4WH4A

Protein gb1 quadruple mutant i6h/n8h/k28h/q32h
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLHLHGKTLKGETTTEAVDAATAEHVFKHYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title The double-histidine Cu2+-binding motif: a highly rigid, site-specific spin probe for electron spin resonance distance measurements.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Signaling protein
total genus 15
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wh4A00
2KN4A 1IGDA 2I2YA 1UWXA 1XCQL 2LGIA 4WH4A 3V3XA 2GI9A 2IGHA 4HKZE 1GB1A 2RPVA 2N7JA 2LHEA 3MP9A 2PW9A 5HG2A 1FCLA 2I38A 2ON8A 2IGDA 5HFYA 1P7FA 2PTLA 1K53A 2ONQA 2N9LA 1PGXA 2ZW0A 1C9FA 1HEZE 2KDMA 2KACA 3UI3A 4IKGA 2GB1A 2JSVX 1K51A 2J52A 1GB4A 4GLSC 3FILA 1MPEA 3FILB 2OEDA 1HZ6A 2LUMA 2J53A 4KGSA 4HJGE 2JWUA 5HHDG 1KH0A 4MACA 1YNTE 2PLPA 1MI0A 4D2KA 2KQ4X 5BMIA 1YMHE 2IGGA 5HI1A 1QKZA 1P7EA 1K50A 2ZW1A 2EELA 4OZCA 5JXVA 1JMLA 1XCTL 1EM7A 2JXTA 1ZXHA 1HZ5A 1K52A 2NMQA 1FCCC 3GB1A 2RMMA 2QMTA 1Q10A 1IBXA 2JZPA 1IBXB 2QSDA 5BMHA 1F2RC 4OZBA 4KGTA 2K0PA 1IGCA 1MHXA 2JU6X 1D4BA 1XF5L 1MVKA 1FD6A 4IOIE 2KWDA 2N9KA 1MHHE 5BMGA 1PGBA 4KGRA 2LHDA 1F2RI 1PGAA 4OZAA
chains in the Genus database with same CATH superfamily
2WXJA 1L2NA 2LZ6A 1C4CA 4W9HA 1ZW7A 1VCBA 3DBHB 1JALA 5IAAC 4N59A 2KC2A 3ZQ4A 2C5LC 1OEYA 3H8HA 2XBBC 2LHEA 2UYZB 2PW9A 3IT4B 2KLCA 1FRDA 4ACFA 1E10A 1HQRD 2KX0A 1SXTA 3MHSD 2DLBA 2PTLA 2FCQA 2J4XA 3QIJA 4L23A 3DBLB 4L1BA 2JXXA 1OQRA 2IDYA 1HEZE 4II2B 2A5UA 3VRBB 1FXIA 5BYQA 1XLNA 3AE2B 1C4PA 4K81A 2FIDA 3PO0A 3PZDA 1JWAD 5J17A 1LGRA 5D2MB 4WQMA 1RFAA 2AQ3B 1K50A 5JXVA 1TZ1A 4FJVB 2KX3A 3IT6B 1FCCC 5CHFA 3L10B 2KANA 2L00B 2W54A 2FCNA 1RRBA 2DYBA 4KIKB 1UH6A 1XT9B 1IBXB 2MBHA 3DVGY 4HWIB 2O6VA 2OHFA 1C78A 4X57B 4P16A 1CK1A 2BW2A 4KKIA 4TQ1A 5AUKA 1ZUD2 1LXDA 1ZOYB 3MFGA 4ZYNA 2LGXA 5DPTA 3E56A 4W9DA 2JRIB 2LXCA 1T6BX 2FUG1 2RDBC 3TMPB 5IP4D 2FNJB 3ML9A 2B3AA 3WA0A 1E90A 2DAJA 4II3B 4WIPA 4IM2A 2YLMA 2K9XA 1FEHA 2L05A 1N60A 3PV1A 3PSEB 4GDKA 4NPNA 1UGMA 3Q8AA 1LQBA 3W9CB 2ON8A 3NY5A 4USAA 4IDIA 2GBKA 1UELA 5AZGA 4A20A 3L13A 3ZYYX 1WXQA 3V6CB 1WYGA 2N1WA 3NZUA 3N1XC 2WYQA 4K3BA 3PZ7A 5LXHA 3NS8A 5IOIA 4RFBA 4KGSA 4K7UA 3V05A 3HIZA 2KQ7A 1UWMA 2INNE 2M1MA 3QCAA 2EELA 1JMLA 1HXYD 4GIVA 1ZXHA 4RF1A 1V49A 1J19A 3TUOA 2Y5BB 3M3JA 2BVCA 5H8YE 4IUMB 2BQQA 2WX1A 2GOWA 4KGTA 3WAOA 1FNWA 3SD5A 4FXCA 4MJSB 3KWLA 3NVWA 1L4DB 3ZRFA 1WXVA 3VXWA 1QZEA 2MW5A 1BT0A 4IOIE 4KX6B 4F8CB 4N58A 2KDFB 4W9JA 1L0YB 1XXGA 2KMAA 4KKJA 2ZPYA 1CZPA 4YXDB 2KDEB 3IHPC 4P1CC 3AV8A 4B95A 3DVNU 5BO4B 4GDLA 2MBOA 4DHZE 2WU2B 1WX8A 4M8NA 4W9KA 2IY0B 1I4QA 1IP9A 1JRUA 3PREA 2KJ6A 4YSYB 5G5HA 4IW0A 1T0SC 3P4RB 1E8XA 4WQOB 5HKHA 2MP2A 3KYCD 1PFDA 1P0RA 2NBUA 1ZGUB 4PK1A 4MSMB 2MWSB 1K53A 2UU7A 3A1QB 4BKSD 1R7SA 3U2SC 3EHVA 4BKTA 2KMMA 4CQNA 2KACA 2LVOA 2K8CA 3Q3FA 2WXGA 3ZNZB 1TT5B 1OQYA 2LUMA 2Y5PA 1WF9A 2INPE 1D3ZA 1Z5SB 2D3CA 2KQ4X 1L6UA 1L0XB 4RGMA 3SHQA 1CMXB 5TR5A 1JWMD 1EM7A 3RNGC 2NS5A 4LNFA 4FHJA 1H4RA 2BWFA 2RSUA 4HEA1 2VH2A 1F2RC 1V86A 4B6WA 1ET6A 2DZMA 2LUEA 2C9WB 3TL5A 3C19A 1VR9A 4HXDA 2LGSA 2ZEQA 4K7SA 1SE2A 2KWDA 1A5RA 4MM3A 1MHHE 3IBEA 3O13A 3ZGZA 4G0NB 3I5JC 3L4PA 4I6NB 1F9JA 1FPYA 1IGDA 2KFJA 1Y56A 4BOSC 2G4DB 4NY0A 3M63B 3N1ZC 3RYTA 1K8RB 1KLVA 2BS2B 3NS1A 3AE5B 1I35A 1VRAB 2CS4A 2WXPA 2E6XA 3OWEB 5DPRA 2K25A 3HM6X 3HRDD 1MG8A 2BTEA 2WXOA 4IWOA 4RGTA 4AOFA 1I4HA 1YN3A 3UINB 2JYEA 1E5WA 3B08A 1ZE3D 1XLQA 3ENEA 2ZW0A 1VLBA 1VZ8A 4XDCA 2M17A 3ECIA 1T0RC 1KRHA 2K3UA 1KJTA 4I6LB 4XWTA 3KLSX 1QLBB 2WXKA 2JWUA 5JHAA 1JRPA 2IGGA 4MGKE 1QKZA 1R4MI 2KT7A 1JWSD 3FKYA 4OZCA 4FADA 1P9DU 2KFKA 1M94A 3A33B 3ABVB 1SEBD 5D3DA 4J3OD 1T0YA 3IVFA 2EKIA 3MJWA 4GSWA 3H6NA 4M0WB 2N1VA 2BGFA 2WQYB 3TBLD 3ZXRA 2GLSA 4JGHB 1MFWA 4ICUA 5E6OA 2IO2B 4NJCA 1TZOA 1E6EB 1JCKB 1GG3A 1L6VA 2EMSA 3NHEB 4MSQB 3U4EG 4HCNB 3KWVA 1ESFA 1FIQA 4ZRJA 2V0GA 1PDXA 2D11A 4JL9A 2FE8A 2NVUI 2Y5CA 4L2YA 1TS2A 3CWIA 3Q3JA 2CU1A 2KVRA 3N9YC 2FCSA 5AEKB 4WJPA 5EE9A 2LGIA 4NJ6A 1AWDA 4AJYB 4HKZE 2LI5A 1GB1A 3N30A 3TSSA 1YQBA 4HK2A 3Q3OC 4WAFA 3V61A 3W1SA 3ZIMA 2IGDA 2M0AA 4XE0A 1AW7A 2AWTA 2IO1B 4W9IA 2JY6A 2N9PC 1RYJA 3UQAA 3TCAA 1KFYB 3H1UA 2PVGC 1L4ZB 3AECB 4XGAB 3OLMD 4WWPA 4S0RA 1WGDA 4ZRKA 3A9JA 3N20C 2DX5B 4GLSC 3PRZA 3X23A 1OQQA 3ZDTA 3MJ5A 3FAHA 3SDLC 1OTRB 1YN5A 5AZHA 4LNOA 4HJGE 4BFRA 4EE2A 3TEWA 4HDQA 4ANVA 1NVID 1C1YB 1TBEA 2W9NA 2KJHB 2IZVB 3E9SA 1SB3C 1IPGA 2JWZA 3RMKC 2NMQA 2JZ3B 1EU3A 2MBEA 2W3SA 2JZPA 2N0SB 3M62B 2AEHA 2AYOB 4JE3B 1TS4A 1TKEA 2K5PA 2KQSA 2PIAA 1WXMA 3N32A 2LFIA 3DHHC 4ZRQA 2M4NA 4C4VB 2GBJA 2I1JA 3ALBA 3Q3NC 1FD6A 2R61A 3AU4A 3C0RB 1HTQA 1WZ0A 1WJUA 4B9KA 2KTRA 2BKFA 2KJRA 3O65B 4FJYA 2JVCA 4LJOB 2MJEA 2B76B 3WALA 1UUPA 4Q2JA 3APFA 5D94A 5FK9C 1FO4A 3TEXA 1PQSA 4WURA 3VDZA 1WX7A 2CJNA 2V3SA 1KF6B 2WXHA 3LYYA 2N9LA 4EFOA 1YX5B 3RT3B 1WI0A 4JX1C 1N5XA 3VUYA 2IO3B 1E8WA 2MEKA 1ZPSA 4TUUA 2Z0EB 2MSED 1GOZA 3KUZA 3IXSA 3ZTDA 1FNVA 2Z8LA 5BYSA 1L0VB 2CHZA 1GC7A 2AL3A 1D6EC 2PLPA 3GE3C 4XC2A 3W2DA 2XK5B 2L3ZA 2MBBB 1N62A 1V2YA 3IAS1 4J6IA 1V9JA 5FR3A 1WRDB 3HK0A 4BKSA 2M0XA 1TKGA 2LD9A 3GP7A 3HHMA 4NAWA 4XDDA 4P1BC 1HTOA 4ZHPA 1NENB 3BIID 4HPPA 2ZCCA 2J0MA 4MGZE 2ZVOA 3JW0X 1MHXA 3VUWA 5IN7A 1YN4A 4KSLC 1WGYA 1OFFA 1FFUA 4HJKA 4EZLA 2NPTA 2LEKA 1YIWA 1YJ1A 3T9LA 1XQQA 2L52A 2K6QA 4DXFA 1T0QC 1U4AA 2SAKA 2IBIB 3PTFC 3ZUNA 1UWXA 3LJ3A 2MRPA 2LRUA 3K9OB 1P1AA 3MHZA 4ZHOA 2PEAA 3KUCB 3CMMB 1EO6A 3SU8X 4LNIA 2J0JA 2GBMA 4GDKB 3RN9C 3AM9A 1WM3A 4W9GA 4LLGM 3VHTC 2WDTB 4AQ7A 2X38A 3KH0A 3PT2B 4N6EB 3NVVA 4EKUA 2HD5B 2KWVB 4AJWA 2WLBA 4ARIA 1PGXA 3FC4A 1DOIA 5IA7A 3GZNI 1WIAA 2WHIA 2KDMA 3UI3A 4IKGA 3OAWA 4RMAA 2LWPA 1QILA 5DPSA 3FILA 1WX9A 3NOBA 4W9EA 3R2IA 2BF8B 4URKA 1ZXIA 1E8ZA 4K1RB 1EU4A 3P1MA 1V1OA 3B0AA 5IKCM 2WXLA 3DBRI 4MT5A 1XCTL 2QC8A 2ICIA 1K52A 2DZJA 3GB1A 4JWUC 1GNUA 4PYZA 1SGHA 3EFCA 1FFVA 2QMTA 2ZNVB 2QSDA 4IWPA 1LO5D 1KLUD 3DWGC 2RGFA 2K6DB 2KZRA 5JH5C 2L8JA 3P42A 2JYTA 2JRHA 1D4BA 3AI5A 4BBNC 1XD3B 3U7DA 4LDTB 3EFUA 3H9DA 2LGYA 3T8MA 2BS4B 1F77A 4KGRA 1FXTB 2O2VB 3DHIC 1I42A 3BVMA 4GDLB 1VDVA 1TYGB 2AL6A 1SF0A 2VZKD 4PS7A 1FNUA 2UWQA 4QAYA 1B9RA 3DDCB 4UDUC 4WAAA 4LNNA 4EUTA 3A9KB 2DZIA 2VRRB 5AZFA 3NUHB 3QA8A 4CHKA 4LK0M 4MELA 3LB8C 2MP2B 1V8CA 1V80A 2ZCBA 1FCLA 2DYMA 3BYTB 1QF6A 2EMTA 2G4SA 4RM8A 1P7FA 2L0TA 1ZP0B 3VH3B 4F7ZA 4GOCA 3RCZA 1R4MB 2RR9A 2J0KA 2RD0A 5EE1A 4HVBA 3H7PB 2KO3A 4ZRIA 2WS3B 1ET9A 5D6JB 3ZLZA 5HHDG 2BYTA 3VH4B 3ONSA 1D5ZC 3V62A 1WMHA 3AN1A 3PRMB 3GOEA 3SFEB 4DQOC 2WDRB 3NRZA 2QJLA 4YSZB 2W82A 3U30A 4HCPB 3WCQA 1QOAA 2NCNA 4KV2A 4ICVA 2BKRB 2V3PA 2INDC 3ZVVA 2BS3B 2FBWB 1P98A 2REXA 1NEKB 1WXSA 1YJIA 3AE8B 3PVLA 2ACZB 2QILA 1SJED 4NJ7A 4MM3B 1PGBA 2IY1B 2KWUB 2LHDA 3AE6B 1E0ZA 1C76A 2AQ2B 3NZ3A 1D5MC 4WH4A 3NVZA 4DHZB 5H92C 1OEYJ 2NTTA 5GXGB 3RNCC 4R3DA 2KDBA 3UGBB 3JYUA 3VQIA 4TV3A 2GMIC 2BYEA 3WAPA 2KAJA 5E6PA 1Y8RC 2KKCA 2I1KA 2MX2A 4BBNF 3KYDD 2RDGA 4C7YA 1RAXA 4ZYSA 2WU5B 3VVWB 2ONQA 3HM3A 2V4LA 2LJ5A 3QK0A 4FA6A 3BVGA 4RF0A 2JX5A 3RZFA 1TIFA 2PKOA 2JSVX 4YTPB 4EOYA 1F52A 2KHWB 3PLVA 4CYEA 3Q8CA 4LNKA 4M01A 2HE7A 2MBQA 2M19A 3ZO5B 2N7EA 4G3XB 2KLGA 2ZW1A 3MC9A 1F0ZA 5GMVA 2KFKB 4RM9A 1HZ5A 4DK5A 1GAQB 3UIOB 1N5WA 2KD0A 3RUIB 2KTFA 4AS1A 2CR5A 3AEGB 2BB5A 3BWUD 2FUHB 3HVDA 1FXAA 2K22A 1WYWB 4MH0E 3QHTA 1WR6E 2MLBA 4FBJB 2WXRA 1UZXB 1EWYC 2LMCA 3AEEB 1WY8A 5MPOA 1E7UA 1HA5A 3KVFB 4AWJA 1STEA 1V5OA 2W55A 2NBVB 4ITKA 4LJPB 1AARA 2RPQA 1PGAA 2X8XX 4ANWA 3GS2A 3M95A 1RLFA 2KN4A 1C3TA 3VUXA 1V1PA 3U7ZA 3DCGA 3R3MA 1XCQL 5J18A 4E71A 5C3JB 2DBYA 1V97A 2D07B 2Z0DB 3B1LX 3IG3A 3TEZA 3VTVA 4A8XC 3QWZB 3UQBA 2K39A 5HFYA 3DBSA 1RM6C 3Q8FA 2J42A 1TS3A 3BVZA 3Q6BA 1WWTA 2N9EB 2D3GA 4IG7B 3I63C 4XX5A 3W5VB 4P6VF 1MG4A 3LDZE 3ZJUA 3OG5A 4DHJB 5G5GA 3RPFC 1KH0A 1EUVB 1YNTE 2L0FA 1YMHE 3S2AA 1WFYA 4NQKE 1CJEA 2LJIA 4HPMB 4KZ0A 2DENB 4XYCA 2AX5A 1A70A 1MJDA 1Z2MA 3NJTA 4JWSC 1C77A 1WR1A 1NYRA 1YD8U 4I6PA 4WWOA 5LNK1 1SSNA 2FAZA 2WDVB 2YEPB 2DHZA 2BBCA 2CHXA 3V6EB 3DOWA 2L76A 4GN1A 1IGCA 1WSPA 2FCMA 2JU6X 3RNAC 2YEPF 1YJJA 5KHOA 4PT5A 3AE9B 3D32A 3I3TB 1NDDA 3R8BA 5AUIA 3U52E 1WJ4A 4DXAB 4E74A 3RZWC 4WJNA 1Q0WB 3BY4B 2QDFA 1X1MA 1NBFC 2H88B 3EC8A 3ZJTA 2KTRB 3V3XA 3PHWB 2L83A 4DDGD 1CQVA 2IGHA 2HTHA 1TY2A 4KVGB 3BZDB 3GZNB 4JQWC 1N61A 1QOBA 3DVNV 2WXNA 1EWCA 2G1EA 4P7IA 3RULA 1YQ3B 3AU5A 1V5TA 1JW9D 1EF1A 1AN8A 2HJ1A 2KC1A 2AQ1B 2N7DA 4E3CA 3DBRB 2J52A 5L83A 3T3OA 1C79A 1ZDXA 2GBNA 4MDKE 3RI7C 4PYUA 2JUOA 2E3TA 3NG0A 3SR6A 4BVUC 1MI0A 3VR9B 2LVPA 1TKYA 3ZNID 5EDSA 4AP4C 4K3CA 2OJWA 4B0MA 1KLGD 4IM0A 3VR8B 3AMZA 1E8YA 1UGJA 2QCZA 1DOYA 5IO9A 2PPHA 2KVZA 3Q2AC 2KNBA 4LCDE 1SE4A 2PE6B 1WJNA 3CSFA 5BMHA 1G6JA 2ZNVC 4NAWB 3JSVA 1YQ4B 4WJQA 3T3NA 2K0PA 3KW5B 2WXMA 2C7HA 2JQRB 3H7SA 3I57A 1D5XC 1GJZA 4DBGA 3L08A 1L5PA 3RNEC 3X0WA 4MEMA 1QOFA 2NPTB 1F2RI 2QEJC 2PJHA 4IC7B 1EF5A 2R2QA 2I2YA 3PZ8A 1J7BA 4M02A 1E7PB 2O6VB 3RNBC 3UF8A 4DDID 2GI9A 3KQ4A 2RPVA 2N7JA 3RFZB 3N1YC 4KZCA 4MH8A 4BKGA 3APCA 2RDHA 3P4PB 2L7RA 2XK5A 3WAMA 3U8ZA 1DGJA 3HUIA 4YTNB 1UNSA 2V1YA 3AXCA 1NI3A 1R4NI 3BK2A 1VZ7A 4ANUA 4RH6A 3FILB 1QT9A 3P2BA 3C8YA 4B0EA 3ZTCA 1I4GA 1BUIC 5BMIA 5E6NA 4YSXB 4A3PA 3B2GA 1GUAB 5BYRA 3WANA 4PS8A 3L0WB 3W1YA 4OHJA 2K1FA 2L32A 4C80A 5LLIA 4HLEA 2SEBD 2JPHA 4KIKA 3W5UB 1IBXA 3KUDB 2INCC 4OZBA 1L7YA 1XLOA 3QQ8B 3NZSA 4M8MA 4EEWA 4NQLB 1P3QU 3V60A 4DHJD 4BZAA 5BMGA 4A6QA 3AB5A 3LXFA 2N4FA 1WH3A 4FHKA 1TS5A 1J7CA 2K8HA 3ZNGC 1TTNA 4FULA 2MA9B 4KDIC 2IO0B 3ZW3A 2BB6A 3CIRB 4K7WA 5EE3A 4RGNA 3QAQA 5G2NA 2VH1A 2MQJA 4REZA 3MP9A 2MH7A 4IWQA 5FR6A 3ZKJC 2I38A 1T3QA 1AYFA 4ASWC 4GB9A 4US8A 2BYVE 4NZLB 1C9FA 3DBHI 3ML8A 5CHWA 5L95C 2WX0A 3B9JA 1Q5WB 2R2OA 1DYQA 3DWMA 3ZRCA 2V9HA 4KSKC 1HZ6A 1BXTA 1WM2A 4MACA 4EZKA 4YTMB 3MC8A 3IFWB 1WJ6A 1WMHB 3CF6E 2D10A 3DBLI 2KOXA 1ZDVA 1HE8A 2K8BA 2JXTA 2YVCA 3BYYB 2J7QB 2MCNB 2MJ3A 3PS6A 2G45B 2O2VA 1IUEA 3AE7B 3L54A 4MJSA 5JHBA 4WWMA 1SE9A 3ZDMC 2KYWA 4YWGG 4G11A 3BK1A 1WGHA 1SIJA 3A9KA 1T5XD 1MVKA 2WWZA 2N9KA 1UBQA 3PLUA 4AUQC 3APDA 3WIMA 2HJ8A 5I4DA 3B2FA 1DOXA 1C4AA 1NI2A 3R7QA 4JIOU 4A3OA 2QHOA 3OJ3A 5LXIB 2NBWB 2LGDA 3H7PA 1KM7A 4F1SA 3AEDB 3OJ4B 4JLCA 5C1ZA 2L1AA 2KK8A 4KDLB 2IPKD 2CHWA 1I4PA 2JT4B 2XN9C 1S3SG 4TMAB 5HG2A 4LTUA 2CJOA 3Q8BA 3QARA 4IM3A 3W1SC 4ZDVA 3A1QA 4GXBA 4WJOA 4OVVA 1M4VA 1VZ6A 3PHXB 1RFKA 4A90A 1JQ4A 1WRIA 2Z59B 3EA6A 1LFDA 1K51A 3ZJVA 4W9FA 2O6VD 2OEDA 2HDEA 4XWWA 1V6EA 2LRWA 1IYFA 4CO7A 2KN5A 4D2KA 3TEYA 3AEBB 3R7RA 3AE4B 2C7MB 2WNMA 2D3BA 3Q69A 2JF5A 2D3AA 2DWQA 4ZOHC 1J8CA 3Q14C 5J2RA 4WWNA 1B1ZA 2DZKA 2H89B 2WGSA 2NTSA 1TY0A 2RMMA 2MHJA 3URYA 4N9F4 3QC8B 3A4RA 2GRIA 3P63A 1JROA 4C7ZA 1H8CA 3ZXVA 3QJZA 1E9MA 1S1QB 3A4SC 2OJRA 5CX3A 4TSSA 1KTKA 2HTME 1TJEA 2WXIA 2G9HD 3VTUA 2A4ZA 1UBIA 2EKEC 2WP9B 1KOTA 1ISNA 2C7NB 3AE1B 3Q8EA 3HVZA 3DHGC 2BYFA 4OZAA 3AE3B 4G50A 1NYQA 3ETRA 1PYWD 1ZKHA 3SEBA 1V1PB 3P4QB 1I4RA 2DNFA 1VD2A 1XEEA 3L16A 2KMCA 2DAFA 1SIFA 1GPXA 5C2TB 3RD2A 1XLPA 2XNAC 3MC0B 3JVZX 2GBRA 4W9LA 2ZZPB 4M00A 4OVUA 4BOZB 3N3KB 1WXAA 4A55A 2WXQA 2DYOA 4BAXA 5JZEB 4MGYE 2NR2A 3ZNHB 1SJHD 4OVZA 4HKQA 2ZPNA 1WE7A 3EECA 3SFDB 4GMVA 2CU3A 2GB1A 1LM8B 1FM0D 3UIPB 1GB4A 2MJDA 4ARCA 3P4SB 1VJKA 3QX1A 4O1NA 1YOVB 1WGRA 1JWUD 4XZ4A 2J53A 4HDOA 5E6JA 3BINA 3L17A 5HI1A 2PMVA 1I4XA 1P7EA 3PGEA 2BT6A 2CKHB 4LDTD 5TSSA 3TJPA 1BMLC 1WGKA 1J0GA 3R66C 3A9JB 4RNAA 4NNJB 4M0WA 3I9V1 3Q3MC 1UD7A 4GU2A 3DVGX 1JWBD 1XO3A 3DQVA 2D5GA 2KWCA 1FRRA 2LVQA 5FKAC 4YL8A 4HROA 1WE6A 2C60A 5G55A 3NVYA 5DPWA 2KXJA 4A9AA 3GE8C 1XF5L 1V81A 2ZJDA 2XEWA 4PS3A 4MGIE 3VFKA 4OW0A 2KDIA 2WDQB 3RNFC 4TKNA 4C00A 3CSTA 5C23A 2LXAA 1N63A 4NAMA 5DCNA 4GGQA 4FJZA 2BPSA 2JZZA 2IJ0A 5CTRC 1QOGA 3AEFB 2IYDB 1SE3A 4ZRPA 4TQ0A 2ASQA 1R4NB 1TGZB 3EGRA 4S17A 1E7VA 3AEAB 4C56C 1GC6A 1N6ZA 1J7AA 4W9CA 4RCOA 5KHQA 1FMAD 4ANXA 3PPAA 2TSSA 2Q5WD 3IAM1 1UF0A 2M56B 2VZKB 3VRAB 4US9A 2G3QB 1Q1OA 1MPEA 2V3NA 1OGWA 3K9PB 3PRPB 1PUTA 5T8IA 2D2QA 3VTWA 2BWES 5D7GA 1F1HA 1QQRA 3MTNB 2M8SA 2N9XA 1ACCA 1ROEA 4RGOS 4HRSA 1WGGA 3EUB2 4HPLB 4YT0B 3AULA 1YX6B 2ZVNA 3VAWA 1Q10A 3AH7A 2PVOD 1SBBB 2WXFA 2QIEB 3JSVB 2FIFA 4JPSA 2Y3AA 4H2AA 2PE9A 1WZ3A 2V4IB 1I7HA 5CHVC 3R2TA 1RWSA 3TIXA 4C4VA 3J9CA 4DXGA 4EZJA 2LASA 2OOBB 3DPDA 1ENFA 4FLHA 4FN2A 4DWFA 2W3RA 5D3IB 5EE0A
chains in the Genus database with same CATH topology
1C76A 3CWIA 1TS5A 1J7CA 3N9YC 2WXJA 1C4CA 5EE9A 2AQ2B 3NZ3A 1D5MC 2LGIA 4WH4A 3NVZA 2BB6A 5H92C 1AWDA 2NTTA 4HKZE 3CIRB 5GXGB 1JALA 4N59A 5EE3A 4RGNA 1GB1A 4R3DA 3TSSA 3ZQ4A 3H8HA 4REZA 2LHEA 3MP9A 2PW9A 2MH7A 3IT4B 3VQIA 4WAFA 2I38A 2KAJA 3W1SA 1FRDA 2IGDA 2M0AA 1AW7A 4XE0A 1E10A 1HQRD 1SXTA 1T3QA 1AYFA 1RYJA 2DLBA 2RDGA 4C7YA 4ZYSA 2PTLA 2WU5B 4US8A 2ONQA 2J4XA 1KFYB 4NZLB 2PVGC 4L23A 1L4ZB 3BVGA 3AECB 4RF0A 1C9FA 4L1BA 2JX5A 3B9JA 1OQRA 2IDYA 1HEZE 2PKOA 1DYQA 2JSVX 4YTPB 4GLSC 3VRBB 1FXIA 5BYQA 1OQQA 1XLNA 3AE2B 1C4PA 3DWMA 3Q8CA 1HZ6A 3MJ5A 3FAHA 1BXTA 1YN5A 3PO0A 4HJGE 1JWAD 4MACA 4YTMB 4EE2A 3TEWA 2M19A 4WQMA 1NVID 2AQ3B 1K50A 2ZW1A 5JXVA 1ZDVA 3E9SA 1F0ZA 1SB3C 2JXTA 3BYYB 1HZ5A 2NMQA 1GAQB 1N5WA 3IT6B 1FCCC 2MJ3A 4AS1A 1EU3A 2W54A 3AEGB 2W3SA 2BB5A 3BWUD 2JZPA 2N0SB 1IBXB 1IUEA 3AE7B 3HVDA 4JE3B 2K22A 1FXAA 1TS4A 1TKEA 2K5PA 2OHFA 2PIAA 1C78A 4WWMA 2WXRA 2LFIA 4YWGG 4ZRQA 1EWYC 4P16A 1CK1A 2BW2A 3BK1A 2LMCA 1SIJA 4KKIA 4TQ1A 1ZUD2 5AUKA 1T5XD 3AEEB 1ZOYB 1MVKA 1FD6A 3MFGA 5MPOA 1HA5A 2N9KA 2R61A 1STEA 3E56A 2W55A 4ITKA 1T6BX 2FUG1 5I4DA 1PGAA 3B2FA 1DOXA 1C4AA 3GS2A 2KN4A 1V1PA 3U7ZA 1XCQL 5C3JB 4WIPA 2DBYA 3AEDB 1V97A 2K9XA 1FEHA 2MJEA 1N60A 2B76B 2L1AA 1UUPA 2IPKD 4Q2JA 1I4PA 3TEZA 3Q8AA 4A8XC 5FK9C 2XN9C 1FO4A 4TMAB 5HG2A 3TEXA 3W9CB 4LTUA 2ON8A 4WURA 2CJOA 1E0ZA 4USAA 3Q8BA 5HFYA 4IDIA 2CJNA 1KF6B 1RM6C 2WXHA 3LYYA 3Q8FA 2J42A 2N9LA 1TS3A 3ZYYX 1WXQA 3BVZA 1WYGA 1WWTA 1M4VA 1N5XA 1VZ6A 4JX1C 1RFKA 4A90A 1JQ4A 1WRIA 2MEKA 1ZPSA 3EA6A 3W5VB 1GOZA 1K51A 4P6VF 3ZJVA 3PZ7A 3IXSA 1FNVA 2Z8LA 3ZJUA 5BYSA 1L0VB 2OEDA 4RFBA 2HDEA 4XWWA 4KGSA 5G5GA 3RPFC 1D6EC 1KH0A 3V05A 1YNTE 2PLPA 4D2KA 1YMHE 3TEYA 3AEBB 1CJEA 2LJIA 3AE4B 3W2DA 1N62A 1UWMA 2INNE 3IAS1 2WNMA 2AX5A 1A70A 3Q69A 2EELA 5FR3A 1JMLA 2DWQA 4ZOHC 1HXYD 4JWSC 1B1ZA 1ZXHA 4RF1A 2H89B 1C77A 2NTSA 3TUOA 1NYRA 1TKGA 1TY0A 2RMMA 5H8YE 3URYA 2GRIA 3GP7A 5LNK1 1SSNA 2WDVB 2YEPB 3P63A 4XDDA 2BBCA 1JROA 4KGTA 4ZHPA 1FNWA 1NENB 4C7ZA 3BIID 4FXCA 3KWLA 1IGCA 1WSPA 1E9MA 3NVWA 1L4DB 1MHXA 2JU6X 1YN4A 4TSSA 1KTKA 2HTME 1TJEA 2WXIA 2YEPF 1OFFA 2G9HD 4IOIE 4KX6B 4N58A 1YJJA 2WP9B 1FFUA 1L0YB 1XXGA 4KKJA 4PT5A 3AE9B 3AE1B 2LEKA 3Q8EA 3HVZA 1CZPA 3R8BA 5AUIA 2L52A 3U52E 4OZAA 3AE3B 4YXDB 4DXFA 3AV8A 1NYQA 2SAKA 3ETRA 1PYWD 2WU2B 2H88B 3SEBA 3ZJTA 1UWXA 1V1PB 3P4QB 1I4RA 1I4QA 1XEEA 3V3XA 2L83A 1CQVA 2IGHA 1GPXA 4YSYB 5G5HA 1TY2A 5C2TB 3BZDB 1XLPA 3P4RB 2XNAC 3MHZA 4ZHOA 3MC0B 1N61A 1QOBA 1PFDA 4GDKB 3AM9A 2WXNA 1EWCA 2G1EA 4LLGM 1YQ3B 4AQ7A 2X38A 4N6EB 4A55A 1JW9D 2WXQA 2DYOA 3NVVA 1K53A 1SJHD 1AN8A 4OVZA 4HKQA 2WLBA 1R7SA 2AQ1B 4ARIA 1PGXA 3U2SC 3FC4A 1DOIA 3SFDB 2KMMA 4CQNA 2KDMA 2CU3A 2KACA 3UI3A 4IKGA 2GB1A 1FM0D 2J52A 1GB4A 2MJDA 1QILA 4ARCA 3FILA 3P4SB 2WXGA 3T3OA 3R2IA 1VJKA 1C79A 2LUMA 4O1NA 1JWUD 2Y5PA 1ZDXA 2J53A 2INPE 2E3TA 3SR6A 5E6JA 1MI0A 1ZXIA 2KQ4X 1L6UA 3VR9B 1TKYA 1L0XB 5HI1A 2PMVA 1I4XA 4RGMA 1P7EA 1EU4A 3P1MA 2BT6A 1V1OA 5TSSA 4B0MA 1KLGD 2WXLA 1JWMD 4MT5A 3VR8B 1BMLC 1XCTL 3AMZA 1EM7A 1WGKA 2ICIA 1UGJA 1K52A 1DOYA 4RNAA 3GB1A 4JWUC 4M0WA 3I9V1 1FFVA 2QMTA 1SE4A 4HEA1 2QSDA 5BMHA 1JWBD 1F2RC 1XO3A 4NAWB 1LO5D 1YQ4B 2D5GA 1FRRA 1KLUD 3DWGC 5FKAC 3T3NA 1ET6A 2K0PA 4HROA 3P42A 2WXMA 3NVYA 2JQRB 2JYTA 3I57A 1D4BA 1VR9A 4A9AA 1XF5L 1D5XC 1SE2A 2KWDA 1L5PA 1MHHE 4OW0A 3O13A 2BS4B 2WDQB 1F77A 3ZGZA 1QOFA 4KGRA 1F2RI 2QEJC 3L4PA 1N63A 4NAMA 1IGDA 2I2YA 3PZ8A 1J7BA 3BVMA 1Y56A 4GDLB 1E7PB 1VDVA 1TYGB 1SF0A 2VZKD 1FNUA 2IJ0A 2GI9A 1QOGA 1B9RA 3AEFB 3KQ4A 4UDUC 2BS2B 3NS1A 3AE5B 1SE3A 4ZRPA 4TQ0A 2RPVA 1VRAB 2WXPA 2E6XA 2N7JA 3RFZB 3OWEB 3HRDD 3NUHB 3EGRA 2BTEA 4LK0M 4MH8A 3LB8C 3AEAB 1V8CA 1FCLA 2WXOA 4C56C 2DYMA 3BYTB 1J7AA 1QF6A 2RDHA 3P4PB 4RCOA 1P7FA 1ZP0B 4RGTA 1FMAD 1I4HA 1YN3A 2JYEA 1DGJA 3HUIA 1ZE3D 1XLQA 4YTNB 1UNSA 2TSSA 2ZW0A 1VLBA 5EE1A 1NI3A 1VZ8A 2Q5WD 3IAM1 4XDCA 2M56B 2VZKB 3VRAB 4US9A 2WS3B 3BK2A 1VZ7A 1ET9A 1MPEA 2V3NA 4RH6A 3FILB 1QT9A 1KRHA 2K3UA 1PUTA 5T8IA 4XWTA 3C8YA 3KLSX 4B0EA 1QLBB 2WXKA 2JWUA 5EE0A 5HHDG 1I4GA 1JRPA 2BYTA 1BUIC 5BMIA 2IGGA 1D5ZC 5D7GA 4YSXB 1QKZA 3B2GA 1QQRA 5BYRA 1JWSD 3AN1A 4OZCA 4OHJA 1ACCA 3SFEB 1ROEA 4RGOS 2L32A 3ABVB 4HRSA 4DQOC 4C80A 1SEBD 5D3DA 2WDRB 3EUB2 2QJLA 3NRZA 2SEBD 4J3OD 4YT0B 2EKIA 4YSZB 2W82A 3WCQA 1QOAA 1Q10A 3W5UB 1IBXA 2WQYB 3AH7A 2PVOD 1SBBB 2WXFA 2V3PA 4OZBA 2QIEB 2BS3B 2FBWB 4JPSA 4NJCA 2Y3AA 4H2AA 1XLOA 2V4IB 1E6EB 1JCKB 1NEKB 1TZOA 1YJIA 1I7HA 1L6VA 3AE8B 3R2TA 1RWSA 3U4EG 3J9CA 4DXGA 2ACZB 3KWVA 2QILA 1ESFA 1FIQA 2V0GA 1SJED 1PDXA 4MM3B 1ENFA 5BMGA 4A6QA 1PGBA 3AB5A 2LHDA 2FE8A 3LXFA 2W3RA 3AE6B 2Y5CA 4L2YA 5D3IB 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KN4 A;  1IGD A;  2I2Y A;  1UWX A;  1XCQ L;  2LGI A;  4WH4 A;  3V3X A;  2GI9 A;  2IGH A;  4HKZ E;  1GB1 A;  2RPV A;  2N7J A;  2LHE A;  3MP9 A;  2PW9 A;  5HG2 A;  1FCL A;  2I38 A;  2ON8 A;  2IGD A;  5HFY A;  1P7F A;  2PTL A;  1K53 A;  2ONQ A;  2N9L A;  1PGX A;  2ZW0 A;  1C9F A;  1HEZ E;  2KDM A;  2KAC A;  3UI3 A;  4IKG A;  2GB1 A;  2JSV X;  1K51 A;  2J52 A;  1GB4 A;  4GLS C;  3FIL A;  1MPE A;  3FIL B;  2OED A;  1HZ6 A;  2LUM A;  2J53 A;  4KGS A;  4HJG E;  2JWU A;  5HHD G;  1KH0 A;  4MAC A;  1YNT E;  2PLP A;  1MI0 A;  4D2K A;  2KQ4 X;  5BMI A;  1YMH E;  2IGG A;  5HI1 A;  1QKZ A;  1P7E A;  1K50 A;  2ZW1 A;  2EEL A;  4OZC A;  5JXV A;  1JML A;  1XCT L;  1EM7 A;  2JXT A;  1ZXH A;  1HZ5 A;  1K52 A;  2NMQ A;  1FCC C;  3GB1 A;  2RMM A;  2QMT A;  1Q10 A;  1IBX A;  2JZP A;  1IBX B;  2QSD A;  5BMH A;  1F2R C;  4OZB A;  4KGT A;  2K0P A;  1IGC A;  1MHX A;  2JU6 X;  1D4B A;  1XF5 L;  1MVK A;  1FD6 A;  4IOI E;  2KWD A;  2N9K A;  1MHH E;  5BMG A;  1PGB A;  4KGR A;  2LHD A;  1F2R I;  1PGA A;  4OZA A; 
#chains in the Genus database with same CATH topology
 2WXJ A;  1L2N A;  2LZ6 A;  1C4C A;  4W9H A;  1ZW7 A;  1VCB A;  3DBH B;  1JAL A;  5IAA C;  4N59 A;  2KC2 A;  3ZQ4 A;  2C5L C;  1OEY A;  3H8H A;  2XBB C;  2LHE A;  2UYZ B;  2PW9 A;  3IT4 B;  2KLC A;  1FRD A;  4ACF A;  1E10 A;  1HQR D;  2KX0 A;  1SXT A;  3MHS D;  2DLB A;  2PTL A;  2FCQ A;  2J4X A;  3QIJ A;  4L23 A;  3DBL B;  4L1B A;  2JXX A;  1OQR A;  2IDY A;  1HEZ E;  4II2 B;  2A5U A;  3VRB B;  1FXI A;  5BYQ A;  1XLN A;  3AE2 B;  1C4P A;  4K81 A;  2FID A;  3PO0 A;  3PZD A;  1JWA D;  5J17 A;  1LGR A;  5D2M B;  4WQM A;  1RFA A;  2AQ3 B;  1K50 A;  5JXV A;  1TZ1 A;  4FJV B;  2KX3 A;  3IT6 B;  1FCC C;  5CHF A;  3L10 B;  2KAN A;  2L00 B;  2W54 A;  2FCN A;  1RRB A;  2DYB A;  4KIK B;  1UH6 A;  1XT9 B;  1IBX B;  2MBH A;  3DVG Y;  4HWI B;  2O6V A;  2OHF A;  1C78 A;  4X57 B;  4P16 A;  1CK1 A;  2BW2 A;  4KKI A;  4TQ1 A;  5AUK A;  1ZUD 2;  1LXD A;  1ZOY B;  3MFG A;  4ZYN A;  2LGX A;  5DPT A;  3E56 A;  4W9D A;  2JRI B;  2LXC A;  1T6B X;  2FUG 1;  2RDB C;  3TMP B;  5IP4 D;  2FNJ B;  3ML9 A;  2B3A A;  3WA0 A;  1E90 A;  2DAJ A;  4II3 B;  4WIP A;  4IM2 A;  2YLM A;  2K9X A;  1FEH A;  2L05 A;  1N60 A;  3PV1 A;  3PSE B;  4GDK A;  4NPN A;  1UGM A;  3Q8A A;  1LQB A;  3W9C B;  2ON8 A;  3NY5 A;  4USA A;  4IDI A;  2GBK A;  1UEL A;  5AZG A;  4A20 A;  3L13 A;  3ZYY X;  1WXQ A;  3V6C B;  1WYG A;  2N1W A;  3NZU A;  3N1X C;  2WYQ A;  4K3B A;  3PZ7 A;  5LXH A;  3NS8 A;  5IOI A;  4RFB A;  4KGS A;  4K7U A;  3V05 A;  3HIZ A;  2KQ7 A;  1UWM A;  2INN E;  2M1M A;  3QCA A;  2EEL A;  1JML A;  1HXY D;  4GIV A;  1ZXH A;  4RF1 A;  1V49 A;  1J19 A;  3TUO A;  2Y5B B;  3M3J A;  2BVC A;  5H8Y E;  4IUM B;  2BQQ A;  2WX1 A;  2GOW A;  4KGT A;  3WAO A;  1FNW A;  3SD5 A;  4FXC A;  4MJS B;  3KWL A;  3NVW A;  1L4D B;  3ZRF A;  1WXV A;  3VXW A;  1QZE A;  2MW5 A;  1BT0 A;  4IOI E;  4KX6 B;  4F8C B;  4N58 A;  2KDF B;  4W9J A;  1L0Y B;  1XXG A;  2KMA A;  4KKJ A;  2ZPY A;  1CZP A;  4YXD B;  2KDE B;  3IHP C;  4P1C C;  3AV8 A;  4B95 A;  3DVN U;  5BO4 B;  4GDL A;  2MBO A;  4DHZ E;  2WU2 B;  1WX8 A;  4M8N A;  4W9K A;  2IY0 B;  1I4Q A;  1IP9 A;  1JRU A;  3PRE A;  2KJ6 A;  4YSY B;  5G5H A;  4IW0 A;  1T0S C;  3P4R B;  1E8X A;  4WQO B;  5HKH A;  2MP2 A;  3KYC D;  1PFD A;  1P0R A;  2NBU A;  1ZGU B;  4PK1 A;  4MSM B;  2MWS B;  1K53 A;  2UU7 A;  3A1Q B;  4BKS D;  1R7S A;  3U2S C;  3EHV A;  4BKT A;  2KMM A;  4CQN A;  2KAC A;  2LVO A;  2K8C A;  3Q3F A;  2WXG A;  3ZNZ B;  1TT5 B;  1OQY A;  2LUM A;  2Y5P A;  1WF9 A;  2INP E;  1D3Z A;  1Z5S B;  2D3C A;  2KQ4 X;  1L6U A;  1L0X B;  4RGM A;  3SHQ A;  1CMX B;  5TR5 A;  1JWM D;  1EM7 A;  3RNG C;  2NS5 A;  4LNF A;  4FHJ A;  1H4R A;  2BWF A;  2RSU A;  4HEA 1;  2VH2 A;  1F2R C;  1V86 A;  4B6W A;  1ET6 A;  2DZM A;  2LUE A;  2C9W B;  3TL5 A;  3C19 A;  1VR9 A;  4HXD A;  2LGS A;  2ZEQ A;  4K7S A;  1SE2 A;  2KWD A;  1A5R A;  4MM3 A;  1MHH E;  3IBE A;  3O13 A;  3ZGZ A;  4G0N B;  3I5J C;  3L4P A;  4I6N B;  1F9J A;  1FPY A;  1IGD A;  2KFJ A;  1Y56 A;  4BOS C;  2G4D B;  4NY0 A;  3M63 B;  3N1Z C;  3RYT A;  1K8R B;  1KLV A;  2BS2 B;  3NS1 A;  3AE5 B;  1I35 A;  1VRA B;  2CS4 A;  2WXP A;  2E6X A;  3OWE B;  5DPR A;  2K25 A;  3HM6 X;  3HRD D;  1MG8 A;  2BTE A;  2WXO A;  4IWO A;  4RGT A;  4AOF A;  1I4H A;  1YN3 A;  3UIN B;  2JYE A;  1E5W A;  3B08 A;  1ZE3 D;  1XLQ A;  3ENE A;  2ZW0 A;  1VLB A;  1VZ8 A;  4XDC A;  2M17 A;  3ECI A;  1T0R C;  1KRH A;  2K3U A;  1KJT A;  4I6L B;  4XWT A;  3KLS X;  1QLB B;  2WXK A;  2JWU A;  5JHA A;  1JRP A;  2IGG A;  4MGK E;  1QKZ A;  1R4M I;  2KT7 A;  1JWS D;  3FKY A;  4OZC A;  4FAD A;  1P9D U;  2KFK A;  1M94 A;  3A33 B;  3ABV B;  1SEB D;  5D3D A;  4J3O D;  1T0Y A;  3IVF A;  2EKI A;  3MJW A;  4GSW A;  3H6N A;  4M0W B;  2N1V A;  2BGF A;  2WQY B;  3TBL D;  3ZXR A;  2GLS A;  4JGH B;  1MFW A;  4ICU A;  5E6O A;  2IO2 B;  4NJC A;  1TZO A;  1E6E B;  1JCK B;  1GG3 A;  1L6V A;  2EMS A;  3NHE B;  4MSQ B;  3U4E G;  4HCN B;  3KWV A;  1ESF A;  1FIQ A;  4ZRJ A;  2V0G A;  1PDX A;  2D11 A;  4JL9 A;  2FE8 A;  2NVU I;  2Y5C A;  4L2Y A;  1TS2 A;  3CWI A;  3Q3J A;  2CU1 A;  2KVR A;  3N9Y C;  2FCS A;  5AEK B;  4WJP A;  5EE9 A;  2LGI A;  4NJ6 A;  1AWD A;  4AJY B;  4HKZ E;  2LI5 A;  1GB1 A;  3N30 A;  3TSS A;  1YQB A;  4HK2 A;  3Q3O C;  4WAF A;  3V61 A;  3W1S A;  3ZIM A;  2IGD A;  2M0A A;  4XE0 A;  1AW7 A;  2AWT A;  2IO1 B;  4W9I A;  2JY6 A;  2N9P C;  1RYJ A;  3UQA A;  3TCA A;  1KFY B;  3H1U A;  2PVG C;  1L4Z B;  3AEC B;  4XGA B;  3OLM D;  4WWP A;  4S0R A;  1WGD A;  4ZRK A;  3A9J A;  3N20 C;  2DX5 B;  4GLS C;  3PRZ A;  3X23 A;  1OQQ A;  3ZDT A;  3MJ5 A;  3FAH A;  3SDL C;  1OTR B;  1YN5 A;  5AZH A;  4LNO A;  4HJG E;  4BFR A;  4EE2 A;  3TEW A;  4HDQ A;  4ANV A;  1NVI D;  1C1Y B;  1TBE A;  2W9N A;  2KJH B;  2IZV B;  3E9S A;  1SB3 C;  1IPG A;  2JWZ A;  3RMK C;  2NMQ A;  2JZ3 B;  1EU3 A;  2MBE A;  2W3S A;  2JZP A;  2N0S B;  3M62 B;  2AEH A;  2AYO B;  4JE3 B;  1TS4 A;  1TKE A;  2K5P A;  2KQS A;  2PIA A;  1WXM A;  3N32 A;  2LFI A;  3DHH C;  4ZRQ A;  2M4N A;  4C4V B;  2GBJ A;  2I1J A;  3ALB A;  3Q3N C;  1FD6 A;  2R61 A;  3AU4 A;  3C0R B;  1HTQ A;  1WZ0 A;  1WJU A;  4B9K A;  2KTR A;  2BKF A;  2KJR A;  3O65 B;  4FJY A;  2JVC A;  4LJO B;  2MJE A;  2B76 B;  3WAL A;  1UUP A;  4Q2J A;  3APF A;  5D94 A;  5FK9 C;  1FO4 A;  3TEX A;  1PQS A;  4WUR A;  3VDZ A;  1WX7 A;  2CJN A;  2V3S A;  1KF6 B;  2WXH A;  3LYY A;  2N9L A;  4EFO A;  1YX5 B;  3RT3 B;  1WI0 A;  4JX1 C;  1N5X A;  3VUY A;  2IO3 B;  1E8W A;  2MEK A;  1ZPS A;  4TUU A;  2Z0E B;  2MSE D;  1GOZ A;  3KUZ A;  3IXS A;  3ZTD A;  1FNV A;  2Z8L A;  5BYS A;  1L0V B;  2CHZ A;  1GC7 A;  2AL3 A;  1D6E C;  2PLP A;  3GE3 C;  4XC2 A;  3W2D A;  2XK5 B;  2L3Z A;  2MBB B;  1N62 A;  1V2Y A;  3IAS 1;  4J6I A;  1V9J A;  5FR3 A;  1WRD B;  3HK0 A;  4BKS A;  2M0X A;  1TKG A;  2LD9 A;  3GP7 A;  3HHM A;  4NAW A;  4XDD A;  4P1B C;  1HTO A;  4ZHP A;  1NEN B;  3BII D;  4HPP A;  2ZCC A;  2J0M A;  4MGZ E;  2ZVO A;  3JW0 X;  1MHX A;  3VUW A;  5IN7 A;  1YN4 A;  4KSL C;  1WGY A;  1OFF A;  1FFU A;  4HJK A;  4EZL A;  2NPT A;  2LEK A;  1YIW A;  1YJ1 A;  3T9L A;  1XQQ A;  2L52 A;  2K6Q A;  4DXF A;  1T0Q C;  1U4A A;  2SAK A;  2IBI B;  3PTF C;  3ZUN A;  1UWX A;  3LJ3 A;  2MRP A;  2LRU A;  3K9O B;  1P1A A;  3MHZ A;  4ZHO A;  2PEA A;  3KUC B;  3CMM B;  1EO6 A;  3SU8 X;  4LNI A;  2J0J A;  2GBM A;  4GDK B;  3RN9 C;  3AM9 A;  1WM3 A;  4W9G A;  4LLG M;  3VHT C;  2WDT B;  4AQ7 A;  2X38 A;  3KH0 A;  3PT2 B;  4N6E B;  3NVV A;  4EKU A;  2HD5 B;  2KWV B;  4AJW A;  2WLB A;  4ARI A;  1PGX A;  3FC4 A;  1DOI A;  5IA7 A;  3GZN I;  1WIA A;  2WHI A;  2KDM A;  3UI3 A;  4IKG A;  3OAW A;  4RMA A;  2LWP A;  1QIL A;  5DPS A;  3FIL A;  1WX9 A;  3NOB A;  4W9E A;  3R2I A;  2BF8 B;  4URK A;  1ZXI A;  1E8Z A;  4K1R B;  1EU4 A;  3P1M A;  1V1O A;  3B0A A;  5IKC M;  2WXL A;  3DBR I;  4MT5 A;  1XCT L;  2QC8 A;  2ICI A;  1K52 A;  2DZJ A;  3GB1 A;  4JWU C;  1GNU A;  4PYZ A;  1SGH A;  3EFC A;  1FFV A;  2QMT A;  2ZNV B;  2QSD A;  4IWP A;  1LO5 D;  1KLU D;  3DWG C;  2RGF A;  2K6D B;  2KZR A;  5JH5 C;  2L8J A;  3P42 A;  2JYT A;  2JRH A;  1D4B A;  3AI5 A;  4BBN C;  1XD3 B;  3U7D A;  4LDT B;  3EFU A;  3H9D A;  2LGY A;  3T8M A;  2BS4 B;  1F77 A;  4KGR A;  1FXT B;  2O2V B;  3DHI C;  1I42 A;  3BVM A;  4GDL B;  1VDV A;  1TYG B;  2AL6 A;  1SF0 A;  2VZK D;  4PS7 A;  1FNU A;  2UWQ A;  4QAY A;  1B9R A;  3DDC B;  4UDU C;  4WAA A;  4LNN A;  4EUT A;  3A9K B;  2DZI A;  2VRR B;  5AZF A;  3NUH B;  3QA8 A;  4CHK A;  4LK0 M;  4MEL A;  3LB8 C;  2MP2 B;  1V8C A;  1V80 A;  2ZCB A;  1FCL A;  2DYM A;  3BYT B;  1QF6 A;  2EMT A;  2G4S A;  4RM8 A;  1P7F A;  2L0T A;  1ZP0 B;  3VH3 B;  4F7Z A;  4GOC A;  3RCZ A;  1R4M B;  2RR9 A;  2J0K A;  2RD0 A;  5EE1 A;  4HVB A;  3H7P B;  2KO3 A;  4ZRI A;  2WS3 B;  1ET9 A;  5D6J B;  3ZLZ A;  5HHD G;  2BYT A;  3VH4 B;  3ONS A;  1D5Z C;  3V62 A;  1WMH A;  3AN1 A;  3PRM B;  3GOE A;  3SFE B;  4DQO C;  2WDR B;  3NRZ A;  2QJL A;  4YSZ B;  2W82 A;  3U30 A;  4HCP B;  3WCQ A;  1QOA A;  2NCN A;  4KV2 A;  4ICV A;  2BKR B;  2V3P A;  2IND C;  3ZVV A;  2BS3 B;  2FBW B;  1P98 A;  2REX A;  1NEK B;  1WXS A;  1YJI A;  3AE8 B;  3PVL A;  2ACZ B;  2QIL A;  1SJE D;  4NJ7 A;  4MM3 B;  1PGB A;  2IY1 B;  2KWU B;  2LHD A;  3AE6 B;  1E0Z A;  1C76 A;  2AQ2 B;  3NZ3 A;  1D5M C;  4WH4 A;  3NVZ A;  4DHZ B;  5H92 C;  1OEY J;  2NTT A;  5GXG B;  3RNC C;  4R3D A;  2KDB A;  3UGB B;  3JYU A;  3VQI A;  4TV3 A;  2GMI C;  2BYE A;  3WAP A;  2KAJ A;  5E6P A;  1Y8R C;  2KKC A;  2I1K A;  2MX2 A;  4BBN F;  3KYD D;  2RDG A;  4C7Y A;  1RAX A;  4ZYS A;  2WU5 B;  3VVW B;  2ONQ A;  3HM3 A;  2V4L A;  2LJ5 A;  3QK0 A;  4FA6 A;  3BVG A;  4RF0 A;  2JX5 A;  3RZF A;  1TIF A;  2PKO A;  2JSV X;  4YTP B;  4EOY A;  1F52 A;  2KHW B;  3PLV A;  4CYE A;  3Q8C A;  4LNK A;  4M01 A;  2HE7 A;  2MBQ A;  2M19 A;  3ZO5 B;  2N7E A;  4G3X B;  2KLG A;  2ZW1 A;  3MC9 A;  1F0Z A;  5GMV A;  2KFK B;  4RM9 A;  1HZ5 A;  4DK5 A;  1GAQ B;  3UIO B;  1N5W A;  2KD0 A;  3RUI B;  2KTF A;  4AS1 A;  2CR5 A;  3AEG B;  2BB5 A;  3BWU D;  2FUH B;  3HVD A;  1FXA A;  2K22 A;  1WYW B;  4MH0 E;  3QHT A;  1WR6 E;  2MLB A;  4FBJ B;  2WXR A;  1UZX B;  1EWY C;  2LMC A;  3AEE B;  1WY8 A;  5MPO A;  1E7U A;  1HA5 A;  3KVF B;  4AWJ A;  1STE A;  1V5O A;  2W55 A;  2NBV B;  4ITK A;  4LJP B;  1AAR A;  2RPQ A;  1PGA A;  2X8X X;  4ANW A;  3GS2 A;  3M95 A;  1RLF A;  2KN4 A;  1C3T A;  3VUX A;  1V1P A;  3U7Z A;  3DCG A;  3R3M A;  1XCQ L;  5J18 A;  4E71 A;  5C3J B;  2DBY A;  1V97 A;  2D07 B;  2Z0D B;  3B1L X;  3IG3 A;  3TEZ A;  3VTV A;  4A8X C;  3QWZ B;  3UQB A;  2K39 A;  5HFY A;  3DBS A;  1RM6 C;  3Q8F A;  2J42 A;  1TS3 A;  3BVZ A;  3Q6B A;  1WWT A;  2N9E B;  2D3G A;  4IG7 B;  3I63 C;  4XX5 A;  3W5V B;  4P6V F;  1MG4 A;  3LDZ E;  3ZJU A;  3OG5 A;  4DHJ B;  5G5G A;  3RPF C;  1KH0 A;  1EUV B;  1YNT E;  2L0F A;  1YMH E;  3S2A A;  1WFY A;  4NQK E;  1CJE A;  2LJI A;  4HPM B;  4KZ0 A;  2DEN B;  4XYC A;  2AX5 A;  1A70 A;  1MJD A;  1Z2M A;  3NJT A;  4JWS C;  1C77 A;  1WR1 A;  1NYR A;  1YD8 U;  4I6P A;  4WWO A;  5LNK 1;  1SSN A;  2FAZ A;  2WDV B;  2YEP B;  2DHZ A;  2BBC A;  2CHX A;  3V6E B;  3DOW A;  2L76 A;  4GN1 A;  1IGC A;  1WSP A;  2FCM A;  2JU6 X;  3RNA C;  2YEP F;  1YJJ A;  5KHO A;  4PT5 A;  3AE9 B;  3D32 A;  3I3T B;  1NDD A;  3R8B A;  5AUI A;  3U52 E;  1WJ4 A;  4DXA B;  4E74 A;  3RZW C;  4WJN A;  1Q0W B;  3BY4 B;  2QDF A;  1X1M A;  1NBF C;  2H88 B;  3EC8 A;  3ZJT A;  2KTR B;  3V3X A;  3PHW B;  2L83 A;  4DDG D;  1CQV A;  2IGH A;  2HTH A;  1TY2 A;  4KVG B;  3BZD B;  3GZN B;  4JQW C;  1N61 A;  1QOB A;  3DVN V;  2WXN A;  1EWC A;  2G1E A;  4P7I A;  3RUL A;  1YQ3 B;  3AU5 A;  1V5T A;  1JW9 D;  1EF1 A;  1AN8 A;  2HJ1 A;  2KC1 A;  2AQ1 B;  2N7D A;  4E3C A;  3DBR B;  2J52 A;  5L83 A;  3T3O A;  1C79 A;  1ZDX A;  2GBN A;  4MDK E;  3RI7 C;  4PYU A;  2JUO A;  2E3T A;  3NG0 A;  3SR6 A;  4BVU C;  1MI0 A;  3VR9 B;  2LVP A;  1TKY A;  3ZNI D;  5EDS A;  4AP4 C;  4K3C A;  2OJW A;  4B0M A;  1KLG D;  4IM0 A;  3VR8 B;  3AMZ A;  1E8Y A;  1UGJ A;  2QCZ A;  1DOY A;  5IO9 A;  2PPH A;  2KVZ A;  3Q2A C;  2KNB A;  4LCD E;  1SE4 A;  2PE6 B;  1WJN A;  3CSF A;  5BMH A;  1G6J A;  2ZNV C;  4NAW B;  3JSV A;  1YQ4 B;  4WJQ A;  3T3N A;  2K0P A;  3KW5 B;  2WXM A;  2C7H A;  2JQR B;  3H7S A;  3I57 A;  1D5X C;  1GJZ A;  4DBG A;  3L08 A;  1L5P A;  3RNE C;  3X0W A;  4MEM A;  1QOF A;  2NPT B;  1F2R I;  2QEJ C;  2PJH A;  4IC7 B;  1EF5 A;  2R2Q A;  2I2Y A;  3PZ8 A;  1J7B A;  4M02 A;  1E7P B;  2O6V B;  3RNB C;  3UF8 A;  4DDI D;  2GI9 A;  3KQ4 A;  2RPV A;  2N7J A;  3RFZ B;  3N1Y C;  4KZC A;  4MH8 A;  4BKG A;  3APC A;  2RDH A;  3P4P B;  2L7R A;  2XK5 A;  3WAM A;  3U8Z A;  1DGJ A;  3HUI A;  4YTN B;  1UNS A;  2V1Y A;  3AXC A;  1NI3 A;  1R4N I;  3BK2 A;  1VZ7 A;  4ANU A;  4RH6 A;  3FIL B;  1QT9 A;  3P2B A;  3C8Y A;  4B0E A;  3ZTC A;  1I4G A;  1BUI C;  5BMI A;  5E6N A;  4YSX B;  4A3P A;  3B2G A;  1GUA B;  5BYR A;  3WAN A;  4PS8 A;  3L0W B;  3W1Y A;  4OHJ A;  2K1F A;  2L32 A;  4C80 A;  5LLI A;  4HLE A;  2SEB D;  2JPH A;  4KIK A;  3W5U B;  1IBX A;  3KUD B;  2INC C;  4OZB A;  1L7Y A;  1XLO A;  3QQ8 B;  3NZS A;  4M8M A;  4EEW A;  4NQL B;  1P3Q U;  3V60 A;  4DHJ D;  4BZA A;  5BMG A;  4A6Q A;  3AB5 A;  3LXF A;  2N4F A;  1WH3 A;  4FHK A;  1TS5 A;  1J7C A;  2K8H A;  3ZNG C;  1TTN A;  4FUL A;  2MA9 B;  4KDI C;  2IO0 B;  3ZW3 A;  2BB6 A;  3CIR B;  4K7W A;  5EE3 A;  4RGN A;  3QAQ A;  5G2N A;  2VH1 A;  2MQJ A;  4REZ A;  3MP9 A;  2MH7 A;  4IWQ A;  5FR6 A;  3ZKJ C;  2I38 A;  1T3Q A;  1AYF A;  4ASW C;  4GB9 A;  4US8 A;  2BYV E;  4NZL B;  1C9F A;  3DBH I;  3ML8 A;  5CHW A;  5L95 C;  2WX0 A;  3B9J A;  1Q5W B;  2R2O A;  1DYQ A;  3DWM A;  3ZRC A;  2V9H A;  4KSK C;  1HZ6 A;  1BXT A;  1WM2 A;  4MAC A;  4EZK A;  4YTM B;  3MC8 A;  3IFW B;  1WJ6 A;  1WMH B;  3CF6 E;  2D10 A;  3DBL I;  2KOX A;  1ZDV A;  1HE8 A;  2K8B A;  2JXT A;  2YVC A;  3BYY B;  2J7Q B;  2MCN B;  2MJ3 A;  3PS6 A;  2G45 B;  2O2V A;  1IUE A;  3AE7 B;  3L54 A;  4MJS A;  5JHB A;  4WWM A;  1SE9 A;  3ZDM C;  2KYW A;  4YWG G;  4G11 A;  3BK1 A;  1WGH A;  1SIJ A;  3A9K A;  1T5X D;  1MVK A;  2WWZ A;  2N9K A;  1UBQ A;  3PLU A;  4AUQ C;  3APD A;  3WIM A;  2HJ8 A;  5I4D A;  3B2F A;  1DOX A;  1C4A A;  1NI2 A;  3R7Q A;  4JIO U;  4A3O A;  2QHO A;  3OJ3 A;  5LXI B;  2NBW B;  2LGD A;  3H7P A;  1KM7 A;  4F1S A;  3AED B;  3OJ4 B;  4JLC A;  5C1Z A;  2L1A A;  2KK8 A;  4KDL B;  2IPK D;  2CHW A;  1I4P A;  2JT4 B;  2XN9 C;  1S3S G;  4TMA B;  5HG2 A;  4LTU A;  2CJO A;  3Q8B A;  3QAR A;  4IM3 A;  3W1S C;  4ZDV A;  3A1Q A;  4GXB A;  4WJO A;  4OVV A;  1M4V A;  1VZ6 A;  3PHX B;  1RFK A;  4A90 A;  1JQ4 A;  1WRI A;  2Z59 B;  3EA6 A;  1LFD A;  1K51 A;  3ZJV A;  4W9F A;  2O6V D;  2OED A;  2HDE A;  4XWW A;  1V6E A;  2LRW A;  1IYF A;  4CO7 A;  2KN5 A;  4D2K A;  3TEY A;  3AEB B;  3R7R A;  3AE4 B;  2C7M B;  2WNM A;  2D3B A;  3Q69 A;  2JF5 A;  2D3A A;  2DWQ A;  4ZOH C;  1J8C A;  3Q14 C;  5J2R A;  4WWN A;  1B1Z A;  2DZK A;  2H89 B;  2WGS A;  2NTS A;  1TY0 A;  2RMM A;  2MHJ A;  3URY A;  4N9F 4;  3QC8 B;  3A4R A;  2GRI A;  3P63 A;  1JRO A;  4C7Z A;  1H8C A;  3ZXV A;  3QJZ A;  1E9M A;  1S1Q B;  3A4S C;  2OJR A;  5CX3 A;  4TSS A;  1KTK A;  2HTM E;  1TJE A;  2WXI A;  2G9H D;  3VTU A;  2A4Z A;  1UBI A;  2EKE C;  2WP9 B;  1KOT A;  1ISN A;  2C7N B;  3AE1 B;  3Q8E A;  3HVZ A;  3DHG C;  2BYF A;  4OZA A;  3AE3 B;  4G50 A;  1NYQ A;  3ETR A;  1PYW D;  1ZKH A;  3SEB A;  1V1P B;  3P4Q B;  1I4R A;  2DNF A;  1VD2 A;  1XEE A;  3L16 A;  2KMC A;  2DAF A;  1SIF A;  1GPX A;  5C2T B;  3RD2 A;  1XLP A;  2XNA C;  3MC0 B;  3JVZ X;  2GBR A;  4W9L A;  2ZZP B;  4M00 A;  4OVU A;  4BOZ B;  3N3K B;  1WXA A;  4A55 A;  2WXQ A;  2DYO A;  4BAX A;  5JZE B;  4MGY E;  2NR2 A;  3ZNH B;  1SJH D;  4OVZ A;  4HKQ A;  2ZPN A;  1WE7 A;  3EEC A;  3SFD B;  4GMV A;  2CU3 A;  2GB1 A;  1LM8 B;  1FM0 D;  3UIP B;  1GB4 A;  2MJD A;  4ARC A;  3P4S B;  1VJK A;  3QX1 A;  4O1N A;  1YOV B;  1WGR A;  1JWU D;  4XZ4 A;  2J53 A;  4HDO A;  5E6J A;  3BIN A;  3L17 A;  5HI1 A;  2PMV A;  1I4X A;  1P7E A;  3PGE A;  2BT6 A;  2CKH B;  4LDT D;  5TSS A;  3TJP A;  1BML C;  1WGK A;  1J0G A;  3R66 C;  3A9J B;  4RNA A;  4NNJ B;  4M0W A;  3I9V 1;  3Q3M C;  1UD7 A;  4GU2 A;  3DVG X;  1JWB D;  1XO3 A;  3DQV A;  2D5G A;  2KWC A;  1FRR A;  2LVQ A;  5FKA C;  4YL8 A;  4HRO A;  1WE6 A;  2C60 A;  5G55 A;  3NVY A;  5DPW A;  2KXJ A;  4A9A A;  3GE8 C;  1XF5 L;  1V81 A;  2ZJD A;  2XEW A;  4PS3 A;  4MGI E;  3VFK A;  4OW0 A;  2KDI A;  2WDQ B;  3RNF C;  4TKN A;  4C00 A;  3CST A;  5C23 A;  2LXA A;  1N63 A;  4NAM A;  5DCN A;  4GGQ A;  4FJZ A;  2BPS A;  2JZZ A;  2IJ0 A;  5CTR C;  1QOG A;  3AEF B;  2IYD B;  1SE3 A;  4ZRP A;  4TQ0 A;  2ASQ A;  1R4N B;  1TGZ B;  3EGR A;  4S17 A;  1E7V A;  3AEA B;  4C56 C;  1GC6 A;  1N6Z A;  1J7A A;  4W9C A;  4RCO A;  5KHQ A;  1FMA D;  4ANX A;  3PPA A;  2TSS A;  2Q5W D;  3IAM 1;  1UF0 A;  2M56 B;  2VZK B;  3VRA B;  4US9 A;  2G3Q B;  1Q1O A;  1MPE A;  2V3N A;  1OGW A;  3K9P B;  3PRP B;  1PUT A;  5T8I A;  2D2Q A;  3VTW A;  2BWE S;  5D7G A;  1F1H A;  1QQR A;  3MTN B;  2M8S A;  2N9X A;  1ACC A;  1ROE A;  4RGO S;  4HRS A;  1WGG A;  3EUB 2;  4HPL B;  4YT0 B;  3AUL A;  1YX6 B;  2ZVN A;  3VAW A;  1Q10 A;  3AH7 A;  2PVO D;  1SBB B;  2WXF A;  2QIE B;  3JSV B;  2FIF A;  4JPS A;  2Y3A A;  4H2A A;  2PE9 A;  1WZ3 A;  2V4I B;  1I7H A;  5CHV C;  3R2T A;  1RWS A;  3TIX A;  4C4V A;  3J9C A;  4DXG A;  4EZJ A;  2LAS A;  2OOB B;  3DPD A;  1ENF A;  4FLH A;  4FN2 A;  4DWF A;  2W3R A;  5D3I B;  5EE0 A; 
#chains in the Genus database with same CATH homology
 1C76 A;  3CWI A;  1TS5 A;  1J7C A;  3N9Y C;  2WXJ A;  1C4C A;  5EE9 A;  2AQ2 B;  3NZ3 A;  1D5M C;  2LGI A;  4WH4 A;  3NVZ A;  2BB6 A;  5H92 C;  1AWD A;  2NTT A;  4HKZ E;  3CIR B;  5GXG B;  1JAL A;  4N59 A;  5EE3 A;  4RGN A;  1GB1 A;  4R3D A;  3TSS A;  3ZQ4 A;  3H8H A;  4REZ A;  2LHE A;  3MP9 A;  2PW9 A;  2MH7 A;  3IT4 B;  3VQI A;  4WAF A;  2I38 A;  2KAJ A;  3W1S A;  1FRD A;  2IGD A;  2M0A A;  1AW7 A;  4XE0 A;  1E10 A;  1HQR D;  1SXT A;  1T3Q A;  1AYF A;  1RYJ A;  2DLB A;  2RDG A;  4C7Y A;  4ZYS A;  2PTL A;  2WU5 B;  4US8 A;  2ONQ A;  2J4X A;  1KFY B;  4NZL B;  2PVG C;  4L23 A;  1L4Z B;  3BVG A;  3AEC B;  4RF0 A;  1C9F A;  4L1B A;  2JX5 A;  3B9J A;  1OQR A;  2IDY A;  1HEZ E;  2PKO A;  1DYQ A;  2JSV X;  4YTP B;  4GLS C;  3VRB B;  1FXI A;  5BYQ A;  1OQQ A;  1XLN A;  3AE2 B;  1C4P A;  3DWM A;  3Q8C A;  1HZ6 A;  3MJ5 A;  3FAH A;  1BXT A;  1YN5 A;  3PO0 A;  4HJG E;  1JWA D;  4MAC A;  4YTM B;  4EE2 A;  3TEW A;  2M19 A;  4WQM A;  1NVI D;  2AQ3 B;  1K50 A;  2ZW1 A;  5JXV A;  1ZDV A;  3E9S A;  1F0Z A;  1SB3 C;  2JXT A;  3BYY B;  1HZ5 A;  2NMQ A;  1GAQ B;  1N5W A;  3IT6 B;  1FCC C;  2MJ3 A;  4AS1 A;  1EU3 A;  2W54 A;  3AEG B;  2W3S A;  2BB5 A;  3BWU D;  2JZP A;  2N0S B;  1IBX B;  1IUE A;  3AE7 B;  3HVD A;  4JE3 B;  2K22 A;  1FXA A;  1TS4 A;  1TKE A;  2K5P A;  2OHF A;  2PIA A;  1C78 A;  4WWM A;  2WXR A;  2LFI A;  4YWG G;  4ZRQ A;  1EWY C;  4P16 A;  1CK1 A;  2BW2 A;  3BK1 A;  2LMC A;  1SIJ A;  4KKI A;  4TQ1 A;  1ZUD 2;  5AUK A;  1T5X D;  3AEE B;  1ZOY B;  1MVK A;  1FD6 A;  3MFG A;  5MPO A;  1HA5 A;  2N9K A;  2R61 A;  1STE A;  3E56 A;  2W55 A;  4ITK A;  1T6B X;  2FUG 1;  5I4D A;  1PGA A;  3B2F A;  1DOX A;  1C4A A;  3GS2 A;  2KN4 A;  1V1P A;  3U7Z A;  1XCQ L;  5C3J B;  4WIP A;  2DBY A;  3AED B;  1V97 A;  2K9X A;  1FEH A;  2MJE A;  1N60 A;  2B76 B;  2L1A A;  1UUP A;  2IPK D;  4Q2J A;  1I4P A;  3TEZ A;  3Q8A A;  4A8X C;  5FK9 C;  2XN9 C;  1FO4 A;  4TMA B;  5HG2 A;  3TEX A;  3W9C B;  4LTU A;  2ON8 A;  4WUR A;  2CJO A;  1E0Z A;  4USA A;  3Q8B A;  5HFY A;  4IDI A;  2CJN A;  1KF6 B;  1RM6 C;  2WXH A;  3LYY A;  3Q8F A;  2J42 A;  2N9L A;  1TS3 A;  3ZYY X;  1WXQ A;  3BVZ A;  1WYG A;  1WWT A;  1M4V A;  1N5X A;  1VZ6 A;  4JX1 C;  1RFK A;  4A90 A;  1JQ4 A;  1WRI A;  2MEK A;  1ZPS A;  3EA6 A;  3W5V B;  1GOZ A;  1K51 A;  4P6V F;  3ZJV A;  3PZ7 A;  3IXS A;  1FNV A;  2Z8L A;  3ZJU A;  5BYS A;  1L0V B;  2OED A;  4RFB A;  2HDE A;  4XWW A;  4KGS A;  5G5G A;  3RPF C;  1D6E C;  1KH0 A;  3V05 A;  1YNT E;  2PLP A;  4D2K A;  1YMH E;  3TEY A;  3AEB B;  1CJE A;  2LJI A;  3AE4 B;  3W2D A;  1N62 A;  1UWM A;  2INN E;  3IAS 1;  2WNM A;  2AX5 A;  1A70 A;  3Q69 A;  2EEL A;  5FR3 A;  1JML A;  2DWQ A;  4ZOH C;  1HXY D;  4JWS C;  1B1Z A;  1ZXH A;  4RF1 A;  2H89 B;  1C77 A;  2NTS A;  3TUO A;  1NYR A;  1TKG A;  1TY0 A;  2RMM A;  5H8Y E;  3URY A;  2GRI A;  3GP7 A;  5LNK 1;  1SSN A;  2WDV B;  2YEP B;  3P63 A;  4XDD A;  2BBC A;  1JRO A;  4KGT A;  4ZHP A;  1FNW A;  1NEN B;  4C7Z A;  3BII D;  4FXC A;  3KWL A;  1IGC A;  1WSP A;  1E9M A;  3NVW A;  1L4D B;  1MHX A;  2JU6 X;  1YN4 A;  4TSS A;  1KTK A;  2HTM E;  1TJE A;  2WXI A;  2YEP F;  1OFF A;  2G9H D;  4IOI E;  4KX6 B;  4N58 A;  1YJJ A;  2WP9 B;  1FFU A;  1L0Y B;  1XXG A;  4KKJ A;  4PT5 A;  3AE9 B;  3AE1 B;  2LEK A;  3Q8E A;  3HVZ A;  1CZP A;  3R8B A;  5AUI A;  2L52 A;  3U52 E;  4OZA A;  3AE3 B;  4YXD B;  4DXF A;  3AV8 A;  1NYQ A;  2SAK A;  3ETR A;  1PYW D;  2WU2 B;  2H88 B;  3SEB A;  3ZJT A;  1UWX A;  1V1P B;  3P4Q B;  1I4R A;  1I4Q A;  1XEE A;  3V3X A;  2L83 A;  1CQV A;  2IGH A;  1GPX A;  4YSY B;  5G5H A;  1TY2 A;  5C2T B;  3BZD B;  1XLP A;  3P4R B;  2XNA C;  3MHZ A;  4ZHO A;  3MC0 B;  1N61 A;  1QOB A;  1PFD A;  4GDK B;  3AM9 A;  2WXN A;  1EWC A;  2G1E A;  4LLG M;  1YQ3 B;  4AQ7 A;  2X38 A;  4N6E B;  4A55 A;  1JW9 D;  2WXQ A;  2DYO A;  3NVV A;  1K53 A;  1SJH D;  1AN8 A;  4OVZ A;  4HKQ A;  2WLB A;  1R7S A;  2AQ1 B;  4ARI A;  1PGX A;  3U2S C;  3FC4 A;  1DOI A;  3SFD B;  2KMM A;  4CQN A;  2KDM A;  2CU3 A;  2KAC A;  3UI3 A;  4IKG A;  2GB1 A;  1FM0 D;  2J52 A;  1GB4 A;  2MJD A;  1QIL A;  4ARC A;  3FIL A;  3P4S B;  2WXG A;  3T3O A;  3R2I A;  1VJK A;  1C79 A;  2LUM A;  4O1N A;  1JWU D;  2Y5P A;  1ZDX A;  2J53 A;  2INP E;  2E3T A;  3SR6 A;  5E6J A;  1MI0 A;  1ZXI A;  2KQ4 X;  1L6U A;  3VR9 B;  1TKY A;  1L0X B;  5HI1 A;  2PMV A;  1I4X A;  4RGM A;  1P7E A;  1EU4 A;  3P1M A;  2BT6 A;  1V1O A;  5TSS A;  4B0M A;  1KLG D;  2WXL A;  1JWM D;  4MT5 A;  3VR8 B;  1BML C;  1XCT L;  3AMZ A;  1EM7 A;  1WGK A;  2ICI A;  1UGJ A;  1K52 A;  1DOY A;  4RNA A;  3GB1 A;  4JWU C;  4M0W A;  3I9V 1;  1FFV A;  2QMT A;  1SE4 A;  4HEA 1;  2QSD A;  5BMH A;  1JWB D;  1F2R C;  1XO3 A;  4NAW B;  1LO5 D;  1YQ4 B;  2D5G A;  1FRR A;  1KLU D;  3DWG C;  5FKA C;  3T3N A;  1ET6 A;  2K0P A;  4HRO A;  3P42 A;  2WXM A;  3NVY A;  2JQR B;  2JYT A;  3I57 A;  1D4B A;  1VR9 A;  4A9A A;  1XF5 L;  1D5X C;  1SE2 A;  2KWD A;  1L5P A;  1MHH E;  4OW0 A;  3O13 A;  2BS4 B;  2WDQ B;  1F77 A;  3ZGZ A;  1QOF A;  4KGR A;  1F2R I;  2QEJ C;  3L4P A;  1N63 A;  4NAM A;  1IGD A;  2I2Y A;  3PZ8 A;  1J7B A;  3BVM A;  1Y56 A;  4GDL B;  1E7P B;  1VDV A;  1TYG B;  1SF0 A;  2VZK D;  1FNU A;  2IJ0 A;  2GI9 A;  1QOG A;  1B9R A;  3AEF B;  3KQ4 A;  4UDU C;  2BS2 B;  3NS1 A;  3AE5 B;  1SE3 A;  4ZRP A;  4TQ0 A;  2RPV A;  1VRA B;  2WXP A;  2E6X A;  2N7J A;  3RFZ B;  3OWE B;  3HRD D;  3NUH B;  3EGR A;  2BTE A;  4LK0 M;  4MH8 A;  3LB8 C;  3AEA B;  1V8C A;  1FCL A;  2WXO A;  4C56 C;  2DYM A;  3BYT B;  1J7A A;  1QF6 A;  2RDH A;  3P4P B;  4RCO A;  1P7F A;  1ZP0 B;  4RGT A;  1FMA D;  1I4H A;  1YN3 A;  2JYE A;  1DGJ A;  3HUI A;  1ZE3 D;  1XLQ A;  4YTN B;  1UNS A;  2TSS A;  2ZW0 A;  1VLB A;  5EE1 A;  1NI3 A;  1VZ8 A;  2Q5W D;  3IAM 1;  4XDC A;  2M56 B;  2VZK B;  3VRA B;  4US9 A;  2WS3 B;  3BK2 A;  1VZ7 A;  1ET9 A;  1MPE A;  2V3N A;  4RH6 A;  3FIL B;  1QT9 A;  1KRH A;  2K3U A;  1PUT A;  5T8I A;  4XWT A;  3C8Y A;  3KLS X;  4B0E A;  1QLB B;  2WXK A;  2JWU A;  5EE0 A;  5HHD G;  1I4G A;  1JRP A;  2BYT A;  1BUI C;  5BMI A;  2IGG A;  1D5Z C;  5D7G A;  4YSX B;  1QKZ A;  3B2G A;  1QQR A;  5BYR A;  1JWS D;  3AN1 A;  4OZC A;  4OHJ A;  1ACC A;  3SFE B;  1ROE A;  4RGO S;  2L32 A;  3ABV B;  4HRS A;  4DQO C;  4C80 A;  1SEB D;  5D3D A;  2WDR B;  3EUB 2;  2QJL A;  3NRZ A;  2SEB D;  4J3O D;  4YT0 B;  2EKI A;  4YSZ B;  2W82 A;  3WCQ A;  1QOA A;  1Q10 A;  3W5U B;  1IBX A;  2WQY B;  3AH7 A;  2PVO D;  1SBB B;  2WXF A;  2V3P A;  4OZB A;  2QIE B;  2BS3 B;  2FBW B;  4JPS A;  4NJC A;  2Y3A A;  4H2A A;  1XLO A;  2V4I B;  1E6E B;  1JCK B;  1NEK B;  1TZO A;  1YJI A;  1I7H A;  1L6V A;  3AE8 B;  3R2T A;  1RWS A;  3U4E G;  3J9C A;  4DXG A;  2ACZ B;  3KWV A;  2QIL A;  1ESF A;  1FIQ A;  2V0G A;  1SJE D;  1PDX A;  4MM3 B;  1ENF A;  5BMG A;  4A6Q A;  1PGB A;  3AB5 A;  2LHD A;  2FE8 A;  3LXF A;  2W3R A;  3AE6 B;  2Y5C A;  4L2Y A;  5D3I B;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...