1XF5L

Complex hcv core-fab 19d9d6-protein l mutant (h74c, y64w)in space group p21212
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
KTPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEWTADLEDGGNCMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Capsid protein C
total genus 16
structure length 71
sequence length 71
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xf5L00
1EM7A 2RPVA 2GI9A 1FD6A 2QMTA 1XF5L 4KGSA 5HFYA 2J53A 2IGHA 2JZPA 4KGRA 2KWDA 2PTLA 3V3XA 2ONQA 1YNTE 2N7JA 2LHDA 1K51A 1KH0A 1IBXB 1IBXA 4D2KA 1QKZA 2ZW0A 4OZAA 1ZXHA 1PGBA 1F2RI 2LGIA 2I38A 2N9KA 1P7FA 3GB1A 1D4BA 4OZBA 1K52A 1HZ6A 1XCTL 1PGXA 4WH4A 4OZCA 2I2YA 1K50A 2LHEA 2IGGA 2N9LA 3MP9A 1HZ5A 3UI3A 4IKGA 1MHXA 1MVKA 2LUMA 5BMHA 5BMIA 2ON8A 2NMQA 2JWUA 5HG2A 5BMGA 2ZW1A 1FCCC 2GB1A 4MACA 1FCLA 4HJGE 1C9FA 4GLSC 2PW9A 5JXVA 1IGCA 1F2RC 2KN4A 1K53A 1UWXA 2JSVX 1PGAA 2JXTA 1GB1A 1Q10A 5HI1A 2J52A 1JMLA 2EELA 3FILB 1P7EA 1MI0A 2JU6X 2KQ4X 5HHDG 2RMMA 1IGDA 1MPEA 2K0PA 2OEDA 1YMHE 2QSDA 1GB4A 2KACA 2KDMA 2PLPA 4IOIE 2IGDA 3FILA 4KGTA 4HKZE 1XCQL 1MHHE 1HEZE
chains in the Genus database with same CATH superfamily
2RPVA 4L1BA 1KLVA 3ZJVA 1TZOA 1ZGUB 4ZYNA 4IWQA 3E56A 1Z2MA 3P4QB 2V9HA 2D3BA 4US8A 4AQ7A 2JZPA 1C4AA 3PHXB 2LZ6A 1C78A 2PTLA 1YJIA 3QQ8B 4IUMB 4XGAB 3BVZA 1WGYA 2KOXA 5LNK1 3PVLA 4RM8A 3Q2AC 1I42A 3DDCB 3R66C 3BK2A 2W54A 4A20A 2LGDA 3DPDA 4HKQA 1HZ5A 4MJSA 1FPYA 2BTEA 1JQ4A 2PVOD 2KHWB 3WIMA 4K81A 3Q8EA 3MFGA 1WJ6A 2WP9B 3TEWA 5D3DA 1XT9B 1WRDB 3P4SB 1XO3A 4JGHB 3TEXA 4NAWA 4NJCA 2BYVE 2JYEA 1NDDA 1V5TA 4I6NB 2KXJA 3L17A 1WJUA 3IG3A 3HM6X 2E6XA 1PUTA 2C9WB 2CHWA 1GC6A 5L83A 1I7HA 5AZFA 3VTUA 1L7YA 4CHKA 2NBWB 3NUHB 3RMKC 3DWMA 1OQQA 3BZDB 4LNKA 4P6VF 4DBGA 3T3OA 1FM0D 1U4AA 4BAXA 2MRPA 1HEZE 2CR5A 2RDBC 4HVBA 2WX1A 5AUKA 2KMMA 5IKCM 3A9KA 1YN3A 1L4ZB 1TS4A 4KVGB 2WXNA 1D5MC 4KGSA 3RNCC 1S3SG 3RZWC 2WXRA 2N7EA 1SE3A 4RH6A 4C4VA 2BS4B 4AS1A 2KWDA 2JXXA 3RNEC 3KUDB 1V6EA 3PV1A 1LO5D 2D3GA 1K51A 2NBVB 2KTFA 5AZGA 4IWOA 4M8MA 2ZW0A 4HK2A 1GAQB 3ECIA 1F2RI 3RT3B 4N9F4 1V80A 3TEZA 1N62A 4AJYB 2NPTA 2M17A 5C3JB 2G4SA 4KKIA 1F1HA 1B1ZA 4OZCA 5D7GA 3ZNHB 3MP9A 4ZHOA 3DBRB 2YVCA 2A5UA 5DCNA 3PZ8A 4TKNA 4E74A 2JPHA 3DVGX 1QT9A 4RF1A 1C4CA 4MACA 3BWUD 3B08A 4XYCA 1NBFC 3OG5A 3Q3NC 4FN2A 1WY8A 1RM6C 2BT6A 2CU3A 2NVUI 4GMVA 4PK1A 3RZFA 2MBOA 1N5WA 1ET6A 3ZTCA 1UBQA 2KYWA 3OWEB 1ISNA 3ZVVA 4IC7B 4ACFA 1X1MA 3NRZA 1UGJA 1G6JA 1L2NA 2MP2A 2KLCA 4A6QA 1L4DB 5CHFA 2ZNVC 2LVPA 1L0YB 1YMHE 4RGNA 5IP4D 3WAPA 3UGBB 1YN5A 5DPTA 2MX2A 4EUTA 1SF0A 3HRDD 2PLPA 1TKEA 4ZRIA 1SXTA 1WM3A 3AE2B 3AV8A 1L5PA 2V0GA 1FNUA 3HVDA 1YIWA 5EE1A 1YN4A 2L32A 3J9CA 2J0JA 4A8XC 1SE4A 3EFCA 1N6ZA 1YNTE 3I9V1 4TUUA 3RULA 2LHDA 4YTNB 3PTFC 2J4XA 1KH0A 2JT4B 3TCAA 1HTQA 1D6EC 4ZRKA 3AEAB 1ZOYB 3MHZA 3VTWA 1MJDA 1J8CA 2BWES 4DDID 3A1QA 1NEKB 3T9LA 3UI3A 1TKGA 1E7VA 2AQ2B 1SIFA 2BWFA 2O6VA 5J17A 4BOZB 4YSYB 3H9DA 3JYUA 4F7ZA 3BINA 2YEPB 2KN5A 2PVGC 3AEBB 3VVWB 4WQOB 5JXVA 1T0RC 1TTNA 1DYQA 1EWCA 1NYRA 4YTPB 4F8CB 4BBNF 2LVOA 3RFZB 3CF6E 2NR2A 4A90A 4HWIB 2LEKA 3VR9B 5C1ZA 1KLUD 1V1PB 3V6EB 3P1MA 1D5XC 4YT0B 1WX9A 4B6WA 4GGQA 2C5LC 4XE0A 1CMXB 4GB9A 2MBQA 1BT0A 3ABVB 3SHQA 3DBRI 1YQBA 2N9EB 2UWQA 2INCC 2ZJDA 1BUIC 1TS5A 3BYYB 3LJ3A 2O2VB 4NZLB 2WNMA 4DK5A 1FXIA 3KWLA 3NS1A 1WMHA 5AUIA 2J0KA 2N7JA 3H1UA 2ICIA 4MH0E 1V9JA 4WWPA 3SEBA 1N63A 2X38A 2ZVOA 3JSVA 1F77A 5E6NA 4YSZB 1WF9A 3FKYA 3C8YA 2KAJA 2IO3B 5G5GA 5LXHA 1STEA 3A4RA 3U7ZA 1D4BA 1UUPA 2SAKA 1SE9A 3QARA 4GOCA 2KFKB 3VUWA 4A9AA 1R4NI 2MHJA 5IA7A 4W9DA 3V60A 3APFA 2SEBD 2C7MB 2LUMA 2WU5B 2IPKD 1RAXA 1GOZA 1L6UA 2KWCA 2IYDB 2DBYA 1XLPA 4EZLA 1ZE3D 2J7QB 3OLMD 2PW9A 3EHVA 4A3PA 1HXYD 1YQ3B 2UYZB 1NVID 3UQBA 2V3SA 1WE7A 2KWVB 3AU5A 4K7UA 1WGKA 3ZNGC 3K9PB 3UIOB 2K0PA 4LK0M 2OJWA 1WX7A 3WALA 4WAFA 1JRUA 4PS7A 2LRUA 3EGRA 1VR9A 3PRPB 4K7SA 2PKOA 5BO4B 2DHZA 2K1FA 2VRRB 1HE8A 4HCNB 2DZKA 2M0AA 4UDUC 2IGHA 3ZRCA 4A3OA 4NNJB 2JVCA 1B9RA 2DYBA 1WXMA 4JLCA 3DCGA 2BB5A 1SIJA 1V2YA 4BKGA 1L0XB 2MLBA 2G3QB 2QDFA 2R61A 1V49A 3HUIA 3AULA 3QC8B 1LGRA 2DZIA 2AQ3B 5JH5C 1MG8A 5G2NA 2I38A 3Q6BA 1WH3A 1I4XA 1WI0A 3N3KB 1P7FA 1YJJA 4JWSC 2WDQB 2Q5WD 3H7PA 1SJED 2JY6A 3RNFC 2KNBA 4WH4A 1WMHB 3AH7A 3V61A 3SDLC 4A55A 3LB8C 4AJWA 3CIRB 4NQKE 3RN9C 1ZW7A 1E8XA 4FJVB 3Q8FA 3V6CB 2WXPA 5CHVC 2KLGA 3IHPC 3GZNI 2WXHA 2Y3AA 2KQSA 3VQIA 2JF5A 1GNUA 1E90A 2Z0DB 5FR3A 1WJ4A 3RPFC 4RGOS 5BYSA 2C60A 4YWGG 3PO0A 3U52E 1TS2A 2RD0A 3FILB 1TJEA 3L4PA 3LDZE 1C1YB 2OJRA 3B0AA 4M02A 4IG7B 3A33B 4KSKC 4F1SA 4MSMB 1YX6B 5C23A 2QSDA 4K3CA 1Q5WB 4WJPA 1ROEA 3DBLB 3Q3OC 4G0NB 2V4LA 1ZP0B 4CO7A 4R3DA 2KVZA 1DOIA 4PT5A 3CWIA 2MJEA 3APCA 2KMCA 1JRPA 3NZUA 3TMPB 3O13A 3A1QB 4ZRJA 3AE7B 5DPWA 5IO9A 2XNAC 3AE4B 4YXDB 2JRHA 2AL3A 1N60A 1UH6A 5BYQA 4XC2A 3SU8X 5J18A 2BW2A 1J19A 1E9MA 3AB5A 2QHOA 3A9JA 4ANVA 4RFBA 2L00B 1ZDVA 2K3UA 2X8XX 3VUXA 4FHJA 5D3IB 3M62B 2ZZPB 4L2YA 4G11A 2G1EA 1VRAB 1L6VA 3PRMB 1IUEA 2EMSA 5IN7A 4GSWA 4DWFA 5GXGB 2ZNVB 3VDZA 4LTUA 3M3JA 3QX1A 4HXDA 3Q3MC 3W5UB 2D07B 3NZSA 5EE0A 2GBJA 2OHFA 3NG0A 2JXTA 1F0ZA 1GB1A 3FAHA 4G3XB 2ASQA 4WWNA 4DQOC 2R2QA 3DOWA 1H8CA 1QLBB 2CHXA 1GUAB 3ALBA 4LNNA 2N1VA 2PMVA 5JHBA 2FNJB 1QILA 2FIFA 1UD7A 2RGFA 4W9GA 3P42A 3Q3JA 4XZ4A 3AMZA 2L3ZA 1OFFA 4EFOA 1V97A 3R7QA 4DXAB 3IVFA 2KX3A 3MJ5A 3MHSD 4RM9A 1J7CA 1VDVA 2WXJA 5DPRA 4OHJA 1UELA 3VAWA 4S0RA 3HVZA 5TR5A 2JWZA 2AWTA 1E8ZA 4HPPA 1LFDA 1AARA 2L0TA 4GDKB 4II2B 3ZDTA 2N7DA 1OQYA 2FUHB 1R7SA 1K8RB 4D2KA 4W9HA 1QKZA 4IDIA 3ML8A 3IFWB 1EU3A 1AWDA 3C0RB 3MC8A 2NTSA 2KJRA 5CTRC 1K52A 3ZNID 4FJZA 1P0RA 2GBRA 3AE6B 1K50A 3D32A 4OVUA 4ANXA 3RNAC 1MVKA 3IBEA 3HK0A 4FA6A 3W2DA 2LVQA 5HG2A 3U30A 3L13A 1WR6E 3GS2A 2O6VB 2QCZA 3EECA 1KTKA 1N61A 1TYGB 1WGHA 3DBHI 2ZPNA 2MBBB 3AM9A 2WXOA 1YD8U 5H8YE 3ZYYX 1SB3C 5IAAC 1PGAA 4W9IA 5EE9A 1QF6A 1WIAA 2EELA 4WURA 2M1MA 3GE3C 4MGKE 2LFIA 2WHIA 3TUOA 2PIAA 3P2BA 4P7IA 3A9JB 4C4VB 2V1YA 5L95C 2WXIA 4B0EA 3ML9A 2D11A 1TS3A 1E7PB 3WAOA 2WDVB 3V05A 3NHEB 3AEGB 3AI5A 3TSSA 2MJDA 4FULA 2FBWB 1GG3A 4IW0A 2BS2B 4USAA 1YJ1A 2KVRA 3KWVA 1J7AA 4KZCA 4EZJA 1A5RA 2J53A 2L0FA 4LJOB 1E5WA 4NY0A 2LXAA 1CK1A 2DZJA 3N1XC 2BF8B 4JPSA 1XXGA 4OZAA 3I3TB 1P1AA 2KDFB 1T5XD 1PGBA 3N20C 1WXQA 2N1WA 1SGHA 1ZKHA 3DHGC 5BYRA 4JQWC 4W9JA 2XK5A 3CSFA 1V86A 4XX5A 4ARIA 1PYWD 3B2GA 1QOBA 1VCBA 2PJHA 5CX3A 2FCMA 4PYUA 2LHEA 2IGGA 4HDOA 3VR8B 4IKGA 4RGTA 2ACZB 3IT6B 4KV2A 1J7BA 1NI2A 4LNIA 1E8WA 1FCCC 5D2MB 1FCLA 2CHZA 4C56C 2JSVX 4ANUA 1WYGA 1PFDA 1I4GA 4AWJA 2GLSA 4MJSB 1Q0WB 3BVGA 2MA9B 2CKHB 4ZRQA 2LRWA 2RDGA 4BBNC 3QIJA 1GPXA 1HTOA 3NVVA 3DBHB 1MPEA 4GDLB 2AL6A 2BGFA 2KACA 3NVZA 5LLIA 4NJ7A 1FXAA 4FJYA 3UIPB 3FILA 4HKZE 3L54A 2KK8A 4OW0A 1MHHE 4NPNA 1H4RA 2CS4A 1SEBD 2WDTB 1FD6A 2ZVNA 3ZLZA 3P4PB 3IT4B 1I4HA 2NPTB 4MH8A 2AX5A 3S2AA 1EUVB 2K5PA 1AN8A 3AE9B 4S17A 3X0WA 3W1SC 2VZKB 1ACCA 1FFUA 4C7YA 2DZMA 2IZVB 4XWTA 1P98A 5E6JA 2WXQA 3TJPA 4OVZA 3U2SC 1RFAA 4AUQC 5MPOA 1D3ZA 3KW5B 2N9KA 4ASWC 4HPMB 4HRSA 3GB1A 4RMAA 2EKEC 2IBIB 5E6OA 2IDYA 1C76A 2GBKA 4QAYA 1LM8B 1YQ4B 2K8HA 2ZEQA 4W9KA 2H88B 2J0MA 4FLHA 1WX8A 4GDLA 2HDEA 2ON8A 1OEYA 3NY5A 2LASA 4HPLB 2G4DB 4EZKA 2N4FA 4GLSC 4CYEA 1NYQA 3URYA 3AE5B 3P4RB 5FKAC 1UWXA 1YOVB 2WX0A 4WIPA 2IJ0A 4MELA 3AE8B 4P16A 1XQQA 3BK1A 2CJNA 1P7EA 4HLEA 3DVNV 2KQ4X 1VD2A 3T8MA 4ICVA 1WZ0A 1FMAD 2GRIA 3Q8BA 4AOFA 4XWWA 3L08A 1V5OA 1Y8RC 2KDIA 3HIZA 2MWSB 4ANWA 5TSSA 4FXCA 1WFYA 1GJZA 3ZIMA 2QMTA 2KWUB 4REZA 3NS8A 1EF5A 4ARCA 2ZPYA 3HM3A 4JX1C 5HFYA 1RRBA 3MC0B 4DDGD 1WSPA 4LDTD 4KGRA 2JRIB 2K25A 4J6IA 3VTVA 3V3XA 2ONQA 2DX5B 4W9CA 1E6EB 3RCZA 3W1YA 2M19A 4JWUC 1JCKB 3PZ7A 2Y5BB 4YL8A 3CMMB 1OEYJ 1T0YA 2FAZA 2KT7A 3SR6A 1QOGA 3VRBB 4AP4C 2M4NA 3QCAA 1V1PA 3L0WB 3W1SA 2D3AA 2H89B 3JSVB 1TIFA 4KIKB 3DBLI 2B76B 4N58A 1KOTA 5BMHA 2JWUA 1KRHA 3VH4B 2MBEA 2ZW1A 1ENFA 2WXMA 3QHTA 3LXFA 3KYDD 2KDBA 5KHOA 2D5GA 1WRIA 2GMIC 1FRRA 4JIOU 2FUG1 1RWSA 3N1YC 2PE9A 4M0WB 4JE3B 4BKTA 4TQ1A 2KKCA 5T8IA 1OQRA 2G9HD 1SE2A 3AEDB 4DHJD 3PPAA 4OVVA 1E8YA 2WLBA 5E6PA 4E3CA 4HCPB 3R2TA 3VXWA 3TBLD 4ICUA 1FEHA 1E10A 3PREA 2E3TA 2KFKA 1BMLC 5KHQA 3NZ3A 2VZKD 4MT5A 1WXVA 4ZYSA 1LXDA 2KC2A 3ZTDA 2L05A 2GI9A 1VZ6A 1V81A 2BS3B 4WAAA 1PDXA 2N9PC 5CHWA 4EOYA 1JWAD 2KO3A 2ZCCA 3ONSA 2LUEA 1QQRA 4MM3A 2G45B 4J3OD 4B9KA 4FADA 3ZUNA 2LMCA 4GDKA 4BZAA 1FXTB 4TV3A 2N0SB 3ZKJC 1IBXB 3X23A 4US9A 4ZHPA 2KMAA 4MEMA 4W9LA 2IY1B 3EFUA 2FCSA 2TSSA 2W9NA 3SD5A 1ZPSA 1HQRD 2LI5A 2LGSA 4LNFA 4NQLB 2PE6B 1ESFA 2IO2B 1V8CA 1WR1A 4K1RB 4N6EB 2N9LA 3NJTA 1WWTA 4MDKE 3AEFB 2LD9A 2K8BA 2FE8A 3KYCD 1JWUD 1EO6A 4WJOA 3ZNZB 1E7UA 4WQMA 3KH0A 1F2RC 1KM7A 5EDSA 2EKIA 2I1JA 1CQVA 3I63C 2HTHA 2JU6X 2MW5A 5HHDG 3A9KB 4GIVA 1I35A 2PEAA 1IPGA 2IY0B 4MM3B 3DHHC 3N32A 1TT5B 3DQVA 1WGRA 2W3SA 2WYQA 2R2OA 2D10A 3UF8A 2K9XA 1V1OA 5FK9C 2JQRB 3Q69A 2FCQA 1FRDA 2REXA 3PRZA 4YSXB 2WDRB 3M95A 5D6JB 3GOEA 1P9DU 1RYJA 3NVYA 2V3NA 3AECB 1I4RA 4HROA 4WJNA 3JVZX 3RD2A 3UQAA 2MCNB 4HDQA 4EE2A 3W5VB 2KTRA 1IBXA 3PGEA 3QK0A 1DGJA 2BYFA 3B9JA 2Y5PA 5AZHA 1JWSD 4KKJA 2Z8LA 2JZ3B 3EUB2 2KJHB 2MBHA 1LQBA 1WJNA 4PS8A 1D5ZC 1ET9A 1XLOA 5H92C 5DPSA 2XN9C 2AEHA 3RNBC 1NI3A 3Q8CA 2DYMA 1SJHD 3BY4B 4BOSC 5BMIA 3W9CB 4X57B 4FBJB 3DVNU 2LWPA 3U7DA 1UGMA 5BMGA 5JZEB 4YTMB 3AU4A 1PQSA 1ZUD2 2AYOB 2KZRA 2GOWA 2DENB 2NTTA 2QEJC 2JZZA 3QA8A 4DXGA 3ZJTA 4P1CC 4RF0A 4XDCA 1MI0A 2LJIA 2O2VA 3MJWA 1FIQA 2BPSA 3R8BA 2OEDA 2NS5A 1CJEA 1I4PA 1L0VB 5AEKB 3ZXVA 1C77A 4IM3A 3BYTB 1RLFA 2N9XA 3OAWA 1BXTA 3VRAB 2QILA 1T3QA 3B1LX 3RUIB 3BIID 4EKUA 2L1AA 3HHMA 3ZDMC 2WXLA 1VZ7A 4RGMA 2MJ3A 4RNAA 4BVUC 4MGZE 4LLGM 1TY2A 2KQ7A 4M00A 1DOYA 2K6DB 1R4MB 1UBIA 2RSUA 4IM0A 1GC7A 1UZXB 4IWPA 2JX5A 4GN1A 1J0GA 2M56B 3ENEA 3MC9A 3H7PB 2YLMA 2Y5CA 2CU1A 2O6VD 3BVMA 3PS6A 3AN1A 5J2RA 2KTRB 1P3QU 1SSNA 3GP7A 1HZ6A 1XCTL 1F9JA 2GBMA 1TBEA 2INPE 1XLNA 4EEWA 3R2IA 3EC8A 4E71A 4NAWB 5GMVA 2MQJA 4URKA 2PPHA 2L8JA 3H6NA 2L52A 3IAM1 1WGDA 1IGCA 2KN4A 1Y56A 4LJPB 2DAFA 1AW7A 1JWMD 2QIEB 2L76A 3B2FA 3GE8C 1UWMA 3H7SA 1F52A 2BB6A 1JALA 3M63B 3L10B 2NBUA 2RMMA 4WJQA 1IGDA 3C19A 2WXGA 2HE7A 4BKSD 2BKRB 4TMAB 2W55A 4W9EA 3ZW3A 3PHWB 5I4DA 4CQNA 2KDMA 2OOBB 2IGDA 3ZO5B 1JWBD 1TZ1A 2K8CA 1XCQL 2XK5B 4LNOA 4XDDA 1T6BX 3Q3FA 3IXSA 3APDA 5HKHA 3FC4A 1XF5L 2Z59B 4M01A 1R4MI 2LGXA 3I5JC 1I4QA 3IAS1 2L83A 3SFDB 1RFKA 4B95A 2ZCBA 4DHJB 3PLVA 1WZ3A 2HTME 2MSED 1ZXIA 3AE3B 4HJKA 3O65B 2L7RA 4B0MA 4DXFA 1CZPA 2BQQA 1JW9D 3PT2B 2I1KA 1M94A 2AQ1B 2M0XA 2D2QA 1M4VA 4LDTB 2FIDA 4KDIC 1WXSA 3KLSX 3GZNB 3QWZB 4BFRA 5IOIA 2MP2B 1PGXA 3TEYA 2I2YA 2A4ZA 2DLBA 3ZGZA 4FHKA 2KJ6A 3DHIC 2GBNA 1FO4A 3H8HA 1KF6B 4KDLB 4GU2A 2GB1A 2YEPF 4N59A 5LXIB 1C9FA 2NCNA 3UINB 1HA5A 1XD3B 2KFJA 3NVWA 2WQYB 1DOXA 2M8SA 2WWZA 3TIXA 3CSTA 4PS3A 3SFEB 2XBBC 4G50A 2J52A 1JMLA 1EF1A 2CJOA 1TKYA 3ZQ4A 2IO0B 3P63A 3K9OB 1E0ZA 2BBCA 4C7ZA 2XEWA 4WWOA 4TSSA 3T3NA 1ZDXA 4Q2JA 4TQ0A 1Z5SB 3DVGY 1FNVA 4PYZA 4KGTA 1OTRB 1UNSA 2KD0A 4ZRPA 1EM7A 3KQ4A 1KLGD 3N9YC 3RI7C 1C3TA 4C80A 4L23A 2EMTA 2K6QA 3QAQA 4P1BC 1XLQA 3WAMA 4K3BA 2KX0A 3OJ4B 2HD5B 4DHZE 2JYTA 1VLBA 1WE6A 3V62A 2DYOA 2JUOA 3AXCA 3KUCB 1ZXHA 1EWYC 1T0QC 4IM2A 1SBBB 2LGIA 3RNGC 2J42A 1WXAA 2DNFA 2Z0EB 4OZBA 4I6LB 1KFYB 2WU2B 2LGYA 1EU4A 3OJ3A 2WGSA 3ZXRA 4M8NA 4MSQB 2WXFA 2MEKA 1IYFA 1C79A 1MHXA 2IO1B 2NMQA 2W3RA 3L16A 2DWQA 3U4EG 2INNE 4HEA1 1WYWB 1IP9A 2BYTA 3VUYA 2UU7A 3A4SC 4I6PA 5D94A 2W82A 3N1ZC 1Q10A 2HJ8A 3WA0A 5HI1A 4KIKA 3JW0X 1TY0A 1UF0A 2VH1A 3RYTA 2V3PA 4H2AA 1YX5B 2VH2A 1QZEA 3DBSA 4JL9A 1Q1OA 4RCOA 1GB4A 3PZDA 4M0WA 4WWMA 3PSEB 3KVFB 3MTNB 4IOIE 3ZRFA 4ITKA 4KSLC 4KX6B 2K22A 3U8ZA 3R3MA 1N5XA 2K39A 1MG4A 4NAMA 4II3B 2KDEB 4ZDVA 2C7NB 4O1NA 3KUZA 3VFKA 3WCQA 3Q8AA 2V4IB 2QJLA 3ETRA 3WANA 2KC1A 1JROA 1VZ8A 2INDC 5G55A 4DHZB 1WGGA 1T0SC 1MFWA 1QOFA 4K7WA 1AYFA 2LJ5A 4GXBA 2D3CA 1OGWA 1WM2A 2B3AA 3EA6A 5C2TB 3E9SA 3PLUA 4LCDE 3QJZA 1FFVA 1A70A 2DAJA 4NJ6A 5JHAA 3AEEB 1XEEA 4C00A 2WXKA 3VHTC 3ZJUA 4HJGE 2BYEA 5EE3A 2RPQA 2HJ1A 3AE1B 4BKSA 1K53A 3NOBA 4W9FA 3LYYA 4KZ0A 2C7HA 2KANA 3VH3B 1KJTA 3N30A 3I57A 4MGIE 2FCNA 3Q14C 1C4PA 1QOAA 3TL5A 5FR6A 1TGZB 2RR9A 2BVCA 2BKFA 3DWGC 1NENB 2QC8A 1VJKA 4MGYE 2LXCA 4ZOHC 2WS3B 1R4NB 1FNWA 2MH7A 5G5HA 1S1QB 2RDHA 3R7RA
chains in the Genus database with same CATH topology
1SEBD 2RPVA 1BXTA 4L1BA 3VRAB 1FD6A 2QILA 1T3QA 3ZJVA 1TZOA 3P4PB 3BIID 3IT4B 3E56A 1I4HA 3P4QB 2M0AA 4UDUC 2L1AA 4MH8A 2IGHA 2AX5A 2WXLA 2JZPA 4US8A 1C4AA 4AQ7A 1C78A 1VZ7A 2K5PA 1AN8A 3AE9B 4RGMA 2MJ3A 2PTLA 4RNAA 1B9RA 4LLGM 1TY2A 1YJIA 2VZKB 2BB5A 1ACCA 1FFUA 1SIJA 4C7YA 1DOYA 4XWTA 1L0XB 2R61A 5E6JA 3HUIA 2WXQA 2JX5A 4OVZA 3U2SC 2M56B 5MPOA 2AQ3B 3BVZA 5LNK1 2I38A 2N9KA 2Y5CA 1I4XA 1P7FA 1YJJA 3BVMA 4HRSA 3AN1A 3GB1A 4JWSC 2WDQB 2Q5WD 1SSNA 2IDYA 3BK2A 3GP7A 1C76A 1SJED 1HZ6A 1XCTL 4WH4A 1YQ4B 2W54A 3AH7A 4HKQA 1HZ5A 2INPE 1XLNA 2BTEA 2H88B 1JQ4A 2PVOD 3R2IA 4A55A 3LB8C 4NAWB 2HDEA 2ON8A 3CIRB 3Q8EA 3MFGA 2WP9B 3TEWA 5D3DA 3P4SB 1XO3A 3TEXA 3Q8FA 2WXPA 4NJCA 2WXHA 2Y3AA 2JYEA 2L52A 3IAM1 4GLSC 1NYQA 3VQIA 3URYA 1IGCA 3AE5B 3P4RB 5FKAC 2KN4A 5FR3A 1UWXA 3RPFC 1Y56A 4RGOS 5BYSA 2E6XA 4YWGG 4WIPA 1PUTA 2IJ0A 1AW7A 1JWMD 2QIEB 3AE8B 3PO0A 3B2FA 3U52E 4P16A 1TS2A 1UWMA 1I7HA 2BB6A 3BK1A 2CJNA 1TJEA 3FILB 1JALA 1P7EA 3L4PA 2KQ4X 2RMMA 1IGDA 3NUHB 1FMAD 2WXGA 3DWMA 2GRIA 1OQQA 3Q8BA 2QSDA 3BZDB 4XWWA 4TMAB 2W55A 5I4DA 4CQNA 4P6VF 2KDMA 2IGDA 1JWBD 3T3OA 1FM0D 1ROEA 1XCQL 5TSSA 1ZP0B 4FXCA 1HEZE 4R3DA 4XDDA 5AUKA 1DOIA 2KMMA 1T6BX 4PT5A 2QMTA 1YN3A 3IXSA 3CWIA 1L4ZB 4REZA 1TS4A 2WXNA 4ARCA 3FC4A 1D5MC 1XF5L 2MJEA 4JX1C 4KGSA 3MC0B 5HFYA 2WXRA 1JRPA 1SE3A 4RH6A 1WSPA 2BS4B 4AS1A 1I4QA 3IAS1 2L83A 4KGRA 2KWDA 3SFDB 1RFKA 3O13A 3V3XA 2ONQA 3AE7B 1LO5D 2HTME 2XNAC 1E6EB 1K51A 3AE4B 4YXDB 1ZXIA 2M19A 1JCKB 4JWUC 3AE3B 3PZ7A 2ZW0A 4B0MA 4DXFA 1CZPA 1N60A 5BYQA 1GAQB 1JW9D 1F2RI 3SR6A 2BW2A 1QOGA 2AQ1B 1M4VA 1E9MA 3VRBB 3AB5A 3KLSX 3TEZA 1N62A 4RFBA 1V1PA 1ZDVA 5C3JB 2K3UA 3W1SA 1PGXA 5D3IB 4KKIA 4OZCA 1B1ZA 2DLBA 3TEYA 4L2YA 5D7GA 2I2YA 3ZGZA 3MP9A 4ZHOA 2H89B 2G1EA 2B76B 4N58A 1VRAB 1L6VA 1FO4A 3H8HA 1KF6B 5BMHA 3PZ8A 1IUEA 2JWUA 1KRHA 1QT9A 4RF1A 1C4CA 5GXGB 4LTUA 2ZW1A 1ENFA 2GB1A 4MACA 3BWUD 2YEPF 3W5UB 4N59A 2WXMA 5EE0A 1C9FA 3LXFA 1HA5A 2D5GA 1WRIA 2WQYB 3NVWA 1DOXA 2OHFA 1FRRA 1RM6C 2BT6A 2CU3A 2FUG1 2JXTA 1RWSA 3SFEB 1F0ZA 1GB1A 3FAHA 1N5WA 1ET6A 3OWEB 4JE3B 4DQOC 2J52A 1JMLA 4TQ1A 1QLBB 2CJOA 5T8IA 3NRZA 1OQRA 1UGJA 2PMVA 1TKYA 2G9HD 1SE2A 3AEDB 3ZQ4A 4A6QA 1L4DB 3P63A 1QILA 1L0YB 1E0ZA 2BBCA 4C7ZA 2WLBA 1YMHE 4RGNA 1YN5A 4TSSA 3P42A 3T3NA 3R2TA 1SF0A 1ZDXA 3HRDD 3AMZA 2PLPA 4Q2JA 1TKEA 1OFFA 4TQ0A 1FEHA 1V97A 1E10A 1SXTA 1FNVA 2E3TA 3AE2B 1UNSA 3AV8A 4KGTA 1BMLC 1L5PA 4ZRPA 3NZ3A 2VZKD 4MT5A 2V0GA 4ZYSA 1EM7A 3KQ4A 1KLGD 3MJ5A 3N9YC 2GI9A 1VZ6A 2BS3B 1J7CA 1PDXA 1VDVA 1FNUA 3HVDA 2WXJA 4C80A 4OHJA 4L23A 1JWAD 1XLQA 3HVZA 1YN4A 5EE1A 2L32A 3J9CA 1QQRA 4A8XC 1SE4A 4GDKB 2JYTA 4J3OD 1VLBA 1YNTE 3I9V1 2LMCA 2LHDA 2DYOA 4YTNB 1R7SA 2J4XA 2N0SB 1KH0A 1IBXB 1D6EC 4D2KA 1QKZA 4IDIA 4US9A 4ZHPA 1ZXHA 1EWYC 3AEAB 1SBBB 2LGIA 1ZOYB 3MHZA 1EU3A 2J42A 1AWDA 2NTSA 2TSSA 1ZPSA 1HQRD 4OZBA 1KFYB 1ESFA 2WU2B 1K52A 1V8CA 1EU4A 3AE6B 1K50A 4N6EB 1NEKB 2N9LA 1WWTA 3UI3A 2WXFA 2MEKA 3AEFB 1C79A 1MHXA 1MVKA 1TKGA 2AQ2B 3W2DA 2NMQA 5HG2A 2W3RA 2DWQA 3U4EG 2INNE 4YSYB 3GS2A 2FE8A 1JWUD 2YEPB 1KTKA 1N61A 1TYGB 4HEA1 2PVGC 3AEBB 4WQMA 5JXVA 3AM9A 2WXOA 2BYTA 1F2RC 5H8YE 3ZYYX 1SB3C 1DYQA 1EWCA 1PGAA 2W82A 1NYRA 5EE9A 2EKIA 1Q10A 4YTPB 5HI1A 1CQVA 1QF6A 3RFZB 2EELA 4WURA 1TY0A 2LFIA 3TUOA 2JU6X 2V3PA 4A90A 2PIAA 5HHDG 4H2AA 2LEKA 3VR9B 1KLUD 1V1PB 3P1MA 1D5XC 4MM3B 4YT0B 4RCOA 1GB4A 2WXIA 4B0EA 4XE0A 4M0WA 4WWMA 1TS3A 1E7PB 2WDVB 4IOIE 2W3SA 3ABVB 4ITKA 4KX6B 3V05A 2K22A 3AEGB 2K9XA 1V1OA 2MJDA 3TSSA 1N5XA 5FK9C 2JQRB 4NAMA 2FBWB 3Q69A 1FRDA 1BUIC 2BS2B 4USAA 1TS5A 3BYYB 4YSXB 2WDRB 4NZLB 2WNMA 1J7AA 3KWVA 4O1NA 2J53A 1FXIA 3WCQA 1RYJA 3KWLA 2V4IB 2QJLA 3ETRA 3NVYA 2V3NA 3AECB 3NS1A 3Q8AA 1I4RA 1JROA 4HROA 1VZ8A 5AUIA 1CK1A 2N7JA 2ICIA 4EE2A 4JPSA 3W5VB 1XXGA 3SEBA 1N63A 1IBXA 2X38A 1F77A 1DGJA 4OZAA 3B9JA 2Y5PA 1QOFA 4YSZB 1AYFA 1JWSD 1T5XD 4KKJA 1PGBA 1WXQA 3C8YA 2KAJA 2Z8LA 5BYRA 3EUB2 5G5GA 3EA6A 1STEA 3U7ZA 1D4BA 1UUPA 5C2TB 4ARIA 2SAKA 3E9SA 1PYWD 1D5ZC 3B2GA 1QOBA 1ET9A 1XLOA 5H92C 4A9AA 2XN9C 1FFVA 1NI3A 2LHEA 2IGGA 1A70A 3VR8B 3Q8CA 2DYMA 2SEBD 4IKGA 4RGTA 2ACZB 2LUMA 3AEEB 1SJHD 2WU5B 2IPKD 3IT6B 3W9CB 5BMIA 1GOZA 1XEEA 1L6UA 2WXKA 1J7BA 5BMGA 2DBYA 1XLPA 4YTMB 1FCCC 1ZE3D 1ZUD2 1FCLA 3ZJUA 4HJGE 2NTTA 2PW9A 5EE3A 2QEJC 4C56C 3AE1B 1HXYD 1K53A 1YQ3B 2JSVX 3LYYA 1WYGA 1PFDA 1I4GA 1NVID 4DXGA 3ZJTA 4RF0A 3BVGA 4XDCA 4ZRQA 1MI0A 2LJIA 2RDGA 3I57A 1GPXA 1WGKA 1C4PA 1QOAA 1FIQA 3NVVA 1MPEA 4GDLB 3DWGC 2K0PA 2OEDA 3R8BA 4LK0M 1NENB 1CJEA 1VJKA 1I4PA 1L0VB 4ZOHC 1C77A 2KACA 2WS3B 3NVZA 4WAFA 1FNWA 1FXAA 3FILA 3EGRA 3BYTB 4HKZE 2MH7A 5G5HA 1VR9A 4OW0A 1MHHE 2RDHA 2PKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM7 A;  2RPV A;  2GI9 A;  1FD6 A;  2QMT A;  1XF5 L;  4KGS A;  5HFY A;  2J53 A;  2IGH A;  2JZP A;  4KGR A;  2KWD A;  2PTL A;  3V3X A;  2ONQ A;  1YNT E;  2N7J A;  2LHD A;  1K51 A;  1KH0 A;  1IBX B;  1IBX A;  4D2K A;  1QKZ A;  2ZW0 A;  4OZA A;  1ZXH A;  1PGB A;  1F2R I;  2LGI A;  2I38 A;  2N9K A;  1P7F A;  3GB1 A;  1D4B A;  4OZB A;  1K52 A;  1HZ6 A;  1XCT L;  1PGX A;  4WH4 A;  4OZC A;  2I2Y A;  1K50 A;  2LHE A;  2IGG A;  2N9L A;  3MP9 A;  1HZ5 A;  3UI3 A;  4IKG A;  1MHX A;  1MVK A;  2LUM A;  5BMH A;  5BMI A;  2ON8 A;  2NMQ A;  2JWU A;  5HG2 A;  5BMG A;  2ZW1 A;  1FCC C;  2GB1 A;  4MAC A;  1FCL A;  4HJG E;  1C9F A;  4GLS C;  2PW9 A;  5JXV A;  1IGC A;  1F2R C;  2KN4 A;  1K53 A;  1UWX A;  2JSV X;  1PGA A;  2JXT A;  1GB1 A;  1Q10 A;  5HI1 A;  2J52 A;  1JML A;  2EEL A;  3FIL B;  1P7E A;  1MI0 A;  2JU6 X;  2KQ4 X;  5HHD G;  2RMM A;  1IGD A;  1MPE A;  2K0P A;  2OED A;  1YMH E;  2QSD A;  1GB4 A;  2KAC A;  2KDM A;  2PLP A;  4IOI E;  2IGD A;  3FIL A;  4KGT A;  4HKZ E;  1XCQ L;  1MHH E;  1HEZ E; 
#chains in the Genus database with same CATH topology
 2RPV A;  4L1B A;  1KLV A;  3ZJV A;  1TZO A;  1ZGU B;  4ZYN A;  4IWQ A;  3E56 A;  1Z2M A;  3P4Q B;  2V9H A;  2D3B A;  4US8 A;  4AQ7 A;  2JZP A;  1C4A A;  3PHX B;  2LZ6 A;  1C78 A;  2PTL A;  1YJI A;  3QQ8 B;  4IUM B;  4XGA B;  3BVZ A;  1WGY A;  2KOX A;  5LNK 1;  3PVL A;  4RM8 A;  3Q2A C;  1I42 A;  3DDC B;  3R66 C;  3BK2 A;  2W54 A;  4A20 A;  2LGD A;  3DPD A;  4HKQ A;  1HZ5 A;  4MJS A;  1FPY A;  2BTE A;  1JQ4 A;  2PVO D;  2KHW B;  3WIM A;  4K81 A;  3Q8E A;  3MFG A;  1WJ6 A;  2WP9 B;  3TEW A;  5D3D A;  1XT9 B;  1WRD B;  3P4S B;  1XO3 A;  4JGH B;  3TEX A;  4NAW A;  4NJC A;  2BYV E;  2JYE A;  1NDD A;  1V5T A;  4I6N B;  2KXJ A;  3L17 A;  1WJU A;  3IG3 A;  3HM6 X;  2E6X A;  1PUT A;  2C9W B;  2CHW A;  1GC6 A;  5L83 A;  1I7H A;  5AZF A;  3VTU A;  1L7Y A;  4CHK A;  2NBW B;  3NUH B;  3RMK C;  3DWM A;  1OQQ A;  3BZD B;  4LNK A;  4P6V F;  4DBG A;  3T3O A;  1FM0 D;  1U4A A;  4BAX A;  2MRP A;  1HEZ E;  2CR5 A;  2RDB C;  4HVB A;  2WX1 A;  5AUK A;  2KMM A;  5IKC M;  3A9K A;  1YN3 A;  1L4Z B;  1TS4 A;  4KVG B;  2WXN A;  1D5M C;  4KGS A;  3RNC C;  1S3S G;  3RZW C;  2WXR A;  2N7E A;  1SE3 A;  4RH6 A;  4C4V A;  2BS4 B;  4AS1 A;  2KWD A;  2JXX A;  3RNE C;  3KUD B;  1V6E A;  3PV1 A;  1LO5 D;  2D3G A;  1K51 A;  2NBV B;  2KTF A;  5AZG A;  4IWO A;  4M8M A;  2ZW0 A;  4HK2 A;  1GAQ B;  3ECI A;  1F2R I;  3RT3 B;  4N9F 4;  1V80 A;  3TEZ A;  1N62 A;  4AJY B;  2NPT A;  2M17 A;  5C3J B;  2G4S A;  4KKI A;  1F1H A;  1B1Z A;  4OZC A;  5D7G A;  3ZNH B;  3MP9 A;  4ZHO A;  3DBR B;  2YVC A;  2A5U A;  5DCN A;  3PZ8 A;  4TKN A;  4E74 A;  2JPH A;  3DVG X;  1QT9 A;  4RF1 A;  1C4C A;  4MAC A;  3BWU D;  3B08 A;  4XYC A;  1NBF C;  3OG5 A;  3Q3N C;  4FN2 A;  1WY8 A;  1RM6 C;  2BT6 A;  2CU3 A;  2NVU I;  4GMV A;  4PK1 A;  3RZF A;  2MBO A;  1N5W A;  1ET6 A;  3ZTC A;  1UBQ A;  2KYW A;  3OWE B;  1ISN A;  3ZVV A;  4IC7 B;  4ACF A;  1X1M A;  3NRZ A;  1UGJ A;  1G6J A;  1L2N A;  2MP2 A;  2KLC A;  4A6Q A;  1L4D B;  5CHF A;  2ZNV C;  2LVP A;  1L0Y B;  1YMH E;  4RGN A;  5IP4 D;  3WAP A;  3UGB B;  1YN5 A;  5DPT A;  2MX2 A;  4EUT A;  1SF0 A;  3HRD D;  2PLP A;  1TKE A;  4ZRI A;  1SXT A;  1WM3 A;  3AE2 B;  3AV8 A;  1L5P A;  2V0G A;  1FNU A;  3HVD A;  1YIW A;  5EE1 A;  1YN4 A;  2L32 A;  3J9C A;  2J0J A;  4A8X C;  1SE4 A;  3EFC A;  1N6Z A;  1YNT E;  3I9V 1;  4TUU A;  3RUL A;  2LHD A;  4YTN B;  3PTF C;  2J4X A;  1KH0 A;  2JT4 B;  3TCA A;  1HTQ A;  1D6E C;  4ZRK A;  3AEA B;  1ZOY B;  3MHZ A;  3VTW A;  1MJD A;  1J8C A;  2BWE S;  4DDI D;  3A1Q A;  1NEK B;  3T9L A;  3UI3 A;  1TKG A;  1E7V A;  2AQ2 B;  1SIF A;  2BWF A;  2O6V A;  5J17 A;  4BOZ B;  4YSY B;  3H9D A;  3JYU A;  4F7Z A;  3BIN A;  2YEP B;  2KN5 A;  2PVG C;  3AEB B;  3VVW B;  4WQO B;  5JXV A;  1T0R C;  1TTN A;  1DYQ A;  1EWC A;  1NYR A;  4YTP B;  4F8C B;  4BBN F;  2LVO A;  3RFZ B;  3CF6 E;  2NR2 A;  4A90 A;  4HWI B;  2LEK A;  3VR9 B;  5C1Z A;  1KLU D;  1V1P B;  3V6E B;  3P1M A;  1D5X C;  4YT0 B;  1WX9 A;  4B6W A;  4GGQ A;  2C5L C;  4XE0 A;  1CMX B;  4GB9 A;  2MBQ A;  1BT0 A;  3ABV B;  3SHQ A;  3DBR I;  1YQB A;  2N9E B;  2UWQ A;  2INC C;  2ZJD A;  1BUI C;  1TS5 A;  3BYY B;  3LJ3 A;  2O2V B;  4NZL B;  2WNM A;  4DK5 A;  1FXI A;  3KWL A;  3NS1 A;  1WMH A;  5AUI A;  2J0K A;  2N7J A;  3H1U A;  2ICI A;  4MH0 E;  1V9J A;  4WWP A;  3SEB A;  1N63 A;  2X38 A;  2ZVO A;  3JSV A;  1F77 A;  5E6N A;  4YSZ B;  1WF9 A;  3FKY A;  3C8Y A;  2KAJ A;  2IO3 B;  5G5G A;  5LXH A;  1STE A;  3A4R A;  3U7Z A;  1D4B A;  1UUP A;  2SAK A;  1SE9 A;  3QAR A;  4GOC A;  2KFK B;  3VUW A;  4A9A A;  1R4N I;  2MHJ A;  5IA7 A;  4W9D A;  3V60 A;  3APF A;  2SEB D;  2C7M B;  2LUM A;  2WU5 B;  2IPK D;  1RAX A;  1GOZ A;  1L6U A;  2KWC A;  2IYD B;  2DBY A;  1XLP A;  4EZL A;  1ZE3 D;  2J7Q B;  3OLM D;  2PW9 A;  3EHV A;  4A3P A;  1HXY D;  1YQ3 B;  2UYZ B;  1NVI D;  3UQB A;  2V3S A;  1WE7 A;  2KWV B;  3AU5 A;  4K7U A;  1WGK A;  3ZNG C;  3K9P B;  3UIO B;  2K0P A;  4LK0 M;  2OJW A;  1WX7 A;  3WAL A;  4WAF A;  1JRU A;  4PS7 A;  2LRU A;  3EGR A;  1VR9 A;  3PRP B;  4K7S A;  2PKO A;  5BO4 B;  2DHZ A;  2K1F A;  2VRR B;  1HE8 A;  4HCN B;  2DZK A;  2M0A A;  4UDU C;  2IGH A;  3ZRC A;  4A3O A;  4NNJ B;  2JVC A;  1B9R A;  2DYB A;  1WXM A;  4JLC A;  3DCG A;  2BB5 A;  1SIJ A;  1V2Y A;  4BKG A;  1L0X B;  2MLB A;  2G3Q B;  2QDF A;  2R61 A;  1V49 A;  3HUI A;  3AUL A;  3QC8 B;  1LGR A;  2DZI A;  2AQ3 B;  5JH5 C;  1MG8 A;  5G2N A;  2I38 A;  3Q6B A;  1WH3 A;  1I4X A;  1WI0 A;  3N3K B;  1P7F A;  1YJJ A;  4JWS C;  2WDQ B;  2Q5W D;  3H7P A;  1SJE D;  2JY6 A;  3RNF C;  2KNB A;  4WH4 A;  1WMH B;  3AH7 A;  3V61 A;  3SDL C;  4A55 A;  3LB8 C;  4AJW A;  3CIR B;  4NQK E;  3RN9 C;  1ZW7 A;  1E8X A;  4FJV B;  3Q8F A;  3V6C B;  2WXP A;  5CHV C;  2KLG A;  3IHP C;  3GZN I;  2WXH A;  2Y3A A;  2KQS A;  3VQI A;  2JF5 A;  1GNU A;  1E90 A;  2Z0D B;  5FR3 A;  1WJ4 A;  3RPF C;  4RGO S;  5BYS A;  2C60 A;  4YWG G;  3PO0 A;  3U52 E;  1TS2 A;  2RD0 A;  3FIL B;  1TJE A;  3L4P A;  3LDZ E;  1C1Y B;  2OJR A;  3B0A A;  4M02 A;  4IG7 B;  3A33 B;  4KSK C;  4F1S A;  4MSM B;  1YX6 B;  5C23 A;  2QSD A;  4K3C A;  1Q5W B;  4WJP A;  1ROE A;  3DBL B;  3Q3O C;  4G0N B;  2V4L A;  1ZP0 B;  4CO7 A;  4R3D A;  2KVZ A;  1DOI A;  4PT5 A;  3CWI A;  2MJE A;  3APC A;  2KMC A;  1JRP A;  3NZU A;  3TMP B;  3O13 A;  3A1Q B;  4ZRJ A;  3AE7 B;  5DPW A;  5IO9 A;  2XNA C;  3AE4 B;  4YXD B;  2JRH A;  2AL3 A;  1N60 A;  1UH6 A;  5BYQ A;  4XC2 A;  3SU8 X;  5J18 A;  2BW2 A;  1J19 A;  1E9M A;  3AB5 A;  2QHO A;  3A9J A;  4ANV A;  4RFB A;  2L00 B;  1ZDV A;  2K3U A;  2X8X X;  3VUX A;  4FHJ A;  5D3I B;  3M62 B;  2ZZP B;  4L2Y A;  4G11 A;  2G1E A;  1VRA B;  1L6V A;  3PRM B;  1IUE A;  2EMS A;  5IN7 A;  4GSW A;  4DWF A;  5GXG B;  2ZNV B;  3VDZ A;  4LTU A;  3M3J A;  3QX1 A;  4HXD A;  3Q3M C;  3W5U B;  2D07 B;  3NZS A;  5EE0 A;  2GBJ A;  2OHF A;  3NG0 A;  2JXT A;  1F0Z A;  1GB1 A;  3FAH A;  4G3X B;  2ASQ A;  4WWN A;  4DQO C;  2R2Q A;  3DOW A;  1H8C A;  1QLB B;  2CHX A;  1GUA B;  3ALB A;  4LNN A;  2N1V A;  2PMV A;  5JHB A;  2FNJ B;  1QIL A;  2FIF A;  1UD7 A;  2RGF A;  4W9G A;  3P42 A;  3Q3J A;  4XZ4 A;  3AMZ A;  2L3Z A;  1OFF A;  4EFO A;  1V97 A;  3R7Q A;  4DXA B;  3IVF A;  2KX3 A;  3MJ5 A;  3MHS D;  4RM9 A;  1J7C A;  1VDV A;  2WXJ A;  5DPR A;  4OHJ A;  1UEL A;  3VAW A;  4S0R A;  3HVZ A;  5TR5 A;  2JWZ A;  2AWT A;  1E8Z A;  4HPP A;  1LFD A;  1AAR A;  2L0T A;  4GDK B;  4II2 B;  3ZDT A;  2N7D A;  1OQY A;  2FUH B;  1R7S A;  1K8R B;  4D2K A;  4W9H A;  1QKZ A;  4IDI A;  3ML8 A;  3IFW B;  1EU3 A;  1AWD A;  3C0R B;  3MC8 A;  2NTS A;  2KJR A;  5CTR C;  1K52 A;  3ZNI D;  4FJZ A;  1P0R A;  2GBR A;  3AE6 B;  1K50 A;  3D32 A;  4OVU A;  4ANX A;  3RNA C;  1MVK A;  3IBE A;  3HK0 A;  4FA6 A;  3W2D A;  2LVQ A;  5HG2 A;  3U30 A;  3L13 A;  1WR6 E;  3GS2 A;  2O6V B;  2QCZ A;  3EEC A;  1KTK A;  1N61 A;  1TYG B;  1WGH A;  3DBH I;  2ZPN A;  2MBB B;  3AM9 A;  2WXO A;  1YD8 U;  5H8Y E;  3ZYY X;  1SB3 C;  5IAA C;  1PGA A;  4W9I A;  5EE9 A;  1QF6 A;  1WIA A;  2EEL A;  4WUR A;  2M1M A;  3GE3 C;  4MGK E;  2LFI A;  2WHI A;  3TUO A;  2PIA A;  3P2B A;  4P7I A;  3A9J B;  4C4V B;  2V1Y A;  5L95 C;  2WXI A;  4B0E A;  3ML9 A;  2D11 A;  1TS3 A;  1E7P B;  3WAO A;  2WDV B;  3V05 A;  3NHE B;  3AEG B;  3AI5 A;  3TSS A;  2MJD A;  4FUL A;  2FBW B;  1GG3 A;  4IW0 A;  2BS2 B;  4USA A;  1YJ1 A;  2KVR A;  3KWV A;  1J7A A;  4KZC A;  4EZJ A;  1A5R A;  2J53 A;  2L0F A;  4LJO B;  1E5W A;  4NY0 A;  2LXA A;  1CK1 A;  2DZJ A;  3N1X C;  2BF8 B;  4JPS A;  1XXG A;  4OZA A;  3I3T B;  1P1A A;  2KDF B;  1T5X D;  1PGB A;  3N20 C;  1WXQ A;  2N1W A;  1SGH A;  1ZKH A;  3DHG C;  5BYR A;  4JQW C;  4W9J A;  2XK5 A;  3CSF A;  1V86 A;  4XX5 A;  4ARI A;  1PYW D;  3B2G A;  1QOB A;  1VCB A;  2PJH A;  5CX3 A;  2FCM A;  4PYU A;  2LHE A;  2IGG A;  4HDO A;  3VR8 B;  4IKG A;  4RGT A;  2ACZ B;  3IT6 B;  4KV2 A;  1J7B A;  1NI2 A;  4LNI A;  1E8W A;  1FCC C;  5D2M B;  1FCL A;  2CHZ A;  4C56 C;  2JSV X;  4ANU A;  1WYG A;  1PFD A;  1I4G A;  4AWJ A;  2GLS A;  4MJS B;  1Q0W B;  3BVG A;  2MA9 B;  2CKH B;  4ZRQ A;  2LRW A;  2RDG A;  4BBN C;  3QIJ A;  1GPX A;  1HTO A;  3NVV A;  3DBH B;  1MPE A;  4GDL B;  2AL6 A;  2BGF A;  2KAC A;  3NVZ A;  5LLI A;  4NJ7 A;  1FXA A;  4FJY A;  3UIP B;  3FIL A;  4HKZ E;  3L54 A;  2KK8 A;  4OW0 A;  1MHH E;  4NPN A;  1H4R A;  2CS4 A;  1SEB D;  2WDT B;  1FD6 A;  2ZVN A;  3ZLZ A;  3P4P B;  3IT4 B;  1I4H A;  2NPT B;  4MH8 A;  2AX5 A;  3S2A A;  1EUV B;  2K5P A;  1AN8 A;  3AE9 B;  4S17 A;  3X0W A;  3W1S C;  2VZK B;  1ACC A;  1FFU A;  4C7Y A;  2DZM A;  2IZV B;  4XWT A;  1P98 A;  5E6J A;  2WXQ A;  3TJP A;  4OVZ A;  3U2S C;  1RFA A;  4AUQ C;  5MPO A;  1D3Z A;  3KW5 B;  2N9K A;  4ASW C;  4HPM B;  4HRS A;  3GB1 A;  4RMA A;  2EKE C;  2IBI B;  5E6O A;  2IDY A;  1C76 A;  2GBK A;  4QAY A;  1LM8 B;  1YQ4 B;  2K8H A;  2ZEQ A;  4W9K A;  2H88 B;  2J0M A;  4FLH A;  1WX8 A;  4GDL A;  2HDE A;  2ON8 A;  1OEY A;  3NY5 A;  2LAS A;  4HPL B;  2G4D B;  4EZK A;  2N4F A;  4GLS C;  4CYE A;  1NYQ A;  3URY A;  3AE5 B;  3P4R B;  5FKA C;  1UWX A;  1YOV B;  2WX0 A;  4WIP A;  2IJ0 A;  4MEL A;  3AE8 B;  4P16 A;  1XQQ A;  3BK1 A;  2CJN A;  1P7E A;  4HLE A;  3DVN V;  2KQ4 X;  1VD2 A;  3T8M A;  4ICV A;  1WZ0 A;  1FMA D;  2GRI A;  3Q8B A;  4AOF A;  4XWW A;  3L08 A;  1V5O A;  1Y8R C;  2KDI A;  3HIZ A;  2MWS B;  4ANW A;  5TSS A;  4FXC A;  1WFY A;  1GJZ A;  3ZIM A;  2QMT A;  2KWU B;  4REZ A;  3NS8 A;  1EF5 A;  4ARC A;  2ZPY A;  3HM3 A;  4JX1 C;  5HFY A;  1RRB A;  3MC0 B;  4DDG D;  1WSP A;  4LDT D;  4KGR A;  2JRI B;  2K25 A;  4J6I A;  3VTV A;  3V3X A;  2ONQ A;  2DX5 B;  4W9C A;  1E6E B;  3RCZ A;  3W1Y A;  2M19 A;  4JWU C;  1JCK B;  3PZ7 A;  2Y5B B;  4YL8 A;  3CMM B;  1OEY J;  1T0Y A;  2FAZ A;  2KT7 A;  3SR6 A;  1QOG A;  3VRB B;  4AP4 C;  2M4N A;  3QCA A;  1V1P A;  3L0W B;  3W1S A;  2D3A A;  2H89 B;  3JSV B;  1TIF A;  4KIK B;  3DBL I;  2B76 B;  4N58 A;  1KOT A;  5BMH A;  2JWU A;  1KRH A;  3VH4 B;  2MBE A;  2ZW1 A;  1ENF A;  2WXM A;  3QHT A;  3LXF A;  3KYD D;  2KDB A;  5KHO A;  2D5G A;  1WRI A;  2GMI C;  1FRR A;  4JIO U;  2FUG 1;  1RWS A;  3N1Y C;  2PE9 A;  4M0W B;  4JE3 B;  4BKT A;  4TQ1 A;  2KKC A;  5T8I A;  1OQR A;  2G9H D;  1SE2 A;  3AED B;  4DHJ D;  3PPA A;  4OVV A;  1E8Y A;  2WLB A;  5E6P A;  4E3C A;  4HCP B;  3R2T A;  3VXW A;  3TBL D;  4ICU A;  1FEH A;  1E10 A;  3PRE A;  2E3T A;  2KFK A;  1BML C;  5KHQ A;  3NZ3 A;  2VZK D;  4MT5 A;  1WXV A;  4ZYS A;  1LXD A;  2KC2 A;  3ZTD A;  2L05 A;  2GI9 A;  1VZ6 A;  1V81 A;  2BS3 B;  4WAA A;  1PDX A;  2N9P C;  5CHW A;  4EOY A;  1JWA D;  2KO3 A;  2ZCC A;  3ONS A;  2LUE A;  1QQR A;  4MM3 A;  2G45 B;  4J3O D;  4B9K A;  4FAD A;  3ZUN A;  2LMC A;  4GDK A;  4BZA A;  1FXT B;  4TV3 A;  2N0S B;  3ZKJ C;  1IBX B;  3X23 A;  4US9 A;  4ZHP A;  2KMA A;  4MEM A;  4W9L A;  2IY1 B;  3EFU A;  2FCS A;  2TSS A;  2W9N A;  3SD5 A;  1ZPS A;  1HQR D;  2LI5 A;  2LGS A;  4LNF A;  4NQL B;  2PE6 B;  1ESF A;  2IO2 B;  1V8C A;  1WR1 A;  4K1R B;  4N6E B;  2N9L A;  3NJT A;  1WWT A;  4MDK E;  3AEF B;  2LD9 A;  2K8B A;  2FE8 A;  3KYC D;  1JWU D;  1EO6 A;  4WJO A;  3ZNZ B;  1E7U A;  4WQM A;  3KH0 A;  1F2R C;  1KM7 A;  5EDS A;  2EKI A;  2I1J A;  1CQV A;  3I63 C;  2HTH A;  2JU6 X;  2MW5 A;  5HHD G;  3A9K B;  4GIV A;  1I35 A;  2PEA A;  1IPG A;  2IY0 B;  4MM3 B;  3DHH C;  3N32 A;  1TT5 B;  3DQV A;  1WGR A;  2W3S A;  2WYQ A;  2R2O A;  2D10 A;  3UF8 A;  2K9X A;  1V1O A;  5FK9 C;  2JQR B;  3Q69 A;  2FCQ A;  1FRD A;  2REX A;  3PRZ A;  4YSX B;  2WDR B;  3M95 A;  5D6J B;  3GOE A;  1P9D U;  1RYJ A;  3NVY A;  2V3N A;  3AEC B;  1I4R A;  4HRO A;  4WJN A;  3JVZ X;  3RD2 A;  3UQA A;  2MCN B;  4HDQ A;  4EE2 A;  3W5V B;  2KTR A;  1IBX A;  3PGE A;  3QK0 A;  1DGJ A;  2BYF A;  3B9J A;  2Y5P A;  5AZH A;  1JWS D;  4KKJ A;  2Z8L A;  2JZ3 B;  3EUB 2;  2KJH B;  2MBH A;  1LQB A;  1WJN A;  4PS8 A;  1D5Z C;  1ET9 A;  1XLO A;  5H92 C;  5DPS A;  2XN9 C;  2AEH A;  3RNB C;  1NI3 A;  3Q8C A;  2DYM A;  1SJH D;  3BY4 B;  4BOS C;  5BMI A;  3W9C B;  4X57 B;  4FBJ B;  3DVN U;  2LWP A;  3U7D A;  1UGM A;  5BMG A;  5JZE B;  4YTM B;  3AU4 A;  1PQS A;  1ZUD 2;  2AYO B;  2KZR A;  2GOW A;  2DEN B;  2NTT A;  2QEJ C;  2JZZ A;  3QA8 A;  4DXG A;  3ZJT A;  4P1C C;  4RF0 A;  4XDC A;  1MI0 A;  2LJI A;  2O2V A;  3MJW A;  1FIQ A;  2BPS A;  3R8B A;  2OED A;  2NS5 A;  1CJE A;  1I4P A;  1L0V B;  5AEK B;  3ZXV A;  1C77 A;  4IM3 A;  3BYT B;  1RLF A;  2N9X A;  3OAW A;  1BXT A;  3VRA B;  2QIL A;  1T3Q A;  3B1L X;  3RUI B;  3BII D;  4EKU A;  2L1A A;  3HHM A;  3ZDM C;  2WXL A;  1VZ7 A;  4RGM A;  2MJ3 A;  4RNA A;  4BVU C;  4MGZ E;  4LLG M;  1TY2 A;  2KQ7 A;  4M00 A;  1DOY A;  2K6D B;  1R4M B;  1UBI A;  2RSU A;  4IM0 A;  1GC7 A;  1UZX B;  4IWP A;  2JX5 A;  4GN1 A;  1J0G A;  2M56 B;  3ENE A;  3MC9 A;  3H7P B;  2YLM A;  2Y5C A;  2CU1 A;  2O6V D;  3BVM A;  3PS6 A;  3AN1 A;  5J2R A;  2KTR B;  1P3Q U;  1SSN A;  3GP7 A;  1HZ6 A;  1XCT L;  1F9J A;  2GBM A;  1TBE A;  2INP E;  1XLN A;  4EEW A;  3R2I A;  3EC8 A;  4E71 A;  4NAW B;  5GMV A;  2MQJ A;  4URK A;  2PPH A;  2L8J A;  3H6N A;  2L52 A;  3IAM 1;  1WGD A;  1IGC A;  2KN4 A;  1Y56 A;  4LJP B;  2DAF A;  1AW7 A;  1JWM D;  2QIE B;  2L76 A;  3B2F A;  3GE8 C;  1UWM A;  3H7S A;  1F52 A;  2BB6 A;  1JAL A;  3M63 B;  3L10 B;  2NBU A;  2RMM A;  4WJQ A;  1IGD A;  3C19 A;  2WXG A;  2HE7 A;  4BKS D;  2BKR B;  4TMA B;  2W55 A;  4W9E A;  3ZW3 A;  3PHW B;  5I4D A;  4CQN A;  2KDM A;  2OOB B;  2IGD A;  3ZO5 B;  1JWB D;  1TZ1 A;  2K8C A;  1XCQ L;  2XK5 B;  4LNO A;  4XDD A;  1T6B X;  3Q3F A;  3IXS A;  3APD A;  5HKH A;  3FC4 A;  1XF5 L;  2Z59 B;  4M01 A;  1R4M I;  2LGX A;  3I5J C;  1I4Q A;  3IAS 1;  2L83 A;  3SFD B;  1RFK A;  4B95 A;  2ZCB A;  4DHJ B;  3PLV A;  1WZ3 A;  2HTM E;  2MSE D;  1ZXI A;  3AE3 B;  4HJK A;  3O65 B;  2L7R A;  4B0M A;  4DXF A;  1CZP A;  2BQQ A;  1JW9 D;  3PT2 B;  2I1K A;  1M94 A;  2AQ1 B;  2M0X A;  2D2Q A;  1M4V A;  4LDT B;  2FID A;  4KDI C;  1WXS A;  3KLS X;  3GZN B;  3QWZ B;  4BFR A;  5IOI A;  2MP2 B;  1PGX A;  3TEY A;  2I2Y A;  2A4Z A;  2DLB A;  3ZGZ A;  4FHK A;  2KJ6 A;  3DHI C;  2GBN A;  1FO4 A;  3H8H A;  1KF6 B;  4KDL B;  4GU2 A;  2GB1 A;  2YEP F;  4N59 A;  5LXI B;  1C9F A;  2NCN A;  3UIN B;  1HA5 A;  1XD3 B;  2KFJ A;  3NVW A;  2WQY B;  1DOX A;  2M8S A;  2WWZ A;  3TIX A;  3CST A;  4PS3 A;  3SFE B;  2XBB C;  4G50 A;  2J52 A;  1JML A;  1EF1 A;  2CJO A;  1TKY A;  3ZQ4 A;  2IO0 B;  3P63 A;  3K9O B;  1E0Z A;  2BBC A;  4C7Z A;  2XEW A;  4WWO A;  4TSS A;  3T3N A;  1ZDX A;  4Q2J A;  4TQ0 A;  1Z5S B;  3DVG Y;  1FNV A;  4PYZ A;  4KGT A;  1OTR B;  1UNS A;  2KD0 A;  4ZRP A;  1EM7 A;  3KQ4 A;  1KLG D;  3N9Y C;  3RI7 C;  1C3T A;  4C80 A;  4L23 A;  2EMT A;  2K6Q A;  3QAQ A;  4P1B C;  1XLQ A;  3WAM A;  4K3B A;  2KX0 A;  3OJ4 B;  2HD5 B;  4DHZ E;  2JYT A;  1VLB A;  1WE6 A;  3V62 A;  2DYO A;  2JUO A;  3AXC A;  3KUC B;  1ZXH A;  1EWY C;  1T0Q C;  4IM2 A;  1SBB B;  2LGI A;  3RNG C;  2J42 A;  1WXA A;  2DNF A;  2Z0E B;  4OZB A;  4I6L B;  1KFY B;  2WU2 B;  2LGY A;  1EU4 A;  3OJ3 A;  2WGS A;  3ZXR A;  4M8N A;  4MSQ B;  2WXF A;  2MEK A;  1IYF A;  1C79 A;  1MHX A;  2IO1 B;  2NMQ A;  2W3R A;  3L16 A;  2DWQ A;  3U4E G;  2INN E;  4HEA 1;  1WYW B;  1IP9 A;  2BYT A;  3VUY A;  2UU7 A;  3A4S C;  4I6P A;  5D94 A;  2W82 A;  3N1Z C;  1Q10 A;  2HJ8 A;  3WA0 A;  5HI1 A;  4KIK A;  3JW0 X;  1TY0 A;  1UF0 A;  2VH1 A;  3RYT A;  2V3P A;  4H2A A;  1YX5 B;  2VH2 A;  1QZE A;  3DBS A;  4JL9 A;  1Q1O A;  4RCO A;  1GB4 A;  3PZD A;  4M0W A;  4WWM A;  3PSE B;  3KVF B;  3MTN B;  4IOI E;  3ZRF A;  4ITK A;  4KSL C;  4KX6 B;  2K22 A;  3U8Z A;  3R3M A;  1N5X A;  2K39 A;  1MG4 A;  4NAM A;  4II3 B;  2KDE B;  4ZDV A;  2C7N B;  4O1N A;  3KUZ A;  3VFK A;  3WCQ A;  3Q8A A;  2V4I B;  2QJL A;  3ETR A;  3WAN A;  2KC1 A;  1JRO A;  1VZ8 A;  2IND C;  5G55 A;  4DHZ B;  1WGG A;  1T0S C;  1MFW A;  1QOF A;  4K7W A;  1AYF A;  2LJ5 A;  4GXB A;  2D3C A;  1OGW A;  1WM2 A;  2B3A A;  3EA6 A;  5C2T B;  3E9S A;  3PLU A;  4LCD E;  3QJZ A;  1FFV A;  1A70 A;  2DAJ A;  4NJ6 A;  5JHA A;  3AEE B;  1XEE A;  4C00 A;  2WXK A;  3VHT C;  3ZJU A;  4HJG E;  2BYE A;  5EE3 A;  2RPQ A;  2HJ1 A;  3AE1 B;  4BKS A;  1K53 A;  3NOB A;  4W9F A;  3LYY A;  4KZ0 A;  2C7H A;  2KAN A;  3VH3 B;  1KJT A;  3N30 A;  3I57 A;  4MGI E;  2FCN A;  3Q14 C;  1C4P A;  1QOA A;  3TL5 A;  5FR6 A;  1TGZ B;  2RR9 A;  2BVC A;  2BKF A;  3DWG C;  1NEN B;  2QC8 A;  1VJK A;  4MGY E;  2LXC A;  4ZOH C;  2WS3 B;  1R4N B;  1FNW A;  2MH7 A;  5G5H A;  1S1Q B;  2RDH A;  3R7R A; 
#chains in the Genus database with same CATH homology
 1SEB D;  2RPV A;  1BXT A;  4L1B A;  3VRA B;  1FD6 A;  2QIL A;  1T3Q A;  3ZJV A;  1TZO A;  3P4P B;  3BII D;  3IT4 B;  3E56 A;  1I4H A;  3P4Q B;  2M0A A;  4UDU C;  2L1A A;  4MH8 A;  2IGH A;  2AX5 A;  2WXL A;  2JZP A;  4US8 A;  1C4A A;  4AQ7 A;  1C78 A;  1VZ7 A;  2K5P A;  1AN8 A;  3AE9 B;  4RGM A;  2MJ3 A;  2PTL A;  4RNA A;  1B9R A;  4LLG M;  1TY2 A;  1YJI A;  2VZK B;  2BB5 A;  1ACC A;  1FFU A;  1SIJ A;  4C7Y A;  1DOY A;  4XWT A;  1L0X B;  2R61 A;  5E6J A;  3HUI A;  2WXQ A;  2JX5 A;  4OVZ A;  3U2S C;  2M56 B;  5MPO A;  2AQ3 B;  3BVZ A;  5LNK 1;  2I38 A;  2N9K A;  2Y5C A;  1I4X A;  1P7F A;  1YJJ A;  3BVM A;  4HRS A;  3AN1 A;  3GB1 A;  4JWS C;  2WDQ B;  2Q5W D;  1SSN A;  2IDY A;  3BK2 A;  3GP7 A;  1C76 A;  1SJE D;  1HZ6 A;  1XCT L;  4WH4 A;  1YQ4 B;  2W54 A;  3AH7 A;  4HKQ A;  1HZ5 A;  2INP E;  1XLN A;  2BTE A;  2H88 B;  1JQ4 A;  2PVO D;  3R2I A;  4A55 A;  3LB8 C;  4NAW B;  2HDE A;  2ON8 A;  3CIR B;  3Q8E A;  3MFG A;  2WP9 B;  3TEW A;  5D3D A;  3P4S B;  1XO3 A;  3TEX A;  3Q8F A;  2WXP A;  4NJC A;  2WXH A;  2Y3A A;  2JYE A;  2L52 A;  3IAM 1;  4GLS C;  1NYQ A;  3VQI A;  3URY A;  1IGC A;  3AE5 B;  3P4R B;  5FKA C;  2KN4 A;  5FR3 A;  1UWX A;  3RPF C;  1Y56 A;  4RGO S;  5BYS A;  2E6X A;  4YWG G;  4WIP A;  1PUT A;  2IJ0 A;  1AW7 A;  1JWM D;  2QIE B;  3AE8 B;  3PO0 A;  3B2F A;  3U52 E;  4P16 A;  1TS2 A;  1UWM A;  1I7H A;  2BB6 A;  3BK1 A;  2CJN A;  1TJE A;  3FIL B;  1JAL A;  1P7E A;  3L4P A;  2KQ4 X;  2RMM A;  1IGD A;  3NUH B;  1FMA D;  2WXG A;  3DWM A;  2GRI A;  1OQQ A;  3Q8B A;  2QSD A;  3BZD B;  4XWW A;  4TMA B;  2W55 A;  5I4D A;  4CQN A;  4P6V F;  2KDM A;  2IGD A;  1JWB D;  3T3O A;  1FM0 D;  1ROE A;  1XCQ L;  5TSS A;  1ZP0 B;  4FXC A;  1HEZ E;  4R3D A;  4XDD A;  5AUK A;  1DOI A;  2KMM A;  1T6B X;  4PT5 A;  2QMT A;  1YN3 A;  3IXS A;  3CWI A;  1L4Z B;  4REZ A;  1TS4 A;  2WXN A;  4ARC A;  3FC4 A;  1D5M C;  1XF5 L;  2MJE A;  4JX1 C;  4KGS A;  3MC0 B;  5HFY A;  2WXR A;  1JRP A;  1SE3 A;  4RH6 A;  1WSP A;  2BS4 B;  4AS1 A;  1I4Q A;  3IAS 1;  2L83 A;  4KGR A;  2KWD A;  3SFD B;  1RFK A;  3O13 A;  3V3X A;  2ONQ A;  3AE7 B;  1LO5 D;  2HTM E;  2XNA C;  1E6E B;  1K51 A;  3AE4 B;  4YXD B;  1ZXI A;  2M19 A;  1JCK B;  4JWU C;  3AE3 B;  3PZ7 A;  2ZW0 A;  4B0M A;  4DXF A;  1CZP A;  1N60 A;  5BYQ A;  1GAQ B;  1JW9 D;  1F2R I;  3SR6 A;  2BW2 A;  1QOG A;  2AQ1 B;  1M4V A;  1E9M A;  3VRB B;  3AB5 A;  3KLS X;  3TEZ A;  1N62 A;  4RFB A;  1V1P A;  1ZDV A;  5C3J B;  2K3U A;  3W1S A;  1PGX A;  5D3I B;  4KKI A;  4OZC A;  1B1Z A;  2DLB A;  3TEY A;  4L2Y A;  5D7G A;  2I2Y A;  3ZGZ A;  3MP9 A;  4ZHO A;  2H89 B;  2G1E A;  2B76 B;  4N58 A;  1VRA B;  1L6V A;  1FO4 A;  3H8H A;  1KF6 B;  5BMH A;  3PZ8 A;  1IUE A;  2JWU A;  1KRH A;  1QT9 A;  4RF1 A;  1C4C A;  5GXG B;  4LTU A;  2ZW1 A;  1ENF A;  2GB1 A;  4MAC A;  3BWU D;  2YEP F;  3W5U B;  4N59 A;  2WXM A;  5EE0 A;  1C9F A;  3LXF A;  1HA5 A;  2D5G A;  1WRI A;  2WQY B;  3NVW A;  1DOX A;  2OHF A;  1FRR A;  1RM6 C;  2BT6 A;  2CU3 A;  2FUG 1;  2JXT A;  1RWS A;  3SFE B;  1F0Z A;  1GB1 A;  3FAH A;  1N5W A;  1ET6 A;  3OWE B;  4JE3 B;  4DQO C;  2J52 A;  1JML A;  4TQ1 A;  1QLB B;  2CJO A;  5T8I A;  3NRZ A;  1OQR A;  1UGJ A;  2PMV A;  1TKY A;  2G9H D;  1SE2 A;  3AED B;  3ZQ4 A;  4A6Q A;  1L4D B;  3P63 A;  1QIL A;  1L0Y B;  1E0Z A;  2BBC A;  4C7Z A;  2WLB A;  1YMH E;  4RGN A;  1YN5 A;  4TSS A;  3P42 A;  3T3N A;  3R2T A;  1SF0 A;  1ZDX A;  3HRD D;  3AMZ A;  2PLP A;  4Q2J A;  1TKE A;  1OFF A;  4TQ0 A;  1FEH A;  1V97 A;  1E10 A;  1SXT A;  1FNV A;  2E3T A;  3AE2 B;  1UNS A;  3AV8 A;  4KGT A;  1BML C;  1L5P A;  4ZRP A;  3NZ3 A;  2VZK D;  4MT5 A;  2V0G A;  4ZYS A;  1EM7 A;  3KQ4 A;  1KLG D;  3MJ5 A;  3N9Y C;  2GI9 A;  1VZ6 A;  2BS3 B;  1J7C A;  1PDX A;  1VDV A;  1FNU A;  3HVD A;  2WXJ A;  4C80 A;  4OHJ A;  4L23 A;  1JWA D;  1XLQ A;  3HVZ A;  1YN4 A;  5EE1 A;  2L32 A;  3J9C A;  1QQR A;  4A8X C;  1SE4 A;  4GDK B;  2JYT A;  4J3O D;  1VLB A;  1YNT E;  3I9V 1;  2LMC A;  2LHD A;  2DYO A;  4YTN B;  1R7S A;  2J4X A;  2N0S B;  1KH0 A;  1IBX B;  1D6E C;  4D2K A;  1QKZ A;  4IDI A;  4US9 A;  4ZHP A;  1ZXH A;  1EWY C;  3AEA B;  1SBB B;  2LGI A;  1ZOY B;  3MHZ A;  1EU3 A;  2J42 A;  1AWD A;  2NTS A;  2TSS A;  1ZPS A;  1HQR D;  4OZB A;  1KFY B;  1ESF A;  2WU2 B;  1K52 A;  1V8C A;  1EU4 A;  3AE6 B;  1K50 A;  4N6E B;  1NEK B;  2N9L A;  1WWT A;  3UI3 A;  2WXF A;  2MEK A;  3AEF B;  1C79 A;  1MHX A;  1MVK A;  1TKG A;  2AQ2 B;  3W2D A;  2NMQ A;  5HG2 A;  2W3R A;  2DWQ A;  3U4E G;  2INN E;  4YSY B;  3GS2 A;  2FE8 A;  1JWU D;  2YEP B;  1KTK A;  1N61 A;  1TYG B;  4HEA 1;  2PVG C;  3AEB B;  4WQM A;  5JXV A;  3AM9 A;  2WXO A;  2BYT A;  1F2R C;  5H8Y E;  3ZYY X;  1SB3 C;  1DYQ A;  1EWC A;  1PGA A;  2W82 A;  1NYR A;  5EE9 A;  2EKI A;  1Q10 A;  4YTP B;  5HI1 A;  1CQV A;  1QF6 A;  3RFZ B;  2EEL A;  4WUR A;  1TY0 A;  2LFI A;  3TUO A;  2JU6 X;  2V3P A;  4A90 A;  2PIA A;  5HHD G;  4H2A A;  2LEK A;  3VR9 B;  1KLU D;  1V1P B;  3P1M A;  1D5X C;  4MM3 B;  4YT0 B;  4RCO A;  1GB4 A;  2WXI A;  4B0E A;  4XE0 A;  4M0W A;  4WWM A;  1TS3 A;  1E7P B;  2WDV B;  4IOI E;  2W3S A;  3ABV B;  4ITK A;  4KX6 B;  3V05 A;  2K22 A;  3AEG B;  2K9X A;  1V1O A;  2MJD A;  3TSS A;  1N5X A;  5FK9 C;  2JQR B;  4NAM A;  2FBW B;  3Q69 A;  1FRD A;  1BUI C;  2BS2 B;  4USA A;  1TS5 A;  3BYY B;  4YSX B;  2WDR B;  4NZL B;  2WNM A;  1J7A A;  3KWV A;  4O1N A;  2J53 A;  1FXI A;  3WCQ A;  1RYJ A;  3KWL A;  2V4I B;  2QJL A;  3ETR A;  3NVY A;  2V3N A;  3AEC B;  3NS1 A;  3Q8A A;  1I4R A;  1JRO A;  4HRO A;  1VZ8 A;  5AUI A;  1CK1 A;  2N7J A;  2ICI A;  4EE2 A;  4JPS A;  3W5V B;  1XXG A;  3SEB A;  1N63 A;  1IBX A;  2X38 A;  1F77 A;  1DGJ A;  4OZA A;  3B9J A;  2Y5P A;  1QOF A;  4YSZ B;  1AYF A;  1JWS D;  1T5X D;  4KKJ A;  1PGB A;  1WXQ A;  3C8Y A;  2KAJ A;  2Z8L A;  5BYR A;  3EUB 2;  5G5G A;  3EA6 A;  1STE A;  3U7Z A;  1D4B A;  1UUP A;  5C2T B;  4ARI A;  2SAK A;  3E9S A;  1PYW D;  1D5Z C;  3B2G A;  1QOB A;  1ET9 A;  1XLO A;  5H92 C;  4A9A A;  2XN9 C;  1FFV A;  1NI3 A;  2LHE A;  2IGG A;  1A70 A;  3VR8 B;  3Q8C A;  2DYM A;  2SEB D;  4IKG A;  4RGT A;  2ACZ B;  2LUM A;  3AEE B;  1SJH D;  2WU5 B;  2IPK D;  3IT6 B;  3W9C B;  5BMI A;  1GOZ A;  1XEE A;  1L6U A;  2WXK A;  1J7B A;  5BMG A;  2DBY A;  1XLP A;  4YTM B;  1FCC C;  1ZE3 D;  1ZUD 2;  1FCL A;  3ZJU A;  4HJG E;  2NTT A;  2PW9 A;  5EE3 A;  2QEJ C;  4C56 C;  3AE1 B;  1HXY D;  1K53 A;  1YQ3 B;  2JSV X;  3LYY A;  1WYG A;  1PFD A;  1I4G A;  1NVI D;  4DXG A;  3ZJT A;  4RF0 A;  3BVG A;  4XDC A;  4ZRQ A;  1MI0 A;  2LJI A;  2RDG A;  3I57 A;  1GPX A;  1WGK A;  1C4P A;  1QOA A;  1FIQ A;  3NVV A;  1MPE A;  4GDL B;  3DWG C;  2K0P A;  2OED A;  3R8B A;  4LK0 M;  1NEN B;  1CJE A;  1VJK A;  1I4P A;  1L0V B;  4ZOH C;  1C77 A;  2KAC A;  2WS3 B;  3NVZ A;  4WAF A;  1FNW A;  1FXA A;  3FIL A;  3EGR A;  3BYT B;  4HKZ E;  2MH7 A;  5G5H A;  1VR9 A;  4OW0 A;  1MHH E;  2RDH A;  2PKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...