2KAJA

Nmr structure of gallium substituted ferredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title Structural and functional characterization of the ga-substituted ferredoxin from Synechocystis sp. PCC6803, a mimic of the native protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kajA00
1FRRA 2DBYA 4N58A 5EE9A 2Y5CA 1NI3A 3AE3B 3SFDB 1N63A 4N6EB 5AUIA 3AM9A 2MH7A 3HUIA 1RYJA 4IDIA 2MJ3A 1JALA 1WWTA 1VLBA 3ABVB 1E0ZA 1GAQB 3AEDB 3B2FA 1N62A 4N59A 1J7BA 3ETRA 4HROA 1V97A 2H89B 1TKEA 3FC4A 1JQ4A 1PDXA 2JX5A 1IUEA 1TKYA 1I7HA 1KRHA 2L52A 2PKOA 2W3RA 1ZOYB 3BIID 4YTNB 2E3TA 2BS2B 4ZOHC 3NVVA 3DWMA 1SIJA 2MJDA 2KAJA 5G5GA 1T3QA 1YJJA 1FRDA 1WXQA 1E6EB 1B9RA 1YJIA 1VDVA 1CZPA 1V8CA 3NVYA 1QF6A 3AEAB 2K5PA 1NEKB 1JRPA 3HVZA 5EE3A 1YQ3B 4JWUC 1FFVA 3HRDD 4YSYB 4ZHOA 1QOFA 2WDRB 1ZUD2 2ACZB 1UWMA 3AB5A 1QT9A 2CJNA 2K22A 1L0VB 2PVOD 4YSXB 2OHFA 3AE6B 3B2GA 1AWDA 2BT6A 2Q5WD 2M56B 2PIAA 3AEGB 3AN1A 1VJKA 4C80A 3NS1A 1NENB 1EWYC 1XLQA 2W54A 2CJOA 2WU5B 3AEEB 3AV8A 3LB8C 1QLBB 2WS3B 1DOIA 2AX5A 4KX6B 2WDQB 1JROA 3W9CB 1FO4A 1YQ4B 1PUTA 2W55A 1DOYA 1OFFA 2B76B 2WLBA 3VRAB 3SFEB 5H92C 2N0SB 3AE8B 3VR9B 1PFDA 2EKIA 5MPOA 5G5HA 2MJEA 2W3SA 1E10A 4YTPB 3SR6A 4YT0B 1TKGA 5AUKA 1ZXIA 2DWQA 2HTME 1RM6C 5C2TB 1SB3C 3P4QB 4FXCA 1WGKA 3VR8B 1QOBA 1GPXA 1N60A 1FIQA 4JWSC 2M19A 4A9AA 3FAHA 1J7AA 2JQRB 1ROEA 2KMMA 3AH7A 3NVWA 2K9XA 2CU3A 3AMZA 1L6VA 3L4PA 1A70A 4US8A 2G1EA 2WP9B 2BS3B 1QOAA 2WU2B 1XLNA 4YSZB 1JWAD 4JX1C 1OQQA 1FM0D 3P4PB 5EE0A 1WYGA 5H8YE 1ZP0B 1N5XA 4WWMA 1FXAA 3WCQA 1XLPA 3CIRB 4C7YA 1FXIA 3P4RB 3LXFA 3P4SB 4USAA 3AEBB 2QIEB 4WQMA 3VRBB 2PVGC 1CJEA 1R7SA 4US9A 4ZHPA 4C7ZA 3CWIA 5GXGB 1JW9D 3P1MA 3AEFB 1TJEA 3NVZA 1NYQA 1J7CA 1AYFA 1F0ZA 1JWBD 3ZYYX 1N61A 3AE4B 1L6UA 3AE1B 2FBWB 1SF0A 1WRIA 4P6VF 2QJLA 5EE1A 1L5PA 2BS4B 2LEKA 3RPFC 5C3JB 3W5UB 1RWSA 3AE7B 2H88B 1NYRA 3AECB 1NVID 1KFYB 1KF6B 4YXDB 3AE2B 1XLOA 1QOGA 1RFKA 1FMAD 1XO3A 2WQYB 3P63A 3PO0A 4HRSA 4LTUA 3W5VB 1N5WA 4ITKA 3EUB2 1E7PB 1E9MA 2WDVB 2L83A 3AE5B 3KWLA 1DGJA 4YTMB 1FFUA 3AE9B 1DOXA 3B9JA 3DWGC 1OQRA 1TYGB 3NRZA
chains in the Genus database with same CATH superfamily
4EE2A 4W9LA 4XWTA 3HUIA 4I6NB 4IDIA 2NS5A 1WXAA 4LLGM 4A55A 1RAXA 1WRDB 2WXHA 4C4VB 1F2RC 1V6EA 2D10A 1UBQA 2RSUA 2LRUA 2Z8LA 1C79A 3VTVA 3GP7A 1HA5A 1D5MC 3KYDD 1QKZA 4LNOA 1E6EB 1B9RA 1TT5B 2JT4B 2WXOA 4B0EA 3DOWA 2AQ1B 3ZXVA 4G11A 4ANVA 2OEDA 2K22A 1EU3A 2FIDA 2FCMA 2JSVX 3JVZX 4AP4C 1DOIA 3Q3OC 2WWZA 4ASWC 2AWTA 2WLBA 1L4DB 5JHAA 2W3SA 3C0RB 5E6OA 4EZLA 1H8CA 3A9JB 1RM6C 2RMMA 2I1JA 3VXWA 4NAWB 3PTFC 1IYFA 2MBEA 2MA9B 1Z5SB 4JX1C 2KQSA 3VDZA 2ZW1A 1XLPA 3VUWA 1WGGA 3EFUA 4KGSA 4C7ZA 1JWBD 1F1HA 3AE1B 4DXFA 3U52E 2IZVB 2EMSA 2J0KA 3ENEA 3ZXRA 1EF1A 3ZVVA 1YN5A 3PZ8A 1KFYB 2ON8A 2WDVB 2L83A 4JL9A 1DOXA 2KWUB 2BB5A 3UI3A 3RNEC 1XCQL 2LASA 4XDDA 4C4VA 3CMMB 3U8ZA 3ABVB 3TJPA 2FNJB 1UWXA 4TV3A 2QC8A 2PKOA 3R7QA 1T5XD 2KN5A 4HJKA 3PZ7A 2KAJA 2MEKA 3UQBA 4GLSC 3SDLC 2CHZA 5EE3A 3HRDD 3V6EB 2AEHA 2ACZB 4LDTB 1WI0A 3B2GA 4R3DA 2BT6A 2NBWB 2JXXA 3IT4B 3TCAA 3E9SA 1G6JA 4A20A 1N6ZA 2AX5A 3H6NA 4LNNA 2ZEQA 3ZW3A 1FO4A 5JHBA 2A5UA 5CHFA 1WX9A 2B76B 3BINA 4WJQA 1HXYD 1J8CA 4XYCA 3J9CA 3TUOA 4NAWA 3Q8BA 4ANXA 5C2TB 3RMKC 4BKTA 4A3OA 4ICVA 2JRIB 4XDCA 3NJTA 4GIVA 2IDYA 1D5ZC 1LO5D 4EUTA 1L6VA 3IFWB 2WHIA 2KMAA 2INPE 2ZVNA 3RUIB 3W1SC 4P16A 1XCTL 4KVGB 3P4SB 2PTLA 1EO6A 2QMTA 3VUYA 2LGSA 4ZHPA 3HHMA 4DHJD 5LXHA 4W9GA 3VAWA 2JYTA 1HEZE 2N1VA 3L0WB 4NJ7A 3Q8CA 1FEHA 5IA7A 1V86A 2LVPA 2RDBC 5DPRA 2KVZA 2WGSA 3R2IA 4KGRA 4M8MA 3ECIA 3RNCC 5D6JB 2GBNA 2MWSB 4OW0A 4A8XC 2J42A 2GOWA 2WXMA 2R2QA 4K7WA 4BAXA 5L95C 4GSWA 5AEKB 4GB9A 3ZNHB 3ZJTA 2E3TA 3ZLZA 1GB1A 4S0RA 1VDVA 4ZRQA 4K3BA 2JF5A 3X0WA 3BVGA 2EMTA 2Y5BB 3L16A 3QCAA 3ZNGC 2LZ6A 2KQ7A 4RM9A 2OHFA 5FKAC 1D4BA 3RCZA 3L54A 1C4CA 2XNAC 3AN1A 4C80A 3NS1A 4REZA 3SFEB 1QLBB 3CSFA 4JQWC 1JROA 2W55A 2BKRB 2KWDA 2WXRA 3B1LX 5G5HA 3RZWC 5CX3A 2IO2B 5DPWA 3ZNID 3MHZA 2HTME 2QDFA 3GZNB 4RF1A 2NCNA 1OEYJ 1K8RB 3VH3B 3RULA 1KLVA 1SIFA 2VZKD 3RFZB 2IGHA 1GG3A 3PRPB 1FNWA 3APCA 2V0GA 1WH3A 3T3NA 3VRBB 2PVGC 4QAYA 4KKJA 3EA6A 4WURA 1WGDA 2IYDB 1R4NI 3AE4B 2E6XA 1WRIA 2DAJA 3ZNZB 2GI9A 2RGFA 2Z0EB 1C4PA 4MM3B 2LHDA 1FMAD 2KHWB 2KFJA 3N9YC 1E5WA 2OJRA 4URKA 1WX8A 2MW5A 2J52A 1OQYA 1SJED 1FRRA 5E6JA 3TIXA 5LNK1 2AYOB 5J2RA 3PLUA 2JZPA 2LD9A 2DHZA 2M0XA 2QSDA 1GAQB 2C60A 1VD2A 3WAPA 4HROA 4M8NA 2NVUI 1P98A 2KDIA 2IJ0A 3ZGZA 1KLGD 3NOBA 4CYEA 4K3CA 4ZYNA 3JW0X 4RCOA 1UWMA 4ZDVA 5IN7A 4L23A 4HDQA 2A4ZA 3OJ4B 3RN9C 1ET9A 4MH8A 1C77A 4AOFA 1XLQA 1UD7A 1XQQA 4CQNA 1I4PA 1Y56A 1AW7A 2Y3AA 3T8MA 2MJEA 2WXQA 4FLHA 4K7UA 5IOIA 4BBNF 1SB3C 2WXFA 1L2NA 1MJDA 1WYWB 1J7AA 5BMGA 3WA0A 2AQ2B 3RD2A 3W1SA 4JLCA 2BWFA 4DHZB 3V3XA 5CHWA 2MBQA 3WAOA 2KLGA 3VUXA 4NY0A 3LXFA 2JWZA 3PV1A 4RGMA 1V80A 1HE8A 1S3SG 4HCPB 3CWIA 4B6WA 4WH4A 4PK1A 1P0RA 1MHXA 4DQOC 3EGRA 4IC7B 1LFDA 3NUHB 3O13A 4YL8A 4MM3A 1M94A 2UU7A 3AU4A 3QC8B 4UDUC 2N9KA 3DDCB 1QOGA 3RNFC 1P7FA 1DGJA 1OQRA 3AEDB 1TBEA 2LHEA 5EDSA 1YN4A 2K8CA 4OHJA 4LJOB 3Q2AC 1M4VA 1SGHA 1B1ZA 2XK5B 4II2B 3ZTCA 3RZFA 1WJUA 2BYVE 1LGRA 2JX5A 4AWJA 2XN9C 2C5LC 3PPAA 4B95A 4OZAA 3QQ8B 1E7UA 2ZPNA 3I57A 3Q14C 2N4FA 1T0QC 1YJJA 3EECA 4HCNB 2N9PC 1SSNA 3QX1A 3GE3C 1QOFA 2WDRB 2D3GA 3U7ZA 1EU4A 2G4SA 4EZJA 1XF5L 5D94A 3PREA 3IG3A 3L10B 2NPTB 3PLVA 1L0YB 2D3AA 4LNKA 2GLSA 5TR5A 1ZXIA 2WXPA 3DQVA 2YEPF 2M19A 4KSKC 4JGHB 4IUMB 2LJIA 3KH0A 3NVWA 2V4IB 4AQ7A 3RYTA 1WYGA 3ML8A 2D5GA 5HFYA 3ZTDA 3AEBB 1R7SA 3ZKJC 2O6VD 4WAFA 4NQKE 4WWNA 3QK0A 2LVOA 1UELA 1K52A 4FBJB 4HRSA 3AE5B 4HKZE 1ESFA 1TIFA 5EE9A 2XK5A 1N63A 4BKSA 2QHOA 3PRMB 3OJ3A 5FR6A 4ICUA 2ZPYA 1R4NB 3KWVA 3M63B 3FC4A 1VZ7A 4KDIC 5JH5C 5J18A 3DHGC 2K39A 2KDMA 5DPSA 4YSYB 4FJZA 2INNE 2INDC 2KC1A 2CJNA 1AWDA 2KC2A 3H7PB 2NPTA 4MSQB 1EWYC 3AV8A 3PRZA 5IAAC 4RFBA 1Q0WB 3Q3MC 1AARA 2FE8A 2KZRA 1K51A 1RLFA 3A9KB 5C1ZA 4LJPB 1YX6B 1GOZA 1UUPA 4YT0B 4IWPA 2BQQA 3DBHB 5AUKA 3VR8B 4MGKE 4PS8A 1QOBA 2JY6A 2VRRB 1UNSA 1ROEA 2KMMA 4B0MA 3MC8A 1A70A 4US8A 2D3BA 1JWAD 3UIPB 3SD5A 2NR2A 3ZRCA 1E90A 4M00A 2JWUA 4C7YA 3JSVB 2SAKA 2LFIA 3H9DA 3NVZA 3ZYYX 2L0FA 1N61A 4AJYB 2LWPA 2B3AA 2YEPB 1YD8U 3VTUA 1EUVB 1FNVA 2BWES 1E7VA 2WQYB 5D3DA 3IAM1 3C8YA 4ZRPA 3DCGA 4I6LB 2N7JA 3WANA 3N30A 2PJHA 2BBCA 4WWPA 2IO1B 4DHJB 1R4MI 2ZZPB 3TEXA 3I9V1 4N59A 1C78A 2WX0A 1QILA 1JQ4A 1SEBD 3MJWA 1Q10A 4W9KA 2L05A 4O1NA 2MJDA 1UH6A 3QJZA 1T3QA 1TZ1A 2V9HA 1WXVA 5L83A 4HVBA 2DX5B 2DZIA 1I4HA 2KT7A 4W9JA 3H7PA 2DZJA 2WXKA 1PYWD 2KYWA 2KTFA 4XZ4A 4NAMA 2CHXA 2CJOA 2KFKB 2PLPA 3A9KA 3ML9A 3Q8FA 1DOYA 4OZCA 5HG2A 4P7IA 1V1PB 3R7RA 1ZPSA 3VR9B 3W1YA 1JCKB 1V5OA 3KYCD 2L76A 4GN1A 3U2SC 3OG5A 3W2DA 3VH4B 2DWQA 2TSSA 1WGKA 3DBRB 2BYEA 3BYYB 2ICIA 2PMVA 5LXIB 1LM8B 1KTKA 4CHKA 3JSVA 3CIRB 1FXIA 4GXBA 2OJWA 3PHXB 3A9JA 3APFA 3AEFB 1I4RA 4WQOB 2DENB 4OVVA 1SJHD 4HWIB 2QJLA 1X1MA 5DPTA 3Q8AA 5AZFA 4IWQA 1BT0A 3NS8A 4PYUA 4YXDB 2IGGA 4XGAB 3PO0A 3VQIA 1UGMA 2D3CA 1JRUA 4M01A 4DXGA 2IY0B 2KANA 4K7SA 2J53A 2W82A 3ZJVA 1WGYA 1MPEA 4YTNB 2HE7A 2I38A 5GMVA 3DHHC 1SIJA 3A33B 4WJPA 1QF6A 4N9F4 1C9FA 1RFAA 4ZHOA 4K1RB 4JWUC 4KGTA 1PGBA 3MHSD 2WDTB 1ISNA 2G45B 2HJ8A 1GNUA 2KFKA 3AE6B 3EHVA 3ZDTA 5HKHA 2M56B 3DBLI 1NENB 1AN8A 1SE4A 4BFRA 1YOVB 2WS3B 2FCNA 2K8HA 1V1PA 2X38A 4TMAB 5IO9A 1PUTA 4W9DA 3A4SC 2K6DB 5DCNA 2KJHB 2K8BA 4DBGA 2NBUA 1QZEA 2EKIA 3D32A 4L2YA 3SR6A 2C7HA 4HDOA 2PEAA 2L0TA 1ZXHA 4MH0E 1KH0A 3FAHA 4F1SA 2FUHB 2WP9B 5CTRC 1MG8A 4MELA 1FM0D 3KQ4A 2I1KA 3P4RB 3LYYA 1VR9A 2K1FA 4USAA 2KLCA 1FXTB 1L7YA 4RGOS 1NYQA 1A5RA 1F0ZA 4DXAB 2DZKA 1L5PA 1GJZA 2LVQA 1YQBA 2JPHA 1I4QA 3P63A 4OZBA 4YWGG 1FCLA 4C56C 1JMLA 2O2VB 1ZW7A 4YTMB 1MVKA 2DNFA 3UQAA 3R3MA 5G55A 1WR6E 2DZMA 2M0AA 4DDID 2LGIA 3B2FA 3I3TB 3ZIMA 2XEWA 4FULA 3ZQ4A 4EZKA 5C23A 1WGRA 2ZNVC 2G3QB 4FHJA 1ACCA 2OOBB 3H7SA 1HTOA 4MGIE 1ZUD2 1R4MB 2CU1A 4YSXB 3DVGY 1T0SC 5D7GA 4W9CA 5J17A 2NBVB 1HZ5A 4PYZA 2LGXA 1IBXB 2JXTA 2BKFA 1J0GA 1TGZB 5BYQA 1F52A 4WJOA 4YTPB 3IBEA 3GB1A 4FXCA 1P1AA 2MP2B 1FIQA 1VRAB 4NJ6A 1KLUD 3DHIC 1STEA 2FCSA 4WWMA 2N1WA 2KN4A 5TSSA 2LXCA 4I6PA 5GXGB 2M17A 3VTWA 5HHDG 1V5TA 3RNBC 2FBWB 1Q5WB 2L00B 2O2VA 1KF6B 4DK5A 1WIAA 1XEEA 2CS4A 3BK2A 5JXVA 4WAAA 1HTQA 3NRZA 3RNGC 4C00A 2QEJC 4XC2A 2O6VB 3AM9A 2MX2A 4NZLB 4NNJB 2REXA 4MACA 1ZDVA 2Y5PA 4RGNA 3TL5A 3UGBB 2JU6X 1L4ZB 2GBKA 2ZNVB 1WXQA 2KVRA 2DAFA 4DHZE 4TSSA 1JWMD 2RD0A 2IGDA 2N7DA 3H1UA 2BYTA 3S2AA 4II3B 1DYQA 1RRBA 1QT9A 2GMIC 4M02A 3Q8EA 2NTTA 2Z59B 2Q5WD 4HPMB 1IBXA 1YIWA 4Q2JA 1H4RA 2W54A 1CMXB 2WXIA 3ZDMC 1KM7A 3N32A 2J7QB 3VRAB 1FPYA 3EC8A 3QARA 2MP2A 3AXCA 1CK1A 1GPXA 4RF0A 1GB4A 1N60A 4LNFA 1E8YA 3KUDB 3DBLB 2L8JA 3DBSA 4OVUA 1KJTA 1WXSA 1XT9B 2MLBA 3P4PB 3VHTC 2N9XA 1WF9A 3HVDA 2WXJA 4EOYA 2QIEB 1ZDXA 4US9A 1JW9D 3R2TA 2GRIA 4ZYSA 3HK0A 1TY0A 2D11A 2L7RA 3N1YC 2QILA 2X8XX 3B08A 2BS4B 4S17A 2H88B 4MEMA 1C1YB 5KHOA 3HM3A 1XO3A 4A6QA 1V9JA 2O6VA 2YVCA 4JPSA 3U7DA 1D3ZA 3B9JA 3WIMA 4M0WB 1E8ZA 2DYOA 3K9OB 2BTEA 4LNIA 4RH6A 2MH7A 2N9EB 1WWTA 3M62B 2DYBA 4IM2A 2KXJA 3BWUD 4E3CA 3KUCB 1MHHE 4HKQA 2I2YA 5G5GA 1FRDA 2DLBA 2GB1A 2HTHA 1P9DU 3MC9A 1V81A 2FIFA 1TS4A 1YQ3B 2FCQA 2LGDA 4GU2A 1ZGUB 4J6IA 5I4DA 3AEGB 1Y8RC 1V49A 2ZVOA 3LB8C 3E56A 3NZ3A 1WSPA 1WFYA 4AJWA 4HLEA 3W9CB 1TS3A 1YQ4B 3GOEA 4IM0A 1EM7A 4MDKE 4RGTA 3NG0A 3MC0B 3AE8B 2VH2A 1TKGA 2M8SA 3BVMA 3PSEB 3X23A 1SBBB 2ZW0A 3BVZA 1SE9A 3QIJA 2V4LA 3HIZA 4H2AA 1QOAA 2L32A 5EE0A 4TQ1A 1ZP0B 3LDZE 3RNAC 5AZHA 5D3IB 3V62A 4BOZB 3L17A 5FK9C 2GBRA 5G2NA 4BZAA 4RNAA 1UZXB 1ZKHA 4WIPA 4IG7B 1IP9A 4P6VF 3TSSA 1HQRD 3RPFC 1YMHE 1NVID 3AE2B 4M0WA 1WE6A 4MJSB 1QQRA 3KWLA 2MHJA 1FFUA 1SXTA 4FN2A 4N58A 3L13A 3QWZB 3AE3B 3GZNI 1VCBA 1JALA 2KDEB 2W9NA 1E0ZA 1OTRB 1J7BA 2RDHA 3N1ZC 4FADA 3T3OA 1PDXA 1T6BX 3BIID 3MTNB 3WALA 1L0XB 1P7EA 2IY1B 3OAWA 1CZPA 4KV2A 1LQBA 5JZEB 3KUZA 1JRPA 4XE0A 4FA6A 3AB5A 4NJCA 1BUIC 1L0VB 2BPSA 2PVOD 3V05A 2KACA 3MFGA 1VJKA 2WXGA 2UWQA 3U4EG 1K53A 1K50A 3APDA 2JZZA 1VZ6A 4KZ0A 3A4RA 1MG4A 2L1AA 3PHWB 4K81A 3P4QB 4HJGE 3SU8X 4JWSC 3SHQA 3AH7A 3AMZA 2WU2B 4GGQA 1N5XA 1YX5B 4HPLB 3TEWA 2WYQA 2BGFA 2K25A 3BZDB 4TQ0A 5IP4D 3FILB 2IPKD 3EFCA 3N3KB 1D5XC 2BB6A 1L6UA 4MGYE 1KOTA 5CHVC 3MJ5A 2XBBC 4MJSA 4L1BA 2INCC 1TZOA 1C4AA 3NZSA 2KTRB 4RMAA 2RPQA 2MBBB 4ITKA 3UIOB 1E7PB 1E9MA 2R61A 1FNUA 3Q3JA 3AI5A 2JVCA 2IBIB 2UYZB 2BVCA 3CSTA 4PT5A 3R8BA 4J3OD 1U4AA 1RYJA 2MJ3A 1JWSD 1EWCA 1V97A 2H89B 4W9FA 3JYUA 1IUEA 2PE6B 2VZKB 1I7HA 1ZOYB 4RM8A 3GS2A 1E8WA 3DWMA 4ARIA 1P3QU 1GC7A 2PW9A 5E6PA 3AEAB 1UF0A 1IGCA 1ET6A 3UF8A 2KDFB 4D2KA 5BMHA 2MBOA 3TEYA 5BO4B 3SEBA 2PIAA 4W9HA 1OGWA 4KX6B 2ZCBA 3IT6B 2DYMA 2ZCCA 1OFFA 4ANUA 1MFWA 1BXTA 2V3SA 4HK2A 3PVLA 5H92C 2HDEA 2N0SB 3PZDA 3B0AA 1E10A 1Q1OA 2KQ4X 3GE8C 2IO0B 4KSLC 1WZ0A 2KWVB 2CU3A 3L4PA 2KWCA 2QCZA 4G3XB 4AS1A 2KX0A 3HM6X 2AL6A 1FXAA 2KD0A 3VFKA 4KIKB 3FILA 2YLMA 4ANWA 4NPNA 1SE3A 4E71A 2MSED 2CR5A 2RDGA 3BYTB 3R66C 3QAQA 1J19A 2MRPA 3V61A 1SF0A 2KTRA 5C3JB 4KKIA 3Q3FA 3AECB 2LGYA 2GBMA 4LTUA 3ZRFA 1PGXA 3W5VB 2EKEC 3QHTA 1T0YA 4TKNA 4W9IA 2M1MA 4BOSC 4N6EB 1CQVA 4LDTD 1IGDA 4HEA1 1VLBA 2KKCA 2Z0DB 1OEYA 2AL3A 1N62A 3Q3NC 4MGZE 3O65B 4IWOA 2FAZA 1MI0A 1LXDA 2M4NA 3RI7C 1TKYA 1KRHA 4X57B 2W3RA 5D2MB 3IAS1 1ENFA 2BW2A 4ZOHC 3NVVA 2J4XA 3PGEA 4FJYA 3NVYA 2K0PA 1IPGA 4P1BC 1V2YA 1FFVA 1WJ4A 2D2QA 2SEBD 3BK1A 3ZO5B 2HJ1A 2LI5A 4GDKB 4WWOA 5BYRA 3ONSA 2IO3B 1V1OA 4GOCA 2R2OA 1WX7A 2WDQB 1NBFC 3CF6E 2BF8B 2KX3A 2J0JA 3IVFA 1PFDA 5MPOA 2C7NB 2LXAA 3UINB 3NHEB 2JQRB 2MBHA 2WXNA 4E74A 4KIKA 3IHPC 1XLNA 1OQQA 3M3JA 1Z2MA 3PT2B 1CJEA 3P1MA 1FD6A 1TJEA 3KLSX 4HPPA 2ONQA 1XXGA 3AE7B 1NYRA 4IKGA 1YJ1A 4EKUA 3KVFB 2G9HD 1N5WA 5T8IA 4KDLB 3AE9B 4W9EA 3DWGC 5BMIA 3DBHI 3SFDB 5AUIA 4HXDA 4FHKA 1WZ3A 3DVNV 4A3PA 1TS2A 5LLIA 2N9LA 1SE2A 2N7EA 3KW5B 3K9PB 5E6NA 1TKEA 3DVGX 4IOIE 3V60A 3TEZA 2KOXA 4KZCA 2ASQA 1F77A 3T9LA 4IM3A 4IW0A 1V8CA 4GDKA 1I4GA 2EELA 1I4XA 4ACFA 2K6QA 1JWUD 2NMQA 4GDLB 2LJ5A 3C19A 2WU5B 1WJ6A 3AEEB 2C9WB 1I42A 4TUUA 4BKGA 3RT3B 2AQ3B 1WGHA 1UGJA 3N1XC 5BYSA 1TTNA 2CKHB 4F7ZA 4BBNC 1TS5A 2KO3A 1ZE3D 4ZRIA 1C3TA 2KJRA 2KJ6A 4JIOU 4EEWA 3PS6A 2K9XA 3P2BA 2BS3B 2LMCA 4LCDE 5H8YE 2V3NA 2C7MB 3MP9A 1GUAB 3BY4B 4WQMA 1WY8A 3H8HA 3U30A 3Q69A 3OLMD 1J7CA 1AYFA 2K3UA 2L3ZA 1F2RI 5EE1A 2J0MA 4G0NB 2LEKA 3FKYA 1RWSA 3Q6BA 2MQJA 3A1QB 1HZ6A 1XD3B 1WJNA 3N20C 1EF5A 2NTSA 2WXLA 1RFKA 2KDBA 3EUB2 1BMLC 1NI2A 4FJVB 2PPHA 2D07B 2CHWA 3M95A 2DBYA 1WMHB 2Y5CA 1NI3A 4P1CC 2LUEA 2RR9A 3VVWB 4A90A 4XWWA 3DBRI 3QA8A 3AULA 4XX5A 2JUOA 3AU5A 1TY2A 3P42A 3URYA 1S1QB 3ETRA 1WE7A 2V1YA 1T0RC 3L08A 4GMVA 4DWFA 1D6EC 4EFOA 2L52A 5FR3A 2BS2B 4AUQC 2GBJA 3IXSA 1YJIA 3I63C 3NY5A 4PS7A 4B9KA 1C76A 1FCCC 2JYEA 2K5PA 1NEKB 2KNBA 3TBLD 3HVZA 4MSMB 4LK0M 3ALBA 4GDLA 2VH1A 4ZRKA 4DDGD 1NDDA 2KMCA 4ZRJA 4OVZA 1VZ8A 4G50A 4JE3B 5KHQA 2HD5B 1I35A 3LJ3A 2PE9A 2RPVA 1PGAA 4WJNA 1GC6A 4CO7A 3I5JC 1PQSA 2JRHA 2FUG1 2JZ3B 4A9AA 1YN3A 1F9JA 2G1EA 4YSZB 1WM3A 2BYFA 4NQLB 4MT5A 2KK8A 3V6CB 3WCQA 3WAMA 3NZUA 2MCNB 2WX1A 2LUMA 5HI1A 3OWEB 4ARCA 1WXMA 1UBIA 5IKCM 4BKSD 3ZJUA 2G4DB 3DPDA 3DVNU 4F8CB 3A1QA 2ZJDA 3ZUNA 3W5UB 2WNMA 1WR1A 5AZGA 1XLOA 1YNTE 3TMPB 2LRWA 1E8XA 1WMHA 4PS3A 4BVUC 2V3PA 1TYGB 1WM2A
chains in the Genus database with same CATH topology
2LHEA 4EE2A 3R8BA 4PT5A 1YN4A 4J3OD 4OHJA 2M0AA 4XWTA 3HUIA 1M4VA 1RYJA 4IDIA 2MJ3A 4LLGM 1B1ZA 4A55A 2WXHA 1JWSD 2LGIA 3B2FA 1F2RC 1EWCA 1V97A 2H89B 3ZQ4A 2JX5A 2XN9C 1IUEA 2VZKB 1I7HA 2Z8LA 1ZOYB 4OZAA 1C79A 3GP7A 3GS2A 1HA5A 4ARIA 1D5MC 3DWMA 3I57A 1QKZA 1YJJA 1E6EB 1B9RA 1SSNA 2PW9A 2WXOA 3AEAB 1ACCA 4B0EA 1IGCA 2AQ1B 1ET6A 1QOFA 2WDRB 1ZUD2 4D2KA 2OEDA 5BMHA 3TEYA 3U7ZA 1EU4A 2K22A 4YSXB 1EU3A 5D7GA 3SEBA 2PIAA 2JSVX 1XF5L 4KX6B 1DOIA 1HZ5A 1IBXB 2JXTA 2DYMA 3IT6B 1OFFA 1L0YB 1BXTA 5BYQA 2WLBA 5H92C 2HDEA 2N0SB 1L4DB 2W3SA 1E10A 4YTPB 3GB1A 2KQ4X 1ZXIA 2WXPA 1RM6C 2RMMA 4FXCA 2YEPF 1FIQA 2M19A 4NAWB 1VRAB 2LJIA 1KLUD 3NVWA 2V4IB 2CU3A 3L4PA 1STEA 4AQ7A 4AS1A 4JX1C 1WYGA 2ZW1A 4WWMA 1FXAA 2KN4A 1XLPA 5TSSA 2D5GA 3FILA 5HFYA 3AEBB 4KGSA 1R7SA 4C7ZA 5GXGB 1SE3A 4WAFA 2RDGA 3BYTB 5HHDG 1JWBD 3AE1B 2FBWB 1SF0A 4DXFA 1K52A 3U52E 5C3JB 1YN5A 4KKIA 3PZ8A 3AECB 1KFYB 1KF6B 4HRSA 4LTUA 1PGXA 3W5VB 1XEEA 2ON8A 3BK2A 2WDVB 5JXVA 2L83A 3AE5B 1DOXA 4HKZE 3NRZA 2BB5A 3UI3A 1ESFA 1XCQL 5EE9A 2QEJC 4XDDA 1N63A 4N6EB 1CQVA 3AM9A 1IGDA 4HEA1 1VLBA 4NZLB 3ABVB 1N62A 1UWXA 3KWVA 1MI0A 3FC4A 4MACA 1ZDVA 1TKYA 2Y5PA 1KRHA 4RGNA 5I4DA 1VZ7A 2PKOA 2W3RA 1T5XD 3IAS1 1ENFA 2BW2A 4ZOHC 3PZ7A 3NVVA 2J4XA 2JU6X 2KAJA 1L4ZB 2MEKA 1WXQA 4GLSC 2KDMA 3NVYA 2K0PA 4TSSA 1JWMD 2IGDA 5EE3A 2SEBD 1FFVA 3HRDD 4YSYB 3BK1A 2BYTA 2ACZB 2INNE 4GDKB 5BYRA 1DYQA 1QT9A 2CJNA 3Q8EA 3B2GA 1AWDA 2NTTA 4R3DA 2BT6A 2Q5WD 3IT4B 1IBXA 4Q2JA 1V1OA 2W54A 1EWYC 3E9SA 3AV8A 4RFBA 2AX5A 2WDQB 1FO4A 2FE8A 2WXIA 1K51A 2B76B 3VRAB 1PFDA 5MPOA 1HXYD 1GOZA 1UUPA 3J9CA 3TUOA 1CK1A 4YT0B 5AUKA 3Q8BA 4RF0A 5C2TB 3VR8B 1GPXA 1QOBA 1GB4A 1N60A 4XDCA 2IDYA 1D5ZC 1ROEA 1UNSA 1LO5D 2JQRB 2KMMA 4B0MA 2WXNA 1L6VA 1A70A 4US8A 1XLNA 2INPE 1JWAD 1OQQA 3P4PB 4P16A 2JWUA 1XCTL 4C7YA 3P4SB 2PTLA 2WXJA 3HVDA 2QMTA 2QIEB 1CJEA 1ZDXA 4US9A 4ZHPA 1JW9D 2SAKA 3P1MA 3R2TA 2GRIA 2LFIA 4ZYSA 1TY0A 1FD6A 1TJEA 3NVZA 3KLSX 3ZYYX 1N61A 2JYTA 1HEZE 2ONQA 2QILA 3Q8CA 2YEPB 2BS4B 1XXGA 3AE7B 2H88B 1NYRA 1FEHA 1FNVA 4IKGA 2WQYB 1XO3A 5D3DA 2G9HD 1N5WA 3IAM1 4A6QA 3R2IA 4KGRA 3C8YA 4ZRPA 5T8IA 4JPSA 2N7JA 3AE9B 3B9JA 3DWGC 4OW0A 2BBCA 5BMIA 2DYOA 2BTEA 4A8XC 3SFDB 4RH6A 5AUIA 2J42A 2MH7A 2WXMA 1WWTA 3TEXA 3I9V1 1TS2A 2N9LA 4N59A 1SE2A 3BWUD 1C78A 1QILA 1TKEA 1JQ4A 1SEBD 3ZJTA 1MHHE 4HKQA 1Q10A 4IOIE 2E3TA 3TEZA 4O1NA 2I2YA 1GB1A 2MJDA 5G5GA 1F77A 1T3QA 1FRDA 2DLBA 2GB1A 1VDVA 4ZRQA 1V8CA 1I4GA 2EELA 1TS4A 3BVGA 1I4HA 1YQ3B 1I4XA 2WXKA 2OHFA 1PYWD 5FKAC 1D4BA 1JWUD 2NMQA 1C4CA 2XNAC 3AEGB 3AN1A 4NAMA 4GDLB 4C80A 3NS1A 2WU5B 3AEEB 3LB8C 4REZA 2CJOA 3E56A 3SFEB 1QLBB 3NZ3A 1WSPA 2PLPA 1JROA 3W9CB 1TS3A 1YQ4B 3Q8FA 4RGTA 1EM7A 2W55A 4OZCA 5HG2A 1DOYA 2KWDA 3MC0B 2WXRA 1V1PB 1ZPSA 2AQ3B 3AE8B 1UGJA 3VR9B 5G5HA 1JCKB 5BYSA 3U2SC 3W2DA 1TKGA 2DWQA 1TS5A 2HTME 3BVMA 2TSSA 1SBBB 2ZW0A 3BVZA 1WGKA 3MHZA 4RF1A 1ZE3D 4H2AA 3BYYB 2VZKD 2K9XA 3RFZB 2ICIA 2IGHA 2PMVA 2BS3B 1QOAA 2L32A 2LMCA 1FNWA 5EE0A 5H8YE 4TQ1A 1KTKA 2V3NA 1ZP0B 2V0GA 3MP9A 3CIRB 1FXIA 5D3IB 3T3NA 4WQMA 3VRBB 2PVGC 3AEFB 4KKJA 1I4RA 3H8HA 3EA6A 4WURA 5FK9C 3Q69A 4RNAA 1J7CA 1AYFA 2K3UA 3AE4B 2E6XA 4WIPA 1SJHD 1F2RI 1WRIA 2QJLA 4P6VF 5EE1A 3TSSA 1HQRD 2LEKA 3RPFC 3Q8AA 1RWSA 2GI9A 1YMHE 1NVID 1HZ6A 2NTSA 1C4PA 2IGGA 2WXLA 3AE2B 2LHDA 1RFKA 1FMAD 3PO0A 4MM3B 4M0WA 3VQIA 1QQRA 3EUB2 1BMLC 3KWLA 3N9YC 2J52A 1FFUA 1SXTA 1SJED 1FRRA 2DBYA 4N58A 5E6JA 5LNK1 2Y5CA 1NI3A 3AE3B 2JZPA 4A90A 4DXGA 4XWWA 1JALA 2QSDA 2J53A 1E0ZA 1GAQB 2W82A 1TY2A 3AEDB 3P42A 3URYA 3ZJVA 1J7BA 3ETRA 2RDHA 4HROA 1MPEA 3T3OA 1PDXA 1D6EC 1T6BX 2L52A 4YTNB 5FR3A 3BIID 2I38A 2BS2B 1L0XB 1P7EA 1SIJA 3IXSA 2IJ0A 1YJIA 1CZPA 3ZGZA 1QF6A 1KLGD 1C76A 1FCCC 2JYEA 2K5PA 1NEKB 1C9FA 1JRPA 3HVZA 4ZHOA 4JWUC 4KGTA 4XE0A 1PGBA 4YXDB 4LK0M 4RCOA 1UWMA 3AB5A 4NJCA 1BUIC 1L0VB 2PVOD 4L23A 3V05A 3AE6B 2KACA 1ET9A 4MH8A 2M56B 1C77A 3MFGA 1VJKA 2WXGA 1NENB 1XLQA 1AN8A 1SE4A 4OVZA 3U4EG 1K53A 1VZ8A 2WS3B 4JE3B 1V1PA 2X38A 4TMAB 1K50A 4CQNA 1I4PA 1PUTA 1Y56A 1AW7A 2Y3AA 1VZ6A 2RPVA 2EKIA 2L1AA 2MJEA 2WXQA 1PGAA 4L2YA 3SR6A 1SB3C 3P4QB 4HJGE 2WXFA 2FUG1 4JWSC 1ZXHA 4A9AA 1KH0A 3FAHA 1J7AA 1YN3A 5BMGA 3AH7A 3AMZA 2AQ2B 3W1SA 2G1EA 2WP9B 2WU2B 4YSZB 1FM0D 4MT5A 3V3XA 1N5XA 3KQ4A 3WCQA 3TEWA 3P4RB 3LYYA 3LXFA 1VR9A 4RGMA 4USAA 2LUMA 5HI1A 3OWEB 4ARCA 3BZDB 4TQ0A 3CWIA 4WH4A 3FILB 2IPKD 1MHXA 4DQOC 4RGOS 1D5XC 3EGRA 1NYQA 1F0ZA 2BB6A 3ZJUA 1L6UA 3NUHB 3O13A 3MJ5A 1L5PA 4L1BA 3W5UB 2WNMA 1TZOA 4UDUC 1I4QA 1C4AA 2N9KA 1XLOA 1QOGA 3P63A 1YNTE 4OZBA 4YWGG 1FCLA 4C56C 1P7FA 1JMLA 1E7PB 1E9MA 2R61A 1MVKA 4ITKA 1FNUA 1DGJA 4YTMB 2V3PA 1OQRA 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRR A;  2DBY A;  4N58 A;  5EE9 A;  2Y5C A;  1NI3 A;  3AE3 B;  3SFD B;  1N63 A;  4N6E B;  5AUI A;  3AM9 A;  2MH7 A;  3HUI A;  1RYJ A;  4IDI A;  2MJ3 A;  1JAL A;  1WWT A;  1VLB A;  3ABV B;  1E0Z A;  1GAQ B;  3AED B;  3B2F A;  1N62 A;  4N59 A;  1J7B A;  3ETR A;  4HRO A;  1V97 A;  2H89 B;  1TKE A;  3FC4 A;  1JQ4 A;  1PDX A;  2JX5 A;  1IUE A;  1TKY A;  1I7H A;  1KRH A;  2L52 A;  2PKO A;  2W3R A;  1ZOY B;  3BII D;  4YTN B;  2E3T A;  2BS2 B;  4ZOH C;  3NVV A;  3DWM A;  1SIJ A;  2MJD A;  2KAJ A;  5G5G A;  1T3Q A;  1YJJ A;  1FRD A;  1WXQ A;  1E6E B;  1B9R A;  1YJI A;  1VDV A;  1CZP A;  1V8C A;  3NVY A;  1QF6 A;  3AEA B;  2K5P A;  1NEK B;  1JRP A;  3HVZ A;  5EE3 A;  1YQ3 B;  4JWU C;  1FFV A;  3HRD D;  4YSY B;  4ZHO A;  1QOF A;  2WDR B;  1ZUD 2;  2ACZ B;  1UWM A;  3AB5 A;  1QT9 A;  2CJN A;  2K22 A;  1L0V B;  2PVO D;  4YSX B;  2OHF A;  3AE6 B;  3B2G A;  1AWD A;  2BT6 A;  2Q5W D;  2M56 B;  2PIA A;  3AEG B;  3AN1 A;  1VJK A;  4C80 A;  3NS1 A;  1NEN B;  1EWY C;  1XLQ A;  2W54 A;  2CJO A;  2WU5 B;  3AEE B;  3AV8 A;  3LB8 C;  1QLB B;  2WS3 B;  1DOI A;  2AX5 A;  4KX6 B;  2WDQ B;  1JRO A;  3W9C B;  1FO4 A;  1YQ4 B;  1PUT A;  2W55 A;  1DOY A;  1OFF A;  2B76 B;  2WLB A;  3VRA B;  3SFE B;  5H92 C;  2N0S B;  3AE8 B;  3VR9 B;  1PFD A;  2EKI A;  5MPO A;  5G5H A;  2MJE A;  2W3S A;  1E10 A;  4YTP B;  3SR6 A;  4YT0 B;  1TKG A;  5AUK A;  1ZXI A;  2DWQ A;  2HTM E;  1RM6 C;  5C2T B;  1SB3 C;  3P4Q B;  4FXC A;  1WGK A;  3VR8 B;  1QOB A;  1GPX A;  1N60 A;  1FIQ A;  4JWS C;  2M19 A;  4A9A A;  3FAH A;  1J7A A;  2JQR B;  1ROE A;  2KMM A;  3AH7 A;  3NVW A;  2K9X A;  2CU3 A;  3AMZ A;  1L6V A;  3L4P A;  1A70 A;  4US8 A;  2G1E A;  2WP9 B;  2BS3 B;  1QOA A;  2WU2 B;  1XLN A;  4YSZ B;  1JWA D;  4JX1 C;  1OQQ A;  1FM0 D;  3P4P B;  5EE0 A;  1WYG A;  5H8Y E;  1ZP0 B;  1N5X A;  4WWM A;  1FXA A;  3WCQ A;  1XLP A;  3CIR B;  4C7Y A;  1FXI A;  3P4R B;  3LXF A;  3P4S B;  4USA A;  3AEB B;  2QIE B;  4WQM A;  3VRB B;  2PVG C;  1CJE A;  1R7S A;  4US9 A;  4ZHP A;  4C7Z A;  3CWI A;  5GXG B;  1JW9 D;  3P1M A;  3AEF B;  1TJE A;  3NVZ A;  1NYQ A;  1J7C A;  1AYF A;  1F0Z A;  1JWB D;  3ZYY X;  1N61 A;  3AE4 B;  1L6U A;  3AE1 B;  2FBW B;  1SF0 A;  1WRI A;  4P6V F;  2QJL A;  5EE1 A;  1L5P A;  2BS4 B;  2LEK A;  3RPF C;  5C3J B;  3W5U B;  1RWS A;  3AE7 B;  2H88 B;  1NYR A;  3AEC B;  1NVI D;  1KFY B;  1KF6 B;  4YXD B;  3AE2 B;  1XLO A;  1QOG A;  1RFK A;  1FMA D;  1XO3 A;  2WQY B;  3P63 A;  3PO0 A;  4HRS A;  4LTU A;  3W5V B;  1N5W A;  4ITK A;  3EUB 2;  1E7P B;  1E9M A;  2WDV B;  2L83 A;  3AE5 B;  3KWL A;  1DGJ A;  4YTM B;  1FFU A;  3AE9 B;  1DOX A;  3B9J A;  3DWG C;  1OQR A;  1TYG B;  3NRZ A; 
#chains in the Genus database with same CATH topology
 4EE2 A;  4W9L A;  4XWT A;  3HUI A;  4I6N B;  4IDI A;  2NS5 A;  1WXA A;  4LLG M;  4A55 A;  1RAX A;  1WRD B;  2WXH A;  4C4V B;  1F2R C;  1V6E A;  2D10 A;  1UBQ A;  2RSU A;  2LRU A;  2Z8L A;  1C79 A;  3VTV A;  3GP7 A;  1HA5 A;  1D5M C;  3KYD D;  1QKZ A;  4LNO A;  1E6E B;  1B9R A;  1TT5 B;  2JT4 B;  2WXO A;  4B0E A;  3DOW A;  2AQ1 B;  3ZXV A;  4G11 A;  4ANV A;  2OED A;  2K22 A;  1EU3 A;  2FID A;  2FCM A;  2JSV X;  3JVZ X;  4AP4 C;  1DOI A;  3Q3O C;  2WWZ A;  4ASW C;  2AWT A;  2WLB A;  1L4D B;  5JHA A;  2W3S A;  3C0R B;  5E6O A;  4EZL A;  1H8C A;  3A9J B;  1RM6 C;  2RMM A;  2I1J A;  3VXW A;  4NAW B;  3PTF C;  1IYF A;  2MBE A;  2MA9 B;  1Z5S B;  4JX1 C;  2KQS A;  3VDZ A;  2ZW1 A;  1XLP A;  3VUW A;  1WGG A;  3EFU A;  4KGS A;  4C7Z A;  1JWB D;  1F1H A;  3AE1 B;  4DXF A;  3U52 E;  2IZV B;  2EMS A;  2J0K A;  3ENE A;  3ZXR A;  1EF1 A;  3ZVV A;  1YN5 A;  3PZ8 A;  1KFY B;  2ON8 A;  2WDV B;  2L83 A;  4JL9 A;  1DOX A;  2KWU B;  2BB5 A;  3UI3 A;  3RNE C;  1XCQ L;  2LAS A;  4XDD A;  4C4V A;  3CMM B;  3U8Z A;  3ABV B;  3TJP A;  2FNJ B;  1UWX A;  4TV3 A;  2QC8 A;  2PKO A;  3R7Q A;  1T5X D;  2KN5 A;  4HJK A;  3PZ7 A;  2KAJ A;  2MEK A;  3UQB A;  4GLS C;  3SDL C;  2CHZ A;  5EE3 A;  3HRD D;  3V6E B;  2AEH A;  2ACZ B;  4LDT B;  1WI0 A;  3B2G A;  4R3D A;  2BT6 A;  2NBW B;  2JXX A;  3IT4 B;  3TCA A;  3E9S A;  1G6J A;  4A20 A;  1N6Z A;  2AX5 A;  3H6N A;  4LNN A;  2ZEQ A;  3ZW3 A;  1FO4 A;  5JHB A;  2A5U A;  5CHF A;  1WX9 A;  2B76 B;  3BIN A;  4WJQ A;  1HXY D;  1J8C A;  4XYC A;  3J9C A;  3TUO A;  4NAW A;  3Q8B A;  4ANX A;  5C2T B;  3RMK C;  4BKT A;  4A3O A;  4ICV A;  2JRI B;  4XDC A;  3NJT A;  4GIV A;  2IDY A;  1D5Z C;  1LO5 D;  4EUT A;  1L6V A;  3IFW B;  2WHI A;  2KMA A;  2INP E;  2ZVN A;  3RUI B;  3W1S C;  4P16 A;  1XCT L;  4KVG B;  3P4S B;  2PTL A;  1EO6 A;  2QMT A;  3VUY A;  2LGS A;  4ZHP A;  3HHM A;  4DHJ D;  5LXH A;  4W9G A;  3VAW A;  2JYT A;  1HEZ E;  2N1V A;  3L0W B;  4NJ7 A;  3Q8C A;  1FEH A;  5IA7 A;  1V86 A;  2LVP A;  2RDB C;  5DPR A;  2KVZ A;  2WGS A;  3R2I A;  4KGR A;  4M8M A;  3ECI A;  3RNC C;  5D6J B;  2GBN A;  2MWS B;  4OW0 A;  4A8X C;  2J42 A;  2GOW A;  2WXM A;  2R2Q A;  4K7W A;  4BAX A;  5L95 C;  4GSW A;  5AEK B;  4GB9 A;  3ZNH B;  3ZJT A;  2E3T A;  3ZLZ A;  1GB1 A;  4S0R A;  1VDV A;  4ZRQ A;  4K3B A;  2JF5 A;  3X0W A;  3BVG A;  2EMT A;  2Y5B B;  3L16 A;  3QCA A;  3ZNG C;  2LZ6 A;  2KQ7 A;  4RM9 A;  2OHF A;  5FKA C;  1D4B A;  3RCZ A;  3L54 A;  1C4C A;  2XNA C;  3AN1 A;  4C80 A;  3NS1 A;  4REZ A;  3SFE B;  1QLB B;  3CSF A;  4JQW C;  1JRO A;  2W55 A;  2BKR B;  2KWD A;  2WXR A;  3B1L X;  5G5H A;  3RZW C;  5CX3 A;  2IO2 B;  5DPW A;  3ZNI D;  3MHZ A;  2HTM E;  2QDF A;  3GZN B;  4RF1 A;  2NCN A;  1OEY J;  1K8R B;  3VH3 B;  3RUL A;  1KLV A;  1SIF A;  2VZK D;  3RFZ B;  2IGH A;  1GG3 A;  3PRP B;  1FNW A;  3APC A;  2V0G A;  1WH3 A;  3T3N A;  3VRB B;  2PVG C;  4QAY A;  4KKJ A;  3EA6 A;  4WUR A;  1WGD A;  2IYD B;  1R4N I;  3AE4 B;  2E6X A;  1WRI A;  2DAJ A;  3ZNZ B;  2GI9 A;  2RGF A;  2Z0E B;  1C4P A;  4MM3 B;  2LHD A;  1FMA D;  2KHW B;  2KFJ A;  3N9Y C;  1E5W A;  2OJR A;  4URK A;  1WX8 A;  2MW5 A;  2J52 A;  1OQY A;  1SJE D;  1FRR A;  5E6J A;  3TIX A;  5LNK 1;  2AYO B;  5J2R A;  3PLU A;  2JZP A;  2LD9 A;  2DHZ A;  2M0X A;  2QSD A;  1GAQ B;  2C60 A;  1VD2 A;  3WAP A;  4HRO A;  4M8N A;  2NVU I;  1P98 A;  2KDI A;  2IJ0 A;  3ZGZ A;  1KLG D;  3NOB A;  4CYE A;  4K3C A;  4ZYN A;  3JW0 X;  4RCO A;  1UWM A;  4ZDV A;  5IN7 A;  4L23 A;  4HDQ A;  2A4Z A;  3OJ4 B;  3RN9 C;  1ET9 A;  4MH8 A;  1C77 A;  4AOF A;  1XLQ A;  1UD7 A;  1XQQ A;  4CQN A;  1I4P A;  1Y56 A;  1AW7 A;  2Y3A A;  3T8M A;  2MJE A;  2WXQ A;  4FLH A;  4K7U A;  5IOI A;  4BBN F;  1SB3 C;  2WXF A;  1L2N A;  1MJD A;  1WYW B;  1J7A A;  5BMG A;  3WA0 A;  2AQ2 B;  3RD2 A;  3W1S A;  4JLC A;  2BWF A;  4DHZ B;  3V3X A;  5CHW A;  2MBQ A;  3WAO A;  2KLG A;  3VUX A;  4NY0 A;  3LXF A;  2JWZ A;  3PV1 A;  4RGM A;  1V80 A;  1HE8 A;  1S3S G;  4HCP B;  3CWI A;  4B6W A;  4WH4 A;  4PK1 A;  1P0R A;  1MHX A;  4DQO C;  3EGR A;  4IC7 B;  1LFD A;  3NUH B;  3O13 A;  4YL8 A;  4MM3 A;  1M94 A;  2UU7 A;  3AU4 A;  3QC8 B;  4UDU C;  2N9K A;  3DDC B;  1QOG A;  3RNF C;  1P7F A;  1DGJ A;  1OQR A;  3AED B;  1TBE A;  2LHE A;  5EDS A;  1YN4 A;  2K8C A;  4OHJ A;  4LJO B;  3Q2A C;  1M4V A;  1SGH A;  1B1Z A;  2XK5 B;  4II2 B;  3ZTC A;  3RZF A;  1WJU A;  2BYV E;  1LGR A;  2JX5 A;  4AWJ A;  2XN9 C;  2C5L C;  3PPA A;  4B95 A;  4OZA A;  3QQ8 B;  1E7U A;  2ZPN A;  3I57 A;  3Q14 C;  2N4F A;  1T0Q C;  1YJJ A;  3EEC A;  4HCN B;  2N9P C;  1SSN A;  3QX1 A;  3GE3 C;  1QOF A;  2WDR B;  2D3G A;  3U7Z A;  1EU4 A;  2G4S A;  4EZJ A;  1XF5 L;  5D94 A;  3PRE A;  3IG3 A;  3L10 B;  2NPT B;  3PLV A;  1L0Y B;  2D3A A;  4LNK A;  2GLS A;  5TR5 A;  1ZXI A;  2WXP A;  3DQV A;  2YEP F;  2M19 A;  4KSK C;  4JGH B;  4IUM B;  2LJI A;  3KH0 A;  3NVW A;  2V4I B;  4AQ7 A;  3RYT A;  1WYG A;  3ML8 A;  2D5G A;  5HFY A;  3ZTD A;  3AEB B;  1R7S A;  3ZKJ C;  2O6V D;  4WAF A;  4NQK E;  4WWN A;  3QK0 A;  2LVO A;  1UEL A;  1K52 A;  4FBJ B;  4HRS A;  3AE5 B;  4HKZ E;  1ESF A;  1TIF A;  5EE9 A;  2XK5 A;  1N63 A;  4BKS A;  2QHO A;  3PRM B;  3OJ3 A;  5FR6 A;  4ICU A;  2ZPY A;  1R4N B;  3KWV A;  3M63 B;  3FC4 A;  1VZ7 A;  4KDI C;  5JH5 C;  5J18 A;  3DHG C;  2K39 A;  2KDM A;  5DPS A;  4YSY B;  4FJZ A;  2INN E;  2IND C;  2KC1 A;  2CJN A;  1AWD A;  2KC2 A;  3H7P B;  2NPT A;  4MSQ B;  1EWY C;  3AV8 A;  3PRZ A;  5IAA C;  4RFB A;  1Q0W B;  3Q3M C;  1AAR A;  2FE8 A;  2KZR A;  1K51 A;  1RLF A;  3A9K B;  5C1Z A;  4LJP B;  1YX6 B;  1GOZ A;  1UUP A;  4YT0 B;  4IWP A;  2BQQ A;  3DBH B;  5AUK A;  3VR8 B;  4MGK E;  4PS8 A;  1QOB A;  2JY6 A;  2VRR B;  1UNS A;  1ROE A;  2KMM A;  4B0M A;  3MC8 A;  1A70 A;  4US8 A;  2D3B A;  1JWA D;  3UIP B;  3SD5 A;  2NR2 A;  3ZRC A;  1E90 A;  4M00 A;  2JWU A;  4C7Y A;  3JSV B;  2SAK A;  2LFI A;  3H9D A;  3NVZ A;  3ZYY X;  2L0F A;  1N61 A;  4AJY B;  2LWP A;  2B3A A;  2YEP B;  1YD8 U;  3VTU A;  1EUV B;  1FNV A;  2BWE S;  1E7V A;  2WQY B;  5D3D A;  3IAM 1;  3C8Y A;  4ZRP A;  3DCG A;  4I6L B;  2N7J A;  3WAN A;  3N30 A;  2PJH A;  2BBC A;  4WWP A;  2IO1 B;  4DHJ B;  1R4M I;  2ZZP B;  3TEX A;  3I9V 1;  4N59 A;  1C78 A;  2WX0 A;  1QIL A;  1JQ4 A;  1SEB D;  3MJW A;  1Q10 A;  4W9K A;  2L05 A;  4O1N A;  2MJD A;  1UH6 A;  3QJZ A;  1T3Q A;  1TZ1 A;  2V9H A;  1WXV A;  5L83 A;  4HVB A;  2DX5 B;  2DZI A;  1I4H A;  2KT7 A;  4W9J A;  3H7P A;  2DZJ A;  2WXK A;  1PYW D;  2KYW A;  2KTF A;  4XZ4 A;  4NAM A;  2CHX A;  2CJO A;  2KFK B;  2PLP A;  3A9K A;  3ML9 A;  3Q8F A;  1DOY A;  4OZC A;  5HG2 A;  4P7I A;  1V1P B;  3R7R A;  1ZPS A;  3VR9 B;  3W1Y A;  1JCK B;  1V5O A;  3KYC D;  2L76 A;  4GN1 A;  3U2S C;  3OG5 A;  3W2D A;  3VH4 B;  2DWQ A;  2TSS A;  1WGK A;  3DBR B;  2BYE A;  3BYY B;  2ICI A;  2PMV A;  5LXI B;  1LM8 B;  1KTK A;  4CHK A;  3JSV A;  3CIR B;  1FXI A;  4GXB A;  2OJW A;  3PHX B;  3A9J A;  3APF A;  3AEF B;  1I4R A;  4WQO B;  2DEN B;  4OVV A;  1SJH D;  4HWI B;  2QJL A;  1X1M A;  5DPT A;  3Q8A A;  5AZF A;  4IWQ A;  1BT0 A;  3NS8 A;  4PYU A;  4YXD B;  2IGG A;  4XGA B;  3PO0 A;  3VQI A;  1UGM A;  2D3C A;  1JRU A;  4M01 A;  4DXG A;  2IY0 B;  2KAN A;  4K7S A;  2J53 A;  2W82 A;  3ZJV A;  1WGY A;  1MPE A;  4YTN B;  2HE7 A;  2I38 A;  5GMV A;  3DHH C;  1SIJ A;  3A33 B;  4WJP A;  1QF6 A;  4N9F 4;  1C9F A;  1RFA A;  4ZHO A;  4K1R B;  4JWU C;  4KGT A;  1PGB A;  3MHS D;  2WDT B;  1ISN A;  2G45 B;  2HJ8 A;  1GNU A;  2KFK A;  3AE6 B;  3EHV A;  3ZDT A;  5HKH A;  2M56 B;  3DBL I;  1NEN B;  1AN8 A;  1SE4 A;  4BFR A;  1YOV B;  2WS3 B;  2FCN A;  2K8H A;  1V1P A;  2X38 A;  4TMA B;  5IO9 A;  1PUT A;  4W9D A;  3A4S C;  2K6D B;  5DCN A;  2KJH B;  2K8B A;  4DBG A;  2NBU A;  1QZE A;  2EKI A;  3D32 A;  4L2Y A;  3SR6 A;  2C7H A;  4HDO A;  2PEA A;  2L0T A;  1ZXH A;  4MH0 E;  1KH0 A;  3FAH A;  4F1S A;  2FUH B;  2WP9 B;  5CTR C;  1MG8 A;  4MEL A;  1FM0 D;  3KQ4 A;  2I1K A;  3P4R B;  3LYY A;  1VR9 A;  2K1F A;  4USA A;  2KLC A;  1FXT B;  1L7Y A;  4RGO S;  1NYQ A;  1A5R A;  1F0Z A;  4DXA B;  2DZK A;  1L5P A;  1GJZ A;  2LVQ A;  1YQB A;  2JPH A;  1I4Q A;  3P63 A;  4OZB A;  4YWG G;  1FCL A;  4C56 C;  1JML A;  2O2V B;  1ZW7 A;  4YTM B;  1MVK A;  2DNF A;  3UQA A;  3R3M A;  5G55 A;  1WR6 E;  2DZM A;  2M0A A;  4DDI D;  2LGI A;  3B2F A;  3I3T B;  3ZIM A;  2XEW A;  4FUL A;  3ZQ4 A;  4EZK A;  5C23 A;  1WGR A;  2ZNV C;  2G3Q B;  4FHJ A;  1ACC A;  2OOB B;  3H7S A;  1HTO A;  4MGI E;  1ZUD 2;  1R4M B;  2CU1 A;  4YSX B;  3DVG Y;  1T0S C;  5D7G A;  4W9C A;  5J17 A;  2NBV B;  1HZ5 A;  4PYZ A;  2LGX A;  1IBX B;  2JXT A;  2BKF A;  1J0G A;  1TGZ B;  5BYQ A;  1F52 A;  4WJO A;  4YTP B;  3IBE A;  3GB1 A;  4FXC A;  1P1A A;  2MP2 B;  1FIQ A;  1VRA B;  4NJ6 A;  1KLU D;  3DHI C;  1STE A;  2FCS A;  4WWM A;  2N1W A;  2KN4 A;  5TSS A;  2LXC A;  4I6P A;  5GXG B;  2M17 A;  3VTW A;  5HHD G;  1V5T A;  3RNB C;  2FBW B;  1Q5W B;  2L00 B;  2O2V A;  1KF6 B;  4DK5 A;  1WIA A;  1XEE A;  2CS4 A;  3BK2 A;  5JXV A;  4WAA A;  1HTQ A;  3NRZ A;  3RNG C;  4C00 A;  2QEJ C;  4XC2 A;  2O6V B;  3AM9 A;  2MX2 A;  4NZL B;  4NNJ B;  2REX A;  4MAC A;  1ZDV A;  2Y5P A;  4RGN A;  3TL5 A;  3UGB B;  2JU6 X;  1L4Z B;  2GBK A;  2ZNV B;  1WXQ A;  2KVR A;  2DAF A;  4DHZ E;  4TSS A;  1JWM D;  2RD0 A;  2IGD A;  2N7D A;  3H1U A;  2BYT A;  3S2A A;  4II3 B;  1DYQ A;  1RRB A;  1QT9 A;  2GMI C;  4M02 A;  3Q8E A;  2NTT A;  2Z59 B;  2Q5W D;  4HPM B;  1IBX A;  1YIW A;  4Q2J A;  1H4R A;  2W54 A;  1CMX B;  2WXI A;  3ZDM C;  1KM7 A;  3N32 A;  2J7Q B;  3VRA B;  1FPY A;  3EC8 A;  3QAR A;  2MP2 A;  3AXC A;  1CK1 A;  1GPX A;  4RF0 A;  1GB4 A;  1N60 A;  4LNF A;  1E8Y A;  3KUD B;  3DBL B;  2L8J A;  3DBS A;  4OVU A;  1KJT A;  1WXS A;  1XT9 B;  2MLB A;  3P4P B;  3VHT C;  2N9X A;  1WF9 A;  3HVD A;  2WXJ A;  4EOY A;  2QIE B;  1ZDX A;  4US9 A;  1JW9 D;  3R2T A;  2GRI A;  4ZYS A;  3HK0 A;  1TY0 A;  2D11 A;  2L7R A;  3N1Y C;  2QIL A;  2X8X X;  3B08 A;  2BS4 B;  4S17 A;  2H88 B;  4MEM A;  1C1Y B;  5KHO A;  3HM3 A;  1XO3 A;  4A6Q A;  1V9J A;  2O6V A;  2YVC A;  4JPS A;  3U7D A;  1D3Z A;  3B9J A;  3WIM A;  4M0W B;  1E8Z A;  2DYO A;  3K9O B;  2BTE A;  4LNI A;  4RH6 A;  2MH7 A;  2N9E B;  1WWT A;  3M62 B;  2DYB A;  4IM2 A;  2KXJ A;  3BWU D;  4E3C A;  3KUC B;  1MHH E;  4HKQ A;  2I2Y A;  5G5G A;  1FRD A;  2DLB A;  2GB1 A;  2HTH A;  1P9D U;  3MC9 A;  1V81 A;  2FIF A;  1TS4 A;  1YQ3 B;  2FCQ A;  2LGD A;  4GU2 A;  1ZGU B;  4J6I A;  5I4D A;  3AEG B;  1Y8R C;  1V49 A;  2ZVO A;  3LB8 C;  3E56 A;  3NZ3 A;  1WSP A;  1WFY A;  4AJW A;  4HLE A;  3W9C B;  1TS3 A;  1YQ4 B;  3GOE A;  4IM0 A;  1EM7 A;  4MDK E;  4RGT A;  3NG0 A;  3MC0 B;  3AE8 B;  2VH2 A;  1TKG A;  2M8S A;  3BVM A;  3PSE B;  3X23 A;  1SBB B;  2ZW0 A;  3BVZ A;  1SE9 A;  3QIJ A;  2V4L A;  3HIZ A;  4H2A A;  1QOA A;  2L32 A;  5EE0 A;  4TQ1 A;  1ZP0 B;  3LDZ E;  3RNA C;  5AZH A;  5D3I B;  3V62 A;  4BOZ B;  3L17 A;  5FK9 C;  2GBR A;  5G2N A;  4BZA A;  4RNA A;  1UZX B;  1ZKH A;  4WIP A;  4IG7 B;  1IP9 A;  4P6V F;  3TSS A;  1HQR D;  3RPF C;  1YMH E;  1NVI D;  3AE2 B;  4M0W A;  1WE6 A;  4MJS B;  1QQR A;  3KWL A;  2MHJ A;  1FFU A;  1SXT A;  4FN2 A;  4N58 A;  3L13 A;  3QWZ B;  3AE3 B;  3GZN I;  1VCB A;  1JAL A;  2KDE B;  2W9N A;  1E0Z A;  1OTR B;  1J7B A;  2RDH A;  3N1Z C;  4FAD A;  3T3O A;  1PDX A;  1T6B X;  3BII D;  3MTN B;  3WAL A;  1L0X B;  1P7E A;  2IY1 B;  3OAW A;  1CZP A;  4KV2 A;  1LQB A;  5JZE B;  3KUZ A;  1JRP A;  4XE0 A;  4FA6 A;  3AB5 A;  4NJC A;  1BUI C;  1L0V B;  2BPS A;  2PVO D;  3V05 A;  2KAC A;  3MFG A;  1VJK A;  2WXG A;  2UWQ A;  3U4E G;  1K53 A;  1K50 A;  3APD A;  2JZZ A;  1VZ6 A;  4KZ0 A;  3A4R A;  1MG4 A;  2L1A A;  3PHW B;  4K81 A;  3P4Q B;  4HJG E;  3SU8 X;  4JWS C;  3SHQ A;  3AH7 A;  3AMZ A;  2WU2 B;  4GGQ A;  1N5X A;  1YX5 B;  4HPL B;  3TEW A;  2WYQ A;  2BGF A;  2K25 A;  3BZD B;  4TQ0 A;  5IP4 D;  3FIL B;  2IPK D;  3EFC A;  3N3K B;  1D5X C;  2BB6 A;  1L6U A;  4MGY E;  1KOT A;  5CHV C;  3MJ5 A;  2XBB C;  4MJS A;  4L1B A;  2INC C;  1TZO A;  1C4A A;  3NZS A;  2KTR B;  4RMA A;  2RPQ A;  2MBB B;  4ITK A;  3UIO B;  1E7P B;  1E9M A;  2R61 A;  1FNU A;  3Q3J A;  3AI5 A;  2JVC A;  2IBI B;  2UYZ B;  2BVC A;  3CST A;  4PT5 A;  3R8B A;  4J3O D;  1U4A A;  1RYJ A;  2MJ3 A;  1JWS D;  1EWC A;  1V97 A;  2H89 B;  4W9F A;  3JYU A;  1IUE A;  2PE6 B;  2VZK B;  1I7H A;  1ZOY B;  4RM8 A;  3GS2 A;  1E8W A;  3DWM A;  4ARI A;  1P3Q U;  1GC7 A;  2PW9 A;  5E6P A;  3AEA B;  1UF0 A;  1IGC A;  1ET6 A;  3UF8 A;  2KDF B;  4D2K A;  5BMH A;  2MBO A;  3TEY A;  5BO4 B;  3SEB A;  2PIA A;  4W9H A;  1OGW A;  4KX6 B;  2ZCB A;  3IT6 B;  2DYM A;  2ZCC A;  1OFF A;  4ANU A;  1MFW A;  1BXT A;  2V3S A;  4HK2 A;  3PVL A;  5H92 C;  2HDE A;  2N0S B;  3PZD A;  3B0A A;  1E10 A;  1Q1O A;  2KQ4 X;  3GE8 C;  2IO0 B;  4KSL C;  1WZ0 A;  2KWV B;  2CU3 A;  3L4P A;  2KWC A;  2QCZ A;  4G3X B;  4AS1 A;  2KX0 A;  3HM6 X;  2AL6 A;  1FXA A;  2KD0 A;  3VFK A;  4KIK B;  3FIL A;  2YLM A;  4ANW A;  4NPN A;  1SE3 A;  4E71 A;  2MSE D;  2CR5 A;  2RDG A;  3BYT B;  3R66 C;  3QAQ A;  1J19 A;  2MRP A;  3V61 A;  1SF0 A;  2KTR A;  5C3J B;  4KKI A;  3Q3F A;  3AEC B;  2LGY A;  2GBM A;  4LTU A;  3ZRF A;  1PGX A;  3W5V B;  2EKE C;  3QHT A;  1T0Y A;  4TKN A;  4W9I A;  2M1M A;  4BOS C;  4N6E B;  1CQV A;  4LDT D;  1IGD A;  4HEA 1;  1VLB A;  2KKC A;  2Z0D B;  1OEY A;  2AL3 A;  1N62 A;  3Q3N C;  4MGZ E;  3O65 B;  4IWO A;  2FAZ A;  1MI0 A;  1LXD A;  2M4N A;  3RI7 C;  1TKY A;  1KRH A;  4X57 B;  2W3R A;  5D2M B;  3IAS 1;  1ENF A;  2BW2 A;  4ZOH C;  3NVV A;  2J4X A;  3PGE A;  4FJY A;  3NVY A;  2K0P A;  1IPG A;  4P1B C;  1V2Y A;  1FFV A;  1WJ4 A;  2D2Q A;  2SEB D;  3BK1 A;  3ZO5 B;  2HJ1 A;  2LI5 A;  4GDK B;  4WWO A;  5BYR A;  3ONS A;  2IO3 B;  1V1O A;  4GOC A;  2R2O A;  1WX7 A;  2WDQ B;  1NBF C;  3CF6 E;  2BF8 B;  2KX3 A;  2J0J A;  3IVF A;  1PFD A;  5MPO A;  2C7N B;  2LXA A;  3UIN B;  3NHE B;  2JQR B;  2MBH A;  2WXN A;  4E74 A;  4KIK A;  3IHP C;  1XLN A;  1OQQ A;  3M3J A;  1Z2M A;  3PT2 B;  1CJE A;  3P1M A;  1FD6 A;  1TJE A;  3KLS X;  4HPP A;  2ONQ A;  1XXG A;  3AE7 B;  1NYR A;  4IKG A;  1YJ1 A;  4EKU A;  3KVF B;  2G9H D;  1N5W A;  5T8I A;  4KDL B;  3AE9 B;  4W9E A;  3DWG C;  5BMI A;  3DBH I;  3SFD B;  5AUI A;  4HXD A;  4FHK A;  1WZ3 A;  3DVN V;  4A3P A;  1TS2 A;  5LLI A;  2N9L A;  1SE2 A;  2N7E A;  3KW5 B;  3K9P B;  5E6N A;  1TKE A;  3DVG X;  4IOI E;  3V60 A;  3TEZ A;  2KOX A;  4KZC A;  2ASQ A;  1F77 A;  3T9L A;  4IM3 A;  4IW0 A;  1V8C A;  4GDK A;  1I4G A;  2EEL A;  1I4X A;  4ACF A;  2K6Q A;  1JWU D;  2NMQ A;  4GDL B;  2LJ5 A;  3C19 A;  2WU5 B;  1WJ6 A;  3AEE B;  2C9W B;  1I42 A;  4TUU A;  4BKG A;  3RT3 B;  2AQ3 B;  1WGH A;  1UGJ A;  3N1X C;  5BYS A;  1TTN A;  2CKH B;  4F7Z A;  4BBN C;  1TS5 A;  2KO3 A;  1ZE3 D;  4ZRI A;  1C3T A;  2KJR A;  2KJ6 A;  4JIO U;  4EEW A;  3PS6 A;  2K9X A;  3P2B A;  2BS3 B;  2LMC A;  4LCD E;  5H8Y E;  2V3N A;  2C7M B;  3MP9 A;  1GUA B;  3BY4 B;  4WQM A;  1WY8 A;  3H8H A;  3U30 A;  3Q69 A;  3OLM D;  1J7C A;  1AYF A;  2K3U A;  2L3Z A;  1F2R I;  5EE1 A;  2J0M A;  4G0N B;  2LEK A;  3FKY A;  1RWS A;  3Q6B A;  2MQJ A;  3A1Q B;  1HZ6 A;  1XD3 B;  1WJN A;  3N20 C;  1EF5 A;  2NTS A;  2WXL A;  1RFK A;  2KDB A;  3EUB 2;  1BML C;  1NI2 A;  4FJV B;  2PPH A;  2D07 B;  2CHW A;  3M95 A;  2DBY A;  1WMH B;  2Y5C A;  1NI3 A;  4P1C C;  2LUE A;  2RR9 A;  3VVW B;  4A90 A;  4XWW A;  3DBR I;  3QA8 A;  3AUL A;  4XX5 A;  2JUO A;  3AU5 A;  1TY2 A;  3P42 A;  3URY A;  1S1Q B;  3ETR A;  1WE7 A;  2V1Y A;  1T0R C;  3L08 A;  4GMV A;  4DWF A;  1D6E C;  4EFO A;  2L52 A;  5FR3 A;  2BS2 B;  4AUQ C;  2GBJ A;  3IXS A;  1YJI A;  3I63 C;  3NY5 A;  4PS7 A;  4B9K A;  1C76 A;  1FCC C;  2JYE A;  2K5P A;  1NEK B;  2KNB A;  3TBL D;  3HVZ A;  4MSM B;  4LK0 M;  3ALB A;  4GDL A;  2VH1 A;  4ZRK A;  4DDG D;  1NDD A;  2KMC A;  4ZRJ A;  4OVZ A;  1VZ8 A;  4G50 A;  4JE3 B;  5KHQ A;  2HD5 B;  1I35 A;  3LJ3 A;  2PE9 A;  2RPV A;  1PGA A;  4WJN A;  1GC6 A;  4CO7 A;  3I5J C;  1PQS A;  2JRH A;  2FUG 1;  2JZ3 B;  4A9A A;  1YN3 A;  1F9J A;  2G1E A;  4YSZ B;  1WM3 A;  2BYF A;  4NQL B;  4MT5 A;  2KK8 A;  3V6C B;  3WCQ A;  3WAM A;  3NZU A;  2MCN B;  2WX1 A;  2LUM A;  5HI1 A;  3OWE B;  4ARC A;  1WXM A;  1UBI A;  5IKC M;  4BKS D;  3ZJU A;  2G4D B;  3DPD A;  3DVN U;  4F8C B;  3A1Q A;  2ZJD A;  3ZUN A;  3W5U B;  2WNM A;  1WR1 A;  5AZG A;  1XLO A;  1YNT E;  3TMP B;  2LRW A;  1E8X A;  1WMH A;  4PS3 A;  4BVU C;  2V3P A;  1TYG B;  1WM2 A; 
#chains in the Genus database with same CATH homology
 2LHE A;  4EE2 A;  3R8B A;  4PT5 A;  1YN4 A;  4J3O D;  4OHJ A;  2M0A A;  4XWT A;  3HUI A;  1M4V A;  1RYJ A;  4IDI A;  2MJ3 A;  4LLG M;  1B1Z A;  4A55 A;  2WXH A;  1JWS D;  2LGI A;  3B2F A;  1F2R C;  1EWC A;  1V97 A;  2H89 B;  3ZQ4 A;  2JX5 A;  2XN9 C;  1IUE A;  2VZK B;  1I7H A;  2Z8L A;  1ZOY B;  4OZA A;  1C79 A;  3GP7 A;  3GS2 A;  1HA5 A;  4ARI A;  1D5M C;  3DWM A;  3I57 A;  1QKZ A;  1YJJ A;  1E6E B;  1B9R A;  1SSN A;  2PW9 A;  2WXO A;  3AEA B;  1ACC A;  4B0E A;  1IGC A;  2AQ1 B;  1ET6 A;  1QOF A;  2WDR B;  1ZUD 2;  4D2K A;  2OED A;  5BMH A;  3TEY A;  3U7Z A;  1EU4 A;  2K22 A;  4YSX B;  1EU3 A;  5D7G A;  3SEB A;  2PIA A;  2JSV X;  1XF5 L;  4KX6 B;  1DOI A;  1HZ5 A;  1IBX B;  2JXT A;  2DYM A;  3IT6 B;  1OFF A;  1L0Y B;  1BXT A;  5BYQ A;  2WLB A;  5H92 C;  2HDE A;  2N0S B;  1L4D B;  2W3S A;  1E10 A;  4YTP B;  3GB1 A;  2KQ4 X;  1ZXI A;  2WXP A;  1RM6 C;  2RMM A;  4FXC A;  2YEP F;  1FIQ A;  2M19 A;  4NAW B;  1VRA B;  2LJI A;  1KLU D;  3NVW A;  2V4I B;  2CU3 A;  3L4P A;  1STE A;  4AQ7 A;  4AS1 A;  4JX1 C;  1WYG A;  2ZW1 A;  4WWM A;  1FXA A;  2KN4 A;  1XLP A;  5TSS A;  2D5G A;  3FIL A;  5HFY A;  3AEB B;  4KGS A;  1R7S A;  4C7Z A;  5GXG B;  1SE3 A;  4WAF A;  2RDG A;  3BYT B;  5HHD G;  1JWB D;  3AE1 B;  2FBW B;  1SF0 A;  4DXF A;  1K52 A;  3U52 E;  5C3J B;  1YN5 A;  4KKI A;  3PZ8 A;  3AEC B;  1KFY B;  1KF6 B;  4HRS A;  4LTU A;  1PGX A;  3W5V B;  1XEE A;  2ON8 A;  3BK2 A;  2WDV B;  5JXV A;  2L83 A;  3AE5 B;  1DOX A;  4HKZ E;  3NRZ A;  2BB5 A;  3UI3 A;  1ESF A;  1XCQ L;  5EE9 A;  2QEJ C;  4XDD A;  1N63 A;  4N6E B;  1CQV A;  3AM9 A;  1IGD A;  4HEA 1;  1VLB A;  4NZL B;  3ABV B;  1N62 A;  1UWX A;  3KWV A;  1MI0 A;  3FC4 A;  4MAC A;  1ZDV A;  1TKY A;  2Y5P A;  1KRH A;  4RGN A;  5I4D A;  1VZ7 A;  2PKO A;  2W3R A;  1T5X D;  3IAS 1;  1ENF A;  2BW2 A;  4ZOH C;  3PZ7 A;  3NVV A;  2J4X A;  2JU6 X;  2KAJ A;  1L4Z B;  2MEK A;  1WXQ A;  4GLS C;  2KDM A;  3NVY A;  2K0P A;  4TSS A;  1JWM D;  2IGD A;  5EE3 A;  2SEB D;  1FFV A;  3HRD D;  4YSY B;  3BK1 A;  2BYT A;  2ACZ B;  2INN E;  4GDK B;  5BYR A;  1DYQ A;  1QT9 A;  2CJN A;  3Q8E A;  3B2G A;  1AWD A;  2NTT A;  4R3D A;  2BT6 A;  2Q5W D;  3IT4 B;  1IBX A;  4Q2J A;  1V1O A;  2W54 A;  1EWY C;  3E9S A;  3AV8 A;  4RFB A;  2AX5 A;  2WDQ B;  1FO4 A;  2FE8 A;  2WXI A;  1K51 A;  2B76 B;  3VRA B;  1PFD A;  5MPO A;  1HXY D;  1GOZ A;  1UUP A;  3J9C A;  3TUO A;  1CK1 A;  4YT0 B;  5AUK A;  3Q8B A;  4RF0 A;  5C2T B;  3VR8 B;  1GPX A;  1QOB A;  1GB4 A;  1N60 A;  4XDC A;  2IDY A;  1D5Z C;  1ROE A;  1UNS A;  1LO5 D;  2JQR B;  2KMM A;  4B0M A;  2WXN A;  1L6V A;  1A70 A;  4US8 A;  1XLN A;  2INP E;  1JWA D;  1OQQ A;  3P4P B;  4P16 A;  2JWU A;  1XCT L;  4C7Y A;  3P4S B;  2PTL A;  2WXJ A;  3HVD A;  2QMT A;  2QIE B;  1CJE A;  1ZDX A;  4US9 A;  4ZHP A;  1JW9 D;  2SAK A;  3P1M A;  3R2T A;  2GRI A;  2LFI A;  4ZYS A;  1TY0 A;  1FD6 A;  1TJE A;  3NVZ A;  3KLS X;  3ZYY X;  1N61 A;  2JYT A;  1HEZ E;  2ONQ A;  2QIL A;  3Q8C A;  2YEP B;  2BS4 B;  1XXG A;  3AE7 B;  2H88 B;  1NYR A;  1FEH A;  1FNV A;  4IKG A;  2WQY B;  1XO3 A;  5D3D A;  2G9H D;  1N5W A;  3IAM 1;  4A6Q A;  3R2I A;  4KGR A;  3C8Y A;  4ZRP A;  5T8I A;  4JPS A;  2N7J A;  3AE9 B;  3B9J A;  3DWG C;  4OW0 A;  2BBC A;  5BMI A;  2DYO A;  2BTE A;  4A8X C;  3SFD B;  4RH6 A;  5AUI A;  2J42 A;  2MH7 A;  2WXM A;  1WWT A;  3TEX A;  3I9V 1;  1TS2 A;  2N9L A;  4N59 A;  1SE2 A;  3BWU D;  1C78 A;  1QIL A;  1TKE A;  1JQ4 A;  1SEB D;  3ZJT A;  1MHH E;  4HKQ A;  1Q10 A;  4IOI E;  2E3T A;  3TEZ A;  4O1N A;  2I2Y A;  1GB1 A;  2MJD A;  5G5G A;  1F77 A;  1T3Q A;  1FRD A;  2DLB A;  2GB1 A;  1VDV A;  4ZRQ A;  1V8C A;  1I4G A;  2EEL A;  1TS4 A;  3BVG A;  1I4H A;  1YQ3 B;  1I4X A;  2WXK A;  2OHF A;  1PYW D;  5FKA C;  1D4B A;  1JWU D;  2NMQ A;  1C4C A;  2XNA C;  3AEG B;  3AN1 A;  4NAM A;  4GDL B;  4C80 A;  3NS1 A;  2WU5 B;  3AEE B;  3LB8 C;  4REZ A;  2CJO A;  3E56 A;  3SFE B;  1QLB B;  3NZ3 A;  1WSP A;  2PLP A;  1JRO A;  3W9C B;  1TS3 A;  1YQ4 B;  3Q8F A;  4RGT A;  1EM7 A;  2W55 A;  4OZC A;  5HG2 A;  1DOY A;  2KWD A;  3MC0 B;  2WXR A;  1V1P B;  1ZPS A;  2AQ3 B;  3AE8 B;  1UGJ A;  3VR9 B;  5G5H A;  1JCK B;  5BYS A;  3U2S C;  3W2D A;  1TKG A;  2DWQ A;  1TS5 A;  2HTM E;  3BVM A;  2TSS A;  1SBB B;  2ZW0 A;  3BVZ A;  1WGK A;  3MHZ A;  4RF1 A;  1ZE3 D;  4H2A A;  3BYY B;  2VZK D;  2K9X A;  3RFZ B;  2ICI A;  2IGH A;  2PMV A;  2BS3 B;  1QOA A;  2L32 A;  2LMC A;  1FNW A;  5EE0 A;  5H8Y E;  4TQ1 A;  1KTK A;  2V3N A;  1ZP0 B;  2V0G A;  3MP9 A;  3CIR B;  1FXI A;  5D3I B;  3T3N A;  4WQM A;  3VRB B;  2PVG C;  3AEF B;  4KKJ A;  1I4R A;  3H8H A;  3EA6 A;  4WUR A;  5FK9 C;  3Q69 A;  4RNA A;  1J7C A;  1AYF A;  2K3U A;  3AE4 B;  2E6X A;  4WIP A;  1SJH D;  1F2R I;  1WRI A;  2QJL A;  4P6V F;  5EE1 A;  3TSS A;  1HQR D;  2LEK A;  3RPF C;  3Q8A A;  1RWS A;  2GI9 A;  1YMH E;  1NVI D;  1HZ6 A;  2NTS A;  1C4P A;  2IGG A;  2WXL A;  3AE2 B;  2LHD A;  1RFK A;  1FMA D;  3PO0 A;  4MM3 B;  4M0W A;  3VQI A;  1QQR A;  3EUB 2;  1BML C;  3KWL A;  3N9Y C;  2J52 A;  1FFU A;  1SXT A;  1SJE D;  1FRR A;  2DBY A;  4N58 A;  5E6J A;  5LNK 1;  2Y5C A;  1NI3 A;  3AE3 B;  2JZP A;  4A90 A;  4DXG A;  4XWW A;  1JAL A;  2QSD A;  2J53 A;  1E0Z A;  1GAQ B;  2W82 A;  1TY2 A;  3AED B;  3P42 A;  3URY A;  3ZJV A;  1J7B A;  3ETR A;  2RDH A;  4HRO A;  1MPE A;  3T3O A;  1PDX A;  1D6E C;  1T6B X;  2L52 A;  4YTN B;  5FR3 A;  3BII D;  2I38 A;  2BS2 B;  1L0X B;  1P7E A;  1SIJ A;  3IXS A;  2IJ0 A;  1YJI A;  1CZP A;  3ZGZ A;  1QF6 A;  1KLG D;  1C76 A;  1FCC C;  2JYE A;  2K5P A;  1NEK B;  1C9F A;  1JRP A;  3HVZ A;  4ZHO A;  4JWU C;  4KGT A;  4XE0 A;  1PGB A;  4YXD B;  4LK0 M;  4RCO A;  1UWM A;  3AB5 A;  4NJC A;  1BUI C;  1L0V B;  2PVO D;  4L23 A;  3V05 A;  3AE6 B;  2KAC A;  1ET9 A;  4MH8 A;  2M56 B;  1C77 A;  3MFG A;  1VJK A;  2WXG A;  1NEN B;  1XLQ A;  1AN8 A;  1SE4 A;  4OVZ A;  3U4E G;  1K53 A;  1VZ8 A;  2WS3 B;  4JE3 B;  1V1P A;  2X38 A;  4TMA B;  1K50 A;  4CQN A;  1I4P A;  1PUT A;  1Y56 A;  1AW7 A;  2Y3A A;  1VZ6 A;  2RPV A;  2EKI A;  2L1A A;  2MJE A;  2WXQ A;  1PGA A;  4L2Y A;  3SR6 A;  1SB3 C;  3P4Q B;  4HJG E;  2WXF A;  2FUG 1;  4JWS C;  1ZXH A;  4A9A A;  1KH0 A;  3FAH A;  1J7A A;  1YN3 A;  5BMG A;  3AH7 A;  3AMZ A;  2AQ2 B;  3W1S A;  2G1E A;  2WP9 B;  2WU2 B;  4YSZ B;  1FM0 D;  4MT5 A;  3V3X A;  1N5X A;  3KQ4 A;  3WCQ A;  3TEW A;  3P4R B;  3LYY A;  3LXF A;  1VR9 A;  4RGM A;  4USA A;  2LUM A;  5HI1 A;  3OWE B;  4ARC A;  3BZD B;  4TQ0 A;  3CWI A;  4WH4 A;  3FIL B;  2IPK D;  1MHX A;  4DQO C;  4RGO S;  1D5X C;  3EGR A;  1NYQ A;  1F0Z A;  2BB6 A;  3ZJU A;  1L6U A;  3NUH B;  3O13 A;  3MJ5 A;  1L5P A;  4L1B A;  3W5U B;  2WNM A;  1TZO A;  4UDU C;  1I4Q A;  1C4A A;  2N9K A;  1XLO A;  1QOG A;  3P63 A;  1YNT E;  4OZB A;  4YWG G;  1FCL A;  4C56 C;  1P7F A;  1JML A;  1E7P B;  1E9M A;  2R61 A;  1MVK A;  4ITK A;  1FNU A;  1DGJ A;  4YTM B;  2V3P A;  1OQR A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...