T0Y A;  5E6P A;  1E7V A;  2RPQ A;  2MW5 A;  1FXT B;  2AEH A;  3L17 A;  2CKH B;  1V81 A;  1WGG A;  1WJU A;  2G4S A;  3GOE A;  1GG3 A;  4MSM B;  3PZD A;  4DDI D;  1X1M A;  3NZU A;  1GUA B;  4HWI B;  3RT3 B;  4IWP A;  2ZJD A;  3K9O B;  3WAM A;  3PHX B;  4RM8 A;  2V1Y A;  4F7Z A;  4MJS A;  2KAN A;  4KZC A;  2PE6 B;  3H7S A;  3NY5 A;  2JWZ A;  4PYZ A;  3KUC B;  5AZG A;  4W9L A;  4ASW C;  2M17 A;  4BKG A;  1EF1 A;  2LRW A;  3U7D A;  3TL5 A;  1V49 A;  2MBE A;  1S3S G;  2KDB A;  4FJY A;  3X0W A;  4MGK E;  2CR5 A;  1R4N I;  2LWP A;  2IO3 B;  3D32 A;  1UBI A;  3VHT C;  2LAS A;  4E74 A;  4PS3 A;  2MQJ A;  2M0X A;  2DYO A;  1KJT A;  4K81 A;  4AUQ C;  2EKE C;  4HVB A;  4NY0 A;  5D6J B;  3VTU A;  4BBN C;  2AL6 A;  2MSE D;  2FCM A;  1SIF A;  3QK0 A;  2JF5 A;  2NS5 A;  3WA0 A;  4ZRJ A;  3UF8 A;  2LXC A;  3KVF B;  2XK5 B;  2MCN B;  1P9D U;  1K8R B;  4I6L B;  4BKS A;  2C7N B;  1V5T A;  3V61 A;  2ZVO A;  5AZH A;  3ZKJ C;  2JZZ A;  2ZCC A;  3EFU A;  3PRE A;  2FUH B;  4W9H A;  3ML8 A;  2DZJ A;  2KKC A;  2HD5 B;  4KV2 A;  2XEW A;  3PS6 A;  1VCB A;  4HXD A;  3OAW A;  3NS8 A;  1GC7 A;  2K39 A;  4GDL A;  1AAR A;  2C7H A;  4DHZ B;  3QAQ A;  3KYD D;  1E5W A;  2KX3 A;  3JW0 X;  2Z0E B;  5CTR C;  3NOB A;  5DPR A;  3VQI A;  3WIM A;  3PGE A;  3APD A;  3N32 A;  3Q3J A;  4IC7 B;  2LJ5 A;  4FLH A;  3AXC A;  2KK8 A;  4WAA A;  1LFD A;  4MH0 E;  4BVU C;  1OGW A;  2LVP A;  3R7R A;  2DEN B;  4ANU A;  1UGM A;  2BF8 B;  2PEA A;  2JVC A;  3A1Q A;  4EFO A;  3W1S A;  4BKT A;  3PRM B;  3LJ3 A;  3QIJ A;  3PV1 A;  4BFR A;  3V60 A;  3RD2 A;  2KWC A;  4LJP B;  1A5R A;  1MG8 A;  1E8X A;  4KIK B;  1H4R A;  3QJZ A;  4GIV A;  4EKU A;  1IP9 A;  1Q1O A;  2L7R A;  3ZDM C;  2RGF A;  2IO1 B;  3APC A;  4DWF A;  2BYE A;  2GBJ A;  1ZGU B;  1V86 A;  2PPH A;  2HE7 A;  3K9P B;  4ANX A;  3EC8 A;  4E3C A;  2ZVN A;  1WZ0 A;  5AZF A;  4GB9 A;  4JIO U;  3ZVV A;  1I35 A;  2LUE A;  2IO0 B;  2JUO A;  3WAN A;  3KUZ A;  4A3O A;  1WE7 A;  2O2V A;  3SHQ A;  1TTN A;  1P0R A;  1LQB A;  2MBQ A;  2AWT A;  3DOW A;  3MTN B;  1GNU A;  2A5U A;  1WMH A;  5AEK B;  2KX0 A;  2LXA A;  5J17 A;  4II2 B;  2UWQ A;  1OQY A;  2NCN A;  1U4A A;  3V6C B;  3ZO5 B;  5JHB A;  3SU8 X;  2MP2 B;  2C7M B;  2GBR A;  4GDK B;  4EZJ A;  3ZUN A;  1WY8 A;  3OJ3 A;  3VXW A;  3L16 A;  3KYC D;  5CHV C;  2DYB A;  1E90 A;  2PJH A;  3ONS A;  4HDQ A;  2G3Q B;  4OVV A;  5J18 A;  5L83 A;  1XT9 B;  4WJN A;  3TJP A;  1WX8 A;  1Z2M A;  2PE9 A;  3NZS A;  4B95 A;  1UZX B;  2D10 A;  5KHQ A;  4ZYN A;  2N7E A;  3LDZ E;  2GBN A;  1NBF C;  3UQB A;  3PPA A;  1G6J A;  2ASQ A;  3N30 A;  1OEY A;  4FN2 A;  2KQ7 A;  2KXJ A;  2RR9 A;  3VH3 B;  4KDI C;  3UIN B;  1WJ6 A;  3QX1 A;  1TBE A;  4DHZ E;  1P3Q U;  1UH6 A;  2C60 A;  4WWP A;  2OOB B;  2DX5 B;  3M63 B;  2J0M A;  2L05 A;  3L08 A;  2MBH A;  5IAA C;  4AOF A;  4EZK A;  2EMS A;  2MX2 A;  2ZNV C;  3X23 A;  2LGY A;  1J0G A;  3MHS D;  4P7I A;  1YX6 B;  2L3Z A;  2XK5 A;  2V3S A;  2FNJ B;  1WGD A;  4F1S A;  4A20 A;  3ZW3 A;  4IWO A;  2K8H A;  3JSV B;  1WM3 A;  4JQW C;  3PTF C;  3QWZ B;  3EHV A;  1L2N A;  5DPT A;  4IUM B;  4ICV A;  3VUW A;  2AL3 A;  2LI5 A;  2MLB A;  3JVZ X;  4NJ6 A;  5G2N A;  2WWZ A;  3AUL A;  3TCA A;  4ANW A;  1VD2 A;  2JRI B;  5D94 A;  2N9X A;  3AI5 A;  4G11 A;  2KTR B;  3IFW B;  5HKH A;  4LDT D;  3WAO A;  4HJK A;  5G55 A;  1ZW7 A;  2MBB B;  5TR5 A;  2NR2 A;  1EF5 A;  3HM3 A;  3VUX A;  2MWS B;  2N1V A;  3RUI B;  3HM6 X;  4NAW B;  3IBE A;  1E7U A;  2KJ6 A;  3H7P B;  1WI0 A;  4HCP B;  3R7Q A;  1GJZ A;  1EO6 A;  2MA9 B;  4RMA A;  3IVF A;  3A9K B;  4FUL A;  5DPS A;  3ZDT A;  1IYF A;  3ECI A;  2J0J A;  3ZNG C;  2BWE S;  2N7D A;  3DBS A;  3DVN V;  3EEC A;  2REX A;  2LGX A;  2LVO A;  3DVG Y;  4OVU A;  3M95 A;  4GN1 A;  3DBH I;  3V6E B;  2FAZ A;  3HK0 A;  2BKF A;  3KUD B;  4KIK A;  1I42 A;  2G45 B;  3Q3F A;  1KOT A;  4II3 B;  3CMM B;  3N3K B;  4IM0 A;  1ZKH A;  3DVN U;  3KW5 B;  2N4F A;  1YQB A;  2GBM A;  2DZI A;  3AU5 A;  5E6O A;  4IG7 B;  2WX1 A;  1WZ3 A;  2RD0 A;  1RLF A;  2K6D B;  3A4S C;  1WX7 A;  2QHO A;  4PS8 A;  1WXM A;  4AWJ A;  2J0K A;  4GSW A;  3QC8 B;  2ZPY A;  1J8C A;  1CMX B;  4DDG D;  2YVC A;  3GZN I;  4IW0 A;  3WAL A;  2NBU A;  4ZRK A;  4W9F A;  1WX9 A;  3W1Y A;  3RCZ A;  3DBR I;  3H1U A;  4B6W A;  2NVU I;  3HIZ A;  4JL9 A;  4MEL A;  4K7S A;  2LZ6 A;  2K1F A;  4NNJ B;  1WJ4 A;  3VFK A;  3DVG X;  4EUT A;  2A4Z A;  3ZLZ A;  2MP2 A;  4MSQ B;  4ZDV A;  1C1Y B;  2CHW A;  3A9J B;  4GDK A;  5GMV A;  2DHZ A;  3OLM D;  3B1L X;  4FA6 A;  1V80 A;  2O6V B;  2G4D B;  2IY0 B;  1UEL A;  2C5L C;  2WX0 A;  4FJZ A;  3DCG A;  4M8M A;  3UIO B;  3ZTC A;  2JXX A;  2Y5B B;  1E8W A;  4KDL B;  4FBJ B;  4WJQ A;  1TZ1 A;  3W1S C;  4J6I A;  5KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...