2REXA

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
total genus 28
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rexA00
3DDCB 2FIDA 2XEWA 4II2B 2V1YA 4KIKB 2KDFB 3ZNZB 2FCQA 3EC8A 3NY5A 2D10A 4EEWA 2L8JA 2MQJA 4N9F4 1WJUA 5DCNA 2OOBB 3TJPA 1J19A 4DHZE 4EOYA 4HPMB 2KN5A 3TIXA 1WGDA 3DVGY 2XK5A 3DVNU 5CHVC 4MJSA 4M8MA 1WFYA 4NY0A 4M8NA 3UINB 4HLEA 1L2NA 2Z0DB 2MBHA 4TQ0A 3KYCD 4G50A 1V86A 2RGFA 1X1MA 3UF8A 3JW0X 1ZW7A 3DBHI 2CU1A 4ZRIA 2MLBA 2ZEQA 2L76A 3A9JB 1WRDB 1E7VA 2EMTA 2IO3B 2LGYA 2NS5A 3U7DA 5JZEB 1NBFC 1SIFA 1UZXB 3NZUA 3WA0A 2M0XA 4FULA 3DBSA 1WX8A 5E6NA 5JH5C 2N9PC 1BT0A 1R4NI 2MSED 3DVNV 2HE7A 3ZIMA 1A5RA 4HCNB 1WZ0A 1I35A 1YD8U 2YLMA 4DBGA 1WJ6A 3KUZA 3QARA 1PQSA 3RD2A 3AU4A 1JRUA 2MX2A 4WJPA 1YX6B 2B3AA 5J17A 1WF9A 2DAFA 3QQ8B 2ZNVB 2KK8A 4EZLA 4G3XB 3V62A 2OJRA 4CHKA 4BOSC 3GZNI 4EZJA 5CHFA 2AEHA 2M8SA 3A1QA 2D07B 5JHBA 3K9PB 4BKSA 1NI2A 1T0YA 3HIZA 4KV2A 2BYVE 1WYWB 3ZKJC 5IA7A 2K6DB 3M3JA 4HPLB 3PLVA 1P1AA 2KWVB 4IG7B 2KDIA 3PT2B 2D11A 4I6NB 2ZCCA 2KTFA 4HDQA 4NJ7A 2KC2A 4PS8A 5BO4B 2C7NB 2ZJDA 1WXVA 2GBMA 4AWJA 4TUUA 3WAPA 1Z5SB 2KLGA 3EECA 1UBQA 2KDBA 2LVPA 2MBOA 3VTWA 2BF8B 3V60A 1P0RA 5DPSA 1VCBA 1WE7A 3AI5A 3H6NA 3PHXB 4RMAA 4NNJB 3VUYA 3VVWB 5JHAA 4JQWC 1EF1A 1E8ZA 1UGMA 5FR6A 2DENB 2RR9A 3Q3JA 3CF6E 4KSLC 2G4DB 2PEAA 2L0FA 2BWES 2MBQA 4ZYNA 3RT3B 3NZSA 4HDOA 1OTRB 4I6LB 4W9CA 3IHPC 4IM0A 2VRRB 2RPQA 4LJPB 4ANUA 1G6JA 2L0TA 2KVRA 3TMPB 2A4ZA 4G11A 2CR5A 3B1LX 2ZPNA 1NDDA 2K8HA 3H7PB 3QA8A 5IAAC 4NAWA 3LJ3A 4AUQC 4TQ1A 2GBNA 5LLIA 2Z59B 3N3KB 2BYEA 3UIPB 4CO7A 4ZDVA 3VTUA 1P98A 3N30A 1ISNA 4FHJA 1KM7A 2DZIA 2KNBA 2MBEA 2R2OA 2C9WB 2JY6A 2C5LC 3IG3A 2LASA 2KFKA 2JT4B 1E8YA 2KOXA 4JL9A 2BGFA 2LXCA 3ENEA 3DCGA 4XX5A 4B9KA 5HKHA 3X23A 4ZRJA 1S1QB 2KKCA 1J8CA 3TBLD 1RFAA 2ZCBA 3VH4B 3RULA 5J18A 1QZEA 4MH0E 3A9KB 4NQKE 2J0KA 1CMXB 4AJYB 4MGKE 3ALBA 4IM2A 2LGDA 3PRZA 1EO6A 4KVGB 5AZGA 4BKTA 2M17A 3ZTCA 2DYOA 2DZJA 4MM3A 4BVUC 4JLCA 1H4RA 4MEMA 2FCMA 2KX3A 2LRUA 3QCAA 4ANWA 2N4FA 3T9LA 4NJ6A 1Q1OA 4NPNA 4URKA 5G55A 2EKEC 4OVUA 2DX5B 2O6VD 1YJ1A 2FCSA 2GBKA 2WWZA 4IWQA 1C1YB 2XK5B 2DZMA 2N1WA 4MJSB 1WZ3A 2C60A 2JZZA 4GDKA 3PRMB 4LCDE 2NVUI 3DBRI 3X0WA 2PE6B 1WXAA 1ZGUB 1WXSA 3PGEA 3RYTA 4DDGD 3ML8A 4FBJB 2JRIB 3VUWA 4HK2A 3APDA 2BYFA 1OGWA 2O2VA 3QHTA 4MGIE 3NHEB 3ZNGC 3M95A 3T8MA 1GC7A 4XZ4A 4EUTA 3JSVA 3DQVA 5TR5A 3WALA 2PJHA 3VUXA 2LGXA 2IO1B 2FUHB 3QK0A 5D94A 1IP9A 3N32A 2RSUA 1UH6A 1P3QU 5DPTA 2JZ3B 2LZ6A 2CHXA 1LM8B 2NPTA 4B95A 1I42A 3S2AA 2BPSA 4K81A 2Z0EB 3U8ZA 2ZVOA 3QJZA 4DHJB 2AYOB 2KZRA 1H8CA 1E8WA 3BY4B 3HK0A 2KHWB 4HCPB 3OJ4B 4W9JA 4JIOU 3ZW3A 1LFDA 1Y8RC 2K25A 1VD2A 3A33B 4GMVA 4ICVA 4GIVA 4A3PA 2JXXA 1WH3A 1WJ4A 1YQBA 2C7MB 3SDLC 3VHTC 4HXDA 1WM2A 2MCNB 3C0RB 3A1QB 4ZRKA 1V80A 3H9DA 3KYDD 1WJNA 1KJTA 2KLCA 1IYFA 5KHOA 2AL6A 2CKHB 3V6EB 3WAOA 2AWTA 2KTRA 4F8CB 4OVVA 2KJRA 4PS3A 4TKNA 4W9KA 5D7GA 3WIMA 4W9IA 3MTNB 1E7UA 2JVCA 3PLUA 3PHWB 2KMAA 4DDID 3A4SC 2C7HA 3IVFA 4NQLB 2IYDB 2KO3A 3AULA 2KWCA 1V5TA 1RLFA 1E5WA 4DHJD 1KOTA 2K8BA 3W1SA 2MA9B 4KZCA 3RCZA 2LXAA 4DHZB 2LVOA 1XD3B 2LUEA 2ZNVC 4MGYE 3KUCB 3MJWA 3CMMB 2K8CA 4FLHA 4WWOA 1ZKHA 2IO2B 4FJZA 3IFWB 4WQOB 3PVLA 2IY1B 1EF5A 3EFUA 2WX1A 3SU8X 3W1SC 5LXHA 2KDEB 1WM3A 4PYZA 1V5OA 5EDSA 1WXMA 2LJ5A 3ZTDA 3UQBA 2L05A 3PRPB 4IM3A 5E6PA 2MRPA 3ZNID 5C1ZA 1WGHA 2N1VA 4NAWB 1E8XA 3D32A 4PYUA 5L95C 3BINA 3L16A 4WJQA 4LDTB 2BKRB 2LI5A 4XC2A 1AARA 2NBUA 4AOFA 1UBIA 3WAMA 3QAQA 3ZVVA 3QIJA 4W9FA 3PREA 4LJOB 2L7RA 4GDLB 3HM3A 3HM6X 3P2BA 3R66C 4GB9A 4M0WB 1EUVB 1WGGA 4WJOA 2PE9A 2DZKA 2PPHA 3APCA 2NBWB 1YIWA 4K1RB 1UELA 1WGRA 3V6CB 3QWZB 4F7ZA 4J6IA 4GGQA 3H1UA 1F9JA 4I6PA 3LDZE 3VXWA 3PPAA 2FAZA 3JVZX 5C23A 4P7IA 3ZUNA 1V49A 2AL3A 1GUAB 2I1KA 3NS8A 3H7PA 1WY8A 3WANA 3M62B 2NR2A 3H7SA 2V4LA 3IBEA 3TL5A 4MELA 2FIFA 2HTHA 2HJ8A 3RZWC 2O6VA 1WMHA 4FHKA 4WWPA 1WX7A 1Q0WB 4FADA 3UQAA 5L83A 4ASWC 3B08A 2G45B 5CX3A 5G2NA 4DXAB 5D2MB 1KLVA 2EMSA 2A5UA 2KX0A 4CYEA 3R3MA 1XQQA 4FN2A 2RD0A 4YL8A 3SD5A 2UYZB 1V6EA 3CSTA 1LXDA 2KANA 4GDKB 3ZRCA 3ZDTA 1LQBA 2ZZPB 2DYBA 1TGZB 4IUMB 2MWSB 4E71A 3UIOB 2J0JA 5D6JB 2K1FA 1U4AA 5AEKB 3VH3B 4IWOA 2GOWA 3K9OB 5DPWA 2O2VB 3V61A 3ZLZA 2KWUB 1C3TA 3VDZA 2BKFA 1GJZA 3JSVB 1HE8A 2QHOA 2KQSA 2MP2A 4IC7B 3JYUA 4KIKA 3DPDA 2KJHB 2NBVB 3KVFB 3RZFA 4AP4C 3R7RA 3KH0A 2KMCA 3L0WB 4MDKE 3VQIA 1WX9A 2NPTB 4DK5A 1Q5WB 1P9DU 2N7EA 4II3B 5DPRA 3ECIA 4E3CA 4W9DA 1WR1A 1RAXA 2Y5BB 2HD5B 2J0MA 5J2RA 1Z2MA 2GBJA 2CS4A 1SE9A 3ZO5B 3PSEB 2IBIB 2DHZA 2I1JA 2MBBB 3A9JA 3RUIB 2IO0B 2K39A 4W9GA 4WJNA 3HHMA 2JF5A 4MSQB 4KZ0A 4DWFA 1WR6E 2BWFA 2YVCA 3DBLI 4GXBA 3OAWA 5CHWA 3KW5B 2GMIC 3A4RA 2KTRB 2LVQA 4W9LA 1R4MI 3OJ3A 2N9XA 4MGZE 4HVBA 3EHVA 4HWIB 2XBBC 2N9EB 2REXA 3ML9A 2G3QB 2ZVNA 3PZDA 4MSMB 4BOZB 1TZ1A 2M1MA 1V9JA 4BFRA 4BBNC 3PV1A 2KFJA 2DYMA 1OEYA 2FCNA 2KJ6A 2KC1A 2LWPA 1L7YA 1SGHA 2L00B 3U30A 4A20A 3APFA 4GOCA 2L3ZA 4G0NB 3O65B 2ZPYA 3ZDMC 4WWNA 4GN1A 4BKGA 2JRHA 4K7UA 1YX5B 3L54A 1V2YA 2LRWA 4EZKA 4FJVB 3VTVA 1MG8A 2KXJA 1XT9B 4KDLB 3TCAA 3ZRFA 4ANVA 4W9EA 4K7SA 2IY0B 1RRBA 4KSKC 4RM9A 1WI0A 4ICUA 1TTNA 4RM8A 3ZNHB 4WAAA 4BKSD 2D2QA 2NCNA 1IPGA 1TBEA 3SHQA 1FXTB 2J7QB 4GSWA 3L10B 4HJKA 4B6WA 4E74A 1V81A 3AXCA 3L08A 5KHQA 1K8RB 2KQ7A 1D3ZA 3W1YA 2KFKB 2V3SA 3Q3FA 5CTRC 2LD9A 4EFOA 4IWPA 1WGYA 3QX1A 2JUOA 2W9NA 4FA6A 2WX0A 3L13A 3GOEA 2IZVB 2GBRA 1GNUA 3PTFC 3I3TB 2R2QA 2G4SA 3MHSD 2UWQA 1UD7A 2O6VB 3L17A 4K7WA 4PS7A 1WMHB 2KD0A 2WYQA 3CSFA 4GU2A 3UGBB 4A3OA 4EKUA 1J0GA 3ONSA 5AZFA 3NOBA 3B0AA 4GDLA 3DOWA 5GMVA 4KDIC 4F1SA 2ASQA 3PS6A 4X57B 4IW0A 4LDTD 2FNJB 3OLMD 2N7DA 2MW5A 3KUDB 3R7QA 1WIAA 4JGHB 3VAWA 2K6QA 2DAJA 2WDTB 3M63B 5E6OA 1GC6A 5AZHA 2M4NA 2JWZA 3DVGX 4FJYA 1OEYJ 1M94A 2CHZA 3A9KA 1WE6A 3AU5A 3QC8B 5LXIB 4ANXA 4BBNF 1OQYA 1S3SG 2JPHA 1E90A 2D3GA 2CHWA 3VFKA 1GG3A 4W9HA 4AJWA 4TV3A 2MP2B
chains in the Genus database with same CATH superfamily
2VZKD 2XEWA 2V1YA 3ZNZB 3NY5A 4Q2JA 3U4EG 2D10A 4EEWA 4RGTA 3HVDA 3TIXA 1WGDA 3DVGY 4M8MA 3CWIA 3UINB 2Z0DB 2V4IB 2V0GA 2MLBA 4N6EB 1WRDB 2EMTA 1KF6B 2CJNA 3WA0A 1UZXB 2Y3AA 2LUMA 1TZOA 1R4NI 1NYQA 1A5RA 2BQQA 1YD8U 5I4DA 2YLMA 1WXQA 3RD2A 2QILA 3AU4A 1J7AA 4WJPA 5IKCM 1YX6B 1GAQB 4JPSA 3P4RB 5BYQA 2PVOD 4CHKA 3GZNI 3A1QA 1NI2A 1T0YA 1IUEA 3HIZA 4KV2A 1HA5A 3B9JA 4YTPB 3AH7A 3PLVA 1VZ7A 3I63C 5HHDG 1JCKB 2C7NB 3C8YA 2HDEA 1L0VB 3EECA 2LVPA 3AI5A 4RMAA 3MC0B 4NNJB 2BYTA 1E8ZA 1UWXA 2DLBA 2RR9A 3CF6E 4HDOA 1OTRB 4W9CA 3SFDB 2L0TA 2RDHA 3B1LX 5IAAC 3H7PB 1VLBA 4AUQC 4NAWA 4TQ1A 2GBNA 2IGGA 1JRPA 4CO7A 4ZDVA 1P98A 4WH4A 2C9WB 2WU2B 3URYA 4M0WA 2KOXA 2LXCA 3ENEA 4K3BA 3DCGA 4J3OD 4B9KA 1RWSA 2NTTA 4ZRJA 2ZCBA 3RULA 5J18A 4MH0E 3A9KB 4NQKE 4WQMA 4IM2A 1EO6A 3RN9C 4KVGB 2M17A 1FD6A 4BVUC 1H4RA 1WSPA 4MEMA 1F2RC 1OQQA 2LRUA 1WRIA 3QCAA 3T9LA 4NPNA 4OVUA 3W2DA 3NVVA 2FCSA 2GBKA 2ONQA 1C1YB 2QSDA 4OHJA 4MJSB 2JYTA 1WZ3A 2C60A 4GDKA 2L83A 3PGEA 4HK2A 3APDA 1OGWA 2O2VA 2PVGC 3NHEB 3NJTA 3ZGZA 3M95A 3VR9B 2PMVA 2FUHB 5D94A 1VDVA 2RMMA 3RMKC 5H92C 2NPTA 1BUIC 3Q8FA 4A8XC 4C56C 2Z0EB 2KZRA 3BY4B 4XYCA 5FK9C 4HCPB 3OJ4B 4JIOU 1JWUD 3LB8C 2WS3B 3A33B 4GMVA 3NVYA 4GIVA 4XWTA 4A3PA 2JXXA 1WH3A 1NENB 1QOFA 3VHTC 2MCNB 1DOYA 4PK1A 1PGBA 2CKHB 4WAFA 3P4SB 1AW7A 1XCQL 4OVVA 2KJRA 4PS3A 3NVWA 3FILB 1E7UA 2JVCA 2KMAA 4DDID 3A4SC 4LNOA 1T0RC 3IVFA 4NQLB 2KWCA 1UNSA 3LYYA 1RLFA 1E5WA 1KOTA 2K8BA 2MA9B 3Q3OC 3CIRB 2LUEA 2ZNVC 3KUCB 1FO4A 1SBBB 2AQ2B 4FJZA 2IO2B 3IXSA 5HFYA 5LNK1 5EDSA 2QDFA 2LJ5A 3ZTDA 1V8CA 3UQBA 5C1ZA 2W55A 3U7ZA 2N1VA 3AE5B 1DYQA 3AEEB 2KACA 4WJQA 1B9RA 1E0ZA 1VJKA 4AOFA 2E6XA 3QIJA 5D3IB 2EKIA 3P2BA 2W82A 3APCA 1WGRA 3QWZB 1WGKA 1F9JA 2QJLA 3VXWA 2CU3A 4P7IA 3IAM1 2FIFA 2TSSA 1NEKB 4WWPA 1MI0A 1HXYD 3U2SC 4ASWC 4DXAB 1IGDA 4JWSC 2N7JA 1KLVA 3GP7A 1XQQA 2RD0A 2V3PA 4YL8A 2OJWA 2D3BA 4YT0B 1TGZB 2MWSB 2WXRA 4WURA 3SFEB 1TKEA 5AEKB 2H88B 1XLOA 4IWOA 2GOWA 5EE9A 3ZLZA 2KWUB 4YTNB 2BKFA 3SR6A 2WXKA 2QEJC 1HE8A 4P16A 3JYUA 4O1NA 2KJHB 3MP9A 3RZFA 3R7RA 3KH0A 2KMCA 2WXOA 4QAYA 1HZ6A 4II3B 1P9DU 4YXDB 5DPRA 2ACZB 2J0MA 2W3RA 1Z2MA 2GBJA 2JQRB 3R8BA 2IBIB 1QQRA 2MBBB 4W9GA 1SEBD 1MHHE 4KZ0A 2VH1A 1WR6E 3DBLI 3KW5B 1I4HA 3N1ZC 5MPOA 1R4MI 2GLSA 3AE8B 4HVBA 3EHVA 4AS1A 2G3QB 1TZ1A 2M1MA 1QT9A 4BBNC 3PV1A 1I7HA 1QOBA 3U30A 4A20A 3APFA 4GOCA 2RDBC 4RFBA 2ZPYA 3GE3C 1YX5B 2LRWA 4EZKA 4YTMB 3VTVA 4KDLB 3TCAA 4W9EA 4K7SA 2IY0B 3T3OA 1P7EA 1WI0A 4RM8A 4WAAA 4ZRPA 1FXTB 2J7QB 1ESFA 4LTUA 1TY0A 3AXCA 1L4DB 3L08A 1FXIA 4EFOA 1SF0A 1ZUD2 4WIPA 3QX1A 1FXAA 4R3DA 1CQVA 1K52A 5BMGA 4HKQA 1QF6A 4AQ7A 3CSFA 3TUOA 3ZYYX 1E10A 1D5MC 4F1SA 3PS6A 4X57B 4LDTD 2FNJB 1ZE3D 4B0EA 2DAJA 1D5ZC 2M4NA 3Q6BA 2CHZA 3A9KA 3GS2A 1OQYA 1S3SG 1KTKA 1RM6C 1EWCA 2CHWA 1GG3A 3GE8C 4W9HA 4TV3A 4KKJA 1FFVA 2FIDA 4KIKB 1P7FA 4H2AA 2OOBB 4DHZE 2KN5A 2VH2A 4M01A 5CHVC 4MJSA 4NY0A 4HLEA 4M8NA 2MBHA 4G50A 4RH6A 2JSVX 2KAJA 2CU1A 1N5XA 3EA6A 2FUG1 3AEAB 1HTQA 2EELA 1SIFA 2M0XA 3DBSA 1WX8A 4C00A 5E6JA 1AYFA 3DWMA 1XEEA 3ZIMA 4USAA 4P6VF 1YN5A 1PQSA 3HRDD 1JRUA 2B3AA 1JROA 2DAFA 2ZNVB 4EZLA 4G3XB 1SJHD 2KN4A 2M8SA 1JWSD 1I4GA 3K9PB 4BKSA 3MJ5A 5IA7A 1HQRD 3M3JA 3Q2AC 2WDVB 4IG7B 2KDIA 1YQ3B 2K22A 3PT2B 3Q8BA 4NJ7A 2KTFA 2KC2A 4XE0A 4S0RA 1WXVA 1ROEA 3WAPA 3BYYB 2KLGA 1UBQA 2MBOA 3Q3MC 2JX5A 4KGRA 1WE7A 3MC9A 2LMCA 4PT5A 2BTEA 2BWES 2MBQA 4ZYNA 3RT3B 2OEDA 4IM0A 2VRRB 1YMHE 2X38A 3MFGA 1G6JA 2KMMA 3TMPB 2A4ZA 3AM9A 2CR5A 3QA8A 4A90A 1I4PA 2GRIA 2Z59B 3N3KB 2BYEA 3NVZA 3VTUA 5H8YE 3N30A 1ISNA 4FHJA 3ZJTA 2DZIA 3RNAC 3W9CB 3DBHB 1XXGA 2LASA 2KFKA 3KWLA 4JL9A 1F77A 1T3QA 2KKCA 1RFAA 1TIFA 4KX6B 2J0KA 1ZXHA 4MGKE 3ALBA 2FBWB 3PRZA 5AZGA 4BKTA 3ZTCA 3Q69A 4JLCA 4LNFA 4ACFA 2N0SB 4ANWA 5HG2A 4NJ6A 1Q1OA 4URKA 5G55A 2DX5B 1YJ1A 4IWQA 2WWZA 2XK5B 2N1WA 3AE7B 4DXFA 2BBCA 4LK0M 3X0WA 1WXAA 4LNIA 1WXSA 3KWVA 4MGIE 4WWMA 3O13A 2R61A 4TSSA 1GC7A 3T8MA 5TR5A 3WALA 1IP9A 2J53A 4K3CA 3ZXRA 1P3QU 1LM8B 1F2RI 3S2AA 4MT5A 2YEPF 4KKIA 2IDYA 3HK0A 4DXGA 4W9JA 5G5GA 2BB6A 1Y8RC 3TEXA 2N9KA 4YSZB 1WJ4A 1JMLA 1WM2A 3IT4B 3DHIC 1V80A 1EU4A 2D3AA 3KQ4A 1KJTA 3H8HA 4HROA 1FRDA 3WAOA 2I38A 2GB1A 4IKGA 4W9KA 3MTNB 3B2FA 5AUIA 2IYDB 2KO3A 5FKAC 4IOIE 1F52A 4MH8A 4DHJD 2KYWA 2LXAA 3EFCA 1XD3B 1I35A 1ZKHA 4WQOB 3SU8X 3PVLA 2IY1B 4PYZA 1WXMA 1FFUA 2L05A 3PRPB 4IM3A 2KDMA 5E6PA 1JALA 2KQ4X 3BYTB 1E8XA 1FEHA 3BINA 3L16A 1ZPSA 4LDTB 2BKRB 2G1EA 1KH0A 1AARA 1C76A 3QAQA 3NRZA 3R66C 3HM6X 4GB9A 3FC4A 2NBWB 4HKZE 4K1RB 2INNE 3T3NA 4J6IA 4GGQA 3H1UA 2FAZA 3JVZX 2AL3A 1GUAB 2ON8A 3DWGC 2MJEA 2HTHA 2WXMA 2HJ8A 2HTME 4MM3B 3TSSA 3B08A 1TKYA 5G2NA 5CX3A 2A5UA 4C7YA 4FN2A 2HJ1A 2UYZB 3ZRCA 2ZZPB 2DYBA 2GI9A 4E71A 5D6JB 1FM0D 2WXNA 1XLPA 1J7BA 1UF0A 1YN4A 1C3TA 3VDZA 3JSVB 1N62A 3Q3NC 4KIKA 4AP4C 1F0ZA 3BK2A 1NYRA 4DK5A 2N7EA 1TJEA 2WDQB 1C79A 4FXCA 3BWUD 5J2RA 1JWAD 1WWTA 2DHZA 2I1JA 2K39A 4WJNA 1SJED 3BZDB 1FNUA 2CJOA 4GXBA 5CHWA 3P4QB 3A4RA 1GOZA 1J7CA 4C7ZA 1I4XA 2N9XA 4OZBA 4HWIB 3HUIA 2XBBC 3B2GA 4BFRA 2IPKD 2FCNA 4RGMA 4G0NB 3O65B 4GN1A 1YQ4B 1V2YA 1MG8A 2KXJA 4ANVA 1RRBA 4KSKC 2MJ3A 2RDGA 2NCNA 3SHQA 3R2TA 4HJKA 4BZAA 3DHGC 4US8A 5KHQA 2KQ7A 2KFKB 2RPVA 1N63A 4L2YA 2Y5CA 2JUOA 2W9NA 1L0YB 4FA6A 3OWEB 2VZKB 3I3TB 1PDXA 2IGDA 3J9CA 4K7WA 1GPXA 4PS7A 1WMHB 1FIQA 4A3OA 4EKUA 3L4PA 4CQNA 2LGIA 5AZFA 3V3XA 3B0AA 4KDIC 1L0XB 1VR9A 1EWYC 1WIAA 4JGHB 2K6QA 3AU5A 3AE3B 3AEGB 4BBNF 5BMIA 2D3GA 4OZAA 3AE1B 2MP2B 3DDCB 1OFFA 2KDFB 4OZCA 1CJEA 3EC8A 2NMQA 2Z8LA 4N9F4 2XN9C 2XK5A 4C80A 1WFYA 2G9HD 4TQ0A 3KYCD 2WP9B 2RGFA 3ETRA 5BYRA 3A9JB 4LNNA 2NS5A 3U52E 2D3CA 3U7DA 1SXTA 3NZUA 5E6NA 5JH5C 1BT0A 4D2KA 3DVNV 1K50A 3TEZA 1WJ6A 3KUZA 1PGXA 1IGCA 2MX2A 3HVZA 5J17A 1JW9D 1WF9A 3QQ8B 4EZJA 5JHBA 2ZW1A 1WYWB 3ZKJC 5IN7A 4HPLB 4M00A 1GB4A 1P1AA 1T0QC 5FR3A 4I6NB 2ZCCA 3PO0A 4HDQA 4PS8A 5BO4B 1T6BX 2ZJDA 2JXTA 4AWJA 4TUUA 1Z5SB 3VTWA 2KDBA 2BF8B 1P0RA 1VCBA 3VUYA 3VVWB 3H6NA 1N5WA 3PHXB 5JHAA 3WCQA 1EF1A 1UGMA 5FR6A 2DENB 3Q3JA 1GB1A 3AE6B 2W54A 1KLUD 4I6LB 4LJPB 4ANUA 1AWDA 1T5XD 2KVRA 3NG0A 1NDDA 2K8HA 4ZHPA 1TS2A 1YJIA 5EE0A 2KNBA 2MBEA 2R2OA 2JY6A 3I9V1 4RF1A 3AECB 1E8YA 4LLGM 3E9SA 1UWMA 5G5HA 3X23A 1S1QB 3RNFC 1J8CA 3TBLD 4C4VB 1MJDA 1L6UA 1QZEA 3NS1A 2LGDA 4YWGG 3EGRA 1JWMD 1FCLA 4MM3A 1A70A 2FCMA 2INPE 3MHZA 1SE2A 2LHDA 2EKEC 2O6VD 3DHHC 3TEWA 4GLSC 1NI3A 2DZMA 2JZZA 3PRMB 2DWQA 2NVUI 4DDGD 4FBJB 2JRIB 2MH7A 2BYFA 3Q8CA 3QHTA 3KLSX 4RF0A 4XZ4A 4EUTA 3JSVA 3BIID 2PJHA 3VUXA 2LGXA 2IO1B 3QK0A 2QCZA 3N32A 1UH6A 5DPTA 1B1ZA 2LZ6A 2CHXA 3AEFB 3AE9B 1I42A 5D3DA 2BPSA 1BMLC 3U8ZA 2ZVOA 3QJZA 1H8CA 2KHWB 3N9YC 5BMHA 3AV8A 1UUPA 2K25A 1VD2A 1YQBA 2C7MB 4ZYSA 3C0RB 1WJNA 2KLCA 1IYFA 1YOVB 2AL6A 3V6EB 2AWTA 1HZ5A 4F8CB 1IBXB 1TS3A 5D7GA 3WIMA 4W9IA 1QLBB 3N1XC 3PLUA 3PHWB 2C7HA 4HJGE 1V5TA 5BYSA 4ARCA 3W1SA 2DBYA 4KZCA 1DOIA 4MGYE 3MJWA 3CMMB 4FLHA 1V97A 3IFWB 3W1SC 1V5OA 2WXLA 2MRPA 1WGHA 4XDDA 1V1PB 4PYUA 3I57A 4NZLB 2KT7A 2JZPA 1FMAD 2LI5A 4XC2A 1UBIA 2JU6X 3WAMA 2WHIA 3ZVVA 4W9FA 4LJOB 1XO3A 4ZOHC 4WJOA 2KVZA 1EUVB 4F7ZA 1FNVA 1VZ6A 3PPAA 4YSXB 2OHFA 3ZUNA 2IGHA 2WXQA 3NS8A 2L32A 1WY8A 2NR2A 3IBEA 4LNKA 2WXHA 1WMHA 4FHKA 4L1BA 1N61A 4HEA1 4FADA 1ENFA 3AEBB 4ZRQA 5D2MB 2EMSA 2KX0A 2KWDA 3SD5A 2M0AA 1V6EA 3I5JC 1LXDA 2KANA 1LQBA 1TYGB 2WXGA 4IUMB 2WDRB 4A55A 2K1FA 1U4AA 2DNFA 3VH3B 5AUKA 3K9OB 2LEKA 5DPWA 4XDCA 2XNAC 1PUTA 3SEBA 1GJZA 2I2YA 5EE1A 2MP2A 2PIAA 1BXTA 4IC7B 3Q14C 3DPDA 2NBVB 1NVID 3L0WB 4MDKE 3VQIA 1L5PA 1Q10A 1UGJA 1WR1A 1RAXA 2K3UA 2Y5BB 1HEZE 1HTOA 2CS4A 1SE9A 2BW2A 3PSEB 3RUIB 3A9JA 2IO0B 4KGTA 2BB5A 3HHMA 2JF5A 1MVKA 3RNCC 4A9AA 2WXFA 4DWFA 1YJJA 2GMIC 2KTRB 2LVQA 1TKGA 4MACA 4MGZE 2UU7A 2REXA 2ZVNA 3PZDA 4MSMB 3UI3A 4B0MA 1V9JA 2QMTA 1I4QA 4NJCA 1R7SA 2KFJA 2DYMA 2KJ6A 2KC1A 2LWPA 1SGHA 2L00B 2NTSA 3AB5A 3V05A 2L3ZA 4HRSA 4P1BC 4WWNA 1K53A 4BKGA 2JRHA 3L54A 2AX5A 4A6QA 5JXVA 1XT9B 3ZRFA 4RM9A 3ZNHB 1ZOYB 2K5PA 5GXGB 3P63A 4GSWA 4B6WA 1V81A 3E56A 3DBRB 4L23A 1AN8A 1D3ZA 2V3SA 1QILA 4IWPA 3NZ3A 2WX0A 3L13A 1MG4A 2J42A 1VRAB 2GBRA 1GNUA 2R2QA 3MHSD 2M19A 3L17A 2O6VB 3Q8AA 3UGBB 4ZHOA 3Q8EA 4HPPA 4GDLA 2L52A 1TT5B 2ASQA 1ET9A 3OLMD 2N7DA 2ICIA 3R7QA 2WDTB 5E6OA 4C4VA 4S17A 3DBLB 3DVGX 1M94A 3ABVB 1WE6A 3BK1A 1WYGA 3ZQ4A 1R4MB 1E90A 1L6VA 1TS5A 4TMAB 2WGSA 4II2B 3FKYA 1F1HA 1TS4A 2FCQA 2L8JA 3RFZB 2MQJA 5DCNA 1WJUA 5HI1A 3TJPA 1J19A 1L4ZB 4EOYA 4HPMB 3DVNU 2LHEA 1L2NA 1V86A 2Y5PA 1X1MA 3UF8A 1MHXA 3JW0X 1ZW7A 3DBHI 1TY2A 4ZRIA 5IOIA 2ZEQA 2L76A 3RI7C 1E7VA 1YNTE 2IO3B 2LGYA 3GB1A 5JZEB 4RCOA 1NBFC 2BVCA 1QOGA 3FAHA 4FULA 2N9PC 2SEBD 3VRBB 1QOAA 2MSED 3N20C 2HE7A 1JQ4A 1STEA 4HCNB 1WZ0A 4DBGA 2MEKA 3QARA 3W5VB 1PYWD 4NAMA 1ACCA 3RNBC 2KK8A 3PZ8A 2WNMA 3V62A 2OJRA 3RPFC 4BOSC 1ZP0B 5CHFA 2AEHA 2D07B 2BYVE 2K6DB 3BVGA 1IBXA 2KWVB 1SSNA 2D11A 4JE3B 5IO9A 1ET6A 3AEDB 2WQYB 2PW9A 2GBMA 1C4CA 5T8IA 1N6ZA 1E6EB 5DPSA 1D4BA 4JQWC 1ZDXA 4JX1C 4KSLC 2G4DB 2PEAA 2L0FA 3NZSA 1FPYA 3IHPC 2RPQA 1LO5D 4G11A 2ZPNA 1V1PA 3LJ3A 2WXPA 5LLIA 3W5UB 3UIPB 1KM7A 1RFKA 3AE2B 2C5LC 3IG3A 5IP4D 1FNWA 2JT4B 2BGFA 5HKHA 2WLBA 4XX5A 3VH4B 1CMXB 4AJYB 2DYOA 3LXFA 2DZJA 5EE3A 2J4XA 4EE2A 2KX3A 4ITKA 3TEYA 2N4FA 3BVMA 2K0PA 4OVZA 4JWUC 4N58A 1FCCC 4LCDE 3DBRI 2V3NA 2PE6B 1ZGUB 3RYTA 3ML8A 3VUWA 3ZNGC 2H89B 2K9XA 1N60A 3DQVA 1SIJA 2RSUA 2PTLA 2JZ3B 3AN1A 3RNEC 4B95A 4K81A 3VRAB 4DHJB 2AYOB 1E8WA 2JYEA 3ZW3A 1LFDA 2V9HA 4ICVA 4YSYB 2BS3B 5C2TB 3SDLC 3N1YC 4HXDA 3A1QB 4ZRKA 1K51A 1M4VA 3H9DA 3KYDD 5KHOA 2KTRA 1QKZA 4TKNA 2FE8A 1XLQA 1XF5L 3ZJUA 3MC8A 3AULA 1E7PB 2QIEB 3P42A 3RCZA 4DHZB 2MJDA 2LVOA 4WWOA 2K8CA 3IAS1 5LXHA 1EF5A 3EFUA 2WX1A 4DQOC 1EM7A 2YEPB 2KDEB 1WM3A 3PZ7A 1EU3A 1SE4A 3AMZA 3RNGC 3P1MA 3ZNID 1D5XC 4NAWB 3D32A 3EUB2 2JWUA 2B76B 5L95C 1V1OA 1C77A 2NBUA 2WU5B 2E3TA 3PREA 2L7RA 4GDLB 2LFIA 3HM3A 3V60A 3VR8B 4M0WB 4ARIA 1WGGA 2PE9A 3IT6B 2DZKA 2PKOA 2PPHA 2WXIA 1I4RA 1YIWA 1UELA 3ZJVA 3V6CB 4I6PA 4UDUC 3LDZE 5C23A 1V49A 2I1KA 3H7PA 3WANA 3M62B 4RNAA 1R4NB 2V4LA 3H7SA 4XGAB 1KLGD 4MELA 3TL5A 3RZWC 2O6VA 1LGRA 2PLPA 2L1AA 4M02A 1WX7A 1Q0WB 1KRHA 2X8XX 3UQAA 5L83A 1VZ8A 2AQ1B 2BS4B 2G45B 1JWBD 4REZA 4CYEA 5C3JB 1YN3A 2LJIA 1OQRA 3R3MA 1DGJA 2J52A 3P4PB 3CSTA 4GDKB 3ZDTA 3GZNB 2BT6A 3UIOB 2J0JA 2O2VB 3V61A 2QHOA 2Q5WD 3R2IA 2KQSA 2ZW0A 1CK1A 1C4PA 3KVFB 1T0SC 1WX9A 2NPTB 1Q5WB 3ECIA 4E3CA 4W9DA 1FRRA 2INCC 2HD5B 4XWWA 2SAKA 3ZO5B 1PGAA 3C19A 2AQ3B 5TSSA 1C78A 4MSQB 1Y56A 2BWFA 2YVCA 3OAWA 4W9LA 3OG5A 4OW0A 3OJ3A 2N9EB 1ZXIA 2INDC 3ML9A 1DOXA 4BOZB 1MFWA 2WXJA 1OEYA 1KFYB 1L7YA 1XCTL 1PFDA 3ZDMC 4K7UA 4FJVB 2M56B 3FILA 4ICUA 1TTNA 4BKSD 2D2QA 1IPGA 1TBEA 1CZPA 1MPEA 4E74A 3L10B 2BS2B 3ZXVA 4KGSA 2QC8A 1K8RB 3W1YA 1SE3A 1C4AA 1ZDVA 3Q3FA 5CTRC 2LD9A 1WGYA 4RGNA 2MHJA 4P1CC 4RGOS 1RYJA 3GOEA 4BAXA 2IZVB 3PTFC 2G4SA 2D5GA 2UWQA 2W3SA 1UD7A 2KD0A 3NUHB 2WYQA 4GU2A 3AE4B 3BVZA 1J0GA 3ONSA 2N9LA 3NOBA 3DOWA 5GMVA 4IW0A 1XLNA 1D6EC 2IJ0A 2MW5A 3KUDB 4IDIA 3VAWA 3M63B 1GC6A 5AZHA 2JWZA 4FJYA 1OEYJ 2LGSA 4US9A 1C9FA 3QC8B 5LXIB 4ANXA 1SB3C 1E9MA 2JPHA 3VFKA 4AJWA 4N59A
chains in the Genus database with same CATH topology
3DDCB 2FIDA 2XEWA 4II2B 2V1YA 4KIKB 2KDFB 3ZNZB 2FCQA 3EC8A 3NY5A 2D10A 4EEWA 2L8JA 2MQJA 4N9F4 1WJUA 5DCNA 2OOBB 3TJPA 1J19A 4DHZE 4EOYA 4HPMB 2KN5A 3TIXA 1WGDA 3DVGY 2XK5A 3DVNU 5CHVC 4MJSA 4M8MA 1WFYA 4NY0A 4M8NA 3UINB 4HLEA 1L2NA 2Z0DB 2MBHA 4TQ0A 3KYCD 4G50A 1V86A 2RGFA 1X1MA 3UF8A 3JW0X 1ZW7A 3DBHI 2CU1A 4ZRIA 2MLBA 2ZEQA 2L76A 3A9JB 1WRDB 1E7VA 2EMTA 2IO3B 2LGYA 2NS5A 3U7DA 5JZEB 1NBFC 1SIFA 1UZXB 3NZUA 3WA0A 2M0XA 4FULA 3DBSA 1WX8A 5E6NA 5JH5C 2N9PC 1BT0A 1R4NI 2MSED 3DVNV 2HE7A 3ZIMA 1A5RA 4HCNB 1WZ0A 1I35A 1YD8U 2YLMA 4DBGA 1WJ6A 3KUZA 3QARA 1PQSA 3RD2A 3AU4A 1JRUA 2MX2A 4WJPA 1YX6B 2B3AA 5J17A 1WF9A 2DAFA 3QQ8B 2ZNVB 2KK8A 4EZLA 4G3XB 3V62A 2OJRA 4CHKA 4BOSC 3GZNI 4EZJA 5CHFA 2AEHA 2M8SA 3A1QA 2D07B 5JHBA 3K9PB 4BKSA 1NI2A 1T0YA 3HIZA 4KV2A 2BYVE 1WYWB 3ZKJC 5IA7A 2K6DB 3M3JA 4HPLB 3PLVA 1P1AA 2KWVB 4IG7B 2KDIA 3PT2B 2D11A 4I6NB 2ZCCA 2KTFA 4HDQA 4NJ7A 2KC2A 4PS8A 5BO4B 2C7NB 2ZJDA 1WXVA 2GBMA 4AWJA 4TUUA 3WAPA 1Z5SB 2KLGA 3EECA 1UBQA 2KDBA 2LVPA 2MBOA 3VTWA 2BF8B 3V60A 1P0RA 5DPSA 1VCBA 1WE7A 3AI5A 3H6NA 3PHXB 4RMAA 4NNJB 3VUYA 3VVWB 5JHAA 4JQWC 1EF1A 1E8ZA 1UGMA 5FR6A 2DENB 2RR9A 3Q3JA 3CF6E 4KSLC 2G4DB 2PEAA 2L0FA 2BWES 2MBQA 4ZYNA 3RT3B 3NZSA 4HDOA 1OTRB 4I6LB 4W9CA 3IHPC 4IM0A 2VRRB 2RPQA 4LJPB 4ANUA 1G6JA 2L0TA 2KVRA 3TMPB 2A4ZA 4G11A 2CR5A 3B1LX 2ZPNA 1NDDA 2K8HA 3H7PB 3QA8A 5IAAC 4NAWA 3LJ3A 4AUQC 4TQ1A 2GBNA 5LLIA 2Z59B 3N3KB 2BYEA 3UIPB 4CO7A 4ZDVA 3VTUA 1P98A 3N30A 1ISNA 4FHJA 1KM7A 2DZIA 2KNBA 2MBEA 2R2OA 2C9WB 2JY6A 2C5LC 3IG3A 2LASA 2KFKA 2JT4B 1E8YA 2KOXA 4JL9A 2BGFA 2LXCA 3ENEA 3DCGA 4XX5A 4B9KA 5HKHA 3X23A 4ZRJA 1S1QB 2KKCA 1J8CA 3TBLD 1RFAA 2ZCBA 3VH4B 3RULA 5J18A 1QZEA 4MH0E 3A9KB 4NQKE 2J0KA 1CMXB 4AJYB 4MGKE 3ALBA 4IM2A 2LGDA 3PRZA 1EO6A 4KVGB 5AZGA 4BKTA 2M17A 3ZTCA 2DYOA 2DZJA 4MM3A 4BVUC 4JLCA 1H4RA 4MEMA 2FCMA 2KX3A 2LRUA 3QCAA 4ANWA 2N4FA 3T9LA 4NJ6A 1Q1OA 4NPNA 4URKA 5G55A 2EKEC 4OVUA 2DX5B 2O6VD 1YJ1A 2FCSA 2GBKA 2WWZA 4IWQA 1C1YB 2XK5B 2DZMA 2N1WA 4MJSB 1WZ3A 2C60A 2JZZA 4GDKA 3PRMB 4LCDE 2NVUI 3DBRI 3X0WA 2PE6B 1WXAA 1ZGUB 1WXSA 3PGEA 3RYTA 4DDGD 3ML8A 4FBJB 2JRIB 3VUWA 4HK2A 3APDA 2BYFA 1OGWA 2O2VA 3QHTA 4MGIE 3NHEB 3ZNGC 3M95A 3T8MA 1GC7A 4XZ4A 4EUTA 3JSVA 3DQVA 5TR5A 3WALA 2PJHA 3VUXA 2LGXA 2IO1B 2FUHB 3QK0A 5D94A 1IP9A 3N32A 2RSUA 1UH6A 1P3QU 5DPTA 2JZ3B 2LZ6A 2CHXA 1LM8B 2NPTA 4B95A 1I42A 3S2AA 2BPSA 4K81A 2Z0EB 3U8ZA 2ZVOA 3QJZA 4DHJB 2AYOB 2KZRA 1H8CA 1E8WA 3BY4B 3HK0A 2KHWB 4HCPB 3OJ4B 4W9JA 4JIOU 3ZW3A 1LFDA 1Y8RC 2K25A 1VD2A 3A33B 4GMVA 4ICVA 4GIVA 4A3PA 2JXXA 1WH3A 1WJ4A 1YQBA 2C7MB 3SDLC 3VHTC 4HXDA 1WM2A 2MCNB 3C0RB 3A1QB 4ZRKA 1V80A 3H9DA 3KYDD 1WJNA 1KJTA 2KLCA 1IYFA 5KHOA 2AL6A 2CKHB 3V6EB 3WAOA 2AWTA 2KTRA 4F8CB 4OVVA 2KJRA 4PS3A 4TKNA 4W9KA 5D7GA 3WIMA 4W9IA 3MTNB 1E7UA 2JVCA 3PLUA 3PHWB 2KMAA 4DDID 3A4SC 2C7HA 3IVFA 4NQLB 2IYDB 2KO3A 3AULA 2KWCA 1V5TA 1RLFA 1E5WA 4DHJD 1KOTA 2K8BA 3W1SA 2MA9B 4KZCA 3RCZA 2LXAA 4DHZB 2LVOA 1XD3B 2LUEA 2ZNVC 4MGYE 3KUCB 3MJWA 3CMMB 2K8CA 4FLHA 4WWOA 1ZKHA 2IO2B 4FJZA 3IFWB 4WQOB 3PVLA 2IY1B 1EF5A 3EFUA 2WX1A 3SU8X 3W1SC 5LXHA 2KDEB 1WM3A 4PYZA 1V5OA 5EDSA 1WXMA 2LJ5A 3ZTDA 3UQBA 2L05A 3PRPB 4IM3A 5E6PA 2MRPA 3ZNID 5C1ZA 1WGHA 2N1VA 4NAWB 1E8XA 3D32A 4PYUA 5L95C 3BINA 3L16A 4WJQA 4LDTB 2BKRB 2LI5A 4XC2A 1AARA 2NBUA 4AOFA 1UBIA 3WAMA 3QAQA 3ZVVA 3QIJA 4W9FA 3PREA 4LJOB 2L7RA 4GDLB 3HM3A 3HM6X 3P2BA 3R66C 4GB9A 4M0WB 1EUVB 1WGGA 4WJOA 2PE9A 2DZKA 2PPHA 3APCA 2NBWB 1YIWA 4K1RB 1UELA 1WGRA 3V6CB 3QWZB 4F7ZA 4J6IA 4GGQA 3H1UA 1F9JA 4I6PA 3LDZE 3VXWA 3PPAA 2FAZA 3JVZX 5C23A 4P7IA 3ZUNA 1V49A 2AL3A 1GUAB 2I1KA 3NS8A 3H7PA 1WY8A 3WANA 3M62B 2NR2A 3H7SA 2V4LA 3IBEA 3TL5A 4MELA 2FIFA 2HTHA 2HJ8A 3RZWC 2O6VA 1WMHA 4FHKA 4WWPA 1WX7A 1Q0WB 4FADA 3UQAA 5L83A 4ASWC 3B08A 2G45B 5CX3A 5G2NA 4DXAB 5D2MB 1KLVA 2EMSA 2A5UA 2KX0A 4CYEA 3R3MA 1XQQA 4FN2A 2RD0A 4YL8A 3SD5A 2UYZB 1V6EA 3CSTA 1LXDA 2KANA 4GDKB 3ZRCA 3ZDTA 1LQBA 2ZZPB 2DYBA 1TGZB 4IUMB 2MWSB 4E71A 3UIOB 2J0JA 5D6JB 2K1FA 1U4AA 5AEKB 3VH3B 4IWOA 2GOWA 3K9OB 5DPWA 2O2VB 3V61A 3ZLZA 2KWUB 1C3TA 3VDZA 2BKFA 1GJZA 3JSVB 1HE8A 2QHOA 2KQSA 2MP2A 4IC7B 3JYUA 4KIKA 3DPDA 2KJHB 2NBVB 3KVFB 3RZFA 4AP4C 3R7RA 3KH0A 2KMCA 3L0WB 4MDKE 3VQIA 1WX9A 2NPTB 4DK5A 1Q5WB 1P9DU 2N7EA 4II3B 5DPRA 3ECIA 4E3CA 4W9DA 1WR1A 1RAXA 2Y5BB 2HD5B 2J0MA 5J2RA 1Z2MA 2GBJA 2CS4A 1SE9A 3ZO5B 3PSEB 2IBIB 2DHZA 2I1JA 2MBBB 3A9JA 3RUIB 2IO0B 2K39A 4W9GA 4WJNA 3HHMA 2JF5A 4MSQB 4KZ0A 4DWFA 1WR6E 2BWFA 2YVCA 3DBLI 4GXBA 3OAWA 5CHWA 3KW5B 2GMIC 3A4RA 2KTRB 2LVQA 4W9LA 1R4MI 3OJ3A 2N9XA 4MGZE 4HVBA 3EHVA 4HWIB 2XBBC 2N9EB 2REXA 3ML9A 2G3QB 2ZVNA 3PZDA 4MSMB 4BOZB 1TZ1A 2M1MA 1V9JA 4BFRA 4BBNC 3PV1A 2KFJA 2DYMA 1OEYA 2FCNA 2KJ6A 2KC1A 2LWPA 1L7YA 1SGHA 2L00B 3U30A 4A20A 3APFA 4GOCA 2L3ZA 4G0NB 3O65B 2ZPYA 3ZDMC 4WWNA 4GN1A 4BKGA 2JRHA 4K7UA 1YX5B 3L54A 1V2YA 2LRWA 4EZKA 4FJVB 3VTVA 1MG8A 2KXJA 1XT9B 4KDLB 3TCAA 3ZRFA 4ANVA 4W9EA 4K7SA 2IY0B 1RRBA 4KSKC 4RM9A 1WI0A 4ICUA 1TTNA 4RM8A 3ZNHB 4WAAA 4BKSD 2D2QA 2NCNA 1IPGA 1TBEA 3SHQA 1FXTB 2J7QB 4GSWA 3L10B 4HJKA 4B6WA 4E74A 1V81A 3AXCA 3L08A 5KHQA 1K8RB 2KQ7A 1D3ZA 3W1YA 2KFKB 2V3SA 3Q3FA 5CTRC 2LD9A 4EFOA 4IWPA 1WGYA 3QX1A 2JUOA 2W9NA 4FA6A 2WX0A 3L13A 3GOEA 2IZVB 2GBRA 1GNUA 3PTFC 3I3TB 2R2QA 2G4SA 3MHSD 2UWQA 1UD7A 2O6VB 3L17A 4K7WA 4PS7A 1WMHB 2KD0A 2WYQA 3CSFA 4GU2A 3UGBB 4A3OA 4EKUA 1J0GA 3ONSA 5AZFA 3NOBA 3B0AA 4GDLA 3DOWA 5GMVA 4KDIC 4F1SA 2ASQA 3PS6A 4X57B 4IW0A 4LDTD 2FNJB 3OLMD 2N7DA 2MW5A 3KUDB 3R7QA 1WIAA 4JGHB 3VAWA 2K6QA 2DAJA 2WDTB 3M63B 5E6OA 1GC6A 5AZHA 2M4NA 2JWZA 3DVGX 4FJYA 1OEYJ 1M94A 2CHZA 3A9KA 1WE6A 3AU5A 3QC8B 5LXIB 4ANXA 4BBNF 1OQYA 1S3SG 2JPHA 1E90A 2D3GA 2CHWA 3VFKA 1GG3A 4W9HA 4AJWA 4TV3A 2MP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDC B;  2FID A;  2XEW A;  4II2 B;  2V1Y A;  4KIK B;  2KDF B;  3ZNZ B;  2FCQ A;  3EC8 A;  3NY5 A;  2D10 A;  4EEW A;  2L8J A;  2MQJ A;  4N9F 4;  1WJU A;  5DCN A;  2OOB B;  3TJP A;  1J19 A;  4DHZ E;  4EOY A;  4HPM B;  2KN5 A;  3TIX A;  1WGD A;  3DVG Y;  2XK5 A;  3DVN U;  5CHV C;  4MJS A;  4M8M A;  1WFY A;  4NY0 A;  4M8N A;  3UIN B;  4HLE A;  1L2N A;  2Z0D B;  2MBH A;  4TQ0 A;  3KYC D;  4G50 A;  1V86 A;  2RGF A;  1X1M A;  3UF8 A;  3JW0 X;  1ZW7 A;  3DBH I;  2CU1 A;  4ZRI A;  2MLB A;  2ZEQ A;  2L76 A;  3A9J B;  1WRD B;  1E7V A;  2EMT A;  2IO3 B;  2LGY A;  2NS5 A;  3U7D A;  5JZE B;  1NBF C;  1SIF A;  1UZX B;  3NZU A;  3WA0 A;  2M0X A;  4FUL A;  3DBS A;  1WX8 A;  5E6N A;  5JH5 C;  2N9P C;  1BT0 A;  1R4N I;  2MSE D;  3DVN V;  2HE7 A;  3ZIM A;  1A5R A;  4HCN B;  1WZ0 A;  1I35 A;  1YD8 U;  2YLM A;  4DBG A;  1WJ6 A;  3KUZ A;  3QAR A;  1PQS A;  3RD2 A;  3AU4 A;  1JRU A;  2MX2 A;  4WJP A;  1YX6 B;  2B3A A;  5J17 A;  1WF9 A;  2DAF A;  3QQ8 B;  2ZNV B;  2KK8 A;  4EZL A;  4G3X B;  3V62 A;  2OJR A;  4CHK A;  4BOS C;  3GZN I;  4EZJ A;  5CHF A;  2AEH A;  2M8S A;  3A1Q A;  2D07 B;  5JHB A;  3K9P B;  4BKS A;  1NI2 A;  1T0Y A;  3HIZ A;  4KV2 A;  2BYV E;  1WYW B;  3ZKJ C;  5IA7 A;  2K6D B;  3M3J A;  4HPL B;  3PLV A;  1P1A A;  2KWV B;  4IG7 B;  2KDI A;  3PT2 B;  2D11 A;  4I6N B;  2ZCC A;  2KTF A;  4HDQ A;  4NJ7 A;  2KC2 A;  4PS8 A;  5BO4 B;  2C7N B;  2ZJD A;  1WXV A;  2GBM A;  4AWJ A;  4TUU A;  3WAP A;  1Z5S B;  2KLG A;  3EEC A;  1UBQ A;  2KDB A;  2LVP A;  2MBO A;  3VTW A;  2BF8 B;  3V60 A;  1P0R A;  5DPS A;  1VCB A;  1WE7 A;  3AI5 A;  3H6N A;  3PHX B;  4RMA A;  4NNJ B;  3VUY A;  3VVW B;  5JHA A;  4JQW C;  1EF1 A;  1E8Z A;  1UGM A;  5FR6 A;  2DEN B;  2RR9 A;  3Q3J A;  3CF6 E;  4KSL C;  2G4D B;  2PEA A;  2L0F A;  2BWE S;  2MBQ A;  4ZYN A;  3RT3 B;  3NZS A;  4HDO A;  1OTR B;  4I6L B;  4W9C A;  3IHP C;  4IM0 A;  2VRR B;  2RPQ A;  4LJP B;  4ANU A;  1G6J A;  2L0T A;  2KVR A;  3TMP B;  2A4Z A;  4G11 A;  2CR5 A;  3B1L X;  2ZPN A;  1NDD A;  2K8H A;  3H7P B;  3QA8 A;  5IAA C;  4NAW A;  3LJ3 A;  4AUQ C;  4TQ1 A;  2GBN A;  5LLI A;  2Z59 B;  3N3K B;  2BYE A;  3UIP B;  4CO7 A;  4ZDV A;  3VTU A;  1P98 A;  3N30 A;  1ISN A;  4FHJ A;  1KM7 A;  2DZI A;  2KNB A;  2MBE A;  2R2O A;  2C9W B;  2JY6 A;  2C5L C;  3IG3 A;  2LAS A;  2KFK A;  2JT4 B;  1E8Y A;  2KOX A;  4JL9 A;  2BGF A;  2LXC A;  3ENE A;  3DCG A;  4XX5 A;  4B9K A;  5HKH A;  3X23 A;  4ZRJ A;  1S1Q B;  2KKC A;  1J8C A;  3TBL D;  1RFA A;  2ZCB A;  3VH4 B;  3RUL A;  5J18 A;  1QZE A;  4MH0 E;  3A9K B;  4NQK E;  2J0K A;  1CMX B;  4AJY B;  4MGK E;  3ALB A;  4IM2 A;  2LGD A;  3PRZ A;  1EO6 A;  4KVG B;  5AZG A;  4BKT A;  2M17 A;  3ZTC A;  2DYO A;  2DZJ A;  4MM3 A;  4BVU C;  4JLC A;  1H4R A;  4MEM A;  2FCM A;  2KX3 A;  2LRU A;  3QCA A;  4ANW A;  2N4F A;  3T9L A;  4NJ6 A;  1Q1O A;  4NPN A;  4URK A;  5G55 A;  2EKE C;  4OVU A;  2DX5 B;  2O6V D;  1YJ1 A;  2FCS A;  2GBK A;  2WWZ A;  4IWQ A;  1C1Y B;  2XK5 B;  2DZM A;  2N1W A;  4MJS B;  1WZ3 A;  2C60 A;  2JZZ A;  4GDK A;  3PRM B;  4LCD E;  2NVU I;  3DBR I;  3X0W A;  2PE6 B;  1WXA A;  1ZGU B;  1WXS A;  3PGE A;  3RYT A;  4DDG D;  3ML8 A;  4FBJ B;  2JRI B;  3VUW A;  4HK2 A;  3APD A;  2BYF A;  1OGW A;  2O2V A;  3QHT A;  4MGI E;  3NHE B;  3ZNG C;  3M95 A;  3T8M A;  1GC7 A;  4XZ4 A;  4EUT A;  3JSV A;  3DQV A;  5TR5 A;  3WAL A;  2PJH A;  3VUX A;  2LGX A;  2IO1 B;  2FUH B;  3QK0 A;  5D94 A;  1IP9 A;  3N32 A;  2RSU A;  1UH6 A;  1P3Q U;  5DPT A;  2JZ3 B;  2LZ6 A;  2CHX A;  1LM8 B;  2NPT A;  4B95 A;  1I42 A;  3S2A A;  2BPS A;  4K81 A;  2Z0E B;  3U8Z A;  2ZVO A;  3QJZ A;  4DHJ B;  2AYO B;  2KZR A;  1H8C A;  1E8W A;  3BY4 B;  3HK0 A;  2KHW B;  4HCP B;  3OJ4 B;  4W9J A;  4JIO U;  3ZW3 A;  1LFD A;  1Y8R C;  2K25 A;  1VD2 A;  3A33 B;  4GMV A;  4ICV A;  4GIV A;  4A3P A;  2JXX A;  1WH3 A;  1WJ4 A;  1YQB A;  2C7M B;  3SDL C;  3VHT C;  4HXD A;  1WM2 A;  2MCN B;  3C0R B;  3A1Q B;  4ZRK A;  1V80 A;  3H9D A;  3KYD D;  1WJN A;  1KJT A;  2KLC A;  1IYF A;  5KHO A;  2AL6 A;  2CKH B;  3V6E B;  3WAO A;  2AWT A;  2KTR A;  4F8C B;  4OVV A;  2KJR A;  4PS3 A;  4TKN A;  4W9K A;  5D7G A;  3WIM A;  4W9I A;  3MTN B;  1E7U A;  2JVC A;  3PLU A;  3PHW B;  2KMA A;  4DDI D;  3A4S C;  2C7H A;  3IVF A;  4NQL B;  2IYD B;  2KO3 A;  3AUL A;  2KWC A;  1V5T A;  1RLF A;  1E5W A;  4DHJ D;  1KOT A;  2K8B A;  3W1S A;  2MA9 B;  4KZC A;  3RCZ A;  2LXA A;  4DHZ B;  2LVO A;  1XD3 B;  2LUE A;  2ZNV C;  4MGY E;  3KUC B;  3MJW A;  3CMM B;  2K8C A;  4FLH A;  4WWO A;  1ZKH A;  2IO2 B;  4FJZ A;  3IFW B;  4WQO B;  3PVL A;  2IY1 B;  1EF5 A;  3EFU A;  2WX1 A;  3SU8 X;  3W1S C;  5LXH A;  2KDE B;  1WM3 A;  4PYZ A;  1V5O A;  5EDS A;  1WXM A;  2LJ5 A;  3ZTD A;  3UQB A;  2L05 A;  3PRP B;  4IM3 A;  5E6P A;  2MRP A;  3ZNI D;  5C1Z A;  1WGH A;  2N1V A;  4NAW B;  1E8X A;  3D32 A;  4PYU A;  5L95 C;  3BIN A;  3L16 A;  4WJQ A;  4LDT B;  2BKR B;  2LI5 A;  4XC2 A;  1AAR A;  2NBU A;  4AOF A;  1UBI A;  3WAM A;  3QAQ A;  3ZVV A;  3QIJ A;  4W9F A;  3PRE A;  4LJO B;  2L7R A;  4GDL B;  3HM3 A;  3HM6 X;  3P2B A;  3R66 C;  4GB9 A;  4M0W B;  1EUV B;  1WGG A;  4WJO A;  2PE9 A;  2DZK A;  2PPH A;  3APC A;  2NBW B;  1YIW A;  4K1R B;  1UEL A;  1WGR A;  3V6C B;  3QWZ B;  4F7Z A;  4J6I A;  4GGQ A;  3H1U A;  1F9J A;  4I6P A;  3LDZ E;  3VXW A;  3PPA A;  2FAZ A;  3JVZ X;  5C23 A;  4P7I A;  3ZUN A;  1V49 A;  2AL3 A;  1GUA B;  2I1K A;  3NS8 A;  3H7P A;  1WY8 A;  3WAN A;  3M62 B;  2NR2 A;  3H7S A;  2V4L A;  3IBE A;  3TL5 A;  4MEL A;  2FIF A;  2HTH A;  2HJ8 A;  3RZW C;  2O6V A;  1WMH A;  4FHK A;  4WWP A;  1WX7 A;  1Q0W B;  4FAD A;  3UQA A;  5L83 A;  4ASW C;  3B08 A;  2G45 B;  5CX3 A;  5G2N A;  4DXA B;  5D2M B;  1KLV A;  2EMS A;  2A5U A;  2KX0 A;  4CYE A;  3R3M A;  1XQQ A;  4FN2 A;  2RD0 A;  4YL8 A;  3SD5 A;  2UYZ B;  1V6E A;  3CST A;  1LXD A;  2KAN A;  4GDK B;  3ZRC A;  3ZDT A;  1LQB A;  2ZZP B;  2DYB A;  1TGZ B;  4IUM B;  2MWS B;  4E71 A;  3UIO B;  2J0J A;  5D6J B;  2K1F A;  1U4A A;  5AEK B;  3VH3 B;  4IWO A;  2GOW A;  3K9O B;  5DPW A;  2O2V B;  3V61 A;  3ZLZ A;  2KWU B;  1C3T A;  3VDZ A;  2BKF A;  1GJZ A;  3JSV B;  1HE8 A;  2QHO A;  2KQS A;  2MP2 A;  4IC7 B;  3JYU A;  4KIK A;  3DPD A;  2KJH B;  2NBV B;  3KVF B;  3RZF A;  4AP4 C;  3R7R A;  3KH0 A;  2KMC A;  3L0W B;  4MDK E;  3VQI A;  1WX9 A;  2NPT B;  4DK5 A;  1Q5W B;  1P9D U;  2N7E A;  4II3 B;  5DPR A;  3ECI A;  4E3C A;  4W9D A;  1WR1 A;  1RAX A;  2Y5B B;  2HD5 B;  2J0M A;  5J2R A;  1Z2M A;  2GBJ A;  2CS4 A;  1SE9 A;  3ZO5 B;  3PSE B;  2IBI B;  2DHZ A;  2I1J A;  2MBB B;  3A9J A;  3RUI B;  2IO0 B;  2K39 A;  4W9G A;  4WJN A;  3HHM A;  2JF5 A;  4MSQ B;  4KZ0 A;  4DWF A;  1WR6 E;  2BWF A;  2YVC A;  3DBL I;  4GXB A;  3OAW A;  5CHW A;  3KW5 B;  2GMI C;  3A4R A;  2KTR B;  2LVQ A;  4W9L A;  1R4M I;  3OJ3 A;  2N9X A;  4MGZ E;  4HVB A;  3EHV A;  4HWI B;  2XBB C;  2N9E B;  2REX A;  3ML9 A;  2G3Q B;  2ZVN A;  3PZD A;  4MSM B;  4BOZ B;  1TZ1 A;  2M1M A;  1V9J A;  4BFR A;  4BBN C;  3PV1 A;  2KFJ A;  2DYM A;  1OEY A;  2FCN A;  2KJ6 A;  2KC1 A;  2LWP A;  1L7Y A;  1SGH A;  2L00 B;  3U30 A;  4A20 A;  3APF A;  4GOC A;  2L3Z A;  4G0N B;  3O65 B;  2ZPY A;  3ZDM C;  4WWN A;  4GN1 A;  4BKG A;  2JRH A;  4K7U A;  1YX5 B;  3L54 A;  1V2Y A;  2LRW A;  4EZK A;  4FJV B;  3VTV A;  1MG8 A;  2KXJ A;  1XT9 B;  4KDL B;  3TCA A;  3ZRF A;  4ANV A;  4W9E A;  4K7S A;  2IY0 B;  1RRB A;  4KSK C;  4RM9 A;  1WI0 A;  4ICU A;  1TTN A;  4RM8 A;  3ZNH B;  4WAA A;  4BKS D;  2D2Q A;  2NCN A;  1IPG A;  1TBE A;  3SHQ A;  1FXT B;  2J7Q B;  4GSW A;  3L10 B;  4HJK A;  4B6W A;  4E74 A;  1V81 A;  3AXC A;  3L08 A;  5KHQ A;  1K8R B;  2KQ7 A;  1D3Z A;  3W1Y A;  2KFK B;  2V3S A;  3Q3F A;  5CTR C;  2LD9 A;  4EFO A;  4IWP A;  1WGY A;  3QX1 A;  2JUO A;  2W9N A;  4FA6 A;  2WX0 A;  3L13 A;  3GOE A;  2IZV B;  2GBR A;  1GNU A;  3PTF C;  3I3T B;  2R2Q A;  2G4S A;  3MHS D;  2UWQ A;  1UD7 A;  2O6V B;  3L17 A;  4K7W A;  4PS7 A;  1WMH B;  2KD0 A;  2WYQ A;  3CSF A;  4GU2 A;  3UGB B;  4A3O A;  4EKU A;  1J0G A;  3ONS A;  5AZF A;  3NOB A;  3B0A A;  4GDL A;  3DOW A;  5GMV A;  4KDI C;  4F1S A;  2ASQ A;  3PS6 A;  4X57 B;  4IW0 A;  4LDT D;  2FNJ B;  3OLM D;  2N7D A;  2MW5 A;  3KUD B;  3R7Q A;  1WIA A;  4JGH B;  3VAW A;  2K6Q A;  2DAJ A;  2WDT B;  3M63 B;  5E6O A;  1GC6 A;  5AZH A;  2M4N A;  2JWZ A;  3DVG X;  4FJY A;  1OEY J;  1M94 A;  2CHZ A;  3A9K A;  1WE6 A;  3AU5 A;  3QC8 B;  5LXI B;  4ANX A;  4BBN F;  1OQY A;  1S3S G;  2JPH A;  1E90 A;  2D3G A;  2CHW A;  3VFK A;  1GG3 A;  4W9H A;  4AJW A;  4TV3 A;  2MP2 B; 
#chains in the Genus database with same CATH topology
 2VZK D;  2XEW A;  2V1Y A;  3ZNZ B;  3NY5 A;  4Q2J A;  3U4E G;  2D10 A;  4EEW A;  4RGT A;  3HVD A;  3TIX A;  1WGD A;  3DVG Y;  4M8M A;  3CWI A;  3UIN B;  2Z0D B;  2V4I B;  2V0G A;  2MLB A;  4N6E B;  1WRD B;  2EMT A;  1KF6 B;  2CJN A;  3WA0 A;  1UZX B;  2Y3A A;  2LUM A;  1TZO A;  1R4N I;  1NYQ A;  1A5R A;  2BQQ A;  1YD8 U;  5I4D A;  2YLM A;  1WXQ A;  3RD2 A;  2QIL A;  3AU4 A;  1J7A A;  4WJP A;  5IKC M;  1YX6 B;  1GAQ B;  4JPS A;  3P4R B;  5BYQ A;  2PVO D;  4CHK A;  3GZN I;  3A1Q A;  1NI2 A;  1T0Y A;  1IUE A;  3HIZ A;  4KV2 A;  1HA5 A;  3B9J A;  4YTP B;  3AH7 A;  3PLV A;  1VZ7 A;  3I63 C;  5HHD G;  1JCK B;  2C7N B;  3C8Y A;  2HDE A;  1L0V B;  3EEC A;  2LVP A;  3AI5 A;  4RMA A;  3MC0 B;  4NNJ B;  2BYT A;  1E8Z A;  1UWX A;  2DLB A;  2RR9 A;  3CF6 E;  4HDO A;  1OTR B;  4W9C A;  3SFD B;  2L0T A;  2RDH A;  3B1L X;  5IAA C;  3H7P B;  1VLB A;  4AUQ C;  4NAW A;  4TQ1 A;  2GBN A;  2IGG A;  1JRP A;  4CO7 A;  4ZDV A;  1P98 A;  4WH4 A;  2C9W B;  2WU2 B;  3URY A;  4M0W A;  2KOX A;  2LXC A;  3ENE A;  4K3B A;  3DCG A;  4J3O D;  4B9K A;  1RWS A;  2NTT A;  4ZRJ A;  2ZCB A;  3RUL A;  5J18 A;  4MH0 E;  3A9K B;  4NQK E;  4WQM A;  4IM2 A;  1EO6 A;  3RN9 C;  4KVG B;  2M17 A;  1FD6 A;  4BVU C;  1H4R A;  1WSP A;  4MEM A;  1F2R C;  1OQQ A;  2LRU A;  1WRI A;  3QCA A;  3T9L A;  4NPN A;  4OVU A;  3W2D A;  3NVV A;  2FCS A;  2GBK A;  2ONQ A;  1C1Y B;  2QSD A;  4OHJ A;  4MJS B;  2JYT A;  1WZ3 A;  2C60 A;  4GDK A;  2L83 A;  3PGE A;  4HK2 A;  3APD A;  1OGW A;  2O2V A;  2PVG C;  3NHE B;  3NJT A;  3ZGZ A;  3M95 A;  3VR9 B;  2PMV A;  2FUH B;  5D94 A;  1VDV A;  2RMM A;  3RMK C;  5H92 C;  2NPT A;  1BUI C;  3Q8F A;  4A8X C;  4C56 C;  2Z0E B;  2KZR A;  3BY4 B;  4XYC A;  5FK9 C;  4HCP B;  3OJ4 B;  4JIO U;  1JWU D;  3LB8 C;  2WS3 B;  3A33 B;  4GMV A;  3NVY A;  4GIV A;  4XWT A;  4A3P A;  2JXX A;  1WH3 A;  1NEN B;  1QOF A;  3VHT C;  2MCN B;  1DOY A;  4PK1 A;  1PGB A;  2CKH B;  4WAF A;  3P4S B;  1AW7 A;  1XCQ L;  4OVV A;  2KJR A;  4PS3 A;  3NVW A;  3FIL B;  1E7U A;  2JVC A;  2KMA A;  4DDI D;  3A4S C;  4LNO A;  1T0R C;  3IVF A;  4NQL B;  2KWC A;  1UNS A;  3LYY A;  1RLF A;  1E5W A;  1KOT A;  2K8B A;  2MA9 B;  3Q3O C;  3CIR B;  2LUE A;  2ZNV C;  3KUC B;  1FO4 A;  1SBB B;  2AQ2 B;  4FJZ A;  2IO2 B;  3IXS A;  5HFY A;  5LNK 1;  5EDS A;  2QDF A;  2LJ5 A;  3ZTD A;  1V8C A;  3UQB A;  5C1Z A;  2W55 A;  3U7Z A;  2N1V A;  3AE5 B;  1DYQ A;  3AEE B;  2KAC A;  4WJQ A;  1B9R A;  1E0Z A;  1VJK A;  4AOF A;  2E6X A;  3QIJ A;  5D3I B;  2EKI A;  3P2B A;  2W82 A;  3APC A;  1WGR A;  3QWZ B;  1WGK A;  1F9J A;  2QJL A;  3VXW A;  2CU3 A;  4P7I A;  3IAM 1;  2FIF A;  2TSS A;  1NEK B;  4WWP A;  1MI0 A;  1HXY D;  3U2S C;  4ASW C;  4DXA B;  1IGD A;  4JWS C;  2N7J A;  1KLV A;  3GP7 A;  1XQQ A;  2RD0 A;  2V3P A;  4YL8 A;  2OJW A;  2D3B A;  4YT0 B;  1TGZ B;  2MWS B;  2WXR A;  4WUR A;  3SFE B;  1TKE A;  5AEK B;  2H88 B;  1XLO A;  4IWO A;  2GOW A;  5EE9 A;  3ZLZ A;  2KWU B;  4YTN B;  2BKF A;  3SR6 A;  2WXK A;  2QEJ C;  1HE8 A;  4P16 A;  3JYU A;  4O1N A;  2KJH B;  3MP9 A;  3RZF A;  3R7R A;  3KH0 A;  2KMC A;  2WXO A;  4QAY A;  1HZ6 A;  4II3 B;  1P9D U;  4YXD B;  5DPR A;  2ACZ B;  2J0M A;  2W3R A;  1Z2M A;  2GBJ A;  2JQR B;  3R8B A;  2IBI B;  1QQR A;  2MBB B;  4W9G A;  1SEB D;  1MHH E;  4KZ0 A;  2VH1 A;  1WR6 E;  3DBL I;  3KW5 B;  1I4H A;  3N1Z C;  5MPO A;  1R4M I;  2GLS A;  3AE8 B;  4HVB A;  3EHV A;  4AS1 A;  2G3Q B;  1TZ1 A;  2M1M A;  1QT9 A;  4BBN C;  3PV1 A;  1I7H A;  1QOB A;  3U30 A;  4A20 A;  3APF A;  4GOC A;  2RDB C;  4RFB A;  2ZPY A;  3GE3 C;  1YX5 B;  2LRW A;  4EZK A;  4YTM B;  3VTV A;  4KDL B;  3TCA A;  4W9E A;  4K7S A;  2IY0 B;  3T3O A;  1P7E A;  1WI0 A;  4RM8 A;  4WAA A;  4ZRP A;  1FXT B;  2J7Q B;  1ESF A;  4LTU A;  1TY0 A;  3AXC A;  1L4D B;  3L08 A;  1FXI A;  4EFO A;  1SF0 A;  1ZUD 2;  4WIP A;  3QX1 A;  1FXA A;  4R3D A;  1CQV A;  1K52 A;  5BMG A;  4HKQ A;  1QF6 A;  4AQ7 A;  3CSF A;  3TUO A;  3ZYY X;  1E10 A;  1D5M C;  4F1S A;  3PS6 A;  4X57 B;  4LDT D;  2FNJ B;  1ZE3 D;  4B0E A;  2DAJ A;  1D5Z C;  2M4N A;  3Q6B A;  2CHZ A;  3A9K A;  3GS2 A;  1OQY A;  1S3S G;  1KTK A;  1RM6 C;  1EWC A;  2CHW A;  1GG3 A;  3GE8 C;  4W9H A;  4TV3 A;  4KKJ A;  1FFV A;  2FID A;  4KIK B;  1P7F A;  4H2A A;  2OOB B;  4DHZ E;  2KN5 A;  2VH2 A;  4M01 A;  5CHV C;  4MJS A;  4NY0 A;  4HLE A;  4M8N A;  2MBH A;  4G50 A;  4RH6 A;  2JSV X;  2KAJ A;  2CU1 A;  1N5X A;  3EA6 A;  2FUG 1;  3AEA B;  1HTQ A;  2EEL A;  1SIF A;  2M0X A;  3DBS A;  1WX8 A;  4C00 A;  5E6J A;  1AYF A;  3DWM A;  1XEE A;  3ZIM A;  4USA A;  4P6V F;  1YN5 A;  1PQS A;  3HRD D;  1JRU A;  2B3A A;  1JRO A;  2DAF A;  2ZNV B;  4EZL A;  4G3X B;  1SJH D;  2KN4 A;  2M8S A;  1JWS D;  1I4G A;  3K9P B;  4BKS A;  3MJ5 A;  5IA7 A;  1HQR D;  3M3J A;  3Q2A C;  2WDV B;  4IG7 B;  2KDI A;  1YQ3 B;  2K22 A;  3PT2 B;  3Q8B A;  4NJ7 A;  2KTF A;  2KC2 A;  4XE0 A;  4S0R A;  1WXV A;  1ROE A;  3WAP A;  3BYY B;  2KLG A;  1UBQ A;  2MBO A;  3Q3M C;  2JX5 A;  4KGR A;  1WE7 A;  3MC9 A;  2LMC A;  4PT5 A;  2BTE A;  2BWE S;  2MBQ A;  4ZYN A;  3RT3 B;  2OED A;  4IM0 A;  2VRR B;  1YMH E;  2X38 A;  3MFG A;  1G6J A;  2KMM A;  3TMP B;  2A4Z A;  3AM9 A;  2CR5 A;  3QA8 A;  4A90 A;  1I4P A;  2GRI A;  2Z59 B;  3N3K B;  2BYE A;  3NVZ A;  3VTU A;  5H8Y E;  3N30 A;  1ISN A;  4FHJ A;  3ZJT A;  2DZI A;  3RNA C;  3W9C B;  3DBH B;  1XXG A;  2LAS A;  2KFK A;  3KWL A;  4JL9 A;  1F77 A;  1T3Q A;  2KKC A;  1RFA A;  1TIF A;  4KX6 B;  2J0K A;  1ZXH A;  4MGK E;  3ALB A;  2FBW B;  3PRZ A;  5AZG A;  4BKT A;  3ZTC A;  3Q69 A;  4JLC A;  4LNF A;  4ACF A;  2N0S B;  4ANW A;  5HG2 A;  4NJ6 A;  1Q1O A;  4URK A;  5G55 A;  2DX5 B;  1YJ1 A;  4IWQ A;  2WWZ A;  2XK5 B;  2N1W A;  3AE7 B;  4DXF A;  2BBC A;  4LK0 M;  3X0W A;  1WXA A;  4LNI A;  1WXS A;  3KWV A;  4MGI E;  4WWM A;  3O13 A;  2R61 A;  4TSS A;  1GC7 A;  3T8M A;  5TR5 A;  3WAL A;  1IP9 A;  2J53 A;  4K3C A;  3ZXR A;  1P3Q U;  1LM8 B;  1F2R I;  3S2A A;  4MT5 A;  2YEP F;  4KKI A;  2IDY A;  3HK0 A;  4DXG A;  4W9J A;  5G5G A;  2BB6 A;  1Y8R C;  3TEX A;  2N9K A;  4YSZ B;  1WJ4 A;  1JML A;  1WM2 A;  3IT4 B;  3DHI C;  1V80 A;  1EU4 A;  2D3A A;  3KQ4 A;  1KJT A;  3H8H A;  4HRO A;  1FRD A;  3WAO A;  2I38 A;  2GB1 A;  4IKG A;  4W9K A;  3MTN B;  3B2F A;  5AUI A;  2IYD B;  2KO3 A;  5FKA C;  4IOI E;  1F52 A;  4MH8 A;  4DHJ D;  2KYW A;  2LXA A;  3EFC A;  1XD3 B;  1I35 A;  1ZKH A;  4WQO B;  3SU8 X;  3PVL A;  2IY1 B;  4PYZ A;  1WXM A;  1FFU A;  2L05 A;  3PRP B;  4IM3 A;  2KDM A;  5E6P A;  1JAL A;  2KQ4 X;  3BYT B;  1E8X A;  1FEH A;  3BIN A;  3L16 A;  1ZPS A;  4LDT B;  2BKR B;  2G1E A;  1KH0 A;  1AAR A;  1C76 A;  3QAQ A;  3NRZ A;  3R66 C;  3HM6 X;  4GB9 A;  3FC4 A;  2NBW B;  4HKZ E;  4K1R B;  2INN E;  3T3N A;  4J6I A;  4GGQ A;  3H1U A;  2FAZ A;  3JVZ X;  2AL3 A;  1GUA B;  2ON8 A;  3DWG C;  2MJE A;  2HTH A;  2WXM A;  2HJ8 A;  2HTM E;  4MM3 B;  3TSS A;  3B08 A;  1TKY A;  5G2N A;  5CX3 A;  2A5U A;  4C7Y A;  4FN2 A;  2HJ1 A;  2UYZ B;  3ZRC A;  2ZZP B;  2DYB A;  2GI9 A;  4E71 A;  5D6J B;  1FM0 D;  2WXN A;  1XLP A;  1J7B A;  1UF0 A;  1YN4 A;  1C3T A;  3VDZ A;  3JSV B;  1N62 A;  3Q3N C;  4KIK A;  4AP4 C;  1F0Z A;  3BK2 A;  1NYR A;  4DK5 A;  2N7E A;  1TJE A;  2WDQ B;  1C79 A;  4FXC A;  3BWU D;  5J2R A;  1JWA D;  1WWT A;  2DHZ A;  2I1J A;  2K39 A;  4WJN A;  1SJE D;  3BZD B;  1FNU A;  2CJO A;  4GXB A;  5CHW A;  3P4Q B;  3A4R A;  1GOZ A;  1J7C A;  4C7Z A;  1I4X A;  2N9X A;  4OZB A;  4HWI B;  3HUI A;  2XBB C;  3B2G A;  4BFR A;  2IPK D;  2FCN A;  4RGM A;  4G0N B;  3O65 B;  4GN1 A;  1YQ4 B;  1V2Y A;  1MG8 A;  2KXJ A;  4ANV A;  1RRB A;  4KSK C;  2MJ3 A;  2RDG A;  2NCN A;  3SHQ A;  3R2T A;  4HJK A;  4BZA A;  3DHG C;  4US8 A;  5KHQ A;  2KQ7 A;  2KFK B;  2RPV A;  1N63 A;  4L2Y A;  2Y5C A;  2JUO A;  2W9N A;  1L0Y B;  4FA6 A;  3OWE B;  2VZK B;  3I3T B;  1PDX A;  2IGD A;  3J9C A;  4K7W A;  1GPX A;  4PS7 A;  1WMH B;  1FIQ A;  4A3O A;  4EKU A;  3L4P A;  4CQN A;  2LGI A;  5AZF A;  3V3X A;  3B0A A;  4KDI C;  1L0X B;  1VR9 A;  1EWY C;  1WIA A;  4JGH B;  2K6Q A;  3AU5 A;  3AE3 B;  3AEG B;  4BBN F;  5BMI A;  2D3G A;  4OZA A;  3AE1 B;  2MP2 B;  3DDC B;  1OFF A;  2KDF B;  4OZC A;  1CJE A;  3EC8 A;  2NMQ A;  2Z8L A;  4N9F 4;  2XN9 C;  2XK5 A;  4C80 A;  1WFY A;  2G9H D;  4TQ0 A;  3KYC D;  2WP9 B;  2RGF A;  3ETR A;  5BYR A;  3A9J B;  4LNN A;  2NS5 A;  3U52 E;  2D3C A;  3U7D A;  1SXT A;  3NZU A;  5E6N A;  5JH5 C;  1BT0 A;  4D2K A;  3DVN V;  1K50 A;  3TEZ A;  1WJ6 A;  3KUZ A;  1PGX A;  1IGC A;  2MX2 A;  3HVZ A;  5J17 A;  1JW9 D;  1WF9 A;  3QQ8 B;  4EZJ A;  5JHB A;  2ZW1 A;  1WYW B;  3ZKJ C;  5IN7 A;  4HPL B;  4M00 A;  1GB4 A;  1P1A A;  1T0Q C;  5FR3 A;  4I6N B;  2ZCC A;  3PO0 A;  4HDQ A;  4PS8 A;  5BO4 B;  1T6B X;  2ZJD A;  2JXT A;  4AWJ A;  4TUU A;  1Z5S B;  3VTW A;  2KDB A;  2BF8 B;  1P0R A;  1VCB A;  3VUY A;  3VVW B;  3H6N A;  1N5W A;  3PHX B;  5JHA A;  3WCQ A;  1EF1 A;  1UGM A;  5FR6 A;  2DEN B;  3Q3J A;  1GB1 A;  3AE6 B;  2W54 A;  1KLU D;  4I6L B;  4LJP B;  4ANU A;  1AWD A;  1T5X D;  2KVR A;  3NG0 A;  1NDD A;  2K8H A;  4ZHP A;  1TS2 A;  1YJI A;  5EE0 A;  2KNB A;  2MBE A;  2R2O A;  2JY6 A;  3I9V 1;  4RF1 A;  3AEC B;  1E8Y A;  4LLG M;  3E9S A;  1UWM A;  5G5H A;  3X23 A;  1S1Q B;  3RNF C;  1J8C A;  3TBL D;  4C4V B;  1MJD A;  1L6U A;  1QZE A;  3NS1 A;  2LGD A;  4YWG G;  3EGR A;  1JWM D;  1FCL A;  4MM3 A;  1A70 A;  2FCM A;  2INP E;  3MHZ A;  1SE2 A;  2LHD A;  2EKE C;  2O6V D;  3DHH C;  3TEW A;  4GLS C;  1NI3 A;  2DZM A;  2JZZ A;  3PRM B;  2DWQ A;  2NVU I;  4DDG D;  4FBJ B;  2JRI B;  2MH7 A;  2BYF A;  3Q8C A;  3QHT A;  3KLS X;  4RF0 A;  4XZ4 A;  4EUT A;  3JSV A;  3BII D;  2PJH A;  3VUX A;  2LGX A;  2IO1 B;  3QK0 A;  2QCZ A;  3N32 A;  1UH6 A;  5DPT A;  1B1Z A;  2LZ6 A;  2CHX A;  3AEF B;  3AE9 B;  1I42 A;  5D3D A;  2BPS A;  1BML C;  3U8Z A;  2ZVO A;  3QJZ A;  1H8C A;  2KHW B;  3N9Y C;  5BMH A;  3AV8 A;  1UUP A;  2K25 A;  1VD2 A;  1YQB A;  2C7M B;  4ZYS A;  3C0R B;  1WJN A;  2KLC A;  1IYF A;  1YOV B;  2AL6 A;  3V6E B;  2AWT A;  1HZ5 A;  4F8C B;  1IBX B;  1TS3 A;  5D7G A;  3WIM A;  4W9I A;  1QLB B;  3N1X C;  3PLU A;  3PHW B;  2C7H A;  4HJG E;  1V5T A;  5BYS A;  4ARC A;  3W1S A;  2DBY A;  4KZC A;  1DOI A;  4MGY E;  3MJW A;  3CMM B;  4FLH A;  1V97 A;  3IFW B;  3W1S C;  1V5O A;  2WXL A;  2MRP A;  1WGH A;  4XDD A;  1V1P B;  4PYU A;  3I57 A;  4NZL B;  2KT7 A;  2JZP A;  1FMA D;  2LI5 A;  4XC2 A;  1UBI A;  2JU6 X;  3WAM A;  2WHI A;  3ZVV A;  4W9F A;  4LJO B;  1XO3 A;  4ZOH C;  4WJO A;  2KVZ A;  1EUV B;  4F7Z A;  1FNV A;  1VZ6 A;  3PPA A;  4YSX B;  2OHF A;  3ZUN A;  2IGH A;  2WXQ A;  3NS8 A;  2L32 A;  1WY8 A;  2NR2 A;  3IBE A;  4LNK A;  2WXH A;  1WMH A;  4FHK A;  4L1B A;  1N61 A;  4HEA 1;  4FAD A;  1ENF A;  3AEB B;  4ZRQ A;  5D2M B;  2EMS A;  2KX0 A;  2KWD A;  3SD5 A;  2M0A A;  1V6E A;  3I5J C;  1LXD A;  2KAN A;  1LQB A;  1TYG B;  2WXG A;  4IUM B;  2WDR B;  4A55 A;  2K1F A;  1U4A A;  2DNF A;  3VH3 B;  5AUK A;  3K9O B;  2LEK A;  5DPW A;  4XDC A;  2XNA C;  1PUT A;  3SEB A;  1GJZ A;  2I2Y A;  5EE1 A;  2MP2 A;  2PIA A;  1BXT A;  4IC7 B;  3Q14 C;  3DPD A;  2NBV B;  1NVI D;  3L0W B;  4MDK E;  3VQI A;  1L5P A;  1Q10 A;  1UGJ A;  1WR1 A;  1RAX A;  2K3U A;  2Y5B B;  1HEZ E;  1HTO A;  2CS4 A;  1SE9 A;  2BW2 A;  3PSE B;  3RUI B;  3A9J A;  2IO0 B;  4KGT A;  2BB5 A;  3HHM A;  2JF5 A;  1MVK A;  3RNC C;  4A9A A;  2WXF A;  4DWF A;  1YJJ A;  2GMI C;  2KTR B;  2LVQ A;  1TKG A;  4MAC A;  4MGZ E;  2UU7 A;  2REX A;  2ZVN A;  3PZD A;  4MSM B;  3UI3 A;  4B0M A;  1V9J A;  2QMT A;  1I4Q A;  4NJC A;  1R7S A;  2KFJ A;  2DYM A;  2KJ6 A;  2KC1 A;  2LWP A;  1SGH A;  2L00 B;  2NTS A;  3AB5 A;  3V05 A;  2L3Z A;  4HRS A;  4P1B C;  4WWN A;  1K53 A;  4BKG A;  2JRH A;  3L54 A;  2AX5 A;  4A6Q A;  5JXV A;  1XT9 B;  3ZRF A;  4RM9 A;  3ZNH B;  1ZOY B;  2K5P A;  5GXG B;  3P63 A;  4GSW A;  4B6W A;  1V81 A;  3E56 A;  3DBR B;  4L23 A;  1AN8 A;  1D3Z A;  2V3S A;  1QIL A;  4IWP A;  3NZ3 A;  2WX0 A;  3L13 A;  1MG4 A;  2J42 A;  1VRA B;  2GBR A;  1GNU A;  2R2Q A;  3MHS D;  2M19 A;  3L17 A;  2O6V B;  3Q8A A;  3UGB B;  4ZHO A;  3Q8E A;  4HPP A;  4GDL A;  2L52 A;  1TT5 B;  2ASQ A;  1ET9 A;  3OLM D;  2N7D A;  2ICI A;  3R7Q A;  2WDT B;  5E6O A;  4C4V A;  4S17 A;  3DBL B;  3DVG X;  1M94 A;  3ABV B;  1WE6 A;  3BK1 A;  1WYG A;  3ZQ4 A;  1R4M B;  1E90 A;  1L6V A;  1TS5 A;  4TMA B;  2WGS A;  4II2 B;  3FKY A;  1F1H A;  1TS4 A;  2FCQ A;  2L8J A;  3RFZ B;  2MQJ A;  5DCN A;  1WJU A;  5HI1 A;  3TJP A;  1J19 A;  1L4Z B;  4EOY A;  4HPM B;  3DVN U;  2LHE A;  1L2N A;  1V86 A;  2Y5P A;  1X1M A;  3UF8 A;  1MHX A;  3JW0 X;  1ZW7 A;  3DBH I;  1TY2 A;  4ZRI A;  5IOI A;  2ZEQ A;  2L76 A;  3RI7 C;  1E7V A;  1YNT E;  2IO3 B;  2LGY A;  3GB1 A;  5JZE B;  4RCO A;  1NBF C;  2BVC A;  1QOG A;  3FAH A;  4FUL A;  2N9P C;  2SEB D;  3VRB B;  1QOA A;  2MSE D;  3N20 C;  2HE7 A;  1JQ4 A;  1STE A;  4HCN B;  1WZ0 A;  4DBG A;  2MEK A;  3QAR A;  3W5V B;  1PYW D;  4NAM A;  1ACC A;  3RNB C;  2KK8 A;  3PZ8 A;  2WNM A;  3V62 A;  2OJR A;  3RPF C;  4BOS C;  1ZP0 B;  5CHF A;  2AEH A;  2D07 B;  2BYV E;  2K6D B;  3BVG A;  1IBX A;  2KWV B;  1SSN A;  2D11 A;  4JE3 B;  5IO9 A;  1ET6 A;  3AED B;  2WQY B;  2PW9 A;  2GBM A;  1C4C A;  5T8I A;  1N6Z A;  1E6E B;  5DPS A;  1D4B A;  4JQW C;  1ZDX A;  4JX1 C;  4KSL C;  2G4D B;  2PEA A;  2L0F A;  3NZS A;  1FPY A;  3IHP C;  2RPQ A;  1LO5 D;  4G11 A;  2ZPN A;  1V1P A;  3LJ3 A;  2WXP A;  5LLI A;  3W5U B;  3UIP B;  1KM7 A;  1RFK A;  3AE2 B;  2C5L C;  3IG3 A;  5IP4 D;  1FNW A;  2JT4 B;  2BGF A;  5HKH A;  2WLB A;  4XX5 A;  3VH4 B;  1CMX B;  4AJY B;  2DYO A;  3LXF A;  2DZJ A;  5EE3 A;  2J4X A;  4EE2 A;  2KX3 A;  4ITK A;  3TEY A;  2N4F A;  3BVM A;  2K0P A;  4OVZ A;  4JWU C;  4N58 A;  1FCC C;  4LCD E;  3DBR I;  2V3N A;  2PE6 B;  1ZGU B;  3RYT A;  3ML8 A;  3VUW A;  3ZNG C;  2H89 B;  2K9X A;  1N60 A;  3DQV A;  1SIJ A;  2RSU A;  2PTL A;  2JZ3 B;  3AN1 A;  3RNE C;  4B95 A;  4K81 A;  3VRA B;  4DHJ B;  2AYO B;  1E8W A;  2JYE A;  3ZW3 A;  1LFD A;  2V9H A;  4ICV A;  4YSY B;  2BS3 B;  5C2T B;  3SDL C;  3N1Y C;  4HXD A;  3A1Q B;  4ZRK A;  1K51 A;  1M4V A;  3H9D A;  3KYD D;  5KHO A;  2KTR A;  1QKZ A;  4TKN A;  2FE8 A;  1XLQ A;  1XF5 L;  3ZJU A;  3MC8 A;  3AUL A;  1E7P B;  2QIE B;  3P42 A;  3RCZ A;  4DHZ B;  2MJD A;  2LVO A;  4WWO A;  2K8C A;  3IAS 1;  5LXH A;  1EF5 A;  3EFU A;  2WX1 A;  4DQO C;  1EM7 A;  2YEP B;  2KDE B;  1WM3 A;  3PZ7 A;  1EU3 A;  1SE4 A;  3AMZ A;  3RNG C;  3P1M A;  3ZNI D;  1D5X C;  4NAW B;  3D32 A;  3EUB 2;  2JWU A;  2B76 B;  5L95 C;  1V1O A;  1C77 A;  2NBU A;  2WU5 B;  2E3T A;  3PRE A;  2L7R A;  4GDL B;  2LFI A;  3HM3 A;  3V60 A;  3VR8 B;  4M0W B;  4ARI A;  1WGG A;  2PE9 A;  3IT6 B;  2DZK A;  2PKO A;  2PPH A;  2WXI A;  1I4R A;  1YIW A;  1UEL A;  3ZJV A;  3V6C B;  4I6P A;  4UDU C;  3LDZ E;  5C23 A;  1V49 A;  2I1K A;  3H7P A;  3WAN A;  3M62 B;  4RNA A;  1R4N B;  2V4L A;  3H7S A;  4XGA B;  1KLG D;  4MEL A;  3TL5 A;  3RZW C;  2O6V A;  1LGR A;  2PLP A;  2L1A A;  4M02 A;  1WX7 A;  1Q0W B;  1KRH A;  2X8X X;  3UQA A;  5L83 A;  1VZ8 A;  2AQ1 B;  2BS4 B;  2G45 B;  1JWB D;  4REZ A;  4CYE A;  5C3J B;  1YN3 A;  2LJI A;  1OQR A;  3R3M A;  1DGJ A;  2J52 A;  3P4P B;  3CST A;  4GDK B;  3ZDT A;  3GZN B;  2BT6 A;  3UIO B;  2J0J A;  2O2V B;  3V61 A;  2QHO A;  2Q5W D;  3R2I A;  2KQS A;  2ZW0 A;  1CK1 A;  1C4P A;  3KVF B;  1T0S C;  1WX9 A;  2NPT B;  1Q5W B;  3ECI A;  4E3C A;  4W9D A;  1FRR A;  2INC C;  2HD5 B;  4XWW A;  2SAK A;  3ZO5 B;  1PGA A;  3C19 A;  2AQ3 B;  5TSS A;  1C78 A;  4MSQ B;  1Y56 A;  2BWF A;  2YVC A;  3OAW A;  4W9L A;  3OG5 A;  4OW0 A;  3OJ3 A;  2N9E B;  1ZXI A;  2IND C;  3ML9 A;  1DOX A;  4BOZ B;  1MFW A;  2WXJ A;  1OEY A;  1KFY B;  1L7Y A;  1XCT L;  1PFD A;  3ZDM C;  4K7U A;  4FJV B;  2M56 B;  3FIL A;  4ICU A;  1TTN A;  4BKS D;  2D2Q A;  1IPG A;  1TBE A;  1CZP A;  1MPE A;  4E74 A;  3L10 B;  2BS2 B;  3ZXV A;  4KGS A;  2QC8 A;  1K8R B;  3W1Y A;  1SE3 A;  1C4A A;  1ZDV A;  3Q3F A;  5CTR C;  2LD9 A;  1WGY A;  4RGN A;  2MHJ A;  4P1C C;  4RGO S;  1RYJ A;  3GOE A;  4BAX A;  2IZV B;  3PTF C;  2G4S A;  2D5G A;  2UWQ A;  2W3S A;  1UD7 A;  2KD0 A;  3NUH B;  2WYQ A;  4GU2 A;  3AE4 B;  3BVZ A;  1J0G A;  3ONS A;  2N9L A;  3NOB A;  3DOW A;  5GMV A;  4IW0 A;  1XLN A;  1D6E C;  2IJ0 A;  2MW5 A;  3KUD B;  4IDI A;  3VAW A;  3M63 B;  1GC6 A;  5AZH A;  2JWZ A;  4FJY A;  1OEY J;  2LGS A;  4US9 A;  1C9F A;  3QC8 B;  5LXI B;  4ANX A;  1SB3 C;  1E9M A;  2JPH A;  3VFK A;  4AJW A;  4N59 A; 
#chains in the Genus database with same CATH homology
 3DDC B;  2FID A;  2XEW A;  4II2 B;  2V1Y A;  4KIK B;  2KDF B;  3ZNZ B;  2FCQ A;  3EC8 A;  3NY5 A;  2D10 A;  4EEW A;  2L8J A;  2MQJ A;  4N9F 4;  1WJU A;  5DCN A;  2OOB B;  3TJP A;  1J19 A;  4DHZ E;  4EOY A;  4HPM B;  2KN5 A;  3TIX A;  1WGD A;  3DVG Y;  2XK5 A;  3DVN U;  5CHV C;  4MJS A;  4M8M A;  1WFY A;  4NY0 A;  4M8N A;  3UIN B;  4HLE A;  1L2N A;  2Z0D B;  2MBH A;  4TQ0 A;  3KYC D;  4G50 A;  1V86 A;  2RGF A;  1X1M A;  3UF8 A;  3JW0 X;  1ZW7 A;  3DBH I;  2CU1 A;  4ZRI A;  2MLB A;  2ZEQ A;  2L76 A;  3A9J B;  1WRD B;  1E7V A;  2EMT A;  2IO3 B;  2LGY A;  2NS5 A;  3U7D A;  5JZE B;  1NBF C;  1SIF A;  1UZX B;  3NZU A;  3WA0 A;  2M0X A;  4FUL A;  3DBS A;  1WX8 A;  5E6N A;  5JH5 C;  2N9P C;  1BT0 A;  1R4N I;  2MSE D;  3DVN V;  2HE7 A;  3ZIM A;  1A5R A;  4HCN B;  1WZ0 A;  1I35 A;  1YD8 U;  2YLM A;  4DBG A;  1WJ6 A;  3KUZ A;  3QAR A;  1PQS A;  3RD2 A;  3AU4 A;  1JRU A;  2MX2 A;  4WJP A;  1YX6 B;  2B3A A;  5J17 A;  1WF9 A;  2DAF A;  3QQ8 B;  2ZNV B;  2KK8 A;  4EZL A;  4G3X B;  3V62 A;  2OJR A;  4CHK A;  4BOS C;  3GZN I;  4EZJ A;  5CHF A;  2AEH A;  2M8S A;  3A1Q A;  2D07 B;  5JHB A;  3K9P B;  4BKS A;  1NI2 A;  1T0Y A;  3HIZ A;  4KV2 A;  2BYV E;  1WYW B;  3ZKJ C;  5IA7 A;  2K6D B;  3M3J A;  4HPL B;  3PLV A;  1P1A A;  2KWV B;  4IG7 B;  2KDI A;  3PT2 B;  2D11 A;  4I6N B;  2ZCC A;  2KTF A;  4HDQ A;  4NJ7 A;  2KC2 A;  4PS8 A;  5BO4 B;  2C7N B;  2ZJD A;  1WXV A;  2GBM A;  4AWJ A;  4TUU A;  3WAP A;  1Z5S B;  2KLG A;  3EEC A;  1UBQ A;  2KDB A;  2LVP A;  2MBO A;  3VTW A;  2BF8 B;  3V60 A;  1P0R A;  5DPS A;  1VCB A;  1WE7 A;  3AI5 A;  3H6N A;  3PHX B;  4RMA A;  4NNJ B;  3VUY A;  3VVW B;  5JHA A;  4JQW C;  1EF1 A;  1E8Z A;  1UGM A;  5FR6 A;  2DEN B;  2RR9 A;  3Q3J A;  3CF6 E;  4KSL C;  2G4D B;  2PEA A;  2L0F A;  2BWE S;  2MBQ A;  4ZYN A;  3RT3 B;  3NZS A;  4HDO A;  1OTR B;  4I6L B;  4W9C A;  3IHP C;  4IM0 A;  2VRR B;  2RPQ A;  4LJP B;  4ANU A;  1G6J A;  2L0T A;  2KVR A;  3TMP B;  2A4Z A;  4G11 A;  2CR5 A;  3B1L X;  2ZPN A;  1NDD A;  2K8H A;  3H7P B;  3QA8 A;  5IAA C;  4NAW A;  3LJ3 A;  4AUQ C;  4TQ1 A;  2GBN A;  5LLI A;  2Z59 B;  3N3K B;  2BYE A;  3UIP B;  4CO7 A;  4ZDV A;  3VTU A;  1P98 A;  3N30 A;  1ISN A;  4FHJ A;  1KM7 A;  2DZI A;  2KNB A;  2MBE A;  2R2O A;  2C9W B;  2JY6 A;  2C5L C;  3IG3 A;  2LAS A;  2KFK A;  2JT4 B;  1E8Y A;  2KOX A;  4JL9 A;  2BGF A;  2LXC A;  3ENE A;  3DCG A;  4XX5 A;  4B9K A;  5HKH A;  3X23 A;  4ZRJ A;  1S1Q B;  2KKC A;  1J8C A;  3TBL D;  1RFA A;  2ZCB A;  3VH4 B;  3RUL A;  5J18 A;  1QZE A;  4MH0 E;  3A9K B;  4NQK E;  2J0K A;  1CMX B;  4AJY B;  4MGK E;  3ALB A;  4IM2 A;  2LGD A;  3PRZ A;  1EO6 A;  4KVG B;  5AZG A;  4BKT A;  2M17 A;  3ZTC A;  2DYO A;  2DZJ A;  4MM3 A;  4BVU C;  4JLC A;  1H4R A;  4MEM A;  2FCM A;  2KX3 A;  2LRU A;  3QCA A;  4ANW A;  2N4F A;  3T9L A;  4NJ6 A;  1Q1O A;  4NPN A;  4URK A;  5G55 A;  2EKE C;  4OVU A;  2DX5 B;  2O6V D;  1YJ1 A;  2FCS A;  2GBK A;  2WWZ A;  4IWQ A;  1C1Y B;  2XK5 B;  2DZM A;  2N1W A;  4MJS B;  1WZ3 A;  2C60 A;  2JZZ A;  4GDK A;  3PRM B;  4LCD E;  2NVU I;  3DBR I;  3X0W A;  2PE6 B;  1WXA A;  1ZGU B;  1WXS A;  3PGE A;  3RYT A;  4DDG D;  3ML8 A;  4FBJ B;  2JRI B;  3VUW A;  4HK2 A;  3APD A;  2BYF A;  1OGW A;  2O2V A;  3QHT A;  4MGI E;  3NHE B;  3ZNG C;  3M95 A;  3T8M A;  1GC7 A;  4XZ4 A;  4EUT A;  3JSV A;  3DQV A;  5TR5 A;  3WAL A;  2PJH A;  3VUX A;  2LGX A;  2IO1 B;  2FUH B;  3QK0 A;  5D94 A;  1IP9 A;  3N32 A;  2RSU A;  1UH6 A;  1P3Q U;  5DPT A;  2JZ3 B;  2LZ6 A;  2CHX A;  1LM8 B;  2NPT A;  4B95 A;  1I42 A;  3S2A A;  2BPS A;  4K81 A;  2Z0E B;  3U8Z A;  2ZVO A;  3QJZ A;  4DHJ B;  2AYO B;  2KZR A;  1H8C A;  1E8W A;  3BY4 B;  3HK0 A;  2KHW B;  4HCP B;  3OJ4 B;  4W9J A;  4JIO U;  3ZW3 A;  1LFD A;  1Y8R C;  2K25 A;  1VD2 A;  3A33 B;  4GMV A;  4ICV A;  4GIV A;  4A3P A;  2JXX A;  1WH3 A;  1WJ4 A;  1YQB A;  2C7M B;  3SDL C;  3VHT C;  4HXD A;  1WM2 A;  2MCN B;  3C0R B;  3A1Q B;  4ZRK A;  1V80 A;  3H9D A;  3KYD D;  1WJN A;  1KJT A;  2KLC A;  1IYF A;  5KHO A;  2AL6 A;  2CKH B;  3V6E B;  3WAO A;  2AWT A;  2KTR A;  4F8C B;  4OVV A;  2KJR A;  4PS3 A;  4TKN A;  4W9K A;  5D7G A;  3WIM A;  4W9I A;  3MTN B;  1E7U A;  2JVC A;  3PLU A;  3PHW B;  2KMA A;  4DDI D;  3A4S C;  2C7H A;  3IVF A;  4NQL B;  2IYD B;  2KO3 A;  3AUL A;  2KWC A;  1V5T A;  1RLF A;  1E5W A;  4DHJ D;  1KOT A;  2K8B A;  3W1S A;  2MA9 B;  4KZC A;  3RCZ A;  2LXA A;  4DHZ B;  2LVO A;  1XD3 B;  2LUE A;  2ZNV C;  4MGY E;  3KUC B;  3MJW A;  3CMM B;  2K8C A;  4FLH A;  4WWO A;  1ZKH A;  2IO2 B;  4FJZ A;  3IFW B;  4WQO B;  3PVL A;  2IY1 B;  1EF5 A;  3EFU A;  2WX1 A;  3SU8 X;  3W1S C;  5LXH A;  2KDE B;  1WM3 A;  4PYZ A;  1V5O A;  5EDS A;  1WXM A;  2LJ5 A;  3ZTD A;  3UQB A;  2L05 A;  3PRP B;  4IM3 A;  5E6P A;  2MRP A;  3ZNI D;  5C1Z A;  1WGH A;  2N1V A;  4NAW B;  1E8X A;  3D32 A;  4PYU A;  5L95 C;  3BIN A;  3L16 A;  4WJQ A;  4LDT B;  2BKR B;  2LI5 A;  4XC2 A;  1AAR A;  2NBU A;  4AOF A;  1UBI A;  3WAM A;  3QAQ A;  3ZVV A;  3QIJ A;  4W9F A;  3PRE A;  4LJO B;  2L7R A;  4GDL B;  3HM3 A;  3HM6 X;  3P2B A;  3R66 C;  4GB9 A;  4M0W B;  1EUV B;  1WGG A;  4WJO A;  2PE9 A;  2DZK A;  2PPH A;  3APC A;  2NBW B;  1YIW A;  4K1R B;  1UEL A;  1WGR A;  3V6C B;  3QWZ B;  4F7Z A;  4J6I A;  4GGQ A;  3H1U A;  1F9J A;  4I6P A;  3LDZ E;  3VXW A;  3PPA A;  2FAZ A;  3JVZ X;  5C23 A;  4P7I A;  3ZUN A;  1V49 A;  2AL3 A;  1GUA B;  2I1K A;  3NS8 A;  3H7P A;  1WY8 A;  3WAN A;  3M62 B;  2NR2 A;  3H7S A;  2V4L A;  3IBE A;  3TL5 A;  4MEL A;  2FIF A;  2HTH A;  2HJ8 A;  3RZW C;  2O6V A;  1WMH A;  4FHK A;  4WWP A;  1WX7 A;  1Q0W B;  4FAD A;  3UQA A;  5L83 A;  4ASW C;  3B08 A;  2G45 B;  5CX3 A;  5G2N A;  4DXA B;  5D2M B;  1KLV A;  2EMS A;  2A5U A;  2KX0 A;  4CYE A;  3R3M A;  1XQQ A;  4FN2 A;  2RD0 A;  4YL8 A;  3SD5 A;  2UYZ B;  1V6E A;  3CST A;  1LXD A;  2KAN A;  4GDK B;  3ZRC A;  3ZDT A;  1LQB A;  2ZZP B;  2DYB A;  1TGZ B;  4IUM B;  2MWS B;  4E71 A;  3UIO B;  2J0J A;  5D6J B;  2K1F A;  1U4A A;  5AEK B;  3VH3 B;  4IWO A;  2GOW A;  3K9O B;  5DPW A;  2O2V B;  3V61 A;  3ZLZ A;  2KWU B;  1C3T A;  3VDZ A;  2BKF A;  1GJZ A;  3JSV B;  1HE8 A;  2QHO A;  2KQS A;  2MP2 A;  4IC7 B;  3JYU A;  4KIK A;  3DPD A;  2KJH B;  2NBV B;  3KVF B;  3RZF A;  4AP4 C;  3R7R A;  3KH0 A;  2KMC A;  3L0W B;  4MDK E;  3VQI A;  1WX9 A;  2NPT B;  4DK5 A;  1Q5W B;  1P9D U;  2N7E A;  4II3 B;  5DPR A;  3ECI A;  4E3C A;  4W9D A;  1WR1 A;  1RAX A;  2Y5B B;  2HD5 B;  2J0M A;  5J2R A;  1Z2M A;  2GBJ A;  2CS4 A;  1SE9 A;  3ZO5 B;  3PSE B;  2IBI B;  2DHZ A;  2I1J A;  2MBB B;  3A9J A;  3RUI B;  2IO0 B;  2K39 A;  4W9G A;  4WJN A;  3HHM A;  2JF5 A;  4MSQ B;  4KZ0 A;  4DWF A;  1WR6 E;  2BWF A;  2YVC A;  3DBL I;  4GXB A;  3OAW A;  5CHW A;  3KW5 B;  2GMI C;  3A4R A;  2KTR B;  2LVQ A;  4W9L A;  1R4M I;  3OJ3 A;  2N9X A;  4MGZ E;  4HVB A;  3EHV A;  4HWI B;  2XBB C;  2N9E B;  2REX A;  3ML9 A;  2G3Q B;  2ZVN A;  3PZD A;  4MSM B;  4BOZ B;  1TZ1 A;  2M1M A;  1V9J A;  4BFR A;  4BBN C;  3PV1 A;  2KFJ A;  2DYM A;  1OEY A;  2FCN A;  2KJ6 A;  2KC1 A;  2LWP A;  1L7Y A;  1SGH A;  2L00 B;  3U30 A;  4A20 A;  3APF A;  4GOC A;  2L3Z A;  4G0N B;  3O65 B;  2ZPY A;  3ZDM C;  4WWN A;  4GN1 A;  4BKG A;  2JRH A;  4K7U A;  1YX5 B;  3L54 A;  1V2Y A;  2LRW A;  4EZK A;  4FJV B;  3VTV A;  1MG8 A;  2KXJ A;  1XT9 B;  4KDL B;  3TCA A;  3ZRF A;  4ANV A;  4W9E A;  4K7S A;  2IY0 B;  1RRB A;  4KSK C;  4RM9 A;  1WI0 A;  4ICU A;  1TTN A;  4RM8 A;  3ZNH B;  4WAA A;  4BKS D;  2D2Q A;  2NCN A;  1IPG A;  1TBE A;  3SHQ A;  1FXT B;  2J7Q B;  4GSW A;  3L10 B;  4HJK A;  4B6W A;  4E74 A;  1V81 A;  3AXC A;  3L08 A;  5KHQ A;  1K8R B;  2KQ7 A;  1D3Z A;  3W1Y A;  2KFK B;  2V3S A;  3Q3F A;  5CTR C;  2LD9 A;  4EFO A;  4IWP A;  1WGY A;  3QX1 A;  2JUO A;  2W9N A;  4FA6 A;  2WX0 A;  3L13 A;  3GOE A;  2IZV B;  2GBR A;  1GNU A;  3PTF C;  3I3T B;  2R2Q A;  2G4S A;  3MHS D;  2UWQ A;  1UD7 A;  2O6V B;  3L17 A;  4K7W A;  4PS7 A;  1WMH B;  2KD0 A;  2WYQ A;  3CSF A;  4GU2 A;  3UGB B;  4A3O A;  4EKU A;  1J0G A;  3ONS A;  5AZF A;  3NOB A;  3B0A A;  4GDL A;  3DOW A;  5GMV A;  4KDI C;  4F1S A;  2ASQ A;  3PS6 A;  4X57 B;  4IW0 A;  4LDT D;  2FNJ B;  3OLM D;  2N7D A;  2MW5 A;  3KUD B;  3R7Q A;  1WIA A;  4JGH B;  3VAW A;  2K6Q A;  2DAJ A;  2WDT B;  3M63 B;  5E6O A;  1GC6 A;  5AZH A;  2M4N A;  2JWZ A;  3DVG X;  4FJY A;  1OEY J;  1M94 A;  2CHZ A;  3A9K A;  1WE6 A;  3AU5 A;  3QC8 B;  5LXI B;  4ANX A;  4BBN F;  1OQY A;  1S3S G;  2JPH A;  1E90 A;  2D3G A;  2CHW A;  3VFK A;  1GG3 A;  4W9H A;  4AJW A;  4TV3 A;  2MP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...