5HG2A

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-2-asn35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein G
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hg2A00
4IKGA 4WH4A 2I2YA 1Q10A 2LHEA 2QMTA 5JXVA 1FCCC 3FILA 2K0PA 1K52A 2JWUA 4D2KA 1IGCA 1F2RC 2KACA 2RMMA 1GB1A 2QSDA 2N7JA 1YMHE 1IGDA 2LHDA 1PGAA 2ZW0A 2IGDA 2JSVX 1MHXA 1C9FA 5BMGA 1FD6A 1IBXA 2LGIA 2PLPA 1K53A 2KDMA 4HKZE 4KGRA 2GI9A 4GLSC 2ZW1A 3MP9A 1P7EA 1F2RI 2KN4A 2KQ4X 1XCQL 5HHDG 1KH0A 2ON8A 2JZPA 1XF5L 2PW9A 2IGGA 2RPVA 5BMIA 2I38A 2LUMA 1ZXHA 1EM7A 1D4BA 1PGBA 4OZBA 2JU6X 1P7FA 1HZ5A 3FILB 3UI3A 2IGHA 1HEZE 3GB1A 1K50A 1MVKA 4HJGE 1MI0A 2JXTA 1GB4A 2PTLA 5HG2A 5BMHA 5HI1A 2N9KA 2NMQA 4KGSA 1K51A 1JMLA 1MPEA 1XCTL 2OEDA 4OZAA 2ONQA 1UWXA 1IBXB 1PGXA 4IOIE 1QKZA 1MHHE 5HFYA 2J52A 4OZCA 2KWDA 4MACA 2N9LA 3V3XA 2J53A 4KGTA 1YNTE 2GB1A 1FCLA 2EELA 1HZ6A
chains in the Genus database with same CATH superfamily
2KT7A 2CHXA 4WH4A 4H2AA 3IAS1 3LJ3A 2LHEA 5AZFA 3BIID 2Y5CA 4MJSA 3SFEB 1F1HA 2BT6A 4GGQA 2IYDB 5IO9A 2M56B 3IT4B 3NHEB 4FHJA 2WXHA 2BWFA 3AULA 4PK1A 1R4NB 1UGJA 2MJEA 2YLMA 4ZOHC 5EDSA 2Z59B 4B0MA 2LEKA 4RF0A 1WYWB 1F9JA 2DWQA 2JSVX 4PYZA 1T0SC 4NAMA 1AWDA 2W82A 1YQ4B 2MH7A 3GP7A 1TKYA 1N5WA 1E7VA 1I4XA 4EZKA 3IHPC 2K6DB 2L8JA 4A8XC 3TEZA 3Q8EA 3RNCC 2WYQA 2LVQA 3KQ4A 4PT5A 2WNMA 2JZZA 1FPYA 1BMLC 1TS5A 3Q3JA 1N61A 2CJOA 1KRHA 2WXKA 4TUUA 4ITKA 1HTOA 4IWPA 1HE8A 1P7FA 3L10B 1HZ5A 2O2VA 2OJWA 1ROEA 3AEAB 1DOYA 1T0YA 3AE1B 2KLCA 1NEKB 1L0YB 1C3TA 3NVZA 2BB6A 3VTUA 2XNAC 1ZKHA 2KTFA 3ZXVA 5D6JB 4ICUA 4AJYB 1LGRA 2KD0A 2IY1B 2KC1A 4OZAA 3H8HA 3PZ8A 4YTNB 2XEWA 2GBRA 1E8YA 4KGTA 3N1ZC 1GC6A 3V60A 4PYUA 4WQMA 4E74A 1SJED 4BFRA 4IKGA 4BOSC 2RPQA 1WXAA 4MSQB 1P3QU 3ZDTA 4K7SA 3H6NA 1XLQA 1K52A 2BYTA 5CHWA 3T3NA 3H1UA 2PJHA 2HJ1A 2KQ7A 2QSDA 2C5LC 2KDBA 4WWPA 1V80A 3C0RB 4HPPA 3ZJTA 2D3AA 1SJHD 4S17A 2LGIA 1JCKB 1WXVA 3AE7B 4RGOS 4C7ZA 3RNFC 3PO0A 2BS2B 3M95A 3R7QA 1ZGUB 4LJOB 4DQOC 2RSUA 1JW9D 2KJ6A 1WJ4A 3TBLD 3MP9A 3LDZE 1R4NI 3SFDB 2GMIC 4YSYB 1JRUA 2DNFA 4E3CA 3N30A 3GE8C 4GN1A 4RM9A 4EEWA 2LFIA 3IBEA 2EMTA 3ZTCA 1PGBA 3NRZA 5KHOA 2JUOA 5BYQA 4C00A 1ACCA 2FIFA 2JT4B 1FNUA 3NUHB 4GDLA 3AB5A 3PRZA 4M8MA 2MP2B 2JXTA 1C4CA 3MHSD 3W1SC 2HE7A 2PTLA 1YD8U 5HG2A 3HUIA 1TS4A 2B76B 1QOBA 2ZNVB 4EKUA 3TMPB 4I6LB 3PHXB 1J19A 3JW0X 3L0WB 4C80A 1AW7A 1I4HA 5JZEB 4KZ0A 2KO3A 2BYVE 4DHZB 5J17A 1LQBA 4YXDB 5JXVA 2L3ZA 4BZAA 5T8IA 1ZP0B 2JWUA 1OQYA 2D07B 2RD0A 1PGAA 1E10A 1RAXA 3N1YC 4FHKA 2JWZA 4K3BA 2JYEA 1KF6B 1V81A 1KTKA 2JF5A 3Q8FA 4M02A 3U7ZA 4NJ6A 2V4IB 2MLBA 4WIPA 3ZJUA 4W9LA 1UF0A 2JPHA 1TZOA 4YTPB 5GXGB 2KZRA 2X8XX 1WSPA 2K6QA 4WAFA 4AS1A 3KWLA 2I1JA 2DYOA 2ON8A 3T9LA 2PW9A 4KSLC 4AWJA 4ZRIA 1YN5A 2WDQB 1YX6B 3IT6B 2O6VA 1HA5A 5LLIA 4RMAA 2G3QB 1NYQA 4KSKC 1Q1OA 2K3UA 5G5HA 1KOTA 4HLEA 3PRMB 3VR8B 3BY4B 2DBYA 2JXXA 3SD5A 1FXAA 2SAKA 1WXSA 4IUMB 1FXTB 2HTME 4DK5A 1SIJA 4ACFA 2KMCA 2WQYB 3AN1A 3NS8A 1H4RA 2JQRB 4OZCA 2LI5A 3WAMA 2R2QA 3W1YA 3JVZX 1Z2MA 2QJLA 4JE3B 5LNK1 2BW2A 2D3BA 4XWWA 2V4LA 2UWQA 3KLSX 2PEAA 4KVGB 4US9A 5AZGA 4YSZB 3PREA 1WXMA 2KTRB 4AP4C 3NG0A 2RR9A 4AQ7A 2NTTA 3Q3OC 3T3OA 1XQQA 2N4FA 2G4DB 2LHDA 1ZXIA 1UBQA 1JWAD 2GOWA 3DQVA 3RCZA 4N9F4 2JYTA 3JSVA 2L1AA 1J7CA 3APFA 2ZCBA 4GB9A 3RT3B 1K53A 3DVGY 2Y5BB 5G55A 4WURA 3I9V1 3A4RA 1RRBA 2WXQA 4MM3B 3RZFA 1P7EA 3DVNU 3B9JA 3P63A 4K81A 1FFVA 4CHKA 5E6NA 5D3DA 3FC4A 4Q2JA 3BYTB 3W2DA 2DAJA 2RPVA 3B0AA 3R66C 3V05A 2KDFB 3CIRB 1JQ4A 3MHZA 4RH6A 2HD5B 3E56A 4HEA1 2L76A 1IYFA 3PZ7A 4LDTB 3VTWA 2H89B 3QHTA 2WXRA 1M4VA 4MH0E 2MBBB 4ZRQA 5I4DA 2BPSA 1ENFA 1C76A 2IO0B 2LVOA 2B3AA 5HI1A 2NMQA 1V9JA 2DHZA 2QHOA 4KGSA 4NJ7A 4ZHPA 4O1NA 2CHZA 1AYFA 2KK8A 1SGHA 5HFYA 3A1QA 3RULA 1D5XC 3Q3MC 3DBHI 3SHQA 1SE9A 2MBHA 1VD2A 1STEA 4NY0A 2KWVB 1JWBD 1HZ6A 4W9FA 4K3CA 2WU2B 3M62B 4ASWC 2WXMA 1LM8B 3RD2A 5DPSA 4PS3A 2JZ3B 3H9DA 1RWSA 5CTRC 3VUWA 1SE3A 3TUOA 5C3JB 3VTVA 4E71A 3V61A 4WQOB 4B9KA 2K8CA 3MC9A 4KDIC 1XLPA 3Q3NC 4W9CA 1V49A 3A9KA 4NNJB 4F7ZA 4WJPA 2C7NB 1WGKA 1PQSA 3PGEA 1OEYJ 1E8WA 4HCNB 4A20A 1SEBD 3A9KB 2GRIA 2GBNA 2JRIB 3QARA 1XD3B 5IN7A 1BXTA 5HHDG 2L0TA 2W3RA 2W54A 1JROA 3U7DA 2FUG1 5EE1A 2R61A 3UGBB 1WE6A 3IFWB 3WALA 4ZDVA 3UI3A 3TEYA 2WXIA 1WH3A 4CQNA 1HEZE 1KM7A 4XDDA 1K50A 2FCQA 2V3NA 1GB4A 3NS1A 2KAJA 1VZ8A 3L54A 2L05A 2WGSA 3BK2A 4HRSA 1I4RA 4WJQA 3ZIMA 3ZW3A 3APDA 1SE4A 1Z5SB 2KMMA 5E6JA 2N1VA 5G2NA 1E0ZA 3JSVB 2BVCA 4C56C 1IUEA 2WWZA 3UINB 1T5XD 2MP2A 4P1BC 3VHTC 3Q6BA 1L7YA 1F77A 1UNSA 1YIWA 1T0QC 1WY8A 3EUB2 1E8XA 5BO4B 4PS7A 1C4PA 3SDLC 4CO7A 3MC8A 2XBBC 4DXAB 1WJ6A 4W9KA 3DBLI 4JWSC 5C2TB 4ZRKA 3R8BA 1T0RC 4B0EA 1E5WA 2ZPNA 2OHFA 4LTUA 4N58A 4A6QA 4JL9A 3AU5A 1IGDA 4C4VB 2HTHA 2YVCA 3AU4A 1XLOA 2LXAA 3PVLA 3P4QB 2IGDA 4HWIB 3I57A 1LO5D 2GLSA 1I42A 2FIDA 3SEBA 1L4DB 1ISNA 1PUTA 3TSSA 4N6EB 2J0JA 1EO6A 1FMAD 3V62A 4BOZB 4AJWA 2ZW1A 2WXPA 1GJZA 1JWUD 2L83A 3H7PB 3AEFB 1CQVA 3V6EB 2KVRA 2LUMA 1QOFA 1OGWA 2WHIA 3UIPB 1V5OA 1F52A 3OLMD 1DOXA 1BT0A 2IGHA 3ZVVA 1JRPA 2AL6A 3BVZA 3LXFA 1MI0A 2FE8A 2H88B 4KZCA 1D3ZA 2NR2A 4WWNA 4DDID 3WAOA 1WWTA 4FN2A 1MG4A 5E6OA 1FO4A 4JPSA 1VCBA 2K9XA 4GXBA 2LGYA 5EE9A 1TT5B 5AUKA 5DCNA 2NTSA 1CK1A 3AE3B 2WDTB 4ZYSA 3DBLB 4G11A 3B08A 2V3SA 4A55A 3ENEA 3P42A 2NPTA 2D10A 4R3DA 1WFYA 3ZDMC 2LGXA 1ZPSA 3H7PA 3KYCD 2KJRA 3NJTA 1I7HA 3M63B 1T3QA 2C7MB 4EUTA 2BKRB 2D11A 2MEKA 2UYZB 3VUXA 1ZW7A 2KYWA 1TKGA 3ZNHB 3RUIB 1MHXA 1KLGD 5AUIA 1J7AA 2O6VD 1NYRA 1PDXA 2N9XA 2IY0B 5BMGA 2MBQA 2W55A 4ICVA 1HXYD 4W9HA 2KMAA 4TQ0A 1A5RA 2ZVNA 4P7IA 1C78A 3B1LX 4MH8A 1JALA 1V86A 1D5MC 2Z0DB 3HM3A 1VJKA 2NCNA 3PT2B 1C79A 2IGGA 4RM8A 4RGNA 1WX8A 4L23A 2FCMA 2WXJA 1EM7A 3L17A 4GSWA 4URKA 3IXSA 2RDGA 4HKQA 3BINA 2INPE 1A70A 4AUQC 2A4ZA 4HJGE 2WP9B 1GNUA 4F8CB 3VXWA 1Q5WB 4EOYA 4DXGA 2Y3AA 2MA9B 1E9MA 2G4SA 2IDYA 3DVGX 3ABVB 4GDKB 1JMLA 1GAQB 3UQBA 3BWUD 1PGXA 2LD9A 3N9YC 4II2B 1WGRA 3J9CA 1GC7A 4NPNA 4US8A 3PPAA 1QOAA 2LGDA 3VQIA 3UQAA 3RNGC 5IAAC 1GG3A 2N7EA 3E9SA 2KNBA 1C77A 3AEEB 3FILA 1EUVB 3FAHA 5L95C 4D2KA 2IPKD 3ZRFA 4OVZA 1L5PA 4NQLB 3UF8A 4G50A 3X23A 5CHVC 1HQRD 1ZE3D 1FFUA 3AECB 4MGYE 3WCQA 3U2SC 4K7UA 2D3GA 1L6VA 3QX1A 2LJ5A 1TBEA 5L83A 2XK5A 4HKZE 1NBFC 3U30A 4USAA 1YN3A 2V1YA 1WRDB 3IVFA 2RGFA 1F2RI 2KQ4X 4WAAA 1SIFA 2W3SA 1YOVB 4ANWA 1KH0A 1DOIA 3ZNGC 4J3OD 4RCOA 3HK0A 4LCDE 4JLCA 1TKEA 3A4SC 4DDGD 3RI7C 2ZJDA 1EU4A 2G1EA 2NVUI 1TTNA 2NS5A 1FRRA 1UGMA 4YT0B 2GBMA 3T8MA 3U52E 5IP4D 3NVWA 2QCZA 1RFAA 3RNEC 3R2IA 1V6EA 5G5GA 4W9DA 4JWUC 3ML8A 5LXIB 2BYEA 3N20C 4NAWA 2KX3A 2KDIA 4MACA 4GMVA 3VUYA 1RFKA 1TS3A 4XC2A 4IM3A 1YNTE 2LVPA 2LJIA 1YQ3B 2BB5A 3Q3FA 3K9PB 3ZYYX 1L0XB 2I1KA 3HHMA 4P16A 1SE2A 1SB3C 3O13A 3O65B 1TY0A 2MQJA 3RFZB 3CSFA 1WR6E 4XE0A 4ANVA 1JWSD 3DVNV 2N7JA 1YMHE 1AARA 2VRRB 2ZW0A 1S3SG 4FLHA 1YJJA 3EHVA 2KFJA 3CF6E 2FNJB 3KH0A 4YL8A 1FM0D 1V1OA 2M0XA 4J6IA 1XEEA 4RGTA 1EF5A 2V0GA 5FK9C 1V1PA 3ZO5B 1N5XA 3ONSA 3Q8CA 4MDKE 2L00B 4DXFA 3MJWA 3ZNZB 4K1RB 3VVWB 1VDVA 2RDHA 3P2BA 4HJKA 1MG8A 2CU1A 3QAQA 4KX6B 4NJCA 3W1SA 2R2OA 5EE0A 3GB1A 4XGAB 4W9JA 1TZ1A 1SBBB 3PLVA 1EWCA 1CJEA 2KN5A 4JX1C 2ZVOA 5BMHA 4OVUA 3CMMB 4GIVA 3SR6A 4FULA 1IPGA 4RFBA 3Q8BA 2XK5B 1N63A 2M4NA 1MPEA 2OOBB 2FAZA 1N60A 4LK0M 1JWMD 1QKZA 1MHHE 4A3PA 1KLVA 2K8BA 4XX5A 3V3XA 1M94A 2J53A 1QLBB 5CHFA 3AE2B 3VH3B 2KOXA 2MJDA 3ZUNA 3ECIA 3EFUA 3MC0B 2K0PA 2BBCA 3KWVA 2DZMA 2MRPA 2EKIA 3AEDB 2NBWB 2L52A 4B95A 1YJIA 3DOWA 1NI3A 2KX0A 2ZPYA 2FCSA 3ZRCA 2KWUB 3TL5A 3GE3C 3ZKJC 2V3PA 1QOGA 4IDIA 3TJPA 1RYJA 2WS3B 4CYEA 4TSSA 1KJTA 3VR9B 1OTRB 1WM2A 4GDKA 1CMXB 4ANXA 3Q69A 1XLNA 2CKHB 2GBJA 2KFKB 3TCAA 4KKJA 5J2RA 2DZJA 4LNKA 2D2QA 2IBIB 3RYTA 2QEJC 1F0ZA 2WU5B 4C4VA 3NVVA 1OFFA 2TSSA 3AE9B 2N9PC 1ZXHA 2INNE 1SXTA 2REXA 1PYWD 4HXDA 2JU6X 1I4QA 3TEXA 2RDBC 2Z0EB 2N1WA 1GUAB 1FNVA 2CJNA 2IO2B 4MSMB 2QDFA 2L0FA 4MJSB 2KANA 3K9OB 2MCNB 3ALBA 4WJNA 5TSSA 4NAWB 2AL3A 3PRPB 5D7GA 2CS4A 4EE2A 1WZ0A 1IBXB 1V2YA 3QJZA 1SF0A 3ZTDA 4BAXA 3DBSA 4A90A 3NZUA 4A3OA 2LRUA 1RLFA 3PZDA 3PTFC 1J8CA 1Q10A 1CZPA 1UUPA 3NVYA 1H8CA 3M3JA 4MT5A 2MSED 3TIXA 3QA8A 2NPTB 3NZSA 2KACA 4GU2A 4TMAB 1Y56A 3RNAC 2AYOB 3RMKC 2NBVB 2BS4B 1C9FA 3UIOB 1D6EC 2BS3B 3N3KB 2PLPA 3VRBB 3ZQ4A 3Q8AA 4EFOA 1TS2A 2MX2A 1TIFA 2QILA 3P1MA 1R7SA 4XYCA 2A5UA 2UU7A 4FJYA 4ZRJA 4BKSD 1WYGA 4HK2A 2O6VB 1XXGA 2AQ1B 2M1MA 3GZNI 2X38A 2JZPA 4JQWC 2C9WB 4M01A 2Z8LA 5BMIA 3CWIA 5DPRA 4M8NA 2JX5A 3FILB 3DDCB 2AWTA 4TQ1A 1N6ZA 2WDRB 4G0NB 1AN8A 1I35A 4I6NB 2INCC 1VLBA 1WJUA 1UBIA 2WXOA 1GPXA 3MFGA 1WGYA 4WWOA 2PVGC 2ACZB 1UD7A 3KYDD 2N9KA 3ZXRA 5KHQA 2CR5A 3SU8X 4HDQA 1L4ZB 3HIZA 1WGDA 2WLBA 2ONQA 5AZHA 4KV2A 2N7DA 3ZNID 2DZIA 4G3XB 3HVDA 3QK0A 3DPDA 4B6WA 1ET6A 4P6VF 5D94A 1R4MI 4ZYNA 3W5UB 2CHWA 4DBGA 4W9IA 2BTEA 4M00A 3U4EG 2KHWB 2I2YA 3P4RB 3DCGA 1X1MA 3KUCB 4WWMA 1KLUD 3P4PB 1LFDA 3A9JB 1QT9A 3QCAA 3L13A 1YX5B 4F1SA 3WAPA 2RMMA 1YN4A 4X57B 3AV8A 2VH2A 4LNFA 2J0MA 2XN9C 2DYMA 1NENB 1EU3A 2SEBD 4BKSA 2QIEB 5DPWA 1WJNA 5IOIA 3JYUA 4P1CC 2KDMA 4M0WA 1RM6C 4GLSC 4XWTA 3PHWB 1I4GA 3ML9A 2BWES 2D3CA 1UZXB 4GDLB 3PLUA 2VZKD 4II3B 2KN4A 1XCQL 2AQ2B 2OJRA 4HPMB 2J0KA 2KLGA 2K22A 1P0RA 3IG3A 1XO3A 3AE4B 2AX5A 1OEYA 1DYQA 1D4BA 3A33B 2E3TA 2V9HA 3DHIC 2KWCA 4RF1A 3VDZA 1MVKA 2BYFA 4BBNC 3NZ3A 1OQQA 1QILA 3AMZA 3AM9A 4N59A 3GOEA 1BUIC 1SSNA 3LYYA 2BQQA 4XZ4A 1N62A 1WGHA 1WI0A 5FR6A 2CU3A 1UWXA 3OWEB 3OAWA 2MHJA 4FBJB 1GOZA 3RZWC 1WX7A 1ET9A 3ZGZA 2K8HA 1P98A 5E6PA 3OJ3A 1WMHA 3HVZA 1FCLA 4UDUC 1TY2A 3DWGC 3LB8C 2M19A 3B2FA 4MELA 3L16A 3U8ZA 2MBEA 2QMTA 2DAFA 3AE5B 2VH1A 4AOFA 1E7PB 3N32A 4HVBA 2LXCA 1FIQA 4MGIE 3BVMA 3AXCA 4OW0A 3N1XC 3GS2A 2FUHB 3DBRB 4ARIA 1WR1A 1MFWA 2EMSA 1FD6A 1J0GA 3P4SB 2DYBA 2KQSA 2WX0A 5HKHA 3ETRA 3KUZA 3RPFC 3R2TA 2L7RA 3C8YA 3BVGA 5J18A 3Q2AC 3S2AA 3WIMA 2M8SA 2DX5B 2INDC 4DHJB 4TKNA 3FKYA 4DHZE 3ZLZA 3AEGB 2I38A 3VRAB 3DBHB 2KKCA 1TJEA 2J7QB 2KC2A 3NOBA 4K7WA 4LLGM 4WJOA 2L32A 2PVOD 5BYSA 4MGKE 4MM3A 2EKEC 1IP9A 2HJ8A 2WXLA 2YEPB 3KVFB 1V97A 3KW5B 3AH7A 4KDLB 4FXCA 2K25A 1G6JA 1S1QB 4RNAA 1ESFA 4PS8A 1NVID 4HDOA 4C7YA 1YJ1A 1E90A 3CSTA 3HM6X 3QIJA 2J4XA 2K39A 2E6XA 4FADA 1WZ3A 1MJDA 1ZOYB 5C1ZA 3BYYB 3DHHC 4DWFA 2NBUA 1HTQA 3AI5A 3VH4B 1VRAB 1PFDA 1FEHA 2DZKA 2BKFA 2KTRA 3EFCA 1Q0WB 3B2GA 4KIKB 2PE6B 1GB1A 1WX9A 2WXNA 3H7SA 1TGZB 1WF9A 3PV1A 4M0WB 1VR9A 1L6UA 2KFKA 3URYA 4LDTD 5D3IB 4ANUA 2AQ3B 2KJHB 4KGRA 3APCA 3DBRI 3HRDD 3Q14C 4OVVA 2IZVB 5IKCM 1NI2A 3MJ5A 1UH6A 2ZCCA 1L0VB 1KFYB 1E8ZA 1E7UA 1XF5L 4IM0A 5H8YE 5D2MB 3I63C 1U4AA 1UELA 1DGJA 1C4AA 3DHGC 2N0SB 1K8RB 5JH5C 2YEPF 3EC8A 4RGMA 5JHAA 3R3MA 3A1QB 4QAYA 4FJZA 4W9EA 2KDEB 3GZNB 1K51A 1B9RA 2OEDA 1XCTL 2MWSB 2LUEA 3I3TB 4YWGG 4BVUC 2M17A 4IOIE 1UWMA 3L4PA 3DWMA 3KUDB 1L2NA 3AE8B 4FJVB 2EELA 4DHJD 1NDDA 2ICIA 2ZEQA 3TEWA 3QC8B 1ZDVA 1LXDA 4IWQA 1FCCC 4EZJA 1J7BA 1QZEA 3AE6B 4XDCA 4ZRPA 1IGCA 5JHBA 1P1AA 1WXQA 3BZDB 1WIAA 2GBKA 2PPHA 4I6PA 2BF8B 1E6EB 3RNBC 3X0WA 3L08A 3AEBB 2PMVA 3BK1A 1R4MB 1IBXA 1V1PB 4LNOA 1V5TA 2LRWA 2GI9A 2KXJA 4S0RA 3QQ8B 5EE3A 4KIKA 1FRDA 1WRIA 2N9EB 3VAWA 3OJ4B 4HCPB 2PE9A 1VZ6A 5FR3A 3V6CB 2JY6A 4LNNA 4IM2A 5H92C 4A9AA 4IG7B 4LNIA 5TR5A 4BKGA 2JVCA 5MPOA 1ZDXA 3A9JA 3EECA 1ZUD2 1QQRA 2LWPA 4YSXB 4OHJA 3NY5A 3EA6A 2LASA 1P9DU 4MGZE 4NQKE 1FNWA 3MTNB 2LGSA 4IW0A 2ZNVC 5C23A 1YQBA 2IJ0A 4REZA 2PKOA 2WXGA 4L1BA 1WE7A 2N9LA 3W9CB 3D32A 2C60A 1Y8RC 3PSEB 2C7HA 2VZKB 4IC7B 2Y5PA 4L2YA 2K5PA 4IWOA 4W9GA 1WM3A 2M0AA 3EGRA 1F2RC 3WA0A 2LMCA 2G45B 1QF6A 5CX3A 4FA6A 3R7RA 2FBWB 2DLBA 2JRHA 5IA7A 2MW5A 1FXIA 4ARCA 1B1ZA 5LXHA 1D5ZC 2AEHA 2DENB 3W5VB 1WMHB 1EF1A 3QWZB 2WDVB 2BGFA 2MBOA 1C1YB 2K1FA 1XT9B 3ZJVA 3IAM1 4NZLB 4JIOU 2HDEA 1VZ7A 4BBNF 4EZLA 4LJPB 2FCNA 3OG5A 5BYRA 4BKTA 2LZ6A 2W9NA 2KVZA 4MEMA 2O2VB 3VFKA 4KKIA 4TV3A 2WXFA 2PIAA 4OZBA 5AEKB 1T6BX 5FKAC 4JGHB 3WANA 1OQRA 1EWYC 2IO1B 2ZZPB 1I4PA 2ASQA 2MJ3A 4ZHOA 2D5GA 4HPLB 3I5JC 4GOCA 3C19A 1WGGA 4HROA 5DPTA 2WX1A 3RN9C 3PS6A 1V8CA 4YTMB 5GMVA 2QC8A 1TYGB 2J52A 2KWDA 2G9HD 2IO3B 2J42A 2GB1A 2Q5WD
chains in the Genus database with same CATH topology
3B2FA 4WH4A 4H2AA 3IAS1 3ZYYX 2WU2B 2LHEA 3BIID 2QMTA 2Y5CA 1L0XB 2WXMA 3SFEB 4P16A 1SE2A 2BT6A 1SB3C 3O13A 3AE5B 1RWSA 1TY0A 1SE3A 2M56B 3IT4B 3TUOA 1E7PB 2WXHA 5C3JB 3RFZB 1FIQA 1UGJA 2MJEA 1JWSD 4XE0A 3BVMA 2N7JA 1YMHE 4OW0A 4ZOHC 3GS2A 2ZW0A 1XLPA 4B0MA 4ARIA 2LEKA 4RF0A 1YJJA 2DWQA 2JSVX 1WGKA 4NAMA 1AWDA 2W82A 1YQ4B 2MH7A 3GP7A 1TKYA 1FD6A 1N5WA 1I4XA 3P4SB 1FM0D 1V1OA 4A8XC 3TEZA 1XEEA 3Q8EA 4RGTA 3ETRA 2V0GA 1SEBD 5FK9C 1V1PA 2GRIA 3KQ4A 3RPFC 4PT5A 3R2TA 1N5XA 2WNMA 3C8YA 3Q8CA 3BVGA 1BMLC 1TS5A 1N61A 1BXTA 4DXFA 5HHDG 2CJOA 1KRHA 2W3RA 2WXKA 1VDVA 2W54A 2RDHA 1JROA 4ITKA 3AEGB 2FUG1 2I38A 5EE1A 2R61A 3VRAB 4KX6B 1TJEA 1P7FA 1HZ5A 3UI3A 3TEYA 4NJCA 2WXIA 3W1SA 4CQNA 1ROEA 1HEZE 3AEAB 5EE0A 3GB1A 1K50A 4XDDA 1DOYA 3AE1B 1SBBB 2V3NA 4LLGM 1EWCA 1GB4A 3NS1A 2L32A 1CJEA 2KAJA 1NEKB 4JX1C 1L0YB 3NVZA 2BB6A 2PVOD 2XNAC 5BYSA 1VZ8A 5BMHA 2WXLA 2YEPB 3BK2A 1V97A 4HRSA 1I4RA 3SR6A 4RFBA 3Q8BA 1N63A 1SE4A 3AH7A 1MPEA 4OZAA 4FXCA 3H8HA 1N60A 2KMMA 4RNAA 4LK0M 1ESFA 3PZ8A 1JWMD 1QKZA 5E6JA 1MHHE 1NVID 4YTNB 4C7YA 1E0ZA 3V3XA 4C56C 2J4XA 2J53A 1IUEA 4KGTA 2E6XA 1QLBB 1T5XD 3AE2B 1F77A 4WQMA 2MJDA 1SJED 1UNSA 4IKGA 1ZOYB 3EUB2 3BYYB 3MC0B 1C4PA 2K0PA 1VRAB 1PFDA 1FEHA 1JWBD 4JWSC 2BBCA 3R8BA 5C2TB 2BYTA 1XLQA 1K52A 3KWVA 4B0EA 3T3NA 2EKIA 3AEDB 2L52A 3B2GA 1YJIA 1GB1A 2QSDA 1NI3A 2OHFA 4LTUA 4N58A 4A6QA 1IGDA 2WXNA 1XLOA 2V3PA 3P4QB 2IGDA 3ZJTA 1VR9A 1QOGA 4IDIA 3I57A 1LO5D 1L6UA 1SJHD 3URYA 5D3IB 1RYJA 2LGIA 2WS3B 3SEBA 1JCKB 1L4DB 1PUTA 3AE7B 4TSSA 3TSSA 4RGOS 4C7ZA 3VR9B 3PO0A 2BS2B 4N6EB 2AQ3B 4KGRA 4DQOC 1FMAD 3Q69A 1XLNA 3HRDD 1JW9D 2ZW1A 4KKJA 2WXPA 3MP9A 1JWUD 3SFDB 2L83A 3MJ5A 3AEFB 1CQVA 2QEJC 1L0VB 4YSYB 1KFYB 1F0ZA 2WU5B 1XF5L 1OFFA 3NVVA 2TSSA 3AE9B 2LUMA 1ZXHA 5H8YE 2INNE 1QOFA 2LFIA 1SXTA 1PGBA 1PYWD 3NRZA 2JU6X 1DOXA 1DGJA 1I4QA 3TEXA 1C4AA 2IGHA 5BYQA 2N0SB 1ACCA 1JRPA 1FNUA 1FNVA 3NUHB 2CJNA 3BVZA 3LXFA 1MI0A 3AB5A 2FE8A 2JXTA 2YEPF 1C4CA 4RGMA 2H88B 2PTLA 5HG2A 3HUIA 5TSSA 1TS4A 1WWTA 4NAWB 1FO4A 4JPSA 1K51A 1B9RA 5D7GA 2OEDA 1XCTL 4EE2A 2B76B 4YWGG 1IBXB 1QOBA 1SF0A 4IOIE 1UWMA 2K9XA 3L4PA 5EE9A 5AUKA 3DWMA 4A90A 2NTSA 1CK1A 3AE8B 3AE3B 1AW7A 1I4HA 4C80A 4ZYSA 2EELA 2ICIA 4A55A 3TEWA 4YXDB 1Q10A 1ZDVA 1CZPA 1UUPA 3NVYA 3P42A 5JXVA 1FCCC 5T8IA 1J7BA 4MT5A 1ZP0B 1HZ6A 4R3DA 3AE6B 4XDCA 4ZRPA 2JWUA 1IGCA 1ZPSA 1I7HA 2KACA 1T3QA 4TMAB 2MEKA 1PGAA 1E10A 1Y56A 1WXQA 3BZDB 1TKGA 2BS4B 1MHXA 1C9FA 1E6EB 1KLGD 1D6EC 5AUIA 2JYEA 2BS3B 1J7AA 1KF6B 1NYRA 1PDXA 5BMGA 3AEBB 2PMVA 3BK1A 1KTKA 2W55A 3Q8FA 2PLPA 3U7ZA 3VRBB 1HXYD 1V1PB 4TQ0A 1IBXA 2V4IB 4WIPA 3ZQ4A 1C78A 3Q8AA 3ZJUA 1TS2A 2GI9A 1TZOA 4YTPB 2QILA 3P1MA 5GXGB 1R7SA 1WSPA 5EE3A 4MH8A 1FRDA 1WRIA 1JALA 1WYGA 4WAFA 1D5MC 1XXGA 4AS1A 3KWLA 2AQ1B 1VJKA 2DYOA 1C79A 2ON8A 2X38A 2JZPA 2PW9A 2IGGA 2Z8LA 4RGNA 5BMIA 4L23A 3CWIA 2WXJA 1YN5A 1EM7A 1VZ6A 5FR3A 2WDQB 3IT6B 3IXSA 2JX5A 1HA5A 5H92C 4A9AA 2RDGA 3FILB 4HKQA 4TQ1A 2WDRB 5MPOA 1AN8A 1ZDXA 2INPE 1NYQA 1A70A 1VLBA 2K3UA 4HJGE 1ZUD2 2WP9B 5G5HA 1QQRA 2WXOA 4YSXB 1GPXA 4OHJA 3MFGA 3VR8B 2DBYA 2PVGC 2ACZB 3EA6A 4DXGA 2Y3AA 1FXAA 2SAKA 1E9MA 1FNWA 2HTME 2N9KA 2IDYA 1SIJA 3ABVB 1L4ZB 2WLBA 4GDKB 1JMLA 2M19A 1GAQB 2ONQA 2WQYB 2IJ0A 4REZA 3AN1A 2PKOA 2WXGA 1PGXA 3BWUD 3N9YC 2JQRB 4L1BA 4OZCA 3HVDA 3J9CA 2N9LA 3W9CB 1ET6A 4P6VF 4US8A 1QOAA 2QJLA 4JE3B 5LNK1 2BW2A 3W5UB 3VQIA 4XWWA 2BTEA 3U4EG 3KLSX 2VZKB 2I2YA 3P4RB 4US9A 3E9SA 2Y5PA 4L2YA 4YSZB 2K5PA 4WWMA 1C77A 3AEEB 3FILA 1KLUD 3P4PB 4AQ7A 3FAHA 1QT9A 2NTTA 2M0AA 4D2KA 2IPKD 3EGRA 1F2RC 2RMMA 1YN4A 2LMCA 4OVZA 1L5PA 3T3OA 3AV8A 2LHDA 1ZXIA 1QF6A 1JWAD 1HQRD 2FBWB 2DLBA 1ZE3D 1FFUA 2JYTA 2XN9C 1FXIA 2DYMA 3AECB 1NENB 4ARCA 1B1ZA 1EU3A 2L1AA 2SEBD 1D5ZC 1J7CA 3WCQA 3U2SC 2QIEB 3W5VB 1K53A 1L6VA 2KDMA 4M0WA 4WURA 4HKZE 1RM6C 2WDVB 3I9V1 4GLSC 1YN3A 4USAA 4XWTA 1I4GA 2WXQA 3IAM1 3ZJVA 4MM3B 4GDLB 4NZLB 2VZKD 1P7EA 1F2RI 2KN4A 2KQ4X 1XCQL 2AQ2B 2HDEA 3B9JA 3P63A 2W3SA 1FFVA 5D3DA 2K22A 1VZ7A 3BYTB 3FC4A 4Q2JA 3W2DA 1KH0A 1DOIA 5BYRA 1XO3A 4J3OD 3AE4B 2RPVA 3V05A 4RCOA 2AX5A 4KKIA 3CIRB 1JQ4A 1DYQA 1TKEA 3MHZA 1D4BA 4RH6A 3E56A 4HEA1 2WXFA 2PIAA 3PZ7A 4OZBA 2E3TA 1EU4A 1T6BX 2G1EA 2H89B 5FKAC 2WXRA 1FRRA 1M4VA 4RF1A 1OQRA 1EWYC 1MVKA 3NZ3A 1OQQA 4YT0B 4ZRQA 5I4DA 3U52E 1QILA 1I4PA 2MJ3A 4ZHOA 1ENFA 1C76A 3AMZA 2D5GA 3AM9A 3NVWA 4N59A 1BUIC 1SSNA 3LYYA 4HROA 3R2IA 5HI1A 2NMQA 1N62A 5G5GA 4KGSA 4ZHPA 4JWUC 4O1NA 1V8CA 4YTMB 2CU3A 1AYFA 1UWXA 3OWEB 1TYGB 5HFYA 1GOZA 2J52A 1D5XC 2KWDA 2G9HD 4MACA 1ET9A 3ZGZA 1RFKA 2J42A 1TS3A 3HVZA 1YNTE 2GB1A 1FCLA 1STEA 2LJIA 1TY2A 2Q5WD 3DWGC 3LB8C 1YQ3B 2BB5A 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKG A;  4WH4 A;  2I2Y A;  1Q10 A;  2LHE A;  2QMT A;  5JXV A;  1FCC C;  3FIL A;  2K0P A;  1K52 A;  2JWU A;  4D2K A;  1IGC A;  1F2R C;  2KAC A;  2RMM A;  1GB1 A;  2QSD A;  2N7J A;  1YMH E;  1IGD A;  2LHD A;  1PGA A;  2ZW0 A;  2IGD A;  2JSV X;  1MHX A;  1C9F A;  5BMG A;  1FD6 A;  1IBX A;  2LGI A;  2PLP A;  1K53 A;  2KDM A;  4HKZ E;  4KGR A;  2GI9 A;  4GLS C;  2ZW1 A;  3MP9 A;  1P7E A;  1F2R I;  2KN4 A;  2KQ4 X;  1XCQ L;  5HHD G;  1KH0 A;  2ON8 A;  2JZP A;  1XF5 L;  2PW9 A;  2IGG A;  2RPV A;  5BMI A;  2I38 A;  2LUM A;  1ZXH A;  1EM7 A;  1D4B A;  1PGB A;  4OZB A;  2JU6 X;  1P7F A;  1HZ5 A;  3FIL B;  3UI3 A;  2IGH A;  1HEZ E;  3GB1 A;  1K50 A;  1MVK A;  4HJG E;  1MI0 A;  2JXT A;  1GB4 A;  2PTL A;  5HG2 A;  5BMH A;  5HI1 A;  2N9K A;  2NMQ A;  4KGS A;  1K51 A;  1JML A;  1MPE A;  1XCT L;  2OED A;  4OZA A;  2ONQ A;  1UWX A;  1IBX B;  1PGX A;  4IOI E;  1QKZ A;  1MHH E;  5HFY A;  2J52 A;  4OZC A;  2KWD A;  4MAC A;  2N9L A;  3V3X A;  2J53 A;  4KGT A;  1YNT E;  2GB1 A;  1FCL A;  2EEL A;  1HZ6 A; 
#chains in the Genus database with same CATH topology
 2KT7 A;  2CHX A;  4WH4 A;  4H2A A;  3IAS 1;  3LJ3 A;  2LHE A;  5AZF A;  3BII D;  2Y5C A;  4MJS A;  3SFE B;  1F1H A;  2BT6 A;  4GGQ A;  2IYD B;  5IO9 A;  2M56 B;  3IT4 B;  3NHE B;  4FHJ A;  2WXH A;  2BWF A;  3AUL A;  4PK1 A;  1R4N B;  1UGJ A;  2MJE A;  2YLM A;  4ZOH C;  5EDS A;  2Z59 B;  4B0M A;  2LEK A;  4RF0 A;  1WYW B;  1F9J A;  2DWQ A;  2JSV X;  4PYZ A;  1T0S C;  4NAM A;  1AWD A;  2W82 A;  1YQ4 B;  2MH7 A;  3GP7 A;  1TKY A;  1N5W A;  1E7V A;  1I4X A;  4EZK A;  3IHP C;  2K6D B;  2L8J A;  4A8X C;  3TEZ A;  3Q8E A;  3RNC C;  2WYQ A;  2LVQ A;  3KQ4 A;  4PT5 A;  2WNM A;  2JZZ A;  1FPY A;  1BML C;  1TS5 A;  3Q3J A;  1N61 A;  2CJO A;  1KRH A;  2WXK A;  4TUU A;  4ITK A;  1HTO A;  4IWP A;  1HE8 A;  1P7F A;  3L10 B;  1HZ5 A;  2O2V A;  2OJW A;  1ROE A;  3AEA B;  1DOY A;  1T0Y A;  3AE1 B;  2KLC A;  1NEK B;  1L0Y B;  1C3T A;  3NVZ A;  2BB6 A;  3VTU A;  2XNA C;  1ZKH A;  2KTF A;  3ZXV A;  5D6J B;  4ICU A;  4AJY B;  1LGR A;  2KD0 A;  2IY1 B;  2KC1 A;  4OZA A;  3H8H A;  3PZ8 A;  4YTN B;  2XEW A;  2GBR A;  1E8Y A;  4KGT A;  3N1Z C;  1GC6 A;  3V60 A;  4PYU A;  4WQM A;  4E74 A;  1SJE D;  4BFR A;  4IKG A;  4BOS C;  2RPQ A;  1WXA A;  4MSQ B;  1P3Q U;  3ZDT A;  4K7S A;  3H6N A;  1XLQ A;  1K52 A;  2BYT A;  5CHW A;  3T3N A;  3H1U A;  2PJH A;  2HJ1 A;  2KQ7 A;  2QSD A;  2C5L C;  2KDB A;  4WWP A;  1V80 A;  3C0R B;  4HPP A;  3ZJT A;  2D3A A;  1SJH D;  4S17 A;  2LGI A;  1JCK B;  1WXV A;  3AE7 B;  4RGO S;  4C7Z A;  3RNF C;  3PO0 A;  2BS2 B;  3M95 A;  3R7Q A;  1ZGU B;  4LJO B;  4DQO C;  2RSU A;  1JW9 D;  2KJ6 A;  1WJ4 A;  3TBL D;  3MP9 A;  3LDZ E;  1R4N I;  3SFD B;  2GMI C;  4YSY B;  1JRU A;  2DNF A;  4E3C A;  3N30 A;  3GE8 C;  4GN1 A;  4RM9 A;  4EEW A;  2LFI A;  3IBE A;  2EMT A;  3ZTC A;  1PGB A;  3NRZ A;  5KHO A;  2JUO A;  5BYQ A;  4C00 A;  1ACC A;  2FIF A;  2JT4 B;  1FNU A;  3NUH B;  4GDL A;  3AB5 A;  3PRZ A;  4M8M A;  2MP2 B;  2JXT A;  1C4C A;  3MHS D;  3W1S C;  2HE7 A;  2PTL A;  1YD8 U;  5HG2 A;  3HUI A;  1TS4 A;  2B76 B;  1QOB A;  2ZNV B;  4EKU A;  3TMP B;  4I6L B;  3PHX B;  1J19 A;  3JW0 X;  3L0W B;  4C80 A;  1AW7 A;  1I4H A;  5JZE B;  4KZ0 A;  2KO3 A;  2BYV E;  4DHZ B;  5J17 A;  1LQB A;  4YXD B;  5JXV A;  2L3Z A;  4BZA A;  5T8I A;  1ZP0 B;  2JWU A;  1OQY A;  2D07 B;  2RD0 A;  1PGA A;  1E10 A;  1RAX A;  3N1Y C;  4FHK A;  2JWZ A;  4K3B A;  2JYE A;  1KF6 B;  1V81 A;  1KTK A;  2JF5 A;  3Q8F A;  4M02 A;  3U7Z A;  4NJ6 A;  2V4I B;  2MLB A;  4WIP A;  3ZJU A;  4W9L A;  1UF0 A;  2JPH A;  1TZO A;  4YTP B;  5GXG B;  2KZR A;  2X8X X;  1WSP A;  2K6Q A;  4WAF A;  4AS1 A;  3KWL A;  2I1J A;  2DYO A;  2ON8 A;  3T9L A;  2PW9 A;  4KSL C;  4AWJ A;  4ZRI A;  1YN5 A;  2WDQ B;  1YX6 B;  3IT6 B;  2O6V A;  1HA5 A;  5LLI A;  4RMA A;  2G3Q B;  1NYQ A;  4KSK C;  1Q1O A;  2K3U A;  5G5H A;  1KOT A;  4HLE A;  3PRM B;  3VR8 B;  3BY4 B;  2DBY A;  2JXX A;  3SD5 A;  1FXA A;  2SAK A;  1WXS A;  4IUM B;  1FXT B;  2HTM E;  4DK5 A;  1SIJ A;  4ACF A;  2KMC A;  2WQY B;  3AN1 A;  3NS8 A;  1H4R A;  2JQR B;  4OZC A;  2LI5 A;  3WAM A;  2R2Q A;  3W1Y A;  3JVZ X;  1Z2M A;  2QJL A;  4JE3 B;  5LNK 1;  2BW2 A;  2D3B A;  4XWW A;  2V4L A;  2UWQ A;  3KLS X;  2PEA A;  4KVG B;  4US9 A;  5AZG A;  4YSZ B;  3PRE A;  1WXM A;  2KTR B;  4AP4 C;  3NG0 A;  2RR9 A;  4AQ7 A;  2NTT A;  3Q3O C;  3T3O A;  1XQQ A;  2N4F A;  2G4D B;  2LHD A;  1ZXI A;  1UBQ A;  1JWA D;  2GOW A;  3DQV A;  3RCZ A;  4N9F 4;  2JYT A;  3JSV A;  2L1A A;  1J7C A;  3APF A;  2ZCB A;  4GB9 A;  3RT3 B;  1K53 A;  3DVG Y;  2Y5B B;  5G55 A;  4WUR A;  3I9V 1;  3A4R A;  1RRB A;  2WXQ A;  4MM3 B;  3RZF A;  1P7E A;  3DVN U;  3B9J A;  3P63 A;  4K81 A;  1FFV A;  4CHK A;  5E6N A;  5D3D A;  3FC4 A;  4Q2J A;  3BYT B;  3W2D A;  2DAJ A;  2RPV A;  3B0A A;  3R66 C;  3V05 A;  2KDF B;  3CIR B;  1JQ4 A;  3MHZ A;  4RH6 A;  2HD5 B;  3E56 A;  4HEA 1;  2L76 A;  1IYF A;  3PZ7 A;  4LDT B;  3VTW A;  2H89 B;  3QHT A;  2WXR A;  1M4V A;  4MH0 E;  2MBB B;  4ZRQ A;  5I4D A;  2BPS A;  1ENF A;  1C76 A;  2IO0 B;  2LVO A;  2B3A A;  5HI1 A;  2NMQ A;  1V9J A;  2DHZ A;  2QHO A;  4KGS A;  4NJ7 A;  4ZHP A;  4O1N A;  2CHZ A;  1AYF A;  2KK8 A;  1SGH A;  5HFY A;  3A1Q A;  3RUL A;  1D5X C;  3Q3M C;  3DBH I;  3SHQ A;  1SE9 A;  2MBH A;  1VD2 A;  1STE A;  4NY0 A;  2KWV B;  1JWB D;  1HZ6 A;  4W9F A;  4K3C A;  2WU2 B;  3M62 B;  4ASW C;  2WXM A;  1LM8 B;  3RD2 A;  5DPS A;  4PS3 A;  2JZ3 B;  3H9D A;  1RWS A;  5CTR C;  3VUW A;  1SE3 A;  3TUO A;  5C3J B;  3VTV A;  4E71 A;  3V61 A;  4WQO B;  4B9K A;  2K8C A;  3MC9 A;  4KDI C;  1XLP A;  3Q3N C;  4W9C A;  1V49 A;  3A9K A;  4NNJ B;  4F7Z A;  4WJP A;  2C7N B;  1WGK A;  1PQS A;  3PGE A;  1OEY J;  1E8W A;  4HCN B;  4A20 A;  1SEB D;  3A9K B;  2GRI A;  2GBN A;  2JRI B;  3QAR A;  1XD3 B;  5IN7 A;  1BXT A;  5HHD G;  2L0T A;  2W3R A;  2W54 A;  1JRO A;  3U7D A;  2FUG 1;  5EE1 A;  2R61 A;  3UGB B;  1WE6 A;  3IFW B;  3WAL A;  4ZDV A;  3UI3 A;  3TEY A;  2WXI A;  1WH3 A;  4CQN A;  1HEZ E;  1KM7 A;  4XDD A;  1K50 A;  2FCQ A;  2V3N A;  1GB4 A;  3NS1 A;  2KAJ A;  1VZ8 A;  3L54 A;  2L05 A;  2WGS A;  3BK2 A;  4HRS A;  1I4R A;  4WJQ A;  3ZIM A;  3ZW3 A;  3APD A;  1SE4 A;  1Z5S B;  2KMM A;  5E6J A;  2N1V A;  5G2N A;  1E0Z A;  3JSV B;  2BVC A;  4C56 C;  1IUE A;  2WWZ A;  3UIN B;  1T5X D;  2MP2 A;  4P1B C;  3VHT C;  3Q6B A;  1L7Y A;  1F77 A;  1UNS A;  1YIW A;  1T0Q C;  1WY8 A;  3EUB 2;  1E8X A;  5BO4 B;  4PS7 A;  1C4P A;  3SDL C;  4CO7 A;  3MC8 A;  2XBB C;  4DXA B;  1WJ6 A;  4W9K A;  3DBL I;  4JWS C;  5C2T B;  4ZRK A;  3R8B A;  1T0R C;  4B0E A;  1E5W A;  2ZPN A;  2OHF A;  4LTU A;  4N58 A;  4A6Q A;  4JL9 A;  3AU5 A;  1IGD A;  4C4V B;  2HTH A;  2YVC A;  3AU4 A;  1XLO A;  2LXA A;  3PVL A;  3P4Q B;  2IGD A;  4HWI B;  3I57 A;  1LO5 D;  2GLS A;  1I42 A;  2FID A;  3SEB A;  1L4D B;  1ISN A;  1PUT A;  3TSS A;  4N6E B;  2J0J A;  1EO6 A;  1FMA D;  3V62 A;  4BOZ B;  4AJW A;  2ZW1 A;  2WXP A;  1GJZ A;  1JWU D;  2L83 A;  3H7P B;  3AEF B;  1CQV A;  3V6E B;  2KVR A;  2LUM A;  1QOF A;  1OGW A;  2WHI A;  3UIP B;  1V5O A;  1F52 A;  3OLM D;  1DOX A;  1BT0 A;  2IGH A;  3ZVV A;  1JRP A;  2AL6 A;  3BVZ A;  3LXF A;  1MI0 A;  2FE8 A;  2H88 B;  4KZC A;  1D3Z A;  2NR2 A;  4WWN A;  4DDI D;  3WAO A;  1WWT A;  4FN2 A;  1MG4 A;  5E6O A;  1FO4 A;  4JPS A;  1VCB A;  2K9X A;  4GXB A;  2LGY A;  5EE9 A;  1TT5 B;  5AUK A;  5DCN A;  2NTS A;  1CK1 A;  3AE3 B;  2WDT B;  4ZYS A;  3DBL B;  4G11 A;  3B08 A;  2V3S A;  4A55 A;  3ENE A;  3P42 A;  2NPT A;  2D10 A;  4R3D A;  1WFY A;  3ZDM C;  2LGX A;  1ZPS A;  3H7P A;  3KYC D;  2KJR A;  3NJT A;  1I7H A;  3M63 B;  1T3Q A;  2C7M B;  4EUT A;  2BKR B;  2D11 A;  2MEK A;  2UYZ B;  3VUX A;  1ZW7 A;  2KYW A;  1TKG A;  3ZNH B;  3RUI B;  1MHX A;  1KLG D;  5AUI A;  1J7A A;  2O6V D;  1NYR A;  1PDX A;  2N9X A;  2IY0 B;  5BMG A;  2MBQ A;  2W55 A;  4ICV A;  1HXY D;  4W9H A;  2KMA A;  4TQ0 A;  1A5R A;  2ZVN A;  4P7I A;  1C78 A;  3B1L X;  4MH8 A;  1JAL A;  1V86 A;  1D5M C;  2Z0D B;  3HM3 A;  1VJK A;  2NCN A;  3PT2 B;  1C79 A;  2IGG A;  4RM8 A;  4RGN A;  1WX8 A;  4L23 A;  2FCM A;  2WXJ A;  1EM7 A;  3L17 A;  4GSW A;  4URK A;  3IXS A;  2RDG A;  4HKQ A;  3BIN A;  2INP E;  1A70 A;  4AUQ C;  2A4Z A;  4HJG E;  2WP9 B;  1GNU A;  4F8C B;  3VXW A;  1Q5W B;  4EOY A;  4DXG A;  2Y3A A;  2MA9 B;  1E9M A;  2G4S A;  2IDY A;  3DVG X;  3ABV B;  4GDK B;  1JML A;  1GAQ B;  3UQB A;  3BWU D;  1PGX A;  2LD9 A;  3N9Y C;  4II2 B;  1WGR A;  3J9C A;  1GC7 A;  4NPN A;  4US8 A;  3PPA A;  1QOA A;  2LGD A;  3VQI A;  3UQA A;  3RNG C;  5IAA C;  1GG3 A;  2N7E A;  3E9S A;  2KNB A;  1C77 A;  3AEE B;  3FIL A;  1EUV B;  3FAH A;  5L95 C;  4D2K A;  2IPK D;  3ZRF A;  4OVZ A;  1L5P A;  4NQL B;  3UF8 A;  4G50 A;  3X23 A;  5CHV C;  1HQR D;  1ZE3 D;  1FFU A;  3AEC B;  4MGY E;  3WCQ A;  3U2S C;  4K7U A;  2D3G A;  1L6V A;  3QX1 A;  2LJ5 A;  1TBE A;  5L83 A;  2XK5 A;  4HKZ E;  1NBF C;  3U30 A;  4USA A;  1YN3 A;  2V1Y A;  1WRD B;  3IVF A;  2RGF A;  1F2R I;  2KQ4 X;  4WAA A;  1SIF A;  2W3S A;  1YOV B;  4ANW A;  1KH0 A;  1DOI A;  3ZNG C;  4J3O D;  4RCO A;  3HK0 A;  4LCD E;  4JLC A;  1TKE A;  3A4S C;  4DDG D;  3RI7 C;  2ZJD A;  1EU4 A;  2G1E A;  2NVU I;  1TTN A;  2NS5 A;  1FRR A;  1UGM A;  4YT0 B;  2GBM A;  3T8M A;  3U52 E;  5IP4 D;  3NVW A;  2QCZ A;  1RFA A;  3RNE C;  3R2I A;  1V6E A;  5G5G A;  4W9D A;  4JWU C;  3ML8 A;  5LXI B;  2BYE A;  3N20 C;  4NAW A;  2KX3 A;  2KDI A;  4MAC A;  4GMV A;  3VUY A;  1RFK A;  1TS3 A;  4XC2 A;  4IM3 A;  1YNT E;  2LVP A;  2LJI A;  1YQ3 B;  2BB5 A;  3Q3F A;  3K9P B;  3ZYY X;  1L0X B;  2I1K A;  3HHM A;  4P16 A;  1SE2 A;  1SB3 C;  3O13 A;  3O65 B;  1TY0 A;  2MQJ A;  3RFZ B;  3CSF A;  1WR6 E;  4XE0 A;  4ANV A;  1JWS D;  3DVN V;  2N7J A;  1YMH E;  1AAR A;  2VRR B;  2ZW0 A;  1S3S G;  4FLH A;  1YJJ A;  3EHV A;  2KFJ A;  3CF6 E;  2FNJ B;  3KH0 A;  4YL8 A;  1FM0 D;  1V1O A;  2M0X A;  4J6I A;  1XEE A;  4RGT A;  1EF5 A;  2V0G A;  5FK9 C;  1V1P A;  3ZO5 B;  1N5X A;  3ONS A;  3Q8C A;  4MDK E;  2L00 B;  4DXF A;  3MJW A;  3ZNZ B;  4K1R B;  3VVW B;  1VDV A;  2RDH A;  3P2B A;  4HJK A;  1MG8 A;  2CU1 A;  3QAQ A;  4KX6 B;  4NJC A;  3W1S A;  2R2O A;  5EE0 A;  3GB1 A;  4XGA B;  4W9J A;  1TZ1 A;  1SBB B;  3PLV A;  1EWC A;  1CJE A;  2KN5 A;  4JX1 C;  2ZVO A;  5BMH A;  4OVU A;  3CMM B;  4GIV A;  3SR6 A;  4FUL A;  1IPG A;  4RFB A;  3Q8B A;  2XK5 B;  1N63 A;  2M4N A;  1MPE A;  2OOB B;  2FAZ A;  1N60 A;  4LK0 M;  1JWM D;  1QKZ A;  1MHH E;  4A3P A;  1KLV A;  2K8B A;  4XX5 A;  3V3X A;  1M94 A;  2J53 A;  1QLB B;  5CHF A;  3AE2 B;  3VH3 B;  2KOX A;  2MJD A;  3ZUN A;  3ECI A;  3EFU A;  3MC0 B;  2K0P A;  2BBC A;  3KWV A;  2DZM A;  2MRP A;  2EKI A;  3AED B;  2NBW B;  2L52 A;  4B95 A;  1YJI A;  3DOW A;  1NI3 A;  2KX0 A;  2ZPY A;  2FCS A;  3ZRC A;  2KWU B;  3TL5 A;  3GE3 C;  3ZKJ C;  2V3P A;  1QOG A;  4IDI A;  3TJP A;  1RYJ A;  2WS3 B;  4CYE A;  4TSS A;  1KJT A;  3VR9 B;  1OTR B;  1WM2 A;  4GDK A;  1CMX B;  4ANX A;  3Q69 A;  1XLN A;  2CKH B;  2GBJ A;  2KFK B;  3TCA A;  4KKJ A;  5J2R A;  2DZJ A;  4LNK A;  2D2Q A;  2IBI B;  3RYT A;  2QEJ C;  1F0Z A;  2WU5 B;  4C4V A;  3NVV A;  1OFF A;  2TSS A;  3AE9 B;  2N9P C;  1ZXH A;  2INN E;  1SXT A;  2REX A;  1PYW D;  4HXD A;  2JU6 X;  1I4Q A;  3TEX A;  2RDB C;  2Z0E B;  2N1W A;  1GUA B;  1FNV A;  2CJN A;  2IO2 B;  4MSM B;  2QDF A;  2L0F A;  4MJS B;  2KAN A;  3K9O B;  2MCN B;  3ALB A;  4WJN A;  5TSS A;  4NAW B;  2AL3 A;  3PRP B;  5D7G A;  2CS4 A;  4EE2 A;  1WZ0 A;  1IBX B;  1V2Y A;  3QJZ A;  1SF0 A;  3ZTD A;  4BAX A;  3DBS A;  4A90 A;  3NZU A;  4A3O A;  2LRU A;  1RLF A;  3PZD A;  3PTF C;  1J8C A;  1Q10 A;  1CZP A;  1UUP A;  3NVY A;  1H8C A;  3M3J A;  4MT5 A;  2MSE D;  3TIX A;  3QA8 A;  2NPT B;  3NZS A;  2KAC A;  4GU2 A;  4TMA B;  1Y56 A;  3RNA C;  2AYO B;  3RMK C;  2NBV B;  2BS4 B;  1C9F A;  3UIO B;  1D6E C;  2BS3 B;  3N3K B;  2PLP A;  3VRB B;  3ZQ4 A;  3Q8A A;  4EFO A;  1TS2 A;  2MX2 A;  1TIF A;  2QIL A;  3P1M A;  1R7S A;  4XYC A;  2A5U A;  2UU7 A;  4FJY A;  4ZRJ A;  4BKS D;  1WYG A;  4HK2 A;  2O6V B;  1XXG A;  2AQ1 B;  2M1M A;  3GZN I;  2X38 A;  2JZP A;  4JQW C;  2C9W B;  4M01 A;  2Z8L A;  5BMI A;  3CWI A;  5DPR A;  4M8N A;  2JX5 A;  3FIL B;  3DDC B;  2AWT A;  4TQ1 A;  1N6Z A;  2WDR B;  4G0N B;  1AN8 A;  1I35 A;  4I6N B;  2INC C;  1VLB A;  1WJU A;  1UBI A;  2WXO A;  1GPX A;  3MFG A;  1WGY A;  4WWO A;  2PVG C;  2ACZ B;  1UD7 A;  3KYD D;  2N9K A;  3ZXR A;  5KHQ A;  2CR5 A;  3SU8 X;  4HDQ A;  1L4Z B;  3HIZ A;  1WGD A;  2WLB A;  2ONQ A;  5AZH A;  4KV2 A;  2N7D A;  3ZNI D;  2DZI A;  4G3X B;  3HVD A;  3QK0 A;  3DPD A;  4B6W A;  1ET6 A;  4P6V F;  5D94 A;  1R4M I;  4ZYN A;  3W5U B;  2CHW A;  4DBG A;  4W9I A;  2BTE A;  4M00 A;  3U4E G;  2KHW B;  2I2Y A;  3P4R B;  3DCG A;  1X1M A;  3KUC B;  4WWM A;  1KLU D;  3P4P B;  1LFD A;  3A9J B;  1QT9 A;  3QCA A;  3L13 A;  1YX5 B;  4F1S A;  3WAP A;  2RMM A;  1YN4 A;  4X57 B;  3AV8 A;  2VH2 A;  4LNF A;  2J0M A;  2XN9 C;  2DYM A;  1NEN B;  1EU3 A;  2SEB D;  4BKS A;  2QIE B;  5DPW A;  1WJN A;  5IOI A;  3JYU A;  4P1C C;  2KDM A;  4M0W A;  1RM6 C;  4GLS C;  4XWT A;  3PHW B;  1I4G A;  3ML9 A;  2BWE S;  2D3C A;  1UZX B;  4GDL B;  3PLU A;  2VZK D;  4II3 B;  2KN4 A;  1XCQ L;  2AQ2 B;  2OJR A;  4HPM B;  2J0K A;  2KLG A;  2K22 A;  1P0R A;  3IG3 A;  1XO3 A;  3AE4 B;  2AX5 A;  1OEY A;  1DYQ A;  1D4B A;  3A33 B;  2E3T A;  2V9H A;  3DHI C;  2KWC A;  4RF1 A;  3VDZ A;  1MVK A;  2BYF A;  4BBN C;  3NZ3 A;  1OQQ A;  1QIL A;  3AMZ A;  3AM9 A;  4N59 A;  3GOE A;  1BUI C;  1SSN A;  3LYY A;  2BQQ A;  4XZ4 A;  1N62 A;  1WGH A;  1WI0 A;  5FR6 A;  2CU3 A;  1UWX A;  3OWE B;  3OAW A;  2MHJ A;  4FBJ B;  1GOZ A;  3RZW C;  1WX7 A;  1ET9 A;  3ZGZ A;  2K8H A;  1P98 A;  5E6P A;  3OJ3 A;  1WMH A;  3HVZ A;  1FCL A;  4UDU C;  1TY2 A;  3DWG C;  3LB8 C;  2M19 A;  3B2F A;  4MEL A;  3L16 A;  3U8Z A;  2MBE A;  2QMT A;  2DAF A;  3AE5 B;  2VH1 A;  4AOF A;  1E7P B;  3N32 A;  4HVB A;  2LXC A;  1FIQ A;  4MGI E;  3BVM A;  3AXC A;  4OW0 A;  3N1X C;  3GS2 A;  2FUH B;  3DBR B;  4ARI A;  1WR1 A;  1MFW A;  2EMS A;  1FD6 A;  1J0G A;  3P4S B;  2DYB A;  2KQS A;  2WX0 A;  5HKH A;  3ETR A;  3KUZ A;  3RPF C;  3R2T A;  2L7R A;  3C8Y A;  3BVG A;  5J18 A;  3Q2A C;  3S2A A;  3WIM A;  2M8S A;  2DX5 B;  2IND C;  4DHJ B;  4TKN A;  3FKY A;  4DHZ E;  3ZLZ A;  3AEG B;  2I38 A;  3VRA B;  3DBH B;  2KKC A;  1TJE A;  2J7Q B;  2KC2 A;  3NOB A;  4K7W A;  4LLG M;  4WJO A;  2L32 A;  2PVO D;  5BYS A;  4MGK E;  4MM3 A;  2EKE C;  1IP9 A;  2HJ8 A;  2WXL A;  2YEP B;  3KVF B;  1V97 A;  3KW5 B;  3AH7 A;  4KDL B;  4FXC A;  2K25 A;  1G6J A;  1S1Q B;  4RNA A;  1ESF A;  4PS8 A;  1NVI D;  4HDO A;  4C7Y A;  1YJ1 A;  1E90 A;  3CST A;  3HM6 X;  3QIJ A;  2J4X A;  2K39 A;  2E6X A;  4FAD A;  1WZ3 A;  1MJD A;  1ZOY B;  5C1Z A;  3BYY B;  3DHH C;  4DWF A;  2NBU A;  1HTQ A;  3AI5 A;  3VH4 B;  1VRA B;  1PFD A;  1FEH A;  2DZK A;  2BKF A;  2KTR A;  3EFC A;  1Q0W B;  3B2G A;  4KIK B;  2PE6 B;  1GB1 A;  1WX9 A;  2WXN A;  3H7S A;  1TGZ B;  1WF9 A;  3PV1 A;  4M0W B;  1VR9 A;  1L6U A;  2KFK A;  3URY A;  4LDT D;  5D3I B;  4ANU A;  2AQ3 B;  2KJH B;  4KGR A;  3APC A;  3DBR I;  3HRD D;  3Q14 C;  4OVV A;  2IZV B;  5IKC M;  1NI2 A;  3MJ5 A;  1UH6 A;  2ZCC A;  1L0V B;  1KFY B;  1E8Z A;  1E7U A;  1XF5 L;  4IM0 A;  5H8Y E;  5D2M B;  3I63 C;  1U4A A;  1UEL A;  1DGJ A;  1C4A A;  3DHG C;  2N0S B;  1K8R B;  5JH5 C;  2YEP F;  3EC8 A;  4RGM A;  5JHA A;  3R3M A;  3A1Q B;  4QAY A;  4FJZ A;  4W9E A;  2KDE B;  3GZN B;  1K51 A;  1B9R A;  2OED A;  1XCT L;  2MWS B;  2LUE A;  3I3T B;  4YWG G;  4BVU C;  2M17 A;  4IOI E;  1UWM A;  3L4P A;  3DWM A;  3KUD B;  1L2N A;  3AE8 B;  4FJV B;  2EEL A;  4DHJ D;  1NDD A;  2ICI A;  2ZEQ A;  3TEW A;  3QC8 B;  1ZDV A;  1LXD A;  4IWQ A;  1FCC C;  4EZJ A;  1J7B A;  1QZE A;  3AE6 B;  4XDC A;  4ZRP A;  1IGC A;  5JHB A;  1P1A A;  1WXQ A;  3BZD B;  1WIA A;  2GBK A;  2PPH A;  4I6P A;  2BF8 B;  1E6E B;  3RNB C;  3X0W A;  3L08 A;  3AEB B;  2PMV A;  3BK1 A;  1R4M B;  1IBX A;  1V1P B;  4LNO A;  1V5T A;  2LRW A;  2GI9 A;  2KXJ A;  4S0R A;  3QQ8 B;  5EE3 A;  4KIK A;  1FRD A;  1WRI A;  2N9E B;  3VAW A;  3OJ4 B;  4HCP B;  2PE9 A;  1VZ6 A;  5FR3 A;  3V6C B;  2JY6 A;  4LNN A;  4IM2 A;  5H92 C;  4A9A A;  4IG7 B;  4LNI A;  5TR5 A;  4BKG A;  2JVC A;  5MPO A;  1ZDX A;  3A9J A;  3EEC A;  1ZUD 2;  1QQR A;  2LWP A;  4YSX B;  4OHJ A;  3NY5 A;  3EA6 A;  2LAS A;  1P9D U;  4MGZ E;  4NQK E;  1FNW A;  3MTN B;  2LGS A;  4IW0 A;  2ZNV C;  5C23 A;  1YQB A;  2IJ0 A;  4REZ A;  2PKO A;  2WXG A;  4L1B A;  1WE7 A;  2N9L A;  3W9C B;  3D32 A;  2C60 A;  1Y8R C;  3PSE B;  2C7H A;  2VZK B;  4IC7 B;  2Y5P A;  4L2Y A;  2K5P A;  4IWO A;  4W9G A;  1WM3 A;  2M0A A;  3EGR A;  1F2R C;  3WA0 A;  2LMC A;  2G45 B;  1QF6 A;  5CX3 A;  4FA6 A;  3R7R A;  2FBW B;  2DLB A;  2JRH A;  5IA7 A;  2MW5 A;  1FXI A;  4ARC A;  1B1Z A;  5LXH A;  1D5Z C;  2AEH A;  2DEN B;  3W5V B;  1WMH B;  1EF1 A;  3QWZ B;  2WDV B;  2BGF A;  2MBO A;  1C1Y B;  2K1F A;  1XT9 B;  3ZJV A;  3IAM 1;  4NZL B;  4JIO U;  2HDE A;  1VZ7 A;  4BBN F;  4EZL A;  4LJP B;  2FCN A;  3OG5 A;  5BYR A;  4BKT A;  2LZ6 A;  2W9N A;  2KVZ A;  4MEM A;  2O2V B;  3VFK A;  4KKI A;  4TV3 A;  2WXF A;  2PIA A;  4OZB A;  5AEK B;  1T6B X;  5FKA C;  4JGH B;  3WAN A;  1OQR A;  1EWY C;  2IO1 B;  2ZZP B;  1I4P A;  2ASQ A;  2MJ3 A;  4ZHO A;  2D5G A;  4HPL B;  3I5J C;  4GOC A;  3C19 A;  1WGG A;  4HRO A;  5DPT A;  2WX1 A;  3RN9 C;  3PS6 A;  1V8C A;  4YTM B;  5GMV A;  2QC8 A;  1TYG B;  2J52 A;  2KWD A;  2G9H D;  2IO3 B;  2J42 A;  2GB1 A;  2Q5W D; 
#chains in the Genus database with same CATH homology
 3B2F A;  4WH4 A;  4H2A A;  3IAS 1;  3ZYY X;  2WU2 B;  2LHE A;  3BII D;  2QMT A;  2Y5C A;  1L0X B;  2WXM A;  3SFE B;  4P16 A;  1SE2 A;  2BT6 A;  1SB3 C;  3O13 A;  3AE5 B;  1RWS A;  1TY0 A;  1SE3 A;  2M56 B;  3IT4 B;  3TUO A;  1E7P B;  2WXH A;  5C3J B;  3RFZ B;  1FIQ A;  1UGJ A;  2MJE A;  1JWS D;  4XE0 A;  3BVM A;  2N7J A;  1YMH E;  4OW0 A;  4ZOH C;  3GS2 A;  2ZW0 A;  1XLP A;  4B0M A;  4ARI A;  2LEK A;  4RF0 A;  1YJJ A;  2DWQ A;  2JSV X;  1WGK A;  4NAM A;  1AWD A;  2W82 A;  1YQ4 B;  2MH7 A;  3GP7 A;  1TKY A;  1FD6 A;  1N5W A;  1I4X A;  3P4S B;  1FM0 D;  1V1O A;  4A8X C;  3TEZ A;  1XEE A;  3Q8E A;  4RGT A;  3ETR A;  2V0G A;  1SEB D;  5FK9 C;  1V1P A;  2GRI A;  3KQ4 A;  3RPF C;  4PT5 A;  3R2T A;  1N5X A;  2WNM A;  3C8Y A;  3Q8C A;  3BVG A;  1BML C;  1TS5 A;  1N61 A;  1BXT A;  4DXF A;  5HHD G;  2CJO A;  1KRH A;  2W3R A;  2WXK A;  1VDV A;  2W54 A;  2RDH A;  1JRO A;  4ITK A;  3AEG B;  2FUG 1;  2I38 A;  5EE1 A;  2R61 A;  3VRA B;  4KX6 B;  1TJE A;  1P7F A;  1HZ5 A;  3UI3 A;  3TEY A;  4NJC A;  2WXI A;  3W1S A;  4CQN A;  1ROE A;  1HEZ E;  3AEA B;  5EE0 A;  3GB1 A;  1K50 A;  4XDD A;  1DOY A;  3AE1 B;  1SBB B;  2V3N A;  4LLG M;  1EWC A;  1GB4 A;  3NS1 A;  2L32 A;  1CJE A;  2KAJ A;  1NEK B;  4JX1 C;  1L0Y B;  3NVZ A;  2BB6 A;  2PVO D;  2XNA C;  5BYS A;  1VZ8 A;  5BMH A;  2WXL A;  2YEP B;  3BK2 A;  1V97 A;  4HRS A;  1I4R A;  3SR6 A;  4RFB A;  3Q8B A;  1N63 A;  1SE4 A;  3AH7 A;  1MPE A;  4OZA A;  4FXC A;  3H8H A;  1N60 A;  2KMM A;  4RNA A;  4LK0 M;  1ESF A;  3PZ8 A;  1JWM D;  1QKZ A;  5E6J A;  1MHH E;  1NVI D;  4YTN B;  4C7Y A;  1E0Z A;  3V3X A;  4C56 C;  2J4X A;  2J53 A;  1IUE A;  4KGT A;  2E6X A;  1QLB B;  1T5X D;  3AE2 B;  1F77 A;  4WQM A;  2MJD A;  1SJE D;  1UNS A;  4IKG A;  1ZOY B;  3EUB 2;  3BYY B;  3MC0 B;  1C4P A;  2K0P A;  1VRA B;  1PFD A;  1FEH A;  1JWB D;  4JWS C;  2BBC A;  3R8B A;  5C2T B;  2BYT A;  1XLQ A;  1K52 A;  3KWV A;  4B0E A;  3T3N A;  2EKI A;  3AED B;  2L52 A;  3B2G A;  1YJI A;  1GB1 A;  2QSD A;  1NI3 A;  2OHF A;  4LTU A;  4N58 A;  4A6Q A;  1IGD A;  2WXN A;  1XLO A;  2V3P A;  3P4Q B;  2IGD A;  3ZJT A;  1VR9 A;  1QOG A;  4IDI A;  3I57 A;  1LO5 D;  1L6U A;  1SJH D;  3URY A;  5D3I B;  1RYJ A;  2LGI A;  2WS3 B;  3SEB A;  1JCK B;  1L4D B;  1PUT A;  3AE7 B;  4TSS A;  3TSS A;  4RGO S;  4C7Z A;  3VR9 B;  3PO0 A;  2BS2 B;  4N6E B;  2AQ3 B;  4KGR A;  4DQO C;  1FMA D;  3Q69 A;  1XLN A;  3HRD D;  1JW9 D;  2ZW1 A;  4KKJ A;  2WXP A;  3MP9 A;  1JWU D;  3SFD B;  2L83 A;  3MJ5 A;  3AEF B;  1CQV A;  2QEJ C;  1L0V B;  4YSY B;  1KFY B;  1F0Z A;  2WU5 B;  1XF5 L;  1OFF A;  3NVV A;  2TSS A;  3AE9 B;  2LUM A;  1ZXH A;  5H8Y E;  2INN E;  1QOF A;  2LFI A;  1SXT A;  1PGB A;  1PYW D;  3NRZ A;  2JU6 X;  1DOX A;  1DGJ A;  1I4Q A;  3TEX A;  1C4A A;  2IGH A;  5BYQ A;  2N0S B;  1ACC A;  1JRP A;  1FNU A;  1FNV A;  3NUH B;  2CJN A;  3BVZ A;  3LXF A;  1MI0 A;  3AB5 A;  2FE8 A;  2JXT A;  2YEP F;  1C4C A;  4RGM A;  2H88 B;  2PTL A;  5HG2 A;  3HUI A;  5TSS A;  1TS4 A;  1WWT A;  4NAW B;  1FO4 A;  4JPS A;  1K51 A;  1B9R A;  5D7G A;  2OED A;  1XCT L;  4EE2 A;  2B76 B;  4YWG G;  1IBX B;  1QOB A;  1SF0 A;  4IOI E;  1UWM A;  2K9X A;  3L4P A;  5EE9 A;  5AUK A;  3DWM A;  4A90 A;  2NTS A;  1CK1 A;  3AE8 B;  3AE3 B;  1AW7 A;  1I4H A;  4C80 A;  4ZYS A;  2EEL A;  2ICI A;  4A55 A;  3TEW A;  4YXD B;  1Q10 A;  1ZDV A;  1CZP A;  1UUP A;  3NVY A;  3P42 A;  5JXV A;  1FCC C;  5T8I A;  1J7B A;  4MT5 A;  1ZP0 B;  1HZ6 A;  4R3D A;  3AE6 B;  4XDC A;  4ZRP A;  2JWU A;  1IGC A;  1ZPS A;  1I7H A;  2KAC A;  1T3Q A;  4TMA B;  2MEK A;  1PGA A;  1E10 A;  1Y56 A;  1WXQ A;  3BZD B;  1TKG A;  2BS4 B;  1MHX A;  1C9F A;  1E6E B;  1KLG D;  1D6E C;  5AUI A;  2JYE A;  2BS3 B;  1J7A A;  1KF6 B;  1NYR A;  1PDX A;  5BMG A;  3AEB B;  2PMV A;  3BK1 A;  1KTK A;  2W55 A;  3Q8F A;  2PLP A;  3U7Z A;  3VRB B;  1HXY D;  1V1P B;  4TQ0 A;  1IBX A;  2V4I B;  4WIP A;  3ZQ4 A;  1C78 A;  3Q8A A;  3ZJU A;  1TS2 A;  2GI9 A;  1TZO A;  4YTP B;  2QIL A;  3P1M A;  5GXG B;  1R7S A;  1WSP A;  5EE3 A;  4MH8 A;  1FRD A;  1WRI A;  1JAL A;  1WYG A;  4WAF A;  1D5M C;  1XXG A;  4AS1 A;  3KWL A;  2AQ1 B;  1VJK A;  2DYO A;  1C79 A;  2ON8 A;  2X38 A;  2JZP A;  2PW9 A;  2IGG A;  2Z8L A;  4RGN A;  5BMI A;  4L23 A;  3CWI A;  2WXJ A;  1YN5 A;  1EM7 A;  1VZ6 A;  5FR3 A;  2WDQ B;  3IT6 B;  3IXS A;  2JX5 A;  1HA5 A;  5H92 C;  4A9A A;  2RDG A;  3FIL B;  4HKQ A;  4TQ1 A;  2WDR B;  5MPO A;  1AN8 A;  1ZDX A;  2INP E;  1NYQ A;  1A70 A;  1VLB A;  2K3U A;  4HJG E;  1ZUD 2;  2WP9 B;  5G5H A;  1QQR A;  2WXO A;  4YSX B;  1GPX A;  4OHJ A;  3MFG A;  3VR8 B;  2DBY A;  2PVG C;  2ACZ B;  3EA6 A;  4DXG A;  2Y3A A;  1FXA A;  2SAK A;  1E9M A;  1FNW A;  2HTM E;  2N9K A;  2IDY A;  1SIJ A;  3ABV B;  1L4Z B;  2WLB A;  4GDK B;  1JML A;  2M19 A;  1GAQ B;  2ONQ A;  2WQY B;  2IJ0 A;  4REZ A;  3AN1 A;  2PKO A;  2WXG A;  1PGX A;  3BWU D;  3N9Y C;  2JQR B;  4L1B A;  4OZC A;  3HVD A;  3J9C A;  2N9L A;  3W9C B;  1ET6 A;  4P6V F;  4US8 A;  1QOA A;  2QJL A;  4JE3 B;  5LNK 1;  2BW2 A;  3W5U B;  3VQI A;  4XWW A;  2BTE A;  3U4E G;  3KLS X;  2VZK B;  2I2Y A;  3P4R B;  4US9 A;  3E9S A;  2Y5P A;  4L2Y A;  4YSZ B;  2K5P A;  4WWM A;  1C77 A;  3AEE B;  3FIL A;  1KLU D;  3P4P B;  4AQ7 A;  3FAH A;  1QT9 A;  2NTT A;  2M0A A;  4D2K A;  2IPK D;  3EGR A;  1F2R C;  2RMM A;  1YN4 A;  2LMC A;  4OVZ A;  1L5P A;  3T3O A;  3AV8 A;  2LHD A;  1ZXI A;  1QF6 A;  1JWA D;  1HQR D;  2FBW B;  2DLB A;  1ZE3 D;  1FFU A;  2JYT A;  2XN9 C;  1FXI A;  2DYM A;  3AEC B;  1NEN B;  4ARC A;  1B1Z A;  1EU3 A;  2L1A A;  2SEB D;  1D5Z C;  1J7C A;  3WCQ A;  3U2S C;  2QIE B;  3W5V B;  1K53 A;  1L6V A;  2KDM A;  4M0W A;  4WUR A;  4HKZ E;  1RM6 C;  2WDV B;  3I9V 1;  4GLS C;  1YN3 A;  4USA A;  4XWT A;  1I4G A;  2WXQ A;  3IAM 1;  3ZJV A;  4MM3 B;  4GDL B;  4NZL B;  2VZK D;  1P7E A;  1F2R I;  2KN4 A;  2KQ4 X;  1XCQ L;  2AQ2 B;  2HDE A;  3B9J A;  3P63 A;  2W3S A;  1FFV A;  5D3D A;  2K22 A;  1VZ7 A;  3BYT B;  3FC4 A;  4Q2J A;  3W2D A;  1KH0 A;  1DOI A;  5BYR A;  1XO3 A;  4J3O D;  3AE4 B;  2RPV A;  3V05 A;  4RCO A;  2AX5 A;  4KKI A;  3CIR B;  1JQ4 A;  1DYQ A;  1TKE A;  3MHZ A;  1D4B A;  4RH6 A;  3E56 A;  4HEA 1;  2WXF A;  2PIA A;  3PZ7 A;  4OZB A;  2E3T A;  1EU4 A;  1T6B X;  2G1E A;  2H89 B;  5FKA C;  2WXR A;  1FRR A;  1M4V A;  4RF1 A;  1OQR A;  1EWY C;  1MVK A;  3NZ3 A;  1OQQ A;  4YT0 B;  4ZRQ A;  5I4D A;  3U52 E;  1QIL A;  1I4P A;  2MJ3 A;  4ZHO A;  1ENF A;  1C76 A;  3AMZ A;  2D5G A;  3AM9 A;  3NVW A;  4N59 A;  1BUI C;  1SSN A;  3LYY A;  4HRO A;  3R2I A;  5HI1 A;  2NMQ A;  1N62 A;  5G5G A;  4KGS A;  4ZHP A;  4JWU C;  4O1N A;  1V8C A;  4YTM B;  2CU3 A;  1AYF A;  1UWX A;  3OWE B;  1TYG B;  5HFY A;  1GOZ A;  2J52 A;  1D5X C;  2KWD A;  2G9H D;  4MAC A;  1ET9 A;  3ZGZ A;  1RFK A;  2J42 A;  1TS3 A;  3HVZ A;  1YNT E;  2GB1 A;  1FCL A;  1STE A;  2LJI A;  1TY2 A;  2Q5W D;  3DWG C;  3LB8 C;  1YQ3 B;  2BB5 A;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...