1XF5L

Complex hcv core-fab 19d9d6-protein l mutant (h74c, y64w)in space group p21212
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
KTPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEWTADLEDGGNCMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
total genus 16
structure length 71
sequence length 71
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xf5L00
2N7JA 2ZW0A 1Q10A 2PLPA 1MHXA 1D4BA 2IGDA 1XCQL 1K52A 2ON8A 1F2RI 2N9LA 1HZ6A 2LGIA 1YMHE 2PTLA 2OEDA 4IOIE 2KWDA 1MPEA 1ZXHA 1IBXB 2PW9A 4KGRA 4D2KA 1FD6A 1K50A 4OZBA 1MI0A 5HI1A 2RMMA 5BMIA 2JSVX 4MACA 2JU6X 1YNTE 2IGGA 2JXTA 2NMQA 2JZPA 4KGSA 1GB1A 1FCLA 2K0PA 3V3XA 4HKZE 2LHDA 2LUMA 1HEZE 1P7FA 4GLSC 1UWXA 3GB1A 1EM7A 1PGBA 2LHEA 1C9FA 1K53A 4IKGA 5HHDG 1K51A 5JXVA 4KGTA 1F2RC 2RPVA 2QSDA 1MVKA 2KACA 1HZ5A 1QKZA 1XCTL 5HG2A 2GB1A 4OZCA 2GI9A 2QMTA 3UI3A 5HFYA 1P7EA 4OZAA 2I38A 1PGAA 3FILA 2JWUA 1JMLA 2J52A 1FCCC 1KH0A 3FILB 5BMHA 1PGXA 1IGCA 2I2YA 5BMGA 2EELA 2KQ4X 2J53A 2ZW1A 2KDMA 2KN4A 1IBXA 4WH4A 3MP9A 4HJGE 1XF5L 1MHHE 1IGDA 2N9KA 1GB4A 2ONQA 2IGHA
chains in the Genus database with same CATH superfamily
3C0RB 4S0RA 1I4HA 4JPSA 1D4BA 3AE4B 3Q8BA 2BWES 1XCQL 4IM3A 4NJ6A 3GZNB 2AL6A 3DQVA 2WDVB 1C3TA 3B9JA 3ML8A 5EE9A 2CJNA 4BAXA 3A9KB 2PW9A 2KQSA 2XBBC 3P42A 4DHZB 2J7QB 2C9WB 3AE2B 3AEFB 4A3OA 3U4EG 1FFUA 2GBKA 2KTRA 1WIAA 2WDQB 4KSLC 2AEHA 1N5XA 1GC7A 2K0PA 4RH6A 2V0GA 3RUIB 1OQQA 2MCNB 4WJOA 4DHJB 1TGZB 2LJIA 1IP9A 1C79A 1TY0A 2FUG1 4RNAA 1BUIC 1J0GA 4M8NA 4LNFA 1MG4A 1E5WA 1E8XA 3BWUD 2K6QA 1A70A 3HM3A 4KGTA 3U52E 2Z59B 4G50A 5BYRA 4C4VA 1YOVB 4K7UA 3R2TA 4GN1A 2E3TA 2LEKA 5HFYA 1AW7A 2N9PC 4XC2A 2V4IB 3PRPB 4FHKA 5JZEB 2KTRB 3L0WB 3N30A 4ICVA 2M1MA 1Z5SB 2KKCA 2MBHA 1NYQA 2IY0B 3M63B 4HPPA 3PHXB 2FCQA 4YSYB 2XK5B 4DXFA 4J6IA 2Y5BB 3UQAA 2WYQA 4B0MA 5H92C 3QC8B 1ACCA 3NG0A 3AEGB 4USAA 3UQBA 4HK2A 2IGDA 1SIFA 3AE6B 2KVZA 3AM9A 1T3QA 3P4PB 2OEDA 4O1NA 2JF5A 4RMAA 3DOWA 4L23A 1VCBA 2KFJA 2MH7A 2VRRB 1K50A 1C4CA 1YQ3B 2XNAC 2ZZPB 3ONSA 3VUYA 2L0FA 5HI1A 3CSTA 2B3AA 1WXQA 2Z0DB 1SE3A 4MH8A 1N61A 2LXAA 2NMQA 4MT5A 2N4FA 3BYTB 4JLCA 3VTVA 3H8HA 4TKNA 1T5XD 1EF1A 2EKIA 1R7SA 1I7HA 2L7RA 2D3CA 5D3IB 5J17A 2DZIA 3BIID 1WMHA 3QJZA 4ICUA 5EDSA 4RF0A 1VR9A 4C56C 4BVUC 1KJTA 1QKZA 3ZJUA 2L0TA 2D3BA 4OZAA 1B9RA 3ZNGC 4YXDB 2Y5CA 4MGZE 4C7ZA 2KMMA 3QARA 4YTMB 1Q1OA 2WLBA 4B0EA 3FILB 4FA6A 3JSVB 1QOBA 4BKGA 1XXGA 1E9MA 2MBBB 1WMHB 3EA6A 1GAQB 2BPSA 5G2NA 1JALA 2N9EB 1J7BA 3JVZX 4KDLB 4LLGM 3L08A 1UNSA 1JWMD 1Q0WB 3ZNID 1GJZA 1F77A 5IP4D 4EOYA 3T3OA 2W3RA 1EU3A 1C1YB 3A9JA 3OAWA 3HVZA 4KZ0A 2BB6A 2ON8A 4TUUA 2YEPF 3P1MA 4DHJD 1FEHA 2MJ3A 4US9A 5KHOA 4FXCA 4S17A 2PE9A 1C76A 2D5GA 2DNFA 4AJYB 1BT0A 4E71A 2N1WA 1XLQA 2HJ1A 3P4SB 2AWTA 2GBNA 3V6CB 1HTOA 3L54A 4ZYSA 4K3BA 1YNTE 2GBMA 2N7DA 5EE1A 3NVWA 1SF0A 2BB5A 1YJIA 4ARIA 4LNNA 2INPE 3EFCA 1GG3A 3B1LX 1S3SG 4RGOS 1CJEA 2HTME 2QIEB 2KJRA 3PZ7A 4DXGA 4ZRPA 2R2QA 4I6NB 3VDZA 3GS2A 2IO0B 1KFYB 1F2RC 3O65B 3RYTA 2KACA 4MGIE 1XCTL 5D6JB 4AJWA 3Q8AA 3AE8B 1L7YA 4FJZA 1P1AA 4IWPA 2DAJA 1PGXA 1TKYA 4M00A 3KUCB 5D94A 2LZ6A 1WGYA 4XGAB 2O2VA 1V1OA 4TQ0A 4GXBA 3HUIA 2KANA 3ZQ4A 4X57B 1F1HA 1XO3A 5TSSA 4NQLB 2IJ0A 2WXMA 4ARCA 4MJSA 1WY8A 1E8YA 3DBRI 3PV1A 2NTTA 1P98A 4P16A 3TBLD 5EE3A 1JWAD 1YMHE 2V3NA 1HXYD 1YN5A 5IN7A 4XX5A 1UBIA 2AQ1B 2ZPNA 4WJQA 3A4SC 4YSZB 3P4QB 4D2KA 1I4PA 1C78A 3H7PA 2O2VB 3ZTCA 3ALBA 4JQWC 2ZVOA 2NVUI 3ZNZB 1XEEA 2MEKA 3UIOB 3QX1A 2LI5A 2FUHB 1VZ6A 1YN4A 3P2BA 3MJ5A 4HDOA 1ZDVA 1HEZE 4K1RB 4FULA 1TT5B 3AE9B 5HHDG 3EUB2 1OQYA 4KKJA 4H2AA 3H7PB 1Y56A 2QSDA 1DOXA 3W5UB 4ANXA 1ZE3D 4XDCA 1NYRA 2BKFA 3AH7A 3AV8A 2KDBA 4BOSC 2MQJA 5IKCM 3IAS1 2KC2A 4WIPA 1TKEA 1GPXA 3X0WA 2N9XA 2PEAA 3TL5A 2SEBD 3ZJVA 1KOTA 1KF6B 3IVFA 1IBXA 3MP9A 4OVZA 2JWZA 4JE3B 3ZRCA 4JX1C 1E7PB 2G4DB 3OWEB 3RNCC 2NPTA 3TUOA 2Y3AA 4A6QA 2PPHA 1VJKA 4EFOA 2UYZB 1WGKA 4B95A 3SEBA 4PS3A 4RCOA 3OJ4B 1V9JA 2Y5PA 1SBBB 1WR1A 2RR9A 1D5MC 2WS3B 2WWZA 2KDFB 4KV2A 4E3CA 1ZXHA 1IBXB 1EWYC 1XLPA 3WANA 3MC0B 4EZKA 2MX2A 4MM3A 4KX6B 1SJHD 2V3PA 1AWDA 4HRSA 4HWIB 3Q3NC 1D3ZA 4NAWA 2NPTB 1CMXB 3BINA 2NBUA 2MBEA 1UELA 5L95C 2M4NA 2C7HA 2L76A 1Z2MA 2WXGA 1GB1A 1TTNA 4N6EB 3V05A 2CS4A 2BYVE 3R66C 4LNOA 3RZWC 2KK8A 4MH0E 5TR5A 3DBSA 4A55A 1NDDA 2VH2A 2L05A 1K51A 1V5OA 2EMSA 4P6VF 2ZCBA 3AB5A 4F7ZA 5CTRC 1PGAA 2GBRA 1EU4A 3BVMA 1FNWA 5D2MB 2AQ3B 3MHSD 1V6EA 2FCNA 2QDFA 1XT9B 4OW0A 2I2YA 5BMGA 1T0SC 1F0ZA 1WGDA 4ZRKA 4BZAA 3A4RA 2HE7A 4G11A 2J0KA 1WYWB 2N7JA 1TS5A 3HM6X 2BS3B 2NBVB 1WXSA 1C4PA 3LJ3A 2KJ6A 4P1CC 3ZTDA 3VXWA 3B08A 1JQ4A 4BBNF 2WXQA 5C1ZA 1F2RI 1YQ4B 4CO7A 4GGQA 3A9KA 5J2RA 5C3JB 1V5TA 5AUKA 1E90A 3S2AA 1TJEA 4A8XC 2CR5A 2G4SA 4JIOU 2V9HA 3SU8X 4MSMB 3U2SC 3W1SA 4HLEA 2OJRA 5JHBA 4XWWA 2WXNA 2N7EA 3NS8A 2JZ3B 1FXIA 2JU6X 4ZHPA 5IA7A 3QQ8B 3ZGZA 2LVPA 2N1VA 4NAMA 1N5WA 4DXAB 4KIKB 2MBQA 4C80A 2JYTA 3KQ4A 1LFDA 1UWXA 2QJLA 2NBWB 2M19A 2LHEA 1I35A 2M8SA 4EZLA 1RM6C 2KFKB 2LMCA 2PKOA 3Q2AC 1GOZA 3L10B 1LGRA 2FCMA 2I38A 2DBYA 3VUWA 3RN9C 2M0AA 2XK5A 3DBLB 3DVGX 4IM2A 4HCPB 1EWCA 2DWQA 4I6PA 3Q8EA 3TSSA 1MFWA 3ZIMA 2BYFA 2X8XX 1I4RA 3BK1A 4IG7B 2D11A 1XF5L 3RD2A 1JRPA 1IGDA 3R7RA 2FE8A 3RT3B 4P1BC 3UINB 4ACFA 3SDLC 5G5GA 3MFGA 4ZRIA 4WJPA 4ASWC 4G0NB 4GIVA 3KLSX 3KH0A 1OTRB 2PE6B 3P63A 3M62B 2V4LA 5AUIA 1E6EB 4MDKE 3EGRA 2KWDA 5T8IA 1Q5WB 4N9F4 2K6DB 3UGBB 2R2OA 4ITKA 4W9IA 4PS7A 3I3TB 1WR6E 3BZDB 3WA0A 2BVCA 2WXOA 4CHKA 2L52A 2NCNA 4REZA 2DZJA 2JZZA 2GMIC 2LHDA 3B2GA 4GLSC 1C4AA 2BF8B 4RM9A 1EM7A 1FXTB 3U30A 1K53A 1XLNA 3Q8FA 3GE8C 2RPVA 1TKGA 3JW0X 2I1KA 2GBJA 2PVOD 4GB9A 4EUTA 5E6JA 3UIPB 4BBNC 2C60A 1D6EC 5AEKB 2D07B 2WXHA 2WDTB 1KTKA 3FILA 3RNAC 3PPAA 3JSVA 2PJHA 1JMLA 2J52A 5I4DA 1FPYA 3URYA 2WXIA 5FR3A 1E10A 1V1PB 1R4NI 2CKHB 4W9JA 1D5XC 2ZVNA 5LXIB 4C00A 4W9CA 2KHWB 2MBOA 4HKQA 2JVCA 2QEJC 4ANWA 2H89B 4EEWA 3WALA 1ZW7A 1TS4A 3HIZA 4HROA 1BMLC 2PMVA 1B1ZA 5MPOA 3BY4B 1GNUA 1J7CA 3O13A 1K8RB 5C2TB 3VR9B 1D5ZC 4UDUC 2KDIA 3APFA 4C7YA 4RF1A 4YT0B 1T0YA 2B76B 5KHQA 4BOZB 2KLGA 4E74A 4OZBA 4EE2A 3AEAB 2D3AA 3PVLA 3T9LA 3H6NA 2KVRA 3LYYA 3KUDB 3RZFA 4DDID 1WX9A 3ZDTA 5E6OA 2AQ2B 3ABVB 3BYYB 3LXFA 4HCNB 1ET6A 1L6UA 4GSWA 2CHWA 2YEPB 1ZKHA 4HPLB 4FHJA 5J18A 2REXA 3Q8CA 3WCQA 2LVQA 2KWCA 2AX5A 4P7IA 5JXVA 2JXXA 2L3ZA 4W9FA 3FKYA 4DK5A 4W9HA 2KD0A 1ET9A 2KDEB 3AI5A 4LK0M 4JL9A 3BVGA 1NVID 1UD7A 2X38A 2LXCA 5GXGB 4A20A 3ZYYX 2LGDA 1ZUD2 2IO2B 2DYBA 2EELA 1L2NA 2J53A 1P9DU 1WYGA 2J4XA 4FLHA 3TJPA 3PO0A 3ZJTA 4MELA 3Q14C 5AZFA 3RNGC 2JQRB 2N9KA 3VRAB 4NZLB 2D10A 4FJYA 1QQRA 3E56A 1YX6B 1E8WA 2HJ8A 1JW9D 3TEYA 5CX3A 1IUEA 1SXTA 1L6VA 1R4NB 1L4DB 2NR2A 2RD0A 4MGKE 4K3CA 2RGFA 1UUPA 1RLFA 1E0ZA 4M02A 1RFAA 3H7SA 1TY2A 2K3UA 1KLUD 3L17A 2ZNVC 4I6LB 3L4PA 3W5VB 3IAM1 3DBHI 4GDKB 3PREA 3L13A 2O6VD 2RDBC 3I57A 1KLGD 3NJTA 4US8A 1P7FA 1HTQA 1UGJA 4ANUA 4DWFA 4HJKA 3TEWA 2M56B 3I9V1 3I63C 3QAQA 2DYOA 2W82A 4PT5A 1FO4A 3QWZB 1WSPA 2WNMA 4PS8A 3KWVA 4CQNA 4FJVB 2K8HA 1P3QU 1ZP0B 2R61A 2RSUA 4NNJB 1ESFA 1YX5B 2L8JA 3NZ3A 3MC8A 1JROA 2MJDA 4B6WA 5L83A 5DPWA 1R4MI 4G3XB 4GOCA 5CHFA 1PUTA 1IGCA 4LJPB 1AYFA 2KQ4X 3ZLZA 4AOFA 2JYEA 2LFIA 5JH5C 1FRRA 2C7NB 3ZUNA 2SAKA 1WX7A 2KO3A 1FNUA 2ONQA 3PT2B 2KN5A 4A90A 3RFZB 2ZW0A 2KOXA 2K25A 1MHXA 1I4GA 3WIMA 3PZDA 2ZEQA 4GDLB 1NBFC 1NI2A 4NJCA 1CQVA 3KW5B 2CHXA 2J0MA 1TZOA 2WXKA 2BT6A 5FR6A 1G6JA 4HXDA 2MP2B 3KWLA 1PFDA 4IOIE 1ZPSA 3R7QA 5CHVC 2ACZB 2G45B 1E7VA 1RFKA 4J3OD 3M3JA 3ZDMC 3OLMD 3PZ8A 5AZGA 2OHFA 3B0AA 1EO6A 3GZNI 2OOBB 4IKGA 5C23A 3X23A 3FAHA 3CF6E 4LTUA 3DVGY 3PLVA 3DBRB 4WAAA 4W9LA 3NS1A 1P7EA 1TS2A 2D3GA 2FBWB 3PRZA 3NHEB 4WWMA 2MLBA 1FCCC 1SJED 5GMVA 3DWMA 2NTSA 1M94A 4RFBA 1JCKB 2LRUA 4YTPB 3T8MA 3AEDB 2A4ZA 1WXMA 3QHTA 3RNFC 1Y8RC 1DGJA 2WX1A 4LDTB 3IG3A 2LRWA 3ENEA 2GLSA 2IBIB 2H88B 2KWVB 4K7WA 4OVVA 2BGFA 2DHZA 1V86A 3DVNV 3ECIA 3HHMA 2A5UA 1R4MB 1WM2A 1WJUA 2L00B 1H8CA 1A5RA 4IDIA 2MSED 1N62A 1X1MA 1WJ6A 3MHZA 2KYWA 1L0XB 4GU2A 1J19A 3LDZE 4GMVA 2PTLA 4NJ7A 1ZDXA 2FIFA 3ML9A 3AECB 1FXAA 3BVZA 2KX0A 1NENB 4KGRA 1TZ1A 1FD6A 3E9SA 1NI3A 4DDGD 2KMAA 3V61A 5BMIA 2INDC 2G1EA 3AU4A 4FBJB 1ZXIA 2IGGA 4KIKA 3U7ZA 1WFYA 2JX5A 3QIJA 1SGHA 1UF0A 1WX8A 2G9HD 2BS4B 2UU7A 4HKZE 3UF8A 1WGHA 5DPSA 2BYTA 2PIAA 4PYZA 5DPTA 3TEXA 4MEMA 3Q6BA 3V60A 2KAJA 2KFKA 5G5HA 1C9FA 1PGBA 4L1BA 2I1JA 4TSSA 2HTHA 3VH3B 5HG2A 2VH1A 4AS1A 2E6XA 4WQOB 4DBGA 2RDGA 2HD5B 4KVGB 3A1QB 3GE3C 2LWPA 3NVZA 2FAZA 1KH0A 3AE7B 2WP9B 5D7GA 3KUZA 1L4ZB 4L2YA 1LM8B 4LCDE 1MHHE 1V2YA 1V97A 4BKSD 4NY0A 1RAXA 4YSXB 1Q10A 4DHZE 1TIFA 1OGWA 1CZPA 2LD9A 4M0WB 3APCA 4WURA 2QILA 1XD3B 2C7MB 1OEYJ 2IO3B 1WM3A 3KVFB 4W9DA 2KX3A 2L83A 3VRBB 1WXVA 4F1SA 1EF5A 3V6EB 2W9NA 2LVOA 1ISNA 2QHOA 3AXCA 1JWSD 4IWQA 3Q3FA 1FM0D 2ASQA 3KYDD 1F52A 2RMMA 4MACA 1ENFA 2CJOA 2IDYA 1J7AA 1OEYA 4NQKE 2JRIB 3Q3JA 4KGSA 4PYUA 4HPMB 2KNBA 1XLOA 1WWTA 1WXAA 2BS2B 2IZVB 3PSEB 2INCC 1MG8A 1SEBD 3A33B 4LDTD 2BWFA 3DVNU 1N60A 4Q2JA 2MWSB 3VQIA 3HVDA 2EMTA 4C4VB 5BYQA 2D2QA 4ZRJA 3T3NA 2GRIA 3AE3B 4XZ4A 5LXHA 1V1PA 3TEZA 2NS5A 3GP7A 4AP4C 2O6VA 2W3SA 3AE5B 1XQQA 1OFFA 1UZXB 1N6ZA 3IBEA 4YTNB 1SB3C 2BBCA 3N1ZC 4HDQA 1SIJA 2KC1A 2WU2B 1RRBA 3TCAA 3AU5A 1F9JA 4EKUA 4M01A 1NEKB 2K8BA 4FADA 4KSKC 4RGTA 3R3MA 3QK0A 4ZOHC 1FRDA 3IT6B 3IHPC 2DENB 2XEWA 2ZNVB 2O6VB 1DOYA 3C8YA 1VDVA 2N9LA 3SFEB 4WWOA 2EKEC 3C19A 3CWIA 4MSQB 2KTFA 4BFRA 3B2FA 1GC6A 3CSFA 3RPFC 3EC8A 4BKTA 1L5PA 3H9DA 4XYCA 2JSVX 4WWNA 4LJOB 1LQBA 3AMZA 3VFKA 2DZKA 4A3PA 4M8MA 4AQ7A 1KM7A 3DHHC 5LLIA 2CU3A 1WE7A 3W1SC 1E7UA 2XN9C 4RGMA 1IPGA 4KZCA 3AULA 5IOIA 3HK0A 4IW0A 2LJ5A 4HEA1 2FNJB 2ZCCA 2W55A 4FN2A 1HQRD 3VHTC 3OJ3A 1SE4A 3N20C 4LNKA 1MVKA 3VAWA 1HZ5A 5DPRA 3DHGC 3HRDD 2QMTA 4IUMB 1BXTA 4DQOC 5EE0A 2K39A 3H1UA 1I4XA 2WDRB 3AEEB 1ZOYB 2KMCA 3N3KB 1WRIA 1YD8U 2MJEA 3WAMA 1TS3A 1EUVB 2L32A 5D3DA 1AN8A 2C5LC 2JUOA 4II3B 1WJNA 5IO9A 2MHJA 1WZ0A 4W9KA 1I42A 1T6BX 1CK1A 3P4RB 2M0XA 3DDCB 3RNEC 1OQRA 4ZDVA 3EECA 3WAOA 4OHJA 2RDHA 3K9PB 1P0RA 4ZHOA 1M4VA 3ZKJC 4JWSC 2BQQA 2MW5A 2Q5WD 1K52A 3W9CB 4YL8A 1FFVA 2K22A 2JY6A 2WXPA 2HDEA 3A9JB 4KKIA 1J8CA 3SFDB 1QLBB 2UWQA 1MPEA 2FCSA 2N0SB 4NPNA 4RGNA 4TQ1A 1YJ1A 4K7SA 1PQSA 1T0RC 5G55A 2YVCA 3PGEA 3KYCD 4GDKA 2LGXA 4WWPA 3NY5A 2JZPA 1SE2A 3ZW3A 2CU1A 3RULA 2DX5B 3N32A 5JHAA 3CIRB 1C77A 1FIQA 1QF6A 1DOIA 1WJ4A 4F8CB 3J9CA 4IC7B 2KLCA 3CMMB 2QCZA 2K1FA 3VTWA 2KWUB 2WGSA 2GI9A 4IWOA 3UI3A 3U8ZA 3R2IA 3VVWB 2LGSA 2DZMA 3WAPA 2RPQA 1VLBA 3K9OB 5BMHA 1JWBD 1VD2A 3ZRFA 3PHWB 3JYUA 2KDMA 3RCZA 2ZPYA 4HVBA 1I4QA 2KN4A 4AWJA 3DWGC 3NRZA 4WQMA 1V8CA 2IO1B 3OG5A 2PVGC 3PS6A 3RMKC 2MRPA 2IGHA 3N9YC 2JT4B 4GDLA 2VZKB 3SHQA 1WZ3A 1T0QC 4AUQC 2YLMA 3MJWA 1KLVA 2WXJA 1IYFA 3IFWB 3BK2A 3PLUA 2BTEA 1UGMA 4W9EA 5FK9C 3Q3MC 4MJSB 2K5PA 1QILA 2MP2A 1SE9A 1HZ6A 2LGIA 4RM8A 1WGGA 3AEBB 2J0JA 1TYGB 3FC4A 2K8CA 3EHVA 3DCGA 5H8YE 1WI0A 1UH6A 4BKSA 2Z0EB 4KDIC 5IAAC 2V3SA 3QCAA 3VR8B 3I5JC 1U4AA 3NOBA 2IPKD 4CYEA 4OVUA 3N1YC 2ICIA 5FKAC 4YWGG 2KT7A 2WXRA 1LO5D 5BYSA 4XWTA 1FCLA 2TSSA 4R3DA 1YIWA 1GUAB 2WXFA 3W2DA 1SSNA 1YN3A 2LASA 2BYEA 3DPDA 3LB8C 2LUMA 4LNIA 1V49A 3NVVA 4JGHB 3GB1A 1ROEA 4TMAB 2WHIA 1UBQA 3RNBC 3NVYA 3M95A 1V81A 3DHIC 1QT9A 2WU5B 3AN1A 4WAFA 4OZCA 3V62A 3VUXA 4QAYA 1HA5A 2M17A 3ZXVA 3ZXRA 4IM0A 3U7DA 1VZ8A 4JWUC 3ZO5B 3PRMB 2JWUA 1JRUA 1PYWD 3L16A 1TBEA 3IXSA 1N63A 2G3QB 4II2B 2GOWA 1MJDA 1AARA 5AZHA 1WH3A 2ZW1A 1QOFA 2BW2A 3TMPB 3TIXA 3Q3OC 5DCNA 4WH4A 1JWUD 2BKRB 2FIDA 3W1YA 3NZUA 3D32A 5BO4B 1WE6A 4K81A 2JRHA 2J42A 2IYDB 2PLPA 3DBHB 3APDA 4URKA 4EZJA 2AL3A 4N58A 3MTNB 2OJWA 2KXJA 3VH4B 3SD5A 4MGYE 1YJJA 5LNK1 1DYQA 3DBLI 4W9GA 2WQYB 4B9KA 4PK1A 4ZYNA 2JPHA 3ZVVA 1KRHA 2W54A 2INNE 2Z8LA 5CHWA 2K9XA 4A9AA 1MI0A 5HKHA 1FNVA 2V1YA 1WRDB 4MM3B 3SR6A 3NUHB 2L1AA 2JXTA 2WXLA 4NAWB 2MA9B 4ZRQA 2KJHB 1HE8A 1PDXA 3EFUA 1UWMA 1L0VB 3V3XA 2DLBA 1FMAD 2LUEA 3GOEA 3N1XC 4XE0A 2AYOB 1QOAA 1WF9A 1QZEA 1YQBA 3NZSA 4ANVA 2KZRA 1LXDA 1ZGUB 1RYJA 2CHZA 1H4RA 1QOGA 2VZKD 3VTUA 2QC8A 3QA8A 3ETRA 2GB1A 3A1QA 2DYMA 2WX0A 2LGYA 5E6NA 2ZJDA 2DAFA 1VRAB 4WJNA 1E8ZA 1STEA 1WGRA 3AE1B 3PTFC 3MC9A 1RWSA 4TV3A 3R8BA 3ZNHB 1S1QB 1V80A 4XDDA 4N59A 3IT4B 3Q69A 1VZ7A 5E6PA 4HJGE 2IY1B 3RI7C 1L0YB 2KQ7A 1GB4A 4M0WA
chains in the Genus database with same CATH topology
2WU2B 1E7PB 1I4HA 3OWEB 4JPSA 1D4BA 1QQRA 3AE4B 3E56A 3TUOA 1NEKB 2Y3AA 4A6QA 1VJKA 1WGKA 3Q8BA 4RGTA 3SEBA 1JW9D 3TEYA 1XCQL 4ZOHC 4RCOA 1FRDA 3IT6B 2Y5PA 1IUEA 1SXTA 1L6VA 1SBBB 2WDVB 1L4DB 1DOYA 3C8YA 1VDVA 1D5MC 2N9LA 2WS3B 3B9JA 3SFEB 5EE9A 2CJNA 3CWIA 1UUPA 3B2FA 1E0ZA 1ZXHA 1IBXB 1TY2A 2PW9A 1EWYC 1XLPA 2K3UA 1KLUD 3RPFC 3MC0B 3P42A 4KX6B 1SJHD 2V3PA 1AWDA 4HRSA 1L5PA 2JSVX 3AE2B 3AEFB 3U4EG 3AMZA 1FFUA 3L4PA 3W5VB 3IAM1 4AQ7A 2WDQB 2WXGA 1N5XA 1GB1A 4GDKB 2CU3A 2K0PA 4RH6A 2V0GA 4N6EB 1OQQA 3V05A 2XN9C 4RGMA 2LJIA 1C79A 1TY0A 2FUG1 3I57A 1BUIC 1KLGD 4RNAA 4US8A 1P7FA 4HEA1 3BWUD 1UGJA 2W55A 4A55A 1HQRD 3TEWA 1A70A 1K51A 2M56B 3I9V1 1SE4A 4KGTA 3U52E 5BYRA 2DYOA 1MVKA 2W82A 4PT5A 1FO4A 1WSPA 2WNMA 3KWVA 3R2TA 4P6VF 1HZ5A 3AB5A 2E3TA 3HRDD 2LEKA 5HFYA 1AW7A 2QMTA 4CQNA 4DQOC 1BXTA 5EE0A 2V4IB 1I4XA 2WDRB 3AEEB 1ZP0B 1ZOYB 1PGAA 2R61A 1ESFA 1EU4A 1WRIA 2MJEA 3BVMA 1FNWA 1JROA 1TS3A 2AQ3B 1NYQA 2MJDA 3NZ3A 2L32A 5D3DA 1AN8A 1PUTA 4OW0A 4YSYB 1IGCA 4DXFA 5BMGA 2I2YA 1AYFA 2KQ4X 2JYEA 2LFIA 1F0ZA 1FRRA 4B0MA 1T6BX 1CK1A 2SAKA 3P4RB 5H92C 1FNUA 1OQRA 2ONQA 1ACCA 4A90A 2N7JA 3RFZB 2ZW0A 1TS5A 4OHJA 2RDHA 3AEGB 1MHXA 2BS3B 1I4GA 4USAA 2IGDA 1C4PA 4GDLB 4ZHOA 1M4VA 3AE6B 4JWSC 4NJCA 2Q5WD 1K52A 3W9CB 1CQVA 1FFVA 2K22A 3AM9A 1T3QA 1JQ4A 2WXQA 2HDEA 1F2RI 2WXPA 4KKIA 1YQ4B 1TZOA 3P4PB 2WXKA 5C3JB 2BT6A 5AUKA 1TJEA 4A8XC 2OEDA 4O1NA 3SFDB 3KWLA 1PFDA 1QLBB 4IOIE 1MPEA 1ZPSA 3U2SC 3W1SA 2N0SB 4RGNA 4L23A 4TQ1A 2MH7A 1K50A 1C4CA 1YQ3B 2XNAC 4XWWA 2ACZB 2WXNA 5HI1A 1WXQA 1RFKA 4J3OD 1SE3A 4MH8A 1N61A 1FXIA 2JU6X 4ZHPA 2NMQA 4MT5A 3ZGZA 4NAMA 3BYTB 1N5WA 2JZPA 1SE2A 3H8HA 1T5XD 2EKIA 1R7SA 3PZ8A 4C80A 2JYTA 1I7HA 2OHFA 3KQ4A 3CIRB 5D3IB 1C77A 1FIQA 1QF6A 3BIID 1UWXA 1DOIA 2QJLA 2M19A 2LHEA 3J9CA 1VR9A 4IKGA 4RF0A 1RM6C 3FAHA 4C56C 2LMCA 4LTUA 1QKZA 2PKOA 3ZJUA 2GI9A 1GOZA 3UI3A 3NS1A 1P7EA 4OZAA 1B9RA 3R2IA 1TS2A 2I38A 2FBWB 4YXDB 2DBYA 2Y5CA 2M0AA 4WWMA 4C7ZA 2KMMA 1VLBA 1FCCC 2WLBA 4YTMB 1SJED 4B0EA 3FILB 1JWBD 1EWCA 3DWMA 5BMHA 2NTSA 2DWQA 1QOBA 4RFBA 1JCKB 3Q8EA 1XXGA 3TSSA 1E9MA 4YTPB 2KDMA 3EA6A 3AEDB 1GAQB 1I4QA 2KN4A 1I4RA 3DWGC 3NRZA 4WQMA 1V8CA 1JALA 1J7BA 1DGJA 3BK1A 1XF5L 1JRPA 1IGDA 2PVGC 4LLGM 1UNSA 1JWMD 2IGHA 2FE8A 3N9YC 2VZKB 2H88B 1F77A 5G5GA 3T3OA 2W3RA 1EU3A 3MFGA 2WXJA 3HVZA 2BB6A 3BK2A 2BTEA 2ON8A 5FK9C 2K5PA 1QILA 4IDIA 2YEPF 3KLSX 3P1MA 1N62A 1FEHA 2MJ3A 4US9A 1HZ6A 3MHZA 1L0XB 2LGIA 3P63A 4FXCA 2PTLA 5AUIA 1ZDXA 3AEBB 1E6EB 1TYGB 3FC4A 3EGRA 2KWDA 3AECB 1FXAA 5H8YE 3BVZA 5T8IA 1C76A 2D5GA 1NENB 4KGRA 4ITKA 1FD6A 3E9SA 1XLQA 1NI3A 3P4SB 3VR8B 5BMIA 2G1EA 4ZYSA 3BZDB 2IPKD 1YNTE 1ZXIA 5FKAC 2ICIA 2IGGA 2WXOA 5EE1A 3NVWA 4YWGG 1SF0A 2WXRA 3U7ZA 2BB5A 2JX5A 1LO5D 2L52A 1YJIA 4ARIA 4REZA 5BYSA 2G9HD 2INPE 4XWTA 1FCLA 2BS4B 2TSSA 4R3DA 3W2DA 2WXFA 4HKZE 1SSNA 1YN3A 4RGOS 1CJEA 2LHDA 2BYTA 3LB8C 2LUMA 2HTME 2PIAA 3B2GA 2QIEB 4GLSC 3TEXA 3NVVA 2KAJA 3GB1A 3PZ7A 1C4AA 5G5HA 4DXGA 1ROEA 4TMAB 1EM7A 1PGBA 4ZRPA 1C9FA 1K53A 1XLNA 3NVYA 3GS2A 3Q8FA 4L1BA 4TSSA 1KFYB 1F2RC 2RPVA 1TKGA 2KACA 1QT9A 2WU5B 2PVOD 3AN1A 4WAFA 1XCTL 5HG2A 5E6JA 4OZCA 4AS1A 1D6EC 3Q8AA 2E6XA 1HA5A 2RDGA 3AE8B 2WXHA 1KTKA 1VZ8A 3FILA 4JWUC 2JWUA 1PYWD 1JMLA 3NVZA 2J52A 3IXSA 5I4DA 1N63A 3URYA 2WXIA 5FR3A 1KH0A 1PGXA 1E10A 1V1PB 3AE7B 2WP9B 1TKYA 5D7GA 2ZW1A 1QOFA 1D5XC 2BW2A 1L4ZB 4L2YA 4WH4A 1JWUD 1MHHE 1V97A 4HKQA 1V1OA 4TQ0A 4YSXB 2QEJC 3HUIA 2H89B 2J42A 1Q10A 2PLPA 3ZQ4A 1TS4A 4HROA 1BMLC 2PMVA 1XO3A 4WURA 1CZPA 1B1ZA 5TSSA 2IJ0A 2WXMA 5MPOA 4ARCA 2QILA 1J7CA 4N58A 3O13A 2L83A 2NTTA 5C2TB 3VR9B 1YJJA 1D5ZC 5LNK1 1DYQA 4UDUC 3VRBB 4P16A 5EE3A 4C7YA 4RF1A 1JWAD 1YMHE 2V3NA 4YT0B 1HXYD 1YN5A 2WQYB 2AQ1B 2B76B 1KRHA 2W54A 2INNE 4YSZB 2Z8LA 3P4QB 4D2KA 1I4PA 1C78A 2K9XA 4OZBA 4EE2A 1JWSD 4A9AA 3AEAB 1MI0A 1FM0D 2RMMA 1FNVA 4MACA 4MM3B 3SR6A 1XEEA 1ENFA 2MEKA 3LYYA 3NUHB 2L1AA 2CJOA 2JXTA 2WXLA 2IDYA 1J7AA 2AQ2B 4NAWB 3ABVB 3BYYB 3LXFA 4ZRQA 4KGSA 1PDXA 1UWMA 1ET6A 1L0VB 3V3XA 1VZ6A 2DLBA 1FMAD 1YN4A 1XLOA 1L6UA 1WWTA 2YEPB 3MJ5A 2BS2B 4XE0A 1ZDVA 1QOAA 1HEZE 3Q8CA 3WCQA 3AE9B 5HHDG 2AX5A 3EUB2 1SEBD 4KKJA 5JXVA 1RYJA 4H2AA 1QOGA 1Y56A 2QSDA 2VZKD 1DOXA 1N60A 3W5UB 3ETRA 1ZE3D 4Q2JA 4XDCA 1NYRA 3VQIA 3HVDA 2GB1A 2DYMA 5BYQA 3AH7A 1ET9A 3AV8A 3T3NA 2GRIA 3AE3B 4LK0M 3IAS1 4WIPA 1VRAB 1TKEA 1V1PA 1GPXA 3BVGA 1NVID 3TEZA 2X38A 5GXGB 3ZYYX 3GP7A 2W3SA 3AE5B 1OFFA 1STEA 1ZUD2 3AE1B 2EELA 2SEBD 3ZJVA 2J53A 1WYGA 1KF6B 2J4XA 4YTNB 1RWSA 1SB3C 3R8BA 3PO0A 3ZJTA 1IBXA 2BBCA 4N59A 4XDDA 3IT4B 3Q69A 1VZ7A 3MP9A 4HJGE 4OVZA 2JQRB 2N9KA 3VRAB 1L0YB 4JE3B 1SIJA 1GB4A 4M0WA 4JX1C 4NZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7J A;  2ZW0 A;  1Q10 A;  2PLP A;  1MHX A;  1D4B A;  2IGD A;  1XCQ L;  1K52 A;  2ON8 A;  1F2R I;  2N9L A;  1HZ6 A;  2LGI A;  1YMH E;  2PTL A;  2OED A;  4IOI E;  2KWD A;  1MPE A;  1ZXH A;  1IBX B;  2PW9 A;  4KGR A;  4D2K A;  1FD6 A;  1K50 A;  4OZB A;  1MI0 A;  5HI1 A;  2RMM A;  5BMI A;  2JSV X;  4MAC A;  2JU6 X;  1YNT E;  2IGG A;  2JXT A;  2NMQ A;  2JZP A;  4KGS A;  1GB1 A;  1FCL A;  2K0P A;  3V3X A;  4HKZ E;  2LHD A;  2LUM A;  1HEZ E;  1P7F A;  4GLS C;  1UWX A;  3GB1 A;  1EM7 A;  1PGB A;  2LHE A;  1C9F A;  1K53 A;  4IKG A;  5HHD G;  1K51 A;  5JXV A;  4KGT A;  1F2R C;  2RPV A;  2QSD A;  1MVK A;  2KAC A;  1HZ5 A;  1QKZ A;  1XCT L;  5HG2 A;  2GB1 A;  4OZC A;  2GI9 A;  2QMT A;  3UI3 A;  5HFY A;  1P7E A;  4OZA A;  2I38 A;  1PGA A;  3FIL A;  2JWU A;  1JML A;  2J52 A;  1FCC C;  1KH0 A;  3FIL B;  5BMH A;  1PGX A;  1IGC A;  2I2Y A;  5BMG A;  2EEL A;  2KQ4 X;  2J53 A;  2ZW1 A;  2KDM A;  2KN4 A;  1IBX A;  4WH4 A;  3MP9 A;  4HJG E;  1XF5 L;  1MHH E;  1IGD A;  2N9K A;  1GB4 A;  2ONQ A;  2IGH A; 
#chains in the Genus database with same CATH topology
 3C0R B;  4S0R A;  1I4H A;  4JPS A;  1D4B A;  3AE4 B;  3Q8B A;  2BWE S;  1XCQ L;  4IM3 A;  4NJ6 A;  3GZN B;  2AL6 A;  3DQV A;  2WDV B;  1C3T A;  3B9J A;  3ML8 A;  5EE9 A;  2CJN A;  4BAX A;  3A9K B;  2PW9 A;  2KQS A;  2XBB C;  3P42 A;  4DHZ B;  2J7Q B;  2C9W B;  3AE2 B;  3AEF B;  4A3O A;  3U4E G;  1FFU A;  2GBK A;  2KTR A;  1WIA A;  2WDQ B;  4KSL C;  2AEH A;  1N5X A;  1GC7 A;  2K0P A;  4RH6 A;  2V0G A;  3RUI B;  1OQQ A;  2MCN B;  4WJO A;  4DHJ B;  1TGZ B;  2LJI A;  1IP9 A;  1C79 A;  1TY0 A;  2FUG 1;  4RNA A;  1BUI C;  1J0G A;  4M8N A;  4LNF A;  1MG4 A;  1E5W A;  1E8X A;  3BWU D;  2K6Q A;  1A70 A;  3HM3 A;  4KGT A;  3U52 E;  2Z59 B;  4G50 A;  5BYR A;  4C4V A;  1YOV B;  4K7U A;  3R2T A;  4GN1 A;  2E3T A;  2LEK A;  5HFY A;  1AW7 A;  2N9P C;  4XC2 A;  2V4I B;  3PRP B;  4FHK A;  5JZE B;  2KTR B;  3L0W B;  3N30 A;  4ICV A;  2M1M A;  1Z5S B;  2KKC A;  2MBH A;  1NYQ A;  2IY0 B;  3M63 B;  4HPP A;  3PHX B;  2FCQ A;  4YSY B;  2XK5 B;  4DXF A;  4J6I A;  2Y5B B;  3UQA A;  2WYQ A;  4B0M A;  5H92 C;  3QC8 B;  1ACC A;  3NG0 A;  3AEG B;  4USA A;  3UQB A;  4HK2 A;  2IGD A;  1SIF A;  3AE6 B;  2KVZ A;  3AM9 A;  1T3Q A;  3P4P B;  2OED A;  4O1N A;  2JF5 A;  4RMA A;  3DOW A;  4L23 A;  1VCB A;  2KFJ A;  2MH7 A;  2VRR B;  1K50 A;  1C4C A;  1YQ3 B;  2XNA C;  2ZZP B;  3ONS A;  3VUY A;  2L0F A;  5HI1 A;  3CST A;  2B3A A;  1WXQ A;  2Z0D B;  1SE3 A;  4MH8 A;  1N61 A;  2LXA A;  2NMQ A;  4MT5 A;  2N4F A;  3BYT B;  4JLC A;  3VTV A;  3H8H A;  4TKN A;  1T5X D;  1EF1 A;  2EKI A;  1R7S A;  1I7H A;  2L7R A;  2D3C A;  5D3I B;  5J17 A;  2DZI A;  3BII D;  1WMH A;  3QJZ A;  4ICU A;  5EDS A;  4RF0 A;  1VR9 A;  4C56 C;  4BVU C;  1KJT A;  1QKZ A;  3ZJU A;  2L0T A;  2D3B A;  4OZA A;  1B9R A;  3ZNG C;  4YXD B;  2Y5C A;  4MGZ E;  4C7Z A;  2KMM A;  3QAR A;  4YTM B;  1Q1O A;  2WLB A;  4B0E A;  3FIL B;  4FA6 A;  3JSV B;  1QOB A;  4BKG A;  1XXG A;  1E9M A;  2MBB B;  1WMH B;  3EA6 A;  1GAQ B;  2BPS A;  5G2N A;  1JAL A;  2N9E B;  1J7B A;  3JVZ X;  4KDL B;  4LLG M;  3L08 A;  1UNS A;  1JWM D;  1Q0W B;  3ZNI D;  1GJZ A;  1F77 A;  5IP4 D;  4EOY A;  3T3O A;  2W3R A;  1EU3 A;  1C1Y B;  3A9J A;  3OAW A;  3HVZ A;  4KZ0 A;  2BB6 A;  2ON8 A;  4TUU A;  2YEP F;  3P1M A;  4DHJ D;  1FEH A;  2MJ3 A;  4US9 A;  5KHO A;  4FXC A;  4S17 A;  2PE9 A;  1C76 A;  2D5G A;  2DNF A;  4AJY B;  1BT0 A;  4E71 A;  2N1W A;  1XLQ A;  2HJ1 A;  3P4S B;  2AWT A;  2GBN A;  3V6C B;  1HTO A;  3L54 A;  4ZYS A;  4K3B A;  1YNT E;  2GBM A;  2N7D A;  5EE1 A;  3NVW A;  1SF0 A;  2BB5 A;  1YJI A;  4ARI A;  4LNN A;  2INP E;  3EFC A;  1GG3 A;  3B1L X;  1S3S G;  4RGO S;  1CJE A;  2HTM E;  2QIE B;  2KJR A;  3PZ7 A;  4DXG A;  4ZRP A;  2R2Q A;  4I6N B;  3VDZ A;  3GS2 A;  2IO0 B;  1KFY B;  1F2R C;  3O65 B;  3RYT A;  2KAC A;  4MGI E;  1XCT L;  5D6J B;  4AJW A;  3Q8A A;  3AE8 B;  1L7Y A;  4FJZ A;  1P1A A;  4IWP A;  2DAJ A;  1PGX A;  1TKY A;  4M00 A;  3KUC B;  5D94 A;  2LZ6 A;  1WGY A;  4XGA B;  2O2V A;  1V1O A;  4TQ0 A;  4GXB A;  3HUI A;  2KAN A;  3ZQ4 A;  4X57 B;  1F1H A;  1XO3 A;  5TSS A;  4NQL B;  2IJ0 A;  2WXM A;  4ARC A;  4MJS A;  1WY8 A;  1E8Y A;  3DBR I;  3PV1 A;  2NTT A;  1P98 A;  4P16 A;  3TBL D;  5EE3 A;  1JWA D;  1YMH E;  2V3N A;  1HXY D;  1YN5 A;  5IN7 A;  4XX5 A;  1UBI A;  2AQ1 B;  2ZPN A;  4WJQ A;  3A4S C;  4YSZ B;  3P4Q B;  4D2K A;  1I4P A;  1C78 A;  3H7P A;  2O2V B;  3ZTC A;  3ALB A;  4JQW C;  2ZVO A;  2NVU I;  3ZNZ B;  1XEE A;  2MEK A;  3UIO B;  3QX1 A;  2LI5 A;  2FUH B;  1VZ6 A;  1YN4 A;  3P2B A;  3MJ5 A;  4HDO A;  1ZDV A;  1HEZ E;  4K1R B;  4FUL A;  1TT5 B;  3AE9 B;  5HHD G;  3EUB 2;  1OQY A;  4KKJ A;  4H2A A;  3H7P B;  1Y56 A;  2QSD A;  1DOX A;  3W5U B;  4ANX A;  1ZE3 D;  4XDC A;  1NYR A;  2BKF A;  3AH7 A;  3AV8 A;  2KDB A;  4BOS C;  2MQJ A;  5IKC M;  3IAS 1;  2KC2 A;  4WIP A;  1TKE A;  1GPX A;  3X0W A;  2N9X A;  2PEA A;  3TL5 A;  2SEB D;  3ZJV A;  1KOT A;  1KF6 B;  3IVF A;  1IBX A;  3MP9 A;  4OVZ A;  2JWZ A;  4JE3 B;  3ZRC A;  4JX1 C;  1E7P B;  2G4D B;  3OWE B;  3RNC C;  2NPT A;  3TUO A;  2Y3A A;  4A6Q A;  2PPH A;  1VJK A;  4EFO A;  2UYZ B;  1WGK A;  4B95 A;  3SEB A;  4PS3 A;  4RCO A;  3OJ4 B;  1V9J A;  2Y5P A;  1SBB B;  1WR1 A;  2RR9 A;  1D5M C;  2WS3 B;  2WWZ A;  2KDF B;  4KV2 A;  4E3C A;  1ZXH A;  1IBX B;  1EWY C;  1XLP A;  3WAN A;  3MC0 B;  4EZK A;  2MX2 A;  4MM3 A;  4KX6 B;  1SJH D;  2V3P A;  1AWD A;  4HRS A;  4HWI B;  3Q3N C;  1D3Z A;  4NAW A;  2NPT B;  1CMX B;  3BIN A;  2NBU A;  2MBE A;  1UEL A;  5L95 C;  2M4N A;  2C7H A;  2L76 A;  1Z2M A;  2WXG A;  1GB1 A;  1TTN A;  4N6E B;  3V05 A;  2CS4 A;  2BYV E;  3R66 C;  4LNO A;  3RZW C;  2KK8 A;  4MH0 E;  5TR5 A;  3DBS A;  4A55 A;  1NDD A;  2VH2 A;  2L05 A;  1K51 A;  1V5O A;  2EMS A;  4P6V F;  2ZCB A;  3AB5 A;  4F7Z A;  5CTR C;  1PGA A;  2GBR A;  1EU4 A;  3BVM A;  1FNW A;  5D2M B;  2AQ3 B;  3MHS D;  1V6E A;  2FCN A;  2QDF A;  1XT9 B;  4OW0 A;  2I2Y A;  5BMG A;  1T0S C;  1F0Z A;  1WGD A;  4ZRK A;  4BZA A;  3A4R A;  2HE7 A;  4G11 A;  2J0K A;  1WYW B;  2N7J A;  1TS5 A;  3HM6 X;  2BS3 B;  2NBV B;  1WXS A;  1C4P A;  3LJ3 A;  2KJ6 A;  4P1C C;  3ZTD A;  3VXW A;  3B08 A;  1JQ4 A;  4BBN F;  2WXQ A;  5C1Z A;  1F2R I;  1YQ4 B;  4CO7 A;  4GGQ A;  3A9K A;  5J2R A;  5C3J B;  1V5T A;  5AUK A;  1E90 A;  3S2A A;  1TJE A;  4A8X C;  2CR5 A;  2G4S A;  4JIO U;  2V9H A;  3SU8 X;  4MSM B;  3U2S C;  3W1S A;  4HLE A;  2OJR A;  5JHB A;  4XWW A;  2WXN A;  2N7E A;  3NS8 A;  2JZ3 B;  1FXI A;  2JU6 X;  4ZHP A;  5IA7 A;  3QQ8 B;  3ZGZ A;  2LVP A;  2N1V A;  4NAM A;  1N5W A;  4DXA B;  4KIK B;  2MBQ A;  4C80 A;  2JYT A;  3KQ4 A;  1LFD A;  1UWX A;  2QJL A;  2NBW B;  2M19 A;  2LHE A;  1I35 A;  2M8S A;  4EZL A;  1RM6 C;  2KFK B;  2LMC A;  2PKO A;  3Q2A C;  1GOZ A;  3L10 B;  1LGR A;  2FCM A;  2I38 A;  2DBY A;  3VUW A;  3RN9 C;  2M0A A;  2XK5 A;  3DBL B;  3DVG X;  4IM2 A;  4HCP B;  1EWC A;  2DWQ A;  4I6P A;  3Q8E A;  3TSS A;  1MFW A;  3ZIM A;  2BYF A;  2X8X X;  1I4R A;  3BK1 A;  4IG7 B;  2D11 A;  1XF5 L;  3RD2 A;  1JRP A;  1IGD A;  3R7R A;  2FE8 A;  3RT3 B;  4P1B C;  3UIN B;  4ACF A;  3SDL C;  5G5G A;  3MFG A;  4ZRI A;  4WJP A;  4ASW C;  4G0N B;  4GIV A;  3KLS X;  3KH0 A;  1OTR B;  2PE6 B;  3P63 A;  3M62 B;  2V4L A;  5AUI A;  1E6E B;  4MDK E;  3EGR A;  2KWD A;  5T8I A;  1Q5W B;  4N9F 4;  2K6D B;  3UGB B;  2R2O A;  4ITK A;  4W9I A;  4PS7 A;  3I3T B;  1WR6 E;  3BZD B;  3WA0 A;  2BVC A;  2WXO A;  4CHK A;  2L52 A;  2NCN A;  4REZ A;  2DZJ A;  2JZZ A;  2GMI C;  2LHD A;  3B2G A;  4GLS C;  1C4A A;  2BF8 B;  4RM9 A;  1EM7 A;  1FXT B;  3U30 A;  1K53 A;  1XLN A;  3Q8F A;  3GE8 C;  2RPV A;  1TKG A;  3JW0 X;  2I1K A;  2GBJ A;  2PVO D;  4GB9 A;  4EUT A;  5E6J A;  3UIP B;  4BBN C;  2C60 A;  1D6E C;  5AEK B;  2D07 B;  2WXH A;  2WDT B;  1KTK A;  3FIL A;  3RNA C;  3PPA A;  3JSV A;  2PJH A;  1JML A;  2J52 A;  5I4D A;  1FPY A;  3URY A;  2WXI A;  5FR3 A;  1E10 A;  1V1P B;  1R4N I;  2CKH B;  4W9J A;  1D5X C;  2ZVN A;  5LXI B;  4C00 A;  4W9C A;  2KHW B;  2MBO A;  4HKQ A;  2JVC A;  2QEJ C;  4ANW A;  2H89 B;  4EEW A;  3WAL A;  1ZW7 A;  1TS4 A;  3HIZ A;  4HRO A;  1BML C;  2PMV A;  1B1Z A;  5MPO A;  3BY4 B;  1GNU A;  1J7C A;  3O13 A;  1K8R B;  5C2T B;  3VR9 B;  1D5Z C;  4UDU C;  2KDI A;  3APF A;  4C7Y A;  4RF1 A;  4YT0 B;  1T0Y A;  2B76 B;  5KHQ A;  4BOZ B;  2KLG A;  4E74 A;  4OZB A;  4EE2 A;  3AEA B;  2D3A A;  3PVL A;  3T9L A;  3H6N A;  2KVR A;  3LYY A;  3KUD B;  3RZF A;  4DDI D;  1WX9 A;  3ZDT A;  5E6O A;  2AQ2 B;  3ABV B;  3BYY B;  3LXF A;  4HCN B;  1ET6 A;  1L6U A;  4GSW A;  2CHW A;  2YEP B;  1ZKH A;  4HPL B;  4FHJ A;  5J18 A;  2REX A;  3Q8C A;  3WCQ A;  2LVQ A;  2KWC A;  2AX5 A;  4P7I A;  5JXV A;  2JXX A;  2L3Z A;  4W9F A;  3FKY A;  4DK5 A;  4W9H A;  2KD0 A;  1ET9 A;  2KDE B;  3AI5 A;  4LK0 M;  4JL9 A;  3BVG A;  1NVI D;  1UD7 A;  2X38 A;  2LXC A;  5GXG B;  4A20 A;  3ZYY X;  2LGD A;  1ZUD 2;  2IO2 B;  2DYB A;  2EEL A;  1L2N A;  2J53 A;  1P9D U;  1WYG A;  2J4X A;  4FLH A;  3TJP A;  3PO0 A;  3ZJT A;  4MEL A;  3Q14 C;  5AZF A;  3RNG C;  2JQR B;  2N9K A;  3VRA B;  4NZL B;  2D10 A;  4FJY A;  1QQR A;  3E56 A;  1YX6 B;  1E8W A;  2HJ8 A;  1JW9 D;  3TEY A;  5CX3 A;  1IUE A;  1SXT A;  1L6V A;  1R4N B;  1L4D B;  2NR2 A;  2RD0 A;  4MGK E;  4K3C A;  2RGF A;  1UUP A;  1RLF A;  1E0Z A;  4M02 A;  1RFA A;  3H7S A;  1TY2 A;  2K3U A;  1KLU D;  3L17 A;  2ZNV C;  4I6L B;  3L4P A;  3W5V B;  3IAM 1;  3DBH I;  4GDK B;  3PRE A;  3L13 A;  2O6V D;  2RDB C;  3I57 A;  1KLG D;  3NJT A;  4US8 A;  1P7F A;  1HTQ A;  1UGJ A;  4ANU A;  4DWF A;  4HJK A;  3TEW A;  2M56 B;  3I9V 1;  3I63 C;  3QAQ A;  2DYO A;  2W82 A;  4PT5 A;  1FO4 A;  3QWZ B;  1WSP A;  2WNM A;  4PS8 A;  3KWV A;  4CQN A;  4FJV B;  2K8H A;  1P3Q U;  1ZP0 B;  2R61 A;  2RSU A;  4NNJ B;  1ESF A;  1YX5 B;  2L8J A;  3NZ3 A;  3MC8 A;  1JRO A;  2MJD A;  4B6W A;  5L83 A;  5DPW A;  1R4M I;  4G3X B;  4GOC A;  5CHF A;  1PUT A;  1IGC A;  4LJP B;  1AYF A;  2KQ4 X;  3ZLZ A;  4AOF A;  2JYE A;  2LFI A;  5JH5 C;  1FRR A;  2C7N B;  3ZUN A;  2SAK A;  1WX7 A;  2KO3 A;  1FNU A;  2ONQ A;  3PT2 B;  2KN5 A;  4A90 A;  3RFZ B;  2ZW0 A;  2KOX A;  2K25 A;  1MHX A;  1I4G A;  3WIM A;  3PZD A;  2ZEQ A;  4GDL B;  1NBF C;  1NI2 A;  4NJC A;  1CQV A;  3KW5 B;  2CHX A;  2J0M A;  1TZO A;  2WXK A;  2BT6 A;  5FR6 A;  1G6J A;  4HXD A;  2MP2 B;  3KWL A;  1PFD A;  4IOI E;  1ZPS A;  3R7Q A;  5CHV C;  2ACZ B;  2G45 B;  1E7V A;  1RFK A;  4J3O D;  3M3J A;  3ZDM C;  3OLM D;  3PZ8 A;  5AZG A;  2OHF A;  3B0A A;  1EO6 A;  3GZN I;  2OOB B;  4IKG A;  5C23 A;  3X23 A;  3FAH A;  3CF6 E;  4LTU A;  3DVG Y;  3PLV A;  3DBR B;  4WAA A;  4W9L A;  3NS1 A;  1P7E A;  1TS2 A;  2D3G A;  2FBW B;  3PRZ A;  3NHE B;  4WWM A;  2MLB A;  1FCC C;  1SJE D;  5GMV A;  3DWM A;  2NTS A;  1M94 A;  4RFB A;  1JCK B;  2LRU A;  4YTP B;  3T8M A;  3AED B;  2A4Z A;  1WXM A;  3QHT A;  3RNF C;  1Y8R C;  1DGJ A;  2WX1 A;  4LDT B;  3IG3 A;  2LRW A;  3ENE A;  2GLS A;  2IBI B;  2H88 B;  2KWV B;  4K7W A;  4OVV A;  2BGF A;  2DHZ A;  1V86 A;  3DVN V;  3ECI A;  3HHM A;  2A5U A;  1R4M B;  1WM2 A;  1WJU A;  2L00 B;  1H8C A;  1A5R A;  4IDI A;  2MSE D;  1N62 A;  1X1M A;  1WJ6 A;  3MHZ A;  2KYW A;  1L0X B;  4GU2 A;  1J19 A;  3LDZ E;  4GMV A;  2PTL A;  4NJ7 A;  1ZDX A;  2FIF A;  3ML9 A;  3AEC B;  1FXA A;  3BVZ A;  2KX0 A;  1NEN B;  4KGR A;  1TZ1 A;  1FD6 A;  3E9S A;  1NI3 A;  4DDG D;  2KMA A;  3V61 A;  5BMI A;  2IND C;  2G1E A;  3AU4 A;  4FBJ B;  1ZXI A;  2IGG A;  4KIK A;  3U7Z A;  1WFY A;  2JX5 A;  3QIJ A;  1SGH A;  1UF0 A;  1WX8 A;  2G9H D;  2BS4 B;  2UU7 A;  4HKZ E;  3UF8 A;  1WGH A;  5DPS A;  2BYT A;  2PIA A;  4PYZ A;  5DPT A;  3TEX A;  4MEM A;  3Q6B A;  3V60 A;  2KAJ A;  2KFK A;  5G5H A;  1C9F A;  1PGB A;  4L1B A;  2I1J A;  4TSS A;  2HTH A;  3VH3 B;  5HG2 A;  2VH1 A;  4AS1 A;  2E6X A;  4WQO B;  4DBG A;  2RDG A;  2HD5 B;  4KVG B;  3A1Q B;  3GE3 C;  2LWP A;  3NVZ A;  2FAZ A;  1KH0 A;  3AE7 B;  2WP9 B;  5D7G A;  3KUZ A;  1L4Z B;  4L2Y A;  1LM8 B;  4LCD E;  1MHH E;  1V2Y A;  1V97 A;  4BKS D;  4NY0 A;  1RAX A;  4YSX B;  1Q10 A;  4DHZ E;  1TIF A;  1OGW A;  1CZP A;  2LD9 A;  4M0W B;  3APC A;  4WUR A;  2QIL A;  1XD3 B;  2C7M B;  1OEY J;  2IO3 B;  1WM3 A;  3KVF B;  4W9D A;  2KX3 A;  2L83 A;  3VRB B;  1WXV A;  4F1S A;  1EF5 A;  3V6E B;  2W9N A;  2LVO A;  1ISN A;  2QHO A;  3AXC A;  1JWS D;  4IWQ A;  3Q3F A;  1FM0 D;  2ASQ A;  3KYD D;  1F52 A;  2RMM A;  4MAC A;  1ENF A;  2CJO A;  2IDY A;  1J7A A;  1OEY A;  4NQK E;  2JRI B;  3Q3J A;  4KGS A;  4PYU A;  4HPM B;  2KNB A;  1XLO A;  1WWT A;  1WXA A;  2BS2 B;  2IZV B;  3PSE B;  2INC C;  1MG8 A;  1SEB D;  3A33 B;  4LDT D;  2BWF A;  3DVN U;  1N60 A;  4Q2J A;  2MWS B;  3VQI A;  3HVD A;  2EMT A;  4C4V B;  5BYQ A;  2D2Q A;  4ZRJ A;  3T3N A;  2GRI A;  3AE3 B;  4XZ4 A;  5LXH A;  1V1P A;  3TEZ A;  2NS5 A;  3GP7 A;  4AP4 C;  2O6V A;  2W3S A;  3AE5 B;  1XQQ A;  1OFF A;  1UZX B;  1N6Z A;  3IBE A;  4YTN B;  1SB3 C;  2BBC A;  3N1Z C;  4HDQ A;  1SIJ A;  2KC1 A;  2WU2 B;  1RRB A;  3TCA A;  3AU5 A;  1F9J A;  4EKU A;  4M01 A;  1NEK B;  2K8B A;  4FAD A;  4KSK C;  4RGT A;  3R3M A;  3QK0 A;  4ZOH C;  1FRD A;  3IT6 B;  3IHP C;  2DEN B;  2XEW A;  2ZNV B;  2O6V B;  1DOY A;  3C8Y A;  1VDV A;  2N9L A;  3SFE B;  4WWO A;  2EKE C;  3C19 A;  3CWI A;  4MSQ B;  2KTF A;  4BFR A;  3B2F A;  1GC6 A;  3CSF A;  3RPF C;  3EC8 A;  4BKT A;  1L5P A;  3H9D A;  4XYC A;  2JSV X;  4WWN A;  4LJO B;  1LQB A;  3AMZ A;  3VFK A;  2DZK A;  4A3P A;  4M8M A;  4AQ7 A;  1KM7 A;  3DHH C;  5LLI A;  2CU3 A;  1WE7 A;  3W1S C;  1E7U A;  2XN9 C;  4RGM A;  1IPG A;  4KZC A;  3AUL A;  5IOI A;  3HK0 A;  4IW0 A;  2LJ5 A;  4HEA 1;  2FNJ B;  2ZCC A;  2W55 A;  4FN2 A;  1HQR D;  3VHT C;  3OJ3 A;  1SE4 A;  3N20 C;  4LNK A;  1MVK A;  3VAW A;  1HZ5 A;  5DPR A;  3DHG C;  3HRD D;  2QMT A;  4IUM B;  1BXT A;  4DQO C;  5EE0 A;  2K39 A;  3H1U A;  1I4X A;  2WDR B;  3AEE B;  1ZOY B;  2KMC A;  3N3K B;  1WRI A;  1YD8 U;  2MJE A;  3WAM A;  1TS3 A;  1EUV B;  2L32 A;  5D3D A;  1AN8 A;  2C5L C;  2JUO A;  4II3 B;  1WJN A;  5IO9 A;  2MHJ A;  1WZ0 A;  4W9K A;  1I42 A;  1T6B X;  1CK1 A;  3P4R B;  2M0X A;  3DDC B;  3RNE C;  1OQR A;  4ZDV A;  3EEC A;  3WAO A;  4OHJ A;  2RDH A;  3K9P B;  1P0R A;  4ZHO A;  1M4V A;  3ZKJ C;  4JWS C;  2BQQ A;  2MW5 A;  2Q5W D;  1K52 A;  3W9C B;  4YL8 A;  1FFV A;  2K22 A;  2JY6 A;  2WXP A;  2HDE A;  3A9J B;  4KKI A;  1J8C A;  3SFD B;  1QLB B;  2UWQ A;  1MPE A;  2FCS A;  2N0S B;  4NPN A;  4RGN A;  4TQ1 A;  1YJ1 A;  4K7S A;  1PQS A;  1T0R C;  5G55 A;  2YVC A;  3PGE A;  3KYC D;  4GDK A;  2LGX A;  4WWP A;  3NY5 A;  2JZP A;  1SE2 A;  3ZW3 A;  2CU1 A;  3RUL A;  2DX5 B;  3N32 A;  5JHA A;  3CIR B;  1C77 A;  1FIQ A;  1QF6 A;  1DOI A;  1WJ4 A;  4F8C B;  3J9C A;  4IC7 B;  2KLC A;  3CMM B;  2QCZ A;  2K1F A;  3VTW A;  2KWU B;  2WGS A;  2GI9 A;  4IWO A;  3UI3 A;  3U8Z A;  3R2I A;  3VVW B;  2LGS A;  2DZM A;  3WAP A;  2RPQ A;  1VLB A;  3K9O B;  5BMH A;  1JWB D;  1VD2 A;  3ZRF A;  3PHW B;  3JYU A;  2KDM A;  3RCZ A;  2ZPY A;  4HVB A;  1I4Q A;  2KN4 A;  4AWJ A;  3DWG C;  3NRZ A;  4WQM A;  1V8C A;  2IO1 B;  3OG5 A;  2PVG C;  3PS6 A;  3RMK C;  2MRP A;  2IGH A;  3N9Y C;  2JT4 B;  4GDL A;  2VZK B;  3SHQ A;  1WZ3 A;  1T0Q C;  4AUQ C;  2YLM A;  3MJW A;  1KLV A;  2WXJ A;  1IYF A;  3IFW B;  3BK2 A;  3PLU A;  2BTE A;  1UGM A;  4W9E A;  5FK9 C;  3Q3M C;  4MJS B;  2K5P A;  1QIL A;  2MP2 A;  1SE9 A;  1HZ6 A;  2LGI A;  4RM8 A;  1WGG A;  3AEB B;  2J0J A;  1TYG B;  3FC4 A;  2K8C A;  3EHV A;  3DCG A;  5H8Y E;  1WI0 A;  1UH6 A;  4BKS A;  2Z0E B;  4KDI C;  5IAA C;  2V3S A;  3QCA A;  3VR8 B;  3I5J C;  1U4A A;  3NOB A;  2IPK D;  4CYE A;  4OVU A;  3N1Y C;  2ICI A;  5FKA C;  4YWG G;  2KT7 A;  2WXR A;  1LO5 D;  5BYS A;  4XWT A;  1FCL A;  2TSS A;  4R3D A;  1YIW A;  1GUA B;  2WXF A;  3W2D A;  1SSN A;  1YN3 A;  2LAS A;  2BYE A;  3DPD A;  3LB8 C;  2LUM A;  4LNI A;  1V49 A;  3NVV A;  4JGH B;  3GB1 A;  1ROE A;  4TMA B;  2WHI A;  1UBQ A;  3RNB C;  3NVY A;  3M95 A;  1V81 A;  3DHI C;  1QT9 A;  2WU5 B;  3AN1 A;  4WAF A;  4OZC A;  3V62 A;  3VUX A;  4QAY A;  1HA5 A;  2M17 A;  3ZXV A;  3ZXR A;  4IM0 A;  3U7D A;  1VZ8 A;  4JWU C;  3ZO5 B;  3PRM B;  2JWU A;  1JRU A;  1PYW D;  3L16 A;  1TBE A;  3IXS A;  1N63 A;  2G3Q B;  4II2 B;  2GOW A;  1MJD A;  1AAR A;  5AZH A;  1WH3 A;  2ZW1 A;  1QOF A;  2BW2 A;  3TMP B;  3TIX A;  3Q3O C;  5DCN A;  4WH4 A;  1JWU D;  2BKR B;  2FID A;  3W1Y A;  3NZU A;  3D32 A;  5BO4 B;  1WE6 A;  4K81 A;  2JRH A;  2J42 A;  2IYD B;  2PLP A;  3DBH B;  3APD A;  4URK A;  4EZJ A;  2AL3 A;  4N58 A;  3MTN B;  2OJW A;  2KXJ A;  3VH4 B;  3SD5 A;  4MGY E;  1YJJ A;  5LNK 1;  1DYQ A;  3DBL I;  4W9G A;  2WQY B;  4B9K A;  4PK1 A;  4ZYN A;  2JPH A;  3ZVV A;  1KRH A;  2W54 A;  2INN E;  2Z8L A;  5CHW A;  2K9X A;  4A9A A;  1MI0 A;  5HKH A;  1FNV A;  2V1Y A;  1WRD B;  4MM3 B;  3SR6 A;  3NUH B;  2L1A A;  2JXT A;  2WXL A;  4NAW B;  2MA9 B;  4ZRQ A;  2KJH B;  1HE8 A;  1PDX A;  3EFU A;  1UWM A;  1L0V B;  3V3X A;  2DLB A;  1FMA D;  2LUE A;  3GOE A;  3N1X C;  4XE0 A;  2AYO B;  1QOA A;  1WF9 A;  1QZE A;  1YQB A;  3NZS A;  4ANV A;  2KZR A;  1LXD A;  1ZGU B;  1RYJ A;  2CHZ A;  1H4R A;  1QOG A;  2VZK D;  3VTU A;  2QC8 A;  3QA8 A;  3ETR A;  2GB1 A;  3A1Q A;  2DYM A;  2WX0 A;  2LGY A;  5E6N A;  2ZJD A;  2DAF A;  1VRA B;  4WJN A;  1E8Z A;  1STE A;  1WGR A;  3AE1 B;  3PTF C;  3MC9 A;  1RWS A;  4TV3 A;  3R8B A;  3ZNH B;  1S1Q B;  1V80 A;  4XDD A;  4N59 A;  3IT4 B;  3Q69 A;  1VZ7 A;  5E6P A;  4HJG E;  2IY1 B;  3RI7 C;  1L0Y B;  2KQ7 A;  1GB4 A;  4M0W A; 
#chains in the Genus database with same CATH homology
 2WU2 B;  1E7P B;  1I4H A;  3OWE B;  4JPS A;  1D4B A;  1QQR A;  3AE4 B;  3E56 A;  3TUO A;  1NEK B;  2Y3A A;  4A6Q A;  1VJK A;  1WGK A;  3Q8B A;  4RGT A;  3SEB A;  1JW9 D;  3TEY A;  1XCQ L;  4ZOH C;  4RCO A;  1FRD A;  3IT6 B;  2Y5P A;  1IUE A;  1SXT A;  1L6V A;  1SBB B;  2WDV B;  1L4D B;  1DOY A;  3C8Y A;  1VDV A;  1D5M C;  2N9L A;  2WS3 B;  3B9J A;  3SFE B;  5EE9 A;  2CJN A;  3CWI A;  1UUP A;  3B2F A;  1E0Z A;  1ZXH A;  1IBX B;  1TY2 A;  2PW9 A;  1EWY C;  1XLP A;  2K3U A;  1KLU D;  3RPF C;  3MC0 B;  3P42 A;  4KX6 B;  1SJH D;  2V3P A;  1AWD A;  4HRS A;  1L5P A;  2JSV X;  3AE2 B;  3AEF B;  3U4E G;  3AMZ A;  1FFU A;  3L4P A;  3W5V B;  3IAM 1;  4AQ7 A;  2WDQ B;  2WXG A;  1N5X A;  1GB1 A;  4GDK B;  2CU3 A;  2K0P A;  4RH6 A;  2V0G A;  4N6E B;  1OQQ A;  3V05 A;  2XN9 C;  4RGM A;  2LJI A;  1C79 A;  1TY0 A;  2FUG 1;  3I57 A;  1BUI C;  1KLG D;  4RNA A;  4US8 A;  1P7F A;  4HEA 1;  3BWU D;  1UGJ A;  2W55 A;  4A55 A;  1HQR D;  3TEW A;  1A70 A;  1K51 A;  2M56 B;  3I9V 1;  1SE4 A;  4KGT A;  3U52 E;  5BYR A;  2DYO A;  1MVK A;  2W82 A;  4PT5 A;  1FO4 A;  1WSP A;  2WNM A;  3KWV A;  3R2T A;  4P6V F;  1HZ5 A;  3AB5 A;  2E3T A;  3HRD D;  2LEK A;  5HFY A;  1AW7 A;  2QMT A;  4CQN A;  4DQO C;  1BXT A;  5EE0 A;  2V4I B;  1I4X A;  2WDR B;  3AEE B;  1ZP0 B;  1ZOY B;  1PGA A;  2R61 A;  1ESF A;  1EU4 A;  1WRI A;  2MJE A;  3BVM A;  1FNW A;  1JRO A;  1TS3 A;  2AQ3 B;  1NYQ A;  2MJD A;  3NZ3 A;  2L32 A;  5D3D A;  1AN8 A;  1PUT A;  4OW0 A;  4YSY B;  1IGC A;  4DXF A;  5BMG A;  2I2Y A;  1AYF A;  2KQ4 X;  2JYE A;  2LFI A;  1F0Z A;  1FRR A;  4B0M A;  1T6B X;  1CK1 A;  2SAK A;  3P4R B;  5H92 C;  1FNU A;  1OQR A;  2ONQ A;  1ACC A;  4A90 A;  2N7J A;  3RFZ B;  2ZW0 A;  1TS5 A;  4OHJ A;  2RDH A;  3AEG B;  1MHX A;  2BS3 B;  1I4G A;  4USA A;  2IGD A;  1C4P A;  4GDL B;  4ZHO A;  1M4V A;  3AE6 B;  4JWS C;  4NJC A;  2Q5W D;  1K52 A;  3W9C B;  1CQV A;  1FFV A;  2K22 A;  3AM9 A;  1T3Q A;  1JQ4 A;  2WXQ A;  2HDE A;  1F2R I;  2WXP A;  4KKI A;  1YQ4 B;  1TZO A;  3P4P B;  2WXK A;  5C3J B;  2BT6 A;  5AUK A;  1TJE A;  4A8X C;  2OED A;  4O1N A;  3SFD B;  3KWL A;  1PFD A;  1QLB B;  4IOI E;  1MPE A;  1ZPS A;  3U2S C;  3W1S A;  2N0S B;  4RGN A;  4L23 A;  4TQ1 A;  2MH7 A;  1K50 A;  1C4C A;  1YQ3 B;  2XNA C;  4XWW A;  2ACZ B;  2WXN A;  5HI1 A;  1WXQ A;  1RFK A;  4J3O D;  1SE3 A;  4MH8 A;  1N61 A;  1FXI A;  2JU6 X;  4ZHP A;  2NMQ A;  4MT5 A;  3ZGZ A;  4NAM A;  3BYT B;  1N5W A;  2JZP A;  1SE2 A;  3H8H A;  1T5X D;  2EKI A;  1R7S A;  3PZ8 A;  4C80 A;  2JYT A;  1I7H A;  2OHF A;  3KQ4 A;  3CIR B;  5D3I B;  1C77 A;  1FIQ A;  1QF6 A;  3BII D;  1UWX A;  1DOI A;  2QJL A;  2M19 A;  2LHE A;  3J9C A;  1VR9 A;  4IKG A;  4RF0 A;  1RM6 C;  3FAH A;  4C56 C;  2LMC A;  4LTU A;  1QKZ A;  2PKO A;  3ZJU A;  2GI9 A;  1GOZ A;  3UI3 A;  3NS1 A;  1P7E A;  4OZA A;  1B9R A;  3R2I A;  1TS2 A;  2I38 A;  2FBW B;  4YXD B;  2DBY A;  2Y5C A;  2M0A A;  4WWM A;  4C7Z A;  2KMM A;  1VLB A;  1FCC C;  2WLB A;  4YTM B;  1SJE D;  4B0E A;  3FIL B;  1JWB D;  1EWC A;  3DWM A;  5BMH A;  2NTS A;  2DWQ A;  1QOB A;  4RFB A;  1JCK B;  3Q8E A;  1XXG A;  3TSS A;  1E9M A;  4YTP B;  2KDM A;  3EA6 A;  3AED B;  1GAQ B;  1I4Q A;  2KN4 A;  1I4R A;  3DWG C;  3NRZ A;  4WQM A;  1V8C A;  1JAL A;  1J7B A;  1DGJ A;  3BK1 A;  1XF5 L;  1JRP A;  1IGD A;  2PVG C;  4LLG M;  1UNS A;  1JWM D;  2IGH A;  2FE8 A;  3N9Y C;  2VZK B;  2H88 B;  1F77 A;  5G5G A;  3T3O A;  2W3R A;  1EU3 A;  3MFG A;  2WXJ A;  3HVZ A;  2BB6 A;  3BK2 A;  2BTE A;  2ON8 A;  5FK9 C;  2K5P A;  1QIL A;  4IDI A;  2YEP F;  3KLS X;  3P1M A;  1N62 A;  1FEH A;  2MJ3 A;  4US9 A;  1HZ6 A;  3MHZ A;  1L0X B;  2LGI A;  3P63 A;  4FXC A;  2PTL A;  5AUI A;  1ZDX A;  3AEB B;  1E6E B;  1TYG B;  3FC4 A;  3EGR A;  2KWD A;  3AEC B;  1FXA A;  5H8Y E;  3BVZ A;  5T8I A;  1C76 A;  2D5G A;  1NEN B;  4KGR A;  4ITK A;  1FD6 A;  3E9S A;  1XLQ A;  1NI3 A;  3P4S B;  3VR8 B;  5BMI A;  2G1E A;  4ZYS A;  3BZD B;  2IPK D;  1YNT E;  1ZXI A;  5FKA C;  2ICI A;  2IGG A;  2WXO A;  5EE1 A;  3NVW A;  4YWG G;  1SF0 A;  2WXR A;  3U7Z A;  2BB5 A;  2JX5 A;  1LO5 D;  2L52 A;  1YJI A;  4ARI A;  4REZ A;  5BYS A;  2G9H D;  2INP E;  4XWT A;  1FCL A;  2BS4 B;  2TSS A;  4R3D A;  3W2D A;  2WXF A;  4HKZ E;  1SSN A;  1YN3 A;  4RGO S;  1CJE A;  2LHD A;  2BYT A;  3LB8 C;  2LUM A;  2HTM E;  2PIA A;  3B2G A;  2QIE B;  4GLS C;  3TEX A;  3NVV A;  2KAJ A;  3GB1 A;  3PZ7 A;  1C4A A;  5G5H A;  4DXG A;  1ROE A;  4TMA B;  1EM7 A;  1PGB A;  4ZRP A;  1C9F A;  1K53 A;  1XLN A;  3NVY A;  3GS2 A;  3Q8F A;  4L1B A;  4TSS A;  1KFY B;  1F2R C;  2RPV A;  1TKG A;  2KAC A;  1QT9 A;  2WU5 B;  2PVO D;  3AN1 A;  4WAF A;  1XCT L;  5HG2 A;  5E6J A;  4OZC A;  4AS1 A;  1D6E C;  3Q8A A;  2E6X A;  1HA5 A;  2RDG A;  3AE8 B;  2WXH A;  1KTK A;  1VZ8 A;  3FIL A;  4JWU C;  2JWU A;  1PYW D;  1JML A;  3NVZ A;  2J52 A;  3IXS A;  5I4D A;  1N63 A;  3URY A;  2WXI A;  5FR3 A;  1KH0 A;  1PGX A;  1E10 A;  1V1P B;  3AE7 B;  2WP9 B;  1TKY A;  5D7G A;  2ZW1 A;  1QOF A;  1D5X C;  2BW2 A;  1L4Z B;  4L2Y A;  4WH4 A;  1JWU D;  1MHH E;  1V97 A;  4HKQ A;  1V1O A;  4TQ0 A;  4YSX B;  2QEJ C;  3HUI A;  2H89 B;  2J42 A;  1Q10 A;  2PLP A;  3ZQ4 A;  1TS4 A;  4HRO A;  1BML C;  2PMV A;  1XO3 A;  4WUR A;  1CZP A;  1B1Z A;  5TSS A;  2IJ0 A;  2WXM A;  5MPO A;  4ARC A;  2QIL A;  1J7C A;  4N58 A;  3O13 A;  2L83 A;  2NTT A;  5C2T B;  3VR9 B;  1YJJ A;  1D5Z C;  5LNK 1;  1DYQ A;  4UDU C;  3VRB B;  4P16 A;  5EE3 A;  4C7Y A;  4RF1 A;  1JWA D;  1YMH E;  2V3N A;  4YT0 B;  1HXY D;  1YN5 A;  2WQY B;  2AQ1 B;  2B76 B;  1KRH A;  2W54 A;  2INN E;  4YSZ B;  2Z8L A;  3P4Q B;  4D2K A;  1I4P A;  1C78 A;  2K9X A;  4OZB A;  4EE2 A;  1JWS D;  4A9A A;  3AEA B;  1MI0 A;  1FM0 D;  2RMM A;  1FNV A;  4MAC A;  4MM3 B;  3SR6 A;  1XEE A;  1ENF A;  2MEK A;  3LYY A;  3NUH B;  2L1A A;  2CJO A;  2JXT A;  2WXL A;  2IDY A;  1J7A A;  2AQ2 B;  4NAW B;  3ABV B;  3BYY B;  3LXF A;  4ZRQ A;  4KGS A;  1PDX A;  1UWM A;  1ET6 A;  1L0V B;  3V3X A;  1VZ6 A;  2DLB A;  1FMA D;  1YN4 A;  1XLO A;  1L6U A;  1WWT A;  2YEP B;  3MJ5 A;  2BS2 B;  4XE0 A;  1ZDV A;  1QOA A;  1HEZ E;  3Q8C A;  3WCQ A;  3AE9 B;  5HHD G;  2AX5 A;  3EUB 2;  1SEB D;  4KKJ A;  5JXV A;  1RYJ A;  4H2A A;  1QOG A;  1Y56 A;  2QSD A;  2VZK D;  1DOX A;  1N60 A;  3W5U B;  3ETR A;  1ZE3 D;  4Q2J A;  4XDC A;  1NYR A;  3VQI A;  3HVD A;  2GB1 A;  2DYM A;  5BYQ A;  3AH7 A;  1ET9 A;  3AV8 A;  3T3N A;  2GRI A;  3AE3 B;  4LK0 M;  3IAS 1;  4WIP A;  1VRA B;  1TKE A;  1V1P A;  1GPX A;  3BVG A;  1NVI D;  3TEZ A;  2X38 A;  5GXG B;  3ZYY X;  3GP7 A;  2W3S A;  3AE5 B;  1OFF A;  1STE A;  1ZUD 2;  3AE1 B;  2EEL A;  2SEB D;  3ZJV A;  2J53 A;  1WYG A;  1KF6 B;  2J4X A;  4YTN B;  1RWS A;  1SB3 C;  3R8B A;  3PO0 A;  3ZJT A;  1IBX A;  2BBC A;  4N59 A;  4XDD A;  3IT4 B;  3Q69 A;  1VZ7 A;  3MP9 A;  4HJG E;  4OVZ A;  2JQR B;  2N9K A;  3VRA B;  1L0Y B;  4JE3 B;  1SIJ A;  1GB4 A;  4M0W A;  4JX1 C;  4NZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...