2KAJA

Nmr structure of gallium substituted ferredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the ga-substituted ferredoxin from Synechocystis sp. PCC6803, a mimic of the native protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
molecule keywords Ferredoxin-1
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kajA00
2ACZB 2M19A 2K9XA 3AMZA 1KF6B 3P4PB 3AEGB 3NVVA 1ZOYB 4HRSA 2HTME 3ZYYX 2W3SA 2Q5WD 3LXFA 3AEEB 1YJJA 4YXDB 1JALA 1OQRA 1QOFA 1NVID 1XLOA 2DWQA 2WDVB 3AH7A 3VR9B 2MJEA 1NEKB 3L4PA 1OQQA 3ABVB 2W55A 1JWAD 1JW9D 3HRDD 4A9AA 2JQRB 3AV8A 1L0VB 2QIEB 1XLPA 3VRBB 1E7PB 4JWSC 2WDRB 1FRDA 4IDIA 3AE9B 4C7ZA 3DWGC 2M56B 3AECB 4ZHPA 1YQ4B 1J7CA 3SR6A 4US8A 1KFYB 2G1EA 2MJ3A 4N58A 3NS1A 1UWMA 3AEAB 3EUB2 4C80A 3AM9A 3SFDB 1NENB 1KRHA 1RM6C 2BS3B 1E6EB 2B76B 2EKIA 4HROA 4WQMA 1TJEA 2W3RA 1E0ZA 4YSXB 1JQ4A 5AUIA 3CWIA 1N62A 3AE5B 1QT9A 1CJEA 1J7AA 3AE7B 1RYJA 2N0SB 4ZHOA 4YSYB 4YTNB 1QF6A 3AEBB 3B2FA 3B9JA 1WYGA 1WRIA 4YTPB 4KX6B 2KAJA 4P6VF 2WU5B 1PUTA 3AE6B 1RWSA 4N6EB 1DOXA 1FMAD 3FC4A 2W54A 1GAQB 1TYGB 1VJKA 1N61A 4C7YA 3VRAB 3NVZA 2MJDA 3FAHA 1CZPA 2CJNA 3SFEB 3NVWA 5G5GA 4YTMB 1NI3A 1FXAA 1E9MA 2BS4B 2WP9B 3AEFB 3WCQA 4N59A 5H8YE 4YSZB 3PO0A 1IUEA 1FO4A 5C3JB 2PKOA 5H92C 3W5UB 4JX1C 2WS3B 1VDVA 1FRRA 1L6UA 3NRZA 1ZP0B 1L5PA 2AX5A 2BT6A 3P4SB 1AWDA 1FM0D 1L6VA 3VR8B 1R7SA 3BIID 1QOAA 1N5WA 2H89B 1QLBB 4ITKA 1I7HA 1PDXA 4ZOHC 1JRPA 1FFUA 1XLQA 2DBYA 4LTUA 4WWMA 2WDQB 1QOGA 2WU2B 1NYRA 1TKYA 1TKGA 1N63A 1N5XA 3RPFC 1YJIA 5EE1A 1NYQA 1V8CA 1XLNA 1V97A 1FIQA 1JROA 2FBWB 2CJOA 2PVOD 3KWLA 1N60A 1SIJA 3ETRA 2Y5CA 1FXIA 3AE3B 2E3TA 1JWBD 2PVGC 1ROEA 2WQYB 3CIRB 1RFKA 1A70A 3AB5A 3W9CB 3P4RB 3AN1A 3DWMA 2LEKA 2K22A 3B2GA 1ZXIA 1VLBA 2OHFA 3P1MA 1EWYC 4USAA 1DGJA 1WGKA 3P63A 5G5HA 5GXGB 1E10A 3AE2B 1F0ZA 1AYFA 1B9RA 1FFVA 4US9A 2K5PA 2KMMA 2BS2B 1WXQA 3AEDB 3P4QB 4YT0B 2QJLA 1QOBA 2L52A 1J7BA 2L83A 1XO3A 1SB3C 3HUIA 1PFDA 1DOYA 5EE3A 1OFFA 1WWTA 5MPOA 5EE9A 4FXCA 2WLBA 3W5VB 2PIAA 1T3QA 2CU3A 3AE4B 3NVYA 3LB8C 1YQ3B 2MH7A 3AE8B 1GPXA 1SF0A 5EE0A 2JX5A 5C2TB 1ZUD2 4JWUC 5AUKA 2H88B 3AE1B 3HVZA 1TKEA 1DOIA
chains in the Genus database with same CATH superfamily
2LHEA 2V4LA 3AEGB 3L13A 1ZOYB 4FHKA 4UDUC 5I4DA 4TKNA 2RDHA 3MP9A 1NEKB 2BKFA 3PRPB 1E7PB 4NQLB 3LJ3A 2V3SA 1G6JA 4WWOA 3AEAB 3JYUA 5BMHA 1KRHA 1UUPA 2K1FA 2BVCA 4IUMB 4LNFA 2UYZB 1VZ6A 4XDCA 2N4FA 3MHZA 3SHQA 4P6VF 4ZRQA 2W9NA 2N1VA 3FAHA 2PLPA 2IO2B 3DHGC 1WI0A 3PO0A 2M0AA 1TS4A 4JQWC 4IKGA 1RRBA 4LLGM 2C9WB 4B9KA 4LTUA 2SAKA 2LXAA 2QMTA 3CMMB 5D2MB 1TS2A 2DZMA 2K6DB 2MRPA 1Q0WB 3PLVA 1R4NB 1ZXHA 2O2VA 4AQ7A 1SIFA 5GXGB 3KVFB 1WGRA 2AWTA 5FR3A 2CS4A 1B9RA 1XF5L 2MWSB 5C1ZA 3PRMB 2N1WA 1WX8A 2PE9A 1V5TA 2WLBA 3GS2A 1WJ6A 2KANA 1A5RA 4HWIB 1H8CA 4B95A 4WWNA 4GLSC 1DOIA 4LCDE 3ZKJC 3NVVA 3VTWA 2HTME 2Q5WD 4X57B 1OQRA 3GE3C 1NVID 1R4MB 3AU4A 1JWAD 3DVGX 2NTSA 2JQRB 1PGBA 1UH6A 4IOIE 2DLBA 1I42A 3AE9B 3WAPA 1EWCA 3QK0A 2XK5A 1LXDA 2MBHA 4ZHPA 4HPPA 2JPHA 2WXGA 4C80A 1WSPA 4FADA 1E0ZA 2C7NB 1F2RC 1ZE3D 3L08A 3DHIC 2C7HA 3W1SC 3MJ5A 2O2VB 3ZO5B 1IP9A 4GMVA 4C4VA 4HK2A 3AULA 2FIFA 3NVWA 3DBHI 3A4RA 2WXJA 2N9EB 1P7EA 1MJDA 1FFUA 5CTRC 3U7DA 4M0WB 2KDFB 3VQIA 3K9PB 4J6IA 1HTQA 4ANVA 2NS5A 5AEKB 3CF6E 2ICIA 2M8SA 1V5OA 3AB5A 3W9CB 2BYTA 2AQ2B 1JCKB 1ZXIA 3ZNHB 2J7QB 1V80A 2BQQA 4B0MA 3UGBB 3NZ3A 2J52A 1F0ZA 1WXQA 1SE9A 4IM3A 1J7BA 1LFDA 4FJYA 4OVUA 2D3BA 3SDLC 2KMAA 2LVPA 3KUZA 1YNTE 3TJPA 1V49A 2GB1A 4W9IA 2JX5A 4JWUC 1V2YA 3VFKA 1TZOA 2N7DA 3DBLI 2DNFA 4GXBA 5DPTA 4XWWA 2YEPB 2NVUI 4E71A 2WX1A 3VHTC 3BYYB 5JHAA 3VR9B 5CHFA 3HRDD 1TY2A 1L0VB 2C5LC 1QKZA 1V1OA 2AQ1B 5J2RA 3BINA 3OG5A 4HJGE 3TCAA 2CU1A 3IBEA 2D3GA 4AJWA 3DBRI 3R66C 4FN2A 1PYWD 2MQJA 2ON8A 4KX6B 2KN5A 3B1LX 3SU8X 1UBQA 3PHWB 3R2IA 1U4AA 4ANXA 1N61A 3PZ8A 2W82A 2HTHA 4NPNA 2JZPA 1FXAA 3V6EB 2WXRA 4YSZB 4N59A 3P2BA 2KTRB 4JLCA 2O6VA 1BUIC 1EF1A 1HXYD 3DVGY 4I6PA 2G4DB 1QOAA 1JWUD 4BKSA 1I7HA 1PDXA 2ZZPB 3ALBA 5LLIA 1ZDXA 4W9HA 2PEAA 2D3AA 2JRHA 3VUXA 2KQSA 4LNIA 3P42A 1HEZE 4PK1A 1HTOA 1RLFA 1C1YB 1FFVA 1SJED 3P4QB 4YT0B 5D3DA 2L52A 1T0RC 1KLGD 2QC8A 2I2YA 4LJOB 2CHZA 2JWZA 3RUIB 4OVVA 4ANUA 4MJSB 1IBXB 1KOTA 3O13A 1H4RA 1TBEA 1ZUD2 2WNMA 3RNCC 3N1ZC 2CKHB 3I9V1 2LUMA 3UQAA 3P4PB 4GB9A 1WY8A 3LXFA 2MBBB 2ZJDA 5AZGA 1SE4A 2V1YA 3MHSD 5D7GA 3E9SA 2LZ6A 1FRDA 3LDZE 2PMVA 4M00A 1BMLC 3SR6A 1WYWB 1UELA 1GUAB 3RCZA 3N32A 1HZ6A 3DVNU 3PZ7A 4M02A 4L1BA 3DVNV 4RF1A 4IM2A 2L00B 5JHBA 4ZRKA 3FC4A 3ZJVA 1KTKA 2MBQA 2KACA 4HEA1 3M95A 1YQBA 2J0MA 2QHOA 2V4IB 1WGHA 1XCQL 2VH1A 1FO4A 3PREA 4EKUA 5HKHA 2KJ6A 3H7SA 1FM0D 1Q1OA 4ZOHC 1F77A 1L0XB 2JXTA 4GN1A 1SJHD 1D6EC 1C78A 1V97A 4TSSA 1FPYA 1P1AA 3Q8FA 4JPSA 1TY0A 1OTRB 2UU7A 1WM2A 4A55A 2OJRA 1JMLA 4CQNA 3P63A 1WIAA 2NBWB 3ZQ4A 1WJ4A 1LQBA 3GB1A 4TQ1A 4M8NA 4KDIC 2GBKA 4LJPB 2BWFA 1QOBA 1IPGA 1OFFA 2ZPNA 3QWZB 3FKYA 1XCTL 3BVZA 2G3QB 3EGRA 4GSWA 1L0YB 4XC2A 4DHJB 4DDID 3PZDA 1N6ZA 5FR6A 1UGJA 2GBMA 1EM7A 1WM3A 4YXDB 4BBNF 1YD8U 4MACA 2K25A 1YN5A 2L32A 4NJ6A 3RULA 1L4DB 4LNOA 2DENB 4IDIA 1WR6E 2KJHB 3R7RA 3PPAA 3MC0B 2BB6A 3L0WB 3VH4B 2W3RA 4ZRPA 2KT7A 3AEBB 4L2YA 2FE8A 4YTPB 2MP2A 2JSVX 1NI2A 3M3JA 1DOXA 4DHJD 3RNGC 3GOEA 1VJKA 4ANWA 1EU3A 3PHXB 2N9PC 3NZUA 3ZRCA 2AL6A 1NI3A 1E9MA 4AJYB 4HVBA 1IUEA 4K7SA 2JF5A 5H92C 1F2RI 3W5UB 3UQBA 4I6NB 2RDBC 3BY4B 4GIVA 1AWDA 1WMHA 3BIID 1SE2A 4ZDVA 2M17A 4WWMA 3RZFA 2INNE 4NAMA 2OOBB 3DOWA 3PRZA 4II2B 1XLNA 4RGNA 4MM3A 2KQ7A 2NMQA 3C19A 3CIRB 5IOIA 4W9DA 3WANA 2FIDA 4RM8A 1E5WA 2OHFA 3Q8BA 4OW0A 3AE2B 1TTNA 3A4SC 2MSED 1X1MA 3VTUA 1MPEA 2DAJA 2R61A 4GOCA 4BZAA 2LI5A 1T0SC 2DZJA 4BKSD 3TMPB 1I4PA 2ACZB 2X8XX 2K9XA 2D2QA 4ACFA 3RFZB 4DXGA 1FD6A 1XLOA 4XE0A 1KLUD 1OQQA 2IGGA 4A9AA 2BF8B 1FCCC 2L1AA 1VCBA 3UIOB 3V60A 1FEHA 1E6EB 4YWGG 4PYUA 1J7AA 3IG3A 2N0SB 2PPHA 4KIKA 4MJSA 1E8WA 1IBXA 3TL5A 4ZYNA 1JWMD 2AL3A 3H7PB 4XGAB 2QDFA 3VTVA 2TSSA 5BYQA 4IWQA 2KJRA 2DYMA 2QEJC 1I4QA 3BWUD 1E8XA 3AEFB 2BTEA 4FJVB 2WWZA 2PTLA 1WGGA 2BT6A 1R7SA 1STEA 1OEYA 5IA7A 1C76A 1GC6A 2H89B 2I38A 1VD2A 2IO3B 4HDOA 2MW5A 3VH3B 5EE1A 3KUDB 2LASA 3MFGA 2GOWA 5TSSA 1E8YA 2KD0A 1CMXB 3M62B 2FUG1 1JRUA 5LXIB 4WH4A 2V3NA 5CHVC 3ECIA 4RGTA 1E7UA 3HM6X 3Q3JA 5G55A 2O6VB 1EWYC 2KYWA 4LDTD 1YIWA 1EU4A 3ZDTA 1SXTA 4JGHB 1T0YA 5MPOA 4RGMA 1XEEA 2Y5PA 3W5VB 2RD0A 4IW0A 2DX5B 4XWTA 3EC8A 5BO4B 3R7QA 2OEDA 1T0QC 3BVGA 5EDSA 1TT5B 4MM3B 3KH0A 1WRDB 4FBJB 2ASQA 3U30A 3IT6B 4MT5A 1KJTA 1GG3A 3GP7A 2KNBA 4NZLB 5HHDG 2JZZA 2QIEB 4OZBA 1I35A 2XN9C 3PSEB 3RT3B 2AQ3B 1XD3B 4CO7A 1V86A 4EZKA 4N58A 3EUB2 3TSSA 1JQ4A 1OEYJ 2KOXA 5HFYA 3CWIA 1CJEA 3ZNZB 4W9GA 2NBVB 3JSVA 1CQVA 1MG4A 2KLGA 5G2NA 1RWSA 2ZW1A 2IY0B 2GI9A 2HJ8A 3QARA 3SFEB 2BS4B 4HKZE 3IAS1 4PS3A 2KO3A 3EHVA 4EE2A 1Q5WB 3URYA 3KW5B 2V3PA 3IVFA 4F1SA 3VXWA 3BK2A 1NYRA 1TKGA 3DBHB 1N63A 1GB1A 1V8CA 4TQ0A 3TEZA 1ISNA 3KUCB 4RF0A 5TR5A 4KKJA 1RFKA 1BT0A 1I4GA 1WXAA 2WX0A 4BFRA 3NZSA 1I4RA 2KDMA 2L8JA 3MC9A 3HK0A 1WJUA 2BBCA 2WXLA 3ENEA 5IAAC 1PFDA 3EFUA 1ZW7A 4CHKA 3KYCD 3JSVB 2JVCA 4WAFA 4G3XB 1D5ZC 1J8CA 3VAWA 1KH0A 1JWSD 2NR2A 4NY0A 1TS3A 2YLMA 2W3SA 4G50A 3QC8B 1C9FA 1WFYA 3Q8CA 4GDLA 3K9OB 3QQ8B 2WDRB 4DHZB 4OHJA 3DBLB 2YEPF 1NDDA 2JT4B 3A9KB 4W9EA 1GB4A 2B76B 4S17A 4J3OD 2BWES 1QT9A 4YSYB 2G9HD 4YTNB 1ZKHA 3RYTA 4LDTB 4N6EB 1TS5A 2ZVNA 4F7ZA 2KLCA 2O6VD 5T8IA 3DQVA 4ZRJA 2KFKA 3BVMA 4ARCA 3WAOA 4W9KA 2D3CA 2CJNA 4A3PA 4WIPA 1RFAA 2VH2A 2WXFA 3VVWB 1AARA 1FNVA 2WS3B 3NRZA 4MSMB 4AP4C 3A1QB 4DHZE 2D07B 4AS1A 1N5WA 1QLBB 3IAM1 3Q3NC 1JRPA 2IGHA 3UIPB 1VR9A 1SSNA 2L0FA 2WDQB 2XNAC 4DWFA 1TKYA 1FIQA 3ETRA 1FXIA 3ZGZA 2PVGC 1ROEA 3U52E 4R3DA 3JW0X 2R2OA 2KFJA 3JVZX 3P4RB 4PT5A 3AN1A 2ZPYA 3DWMA 2LEKA 1KLVA 3B2GA 3N9YC 5JH5C 1GC7A 2LHDA 1MI0A 2JUOA 1J19A 3AEDB 4OZAA 2B3AA 3RN9C 3HUIA 3QJZA 1WWTA 2WXMA 5HI1A 2JU6X 1LO5D 4ZRIA 3Q8EA 2J42A 3AMZA 3IFWB 3GZNI 5IP4D 1NBFC 4NJCA 1FXTB 3L4PA 4KZ0A 1XLPA 4NNJB 4MH8A 2K8HA 4P1BC 4LK0M 4US8A 3DDCB 1RM6C 1TJEA 5AUIA 2N9XA 3HM3A 3H1UA 1WYGA 3QA8A 4EFOA 1YJ1A 4YL8A 4E3CA 2BGFA 3W2DA 4FJZA 4AUQC 3X23A 1WJNA 2DZKA 3W1SA 4XYCA 4BVUC 3D32A 4RCOA 1IYFA 2PJHA 5FKAC 1D4BA 5HG2A 3OAWA 2WXOA 2QILA 1ET9A 4II3B 4TMAB 2Z0EB 5EE9A 4A90A 1B1ZA 1UBIA 2DYOA 3APFA 1WXMA 4KKIA 4WJPA 1C77A 1V81A 1QILA 1IGCA 3Q2AC 1EF5A 2HJ1A 1SB3C 1MG8A 2KHWB 5IO9A 4B6WA 4RM9A 2GMIC 1TZ1A 2CU3A 2J4XA 3AE4B 3NVYA 3RI7C 1YN4A 4MGYE 5C2TB 2JWUA 3MTNB 3NUHB 3AE1B 1IGDA 4NQKE 2RMMA 4WQOB 2LMCA 3V6CB 3QHTA 1JALA 3A9JA 4MSQB 1WXVA 3TBLD 2BB5A 1P9DU 3NHEB 2FCSA 4TV3A 3VRBB 2LXCA 1WMHB 4C7ZA 3U2SC 2FCNA 3DWGC 3RZWC 2LUEA 2J0KA 3KLSX 3AU5A 4G11A 4C56C 2RDGA 2KXJA 3QAQA 2PW9A 1YOVB 3VDZA 4HCNB 1WH3A 5BMGA 2WU5B 2KWDA 4C4VB 4JIOU 3RMKC 2W54A 1TYGB 3A1QA 5IN7A 2MJDA 3SEBA 5G5GA 1TIFA 3QIJA 3WCQA 2PKOA 1L6UA 1ZPSA 2KMCA 1K51A 4KV2A 2Z8LA 2DYBA 2LRWA 1ET6A 1XLQA 2DBYA 4WURA 2N7JA 1YJIA 1M4VA 1S1QB 1E90A 2CJOA 2ZCBA 1SIJA 1Y8RC 3H8HA 1JWBD 2J53A 3QCAA 5GMVA 3QX1A 1YX6B 4M0WA 2KWUB 5D94A 1QQRA 3H9DA 4USAA 4A8XC 4WJNA 2N9LA 2L0TA 3ZDMC 5JZEB 3DHHC 1Z2MA 2LJIA 2RR9A 2R2QA 2Z0DB 4MDKE 4EEWA 4XDDA 1WGYA 1GPXA 1SF0A 5EE0A 3TEWA 2KQ4X 2WXIA 5FK9C 4QAYA 1D5MC 2Y3AA 3WA0A 3AE7B 4MEMA 2M19A 1ACCA 1ZDVA 3UINB 1V6EA 4HCPB 5AZFA 1YJJA 2Y5BB 1F52A 1QOFA 1P0RA 3KYDD 4BKGA 3OJ4B 2KK8A 5LNK1 1Q10A 1WZ3A 2I1KA 3BZDB 2JYTA 2G4SA 3RNBC 1UWXA 2JYEA 2EKIA 4HPMB 4A6QA 4AWJA 2MEKA 3I63C 2L7RA 2N7EA 5E6NA 4KGTA 1SE3A 4IG7B 2I1JA 2SEBD 1DYQA 3ZTDA 2GLSA 2C7MB 4GDLB 1MHXA 3DBRB 1WX7A 5J18A 4BAXA 2WP9B 1WZ0A 2L05A 3P4SB 2IYDB 2OJWA 2EMSA 1L6VA 4KZCA 4DK5A 4F8CB 3Q3MC 4ITKA 3ZUNA 3N30A 1I4HA 2K8CA 1YX5B 3Q14C 4KGSA 3ML8A 5BMIA 1K50A 1JROA 2KVRA 4S0RA 2WXQA 2NBUA 2E3TA 2DHZA 4K3BA 4JL9A 3L10B 4MELA 2LVOA 1DGJA 1WGKA 3NY5A 2IDYA 1WXSA 2ZNVB 3APDA 2KDEB 2BPSA 4PS7A 3N3KB 3V3XA 5E6PA 2WXPA 1XT9B 4KVGB 1P3QU 3OWEB 4HKQA 3I3TB 4URKA 4MGKE 3PLUA 4D2KA 5CHWA 3LB8C 2K3UA 3PTFC 5AUKA 4JE3B 3L54A 4HRSA 3ZYYX 1XQQA 3Q3FA 5BYSA 1V9JA 2Z59B 4P7IA 1V1PB 2MBOA 3L17A 2ZNVC 2LVQA 3TUOA 3IHPC 2N9KA 2JRIB 2IZVB 3AM9A 1K53A 4HXDA 4HROA 3T3OA 2K8BA 4ZHOA 1QF6A 3NS8A 3PGEA 2BYEA 2INPE 3B9JA 2ZCCA 5DPWA 4NJ7A 1GAQB 2AEHA 3FILA 2MHJA 4REZA 1EUVB 2V0GA 4EZLA 2K6QA 3MC8A 5H8YE 2ZVOA 4ARIA 1P98A 1BXTA 1VDVA 4KSLC 1WGDA 1PGAA 2IY1B 4TUUA 3KWLA 2FBWB 2PVOD 1N60A 1AN8A 2WQYB 3ZNGC 1XXGA 4GGQA 2INDC 1UF0A 2GBNA 2L3ZA 4IWOA 3Q6BA 3OLMD 5E6JA 3V62A 4KGRA 3CSFA 3ZJTA 2KTRA 4BKTA 5EE3A 1MFWA 1I4XA 2NPTB 1P7FA 2MH7A 2LGIA 4W9FA 3RNAC 3EFCA 2QSDA 2KKCA 1K8RB 1GNUA 4KDLB 4RMAA 1R4NI 3ZVVA 3AH7A 1D3ZA 2REXA 1M94A 2LJ5A 3B0AA 3A9KA 3NJTA 4B0EA 4K81A 5D3IB 3HIZA 3I5JC 3AECB 1YQ4B 1J7CA 3ZW3A 2MJ3A 1UWMA 3WAMA 1C79A 1NENB 3ZTCA 4HJKA 2WYQA 4M8MA 2JY6A 3AE5B 4CYEA 2CHWA 3B2FA 2D5GA 1C4AA 4PYZA 5DCNA 3N1XC 3R3MA 1FNWA 2LD9A 3B08A 1WR1A 3BYTB 1PQSA 2LWPA 2MCNB 2D10A 2WGSA 2LRUA 2XEWA 1OGWA 1K52A 4GDKA 3KQ4A 1LGRA 1E7VA 3RNEC 2WU2B 4NAWB 3GZNB 3RD2A 1FCLA 2LFIA 1NYQA 4WJQA 3VR8B 1HA5A 3ZIMA 3ZJUA 3W1YA 2Y5CA 3AE3B 4BBNC 5CX3A 4AOFA 1HE8A 3PV1A 3MJWA 1YMHE 3P1MA 5G5HA 4ICUA 3TEYA 3PT2B 3C0RB 4XX5A 2KTFA 3Q69A 4WJOA 3S2AA 4BOSC 1AYFA 2RPQA 2IBIB 2JZ3B 1ESFA 2CR5A 1DOYA 1KM7A 2DAFA 3X0WA 3V05A 2KDBA 2CHXA 4RH6A 1EO6A 2FCMA 4DDGD 4G0NB 3R8BA 2HD5B 3I57A 2H88B 3ZRFA 2KN4A 3VUYA 3TEXA 1Y56A 4EZJA 2NTTA 3Q3OC 3PVLA 3Q8AA 3U7ZA 1YN3A 1V1PA 4HDQA 4K1RB 3C8YA 2DWQA 4MGIE 1UZXB 5KHQA 5C23A 1S3SG 2VZKB 2XK5B 3V61A 2MA9B 1VZ8A 3NS1A 3SFDB 1GJZA 1D5XC 4WQMA 2UWQA 1N62A 1T6BX 2NCNA 2E6XA 1F9JA 1QZEA 1HZ5A 2KZRA 2LGXA 2AYOB 4HPLB 4RFBA 1FMAD 3U8ZA 2BYVE 4A20A 4BOZB 2IO1B 1CZPA 2K0PA 4KIKB 3CSTA 4M01A 4IM0A 2RSUA 4K3CA 4DBGA 2EKEC 3OJ3A 3T8MA 5E6OA 2MX2A 1UD7A 5L83A 1GOZA 1C3TA 2ZEQA 4XZ4A 3UF8A 2WXHA 4L23A 3ZLZA 2NPTA 1TGZB 4OVZA 1CK1A 2KWVB 2LGSA 4N9F4 3BK1A 2MP2B 4K7WA 1VLBA 1WE7A 3IT4B 1MHHE 3ZNID 3ZXRA 3H6NA 1C4CA 2X38A 4W9LA 3GE8C 1SEBD 2K39A 1LM8B 2RPVA 1YQ3B 2GBJA 2WXKA 2HE7A 3A9JB 4MGZE 1UNSA 3AEEB 2WDVB 3APCA 4NAWA 3TIXA 3ABVB 2W55A 3AV8A 2RGFA 3FILB 4HLEA 3DBSA 4RGOS 5DPSA 2G1EA 2INCC 4YSXB 3R2TA 2KFKB 4C00A 2XBBC 1WRIA 2QCZA 1PGXA 4FULA 4E74A 2WHIA 4Q2JA 2ONQA 1UGMA 4LNKA 4C7YA 3NVZA 3U4EG 2JXXA 4ASWC 2A5UA 5C3JB 4JX1C 3NOBA 2J0JA 1ZP0B 5LXHA 2WXNA 4A3OA 5J17A 2M0XA 1N5XA 3RPFC 5L95C 4MH0E 3ML9A 4IWPA 2GRIA 2KC2A 3EA6A 2VRRB 1SBBB 3SD5A 3ZXVA 3L16A 4GU2A 4K7UA 3HHMA 1HQRD 2BKRB 2G45B 1E10A 3A33B 4I6LB 4FLHA 5BYRA 3N1YC 1F1HA 2K5PA 2KMMA 2BS2B 4US9A 1WX9A 2L76A 2M4NA 2QJLA 2L83A 1WE6A 2GBRA 1AW7A 2HDEA 3ONSA 1E8ZA 5AZHA 2PIAA 3T9LA 1T3QA 1FNUA 3VUWA 1SGHA 3AI5A 3PS6A 5IKCM 3HVZA 1TKEA 1KF6B 4O1NA 3IXSA 1L2NA 3KWVA 2FNJB 4IC7B 4P16A 3HVDA 3N20C 4DQOC 2A4ZA 1OQYA 2MJEA 4FA6A 1JW9D 2YVCA 2KC1A 4WWPA 4JWSC 1VZ7A 2M56B 2KDIA 1WF9A 1KFYB 1VRAB 2V9HA 2BS3B 3NG0A 2EELA 2MLBA 1L4ZB 1RYJA 3WALA 3EECA 1T5XD 2KAJA 2IJ0A 4H2AA 1PUTA 3AE6B 3E56A 2FUHB 2M1MA 3DPDA 4KSKC 2KVZA 2FCQA 1J0GA 5KHOA 4EOYA 3VRAB 3WIMA 2D11A 1R4MI 4PS8A 2KX0A 4YTMB 2ZW0A 3RNFC 4ZYSA 2LGDA 1FRRA 2C60A 5JXVA 1L5PA 2AX5A 1L7YA 3O65B 4FHJA 5D6JB 2EMTA 4LNNA 4DXAB 1QOGA 4DXFA 2MBEA 3UI3A 4EUTA 1RAXA 2FAZA 4W9JA 3AXCA 1A70A 3LYYA 3M63B 1ENFA 1ZGUB 2K22A 4OZCA 2KWCA 2BW2A 2IGDA 4ICVA 4WAAA 4RNAA 4W9CA 1C4PA 4P1CC 3DCGA 1XO3A 2LGYA 2PE6B 3H7PA 2KX3A 3J9CA 4FXCA 2DZIA 1MVKA 2IPKD 3AE8B 4GDKB 2VZKD 3T3NA 2BYFA 5DPRA 1Z5SB 2IO0B 2WDTB
chains in the Genus database with same CATH topology
2LHEA 2J42A 3AMZA 3AEGB 4UDUC 1ZOYB 5I4DA 1UGJA 1EM7A 2RDHA 4YXDB 3AH7A 3MP9A 4NJCA 4MACA 3L4PA 1NEKB 1YN5A 2L32A 1L4DB 1XLPA 4B0EA 1E7PB 4MH8A 4IDIA 5D3IB 3AECB 1YQ4B 1J7CA 4LK0M 4US8A 2MJ3A 1UWMA 3AEAB 3MC0B 1C79A 1KRHA 1NENB 1RM6C 1UUPA 2BB6A 5BMHA 1TJEA 2W3RA 5AUIA 3AE5B 4ZRPA 1VZ6A 4XDCA 3AEBB 3B2FA 1WYGA 3MHZA 4L2YA 2FE8A 4YTPB 2D5GA 1C4AA 2JSVX 4P6VF 4ZRQA 1DOXA 1VJKA 3W2DA 1EU3A 3FAHA 1FNWA 2PLPA 1NI3A 1E9MA 3BYTB 3W1SA 4RCOA 3PO0A 1IUEA 5H92C 1F2RI 3W5UB 2M0AA 5FKAC 1D4BA 1TS4A 1AWDA 4IKGA 5HG2A 2WXOA 3BIID 1SE2A 4LLGM 1K52A 2QILA 1ET9A 3KQ4A 4LTUA 4WWMA 2INNE 2SAKA 2WU2B 4NAWB 4NAMA 4TMAB 1FCLA 2LFIA 5EE9A 1NYQA 1XLNA 4RGNA 3VR8B 2QMTA 1HA5A 4A90A 3ZJUA 1B1ZA 1TS2A 2NMQA 2Y5CA 3AE3B 2DYOA 3CIRB 1ZXHA 4AQ7A 1YMHE 4KKIA 2OHFA 3P1MA 5G5HA 5GXGB 3TEYA 3Q8BA 1C77A 3Q69A 1QILA 1IGCA 4OW0A 5FR3A 3AE2B 1AYFA 1B9RA 1XF5L 1ESFA 1SB3C 1DOYA 1MPEA 3V05A 2R61A 2WLBA 4RH6A 3GS2A 2CU3A 2J4XA 3AE4B 3NVYA 1YN4A 5C2TB 3R8BA 3I57A 2JWUA 3NUHB 2H88B 3AE1B 2KN4A 1IGDA 4GLSC 1DOIA 1I4PA 2ACZB 3TEXA 1Y56A 2K9XA 2RMMA 3NVVA 2LMCA 2NTTA 2HTME 2Q5WD 3Q8AA 3U7ZA 4DXGA 3RFZB 1FD6A 1YN3A 1V1PA 1JALA 1OQRA 1XLOA 1NVID 2DWQA 3C8YA 4XE0A 1KLUD 1OQQA 2IGGA 1JWAD 4A9AA 2BB5A 2NTSA 2JQRB 1PGBA 1FCCC 4IOIE 3VRBB 2VZKB 2DLBA 3AE9B 4C7ZA 3U2SC 2L1AA 1EWCA 3DWGC 1VZ8A 4ZHPA 2WXGA 4C80A 3NS1A 1WSPA 3SFDB 1FEHA 3KLSX 1E6EB 4YWGG 1D5XC 1E0ZA 4WQMA 4C56C 1F2RC 1ZE3D 2RDGA 1N62A 1T6BX 1J7AA 2N0SB 2E6XA 1HZ5A 2PW9A 1IBXA 3MJ5A 5BMGA 2WU5B 2KWDA 4RFBA 1FMAD 1JWMD 2W54A 1TYGB 2TSSA 2MJDA 5BYQA 2DYMA 2QEJC 1CZPA 2K0PA 1I4QA 3SEBA 3BWUD 3NVWA 5G5GA 3AEFB 2BTEA 3WCQA 2PKOA 2PTLA 2WXJA 1L6UA 1P7EA 1ZPSA 2BT6A 1GOZA 1K51A 1R7SA 2Z8LA 1STEA 1C76A 2H89B 2I38A 1ET6A 1FFUA 1XLQA 2DBYA 2WXHA 4WURA 4L23A 3VQIA 2N7JA 1YJIA 5EE1A 1M4VA 3MFGA 2CJOA 5TSSA 1SIJA 3H8HA 1JWBD 1CK1A 2FUG1 2J53A 4OVZA 2ICIA 3AB5A 4WH4A 3W9CB 2V3NA 4RGTA 2BYTA 2AQ2B 3BK1A 4M0WA 1JCKB 1QQRA 1ZXIA 1VLBA 4USAA 1EWYC 3IT4B 1MHHE 4A8XC 4B0MA 3NZ3A 2J52A 2N9LA 1F0ZA 1EU4A 1WXQA 1C4CA 2LJIA 1SXTA 1J7BA 2X38A 5MPOA 1SEBD 4RGMA 1XEEA 2Y5PA 3W5VB 1YNTE 2RPVA 4XDDA 1YQ3B 2GB1A 4XWTA 1GPXA 1SF0A 5EE0A 3TEWA 2WXKA 2JX5A 2KQ4X 2WXIA 5FK9C 4JWUC 1D5MC 2Y3AA 3AE7B 2OEDA 2M19A 1ACCA 1TZOA 1ZDVA 3BVGA 1UNSA 4XWWA 4MM3B 2YEPB 3AEEB 1YJJA 3IT6B 1QOFA 2WDVB 4MT5A 3BYYB 3VR9B 3ABVB 2W55A 3GP7A 3HRDD 4NZLB 3AV8A 5HHDG 1TY2A 1L0VB 3FILB 2QIEB 4OZBA 2XN9C 1QKZA 5LNK1 2AQ3B 4RGOS 1Q10A 1V1OA 2AQ1B 3BZDB 2JYTA 4HJGE 2G1EA 4N58A 3EUB2 1UWXA 3TSSA 2JYEA 2EKIA 1JQ4A 4YSXB 5HFYA 3CWIA 3R2TA 4A6QA 1CJEA 1PYWD 2MEKA 1WRIA 2ON8A 1CQVA 1PGXA 4KX6B 4KGTA 1RWSA 1SE3A 2SEBD 2ZW1A 1DYQA 3R2IA 4Q2JA 4GDLB 2ONQA 1N61A 4C7YA 3PZ8A 3NVZA 1MHXA 2W82A 3U4EG 2GI9A 2JZPA 3SFEB 2BS4B 1FXAA 2WP9B 2WXRA 4HKZE 4YSZB 4N59A 3IAS1 5C3JB 4JX1C 1BUIC 1ZP0B 3P4SB 4EE2A 1HXYD 1L6VA 3URYA 2V3PA 1QOAA 1JWUD 4ITKA 1I7HA 1PDXA 2WXNA 1I4HA 3BK2A 1NYRA 1TKGA 4KGSA 1N63A 1N5XA 3RPFC 5BMIA 1GB1A 1ZDXA 1V8CA 1K50A 1JROA 4TQ0A 3TEZA 2GRIA 2WXQA 4RF0A 3EA6A 2E3TA 4KKJA 1SBBB 1RFKA 1I4GA 3P42A 1HEZE 1I4RA 2KDMA 1HQRD 1DGJA 1WGKA 1E10A 2IDYA 2BBCA 2WXLA 5BYRA 1FFVA 4US9A 2K5PA 2KMMA 2BS2B 1SJED 3P4QB 4YT0B 5D3DA 2QJLA 2L52A 3V3XA 2L83A 1PFDA 1KLGD 2WXPA 1AW7A 2HDEA 3OWEB 4HKQA 2I2YA 2PIAA 1T3QA 4D2KA 1FNUA 3LB8C 4WAFA 1IBXB 2K3UA 3O13A 1D5ZC 1ZUD2 2WNMA 5AUKA 1KH0A 3I9V1 3HVZA 1TKEA 2LUMA 1JWSD 1KF6B 3IXSA 3P4PB 4JE3B 4O1NA 3KWVA 4HRSA 1TS3A 3ZYYX 2W3SA 3LXFA 4P16A 3HVDA 5BYSA 4DQOC 1V1PB 1C9FA 2MJEA 1JW9D 3Q8CA 1SE4A 3TUOA 5D7GA 3E9SA 4JWSC 2WDRB 1VZ7A 1FRDA 4OHJA 2PMVA 2M56B 1BMLC 3SR6A 2N9KA 2YEPF 1KFYB 1VRAB 1GB4A 3AM9A 1HZ6A 2BS3B 1K53A 2B76B 4HROA 3T3OA 4J3OD 2EELA 1QT9A 1L4ZB 4ZHOA 1RYJA 1QF6A 3PZ7A 4YSYB 2G9HD 4YTNB 2INPE 3B9JA 1T5XD 4L1BA 4RF1A 2KAJA 2IJ0A 4H2AA 1TS5A 1PUTA 3AE6B 3E56A 4N6EB 3FC4A 3ZJVA 1KTKA 1GAQB 5T8IA 3FILA 2KACA 4HEA1 3VRAB 3BVMA 4REZA 4ARCA 2CJNA 2V0GA 4WIPA 2V4IB 1XCQL 2ZW0A 4YTMB 4ZYSA 5H8YE 1FO4A 4ARIA 2WXFA 1BXTA 1FNVA 2WS3B 1VDVA 1FRRA 3NRZA 5JXVA 1L5PA 2AX5A 4AS1A 1FM0D 1N5WA 1QLBB 3IAM1 4ZOHC 1F77A 1L0XB 2IGHA 1JRPA 2JXTA 1PGAA 1SJHD 1VR9A 1SSNA 1QOGA 2WDQB 2XNAC 1TKYA 4DXFA 1D6EC 1C78A 3KWLA 2FBWB 1V97A 1FIQA 4TSSA 2PVOD 3UI3A 1N60A 3ETRA 3Q8FA 1FXIA 1AN8A 3ZGZA 4JPSA 1TY0A 2PVGC 2WQYB 1ROEA 3U52E 4R3DA 1XXGA 1A70A 3LYYA 3P4RB 4PT5A 3AN1A 4A55A 3DWMA 1ENFA 2LEKA 2K22A 3B2GA 4OZCA 1JMLA 3N9YC 4CQNA 3P63A 3ZQ4A 3GB1A 2BW2A 4TQ1A 2IGDA 5E6JA 4KGRA 2LHDA 4RNAA 1MI0A 3AEDB 4OZAA 1C4PA 1QOBA 3HUIA 3ZJTA 1XO3A 5EE3A 1OFFA 1WWTA 1I4XA 3J9CA 1XCTL 4FXCA 3BVZA 2WXMA 5HI1A 1P7FA 2JU6X 3EGRA 1MVKA 1L0YB 1LO5D 2IPKD 2LGIA 2MH7A 3AE8B 4GDKB 2VZKD 3T3NA 3Q8EA 2QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ B;  2M19 A;  2K9X A;  3AMZ A;  1KF6 B;  3P4P B;  3AEG B;  3NVV A;  1ZOY B;  4HRS A;  2HTM E;  3ZYY X;  2W3S A;  2Q5W D;  3LXF A;  3AEE B;  1YJJ A;  4YXD B;  1JAL A;  1OQR A;  1QOF A;  1NVI D;  1XLO A;  2DWQ A;  2WDV B;  3AH7 A;  3VR9 B;  2MJE A;  1NEK B;  3L4P A;  1OQQ A;  3ABV B;  2W55 A;  1JWA D;  1JW9 D;  3HRD D;  4A9A A;  2JQR B;  3AV8 A;  1L0V B;  2QIE B;  1XLP A;  3VRB B;  1E7P B;  4JWS C;  2WDR B;  1FRD A;  4IDI A;  3AE9 B;  4C7Z A;  3DWG C;  2M56 B;  3AEC B;  4ZHP A;  1YQ4 B;  1J7C A;  3SR6 A;  4US8 A;  1KFY B;  2G1E A;  2MJ3 A;  4N58 A;  3NS1 A;  1UWM A;  3AEA B;  3EUB 2;  4C80 A;  3AM9 A;  3SFD B;  1NEN B;  1KRH A;  1RM6 C;  2BS3 B;  1E6E B;  2B76 B;  2EKI A;  4HRO A;  4WQM A;  1TJE A;  2W3R A;  1E0Z A;  4YSX B;  1JQ4 A;  5AUI A;  3CWI A;  1N62 A;  3AE5 B;  1QT9 A;  1CJE A;  1J7A A;  3AE7 B;  1RYJ A;  2N0S B;  4ZHO A;  4YSY B;  4YTN B;  1QF6 A;  3AEB B;  3B2F A;  3B9J A;  1WYG A;  1WRI A;  4YTP B;  4KX6 B;  2KAJ A;  4P6V F;  2WU5 B;  1PUT A;  3AE6 B;  1RWS A;  4N6E B;  1DOX A;  1FMA D;  3FC4 A;  2W54 A;  1GAQ B;  1TYG B;  1VJK A;  1N61 A;  4C7Y A;  3VRA B;  3NVZ A;  2MJD A;  3FAH A;  1CZP A;  2CJN A;  3SFE B;  3NVW A;  5G5G A;  4YTM B;  1NI3 A;  1FXA A;  1E9M A;  2BS4 B;  2WP9 B;  3AEF B;  3WCQ A;  4N59 A;  5H8Y E;  4YSZ B;  3PO0 A;  1IUE A;  1FO4 A;  5C3J B;  2PKO A;  5H92 C;  3W5U B;  4JX1 C;  2WS3 B;  1VDV A;  1FRR A;  1L6U A;  3NRZ A;  1ZP0 B;  1L5P A;  2AX5 A;  2BT6 A;  3P4S B;  1AWD A;  1FM0 D;  1L6V A;  3VR8 B;  1R7S A;  3BII D;  1QOA A;  1N5W A;  2H89 B;  1QLB B;  4ITK A;  1I7H A;  1PDX A;  4ZOH C;  1JRP A;  1FFU A;  1XLQ A;  2DBY A;  4LTU A;  4WWM A;  2WDQ B;  1QOG A;  2WU2 B;  1NYR A;  1TKY A;  1TKG A;  1N63 A;  1N5X A;  3RPF C;  1YJI A;  5EE1 A;  1NYQ A;  1V8C A;  1XLN A;  1V97 A;  1FIQ A;  1JRO A;  2FBW B;  2CJO A;  2PVO D;  3KWL A;  1N60 A;  1SIJ A;  3ETR A;  2Y5C A;  1FXI A;  3AE3 B;  2E3T A;  1JWB D;  2PVG C;  1ROE A;  2WQY B;  3CIR B;  1RFK A;  1A70 A;  3AB5 A;  3W9C B;  3P4R B;  3AN1 A;  3DWM A;  2LEK A;  2K22 A;  3B2G A;  1ZXI A;  1VLB A;  2OHF A;  3P1M A;  1EWY C;  4USA A;  1DGJ A;  1WGK A;  3P63 A;  5G5H A;  5GXG B;  1E10 A;  3AE2 B;  1F0Z A;  1AYF A;  1B9R A;  1FFV A;  4US9 A;  2K5P A;  2KMM A;  2BS2 B;  1WXQ A;  3AED B;  3P4Q B;  4YT0 B;  2QJL A;  1QOB A;  2L52 A;  1J7B A;  2L83 A;  1XO3 A;  1SB3 C;  3HUI A;  1PFD A;  1DOY A;  5EE3 A;  1OFF A;  1WWT A;  5MPO A;  5EE9 A;  4FXC A;  2WLB A;  3W5V B;  2PIA A;  1T3Q A;  2CU3 A;  3AE4 B;  3NVY A;  3LB8 C;  1YQ3 B;  2MH7 A;  3AE8 B;  1GPX A;  1SF0 A;  5EE0 A;  2JX5 A;  5C2T B;  1ZUD 2;  4JWU C;  5AUK A;  2H88 B;  3AE1 B;  3HVZ A;  1TKE A;  1DOI A; 
#chains in the Genus database with same CATH topology
 2LHE A;  2V4L A;  3AEG B;  3L13 A;  1ZOY B;  4FHK A;  4UDU C;  5I4D A;  4TKN A;  2RDH A;  3MP9 A;  1NEK B;  2BKF A;  3PRP B;  1E7P B;  4NQL B;  3LJ3 A;  2V3S A;  1G6J A;  4WWO A;  3AEA B;  3JYU A;  5BMH A;  1KRH A;  1UUP A;  2K1F A;  2BVC A;  4IUM B;  4LNF A;  2UYZ B;  1VZ6 A;  4XDC A;  2N4F A;  3MHZ A;  3SHQ A;  4P6V F;  4ZRQ A;  2W9N A;  2N1V A;  3FAH A;  2PLP A;  2IO2 B;  3DHG C;  1WI0 A;  3PO0 A;  2M0A A;  1TS4 A;  4JQW C;  4IKG A;  1RRB A;  4LLG M;  2C9W B;  4B9K A;  4LTU A;  2SAK A;  2LXA A;  2QMT A;  3CMM B;  5D2M B;  1TS2 A;  2DZM A;  2K6D B;  2MRP A;  1Q0W B;  3PLV A;  1R4N B;  1ZXH A;  2O2V A;  4AQ7 A;  1SIF A;  5GXG B;  3KVF B;  1WGR A;  2AWT A;  5FR3 A;  2CS4 A;  1B9R A;  1XF5 L;  2MWS B;  5C1Z A;  3PRM B;  2N1W A;  1WX8 A;  2PE9 A;  1V5T A;  2WLB A;  3GS2 A;  1WJ6 A;  2KAN A;  1A5R A;  4HWI B;  1H8C A;  4B95 A;  4WWN A;  4GLS C;  1DOI A;  4LCD E;  3ZKJ C;  3NVV A;  3VTW A;  2HTM E;  2Q5W D;  4X57 B;  1OQR A;  3GE3 C;  1NVI D;  1R4M B;  3AU4 A;  1JWA D;  3DVG X;  2NTS A;  2JQR B;  1PGB A;  1UH6 A;  4IOI E;  2DLB A;  1I42 A;  3AE9 B;  3WAP A;  1EWC A;  3QK0 A;  2XK5 A;  1LXD A;  2MBH A;  4ZHP A;  4HPP A;  2JPH A;  2WXG A;  4C80 A;  1WSP A;  4FAD A;  1E0Z A;  2C7N B;  1F2R C;  1ZE3 D;  3L08 A;  3DHI C;  2C7H A;  3W1S C;  3MJ5 A;  2O2V B;  3ZO5 B;  1IP9 A;  4GMV A;  4C4V A;  4HK2 A;  3AUL A;  2FIF A;  3NVW A;  3DBH I;  3A4R A;  2WXJ A;  2N9E B;  1P7E A;  1MJD A;  1FFU A;  5CTR C;  3U7D A;  4M0W B;  2KDF B;  3VQI A;  3K9P B;  4J6I A;  1HTQ A;  4ANV A;  2NS5 A;  5AEK B;  3CF6 E;  2ICI A;  2M8S A;  1V5O A;  3AB5 A;  3W9C B;  2BYT A;  2AQ2 B;  1JCK B;  1ZXI A;  3ZNH B;  2J7Q B;  1V80 A;  2BQQ A;  4B0M A;  3UGB B;  3NZ3 A;  2J52 A;  1F0Z A;  1WXQ A;  1SE9 A;  4IM3 A;  1J7B A;  1LFD A;  4FJY A;  4OVU A;  2D3B A;  3SDL C;  2KMA A;  2LVP A;  3KUZ A;  1YNT E;  3TJP A;  1V49 A;  2GB1 A;  4W9I A;  2JX5 A;  4JWU C;  1V2Y A;  3VFK A;  1TZO A;  2N7D A;  3DBL I;  2DNF A;  4GXB A;  5DPT A;  4XWW A;  2YEP B;  2NVU I;  4E71 A;  2WX1 A;  3VHT C;  3BYY B;  5JHA A;  3VR9 B;  5CHF A;  3HRD D;  1TY2 A;  1L0V B;  2C5L C;  1QKZ A;  1V1O A;  2AQ1 B;  5J2R A;  3BIN A;  3OG5 A;  4HJG E;  3TCA A;  2CU1 A;  3IBE A;  2D3G A;  4AJW A;  3DBR I;  3R66 C;  4FN2 A;  1PYW D;  2MQJ A;  2ON8 A;  4KX6 B;  2KN5 A;  3B1L X;  3SU8 X;  1UBQ A;  3PHW B;  3R2I A;  1U4A A;  4ANX A;  1N61 A;  3PZ8 A;  2W82 A;  2HTH A;  4NPN A;  2JZP A;  1FXA A;  3V6E B;  2WXR A;  4YSZ B;  4N59 A;  3P2B A;  2KTR B;  4JLC A;  2O6V A;  1BUI C;  1EF1 A;  1HXY D;  3DVG Y;  4I6P A;  2G4D B;  1QOA A;  1JWU D;  4BKS A;  1I7H A;  1PDX A;  2ZZP B;  3ALB A;  5LLI A;  1ZDX A;  4W9H A;  2PEA A;  2D3A A;  2JRH A;  3VUX A;  2KQS A;  4LNI A;  3P42 A;  1HEZ E;  4PK1 A;  1HTO A;  1RLF A;  1C1Y B;  1FFV A;  1SJE D;  3P4Q B;  4YT0 B;  5D3D A;  2L52 A;  1T0R C;  1KLG D;  2QC8 A;  2I2Y A;  4LJO B;  2CHZ A;  2JWZ A;  3RUI B;  4OVV A;  4ANU A;  4MJS B;  1IBX B;  1KOT A;  3O13 A;  1H4R A;  1TBE A;  1ZUD 2;  2WNM A;  3RNC C;  3N1Z C;  2CKH B;  3I9V 1;  2LUM A;  3UQA A;  3P4P B;  4GB9 A;  1WY8 A;  3LXF A;  2MBB B;  2ZJD A;  5AZG A;  1SE4 A;  2V1Y A;  3MHS D;  5D7G A;  3E9S A;  2LZ6 A;  1FRD A;  3LDZ E;  2PMV A;  4M00 A;  1BML C;  3SR6 A;  1WYW B;  1UEL A;  1GUA B;  3RCZ A;  3N32 A;  1HZ6 A;  3DVN U;  3PZ7 A;  4M02 A;  4L1B A;  3DVN V;  4RF1 A;  4IM2 A;  2L00 B;  5JHB A;  4ZRK A;  3FC4 A;  3ZJV A;  1KTK A;  2MBQ A;  2KAC A;  4HEA 1;  3M95 A;  1YQB A;  2J0M A;  2QHO A;  2V4I B;  1WGH A;  1XCQ L;  2VH1 A;  1FO4 A;  3PRE A;  4EKU A;  5HKH A;  2KJ6 A;  3H7S A;  1FM0 D;  1Q1O A;  4ZOH C;  1F77 A;  1L0X B;  2JXT A;  4GN1 A;  1SJH D;  1D6E C;  1C78 A;  1V97 A;  4TSS A;  1FPY A;  1P1A A;  3Q8F A;  4JPS A;  1TY0 A;  1OTR B;  2UU7 A;  1WM2 A;  4A55 A;  2OJR A;  1JML A;  4CQN A;  3P63 A;  1WIA A;  2NBW B;  3ZQ4 A;  1WJ4 A;  1LQB A;  3GB1 A;  4TQ1 A;  4M8N A;  4KDI C;  2GBK A;  4LJP B;  2BWF A;  1QOB A;  1IPG A;  1OFF A;  2ZPN A;  3QWZ B;  3FKY A;  1XCT L;  3BVZ A;  2G3Q B;  3EGR A;  4GSW A;  1L0Y B;  4XC2 A;  4DHJ B;  4DDI D;  3PZD A;  1N6Z A;  5FR6 A;  1UGJ A;  2GBM A;  1EM7 A;  1WM3 A;  4YXD B;  4BBN F;  1YD8 U;  4MAC A;  2K25 A;  1YN5 A;  2L32 A;  4NJ6 A;  3RUL A;  1L4D B;  4LNO A;  2DEN B;  4IDI A;  1WR6 E;  2KJH B;  3R7R A;  3PPA A;  3MC0 B;  2BB6 A;  3L0W B;  3VH4 B;  2W3R A;  4ZRP A;  2KT7 A;  3AEB B;  4L2Y A;  2FE8 A;  4YTP B;  2MP2 A;  2JSV X;  1NI2 A;  3M3J A;  1DOX A;  4DHJ D;  3RNG C;  3GOE A;  1VJK A;  4ANW A;  1EU3 A;  3PHX B;  2N9P C;  3NZU A;  3ZRC A;  2AL6 A;  1NI3 A;  1E9M A;  4AJY B;  4HVB A;  1IUE A;  4K7S A;  2JF5 A;  5H92 C;  1F2R I;  3W5U B;  3UQB A;  4I6N B;  2RDB C;  3BY4 B;  4GIV A;  1AWD A;  1WMH A;  3BII D;  1SE2 A;  4ZDV A;  2M17 A;  4WWM A;  3RZF A;  2INN E;  4NAM A;  2OOB B;  3DOW A;  3PRZ A;  4II2 B;  1XLN A;  4RGN A;  4MM3 A;  2KQ7 A;  2NMQ A;  3C19 A;  3CIR B;  5IOI A;  4W9D A;  3WAN A;  2FID A;  4RM8 A;  1E5W A;  2OHF A;  3Q8B A;  4OW0 A;  3AE2 B;  1TTN A;  3A4S C;  2MSE D;  1X1M A;  3VTU A;  1MPE A;  2DAJ A;  2R61 A;  4GOC A;  4BZA A;  2LI5 A;  1T0S C;  2DZJ A;  4BKS D;  3TMP B;  1I4P A;  2ACZ B;  2X8X X;  2K9X A;  2D2Q A;  4ACF A;  3RFZ B;  4DXG A;  1FD6 A;  1XLO A;  4XE0 A;  1KLU D;  1OQQ A;  2IGG A;  4A9A A;  2BF8 B;  1FCC C;  2L1A A;  1VCB A;  3UIO B;  3V60 A;  1FEH A;  1E6E B;  4YWG G;  4PYU A;  1J7A A;  3IG3 A;  2N0S B;  2PPH A;  4KIK A;  4MJS A;  1E8W A;  1IBX A;  3TL5 A;  4ZYN A;  1JWM D;  2AL3 A;  3H7P B;  4XGA B;  2QDF A;  3VTV A;  2TSS A;  5BYQ A;  4IWQ A;  2KJR A;  2DYM A;  2QEJ C;  1I4Q A;  3BWU D;  1E8X A;  3AEF B;  2BTE A;  4FJV B;  2WWZ A;  2PTL A;  1WGG A;  2BT6 A;  1R7S A;  1STE A;  1OEY A;  5IA7 A;  1C76 A;  1GC6 A;  2H89 B;  2I38 A;  1VD2 A;  2IO3 B;  4HDO A;  2MW5 A;  3VH3 B;  5EE1 A;  3KUD B;  2LAS A;  3MFG A;  2GOW A;  5TSS A;  1E8Y A;  2KD0 A;  1CMX B;  3M62 B;  2FUG 1;  1JRU A;  5LXI B;  4WH4 A;  2V3N A;  5CHV C;  3ECI A;  4RGT A;  1E7U A;  3HM6 X;  3Q3J A;  5G55 A;  2O6V B;  1EWY C;  2KYW A;  4LDT D;  1YIW A;  1EU4 A;  3ZDT A;  1SXT A;  4JGH B;  1T0Y A;  5MPO A;  4RGM A;  1XEE A;  2Y5P A;  3W5V B;  2RD0 A;  4IW0 A;  2DX5 B;  4XWT A;  3EC8 A;  5BO4 B;  3R7Q A;  2OED A;  1T0Q C;  3BVG A;  5EDS A;  1TT5 B;  4MM3 B;  3KH0 A;  1WRD B;  4FBJ B;  2ASQ A;  3U30 A;  3IT6 B;  4MT5 A;  1KJT A;  1GG3 A;  3GP7 A;  2KNB A;  4NZL B;  5HHD G;  2JZZ A;  2QIE B;  4OZB A;  1I35 A;  2XN9 C;  3PSE B;  3RT3 B;  2AQ3 B;  1XD3 B;  4CO7 A;  1V86 A;  4EZK A;  4N58 A;  3EUB 2;  3TSS A;  1JQ4 A;  1OEY J;  2KOX A;  5HFY A;  3CWI A;  1CJE A;  3ZNZ B;  4W9G A;  2NBV B;  3JSV A;  1CQV A;  1MG4 A;  2KLG A;  5G2N A;  1RWS A;  2ZW1 A;  2IY0 B;  2GI9 A;  2HJ8 A;  3QAR A;  3SFE B;  2BS4 B;  4HKZ E;  3IAS 1;  4PS3 A;  2KO3 A;  3EHV A;  4EE2 A;  1Q5W B;  3URY A;  3KW5 B;  2V3P A;  3IVF A;  4F1S A;  3VXW A;  3BK2 A;  1NYR A;  1TKG A;  3DBH B;  1N63 A;  1GB1 A;  1V8C A;  4TQ0 A;  3TEZ A;  1ISN A;  3KUC B;  4RF0 A;  5TR5 A;  4KKJ A;  1RFK A;  1BT0 A;  1I4G A;  1WXA A;  2WX0 A;  4BFR A;  3NZS A;  1I4R A;  2KDM A;  2L8J A;  3MC9 A;  3HK0 A;  1WJU A;  2BBC A;  2WXL A;  3ENE A;  5IAA C;  1PFD A;  3EFU A;  1ZW7 A;  4CHK A;  3KYC D;  3JSV B;  2JVC A;  4WAF A;  4G3X B;  1D5Z C;  1J8C A;  3VAW A;  1KH0 A;  1JWS D;  2NR2 A;  4NY0 A;  1TS3 A;  2YLM A;  2W3S A;  4G50 A;  3QC8 B;  1C9F A;  1WFY A;  3Q8C A;  4GDL A;  3K9O B;  3QQ8 B;  2WDR B;  4DHZ B;  4OHJ A;  3DBL B;  2YEP F;  1NDD A;  2JT4 B;  3A9K B;  4W9E A;  1GB4 A;  2B76 B;  4S17 A;  4J3O D;  2BWE S;  1QT9 A;  4YSY B;  2G9H D;  4YTN B;  1ZKH A;  3RYT A;  4LDT B;  4N6E B;  1TS5 A;  2ZVN A;  4F7Z A;  2KLC A;  2O6V D;  5T8I A;  3DQV A;  4ZRJ A;  2KFK A;  3BVM A;  4ARC A;  3WAO A;  4W9K A;  2D3C A;  2CJN A;  4A3P A;  4WIP A;  1RFA A;  2VH2 A;  2WXF A;  3VVW B;  1AAR A;  1FNV A;  2WS3 B;  3NRZ A;  4MSM B;  4AP4 C;  3A1Q B;  4DHZ E;  2D07 B;  4AS1 A;  1N5W A;  1QLB B;  3IAM 1;  3Q3N C;  1JRP A;  2IGH A;  3UIP B;  1VR9 A;  1SSN A;  2L0F A;  2WDQ B;  2XNA C;  4DWF A;  1TKY A;  1FIQ A;  3ETR A;  1FXI A;  3ZGZ A;  2PVG C;  1ROE A;  3U52 E;  4R3D A;  3JW0 X;  2R2O A;  2KFJ A;  3JVZ X;  3P4R B;  4PT5 A;  3AN1 A;  2ZPY A;  3DWM A;  2LEK A;  1KLV A;  3B2G A;  3N9Y C;  5JH5 C;  1GC7 A;  2LHD A;  1MI0 A;  2JUO A;  1J19 A;  3AED B;  4OZA A;  2B3A A;  3RN9 C;  3HUI A;  3QJZ A;  1WWT A;  2WXM A;  5HI1 A;  2JU6 X;  1LO5 D;  4ZRI A;  3Q8E A;  2J42 A;  3AMZ A;  3IFW B;  3GZN I;  5IP4 D;  1NBF C;  4NJC A;  1FXT B;  3L4P A;  4KZ0 A;  1XLP A;  4NNJ B;  4MH8 A;  2K8H A;  4P1B C;  4LK0 M;  4US8 A;  3DDC B;  1RM6 C;  1TJE A;  5AUI A;  2N9X A;  3HM3 A;  3H1U A;  1WYG A;  3QA8 A;  4EFO A;  1YJ1 A;  4YL8 A;  4E3C A;  2BGF A;  3W2D A;  4FJZ A;  4AUQ C;  3X23 A;  1WJN A;  2DZK A;  3W1S A;  4XYC A;  4BVU C;  3D32 A;  4RCO A;  1IYF A;  2PJH A;  5FKA C;  1D4B A;  5HG2 A;  3OAW A;  2WXO A;  2QIL A;  1ET9 A;  4II3 B;  4TMA B;  2Z0E B;  5EE9 A;  4A90 A;  1B1Z A;  1UBI A;  2DYO A;  3APF A;  1WXM A;  4KKI A;  4WJP A;  1C77 A;  1V81 A;  1QIL A;  1IGC A;  3Q2A C;  1EF5 A;  2HJ1 A;  1SB3 C;  1MG8 A;  2KHW B;  5IO9 A;  4B6W A;  4RM9 A;  2GMI C;  1TZ1 A;  2CU3 A;  2J4X A;  3AE4 B;  3NVY A;  3RI7 C;  1YN4 A;  4MGY E;  5C2T B;  2JWU A;  3MTN B;  3NUH B;  3AE1 B;  1IGD A;  4NQK E;  2RMM A;  4WQO B;  2LMC A;  3V6C B;  3QHT A;  1JAL A;  3A9J A;  4MSQ B;  1WXV A;  3TBL D;  2BB5 A;  1P9D U;  3NHE B;  2FCS A;  4TV3 A;  3VRB B;  2LXC A;  1WMH B;  4C7Z A;  3U2S C;  2FCN A;  3DWG C;  3RZW C;  2LUE A;  2J0K A;  3KLS X;  3AU5 A;  4G11 A;  4C56 C;  2RDG A;  2KXJ A;  3QAQ A;  2PW9 A;  1YOV B;  3VDZ A;  4HCN B;  1WH3 A;  5BMG A;  2WU5 B;  2KWD A;  4C4V B;  4JIO U;  3RMK C;  2W54 A;  1TYG B;  3A1Q A;  5IN7 A;  2MJD A;  3SEB A;  5G5G A;  1TIF A;  3QIJ A;  3WCQ A;  2PKO A;  1L6U A;  1ZPS A;  2KMC A;  1K51 A;  4KV2 A;  2Z8L A;  2DYB A;  2LRW A;  1ET6 A;  1XLQ A;  2DBY A;  4WUR A;  2N7J A;  1YJI A;  1M4V A;  1S1Q B;  1E90 A;  2CJO A;  2ZCB A;  1SIJ A;  1Y8R C;  3H8H A;  1JWB D;  2J53 A;  3QCA A;  5GMV A;  3QX1 A;  1YX6 B;  4M0W A;  2KWU B;  5D94 A;  1QQR A;  3H9D A;  4USA A;  4A8X C;  4WJN A;  2N9L A;  2L0T A;  3ZDM C;  5JZE B;  3DHH C;  1Z2M A;  2LJI A;  2RR9 A;  2R2Q A;  2Z0D B;  4MDK E;  4EEW A;  4XDD A;  1WGY A;  1GPX A;  1SF0 A;  5EE0 A;  3TEW A;  2KQ4 X;  2WXI A;  5FK9 C;  4QAY A;  1D5M C;  2Y3A A;  3WA0 A;  3AE7 B;  4MEM A;  2M19 A;  1ACC A;  1ZDV A;  3UIN B;  1V6E A;  4HCP B;  5AZF A;  1YJJ A;  2Y5B B;  1F52 A;  1QOF A;  1P0R A;  3KYD D;  4BKG A;  3OJ4 B;  2KK8 A;  5LNK 1;  1Q10 A;  1WZ3 A;  2I1K A;  3BZD B;  2JYT A;  2G4S A;  3RNB C;  1UWX A;  2JYE A;  2EKI A;  4HPM B;  4A6Q A;  4AWJ A;  2MEK A;  3I63 C;  2L7R A;  2N7E A;  5E6N A;  4KGT A;  1SE3 A;  4IG7 B;  2I1J A;  2SEB D;  1DYQ A;  3ZTD A;  2GLS A;  2C7M B;  4GDL B;  1MHX A;  3DBR B;  1WX7 A;  5J18 A;  4BAX A;  2WP9 B;  1WZ0 A;  2L05 A;  3P4S B;  2IYD B;  2OJW A;  2EMS A;  1L6V A;  4KZC A;  4DK5 A;  4F8C B;  3Q3M C;  4ITK A;  3ZUN A;  3N30 A;  1I4H A;  2K8C A;  1YX5 B;  3Q14 C;  4KGS A;  3ML8 A;  5BMI A;  1K50 A;  1JRO A;  2KVR A;  4S0R A;  2WXQ A;  2NBU A;  2E3T A;  2DHZ A;  4K3B A;  4JL9 A;  3L10 B;  4MEL A;  2LVO A;  1DGJ A;  1WGK A;  3NY5 A;  2IDY A;  1WXS A;  2ZNV B;  3APD A;  2KDE B;  2BPS A;  4PS7 A;  3N3K B;  3V3X A;  5E6P A;  2WXP A;  1XT9 B;  4KVG B;  1P3Q U;  3OWE B;  4HKQ A;  3I3T B;  4URK A;  4MGK E;  3PLU A;  4D2K A;  5CHW A;  3LB8 C;  2K3U A;  3PTF C;  5AUK A;  4JE3 B;  3L54 A;  4HRS A;  3ZYY X;  1XQQ A;  3Q3F A;  5BYS A;  1V9J A;  2Z59 B;  4P7I A;  1V1P B;  2MBO A;  3L17 A;  2ZNV C;  2LVQ A;  3TUO A;  3IHP C;  2N9K A;  2JRI B;  2IZV B;  3AM9 A;  1K53 A;  4HXD A;  4HRO A;  3T3O A;  2K8B A;  4ZHO A;  1QF6 A;  3NS8 A;  3PGE A;  2BYE A;  2INP E;  3B9J A;  2ZCC A;  5DPW A;  4NJ7 A;  1GAQ B;  2AEH A;  3FIL A;  2MHJ A;  4REZ A;  1EUV B;  2V0G A;  4EZL A;  2K6Q A;  3MC8 A;  5H8Y E;  2ZVO A;  4ARI A;  1P98 A;  1BXT A;  1VDV A;  4KSL C;  1WGD A;  1PGA A;  2IY1 B;  4TUU A;  3KWL A;  2FBW B;  2PVO D;  1N60 A;  1AN8 A;  2WQY B;  3ZNG C;  1XXG A;  4GGQ A;  2IND C;  1UF0 A;  2GBN A;  2L3Z A;  4IWO A;  3Q6B A;  3OLM D;  5E6J A;  3V62 A;  4KGR A;  3CSF A;  3ZJT A;  2KTR A;  4BKT A;  5EE3 A;  1MFW A;  1I4X A;  2NPT B;  1P7F A;  2MH7 A;  2LGI A;  4W9F A;  3RNA C;  3EFC A;  2QSD A;  2KKC A;  1K8R B;  1GNU A;  4KDL B;  4RMA A;  1R4N I;  3ZVV A;  3AH7 A;  1D3Z A;  2REX A;  1M94 A;  2LJ5 A;  3B0A A;  3A9K A;  3NJT A;  4B0E A;  4K81 A;  5D3I B;  3HIZ A;  3I5J C;  3AEC B;  1YQ4 B;  1J7C A;  3ZW3 A;  2MJ3 A;  1UWM A;  3WAM A;  1C79 A;  1NEN B;  3ZTC A;  4HJK A;  2WYQ A;  4M8M A;  2JY6 A;  3AE5 B;  4CYE A;  2CHW A;  3B2F A;  2D5G A;  1C4A A;  4PYZ A;  5DCN A;  3N1X C;  3R3M A;  1FNW A;  2LD9 A;  3B08 A;  1WR1 A;  3BYT B;  1PQS A;  2LWP A;  2MCN B;  2D10 A;  2WGS A;  2LRU A;  2XEW A;  1OGW A;  1K52 A;  4GDK A;  3KQ4 A;  1LGR A;  1E7V A;  3RNE C;  2WU2 B;  4NAW B;  3GZN B;  3RD2 A;  1FCL A;  2LFI A;  1NYQ A;  4WJQ A;  3VR8 B;  1HA5 A;  3ZIM A;  3ZJU A;  3W1Y A;  2Y5C A;  3AE3 B;  4BBN C;  5CX3 A;  4AOF A;  1HE8 A;  3PV1 A;  3MJW A;  1YMH E;  3P1M A;  5G5H A;  4ICU A;  3TEY A;  3PT2 B;  3C0R B;  4XX5 A;  2KTF A;  3Q69 A;  4WJO A;  3S2A A;  4BOS C;  1AYF A;  2RPQ A;  2IBI B;  2JZ3 B;  1ESF A;  2CR5 A;  1DOY A;  1KM7 A;  2DAF A;  3X0W A;  3V05 A;  2KDB A;  2CHX A;  4RH6 A;  1EO6 A;  2FCM A;  4DDG D;  4G0N B;  3R8B A;  2HD5 B;  3I57 A;  2H88 B;  3ZRF A;  2KN4 A;  3VUY A;  3TEX A;  1Y56 A;  4EZJ A;  2NTT A;  3Q3O C;  3PVL A;  3Q8A A;  3U7Z A;  1YN3 A;  1V1P A;  4HDQ A;  4K1R B;  3C8Y A;  2DWQ A;  4MGI E;  1UZX B;  5KHQ A;  5C23 A;  1S3S G;  2VZK B;  2XK5 B;  3V61 A;  2MA9 B;  1VZ8 A;  3NS1 A;  3SFD B;  1GJZ A;  1D5X C;  4WQM A;  2UWQ A;  1N62 A;  1T6B X;  2NCN A;  2E6X A;  1F9J A;  1QZE A;  1HZ5 A;  2KZR A;  2LGX A;  2AYO B;  4HPL B;  4RFB A;  1FMA D;  3U8Z A;  2BYV E;  4A20 A;  4BOZ B;  2IO1 B;  1CZP A;  2K0P A;  4KIK B;  3CST A;  4M01 A;  4IM0 A;  2RSU A;  4K3C A;  4DBG A;  2EKE C;  3OJ3 A;  3T8M A;  5E6O A;  2MX2 A;  1UD7 A;  5L83 A;  1GOZ A;  1C3T A;  2ZEQ A;  4XZ4 A;  3UF8 A;  2WXH A;  4L23 A;  3ZLZ A;  2NPT A;  1TGZ B;  4OVZ A;  1CK1 A;  2KWV B;  2LGS A;  4N9F 4;  3BK1 A;  2MP2 B;  4K7W A;  1VLB A;  1WE7 A;  3IT4 B;  1MHH E;  3ZNI D;  3ZXR A;  3H6N A;  1C4C A;  2X38 A;  4W9L A;  3GE8 C;  1SEB D;  2K39 A;  1LM8 B;  2RPV A;  1YQ3 B;  2GBJ A;  2WXK A;  2HE7 A;  3A9J B;  4MGZ E;  1UNS A;  3AEE B;  2WDV B;  3APC A;  4NAW A;  3TIX A;  3ABV B;  2W55 A;  3AV8 A;  2RGF A;  3FIL B;  4HLE A;  3DBS A;  4RGO S;  5DPS A;  2G1E A;  2INC C;  4YSX B;  3R2T A;  2KFK B;  4C00 A;  2XBB C;  1WRI A;  2QCZ A;  1PGX A;  4FUL A;  4E74 A;  2WHI A;  4Q2J A;  2ONQ A;  1UGM A;  4LNK A;  4C7Y A;  3NVZ A;  3U4E G;  2JXX A;  4ASW C;  2A5U A;  5C3J B;  4JX1 C;  3NOB A;  2J0J A;  1ZP0 B;  5LXH A;  2WXN A;  4A3O A;  5J17 A;  2M0X A;  1N5X A;  3RPF C;  5L95 C;  4MH0 E;  3ML9 A;  4IWP A;  2GRI A;  2KC2 A;  3EA6 A;  2VRR B;  1SBB B;  3SD5 A;  3ZXV A;  3L16 A;  4GU2 A;  4K7U A;  3HHM A;  1HQR D;  2BKR B;  2G45 B;  1E10 A;  3A33 B;  4I6L B;  4FLH A;  5BYR A;  3N1Y C;  1F1H A;  2K5P A;  2KMM A;  2BS2 B;  4US9 A;  1WX9 A;  2L76 A;  2M4N A;  2QJL A;  2L83 A;  1WE6 A;  2GBR A;  1AW7 A;  2HDE A;  3ONS A;  1E8Z A;  5AZH A;  2PIA A;  3T9L A;  1T3Q A;  1FNU A;  3VUW A;  1SGH A;  3AI5 A;  3PS6 A;  5IKC M;  3HVZ A;  1TKE A;  1KF6 B;  4O1N A;  3IXS A;  1L2N A;  3KWV A;  2FNJ B;  4IC7 B;  4P16 A;  3HVD A;  3N20 C;  4DQO C;  2A4Z A;  1OQY A;  2MJE A;  4FA6 A;  1JW9 D;  2YVC A;  2KC1 A;  4WWP A;  4JWS C;  1VZ7 A;  2M56 B;  2KDI A;  1WF9 A;  1KFY B;  1VRA B;  2V9H A;  2BS3 B;  3NG0 A;  2EEL A;  2MLB A;  1L4Z B;  1RYJ A;  3WAL A;  3EEC A;  1T5X D;  2KAJ A;  2IJ0 A;  4H2A A;  1PUT A;  3AE6 B;  3E56 A;  2FUH B;  2M1M A;  3DPD A;  4KSK C;  2KVZ A;  2FCQ A;  1J0G A;  5KHO A;  4EOY A;  3VRA B;  3WIM A;  2D11 A;  1R4M I;  4PS8 A;  2KX0 A;  4YTM B;  2ZW0 A;  3RNF C;  4ZYS A;  2LGD A;  1FRR A;  2C60 A;  5JXV A;  1L5P A;  2AX5 A;  1L7Y A;  3O65 B;  4FHJ A;  5D6J B;  2EMT A;  4LNN A;  4DXA B;  1QOG A;  4DXF A;  2MBE A;  3UI3 A;  4EUT A;  1RAX A;  2FAZ A;  4W9J A;  3AXC A;  1A70 A;  3LYY A;  3M63 B;  1ENF A;  1ZGU B;  2K22 A;  4OZC A;  2KWC A;  2BW2 A;  2IGD A;  4ICV A;  4WAA A;  4RNA A;  4W9C A;  1C4P A;  4P1C C;  3DCG A;  1XO3 A;  2LGY A;  2PE6 B;  3H7P A;  2KX3 A;  3J9C A;  4FXC A;  2DZI A;  1MVK A;  2IPK D;  3AE8 B;  4GDK B;  2VZK D;  3T3N A;  2BYF A;  5DPR A;  1Z5S B;  2IO0 B;  2WDT B; 
#chains in the Genus database with same CATH homology
 2LHE A;  2J42 A;  3AMZ A;  3AEG B;  4UDU C;  1ZOY B;  5I4D A;  1UGJ A;  1EM7 A;  2RDH A;  4YXD B;  3AH7 A;  3MP9 A;  4NJC A;  4MAC A;  3L4P A;  1NEK B;  1YN5 A;  2L32 A;  1L4D B;  1XLP A;  4B0E A;  1E7P B;  4MH8 A;  4IDI A;  5D3I B;  3AEC B;  1YQ4 B;  1J7C A;  4LK0 M;  4US8 A;  2MJ3 A;  1UWM A;  3AEA B;  3MC0 B;  1C79 A;  1KRH A;  1NEN B;  1RM6 C;  1UUP A;  2BB6 A;  5BMH A;  1TJE A;  2W3R A;  5AUI A;  3AE5 B;  4ZRP A;  1VZ6 A;  4XDC A;  3AEB B;  3B2F A;  1WYG A;  3MHZ A;  4L2Y A;  2FE8 A;  4YTP B;  2D5G A;  1C4A A;  2JSV X;  4P6V F;  4ZRQ A;  1DOX A;  1VJK A;  3W2D A;  1EU3 A;  3FAH A;  1FNW A;  2PLP A;  1NI3 A;  1E9M A;  3BYT B;  3W1S A;  4RCO A;  3PO0 A;  1IUE A;  5H92 C;  1F2R I;  3W5U B;  2M0A A;  5FKA C;  1D4B A;  1TS4 A;  1AWD A;  4IKG A;  5HG2 A;  2WXO A;  3BII D;  1SE2 A;  4LLG M;  1K52 A;  2QIL A;  1ET9 A;  3KQ4 A;  4LTU A;  4WWM A;  2INN E;  2SAK A;  2WU2 B;  4NAW B;  4NAM A;  4TMA B;  1FCL A;  2LFI A;  5EE9 A;  1NYQ A;  1XLN A;  4RGN A;  3VR8 B;  2QMT A;  1HA5 A;  4A90 A;  3ZJU A;  1B1Z A;  1TS2 A;  2NMQ A;  2Y5C A;  3AE3 B;  2DYO A;  3CIR B;  1ZXH A;  4AQ7 A;  1YMH E;  4KKI A;  2OHF A;  3P1M A;  5G5H A;  5GXG B;  3TEY A;  3Q8B A;  1C77 A;  3Q69 A;  1QIL A;  1IGC A;  4OW0 A;  5FR3 A;  3AE2 B;  1AYF A;  1B9R A;  1XF5 L;  1ESF A;  1SB3 C;  1DOY A;  1MPE A;  3V05 A;  2R61 A;  2WLB A;  4RH6 A;  3GS2 A;  2CU3 A;  2J4X A;  3AE4 B;  3NVY A;  1YN4 A;  5C2T B;  3R8B A;  3I57 A;  2JWU A;  3NUH B;  2H88 B;  3AE1 B;  2KN4 A;  1IGD A;  4GLS C;  1DOI A;  1I4P A;  2ACZ B;  3TEX A;  1Y56 A;  2K9X A;  2RMM A;  3NVV A;  2LMC A;  2NTT A;  2HTM E;  2Q5W D;  3Q8A A;  3U7Z A;  4DXG A;  3RFZ B;  1FD6 A;  1YN3 A;  1V1P A;  1JAL A;  1OQR A;  1XLO A;  1NVI D;  2DWQ A;  3C8Y A;  4XE0 A;  1KLU D;  1OQQ A;  2IGG A;  1JWA D;  4A9A A;  2BB5 A;  2NTS A;  2JQR B;  1PGB A;  1FCC C;  4IOI E;  3VRB B;  2VZK B;  2DLB A;  3AE9 B;  4C7Z A;  3U2S C;  2L1A A;  1EWC A;  3DWG C;  1VZ8 A;  4ZHP A;  2WXG A;  4C80 A;  3NS1 A;  1WSP A;  3SFD B;  1FEH A;  3KLS X;  1E6E B;  4YWG G;  1D5X C;  1E0Z A;  4WQM A;  4C56 C;  1F2R C;  1ZE3 D;  2RDG A;  1N62 A;  1T6B X;  1J7A A;  2N0S B;  2E6X A;  1HZ5 A;  2PW9 A;  1IBX A;  3MJ5 A;  5BMG A;  2WU5 B;  2KWD A;  4RFB A;  1FMA D;  1JWM D;  2W54 A;  1TYG B;  2TSS A;  2MJD A;  5BYQ A;  2DYM A;  2QEJ C;  1CZP A;  2K0P A;  1I4Q A;  3SEB A;  3BWU D;  3NVW A;  5G5G A;  3AEF B;  2BTE A;  3WCQ A;  2PKO A;  2PTL A;  2WXJ A;  1L6U A;  1P7E A;  1ZPS A;  2BT6 A;  1GOZ A;  1K51 A;  1R7S A;  2Z8L A;  1STE A;  1C76 A;  2H89 B;  2I38 A;  1ET6 A;  1FFU A;  1XLQ A;  2DBY A;  2WXH A;  4WUR A;  4L23 A;  3VQI A;  2N7J A;  1YJI A;  5EE1 A;  1M4V A;  3MFG A;  2CJO A;  5TSS A;  1SIJ A;  3H8H A;  1JWB D;  1CK1 A;  2FUG 1;  2J53 A;  4OVZ A;  2ICI A;  3AB5 A;  4WH4 A;  3W9C B;  2V3N A;  4RGT A;  2BYT A;  2AQ2 B;  3BK1 A;  4M0W A;  1JCK B;  1QQR A;  1ZXI A;  1VLB A;  4USA A;  1EWY C;  3IT4 B;  1MHH E;  4A8X C;  4B0M A;  3NZ3 A;  2J52 A;  2N9L A;  1F0Z A;  1EU4 A;  1WXQ A;  1C4C A;  2LJI A;  1SXT A;  1J7B A;  2X38 A;  5MPO A;  1SEB D;  4RGM A;  1XEE A;  2Y5P A;  3W5V B;  1YNT E;  2RPV A;  4XDD A;  1YQ3 B;  2GB1 A;  4XWT A;  1GPX A;  1SF0 A;  5EE0 A;  3TEW A;  2WXK A;  2JX5 A;  2KQ4 X;  2WXI A;  5FK9 C;  4JWU C;  1D5M C;  2Y3A A;  3AE7 B;  2OED A;  2M19 A;  1ACC A;  1TZO A;  1ZDV A;  3BVG A;  1UNS A;  4XWW A;  4MM3 B;  2YEP B;  3AEE B;  1YJJ A;  3IT6 B;  1QOF A;  2WDV B;  4MT5 A;  3BYY B;  3VR9 B;  3ABV B;  2W55 A;  3GP7 A;  3HRD D;  4NZL B;  3AV8 A;  5HHD G;  1TY2 A;  1L0V B;  3FIL B;  2QIE B;  4OZB A;  2XN9 C;  1QKZ A;  5LNK 1;  2AQ3 B;  4RGO S;  1Q10 A;  1V1O A;  2AQ1 B;  3BZD B;  2JYT A;  4HJG E;  2G1E A;  4N58 A;  3EUB 2;  1UWX A;  3TSS A;  2JYE A;  2EKI A;  1JQ4 A;  4YSX B;  5HFY A;  3CWI A;  3R2T A;  4A6Q A;  1CJE A;  1PYW D;  2MEK A;  1WRI A;  2ON8 A;  1CQV A;  1PGX A;  4KX6 B;  4KGT A;  1RWS A;  1SE3 A;  2SEB D;  2ZW1 A;  1DYQ A;  3R2I A;  4Q2J A;  4GDL B;  2ONQ A;  1N61 A;  4C7Y A;  3PZ8 A;  3NVZ A;  1MHX A;  2W82 A;  3U4E G;  2GI9 A;  2JZP A;  3SFE B;  2BS4 B;  1FXA A;  2WP9 B;  2WXR A;  4HKZ E;  4YSZ B;  4N59 A;  3IAS 1;  5C3J B;  4JX1 C;  1BUI C;  1ZP0 B;  3P4S B;  4EE2 A;  1HXY D;  1L6V A;  3URY A;  2V3P A;  1QOA A;  1JWU D;  4ITK A;  1I7H A;  1PDX A;  2WXN A;  1I4H A;  3BK2 A;  1NYR A;  1TKG A;  4KGS A;  1N63 A;  1N5X A;  3RPF C;  5BMI A;  1GB1 A;  1ZDX A;  1V8C A;  1K50 A;  1JRO A;  4TQ0 A;  3TEZ A;  2GRI A;  2WXQ A;  4RF0 A;  3EA6 A;  2E3T A;  4KKJ A;  1SBB B;  1RFK A;  1I4G A;  3P42 A;  1HEZ E;  1I4R A;  2KDM A;  1HQR D;  1DGJ A;  1WGK A;  1E10 A;  2IDY A;  2BBC A;  2WXL A;  5BYR A;  1FFV A;  4US9 A;  2K5P A;  2KMM A;  2BS2 B;  1SJE D;  3P4Q B;  4YT0 B;  5D3D A;  2QJL A;  2L52 A;  3V3X A;  2L83 A;  1PFD A;  1KLG D;  2WXP A;  1AW7 A;  2HDE A;  3OWE B;  4HKQ A;  2I2Y A;  2PIA A;  1T3Q A;  4D2K A;  1FNU A;  3LB8 C;  4WAF A;  1IBX B;  2K3U A;  3O13 A;  1D5Z C;  1ZUD 2;  2WNM A;  5AUK A;  1KH0 A;  3I9V 1;  3HVZ A;  1TKE A;  2LUM A;  1JWS D;  1KF6 B;  3IXS A;  3P4P B;  4JE3 B;  4O1N A;  3KWV A;  4HRS A;  1TS3 A;  3ZYY X;  2W3S A;  3LXF A;  4P16 A;  3HVD A;  5BYS A;  4DQO C;  1V1P B;  1C9F A;  2MJE A;  1JW9 D;  3Q8C A;  1SE4 A;  3TUO A;  5D7G A;  3E9S A;  4JWS C;  2WDR B;  1VZ7 A;  1FRD A;  4OHJ A;  2PMV A;  2M56 B;  1BML C;  3SR6 A;  2N9K A;  2YEP F;  1KFY B;  1VRA B;  1GB4 A;  3AM9 A;  1HZ6 A;  2BS3 B;  1K53 A;  2B76 B;  4HRO A;  3T3O A;  4J3O D;  2EEL A;  1QT9 A;  1L4Z B;  4ZHO A;  1RYJ A;  1QF6 A;  3PZ7 A;  4YSY B;  2G9H D;  4YTN B;  2INP E;  3B9J A;  1T5X D;  4L1B A;  4RF1 A;  2KAJ A;  2IJ0 A;  4H2A A;  1TS5 A;  1PUT A;  3AE6 B;  3E56 A;  4N6E B;  3FC4 A;  3ZJV A;  1KTK A;  1GAQ B;  5T8I A;  3FIL A;  2KAC A;  4HEA 1;  3VRA B;  3BVM A;  4REZ A;  4ARC A;  2CJN A;  2V0G A;  4WIP A;  2V4I B;  1XCQ L;  2ZW0 A;  4YTM B;  4ZYS A;  5H8Y E;  1FO4 A;  4ARI A;  2WXF A;  1BXT A;  1FNV A;  2WS3 B;  1VDV A;  1FRR A;  3NRZ A;  5JXV A;  1L5P A;  2AX5 A;  4AS1 A;  1FM0 D;  1N5W A;  1QLB B;  3IAM 1;  4ZOH C;  1F77 A;  1L0X B;  2IGH A;  1JRP A;  2JXT A;  1PGA A;  1SJH D;  1VR9 A;  1SSN A;  1QOG A;  2WDQ B;  2XNA C;  1TKY A;  4DXF A;  1D6E C;  1C78 A;  3KWL A;  2FBW B;  1V97 A;  1FIQ A;  4TSS A;  2PVO D;  3UI3 A;  1N60 A;  3ETR A;  3Q8F A;  1FXI A;  1AN8 A;  3ZGZ A;  4JPS A;  1TY0 A;  2PVG C;  2WQY B;  1ROE A;  3U52 E;  4R3D A;  1XXG A;  1A70 A;  3LYY A;  3P4R B;  4PT5 A;  3AN1 A;  4A55 A;  3DWM A;  1ENF A;  2LEK A;  2K22 A;  3B2G A;  4OZC A;  1JML A;  3N9Y C;  4CQN A;  3P63 A;  3ZQ4 A;  3GB1 A;  2BW2 A;  4TQ1 A;  2IGD A;  5E6J A;  4KGR A;  2LHD A;  4RNA A;  1MI0 A;  3AED B;  4OZA A;  1C4P A;  1QOB A;  3HUI A;  3ZJT A;  1XO3 A;  5EE3 A;  1OFF A;  1WWT A;  1I4X A;  3J9C A;  1XCT L;  4FXC A;  3BVZ A;  2WXM A;  5HI1 A;  1P7F A;  2JU6 X;  3EGR A;  1MVK A;  1L0Y B;  1LO5 D;  2IPK D;  2LGI A;  2MH7 A;  3AE8 B;  4GDK B;  2VZK D;  3T3N A;  3Q8E A;  2QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...