2JXXA

Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFATC2-interacting protein
publication title Solution structure of Ubiquitin-like domain of NFATC2IP.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jxxA00
2KDEB 2PJHA 3ALBA 3RT3B 3W1YA 3B0AA 2D11A 2GBJA 4LJPB 3V6EB 2JWZA 5L83A 5DPWA 2M8SA 4BBNC 3VHTC 2JPHA 3A4SC 2BYVE 4TV3A 4KV2A 4X57B 2N4FA 4JIOU 2ZNVB 5C1ZA 4E71A 3NOBA 3P2BA 1WXSA 2KTRB 2LXAA 4NJ6A 3RYTA 4NAWA 1GC6A 4GMVA 3W1SC 2FCNA 2NBVB 4IUMB 3ZUNA 1V49A 4A3OA 3KUZA 2OJRA 2NPTB 3DBLI 4MGIE 1F9JA 2ZEQA 5IAAC 1V81A 5G55A 4W9KA 2LGXA 2XEWA 2GBKA 3B1LX 2KK8A 3H1UA 2I1KA 3DQVA 4FHKA 3T8MA 1E8WA 1SIFA 1LM8B 2DENB 1EUVB 1CMXB 4PS8A 1WX8A 1WXAA 4ICUA 4FLHA 2NBUA 4GDKA 2KFKA 3PS6A 5GMVA 4FULA 2DZMA 3RULA 2MRPA 2AL6A 1UGMA 2LGYA 2R2OA 4EFOA 1IPGA 3L17A 3QAQA 3SD5A 3ML9A 4PYZA 1NBFC 1E7VA 2BKRB 3VTUA 4DHZB 3IFWB 5JH5C 3APFA 1UELA 1Q1OA 4PS3A 4GIVA 1U4AA 4WAAA 4ANUA 2DYBA 1M94A 4W9EA 2MCNB 3HHMA 2G45B 1WJ6A 2ZZPB 3S2AA 3QA8A 3HK0A 1V9JA 4II2B 2V4LA 4BKSD 3DVGY 2N7EA 2PPHA 2L3ZA 1LXDA 1SE9A 4MGKE 1WX7A 2NBWB 3R7RA 4ZDVA 5DPTA 2WWZA 4MJSB 1WZ0A 2LXCA 2JRHA 4ANWA 3A9KB 1E8XA 1YJ1A 4MDKE 2LASA 1NDDA 4GN1A 4AP4C 4EZKA 2KQ7A 5LXIB 1UBQA 3X0WA 1R4MI 2REXA 1UH6A 3MTNB 4HPMB 4DDID 3OAWA 1V5TA 3U30A 4EOYA 5JHBA 3V61A 2CHZA 2N9PC 4ICVA 4NNJB 2D07B 4CO7A 1WY8A 5E6NA 2ZVNA 3QCAA 2IO0B 3MHSD 2K1FA 4WWNA 4J6IA 2FIDA 3JW0X 1GG3A 2KMAA 4OVVA 2UYZB 4DHJB 2LGDA 3ZDMC 3AULA 3QK0A 5G2NA 2FUHB 3WANA 1WMHB 1RLFA 2BWES 1C3TA 4KZCA 1OQYA 3V60A 1E5WA 1UD7A 2KJRA 3PTFC 3WAPA 4CHKA 4FADA 2HE7A 2QHOA 1H4RA 3BY4B 2GOWA 2JY6A 5BO4B 5D2MB 2O2VB 4BFRA 4TQ0A 2IO3B 4EKUA 2K6DB 2KC2A 3VDZA 3UINB 3BINA 3WALA 2J7QB 3A33B 4EEWA 3VQIA 3PZDA 4N9F4 2M0XA 1I35A 4NJ7A 3JSVB 4HWIB 3PRMB 1D3ZA 3M95A 5CHFA 4II3B 2KXJA 2J0MA 2NCNA 3I3TB 3N30A 3H9DA 4MM3A 5L95C 2BYEA 3GOEA 1J8CA 2G4SA 1RAXA 2EMTA 2MQJA 2C60A 4IWPA 5AZHA 4BKGA 4URKA 2KC1A 1NI2A 1VD2A 2CKHB 3DBHI 1WR6E 3VFKA 2O6VB 2IZVB 3C0RB 4DWFA 3X23A 4W9DA 4HXDA 4WWPA 3DDCB 2KX0A 4FHJA 2FCSA 4DXAB 1J19A 3QHTA 2DZKA 3EHVA 2MBHA 2DHZA 1S1QB 2KWUB 3PRPB 3PT2B 5C23A 1A5RA 3A9JB 2KHWB 3Q3JA 3LJ3A 3OJ3A 4IM3A 3T9LA 4KVGB 4W9GA 2JUOA 3DVNU 3UQBA 1H8CA 2JZ3B 1TZ1A 2G3QB 4M8NA 3NHEB 2KVRA 3A1QA 2KNBA 4FJVB 1WGYA 2L7RA 2LJ5A 1E8YA 2KLGA 3L08A 1QZEA 3IBEA 2C9WB 2GBMA 3R66C 4K1RB 1WGGA 4JLCA 2KDFB 2CU1A 2DZJA 4M8MA 4EZLA 4HLEA 4IM2A 2RGFA 4DHJD 5IA7A 3UF8A 2IYDB 2G4DB 1WXMA 3JVZX 2LI5A 3TCAA 4A3PA 2A4ZA 3ZNZB 5HKHA 2FCMA 2VRRB 2L8JA 2J0KA 4FBJB 3HIZA 4NQLB 5J2RA 2HD5B 3L0WB 4W9HA 2ZCCA 4BKSA 1EF5A 2ZVOA 3APCA 1KOTA 3DPDA 1C1YB 1TGZB 4GGQA 4MSQB 4W9CA 4RM8A 3VTWA 4GDLB 2RSUA 1IYFA 4MEMA 1WM3A 1P3QU 1WF9A 2DAFA 4K7SA 2YLMA 4WJPA 2R2QA 4K7WA 1TTNA 2WX0A 3H7SA 4KZ0A 1P98A 4MSMB 4ZRJA 1WFYA 2L0FA 4F1SA 1I42A 2KTRA 1P9DU 1RFAA 4HPLB 2NR2A 3ZO5B 4XC2A 1YD8U 2BPSA 1XD3B 1HE8A 2M17A 3L13A 2KQSA 2KMCA 3VTVA 2WDTB 1WI0A 4AWJA 4K7UA 3VUYA 2IY0B 5AZGA 2O6VD 3TL5A 2CS4A 2NPTA 3PREA 3V6CB 5JZEB 3WAMA 1WZ3A 5TR5A 3M3JA 2ZCBA 1Q0WB 4I6NB 3HM6X 4DHZE 4EUTA 4DDGD 2DAJA 3R7QA 1E7UA 4G0NB 5LXHA 2L76A 1L7YA 4HDOA 3N3KB 2C7HA 1ZKHA 3QC8B 5E6OA 2V1YA 2OOBB 3ZDTA 4CYEA 2N9EB 3L54A 3ZKJC 3CSFA 2DYOA 2MP2B 2D2QA 3ONSA 3ZVVA 3HM3A 3NS8A 4KIKB 2MSED 3EECA 3QARA 4WJQA 2KOXA 5CTRC 1WE6A 2L05A 3VUXA 2A5UA 5KHQA 1LQBA 3DBRI 2GMIC 4FJYA 3V62A 3NZSA 1UBIA 3H7PB 2I1JA 3AI5A 3RCZA 3TBLD 2KLCA 2IY1B 2KWCA 2RD0A 5DCNA 4BBNF 1FXTB 3JYUA 4DK5A 3DVGX 5CHWA 1Q5WB 2NVUI 2M1MA 2BF8B 4EZJA 3O65B 4LDTB 3WIMA 3UQAA 3OJ4B 2IO1B 1EO6A 4FA6A 3QIJA 1V5OA 2XK5B 4LCDE 5E6PA 4GOCA 2LRWA 4MJSA 1WM2A 3PLUA 3AU5A 3M63B 3A9KA 5J18A 2RR9A 4JQWC 2XBBC 3VH4B 1WJNA 3PHXB 1LFDA 2JT4B 2N1VA 2MBOA 1R4NI 3K9OB 2DZIA 3QQ8B 1WJUA 2NS5A 3AU4A 4IC7B 1WGDA 1WXVA 4G50A 2MBEA 2MX2A 2RPQA 2BGFA 1WYWB 4NAWB 4RM9A 2AWTA 2KN5A 3IHPC 1G6JA 2KTFA 2JVCA 1GNUA 4MELA 3QX1A 4E74A 3PRZA 3L16A 4PS7A 1WMHA 2PE6B 1WH3A 1EF1A 1MG8A 1ZW7A 3B08A 2DYMA 2D3GA 1WIAA 4HCNB 1Z5SB 4XX5A 4GB9A 2BYFA 3D32A 4LJOB 4KSKC 5D94A 1KM7A 5D7GA 2O2VA 4FJZA 3RZWC 3KYDD 1OGWA 4B9KA 1KLVA 2MBQA 2Z59B 3N32A 4WQOB 3IVFA 4W9IA 4B95A 5EDSA 1WE7A 2FAZA 3DCGA 2KX3A 3ZLZA 2GBNA 1T0YA 1WRDB 2V3SA 4HJKA 2HTHA 4BKTA 4BVUC 4NY0A 2KJHB 4GDKB 2D10A 4W9FA 2KFKB 4IWQA 4GXBA 5LLIA 3JSVA 3ZNGC 1ISNA 1GJZA 4PYUA 2W9NA 3ZNHB 2GBRA 3VVWB 3A4RA 1SGHA 3KVFB 1Z2MA 1WJ4A 3L10B 4LDTD 4FN2A 4XZ4A 3TMPB 3ZNID 1TBEA 2ZJDA 1V2YA 4ZRKA 2O6VA 2BWFA 2EKEC 2FNJB 2Z0EB 3PV1A 4ASWC 1XQQA 4P7IA 3ZTDA 1E8ZA 3ENEA 4W9LA 2MLBA 2LVQA 2KZRA 4ANXA 3CF6E 3ML8A 3NY5A 4MH0E 1J0GA 3GZNI 3WA0A 2ZPYA 3ZIMA 3A9JA 1ZGUB 2C7MB 3LDZE 5DPRA 4BOSC 2M4NA 2KKCA 2PE9A 4ZRIA 2Y5BB 1YQBA 4KDIC 3U7DA 2BKFA 2ZPNA 3EC8A 3PSEB 2FCQA 4TQ1A 5KHOA 4BOZB 2MBBB 3KYCD 1IP9A 2JF5A 1OEYJ 2DX5B 3MJWA 3DOWA 3SU8X 4AJWA 2MW5A 3VXWA 1YIWA 3DBSA 4GU2A 4I6LB 3TJPA 2CHWA 4G11A 4IWOA 1S3SG 1P1AA 3ZRFA 3KUCB 4A20A 1OTRB 2C5LC 5FR6A 2LWPA 2B3AA 2YVCA 3IG3A 4JGHB 3KH0A 4I6PA 4KSLC 2PEAA 3R3MA 3APDA 3PGEA 4IM0A 3KW5B 4MGYE 2CR5A 2KDIA 3RZFA 1GC7A 2K39A 4GDLA 4ZYNA 3UIPB 3WAOA 3PHWB 1X1MA 3UGBB 5AZFA 1PQSA 2UWQA 2K8CA 4AJYB 4HCPB 3TIXA 2L00B 2LRUA 3ECIA 4B6WA 1YX6B 1WGHA 3VAWA 3PLVA 4DBGA 1AARA 2IO2B 1V6EA 2MA9B 4MGZE 4WWOA 1XT9B 2HJ8A 1L2NA 4AOFA 3W1SA 2AYOB 5CHVC 2AL3A 1BT0A 1WX9A 2Z0DB 1VCBA 1GUAB 2CHXA 4JL9A 1YX5B 2K8BA 5J17A 4NPNA 2KDBA 4E3CA 3U8ZA 3PPAA 4WJNA 2IBIB 1K8RB 2N9XA 3ZTCA 2ASQA 1WGRA 2KD0A 4HDQA 4NQKE 4F7ZA 3PVLA 5DPSA 1E90A 3EFUA 4KDLB 3ZW3A 2C7NB 4OVUA 1OEYA 2WYQA 2ZNVC 4ANVA 2JXXA 2MP2A 2JZZA 5CX3A 1RRBA 3NZUA 2K8HA 1JRUA 3OLMD 2K6QA 2AEHA 3A1QB 4IG7B 4KIKA 2LD9A 4M0WB 3UIOB 2LVOA 3VH3B 3RUIB 3Q3FA 4RMAA 4K81A 3ZRCA 4TKNA 2L0TA 3H7PA 2N1WA 4GSWA 2JRIB 4IW0A 2KWVB 1V80A 1UZXB 2FIFA 2J0JA 3DVNV 2KJ6A 2KO3A 1WR1A 2EMSA 4G3XB 5JHAA 4AUQC 3M62B 1V86A 2LUEA 3H6NA 5D6JB 3K9PB 4TUUA 3QWZB 3SHQA 4F8CB 4YL8A 3SDLC 3RD2A 3QJZA 3VUWA 2KFJA 2XK5A 2N7DA 4WJOA 2MWSB 3AXCA 1Y8RC 3CSTA 4HVBA 1KJTA 3KUDB 2KANA 2WX1A 2K25A 5AEKB 2LZ6A 3CMMB 4W9JA 1P0RA 2LVPA 4HK2A
chains in the Genus database with same CATH superfamily
2KDEB 3RT3B 3B0AA 2GBJA 3CWIA 4BBNC 1GB4A 3VHTC 4RF1A 3SFDB 2BYVE 4YTPB 4RGTA 2N4FA 3I63C 4JIOU 3P2BA 1D5ZC 2KTRB 2DWQA 3AE9B 3EUB2 3BVGA 5I4DA 2NBVB 4IUMB 4KKJA 1Q10A 4US9A 3IT6B 1V81A 5G55A 3B1LX 3SEBA 2KK8A 2JSVX 4UDUC 3DHGC 3Q2AC 1CMXB 2JX5A 3ZQ4A 4PS8A 5C2TB 2AX5A 1WXAA 4GDKA 2NBUA 5GMVA 2QSDA 2MRPA 4EFOA 2PMVA 2PTLA 1TJEA 3L17A 5JH5C 1NBFC 5BMHA 4DHZB 3IFWB 1UELA 2M56B 2D3CA 2MCNB 4HJGE 1XF5L 3ZGZA 2PPHA 2L3ZA 1N60A 1SE9A 4MGKE 1FD6A 2OJWA 2X38A 2JRHA 1JW9D 1OFFA 2IPKD 1E8XA 1YJ1A 2D5GA 4AP4C 4EZKA 2KQ7A 2X8XX 1YNTE 1R4MI 3Q3MC 1FCLA 4N6EB 3MTNB 4DDID 3OAWA 2MH7A 1TY0A 4ICVA 4OZCA 4B0MA 2D07B 1BUIC 3QCAA 3MHSD 1UWXA 4AQ7A 3P4SB 4ARCA 4S0RA 2G9HD 3JW0X 1GG3A 4OVVA 4EE2A 3AULA 3PO0A 5BYQA 1RLFA 3AB5A 4ARIA 3WAPA 4CHKA 4FADA 4REZA 1ZP0B 2QHOA 2WXIA 1XO3A 4BFRA 1N61A 4K3CA 2IO3B 4EKUA 3VDZA 3BINA 3WALA 3A33B 4C00A 4N9F4 2XN9C 1YN3A 1I35A 3JSVB 3PRMB 3I3TB 3FILA 3AE7B 4MM3A 5L95C 2K0PA 4ZYSA 2EMTA 5AZHA 1NI2A 2CKHB 1M4VA 1V1OA 2UU7A 4HXDA 4FHJA 3NS1A 4DXAB 3EHVA 1N5WA 1PFDA 1F2RI 2KWUB 3PRPB 4ZRQA 5C23A 3AE1B 3LJ3A 2JUOA 3P4RB 1TZ1A 1JWMD 1NYRA 3A1QA 2KNBA 1WGYA 3MP9A 1ZDVA 2KLGA 3L08A 3R66C 3AN1A 3DHHC 3NG0A 1MJDA 2WXGA 2KDFB 2DZJA 5BMGA 2RGFA 5IA7A 3UF8A 3JVZX 2L8JA 2CJOA 4NQLB 2HD5B 4W9HA 2M0AA 4BKSA 1EF5A 1N62A 1ACCA 3DWGC 4RM8A 3KWLA 3RNCC 4P6VF 3FAHA 1QLBB 3CIRB 4KZ0A 1TKYA 1I42A 2L0FA 1C79A 3DBLB 2KTRA 1B1ZA 2IGGA 4LNOA 2R61A 4XGAB 1F0ZA 3L13A 3VTVA 4AWJA 2WDTB 3VUYA 5AZGA 2VH1A 3Q8EA 3PREA 1EWCA 1SB3C 4I6NB 3HM6X 1E7UA 4G0NB 5AUIA 5IO9A 5LXHA 3GE3C 2C7HA 4XE0A 2N9EB 4OHJA 3ZKJC 2BS4B 2MP2B 4R3DA 3ZVVA 1T3QA 3HM3A 3QARA 1FIQA 2KOXA 2GMIC 2B76B 3AI5A 3TBLD 2KLCA 2RD0A 2MEKA 3JYUA 4DK5A 4IKGA 1F1HA 3ABVB 5GXGB 1Q5WB 2KAJA 1L5PA 1JMLA 3Q6BA 3T3OA 1EO6A 1SIJA 1VRAB 3IXSA 4XDDA 3QIJA 2XK5B 5E6PA 4GOCA 2LRWA 1SEBD 4JQWC 2SAKA 1QOFA 2MBOA 1T0RC 1WJUA 1YOVB 4G50A 4HPPA 2BGFA 1WYWB 4RM9A 1D6EC 1DGJA 2KTFA 4MELA 3PRZA 1V8CA 1TS3A 3ZJUA 1WRIA 1WH3A 1ZW7A 2DLBA 2DNFA 4HCNB 2BYFA 4LJOB 2YEPF 5D7GA 1HXYD 3WCQA 3U2SC 4B9KA 4WQOB 3IVFA 3AE2B 1V97A 1NENB 1WE7A 2FAZA 3ZLZA 5EDSA 4HJKA 2HTHA 4W9FA 2D10A 3ZNGC 3JSVA 3N1XC 3AH7A 1C4CA 2QC8A 3ETRA 1CZPA 4DXGA 2WP9B 1XLNA 1SGHA 2MJEA 4FN2A 3TMPB 1EWYC 3V05A 2Z0EB 3PV1A 4W9LA 1LGRA 3CF6E 3NY5A 2BBCA 3GZNI 1D4BA 2J53A 2IGHA 3LDZE 5DPRA 4FXCA 2RMMA 1YJIA 2ZPNA 2FCQA 4TQ1A 4RF0A 1IP9A 3MJWA 3BIID 1ZPSA 3BK1A 1RFKA 4AS1A 1HA5A 5FR6A 2AQ3B 3IG3A 1FXIA 4KSLC 1SJHD 3KW5B 4RGMA 1T5XD 2CR5A 2KDIA 3RNEC 2BYTA 3WAOA 2GI9A 2QIEB 4OW0A 1QKZA 1N5XA 2LHEA 2L00B 2LRUA 3ECIA 4B6WA 1XCTL 3PLVA 4MGZE 2HJ8A 3Q14C 4WH4A 3W1SA 2AYOB 5CHVC 2AL3A 1BT0A 2PIAA 1WX9A 1VCBA 3Q8AA 4NPNA 2BTEA 3W9CB 5D3IB 3ZTCA 1WGRA 4NQKE 2WGSA 3PVLA 1E90A 2C7NB 2ZNVC 4OVZA 4ANVA 2MP2A 5CX3A 3IT4B 1JWAD 4XWWA 4M0WB 2K6QA 1SSNA 2I2YA 3W5VB 2L0TA 1VZ6A 2CU3A 4Q2JA 1UZXB 1WR1A 2WXMA 4G3XB 4AUQC 1YMHE 2PLPA 4HKZE 3RD2A 2XK5A 3N20C 2N7DA 4PT5A 4P16A 4HEA1 4HVBA 3KUDB 5AEKB 3CMMB 4W9JA 2PJHA 3I57A 2WQYB 2D11A 4LJPB 5L83A 4IDIA 2JPHA 4TV3A 4KV2A 1JWBD 4E71A 3NOBA 3AECB 3RYTA 1IGDA 1SE4A 1VLBA 1L4DB 1JQ4A 3KUZA 3AE4B 1K50A 2LGXA 1ET9A 4H2AA 3H1UA 3T8MA 2DENB 1EUVB 1ZOYB 1L0YB 4ICUA 5JXVA 2MHJA 1C9FA 1ESFA 4FULA 3RULA 4K3BA 4S17A 2R2OA 4RH6A 1IPGA 3OWEB 3VTUA 1HTOA 1Q1OA 1QOAA 4GIVA 1U4AA 4W9EA 1BMLC 2Y5PA 2SEBD 2ZZPB 1WJ6A 1V9JA 4BKSD 1MHXA 4HKQA 3DVGY 1LXDA 2NBWB 5DPTA 2WWZA 1ZUD2 4ANWA 2KMMA 3ZJVA 1NDDA 1GB1A 1UBQA 1V1PB 1UH6A 1SE2A 3U30A 4EOYA 1PYWD 3V61A 2CHZA 4WWNA 3U52E 2FIDA 5FKAC 3VRAB 4ZHPA 3W2DA 2KMAA 5FR3A 2UYZB 1DYQA 5G2NA 2BWES 2W55A 1OQYA 1E5WA 1UD7A 3PTFC 1P7EA 2JY6A 2O2VB 2KC2A 1AN8A 4LNKA 3NZ3A 3VQIA 2JZPA 2V3PA 4KGRA 1D3ZA 5CHFA 3RN9C 2HJ1A 1XEEA 3N30A 3H9DA 4XDCA 1F52A 3GOEA 1UUPA 1SXTA 2KC1A 2O6VB 1IUEA 2Y3AA 3BWUD 4DWFA 4WWPA 1KF6B 1ZXIA 2FCSA 2AQ1B 1J19A 3TEZA 2I38A 2WU5B 3PT2B 1H8CA 4KVGB 4W9GA 3DVNU 3UQBA 2VH2A 1KTKA 3P4PB 4M0WA 4FJVB 2INDC 2W3SA 2LJ5A 4LNIA 1I4RA 2GBMA 4J3OD 4JLCA 5D3DA 2CU1A 4EZLA 4IM2A 1WXMA 3TCAA 3TEYA 2A4ZA 1DOIA 5J2RA 3L0WB 4ACFA 1YN4A 3APCA 3DPDA 1C1YB 3E56A 4MSQB 4W9CA 4M00A 3VTWA 4GDLB 2RSUA 1IYFA 2WU2B 3MFGA 4YT0B 2MJ3A 4K7WA 1MI0A 1TTNA 3H7SA 4MSMB 1WFYA 1QOGA 1RFAA 2NR2A 4XC2A 5MPOA 1HE8A 3ZXVA 4C7ZA 3I5JC 4K7UA 4YTNB 2IY0B 4DXFA 5JZEB 3WAMA 4C4VB 5TR5A 1Q0WB 3L4PA 2NMQA 3R8BA 3R7QA 1AWDA 1ZKHA 3NVWA 2V1YA 4CYEA 3GE8C 5BYSA 3NS8A 5KHQA 2A5UA 4FJYA 4YSXB 1RWSA 2I1JA 5DCNA 1FXTB 1QILA 3DVGX 2LGSA 5H92C 2BF8B 4EZJA 1MPEA 1WSPA 3AEAB 1ET6A 2KT7A 1R4MB 2HDEA 1FCCC 2K3UA 1V5OA 1OQRA 3VH4B 3B2GA 1LFDA 1V1PA 1ENFA 4RNAA 1R4NI 2INPE 2E3TA 2DZIA 4YWGG 2J52A 3B2FA 1WGDA 4TSSA 3RFZB 2RPQA 3NVYA 2FUG1 5FK9C 2KN5A 3UI3A 2JVCA 1GNUA 3QX1A 1Y56A 1AW7A 1MG8A 3B08A 3D32A 4KSKC 2INNE 1CK1A 2O2VA 3RZWC 1QF6A 3KYDD 1OGWA 1R4NB 1I4QA 2MBQA 2Z59B 3R2TA 3N32A 3C19A 4B95A 5HHDG 3Q8FA 2V3SA 3NRZA 4ZHOA 2EKIA 2QJLA 2KJHB 5LLIA 2KFKB 4IWQA 2Y5CA 1ISNA 4PYUA 4YSYB 2MJDA 3A4RA 4KX6B 3ZNID 1V2YA 2O6VA 4ASWC 4P7IA 3ENEA 1TS2A 4C56C 4ANXA 3ML8A 2IGDA 1C4AA 3WA0A 3ZIMA 1T6BX 1ZGUB 2M4NA 1ZXHA 1D5XC 1YQBA 1FXAA 4BOZB 2DX5B 2LGIA 1ROEA 3AE3B 1YIWA 1FM0D 1FNUA 4I6LB 3AMZA 3HVZA 4IWOA 2INCC 3KUCB 2B3AA 2K22A 4JGHB 3KH0A 3URYA 1HEZE 3APDA 3RNFC 5AUKA 3RZFA 2K39A 4GDLA 1FFUA 3TUOA 2UWQA 2K8CA 5G5HA 3TIXA 3Q69A 1YX6B 4P1CC 4DBGA 1AARA 2IO2B 1V6EA 2MA9B 1ZDXA 1QQRA 3GB1A 2PKOA 1GUAB 1MFWA 1L0VB 4C4VA 4E3CA 4D2KA 1DOYA 2IBIB 1DOXA 2N9XA 4HDQA 2ONQA 2FBWB 3DWMA 3ZW3A 2HTME 2BB6A 3NJTA 1MVKA 2JXXA 3NZUA 2K8HA 1JRUA 4IG7B 3VH3B 2J42A 2LVOA 4RMAA 2N1WA 2JRIB 1FRRA 2J0JA 2KO3A 3BK2A 2E6XA 2KN4A 3H6NA 5D6JB 4TUUA 3SHQA 3SDLC 1F2RC 4USAA 3CSTA 1XLOA 1NVID 1GAQB 3ZXRA 1KJTA 2LZ6A 2NTTA 2K5PA 3W1YA 1FPYA 4NJCA 5DPWA 2M8SA 2BS2B 1FFVA 3A4SC 4X57B 5EE0A 2ZNVB 2JU6X 2KYWA 2LXAA 1PDXA 4NJ6A 1JRPA 1GC6A 4RFBA 3W1SC 3TSSA 1V49A 1R7SA 2JQRB 2V4IB 2OJRA 2VZKD 2XEWA 2GBKA 5HG2A 2LFIA 4FHKA 1K53A 1JALA 2L83A 1WX8A 4FLHA 2KFKA 1D5MC 3TEWA 4JWUC 1C77A 2AL6A 1P7FA 2NTSA 2BKRB 3GZNB 3APFA 1HZ6A 4PS3A 4WAAA 4ANUA 2N9LA 3HHMA 2Q5WD 3LB8C 2G45B 3S2AA 3HK0A 2V4LA 2N7EA 2WDVB 3SR6A 3R7RA 4ZDVA 4MJSB 4M02A 1WZ0A 2LXCA 3A9KB 4MDKE 2LASA 4GN1A 5LXIB 3X0WA 2QCZA 4HRSA 2REXA 4HPMB 1V5TA 4RCOA 5JHBA 2N9PC 2ZW0A 4CO7A 5EE3A 1WY8A 5E6NA 2IO0B 1RYJA 4J6IA 2WXNA 2BB5A 2VZKB 4DHJB 1KRHA 2LGDA 3WANA 1WMHB 4KZCA 3AEEB 4C7YA 2YEPB 1C76A 2HE7A 1H4RA 4RGNA 3HVDA 2GOWA 4DQOC 3RMKC 4TQ0A 2K6DB 4BZAA 4EEWA 3PZDA 4KGSA 4NJ7A 3M95A 4II3B 2TSSA 4A90A 1J8CA 1RAXA 5IP4D 3J9CA 3V3XA 2C60A 4BKGA 1GPXA 3DBHI 1WR6E 4RGOS 3AV8A 3VFKA 2FE8A 4A55A 3KWVA 3X23A 3DDCB 2KX0A 1L0XB 3QHTA 2DZKA 2MBHA 1S1QB 2JXTA 1A5RA 3NVZA 3A9JB 1HZ5A 3OJ3A 3T9LA 4OZAA 2G3QB 2N9KA 4M8NA 2KVRA 1PGBA 1SBBB 2L7RA 1LO5D 2KQ4X 1E8YA 2C9WB 2PVGC 5TSSA 2XNAC 3DBHB 4K1RB 3TEXA 4HLEA 1KH0A 5EE9A 2IYDB 2G4DB 1TKEA 2LI5A 3ZNZB 2FCMA 2VRRB 1NEKB 2ZVOA 1KOTA 1UF0A 4MEMA 1WM3A 1P3QU 1WF9A 2GLSA 3AE5B 2KVZA 4K7SA 2W82A 4WJPA 3VR8B 4ZRJA 4F1SA 2WXHA 1P9DU 2WXLA 4HPLB 3ZO5B 1XD3B 3W5UB 3IAM1 1MHHE 1WI0A 3FC4A 2WLBA 2O6VD 3TL5A 2CS4A 1WZ3A 4EUTA 3N9YC 1L7YA 4HDOA 1JCKB 3GS2A 2OOBB 1KLUD 2WNMA 2DYOA 3KLSX 3BZDB 4MT5A 2D2QA 3AEGB 3ONSA 4KIKB 1WXQA 2MSED 3T3NA 4WJQA 3VUXA 1WE6A 4LTUA 4WQMA 2L52A 3V62A 3NZSA 1UBIA 3RCZA 3OG5A 2D3AA 3RNGC 3NUHB 2V9HA 3O65B 4LDTB 3WIMA 1XCQL 3OJ4B 4FA6A 5BYRA 3RNBC 2BW2A 1EM7A 4MJSA 1WM2A 3AU5A 3A9KA 4A8XC 5J18A 3AEFB 2XBBC 3PHXB 2N1VA 2JT4B 3N1YC 2NS5A 3AU4A 4B0EA 1WXVA 1L4ZB 2MBEA 2ON8A 2MX2A 4NAWB 3HRDD 2RDHA 3IHPC 1G6JA 4E74A 4PS7A 1WMHA 2PE6B 1EF1A 1YQ4B 1FMAD 1WIAA 3P42A 4GB9A 4OZBA 2OHFA 1TKGA 1KM7A 4A6QA 1SE3A 4O1NA 1I4XA 3EGRA 4W9IA 1TS4A 3DCGA 2GBNA 1T0YA 4BKTA 3ZJTA 4US8A 2AQ2B 4NY0A 1IGCA 5LNK1 4GXBA 3MHZA 1PUTA 3BYYB 2GBRA 3VVWB 3P63A 1HTQA 2LUMA 1CQVA 1YN5A 3VRBB 1TBEA 2ZJDA 2BWFA 3ZTDA 5G5GA 2LVQA 2KZRA 4ZRPA 1J0GA 3A9JA 5H8YE 2RPVA 2QDFA 3VR9B 4ZRIA 2Y5BB 3U7DA 2BKFA 3EC8A 3PSEB 2MBBB 2JF5A 2QEJC 3SU8X 3DOWA 4AJWA 2MW5A 4GU2A 3TJPA 3FKYA 4G11A 4N59A 1TIFA 1A70A 1VZ7A 4A20A 2C5LC 2LWPA 1XLPA 4I6PA 1FO4A 2PEAA 3R3MA 2G1EA 4IM0A 4MGYE 1E7PB 1GC7A 4ZYNA 3PHWB 1FRDA 3UGBB 5AZFA 1K51A 1E0ZA 1L6VA 4BAXA 3AE6B 1VZ8A 4MACA 1IBXB 2WDRB 2Z0DB 1QOBA 3NVVA 2CHXA 4A9AA 4JL9A 5J17A 1E10A 2KDBA 4WIPA 2WS3B 1YQ3B 3PPAA 3U8ZA 4JWSC 3RPFC 3IAS1 4WJNA 3AM9A 1K8RB 4F7ZA 2ASQA 2WDQB 4TMAB 1TY2A 5DPSA 3R2IA 3EFUA 4KDLB 1N6ZA 1UWMA 3OLMD 4KIKA 2AEHA 3UIOB 4C80A 1KLGD 3RUIB 4K81A 3ZRCA 1SF0A 4GSWA 2KWVB 1TZOA 2FIFA 3DVNV 1CJEA 2EMSA 3N1ZC 5JHAA 4CQNA 2KDMA 3M62B 2H89B 1V86A 1WYGA 3K9PB 4KKIA 3QWZB 4F8CB 2L32A 2WXOA 1VDVA 3VUWA 4YXDB 2MWSB 3AXCA 1Y8RC 2WXPA 3GP7A 2KANA 3MC9A 1P0RA 4HK2A 2H88B 3ALBA 3V6EB 2JWZA 5IN7A 1N63A 1FNVA 4N58A 4YSZB 1SJED 5C1ZA 1WXSA 4NAWA 4GMVA 1JWUD 2FCNA 3ZUNA 2GRIA 4A3OA 3SFEB 2ZW1A 4WURA 2NPTB 3DBLI 4MGIE 1F9JA 4L1BA 1EU3A 2ZEQA 5IAAC 4W9KA 2I1KA 3DQVA 2EELA 1E8WA 1SIFA 1LM8B 1MG4A 2QILA 3PS6A 1J7AA 2DZMA 1UGMA 1TT5B 2LGYA 3QAQA 3SD5A 3ML9A 3HUIA 4PYZA 1E7VA 1E6EB 3MJ5A 3EA6A 2DYBA 1M94A 3QA8A 4II2B 1WX7A 2WXJA 1C4PA 1B9RA 3MC0B 1XXGA 4NNJB 5HFYA 2ZVNA 2K1FA 3LXFA 3RNAC 1FEHA 2KACA 1FNWA 3ZDMC 3QK0A 2FUHB 1C3TA 3V60A 3BVZA 2KJRA 4ITKA 3BY4B 5BO4B 5D2MB 5BMIA 1VR9A 3UINB 2J7QB 1NYQA 1PGXA 2WHIA 2M0XA 4HWIB 2WXFA 1TS5A 2KXJA 2J0MA 2NCNA 4LNNA 4L2YA 2BYEA 4PK1A 2G4SA 4WAFA 1IBXA 2KWDA 2MQJA 4IWPA 4URKA 1VD2A 3U4EG 2QMTA 2IZVB 3C0RB 5IKCM 4W9DA 2JYTA 2OEDA 2DHZA 3I9V1 2KHWB 3Q3JA 3DHIC 4IM3A 2V3NA 3P4QB 2JZ3B 3NHEB 2RDGA 3H8HA 1QZEA 3IBEA 1WGGA 4M8MA 1L6UA 3EFCA 4DHJD 2ICIA 4A3PA 5HKHA 4FBJB 1C78A 2J0KA 3HIZA 2W3RA 1KFYB 4NZLB 2WXQA 1UGJA 2ZCCA 4HROA 3U7ZA 2JWUA 4GGQA 1TGZB 2DAFA 2YLMA 2R2QA 2WX0A 2JYEA 1P98A 2BQQA 1HQRD 1JROA 1YD8U 2BPSA 2M17A 2KQSA 2KMCA 2GB1A 3ZYYX 2BT6A 2N0SB 2NPTA 5IOIA 3V6CB 3M3JA 4LK0M 2ZCBA 1VJKA 4DHZE 4DDGD 2DAJA 2L76A 3N3KB 3QC8B 3B9JA 5E6OA 2DBYA 1J7CA 3ZDTA 3L54A 5T8IA 3CSFA 1XLQA 3AEBB 3EECA 2CJNA 5CTRC 2L05A 1E9MA 1LQBA 3DBRI 2PVOD 3H7PB 2IY1B 2KWCA 4BBNF 5CHWA 2NVUI 2M1MA 2W54A 2PW9A 3UQAA 2IO1B 1QT9A 2RDBC 3Q3NC 4LCDE 1EU4A 3PLUA 4GLSC 3M63B 2RR9A 1RM6C 1WJNA 4XWTA 3DBRB 1AYFA 3K9OB 4M01A 3QQ8B 1F77A 4IC7B 1I4GA 3Q8CA 3E9SA 3BYTB 4ZOHC 3AE8B 1ZE3D 1I4PA 2AWTA 5C3JB 3L16A 4JX1C 2DYMA 2D3GA 1STEA 1Z5SB 4XX5A 2WXKA 4JPSA 5D94A 4FJZA 1KLVA 5EE1A 1WWTA 2KX3A 4BVUC 1WRDB 4GDKB 4KGTA 1GJZA 2W9NA 3ZNHB 3KVFB 1Z2MA 1WJ4A 3L10B 4LDTD 4XZ4A 4ZRKA 2EKEC 3BVMA 2FNJB 1I4HA 1XQQA 2V0GA 1E8ZA 2LEKA 2MLBA 2LHDA 2IDYA 4MH0E 2ZPYA 2LJIA 2C7MB 2N7JA 4BOSC 2M19A 3KQ4A 2KKCA 2PE9A 4IOIE 4KDIC 3MC8A 5E6JA 5KHOA 3KYCD 1OEYJ 4MH8A 3VXWA 1OQQA 1UNSA 3DBSA 2CHWA 2LMCA 1S3SG 1P1AA 3ZRFA 3Q3OC 1OTRB 2YVCA 3C8YA 2L1AA 3PZ8A 5HI1A 3Q8BA 3PGEA 3P1MA 3UIPB 1X1MA 4L23A 1PQSA 4LNFA 4AJYB 4HCPB 1GOZA 1WGHA 3VAWA 4WWOA 1J7BA 1XT9B 4NAMA 1L2NA 3FILB 4AOFA 4MM3B 4WWMA 2BVCA 4P1BC 4YTMB 4JE3B 1YX5B 2K8BA 2Z8LA 3PZ7A 2WXRA 1T0SC 2KD0A 4LLGM 4OVUA 1OEYA 2WYQA 2ACZB 2JZZA 1TYGB 1RRBA 2K9XA 3O13A 1K52A 3A1QB 2LD9A 3LYYA 4QAYA 1JWSD 3Q3FA 4TKNA 1YJJA 3H7PA 3AEDB 1I7HA 4IW0A 1V80A 1PGAA 1NI3A 1BXTA 2KJ6A 3RI7C 2BS3B 2D3BA 2LUEA 4YL8A 1T0QC 3QJZA 2KFJA 4WJOA 1WGKA 2J4XA 2WX1A 2K25A 4XYCA 2IJ0A 2LVPA
chains in the Genus database with same CATH topology
2KDEB 2PJHA 3ALBA 3RT3B 3W1YA 3B0AA 2D11A 2GBJA 4LJPB 3V6EB 2JWZA 5L83A 5DPWA 2M8SA 4BBNC 3VHTC 2JPHA 3A4SC 2BYVE 4TV3A 4KV2A 4X57B 2N4FA 4JIOU 2ZNVB 5C1ZA 4E71A 3NOBA 3P2BA 1WXSA 2KTRB 2LXAA 4NJ6A 3RYTA 4NAWA 1GC6A 4GMVA 3W1SC 2FCNA 2NBVB 4IUMB 3ZUNA 1V49A 4A3OA 3KUZA 2OJRA 2NPTB 3DBLI 4MGIE 1F9JA 2ZEQA 5IAAC 1V81A 5G55A 4W9KA 2LGXA 2XEWA 2GBKA 3B1LX 2KK8A 3H1UA 2I1KA 3DQVA 4FHKA 3T8MA 1E8WA 1SIFA 1LM8B 2DENB 1EUVB 1CMXB 4PS8A 1WX8A 1WXAA 4ICUA 4FLHA 2NBUA 4GDKA 2KFKA 3PS6A 5GMVA 4FULA 2DZMA 3RULA 2MRPA 2AL6A 1UGMA 2LGYA 2R2OA 4EFOA 1IPGA 3L17A 3QAQA 3SD5A 3ML9A 4PYZA 1NBFC 1E7VA 2BKRB 3VTUA 4DHZB 3IFWB 5JH5C 3APFA 1UELA 1Q1OA 4PS3A 4GIVA 1U4AA 4WAAA 4ANUA 2DYBA 1M94A 4W9EA 2MCNB 3HHMA 2G45B 1WJ6A 2ZZPB 3S2AA 3QA8A 3HK0A 1V9JA 4II2B 2V4LA 4BKSD 3DVGY 2N7EA 2PPHA 2L3ZA 1LXDA 1SE9A 4MGKE 1WX7A 2NBWB 3R7RA 4ZDVA 5DPTA 2WWZA 4MJSB 1WZ0A 2LXCA 2JRHA 4ANWA 3A9KB 1E8XA 1YJ1A 4MDKE 2LASA 1NDDA 4GN1A 4AP4C 4EZKA 2KQ7A 5LXIB 1UBQA 3X0WA 1R4MI 2REXA 1UH6A 3MTNB 4HPMB 4DDID 3OAWA 1V5TA 3U30A 4EOYA 5JHBA 3V61A 2CHZA 2N9PC 4ICVA 4NNJB 2D07B 4CO7A 1WY8A 5E6NA 2ZVNA 3QCAA 2IO0B 3MHSD 2K1FA 4WWNA 4J6IA 2FIDA 3JW0X 1GG3A 2KMAA 4OVVA 2UYZB 4DHJB 2LGDA 3ZDMC 3AULA 3QK0A 5G2NA 2FUHB 3WANA 1WMHB 1RLFA 2BWES 1C3TA 4KZCA 1OQYA 3V60A 1E5WA 1UD7A 2KJRA 3PTFC 3WAPA 4CHKA 4FADA 2HE7A 2QHOA 1H4RA 3BY4B 2GOWA 2JY6A 5BO4B 5D2MB 2O2VB 4BFRA 4TQ0A 2IO3B 4EKUA 2K6DB 2KC2A 3VDZA 3UINB 3BINA 3WALA 2J7QB 3A33B 4EEWA 3VQIA 3PZDA 4N9F4 2M0XA 1I35A 4NJ7A 3JSVB 4HWIB 3PRMB 1D3ZA 3M95A 5CHFA 4II3B 2KXJA 2J0MA 2NCNA 3I3TB 3N30A 3H9DA 4MM3A 5L95C 2BYEA 3GOEA 1J8CA 2G4SA 1RAXA 2EMTA 2MQJA 2C60A 4IWPA 5AZHA 4BKGA 4URKA 2KC1A 1NI2A 1VD2A 2CKHB 3DBHI 1WR6E 3VFKA 2O6VB 2IZVB 3C0RB 4DWFA 3X23A 4W9DA 4HXDA 4WWPA 3DDCB 2KX0A 4FHJA 2FCSA 4DXAB 1J19A 3QHTA 2DZKA 3EHVA 2MBHA 2DHZA 1S1QB 2KWUB 3PRPB 3PT2B 5C23A 1A5RA 3A9JB 2KHWB 3Q3JA 3LJ3A 3OJ3A 4IM3A 3T9LA 4KVGB 4W9GA 2JUOA 3DVNU 3UQBA 1H8CA 2JZ3B 1TZ1A 2G3QB 4M8NA 3NHEB 2KVRA 3A1QA 2KNBA 4FJVB 1WGYA 2L7RA 2LJ5A 1E8YA 2KLGA 3L08A 1QZEA 3IBEA 2C9WB 2GBMA 3R66C 4K1RB 1WGGA 4JLCA 2KDFB 2CU1A 2DZJA 4M8MA 4EZLA 4HLEA 4IM2A 2RGFA 4DHJD 5IA7A 3UF8A 2IYDB 2G4DB 1WXMA 3JVZX 2LI5A 3TCAA 4A3PA 2A4ZA 3ZNZB 5HKHA 2FCMA 2VRRB 2L8JA 2J0KA 4FBJB 3HIZA 4NQLB 5J2RA 2HD5B 3L0WB 4W9HA 2ZCCA 4BKSA 1EF5A 2ZVOA 3APCA 1KOTA 3DPDA 1C1YB 1TGZB 4GGQA 4MSQB 4W9CA 4RM8A 3VTWA 4GDLB 2RSUA 1IYFA 4MEMA 1WM3A 1P3QU 1WF9A 2DAFA 4K7SA 2YLMA 4WJPA 2R2QA 4K7WA 1TTNA 2WX0A 3H7SA 4KZ0A 1P98A 4MSMB 4ZRJA 1WFYA 2L0FA 4F1SA 1I42A 2KTRA 1P9DU 1RFAA 4HPLB 2NR2A 3ZO5B 4XC2A 1YD8U 2BPSA 1XD3B 1HE8A 2M17A 3L13A 2KQSA 2KMCA 3VTVA 2WDTB 1WI0A 4AWJA 4K7UA 3VUYA 2IY0B 5AZGA 2O6VD 3TL5A 2CS4A 2NPTA 3PREA 3V6CB 5JZEB 3WAMA 1WZ3A 5TR5A 3M3JA 2ZCBA 1Q0WB 4I6NB 3HM6X 4DHZE 4EUTA 4DDGD 2DAJA 3R7QA 1E7UA 4G0NB 5LXHA 2L76A 1L7YA 4HDOA 3N3KB 2C7HA 1ZKHA 3QC8B 5E6OA 2V1YA 2OOBB 3ZDTA 4CYEA 2N9EB 3L54A 3ZKJC 3CSFA 2DYOA 2MP2B 2D2QA 3ONSA 3ZVVA 3HM3A 3NS8A 4KIKB 2MSED 3EECA 3QARA 4WJQA 2KOXA 5CTRC 1WE6A 2L05A 3VUXA 2A5UA 5KHQA 1LQBA 3DBRI 2GMIC 4FJYA 3V62A 3NZSA 1UBIA 3H7PB 2I1JA 3AI5A 3RCZA 3TBLD 2KLCA 2IY1B 2KWCA 2RD0A 5DCNA 4BBNF 1FXTB 3JYUA 4DK5A 3DVGX 5CHWA 1Q5WB 2NVUI 2M1MA 2BF8B 4EZJA 3O65B 4LDTB 3WIMA 3UQAA 3OJ4B 2IO1B 1EO6A 4FA6A 3QIJA 1V5OA 2XK5B 4LCDE 5E6PA 4GOCA 2LRWA 4MJSA 1WM2A 3PLUA 3AU5A 3M63B 3A9KA 5J18A 2RR9A 4JQWC 2XBBC 3VH4B 1WJNA 3PHXB 1LFDA 2JT4B 2N1VA 2MBOA 1R4NI 3K9OB 2DZIA 3QQ8B 1WJUA 2NS5A 3AU4A 4IC7B 1WGDA 1WXVA 4G50A 2MBEA 2MX2A 2RPQA 2BGFA 1WYWB 4NAWB 4RM9A 2AWTA 2KN5A 3IHPC 1G6JA 2KTFA 2JVCA 1GNUA 4MELA 3QX1A 4E74A 3PRZA 3L16A 4PS7A 1WMHA 2PE6B 1WH3A 1EF1A 1MG8A 1ZW7A 3B08A 2DYMA 2D3GA 1WIAA 4HCNB 1Z5SB 4XX5A 4GB9A 2BYFA 3D32A 4LJOB 4KSKC 5D94A 1KM7A 5D7GA 2O2VA 4FJZA 3RZWC 3KYDD 1OGWA 4B9KA 1KLVA 2MBQA 2Z59B 3N32A 4WQOB 3IVFA 4W9IA 4B95A 5EDSA 1WE7A 2FAZA 3DCGA 2KX3A 3ZLZA 2GBNA 1T0YA 1WRDB 2V3SA 4HJKA 2HTHA 4BKTA 4BVUC 4NY0A 2KJHB 4GDKB 2D10A 4W9FA 2KFKB 4IWQA 4GXBA 5LLIA 3JSVA 3ZNGC 1ISNA 1GJZA 4PYUA 2W9NA 3ZNHB 2GBRA 3VVWB 3A4RA 1SGHA 3KVFB 1Z2MA 1WJ4A 3L10B 4LDTD 4FN2A 4XZ4A 3TMPB 3ZNID 1TBEA 2ZJDA 1V2YA 4ZRKA 2O6VA 2BWFA 2EKEC 2FNJB 2Z0EB 3PV1A 4ASWC 1XQQA 4P7IA 3ZTDA 1E8ZA 3ENEA 4W9LA 2MLBA 2LVQA 2KZRA 4ANXA 3CF6E 3ML8A 3NY5A 4MH0E 1J0GA 3GZNI 3WA0A 2ZPYA 3ZIMA 3A9JA 1ZGUB 2C7MB 3LDZE 5DPRA 4BOSC 2M4NA 2KKCA 2PE9A 4ZRIA 2Y5BB 1YQBA 4KDIC 3U7DA 2BKFA 2ZPNA 3EC8A 3PSEB 2FCQA 4TQ1A 5KHOA 4BOZB 2MBBB 3KYCD 1IP9A 2JF5A 1OEYJ 2DX5B 3MJWA 3DOWA 3SU8X 4AJWA 2MW5A 3VXWA 1YIWA 3DBSA 4GU2A 4I6LB 3TJPA 2CHWA 4G11A 4IWOA 1S3SG 1P1AA 3ZRFA 3KUCB 4A20A 1OTRB 2C5LC 5FR6A 2LWPA 2B3AA 2YVCA 3IG3A 4JGHB 3KH0A 4I6PA 4KSLC 2PEAA 3R3MA 3APDA 3PGEA 4IM0A 3KW5B 4MGYE 2CR5A 2KDIA 3RZFA 1GC7A 2K39A 4GDLA 4ZYNA 3UIPB 3WAOA 3PHWB 1X1MA 3UGBB 5AZFA 1PQSA 2UWQA 2K8CA 4AJYB 4HCPB 3TIXA 2L00B 2LRUA 3ECIA 4B6WA 1YX6B 1WGHA 3VAWA 3PLVA 4DBGA 1AARA 2IO2B 1V6EA 2MA9B 4MGZE 4WWOA 1XT9B 2HJ8A 1L2NA 4AOFA 3W1SA 2AYOB 5CHVC 2AL3A 1BT0A 1WX9A 2Z0DB 1VCBA 1GUAB 2CHXA 4JL9A 1YX5B 2K8BA 5J17A 4NPNA 2KDBA 4E3CA 3U8ZA 3PPAA 4WJNA 2IBIB 1K8RB 2N9XA 3ZTCA 2ASQA 1WGRA 2KD0A 4HDQA 4NQKE 4F7ZA 3PVLA 5DPSA 1E90A 3EFUA 4KDLB 3ZW3A 2C7NB 4OVUA 1OEYA 2WYQA 2ZNVC 4ANVA 2JXXA 2MP2A 2JZZA 5CX3A 1RRBA 3NZUA 2K8HA 1JRUA 3OLMD 2K6QA 2AEHA 3A1QB 4IG7B 4KIKA 2LD9A 4M0WB 3UIOB 2LVOA 3VH3B 3RUIB 3Q3FA 4RMAA 4K81A 3ZRCA 4TKNA 2L0TA 3H7PA 2N1WA 4GSWA 2JRIB 4IW0A 2KWVB 1V80A 1UZXB 2FIFA 2J0JA 3DVNV 2KJ6A 2KO3A 1WR1A 2EMSA 4G3XB 5JHAA 4AUQC 3M62B 1V86A 2LUEA 3H6NA 5D6JB 3K9PB 4TUUA 3QWZB 3SHQA 4F8CB 4YL8A 3SDLC 3RD2A 3QJZA 3VUWA 2KFJA 2XK5A 2N7DA 4WJOA 2MWSB 3AXCA 1Y8RC 3CSTA 4HVBA 1KJTA 3KUDB 2KANA 2WX1A 2K25A 5AEKB 2LZ6A 3CMMB 4W9JA 1P0RA 2LVPA 4HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDE B;  2PJH A;  3ALB A;  3RT3 B;  3W1Y A;  3B0A A;  2D11 A;  2GBJ A;  4LJP B;  3V6E B;  2JWZ A;  5L83 A;  5DPW A;  2M8S A;  4BBN C;  3VHT C;  2JPH A;  3A4S C;  2BYV E;  4TV3 A;  4KV2 A;  4X57 B;  2N4F A;  4JIO U;  2ZNV B;  5C1Z A;  4E71 A;  3NOB A;  3P2B A;  1WXS A;  2KTR B;  2LXA A;  4NJ6 A;  3RYT A;  4NAW A;  1GC6 A;  4GMV A;  3W1S C;  2FCN A;  2NBV B;  4IUM B;  3ZUN A;  1V49 A;  4A3O A;  3KUZ A;  2OJR A;  2NPT B;  3DBL I;  4MGI E;  1F9J A;  2ZEQ A;  5IAA C;  1V81 A;  5G55 A;  4W9K A;  2LGX A;  2XEW A;  2GBK A;  3B1L X;  2KK8 A;  3H1U A;  2I1K A;  3DQV A;  4FHK A;  3T8M A;  1E8W A;  1SIF A;  1LM8 B;  2DEN B;  1EUV B;  1CMX B;  4PS8 A;  1WX8 A;  1WXA A;  4ICU A;  4FLH A;  2NBU A;  4GDK A;  2KFK A;  3PS6 A;  5GMV A;  4FUL A;  2DZM A;  3RUL A;  2MRP A;  2AL6 A;  1UGM A;  2LGY A;  2R2O A;  4EFO A;  1IPG A;  3L17 A;  3QAQ A;  3SD5 A;  3ML9 A;  4PYZ A;  1NBF C;  1E7V A;  2BKR B;  3VTU A;  4DHZ B;  3IFW B;  5JH5 C;  3APF A;  1UEL A;  1Q1O A;  4PS3 A;  4GIV A;  1U4A A;  4WAA A;  4ANU A;  2DYB A;  1M94 A;  4W9E A;  2MCN B;  3HHM A;  2G45 B;  1WJ6 A;  2ZZP B;  3S2A A;  3QA8 A;  3HK0 A;  1V9J A;  4II2 B;  2V4L A;  4BKS D;  3DVG Y;  2N7E A;  2PPH A;  2L3Z A;  1LXD A;  1SE9 A;  4MGK E;  1WX7 A;  2NBW B;  3R7R A;  4ZDV A;  5DPT A;  2WWZ A;  4MJS B;  1WZ0 A;  2LXC A;  2JRH A;  4ANW A;  3A9K B;  1E8X A;  1YJ1 A;  4MDK E;  2LAS A;  1NDD A;  4GN1 A;  4AP4 C;  4EZK A;  2KQ7 A;  5LXI B;  1UBQ A;  3X0W A;  1R4M I;  2REX A;  1UH6 A;  3MTN B;  4HPM B;  4DDI D;  3OAW A;  1V5T A;  3U30 A;  4EOY A;  5JHB A;  3V61 A;  2CHZ A;  2N9P C;  4ICV A;  4NNJ B;  2D07 B;  4CO7 A;  1WY8 A;  5E6N A;  2ZVN A;  3QCA A;  2IO0 B;  3MHS D;  2K1F A;  4WWN A;  4J6I A;  2FID A;  3JW0 X;  1GG3 A;  2KMA A;  4OVV A;  2UYZ B;  4DHJ B;  2LGD A;  3ZDM C;  3AUL A;  3QK0 A;  5G2N A;  2FUH B;  3WAN A;  1WMH B;  1RLF A;  2BWE S;  1C3T A;  4KZC A;  1OQY A;  3V60 A;  1E5W A;  1UD7 A;  2KJR A;  3PTF C;  3WAP A;  4CHK A;  4FAD A;  2HE7 A;  2QHO A;  1H4R A;  3BY4 B;  2GOW A;  2JY6 A;  5BO4 B;  5D2M B;  2O2V B;  4BFR A;  4TQ0 A;  2IO3 B;  4EKU A;  2K6D B;  2KC2 A;  3VDZ A;  3UIN B;  3BIN A;  3WAL A;  2J7Q B;  3A33 B;  4EEW A;  3VQI A;  3PZD A;  4N9F 4;  2M0X A;  1I35 A;  4NJ7 A;  3JSV B;  4HWI B;  3PRM B;  1D3Z A;  3M95 A;  5CHF A;  4II3 B;  2KXJ A;  2J0M A;  2NCN A;  3I3T B;  3N30 A;  3H9D A;  4MM3 A;  5L95 C;  2BYE A;  3GOE A;  1J8C A;  2G4S A;  1RAX A;  2EMT A;  2MQJ A;  2C60 A;  4IWP A;  5AZH A;  4BKG A;  4URK A;  2KC1 A;  1NI2 A;  1VD2 A;  2CKH B;  3DBH I;  1WR6 E;  3VFK A;  2O6V B;  2IZV B;  3C0R B;  4DWF A;  3X23 A;  4W9D A;  4HXD A;  4WWP A;  3DDC B;  2KX0 A;  4FHJ A;  2FCS A;  4DXA B;  1J19 A;  3QHT A;  2DZK A;  3EHV A;  2MBH A;  2DHZ A;  1S1Q B;  2KWU B;  3PRP B;  3PT2 B;  5C23 A;  1A5R A;  3A9J B;  2KHW B;  3Q3J A;  3LJ3 A;  3OJ3 A;  4IM3 A;  3T9L A;  4KVG B;  4W9G A;  2JUO A;  3DVN U;  3UQB A;  1H8C A;  2JZ3 B;  1TZ1 A;  2G3Q B;  4M8N A;  3NHE B;  2KVR A;  3A1Q A;  2KNB A;  4FJV B;  1WGY A;  2L7R A;  2LJ5 A;  1E8Y A;  2KLG A;  3L08 A;  1QZE A;  3IBE A;  2C9W B;  2GBM A;  3R66 C;  4K1R B;  1WGG A;  4JLC A;  2KDF B;  2CU1 A;  2DZJ A;  4M8M A;  4EZL A;  4HLE A;  4IM2 A;  2RGF A;  4DHJ D;  5IA7 A;  3UF8 A;  2IYD B;  2G4D B;  1WXM A;  3JVZ X;  2LI5 A;  3TCA A;  4A3P A;  2A4Z A;  3ZNZ B;  5HKH A;  2FCM A;  2VRR B;  2L8J A;  2J0K A;  4FBJ B;  3HIZ A;  4NQL B;  5J2R A;  2HD5 B;  3L0W B;  4W9H A;  2ZCC A;  4BKS A;  1EF5 A;  2ZVO A;  3APC A;  1KOT A;  3DPD A;  1C1Y B;  1TGZ B;  4GGQ A;  4MSQ B;  4W9C A;  4RM8 A;  3VTW A;  4GDL B;  2RSU A;  1IYF A;  4MEM A;  1WM3 A;  1P3Q U;  1WF9 A;  2DAF A;  4K7S A;  2YLM A;  4WJP A;  2R2Q A;  4K7W A;  1TTN A;  2WX0 A;  3H7S A;  4KZ0 A;  1P98 A;  4MSM B;  4ZRJ A;  1WFY A;  2L0F A;  4F1S A;  1I42 A;  2KTR A;  1P9D U;  1RFA A;  4HPL B;  2NR2 A;  3ZO5 B;  4XC2 A;  1YD8 U;  2BPS A;  1XD3 B;  1HE8 A;  2M17 A;  3L13 A;  2KQS A;  2KMC A;  3VTV A;  2WDT B;  1WI0 A;  4AWJ A;  4K7U A;  3VUY A;  2IY0 B;  5AZG A;  2O6V D;  3TL5 A;  2CS4 A;  2NPT A;  3PRE A;  3V6C B;  5JZE B;  3WAM A;  1WZ3 A;  5TR5 A;  3M3J A;  2ZCB A;  1Q0W B;  4I6N B;  3HM6 X;  4DHZ E;  4EUT A;  4DDG D;  2DAJ A;  3R7Q A;  1E7U A;  4G0N B;  5LXH A;  2L76 A;  1L7Y A;  4HDO A;  3N3K B;  2C7H A;  1ZKH A;  3QC8 B;  5E6O A;  2V1Y A;  2OOB B;  3ZDT A;  4CYE A;  2N9E B;  3L54 A;  3ZKJ C;  3CSF A;  2DYO A;  2MP2 B;  2D2Q A;  3ONS A;  3ZVV A;  3HM3 A;  3NS8 A;  4KIK B;  2MSE D;  3EEC A;  3QAR A;  4WJQ A;  2KOX A;  5CTR C;  1WE6 A;  2L05 A;  3VUX A;  2A5U A;  5KHQ A;  1LQB A;  3DBR I;  2GMI C;  4FJY A;  3V62 A;  3NZS A;  1UBI A;  3H7P B;  2I1J A;  3AI5 A;  3RCZ A;  3TBL D;  2KLC A;  2IY1 B;  2KWC A;  2RD0 A;  5DCN A;  4BBN F;  1FXT B;  3JYU A;  4DK5 A;  3DVG X;  5CHW A;  1Q5W B;  2NVU I;  2M1M A;  2BF8 B;  4EZJ A;  3O65 B;  4LDT B;  3WIM A;  3UQA A;  3OJ4 B;  2IO1 B;  1EO6 A;  4FA6 A;  3QIJ A;  1V5O A;  2XK5 B;  4LCD E;  5E6P A;  4GOC A;  2LRW A;  4MJS A;  1WM2 A;  3PLU A;  3AU5 A;  3M63 B;  3A9K A;  5J18 A;  2RR9 A;  4JQW C;  2XBB C;  3VH4 B;  1WJN A;  3PHX B;  1LFD A;  2JT4 B;  2N1V A;  2MBO A;  1R4N I;  3K9O B;  2DZI A;  3QQ8 B;  1WJU A;  2NS5 A;  3AU4 A;  4IC7 B;  1WGD A;  1WXV A;  4G50 A;  2MBE A;  2MX2 A;  2RPQ A;  2BGF A;  1WYW B;  4NAW B;  4RM9 A;  2AWT A;  2KN5 A;  3IHP C;  1G6J A;  2KTF A;  2JVC A;  1GNU A;  4MEL A;  3QX1 A;  4E74 A;  3PRZ A;  3L16 A;  4PS7 A;  1WMH A;  2PE6 B;  1WH3 A;  1EF1 A;  1MG8 A;  1ZW7 A;  3B08 A;  2DYM A;  2D3G A;  1WIA A;  4HCN B;  1Z5S B;  4XX5 A;  4GB9 A;  2BYF A;  3D32 A;  4LJO B;  4KSK C;  5D94 A;  1KM7 A;  5D7G A;  2O2V A;  4FJZ A;  3RZW C;  3KYD D;  1OGW A;  4B9K A;  1KLV A;  2MBQ A;  2Z59 B;  3N32 A;  4WQO B;  3IVF A;  4W9I A;  4B95 A;  5EDS A;  1WE7 A;  2FAZ A;  3DCG A;  2KX3 A;  3ZLZ A;  2GBN A;  1T0Y A;  1WRD B;  2V3S A;  4HJK A;  2HTH A;  4BKT A;  4BVU C;  4NY0 A;  2KJH B;  4GDK B;  2D10 A;  4W9F A;  2KFK B;  4IWQ A;  4GXB A;  5LLI A;  3JSV A;  3ZNG C;  1ISN A;  1GJZ A;  4PYU A;  2W9N A;  3ZNH B;  2GBR A;  3VVW B;  3A4R A;  1SGH A;  3KVF B;  1Z2M A;  1WJ4 A;  3L10 B;  4LDT D;  4FN2 A;  4XZ4 A;  3TMP B;  3ZNI D;  1TBE A;  2ZJD A;  1V2Y A;  4ZRK A;  2O6V A;  2BWF A;  2EKE C;  2FNJ B;  2Z0E B;  3PV1 A;  4ASW C;  1XQQ A;  4P7I A;  3ZTD A;  1E8Z A;  3ENE A;  4W9L A;  2MLB A;  2LVQ A;  2KZR A;  4ANX A;  3CF6 E;  3ML8 A;  3NY5 A;  4MH0 E;  1J0G A;  3GZN I;  3WA0 A;  2ZPY A;  3ZIM A;  3A9J A;  1ZGU B;  2C7M B;  3LDZ E;  5DPR A;  4BOS C;  2M4N A;  2KKC A;  2PE9 A;  4ZRI A;  2Y5B B;  1YQB A;  4KDI C;  3U7D A;  2BKF A;  2ZPN A;  3EC8 A;  3PSE B;  2FCQ A;  4TQ1 A;  5KHO A;  4BOZ B;  2MBB B;  3KYC D;  1IP9 A;  2JF5 A;  1OEY J;  2DX5 B;  3MJW A;  3DOW A;  3SU8 X;  4AJW A;  2MW5 A;  3VXW A;  1YIW A;  3DBS A;  4GU2 A;  4I6L B;  3TJP A;  2CHW A;  4G11 A;  4IWO A;  1S3S G;  1P1A A;  3ZRF A;  3KUC B;  4A20 A;  1OTR B;  2C5L C;  5FR6 A;  2LWP A;  2B3A A;  2YVC A;  3IG3 A;  4JGH B;  3KH0 A;  4I6P A;  4KSL C;  2PEA A;  3R3M A;  3APD A;  3PGE A;  4IM0 A;  3KW5 B;  4MGY E;  2CR5 A;  2KDI A;  3RZF A;  1GC7 A;  2K39 A;  4GDL A;  4ZYN A;  3UIP B;  3WAO A;  3PHW B;  1X1M A;  3UGB B;  5AZF A;  1PQS A;  2UWQ A;  2K8C A;  4AJY B;  4HCP B;  3TIX A;  2L00 B;  2LRU A;  3ECI A;  4B6W A;  1YX6 B;  1WGH A;  3VAW A;  3PLV A;  4DBG A;  1AAR A;  2IO2 B;  1V6E A;  2MA9 B;  4MGZ E;  4WWO A;  1XT9 B;  2HJ8 A;  1L2N A;  4AOF A;  3W1S A;  2AYO B;  5CHV C;  2AL3 A;  1BT0 A;  1WX9 A;  2Z0D B;  1VCB A;  1GUA B;  2CHX A;  4JL9 A;  1YX5 B;  2K8B A;  5J17 A;  4NPN A;  2KDB A;  4E3C A;  3U8Z A;  3PPA A;  4WJN A;  2IBI B;  1K8R B;  2N9X A;  3ZTC A;  2ASQ A;  1WGR A;  2KD0 A;  4HDQ A;  4NQK E;  4F7Z A;  3PVL A;  5DPS A;  1E90 A;  3EFU A;  4KDL B;  3ZW3 A;  2C7N B;  4OVU A;  1OEY A;  2WYQ A;  2ZNV C;  4ANV A;  2JXX A;  2MP2 A;  2JZZ A;  5CX3 A;  1RRB A;  3NZU A;  2K8H A;  1JRU A;  3OLM D;  2K6Q A;  2AEH A;  3A1Q B;  4IG7 B;  4KIK A;  2LD9 A;  4M0W B;  3UIO B;  2LVO A;  3VH3 B;  3RUI B;  3Q3F A;  4RMA A;  4K81 A;  3ZRC A;  4TKN A;  2L0T A;  3H7P A;  2N1W A;  4GSW A;  2JRI B;  4IW0 A;  2KWV B;  1V80 A;  1UZX B;  2FIF A;  2J0J A;  3DVN V;  2KJ6 A;  2KO3 A;  1WR1 A;  2EMS A;  4G3X B;  5JHA A;  4AUQ C;  3M62 B;  1V86 A;  2LUE A;  3H6N A;  5D6J B;  3K9P B;  4TUU A;  3QWZ B;  3SHQ A;  4F8C B;  4YL8 A;  3SDL C;  3RD2 A;  3QJZ A;  3VUW A;  2KFJ A;  2XK5 A;  2N7D A;  4WJO A;  2MWS B;  3AXC A;  1Y8R C;  3CST A;  4HVB A;  1KJT A;  3KUD B;  2KAN A;  2WX1 A;  2K25 A;  5AEK B;  2LZ6 A;  3CMM B;  4W9J A;  1P0R A;  2LVP A;  4HK2 A; 
#chains in the Genus database with same CATH topology
 2KDE B;  3RT3 B;  3B0A A;  2GBJ A;  3CWI A;  4BBN C;  1GB4 A;  3VHT C;  4RF1 A;  3SFD B;  2BYV E;  4YTP B;  4RGT A;  2N4F A;  3I63 C;  4JIO U;  3P2B A;  1D5Z C;  2KTR B;  2DWQ A;  3AE9 B;  3EUB 2;  3BVG A;  5I4D A;  2NBV B;  4IUM B;  4KKJ A;  1Q10 A;  4US9 A;  3IT6 B;  1V81 A;  5G55 A;  3B1L X;  3SEB A;  2KK8 A;  2JSV X;  4UDU C;  3DHG C;  3Q2A C;  1CMX B;  2JX5 A;  3ZQ4 A;  4PS8 A;  5C2T B;  2AX5 A;  1WXA A;  4GDK A;  2NBU A;  5GMV A;  2QSD A;  2MRP A;  4EFO A;  2PMV A;  2PTL A;  1TJE A;  3L17 A;  5JH5 C;  1NBF C;  5BMH A;  4DHZ B;  3IFW B;  1UEL A;  2M56 B;  2D3C A;  2MCN B;  4HJG E;  1XF5 L;  3ZGZ A;  2PPH A;  2L3Z A;  1N60 A;  1SE9 A;  4MGK E;  1FD6 A;  2OJW A;  2X38 A;  2JRH A;  1JW9 D;  1OFF A;  2IPK D;  1E8X A;  1YJ1 A;  2D5G A;  4AP4 C;  4EZK A;  2KQ7 A;  2X8X X;  1YNT E;  1R4M I;  3Q3M C;  1FCL A;  4N6E B;  3MTN B;  4DDI D;  3OAW A;  2MH7 A;  1TY0 A;  4ICV A;  4OZC A;  4B0M A;  2D07 B;  1BUI C;  3QCA A;  3MHS D;  1UWX A;  4AQ7 A;  3P4S B;  4ARC A;  4S0R A;  2G9H D;  3JW0 X;  1GG3 A;  4OVV A;  4EE2 A;  3AUL A;  3PO0 A;  5BYQ A;  1RLF A;  3AB5 A;  4ARI A;  3WAP A;  4CHK A;  4FAD A;  4REZ A;  1ZP0 B;  2QHO A;  2WXI A;  1XO3 A;  4BFR A;  1N61 A;  4K3C A;  2IO3 B;  4EKU A;  3VDZ A;  3BIN A;  3WAL A;  3A33 B;  4C00 A;  4N9F 4;  2XN9 C;  1YN3 A;  1I35 A;  3JSV B;  3PRM B;  3I3T B;  3FIL A;  3AE7 B;  4MM3 A;  5L95 C;  2K0P A;  4ZYS A;  2EMT A;  5AZH A;  1NI2 A;  2CKH B;  1M4V A;  1V1O A;  2UU7 A;  4HXD A;  4FHJ A;  3NS1 A;  4DXA B;  3EHV A;  1N5W A;  1PFD A;  1F2R I;  2KWU B;  3PRP B;  4ZRQ A;  5C23 A;  3AE1 B;  3LJ3 A;  2JUO A;  3P4R B;  1TZ1 A;  1JWM D;  1NYR A;  3A1Q A;  2KNB A;  1WGY A;  3MP9 A;  1ZDV A;  2KLG A;  3L08 A;  3R66 C;  3AN1 A;  3DHH C;  3NG0 A;  1MJD A;  2WXG A;  2KDF B;  2DZJ A;  5BMG A;  2RGF A;  5IA7 A;  3UF8 A;  3JVZ X;  2L8J A;  2CJO A;  4NQL B;  2HD5 B;  4W9H A;  2M0A A;  4BKS A;  1EF5 A;  1N62 A;  1ACC A;  3DWG C;  4RM8 A;  3KWL A;  3RNC C;  4P6V F;  3FAH A;  1QLB B;  3CIR B;  4KZ0 A;  1TKY A;  1I42 A;  2L0F A;  1C79 A;  3DBL B;  2KTR A;  1B1Z A;  2IGG A;  4LNO A;  2R61 A;  4XGA B;  1F0Z A;  3L13 A;  3VTV A;  4AWJ A;  2WDT B;  3VUY A;  5AZG A;  2VH1 A;  3Q8E A;  3PRE A;  1EWC A;  1SB3 C;  4I6N B;  3HM6 X;  1E7U A;  4G0N B;  5AUI A;  5IO9 A;  5LXH A;  3GE3 C;  2C7H A;  4XE0 A;  2N9E B;  4OHJ A;  3ZKJ C;  2BS4 B;  2MP2 B;  4R3D A;  3ZVV A;  1T3Q A;  3HM3 A;  3QAR A;  1FIQ A;  2KOX A;  2GMI C;  2B76 B;  3AI5 A;  3TBL D;  2KLC A;  2RD0 A;  2MEK A;  3JYU A;  4DK5 A;  4IKG A;  1F1H A;  3ABV B;  5GXG B;  1Q5W B;  2KAJ A;  1L5P A;  1JML A;  3Q6B A;  3T3O A;  1EO6 A;  1SIJ A;  1VRA B;  3IXS A;  4XDD A;  3QIJ A;  2XK5 B;  5E6P A;  4GOC A;  2LRW A;  1SEB D;  4JQW C;  2SAK A;  1QOF A;  2MBO A;  1T0R C;  1WJU A;  1YOV B;  4G50 A;  4HPP A;  2BGF A;  1WYW B;  4RM9 A;  1D6E C;  1DGJ A;  2KTF A;  4MEL A;  3PRZ A;  1V8C A;  1TS3 A;  3ZJU A;  1WRI A;  1WH3 A;  1ZW7 A;  2DLB A;  2DNF A;  4HCN B;  2BYF A;  4LJO B;  2YEP F;  5D7G A;  1HXY D;  3WCQ A;  3U2S C;  4B9K A;  4WQO B;  3IVF A;  3AE2 B;  1V97 A;  1NEN B;  1WE7 A;  2FAZ A;  3ZLZ A;  5EDS A;  4HJK A;  2HTH A;  4W9F A;  2D10 A;  3ZNG C;  3JSV A;  3N1X C;  3AH7 A;  1C4C A;  2QC8 A;  3ETR A;  1CZP A;  4DXG A;  2WP9 B;  1XLN A;  1SGH A;  2MJE A;  4FN2 A;  3TMP B;  1EWY C;  3V05 A;  2Z0E B;  3PV1 A;  4W9L A;  1LGR A;  3CF6 E;  3NY5 A;  2BBC A;  3GZN I;  1D4B A;  2J53 A;  2IGH A;  3LDZ E;  5DPR A;  4FXC A;  2RMM A;  1YJI A;  2ZPN A;  2FCQ A;  4TQ1 A;  4RF0 A;  1IP9 A;  3MJW A;  3BII D;  1ZPS A;  3BK1 A;  1RFK A;  4AS1 A;  1HA5 A;  5FR6 A;  2AQ3 B;  3IG3 A;  1FXI A;  4KSL C;  1SJH D;  3KW5 B;  4RGM A;  1T5X D;  2CR5 A;  2KDI A;  3RNE C;  2BYT A;  3WAO A;  2GI9 A;  2QIE B;  4OW0 A;  1QKZ A;  1N5X A;  2LHE A;  2L00 B;  2LRU A;  3ECI A;  4B6W A;  1XCT L;  3PLV A;  4MGZ E;  2HJ8 A;  3Q14 C;  4WH4 A;  3W1S A;  2AYO B;  5CHV C;  2AL3 A;  1BT0 A;  2PIA A;  1WX9 A;  1VCB A;  3Q8A A;  4NPN A;  2BTE A;  3W9C B;  5D3I B;  3ZTC A;  1WGR A;  4NQK E;  2WGS A;  3PVL A;  1E90 A;  2C7N B;  2ZNV C;  4OVZ A;  4ANV A;  2MP2 A;  5CX3 A;  3IT4 B;  1JWA D;  4XWW A;  4M0W B;  2K6Q A;  1SSN A;  2I2Y A;  3W5V B;  2L0T A;  1VZ6 A;  2CU3 A;  4Q2J A;  1UZX B;  1WR1 A;  2WXM A;  4G3X B;  4AUQ C;  1YMH E;  2PLP A;  4HKZ E;  3RD2 A;  2XK5 A;  3N20 C;  2N7D A;  4PT5 A;  4P16 A;  4HEA 1;  4HVB A;  3KUD B;  5AEK B;  3CMM B;  4W9J A;  2PJH A;  3I57 A;  2WQY B;  2D11 A;  4LJP B;  5L83 A;  4IDI A;  2JPH A;  4TV3 A;  4KV2 A;  1JWB D;  4E71 A;  3NOB A;  3AEC B;  3RYT A;  1IGD A;  1SE4 A;  1VLB A;  1L4D B;  1JQ4 A;  3KUZ A;  3AE4 B;  1K50 A;  2LGX A;  1ET9 A;  4H2A A;  3H1U A;  3T8M A;  2DEN B;  1EUV B;  1ZOY B;  1L0Y B;  4ICU A;  5JXV A;  2MHJ A;  1C9F A;  1ESF A;  4FUL A;  3RUL A;  4K3B A;  4S17 A;  2R2O A;  4RH6 A;  1IPG A;  3OWE B;  3VTU A;  1HTO A;  1Q1O A;  1QOA A;  4GIV A;  1U4A A;  4W9E A;  1BML C;  2Y5P A;  2SEB D;  2ZZP B;  1WJ6 A;  1V9J A;  4BKS D;  1MHX A;  4HKQ A;  3DVG Y;  1LXD A;  2NBW B;  5DPT A;  2WWZ A;  1ZUD 2;  4ANW A;  2KMM A;  3ZJV A;  1NDD A;  1GB1 A;  1UBQ A;  1V1P B;  1UH6 A;  1SE2 A;  3U30 A;  4EOY A;  1PYW D;  3V61 A;  2CHZ A;  4WWN A;  3U52 E;  2FID A;  5FKA C;  3VRA B;  4ZHP A;  3W2D A;  2KMA A;  5FR3 A;  2UYZ B;  1DYQ A;  5G2N A;  2BWE S;  2W55 A;  1OQY A;  1E5W A;  1UD7 A;  3PTF C;  1P7E A;  2JY6 A;  2O2V B;  2KC2 A;  1AN8 A;  4LNK A;  3NZ3 A;  3VQI A;  2JZP A;  2V3P A;  4KGR A;  1D3Z A;  5CHF A;  3RN9 C;  2HJ1 A;  1XEE A;  3N30 A;  3H9D A;  4XDC A;  1F52 A;  3GOE A;  1UUP A;  1SXT A;  2KC1 A;  2O6V B;  1IUE A;  2Y3A A;  3BWU D;  4DWF A;  4WWP A;  1KF6 B;  1ZXI A;  2FCS A;  2AQ1 B;  1J19 A;  3TEZ A;  2I38 A;  2WU5 B;  3PT2 B;  1H8C A;  4KVG B;  4W9G A;  3DVN U;  3UQB A;  2VH2 A;  1KTK A;  3P4P B;  4M0W A;  4FJV B;  2IND C;  2W3S A;  2LJ5 A;  4LNI A;  1I4R A;  2GBM A;  4J3O D;  4JLC A;  5D3D A;  2CU1 A;  4EZL A;  4IM2 A;  1WXM A;  3TCA A;  3TEY A;  2A4Z A;  1DOI A;  5J2R A;  3L0W B;  4ACF A;  1YN4 A;  3APC A;  3DPD A;  1C1Y B;  3E56 A;  4MSQ B;  4W9C A;  4M00 A;  3VTW A;  4GDL B;  2RSU A;  1IYF A;  2WU2 B;  3MFG A;  4YT0 B;  2MJ3 A;  4K7W A;  1MI0 A;  1TTN A;  3H7S A;  4MSM B;  1WFY A;  1QOG A;  1RFA A;  2NR2 A;  4XC2 A;  5MPO A;  1HE8 A;  3ZXV A;  4C7Z A;  3I5J C;  4K7U A;  4YTN B;  2IY0 B;  4DXF A;  5JZE B;  3WAM A;  4C4V B;  5TR5 A;  1Q0W B;  3L4P A;  2NMQ A;  3R8B A;  3R7Q A;  1AWD A;  1ZKH A;  3NVW A;  2V1Y A;  4CYE A;  3GE8 C;  5BYS A;  3NS8 A;  5KHQ A;  2A5U A;  4FJY A;  4YSX B;  1RWS A;  2I1J A;  5DCN A;  1FXT B;  1QIL A;  3DVG X;  2LGS A;  5H92 C;  2BF8 B;  4EZJ A;  1MPE A;  1WSP A;  3AEA B;  1ET6 A;  2KT7 A;  1R4M B;  2HDE A;  1FCC C;  2K3U A;  1V5O A;  1OQR A;  3VH4 B;  3B2G A;  1LFD A;  1V1P A;  1ENF A;  4RNA A;  1R4N I;  2INP E;  2E3T A;  2DZI A;  4YWG G;  2J52 A;  3B2F A;  1WGD A;  4TSS A;  3RFZ B;  2RPQ A;  3NVY A;  2FUG 1;  5FK9 C;  2KN5 A;  3UI3 A;  2JVC A;  1GNU A;  3QX1 A;  1Y56 A;  1AW7 A;  1MG8 A;  3B08 A;  3D32 A;  4KSK C;  2INN E;  1CK1 A;  2O2V A;  3RZW C;  1QF6 A;  3KYD D;  1OGW A;  1R4N B;  1I4Q A;  2MBQ A;  2Z59 B;  3R2T A;  3N32 A;  3C19 A;  4B95 A;  5HHD G;  3Q8F A;  2V3S A;  3NRZ A;  4ZHO A;  2EKI A;  2QJL A;  2KJH B;  5LLI A;  2KFK B;  4IWQ A;  2Y5C A;  1ISN A;  4PYU A;  4YSY B;  2MJD A;  3A4R A;  4KX6 B;  3ZNI D;  1V2Y A;  2O6V A;  4ASW C;  4P7I A;  3ENE A;  1TS2 A;  4C56 C;  4ANX A;  3ML8 A;  2IGD A;  1C4A A;  3WA0 A;  3ZIM A;  1T6B X;  1ZGU B;  2M4N A;  1ZXH A;  1D5X C;  1YQB A;  1FXA A;  4BOZ B;  2DX5 B;  2LGI A;  1ROE A;  3AE3 B;  1YIW A;  1FM0 D;  1FNU A;  4I6L B;  3AMZ A;  3HVZ A;  4IWO A;  2INC C;  3KUC B;  2B3A A;  2K22 A;  4JGH B;  3KH0 A;  3URY A;  1HEZ E;  3APD A;  3RNF C;  5AUK A;  3RZF A;  2K39 A;  4GDL A;  1FFU A;  3TUO A;  2UWQ A;  2K8C A;  5G5H A;  3TIX A;  3Q69 A;  1YX6 B;  4P1C C;  4DBG A;  1AAR A;  2IO2 B;  1V6E A;  2MA9 B;  1ZDX A;  1QQR A;  3GB1 A;  2PKO A;  1GUA B;  1MFW A;  1L0V B;  4C4V A;  4E3C A;  4D2K A;  1DOY A;  2IBI B;  1DOX A;  2N9X A;  4HDQ A;  2ONQ A;  2FBW B;  3DWM A;  3ZW3 A;  2HTM E;  2BB6 A;  3NJT A;  1MVK A;  2JXX A;  3NZU A;  2K8H A;  1JRU A;  4IG7 B;  3VH3 B;  2J42 A;  2LVO A;  4RMA A;  2N1W A;  2JRI B;  1FRR A;  2J0J A;  2KO3 A;  3BK2 A;  2E6X A;  2KN4 A;  3H6N A;  5D6J B;  4TUU A;  3SHQ A;  3SDL C;  1F2R C;  4USA A;  3CST A;  1XLO A;  1NVI D;  1GAQ B;  3ZXR A;  1KJT A;  2LZ6 A;  2NTT A;  2K5P A;  3W1Y A;  1FPY A;  4NJC A;  5DPW A;  2M8S A;  2BS2 B;  1FFV A;  3A4S C;  4X57 B;  5EE0 A;  2ZNV B;  2JU6 X;  2KYW A;  2LXA A;  1PDX A;  4NJ6 A;  1JRP A;  1GC6 A;  4RFB A;  3W1S C;  3TSS A;  1V49 A;  1R7S A;  2JQR B;  2V4I B;  2OJR A;  2VZK D;  2XEW A;  2GBK A;  5HG2 A;  2LFI A;  4FHK A;  1K53 A;  1JAL A;  2L83 A;  1WX8 A;  4FLH A;  2KFK A;  1D5M C;  3TEW A;  4JWU C;  1C77 A;  2AL6 A;  1P7F A;  2NTS A;  2BKR B;  3GZN B;  3APF A;  1HZ6 A;  4PS3 A;  4WAA A;  4ANU A;  2N9L A;  3HHM A;  2Q5W D;  3LB8 C;  2G45 B;  3S2A A;  3HK0 A;  2V4L A;  2N7E A;  2WDV B;  3SR6 A;  3R7R A;  4ZDV A;  4MJS B;  4M02 A;  1WZ0 A;  2LXC A;  3A9K B;  4MDK E;  2LAS A;  4GN1 A;  5LXI B;  3X0W A;  2QCZ A;  4HRS A;  2REX A;  4HPM B;  1V5T A;  4RCO A;  5JHB A;  2N9P C;  2ZW0 A;  4CO7 A;  5EE3 A;  1WY8 A;  5E6N A;  2IO0 B;  1RYJ A;  4J6I A;  2WXN A;  2BB5 A;  2VZK B;  4DHJ B;  1KRH A;  2LGD A;  3WAN A;  1WMH B;  4KZC A;  3AEE B;  4C7Y A;  2YEP B;  1C76 A;  2HE7 A;  1H4R A;  4RGN A;  3HVD A;  2GOW A;  4DQO C;  3RMK C;  4TQ0 A;  2K6D B;  4BZA A;  4EEW A;  3PZD A;  4KGS A;  4NJ7 A;  3M95 A;  4II3 B;  2TSS A;  4A90 A;  1J8C A;  1RAX A;  5IP4 D;  3J9C A;  3V3X A;  2C60 A;  4BKG A;  1GPX A;  3DBH I;  1WR6 E;  4RGO S;  3AV8 A;  3VFK A;  2FE8 A;  4A55 A;  3KWV A;  3X23 A;  3DDC B;  2KX0 A;  1L0X B;  3QHT A;  2DZK A;  2MBH A;  1S1Q B;  2JXT A;  1A5R A;  3NVZ A;  3A9J B;  1HZ5 A;  3OJ3 A;  3T9L A;  4OZA A;  2G3Q B;  2N9K A;  4M8N A;  2KVR A;  1PGB A;  1SBB B;  2L7R A;  1LO5 D;  2KQ4 X;  1E8Y A;  2C9W B;  2PVG C;  5TSS A;  2XNA C;  3DBH B;  4K1R B;  3TEX A;  4HLE A;  1KH0 A;  5EE9 A;  2IYD B;  2G4D B;  1TKE A;  2LI5 A;  3ZNZ B;  2FCM A;  2VRR B;  1NEK B;  2ZVO A;  1KOT A;  1UF0 A;  4MEM A;  1WM3 A;  1P3Q U;  1WF9 A;  2GLS A;  3AE5 B;  2KVZ A;  4K7S A;  2W82 A;  4WJP A;  3VR8 B;  4ZRJ A;  4F1S A;  2WXH A;  1P9D U;  2WXL A;  4HPL B;  3ZO5 B;  1XD3 B;  3W5U B;  3IAM 1;  1MHH E;  1WI0 A;  3FC4 A;  2WLB A;  2O6V D;  3TL5 A;  2CS4 A;  1WZ3 A;  4EUT A;  3N9Y C;  1L7Y A;  4HDO A;  1JCK B;  3GS2 A;  2OOB B;  1KLU D;  2WNM A;  2DYO A;  3KLS X;  3BZD B;  4MT5 A;  2D2Q A;  3AEG B;  3ONS A;  4KIK B;  1WXQ A;  2MSE D;  3T3N A;  4WJQ A;  3VUX A;  1WE6 A;  4LTU A;  4WQM A;  2L52 A;  3V62 A;  3NZS A;  1UBI A;  3RCZ A;  3OG5 A;  2D3A A;  3RNG C;  3NUH B;  2V9H A;  3O65 B;  4LDT B;  3WIM A;  1XCQ L;  3OJ4 B;  4FA6 A;  5BYR A;  3RNB C;  2BW2 A;  1EM7 A;  4MJS A;  1WM2 A;  3AU5 A;  3A9K A;  4A8X C;  5J18 A;  3AEF B;  2XBB C;  3PHX B;  2N1V A;  2JT4 B;  3N1Y C;  2NS5 A;  3AU4 A;  4B0E A;  1WXV A;  1L4Z B;  2MBE A;  2ON8 A;  2MX2 A;  4NAW B;  3HRD D;  2RDH A;  3IHP C;  1G6J A;  4E74 A;  4PS7 A;  1WMH A;  2PE6 B;  1EF1 A;  1YQ4 B;  1FMA D;  1WIA A;  3P42 A;  4GB9 A;  4OZB A;  2OHF A;  1TKG A;  1KM7 A;  4A6Q A;  1SE3 A;  4O1N A;  1I4X A;  3EGR A;  4W9I A;  1TS4 A;  3DCG A;  2GBN A;  1T0Y A;  4BKT A;  3ZJT A;  4US8 A;  2AQ2 B;  4NY0 A;  1IGC A;  5LNK 1;  4GXB A;  3MHZ A;  1PUT A;  3BYY B;  2GBR A;  3VVW B;  3P63 A;  1HTQ A;  2LUM A;  1CQV A;  1YN5 A;  3VRB B;  1TBE A;  2ZJD A;  2BWF A;  3ZTD A;  5G5G A;  2LVQ A;  2KZR A;  4ZRP A;  1J0G A;  3A9J A;  5H8Y E;  2RPV A;  2QDF A;  3VR9 B;  4ZRI A;  2Y5B B;  3U7D A;  2BKF A;  3EC8 A;  3PSE B;  2MBB B;  2JF5 A;  2QEJ C;  3SU8 X;  3DOW A;  4AJW A;  2MW5 A;  4GU2 A;  3TJP A;  3FKY A;  4G11 A;  4N59 A;  1TIF A;  1A70 A;  1VZ7 A;  4A20 A;  2C5L C;  2LWP A;  1XLP A;  4I6P A;  1FO4 A;  2PEA A;  3R3M A;  2G1E A;  4IM0 A;  4MGY E;  1E7P B;  1GC7 A;  4ZYN A;  3PHW B;  1FRD A;  3UGB B;  5AZF A;  1K51 A;  1E0Z A;  1L6V A;  4BAX A;  3AE6 B;  1VZ8 A;  4MAC A;  1IBX B;  2WDR B;  2Z0D B;  1QOB A;  3NVV A;  2CHX A;  4A9A A;  4JL9 A;  5J17 A;  1E10 A;  2KDB A;  4WIP A;  2WS3 B;  1YQ3 B;  3PPA A;  3U8Z A;  4JWS C;  3RPF C;  3IAS 1;  4WJN A;  3AM9 A;  1K8R B;  4F7Z A;  2ASQ A;  2WDQ B;  4TMA B;  1TY2 A;  5DPS A;  3R2I A;  3EFU A;  4KDL B;  1N6Z A;  1UWM A;  3OLM D;  4KIK A;  2AEH A;  3UIO B;  4C80 A;  1KLG D;  3RUI B;  4K81 A;  3ZRC A;  1SF0 A;  4GSW A;  2KWV B;  1TZO A;  2FIF A;  3DVN V;  1CJE A;  2EMS A;  3N1Z C;  5JHA A;  4CQN A;  2KDM A;  3M62 B;  2H89 B;  1V86 A;  1WYG A;  3K9P B;  4KKI A;  3QWZ B;  4F8C B;  2L32 A;  2WXO A;  1VDV A;  3VUW A;  4YXD B;  2MWS B;  3AXC A;  1Y8R C;  2WXP A;  3GP7 A;  2KAN A;  3MC9 A;  1P0R A;  4HK2 A;  2H88 B;  3ALB A;  3V6E B;  2JWZ A;  5IN7 A;  1N63 A;  1FNV A;  4N58 A;  4YSZ B;  1SJE D;  5C1Z A;  1WXS A;  4NAW A;  4GMV A;  1JWU D;  2FCN A;  3ZUN A;  2GRI A;  4A3O A;  3SFE B;  2ZW1 A;  4WUR A;  2NPT B;  3DBL I;  4MGI E;  1F9J A;  4L1B A;  1EU3 A;  2ZEQ A;  5IAA C;  4W9K A;  2I1K A;  3DQV A;  2EEL A;  1E8W A;  1SIF A;  1LM8 B;  1MG4 A;  2QIL A;  3PS6 A;  1J7A A;  2DZM A;  1UGM A;  1TT5 B;  2LGY A;  3QAQ A;  3SD5 A;  3ML9 A;  3HUI A;  4PYZ A;  1E7V A;  1E6E B;  3MJ5 A;  3EA6 A;  2DYB A;  1M94 A;  3QA8 A;  4II2 B;  1WX7 A;  2WXJ A;  1C4P A;  1B9R A;  3MC0 B;  1XXG A;  4NNJ B;  5HFY A;  2ZVN A;  2K1F A;  3LXF A;  3RNA C;  1FEH A;  2KAC A;  1FNW A;  3ZDM C;  3QK0 A;  2FUH B;  1C3T A;  3V60 A;  3BVZ A;  2KJR A;  4ITK A;  3BY4 B;  5BO4 B;  5D2M B;  5BMI A;  1VR9 A;  3UIN B;  2J7Q B;  1NYQ A;  1PGX A;  2WHI A;  2M0X A;  4HWI B;  2WXF A;  1TS5 A;  2KXJ A;  2J0M A;  2NCN A;  4LNN A;  4L2Y A;  2BYE A;  4PK1 A;  2G4S A;  4WAF A;  1IBX A;  2KWD A;  2MQJ A;  4IWP A;  4URK A;  1VD2 A;  3U4E G;  2QMT A;  2IZV B;  3C0R B;  5IKC M;  4W9D A;  2JYT A;  2OED A;  2DHZ A;  3I9V 1;  2KHW B;  3Q3J A;  3DHI C;  4IM3 A;  2V3N A;  3P4Q B;  2JZ3 B;  3NHE B;  2RDG A;  3H8H A;  1QZE A;  3IBE A;  1WGG A;  4M8M A;  1L6U A;  3EFC A;  4DHJ D;  2ICI A;  4A3P A;  5HKH A;  4FBJ B;  1C78 A;  2J0K A;  3HIZ A;  2W3R A;  1KFY B;  4NZL B;  2WXQ A;  1UGJ A;  2ZCC A;  4HRO A;  3U7Z A;  2JWU A;  4GGQ A;  1TGZ B;  2DAF A;  2YLM A;  2R2Q A;  2WX0 A;  2JYE A;  1P98 A;  2BQQ A;  1HQR D;  1JRO A;  1YD8 U;  2BPS A;  2M17 A;  2KQS A;  2KMC A;  2GB1 A;  3ZYY X;  2BT6 A;  2N0S B;  2NPT A;  5IOI A;  3V6C B;  3M3J A;  4LK0 M;  2ZCB A;  1VJK A;  4DHZ E;  4DDG D;  2DAJ A;  2L76 A;  3N3K B;  3QC8 B;  3B9J A;  5E6O A;  2DBY A;  1J7C A;  3ZDT A;  3L54 A;  5T8I A;  3CSF A;  1XLQ A;  3AEB B;  3EEC A;  2CJN A;  5CTR C;  2L05 A;  1E9M A;  1LQB A;  3DBR I;  2PVO D;  3H7P B;  2IY1 B;  2KWC A;  4BBN F;  5CHW A;  2NVU I;  2M1M A;  2W54 A;  2PW9 A;  3UQA A;  2IO1 B;  1QT9 A;  2RDB C;  3Q3N C;  4LCD E;  1EU4 A;  3PLU A;  4GLS C;  3M63 B;  2RR9 A;  1RM6 C;  1WJN A;  4XWT A;  3DBR B;  1AYF A;  3K9O B;  4M01 A;  3QQ8 B;  1F77 A;  4IC7 B;  1I4G A;  3Q8C A;  3E9S A;  3BYT B;  4ZOH C;  3AE8 B;  1ZE3 D;  1I4P A;  2AWT A;  5C3J B;  3L16 A;  4JX1 C;  2DYM A;  2D3G A;  1STE A;  1Z5S B;  4XX5 A;  2WXK A;  4JPS A;  5D94 A;  4FJZ A;  1KLV A;  5EE1 A;  1WWT A;  2KX3 A;  4BVU C;  1WRD B;  4GDK B;  4KGT A;  1GJZ A;  2W9N A;  3ZNH B;  3KVF B;  1Z2M A;  1WJ4 A;  3L10 B;  4LDT D;  4XZ4 A;  4ZRK A;  2EKE C;  3BVM A;  2FNJ B;  1I4H A;  1XQQ A;  2V0G A;  1E8Z A;  2LEK A;  2MLB A;  2LHD A;  2IDY A;  4MH0 E;  2ZPY A;  2LJI A;  2C7M B;  2N7J A;  4BOS C;  2M19 A;  3KQ4 A;  2KKC A;  2PE9 A;  4IOI E;  4KDI C;  3MC8 A;  5E6J A;  5KHO A;  3KYC D;  1OEY J;  4MH8 A;  3VXW A;  1OQQ A;  1UNS A;  3DBS A;  2CHW A;  2LMC A;  1S3S G;  1P1A A;  3ZRF A;  3Q3O C;  1OTR B;  2YVC A;  3C8Y A;  2L1A A;  3PZ8 A;  5HI1 A;  3Q8B A;  3PGE A;  3P1M A;  3UIP B;  1X1M A;  4L23 A;  1PQS A;  4LNF A;  4AJY B;  4HCP B;  1GOZ A;  1WGH A;  3VAW A;  4WWO A;  1J7B A;  1XT9 B;  4NAM A;  1L2N A;  3FIL B;  4AOF A;  4MM3 B;  4WWM A;  2BVC A;  4P1B C;  4YTM B;  4JE3 B;  1YX5 B;  2K8B A;  2Z8L A;  3PZ7 A;  2WXR A;  1T0S C;  2KD0 A;  4LLG M;  4OVU A;  1OEY A;  2WYQ A;  2ACZ B;  2JZZ A;  1TYG B;  1RRB A;  2K9X A;  3O13 A;  1K52 A;  3A1Q B;  2LD9 A;  3LYY A;  4QAY A;  1JWS D;  3Q3F A;  4TKN A;  1YJJ A;  3H7P A;  3AED B;  1I7H A;  4IW0 A;  1V80 A;  1PGA A;  1NI3 A;  1BXT A;  2KJ6 A;  3RI7 C;  2BS3 B;  2D3B A;  2LUE A;  4YL8 A;  1T0Q C;  3QJZ A;  2KFJ A;  4WJO A;  1WGK A;  2J4X A;  2WX1 A;  2K25 A;  4XYC A;  2IJ0 A;  2LVP A; 
#chains in the Genus database with same CATH homology
 2KDE B;  2PJH A;  3ALB A;  3RT3 B;  3W1Y A;  3B0A A;  2D11 A;  2GBJ A;  4LJP B;  3V6E B;  2JWZ A;  5L83 A;  5DPW A;  2M8S A;  4BBN C;  3VHT C;  2JPH A;  3A4S C;  2BYV E;  4TV3 A;  4KV2 A;  4X57 B;  2N4F A;  4JIO U;  2ZNV B;  5C1Z A;  4E71 A;  3NOB A;  3P2B A;  1WXS A;  2KTR B;  2LXA A;  4NJ6 A;  3RYT A;  4NAW A;  1GC6 A;  4GMV A;  3W1S C;  2FCN A;  2NBV B;  4IUM B;  3ZUN A;  1V49 A;  4A3O A;  3KUZ A;  2OJR A;  2NPT B;  3DBL I;  4MGI E;  1F9J A;  2ZEQ A;  5IAA C;  1V81 A;  5G55 A;  4W9K A;  2LGX A;  2XEW A;  2GBK A;  3B1L X;  2KK8 A;  3H1U A;  2I1K A;  3DQV A;  4FHK A;  3T8M A;  1E8W A;  1SIF A;  1LM8 B;  2DEN B;  1EUV B;  1CMX B;  4PS8 A;  1WX8 A;  1WXA A;  4ICU A;  4FLH A;  2NBU A;  4GDK A;  2KFK A;  3PS6 A;  5GMV A;  4FUL A;  2DZM A;  3RUL A;  2MRP A;  2AL6 A;  1UGM A;  2LGY A;  2R2O A;  4EFO A;  1IPG A;  3L17 A;  3QAQ A;  3SD5 A;  3ML9 A;  4PYZ A;  1NBF C;  1E7V A;  2BKR B;  3VTU A;  4DHZ B;  3IFW B;  5JH5 C;  3APF A;  1UEL A;  1Q1O A;  4PS3 A;  4GIV A;  1U4A A;  4WAA A;  4ANU A;  2DYB A;  1M94 A;  4W9E A;  2MCN B;  3HHM A;  2G45 B;  1WJ6 A;  2ZZP B;  3S2A A;  3QA8 A;  3HK0 A;  1V9J A;  4II2 B;  2V4L A;  4BKS D;  3DVG Y;  2N7E A;  2PPH A;  2L3Z A;  1LXD A;  1SE9 A;  4MGK E;  1WX7 A;  2NBW B;  3R7R A;  4ZDV A;  5DPT A;  2WWZ A;  4MJS B;  1WZ0 A;  2LXC A;  2JRH A;  4ANW A;  3A9K B;  1E8X A;  1YJ1 A;  4MDK E;  2LAS A;  1NDD A;  4GN1 A;  4AP4 C;  4EZK A;  2KQ7 A;  5LXI B;  1UBQ A;  3X0W A;  1R4M I;  2REX A;  1UH6 A;  3MTN B;  4HPM B;  4DDI D;  3OAW A;  1V5T A;  3U30 A;  4EOY A;  5JHB A;  3V61 A;  2CHZ A;  2N9P C;  4ICV A;  4NNJ B;  2D07 B;  4CO7 A;  1WY8 A;  5E6N A;  2ZVN A;  3QCA A;  2IO0 B;  3MHS D;  2K1F A;  4WWN A;  4J6I A;  2FID A;  3JW0 X;  1GG3 A;  2KMA A;  4OVV A;  2UYZ B;  4DHJ B;  2LGD A;  3ZDM C;  3AUL A;  3QK0 A;  5G2N A;  2FUH B;  3WAN A;  1WMH B;  1RLF A;  2BWE S;  1C3T A;  4KZC A;  1OQY A;  3V60 A;  1E5W A;  1UD7 A;  2KJR A;  3PTF C;  3WAP A;  4CHK A;  4FAD A;  2HE7 A;  2QHO A;  1H4R A;  3BY4 B;  2GOW A;  2JY6 A;  5BO4 B;  5D2M B;  2O2V B;  4BFR A;  4TQ0 A;  2IO3 B;  4EKU A;  2K6D B;  2KC2 A;  3VDZ A;  3UIN B;  3BIN A;  3WAL A;  2J7Q B;  3A33 B;  4EEW A;  3VQI A;  3PZD A;  4N9F 4;  2M0X A;  1I35 A;  4NJ7 A;  3JSV B;  4HWI B;  3PRM B;  1D3Z A;  3M95 A;  5CHF A;  4II3 B;  2KXJ A;  2J0M A;  2NCN A;  3I3T B;  3N30 A;  3H9D A;  4MM3 A;  5L95 C;  2BYE A;  3GOE A;  1J8C A;  2G4S A;  1RAX A;  2EMT A;  2MQJ A;  2C60 A;  4IWP A;  5AZH A;  4BKG A;  4URK A;  2KC1 A;  1NI2 A;  1VD2 A;  2CKH B;  3DBH I;  1WR6 E;  3VFK A;  2O6V B;  2IZV B;  3C0R B;  4DWF A;  3X23 A;  4W9D A;  4HXD A;  4WWP A;  3DDC B;  2KX0 A;  4FHJ A;  2FCS A;  4DXA B;  1J19 A;  3QHT A;  2DZK A;  3EHV A;  2MBH A;  2DHZ A;  1S1Q B;  2KWU B;  3PRP B;  3PT2 B;  5C23 A;  1A5R A;  3A9J B;  2KHW B;  3Q3J A;  3LJ3 A;  3OJ3 A;  4IM3 A;  3T9L A;  4KVG B;  4W9G A;  2JUO A;  3DVN U;  3UQB A;  1H8C A;  2JZ3 B;  1TZ1 A;  2G3Q B;  4M8N A;  3NHE B;  2KVR A;  3A1Q A;  2KNB A;  4FJV B;  1WGY A;  2L7R A;  2LJ5 A;  1E8Y A;  2KLG A;  3L08 A;  1QZE A;  3IBE A;  2C9W B;  2GBM A;  3R66 C;  4K1R B;  1WGG A;  4JLC A;  2KDF B;  2CU1 A;  2DZJ A;  4M8M A;  4EZL A;  4HLE A;  4IM2 A;  2RGF A;  4DHJ D;  5IA7 A;  3UF8 A;  2IYD B;  2G4D B;  1WXM A;  3JVZ X;  2LI5 A;  3TCA A;  4A3P A;  2A4Z A;  3ZNZ B;  5HKH A;  2FCM A;  2VRR B;  2L8J A;  2J0K A;  4FBJ B;  3HIZ A;  4NQL B;  5J2R A;  2HD5 B;  3L0W B;  4W9H A;  2ZCC A;  4BKS A;  1EF5 A;  2ZVO A;  3APC A;  1KOT A;  3DPD A;  1C1Y B;  1TGZ B;  4GGQ A;  4MSQ B;  4W9C A;  4RM8 A;  3VTW A;  4GDL B;  2RSU A;  1IYF A;  4MEM A;  1WM3 A;  1P3Q U;  1WF9 A;  2DAF A;  4K7S A;  2YLM A;  4WJP A;  2R2Q A;  4K7W A;  1TTN A;  2WX0 A;  3H7S A;  4KZ0 A;  1P98 A;  4MSM B;  4ZRJ A;  1WFY A;  2L0F A;  4F1S A;  1I42 A;  2KTR A;  1P9D U;  1RFA A;  4HPL B;  2NR2 A;  3ZO5 B;  4XC2 A;  1YD8 U;  2BPS A;  1XD3 B;  1HE8 A;  2M17 A;  3L13 A;  2KQS A;  2KMC A;  3VTV A;  2WDT B;  1WI0 A;  4AWJ A;  4K7U A;  3VUY A;  2IY0 B;  5AZG A;  2O6V D;  3TL5 A;  2CS4 A;  2NPT A;  3PRE A;  3V6C B;  5JZE B;  3WAM A;  1WZ3 A;  5TR5 A;  3M3J A;  2ZCB A;  1Q0W B;  4I6N B;  3HM6 X;  4DHZ E;  4EUT A;  4DDG D;  2DAJ A;  3R7Q A;  1E7U A;  4G0N B;  5LXH A;  2L76 A;  1L7Y A;  4HDO A;  3N3K B;  2C7H A;  1ZKH A;  3QC8 B;  5E6O A;  2V1Y A;  2OOB B;  3ZDT A;  4CYE A;  2N9E B;  3L54 A;  3ZKJ C;  3CSF A;  2DYO A;  2MP2 B;  2D2Q A;  3ONS A;  3ZVV A;  3HM3 A;  3NS8 A;  4KIK B;  2MSE D;  3EEC A;  3QAR A;  4WJQ A;  2KOX A;  5CTR C;  1WE6 A;  2L05 A;  3VUX A;  2A5U A;  5KHQ A;  1LQB A;  3DBR I;  2GMI C;  4FJY A;  3V62 A;  3NZS A;  1UBI A;  3H7P B;  2I1J A;  3AI5 A;  3RCZ A;  3TBL D;  2KLC A;  2IY1 B;  2KWC A;  2RD0 A;  5DCN A;  4BBN F;  1FXT B;  3JYU A;  4DK5 A;  3DVG X;  5CHW A;  1Q5W B;  2NVU I;  2M1M A;  2BF8 B;  4EZJ A;  3O65 B;  4LDT B;  3WIM A;  3UQA A;  3OJ4 B;  2IO1 B;  1EO6 A;  4FA6 A;  3QIJ A;  1V5O A;  2XK5 B;  4LCD E;  5E6P A;  4GOC A;  2LRW A;  4MJS A;  1WM2 A;  3PLU A;  3AU5 A;  3M63 B;  3A9K A;  5J18 A;  2RR9 A;  4JQW C;  2XBB C;  3VH4 B;  1WJN A;  3PHX B;  1LFD A;  2JT4 B;  2N1V A;  2MBO A;  1R4N I;  3K9O B;  2DZI A;  3QQ8 B;  1WJU A;  2NS5 A;  3AU4 A;  4IC7 B;  1WGD A;  1WXV A;  4G50 A;  2MBE A;  2MX2 A;  2RPQ A;  2BGF A;  1WYW B;  4NAW B;  4RM9 A;  2AWT A;  2KN5 A;  3IHP C;  1G6J A;  2KTF A;  2JVC A;  1GNU A;  4MEL A;  3QX1 A;  4E74 A;  3PRZ A;  3L16 A;  4PS7 A;  1WMH A;  2PE6 B;  1WH3 A;  1EF1 A;  1MG8 A;  1ZW7 A;  3B08 A;  2DYM A;  2D3G A;  1WIA A;  4HCN B;  1Z5S B;  4XX5 A;  4GB9 A;  2BYF A;  3D32 A;  4LJO B;  4KSK C;  5D94 A;  1KM7 A;  5D7G A;  2O2V A;  4FJZ A;  3RZW C;  3KYD D;  1OGW A;  4B9K A;  1KLV A;  2MBQ A;  2Z59 B;  3N32 A;  4WQO B;  3IVF A;  4W9I A;  4B95 A;  5EDS A;  1WE7 A;  2FAZ A;  3DCG A;  2KX3 A;  3ZLZ A;  2GBN A;  1T0Y A;  1WRD B;  2V3S A;  4HJK A;  2HTH A;  4BKT A;  4BVU C;  4NY0 A;  2KJH B;  4GDK B;  2D10 A;  4W9F A;  2KFK B;  4IWQ A;  4GXB A;  5LLI A;  3JSV A;  3ZNG C;  1ISN A;  1GJZ A;  4PYU A;  2W9N A;  3ZNH B;  2GBR A;  3VVW B;  3A4R A;  1SGH A;  3KVF B;  1Z2M A;  1WJ4 A;  3L10 B;  4LDT D;  4FN2 A;  4XZ4 A;  3TMP B;  3ZNI D;  1TBE A;  2ZJD A;  1V2Y A;  4ZRK A;  2O6V A;  2BWF A;  2EKE C;  2FNJ B;  2Z0E B;  3PV1 A;  4ASW C;  1XQQ A;  4P7I A;  3ZTD A;  1E8Z A;  3ENE A;  4W9L A;  2MLB A;  2LVQ A;  2KZR A;  4ANX A;  3CF6 E;  3ML8 A;  3NY5 A;  4MH0 E;  1J0G A;  3GZN I;  3WA0 A;  2ZPY A;  3ZIM A;  3A9J A;  1ZGU B;  2C7M B;  3LDZ E;  5DPR A;  4BOS C;  2M4N A;  2KKC A;  2PE9 A;  4ZRI A;  2Y5B B;  1YQB A;  4KDI C;  3U7D A;  2BKF A;  2ZPN A;  3EC8 A;  3PSE B;  2FCQ A;  4TQ1 A;  5KHO A;  4BOZ B;  2MBB B;  3KYC D;  1IP9 A;  2JF5 A;  1OEY J;  2DX5 B;  3MJW A;  3DOW A;  3SU8 X;  4AJW A;  2MW5 A;  3VXW A;  1YIW A;  3DBS A;  4GU2 A;  4I6L B;  3TJP A;  2CHW A;  4G11 A;  4IWO A;  1S3S G;  1P1A A;  3ZRF A;  3KUC B;  4A20 A;  1OTR B;  2C5L C;  5FR6 A;  2LWP A;  2B3A A;  2YVC A;  3IG3 A;  4JGH B;  3KH0 A;  4I6P A;  4KSL C;  2PEA A;  3R3M A;  3APD A;  3PGE A;  4IM0 A;  3KW5 B;  4MGY E;  2CR5 A;  2KDI A;  3RZF A;  1GC7 A;  2K39 A;  4GDL A;  4ZYN A;  3UIP B;  3WAO A;  3PHW B;  1X1M A;  3UGB B;  5AZF A;  1PQS A;  2UWQ A;  2K8C A;  4AJY B;  4HCP B;  3TIX A;  2L00 B;  2LRU A;  3ECI A;  4B6W A;  1YX6 B;  1WGH A;  3VAW A;  3PLV A;  4DBG A;  1AAR A;  2IO2 B;  1V6E A;  2MA9 B;  4MGZ E;  4WWO A;  1XT9 B;  2HJ8 A;  1L2N A;  4AOF A;  3W1S A;  2AYO B;  5CHV C;  2AL3 A;  1BT0 A;  1WX9 A;  2Z0D B;  1VCB A;  1GUA B;  2CHX A;  4JL9 A;  1YX5 B;  2K8B A;  5J17 A;  4NPN A;  2KDB A;  4E3C A;  3U8Z A;  3PPA A;  4WJN A;  2IBI B;  1K8R B;  2N9X A;  3ZTC A;  2ASQ A;  1WGR A;  2KD0 A;  4HDQ A;  4NQK E;  4F7Z A;  3PVL A;  5DPS A;  1E90 A;  3EFU A;  4KDL B;  3ZW3 A;  2C7N B;  4OVU A;  1OEY A;  2WYQ A;  2ZNV C;  4ANV A;  2JXX A;  2MP2 A;  2JZZ A;  5CX3 A;  1RRB A;  3NZU A;  2K8H A;  1JRU A;  3OLM D;  2K6Q A;  2AEH A;  3A1Q B;  4IG7 B;  4KIK A;  2LD9 A;  4M0W B;  3UIO B;  2LVO A;  3VH3 B;  3RUI B;  3Q3F A;  4RMA A;  4K81 A;  3ZRC A;  4TKN A;  2L0T A;  3H7P A;  2N1W A;  4GSW A;  2JRI B;  4IW0 A;  2KWV B;  1V80 A;  1UZX B;  2FIF A;  2J0J A;  3DVN V;  2KJ6 A;  2KO3 A;  1WR1 A;  2EMS A;  4G3X B;  5JHA A;  4AUQ C;  3M62 B;  1V86 A;  2LUE A;  3H6N A;  5D6J B;  3K9P B;  4TUU A;  3QWZ B;  3SHQ A;  4F8C B;  4YL8 A;  3SDL C;  3RD2 A;  3QJZ A;  3VUW A;  2KFJ A;  2XK5 A;  2N7D A;  4WJO A;  2MWS B;  3AXC A;  1Y8R C;  3CST A;  4HVB A;  1KJT A;  3KUD B;  2KAN A;  2WX1 A;  2K25 A;  5AEK B;  2LZ6 A;  3CMM B;  4W9J A;  1P0R A;  2LVP A;  4HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...