2KAJA

Nmr structure of gallium substituted ferredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title Structural and functional characterization of the ga-substituted ferredoxin from Synechocystis sp. PCC6803, a mimic of the native protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kajA00
1N5WA 3P4PB 4A9AA 3AE8B 4JWUC 2EKIA 1RM6C 1ZUD2 4YTMB 3NS1A 1QLBB 1QOGA 1J7AA 2CU3A 3ABVB 4US9A 2BT6A 3AH7A 3NVYA 3VR8B 1YQ4B 1SF0A 1XLPA 1WXQA 1UWMA 4WWMA 1J7CA 1PFDA 3PO0A 1B9RA 3FC4A 1TJEA 2WP9B 3AB5A 3HVZA 4FXCA 1E0ZA 4N6EB 2MJEA 1OFFA 1E9MA 2MH7A 1WYGA 2WU2B 2K9XA 3AEBB 3DWGC 3P4RB 1XLNA 1WRIA 2LEKA 1FXIA 1AYFA 2K5PA 4ZHOA 1GAQB 2DWQA 2H89B 4N58A 5GXGB 2W54A 5H92C 1ROEA 3CIRB 1SB3C 5EE1A 4WQMA 1A70A 1TKGA 3VRBB 3WCQA 5G5GA 2G1EA 1QF6A 3P4SB 1FMAD 1QOAA 2W3SA 1FRDA 4ZOHC 1DOXA 1KF6B 3AE4B 1YQ3B 5AUKA 2KAJA 3AE2B 4LTUA 3AE5B 3AEEB 1N63A 3AE3B 3AV8A 2ACZB 3NVVA 4IDIA 5C2TB 5G5HA 1XLQA 1VLBA 3P63A 1NVID 2Q5WD 3B2FA 3EUB2 5MPOA 1V97A 2HTME 5EE3A 1I7HA 3W5UB 2JX5A 1WGKA 1WWTA 3AEAB 2DBYA 1L6VA 4KX6B 1RFKA 1XO3A 1VDVA 1TKEA 2L52A 1E6EB 1FM0D 1RYJA 3AEFB 1L0VB 1IUEA 2BS4B 3HRDD 3FAHA 2WQYB 1ZOYB 4N59A 4C7YA 5C3JB 1NYRA 3ETRA 4C80A 1XLOA 2PVGC 1VJKA 2B76B 5AUIA 1YJIA 1YJJA 2JQRB 2MJ3A 1T3QA 1CZPA 4HRSA 4JX1C 2CJOA 1JALA 2WU5B 2H88B 2M19A 1JWAD 2K22A 1TKYA 3AEGB 2OHFA 1FIQA 4ZHPA 2QIEB 2WLBA 4YT0B 2WDQB 3SR6A 3B9JA 3DWMA 2PVOD 1R7SA 3ZYYX 4C7ZA 4YTPB 1FFUA 4ITKA 1L6UA 1N62A 2WDRB 3CWIA 1NENB 2MJDA 1FRRA 1E10A 3P1MA 1J7BA 1KFYB 2KMMA 3AE1B 1DOYA 3AM9A 1L5PA 1NYQA 2QJLA 1PDXA 3AECB 3LB8C 1DOIA 1SIJA 3B2GA 3AE7B 3LXFA 4YSYB 1JRPA 1ZP0B 1OQRA 2Y5CA 3AE6B 3NVWA 1NI3A 1N5XA 1N61A 2L83A 5EE0A 2W55A 3AN1A 2BS3B 1FFVA 3NRZA 3W9CB 3SFEB 1TYGB 1N60A 1FO4A 3VR9B 3SFDB 1GPXA 1QOFA 3AEDB 2W3RA 3AMZA 4JWSC 1QT9A 4YSXB 3NVZA 1PUTA 4USAA 4YSZB 1AWDA 1FXAA 5EE9A 1QOBA 1F0ZA 4YTNB 2N0SB 3VRAB 2E3TA 1JWBD 1JROA 1OQQA 1V8CA 3P4QB 4HROA 1EWYC 1DGJA 1JW9D 2AX5A 1RWSA 2PKOA 2WDVB 3HUIA 3L4PA 2BS2B 2WS3B 3BIID 5H8YE 3AE9B 3KWLA 2FBWB 2M56B 1JQ4A 1E7PB 1ZXIA 1NEKB 2CJNA 1KRHA 2PIAA 4US8A 3RPFC 1CJEA 4YXDB 4P6VF 3W5VB
chains in the Genus database with same CATH superfamily
2K6QA 3DVGY 2G9HD 1OEYA 1XCTL 3EFUA 1PFDA 1L4DB 4ICUA 2KFKA 1PGAA 3R7QA 4FJYA 2WWZA 5GXGB 1F77A 2DWQA 2JRIB 4KKIA 1JWSD 4DHJB 1XF5L 3L16A 2KOXA 2G1EA 2WX1A 2V4IB 2AEHA 2LFIA 1D3ZA 3UINB 3BYYB 3RNCC 2UYZB 2WNMA 1UBQA 3APFA 5MPOA 4WQOB 3OAWA 3RCZA 1Y8RC 3CSFA 5DPTA 4K3BA 4C7YA 2WQYB 2V3NA 4OHJA 4ICVA 4HRSA 5D3IB 2CJOA 2WXLA 2M19A 2D3AA 2M1MA 4ZRQA 4B6WA 3TEWA 4RM9A 2MJDA 5HI1A 4KDLB 1OTRB 4FHJA 2EMSA 1NYQA 1I4RA 2IPKD 3QK0A 4IC7B 2Y5CA 4MJSB 4MM3B 3KW5B 3NRZA 1PGBA 2RD0A 4W9LA 3SFEB 1TYGB 2M0AA 5LXHA 1F2RC 2JY6A 3DBLI 4G11A 1PYWD 3H7SA 1F52A 4NJ7A 2JZ3B 3TJPA 2N1VA 4GU2A 3UQAA 2YLMA 1OQYA 3ZTDA 3APCA 3SU8X 2FNJB 1H8CA 3QQ8B 1ZKHA 2RPQA 3CF6E 1ENFA 2YEPB 1E7PB 3ML9A 1JWUD 1EM7A 4G0NB 4GLSC 4A8XC 1ZPSA 2LHEA 3SDLC 4GDLA 3AH7A 2D3BA 2JXTA 1YQ4B 2LASA 3VR8B 3SEBA 3EGRA 3K9OB 2DNFA 3DBLB 1B9RA 2L7RA 2R2QA 2JZPA 4MSMB 4MGIE 3R7RA 2HJ1A 4FBJB 3A9KA 1FNWA 2HD5B 3TMPB 4XWTA 3WAPA 4CYEA 2NCNA 3U2SC 3VRBB 3MJ5A 4EZLA 3V61A 2PE9A 4F1SA 3GB1A 4GN1A 1WZ0A 2BQQA 4KZCA 1N63A 2KDIA 3WALA 2LD9A 5HKHA 2VH1A 4M8NA 2UWQA 2QILA 2SAKA 1VCBA 1FM0D 5T8IA 2KHWB 2HTHA 4ASWC 5LLIA 1IP9A 2LVQA 2DHZA 3SR6A 4C7ZA 2M0XA 4IG7B 2KZRA 1K53A 4WIPA 4XX5A 2LVPA 3Q8AA 3DCGA 1PDXA 2M17A 3AE7B 1I42A 2WXOA 1IGDA 4ANWA 2WXNA 1KLUD 3KUZA 2ZW1A 3QC8B 1SXTA 4RGNA 2XN9C 1YX6B 5H8YE 2KC1A 2XEWA 4GSWA 4P7IA 3W1YA 1ZE3D 1D6EC 1TBEA 1CJEA 4P6VF 4HLEA 2K8CA 1LFDA 3Q8EA 3ZDMC 2BWFA 1C79A 3RNGC 2O2VB 2G3QB 4O1NA 2MX2A 4LCDE 4WWMA 2NBUA 4LJOB 1WJ6A 1SIFA 3H9DA 2H89B 3I63C 2W54A 2PW9A 2MRPA 2GBNA 5IOIA 2KWCA 5G5GA 3JVZX 4KV2A 2D3CA 2DZIA 4LK0M 2GI9A 5IN7A 4OVZA 3HK0A 4GMVA 3PRPB 5EE3A 4TQ1A 4W9HA 3KVFB 3BINA 1V9JA 4Q2JA 4S0RA 1L6VA 4KGTA 1RYJA 3VUXA 1LM8B 3HRDD 4JIOU 3VH3B 1WXMA 4DXGA 1NYRA 2N7EA 2PEAA 1K50A 3VDZA 2FCQA 1CZPA 4PYZA 4K3CA 3AEGB 2ZZPB 2N9LA 3HIZA 5CHWA 3UF8A 1E10A 3M3JA 1DOYA 3W1SC 1JRPA 2KTFA 2L83A 3PTFC 3MTNB 1MJDA 4XWWA 1GPXA 1UWXA 1QT9A 2CHWA 1SGHA 2MW5A 2BWES 2IO0B 4LNOA 4RMAA 5BMGA 1IBXA 2N9XA 4GDKB 4TSSA 4N9F4 3W5VB 4A9AA 1QOGA 5JH5C 3VVWB 2ICIA 3ZNID 1LGRA 4MELA 4MDKE 3N1XC 1EWCA 2WP9B 3WA0A 2LRUA 2KWVB 5DPRA 4TQ0A 3V6EB 2ZEQA 4LNKA 3ZNZB 1TKGA 4WH4A 1FMAD 5JZEB 1HTOA 1Q10A 2W3SA 3U4EG 2WXPA 3MJWA 2Y5BB 3A9KB 2EMTA 1YOVB 1J0GA 2KX0A 5C2TB 2J7QB 1WE6A 4JL9A 5D6JB 1KJTA 2KMCA 3OWEB 1Q1OA 1IPGA 4JQWC 3D32A 3ZXRA 2ON8A 4DDID 1H4RA 3AXCA 3N9YC 4ANXA 2L3ZA 1TY2A 3ZNHB 1C76A 2AQ3B 3E9SA 3VHTC 1YJIA 4OZAA 4NQLB 3TEYA 2DAFA 2I1JA 4G50A 2MCNB 1NENB 2EELA 1KFYB 2M8SA 2NBVB 3S2AA 3DBRI 1SIJA 1MG4A 2BKRB 4HDOA 1VD2A 3PREA 4C56C 1I4GA 4WJPA 3Q3OC 4J6IA 2OOBB 1YJ1A 2LJIA 3PT2B 2KJHB 2J53A 3VRAB 4MJSA 1NI2A 1JWBD 2W9NA 1SE3A 3L4PA 2OJRA 3BIID 4IWPA 1VZ8A 1Z5SB 4A3OA 2PIAA 2FCSA 4YXDB 3KUDB 3DBRB 2G45B 4EZJA 2BTEA 4IWQA 2KN4A 4J3OD 1GOZA 3TIXA 2J4XA 4X57B 3PO0A 4PYUA 1V1PA 2HE7A 3AB5A 1WZ3A 2NPTA 2K9XA 4NAMA 2L0TA 2QSDA 1EU4A 1A70A 4W9FA 2C7NB 2K0PA 4ARIA 2DZJA 1TS3A 2NBWB 2Z59B 3B1LX 2BW2A 1P7FA 2MP2B 3Q8CA 2KAJA 1YD8U 4KDIC 1PGXA 1I7HA 3DBSA 2V4LA 4GXBA 2KDMA 1E8YA 2GMIC 3MP9A 3M62B 1F1HA 3KYDD 3EC8A 4N59A 1FNVA 5EDSA 1VJKA 2ZNVC 3O65B 4LJPB 1HZ6A 4MEMA 1JWAD 1E8ZA 3B9JA 4I6LB 4YTPB 3IAM1 1PQSA 1L5PA 4M02A 1WIAA 3O13A 4OZBA 1SEBD 3NVWA 2OJWA 3C8YA 5BMHA 2KN5A 3AEDB 4EZKA 1C78A 1AARA 2RMMA 4BBNC 1V8CA 1MFWA 2BB5A 4KGSA 5BYRA 2O6VB 1DGJA 4WWOA 3AE9B 3ECIA 2KDBA 2K1FA 1SE4A 4K81A 4BAXA 3RPFC 4EEWA 2CU1A 4YTMB 4MH0E 3V60A 1D5XC 3TL5A 3KH0A 2Z0DB 4HKZE 3GP7A 1IBXB 3AI5A 3ONSA 2GBKA 4DHJD 5BO4B 2KC2A 1E0ZA 2RDHA 2V0GA 1WRIA 4DXFA 1SB3C 2ZVNA 1ET9A 4BKGA 2G4SA 3IXSA 3DOWA 4E71A 4FA6A 2L32A 1MI0A 3Q8BA 1RFAA 2J52A 1QQRA 4LTUA 3AEEB 3AE3B 2FIFA 3AV8A 3TEZA 3ZRFA 1VLBA 3B2FA 2KVZA 1UF0A 3IBEA 2DX5B 1WSPA 1SBBB 1ZDXA 4XDDA 1WJ4A 1E6EB 3DVNU 1MVKA 3FAHA 4KGRA 2Z0EB 1WGGA 2BYVE 4C80A 4DWFA 2LGXA 3ML8A 1YN4A 4XE0A 1T3QA 2V9HA 1MG8A 1FXTB 4AUQC 2BVCA 2WXQA 1N6ZA 1FFUA 2FUG1 3Q8FA 2MBQA 2ZVOA 1DOIA 4CHKA 3L08A 5LXIB 1FFVA 1WM2A 2KJRA 1LXDA 2VZKD 2WXHA 3N20C 5E6PA 4F8CB 1PUTA 4GOCA 3OLMD 3C19A 1F0ZA 1Y56A 3TSSA 3E56A 3QX1A 2E3TA 3Q14C 3PLVA 2IZVB 4WJOA 4BOZB 4KIKB 1GUAB 2C7MB 3X23A 4I6PA 5JHAA 3DVNV 4LNNA 4ZRPA 1S3SG 4UDUC 1D5MC 2L1AA 4BFRA 4BVUC 3I3TB 2X38A 4GDKA 2VZKB 1SJED 2XNAC 2DYMA 4N58A 2BYEA 2C9WB 3QCAA 4BKTA 1V1PB 3P4SB 1FNUA 4HK2A 2NPTB 1IYFA 4WWPA 2ZCCA 1DOXA 1KF6B 3AE4B 1YQ3B 2JVCA 3BZDB 1XD3B 1K52A 4M0WB 3Q3FA 4PK1A 2ACZB 1T6BX 3MFGA 3DHIC 4MSQB 3ZJTA 1TS5A 2Y5PA 1WGYA 3PPAA 2SEBD 3AEAB 2QHOA 3V6CB 2J0MA 1V5OA 2A4ZA 3AEFB 5IAAC 4WAFA 5JXVA 3ETRA 1C4PA 5AUIA 3OG5A 2KQ7A 3R2IA 4JGHB 3Q3JA 4M00A 2L05A 1TKYA 3ZDTA 3DHGC 2RPVA 3ZYYX 4ITKA 3EA6A 1VR9A 4C00A 2BB6A 1N5XA 3W9CB 2W55A 3NOBA 5D94A 4PS3A 2JUOA 2IDYA 3H7PA 2LRWA 3U7DA 2PPHA 2KD0A 5EE9A 2BYTA 3A4RA 3V3XA 1E8WA 4K7SA 1YNTE 5C1ZA 2LGSA 4D2KA 2WS3B 3NHEB 1ISNA 3KWLA 4A55A 2WGSA 5TSSA 1I35A 4ZRJA 3KQ4A 3L54A 2RDBC 1S1QB 3MC8A 2IYDB 4ZDVA 4RGTA 2CU3A 1D4BA 3ZLZA 3ZQ4A 3NVYA 2MHJA 1WI0A 2K25A 3VXWA 1SF0A 3N32A 2KFJA 4W9JA 2XBBC 2BF8B 3Q69A 3RFZB 4EFOA 3A9JB 2CKHB 5FKAC 1WFYA 3ZXVA 4G3XB 4BKSA 2KKCA 3MC9A 2K6DB 5CHVC 1TS4A 2KLGA 3DPDA 1ZDVA 1C77A 2AL3A 2KQ4X 1WGKA 1ET6A 2MP2A 2D10A 1XO3A 4DHZB 2LJ5A 2CR5A 4KZ0A 4DXAB 1ZOYB 2GB1A 3APDA 1TGZB 1EO6A 5E6JA 2MJ3A 4OVUA 1C4CA 3VUWA 2OHFA 4ZHPA 4MT5A 2LWPA 4NY0A 2N4FA 3CWIA 1HA5A 2KYWA 3P1MA 1WY8A 3T3NA 2B3AA 2CS4A 3ALBA 1ZP0B 1FPYA 1T0SC 5FK9C 3NUHB 4I6NB 2LVOA 3VR9B 3BVGA 1QOFA 1WXSA 4JWSC 4YSXB 4A6QA 1GJZA 3PHWB 4YTNB 2N0SB 4L1BA 1Q5WB 2IBIB 2NR2A 2I2YA 2REXA 1I4QA 2KJ6A 2C5LC 4WJNA 3ZKJC 1KM7A 1FD6A 1T0QC 4EE2A 2KVRA 2O6VA 4GB9A 1WH3A 2L8JA 2ZCBA 1XLPA 1UWMA 2K8BA 1EF5A 4R3DA 4ZYNA 5IP4D 1ZGUB 4N6EB 3AEBB 3NZUA 2LEKA 2KANA 1GAQB 2INNE 2W82A 3A4SC 4MGKE 4KKJA 2K39A 4P16A 3P42A 1L0YB 4W9DA 1FEHA 3BYTB 1FRDA 4M8MA 3AE5B 4IKGA 2QC8A 4NNJB 2MEKA 2LZ6A 2V1YA 3QWZB 1WJNA 3EUB2 1YN5A 4FLHA 4M01A 5D7GA 1OEYJ 4L23A 4CO7A 1VDVA 1TTNA 1LO5D 1UUPA 3KLSX 4OW0A 2KDEB 4AQ7A 2IO3B 5AZHA 1HTQA 1UGJA 3CSTA 3M95A 4B9KA 3Q6BA 1V2YA 2JQRB 4JX1C 3ZIMA 5C23A 4DBGA 1R4NI 2MSED 2ZPYA 3JW0X 2EKEC 4XDCA 2LXCA 3PZ7A 3TCAA 3R8BA 1B1ZA 3B2GA 3LDZE 4MACA 1WMHB 3T3OA 3ZRCA 1NI3A 1N61A 4TV3A 3AN1A 4W9GA 4TUUA 1QKZA 2I1KA 1TT5B 1QZEA 2GOWA 3UIOB 4MH8A 1P1AA 2BGFA 1R4NB 4LDTD 1OQQA 5DCNA 2AX5A 3HUIA 3RULA 3IVFA 1XXGA 4JE3B 2N9EB 3PZ8A 3H7PB 4A90A 4EUTA 2CJNA 3L10B 2LHDA 3J9CA 1YN3A 3RD2A 1DYQA 4BKSD 4KIKA 5IKCM 4ZRIA 3QARA 2DENB 4RCOA 3VAWA 5HFYA 1R4MI 5CHFA 4XC2A 5AEKB 1E9MA 2MBBB 2LUEA 3AU5A 3NG0A 3HM3A 2K5PA 1YQBA 1WRDB 4LDTB 4XYCA 4K7UA 3ZGZA 2L00B 3MHZA 1SJHD 2D5GA 1RAXA 4A20A 4NJ6A 4IDIA 1EU3A 2Q5WD 4PS7A 2Y3AA 2HTME 2LGYA 1NBFC 2DBYA 2RSUA 1R4MB 3FKYA 1RFKA 1JCKB 4M0WA 1Q0WB 1WJUA 2D3GA 4DQOC 4IWOA 3N1ZC 1WGRA 4NJCA 2R2OA 2B76B 1I4HA 2MQJA 3ZW3A 3SHQA 2TSSA 1CMXB 1JALA 4B0MA 2H88B 3ZNGC 1K51A 1XCQL 4HJKA 1R7SA 4YWGG 3IAS1 4RGOS 3ZUNA 1FRRA 1V5TA 2KMMA 2L0FA 3LB8C 3UI3A 1F2RI 1HXYD 2MBEA 2JF5A 3ZVVA 2V3SA 4HPPA 1FO4A 4DHZE 1KTKA 1P3QU 2O6VD 3VQIA 4CQNA 4IM2A 3NVZA 3W1SA 3GE8C 1TIFA 4HVBA 1JROA 1P98A 3FILB 3P4QB 2N9PC 3RMKC 5AZGA 3TUOA 2NMQA 1BUIC 1KLVA 4HDQA 2KTRA 2EKIA 2GBJA 1HE8A 1I4XA 2DYOA 4RM8A 1WXQA 3H6NA 5KHQA 1KLGD 3L0WB 1YX5B 2C7HA 4FXCA 3WAOA 2NTTA 3DVGX 3ZTCA 3DWGC 3RZFA 2KNBA 3R2TA 4DK5A 5EE1A 1UBIA 3WCQA 4FADA 1YMHE 1EF1A 4HKQA 1QOAA 3DHHC 3Q3MC 2INPE 4GIVA 4ZOHC 4HPMB 2WXJA 1UD7A 4ZRKA 3IFWB 2JYEA 3TBLD 2HJ8A 3A9JA 3RI7C 4C4VB 2RR9A 3W2DA 2WYQA 1V97A 2JX5A 1WWTA 4P1BC 1WXVA 2JWZA 1WX9A 4IM0A 1OGWA 2L52A 4ANUA 4E74A 2N1WA 3PV1A 4FJVB 4ARCA 1FIQA 2KX3A 2WLBA 4HJGE 3SD5A 3H1UA 2WDRB 2DZKA 4ZYSA 3ZJUA 2FE8A 3AU4A 3LXFA 5IA7A 5L83A 3MC0B 2CHXA 3IG3A 2DAJA 2AWTA 3JYUA 3EFCA 4USAA 1FXAA 1E90A 1FCCC 3CMMB 4B0EA 1WR1A 3GE3C 1JW9D 1L0XB 4ACFA 5E6NA 3IT6B 2FBWB 1D5ZC 2NVUI 2Z8LA 1T5XD 2KXJA 1N5WA 3NZ3A 4GGQA 2K8HA 1ZUD2 4TMAB 2FCNA 3VUYA 1QLBB 2WDTB 3ABVB 2GBMA 3A1QA 3WANA 3HHMA 2AL6A 2ZPNA 1G6JA 3EHVA 2MJEA 1OFFA 3L17A 2VRRB 5H92C 2WXGA 1E7VA 1HEZE 4AP4C 1WM3A 2IY1B 1Z2MA 1WGHA 2PE6B 3BVMA 2M4NA 1GB1A 4BOSC 4WWNA 2NTSA 3KUCB 1CQVA 2MWSB 2JZZA 1X1MA 1HQRD 1TKEA 5HHDG 1IUEA 4H2AA 2C60A 1CK1A 3M63B 1WE7A 1UGMA 1KOTA 2PVGC 4RH6A 2D07B 3TEXA 4WURA 2FAZA 1L6UA 2RDGA 3VH4B 4WJQA 2WXIA 4E3CA 1TS2A 4F7ZA 5J18A 3AECB 2KACA 3L13A 2IGHA 3B0AA 4NPNA 2ASQA 3NY5A 3IHPC 1K8RB 3AULA 3QAQA 2BPSA 4NZLB 1WMHA 3GS2A 4K7WA 1WGDA 5BMIA 3I57A 2AQ2B 1EWYC 4IW0A 2LI5A 2BBCA 4US8A 1UH6A 3K9PB 4FN2A 1E5WA 3RNFC 1J7AA 4TKNA 4RNAA 3HM6X 1MHHE 3Q2AC 4B95A 1C9FA 3P2BA 2KK8A 4NAWA 3RT3B 2KTRB 4URKA 5CTRC 2WU2B 3P4RB 2QEJC 1XLNA 1M4VA 3RZWC 4WQMA 4QAYA 2KDFB 2DLBA 1U4AA 1GG3A 1XEEA 4S17A 5CX3A 3QIJA 2LGIA 1KH0A 1L2NA 2AQ1B 3BK2A 2KO3A 1SE2A 1L0VB 2JRHA 4BBNF 1LQBA 4YL8A 2GRIA 1UELA 4AJYB 4MGYE 2N7JA 2DYBA 1J7BA 3MHSD 3PSEB 3QJZA 4II3B 3AM9A 3GZNI 4HEA1 5E6OA 3RNBC 1BMLC 1BT0A 1OQRA 1HZ5A 1GC6A 5KHOA 3PRMB 2XK5B 2J42A 3SFDB 1ACCA 2W3RA 3VTWA 2WXKA 3URYA 4RF1A 4YSZB 3N30A 2HDEA 3GOEA 3WIMA 4LNFA 1MHXA 4WAAA 1JQ4A 4XGAB 1SE9A 1KRHA 2I38A 3GZNB 5TR5A 2KFKB 1GNUA 3FILA 3NS1A 2BT6A 2G4DB 4BZAA 2JPHA 3ZO5B 5G55A 2IO2B 1ESFA 2MH7A 2UU7A 3DQVA 2KQSA 3A1QB 4FHKA 5JHBA 1ZXHA 3BY4B 3DBHI 3CIRB 4P1CC 3PS6A 2FCMA 1TY0A 2KWUB 4A3PA 2MBOA 3AE2B 3KYCD 1FCLA 2FUHB 1J8CA 5G5HA 1XLQA 2WHIA 3PGEA 2JYTA 2BKFA 3ENEA 3W5UB 3JSVA 1VRAB 4HCPB 1C4AA 3QHTA 2LMCA 1JRUA 4C4VA 4REZA 3DBHB 3B08A 5IO9A 3VFKA 5I4DA 2WX0A 1XLOA 5J17A 2DZMA 2YVCA 2K22A 2QIEB 2PTLA 3DWMA 3PHXB 1NDDA 1V81A 4IOIE 1N62A 1UNSA 4EOYA 3AE1B 2JWUA 1V86A 5GMVA 5DPWA 2IGDA 2ZW0A 4PT5A 2WXFA 3U8ZA 1V80A 5FR6A 1WR6E 1P7EA 3DDCB 2ZNVB 2ONQA 5AZFA 1MPEA 1QOBA 1SSNA 4KVGB 2KWDA 2MLBA 4HROA 2GLSA 4KX6B 1RWSA 4GDLB 4AWJA 3WAMA 3PZDA 2D11A 2M56B 1F9JA 2N7DA 1VZ6A 1TZOA 3AE8B 3NZSA 4JWUC 4W9KA 3PRZA 4L2YA 2PLPA 4HCNB 1J7CA 3FC4A 2RGFA 3H8HA 4AJWA 2MBHA 2LGDA 2LUMA 2N9KA 1WYGA 1WX7A 2MA9B 3I5JC 3R66C 1ROEA 4FULA 4DDGD 4AS1A 4NAWB 4PS8A 3Q3NC 1VZ7A 2IGGA 2INDC 2R61A 5AUKA 1V1OA 1RLFA 2LXAA 4FJZA 5G2NA 1EUVB 4II2B 3P63A 3RYTA 1E7UA 1P9DU 3IT4B 1E8XA 3KWVA 4HXDA 3V05A 1L4ZB 2ZJDA 4W9CA 4RFBA 2NS5A 3V62A 4K1RB 2GBRA 2L76A 4JPSA 3PLUA 3T8MA 1YJJA 2J0JA 1C3TA 3A33B 3PVLA 1A5RA 1ZW7A 2WDQB 2FIDA 2A5UA 2IJ0A 4MM3A 4W9IA 3LYYA 2VH2A 2IY0B 2KMAA 1L7YA 4LLGM 4ANVA 1BXTA 4YSYB 3AE6B 2E6XA 3OJ3A 5EE0A 2BS3B 1WXAA 3U7ZA 1N60A 1J19A 1GC7A 3RUIB 2V3PA 1WX8A 3HVDA 4NQKE 1AWDA 1JMLA 2PMVA 4EKUA 4AOFA 2K3UA 5DPSA 2CHZA 1C1YB 4W9EA 2WDVB 4IM3A 2BS2B 3VTUA 2JU6X 2KLCA 2QCZA 4XZ4A 2INCC 3UQBA 2IO1B 2QDFA 5BYSA 5HG2A 3P4PB 1QILA 2OEDA 1RM6C 4US9A 3UIPB 2KT7A 3N1YC 1I4PA 1TJEA 3EECA 3HVZA 3OJ4B 1T0YA 1TZ1A 2QMTA 3UGBB 3U52E 1AW7A 1IGCA 1FXIA 1AYFA 4ZHOA 1V49A 5J2RA 4HWIB 2JSVX 1QF6A 4LNIA 4OZCA 3T9LA 4KSKC 1UZXB 3RN9C 3X0WA 5D3DA 2YEPF 1V6EA 3NVVA 4KSLC 3VTVA 3BK1A 2WXMA 4RGMA 1NVID 4MGZE 5D2MB 1T0RC 3R3MA 3RNAC 1XQQA 3NS8A 3ZJVA 2BS4B 5BYQA 3I9V1 5C3JB 3LJ3A 3JSVB 4IUMB 4OVVA 2WU5B 2JT4B 3RNEC 3C0RB 2JXXA 4JLCA 4YT0B 1XT9B 2PVOD 1RRBA 2J0KA 1JWMD 2QJLA 5LNK1 1M94A 3BVZA 1GB4A 1STEA 1WYWB 2BYFA 2D2QA 1P0RA 2PJHA 4HPLB 1YIWA 3AMZA 2X8XX 2AYOB 2WXRA 2PKOA 5FR3A 2XK5A 2O2VA 3QA8A 5L95C 4RF0A 1WF9A 3BWUD 1ZXIA 1NEKB 3U30A 1AN8A 3N3KB 3NJTA
chains in the Genus database with same CATH topology
1FD6A 4EE2A 1J7AA 2BTEA 2G9HD 2KN4A 4RNAA 4J3OD 1MHHE 1XCTL 1GOZA 1XLPA 1UWMA 2J4XA 1PFDA 3PO0A 1V1PA 1C9FA 3AB5A 4R3DA 1L4DB 4N6EB 1PGAA 2WU2B 2K9XA 3AEBB 3P4RB 4NAMA 2QEJC 1XLNA 2LEKA 1GAQB 1F77A 2DWQA 1M4VA 2INNE 2W82A 5GXGB 4KKIA 1JWSD 1EU4A 2QSDA 4WQMA 1A70A 1XF5L 4KKJA 2G1EA 2K0PA 4ARIA 4P16A 3P42A 1L0YB 2V4IB 1TS3A 2DLBA 1FEHA 3BYTB 1FRDA 2BW2A 1XEEA 1P7FA 3Q8CA 2KAJA 3AE5B 2LFIA 4IKGA 2MEKA 3BYYB 2WNMA 2LGIA 5MPOA 1KH0A 1PGXA 3EUB2 1YN5A 1I7HA 2AQ1B 3BK2A 5D7GA 4L23A 2KDMA 3MP9A 1VDVA 1SE2A 1LO5D 1UUPA 1L0VB 4C7YA 4N59A 3KLSX 4OW0A 2WQYB 4AQ7A 1FNVA 2V3NA 1VJKA 4OHJA 1UGJA 4HRSA 2JQRB 4JX1C 5D3IB 1HZ6A 2CJOA 2WXLA 2M19A 1JWAD 2GRIA 4ZRQA 3B9JA 4XDCA 4YTPB 3TEWA 3PZ7A 2N7JA 2MJDA 5HI1A 3IAM1 3R8BA 1J7BA 3AM9A 1B1ZA 1L5PA 1I4RA 1NYQA 4HEA1 3B2GA 2IPKD 1BMLC 3O13A 4OZBA 4MACA 3T3OA 1SEBD 1OQRA 2Y5CA 3NVWA 1NI3A 1HZ5A 1N61A 4MM3B 3AN1A 1PGBA 3C8YA 3NRZA 5BMHA 3SFEB 1TYGB 2M0AA 1F2RC 1QKZA 2J42A 3SFDB 3AEDB 1ACCA 2W3RA 1PYWD 1C78A 2WXKA 3URYA 4RF1A 4YSZB 4MH8A 2RMMA 2HDEA 1OQQA 1V8CA 2BB5A 4KGSA 5BYRA 1DGJA 2AX5A 3HUIA 1XXGA 3AE9B 4JE3B 1MHXA 3PZ8A 1ENFA 2YEPB 4A90A 1JQ4A 1E7PB 1SE4A 2CJNA 1KRHA 2I38A 1JWUD 3RPFC 2LHDA 3J9CA 1EM7A 1YN3A 4GLSC 4YTMB 3FILA 3NS1A 1DYQA 1ZPSA 2LHEA 4A8XC 1D5XC 2BT6A 3AH7A 2JXTA 3VR8B 1YQ4B 4HKZE 3GP7A 3SEBA 1IBXB 3EGRA 1B9RA 4RCOA 2JZPA 1ESFA 5HFYA 1E0ZA 2RDHA 1E9MA 2MH7A 2V0GA 1FNWA 1WRIA 4DXFA 2K5PA 1ZXHA 3CIRB 1SB3C 4XWTA 1ET9A 3U2SC 3VRBB 3MJ5A 3ZGZA 3IXSA 3MHZA 2L32A 1TY0A 3GB1A 1MI0A 1SJHD 2D5GA 3Q8BA 3AE2B 2J52A 1QQRA 4LTUA 1FCLA 3AEEB 1N63A 3AE3B 3AV8A 3TEZA 4IDIA 5G5HA 1XLQA 1EU3A 1VLBA 2JYTA 2Q5WD 3B2FA 2Y3AA 2HTME 3W5UB 2DBYA 1WSPA 1SBBB 1VRAB 1ZDXA 2QILA 1RFKA 2SAKA 1JCKB 4M0WA 4XDDA 1E6EB 1C4AA 1FM0D 5T8IA 1MVKA 2LMCA 4DQOC 3FAHA 4KGRA 4REZA 4NJCA 5I4DA 4C80A 1XLOA 2B76B 1I4HA 4XE0A 1YN4A 1T3QA 2TSSA 1JALA 4B0MA 2H88B 2K22A 1K51A 2QIEB 2WXQA 1XCQL 2PTLA 3SR6A 3DWMA 4C7ZA 1R7SA 4YWGG 1FFUA 2FUG1 3IAS1 4IOIE 3Q8FA 4RGOS 1N62A 1UNSA 1K53A 1FRRA 4WIPA 2KMMA 3AE1B 2JWUA 3Q8AA 1PDXA 3LB8C 1DOIA 2IGDA 3AE7B 3UI3A 2WXOA 2ZW0A 4PT5A 1IGDA 2WXFA 1F2RI 1HXYD 2WXNA 1FFVA 2VZKD 1KLUD 2WXHA 1FO4A 1KTKA 3VQIA 1P7EA 4CQNA 2ONQA 2ZW1A 3NVZA 1PUTA 1MPEA 3W1SA 1QOBA 1SSNA 1F0ZA 1Y56A 2KWDA 3TSSA 1SXTA 3E56A 4RGNA 2E3TA 1JROA 3FILB 3P4QB 2XN9C 4HROA 4KX6B 1RWSA 4GDLB 5H8YE 2M56B 1ZE3D 3TUOA 1D6EC 2NMQA 1BUIC 1CJEA 4P6VF 4ZRPA 1VZ6A 1TZOA 3AE8B 2EKIA 3Q8EA 4JWUC 4UDUC 1C79A 1D5MC 2L1AA 4O1NA 4L2YA 2PLPA 1I4XA 2DYOA 1WXQA 4WWMA 1J7CA 1KLGD 2X38A 3FC4A 2VZKB 3H8HA 2LUMA 4FXCA 2N9KA 2NTTA 1WYGA 3DWGC 1SJED 2XNAC 2DYMA 3R2TA 2H89B 4N58A 2W54A 1ROEA 2PW9A 5EE1A 3WCQA 1YMHE 5G5GA 4HKQA 1V1PB 3P4SB 4AS1A 1QOAA 1FNUA 4NAWB 1VZ7A 2INPE 4LK0M 2GI9A 2IGGA 4ZOHC 1DOXA 1KF6B 3AE4B 1YQ3B 2R61A 2WXJA 3BZDB 1V1OA 5AUKA 4OVZA 1K52A 2JYEA 2ACZB 1T6BX 3MFGA 3ZJTA 1TS5A 3P63A 3W2DA 2Y5PA 1V97A 5EE3A 4TQ1A 3IT4B 2JX5A 1WWTA 3KWVA 2SEBD 3AEAB 4Q2JA 1L6VA 4KGTA 3V05A 2L52A 1L4ZB 1RYJA 3AEFB 3HRDD 4WAFA 4RFBA 5JXVA 4DXGA 1NYRA 3ETRA 4JPSA 1K50A 1C4PA 5AUIA 4ARCA 3R2IA 1YJJA 1CZPA 3AEGB 1TKYA 1FIQA 2WLBA 2WDQB 2IJ0A 2RPVA 4HJGE 3ZYYX 2N9LA 3LYYA 4ITKA 2WDRB 4ZYSA 1E10A 3EA6A 4LLGM 3ZJUA 1DOYA 2FE8A 3LXFA 1VR9A 1BXTA 1JRPA 4YSYB 2BB6A 3AE6B 2E6XA 5EE0A 2L83A 1N5XA 3W9CB 2W55A 2BS3B 3MC0B 3U7ZA 1N60A 4XWWA 1GPXA 1UWXA 2V3PA 2IDYA 1QT9A 3HVDA 4USAA 1AWDA 1JMLA 1FXAA 2PMVA 5EE9A 2BYTA 3V3XA 2K3UA 1FCCC 4B0EA 1YNTE 1JW9D 1L0XB 2WDVB 4D2KA 2BS2B 2WS3B 5BMGA 2JU6X 3IT6B 3KWLA 4A55A 5TSSA 2FBWB 1D5ZC 2Z8LA 1IBXA 1T5XD 3KQ4A 4GDKB 4TSSA 5BYSA 5HG2A 3W5VB 1N5WA 3P4PB 3NZ3A 1QILA 4A9AA 2OEDA 1RM6C 1ZUD2 4TMAB 1QLBB 1QOGA 4RGTA 2CU3A 3ABVB 4US9A 1D4BA 3ZQ4A 3NVYA 2ICIA 1SF0A 1EWCA 1I4PA 1TJEA 2WP9B 3HVZA 2MJEA 1OFFA 2QMTA 4TQ0A 3U52E 1AW7A 1IGCA 1FXIA 1AYFA 3Q69A 4ZHOA 3RFZB 5H92C 2WXGA 1TKGA 2JSVX 1QF6A 4WH4A 1HEZE 1FMAD 5FKAC 1Q10A 2W3SA 3U4EG 2WXPA 4OZCA 5D3DA 2YEPF 1TS4A 3NVVA 5C2TB 3BVMA 3BK1A 1ZDVA 2WXMA 4RGMA 1NVID 1GB1A 1C77A 2KQ4X 1WGKA 2NTSA 3OWEB 1ET6A 1CQVA 1XO3A 1HQRD 1TKEA 2ON8A 5HHDG 3ZJVA 1IUEA 2BS4B 5BYQA 1ZOYB 2GB1A 3N9YC 4H2AA 3I9V1 5C3JB 1CK1A 1TY2A 1C76A 2PVGC 2AQ3B 3E9SA 5E6JA 1YJIA 4OZAA 4RH6A 2MJ3A 3TEYA 3TEXA 2WU5B 1C4CA 4WURA 2OHFA 4ZHPA 4YT0B 2PVOD 4MT5A 1L6UA 3CWIA 1NENB 1HA5A 1JWMD 2EELA 2RDGA 3P1MA 2WXIA 1KFYB 1TS2A 2QJLA 3AECB 3T3NA 1SIJA 2KACA 5LNK1 3BVZA 1GB4A 1STEA 1ZP0B 5FK9C 2IGHA 3NUHB 4C56C 1I4GA 3VR9B 3BVGA 1QOFA 3AMZA 4JWSC 4YSXB 4A6QA 2LJIA 2J53A 4NZLB 4YTNB 2N0SB 3GS2A 3VRAB 5BMIA 3I57A 1JWBD 2AQ2B 4L1BA 2WXRA 1EWYC 2PKOA 1SE3A 5FR3A 3L4PA 3BIID 2I2YA 1VZ8A 4RF0A 3BWUD 1I4QA 1ZXIA 1NEKB 1AN8A 2PIAA 2BBCA 4US8A 4YXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W A;  3P4P B;  4A9A A;  3AE8 B;  4JWU C;  2EKI A;  1RM6 C;  1ZUD 2;  4YTM B;  3NS1 A;  1QLB B;  1QOG A;  1J7A A;  2CU3 A;  3ABV B;  4US9 A;  2BT6 A;  3AH7 A;  3NVY A;  3VR8 B;  1YQ4 B;  1SF0 A;  1XLP A;  1WXQ A;  1UWM A;  4WWM A;  1J7C A;  1PFD A;  3PO0 A;  1B9R A;  3FC4 A;  1TJE A;  2WP9 B;  3AB5 A;  3HVZ A;  4FXC A;  1E0Z A;  4N6E B;  2MJE A;  1OFF A;  1E9M A;  2MH7 A;  1WYG A;  2WU2 B;  2K9X A;  3AEB B;  3DWG C;  3P4R B;  1XLN A;  1WRI A;  2LEK A;  1FXI A;  1AYF A;  2K5P A;  4ZHO A;  1GAQ B;  2DWQ A;  2H89 B;  4N58 A;  5GXG B;  2W54 A;  5H92 C;  1ROE A;  3CIR B;  1SB3 C;  5EE1 A;  4WQM A;  1A70 A;  1TKG A;  3VRB B;  3WCQ A;  5G5G A;  2G1E A;  1QF6 A;  3P4S B;  1FMA D;  1QOA A;  2W3S A;  1FRD A;  4ZOH C;  1DOX A;  1KF6 B;  3AE4 B;  1YQ3 B;  5AUK A;  2KAJ A;  3AE2 B;  4LTU A;  3AE5 B;  3AEE B;  1N63 A;  3AE3 B;  3AV8 A;  2ACZ B;  3NVV A;  4IDI A;  5C2T B;  5G5H A;  1XLQ A;  1VLB A;  3P63 A;  1NVI D;  2Q5W D;  3B2F A;  3EUB 2;  5MPO A;  1V97 A;  2HTM E;  5EE3 A;  1I7H A;  3W5U B;  2JX5 A;  1WGK A;  1WWT A;  3AEA B;  2DBY A;  1L6V A;  4KX6 B;  1RFK A;  1XO3 A;  1VDV A;  1TKE A;  2L52 A;  1E6E B;  1FM0 D;  1RYJ A;  3AEF B;  1L0V B;  1IUE A;  2BS4 B;  3HRD D;  3FAH A;  2WQY B;  1ZOY B;  4N59 A;  4C7Y A;  5C3J B;  1NYR A;  3ETR A;  4C80 A;  1XLO A;  2PVG C;  1VJK A;  2B76 B;  5AUI A;  1YJI A;  1YJJ A;  2JQR B;  2MJ3 A;  1T3Q A;  1CZP A;  4HRS A;  4JX1 C;  2CJO A;  1JAL A;  2WU5 B;  2H88 B;  2M19 A;  1JWA D;  2K22 A;  1TKY A;  3AEG B;  2OHF A;  1FIQ A;  4ZHP A;  2QIE B;  2WLB A;  4YT0 B;  2WDQ B;  3SR6 A;  3B9J A;  3DWM A;  2PVO D;  1R7S A;  3ZYY X;  4C7Z A;  4YTP B;  1FFU A;  4ITK A;  1L6U A;  1N62 A;  2WDR B;  3CWI A;  1NEN B;  2MJD A;  1FRR A;  1E10 A;  3P1M A;  1J7B A;  1KFY B;  2KMM A;  3AE1 B;  1DOY A;  3AM9 A;  1L5P A;  1NYQ A;  2QJL A;  1PDX A;  3AEC B;  3LB8 C;  1DOI A;  1SIJ A;  3B2G A;  3AE7 B;  3LXF A;  4YSY B;  1JRP A;  1ZP0 B;  1OQR A;  2Y5C A;  3AE6 B;  3NVW A;  1NI3 A;  1N5X A;  1N61 A;  2L83 A;  5EE0 A;  2W55 A;  3AN1 A;  2BS3 B;  1FFV A;  3NRZ A;  3W9C B;  3SFE B;  1TYG B;  1N60 A;  1FO4 A;  3VR9 B;  3SFD B;  1GPX A;  1QOF A;  3AED B;  2W3R A;  3AMZ A;  4JWS C;  1QT9 A;  4YSX B;  3NVZ A;  1PUT A;  4USA A;  4YSZ B;  1AWD A;  1FXA A;  5EE9 A;  1QOB A;  1F0Z A;  4YTN B;  2N0S B;  3VRA B;  2E3T A;  1JWB D;  1JRO A;  1OQQ A;  1V8C A;  3P4Q B;  4HRO A;  1EWY C;  1DGJ A;  1JW9 D;  2AX5 A;  1RWS A;  2PKO A;  2WDV B;  3HUI A;  3L4P A;  2BS2 B;  2WS3 B;  3BII D;  5H8Y E;  3AE9 B;  3KWL A;  2FBW B;  2M56 B;  1JQ4 A;  1E7P B;  1ZXI A;  1NEK B;  2CJN A;  1KRH A;  2PIA A;  4US8 A;  3RPF C;  1CJE A;  4YXD B;  4P6V F;  3W5V B; 
#chains in the Genus database with same CATH topology
 2K6Q A;  3DVG Y;  2G9H D;  1OEY A;  1XCT L;  3EFU A;  1PFD A;  1L4D B;  4ICU A;  2KFK A;  1PGA A;  3R7Q A;  4FJY A;  2WWZ A;  5GXG B;  1F77 A;  2DWQ A;  2JRI B;  4KKI A;  1JWS D;  4DHJ B;  1XF5 L;  3L16 A;  2KOX A;  2G1E A;  2WX1 A;  2V4I B;  2AEH A;  2LFI A;  1D3Z A;  3UIN B;  3BYY B;  3RNC C;  2UYZ B;  2WNM A;  1UBQ A;  3APF A;  5MPO A;  4WQO B;  3OAW A;  3RCZ A;  1Y8R C;  3CSF A;  5DPT A;  4K3B A;  4C7Y A;  2WQY B;  2V3N A;  4OHJ A;  4ICV A;  4HRS A;  5D3I B;  2CJO A;  2WXL A;  2M19 A;  2D3A A;  2M1M A;  4ZRQ A;  4B6W A;  3TEW A;  4RM9 A;  2MJD A;  5HI1 A;  4KDL B;  1OTR B;  4FHJ A;  2EMS A;  1NYQ A;  1I4R A;  2IPK D;  3QK0 A;  4IC7 B;  2Y5C A;  4MJS B;  4MM3 B;  3KW5 B;  3NRZ A;  1PGB A;  2RD0 A;  4W9L A;  3SFE B;  1TYG B;  2M0A A;  5LXH A;  1F2R C;  2JY6 A;  3DBL I;  4G11 A;  1PYW D;  3H7S A;  1F52 A;  4NJ7 A;  2JZ3 B;  3TJP A;  2N1V A;  4GU2 A;  3UQA A;  2YLM A;  1OQY A;  3ZTD A;  3APC A;  3SU8 X;  2FNJ B;  1H8C A;  3QQ8 B;  1ZKH A;  2RPQ A;  3CF6 E;  1ENF A;  2YEP B;  1E7P B;  3ML9 A;  1JWU D;  1EM7 A;  4G0N B;  4GLS C;  4A8X C;  1ZPS A;  2LHE A;  3SDL C;  4GDL A;  3AH7 A;  2D3B A;  2JXT A;  1YQ4 B;  2LAS A;  3VR8 B;  3SEB A;  3EGR A;  3K9O B;  2DNF A;  3DBL B;  1B9R A;  2L7R A;  2R2Q A;  2JZP A;  4MSM B;  4MGI E;  3R7R A;  2HJ1 A;  4FBJ B;  3A9K A;  1FNW A;  2HD5 B;  3TMP B;  4XWT A;  3WAP A;  4CYE A;  2NCN A;  3U2S C;  3VRB B;  3MJ5 A;  4EZL A;  3V61 A;  2PE9 A;  4F1S A;  3GB1 A;  4GN1 A;  1WZ0 A;  2BQQ A;  4KZC A;  1N63 A;  2KDI A;  3WAL A;  2LD9 A;  5HKH A;  2VH1 A;  4M8N A;  2UWQ A;  2QIL A;  2SAK A;  1VCB A;  1FM0 D;  5T8I A;  2KHW B;  2HTH A;  4ASW C;  5LLI A;  1IP9 A;  2LVQ A;  2DHZ A;  3SR6 A;  4C7Z A;  2M0X A;  4IG7 B;  2KZR A;  1K53 A;  4WIP A;  4XX5 A;  2LVP A;  3Q8A A;  3DCG A;  1PDX A;  2M17 A;  3AE7 B;  1I42 A;  2WXO A;  1IGD A;  4ANW A;  2WXN A;  1KLU D;  3KUZ A;  2ZW1 A;  3QC8 B;  1SXT A;  4RGN A;  2XN9 C;  1YX6 B;  5H8Y E;  2KC1 A;  2XEW A;  4GSW A;  4P7I A;  3W1Y A;  1ZE3 D;  1D6E C;  1TBE A;  1CJE A;  4P6V F;  4HLE A;  2K8C A;  1LFD A;  3Q8E A;  3ZDM C;  2BWF A;  1C79 A;  3RNG C;  2O2V B;  2G3Q B;  4O1N A;  2MX2 A;  4LCD E;  4WWM A;  2NBU A;  4LJO B;  1WJ6 A;  1SIF A;  3H9D A;  2H89 B;  3I63 C;  2W54 A;  2PW9 A;  2MRP A;  2GBN A;  5IOI A;  2KWC A;  5G5G A;  3JVZ X;  4KV2 A;  2D3C A;  2DZI A;  4LK0 M;  2GI9 A;  5IN7 A;  4OVZ A;  3HK0 A;  4GMV A;  3PRP B;  5EE3 A;  4TQ1 A;  4W9H A;  3KVF B;  3BIN A;  1V9J A;  4Q2J A;  4S0R A;  1L6V A;  4KGT A;  1RYJ A;  3VUX A;  1LM8 B;  3HRD D;  4JIO U;  3VH3 B;  1WXM A;  4DXG A;  1NYR A;  2N7E A;  2PEA A;  1K50 A;  3VDZ A;  2FCQ A;  1CZP A;  4PYZ A;  4K3C A;  3AEG B;  2ZZP B;  2N9L A;  3HIZ A;  5CHW A;  3UF8 A;  1E10 A;  3M3J A;  1DOY A;  3W1S C;  1JRP A;  2KTF A;  2L83 A;  3PTF C;  3MTN B;  1MJD A;  4XWW A;  1GPX A;  1UWX A;  1QT9 A;  2CHW A;  1SGH A;  2MW5 A;  2BWE S;  2IO0 B;  4LNO A;  4RMA A;  5BMG A;  1IBX A;  2N9X A;  4GDK B;  4TSS A;  4N9F 4;  3W5V B;  4A9A A;  1QOG A;  5JH5 C;  3VVW B;  2ICI A;  3ZNI D;  1LGR A;  4MEL A;  4MDK E;  3N1X C;  1EWC A;  2WP9 B;  3WA0 A;  2LRU A;  2KWV B;  5DPR A;  4TQ0 A;  3V6E B;  2ZEQ A;  4LNK A;  3ZNZ B;  1TKG A;  4WH4 A;  1FMA D;  5JZE B;  1HTO A;  1Q10 A;  2W3S A;  3U4E G;  2WXP A;  3MJW A;  2Y5B B;  3A9K B;  2EMT A;  1YOV B;  1J0G A;  2KX0 A;  5C2T B;  2J7Q B;  1WE6 A;  4JL9 A;  5D6J B;  1KJT A;  2KMC A;  3OWE B;  1Q1O A;  1IPG A;  4JQW C;  3D32 A;  3ZXR A;  2ON8 A;  4DDI D;  1H4R A;  3AXC A;  3N9Y C;  4ANX A;  2L3Z A;  1TY2 A;  3ZNH B;  1C76 A;  2AQ3 B;  3E9S A;  3VHT C;  1YJI A;  4OZA A;  4NQL B;  3TEY A;  2DAF A;  2I1J A;  4G50 A;  2MCN B;  1NEN B;  2EEL A;  1KFY B;  2M8S A;  2NBV B;  3S2A A;  3DBR I;  1SIJ A;  1MG4 A;  2BKR B;  4HDO A;  1VD2 A;  3PRE A;  4C56 C;  1I4G A;  4WJP A;  3Q3O C;  4J6I A;  2OOB B;  1YJ1 A;  2LJI A;  3PT2 B;  2KJH B;  2J53 A;  3VRA B;  4MJS A;  1NI2 A;  1JWB D;  2W9N A;  1SE3 A;  3L4P A;  2OJR A;  3BII D;  4IWP A;  1VZ8 A;  1Z5S B;  4A3O A;  2PIA A;  2FCS A;  4YXD B;  3KUD B;  3DBR B;  2G45 B;  4EZJ A;  2BTE A;  4IWQ A;  2KN4 A;  4J3O D;  1GOZ A;  3TIX A;  2J4X A;  4X57 B;  3PO0 A;  4PYU A;  1V1P A;  2HE7 A;  3AB5 A;  1WZ3 A;  2NPT A;  2K9X A;  4NAM A;  2L0T A;  2QSD A;  1EU4 A;  1A70 A;  4W9F A;  2C7N B;  2K0P A;  4ARI A;  2DZJ A;  1TS3 A;  2NBW B;  2Z59 B;  3B1L X;  2BW2 A;  1P7F A;  2MP2 B;  3Q8C A;  2KAJ A;  1YD8 U;  4KDI C;  1PGX A;  1I7H A;  3DBS A;  2V4L A;  4GXB A;  2KDM A;  1E8Y A;  2GMI C;  3MP9 A;  3M62 B;  1F1H A;  3KYD D;  3EC8 A;  4N59 A;  1FNV A;  5EDS A;  1VJK A;  2ZNV C;  3O65 B;  4LJP B;  1HZ6 A;  4MEM A;  1JWA D;  1E8Z A;  3B9J A;  4I6L B;  4YTP B;  3IAM 1;  1PQS A;  1L5P A;  4M02 A;  1WIA A;  3O13 A;  4OZB A;  1SEB D;  3NVW A;  2OJW A;  3C8Y A;  5BMH A;  2KN5 A;  3AED B;  4EZK A;  1C78 A;  1AAR A;  2RMM A;  4BBN C;  1V8C A;  1MFW A;  2BB5 A;  4KGS A;  5BYR A;  2O6V B;  1DGJ A;  4WWO A;  3AE9 B;  3ECI A;  2KDB A;  2K1F A;  1SE4 A;  4K81 A;  4BAX A;  3RPF C;  4EEW A;  2CU1 A;  4YTM B;  4MH0 E;  3V60 A;  1D5X C;  3TL5 A;  3KH0 A;  2Z0D B;  4HKZ E;  3GP7 A;  1IBX B;  3AI5 A;  3ONS A;  2GBK A;  4DHJ D;  5BO4 B;  2KC2 A;  1E0Z A;  2RDH A;  2V0G A;  1WRI A;  4DXF A;  1SB3 C;  2ZVN A;  1ET9 A;  4BKG A;  2G4S A;  3IXS A;  3DOW A;  4E71 A;  4FA6 A;  2L32 A;  1MI0 A;  3Q8B A;  1RFA A;  2J52 A;  1QQR A;  4LTU A;  3AEE B;  3AE3 B;  2FIF A;  3AV8 A;  3TEZ A;  3ZRF A;  1VLB A;  3B2F A;  2KVZ A;  1UF0 A;  3IBE A;  2DX5 B;  1WSP A;  1SBB B;  1ZDX A;  4XDD A;  1WJ4 A;  1E6E B;  3DVN U;  1MVK A;  3FAH A;  4KGR A;  2Z0E B;  1WGG A;  2BYV E;  4C80 A;  4DWF A;  2LGX A;  3ML8 A;  1YN4 A;  4XE0 A;  1T3Q A;  2V9H A;  1MG8 A;  1FXT B;  4AUQ C;  2BVC A;  2WXQ A;  1N6Z A;  1FFU A;  2FUG 1;  3Q8F A;  2MBQ A;  2ZVO A;  1DOI A;  4CHK A;  3L08 A;  5LXI B;  1FFV A;  1WM2 A;  2KJR A;  1LXD A;  2VZK D;  2WXH A;  3N20 C;  5E6P A;  4F8C B;  1PUT A;  4GOC A;  3OLM D;  3C19 A;  1F0Z A;  1Y56 A;  3TSS A;  3E56 A;  3QX1 A;  2E3T A;  3Q14 C;  3PLV A;  2IZV B;  4WJO A;  4BOZ B;  4KIK B;  1GUA B;  2C7M B;  3X23 A;  4I6P A;  5JHA A;  3DVN V;  4LNN A;  4ZRP A;  1S3S G;  4UDU C;  1D5M C;  2L1A A;  4BFR A;  4BVU C;  3I3T B;  2X38 A;  4GDK A;  2VZK B;  1SJE D;  2XNA C;  2DYM A;  4N58 A;  2BYE A;  2C9W B;  3QCA A;  4BKT A;  1V1P B;  3P4S B;  1FNU A;  4HK2 A;  2NPT B;  1IYF A;  4WWP A;  2ZCC A;  1DOX A;  1KF6 B;  3AE4 B;  1YQ3 B;  2JVC A;  3BZD B;  1XD3 B;  1K52 A;  4M0W B;  3Q3F A;  4PK1 A;  2ACZ B;  1T6B X;  3MFG A;  3DHI C;  4MSQ B;  3ZJT A;  1TS5 A;  2Y5P A;  1WGY A;  3PPA A;  2SEB D;  3AEA B;  2QHO A;  3V6C B;  2J0M A;  1V5O A;  2A4Z A;  3AEF B;  5IAA C;  4WAF A;  5JXV A;  3ETR A;  1C4P A;  5AUI A;  3OG5 A;  2KQ7 A;  3R2I A;  4JGH B;  3Q3J A;  4M00 A;  2L05 A;  1TKY A;  3ZDT A;  3DHG C;  2RPV A;  3ZYY X;  4ITK A;  3EA6 A;  1VR9 A;  4C00 A;  2BB6 A;  1N5X A;  3W9C B;  2W55 A;  3NOB A;  5D94 A;  4PS3 A;  2JUO A;  2IDY A;  3H7P A;  2LRW A;  3U7D A;  2PPH A;  2KD0 A;  5EE9 A;  2BYT A;  3A4R A;  3V3X A;  1E8W A;  4K7S A;  1YNT E;  5C1Z A;  2LGS A;  4D2K A;  2WS3 B;  3NHE B;  1ISN A;  3KWL A;  4A55 A;  2WGS A;  5TSS A;  1I35 A;  4ZRJ A;  3KQ4 A;  3L54 A;  2RDB C;  1S1Q B;  3MC8 A;  2IYD B;  4ZDV A;  4RGT A;  2CU3 A;  1D4B A;  3ZLZ A;  3ZQ4 A;  3NVY A;  2MHJ A;  1WI0 A;  2K25 A;  3VXW A;  1SF0 A;  3N32 A;  2KFJ A;  4W9J A;  2XBB C;  2BF8 B;  3Q69 A;  3RFZ B;  4EFO A;  3A9J B;  2CKH B;  5FKA C;  1WFY A;  3ZXV A;  4G3X B;  4BKS A;  2KKC A;  3MC9 A;  2K6D B;  5CHV C;  1TS4 A;  2KLG A;  3DPD A;  1ZDV A;  1C77 A;  2AL3 A;  2KQ4 X;  1WGK A;  1ET6 A;  2MP2 A;  2D10 A;  1XO3 A;  4DHZ B;  2LJ5 A;  2CR5 A;  4KZ0 A;  4DXA B;  1ZOY B;  2GB1 A;  3APD A;  1TGZ B;  1EO6 A;  5E6J A;  2MJ3 A;  4OVU A;  1C4C A;  3VUW A;  2OHF A;  4ZHP A;  4MT5 A;  2LWP A;  4NY0 A;  2N4F A;  3CWI A;  1HA5 A;  2KYW A;  3P1M A;  1WY8 A;  3T3N A;  2B3A A;  2CS4 A;  3ALB A;  1ZP0 B;  1FPY A;  1T0S C;  5FK9 C;  3NUH B;  4I6N B;  2LVO A;  3VR9 B;  3BVG A;  1QOF A;  1WXS A;  4JWS C;  4YSX B;  4A6Q A;  1GJZ A;  3PHW B;  4YTN B;  2N0S B;  4L1B A;  1Q5W B;  2IBI B;  2NR2 A;  2I2Y A;  2REX A;  1I4Q A;  2KJ6 A;  2C5L C;  4WJN A;  3ZKJ C;  1KM7 A;  1FD6 A;  1T0Q C;  4EE2 A;  2KVR A;  2O6V A;  4GB9 A;  1WH3 A;  2L8J A;  2ZCB A;  1XLP A;  1UWM A;  2K8B A;  1EF5 A;  4R3D A;  4ZYN A;  5IP4 D;  1ZGU B;  4N6E B;  3AEB B;  3NZU A;  2LEK A;  2KAN A;  1GAQ B;  2INN E;  2W82 A;  3A4S C;  4MGK E;  4KKJ A;  2K39 A;  4P16 A;  3P42 A;  1L0Y B;  4W9D A;  1FEH A;  3BYT B;  1FRD A;  4M8M A;  3AE5 B;  4IKG A;  2QC8 A;  4NNJ B;  2MEK A;  2LZ6 A;  2V1Y A;  3QWZ B;  1WJN A;  3EUB 2;  1YN5 A;  4FLH A;  4M01 A;  5D7G A;  1OEY J;  4L23 A;  4CO7 A;  1VDV A;  1TTN A;  1LO5 D;  1UUP A;  3KLS X;  4OW0 A;  2KDE B;  4AQ7 A;  2IO3 B;  5AZH A;  1HTQ A;  1UGJ A;  3CST A;  3M95 A;  4B9K A;  3Q6B A;  1V2Y A;  2JQR B;  4JX1 C;  3ZIM A;  5C23 A;  4DBG A;  1R4N I;  2MSE D;  2ZPY A;  3JW0 X;  2EKE C;  4XDC A;  2LXC A;  3PZ7 A;  3TCA A;  3R8B A;  1B1Z A;  3B2G A;  3LDZ E;  4MAC A;  1WMH B;  3T3O A;  3ZRC A;  1NI3 A;  1N61 A;  4TV3 A;  3AN1 A;  4W9G A;  4TUU A;  1QKZ A;  2I1K A;  1TT5 B;  1QZE A;  2GOW A;  3UIO B;  4MH8 A;  1P1A A;  2BGF A;  1R4N B;  4LDT D;  1OQQ A;  5DCN A;  2AX5 A;  3HUI A;  3RUL A;  3IVF A;  1XXG A;  4JE3 B;  2N9E B;  3PZ8 A;  3H7P B;  4A90 A;  4EUT A;  2CJN A;  3L10 B;  2LHD A;  3J9C A;  1YN3 A;  3RD2 A;  1DYQ A;  4BKS D;  4KIK A;  5IKC M;  4ZRI A;  3QAR A;  2DEN B;  4RCO A;  3VAW A;  5HFY A;  1R4M I;  5CHF A;  4XC2 A;  5AEK B;  1E9M A;  2MBB B;  2LUE A;  3AU5 A;  3NG0 A;  3HM3 A;  2K5P A;  1YQB A;  1WRD B;  4LDT B;  4XYC A;  4K7U A;  3ZGZ A;  2L00 B;  3MHZ A;  1SJH D;  2D5G A;  1RAX A;  4A20 A;  4NJ6 A;  4IDI A;  1EU3 A;  2Q5W D;  4PS7 A;  2Y3A A;  2HTM E;  2LGY A;  1NBF C;  2DBY A;  2RSU A;  1R4M B;  3FKY A;  1RFK A;  1JCK B;  4M0W A;  1Q0W B;  1WJU A;  2D3G A;  4DQO C;  4IWO A;  3N1Z C;  1WGR A;  4NJC A;  2R2O A;  2B76 B;  1I4H A;  2MQJ A;  3ZW3 A;  3SHQ A;  2TSS A;  1CMX B;  1JAL A;  4B0M A;  2H88 B;  3ZNG C;  1K51 A;  1XCQ L;  4HJK A;  1R7S A;  4YWG G;  3IAS 1;  4RGO S;  3ZUN A;  1FRR A;  1V5T A;  2KMM A;  2L0F A;  3LB8 C;  3UI3 A;  1F2R I;  1HXY D;  2MBE A;  2JF5 A;  3ZVV A;  2V3S A;  4HPP A;  1FO4 A;  4DHZ E;  1KTK A;  1P3Q U;  2O6V D;  3VQI A;  4CQN A;  4IM2 A;  3NVZ A;  3W1S A;  3GE8 C;  1TIF A;  4HVB A;  1JRO A;  1P98 A;  3FIL B;  3P4Q B;  2N9P C;  3RMK C;  5AZG A;  3TUO A;  2NMQ A;  1BUI C;  1KLV A;  4HDQ A;  2KTR A;  2EKI A;  2GBJ A;  1HE8 A;  1I4X A;  2DYO A;  4RM8 A;  1WXQ A;  3H6N A;  5KHQ A;  1KLG D;  3L0W B;  1YX5 B;  2C7H A;  4FXC A;  3WAO A;  2NTT A;  3DVG X;  3ZTC A;  3DWG C;  3RZF A;  2KNB A;  3R2T A;  4DK5 A;  5EE1 A;  1UBI A;  3WCQ A;  4FAD A;  1YMH E;  1EF1 A;  4HKQ A;  1QOA A;  3DHH C;  3Q3M C;  2INP E;  4GIV A;  4ZOH C;  4HPM B;  2WXJ A;  1UD7 A;  4ZRK A;  3IFW B;  2JYE A;  3TBL D;  2HJ8 A;  3A9J A;  3RI7 C;  4C4V B;  2RR9 A;  3W2D A;  2WYQ A;  1V97 A;  2JX5 A;  1WWT A;  4P1B C;  1WXV A;  2JWZ A;  1WX9 A;  4IM0 A;  1OGW A;  2L52 A;  4ANU A;  4E74 A;  2N1W A;  3PV1 A;  4FJV B;  4ARC A;  1FIQ A;  2KX3 A;  2WLB A;  4HJG E;  3SD5 A;  3H1U A;  2WDR B;  2DZK A;  4ZYS A;  3ZJU A;  2FE8 A;  3AU4 A;  3LXF A;  5IA7 A;  5L83 A;  3MC0 B;  2CHX A;  3IG3 A;  2DAJ A;  2AWT A;  3JYU A;  3EFC A;  4USA A;  1FXA A;  1E90 A;  1FCC C;  3CMM B;  4B0E A;  1WR1 A;  3GE3 C;  1JW9 D;  1L0X B;  4ACF A;  5E6N A;  3IT6 B;  2FBW B;  1D5Z C;  2NVU I;  2Z8L A;  1T5X D;  2KXJ A;  1N5W A;  3NZ3 A;  4GGQ A;  2K8H A;  1ZUD 2;  4TMA B;  2FCN A;  3VUY A;  1QLB B;  2WDT B;  3ABV B;  2GBM A;  3A1Q A;  3WAN A;  3HHM A;  2AL6 A;  2ZPN A;  1G6J A;  3EHV A;  2MJE A;  1OFF A;  3L17 A;  2VRR B;  5H92 C;  2WXG A;  1E7V A;  1HEZ E;  4AP4 C;  1WM3 A;  2IY1 B;  1Z2M A;  1WGH A;  2PE6 B;  3BVM A;  2M4N A;  1GB1 A;  4BOS C;  4WWN A;  2NTS A;  3KUC B;  1CQV A;  2MWS B;  2JZZ A;  1X1M A;  1HQR D;  1TKE A;  5HHD G;  1IUE A;  4H2A A;  2C60 A;  1CK1 A;  3M63 B;  1WE7 A;  1UGM A;  1KOT A;  2PVG C;  4RH6 A;  2D07 B;  3TEX A;  4WUR A;  2FAZ A;  1L6U A;  2RDG A;  3VH4 B;  4WJQ A;  2WXI A;  4E3C A;  1TS2 A;  4F7Z A;  5J18 A;  3AEC B;  2KAC A;  3L13 A;  2IGH A;  3B0A A;  4NPN A;  2ASQ A;  3NY5 A;  3IHP C;  1K8R B;  3AUL A;  3QAQ A;  2BPS A;  4NZL B;  1WMH A;  3GS2 A;  4K7W A;  1WGD A;  5BMI A;  3I57 A;  2AQ2 B;  1EWY C;  4IW0 A;  2LI5 A;  2BBC A;  4US8 A;  1UH6 A;  3K9P B;  4FN2 A;  1E5W A;  3RNF C;  1J7A A;  4TKN A;  4RNA A;  3HM6 X;  1MHH E;  3Q2A C;  4B95 A;  1C9F A;  3P2B A;  2KK8 A;  4NAW A;  3RT3 B;  2KTR B;  4URK A;  5CTR C;  2WU2 B;  3P4R B;  2QEJ C;  1XLN A;  1M4V A;  3RZW C;  4WQM A;  4QAY A;  2KDF B;  2DLB A;  1U4A A;  1GG3 A;  1XEE A;  4S17 A;  5CX3 A;  3QIJ A;  2LGI A;  1KH0 A;  1L2N A;  2AQ1 B;  3BK2 A;  2KO3 A;  1SE2 A;  1L0V B;  2JRH A;  4BBN F;  1LQB A;  4YL8 A;  2GRI A;  1UEL A;  4AJY B;  4MGY E;  2N7J A;  2DYB A;  1J7B A;  3MHS D;  3PSE B;  3QJZ A;  4II3 B;  3AM9 A;  3GZN I;  4HEA 1;  5E6O A;  3RNB C;  1BML C;  1BT0 A;  1OQR A;  1HZ5 A;  1GC6 A;  5KHO A;  3PRM B;  2XK5 B;  2J42 A;  3SFD B;  1ACC A;  2W3R A;  3VTW A;  2WXK A;  3URY A;  4RF1 A;  4YSZ B;  3N30 A;  2HDE A;  3GOE A;  3WIM A;  4LNF A;  1MHX A;  4WAA A;  1JQ4 A;  4XGA B;  1SE9 A;  1KRH A;  2I38 A;  3GZN B;  5TR5 A;  2KFK B;  1GNU A;  3FIL A;  3NS1 A;  2BT6 A;  2G4D B;  4BZA A;  2JPH A;  3ZO5 B;  5G55 A;  2IO2 B;  1ESF A;  2MH7 A;  2UU7 A;  3DQV A;  2KQS A;  3A1Q B;  4FHK A;  5JHB A;  1ZXH A;  3BY4 B;  3DBH I;  3CIR B;  4P1C C;  3PS6 A;  2FCM A;  1TY0 A;  2KWU B;  4A3P A;  2MBO A;  3AE2 B;  3KYC D;  1FCL A;  2FUH B;  1J8C A;  5G5H A;  1XLQ A;  2WHI A;  3PGE A;  2JYT A;  2BKF A;  3ENE A;  3W5U B;  3JSV A;  1VRA B;  4HCP B;  1C4A A;  3QHT A;  2LMC A;  1JRU A;  4C4V A;  4REZ A;  3DBH B;  3B08 A;  5IO9 A;  3VFK A;  5I4D A;  2WX0 A;  1XLO A;  5J17 A;  2DZM A;  2YVC A;  2K22 A;  2QIE B;  2PTL A;  3DWM A;  3PHX B;  1NDD A;  1V81 A;  4IOI E;  1N62 A;  1UNS A;  4EOY A;  3AE1 B;  2JWU A;  1V86 A;  5GMV A;  5DPW A;  2IGD A;  2ZW0 A;  4PT5 A;  2WXF A;  3U8Z A;  1V80 A;  5FR6 A;  1WR6 E;  1P7E A;  3DDC B;  2ZNV B;  2ONQ A;  5AZF A;  1MPE A;  1QOB A;  1SSN A;  4KVG B;  2KWD A;  2MLB A;  4HRO A;  2GLS A;  4KX6 B;  1RWS A;  4GDL B;  4AWJ A;  3WAM A;  3PZD A;  2D11 A;  2M56 B;  1F9J A;  2N7D A;  1VZ6 A;  1TZO A;  3AE8 B;  3NZS A;  4JWU C;  4W9K A;  3PRZ A;  4L2Y A;  2PLP A;  4HCN B;  1J7C A;  3FC4 A;  2RGF A;  3H8H A;  4AJW A;  2MBH A;  2LGD A;  2LUM A;  2N9K A;  1WYG A;  1WX7 A;  2MA9 B;  3I5J C;  3R66 C;  1ROE A;  4FUL A;  4DDG D;  4AS1 A;  4NAW B;  4PS8 A;  3Q3N C;  1VZ7 A;  2IGG A;  2IND C;  2R61 A;  5AUK A;  1V1O A;  1RLF A;  2LXA A;  4FJZ A;  5G2N A;  1EUV B;  4II2 B;  3P63 A;  3RYT A;  1E7U A;  1P9D U;  3IT4 B;  1E8X A;  3KWV A;  4HXD A;  3V05 A;  1L4Z B;  2ZJD A;  4W9C A;  4RFB A;  2NS5 A;  3V62 A;  4K1R B;  2GBR A;  2L76 A;  4JPS A;  3PLU A;  3T8M A;  1YJJ A;  2J0J A;  1C3T A;  3A33 B;  3PVL A;  1A5R A;  1ZW7 A;  2WDQ B;  2FID A;  2A5U A;  2IJ0 A;  4MM3 A;  4W9I A;  3LYY A;  2VH2 A;  2IY0 B;  2KMA A;  1L7Y A;  4LLG M;  4ANV A;  1BXT A;  4YSY B;  3AE6 B;  2E6X A;  3OJ3 A;  5EE0 A;  2BS3 B;  1WXA A;  3U7Z A;  1N60 A;  1J19 A;  1GC7 A;  3RUI B;  2V3P A;  1WX8 A;  3HVD A;  4NQK E;  1AWD A;  1JML A;  2PMV A;  4EKU A;  4AOF A;  2K3U A;  5DPS A;  2CHZ A;  1C1Y B;  4W9E A;  2WDV B;  4IM3 A;  2BS2 B;  3VTU A;  2JU6 X;  2KLC A;  2QCZ A;  4XZ4 A;  2INC C;  3UQB A;  2IO1 B;  2QDF A;  5BYS A;  5HG2 A;  3P4P B;  1QIL A;  2OED A;  1RM6 C;  4US9 A;  3UIP B;  2KT7 A;  3N1Y C;  1I4P A;  1TJE A;  3EEC A;  3HVZ A;  3OJ4 B;  1T0Y A;  1TZ1 A;  2QMT A;  3UGB B;  3U52 E;  1AW7 A;  1IGC A;  1FXI A;  1AYF A;  4ZHO A;  1V49 A;  5J2R A;  4HWI B;  2JSV X;  1QF6 A;  4LNI A;  4OZC A;  3T9L A;  4KSK C;  1UZX B;  3RN9 C;  3X0W A;  5D3D A;  2YEP F;  1V6E A;  3NVV A;  4KSL C;  3VTV A;  3BK1 A;  2WXM A;  4RGM A;  1NVI D;  4MGZ E;  5D2M B;  1T0R C;  3R3M A;  3RNA C;  1XQQ A;  3NS8 A;  3ZJV A;  2BS4 B;  5BYQ A;  3I9V 1;  5C3J B;  3LJ3 A;  3JSV B;  4IUM B;  4OVV A;  2WU5 B;  2JT4 B;  3RNE C;  3C0R B;  2JXX A;  4JLC A;  4YT0 B;  1XT9 B;  2PVO D;  1RRB A;  2J0K A;  1JWM D;  2QJL A;  5LNK 1;  1M94 A;  3BVZ A;  1GB4 A;  1STE A;  1WYW B;  2BYF A;  2D2Q A;  1P0R A;  2PJH A;  4HPL B;  1YIW A;  3AMZ A;  2X8X X;  2AYO B;  2WXR A;  2PKO A;  5FR3 A;  2XK5 A;  2O2V A;  3QA8 A;  5L95 C;  4RF0 A;  1WF9 A;  3BWU D;  1ZXI A;  1NEK B;  3U30 A;  1AN8 A;  3N3K B;  3NJT A; 
#chains in the Genus database with same CATH homology
 1FD6 A;  4EE2 A;  1J7A A;  2BTE A;  2G9H D;  2KN4 A;  4RNA A;  4J3O D;  1MHH E;  1XCT L;  1GOZ A;  1XLP A;  1UWM A;  2J4X A;  1PFD A;  3PO0 A;  1V1P A;  1C9F A;  3AB5 A;  4R3D A;  1L4D B;  4N6E B;  1PGA A;  2WU2 B;  2K9X A;  3AEB B;  3P4R B;  4NAM A;  2QEJ C;  1XLN A;  2LEK A;  1GAQ B;  1F77 A;  2DWQ A;  1M4V A;  2INN E;  2W82 A;  5GXG B;  4KKI A;  1JWS D;  1EU4 A;  2QSD A;  4WQM A;  1A70 A;  1XF5 L;  4KKJ A;  2G1E A;  2K0P A;  4ARI A;  4P16 A;  3P42 A;  1L0Y B;  2V4I B;  1TS3 A;  2DLB A;  1FEH A;  3BYT B;  1FRD A;  2BW2 A;  1XEE A;  1P7F A;  3Q8C A;  2KAJ A;  3AE5 B;  2LFI A;  4IKG A;  2MEK A;  3BYY B;  2WNM A;  2LGI A;  5MPO A;  1KH0 A;  1PGX A;  3EUB 2;  1YN5 A;  1I7H A;  2AQ1 B;  3BK2 A;  5D7G A;  4L23 A;  2KDM A;  3MP9 A;  1VDV A;  1SE2 A;  1LO5 D;  1UUP A;  1L0V B;  4C7Y A;  4N59 A;  3KLS X;  4OW0 A;  2WQY B;  4AQ7 A;  1FNV A;  2V3N A;  1VJK A;  4OHJ A;  1UGJ A;  4HRS A;  2JQR B;  4JX1 C;  5D3I B;  1HZ6 A;  2CJO A;  2WXL A;  2M19 A;  1JWA D;  2GRI A;  4ZRQ A;  3B9J A;  4XDC A;  4YTP B;  3TEW A;  3PZ7 A;  2N7J A;  2MJD A;  5HI1 A;  3IAM 1;  3R8B A;  1J7B A;  3AM9 A;  1B1Z A;  1L5P A;  1I4R A;  1NYQ A;  4HEA 1;  3B2G A;  2IPK D;  1BML C;  3O13 A;  4OZB A;  4MAC A;  3T3O A;  1SEB D;  1OQR A;  2Y5C A;  3NVW A;  1NI3 A;  1HZ5 A;  1N61 A;  4MM3 B;  3AN1 A;  1PGB A;  3C8Y A;  3NRZ A;  5BMH A;  3SFE B;  1TYG B;  2M0A A;  1F2R C;  1QKZ A;  2J42 A;  3SFD B;  3AED B;  1ACC A;  2W3R A;  1PYW D;  1C78 A;  2WXK A;  3URY A;  4RF1 A;  4YSZ B;  4MH8 A;  2RMM A;  2HDE A;  1OQQ A;  1V8C A;  2BB5 A;  4KGS A;  5BYR A;  1DGJ A;  2AX5 A;  3HUI A;  1XXG A;  3AE9 B;  4JE3 B;  1MHX A;  3PZ8 A;  1ENF A;  2YEP B;  4A90 A;  1JQ4 A;  1E7P B;  1SE4 A;  2CJN A;  1KRH A;  2I38 A;  1JWU D;  3RPF C;  2LHD A;  3J9C A;  1EM7 A;  1YN3 A;  4GLS C;  4YTM B;  3FIL A;  3NS1 A;  1DYQ A;  1ZPS A;  2LHE A;  4A8X C;  1D5X C;  2BT6 A;  3AH7 A;  2JXT A;  3VR8 B;  1YQ4 B;  4HKZ E;  3GP7 A;  3SEB A;  1IBX B;  3EGR A;  1B9R A;  4RCO A;  2JZP A;  1ESF A;  5HFY A;  1E0Z A;  2RDH A;  1E9M A;  2MH7 A;  2V0G A;  1FNW A;  1WRI A;  4DXF A;  2K5P A;  1ZXH A;  3CIR B;  1SB3 C;  4XWT A;  1ET9 A;  3U2S C;  3VRB B;  3MJ5 A;  3ZGZ A;  3IXS A;  3MHZ A;  2L32 A;  1TY0 A;  3GB1 A;  1MI0 A;  1SJH D;  2D5G A;  3Q8B A;  3AE2 B;  2J52 A;  1QQR A;  4LTU A;  1FCL A;  3AEE B;  1N63 A;  3AE3 B;  3AV8 A;  3TEZ A;  4IDI A;  5G5H A;  1XLQ A;  1EU3 A;  1VLB A;  2JYT A;  2Q5W D;  3B2F A;  2Y3A A;  2HTM E;  3W5U B;  2DBY A;  1WSP A;  1SBB B;  1VRA B;  1ZDX A;  2QIL A;  1RFK A;  2SAK A;  1JCK B;  4M0W A;  4XDD A;  1E6E B;  1C4A A;  1FM0 D;  5T8I A;  1MVK A;  2LMC A;  4DQO C;  3FAH A;  4KGR A;  4REZ A;  4NJC A;  5I4D A;  4C80 A;  1XLO A;  2B76 B;  1I4H A;  4XE0 A;  1YN4 A;  1T3Q A;  2TSS A;  1JAL A;  4B0M A;  2H88 B;  2K22 A;  1K51 A;  2QIE B;  2WXQ A;  1XCQ L;  2PTL A;  3SR6 A;  3DWM A;  4C7Z A;  1R7S A;  4YWG G;  1FFU A;  2FUG 1;  3IAS 1;  4IOI E;  3Q8F A;  4RGO S;  1N62 A;  1UNS A;  1K53 A;  1FRR A;  4WIP A;  2KMM A;  3AE1 B;  2JWU A;  3Q8A A;  1PDX A;  3LB8 C;  1DOI A;  2IGD A;  3AE7 B;  3UI3 A;  2WXO A;  2ZW0 A;  4PT5 A;  1IGD A;  2WXF A;  1F2R I;  1HXY D;  2WXN A;  1FFV A;  2VZK D;  1KLU D;  2WXH A;  1FO4 A;  1KTK A;  3VQI A;  1P7E A;  4CQN A;  2ONQ A;  2ZW1 A;  3NVZ A;  1PUT A;  1MPE A;  3W1S A;  1QOB A;  1SSN A;  1F0Z A;  1Y56 A;  2KWD A;  3TSS A;  1SXT A;  3E56 A;  4RGN A;  2E3T A;  1JRO A;  3FIL B;  3P4Q B;  2XN9 C;  4HRO A;  4KX6 B;  1RWS A;  4GDL B;  5H8Y E;  2M56 B;  1ZE3 D;  3TUO A;  1D6E C;  2NMQ A;  1BUI C;  1CJE A;  4P6V F;  4ZRP A;  1VZ6 A;  1TZO A;  3AE8 B;  2EKI A;  3Q8E A;  4JWU C;  4UDU C;  1C79 A;  1D5M C;  2L1A A;  4O1N A;  4L2Y A;  2PLP A;  1I4X A;  2DYO A;  1WXQ A;  4WWM A;  1J7C A;  1KLG D;  2X38 A;  3FC4 A;  2VZK B;  3H8H A;  2LUM A;  4FXC A;  2N9K A;  2NTT A;  1WYG A;  3DWG C;  1SJE D;  2XNA C;  2DYM A;  3R2T A;  2H89 B;  4N58 A;  2W54 A;  1ROE A;  2PW9 A;  5EE1 A;  3WCQ A;  1YMH E;  5G5G A;  4HKQ A;  1V1P B;  3P4S B;  4AS1 A;  1QOA A;  1FNU A;  4NAW B;  1VZ7 A;  2INP E;  4LK0 M;  2GI9 A;  2IGG A;  4ZOH C;  1DOX A;  1KF6 B;  3AE4 B;  1YQ3 B;  2R61 A;  2WXJ A;  3BZD B;  1V1O A;  5AUK A;  4OVZ A;  1K52 A;  2JYE A;  2ACZ B;  1T6B X;  3MFG A;  3ZJT A;  1TS5 A;  3P63 A;  3W2D A;  2Y5P A;  1V97 A;  5EE3 A;  4TQ1 A;  3IT4 B;  2JX5 A;  1WWT A;  3KWV A;  2SEB D;  3AEA B;  4Q2J A;  1L6V A;  4KGT A;  3V05 A;  2L52 A;  1L4Z B;  1RYJ A;  3AEF B;  3HRD D;  4WAF A;  4RFB A;  5JXV A;  4DXG A;  1NYR A;  3ETR A;  4JPS A;  1K50 A;  1C4P A;  5AUI A;  4ARC A;  3R2I A;  1YJJ A;  1CZP A;  3AEG B;  1TKY A;  1FIQ A;  2WLB A;  2WDQ B;  2IJ0 A;  2RPV A;  4HJG E;  3ZYY X;  2N9L A;  3LYY A;  4ITK A;  2WDR B;  4ZYS A;  1E10 A;  3EA6 A;  4LLG M;  3ZJU A;  1DOY A;  2FE8 A;  3LXF A;  1VR9 A;  1BXT A;  1JRP A;  4YSY B;  2BB6 A;  3AE6 B;  2E6X A;  5EE0 A;  2L83 A;  1N5X A;  3W9C B;  2W55 A;  2BS3 B;  3MC0 B;  3U7Z A;  1N60 A;  4XWW A;  1GPX A;  1UWX A;  2V3P A;  2IDY A;  1QT9 A;  3HVD A;  4USA A;  1AWD A;  1JML A;  1FXA A;  2PMV A;  5EE9 A;  2BYT A;  3V3X A;  2K3U A;  1FCC C;  4B0E A;  1YNT E;  1JW9 D;  1L0X B;  2WDV B;  4D2K A;  2BS2 B;  2WS3 B;  5BMG A;  2JU6 X;  3IT6 B;  3KWL A;  4A55 A;  5TSS A;  2FBW B;  1D5Z C;  2Z8L A;  1IBX A;  1T5X D;  3KQ4 A;  4GDK B;  4TSS A;  5BYS A;  5HG2 A;  3W5V B;  1N5W A;  3P4P B;  3NZ3 A;  1QIL A;  4A9A A;  2OED A;  1RM6 C;  1ZUD 2;  4TMA B;  1QLB B;  1QOG A;  4RGT A;  2CU3 A;  3ABV B;  4US9 A;  1D4B A;  3ZQ4 A;  3NVY A;  2ICI A;  1SF0 A;  1EWC A;  1I4P A;  1TJE A;  2WP9 B;  3HVZ A;  2MJE A;  1OFF A;  2QMT A;  4TQ0 A;  3U52 E;  1AW7 A;  1IGC A;  1FXI A;  1AYF A;  3Q69 A;  4ZHO A;  3RFZ B;  5H92 C;  2WXG A;  1TKG A;  2JSV X;  1QF6 A;  4WH4 A;  1HEZ E;  1FMA D;  5FKA C;  1Q10 A;  2W3S A;  3U4E G;  2WXP A;  4OZC A;  5D3D A;  2YEP F;  1TS4 A;  3NVV A;  5C2T B;  3BVM A;  3BK1 A;  1ZDV A;  2WXM A;  4RGM A;  1NVI D;  1GB1 A;  1C77 A;  2KQ4 X;  1WGK A;  2NTS A;  3OWE B;  1ET6 A;  1CQV A;  1XO3 A;  1HQR D;  1TKE A;  2ON8 A;  5HHD G;  3ZJV A;  1IUE A;  2BS4 B;  5BYQ A;  1ZOY B;  2GB1 A;  3N9Y C;  4H2A A;  3I9V 1;  5C3J B;  1CK1 A;  1TY2 A;  1C76 A;  2PVG C;  2AQ3 B;  3E9S A;  5E6J A;  1YJI A;  4OZA A;  4RH6 A;  2MJ3 A;  3TEY A;  3TEX A;  2WU5 B;  1C4C A;  4WUR A;  2OHF A;  4ZHP A;  4YT0 B;  2PVO D;  4MT5 A;  1L6U A;  3CWI A;  1NEN B;  1HA5 A;  1JWM D;  2EEL A;  2RDG A;  3P1M A;  2WXI A;  1KFY B;  1TS2 A;  2QJL A;  3AEC B;  3T3N A;  1SIJ A;  2KAC A;  5LNK 1;  3BVZ A;  1GB4 A;  1STE A;  1ZP0 B;  5FK9 C;  2IGH A;  3NUH B;  4C56 C;  1I4G A;  3VR9 B;  3BVG A;  1QOF A;  3AMZ A;  4JWS C;  4YSX B;  4A6Q A;  2LJI A;  2J53 A;  4NZL B;  4YTN B;  2N0S B;  3GS2 A;  3VRA B;  5BMI A;  3I57 A;  1JWB D;  2AQ2 B;  4L1B A;  2WXR A;  1EWY C;  2PKO A;  1SE3 A;  5FR3 A;  3L4P A;  3BII D;  2I2Y A;  1VZ8 A;  4RF0 A;  3BWU D;  1I4Q A;  1ZXI A;  1NEK B;  1AN8 A;  2PIA A;  2BBC A;  4US8 A;  4YXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...