2REXA

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'YRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
total genus 28
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rexA00
4KSKC 3CSFA 1GC6A 1V9JA 4KVGB 4GXBA 2D11A 4EEWA 2O6VB 2G4DB 1KM7A 3ZTCA 4EFOA 2RR9A 3VQIA 4HVBA 1YIWA 2MA9B 1WGDA 2ZJDA 1F9JA 1WJNA 1YQBA 2LGXA 2NS5A 1WFYA 1Z2MA 2GBRA 1OEYJ 4HWIB 4FN2A 4KV2A 2K39A 4HCNB 4W9HA 3A9JA 3QARA 2HD5B 1NDDA 2NPTA 1VD2A 1IP9A 2ASQA 1Q5WB 3RULA 3VXWA 2MP2B 4W9IA 1L7YA 4M8NA 3DVNU 2L8JA 3PT2B 2M1MA 2MW5A 2KTRA 2RPQA 1XT9B 2BYVE 2N4FA 2A5UA 5AZFA 3Q3JA 1WMHA 5IA7A 2JZZA 1V2YA 1WI0A 3O65B 3WA0A 4NJ6A 1FXTB 2NVUI 1JRUA 2GBMA 3AXCA 4HPLB 3SDLC 4IWOA 3VFKA 1I35A 4GMVA 3X0WA 2AYOB 3HHMA 4ICVA 2NBVB 4CYEA 2CHZA 2ZVOA 1A5RA 1NBFC 1UBIA 5FR6A 4JQWC 2FCMA 4AJYB 2KFKB 3M62B 3NZUA 4WJPA 3EHVA 5G55A 1RLFA 1J0GA 2IY0B 4KDLB 5LLIA 4BOSC 2IO3B 3B1LX 1SE9A 2AEHA 1S3SG 2L3ZA 2ZVNA 3ZRFA 1E8YA 3V60A 3X23A 3A9KB 1Q0WB 4A3OA 4DHJB 4EZKA 2O2VB 3GZNI 2LD9A 4X57B 2DAFA 1QZEA 2V3SA 2CKHB 2ZPYA 5E6OA 2L76A 4W9EA 4BKSD 2JRIB 4NJ7A 2BWES 4ZRKA 1XQQA 3ZDMC 1T0YA 4BOZB 1WJ4A 1ZGUB 3NOBA 4K7WA 1WGRA 2K8CA 4EKUA 1GUAB 2K25A 3IBEA 1IPGA 1TGZB 1YX6B 4W9JA 4WJQA 3U7DA 2GBNA 2WWZA 1TBEA 1C1YB 3EFUA 2KOXA 2C9WB 2MLBA 3DDCB 3TCAA 3ML9A 2DAJA 1E8XA 4ZRJA 1WZ3A 3MTNB 4OVVA 4IWPA 5JHAA 1WJUA 1E8ZA 2GBJA 4HPMB 4NQLB 2I1JA 4HDQA 3JSVB 1I42A 2KTFA 3QHTA 5L83A 4K1RB 4DHJD 3OJ4B 5C1ZA 2DZIA 1WX9A 2K6DB 1WXAA 2FIDA 4K7UA 5AZGA 4HXDA 1TTNA 4MJSB 3SD5A 1J8CA 4LDTB 2FAZA 3B0AA 3HK0A 4AOFA 4FADA 2ZNVC 3OLMD 3VVWB 4KZCA 1E5WA 1WJ6A 4WJNA 1KOTA 2G45B 3DBRI 1J19A 4FULA 4TUUA 1WXSA 2BYFA 1R4NI 2HTHA 4IC7B 3IG3A 2WDTB 2Z59B 3NHEB 2MRPA 5DPTA 3KUZA 2L0TA 2LUEA 3PTFC 4MGIE 4CO7A 2KD0A 4FJZA 3T8MA 2NBWB 4AP4C 4GSWA 1OGWA 4GN1A 3V61A 4IG7B 1H4RA 3DQVA 3ZW3A 4ICUA 3A4SC 3SU8X 2KWCA 3VTWA 4CHKA 4BBNC 3PLUA 4BKTA 4GGQA 3A1QA 3P2BA 3VH3B 2KK8A 5EDSA 2LVOA 2OJRA 5DPRA 2IYDB 3K9PB 4HJKA 4LDTD 4W9CA 3H9DA 3WAPA 2DZMA 3QIJA 3RCZA 4FA6A 4EOYA 4RM9A 4MDKE 3R7QA 3WALA 2M8SA 5JH5C 1V80A 4LCDE 2LI5A 2KC1A 2D10A 4W9FA 2C7NB 4HK2A 2BKFA 3PPAA 3TIXA 3JYUA 3AU5A 3W1SA 4DDGD 2KX3A 3HM6X 2LVQA 3ZO5B 2GOWA 4NNJB 4AJWA 2ZCBA 3WAMA 4GDKB 2YVCA 1WY8A 3L10B 2DYBA 3PGEA 2KHWB 1E90A 1GG3A 4KIKA 2MBHA 4RM8A 4AWJA 3TMPB 1WMHB 5LXIB 2KFJA 1UELA 4HDOA 2IBIB 1WM2A 5E6NA 4K81A 3VUXA 3APCA 2KWVB 4I6PA 2DZJA 5LXHA 1Z5SB 4MEMA 1HE8A 4F7ZA 1EUVB 3V6CB 4ASWC 2MQJA 1WE7A 3KUCB 1WIAA 4XZ4A 4PS7A 2LJ5A 4MSMB 3PV1A 2FIFA 3QCAA 4FLHA 3DOWA 3WIMA 3ZNZB 4NPNA 3QK0A 4A3PA 2O6VA 2WX1A 2ZEQA 4PS3A 3ZIMA 4ANWA 3ZTDA 3K9OB 2KQ7A 4DWFA 2BWFA 3OAWA 1Y8RC 3VUYA 4XX5A 2PE6B 3ECIA 2GMIC 4NAWA 4FHKA 2EKEC 5IAAC 4IM2A 3W1YA 1Q1OA 4GOCA 2J0KA 3PHXB 2JPHA 4A20A 1RRBA 3KW5B 3M95A 5BO4B 1WXMA 3AI5A 3H7PA 3QQ8B 4IM3A 4NY0A 3VAWA 1LM8B 1SIFA 4HLEA 4BFRA 2L7RA 4BBNF 2CS4A 1P98A 2KXJA 3DPDA 3PHWB 2EMSA 3DVGY 4MELA 3RYTA 2PJHA 5D94A 1LXDA 4W9LA 1CMXB 3T9LA 3C0RB 3UIPB 4GDLA 3S2AA 3L08A 2L05A 3U30A 1OEYA 2C5LC 2IY1B 1EF1A 2JF5A 2KDFB 1G6JA 1E7UA 3BY4B 1OQYA 1KLVA 1GNUA 2ZZPB 3ZUNA 2L0FA 3PRMB 2JZ3B 4MM3A 4I6LB 2GBKA 3ALBA 2FUHB 1SGHA 1V86A 2V1YA 3ZKJC 2ZNVB 2BF8B 5J2RA 2JXXA 1WXVA 1WH3A 2R2OA 3SHQA 3QA8A 2PPHA 3UINB 3BINA 3KUDB 3RZFA 3APFA 5CHFA 4TQ1A 1WYWB 1PQSA 3A9KA 2ZCCA 4RMAA 1H8CA 2KMCA 4ANUA 4FJVB 3VDZA 2KX0A 1ZKHA 3ZNID 1WGGA 3AU4A 4KZ0A 3KYDD 3HIZA 3B08A 2FNJB 5C23A 3JW0X 1R4MI 2PE9A 3N32A 1L2NA 2N9PC 3GOEA 3ZNGC 1V6EA 2KJHB 2KDBA 3R66C 1E8WA 2MSED 2KDEB 3LJ3A 3CSTA 1NI2A 1WX7A 2KJRA 2W9NA 3ONSA 3A1QB 1BT0A 4WAAA 4KDIC 2IO1B 3CMMB 2N1VA 2K8HA 2KDIA 2MX2A 2K8BA 3NZSA 4I6NB 3IFWB 4OVUA 3UQBA 2CR5A 4KSLC 5D2MB 3DCGA 2KN5A 2ZPNA 3JSVA 4F1SA 3NS8A 2N7EA 2DX5B 2NBUA 5G2NA 4E3CA 2UYZB 2QHOA 3PZDA 3ZRCA 2Y5BB 2XEWA 4B95A 5L95C 2LXAA 2BGFA 2WYQA 3DBLI 1GC7A 3KYCD 4ZRIA 2PEAA 4J6IA 2KZRA 4G0NB 2RD0A 2N9EB 4MJSA 2CU1A 3CF6E 1WX8A 3JVZX 3MJWA 3MHSD 3A9JB 4KIKB 2M17A 2JVCA 2NPTB 3QAQA 4JIOU 1P1AA 4PYUA 3I3TB 4ZDVA 2IO0B 2J0MA 2DYOA 3DVGX 4MSQB 3L13A 3H7SA 2DHZA 5KHQA 2REXA 4TQ0A 1RAXA 2AL3A 4G50A 2FCQA 2JY6A 2HE7A 3PLVA 2KTRB 3IVFA 2M0XA 3V62A 3N3KB 3W1SC 2LVPA 3N30A 1IYFA 2IZVB 3DBSA 3L54A 4AUQC 5D6JB 3LDZE 3QX1A 3QC8B 2KJ6A 4HCPB 4LJPB 3RZWC 3TBLD 4N9F4 4DXAB 1E7VA 2BKRB 2N9XA 3Q3FA 4TKNA 3TJPA 2XK5A 3IHPC 4P7IA 3VTUA 2CHWA 2G3QB 2K6QA 2L00B 3PRPB 5TR5A 3PREA 4F8CB 1D3ZA 2UWQA 4W9GA 2LRUA 4NAWB 2DYMA 3APDA 3DVNV 4JGHB 2YLMA 3QWZB 3UF8A 1EO6A 5AEKB 5JZEB 2KMAA 1P9DU 4MGYE 1LFDA 1S1QB 2DZKA 1TZ1A 3H7PB 4FJYA 3UIOB 2KNBA 5D7GA 4DHZE 2AL6A 3L16A 1UD7A 2BYEA 2D2QA 2DENB 1WZ0A 2MBOA 4ANXA 2MBBB 4ZYNA 4E71A 2IO2B 2MCNB 1WM3A 4GDKA 4W9DA 5J17A 2B3AA 2K1FA 1X1MA 3EECA 2N7DA 4GDLB 4PS8A 4BVUC 4DHZB 2EMTA 1V5OA 2KVRA 2V4LA 1U4AA 1UBQA 2MWSB 5HKHA 2RSUA 2VRRB 2O6VD 3WAOA 4PYZA 2MP2A 4MGZE 3VTVA 3L17A 3DBHI 3PSEB 1V81A 4M0WB 2J0JA 3WANA 4LJOB 4BKSA 2JT4B 1XD3B 3RUIB 2R2QA 2KANA 2LWPA 4IW0A 4DDID 3HM3A 2KC2A 2FCNA 3VUWA 4B6WA 2KQSA 2M4NA 1ZW7A 4G3XB 4URKA 2LZ6A 5CHWA 4MGKE 5KHOA 3VH4B 2BPSA 1MG8A 2MBQA 5JHBA 2KFKA 2KLGA 3RD2A 3D32A 4ANVA 5CX3A 2KLCA 1WGYA 4WWNA 1LQBA 1YJ1A 4FBJB 2XBBC 1RFAA 2C60A 2J7QB 4JLCA 2JWZA 3U8ZA 2CHXA 2C7MB 2C7HA 4NQKE 1UZXB 2LGDA 3KH0A 4JL9A 4MH0E 4TV3A 5E6PA 3VHTC 2JUOA 3H1UA 1V5TA 2O2VA 3V6EB 1C3TA 1M94A 1WE6A 2KO3A 3PRZA 1K8RB 2OOBB 3H6NA 2G4SA 1V49A 1WR1A 3NY5A 2LGYA 3PVLA 3AULA 4EUTA 1GJZA 3ZNHB 5AZHA 5J18A 2KWUB 4IWQA 4WWPA 1P0RA 1WR6E 2AWTA 3L0WB 5GMVA 5DPSA 4FHJA 4II2B 4IUMB 4GB9A 5CTRC 1YD8U 2Z0EB 3M3JA 3PS6A 4GU2A 3R7RA 2JRHA 4W9KA 3UQAA 5DPWA 3ENEA 4DBGA 3A33B 4II3B 2FCSA 4WJOA 1OTRB 4WWOA 3OJ3A 1P3QU 3EC8A 2LXCA 2NCNA 2HJ8A 1KJTA 3UGBB 3A4RA 4K7SA 2NR2A 2RGFA 1VCBA 3M63B 4YL8A 3ML8A 3ZVVA 4B9KA 1YX5B 2LASA 1ISNA 4BKGA 3KVFB 2I1KA 3QJZA 1WF9A 4IM0A 2D3GA 4G11A 3TL5A 2MBEA 4EZJA 3RT3B 1EF5A 3ZLZA 2D07B 2A4ZA 2KKCA 2WX0A 4E74A 4XC2A 1UGMA 4GIVA 4M8MA 5DCNA 3ZDTA 4DK5A 1WRDB 2Z0DB 2XK5B 1UH6A 1WGHA 2LRWA 2N1WA 5CHVC 4EZLA 3R3MA 1AARA 4WQOB
chains in the Genus database with same CATH superfamily
4KSKC 4A8XC 4KVGB 4EE2A 3P4QB 5AUIA 2D11A 4P6VF 4EFOA 3UI3A 3VRAB 1SIJA 1YQBA 2NS5A 1KRHA 1PGXA 2K22A 1VD2A 3NJTA 1WSPA 3VXWA 2MP2B 3BK2A 5IO9A 1ZDVA 2KQ4X 2NTSA 1E9MA 4WURA 2KTRA 2JZZA 4HPLB 1JRUA 1I35A 2AYOB 3I57A 1R7SA 4CYEA 4BAXA 3U7ZA 1A5RA 3P4RB 1NBFC 5LNK1 1YN4A 4WJPA 5G55A 1LGRA 3Q6BA 2IY0B 2AEHA 2IDYA 4RNAA 1JQ4A 5G5HA 3KWLA 4DHJB 3GZNI 2LD9A 2ZPYA 1YN5A 4BKSD 4W9EA 4ZRKA 2BT6A 3DBLB 4K7WA 1WGRA 2WXPA 2K25A 1OQRA 3IBEA 1IPGA 1TGZB 1YX6B 4WJQA 3U7DA 2KOXA 2C9WB 2MLBA 3Q8FA 2RDBC 3ML9A 2DAJA 5JHAA 1AYFA 1I42A 4RGTA 2BB6A 4K1RB 1VZ6A 3OJ4B 2N9LA 1UUPA 1WX9A 2FIDA 4K7UA 3Q69A 1T3QA 2RMMA 1XF5L 4LLGM 2ZNVC 3OLMD 3VVWB 4KZCA 3FAHA 1WJ6A 1J19A 1WXSA 2INCC 3Q3NC 3IG3A 3NHEB 2MRPA 5DPTA 3FKYA 3T8MA 3ZQ4A 4GSWA 5C2TB 4IG7B 1H4RA 3ZW3A 2KWCA 2GI9A 3VTWA 2RDGA 3VH3B 2KK8A 5EDSA 2OJRA 1E6EB 3PZ7A 2VZKB 2DZMA 3WAPA 2AX5A 4MDKE 3WALA 1C4AA 2BKFA 3PPAA 1MHHE 1HA5A 1UF0A 3JYUA 3RNAC 2GOWA 5TSSA 4AJWA 2ZCBA 3WAMA 1V97A 4GDKB 1WY8A 3L10B 3AE5B 2KHWB 3IT4B 2MBHA 5LXIB 2DWQA 1Z5SB 4MEMA 3AE3B 4S0RA 4F7ZA 1EUVB 3R8BA 1WE7A 1WIAA 4MSMB 1C9FA 3DOWA 2KMMA 3BWUD 3NG0A 4NPNA 5GXGB 1R4MB 4PS3A 4ANWA 3ZIMA 3ZTDA 3K9OB 3OAWA 1N6ZA 1IBXA 3VUYA 2L52A 4XX5A 3ECIA 2X8XX 4IM2A 1Q1OA 2J0KA 1D5XC 1NEKB 4A20A 1RRBA 3M95A 1WXMA 4NY0A 1LM8B 1SIFA 1C4CA 2CS4A 4MELA 2PJHA 4C4VB 2ZZPB 4CQNA 1IGCA 3PRMB 2GBKA 3ALBA 3ZKJC 2ZNVB 5J2RA 3BVMA 1WH3A 2ON8A 3IXSA 3Q2AC 4PK1A 2PPHA 3Q8EA 3BINA 5CHFA 4XDDA 4TQ1A 1YNTE 1SE2A 3A9KA 1H8CA 3AEDB 1RM6C 2Y5PA 2IPKD 2M56B 3MC0B 3ZNID 4KZ0A 1FRDA 2UU7A 1RWSA 1RYJA 5HFYA 1V1OA 1R4MI 1L2NA 3GOEA 1E8WA 2KDEB 3OWEB 3CSTA 3LB8C 1V1PA 3A1QB 4WAAA 4KDIC 4HPPA 2K8HA 1FNVA 3UQBA 5HHDG 3IFWB 4F1SA 2D3BA 3Q3MC 2UYZB 2QHOA 3PZDA 1A70A 1I7HA 4MJSA 4C00A 1WX8A 4N6EB 4A55A 4KIKB 1JWMD 2JVCA 2NPTB 2WS3B 4ZDVA 4MSQB 2PVOD 2REXA 2JY6A 2HE7A 1TIFA 3IVFA 2LVPA 1IYFA 4AUQC 4O1NA 3IT6B 1EWCA 2BS3B 4N9F4 4XWTA 1NYQA 1E7VA 1KH0A 4H2AA 4P7IA 3PRPB 3RNCC 4W9GA 2LRUA 5AUKA 4R3DA 1WGKA 4JGHB 3QWZB 5JZEB 1P9DU 3H7PB 5I4DA 5D7GA 2AL6A 2DENB 1WZ0A 2MBBB 5JXVA 3J9CA 4C56C 4ZYNA 2KVZA 2PW9A 1K52A 1WM3A 5J17A 2CU3A 2Q5WD 2N7DA 2QDFA 3SEBA 2MWSB 1UBQA 5HKHA 4N58A 3WAOA 3VTVA 3L17A 2DLBA 2OJWA 4L23A 3V05A 1V81A 3WANA 4QAYA 4YTMB 2JT4B 2LWPA 4LNKA 2KQSA 2WDVB 3ABVB 1N5XA 1XCTL 5CHWA 3W5VB 2KFKA 4ANVA 5CX3A 4WWNA 1LQBA 4ZRPA 2J7QB 4JLCA 2JWZA 4NQKE 2C7HA 4MH0E 4JL9A 1N60A 3VHTC 3H1UA 3V6EB 1C3TA 1M94A 1WE6A 2LGYA 2LMCA 1GJZA 4C7ZA 2DNFA 2JWUA 2J42A 3KLSX 1QOAA 1P0RA 4ZHOA 1YQ3B 4II2B 2JRHA 4W9KA 5DPWA 4DBGA 4WJOA 1OTRB 2GB1A 2G9HD 1P3QU 3TSSA 1TS3A 2LXCA 2NCNA 2E3TA 3ZXVA 3A4RA 2PMVA 2RGFA 1VCBA 2JSVX 3I9V1 3ML8A 4BKGA 1JRPA 1SE4A 3HUIA 1WF9A 4AQ7A 2D3GA 3AN1A 4G11A 4EZJA 3RT3B 3ZLZA 2A4ZA 2KKCA 2WX0A 1SSNA 1UGMA 4JX1C 3ZDTA 2NTTA 2PKOA 3BZDB 4M02A 1WGHA 4M01A 3TEWA 4DXFA 3AE8B 3ZYYX 1D4BA 2MJDA 4N59A 1GC6A 4KX6B 2G4DB 1KM7A 3T3NA 2RR9A 2ZJDA 1F9JA 3N20C 1Z2MA 4DXGA 1ZOYB 2V9HA 1GB1A 3BVGA 1PYWD 4HCNB 3QARA 2HD5B 1FM0D 2ASQA 1Q5WB 2CJNA 4W9IA 1Y56A 1L7YA 4M8NA 3DVNU 4ZHPA 2MW5A 2BYVE 2WXJA 2BYTA 3Q3OC 3Q3JA 1WMHA 4ACFA 1V2YA 1WI0A 1AWDA 1ZE3D 2NVUI 3SDLC 3VFKA 3HHMA 4ICVA 1DYQA 2ZVOA 1BMLC 1CQVA 3SFDB 1UBIA 3DBRB 1VZ8A 3M62B 1J0GA 4KDLB 1SE9A 1S3SG 2RPVA 3AE6B 2WP9B 3X23A 3DHHC 3CIRB 4OHJA 2WXQA 2O2VB 4X57B 2BS2B 4US8A 2JRIB 2BWES 1XQQA 3ZDMC 4BOZB 2AQ1B 1ZP0B 3EFUA 5IP4D 4OZBA 2L1AA 1E8XA 3P4PB 4ZRJA 1WZ3A 5BMGA 2V3NA 2KT7A 1WJUA 1E8ZA 5T8IA 5C3JB 3JSVB 4D2KA 4DHJD 3EUB2 2DZIA 4HXDA 1J8CA 1C78A 4LDTB 2FAZA 3B0AA 4L1BA 4AOFA 3AE7B 4RF1A 4OZCA 2I38A 1J7BA 1KOTA 4K3CA 2G45B 3NUHB 3DBRI 1YN3A 1YJIA 2X38A 1I4HA 1QILA 2LUEA 3PTFC 4CO7A 2NBWB 4AP4C 3RI7C 2W3SA 2BQQA 4YSZB 2ZW1A 3AE1B 4ICUA 4BBNC 1FXAA 1PUTA 1QOFA 4XDCA 4W9CA 3H9DA 4FA6A 2Y5CA 2M8SA 1D6EC 5JH5C 2LI5A 4OVZA 3BVZA 4DDGD 1E0ZA 2M19A 1GPXA 2LVQA 3ZO5B 4NNJB 3URYA 2JYTA 3RNGC 2D3CA 3PGEA 1GG3A 3TMPB 3ZJTA 1UELA 5E6NA 2IBIB 3VUXA 4K81A 4I6PA 4OW0A 2DZJA 3KWVA 3RPFC 2GLSA 3AE2B 2IGGA 1DOIA 1FCLA 3ZJUA 2VZKD 2W82A 3B2GA 1SF0A 2WDRB 1PGAA 2WX1A 5EE1A 2KQ7A 2BWFA 1Y8RC 1JALA 2GMIC 1D5ZC 4NAWA 4GOCA 2JPHA 1UWMA 2PIAA 5BO4B 3VAWA 3QQ8B 2K0PA 4BFRA 1XO3A 4BBNF 4IKGA 3Q14C 1P98A 3PHWB 1YJJA 2EMSA 3DVGY 5D94A 3T9LA 4GDLA 3MHZA 3U30A 4M00A 5IN7A 3SR6A 2IGDA 2JF5A 3DWMA 1E7UA 4JWUC 2SEBD 2L0FA 1STEA 1SGHA 4M0WA 3EGRA 2R2OA 3DWGC 3SHQA 4LNNA 3RZFA 4HJGE 2D3AA 1LO5D 5BYQA 4FJVB 1GAQB 4A9AA 3KYDD 1FXIA 3HIZA 2FE8A 1K50A 1ZXIA 2QJLA 2FUG1 3N32A 2N9PC 3ZNGC 4C80A 1E7PB 1ZXHA 1NI2A 2W9NA 1AN8A 2KDIA 1WXQA 5E6JA 2N7EA 1JROA 2DX5B 4RGOS 2Y5BB 1P7EA 4B95A 3DBLI 1GC7A 4ZRIA 2PEAA 3DBHB 2W55A 4G0NB 1MJDA 1NVID 2CU1A 3A9JB 4HKQA 1HZ6A 2ICIA 2V3PA 3L13A 2QILA 3AH7A 4TQ0A 2AL3A 1L4DB 3N3KB 3W1SC 5D6JB 4KGRA 3QC8B 2KJ6A 1QT9A 4LJPB 1C76A 4DXAB 2BKRB 2N9XA 2OEDA 2XK5A 3IHPC 2CHWA 4JWSC 5D3DA 5TR5A 3ETRA 1IBXB 2DYMA 2I2YA 3DVNV 4JPSA 4B0EA 2G1EA 1N62A 5AEKB 2KMAA 2DZKA 1CJEA 1QOGA 1S1QB 2V0GA 1KLUD 4KKJA 2HJ1A 3AEAB 2BYEA 3PO0A 4YWGG 1IGDA 2WDQB 3NVYA 4GDKA 4BVUC 4PS8A 2EMTA 1V5OA 2KVRA 1U4AA 1TS2A 3U2SC 3L4PA 2O6VD 3DBHI 3PSEB 4BKSA 4LJOB 2R2QA 3MC9A 2LHEA 4DDID 1TKEA 2AQ3B 3HM3A 3P1MA 3VUWA 1FMAD 3W2DA 4B0MA 4MGKE 5KHOA 2E6XA 5JHBA 3TEZA 3RD2A 1WGYA 2C60A 2CHXA 3GE8C 1MG4A 3RN9C 3NS1A 3ZJVA 4HKZE 1V1PB 2G4SA 3NY5A 3AULA 2IJ0A 1ENFA 3N1XC 4EUTA 3B2FA 4HEA1 4C4VA 5AZHA 1XLNA 4KKIA 1C4PA 4WWPA 3U4EG 1I4PA 1WWTA 3R7RA 4GB9A 5CTRC 2CJOA 3ENEA 4RGMA 3A33B 4WWOA 3OJ3A 3VR9B 3EC8A 2NR2A 1P7FA 3M63B 4WIPA 3RNFC 4B9KA 1YX5B 1ISNA 2INNE 2I1KA 5MPOA 1F1HA 2JU6X 1EF5A 4PT5A 5DCNA 2WLBA 3AE4B 2WXGA 1QQRA 1UH6A 2LRWA 5CHVC 4EZLA 2INPE 3R3MA 1EM7A 1AARA 1FFVA 1V8CA 1JW9D 2H89B 3EFCA 3CSFA 4OZAA 3Q8AA 4NJCA 1T5XD 1JWSD 4MH8A 4GXBA 4EEWA 2O6VB 3FILB 3AECB 1WYGA 5BYSA 3ZTCA 2D5GA 3VQIA 2MA9B 2LGXA 3MFGA 4RGNA 1WFYA 2GBRA 4HWIB 4FN2A 4KV2A 2K39A 4W9HA 1NDDA 2NPTA 2JQRB 3RULA 1E10A 2YEPB 2L8JA 3RNEC 3CWIA 2JZPA 1M4VA 2RPQA 1F0ZA 2N4FA 5AZFA 5IA7A 3N9YC 4NJ6A 1FXTB 2GBMA 3AXCA 1SE3A 4IWOA 4GMVA 3X0WA 2NBVB 1UWXA 4JQWC 2FCMA 4AJYB 2KFKB 3NZUA 1R4NB 3EHVA 4BOSC 5LLIA 2IO3B 2L3ZA 1E8YA 5FR3A 4DQOC 1Q0WB 3LXFA 4A3OA 1QZEA 2L76A 4L2YA 4NJ7A 3NOBA 1GUAB 1FRRA 2GBNA 1C1YB 1TBEA 3DDCB 1XCQL 4A6QA 1XEEA 2W54A 1SJED 2GBJA 3AEBB 4HPMB 1HXYD 2QSDA 5D3IB 1PGBA 1MPEA 5L83A 4K3BA 1T0SC 1QOBA 2BW2A 4YSYB 2J53A 2K6DB 1TTNA 2AQ2B 2ACZB 3SD5A 2N9KA 1E5WA 3MJ5A 4TUUA 5IOIA 1R4NI 3HVDA 2WDTB 2Z59B 2WXHA 2V4IB 2L0TA 2KD0A 4FJZA 3V61A 1OGWA 1HQRD 4GN1A 3DQVA 1ESFA 3SU8X 5EE0A 1TYGB 3P2BA 3GP7A 1QKZA 5DPRA 2IYDB 4HJKA 4LDTD 3NZ3A 3QIJA 3RCZA 4RM9A 1V80A 4LCDE 2C7NB 5HI1A 2BBCA 4JE3B 2KX3A 1UGJA 2NMQA 3BK1A 1HEZE 2YVCA 4USAA 1DGJA 4RM8A 1HTQA 1WMHB 2ONQA 1CZPA 4UDUC 2KFJA 4HDOA 1WM2A 2WXIA 1ZPSA 1HE8A 4ASWC 3KUCB 1UNSA 4PS7A 1HZ5A 3QCAA 3ZNZB 2XN9C 3QK0A 2ZEQA 2PE6B 4FHKA 5IAAC 3W1YA 3PHXB 2MHJA 3KW5B 3AI5A 4IM3A 1T6BX 4HLEA 2L7RA 2KXJA 3DPDA 1LXDA 1CMXB 3S2AA 2IGHA 2K9XA 3W9CB 1OEYA 2C5LC 3WCQA 1EF1A 2KDFB 1I4GA 4MM3A 2JZ3B 1VDVA 3IAS1 1DOXA 1GOZA 3AE9B 1JCKB 2WQYB 3KUDB 2WXFA 1IUEA 1PQSA 2ZCCA 4RMAA 2VH2A 1J7AA 2KX0A 1EU3A 2H88B 4YT0B 1MVKA 1SJHD 2FNJB 5C23A 3ZXRA 3JW0X 1J7CA 3TEYA 1K53A 1T0RC 3LJ3A 4ZRQA 1SEBD 1C77A 1VR9A 1WX7A 1BT0A 4A90A 2IO1B 3CMMB 2K8BA 3NZSA 4I6NB 4OVUA 5H8YE 1GB4A 4FXCA 2CR5A 3LYYA 2ZPNA 3JSVA 3NS8A 4HRSA 1JWAD 5G2NA 3SFEB 5L95C 2LXAA 2BGFA 2KN4A 2WYQA 2J4XA 3KYCD 2KZRA 2RD0A 4IOIE 2MH7A 3MJWA 3JVZX 2KACA 3MHSD 2WU5B 2LEKA 3PZ8A 3QAQA 4PYUA 1P1AA 2J0MA 2DYOA 3C19A 1DOYA 5KHQA 1RAXA 3R2IA 2FCQA 3PLVA 2KTRB 3V62A 2BTEA 1FFUA 3N30A 1FNWA 3LDZE 3QX1A 3RZWC 3TUOA 4TKNA 1N63A 3TJPA 2LHDA 2G3QB 2K6QA 2L00B 2WXKA 1F2RC 1TZOA 4LNOA 4F8CB 1D3ZA 1I4QA 2JX5A 2WGSA 4NAWB 3I63C 3APDA 4MT5A 2YLMA 1FO4A 4MGYE 1LFDA 4ZOHC 3L16A 1UD7A 2MBOA 2ZW0A 4ANXA 4E71A 2IO2B 3AV8A 3N1ZC 1L6VA 1I4XA 1KFYB 4HROA 3EECA 1NENB 4GDLB 4DHZB 4S17A 2RSUA 2VRRB 1PDXA 1YMHE 2MP2A 4MGZE 1YOVB 1RFKA 3P63A 4M0WB 5EE3A 2KANA 4B6WA 2PLPA 1SBBB 1ZW7A 4IDIA 1JWUD 3VH4B 2BPSA 2WXNA 4RF0A 2KDMA 2KWDA 2KLCA 4TSSA 1RFAA 3U8ZA 2C7MB 2LGDA 1BUIC 2INDC 3KH0A 4TV3A 5E6PA 2WXMA 2K3UA 4LK0M 2KO3A 1K8RB 1V49A 3PVLA 4ITKA 2KWUB 4XYCA 5EE9A 4IWQA 1MFWA 1C79A 3IAM1 1D5MC 4IUMB 3M3JA 1VZ7A 4II3B 2FCSA 3C8YA 3NRZA 1WRIA 2HJ8A 1XLOA 2J52A 3UGBB 2M0AA 2MJEA 4YL8A 3ZVVA 2LASA 3KVFB 4REZA 4IM0A 2LUMA 1TKYA 1NI3A 2MBEA 4C7YA 2D07B 4XC2A 4GIVA 4M8MA 1EWYC 4DK5A 3EA6A 2XK5B 2N1WA 4WQOB 1SB3C 3P42A 4ZYSA 4XWWA 1V9JA 1F77A 1CK1A 4HVBA 1YIWA 2KAJA 1WGDA 2LGIA 1WJNA 3BIID 1OEYJ 2PVGC 3A9JA 3T3OA 1IP9A 4LNIA 3PT2B 2M1MA 2R61A 1ET6A 1XT9B 3NVVA 2HTME 3V3XA 2A5UA 3WA0A 3O65B 1L4ZB 4YSXB 2CHZA 3AEGB 5FR6A 2WXRA 1L0YB 2QMTA 1RLFA 1F2RI 3B1LX 2ZVNA 3ZRFA 3V60A 1PFDA 3A9KB 2QC8A 4YTPB 1XLQA 4EZKA 2DAFA 2V3SA 2CKHB 5E6OA 1QF6A 1T0YA 4P1CC 1WJ4A 1ZGUB 2SAKA 2K8CA 4EKUA 1XXGA 1TKGA 4W9JA 4US9A 2WWZA 2WU2B 3GS2A 3TCAA 1FIQA 1FCCC 3Q8CA 3MTNB 4OVVA 4IWPA 4KGTA 3VR8B 4NQLB 2I1JA 4HDQA 2KTFA 4P1BC 3QHTA 1ZDXA 5C1ZA 1B9RA 3N1YC 2RDHA 1WXAA 5AZGA 5H92C 4MJSB 3HK0A 4FADA 3RNBC 4MACA 4WJNA 4NAMA 1B1ZA 1BXTA 2Y3AA 3RFZB 4FULA 2BYFA 1MHXA 2HTHA 1ROEA 2WXOA 3E9SA 4IC7B 3KUZA 2YEPF 1FPYA 4MGIE 1L5PA 2QCZA 1TJEA 3KQ4A 1T0QC 3A4SC 4CHKA 3PLUA 4BKTA 4GGQA 3A1QA 2XNAC 2LVOA 2L32A 2LGSA 5IKCM 3K9PB 3OG5A 3AEEB 3Q8BA 4EOYA 3R7QA 3ZGZA 2KC1A 2D10A 4W9FA 3TIXA 4HK2A 3AU5A 3W1SA 1VJKA 1XLPA 3HM6X 4P16A 2W3RA 3GB1A 4NZLB 2DYBA 1E90A 4KIKA 4AWJA 1TY2A 3NVWA 3APCA 5BYRA 2KWVB 5LXHA 4YTNB 3V6CB 2MQJA 1JWBD 3MP9A 4XZ4A 2LJ5A 3PV1A 2FIFA 4FLHA 2OHFA 2WNMA 1KLGD 3WIMA 3MC8A 3U52E 4A3PA 5HG2A 2O6VA 3FILA 2EELA 4DWFA 4Q2JA 4XE0A 2EKEC 3H8HA 3H7PA 1HTOA 1KF6B 1K51A 3RYTA 3AM9A 4W9LA 3UIPB 3C0RB 4RH6A 3L08A 2L05A 2L83A 2QIEB 1N5WA 2IY1B 3BYTB 2K5PA 3BY4B 1G6JA 1OQYA 1KLVA 1GNUA 3ZUNA 1QLBB 4I6LB 4AS1A 4YXDB 3P4SB 2FUHB 1V86A 2V1YA 2BF8B 2JXXA 1WXVA 2BVCA 4BZAA 3QA8A 3UINB 1SXTA 3APFA 4WH4A 5G5GA 1WYWB 2VH1A 4KGSA 2KMCA 4ANUA 3VDZA 1ZKHA 5BMHA 1WGGA 3AU4A 3B08A 4WAFA 3GE3C 2PE9A 1V6EA 2KJHB 2KDBA 3R66C 2MSED 1ACCA 1JMLA 4WWMA 1FD6A 1F52A 2KJRA 3ONSA 4WQMA 2MEKA 2N1VA 2MX2A 4KSLC 5D2MB 3DCGA 2KN5A 1VRAB 2NBUA 4E3CA 3ZRCA 3TEXA 2XEWA 4RCOA 3BYYB 4J6IA 3RMKC 2N9EB 1OQQA 3CF6E 2LFIA 3O13A 1TS5A 2M17A 3DHIC 4JIOU 3I3TB 2IO0B 3DVGX 1ET9A 2BS4B 1ZUD2 3I5JC 3H7SA 2DHZA 4G50A 1L0XB 2N0SB 2M0XA 2IZVB 3DBSA 3L54A 4HCPB 3TBLD 2GRIA 3Q3FA 3VTUA 1KTKA 2B76B 1TT5B 1AW7A 1VLBA 1TS4A 3VRBB 3PREA 2UWQA 1TY0A 1YQ4B 3UF8A 3HVZA 1EO6A 1L6UA 5FKAC 1TZ1A 4FJYA 3UIOB 2KNBA 4DHZE 2EKIA 3W5UB 2D2QA 4J3OD 2MCNB 4W9DA 2B3AA 2K1FA 1X1MA 2V4LA 2N7JA 5FK9C 4PYZA 1NYRA 1N61A 4ARIA 4MM3B 3R2TA 3E56A 1OFFA 3AMZA 4ARCA 2J0JA 3AB5A 1XD3B 3RUIB 4IW0A 2KC2A 2FCNA 2M4NA 4G3XB 4URKA 2QEJC 2LZ6A 2HDEA 1MG8A 1Q10A 2MBQA 2KLGA 3D32A 3DHGC 4XGAB 1YJ1A 4FBJB 2XBBC 1UZXB 2WXLA 2JUOA 1V5TA 2O2VA 1I4RA 3PRZA 2WHIA 2OOBB 3H6NA 2PTLA 1WR1A 3B9JA 3ZNHB 4TMAB 5J18A 2Z8LA 2TSSA 2FBWB 1WR6E 3L0WB 2AWTA 5GMVA 2KYWA 3FC4A 4LTUA 3NVZA 5DPSA 1MI0A 4FHJA 3AEFB 1YD8U 2Z0EB 3PS6A 4GU2A 5BMIA 2DBYA 3UQAA 4LNFA 1EU4A 2BB5A 1FEHA 1KJTA 4K7SA 3HRDD 3QJZA 4GLSC 3TL5A 1L0VB 2MJ3A 2JYEA 1FNUA 4E74A 2JXTA 1WRDB 2Z0DB 4RFBA 2LJIA 3GZNB
chains in the Genus database with same CATH topology
4KSKC 3CSFA 1GC6A 1V9JA 4KVGB 4GXBA 2D11A 4EEWA 2O6VB 2G4DB 1KM7A 3ZTCA 4EFOA 2RR9A 3VQIA 4HVBA 1YIWA 2MA9B 1WGDA 2ZJDA 1F9JA 1WJNA 1YQBA 2LGXA 2NS5A 1WFYA 1Z2MA 2GBRA 1OEYJ 4HWIB 4FN2A 4KV2A 2K39A 4HCNB 4W9HA 3A9JA 3QARA 2HD5B 1NDDA 2NPTA 1VD2A 1IP9A 2ASQA 1Q5WB 3RULA 3VXWA 2MP2B 4W9IA 1L7YA 4M8NA 3DVNU 2L8JA 3PT2B 2M1MA 2MW5A 2KTRA 2RPQA 1XT9B 2BYVE 2N4FA 2A5UA 5AZFA 3Q3JA 1WMHA 5IA7A 2JZZA 1V2YA 1WI0A 3O65B 3WA0A 4NJ6A 1FXTB 2NVUI 1JRUA 2GBMA 3AXCA 4HPLB 3SDLC 4IWOA 3VFKA 1I35A 4GMVA 3X0WA 2AYOB 3HHMA 4ICVA 2NBVB 4CYEA 2CHZA 2ZVOA 1A5RA 1NBFC 1UBIA 5FR6A 4JQWC 2FCMA 4AJYB 2KFKB 3M62B 3NZUA 4WJPA 3EHVA 5G55A 1RLFA 1J0GA 2IY0B 4KDLB 5LLIA 4BOSC 2IO3B 3B1LX 1SE9A 2AEHA 1S3SG 2L3ZA 2ZVNA 3ZRFA 1E8YA 3V60A 3X23A 3A9KB 1Q0WB 4A3OA 4DHJB 4EZKA 2O2VB 3GZNI 2LD9A 4X57B 2DAFA 1QZEA 2V3SA 2CKHB 2ZPYA 5E6OA 2L76A 4W9EA 4BKSD 2JRIB 4NJ7A 2BWES 4ZRKA 1XQQA 3ZDMC 1T0YA 4BOZB 1WJ4A 1ZGUB 3NOBA 4K7WA 1WGRA 2K8CA 4EKUA 1GUAB 2K25A 3IBEA 1IPGA 1TGZB 1YX6B 4W9JA 4WJQA 3U7DA 2GBNA 2WWZA 1TBEA 1C1YB 3EFUA 2KOXA 2C9WB 2MLBA 3DDCB 3TCAA 3ML9A 2DAJA 1E8XA 4ZRJA 1WZ3A 3MTNB 4OVVA 4IWPA 5JHAA 1WJUA 1E8ZA 2GBJA 4HPMB 4NQLB 2I1JA 4HDQA 3JSVB 1I42A 2KTFA 3QHTA 5L83A 4K1RB 4DHJD 3OJ4B 5C1ZA 2DZIA 1WX9A 2K6DB 1WXAA 2FIDA 4K7UA 5AZGA 4HXDA 1TTNA 4MJSB 3SD5A 1J8CA 4LDTB 2FAZA 3B0AA 3HK0A 4AOFA 4FADA 2ZNVC 3OLMD 3VVWB 4KZCA 1E5WA 1WJ6A 4WJNA 1KOTA 2G45B 3DBRI 1J19A 4FULA 4TUUA 1WXSA 2BYFA 1R4NI 2HTHA 4IC7B 3IG3A 2WDTB 2Z59B 3NHEB 2MRPA 5DPTA 3KUZA 2L0TA 2LUEA 3PTFC 4MGIE 4CO7A 2KD0A 4FJZA 3T8MA 2NBWB 4AP4C 4GSWA 1OGWA 4GN1A 3V61A 4IG7B 1H4RA 3DQVA 3ZW3A 4ICUA 3A4SC 3SU8X 2KWCA 3VTWA 4CHKA 4BBNC 3PLUA 4BKTA 4GGQA 3A1QA 3P2BA 3VH3B 2KK8A 5EDSA 2LVOA 2OJRA 5DPRA 2IYDB 3K9PB 4HJKA 4LDTD 4W9CA 3H9DA 3WAPA 2DZMA 3QIJA 3RCZA 4FA6A 4EOYA 4RM9A 4MDKE 3R7QA 3WALA 2M8SA 5JH5C 1V80A 4LCDE 2LI5A 2KC1A 2D10A 4W9FA 2C7NB 4HK2A 2BKFA 3PPAA 3TIXA 3JYUA 3AU5A 3W1SA 4DDGD 2KX3A 3HM6X 2LVQA 3ZO5B 2GOWA 4NNJB 4AJWA 2ZCBA 3WAMA 4GDKB 2YVCA 1WY8A 3L10B 2DYBA 3PGEA 2KHWB 1E90A 1GG3A 4KIKA 2MBHA 4RM8A 4AWJA 3TMPB 1WMHB 5LXIB 2KFJA 1UELA 4HDOA 2IBIB 1WM2A 5E6NA 4K81A 3VUXA 3APCA 2KWVB 4I6PA 2DZJA 5LXHA 1Z5SB 4MEMA 1HE8A 4F7ZA 1EUVB 3V6CB 4ASWC 2MQJA 1WE7A 3KUCB 1WIAA 4XZ4A 4PS7A 2LJ5A 4MSMB 3PV1A 2FIFA 3QCAA 4FLHA 3DOWA 3WIMA 3ZNZB 4NPNA 3QK0A 4A3PA 2O6VA 2WX1A 2ZEQA 4PS3A 3ZIMA 4ANWA 3ZTDA 3K9OB 2KQ7A 4DWFA 2BWFA 3OAWA 1Y8RC 3VUYA 4XX5A 2PE6B 3ECIA 2GMIC 4NAWA 4FHKA 2EKEC 5IAAC 4IM2A 3W1YA 1Q1OA 4GOCA 2J0KA 3PHXB 2JPHA 4A20A 1RRBA 3KW5B 3M95A 5BO4B 1WXMA 3AI5A 3H7PA 3QQ8B 4IM3A 4NY0A 3VAWA 1LM8B 1SIFA 4HLEA 4BFRA 2L7RA 4BBNF 2CS4A 1P98A 2KXJA 3DPDA 3PHWB 2EMSA 3DVGY 4MELA 3RYTA 2PJHA 5D94A 1LXDA 4W9LA 1CMXB 3T9LA 3C0RB 3UIPB 4GDLA 3S2AA 3L08A 2L05A 3U30A 1OEYA 2C5LC 2IY1B 1EF1A 2JF5A 2KDFB 1G6JA 1E7UA 3BY4B 1OQYA 1KLVA 1GNUA 2ZZPB 3ZUNA 2L0FA 3PRMB 2JZ3B 4MM3A 4I6LB 2GBKA 3ALBA 2FUHB 1SGHA 1V86A 2V1YA 3ZKJC 2ZNVB 2BF8B 5J2RA 2JXXA 1WXVA 1WH3A 2R2OA 3SHQA 3QA8A 2PPHA 3UINB 3BINA 3KUDB 3RZFA 3APFA 5CHFA 4TQ1A 1WYWB 1PQSA 3A9KA 2ZCCA 4RMAA 1H8CA 2KMCA 4ANUA 4FJVB 3VDZA 2KX0A 1ZKHA 3ZNID 1WGGA 3AU4A 4KZ0A 3KYDD 3HIZA 3B08A 2FNJB 5C23A 3JW0X 1R4MI 2PE9A 3N32A 1L2NA 2N9PC 3GOEA 3ZNGC 1V6EA 2KJHB 2KDBA 3R66C 1E8WA 2MSED 2KDEB 3LJ3A 3CSTA 1NI2A 1WX7A 2KJRA 2W9NA 3ONSA 3A1QB 1BT0A 4WAAA 4KDIC 2IO1B 3CMMB 2N1VA 2K8HA 2KDIA 2MX2A 2K8BA 3NZSA 4I6NB 3IFWB 4OVUA 3UQBA 2CR5A 4KSLC 5D2MB 3DCGA 2KN5A 2ZPNA 3JSVA 4F1SA 3NS8A 2N7EA 2DX5B 2NBUA 5G2NA 4E3CA 2UYZB 2QHOA 3PZDA 3ZRCA 2Y5BB 2XEWA 4B95A 5L95C 2LXAA 2BGFA 2WYQA 3DBLI 1GC7A 3KYCD 4ZRIA 2PEAA 4J6IA 2KZRA 4G0NB 2RD0A 2N9EB 4MJSA 2CU1A 3CF6E 1WX8A 3JVZX 3MJWA 3MHSD 3A9JB 4KIKB 2M17A 2JVCA 2NPTB 3QAQA 4JIOU 1P1AA 4PYUA 3I3TB 4ZDVA 2IO0B 2J0MA 2DYOA 3DVGX 4MSQB 3L13A 3H7SA 2DHZA 5KHQA 2REXA 4TQ0A 1RAXA 2AL3A 4G50A 2FCQA 2JY6A 2HE7A 3PLVA 2KTRB 3IVFA 2M0XA 3V62A 3N3KB 3W1SC 2LVPA 3N30A 1IYFA 2IZVB 3DBSA 3L54A 4AUQC 5D6JB 3LDZE 3QX1A 3QC8B 2KJ6A 4HCPB 4LJPB 3RZWC 3TBLD 4N9F4 4DXAB 1E7VA 2BKRB 2N9XA 3Q3FA 4TKNA 3TJPA 2XK5A 3IHPC 4P7IA 3VTUA 2CHWA 2G3QB 2K6QA 2L00B 3PRPB 5TR5A 3PREA 4F8CB 1D3ZA 2UWQA 4W9GA 2LRUA 4NAWB 2DYMA 3APDA 3DVNV 4JGHB 2YLMA 3QWZB 3UF8A 1EO6A 5AEKB 5JZEB 2KMAA 1P9DU 4MGYE 1LFDA 1S1QB 2DZKA 1TZ1A 3H7PB 4FJYA 3UIOB 2KNBA 5D7GA 4DHZE 2AL6A 3L16A 1UD7A 2BYEA 2D2QA 2DENB 1WZ0A 2MBOA 4ANXA 2MBBB 4ZYNA 4E71A 2IO2B 2MCNB 1WM3A 4GDKA 4W9DA 5J17A 2B3AA 2K1FA 1X1MA 3EECA 2N7DA 4GDLB 4PS8A 4BVUC 4DHZB 2EMTA 1V5OA 2KVRA 2V4LA 1U4AA 1UBQA 2MWSB 5HKHA 2RSUA 2VRRB 2O6VD 3WAOA 4PYZA 2MP2A 4MGZE 3VTVA 3L17A 3DBHI 3PSEB 1V81A 4M0WB 2J0JA 3WANA 4LJOB 4BKSA 2JT4B 1XD3B 3RUIB 2R2QA 2KANA 2LWPA 4IW0A 4DDID 3HM3A 2KC2A 2FCNA 3VUWA 4B6WA 2KQSA 2M4NA 1ZW7A 4G3XB 4URKA 2LZ6A 5CHWA 4MGKE 5KHOA 3VH4B 2BPSA 1MG8A 2MBQA 5JHBA 2KFKA 2KLGA 3RD2A 3D32A 4ANVA 5CX3A 2KLCA 1WGYA 4WWNA 1LQBA 1YJ1A 4FBJB 2XBBC 1RFAA 2C60A 2J7QB 4JLCA 2JWZA 3U8ZA 2CHXA 2C7MB 2C7HA 4NQKE 1UZXB 2LGDA 3KH0A 4JL9A 4MH0E 4TV3A 5E6PA 3VHTC 2JUOA 3H1UA 1V5TA 2O2VA 3V6EB 1C3TA 1M94A 1WE6A 2KO3A 3PRZA 1K8RB 2OOBB 3H6NA 2G4SA 1V49A 1WR1A 3NY5A 2LGYA 3PVLA 3AULA 4EUTA 1GJZA 3ZNHB 5AZHA 5J18A 2KWUB 4IWQA 4WWPA 1P0RA 1WR6E 2AWTA 3L0WB 5GMVA 5DPSA 4FHJA 4II2B 4IUMB 4GB9A 5CTRC 1YD8U 2Z0EB 3M3JA 3PS6A 4GU2A 3R7RA 2JRHA 4W9KA 3UQAA 5DPWA 3ENEA 4DBGA 3A33B 4II3B 2FCSA 4WJOA 1OTRB 4WWOA 3OJ3A 1P3QU 3EC8A 2LXCA 2NCNA 2HJ8A 1KJTA 3UGBB 3A4RA 4K7SA 2NR2A 2RGFA 1VCBA 3M63B 4YL8A 3ML8A 3ZVVA 4B9KA 1YX5B 2LASA 1ISNA 4BKGA 3KVFB 2I1KA 3QJZA 1WF9A 4IM0A 2D3GA 4G11A 3TL5A 2MBEA 4EZJA 3RT3B 1EF5A 3ZLZA 2D07B 2A4ZA 2KKCA 2WX0A 4E74A 4XC2A 1UGMA 4GIVA 4M8MA 5DCNA 3ZDTA 4DK5A 1WRDB 2Z0DB 2XK5B 1UH6A 1WGHA 2LRWA 2N1WA 5CHVC 4EZLA 3R3MA 1AARA 4WQOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSK C;  3CSF A;  1GC6 A;  1V9J A;  4KVG B;  4GXB A;  2D11 A;  4EEW A;  2O6V B;  2G4D B;  1KM7 A;  3ZTC A;  4EFO A;  2RR9 A;  3VQI A;  4HVB A;  1YIW A;  2MA9 B;  1WGD A;  2ZJD A;  1F9J A;  1WJN A;  1YQB A;  2LGX A;  2NS5 A;  1WFY A;  1Z2M A;  2GBR A;  1OEY J;  4HWI B;  4FN2 A;  4KV2 A;  2K39 A;  4HCN B;  4W9H A;  3A9J A;  3QAR A;  2HD5 B;  1NDD A;  2NPT A;  1VD2 A;  1IP9 A;  2ASQ A;  1Q5W B;  3RUL A;  3VXW A;  2MP2 B;  4W9I A;  1L7Y A;  4M8N A;  3DVN U;  2L8J A;  3PT2 B;  2M1M A;  2MW5 A;  2KTR A;  2RPQ A;  1XT9 B;  2BYV E;  2N4F A;  2A5U A;  5AZF A;  3Q3J A;  1WMH A;  5IA7 A;  2JZZ A;  1V2Y A;  1WI0 A;  3O65 B;  3WA0 A;  4NJ6 A;  1FXT B;  2NVU I;  1JRU A;  2GBM A;  3AXC A;  4HPL B;  3SDL C;  4IWO A;  3VFK A;  1I35 A;  4GMV A;  3X0W A;  2AYO B;  3HHM A;  4ICV A;  2NBV B;  4CYE A;  2CHZ A;  2ZVO A;  1A5R A;  1NBF C;  1UBI A;  5FR6 A;  4JQW C;  2FCM A;  4AJY B;  2KFK B;  3M62 B;  3NZU A;  4WJP A;  3EHV A;  5G55 A;  1RLF A;  1J0G A;  2IY0 B;  4KDL B;  5LLI A;  4BOS C;  2IO3 B;  3B1L X;  1SE9 A;  2AEH A;  1S3S G;  2L3Z A;  2ZVN A;  3ZRF A;  1E8Y A;  3V60 A;  3X23 A;  3A9K B;  1Q0W B;  4A3O A;  4DHJ B;  4EZK A;  2O2V B;  3GZN I;  2LD9 A;  4X57 B;  2DAF A;  1QZE A;  2V3S A;  2CKH B;  2ZPY A;  5E6O A;  2L76 A;  4W9E A;  4BKS D;  2JRI B;  4NJ7 A;  2BWE S;  4ZRK A;  1XQQ A;  3ZDM C;  1T0Y A;  4BOZ B;  1WJ4 A;  1ZGU B;  3NOB A;  4K7W A;  1WGR A;  2K8C A;  4EKU A;  1GUA B;  2K25 A;  3IBE A;  1IPG A;  1TGZ B;  1YX6 B;  4W9J A;  4WJQ A;  3U7D A;  2GBN A;  2WWZ A;  1TBE A;  1C1Y B;  3EFU A;  2KOX A;  2C9W B;  2MLB A;  3DDC B;  3TCA A;  3ML9 A;  2DAJ A;  1E8X A;  4ZRJ A;  1WZ3 A;  3MTN B;  4OVV A;  4IWP A;  5JHA A;  1WJU A;  1E8Z A;  2GBJ A;  4HPM B;  4NQL B;  2I1J A;  4HDQ A;  3JSV B;  1I42 A;  2KTF A;  3QHT A;  5L83 A;  4K1R B;  4DHJ D;  3OJ4 B;  5C1Z A;  2DZI A;  1WX9 A;  2K6D B;  1WXA A;  2FID A;  4K7U A;  5AZG A;  4HXD A;  1TTN A;  4MJS B;  3SD5 A;  1J8C A;  4LDT B;  2FAZ A;  3B0A A;  3HK0 A;  4AOF A;  4FAD A;  2ZNV C;  3OLM D;  3VVW B;  4KZC A;  1E5W A;  1WJ6 A;  4WJN A;  1KOT A;  2G45 B;  3DBR I;  1J19 A;  4FUL A;  4TUU A;  1WXS A;  2BYF A;  1R4N I;  2HTH A;  4IC7 B;  3IG3 A;  2WDT B;  2Z59 B;  3NHE B;  2MRP A;  5DPT A;  3KUZ A;  2L0T A;  2LUE A;  3PTF C;  4MGI E;  4CO7 A;  2KD0 A;  4FJZ A;  3T8M A;  2NBW B;  4AP4 C;  4GSW A;  1OGW A;  4GN1 A;  3V61 A;  4IG7 B;  1H4R A;  3DQV A;  3ZW3 A;  4ICU A;  3A4S C;  3SU8 X;  2KWC A;  3VTW A;  4CHK A;  4BBN C;  3PLU A;  4BKT A;  4GGQ A;  3A1Q A;  3P2B A;  3VH3 B;  2KK8 A;  5EDS A;  2LVO A;  2OJR A;  5DPR A;  2IYD B;  3K9P B;  4HJK A;  4LDT D;  4W9C A;  3H9D A;  3WAP A;  2DZM A;  3QIJ A;  3RCZ A;  4FA6 A;  4EOY A;  4RM9 A;  4MDK E;  3R7Q A;  3WAL A;  2M8S A;  5JH5 C;  1V80 A;  4LCD E;  2LI5 A;  2KC1 A;  2D10 A;  4W9F A;  2C7N B;  4HK2 A;  2BKF A;  3PPA A;  3TIX A;  3JYU A;  3AU5 A;  3W1S A;  4DDG D;  2KX3 A;  3HM6 X;  2LVQ A;  3ZO5 B;  2GOW A;  4NNJ B;  4AJW A;  2ZCB A;  3WAM A;  4GDK B;  2YVC A;  1WY8 A;  3L10 B;  2DYB A;  3PGE A;  2KHW B;  1E90 A;  1GG3 A;  4KIK A;  2MBH A;  4RM8 A;  4AWJ A;  3TMP B;  1WMH B;  5LXI B;  2KFJ A;  1UEL A;  4HDO A;  2IBI B;  1WM2 A;  5E6N A;  4K81 A;  3VUX A;  3APC A;  2KWV B;  4I6P A;  2DZJ A;  5LXH A;  1Z5S B;  4MEM A;  1HE8 A;  4F7Z A;  1EUV B;  3V6C B;  4ASW C;  2MQJ A;  1WE7 A;  3KUC B;  1WIA A;  4XZ4 A;  4PS7 A;  2LJ5 A;  4MSM B;  3PV1 A;  2FIF A;  3QCA A;  4FLH A;  3DOW A;  3WIM A;  3ZNZ B;  4NPN A;  3QK0 A;  4A3P A;  2O6V A;  2WX1 A;  2ZEQ A;  4PS3 A;  3ZIM A;  4ANW A;  3ZTD A;  3K9O B;  2KQ7 A;  4DWF A;  2BWF A;  3OAW A;  1Y8R C;  3VUY A;  4XX5 A;  2PE6 B;  3ECI A;  2GMI C;  4NAW A;  4FHK A;  2EKE C;  5IAA C;  4IM2 A;  3W1Y A;  1Q1O A;  4GOC A;  2J0K A;  3PHX B;  2JPH A;  4A20 A;  1RRB A;  3KW5 B;  3M95 A;  5BO4 B;  1WXM A;  3AI5 A;  3H7P A;  3QQ8 B;  4IM3 A;  4NY0 A;  3VAW A;  1LM8 B;  1SIF A;  4HLE A;  4BFR A;  2L7R A;  4BBN F;  2CS4 A;  1P98 A;  2KXJ A;  3DPD A;  3PHW B;  2EMS A;  3DVG Y;  4MEL A;  3RYT A;  2PJH A;  5D94 A;  1LXD A;  4W9L A;  1CMX B;  3T9L A;  3C0R B;  3UIP B;  4GDL A;  3S2A A;  3L08 A;  2L05 A;  3U30 A;  1OEY A;  2C5L C;  2IY1 B;  1EF1 A;  2JF5 A;  2KDF B;  1G6J A;  1E7U A;  3BY4 B;  1OQY A;  1KLV A;  1GNU A;  2ZZP B;  3ZUN A;  2L0F A;  3PRM B;  2JZ3 B;  4MM3 A;  4I6L B;  2GBK A;  3ALB A;  2FUH B;  1SGH A;  1V86 A;  2V1Y A;  3ZKJ C;  2ZNV B;  2BF8 B;  5J2R A;  2JXX A;  1WXV A;  1WH3 A;  2R2O A;  3SHQ A;  3QA8 A;  2PPH A;  3UIN B;  3BIN A;  3KUD B;  3RZF A;  3APF A;  5CHF A;  4TQ1 A;  1WYW B;  1PQS A;  3A9K A;  2ZCC A;  4RMA A;  1H8C A;  2KMC A;  4ANU A;  4FJV B;  3VDZ A;  2KX0 A;  1ZKH A;  3ZNI D;  1WGG A;  3AU4 A;  4KZ0 A;  3KYD D;  3HIZ A;  3B08 A;  2FNJ B;  5C23 A;  3JW0 X;  1R4M I;  2PE9 A;  3N32 A;  1L2N A;  2N9P C;  3GOE A;  3ZNG C;  1V6E A;  2KJH B;  2KDB A;  3R66 C;  1E8W A;  2MSE D;  2KDE B;  3LJ3 A;  3CST A;  1NI2 A;  1WX7 A;  2KJR A;  2W9N A;  3ONS A;  3A1Q B;  1BT0 A;  4WAA A;  4KDI C;  2IO1 B;  3CMM B;  2N1V A;  2K8H A;  2KDI A;  2MX2 A;  2K8B A;  3NZS A;  4I6N B;  3IFW B;  4OVU A;  3UQB A;  2CR5 A;  4KSL C;  5D2M B;  3DCG A;  2KN5 A;  2ZPN A;  3JSV A;  4F1S A;  3NS8 A;  2N7E A;  2DX5 B;  2NBU A;  5G2N A;  4E3C A;  2UYZ B;  2QHO A;  3PZD A;  3ZRC A;  2Y5B B;  2XEW A;  4B95 A;  5L95 C;  2LXA A;  2BGF A;  2WYQ A;  3DBL I;  1GC7 A;  3KYC D;  4ZRI A;  2PEA A;  4J6I A;  2KZR A;  4G0N B;  2RD0 A;  2N9E B;  4MJS A;  2CU1 A;  3CF6 E;  1WX8 A;  3JVZ X;  3MJW A;  3MHS D;  3A9J B;  4KIK B;  2M17 A;  2JVC A;  2NPT B;  3QAQ A;  4JIO U;  1P1A A;  4PYU A;  3I3T B;  4ZDV A;  2IO0 B;  2J0M A;  2DYO A;  3DVG X;  4MSQ B;  3L13 A;  3H7S A;  2DHZ A;  5KHQ A;  2REX A;  4TQ0 A;  1RAX A;  2AL3 A;  4G50 A;  2FCQ A;  2JY6 A;  2HE7 A;  3PLV A;  2KTR B;  3IVF A;  2M0X A;  3V62 A;  3N3K B;  3W1S C;  2LVP A;  3N30 A;  1IYF A;  2IZV B;  3DBS A;  3L54 A;  4AUQ C;  5D6J B;  3LDZ E;  3QX1 A;  3QC8 B;  2KJ6 A;  4HCP B;  4LJP B;  3RZW C;  3TBL D;  4N9F 4;  4DXA B;  1E7V A;  2BKR B;  2N9X A;  3Q3F A;  4TKN A;  3TJP A;  2XK5 A;  3IHP C;  4P7I A;  3VTU A;  2CHW A;  2G3Q B;  2K6Q A;  2L00 B;  3PRP B;  5TR5 A;  3PRE A;  4F8C B;  1D3Z A;  2UWQ A;  4W9G A;  2LRU A;  4NAW B;  2DYM A;  3APD A;  3DVN V;  4JGH B;  2YLM A;  3QWZ B;  3UF8 A;  1EO6 A;  5AEK B;  5JZE B;  2KMA A;  1P9D U;  4MGY E;  1LFD A;  1S1Q B;  2DZK A;  1TZ1 A;  3H7P B;  4FJY A;  3UIO B;  2KNB A;  5D7G A;  4DHZ E;  2AL6 A;  3L16 A;  1UD7 A;  2BYE A;  2D2Q A;  2DEN B;  1WZ0 A;  2MBO A;  4ANX A;  2MBB B;  4ZYN A;  4E71 A;  2IO2 B;  2MCN B;  1WM3 A;  4GDK A;  4W9D A;  5J17 A;  2B3A A;  2K1F A;  1X1M A;  3EEC A;  2N7D A;  4GDL B;  4PS8 A;  4BVU C;  4DHZ B;  2EMT A;  1V5O A;  2KVR A;  2V4L A;  1U4A A;  1UBQ A;  2MWS B;  5HKH A;  2RSU A;  2VRR B;  2O6V D;  3WAO A;  4PYZ A;  2MP2 A;  4MGZ E;  3VTV A;  3L17 A;  3DBH I;  3PSE B;  1V81 A;  4M0W B;  2J0J A;  3WAN A;  4LJO B;  4BKS A;  2JT4 B;  1XD3 B;  3RUI B;  2R2Q A;  2KAN A;  2LWP A;  4IW0 A;  4DDI D;  3HM3 A;  2KC2 A;  2FCN A;  3VUW A;  4B6W A;  2KQS A;  2M4N A;  1ZW7 A;  4G3X B;  4URK A;  2LZ6 A;  5CHW A;  4MGK E;  5KHO A;  3VH4 B;  2BPS A;  1MG8 A;  2MBQ A;  5JHB A;  2KFK A;  2KLG A;  3RD2 A;  3D32 A;  4ANV A;  5CX3 A;  2KLC A;  1WGY A;  4WWN A;  1LQB A;  1YJ1 A;  4FBJ B;  2XBB C;  1RFA A;  2C60 A;  2J7Q B;  4JLC A;  2JWZ A;  3U8Z A;  2CHX A;  2C7M B;  2C7H A;  4NQK E;  1UZX B;  2LGD A;  3KH0 A;  4JL9 A;  4MH0 E;  4TV3 A;  5E6P A;  3VHT C;  2JUO A;  3H1U A;  1V5T A;  2O2V A;  3V6E B;  1C3T A;  1M94 A;  1WE6 A;  2KO3 A;  3PRZ A;  1K8R B;  2OOB B;  3H6N A;  2G4S A;  1V49 A;  1WR1 A;  3NY5 A;  2LGY A;  3PVL A;  3AUL A;  4EUT A;  1GJZ A;  3ZNH B;  5AZH A;  5J18 A;  2KWU B;  4IWQ A;  4WWP A;  1P0R A;  1WR6 E;  2AWT A;  3L0W B;  5GMV A;  5DPS A;  4FHJ A;  4II2 B;  4IUM B;  4GB9 A;  5CTR C;  1YD8 U;  2Z0E B;  3M3J A;  3PS6 A;  4GU2 A;  3R7R A;  2JRH A;  4W9K A;  3UQA A;  5DPW A;  3ENE A;  4DBG A;  3A33 B;  4II3 B;  2FCS A;  4WJO A;  1OTR B;  4WWO A;  3OJ3 A;  1P3Q U;  3EC8 A;  2LXC A;  2NCN A;  2HJ8 A;  1KJT A;  3UGB B;  3A4R A;  4K7S A;  2NR2 A;  2RGF A;  1VCB A;  3M63 B;  4YL8 A;  3ML8 A;  3ZVV A;  4B9K A;  1YX5 B;  2LAS A;  1ISN A;  4BKG A;  3KVF B;  2I1K A;  3QJZ A;  1WF9 A;  4IM0 A;  2D3G A;  4G11 A;  3TL5 A;  2MBE A;  4EZJ A;  3RT3 B;  1EF5 A;  3ZLZ A;  2D07 B;  2A4Z A;  2KKC A;  2WX0 A;  4E74 A;  4XC2 A;  1UGM A;  4GIV A;  4M8M A;  5DCN A;  3ZDT A;  4DK5 A;  1WRD B;  2Z0D B;  2XK5 B;  1UH6 A;  1WGH A;  2LRW A;  2N1W A;  5CHV C;  4EZL A;  3R3M A;  1AAR A;  4WQO B; 
#chains in the Genus database with same CATH topology
 4KSK C;  4A8X C;  4KVG B;  4EE2 A;  3P4Q B;  5AUI A;  2D11 A;  4P6V F;  4EFO A;  3UI3 A;  3VRA B;  1SIJ A;  1YQB A;  2NS5 A;  1KRH A;  1PGX A;  2K22 A;  1VD2 A;  3NJT A;  1WSP A;  3VXW A;  2MP2 B;  3BK2 A;  5IO9 A;  1ZDV A;  2KQ4 X;  2NTS A;  1E9M A;  4WUR A;  2KTR A;  2JZZ A;  4HPL B;  1JRU A;  1I35 A;  2AYO B;  3I57 A;  1R7S A;  4CYE A;  4BAX A;  3U7Z A;  1A5R A;  3P4R B;  1NBF C;  5LNK 1;  1YN4 A;  4WJP A;  5G55 A;  1LGR A;  3Q6B A;  2IY0 B;  2AEH A;  2IDY A;  4RNA A;  1JQ4 A;  5G5H A;  3KWL A;  4DHJ B;  3GZN I;  2LD9 A;  2ZPY A;  1YN5 A;  4BKS D;  4W9E A;  4ZRK A;  2BT6 A;  3DBL B;  4K7W A;  1WGR A;  2WXP A;  2K25 A;  1OQR A;  3IBE A;  1IPG A;  1TGZ B;  1YX6 B;  4WJQ A;  3U7D A;  2KOX A;  2C9W B;  2MLB A;  3Q8F A;  2RDB C;  3ML9 A;  2DAJ A;  5JHA A;  1AYF A;  1I42 A;  4RGT A;  2BB6 A;  4K1R B;  1VZ6 A;  3OJ4 B;  2N9L A;  1UUP A;  1WX9 A;  2FID A;  4K7U A;  3Q69 A;  1T3Q A;  2RMM A;  1XF5 L;  4LLG M;  2ZNV C;  3OLM D;  3VVW B;  4KZC A;  3FAH A;  1WJ6 A;  1J19 A;  1WXS A;  2INC C;  3Q3N C;  3IG3 A;  3NHE B;  2MRP A;  5DPT A;  3FKY A;  3T8M A;  3ZQ4 A;  4GSW A;  5C2T B;  4IG7 B;  1H4R A;  3ZW3 A;  2KWC A;  2GI9 A;  3VTW A;  2RDG A;  3VH3 B;  2KK8 A;  5EDS A;  2OJR A;  1E6E B;  3PZ7 A;  2VZK B;  2DZM A;  3WAP A;  2AX5 A;  4MDK E;  3WAL A;  1C4A A;  2BKF A;  3PPA A;  1MHH E;  1HA5 A;  1UF0 A;  3JYU A;  3RNA C;  2GOW A;  5TSS A;  4AJW A;  2ZCB A;  3WAM A;  1V97 A;  4GDK B;  1WY8 A;  3L10 B;  3AE5 B;  2KHW B;  3IT4 B;  2MBH A;  5LXI B;  2DWQ A;  1Z5S B;  4MEM A;  3AE3 B;  4S0R A;  4F7Z A;  1EUV B;  3R8B A;  1WE7 A;  1WIA A;  4MSM B;  1C9F A;  3DOW A;  2KMM A;  3BWU D;  3NG0 A;  4NPN A;  5GXG B;  1R4M B;  4PS3 A;  4ANW A;  3ZIM A;  3ZTD A;  3K9O B;  3OAW A;  1N6Z A;  1IBX A;  3VUY A;  2L52 A;  4XX5 A;  3ECI A;  2X8X X;  4IM2 A;  1Q1O A;  2J0K A;  1D5X C;  1NEK B;  4A20 A;  1RRB A;  3M95 A;  1WXM A;  4NY0 A;  1LM8 B;  1SIF A;  1C4C A;  2CS4 A;  4MEL A;  2PJH A;  4C4V B;  2ZZP B;  4CQN A;  1IGC A;  3PRM B;  2GBK A;  3ALB A;  3ZKJ C;  2ZNV B;  5J2R A;  3BVM A;  1WH3 A;  2ON8 A;  3IXS A;  3Q2A C;  4PK1 A;  2PPH A;  3Q8E A;  3BIN A;  5CHF A;  4XDD A;  4TQ1 A;  1YNT E;  1SE2 A;  3A9K A;  1H8C A;  3AED B;  1RM6 C;  2Y5P A;  2IPK D;  2M56 B;  3MC0 B;  3ZNI D;  4KZ0 A;  1FRD A;  2UU7 A;  1RWS A;  1RYJ A;  5HFY A;  1V1O A;  1R4M I;  1L2N A;  3GOE A;  1E8W A;  2KDE B;  3OWE B;  3CST A;  3LB8 C;  1V1P A;  3A1Q B;  4WAA A;  4KDI C;  4HPP A;  2K8H A;  1FNV A;  3UQB A;  5HHD G;  3IFW B;  4F1S A;  2D3B A;  3Q3M C;  2UYZ B;  2QHO A;  3PZD A;  1A70 A;  1I7H A;  4MJS A;  4C00 A;  1WX8 A;  4N6E B;  4A55 A;  4KIK B;  1JWM D;  2JVC A;  2NPT B;  2WS3 B;  4ZDV A;  4MSQ B;  2PVO D;  2REX A;  2JY6 A;  2HE7 A;  1TIF A;  3IVF A;  2LVP A;  1IYF A;  4AUQ C;  4O1N A;  3IT6 B;  1EWC A;  2BS3 B;  4N9F 4;  4XWT A;  1NYQ A;  1E7V A;  1KH0 A;  4H2A A;  4P7I A;  3PRP B;  3RNC C;  4W9G A;  2LRU A;  5AUK A;  4R3D A;  1WGK A;  4JGH B;  3QWZ B;  5JZE B;  1P9D U;  3H7P B;  5I4D A;  5D7G A;  2AL6 A;  2DEN B;  1WZ0 A;  2MBB B;  5JXV A;  3J9C A;  4C56 C;  4ZYN A;  2KVZ A;  2PW9 A;  1K52 A;  1WM3 A;  5J17 A;  2CU3 A;  2Q5W D;  2N7D A;  2QDF A;  3SEB A;  2MWS B;  1UBQ A;  5HKH A;  4N58 A;  3WAO A;  3VTV A;  3L17 A;  2DLB A;  2OJW A;  4L23 A;  3V05 A;  1V81 A;  3WAN A;  4QAY A;  4YTM B;  2JT4 B;  2LWP A;  4LNK A;  2KQS A;  2WDV B;  3ABV B;  1N5X A;  1XCT L;  5CHW A;  3W5V B;  2KFK A;  4ANV A;  5CX3 A;  4WWN A;  1LQB A;  4ZRP A;  2J7Q B;  4JLC A;  2JWZ A;  4NQK E;  2C7H A;  4MH0 E;  4JL9 A;  1N60 A;  3VHT C;  3H1U A;  3V6E B;  1C3T A;  1M94 A;  1WE6 A;  2LGY A;  2LMC A;  1GJZ A;  4C7Z A;  2DNF A;  2JWU A;  2J42 A;  3KLS X;  1QOA A;  1P0R A;  4ZHO A;  1YQ3 B;  4II2 B;  2JRH A;  4W9K A;  5DPW A;  4DBG A;  4WJO A;  1OTR B;  2GB1 A;  2G9H D;  1P3Q U;  3TSS A;  1TS3 A;  2LXC A;  2NCN A;  2E3T A;  3ZXV A;  3A4R A;  2PMV A;  2RGF A;  1VCB A;  2JSV X;  3I9V 1;  3ML8 A;  4BKG A;  1JRP A;  1SE4 A;  3HUI A;  1WF9 A;  4AQ7 A;  2D3G A;  3AN1 A;  4G11 A;  4EZJ A;  3RT3 B;  3ZLZ A;  2A4Z A;  2KKC A;  2WX0 A;  1SSN A;  1UGM A;  4JX1 C;  3ZDT A;  2NTT A;  2PKO A;  3BZD B;  4M02 A;  1WGH A;  4M01 A;  3TEW A;  4DXF A;  3AE8 B;  3ZYY X;  1D4B A;  2MJD A;  4N59 A;  1GC6 A;  4KX6 B;  2G4D B;  1KM7 A;  3T3N A;  2RR9 A;  2ZJD A;  1F9J A;  3N20 C;  1Z2M A;  4DXG A;  1ZOY B;  2V9H A;  1GB1 A;  3BVG A;  1PYW D;  4HCN B;  3QAR A;  2HD5 B;  1FM0 D;  2ASQ A;  1Q5W B;  2CJN A;  4W9I A;  1Y56 A;  1L7Y A;  4M8N A;  3DVN U;  4ZHP A;  2MW5 A;  2BYV E;  2WXJ A;  2BYT A;  3Q3O C;  3Q3J A;  1WMH A;  4ACF A;  1V2Y A;  1WI0 A;  1AWD A;  1ZE3 D;  2NVU I;  3SDL C;  3VFK A;  3HHM A;  4ICV A;  1DYQ A;  2ZVO A;  1BML C;  1CQV A;  3SFD B;  1UBI A;  3DBR B;  1VZ8 A;  3M62 B;  1J0G A;  4KDL B;  1SE9 A;  1S3S G;  2RPV A;  3AE6 B;  2WP9 B;  3X23 A;  3DHH C;  3CIR B;  4OHJ A;  2WXQ A;  2O2V B;  4X57 B;  2BS2 B;  4US8 A;  2JRI B;  2BWE S;  1XQQ A;  3ZDM C;  4BOZ B;  2AQ1 B;  1ZP0 B;  3EFU A;  5IP4 D;  4OZB A;  2L1A A;  1E8X A;  3P4P B;  4ZRJ A;  1WZ3 A;  5BMG A;  2V3N A;  2KT7 A;  1WJU A;  1E8Z A;  5T8I A;  5C3J B;  3JSV B;  4D2K A;  4DHJ D;  3EUB 2;  2DZI A;  4HXD A;  1J8C A;  1C78 A;  4LDT B;  2FAZ A;  3B0A A;  4L1B A;  4AOF A;  3AE7 B;  4RF1 A;  4OZC A;  2I38 A;  1J7B A;  1KOT A;  4K3C A;  2G45 B;  3NUH B;  3DBR I;  1YN3 A;  1YJI A;  2X38 A;  1I4H A;  1QIL A;  2LUE A;  3PTF C;  4CO7 A;  2NBW B;  4AP4 C;  3RI7 C;  2W3S A;  2BQQ A;  4YSZ B;  2ZW1 A;  3AE1 B;  4ICU A;  4BBN C;  1FXA A;  1PUT A;  1QOF A;  4XDC A;  4W9C A;  3H9D A;  4FA6 A;  2Y5C A;  2M8S A;  1D6E C;  5JH5 C;  2LI5 A;  4OVZ A;  3BVZ A;  4DDG D;  1E0Z A;  2M19 A;  1GPX A;  2LVQ A;  3ZO5 B;  4NNJ B;  3URY A;  2JYT A;  3RNG C;  2D3C A;  3PGE A;  1GG3 A;  3TMP B;  3ZJT A;  1UEL A;  5E6N A;  2IBI B;  3VUX A;  4K81 A;  4I6P A;  4OW0 A;  2DZJ A;  3KWV A;  3RPF C;  2GLS A;  3AE2 B;  2IGG A;  1DOI A;  1FCL A;  3ZJU A;  2VZK D;  2W82 A;  3B2G A;  1SF0 A;  2WDR B;  1PGA A;  2WX1 A;  5EE1 A;  2KQ7 A;  2BWF A;  1Y8R C;  1JAL A;  2GMI C;  1D5Z C;  4NAW A;  4GOC A;  2JPH A;  1UWM A;  2PIA A;  5BO4 B;  3VAW A;  3QQ8 B;  2K0P A;  4BFR A;  1XO3 A;  4BBN F;  4IKG A;  3Q14 C;  1P98 A;  3PHW B;  1YJJ A;  2EMS A;  3DVG Y;  5D94 A;  3T9L A;  4GDL A;  3MHZ A;  3U30 A;  4M00 A;  5IN7 A;  3SR6 A;  2IGD A;  2JF5 A;  3DWM A;  1E7U A;  4JWU C;  2SEB D;  2L0F A;  1STE A;  1SGH A;  4M0W A;  3EGR A;  2R2O A;  3DWG C;  3SHQ A;  4LNN A;  3RZF A;  4HJG E;  2D3A A;  1LO5 D;  5BYQ A;  4FJV B;  1GAQ B;  4A9A A;  3KYD D;  1FXI A;  3HIZ A;  2FE8 A;  1K50 A;  1ZXI A;  2QJL A;  2FUG 1;  3N32 A;  2N9P C;  3ZNG C;  4C80 A;  1E7P B;  1ZXH A;  1NI2 A;  2W9N A;  1AN8 A;  2KDI A;  1WXQ A;  5E6J A;  2N7E A;  1JRO A;  2DX5 B;  4RGO S;  2Y5B B;  1P7E A;  4B95 A;  3DBL I;  1GC7 A;  4ZRI A;  2PEA A;  3DBH B;  2W55 A;  4G0N B;  1MJD A;  1NVI D;  2CU1 A;  3A9J B;  4HKQ A;  1HZ6 A;  2ICI A;  2V3P A;  3L13 A;  2QIL A;  3AH7 A;  4TQ0 A;  2AL3 A;  1L4D B;  3N3K B;  3W1S C;  5D6J B;  4KGR A;  3QC8 B;  2KJ6 A;  1QT9 A;  4LJP B;  1C76 A;  4DXA B;  2BKR B;  2N9X A;  2OED A;  2XK5 A;  3IHP C;  2CHW A;  4JWS C;  5D3D A;  5TR5 A;  3ETR A;  1IBX B;  2DYM A;  2I2Y A;  3DVN V;  4JPS A;  4B0E A;  2G1E A;  1N62 A;  5AEK B;  2KMA A;  2DZK A;  1CJE A;  1QOG A;  1S1Q B;  2V0G A;  1KLU D;  4KKJ A;  2HJ1 A;  3AEA B;  2BYE A;  3PO0 A;  4YWG G;  1IGD A;  2WDQ B;  3NVY A;  4GDK A;  4BVU C;  4PS8 A;  2EMT A;  1V5O A;  2KVR A;  1U4A A;  1TS2 A;  3U2S C;  3L4P A;  2O6V D;  3DBH I;  3PSE B;  4BKS A;  4LJO B;  2R2Q A;  3MC9 A;  2LHE A;  4DDI D;  1TKE A;  2AQ3 B;  3HM3 A;  3P1M A;  3VUW A;  1FMA D;  3W2D A;  4B0M A;  4MGK E;  5KHO A;  2E6X A;  5JHB A;  3TEZ A;  3RD2 A;  1WGY A;  2C60 A;  2CHX A;  3GE8 C;  1MG4 A;  3RN9 C;  3NS1 A;  3ZJV A;  4HKZ E;  1V1P B;  2G4S A;  3NY5 A;  3AUL A;  2IJ0 A;  1ENF A;  3N1X C;  4EUT A;  3B2F A;  4HEA 1;  4C4V A;  5AZH A;  1XLN A;  4KKI A;  1C4P A;  4WWP A;  3U4E G;  1I4P A;  1WWT A;  3R7R A;  4GB9 A;  5CTR C;  2CJO A;  3ENE A;  4RGM A;  3A33 B;  4WWO A;  3OJ3 A;  3VR9 B;  3EC8 A;  2NR2 A;  1P7F A;  3M63 B;  4WIP A;  3RNF C;  4B9K A;  1YX5 B;  1ISN A;  2INN E;  2I1K A;  5MPO A;  1F1H A;  2JU6 X;  1EF5 A;  4PT5 A;  5DCN A;  2WLB A;  3AE4 B;  2WXG A;  1QQR A;  1UH6 A;  2LRW A;  5CHV C;  4EZL A;  2INP E;  3R3M A;  1EM7 A;  1AAR A;  1FFV A;  1V8C A;  1JW9 D;  2H89 B;  3EFC A;  3CSF A;  4OZA A;  3Q8A A;  4NJC A;  1T5X D;  1JWS D;  4MH8 A;  4GXB A;  4EEW A;  2O6V B;  3FIL B;  3AEC B;  1WYG A;  5BYS A;  3ZTC A;  2D5G A;  3VQI A;  2MA9 B;  2LGX A;  3MFG A;  4RGN A;  1WFY A;  2GBR A;  4HWI B;  4FN2 A;  4KV2 A;  2K39 A;  4W9H A;  1NDD A;  2NPT A;  2JQR B;  3RUL A;  1E10 A;  2YEP B;  2L8J A;  3RNE C;  3CWI A;  2JZP A;  1M4V A;  2RPQ A;  1F0Z A;  2N4F A;  5AZF A;  5IA7 A;  3N9Y C;  4NJ6 A;  1FXT B;  2GBM A;  3AXC A;  1SE3 A;  4IWO A;  4GMV A;  3X0W A;  2NBV B;  1UWX A;  4JQW C;  2FCM A;  4AJY B;  2KFK B;  3NZU A;  1R4N B;  3EHV A;  4BOS C;  5LLI A;  2IO3 B;  2L3Z A;  1E8Y A;  5FR3 A;  4DQO C;  1Q0W B;  3LXF A;  4A3O A;  1QZE A;  2L76 A;  4L2Y A;  4NJ7 A;  3NOB A;  1GUA B;  1FRR A;  2GBN A;  1C1Y B;  1TBE A;  3DDC B;  1XCQ L;  4A6Q A;  1XEE A;  2W54 A;  1SJE D;  2GBJ A;  3AEB B;  4HPM B;  1HXY D;  2QSD A;  5D3I B;  1PGB A;  1MPE A;  5L83 A;  4K3B A;  1T0S C;  1QOB A;  2BW2 A;  4YSY B;  2J53 A;  2K6D B;  1TTN A;  2AQ2 B;  2ACZ B;  3SD5 A;  2N9K A;  1E5W A;  3MJ5 A;  4TUU A;  5IOI A;  1R4N I;  3HVD A;  2WDT B;  2Z59 B;  2WXH A;  2V4I B;  2L0T A;  2KD0 A;  4FJZ A;  3V61 A;  1OGW A;  1HQR D;  4GN1 A;  3DQV A;  1ESF A;  3SU8 X;  5EE0 A;  1TYG B;  3P2B A;  3GP7 A;  1QKZ A;  5DPR A;  2IYD B;  4HJK A;  4LDT D;  3NZ3 A;  3QIJ A;  3RCZ A;  4RM9 A;  1V80 A;  4LCD E;  2C7N B;  5HI1 A;  2BBC A;  4JE3 B;  2KX3 A;  1UGJ A;  2NMQ A;  3BK1 A;  1HEZ E;  2YVC A;  4USA A;  1DGJ A;  4RM8 A;  1HTQ A;  1WMH B;  2ONQ A;  1CZP A;  4UDU C;  2KFJ A;  4HDO A;  1WM2 A;  2WXI A;  1ZPS A;  1HE8 A;  4ASW C;  3KUC B;  1UNS A;  4PS7 A;  1HZ5 A;  3QCA A;  3ZNZ B;  2XN9 C;  3QK0 A;  2ZEQ A;  2PE6 B;  4FHK A;  5IAA C;  3W1Y A;  3PHX B;  2MHJ A;  3KW5 B;  3AI5 A;  4IM3 A;  1T6B X;  4HLE A;  2L7R A;  2KXJ A;  3DPD A;  1LXD A;  1CMX B;  3S2A A;  2IGH A;  2K9X A;  3W9C B;  1OEY A;  2C5L C;  3WCQ A;  1EF1 A;  2KDF B;  1I4G A;  4MM3 A;  2JZ3 B;  1VDV A;  3IAS 1;  1DOX A;  1GOZ A;  3AE9 B;  1JCK B;  2WQY B;  3KUD B;  2WXF A;  1IUE A;  1PQS A;  2ZCC A;  4RMA A;  2VH2 A;  1J7A A;  2KX0 A;  1EU3 A;  2H88 B;  4YT0 B;  1MVK A;  1SJH D;  2FNJ B;  5C23 A;  3ZXR A;  3JW0 X;  1J7C A;  3TEY A;  1K53 A;  1T0R C;  3LJ3 A;  4ZRQ A;  1SEB D;  1C77 A;  1VR9 A;  1WX7 A;  1BT0 A;  4A90 A;  2IO1 B;  3CMM B;  2K8B A;  3NZS A;  4I6N B;  4OVU A;  5H8Y E;  1GB4 A;  4FXC A;  2CR5 A;  3LYY A;  2ZPN A;  3JSV A;  3NS8 A;  4HRS A;  1JWA D;  5G2N A;  3SFE B;  5L95 C;  2LXA A;  2BGF A;  2KN4 A;  2WYQ A;  2J4X A;  3KYC D;  2KZR A;  2RD0 A;  4IOI E;  2MH7 A;  3MJW A;  3JVZ X;  2KAC A;  3MHS D;  2WU5 B;  2LEK A;  3PZ8 A;  3QAQ A;  4PYU A;  1P1A A;  2J0M A;  2DYO A;  3C19 A;  1DOY A;  5KHQ A;  1RAX A;  3R2I A;  2FCQ A;  3PLV A;  2KTR B;  3V62 A;  2BTE A;  1FFU A;  3N30 A;  1FNW A;  3LDZ E;  3QX1 A;  3RZW C;  3TUO A;  4TKN A;  1N63 A;  3TJP A;  2LHD A;  2G3Q B;  2K6Q A;  2L00 B;  2WXK A;  1F2R C;  1TZO A;  4LNO A;  4F8C B;  1D3Z A;  1I4Q A;  2JX5 A;  2WGS A;  4NAW B;  3I63 C;  3APD A;  4MT5 A;  2YLM A;  1FO4 A;  4MGY E;  1LFD A;  4ZOH C;  3L16 A;  1UD7 A;  2MBO A;  2ZW0 A;  4ANX A;  4E71 A;  2IO2 B;  3AV8 A;  3N1Z C;  1L6V A;  1I4X A;  1KFY B;  4HRO A;  3EEC A;  1NEN B;  4GDL B;  4DHZ B;  4S17 A;  2RSU A;  2VRR B;  1PDX A;  1YMH E;  2MP2 A;  4MGZ E;  1YOV B;  1RFK A;  3P63 A;  4M0W B;  5EE3 A;  2KAN A;  4B6W A;  2PLP A;  1SBB B;  1ZW7 A;  4IDI A;  1JWU D;  3VH4 B;  2BPS A;  2WXN A;  4RF0 A;  2KDM A;  2KWD A;  2KLC A;  4TSS A;  1RFA A;  3U8Z A;  2C7M B;  2LGD A;  1BUI C;  2IND C;  3KH0 A;  4TV3 A;  5E6P A;  2WXM A;  2K3U A;  4LK0 M;  2KO3 A;  1K8R B;  1V49 A;  3PVL A;  4ITK A;  2KWU B;  4XYC A;  5EE9 A;  4IWQ A;  1MFW A;  1C79 A;  3IAM 1;  1D5M C;  4IUM B;  3M3J A;  1VZ7 A;  4II3 B;  2FCS A;  3C8Y A;  3NRZ A;  1WRI A;  2HJ8 A;  1XLO A;  2J52 A;  3UGB B;  2M0A A;  2MJE A;  4YL8 A;  3ZVV A;  2LAS A;  3KVF B;  4REZ A;  4IM0 A;  2LUM A;  1TKY A;  1NI3 A;  2MBE A;  4C7Y A;  2D07 B;  4XC2 A;  4GIV A;  4M8M A;  1EWY C;  4DK5 A;  3EA6 A;  2XK5 B;  2N1W A;  4WQO B;  1SB3 C;  3P42 A;  4ZYS A;  4XWW A;  1V9J A;  1F77 A;  1CK1 A;  4HVB A;  1YIW A;  2KAJ A;  1WGD A;  2LGI A;  1WJN A;  3BII D;  1OEY J;  2PVG C;  3A9J A;  3T3O A;  1IP9 A;  4LNI A;  3PT2 B;  2M1M A;  2R61 A;  1ET6 A;  1XT9 B;  3NVV A;  2HTM E;  3V3X A;  2A5U A;  3WA0 A;  3O65 B;  1L4Z B;  4YSX B;  2CHZ A;  3AEG B;  5FR6 A;  2WXR A;  1L0Y B;  2QMT A;  1RLF A;  1F2R I;  3B1L X;  2ZVN A;  3ZRF A;  3V60 A;  1PFD A;  3A9K B;  2QC8 A;  4YTP B;  1XLQ A;  4EZK A;  2DAF A;  2V3S A;  2CKH B;  5E6O A;  1QF6 A;  1T0Y A;  4P1C C;  1WJ4 A;  1ZGU B;  2SAK A;  2K8C A;  4EKU A;  1XXG A;  1TKG A;  4W9J A;  4US9 A;  2WWZ A;  2WU2 B;  3GS2 A;  3TCA A;  1FIQ A;  1FCC C;  3Q8C A;  3MTN B;  4OVV A;  4IWP A;  4KGT A;  3VR8 B;  4NQL B;  2I1J A;  4HDQ A;  2KTF A;  4P1B C;  3QHT A;  1ZDX A;  5C1Z A;  1B9R A;  3N1Y C;  2RDH A;  1WXA A;  5AZG A;  5H92 C;  4MJS B;  3HK0 A;  4FAD A;  3RNB C;  4MAC A;  4WJN A;  4NAM A;  1B1Z A;  1BXT A;  2Y3A A;  3RFZ B;  4FUL A;  2BYF A;  1MHX A;  2HTH A;  1ROE A;  2WXO A;  3E9S A;  4IC7 B;  3KUZ A;  2YEP F;  1FPY A;  4MGI E;  1L5P A;  2QCZ A;  1TJE A;  3KQ4 A;  1T0Q C;  3A4S C;  4CHK A;  3PLU A;  4BKT A;  4GGQ A;  3A1Q A;  2XNA C;  2LVO A;  2L32 A;  2LGS A;  5IKC M;  3K9P B;  3OG5 A;  3AEE B;  3Q8B A;  4EOY A;  3R7Q A;  3ZGZ A;  2KC1 A;  2D10 A;  4W9F A;  3TIX A;  4HK2 A;  3AU5 A;  3W1S A;  1VJK A;  1XLP A;  3HM6 X;  4P16 A;  2W3R A;  3GB1 A;  4NZL B;  2DYB A;  1E90 A;  4KIK A;  4AWJ A;  1TY2 A;  3NVW A;  3APC A;  5BYR A;  2KWV B;  5LXH A;  4YTN B;  3V6C B;  2MQJ A;  1JWB D;  3MP9 A;  4XZ4 A;  2LJ5 A;  3PV1 A;  2FIF A;  4FLH A;  2OHF A;  2WNM A;  1KLG D;  3WIM A;  3MC8 A;  3U52 E;  4A3P A;  5HG2 A;  2O6V A;  3FIL A;  2EEL A;  4DWF A;  4Q2J A;  4XE0 A;  2EKE C;  3H8H A;  3H7P A;  1HTO A;  1KF6 B;  1K51 A;  3RYT A;  3AM9 A;  4W9L A;  3UIP B;  3C0R B;  4RH6 A;  3L08 A;  2L05 A;  2L83 A;  2QIE B;  1N5W A;  2IY1 B;  3BYT B;  2K5P A;  3BY4 B;  1G6J A;  1OQY A;  1KLV A;  1GNU A;  3ZUN A;  1QLB B;  4I6L B;  4AS1 A;  4YXD B;  3P4S B;  2FUH B;  1V86 A;  2V1Y A;  2BF8 B;  2JXX A;  1WXV A;  2BVC A;  4BZA A;  3QA8 A;  3UIN B;  1SXT A;  3APF A;  4WH4 A;  5G5G A;  1WYW B;  2VH1 A;  4KGS A;  2KMC A;  4ANU A;  3VDZ A;  1ZKH A;  5BMH A;  1WGG A;  3AU4 A;  3B08 A;  4WAF A;  3GE3 C;  2PE9 A;  1V6E A;  2KJH B;  2KDB A;  3R66 C;  2MSE D;  1ACC A;  1JML A;  4WWM A;  1FD6 A;  1F52 A;  2KJR A;  3ONS A;  4WQM A;  2MEK A;  2N1V A;  2MX2 A;  4KSL C;  5D2M B;  3DCG A;  2KN5 A;  1VRA B;  2NBU A;  4E3C A;  3ZRC A;  3TEX A;  2XEW A;  4RCO A;  3BYY B;  4J6I A;  3RMK C;  2N9E B;  1OQQ A;  3CF6 E;  2LFI A;  3O13 A;  1TS5 A;  2M17 A;  3DHI C;  4JIO U;  3I3T B;  2IO0 B;  3DVG X;  1ET9 A;  2BS4 B;  1ZUD 2;  3I5J C;  3H7S A;  2DHZ A;  4G50 A;  1L0X B;  2N0S B;  2M0X A;  2IZV B;  3DBS A;  3L54 A;  4HCP B;  3TBL D;  2GRI A;  3Q3F A;  3VTU A;  1KTK A;  2B76 B;  1TT5 B;  1AW7 A;  1VLB A;  1TS4 A;  3VRB B;  3PRE A;  2UWQ A;  1TY0 A;  1YQ4 B;  3UF8 A;  3HVZ A;  1EO6 A;  1L6U A;  5FKA C;  1TZ1 A;  4FJY A;  3UIO B;  2KNB A;  4DHZ E;  2EKI A;  3W5U B;  2D2Q A;  4J3O D;  2MCN B;  4W9D A;  2B3A A;  2K1F A;  1X1M A;  2V4L A;  2N7J A;  5FK9 C;  4PYZ A;  1NYR A;  1N61 A;  4ARI A;  4MM3 B;  3R2T A;  3E56 A;  1OFF A;  3AMZ A;  4ARC A;  2J0J A;  3AB5 A;  1XD3 B;  3RUI B;  4IW0 A;  2KC2 A;  2FCN A;  2M4N A;  4G3X B;  4URK A;  2QEJ C;  2LZ6 A;  2HDE A;  1MG8 A;  1Q10 A;  2MBQ A;  2KLG A;  3D32 A;  3DHG C;  4XGA B;  1YJ1 A;  4FBJ B;  2XBB C;  1UZX B;  2WXL A;  2JUO A;  1V5T A;  2O2V A;  1I4R A;  3PRZ A;  2WHI A;  2OOB B;  3H6N A;  2PTL A;  1WR1 A;  3B9J A;  3ZNH B;  4TMA B;  5J18 A;  2Z8L A;  2TSS A;  2FBW B;  1WR6 E;  3L0W B;  2AWT A;  5GMV A;  2KYW A;  3FC4 A;  4LTU A;  3NVZ A;  5DPS A;  1MI0 A;  4FHJ A;  3AEF B;  1YD8 U;  2Z0E B;  3PS6 A;  4GU2 A;  5BMI A;  2DBY A;  3UQA A;  4LNF A;  1EU4 A;  2BB5 A;  1FEH A;  1KJT A;  4K7S A;  3HRD D;  3QJZ A;  4GLS C;  3TL5 A;  1L0V B;  2MJ3 A;  2JYE A;  1FNU A;  4E74 A;  2JXT A;  1WRD B;  2Z0D B;  4RFB A;  2LJI A;  3GZN B; 
#chains in the Genus database with same CATH homology
 4KSK C;  3CSF A;  1GC6 A;  1V9J A;  4KVG B;  4GXB A;  2D11 A;  4EEW A;  2O6V B;  2G4D B;  1KM7 A;  3ZTC A;  4EFO A;  2RR9 A;  3VQI A;  4HVB A;  1YIW A;  2MA9 B;  1WGD A;  2ZJD A;  1F9J A;  1WJN A;  1YQB A;  2LGX A;  2NS5 A;  1WFY A;  1Z2M A;  2GBR A;  1OEY J;  4HWI B;  4FN2 A;  4KV2 A;  2K39 A;  4HCN B;  4W9H A;  3A9J A;  3QAR A;  2HD5 B;  1NDD A;  2NPT A;  1VD2 A;  1IP9 A;  2ASQ A;  1Q5W B;  3RUL A;  3VXW A;  2MP2 B;  4W9I A;  1L7Y A;  4M8N A;  3DVN U;  2L8J A;  3PT2 B;  2M1M A;  2MW5 A;  2KTR A;  2RPQ A;  1XT9 B;  2BYV E;  2N4F A;  2A5U A;  5AZF A;  3Q3J A;  1WMH A;  5IA7 A;  2JZZ A;  1V2Y A;  1WI0 A;  3O65 B;  3WA0 A;  4NJ6 A;  1FXT B;  2NVU I;  1JRU A;  2GBM A;  3AXC A;  4HPL B;  3SDL C;  4IWO A;  3VFK A;  1I35 A;  4GMV A;  3X0W A;  2AYO B;  3HHM A;  4ICV A;  2NBV B;  4CYE A;  2CHZ A;  2ZVO A;  1A5R A;  1NBF C;  1UBI A;  5FR6 A;  4JQW C;  2FCM A;  4AJY B;  2KFK B;  3M62 B;  3NZU A;  4WJP A;  3EHV A;  5G55 A;  1RLF A;  1J0G A;  2IY0 B;  4KDL B;  5LLI A;  4BOS C;  2IO3 B;  3B1L X;  1SE9 A;  2AEH A;  1S3S G;  2L3Z A;  2ZVN A;  3ZRF A;  1E8Y A;  3V60 A;  3X23 A;  3A9K B;  1Q0W B;  4A3O A;  4DHJ B;  4EZK A;  2O2V B;  3GZN I;  2LD9 A;  4X57 B;  2DAF A;  1QZE A;  2V3S A;  2CKH B;  2ZPY A;  5E6O A;  2L76 A;  4W9E A;  4BKS D;  2JRI B;  4NJ7 A;  2BWE S;  4ZRK A;  1XQQ A;  3ZDM C;  1T0Y A;  4BOZ B;  1WJ4 A;  1ZGU B;  3NOB A;  4K7W A;  1WGR A;  2K8C A;  4EKU A;  1GUA B;  2K25 A;  3IBE A;  1IPG A;  1TGZ B;  1YX6 B;  4W9J A;  4WJQ A;  3U7D A;  2GBN A;  2WWZ A;  1TBE A;  1C1Y B;  3EFU A;  2KOX A;  2C9W B;  2MLB A;  3DDC B;  3TCA A;  3ML9 A;  2DAJ A;  1E8X A;  4ZRJ A;  1WZ3 A;  3MTN B;  4OVV A;  4IWP A;  5JHA A;  1WJU A;  1E8Z A;  2GBJ A;  4HPM B;  4NQL B;  2I1J A;  4HDQ A;  3JSV B;  1I42 A;  2KTF A;  3QHT A;  5L83 A;  4K1R B;  4DHJ D;  3OJ4 B;  5C1Z A;  2DZI A;  1WX9 A;  2K6D B;  1WXA A;  2FID A;  4K7U A;  5AZG A;  4HXD A;  1TTN A;  4MJS B;  3SD5 A;  1J8C A;  4LDT B;  2FAZ A;  3B0A A;  3HK0 A;  4AOF A;  4FAD A;  2ZNV C;  3OLM D;  3VVW B;  4KZC A;  1E5W A;  1WJ6 A;  4WJN A;  1KOT A;  2G45 B;  3DBR I;  1J19 A;  4FUL A;  4TUU A;  1WXS A;  2BYF A;  1R4N I;  2HTH A;  4IC7 B;  3IG3 A;  2WDT B;  2Z59 B;  3NHE B;  2MRP A;  5DPT A;  3KUZ A;  2L0T A;  2LUE A;  3PTF C;  4MGI E;  4CO7 A;  2KD0 A;  4FJZ A;  3T8M A;  2NBW B;  4AP4 C;  4GSW A;  1OGW A;  4GN1 A;  3V61 A;  4IG7 B;  1H4R A;  3DQV A;  3ZW3 A;  4ICU A;  3A4S C;  3SU8 X;  2KWC A;  3VTW A;  4CHK A;  4BBN C;  3PLU A;  4BKT A;  4GGQ A;  3A1Q A;  3P2B A;  3VH3 B;  2KK8 A;  5EDS A;  2LVO A;  2OJR A;  5DPR A;  2IYD B;  3K9P B;  4HJK A;  4LDT D;  4W9C A;  3H9D A;  3WAP A;  2DZM A;  3QIJ A;  3RCZ A;  4FA6 A;  4EOY A;  4RM9 A;  4MDK E;  3R7Q A;  3WAL A;  2M8S A;  5JH5 C;  1V80 A;  4LCD E;  2LI5 A;  2KC1 A;  2D10 A;  4W9F A;  2C7N B;  4HK2 A;  2BKF A;  3PPA A;  3TIX A;  3JYU A;  3AU5 A;  3W1S A;  4DDG D;  2KX3 A;  3HM6 X;  2LVQ A;  3ZO5 B;  2GOW A;  4NNJ B;  4AJW A;  2ZCB A;  3WAM A;  4GDK B;  2YVC A;  1WY8 A;  3L10 B;  2DYB A;  3PGE A;  2KHW B;  1E90 A;  1GG3 A;  4KIK A;  2MBH A;  4RM8 A;  4AWJ A;  3TMP B;  1WMH B;  5LXI B;  2KFJ A;  1UEL A;  4HDO A;  2IBI B;  1WM2 A;  5E6N A;  4K81 A;  3VUX A;  3APC A;  2KWV B;  4I6P A;  2DZJ A;  5LXH A;  1Z5S B;  4MEM A;  1HE8 A;  4F7Z A;  1EUV B;  3V6C B;  4ASW C;  2MQJ A;  1WE7 A;  3KUC B;  1WIA A;  4XZ4 A;  4PS7 A;  2LJ5 A;  4MSM B;  3PV1 A;  2FIF A;  3QCA A;  4FLH A;  3DOW A;  3WIM A;  3ZNZ B;  4NPN A;  3QK0 A;  4A3P A;  2O6V A;  2WX1 A;  2ZEQ A;  4PS3 A;  3ZIM A;  4ANW A;  3ZTD A;  3K9O B;  2KQ7 A;  4DWF A;  2BWF A;  3OAW A;  1Y8R C;  3VUY A;  4XX5 A;  2PE6 B;  3ECI A;  2GMI C;  4NAW A;  4FHK A;  2EKE C;  5IAA C;  4IM2 A;  3W1Y A;  1Q1O A;  4GOC A;  2J0K A;  3PHX B;  2JPH A;  4A20 A;  1RRB A;  3KW5 B;  3M95 A;  5BO4 B;  1WXM A;  3AI5 A;  3H7P A;  3QQ8 B;  4IM3 A;  4NY0 A;  3VAW A;  1LM8 B;  1SIF A;  4HLE A;  4BFR A;  2L7R A;  4BBN F;  2CS4 A;  1P98 A;  2KXJ A;  3DPD A;  3PHW B;  2EMS A;  3DVG Y;  4MEL A;  3RYT A;  2PJH A;  5D94 A;  1LXD A;  4W9L A;  1CMX B;  3T9L A;  3C0R B;  3UIP B;  4GDL A;  3S2A A;  3L08 A;  2L05 A;  3U30 A;  1OEY A;  2C5L C;  2IY1 B;  1EF1 A;  2JF5 A;  2KDF B;  1G6J A;  1E7U A;  3BY4 B;  1OQY A;  1KLV A;  1GNU A;  2ZZP B;  3ZUN A;  2L0F A;  3PRM B;  2JZ3 B;  4MM3 A;  4I6L B;  2GBK A;  3ALB A;  2FUH B;  1SGH A;  1V86 A;  2V1Y A;  3ZKJ C;  2ZNV B;  2BF8 B;  5J2R A;  2JXX A;  1WXV A;  1WH3 A;  2R2O A;  3SHQ A;  3QA8 A;  2PPH A;  3UIN B;  3BIN A;  3KUD B;  3RZF A;  3APF A;  5CHF A;  4TQ1 A;  1WYW B;  1PQS A;  3A9K A;  2ZCC A;  4RMA A;  1H8C A;  2KMC A;  4ANU A;  4FJV B;  3VDZ A;  2KX0 A;  1ZKH A;  3ZNI D;  1WGG A;  3AU4 A;  4KZ0 A;  3KYD D;  3HIZ A;  3B08 A;  2FNJ B;  5C23 A;  3JW0 X;  1R4M I;  2PE9 A;  3N32 A;  1L2N A;  2N9P C;  3GOE A;  3ZNG C;  1V6E A;  2KJH B;  2KDB A;  3R66 C;  1E8W A;  2MSE D;  2KDE B;  3LJ3 A;  3CST A;  1NI2 A;  1WX7 A;  2KJR A;  2W9N A;  3ONS A;  3A1Q B;  1BT0 A;  4WAA A;  4KDI C;  2IO1 B;  3CMM B;  2N1V A;  2K8H A;  2KDI A;  2MX2 A;  2K8B A;  3NZS A;  4I6N B;  3IFW B;  4OVU A;  3UQB A;  2CR5 A;  4KSL C;  5D2M B;  3DCG A;  2KN5 A;  2ZPN A;  3JSV A;  4F1S A;  3NS8 A;  2N7E A;  2DX5 B;  2NBU A;  5G2N A;  4E3C A;  2UYZ B;  2QHO A;  3PZD A;  3ZRC A;  2Y5B B;  2XEW A;  4B95 A;  5L95 C;  2LXA A;  2BGF A;  2WYQ A;  3DBL I;  1GC7 A;  3KYC D;  4ZRI A;  2PEA A;  4J6I A;  2KZR A;  4G0N B;  2RD0 A;  2N9E B;  4MJS A;  2CU1 A;  3CF6 E;  1WX8 A;  3JVZ X;  3MJW A;  3MHS D;  3A9J B;  4KIK B;  2M17 A;  2JVC A;  2NPT B;  3QAQ A;  4JIO U;  1P1A A;  4PYU A;  3I3T B;  4ZDV A;  2IO0 B;  2J0M A;  2DYO A;  3DVG X;  4MSQ B;  3L13 A;  3H7S A;  2DHZ A;  5KHQ A;  2REX A;  4TQ0 A;  1RAX A;  2AL3 A;  4G50 A;  2FCQ A;  2JY6 A;  2HE7 A;  3PLV A;  2KTR B;  3IVF A;  2M0X A;  3V62 A;  3N3K B;  3W1S C;  2LVP A;  3N30 A;  1IYF A;  2IZV B;  3DBS A;  3L54 A;  4AUQ C;  5D6J B;  3LDZ E;  3QX1 A;  3QC8 B;  2KJ6 A;  4HCP B;  4LJP B;  3RZW C;  3TBL D;  4N9F 4;  4DXA B;  1E7V A;  2BKR B;  2N9X A;  3Q3F A;  4TKN A;  3TJP A;  2XK5 A;  3IHP C;  4P7I A;  3VTU A;  2CHW A;  2G3Q B;  2K6Q A;  2L00 B;  3PRP B;  5TR5 A;  3PRE A;  4F8C B;  1D3Z A;  2UWQ A;  4W9G A;  2LRU A;  4NAW B;  2DYM A;  3APD A;  3DVN V;  4JGH B;  2YLM A;  3QWZ B;  3UF8 A;  1EO6 A;  5AEK B;  5JZE B;  2KMA A;  1P9D U;  4MGY E;  1LFD A;  1S1Q B;  2DZK A;  1TZ1 A;  3H7P B;  4FJY A;  3UIO B;  2KNB A;  5D7G A;  4DHZ E;  2AL6 A;  3L16 A;  1UD7 A;  2BYE A;  2D2Q A;  2DEN B;  1WZ0 A;  2MBO A;  4ANX A;  2MBB B;  4ZYN A;  4E71 A;  2IO2 B;  2MCN B;  1WM3 A;  4GDK A;  4W9D A;  5J17 A;  2B3A A;  2K1F A;  1X1M A;  3EEC A;  2N7D A;  4GDL B;  4PS8 A;  4BVU C;  4DHZ B;  2EMT A;  1V5O A;  2KVR A;  2V4L A;  1U4A A;  1UBQ A;  2MWS B;  5HKH A;  2RSU A;  2VRR B;  2O6V D;  3WAO A;  4PYZ A;  2MP2 A;  4MGZ E;  3VTV A;  3L17 A;  3DBH I;  3PSE B;  1V81 A;  4M0W B;  2J0J A;  3WAN A;  4LJO B;  4BKS A;  2JT4 B;  1XD3 B;  3RUI B;  2R2Q A;  2KAN A;  2LWP A;  4IW0 A;  4DDI D;  3HM3 A;  2KC2 A;  2FCN A;  3VUW A;  4B6W A;  2KQS A;  2M4N A;  1ZW7 A;  4G3X B;  4URK A;  2LZ6 A;  5CHW A;  4MGK E;  5KHO A;  3VH4 B;  2BPS A;  1MG8 A;  2MBQ A;  5JHB A;  2KFK A;  2KLG A;  3RD2 A;  3D32 A;  4ANV A;  5CX3 A;  2KLC A;  1WGY A;  4WWN A;  1LQB A;  1YJ1 A;  4FBJ B;  2XBB C;  1RFA A;  2C60 A;  2J7Q B;  4JLC A;  2JWZ A;  3U8Z A;  2CHX A;  2C7M B;  2C7H A;  4NQK E;  1UZX B;  2LGD A;  3KH0 A;  4JL9 A;  4MH0 E;  4TV3 A;  5E6P A;  3VHT C;  2JUO A;  3H1U A;  1V5T A;  2O2V A;  3V6E B;  1C3T A;  1M94 A;  1WE6 A;  2KO3 A;  3PRZ A;  1K8R B;  2OOB B;  3H6N A;  2G4S A;  1V49 A;  1WR1 A;  3NY5 A;  2LGY A;  3PVL A;  3AUL A;  4EUT A;  1GJZ A;  3ZNH B;  5AZH A;  5J18 A;  2KWU B;  4IWQ A;  4WWP A;  1P0R A;  1WR6 E;  2AWT A;  3L0W B;  5GMV A;  5DPS A;  4FHJ A;  4II2 B;  4IUM B;  4GB9 A;  5CTR C;  1YD8 U;  2Z0E B;  3M3J A;  3PS6 A;  4GU2 A;  3R7R A;  2JRH A;  4W9K A;  3UQA A;  5DPW A;  3ENE A;  4DBG A;  3A33 B;  4II3 B;  2FCS A;  4WJO A;  1OTR B;  4WWO A;  3OJ3 A;  1P3Q U;  3EC8 A;  2LXC A;  2NCN A;  2HJ8 A;  1KJT A;  3UGB B;  3A4R A;  4K7S A;  2NR2 A;  2RGF A;  1VCB A;  3M63 B;  4YL8 A;  3ML8 A;  3ZVV A;  4B9K A;  1YX5 B;  2LAS A;  1ISN A;  4BKG A;  3KVF B;  2I1K A;  3QJZ A;  1WF9 A;  4IM0 A;  2D3G A;  4G11 A;  3TL5 A;  2MBE A;  4EZJ A;  3RT3 B;  1EF5 A;  3ZLZ A;  2D07 B;  2A4Z A;  2KKC A;  2WX0 A;  4E74 A;  4XC2 A;  1UGM A;  4GIV A;  4M8M A;  5DCN A;  3ZDT A;  4DK5 A;  1WRD B;  2Z0D B;  2XK5 B;  1UH6 A;  1WGH A;  2LRW A;  2N1W A;  5CHV C;  4EZL A;  3R3M A;  1AAR A;  4WQO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...