5HG2A

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-2-asn35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hg2A00
2PW9A 5HFYA 1IGCA 1GB4A 2JZPA 2PLPA 1C9FA 2ZW1A 5HHDG 1XCTL 1D4BA 2LHDA 1ZXHA 1XF5L 2OEDA 2GI9A 2I38A 4OZCA 4GLSC 3V3XA 2QSDA 2ZW0A 5JXVA 1K52A 1MI0A 2K0PA 1GB1A 2IGGA 1EM7A 1K51A 1FD6A 2QMTA 3FILB 2JSVX 1IBXA 2JWUA 1KH0A 2RMMA 2N7JA 2JU6X 1F2RI 2RPVA 3MP9A 5BMIA 4KGRA 1Q10A 1MVKA 2KWDA 3UI3A 2IGDA 2PTLA 4IKGA 2JXTA 2KDMA 1P7EA 1HZ5A 1HZ6A 1P7FA 2KACA 2EELA 5HG2A 1F2RC 2J53A 2I2YA 2NMQA 1XCQL 1MHHE 1FCCC 2J52A 5BMHA 4IOIE 4MACA 2ONQA 1PGXA 1QKZA 1YMHE 2N9KA 4OZAA 2KQ4X 4HJGE 1MHXA 1PGAA 2LHEA 1MPEA 3FILA 4KGSA 1PGBA 1IBXB 4HKZE 5BMGA 1JMLA 2GB1A 2LGIA 4KGTA 5HI1A 2KN4A 1K50A 4WH4A 1K53A 2LUMA 1FCLA 1HEZE 3GB1A 2N9LA 1IGDA 1YNTE 4D2KA 2ON8A 2IGHA 4OZBA 1UWXA
chains in the Genus database with same CATH superfamily
1J7CA 2QC8A 3PZDA 3BZDB 2EMSA 4W9KA 4YXDB 2JXXA 2C7NB 5DPRA 5C2TB 1XF5L 3EUB2 4Q2JA 3AXCA 3NVVA 4QAYA 2W55A 2JT4B 4AWJA 2VH2A 3AEFB 3ZJUA 3U8ZA 2E6XA 3IG3A 2W3SA 3DVNU 4GDKA 1WMHB 1Z2MA 2INNE 2KC1A 1T0SC 2HJ1A 1YQ4B 2PVOD 2RPVA 3BK1A 4HPMB 1E8YA 3I3TB 3ZYYX 3V61A 3O13A 1R4NI 1JWSD 2C60A 3DBHI 5AZFA 1YJJA 4CQNA 2ICIA 1UNSA 2LWPA 4GGQA 3MC9A 4FN2A 1J8CA 4WJQA 3BWUD 2DYOA 2ZNVC 4ANWA 5J18A 3A4SC 5E6PA 2MLBA 2JPHA 3HVDA 3PZ7A 4HVBA 2CR5A 4JPSA 4A8XC 1ZE3D 3NOBA 4J3OD 3AEDB 1E0ZA 4BBNF 4AQ7A 1T0RC 1UZXB 3CSFA 4FULA 3MJWA 1MPEA 1XXGA 3B1LX 4XE0A 2WXHA 2WGSA 4II3B 1KLVA 3BK2A 2ZJDA 3L13A 3NZUA 3QA8A 1YD8U 2KVZA 1NBFC 3JYUA 2LGDA 2AL6A 1V80A 2RD0A 4M0WB 1NVID 2WQYB 2CJNA 1ACCA 1IGDA 2IJ0A 1WM3A 3KLSX 1M94A 2KMCA 2IGHA 1ENFA 2DBYA 2KMMA 5HFYA 2LD9A 2K1FA 3NHEB 1STEA 2KLGA 4L1BA 4US8A 4IW0A 5KHQA 4GU2A 2FIFA 1QOBA 3GZNB 2GBKA 1XLOA 4A20A 2ZW0A 4E71A 5JXVA 1Q5WB 5EE9A 3AEAB 4WAAA 4M8MA 2IGGA 2ZPNA 4LLGM 3QCAA 1C4PA 1XD3B 1WGRA 3C19A 2HTME 1AW7A 1LO5D 2WXNA 3A9JB 5IP4D 4M0WA 2OOBB 5AZHA 3PHWB 1GG3A 2QHOA 3AEGB 4EZJA 4N58A 3SFEB 3A9KB 3Q8FA 3ZTCA 4KSLC 4C56C 3IAM1 2N9PC 3AI5A 3R66C 3B2GA 2WU2B 2MJ3A 3QARA 3Q8BA 2LUEA 1IUEA 1XLPA 5IO9A 4DXAB 4RM9A 1LGRA 1YMHE 2W54A 4K3CA 4P16A 3ZDMC 1RM6C 4MEMA 3BYYB 3EFCA 2LGIA 1U4AA 1D6EC 5BYSA 2WDQB 1C77A 4C80A 5FR6A 4LJPB 2H89B 3C0RB 2V4LA 3PV1A 2VRRB 3ML8A 3RULA 3GE8C 3ZVVA 4FBJB 2BS4B 3P42A 4HPPA 2JQRB 3A9KA 1JWMD 1FPYA 1EUVB 1JRUA 1V1PA 1L2NA 4B95A 3OJ3A 4I6NB 2K22A 1SB3C 1PQSA 1R4MI 1SE9A 1SIFA 4RGOS 3IVFA 2KKCA 2WU5B 3DQVA 2X38A 3NJTA 2K0PA 2Z59B 3V05A 2O6VA 2L05A 1FD6A 4OVZA 1TS5A 2B76B 2K6DB 2RMMA 1NYQA 3UQAA 2KLCA 4BKSA 3AULA 3UGBB 4YTMB 2DAFA 3Q2AC 4HDQA 2A5UA 2LRWA 2PTLA 2BYFA 2D3BA 4AP4C 4F1SA 2KDMA 2BGFA 2JWZA 2LRUA 1P9DU 1P7EA 5LLIA 1MJDA 2EELA 4N6EB 2J42A 2KYWA 2N1WA 2N9EB 3PTFC 4P6VF 4ZHOA 1XCQL 4NNJB 2MBEA 3W1YA 3DBSA 2FCMA 3VVWB 4WWOA 5IAAC 1E7UA 3TIXA 2WHIA 4F7ZA 3SHQA 3B2FA 2MEKA 4S0RA 3SDLC 1FIQA 4FA6A 2J0JA 4CO7A 5J2RA 2KJ6A 3Q8AA 1WR1A 2WXIA 3H8HA 5FK9C 1FCLA 3P4PB 2C7HA 3PREA 3LB8C 4ICVA 3W5VB 4DHZE 4AUQC 3PS6A 4URKA 3H1UA 1QZEA 5TR5A 3NZSA 2MBQA 1IGCA 4HWIB 2RSUA 3SEBA 4YWGG 1L5PA 2X8XX 2AYOB 3VFKA 1GAQB 2DHZA 4PYUA 1HA5A 3H7PB 1YN4A 4G0NB 3ABVB 3RUIB 1YN3A 2K6QA 5FKAC 4L23A 2Y5PA 4IWOA 3EHVA 2D11A 2DYBA 4IM0A 2PJHA 4LNIA 3AE1B 1KH0A 4KSKC 2WP9B 2N7JA 2QCZA 1ESFA 2BWES 4A3OA 4BKGA 2I1JA 2WYQA 3R2IA 2KXJA 4JLCA 1I4XA 5H8YE 2XEWA 2RR9A 4ZHPA 5IKCM 1C79A 2GBJA 2K8BA 1V49A 2IPKD 4NAWB 1AWDA 2KD0A 1FXIA 3VH3B 2ASQA 2BT6A 2GLSA 3APCA 3ZJTA 3H7PA 5BMHA 3DOWA 4ANUA 4OW0A 1YJ1A 1WYWB 1FRDA 2FBWB 3SD5A 4DXFA 1JWUD 1SE4A 3PVLA 2M17A 3NS1A 3ZRFA 3ZUNA 4KGTA 1WH3A 2FNJB 3N1XC 3KUZA 3VQIA 4GSWA 3AE4B 1JALA 3C8YA 3H7SA 1Q1OA 2YEPF 1FXAA 2NS5A 3RNCC 4RF0A 1N61A 3OWEB 3VUWA 3NG0A 1VR9A 2LGSA 3Q3MC 3Q3JA 2V3NA 5EE1A 2LVQA 2PPHA 1WGYA 4YT0B 3VUYA 5KHOA 4NQLB 2GI9A 2I38A 2JF5A 3Q69A 3NY5A 3KH0A 2WXMA 4TV3A 1GB1A 4MH0E 2R61A 4FHJA 3RYTA 3EA6A 1ZOYB 2KFKB 2KFJA 2NTTA 2FAZA 2MX2A 3AM9A 4MDKE 2NBUA 1H4RA 4YSXB 4USAA 4LK0M 1WJUA 4IKGA 2JXTA 1SJED 4HCNB 3ZNID 2WXGA 4W9FA 2MBHA 1CZPA 2BYVE 3U4EG 3WALA 1JRPA 1RAXA 4P1BC 2J53A 1JQ4A 2IZVB 3I5JC 1TYGB 4MM3B 3ZW3A 2D2QA 3CMMB 3ECIA 2ZZPB 2KTRB 4IOIE 1V2YA 3N1YC 4ZRQA 1WGHA 2K8CA 3T3OA 2HJ8A 3KUCB 3NVWA 3WIMA 3MHSD 1QLBB 4TQ0A 3J9CA 2ZVNA 4LNFA 2MJDA 3R3MA 1IYFA 3ZXVA 2JYEA 2QILA 1IPGA 4NPNA 3ZO5B 1WR6E 1S1QB 2N9LA 4ZRJA 5DPSA 2DENB 2WDRB 2KO3A 2KDIA 2M56B 5JZEB 1UELA 4HRSA 2HD5B 1QOAA 3JSVB 5CX3A 1MG4A 4HEA1 1YX5B 4H2AA 4EKUA 3EGRA 2JRHA 1V6EA 2N0SB 1SIJA 5HHDG 2LHDA 2LVOA 2OEDA 1J7AA 2G4DB 2KTRA 2XN9C 2D3GA 1T6BX 2KC2A 3Q14C 3MJ5A 4XWTA 3AE6B 3AEBB 3SR6A 1EWCA 1SF0A 2NPTB 3DVGY 4XC2A 3EFUA 4DDGD 2Y3AA 4GB9A 3MP9A 3KYCD 3RNGC 4IWQA 4II2B 2KWDA 3DBLI 1K8RB 2M0AA 3JSVA 4UDUC 1OEYJ 2M0XA 4RF1A 2DWQA 2GBRA 3ZJVA 2AX5A 1CJEA 2M1MA 2QDFA 4OVVA 1MHHE 2PIAA 3H6NA 3LDZE 2MBOA 4I6LB 4KVGB 2LVPA 3PRMB 4I6PA 2L32A 3VR9B 1OQQA 2LHEA 2UU7A 1Y8RC 4N59A 2AQ1B 1I7HA 1P3QU 3W9CB 3U52E 4IG7B 2KN4A 4YL8A 2IBIB 3IAS1 2ACZB 3GB1A 4EEWA 3BVGA 1ZW7A 3TJPA 3PZ8A 2I1KA 1ISNA 1E8XA 2OHFA 2E3TA 2RDHA 2ON8A 3CSTA 2KX3A 1E5WA 2G1EA 3TEYA 1NENB 1WMHA 5GXGB 1I35A 2BYEA 4EOYA 3VAWA 1OEYA 4JWUC 2D10A 3Q6BA 3BINA 4K7SA 1FM0D 3SU8X 1VZ7A 1WX8A 2YEPB 4CHKA 2J4XA 4W9IA 3AU5A 1UF0A 5BYQA 5EDSA 3N1ZC 2JWUA 3BVZA 5CHVC 2CU3A 3KWVA 4KKIA 1BT0A 1VD2A 1PDXA 3L08A 2INPE 1M4VA 1TY0A 5LNK1 5IN7A 3RNAC 2V3SA 2HTHA 3CF6E 1MG8A 1DGJA 3RZWC 1HE8A 3RNEC 3KYDD 1I4HA 2MW5A 4C4VB 1L6UA 2FCQA 2BYTA 4IDIA 3E9SA 3NRZA 1PUTA 3RPFC 3TSSA 4ACFA 3ZIMA 1FCCC 2M19A 4M8NA 1FEHA 3AE7B 1SBBB 1WXVA 3QK0A 3JVZX 3R7RA 3DWGC 4HKQA 1IBXB 5G5GA 1C1YB 5HI1A 3NVYA 1V9JA 4RNAA 4A6QA 2EMTA 1WE6A 2PMVA 2WDVB 3P2BA 3RCZA 2BS3B 1TS4A 1BUIC 2DZKA 2INDC 4LNOA 4KZCA 3AE3B 3GOEA 4BAXA 1ZDXA 1UWXA 1HXYD 1XLNA 4C4VA 4HLEA 2K25A 1SGHA 5E6JA 1C9FA 5L95C 1UBQA 3TCAA 3GE3C 2BKFA 5AZGA 3EECA 3A9JA 4JWSC 3TEXA 1DOXA 3L16A 2Z0DB 2BF8B 1UH6A 1KOTA 1TS3A 1H8CA 4B0MA 4E74A 1IBXA 1V8CA 4RM8A 2N4FA 1N63A 2NCNA 2JRIB 1C76A 3P63A 2L7RA 3UQBA 1TIFA 3HK0A 5DPWA 1Q10A 3IHPC 1GC7A 4PT5A 2AL3A 1DOIA 4EZKA 3A4RA 5AEKB 1F2RC 3FAHA 1WJNA 1L7YA 5GMVA 1VZ8A 1V86A 3DBLB 4P1CC 4NJ7A 2M4NA 2WXQA 1GNUA 1QT9A 2D3AA 2KWUB 2WXRA 1YIWA 3WANA 2ZEQA 3I63C 4HXDA 3AV8A 1FNUA 3P4RB 1N62A 3UF8A 3WAPA 3ZLZA 2CHXA 3IT4B 5D6JB 3Q8CA 4WJPA 1UD7A 2J0MA 1RYJA 4NZLB 5MPOA 2JUOA 3NS8A 1R4NB 1SE3A 3ML9A 3OJ4B 3OLMD 3DBHB 1GJZA 4BFRA 3T9LA 3PRPB 3P1MA 3P4QB 4EZLA 2ZCBA 1TJEA 5FR3A 2IY0B 3LJ3A 1WZ3A 1YX6B 1XEEA 3RI7C 1WXAA 4WURA 3OG5A 4ITKA 4ARCA 3B08A 2SAKA 2Y5BB 5D3IB 1K52A 3L10B 1QF6A 2REXA 4AJWA 2PEAA 4ARIA 1L4DB 3L0WB 1E8ZA 1VLBA 1UUPA 2LEKA 1FRRA 4ZRIA 4WWMA 1L6VA 5JH5C 1T5XD 3RT3B 1TKEA 4BZAA 2KWVB 2BB6A 3VTWA 2M8SA 3E56A 2L1AA 2MHJA 1F52A 1ZPSA 5LXIB 4JIOU 2MSED 1YQ3B 1HZ5A 4XX5A 4XDDA 2LXCA 1NI3A 4IM2A 4IUMB 4NY0A 4XYCA 2NBVB 1TBEA 2KANA 2BVCA 2WDTB 2J52A 3ZNHB 3Q8EA 1WXMA 2XK5B 4DBGA 4OZAA 2RGFA 2KQ4X 1KJTA 1WSPA 4NAMA 1CMXB 3VXWA 4HKZE 1WI0A 3OAWA 2OJWA 4W9LA 1K50A 4W9DA 1KTKA 3PT2B 2G9HD 1G6JA 1SXTA 2LUMA 1R7SA 1OTRB 2JX5A 2AWTA 3VDZA 1B9RA 2MP2B 2LMCA 4REZA 4KX6B 4LNNA 1N5WA 4WIPA 2NR2A 2KDFB 2N7EA 2PW9A 1WJ4A 4MJSB 5BO4B 2L0FA 4MGZE 1NEKB 2KNBA 1D5XC 5C3JB 4WJNA 2LZ6A 2L0TA 1F9JA 3DVGX 1NDDA 1Z5SB 2XK5A 4NJCA 1WY8A 5EE0A 1JROA 1F1HA 2MRPA 3S2AA 4WQMA 2NVUI 4KV2A 2DNFA 4MH8A 2JSVX 4NAWA 3I9V1 1RRBA 2DZJA 4EE2A 2D5GA 4K1RB 3ZNGC 2IO1B 2PKOA 4PK1A 1D5MC 5D3DA 1OQYA 2MP2A 4JQWC 4G11A 1QOGA 4KZ0A 3PRZA 2IGDA 3R2TA 4M02A 2QIEB 4W9JA 2BTEA 2K3UA 4G50A 2V0GA 1XT9B 4MJSA 4DHZB 1XQQA 3FKYA 3RN9C 2ZNVB 5HG2A 2DX5B 2FCSA 3WA0A 2DLBA 1LXDA 1WGKA 4PYZA 4A90A 2NMQA 4J6IA 1R4MB 1BXTA 5C23A 1WXSA 2R2OA 3ZQ4A 2ONQA 1QKZA 3VR8B 4GIVA 4AOFA 4GDLB 1WRIA 3PGEA 3FC4A 3RFZB 1JWBD 4DQOC 3DHHC 4KIKB 4BBNC 1FMAD 4LDTB 2MWSB 4HDOA 3ETRA 2XNAC 4JE3B 3W5UB 4ANVA 4D2KA 4BKTA 4JGHB 3ZTDA 5I4DA 4O1NA 3N32A 3IFWB 4WAFA 3V60A 2KWCA 2A4ZA 2KFKA 1XCTL 4FADA 1EU4A 1SJHD 1EF5A 4WWNA 1L4ZB 1TTNA 3V3XA 2QEJC 4EFOA 3NUHB 2KMAA 2C7MB 4MELA 3QAQA 3P4SB 1E8WA 5BYRA 4ZRPA 1DYQA 5L83A 2V3PA 1FNVA 3V6CB 1KRHA 3VH4B 3VHTC 3AB5A 3ALBA 4MM3A 2DYMA 3DDCB 1WGDA 3AMZA 1EU3A 1WGGA 2LFIA 5H92C 1UGMA 4PS3A 2IYDB 2MJEA 5AUKA 2FCNA 2WLBA 1OGWA 3EC8A 2CS4A 4GDKB 1MFWA 1P7FA 2KACA 3N30A 4W9CA 4WWPA 2YVCA 4ASWC 3CWIA 2JY6A 2IO3B 3AEEB 3A1QB 3Q3NC 4MT5A 2L8JA 2WXFA 4MACA 1VJKA 1Q0WB 4W9HA 4ICUA 3ZKJC 1P0RA 4CYEA 3VRBB 2BKRB 4ZYSA 3U30A 1WYGA 4GOCA 4KGSA 1I4QA 4HK2A 3QQ8B 1VDVA 1GPXA 1ZDVA 1NYRA 5T8IA 4LDTD 1L0VB 2GMIC 2FIDA 3VTVA 2EKIA 2LXAA 4RH6A 5JHBA 2MA9B 4OVUA 1A70A 2VZKB 3PSEB 1F77A 2KK8A 1N6ZA 1VCBA 5DCNA 3AE9B 4ZOHC 5D94A 1WX9A 2NPTA 4W9GA 1TKGA 1WFYA 3A1QA 1WF9A 2Z8LA 2O2VB 3KWLA 4XZ4A 1E7VA 3Q3OC 4FXCA 2WS3B 1UWMA 2AQ2B 1K51A 1ZGUB 1LQBA 2DZIA 2KOXA 4RGMA 2CJOA 2J0KA 2JU6X 3AN1A 2WWZA 3AU4A 1ZKHA 4KGRA 2KX0A 1I4RA 1J0GA 4ANXA 3TEWA 1L0XB 1ZP0B 4K3BA 3N9YC 2WX1A 4M01A 1OQRA 5D2MB 3MC8A 4HJKA 3KQ4A 4K7UA 2UYZB 1LM8B 3N3KB 1V5OA 4ZDVA 3L17A 2O2VA 1EO6A 3LXFA 3B9JA 3K9OB 2BQQA 4FJVB 3RZFA 1MHXA 2KJRA 3U7DA 3JW0X 3PLVA 2KDBA 3IXSA 4KDIC 3N20C 1FFVA 1Y56A 1TZOA 2KHWB 2WX0A 2G4SA 1JMLA 4NQKE 3DWMA 3R7QA 3GP7A 2LI5A 1C78A 1P98A 1I4GA 1WXQA 2QJLA 2KJHB 2B3AA 2VZKD 2L00B 4XDCA 4BVUC 2MBBB 1KLGD 2WXJA 2MH7A 2IO2B 3M95A 2KTFA 3PO0A 1PFDA 2ZPYA 2W9NA 5CTRC 2EKEC 2ZW1A 2FUHB 3L54A 4DXGA 4OZCA 4HROA 3PPAA 3QX1A 2L3ZA 1FO4A 2GRIA 2QSDA 3BIID 4NJ6A 2K5PA 3APFA 2QMTA 2WNMA 5TSSA 2DZMA 1BMLC 2L52A 3WAMA 2ZVOA 2RDBC 2W3RA 2WXLA 1HTQA 2DAJA 1V1PB 3TL5A 4GN1A 3ZRCA 5BMIA 2RDGA 1WJ6A 4HCPB 4TQ1A 4K7WA 3RNFC 2O6VB 1RLFA 3MC0B 3DBRI 4S17A 3KVFB 2R2QA 2TSSA 1T3QA 2LGXA 2D07B 1J7BA 3NVZA 4BOSC 1WX7A 4TUUA 4L2YA 3BVMA 2YLMA 3AH7A 3D32A 1V81A 2G45B 2IY1B 1P1AA 3HHMA 1WZ0A 3VUXA 1L0YB 2J7QB 2CU1A 3T8MA 5D7GA 4B6WA 5G5HA 2PVGC 5EE3A 5BMGA 3UIPB 2PE6B 2BWFA 1KLUD 3PHXB 1T0YA 4DHJB 3B0AA 2L76A 1C3TA 1HEZE 4X57B 2BPSA 1XLQA 3RNBC 3DHGC 1TGZB 1I42A 4AS1A 3TBLD 1EWYC 4HPLB 4OZBA 3DCGA 1E10A 3DPDA 2BS2B 3W1SA 1SSNA 2PLPA 3MTNB 3M3JA 2KAJA 4EUTA 2GBMA 1E7PB 3HM3A 5LXHA 1ET6A 2H88B 5AUIA 4AJYB 1N5XA 1TY2A 4GLSC 3ZDTA 1AARA 2N7DA 2JZ3B 4ZRKA 3V6EB 2GOWA 1AYFA 3H9DA 4B9KA 3DVNV 5DPTA 1FXTB 2WXKA 3UINB 3BYTB 2UWQA 5G55A 1YN5A 2O6VD 1JWAD 1MVKA 1D5ZC 2CKHB 3UI3A 2AQ3B 3RD2A 4BOZB 3QHTA 1SEBD 1CQVA 2D3CA 3AECB 2CHZA 4ZYNA 1C4AA 1GUAB 4LJOB 3URYA 3HIZA 3TMPB 4LNKA 3M62B 4BKSD 3RMKC 1E6EB 4LCDE 2MQJA 5IOIA 5IA7A 1N60A 2PE9A 3ONSA 1SE2A 2N9KA 1E9MA 1WRDB 4FLHA 3R8BA 5E6OA 2BW2A 3DHIC 1F0ZA 4A9AA 2HE7A 2V4IB 3VTUA 2FUG1 1PGBA 4WQOB 4IC7B 4DHJD 3ZGZA 3HM6X 2MCNB 2GB1A 1KM7A 2WXOA 3QIJA 1VZ6A 1OFFA 4DK5A 2K9XA 4FHKA 4IM3A 3QJZA 5HKHA 1RWSA 3KW5B 5JHAA 2Z0EB 2KT7A 3O65B 3ZXRA 2ZCCA 3AE5B 4YSYB 2IDYA 1J19A 4W9EA 2KDEB 3QC8B 2KQ7A 1C4CA 1GB4A 4RMAA 2BB5A 2JZPA 4JL9A 1TT5B 1WWTA 4YTPB 3W2DA 4JX1C 2Q5WD 5CHFA 1V97A 2WXPA 1YOVB 3L4PA 4RGTA 4YTNB 1XO3A 3PLUA 3GS2A 1MI0A 2RPQA 1QQRA 4RCOA 5C1ZA 1KFYB 1EM7A 1JW9D 3FILB 1DOYA 3W1SC 1RFKA 1QOFA 4US9A 1S3SG 4KDLB 5G2NA 3HVZA 1NI2A 2OJRA 1I4PA 1F2RI 1D3ZA 2G3QB 2N1VA 5E6NA 4MSMB 1JCKB 4A55A 4DWFA 3NZ3A 3A33B 3U7ZA 2CHWA 1YJIA 1WM2A 4XGAB 3APDA 4MGKE 1HZ6A 2JVCA 3X23A 2LJ5A 4WJOA 2XBBC 3UIOB 4MGYE 4XWWA 4C00A 1GOZA 2GBNA 1ZUD2 2KZRA 2JYTA 3BY4B 2IO0B 2V9HA 4FJZA 4HJGE 3MFGA 4B0EA 3DBRB 3AE8B 3FILA 4MSQB 1E90A 2K8HA 4TMAB 1TS2A 2SEBD 1ET9A 1K53A 2KVRA 3X0WA 4P7IA 1WIAA 1FNWA 1PYWD 1LFDA 3GZNI 3HUIA 1UGJA 1TKYA 1YQBA 4MGIE 2C9WB 4E3CA 2C5LC 1V5TA 2L83A 3WAOA 4GMVA 1IP9A 2FE8A 3MHZA 1ROEA 1D4BA 2NTSA 1ZXHA 2LJIA 3Q3FA 4A3PA 4GXBA 4OHJA 4PS7A 2INCC 1HTOA 2V1YA 4TSSA 1ZXIA 3K9PB 3ENEA 4F8CB 3QWZB 2HDEA 2LGYA 3SFDB 2W82A 1X1MA 2N9XA 4FJYA 4N9F4 5J17A 4C7YA 3CIRB 1V1OA 3T3NA 4PS8A 3M63B 3HRDD 4RGNA 2JZZA 4DDID 3I57A 3VRAB 1FFUA 1HQRD 4RFBA 4GDLA 2AEHA 3U2SC 4C7ZA 5CHWA 2I2YA 1A5RA 1AN8A 1T0QC 1WE7A 4R3DA 4KIKA 3TEZA 3WCQA 2NBWB 4M00A 1UBIA 1VRAB 1PGXA 4LTUA 2K39A 3LYYA 4TKNA 2KQSA 2KN5A 1PGAA 3TUOA 4YSZB 1GC6A 2VH1A 4KKJA 4K81A 1B1ZA 3IT6B 4G3XB 2BBCA 4WH4A 3IBEA 1QILA 3ZNZB 2Y5CA 1KF6B 3AE2B 1RFAA 1CK1A 1YNTE 2LASA 4IWPA 3V62A 3KUDB 1TZ1A 1EF1A
chains in the Genus database with same CATH topology
1J7CA 1VR9A 3PO0A 1PFDA 3BZDB 3P1MA 3P4QB 4YXDB 2V3NA 1TJEA 5EE1A 5FR3A 2ZW1A 4YT0B 5C2TB 1XF5L 1XEEA 3EUB2 4Q2JA 4WURA 2GI9A 4ITKA 2I38A 4HROA 4OZCA 3NVVA 4DXGA 2SAKA 1FO4A 4ARCA 2GRIA 2QSDA 2W55A 3BIID 3Q69A 5D3IB 1K52A 2WXMA 1QF6A 1GB1A 2K5PA 4ARIA 3AEFB 3ZJUA 1L4DB 2QMTA 2WNMA 2E6XA 1VLBA 5TSSA 2W3SA 2R61A 1BMLC 1UUPA 2L52A 2LEKA 2W3RA 2INNE 2WXLA 1FRRA 4WWMA 1V1PB 3EA6A 1L6VA 1ZOYB 1T5XD 1YQ4B 2NTTA 2PVOD 1TKEA 2RPVA 2RDGA 3AM9A 5BMIA 3BK1A 2BB6A 3ZYYX 3O13A 4TQ1A 3E56A 4YSXB 4USAA 4LK0M 1JWSD 2L1AA 4IKGA 2JXTA 1SJED 1YJJA 4CQNA 2ICIA 1ZPSA 1UNSA 2WXGA 3MC0B 1YQ3B 3BWUD 2DYOA 1CZPA 1HZ5A 3U4EG 4XDDA 2TSSA 3HVDA 1T3QA 1JRPA 1NI3A 3PZ7A 1J7BA 3NVZA 2J53A 4JPSA 4A8XC 1JQ4A 1ZE3D 4L2YA 4J3OD 1TYGB 3AEDB 3BVMA 3AH7A 4MM3B 1E0ZA 2J52A 3Q8EA 4IOIE 4AQ7A 4ZRQA 1L0YB 4OZAA 2KQ4X 3T3OA 1WSPA 4NAMA 3NVWA 1MPEA 1XXGA 5D7GA 4XE0A 1QLBB 2WXHA 4HKZE 4TQ0A 3BK2A 3J9CA 5G5HA 2MJDA 2PVGC 5EE3A 5BMGA 1KLUD 1K50A 1KTKA 2G9HD 1SXTA 2LUMA 1R7SA 2JX5A 1HEZE 2JYEA 2QILA 1B9RA 2LMCA 2N9LA 1XLQA 1NVID 2WQYB 2CJNA 1ACCA 1IGDA 4REZA 2IJ0A 4KX6B 3KLSX 4AS1A 2WDRB 2M56B 1N5WA 4WIPA 1EWYC 2IGHA 1ENFA 4HRSA 4OZBA 1QOAA 1E10A 2DBYA 2KMMA 2PW9A 5HFYA 4HEA1 2BS2B 4H2AA 1NEKB 3W1SA 1SSNA 1D5XC 2PLPA 2KAJA 3EGRA 1STEA 2N0SB 5C3JB 1SIJA 1E7PB 5HHDG 4L1BA 4US8A 2LHDA 2OEDA 1ET6A 1J7AA 2H88B 5AUIA 1QOBA 1N5XA 1TY2A 4GLSC 1XLOA 2ZW0A 4NJCA 5JXVA 5EE0A 1JROA 2XN9C 5EE9A 3AEAB 1T6BX 2IGGA 4LLGM 4WQMA 3MJ5A 4MH8A 2JSVX 4XWTA 3AE6B 1C4PA 3AEBB 1AYFA 3I9V1 3SR6A 1EWCA 1SF0A 4EE2A 2D5GA 2HTME 2PKOA 1AW7A 1D5MC 1LO5D 2WXKA 2Y3AA 5D3DA 3BYTB 3MP9A 2WXNA 1YN5A 1JWAD 1MVKA 4M0WA 2KWDA 1QOGA 1D5ZC 3UI3A 2AQ3B 2IGDA 3R2TA 1SEBD 2QIEB 1CQVA 2M0AA 3AECB 1C4AA 2BTEA 2K3UA 3AEGB 3URYA 4UDUC 2V0GA 4N58A 4RF1A 2DWQA 3ZJVA 3SFEB 5HG2A 3Q8FA 1E6EB 4C56C 2AX5A 3IAM1 1CJEA 2DLBA 3B2GA 1WGKA 4A90A 2NMQA 2MJ3A 2WU2B 3Q8BA 1BXTA 1MHHE 1IUEA 1N60A 1XLPA 2PIAA 3ZQ4A 1SE2A 2ONQA 2N9KA 1QKZA 1YMHE 2L32A 2W54A 3VR9B 1E9MA 3VR8B 1OQQA 4P16A 3R8BA 2LHEA 2BW2A 1F0ZA 4GDLB 4A9AA 2V4IB 2FUG1 1RM6C 1WRIA 1PGBA 4N59A 2AQ1B 3ZGZA 1I7HA 3BYYB 3W9CB 3FC4A 2GB1A 3U52E 2LGIA 2WXOA 2KN4A 3RFZB 1JWBD 4DQOC 1VZ6A 1OFFA 1D6EC 2K9XA 5BYSA 2WDQB 3IAS1 1C77A 4C80A 2ACZB 3GB1A 1FMAD 2H89B 3BVGA 3PZ8A 1RWSA 3ETRA 2XNAC 2OHFA 4JE3B 2E3TA 3W5UB 2RDHA 4D2KA 2ON8A 2BS4B 3P42A 3AE5B 5I4DA 4O1NA 4YSYB 2IDYA 4WAFA 2G1EA 2JQRB 3TEYA 1NENB 1JWMD 1C4CA 1GB4A 2BB5A 2JZPA 1V1PA 1WWTA 4YTPB 5GXGB 3W2DA 4JX1C 2K22A 2Q5WD 1XCTL 1V97A 1EU4A 1SB3C 1SJHD 2WXPA 4RGTA 3L4PA 4YTNB 1L4ZB 4JWUC 4RGOS 1XO3A 3V3XA 2WU5B 2QEJC 1FM0D 2X38A 1VZ7A 1MI0A 3GS2A 1QQRA 2K0PA 3V05A 3NUHB 4RCOA 1KFYB 2YEPB 1EM7A 2J4XA 1FD6A 1JW9D 3FILB 3P4SB 5BYRA 1DOYA 1RFKA 1DYQA 1QOFA 4ZRPA 5BYQA 4US9A 2V3PA 4OVZA 1FNVA 1TS5A 2B76B 3HVZA 1KRHA 2JWUA 2RMMA 3AB5A 3BVZA 1I4PA 1NYQA 2CU3A 3KWVA 1F2RI 4KKIA 2DYMA 4YTMB 1PDXA 3AMZA 2INPE 1EU3A 1JCKB 1M4VA 1TY0A 2LFIA 5H92C 4A55A 2PTLA 5LNK1 2MJEA 3NZ3A 3U7ZA 1DGJA 5AUKA 2KDMA 1YJIA 2WLBA 1P7EA 1HZ6A 1I4HA 4GDKB 1P7FA 2KACA 2EELA 4N6EB 2J42A 1L6UA 2BYTA 4XWWA 4IDIA 3CWIA 3E9SA 4P6VF 1GOZA 4ZHOA 3NRZA 1PUTA 1ZUD2 1XCQL 3AEEB 3RPFC 3TSSA 1FCCC 2M19A 1FEHA 2JYTA 4MT5A 2WXFA 4MACA 1VJKA 3AE7B 1SBBB 4HJGE 3VRBB 3MFGA 4B0EA 4ZYSA 1WYGA 3DWGC 3AE8B 3B2FA 3FILA 4HKQA 2MEKA 4KGSA 1IBXB 1I4QA 1FIQA 5G5GA 4TMAB 1VDVA 1GPXA 1ZDVA 1NYRA 5T8IA 5HI1A 1L0VB 3NVYA 1TS2A 2SEBD 4RNAA 1ET9A 3Q8AA 4A6QA 2EKIA 1K53A 2WXIA 3H8HA 5FK9C 1FCLA 4RH6A 2PMVA 2WDVB 3P4PB 3LB8C 1FNWA 2BS3B 1PYWD 1TS4A 1BUIC 3HUIA 1UGJA 3W5VB 1A70A 1TKYA 2VZKB 1F77A 3AE3B 2L83A 1ZDXA 3AE9B 1UWXA 1HXYD 1XLNA 4ZOHC 1IGCA 2FE8A 3SEBA 5E6JA 4YWGG 1C9FA 1L5PA 3MHZA 1ROEA 1TKGA 1D4BA 2NTSA 1ZXHA 1GAQB 2Z8LA 2LJIA 3KWLA 1HA5A 4JWSC 3TEXA 1YN4A 4OHJA 1DOXA 4FXCA 2WS3B 3ABVB 1UWMA 4TSSA 1ZXIA 2AQ2B 1K51A 1YN3A 1TS3A 2HDEA 5FKAC 3SFDB 2W82A 4B0MA 4L23A 1IBXA 1V8CA 2Y5PA 4C7YA 3CIRB 1V1OA 4RGMA 1N63A 3AE1B 1KH0A 2WP9B 1C76A 2N7JA 3P63A 3T3NA 2CJOA 2JU6X 1ESFA 3AN1A 3HRDD 4KGRA 4RGNA 3R2IA 1Q10A 1I4RA 1I4XA 5H8YE 4PT5A 4ZHPA 3I57A 3VRAB 1FFUA 3TEWA 1C79A 1HQRD 1L0XB 1ZP0B 1DOIA 4RFBA 3N9YC 1OQRA 2IPKD 4NAWB 1AWDA 3KQ4A 3U2SC 1FXIA 1F2RC 3FAHA 4C7ZA 2BT6A 2I2YA 1AN8A 4R3DA 3ZJTA 3TEZA 5BMHA 3WCQA 1VZ8A 1VRAB 3LXFA 3B9JA 1PGXA 4LTUA 4OW0A 3LYYA 2WXQA 1MHXA 1QT9A 1PGAA 3TUOA 1FRDA 4YSZB 2FBWB 2WXRA 4DXFA 4KKJA 1JWUD 1B1ZA 3IXSA 3IT6B 1FFVA 1SE4A 1Y56A 1TZOA 3AV8A 1JMLA 3NS1A 1FNUA 2BBCA 3DWMA 4KGTA 3GP7A 4WH4A 3P4RB 1N62A 1C78A 1I4GA 1WXQA 2QJLA 3IT4B 1QILA 3VQIA 3Q8CA 2VZKD 2Y5CA 1RYJA 1KF6B 4NZLB 3AE4B 1JALA 5MPOA 3AE2B 4XDCA 1SE3A 3C8YA 1KLGD 2YEPF 1FXAA 2WXJA 1CK1A 1YNTE 4RF0A 1N61A 2MH7A 3OWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW9 A;  5HFY A;  1IGC A;  1GB4 A;  2JZP A;  2PLP A;  1C9F A;  2ZW1 A;  5HHD G;  1XCT L;  1D4B A;  2LHD A;  1ZXH A;  1XF5 L;  2OED A;  2GI9 A;  2I38 A;  4OZC A;  4GLS C;  3V3X A;  2QSD A;  2ZW0 A;  5JXV A;  1K52 A;  1MI0 A;  2K0P A;  1GB1 A;  2IGG A;  1EM7 A;  1K51 A;  1FD6 A;  2QMT A;  3FIL B;  2JSV X;  1IBX A;  2JWU A;  1KH0 A;  2RMM A;  2N7J A;  2JU6 X;  1F2R I;  2RPV A;  3MP9 A;  5BMI A;  4KGR A;  1Q10 A;  1MVK A;  2KWD A;  3UI3 A;  2IGD A;  2PTL A;  4IKG A;  2JXT A;  2KDM A;  1P7E A;  1HZ5 A;  1HZ6 A;  1P7F A;  2KAC A;  2EEL A;  5HG2 A;  1F2R C;  2J53 A;  2I2Y A;  2NMQ A;  1XCQ L;  1MHH E;  1FCC C;  2J52 A;  5BMH A;  4IOI E;  4MAC A;  2ONQ A;  1PGX A;  1QKZ A;  1YMH E;  2N9K A;  4OZA A;  2KQ4 X;  4HJG E;  1MHX A;  1PGA A;  2LHE A;  1MPE A;  3FIL A;  4KGS A;  1PGB A;  1IBX B;  4HKZ E;  5BMG A;  1JML A;  2GB1 A;  2LGI A;  4KGT A;  5HI1 A;  2KN4 A;  1K50 A;  4WH4 A;  1K53 A;  2LUM A;  1FCL A;  1HEZ E;  3GB1 A;  2N9L A;  1IGD A;  1YNT E;  4D2K A;  2ON8 A;  2IGH A;  4OZB A;  1UWX A; 
#chains in the Genus database with same CATH topology
 1J7C A;  2QC8 A;  3PZD A;  3BZD B;  2EMS A;  4W9K A;  4YXD B;  2JXX A;  2C7N B;  5DPR A;  5C2T B;  1XF5 L;  3EUB 2;  4Q2J A;  3AXC A;  3NVV A;  4QAY A;  2W55 A;  2JT4 B;  4AWJ A;  2VH2 A;  3AEF B;  3ZJU A;  3U8Z A;  2E6X A;  3IG3 A;  2W3S A;  3DVN U;  4GDK A;  1WMH B;  1Z2M A;  2INN E;  2KC1 A;  1T0S C;  2HJ1 A;  1YQ4 B;  2PVO D;  2RPV A;  3BK1 A;  4HPM B;  1E8Y A;  3I3T B;  3ZYY X;  3V61 A;  3O13 A;  1R4N I;  1JWS D;  2C60 A;  3DBH I;  5AZF A;  1YJJ A;  4CQN A;  2ICI A;  1UNS A;  2LWP A;  4GGQ A;  3MC9 A;  4FN2 A;  1J8C A;  4WJQ A;  3BWU D;  2DYO A;  2ZNV C;  4ANW A;  5J18 A;  3A4S C;  5E6P A;  2MLB A;  2JPH A;  3HVD A;  3PZ7 A;  4HVB A;  2CR5 A;  4JPS A;  4A8X C;  1ZE3 D;  3NOB A;  4J3O D;  3AED B;  1E0Z A;  4BBN F;  4AQ7 A;  1T0R C;  1UZX B;  3CSF A;  4FUL A;  3MJW A;  1MPE A;  1XXG A;  3B1L X;  4XE0 A;  2WXH A;  2WGS A;  4II3 B;  1KLV A;  3BK2 A;  2ZJD A;  3L13 A;  3NZU A;  3QA8 A;  1YD8 U;  2KVZ A;  1NBF C;  3JYU A;  2LGD A;  2AL6 A;  1V80 A;  2RD0 A;  4M0W B;  1NVI D;  2WQY B;  2CJN A;  1ACC A;  1IGD A;  2IJ0 A;  1WM3 A;  3KLS X;  1M94 A;  2KMC A;  2IGH A;  1ENF A;  2DBY A;  2KMM A;  5HFY A;  2LD9 A;  2K1F A;  3NHE B;  1STE A;  2KLG A;  4L1B A;  4US8 A;  4IW0 A;  5KHQ A;  4GU2 A;  2FIF A;  1QOB A;  3GZN B;  2GBK A;  1XLO A;  4A20 A;  2ZW0 A;  4E71 A;  5JXV A;  1Q5W B;  5EE9 A;  3AEA B;  4WAA A;  4M8M A;  2IGG A;  2ZPN A;  4LLG M;  3QCA A;  1C4P A;  1XD3 B;  1WGR A;  3C19 A;  2HTM E;  1AW7 A;  1LO5 D;  2WXN A;  3A9J B;  5IP4 D;  4M0W A;  2OOB B;  5AZH A;  3PHW B;  1GG3 A;  2QHO A;  3AEG B;  4EZJ A;  4N58 A;  3SFE B;  3A9K B;  3Q8F A;  3ZTC A;  4KSL C;  4C56 C;  3IAM 1;  2N9P C;  3AI5 A;  3R66 C;  3B2G A;  2WU2 B;  2MJ3 A;  3QAR A;  3Q8B A;  2LUE A;  1IUE A;  1XLP A;  5IO9 A;  4DXA B;  4RM9 A;  1LGR A;  1YMH E;  2W54 A;  4K3C A;  4P16 A;  3ZDM C;  1RM6 C;  4MEM A;  3BYY B;  3EFC A;  2LGI A;  1U4A A;  1D6E C;  5BYS A;  2WDQ B;  1C77 A;  4C80 A;  5FR6 A;  4LJP B;  2H89 B;  3C0R B;  2V4L A;  3PV1 A;  2VRR B;  3ML8 A;  3RUL A;  3GE8 C;  3ZVV A;  4FBJ B;  2BS4 B;  3P42 A;  4HPP A;  2JQR B;  3A9K A;  1JWM D;  1FPY A;  1EUV B;  1JRU A;  1V1P A;  1L2N A;  4B95 A;  3OJ3 A;  4I6N B;  2K22 A;  1SB3 C;  1PQS A;  1R4M I;  1SE9 A;  1SIF A;  4RGO S;  3IVF A;  2KKC A;  2WU5 B;  3DQV A;  2X38 A;  3NJT A;  2K0P A;  2Z59 B;  3V05 A;  2O6V A;  2L05 A;  1FD6 A;  4OVZ A;  1TS5 A;  2B76 B;  2K6D B;  2RMM A;  1NYQ A;  3UQA A;  2KLC A;  4BKS A;  3AUL A;  3UGB B;  4YTM B;  2DAF A;  3Q2A C;  4HDQ A;  2A5U A;  2LRW A;  2PTL A;  2BYF A;  2D3B A;  4AP4 C;  4F1S A;  2KDM A;  2BGF A;  2JWZ A;  2LRU A;  1P9D U;  1P7E A;  5LLI A;  1MJD A;  2EEL A;  4N6E B;  2J42 A;  2KYW A;  2N1W A;  2N9E B;  3PTF C;  4P6V F;  4ZHO A;  1XCQ L;  4NNJ B;  2MBE A;  3W1Y A;  3DBS A;  2FCM A;  3VVW B;  4WWO A;  5IAA C;  1E7U A;  3TIX A;  2WHI A;  4F7Z A;  3SHQ A;  3B2F A;  2MEK A;  4S0R A;  3SDL C;  1FIQ A;  4FA6 A;  2J0J A;  4CO7 A;  5J2R A;  2KJ6 A;  3Q8A A;  1WR1 A;  2WXI A;  3H8H A;  5FK9 C;  1FCL A;  3P4P B;  2C7H A;  3PRE A;  3LB8 C;  4ICV A;  3W5V B;  4DHZ E;  4AUQ C;  3PS6 A;  4URK A;  3H1U A;  1QZE A;  5TR5 A;  3NZS A;  2MBQ A;  1IGC A;  4HWI B;  2RSU A;  3SEB A;  4YWG G;  1L5P A;  2X8X X;  2AYO B;  3VFK A;  1GAQ B;  2DHZ A;  4PYU A;  1HA5 A;  3H7P B;  1YN4 A;  4G0N B;  3ABV B;  3RUI B;  1YN3 A;  2K6Q A;  5FKA C;  4L23 A;  2Y5P A;  4IWO A;  3EHV A;  2D11 A;  2DYB A;  4IM0 A;  2PJH A;  4LNI A;  3AE1 B;  1KH0 A;  4KSK C;  2WP9 B;  2N7J A;  2QCZ A;  1ESF A;  2BWE S;  4A3O A;  4BKG A;  2I1J A;  2WYQ A;  3R2I A;  2KXJ A;  4JLC A;  1I4X A;  5H8Y E;  2XEW A;  2RR9 A;  4ZHP A;  5IKC M;  1C79 A;  2GBJ A;  2K8B A;  1V49 A;  2IPK D;  4NAW B;  1AWD A;  2KD0 A;  1FXI A;  3VH3 B;  2ASQ A;  2BT6 A;  2GLS A;  3APC A;  3ZJT A;  3H7P A;  5BMH A;  3DOW A;  4ANU A;  4OW0 A;  1YJ1 A;  1WYW B;  1FRD A;  2FBW B;  3SD5 A;  4DXF A;  1JWU D;  1SE4 A;  3PVL A;  2M17 A;  3NS1 A;  3ZRF A;  3ZUN A;  4KGT A;  1WH3 A;  2FNJ B;  3N1X C;  3KUZ A;  3VQI A;  4GSW A;  3AE4 B;  1JAL A;  3C8Y A;  3H7S A;  1Q1O A;  2YEP F;  1FXA A;  2NS5 A;  3RNC C;  4RF0 A;  1N61 A;  3OWE B;  3VUW A;  3NG0 A;  1VR9 A;  2LGS A;  3Q3M C;  3Q3J A;  2V3N A;  5EE1 A;  2LVQ A;  2PPH A;  1WGY A;  4YT0 B;  3VUY A;  5KHO A;  4NQL B;  2GI9 A;  2I38 A;  2JF5 A;  3Q69 A;  3NY5 A;  3KH0 A;  2WXM A;  4TV3 A;  1GB1 A;  4MH0 E;  2R61 A;  4FHJ A;  3RYT A;  3EA6 A;  1ZOY B;  2KFK B;  2KFJ A;  2NTT A;  2FAZ A;  2MX2 A;  3AM9 A;  4MDK E;  2NBU A;  1H4R A;  4YSX B;  4USA A;  4LK0 M;  1WJU A;  4IKG A;  2JXT A;  1SJE D;  4HCN B;  3ZNI D;  2WXG A;  4W9F A;  2MBH A;  1CZP A;  2BYV E;  3U4E G;  3WAL A;  1JRP A;  1RAX A;  4P1B C;  2J53 A;  1JQ4 A;  2IZV B;  3I5J C;  1TYG B;  4MM3 B;  3ZW3 A;  2D2Q A;  3CMM B;  3ECI A;  2ZZP B;  2KTR B;  4IOI E;  1V2Y A;  3N1Y C;  4ZRQ A;  1WGH A;  2K8C A;  3T3O A;  2HJ8 A;  3KUC B;  3NVW A;  3WIM A;  3MHS D;  1QLB B;  4TQ0 A;  3J9C A;  2ZVN A;  4LNF A;  2MJD A;  3R3M A;  1IYF A;  3ZXV A;  2JYE A;  2QIL A;  1IPG A;  4NPN A;  3ZO5 B;  1WR6 E;  1S1Q B;  2N9L A;  4ZRJ A;  5DPS A;  2DEN B;  2WDR B;  2KO3 A;  2KDI A;  2M56 B;  5JZE B;  1UEL A;  4HRS A;  2HD5 B;  1QOA A;  3JSV B;  5CX3 A;  1MG4 A;  4HEA 1;  1YX5 B;  4H2A A;  4EKU A;  3EGR A;  2JRH A;  1V6E A;  2N0S B;  1SIJ A;  5HHD G;  2LHD A;  2LVO A;  2OED A;  1J7A A;  2G4D B;  2KTR A;  2XN9 C;  2D3G A;  1T6B X;  2KC2 A;  3Q14 C;  3MJ5 A;  4XWT A;  3AE6 B;  3AEB B;  3SR6 A;  1EWC A;  1SF0 A;  2NPT B;  3DVG Y;  4XC2 A;  3EFU A;  4DDG D;  2Y3A A;  4GB9 A;  3MP9 A;  3KYC D;  3RNG C;  4IWQ A;  4II2 B;  2KWD A;  3DBL I;  1K8R B;  2M0A A;  3JSV A;  4UDU C;  1OEY J;  2M0X A;  4RF1 A;  2DWQ A;  2GBR A;  3ZJV A;  2AX5 A;  1CJE A;  2M1M A;  2QDF A;  4OVV A;  1MHH E;  2PIA A;  3H6N A;  3LDZ E;  2MBO A;  4I6L B;  4KVG B;  2LVP A;  3PRM B;  4I6P A;  2L32 A;  3VR9 B;  1OQQ A;  2LHE A;  2UU7 A;  1Y8R C;  4N59 A;  2AQ1 B;  1I7H A;  1P3Q U;  3W9C B;  3U52 E;  4IG7 B;  2KN4 A;  4YL8 A;  2IBI B;  3IAS 1;  2ACZ B;  3GB1 A;  4EEW A;  3BVG A;  1ZW7 A;  3TJP A;  3PZ8 A;  2I1K A;  1ISN A;  1E8X A;  2OHF A;  2E3T A;  2RDH A;  2ON8 A;  3CST A;  2KX3 A;  1E5W A;  2G1E A;  3TEY A;  1NEN B;  1WMH A;  5GXG B;  1I35 A;  2BYE A;  4EOY A;  3VAW A;  1OEY A;  4JWU C;  2D10 A;  3Q6B A;  3BIN A;  4K7S A;  1FM0 D;  3SU8 X;  1VZ7 A;  1WX8 A;  2YEP B;  4CHK A;  2J4X A;  4W9I A;  3AU5 A;  1UF0 A;  5BYQ A;  5EDS A;  3N1Z C;  2JWU A;  3BVZ A;  5CHV C;  2CU3 A;  3KWV A;  4KKI A;  1BT0 A;  1VD2 A;  1PDX A;  3L08 A;  2INP E;  1M4V A;  1TY0 A;  5LNK 1;  5IN7 A;  3RNA C;  2V3S A;  2HTH A;  3CF6 E;  1MG8 A;  1DGJ A;  3RZW C;  1HE8 A;  3RNE C;  3KYD D;  1I4H A;  2MW5 A;  4C4V B;  1L6U A;  2FCQ A;  2BYT A;  4IDI A;  3E9S A;  3NRZ A;  1PUT A;  3RPF C;  3TSS A;  4ACF A;  3ZIM A;  1FCC C;  2M19 A;  4M8N A;  1FEH A;  3AE7 B;  1SBB B;  1WXV A;  3QK0 A;  3JVZ X;  3R7R A;  3DWG C;  4HKQ A;  1IBX B;  5G5G A;  1C1Y B;  5HI1 A;  3NVY A;  1V9J A;  4RNA A;  4A6Q A;  2EMT A;  1WE6 A;  2PMV A;  2WDV B;  3P2B A;  3RCZ A;  2BS3 B;  1TS4 A;  1BUI C;  2DZK A;  2IND C;  4LNO A;  4KZC A;  3AE3 B;  3GOE A;  4BAX A;  1ZDX A;  1UWX A;  1HXY D;  1XLN A;  4C4V A;  4HLE A;  2K25 A;  1SGH A;  5E6J A;  1C9F A;  5L95 C;  1UBQ A;  3TCA A;  3GE3 C;  2BKF A;  5AZG A;  3EEC A;  3A9J A;  4JWS C;  3TEX A;  1DOX A;  3L16 A;  2Z0D B;  2BF8 B;  1UH6 A;  1KOT A;  1TS3 A;  1H8C A;  4B0M A;  4E74 A;  1IBX A;  1V8C A;  4RM8 A;  2N4F A;  1N63 A;  2NCN A;  2JRI B;  1C76 A;  3P63 A;  2L7R A;  3UQB A;  1TIF A;  3HK0 A;  5DPW A;  1Q10 A;  3IHP C;  1GC7 A;  4PT5 A;  2AL3 A;  1DOI A;  4EZK A;  3A4R A;  5AEK B;  1F2R C;  3FAH A;  1WJN A;  1L7Y A;  5GMV A;  1VZ8 A;  1V86 A;  3DBL B;  4P1C C;  4NJ7 A;  2M4N A;  2WXQ A;  1GNU A;  1QT9 A;  2D3A A;  2KWU B;  2WXR A;  1YIW A;  3WAN A;  2ZEQ A;  3I63 C;  4HXD A;  3AV8 A;  1FNU A;  3P4R B;  1N62 A;  3UF8 A;  3WAP A;  3ZLZ A;  2CHX A;  3IT4 B;  5D6J B;  3Q8C A;  4WJP A;  1UD7 A;  2J0M A;  1RYJ A;  4NZL B;  5MPO A;  2JUO A;  3NS8 A;  1R4N B;  1SE3 A;  3ML9 A;  3OJ4 B;  3OLM D;  3DBH B;  1GJZ A;  4BFR A;  3T9L A;  3PRP B;  3P1M A;  3P4Q B;  4EZL A;  2ZCB A;  1TJE A;  5FR3 A;  2IY0 B;  3LJ3 A;  1WZ3 A;  1YX6 B;  1XEE A;  3RI7 C;  1WXA A;  4WUR A;  3OG5 A;  4ITK A;  4ARC A;  3B08 A;  2SAK A;  2Y5B B;  5D3I B;  1K52 A;  3L10 B;  1QF6 A;  2REX A;  4AJW A;  2PEA A;  4ARI A;  1L4D B;  3L0W B;  1E8Z A;  1VLB A;  1UUP A;  2LEK A;  1FRR A;  4ZRI A;  4WWM A;  1L6V A;  5JH5 C;  1T5X D;  3RT3 B;  1TKE A;  4BZA A;  2KWV B;  2BB6 A;  3VTW A;  2M8S A;  3E56 A;  2L1A A;  2MHJ A;  1F52 A;  1ZPS A;  5LXI B;  4JIO U;  2MSE D;  1YQ3 B;  1HZ5 A;  4XX5 A;  4XDD A;  2LXC A;  1NI3 A;  4IM2 A;  4IUM B;  4NY0 A;  4XYC A;  2NBV B;  1TBE A;  2KAN A;  2BVC A;  2WDT B;  2J52 A;  3ZNH B;  3Q8E A;  1WXM A;  2XK5 B;  4DBG A;  4OZA A;  2RGF A;  2KQ4 X;  1KJT A;  1WSP A;  4NAM A;  1CMX B;  3VXW A;  4HKZ E;  1WI0 A;  3OAW A;  2OJW A;  4W9L A;  1K50 A;  4W9D A;  1KTK A;  3PT2 B;  2G9H D;  1G6J A;  1SXT A;  2LUM A;  1R7S A;  1OTR B;  2JX5 A;  2AWT A;  3VDZ A;  1B9R A;  2MP2 B;  2LMC A;  4REZ A;  4KX6 B;  4LNN A;  1N5W A;  4WIP A;  2NR2 A;  2KDF B;  2N7E A;  2PW9 A;  1WJ4 A;  4MJS B;  5BO4 B;  2L0F A;  4MGZ E;  1NEK B;  2KNB A;  1D5X C;  5C3J B;  4WJN A;  2LZ6 A;  2L0T A;  1F9J A;  3DVG X;  1NDD A;  1Z5S B;  2XK5 A;  4NJC A;  1WY8 A;  5EE0 A;  1JRO A;  1F1H A;  2MRP A;  3S2A A;  4WQM A;  2NVU I;  4KV2 A;  2DNF A;  4MH8 A;  2JSV X;  4NAW A;  3I9V 1;  1RRB A;  2DZJ A;  4EE2 A;  2D5G A;  4K1R B;  3ZNG C;  2IO1 B;  2PKO A;  4PK1 A;  1D5M C;  5D3D A;  1OQY A;  2MP2 A;  4JQW C;  4G11 A;  1QOG A;  4KZ0 A;  3PRZ A;  2IGD A;  3R2T A;  4M02 A;  2QIE B;  4W9J A;  2BTE A;  2K3U A;  4G50 A;  2V0G A;  1XT9 B;  4MJS A;  4DHZ B;  1XQQ A;  3FKY A;  3RN9 C;  2ZNV B;  5HG2 A;  2DX5 B;  2FCS A;  3WA0 A;  2DLB A;  1LXD A;  1WGK A;  4PYZ A;  4A90 A;  2NMQ A;  4J6I A;  1R4M B;  1BXT A;  5C23 A;  1WXS A;  2R2O A;  3ZQ4 A;  2ONQ A;  1QKZ A;  3VR8 B;  4GIV A;  4AOF A;  4GDL B;  1WRI A;  3PGE A;  3FC4 A;  3RFZ B;  1JWB D;  4DQO C;  3DHH C;  4KIK B;  4BBN C;  1FMA D;  4LDT B;  2MWS B;  4HDO A;  3ETR A;  2XNA C;  4JE3 B;  3W5U B;  4ANV A;  4D2K A;  4BKT A;  4JGH B;  3ZTD A;  5I4D A;  4O1N A;  3N32 A;  3IFW B;  4WAF A;  3V60 A;  2KWC A;  2A4Z A;  2KFK A;  1XCT L;  4FAD A;  1EU4 A;  1SJH D;  1EF5 A;  4WWN A;  1L4Z B;  1TTN A;  3V3X A;  2QEJ C;  4EFO A;  3NUH B;  2KMA A;  2C7M B;  4MEL A;  3QAQ A;  3P4S B;  1E8W A;  5BYR A;  4ZRP A;  1DYQ A;  5L83 A;  2V3P A;  1FNV A;  3V6C B;  1KRH A;  3VH4 B;  3VHT C;  3AB5 A;  3ALB A;  4MM3 A;  2DYM A;  3DDC B;  1WGD A;  3AMZ A;  1EU3 A;  1WGG A;  2LFI A;  5H92 C;  1UGM A;  4PS3 A;  2IYD B;  2MJE A;  5AUK A;  2FCN A;  2WLB A;  1OGW A;  3EC8 A;  2CS4 A;  4GDK B;  1MFW A;  1P7F A;  2KAC A;  3N30 A;  4W9C A;  4WWP A;  2YVC A;  4ASW C;  3CWI A;  2JY6 A;  2IO3 B;  3AEE B;  3A1Q B;  3Q3N C;  4MT5 A;  2L8J A;  2WXF A;  4MAC A;  1VJK A;  1Q0W B;  4W9H A;  4ICU A;  3ZKJ C;  1P0R A;  4CYE A;  3VRB B;  2BKR B;  4ZYS A;  3U30 A;  1WYG A;  4GOC A;  4KGS A;  1I4Q A;  4HK2 A;  3QQ8 B;  1VDV A;  1GPX A;  1ZDV A;  1NYR A;  5T8I A;  4LDT D;  1L0V B;  2GMI C;  2FID A;  3VTV A;  2EKI A;  2LXA A;  4RH6 A;  5JHB A;  2MA9 B;  4OVU A;  1A70 A;  2VZK B;  3PSE B;  1F77 A;  2KK8 A;  1N6Z A;  1VCB A;  5DCN A;  3AE9 B;  4ZOH C;  5D94 A;  1WX9 A;  2NPT A;  4W9G A;  1TKG A;  1WFY A;  3A1Q A;  1WF9 A;  2Z8L A;  2O2V B;  3KWL A;  4XZ4 A;  1E7V A;  3Q3O C;  4FXC A;  2WS3 B;  1UWM A;  2AQ2 B;  1K51 A;  1ZGU B;  1LQB A;  2DZI A;  2KOX A;  4RGM A;  2CJO A;  2J0K A;  2JU6 X;  3AN1 A;  2WWZ A;  3AU4 A;  1ZKH A;  4KGR A;  2KX0 A;  1I4R A;  1J0G A;  4ANX A;  3TEW A;  1L0X B;  1ZP0 B;  4K3B A;  3N9Y C;  2WX1 A;  4M01 A;  1OQR A;  5D2M B;  3MC8 A;  4HJK A;  3KQ4 A;  4K7U A;  2UYZ B;  1LM8 B;  3N3K B;  1V5O A;  4ZDV A;  3L17 A;  2O2V A;  1EO6 A;  3LXF A;  3B9J A;  3K9O B;  2BQQ A;  4FJV B;  3RZF A;  1MHX A;  2KJR A;  3U7D A;  3JW0 X;  3PLV A;  2KDB A;  3IXS A;  4KDI C;  3N20 C;  1FFV A;  1Y56 A;  1TZO A;  2KHW B;  2WX0 A;  2G4S A;  1JML A;  4NQK E;  3DWM A;  3R7Q A;  3GP7 A;  2LI5 A;  1C78 A;  1P98 A;  1I4G A;  1WXQ A;  2QJL A;  2KJH B;  2B3A A;  2VZK D;  2L00 B;  4XDC A;  4BVU C;  2MBB B;  1KLG D;  2WXJ A;  2MH7 A;  2IO2 B;  3M95 A;  2KTF A;  3PO0 A;  1PFD A;  2ZPY A;  2W9N A;  5CTR C;  2EKE C;  2ZW1 A;  2FUH B;  3L54 A;  4DXG A;  4OZC A;  4HRO A;  3PPA A;  3QX1 A;  2L3Z A;  1FO4 A;  2GRI A;  2QSD A;  3BII D;  4NJ6 A;  2K5P A;  3APF A;  2QMT A;  2WNM A;  5TSS A;  2DZM A;  1BML C;  2L52 A;  3WAM A;  2ZVO A;  2RDB C;  2W3R A;  2WXL A;  1HTQ A;  2DAJ A;  1V1P B;  3TL5 A;  4GN1 A;  3ZRC A;  5BMI A;  2RDG A;  1WJ6 A;  4HCP B;  4TQ1 A;  4K7W A;  3RNF C;  2O6V B;  1RLF A;  3MC0 B;  3DBR I;  4S17 A;  3KVF B;  2R2Q A;  2TSS A;  1T3Q A;  2LGX A;  2D07 B;  1J7B A;  3NVZ A;  4BOS C;  1WX7 A;  4TUU A;  4L2Y A;  3BVM A;  2YLM A;  3AH7 A;  3D32 A;  1V81 A;  2G45 B;  2IY1 B;  1P1A A;  3HHM A;  1WZ0 A;  3VUX A;  1L0Y B;  2J7Q B;  2CU1 A;  3T8M A;  5D7G A;  4B6W A;  5G5H A;  2PVG C;  5EE3 A;  5BMG A;  3UIP B;  2PE6 B;  2BWF A;  1KLU D;  3PHX B;  1T0Y A;  4DHJ B;  3B0A A;  2L76 A;  1C3T A;  1HEZ E;  4X57 B;  2BPS A;  1XLQ A;  3RNB C;  3DHG C;  1TGZ B;  1I42 A;  4AS1 A;  3TBL D;  1EWY C;  4HPL B;  4OZB A;  3DCG A;  1E10 A;  3DPD A;  2BS2 B;  3W1S A;  1SSN A;  2PLP A;  3MTN B;  3M3J A;  2KAJ A;  4EUT A;  2GBM A;  1E7P B;  3HM3 A;  5LXH A;  1ET6 A;  2H88 B;  5AUI A;  4AJY B;  1N5X A;  1TY2 A;  4GLS C;  3ZDT A;  1AAR A;  2N7D A;  2JZ3 B;  4ZRK A;  3V6E B;  2GOW A;  1AYF A;  3H9D A;  4B9K A;  3DVN V;  5DPT A;  1FXT B;  2WXK A;  3UIN B;  3BYT B;  2UWQ A;  5G55 A;  1YN5 A;  2O6V D;  1JWA D;  1MVK A;  1D5Z C;  2CKH B;  3UI3 A;  2AQ3 B;  3RD2 A;  4BOZ B;  3QHT A;  1SEB D;  1CQV A;  2D3C A;  3AEC B;  2CHZ A;  4ZYN A;  1C4A A;  1GUA B;  4LJO B;  3URY A;  3HIZ A;  3TMP B;  4LNK A;  3M62 B;  4BKS D;  3RMK C;  1E6E B;  4LCD E;  2MQJ A;  5IOI A;  5IA7 A;  1N60 A;  2PE9 A;  3ONS A;  1SE2 A;  2N9K A;  1E9M A;  1WRD B;  4FLH A;  3R8B A;  5E6O A;  2BW2 A;  3DHI C;  1F0Z A;  4A9A A;  2HE7 A;  2V4I B;  3VTU A;  2FUG 1;  1PGB A;  4WQO B;  4IC7 B;  4DHJ D;  3ZGZ A;  3HM6 X;  2MCN B;  2GB1 A;  1KM7 A;  2WXO A;  3QIJ A;  1VZ6 A;  1OFF A;  4DK5 A;  2K9X A;  4FHK A;  4IM3 A;  3QJZ A;  5HKH A;  1RWS A;  3KW5 B;  5JHA A;  2Z0E B;  2KT7 A;  3O65 B;  3ZXR A;  2ZCC A;  3AE5 B;  4YSY B;  2IDY A;  1J19 A;  4W9E A;  2KDE B;  3QC8 B;  2KQ7 A;  1C4C A;  1GB4 A;  4RMA A;  2BB5 A;  2JZP A;  4JL9 A;  1TT5 B;  1WWT A;  4YTP B;  3W2D A;  4JX1 C;  2Q5W D;  5CHF A;  1V97 A;  2WXP A;  1YOV B;  3L4P A;  4RGT A;  4YTN B;  1XO3 A;  3PLU A;  3GS2 A;  1MI0 A;  2RPQ A;  1QQR A;  4RCO A;  5C1Z A;  1KFY B;  1EM7 A;  1JW9 D;  3FIL B;  1DOY A;  3W1S C;  1RFK A;  1QOF A;  4US9 A;  1S3S G;  4KDL B;  5G2N A;  3HVZ A;  1NI2 A;  2OJR A;  1I4P A;  1F2R I;  1D3Z A;  2G3Q B;  2N1V A;  5E6N A;  4MSM B;  1JCK B;  4A55 A;  4DWF A;  3NZ3 A;  3A33 B;  3U7Z A;  2CHW A;  1YJI A;  1WM2 A;  4XGA B;  3APD A;  4MGK E;  1HZ6 A;  2JVC A;  3X23 A;  2LJ5 A;  4WJO A;  2XBB C;  3UIO B;  4MGY E;  4XWW A;  4C00 A;  1GOZ A;  2GBN A;  1ZUD 2;  2KZR A;  2JYT A;  3BY4 B;  2IO0 B;  2V9H A;  4FJZ A;  4HJG E;  3MFG A;  4B0E A;  3DBR B;  3AE8 B;  3FIL A;  4MSQ B;  1E90 A;  2K8H A;  4TMA B;  1TS2 A;  2SEB D;  1ET9 A;  1K53 A;  2KVR A;  3X0W A;  4P7I A;  1WIA A;  1FNW A;  1PYW D;  1LFD A;  3GZN I;  3HUI A;  1UGJ A;  1TKY A;  1YQB A;  4MGI E;  2C9W B;  4E3C A;  2C5L C;  1V5T A;  2L83 A;  3WAO A;  4GMV A;  1IP9 A;  2FE8 A;  3MHZ A;  1ROE A;  1D4B A;  2NTS A;  1ZXH A;  2LJI A;  3Q3F A;  4A3P A;  4GXB A;  4OHJ A;  4PS7 A;  2INC C;  1HTO A;  2V1Y A;  4TSS A;  1ZXI A;  3K9P B;  3ENE A;  4F8C B;  3QWZ B;  2HDE A;  2LGY A;  3SFD B;  2W82 A;  1X1M A;  2N9X A;  4FJY A;  4N9F 4;  5J17 A;  4C7Y A;  3CIR B;  1V1O A;  3T3N A;  4PS8 A;  3M63 B;  3HRD D;  4RGN A;  2JZZ A;  4DDI D;  3I57 A;  3VRA B;  1FFU A;  1HQR D;  4RFB A;  4GDL A;  2AEH A;  3U2S C;  4C7Z A;  5CHW A;  2I2Y A;  1A5R A;  1AN8 A;  1T0Q C;  1WE7 A;  4R3D A;  4KIK A;  3TEZ A;  3WCQ A;  2NBW B;  4M00 A;  1UBI A;  1VRA B;  1PGX A;  4LTU A;  2K39 A;  3LYY A;  4TKN A;  2KQS A;  2KN5 A;  1PGA A;  3TUO A;  4YSZ B;  1GC6 A;  2VH1 A;  4KKJ A;  4K81 A;  1B1Z A;  3IT6 B;  4G3X B;  2BBC A;  4WH4 A;  3IBE A;  1QIL A;  3ZNZ B;  2Y5C A;  1KF6 B;  3AE2 B;  1RFA A;  1CK1 A;  1YNT E;  2LAS A;  4IWP A;  3V62 A;  3KUD B;  1TZ1 A;  1EF1 A; 
#chains in the Genus database with same CATH homology
 1J7C A;  1VR9 A;  3PO0 A;  1PFD A;  3BZD B;  3P1M A;  3P4Q B;  4YXD B;  2V3N A;  1TJE A;  5EE1 A;  5FR3 A;  2ZW1 A;  4YT0 B;  5C2T B;  1XF5 L;  1XEE A;  3EUB 2;  4Q2J A;  4WUR A;  2GI9 A;  4ITK A;  2I38 A;  4HRO A;  4OZC A;  3NVV A;  4DXG A;  2SAK A;  1FO4 A;  4ARC A;  2GRI A;  2QSD A;  2W55 A;  3BII D;  3Q69 A;  5D3I B;  1K52 A;  2WXM A;  1QF6 A;  1GB1 A;  2K5P A;  4ARI A;  3AEF B;  3ZJU A;  1L4D B;  2QMT A;  2WNM A;  2E6X A;  1VLB A;  5TSS A;  2W3S A;  2R61 A;  1BML C;  1UUP A;  2L52 A;  2LEK A;  2W3R A;  2INN E;  2WXL A;  1FRR A;  4WWM A;  1V1P B;  3EA6 A;  1L6V A;  1ZOY B;  1T5X D;  1YQ4 B;  2NTT A;  2PVO D;  1TKE A;  2RPV A;  2RDG A;  3AM9 A;  5BMI A;  3BK1 A;  2BB6 A;  3ZYY X;  3O13 A;  4TQ1 A;  3E56 A;  4YSX B;  4USA A;  4LK0 M;  1JWS D;  2L1A A;  4IKG A;  2JXT A;  1SJE D;  1YJJ A;  4CQN A;  2ICI A;  1ZPS A;  1UNS A;  2WXG A;  3MC0 B;  1YQ3 B;  3BWU D;  2DYO A;  1CZP A;  1HZ5 A;  3U4E G;  4XDD A;  2TSS A;  3HVD A;  1T3Q A;  1JRP A;  1NI3 A;  3PZ7 A;  1J7B A;  3NVZ A;  2J53 A;  4JPS A;  4A8X C;  1JQ4 A;  1ZE3 D;  4L2Y A;  4J3O D;  1TYG B;  3AED B;  3BVM A;  3AH7 A;  4MM3 B;  1E0Z A;  2J52 A;  3Q8E A;  4IOI E;  4AQ7 A;  4ZRQ A;  1L0Y B;  4OZA A;  2KQ4 X;  3T3O A;  1WSP A;  4NAM A;  3NVW A;  1MPE A;  1XXG A;  5D7G A;  4XE0 A;  1QLB B;  2WXH A;  4HKZ E;  4TQ0 A;  3BK2 A;  3J9C A;  5G5H A;  2MJD A;  2PVG C;  5EE3 A;  5BMG A;  1KLU D;  1K50 A;  1KTK A;  2G9H D;  1SXT A;  2LUM A;  1R7S A;  2JX5 A;  1HEZ E;  2JYE A;  2QIL A;  1B9R A;  2LMC A;  2N9L A;  1XLQ A;  1NVI D;  2WQY B;  2CJN A;  1ACC A;  1IGD A;  4REZ A;  2IJ0 A;  4KX6 B;  3KLS X;  4AS1 A;  2WDR B;  2M56 B;  1N5W A;  4WIP A;  1EWY C;  2IGH A;  1ENF A;  4HRS A;  4OZB A;  1QOA A;  1E10 A;  2DBY A;  2KMM A;  2PW9 A;  5HFY A;  4HEA 1;  2BS2 B;  4H2A A;  1NEK B;  3W1S A;  1SSN A;  1D5X C;  2PLP A;  2KAJ A;  3EGR A;  1STE A;  2N0S B;  5C3J B;  1SIJ A;  1E7P B;  5HHD G;  4L1B A;  4US8 A;  2LHD A;  2OED A;  1ET6 A;  1J7A A;  2H88 B;  5AUI A;  1QOB A;  1N5X A;  1TY2 A;  4GLS C;  1XLO A;  2ZW0 A;  4NJC A;  5JXV A;  5EE0 A;  1JRO A;  2XN9 C;  5EE9 A;  3AEA B;  1T6B X;  2IGG A;  4LLG M;  4WQM A;  3MJ5 A;  4MH8 A;  2JSV X;  4XWT A;  3AE6 B;  1C4P A;  3AEB B;  1AYF A;  3I9V 1;  3SR6 A;  1EWC A;  1SF0 A;  4EE2 A;  2D5G A;  2HTM E;  2PKO A;  1AW7 A;  1D5M C;  1LO5 D;  2WXK A;  2Y3A A;  5D3D A;  3BYT B;  3MP9 A;  2WXN A;  1YN5 A;  1JWA D;  1MVK A;  4M0W A;  2KWD A;  1QOG A;  1D5Z C;  3UI3 A;  2AQ3 B;  2IGD A;  3R2T A;  1SEB D;  2QIE B;  1CQV A;  2M0A A;  3AEC B;  1C4A A;  2BTE A;  2K3U A;  3AEG B;  3URY A;  4UDU C;  2V0G A;  4N58 A;  4RF1 A;  2DWQ A;  3ZJV A;  3SFE B;  5HG2 A;  3Q8F A;  1E6E B;  4C56 C;  2AX5 A;  3IAM 1;  1CJE A;  2DLB A;  3B2G A;  1WGK A;  4A90 A;  2NMQ A;  2MJ3 A;  2WU2 B;  3Q8B A;  1BXT A;  1MHH E;  1IUE A;  1N60 A;  1XLP A;  2PIA A;  3ZQ4 A;  1SE2 A;  2ONQ A;  2N9K A;  1QKZ A;  1YMH E;  2L32 A;  2W54 A;  3VR9 B;  1E9M A;  3VR8 B;  1OQQ A;  4P16 A;  3R8B A;  2LHE A;  2BW2 A;  1F0Z A;  4GDL B;  4A9A A;  2V4I B;  2FUG 1;  1RM6 C;  1WRI A;  1PGB A;  4N59 A;  2AQ1 B;  3ZGZ A;  1I7H A;  3BYY B;  3W9C B;  3FC4 A;  2GB1 A;  3U52 E;  2LGI A;  2WXO A;  2KN4 A;  3RFZ B;  1JWB D;  4DQO C;  1VZ6 A;  1OFF A;  1D6E C;  2K9X A;  5BYS A;  2WDQ B;  3IAS 1;  1C77 A;  4C80 A;  2ACZ B;  3GB1 A;  1FMA D;  2H89 B;  3BVG A;  3PZ8 A;  1RWS A;  3ETR A;  2XNA C;  2OHF A;  4JE3 B;  2E3T A;  3W5U B;  2RDH A;  4D2K A;  2ON8 A;  2BS4 B;  3P42 A;  3AE5 B;  5I4D A;  4O1N A;  4YSY B;  2IDY A;  4WAF A;  2G1E A;  2JQR B;  3TEY A;  1NEN B;  1JWM D;  1C4C A;  1GB4 A;  2BB5 A;  2JZP A;  1V1P A;  1WWT A;  4YTP B;  5GXG B;  3W2D A;  4JX1 C;  2K22 A;  2Q5W D;  1XCT L;  1V97 A;  1EU4 A;  1SB3 C;  1SJH D;  2WXP A;  4RGT A;  3L4P A;  4YTN B;  1L4Z B;  4JWU C;  4RGO S;  1XO3 A;  3V3X A;  2WU5 B;  2QEJ C;  1FM0 D;  2X38 A;  1VZ7 A;  1MI0 A;  3GS2 A;  1QQR A;  2K0P A;  3V05 A;  3NUH B;  4RCO A;  1KFY B;  2YEP B;  1EM7 A;  2J4X A;  1FD6 A;  1JW9 D;  3FIL B;  3P4S B;  5BYR A;  1DOY A;  1RFK A;  1DYQ A;  1QOF A;  4ZRP A;  5BYQ A;  4US9 A;  2V3P A;  4OVZ A;  1FNV A;  1TS5 A;  2B76 B;  3HVZ A;  1KRH A;  2JWU A;  2RMM A;  3AB5 A;  3BVZ A;  1I4P A;  1NYQ A;  2CU3 A;  3KWV A;  1F2R I;  4KKI A;  2DYM A;  4YTM B;  1PDX A;  3AMZ A;  2INP E;  1EU3 A;  1JCK B;  1M4V A;  1TY0 A;  2LFI A;  5H92 C;  4A55 A;  2PTL A;  5LNK 1;  2MJE A;  3NZ3 A;  3U7Z A;  1DGJ A;  5AUK A;  2KDM A;  1YJI A;  2WLB A;  1P7E A;  1HZ6 A;  1I4H A;  4GDK B;  1P7F A;  2KAC A;  2EEL A;  4N6E B;  2J42 A;  1L6U A;  2BYT A;  4XWW A;  4IDI A;  3CWI A;  3E9S A;  4P6V F;  1GOZ A;  4ZHO A;  3NRZ A;  1PUT A;  1ZUD 2;  1XCQ L;  3AEE B;  3RPF C;  3TSS A;  1FCC C;  2M19 A;  1FEH A;  2JYT A;  4MT5 A;  2WXF A;  4MAC A;  1VJK A;  3AE7 B;  1SBB B;  4HJG E;  3VRB B;  3MFG A;  4B0E A;  4ZYS A;  1WYG A;  3DWG C;  3AE8 B;  3B2F A;  3FIL A;  4HKQ A;  2MEK A;  4KGS A;  1IBX B;  1I4Q A;  1FIQ A;  5G5G A;  4TMA B;  1VDV A;  1GPX A;  1ZDV A;  1NYR A;  5T8I A;  5HI1 A;  1L0V B;  3NVY A;  1TS2 A;  2SEB D;  4RNA A;  1ET9 A;  3Q8A A;  4A6Q A;  2EKI A;  1K53 A;  2WXI A;  3H8H A;  5FK9 C;  1FCL A;  4RH6 A;  2PMV A;  2WDV B;  3P4P B;  3LB8 C;  1FNW A;  2BS3 B;  1PYW D;  1TS4 A;  1BUI C;  3HUI A;  1UGJ A;  3W5V B;  1A70 A;  1TKY A;  2VZK B;  1F77 A;  3AE3 B;  2L83 A;  1ZDX A;  3AE9 B;  1UWX A;  1HXY D;  1XLN A;  4ZOH C;  1IGC A;  2FE8 A;  3SEB A;  5E6J A;  4YWG G;  1C9F A;  1L5P A;  3MHZ A;  1ROE A;  1TKG A;  1D4B A;  2NTS A;  1ZXH A;  1GAQ B;  2Z8L A;  2LJI A;  3KWL A;  1HA5 A;  4JWS C;  3TEX A;  1YN4 A;  4OHJ A;  1DOX A;  4FXC A;  2WS3 B;  3ABV B;  1UWM A;  4TSS A;  1ZXI A;  2AQ2 B;  1K51 A;  1YN3 A;  1TS3 A;  2HDE A;  5FKA C;  3SFD B;  2W82 A;  4B0M A;  4L23 A;  1IBX A;  1V8C A;  2Y5P A;  4C7Y A;  3CIR B;  1V1O A;  4RGM A;  1N63 A;  3AE1 B;  1KH0 A;  2WP9 B;  1C76 A;  2N7J A;  3P63 A;  3T3N A;  2CJO A;  2JU6 X;  1ESF A;  3AN1 A;  3HRD D;  4KGR A;  4RGN A;  3R2I A;  1Q10 A;  1I4R A;  1I4X A;  5H8Y E;  4PT5 A;  4ZHP A;  3I57 A;  3VRA B;  1FFU A;  3TEW A;  1C79 A;  1HQR D;  1L0X B;  1ZP0 B;  1DOI A;  4RFB A;  3N9Y C;  1OQR A;  2IPK D;  4NAW B;  1AWD A;  3KQ4 A;  3U2S C;  1FXI A;  1F2R C;  3FAH A;  4C7Z A;  2BT6 A;  2I2Y A;  1AN8 A;  4R3D A;  3ZJT A;  3TEZ A;  5BMH A;  3WCQ A;  1VZ8 A;  1VRA B;  3LXF A;  3B9J A;  1PGX A;  4LTU A;  4OW0 A;  3LYY A;  2WXQ A;  1MHX A;  1QT9 A;  1PGA A;  3TUO A;  1FRD A;  4YSZ B;  2FBW B;  2WXR A;  4DXF A;  4KKJ A;  1JWU D;  1B1Z A;  3IXS A;  3IT6 B;  1FFV A;  1SE4 A;  1Y56 A;  1TZO A;  3AV8 A;  1JML A;  3NS1 A;  1FNU A;  2BBC A;  3DWM A;  4KGT A;  3GP7 A;  4WH4 A;  3P4R B;  1N62 A;  1C78 A;  1I4G A;  1WXQ A;  2QJL A;  3IT4 B;  1QIL A;  3VQI A;  3Q8C A;  2VZK D;  2Y5C A;  1RYJ A;  1KF6 B;  4NZL B;  3AE4 B;  1JAL A;  5MPO A;  3AE2 B;  4XDC A;  1SE3 A;  3C8Y A;  1KLG D;  2YEP F;  1FXA A;  2WXJ A;  1CK1 A;  1YNT E;  4RF0 A;  1N61 A;  2MH7 A;  3OWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...