1XF5L

Complex hcv core-fab 19d9d6-protein l mutant (h74c, y64w)in space group p21212
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
KTPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEWTADLEDGGNCMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 16
structure length 71
sequence length 71
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xf5L00
4GLSC 2ON8A 1YNTE 1YMHE 2PW9A 2J52A 3V3XA 2I38A 4OZAA 1PGBA 2NMQA 2KACA 5BMHA 2LUMA 3FILA 1IBXB 2QMTA 5HG2A 2QSDA 1XCTL 2PLPA 4IKGA 2OEDA 4MACA 1XCQL 2JSVX 1HEZE 2LGIA 1C9FA 1PGXA 1EM7A 1HZ6A 1F2RI 2JZPA 2J53A 2KN4A 1MPEA 1MHXA 2IGGA 4KGRA 1K53A 4KGTA 2ZW0A 3UI3A 1Q10A 2KDMA 2N9KA 4D2KA 2LHEA 2LHDA 4IOIE 1HZ5A 5HI1A 4KGSA 1D4BA 4WH4A 2RPVA 2EELA 1IBXA 1JMLA 1MI0A 3GB1A 2RMMA 2JXTA 1PGAA 1QKZA 4OZCA 1MHHE 4OZBA 1FCLA 1IGDA 5BMIA 1P7EA 3FILB 1FD6A 2KQ4X 2KWDA 1UWXA 2JWUA 5HHDG 1K51A 2GI9A 2IGDA 4HKZE 2IGHA 1F2RC 2N9LA 5JXVA 1FCCC 2JU6X 1GB1A 3MP9A 1P7FA 2ZW1A 4HJGE 5HFYA 1GB4A 1ZXHA 1K50A 1KH0A 2GB1A 1XF5L 2N7JA 2PTLA 2K0PA 2I2YA 1K52A 1IGCA 2ONQA 1MVKA 5BMGA
chains in the Genus database with same CATH superfamily
2WHIA 4PYUA 3GP7A 3DQVA 1D3ZA 2IBIB 3C8YA 3VUYA 4A90A 3DHIC 2PLPA 2Z59B 2K6QA 3RD2A 3QQ8B 1C9FA 2INDC 3U30A 1AWDA 2BT6A 3X23A 1T5XD 3RZWC 1FMAD 1HXYD 2IGGA 2IY1B 5BYQA 3PS6A 1UH6A 1FRDA 1V6EA 5C3JB 4ZRPA 5AEKB 4OVUA 4CO7A 3LDZE 3C0RB 4LNIA 1BXTA 1IPGA 2W55A 3V60A 4M02A 1HZ5A 4J3OD 1FFVA 5DPTA 1E8WA 1UGMA 4WWMA 4MELA 5LLIA 3EA6A 5DPSA 5E6PA 2JZ3B 2N9PC 3NY5A 1C77A 1OQRA 4GU2A 4ZRKA 3FILB 2LVPA 1TYGB 1XXGA 1UWXA 4G3XB 4HKZE 2N9LA 1XEEA 1P7FA 1ZDXA 4RM8A 2ZW1A 2WXLA 3Q14C 1L4DB 1ZXHA 2LASA 3ZVVA 3SFEB 2IO2B 1QT9A 2CS4A 3DVNU 2PTLA 1T0SC 3ZTCA 2W3SA 4OVVA 1P98A 3R7RA 3QX1A 5L83A 2INPE 4GLSC 2FIDA 3HVZA 3ZIMA 4GIVA 5J2RA 1I7HA 4M8NA 2R2QA 4CYEA 2LFIA 3DHHC 3E56A 2QJLA 1WXQA 5C2TB 1L7YA 1VR9A 2OEDA 2QIEB 3SEBA 4B95A 3MC9A 1C4AA 3DCGA 4K1RB 1B9RA 2MEKA 3WIMA 1Z2MA 1LO5D 4EFOA 1E0ZA 4LJOB 3GZNI 4M00A 3UQAA 5D94A 2GBJA 2FIFA 3RNCC 3D32A 1OTRB 4H2AA 1GC6A 1T3QA 5DPWA 2JX5A 2LZ6A 3L0WB 1H4RA 2DBYA 3KUCB 4ANWA 1SF0A 3M3JA 1PUTA 2CHXA 4GDKB 3NZ3A 4NAMA 2EELA 3AE4B 3IBEA 4WIPA 1ZXIA 3ZDMC 2K22A 3HRDD 3NVWA 1EF5A 2V4IB 1C4PA 2JYTA 2KWCA 3IG3A 4AP4C 4FBJB 3I9V1 4GSWA 4GGQA 5BMIA 4PS3A 1EF1A 4C80A 1JQ4A 2KWDA 1E9MA 1T0RC 2BKFA 1K51A 2IGHA 4AOFA 2KJHB 2A4ZA 3W1SA 3RNFC 2XK5B 2KNBA 4GOCA 2J4XA 3AN1A 4IG7B 2GBMA 3NOBA 3PGEA 1E7UA 4AUQC 4GDLA 4WJNA 2ZCCA 3VHTC 3SU8X 3Q8CA 2I2YA 1T6BX 1J0GA 3H9DA 3RPFC 1VZ7A 1WM2A 3NZSA 1TKEA 5BYRA 3DDCB 1JWMD 4A3PA 2PW9A 1Q1OA 1HE8A 5CHVC 4NJ7A 3KVFB 5G55A 1FXIA 3APDA 3PHXB 3URYA 1ET9A 2LUEA 2UWQA 2WLBA 3J9CA 3B2FA 3TL5A 1LFDA 4DHJB 2NCNA 5L95C 1XQQA 5BO4B 5C23A 4ZYSA 2KO3A 2L76A 1UNSA 2ZW0A 2KHWB 5FKAC 5FR3A 4YSZB 2X38A 1BMLC 3ML9A 3AM9A 3QIJA 4GXBA 1FXTB 3ZTDA 4P16A 4HCPB 4URKA 3KWVA 5CTRC 5CHFA 3OWEB 4HROA 2LVQA 2BYVE 1R4MI 5I4DA 2FCQA 3H7PB 4B9KA 4CHKA 1V5TA 2WNMA 2LJ5A 1UZXB 2C5LC 3SR6A 4C00A 1RAXA 1QKZA 5G2NA 3WAMA 1P1AA 2JUOA 4PYZA 2NBUA 3QCAA 2UU7A 4IWOA 4WWNA 2N9XA 3U8ZA 4MEMA 4IM2A 5TR5A 3BVGA 1WGYA 4N58A 3AE9B 2HTME 4I6LB 5H92C 3PLVA 4M01A 2V0GA 2L1AA 4JL9A 1E90A 2D3GA 3ZYYX 4RGOS 4JWUC 4A8XC 4ITKA 1YN4A 2V1YA 1WSPA 2DZJA 3HM3A 4BOZB 2J52A 2JRIB 1DOYA 4LLGM 3W1SC 3BIID 5IOIA 2NMQA 2KACA 1ACCA 1UGJA 2UYZB 1IBXB 1OEYA 2WGSA 2WXNA 2N7EA 3P4RB 1VCBA 1SE9A 5GXGB 5D3DA 3IAM1 4JQWC 4J6IA 3K9PB 2NBVB 4NQLB 2ZPNA 1V49A 2W3RA 2LHEA 4K7UA 1YN5A 1L4ZB 5HI1A 2PE6B 4K3CA 1F52A 1QZEA 1ZP0B 2KQSA 4BKSA 2QEJC 2DLBA 3B1LX 3TUOA 2EMSA 3WCQA 2FNJB 3W5UB 1R4NI 2WXJA 2O2VA 1SXTA 4KIKA 1FXAA 1TY2A 4KKJA 4WAFA 1IGDA 1D6EC 4W9EA 3AE6B 1WMHB 2V3SA 2O6VA 2PKOA 3VR9B 3GOEA 3DVGY 3PV1A 3B0AA 4CQNA 3W1YA 5IA7A 3PLUA 1WJ6A 1YJIA 1Z5SB 4BKTA 3V6CB 2LEKA 4HVBA 3VH4B 4ZRIA 2HTHA 3BVMA 1Q5WB 4ICVA 5AZGA 4E3CA 3NJTA 5J17A 2MRPA 3N20C 4HCNB 2K0PA 5EE0A 3P4QB 3W5VB 5BMGA 3ENEA 1N5XA 1XO3A 3OLMD 1L0YB 2JZZA 3FC4A 2RDGA 4ARIA 4S17A 2N1WA 5BMHA 4WWPA 2LUMA 4N59A 2RD0A 1WIAA 1UELA 3EFUA 4FJVB 1J7CA 1N62A 4II2B 5J18A 3TMPB 5CX3A 2KN4A 1MHXA 2KT7A 3AEFB 1EUVB 4B0EA 2L0FA 2Z0EB 3ZJVA 2G1EA 3A9JB 3H1UA 2Z8LA 3CSTA 1TJEA 2M0AA 1DOXA 3V62A 2BF8B 3WAPA 1WXAA 2IO0B 3CWIA 4ANVA 2JQRB 3ZRCA 1SE4A 4W9GA 1UD7A 4TMAB 1TBEA 2CU3A 4US8A 1WX8A 2CHWA 1F9JA 3AE3B 3CIRB 4NPNA 2Q5WD 4MM3A 3ZQ4A 1N5WA 1SSNA 1WJNA 3RUIB 1F0ZA 4C7YA 1SEBD 1F2RC 3LB8C 3C19A 1GUAB 3AULA 2FAZA 2MW5A 4C4VB 4I6PA 3RN9C 2L05A 3DVNV 2JXXA 4DHZB 5LXHA 3QWZB 2AL3A 4XWWA 1E8ZA 2SAKA 1XLQA 1WE7A 2QILA 3BZDB 4LK0M 5CHWA 3PPAA 1YNTE 2XEWA 5JHAA 4FHKA 4AQ7A 4WWOA 2I38A 2GBRA 4TV3A 2N1VA 4BBNF 2D07B 2NTSA 2NPTA 3AE5B 1ZGUB 1P3QU 3GZNB 4DBGA 3SDLC 4ASWC 1EM7A 2WDVB 4GN1A 1P0RA 4IWQA 4WAAA 1TS2A 1ENFA 2L7RA 1J7AA 1WGRA 3KQ4A 3GS2A 5C1ZA 1WXMA 2LXCA 2WX0A 2KFKB 3QK0A 2JF5A 3UI3A 4EZLA 2W9NA 5BYSA 3DOWA 2WXKA 1JWUD 1V1PA 4DHJD 1JWBD 1KLUD 4ZOHC 3EC8A 4MT5A 3P63A 2WDTB 3NG0A 1FEHA 2MWSB 3QARA 3Q3JA 1C78A 4EE2A 4RF0A 3M63B 1YX6B 2KD0A 2WX1A 1VLBA 4K81A 3ZNGC 2ZPYA 1TKYA 4KZ0A 1ZE3D 3ZNID 4XWTA 1JWAD 3PT2B 2WP9B 4P1BC 3Q3NC 1WM3A 4MSQB 4O1NA 4W9IA 3RCZA 5JH5C 1YJ1A 2WQYB 3KYCD 2DZKA 3VTWA 5KHOA 1TS5A 3BK2A 4RH6A 2AEHA 3MC0B 2AWTA 3APFA 3LJ3A 1QLBB 3ZXRA 3ZNHB 3ALBA 3U7DA 4RM9A 2N7DA 2KX0A 3EECA 3R8BA 2XK5A 3LXFA 4BFRA 2KLGA 3VR8B 4B6WA 3UINB 2KN5A 4OW0A 1PFDA 3H6NA 2PE9A 2PIAA 1E5WA 2QMTA 4L2YA 1XCTL 3IVFA 3PZDA 1ISNA 1HEZE 2JSVX 2LGIA 1L6VA 1WFYA 1DOIA 1F2RI 2KC2A 4LNFA 3UGBB 2J53A 4B0MA 4LNOA 3B2GA 2Y3AA 4KGRA 3JSVA 4JE3B 4UDUC 4DXAB 3N1ZC 1WY8A 2KLCA 4DXFA 5TSSA 2D11A 2L32A 2DZMA 2WS3B 2LHDA 1R4MB 3A9KA 1RWSA 2I1KA 3DBRI 2E6XA 2ZVNA 2MP2A 3MFGA 2VH1A 1OFFA 2K8CA 2KDFB 1MI0A 2YEPB 2K9XA 4WJOA 1FO4A 2HJ1A 2K3UA 4JPSA 5FK9C 3W9CB 3QAQA 3AV8A 3I3TB 2ZCBA 1OQYA 5DCNA 2WXMA 2OJRA 2NBWB 3DBLI 3HUIA 3U4EG 5HHDG 4LTUA 2AYOB 2KTFA 3BY4B 3RMKC 4ANUA 1GB1A 4P6VF 1WGHA 2IPKD 5DPRA 2ZNVC 1SBBB 1XF5L 3OG5A 4ARCA 4TQ0A 1KFYB 4YSXB 1WX7A 2IYDB 2MQJA 4P7IA 2ZEQA 2B3AA 2DX5B 5D3IB 3APCA 3PRPB 2VRRB 4KDIC 1MJDA 3H8HA 4BOSC 2NTTA 2RPQA 4E71A 1KJTA 2RGFA 2K6DB 3VTVA 3VH3B 2PVOD 3M62B 3N1XC 3KWLA 4IKGA 3AB5A 3NRZA 2G45B 4ZRJA 2WDQB 1UF0A 4MGKE 2NR2A 1FRRA 3KW5B 1FFUA 3AU4A 2BWES 4FADA 2KZRA 4NQKE 4WJQA 2KKCA 1RLFA 1Q10A 2AQ2B 4LDTB 2V4LA 3MC8A 4D2KA 4FJYA 4G0NB 4X57B 2KTRA 3R66C 1WWTA 4NY0A 3PRMB 4DDGD 1D4BA 4KVGB 2GRIA 2XN9C 2RPVA 1R4NB 3KH0A 1WR1A 1SB3C 2LRUA 4PK1A 1PGAA 3W2DA 1JW9D 1WX9A 3PVLA 1MHHE 2Z0DB 1UBIA 1WXSA 5AZHA 2YEPF 3AXCA 2BPSA 1WH3A 1FPYA 2ZVOA 3Q8BA 1JROA 2ICIA 1RRBA 1L6UA 3DHGC 1V8CA 2G3QB 1VJKA 1NI2A 2BTEA 2J42A 3UF8A 2LI5A 4XDDA 4MJSA 1RYJA 4FXCA 2MCNB 5HFYA 3CMMB 5KHQA 1BT0A 4E74A 1QF6A 3KYDD 5D2MB 3R7QA 5IN7A 2DWQA 2Y5CA 1YN3A 4EOYA 4RCOA 4ZHPA 3VRAB 4BKSD 3T9LA 4OHJA 3OJ4B 2BB6A 1VRAB 4KKIA 1WRDB 1UBQA 2PMVA 1LGRA 2BS3B 1GJZA 3H7SA 2QC8A 3WAOA 3RNGC 2Y5BB 5HG2A 2MBHA 1YQBA 2Y5PA 1NVID 3NVZA 1GAQB 2O6VD 1I35A 5T8IA 2QHOA 2J0MA 5IO9A 1E8YA 1YIWA 3V61A 3ZO5B 3L17A 4M0WA 1VDVA 1WJ4A 2WXGA 1JALA 3R2TA 3TJPA 2YVCA 3JW0X 1CZPA 4WURA 2CKHB 3RFZB 1C4CA 3VFKA 2RDHA 1JWSD 3V6EB 4G50A 2LXAA 4GDLB 2G4SA 4K7SA 5FR6A 3N32A 3ZJUA 3GB1A 3M95A 2MBOA 2FUHB 2WXRA 3WANA 2ASQA 1SGHA 1UUPA 2LGYA 2R61A 4A3OA 3I5JC 3RZFA 2KYWA 3AEDB 3HIZA 3L16A 4OZBA 2HD5B 1FCLA 3Q3FA 4RGNA 4AWJA 2WU2B 1V9JA 4G11A 1J8CA 1UWMA 2HDEA 3PHWB 4RMAA 2EKIA 4YTMB 4II3B 5IKCM 3TBLD 5E6NA 1FCCC 4WQMA 3MP9A 4JLCA 1P9DU 2AL6A 3A1QA 4IUMB 1KLGD 2DYBA 3A33B 4HXDA 4ZDVA 2PPHA 1WE6A 2CU1A 5E6JA 4M8MA 3EFCA 1EU4A 4JWSC 4NJCA 1LM8B 2KDBA 1L0VB 1DGJA 3U2SC 2IO1B 4LJPB 1E7VA 2WYQA 5IAAC 4FN2A 2JVCA 3MJWA 1H8CA 1ZPSA 1EO6A 4XE0A 1XLNA 1JCKB 4FJZA 1YQ3B 1I4GA 3I63C 4US9A 1XCQL 1C1YB 2EKEC 3JVZX 4AS1A 3P4SB 4OVZA 4N6EB 1V86A 1HTQA 3EHVA 4ACFA 2KMMA 3B08A 3NHEB 3AE8B 2LJIA 4FHJA 3TEWA 5D7GA 4C56C 3BVZA 4NAWA 1ZW7A 4RGTA 2GLSA 3T3OA 4JIOU 3ECIA 3NUHB 2M17A 1CQVA 1NEKB 2AQ1B 1OGWA 2KVZA 2WXQA 2A5UA 4IWPA 1QOGA 2DAFA 1CMXB 3L13A 2FCSA 3KUZA 3U52E 1GOZA 3RNEC 2KQ4X 3P1MA 2BQQA 2QCZA 5JXVA 2KXJA 4JGHB 4LCDE 3SFDB 1V5OA 3Q8AA 1JRUA 2M19A 2JRHA 3IAS1 3S2AA 1K52A 2C60A 2DYOA 1V80A 1XLPA 4HLEA 3NVYA 2V9HA 4RFBA 1SJED 4Q2JA 2BS4B 3FILA 1OEYJ 2FE8A 3AEBB 4KSLC 1A70A 2LWPA 3ZLZA 4W9CA 1F77A 2M4NA 1PGXA 2O2VB 2LMCA 3RI7C 4YTPB 2MH7A 4XDCA 3VUWA 1NDDA 2BWFA 4MSMB 2ZZPB 3AE1B 4LNKA 2O6VB 4DDID 2BYTA 2CJNA 3R3MA 2N9KA 1GNUA 1VZ6A 3DBRB 2GOWA 4QAYA 5HKHA 1E10A 3N9YC 2KJ6A 3ZNZB 3N30A 4EUTA 1WGGA 4EKUA 2K1FA 4P1CC 1TTNA 4LDTD 1ZKHA 3ZKJC 2MX2A 3FKYA 3GE3C 4MH0E 2KQ7A 3GE8C 1ZOYB 3DBLB 1AN8A 1PYWD 2C7NB 2W54A 3MHZA 4EZKA 4F7ZA 4A9AA 4JX1C 4AJYB 2MJDA 2OJWA 1WGKA 4WQOB 4F1SA 4PT5A 3ZW3A 2JU6X 3QHTA 4IM0A 3AEGB 3KLSX 1MFWA 1ET6A 4W9KA 1MG4A 1VD2A 1QOFA 3B9JA 2GB1A 4RGMA 2BKRB 4GDKA 4BKGA 1FIQA 1SIFA 3VVWB 3DWGC 1MVKA 5AZFA 1OQQA 1ZUD2 1M94A 4XGAB 4REZA 3N3KB 3MJ5A 3IT6B 1DYQA 1TS3A 3DBHI 4W9FA 2BB5A 2XNAC 3DBSA 2BVCA 2D2QA 2OHFA 1ROEA 4IM3A 4KZCA 2DZIA 1HA5A 2KJRA 4MACA 5EE9A 4XC2A 4ZRQA 3BINA 4IC7B 1YX5B 3JYUA 3Q6BA 2CR5A 4MM3B 2L3ZA 1V1OA 4YXDB 1WI0A 3O65B 2KDMA 4YT0B 2RSUA 5EE1A 4PS7A 3ZRFA 2IO3B 1FNUA 1TKGA 2WXHA 1I4QA 1NENB 1AYFA 2XBBC 2VZKD 3VDZA 3T8MA 3CF6E 4HEA1 4LNNA 4F8CB 3OAWA 2J0JA 3BK1A 1D5XC 1WJUA 2J0KA 2JWZA 3VUXA 1WRIA 1P7EA 1F1HA 1HQRD 3ML8A 1ZDVA 1GPXA 2BBCA 1KF6B 2NPTB 4AJWA 4S0RA 2I1JA 4YL8A 1E6EB 3ONSA 4KSKC 2GI9A 4DHZE 4BZAA 3NVVA 3FAHA 3ETRA 1RM6C 2M1MA 4YTNB 2L0TA 2N7JA 3BYYB 3MTNB 1LQBA 2FCMA 2K8HA 2GBKA 2M56B 4K3BA 4XZ4A 3H7PA 4TSSA 3ABVB 2ACZB 1XD3B 3Q8EA 1V1PB 2K39A 1STEA 1TY0A 3U7ZA 2ON8A 1I4RA 4DK5A 3V3XA 4HPMB 1Q0WB 2SEBD 5JZEB 2WXPA 1SJHD 3RT3B 4NJ6A 2WU5B 2BS2B 1CJEA 2FCNA 3HVDA 2QSDA 4YSYB 3AMZA 4XYCA 2G4DB 1YQ4B 5IP4D 1E8XA 1C3TA 1I42A 2ZNVB 2KDIA 4HWIB 2D3BA 2KANA 2MBQA 1WZ3A 2JPHA 3SD5A 4DQOC 3TEYA 2WDRB 2JT4B 1Y56A 4KGTA 3RYTA 3UIPB 4BAXA 2LGXA 3OJ3A 2WXFA 4KDLB 2GMIC 2C9WB 1SE3A 1YD8U 3I57A 2DYMA 3AECB 4DXGA 1IP9A 3BYTB 1WGDA 4FA6A 4WH4A 3E9SA 1TIFA 1IBXA 1RFAA 3PREA 3P42A 2K25A 2JXTA 3QA8A 4I6NB 5AUKA 1N6ZA 1YOVB 1YJJA 3ZDTA 2WXIA 2HE7A 1E7PB 2CHZA 3QC8B 4HPLB 5MPOA 4IDIA 5JHBA 1M4VA 1TGZB 1PDXA 2D5GA 2IGDA 2X8XX 1QILA 1XLOA 1L5PA 4K7WA 2L52A 4EEWA 1D5ZC 4HRSA 2KVRA 1GB4A 1I4PA 3IT4B 1KH0A 2D3CA 3JSVB 2M8SA 3QJZA 1NBFC 3ZXVA 2DAJA 3R2IA 1WYGA 4W9DA 2ONQA 1C79A 1QOAA 1I4XA 3MHSD 2MBBB 2TSSA 3A4SC 4W9JA 3A9KB 1J7BA 1K8RB 1X1MA 2MP2B 2DNFA 4TUUA 3TEXA 1RFKA 2LRWA 1WMHA 3TCAA 5EE3A 3VQIA 5EDSA 2KAJA 4EZJA 3LYYA 1HZ6A 1U4AA 2E3TA 3PTFC 1AW7A 3X0WA 1MPEA 2LVOA 1KLVA 5AUIA 1K53A 1JRPA 1TZOA 4HKQA 3N1YC 1SE2A 2PEAA 2WXOA 2KFJA 3DVGX 2IDYA 1B1ZA 1WYWB 1JMLA 2IZVB 3TIXA 1TS4A 4A20A 2W82A 1N63A 2IY0B 1S3SG 1KTKA 2VZKB 2FUG1 2D10A 2AQ3B 2MLBA 1NYRA 3NZUA 2MA9B 3A9JA 3TEZA 2N4FA 1FM0D 4TKNA 1MG8A 3UQBA 2K8BA 2K5PA 1GC7A 4HJKA 1G6JA 1L2NA 2M0XA 3P2BA 2V3NA 2L83A 5LXIB 3AEEB 2PVGC 2BW2A 3AH7A 3VRBB 1HTOA 1BUIC 2MSED 3BWUD 3PZ8A 5G5GA 1IGCA 3IXSA 4ANXA 3IHPC 1TT5B 3V05A 2KTRB 4RNAA 2N0SB 1N60A 4HDQA 3AU5A 2OOBB 1WXVA 2MJEA 1PGBA 4FLHA 4HDOA 1QOBA 1AARA 4ZYNA 2KWVB 3ZGZA 1T0YA 1ESFA 2C7HA 5LNK1 2DHZA 2RDBC 3DPDA 3DWMA 2J7QB 4USAA 3VXWA 4C4VA 1WF9A 2KK8A 2JYEA 2MHJA 3WA0A 4FULA 3WALA 2NS5A 1TZ1A 3VTUA 1R7SA 4IOIE 1QQRA 4MGYE 4MJSB 1NI3A 3K9OB 4W9HA 1Y8RC 2REXA 3AE2B 4KGSA 1IUEA 2HJ8A 2R2OA 3NS8A 2MJ3A 3KUDB 2DENB 2QDFA 1EWYC 1IYFA 3L4PA 3HK0A 3VAWA 4A55A 3A4RA 3PRZA 4L1BA 4BBNC 2KOXA 5GMVA 2CJOA 2BYFA 3RNAC 1XT9B 2KFKA 3Q8FA 2JWUA 3L54A 1KM7A 1VZ8A 4A6QA 2VH2A 1WZ0A 4DWFA 3PZ7A 4HJGE 1PQSA 3CSFA 4R3DA 2MBEA 2KX3A 4KX6B 1D5MC 2GBNA 3Q2AC 4M0WB 2YLMA 1L0XB 4ZHOA 3NS1A 3HHMA 3IFWB 4NZLB 2LD9A 3DBHB 2WWZA 1V2YA 2H89B 2KDEB 2G9HD 1GG3A 1S1QB 4ICUA 1YMHE 2AX5A 5H8YE 1A5RA 3RNBC 1J19A 2B76B 4OZAA 4WJPA 2BGFA 1SIJA 3L08A 1KRHA 2KWUB 3Q69A 4HK2A 1LXDA 2L8JA 3T3NA 3ZJTA 2H88B 2JZPA 1KOTA 4BVUC 1N61A 2IJ0A 1V97A 3RULA 1EU3A 4XX5A 3PO0A 1NYQA 2LGSA 3P4PB 4GB9A 4L23A 1FNVA 1WR6E 4KV2A 4NNJB 5D6JB 3UIOB 4PS8A 3AEAB 2C7MB 1C76A 4N9F4 3O13A 3A1QB 2KC1A 3ZUNA 1EWCA 3HM6X 4MDKE 4TQ1A 2L00B 3AI5A 2FBWB 4KIKB 3EUB2 5G5HA 3SHQA 2PJHA 5E6OA 1T0QC 2LGDA 2RMMA 3TSSA 4OZCA 4C7ZA 1FNWA 2INNE 2NVUI 1CK1A 1V81A 2KMAA 4MH8A 2ZJDA 3Q3OC 1FD6A 2D3AA 2RR9A 4HPPA 4W9LA 1I4HA 3AE7B 4YWGG 4RF1A 4IW0A 3Q3MC 2BYEA 2EMTA 4GMVA 2N9EB 1K50A 4MGZE 2INCC 2V3PA 3EGRA 4MGIE 3L10B 4NAWB 2JY6A 3PSEB 2KMCA
chains in the Genus database with same CATH topology
1STEA 1N5XA 1TY0A 4OHJA 2ON8A 3U7ZA 2BB6A 1I4RA 1VRAB 1XO3A 4KKIA 3GP7A 1L0YB 3V3XA 3FC4A 2PMVA 2RDGA 2SEBD 2WXPA 4ARIA 1SJHD 2WU5B 2BS3B 2BS2B 5BMHA 1CJEA 2LUMA 4N59A 3C8YA 3HVDA 4A90A 5HG2A 2QSDA 2PLPA 4YSYB 2Y5PA 3AMZA 1NVID 3NVZA 1YQ4B 1C9FA 1GAQB 5T8IA 1AWDA 1J7CA 1N62A 2BT6A 1T5XD 1FMAD 1HXYD 2KN4A 2IGGA 1MHXA 4DQOC 5BYQA 3TEYA 2WDRB 1Y56A 3AEFB 4B0EA 1FRDA 4KGTA 4M0WA 5C3JB 3ZJVA 1VDVA 4ZRPA 2G1EA 2WXFA 2WXGA 2Z8LA 1BXTA 1TJEA 1JALA 3R2TA 2M0AA 1SE3A 1DOXA 2W55A 3I57A 2DYMA 4WURA 1CZPA 3AECB 1HZ5A 4DXGA 4J3OD 3BYTB 3RFZB 1C4CA 1FFVA 3CWIA 2RDHA 1JWSD 4WWMA 4WH4A 3E9SA 4GDLB 2JQRB 1IBXA 3EA6A 3ZJUA 1SE4A 3GB1A 2WXRA 3P42A 1UUPA 2JXTA 4TMAB 2R61A 3AEDB 2CU3A 1C77A 4US8A 1OQRA 4OZBA 5AUKA 1FCLA 1YJJA 4RGNA 2WU2B 2WXIA 3FILB 1UWMA 3AE3B 2HDEA 3CIRB 1E7PB 2Q5WD 3ZQ4A 1N5WA 1TYGB 5MPOA 1XXGA 1SSNA 4IDIA 1UWXA 2EKIA 4YTMB 1M4VA 1PDXA 1F0ZA 2D5GA 4C7YA 2IGDA 1SEBD 4HKZE 1F2RC 1QILA 3LB8C 1XLOA 2N9LA 1XEEA 1FCCC 1L5PA 3MP9A 4WQMA 1P7FA 1ZDXA 2ZW1A 2L52A 2WXLA 1D5ZC 4HRSA 1L4DB 1GB4A 1I4PA 1ZXHA 3IT4B 1KLGD 1KH0A 3SFEB 1QT9A 2PTLA 2W3SA 5E6JA 4XWWA 1EU4A 2SAKA 4JWSC 4NJCA 3R2IA 1WYGA 1L0VB 1XLQA 2ONQA 1C79A 2QILA 3BZDB 1DGJA 4LK0M 1QOAA 1I4XA 2INPE 3U2SC 2TSSA 4GLSC 1YNTE 3HVZA 1I7HA 4AQ7A 2I38A 1J7BA 2LFIA 3E56A 2QJLA 1WXQA 3TEXA 1RFKA 5C2TB 1ZPSA 1VR9A 2NTSA 4XE0A 3AE5B 1XLNA 1JCKB 1YQ3B 1I4GA 2OEDA 4US9A 1XCQL 5EE3A 2QIEB 3VQIA 3SEBA 2KAJA 1C4AA 1EM7A 2WDVB 4AS1A 3LYYA 1HZ6A 1TS2A 1ENFA 2MEKA 2E3TA 1B9RA 1LO5D 3P4SB 1J7AA 4OVZA 1E0ZA 4N6EB 1AW7A 3GS2A 3KQ4A 1MPEA 2KMMA 5AUIA 1K53A 3AE8B 1JRPA 2LJIA 3UI3A 1TZOA 3TEWA 5BYSA 5D7GA 4H2AA 4C56C 4HKQA 3BVZA 2WXKA 1JWUD 1T3QA 1V1PA 1JWBD 1SE2A 2WXOA 1KLUD 4ZOHC 4RGTA 4MT5A 2JX5A 3P63A 2DBYA 1SF0A 1FEHA 1PUTA 3T3OA 1C78A 4GDKB 4EE2A 2IDYA 1B1ZA 3NZ3A 4NAMA 2EELA 3AE4B 3NUHB 4WIPA 4RF0A 1JMLA 1CQVA 1NEKB 1ZXIA 1VLBA 2AQ1B 1TS4A 2K22A 2WXQA 2W82A 3HRDD 1N63A 3NVWA 2V4IB 1C4PA 2JYTA 1TKYA 1QOGA 1ZE3D 4XWTA 1JWAD 2WP9B 1KTKA 3I9V1 2VZKB 2FUG1 3U52E 5BMIA 2AQ3B 1NYRA 4O1NA 4C80A 1JQ4A 1GOZA 2KQ4X 2WQYB 2KWDA 3P1MA 1TS5A 1E9MA 3TEZA 3BK2A 1K51A 1FM0D 4RH6A 2IGHA 5JXVA 3MC0B 3W1SA 2K5PA 3SFDB 2J4XA 3AN1A 3Q8AA 2V3NA 2L83A 1QLBB 3AEEB 2PVGC 2M19A 2BW2A 3AH7A 3IAS1 3VRBB 1BUIC 3BWUD 3Q8CA 2I2YA 1T6BX 3PZ8A 1K52A 5G5GA 3R8BA 1IGCA 3IXSA 2DYOA 3RPFC 1VZ7A 3LXFA 1TKEA 5BYRA 3V05A 1JWMD 4RNAA 1XLPA 2N0SB 3VR8B 1N60A 3NVYA 2PW9A 4OW0A 2MJEA 1PFDA 4RFBA 1PGBA 1SJED 1QOBA 4Q2JA 2BS4B 3FILA 2PIAA 2FE8A 2QMTA 1FXIA 3AEBB 4L2YA 3ZGZA 1XCTL 1A70A 3URYA 1ESFA 1ET9A 5LNK1 2WLBA 2JSVX 1HEZE 2LGIA 1F77A 1L6VA 3J9CA 1DOIA 1PGXA 3DWMA 3B2FA 1F2RI 2LMCA 4USAA 4YTPB 2J53A 2MH7A 2JYEA 4XDCA 4B0MA 4ZYSA 3B2GA 2Y3AA 4KGRA 3AE1B 4JE3B 4UDUC 1UNSA 2ZW0A 2BYTA 2CJNA 5FKAC 5FR3A 2N9KA 4YSZB 4DXFA 1VZ6A 5TSSA 2X38A 1BMLC 2L32A 3AM9A 1E10A 2WS3B 1R7SA 2LHDA 4IOIE 4P16A 1QQRA 3N9YC 1NI3A 3KWVA 1RWSA 3AE2B 4KGSA 1IUEA 2E6XA 3OWEB 4HROA 3MFGA 2MJ3A 1OFFA 5I4DA 1MI0A 2YEPB 1EWYC 2WNMA 3L4PA 2K9XA 1FO4A 2K3UA 4JPSA 4A55A 3SR6A 4L1BA 5FK9C 3W9CB 1ZOYB 1QKZA 1AN8A 1PYWD 3AV8A 2W54A 3MHZA 4A9AA 2WXMA 2CJOA 4JX1C 3Q8FA 2MJDA 3HUIA 3U4EG 2JWUA 5HHDG 1WGKA 4LTUA 1VZ8A 4PT5A 4A6QA 1GB1A 2JU6X 3BVGA 3AEGB 3KLSX 4N58A 3AE9B 2HTME 4P6VF 1ET6A 3PZ7A 2IPKD 4HJGE 5H92C 4R3DA 1QOFA 3B9JA 2GB1A 1SBBB 2V0GA 4RGMA 2L1AA 1XF5L 4KX6B 1D5MC 1FIQA 4ARCA 4TQ0A 1KFYB 3DWGC 4YSXB 1L0XB 4ZHOA 3NS1A 1MVKA 3ZYYX 4RGOS 4NZLB 4JWUC 4A8XC 1OQQA 1ZUD2 2H89B 4ITKA 2G9HD 1YN4A 1WSPA 5D3IB 1YMHE 2AX5A 5H8YE 2J52A 1DOYA 4REZA 4LLGM 2B76B 3H8HA 4OZAA 3MJ5A 3BIID 3IT6B 2NTTA 1DYQA 2NMQA 1TS3A 2KACA 1ACCA 1UGJA 2BB5A 2XNAC 1IBXB 1SIJA 2PVOD 2OHFA 1ROEA 4IKGA 3KWLA 1HA5A 4MACA 3AB5A 3NRZA 2WXNA 1KRHA 3Q69A 5EE9A 2WDQB 3P4RB 4ZRQA 5GXGB 3T3NA 5D3DA 3IAM1 3ZJTA 2H88B 2JZPA 1FRRA 1N61A 2IJ0A 1V97A 1FFUA 1EU3A 3PO0A 1NYQA 3P4PB 4L23A 4MM3B 1FNVA 1V1OA 4YXDB 2W3RA 1Q10A 2AQ2B 3AEAB 2KDMA 4YT0B 4D2KA 2LHEA 1C76A 5EE1A 3O13A 1YN5A 1L4ZB 1FNUA 1TKGA 1WWTA 5HI1A 2WXHA 1EWCA 1I4QA 1ZP0B 1NENB 1AYFA 4TQ1A 1D4BA 2GRIA 2XN9C 2FBWB 2RPVA 2QEJC 2VZKD 3EUB2 5G5HA 2DLBA 3TUOA 3WCQA 1SB3C 4HEA1 3W5UB 2RMMA 3TSSA 1PGAA 2WXJA 3W2DA 1JW9D 4OZCA 1MHHE 4C7ZA 3BK1A 1FNWA 1SXTA 1D5XC 1FXAA 1TY2A 4KKJA 4WAFA 2INNE 1IGDA 2YEPF 1WRIA 1P7EA 1HQRD 1CK1A 1ZDVA 1GPXA 1D6EC 4MH8A 3AE6B 2BBCA 1KF6B 3Q8BA 1JROA 1FD6A 2ICIA 1L6UA 2PKOA 3VR9B 1V8CA 1I4HA 1E6EB 3AE7B 4RF1A 4YWGG 2GI9A 1VJKA 4CQNA 2BTEA 2J42A 3NVVA 3FAHA 1YJIA 4XDDA 3ETRA 1RM6C 1RYJA 4FXCA 5HFYA 2LEKA 1K50A 4YTNB 3BVMA 1QF6A 2DWQA 2N7JA 3BYYB 2V3PA 3EGRA 2Y5CA 2M56B 1YN3A 2K0PA 4TSSA 3ABVB 2ACZB 3Q8EA 4RCOA 4NAWB 3P4QB 5EE0A 1V1PB 3W5VB 4ZHPA 3VRAB 5BMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLS C;  2ON8 A;  1YNT E;  1YMH E;  2PW9 A;  2J52 A;  3V3X A;  2I38 A;  4OZA A;  1PGB A;  2NMQ A;  2KAC A;  5BMH A;  2LUM A;  3FIL A;  1IBX B;  2QMT A;  5HG2 A;  2QSD A;  1XCT L;  2PLP A;  4IKG A;  2OED A;  4MAC A;  1XCQ L;  2JSV X;  1HEZ E;  2LGI A;  1C9F A;  1PGX A;  1EM7 A;  1HZ6 A;  1F2R I;  2JZP A;  2J53 A;  2KN4 A;  1MPE A;  1MHX A;  2IGG A;  4KGR A;  1K53 A;  4KGT A;  2ZW0 A;  3UI3 A;  1Q10 A;  2KDM A;  2N9K A;  4D2K A;  2LHE A;  2LHD A;  4IOI E;  1HZ5 A;  5HI1 A;  4KGS A;  1D4B A;  4WH4 A;  2RPV A;  2EEL A;  1IBX A;  1JML A;  1MI0 A;  3GB1 A;  2RMM A;  2JXT A;  1PGA A;  1QKZ A;  4OZC A;  1MHH E;  4OZB A;  1FCL A;  1IGD A;  5BMI A;  1P7E A;  3FIL B;  1FD6 A;  2KQ4 X;  2KWD A;  1UWX A;  2JWU A;  5HHD G;  1K51 A;  2GI9 A;  2IGD A;  4HKZ E;  2IGH A;  1F2R C;  2N9L A;  5JXV A;  1FCC C;  2JU6 X;  1GB1 A;  3MP9 A;  1P7F A;  2ZW1 A;  4HJG E;  5HFY A;  1GB4 A;  1ZXH A;  1K50 A;  1KH0 A;  2GB1 A;  1XF5 L;  2N7J A;  2PTL A;  2K0P A;  2I2Y A;  1K52 A;  1IGC A;  2ONQ A;  1MVK A;  5BMG A; 
#chains in the Genus database with same CATH topology
 2WHI A;  4PYU A;  3GP7 A;  3DQV A;  1D3Z A;  2IBI B;  3C8Y A;  3VUY A;  4A90 A;  3DHI C;  2PLP A;  2Z59 B;  2K6Q A;  3RD2 A;  3QQ8 B;  1C9F A;  2IND C;  3U30 A;  1AWD A;  2BT6 A;  3X23 A;  1T5X D;  3RZW C;  1FMA D;  1HXY D;  2IGG A;  2IY1 B;  5BYQ A;  3PS6 A;  1UH6 A;  1FRD A;  1V6E A;  5C3J B;  4ZRP A;  5AEK B;  4OVU A;  4CO7 A;  3LDZ E;  3C0R B;  4LNI A;  1BXT A;  1IPG A;  2W55 A;  3V60 A;  4M02 A;  1HZ5 A;  4J3O D;  1FFV A;  5DPT A;  1E8W A;  1UGM A;  4WWM A;  4MEL A;  5LLI A;  3EA6 A;  5DPS A;  5E6P A;  2JZ3 B;  2N9P C;  3NY5 A;  1C77 A;  1OQR A;  4GU2 A;  4ZRK A;  3FIL B;  2LVP A;  1TYG B;  1XXG A;  1UWX A;  4G3X B;  4HKZ E;  2N9L A;  1XEE A;  1P7F A;  1ZDX A;  4RM8 A;  2ZW1 A;  2WXL A;  3Q14 C;  1L4D B;  1ZXH A;  2LAS A;  3ZVV A;  3SFE B;  2IO2 B;  1QT9 A;  2CS4 A;  3DVN U;  2PTL A;  1T0S C;  3ZTC A;  2W3S A;  4OVV A;  1P98 A;  3R7R A;  3QX1 A;  5L83 A;  2INP E;  4GLS C;  2FID A;  3HVZ A;  3ZIM A;  4GIV A;  5J2R A;  1I7H A;  4M8N A;  2R2Q A;  4CYE A;  2LFI A;  3DHH C;  3E56 A;  2QJL A;  1WXQ A;  5C2T B;  1L7Y A;  1VR9 A;  2OED A;  2QIE B;  3SEB A;  4B95 A;  3MC9 A;  1C4A A;  3DCG A;  4K1R B;  1B9R A;  2MEK A;  3WIM A;  1Z2M A;  1LO5 D;  4EFO A;  1E0Z A;  4LJO B;  3GZN I;  4M00 A;  3UQA A;  5D94 A;  2GBJ A;  2FIF A;  3RNC C;  3D32 A;  1OTR B;  4H2A A;  1GC6 A;  1T3Q A;  5DPW A;  2JX5 A;  2LZ6 A;  3L0W B;  1H4R A;  2DBY A;  3KUC B;  4ANW A;  1SF0 A;  3M3J A;  1PUT A;  2CHX A;  4GDK B;  3NZ3 A;  4NAM A;  2EEL A;  3AE4 B;  3IBE A;  4WIP A;  1ZXI A;  3ZDM C;  2K22 A;  3HRD D;  3NVW A;  1EF5 A;  2V4I B;  1C4P A;  2JYT A;  2KWC A;  3IG3 A;  4AP4 C;  4FBJ B;  3I9V 1;  4GSW A;  4GGQ A;  5BMI A;  4PS3 A;  1EF1 A;  4C80 A;  1JQ4 A;  2KWD A;  1E9M A;  1T0R C;  2BKF A;  1K51 A;  2IGH A;  4AOF A;  2KJH B;  2A4Z A;  3W1S A;  3RNF C;  2XK5 B;  2KNB A;  4GOC A;  2J4X A;  3AN1 A;  4IG7 B;  2GBM A;  3NOB A;  3PGE A;  1E7U A;  4AUQ C;  4GDL A;  4WJN A;  2ZCC A;  3VHT C;  3SU8 X;  3Q8C A;  2I2Y A;  1T6B X;  1J0G A;  3H9D A;  3RPF C;  1VZ7 A;  1WM2 A;  3NZS A;  1TKE A;  5BYR A;  3DDC B;  1JWM D;  4A3P A;  2PW9 A;  1Q1O A;  1HE8 A;  5CHV C;  4NJ7 A;  3KVF B;  5G55 A;  1FXI A;  3APD A;  3PHX B;  3URY A;  1ET9 A;  2LUE A;  2UWQ A;  2WLB A;  3J9C A;  3B2F A;  3TL5 A;  1LFD A;  4DHJ B;  2NCN A;  5L95 C;  1XQQ A;  5BO4 B;  5C23 A;  4ZYS A;  2KO3 A;  2L76 A;  1UNS A;  2ZW0 A;  2KHW B;  5FKA C;  5FR3 A;  4YSZ B;  2X38 A;  1BML C;  3ML9 A;  3AM9 A;  3QIJ A;  4GXB A;  1FXT B;  3ZTD A;  4P16 A;  4HCP B;  4URK A;  3KWV A;  5CTR C;  5CHF A;  3OWE B;  4HRO A;  2LVQ A;  2BYV E;  1R4M I;  5I4D A;  2FCQ A;  3H7P B;  4B9K A;  4CHK A;  1V5T A;  2WNM A;  2LJ5 A;  1UZX B;  2C5L C;  3SR6 A;  4C00 A;  1RAX A;  1QKZ A;  5G2N A;  3WAM A;  1P1A A;  2JUO A;  4PYZ A;  2NBU A;  3QCA A;  2UU7 A;  4IWO A;  4WWN A;  2N9X A;  3U8Z A;  4MEM A;  4IM2 A;  5TR5 A;  3BVG A;  1WGY A;  4N58 A;  3AE9 B;  2HTM E;  4I6L B;  5H92 C;  3PLV A;  4M01 A;  2V0G A;  2L1A A;  4JL9 A;  1E90 A;  2D3G A;  3ZYY X;  4RGO S;  4JWU C;  4A8X C;  4ITK A;  1YN4 A;  2V1Y A;  1WSP A;  2DZJ A;  3HM3 A;  4BOZ B;  2J52 A;  2JRI B;  1DOY A;  4LLG M;  3W1S C;  3BII D;  5IOI A;  2NMQ A;  2KAC A;  1ACC A;  1UGJ A;  2UYZ B;  1IBX B;  1OEY A;  2WGS A;  2WXN A;  2N7E A;  3P4R B;  1VCB A;  1SE9 A;  5GXG B;  5D3D A;  3IAM 1;  4JQW C;  4J6I A;  3K9P B;  2NBV B;  4NQL B;  2ZPN A;  1V49 A;  2W3R A;  2LHE A;  4K7U A;  1YN5 A;  1L4Z B;  5HI1 A;  2PE6 B;  4K3C A;  1F52 A;  1QZE A;  1ZP0 B;  2KQS A;  4BKS A;  2QEJ C;  2DLB A;  3B1L X;  3TUO A;  2EMS A;  3WCQ A;  2FNJ B;  3W5U B;  1R4N I;  2WXJ A;  2O2V A;  1SXT A;  4KIK A;  1FXA A;  1TY2 A;  4KKJ A;  4WAF A;  1IGD A;  1D6E C;  4W9E A;  3AE6 B;  1WMH B;  2V3S A;  2O6V A;  2PKO A;  3VR9 B;  3GOE A;  3DVG Y;  3PV1 A;  3B0A A;  4CQN A;  3W1Y A;  5IA7 A;  3PLU A;  1WJ6 A;  1YJI A;  1Z5S B;  4BKT A;  3V6C B;  2LEK A;  4HVB A;  3VH4 B;  4ZRI A;  2HTH A;  3BVM A;  1Q5W B;  4ICV A;  5AZG A;  4E3C A;  3NJT A;  5J17 A;  2MRP A;  3N20 C;  4HCN B;  2K0P A;  5EE0 A;  3P4Q B;  3W5V B;  5BMG A;  3ENE A;  1N5X A;  1XO3 A;  3OLM D;  1L0Y B;  2JZZ A;  3FC4 A;  2RDG A;  4ARI A;  4S17 A;  2N1W A;  5BMH A;  4WWP A;  2LUM A;  4N59 A;  2RD0 A;  1WIA A;  1UEL A;  3EFU A;  4FJV B;  1J7C A;  1N62 A;  4II2 B;  5J18 A;  3TMP B;  5CX3 A;  2KN4 A;  1MHX A;  2KT7 A;  3AEF B;  1EUV B;  4B0E A;  2L0F A;  2Z0E B;  3ZJV A;  2G1E A;  3A9J B;  3H1U A;  2Z8L A;  3CST A;  1TJE A;  2M0A A;  1DOX A;  3V62 A;  2BF8 B;  3WAP A;  1WXA A;  2IO0 B;  3CWI A;  4ANV A;  2JQR B;  3ZRC A;  1SE4 A;  4W9G A;  1UD7 A;  4TMA B;  1TBE A;  2CU3 A;  4US8 A;  1WX8 A;  2CHW A;  1F9J A;  3AE3 B;  3CIR B;  4NPN A;  2Q5W D;  4MM3 A;  3ZQ4 A;  1N5W A;  1SSN A;  1WJN A;  3RUI B;  1F0Z A;  4C7Y A;  1SEB D;  1F2R C;  3LB8 C;  3C19 A;  1GUA B;  3AUL A;  2FAZ A;  2MW5 A;  4C4V B;  4I6P A;  3RN9 C;  2L05 A;  3DVN V;  2JXX A;  4DHZ B;  5LXH A;  3QWZ B;  2AL3 A;  4XWW A;  1E8Z A;  2SAK A;  1XLQ A;  1WE7 A;  2QIL A;  3BZD B;  4LK0 M;  5CHW A;  3PPA A;  1YNT E;  2XEW A;  5JHA A;  4FHK A;  4AQ7 A;  4WWO A;  2I38 A;  2GBR A;  4TV3 A;  2N1V A;  4BBN F;  2D07 B;  2NTS A;  2NPT A;  3AE5 B;  1ZGU B;  1P3Q U;  3GZN B;  4DBG A;  3SDL C;  4ASW C;  1EM7 A;  2WDV B;  4GN1 A;  1P0R A;  4IWQ A;  4WAA A;  1TS2 A;  1ENF A;  2L7R A;  1J7A A;  1WGR A;  3KQ4 A;  3GS2 A;  5C1Z A;  1WXM A;  2LXC A;  2WX0 A;  2KFK B;  3QK0 A;  2JF5 A;  3UI3 A;  4EZL A;  2W9N A;  5BYS A;  3DOW A;  2WXK A;  1JWU D;  1V1P A;  4DHJ D;  1JWB D;  1KLU D;  4ZOH C;  3EC8 A;  4MT5 A;  3P63 A;  2WDT B;  3NG0 A;  1FEH A;  2MWS B;  3QAR A;  3Q3J A;  1C78 A;  4EE2 A;  4RF0 A;  3M63 B;  1YX6 B;  2KD0 A;  2WX1 A;  1VLB A;  4K81 A;  3ZNG C;  2ZPY A;  1TKY A;  4KZ0 A;  1ZE3 D;  3ZNI D;  4XWT A;  1JWA D;  3PT2 B;  2WP9 B;  4P1B C;  3Q3N C;  1WM3 A;  4MSQ B;  4O1N A;  4W9I A;  3RCZ A;  5JH5 C;  1YJ1 A;  2WQY B;  3KYC D;  2DZK A;  3VTW A;  5KHO A;  1TS5 A;  3BK2 A;  4RH6 A;  2AEH A;  3MC0 B;  2AWT A;  3APF A;  3LJ3 A;  1QLB B;  3ZXR A;  3ZNH B;  3ALB A;  3U7D A;  4RM9 A;  2N7D A;  2KX0 A;  3EEC A;  3R8B A;  2XK5 A;  3LXF A;  4BFR A;  2KLG A;  3VR8 B;  4B6W A;  3UIN B;  2KN5 A;  4OW0 A;  1PFD A;  3H6N A;  2PE9 A;  2PIA A;  1E5W A;  2QMT A;  4L2Y A;  1XCT L;  3IVF A;  3PZD A;  1ISN A;  1HEZ E;  2JSV X;  2LGI A;  1L6V A;  1WFY A;  1DOI A;  1F2R I;  2KC2 A;  4LNF A;  3UGB B;  2J53 A;  4B0M A;  4LNO A;  3B2G A;  2Y3A A;  4KGR A;  3JSV A;  4JE3 B;  4UDU C;  4DXA B;  3N1Z C;  1WY8 A;  2KLC A;  4DXF A;  5TSS A;  2D11 A;  2L32 A;  2DZM A;  2WS3 B;  2LHD A;  1R4M B;  3A9K A;  1RWS A;  2I1K A;  3DBR I;  2E6X A;  2ZVN A;  2MP2 A;  3MFG A;  2VH1 A;  1OFF A;  2K8C A;  2KDF B;  1MI0 A;  2YEP B;  2K9X A;  4WJO A;  1FO4 A;  2HJ1 A;  2K3U A;  4JPS A;  5FK9 C;  3W9C B;  3QAQ A;  3AV8 A;  3I3T B;  2ZCB A;  1OQY A;  5DCN A;  2WXM A;  2OJR A;  2NBW B;  3DBL I;  3HUI A;  3U4E G;  5HHD G;  4LTU A;  2AYO B;  2KTF A;  3BY4 B;  3RMK C;  4ANU A;  1GB1 A;  4P6V F;  1WGH A;  2IPK D;  5DPR A;  2ZNV C;  1SBB B;  1XF5 L;  3OG5 A;  4ARC A;  4TQ0 A;  1KFY B;  4YSX B;  1WX7 A;  2IYD B;  2MQJ A;  4P7I A;  2ZEQ A;  2B3A A;  2DX5 B;  5D3I B;  3APC A;  3PRP B;  2VRR B;  4KDI C;  1MJD A;  3H8H A;  4BOS C;  2NTT A;  2RPQ A;  4E71 A;  1KJT A;  2RGF A;  2K6D B;  3VTV A;  3VH3 B;  2PVO D;  3M62 B;  3N1X C;  3KWL A;  4IKG A;  3AB5 A;  3NRZ A;  2G45 B;  4ZRJ A;  2WDQ B;  1UF0 A;  4MGK E;  2NR2 A;  1FRR A;  3KW5 B;  1FFU A;  3AU4 A;  2BWE S;  4FAD A;  2KZR A;  4NQK E;  4WJQ A;  2KKC A;  1RLF A;  1Q10 A;  2AQ2 B;  4LDT B;  2V4L A;  3MC8 A;  4D2K A;  4FJY A;  4G0N B;  4X57 B;  2KTR A;  3R66 C;  1WWT A;  4NY0 A;  3PRM B;  4DDG D;  1D4B A;  4KVG B;  2GRI A;  2XN9 C;  2RPV A;  1R4N B;  3KH0 A;  1WR1 A;  1SB3 C;  2LRU A;  4PK1 A;  1PGA A;  3W2D A;  1JW9 D;  1WX9 A;  3PVL A;  1MHH E;  2Z0D B;  1UBI A;  1WXS A;  5AZH A;  2YEP F;  3AXC A;  2BPS A;  1WH3 A;  1FPY A;  2ZVO A;  3Q8B A;  1JRO A;  2ICI A;  1RRB A;  1L6U A;  3DHG C;  1V8C A;  2G3Q B;  1VJK A;  1NI2 A;  2BTE A;  2J42 A;  3UF8 A;  2LI5 A;  4XDD A;  4MJS A;  1RYJ A;  4FXC A;  2MCN B;  5HFY A;  3CMM B;  5KHQ A;  1BT0 A;  4E74 A;  1QF6 A;  3KYD D;  5D2M B;  3R7Q A;  5IN7 A;  2DWQ A;  2Y5C A;  1YN3 A;  4EOY A;  4RCO A;  4ZHP A;  3VRA B;  4BKS D;  3T9L A;  4OHJ A;  3OJ4 B;  2BB6 A;  1VRA B;  4KKI A;  1WRD B;  1UBQ A;  2PMV A;  1LGR A;  2BS3 B;  1GJZ A;  3H7S A;  2QC8 A;  3WAO A;  3RNG C;  2Y5B B;  5HG2 A;  2MBH A;  1YQB A;  2Y5P A;  1NVI D;  3NVZ A;  1GAQ B;  2O6V D;  1I35 A;  5T8I A;  2QHO A;  2J0M A;  5IO9 A;  1E8Y A;  1YIW A;  3V61 A;  3ZO5 B;  3L17 A;  4M0W A;  1VDV A;  1WJ4 A;  2WXG A;  1JAL A;  3R2T A;  3TJP A;  2YVC A;  3JW0 X;  1CZP A;  4WUR A;  2CKH B;  3RFZ B;  1C4C A;  3VFK A;  2RDH A;  1JWS D;  3V6E B;  4G50 A;  2LXA A;  4GDL B;  2G4S A;  4K7S A;  5FR6 A;  3N32 A;  3ZJU A;  3GB1 A;  3M95 A;  2MBO A;  2FUH B;  2WXR A;  3WAN A;  2ASQ A;  1SGH A;  1UUP A;  2LGY A;  2R61 A;  4A3O A;  3I5J C;  3RZF A;  2KYW A;  3AED B;  3HIZ A;  3L16 A;  4OZB A;  2HD5 B;  1FCL A;  3Q3F A;  4RGN A;  4AWJ A;  2WU2 B;  1V9J A;  4G11 A;  1J8C A;  1UWM A;  2HDE A;  3PHW B;  4RMA A;  2EKI A;  4YTM B;  4II3 B;  5IKC M;  3TBL D;  5E6N A;  1FCC C;  4WQM A;  3MP9 A;  4JLC A;  1P9D U;  2AL6 A;  3A1Q A;  4IUM B;  1KLG D;  2DYB A;  3A33 B;  4HXD A;  4ZDV A;  2PPH A;  1WE6 A;  2CU1 A;  5E6J A;  4M8M A;  3EFC A;  1EU4 A;  4JWS C;  4NJC A;  1LM8 B;  2KDB A;  1L0V B;  1DGJ A;  3U2S C;  2IO1 B;  4LJP B;  1E7V A;  2WYQ A;  5IAA C;  4FN2 A;  2JVC A;  3MJW A;  1H8C A;  1ZPS A;  1EO6 A;  4XE0 A;  1XLN A;  1JCK B;  4FJZ A;  1YQ3 B;  1I4G A;  3I63 C;  4US9 A;  1XCQ L;  1C1Y B;  2EKE C;  3JVZ X;  4AS1 A;  3P4S B;  4OVZ A;  4N6E B;  1V86 A;  1HTQ A;  3EHV A;  4ACF A;  2KMM A;  3B08 A;  3NHE B;  3AE8 B;  2LJI A;  4FHJ A;  3TEW A;  5D7G A;  4C56 C;  3BVZ A;  4NAW A;  1ZW7 A;  4RGT A;  2GLS A;  3T3O A;  4JIO U;  3ECI A;  3NUH B;  2M17 A;  1CQV A;  1NEK B;  2AQ1 B;  1OGW A;  2KVZ A;  2WXQ A;  2A5U A;  4IWP A;  1QOG A;  2DAF A;  1CMX B;  3L13 A;  2FCS A;  3KUZ A;  3U52 E;  1GOZ A;  3RNE C;  2KQ4 X;  3P1M A;  2BQQ A;  2QCZ A;  5JXV A;  2KXJ A;  4JGH B;  4LCD E;  3SFD B;  1V5O A;  3Q8A A;  1JRU A;  2M19 A;  2JRH A;  3IAS 1;  3S2A A;  1K52 A;  2C60 A;  2DYO A;  1V80 A;  1XLP A;  4HLE A;  3NVY A;  2V9H A;  4RFB A;  1SJE D;  4Q2J A;  2BS4 B;  3FIL A;  1OEY J;  2FE8 A;  3AEB B;  4KSL C;  1A70 A;  2LWP A;  3ZLZ A;  4W9C A;  1F77 A;  2M4N A;  1PGX A;  2O2V B;  2LMC A;  3RI7 C;  4YTP B;  2MH7 A;  4XDC A;  3VUW A;  1NDD A;  2BWF A;  4MSM B;  2ZZP B;  3AE1 B;  4LNK A;  2O6V B;  4DDI D;  2BYT A;  2CJN A;  3R3M A;  2N9K A;  1GNU A;  1VZ6 A;  3DBR B;  2GOW A;  4QAY A;  5HKH A;  1E10 A;  3N9Y C;  2KJ6 A;  3ZNZ B;  3N30 A;  4EUT A;  1WGG A;  4EKU A;  2K1F A;  4P1C C;  1TTN A;  4LDT D;  1ZKH A;  3ZKJ C;  2MX2 A;  3FKY A;  3GE3 C;  4MH0 E;  2KQ7 A;  3GE8 C;  1ZOY B;  3DBL B;  1AN8 A;  1PYW D;  2C7N B;  2W54 A;  3MHZ A;  4EZK A;  4F7Z A;  4A9A A;  4JX1 C;  4AJY B;  2MJD A;  2OJW A;  1WGK A;  4WQO B;  4F1S A;  4PT5 A;  3ZW3 A;  2JU6 X;  3QHT A;  4IM0 A;  3AEG B;  3KLS X;  1MFW A;  1ET6 A;  4W9K A;  1MG4 A;  1VD2 A;  1QOF A;  3B9J A;  2GB1 A;  4RGM A;  2BKR B;  4GDK A;  4BKG A;  1FIQ A;  1SIF A;  3VVW B;  3DWG C;  1MVK A;  5AZF A;  1OQQ A;  1ZUD 2;  1M94 A;  4XGA B;  4REZ A;  3N3K B;  3MJ5 A;  3IT6 B;  1DYQ A;  1TS3 A;  3DBH I;  4W9F A;  2BB5 A;  2XNA C;  3DBS A;  2BVC A;  2D2Q A;  2OHF A;  1ROE A;  4IM3 A;  4KZC A;  2DZI A;  1HA5 A;  2KJR A;  4MAC A;  5EE9 A;  4XC2 A;  4ZRQ A;  3BIN A;  4IC7 B;  1YX5 B;  3JYU A;  3Q6B A;  2CR5 A;  4MM3 B;  2L3Z A;  1V1O A;  4YXD B;  1WI0 A;  3O65 B;  2KDM A;  4YT0 B;  2RSU A;  5EE1 A;  4PS7 A;  3ZRF A;  2IO3 B;  1FNU A;  1TKG A;  2WXH A;  1I4Q A;  1NEN B;  1AYF A;  2XBB C;  2VZK D;  3VDZ A;  3T8M A;  3CF6 E;  4HEA 1;  4LNN A;  4F8C B;  3OAW A;  2J0J A;  3BK1 A;  1D5X C;  1WJU A;  2J0K A;  2JWZ A;  3VUX A;  1WRI A;  1P7E A;  1F1H A;  1HQR D;  3ML8 A;  1ZDV A;  1GPX A;  2BBC A;  1KF6 B;  2NPT B;  4AJW A;  4S0R A;  2I1J A;  4YL8 A;  1E6E B;  3ONS A;  4KSK C;  2GI9 A;  4DHZ E;  4BZA A;  3NVV A;  3FAH A;  3ETR A;  1RM6 C;  2M1M A;  4YTN B;  2L0T A;  2N7J A;  3BYY B;  3MTN B;  1LQB A;  2FCM A;  2K8H A;  2GBK A;  2M56 B;  4K3B A;  4XZ4 A;  3H7P A;  4TSS A;  3ABV B;  2ACZ B;  1XD3 B;  3Q8E A;  1V1P B;  2K39 A;  1STE A;  1TY0 A;  3U7Z A;  2ON8 A;  1I4R A;  4DK5 A;  3V3X A;  4HPM B;  1Q0W B;  2SEB D;  5JZE B;  2WXP A;  1SJH D;  3RT3 B;  4NJ6 A;  2WU5 B;  2BS2 B;  1CJE A;  2FCN A;  3HVD A;  2QSD A;  4YSY B;  3AMZ A;  4XYC A;  2G4D B;  1YQ4 B;  5IP4 D;  1E8X A;  1C3T A;  1I42 A;  2ZNV B;  2KDI A;  4HWI B;  2D3B A;  2KAN A;  2MBQ A;  1WZ3 A;  2JPH A;  3SD5 A;  4DQO C;  3TEY A;  2WDR B;  2JT4 B;  1Y56 A;  4KGT A;  3RYT A;  3UIP B;  4BAX A;  2LGX A;  3OJ3 A;  2WXF A;  4KDL B;  2GMI C;  2C9W B;  1SE3 A;  1YD8 U;  3I57 A;  2DYM A;  3AEC B;  4DXG A;  1IP9 A;  3BYT B;  1WGD A;  4FA6 A;  4WH4 A;  3E9S A;  1TIF A;  1IBX A;  1RFA A;  3PRE A;  3P42 A;  2K25 A;  2JXT A;  3QA8 A;  4I6N B;  5AUK A;  1N6Z A;  1YOV B;  1YJJ A;  3ZDT A;  2WXI A;  2HE7 A;  1E7P B;  2CHZ A;  3QC8 B;  4HPL B;  5MPO A;  4IDI A;  5JHB A;  1M4V A;  1TGZ B;  1PDX A;  2D5G A;  2IGD A;  2X8X X;  1QIL A;  1XLO A;  1L5P A;  4K7W A;  2L52 A;  4EEW A;  1D5Z C;  4HRS A;  2KVR A;  1GB4 A;  1I4P A;  3IT4 B;  1KH0 A;  2D3C A;  3JSV B;  2M8S A;  3QJZ A;  1NBF C;  3ZXV A;  2DAJ A;  3R2I A;  1WYG A;  4W9D A;  2ONQ A;  1C79 A;  1QOA A;  1I4X A;  3MHS D;  2MBB B;  2TSS A;  3A4S C;  4W9J A;  3A9K B;  1J7B A;  1K8R B;  1X1M A;  2MP2 B;  2DNF A;  4TUU A;  3TEX A;  1RFK A;  2LRW A;  1WMH A;  3TCA A;  5EE3 A;  3VQI A;  5EDS A;  2KAJ A;  4EZJ A;  3LYY A;  1HZ6 A;  1U4A A;  2E3T A;  3PTF C;  1AW7 A;  3X0W A;  1MPE A;  2LVO A;  1KLV A;  5AUI A;  1K53 A;  1JRP A;  1TZO A;  4HKQ A;  3N1Y C;  1SE2 A;  2PEA A;  2WXO A;  2KFJ A;  3DVG X;  2IDY A;  1B1Z A;  1WYW B;  1JML A;  2IZV B;  3TIX A;  1TS4 A;  4A20 A;  2W82 A;  1N63 A;  2IY0 B;  1S3S G;  1KTK A;  2VZK B;  2FUG 1;  2D10 A;  2AQ3 B;  2MLB A;  1NYR A;  3NZU A;  2MA9 B;  3A9J A;  3TEZ A;  2N4F A;  1FM0 D;  4TKN A;  1MG8 A;  3UQB A;  2K8B A;  2K5P A;  1GC7 A;  4HJK A;  1G6J A;  1L2N A;  2M0X A;  3P2B A;  2V3N A;  2L83 A;  5LXI B;  3AEE B;  2PVG C;  2BW2 A;  3AH7 A;  3VRB B;  1HTO A;  1BUI C;  2MSE D;  3BWU D;  3PZ8 A;  5G5G A;  1IGC A;  3IXS A;  4ANX A;  3IHP C;  1TT5 B;  3V05 A;  2KTR B;  4RNA A;  2N0S B;  1N60 A;  4HDQ A;  3AU5 A;  2OOB B;  1WXV A;  2MJE A;  1PGB A;  4FLH A;  4HDO A;  1QOB A;  1AAR A;  4ZYN A;  2KWV B;  3ZGZ A;  1T0Y A;  1ESF A;  2C7H A;  5LNK 1;  2DHZ A;  2RDB C;  3DPD A;  3DWM A;  2J7Q B;  4USA A;  3VXW A;  4C4V A;  1WF9 A;  2KK8 A;  2JYE A;  2MHJ A;  3WA0 A;  4FUL A;  3WAL A;  2NS5 A;  1TZ1 A;  3VTU A;  1R7S A;  4IOI E;  1QQR A;  4MGY E;  4MJS B;  1NI3 A;  3K9O B;  4W9H A;  1Y8R C;  2REX A;  3AE2 B;  4KGS A;  1IUE A;  2HJ8 A;  2R2O A;  3NS8 A;  2MJ3 A;  3KUD B;  2DEN B;  2QDF A;  1EWY C;  1IYF A;  3L4P A;  3HK0 A;  3VAW A;  4A55 A;  3A4R A;  3PRZ A;  4L1B A;  4BBN C;  2KOX A;  5GMV A;  2CJO A;  2BYF A;  3RNA C;  1XT9 B;  2KFK A;  3Q8F A;  2JWU A;  3L54 A;  1KM7 A;  1VZ8 A;  4A6Q A;  2VH2 A;  1WZ0 A;  4DWF A;  3PZ7 A;  4HJG E;  1PQS A;  3CSF A;  4R3D A;  2MBE A;  2KX3 A;  4KX6 B;  1D5M C;  2GBN A;  3Q2A C;  4M0W B;  2YLM A;  1L0X B;  4ZHO A;  3NS1 A;  3HHM A;  3IFW B;  4NZL B;  2LD9 A;  3DBH B;  2WWZ A;  1V2Y A;  2H89 B;  2KDE B;  2G9H D;  1GG3 A;  1S1Q B;  4ICU A;  1YMH E;  2AX5 A;  5H8Y E;  1A5R A;  3RNB C;  1J19 A;  2B76 B;  4OZA A;  4WJP A;  2BGF A;  1SIJ A;  3L08 A;  1KRH A;  2KWU B;  3Q69 A;  4HK2 A;  1LXD A;  2L8J A;  3T3N A;  3ZJT A;  2H88 B;  2JZP A;  1KOT A;  4BVU C;  1N61 A;  2IJ0 A;  1V97 A;  3RUL A;  1EU3 A;  4XX5 A;  3PO0 A;  1NYQ A;  2LGS A;  3P4P B;  4GB9 A;  4L23 A;  1FNV A;  1WR6 E;  4KV2 A;  4NNJ B;  5D6J B;  3UIO B;  4PS8 A;  3AEA B;  2C7M B;  1C76 A;  4N9F 4;  3O13 A;  3A1Q B;  2KC1 A;  3ZUN A;  1EWC A;  3HM6 X;  4MDK E;  4TQ1 A;  2L00 B;  3AI5 A;  2FBW B;  4KIK B;  3EUB 2;  5G5H A;  3SHQ A;  2PJH A;  5E6O A;  1T0Q C;  2LGD A;  2RMM A;  3TSS A;  4OZC A;  4C7Z A;  1FNW A;  2INN E;  2NVU I;  1CK1 A;  1V81 A;  2KMA A;  4MH8 A;  2ZJD A;  3Q3O C;  1FD6 A;  2D3A A;  2RR9 A;  4HPP A;  4W9L A;  1I4H A;  3AE7 B;  4YWG G;  4RF1 A;  4IW0 A;  3Q3M C;  2BYE A;  2EMT A;  4GMV A;  2N9E B;  1K50 A;  4MGZ E;  2INC C;  2V3P A;  3EGR A;  4MGI E;  3L10 B;  4NAW B;  2JY6 A;  3PSE B;  2KMC A; 
#chains in the Genus database with same CATH homology
 1STE A;  1N5X A;  1TY0 A;  4OHJ A;  2ON8 A;  3U7Z A;  2BB6 A;  1I4R A;  1VRA B;  1XO3 A;  4KKI A;  3GP7 A;  1L0Y B;  3V3X A;  3FC4 A;  2PMV A;  2RDG A;  2SEB D;  2WXP A;  4ARI A;  1SJH D;  2WU5 B;  2BS3 B;  2BS2 B;  5BMH A;  1CJE A;  2LUM A;  4N59 A;  3C8Y A;  3HVD A;  4A90 A;  5HG2 A;  2QSD A;  2PLP A;  4YSY B;  2Y5P A;  3AMZ A;  1NVI D;  3NVZ A;  1YQ4 B;  1C9F A;  1GAQ B;  5T8I A;  1AWD A;  1J7C A;  1N62 A;  2BT6 A;  1T5X D;  1FMA D;  1HXY D;  2KN4 A;  2IGG A;  1MHX A;  4DQO C;  5BYQ A;  3TEY A;  2WDR B;  1Y56 A;  3AEF B;  4B0E A;  1FRD A;  4KGT A;  4M0W A;  5C3J B;  3ZJV A;  1VDV A;  4ZRP A;  2G1E A;  2WXF A;  2WXG A;  2Z8L A;  1BXT A;  1TJE A;  1JAL A;  3R2T A;  2M0A A;  1SE3 A;  1DOX A;  2W55 A;  3I57 A;  2DYM A;  4WUR A;  1CZP A;  3AEC B;  1HZ5 A;  4DXG A;  4J3O D;  3BYT B;  3RFZ B;  1C4C A;  1FFV A;  3CWI A;  2RDH A;  1JWS D;  4WWM A;  4WH4 A;  3E9S A;  4GDL B;  2JQR B;  1IBX A;  3EA6 A;  3ZJU A;  1SE4 A;  3GB1 A;  2WXR A;  3P42 A;  1UUP A;  2JXT A;  4TMA B;  2R61 A;  3AED B;  2CU3 A;  1C77 A;  4US8 A;  1OQR A;  4OZB A;  5AUK A;  1FCL A;  1YJJ A;  4RGN A;  2WU2 B;  2WXI A;  3FIL B;  1UWM A;  3AE3 B;  2HDE A;  3CIR B;  1E7P B;  2Q5W D;  3ZQ4 A;  1N5W A;  1TYG B;  5MPO A;  1XXG A;  1SSN A;  4IDI A;  1UWX A;  2EKI A;  4YTM B;  1M4V A;  1PDX A;  1F0Z A;  2D5G A;  4C7Y A;  2IGD A;  1SEB D;  4HKZ E;  1F2R C;  1QIL A;  3LB8 C;  1XLO A;  2N9L A;  1XEE A;  1FCC C;  1L5P A;  3MP9 A;  4WQM A;  1P7F A;  1ZDX A;  2ZW1 A;  2L52 A;  2WXL A;  1D5Z C;  4HRS A;  1L4D B;  1GB4 A;  1I4P A;  1ZXH A;  3IT4 B;  1KLG D;  1KH0 A;  3SFE B;  1QT9 A;  2PTL A;  2W3S A;  5E6J A;  4XWW A;  1EU4 A;  2SAK A;  4JWS C;  4NJC A;  3R2I A;  1WYG A;  1L0V B;  1XLQ A;  2ONQ A;  1C79 A;  2QIL A;  3BZD B;  1DGJ A;  4LK0 M;  1QOA A;  1I4X A;  2INP E;  3U2S C;  2TSS A;  4GLS C;  1YNT E;  3HVZ A;  1I7H A;  4AQ7 A;  2I38 A;  1J7B A;  2LFI A;  3E56 A;  2QJL A;  1WXQ A;  3TEX A;  1RFK A;  5C2T B;  1ZPS A;  1VR9 A;  2NTS A;  4XE0 A;  3AE5 B;  1XLN A;  1JCK B;  1YQ3 B;  1I4G A;  2OED A;  4US9 A;  1XCQ L;  5EE3 A;  2QIE B;  3VQI A;  3SEB A;  2KAJ A;  1C4A A;  1EM7 A;  2WDV B;  4AS1 A;  3LYY A;  1HZ6 A;  1TS2 A;  1ENF A;  2MEK A;  2E3T A;  1B9R A;  1LO5 D;  3P4S B;  1J7A A;  4OVZ A;  1E0Z A;  4N6E B;  1AW7 A;  3GS2 A;  3KQ4 A;  1MPE A;  2KMM A;  5AUI A;  1K53 A;  3AE8 B;  1JRP A;  2LJI A;  3UI3 A;  1TZO A;  3TEW A;  5BYS A;  5D7G A;  4H2A A;  4C56 C;  4HKQ A;  3BVZ A;  2WXK A;  1JWU D;  1T3Q A;  1V1P A;  1JWB D;  1SE2 A;  2WXO A;  1KLU D;  4ZOH C;  4RGT A;  4MT5 A;  2JX5 A;  3P63 A;  2DBY A;  1SF0 A;  1FEH A;  1PUT A;  3T3O A;  1C78 A;  4GDK B;  4EE2 A;  2IDY A;  1B1Z A;  3NZ3 A;  4NAM A;  2EEL A;  3AE4 B;  3NUH B;  4WIP A;  4RF0 A;  1JML A;  1CQV A;  1NEK B;  1ZXI A;  1VLB A;  2AQ1 B;  1TS4 A;  2K22 A;  2WXQ A;  2W82 A;  3HRD D;  1N63 A;  3NVW A;  2V4I B;  1C4P A;  2JYT A;  1TKY A;  1QOG A;  1ZE3 D;  4XWT A;  1JWA D;  2WP9 B;  1KTK A;  3I9V 1;  2VZK B;  2FUG 1;  3U52 E;  5BMI A;  2AQ3 B;  1NYR A;  4O1N A;  4C80 A;  1JQ4 A;  1GOZ A;  2KQ4 X;  2WQY B;  2KWD A;  3P1M A;  1TS5 A;  1E9M A;  3TEZ A;  3BK2 A;  1K51 A;  1FM0 D;  4RH6 A;  2IGH A;  5JXV A;  3MC0 B;  3W1S A;  2K5P A;  3SFD B;  2J4X A;  3AN1 A;  3Q8A A;  2V3N A;  2L83 A;  1QLB B;  3AEE B;  2PVG C;  2M19 A;  2BW2 A;  3AH7 A;  3IAS 1;  3VRB B;  1BUI C;  3BWU D;  3Q8C A;  2I2Y A;  1T6B X;  3PZ8 A;  1K52 A;  5G5G A;  3R8B A;  1IGC A;  3IXS A;  2DYO A;  3RPF C;  1VZ7 A;  3LXF A;  1TKE A;  5BYR A;  3V05 A;  1JWM D;  4RNA A;  1XLP A;  2N0S B;  3VR8 B;  1N60 A;  3NVY A;  2PW9 A;  4OW0 A;  2MJE A;  1PFD A;  4RFB A;  1PGB A;  1SJE D;  1QOB A;  4Q2J A;  2BS4 B;  3FIL A;  2PIA A;  2FE8 A;  2QMT A;  1FXI A;  3AEB B;  4L2Y A;  3ZGZ A;  1XCT L;  1A70 A;  3URY A;  1ESF A;  1ET9 A;  5LNK 1;  2WLB A;  2JSV X;  1HEZ E;  2LGI A;  1F77 A;  1L6V A;  3J9C A;  1DOI A;  1PGX A;  3DWM A;  3B2F A;  1F2R I;  2LMC A;  4USA A;  4YTP B;  2J53 A;  2MH7 A;  2JYE A;  4XDC A;  4B0M A;  4ZYS A;  3B2G A;  2Y3A A;  4KGR A;  3AE1 B;  4JE3 B;  4UDU C;  1UNS A;  2ZW0 A;  2BYT A;  2CJN A;  5FKA C;  5FR3 A;  2N9K A;  4YSZ B;  4DXF A;  1VZ6 A;  5TSS A;  2X38 A;  1BML C;  2L32 A;  3AM9 A;  1E10 A;  2WS3 B;  1R7S A;  2LHD A;  4IOI E;  4P16 A;  1QQR A;  3N9Y C;  1NI3 A;  3KWV A;  1RWS A;  3AE2 B;  4KGS A;  1IUE A;  2E6X A;  3OWE B;  4HRO A;  3MFG A;  2MJ3 A;  1OFF A;  5I4D A;  1MI0 A;  2YEP B;  1EWY C;  2WNM A;  3L4P A;  2K9X A;  1FO4 A;  2K3U A;  4JPS A;  4A55 A;  3SR6 A;  4L1B A;  5FK9 C;  3W9C B;  1ZOY B;  1QKZ A;  1AN8 A;  1PYW D;  3AV8 A;  2W54 A;  3MHZ A;  4A9A A;  2WXM A;  2CJO A;  4JX1 C;  3Q8F A;  2MJD A;  3HUI A;  3U4E G;  2JWU A;  5HHD G;  1WGK A;  4LTU A;  1VZ8 A;  4PT5 A;  4A6Q A;  1GB1 A;  2JU6 X;  3BVG A;  3AEG B;  3KLS X;  4N58 A;  3AE9 B;  2HTM E;  4P6V F;  1ET6 A;  3PZ7 A;  2IPK D;  4HJG E;  5H92 C;  4R3D A;  1QOF A;  3B9J A;  2GB1 A;  1SBB B;  2V0G A;  4RGM A;  2L1A A;  1XF5 L;  4KX6 B;  1D5M C;  1FIQ A;  4ARC A;  4TQ0 A;  1KFY B;  3DWG C;  4YSX B;  1L0X B;  4ZHO A;  3NS1 A;  1MVK A;  3ZYY X;  4RGO S;  4NZL B;  4JWU C;  4A8X C;  1OQQ A;  1ZUD 2;  2H89 B;  4ITK A;  2G9H D;  1YN4 A;  1WSP A;  5D3I B;  1YMH E;  2AX5 A;  5H8Y E;  2J52 A;  1DOY A;  4REZ A;  4LLG M;  2B76 B;  3H8H A;  4OZA A;  3MJ5 A;  3BII D;  3IT6 B;  2NTT A;  1DYQ A;  2NMQ A;  1TS3 A;  2KAC A;  1ACC A;  1UGJ A;  2BB5 A;  2XNA C;  1IBX B;  1SIJ A;  2PVO D;  2OHF A;  1ROE A;  4IKG A;  3KWL A;  1HA5 A;  4MAC A;  3AB5 A;  3NRZ A;  2WXN A;  1KRH A;  3Q69 A;  5EE9 A;  2WDQ B;  3P4R B;  4ZRQ A;  5GXG B;  3T3N A;  5D3D A;  3IAM 1;  3ZJT A;  2H88 B;  2JZP A;  1FRR A;  1N61 A;  2IJ0 A;  1V97 A;  1FFU A;  1EU3 A;  3PO0 A;  1NYQ A;  3P4P B;  4L23 A;  4MM3 B;  1FNV A;  1V1O A;  4YXD B;  2W3R A;  1Q10 A;  2AQ2 B;  3AEA B;  2KDM A;  4YT0 B;  4D2K A;  2LHE A;  1C76 A;  5EE1 A;  3O13 A;  1YN5 A;  1L4Z B;  1FNU A;  1TKG A;  1WWT A;  5HI1 A;  2WXH A;  1EWC A;  1I4Q A;  1ZP0 B;  1NEN B;  1AYF A;  4TQ1 A;  1D4B A;  2GRI A;  2XN9 C;  2FBW B;  2RPV A;  2QEJ C;  2VZK D;  3EUB 2;  5G5H A;  2DLB A;  3TUO A;  3WCQ A;  1SB3 C;  4HEA 1;  3W5U B;  2RMM A;  3TSS A;  1PGA A;  2WXJ A;  3W2D A;  1JW9 D;  4OZC A;  1MHH E;  4C7Z A;  3BK1 A;  1FNW A;  1SXT A;  1D5X C;  1FXA A;  1TY2 A;  4KKJ A;  4WAF A;  2INN E;  1IGD A;  2YEP F;  1WRI A;  1P7E A;  1HQR D;  1CK1 A;  1ZDV A;  1GPX A;  1D6E C;  4MH8 A;  3AE6 B;  2BBC A;  1KF6 B;  3Q8B A;  1JRO A;  1FD6 A;  2ICI A;  1L6U A;  2PKO A;  3VR9 B;  1V8C A;  1I4H A;  1E6E B;  3AE7 B;  4RF1 A;  4YWG G;  2GI9 A;  1VJK A;  4CQN A;  2BTE A;  2J42 A;  3NVV A;  3FAH A;  1YJI A;  4XDD A;  3ETR A;  1RM6 C;  1RYJ A;  4FXC A;  5HFY A;  2LEK A;  1K50 A;  4YTN B;  3BVM A;  1QF6 A;  2DWQ A;  2N7J A;  3BYY B;  2V3P A;  3EGR A;  2Y5C A;  2M56 B;  1YN3 A;  2K0P A;  4TSS A;  3ABV B;  2ACZ B;  3Q8E A;  4RCO A;  4NAW B;  3P4Q B;  5EE0 A;  1V1P B;  3W5V B;  4ZHP A;  3VRA B;  5BMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...