4WH4A

Protein gb1 quadruple mutant i6h/n8h/k28h/q32h
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLHLHGKTLKGETTTEAVDAATAEHVFKHYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Immunoglobulin G-binding protein G
publication title The double-histidine Cu2+-binding motif: a highly rigid, site-specific spin probe for electron spin resonance distance measurements.
pubmed doi rcsb
source organism Streptococcus sp. group g
total genus 15
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wh4A00
4KGSA 5JXVA 5HI1A 1ZXHA 3MP9A 5HFYA 1PGBA 1FD6A 1F2RI 4HJGE 1HZ6A 4KGTA 1K51A 3V3XA 4IKGA 3GB1A 1K53A 4HKZE 2KN4A 1IBXA 2N9KA 2QSDA 2IGGA 2PLPA 2NMQA 4OZBA 1F2RC 1JMLA 3FILB 4GLSC 1P7FA 1EM7A 2ZW1A 2QMTA 2GI9A 1MPEA 1MHHE 1UWXA 2EELA 1MVKA 2PW9A 2ONQA 2KQ4X 1HZ5A 2KDMA 2IGHA 2PTLA 2KACA 5HHDG 2GB1A 2JZPA 2LGIA 2LHDA 2RPVA 1XF5L 5BMHA 2JXTA 1P7EA 1GB4A 1HEZE 1QKZA 2LUMA 2JWUA 2ZW0A 3FILA 2J53A 1Q10A 2OEDA 1GB1A 2K0PA 2I2YA 4OZCA 4WH4A 1PGXA 1YNTE 1K52A 4MACA 2N9LA 3UI3A 1XCTL 1KH0A 1IBXB 5HG2A 1MHXA 1MI0A 4IOIE 1XCQL 2N7JA 2ON8A 2IGDA 4KGRA 2JU6X 1FCCC 4OZAA 1D4BA 2JSVX 2KWDA 1FCLA 1YMHE 1IGCA 2J52A 1PGAA 5BMGA 1K50A 2I38A 1C9FA 2LHEA 1IGDA 2RMMA 5BMIA 4D2KA
chains in the Genus database with same CATH superfamily
2FCNA 5HI1A 2BYTA 2LUEA 3H8HA 4L2YA 1E8YA 3U2SC 2H89B 2KWCA 3Q3OC 4RMAA 1V1PB 4I6PA 4K7SA 4M0WB 1YQBA 4A20A 2NTTA 5J18A 2KC2A 4AOFA 1WRIA 4PYZA 3ZNZB 3UQAA 3RMKC 3RT3B 5TSSA 3AU5A 3DBRB 3RFZB 4ARIA 4ARCA 1JROA 1JRUA 4N58A 2QMTA 4PS3A 3Q3MC 1V97A 3SR6A 1OEYJ 3VRBB 4DHZB 1I4GA 3MC9A 3H9DA 2KDEB 3B2FA 2CJNA 3VUXA 2OHFA 3NZSA 4MH8A 2DYOA 2K3UA 3AH7A 5E6OA 2ZNVB 2MEKA 2G4DB 2FAZA 2WLBA 2KWVB 1GC7A 1TT5B 3RD2A 1WR6E 3DHIC 1ET6A 2BBCA 2KOXA 3EHVA 3ZYYX 1S3SG 2PIAA 1D3ZA 3QAQA 1TKEA 2WYQA 2QEJC 4K3BA 3OJ3A 2J53A 4C80A 1C4AA 2N0SB 4P6VF 3PT2B 1EWYC 2WXRA 4KDIC 3WALA 3UF8A 3RNEC 3VTUA 2N7DA 3DHGC 2KKCA 1Q0WB 1SSNA 3DDCB 1UD7A 2IDYA 5KHOA 4HJKA 4XZ4A 1FCCC 2Y5CA 4A3PA 1TS3A 2R2OA 1I7HA 1WF9A 4JQWC 1IGCA 4YL8A 2GOWA 2KTRA 2MRPA 1C9FA 1IGDA 2X8XX 2O2VB 1QOAA 4C56C 4F7ZA 2NCNA 4IWQA 2LVPA 3AEDB 1I4RA 2DZKA 4AQ7A 2BYFA 3P2BA 4KZ0A 1RM6C 4XDDA 2D3GA 2WU5B 2Z0DB 2KMAA 1KLUD 2IGGA 3HVDA 1UBIA 2BS3B 2L05A 3B1LX 4JWUC 2WXKA 2RD0A 3WCQA 4GDLB 2LZ6A 1WR1A 3A1QA 3BK1A 1L0YB 4RFBA 3M95A 2I1JA 1FM0D 4C4VA 1T0SC 2MBBB 3ZVVA 3VQIA 4MELA 2LJIA 2X38A 4CO7A 2RPVA 3KUZA 1U4AA 1TS2A 4KZCA 4MM3A 1WM2A 1R4MI 2ZW0A 4EEWA 2KN5A 4FXCA 5IAAC 2INNE 4LTUA 2OEDA 4TQ1A 2LASA 1L2NA 3ABVB 1F1HA 2Y3AA 4KX6B 1E7UA 2JWZA 1HTOA 3QC8B 3UI3A 4A9AA 2RR9A 2A4ZA 2KJHB 1OQRA 3RCZA 4C7ZA 2YEPB 1ZUD2 4GU2A 2FUG1 3W2DA 1V9JA 2MCNB 1RWSA 4NJ7A 5BYQA 2J52A 1PGAA 1TKGA 4REZA 1T6BX 2I38A 4ASWC 2BS4B 1BXTA 2HJ8A 2LVQA 1LXDA 3N20C 3AB5A 1WZ0A 1WGKA 1A5RA 1FPYA 5D3IB 5IA7A 3KH0A 1XO3A 1KTKA 1YX6B 3PLVA 3P4PB 4P1CC 3AE2B 2INCC 2KNBA 5J2RA 1WRDB 4JIOU 4HCNB 3L17A 3CSFA 2HE7A 4ANVA 3PZDA 1TBEA 1WYWB 2KQ7A 1GNUA 2B3AA 3HHMA 2N4FA 3R7QA 2PPHA 2IO2B 3PO0A 1WJNA 3U30A 4WAAA 2JXXA 2EMSA 1HZ5A 1E5WA 2KWUB 1R7SA 3PS6A 1C77A 3SFEB 2K6DB 3PRMB 1MFWA 4FADA 5CHWA 4OW0A 2O6VD 1MJDA 3IAS1 3PZ7A 3Q3NC 2JWUA 3ZNGC 2WXJA 2AEHA 4KVGB 5I4DA 2MWSB 2LMCA 3NRZA 5C3JB 1OQYA 3W5VB 4LCDE 4PYUA 2JVCA 4MACA 4FN2A 4NAMA 2NBUA 3ZTCA 1STEA 3PREA 1CZPA 5D6JB 4GDKB 4WJPA 2MLBA 4XWWA 4JGHB 1TY0A 3WA0A 2M0AA 4A55A 3P4QB 3AV8A 1TYGB 1L6VA 3RUIB 1LM8B 1G6JA 2DYMA 2LVOA 2WDQB 1GG3A 4XE0A 1NVID 1YN4A 2C7NB 1WXQA 3K9PB 5KHQA 2N7EA 4DBGA 4ACFA 2KYWA 1SE4A 2AL6A 1TKYA 1D6EC 1JWBD 3NVYA 3PTFC 4Q2JA 4O1NA 2DX5B 1K51A 1V5OA 1EO6A 4LK0M 5JHAA 3ZTDA 1RLFA 2OJWA 2MJEA 3DWGC 2PMVA 1T0QC 1ZP0B 2INDC 1SB3C 3U4EG 3ZNHB 3B2GA 4RNAA 1Y8RC 4ANWA 4MGYE 4FULA 2GI9A 3SDLC 2K1FA 2LRWA 4NPNA 1QOGA 2Y5BB 1WGDA 1MHHE 2E6XA 3A33B 2KQ4X 4US8A 1N6ZA 1NI3A 2CHWA 2FCSA 4FBJB 4A3OA 2NS5A 2GB1A 3Q8BA 4MM3B 3AXCA 4M0WA 2L76A 4WQMA 2LGYA 2Z8LA 3TEYA 2RDHA 4BKGA 4S17A 2W55A 3VXWA 3BVMA 1V1OA 4G0NB 4ZRPA 1BT0A 1MG8A 3DWMA 2MBHA 1JWAD 3I9V1 5CX3A 1XQQA 4W9GA 1LGRA 4MDKE 1EF5A 1ZPSA 3WANA 2Q5WD 4IM0A 5IOIA 3NS1A 3JYUA 1WH3A 2IGDA 3HUIA 2BKFA 2W54A 4ANUA 2PJHA 2PVGC 3APCA 3FC4A 2RPQA 2WX0A 4W9CA 4ZYSA 1GC6A 4M8MA 3URYA 3TIXA 4IM2A 3P4RB 1FNUA 4HK2A 3AE6B 1YOVB 2QJLA 4L23A 4B0EA 5BYRA 2ZVOA 4BBNF 4RM8A 2DWQA 4FA6A 3QK0A 2H88B 2BYEA 2WXPA 4K81A 4B0MA 4DDGD 3RN9C 2D10A 1F2RC 4MSMB 2KXJA 3DHHC 5IP4D 3VDZA 1RAXA 1C79A 3KWLA 3A9JB 2D2QA 2O2VA 1C4PA 2HJ1A 4HPPA 2ZZPB 1SGHA 2PW9A 4AJWA 1IP9A 2QIEB 3CSTA 3U7DA 2KACA 1ROEA 1ZE3D 2MA9B 4GN1A 1QKZA 4PS8A 2KK8A 1C3TA 5E6PA 1WX9A 2KQSA 4JWSC 3NZUA 4GDLA 2KD0A 4EZKA 3Q8AA 1GUAB 2K0PA 3TEWA 3IT6B 4NJCA 4CQNA 4ANXA 2JY6A 1JALA 2ICIA 1N60A 2CKHB 3V60A 4OVZA 2D3BA 1OTRB 4WAFA 2J0JA 1AWDA 2BGFA 4LJOB 3AE7B 1CMXB 3N9YC 4HROA 1SJED 3T9LA 4NAWB 2BKRB 1C4CA 2L1AA 2WDRB 2JYTA 2DAJA 2WXIA 4WWNA 1SE2A 1F2RI 4ZYNA 2CU1A 1J0GA 2JPHA 1D5ZC 5J17A 4BZAA 3GB1A 3TUOA 1YQ3B 2CJOA 2IYDB 4TKNA 5D7GA 3IG3A 3VUWA 1ET9A 2K25A 2SAKA 4XDCA 2NMQA 1WGRA 3AECB 2O6VB 2OOBB 5LXIB 2IBIB 1JWUD 3Q8EA 2MBEA 4EFOA 4GLSC 3AEGB 1P3QU 5GXGB 1XLQA 4B95A 1RYJA 2L0TA 1R4NB 1WX8A 3ZGZA 5AEKB 1UWXA 5AZFA 2GBRA 1FRRA 2WWZA 4E74A 2KDMA 4DQOC 4JE3B 1TS4A 3P42A 3TCAA 3VVWB 3V05A 2LGIA 2M19A 2MHJA 2V1YA 2TSSA 4PK1A 2NBWB 3APDA 1EUVB 2KFJA 1T5XD 2LGDA 4HEA1 1WJUA 3Q8FA 3QQ8B 1I4PA 2V4IB 1KFYB 2WXHA 4E71A 1WIAA 3ZQ4A 1XEEA 1CK1A 3R3MA 4IG7B 2LRUA 1C76A 2M4NA 1J7CA 2AWTA 3AULA 3AEFB 1FFUA 2SEBD 3VHTC 3B9JA 3Q2AC 3TEZA 1QZEA 2WXMA 3CIRB 2ASQA 1K50A 2UU7A 2XNAC 5BMIA 3AU4A 1F0ZA 4KSKC 1WXSA 1SXTA 4DXAB 2DHZA 3NG0A 1XLPA 3SD5A 1V8CA 2KN4A 1SF0A 3E56A 3ML9A 1KRHA 4IWPA 4GDKA 3W5UB 3ZUNA 2D07B 2WU2B 3ZIMA 4YSYB 3WAMA 5EE0A 4G11A 1YJJA 2MP2B 2L32A 3DBLB 4LDTB 1IYFA 4ZOHC 2BB6A 1OQQA 2G1EA 3QWZB 4AUQC 4W9KA 2MW5A 1WX7A 2MX2A 2DENB 1C78A 3MC0B 3P63A 2FE8A 3Q69A 2ZVNA 3KLSX 2BQQA 1E7VA 4RH6A 1P7EA 3DOWA 1GB4A 3IT4B 1Q1OA 3TSSA 3A4RA 3WAOA 2BF8B 3KQ4A 1VR9A 4ZRKA 3FKYA 3RI7C 3ONSA 1K52A 1PUTA 4EZJA 3EFUA 1JWMD 2D5GA 1R4MB 3PRZA 2W3SA 1ZDXA 1FXTB 1XCQL 4G3XB 2WGSA 3R2TA 4E3CA 2AL3A 3LDZE 3VTVA 4OVVA 3AEAB 4W9FA 1QF6A 2WP9B 2IJ0A 1L4DB 1WXMA 5GMVA 1E8XA 4L1BA 1PGBA 4W9JA 3QCAA 1WJ4A 2MJ3A 1DOXA 4J3OD 3P4SB 2YEPF 2BW2A 3PRPB 4YSXB 3U52E 4YSZB 2BWES 4WURA 2JRHA 2CHZA 2K22A 4HKQA 1NDDA 3NHEB 4YXDB 4LNNA 5JH5C 5IKCM 3I5JC 1J7BA 2C60A 3C8YA 2KAJA 1PYWD 4TUUA 1MVKA 1PDXA 1L7YA 1CJEA 3OJ4B 3AMZA 1P0RA 1RRBA 2L0FA 3HVZA 5E6JA 2V4LA 4JL9A 1JWSD 1E9MA 5FR3A 4ZRQA 1SE3A 4M00A 4MGKE 3C19A 2ZEQA 4FJYA 3QX1A 2YVCA 4C00A 5D2MB 2AQ1B 3MJWA 2WDVB 1VRAB 3A9JA 1YX5B 4N9F4 4BVUC 4WH4A 3S2AA 3ZDMC 1I35A 1WM3A 2LGXA 2RDGA 4BKSD 4BKTA 4GB9A 2KMCA 1SE9A 1KOTA 4CHKA 1MHXA 3BINA 2KO3A 4KGRA 2JU6X 3OG5A 1SIJA 1L6UA 5BMGA 3L08A 2JQRB 2RMMA 1ZXHA 2YLMA 4NQLB 3DVGY 1TIFA 5G2NA 2DBYA 2HTME 5G55A 2W9NA 2BPSA 3W1SC 4RGOS 3EECA 4KIKB 1E90A 4KDLB 2MQJA 3L54A 4M01A 1VZ7A 4K3CA 2V3SA 3OAWA 2VH1A 1YQ4B 4NAWA 4BAXA 1B9RA 4NJ6A 3L10B 2V3PA 1M4VA 4ZDVA 4DWFA 3C0RB 4XX5A 2WDTB 1XLOA 3BZDB 2ONQA 3AE9B 2K9XA 2JYEA 2L3ZA 1HXYD 2PTLA 3BYTB 2G9HD 1E8ZA 3I57A 2AQ3B 2JXTA 2VZKD 4LNKA 4YTMB 2KJRA 2O6VA 2HTHA 3L13A 4A6QA 4LNOA 2M8SA 5LLIA 3JVZX 1QT9A 4DXFA 3MTNB 1PGXA 1QOBA 1YNTE 1N5WA 2ZPNA 5BO4B 2RGFA 3T3NA 2N9LA 1N61A 3BYYB 1FEHA 2NVUI 2DYBA 3UGBB 3D32A 3BVGA 2N9EB 2N7JA 1ZXIA 2L52A 1ZOYB 4BFRA 1NBFC 3CMMB 1GJZA 3DQVA 3NY5A 4WJNA 3T8MA 2FCQA 1YMHE 1WMHB 2FIFA 4A8XC 2J4XA 1E7PB 1E10A 3OWEB 4IUMB 4WJQA 4KGSA 1FNVA 4S0RA 2EKIA 1UGMA 1FD6A 1ZGUB 3AE1B 3HM3A 1ZDVA 5DCNA 1FFVA 4IKGA 4US9A 2KLGA 2N9KA 3H1UA 1TY2A 1PQSA 3PGEA 4NZLB 3RPFC 3QA8A 2LFIA 3CF6E 1VJKA 3N1ZC 2AQ2B 2LJ5A 2REXA 2Y5PA 4C7YA 3DBHI 1JQ4A 3ZW3A 1J19A 1EM7A 3RZFA 1P9DU 2K5PA 3Q8CA 1D5XC 3NUHB 1IPGA 1UUPA 3A4SC 4N6EB 4LJPB 3BIID 2V3NA 4TSSA 5LXHA 2R61A 1V81A 4DK5A 3SU8X 1NENB 2MBQA 4GXBA 2JZPA 1H8CA 2M0XA 1T0YA 3H6NA 1HE8A 1UWMA 2DLBA 1KF6B 3UIPB 2E3TA 2KJ6A 2ACZB 2LGSA 4ZHOA 2DZMA 3UINB 4JLCA 3J9CA 1WWTA 3PHWB 4MJSB 4F8CB 1P1AA 2MP2A 5E6NA 1L5PA 4IWOA 4WWOA 1L0XB 4IM3A 1KH0A 1WFYA 2M56B 4JX1C 1CQVA 2GBJA 4UDUC 3VUYA 1WGYA 4MT5A 4TMAB 5AUIA 4IOIE 3UQBA 2K8HA 3ZKJC 4ZRJA 2XK5B 1FXIA 5TR5A 3GE8C 2KWDA 2KLCA 3JSVA 3RNBC 4OVUA 4OHJA 4II3B 3H7SA 4D2KA 4EE2A 4AJYB 3MP9A 1NYRA 2PE6B 4RF0A 1TJEA 1H4RA 4KGTA 4NNJB 4N59A 3V3XA 3GS2A 2WX1A 2GRIA 2D3CA 3UIOB 1AYFA 2PEAA 3AEEB 2QSDA 1UNSA 1L4ZB 2M1MA 3ZO5B 2GBNA 2K39A 4MEMA 3TEXA 4J6IA 1V86A 2UYZB 5C2TB 5CHFA 5T8IA 2DNFA 3Q14C 2K8CA 2R2QA 3BY4B 3L4PA 2KZRA 1NI2A 1KJTA 1VLBA 3GZNI 3HK0A 3NOBA 1TGZB 4AS1A 3DPDA 4MGZE 2KDFB 4A90A 2KVRA 2GLSA 4ZRIA 5L95C 1WGGA 4HLEA 4I6NB 2CR5A 2ZNVC 4IDIA 2GBKA 2IZVB 3GE3C 1E0ZA 3AE5B 1WSPA 1V6EA 3EGRA 4AP4C 4PS7A 1SBBB 1NYQA 4FJZA 3ML8A 5C23A 1WI0A 3H7PB 1DOYA 3N32A 1ZKHA 1V2YA 4KSLC 1F77A 3B0AA 2KX0A 1ISNA 4EZLA 3MFGA 3DBSA 2N9XA 3NVWA 3R66C 1UBQA 2Z59B 5HG2A 5EE9A 3RZWC 3DVGX 3KVFB 2C7HA 1QOFA 3M62B 3IBEA 4NY0A 1BUIC 1D4BA 3ZRFA 2HDEA 1R4NI 1WY8A 1DYQA 4RM9A 3Q3FA 5G5HA 4MGIE 1YN5A 4TV3A 2HD5B 1WE6A 4YTNB 5G5GA 2IPKD 3AN1A 4HPLB 2GMIC 1WXVA 2QCZA 4I6LB 5FK9C 2JZ3B 4FHJA 1OGWA 3DBRI 1IUEA 1XXGA 1XT9B 3V62A 3SFDB 3VH3B 3PVLA 3R7RA 3PLUA 2RDBC 1WYGA 5DPWA 4OZBA 4RF1A 2KFKB 1V80A 2BB5A 2VZKB 2QC8A 3NS8A 1WE7A 3FILB 2KC1A 3R2IA 3MC8A 2L8JA 3RNAC 3GP7A 1YIWA 2J0MA 1UZXB 3SHQA 2M17A 2OJRA 2FBWB 2G3QB 2NTSA 1D5MC 4ZHPA 1M94A 4KIKA 3N1YC 4EOYA 4YWGG 3RNFC 4KV2A 2LHDA 2N1WA 5BMHA 2DAFA 2MH7A 2JF5A 1B1ZA 5AZGA 5MPOA 3LB8C 2EKEC 1PFDA 1E8WA 4HRSA 2IY1B 1JCKB 1XCTL 2VRRB 3GOEA 1IBXB 2J42A 3HM6X 4GOCA 4EKUA 4NQKE 2EMTA 1TZ1A 3JSVB 4K1RB 2PVOD 2JSVX 2V9HA 2KT7A 3DBLI 1EU3A 1SIFA 4W9EA 4HPMB 3MJ5A 2JT4B 1YD8U 2D11A 2LHEA 3QIJA 4W9IA 1KLGD 3NZ3A 3EFCA 4B9KA 1J7AA 3VRAB 3KYDD 4P1BC 2G4SA 4EUTA 1DGJA 4HKZE 3U7ZA 1HTQA 3AI5A 4HDOA 1I4XA 4W9HA 4P16A 3A9KB 3W1SA 4DHZE 2XN9C 1K8RB 2L7RA 1UF0A 1WMHA 3DVNU 3DCGA 2ZW1A 2C9WB 2WXQA 3PV1A 2KDBA 3VR9B 1FMAD 1FNWA 2EELA 5AZHA 4XYCA 3K9OB 3BK2A 3ZXVA 5EE3A 1T3QA 4W9DA 3ENEA 3PSEB 1E6EB 3N30A 3BVZA 1L0VB 3I63C 3LJ3A 1HQRD 5BYSA 4PT5A 3FAHA 3KWVA 3N3KB 4GMVA 1VD2A 5EDSA 3QHTA 2K6QA 2KANA 4CYEA 1I42A 4II2B 4OZCA 5H8YE 1N63A 1ESFA 2KMMA 3PPAA 2CS4A 5EE1A 1RFKA 1VCBA 2Z0EB 3SEBA 2LEKA 3Q6BA 4GIVA 4W9LA 2VH2A 2FCMA 2ON8A 1ACCA 4OZAA 2K8BA 3AE3B 3RNCC 1AW7A 3ETRA 4MJSA 5JXVA 1Y56A 5HFYA 3QARA 1I4QA 1MG4A 2WXFA 1QLBB 4KKJA 3X0WA 5C1ZA 1FIQA 2KTFA 1YN3A 1FRDA 2PE9A 5DPTA 2WXOA 1T0RC 4ITKA 3EC8A 3N1XC 4YT0B 2XK5A 4DHJD 3NVVA 4H2AA 1VZ8A 3AE4B 5DPSA 4XGAB 2J7QB 5IO9A 2BT6A 4K7UA 1GAQB 4HVBA 2J0KA 3ZJUA 4BOSC 4G50A 4BOZB 4USAA 1TZOA 4WIPA 3TBLD 2FIDA 2CHXA 2MBOA 3AE8B 1HA5A 3VFKA 3OLMD 1V49A 1QILA 4YTPB 4MSQB 4RGNA 3O65B 4P7IA 1JW9D 2QHOA 1HEZE 2KTRB 2WXGA 2B76B 1SJHD 1UELA 3RULA 2DZIA 1Q10A 1XD3B 2L83A 2I2YA 3NJTA 3TMPB 2QDFA 2ZPYA 4LLGM 1WXAA 1EWCA 1EF1A 2IO3B 5JHBA 1VDVA 4DXGA 4BKSA 5FKAC 1X1MA 3TL5A 1WZ3A 2NPTA 5JZEB 2V0GA 1N5XA 2DZJA 2WS3B 2MSED 4AWJA 1KLVA 4JPSA 3ZLZA 3A1QB 4XC2A 3H7PA 3W9CB 3ZRCA 3Q3JA 1J8CA 1GOZA 2N1VA 1N62A 3E9SA 4C4VB 2KHWB 3V6EB 4RGTA 4BBNC 4XWTA 3RNGC 3VR8B 3EUB2 3KUCB 2JRIB 1WJ6A 3HIZA 4WJOA 4TQ0A 4FHKA 3ZJTA 5DPRA 2W82A 2PLPA 3AM9A 3I3TB 2CU3A 5HKHA 1LFDA 1C1YB 1V1PA 2WHIA 3VTWA 1RFAA 3TJPA 1SEBD 3KYCD 3L0WB 1MPEA 2XEWA 3CWIA 1BMLC 5FR6A 3IFWB 4LDTD 3ZDTA 2BYVE 2INPE 3DBHB 4QAYA 2KX3A 3IVFA 2LXCA 1ENFA 5L83A 2AYOB 3QJZA 5CTRC 2C7MB 5HHDG 2QILA 2PKOA 1QQRA 1XF5L 5AUKA 1LO5D 2C5LC 3VH4B 2LUMA 2JUOA 4K7WA 2KFKA 1OFFA 3NVZA 1ZW7A 3KUDB 1A70A 3HRDD 3FILA 4URKA 2W3RA 2D3AA 1F52A 1YJIA 1Q5WB 4HDQA 2KDIA 2GBMA 4X57B 2ZJDA 3MHSD 3KW5B 5H92C 3IAM1 1F9JA 2WQYB 1I4HA 2LWPA 2NBVB 3M63B 4ICUA 1TTNA 1WGHA 3LYYA 3V61A 1FCLA 2AX5A 1GPXA 3LXFA 1VZ6A 3ZJVA 1OEYA 2IO0B 3ZXRA 2IY0B 4MH0E 4B6WA 2LXAA 4GSWA 2WXNA 3VAWA 4F1SA 1JRPA 2KVZA 2FNJB 4HJGE 1HZ6A 4ICVA 2RSUA 1UGJA 4R3DA 3PHXB 3IXSA 2IO1B 4RCOA 1K53A 3APFA 1S1QB 2BWFA 5LNK1 1IBXA 2JZZA 4RGMA 1DOIA 2LI5A 1AARA 1P98A 2A5UA 4M8NA 2XBBC 1UH6A 4LNFA 1JMLA 3O13A 3W1YA 2I1KA 1P7FA 1YJ1A 2L00B 3JW0X 1Z2MA 2BVCA 4WWPA 3R8BA 1TS5A 4HXDA 3WAPA 4DDID 5IN7A 2JX5A 3T3OA 4IC7B 3RYTA 4GGQA 5CHVC 3P1MA 5D3DA 3ECIA 2IGHA 3GZNB 2MJDA 3A9KA 3U8ZA 4FJVB 4KKIA 3X23A 2UWQA 4FLHA 2ZCBA 3B08A 3V6CB 1FO4A 3PZ8A 3IHPC 1GB1A 1LQBA 3ZNID 5D94A 3AEBB 2ZCCA 1KM7A 3MHZA 1XLNA 3BWUD 4WQOB 4IW0A 1Z5SB 2BS2B 1FXAA 4HCPB 2NPTB 2BTEA 1AN8A 1MI0A 2WNMA 1EU4A 4LNIA 2N9PC 3DVNV 2WXLA 3M3JA 3WIMA 4M02A 4DHJB 4HWIB 3EA6A 2FUHB 4WWMA 2G45B 1NEKB 2NR2A 2LD9A 3ALBA 1V5TA 3L16A
chains in the Genus database with same CATH topology
1FNUA 3AE6B 2QJLA 1J7AA 5HI1A 3VRAB 1ZXHA 4L23A 2BYTA 4B0EA 5BYRA 2DBYA 2HTME 3H8HA 1DGJA 2DWQA 4L2YA 4HKZE 3U7ZA 3U2SC 2H89B 4RGOS 2H88B 1V1PB 2WXPA 1I4XA 4B0MA 2NTTA 4P16A 1VZ7A 3W1SA 1F2RC 1WRIA 2XN9C 5TSSA 3RFZB 4ARIA 4ARCA 1C79A 1YQ4B 1JROA 2ZW1A 4N58A 3KWLA 2QMTA 1B9RA 1V97A 3SR6A 3VRBB 2V3PA 1C4PA 1M4VA 1I4GA 2WXQA 3B2FA 3VR9B 1FMAD 2CJNA 1XLOA 3BZDB 1FNWA 2EELA 2OHFA 2ONQA 2PW9A 3AE9B 4MH8A 2DYOA 2K3UA 2K9XA 2JYEA 3AH7A 3BK2A 2QIEB 2MEKA 1HXYD 5EE3A 1T3QA 2WLBA 2PTLA 2KACA 1ROEA 2G9HD 1E6EB 3BYTB 3I57A 2AQ3B 3BVZA 1L0VB 1ZE3D 2JXTA 2BBCA 1ET6A 3ZYYX 1HQRD 1QKZA 2VZKD 5BYSA 4YTMB 2PIAA 4PT5A 3FAHA 1TKEA 3KWVA 2QEJC 4A6QA 4JWSC 2J53A 4C80A 3Q8AA 1QT9A 4DXFA 1C4AA 2K0PA 3TEWA 3IT6B 4OZCA 5H8YE 1PGXA 1QOBA 1YNTE 1N5WA 2N0SB 1N63A 4NJCA 4P6VF 4CQNA 1EWYC 2WXRA 1ESFA 2KMMA 3T3NA 2N9LA 5EE1A 1N61A 3BYYB 1FEHA 1RFKA 1SSNA 3SEBA 1JALA 2LEKA 2ICIA 2IDYA 3BVGA 1N60A 2N7JA 1ZXIA 2ON8A 1ACCA 4OVZA 2L52A 4WAFA 1AWDA 1FCCC 1ZOYB 2Y5CA 4OZAA 1TS3A 1I7HA 3AE7B 3N9YC 4HROA 1YMHE 1SJED 3AE3B 1IGCA 4NAWB 4A8XC 2J4XA 1C9FA 1AW7A 1C4CA 2L1AA 3ETRA 1E7PB 2WDRB 1IGDA 1E10A 1QOAA 3OWEB 2JYTA 2WXIA 4KGSA 1FNVA 5JXVA 4C56C 1Y56A 2EKIA 5HFYA 1SE2A 1FD6A 1I4QA 1F2RI 3AEDB 1I4RA 2WXFA 1QLBB 3AE1B 4KKJA 4AQ7A 1D5ZC 1ZDVA 1FFVA 4IKGA 3GB1A 3TUOA 1YQ3B 1FIQA 2CJOA 1RM6C 4US9A 4XDDA 1YN3A 2N9KA 5D7GA 1FRDA 2WU5B 1TY2A 1KLUD 2IGGA 2WXOA 3HVDA 4ITKA 1ET9A 2BS3B 2SAKA 4XDCA 4NZLB 2NMQA 4JWUC 4YT0B 3RPFC 2LFIA 1VJKA 2WXKA 3AECB 3NVVA 2AQ2B 3WCQA 4H2AA 1JWUD 2Y5PA 3Q8EA 1VZ8A 4C7YA 1JQ4A 3AE4B 4GDLB 4GLSC 1EM7A 3BK1A 3AEGB 1L0YB 5GXGB 1XLQA 1RYJA 2BT6A 4RFBA 3ZGZA 1GAQB 2K5PA 3ZJUA 3Q8CA 1D5XC 1UWXA 4USAA 1FM0D 1TZOA 3NUHB 4WIPA 4N6EB 1UUPA 3BIID 2V3NA 1FRRA 4TSSA 2KDMA 3AE8B 1HA5A 3VQIA 4DQOC 2R61A 4JE3B 1TS4A 1NENB 3P42A 2JZPA 2LJIA 4YTPB 1QILA 2X38A 2LGIA 4RGNA 2RPVA 3V05A 1UWMA 1TS2A 2DLBA 1JW9D 1KF6B 2E3TA 1HEZE 2ACZB 2M19A 2WXGA 2B76B 1SJHD 4ZHOA 2ZW0A 2TSSA 4FXCA 2INNE 3J9CA 4LTUA 1WWTA 1Q10A 1T5XD 2OEDA 4HEA1 2L83A 4TQ1A 3ABVB 2I2YA 2Y3AA 1L5PA 3Q8FA 4LLGM 4KX6B 1EWCA 1I4PA 1L0XB 2V4IB 1VDVA 1KFYB 4DXGA 2WXHA 3UI3A 1KH0A 2M56B 4A9AA 4JX1C 5FKAC 1CQVA 4UDUC 3ZQ4A 1OQRA 1XEEA 1CK1A 4C7ZA 4MT5A 4TMAB 5AUIA 4IOIE 1C76A 2YEPB 1J7CA 1ZUD2 2FUG1 3W2DA 1FXIA 2V0GA 1N5XA 2WS3B 3AEFB 1FFUA 2SEBD 3B9JA 2KWDA 3TEZA 4JPSA 1RWSA 5BYQA 2J52A 2WXMA 1PGAA 1TKGA 3CIRB 4REZA 1T6BX 1K50A 2I38A 4OHJA 2BS4B 3W9CB 1BXTA 2XNAC 4D2KA 5BMIA 4EE2A 3AB5A 1GOZA 1WGKA 1F0ZA 1N62A 3MP9A 3E9SA 1NYRA 5D3IB 4RF0A 1TJEA 4RGTA 1SXTA 4KGTA 4XWTA 4N59A 3VR8B 3V3XA 1XO3A 3GS2A 2GRIA 3EUB2 1KTKA 1XLPA 3P4PB 1AYFA 1V8CA 2KN4A 1SF0A 3AE2B 3E56A 3AEEB 1KRHA 3W5UB 2QSDA 1UNSA 4TQ0A 1L4ZB 3ZJTA 2W82A 2PLPA 2WU2B 3AM9A 3TEXA 2CU3A 5C2TB 5T8IA 4YSYB 1V1PA 5EE0A 1YJJA 1SEBD 2L32A 3L4PA 1MPEA 3CWIA 1BMLC 1VLBA 4ZOHC 3PO0A 2BB6A 4AS1A 1OQQA 2INPE 2G1EA 4A90A 1HZ5A 1R7SA 4IDIA 1C78A 1C77A 3MC0B 3SFEB 3P63A 1E0ZA 2FE8A 1ENFA 3AE5B 3Q69A 1WSPA 5HHDG 3EGRA 3KLSX 2QILA 2PKOA 1QQRA 4OW0A 1XF5L 5AUKA 4RH6A 1P7EA 1GB4A 1LO5D 3IAS1 1SBBB 3IT4B 1NYQA 3TSSA 2LUMA 3PZ7A 1OFFA 3NVZA 2JWUA 2WXJA 1A70A 3HRDD 3FILA 3KQ4A 2W3RA 1VR9A 5I4DA 1DOYA 2LMCA 3NRZA 5C3JB 3W5VB 1YJIA 1F77A 1K52A 1PUTA 1JWMD 4MACA 4NAMA 3MFGA 2D5GA 1STEA 3NVWA 1CZPA 5H92C 3IAM1 2W3SA 5HG2A 5EE9A 1ZDXA 4GDKB 2WQYB 1XCQL 1I4HA 4XWWA 1QOFA 1TY0A 4A55A 2M0AA 3P4QB 1BUIC 1D4BA 3LYYA 1FCLA 2HDEA 3AV8A 3R2TA 1TYGB 1DYQA 1L6VA 2AX5A 3LXFA 1GPXA 1VZ6A 3ZJVA 2DYMA 2WDQB 3AEAB 1NVID 1YN4A 4XE0A 5G5HA 1YN5A 1WXQA 1QF6A 4YTNB 5G5GA 2WP9B 2IPKD 2IJ0A 2WXNA 3AN1A 1JRPA 1L4DB 1SE4A 4L1BA 1PGBA 4HJGE 1HZ6A 1D6EC 1JWBD 1TKYA 3NVYA 5FK9C 4Q2JA 4O1NA 1UGJA 2MJ3A 1DOXA 1K51A 3P4SB 4J3OD 4R3DA 3IXSA 2YEPF 2BW2A 4RCOA 1IUEA 1K53A 4YSXB 4LK0M 1XXGA 5LNK1 1IBXA 4RGMA 3U52E 3SFDB 1DOIA 4YSZB 2MJEA 3DWGC 4WURA 1WYGA 2PMVA 2K22A 4OZBA 4HKQA 4RF1A 1JMLA 1ZP0B 3O13A 1SB3C 3U4EG 2BB5A 2VZKB 4YXDB 3B2GA 4RNAA 3FILB 3R2IA 1P7FA 1J7BA 2GI9A 3GP7A 3C8YA 2KAJA 1PYWD 1QOGA 3R8BA 2FBWB 1TS5A 1MHHE 2E6XA 2JX5A 1MVKA 1PDXA 2NTSA 2KQ4X 4US8A 1CJEA 3T3OA 3AMZA 5E6JA 3HVZA 3P1MA 1NI3A 5D3DA 1D5MC 2IGHA 4ZHPA 2GB1A 1JWSD 3Q8BA 4MM3B 1E9MA 4YWGG 4M0WA 5FR3A 2LHDA 5BMHA 4WQMA 4ZRQA 1SE3A 2MJDA 2MH7A 1B1ZA 2Z8LA 4KKIA 3TEYA 2RDHA 5MPOA 2AQ1B 2W55A 3BVMA 1V1OA 1FO4A 3PZ8A 2WDVB 1VRAB 1GB1A 3LB8C 4WH4A 4ZRPA 3AEBB 3DWMA 1XLNA 3BWUD 1PFDA 3MHZA 1JWAD 2RDGA 3I9V1 4HRSA 1JCKB 2BS2B 1XCTL 1FXAA 1ZPSA 2BTEA 1IBXB 2J42A 1AN8A 2Q5WD 1MHXA 1MI0A 2WNMA 1EU4A 3NS1A 2IGDA 3HUIA 4KGRA 2JU6X 2PVOD 2W54A 2JSVX 2WXLA 2PVGC 1EU3A 3FC4A 1SIJA 3EA6A 4ZYSA 1L6UA 3MJ5A 5BMGA 3URYA 4WWMA 1NEKB 2LHEA 2JQRB 1KLGD 2RMMA 3P4RB 3NZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGS A;  5JXV A;  5HI1 A;  1ZXH A;  3MP9 A;  5HFY A;  1PGB A;  1FD6 A;  1F2R I;  4HJG E;  1HZ6 A;  4KGT A;  1K51 A;  3V3X A;  4IKG A;  3GB1 A;  1K53 A;  4HKZ E;  2KN4 A;  1IBX A;  2N9K A;  2QSD A;  2IGG A;  2PLP A;  2NMQ A;  4OZB A;  1F2R C;  1JML A;  3FIL B;  4GLS C;  1P7F A;  1EM7 A;  2ZW1 A;  2QMT A;  2GI9 A;  1MPE A;  1MHH E;  1UWX A;  2EEL A;  1MVK A;  2PW9 A;  2ONQ A;  2KQ4 X;  1HZ5 A;  2KDM A;  2IGH A;  2PTL A;  2KAC A;  5HHD G;  2GB1 A;  2JZP A;  2LGI A;  2LHD A;  2RPV A;  1XF5 L;  5BMH A;  2JXT A;  1P7E A;  1GB4 A;  1HEZ E;  1QKZ A;  2LUM A;  2JWU A;  2ZW0 A;  3FIL A;  2J53 A;  1Q10 A;  2OED A;  1GB1 A;  2K0P A;  2I2Y A;  4OZC A;  4WH4 A;  1PGX A;  1YNT E;  1K52 A;  4MAC A;  2N9L A;  3UI3 A;  1XCT L;  1KH0 A;  1IBX B;  5HG2 A;  1MHX A;  1MI0 A;  4IOI E;  1XCQ L;  2N7J A;  2ON8 A;  2IGD A;  4KGR A;  2JU6 X;  1FCC C;  4OZA A;  1D4B A;  2JSV X;  2KWD A;  1FCL A;  1YMH E;  1IGC A;  2J52 A;  1PGA A;  5BMG A;  1K50 A;  2I38 A;  1C9F A;  2LHE A;  1IGD A;  2RMM A;  5BMI A;  4D2K A; 
#chains in the Genus database with same CATH topology
 2FCN A;  5HI1 A;  2BYT A;  2LUE A;  3H8H A;  4L2Y A;  1E8Y A;  3U2S C;  2H89 B;  2KWC A;  3Q3O C;  4RMA A;  1V1P B;  4I6P A;  4K7S A;  4M0W B;  1YQB A;  4A20 A;  2NTT A;  5J18 A;  2KC2 A;  4AOF A;  1WRI A;  4PYZ A;  3ZNZ B;  3UQA A;  3RMK C;  3RT3 B;  5TSS A;  3AU5 A;  3DBR B;  3RFZ B;  4ARI A;  4ARC A;  1JRO A;  1JRU A;  4N58 A;  2QMT A;  4PS3 A;  3Q3M C;  1V97 A;  3SR6 A;  1OEY J;  3VRB B;  4DHZ B;  1I4G A;  3MC9 A;  3H9D A;  2KDE B;  3B2F A;  2CJN A;  3VUX A;  2OHF A;  3NZS A;  4MH8 A;  2DYO A;  2K3U A;  3AH7 A;  5E6O A;  2ZNV B;  2MEK A;  2G4D B;  2FAZ A;  2WLB A;  2KWV B;  1GC7 A;  1TT5 B;  3RD2 A;  1WR6 E;  3DHI C;  1ET6 A;  2BBC A;  2KOX A;  3EHV A;  3ZYY X;  1S3S G;  2PIA A;  1D3Z A;  3QAQ A;  1TKE A;  2WYQ A;  2QEJ C;  4K3B A;  3OJ3 A;  2J53 A;  4C80 A;  1C4A A;  2N0S B;  4P6V F;  3PT2 B;  1EWY C;  2WXR A;  4KDI C;  3WAL A;  3UF8 A;  3RNE C;  3VTU A;  2N7D A;  3DHG C;  2KKC A;  1Q0W B;  1SSN A;  3DDC B;  1UD7 A;  2IDY A;  5KHO A;  4HJK A;  4XZ4 A;  1FCC C;  2Y5C A;  4A3P A;  1TS3 A;  2R2O A;  1I7H A;  1WF9 A;  4JQW C;  1IGC A;  4YL8 A;  2GOW A;  2KTR A;  2MRP A;  1C9F A;  1IGD A;  2X8X X;  2O2V B;  1QOA A;  4C56 C;  4F7Z A;  2NCN A;  4IWQ A;  2LVP A;  3AED B;  1I4R A;  2DZK A;  4AQ7 A;  2BYF A;  3P2B A;  4KZ0 A;  1RM6 C;  4XDD A;  2D3G A;  2WU5 B;  2Z0D B;  2KMA A;  1KLU D;  2IGG A;  3HVD A;  1UBI A;  2BS3 B;  2L05 A;  3B1L X;  4JWU C;  2WXK A;  2RD0 A;  3WCQ A;  4GDL B;  2LZ6 A;  1WR1 A;  3A1Q A;  3BK1 A;  1L0Y B;  4RFB A;  3M95 A;  2I1J A;  1FM0 D;  4C4V A;  1T0S C;  2MBB B;  3ZVV A;  3VQI A;  4MEL A;  2LJI A;  2X38 A;  4CO7 A;  2RPV A;  3KUZ A;  1U4A A;  1TS2 A;  4KZC A;  4MM3 A;  1WM2 A;  1R4M I;  2ZW0 A;  4EEW A;  2KN5 A;  4FXC A;  5IAA C;  2INN E;  4LTU A;  2OED A;  4TQ1 A;  2LAS A;  1L2N A;  3ABV B;  1F1H A;  2Y3A A;  4KX6 B;  1E7U A;  2JWZ A;  1HTO A;  3QC8 B;  3UI3 A;  4A9A A;  2RR9 A;  2A4Z A;  2KJH B;  1OQR A;  3RCZ A;  4C7Z A;  2YEP B;  1ZUD 2;  4GU2 A;  2FUG 1;  3W2D A;  1V9J A;  2MCN B;  1RWS A;  4NJ7 A;  5BYQ A;  2J52 A;  1PGA A;  1TKG A;  4REZ A;  1T6B X;  2I38 A;  4ASW C;  2BS4 B;  1BXT A;  2HJ8 A;  2LVQ A;  1LXD A;  3N20 C;  3AB5 A;  1WZ0 A;  1WGK A;  1A5R A;  1FPY A;  5D3I B;  5IA7 A;  3KH0 A;  1XO3 A;  1KTK A;  1YX6 B;  3PLV A;  3P4P B;  4P1C C;  3AE2 B;  2INC C;  2KNB A;  5J2R A;  1WRD B;  4JIO U;  4HCN B;  3L17 A;  3CSF A;  2HE7 A;  4ANV A;  3PZD A;  1TBE A;  1WYW B;  2KQ7 A;  1GNU A;  2B3A A;  3HHM A;  2N4F A;  3R7Q A;  2PPH A;  2IO2 B;  3PO0 A;  1WJN A;  3U30 A;  4WAA A;  2JXX A;  2EMS A;  1HZ5 A;  1E5W A;  2KWU B;  1R7S A;  3PS6 A;  1C77 A;  3SFE B;  2K6D B;  3PRM B;  1MFW A;  4FAD A;  5CHW A;  4OW0 A;  2O6V D;  1MJD A;  3IAS 1;  3PZ7 A;  3Q3N C;  2JWU A;  3ZNG C;  2WXJ A;  2AEH A;  4KVG B;  5I4D A;  2MWS B;  2LMC A;  3NRZ A;  5C3J B;  1OQY A;  3W5V B;  4LCD E;  4PYU A;  2JVC A;  4MAC A;  4FN2 A;  4NAM A;  2NBU A;  3ZTC A;  1STE A;  3PRE A;  1CZP A;  5D6J B;  4GDK B;  4WJP A;  2MLB A;  4XWW A;  4JGH B;  1TY0 A;  3WA0 A;  2M0A A;  4A55 A;  3P4Q B;  3AV8 A;  1TYG B;  1L6V A;  3RUI B;  1LM8 B;  1G6J A;  2DYM A;  2LVO A;  2WDQ B;  1GG3 A;  4XE0 A;  1NVI D;  1YN4 A;  2C7N B;  1WXQ A;  3K9P B;  5KHQ A;  2N7E A;  4DBG A;  4ACF A;  2KYW A;  1SE4 A;  2AL6 A;  1TKY A;  1D6E C;  1JWB D;  3NVY A;  3PTF C;  4Q2J A;  4O1N A;  2DX5 B;  1K51 A;  1V5O A;  1EO6 A;  4LK0 M;  5JHA A;  3ZTD A;  1RLF A;  2OJW A;  2MJE A;  3DWG C;  2PMV A;  1T0Q C;  1ZP0 B;  2IND C;  1SB3 C;  3U4E G;  3ZNH B;  3B2G A;  4RNA A;  1Y8R C;  4ANW A;  4MGY E;  4FUL A;  2GI9 A;  3SDL C;  2K1F A;  2LRW A;  4NPN A;  1QOG A;  2Y5B B;  1WGD A;  1MHH E;  2E6X A;  3A33 B;  2KQ4 X;  4US8 A;  1N6Z A;  1NI3 A;  2CHW A;  2FCS A;  4FBJ B;  4A3O A;  2NS5 A;  2GB1 A;  3Q8B A;  4MM3 B;  3AXC A;  4M0W A;  2L76 A;  4WQM A;  2LGY A;  2Z8L A;  3TEY A;  2RDH A;  4BKG A;  4S17 A;  2W55 A;  3VXW A;  3BVM A;  1V1O A;  4G0N B;  4ZRP A;  1BT0 A;  1MG8 A;  3DWM A;  2MBH A;  1JWA D;  3I9V 1;  5CX3 A;  1XQQ A;  4W9G A;  1LGR A;  4MDK E;  1EF5 A;  1ZPS A;  3WAN A;  2Q5W D;  4IM0 A;  5IOI A;  3NS1 A;  3JYU A;  1WH3 A;  2IGD A;  3HUI A;  2BKF A;  2W54 A;  4ANU A;  2PJH A;  2PVG C;  3APC A;  3FC4 A;  2RPQ A;  2WX0 A;  4W9C A;  4ZYS A;  1GC6 A;  4M8M A;  3URY A;  3TIX A;  4IM2 A;  3P4R B;  1FNU A;  4HK2 A;  3AE6 B;  1YOV B;  2QJL A;  4L23 A;  4B0E A;  5BYR A;  2ZVO A;  4BBN F;  4RM8 A;  2DWQ A;  4FA6 A;  3QK0 A;  2H88 B;  2BYE A;  2WXP A;  4K81 A;  4B0M A;  4DDG D;  3RN9 C;  2D10 A;  1F2R C;  4MSM B;  2KXJ A;  3DHH C;  5IP4 D;  3VDZ A;  1RAX A;  1C79 A;  3KWL A;  3A9J B;  2D2Q A;  2O2V A;  1C4P A;  2HJ1 A;  4HPP A;  2ZZP B;  1SGH A;  2PW9 A;  4AJW A;  1IP9 A;  2QIE B;  3CST A;  3U7D A;  2KAC A;  1ROE A;  1ZE3 D;  2MA9 B;  4GN1 A;  1QKZ A;  4PS8 A;  2KK8 A;  1C3T A;  5E6P A;  1WX9 A;  2KQS A;  4JWS C;  3NZU A;  4GDL A;  2KD0 A;  4EZK A;  3Q8A A;  1GUA B;  2K0P A;  3TEW A;  3IT6 B;  4NJC A;  4CQN A;  4ANX A;  2JY6 A;  1JAL A;  2ICI A;  1N60 A;  2CKH B;  3V60 A;  4OVZ A;  2D3B A;  1OTR B;  4WAF A;  2J0J A;  1AWD A;  2BGF A;  4LJO B;  3AE7 B;  1CMX B;  3N9Y C;  4HRO A;  1SJE D;  3T9L A;  4NAW B;  2BKR B;  1C4C A;  2L1A A;  2WDR B;  2JYT A;  2DAJ A;  2WXI A;  4WWN A;  1SE2 A;  1F2R I;  4ZYN A;  2CU1 A;  1J0G A;  2JPH A;  1D5Z C;  5J17 A;  4BZA A;  3GB1 A;  3TUO A;  1YQ3 B;  2CJO A;  2IYD B;  4TKN A;  5D7G A;  3IG3 A;  3VUW A;  1ET9 A;  2K25 A;  2SAK A;  4XDC A;  2NMQ A;  1WGR A;  3AEC B;  2O6V B;  2OOB B;  5LXI B;  2IBI B;  1JWU D;  3Q8E A;  2MBE A;  4EFO A;  4GLS C;  3AEG B;  1P3Q U;  5GXG B;  1XLQ A;  4B95 A;  1RYJ A;  2L0T A;  1R4N B;  1WX8 A;  3ZGZ A;  5AEK B;  1UWX A;  5AZF A;  2GBR A;  1FRR A;  2WWZ A;  4E74 A;  2KDM A;  4DQO C;  4JE3 B;  1TS4 A;  3P42 A;  3TCA A;  3VVW B;  3V05 A;  2LGI A;  2M19 A;  2MHJ A;  2V1Y A;  2TSS A;  4PK1 A;  2NBW B;  3APD A;  1EUV B;  2KFJ A;  1T5X D;  2LGD A;  4HEA 1;  1WJU A;  3Q8F A;  3QQ8 B;  1I4P A;  2V4I B;  1KFY B;  2WXH A;  4E71 A;  1WIA A;  3ZQ4 A;  1XEE A;  1CK1 A;  3R3M A;  4IG7 B;  2LRU A;  1C76 A;  2M4N A;  1J7C A;  2AWT A;  3AUL A;  3AEF B;  1FFU A;  2SEB D;  3VHT C;  3B9J A;  3Q2A C;  3TEZ A;  1QZE A;  2WXM A;  3CIR B;  2ASQ A;  1K50 A;  2UU7 A;  2XNA C;  5BMI A;  3AU4 A;  1F0Z A;  4KSK C;  1WXS A;  1SXT A;  4DXA B;  2DHZ A;  3NG0 A;  1XLP A;  3SD5 A;  1V8C A;  2KN4 A;  1SF0 A;  3E56 A;  3ML9 A;  1KRH A;  4IWP A;  4GDK A;  3W5U B;  3ZUN A;  2D07 B;  2WU2 B;  3ZIM A;  4YSY B;  3WAM A;  5EE0 A;  4G11 A;  1YJJ A;  2MP2 B;  2L32 A;  3DBL B;  4LDT B;  1IYF A;  4ZOH C;  2BB6 A;  1OQQ A;  2G1E A;  3QWZ B;  4AUQ C;  4W9K A;  2MW5 A;  1WX7 A;  2MX2 A;  2DEN B;  1C78 A;  3MC0 B;  3P63 A;  2FE8 A;  3Q69 A;  2ZVN A;  3KLS X;  2BQQ A;  1E7V A;  4RH6 A;  1P7E A;  3DOW A;  1GB4 A;  3IT4 B;  1Q1O A;  3TSS A;  3A4R A;  3WAO A;  2BF8 B;  3KQ4 A;  1VR9 A;  4ZRK A;  3FKY A;  3RI7 C;  3ONS A;  1K52 A;  1PUT A;  4EZJ A;  3EFU A;  1JWM D;  2D5G A;  1R4M B;  3PRZ A;  2W3S A;  1ZDX A;  1FXT B;  1XCQ L;  4G3X B;  2WGS A;  3R2T A;  4E3C A;  2AL3 A;  3LDZ E;  3VTV A;  4OVV A;  3AEA B;  4W9F A;  1QF6 A;  2WP9 B;  2IJ0 A;  1L4D B;  1WXM A;  5GMV A;  1E8X A;  4L1B A;  1PGB A;  4W9J A;  3QCA A;  1WJ4 A;  2MJ3 A;  1DOX A;  4J3O D;  3P4S B;  2YEP F;  2BW2 A;  3PRP B;  4YSX B;  3U52 E;  4YSZ B;  2BWE S;  4WUR A;  2JRH A;  2CHZ A;  2K22 A;  4HKQ A;  1NDD A;  3NHE B;  4YXD B;  4LNN A;  5JH5 C;  5IKC M;  3I5J C;  1J7B A;  2C60 A;  3C8Y A;  2KAJ A;  1PYW D;  4TUU A;  1MVK A;  1PDX A;  1L7Y A;  1CJE A;  3OJ4 B;  3AMZ A;  1P0R A;  1RRB A;  2L0F A;  3HVZ A;  5E6J A;  2V4L A;  4JL9 A;  1JWS D;  1E9M A;  5FR3 A;  4ZRQ A;  1SE3 A;  4M00 A;  4MGK E;  3C19 A;  2ZEQ A;  4FJY A;  3QX1 A;  2YVC A;  4C00 A;  5D2M B;  2AQ1 B;  3MJW A;  2WDV B;  1VRA B;  3A9J A;  1YX5 B;  4N9F 4;  4BVU C;  4WH4 A;  3S2A A;  3ZDM C;  1I35 A;  1WM3 A;  2LGX A;  2RDG A;  4BKS D;  4BKT A;  4GB9 A;  2KMC A;  1SE9 A;  1KOT A;  4CHK A;  1MHX A;  3BIN A;  2KO3 A;  4KGR A;  2JU6 X;  3OG5 A;  1SIJ A;  1L6U A;  5BMG A;  3L08 A;  2JQR B;  2RMM A;  1ZXH A;  2YLM A;  4NQL B;  3DVG Y;  1TIF A;  5G2N A;  2DBY A;  2HTM E;  5G55 A;  2W9N A;  2BPS A;  3W1S C;  4RGO S;  3EEC A;  4KIK B;  1E90 A;  4KDL B;  2MQJ A;  3L54 A;  4M01 A;  1VZ7 A;  4K3C A;  2V3S A;  3OAW A;  2VH1 A;  1YQ4 B;  4NAW A;  4BAX A;  1B9R A;  4NJ6 A;  3L10 B;  2V3P A;  1M4V A;  4ZDV A;  4DWF A;  3C0R B;  4XX5 A;  2WDT B;  1XLO A;  3BZD B;  2ONQ A;  3AE9 B;  2K9X A;  2JYE A;  2L3Z A;  1HXY D;  2PTL A;  3BYT B;  2G9H D;  1E8Z A;  3I57 A;  2AQ3 B;  2JXT A;  2VZK D;  4LNK A;  4YTM B;  2KJR A;  2O6V A;  2HTH A;  3L13 A;  4A6Q A;  4LNO A;  2M8S A;  5LLI A;  3JVZ X;  1QT9 A;  4DXF A;  3MTN B;  1PGX A;  1QOB A;  1YNT E;  1N5W A;  2ZPN A;  5BO4 B;  2RGF A;  3T3N A;  2N9L A;  1N61 A;  3BYY B;  1FEH A;  2NVU I;  2DYB A;  3UGB B;  3D32 A;  3BVG A;  2N9E B;  2N7J A;  1ZXI A;  2L52 A;  1ZOY B;  4BFR A;  1NBF C;  3CMM B;  1GJZ A;  3DQV A;  3NY5 A;  4WJN A;  3T8M A;  2FCQ A;  1YMH E;  1WMH B;  2FIF A;  4A8X C;  2J4X A;  1E7P B;  1E10 A;  3OWE B;  4IUM B;  4WJQ A;  4KGS A;  1FNV A;  4S0R A;  2EKI A;  1UGM A;  1FD6 A;  1ZGU B;  3AE1 B;  3HM3 A;  1ZDV A;  5DCN A;  1FFV A;  4IKG A;  4US9 A;  2KLG A;  2N9K A;  3H1U A;  1TY2 A;  1PQS A;  3PGE A;  4NZL B;  3RPF C;  3QA8 A;  2LFI A;  3CF6 E;  1VJK A;  3N1Z C;  2AQ2 B;  2LJ5 A;  2REX A;  2Y5P A;  4C7Y A;  3DBH I;  1JQ4 A;  3ZW3 A;  1J19 A;  1EM7 A;  3RZF A;  1P9D U;  2K5P A;  3Q8C A;  1D5X C;  3NUH B;  1IPG A;  1UUP A;  3A4S C;  4N6E B;  4LJP B;  3BII D;  2V3N A;  4TSS A;  5LXH A;  2R61 A;  1V81 A;  4DK5 A;  3SU8 X;  1NEN B;  2MBQ A;  4GXB A;  2JZP A;  1H8C A;  2M0X A;  1T0Y A;  3H6N A;  1HE8 A;  1UWM A;  2DLB A;  1KF6 B;  3UIP B;  2E3T A;  2KJ6 A;  2ACZ B;  2LGS A;  4ZHO A;  2DZM A;  3UIN B;  4JLC A;  3J9C A;  1WWT A;  3PHW B;  4MJS B;  4F8C B;  1P1A A;  2MP2 A;  5E6N A;  1L5P A;  4IWO A;  4WWO A;  1L0X B;  4IM3 A;  1KH0 A;  1WFY A;  2M56 B;  4JX1 C;  1CQV A;  2GBJ A;  4UDU C;  3VUY A;  1WGY A;  4MT5 A;  4TMA B;  5AUI A;  4IOI E;  3UQB A;  2K8H A;  3ZKJ C;  4ZRJ A;  2XK5 B;  1FXI A;  5TR5 A;  3GE8 C;  2KWD A;  2KLC A;  3JSV A;  3RNB C;  4OVU A;  4OHJ A;  4II3 B;  3H7S A;  4D2K A;  4EE2 A;  4AJY B;  3MP9 A;  1NYR A;  2PE6 B;  4RF0 A;  1TJE A;  1H4R A;  4KGT A;  4NNJ B;  4N59 A;  3V3X A;  3GS2 A;  2WX1 A;  2GRI A;  2D3C A;  3UIO B;  1AYF A;  2PEA A;  3AEE B;  2QSD A;  1UNS A;  1L4Z B;  2M1M A;  3ZO5 B;  2GBN A;  2K39 A;  4MEM A;  3TEX A;  4J6I A;  1V86 A;  2UYZ B;  5C2T B;  5CHF A;  5T8I A;  2DNF A;  3Q14 C;  2K8C A;  2R2Q A;  3BY4 B;  3L4P A;  2KZR A;  1NI2 A;  1KJT A;  1VLB A;  3GZN I;  3HK0 A;  3NOB A;  1TGZ B;  4AS1 A;  3DPD A;  4MGZ E;  2KDF B;  4A90 A;  2KVR A;  2GLS A;  4ZRI A;  5L95 C;  1WGG A;  4HLE A;  4I6N B;  2CR5 A;  2ZNV C;  4IDI A;  2GBK A;  2IZV B;  3GE3 C;  1E0Z A;  3AE5 B;  1WSP A;  1V6E A;  3EGR A;  4AP4 C;  4PS7 A;  1SBB B;  1NYQ A;  4FJZ A;  3ML8 A;  5C23 A;  1WI0 A;  3H7P B;  1DOY A;  3N32 A;  1ZKH A;  1V2Y A;  4KSL C;  1F77 A;  3B0A A;  2KX0 A;  1ISN A;  4EZL A;  3MFG A;  3DBS A;  2N9X A;  3NVW A;  3R66 C;  1UBQ A;  2Z59 B;  5HG2 A;  5EE9 A;  3RZW C;  3DVG X;  3KVF B;  2C7H A;  1QOF A;  3M62 B;  3IBE A;  4NY0 A;  1BUI C;  1D4B A;  3ZRF A;  2HDE A;  1R4N I;  1WY8 A;  1DYQ A;  4RM9 A;  3Q3F A;  5G5H A;  4MGI E;  1YN5 A;  4TV3 A;  2HD5 B;  1WE6 A;  4YTN B;  5G5G A;  2IPK D;  3AN1 A;  4HPL B;  2GMI C;  1WXV A;  2QCZ A;  4I6L B;  5FK9 C;  2JZ3 B;  4FHJ A;  1OGW A;  3DBR I;  1IUE A;  1XXG A;  1XT9 B;  3V62 A;  3SFD B;  3VH3 B;  3PVL A;  3R7R A;  3PLU A;  2RDB C;  1WYG A;  5DPW A;  4OZB A;  4RF1 A;  2KFK B;  1V80 A;  2BB5 A;  2VZK B;  2QC8 A;  3NS8 A;  1WE7 A;  3FIL B;  2KC1 A;  3R2I A;  3MC8 A;  2L8J A;  3RNA C;  3GP7 A;  1YIW A;  2J0M A;  1UZX B;  3SHQ A;  2M17 A;  2OJR A;  2FBW B;  2G3Q B;  2NTS A;  1D5M C;  4ZHP A;  1M94 A;  4KIK A;  3N1Y C;  4EOY A;  4YWG G;  3RNF C;  4KV2 A;  2LHD A;  2N1W A;  5BMH A;  2DAF A;  2MH7 A;  2JF5 A;  1B1Z A;  5AZG A;  5MPO A;  3LB8 C;  2EKE C;  1PFD A;  1E8W A;  4HRS A;  2IY1 B;  1JCK B;  1XCT L;  2VRR B;  3GOE A;  1IBX B;  2J42 A;  3HM6 X;  4GOC A;  4EKU A;  4NQK E;  2EMT A;  1TZ1 A;  3JSV B;  4K1R B;  2PVO D;  2JSV X;  2V9H A;  2KT7 A;  3DBL I;  1EU3 A;  1SIF A;  4W9E A;  4HPM B;  3MJ5 A;  2JT4 B;  1YD8 U;  2D11 A;  2LHE A;  3QIJ A;  4W9I A;  1KLG D;  3NZ3 A;  3EFC A;  4B9K A;  1J7A A;  3VRA B;  3KYD D;  4P1B C;  2G4S A;  4EUT A;  1DGJ A;  4HKZ E;  3U7Z A;  1HTQ A;  3AI5 A;  4HDO A;  1I4X A;  4W9H A;  4P16 A;  3A9K B;  3W1S A;  4DHZ E;  2XN9 C;  1K8R B;  2L7R A;  1UF0 A;  1WMH A;  3DVN U;  3DCG A;  2ZW1 A;  2C9W B;  2WXQ A;  3PV1 A;  2KDB A;  3VR9 B;  1FMA D;  1FNW A;  2EEL A;  5AZH A;  4XYC A;  3K9O B;  3BK2 A;  3ZXV A;  5EE3 A;  1T3Q A;  4W9D A;  3ENE A;  3PSE B;  1E6E B;  3N30 A;  3BVZ A;  1L0V B;  3I63 C;  3LJ3 A;  1HQR D;  5BYS A;  4PT5 A;  3FAH A;  3KWV A;  3N3K B;  4GMV A;  1VD2 A;  5EDS A;  3QHT A;  2K6Q A;  2KAN A;  4CYE A;  1I42 A;  4II2 B;  4OZC A;  5H8Y E;  1N63 A;  1ESF A;  2KMM A;  3PPA A;  2CS4 A;  5EE1 A;  1RFK A;  1VCB A;  2Z0E B;  3SEB A;  2LEK A;  3Q6B A;  4GIV A;  4W9L A;  2VH2 A;  2FCM A;  2ON8 A;  1ACC A;  4OZA A;  2K8B A;  3AE3 B;  3RNC C;  1AW7 A;  3ETR A;  4MJS A;  5JXV A;  1Y56 A;  5HFY A;  3QAR A;  1I4Q A;  1MG4 A;  2WXF A;  1QLB B;  4KKJ A;  3X0W A;  5C1Z A;  1FIQ A;  2KTF A;  1YN3 A;  1FRD A;  2PE9 A;  5DPT A;  2WXO A;  1T0R C;  4ITK A;  3EC8 A;  3N1X C;  4YT0 B;  2XK5 A;  4DHJ D;  3NVV A;  4H2A A;  1VZ8 A;  3AE4 B;  5DPS A;  4XGA B;  2J7Q B;  5IO9 A;  2BT6 A;  4K7U A;  1GAQ B;  4HVB A;  2J0K A;  3ZJU A;  4BOS C;  4G50 A;  4BOZ B;  4USA A;  1TZO A;  4WIP A;  3TBL D;  2FID A;  2CHX A;  2MBO A;  3AE8 B;  1HA5 A;  3VFK A;  3OLM D;  1V49 A;  1QIL A;  4YTP B;  4MSQ B;  4RGN A;  3O65 B;  4P7I A;  1JW9 D;  2QHO A;  1HEZ E;  2KTR B;  2WXG A;  2B76 B;  1SJH D;  1UEL A;  3RUL A;  2DZI A;  1Q10 A;  1XD3 B;  2L83 A;  2I2Y A;  3NJT A;  3TMP B;  2QDF A;  2ZPY A;  4LLG M;  1WXA A;  1EWC A;  1EF1 A;  2IO3 B;  5JHB A;  1VDV A;  4DXG A;  4BKS A;  5FKA C;  1X1M A;  3TL5 A;  1WZ3 A;  2NPT A;  5JZE B;  2V0G A;  1N5X A;  2DZJ A;  2WS3 B;  2MSE D;  4AWJ A;  1KLV A;  4JPS A;  3ZLZ A;  3A1Q B;  4XC2 A;  3H7P A;  3W9C B;  3ZRC A;  3Q3J A;  1J8C A;  1GOZ A;  2N1V A;  1N62 A;  3E9S A;  4C4V B;  2KHW B;  3V6E B;  4RGT A;  4BBN C;  4XWT A;  3RNG C;  3VR8 B;  3EUB 2;  3KUC B;  2JRI B;  1WJ6 A;  3HIZ A;  4WJO A;  4TQ0 A;  4FHK A;  3ZJT A;  5DPR A;  2W82 A;  2PLP A;  3AM9 A;  3I3T B;  2CU3 A;  5HKH A;  1LFD A;  1C1Y B;  1V1P A;  2WHI A;  3VTW A;  1RFA A;  3TJP A;  1SEB D;  3KYC D;  3L0W B;  1MPE A;  2XEW A;  3CWI A;  1BML C;  5FR6 A;  3IFW B;  4LDT D;  3ZDT A;  2BYV E;  2INP E;  3DBH B;  4QAY A;  2KX3 A;  3IVF A;  2LXC A;  1ENF A;  5L83 A;  2AYO B;  3QJZ A;  5CTR C;  2C7M B;  5HHD G;  2QIL A;  2PKO A;  1QQR A;  1XF5 L;  5AUK A;  1LO5 D;  2C5L C;  3VH4 B;  2LUM A;  2JUO A;  4K7W A;  2KFK A;  1OFF A;  3NVZ A;  1ZW7 A;  3KUD B;  1A70 A;  3HRD D;  3FIL A;  4URK A;  2W3R A;  2D3A A;  1F52 A;  1YJI A;  1Q5W B;  4HDQ A;  2KDI A;  2GBM A;  4X57 B;  2ZJD A;  3MHS D;  3KW5 B;  5H92 C;  3IAM 1;  1F9J A;  2WQY B;  1I4H A;  2LWP A;  2NBV B;  3M63 B;  4ICU A;  1TTN A;  1WGH A;  3LYY A;  3V61 A;  1FCL A;  2AX5 A;  1GPX A;  3LXF A;  1VZ6 A;  3ZJV A;  1OEY A;  2IO0 B;  3ZXR A;  2IY0 B;  4MH0 E;  4B6W A;  2LXA A;  4GSW A;  2WXN A;  3VAW A;  4F1S A;  1JRP A;  2KVZ A;  2FNJ B;  4HJG E;  1HZ6 A;  4ICV A;  2RSU A;  1UGJ A;  4R3D A;  3PHX B;  3IXS A;  2IO1 B;  4RCO A;  1K53 A;  3APF A;  1S1Q B;  2BWF A;  5LNK 1;  1IBX A;  2JZZ A;  4RGM A;  1DOI A;  2LI5 A;  1AAR A;  1P98 A;  2A5U A;  4M8N A;  2XBB C;  1UH6 A;  4LNF A;  1JML A;  3O13 A;  3W1Y A;  2I1K A;  1P7F A;  1YJ1 A;  2L00 B;  3JW0 X;  1Z2M A;  2BVC A;  4WWP A;  3R8B A;  1TS5 A;  4HXD A;  3WAP A;  4DDI D;  5IN7 A;  2JX5 A;  3T3O A;  4IC7 B;  3RYT A;  4GGQ A;  5CHV C;  3P1M A;  5D3D A;  3ECI A;  2IGH A;  3GZN B;  2MJD A;  3A9K A;  3U8Z A;  4FJV B;  4KKI A;  3X23 A;  2UWQ A;  4FLH A;  2ZCB A;  3B08 A;  3V6C B;  1FO4 A;  3PZ8 A;  3IHP C;  1GB1 A;  1LQB A;  3ZNI D;  5D94 A;  3AEB B;  2ZCC A;  1KM7 A;  3MHZ A;  1XLN A;  3BWU D;  4WQO B;  4IW0 A;  1Z5S B;  2BS2 B;  1FXA A;  4HCP B;  2NPT B;  2BTE A;  1AN8 A;  1MI0 A;  2WNM A;  1EU4 A;  4LNI A;  2N9P C;  3DVN V;  2WXL A;  3M3J A;  3WIM A;  4M02 A;  4DHJ B;  4HWI B;  3EA6 A;  2FUH B;  4WWM A;  2G45 B;  1NEK B;  2NR2 A;  2LD9 A;  3ALB A;  1V5T A;  3L16 A; 
#chains in the Genus database with same CATH homology
 1FNU A;  3AE6 B;  2QJL A;  1J7A A;  5HI1 A;  3VRA B;  1ZXH A;  4L23 A;  2BYT A;  4B0E A;  5BYR A;  2DBY A;  2HTM E;  3H8H A;  1DGJ A;  2DWQ A;  4L2Y A;  4HKZ E;  3U7Z A;  3U2S C;  2H89 B;  4RGO S;  2H88 B;  1V1P B;  2WXP A;  1I4X A;  4B0M A;  2NTT A;  4P16 A;  1VZ7 A;  3W1S A;  1F2R C;  1WRI A;  2XN9 C;  5TSS A;  3RFZ B;  4ARI A;  4ARC A;  1C79 A;  1YQ4 B;  1JRO A;  2ZW1 A;  4N58 A;  3KWL A;  2QMT A;  1B9R A;  1V97 A;  3SR6 A;  3VRB B;  2V3P A;  1C4P A;  1M4V A;  1I4G A;  2WXQ A;  3B2F A;  3VR9 B;  1FMA D;  2CJN A;  1XLO A;  3BZD B;  1FNW A;  2EEL A;  2OHF A;  2ONQ A;  2PW9 A;  3AE9 B;  4MH8 A;  2DYO A;  2K3U A;  2K9X A;  2JYE A;  3AH7 A;  3BK2 A;  2QIE B;  2MEK A;  1HXY D;  5EE3 A;  1T3Q A;  2WLB A;  2PTL A;  2KAC A;  1ROE A;  2G9H D;  1E6E B;  3BYT B;  3I57 A;  2AQ3 B;  3BVZ A;  1L0V B;  1ZE3 D;  2JXT A;  2BBC A;  1ET6 A;  3ZYY X;  1HQR D;  1QKZ A;  2VZK D;  5BYS A;  4YTM B;  2PIA A;  4PT5 A;  3FAH A;  1TKE A;  3KWV A;  2QEJ C;  4A6Q A;  4JWS C;  2J53 A;  4C80 A;  3Q8A A;  1QT9 A;  4DXF A;  1C4A A;  2K0P A;  3TEW A;  3IT6 B;  4OZC A;  5H8Y E;  1PGX A;  1QOB A;  1YNT E;  1N5W A;  2N0S B;  1N63 A;  4NJC A;  4P6V F;  4CQN A;  1EWY C;  2WXR A;  1ESF A;  2KMM A;  3T3N A;  2N9L A;  5EE1 A;  1N61 A;  3BYY B;  1FEH A;  1RFK A;  1SSN A;  3SEB A;  1JAL A;  2LEK A;  2ICI A;  2IDY A;  3BVG A;  1N60 A;  2N7J A;  1ZXI A;  2ON8 A;  1ACC A;  4OVZ A;  2L52 A;  4WAF A;  1AWD A;  1FCC C;  1ZOY B;  2Y5C A;  4OZA A;  1TS3 A;  1I7H A;  3AE7 B;  3N9Y C;  4HRO A;  1YMH E;  1SJE D;  3AE3 B;  1IGC A;  4NAW B;  4A8X C;  2J4X A;  1C9F A;  1AW7 A;  1C4C A;  2L1A A;  3ETR A;  1E7P B;  2WDR B;  1IGD A;  1E10 A;  1QOA A;  3OWE B;  2JYT A;  2WXI A;  4KGS A;  1FNV A;  5JXV A;  4C56 C;  1Y56 A;  2EKI A;  5HFY A;  1SE2 A;  1FD6 A;  1I4Q A;  1F2R I;  3AED B;  1I4R A;  2WXF A;  1QLB B;  3AE1 B;  4KKJ A;  4AQ7 A;  1D5Z C;  1ZDV A;  1FFV A;  4IKG A;  3GB1 A;  3TUO A;  1YQ3 B;  1FIQ A;  2CJO A;  1RM6 C;  4US9 A;  4XDD A;  1YN3 A;  2N9K A;  5D7G A;  1FRD A;  2WU5 B;  1TY2 A;  1KLU D;  2IGG A;  2WXO A;  3HVD A;  4ITK A;  1ET9 A;  2BS3 B;  2SAK A;  4XDC A;  4NZL B;  2NMQ A;  4JWU C;  4YT0 B;  3RPF C;  2LFI A;  1VJK A;  2WXK A;  3AEC B;  3NVV A;  2AQ2 B;  3WCQ A;  4H2A A;  1JWU D;  2Y5P A;  3Q8E A;  1VZ8 A;  4C7Y A;  1JQ4 A;  3AE4 B;  4GDL B;  4GLS C;  1EM7 A;  3BK1 A;  3AEG B;  1L0Y B;  5GXG B;  1XLQ A;  1RYJ A;  2BT6 A;  4RFB A;  3ZGZ A;  1GAQ B;  2K5P A;  3ZJU A;  3Q8C A;  1D5X C;  1UWX A;  4USA A;  1FM0 D;  1TZO A;  3NUH B;  4WIP A;  4N6E B;  1UUP A;  3BII D;  2V3N A;  1FRR A;  4TSS A;  2KDM A;  3AE8 B;  1HA5 A;  3VQI A;  4DQO C;  2R61 A;  4JE3 B;  1TS4 A;  1NEN B;  3P42 A;  2JZP A;  2LJI A;  4YTP B;  1QIL A;  2X38 A;  2LGI A;  4RGN A;  2RPV A;  3V05 A;  1UWM A;  1TS2 A;  2DLB A;  1JW9 D;  1KF6 B;  2E3T A;  1HEZ E;  2ACZ B;  2M19 A;  2WXG A;  2B76 B;  1SJH D;  4ZHO A;  2ZW0 A;  2TSS A;  4FXC A;  2INN E;  3J9C A;  4LTU A;  1WWT A;  1Q10 A;  1T5X D;  2OED A;  4HEA 1;  2L83 A;  4TQ1 A;  3ABV B;  2I2Y A;  2Y3A A;  1L5P A;  3Q8F A;  4LLG M;  4KX6 B;  1EWC A;  1I4P A;  1L0X B;  2V4I B;  1VDV A;  1KFY B;  4DXG A;  2WXH A;  3UI3 A;  1KH0 A;  2M56 B;  4A9A A;  4JX1 C;  5FKA C;  1CQV A;  4UDU C;  3ZQ4 A;  1OQR A;  1XEE A;  1CK1 A;  4C7Z A;  4MT5 A;  4TMA B;  5AUI A;  4IOI E;  1C76 A;  2YEP B;  1J7C A;  1ZUD 2;  2FUG 1;  3W2D A;  1FXI A;  2V0G A;  1N5X A;  2WS3 B;  3AEF B;  1FFU A;  2SEB D;  3B9J A;  2KWD A;  3TEZ A;  4JPS A;  1RWS A;  5BYQ A;  2J52 A;  2WXM A;  1PGA A;  1TKG A;  3CIR B;  4REZ A;  1T6B X;  1K50 A;  2I38 A;  4OHJ A;  2BS4 B;  3W9C B;  1BXT A;  2XNA C;  4D2K A;  5BMI A;  4EE2 A;  3AB5 A;  1GOZ A;  1WGK A;  1F0Z A;  1N62 A;  3MP9 A;  3E9S A;  1NYR A;  5D3I B;  4RF0 A;  1TJE A;  4RGT A;  1SXT A;  4KGT A;  4XWT A;  4N59 A;  3VR8 B;  3V3X A;  1XO3 A;  3GS2 A;  2GRI A;  3EUB 2;  1KTK A;  1XLP A;  3P4P B;  1AYF A;  1V8C A;  2KN4 A;  1SF0 A;  3AE2 B;  3E56 A;  3AEE B;  1KRH A;  3W5U B;  2QSD A;  1UNS A;  4TQ0 A;  1L4Z B;  3ZJT A;  2W82 A;  2PLP A;  2WU2 B;  3AM9 A;  3TEX A;  2CU3 A;  5C2T B;  5T8I A;  4YSY B;  1V1P A;  5EE0 A;  1YJJ A;  1SEB D;  2L32 A;  3L4P A;  1MPE A;  3CWI A;  1BML C;  1VLB A;  4ZOH C;  3PO0 A;  2BB6 A;  4AS1 A;  1OQQ A;  2INP E;  2G1E A;  4A90 A;  1HZ5 A;  1R7S A;  4IDI A;  1C78 A;  1C77 A;  3MC0 B;  3SFE B;  3P63 A;  1E0Z A;  2FE8 A;  1ENF A;  3AE5 B;  3Q69 A;  1WSP A;  5HHD G;  3EGR A;  3KLS X;  2QIL A;  2PKO A;  1QQR A;  4OW0 A;  1XF5 L;  5AUK A;  4RH6 A;  1P7E A;  1GB4 A;  1LO5 D;  3IAS 1;  1SBB B;  3IT4 B;  1NYQ A;  3TSS A;  2LUM A;  3PZ7 A;  1OFF A;  3NVZ A;  2JWU A;  2WXJ A;  1A70 A;  3HRD D;  3FIL A;  3KQ4 A;  2W3R A;  1VR9 A;  5I4D A;  1DOY A;  2LMC A;  3NRZ A;  5C3J B;  3W5V B;  1YJI A;  1F77 A;  1K52 A;  1PUT A;  1JWM D;  4MAC A;  4NAM A;  3MFG A;  2D5G A;  1STE A;  3NVW A;  1CZP A;  5H92 C;  3IAM 1;  2W3S A;  5HG2 A;  5EE9 A;  1ZDX A;  4GDK B;  2WQY B;  1XCQ L;  1I4H A;  4XWW A;  1QOF A;  1TY0 A;  4A55 A;  2M0A A;  3P4Q B;  1BUI C;  1D4B A;  3LYY A;  1FCL A;  2HDE A;  3AV8 A;  3R2T A;  1TYG B;  1DYQ A;  1L6V A;  2AX5 A;  3LXF A;  1GPX A;  1VZ6 A;  3ZJV A;  2DYM A;  2WDQ B;  3AEA B;  1NVI D;  1YN4 A;  4XE0 A;  5G5H A;  1YN5 A;  1WXQ A;  1QF6 A;  4YTN B;  5G5G A;  2WP9 B;  2IPK D;  2IJ0 A;  2WXN A;  3AN1 A;  1JRP A;  1L4D B;  1SE4 A;  4L1B A;  1PGB A;  4HJG E;  1HZ6 A;  1D6E C;  1JWB D;  1TKY A;  3NVY A;  5FK9 C;  4Q2J A;  4O1N A;  1UGJ A;  2MJ3 A;  1DOX A;  1K51 A;  3P4S B;  4J3O D;  4R3D A;  3IXS A;  2YEP F;  2BW2 A;  4RCO A;  1IUE A;  1K53 A;  4YSX B;  4LK0 M;  1XXG A;  5LNK 1;  1IBX A;  4RGM A;  3U52 E;  3SFD B;  1DOI A;  4YSZ B;  2MJE A;  3DWG C;  4WUR A;  1WYG A;  2PMV A;  2K22 A;  4OZB A;  4HKQ A;  4RF1 A;  1JML A;  1ZP0 B;  3O13 A;  1SB3 C;  3U4E G;  2BB5 A;  2VZK B;  4YXD B;  3B2G A;  4RNA A;  3FIL B;  3R2I A;  1P7F A;  1J7B A;  2GI9 A;  3GP7 A;  3C8Y A;  2KAJ A;  1PYW D;  1QOG A;  3R8B A;  2FBW B;  1TS5 A;  1MHH E;  2E6X A;  2JX5 A;  1MVK A;  1PDX A;  2NTS A;  2KQ4 X;  4US8 A;  1CJE A;  3T3O A;  3AMZ A;  5E6J A;  3HVZ A;  3P1M A;  1NI3 A;  5D3D A;  1D5M C;  2IGH A;  4ZHP A;  2GB1 A;  1JWS D;  3Q8B A;  4MM3 B;  1E9M A;  4YWG G;  4M0W A;  5FR3 A;  2LHD A;  5BMH A;  4WQM A;  4ZRQ A;  1SE3 A;  2MJD A;  2MH7 A;  1B1Z A;  2Z8L A;  4KKI A;  3TEY A;  2RDH A;  5MPO A;  2AQ1 B;  2W55 A;  3BVM A;  1V1O A;  1FO4 A;  3PZ8 A;  2WDV B;  1VRA B;  1GB1 A;  3LB8 C;  4WH4 A;  4ZRP A;  3AEB B;  3DWM A;  1XLN A;  3BWU D;  1PFD A;  3MHZ A;  1JWA D;  2RDG A;  3I9V 1;  4HRS A;  1JCK B;  2BS2 B;  1XCT L;  1FXA A;  1ZPS A;  2BTE A;  1IBX B;  2J42 A;  1AN8 A;  2Q5W D;  1MHX A;  1MI0 A;  2WNM A;  1EU4 A;  3NS1 A;  2IGD A;  3HUI A;  4KGR A;  2JU6 X;  2PVO D;  2W54 A;  2JSV X;  2WXL A;  2PVG C;  1EU3 A;  3FC4 A;  1SIJ A;  3EA6 A;  4ZYS A;  1L6U A;  3MJ5 A;  5BMG A;  3URY A;  4WWM A;  1NEK B;  2LHE A;  2JQR B;  1KLG D;  2RMM A;  3P4R B;  3NZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...