2KAJA

Nmr structure of gallium substituted ferredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferredoxin-1
publication title Structural and functional characterization of the ga-substituted ferredoxin from Synechocystis sp. PCC6803, a mimic of the native protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kajA00
1JALA 1OQRA 3RPFC 3AE8B 1J7CA 2M56B 1J7AA 1KRHA 1N5WA 1N61A 1T3QA 1JROA 4YSZB 3NS1A 2PVGC 1E6EB 2WDVB 3AE3B 3BIID 2WDRB 1PFDA 2QIEB 3ETRA 4ZHPA 2DWQA 3L4PA 3SR6A 2LEKA 1PUTA 3NVYA 4YT0B 1AWDA 1RM6C 4C7ZA 1DOYA 1NI3A 1OFFA 1YQ3B 4N59A 4ZOHC 1CJEA 1FMAD 1RWSA 2W54A 3AEEB 3AE9B 5MPOA 3P4QB 3P4SB 1GAQB 1QOAA 3W9CB 3AM9A 3KWLA 1XLOA 2Y5CA 3AEAB 3NRZA 4US8A 2AX5A 1TJEA 1L6UA 1OQQA 2E3TA 3P63A 3AN1A 2ACZB 1WYGA 2L83A 1YQ4B 3CIRB 1DGJA 1FIQA 1N5XA 1FFVA 1B9RA 4WQMA 1A70A 5EE3A 3SFEB 1NENB 1YJJA 1JQ4A 2JQRB 1ZUD2 1L0VB 2H89B 1ZP0B 1ZOYB 2N0SB 2WQYB 4HROA 3ZYYX 1WWTA 4YXDB 1NEKB 1VLBA 1WRIA 2B76B 2WU2B 1RYJA 3AEFB 3WCQA 1QT9A 2BT6A 2W55A 2WU5B 3B2GA 4US9A 1V97A 2CU3A 2CJNA 2K5PA 1J7BA 3NVVA 4N6EB 1KF6B 3AECB 1QLBB 1ROEA 2DBYA 5EE9A 1KFYB 2KAJA 3AEDB 4P6VF 4YTNB 1JRPA 3LB8C 1E9MA 1TYGB 1WXQA 4N58A 5EE1A 4A9AA 4JX1C 3LXFA 1XLQA 3AE2B 2M19A 4HRSA 2WS3B 3FC4A 2MH7A 2H88B 2FBWB 3CWIA 3DWMA 3HVZA 3NVZA 1XO3A 3B9JA 2K22A 1JWAD 5C2TB 1PDXA 1WGKA 1SF0A 3AE7B 2MJ3A 3AE6B 1SB3C 1DOIA 1DOXA 1FXIA 1NYRA 5GXGB 5H92C 1GPXA 1FFUA 1FM0D 1QOFA 1V8CA 2JX5A 1NYQA 2OHFA 1VJKA 2K9XA 3AEBB 4C80A 5C3JB 3PO0A 2MJEA 3VRAB 2G1EA 2PIAA 1TKEA 1NVID 1AYFA 3AH7A 3HUIA 1RFKA 3ABVB 3FAHA 3B2FA 1N63A 1EWYC 4FXCA 3P1MA 3VRBB 1I7HA 1FRRA 5AUIA 4JWUC 1CZPA 2L52A 1XLPA 1TKGA 1VDVA 3AV8A 3P4PB 5H8YE 3W5VB 3AE4B 5AUKA 2BS2B 2HTME 2WLBA 3P4RB 1E7PB 1QF6A 1R7SA 1SIJA 2KMMA 5EE0A 2CJOA 1E0ZA 3VR8B 4IDIA 1E10A 3AE5B 2WDQB 3NVWA 3HRDD 4YTMB 3SFDB 1TKYA 2QJLA 2PKOA 5G5GA 5G5HA 4YSXB 2PVOD 2WP9B 3AE1B 4JWSC 1FXAA 3VR9B 1JW9D 1N62A 1IUEA 1JWBD 2W3SA 4ITKA 4WWMA 4ZHOA 1QOGA 1UWMA 4USAA 4YTPB 1YJIA 1F0ZA 2W3RA 3W5UB 1L6VA 1N60A 1FRDA 3AB5A 1QOBA 2BS3B 3DWGC 1XLNA 1FO4A 2EKIA 1L5PA 3EUB2 4C7YA 2MJDA 3AMZA 4KX6B 4YSYB 2BS4B 3AEGB 4LTUA 1ZXIA 2Q5WD
chains in the Genus database with same CATH superfamily
1EF1A 1UELA 1TT5B 4ARIA 4HEA1 2BYEA 2KO3A 3VUXA 4PS7A 1V86A 4GOCA 3TL5A 3RNFC 1V6EA 4ZYNA 3CSTA 5DPTA 1ZXHA 2PE9A 2LI5A 4ASWC 2MEKA 2DNFA 4OZCA 5JZEB 2XNAC 3W9CB 1JCKB 4ICUA 3KWLA 1H8CA 2JWZA 1SIFA 2ACZB 4AJWA 2INPE 1SE9A 3U4EG 1YJJA 1ZUD2 1L0VB 2WQYB 1ZOYB 1V5TA 1D4BA 1WWTA 3PV1A 1YOVB 4ANVA 3KW5B 2KJHB 3AECB 4K7UA 2DBYA 2G4DB 1HE8A 2LWPA 1ISNA 4NQLB 3BYTB 2SAKA 1XLQA 1M94A 3FC4A 4PS8A 2UU7A 4HVBA 1ZKHA 3ML8A 4W9KA 3B1LX 4KDLB 4MM3B 1NYRA 4NAWA 2BF8B 2PE6B 4DDID 4C80A 3N30A 3FAHA 5AUIA 3W5UB 2NBWB 2JYEA 2WXOA 3DPDA 1MFWA 3AE4B 2WXNA 2KFJA 1PGXA 2KWUB 4EUTA 3TIXA 1MHHE 4XZ4A 4YTMB 1Q10A 4MEMA 1EU4A 5G5HA 3N3KB 1JW9D 4A90A 1D5ZC 4ITKA 2MBOA 2E6XA 1WSPA 4C4VA 1MJDA 3K9PB 4RF0A 2WX0A 3AMZA 4JGHB 2AYOB 2K25A 3IXSA 1F77A 4NNJB 2K6DB 3C8YA 1VR9A 2WXPA 3KQ4A 4JQWC 3RT3B 2N7EA 1TGZB 2DWQA 3L4PA 3SR6A 2LEKA 3NZSA 2ONQA 4W9DA 3AEEB 1LGRA 1GAQB 1QOAA 3AM9A 1XF5L 1XLOA 3X23A 3Q8CA 1YQBA 1L6UA 4KKIA 2AQ2B 4KGTA 1V5OA 1K8RB 3VAWA 1TY2A 2GBMA 2WXKA 2YEPF 2JZ3B 4EE2A 1WM2A 2LRUA 2LGYA 2NR2A 1MPEA 2V3PA 5DPWA 1I4QA 1VLBA 2MRPA 3V3XA 1UNSA 2WXMA 2ZNVC 1NI2A 3ZKJC 2KX3A 2C5LC 1SE3A 3PZ7A 2LRWA 2NMQA 3TEWA 1WJ6A 3IT4B 1OQYA 3BYYB 2K8HA 5D6JB 2FBWB 3DOWA 2C60A 2OJWA 3W1SC 3AE6B 2X8XX 4EEWA 5H92C 3X0WA 1T0SC 5C3JB 2MW5A 2MP2A 3PVLA 4HDOA 2PIAA 3EECA 1WX7A 2D3AA 1WE6A 3R7QA 2LHEA 2BPSA 5CHWA 2R2OA 2SEBD 1XCQL 2WLBA 5D94A 4IWOA 4EKUA 4K81A 2LGDA 2M0XA 3V60A 3H7PB 2L7RA 3DVNU 4E3CA 3ZLZA 3ZDMC 3A1QA 1SE4A 3JSVB 3VR9B 2YEPB 3OLMD 3UI3A 4BOZB 1AARA 1VZ6A 1SBBB 4MGKE 5E6PA 1WGGA 1N60A 4B0MA 5EDSA 1JALA 1UF0A 1J7AA 1FEHA 2ZVOA 1TBEA 1GB1A 4AQ7A 2O6VD 5D3IB 4XDCA 4FULA 5IA7A 1E8WA 2NVUI 1YN5A 2KACA 2O2VA 4IWPA 3ZJVA 2WXGA 3CF6E 3HHMA 1E5WA 2IO3B 2GBRA 2BWFA 2KLGA 3UIPB 3I57A 2BTEA 2JQRB 4W9IA 2FNJB 2KDEB 4HROA 3Q69A 4GDLA 2FIDA 3I3TB 3LJ3A 4ZRJA 3B2GA 4US9A 2L32A 3TEXA 4W9FA 2LVQA 4XYCA 1KFYB 2KAJA 1E9MA 1HEZE 4BFRA 4N58A 3ZQ4A 2XEWA 3AE2B 4IOIE 1TS5A 4HWIB 2BVCA 2Z0EB 3ZJTA 1S1QB 3H9DA 4OVZA 2LGSA 3N9YC 1YN4A 5E6JA 2M1MA 2D2QA 3QK0A 4NZLB 3AV8A 3KWVA 1L2NA 4A55A 2C7HA 3RZWC 2GB1A 4DHZB 2BS2B 2RDHA 2HTME 2KTRB 1RRBA 1MG4A 2JXXA 1XCTL 2D5GA 3ZJUA 2PKOA 1EO6A 4YSXB 2WP9B 1EF5A 4UDUC 3FKYA 2KD0A 3Q6BA 3QC8B 4FJYA 2LUEA 1WX8A 1BXTA 1FXTB 2LFIA 1C4CA 1ZDVA 4WWPA 2BS3B 1L5PA 4RNAA 1ZXIA 3DBLI 4K3BA 4BKTA 3M62B 2BYVE 1KRHA 4II2B 3ZGZA 3MC0B 3ZUNA 2XK5A 2G4SA 2VZKB 4DHJD 3BWUD 2KWDA 4HKQA 1OFFA 1EUVB 3KUCB 4IM2A 1WR1A 3O65B 3ZRCA 3AN1A 1JWMD 4X57B 3DBRI 4LLGM 4WQMA 1Q1OA 4XWWA 1QZEA 4RM9A 3U30A 1JRUA 1ZPSA 1P98A 1JWSD 1WM3A 4XE0A 3PHXB 3WCQA 1F2RI 2BBCA 2BT6A 2W55A 3LDZE 4DHZE 2BKFA 3ZNGC 5EE9A 2WXIA 1AN8A 1LXDA 3Q3MC 4P6VF 4MDKE 4BBNC 2MH7A 5LNK1 5C2TB 3AE7B 4ZRIA 1WF9A 3DQVA 2WGSA 1CQVA 1FM0D 2OHFA 3ZNID 4LCDE 4C56C 3BVZA 3ABVB 1XEEA 1C3TA 4MGZE 4YL8A 1BUIC 1C79A 2KYWA 1F52A 2N1WA 2PLPA 1L4ZB 3L54A 2N9EB 1ENFA 4M0WB 1WJNA 2PVOD 3HIZA 3OAWA 4RGNA 4YTPB 2LUMA 1E8YA 1FRDA 4HJGE 2KK8A 1FO4A 4C7YA 2V0GA 1WMHA 4LTUA 4MM3A 3EFCA 3VUWA 3A9JB 1R4NI 4GDKA 3TMPB 4KKJA 1TS4A 3BIID 2PTLA 4HKZE 3V05A 2QIEB 4G50A 2D07B 2CHXA 1KLVA 3MC9A 1CJEA 1FMAD 2KQ4X 4EZJA 2QEJC 1B9RA 1UH6A 1A70A 2MHJA 1HQRD 2H89B 3OJ3A 4RCOA 2LXAA 2GBJA 4B0EA 2INCC 4LNFA 4YTNB 1JRPA 2N9KA 4HJKA 1ESFA 3T8MA 2L0TA 3R3MA 1N6ZA 2KXJA 3NVZA 1XO3A 3V62A 4ZYSA 2NTSA 3QAQA 1EU3A 1WY8A 1SSNA 2HDEA 3AEBB 5D7GA 1BT0A 4JL9A 1NVID 3RUIB 1PGBA 1VRAB 2R61A 3KVFB 1CZPA 3H8HA 3ZVVA 3DCGA 1R7SA 1SIJA 2LGXA 3LYYA 4BKSA 2CJOA 4LDTD 3PT2B 1E10A 2LZ6A 2GI9A 2DAFA 5BYSA 1TKYA 3ZDTA 1WXSA 1GC6A 4JWSC 3N1YC 2L0FA 2GBNA 1OTRB 4RGOS 2CS4A 4A3OA 1YN3A 1WGYA 4HPLB 1WI0A 4KX6B 4A20A 2ZW0A 2IO1B 2KDFB 2V4LA 4XX5A 4NJCA 3RPFC 3AE8B 1UZXB 3B08A 4DHJB 3Q3FA 3QHTA 4RM8A 3SEBA 1HA5A 2MA9B 2N4FA 4WAFA 3APDA 1UBQA 4XWTA 4N59A 1PQSA 1ZGUB 2K8BA 1TJEA 1WGDA 3H7PA 1UWXA 1WH3A 5HI1A 5D3DA 1MI0A 1VCBA 3JSVA 1D6EC 3BK1A 3GP7A 4ZRQA 2RDGA 3MJWA 1KJTA 3NY5A 4I6LB 4GN1A 1T0RC 1WGHA 2DLBA 2FCMA 2J52A 1BMLC 1WXQA 4LNIA 4WH4A 2KNBA 3GE8C 2MBQA 5HHDG 1WXVA 2Y5BB 4A8XC 1DOXA 3OJ4B 1QILA 2K9XA 4NQKE 2AWTA 1OEYJ 1N63A 1MHXA 4MACA 3UIOB 4DXFA 1XLPA 3W1SA 4ZRKA 2BWES 2IJ0A 4IDIA 4EZLA 3NOBA 3NVWA 2N7JA 4G11A 4RF1A 4ARCA 2N9PC 3TSSA 3UQAA 2ZVNA 3QARA 1YD8U 4ZHOA 3KH0A 4IM0A 2JZZA 3DBHI 2KANA 1KH0A 1F0ZA 2W3RA 1J8CA 2AQ1B 1XLNA 1U4AA 2BS4B 3L08A 1R4MB 4JIOU 2V1YA 3TEZA 4GMVA 4KGRA 4MSMB 2R2QA 2NBVB 2D3GA 2DHZA 3NVYA 5T8IA 4WQOB 3E9SA 1ET6A 3MC8A 5MPOA 3ALBA 2IBIB 3P4QB 4PT5A 3M3JA 1XD3B 1XT9B 4XC2A 3QCAA 1WYWB 3GOEA 5C23A 2W9NA 2L00B 2N0SB 4M01A 1WRIA 1IBXA 1RYJA 4GLSC 1FNWA 3MTNB 3ZO5B 4TKNA 1SXTA 1FPYA 5FR3A 1K51A 5IKCM 4K3CA 2INDC 1Y56A 3PHWB 2QCZA 4K7WA 4OZAA 3PRMB 3AU4A 1ZDXA 2WX1A 2IGHA 4ICVA 1VD2A 1SB3C 4XGAB 4URKA 4W9GA 1V8CA 1TS2A 1V1PB 2JX5A 5HG2A 3AU5A 1JMLA 3PO0A 1E90A 2I1JA 3AH7A 5J18A 1EWYC 2G9HD 3AXCA 4LDTB 5TSSA 1WJUA 3W5VB 3JYUA 2FUHB 3URYA 1HXYD 2JT4B 2MX2A 2IDYA 1P1AA 1P7EA 3EFUA 2ZPNA 3TEYA 1JWBD 1WXMA 1QOGA 3AULA 4USAA 3ZNZB 3PZ8A 4OW0A 3Q8BA 2QSDA 2CR5A 3U7DA 3MHSD 3EUB2 4DXGA 1YX6B 3SDLC 2J7QB 1XXGA 2LXCA 2M56B 1N61A 3VQIA 1GG3A 1L0YB 3SHQA 1LM8B 4ZHPA 1I4GA 4ZDVA 1WRDB 4WURA 1AWDA 3R8BA 2ICIA 3UQBA 2IPKD 1IP9A 2DZKA 2JXTA 4M0WA 2KN4A 1OQQA 2E3TA 4HXDA 5BO4B 1EWCA 2KC2A 3DDCB 1JQ4A 1LO5D 1JWUD 4IW0A 3DBHB 2JYTA 1NEKB 2KVZA 5HFYA 2WXQA 3UINB 4OVUA 2YLMA 4C00A 2K5PA 1J7BA 3ZXVA 4FLHA 1QLBB 4W9LA 2NPTA 2NBUA 3A9JA 4MELA 4GSWA 3QJZA 2V3SA 1UGJA 2LD9A 2M17A 4MJSB 4PYUA 1Q5WB 1DOIA 3IHPC 2DZIA 3N20C 4W9JA 3RNCC 2G1EA 2D10A 1RFKA 3PLVA 2BYTA 3B2FA 3VRBB 4RGMA 3VTUA 5BMHA 3SU8X 4F7ZA 1QF6A 1E7PB 3D32A 4KIKB 2D11A 2C7MB 1P3QU 1T6BX 3N1XC 1C1YB 4H2AA 1V81A 5G5GA 2OEDA 3R2TA 4FJVB 4GGQA 3I5JC 3WAPA 2PEAA 3RNBC 4M8NA 3T9LA 3RI7C 2LJ5A 3A9KA 3HVDA 4LJPB 4YSYB 3QIJA 2KLCA 3R7RA 2TSSA 1OQRA 4AUQC 2RPVA 3L13A 2WDVB 1KLUD 1AW7A 3Q14C 3WANA 4TUUA 1A5RA 5KHOA 2LJIA 2KHWB 3A4SC 3P42A 3U52E 5AEKB 4FBJB 3DHIC 1PYWD 3MHZA 2LVPA 4M00A 2V4IB 2L1AA 3Q3NC 2NTTA 2AX5A 2GMIC 4QAYA 3SFEB 1KM7A 2UYZB 4KSKC 2RPQA 1C77A 5CTRC 2KT7A 2GBKA 2CKHB 2IGGA 5BMGA 3RD2A 2V9HA 4REZA 5JHBA 4LNNA 4A9AA 5EE1A 3LXFA 2DYOA 1I4HA 3I9V1 2H88B 1J19A 1KLGD 3N1ZC 3VVWB 3GS2A 1OEYA 1FXIA 1YNTE 2L05A 1QOFA 4TSSA 3W2DA 1VJKA 2Y3AA 3IG3A 3QX1A 2RDBC 5GMVA 2PMVA 2DAJA 4GU2A 2QDFA 5BYQA 4HDQA 3NZ3A 2KDBA 2FE8A 1MVKA 2ZEQA 1SGHA 3KYCD 4AJYB 3SFDB 1XQQA 1SJHD 4MGIE 3L16A 2N9XA 2W3SA 4IC7B 1WJ4A 3ZNHB 1L6VA 4KVGB 4WIPA 2G3QB 1LFDA 4TMAB 3E56A 4EFOA 2KQSA 4KDIC 1N5WA 1T3QA 4RH6A 3NS1A 1E6EB 3HM3A 2JWUA 4F1SA 5DCNA 4M8MA 2WDRB 3VDZA 2GOWA 1T0YA 2XN9C 4S17A 3ONSA 3GZNI 2KTFA 5FR6A 2RR9A 3IAM1 4GIVA 4CYEA 1L4DB 1WR6E 2KMCA 3Q8EA 2O6VB 3Q8AA 4BKGA 2I1KA 5BYRA 1HZ6A 3ML9A 4MT5A 1GUAB 1ZP0B 1FNVA 3ZYYX 1F2RC 4DQOC 3MFGA 1GOZA 1GC7A 2LVOA 1QT9A 2ZJDA 1ZE3D 1WXAA 3KLSX 2IYDB 4BOSC 3RFZB 2O2VB 3DVGX 5IP4D 2M19A 4HRSA 1LQBA 2REXA 3DWMA 1TS3A 2MBBB 4HPPA 1UGMA 2WXFA 4AP4C 1UD7A 5GXGB 3VFKA 2DYMA 3RMKC 3J9CA 3PGEA 4ANWA 4D2KA 1C4AA 3M63B 4GDLB 3EGRA 4WWNA 1FRRA 3DBLB 3WALA 2ZZPB 2IO2B 3WAMA 1V2YA 1UBIA 1M4VA 2Y5PA 2OOBB 1TTNA 3OG5A 2RD0A 2JUOA 3U8ZA 1N62A 5DPRA 2MBHA 1WZ0A 3FILB 2AQ3B 2KN5A 3DVNV 3B0AA 3VH4B 2MWSB 3WAOA 3AB5A 4CO7A 2K1FA 3DBRB 4GB9A 1HZ5A 3GE3C 3AI5A 4L1BA 1V1PA 1J7CA 2PPHA 3EC8A 4BKSD 2J53A 3A4RA 5L83A 1VZ8A 4C7ZA 1IPGA 2CHZA 5LXIB 1ET9A 3AE9B 4OHJA 3NRZA 3ZW3A 4HCPB 2BB5A 4IG7B 4P7IA 1B1ZA 4E74A 4WJOA 2KJRA 5AZFA 1D3ZA 2AEHA 2XK5B 2MCNB 5AZHA 1P0RA 3AEDB 3BY4B 2M0AA 4W9HA 4KZ0A 1RFAA 4W9CA 3TBLD 2I38A 4MH8A 3VHTC 3P2BA 3B9JA 2K22A 1GB4A 1PDXA 1OGWA 2LMCA 4RFBA 2DZMA 2I2YA 3EA6A 3ZRFA 3DHGC 1GPXA 3R2IA 3MP9A 1NYQA 1E8ZA 2ZCBA 5J2RA 2DYBA 4WWOA 1P9DU 1YJ1A 2BQQA 4FXCA 4K1RB 1TY0A 1TKGA 1VDVA 2K6QA 3APFA 4BZAA 1R4NB 4A6QA 3AE5B 2MQJA 2WWZA 2FAZA 3N32A 3APCA 3WA0A 1E8XA 1VZ7A 3AE1B 4KSLC 1FXAA 3VTVA 4HLEA 1SJED 1UWMA 2Z0DB 2KDIA 2DENB 5G2NA 2J0JA 1HTOA 1YIWA 4ACFA 4MJSA 2EKEC 4TQ1A 2KKCA 1DYQA 2JSVX 2JRIB 3I63C 2Z8LA 2ASQA 2PVGC 3H1UA 2AL3A 3Q3JA 3DBSA 4CHKA 1RM6C 2JF5A 1NI3A 5LXHA 4KIKA 2W54A 2LGIA 2B3AA 1WYGA 1TZOA 1WMHB 2MLBA 2KFKB 5IO9A 2INNE 3ENEA 4GDKB 2DX5B 5D2MB 4NAMA 3L0WB 4B95A 2ON8A 4N6EB 2KTRA 1ROEA 3RNAC 4LK0M 1QQRA 5CHVC 2KWCA 5CX3A 3HK0A 2WHIA 1JWAD 2V3NA 3HM6X 2J0KA 3H6NA 2JU6X 1G6JA 2PJHA 2MBEA 3RYTA 3NHEB 2IY1B 5L95C 4PYZA 3DHHC 5IAAC 1H4RA 2JPHA 3P1MA 3SD5A 2Z59B 4E71A 3PLUA 4NPNA 2K0PA 3Q3OC 1FD6A 5FK9C 3L17A 1C76A 2GLSA 2KMMA 4DK5A 2JRHA 5AZGA 1P7FA 2WDQB 4HCNB 2QJLA 4IM3A 4EZKA 2N1VA 4WJQA 3RNEC 3PPAA 4JPSA 2IZVB 3PTFC 2HE7A 2CU1A 2OJRA 1Z5SB 3BINA 2VZKD 5HKHA 5J17A 5CHFA 2RSUA 3U7ZA 2NCNA 2WXRA 1STEA 4YSZB 2L3ZA 4KV2A 1WX9A 4ZRPA 3VH3B 4EOYA 3IAS1 3S2AA 1ZW7A 1X1MA 3JVZX 1Y8RC 1V9JA 3JW0X 3P63A 3NUHB 1YQ4B 3GB1A 1YX5B 4NJ6A 2AL6A 2JVCA 3DVGY 2G45B 4P1BC 1NENB 1D5MC 1I4XA 1YMHE 2C7NB 1V1OA 1NDDA 4DBGA 2CJNA 2VRRB 4TQ0A 3NG0A 3LB8C 4ANXA 2QMTA 3IBEA 3HVZA 3CWIA 3Q8FA 2KC1A 2ZPYA 3PRPB 4LNOA 3NJTA 3BVGA 1FFUA 1WFYA 2KWVB 2UWQA 1F1HA 2MJEA 3VRAB 1I35A 1TKEA 1AYFA 3HUIA 3UGBB 1UUPA 1I7HA 4DXAB 4JWUC 4O1NA 2O6VA 2RMMA 5AUKA 3P4RB 2KMAA 2EELA 1IGDA 2VH1A 1CMXB 3HRDD 2J4XA 2M4NA 1MG8A 1I42A 2J0MA 1F9JA 2ZNVB 3H7SA 4JE3B 3CMMB 3PZDA 1J0GA 2KVRA 1EM7A 1QOBA 3DWGC 3BK2A 4P16A 2EKIA 3ECIA 2D3CA 4RMAA 2WXLA 2FCSA 2KOXA 3RZFA 4II3B 4G0NB 4B9KA 2C9WB 2WNMA 1C9FA 1PUTA 2KX0A 4NAWB 1DOYA 1TIFA 2N9LA 3MJ5A 2BKRB 2JY6A 3RNGC 3TUOA 3QWZB 2LASA 2GRIA 1DGJA 1N5XA 2EMSA 3VTWA 2EMTA 4NJ7A 3FILA 2B76B 3U2SC 2WU5B 4A3PA 3M95A 3PSEB 4FHJA 4F8CB 3V61A 1ACCA 1TYGB 4JX1C 1L7YA 2QHOA 4C4VB 4HPMB 1D5XC 1S3SG 4MSQB 2X38A 2HJ8A 3R66C 1KTKA 5DPSA 2N7DA 1IYFA 3V6CB 1IBXB 4MGYE 5E6OA 2D3BA 2BW2A 2L76A 5EE0A 4PK1A 4AOFA 3K9OB 3KUDB 2CHWA 1GNUA 3C19A 2IO0B 4J3OD 1IUEA 4J6IA 2FCQA 4OZBA 1YJIA 4KGSA 1L0XB 5JH5C 4Q2JA 2WYQA 2WXJA 4KZCA 2Q5WD 4MH0E 5FKAC 3ZTDA 3A33B 3KYDD 4AS1A 3PREA 3RCZA 1Z2MA 3ZXRA 3T3OA 3ZIMA 4FA6A 4DWFA 4AWJA 5TR5A 4FJZA 2YVCA 4YT0B 2K8CA 2FCNA 1YQ3B 5EE3A 5JXVA 1RWSA 1C78A 2KQ7A 2MP2B 4HK2A 4WAAA 2KJ6A 1QKZA 2Y5CA 4US8A 3AEAB 5C1ZA 4L2YA 2VH2A 2HD5B 4GXBA 3CIRB 1FIQA 4XDDA 4W9EA 2DZJA 1KOTA 2WU2B 4BVUC 3AEFB 3QA8A 1WZ3A 2KDMA 1V97A 4BBNF 2CU3A 3A1QB 3NVVA 1KF6B 1FCLA 2IY0B 4K7SA 1WGRA 4FN2A 2WS3B 1K50A 4M02A 1WGKA 1SF0A 2L8JA 1IGCA 2MJ3A 2NS5A 2A4ZA 5JHAA 2WDTB 5G55A 4FHKA 2A5UA 5IN7A 3O13A 1K52A 1SE2A 3W1YA 2L52A 3P4PB 2KFKA 2NPTB 3VR8B 1PGAA 3OWEB 2FUG1 2ZW1A 2HTHA 4LJOB 1FNUA 2ZCCA 1NBFC 4R3DA 1I4RA 3Q2AC 1WE7A 3BVMA 3C0RB 2J42A 3PS6A 4LNKA 3PRZA 1T5XD 2MJDA 1CK1A 3V6EB 4WJPA 4ANUA 2FIFA 3RULA 1WIAA 1JROA 2HJ1A 4NY0A 1Q0WB 1FCCC 4TV3A 3AE3B 1PFDA 1HTQA 3ETRA 4RGTA 3RN9C 4BAXA 4ZOHC 2QILA 4S0RA 3P4SB 3TJPA 4B6WA 1V49A 4CQNA 1I4PA 4IUMB 2PW9A 3A9KB 2L83A 3NZUA 1T0QC 1FFVA 1R4MI 1RAXA 5LLIA 3ZTCA 1C4PA 4YXDB 3NS8A 2JZPA 4WJNA 1TZ1A 3L10B 3VUYA 3KUZA 5I4DA 4I6PA 2K39A 3BZDB 4OVVA 4YWGG 1E7UA 3UF8A 2BB6A 1E7VA 1K53A 4DDGD 2M8SA 2RGFA 2XBBC 4IWQA 4FADA 3QQ8B 4JLCA 2MSED 1GJZA 2BYFA 5BMIA 4L23A 5H8YE 4IKGA 3IT6B 3CSFA 2W82A 4I6NB 2QC8A 1E0ZA 5E6NA 2K3UA 4N9F4 1SEBD 3IVFA 3TCAA 3T3NA 4PS3A 3EHVA 4G3XB 2IGDA 3VXWA 3IFWB 5IOIA 3WIMA 2KZRA 4WWMA 3GZNB 1RLFA 2BGFA 1V80A 4P1CC 3AEGB 5KHQA 2WXHA 2LHDA
chains in the Genus database with same CATH topology
2TSSA 4ARIA 1OQRA 4HEA1 2RPVA 2WXRA 4KKJA 1STEA 1TS4A 4LTUA 4YSZB 2WDVB 1KLUD 1AW7A 3BIID 2PTLA 4HKZE 4ZRPA 3V05A 2QIEB 2LJIA 3IAS1 1ZXHA 2MEKA 1CJEA 1FMAD 4OZCA 3P42A 2XNAC 3U52E 3W9CB 1PYWD 3MHZA 1JCKB 2V4IB 2KQ4X 2L1AA 3KWLA 2NTTA 2AX5A 3P63A 2ACZB 3NUHB 1YQ4B 2QEJC 3GB1A 2INPE 1B9RA 3SFEB 1A70A 3U4EG 1NENB 1YJJA 1ZUD2 1D5MC 1HQRD 2H89B 1I4XA 1L0VB 1ZOYB 1YMHE 2WQYB 1D4BA 4RCOA 1V1OA 1WWTA 1C77A 4B0EA 2CJNA 4TQ0A 2IGGA 5BMGA 3AECB 2DBYA 4YTNB 4REZA 1JRPA 3BYTB 3LB8C 5EE1A 2N9KA 4A9AA 1ESFA 2SAKA 3LXFA 1XLQA 2DYOA 2QMTA 1I4HA 3I9V1 3FC4A 3HVZA 2H88B 3CWIA 3Q8FA 3NVZA 1XO3A 1KLGD 4ZYSA 2NTSA 3GS2A 3BVGA 4MM3B 1FXIA 1NYRA 1EU3A 1FFUA 1YNTE 1QOFA 1SSNA 4TSSA 2HDEA 3W2DA 4C80A 1VJKA 3AEBB 5D7GA 2Y3AA 2MJEA 3VRAB 1TKEA 1NVID 1AYFA 3HUIA 3FAHA 1UUPA 1I7HA 1PGBA 1VRAB 2R61A 5AUIA 4JWUC 1CZPA 2WXOA 2JYEA 4O1NA 2PMVA 3W5UB 3H8HA 5BYQA 2RMMA 3AE4B 5AUKA 2WXNA 3P4RB 3NZ3A 2EELA 1IGDA 1PGXA 1R7SA 1SIJA 2FE8A 3LYYA 2CJOA 1MVKA 1E10A 1MHHE 3HRDD 2GI9A 2J4XA 4YTMB 3SFDB 1Q10A 1TKYA 5BYSA 1SJHD 1EU4A 5G5HA 4JWSC 1JW9D 4A90A 1D5ZC 4ITKA 2W3SA 4JE3B 4RGOS 2E6XA 1WSPA 1L6VA 1EM7A 1QOBA 4WIPA 3DWGC 1YN3A 3BK2A 4P16A 2EKIA 4RF0A 3AMZA 4KX6B 2ZW0A 3IXSA 4TMAB 3E56A 2WXLA 1F77A 4NJCA 3RPFC 3AE8B 1N5WA 1T3QA 3C8YA 1VR9A 2WXPA 4RH6A 3NS1A 1E6EB 2JWUA 2WDRB 3KQ4A 3SEBA 2DWQA 2WNMA 1HA5A 3L4PA 3SR6A 1C9FA 2LEKA 2XN9C 1PUTA 4WAFA 4NAWB 2ONQA 4XWTA 1DOYA 4N59A 2N9LA 3AEEB 3MJ5A 1GAQB 1QOAA 3AM9A 1XF5L 3IAM1 1XLOA 3Q8CA 3TUOA 1TJEA 1L6UA 4KKIA 1L4DB 1UWXA 2AQ2B 4KGTA 5HI1A 3Q8EA 2GRIA 1DGJA 1N5XA 5D3DA 1MI0A 3Q8AA 1TY2A 2WXKA 1D6EC 5BYRA 1HZ6A 3BK1A 3GP7A 2YEPF 4ZRQA 2RDGA 4MT5A 3FILA 1ZP0B 1FNVA 4EE2A 3ZYYX 2V3PA 1MPEA 1F2RC 4DQOC 1I4QA 1VLBA 3MFGA 1GOZA 2B76B 3V3XA 1QT9A 1UNSA 2WXMA 3U2SC 2WU5B 1ZE3D 3KLSX 2DLBA 2J52A 1SE3A 3PZ7A 1ACCA 1BMLC 1TYGB 1WXQA 2NMQA 4JX1C 3RFZB 3TEWA 3IT4B 4WH4A 3BYYB 2M19A 4HRSA 5HHDG 2FBWB 3DWMA 1TS3A 2WXFA 1D5XC 3AE6B 4A8XC 1DOXA 5H92C 5GXGB 2X38A 2DYMA 1QILA 2K9XA 3J9CA 5C3JB 1KTKA 2PIAA 4D2KA 1N63A 1C4AA 4GDLB 1IBXB 1MHXA 3EGRA 1FRRA 2LHEA 4MACA 4DXFA 1XLPA 2BW2A 2SEBD 3W1SA 1XCQL 2WLBA 2IJ0A 5EE0A 4IDIA 1M4VA 2Y5PA 3NVWA 2N7JA 4RF1A 4ARCA 3TSSA 4J3OD 1SE4A 3VR9B 1N62A 1IUEA 2YEPB 4OZBA 4ZHOA 3UI3A 1VZ6A 3FILB 1SBBB 2AQ3B 1YJIA 4KGSA 1L0XB 1KH0A 1F0ZA 2W3RA 1N60A 3AB5A 2AQ1B 4B0MA 1XLNA 4Q2JA 2WXJA 2BS4B 2Q5WD 1HZ5A 5FKAC 4L1BA 1JALA 1V1PA 1J7CA 4AS1A 1J7AA 1FEHA 3TEZA 3T3OA 1GB1A 4AQ7A 5D3IB 4KGRA 4XDCA 2J53A 3NVYA 4YT0B 5T8IA 3E9SA 1VZ8A 4C7ZA 1YN5A 1YQ3B 2KACA 5EE3A 5JXVA 1ET6A 1C78A 1ET9A 1RWSA 3AE9B 5MPOA 3P4QB 4PT5A 4OHJA 1QKZA 3ZJVA 2WXGA 2Y5CA 3NRZA 3AEAB 4US8A 4L2YA 3CIRB 2BB5A 3I57A 1FIQA 2BTEA 4XDDA 2JQRB 1B1ZA 4HROA 2N0SB 1WRIA 3Q69A 2WU2B 1IBXA 1RYJA 4GLSC 3AEFB 1FNWA 2KDMA 3B2GA 4US9A 2L32A 1V97A 3TEXA 2CU3A 1SXTA 3NVVA 5FR3A 1KF6B 1K51A 1KFYB 2KAJA 3AEDB 2M0AA 1FCLA 1E9MA 1HEZE 4N58A 1Y56A 3ZQ4A 3AE2B 4IOIE 2WS3B 2I38A 4MH8A 1TS5A 4OZAA 1K50A 3B9JA 2K22A 3ZJTA 1GB4A 1PDXA 1WGKA 1SF0A 1ZDXA 2IGHA 1IGCA 2LMCA 2MJ3A 4RFBA 1SB3C 2I2YA 3EA6A 1GPXA 3R2IA 4OVZA 1V8CA 3MP9A 1TS2A 1V1PB 1NYQA 2JX5A 3N9YC 5HG2A 1YN4A 1JMLA 3PO0A 5E6JA 3AH7A 3O13A 1EWYC 4FXCA 1K52A 1SE2A 2G9HD 4NZLB 1TY0A 2L52A 1TKGA 1VDVA 3AV8A 3P4PB 5TSSA 3KWVA 4A55A 3W5VB 2GB1A 2BS2B 2RDHA 2HTME 4A6QA 3URYA 3VR8B 1HXYD 3AE5B 1XCTL 1PGAA 2D5GA 3OWEB 3ZJUA 2FUG1 2IDYA 2PKOA 2ZW1A 4YSXB 2WP9B 1P7EA 1VZ7A 1FNUA 3AE1B 1FXAA 4UDUC 3TEYA 1SJED 1JWBD 4R3DA 1QOGA 1UWMA 4USAA 1I4RA 3PZ8A 4OW0A 3BVMA 3Q8BA 2QSDA 1BXTA 2LFIA 2J42A 1C4CA 1ZDVA 2BS3B 1L5PA 1T5XD 3EUB2 2MJDA 4RNAA 4DXGA 1CK1A 4TQ1A 1DYQA 1ZXIA 2JSVX 1XXGA 2Z8LA 2M56B 1KRHA 1N61A 1JROA 3VQIA 2PVGC 3ZGZA 1FCCC 1L0YB 3AE3B 3MC0B 1PFDA 3ETRA 4ZHPA 4RGTA 1I4GA 2VZKB 3BWUD 2KWDA 4WURA 1AWDA 3R8BA 4HKQA 1RM6C 2ICIA 1NI3A 1OFFA 4ZOHC 2W54A 2QILA 2IPKD 3P4SB 4CQNA 2JXTA 1I4PA 4M0WA 2KN4A 1OQQA 2LGIA 2E3TA 2PW9A 3AN1A 1JWMD 1WYGA 1TZOA 2L83A 1EWCA 1FFVA 4LLGM 4WQMA 1JQ4A 4XWWA 1LO5D 1ZPSA 1JWSD 1JWUD 1C4PA 2INNE 4YXDB 2JYTA 1NEKB 4GDKB 4XE0A 2JZPA 2WXQA 3WCQA 5HFYA 4NAMA 1F2RI 2BBCA 2BT6A 2W55A 2K5PA 1J7BA 2ON8A 4N6EB 1QLBB 1ROEA 5EE9A 2WXIA 1AN8A 4P6VF 4LK0M 5I4DA 1QQRA 3BZDB 4YWGG 2MH7A 2BB6A 1UGJA 5LNK1 5C2TB 1JWAD 2V3NA 3AE7B 1K53A 1DOIA 2JU6X 1CQVA 1FM0D 2OHFA 2G1EA 4C56C 3BVZA 1RFKA 3ABVB 2BYTA 3B2FA 3VRBB 3P1MA 4RGMA 1XEEA 5BMIA 4L23A 5H8YE 4IKGA 5BMHA 3IT6B 2K0PA 2W82A 1FD6A 1BUIC 1C79A 5FK9C 1QF6A 1E7PB 1C76A 2KMMA 1E0ZA 2K3UA 1P7FA 2PLPA 1L4ZB 1T6BX 1SEBD 2WDQB 1ENFA 3T3NA 2QJLA 4H2AA 5G5GA 2IGDA 2PVOD 2OEDA 3R2TA 4WWMA 4JPSA 4RGNA 4YTPB 2LUMA 1FRDA 4HJGE 2VZKD 3HVDA 1FO4A 4C7YA 4YSYB 3AEGB 2V0GA 2WXHA 3U7ZA 2LHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAL A;  1OQR A;  3RPF C;  3AE8 B;  1J7C A;  2M56 B;  1J7A A;  1KRH A;  1N5W A;  1N61 A;  1T3Q A;  1JRO A;  4YSZ B;  3NS1 A;  2PVG C;  1E6E B;  2WDV B;  3AE3 B;  3BII D;  2WDR B;  1PFD A;  2QIE B;  3ETR A;  4ZHP A;  2DWQ A;  3L4P A;  3SR6 A;  2LEK A;  1PUT A;  3NVY A;  4YT0 B;  1AWD A;  1RM6 C;  4C7Z A;  1DOY A;  1NI3 A;  1OFF A;  1YQ3 B;  4N59 A;  4ZOH C;  1CJE A;  1FMA D;  1RWS A;  2W54 A;  3AEE B;  3AE9 B;  5MPO A;  3P4Q B;  3P4S B;  1GAQ B;  1QOA A;  3W9C B;  3AM9 A;  3KWL A;  1XLO A;  2Y5C A;  3AEA B;  3NRZ A;  4US8 A;  2AX5 A;  1TJE A;  1L6U A;  1OQQ A;  2E3T A;  3P63 A;  3AN1 A;  2ACZ B;  1WYG A;  2L83 A;  1YQ4 B;  3CIR B;  1DGJ A;  1FIQ A;  1N5X A;  1FFV A;  1B9R A;  4WQM A;  1A70 A;  5EE3 A;  3SFE B;  1NEN B;  1YJJ A;  1JQ4 A;  2JQR B;  1ZUD 2;  1L0V B;  2H89 B;  1ZP0 B;  1ZOY B;  2N0S B;  2WQY B;  4HRO A;  3ZYY X;  1WWT A;  4YXD B;  1NEK B;  1VLB A;  1WRI A;  2B76 B;  2WU2 B;  1RYJ A;  3AEF B;  3WCQ A;  1QT9 A;  2BT6 A;  2W55 A;  2WU5 B;  3B2G A;  4US9 A;  1V97 A;  2CU3 A;  2CJN A;  2K5P A;  1J7B A;  3NVV A;  4N6E B;  1KF6 B;  3AEC B;  1QLB B;  1ROE A;  2DBY A;  5EE9 A;  1KFY B;  2KAJ A;  3AED B;  4P6V F;  4YTN B;  1JRP A;  3LB8 C;  1E9M A;  1TYG B;  1WXQ A;  4N58 A;  5EE1 A;  4A9A A;  4JX1 C;  3LXF A;  1XLQ A;  3AE2 B;  2M19 A;  4HRS A;  2WS3 B;  3FC4 A;  2MH7 A;  2H88 B;  2FBW B;  3CWI A;  3DWM A;  3HVZ A;  3NVZ A;  1XO3 A;  3B9J A;  2K22 A;  1JWA D;  5C2T B;  1PDX A;  1WGK A;  1SF0 A;  3AE7 B;  2MJ3 A;  3AE6 B;  1SB3 C;  1DOI A;  1DOX A;  1FXI A;  1NYR A;  5GXG B;  5H92 C;  1GPX A;  1FFU A;  1FM0 D;  1QOF A;  1V8C A;  2JX5 A;  1NYQ A;  2OHF A;  1VJK A;  2K9X A;  3AEB B;  4C80 A;  5C3J B;  3PO0 A;  2MJE A;  3VRA B;  2G1E A;  2PIA A;  1TKE A;  1NVI D;  1AYF A;  3AH7 A;  3HUI A;  1RFK A;  3ABV B;  3FAH A;  3B2F A;  1N63 A;  1EWY C;  4FXC A;  3P1M A;  3VRB B;  1I7H A;  1FRR A;  5AUI A;  4JWU C;  1CZP A;  2L52 A;  1XLP A;  1TKG A;  1VDV A;  3AV8 A;  3P4P B;  5H8Y E;  3W5V B;  3AE4 B;  5AUK A;  2BS2 B;  2HTM E;  2WLB A;  3P4R B;  1E7P B;  1QF6 A;  1R7S A;  1SIJ A;  2KMM A;  5EE0 A;  2CJO A;  1E0Z A;  3VR8 B;  4IDI A;  1E10 A;  3AE5 B;  2WDQ B;  3NVW A;  3HRD D;  4YTM B;  3SFD B;  1TKY A;  2QJL A;  2PKO A;  5G5G A;  5G5H A;  4YSX B;  2PVO D;  2WP9 B;  3AE1 B;  4JWS C;  1FXA A;  3VR9 B;  1JW9 D;  1N62 A;  1IUE A;  1JWB D;  2W3S A;  4ITK A;  4WWM A;  4ZHO A;  1QOG A;  1UWM A;  4USA A;  4YTP B;  1YJI A;  1F0Z A;  2W3R A;  3W5U B;  1L6V A;  1N60 A;  1FRD A;  3AB5 A;  1QOB A;  2BS3 B;  3DWG C;  1XLN A;  1FO4 A;  2EKI A;  1L5P A;  3EUB 2;  4C7Y A;  2MJD A;  3AMZ A;  4KX6 B;  4YSY B;  2BS4 B;  3AEG B;  4LTU A;  1ZXI A;  2Q5W D; 
#chains in the Genus database with same CATH topology
 1EF1 A;  1UEL A;  1TT5 B;  4ARI A;  4HEA 1;  2BYE A;  2KO3 A;  3VUX A;  4PS7 A;  1V86 A;  4GOC A;  3TL5 A;  3RNF C;  1V6E A;  4ZYN A;  3CST A;  5DPT A;  1ZXH A;  2PE9 A;  2LI5 A;  4ASW C;  2MEK A;  2DNF A;  4OZC A;  5JZE B;  2XNA C;  3W9C B;  1JCK B;  4ICU A;  3KWL A;  1H8C A;  2JWZ A;  1SIF A;  2ACZ B;  4AJW A;  2INP E;  1SE9 A;  3U4E G;  1YJJ A;  1ZUD 2;  1L0V B;  2WQY B;  1ZOY B;  1V5T A;  1D4B A;  1WWT A;  3PV1 A;  1YOV B;  4ANV A;  3KW5 B;  2KJH B;  3AEC B;  4K7U A;  2DBY A;  2G4D B;  1HE8 A;  2LWP A;  1ISN A;  4NQL B;  3BYT B;  2SAK A;  1XLQ A;  1M94 A;  3FC4 A;  4PS8 A;  2UU7 A;  4HVB A;  1ZKH A;  3ML8 A;  4W9K A;  3B1L X;  4KDL B;  4MM3 B;  1NYR A;  4NAW A;  2BF8 B;  2PE6 B;  4DDI D;  4C80 A;  3N30 A;  3FAH A;  5AUI A;  3W5U B;  2NBW B;  2JYE A;  2WXO A;  3DPD A;  1MFW A;  3AE4 B;  2WXN A;  2KFJ A;  1PGX A;  2KWU B;  4EUT A;  3TIX A;  1MHH E;  4XZ4 A;  4YTM B;  1Q10 A;  4MEM A;  1EU4 A;  5G5H A;  3N3K B;  1JW9 D;  4A90 A;  1D5Z C;  4ITK A;  2MBO A;  2E6X A;  1WSP A;  4C4V A;  1MJD A;  3K9P B;  4RF0 A;  2WX0 A;  3AMZ A;  4JGH B;  2AYO B;  2K25 A;  3IXS A;  1F77 A;  4NNJ B;  2K6D B;  3C8Y A;  1VR9 A;  2WXP A;  3KQ4 A;  4JQW C;  3RT3 B;  2N7E A;  1TGZ B;  2DWQ A;  3L4P A;  3SR6 A;  2LEK A;  3NZS A;  2ONQ A;  4W9D A;  3AEE B;  1LGR A;  1GAQ B;  1QOA A;  3AM9 A;  1XF5 L;  1XLO A;  3X23 A;  3Q8C A;  1YQB A;  1L6U A;  4KKI A;  2AQ2 B;  4KGT A;  1V5O A;  1K8R B;  3VAW A;  1TY2 A;  2GBM A;  2WXK A;  2YEP F;  2JZ3 B;  4EE2 A;  1WM2 A;  2LRU A;  2LGY A;  2NR2 A;  1MPE A;  2V3P A;  5DPW A;  1I4Q A;  1VLB A;  2MRP A;  3V3X A;  1UNS A;  2WXM A;  2ZNV C;  1NI2 A;  3ZKJ C;  2KX3 A;  2C5L C;  1SE3 A;  3PZ7 A;  2LRW A;  2NMQ A;  3TEW A;  1WJ6 A;  3IT4 B;  1OQY A;  3BYY B;  2K8H A;  5D6J B;  2FBW B;  3DOW A;  2C60 A;  2OJW A;  3W1S C;  3AE6 B;  2X8X X;  4EEW A;  5H92 C;  3X0W A;  1T0S C;  5C3J B;  2MW5 A;  2MP2 A;  3PVL A;  4HDO A;  2PIA A;  3EEC A;  1WX7 A;  2D3A A;  1WE6 A;  3R7Q A;  2LHE A;  2BPS A;  5CHW A;  2R2O A;  2SEB D;  1XCQ L;  2WLB A;  5D94 A;  4IWO A;  4EKU A;  4K81 A;  2LGD A;  2M0X A;  3V60 A;  3H7P B;  2L7R A;  3DVN U;  4E3C A;  3ZLZ A;  3ZDM C;  3A1Q A;  1SE4 A;  3JSV B;  3VR9 B;  2YEP B;  3OLM D;  3UI3 A;  4BOZ B;  1AAR A;  1VZ6 A;  1SBB B;  4MGK E;  5E6P A;  1WGG A;  1N60 A;  4B0M A;  5EDS A;  1JAL A;  1UF0 A;  1J7A A;  1FEH A;  2ZVO A;  1TBE A;  1GB1 A;  4AQ7 A;  2O6V D;  5D3I B;  4XDC A;  4FUL A;  5IA7 A;  1E8W A;  2NVU I;  1YN5 A;  2KAC A;  2O2V A;  4IWP A;  3ZJV A;  2WXG A;  3CF6 E;  3HHM A;  1E5W A;  2IO3 B;  2GBR A;  2BWF A;  2KLG A;  3UIP B;  3I57 A;  2BTE A;  2JQR B;  4W9I A;  2FNJ B;  2KDE B;  4HRO A;  3Q69 A;  4GDL A;  2FID A;  3I3T B;  3LJ3 A;  4ZRJ A;  3B2G A;  4US9 A;  2L32 A;  3TEX A;  4W9F A;  2LVQ A;  4XYC A;  1KFY B;  2KAJ A;  1E9M A;  1HEZ E;  4BFR A;  4N58 A;  3ZQ4 A;  2XEW A;  3AE2 B;  4IOI E;  1TS5 A;  4HWI B;  2BVC A;  2Z0E B;  3ZJT A;  1S1Q B;  3H9D A;  4OVZ A;  2LGS A;  3N9Y C;  1YN4 A;  5E6J A;  2M1M A;  2D2Q A;  3QK0 A;  4NZL B;  3AV8 A;  3KWV A;  1L2N A;  4A55 A;  2C7H A;  3RZW C;  2GB1 A;  4DHZ B;  2BS2 B;  2RDH A;  2HTM E;  2KTR B;  1RRB A;  1MG4 A;  2JXX A;  1XCT L;  2D5G A;  3ZJU A;  2PKO A;  1EO6 A;  4YSX B;  2WP9 B;  1EF5 A;  4UDU C;  3FKY A;  2KD0 A;  3Q6B A;  3QC8 B;  4FJY A;  2LUE A;  1WX8 A;  1BXT A;  1FXT B;  2LFI A;  1C4C A;  1ZDV A;  4WWP A;  2BS3 B;  1L5P A;  4RNA A;  1ZXI A;  3DBL I;  4K3B A;  4BKT A;  3M62 B;  2BYV E;  1KRH A;  4II2 B;  3ZGZ A;  3MC0 B;  3ZUN A;  2XK5 A;  2G4S A;  2VZK B;  4DHJ D;  3BWU D;  2KWD A;  4HKQ A;  1OFF A;  1EUV B;  3KUC B;  4IM2 A;  1WR1 A;  3O65 B;  3ZRC A;  3AN1 A;  1JWM D;  4X57 B;  3DBR I;  4LLG M;  4WQM A;  1Q1O A;  4XWW A;  1QZE A;  4RM9 A;  3U30 A;  1JRU A;  1ZPS A;  1P98 A;  1JWS D;  1WM3 A;  4XE0 A;  3PHX B;  3WCQ A;  1F2R I;  2BBC A;  2BT6 A;  2W55 A;  3LDZ E;  4DHZ E;  2BKF A;  3ZNG C;  5EE9 A;  2WXI A;  1AN8 A;  1LXD A;  3Q3M C;  4P6V F;  4MDK E;  4BBN C;  2MH7 A;  5LNK 1;  5C2T B;  3AE7 B;  4ZRI A;  1WF9 A;  3DQV A;  2WGS A;  1CQV A;  1FM0 D;  2OHF A;  3ZNI D;  4LCD E;  4C56 C;  3BVZ A;  3ABV B;  1XEE A;  1C3T A;  4MGZ E;  4YL8 A;  1BUI C;  1C79 A;  2KYW A;  1F52 A;  2N1W A;  2PLP A;  1L4Z B;  3L54 A;  2N9E B;  1ENF A;  4M0W B;  1WJN A;  2PVO D;  3HIZ A;  3OAW A;  4RGN A;  4YTP B;  2LUM A;  1E8Y A;  1FRD A;  4HJG E;  2KK8 A;  1FO4 A;  4C7Y A;  2V0G A;  1WMH A;  4LTU A;  4MM3 A;  3EFC A;  3VUW A;  3A9J B;  1R4N I;  4GDK A;  3TMP B;  4KKJ A;  1TS4 A;  3BII D;  2PTL A;  4HKZ E;  3V05 A;  2QIE B;  4G50 A;  2D07 B;  2CHX A;  1KLV A;  3MC9 A;  1CJE A;  1FMA D;  2KQ4 X;  4EZJ A;  2QEJ C;  1B9R A;  1UH6 A;  1A70 A;  2MHJ A;  1HQR D;  2H89 B;  3OJ3 A;  4RCO A;  2LXA A;  2GBJ A;  4B0E A;  2INC C;  4LNF A;  4YTN B;  1JRP A;  2N9K A;  4HJK A;  1ESF A;  3T8M A;  2L0T A;  3R3M A;  1N6Z A;  2KXJ A;  3NVZ A;  1XO3 A;  3V62 A;  4ZYS A;  2NTS A;  3QAQ A;  1EU3 A;  1WY8 A;  1SSN A;  2HDE A;  3AEB B;  5D7G A;  1BT0 A;  4JL9 A;  1NVI D;  3RUI B;  1PGB A;  1VRA B;  2R61 A;  3KVF B;  1CZP A;  3H8H A;  3ZVV A;  3DCG A;  1R7S A;  1SIJ A;  2LGX A;  3LYY A;  4BKS A;  2CJO A;  4LDT D;  3PT2 B;  1E10 A;  2LZ6 A;  2GI9 A;  2DAF A;  5BYS A;  1TKY A;  3ZDT A;  1WXS A;  1GC6 A;  4JWS C;  3N1Y C;  2L0F A;  2GBN A;  1OTR B;  4RGO S;  2CS4 A;  4A3O A;  1YN3 A;  1WGY A;  4HPL B;  1WI0 A;  4KX6 B;  4A20 A;  2ZW0 A;  2IO1 B;  2KDF B;  2V4L A;  4XX5 A;  4NJC A;  3RPF C;  3AE8 B;  1UZX B;  3B08 A;  4DHJ B;  3Q3F A;  3QHT A;  4RM8 A;  3SEB A;  1HA5 A;  2MA9 B;  2N4F A;  4WAF A;  3APD A;  1UBQ A;  4XWT A;  4N59 A;  1PQS A;  1ZGU B;  2K8B A;  1TJE A;  1WGD A;  3H7P A;  1UWX A;  1WH3 A;  5HI1 A;  5D3D A;  1MI0 A;  1VCB A;  3JSV A;  1D6E C;  3BK1 A;  3GP7 A;  4ZRQ A;  2RDG A;  3MJW A;  1KJT A;  3NY5 A;  4I6L B;  4GN1 A;  1T0R C;  1WGH A;  2DLB A;  2FCM A;  2J52 A;  1BML C;  1WXQ A;  4LNI A;  4WH4 A;  2KNB A;  3GE8 C;  2MBQ A;  5HHD G;  1WXV A;  2Y5B B;  4A8X C;  1DOX A;  3OJ4 B;  1QIL A;  2K9X A;  4NQK E;  2AWT A;  1OEY J;  1N63 A;  1MHX A;  4MAC A;  3UIO B;  4DXF A;  1XLP A;  3W1S A;  4ZRK A;  2BWE S;  2IJ0 A;  4IDI A;  4EZL A;  3NOB A;  3NVW A;  2N7J A;  4G11 A;  4RF1 A;  4ARC A;  2N9P C;  3TSS A;  3UQA A;  2ZVN A;  3QAR A;  1YD8 U;  4ZHO A;  3KH0 A;  4IM0 A;  2JZZ A;  3DBH I;  2KAN A;  1KH0 A;  1F0Z A;  2W3R A;  1J8C A;  2AQ1 B;  1XLN A;  1U4A A;  2BS4 B;  3L08 A;  1R4M B;  4JIO U;  2V1Y A;  3TEZ A;  4GMV A;  4KGR A;  4MSM B;  2R2Q A;  2NBV B;  2D3G A;  2DHZ A;  3NVY A;  5T8I A;  4WQO B;  3E9S A;  1ET6 A;  3MC8 A;  5MPO A;  3ALB A;  2IBI B;  3P4Q B;  4PT5 A;  3M3J A;  1XD3 B;  1XT9 B;  4XC2 A;  3QCA A;  1WYW B;  3GOE A;  5C23 A;  2W9N A;  2L00 B;  2N0S B;  4M01 A;  1WRI A;  1IBX A;  1RYJ A;  4GLS C;  1FNW A;  3MTN B;  3ZO5 B;  4TKN A;  1SXT A;  1FPY A;  5FR3 A;  1K51 A;  5IKC M;  4K3C A;  2IND C;  1Y56 A;  3PHW B;  2QCZ A;  4K7W A;  4OZA A;  3PRM B;  3AU4 A;  1ZDX A;  2WX1 A;  2IGH A;  4ICV A;  1VD2 A;  1SB3 C;  4XGA B;  4URK A;  4W9G A;  1V8C A;  1TS2 A;  1V1P B;  2JX5 A;  5HG2 A;  3AU5 A;  1JML A;  3PO0 A;  1E90 A;  2I1J A;  3AH7 A;  5J18 A;  1EWY C;  2G9H D;  3AXC A;  4LDT B;  5TSS A;  1WJU A;  3W5V B;  3JYU A;  2FUH B;  3URY A;  1HXY D;  2JT4 B;  2MX2 A;  2IDY A;  1P1A A;  1P7E A;  3EFU A;  2ZPN A;  3TEY A;  1JWB D;  1WXM A;  1QOG A;  3AUL A;  4USA A;  3ZNZ B;  3PZ8 A;  4OW0 A;  3Q8B A;  2QSD A;  2CR5 A;  3U7D A;  3MHS D;  3EUB 2;  4DXG A;  1YX6 B;  3SDL C;  2J7Q B;  1XXG A;  2LXC A;  2M56 B;  1N61 A;  3VQI A;  1GG3 A;  1L0Y B;  3SHQ A;  1LM8 B;  4ZHP A;  1I4G A;  4ZDV A;  1WRD B;  4WUR A;  1AWD A;  3R8B A;  2ICI A;  3UQB A;  2IPK D;  1IP9 A;  2DZK A;  2JXT A;  4M0W A;  2KN4 A;  1OQQ A;  2E3T A;  4HXD A;  5BO4 B;  1EWC A;  2KC2 A;  3DDC B;  1JQ4 A;  1LO5 D;  1JWU D;  4IW0 A;  3DBH B;  2JYT A;  1NEK B;  2KVZ A;  5HFY A;  2WXQ A;  3UIN B;  4OVU A;  2YLM A;  4C00 A;  2K5P A;  1J7B A;  3ZXV A;  4FLH A;  1QLB B;  4W9L A;  2NPT A;  2NBU A;  3A9J A;  4MEL A;  4GSW A;  3QJZ A;  2V3S A;  1UGJ A;  2LD9 A;  2M17 A;  4MJS B;  4PYU A;  1Q5W B;  1DOI A;  3IHP C;  2DZI A;  3N20 C;  4W9J A;  3RNC C;  2G1E A;  2D10 A;  1RFK A;  3PLV A;  2BYT A;  3B2F A;  3VRB B;  4RGM A;  3VTU A;  5BMH A;  3SU8 X;  4F7Z A;  1QF6 A;  1E7P B;  3D32 A;  4KIK B;  2D11 A;  2C7M B;  1P3Q U;  1T6B X;  3N1X C;  1C1Y B;  4H2A A;  1V81 A;  5G5G A;  2OED A;  3R2T A;  4FJV B;  4GGQ A;  3I5J C;  3WAP A;  2PEA A;  3RNB C;  4M8N A;  3T9L A;  3RI7 C;  2LJ5 A;  3A9K A;  3HVD A;  4LJP B;  4YSY B;  3QIJ A;  2KLC A;  3R7R A;  2TSS A;  1OQR A;  4AUQ C;  2RPV A;  3L13 A;  2WDV B;  1KLU D;  1AW7 A;  3Q14 C;  3WAN A;  4TUU A;  1A5R A;  5KHO A;  2LJI A;  2KHW B;  3A4S C;  3P42 A;  3U52 E;  5AEK B;  4FBJ B;  3DHI C;  1PYW D;  3MHZ A;  2LVP A;  4M00 A;  2V4I B;  2L1A A;  3Q3N C;  2NTT A;  2AX5 A;  2GMI C;  4QAY A;  3SFE B;  1KM7 A;  2UYZ B;  4KSK C;  2RPQ A;  1C77 A;  5CTR C;  2KT7 A;  2GBK A;  2CKH B;  2IGG A;  5BMG A;  3RD2 A;  2V9H A;  4REZ A;  5JHB A;  4LNN A;  4A9A A;  5EE1 A;  3LXF A;  2DYO A;  1I4H A;  3I9V 1;  2H88 B;  1J19 A;  1KLG D;  3N1Z C;  3VVW B;  3GS2 A;  1OEY A;  1FXI A;  1YNT E;  2L05 A;  1QOF A;  4TSS A;  3W2D A;  1VJK A;  2Y3A A;  3IG3 A;  3QX1 A;  2RDB C;  5GMV A;  2PMV A;  2DAJ A;  4GU2 A;  2QDF A;  5BYQ A;  4HDQ A;  3NZ3 A;  2KDB A;  2FE8 A;  1MVK A;  2ZEQ A;  1SGH A;  3KYC D;  4AJY B;  3SFD B;  1XQQ A;  1SJH D;  4MGI E;  3L16 A;  2N9X A;  2W3S A;  4IC7 B;  1WJ4 A;  3ZNH B;  1L6V A;  4KVG B;  4WIP A;  2G3Q B;  1LFD A;  4TMA B;  3E56 A;  4EFO A;  2KQS A;  4KDI C;  1N5W A;  1T3Q A;  4RH6 A;  3NS1 A;  1E6E B;  3HM3 A;  2JWU A;  4F1S A;  5DCN A;  4M8M A;  2WDR B;  3VDZ A;  2GOW A;  1T0Y A;  2XN9 C;  4S17 A;  3ONS A;  3GZN I;  2KTF A;  5FR6 A;  2RR9 A;  3IAM 1;  4GIV A;  4CYE A;  1L4D B;  1WR6 E;  2KMC A;  3Q8E A;  2O6V B;  3Q8A A;  4BKG A;  2I1K A;  5BYR A;  1HZ6 A;  3ML9 A;  4MT5 A;  1GUA B;  1ZP0 B;  1FNV A;  3ZYY X;  1F2R C;  4DQO C;  3MFG A;  1GOZ A;  1GC7 A;  2LVO A;  1QT9 A;  2ZJD A;  1ZE3 D;  1WXA A;  3KLS X;  2IYD B;  4BOS C;  3RFZ B;  2O2V B;  3DVG X;  5IP4 D;  2M19 A;  4HRS A;  1LQB A;  2REX A;  3DWM A;  1TS3 A;  2MBB B;  4HPP A;  1UGM A;  2WXF A;  4AP4 C;  1UD7 A;  5GXG B;  3VFK A;  2DYM A;  3RMK C;  3J9C A;  3PGE A;  4ANW A;  4D2K A;  1C4A A;  3M63 B;  4GDL B;  3EGR A;  4WWN A;  1FRR A;  3DBL B;  3WAL A;  2ZZP B;  2IO2 B;  3WAM A;  1V2Y A;  1UBI A;  1M4V A;  2Y5P A;  2OOB B;  1TTN A;  3OG5 A;  2RD0 A;  2JUO A;  3U8Z A;  1N62 A;  5DPR A;  2MBH A;  1WZ0 A;  3FIL B;  2AQ3 B;  2KN5 A;  3DVN V;  3B0A A;  3VH4 B;  2MWS B;  3WAO A;  3AB5 A;  4CO7 A;  2K1F A;  3DBR B;  4GB9 A;  1HZ5 A;  3GE3 C;  3AI5 A;  4L1B A;  1V1P A;  1J7C A;  2PPH A;  3EC8 A;  4BKS D;  2J53 A;  3A4R A;  5L83 A;  1VZ8 A;  4C7Z A;  1IPG A;  2CHZ A;  5LXI B;  1ET9 A;  3AE9 B;  4OHJ A;  3NRZ A;  3ZW3 A;  4HCP B;  2BB5 A;  4IG7 B;  4P7I A;  1B1Z A;  4E74 A;  4WJO A;  2KJR A;  5AZF A;  1D3Z A;  2AEH A;  2XK5 B;  2MCN B;  5AZH A;  1P0R A;  3AED B;  3BY4 B;  2M0A A;  4W9H A;  4KZ0 A;  1RFA A;  4W9C A;  3TBL D;  2I38 A;  4MH8 A;  3VHT C;  3P2B A;  3B9J A;  2K22 A;  1GB4 A;  1PDX A;  1OGW A;  2LMC A;  4RFB A;  2DZM A;  2I2Y A;  3EA6 A;  3ZRF A;  3DHG C;  1GPX A;  3R2I A;  3MP9 A;  1NYQ A;  1E8Z A;  2ZCB A;  5J2R A;  2DYB A;  4WWO A;  1P9D U;  1YJ1 A;  2BQQ A;  4FXC A;  4K1R B;  1TY0 A;  1TKG A;  1VDV A;  2K6Q A;  3APF A;  4BZA A;  1R4N B;  4A6Q A;  3AE5 B;  2MQJ A;  2WWZ A;  2FAZ A;  3N32 A;  3APC A;  3WA0 A;  1E8X A;  1VZ7 A;  3AE1 B;  4KSL C;  1FXA A;  3VTV A;  4HLE A;  1SJE D;  1UWM A;  2Z0D B;  2KDI A;  2DEN B;  5G2N A;  2J0J A;  1HTO A;  1YIW A;  4ACF A;  4MJS A;  2EKE C;  4TQ1 A;  2KKC A;  1DYQ A;  2JSV X;  2JRI B;  3I63 C;  2Z8L A;  2ASQ A;  2PVG C;  3H1U A;  2AL3 A;  3Q3J A;  3DBS A;  4CHK A;  1RM6 C;  2JF5 A;  1NI3 A;  5LXH A;  4KIK A;  2W54 A;  2LGI A;  2B3A A;  1WYG A;  1TZO A;  1WMH B;  2MLB A;  2KFK B;  5IO9 A;  2INN E;  3ENE A;  4GDK B;  2DX5 B;  5D2M B;  4NAM A;  3L0W B;  4B95 A;  2ON8 A;  4N6E B;  2KTR A;  1ROE A;  3RNA C;  4LK0 M;  1QQR A;  5CHV C;  2KWC A;  5CX3 A;  3HK0 A;  2WHI A;  1JWA D;  2V3N A;  3HM6 X;  2J0K A;  3H6N A;  2JU6 X;  1G6J A;  2PJH A;  2MBE A;  3RYT A;  3NHE B;  2IY1 B;  5L95 C;  4PYZ A;  3DHH C;  5IAA C;  1H4R A;  2JPH A;  3P1M A;  3SD5 A;  2Z59 B;  4E71 A;  3PLU A;  4NPN A;  2K0P A;  3Q3O C;  1FD6 A;  5FK9 C;  3L17 A;  1C76 A;  2GLS A;  2KMM A;  4DK5 A;  2JRH A;  5AZG A;  1P7F A;  2WDQ B;  4HCN B;  2QJL A;  4IM3 A;  4EZK A;  2N1V A;  4WJQ A;  3RNE C;  3PPA A;  4JPS A;  2IZV B;  3PTF C;  2HE7 A;  2CU1 A;  2OJR A;  1Z5S B;  3BIN A;  2VZK D;  5HKH A;  5J17 A;  5CHF A;  2RSU A;  3U7Z A;  2NCN A;  2WXR A;  1STE A;  4YSZ B;  2L3Z A;  4KV2 A;  1WX9 A;  4ZRP A;  3VH3 B;  4EOY A;  3IAS 1;  3S2A A;  1ZW7 A;  1X1M A;  3JVZ X;  1Y8R C;  1V9J A;  3JW0 X;  3P63 A;  3NUH B;  1YQ4 B;  3GB1 A;  1YX5 B;  4NJ6 A;  2AL6 A;  2JVC A;  3DVG Y;  2G45 B;  4P1B C;  1NEN B;  1D5M C;  1I4X A;  1YMH E;  2C7N B;  1V1O A;  1NDD A;  4DBG A;  2CJN A;  2VRR B;  4TQ0 A;  3NG0 A;  3LB8 C;  4ANX A;  2QMT A;  3IBE A;  3HVZ A;  3CWI A;  3Q8F A;  2KC1 A;  2ZPY A;  3PRP B;  4LNO A;  3NJT A;  3BVG A;  1FFU A;  1WFY A;  2KWV B;  2UWQ A;  1F1H A;  2MJE A;  3VRA B;  1I35 A;  1TKE A;  1AYF A;  3HUI A;  3UGB B;  1UUP A;  1I7H A;  4DXA B;  4JWU C;  4O1N A;  2O6V A;  2RMM A;  5AUK A;  3P4R B;  2KMA A;  2EEL A;  1IGD A;  2VH1 A;  1CMX B;  3HRD D;  2J4X A;  2M4N A;  1MG8 A;  1I42 A;  2J0M A;  1F9J A;  2ZNV B;  3H7S A;  4JE3 B;  3CMM B;  3PZD A;  1J0G A;  2KVR A;  1EM7 A;  1QOB A;  3DWG C;  3BK2 A;  4P16 A;  2EKI A;  3ECI A;  2D3C A;  4RMA A;  2WXL A;  2FCS A;  2KOX A;  3RZF A;  4II3 B;  4G0N B;  4B9K A;  2C9W B;  2WNM A;  1C9F A;  1PUT A;  2KX0 A;  4NAW B;  1DOY A;  1TIF A;  2N9L A;  3MJ5 A;  2BKR B;  2JY6 A;  3RNG C;  3TUO A;  3QWZ B;  2LAS A;  2GRI A;  1DGJ A;  1N5X A;  2EMS A;  3VTW A;  2EMT A;  4NJ7 A;  3FIL A;  2B76 B;  3U2S C;  2WU5 B;  4A3P A;  3M95 A;  3PSE B;  4FHJ A;  4F8C B;  3V61 A;  1ACC A;  1TYG B;  4JX1 C;  1L7Y A;  2QHO A;  4C4V B;  4HPM B;  1D5X C;  1S3S G;  4MSQ B;  2X38 A;  2HJ8 A;  3R66 C;  1KTK A;  5DPS A;  2N7D A;  1IYF A;  3V6C B;  1IBX B;  4MGY E;  5E6O A;  2D3B A;  2BW2 A;  2L76 A;  5EE0 A;  4PK1 A;  4AOF A;  3K9O B;  3KUD B;  2CHW A;  1GNU A;  3C19 A;  2IO0 B;  4J3O D;  1IUE A;  4J6I A;  2FCQ A;  4OZB A;  1YJI A;  4KGS A;  1L0X B;  5JH5 C;  4Q2J A;  2WYQ A;  2WXJ A;  4KZC A;  2Q5W D;  4MH0 E;  5FKA C;  3ZTD A;  3A33 B;  3KYD D;  4AS1 A;  3PRE A;  3RCZ A;  1Z2M A;  3ZXR A;  3T3O A;  3ZIM A;  4FA6 A;  4DWF A;  4AWJ A;  5TR5 A;  4FJZ A;  2YVC A;  4YT0 B;  2K8C A;  2FCN A;  1YQ3 B;  5EE3 A;  5JXV A;  1RWS A;  1C78 A;  2KQ7 A;  2MP2 B;  4HK2 A;  4WAA A;  2KJ6 A;  1QKZ A;  2Y5C A;  4US8 A;  3AEA B;  5C1Z A;  4L2Y A;  2VH2 A;  2HD5 B;  4GXB A;  3CIR B;  1FIQ A;  4XDD A;  4W9E A;  2DZJ A;  1KOT A;  2WU2 B;  4BVU C;  3AEF B;  3QA8 A;  1WZ3 A;  2KDM A;  1V97 A;  4BBN F;  2CU3 A;  3A1Q B;  3NVV A;  1KF6 B;  1FCL A;  2IY0 B;  4K7S A;  1WGR A;  4FN2 A;  2WS3 B;  1K50 A;  4M02 A;  1WGK A;  1SF0 A;  2L8J A;  1IGC A;  2MJ3 A;  2NS5 A;  2A4Z A;  5JHA A;  2WDT B;  5G55 A;  4FHK A;  2A5U A;  5IN7 A;  3O13 A;  1K52 A;  1SE2 A;  3W1Y A;  2L52 A;  3P4P B;  2KFK A;  2NPT B;  3VR8 B;  1PGA A;  3OWE B;  2FUG 1;  2ZW1 A;  2HTH A;  4LJO B;  1FNU A;  2ZCC A;  1NBF C;  4R3D A;  1I4R A;  3Q2A C;  1WE7 A;  3BVM A;  3C0R B;  2J42 A;  3PS6 A;  4LNK A;  3PRZ A;  1T5X D;  2MJD A;  1CK1 A;  3V6E B;  4WJP A;  4ANU A;  2FIF A;  3RUL A;  1WIA A;  1JRO A;  2HJ1 A;  4NY0 A;  1Q0W B;  1FCC C;  4TV3 A;  3AE3 B;  1PFD A;  1HTQ A;  3ETR A;  4RGT A;  3RN9 C;  4BAX A;  4ZOH C;  2QIL A;  4S0R A;  3P4S B;  3TJP A;  4B6W A;  1V49 A;  4CQN A;  1I4P A;  4IUM B;  2PW9 A;  3A9K B;  2L83 A;  3NZU A;  1T0Q C;  1FFV A;  1R4M I;  1RAX A;  5LLI A;  3ZTC A;  1C4P A;  4YXD B;  3NS8 A;  2JZP A;  4WJN A;  1TZ1 A;  3L10 B;  3VUY A;  3KUZ A;  5I4D A;  4I6P A;  2K39 A;  3BZD B;  4OVV A;  4YWG G;  1E7U A;  3UF8 A;  2BB6 A;  1E7V A;  1K53 A;  4DDG D;  2M8S A;  2RGF A;  2XBB C;  4IWQ A;  4FAD A;  3QQ8 B;  4JLC A;  2MSE D;  1GJZ A;  2BYF A;  5BMI A;  4L23 A;  5H8Y E;  4IKG A;  3IT6 B;  3CSF A;  2W82 A;  4I6N B;  2QC8 A;  1E0Z A;  5E6N A;  2K3U A;  4N9F 4;  1SEB D;  3IVF A;  3TCA A;  3T3N A;  4PS3 A;  3EHV A;  4G3X B;  2IGD A;  3VXW A;  3IFW B;  5IOI A;  3WIM A;  2KZR A;  4WWM A;  3GZN B;  1RLF A;  2BGF A;  1V80 A;  4P1C C;  3AEG B;  5KHQ A;  2WXH A;  2LHD A; 
#chains in the Genus database with same CATH homology
 2TSS A;  4ARI A;  1OQR A;  4HEA 1;  2RPV A;  2WXR A;  4KKJ A;  1STE A;  1TS4 A;  4LTU A;  4YSZ B;  2WDV B;  1KLU D;  1AW7 A;  3BII D;  2PTL A;  4HKZ E;  4ZRP A;  3V05 A;  2QIE B;  2LJI A;  3IAS 1;  1ZXH A;  2MEK A;  1CJE A;  1FMA D;  4OZC A;  3P42 A;  2XNA C;  3U52 E;  3W9C B;  1PYW D;  3MHZ A;  1JCK B;  2V4I B;  2KQ4 X;  2L1A A;  3KWL A;  2NTT A;  2AX5 A;  3P63 A;  2ACZ B;  3NUH B;  1YQ4 B;  2QEJ C;  3GB1 A;  2INP E;  1B9R A;  3SFE B;  1A70 A;  3U4E G;  1NEN B;  1YJJ A;  1ZUD 2;  1D5M C;  1HQR D;  2H89 B;  1I4X A;  1L0V B;  1ZOY B;  1YMH E;  2WQY B;  1D4B A;  4RCO A;  1V1O A;  1WWT A;  1C77 A;  4B0E A;  2CJN A;  4TQ0 A;  2IGG A;  5BMG A;  3AEC B;  2DBY A;  4YTN B;  4REZ A;  1JRP A;  3BYT B;  3LB8 C;  5EE1 A;  2N9K A;  4A9A A;  1ESF A;  2SAK A;  3LXF A;  1XLQ A;  2DYO A;  2QMT A;  1I4H A;  3I9V 1;  3FC4 A;  3HVZ A;  2H88 B;  3CWI A;  3Q8F A;  3NVZ A;  1XO3 A;  1KLG D;  4ZYS A;  2NTS A;  3GS2 A;  3BVG A;  4MM3 B;  1FXI A;  1NYR A;  1EU3 A;  1FFU A;  1YNT E;  1QOF A;  1SSN A;  4TSS A;  2HDE A;  3W2D A;  4C80 A;  1VJK A;  3AEB B;  5D7G A;  2Y3A A;  2MJE A;  3VRA B;  1TKE A;  1NVI D;  1AYF A;  3HUI A;  3FAH A;  1UUP A;  1I7H A;  1PGB A;  1VRA B;  2R61 A;  5AUI A;  4JWU C;  1CZP A;  2WXO A;  2JYE A;  4O1N A;  2PMV A;  3W5U B;  3H8H A;  5BYQ A;  2RMM A;  3AE4 B;  5AUK A;  2WXN A;  3P4R B;  3NZ3 A;  2EEL A;  1IGD A;  1PGX A;  1R7S A;  1SIJ A;  2FE8 A;  3LYY A;  2CJO A;  1MVK A;  1E10 A;  1MHH E;  3HRD D;  2GI9 A;  2J4X A;  4YTM B;  3SFD B;  1Q10 A;  1TKY A;  5BYS A;  1SJH D;  1EU4 A;  5G5H A;  4JWS C;  1JW9 D;  4A90 A;  1D5Z C;  4ITK A;  2W3S A;  4JE3 B;  4RGO S;  2E6X A;  1WSP A;  1L6V A;  1EM7 A;  1QOB A;  4WIP A;  3DWG C;  1YN3 A;  3BK2 A;  4P16 A;  2EKI A;  4RF0 A;  3AMZ A;  4KX6 B;  2ZW0 A;  3IXS A;  4TMA B;  3E56 A;  2WXL A;  1F77 A;  4NJC A;  3RPF C;  3AE8 B;  1N5W A;  1T3Q A;  3C8Y A;  1VR9 A;  2WXP A;  4RH6 A;  3NS1 A;  1E6E B;  2JWU A;  2WDR B;  3KQ4 A;  3SEB A;  2DWQ A;  2WNM A;  1HA5 A;  3L4P A;  3SR6 A;  1C9F A;  2LEK A;  2XN9 C;  1PUT A;  4WAF A;  4NAW B;  2ONQ A;  4XWT A;  1DOY A;  4N59 A;  2N9L A;  3AEE B;  3MJ5 A;  1GAQ B;  1QOA A;  3AM9 A;  1XF5 L;  3IAM 1;  1XLO A;  3Q8C A;  3TUO A;  1TJE A;  1L6U A;  4KKI A;  1L4D B;  1UWX A;  2AQ2 B;  4KGT A;  5HI1 A;  3Q8E A;  2GRI A;  1DGJ A;  1N5X A;  5D3D A;  1MI0 A;  3Q8A A;  1TY2 A;  2WXK A;  1D6E C;  5BYR A;  1HZ6 A;  3BK1 A;  3GP7 A;  2YEP F;  4ZRQ A;  2RDG A;  4MT5 A;  3FIL A;  1ZP0 B;  1FNV A;  4EE2 A;  3ZYY X;  2V3P A;  1MPE A;  1F2R C;  4DQO C;  1I4Q A;  1VLB A;  3MFG A;  1GOZ A;  2B76 B;  3V3X A;  1QT9 A;  1UNS A;  2WXM A;  3U2S C;  2WU5 B;  1ZE3 D;  3KLS X;  2DLB A;  2J52 A;  1SE3 A;  3PZ7 A;  1ACC A;  1BML C;  1TYG B;  1WXQ A;  2NMQ A;  4JX1 C;  3RFZ B;  3TEW A;  3IT4 B;  4WH4 A;  3BYY B;  2M19 A;  4HRS A;  5HHD G;  2FBW B;  3DWM A;  1TS3 A;  2WXF A;  1D5X C;  3AE6 B;  4A8X C;  1DOX A;  5H92 C;  5GXG B;  2X38 A;  2DYM A;  1QIL A;  2K9X A;  3J9C A;  5C3J B;  1KTK A;  2PIA A;  4D2K A;  1N63 A;  1C4A A;  4GDL B;  1IBX B;  1MHX A;  3EGR A;  1FRR A;  2LHE A;  4MAC A;  4DXF A;  1XLP A;  2BW2 A;  2SEB D;  3W1S A;  1XCQ L;  2WLB A;  2IJ0 A;  5EE0 A;  4IDI A;  1M4V A;  2Y5P A;  3NVW A;  2N7J A;  4RF1 A;  4ARC A;  3TSS A;  4J3O D;  1SE4 A;  3VR9 B;  1N62 A;  1IUE A;  2YEP B;  4OZB A;  4ZHO A;  3UI3 A;  1VZ6 A;  3FIL B;  1SBB B;  2AQ3 B;  1YJI A;  4KGS A;  1L0X B;  1KH0 A;  1F0Z A;  2W3R A;  1N60 A;  3AB5 A;  2AQ1 B;  4B0M A;  1XLN A;  4Q2J A;  2WXJ A;  2BS4 B;  2Q5W D;  1HZ5 A;  5FKA C;  4L1B A;  1JAL A;  1V1P A;  1J7C A;  4AS1 A;  1J7A A;  1FEH A;  3TEZ A;  3T3O A;  1GB1 A;  4AQ7 A;  5D3I B;  4KGR A;  4XDC A;  2J53 A;  3NVY A;  4YT0 B;  5T8I A;  3E9S A;  1VZ8 A;  4C7Z A;  1YN5 A;  1YQ3 B;  2KAC A;  5EE3 A;  5JXV A;  1ET6 A;  1C78 A;  1ET9 A;  1RWS A;  3AE9 B;  5MPO A;  3P4Q B;  4PT5 A;  4OHJ A;  1QKZ A;  3ZJV A;  2WXG A;  2Y5C A;  3NRZ A;  3AEA B;  4US8 A;  4L2Y A;  3CIR B;  2BB5 A;  3I57 A;  1FIQ A;  2BTE A;  4XDD A;  2JQR B;  1B1Z A;  4HRO A;  2N0S B;  1WRI A;  3Q69 A;  2WU2 B;  1IBX A;  1RYJ A;  4GLS C;  3AEF B;  1FNW A;  2KDM A;  3B2G A;  4US9 A;  2L32 A;  1V97 A;  3TEX A;  2CU3 A;  1SXT A;  3NVV A;  5FR3 A;  1KF6 B;  1K51 A;  1KFY B;  2KAJ A;  3AED B;  2M0A A;  1FCL A;  1E9M A;  1HEZ E;  4N58 A;  1Y56 A;  3ZQ4 A;  3AE2 B;  4IOI E;  2WS3 B;  2I38 A;  4MH8 A;  1TS5 A;  4OZA A;  1K50 A;  3B9J A;  2K22 A;  3ZJT A;  1GB4 A;  1PDX A;  1WGK A;  1SF0 A;  1ZDX A;  2IGH A;  1IGC A;  2LMC A;  2MJ3 A;  4RFB A;  1SB3 C;  2I2Y A;  3EA6 A;  1GPX A;  3R2I A;  4OVZ A;  1V8C A;  3MP9 A;  1TS2 A;  1V1P B;  1NYQ A;  2JX5 A;  3N9Y C;  5HG2 A;  1YN4 A;  1JML A;  3PO0 A;  5E6J A;  3AH7 A;  3O13 A;  1EWY C;  4FXC A;  1K52 A;  1SE2 A;  2G9H D;  4NZL B;  1TY0 A;  2L52 A;  1TKG A;  1VDV A;  3AV8 A;  3P4P B;  5TSS A;  3KWV A;  4A55 A;  3W5V B;  2GB1 A;  2BS2 B;  2RDH A;  2HTM E;  4A6Q A;  3URY A;  3VR8 B;  1HXY D;  3AE5 B;  1XCT L;  1PGA A;  2D5G A;  3OWE B;  3ZJU A;  2FUG 1;  2IDY A;  2PKO A;  2ZW1 A;  4YSX B;  2WP9 B;  1P7E A;  1VZ7 A;  1FNU A;  3AE1 B;  1FXA A;  4UDU C;  3TEY A;  1SJE D;  1JWB D;  4R3D A;  1QOG A;  1UWM A;  4USA A;  1I4R A;  3PZ8 A;  4OW0 A;  3BVM A;  3Q8B A;  2QSD A;  1BXT A;  2LFI A;  2J42 A;  1C4C A;  1ZDV A;  2BS3 B;  1L5P A;  1T5X D;  3EUB 2;  2MJD A;  4RNA A;  4DXG A;  1CK1 A;  4TQ1 A;  1DYQ A;  1ZXI A;  2JSV X;  1XXG A;  2Z8L A;  2M56 B;  1KRH A;  1N61 A;  1JRO A;  3VQI A;  2PVG C;  3ZGZ A;  1FCC C;  1L0Y B;  3AE3 B;  3MC0 B;  1PFD A;  3ETR A;  4ZHP A;  4RGT A;  1I4G A;  2VZK B;  3BWU D;  2KWD A;  4WUR A;  1AWD A;  3R8B A;  4HKQ A;  1RM6 C;  2ICI A;  1NI3 A;  1OFF A;  4ZOH C;  2W54 A;  2QIL A;  2IPK D;  3P4S B;  4CQN A;  2JXT A;  1I4P A;  4M0W A;  2KN4 A;  1OQQ A;  2LGI A;  2E3T A;  2PW9 A;  3AN1 A;  1JWM D;  1WYG A;  1TZO A;  2L83 A;  1EWC A;  1FFV A;  4LLG M;  4WQM A;  1JQ4 A;  4XWW A;  1LO5 D;  1ZPS A;  1JWS D;  1JWU D;  1C4P A;  2INN E;  4YXD B;  2JYT A;  1NEK B;  4GDK B;  4XE0 A;  2JZP A;  2WXQ A;  3WCQ A;  5HFY A;  4NAM A;  1F2R I;  2BBC A;  2BT6 A;  2W55 A;  2K5P A;  1J7B A;  2ON8 A;  4N6E B;  1QLB B;  1ROE A;  5EE9 A;  2WXI A;  1AN8 A;  4P6V F;  4LK0 M;  5I4D A;  1QQR A;  3BZD B;  4YWG G;  2MH7 A;  2BB6 A;  1UGJ A;  5LNK 1;  5C2T B;  1JWA D;  2V3N A;  3AE7 B;  1K53 A;  1DOI A;  2JU6 X;  1CQV A;  1FM0 D;  2OHF A;  2G1E A;  4C56 C;  3BVZ A;  1RFK A;  3ABV B;  2BYT A;  3B2F A;  3VRB B;  3P1M A;  4RGM A;  1XEE A;  5BMI A;  4L23 A;  5H8Y E;  4IKG A;  5BMH A;  3IT6 B;  2K0P A;  2W82 A;  1FD6 A;  1BUI C;  1C79 A;  5FK9 C;  1QF6 A;  1E7P B;  1C76 A;  2KMM A;  1E0Z A;  2K3U A;  1P7F A;  2PLP A;  1L4Z B;  1T6B X;  1SEB D;  2WDQ B;  1ENF A;  3T3N A;  2QJL A;  4H2A A;  5G5G A;  2IGD A;  2PVO D;  2OED A;  3R2T A;  4WWM A;  4JPS A;  4RGN A;  4YTP B;  2LUM A;  1FRD A;  4HJG E;  2VZK D;  3HVD A;  1FO4 A;  4C7Y A;  4YSY B;  3AEG B;  2V0G A;  2WXH A;  3U7Z A;  2LHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...