2JXXA

Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFATC2-interacting protein
publication title Solution structure of Ubiquitin-like domain of NFATC2IP.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jxxA00
3DOWA 2GBMA 3QWZB 2N9PC 1GUAB 4HDOA 2J0MA 3RULA 2KJHB 2MBOA 4WWPA 3DCGA 2M8SA 1WE7A 1EUVB 2WWZA 3LJ3A 5KHOA 3VTUA 3M3JA 3KVFB 1MG8A 2MQJA 2OJRA 4DHJD 5LXIB 4ANVA 4DDGD 4KDLB 3Q3FA 3QAQA 4KIKA 3RCZA 5LLIA 3KH0A 2RR9A 2CKHB 1WX7A 1LQBA 4M0WB 5G2NA 1ZGUB 3VAWA 3VHTC 1EF5A 2MRPA 1T0YA 2NPTA 2O2VA 2HD5B 2FCMA 3DBHI 3HIZA 2K39A 1M94A 4MGIE 3VDZA 4MJSB 3TBLD 2O6VB 4I6NB 2GMIC 3IFWB 4W9JA 2L7RA 4BFRA 5D7GA 3EECA 3CF6E 2C5LC 4AP4C 4EOYA 3MJWA 2DYBA 2XK5B 4CO7A 3Q3JA 2UYZB 2DZIA 1V9JA 4IG7B 3I3TB 2CS4A 4FULA 1WJNA 1WR6E 2KN5A 4WWOA 3QIJA 2IO3B 2MWSB 5CHFA 1E7VA 4DHJB 1WGYA 4MDKE 1KOTA 5AZGA 2MA9B 3ZTDA 2N9EB 3B08A 2KZRA 1WIAA 2KQ7A 2DYOA 3TCAA 4EZLA 2KFKA 4CHKA 3ZDMC 1OGWA 2ZNVB 2RD0A 2PE9A 2FNJB 3EHVA 4W9FA 1SGHA 2XEWA 2Z0DB 2KX0A 4BOZB 2J0JA 4TV3A 5D94A 2KD0A 4ZRIA 1J0GA 2AL3A 2BWFA 2JRIB 3ECIA 2JF5A 3P2BA 2L0FA 4II3B 4A20A 1Y8RC 3W1SA 2KQSA 1OTRB 3N32A 2ZPNA 3ZUNA 2KVRA 2MBHA 2KMCA 3MHSD 4DBGA 4OVUA 3T8MA 1J19A 1UGMA 3APCA 2ZCBA 3UGBB 1ZW7A 3JVZX 2ASQA 1P9DU 2JWZA 3OJ3A 3R7QA 3U30A 4MJSA 4E3CA 3BY4B 2O6VA 2K1FA 3N30A 4KSLC 4I6LB 1G6JA 3N3KB 3PLUA 2L0TA 4NY0A 4EFOA 3RZFA 4RM8A 4AOFA 2M0XA 2MBBB 3H1UA 5D2MB 1C1YB 2C7MB 4BKGA 3K9OB 4JQWC 5DPWA 4IW0A 2KOXA 4HWIB 2GOWA 3PPAA 3H7PA 3PRPB 2N9XA 1L2NA 3GOEA 5GMVA 3EFUA 5DPRA 2EMTA 4KIKB 3L16A 2ZCCA 1WRDB 4CYEA 3L08A 2KMAA 1HE8A 2KLCA 3NY5A 4ANWA 2DHZA 2JXXA 4MEMA 4ASWC 3RYTA 1YD8U 2LXCA 3L17A 4KVGB 4ICVA 4LJPB 2OOBB 2REXA 1LFDA 2KX3A 4G3XB 2MCNB 1FXTB 1WGDA 1YIWA 4PYUA 4AJWA 4FA6A 1IP9A 3PHWB 2W9NA 2IO0B 3TL5A 1UBQA 3QX1A 2G3QB 2GBKA 5JH5C 4GXBA 4HCNB 3UQBA 2LGXA 3VUXA 1ZKHA 3A4SC 2NCNA 2FIDA 1WX8A 2BPSA 2L3ZA 4KDIC 4PS3A 2CU1A 2G4SA 3AU5A 4KZCA 4JGHB 2ZEQA 2MBEA 5E6OA 2D3GA 5EDSA 4DXAB 4TUUA 5IA7A 1Q5WB 2KDEB 1U4AA 3QK0A 4HPLB 4MSMB 1V81A 2G4DB 2DENB 4WJNA 3PHXB 3PT2B 1LM8B 1YX5B 3H9DA 2KWUB 2KFKB 4G0NB 5J18A 3TMPB 3DQVA 2KO3A 3DPDA 4ZYNA 1KM7A 2K25A 1GC7A 3JW0X 1BT0A 2KHWB 3JYUA 4HJKA 4JIOU 4MGYE 1D3ZA 3DDCB 3X0WA 3NS8A 1GNUA 3KUCB 5C1ZA 2J0KA 4WJQA 5L95C 1Z2MA 2IY0B 4DHZE 4A3PA 4F8CB 2HTHA 1YX6B 4PYZA 4ZRKA 4IM3A 1V86A 2MW5A 3NZUA 4W9GA 2KJRA 3PTFC 3OJ4B 4OVVA 3ZRCA 4MM3A 4E74A 1PQSA 4BOSC 2V4LA 2NVUI 1AARA 2NS5A 3AULA 3WIMA 3ML9A 1KJTA 1SIFA 1E8ZA 2DYMA 3S2AA 2V1YA 1V5TA 2LWPA 4KSKC 2YVCA 1IPGA 1EF1A 3U7DA 4BKTA 2FIFA 4W9KA 3JSVB 4JLCA 3RT3B 4W9IA 1WI0A 1WGRA 1WMHB 2AWTA 4YL8A 2J7QB 4W9LA 4F1SA 3H7PB 1E7UA 4NJ7A 1WXVA 3PS6A 1XD3B 3VH4B 1IYFA 2A4ZA 2IO2B 1R4NI 4ZDVA 2YLMA 1OEYJ 2C7HA 4JL9A 1C3TA 2LVPA 4GOCA 3IBEA 3NHEB 4W9HA 3WA0A 3M95A 3ZNGC 3ZO5B 3A4RA 2M17A 1NBFC 1S3SG 3ONSA 2PE6B 2UWQA 2KWCA 4K7SA 3QARA 2JY6A 2HE7A 3DBRI 2VRRB 4XX5A 2JVCA 2JZZA 3AU4A 3ZLZA 3DBLI 1Q0WB 3PV1A 2LZ6A 3KUZA 2LGYA 4W9DA 2ZVOA 2L00B 3VH3B 4DDID 3A9KB 4GDLB 3A1QB 4IWOA 2AYOB 4HPMB 4K1RB 3O65B 1VCBA 5JHAA 2WDTB 1E8YA 3SDLC 2BYFA 5E6PA 1RFAA 3W1YA 4EEWA 2GBNA 2BKFA 2KC1A 3JSVA 4URKA 3ZNID 4LJOB 4F7ZA 1WMHA 3ZNZB 2D07B 4MSQB 1I42A 2K6DB 2WYQA 3HM3A 5HKHA 4IC7B 4PS8A 3QHTA 2D11A 3VTVA 3VUYA 1K8RB 3D32A 3VVWB 3L10B 4M8NA 2DAJA 2LVOA 3ZTCA 3MTNB 3UF8A 2NBVB 1WXAA 3CSFA 2KKCA 4IWQA 3RUIB 3VUWA 4LCDE 3VTWA 2RGFA 2RPQA 4MGZE 1WM2A 2N1VA 2CHWA 5DPTA 1WJ6A 2N1WA 2QHOA 2RSUA 2LVQA 3DVNV 3HM6X 2LRUA 4J6IA 2KWVB 2JT4B 2LASA 3R3MA 3B0AA 3OAWA 2PEAA 2GBJA 4HLEA 4MGKE 4WJOA 5IAAC 3L54A 3R66C 2B3AA 3ZIMA 3B1LX 2HJ8A 4XC2A 2LI5A 4FHKA 4BKSA 5L83A 1WXSA 1WF9A 1YQBA 4EUTA 2ZVNA 4MH0E 2JRHA 1P1AA 3TIXA 1UELA 4FJZA 5BO4B 3A9KA 4GDLA 3A1QA 4II2B 1YJ1A 4TQ1A 2BF8B 4XZ4A 1RAXA 3RD2A 1A5RA 3VXWA 1GG3A 2ZNVC 2I1KA 4X57B 2N7DA 4B9KA 2MX2A 2N7EA 3KYCD 1KLVA 1TZ1A 4NQLB 2FAZA 3L0WB 4GB9A 1F9JA 2DZKA 1WGGA 2K8BA 3ALBA 3U8ZA 2CHZA 2KDFB 3IVFA 4B95A 3H7SA 2NR2A 3GZNI 1GC6A 1NDDA 1V6EA 3UQAA 4DHZB 1GJZA 1WH3A 2ZJDA 3DVNU 2K8CA 2CR5A 1I35A 3RZWC 4GSWA 4EZJA 3WAOA 1NI2A 2LUEA 4G50A 4GDKA 4ZRJA 4HDQA 2KLGA 1WR1A 2BWES 2D10A 2MP2B 2V3SA 1V5OA 4PS7A 4K7WA 2Z59B 1WZ3A 4AJYB 3PREA 4BKSD 4ANXA 3SD5A 2L76A 3PGEA 4K7UA 2PJHA 3DVGY 2IZVB 1UZXB 2AEHA 2LRWA 4IM2A 3HK0A 4KV2A 5FR6A 3M63B 2KK8A 2R2OA 3WANA 3QQ8B 4DWFA 2M1MA 1L7YA 2KC2A 4B6WA 1QZEA 4M8MA 5AEKB 2DX5B 2M4NA 2ZPYA 3X23A 2KTRB 1RLFA 2KDBA 3AXCA 1E8WA 3AI5A 2BKRB 1H4RA 2KANA 3A9JB 4WJPA 2R2QA 4BBNC 4KZ0A 3KW5B 3QJZA 1H8CA 2K8HA 4BBNF 2JZ3B 3SHQA 1LXDA 2EMSA 3DBSA 1TBEA 2LD9A 4MELA 2C9WB 3KUDB 1OEYA 1VD2A 2CHXA 5AZHA 4BVUC 3ENEA 3WAPA 4NAWB 3ZW3A 2MSED 1J8CA 4FJVB 2DZJA 2XBBC 3H6NA 2Z0EB 2AL6A 2MBQA 3A33B 1WJUA 2C60A 4GU2A 5JHBA 1S1QB 4E71A 3DVGX 3T9LA 4RM9A 4I6PA 2LGDA 3R7RA 4GMVA 1OQYA 3QA8A 5TR5A 2WX0A 2NBUA 1E5WA 2IBIB 4IWPA 3ZKJC 1WJ4A 1RRBA 1WXMA 2KFJA 5KHQA 3CSTA 4TKNA 2DAFA 1WM3A 2JPHA 1SE9A 2MP2A 2L8JA 5DCNA 3QCAA 2DZMA 3V60A 1WZ0A 2K6QA 3UINB 1WYWB 5LXHA 2BGFA 4LDTD 4EKUA 2PPHA 3NOBA 2LXAA 1JRUA 3V6CB 3V6EB 1P3QU 2FUHB 1UBIA 4FHJA 4G11A 2BYEA 2IYDB 3W1SC 5D6JB 3WAMA 1Q1OA 3ZNHB 4WQOB 4ANUA 3PZDA 3ZDTA 2ZZPB 3K9PB 1TTNA 4HK2A 4K81A 3EC8A 2KTRA 1WGHA 3QC8B 4FLHA 5CHWA 3V62A 2FCSA 1TGZB 3VFKA 1P0RA 1ISNA 2Y5BB 2N4FA 4W9CA 1UH6A 1XT9B 5J2RA 3A9JA 2WX1A 2LJ5A 2IO1B 5CHVC 2XK5A 3VQIA 4AUQC 1WX9A 3ML8A 3ZVVA 3M62B 2KDIA 2JUOA 5AZFA 5G55A 4GDKB 3PRZA 4NPNA 4NQKE 4WWNA 3ZRFA 3NZSA 4IM0A 2A5UA 5E6NA 4FADA 2KJ6A 4GGQA 3IG3A 4NAWA 4W9EA 3OLMD 1E8XA 4IUMB 4NJ6A 3SU8X 4FJYA 5J17A 2G45B 4GIVA 2EKEC 4P7IA 1X1MA 2MLBA 4EZKA 2KNBA 1R4MI 4WAAA 4ICUA 4RMAA 4LDTB 2GBRA 2FCQA 3PLVA 2NPTB 4NNJB 2KTFA 2NBWB 2O2VB 3KYDD 5JZEB 3APDA 3V61A 3WALA 3LDZE 4TQ0A 2IY1B 2L05A 1Z5SB 2FCNA 3UIOB 3BINA 1EO6A 2BYVE 2I1JA 3PRMB 5DPSA 2D2QA 5CTRC 5C23A 3TJPA 1WFYA 4AWJA 4HVBA 4FBJB 1E90A 4HCPB 4HXDA 3HHMA 1V80A 5CX3A 1V2YA 1XQQA 1CMXB 1WY8A 1V49A 3CMMB 4DK5A 2C7NB 2KXJA 3C0RB 1UD7A 2O6VD 4FN2A 4N9F4 3IHPC 3APFA 3PSEB 3UIPB 4GN1A 4A3OA 3L13A 3PVLA 1WE6A 1P98A
chains in the Genus database with same CATH superfamily
3DOWA 2OJWA 2W54A 2KJHB 3RULA 3DCGA 1WE7A 5KHOA 1TT5B 3M3JA 1MG8A 5BYRA 1STEA 3ZJVA 2OJRA 4DHJD 4KDLB 2PVOD 3RCZA 1F77A 1WX7A 4RGOS 1EF5A 3AEEB 2O2VA 3DBHI 1M94A 4MGIE 4MJSB 2INCC 3TBLD 1F2RC 4I6NB 1SE3A 3FILB 1V97A 1PUTA 4EOYA 1AWDA 2MJEA 2WGSA 3RNEC 1WJNA 2KN5A 4WWOA 3QIJA 2MWSB 4MDKE 2N9EB 3B08A 2K9XA 2KZRA 1V8CA 3ZDMC 1OGWA 1MHHE 2N0SB 4RH6A 2AL3A 2BWFA 3AH7A 1C76A 2MBHA 1QLBB 2MHJA 3ZJUA 4EE2A 3JVZX 1T5XD 1PGXA 3U7ZA 3BY4B 4KSLC 1JMLA 2MBBB 3AMZA 4GLSC 2WXPA 4JQWC 3H7PA 2GB1A 1N60A 3RN9C 1GPXA 2N9XA 3TEXA 3GOEA 1WRDB 2KMAA 2EELA 2BB5A 3L17A 2INDC 4ICVA 2G1EA 1FNVA 4G3XB 4FA6A 2IO0B 3C8YA 3TL5A 3UQBA 2LGXA 2ZW1A 4KDIC 2BPSA 3AU5A 4KZCA 4JGHB 1HZ6A 2D3GA 1UGJA 4DXAB 1HQRD 1B1ZA 2WS3B 3RNGC 3URYA 4YXDB 2DENB 1I4HA 2QMTA 1F0ZA 5HFYA 3H9DA 1N63A 3P4RB 2KWDA 3TMPB 2WXKA 4HJKA 2KHWB 3B9JA 3DDCB 3NS8A 5C1ZA 4JWSC 3EUB2 3IAS1 4ZRKA 4A6QA 2MW5A 4OVZA 1KLUD 4S0RA 1E9MA 1F52A 4OVVA 4MM3A 4E74A 1N5XA 1PQSA 4XYCA 3E9SA 1AARA 3WIMA 2H89B 1SIFA 4KSKC 2BW2A 1EF1A 3ZGZA 3JSVB 4JLCA 4OZBA 4W9IA 2AWTA 4W9LA 3H7PB 1IUEA 4NJ7A 1JWBD 4MACA 3PS6A 1PYWD 1DOYA 2YLMA 1OEYJ 1D5MC 1Q10A 1PFDA 5D3DA 3TEWA 2JX5A 3IBEA 3NHEB 2Q5WD 1MG4A 1NBFC 1S3SG 2UWQA 4K7SA 2HE7A 2CJNA 5EE9A 2JZZA 3ZLZA 2J53A 3PV1A 4W9DA 1TZOA 3VH3B 4GDLB 4IWOA 2AYOB 1VCBA 2RDHA 1E0ZA 2BYFA 4KX6B 1RFAA 3NVWA 2KC1A 2ONQA 2WXNA 4LJOB 2WYQA 4IDIA 2D11A 3P1MA 1SB3C 4M8NA 2DAJA 1ACCA 3ZTCA 2NBVB 4ZHOA 2KKCA 1E10A 3RUIB 4MGZE 3AEBB 1WM2A 2CHWA 1WJ6A 4JE3B 2JYEA 3W5UB 2LRUA 2KWVB 2LASA 3SEBA 3OAWA 1C79A 4MGKE 3ZIMA 3B1LX 4XC2A 1TKEA 4BKSA 2WXMA 2ZVNA 2JRHA 3A9KA 3DBLB 2RDGA 4TQ1A 1YOVB 2BF8B 4XZ4A 4X57B 2NTTA 4NQLB 1QOGA 1N5WA 3H7SA 1E7PB 5G5HA 3GZNI 3UQAA 1WH3A 3DVNU 3HVZA 1K52A 4G50A 4ZRJA 4HDQA 2MP2B 3AE2B 1QF6A 2PJHA 3DVGY 3N1XC 4L2YA 1ZOYB 3KLSX 5FR6A 4ZYSA 4O1NA 2KC2A 4B6WA 1QZEA 4LLGM 2W3RA 2KTRB 2KDBA 1E8WA 4C4VA 2KANA 4WJPA 3W9CB 5G5GA 1XCQL 2QIEB 2IGDA 3MHZA 4OW0A 3VR8B 1LXDA 3GS2A 2C9WB 4N6EB 1VDVA 4BVUC 1FM0D 2LEKA 2MSED 2LMCA 2XBBC 2Z0EB 1WJUA 5JHBA 1S1QB 1SIJA 2BS2B 2NBUA 3Q8AA 4IWPA 1WJ4A 1JALA 1RRBA 4TKNA 1WM3A 3UINB 5LXHA 2IDYA 2BGFA 4EKUA 2PPHA 3ETRA 2LXAA 3U2SC 1JRUA 4M0WA 3V6CB 4FHJA 2IYDB 3E56A 2M19A 3PZDA 3Q3OC 3K9PB 1TTNA 3NJTA 1XLOA 1CK1A 2FCSA 2INPE 3VFKA 1UH6A 5J2RA 2WDRB 1I4XA 2G9HD 2WX1A 2LJ5A 1WX9A 3M62B 2Y5PA 4IM0A 4W9EA 1CZPA 3ZXRA 3OLMD 1QOAA 5J17A 4M02A 1X1MA 2MLBA 2KNBA 1XF5L 1FPYA 1TYGB 2FCQA 4NNJB 2BS3B 2KTFA 3MC0B 1C77A 2IY1B 3BINA 3MC8A 1Y56A 5DPSA 2ON8A 2HJ1A 3LYYA 4AWJA 1NI3A 1V80A 5CX3A 2X8XX 1WY8A 4KGSA 4US9A 2KXJA 3KWLA 1UD7A 3PSEB 3L13A 1XLPA 4HJGE 2W82A 4B0MA 3ZVVA 1P98A 4DXGA 1I4QA 4US8A 2J0MA 1KFYB 2MBOA 4WWPA 1ZDXA 1RWSA 3KVFB 1JCKB 2D3AA 1BUIC 4ANVA 2LHEA 3Q3FA 4KIKA 2WXIA 2CKHB 4M0WB 5G2NA 3LXFA 3VAWA 4ZOHC 2MRPA 4P1CC 2NPTA 1R4MB 3ZXVA 2JYTA 3VDZA 3IFWB 2L7RA 4BFRA 2C5LC 3MJWA 2JSVX 2DZIA 5IKCM 4IG7B 4FULA 2KACA 2IO3B 4AQ7A 1E7VA 1SF0A 1KOTA 2YEPB 1WIAA 2KQ7A 3GZNB 4S17A 4HPPA 2ZNVB 4YTNB 3EHVA 5FR3A 4W9FA 4L1BA 2KX0A 5AUKA 2J0JA 5D94A 1ROEA 4ZRIA 2JRIB 3P2BA 2JF5A 4M00A 4A20A 1Y8RC 3W1SA 2GLSA 2IGHA 3MHSD 4DBGA 1UGMA 2DBYA 3APCA 3UGBB 2DNFA 4MJSA 3U52E 3FILA 3N3KB 2L0TA 4EFOA 4ZRPA 4RM8A 2I2YA 2C7MB 4MT5A 1UNSA 2W3SA 3PPAA 3PRPB 2SEBD 4KIKB 1QOBA 2ZCCA 3DHHC 1YN4A 1HE8A 3NY5A 2DHZA 2JXXA 4WAFA 2XN9C 3RYTA 1YD8U 5EE0A 2LXCA 4N59A 2WU2B 2REXA 1LFDA 4DXFA 2KX3A 2MCNB 1IP9A 2VH2A 2KVZA 3PHWB 2PLPA 2G3QB 2JWUA 4RF1A 5HG2A 3VUXA 5EE1A 1WX8A 3C19A 4PS3A 2CU1A 2MBEA 4TUUA 2KDEB 1U4AA 3QK0A 1XEEA 2RPVA 4ZRQA 4MSMB 4WJNA 3PT2B 4YTMB 1LM8B 5J18A 3DPDA 2KO3A 3NVVA 3JYUA 3X0WA 1FRDA 4WJQA 2IY0B 4DHZE 2JXTA 4A3PA 4F8CB 4KGTA 1CJEA 4W9GA 2QDFA 3OJ4B 4BOSC 2V4LA 5I4DA 5BYSA 2NS5A 2DYMA 1V5TA 2LWPA 2YVCA 3RT3B 2QEJC 4RCOA 4YL8A 2J7QB 1WSPA 4RGMA 4F1SA 1E7UA 2PVGC 3BVZA 1TS2A 3T3NA 2A4ZA 4ZDVA 1SJED 5T8IA 3AEFB 1C3TA 4GOCA 1I4PA 4W9HA 3ZNGC 3Q8BA 2M17A 3ONSA 3GB1A 2JY6A 2BQQA 3KQ4A 5E6JA 2VRRB 3O13A 4HKZE 3DBLI 1Q0WB 2LZ6A 2LGYA 1SBBB 4XDCA 1FNUA 3RPFC 2WDTB 3Q6BA 1GB1A 2GBNA 2BKFA 3BVGA 3JSVA 4URKA 4XWTA 3ZNID 3BZDB 5IOIA 3HM3A 5HKHA 2WXLA 1C4CA 2LVOA 4YSXB 2V0GA 1YN5A 5C2TB 3NG0A 2RPQA 5MPOA 2VZKB 2N1WA 2JZPA 3DVNV 3B0AA 4WJOA 5IAAC 3R66C 2B3AA 5L83A 3HRDD 1WF9A 2D3BA 4EUTA 4MH0E 4GDLA 2VH1A 1YJ1A 1EWYC 3VRBB 1RAXA 3RD2A 2V4IB 1BXTA 1EWCA 1VZ7A 2N7EA 1FRRA 1DOIA 1TZ1A 3L0WB 2Y5CA 1T6BX 4A8XC 1F9JA 1JRPA 2K8BA 2KAJA 3ALBA 1QILA 3U8ZA 2KDFB 3IVFA 4B95A 3P4PB 1V6EA 2ZJDA 4PT5A 3TUOA 2CR5A 3NVYA 4RFBA 1M4VA 2LUEA 1T0RC 2BWES 2V3SA 4PS7A 4RGNA 3R8BA 4YSYB 4K7UA 1UZXB 2LRWA 4IM2A 4KV2A 1SJHD 2KK8A 3M63B 1L7YA 1AW7A 2E6XA 1D6EC 5AEKB 5BMHA 3AXCA 2R2QA 4BBNC 3AE5B 3SHQA 2WXHA 4MELA 2LD9A 3Q3NC 3AV8A 5AZHA 3ENEA 1PGBA 4XDDA 1VZ6A 1JWMD 3H6NA 3A33B 3BIID 4E71A 1MFWA 2LGDA 3R7RA 1IGDA 3BK1A 2QJLA 3QA8A 1TS5A 2WX0A 1E5WA 2KFJA 4K3CA 2MP2A 3ABVB 3QCAA 1ESFA 3KWVA 3MC9A 2DWQA 1KH0A 2L83A 4LDTD 5FKAC 1FNWA 3V6EB 1P3QU 1UBIA 3NUHB 3WAMA 1HZ5A 3EC8A 2KTRA 1WGHA 4FLHA 3AE3B 5CHWA 1C9FA 4TSSA 1P0RA 2N4FA 1FO4A 1B9RA 2IO1B 4AUQC 3ML8A 2WHIA 5G55A 4NPNA 4NQKE 3ZRFA 3RNAC 4IUMB 4FJYA 2KT7A 2G45B 4GIVA 3VR9B 5C3JB 1R4MI 1HA5A 4WAAA 4ICUA 4RMAA 3PLVA 2NBWB 3LDZE 4TQ0A 1Z5SB 2R61A 3V3XA 1GB4A 3PRMB 3TJPA 1DOXA 1WFYA 1QQRA 1WRIA 3C0RB 1N62A 4N9F4 1K53A 1WYGA 3Q2AC 2WU5B 3QWZB 1I4RA 2N9PC 1L6VA 2WWZA 1EUVB 4LNIA 3LJ3A 3VTUA 4KKIA 2Y3AA 1JWSD 5LXIB 1MJDA 3QAQA 1WXQA 1JWAD 5LLIA 1KRHA 2RR9A 5EE3A 1ENFA 1TS3A 1ZGUB 3DWGC 4N58A 3R2IA 3AE4B 2HD5B 2K39A 2RDBC 2IJ0A 2O6VB 4LK0M 1HEZE 2AQ2B 5D7GA 1IBXB 3EECA 4AP4C 4REZA 4JWUC 2GRIA 4CO7A 2BVCA 3I3TB 1K50A 4DHJB 1WGYA 1F2RI 5BMGA 5AZGA 3ZTDA 2BT6A 2M0AA 1DYQA 2DYOA 4LNNA 4CHKA 2K3UA 2FNJB 3GP7A 4KKJA 4TV3A 2KD0A 1J0GA 4HRSA 1KF6B 2L0FA 2LGIA 2AQ3B 2ZPNA 1UUPA 5IN7A 4WWMA 2ZCBA 3BVMA 1ZW7A 2ASQA 1P9DU 2JWZA 3R7QA 3U30A 2WXQA 4I6LB 2KYWA 1G6JA 4NY0A 3PLUA 3AEDB 3RZFA 4LTUA 4AOFA 2M0XA 3H1UA 5D2MB 3BK2A 4BKGA 3K9OB 4IW0A 1MPEA 2KOXA 4OZAA 1EM7A 2GOWA 4CQNA 4C80A 3GE3C 5GMVA 3EFUA 3L16A 3CIRB 4CYEA 3L08A 4ANWA 2KLCA 3ZQ4A 4MEMA 1JWUD 2AQ1B 4KVGB 1ET6A 4LJPB 2OOBB 2WXOA 3Q3MC 1TY0A 3I63C 1FXTB 4PYUA 1YIWA 4AJWA 2W9NA 4ZHPA 5JH5C 5BMIA 1ZKHA 3A4SC 2NCNA 2FIDA 2L3ZA 1KLGD 1SSNA 3IT6B 2ZEQA 5E6OA 4P16A 5EDSA 4HPLB 3BYYB 2H88B 2KWUB 1A70A 3DQVA 3JW0X 1BT0A 4MGYE 4JIOU 1T3QA 4LNOA 2KDMA 3KUCB 2J0KA 5L95C 2HTHA 1YX6B 4PYZA 4YT0B 4C7YA 2DLBA 3NZUA 1WWTA 1GAQB 3ZRCA 1PGAA 2J42A 2NVUI 1AN8A 3AULA 1MVKA 1KJTA 1E8ZA 1L0XB 3S2AA 2QC8A 1IPGA 1ZP0B 4M01A 4BKTA 4W9KA 1ZE3D 1WI0A 1L0VB 1AYFA 1WGRA 1WMHB 3MP9A 4WQMA 2WDVB 3OG5A 4XE0A 4FXCA 1XD3B 3VH4B 2IO2B 2C7HA 1VZ8A 2K0PA 1TS4A 2LVPA 3M95A 3ZO5B 3H8HA 1UWMA 2KWCA 4BAXA 2M56B 3PZ8A 3MJ5A 3AU4A 1SE2A 2OHFA 3KUZA 3T3OA 2L00B 4DDID 1T0SC 3A1QB 4HPMB 4K1RB 1E8YA 3W1YA 3RMKC 4F7ZA 1CQVA 3IXSA 3WCQA 4WIPA 3ZNZB 1QKZA 1I42A 3Q8FA 2K6DB 1NYRA 1K8RB 1GOZA 3MTNB 3UF8A 1WXAA 1F1HA 1ZXHA 3VUWA 3VTWA 1R4NB 2N1VA 2PIAA 5IO9A 1TIFA 4XWWA 1L6UA 5DPTA 2QHOA 3V05A 2MEKA 4J6IA 2JT4B 1OQRA 3R3MA 2GBJA 1XLNA 4HLEA 3L54A 1FFUA 3GE8C 4P6VF 3P4QB 1N61A 3DBRB 1YQBA 5BYQA 3TIXA 1P1AA 1UELA 1SXTA 2L52A 3OWEB 4FJZA 2WLBA 1N6ZA 3VXWA 2ZNVC 2LHDA 2I1KA 2N7DA 4B9KA 5IP4D 3KYCD 1KLVA 2FAZA 4GB9A 3AECB 3RI7C 2DZKA 1WGGA 1P7FA 1XLQA 2L32A 2W55A 2BS4B 1XCTL 2NR2A 1GC6A 1NDDA 1YQ3B 5HHDG 4DHZB 4WURA 2N7JA 3RZWC 4GSWA 3FAHA 3I57A 2LFIA 2KLGA 1WR1A 1V5OA 3MFGA 2Z59B 1WZ3A 3PZ7A 3EA6A 3PREA 4BKSD 1FCLA 4ANXA 3SD5A 3PGEA 2PW9A 1C78A 3HK0A 2WXGA 3WANA 2KQ4X 4DWFA 2R2OA 3QQ8B 4TMAB 1NVID 2DX5B 2M4NA 2ZPYA 1RLFA 2WP9B 4USAA 3FKYA 4NZLB 3A9JB 4KZ0A 1FIQA 3QJZA 2TSSA 1OQQA 1H8CA 3N20C 2K8HA 4BBNF 2NTSA 1TBEA 1VR9A 2CHXA 1J8CA 4NAWB 3ZW3A 2DZJA 3IAM1 4GU2A 1PDXA 4I6PA 1VLBA 4GMVA 1FXIA 5TR5A 2IBIB 1HTQA 1WXMA 3CSTA 4C56C 2DAFA 5DCNA 1YQ4B 1VRAB 2DZMA 2K5PA 1WZ0A 4LNFA 2K6QA 3V60A 1VJKA 2V3NA 4G11A 2BYEA 4ANUA 3W1SC 3ZNHB 4NJCA 4XGAB 2LJIA 4HK2A 2X38A 3QC8B 3BWUD 2KMMA 1ISNA 2Y5BB 4W9CA 1YN3A 1XT9B 5CHVC 2XK5A 3VQIA 2CJOA 2KDIA 5AZFA 3I5JC 3PRZA 2MJDA 4WWNA 3NZSA 4FADA 2A5UA 2K22A 4HROA 3R2TA 2KJ6A 4GGQA 4P1BC 4NJ6A 3SU8X 1RM6C 4RF0A 2EKEC 4BZAA 3EFCA 2O2VB 3FC4A 4QAYA 3APDA 3V61A 2FCNA 3Q8EA 4AS1A 1YJJA 5CTRC 5C23A 2WXJA 4D2KA 1RFKA 4HCPB 4B0EA 4ARCA 1XQQA 1FFVA 1V49A 4DK5A 1ZPSA 3APFA 3P42A 4OHJA 2Z8LA 1WE6A 2GBMA 4IKGA 4Q2JA 1GUAB 4HDOA 4K3BA 3CWIA 1V1OA 3ZJTA 2M8SA 1LGRA 2MQJA 1I4GA 4DDGD 3KH0A 1LQBA 3VHTC 1T0YA 2FCMA 3P63A 3HIZA 2WNMA 2GI9A 2WQYB 2GMIC 4W9JA 3CF6E 4PK1A 2DYBA 4UDUC 2XK5B 1P7EA 2PMVA 3Q3JA 2UYZB 1V9JA 3B2GA 2CS4A 1L4ZB 2FE8A 1I7HA 1WR6E 3N9YC 3EGRA 2UU7A 2FBWB 5CHFA 2MA9B 4HEA1 3TCAA 4EZLA 2KFKA 4NAMA 3AE8B 2RD0A 3W5VB 2PE9A 1SGHA 2XEWA 2Z0DB 1L0YB 4A9AA 2RMMA 4BOZB 3ECIA 4II3B 2FUG1 2KQSA 1OTRB 2CU3A 3N32A 3ZUNA 2I38A 2KVRA 2KMCA 2BBCA 4RNAA 4OVUA 1HTOA 3T8MA 1J19A 3OJ3A 3RFZB 4E3CA 2O6VA 2K1FA 3N30A 3DBHB 1IBXA 3IT4B 1RYJA 1C1YB 1J7BA 5DPWA 4HWIB 3Q69A 1L2NA 1FCCC 1TKGA 3TEYA 3NVZA 5DPRA 2EMTA 3AEGB 2D5GA 2ICIA 4ASWC 1R7SA 4MM3B 3Q8CA 4A55A 1WGDA 2BYTA 2SAKA 3AN1A 1MI0A 1UBQA 3QX1A 2GBKA 4GXBA 4HCNB 1SEBD 3SFDB 3Q14C 2G4SA 2WDQB 2QILA 5IA7A 3VRAB 1Q5WB 3RNBC 1V81A 2G4DB 3PHXB 1OFFA 1YX5B 3BYTB 2KFKB 1V1PA 4G0NB 5JXVA 2KN4A 1KM7A 2K25A 1GC7A 4ZYNA 5HI1A 1D3ZA 4C00A 1GNUA 2J4XA 1Z2MA 3NS1A 4IM3A 1V86A 3AEAB 1DGJA 5H92C 2KJRA 3PTFC 1TY2A 1YNTE 3ML9A 2QSDA 1YJIA 1ZUD2 2V1YA 3DHIC 3U7DA 2FIFA 4YWGG 1NEKB 1NYQA 2N9KA 1EU3A 1JW9D 1WXVA 1E6EB 1IYFA 1XXGA 1R4NI 3UI3A 4JL9A 3N1YC 1EU4A 3WA0A 4KGRA 3A4RA 2PE6B 3QARA 4DQOC 4LNKA 3DBRI 2BB6A 3I9V1 2EKIA 4WH4A 4XX5A 1L5PA 2JVCA 1LO5D 2VZKD 2HTME 2XNAC 2ZVOA 3P4SB 3A9KB 5JHAA 3O65B 5H8YE 3B2FA 3SDLC 3AE6B 5E6PA 4EEWA 4L23A 1V1PB 3W2DA 3L4PA 1WMHA 2D07B 1XO3A 4MSQB 4YSZB 4IC7B 4PS8A 5TSSA 2PKOA 3QHTA 3VTVA 3VUYA 3D32A 3VVWB 3L10B 1QOFA 3CSFA 4IWQA 4LCDE 3U4EG 2RGFA 2RSUA 2LVQA 1MHXA 3HM6X 1JQ4A 2J52A 2PEAA 5FK9C 3DHGC 2HJ8A 2LI5A 1UF0A 4FHKA 1WXSA 4C7ZA 1K51A 3HUIA 5BO4B 3A1QA 4II2B 4JPSA 1JROA 2YEPF 1A5RA 4C4VB 1GG3A 3J9CA 1J7AA 1SE4A 2MX2A 1J7CA 3TEZA 4A90A 2CHZA 1ZDVA 2QCZA 1KTKA 1GJZA 1NENB 4IOIE 2K8CA 1I35A 3AE7B 3AB5A 4EZJA 3WAOA 1NI2A 4GDKA 2D10A 2V3PA 1HXYD 3ZYYX 4RGTA 4K7WA 3NZ3A 5D3IB 4AJYB 2L76A 2L1AA 2IZVB 2AEHA 2M1MA 4ITKA 2AX5A 1D4BA 4M8MA 3X23A 3AM9A 1BMLC 3RNFC 3AI5A 2BKRB 1H4RA 1D5XC 2B76B 3KW5B 2IPKD 2JZ3B 2EMSA 4H2AA 3DBSA 4JX1C 1WGKA 3KUDB 1OEYA 1VD2A 4J3OD 1TJEA 3WAPA 4FJVB 2WXFA 2AL6A 2MBQA 2C60A 2V9HA 3DVGX 4RM9A 3T9LA 4ACFA 3AE1B 3PO0A 1OQYA 3SR6A 3ZKJC 5KHQA 2JPHA 1SE9A 2L8JA 2MJ3A 1TKYA 2D3CA 1YMHE 2IGGA 1WYWB 2INNE 1FXAA 2HDEA 3LB8C 3NOBA 4OZCA 2N9LA 1ET9A 2FUHB 2ACZB 5D6JB 1Q1OA 4WQOB 3ZDTA 2ZZPB 1L4DB 4K81A 2JU6X 3V62A 5GXGB 3RNCC 1TGZB 1UWXA 3A9JA 1ZXIA 4YTPB 4ARIA 2LGSA 2WXRA 1QT9A 2JUOA 1D5ZC 2JQRB 4GDKB 3AE9B 5E6NA 3TSSA 3DWMA 3IG3A 4NAWA 1E8XA 3N1ZC 4P7IA 4EZKA 3HVDA 2PTLA 1FMAD 5AUIA 4LDTB 2GBRA 2NPTB 3KYDD 5JZEB 1C4AA 1C4PA 2BTEA 3WALA 3SFEB 2L05A 2NMQA 4R3DA 3UIOB 2ZW0A 1EO6A 2BYVE 2I1JA 1IGCA 2D2QA 2E3TA 5LNK1 1T0QC 4HVBA 1FD6A 4FBJB 1E90A 4HXDA 3HHMA 1V2YA 1CMXB 2OEDA 3CMMB 2C7NB 1FEHA 2O6VD 4FN2A 4MH8A 3IHPC 3UIPB 4A3OA 4HKQA 4GN1A 3NRZA 2LUMA 3PVLA 2MH7A
chains in the Genus database with same CATH topology
3DOWA 2GBMA 3QWZB 2N9PC 1GUAB 4HDOA 2J0MA 3RULA 2KJHB 2MBOA 4WWPA 3DCGA 2M8SA 1WE7A 1EUVB 2WWZA 3LJ3A 5KHOA 3VTUA 3M3JA 3KVFB 1MG8A 2MQJA 2OJRA 4DHJD 5LXIB 4ANVA 4DDGD 4KDLB 3Q3FA 3QAQA 4KIKA 3RCZA 5LLIA 3KH0A 2RR9A 2CKHB 1WX7A 1LQBA 4M0WB 5G2NA 1ZGUB 3VAWA 3VHTC 1EF5A 2MRPA 1T0YA 2NPTA 2O2VA 2HD5B 2FCMA 3DBHI 3HIZA 2K39A 1M94A 4MGIE 3VDZA 4MJSB 3TBLD 2O6VB 4I6NB 2GMIC 3IFWB 4W9JA 2L7RA 4BFRA 5D7GA 3EECA 3CF6E 2C5LC 4AP4C 4EOYA 3MJWA 2DYBA 2XK5B 4CO7A 3Q3JA 2UYZB 2DZIA 1V9JA 4IG7B 3I3TB 2CS4A 4FULA 1WJNA 1WR6E 2KN5A 4WWOA 3QIJA 2IO3B 2MWSB 5CHFA 1E7VA 4DHJB 1WGYA 4MDKE 1KOTA 5AZGA 2MA9B 3ZTDA 2N9EB 3B08A 2KZRA 1WIAA 2KQ7A 2DYOA 3TCAA 4EZLA 2KFKA 4CHKA 3ZDMC 1OGWA 2ZNVB 2RD0A 2PE9A 2FNJB 3EHVA 4W9FA 1SGHA 2XEWA 2Z0DB 2KX0A 4BOZB 2J0JA 4TV3A 5D94A 2KD0A 4ZRIA 1J0GA 2AL3A 2BWFA 2JRIB 3ECIA 2JF5A 3P2BA 2L0FA 4II3B 4A20A 1Y8RC 3W1SA 2KQSA 1OTRB 3N32A 2ZPNA 3ZUNA 2KVRA 2MBHA 2KMCA 3MHSD 4DBGA 4OVUA 3T8MA 1J19A 1UGMA 3APCA 2ZCBA 3UGBB 1ZW7A 3JVZX 2ASQA 1P9DU 2JWZA 3OJ3A 3R7QA 3U30A 4MJSA 4E3CA 3BY4B 2O6VA 2K1FA 3N30A 4KSLC 4I6LB 1G6JA 3N3KB 3PLUA 2L0TA 4NY0A 4EFOA 3RZFA 4RM8A 4AOFA 2M0XA 2MBBB 3H1UA 5D2MB 1C1YB 2C7MB 4BKGA 3K9OB 4JQWC 5DPWA 4IW0A 2KOXA 4HWIB 2GOWA 3PPAA 3H7PA 3PRPB 2N9XA 1L2NA 3GOEA 5GMVA 3EFUA 5DPRA 2EMTA 4KIKB 3L16A 2ZCCA 1WRDB 4CYEA 3L08A 2KMAA 1HE8A 2KLCA 3NY5A 4ANWA 2DHZA 2JXXA 4MEMA 4ASWC 3RYTA 1YD8U 2LXCA 3L17A 4KVGB 4ICVA 4LJPB 2OOBB 2REXA 1LFDA 2KX3A 4G3XB 2MCNB 1FXTB 1WGDA 1YIWA 4PYUA 4AJWA 4FA6A 1IP9A 3PHWB 2W9NA 2IO0B 3TL5A 1UBQA 3QX1A 2G3QB 2GBKA 5JH5C 4GXBA 4HCNB 3UQBA 2LGXA 3VUXA 1ZKHA 3A4SC 2NCNA 2FIDA 1WX8A 2BPSA 2L3ZA 4KDIC 4PS3A 2CU1A 2G4SA 3AU5A 4KZCA 4JGHB 2ZEQA 2MBEA 5E6OA 2D3GA 5EDSA 4DXAB 4TUUA 5IA7A 1Q5WB 2KDEB 1U4AA 3QK0A 4HPLB 4MSMB 1V81A 2G4DB 2DENB 4WJNA 3PHXB 3PT2B 1LM8B 1YX5B 3H9DA 2KWUB 2KFKB 4G0NB 5J18A 3TMPB 3DQVA 2KO3A 3DPDA 4ZYNA 1KM7A 2K25A 1GC7A 3JW0X 1BT0A 2KHWB 3JYUA 4HJKA 4JIOU 4MGYE 1D3ZA 3DDCB 3X0WA 3NS8A 1GNUA 3KUCB 5C1ZA 2J0KA 4WJQA 5L95C 1Z2MA 2IY0B 4DHZE 4A3PA 4F8CB 2HTHA 1YX6B 4PYZA 4ZRKA 4IM3A 1V86A 2MW5A 3NZUA 4W9GA 2KJRA 3PTFC 3OJ4B 4OVVA 3ZRCA 4MM3A 4E74A 1PQSA 4BOSC 2V4LA 2NVUI 1AARA 2NS5A 3AULA 3WIMA 3ML9A 1KJTA 1SIFA 1E8ZA 2DYMA 3S2AA 2V1YA 1V5TA 2LWPA 4KSKC 2YVCA 1IPGA 1EF1A 3U7DA 4BKTA 2FIFA 4W9KA 3JSVB 4JLCA 3RT3B 4W9IA 1WI0A 1WGRA 1WMHB 2AWTA 4YL8A 2J7QB 4W9LA 4F1SA 3H7PB 1E7UA 4NJ7A 1WXVA 3PS6A 1XD3B 3VH4B 1IYFA 2A4ZA 2IO2B 1R4NI 4ZDVA 2YLMA 1OEYJ 2C7HA 4JL9A 1C3TA 2LVPA 4GOCA 3IBEA 3NHEB 4W9HA 3WA0A 3M95A 3ZNGC 3ZO5B 3A4RA 2M17A 1NBFC 1S3SG 3ONSA 2PE6B 2UWQA 2KWCA 4K7SA 3QARA 2JY6A 2HE7A 3DBRI 2VRRB 4XX5A 2JVCA 2JZZA 3AU4A 3ZLZA 3DBLI 1Q0WB 3PV1A 2LZ6A 3KUZA 2LGYA 4W9DA 2ZVOA 2L00B 3VH3B 4DDID 3A9KB 4GDLB 3A1QB 4IWOA 2AYOB 4HPMB 4K1RB 3O65B 1VCBA 5JHAA 2WDTB 1E8YA 3SDLC 2BYFA 5E6PA 1RFAA 3W1YA 4EEWA 2GBNA 2BKFA 2KC1A 3JSVA 4URKA 3ZNID 4LJOB 4F7ZA 1WMHA 3ZNZB 2D07B 4MSQB 1I42A 2K6DB 2WYQA 3HM3A 5HKHA 4IC7B 4PS8A 3QHTA 2D11A 3VTVA 3VUYA 1K8RB 3D32A 3VVWB 3L10B 4M8NA 2DAJA 2LVOA 3ZTCA 3MTNB 3UF8A 2NBVB 1WXAA 3CSFA 2KKCA 4IWQA 3RUIB 3VUWA 4LCDE 3VTWA 2RGFA 2RPQA 4MGZE 1WM2A 2N1VA 2CHWA 5DPTA 1WJ6A 2N1WA 2QHOA 2RSUA 2LVQA 3DVNV 3HM6X 2LRUA 4J6IA 2KWVB 2JT4B 2LASA 3R3MA 3B0AA 3OAWA 2PEAA 2GBJA 4HLEA 4MGKE 4WJOA 5IAAC 3L54A 3R66C 2B3AA 3ZIMA 3B1LX 2HJ8A 4XC2A 2LI5A 4FHKA 4BKSA 5L83A 1WXSA 1WF9A 1YQBA 4EUTA 2ZVNA 4MH0E 2JRHA 1P1AA 3TIXA 1UELA 4FJZA 5BO4B 3A9KA 4GDLA 3A1QA 4II2B 1YJ1A 4TQ1A 2BF8B 4XZ4A 1RAXA 3RD2A 1A5RA 3VXWA 1GG3A 2ZNVC 2I1KA 4X57B 2N7DA 4B9KA 2MX2A 2N7EA 3KYCD 1KLVA 1TZ1A 4NQLB 2FAZA 3L0WB 4GB9A 1F9JA 2DZKA 1WGGA 2K8BA 3ALBA 3U8ZA 2CHZA 2KDFB 3IVFA 4B95A 3H7SA 2NR2A 3GZNI 1GC6A 1NDDA 1V6EA 3UQAA 4DHZB 1GJZA 1WH3A 2ZJDA 3DVNU 2K8CA 2CR5A 1I35A 3RZWC 4GSWA 4EZJA 3WAOA 1NI2A 2LUEA 4G50A 4GDKA 4ZRJA 4HDQA 2KLGA 1WR1A 2BWES 2D10A 2MP2B 2V3SA 1V5OA 4PS7A 4K7WA 2Z59B 1WZ3A 4AJYB 3PREA 4BKSD 4ANXA 3SD5A 2L76A 3PGEA 4K7UA 2PJHA 3DVGY 2IZVB 1UZXB 2AEHA 2LRWA 4IM2A 3HK0A 4KV2A 5FR6A 3M63B 2KK8A 2R2OA 3WANA 3QQ8B 4DWFA 2M1MA 1L7YA 2KC2A 4B6WA 1QZEA 4M8MA 5AEKB 2DX5B 2M4NA 2ZPYA 3X23A 2KTRB 1RLFA 2KDBA 3AXCA 1E8WA 3AI5A 2BKRB 1H4RA 2KANA 3A9JB 4WJPA 2R2QA 4BBNC 4KZ0A 3KW5B 3QJZA 1H8CA 2K8HA 4BBNF 2JZ3B 3SHQA 1LXDA 2EMSA 3DBSA 1TBEA 2LD9A 4MELA 2C9WB 3KUDB 1OEYA 1VD2A 2CHXA 5AZHA 4BVUC 3ENEA 3WAPA 4NAWB 3ZW3A 2MSED 1J8CA 4FJVB 2DZJA 2XBBC 3H6NA 2Z0EB 2AL6A 2MBQA 3A33B 1WJUA 2C60A 4GU2A 5JHBA 1S1QB 4E71A 3DVGX 3T9LA 4RM9A 4I6PA 2LGDA 3R7RA 4GMVA 1OQYA 3QA8A 5TR5A 2WX0A 2NBUA 1E5WA 2IBIB 4IWPA 3ZKJC 1WJ4A 1RRBA 1WXMA 2KFJA 5KHQA 3CSTA 4TKNA 2DAFA 1WM3A 2JPHA 1SE9A 2MP2A 2L8JA 5DCNA 3QCAA 2DZMA 3V60A 1WZ0A 2K6QA 3UINB 1WYWB 5LXHA 2BGFA 4LDTD 4EKUA 2PPHA 3NOBA 2LXAA 1JRUA 3V6CB 3V6EB 1P3QU 2FUHB 1UBIA 4FHJA 4G11A 2BYEA 2IYDB 3W1SC 5D6JB 3WAMA 1Q1OA 3ZNHB 4WQOB 4ANUA 3PZDA 3ZDTA 2ZZPB 3K9PB 1TTNA 4HK2A 4K81A 3EC8A 2KTRA 1WGHA 3QC8B 4FLHA 5CHWA 3V62A 2FCSA 1TGZB 3VFKA 1P0RA 1ISNA 2Y5BB 2N4FA 4W9CA 1UH6A 1XT9B 5J2RA 3A9JA 2WX1A 2LJ5A 2IO1B 5CHVC 2XK5A 3VQIA 4AUQC 1WX9A 3ML8A 3ZVVA 3M62B 2KDIA 2JUOA 5AZFA 5G55A 4GDKB 3PRZA 4NPNA 4NQKE 4WWNA 3ZRFA 3NZSA 4IM0A 2A5UA 5E6NA 4FADA 2KJ6A 4GGQA 3IG3A 4NAWA 4W9EA 3OLMD 1E8XA 4IUMB 4NJ6A 3SU8X 4FJYA 5J17A 2G45B 4GIVA 2EKEC 4P7IA 1X1MA 2MLBA 4EZKA 2KNBA 1R4MI 4WAAA 4ICUA 4RMAA 4LDTB 2GBRA 2FCQA 3PLVA 2NPTB 4NNJB 2KTFA 2NBWB 2O2VB 3KYDD 5JZEB 3APDA 3V61A 3WALA 3LDZE 4TQ0A 2IY1B 2L05A 1Z5SB 2FCNA 3UIOB 3BINA 1EO6A 2BYVE 2I1JA 3PRMB 5DPSA 2D2QA 5CTRC 5C23A 3TJPA 1WFYA 4AWJA 4HVBA 4FBJB 1E90A 4HCPB 4HXDA 3HHMA 1V80A 5CX3A 1V2YA 1XQQA 1CMXB 1WY8A 1V49A 3CMMB 4DK5A 2C7NB 2KXJA 3C0RB 1UD7A 2O6VD 4FN2A 4N9F4 3IHPC 3APFA 3PSEB 3UIPB 4GN1A 4A3OA 3L13A 3PVLA 1WE6A 1P98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOW A;  2GBM A;  3QWZ B;  2N9P C;  1GUA B;  4HDO A;  2J0M A;  3RUL A;  2KJH B;  2MBO A;  4WWP A;  3DCG A;  2M8S A;  1WE7 A;  1EUV B;  2WWZ A;  3LJ3 A;  5KHO A;  3VTU A;  3M3J A;  3KVF B;  1MG8 A;  2MQJ A;  2OJR A;  4DHJ D;  5LXI B;  4ANV A;  4DDG D;  4KDL B;  3Q3F A;  3QAQ A;  4KIK A;  3RCZ A;  5LLI A;  3KH0 A;  2RR9 A;  2CKH B;  1WX7 A;  1LQB A;  4M0W B;  5G2N A;  1ZGU B;  3VAW A;  3VHT C;  1EF5 A;  2MRP A;  1T0Y A;  2NPT A;  2O2V A;  2HD5 B;  2FCM A;  3DBH I;  3HIZ A;  2K39 A;  1M94 A;  4MGI E;  3VDZ A;  4MJS B;  3TBL D;  2O6V B;  4I6N B;  2GMI C;  3IFW B;  4W9J A;  2L7R A;  4BFR A;  5D7G A;  3EEC A;  3CF6 E;  2C5L C;  4AP4 C;  4EOY A;  3MJW A;  2DYB A;  2XK5 B;  4CO7 A;  3Q3J A;  2UYZ B;  2DZI A;  1V9J A;  4IG7 B;  3I3T B;  2CS4 A;  4FUL A;  1WJN A;  1WR6 E;  2KN5 A;  4WWO A;  3QIJ A;  2IO3 B;  2MWS B;  5CHF A;  1E7V A;  4DHJ B;  1WGY A;  4MDK E;  1KOT A;  5AZG A;  2MA9 B;  3ZTD A;  2N9E B;  3B08 A;  2KZR A;  1WIA A;  2KQ7 A;  2DYO A;  3TCA A;  4EZL A;  2KFK A;  4CHK A;  3ZDM C;  1OGW A;  2ZNV B;  2RD0 A;  2PE9 A;  2FNJ B;  3EHV A;  4W9F A;  1SGH A;  2XEW A;  2Z0D B;  2KX0 A;  4BOZ B;  2J0J A;  4TV3 A;  5D94 A;  2KD0 A;  4ZRI A;  1J0G A;  2AL3 A;  2BWF A;  2JRI B;  3ECI A;  2JF5 A;  3P2B A;  2L0F A;  4II3 B;  4A20 A;  1Y8R C;  3W1S A;  2KQS A;  1OTR B;  3N32 A;  2ZPN A;  3ZUN A;  2KVR A;  2MBH A;  2KMC A;  3MHS D;  4DBG A;  4OVU A;  3T8M A;  1J19 A;  1UGM A;  3APC A;  2ZCB A;  3UGB B;  1ZW7 A;  3JVZ X;  2ASQ A;  1P9D U;  2JWZ A;  3OJ3 A;  3R7Q A;  3U30 A;  4MJS A;  4E3C A;  3BY4 B;  2O6V A;  2K1F A;  3N30 A;  4KSL C;  4I6L B;  1G6J A;  3N3K B;  3PLU A;  2L0T A;  4NY0 A;  4EFO A;  3RZF A;  4RM8 A;  4AOF A;  2M0X A;  2MBB B;  3H1U A;  5D2M B;  1C1Y B;  2C7M B;  4BKG A;  3K9O B;  4JQW C;  5DPW A;  4IW0 A;  2KOX A;  4HWI B;  2GOW A;  3PPA A;  3H7P A;  3PRP B;  2N9X A;  1L2N A;  3GOE A;  5GMV A;  3EFU A;  5DPR A;  2EMT A;  4KIK B;  3L16 A;  2ZCC A;  1WRD B;  4CYE A;  3L08 A;  2KMA A;  1HE8 A;  2KLC A;  3NY5 A;  4ANW A;  2DHZ A;  2JXX A;  4MEM A;  4ASW C;  3RYT A;  1YD8 U;  2LXC A;  3L17 A;  4KVG B;  4ICV A;  4LJP B;  2OOB B;  2REX A;  1LFD A;  2KX3 A;  4G3X B;  2MCN B;  1FXT B;  1WGD A;  1YIW A;  4PYU A;  4AJW A;  4FA6 A;  1IP9 A;  3PHW B;  2W9N A;  2IO0 B;  3TL5 A;  1UBQ A;  3QX1 A;  2G3Q B;  2GBK A;  5JH5 C;  4GXB A;  4HCN B;  3UQB A;  2LGX A;  3VUX A;  1ZKH A;  3A4S C;  2NCN A;  2FID A;  1WX8 A;  2BPS A;  2L3Z A;  4KDI C;  4PS3 A;  2CU1 A;  2G4S A;  3AU5 A;  4KZC A;  4JGH B;  2ZEQ A;  2MBE A;  5E6O A;  2D3G A;  5EDS A;  4DXA B;  4TUU A;  5IA7 A;  1Q5W B;  2KDE B;  1U4A A;  3QK0 A;  4HPL B;  4MSM B;  1V81 A;  2G4D B;  2DEN B;  4WJN A;  3PHX B;  3PT2 B;  1LM8 B;  1YX5 B;  3H9D A;  2KWU B;  2KFK B;  4G0N B;  5J18 A;  3TMP B;  3DQV A;  2KO3 A;  3DPD A;  4ZYN A;  1KM7 A;  2K25 A;  1GC7 A;  3JW0 X;  1BT0 A;  2KHW B;  3JYU A;  4HJK A;  4JIO U;  4MGY E;  1D3Z A;  3DDC B;  3X0W A;  3NS8 A;  1GNU A;  3KUC B;  5C1Z A;  2J0K A;  4WJQ A;  5L95 C;  1Z2M A;  2IY0 B;  4DHZ E;  4A3P A;  4F8C B;  2HTH A;  1YX6 B;  4PYZ A;  4ZRK A;  4IM3 A;  1V86 A;  2MW5 A;  3NZU A;  4W9G A;  2KJR A;  3PTF C;  3OJ4 B;  4OVV A;  3ZRC A;  4MM3 A;  4E74 A;  1PQS A;  4BOS C;  2V4L A;  2NVU I;  1AAR A;  2NS5 A;  3AUL A;  3WIM A;  3ML9 A;  1KJT A;  1SIF A;  1E8Z A;  2DYM A;  3S2A A;  2V1Y A;  1V5T A;  2LWP A;  4KSK C;  2YVC A;  1IPG A;  1EF1 A;  3U7D A;  4BKT A;  2FIF A;  4W9K A;  3JSV B;  4JLC A;  3RT3 B;  4W9I A;  1WI0 A;  1WGR A;  1WMH B;  2AWT A;  4YL8 A;  2J7Q B;  4W9L A;  4F1S A;  3H7P B;  1E7U A;  4NJ7 A;  1WXV A;  3PS6 A;  1XD3 B;  3VH4 B;  1IYF A;  2A4Z A;  2IO2 B;  1R4N I;  4ZDV A;  2YLM A;  1OEY J;  2C7H A;  4JL9 A;  1C3T A;  2LVP A;  4GOC A;  3IBE A;  3NHE B;  4W9H A;  3WA0 A;  3M95 A;  3ZNG C;  3ZO5 B;  3A4R A;  2M17 A;  1NBF C;  1S3S G;  3ONS A;  2PE6 B;  2UWQ A;  2KWC A;  4K7S A;  3QAR A;  2JY6 A;  2HE7 A;  3DBR I;  2VRR B;  4XX5 A;  2JVC A;  2JZZ A;  3AU4 A;  3ZLZ A;  3DBL I;  1Q0W B;  3PV1 A;  2LZ6 A;  3KUZ A;  2LGY A;  4W9D A;  2ZVO A;  2L00 B;  3VH3 B;  4DDI D;  3A9K B;  4GDL B;  3A1Q B;  4IWO A;  2AYO B;  4HPM B;  4K1R B;  3O65 B;  1VCB A;  5JHA A;  2WDT B;  1E8Y A;  3SDL C;  2BYF A;  5E6P A;  1RFA A;  3W1Y A;  4EEW A;  2GBN A;  2BKF A;  2KC1 A;  3JSV A;  4URK A;  3ZNI D;  4LJO B;  4F7Z A;  1WMH A;  3ZNZ B;  2D07 B;  4MSQ B;  1I42 A;  2K6D B;  2WYQ A;  3HM3 A;  5HKH A;  4IC7 B;  4PS8 A;  3QHT A;  2D11 A;  3VTV A;  3VUY A;  1K8R B;  3D32 A;  3VVW B;  3L10 B;  4M8N A;  2DAJ A;  2LVO A;  3ZTC A;  3MTN B;  3UF8 A;  2NBV B;  1WXA A;  3CSF A;  2KKC A;  4IWQ A;  3RUI B;  3VUW A;  4LCD E;  3VTW A;  2RGF A;  2RPQ A;  4MGZ E;  1WM2 A;  2N1V A;  2CHW A;  5DPT A;  1WJ6 A;  2N1W A;  2QHO A;  2RSU A;  2LVQ A;  3DVN V;  3HM6 X;  2LRU A;  4J6I A;  2KWV B;  2JT4 B;  2LAS A;  3R3M A;  3B0A A;  3OAW A;  2PEA A;  2GBJ A;  4HLE A;  4MGK E;  4WJO A;  5IAA C;  3L54 A;  3R66 C;  2B3A A;  3ZIM A;  3B1L X;  2HJ8 A;  4XC2 A;  2LI5 A;  4FHK A;  4BKS A;  5L83 A;  1WXS A;  1WF9 A;  1YQB A;  4EUT A;  2ZVN A;  4MH0 E;  2JRH A;  1P1A A;  3TIX A;  1UEL A;  4FJZ A;  5BO4 B;  3A9K A;  4GDL A;  3A1Q A;  4II2 B;  1YJ1 A;  4TQ1 A;  2BF8 B;  4XZ4 A;  1RAX A;  3RD2 A;  1A5R A;  3VXW A;  1GG3 A;  2ZNV C;  2I1K A;  4X57 B;  2N7D A;  4B9K A;  2MX2 A;  2N7E A;  3KYC D;  1KLV A;  1TZ1 A;  4NQL B;  2FAZ A;  3L0W B;  4GB9 A;  1F9J A;  2DZK A;  1WGG A;  2K8B A;  3ALB A;  3U8Z A;  2CHZ A;  2KDF B;  3IVF A;  4B95 A;  3H7S A;  2NR2 A;  3GZN I;  1GC6 A;  1NDD A;  1V6E A;  3UQA A;  4DHZ B;  1GJZ A;  1WH3 A;  2ZJD A;  3DVN U;  2K8C A;  2CR5 A;  1I35 A;  3RZW C;  4GSW A;  4EZJ A;  3WAO A;  1NI2 A;  2LUE A;  4G50 A;  4GDK A;  4ZRJ A;  4HDQ A;  2KLG A;  1WR1 A;  2BWE S;  2D10 A;  2MP2 B;  2V3S A;  1V5O A;  4PS7 A;  4K7W A;  2Z59 B;  1WZ3 A;  4AJY B;  3PRE A;  4BKS D;  4ANX A;  3SD5 A;  2L76 A;  3PGE A;  4K7U A;  2PJH A;  3DVG Y;  2IZV B;  1UZX B;  2AEH A;  2LRW A;  4IM2 A;  3HK0 A;  4KV2 A;  5FR6 A;  3M63 B;  2KK8 A;  2R2O A;  3WAN A;  3QQ8 B;  4DWF A;  2M1M A;  1L7Y A;  2KC2 A;  4B6W A;  1QZE A;  4M8M A;  5AEK B;  2DX5 B;  2M4N A;  2ZPY A;  3X23 A;  2KTR B;  1RLF A;  2KDB A;  3AXC A;  1E8W A;  3AI5 A;  2BKR B;  1H4R A;  2KAN A;  3A9J B;  4WJP A;  2R2Q A;  4BBN C;  4KZ0 A;  3KW5 B;  3QJZ A;  1H8C A;  2K8H A;  4BBN F;  2JZ3 B;  3SHQ A;  1LXD A;  2EMS A;  3DBS A;  1TBE A;  2LD9 A;  4MEL A;  2C9W B;  3KUD B;  1OEY A;  1VD2 A;  2CHX A;  5AZH A;  4BVU C;  3ENE A;  3WAP A;  4NAW B;  3ZW3 A;  2MSE D;  1J8C A;  4FJV B;  2DZJ A;  2XBB C;  3H6N A;  2Z0E B;  2AL6 A;  2MBQ A;  3A33 B;  1WJU A;  2C60 A;  4GU2 A;  5JHB A;  1S1Q B;  4E71 A;  3DVG X;  3T9L A;  4RM9 A;  4I6P A;  2LGD A;  3R7R A;  4GMV A;  1OQY A;  3QA8 A;  5TR5 A;  2WX0 A;  2NBU A;  1E5W A;  2IBI B;  4IWP A;  3ZKJ C;  1WJ4 A;  1RRB A;  1WXM A;  2KFJ A;  5KHQ A;  3CST A;  4TKN A;  2DAF A;  1WM3 A;  2JPH A;  1SE9 A;  2MP2 A;  2L8J A;  5DCN A;  3QCA A;  2DZM A;  3V60 A;  1WZ0 A;  2K6Q A;  3UIN B;  1WYW B;  5LXH A;  2BGF A;  4LDT D;  4EKU A;  2PPH A;  3NOB A;  2LXA A;  1JRU A;  3V6C B;  3V6E B;  1P3Q U;  2FUH B;  1UBI A;  4FHJ A;  4G11 A;  2BYE A;  2IYD B;  3W1S C;  5D6J B;  3WAM A;  1Q1O A;  3ZNH B;  4WQO B;  4ANU A;  3PZD A;  3ZDT A;  2ZZP B;  3K9P B;  1TTN A;  4HK2 A;  4K81 A;  3EC8 A;  2KTR A;  1WGH A;  3QC8 B;  4FLH A;  5CHW A;  3V62 A;  2FCS A;  1TGZ B;  3VFK A;  1P0R A;  1ISN A;  2Y5B B;  2N4F A;  4W9C A;  1UH6 A;  1XT9 B;  5J2R A;  3A9J A;  2WX1 A;  2LJ5 A;  2IO1 B;  5CHV C;  2XK5 A;  3VQI A;  4AUQ C;  1WX9 A;  3ML8 A;  3ZVV A;  3M62 B;  2KDI A;  2JUO A;  5AZF A;  5G55 A;  4GDK B;  3PRZ A;  4NPN A;  4NQK E;  4WWN A;  3ZRF A;  3NZS A;  4IM0 A;  2A5U A;  5E6N A;  4FAD A;  2KJ6 A;  4GGQ A;  3IG3 A;  4NAW A;  4W9E A;  3OLM D;  1E8X A;  4IUM B;  4NJ6 A;  3SU8 X;  4FJY A;  5J17 A;  2G45 B;  4GIV A;  2EKE C;  4P7I A;  1X1M A;  2MLB A;  4EZK A;  2KNB A;  1R4M I;  4WAA A;  4ICU A;  4RMA A;  4LDT B;  2GBR A;  2FCQ A;  3PLV A;  2NPT B;  4NNJ B;  2KTF A;  2NBW B;  2O2V B;  3KYD D;  5JZE B;  3APD A;  3V61 A;  3WAL A;  3LDZ E;  4TQ0 A;  2IY1 B;  2L05 A;  1Z5S B;  2FCN A;  3UIO B;  3BIN A;  1EO6 A;  2BYV E;  2I1J A;  3PRM B;  5DPS A;  2D2Q A;  5CTR C;  5C23 A;  3TJP A;  1WFY A;  4AWJ A;  4HVB A;  4FBJ B;  1E90 A;  4HCP B;  4HXD A;  3HHM A;  1V80 A;  5CX3 A;  1V2Y A;  1XQQ A;  1CMX B;  1WY8 A;  1V49 A;  3CMM B;  4DK5 A;  2C7N B;  2KXJ A;  3C0R B;  1UD7 A;  2O6V D;  4FN2 A;  4N9F 4;  3IHP C;  3APF A;  3PSE B;  3UIP B;  4GN1 A;  4A3O A;  3L13 A;  3PVL A;  1WE6 A;  1P98 A; 
#chains in the Genus database with same CATH topology
 3DOW A;  2OJW A;  2W54 A;  2KJH B;  3RUL A;  3DCG A;  1WE7 A;  5KHO A;  1TT5 B;  3M3J A;  1MG8 A;  5BYR A;  1STE A;  3ZJV A;  2OJR A;  4DHJ D;  4KDL B;  2PVO D;  3RCZ A;  1F77 A;  1WX7 A;  4RGO S;  1EF5 A;  3AEE B;  2O2V A;  3DBH I;  1M94 A;  4MGI E;  4MJS B;  2INC C;  3TBL D;  1F2R C;  4I6N B;  1SE3 A;  3FIL B;  1V97 A;  1PUT A;  4EOY A;  1AWD A;  2MJE A;  2WGS A;  3RNE C;  1WJN A;  2KN5 A;  4WWO A;  3QIJ A;  2MWS B;  4MDK E;  2N9E B;  3B08 A;  2K9X A;  2KZR A;  1V8C A;  3ZDM C;  1OGW A;  1MHH E;  2N0S B;  4RH6 A;  2AL3 A;  2BWF A;  3AH7 A;  1C76 A;  2MBH A;  1QLB B;  2MHJ A;  3ZJU A;  4EE2 A;  3JVZ X;  1T5X D;  1PGX A;  3U7Z A;  3BY4 B;  4KSL C;  1JML A;  2MBB B;  3AMZ A;  4GLS C;  2WXP A;  4JQW C;  3H7P A;  2GB1 A;  1N60 A;  3RN9 C;  1GPX A;  2N9X A;  3TEX A;  3GOE A;  1WRD B;  2KMA A;  2EEL A;  2BB5 A;  3L17 A;  2IND C;  4ICV A;  2G1E A;  1FNV A;  4G3X B;  4FA6 A;  2IO0 B;  3C8Y A;  3TL5 A;  3UQB A;  2LGX A;  2ZW1 A;  4KDI C;  2BPS A;  3AU5 A;  4KZC A;  4JGH B;  1HZ6 A;  2D3G A;  1UGJ A;  4DXA B;  1HQR D;  1B1Z A;  2WS3 B;  3RNG C;  3URY A;  4YXD B;  2DEN B;  1I4H A;  2QMT A;  1F0Z A;  5HFY A;  3H9D A;  1N63 A;  3P4R B;  2KWD A;  3TMP B;  2WXK A;  4HJK A;  2KHW B;  3B9J A;  3DDC B;  3NS8 A;  5C1Z A;  4JWS C;  3EUB 2;  3IAS 1;  4ZRK A;  4A6Q A;  2MW5 A;  4OVZ A;  1KLU D;  4S0R A;  1E9M A;  1F52 A;  4OVV A;  4MM3 A;  4E74 A;  1N5X A;  1PQS A;  4XYC A;  3E9S A;  1AAR A;  3WIM A;  2H89 B;  1SIF A;  4KSK C;  2BW2 A;  1EF1 A;  3ZGZ A;  3JSV B;  4JLC A;  4OZB A;  4W9I A;  2AWT A;  4W9L A;  3H7P B;  1IUE A;  4NJ7 A;  1JWB D;  4MAC A;  3PS6 A;  1PYW D;  1DOY A;  2YLM A;  1OEY J;  1D5M C;  1Q10 A;  1PFD A;  5D3D A;  3TEW A;  2JX5 A;  3IBE A;  3NHE B;  2Q5W D;  1MG4 A;  1NBF C;  1S3S G;  2UWQ A;  4K7S A;  2HE7 A;  2CJN A;  5EE9 A;  2JZZ A;  3ZLZ A;  2J53 A;  3PV1 A;  4W9D A;  1TZO A;  3VH3 B;  4GDL B;  4IWO A;  2AYO B;  1VCB A;  2RDH A;  1E0Z A;  2BYF A;  4KX6 B;  1RFA A;  3NVW A;  2KC1 A;  2ONQ A;  2WXN A;  4LJO B;  2WYQ A;  4IDI A;  2D11 A;  3P1M A;  1SB3 C;  4M8N A;  2DAJ A;  1ACC A;  3ZTC A;  2NBV B;  4ZHO A;  2KKC A;  1E10 A;  3RUI B;  4MGZ E;  3AEB B;  1WM2 A;  2CHW A;  1WJ6 A;  4JE3 B;  2JYE A;  3W5U B;  2LRU A;  2KWV B;  2LAS A;  3SEB A;  3OAW A;  1C79 A;  4MGK E;  3ZIM A;  3B1L X;  4XC2 A;  1TKE A;  4BKS A;  2WXM A;  2ZVN A;  2JRH A;  3A9K A;  3DBL B;  2RDG A;  4TQ1 A;  1YOV B;  2BF8 B;  4XZ4 A;  4X57 B;  2NTT A;  4NQL B;  1QOG A;  1N5W A;  3H7S A;  1E7P B;  5G5H A;  3GZN I;  3UQA A;  1WH3 A;  3DVN U;  3HVZ A;  1K52 A;  4G50 A;  4ZRJ A;  4HDQ A;  2MP2 B;  3AE2 B;  1QF6 A;  2PJH A;  3DVG Y;  3N1X C;  4L2Y A;  1ZOY B;  3KLS X;  5FR6 A;  4ZYS A;  4O1N A;  2KC2 A;  4B6W A;  1QZE A;  4LLG M;  2W3R A;  2KTR B;  2KDB A;  1E8W A;  4C4V A;  2KAN A;  4WJP A;  3W9C B;  5G5G A;  1XCQ L;  2QIE B;  2IGD A;  3MHZ A;  4OW0 A;  3VR8 B;  1LXD A;  3GS2 A;  2C9W B;  4N6E B;  1VDV A;  4BVU C;  1FM0 D;  2LEK A;  2MSE D;  2LMC A;  2XBB C;  2Z0E B;  1WJU A;  5JHB A;  1S1Q B;  1SIJ A;  2BS2 B;  2NBU A;  3Q8A A;  4IWP A;  1WJ4 A;  1JAL A;  1RRB A;  4TKN A;  1WM3 A;  3UIN B;  5LXH A;  2IDY A;  2BGF A;  4EKU A;  2PPH A;  3ETR A;  2LXA A;  3U2S C;  1JRU A;  4M0W A;  3V6C B;  4FHJ A;  2IYD B;  3E56 A;  2M19 A;  3PZD A;  3Q3O C;  3K9P B;  1TTN A;  3NJT A;  1XLO A;  1CK1 A;  2FCS A;  2INP E;  3VFK A;  1UH6 A;  5J2R A;  2WDR B;  1I4X A;  2G9H D;  2WX1 A;  2LJ5 A;  1WX9 A;  3M62 B;  2Y5P A;  4IM0 A;  4W9E A;  1CZP A;  3ZXR A;  3OLM D;  1QOA A;  5J17 A;  4M02 A;  1X1M A;  2MLB A;  2KNB A;  1XF5 L;  1FPY A;  1TYG B;  2FCQ A;  4NNJ B;  2BS3 B;  2KTF A;  3MC0 B;  1C77 A;  2IY1 B;  3BIN A;  3MC8 A;  1Y56 A;  5DPS A;  2ON8 A;  2HJ1 A;  3LYY A;  4AWJ A;  1NI3 A;  1V80 A;  5CX3 A;  2X8X X;  1WY8 A;  4KGS A;  4US9 A;  2KXJ A;  3KWL A;  1UD7 A;  3PSE B;  3L13 A;  1XLP A;  4HJG E;  2W82 A;  4B0M A;  3ZVV A;  1P98 A;  4DXG A;  1I4Q A;  4US8 A;  2J0M A;  1KFY B;  2MBO A;  4WWP A;  1ZDX A;  1RWS A;  3KVF B;  1JCK B;  2D3A A;  1BUI C;  4ANV A;  2LHE A;  3Q3F A;  4KIK A;  2WXI A;  2CKH B;  4M0W B;  5G2N A;  3LXF A;  3VAW A;  4ZOH C;  2MRP A;  4P1C C;  2NPT A;  1R4M B;  3ZXV A;  2JYT A;  3VDZ A;  3IFW B;  2L7R A;  4BFR A;  2C5L C;  3MJW A;  2JSV X;  2DZI A;  5IKC M;  4IG7 B;  4FUL A;  2KAC A;  2IO3 B;  4AQ7 A;  1E7V A;  1SF0 A;  1KOT A;  2YEP B;  1WIA A;  2KQ7 A;  3GZN B;  4S17 A;  4HPP A;  2ZNV B;  4YTN B;  3EHV A;  5FR3 A;  4W9F A;  4L1B A;  2KX0 A;  5AUK A;  2J0J A;  5D94 A;  1ROE A;  4ZRI A;  2JRI B;  3P2B A;  2JF5 A;  4M00 A;  4A20 A;  1Y8R C;  3W1S A;  2GLS A;  2IGH A;  3MHS D;  4DBG A;  1UGM A;  2DBY A;  3APC A;  3UGB B;  2DNF A;  4MJS A;  3U52 E;  3FIL A;  3N3K B;  2L0T A;  4EFO A;  4ZRP A;  4RM8 A;  2I2Y A;  2C7M B;  4MT5 A;  1UNS A;  2W3S A;  3PPA A;  3PRP B;  2SEB D;  4KIK B;  1QOB A;  2ZCC A;  3DHH C;  1YN4 A;  1HE8 A;  3NY5 A;  2DHZ A;  2JXX A;  4WAF A;  2XN9 C;  3RYT A;  1YD8 U;  5EE0 A;  2LXC A;  4N59 A;  2WU2 B;  2REX A;  1LFD A;  4DXF A;  2KX3 A;  2MCN B;  1IP9 A;  2VH2 A;  2KVZ A;  3PHW B;  2PLP A;  2G3Q B;  2JWU A;  4RF1 A;  5HG2 A;  3VUX A;  5EE1 A;  1WX8 A;  3C19 A;  4PS3 A;  2CU1 A;  2MBE A;  4TUU A;  2KDE B;  1U4A A;  3QK0 A;  1XEE A;  2RPV A;  4ZRQ A;  4MSM B;  4WJN A;  3PT2 B;  4YTM B;  1LM8 B;  5J18 A;  3DPD A;  2KO3 A;  3NVV A;  3JYU A;  3X0W A;  1FRD A;  4WJQ A;  2IY0 B;  4DHZ E;  2JXT A;  4A3P A;  4F8C B;  4KGT A;  1CJE A;  4W9G A;  2QDF A;  3OJ4 B;  4BOS C;  2V4L A;  5I4D A;  5BYS A;  2NS5 A;  2DYM A;  1V5T A;  2LWP A;  2YVC A;  3RT3 B;  2QEJ C;  4RCO A;  4YL8 A;  2J7Q B;  1WSP A;  4RGM A;  4F1S A;  1E7U A;  2PVG C;  3BVZ A;  1TS2 A;  3T3N A;  2A4Z A;  4ZDV A;  1SJE D;  5T8I A;  3AEF B;  1C3T A;  4GOC A;  1I4P A;  4W9H A;  3ZNG C;  3Q8B A;  2M17 A;  3ONS A;  3GB1 A;  2JY6 A;  2BQQ A;  3KQ4 A;  5E6J A;  2VRR B;  3O13 A;  4HKZ E;  3DBL I;  1Q0W B;  2LZ6 A;  2LGY A;  1SBB B;  4XDC A;  1FNU A;  3RPF C;  2WDT B;  3Q6B A;  1GB1 A;  2GBN A;  2BKF A;  3BVG A;  3JSV A;  4URK A;  4XWT A;  3ZNI D;  3BZD B;  5IOI A;  3HM3 A;  5HKH A;  2WXL A;  1C4C A;  2LVO A;  4YSX B;  2V0G A;  1YN5 A;  5C2T B;  3NG0 A;  2RPQ A;  5MPO A;  2VZK B;  2N1W A;  2JZP A;  3DVN V;  3B0A A;  4WJO A;  5IAA C;  3R66 C;  2B3A A;  5L83 A;  3HRD D;  1WF9 A;  2D3B A;  4EUT A;  4MH0 E;  4GDL A;  2VH1 A;  1YJ1 A;  1EWY C;  3VRB B;  1RAX A;  3RD2 A;  2V4I B;  1BXT A;  1EWC A;  1VZ7 A;  2N7E A;  1FRR A;  1DOI A;  1TZ1 A;  3L0W B;  2Y5C A;  1T6B X;  4A8X C;  1F9J A;  1JRP A;  2K8B A;  2KAJ A;  3ALB A;  1QIL A;  3U8Z A;  2KDF B;  3IVF A;  4B95 A;  3P4P B;  1V6E A;  2ZJD A;  4PT5 A;  3TUO A;  2CR5 A;  3NVY A;  4RFB A;  1M4V A;  2LUE A;  1T0R C;  2BWE S;  2V3S A;  4PS7 A;  4RGN A;  3R8B A;  4YSY B;  4K7U A;  1UZX B;  2LRW A;  4IM2 A;  4KV2 A;  1SJH D;  2KK8 A;  3M63 B;  1L7Y A;  1AW7 A;  2E6X A;  1D6E C;  5AEK B;  5BMH A;  3AXC A;  2R2Q A;  4BBN C;  3AE5 B;  3SHQ A;  2WXH A;  4MEL A;  2LD9 A;  3Q3N C;  3AV8 A;  5AZH A;  3ENE A;  1PGB A;  4XDD A;  1VZ6 A;  1JWM D;  3H6N A;  3A33 B;  3BII D;  4E71 A;  1MFW A;  2LGD A;  3R7R A;  1IGD A;  3BK1 A;  2QJL A;  3QA8 A;  1TS5 A;  2WX0 A;  1E5W A;  2KFJ A;  4K3C A;  2MP2 A;  3ABV B;  3QCA A;  1ESF A;  3KWV A;  3MC9 A;  2DWQ A;  1KH0 A;  2L83 A;  4LDT D;  5FKA C;  1FNW A;  3V6E B;  1P3Q U;  1UBI A;  3NUH B;  3WAM A;  1HZ5 A;  3EC8 A;  2KTR A;  1WGH A;  4FLH A;  3AE3 B;  5CHW A;  1C9F A;  4TSS A;  1P0R A;  2N4F A;  1FO4 A;  1B9R A;  2IO1 B;  4AUQ C;  3ML8 A;  2WHI A;  5G55 A;  4NPN A;  4NQK E;  3ZRF A;  3RNA C;  4IUM B;  4FJY A;  2KT7 A;  2G45 B;  4GIV A;  3VR9 B;  5C3J B;  1R4M I;  1HA5 A;  4WAA A;  4ICU A;  4RMA A;  3PLV A;  2NBW B;  3LDZ E;  4TQ0 A;  1Z5S B;  2R61 A;  3V3X A;  1GB4 A;  3PRM B;  3TJP A;  1DOX A;  1WFY A;  1QQR A;  1WRI A;  3C0R B;  1N62 A;  4N9F 4;  1K53 A;  1WYG A;  3Q2A C;  2WU5 B;  3QWZ B;  1I4R A;  2N9P C;  1L6V A;  2WWZ A;  1EUV B;  4LNI A;  3LJ3 A;  3VTU A;  4KKI A;  2Y3A A;  1JWS D;  5LXI B;  1MJD A;  3QAQ A;  1WXQ A;  1JWA D;  5LLI A;  1KRH A;  2RR9 A;  5EE3 A;  1ENF A;  1TS3 A;  1ZGU B;  3DWG C;  4N58 A;  3R2I A;  3AE4 B;  2HD5 B;  2K39 A;  2RDB C;  2IJ0 A;  2O6V B;  4LK0 M;  1HEZ E;  2AQ2 B;  5D7G A;  1IBX B;  3EEC A;  4AP4 C;  4REZ A;  4JWU C;  2GRI A;  4CO7 A;  2BVC A;  3I3T B;  1K50 A;  4DHJ B;  1WGY A;  1F2R I;  5BMG A;  5AZG A;  3ZTD A;  2BT6 A;  2M0A A;  1DYQ A;  2DYO A;  4LNN A;  4CHK A;  2K3U A;  2FNJ B;  3GP7 A;  4KKJ A;  4TV3 A;  2KD0 A;  1J0G A;  4HRS A;  1KF6 B;  2L0F A;  2LGI A;  2AQ3 B;  2ZPN A;  1UUP A;  5IN7 A;  4WWM A;  2ZCB A;  3BVM A;  1ZW7 A;  2ASQ A;  1P9D U;  2JWZ A;  3R7Q A;  3U30 A;  2WXQ A;  4I6L B;  2KYW A;  1G6J A;  4NY0 A;  3PLU A;  3AED B;  3RZF A;  4LTU A;  4AOF A;  2M0X A;  3H1U A;  5D2M B;  3BK2 A;  4BKG A;  3K9O B;  4IW0 A;  1MPE A;  2KOX A;  4OZA A;  1EM7 A;  2GOW A;  4CQN A;  4C80 A;  3GE3 C;  5GMV A;  3EFU A;  3L16 A;  3CIR B;  4CYE A;  3L08 A;  4ANW A;  2KLC A;  3ZQ4 A;  4MEM A;  1JWU D;  2AQ1 B;  4KVG B;  1ET6 A;  4LJP B;  2OOB B;  2WXO A;  3Q3M C;  1TY0 A;  3I63 C;  1FXT B;  4PYU A;  1YIW A;  4AJW A;  2W9N A;  4ZHP A;  5JH5 C;  5BMI A;  1ZKH A;  3A4S C;  2NCN A;  2FID A;  2L3Z A;  1KLG D;  1SSN A;  3IT6 B;  2ZEQ A;  5E6O A;  4P16 A;  5EDS A;  4HPL B;  3BYY B;  2H88 B;  2KWU B;  1A70 A;  3DQV A;  3JW0 X;  1BT0 A;  4MGY E;  4JIO U;  1T3Q A;  4LNO A;  2KDM A;  3KUC B;  2J0K A;  5L95 C;  2HTH A;  1YX6 B;  4PYZ A;  4YT0 B;  4C7Y A;  2DLB A;  3NZU A;  1WWT A;  1GAQ B;  3ZRC A;  1PGA A;  2J42 A;  2NVU I;  1AN8 A;  3AUL A;  1MVK A;  1KJT A;  1E8Z A;  1L0X B;  3S2A A;  2QC8 A;  1IPG A;  1ZP0 B;  4M01 A;  4BKT A;  4W9K A;  1ZE3 D;  1WI0 A;  1L0V B;  1AYF A;  1WGR A;  1WMH B;  3MP9 A;  4WQM A;  2WDV B;  3OG5 A;  4XE0 A;  4FXC A;  1XD3 B;  3VH4 B;  2IO2 B;  2C7H A;  1VZ8 A;  2K0P A;  1TS4 A;  2LVP A;  3M95 A;  3ZO5 B;  3H8H A;  1UWM A;  2KWC A;  4BAX A;  2M56 B;  3PZ8 A;  3MJ5 A;  3AU4 A;  1SE2 A;  2OHF A;  3KUZ A;  3T3O A;  2L00 B;  4DDI D;  1T0S C;  3A1Q B;  4HPM B;  4K1R B;  1E8Y A;  3W1Y A;  3RMK C;  4F7Z A;  1CQV A;  3IXS A;  3WCQ A;  4WIP A;  3ZNZ B;  1QKZ A;  1I42 A;  3Q8F A;  2K6D B;  1NYR A;  1K8R B;  1GOZ A;  3MTN B;  3UF8 A;  1WXA A;  1F1H A;  1ZXH A;  3VUW A;  3VTW A;  1R4N B;  2N1V A;  2PIA A;  5IO9 A;  1TIF A;  4XWW A;  1L6U A;  5DPT A;  2QHO A;  3V05 A;  2MEK A;  4J6I A;  2JT4 B;  1OQR A;  3R3M A;  2GBJ A;  1XLN A;  4HLE A;  3L54 A;  1FFU A;  3GE8 C;  4P6V F;  3P4Q B;  1N61 A;  3DBR B;  1YQB A;  5BYQ A;  3TIX A;  1P1A A;  1UEL A;  1SXT A;  2L52 A;  3OWE B;  4FJZ A;  2WLB A;  1N6Z A;  3VXW A;  2ZNV C;  2LHD A;  2I1K A;  2N7D A;  4B9K A;  5IP4 D;  3KYC D;  1KLV A;  2FAZ A;  4GB9 A;  3AEC B;  3RI7 C;  2DZK A;  1WGG A;  1P7F A;  1XLQ A;  2L32 A;  2W55 A;  2BS4 B;  1XCT L;  2NR2 A;  1GC6 A;  1NDD A;  1YQ3 B;  5HHD G;  4DHZ B;  4WUR A;  2N7J A;  3RZW C;  4GSW A;  3FAH A;  3I57 A;  2LFI A;  2KLG A;  1WR1 A;  1V5O A;  3MFG A;  2Z59 B;  1WZ3 A;  3PZ7 A;  3EA6 A;  3PRE A;  4BKS D;  1FCL A;  4ANX A;  3SD5 A;  3PGE A;  2PW9 A;  1C78 A;  3HK0 A;  2WXG A;  3WAN A;  2KQ4 X;  4DWF A;  2R2O A;  3QQ8 B;  4TMA B;  1NVI D;  2DX5 B;  2M4N A;  2ZPY A;  1RLF A;  2WP9 B;  4USA A;  3FKY A;  4NZL B;  3A9J B;  4KZ0 A;  1FIQ A;  3QJZ A;  2TSS A;  1OQQ A;  1H8C A;  3N20 C;  2K8H A;  4BBN F;  2NTS A;  1TBE A;  1VR9 A;  2CHX A;  1J8C A;  4NAW B;  3ZW3 A;  2DZJ A;  3IAM 1;  4GU2 A;  1PDX A;  4I6P A;  1VLB A;  4GMV A;  1FXI A;  5TR5 A;  2IBI B;  1HTQ A;  1WXM A;  3CST A;  4C56 C;  2DAF A;  5DCN A;  1YQ4 B;  1VRA B;  2DZM A;  2K5P A;  1WZ0 A;  4LNF A;  2K6Q A;  3V60 A;  1VJK A;  2V3N A;  4G11 A;  2BYE A;  4ANU A;  3W1S C;  3ZNH B;  4NJC A;  4XGA B;  2LJI A;  4HK2 A;  2X38 A;  3QC8 B;  3BWU D;  2KMM A;  1ISN A;  2Y5B B;  4W9C A;  1YN3 A;  1XT9 B;  5CHV C;  2XK5 A;  3VQI A;  2CJO A;  2KDI A;  5AZF A;  3I5J C;  3PRZ A;  2MJD A;  4WWN A;  3NZS A;  4FAD A;  2A5U A;  2K22 A;  4HRO A;  3R2T A;  2KJ6 A;  4GGQ A;  4P1B C;  4NJ6 A;  3SU8 X;  1RM6 C;  4RF0 A;  2EKE C;  4BZA A;  3EFC A;  2O2V B;  3FC4 A;  4QAY A;  3APD A;  3V61 A;  2FCN A;  3Q8E A;  4AS1 A;  1YJJ A;  5CTR C;  5C23 A;  2WXJ A;  4D2K A;  1RFK A;  4HCP B;  4B0E A;  4ARC A;  1XQQ A;  1FFV A;  1V49 A;  4DK5 A;  1ZPS A;  3APF A;  3P42 A;  4OHJ A;  2Z8L A;  1WE6 A;  2GBM A;  4IKG A;  4Q2J A;  1GUA B;  4HDO A;  4K3B A;  3CWI A;  1V1O A;  3ZJT A;  2M8S A;  1LGR A;  2MQJ A;  1I4G A;  4DDG D;  3KH0 A;  1LQB A;  3VHT C;  1T0Y A;  2FCM A;  3P63 A;  3HIZ A;  2WNM A;  2GI9 A;  2WQY B;  2GMI C;  4W9J A;  3CF6 E;  4PK1 A;  2DYB A;  4UDU C;  2XK5 B;  1P7E A;  2PMV A;  3Q3J A;  2UYZ B;  1V9J A;  3B2G A;  2CS4 A;  1L4Z B;  2FE8 A;  1I7H A;  1WR6 E;  3N9Y C;  3EGR A;  2UU7 A;  2FBW B;  5CHF A;  2MA9 B;  4HEA 1;  3TCA A;  4EZL A;  2KFK A;  4NAM A;  3AE8 B;  2RD0 A;  3W5V B;  2PE9 A;  1SGH A;  2XEW A;  2Z0D B;  1L0Y B;  4A9A A;  2RMM A;  4BOZ B;  3ECI A;  4II3 B;  2FUG 1;  2KQS A;  1OTR B;  2CU3 A;  3N32 A;  3ZUN A;  2I38 A;  2KVR A;  2KMC A;  2BBC A;  4RNA A;  4OVU A;  1HTO A;  3T8M A;  1J19 A;  3OJ3 A;  3RFZ B;  4E3C A;  2O6V A;  2K1F A;  3N30 A;  3DBH B;  1IBX A;  3IT4 B;  1RYJ A;  1C1Y B;  1J7B A;  5DPW A;  4HWI B;  3Q69 A;  1L2N A;  1FCC C;  1TKG A;  3TEY A;  3NVZ A;  5DPR A;  2EMT A;  3AEG B;  2D5G A;  2ICI A;  4ASW C;  1R7S A;  4MM3 B;  3Q8C A;  4A55 A;  1WGD A;  2BYT A;  2SAK A;  3AN1 A;  1MI0 A;  1UBQ A;  3QX1 A;  2GBK A;  4GXB A;  4HCN B;  1SEB D;  3SFD B;  3Q14 C;  2G4S A;  2WDQ B;  2QIL A;  5IA7 A;  3VRA B;  1Q5W B;  3RNB C;  1V81 A;  2G4D B;  3PHX B;  1OFF A;  1YX5 B;  3BYT B;  2KFK B;  1V1P A;  4G0N B;  5JXV A;  2KN4 A;  1KM7 A;  2K25 A;  1GC7 A;  4ZYN A;  5HI1 A;  1D3Z A;  4C00 A;  1GNU A;  2J4X A;  1Z2M A;  3NS1 A;  4IM3 A;  1V86 A;  3AEA B;  1DGJ A;  5H92 C;  2KJR A;  3PTF C;  1TY2 A;  1YNT E;  3ML9 A;  2QSD A;  1YJI A;  1ZUD 2;  2V1Y A;  3DHI C;  3U7D A;  2FIF A;  4YWG G;  1NEK B;  1NYQ A;  2N9K A;  1EU3 A;  1JW9 D;  1WXV A;  1E6E B;  1IYF A;  1XXG A;  1R4N I;  3UI3 A;  4JL9 A;  3N1Y C;  1EU4 A;  3WA0 A;  4KGR A;  3A4R A;  2PE6 B;  3QAR A;  4DQO C;  4LNK A;  3DBR I;  2BB6 A;  3I9V 1;  2EKI A;  4WH4 A;  4XX5 A;  1L5P A;  2JVC A;  1LO5 D;  2VZK D;  2HTM E;  2XNA C;  2ZVO A;  3P4S B;  3A9K B;  5JHA A;  3O65 B;  5H8Y E;  3B2F A;  3SDL C;  3AE6 B;  5E6P A;  4EEW A;  4L23 A;  1V1P B;  3W2D A;  3L4P A;  1WMH A;  2D07 B;  1XO3 A;  4MSQ B;  4YSZ B;  4IC7 B;  4PS8 A;  5TSS A;  2PKO A;  3QHT A;  3VTV A;  3VUY A;  3D32 A;  3VVW B;  3L10 B;  1QOF A;  3CSF A;  4IWQ A;  4LCD E;  3U4E G;  2RGF A;  2RSU A;  2LVQ A;  1MHX A;  3HM6 X;  1JQ4 A;  2J52 A;  2PEA A;  5FK9 C;  3DHG C;  2HJ8 A;  2LI5 A;  1UF0 A;  4FHK A;  1WXS A;  4C7Z A;  1K51 A;  3HUI A;  5BO4 B;  3A1Q A;  4II2 B;  4JPS A;  1JRO A;  2YEP F;  1A5R A;  4C4V B;  1GG3 A;  3J9C A;  1J7A A;  1SE4 A;  2MX2 A;  1J7C A;  3TEZ A;  4A90 A;  2CHZ A;  1ZDV A;  2QCZ A;  1KTK A;  1GJZ A;  1NEN B;  4IOI E;  2K8C A;  1I35 A;  3AE7 B;  3AB5 A;  4EZJ A;  3WAO A;  1NI2 A;  4GDK A;  2D10 A;  2V3P A;  1HXY D;  3ZYY X;  4RGT A;  4K7W A;  3NZ3 A;  5D3I B;  4AJY B;  2L76 A;  2L1A A;  2IZV B;  2AEH A;  2M1M A;  4ITK A;  2AX5 A;  1D4B A;  4M8M A;  3X23 A;  3AM9 A;  1BML C;  3RNF C;  3AI5 A;  2BKR B;  1H4R A;  1D5X C;  2B76 B;  3KW5 B;  2IPK D;  2JZ3 B;  2EMS A;  4H2A A;  3DBS A;  4JX1 C;  1WGK A;  3KUD B;  1OEY A;  1VD2 A;  4J3O D;  1TJE A;  3WAP A;  4FJV B;  2WXF A;  2AL6 A;  2MBQ A;  2C60 A;  2V9H A;  3DVG X;  4RM9 A;  3T9L A;  4ACF A;  3AE1 B;  3PO0 A;  1OQY A;  3SR6 A;  3ZKJ C;  5KHQ A;  2JPH A;  1SE9 A;  2L8J A;  2MJ3 A;  1TKY A;  2D3C A;  1YMH E;  2IGG A;  1WYW B;  2INN E;  1FXA A;  2HDE A;  3LB8 C;  3NOB A;  4OZC A;  2N9L A;  1ET9 A;  2FUH B;  2ACZ B;  5D6J B;  1Q1O A;  4WQO B;  3ZDT A;  2ZZP B;  1L4D B;  4K81 A;  2JU6 X;  3V62 A;  5GXG B;  3RNC C;  1TGZ B;  1UWX A;  3A9J A;  1ZXI A;  4YTP B;  4ARI A;  2LGS A;  2WXR A;  1QT9 A;  2JUO A;  1D5Z C;  2JQR B;  4GDK B;  3AE9 B;  5E6N A;  3TSS A;  3DWM A;  3IG3 A;  4NAW A;  1E8X A;  3N1Z C;  4P7I A;  4EZK A;  3HVD A;  2PTL A;  1FMA D;  5AUI A;  4LDT B;  2GBR A;  2NPT B;  3KYD D;  5JZE B;  1C4A A;  1C4P A;  2BTE A;  3WAL A;  3SFE B;  2L05 A;  2NMQ A;  4R3D A;  3UIO B;  2ZW0 A;  1EO6 A;  2BYV E;  2I1J A;  1IGC A;  2D2Q A;  2E3T A;  5LNK 1;  1T0Q C;  4HVB A;  1FD6 A;  4FBJ B;  1E90 A;  4HXD A;  3HHM A;  1V2Y A;  1CMX B;  2OED A;  3CMM B;  2C7N B;  1FEH A;  2O6V D;  4FN2 A;  4MH8 A;  3IHP C;  3UIP B;  4A3O A;  4HKQ A;  4GN1 A;  3NRZ A;  2LUM A;  3PVL A;  2MH7 A; 
#chains in the Genus database with same CATH homology
 3DOW A;  2GBM A;  3QWZ B;  2N9P C;  1GUA B;  4HDO A;  2J0M A;  3RUL A;  2KJH B;  2MBO A;  4WWP A;  3DCG A;  2M8S A;  1WE7 A;  1EUV B;  2WWZ A;  3LJ3 A;  5KHO A;  3VTU A;  3M3J A;  3KVF B;  1MG8 A;  2MQJ A;  2OJR A;  4DHJ D;  5LXI B;  4ANV A;  4DDG D;  4KDL B;  3Q3F A;  3QAQ A;  4KIK A;  3RCZ A;  5LLI A;  3KH0 A;  2RR9 A;  2CKH B;  1WX7 A;  1LQB A;  4M0W B;  5G2N A;  1ZGU B;  3VAW A;  3VHT C;  1EF5 A;  2MRP A;  1T0Y A;  2NPT A;  2O2V A;  2HD5 B;  2FCM A;  3DBH I;  3HIZ A;  2K39 A;  1M94 A;  4MGI E;  3VDZ A;  4MJS B;  3TBL D;  2O6V B;  4I6N B;  2GMI C;  3IFW B;  4W9J A;  2L7R A;  4BFR A;  5D7G A;  3EEC A;  3CF6 E;  2C5L C;  4AP4 C;  4EOY A;  3MJW A;  2DYB A;  2XK5 B;  4CO7 A;  3Q3J A;  2UYZ B;  2DZI A;  1V9J A;  4IG7 B;  3I3T B;  2CS4 A;  4FUL A;  1WJN A;  1WR6 E;  2KN5 A;  4WWO A;  3QIJ A;  2IO3 B;  2MWS B;  5CHF A;  1E7V A;  4DHJ B;  1WGY A;  4MDK E;  1KOT A;  5AZG A;  2MA9 B;  3ZTD A;  2N9E B;  3B08 A;  2KZR A;  1WIA A;  2KQ7 A;  2DYO A;  3TCA A;  4EZL A;  2KFK A;  4CHK A;  3ZDM C;  1OGW A;  2ZNV B;  2RD0 A;  2PE9 A;  2FNJ B;  3EHV A;  4W9F A;  1SGH A;  2XEW A;  2Z0D B;  2KX0 A;  4BOZ B;  2J0J A;  4TV3 A;  5D94 A;  2KD0 A;  4ZRI A;  1J0G A;  2AL3 A;  2BWF A;  2JRI B;  3ECI A;  2JF5 A;  3P2B A;  2L0F A;  4II3 B;  4A20 A;  1Y8R C;  3W1S A;  2KQS A;  1OTR B;  3N32 A;  2ZPN A;  3ZUN A;  2KVR A;  2MBH A;  2KMC A;  3MHS D;  4DBG A;  4OVU A;  3T8M A;  1J19 A;  1UGM A;  3APC A;  2ZCB A;  3UGB B;  1ZW7 A;  3JVZ X;  2ASQ A;  1P9D U;  2JWZ A;  3OJ3 A;  3R7Q A;  3U30 A;  4MJS A;  4E3C A;  3BY4 B;  2O6V A;  2K1F A;  3N30 A;  4KSL C;  4I6L B;  1G6J A;  3N3K B;  3PLU A;  2L0T A;  4NY0 A;  4EFO A;  3RZF A;  4RM8 A;  4AOF A;  2M0X A;  2MBB B;  3H1U A;  5D2M B;  1C1Y B;  2C7M B;  4BKG A;  3K9O B;  4JQW C;  5DPW A;  4IW0 A;  2KOX A;  4HWI B;  2GOW A;  3PPA A;  3H7P A;  3PRP B;  2N9X A;  1L2N A;  3GOE A;  5GMV A;  3EFU A;  5DPR A;  2EMT A;  4KIK B;  3L16 A;  2ZCC A;  1WRD B;  4CYE A;  3L08 A;  2KMA A;  1HE8 A;  2KLC A;  3NY5 A;  4ANW A;  2DHZ A;  2JXX A;  4MEM A;  4ASW C;  3RYT A;  1YD8 U;  2LXC A;  3L17 A;  4KVG B;  4ICV A;  4LJP B;  2OOB B;  2REX A;  1LFD A;  2KX3 A;  4G3X B;  2MCN B;  1FXT B;  1WGD A;  1YIW A;  4PYU A;  4AJW A;  4FA6 A;  1IP9 A;  3PHW B;  2W9N A;  2IO0 B;  3TL5 A;  1UBQ A;  3QX1 A;  2G3Q B;  2GBK A;  5JH5 C;  4GXB A;  4HCN B;  3UQB A;  2LGX A;  3VUX A;  1ZKH A;  3A4S C;  2NCN A;  2FID A;  1WX8 A;  2BPS A;  2L3Z A;  4KDI C;  4PS3 A;  2CU1 A;  2G4S A;  3AU5 A;  4KZC A;  4JGH B;  2ZEQ A;  2MBE A;  5E6O A;  2D3G A;  5EDS A;  4DXA B;  4TUU A;  5IA7 A;  1Q5W B;  2KDE B;  1U4A A;  3QK0 A;  4HPL B;  4MSM B;  1V81 A;  2G4D B;  2DEN B;  4WJN A;  3PHX B;  3PT2 B;  1LM8 B;  1YX5 B;  3H9D A;  2KWU B;  2KFK B;  4G0N B;  5J18 A;  3TMP B;  3DQV A;  2KO3 A;  3DPD A;  4ZYN A;  1KM7 A;  2K25 A;  1GC7 A;  3JW0 X;  1BT0 A;  2KHW B;  3JYU A;  4HJK A;  4JIO U;  4MGY E;  1D3Z A;  3DDC B;  3X0W A;  3NS8 A;  1GNU A;  3KUC B;  5C1Z A;  2J0K A;  4WJQ A;  5L95 C;  1Z2M A;  2IY0 B;  4DHZ E;  4A3P A;  4F8C B;  2HTH A;  1YX6 B;  4PYZ A;  4ZRK A;  4IM3 A;  1V86 A;  2MW5 A;  3NZU A;  4W9G A;  2KJR A;  3PTF C;  3OJ4 B;  4OVV A;  3ZRC A;  4MM3 A;  4E74 A;  1PQS A;  4BOS C;  2V4L A;  2NVU I;  1AAR A;  2NS5 A;  3AUL A;  3WIM A;  3ML9 A;  1KJT A;  1SIF A;  1E8Z A;  2DYM A;  3S2A A;  2V1Y A;  1V5T A;  2LWP A;  4KSK C;  2YVC A;  1IPG A;  1EF1 A;  3U7D A;  4BKT A;  2FIF A;  4W9K A;  3JSV B;  4JLC A;  3RT3 B;  4W9I A;  1WI0 A;  1WGR A;  1WMH B;  2AWT A;  4YL8 A;  2J7Q B;  4W9L A;  4F1S A;  3H7P B;  1E7U A;  4NJ7 A;  1WXV A;  3PS6 A;  1XD3 B;  3VH4 B;  1IYF A;  2A4Z A;  2IO2 B;  1R4N I;  4ZDV A;  2YLM A;  1OEY J;  2C7H A;  4JL9 A;  1C3T A;  2LVP A;  4GOC A;  3IBE A;  3NHE B;  4W9H A;  3WA0 A;  3M95 A;  3ZNG C;  3ZO5 B;  3A4R A;  2M17 A;  1NBF C;  1S3S G;  3ONS A;  2PE6 B;  2UWQ A;  2KWC A;  4K7S A;  3QAR A;  2JY6 A;  2HE7 A;  3DBR I;  2VRR B;  4XX5 A;  2JVC A;  2JZZ A;  3AU4 A;  3ZLZ A;  3DBL I;  1Q0W B;  3PV1 A;  2LZ6 A;  3KUZ A;  2LGY A;  4W9D A;  2ZVO A;  2L00 B;  3VH3 B;  4DDI D;  3A9K B;  4GDL B;  3A1Q B;  4IWO A;  2AYO B;  4HPM B;  4K1R B;  3O65 B;  1VCB A;  5JHA A;  2WDT B;  1E8Y A;  3SDL C;  2BYF A;  5E6P A;  1RFA A;  3W1Y A;  4EEW A;  2GBN A;  2BKF A;  2KC1 A;  3JSV A;  4URK A;  3ZNI D;  4LJO B;  4F7Z A;  1WMH A;  3ZNZ B;  2D07 B;  4MSQ B;  1I42 A;  2K6D B;  2WYQ A;  3HM3 A;  5HKH A;  4IC7 B;  4PS8 A;  3QHT A;  2D11 A;  3VTV A;  3VUY A;  1K8R B;  3D32 A;  3VVW B;  3L10 B;  4M8N A;  2DAJ A;  2LVO A;  3ZTC A;  3MTN B;  3UF8 A;  2NBV B;  1WXA A;  3CSF A;  2KKC A;  4IWQ A;  3RUI B;  3VUW A;  4LCD E;  3VTW A;  2RGF A;  2RPQ A;  4MGZ E;  1WM2 A;  2N1V A;  2CHW A;  5DPT A;  1WJ6 A;  2N1W A;  2QHO A;  2RSU A;  2LVQ A;  3DVN V;  3HM6 X;  2LRU A;  4J6I A;  2KWV B;  2JT4 B;  2LAS A;  3R3M A;  3B0A A;  3OAW A;  2PEA A;  2GBJ A;  4HLE A;  4MGK E;  4WJO A;  5IAA C;  3L54 A;  3R66 C;  2B3A A;  3ZIM A;  3B1L X;  2HJ8 A;  4XC2 A;  2LI5 A;  4FHK A;  4BKS A;  5L83 A;  1WXS A;  1WF9 A;  1YQB A;  4EUT A;  2ZVN A;  4MH0 E;  2JRH A;  1P1A A;  3TIX A;  1UEL A;  4FJZ A;  5BO4 B;  3A9K A;  4GDL A;  3A1Q A;  4II2 B;  1YJ1 A;  4TQ1 A;  2BF8 B;  4XZ4 A;  1RAX A;  3RD2 A;  1A5R A;  3VXW A;  1GG3 A;  2ZNV C;  2I1K A;  4X57 B;  2N7D A;  4B9K A;  2MX2 A;  2N7E A;  3KYC D;  1KLV A;  1TZ1 A;  4NQL B;  2FAZ A;  3L0W B;  4GB9 A;  1F9J A;  2DZK A;  1WGG A;  2K8B A;  3ALB A;  3U8Z A;  2CHZ A;  2KDF B;  3IVF A;  4B95 A;  3H7S A;  2NR2 A;  3GZN I;  1GC6 A;  1NDD A;  1V6E A;  3UQA A;  4DHZ B;  1GJZ A;  1WH3 A;  2ZJD A;  3DVN U;  2K8C A;  2CR5 A;  1I35 A;  3RZW C;  4GSW A;  4EZJ A;  3WAO A;  1NI2 A;  2LUE A;  4G50 A;  4GDK A;  4ZRJ A;  4HDQ A;  2KLG A;  1WR1 A;  2BWE S;  2D10 A;  2MP2 B;  2V3S A;  1V5O A;  4PS7 A;  4K7W A;  2Z59 B;  1WZ3 A;  4AJY B;  3PRE A;  4BKS D;  4ANX A;  3SD5 A;  2L76 A;  3PGE A;  4K7U A;  2PJH A;  3DVG Y;  2IZV B;  1UZX B;  2AEH A;  2LRW A;  4IM2 A;  3HK0 A;  4KV2 A;  5FR6 A;  3M63 B;  2KK8 A;  2R2O A;  3WAN A;  3QQ8 B;  4DWF A;  2M1M A;  1L7Y A;  2KC2 A;  4B6W A;  1QZE A;  4M8M A;  5AEK B;  2DX5 B;  2M4N A;  2ZPY A;  3X23 A;  2KTR B;  1RLF A;  2KDB A;  3AXC A;  1E8W A;  3AI5 A;  2BKR B;  1H4R A;  2KAN A;  3A9J B;  4WJP A;  2R2Q A;  4BBN C;  4KZ0 A;  3KW5 B;  3QJZ A;  1H8C A;  2K8H A;  4BBN F;  2JZ3 B;  3SHQ A;  1LXD A;  2EMS A;  3DBS A;  1TBE A;  2LD9 A;  4MEL A;  2C9W B;  3KUD B;  1OEY A;  1VD2 A;  2CHX A;  5AZH A;  4BVU C;  3ENE A;  3WAP A;  4NAW B;  3ZW3 A;  2MSE D;  1J8C A;  4FJV B;  2DZJ A;  2XBB C;  3H6N A;  2Z0E B;  2AL6 A;  2MBQ A;  3A33 B;  1WJU A;  2C60 A;  4GU2 A;  5JHB A;  1S1Q B;  4E71 A;  3DVG X;  3T9L A;  4RM9 A;  4I6P A;  2LGD A;  3R7R A;  4GMV A;  1OQY A;  3QA8 A;  5TR5 A;  2WX0 A;  2NBU A;  1E5W A;  2IBI B;  4IWP A;  3ZKJ C;  1WJ4 A;  1RRB A;  1WXM A;  2KFJ A;  5KHQ A;  3CST A;  4TKN A;  2DAF A;  1WM3 A;  2JPH A;  1SE9 A;  2MP2 A;  2L8J A;  5DCN A;  3QCA A;  2DZM A;  3V60 A;  1WZ0 A;  2K6Q A;  3UIN B;  1WYW B;  5LXH A;  2BGF A;  4LDT D;  4EKU A;  2PPH A;  3NOB A;  2LXA A;  1JRU A;  3V6C B;  3V6E B;  1P3Q U;  2FUH B;  1UBI A;  4FHJ A;  4G11 A;  2BYE A;  2IYD B;  3W1S C;  5D6J B;  3WAM A;  1Q1O A;  3ZNH B;  4WQO B;  4ANU A;  3PZD A;  3ZDT A;  2ZZP B;  3K9P B;  1TTN A;  4HK2 A;  4K81 A;  3EC8 A;  2KTR A;  1WGH A;  3QC8 B;  4FLH A;  5CHW A;  3V62 A;  2FCS A;  1TGZ B;  3VFK A;  1P0R A;  1ISN A;  2Y5B B;  2N4F A;  4W9C A;  1UH6 A;  1XT9 B;  5J2R A;  3A9J A;  2WX1 A;  2LJ5 A;  2IO1 B;  5CHV C;  2XK5 A;  3VQI A;  4AUQ C;  1WX9 A;  3ML8 A;  3ZVV A;  3M62 B;  2KDI A;  2JUO A;  5AZF A;  5G55 A;  4GDK B;  3PRZ A;  4NPN A;  4NQK E;  4WWN A;  3ZRF A;  3NZS A;  4IM0 A;  2A5U A;  5E6N A;  4FAD A;  2KJ6 A;  4GGQ A;  3IG3 A;  4NAW A;  4W9E A;  3OLM D;  1E8X A;  4IUM B;  4NJ6 A;  3SU8 X;  4FJY A;  5J17 A;  2G45 B;  4GIV A;  2EKE C;  4P7I A;  1X1M A;  2MLB A;  4EZK A;  2KNB A;  1R4M I;  4WAA A;  4ICU A;  4RMA A;  4LDT B;  2GBR A;  2FCQ A;  3PLV A;  2NPT B;  4NNJ B;  2KTF A;  2NBW B;  2O2V B;  3KYD D;  5JZE B;  3APD A;  3V61 A;  3WAL A;  3LDZ E;  4TQ0 A;  2IY1 B;  2L05 A;  1Z5S B;  2FCN A;  3UIO B;  3BIN A;  1EO6 A;  2BYV E;  2I1J A;  3PRM B;  5DPS A;  2D2Q A;  5CTR C;  5C23 A;  3TJP A;  1WFY A;  4AWJ A;  4HVB A;  4FBJ B;  1E90 A;  4HCP B;  4HXD A;  3HHM A;  1V80 A;  5CX3 A;  1V2Y A;  1XQQ A;  1CMX B;  1WY8 A;  1V49 A;  3CMM B;  4DK5 A;  2C7N B;  2KXJ A;  3C0R B;  1UD7 A;  2O6V D;  4FN2 A;  4N9F 4;  3IHP C;  3APF A;  3PSE B;  3UIP B;  4GN1 A;  4A3O A;  3L13 A;  3PVL A;  1WE6 A;  1P98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...