4WH4A

Protein gb1 quadruple mutant i6h/n8h/k28h/q32h
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLHLHGKTLKGETTTEAVDAATAEHVFKHYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title The double-histidine Cu2+-binding motif: a highly rigid, site-specific spin probe for electron spin resonance distance measurements.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Signaling protein
total genus 15
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wh4A00
5HFYA 1UWXA 1IBXA 4KGSA 1IBXB 2JSVX 1IGCA 1MPEA 4OZAA 3GB1A 1D4BA 2IGGA 1P7FA 4KGTA 2LHDA 2LUMA 1F2RI 4HJGE 1MVKA 2JU6X 1JMLA 1KH0A 2N7JA 2I2YA 4GLSC 1K51A 2QMTA 1FD6A 2ONQA 1XCTL 5BMHA 1GB4A 2GI9A 1ZXHA 2K0PA 1MI0A 1K52A 2JZPA 4OZBA 5BMGA 2OEDA 2EELA 2KDMA 1HEZE 2RPVA 2JWUA 2ZW1A 4MACA 5JXVA 4IKGA 3MP9A 1MHXA 2ZW0A 2GB1A 2LHEA 1XCQL 2I38A 4IOIE 2NMQA 1PGXA 1XF5L 5BMIA 2RMMA 1K50A 2IGDA 2KQ4X 1EM7A 2KN4A 1FCLA 2ON8A 1GB1A 4D2KA 1QKZA 1Q10A 2PW9A 1P7EA 1HZ5A 1HZ6A 2N9LA 1IGDA 2JXTA 1PGAA 2PLPA 2J53A 5HI1A 1C9FA 2J52A 5HG2A 4WH4A 1F2RC 4OZCA 1MHHE 1K53A 4HKZE 3V3XA 1YMHE 2LGIA 2KWDA 2IGHA 2PTLA 2KACA 2N9KA 1FCCC 4KGRA 5HHDG 1PGBA 3FILA 3FILB 1YNTE 3UI3A 2QSDA
chains in the Genus database with same CATH superfamily
4NJCA 1IBXB 1ISNA 1TGZB 2BWES 1V97A 1B1ZA 3B1LX 3H7PB 1TS3A 2WNMA 4HDQA 1WYGA 4URKA 2WLBA 3AV8A 2JPHA 3L16A 2NTSA 4K3BA 3MC0B 4BZAA 1KRHA 1R4MI 3TIXA 3MC8A 1QQRA 3KH0A 5E6OA 3DBHB 4RGTA 3UIPB 4FJYA 4WQMA 1PYWD 1GAQB 4FHJA 4ZYSA 2QIEB 4PS7A 3C8YA 1Y56A 5E6NA 1R4NI 1RFAA 2KJHB 1MHXA 1T0QC 1WJ4A 1XLPA 4RMAA 3TL5A 3VTUA 1MFWA 2D3AA 1PGXA 5FR3A 3NZSA 4XGAB 1TZOA 2IGDA 3FAHA 3ZYYX 3LB8C 4RH6A 2OHFA 3ZNGC 3QJZA 5TR5A 2WXGA 3RI7C 4BKSA 3CWIA 2JXTA 2NBUA 1V5OA 4ANUA 2WXJA 4DHJD 1R7SA 5T8IA 2C7HA 3WIMA 1WX9A 3APDA 4YXDB 1F2RC 4KVGB 1JWUD 4W9IA 1F77A 2K1FA 2VH2A 3N1ZC 4B0MA 2WHIA 3QCAA 4AUQC 1PFDA 2JQRB 4W9EA 3IT6B 1AW7A 2D11A 1UGMA 1L6VA 2L52A 3V6EB 5AUKA 2G1EA 2LXCA 4GGQA 3KW5B 3AU5A 2IO2B 3T3NA 1EU4A 2LUMA 4UDUC 2MH7A 3IT4B 2D2QA 4XE0A 1QLBB 4KSLC 1KF6B 2EMSA 1QT9A 2WU2B 5IO9A 2FCNA 2GI9A 1FM0D 2HE7A 3GE3C 4A8XC 4W9GA 3AXCA 4TQ1A 4OZBA 4NAMA 4MJSA 1V1PB 2C9WB 1HQRD 2LGYA 2X8XX 4EZLA 3BWUD 2K22A 3A33B 2G3QB 2EMTA 4PS8A 1TS5A 2HTME 1DGJA 3Q3JA 1P1AA 1C4CA 3O13A 2IYDB 1SIJA 2FUHB 3Q8CA 3TSSA 4YTNB 2R2OA 2BB6A 3Q3FA 5H92C 1KLGD 5BYQA 2KN4A 1WMHA 2L1AA 1P3QU 3QHTA 1Q10A 2BW2A 2O2VA 1VDVA 2HJ8A 2QC8A 3ZNID 1IYFA 1LGRA 2V9HA 4FXCA 4PYUA 2WDTB 3PZ8A 2HTHA 3JSVB 4OHJA 2VH1A 5LXHA 4YWGG 2DNFA 3AN1A 4HJKA 4A3PA 4DDID 2M19A 2N0SB 4ARCA 1PUTA 3ML8A 2KWDA 2L3ZA 1WJ6A 4AS1A 3Q3NC 3V05A 3W2DA 2MRPA 1XEEA 3ZJUA 3AE7B 1ZOYB 1WSPA 4W9CA 4TV3A 1WXAA 2K8HA 1CMXB 5D94A 1KLUD 2MA9B 4DQOC 1ZDXA 3UQAA 1NYRA 1ZXHA 2MJEA 4S0RA 5C23A 3HRDD 5BMGA 2BQQA 3QQ8B 4OVZA 5IKCM 1EF1A 2KDEB 4M8NA 1WY8A 4A3OA 3C0RB 2ICIA 4II2B 3AEDB 3IHPC 4LK0M 2KDMA 3BK1A 2RPVA 3GOEA 1LM8B 1VLBA 1HXYD 1N6ZA 4TUUA 1V5TA 1TIFA 4C4VA 1KJTA 3NVWA 3PHXB 1WRIA 4KZCA 2K8BA 1E6EB 2IPKD 1QOFA 1A70A 3ZXRA 2MHJA 1I4GA 3ZQ4A 1WXQA 2KX3A 3RYTA 2W9NA 2L0FA 4EKUA 3IBEA 4EE2A 2ON8A 5AZFA 1FMAD 1SJHD 4DXGA 2CJNA 1D3ZA 1C77A 1RWSA 2DZKA 4YSXB 1OTRB 3VXWA 1NEKB 2AYOB 3U2SC 2IZVB 2ZZPB 1YX5B 2KMMA 4GDKA 2KJRA 1E9MA 3R2TA 2A5UA 1Q5WB 2HD5B 3H9DA 1TYGB 4XZ4A 4JLCA 2AX5A 1E5WA 3EFUA 2KYWA 1PDXA 5E6PA 3ZJVA 5J2RA 1OGWA 1YN3A 3H8HA 2BB5A 3DBHI 4HWIB 3FILA 1PQSA 4WWNA 1D5MC 2LI5A 2J0KA 4WAAA 3P4QB 1YN4A 2KFKA 3GB1A 1P7FA 3I5JC 1AYFA 3Q69A 1SEBD 5CHFA 2CHZA 2WXLA 1C4PA 2JU6X 4AP4C 5IAAC 1SB3C 1E8WA 3M62B 1EWCA 4GSWA 1ET6A 1N60A 1I7HA 3WAMA 4JX1C 3KYDD 1YX6B 2PEAA 2XEWA 1GC7A 5AZHA 3PT2B 3NS8A 4EUTA 3OWEB 3WANA 2J0JA 1N63A 3SFDB 1FNWA 3SEBA 1L0VB 1G6JA 4NY0A 2XK5A 3DBSA 2NR2A 2KLCA 5L83A 2GB1A 1E10A 4JWSC 2MBEA 5GMVA 3K9OB 2KANA 1L5PA 1ZUD2 1K8RB 4KDIC 2M1MA 4YSZB 5EE0A 2RMMA 4K7WA 4JIOU 4KKIA 4BVUC 3N9YC 1FCLA 1WWTA 4OW0A 3Q8AA 3KYCD 4WJOA 1F1HA 3A9KA 3X0WA 4E71A 3W9CB 2N9LA 1PGAA 3VR8B 1LQBA 2BPSA 2J42A 2JT4B 2BKRB 2KMAA 1T0SC 2L00B 4W9KA 2AQ3B 2OOBB 4P16A 4G0NB 2LD9A 3DWGC 3TJPA 4DHZE 2KACA 3NS1A 1IP9A 1XXGA 2KTRB 2O6VD 3AE2B 1E7VA 3D32A 1SE4A 1YJJA 1NVID 2K25A 4HVBA 2B3AA 3W1YA 1BUIC 4NAWA 4RM9A 3DPDA 3ZNZB 3ECIA 2DAFA 3QARA 3PZDA 1A5RA 2OJWA 1YIWA 3AM9A 3PRZA 2ONQA 2X38A 2DX5B 2LVPA 3RT3B 2KWCA 2ZCCA 5D6JB 4CYEA 3PHWB 3VUWA 1SXTA 2BYVE 5CX3A 2JWZA 1DOXA 1WJNA 2JRHA 4FULA 4GIVA 4N9F4 1RFKA 4MH8A 3A9JB 2NBVB 3VUYA 2VZKD 4KKJA 2ZJDA 3NUHB 2WYQA 2MX2A 2HDEA 4IDIA 3WAOA 3VTWA 4GU2A 2O6VB 4LNNA 4EZKA 1QOGA 3W1SA 3AEGB 2PKOA 3DOWA 1C1YB 4K1RB 2CU1A 2HJ1A 3MTNB 5HI1A 4F7ZA 3KUDB 4ASWC 2IJ0A 2PE6B 3VDZA 3KQ4A 5G2NA 2WXPA 2V3PA 4BKSD 4N6EB 3RD2A 2INCC 5AZGA 2KAJA 2BGFA 2IGHA 2Z8LA 3R3MA 3P4RB 5HHDG 2LGDA 3BYYB 2UYZB 1L2NA 3UI3A 3I57A 3K9PB 3U7ZA 3B9JA 5J18A 1NBFC 1OQYA 2MP2B 4LNFA 3N3KB 5KHQA 2JYEA 1TY0A 2RGFA 3L13A 4ZHOA 3WA0A 3W5VB 3FKYA 1MVKA 1TKYA 2GBJA 5EDSA 4A6QA 3NJTA 3HIZA 4MGYE 3ZJTA 4YTMB 3RNEC 2M8SA 4L1BA 4BFRA 1KLVA 2Y3AA 4C7YA 5G55A 5BO4B 3AE3B 3RNBC 1WGDA 4E74A 3NY5A 3MP9A 4IC7B 3PLUA 2UU7A 2KKCA 4L2YA 4XYCA 1D6EC 1TS4A 2FCSA 2K5PA 3JW0X 2LVOA 3TEZA 4YSYB 2KQ4X 1EF5A 4B0EA 1V6EA 3IAS1 3ZVVA 2QHOA 2D3CA 2E3TA 2BS4B 2BKFA 3OJ4B 4ARIA 1HZ5A 1JALA 4ZRQA 1MJDA 4KX6B 2WXRA 4A9AA 4XWTA 1FO4A 4JWUC 1JCKB 1T5XD 4G3XB 2SEBD 4HKZE 3V3XA 4N58A 2KVZA 2PE9A 1HA5A 4XDCA 4RFBA 1OQQA 1SGHA 4IM0A 1DOYA 2RDHA 3NOBA 2E6XA 3A1QB 2N9EB 1IBXA 1E90A 3WCQA 4M02A 2LASA 1WXSA 3R7QA 2V3NA 2B76B 2LZ6A 5LNK1 4ICUA 2I1KA 2Y5PA 1GUAB 1XD3B 2N9XA 3ZDTA 3JYUA 5D7GA 2WWZA 1WM2A 3HM6X 2KC1A 4LLGM 2I2YA 1ESFA 2MEKA 3AEBB 4MELA 1WXMA 3MHSD 3N30A 4NQKE 1K52A 2JZPA 2PVGC 1EO6A 4YTPB 4BOSC 1Z5SB 1WMHB 3EFCA 2GBRA 2M0AA 3VH3B 1L0YB 2GBMA 2KOXA 2O2VB 1ACCA 4HCPB 4EFOA 2KDIA 3ZLZA 1RM6C 2KJ6A 4B9KA 4HROA 3BVMA 1E0ZA 1Z2MA 5JHBA 2BWFA 2GBNA 2JVCA 2FIDA 3M63B 2KTFA 4RF1A 1ENFA 1J7CA 2CJOA 2K6DB 2RSUA 3AE9B 3DBRI 1C76A 3SDLC 4DHJB 3DHHC 2ZNVC 2N7DA 2NPTB 1P7EA 1L0XB 1XLNA 3DVNV 4P6VF 3BVGA 1C78A 1WRDB 2WXNA 3ZKJC 4FJZA 1JWAD 3SR6A 3DCGA 2CR5A 1JWMD 4WJNA 3IG3A 2MQJA 3QAQA 1YN5A 3HHMA 2WP9B 3W1SC 1J19A 4EEWA 1E8XA 2KDFB 1FNVA 3ETRA 4OVVA 3L10B 3WALA 1GG3A 1TKGA 1C79A 1U4AA 3DVGX 3VR9B 1HE8A 4ZHPA 1D4BA 3OLMD 1QOAA 3ZTCA 1CJEA 3U30A 1JWSD 2W54A 1WI0A 2EKIA 3PGEA 4HJGE 2N7JA 3V60A 2DZMA 1K51A 4C4VB 1WX8A 2DZIA 2L76A 2FNJB 4MEMA 1CK1A 4HK2A 4IWPA 1WGGA 4RGNA 1L4DB 1V1PA 2WXMA 2OEDA 4P7IA 2M17A 4HCNB 2LWPA 1HEZE 2ZW1A 5D2MB 4ZRJA 5H8YE 5FKAC 4WQOB 5C2TB 2LHEA 3ONSA 1T6BX 4LNOA 3R8BA 3TUOA 1H4RA 3VFKA 4ANXA 4F8CB 2WGSA 4GDKB 2C60A 1H8CA 2BYTA 2L32A 2D5GA 1XLQA 1YOVB 1TT5B 1GNUA 4ITKA 1GC6A 3PSEB 4PYZA 3A4SC 3UIOB 2PIAA 2Y5BB 3IAM1 3PS6A 2WDQB 5CTRC 5DCNA 3U52E 3JSVA 2DYBA 2AQ1B 1C9FA 2J52A 4NZLB 1E7PB 1SSNA 2L05A 1RLFA 3PV1A 4RGOS 4Q2JA 4HPPA 1IPGA 2KFKB 3TEWA 1MHHE 4PK1A 2NS5A 2JY6A 3SU8X 3DBLI 2NTTA 1SIFA 1NI3A 2LJIA 4CQNA 2DBYA 3KUCB 1DYQA 2N4FA 2BT6A 1UWXA 3ZIMA 4KGSA 3VUXA 2MSED 2QEJC 3N32A 1LO5D 3R7RA 2ACZB 2DENB 5FK9C 4GXBA 1VZ8A 4FLHA 1GOZA 4AJYB 1YD8U 1L4ZB 1ZDVA 2FAZA 2Z0EB 1WGHA 1UUPA 4LJOB 1BT0A 4M0WA 2N9PC 4HDOA 1V1OA 1KH0A 4RGMA 2KHWB 2QMTA 1TBEA 4HXDA 1GB4A 1WGKA 2MBBB 2FCQA 1R4MB 1I4QA 4GN1A 4DK5A 3Q3OC 4ZRIA 4BBNC 2FBWB 4HPLB 3VRAB 4US9A 3A9KB 2DLBA 3ZO5B 2N1VA 5JXVA 1EUVB 4ANWA 4RNAA 4RCOA 2QDFA 4FADA 2N1WA 1R4NB 4IOIE 1VD2A 3RNAC 1VZ6A 5BMIA 1K50A 3VTVA 1I4HA 4W9JA 1WXVA 4NJ6A 2INDC 4ZOHC 2AL3A 1ZPSA 3VQIA 3U7DA 1TKEA 4KIKA 1ET9A 1EU3A 1HZ6A 4IM2A 1WR1A 3AI5A 3QX1A 5MPOA 5IN7A 2C7NB 3RNGC 1V49A 5C1ZA 3AMZA 4JQWC 5BYSA 4MM3B 3H1UA 1NYQA 3X23A 1K53A 3B2FA 2V4IB 1TZ1A 4ZRKA 3R2IA 2G4SA 4XWWA 3LJ3A 2ASQA 2JX5A 1WZ0A 1N5WA 2J0MA 4YT0B 2BTEA 2JSVX 1L7YA 3URYA 3EGRA 2WXKA 2V1YA 3N1XC 4E3CA 2J4XA 3TBLD 2CS4A 3L54A 4G11A 1UNSA 1NI2A 2PPHA 2ZVNA 3KLSX 3TMPB 4FBJB 1JROA 1FD6A 4WURA 1WYWB 3DWMA 5BMHA 1FRDA 1F52A 1F0ZA 2DYOA 2LXAA 3EUB2 1RYJA 2R2QA 3NHEB 3RN9C 2NBWB 1TS2A 2MW5A 1ZGUB 2JZ3B 3T8MA 3ZW3A 2BS3B 4N59A 3BY4B 1JWBD 2Q5WD 2XBBC 1Q1OA 2N7EA 4KSKC 3GP7A 3AEAB 2I38A 5D3IB 2NMQA 3T3OA 2KQ7A 2WX0A 2MCNB 2WS3B 3TEYA 1JRPA 4LDTD 1HTQA 3QK0A 2FE8A 1VR9A 1I35A 3IXSA 3Q8EA 4FN2A 4DDGD 2BVCA 5IOIA 1GB1A 4HKQA 2K39A 4JPSA 2W55A 4BOZB 5LXIB 2PVOD 1SE2A 2PJHA 1SBBB 2MJ3A 1L6UA 5HG2A 1T0YA 1TJEA 3ZGZA 1KTKA 2KT7A 2INPE 3H7SA 2MWSB 1E8YA 1AWDA 2WX1A 2L7RA 1OFFA 2KTRA 3B0AA 4S17A 3VRBB 2TSSA 5KHOA 2M56B 1FNUA 5AUIA 1IGCA 1QF6A 3EA6A 2GRIA 2FIFA 4KV2A 3AU4A 4KGTA 2LRWA 1J8CA 3AH7A 1UZXB 4LDTB 3AE1B 3KUZA 1I4XA 2W82A 3HK0A 2JF5A 1SF0A 4GDLA 1C4AA 4GLSC 4BAXA 4I6LB 4C00A 1JW9D 2KK8A 2BBCA 2JZZA 4RM8A 1S3SG 4O1NA 2L83A 1LXDA 4C56C 2VZKB 5EE1A 4AOFA 3KWLA 3RCZA 3BK2A 3ZXVA 2V3SA 2WDVB 2KDBA 1VCBA 1GJZA 2ZW0A 2W3SA 1AARA 1P0RA 3A4RA 1ZW7A 4PS3A 4J3OD 4A90A 2RPQA 2WXFA 3BYTB 1FFVA 2H88B 4IG7B 2KO3A 3AECB 3PLVA 1I42A 3HUIA 2LUEA 2LRUA 4C7ZA 4M01A 4FHKA 2K3UA 4A55A 2KX0A 4LNIA 2GOWA 1XQQA 4NNJB 1M94A 2M0XA 5L95C 3BIID 2H89B 3RPFC 4DBGA 2ZPNA 5BYRA 5EE9A 1D5XC 3NG0A 1WE7A 4IWOA 4ZRPA 3NZUA 2CHXA 2N9KA 4KDLB 4BKGA 2A4ZA 1YNTE 5HFYA 4I6PA 1BMLC 1JRUA 2UWQA 3GS2A 2SAKA 4AWJA 5J17A 2MP2A 4M8MA 4XC2A 3L4PA 4K7UA 3Q3MC 1XT9B 1F2RI 3IFWB 3LDZE 4IWQA 3WAPA 1I4RA 3KVFB 2JRIB 3U8ZA 2EKEC 3Q2AC 3PZ7A 3DQVA 4MJSB 1UBIA 2CU3A 2NVUI 1CZPA 2J7QB 3H7PA 2MLBA 2W3RA 1YQ4B 4I6NB 5G5GA 5IP4D 1OEYJ 1UWMA 3C19A 1WJUA 3ENEA 4TKNA 3EECA 3OAWA 5DPWA 4W9FA 2BF8B 1XF5L 2REXA 3V61A 2BYEA 3Q14C 3ZNHB 3ZRFA 1T0RC 3ML9A 3VAWA 3UGBB 3P4PB 2YEPB 5TSSA 3S2AA 1ZP0B 2RDBC 2MBHA 3ZDMC 4ACFA 3J9CA 2DZJA 3H6NA 1YJ1A 3QWZB 3N1YC 5E6JA 4JGHB 1ZE3D 2AQ2B 3M95A 1V80A 4C80A 4MSQB 3UQBA 2AWTA 3I3TB 4OZCA 3TCAA 1FXAA 1E8ZA 2IY1B 2K6QA 4ICVA 2PTLA 4KGRA 2QILA 3A1QA 1NDDA 3PRMB 4LNKA 4LJPB 2IDYA 3PRPB 4WWOA 4F1SA 3CSTA 4QAYA 4EZJA 1P9DU 2IO1B 4HLEA 3V6CB 3MHZA 4J6IA 3DHIC 4HEA1 4W9DA 3JVZX 1J7BA 3Q8FA 2V0GA 3NRZA 4TMAB 3PREA 3ZUNA 1MI0A 3PO0A 2IO3B 2DWQA 4MGZE 2MBQA 2BS2B 2EELA 4ZDVA 4BKTA 2LGSA 3DHGC 3HVDA 3SD5A 2JWUA 2GLSA 3Q6BA 4RF0A 5AEKB 1FXIA 2BYFA 2KWVB 4GOCA 1XCQL 1WFYA 4US8A 4DHZB 4MSMB 1S1QB 3U4EG 4LCDE 1YJIA 4TSSA 3AE8B 3N20C 1N61A 4D2KA 1WR6E 3ALBA 2NPTA 1FFUA 2G45B 3GZNB 3RNFC 4HPMB 1FXTB 2PLPA 2K9XA 3AB5A 1WGRA 5JZEB 3RFZB 1JQ4A 2JXXA 2VRRB 3HM3A 4AQ7A 2DHZA 4W9HA 1YMHE 1SE9A 4WJPA 4M0WB 1P98A 4CHKA 1I4PA 4K3CA 2PMVA 1GPXA 2IO0B 1PGBA 3FILB 4ZYNA 5JHAA 2WXIA 4REZA 2XN9C 3MC9A 3CSFA 2AEHA 4II3B 1WM3A 4BBNF 1MPEA 4MH0E 4WAFA 3EC8A 5DPRA 2KZRA 2D10A 4DXFA 2C7MB 5D3DA 1JMLA 3OJ3A 1V8CA 3AE6B 2KD0A 3GE8C 2L0TA 2KNBA 1V86A 1F9JA 1NENB 1XCTL 3RMKC 1WH3A 3MJWA 3M3JA 1D5ZC 2KWUB 1OQRA 1V81A 2JYTA 4PT5A 1J0GA 1HTOA 3ZRCA 3SFEB 4G50A 4K7SA 4MGIE 1AN8A 5IA7A 4K81A 2KXJA 4MACA 3I9V1 3HVZA 1FRRA 3NVZA 4KIKB 2XK5B 4NQLB 3NZ3A 4XDDA 3O65B 3B2GA 2LFIA 2IY0B 1KFYB 4IM3A 3FC4A 2ZEQA 5I4DA 5C3JB 1ROEA 1EM7A 1WGYA 2G4DB 1QOBA 3VVWB 1STEA 4FJVB 5EE3A 2MJDA 2QCZA 3E9SA 3EHVA 3P1MA 1MG4A 3VHTC 1J7AA 1IGDA 3QA8A 3AE4B 1WZ3A 3SHQA 2J53A 2K8CA 2WXQA 3CMMB 3DDCB 2INNE 1WIAA 2OJRA 4R3DA 4WWPA 1B9RA 2KC2A 2YEPF 1FPYA 2LGIA 3P42A 2MBOA 2RR9A 4P1BC 5GXGB 2ZPYA 2KMCA 4GMVA 3P4SB 1CQVA 3KWVA 1SE3A 1KM7A 3MJ5A 4X57B 1TTNA 3BZDB 4OZAA 3AEEB 2WQYB 4NAWB 2LHDA 3DVGY 3IVFA 2LGXA 1QILA 2CKHB 3L0WB 2WU5B 5DPSA 1V9JA 1ZXIA 1YQBA 4HRSA 3CIRB 3PPAA 1QZEA 3VH4B 2I1JA 2K0PA 3NVYA 3L17A 1SJED 2G9HD 5FR6A 3APFA 2ZVOA 4A20A 4XX5A 4DWFA 1WX7A 2ZNVB 3BINA 2RDGA 1LFDA 1VJKA 1X1MA 3AE5B 2KQSA 2CHWA 2LMCA 2WXOA 4TQ0A 1Y8RC 4W9LA 4JL9A 3ZTDA 5CHWA 2Y5CA 2WXHA 3PTFC 4B6WA 1UD7A 3DVNU 4IUMB 4EOYA 3UF8A 3W5UB 3CF6E 2D3BA 1YQ3B 1VRAB 3T9LA 1UF0A 3R66C 1TY2A 4NJ7A 1XLOA 1UGJA 2LEKA 3APCA 4WJQA 2PW9A 3DBRB 3RZWC 5G5HA 1KOTA 1UBQA 2R61A 4WWMA 5CHVC 1UELA 4B95A 2M4NA 4MDKE 4WH4A 3RZFA 3L08A 1VZ7A 2LVQA 4MM3A 2YVCA 4MGKE 3QIJA 4LTUA 3OG5A 4IW0A 2Z59B 4USAA 2WDRB 2DYMA 3AULA 2Z0DB 3TEXA 2C5LC 1FCCC 1T3QA 4GDLB 4WIPA 2KN5A 2QSDA 1FIQA 2YLMA 2L8JA 1IUEA 4GB9A 2IBIB 2ZCBA 3LYYA 2IGGA 1OEYA 3B08A 1RAXA 2V4LA 4ANVA 2JUOA 2RD0A 1N62A 5JH5C 2QJLA 4P1CC 2FCMA 4YL8A 3I63C 1MG8A 3RNCC 4DXAB 4AJWA 4L23A 3E56A 5LLIA 1UH6A 2LJ5A 2AL6A 4CO7A 3GZNI 2GMIC 2KVRA 1ZKHA 3P63A 4IKGA 3P2BA 3QC8B 1C3TA 3BVZA 2D3GA 2DAJA 4FA6A 2GBKA 1WE6A 1XO3A 3UINB 3Q8BA 1Q0WB 5HKHA 1WF9A 3LXFA 1E7UA 3V62A 2FUG1 3MFGA 3AEFB 1M4VA 3PVLA 2XNAC 3RUIB 3RULA 1QKZA 4KZ0A 4M00A 1BXTA 3A9JA 2NCNA 2D07B 1V2YA 1EWYC 1FEHA 2KLGA 2KFJA 3NVVA 4H2AA 3ABVB 2O6VA 1N5XA 4OVUA 1RRBA 5DPTA 1DOIA 4NPNA 3DBLB 4JE3B 4MT5A
chains in the Genus database with same CATH topology
3AE2B 1UWXA 1SE4A 1YJJA 4KGSA 4NJCA 1IBXB 1NVID 2QEJC 1LO5D 2ACZB 2IDYA 5FK9C 1VZ8A 1GOZA 1V97A 1B1ZA 1BUIC 1L4ZB 1ZDVA 1TS3A 2WNMA 1WYGA 2WLBA 3AV8A 1UUPA 3MHZA 4M0WA 2NTSA 1V1OA 3MC0B 4HEA1 1KH0A 4RGMA 1KRHA 3AM9A 2QMTA 1J7BA 2ONQA 3Q8FA 2X38A 2V0GA 1GB4A 3NRZA 4TMAB 1WGKA 1QQRA 1MI0A 3PO0A 2DWQA 1I4QA 4RGTA 2BS2B 2EELA 4WQMA 1PYWD 1SXTA 1GAQB 2FBWB 4ZYSA 1DOXA 3HVDA 3VRAB 2QIEB 4US9A 2JWUA 2DLBA 4RF0A 1FXIA 3C8YA 5JXVA 1Y56A 1RFKA 4MH8A 1MHXA 4RNAA 2VZKD 4KKJA 4RCOA 1XLPA 1XCQL 3NUHB 4IOIE 2HDEA 4US8A 1PGXA 5FR3A 4IDIA 1VZ6A 3U4EG 5BMIA 1K50A 1TZOA 2IGDA 3FAHA 1I4HA 1YJIA 3ZYYX 3LB8C 4TSSA 1QOGA 3W1SA 3AEGB 4RH6A 2OHFA 2PKOA 3AE8B 4ZOHC 1N61A 4D2KA 1ZPSA 3VQIA 2WXGA 1TKEA 1FFUA 1ET9A 1EU3A 1HZ6A 3CWIA 2JXTA 5MPOA 2PLPA 2WXJA 1R7SA 2K9XA 3AB5A 5HI1A 5T8IA 3AMZA 5BYSA 2IJ0A 4YXDB 1F2RC 3KQ4A 3RFZB 1JWUD 1JQ4A 2WXPA 1F77A 4MM3B 2V3PA 4AQ7A 1NYQA 4B0MA 4N6EB 1K53A 3B2FA 2V4IB 1YMHE 3R2IA 4XWWA 2KAJA 1PFDA 2JQRB 2IGHA 2Z8LA 3IT6B 2JX5A 1AW7A 1I4PA 3P4RB 1L6VA 2PMVA 5HHDG 1GPXA 1PGBA 3BYYB 3FILB 1N5WA 3UI3A 2L52A 4YT0B 2WXIA 3I57A 3U7ZA 4REZA 2XN9C 2G1EA 5AUKA 2BTEA 2JSVX 3B9JA 3T3NA 1MPEA 3URYA 3EGRA 4WAFA 1EU4A 2WXKA 2LUMA 4UDUC 2MH7A 2J4XA 3IT4B 2JYEA 4DXFA 1TY0A 5D3DA 1UNSA 4XE0A 1QLBB 4ZHOA 3W5VB 1MVKA 1JMLA 1V8CA 3AE6B 1TKYA 3KLSX 1JROA 1KF6B 4A6QA 1QT9A 4WURA 1FD6A 1NENB 3DWMA 2WU2B 1XCTL 5BMHA 2GI9A 1FM0D 4A8XC 1FRDA 3ZJTA 1F0ZA 4YTMB 4TQ1A 2DYOA 3EUB2 4OZBA 1D5ZC 1RYJA 4L1BA 4NAMA 1OQRA 1V1PB 2JYTA 1HQRD 2Y3AA 4PT5A 4C7YA 1TS2A 3BWUD 3SFEB 3AE3B 1AN8A 2K22A 4MACA 3I9V1 3HVZA 2BS3B 1FRRA 3NVZA 3MP9A 4N59A 1JWBD 2Q5WD 3NZ3A 4XDDA 1TS5A 2HTME 3B2GA 1DGJA 3GP7A 1C4CA 4L2YA 1D6EC 2LFIA 3AEAB 3O13A 1KFYB 2I38A 5D3IB 2NMQA 1TS4A 3FC4A 1SIJA 5I4DA 3T3OA 3Q8CA 3TSSA 4YTNB 2K5PA 2WS3B 3TEYA 1JRPA 2BB6A 3TEZA 4YSYB 2FE8A 2KQ4X 5H92C 5C3JB 1ROEA 1VR9A 4B0EA 3IXSA 1EM7A 1KLGD 3IAS1 5BYQA 2KN4A 2L1AA 1QOBA 3Q8EA 1STEA 5EE3A 2MJDA 1GB1A 4HKQA 1Q10A 2E3TA 2BW2A 2BS4B 1VDVA 3E9SA 3P1MA 4ARIA 4FXCA 1HZ5A 1JALA 4JPSA 2W55A 1J7AA 1IGDA 3AE4B 3PZ8A 2PVOD 1SE2A 4ZRQA 1SBBB 4OHJA 2J53A 2MJ3A 2WXQA 1L6UA 2WXRA 4KX6B 5HG2A 4A9AA 4XWTA 1FO4A 4JWUC 4YWGG 1JCKB 1TJEA 3ZGZA 1T5XD 2INNE 3AN1A 2SEBD 1KTKA 4HKZE 3V3XA 2INPE 2M19A 4N58A 4R3DA 2N0SB 1B9RA 4ARCA 1PUTA 2YEPF 2LGIA 3P42A 2KWDA 4AS1A 1HA5A 1AWDA 3V05A 3W2DA 4XDCA 1XEEA 1OQQA 4RFBA 3ZJUA 3AE7B 5GXGB 1OFFA 3VRBB 1DOYA 1ZOYB 3P4SB 2RDHA 1CQVA 3KWVA 2TSSA 2E6XA 1SE3A 1IBXA 2M56B 3WCQA 1FNUA 5AUIA 1IGCA 1WSPA 1QF6A 3EA6A 3MJ5A 2GRIA 4OZAA 3BZDB 3AEEB 2V3NA 2WQYB 2B76B 4KGTA 4NAWB 5LNK1 2LHDA 3AH7A 1QILA 3AE1B 2Y5PA 1I4XA 2W82A 1KLUD 2WU5B 1ZXIA 5D7GA 1SF0A 4DQOC 1C4AA 4HRSA 4LLGM 3CIRB 1ZDXA 4GLSC 1ESFA 2I2YA 2MEKA 3AEBB 1NYRA 1ZXHA 2MJEA 1JW9D 2K0PA 3NVYA 1K52A 2JZPA 1SJED 2G9HD 2PVGC 2BBCA 3HRDD 5BMGA 4O1NA 2L83A 4OVZA 4YTPB 4C56C 2VZKB 5EE1A 2ICIA 2RDGA 3AEDB 1VJKA 4LK0M 2M0AA 3AE5B 1L0YB 2LMCA 2WXOA 2KDMA 3BK1A 3KWLA 4TQ0A 3BK2A 2RPVA 1ACCA 1VLBA 2WDVB 1HXYD 1RM6C 2Y5CA 4HROA 2WXHA 2ZW0A 2W3SA 3BVMA 1E0ZA 3NVWA 1WRIA 1E6EB 2IPKD 3W5UB 4J3OD 4A90A 1QOFA 1A70A 2WXFA 3BYTB 1I4GA 3ZQ4A 1FFVA 2H88B 4RF1A 1ENFA 1YQ3B 1J7CA 1WXQA 2CJOA 1VRAB 3AE9B 1C76A 1TY2A 3AECB 4EE2A 1XLOA 2ON8A 1UGJA 3HUIA 1FMAD 2LEKA 2PW9A 1SJHD 4C7ZA 1P7EA 1L0XB 1XLNA 4DXGA 2CJNA 4P6VF 5G5HA 1C77A 1RWSA 2R61A 3BVGA 4YSXB 1NEKB 4WWMA 1C78A 2WXNA 3U2SC 2K3UA 4A55A 2KMMA 4WH4A 1JWAD 1E9MA 1VZ7A 3SR6A 3R2TA 1JWMD 1TYGB 3BIID 2H89B 3RPFC 4LTUA 2AX5A 5BYRA 5EE9A 1D5XC 1PDXA 4USAA 2WDRB 3ZJVA 2DYMA 1YN5A 4ZRPA 3TEXA 1YN3A 2WP9B 3H8HA 2N9KA 1FCCC 2BB5A 1T3QA 4GDLB 4WIPA 3FILA 1FNVA 1YNTE 2QSDA 1FIQA 5HFYA 3ETRA 1BMLC 3GS2A 1IUEA 1D5MC 2SAKA 1TKGA 1C79A 3LYYA 3P4QB 3VR9B 1YN4A 3GB1A 4ZHPA 1D4BA 2IGGA 1P7FA 1QOAA 3L4PA 1CJEA 1F2RI 1JWSD 1AYFA 1I4RA 3Q69A 1SEBD 1N62A 2W54A 2EKIA 2QJLA 2WXLA 4HJGE 1C4PA 2JU6X 2N7JA 1SB3C 1K51A 1EWCA 1ET6A 3PZ7A 1N60A 1I7HA 4JX1C 1CK1A 4L23A 4RGNA 1L4DB 3E56A 1V1PA 2WXMA 2OEDA 2CU3A 3OWEB 1N63A 1CZPA 3SFDB 2W3RA 1FNWA 3SEBA 1L0VB 1HEZE 1YQ4B 2ZW1A 5G5GA 3P63A 5H8YE 1UWMA 4IKGA 5FKAC 3BVZA 5C2TB 2GB1A 2LHEA 1E10A 1T6BX 3R8BA 4JWSC 3TUOA 1XO3A 1L5PA 3Q8BA 4GDKB 1ZUD2 1XF5L 4YSZB 5EE0A 2BYTA 2RMMA 2L32A 2D5GA 1XLQA 3LXFA 4KKIA 3N9YC 2FUG1 3MFGA 1FCLA 4ITKA 1WWTA 3AEFB 1M4VA 3Q8AA 4OW0A 3P4PB 2YEPB 5TSSA 2XNAC 1QKZA 1ZP0B 1BXTA 3J9CA 3W9CB 2PIAA 3IAM1 2N9LA 2WDQB 5E6JA 3U52E 1PGAA 3VR8B 1EWYC 2J42A 2AQ1B 1C9FA 1ZE3D 2AQ2B 2J52A 1FEHA 4NZLB 1E7PB 1SSNA 4RGOS 4Q2JA 3NVVA 4H2AA 3ABVB 4C80A 3TEWA 4OZCA 1MHHE 1N5XA 1FXAA 2AQ3B 4P16A 2NTTA 1NI3A 2LJIA 4CQNA 3DWGC 1DOIA 2PTLA 2KACA 2DBYA 4KGRA 1DYQA 3NS1A 4JE3B 4MT5A 1XXGA 2BT6A 2QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFY A;  1UWX A;  1IBX A;  4KGS A;  1IBX B;  2JSV X;  1IGC A;  1MPE A;  4OZA A;  3GB1 A;  1D4B A;  2IGG A;  1P7F A;  4KGT A;  2LHD A;  2LUM A;  1F2R I;  4HJG E;  1MVK A;  2JU6 X;  1JML A;  1KH0 A;  2N7J A;  2I2Y A;  4GLS C;  1K51 A;  2QMT A;  1FD6 A;  2ONQ A;  1XCT L;  5BMH A;  1GB4 A;  2GI9 A;  1ZXH A;  2K0P A;  1MI0 A;  1K52 A;  2JZP A;  4OZB A;  5BMG A;  2OED A;  2EEL A;  2KDM A;  1HEZ E;  2RPV A;  2JWU A;  2ZW1 A;  4MAC A;  5JXV A;  4IKG A;  3MP9 A;  1MHX A;  2ZW0 A;  2GB1 A;  2LHE A;  1XCQ L;  2I38 A;  4IOI E;  2NMQ A;  1PGX A;  1XF5 L;  5BMI A;  2RMM A;  1K50 A;  2IGD A;  2KQ4 X;  1EM7 A;  2KN4 A;  1FCL A;  2ON8 A;  1GB1 A;  4D2K A;  1QKZ A;  1Q10 A;  2PW9 A;  1P7E A;  1HZ5 A;  1HZ6 A;  2N9L A;  1IGD A;  2JXT A;  1PGA A;  2PLP A;  2J53 A;  5HI1 A;  1C9F A;  2J52 A;  5HG2 A;  4WH4 A;  1F2R C;  4OZC A;  1MHH E;  1K53 A;  4HKZ E;  3V3X A;  1YMH E;  2LGI A;  2KWD A;  2IGH A;  2PTL A;  2KAC A;  2N9K A;  1FCC C;  4KGR A;  5HHD G;  1PGB A;  3FIL A;  3FIL B;  1YNT E;  3UI3 A;  2QSD A; 
#chains in the Genus database with same CATH topology
 4NJC A;  1IBX B;  1ISN A;  1TGZ B;  2BWE S;  1V97 A;  1B1Z A;  3B1L X;  3H7P B;  1TS3 A;  2WNM A;  4HDQ A;  1WYG A;  4URK A;  2WLB A;  3AV8 A;  2JPH A;  3L16 A;  2NTS A;  4K3B A;  3MC0 B;  4BZA A;  1KRH A;  1R4M I;  3TIX A;  3MC8 A;  1QQR A;  3KH0 A;  5E6O A;  3DBH B;  4RGT A;  3UIP B;  4FJY A;  4WQM A;  1PYW D;  1GAQ B;  4FHJ A;  4ZYS A;  2QIE B;  4PS7 A;  3C8Y A;  1Y56 A;  5E6N A;  1R4N I;  1RFA A;  2KJH B;  1MHX A;  1T0Q C;  1WJ4 A;  1XLP A;  4RMA A;  3TL5 A;  3VTU A;  1MFW A;  2D3A A;  1PGX A;  5FR3 A;  3NZS A;  4XGA B;  1TZO A;  2IGD A;  3FAH A;  3ZYY X;  3LB8 C;  4RH6 A;  2OHF A;  3ZNG C;  3QJZ A;  5TR5 A;  2WXG A;  3RI7 C;  4BKS A;  3CWI A;  2JXT A;  2NBU A;  1V5O A;  4ANU A;  2WXJ A;  4DHJ D;  1R7S A;  5T8I A;  2C7H A;  3WIM A;  1WX9 A;  3APD A;  4YXD B;  1F2R C;  4KVG B;  1JWU D;  4W9I A;  1F77 A;  2K1F A;  2VH2 A;  3N1Z C;  4B0M A;  2WHI A;  3QCA A;  4AUQ C;  1PFD A;  2JQR B;  4W9E A;  3IT6 B;  1AW7 A;  2D11 A;  1UGM A;  1L6V A;  2L52 A;  3V6E B;  5AUK A;  2G1E A;  2LXC A;  4GGQ A;  3KW5 B;  3AU5 A;  2IO2 B;  3T3N A;  1EU4 A;  2LUM A;  4UDU C;  2MH7 A;  3IT4 B;  2D2Q A;  4XE0 A;  1QLB B;  4KSL C;  1KF6 B;  2EMS A;  1QT9 A;  2WU2 B;  5IO9 A;  2FCN A;  2GI9 A;  1FM0 D;  2HE7 A;  3GE3 C;  4A8X C;  4W9G A;  3AXC A;  4TQ1 A;  4OZB A;  4NAM A;  4MJS A;  1V1P B;  2C9W B;  1HQR D;  2LGY A;  2X8X X;  4EZL A;  3BWU D;  2K22 A;  3A33 B;  2G3Q B;  2EMT A;  4PS8 A;  1TS5 A;  2HTM E;  1DGJ A;  3Q3J A;  1P1A A;  1C4C A;  3O13 A;  2IYD B;  1SIJ A;  2FUH B;  3Q8C A;  3TSS A;  4YTN B;  2R2O A;  2BB6 A;  3Q3F A;  5H92 C;  1KLG D;  5BYQ A;  2KN4 A;  1WMH A;  2L1A A;  1P3Q U;  3QHT A;  1Q10 A;  2BW2 A;  2O2V A;  1VDV A;  2HJ8 A;  2QC8 A;  3ZNI D;  1IYF A;  1LGR A;  2V9H A;  4FXC A;  4PYU A;  2WDT B;  3PZ8 A;  2HTH A;  3JSV B;  4OHJ A;  2VH1 A;  5LXH A;  4YWG G;  2DNF A;  3AN1 A;  4HJK A;  4A3P A;  4DDI D;  2M19 A;  2N0S B;  4ARC A;  1PUT A;  3ML8 A;  2KWD A;  2L3Z A;  1WJ6 A;  4AS1 A;  3Q3N C;  3V05 A;  3W2D A;  2MRP A;  1XEE A;  3ZJU A;  3AE7 B;  1ZOY B;  1WSP A;  4W9C A;  4TV3 A;  1WXA A;  2K8H A;  1CMX B;  5D94 A;  1KLU D;  2MA9 B;  4DQO C;  1ZDX A;  3UQA A;  1NYR A;  1ZXH A;  2MJE A;  4S0R A;  5C23 A;  3HRD D;  5BMG A;  2BQQ A;  3QQ8 B;  4OVZ A;  5IKC M;  1EF1 A;  2KDE B;  4M8N A;  1WY8 A;  4A3O A;  3C0R B;  2ICI A;  4II2 B;  3AED B;  3IHP C;  4LK0 M;  2KDM A;  3BK1 A;  2RPV A;  3GOE A;  1LM8 B;  1VLB A;  1HXY D;  1N6Z A;  4TUU A;  1V5T A;  1TIF A;  4C4V A;  1KJT A;  3NVW A;  3PHX B;  1WRI A;  4KZC A;  2K8B A;  1E6E B;  2IPK D;  1QOF A;  1A70 A;  3ZXR A;  2MHJ A;  1I4G A;  3ZQ4 A;  1WXQ A;  2KX3 A;  3RYT A;  2W9N A;  2L0F A;  4EKU A;  3IBE A;  4EE2 A;  2ON8 A;  5AZF A;  1FMA D;  1SJH D;  4DXG A;  2CJN A;  1D3Z A;  1C77 A;  1RWS A;  2DZK A;  4YSX B;  1OTR B;  3VXW A;  1NEK B;  2AYO B;  3U2S C;  2IZV B;  2ZZP B;  1YX5 B;  2KMM A;  4GDK A;  2KJR A;  1E9M A;  3R2T A;  2A5U A;  1Q5W B;  2HD5 B;  3H9D A;  1TYG B;  4XZ4 A;  4JLC A;  2AX5 A;  1E5W A;  3EFU A;  2KYW A;  1PDX A;  5E6P A;  3ZJV A;  5J2R A;  1OGW A;  1YN3 A;  3H8H A;  2BB5 A;  3DBH I;  4HWI B;  3FIL A;  1PQS A;  4WWN A;  1D5M C;  2LI5 A;  2J0K A;  4WAA A;  3P4Q B;  1YN4 A;  2KFK A;  3GB1 A;  1P7F A;  3I5J C;  1AYF A;  3Q69 A;  1SEB D;  5CHF A;  2CHZ A;  2WXL A;  1C4P A;  2JU6 X;  4AP4 C;  5IAA C;  1SB3 C;  1E8W A;  3M62 B;  1EWC A;  4GSW A;  1ET6 A;  1N60 A;  1I7H A;  3WAM A;  4JX1 C;  3KYD D;  1YX6 B;  2PEA A;  2XEW A;  1GC7 A;  5AZH A;  3PT2 B;  3NS8 A;  4EUT A;  3OWE B;  3WAN A;  2J0J A;  1N63 A;  3SFD B;  1FNW A;  3SEB A;  1L0V B;  1G6J A;  4NY0 A;  2XK5 A;  3DBS A;  2NR2 A;  2KLC A;  5L83 A;  2GB1 A;  1E10 A;  4JWS C;  2MBE A;  5GMV A;  3K9O B;  2KAN A;  1L5P A;  1ZUD 2;  1K8R B;  4KDI C;  2M1M A;  4YSZ B;  5EE0 A;  2RMM A;  4K7W A;  4JIO U;  4KKI A;  4BVU C;  3N9Y C;  1FCL A;  1WWT A;  4OW0 A;  3Q8A A;  3KYC D;  4WJO A;  1F1H A;  3A9K A;  3X0W A;  4E71 A;  3W9C B;  2N9L A;  1PGA A;  3VR8 B;  1LQB A;  2BPS A;  2J42 A;  2JT4 B;  2BKR B;  2KMA A;  1T0S C;  2L00 B;  4W9K A;  2AQ3 B;  2OOB B;  4P16 A;  4G0N B;  2LD9 A;  3DWG C;  3TJP A;  4DHZ E;  2KAC A;  3NS1 A;  1IP9 A;  1XXG A;  2KTR B;  2O6V D;  3AE2 B;  1E7V A;  3D32 A;  1SE4 A;  1YJJ A;  1NVI D;  2K25 A;  4HVB A;  2B3A A;  3W1Y A;  1BUI C;  4NAW A;  4RM9 A;  3DPD A;  3ZNZ B;  3ECI A;  2DAF A;  3QAR A;  3PZD A;  1A5R A;  2OJW A;  1YIW A;  3AM9 A;  3PRZ A;  2ONQ A;  2X38 A;  2DX5 B;  2LVP A;  3RT3 B;  2KWC A;  2ZCC A;  5D6J B;  4CYE A;  3PHW B;  3VUW A;  1SXT A;  2BYV E;  5CX3 A;  2JWZ A;  1DOX A;  1WJN A;  2JRH A;  4FUL A;  4GIV A;  4N9F 4;  1RFK A;  4MH8 A;  3A9J B;  2NBV B;  3VUY A;  2VZK D;  4KKJ A;  2ZJD A;  3NUH B;  2WYQ A;  2MX2 A;  2HDE A;  4IDI A;  3WAO A;  3VTW A;  4GU2 A;  2O6V B;  4LNN A;  4EZK A;  1QOG A;  3W1S A;  3AEG B;  2PKO A;  3DOW A;  1C1Y B;  4K1R B;  2CU1 A;  2HJ1 A;  3MTN B;  5HI1 A;  4F7Z A;  3KUD B;  4ASW C;  2IJ0 A;  2PE6 B;  3VDZ A;  3KQ4 A;  5G2N A;  2WXP A;  2V3P A;  4BKS D;  4N6E B;  3RD2 A;  2INC C;  5AZG A;  2KAJ A;  2BGF A;  2IGH A;  2Z8L A;  3R3M A;  3P4R B;  5HHD G;  2LGD A;  3BYY B;  2UYZ B;  1L2N A;  3UI3 A;  3I57 A;  3K9P B;  3U7Z A;  3B9J A;  5J18 A;  1NBF C;  1OQY A;  2MP2 B;  4LNF A;  3N3K B;  5KHQ A;  2JYE A;  1TY0 A;  2RGF A;  3L13 A;  4ZHO A;  3WA0 A;  3W5V B;  3FKY A;  1MVK A;  1TKY A;  2GBJ A;  5EDS A;  4A6Q A;  3NJT A;  3HIZ A;  4MGY E;  3ZJT A;  4YTM B;  3RNE C;  2M8S A;  4L1B A;  4BFR A;  1KLV A;  2Y3A A;  4C7Y A;  5G55 A;  5BO4 B;  3AE3 B;  3RNB C;  1WGD A;  4E74 A;  3NY5 A;  3MP9 A;  4IC7 B;  3PLU A;  2UU7 A;  2KKC A;  4L2Y A;  4XYC A;  1D6E C;  1TS4 A;  2FCS A;  2K5P A;  3JW0 X;  2LVO A;  3TEZ A;  4YSY B;  2KQ4 X;  1EF5 A;  4B0E A;  1V6E A;  3IAS 1;  3ZVV A;  2QHO A;  2D3C A;  2E3T A;  2BS4 B;  2BKF A;  3OJ4 B;  4ARI A;  1HZ5 A;  1JAL A;  4ZRQ A;  1MJD A;  4KX6 B;  2WXR A;  4A9A A;  4XWT A;  1FO4 A;  4JWU C;  1JCK B;  1T5X D;  4G3X B;  2SEB D;  4HKZ E;  3V3X A;  4N58 A;  2KVZ A;  2PE9 A;  1HA5 A;  4XDC A;  4RFB A;  1OQQ A;  1SGH A;  4IM0 A;  1DOY A;  2RDH A;  3NOB A;  2E6X A;  3A1Q B;  2N9E B;  1IBX A;  1E90 A;  3WCQ A;  4M02 A;  2LAS A;  1WXS A;  3R7Q A;  2V3N A;  2B76 B;  2LZ6 A;  5LNK 1;  4ICU A;  2I1K A;  2Y5P A;  1GUA B;  1XD3 B;  2N9X A;  3ZDT A;  3JYU A;  5D7G A;  2WWZ A;  1WM2 A;  3HM6 X;  2KC1 A;  4LLG M;  2I2Y A;  1ESF A;  2MEK A;  3AEB B;  4MEL A;  1WXM A;  3MHS D;  3N30 A;  4NQK E;  1K52 A;  2JZP A;  2PVG C;  1EO6 A;  4YTP B;  4BOS C;  1Z5S B;  1WMH B;  3EFC A;  2GBR A;  2M0A A;  3VH3 B;  1L0Y B;  2GBM A;  2KOX A;  2O2V B;  1ACC A;  4HCP B;  4EFO A;  2KDI A;  3ZLZ A;  1RM6 C;  2KJ6 A;  4B9K A;  4HRO A;  3BVM A;  1E0Z A;  1Z2M A;  5JHB A;  2BWF A;  2GBN A;  2JVC A;  2FID A;  3M63 B;  2KTF A;  4RF1 A;  1ENF A;  1J7C A;  2CJO A;  2K6D B;  2RSU A;  3AE9 B;  3DBR I;  1C76 A;  3SDL C;  4DHJ B;  3DHH C;  2ZNV C;  2N7D A;  2NPT B;  1P7E A;  1L0X B;  1XLN A;  3DVN V;  4P6V F;  3BVG A;  1C78 A;  1WRD B;  2WXN A;  3ZKJ C;  4FJZ A;  1JWA D;  3SR6 A;  3DCG A;  2CR5 A;  1JWM D;  4WJN A;  3IG3 A;  2MQJ A;  3QAQ A;  1YN5 A;  3HHM A;  2WP9 B;  3W1S C;  1J19 A;  4EEW A;  1E8X A;  2KDF B;  1FNV A;  3ETR A;  4OVV A;  3L10 B;  3WAL A;  1GG3 A;  1TKG A;  1C79 A;  1U4A A;  3DVG X;  3VR9 B;  1HE8 A;  4ZHP A;  1D4B A;  3OLM D;  1QOA A;  3ZTC A;  1CJE A;  3U30 A;  1JWS D;  2W54 A;  1WI0 A;  2EKI A;  3PGE A;  4HJG E;  2N7J A;  3V60 A;  2DZM A;  1K51 A;  4C4V B;  1WX8 A;  2DZI A;  2L76 A;  2FNJ B;  4MEM A;  1CK1 A;  4HK2 A;  4IWP A;  1WGG A;  4RGN A;  1L4D B;  1V1P A;  2WXM A;  2OED A;  4P7I A;  2M17 A;  4HCN B;  2LWP A;  1HEZ E;  2ZW1 A;  5D2M B;  4ZRJ A;  5H8Y E;  5FKA C;  4WQO B;  5C2T B;  2LHE A;  3ONS A;  1T6B X;  4LNO A;  3R8B A;  3TUO A;  1H4R A;  3VFK A;  4ANX A;  4F8C B;  2WGS A;  4GDK B;  2C60 A;  1H8C A;  2BYT A;  2L32 A;  2D5G A;  1XLQ A;  1YOV B;  1TT5 B;  1GNU A;  4ITK A;  1GC6 A;  3PSE B;  4PYZ A;  3A4S C;  3UIO B;  2PIA A;  2Y5B B;  3IAM 1;  3PS6 A;  2WDQ B;  5CTR C;  5DCN A;  3U52 E;  3JSV A;  2DYB A;  2AQ1 B;  1C9F A;  2J52 A;  4NZL B;  1E7P B;  1SSN A;  2L05 A;  1RLF A;  3PV1 A;  4RGO S;  4Q2J A;  4HPP A;  1IPG A;  2KFK B;  3TEW A;  1MHH E;  4PK1 A;  2NS5 A;  2JY6 A;  3SU8 X;  3DBL I;  2NTT A;  1SIF A;  1NI3 A;  2LJI A;  4CQN A;  2DBY A;  3KUC B;  1DYQ A;  2N4F A;  2BT6 A;  1UWX A;  3ZIM A;  4KGS A;  3VUX A;  2MSE D;  2QEJ C;  3N32 A;  1LO5 D;  3R7R A;  2ACZ B;  2DEN B;  5FK9 C;  4GXB A;  1VZ8 A;  4FLH A;  1GOZ A;  4AJY B;  1YD8 U;  1L4Z B;  1ZDV A;  2FAZ A;  2Z0E B;  1WGH A;  1UUP A;  4LJO B;  1BT0 A;  4M0W A;  2N9P C;  4HDO A;  1V1O A;  1KH0 A;  4RGM A;  2KHW B;  2QMT A;  1TBE A;  4HXD A;  1GB4 A;  1WGK A;  2MBB B;  2FCQ A;  1R4M B;  1I4Q A;  4GN1 A;  4DK5 A;  3Q3O C;  4ZRI A;  4BBN C;  2FBW B;  4HPL B;  3VRA B;  4US9 A;  3A9K B;  2DLB A;  3ZO5 B;  2N1V A;  5JXV A;  1EUV B;  4ANW A;  4RNA A;  4RCO A;  2QDF A;  4FAD A;  2N1W A;  1R4N B;  4IOI E;  1VD2 A;  3RNA C;  1VZ6 A;  5BMI A;  1K50 A;  3VTV A;  1I4H A;  4W9J A;  1WXV A;  4NJ6 A;  2IND C;  4ZOH C;  2AL3 A;  1ZPS A;  3VQI A;  3U7D A;  1TKE A;  4KIK A;  1ET9 A;  1EU3 A;  1HZ6 A;  4IM2 A;  1WR1 A;  3AI5 A;  3QX1 A;  5MPO A;  5IN7 A;  2C7N B;  3RNG C;  1V49 A;  5C1Z A;  3AMZ A;  4JQW C;  5BYS A;  4MM3 B;  3H1U A;  1NYQ A;  3X23 A;  1K53 A;  3B2F A;  2V4I B;  1TZ1 A;  4ZRK A;  3R2I A;  2G4S A;  4XWW A;  3LJ3 A;  2ASQ A;  2JX5 A;  1WZ0 A;  1N5W A;  2J0M A;  4YT0 B;  2BTE A;  2JSV X;  1L7Y A;  3URY A;  3EGR A;  2WXK A;  2V1Y A;  3N1X C;  4E3C A;  2J4X A;  3TBL D;  2CS4 A;  3L54 A;  4G11 A;  1UNS A;  1NI2 A;  2PPH A;  2ZVN A;  3KLS X;  3TMP B;  4FBJ B;  1JRO A;  1FD6 A;  4WUR A;  1WYW B;  3DWM A;  5BMH A;  1FRD A;  1F52 A;  1F0Z A;  2DYO A;  2LXA A;  3EUB 2;  1RYJ A;  2R2Q A;  3NHE B;  3RN9 C;  2NBW B;  1TS2 A;  2MW5 A;  1ZGU B;  2JZ3 B;  3T8M A;  3ZW3 A;  2BS3 B;  4N59 A;  3BY4 B;  1JWB D;  2Q5W D;  2XBB C;  1Q1O A;  2N7E A;  4KSK C;  3GP7 A;  3AEA B;  2I38 A;  5D3I B;  2NMQ A;  3T3O A;  2KQ7 A;  2WX0 A;  2MCN B;  2WS3 B;  3TEY A;  1JRP A;  4LDT D;  1HTQ A;  3QK0 A;  2FE8 A;  1VR9 A;  1I35 A;  3IXS A;  3Q8E A;  4FN2 A;  4DDG D;  2BVC A;  5IOI A;  1GB1 A;  4HKQ A;  2K39 A;  4JPS A;  2W55 A;  4BOZ B;  5LXI B;  2PVO D;  1SE2 A;  2PJH A;  1SBB B;  2MJ3 A;  1L6U A;  5HG2 A;  1T0Y A;  1TJE A;  3ZGZ A;  1KTK A;  2KT7 A;  2INP E;  3H7S A;  2MWS B;  1E8Y A;  1AWD A;  2WX1 A;  2L7R A;  1OFF A;  2KTR A;  3B0A A;  4S17 A;  3VRB B;  2TSS A;  5KHO A;  2M56 B;  1FNU A;  5AUI A;  1IGC A;  1QF6 A;  3EA6 A;  2GRI A;  2FIF A;  4KV2 A;  3AU4 A;  4KGT A;  2LRW A;  1J8C A;  3AH7 A;  1UZX B;  4LDT B;  3AE1 B;  3KUZ A;  1I4X A;  2W82 A;  3HK0 A;  2JF5 A;  1SF0 A;  4GDL A;  1C4A A;  4GLS C;  4BAX A;  4I6L B;  4C00 A;  1JW9 D;  2KK8 A;  2BBC A;  2JZZ A;  4RM8 A;  1S3S G;  4O1N A;  2L83 A;  1LXD A;  4C56 C;  2VZK B;  5EE1 A;  4AOF A;  3KWL A;  3RCZ A;  3BK2 A;  3ZXV A;  2V3S A;  2WDV B;  2KDB A;  1VCB A;  1GJZ A;  2ZW0 A;  2W3S A;  1AAR A;  1P0R A;  3A4R A;  1ZW7 A;  4PS3 A;  4J3O D;  4A90 A;  2RPQ A;  2WXF A;  3BYT B;  1FFV A;  2H88 B;  4IG7 B;  2KO3 A;  3AEC B;  3PLV A;  1I42 A;  3HUI A;  2LUE A;  2LRU A;  4C7Z A;  4M01 A;  4FHK A;  2K3U A;  4A55 A;  2KX0 A;  4LNI A;  2GOW A;  1XQQ A;  4NNJ B;  1M94 A;  2M0X A;  5L95 C;  3BII D;  2H89 B;  3RPF C;  4DBG A;  2ZPN A;  5BYR A;  5EE9 A;  1D5X C;  3NG0 A;  1WE7 A;  4IWO A;  4ZRP A;  3NZU A;  2CHX A;  2N9K A;  4KDL B;  4BKG A;  2A4Z A;  1YNT E;  5HFY A;  4I6P A;  1BML C;  1JRU A;  2UWQ A;  3GS2 A;  2SAK A;  4AWJ A;  5J17 A;  2MP2 A;  4M8M A;  4XC2 A;  3L4P A;  4K7U A;  3Q3M C;  1XT9 B;  1F2R I;  3IFW B;  3LDZ E;  4IWQ A;  3WAP A;  1I4R A;  3KVF B;  2JRI B;  3U8Z A;  2EKE C;  3Q2A C;  3PZ7 A;  3DQV A;  4MJS B;  1UBI A;  2CU3 A;  2NVU I;  1CZP A;  2J7Q B;  3H7P A;  2MLB A;  2W3R A;  1YQ4 B;  4I6N B;  5G5G A;  5IP4 D;  1OEY J;  1UWM A;  3C19 A;  1WJU A;  3ENE A;  4TKN A;  3EEC A;  3OAW A;  5DPW A;  4W9F A;  2BF8 B;  1XF5 L;  2REX A;  3V61 A;  2BYE A;  3Q14 C;  3ZNH B;  3ZRF A;  1T0R C;  3ML9 A;  3VAW A;  3UGB B;  3P4P B;  2YEP B;  5TSS A;  3S2A A;  1ZP0 B;  2RDB C;  2MBH A;  3ZDM C;  4ACF A;  3J9C A;  2DZJ A;  3H6N A;  1YJ1 A;  3QWZ B;  3N1Y C;  5E6J A;  4JGH B;  1ZE3 D;  2AQ2 B;  3M95 A;  1V80 A;  4C80 A;  4MSQ B;  3UQB A;  2AWT A;  3I3T B;  4OZC A;  3TCA A;  1FXA A;  1E8Z A;  2IY1 B;  2K6Q A;  4ICV A;  2PTL A;  4KGR A;  2QIL A;  3A1Q A;  1NDD A;  3PRM B;  4LNK A;  4LJP B;  2IDY A;  3PRP B;  4WWO A;  4F1S A;  3CST A;  4QAY A;  4EZJ A;  1P9D U;  2IO1 B;  4HLE A;  3V6C B;  3MHZ A;  4J6I A;  3DHI C;  4HEA 1;  4W9D A;  3JVZ X;  1J7B A;  3Q8F A;  2V0G A;  3NRZ A;  4TMA B;  3PRE A;  3ZUN A;  1MI0 A;  3PO0 A;  2IO3 B;  2DWQ A;  4MGZ E;  2MBQ A;  2BS2 B;  2EEL A;  4ZDV A;  4BKT A;  2LGS A;  3DHG C;  3HVD A;  3SD5 A;  2JWU A;  2GLS A;  3Q6B A;  4RF0 A;  5AEK B;  1FXI A;  2BYF A;  2KWV B;  4GOC A;  1XCQ L;  1WFY A;  4US8 A;  4DHZ B;  4MSM B;  1S1Q B;  3U4E G;  4LCD E;  1YJI A;  4TSS A;  3AE8 B;  3N20 C;  1N61 A;  4D2K A;  1WR6 E;  3ALB A;  2NPT A;  1FFU A;  2G45 B;  3GZN B;  3RNF C;  4HPM B;  1FXT B;  2PLP A;  2K9X A;  3AB5 A;  1WGR A;  5JZE B;  3RFZ B;  1JQ4 A;  2JXX A;  2VRR B;  3HM3 A;  4AQ7 A;  2DHZ A;  4W9H A;  1YMH E;  1SE9 A;  4WJP A;  4M0W B;  1P98 A;  4CHK A;  1I4P A;  4K3C A;  2PMV A;  1GPX A;  2IO0 B;  1PGB A;  3FIL B;  4ZYN A;  5JHA A;  2WXI A;  4REZ A;  2XN9 C;  3MC9 A;  3CSF A;  2AEH A;  4II3 B;  1WM3 A;  4BBN F;  1MPE A;  4MH0 E;  4WAF A;  3EC8 A;  5DPR A;  2KZR A;  2D10 A;  4DXF A;  2C7M B;  5D3D A;  1JML A;  3OJ3 A;  1V8C A;  3AE6 B;  2KD0 A;  3GE8 C;  2L0T A;  2KNB A;  1V86 A;  1F9J A;  1NEN B;  1XCT L;  3RMK C;  1WH3 A;  3MJW A;  3M3J A;  1D5Z C;  2KWU B;  1OQR A;  1V81 A;  2JYT A;  4PT5 A;  1J0G A;  1HTO A;  3ZRC A;  3SFE B;  4G50 A;  4K7S A;  4MGI E;  1AN8 A;  5IA7 A;  4K81 A;  2KXJ A;  4MAC A;  3I9V 1;  3HVZ A;  1FRR A;  3NVZ A;  4KIK B;  2XK5 B;  4NQL B;  3NZ3 A;  4XDD A;  3O65 B;  3B2G A;  2LFI A;  2IY0 B;  1KFY B;  4IM3 A;  3FC4 A;  2ZEQ A;  5I4D A;  5C3J B;  1ROE A;  1EM7 A;  1WGY A;  2G4D B;  1QOB A;  3VVW B;  1STE A;  4FJV B;  5EE3 A;  2MJD A;  2QCZ A;  3E9S A;  3EHV A;  3P1M A;  1MG4 A;  3VHT C;  1J7A A;  1IGD A;  3QA8 A;  3AE4 B;  1WZ3 A;  3SHQ A;  2J53 A;  2K8C A;  2WXQ A;  3CMM B;  3DDC B;  2INN E;  1WIA A;  2OJR A;  4R3D A;  4WWP A;  1B9R A;  2KC2 A;  2YEP F;  1FPY A;  2LGI A;  3P42 A;  2MBO A;  2RR9 A;  4P1B C;  5GXG B;  2ZPY A;  2KMC A;  4GMV A;  3P4S B;  1CQV A;  3KWV A;  1SE3 A;  1KM7 A;  3MJ5 A;  4X57 B;  1TTN A;  3BZD B;  4OZA A;  3AEE B;  2WQY B;  4NAW B;  2LHD A;  3DVG Y;  3IVF A;  2LGX A;  1QIL A;  2CKH B;  3L0W B;  2WU5 B;  5DPS A;  1V9J A;  1ZXI A;  1YQB A;  4HRS A;  3CIR B;  3PPA A;  1QZE A;  3VH4 B;  2I1J A;  2K0P A;  3NVY A;  3L17 A;  1SJE D;  2G9H D;  5FR6 A;  3APF A;  2ZVO A;  4A20 A;  4XX5 A;  4DWF A;  1WX7 A;  2ZNV B;  3BIN A;  2RDG A;  1LFD A;  1VJK A;  1X1M A;  3AE5 B;  2KQS A;  2CHW A;  2LMC A;  2WXO A;  4TQ0 A;  1Y8R C;  4W9L A;  4JL9 A;  3ZTD A;  5CHW A;  2Y5C A;  2WXH A;  3PTF C;  4B6W A;  1UD7 A;  3DVN U;  4IUM B;  4EOY A;  3UF8 A;  3W5U B;  3CF6 E;  2D3B A;  1YQ3 B;  1VRA B;  3T9L A;  1UF0 A;  3R66 C;  1TY2 A;  4NJ7 A;  1XLO A;  1UGJ A;  2LEK A;  3APC A;  4WJQ A;  2PW9 A;  3DBR B;  3RZW C;  5G5H A;  1KOT A;  1UBQ A;  2R61 A;  4WWM A;  5CHV C;  1UEL A;  4B95 A;  2M4N A;  4MDK E;  4WH4 A;  3RZF A;  3L08 A;  1VZ7 A;  2LVQ A;  4MM3 A;  2YVC A;  4MGK E;  3QIJ A;  4LTU A;  3OG5 A;  4IW0 A;  2Z59 B;  4USA A;  2WDR B;  2DYM A;  3AUL A;  2Z0D B;  3TEX A;  2C5L C;  1FCC C;  1T3Q A;  4GDL B;  4WIP A;  2KN5 A;  2QSD A;  1FIQ A;  2YLM A;  2L8J A;  1IUE A;  4GB9 A;  2IBI B;  2ZCB A;  3LYY A;  2IGG A;  1OEY A;  3B08 A;  1RAX A;  2V4L A;  4ANV A;  2JUO A;  2RD0 A;  1N62 A;  5JH5 C;  2QJL A;  4P1C C;  2FCM A;  4YL8 A;  3I63 C;  1MG8 A;  3RNC C;  4DXA B;  4AJW A;  4L23 A;  3E56 A;  5LLI A;  1UH6 A;  2LJ5 A;  2AL6 A;  4CO7 A;  3GZN I;  2GMI C;  2KVR A;  1ZKH A;  3P63 A;  4IKG A;  3P2B A;  3QC8 B;  1C3T A;  3BVZ A;  2D3G A;  2DAJ A;  4FA6 A;  2GBK A;  1WE6 A;  1XO3 A;  3UIN B;  3Q8B A;  1Q0W B;  5HKH A;  1WF9 A;  3LXF A;  1E7U A;  3V62 A;  2FUG 1;  3MFG A;  3AEF B;  1M4V A;  3PVL A;  2XNA C;  3RUI B;  3RUL A;  1QKZ A;  4KZ0 A;  4M00 A;  1BXT A;  3A9J A;  2NCN A;  2D07 B;  1V2Y A;  1EWY C;  1FEH A;  2KLG A;  2KFJ A;  3NVV A;  4H2A A;  3ABV B;  2O6V A;  1N5X A;  4OVU A;  1RRB A;  5DPT A;  1DOI A;  4NPN A;  3DBL B;  4JE3 B;  4MT5 A; 
#chains in the Genus database with same CATH homology
 3AE2 B;  1UWX A;  1SE4 A;  1YJJ A;  4KGS A;  4NJC A;  1IBX B;  1NVI D;  2QEJ C;  1LO5 D;  2ACZ B;  2IDY A;  5FK9 C;  1VZ8 A;  1GOZ A;  1V97 A;  1B1Z A;  1BUI C;  1L4Z B;  1ZDV A;  1TS3 A;  2WNM A;  1WYG A;  2WLB A;  3AV8 A;  1UUP A;  3MHZ A;  4M0W A;  2NTS A;  1V1O A;  3MC0 B;  4HEA 1;  1KH0 A;  4RGM A;  1KRH A;  3AM9 A;  2QMT A;  1J7B A;  2ONQ A;  3Q8F A;  2X38 A;  2V0G A;  1GB4 A;  3NRZ A;  4TMA B;  1WGK A;  1QQR A;  1MI0 A;  3PO0 A;  2DWQ A;  1I4Q A;  4RGT A;  2BS2 B;  2EEL A;  4WQM A;  1PYW D;  1SXT A;  1GAQ B;  2FBW B;  4ZYS A;  1DOX A;  3HVD A;  3VRA B;  2QIE B;  4US9 A;  2JWU A;  2DLB A;  4RF0 A;  1FXI A;  3C8Y A;  5JXV A;  1Y56 A;  1RFK A;  4MH8 A;  1MHX A;  4RNA A;  2VZK D;  4KKJ A;  4RCO A;  1XLP A;  1XCQ L;  3NUH B;  4IOI E;  2HDE A;  4US8 A;  1PGX A;  5FR3 A;  4IDI A;  1VZ6 A;  3U4E G;  5BMI A;  1K50 A;  1TZO A;  2IGD A;  3FAH A;  1I4H A;  1YJI A;  3ZYY X;  3LB8 C;  4TSS A;  1QOG A;  3W1S A;  3AEG B;  4RH6 A;  2OHF A;  2PKO A;  3AE8 B;  4ZOH C;  1N61 A;  4D2K A;  1ZPS A;  3VQI A;  2WXG A;  1TKE A;  1FFU A;  1ET9 A;  1EU3 A;  1HZ6 A;  3CWI A;  2JXT A;  5MPO A;  2PLP A;  2WXJ A;  1R7S A;  2K9X A;  3AB5 A;  5HI1 A;  5T8I A;  3AMZ A;  5BYS A;  2IJ0 A;  4YXD B;  1F2R C;  3KQ4 A;  3RFZ B;  1JWU D;  1JQ4 A;  2WXP A;  1F77 A;  4MM3 B;  2V3P A;  4AQ7 A;  1NYQ A;  4B0M A;  4N6E B;  1K53 A;  3B2F A;  2V4I B;  1YMH E;  3R2I A;  4XWW A;  2KAJ A;  1PFD A;  2JQR B;  2IGH A;  2Z8L A;  3IT6 B;  2JX5 A;  1AW7 A;  1I4P A;  3P4R B;  1L6V A;  2PMV A;  5HHD G;  1GPX A;  1PGB A;  3BYY B;  3FIL B;  1N5W A;  3UI3 A;  2L52 A;  4YT0 B;  2WXI A;  3I57 A;  3U7Z A;  4REZ A;  2XN9 C;  2G1E A;  5AUK A;  2BTE A;  2JSV X;  3B9J A;  3T3N A;  1MPE A;  3URY A;  3EGR A;  4WAF A;  1EU4 A;  2WXK A;  2LUM A;  4UDU C;  2MH7 A;  2J4X A;  3IT4 B;  2JYE A;  4DXF A;  1TY0 A;  5D3D A;  1UNS A;  4XE0 A;  1QLB B;  4ZHO A;  3W5V B;  1MVK A;  1JML A;  1V8C A;  3AE6 B;  1TKY A;  3KLS X;  1JRO A;  1KF6 B;  4A6Q A;  1QT9 A;  4WUR A;  1FD6 A;  1NEN B;  3DWM A;  2WU2 B;  1XCT L;  5BMH A;  2GI9 A;  1FM0 D;  4A8X C;  1FRD A;  3ZJT A;  1F0Z A;  4YTM B;  4TQ1 A;  2DYO A;  3EUB 2;  4OZB A;  1D5Z C;  1RYJ A;  4L1B A;  4NAM A;  1OQR A;  1V1P B;  2JYT A;  1HQR D;  2Y3A A;  4PT5 A;  4C7Y A;  1TS2 A;  3BWU D;  3SFE B;  3AE3 B;  1AN8 A;  2K22 A;  4MAC A;  3I9V 1;  3HVZ A;  2BS3 B;  1FRR A;  3NVZ A;  3MP9 A;  4N59 A;  1JWB D;  2Q5W D;  3NZ3 A;  4XDD A;  1TS5 A;  2HTM E;  3B2G A;  1DGJ A;  3GP7 A;  1C4C A;  4L2Y A;  1D6E C;  2LFI A;  3AEA B;  3O13 A;  1KFY B;  2I38 A;  5D3I B;  2NMQ A;  1TS4 A;  3FC4 A;  1SIJ A;  5I4D A;  3T3O A;  3Q8C A;  3TSS A;  4YTN B;  2K5P A;  2WS3 B;  3TEY A;  1JRP A;  2BB6 A;  3TEZ A;  4YSY B;  2FE8 A;  2KQ4 X;  5H92 C;  5C3J B;  1ROE A;  1VR9 A;  4B0E A;  3IXS A;  1EM7 A;  1KLG D;  3IAS 1;  5BYQ A;  2KN4 A;  2L1A A;  1QOB A;  3Q8E A;  1STE A;  5EE3 A;  2MJD A;  1GB1 A;  4HKQ A;  1Q10 A;  2E3T A;  2BW2 A;  2BS4 B;  1VDV A;  3E9S A;  3P1M A;  4ARI A;  4FXC A;  1HZ5 A;  1JAL A;  4JPS A;  2W55 A;  1J7A A;  1IGD A;  3AE4 B;  3PZ8 A;  2PVO D;  1SE2 A;  4ZRQ A;  1SBB B;  4OHJ A;  2J53 A;  2MJ3 A;  2WXQ A;  1L6U A;  2WXR A;  4KX6 B;  5HG2 A;  4A9A A;  4XWT A;  1FO4 A;  4JWU C;  4YWG G;  1JCK B;  1TJE A;  3ZGZ A;  1T5X D;  2INN E;  3AN1 A;  2SEB D;  1KTK A;  4HKZ E;  3V3X A;  2INP E;  2M19 A;  4N58 A;  4R3D A;  2N0S B;  1B9R A;  4ARC A;  1PUT A;  2YEP F;  2LGI A;  3P42 A;  2KWD A;  4AS1 A;  1HA5 A;  1AWD A;  3V05 A;  3W2D A;  4XDC A;  1XEE A;  1OQQ A;  4RFB A;  3ZJU A;  3AE7 B;  5GXG B;  1OFF A;  3VRB B;  1DOY A;  1ZOY B;  3P4S B;  2RDH A;  1CQV A;  3KWV A;  2TSS A;  2E6X A;  1SE3 A;  1IBX A;  2M56 B;  3WCQ A;  1FNU A;  5AUI A;  1IGC A;  1WSP A;  1QF6 A;  3EA6 A;  3MJ5 A;  2GRI A;  4OZA A;  3BZD B;  3AEE B;  2V3N A;  2WQY B;  2B76 B;  4KGT A;  4NAW B;  5LNK 1;  2LHD A;  3AH7 A;  1QIL A;  3AE1 B;  2Y5P A;  1I4X A;  2W82 A;  1KLU D;  2WU5 B;  1ZXI A;  5D7G A;  1SF0 A;  4DQO C;  1C4A A;  4HRS A;  4LLG M;  3CIR B;  1ZDX A;  4GLS C;  1ESF A;  2I2Y A;  2MEK A;  3AEB B;  1NYR A;  1ZXH A;  2MJE A;  1JW9 D;  2K0P A;  3NVY A;  1K52 A;  2JZP A;  1SJE D;  2G9H D;  2PVG C;  2BBC A;  3HRD D;  5BMG A;  4O1N A;  2L83 A;  4OVZ A;  4YTP B;  4C56 C;  2VZK B;  5EE1 A;  2ICI A;  2RDG A;  3AED B;  1VJK A;  4LK0 M;  2M0A A;  3AE5 B;  1L0Y B;  2LMC A;  2WXO A;  2KDM A;  3BK1 A;  3KWL A;  4TQ0 A;  3BK2 A;  2RPV A;  1ACC A;  1VLB A;  2WDV B;  1HXY D;  1RM6 C;  2Y5C A;  4HRO A;  2WXH A;  2ZW0 A;  2W3S A;  3BVM A;  1E0Z A;  3NVW A;  1WRI A;  1E6E B;  2IPK D;  3W5U B;  4J3O D;  4A90 A;  1QOF A;  1A70 A;  2WXF A;  3BYT B;  1I4G A;  3ZQ4 A;  1FFV A;  2H88 B;  4RF1 A;  1ENF A;  1YQ3 B;  1J7C A;  1WXQ A;  2CJO A;  1VRA B;  3AE9 B;  1C76 A;  1TY2 A;  3AEC B;  4EE2 A;  1XLO A;  2ON8 A;  1UGJ A;  3HUI A;  1FMA D;  2LEK A;  2PW9 A;  1SJH D;  4C7Z A;  1P7E A;  1L0X B;  1XLN A;  4DXG A;  2CJN A;  4P6V F;  5G5H A;  1C77 A;  1RWS A;  2R61 A;  3BVG A;  4YSX B;  1NEK B;  4WWM A;  1C78 A;  2WXN A;  3U2S C;  2K3U A;  4A55 A;  2KMM A;  4WH4 A;  1JWA D;  1E9M A;  1VZ7 A;  3SR6 A;  3R2T A;  1JWM D;  1TYG B;  3BII D;  2H89 B;  3RPF C;  4LTU A;  2AX5 A;  5BYR A;  5EE9 A;  1D5X C;  1PDX A;  4USA A;  2WDR B;  3ZJV A;  2DYM A;  1YN5 A;  4ZRP A;  3TEX A;  1YN3 A;  2WP9 B;  3H8H A;  2N9K A;  1FCC C;  2BB5 A;  1T3Q A;  4GDL B;  4WIP A;  3FIL A;  1FNV A;  1YNT E;  2QSD A;  1FIQ A;  5HFY A;  3ETR A;  1BML C;  3GS2 A;  1IUE A;  1D5M C;  2SAK A;  1TKG A;  1C79 A;  3LYY A;  3P4Q B;  3VR9 B;  1YN4 A;  3GB1 A;  4ZHP A;  1D4B A;  2IGG A;  1P7F A;  1QOA A;  3L4P A;  1CJE A;  1F2R I;  1JWS D;  1AYF A;  1I4R A;  3Q69 A;  1SEB D;  1N62 A;  2W54 A;  2EKI A;  2QJL A;  2WXL A;  4HJG E;  1C4P A;  2JU6 X;  2N7J A;  1SB3 C;  1K51 A;  1EWC A;  1ET6 A;  3PZ7 A;  1N60 A;  1I7H A;  4JX1 C;  1CK1 A;  4L23 A;  4RGN A;  1L4D B;  3E56 A;  1V1P A;  2WXM A;  2OED A;  2CU3 A;  3OWE B;  1N63 A;  1CZP A;  3SFD B;  2W3R A;  1FNW A;  3SEB A;  1L0V B;  1HEZ E;  1YQ4 B;  2ZW1 A;  5G5G A;  3P63 A;  5H8Y E;  1UWM A;  4IKG A;  5FKA C;  3BVZ A;  5C2T B;  2GB1 A;  2LHE A;  1E10 A;  1T6B X;  3R8B A;  4JWS C;  3TUO A;  1XO3 A;  1L5P A;  3Q8B A;  4GDK B;  1ZUD 2;  1XF5 L;  4YSZ B;  5EE0 A;  2BYT A;  2RMM A;  2L32 A;  2D5G A;  1XLQ A;  3LXF A;  4KKI A;  3N9Y C;  2FUG 1;  3MFG A;  1FCL A;  4ITK A;  1WWT A;  3AEF B;  1M4V A;  3Q8A A;  4OW0 A;  3P4P B;  2YEP B;  5TSS A;  2XNA C;  1QKZ A;  1ZP0 B;  1BXT A;  3J9C A;  3W9C B;  2PIA A;  3IAM 1;  2N9L A;  2WDQ B;  5E6J A;  3U52 E;  1PGA A;  3VR8 B;  1EWY C;  2J42 A;  2AQ1 B;  1C9F A;  1ZE3 D;  2AQ2 B;  2J52 A;  1FEH A;  4NZL B;  1E7P B;  1SSN A;  4RGO S;  4Q2J A;  3NVV A;  4H2A A;  3ABV B;  4C80 A;  3TEW A;  4OZC A;  1MHH E;  1N5X A;  1FXA A;  2AQ3 B;  4P16 A;  2NTT A;  1NI3 A;  2LJI A;  4CQN A;  3DWG C;  1DOI A;  2PTL A;  2KAC A;  2DBY A;  4KGR A;  1DYQ A;  3NS1 A;  4JE3 B;  4MT5 A;  1XXG A;  2BT6 A;  2QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...