2JXXA

Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords NFATC2-interacting protein
publication title Solution structure of Ubiquitin-like domain of NFATC2IP.
rcsb
source organism Homo sapiens
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jxxA00
3JSVA 2ZEQA 2KLCA 4GSWA 4MJSA 4ANWA 4W9EA 3KUCB 1Q1OA 2FCQA 3N30A 3PS6A 4I6NB 4IC7B 5CHWA 2JUOA 2NS5A 2ZNVC 3WANA 1VD2A 2JXXA 4MELA 3UIPB 2N9EB 3DCGA 3NZSA 1Y8RC 2L00B 3VH3B 4TKNA 4WQOB 2KTRB 4DDGD 4OVVA 1M94A 4DHJB 2KVRA 2QHOA 3W1YA 4RM9A 3EECA 4GB9A 4PYUA 2ZZPB 4PS8A 4ZRJA 1KJTA 2BWFA 3NOBA 3ZRFA 3A9JA 3KUZA 2CKHB 3EHVA 2AEHA 3M3JA 2DZJA 2K6QA 3TIXA 2D10A 2DAJA 3B08A 4NNJB 2DENB 1WM2A 4GGQA 3SU8X 1E5WA 3HK0A 4WJQA 4ZDVA 4A20A 4CYEA 2LGYA 1GC6A 1JRUA 2ASQA 1J0GA 3WAOA 3DQVA 4AJWA 3AI5A 1LXDA 4X57B 2DYMA 2EKEC 2KKCA 4AJYB 1FXTB 1WMHB 1WR6E 3B1LX 1TBEA 1V2YA 2NR2A 4TQ1A 4RMAA 1OGWA 4BBNC 4LJOB 4EOYA 2N9XA 5D6JB 3KW5B 3OJ3A 2ZJDA 3PPAA 1E7VA 3V60A 1F9JA 1ZGUB 2IO0B 5L95C 2OJRA 4I6LB 3HM3A 1R4NI 3ZDTA 1WE7A 4HJKA 4ANXA 3PVLA 3HM6X 2KX0A 2KANA 2J7QB 1QZEA 3UQAA 2FAZA 2GBJA 4W9FA 3M63B 3AULA 2L3ZA 4NQLB 4WWPA 3QC8B 4GOCA 1RFAA 1KM7A 3A9KB 3TMPB 5HKHA 2BYEA 1LFDA 2JY6A 3DBHI 1I42A 2Z0DB 2MBHA 3HHMA 1OEYA 1G6JA 3I3TB 1WX7A 1PQSA 3VAWA 1WX8A 2AL3A 2D2QA 5DPSA 3SHQA 2LRUA 4AWJA 4MH0E 1J19A 4WAAA 1WF9A 2MX2A 3JW0X 5CHFA 4BKSA 2WX1A 3L0WB 3RYTA 1NDDA 2DZKA 3Q3FA 3VDZA 2YLMA 2J0MA 3QWZB 2NBUA 3DVGX 1H8CA 4MGYE 3IVFA 3ZW3A 2NCNA 2GBMA 2CHXA 2RR9A 2KXJA 3IFWB 4DBGA 3PSEB 3VFKA 3C0RB 3KYDD 4MM3A 4E3CA 1WZ0A 1MG8A 2MLBA 4A3PA 2FCSA 4N9F4 3ALBA 2DZIA 5JHBA 2O6VD 2KMCA 3L17A 1XQQA 1YJ1A 2LWPA 2RSUA 3H7SA 4A3OA 1P9DU 1V5OA 1RRBA 2Y5BB 3PGEA 1UBQA 3A4SC 1LM8B 1YD8U 1WIAA 3PZDA 4EFOA 2N1VA 2KFJA 2KFKA 5AEKB 2LVPA 2REXA 4WJPA 1KLVA 3DBLI 3ZVVA 5C23A 3V6CB 1V9JA 2O6VA 2V1YA 3PHXB 1A5RA 2KNBA 3TBLD 4AOFA 4K1RB 1WGDA 4II2B 2MCNB 1T0YA 4NY0A 1WGYA 5DPWA 3X0WA 1TZ1A 1AARA 1WR1A 2L0TA 4HWIB 3ECIA 3A1QA 3ZRCA 4NAWA 4FHKA 1J8CA 3VHTC 2FUHB 3L08A 5AZGA 2MA9B 3KH0A 4G11A 1WJ4A 5DCNA 2J0KA 2WDTB 3A4RA 2XK5A 2MWSB 2G4SA 4F7ZA 4WWOA 5J2RA 1OTRB 3H7PA 5CTRC 3V6EB 2EMTA 4MGZE 1WX9A 2KWUB 2LGDA 4RM8A 2HJ8A 1WGHA 1S3SG 2O6VB 3T8MA 2OOBB 3UQBA 3VTWA 2JVCA 3M95A 4PYZA 1YX5B 4F1SA 3DBSA 1P1AA 3QQ8B 4BOSC 3JSVB 4TV3A 4MJSB 2KK8A 4BFRA 2JZZA 1E8WA 1Q0WB 5L83A 2DYOA 3VUXA 2KMAA 4P7IA 1IYFA 3S2AA 4MSQB 3U7DA 3VVWB 1UGMA 4HK2A 4XC2A 4PS7A 3JVZX 3IG3A 2K1FA 2K25A 1CMXB 2KLGA 2M4NA 1WZ3A 2JWZA 2ZPYA 2PPHA 3R7QA 4DHZB 2CR5A 2XBBC 1Q5WB 4MEMA 2EMSA 2XK5B 3VUWA 1EO6A 3GOEA 2K8CA 2MBEA 2LGXA 2KX3A 1UD7A 1WE6A 2AL6A 3A9JB 3ZNHB 3VUYA 4BVUC 3N32A 1XT9B 1E90A 2LJ5A 3PRZA 2LI5A 2AWTA 1WJUA 1WRDB 2MBQA 1UH6A 1V6EA 3WALA 2HTHA 3KVFB 3CSTA 5LXIB 1RLFA 1C1YB 2C60A 3JYUA 3NY5A 1WH3A 4KIKA 4OVUA 4BKSD 2Z0EB 2MP2A 4F8CB 2GMIC 2GBKA 1VCBA 2NPTA 2GOWA 3CSFA 3MJWA 5LLIA 4EZJA 2M17A 2O2VA 3QJZA 5BO4B 4BOZB 3DBRI 1WJNA 2BKRB 3NHEB 3QK0A 2J0JA 3L54A 2BF8B 4ICVA 4FJZA 4PS3A 4XX5A 4YL8A 3QCAA 4M0WB 2IY1B 3DDCB 3RCZA 2LZ6A 1WFYA 1GG3A 3L10B 1SE9A 1GC7A 3H9DA 3RT3B 4HLEA 2D11A 1TGZB 4AUQC 2MBOA 3B0AA 3ONSA 3QHTA 4G3XB 2KOXA 4ANVA 1OQYA 4IWQA 3APFA 3TJPA 2RD0A 1WM3A 3AU4A 2KD0A 1D3ZA 3L16A 3ZTCA 4GDKA 4URKA 1UELA 1ISNA 2IBIB 2MQJA 4GN1A 4WJNA 4BKTA 1P0RA 3KUDB 1EF1A 2G45B 3CMMB 4B95A 4M8NA 4TUUA 4IUMB 4JIOU 3R7RA 1EUVB 4G0NB 2KHWB 2O2VB 1WXAA 3IHPC 1GNUA 4HDOA 3U8ZA 3V61A 2RGFA 4GU2A 5D94A 2YVCA 3RULA 2KO3A 3BINA 3ZNGC 3ZDMC 1IP9A 2MW5A 2W9NA 2LXCA 3R3MA 3WAPA 1NBFC 1WI0A 4ASWC 2IO3B 2LUEA 4KDIC 1Z5SB 2R2QA 4EZLA 4HVBA 5AZFA 3NZUA 2LRWA 1YX6B 2L0FA 5KHQA 1WJ6A 4WJOA 2BGFA 4BKGA 2FCNA 3PREA 3PLUA 3ZTDA 1H4RA 2CU1A 2PE6B 2N7EA 1R4MI 2DYBA 2ZPNA 3ML8A 1E8ZA 3OAWA 3P2BA 2DAFA 2IZVB 2KDBA 2L76A 2KTRA 1OEYJ 2JRHA 3GZNI 5J17A 2L05A 2KJHB 4W9HA 5DPTA 1YIWA 3ENEA 4K7SA 3M62B 4GIVA 3QIJA 2C7NB 4EUTA 2MSED 2BPSA 4DK5A 1WXVA 4J6IA 4IM0A 1C3TA 2C5LC 1E7UA 4EZKA 2WWZA 5JH5C 2K8BA 3TL5A 5G2NA 3OJ4B 4W9KA 5JZEB 4FJYA 3APDA 2BKFA 3PT2B 4K81A 2HD5B 3SD5A 3ZLZA 1E8XA 1SIFA 3PLVA 2KFKB 4W9IA 4CO7A 3X23A 2FCMA 3UGBB 4LDTB 4KZ0A 3MTNB 2JRIB 3EFUA 3AXCA 3UIOB 2N9PC 1WMHA 1WXMA 3NS8A 5E6NA 4W9DA 4KZCA 3IBEA 2IY0B 4M8MA 3UF8A 2ZVOA 2A5UA 4IWPA 4ZRIA 3ZUNA 2KQSA 2UYZB 4JQWC 5LXHA 1V81A 3A1QB 3SDLC 1EF5A 4G50A 2AYOB 4JLCA 4NAWB 3W1SC 4W9GA 5GMVA 2K8HA 1L2NA 2KDFB 2N4FA 4EKUA 2DX5B 3CF6E 1I35A 2KDIA 1LQBA 3DVNV 4JL9A 4FN2A 4LCDE 2KTFA 3R66C 3O65B 3MHSD 3T9LA 2BWES 2LXAA 4NPNA 4W9JA 2LASA 2VRRB 4HPLB 3QX1A 2V3SA 1P3QU 2MBBB 2FIFA 2KC1A 1U4AA 1S1QB 3H7PB 4B9KA 4MGKE 3N3KB 4MGIE 4E71A 2KDEB 4DWFA 3Q3JA 3ZIMA 2I1KA 3RZWC 2GBNA 4W9CA 5J18A 3A9KA 4KSLC 4IW0A 2DZMA 4II3B 4K7UA 3RUIB 4ICUA 3U30A 5C1ZA 2PE9A 4CHKA 1BT0A 1NI2A 3EC8A 2UWQA 1V49A 3K9PB 4E74A 3PV1A 3DPDA 4IG7B 1GUAB 2KZRA 2G4DB 5D2MB 5DPRA 3VTUA 4MSMB 1WY8A 5E6OA 2CHZA 2NBWB 3HIZA 3PRMB 1ZW7A 2LVQA 4HPMB 4HCNB 4LJPB 4DXAB 2BYFA 2JT4B 2NBVB 3UINB 3WAMA 2ZVNA 3PTFC 4GMVA 1WGRA 4BBNF 4GXBA 2C7MB 3D32A 2D07B 2KWCA 3BY4B 1XD3B 1HE8A 2LD9A 2KJ6A 1V80A 1X1MA 4AP4C 2FIDA 2LVOA 3APCA 2L8JA 4B6WA 5CX3A 2GBRA 1K8RB 2KJRA 4NJ7A 1ZKHA 4KDLB 2JZ3B 4KVGB 3TCAA 1P98A 3DVGY 4KSKC 5FR6A 3VQIA 2BYVE 3DVNU 2WYQA 4FHJA 1GJZA 4FA6A 1L7YA 3DOWA 1UZXB 2RPQA 3QARA 3WA0A 4KIKB 5D7GA 2A4ZA 2G3QB 1RAXA 1V86A 2PJHA 2MP2B 2KQ7A 2ZCCA 3ML9A 3K9OB 2NPTB 2M8SA 4GDLA 4LDTD 5TR5A 2ZCBA 3VTVA 2R2OA 5IAAC 2NVUI 3ZO5B 3L13A 2KN5A 3VH4B 2IO2B 2KC2A 5KHOA 2D3GA 2N7DA 4IM3A 4NJ6A 5AZHA 1YQBA 3PHWB 2K6DB 1WGGA 2Z59B 4DHJD 2IO1B 2JPHA 2N1WA 3H1UA 2M0XA 3OLMD 5EDSA 3A33B 1TTNA 4DDID 4W9LA 1V5TA 4ZRKA 3LJ3A 4DHZE 4FJVB 4NQKE 2FNJB 4IM2A 3QA8A 2I1JA 4XZ4A 4HXDA 4FULA 5E6PA 4GDKB 2DHZA 2IYDB 4FBJB 3PRPB 2V4LA 2CS4A 4K7WA 2PEAA 3AU5A 3W1SA 2K39A 2ZNVB 2CHWA 4FADA 4WWNA 2B3AA 3WIMA 3RZFA 3QAQA 5IA7A 3VXWA 1SGHA 4JGHB 4HCPB 5G55A 4FLHA 1WYWB 2MRPA 4ANUA 4GDLB 4EEWA 1Z2MA 1E8YA 2C7HA 4TQ0A 4KV2A 3ZKJC 5CHVC 2XEWA 1KOTA 3KYCD 3LDZE 3V62A 5JHAA 2WX0A 2JF5A 2C9WB 2HE7A 1UBIA 2M1MA 4MDKE 2KWVB 3H6NA 4IWOA 4ZYNA 3ZNID 1WXSA 3ZNZB 4HDQA 4I6PA 3RD2A 1IPGA 2L7RA
chains in the Genus database with same CATH superfamily
2KLCA 4ANWA 2L1AA 1Q1OA 1EU3A 2AQ2B 2FCQA 3N30A 3NS1A 2KAJA 2JUOA 2NS5A 2ZNVC 1J7BA 2JXXA 3TEZA 3RNBC 1Y8RC 4YTNB 5FK9C 3VR8B 3H8HA 4GB9A 4PYUA 1TY0A 2ZZPB 2AQ3B 2BWFA 3EHVA 2K6QA 3TIXA 2D10A 3B08A 4GGQA 3RNEC 1E5WA 1ET6A 5IO9A 1D5ZC 2X8XX 3R8BA 3DQVA 3AI5A 4ZRQA 3TEYA 2DYMA 4AJYB 1WMHB 4M0WA 1YOVB 3GE8C 1DOYA 2OJWA 4ZRPA 2ZW1A 4EOYA 3MC8A 3OJ3A 2ZJDA 2JU6X 3V60A 1ZGUB 3MJ5A 4HJKA 4ANXA 3PVLA 1VR9A 2MEKA 4DXGA 4TSSA 1QZEA 3UQAA 4W9FA 1L0VB 1XO3A 3AULA 1DYQA 2W55A 1FNWA 4C7YA 3DHIC 2WXLA 2LHEA 2Z0DB 5T8IA 4P1BC 1WX7A 1PQSA 3VAWA 3C19A 4HPPA 4AWJA 4YWGG 1Q10A 1J19A 5CHFA 2PTLA 3L0WB 2DZKA 4N6EB 2YLMA 1H8CA 2V3PA 4JWSC 2NCNA 2CHXA 2RR9A 4DBGA 3VFKA 3GB1A 1FNVA 1WZ0A 1MG8A 2MLBA 2FCSA 1SJED 4N9F4 2DZIA 5JHBA 1XQQA 2RSUA 3H7SA 5H8YE 4NAMA 3RFZB 1C4AA 2RMMA 3EFCA 3PGEA 3A4SC 3PZDA 3BK2A 2N1VA 2QSDA 2REXA 4WJPA 3V6CB 2ZW0A 1A5RA 3Q8AA 2WXGA 3LYYA 2MCNB 1T0YA 1WGYA 1TZ1A 2L0TA 1HZ6A 1EWYC 3ECIA 3ZRCA 2WXJA 3FC4A 1QILA 1ZXIA 5EE1A 1T0RC 4G11A 1VJKA 2CJNA 3A4RA 4C4VA 2BS4B 3BVMA 2BW2A 3BVGA 4F7ZA 4WWOA 5J2RA 3AM9A 1OTRB 3H7PA 1A70A 2LGDA 2NTTA 2HJ8A 2KT7A 2JVCA 1I7HA 1YX5B 1EM7A 1P1AA 4P16A 3JSVB 2KK8A 2YEPF 4BFRA 1XLQA 2JZZA 3S2AA 3AEEB 5LNK1 2K25A 1BMLC 2JWZA 2ZPYA 3SFDB 4DHZB 2CR5A 3GP7A 4MEMA 1FFVA 2MBEA 2KX3A 1XLOA 3A9JB 3VUYA 1XLPA 2LJ5A 3AE1B 2LI5A 1WRDB 1UH6A 1V6EA 2WP9B 5D3IB 3VR9B 1QT9A 3T3NA 1GPXA 2EKIA 4A8XC 2MP2A 5D3DA 2NPTA 2BBCA 2M17A 4PS3A 4ICVA 4FJZA 4YL8A 1UWXA 3RCZA 1HXYD 4HLEA 2D11A 2RPVA 1VDVA 3HRDD 3Q8FA 5C2TB 2QMTA 2H88B 3HVZA 3N1YC 4YTPB 1UELA 1ISNA 1CJEA 2MQJA 3W5VB 3BYTB 1NI3A 2G45B 4M01A 3P63A 4HEA1 1TIFA 4B95A 3R7RA 1JWAD 3U8ZA 4HDOA 3V61A 1F52A 3ZNGC 3DHGC 4RF0A 3WAPA 1WI0A 4LK0M 4HVBA 5AZFA 2LRWA 1FIQA 4WJOA 4BKGA 3ZTDA 1H4RA 2PE6B 3Q69A 5D7GA 1R4MI 4BZAA 2IZVB 2KDBA 5J17A 2KJHB 4W9HA 4M00A 1QF6A 1WXVA 3AECB 2WWZA 1OFFA 1VLBA 1JWSD 2BKFA 5BMIA 2BT6A 1E8XA 3PLVA 1BUIC 3NVZA 1PYWD 4CO7A 2FCMA 3UGBB 2INDC 4LDTB 2V4IB 2QJLA 1V8CA 1YN4A 1WXMA 3NS8A 4W9DA 4ZRIA 3RMKC 4G50A 3W1SC 2VH1A 5GMVA 2N4FA 2DX5B 1VRAB 4LCDE 1C76A 2KTFA 3IXSA 3O65B 3MHSD 2BWES 2VRRB 3U52E 1P3QU 2BYTA 2QC8A 2KC1A 1I4HA 1U4AA 4B9KA 2KDEB 1FD6A 3ZIMA 2I1KA 4IW0A 4II3B 5MPOA 4ICUA 2BB5A 3I57A 2IGGA 2PE9A 1BT0A 4XDDA 4PT5A 4HRSA 5G5GA 3GS2A 3AE7B 1V49A 3VTUA 1GUAB 5DPRA 1WY8A 2NBWB 3HIZA 1RWSA 4RFBA 4B0EA 4LJPB 2JT4B 2NBVB 4N58A 4GMVA 4BBNF 4OW0A 2C7MB 3P4PB 3FILB 4RGTA 1UF0A 1N5XA 2D07B 2KJ6A 1V80A 1X1MA 1TZOA 4AP4C 2NTSA 1N61A 4USAA 4KDLB 1ZKHA 1NVID 2JZ3B 4D2KA 1IGDA 1P98A 3DVGY 3RI7C 2K3UA 3ZJVA 3T3OA 3DVNU 1IGCA 1ACCA 1L7YA 1Y56A 2B76B 2KDMA 2Y3AA 3WA0A 2A4ZA 1RAXA 4B0MA 3ML9A 4GDLA 2M8SA 5IAAC 4LLGM 4LNKA 4Q2JA 4P1CC 1KLUD 5KHOA 4IM3A 4NJ6A 3PHWB 2Z59B 3H1UA 5HFYA 3OLMD 4DDID 3N9YC 3U2SC 4ZRKA 4DHZE 4IM2A 2I1JA 4XZ4A 1DGJA 4GDKB 5HG2A 3Q3OC 1E10A 3PRPB 2PEAA 3AU5A 2E3TA 2K39A 2JYEA 4FADA 4WWNA 1MPEA 4NZLB 3QAQA 2ICIA 1WYWB 1Z2MA 4KV2A 3KYCD 2BS3B 2HE7A 4HDQA 2L7RA 2G1EA 4GSWA 2QIEB 3EUB2 4IC7B 3TEXA 4C7ZA 2BB6A 2L00B 1FO4A 2KTRB 4OVVA 4DHJB 2KVRA 2QHOA 1QQRA 2JYTA 1I4GA 3ZQ4A 1K50A 1JALA 3KUZA 2CKHB 2AEHA 3DHHC 1WM2A 4ZDVA 4A20A 4XWTA 1TS3A 1GC6A 1TS2A 1JRUA 3GZNB 2ASQA 1AN8A 1ESFA 3KQ4A 1NEKB 3MC9A 3VRAB 2EKEC 1I4PA 2WXMA 4HROA 2NR2A 4RMAA 4BBNC 3Q2AC 3RN9C 2HJ1A 3ABVB 2IO0B 2OJRA 3HM3A 1R4NI 2Y5CA 3ZDTA 1WE7A 4XYCA 3J9CA 2N7JA 2KANA 1GAQB 2FAZA 2GBJA 1VZ6A 2L3ZA 4NQLB 3NVWA 3QC8B 4GOCA 1RFAA 3A9KB 2LUMA 4US8A 1LFDA 2JY6A 3DBHI 2MBHA 3HHMA 4ARCA 4CQNA 2AL3A 2D2QA 1WF9A 2MX2A 4US9A 4BKSA 3AE5B 3Q3FA 4DXFA 3QWZB 1XF5L 4L23A 4AS1A 1ZUD2 3CIRB 2WXIA 2IGDA 1EU4A 1JWMD 3BZDB 2O6VD 1D4BA 3L17A 1T0SC 2FUG1 3AEAB 1CK1A 4A3OA 3KWLA 1V5OA 3ZYYX 1TY2A 1RRBA 4ITKA 1SJHD 1F0ZA 2IGHA 2KFJA 2KFKA 2LVPA 4DQOC 3IT6B 4KGSA 3ZVVA 5C23A 1V9JA 3TUOA 2V1YA 1B1ZA 3TBLD 2YEPB 4NY0A 2Z8LA 4HWIB 1AARA 1UUPA 1RYJA 4YXDB 1F77A 3BVZA 4NAWA 1FCLA 4FHKA 1J8CA 3ZXVA 3L08A 3Q8CA 2GRIA 2N9LA 5DCNA 2J0KA 2WDTB 2KWDA 1D6EC 2XK5A 4WH4A 4RCOA 1VZ7A 2KWUB 2EELA 2D3AA 4PYZA 2WU2B 3DBSA 3QQ8B 4BOSC 4TV3A 4MJSB 4XGAB 1E8WA 1Q0WB 3NG0A 5L83A 2KMAA 2WQYB 3VVWB 1UGMA 4XC2A 2M4NA 2PPHA 1FEHA 1Q5WB 1OQQA 2LGXA 1RM6C 3ZNHB 4BVUC 3N32A 3PRZA 1T3QA 3E56A 2AWTA 3WALA 3KVFB 1TKGA 2C60A 3JYUA 4BKSD 1WWTA 3CSFA 1VCBA 1QLBB 4EZJA 1E0ZA 3L54A 3QCAA 4YSZB 1GG3A 1SE9A 1GC7A 2MJEA 1TGZB 3SFEB 4AUQC 5I4DA 2KOXA 2WS3B 4IWQA 3AMZA 3TJPA 3AU4A 1D3ZA 1PGXA 3L16A 3ZTCA 4GN1A 3CWIA 4WJNA 4BKTA 1P0RA 4A6QA 1FRDA 1WXAA 3AEBB 4ZYSA 2RGFA 2PVOD 2K5PA 5D94A 2KO3A 1XLNA 4KDIC 4EZLA 2I38A 2L0FA 2BGFA 3PREA 1C3TA 2DYBA 2ZPNA 1AWDA 2L76A 2JRHA 1JW9D 4MM3B 1YIWA 1NENB 3ENEA 4GIVA 3QIJA 1J7CA 2MSED 2SAKA 4DK5A 4J6IA 4IM0A 1E7UA 4IOIE 4K81A 1QOAA 3AN1A 3R2IA 3GE3C 4KZ0A 3MTNB 2J52A 3ZJUA 2MJ3A 2N9PC 1WMHA 4LNFA 3B2FA 1HTOA 3IBEA 2IY0B 3UF8A 2W82A 1IBXB 4JQWC 1C4PA 3SDLC 3A1QB 4JLCA 3SEBA 3U7ZA 5G5HA 2KDFB 3AE2B 2KDIA 1LQBA 3DVNV 4JL9A 2FE8A 4W9JA 1LO5D 4OZAA 4AQ7A 1V97A 4MT5A 2MBBB 2FIFA 3N3KB 2SEBD 4E71A 4DWFA 1KH0A 3RZWC 3FKYA 1MVKA 1ZDXA 3U30A 4CHKA 2K22A 2UWQA 3K9PB 3PV1A 4IG7B 2G4DB 5D2MB 4MSMB 5E6OA 3Q8EA 2LVQA 4DXAB 2BYFA 2W3RA 1XCTL 2D5GA 4GXBA 1SF0A 4P6VF 2LVOA 1V1OA 2L8JA 3TCAA 2KJRA 1FCCC 3I63C 3B9JA 3Q6BA 4KSKC 2BYVE 4FHJA 1GJZA 4KIKB 3MHZA 2G3QB 1V86A 3ZKJC 4MH8A 3AV8A 4ARIA 4NJCA 4OZBA 3UI3A 4R3DA 3VH4B 2IO2B 4JWUC 1YQBA 1E6EB 1WGGA 2N1WA 5EDSA 2M0AA 4W9LA 1N6ZA 1ZOYB 1B9RA 3LJ3A 2NMQA 4FULA 2IYDB 2CS4A 2ZNVB 2CHWA 1TKEA 4HKQA 3RZFA 5IA7A 4JGHB 1C78A 4HCPB 3SR6A 1XCQL 2MRPA 4ANUA 4GDLB 1OQRA 2WXNA 3LDZE 3V62A 4RF1A 1JWUD 1N60A 1D5MC 1V1PB 3H6NA 2INNE 4ZYNA 1WXSA 5IOIA 1ROEA 2DNFA 3RD2A 1QOBA 4H2AA 1IUEA 3JSVA 3KWVA 4W9EA 1TKYA 4I6NB 3WANA 3DCGA 3NZSA 1MG4A 1NYQA 1C4CA 2ON8A 4TKNA 4WQOB 4WWMA 3VH3B 1M94A 4DDGD 4RM9A 3EECA 1WXQA 1YN5A 3DWMA 5TSSA 4ZRJA 2LFIA 1KJTA 4JPSA 3NOBA 3ZRFA 1SE2A 3A9JA 3P1MA 5C3JB 3ETRA 3M3JA 2JQRB 5HHDG 4NNJB 2DENB 1TYGB 3SU8X 3MFGA 2PIAA 3TSSA 1ZDVA 2V3NA 1MHXA 4C00A 2LGYA 1R4MB 1HTQA 2WLBA 2VZKB 3WAOA 1F2RC 3BYYB 4AJWA 1LXDA 1WR6E 5BMHA 3AB5A 4TQ1A 3HVDA 2AQ1B 2KMMA 3KW5B 3MP9A 3PPAA 1E7VA 2JX5A 3R2TA 1F9JA 3HUIA 5L95C 2I2YA 4HJGE 2IJ0A 4K3BA 2KX0A 2WXOA 4KGTA 3M63B 4WWPA 1ZPSA 4YSXB 3RNCC 3TMPB 1I42A 4PK1A 1G6JA 5DPSA 1TT5B 4MH0E 4WAAA 3JW0X 3RYTA 1NDDA 3VDZA 1FRRA 1HEZE 2CU3A 1XXGA 3DVGX 1ZE3D 2PLPA 4MGYE 3IVFA 3ZW3A 2LGSA 2KXJA 3C0RB 3KYDD 2WXRA 4E3CA 4A3PA 3E9SA 2L52A 1L4DB 1YJ1A 1F1HA 1YMHE 3W9CB 1QOGA 2Y5BB 1SIJA 1UBQA 3AE8B 1AW7A 2KACA 1KLVA 3DBLI 4XWWA 2QILA 2O6VA 1WSPA 3PHXB 1FXIA 3IAM1 1K52A 1WGDA 3ZJTA 5DPWA 2HDEA 1E9MA 2Q5WD 3Q14C 2MA9B 3KH0A 1WJ4A 1GB4A 1I4XA 5CTRC 2EMTA 4MGZE 1WX9A 4RM8A 1LGRA 1WGHA 3M95A 4F1SA 2QCZA 2KVZA 1TJEA 4REZA 2DYOA 2N0SB 3VUXA 1IYFA 2D3CA 2MJDA 3U7DA 3JVZX 1ET9A 2LGIA 5EE3A 2K1FA 1CMXB 1YJJA 1WZ3A 3R7QA 2XBBC 1FPYA 2XK5B 3VUWA 3GOEA 2Y5PA 1UD7A 3FILA 1WE6A 2AL6A 1T5XD 3NZ3A 1XT9B 3NJTA 3CSTA 5LXIB 2L83A 3NY5A 3C8YA 4F8CB 2GMIC 3MJWA 5LLIA 3W5UB 2O2VA 3QJZA 5BO4B 4BOZB 3DBRI 1WJNA 2J0JA 2BF8B 3P4SB 4M0WB 1JCKB 2IY1B 2LEKA 1JMLA 3DDCB 4XE0A 4ZHPA 3B2GA 1WFYA 1WRIA 3NVYA 3RT3B 1SBBB 2K9XA 3B0AA 3QHTA 1OQYA 3APFA 2K0PA 2KD0A 4URKA 4GDKA 2IBIB 3KUDB 1RFKA 1EF1A 4M8NA 4TUUA 4IUMB 2WXFA 1EUVB 2KHWB 1N5WA 1F2RI 3AE9B 3RULA 3BINA 3ZDMC 1IP9A 4IDIA 2W9NA 3LXFA 3R3MA 3V05A 4ASWC 1R4NB 1L0XB 2IO3B 2LUEA 1C77A 1D5XC 1Z5SB 2R2QA 4JE3B 1YX6B 5KHQA 2FCNA 2FBWB 3P42A 3OAWA 3ML8A 1E8ZA 4YTMB 3ZGZA 3AE4B 1K51A 2KTRA 2JZPA 3DBHB 2L05A 4ACFA 2C7NB 4EUTA 3BWUD 1I4QA 3VRBB 2C5LC 1T0QC 4EZKA 1M4VA 2K8BA 5G2NA 3OJ4B 4W9KA 5JZEB 4FJYA 3PT2B 2JXTA 2HD5B 5BYSA 3I9V1 2RDGA 1XEEA 4ZHOA 1HZ5A 1T6BX 2JRIB 3EFUA 3UIOB 3MC0B 5E6NA 2A5UA 4IWPA 4N59A 2AYOB 2G9HD 4W9GA 3PO0A 2K8HA 1L2NA 2CJOA 1I35A 1R7SA 3R66C 3T9LA 4C4VB 4HPLB 1FNUA 2RDBC 3DWGC 1S1QB 3H7PB 4MGKE 1P7EA 3Q3JA 5J18A 1DOXA 4W9CA 3L4PA 3A9KA 4KSLC 4LNNA 4K7UA 3RUIB 3AH7A 1TS5A 3EC8A 1CZPA 2WDVB 4E74A 1JQ4A 1ZXHA 2CHZA 1N62A 4KX6B 1JRPA 3PRMB 1ZW7A 4HPMB 2H89B 3UINB 3WAMA 2ZVNA 5AUIA 3RNFC 1WGRA 1ZP0B 4UDUC 3BY4B 2KWCA 1XD3B 1HE8A 2LD9A 4J3OD 1SSNA 2PVGC 4B6WA 2GBRA 1K8RB 4KVGB 1PFDA 2WYQA 3AEDB 4FA6A 3DOWA 1C79A 1UZXB 2RPQA 3QARA 4QAYA 4LNIA 1PUTA 2MP2B 2BQQA 2ZCCA 5TR5A 3K9OB 1YNTE 2NPTB 3VTVA 1SE4A 2ZCBA 2R2OA 3U4EG 2NVUI 3URYA 2GI9A 4WQMA 2KC2A 2N7DA 5AZHA 4YSYB 4DHJD 2IO1B 3FAHA 2KYWA 4FJVB 2FNJB 1YJIA 3QA8A 5E6PA 1WYGA 2DHZA 2V9HA 2WU5B 3W1SA 2W3SA 5BMGA 4M02A 4L1BA 3VXWA 1SGHA 3W2DA 5G55A 4EEWA 4TQ0A 1AYFA 5CHVC 3P4RB 2WX0A 2C9WB 2M1MA 2VH2A 1E7PB 2J53A 2BTEA 3ZNZB 1EWCA 4WAFA 1C9FA 1IPGA 2ZEQA 4MJSA 2JWUA 3KUCB 3PS6A 5CHWA 1VD2A 3UIPB 4MELA 4WIPA 2N9EB 1J7AA 2LHDA 2OEDA 3W1YA 2INCC 1K53A 3PZ7A 1QOFA 4PS8A 4FXCA 4KKJA 2DZJA 4KKIA 2DAJA 4O1NA 3HK0A 4WJQA 4CYEA 2UU7A 4IKGA 4OHJA 1J0GA 4A90A 4X57B 2JSVX 3BK1A 2XN9C 2KKCA 3NRZA 1FXTB 4ZOHC 3B1LX 1TBEA 1V2YA 5FR3A 1OGWA 4LJOB 2N9XA 5D6JB 4KGRA 1KTKA 4EE2A 2V0GA 3AEFB 4I6LB 2WGSA 5IP4D 2BVCA 3ZXRA 3HM6X 4WURA 2J7QB 2M19A 2WXPA 1KM7A 5HKHA 2BYEA 4LNOA 1OEYA 3I3TB 1WX8A 3SHQA 2DBYA 2LRUA 2WX1A 3TEWA 1VZ8A 2J0MA 2NBUA 1DOIA 2GBMA 1NYRA 3IFWB 3RNGC 3PSEB 2PW9A 4MM3A 3O13A 2KQ4X 2D3BA 2N9KA 3ALBA 4YT0B 3PZ8A 2KMCA 2LWPA 1SXTA 1P9DU 1PDXA 1WGKA 1LM8B 1YD8U 1WIAA 4EFOA 5AEKB 2E6XA 1PGAA 5H92C 1FFUA 1GOZA 2KNBA 4AOFA 4K1RB 5EE0A 1UGJA 4C80A 1L6VA 1YQ3B 4II2B 5AUKA 3X0WA 2KN4A 1WR1A 5BYQA 5E6JA 1IBXA 3A1QA 2LJIA 2OHFA 5HI1A 4LTUA 3VHTC 2FUHB 3KLSX 3RPFC 5AZGA 1BXTA 1GB1A 2MWSB 2G4SA 3I5JC 3V6EB 2WDRB 1S3SG 2O6VB 3T8MA 2OOBB 3UQBA 3VTWA 3P4QB 3AEGB 2WXKA 4P7IA 2RDHA 1MFWA 4MSQB 4C56C 4HK2A 2W54A 4PS7A 3IG3A 2IPKD 2TSSA 2KLGA 4GLSC 1P7FA 1KRHA 3IAS1 2EMSA 3EA6A 1EO6A 5BYRA 2K8CA 3N1ZC 1E90A 3EGRA 1WJUA 2MBQA 2HTHA 2WDQB 1RLFA 1C1YB 3Q8BA 1I4RA 1WH3A 4KIKA 4OVUA 1FMAD 2Z0EB 2GBKA 2GOWA 3AE3B 4S0RA 1UWMA 3NHEB 2BKRB 3QK0A 4XX5A 4RGMA 1KF6B 1JROA 2LZ6A 3L10B 2M56B 3H9DA 2MBOA 3ONSA 4A9AA 4G3XB 4ANVA 2RD0A 1WM3A 1N63A 2INPE 4JX1C 3CMMB 4JIOU 1QKZA 4G0NB 2O2VB 3IHPC 1GNUA 1ENFA 4MACA 4GU2A 1JWBD 2YVCA 1V1PA 2MW5A 2LXCA 2QEJC 1NBFC 1FM0D 3NZUA 1MHHE 1SE3A 2WXQA 1WJ6A 3PLUA 2CU1A 2N7EA 3P2BA 2ACZB 2DAFA 5EE9A 1OEYJ 3GZNI 3WCQA 5DPTA 4K7SA 3M62B 2BPSA 1L5PA 2DWQA 5JH5C 3TL5A 4L2YA 3SD5A 1FXAA 3APDA 3ZLZA 2MHJA 1YQ4B 1SIFA 4BAXA 2KFKB 1L4ZB 4W9IA 2X38A 2AX5A 3X23A 3RNAC 4RGOS 3AXCA 2J4XA 4KZCA 4M8MA 3ZUNA 2ZVOA 3Q3NC 5LXHA 2KQSA 2UYZB 2DLBA 1V81A 1EF5A 4NAWB 2LMCA 2PKOA 2MH7A 2R61A 4EKUA 1STEA 2HTME 3CF6E 4FN2A 3DBLB 5GXGB 2LXAA 4NPNA 1SB3C 2LASA 3QX1A 2V3SA 1L6UA 4MGIE 1KLGD 4OZCA 2IDYA 2GBNA 2DZMA 3N1XC 1UNSA 3AE6B 3OWEB 2WNMA 5C1ZA 1MI0A 1NI2A 2PMVA 3OG5A 3DPDA 2GB1A 2KZRA 3BIID 3Q3MC 4HCNB 2XNAC 1HA5A 4RGNA 3NVVA 3PTFC 2WHIA 3N20C 3D32A 5IKCM 5IN7A 2FIDA 2L32A 5JXVA 3APCA 5CX3A 4NJ7A 4HKZE 5FR6A 4S17A 3VQIA 4OVZA 2PJHA 3NUHB 2KQ7A 4LDTD 4RNAA 2WXHA 3ZO5B 1CQVA 1MJDA 3L13A 2KN5A 2D3GA 2K6DB 2JPHA 2M0XA 3A33B 1TTNA 1V5TA 5FKAC 1L0YB 3LB8C 2QDFA 4NQKE 4HXDA 3V3XA 4FBJB 4K7WA 2V4LA 4TMAB 1PGBA 3DBRB 2B3AA 3WIMA 4RH6A 1YN3A 1TS4A 2BS2B 4XDCA 4FLHA 3IT4B 1E8YA 2C7HA 1KOTA 4A55A 2XEWA 1HQRD 2VZKD 5JHAA 2JF5A 1UBIA 4MDKE 2ONQA 2KWVB 2GLSA 4IWOA 3ZNID 4K3CA 2J42A 1KFYB 4I6PA 1SEBD
chains in the Genus database with same CATH topology
3JSVA 2ZEQA 2KLCA 4GSWA 4MJSA 4ANWA 4W9EA 3KUCB 1Q1OA 2FCQA 3N30A 3PS6A 4I6NB 4IC7B 5CHWA 2JUOA 2NS5A 2ZNVC 3WANA 1VD2A 2JXXA 4MELA 3UIPB 2N9EB 3DCGA 3NZSA 1Y8RC 2L00B 3VH3B 4TKNA 4WQOB 2KTRB 4DDGD 4OVVA 1M94A 4DHJB 2KVRA 2QHOA 3W1YA 4RM9A 3EECA 4GB9A 4PYUA 2ZZPB 4PS8A 4ZRJA 1KJTA 2BWFA 3NOBA 3ZRFA 3A9JA 3KUZA 2CKHB 3EHVA 2AEHA 3M3JA 2DZJA 2K6QA 3TIXA 2D10A 2DAJA 3B08A 4NNJB 2DENB 1WM2A 4GGQA 3SU8X 1E5WA 3HK0A 4WJQA 4ZDVA 4A20A 4CYEA 2LGYA 1GC6A 1JRUA 2ASQA 1J0GA 3WAOA 3DQVA 4AJWA 3AI5A 1LXDA 4X57B 2DYMA 2EKEC 2KKCA 4AJYB 1FXTB 1WMHB 1WR6E 3B1LX 1TBEA 1V2YA 2NR2A 4TQ1A 4RMAA 1OGWA 4BBNC 4LJOB 4EOYA 2N9XA 5D6JB 3KW5B 3OJ3A 2ZJDA 3PPAA 1E7VA 3V60A 1F9JA 1ZGUB 2IO0B 5L95C 2OJRA 4I6LB 3HM3A 1R4NI 3ZDTA 1WE7A 4HJKA 4ANXA 3PVLA 3HM6X 2KX0A 2KANA 2J7QB 1QZEA 3UQAA 2FAZA 2GBJA 4W9FA 3M63B 3AULA 2L3ZA 4NQLB 4WWPA 3QC8B 4GOCA 1RFAA 1KM7A 3A9KB 3TMPB 5HKHA 2BYEA 1LFDA 2JY6A 3DBHI 1I42A 2Z0DB 2MBHA 3HHMA 1OEYA 1G6JA 3I3TB 1WX7A 1PQSA 3VAWA 1WX8A 2AL3A 2D2QA 5DPSA 3SHQA 2LRUA 4AWJA 4MH0E 1J19A 4WAAA 1WF9A 2MX2A 3JW0X 5CHFA 4BKSA 2WX1A 3L0WB 3RYTA 1NDDA 2DZKA 3Q3FA 3VDZA 2YLMA 2J0MA 3QWZB 2NBUA 3DVGX 1H8CA 4MGYE 3IVFA 3ZW3A 2NCNA 2GBMA 2CHXA 2RR9A 2KXJA 3IFWB 4DBGA 3PSEB 3VFKA 3C0RB 3KYDD 4MM3A 4E3CA 1WZ0A 1MG8A 2MLBA 4A3PA 2FCSA 4N9F4 3ALBA 2DZIA 5JHBA 2O6VD 2KMCA 3L17A 1XQQA 1YJ1A 2LWPA 2RSUA 3H7SA 4A3OA 1P9DU 1V5OA 1RRBA 2Y5BB 3PGEA 1UBQA 3A4SC 1LM8B 1YD8U 1WIAA 3PZDA 4EFOA 2N1VA 2KFJA 2KFKA 5AEKB 2LVPA 2REXA 4WJPA 1KLVA 3DBLI 3ZVVA 5C23A 3V6CB 1V9JA 2O6VA 2V1YA 3PHXB 1A5RA 2KNBA 3TBLD 4AOFA 4K1RB 1WGDA 4II2B 2MCNB 1T0YA 4NY0A 1WGYA 5DPWA 3X0WA 1TZ1A 1AARA 1WR1A 2L0TA 4HWIB 3ECIA 3A1QA 3ZRCA 4NAWA 4FHKA 1J8CA 3VHTC 2FUHB 3L08A 5AZGA 2MA9B 3KH0A 4G11A 1WJ4A 5DCNA 2J0KA 2WDTB 3A4RA 2XK5A 2MWSB 2G4SA 4F7ZA 4WWOA 5J2RA 1OTRB 3H7PA 5CTRC 3V6EB 2EMTA 4MGZE 1WX9A 2KWUB 2LGDA 4RM8A 2HJ8A 1WGHA 1S3SG 2O6VB 3T8MA 2OOBB 3UQBA 3VTWA 2JVCA 3M95A 4PYZA 1YX5B 4F1SA 3DBSA 1P1AA 3QQ8B 4BOSC 3JSVB 4TV3A 4MJSB 2KK8A 4BFRA 2JZZA 1E8WA 1Q0WB 5L83A 2DYOA 3VUXA 2KMAA 4P7IA 1IYFA 3S2AA 4MSQB 3U7DA 3VVWB 1UGMA 4HK2A 4XC2A 4PS7A 3JVZX 3IG3A 2K1FA 2K25A 1CMXB 2KLGA 2M4NA 1WZ3A 2JWZA 2ZPYA 2PPHA 3R7QA 4DHZB 2CR5A 2XBBC 1Q5WB 4MEMA 2EMSA 2XK5B 3VUWA 1EO6A 3GOEA 2K8CA 2MBEA 2LGXA 2KX3A 1UD7A 1WE6A 2AL6A 3A9JB 3ZNHB 3VUYA 4BVUC 3N32A 1XT9B 1E90A 2LJ5A 3PRZA 2LI5A 2AWTA 1WJUA 1WRDB 2MBQA 1UH6A 1V6EA 3WALA 2HTHA 3KVFB 3CSTA 5LXIB 1RLFA 1C1YB 2C60A 3JYUA 3NY5A 1WH3A 4KIKA 4OVUA 4BKSD 2Z0EB 2MP2A 4F8CB 2GMIC 2GBKA 1VCBA 2NPTA 2GOWA 3CSFA 3MJWA 5LLIA 4EZJA 2M17A 2O2VA 3QJZA 5BO4B 4BOZB 3DBRI 1WJNA 2BKRB 3NHEB 3QK0A 2J0JA 3L54A 2BF8B 4ICVA 4FJZA 4PS3A 4XX5A 4YL8A 3QCAA 4M0WB 2IY1B 3DDCB 3RCZA 2LZ6A 1WFYA 1GG3A 3L10B 1SE9A 1GC7A 3H9DA 3RT3B 4HLEA 2D11A 1TGZB 4AUQC 2MBOA 3B0AA 3ONSA 3QHTA 4G3XB 2KOXA 4ANVA 1OQYA 4IWQA 3APFA 3TJPA 2RD0A 1WM3A 3AU4A 2KD0A 1D3ZA 3L16A 3ZTCA 4GDKA 4URKA 1UELA 1ISNA 2IBIB 2MQJA 4GN1A 4WJNA 4BKTA 1P0RA 3KUDB 1EF1A 2G45B 3CMMB 4B95A 4M8NA 4TUUA 4IUMB 4JIOU 3R7RA 1EUVB 4G0NB 2KHWB 2O2VB 1WXAA 3IHPC 1GNUA 4HDOA 3U8ZA 3V61A 2RGFA 4GU2A 5D94A 2YVCA 3RULA 2KO3A 3BINA 3ZNGC 3ZDMC 1IP9A 2MW5A 2W9NA 2LXCA 3R3MA 3WAPA 1NBFC 1WI0A 4ASWC 2IO3B 2LUEA 4KDIC 1Z5SB 2R2QA 4EZLA 4HVBA 5AZFA 3NZUA 2LRWA 1YX6B 2L0FA 5KHQA 1WJ6A 4WJOA 2BGFA 4BKGA 2FCNA 3PREA 3PLUA 3ZTDA 1H4RA 2CU1A 2PE6B 2N7EA 1R4MI 2DYBA 2ZPNA 3ML8A 1E8ZA 3OAWA 3P2BA 2DAFA 2IZVB 2KDBA 2L76A 2KTRA 1OEYJ 2JRHA 3GZNI 5J17A 2L05A 2KJHB 4W9HA 5DPTA 1YIWA 3ENEA 4K7SA 3M62B 4GIVA 3QIJA 2C7NB 4EUTA 2MSED 2BPSA 4DK5A 1WXVA 4J6IA 4IM0A 1C3TA 2C5LC 1E7UA 4EZKA 2WWZA 5JH5C 2K8BA 3TL5A 5G2NA 3OJ4B 4W9KA 5JZEB 4FJYA 3APDA 2BKFA 3PT2B 4K81A 2HD5B 3SD5A 3ZLZA 1E8XA 1SIFA 3PLVA 2KFKB 4W9IA 4CO7A 3X23A 2FCMA 3UGBB 4LDTB 4KZ0A 3MTNB 2JRIB 3EFUA 3AXCA 3UIOB 2N9PC 1WMHA 1WXMA 3NS8A 5E6NA 4W9DA 4KZCA 3IBEA 2IY0B 4M8MA 3UF8A 2ZVOA 2A5UA 4IWPA 4ZRIA 3ZUNA 2KQSA 2UYZB 4JQWC 5LXHA 1V81A 3A1QB 3SDLC 1EF5A 4G50A 2AYOB 4JLCA 4NAWB 3W1SC 4W9GA 5GMVA 2K8HA 1L2NA 2KDFB 2N4FA 4EKUA 2DX5B 3CF6E 1I35A 2KDIA 1LQBA 3DVNV 4JL9A 4FN2A 4LCDE 2KTFA 3R66C 3O65B 3MHSD 3T9LA 2BWES 2LXAA 4NPNA 4W9JA 2LASA 2VRRB 4HPLB 3QX1A 2V3SA 1P3QU 2MBBB 2FIFA 2KC1A 1U4AA 1S1QB 3H7PB 4B9KA 4MGKE 3N3KB 4MGIE 4E71A 2KDEB 4DWFA 3Q3JA 3ZIMA 2I1KA 3RZWC 2GBNA 4W9CA 5J18A 3A9KA 4KSLC 4IW0A 2DZMA 4II3B 4K7UA 3RUIB 4ICUA 3U30A 5C1ZA 2PE9A 4CHKA 1BT0A 1NI2A 3EC8A 2UWQA 1V49A 3K9PB 4E74A 3PV1A 3DPDA 4IG7B 1GUAB 2KZRA 2G4DB 5D2MB 5DPRA 3VTUA 4MSMB 1WY8A 5E6OA 2CHZA 2NBWB 3HIZA 3PRMB 1ZW7A 2LVQA 4HPMB 4HCNB 4LJPB 4DXAB 2BYFA 2JT4B 2NBVB 3UINB 3WAMA 2ZVNA 3PTFC 4GMVA 1WGRA 4BBNF 4GXBA 2C7MB 3D32A 2D07B 2KWCA 3BY4B 1XD3B 1HE8A 2LD9A 2KJ6A 1V80A 1X1MA 4AP4C 2FIDA 2LVOA 3APCA 2L8JA 4B6WA 5CX3A 2GBRA 1K8RB 2KJRA 4NJ7A 1ZKHA 4KDLB 2JZ3B 4KVGB 3TCAA 1P98A 3DVGY 4KSKC 5FR6A 3VQIA 2BYVE 3DVNU 2WYQA 4FHJA 1GJZA 4FA6A 1L7YA 3DOWA 1UZXB 2RPQA 3QARA 3WA0A 4KIKB 5D7GA 2A4ZA 2G3QB 1RAXA 1V86A 2PJHA 2MP2B 2KQ7A 2ZCCA 3ML9A 3K9OB 2NPTB 2M8SA 4GDLA 4LDTD 5TR5A 2ZCBA 3VTVA 2R2OA 5IAAC 2NVUI 3ZO5B 3L13A 2KN5A 3VH4B 2IO2B 2KC2A 5KHOA 2D3GA 2N7DA 4IM3A 4NJ6A 5AZHA 1YQBA 3PHWB 2K6DB 1WGGA 2Z59B 4DHJD 2IO1B 2JPHA 2N1WA 3H1UA 2M0XA 3OLMD 5EDSA 3A33B 1TTNA 4DDID 4W9LA 1V5TA 4ZRKA 3LJ3A 4DHZE 4FJVB 4NQKE 2FNJB 4IM2A 3QA8A 2I1JA 4XZ4A 4HXDA 4FULA 5E6PA 4GDKB 2DHZA 2IYDB 4FBJB 3PRPB 2V4LA 2CS4A 4K7WA 2PEAA 3AU5A 3W1SA 2K39A 2ZNVB 2CHWA 4FADA 4WWNA 2B3AA 3WIMA 3RZFA 3QAQA 5IA7A 3VXWA 1SGHA 4JGHB 4HCPB 5G55A 4FLHA 1WYWB 2MRPA 4ANUA 4GDLB 4EEWA 1Z2MA 1E8YA 2C7HA 4TQ0A 4KV2A 3ZKJC 5CHVC 2XEWA 1KOTA 3KYCD 3LDZE 3V62A 5JHAA 2WX0A 2JF5A 2C9WB 2HE7A 1UBIA 2M1MA 4MDKE 2KWVB 3H6NA 4IWOA 4ZYNA 3ZNID 1WXSA 3ZNZB 4HDQA 4I6PA 3RD2A 1IPGA 2L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV A;  2ZEQ A;  2KLC A;  4GSW A;  4MJS A;  4ANW A;  4W9E A;  3KUC B;  1Q1O A;  2FCQ A;  3N30 A;  3PS6 A;  4I6N B;  4IC7 B;  5CHW A;  2JUO A;  2NS5 A;  2ZNV C;  3WAN A;  1VD2 A;  2JXX A;  4MEL A;  3UIP B;  2N9E B;  3DCG A;  3NZS A;  1Y8R C;  2L00 B;  3VH3 B;  4TKN A;  4WQO B;  2KTR B;  4DDG D;  4OVV A;  1M94 A;  4DHJ B;  2KVR A;  2QHO A;  3W1Y A;  4RM9 A;  3EEC A;  4GB9 A;  4PYU A;  2ZZP B;  4PS8 A;  4ZRJ A;  1KJT A;  2BWF A;  3NOB A;  3ZRF A;  3A9J A;  3KUZ A;  2CKH B;  3EHV A;  2AEH A;  3M3J A;  2DZJ A;  2K6Q A;  3TIX A;  2D10 A;  2DAJ A;  3B08 A;  4NNJ B;  2DEN B;  1WM2 A;  4GGQ A;  3SU8 X;  1E5W A;  3HK0 A;  4WJQ A;  4ZDV A;  4A20 A;  4CYE A;  2LGY A;  1GC6 A;  1JRU A;  2ASQ A;  1J0G A;  3WAO A;  3DQV A;  4AJW A;  3AI5 A;  1LXD A;  4X57 B;  2DYM A;  2EKE C;  2KKC A;  4AJY B;  1FXT B;  1WMH B;  1WR6 E;  3B1L X;  1TBE A;  1V2Y A;  2NR2 A;  4TQ1 A;  4RMA A;  1OGW A;  4BBN C;  4LJO B;  4EOY A;  2N9X A;  5D6J B;  3KW5 B;  3OJ3 A;  2ZJD A;  3PPA A;  1E7V A;  3V60 A;  1F9J A;  1ZGU B;  2IO0 B;  5L95 C;  2OJR A;  4I6L B;  3HM3 A;  1R4N I;  3ZDT A;  1WE7 A;  4HJK A;  4ANX A;  3PVL A;  3HM6 X;  2KX0 A;  2KAN A;  2J7Q B;  1QZE A;  3UQA A;  2FAZ A;  2GBJ A;  4W9F A;  3M63 B;  3AUL A;  2L3Z A;  4NQL B;  4WWP A;  3QC8 B;  4GOC A;  1RFA A;  1KM7 A;  3A9K B;  3TMP B;  5HKH A;  2BYE A;  1LFD A;  2JY6 A;  3DBH I;  1I42 A;  2Z0D B;  2MBH A;  3HHM A;  1OEY A;  1G6J A;  3I3T B;  1WX7 A;  1PQS A;  3VAW A;  1WX8 A;  2AL3 A;  2D2Q A;  5DPS A;  3SHQ A;  2LRU A;  4AWJ A;  4MH0 E;  1J19 A;  4WAA A;  1WF9 A;  2MX2 A;  3JW0 X;  5CHF A;  4BKS A;  2WX1 A;  3L0W B;  3RYT A;  1NDD A;  2DZK A;  3Q3F A;  3VDZ A;  2YLM A;  2J0M A;  3QWZ B;  2NBU A;  3DVG X;  1H8C A;  4MGY E;  3IVF A;  3ZW3 A;  2NCN A;  2GBM A;  2CHX A;  2RR9 A;  2KXJ A;  3IFW B;  4DBG A;  3PSE B;  3VFK A;  3C0R B;  3KYD D;  4MM3 A;  4E3C A;  1WZ0 A;  1MG8 A;  2MLB A;  4A3P A;  2FCS A;  4N9F 4;  3ALB A;  2DZI A;  5JHB A;  2O6V D;  2KMC A;  3L17 A;  1XQQ A;  1YJ1 A;  2LWP A;  2RSU A;  3H7S A;  4A3O A;  1P9D U;  1V5O A;  1RRB A;  2Y5B B;  3PGE A;  1UBQ A;  3A4S C;  1LM8 B;  1YD8 U;  1WIA A;  3PZD A;  4EFO A;  2N1V A;  2KFJ A;  2KFK A;  5AEK B;  2LVP A;  2REX A;  4WJP A;  1KLV A;  3DBL I;  3ZVV A;  5C23 A;  3V6C B;  1V9J A;  2O6V A;  2V1Y A;  3PHX B;  1A5R A;  2KNB A;  3TBL D;  4AOF A;  4K1R B;  1WGD A;  4II2 B;  2MCN B;  1T0Y A;  4NY0 A;  1WGY A;  5DPW A;  3X0W A;  1TZ1 A;  1AAR A;  1WR1 A;  2L0T A;  4HWI B;  3ECI A;  3A1Q A;  3ZRC A;  4NAW A;  4FHK A;  1J8C A;  3VHT C;  2FUH B;  3L08 A;  5AZG A;  2MA9 B;  3KH0 A;  4G11 A;  1WJ4 A;  5DCN A;  2J0K A;  2WDT B;  3A4R A;  2XK5 A;  2MWS B;  2G4S A;  4F7Z A;  4WWO A;  5J2R A;  1OTR B;  3H7P A;  5CTR C;  3V6E B;  2EMT A;  4MGZ E;  1WX9 A;  2KWU B;  2LGD A;  4RM8 A;  2HJ8 A;  1WGH A;  1S3S G;  2O6V B;  3T8M A;  2OOB B;  3UQB A;  3VTW A;  2JVC A;  3M95 A;  4PYZ A;  1YX5 B;  4F1S A;  3DBS A;  1P1A A;  3QQ8 B;  4BOS C;  3JSV B;  4TV3 A;  4MJS B;  2KK8 A;  4BFR A;  2JZZ A;  1E8W A;  1Q0W B;  5L83 A;  2DYO A;  3VUX A;  2KMA A;  4P7I A;  1IYF A;  3S2A A;  4MSQ B;  3U7D A;  3VVW B;  1UGM A;  4HK2 A;  4XC2 A;  4PS7 A;  3JVZ X;  3IG3 A;  2K1F A;  2K25 A;  1CMX B;  2KLG A;  2M4N A;  1WZ3 A;  2JWZ A;  2ZPY A;  2PPH A;  3R7Q A;  4DHZ B;  2CR5 A;  2XBB C;  1Q5W B;  4MEM A;  2EMS A;  2XK5 B;  3VUW A;  1EO6 A;  3GOE A;  2K8C A;  2MBE A;  2LGX A;  2KX3 A;  1UD7 A;  1WE6 A;  2AL6 A;  3A9J B;  3ZNH B;  3VUY A;  4BVU C;  3N32 A;  1XT9 B;  1E90 A;  2LJ5 A;  3PRZ A;  2LI5 A;  2AWT A;  1WJU A;  1WRD B;  2MBQ A;  1UH6 A;  1V6E A;  3WAL A;  2HTH A;  3KVF B;  3CST A;  5LXI B;  1RLF A;  1C1Y B;  2C60 A;  3JYU A;  3NY5 A;  1WH3 A;  4KIK A;  4OVU A;  4BKS D;  2Z0E B;  2MP2 A;  4F8C B;  2GMI C;  2GBK A;  1VCB A;  2NPT A;  2GOW A;  3CSF A;  3MJW A;  5LLI A;  4EZJ A;  2M17 A;  2O2V A;  3QJZ A;  5BO4 B;  4BOZ B;  3DBR I;  1WJN A;  2BKR B;  3NHE B;  3QK0 A;  2J0J A;  3L54 A;  2BF8 B;  4ICV A;  4FJZ A;  4PS3 A;  4XX5 A;  4YL8 A;  3QCA A;  4M0W B;  2IY1 B;  3DDC B;  3RCZ A;  2LZ6 A;  1WFY A;  1GG3 A;  3L10 B;  1SE9 A;  1GC7 A;  3H9D A;  3RT3 B;  4HLE A;  2D11 A;  1TGZ B;  4AUQ C;  2MBO A;  3B0A A;  3ONS A;  3QHT A;  4G3X B;  2KOX A;  4ANV A;  1OQY A;  4IWQ A;  3APF A;  3TJP A;  2RD0 A;  1WM3 A;  3AU4 A;  2KD0 A;  1D3Z A;  3L16 A;  3ZTC A;  4GDK A;  4URK A;  1UEL A;  1ISN A;  2IBI B;  2MQJ A;  4GN1 A;  4WJN A;  4BKT A;  1P0R A;  3KUD B;  1EF1 A;  2G45 B;  3CMM B;  4B95 A;  4M8N A;  4TUU A;  4IUM B;  4JIO U;  3R7R A;  1EUV B;  4G0N B;  2KHW B;  2O2V B;  1WXA A;  3IHP C;  1GNU A;  4HDO A;  3U8Z A;  3V61 A;  2RGF A;  4GU2 A;  5D94 A;  2YVC A;  3RUL A;  2KO3 A;  3BIN A;  3ZNG C;  3ZDM C;  1IP9 A;  2MW5 A;  2W9N A;  2LXC A;  3R3M A;  3WAP A;  1NBF C;  1WI0 A;  4ASW C;  2IO3 B;  2LUE A;  4KDI C;  1Z5S B;  2R2Q A;  4EZL A;  4HVB A;  5AZF A;  3NZU A;  2LRW A;  1YX6 B;  2L0F A;  5KHQ A;  1WJ6 A;  4WJO A;  2BGF A;  4BKG A;  2FCN A;  3PRE A;  3PLU A;  3ZTD A;  1H4R A;  2CU1 A;  2PE6 B;  2N7E A;  1R4M I;  2DYB A;  2ZPN A;  3ML8 A;  1E8Z A;  3OAW A;  3P2B A;  2DAF A;  2IZV B;  2KDB A;  2L76 A;  2KTR A;  1OEY J;  2JRH A;  3GZN I;  5J17 A;  2L05 A;  2KJH B;  4W9H A;  5DPT A;  1YIW A;  3ENE A;  4K7S A;  3M62 B;  4GIV A;  3QIJ A;  2C7N B;  4EUT A;  2MSE D;  2BPS A;  4DK5 A;  1WXV A;  4J6I A;  4IM0 A;  1C3T A;  2C5L C;  1E7U A;  4EZK A;  2WWZ A;  5JH5 C;  2K8B A;  3TL5 A;  5G2N A;  3OJ4 B;  4W9K A;  5JZE B;  4FJY A;  3APD A;  2BKF A;  3PT2 B;  4K81 A;  2HD5 B;  3SD5 A;  3ZLZ A;  1E8X A;  1SIF A;  3PLV A;  2KFK B;  4W9I A;  4CO7 A;  3X23 A;  2FCM A;  3UGB B;  4LDT B;  4KZ0 A;  3MTN B;  2JRI B;  3EFU A;  3AXC A;  3UIO B;  2N9P C;  1WMH A;  1WXM A;  3NS8 A;  5E6N A;  4W9D A;  4KZC A;  3IBE A;  2IY0 B;  4M8M A;  3UF8 A;  2ZVO A;  2A5U A;  4IWP A;  4ZRI A;  3ZUN A;  2KQS A;  2UYZ B;  4JQW C;  5LXH A;  1V81 A;  3A1Q B;  3SDL C;  1EF5 A;  4G50 A;  2AYO B;  4JLC A;  4NAW B;  3W1S C;  4W9G A;  5GMV A;  2K8H A;  1L2N A;  2KDF B;  2N4F A;  4EKU A;  2DX5 B;  3CF6 E;  1I35 A;  2KDI A;  1LQB A;  3DVN V;  4JL9 A;  4FN2 A;  4LCD E;  2KTF A;  3R66 C;  3O65 B;  3MHS D;  3T9L A;  2BWE S;  2LXA A;  4NPN A;  4W9J A;  2LAS A;  2VRR B;  4HPL B;  3QX1 A;  2V3S A;  1P3Q U;  2MBB B;  2FIF A;  2KC1 A;  1U4A A;  1S1Q B;  3H7P B;  4B9K A;  4MGK E;  3N3K B;  4MGI E;  4E71 A;  2KDE B;  4DWF A;  3Q3J A;  3ZIM A;  2I1K A;  3RZW C;  2GBN A;  4W9C A;  5J18 A;  3A9K A;  4KSL C;  4IW0 A;  2DZM A;  4II3 B;  4K7U A;  3RUI B;  4ICU A;  3U30 A;  5C1Z A;  2PE9 A;  4CHK A;  1BT0 A;  1NI2 A;  3EC8 A;  2UWQ A;  1V49 A;  3K9P B;  4E74 A;  3PV1 A;  3DPD A;  4IG7 B;  1GUA B;  2KZR A;  2G4D B;  5D2M B;  5DPR A;  3VTU A;  4MSM B;  1WY8 A;  5E6O A;  2CHZ A;  2NBW B;  3HIZ A;  3PRM B;  1ZW7 A;  2LVQ A;  4HPM B;  4HCN B;  4LJP B;  4DXA B;  2BYF A;  2JT4 B;  2NBV B;  3UIN B;  3WAM A;  2ZVN A;  3PTF C;  4GMV A;  1WGR A;  4BBN F;  4GXB A;  2C7M B;  3D32 A;  2D07 B;  2KWC A;  3BY4 B;  1XD3 B;  1HE8 A;  2LD9 A;  2KJ6 A;  1V80 A;  1X1M A;  4AP4 C;  2FID A;  2LVO A;  3APC A;  2L8J A;  4B6W A;  5CX3 A;  2GBR A;  1K8R B;  2KJR A;  4NJ7 A;  1ZKH A;  4KDL B;  2JZ3 B;  4KVG B;  3TCA A;  1P98 A;  3DVG Y;  4KSK C;  5FR6 A;  3VQI A;  2BYV E;  3DVN U;  2WYQ A;  4FHJ A;  1GJZ A;  4FA6 A;  1L7Y A;  3DOW A;  1UZX B;  2RPQ A;  3QAR A;  3WA0 A;  4KIK B;  5D7G A;  2A4Z A;  2G3Q B;  1RAX A;  1V86 A;  2PJH A;  2MP2 B;  2KQ7 A;  2ZCC A;  3ML9 A;  3K9O B;  2NPT B;  2M8S A;  4GDL A;  4LDT D;  5TR5 A;  2ZCB A;  3VTV A;  2R2O A;  5IAA C;  2NVU I;  3ZO5 B;  3L13 A;  2KN5 A;  3VH4 B;  2IO2 B;  2KC2 A;  5KHO A;  2D3G A;  2N7D A;  4IM3 A;  4NJ6 A;  5AZH A;  1YQB A;  3PHW B;  2K6D B;  1WGG A;  2Z59 B;  4DHJ D;  2IO1 B;  2JPH A;  2N1W A;  3H1U A;  2M0X A;  3OLM D;  5EDS A;  3A33 B;  1TTN A;  4DDI D;  4W9L A;  1V5T A;  4ZRK A;  3LJ3 A;  4DHZ E;  4FJV B;  4NQK E;  2FNJ B;  4IM2 A;  3QA8 A;  2I1J A;  4XZ4 A;  4HXD A;  4FUL A;  5E6P A;  4GDK B;  2DHZ A;  2IYD B;  4FBJ B;  3PRP B;  2V4L A;  2CS4 A;  4K7W A;  2PEA A;  3AU5 A;  3W1S A;  2K39 A;  2ZNV B;  2CHW A;  4FAD A;  4WWN A;  2B3A A;  3WIM A;  3RZF A;  3QAQ A;  5IA7 A;  3VXW A;  1SGH A;  4JGH B;  4HCP B;  5G55 A;  4FLH A;  1WYW B;  2MRP A;  4ANU A;  4GDL B;  4EEW A;  1Z2M A;  1E8Y A;  2C7H A;  4TQ0 A;  4KV2 A;  3ZKJ C;  5CHV C;  2XEW A;  1KOT A;  3KYC D;  3LDZ E;  3V62 A;  5JHA A;  2WX0 A;  2JF5 A;  2C9W B;  2HE7 A;  1UBI A;  2M1M A;  4MDK E;  2KWV B;  3H6N A;  4IWO A;  4ZYN A;  3ZNI D;  1WXS A;  3ZNZ B;  4HDQ A;  4I6P A;  3RD2 A;  1IPG A;  2L7R A; 
#chains in the Genus database with same CATH topology
 2KLC A;  4ANW A;  2L1A A;  1Q1O A;  1EU3 A;  2AQ2 B;  2FCQ A;  3N30 A;  3NS1 A;  2KAJ A;  2JUO A;  2NS5 A;  2ZNV C;  1J7B A;  2JXX A;  3TEZ A;  3RNB C;  1Y8R C;  4YTN B;  5FK9 C;  3VR8 B;  3H8H A;  4GB9 A;  4PYU A;  1TY0 A;  2ZZP B;  2AQ3 B;  2BWF A;  3EHV A;  2K6Q A;  3TIX A;  2D10 A;  3B08 A;  4GGQ A;  3RNE C;  1E5W A;  1ET6 A;  5IO9 A;  1D5Z C;  2X8X X;  3R8B A;  3DQV A;  3AI5 A;  4ZRQ A;  3TEY A;  2DYM A;  4AJY B;  1WMH B;  4M0W A;  1YOV B;  3GE8 C;  1DOY A;  2OJW A;  4ZRP A;  2ZW1 A;  4EOY A;  3MC8 A;  3OJ3 A;  2ZJD A;  2JU6 X;  3V60 A;  1ZGU B;  3MJ5 A;  4HJK A;  4ANX A;  3PVL A;  1VR9 A;  2MEK A;  4DXG A;  4TSS A;  1QZE A;  3UQA A;  4W9F A;  1L0V B;  1XO3 A;  3AUL A;  1DYQ A;  2W55 A;  1FNW A;  4C7Y A;  3DHI C;  2WXL A;  2LHE A;  2Z0D B;  5T8I A;  4P1B C;  1WX7 A;  1PQS A;  3VAW A;  3C19 A;  4HPP A;  4AWJ A;  4YWG G;  1Q10 A;  1J19 A;  5CHF A;  2PTL A;  3L0W B;  2DZK A;  4N6E B;  2YLM A;  1H8C A;  2V3P A;  4JWS C;  2NCN A;  2CHX A;  2RR9 A;  4DBG A;  3VFK A;  3GB1 A;  1FNV A;  1WZ0 A;  1MG8 A;  2MLB A;  2FCS A;  1SJE D;  4N9F 4;  2DZI A;  5JHB A;  1XQQ A;  2RSU A;  3H7S A;  5H8Y E;  4NAM A;  3RFZ B;  1C4A A;  2RMM A;  3EFC A;  3PGE A;  3A4S C;  3PZD A;  3BK2 A;  2N1V A;  2QSD A;  2REX A;  4WJP A;  3V6C B;  2ZW0 A;  1A5R A;  3Q8A A;  2WXG A;  3LYY A;  2MCN B;  1T0Y A;  1WGY A;  1TZ1 A;  2L0T A;  1HZ6 A;  1EWY C;  3ECI A;  3ZRC A;  2WXJ A;  3FC4 A;  1QIL A;  1ZXI A;  5EE1 A;  1T0R C;  4G11 A;  1VJK A;  2CJN A;  3A4R A;  4C4V A;  2BS4 B;  3BVM A;  2BW2 A;  3BVG A;  4F7Z A;  4WWO A;  5J2R A;  3AM9 A;  1OTR B;  3H7P A;  1A70 A;  2LGD A;  2NTT A;  2HJ8 A;  2KT7 A;  2JVC A;  1I7H A;  1YX5 B;  1EM7 A;  1P1A A;  4P16 A;  3JSV B;  2KK8 A;  2YEP F;  4BFR A;  1XLQ A;  2JZZ A;  3S2A A;  3AEE B;  5LNK 1;  2K25 A;  1BML C;  2JWZ A;  2ZPY A;  3SFD B;  4DHZ B;  2CR5 A;  3GP7 A;  4MEM A;  1FFV A;  2MBE A;  2KX3 A;  1XLO A;  3A9J B;  3VUY A;  1XLP A;  2LJ5 A;  3AE1 B;  2LI5 A;  1WRD B;  1UH6 A;  1V6E A;  2WP9 B;  5D3I B;  3VR9 B;  1QT9 A;  3T3N A;  1GPX A;  2EKI A;  4A8X C;  2MP2 A;  5D3D A;  2NPT A;  2BBC A;  2M17 A;  4PS3 A;  4ICV A;  4FJZ A;  4YL8 A;  1UWX A;  3RCZ A;  1HXY D;  4HLE A;  2D11 A;  2RPV A;  1VDV A;  3HRD D;  3Q8F A;  5C2T B;  2QMT A;  2H88 B;  3HVZ A;  3N1Y C;  4YTP B;  1UEL A;  1ISN A;  1CJE A;  2MQJ A;  3W5V B;  3BYT B;  1NI3 A;  2G45 B;  4M01 A;  3P63 A;  4HEA 1;  1TIF A;  4B95 A;  3R7R A;  1JWA D;  3U8Z A;  4HDO A;  3V61 A;  1F52 A;  3ZNG C;  3DHG C;  4RF0 A;  3WAP A;  1WI0 A;  4LK0 M;  4HVB A;  5AZF A;  2LRW A;  1FIQ A;  4WJO A;  4BKG A;  3ZTD A;  1H4R A;  2PE6 B;  3Q69 A;  5D7G A;  1R4M I;  4BZA A;  2IZV B;  2KDB A;  5J17 A;  2KJH B;  4W9H A;  4M00 A;  1QF6 A;  1WXV A;  3AEC B;  2WWZ A;  1OFF A;  1VLB A;  1JWS D;  2BKF A;  5BMI A;  2BT6 A;  1E8X A;  3PLV A;  1BUI C;  3NVZ A;  1PYW D;  4CO7 A;  2FCM A;  3UGB B;  2IND C;  4LDT B;  2V4I B;  2QJL A;  1V8C A;  1YN4 A;  1WXM A;  3NS8 A;  4W9D A;  4ZRI A;  3RMK C;  4G50 A;  3W1S C;  2VH1 A;  5GMV A;  2N4F A;  2DX5 B;  1VRA B;  4LCD E;  1C76 A;  2KTF A;  3IXS A;  3O65 B;  3MHS D;  2BWE S;  2VRR B;  3U52 E;  1P3Q U;  2BYT A;  2QC8 A;  2KC1 A;  1I4H A;  1U4A A;  4B9K A;  2KDE B;  1FD6 A;  3ZIM A;  2I1K A;  4IW0 A;  4II3 B;  5MPO A;  4ICU A;  2BB5 A;  3I57 A;  2IGG A;  2PE9 A;  1BT0 A;  4XDD A;  4PT5 A;  4HRS A;  5G5G A;  3GS2 A;  3AE7 B;  1V49 A;  3VTU A;  1GUA B;  5DPR A;  1WY8 A;  2NBW B;  3HIZ A;  1RWS A;  4RFB A;  4B0E A;  4LJP B;  2JT4 B;  2NBV B;  4N58 A;  4GMV A;  4BBN F;  4OW0 A;  2C7M B;  3P4P B;  3FIL B;  4RGT A;  1UF0 A;  1N5X A;  2D07 B;  2KJ6 A;  1V80 A;  1X1M A;  1TZO A;  4AP4 C;  2NTS A;  1N61 A;  4USA A;  4KDL B;  1ZKH A;  1NVI D;  2JZ3 B;  4D2K A;  1IGD A;  1P98 A;  3DVG Y;  3RI7 C;  2K3U A;  3ZJV A;  3T3O A;  3DVN U;  1IGC A;  1ACC A;  1L7Y A;  1Y56 A;  2B76 B;  2KDM A;  2Y3A A;  3WA0 A;  2A4Z A;  1RAX A;  4B0M A;  3ML9 A;  4GDL A;  2M8S A;  5IAA C;  4LLG M;  4LNK A;  4Q2J A;  4P1C C;  1KLU D;  5KHO A;  4IM3 A;  4NJ6 A;  3PHW B;  2Z59 B;  3H1U A;  5HFY A;  3OLM D;  4DDI D;  3N9Y C;  3U2S C;  4ZRK A;  4DHZ E;  4IM2 A;  2I1J A;  4XZ4 A;  1DGJ A;  4GDK B;  5HG2 A;  3Q3O C;  1E10 A;  3PRP B;  2PEA A;  3AU5 A;  2E3T A;  2K39 A;  2JYE A;  4FAD A;  4WWN A;  1MPE A;  4NZL B;  3QAQ A;  2ICI A;  1WYW B;  1Z2M A;  4KV2 A;  3KYC D;  2BS3 B;  2HE7 A;  4HDQ A;  2L7R A;  2G1E A;  4GSW A;  2QIE B;  3EUB 2;  4IC7 B;  3TEX A;  4C7Z A;  2BB6 A;  2L00 B;  1FO4 A;  2KTR B;  4OVV A;  4DHJ B;  2KVR A;  2QHO A;  1QQR A;  2JYT A;  1I4G A;  3ZQ4 A;  1K50 A;  1JAL A;  3KUZ A;  2CKH B;  2AEH A;  3DHH C;  1WM2 A;  4ZDV A;  4A20 A;  4XWT A;  1TS3 A;  1GC6 A;  1TS2 A;  1JRU A;  3GZN B;  2ASQ A;  1AN8 A;  1ESF A;  3KQ4 A;  1NEK B;  3MC9 A;  3VRA B;  2EKE C;  1I4P A;  2WXM A;  4HRO A;  2NR2 A;  4RMA A;  4BBN C;  3Q2A C;  3RN9 C;  2HJ1 A;  3ABV B;  2IO0 B;  2OJR A;  3HM3 A;  1R4N I;  2Y5C A;  3ZDT A;  1WE7 A;  4XYC A;  3J9C A;  2N7J A;  2KAN A;  1GAQ B;  2FAZ A;  2GBJ A;  1VZ6 A;  2L3Z A;  4NQL B;  3NVW A;  3QC8 B;  4GOC A;  1RFA A;  3A9K B;  2LUM A;  4US8 A;  1LFD A;  2JY6 A;  3DBH I;  2MBH A;  3HHM A;  4ARC A;  4CQN A;  2AL3 A;  2D2Q A;  1WF9 A;  2MX2 A;  4US9 A;  4BKS A;  3AE5 B;  3Q3F A;  4DXF A;  3QWZ B;  1XF5 L;  4L23 A;  4AS1 A;  1ZUD 2;  3CIR B;  2WXI A;  2IGD A;  1EU4 A;  1JWM D;  3BZD B;  2O6V D;  1D4B A;  3L17 A;  1T0S C;  2FUG 1;  3AEA B;  1CK1 A;  4A3O A;  3KWL A;  1V5O A;  3ZYY X;  1TY2 A;  1RRB A;  4ITK A;  1SJH D;  1F0Z A;  2IGH A;  2KFJ A;  2KFK A;  2LVP A;  4DQO C;  3IT6 B;  4KGS A;  3ZVV A;  5C23 A;  1V9J A;  3TUO A;  2V1Y A;  1B1Z A;  3TBL D;  2YEP B;  4NY0 A;  2Z8L A;  4HWI B;  1AAR A;  1UUP A;  1RYJ A;  4YXD B;  1F77 A;  3BVZ A;  4NAW A;  1FCL A;  4FHK A;  1J8C A;  3ZXV A;  3L08 A;  3Q8C A;  2GRI A;  2N9L A;  5DCN A;  2J0K A;  2WDT B;  2KWD A;  1D6E C;  2XK5 A;  4WH4 A;  4RCO A;  1VZ7 A;  2KWU B;  2EEL A;  2D3A A;  4PYZ A;  2WU2 B;  3DBS A;  3QQ8 B;  4BOS C;  4TV3 A;  4MJS B;  4XGA B;  1E8W A;  1Q0W B;  3NG0 A;  5L83 A;  2KMA A;  2WQY B;  3VVW B;  1UGM A;  4XC2 A;  2M4N A;  2PPH A;  1FEH A;  1Q5W B;  1OQQ A;  2LGX A;  1RM6 C;  3ZNH B;  4BVU C;  3N32 A;  3PRZ A;  1T3Q A;  3E56 A;  2AWT A;  3WAL A;  3KVF B;  1TKG A;  2C60 A;  3JYU A;  4BKS D;  1WWT A;  3CSF A;  1VCB A;  1QLB B;  4EZJ A;  1E0Z A;  3L54 A;  3QCA A;  4YSZ B;  1GG3 A;  1SE9 A;  1GC7 A;  2MJE A;  1TGZ B;  3SFE B;  4AUQ C;  5I4D A;  2KOX A;  2WS3 B;  4IWQ A;  3AMZ A;  3TJP A;  3AU4 A;  1D3Z A;  1PGX A;  3L16 A;  3ZTC A;  4GN1 A;  3CWI A;  4WJN A;  4BKT A;  1P0R A;  4A6Q A;  1FRD A;  1WXA A;  3AEB B;  4ZYS A;  2RGF A;  2PVO D;  2K5P A;  5D94 A;  2KO3 A;  1XLN A;  4KDI C;  4EZL A;  2I38 A;  2L0F A;  2BGF A;  3PRE A;  1C3T A;  2DYB A;  2ZPN A;  1AWD A;  2L76 A;  2JRH A;  1JW9 D;  4MM3 B;  1YIW A;  1NEN B;  3ENE A;  4GIV A;  3QIJ A;  1J7C A;  2MSE D;  2SAK A;  4DK5 A;  4J6I A;  4IM0 A;  1E7U A;  4IOI E;  4K81 A;  1QOA A;  3AN1 A;  3R2I A;  3GE3 C;  4KZ0 A;  3MTN B;  2J52 A;  3ZJU A;  2MJ3 A;  2N9P C;  1WMH A;  4LNF A;  3B2F A;  1HTO A;  3IBE A;  2IY0 B;  3UF8 A;  2W82 A;  1IBX B;  4JQW C;  1C4P A;  3SDL C;  3A1Q B;  4JLC A;  3SEB A;  3U7Z A;  5G5H A;  2KDF B;  3AE2 B;  2KDI A;  1LQB A;  3DVN V;  4JL9 A;  2FE8 A;  4W9J A;  1LO5 D;  4OZA A;  4AQ7 A;  1V97 A;  4MT5 A;  2MBB B;  2FIF A;  3N3K B;  2SEB D;  4E71 A;  4DWF A;  1KH0 A;  3RZW C;  3FKY A;  1MVK A;  1ZDX A;  3U30 A;  4CHK A;  2K22 A;  2UWQ A;  3K9P B;  3PV1 A;  4IG7 B;  2G4D B;  5D2M B;  4MSM B;  5E6O A;  3Q8E A;  2LVQ A;  4DXA B;  2BYF A;  2W3R A;  1XCT L;  2D5G A;  4GXB A;  1SF0 A;  4P6V F;  2LVO A;  1V1O A;  2L8J A;  3TCA A;  2KJR A;  1FCC C;  3I63 C;  3B9J A;  3Q6B A;  4KSK C;  2BYV E;  4FHJ A;  1GJZ A;  4KIK B;  3MHZ A;  2G3Q B;  1V86 A;  3ZKJ C;  4MH8 A;  3AV8 A;  4ARI A;  4NJC A;  4OZB A;  3UI3 A;  4R3D A;  3VH4 B;  2IO2 B;  4JWU C;  1YQB A;  1E6E B;  1WGG A;  2N1W A;  5EDS A;  2M0A A;  4W9L A;  1N6Z A;  1ZOY B;  1B9R A;  3LJ3 A;  2NMQ A;  4FUL A;  2IYD B;  2CS4 A;  2ZNV B;  2CHW A;  1TKE A;  4HKQ A;  3RZF A;  5IA7 A;  4JGH B;  1C78 A;  4HCP B;  3SR6 A;  1XCQ L;  2MRP A;  4ANU A;  4GDL B;  1OQR A;  2WXN A;  3LDZ E;  3V62 A;  4RF1 A;  1JWU D;  1N60 A;  1D5M C;  1V1P B;  3H6N A;  2INN E;  4ZYN A;  1WXS A;  5IOI A;  1ROE A;  2DNF A;  3RD2 A;  1QOB A;  4H2A A;  1IUE A;  3JSV A;  3KWV A;  4W9E A;  1TKY A;  4I6N B;  3WAN A;  3DCG A;  3NZS A;  1MG4 A;  1NYQ A;  1C4C A;  2ON8 A;  4TKN A;  4WQO B;  4WWM A;  3VH3 B;  1M94 A;  4DDG D;  4RM9 A;  3EEC A;  1WXQ A;  1YN5 A;  3DWM A;  5TSS A;  4ZRJ A;  2LFI A;  1KJT A;  4JPS A;  3NOB A;  3ZRF A;  1SE2 A;  3A9J A;  3P1M A;  5C3J B;  3ETR A;  3M3J A;  2JQR B;  5HHD G;  4NNJ B;  2DEN B;  1TYG B;  3SU8 X;  3MFG A;  2PIA A;  3TSS A;  1ZDV A;  2V3N A;  1MHX A;  4C00 A;  2LGY A;  1R4M B;  1HTQ A;  2WLB A;  2VZK B;  3WAO A;  1F2R C;  3BYY B;  4AJW A;  1LXD A;  1WR6 E;  5BMH A;  3AB5 A;  4TQ1 A;  3HVD A;  2AQ1 B;  2KMM A;  3KW5 B;  3MP9 A;  3PPA A;  1E7V A;  2JX5 A;  3R2T A;  1F9J A;  3HUI A;  5L95 C;  2I2Y A;  4HJG E;  2IJ0 A;  4K3B A;  2KX0 A;  2WXO A;  4KGT A;  3M63 B;  4WWP A;  1ZPS A;  4YSX B;  3RNC C;  3TMP B;  1I42 A;  4PK1 A;  1G6J A;  5DPS A;  1TT5 B;  4MH0 E;  4WAA A;  3JW0 X;  3RYT A;  1NDD A;  3VDZ A;  1FRR A;  1HEZ E;  2CU3 A;  1XXG A;  3DVG X;  1ZE3 D;  2PLP A;  4MGY E;  3IVF A;  3ZW3 A;  2LGS A;  2KXJ A;  3C0R B;  3KYD D;  2WXR A;  4E3C A;  4A3P A;  3E9S A;  2L52 A;  1L4D B;  1YJ1 A;  1F1H A;  1YMH E;  3W9C B;  1QOG A;  2Y5B B;  1SIJ A;  1UBQ A;  3AE8 B;  1AW7 A;  2KAC A;  1KLV A;  3DBL I;  4XWW A;  2QIL A;  2O6V A;  1WSP A;  3PHX B;  1FXI A;  3IAM 1;  1K52 A;  1WGD A;  3ZJT A;  5DPW A;  2HDE A;  1E9M A;  2Q5W D;  3Q14 C;  2MA9 B;  3KH0 A;  1WJ4 A;  1GB4 A;  1I4X A;  5CTR C;  2EMT A;  4MGZ E;  1WX9 A;  4RM8 A;  1LGR A;  1WGH A;  3M95 A;  4F1S A;  2QCZ A;  2KVZ A;  1TJE A;  4REZ A;  2DYO A;  2N0S B;  3VUX A;  1IYF A;  2D3C A;  2MJD A;  3U7D A;  3JVZ X;  1ET9 A;  2LGI A;  5EE3 A;  2K1F A;  1CMX B;  1YJJ A;  1WZ3 A;  3R7Q A;  2XBB C;  1FPY A;  2XK5 B;  3VUW A;  3GOE A;  2Y5P A;  1UD7 A;  3FIL A;  1WE6 A;  2AL6 A;  1T5X D;  3NZ3 A;  1XT9 B;  3NJT A;  3CST A;  5LXI B;  2L83 A;  3NY5 A;  3C8Y A;  4F8C B;  2GMI C;  3MJW A;  5LLI A;  3W5U B;  2O2V A;  3QJZ A;  5BO4 B;  4BOZ B;  3DBR I;  1WJN A;  2J0J A;  2BF8 B;  3P4S B;  4M0W B;  1JCK B;  2IY1 B;  2LEK A;  1JML A;  3DDC B;  4XE0 A;  4ZHP A;  3B2G A;  1WFY A;  1WRI A;  3NVY A;  3RT3 B;  1SBB B;  2K9X A;  3B0A A;  3QHT A;  1OQY A;  3APF A;  2K0P A;  2KD0 A;  4URK A;  4GDK A;  2IBI B;  3KUD B;  1RFK A;  1EF1 A;  4M8N A;  4TUU A;  4IUM B;  2WXF A;  1EUV B;  2KHW B;  1N5W A;  1F2R I;  3AE9 B;  3RUL A;  3BIN A;  3ZDM C;  1IP9 A;  4IDI A;  2W9N A;  3LXF A;  3R3M A;  3V05 A;  4ASW C;  1R4N B;  1L0X B;  2IO3 B;  2LUE A;  1C77 A;  1D5X C;  1Z5S B;  2R2Q A;  4JE3 B;  1YX6 B;  5KHQ A;  2FCN A;  2FBW B;  3P42 A;  3OAW A;  3ML8 A;  1E8Z A;  4YTM B;  3ZGZ A;  3AE4 B;  1K51 A;  2KTR A;  2JZP A;  3DBH B;  2L05 A;  4ACF A;  2C7N B;  4EUT A;  3BWU D;  1I4Q A;  3VRB B;  2C5L C;  1T0Q C;  4EZK A;  1M4V A;  2K8B A;  5G2N A;  3OJ4 B;  4W9K A;  5JZE B;  4FJY A;  3PT2 B;  2JXT A;  2HD5 B;  5BYS A;  3I9V 1;  2RDG A;  1XEE A;  4ZHO A;  1HZ5 A;  1T6B X;  2JRI B;  3EFU A;  3UIO B;  3MC0 B;  5E6N A;  2A5U A;  4IWP A;  4N59 A;  2AYO B;  2G9H D;  4W9G A;  3PO0 A;  2K8H A;  1L2N A;  2CJO A;  1I35 A;  1R7S A;  3R66 C;  3T9L A;  4C4V B;  4HPL B;  1FNU A;  2RDB C;  3DWG C;  1S1Q B;  3H7P B;  4MGK E;  1P7E A;  3Q3J A;  5J18 A;  1DOX A;  4W9C A;  3L4P A;  3A9K A;  4KSL C;  4LNN A;  4K7U A;  3RUI B;  3AH7 A;  1TS5 A;  3EC8 A;  1CZP A;  2WDV B;  4E74 A;  1JQ4 A;  1ZXH A;  2CHZ A;  1N62 A;  4KX6 B;  1JRP A;  3PRM B;  1ZW7 A;  4HPM B;  2H89 B;  3UIN B;  3WAM A;  2ZVN A;  5AUI A;  3RNF C;  1WGR A;  1ZP0 B;  4UDU C;  3BY4 B;  2KWC A;  1XD3 B;  1HE8 A;  2LD9 A;  4J3O D;  1SSN A;  2PVG C;  4B6W A;  2GBR A;  1K8R B;  4KVG B;  1PFD A;  2WYQ A;  3AED B;  4FA6 A;  3DOW A;  1C79 A;  1UZX B;  2RPQ A;  3QAR A;  4QAY A;  4LNI A;  1PUT A;  2MP2 B;  2BQQ A;  2ZCC A;  5TR5 A;  3K9O B;  1YNT E;  2NPT B;  3VTV A;  1SE4 A;  2ZCB A;  2R2O A;  3U4E G;  2NVU I;  3URY A;  2GI9 A;  4WQM A;  2KC2 A;  2N7D A;  5AZH A;  4YSY B;  4DHJ D;  2IO1 B;  3FAH A;  2KYW A;  4FJV B;  2FNJ B;  1YJI A;  3QA8 A;  5E6P A;  1WYG A;  2DHZ A;  2V9H A;  2WU5 B;  3W1S A;  2W3S A;  5BMG A;  4M02 A;  4L1B A;  3VXW A;  1SGH A;  3W2D A;  5G55 A;  4EEW A;  4TQ0 A;  1AYF A;  5CHV C;  3P4R B;  2WX0 A;  2C9W B;  2M1M A;  2VH2 A;  1E7P B;  2J53 A;  2BTE A;  3ZNZ B;  1EWC A;  4WAF A;  1C9F A;  1IPG A;  2ZEQ A;  4MJS A;  2JWU A;  3KUC B;  3PS6 A;  5CHW A;  1VD2 A;  3UIP B;  4MEL A;  4WIP A;  2N9E B;  1J7A A;  2LHD A;  2OED A;  3W1Y A;  2INC C;  1K53 A;  3PZ7 A;  1QOF A;  4PS8 A;  4FXC A;  4KKJ A;  2DZJ A;  4KKI A;  2DAJ A;  4O1N A;  3HK0 A;  4WJQ A;  4CYE A;  2UU7 A;  4IKG A;  4OHJ A;  1J0G A;  4A90 A;  4X57 B;  2JSV X;  3BK1 A;  2XN9 C;  2KKC A;  3NRZ A;  1FXT B;  4ZOH C;  3B1L X;  1TBE A;  1V2Y A;  5FR3 A;  1OGW A;  4LJO B;  2N9X A;  5D6J B;  4KGR A;  1KTK A;  4EE2 A;  2V0G A;  3AEF B;  4I6L B;  2WGS A;  5IP4 D;  2BVC A;  3ZXR A;  3HM6 X;  4WUR A;  2J7Q B;  2M19 A;  2WXP A;  1KM7 A;  5HKH A;  2BYE A;  4LNO A;  1OEY A;  3I3T B;  1WX8 A;  3SHQ A;  2DBY A;  2LRU A;  2WX1 A;  3TEW A;  1VZ8 A;  2J0M A;  2NBU A;  1DOI A;  2GBM A;  1NYR A;  3IFW B;  3RNG C;  3PSE B;  2PW9 A;  4MM3 A;  3O13 A;  2KQ4 X;  2D3B A;  2N9K A;  3ALB A;  4YT0 B;  3PZ8 A;  2KMC A;  2LWP A;  1SXT A;  1P9D U;  1PDX A;  1WGK A;  1LM8 B;  1YD8 U;  1WIA A;  4EFO A;  5AEK B;  2E6X A;  1PGA A;  5H92 C;  1FFU A;  1GOZ A;  2KNB A;  4AOF A;  4K1R B;  5EE0 A;  1UGJ A;  4C80 A;  1L6V A;  1YQ3 B;  4II2 B;  5AUK A;  3X0W A;  2KN4 A;  1WR1 A;  5BYQ A;  5E6J A;  1IBX A;  3A1Q A;  2LJI A;  2OHF A;  5HI1 A;  4LTU A;  3VHT C;  2FUH B;  3KLS X;  3RPF C;  5AZG A;  1BXT A;  1GB1 A;  2MWS B;  2G4S A;  3I5J C;  3V6E B;  2WDR B;  1S3S G;  2O6V B;  3T8M A;  2OOB B;  3UQB A;  3VTW A;  3P4Q B;  3AEG B;  2WXK A;  4P7I A;  2RDH A;  1MFW A;  4MSQ B;  4C56 C;  4HK2 A;  2W54 A;  4PS7 A;  3IG3 A;  2IPK D;  2TSS A;  2KLG A;  4GLS C;  1P7F A;  1KRH A;  3IAS 1;  2EMS A;  3EA6 A;  1EO6 A;  5BYR A;  2K8C A;  3N1Z C;  1E90 A;  3EGR A;  1WJU A;  2MBQ A;  2HTH A;  2WDQ B;  1RLF A;  1C1Y B;  3Q8B A;  1I4R A;  1WH3 A;  4KIK A;  4OVU A;  1FMA D;  2Z0E B;  2GBK A;  2GOW A;  3AE3 B;  4S0R A;  1UWM A;  3NHE B;  2BKR B;  3QK0 A;  4XX5 A;  4RGM A;  1KF6 B;  1JRO A;  2LZ6 A;  3L10 B;  2M56 B;  3H9D A;  2MBO A;  3ONS A;  4A9A A;  4G3X B;  4ANV A;  2RD0 A;  1WM3 A;  1N63 A;  2INP E;  4JX1 C;  3CMM B;  4JIO U;  1QKZ A;  4G0N B;  2O2V B;  3IHP C;  1GNU A;  1ENF A;  4MAC A;  4GU2 A;  1JWB D;  2YVC A;  1V1P A;  2MW5 A;  2LXC A;  2QEJ C;  1NBF C;  1FM0 D;  3NZU A;  1MHH E;  1SE3 A;  2WXQ A;  1WJ6 A;  3PLU A;  2CU1 A;  2N7E A;  3P2B A;  2ACZ B;  2DAF A;  5EE9 A;  1OEY J;  3GZN I;  3WCQ A;  5DPT A;  4K7S A;  3M62 B;  2BPS A;  1L5P A;  2DWQ A;  5JH5 C;  3TL5 A;  4L2Y A;  3SD5 A;  1FXA A;  3APD A;  3ZLZ A;  2MHJ A;  1YQ4 B;  1SIF A;  4BAX A;  2KFK B;  1L4Z B;  4W9I A;  2X38 A;  2AX5 A;  3X23 A;  3RNA C;  4RGO S;  3AXC A;  2J4X A;  4KZC A;  4M8M A;  3ZUN A;  2ZVO A;  3Q3N C;  5LXH A;  2KQS A;  2UYZ B;  2DLB A;  1V81 A;  1EF5 A;  4NAW B;  2LMC A;  2PKO A;  2MH7 A;  2R61 A;  4EKU A;  1STE A;  2HTM E;  3CF6 E;  4FN2 A;  3DBL B;  5GXG B;  2LXA A;  4NPN A;  1SB3 C;  2LAS A;  3QX1 A;  2V3S A;  1L6U A;  4MGI E;  1KLG D;  4OZC A;  2IDY A;  2GBN A;  2DZM A;  3N1X C;  1UNS A;  3AE6 B;  3OWE B;  2WNM A;  5C1Z A;  1MI0 A;  1NI2 A;  2PMV A;  3OG5 A;  3DPD A;  2GB1 A;  2KZR A;  3BII D;  3Q3M C;  4HCN B;  2XNA C;  1HA5 A;  4RGN A;  3NVV A;  3PTF C;  2WHI A;  3N20 C;  3D32 A;  5IKC M;  5IN7 A;  2FID A;  2L32 A;  5JXV A;  3APC A;  5CX3 A;  4NJ7 A;  4HKZ E;  5FR6 A;  4S17 A;  3VQI A;  4OVZ A;  2PJH A;  3NUH B;  2KQ7 A;  4LDT D;  4RNA A;  2WXH A;  3ZO5 B;  1CQV A;  1MJD A;  3L13 A;  2KN5 A;  2D3G A;  2K6D B;  2JPH A;  2M0X A;  3A33 B;  1TTN A;  1V5T A;  5FKA C;  1L0Y B;  3LB8 C;  2QDF A;  4NQK E;  4HXD A;  3V3X A;  4FBJ B;  4K7W A;  2V4L A;  4TMA B;  1PGB A;  3DBR B;  2B3A A;  3WIM A;  4RH6 A;  1YN3 A;  1TS4 A;  2BS2 B;  4XDC A;  4FLH A;  3IT4 B;  1E8Y A;  2C7H A;  1KOT A;  4A55 A;  2XEW A;  1HQR D;  2VZK D;  5JHA A;  2JF5 A;  1UBI A;  4MDK E;  2ONQ A;  2KWV B;  2GLS A;  4IWO A;  3ZNI D;  4K3C A;  2J42 A;  1KFY B;  4I6P A;  1SEB D; 
#chains in the Genus database with same CATH homology
 3JSV A;  2ZEQ A;  2KLC A;  4GSW A;  4MJS A;  4ANW A;  4W9E A;  3KUC B;  1Q1O A;  2FCQ A;  3N30 A;  3PS6 A;  4I6N B;  4IC7 B;  5CHW A;  2JUO A;  2NS5 A;  2ZNV C;  3WAN A;  1VD2 A;  2JXX A;  4MEL A;  3UIP B;  2N9E B;  3DCG A;  3NZS A;  1Y8R C;  2L00 B;  3VH3 B;  4TKN A;  4WQO B;  2KTR B;  4DDG D;  4OVV A;  1M94 A;  4DHJ B;  2KVR A;  2QHO A;  3W1Y A;  4RM9 A;  3EEC A;  4GB9 A;  4PYU A;  2ZZP B;  4PS8 A;  4ZRJ A;  1KJT A;  2BWF A;  3NOB A;  3ZRF A;  3A9J A;  3KUZ A;  2CKH B;  3EHV A;  2AEH A;  3M3J A;  2DZJ A;  2K6Q A;  3TIX A;  2D10 A;  2DAJ A;  3B08 A;  4NNJ B;  2DEN B;  1WM2 A;  4GGQ A;  3SU8 X;  1E5W A;  3HK0 A;  4WJQ A;  4ZDV A;  4A20 A;  4CYE A;  2LGY A;  1GC6 A;  1JRU A;  2ASQ A;  1J0G A;  3WAO A;  3DQV A;  4AJW A;  3AI5 A;  1LXD A;  4X57 B;  2DYM A;  2EKE C;  2KKC A;  4AJY B;  1FXT B;  1WMH B;  1WR6 E;  3B1L X;  1TBE A;  1V2Y A;  2NR2 A;  4TQ1 A;  4RMA A;  1OGW A;  4BBN C;  4LJO B;  4EOY A;  2N9X A;  5D6J B;  3KW5 B;  3OJ3 A;  2ZJD A;  3PPA A;  1E7V A;  3V60 A;  1F9J A;  1ZGU B;  2IO0 B;  5L95 C;  2OJR A;  4I6L B;  3HM3 A;  1R4N I;  3ZDT A;  1WE7 A;  4HJK A;  4ANX A;  3PVL A;  3HM6 X;  2KX0 A;  2KAN A;  2J7Q B;  1QZE A;  3UQA A;  2FAZ A;  2GBJ A;  4W9F A;  3M63 B;  3AUL A;  2L3Z A;  4NQL B;  4WWP A;  3QC8 B;  4GOC A;  1RFA A;  1KM7 A;  3A9K B;  3TMP B;  5HKH A;  2BYE A;  1LFD A;  2JY6 A;  3DBH I;  1I42 A;  2Z0D B;  2MBH A;  3HHM A;  1OEY A;  1G6J A;  3I3T B;  1WX7 A;  1PQS A;  3VAW A;  1WX8 A;  2AL3 A;  2D2Q A;  5DPS A;  3SHQ A;  2LRU A;  4AWJ A;  4MH0 E;  1J19 A;  4WAA A;  1WF9 A;  2MX2 A;  3JW0 X;  5CHF A;  4BKS A;  2WX1 A;  3L0W B;  3RYT A;  1NDD A;  2DZK A;  3Q3F A;  3VDZ A;  2YLM A;  2J0M A;  3QWZ B;  2NBU A;  3DVG X;  1H8C A;  4MGY E;  3IVF A;  3ZW3 A;  2NCN A;  2GBM A;  2CHX A;  2RR9 A;  2KXJ A;  3IFW B;  4DBG A;  3PSE B;  3VFK A;  3C0R B;  3KYD D;  4MM3 A;  4E3C A;  1WZ0 A;  1MG8 A;  2MLB A;  4A3P A;  2FCS A;  4N9F 4;  3ALB A;  2DZI A;  5JHB A;  2O6V D;  2KMC A;  3L17 A;  1XQQ A;  1YJ1 A;  2LWP A;  2RSU A;  3H7S A;  4A3O A;  1P9D U;  1V5O A;  1RRB A;  2Y5B B;  3PGE A;  1UBQ A;  3A4S C;  1LM8 B;  1YD8 U;  1WIA A;  3PZD A;  4EFO A;  2N1V A;  2KFJ A;  2KFK A;  5AEK B;  2LVP A;  2REX A;  4WJP A;  1KLV A;  3DBL I;  3ZVV A;  5C23 A;  3V6C B;  1V9J A;  2O6V A;  2V1Y A;  3PHX B;  1A5R A;  2KNB A;  3TBL D;  4AOF A;  4K1R B;  1WGD A;  4II2 B;  2MCN B;  1T0Y A;  4NY0 A;  1WGY A;  5DPW A;  3X0W A;  1TZ1 A;  1AAR A;  1WR1 A;  2L0T A;  4HWI B;  3ECI A;  3A1Q A;  3ZRC A;  4NAW A;  4FHK A;  1J8C A;  3VHT C;  2FUH B;  3L08 A;  5AZG A;  2MA9 B;  3KH0 A;  4G11 A;  1WJ4 A;  5DCN A;  2J0K A;  2WDT B;  3A4R A;  2XK5 A;  2MWS B;  2G4S A;  4F7Z A;  4WWO A;  5J2R A;  1OTR B;  3H7P A;  5CTR C;  3V6E B;  2EMT A;  4MGZ E;  1WX9 A;  2KWU B;  2LGD A;  4RM8 A;  2HJ8 A;  1WGH A;  1S3S G;  2O6V B;  3T8M A;  2OOB B;  3UQB A;  3VTW A;  2JVC A;  3M95 A;  4PYZ A;  1YX5 B;  4F1S A;  3DBS A;  1P1A A;  3QQ8 B;  4BOS C;  3JSV B;  4TV3 A;  4MJS B;  2KK8 A;  4BFR A;  2JZZ A;  1E8W A;  1Q0W B;  5L83 A;  2DYO A;  3VUX A;  2KMA A;  4P7I A;  1IYF A;  3S2A A;  4MSQ B;  3U7D A;  3VVW B;  1UGM A;  4HK2 A;  4XC2 A;  4PS7 A;  3JVZ X;  3IG3 A;  2K1F A;  2K25 A;  1CMX B;  2KLG A;  2M4N A;  1WZ3 A;  2JWZ A;  2ZPY A;  2PPH A;  3R7Q A;  4DHZ B;  2CR5 A;  2XBB C;  1Q5W B;  4MEM A;  2EMS A;  2XK5 B;  3VUW A;  1EO6 A;  3GOE A;  2K8C A;  2MBE A;  2LGX A;  2KX3 A;  1UD7 A;  1WE6 A;  2AL6 A;  3A9J B;  3ZNH B;  3VUY A;  4BVU C;  3N32 A;  1XT9 B;  1E90 A;  2LJ5 A;  3PRZ A;  2LI5 A;  2AWT A;  1WJU A;  1WRD B;  2MBQ A;  1UH6 A;  1V6E A;  3WAL A;  2HTH A;  3KVF B;  3CST A;  5LXI B;  1RLF A;  1C1Y B;  2C60 A;  3JYU A;  3NY5 A;  1WH3 A;  4KIK A;  4OVU A;  4BKS D;  2Z0E B;  2MP2 A;  4F8C B;  2GMI C;  2GBK A;  1VCB A;  2NPT A;  2GOW A;  3CSF A;  3MJW A;  5LLI A;  4EZJ A;  2M17 A;  2O2V A;  3QJZ A;  5BO4 B;  4BOZ B;  3DBR I;  1WJN A;  2BKR B;  3NHE B;  3QK0 A;  2J0J A;  3L54 A;  2BF8 B;  4ICV A;  4FJZ A;  4PS3 A;  4XX5 A;  4YL8 A;  3QCA A;  4M0W B;  2IY1 B;  3DDC B;  3RCZ A;  2LZ6 A;  1WFY A;  1GG3 A;  3L10 B;  1SE9 A;  1GC7 A;  3H9D A;  3RT3 B;  4HLE A;  2D11 A;  1TGZ B;  4AUQ C;  2MBO A;  3B0A A;  3ONS A;  3QHT A;  4G3X B;  2KOX A;  4ANV A;  1OQY A;  4IWQ A;  3APF A;  3TJP A;  2RD0 A;  1WM3 A;  3AU4 A;  2KD0 A;  1D3Z A;  3L16 A;  3ZTC A;  4GDK A;  4URK A;  1UEL A;  1ISN A;  2IBI B;  2MQJ A;  4GN1 A;  4WJN A;  4BKT A;  1P0R A;  3KUD B;  1EF1 A;  2G45 B;  3CMM B;  4B95 A;  4M8N A;  4TUU A;  4IUM B;  4JIO U;  3R7R A;  1EUV B;  4G0N B;  2KHW B;  2O2V B;  1WXA A;  3IHP C;  1GNU A;  4HDO A;  3U8Z A;  3V61 A;  2RGF A;  4GU2 A;  5D94 A;  2YVC A;  3RUL A;  2KO3 A;  3BIN A;  3ZNG C;  3ZDM C;  1IP9 A;  2MW5 A;  2W9N A;  2LXC A;  3R3M A;  3WAP A;  1NBF C;  1WI0 A;  4ASW C;  2IO3 B;  2LUE A;  4KDI C;  1Z5S B;  2R2Q A;  4EZL A;  4HVB A;  5AZF A;  3NZU A;  2LRW A;  1YX6 B;  2L0F A;  5KHQ A;  1WJ6 A;  4WJO A;  2BGF A;  4BKG A;  2FCN A;  3PRE A;  3PLU A;  3ZTD A;  1H4R A;  2CU1 A;  2PE6 B;  2N7E A;  1R4M I;  2DYB A;  2ZPN A;  3ML8 A;  1E8Z A;  3OAW A;  3P2B A;  2DAF A;  2IZV B;  2KDB A;  2L76 A;  2KTR A;  1OEY J;  2JRH A;  3GZN I;  5J17 A;  2L05 A;  2KJH B;  4W9H A;  5DPT A;  1YIW A;  3ENE A;  4K7S A;  3M62 B;  4GIV A;  3QIJ A;  2C7N B;  4EUT A;  2MSE D;  2BPS A;  4DK5 A;  1WXV A;  4J6I A;  4IM0 A;  1C3T A;  2C5L C;  1E7U A;  4EZK A;  2WWZ A;  5JH5 C;  2K8B A;  3TL5 A;  5G2N A;  3OJ4 B;  4W9K A;  5JZE B;  4FJY A;  3APD A;  2BKF A;  3PT2 B;  4K81 A;  2HD5 B;  3SD5 A;  3ZLZ A;  1E8X A;  1SIF A;  3PLV A;  2KFK B;  4W9I A;  4CO7 A;  3X23 A;  2FCM A;  3UGB B;  4LDT B;  4KZ0 A;  3MTN B;  2JRI B;  3EFU A;  3AXC A;  3UIO B;  2N9P C;  1WMH A;  1WXM A;  3NS8 A;  5E6N A;  4W9D A;  4KZC A;  3IBE A;  2IY0 B;  4M8M A;  3UF8 A;  2ZVO A;  2A5U A;  4IWP A;  4ZRI A;  3ZUN A;  2KQS A;  2UYZ B;  4JQW C;  5LXH A;  1V81 A;  3A1Q B;  3SDL C;  1EF5 A;  4G50 A;  2AYO B;  4JLC A;  4NAW B;  3W1S C;  4W9G A;  5GMV A;  2K8H A;  1L2N A;  2KDF B;  2N4F A;  4EKU A;  2DX5 B;  3CF6 E;  1I35 A;  2KDI A;  1LQB A;  3DVN V;  4JL9 A;  4FN2 A;  4LCD E;  2KTF A;  3R66 C;  3O65 B;  3MHS D;  3T9L A;  2BWE S;  2LXA A;  4NPN A;  4W9J A;  2LAS A;  2VRR B;  4HPL B;  3QX1 A;  2V3S A;  1P3Q U;  2MBB B;  2FIF A;  2KC1 A;  1U4A A;  1S1Q B;  3H7P B;  4B9K A;  4MGK E;  3N3K B;  4MGI E;  4E71 A;  2KDE B;  4DWF A;  3Q3J A;  3ZIM A;  2I1K A;  3RZW C;  2GBN A;  4W9C A;  5J18 A;  3A9K A;  4KSL C;  4IW0 A;  2DZM A;  4II3 B;  4K7U A;  3RUI B;  4ICU A;  3U30 A;  5C1Z A;  2PE9 A;  4CHK A;  1BT0 A;  1NI2 A;  3EC8 A;  2UWQ A;  1V49 A;  3K9P B;  4E74 A;  3PV1 A;  3DPD A;  4IG7 B;  1GUA B;  2KZR A;  2G4D B;  5D2M B;  5DPR A;  3VTU A;  4MSM B;  1WY8 A;  5E6O A;  2CHZ A;  2NBW B;  3HIZ A;  3PRM B;  1ZW7 A;  2LVQ A;  4HPM B;  4HCN B;  4LJP B;  4DXA B;  2BYF A;  2JT4 B;  2NBV B;  3UIN B;  3WAM A;  2ZVN A;  3PTF C;  4GMV A;  1WGR A;  4BBN F;  4GXB A;  2C7M B;  3D32 A;  2D07 B;  2KWC A;  3BY4 B;  1XD3 B;  1HE8 A;  2LD9 A;  2KJ6 A;  1V80 A;  1X1M A;  4AP4 C;  2FID A;  2LVO A;  3APC A;  2L8J A;  4B6W A;  5CX3 A;  2GBR A;  1K8R B;  2KJR A;  4NJ7 A;  1ZKH A;  4KDL B;  2JZ3 B;  4KVG B;  3TCA A;  1P98 A;  3DVG Y;  4KSK C;  5FR6 A;  3VQI A;  2BYV E;  3DVN U;  2WYQ A;  4FHJ A;  1GJZ A;  4FA6 A;  1L7Y A;  3DOW A;  1UZX B;  2RPQ A;  3QAR A;  3WA0 A;  4KIK B;  5D7G A;  2A4Z A;  2G3Q B;  1RAX A;  1V86 A;  2PJH A;  2MP2 B;  2KQ7 A;  2ZCC A;  3ML9 A;  3K9O B;  2NPT B;  2M8S A;  4GDL A;  4LDT D;  5TR5 A;  2ZCB A;  3VTV A;  2R2O A;  5IAA C;  2NVU I;  3ZO5 B;  3L13 A;  2KN5 A;  3VH4 B;  2IO2 B;  2KC2 A;  5KHO A;  2D3G A;  2N7D A;  4IM3 A;  4NJ6 A;  5AZH A;  1YQB A;  3PHW B;  2K6D B;  1WGG A;  2Z59 B;  4DHJ D;  2IO1 B;  2JPH A;  2N1W A;  3H1U A;  2M0X A;  3OLM D;  5EDS A;  3A33 B;  1TTN A;  4DDI D;  4W9L A;  1V5T A;  4ZRK A;  3LJ3 A;  4DHZ E;  4FJV B;  4NQK E;  2FNJ B;  4IM2 A;  3QA8 A;  2I1J A;  4XZ4 A;  4HXD A;  4FUL A;  5E6P A;  4GDK B;  2DHZ A;  2IYD B;  4FBJ B;  3PRP B;  2V4L A;  2CS4 A;  4K7W A;  2PEA A;  3AU5 A;  3W1S A;  2K39 A;  2ZNV B;  2CHW A;  4FAD A;  4WWN A;  2B3A A;  3WIM A;  3RZF A;  3QAQ A;  5IA7 A;  3VXW A;  1SGH A;  4JGH B;  4HCP B;  5G55 A;  4FLH A;  1WYW B;  2MRP A;  4ANU A;  4GDL B;  4EEW A;  1Z2M A;  1E8Y A;  2C7H A;  4TQ0 A;  4KV2 A;  3ZKJ C;  5CHV C;  2XEW A;  1KOT A;  3KYC D;  3LDZ E;  3V62 A;  5JHA A;  2WX0 A;  2JF5 A;  2C9W B;  2HE7 A;  1UBI A;  2M1M A;  4MDK E;  2KWV B;  3H6N A;  4IWO A;  4ZYN A;  3ZNI D;  1WXS A;  3ZNZ B;  4HDQ A;  4I6P A;  3RD2 A;  1IPG A;  2L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...