2JXXA

Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Ubiquitin-like domain of NFATC2IP.
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords NFATC2-interacting protein
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jxxA00
1GC7A 5L83A 4M0WB 2HE7A 3UIPB 3A9KB 3ONSA 2XBBC 3VTWA 2OOBB 3QC8B 4ICUA 3U8ZA 4HCPB 4TQ1A 3AULA 4K7WA 4JGHB 2ZJDA 3RCZA 2KFKA 2KQ7A 1KLVA 4AWJA 1IP9A 2BF8B 3MJWA 3PVLA 3ZNZB 2KN5A 2WWZA 3H7PA 3QAQA 2DYMA 1Y8RC 3QQ8B 4MSMB 5L95C 4LDTB 1WM3A 4BOSC 3L10B 5J18A 3QIJA 2KO3A 4IM0A 2NBVB 4ZDVA 2KK8A 1WXMA 4ZRKA 3GOEA 2NBWB 2R2QA 4F8CB 4EZLA 2KANA 4AUQC 3S2AA 3VH3B 2N4FA 5CHFA 4B9KA 3KYDD 2GOWA 1K8RB 4GDKA 4WWNA 4DDGD 2JUOA 2L0TA 3ALBA 1WXAA 4WWOA 4FJVB 1ZGUB 4FJYA 4NQLB 4MELA 5LXIB 2D10A 3H9DA 4W9GA 2IO1B 3UQAA 2ZVOA 3KUZA 4I6PA 5KHOA 1UH6A 3Q3FA 3QA8A 3VVWB 4FULA 2JPHA 3VDZA 2DZIA 4EKUA 1U4AA 4NAWA 2NR2A 2KDEB 4MGKE 3V62A 1Q1OA 4YL8A 2BKFA 3APFA 2JRHA 1WZ3A 2UYZB 2KD0A 3PGEA 2LGYA 4TQ0A 2J0MA 2MW5A 1YJ1A 3ZTDA 3VXWA 4E74A 1GUAB 1EF1A 2Z0EB 1P0RA 4RM8A 3EECA 2O6VD 1WGHA 4G11A 2D11A 2HD5B 2PEAA 3CSTA 2L7RA 2BYVE 2FUHB 2HTHA 2PE6B 5J2RA 1BT0A 3R66C 1WJNA 3TCAA 5CTRC 3UQBA 4DHZB 4JL9A 2JT4B 3A1QB 4GB9A 3VFKA 4URKA 2DENB 3DBHI 2N9EB 3PPAA 2LXCA 2N1WA 3O65B 1J8CA 3DCGA 4LJOB 1I42A 1OQYA 4F7ZA 1SGHA 1WRDB 1UELA 2G4SA 2C7MB 4HLEA 2R2OA 4GU2A 3ZRFA 1JRUA 4LJPB 2K8HA 3PZDA 2K8CA 4X57B 1LM8B 4BBNC 2V1YA 3NHEB 3T8MA 3ENEA 2CKHB 3WAMA 2KXJA 2ZPNA 4ANWA 2B3AA 1WE7A 1NDDA 2BWFA 4WJNA 5BO4B 3HK0A 1AARA 3RZWC 3W1SC 2LASA 2N1VA 3SU8X 1WR1A 2BWES 4DWFA 3WANA 4FN2A 2BPSA 2RGFA 1VCBA 2KMAA 4DXAB 3ZLZA 3U30A 4BKSD 3PSEB 3R3MA 2HJ8A 2CS4A 3V60A 2KTFA 1UBIA 2MBEA 1UGMA 3OJ4B 2NVUI 4KDLB 3M62B 2L76A 4IM2A 2IO0B 1ISNA 2J0KA 1E7VA 3DPDA 3B0AA 3W1YA 2MBBB 2M0XA 2YVCA 5E6OA 5DCNA 3TL5A 3DBLI 3SHQA 3N32A 1H8CA 2V3SA 1KJTA 2BKRB 3R7QA 1F9JA 4HK2A 4KSLC 1RRBA 1OEYA 5CHWA 4KIKB 2Z59B 2RPQA 3R7RA 4MGYE 2C7NB 3M95A 4MGZE 3VTVA 3L54A 5D7GA 4DBGA 1WH3A 2A4ZA 3PREA 1J19A 2RR9A 3DVNV 4EFOA 5JZEB 4DHJB 2MP2A 3WAPA 4B6WA 4W9IA 1IYFA 2IBIB 2LD9A 5C23A 3VUXA 1P3QU 2JVCA 2MX2A 4G3XB 1Q5WB 4KZCA 2UWQA 2NPTB 4GGQA 1IPGA 4W9FA 4F1SA 1V9JA 2DZKA 4FHJA 4WJOA 2Y5BB 1WX7A 4A3PA 4ASWC 4LCDE 2K39A 5DPSA 1TTNA 2MSED 2AYOB 4MDKE 3C0RB 2IO2B 5J17A 1YX6B 3DBRI 2KKCA 4NJ7A 1GJZA 2KZRA 4GSWA 5EDSA 3PS6A 2EMTA 4II3B 3OLMD 4PYZA 5TR5A 4MEMA 2PJHA 2KQSA 1E8WA 2BYFA 3CMMB 2ZNVB 4PYUA 4FADA 1OGWA 2M17A 1WE6A 1WGYA 2GBRA 3ZDTA 4WWPA 3AI5A 4E71A 1L7YA 2MWSB 4XC2A 3QK0A 1GNUA 3EFUA 4MSQB 1PQSA 2BYEA 3W1SA 3TBLD 4TKNA 3RUIB 4XX5A 3VAWA 1EUVB 5LXHA 3DBSA 3N3KB 4K81A 5E6PA 1WIAA 1UBQA 2N7DA 4WAAA 2KDIA 3ML9A 5AZHA 4GN1A 1D3ZA 3PRZA 4M8MA 2MBOA 2WYQA 3SDLC 3UIOB 1OEYJ 2CHXA 3LJ3A 3MHSD 2L0FA 3VQIA 1YX5B 3IBEA 2O2VA 3A9JA 2QHOA 2DAFA 2AWTA 4MH0E 4FA6A 2PE9A 2ASQA 2EMSA 3PHXB 2KJRA 3AU5A 5IAAC 3IFWB 3RD2A 1WJUA 2RSUA 1V5OA 3JVZX 4PS7A 1P9DU 4B95A 2LWPA 3DQVA 1J0GA 1CMXB 3APCA 4IWQA 3KVFB 2ZEQA 3L0WB 2KFJA 2XEWA 3TIXA 4DHZE 3HIZA 3NS8A 2I1JA 2K1FA 5DPRA 5G55A 1E5WA 3ZNHB 3K9OB 2ZPYA 2AEHA 4PS3A 2M8SA 4KSKC 2AL3A 4IWOA 4NPNA 4W9LA 4AOFA 4EZKA 3ZDMC 3H7PB 3OAWA 3PV1A 4HDOA 3PTFC 5DPTA 4NQKE 2IY1B 3A1QA 4AJWA 1V2YA 4EZJA 1A5RA 1RAXA 2KMCA 3DVGY 2JF5A 4K7UA 2N7EA 1NBFC 3LDZE 1WX9A 2C60A 2KJ6A 2EKEC 1E8YA 1WMHB 4N9F4 3JSVB 2FCMA 4DDID 3QX1A 4KDIC 5D94A 4FLHA 2N9PC 2KWCA 4J6IA 4IWPA 3QJZA 1E8ZA 3EC8A 3RULA 4W9KA 3L16A 5HKHA 2KDFB 4E3CA 3DOWA 2LXAA 1YD8U 1NI2A 2ZCBA 3L13A 4JLCA 3UINB 3DVGX 1P1AA 1YIWA 1WGGA 1WXSA 1WX8A 1XQQA 3KW5B 2KJHB 4W9EA 5DPWA 4IG7B 2IYDB 3V6CB 2DAJA 4MJSB 2GMIC 2WX1A 3AXCA 2ZVNA 4NJ6A 2FCNA 2REXA 1WJ4A 2N9XA 3CF6E 3VH4B 1LFDA 5CX3A 2KHWB 1WZ0A 4GMVA 1V6EA 4ANUA 1E7UA 2JZ3B 2JRIB 3WIMA 4ANXA 2LJ5A 4WQOB 2IO3B 2MRPA 2FAZA 2YLMA 3RYTA 4HWIB 3PRMB 3Q3JA 4GDLB 3WAOA 4AP4C 2DZJA 3UF8A 4HDQA 3PT2B 2JY6A 2M1MA 2WDTB 1S3SG 4M8NA 4FBJB 2D3GA 4ANVA 2FIFA 4RM9A 2L8JA 5AZFA 4HPMB 4K7SA 2NPTA 3KUDB 4ICVA 4II2B 4IC7B 4OVVA 5C1ZA 1OTRB 3A9KA 3KUCB 2LZ6A 3ZTCA 2KC1A 2K6DB 2VRRB 3BINA 1WMHA 2CU1A 5AZGA 3X23A 3JSVA 2KLGA 3MTNB 2NBUA 2LVOA 4P7IA 2DYBA 2G45B 2ZZPB 4TUUA 2KTRB 1TBEA 5JH5C 2IZVB 5FR6A 2XK5B 3A33B 4NNJB 3ZVVA 3APDA 3M3JA 1RLFA 4I6NB 2DX5B 4DHJD 2J0JA 3T9LA 3D32A 1WFYA 2Z0DB 1GC6A 2BGFA 3PLUA 2LUEA 2FNJB 1E90A 3L17A 4LDTD 5IA7A 3ZUNA 2MQJA 5JHAA 1MG8A 1ZKHA 2JXXA 2KC2A 2KFKB 4GOCA 2LRUA 1WR6E 1SIFA 2RD0A 3PHWB 1ZW7A 4GDKB 4MJSA 2FIDA 4JQWC 3A4SC 5LLIA 4BOZB 1WYWB 3GZNI 1S1QB 4BKSA 3WA0A 4TV3A 4K1RB 4KIKA 1V86A 2DHZA 2LVQA 3DVNU 4G50A 2MCNB 1LQBA 4WJPA 2K8BA 4BVUC 2GBNA 1WXVA 2NS5A 1WM2A 2KVRA 2MBQA 2O2VB 3X0WA 2GBKA 3IG3A 1KOTA 2LGDA 4MM3A 4GDLA 1KM7A 2L3ZA 3NZUA 2LVPA 2OJRA 5AEKB 1RFAA 4CYEA 2CHWA 4IW0A 3V61A 3ZO5B 1V81A 2G3QB 1C3TA 1R4NI 2CR5A 4ZYNA 3ZNGC 2D2QA 2M4NA 4IUMB 3VTUA 1I35A 4MGIE 2FCSA 3QWZB 1H4RA 4FHKA 4NAWB 4RMAA 3A9JB 1L2NA 2A5UA 2AL6A 1T0YA 1HE8A 2GBMA 1YQBA 4EEWA 4HVBA 4EUTA 3H6NA 3M63B 3QHTA 3IHPC 4BKGA 3NY5A 3ZKJC 4EOYA 2XK5A 4ZRJA 3ZW3A 2WX0A 3PLVA 3UGBB 2C9WB 3HHMA 2KOXA 2K25A 5JHBA 1QZEA 1WGDA 2JWZA 2MA9B 2K6QA 3H1UA 3HM3A 4CHKA 3B1LX 3QCAA 5E6NA 4XZ4A 2ZNVC 4W9JA 3ZRCA 1VD2A 2O6VB 1M94A 2MLBA 4FJZA 3AU4A 5GMVA 5KHQA 3ZNID 4BBNF 3WALA 1WI0A 1WF9A 1EO6A 2LGXA 3ECIA 3CSFA 4HCNB 2KX0A 3JW0X 4JIOU 2PPHA 4IM3A 4AJYB 2W9NA 3PRPB 2D07B 3V6EB 4HJKA 5CHVC 3I3TB 4I6LB 3NOBA 2L00B 1TGZB 1C1YB 1UZXB 1XD3B 2JZZA 4ZRIA 4KVGB 4G0NB 1V5TA 2FCQA 1SE9A 4DK5A 2J7QB 2V4LA 2I1KA 3H7SA 4BFRA 3EHVA 1Z2MA 1WGRA 2IY0B 1WY8A 2KDBA 4W9CA 1UD7A 3BY4B 3KYCD 1FXTB 2L05A 4GXBA 1E8XA 1Q0WB 1G6JA 5D2MB 2DYOA 5D6JB 3ZIMA 1Z5SB 3L08A 4NY0A 3VHTC 4HPLB 1TZ1A 3OJ3A 3A4RA 2LI5A 2LRWA 4A3OA 3RT3B 1R4MI 1LXDA 2C5LC 2DZMA 3VUYA 3VUWA 1GG3A 4KV2A 3SD5A 2KLCA 4BKTA 4W9HA 2KX3A 3DDCB 3HM6X 3N30A 3KH0A 2G4DB 2KWUB 4KZ0A 1XT9B 3TJPA 3JYUA 5G2NA 3ML8A 1P98A 4WJQA 4GIVA 3TMPB 2CHZA 3RZFA 2C7HA 4HXDA 2NCNA 2O6VA 2MP2B 3B08A 4A20A 3U7DA 1X1MA 4PS8A 4W9DA 1EF5A 4OVUA 2KTRA 3IVFA 1V49A 2MBHA 3P2BA 2KWVB 1V80A 3K9PB 4CO7A 2KNBA 3QARA 2GBJA 1WJ6A 2ZCCA 3NZSA
chains in the Genus database with same CATH superfamily
5IP4D 4M0WB 2HE7A 3A9KB 2OOBB 2MH7A 1STEA 3IT6B 1E7PB 1XO3A 2KFKA 3RN9C 2BYTA 3AE1B 2WWZA 1E6EB 1Y8RC 5L95C 4LDTB 1WM3A 2DNFA 1JWMD 1ESFA 3L10B 3MC8A 4IM0A 1WXMA 2QMTA 4ZRKA 1AYFA 3S2AA 4N6EB 3KYDD 3BVGA 4GDKA 4LNIA 4DDGD 1ZE3D 4ZYSA 4WWOA 1FCCC 1ZGUB 1FXIA 5FR3A 2WXLA 4W9GA 3UQAA 2IO1B 4I6PA 5KHOA 1FXAA 3QA8A 4REZA 2NR2A 3V62A 3APFA 1XLPA 4M02A 4HROA 4TQ0A 2J0MA 1KH0A 4E74A 1SB3C 2Z0EB 2O6VD 1EWCA 1J7AA 4O1NA 2FUHB 3R66C 5CTRC 2RDBC 2N1WA 3O65B 1TYGB 1UELA 2RMMA 2R2OA 4GU2A 1V97A 1JRUA 2WXRA 2K8HA 4US8A 2RDGA 3N1ZC 4BBNC 3T8MA 5EE9A 2ZPNA 2BWFA 5BO4B 3RZWC 3SU8X 1WR1A 2BWES 1R4NB 3R2IA 2BPSA 4C56C 3PSEB 3V60A 2MBEA 5BMHA 2NVUI 3M62B 1TS5A 3TEXA 1ISNA 3W1YA 2MBBB 3DBLI 3SHQA 1ZXHA 1KJTA 2BKRB 3EFCA 4HK2A 3ZYYX 4KSLC 1F1HA 2Z59B 2RPQA 5D7GA 1I4PA 5G5HA 3Q8AA 1TT5B 3NJTA 1UF0A 3VUXA 2MX2A 4G3XB 2UWQA 2FBWB 4W9FA 4ZHOA 4ASWC 4LCDE 1OFFA 2MSED 1N5XA 1N5WA 2KKCA 2BT6A 3PS6A 2EMTA 2WXQA 5TR5A 2N9LA 4XE0A 3RNGC 4OZCA 5GXGB 4Q2JA 2PKOA 1J7CA 1OGWA 3FKYA 2GBRA 4WWPA 1ZUD2 2E6XA 3QK0A 1GNUA 3EFUA 4MSQB 2BYEA 1PGBA 4P1CC 1FPYA 1PUTA 2K0PA 2IGHA 3VAWA 3TEWA 1WIAA 1P7FA 4GN1A 3PRZA 2WYQA 1WWTA 4MH8A 4YSZB 1OEYJ 4DXGA 3EGRA 3IBEA 2DAFA 2ASQA 4XGAB 2WP9B 1PGAA 3AE3B 1CK1A 2RSUA 3JVZX 3DQVA 3N1XC 1CMXB 1TS4A 2HTME 3VRAB 2ICIA 3TIXA 1OQQA 2D3AA 1KF6B 4AS1A 4PS3A 3OWEB 1VJKA 4KSKC 3IXSA 2PVOD 5D3DA 4W9LA 5DPTA 1ZDXA 3A1QA 3AEDB 3DVGY 2N7EA 1I4GA 4KGSA 4LNKA 1E8YA 2D5GA 3JSVB 1JALA 4KGRA 4P6VF 4J6IA 2KWCA 1SEBD 3L16A 5HKHA 1OQRA 3L13A 4KKIA 2MHJA 1WGGA 1XQQA 3KW5B 4W9EA 5DPWA 3NVYA 4IG7B 1F52A 2REXA 3CF6E 5CX3A 1V6EA 2Z8LA 2JZ3B 2YLMA 4RGNA 4HPPA 3WAOA 3UF8A 4LNNA 2WS3B 1S3SG 2JQRB 5AZFA 4II2B 1OTRB 1TZOA 1VZ7A 4HKZE 2KC1A 3BINA 3ZTCA 1QOAA 2KLGA 2WXHA 1N63A 4P7IA 2DYBA 2G45B 2XK5B 3FILA 4DHJD 1QQRA 2D3CA 1FRDA 3R8BA 1TY2A 3N20C 3L17A 2RPVA 3ZUNA 1K53A 3Q6BA 1SIFA 3PHWB 4N58A 1L4DB 1K52A 2FIDA 1UUPA 3DBRB 4KIKA 2DHZA 1WSPA 3U4EG 1AWDA 1SE4A 3IG3A 2CHWA 4LTUA 4A90A 1R4NI 3NS1A 3ZNGC 1MG4A 4IUMB 1YOVB 4FHKA 4NAWB 2AL6A 1IBXA 1T0YA 2ONQA 2VH1A 1YQBA 4HVBA 4EUTA 3AE9B 2WXIA 4BKGA 4EOYA 2INCC 2K25A 1I4QA 3H1UA 3BZDB 3I63C 3ZRCA 3HVZA 3R2TA 3ZNID 4BBNF 3AE6B 4P1BC 3P42A 3Q8FA 4HCNB 1UWMA 1CJEA 1T5XD 5CHVC 3NOBA 1TGZB 1XD3B 1UZXB 2N9KA 2W55A 2V4LA 4BFRA 1C4PA 1Z2MA 2KDBA 2L05A 2AQ2B 2GLSA 1E8XA 1Q0WB 1JW9D 5D6JB 3ZIMA 4NY0A 4A3OA 1MVKA 3RT3B 2C5LC 1L0VB 3P4RB 1GG3A 4KV2A 3SD5A 5TSSA 4N59A 4W9HA 1Q10A 2ON8A 3JYUA 2JXTA 4GIVA 2OEDA 2WXNA 2C7HA 4A20A 3U7DA 1X1MA 4PS8A 1JCKB 3Q8EA 4DXFA 4IOIE 2KTRA 1V80A 2MJEA 4CO7A 4OW0A 4GXBA 1KLGD 2VZKD 1HZ6A 3UIPB 3KWVA 4C80A 4HCPB 4TQ1A 3DHHC 3W5VB 4JGHB 2ZJDA 3RCZA 1Y56A 4RH6A 3H7PA 3W2DA 3QQ8B 5IO9A 4C7YA 1YQ3B 4ZDVA 2KO3A 2NBVB 2KK8A 3GOEA 4F8CB 2IPKD 2KANA 3VH3B 5CHFA 4WH4A 4B9KA 4J3OD 1KTKA 1K8RB 4WWNA 1LGRA 3Q3OC 2IGDA 1L5PA 2GI9A 3P4SB 4FJVB 1TIFA 4FJYA 4NQLB 2D10A 2RDHA 2ZVOA 3KUZA 1UH6A 3Q3FA 3VVWB 4FXCA 5G5GA 1V8CA 2V0GA 4BZAA 2UYZB 3PGEA 3VXWA 1P0RA 4RM8A 3AEFB 3BWUD 2BYVE 2HTHA 1DYQA 1I4XA 1BT0A 3TCAA 4JL9A 1EU4A 4GB9A 4LK0M 4URKA 2N9EB 5E6JA 3PPAA 2LXCA 3DCGA 3RFZB 1I42A 1OQYA 1SGHA 4BAXA 3AEEB 2LGSA 2MJ3A 4LJPB 4X57B 1LM8B 1SXTA 4PT5A 2B3AA 1WE7A 2L83A 4WJNA 3W1SC 5JXVA 4FN2A 1VCBA 4DXAB 4EE2A 3EUB2 2HJ8A 1UBIA 2BVCA 1UGMA 3OJ4B 4XDDA 2L76A 5FKAC 2IO0B 3AH7A 1E7VA 5HI1A 1B9RA 3B0AA 1H8CA 2ACZB 2BS4B 2PIAA 3R7QA 1RRBA 1OEYA 4MGYE 3DHIC 1WH3A 2A4ZA 3PREA 4D2KA 3DVNV 4EFOA 4DHJB 2MP2A 3WAPA 1YN3A 4B6WA 4W9IA 1IYFA 2IBIB 2JVCA 3AE8B 1GB4A 1Q5WB 2WU5B 1IPGA 2X8XX 4F1SA 4WJOA 2V3PA 1GB1A 2AYOB 4MDKE 3C0RB 5J17A 4GSWA 5EDSA 4II3B 1JQ4A 3BVZA 1B1ZA 3HRDD 2PJHA 2KQSA 2BYFA 1FNUA 1KRHA 4PYUA 2JU6X 1L7YA 4XC2A 2M56B 3J9CA 1RWSA 3W1SA 3AEGB 3RUIB 1EUVB 5LXHA 1VZ6A 3N3KB 1UBQA 3ML9A 1JRPA 1D3ZA 3SDLC 1QILA 1FO4A 2W3SA 2V3NA 3ZJVA 2V9HA 1TS3A 1MFWA 2QHOA 1F0ZA 1YJJA 2PLPA 2EMSA 4S17A 4ZOHC 5IAAC 1V5OA 4PS7A 1P9DU 1J0GA 3APCA 1PFDA 3KVFB 1CQVA 4A9AA 4S0RA 2JX5A 2KFJA 2WXOA 2XEWA 5DPRA 5G55A 2K1FA 2PTLA 2ZPYA 4LNFA 1GPXA 2KACA 1JWBD 3PV1A 4GLSC 3PTFC 4NQKE 2IY1B 1A5RA 4K7UA 5I4DA 3E9SA 3I9V1 2FCMA 4KDIC 2N9PC 4YTMB 4YT0B 2Y5PA 1XLNA 3GB1A 3DOWA 1FEHA 1XXGA 1YD8U 1NI2A 3NUHB 3UINB 3DVGX 3LYYA 3RNFC 4YTNB 2Y5CA 1I4HA 3GS2A 1VZ8A 4NJ6A 2FCNA 1WJ4A 2N9XA 1XLQA 3NVVA 2JRIB 2WDRB 2MRPA 4NZLB 2OJWA 3PRMB 3Q3JA 1A70A 2W54A 3PT2B 2J52A 2KT7A 2WDTB 4M8NA 5IOIA 2FIFA 3C19A 3KUDB 4OVVA 1HXYD 5AZGA 1WMHA 2CU1A 2LVOA 1NEKB 2G9HD 4TUUA 1NENB 2IZVB 4NNJB 3CIRB 1RLFA 3B9JA 2DX5B 1BUIC 3D32A 3N9YC 1GC6A 2LUEA 2FNJB 1CZPA 1E90A 2KMMA 4LDTD 1L4ZB 3FAHA 2MQJA 5JHAA 5EE1A 1ZKHA 2Q5WD 4ACFA 2RD0A 3U7ZA 1ZW7A 4MJSA 1SJHD 4JQWC 3A4SC 1WYWB 3GZNI 4ZHPA 3WA0A 1E0ZA 2MCNB 2LVQA 2E3TA 5BYRA 1LQBA 4HRSA 2K8BA 2GBNA 1WXVA 2W3RA 2KAJA 2NS5A 2TSSA 5EE3A 3X0WA 4YXDB 2L3ZA 1RFAA 1BMLC 2CR5A 1I35A 4MGIE 2FCSA 2HDEA 3QWZB 1H4RA 4RMAA 2GBMA 2SAKA 3H6NA 1UGJA 3M63B 3QHTA 1C4AA 2WX0A 3PLVA 3UGBB 3HHMA 2KOXA 3IAS1 1K51A 2K6QA 3HM3A 4CHKA 2QILA 4FJZA 1ZDVA 1YMHE 5KHQA 1WI0A 3BYYB 1SJED 1HTOA 4RF0A 2PPHA 3MHZA 4WAFA 4HJKA 2FCQA 4DK5A 3EHVA 2GB1A 1WGRA 2IY0B 1WY8A 1XF5L 1T0SC 5D2MB 2DYOA 3L08A 5IKCM 3ZQ4A 4HPLB 3A4RA 2LRWA 2OHFA 2NMQA 3VUYA 3VUWA 2LHEA 1BXTA 1D4BA 1FNWA 1QKZA 4LLGM 3HM6X 1TJEA 3KH0A 2KWUB 5G2NA 4WJQA 1P98A 4IDIA 1HZ5A 4TSSA 3TMPB 3RZFA 3Q8BA 4HXDA 3B08A 3P1MA 1I4RA 1SF0A 1YN4A 2LGIA 4OVUA 4RGTA 1T6BX 2KNBA 3QARA 4RCOA 1WJ6A 4USAA 1GC7A 5L83A 2WXMA 3OG5A 1D5ZC 2K22A 3AULA 3AV8A 4K7WA 3TUOA 1KLVA 4AWJA 1IP9A 2BF8B 3MJWA 3IAM1 3QAQA 4MSMB 1FD6A 2V4IB 2INPE 3NVZA 2JWUA 4EZLA 5T8IA 2BBCA 1SE3A 2JUOA 2L0TA 3ALBA 1WXAA 2N7JA 3H9DA 1C78A 2WXJA 4RF1A 3T3NA 4FULA 2KN4A 2DZIA 1U4AA 4NAWA 1MHHE 2KDEB 4MGKE 1Q1OA 1ROEA 2BKFA 1WZ3A 2KD0A 2LGYA 2KWDA 2MW5A 1WGHA 2HD5B 1ZXIA 2PEAA 3CSTA 2L7RA 5J2RA 3UQBA 1WJNA 4DHZB 2LEKA 3VFKA 1L0XB 1QT9A 2EELA 2J4XA 4LJOB 3RNCC 2CJNA 2G4SA 5AUKA 3PZDA 2V1YA 2CKHB 1GOZA 5FK9C 5H8YE 2KXJA 4ANWA 1ACCA 1TY0A 1AARA 2LASA 4AQ7A 3VR9B 3WANA 2KMAA 4JX1C 3R3MA 1IGDA 4IM2A 2BS2B 2J0KA 2M0XA 2YVCA 5E6OA 5DCNA 3TL5A 3DWMA 3N32A 2V3SA 4B0MA 2DBYA 2BB6A 1PGXA 3V05A 3R7RA 3M95A 3L54A 4DBGA 4MM3B 2LD9A 3MFGA 4KZCA 2NPTB 2Y5BB 4A3PA 2K39A 3KWLA 5MPOA 5DPSA 2K3UA 1TTNA 2K9XA 2IO2B 1YX6B 1SE2A 3DBRI 4NJ7A 1GJZA 1VR9A 3OLMD 1XEEA 4MEMA 3AMZA 2LFIA 2PW9A 1E8WA 3CMMB 1RFKA 2KYWA 1WE6A 2QEJC 3AI5A 3TEYA 2VZKB 1PQSA 3TBLD 1HQRD 4TKNA 2WHIA 1T0RC 2ZW1A 4K81A 5E6PA 2N7DA 2KDIA 1WXQA 2INDC 4M8MA 3SEBA 2D3BA 3E56A 1JWSD 3LJ3A 2L0FA 2AQ1B 3TSSA 3VQIA 2O2VA 4MH0E 2AWTA 2PE9A 3DBLB 4RGMA 2KJRA 3RD2A 2BS3B 4B95A 2LWPA 1V1OA 3KLSX 3B2GA 2LHDA 2IDYA 4QAYA 4HJGE 1DGJA 2ZEQA 3AB5A 3L0WB 1GAQB 4B0EA 3NS8A 2H89B 4TMAB 3K9OB 2AEHA 1N60A 2GRIA 1E10A 1AW7A 2L52A 2M8SA 2AL3A 4IWOA 1D5MC 4NPNA 1IGCA 3H7PB 3OAWA 4HDOA 4AJWA 4EZJA 1V2YA 1XCTL 4C4VB 1NBFC 2C60A 1VDVA 2KJ6A 1F2RC 3GE3C 1WMHB 4N9F4 1T0QC 1YJIA 3QX1A 4FLHA 4IWPA 3QJZA 3EC8A 3RULA 4W9KA 2INNE 2ZCBA 2M19A 1YIWA 1WXSA 1I7HA 4XDCA 4WWMA 3P4QB 2IYDB 3V6CB 2YEPF 1RYJA 4MJSB 2X38A 4RNAA 1N62A 3U2SC 3NRZA 3VH4B 4GMVA 4ANUA 5HHDG 3WIMA 4WQOB 1R4MB 4HDQA 3T3OA 2JY6A 1SSNA 3Q69A 2WNMA 1FCLA 3UI3A 4FBJB 2D3GA 4ANVA 4RM9A 2L8JA 4OHJA 4HPMB 1JROA 4IC7B 4ARCA 3NG0A 2LZ6A 2VRRB 2K6DB 3ZXVA 3X23A 3MTNB 2ZZPB 1TBEA 1D6EC 1C77A 2Y3AA 5JH5C 5FR6A 3A33B 3APDA 4P16A 4ARIA 1WFYA 2R61A 2Z0DB 2BGFA 3PLUA 4OZAA 5IA7A 4WQMA 2QDFA 2VH2A 1MG8A 4YTPB 2KFKB 2M0AA 4GOCA 2K5PA 4H2AA 4XWWA 2WLBA 3BYTB 3Q2AC 4BOZB 1S1QB 4BKSA 4TV3A 1V86A 3DVNU 4G50A 3DBHB 1WM2A 1MPEA 2KVRA 2MBQA 2NTSA 4GDLA 4UDUC 3NZUA 2OJRA 5AEKB 4IW0A 2G3QB 4ZYNA 1EM7A 1YNTE 1MHXA 1ZP0B 4WURA 3VTUA 5H92C 1NVID 4RFBA 1FNVA 1QOBA 3AEBB 1TKGA 3RI7C 3ZKJC 1ET9A 3ZW3A 2C9WB 5JHBA 1WGDA 2JWZA 3B1LX 3QCAA 5E6NA 1FFVA 2ZNVC 2WGSA 1ZPSA 2MLBA 1FFUA 3AU4A 5GMVA 1TKEA 3WALA 5LNK1 3O13A 3DWGC 2JZPA 4YWGG 1NYRA 4JIOU 3MC9A 4IM3A 4KGTA 2D07B 3V6EB 3I3TB 3AECB 2L00B 4ZRIA 3IT4B 4KVGB 1F77A 1V5TA 4JWSC 1FMAD 1UD7A 3BY4B 3KYCD 3NVWA 1DOIA 1UWXA 1Z5SB 4NAMA 1TZ1A 2LI5A 2DWQA 2IGGA 1R4MI 1C79A 4DQOC 2KLCA 4BKTA 3ZJTA 4US9A 2KX3A 3VR8B 3DDCB 2KQ4X 1XT9B 2QSDA 3ZJUA 2CHZA 2BTEA 2O6VA 1VLBA 2H88B 4W9DA 1EF5A 2N0SB 1QF6A 3IVFA 4XWTA 3AE4B 3K9PB 3NZSA 1DOXA 1ZOYB 1JWUD 3ONSA 2XBBC 3VTWA 4ICUA 3QC8B 3U8ZA 2CJOA 2DLBA 3W9CB 2I2YA 2KQ7A 1L6VA 2AQ3B 3AM9A 1TKYA 3PVLA 3ZNZB 2KN5A 2DYMA 3FC4A 4BOSC 5J18A 3QIJA 1DOYA 2WXGA 2NBWB 2R2QA 4AUQC 2N4FA 2GOWA 2KDMA 2WXPA 3MC0B 3Q14C 5BMIA 4MELA 5AUIA 5LXIB 3RNBC 2JPHA 3VDZA 4EKUA 4C7ZA 4YL8A 2JRHA 1SIJA 4XYCA 3ZTDA 1F2RI 1FM0D 1YJ1A 1GUAB 1EF1A 3EECA 4G11A 3W5UB 2D11A 2ZW0A 4M0WA 1XCQL 4LNOA 2PE6B 4OZBA 2JT4B 3BVMA 3A1QB 1V1PA 2DENB 3DBHI 3I57A 1J8CA 1FIQA 4JE3B 4F7ZA 1WRDB 2C7MB 1C4CA 4HLEA 3ZRFA 4K3CA 5C3JB 1YQ4B 2K8CA 2NTTA 3NHEB 3ENEA 3WAMA 2MEKA 1ENFA 4HEA1 2QCZA 1NDDA 3HK0A 3RNAC 2N1VA 3EA6A 4DWFA 1MI0A 2RGFA 3I5JC 3ZLZA 3U30A 4BKSD 2CS4A 4KX6B 2KTFA 1VRAB 4KDLB 2JYEA 2W82A 1AN8A 3DPDA 3RNEC 3URYA 1ET6A 2HJ1A 1RM6C 4OVZA 3WCQA 4JPSA 1EU3A 1F9JA 1NI3A 3CWIA 5CHWA 1SBBB 4KIKB 2C7NB 4MGZE 3VTVA 1J19A 2RR9A 4YSXB 5JZEB 3SFDB 3H8HA 3RPFC 5C23A 1P3QU 4GGQA 5HG2A 3SFEB 2PMVA 1V9JA 2DZKA 2LJIA 4FHJA 2LUMA 1WX7A 4CQNA 1FRRA 1C76A 4WIPA 2J53A 1IBXB 2KZRA 1TS2A 2AX5A 3ZXRA 1P7EA 4PYZA 2ZNVB 4M00A 2M17A 4FADA 1WGYA 1UNSA 3ZDTA 4E71A 2MWSB 1IUEA 1QOFA 5BYSA 2L1AA 3BK2A 4XX5A 3DBSA 5IN7A 4WAAA 5AZHA 2MBOA 3UIOB 2CHXA 3MHSD 3MJ5A 1YX5B 3A9JA 4FA6A 3PZ8A 3C8YA 3PHXB 4K3BA 3AU5A 4JWUC 3IFWB 1WJUA 4ITKA 2BQQA 2FUG1 3LB8C 4R3DA 2JYTA 1WGKA 2I38A 4IWQA 2SEBD 4DHZE 3HIZA 1D5XC 2I1JA 1E5WA 2PVGC 3ZNHB 3P4PB 1K50A 3PZ7A 4EZKA 4AOFA 3ZDMC 2XNAC 1RAXA 2KMCA 2JF5A 3LDZE 1WX9A 1YN5A 3L4PA 2EKEC 3Q3NC 4DDID 3TEZA 2LMCA 5D94A 3BK1A 1LO5D 3AE5B 5EE0A 1E8ZA 3AE2B 4RGOS 1V1PB 2KDFB 4E3CA 3ZGZA 2LXAA 2WU2B 3ETRA 4JLCA 4ZRPA 1P1AA 3N1YC 1L6UA 2B76B 1WX8A 2KJHB 2DAJA 2GMIC 2WX1A 3AXCA 2ZVNA 1KLUD 3MP9A 1NYQA 2WDVB 4YSYB 1LFDA 2KHWB 1WZ0A 2WXFA 1E7UA 1EWYC 2XN9C 4ANXA 2G1EA 2LJ5A 2IO3B 3SR6A 2FAZA 3VRBB 3RYTA 3DHGC 4HWIB 4GDLB 2QIEB 4AP4C 2DZJA 3BIID 3HVDA 1PDXA 3RMKC 1E9MA 2M1MA 5BYQA 4L23A 1MJDA 3B2FA 1WYGA 4K7SA 1N61A 2NPTA 4ICVA 5C1ZA 3A9KA 3KUCB 1WRIA 4HKQA 3JSVA 3AEAB 4ZRQA 2NBUA 2KTRB 3ZVVA 3M3JA 4I6NB 2J0JA 3T9LA 1QLBB 3Q8CA 4A55A 3V3XA 2JXXA 3PO0A 2KC2A 3P63A 2LRUA 1WR6E 4GDKB 2EKIA 2QJLA 5C2TB 2IJ0A 2WDQB 5LLIA 4PK1A 4K1RB 1JMLA 3AN1A 4WJPA 1QOGA 1XLOA 4BVUC 5HFYA 2O2VB 1C9FA 2GBKA 1KOTA 2LGDA 2YEPB 4MM3A 1KM7A 3AE7B 2LVPA 2J42A 3LXFA 4CYEA 2MJDA 3V61A 3ZO5B 1V81A 1J7BA 1C3TA 3U52E 2D2QA 2M4NA 4A6QA 2BB5A 1L2NA 3A9JB 2A5UA 1HE8A 4C00A 4EEWA 3GZNB 2FE8A 2JSVX 3IHPC 3NY5A 2WQYB 2XK5A 3FILB 4A8XC 4ZRJA 3NZ3A 1QZEA 2MA9B 1KFYB 1M4VA 5D3IB 2BW2A 4C4VA 4XZ4A 4W9JA 1VD2A 2O6VB 1PYWD 1M94A 2CU3A 2L32A 1HEZE 1WF9A 1EO6A 2LGXA 3ECIA 3CSFA 1HTQA 2KX0A 3JW0X 3KQ4A 3Q3MC 4AJYB 2W9NA 3PRPB 2QC8A 1R7SA 4I6LB 1C1YB 2JZZA 4G0NB 1SE9A 2J7QB 3H7SA 2I1KA 4M01A 4W9CA 1FXTB 3GE8C 2UU7A 1G6JA 3VHTC 2KVZA 3OJ3A 4L2YA 1HA5A 1LXDA 3HUIA 2DZMA 1L0YB 1N6ZA 3ABVB 3N30A 2G4DB 4MACA 4KZ0A 5BMGA 3TJPA 1T3QA 2WXKA 3ML8A 4NJCA 4KKJA 3GP7A 2NCNA 2MP2B 4MT5A 4L1BA 4IKGA 1JWAD 1V49A 2MBHA 3P2BA 2KWVB 2GBJA 2ZCCA
chains in the Genus database with same CATH topology
1GC7A 5L83A 4M0WB 2HE7A 3UIPB 3A9KB 3ONSA 2XBBC 3VTWA 2OOBB 3QC8B 4ICUA 3U8ZA 4HCPB 4TQ1A 3AULA 4K7WA 4JGHB 2ZJDA 3RCZA 2KFKA 2KQ7A 1KLVA 4AWJA 1IP9A 2BF8B 3MJWA 3PVLA 3ZNZB 2KN5A 2WWZA 3H7PA 3QAQA 2DYMA 1Y8RC 3QQ8B 4MSMB 5L95C 4LDTB 1WM3A 4BOSC 3L10B 5J18A 3QIJA 2KO3A 4IM0A 2NBVB 4ZDVA 2KK8A 1WXMA 4ZRKA 3GOEA 2NBWB 2R2QA 4F8CB 4EZLA 2KANA 4AUQC 3S2AA 3VH3B 2N4FA 5CHFA 4B9KA 3KYDD 2GOWA 1K8RB 4GDKA 4WWNA 4DDGD 2JUOA 2L0TA 3ALBA 1WXAA 4WWOA 4FJVB 1ZGUB 4FJYA 4NQLB 4MELA 5LXIB 2D10A 3H9DA 4W9GA 2IO1B 3UQAA 2ZVOA 3KUZA 4I6PA 5KHOA 1UH6A 3Q3FA 3QA8A 3VVWB 4FULA 2JPHA 3VDZA 2DZIA 4EKUA 1U4AA 4NAWA 2NR2A 2KDEB 4MGKE 3V62A 1Q1OA 4YL8A 2BKFA 3APFA 2JRHA 1WZ3A 2UYZB 2KD0A 3PGEA 2LGYA 4TQ0A 2J0MA 2MW5A 1YJ1A 3ZTDA 3VXWA 4E74A 1GUAB 1EF1A 2Z0EB 1P0RA 4RM8A 3EECA 2O6VD 1WGHA 4G11A 2D11A 2HD5B 2PEAA 3CSTA 2L7RA 2BYVE 2FUHB 2HTHA 2PE6B 5J2RA 1BT0A 3R66C 1WJNA 3TCAA 5CTRC 3UQBA 4DHZB 4JL9A 2JT4B 3A1QB 4GB9A 3VFKA 4URKA 2DENB 3DBHI 2N9EB 3PPAA 2LXCA 2N1WA 3O65B 1J8CA 3DCGA 4LJOB 1I42A 1OQYA 4F7ZA 1SGHA 1WRDB 1UELA 2G4SA 2C7MB 4HLEA 2R2OA 4GU2A 3ZRFA 1JRUA 4LJPB 2K8HA 3PZDA 2K8CA 4X57B 1LM8B 4BBNC 2V1YA 3NHEB 3T8MA 3ENEA 2CKHB 3WAMA 2KXJA 2ZPNA 4ANWA 2B3AA 1WE7A 1NDDA 2BWFA 4WJNA 5BO4B 3HK0A 1AARA 3RZWC 3W1SC 2LASA 2N1VA 3SU8X 1WR1A 2BWES 4DWFA 3WANA 4FN2A 2BPSA 2RGFA 1VCBA 2KMAA 4DXAB 3ZLZA 3U30A 4BKSD 3PSEB 3R3MA 2HJ8A 2CS4A 3V60A 2KTFA 1UBIA 2MBEA 1UGMA 3OJ4B 2NVUI 4KDLB 3M62B 2L76A 4IM2A 2IO0B 1ISNA 2J0KA 1E7VA 3DPDA 3B0AA 3W1YA 2MBBB 2M0XA 2YVCA 5E6OA 5DCNA 3TL5A 3DBLI 3SHQA 3N32A 1H8CA 2V3SA 1KJTA 2BKRB 3R7QA 1F9JA 4HK2A 4KSLC 1RRBA 1OEYA 5CHWA 4KIKB 2Z59B 2RPQA 3R7RA 4MGYE 2C7NB 3M95A 4MGZE 3VTVA 3L54A 5D7GA 4DBGA 1WH3A 2A4ZA 3PREA 1J19A 2RR9A 3DVNV 4EFOA 5JZEB 4DHJB 2MP2A 3WAPA 4B6WA 4W9IA 1IYFA 2IBIB 2LD9A 5C23A 3VUXA 1P3QU 2JVCA 2MX2A 4G3XB 1Q5WB 4KZCA 2UWQA 2NPTB 4GGQA 1IPGA 4W9FA 4F1SA 1V9JA 2DZKA 4FHJA 4WJOA 2Y5BB 1WX7A 4A3PA 4ASWC 4LCDE 2K39A 5DPSA 1TTNA 2MSED 2AYOB 4MDKE 3C0RB 2IO2B 5J17A 1YX6B 3DBRI 2KKCA 4NJ7A 1GJZA 2KZRA 4GSWA 5EDSA 3PS6A 2EMTA 4II3B 3OLMD 4PYZA 5TR5A 4MEMA 2PJHA 2KQSA 1E8WA 2BYFA 3CMMB 2ZNVB 4PYUA 4FADA 1OGWA 2M17A 1WE6A 1WGYA 2GBRA 3ZDTA 4WWPA 3AI5A 4E71A 1L7YA 2MWSB 4XC2A 3QK0A 1GNUA 3EFUA 4MSQB 1PQSA 2BYEA 3W1SA 3TBLD 4TKNA 3RUIB 4XX5A 3VAWA 1EUVB 5LXHA 3DBSA 3N3KB 4K81A 5E6PA 1WIAA 1UBQA 2N7DA 4WAAA 2KDIA 3ML9A 5AZHA 4GN1A 1D3ZA 3PRZA 4M8MA 2MBOA 2WYQA 3SDLC 3UIOB 1OEYJ 2CHXA 3LJ3A 3MHSD 2L0FA 3VQIA 1YX5B 3IBEA 2O2VA 3A9JA 2QHOA 2DAFA 2AWTA 4MH0E 4FA6A 2PE9A 2ASQA 2EMSA 3PHXB 2KJRA 3AU5A 5IAAC 3IFWB 3RD2A 1WJUA 2RSUA 1V5OA 3JVZX 4PS7A 1P9DU 4B95A 2LWPA 3DQVA 1J0GA 1CMXB 3APCA 4IWQA 3KVFB 2ZEQA 3L0WB 2KFJA 2XEWA 3TIXA 4DHZE 3HIZA 3NS8A 2I1JA 2K1FA 5DPRA 5G55A 1E5WA 3ZNHB 3K9OB 2ZPYA 2AEHA 4PS3A 2M8SA 4KSKC 2AL3A 4IWOA 4NPNA 4W9LA 4AOFA 4EZKA 3ZDMC 3H7PB 3OAWA 3PV1A 4HDOA 3PTFC 5DPTA 4NQKE 2IY1B 3A1QA 4AJWA 1V2YA 4EZJA 1A5RA 1RAXA 2KMCA 3DVGY 2JF5A 4K7UA 2N7EA 1NBFC 3LDZE 1WX9A 2C60A 2KJ6A 2EKEC 1E8YA 1WMHB 4N9F4 3JSVB 2FCMA 4DDID 3QX1A 4KDIC 5D94A 4FLHA 2N9PC 2KWCA 4J6IA 4IWPA 3QJZA 1E8ZA 3EC8A 3RULA 4W9KA 3L16A 5HKHA 2KDFB 4E3CA 3DOWA 2LXAA 1YD8U 1NI2A 2ZCBA 3L13A 4JLCA 3UINB 3DVGX 1P1AA 1YIWA 1WGGA 1WXSA 1WX8A 1XQQA 3KW5B 2KJHB 4W9EA 5DPWA 4IG7B 2IYDB 3V6CB 2DAJA 4MJSB 2GMIC 2WX1A 3AXCA 2ZVNA 4NJ6A 2FCNA 2REXA 1WJ4A 2N9XA 3CF6E 3VH4B 1LFDA 5CX3A 2KHWB 1WZ0A 4GMVA 1V6EA 4ANUA 1E7UA 2JZ3B 2JRIB 3WIMA 4ANXA 2LJ5A 4WQOB 2IO3B 2MRPA 2FAZA 2YLMA 3RYTA 4HWIB 3PRMB 3Q3JA 4GDLB 3WAOA 4AP4C 2DZJA 3UF8A 4HDQA 3PT2B 2JY6A 2M1MA 2WDTB 1S3SG 4M8NA 4FBJB 2D3GA 4ANVA 2FIFA 4RM9A 2L8JA 5AZFA 4HPMB 4K7SA 2NPTA 3KUDB 4ICVA 4II2B 4IC7B 4OVVA 5C1ZA 1OTRB 3A9KA 3KUCB 2LZ6A 3ZTCA 2KC1A 2K6DB 2VRRB 3BINA 1WMHA 2CU1A 5AZGA 3X23A 3JSVA 2KLGA 3MTNB 2NBUA 2LVOA 4P7IA 2DYBA 2G45B 2ZZPB 4TUUA 2KTRB 1TBEA 5JH5C 2IZVB 5FR6A 2XK5B 3A33B 4NNJB 3ZVVA 3APDA 3M3JA 1RLFA 4I6NB 2DX5B 4DHJD 2J0JA 3T9LA 3D32A 1WFYA 2Z0DB 1GC6A 2BGFA 3PLUA 2LUEA 2FNJB 1E90A 3L17A 4LDTD 5IA7A 3ZUNA 2MQJA 5JHAA 1MG8A 1ZKHA 2JXXA 2KC2A 2KFKB 4GOCA 2LRUA 1WR6E 1SIFA 2RD0A 3PHWB 1ZW7A 4GDKB 4MJSA 2FIDA 4JQWC 3A4SC 5LLIA 4BOZB 1WYWB 3GZNI 1S1QB 4BKSA 3WA0A 4TV3A 4K1RB 4KIKA 1V86A 2DHZA 2LVQA 3DVNU 4G50A 2MCNB 1LQBA 4WJPA 2K8BA 4BVUC 2GBNA 1WXVA 2NS5A 1WM2A 2KVRA 2MBQA 2O2VB 3X0WA 2GBKA 3IG3A 1KOTA 2LGDA 4MM3A 4GDLA 1KM7A 2L3ZA 3NZUA 2LVPA 2OJRA 5AEKB 1RFAA 4CYEA 2CHWA 4IW0A 3V61A 3ZO5B 1V81A 2G3QB 1C3TA 1R4NI 2CR5A 4ZYNA 3ZNGC 2D2QA 2M4NA 4IUMB 3VTUA 1I35A 4MGIE 2FCSA 3QWZB 1H4RA 4FHKA 4NAWB 4RMAA 3A9JB 1L2NA 2A5UA 2AL6A 1T0YA 1HE8A 2GBMA 1YQBA 4EEWA 4HVBA 4EUTA 3H6NA 3M63B 3QHTA 3IHPC 4BKGA 3NY5A 3ZKJC 4EOYA 2XK5A 4ZRJA 3ZW3A 2WX0A 3PLVA 3UGBB 2C9WB 3HHMA 2KOXA 2K25A 5JHBA 1QZEA 1WGDA 2JWZA 2MA9B 2K6QA 3H1UA 3HM3A 4CHKA 3B1LX 3QCAA 5E6NA 4XZ4A 2ZNVC 4W9JA 3ZRCA 1VD2A 2O6VB 1M94A 2MLBA 4FJZA 3AU4A 5GMVA 5KHQA 3ZNID 4BBNF 3WALA 1WI0A 1WF9A 1EO6A 2LGXA 3ECIA 3CSFA 4HCNB 2KX0A 3JW0X 4JIOU 2PPHA 4IM3A 4AJYB 2W9NA 3PRPB 2D07B 3V6EB 4HJKA 5CHVC 3I3TB 4I6LB 3NOBA 2L00B 1TGZB 1C1YB 1UZXB 1XD3B 2JZZA 4ZRIA 4KVGB 4G0NB 1V5TA 2FCQA 1SE9A 4DK5A 2J7QB 2V4LA 2I1KA 3H7SA 4BFRA 3EHVA 1Z2MA 1WGRA 2IY0B 1WY8A 2KDBA 4W9CA 1UD7A 3BY4B 3KYCD 1FXTB 2L05A 4GXBA 1E8XA 1Q0WB 1G6JA 5D2MB 2DYOA 5D6JB 3ZIMA 1Z5SB 3L08A 4NY0A 3VHTC 4HPLB 1TZ1A 3OJ3A 3A4RA 2LI5A 2LRWA 4A3OA 3RT3B 1R4MI 1LXDA 2C5LC 2DZMA 3VUYA 3VUWA 1GG3A 4KV2A 3SD5A 2KLCA 4BKTA 4W9HA 2KX3A 3DDCB 3HM6X 3N30A 3KH0A 2G4DB 2KWUB 4KZ0A 1XT9B 3TJPA 3JYUA 5G2NA 3ML8A 1P98A 4WJQA 4GIVA 3TMPB 2CHZA 3RZFA 2C7HA 4HXDA 2NCNA 2O6VA 2MP2B 3B08A 4A20A 3U7DA 1X1MA 4PS8A 4W9DA 1EF5A 4OVUA 2KTRA 3IVFA 1V49A 2MBHA 3P2BA 2KWVB 1V80A 3K9PB 4CO7A 2KNBA 3QARA 2GBJA 1WJ6A 2ZCCA 3NZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  5L83 A;  4M0W B;  2HE7 A;  3UIP B;  3A9K B;  3ONS A;  2XBB C;  3VTW A;  2OOB B;  3QC8 B;  4ICU A;  3U8Z A;  4HCP B;  4TQ1 A;  3AUL A;  4K7W A;  4JGH B;  2ZJD A;  3RCZ A;  2KFK A;  2KQ7 A;  1KLV A;  4AWJ A;  1IP9 A;  2BF8 B;  3MJW A;  3PVL A;  3ZNZ B;  2KN5 A;  2WWZ A;  3H7P A;  3QAQ A;  2DYM A;  1Y8R C;  3QQ8 B;  4MSM B;  5L95 C;  4LDT B;  1WM3 A;  4BOS C;  3L10 B;  5J18 A;  3QIJ A;  2KO3 A;  4IM0 A;  2NBV B;  4ZDV A;  2KK8 A;  1WXM A;  4ZRK A;  3GOE A;  2NBW B;  2R2Q A;  4F8C B;  4EZL A;  2KAN A;  4AUQ C;  3S2A A;  3VH3 B;  2N4F A;  5CHF A;  4B9K A;  3KYD D;  2GOW A;  1K8R B;  4GDK A;  4WWN A;  4DDG D;  2JUO A;  2L0T A;  3ALB A;  1WXA A;  4WWO A;  4FJV B;  1ZGU B;  4FJY A;  4NQL B;  4MEL A;  5LXI B;  2D10 A;  3H9D A;  4W9G A;  2IO1 B;  3UQA A;  2ZVO A;  3KUZ A;  4I6P A;  5KHO A;  1UH6 A;  3Q3F A;  3QA8 A;  3VVW B;  4FUL A;  2JPH A;  3VDZ A;  2DZI A;  4EKU A;  1U4A A;  4NAW A;  2NR2 A;  2KDE B;  4MGK E;  3V62 A;  1Q1O A;  4YL8 A;  2BKF A;  3APF A;  2JRH A;  1WZ3 A;  2UYZ B;  2KD0 A;  3PGE A;  2LGY A;  4TQ0 A;  2J0M A;  2MW5 A;  1YJ1 A;  3ZTD A;  3VXW A;  4E74 A;  1GUA B;  1EF1 A;  2Z0E B;  1P0R A;  4RM8 A;  3EEC A;  2O6V D;  1WGH A;  4G11 A;  2D11 A;  2HD5 B;  2PEA A;  3CST A;  2L7R A;  2BYV E;  2FUH B;  2HTH A;  2PE6 B;  5J2R A;  1BT0 A;  3R66 C;  1WJN A;  3TCA A;  5CTR C;  3UQB A;  4DHZ B;  4JL9 A;  2JT4 B;  3A1Q B;  4GB9 A;  3VFK A;  4URK A;  2DEN B;  3DBH I;  2N9E B;  3PPA A;  2LXC A;  2N1W A;  3O65 B;  1J8C A;  3DCG A;  4LJO B;  1I42 A;  1OQY A;  4F7Z A;  1SGH A;  1WRD B;  1UEL A;  2G4S A;  2C7M B;  4HLE A;  2R2O A;  4GU2 A;  3ZRF A;  1JRU A;  4LJP B;  2K8H A;  3PZD A;  2K8C A;  4X57 B;  1LM8 B;  4BBN C;  2V1Y A;  3NHE B;  3T8M A;  3ENE A;  2CKH B;  3WAM A;  2KXJ A;  2ZPN A;  4ANW A;  2B3A A;  1WE7 A;  1NDD A;  2BWF A;  4WJN A;  5BO4 B;  3HK0 A;  1AAR A;  3RZW C;  3W1S C;  2LAS A;  2N1V A;  3SU8 X;  1WR1 A;  2BWE S;  4DWF A;  3WAN A;  4FN2 A;  2BPS A;  2RGF A;  1VCB A;  2KMA A;  4DXA B;  3ZLZ A;  3U30 A;  4BKS D;  3PSE B;  3R3M A;  2HJ8 A;  2CS4 A;  3V60 A;  2KTF A;  1UBI A;  2MBE A;  1UGM A;  3OJ4 B;  2NVU I;  4KDL B;  3M62 B;  2L76 A;  4IM2 A;  2IO0 B;  1ISN A;  2J0K A;  1E7V A;  3DPD A;  3B0A A;  3W1Y A;  2MBB B;  2M0X A;  2YVC A;  5E6O A;  5DCN A;  3TL5 A;  3DBL I;  3SHQ A;  3N32 A;  1H8C A;  2V3S A;  1KJT A;  2BKR B;  3R7Q A;  1F9J A;  4HK2 A;  4KSL C;  1RRB A;  1OEY A;  5CHW A;  4KIK B;  2Z59 B;  2RPQ A;  3R7R A;  4MGY E;  2C7N B;  3M95 A;  4MGZ E;  3VTV A;  3L54 A;  5D7G A;  4DBG A;  1WH3 A;  2A4Z A;  3PRE A;  1J19 A;  2RR9 A;  3DVN V;  4EFO A;  5JZE B;  4DHJ B;  2MP2 A;  3WAP A;  4B6W A;  4W9I A;  1IYF A;  2IBI B;  2LD9 A;  5C23 A;  3VUX A;  1P3Q U;  2JVC A;  2MX2 A;  4G3X B;  1Q5W B;  4KZC A;  2UWQ A;  2NPT B;  4GGQ A;  1IPG A;  4W9F A;  4F1S A;  1V9J A;  2DZK A;  4FHJ A;  4WJO A;  2Y5B B;  1WX7 A;  4A3P A;  4ASW C;  4LCD E;  2K39 A;  5DPS A;  1TTN A;  2MSE D;  2AYO B;  4MDK E;  3C0R B;  2IO2 B;  5J17 A;  1YX6 B;  3DBR I;  2KKC A;  4NJ7 A;  1GJZ A;  2KZR A;  4GSW A;  5EDS A;  3PS6 A;  2EMT A;  4II3 B;  3OLM D;  4PYZ A;  5TR5 A;  4MEM A;  2PJH A;  2KQS A;  1E8W A;  2BYF A;  3CMM B;  2ZNV B;  4PYU A;  4FAD A;  1OGW A;  2M17 A;  1WE6 A;  1WGY A;  2GBR A;  3ZDT A;  4WWP A;  3AI5 A;  4E71 A;  1L7Y A;  2MWS B;  4XC2 A;  3QK0 A;  1GNU A;  3EFU A;  4MSQ B;  1PQS A;  2BYE A;  3W1S A;  3TBL D;  4TKN A;  3RUI B;  4XX5 A;  3VAW A;  1EUV B;  5LXH A;  3DBS A;  3N3K B;  4K81 A;  5E6P A;  1WIA A;  1UBQ A;  2N7D A;  4WAA A;  2KDI A;  3ML9 A;  5AZH A;  4GN1 A;  1D3Z A;  3PRZ A;  4M8M A;  2MBO A;  2WYQ A;  3SDL C;  3UIO B;  1OEY J;  2CHX A;  3LJ3 A;  3MHS D;  2L0F A;  3VQI A;  1YX5 B;  3IBE A;  2O2V A;  3A9J A;  2QHO A;  2DAF A;  2AWT A;  4MH0 E;  4FA6 A;  2PE9 A;  2ASQ A;  2EMS A;  3PHX B;  2KJR A;  3AU5 A;  5IAA C;  3IFW B;  3RD2 A;  1WJU A;  2RSU A;  1V5O A;  3JVZ X;  4PS7 A;  1P9D U;  4B95 A;  2LWP A;  3DQV A;  1J0G A;  1CMX B;  3APC A;  4IWQ A;  3KVF B;  2ZEQ A;  3L0W B;  2KFJ A;  2XEW A;  3TIX A;  4DHZ E;  3HIZ A;  3NS8 A;  2I1J A;  2K1F A;  5DPR A;  5G55 A;  1E5W A;  3ZNH B;  3K9O B;  2ZPY A;  2AEH A;  4PS3 A;  2M8S A;  4KSK C;  2AL3 A;  4IWO A;  4NPN A;  4W9L A;  4AOF A;  4EZK A;  3ZDM C;  3H7P B;  3OAW A;  3PV1 A;  4HDO A;  3PTF C;  5DPT A;  4NQK E;  2IY1 B;  3A1Q A;  4AJW A;  1V2Y A;  4EZJ A;  1A5R A;  1RAX A;  2KMC A;  3DVG Y;  2JF5 A;  4K7U A;  2N7E A;  1NBF C;  3LDZ E;  1WX9 A;  2C60 A;  2KJ6 A;  2EKE C;  1E8Y A;  1WMH B;  4N9F 4;  3JSV B;  2FCM A;  4DDI D;  3QX1 A;  4KDI C;  5D94 A;  4FLH A;  2N9P C;  2KWC A;  4J6I A;  4IWP A;  3QJZ A;  1E8Z A;  3EC8 A;  3RUL A;  4W9K A;  3L16 A;  5HKH A;  2KDF B;  4E3C A;  3DOW A;  2LXA A;  1YD8 U;  1NI2 A;  2ZCB A;  3L13 A;  4JLC A;  3UIN B;  3DVG X;  1P1A A;  1YIW A;  1WGG A;  1WXS A;  1WX8 A;  1XQQ A;  3KW5 B;  2KJH B;  4W9E A;  5DPW A;  4IG7 B;  2IYD B;  3V6C B;  2DAJ A;  4MJS B;  2GMI C;  2WX1 A;  3AXC A;  2ZVN A;  4NJ6 A;  2FCN A;  2REX A;  1WJ4 A;  2N9X A;  3CF6 E;  3VH4 B;  1LFD A;  5CX3 A;  2KHW B;  1WZ0 A;  4GMV A;  1V6E A;  4ANU A;  1E7U A;  2JZ3 B;  2JRI B;  3WIM A;  4ANX A;  2LJ5 A;  4WQO B;  2IO3 B;  2MRP A;  2FAZ A;  2YLM A;  3RYT A;  4HWI B;  3PRM B;  3Q3J A;  4GDL B;  3WAO A;  4AP4 C;  2DZJ A;  3UF8 A;  4HDQ A;  3PT2 B;  2JY6 A;  2M1M A;  2WDT B;  1S3S G;  4M8N A;  4FBJ B;  2D3G A;  4ANV A;  2FIF A;  4RM9 A;  2L8J A;  5AZF A;  4HPM B;  4K7S A;  2NPT A;  3KUD B;  4ICV A;  4II2 B;  4IC7 B;  4OVV A;  5C1Z A;  1OTR B;  3A9K A;  3KUC B;  2LZ6 A;  3ZTC A;  2KC1 A;  2K6D B;  2VRR B;  3BIN A;  1WMH A;  2CU1 A;  5AZG A;  3X23 A;  3JSV A;  2KLG A;  3MTN B;  2NBU A;  2LVO A;  4P7I A;  2DYB A;  2G45 B;  2ZZP B;  4TUU A;  2KTR B;  1TBE A;  5JH5 C;  2IZV B;  5FR6 A;  2XK5 B;  3A33 B;  4NNJ B;  3ZVV A;  3APD A;  3M3J A;  1RLF A;  4I6N B;  2DX5 B;  4DHJ D;  2J0J A;  3T9L A;  3D32 A;  1WFY A;  2Z0D B;  1GC6 A;  2BGF A;  3PLU A;  2LUE A;  2FNJ B;  1E90 A;  3L17 A;  4LDT D;  5IA7 A;  3ZUN A;  2MQJ A;  5JHA A;  1MG8 A;  1ZKH A;  2JXX A;  2KC2 A;  2KFK B;  4GOC A;  2LRU A;  1WR6 E;  1SIF A;  2RD0 A;  3PHW B;  1ZW7 A;  4GDK B;  4MJS A;  2FID A;  4JQW C;  3A4S C;  5LLI A;  4BOZ B;  1WYW B;  3GZN I;  1S1Q B;  4BKS A;  3WA0 A;  4TV3 A;  4K1R B;  4KIK A;  1V86 A;  2DHZ A;  2LVQ A;  3DVN U;  4G50 A;  2MCN B;  1LQB A;  4WJP A;  2K8B A;  4BVU C;  2GBN A;  1WXV A;  2NS5 A;  1WM2 A;  2KVR A;  2MBQ A;  2O2V B;  3X0W A;  2GBK A;  3IG3 A;  1KOT A;  2LGD A;  4MM3 A;  4GDL A;  1KM7 A;  2L3Z A;  3NZU A;  2LVP A;  2OJR A;  5AEK B;  1RFA A;  4CYE A;  2CHW A;  4IW0 A;  3V61 A;  3ZO5 B;  1V81 A;  2G3Q B;  1C3T A;  1R4N I;  2CR5 A;  4ZYN A;  3ZNG C;  2D2Q A;  2M4N A;  4IUM B;  3VTU A;  1I35 A;  4MGI E;  2FCS A;  3QWZ B;  1H4R A;  4FHK A;  4NAW B;  4RMA A;  3A9J B;  1L2N A;  2A5U A;  2AL6 A;  1T0Y A;  1HE8 A;  2GBM A;  1YQB A;  4EEW A;  4HVB A;  4EUT A;  3H6N A;  3M63 B;  3QHT A;  3IHP C;  4BKG A;  3NY5 A;  3ZKJ C;  4EOY A;  2XK5 A;  4ZRJ A;  3ZW3 A;  2WX0 A;  3PLV A;  3UGB B;  2C9W B;  3HHM A;  2KOX A;  2K25 A;  5JHB A;  1QZE A;  1WGD A;  2JWZ A;  2MA9 B;  2K6Q A;  3H1U A;  3HM3 A;  4CHK A;  3B1L X;  3QCA A;  5E6N A;  4XZ4 A;  2ZNV C;  4W9J A;  3ZRC A;  1VD2 A;  2O6V B;  1M94 A;  2MLB A;  4FJZ A;  3AU4 A;  5GMV A;  5KHQ A;  3ZNI D;  4BBN F;  3WAL A;  1WI0 A;  1WF9 A;  1EO6 A;  2LGX A;  3ECI A;  3CSF A;  4HCN B;  2KX0 A;  3JW0 X;  4JIO U;  2PPH A;  4IM3 A;  4AJY B;  2W9N A;  3PRP B;  2D07 B;  3V6E B;  4HJK A;  5CHV C;  3I3T B;  4I6L B;  3NOB A;  2L00 B;  1TGZ B;  1C1Y B;  1UZX B;  1XD3 B;  2JZZ A;  4ZRI A;  4KVG B;  4G0N B;  1V5T A;  2FCQ A;  1SE9 A;  4DK5 A;  2J7Q B;  2V4L A;  2I1K A;  3H7S A;  4BFR A;  3EHV A;  1Z2M A;  1WGR A;  2IY0 B;  1WY8 A;  2KDB A;  4W9C A;  1UD7 A;  3BY4 B;  3KYC D;  1FXT B;  2L05 A;  4GXB A;  1E8X A;  1Q0W B;  1G6J A;  5D2M B;  2DYO A;  5D6J B;  3ZIM A;  1Z5S B;  3L08 A;  4NY0 A;  3VHT C;  4HPL B;  1TZ1 A;  3OJ3 A;  3A4R A;  2LI5 A;  2LRW A;  4A3O A;  3RT3 B;  1R4M I;  1LXD A;  2C5L C;  2DZM A;  3VUY A;  3VUW A;  1GG3 A;  4KV2 A;  3SD5 A;  2KLC A;  4BKT A;  4W9H A;  2KX3 A;  3DDC B;  3HM6 X;  3N30 A;  3KH0 A;  2G4D B;  2KWU B;  4KZ0 A;  1XT9 B;  3TJP A;  3JYU A;  5G2N A;  3ML8 A;  1P98 A;  4WJQ A;  4GIV A;  3TMP B;  2CHZ A;  3RZF A;  2C7H A;  4HXD A;  2NCN A;  2O6V A;  2MP2 B;  3B08 A;  4A20 A;  3U7D A;  1X1M A;  4PS8 A;  4W9D A;  1EF5 A;  4OVU A;  2KTR A;  3IVF A;  1V49 A;  2MBH A;  3P2B A;  2KWV B;  1V80 A;  3K9P B;  4CO7 A;  2KNB A;  3QAR A;  2GBJ A;  1WJ6 A;  2ZCC A;  3NZS A; 
#chains in the Genus database with same CATH topology
 5IP4 D;  4M0W B;  2HE7 A;  3A9K B;  2OOB B;  2MH7 A;  1STE A;  3IT6 B;  1E7P B;  1XO3 A;  2KFK A;  3RN9 C;  2BYT A;  3AE1 B;  2WWZ A;  1E6E B;  1Y8R C;  5L95 C;  4LDT B;  1WM3 A;  2DNF A;  1JWM D;  1ESF A;  3L10 B;  3MC8 A;  4IM0 A;  1WXM A;  2QMT A;  4ZRK A;  1AYF A;  3S2A A;  4N6E B;  3KYD D;  3BVG A;  4GDK A;  4LNI A;  4DDG D;  1ZE3 D;  4ZYS A;  4WWO A;  1FCC C;  1ZGU B;  1FXI A;  5FR3 A;  2WXL A;  4W9G A;  3UQA A;  2IO1 B;  4I6P A;  5KHO A;  1FXA A;  3QA8 A;  4REZ A;  2NR2 A;  3V62 A;  3APF A;  1XLP A;  4M02 A;  4HRO A;  4TQ0 A;  2J0M A;  1KH0 A;  4E74 A;  1SB3 C;  2Z0E B;  2O6V D;  1EWC A;  1J7A A;  4O1N A;  2FUH B;  3R66 C;  5CTR C;  2RDB C;  2N1W A;  3O65 B;  1TYG B;  1UEL A;  2RMM A;  2R2O A;  4GU2 A;  1V97 A;  1JRU A;  2WXR A;  2K8H A;  4US8 A;  2RDG A;  3N1Z C;  4BBN C;  3T8M A;  5EE9 A;  2ZPN A;  2BWF A;  5BO4 B;  3RZW C;  3SU8 X;  1WR1 A;  2BWE S;  1R4N B;  3R2I A;  2BPS A;  4C56 C;  3PSE B;  3V60 A;  2MBE A;  5BMH A;  2NVU I;  3M62 B;  1TS5 A;  3TEX A;  1ISN A;  3W1Y A;  2MBB B;  3DBL I;  3SHQ A;  1ZXH A;  1KJT A;  2BKR B;  3EFC A;  4HK2 A;  3ZYY X;  4KSL C;  1F1H A;  2Z59 B;  2RPQ A;  5D7G A;  1I4P A;  5G5H A;  3Q8A A;  1TT5 B;  3NJT A;  1UF0 A;  3VUX A;  2MX2 A;  4G3X B;  2UWQ A;  2FBW B;  4W9F A;  4ZHO A;  4ASW C;  4LCD E;  1OFF A;  2MSE D;  1N5X A;  1N5W A;  2KKC A;  2BT6 A;  3PS6 A;  2EMT A;  2WXQ A;  5TR5 A;  2N9L A;  4XE0 A;  3RNG C;  4OZC A;  5GXG B;  4Q2J A;  2PKO A;  1J7C A;  1OGW A;  3FKY A;  2GBR A;  4WWP A;  1ZUD 2;  2E6X A;  3QK0 A;  1GNU A;  3EFU A;  4MSQ B;  2BYE A;  1PGB A;  4P1C C;  1FPY A;  1PUT A;  2K0P A;  2IGH A;  3VAW A;  3TEW A;  1WIA A;  1P7F A;  4GN1 A;  3PRZ A;  2WYQ A;  1WWT A;  4MH8 A;  4YSZ B;  1OEY J;  4DXG A;  3EGR A;  3IBE A;  2DAF A;  2ASQ A;  4XGA B;  2WP9 B;  1PGA A;  3AE3 B;  1CK1 A;  2RSU A;  3JVZ X;  3DQV A;  3N1X C;  1CMX B;  1TS4 A;  2HTM E;  3VRA B;  2ICI A;  3TIX A;  1OQQ A;  2D3A A;  1KF6 B;  4AS1 A;  4PS3 A;  3OWE B;  1VJK A;  4KSK C;  3IXS A;  2PVO D;  5D3D A;  4W9L A;  5DPT A;  1ZDX A;  3A1Q A;  3AED B;  3DVG Y;  2N7E A;  1I4G A;  4KGS A;  4LNK A;  1E8Y A;  2D5G A;  3JSV B;  1JAL A;  4KGR A;  4P6V F;  4J6I A;  2KWC A;  1SEB D;  3L16 A;  5HKH A;  1OQR A;  3L13 A;  4KKI A;  2MHJ A;  1WGG A;  1XQQ A;  3KW5 B;  4W9E A;  5DPW A;  3NVY A;  4IG7 B;  1F52 A;  2REX A;  3CF6 E;  5CX3 A;  1V6E A;  2Z8L A;  2JZ3 B;  2YLM A;  4RGN A;  4HPP A;  3WAO A;  3UF8 A;  4LNN A;  2WS3 B;  1S3S G;  2JQR B;  5AZF A;  4II2 B;  1OTR B;  1TZO A;  1VZ7 A;  4HKZ E;  2KC1 A;  3BIN A;  3ZTC A;  1QOA A;  2KLG A;  2WXH A;  1N63 A;  4P7I A;  2DYB A;  2G45 B;  2XK5 B;  3FIL A;  4DHJ D;  1QQR A;  2D3C A;  1FRD A;  3R8B A;  1TY2 A;  3N20 C;  3L17 A;  2RPV A;  3ZUN A;  1K53 A;  3Q6B A;  1SIF A;  3PHW B;  4N58 A;  1L4D B;  1K52 A;  2FID A;  1UUP A;  3DBR B;  4KIK A;  2DHZ A;  1WSP A;  3U4E G;  1AWD A;  1SE4 A;  3IG3 A;  2CHW A;  4LTU A;  4A90 A;  1R4N I;  3NS1 A;  3ZNG C;  1MG4 A;  4IUM B;  1YOV B;  4FHK A;  4NAW B;  2AL6 A;  1IBX A;  1T0Y A;  2ONQ A;  2VH1 A;  1YQB A;  4HVB A;  4EUT A;  3AE9 B;  2WXI A;  4BKG A;  4EOY A;  2INC C;  2K25 A;  1I4Q A;  3H1U A;  3BZD B;  3I63 C;  3ZRC A;  3HVZ A;  3R2T A;  3ZNI D;  4BBN F;  3AE6 B;  4P1B C;  3P42 A;  3Q8F A;  4HCN B;  1UWM A;  1CJE A;  1T5X D;  5CHV C;  3NOB A;  1TGZ B;  1XD3 B;  1UZX B;  2N9K A;  2W55 A;  2V4L A;  4BFR A;  1C4P A;  1Z2M A;  2KDB A;  2L05 A;  2AQ2 B;  2GLS A;  1E8X A;  1Q0W B;  1JW9 D;  5D6J B;  3ZIM A;  4NY0 A;  4A3O A;  1MVK A;  3RT3 B;  2C5L C;  1L0V B;  3P4R B;  1GG3 A;  4KV2 A;  3SD5 A;  5TSS A;  4N59 A;  4W9H A;  1Q10 A;  2ON8 A;  3JYU A;  2JXT A;  4GIV A;  2OED A;  2WXN A;  2C7H A;  4A20 A;  3U7D A;  1X1M A;  4PS8 A;  1JCK B;  3Q8E A;  4DXF A;  4IOI E;  2KTR A;  1V80 A;  2MJE A;  4CO7 A;  4OW0 A;  4GXB A;  1KLG D;  2VZK D;  1HZ6 A;  3UIP B;  3KWV A;  4C80 A;  4HCP B;  4TQ1 A;  3DHH C;  3W5V B;  4JGH B;  2ZJD A;  3RCZ A;  1Y56 A;  4RH6 A;  3H7P A;  3W2D A;  3QQ8 B;  5IO9 A;  4C7Y A;  1YQ3 B;  4ZDV A;  2KO3 A;  2NBV B;  2KK8 A;  3GOE A;  4F8C B;  2IPK D;  2KAN A;  3VH3 B;  5CHF A;  4WH4 A;  4B9K A;  4J3O D;  1KTK A;  1K8R B;  4WWN A;  1LGR A;  3Q3O C;  2IGD A;  1L5P A;  2GI9 A;  3P4S B;  4FJV B;  1TIF A;  4FJY A;  4NQL B;  2D10 A;  2RDH A;  2ZVO A;  3KUZ A;  1UH6 A;  3Q3F A;  3VVW B;  4FXC A;  5G5G A;  1V8C A;  2V0G A;  4BZA A;  2UYZ B;  3PGE A;  3VXW A;  1P0R A;  4RM8 A;  3AEF B;  3BWU D;  2BYV E;  2HTH A;  1DYQ A;  1I4X A;  1BT0 A;  3TCA A;  4JL9 A;  1EU4 A;  4GB9 A;  4LK0 M;  4URK A;  2N9E B;  5E6J A;  3PPA A;  2LXC A;  3DCG A;  3RFZ B;  1I42 A;  1OQY A;  1SGH A;  4BAX A;  3AEE B;  2LGS A;  2MJ3 A;  4LJP B;  4X57 B;  1LM8 B;  1SXT A;  4PT5 A;  2B3A A;  1WE7 A;  2L83 A;  4WJN A;  3W1S C;  5JXV A;  4FN2 A;  1VCB A;  4DXA B;  4EE2 A;  3EUB 2;  2HJ8 A;  1UBI A;  2BVC A;  1UGM A;  3OJ4 B;  4XDD A;  2L76 A;  5FKA C;  2IO0 B;  3AH7 A;  1E7V A;  5HI1 A;  1B9R A;  3B0A A;  1H8C A;  2ACZ B;  2BS4 B;  2PIA A;  3R7Q A;  1RRB A;  1OEY A;  4MGY E;  3DHI C;  1WH3 A;  2A4Z A;  3PRE A;  4D2K A;  3DVN V;  4EFO A;  4DHJ B;  2MP2 A;  3WAP A;  1YN3 A;  4B6W A;  4W9I A;  1IYF A;  2IBI B;  2JVC A;  3AE8 B;  1GB4 A;  1Q5W B;  2WU5 B;  1IPG A;  2X8X X;  4F1S A;  4WJO A;  2V3P A;  1GB1 A;  2AYO B;  4MDK E;  3C0R B;  5J17 A;  4GSW A;  5EDS A;  4II3 B;  1JQ4 A;  3BVZ A;  1B1Z A;  3HRD D;  2PJH A;  2KQS A;  2BYF A;  1FNU A;  1KRH A;  4PYU A;  2JU6 X;  1L7Y A;  4XC2 A;  2M56 B;  3J9C A;  1RWS A;  3W1S A;  3AEG B;  3RUI B;  1EUV B;  5LXH A;  1VZ6 A;  3N3K B;  1UBQ A;  3ML9 A;  1JRP A;  1D3Z A;  3SDL C;  1QIL A;  1FO4 A;  2W3S A;  2V3N A;  3ZJV A;  2V9H A;  1TS3 A;  1MFW A;  2QHO A;  1F0Z A;  1YJJ A;  2PLP A;  2EMS A;  4S17 A;  4ZOH C;  5IAA C;  1V5O A;  4PS7 A;  1P9D U;  1J0G A;  3APC A;  1PFD A;  3KVF B;  1CQV A;  4A9A A;  4S0R A;  2JX5 A;  2KFJ A;  2WXO A;  2XEW A;  5DPR A;  5G55 A;  2K1F A;  2PTL A;  2ZPY A;  4LNF A;  1GPX A;  2KAC A;  1JWB D;  3PV1 A;  4GLS C;  3PTF C;  4NQK E;  2IY1 B;  1A5R A;  4K7U A;  5I4D A;  3E9S A;  3I9V 1;  2FCM A;  4KDI C;  2N9P C;  4YTM B;  4YT0 B;  2Y5P A;  1XLN A;  3GB1 A;  3DOW A;  1FEH A;  1XXG A;  1YD8 U;  1NI2 A;  3NUH B;  3UIN B;  3DVG X;  3LYY A;  3RNF C;  4YTN B;  2Y5C A;  1I4H A;  3GS2 A;  1VZ8 A;  4NJ6 A;  2FCN A;  1WJ4 A;  2N9X A;  1XLQ A;  3NVV A;  2JRI B;  2WDR B;  2MRP A;  4NZL B;  2OJW A;  3PRM B;  3Q3J A;  1A70 A;  2W54 A;  3PT2 B;  2J52 A;  2KT7 A;  2WDT B;  4M8N A;  5IOI A;  2FIF A;  3C19 A;  3KUD B;  4OVV A;  1HXY D;  5AZG A;  1WMH A;  2CU1 A;  2LVO A;  1NEK B;  2G9H D;  4TUU A;  1NEN B;  2IZV B;  4NNJ B;  3CIR B;  1RLF A;  3B9J A;  2DX5 B;  1BUI C;  3D32 A;  3N9Y C;  1GC6 A;  2LUE A;  2FNJ B;  1CZP A;  1E90 A;  2KMM A;  4LDT D;  1L4Z B;  3FAH A;  2MQJ A;  5JHA A;  5EE1 A;  1ZKH A;  2Q5W D;  4ACF A;  2RD0 A;  3U7Z A;  1ZW7 A;  4MJS A;  1SJH D;  4JQW C;  3A4S C;  1WYW B;  3GZN I;  4ZHP A;  3WA0 A;  1E0Z A;  2MCN B;  2LVQ A;  2E3T A;  5BYR A;  1LQB A;  4HRS A;  2K8B A;  2GBN A;  1WXV A;  2W3R A;  2KAJ A;  2NS5 A;  2TSS A;  5EE3 A;  3X0W A;  4YXD B;  2L3Z A;  1RFA A;  1BML C;  2CR5 A;  1I35 A;  4MGI E;  2FCS A;  2HDE A;  3QWZ B;  1H4R A;  4RMA A;  2GBM A;  2SAK A;  3H6N A;  1UGJ A;  3M63 B;  3QHT A;  1C4A A;  2WX0 A;  3PLV A;  3UGB B;  3HHM A;  2KOX A;  3IAS 1;  1K51 A;  2K6Q A;  3HM3 A;  4CHK A;  2QIL A;  4FJZ A;  1ZDV A;  1YMH E;  5KHQ A;  1WI0 A;  3BYY B;  1SJE D;  1HTO A;  4RF0 A;  2PPH A;  3MHZ A;  4WAF A;  4HJK A;  2FCQ A;  4DK5 A;  3EHV A;  2GB1 A;  1WGR A;  2IY0 B;  1WY8 A;  1XF5 L;  1T0S C;  5D2M B;  2DYO A;  3L08 A;  5IKC M;  3ZQ4 A;  4HPL B;  3A4R A;  2LRW A;  2OHF A;  2NMQ A;  3VUY A;  3VUW A;  2LHE A;  1BXT A;  1D4B A;  1FNW A;  1QKZ A;  4LLG M;  3HM6 X;  1TJE A;  3KH0 A;  2KWU B;  5G2N A;  4WJQ A;  1P98 A;  4IDI A;  1HZ5 A;  4TSS A;  3TMP B;  3RZF A;  3Q8B A;  4HXD A;  3B08 A;  3P1M A;  1I4R A;  1SF0 A;  1YN4 A;  2LGI A;  4OVU A;  4RGT A;  1T6B X;  2KNB A;  3QAR A;  4RCO A;  1WJ6 A;  4USA A;  1GC7 A;  5L83 A;  2WXM A;  3OG5 A;  1D5Z C;  2K22 A;  3AUL A;  3AV8 A;  4K7W A;  3TUO A;  1KLV A;  4AWJ A;  1IP9 A;  2BF8 B;  3MJW A;  3IAM 1;  3QAQ A;  4MSM B;  1FD6 A;  2V4I B;  2INP E;  3NVZ A;  2JWU A;  4EZL A;  5T8I A;  2BBC A;  1SE3 A;  2JUO A;  2L0T A;  3ALB A;  1WXA A;  2N7J A;  3H9D A;  1C78 A;  2WXJ A;  4RF1 A;  3T3N A;  4FUL A;  2KN4 A;  2DZI A;  1U4A A;  4NAW A;  1MHH E;  2KDE B;  4MGK E;  1Q1O A;  1ROE A;  2BKF A;  1WZ3 A;  2KD0 A;  2LGY A;  2KWD A;  2MW5 A;  1WGH A;  2HD5 B;  1ZXI A;  2PEA A;  3CST A;  2L7R A;  5J2R A;  3UQB A;  1WJN A;  4DHZ B;  2LEK A;  3VFK A;  1L0X B;  1QT9 A;  2EEL A;  2J4X A;  4LJO B;  3RNC C;  2CJN A;  2G4S A;  5AUK A;  3PZD A;  2V1Y A;  2CKH B;  1GOZ A;  5FK9 C;  5H8Y E;  2KXJ A;  4ANW A;  1ACC A;  1TY0 A;  1AAR A;  2LAS A;  4AQ7 A;  3VR9 B;  3WAN A;  2KMA A;  4JX1 C;  3R3M A;  1IGD A;  4IM2 A;  2BS2 B;  2J0K A;  2M0X A;  2YVC A;  5E6O A;  5DCN A;  3TL5 A;  3DWM A;  3N32 A;  2V3S A;  4B0M A;  2DBY A;  2BB6 A;  1PGX A;  3V05 A;  3R7R A;  3M95 A;  3L54 A;  4DBG A;  4MM3 B;  2LD9 A;  3MFG A;  4KZC A;  2NPT B;  2Y5B B;  4A3P A;  2K39 A;  3KWL A;  5MPO A;  5DPS A;  2K3U A;  1TTN A;  2K9X A;  2IO2 B;  1YX6 B;  1SE2 A;  3DBR I;  4NJ7 A;  1GJZ A;  1VR9 A;  3OLM D;  1XEE A;  4MEM A;  3AMZ A;  2LFI A;  2PW9 A;  1E8W A;  3CMM B;  1RFK A;  2KYW A;  1WE6 A;  2QEJ C;  3AI5 A;  3TEY A;  2VZK B;  1PQS A;  3TBL D;  1HQR D;  4TKN A;  2WHI A;  1T0R C;  2ZW1 A;  4K81 A;  5E6P A;  2N7D A;  2KDI A;  1WXQ A;  2IND C;  4M8M A;  3SEB A;  2D3B A;  3E56 A;  1JWS D;  3LJ3 A;  2L0F A;  2AQ1 B;  3TSS A;  3VQI A;  2O2V A;  4MH0 E;  2AWT A;  2PE9 A;  3DBL B;  4RGM A;  2KJR A;  3RD2 A;  2BS3 B;  4B95 A;  2LWP A;  1V1O A;  3KLS X;  3B2G A;  2LHD A;  2IDY A;  4QAY A;  4HJG E;  1DGJ A;  2ZEQ A;  3AB5 A;  3L0W B;  1GAQ B;  4B0E A;  3NS8 A;  2H89 B;  4TMA B;  3K9O B;  2AEH A;  1N60 A;  2GRI A;  1E10 A;  1AW7 A;  2L52 A;  2M8S A;  2AL3 A;  4IWO A;  1D5M C;  4NPN A;  1IGC A;  3H7P B;  3OAW A;  4HDO A;  4AJW A;  4EZJ A;  1V2Y A;  1XCT L;  4C4V B;  1NBF C;  2C60 A;  1VDV A;  2KJ6 A;  1F2R C;  3GE3 C;  1WMH B;  4N9F 4;  1T0Q C;  1YJI A;  3QX1 A;  4FLH A;  4IWP A;  3QJZ A;  3EC8 A;  3RUL A;  4W9K A;  2INN E;  2ZCB A;  2M19 A;  1YIW A;  1WXS A;  1I7H A;  4XDC A;  4WWM A;  3P4Q B;  2IYD B;  3V6C B;  2YEP F;  1RYJ A;  4MJS B;  2X38 A;  4RNA A;  1N62 A;  3U2S C;  3NRZ A;  3VH4 B;  4GMV A;  4ANU A;  5HHD G;  3WIM A;  4WQO B;  1R4M B;  4HDQ A;  3T3O A;  2JY6 A;  1SSN A;  3Q69 A;  2WNM A;  1FCL A;  3UI3 A;  4FBJ B;  2D3G A;  4ANV A;  4RM9 A;  2L8J A;  4OHJ A;  4HPM B;  1JRO A;  4IC7 B;  4ARC A;  3NG0 A;  2LZ6 A;  2VRR B;  2K6D B;  3ZXV A;  3X23 A;  3MTN B;  2ZZP B;  1TBE A;  1D6E C;  1C77 A;  2Y3A A;  5JH5 C;  5FR6 A;  3A33 B;  3APD A;  4P16 A;  4ARI A;  1WFY A;  2R61 A;  2Z0D B;  2BGF A;  3PLU A;  4OZA A;  5IA7 A;  4WQM A;  2QDF A;  2VH2 A;  1MG8 A;  4YTP B;  2KFK B;  2M0A A;  4GOC A;  2K5P A;  4H2A A;  4XWW A;  2WLB A;  3BYT B;  3Q2A C;  4BOZ B;  1S1Q B;  4BKS A;  4TV3 A;  1V86 A;  3DVN U;  4G50 A;  3DBH B;  1WM2 A;  1MPE A;  2KVR A;  2MBQ A;  2NTS A;  4GDL A;  4UDU C;  3NZU A;  2OJR A;  5AEK B;  4IW0 A;  2G3Q B;  4ZYN A;  1EM7 A;  1YNT E;  1MHX A;  1ZP0 B;  4WUR A;  3VTU A;  5H92 C;  1NVI D;  4RFB A;  1FNV A;  1QOB A;  3AEB B;  1TKG A;  3RI7 C;  3ZKJ C;  1ET9 A;  3ZW3 A;  2C9W B;  5JHB A;  1WGD A;  2JWZ A;  3B1L X;  3QCA A;  5E6N A;  1FFV A;  2ZNV C;  2WGS A;  1ZPS A;  2MLB A;  1FFU A;  3AU4 A;  5GMV A;  1TKE A;  3WAL A;  5LNK 1;  3O13 A;  3DWG C;  2JZP A;  4YWG G;  1NYR A;  4JIO U;  3MC9 A;  4IM3 A;  4KGT A;  2D07 B;  3V6E B;  3I3T B;  3AEC B;  2L00 B;  4ZRI A;  3IT4 B;  4KVG B;  1F77 A;  1V5T A;  4JWS C;  1FMA D;  1UD7 A;  3BY4 B;  3KYC D;  3NVW A;  1DOI A;  1UWX A;  1Z5S B;  4NAM A;  1TZ1 A;  2LI5 A;  2DWQ A;  2IGG A;  1R4M I;  1C79 A;  4DQO C;  2KLC A;  4BKT A;  3ZJT A;  4US9 A;  2KX3 A;  3VR8 B;  3DDC B;  2KQ4 X;  1XT9 B;  2QSD A;  3ZJU A;  2CHZ A;  2BTE A;  2O6V A;  1VLB A;  2H88 B;  4W9D A;  1EF5 A;  2N0S B;  1QF6 A;  3IVF A;  4XWT A;  3AE4 B;  3K9P B;  3NZS A;  1DOX A;  1ZOY B;  1JWU D;  3ONS A;  2XBB C;  3VTW A;  4ICU A;  3QC8 B;  3U8Z A;  2CJO A;  2DLB A;  3W9C B;  2I2Y A;  2KQ7 A;  1L6V A;  2AQ3 B;  3AM9 A;  1TKY A;  3PVL A;  3ZNZ B;  2KN5 A;  2DYM A;  3FC4 A;  4BOS C;  5J18 A;  3QIJ A;  1DOY A;  2WXG A;  2NBW B;  2R2Q A;  4AUQ C;  2N4F A;  2GOW A;  2KDM A;  2WXP A;  3MC0 B;  3Q14 C;  5BMI A;  4MEL A;  5AUI A;  5LXI B;  3RNB C;  2JPH A;  3VDZ A;  4EKU A;  4C7Z A;  4YL8 A;  2JRH A;  1SIJ A;  4XYC A;  3ZTD A;  1F2R I;  1FM0 D;  1YJ1 A;  1GUA B;  1EF1 A;  3EEC A;  4G11 A;  3W5U B;  2D11 A;  2ZW0 A;  4M0W A;  1XCQ L;  4LNO A;  2PE6 B;  4OZB A;  2JT4 B;  3BVM A;  3A1Q B;  1V1P A;  2DEN B;  3DBH I;  3I57 A;  1J8C A;  1FIQ A;  4JE3 B;  4F7Z A;  1WRD B;  2C7M B;  1C4C A;  4HLE A;  3ZRF A;  4K3C A;  5C3J B;  1YQ4 B;  2K8C A;  2NTT A;  3NHE B;  3ENE A;  3WAM A;  2MEK A;  1ENF A;  4HEA 1;  2QCZ A;  1NDD A;  3HK0 A;  3RNA C;  2N1V A;  3EA6 A;  4DWF A;  1MI0 A;  2RGF A;  3I5J C;  3ZLZ A;  3U30 A;  4BKS D;  2CS4 A;  4KX6 B;  2KTF A;  1VRA B;  4KDL B;  2JYE A;  2W82 A;  1AN8 A;  3DPD A;  3RNE C;  3URY A;  1ET6 A;  2HJ1 A;  1RM6 C;  4OVZ A;  3WCQ A;  4JPS A;  1EU3 A;  1F9J A;  1NI3 A;  3CWI A;  5CHW A;  1SBB B;  4KIK B;  2C7N B;  4MGZ E;  3VTV A;  1J19 A;  2RR9 A;  4YSX B;  5JZE B;  3SFD B;  3H8H A;  3RPF C;  5C23 A;  1P3Q U;  4GGQ A;  5HG2 A;  3SFE B;  2PMV A;  1V9J A;  2DZK A;  2LJI A;  4FHJ A;  2LUM A;  1WX7 A;  4CQN A;  1FRR A;  1C76 A;  4WIP A;  2J53 A;  1IBX B;  2KZR A;  1TS2 A;  2AX5 A;  3ZXR A;  1P7E A;  4PYZ A;  2ZNV B;  4M00 A;  2M17 A;  4FAD A;  1WGY A;  1UNS A;  3ZDT A;  4E71 A;  2MWS B;  1IUE A;  1QOF A;  5BYS A;  2L1A A;  3BK2 A;  4XX5 A;  3DBS A;  5IN7 A;  4WAA A;  5AZH A;  2MBO A;  3UIO B;  2CHX A;  3MHS D;  3MJ5 A;  1YX5 B;  3A9J A;  4FA6 A;  3PZ8 A;  3C8Y A;  3PHX B;  4K3B A;  3AU5 A;  4JWU C;  3IFW B;  1WJU A;  4ITK A;  2BQQ A;  2FUG 1;  3LB8 C;  4R3D A;  2JYT A;  1WGK A;  2I38 A;  4IWQ A;  2SEB D;  4DHZ E;  3HIZ A;  1D5X C;  2I1J A;  1E5W A;  2PVG C;  3ZNH B;  3P4P B;  1K50 A;  3PZ7 A;  4EZK A;  4AOF A;  3ZDM C;  2XNA C;  1RAX A;  2KMC A;  2JF5 A;  3LDZ E;  1WX9 A;  1YN5 A;  3L4P A;  2EKE C;  3Q3N C;  4DDI D;  3TEZ A;  2LMC A;  5D94 A;  3BK1 A;  1LO5 D;  3AE5 B;  5EE0 A;  1E8Z A;  3AE2 B;  4RGO S;  1V1P B;  2KDF B;  4E3C A;  3ZGZ A;  2LXA A;  2WU2 B;  3ETR A;  4JLC A;  4ZRP A;  1P1A A;  3N1Y C;  1L6U A;  2B76 B;  1WX8 A;  2KJH B;  2DAJ A;  2GMI C;  2WX1 A;  3AXC A;  2ZVN A;  1KLU D;  3MP9 A;  1NYQ A;  2WDV B;  4YSY B;  1LFD A;  2KHW B;  1WZ0 A;  2WXF A;  1E7U A;  1EWY C;  2XN9 C;  4ANX A;  2G1E A;  2LJ5 A;  2IO3 B;  3SR6 A;  2FAZ A;  3VRB B;  3RYT A;  3DHG C;  4HWI B;  4GDL B;  2QIE B;  4AP4 C;  2DZJ A;  3BII D;  3HVD A;  1PDX A;  3RMK C;  1E9M A;  2M1M A;  5BYQ A;  4L23 A;  1MJD A;  3B2F A;  1WYG A;  4K7S A;  1N61 A;  2NPT A;  4ICV A;  5C1Z A;  3A9K A;  3KUC B;  1WRI A;  4HKQ A;  3JSV A;  3AEA B;  4ZRQ A;  2NBU A;  2KTR B;  3ZVV A;  3M3J A;  4I6N B;  2J0J A;  3T9L A;  1QLB B;  3Q8C A;  4A55 A;  3V3X A;  2JXX A;  3PO0 A;  2KC2 A;  3P63 A;  2LRU A;  1WR6 E;  4GDK B;  2EKI A;  2QJL A;  5C2T B;  2IJ0 A;  2WDQ B;  5LLI A;  4PK1 A;  4K1R B;  1JML A;  3AN1 A;  4WJP A;  1QOG A;  1XLO A;  4BVU C;  5HFY A;  2O2V B;  1C9F A;  2GBK A;  1KOT A;  2LGD A;  2YEP B;  4MM3 A;  1KM7 A;  3AE7 B;  2LVP A;  2J42 A;  3LXF A;  4CYE A;  2MJD A;  3V61 A;  3ZO5 B;  1V81 A;  1J7B A;  1C3T A;  3U52 E;  2D2Q A;  2M4N A;  4A6Q A;  2BB5 A;  1L2N A;  3A9J B;  2A5U A;  1HE8 A;  4C00 A;  4EEW A;  3GZN B;  2FE8 A;  2JSV X;  3IHP C;  3NY5 A;  2WQY B;  2XK5 A;  3FIL B;  4A8X C;  4ZRJ A;  3NZ3 A;  1QZE A;  2MA9 B;  1KFY B;  1M4V A;  5D3I B;  2BW2 A;  4C4V A;  4XZ4 A;  4W9J A;  1VD2 A;  2O6V B;  1PYW D;  1M94 A;  2CU3 A;  2L32 A;  1HEZ E;  1WF9 A;  1EO6 A;  2LGX A;  3ECI A;  3CSF A;  1HTQ A;  2KX0 A;  3JW0 X;  3KQ4 A;  3Q3M C;  4AJY B;  2W9N A;  3PRP B;  2QC8 A;  1R7S A;  4I6L B;  1C1Y B;  2JZZ A;  4G0N B;  1SE9 A;  2J7Q B;  3H7S A;  2I1K A;  4M01 A;  4W9C A;  1FXT B;  3GE8 C;  2UU7 A;  1G6J A;  3VHT C;  2KVZ A;  3OJ3 A;  4L2Y A;  1HA5 A;  1LXD A;  3HUI A;  2DZM A;  1L0Y B;  1N6Z A;  3ABV B;  3N30 A;  2G4D B;  4MAC A;  4KZ0 A;  5BMG A;  3TJP A;  1T3Q A;  2WXK A;  3ML8 A;  4NJC A;  4KKJ A;  3GP7 A;  2NCN A;  2MP2 B;  4MT5 A;  4L1B A;  4IKG A;  1JWA D;  1V49 A;  2MBH A;  3P2B A;  2KWV B;  2GBJ A;  2ZCC A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  5L83 A;  4M0W B;  2HE7 A;  3UIP B;  3A9K B;  3ONS A;  2XBB C;  3VTW A;  2OOB B;  3QC8 B;  4ICU A;  3U8Z A;  4HCP B;  4TQ1 A;  3AUL A;  4K7W A;  4JGH B;  2ZJD A;  3RCZ A;  2KFK A;  2KQ7 A;  1KLV A;  4AWJ A;  1IP9 A;  2BF8 B;  3MJW A;  3PVL A;  3ZNZ B;  2KN5 A;  2WWZ A;  3H7P A;  3QAQ A;  2DYM A;  1Y8R C;  3QQ8 B;  4MSM B;  5L95 C;  4LDT B;  1WM3 A;  4BOS C;  3L10 B;  5J18 A;  3QIJ A;  2KO3 A;  4IM0 A;  2NBV B;  4ZDV A;  2KK8 A;  1WXM A;  4ZRK A;  3GOE A;  2NBW B;  2R2Q A;  4F8C B;  4EZL A;  2KAN A;  4AUQ C;  3S2A A;  3VH3 B;  2N4F A;  5CHF A;  4B9K A;  3KYD D;  2GOW A;  1K8R B;  4GDK A;  4WWN A;  4DDG D;  2JUO A;  2L0T A;  3ALB A;  1WXA A;  4WWO A;  4FJV B;  1ZGU B;  4FJY A;  4NQL B;  4MEL A;  5LXI B;  2D10 A;  3H9D A;  4W9G A;  2IO1 B;  3UQA A;  2ZVO A;  3KUZ A;  4I6P A;  5KHO A;  1UH6 A;  3Q3F A;  3QA8 A;  3VVW B;  4FUL A;  2JPH A;  3VDZ A;  2DZI A;  4EKU A;  1U4A A;  4NAW A;  2NR2 A;  2KDE B;  4MGK E;  3V62 A;  1Q1O A;  4YL8 A;  2BKF A;  3APF A;  2JRH A;  1WZ3 A;  2UYZ B;  2KD0 A;  3PGE A;  2LGY A;  4TQ0 A;  2J0M A;  2MW5 A;  1YJ1 A;  3ZTD A;  3VXW A;  4E74 A;  1GUA B;  1EF1 A;  2Z0E B;  1P0R A;  4RM8 A;  3EEC A;  2O6V D;  1WGH A;  4G11 A;  2D11 A;  2HD5 B;  2PEA A;  3CST A;  2L7R A;  2BYV E;  2FUH B;  2HTH A;  2PE6 B;  5J2R A;  1BT0 A;  3R66 C;  1WJN A;  3TCA A;  5CTR C;  3UQB A;  4DHZ B;  4JL9 A;  2JT4 B;  3A1Q B;  4GB9 A;  3VFK A;  4URK A;  2DEN B;  3DBH I;  2N9E B;  3PPA A;  2LXC A;  2N1W A;  3O65 B;  1J8C A;  3DCG A;  4LJO B;  1I42 A;  1OQY A;  4F7Z A;  1SGH A;  1WRD B;  1UEL A;  2G4S A;  2C7M B;  4HLE A;  2R2O A;  4GU2 A;  3ZRF A;  1JRU A;  4LJP B;  2K8H A;  3PZD A;  2K8C A;  4X57 B;  1LM8 B;  4BBN C;  2V1Y A;  3NHE B;  3T8M A;  3ENE A;  2CKH B;  3WAM A;  2KXJ A;  2ZPN A;  4ANW A;  2B3A A;  1WE7 A;  1NDD A;  2BWF A;  4WJN A;  5BO4 B;  3HK0 A;  1AAR A;  3RZW C;  3W1S C;  2LAS A;  2N1V A;  3SU8 X;  1WR1 A;  2BWE S;  4DWF A;  3WAN A;  4FN2 A;  2BPS A;  2RGF A;  1VCB A;  2KMA A;  4DXA B;  3ZLZ A;  3U30 A;  4BKS D;  3PSE B;  3R3M A;  2HJ8 A;  2CS4 A;  3V60 A;  2KTF A;  1UBI A;  2MBE A;  1UGM A;  3OJ4 B;  2NVU I;  4KDL B;  3M62 B;  2L76 A;  4IM2 A;  2IO0 B;  1ISN A;  2J0K A;  1E7V A;  3DPD A;  3B0A A;  3W1Y A;  2MBB B;  2M0X A;  2YVC A;  5E6O A;  5DCN A;  3TL5 A;  3DBL I;  3SHQ A;  3N32 A;  1H8C A;  2V3S A;  1KJT A;  2BKR B;  3R7Q A;  1F9J A;  4HK2 A;  4KSL C;  1RRB A;  1OEY A;  5CHW A;  4KIK B;  2Z59 B;  2RPQ A;  3R7R A;  4MGY E;  2C7N B;  3M95 A;  4MGZ E;  3VTV A;  3L54 A;  5D7G A;  4DBG A;  1WH3 A;  2A4Z A;  3PRE A;  1J19 A;  2RR9 A;  3DVN V;  4EFO A;  5JZE B;  4DHJ B;  2MP2 A;  3WAP A;  4B6W A;  4W9I A;  1IYF A;  2IBI B;  2LD9 A;  5C23 A;  3VUX A;  1P3Q U;  2JVC A;  2MX2 A;  4G3X B;  1Q5W B;  4KZC A;  2UWQ A;  2NPT B;  4GGQ A;  1IPG A;  4W9F A;  4F1S A;  1V9J A;  2DZK A;  4FHJ A;  4WJO A;  2Y5B B;  1WX7 A;  4A3P A;  4ASW C;  4LCD E;  2K39 A;  5DPS A;  1TTN A;  2MSE D;  2AYO B;  4MDK E;  3C0R B;  2IO2 B;  5J17 A;  1YX6 B;  3DBR I;  2KKC A;  4NJ7 A;  1GJZ A;  2KZR A;  4GSW A;  5EDS A;  3PS6 A;  2EMT A;  4II3 B;  3OLM D;  4PYZ A;  5TR5 A;  4MEM A;  2PJH A;  2KQS A;  1E8W A;  2BYF A;  3CMM B;  2ZNV B;  4PYU A;  4FAD A;  1OGW A;  2M17 A;  1WE6 A;  1WGY A;  2GBR A;  3ZDT A;  4WWP A;  3AI5 A;  4E71 A;  1L7Y A;  2MWS B;  4XC2 A;  3QK0 A;  1GNU A;  3EFU A;  4MSQ B;  1PQS A;  2BYE A;  3W1S A;  3TBL D;  4TKN A;  3RUI B;  4XX5 A;  3VAW A;  1EUV B;  5LXH A;  3DBS A;  3N3K B;  4K81 A;  5E6P A;  1WIA A;  1UBQ A;  2N7D A;  4WAA A;  2KDI A;  3ML9 A;  5AZH A;  4GN1 A;  1D3Z A;  3PRZ A;  4M8M A;  2MBO A;  2WYQ A;  3SDL C;  3UIO B;  1OEY J;  2CHX A;  3LJ3 A;  3MHS D;  2L0F A;  3VQI A;  1YX5 B;  3IBE A;  2O2V A;  3A9J A;  2QHO A;  2DAF A;  2AWT A;  4MH0 E;  4FA6 A;  2PE9 A;  2ASQ A;  2EMS A;  3PHX B;  2KJR A;  3AU5 A;  5IAA C;  3IFW B;  3RD2 A;  1WJU A;  2RSU A;  1V5O A;  3JVZ X;  4PS7 A;  1P9D U;  4B95 A;  2LWP A;  3DQV A;  1J0G A;  1CMX B;  3APC A;  4IWQ A;  3KVF B;  2ZEQ A;  3L0W B;  2KFJ A;  2XEW A;  3TIX A;  4DHZ E;  3HIZ A;  3NS8 A;  2I1J A;  2K1F A;  5DPR A;  5G55 A;  1E5W A;  3ZNH B;  3K9O B;  2ZPY A;  2AEH A;  4PS3 A;  2M8S A;  4KSK C;  2AL3 A;  4IWO A;  4NPN A;  4W9L A;  4AOF A;  4EZK A;  3ZDM C;  3H7P B;  3OAW A;  3PV1 A;  4HDO A;  3PTF C;  5DPT A;  4NQK E;  2IY1 B;  3A1Q A;  4AJW A;  1V2Y A;  4EZJ A;  1A5R A;  1RAX A;  2KMC A;  3DVG Y;  2JF5 A;  4K7U A;  2N7E A;  1NBF C;  3LDZ E;  1WX9 A;  2C60 A;  2KJ6 A;  2EKE C;  1E8Y A;  1WMH B;  4N9F 4;  3JSV B;  2FCM A;  4DDI D;  3QX1 A;  4KDI C;  5D94 A;  4FLH A;  2N9P C;  2KWC A;  4J6I A;  4IWP A;  3QJZ A;  1E8Z A;  3EC8 A;  3RUL A;  4W9K A;  3L16 A;  5HKH A;  2KDF B;  4E3C A;  3DOW A;  2LXA A;  1YD8 U;  1NI2 A;  2ZCB A;  3L13 A;  4JLC A;  3UIN B;  3DVG X;  1P1A A;  1YIW A;  1WGG A;  1WXS A;  1WX8 A;  1XQQ A;  3KW5 B;  2KJH B;  4W9E A;  5DPW A;  4IG7 B;  2IYD B;  3V6C B;  2DAJ A;  4MJS B;  2GMI C;  2WX1 A;  3AXC A;  2ZVN A;  4NJ6 A;  2FCN A;  2REX A;  1WJ4 A;  2N9X A;  3CF6 E;  3VH4 B;  1LFD A;  5CX3 A;  2KHW B;  1WZ0 A;  4GMV A;  1V6E A;  4ANU A;  1E7U A;  2JZ3 B;  2JRI B;  3WIM A;  4ANX A;  2LJ5 A;  4WQO B;  2IO3 B;  2MRP A;  2FAZ A;  2YLM A;  3RYT A;  4HWI B;  3PRM B;  3Q3J A;  4GDL B;  3WAO A;  4AP4 C;  2DZJ A;  3UF8 A;  4HDQ A;  3PT2 B;  2JY6 A;  2M1M A;  2WDT B;  1S3S G;  4M8N A;  4FBJ B;  2D3G A;  4ANV A;  2FIF A;  4RM9 A;  2L8J A;  5AZF A;  4HPM B;  4K7S A;  2NPT A;  3KUD B;  4ICV A;  4II2 B;  4IC7 B;  4OVV A;  5C1Z A;  1OTR B;  3A9K A;  3KUC B;  2LZ6 A;  3ZTC A;  2KC1 A;  2K6D B;  2VRR B;  3BIN A;  1WMH A;  2CU1 A;  5AZG A;  3X23 A;  3JSV A;  2KLG A;  3MTN B;  2NBU A;  2LVO A;  4P7I A;  2DYB A;  2G45 B;  2ZZP B;  4TUU A;  2KTR B;  1TBE A;  5JH5 C;  2IZV B;  5FR6 A;  2XK5 B;  3A33 B;  4NNJ B;  3ZVV A;  3APD A;  3M3J A;  1RLF A;  4I6N B;  2DX5 B;  4DHJ D;  2J0J A;  3T9L A;  3D32 A;  1WFY A;  2Z0D B;  1GC6 A;  2BGF A;  3PLU A;  2LUE A;  2FNJ B;  1E90 A;  3L17 A;  4LDT D;  5IA7 A;  3ZUN A;  2MQJ A;  5JHA A;  1MG8 A;  1ZKH A;  2JXX A;  2KC2 A;  2KFK B;  4GOC A;  2LRU A;  1WR6 E;  1SIF A;  2RD0 A;  3PHW B;  1ZW7 A;  4GDK B;  4MJS A;  2FID A;  4JQW C;  3A4S C;  5LLI A;  4BOZ B;  1WYW B;  3GZN I;  1S1Q B;  4BKS A;  3WA0 A;  4TV3 A;  4K1R B;  4KIK A;  1V86 A;  2DHZ A;  2LVQ A;  3DVN U;  4G50 A;  2MCN B;  1LQB A;  4WJP A;  2K8B A;  4BVU C;  2GBN A;  1WXV A;  2NS5 A;  1WM2 A;  2KVR A;  2MBQ A;  2O2V B;  3X0W A;  2GBK A;  3IG3 A;  1KOT A;  2LGD A;  4MM3 A;  4GDL A;  1KM7 A;  2L3Z A;  3NZU A;  2LVP A;  2OJR A;  5AEK B;  1RFA A;  4CYE A;  2CHW A;  4IW0 A;  3V61 A;  3ZO5 B;  1V81 A;  2G3Q B;  1C3T A;  1R4N I;  2CR5 A;  4ZYN A;  3ZNG C;  2D2Q A;  2M4N A;  4IUM B;  3VTU A;  1I35 A;  4MGI E;  2FCS A;  3QWZ B;  1H4R A;  4FHK A;  4NAW B;  4RMA A;  3A9J B;  1L2N A;  2A5U A;  2AL6 A;  1T0Y A;  1HE8 A;  2GBM A;  1YQB A;  4EEW A;  4HVB A;  4EUT A;  3H6N A;  3M63 B;  3QHT A;  3IHP C;  4BKG A;  3NY5 A;  3ZKJ C;  4EOY A;  2XK5 A;  4ZRJ A;  3ZW3 A;  2WX0 A;  3PLV A;  3UGB B;  2C9W B;  3HHM A;  2KOX A;  2K25 A;  5JHB A;  1QZE A;  1WGD A;  2JWZ A;  2MA9 B;  2K6Q A;  3H1U A;  3HM3 A;  4CHK A;  3B1L X;  3QCA A;  5E6N A;  4XZ4 A;  2ZNV C;  4W9J A;  3ZRC A;  1VD2 A;  2O6V B;  1M94 A;  2MLB A;  4FJZ A;  3AU4 A;  5GMV A;  5KHQ A;  3ZNI D;  4BBN F;  3WAL A;  1WI0 A;  1WF9 A;  1EO6 A;  2LGX A;  3ECI A;  3CSF A;  4HCN B;  2KX0 A;  3JW0 X;  4JIO U;  2PPH A;  4IM3 A;  4AJY B;  2W9N A;  3PRP B;  2D07 B;  3V6E B;  4HJK A;  5CHV C;  3I3T B;  4I6L B;  3NOB A;  2L00 B;  1TGZ B;  1C1Y B;  1UZX B;  1XD3 B;  2JZZ A;  4ZRI A;  4KVG B;  4G0N B;  1V5T A;  2FCQ A;  1SE9 A;  4DK5 A;  2J7Q B;  2V4L A;  2I1K A;  3H7S A;  4BFR A;  3EHV A;  1Z2M A;  1WGR A;  2IY0 B;  1WY8 A;  2KDB A;  4W9C A;  1UD7 A;  3BY4 B;  3KYC D;  1FXT B;  2L05 A;  4GXB A;  1E8X A;  1Q0W B;  1G6J A;  5D2M B;  2DYO A;  5D6J B;  3ZIM A;  1Z5S B;  3L08 A;  4NY0 A;  3VHT C;  4HPL B;  1TZ1 A;  3OJ3 A;  3A4R A;  2LI5 A;  2LRW A;  4A3O A;  3RT3 B;  1R4M I;  1LXD A;  2C5L C;  2DZM A;  3VUY A;  3VUW A;  1GG3 A;  4KV2 A;  3SD5 A;  2KLC A;  4BKT A;  4W9H A;  2KX3 A;  3DDC B;  3HM6 X;  3N30 A;  3KH0 A;  2G4D B;  2KWU B;  4KZ0 A;  1XT9 B;  3TJP A;  3JYU A;  5G2N A;  3ML8 A;  1P98 A;  4WJQ A;  4GIV A;  3TMP B;  2CHZ A;  3RZF A;  2C7H A;  4HXD A;  2NCN A;  2O6V A;  2MP2 B;  3B08 A;  4A20 A;  3U7D A;  1X1M A;  4PS8 A;  4W9D A;  1EF5 A;  4OVU A;  2KTR A;  3IVF A;  1V49 A;  2MBH A;  3P2B A;  2KWV B;  1V80 A;  3K9P B;  4CO7 A;  2KNB A;  3QAR A;  2GBJ A;  1WJ6 A;  2ZCC A;  3NZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...