5HG2A

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-2-asn35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hg2A00
4KGTA 1FD6A 1EM7A 4WH4A 1MI0A 1PGXA 2RPVA 2I2YA 1JMLA 1HZ6A 1P7FA 3GB1A 1QKZA 2KWDA 3UI3A 2PW9A 1Q10A 2LHDA 2JWUA 1PGBA 1GB1A 1FCLA 1F2RI 4MACA 4OZBA 1K50A 2IGHA 4IOIE 2N7JA 2PLPA 4KGRA 1MHXA 1GB4A 2IGDA 4D2KA 2I38A 5HFYA 4OZAA 1F2RC 2JU6X 1K52A 1MVKA 5BMIA 2ONQA 2ZW0A 2LUMA 5HG2A 2K0PA 2KQ4X 1KH0A 1IGCA 4GLSC 4HKZE 2RMMA 1YMHE 2QMTA 1P7EA 2KACA 1XCQL 2IGGA 5BMGA 1FCCC 5JXVA 1ZXHA 2GB1A 2JXTA 2NMQA 1XCTL 1MHHE 2QSDA 2JSVX 2ON8A 2J52A 1YNTE 1C9FA 2JZPA 4OZCA 2J53A 2OEDA 1XF5L 1K51A 1UWXA 1HEZE 1IGDA 2KDMA 2GI9A 3FILB 5BMHA 2N9LA 2N9KA 1HZ5A 5HHDG 4KGSA 3FILA 5HI1A 2LHEA 2EELA 2ZW1A 2PTLA 1IBXB 4HJGE 1PGAA 1MPEA 3V3XA 4IKGA 1IBXA 2KN4A 2LGIA 1K53A 1D4BA 3MP9A
chains in the Genus database with same CATH superfamily
3A9JB 3DPDA 2D10A 1FD6A 1ROEA 2N1VA 4C7YA 4ANWA 4ANXA 3KUCB 2FUHB 2MLBA 2MWSB 1YJJA 1P9DU 4HDQA 3P63A 5BO4B 2ZPNA 1P1AA 3PGEA 1GB1A 2KYWA 3N9YC 1WE6A 3M62B 1Q5WB 4WJPA 3A9KA 2AL3A 3Q3OC 3CWIA 2XK5B 4OZAA 3W5VB 4KVGB 4MSMB 1NI2A 2JVCA 4K1RB 2O6VA 2EKEC 2RR9A 2W54A 1XLQA 1XEEA 3PV1A 1JWSD 3MC8A 2XN9C 3L08A 2CHZA 4HPPA 2BW2A 3I57A 3LJ3A 2LGDA 4ZYSA 1TS3A 4C00A 2V0GA 1T0RC 3TEXA 1ZP0B 1YN4A 3WANA 1Y56A 3TUOA 2C60A 1JCKB 4CHKA 2INNE 1XLPA 3K9OB 2BYTA 3HIZA 1YJ1A 2FIDA 1R4MI 1R4NI 2DZIA 3SHQA 3MC0B 1S3SG 1R4NB 3I63C 3RZWC 2BS3B 1WJ6A 2K8CA 4KGSA 4DHJD 4LLGM 4B0MA 2L1AA 4CO7A 3TIXA 3PT2B 4AJWA 2VH2A 2BYVE 2PPHA 2KN4A 2WX0A 1WGGA 1ZE3D 1KLVA 1K53A 3P4QB 3L13A 3FKYA 1D5XC 1NYRA 2RPQA 3BVMA 4FHKA 1WGHA 5H8YE 1C79A 3KLSX 4MM3A 2CKHB 2CR5A 3E56A 2FE8A 2WDTB 1T0QC 2IO1B 4BKGA 1CMXB 1OQYA 1L5PA 2GBRA 3URYA 4DHJB 4URKA 1EF1A 2Y5BB 3Q69A 1RYJA 4JE3B 4YTMB 1QOGA 2VRRB 2R61A 3X0WA 1PFDA 2K8HA 3UIOB 1JWMD 1WGYA 2LZ6A 5D3IB 3ZDTA 3RNAC 1WXVA 1Q1OA 2X38A 3DVGY 1T5XD 2C9WB 4EZLA 5J17A 4MDKE 5D7GA 3PZDA 3BVZA 1XD3B 4XYCA 3VH3B 2NBVB 3R2TA 2M17A 2N4FA 2Y3AA 4EFOA 5EE3A 4ASWC 3NS1A 4ICUA 1SXTA 3GOEA 3DBLI 1DYQA 1L4DB 2WGSA 3O65B 3ONSA 4FLHA 3EECA 1WX7A 2DZJA 2Y5PA 3DBLB 2NPTA 2HD5B 4KZCA 1I4RA 4NQLB 2FBWB 2LHEA 3ZJUA 3KYDD 3U7DA 4L23A 1E8YA 4FJZA 3GE3C 1WGDA 4OW0A 3NVZA 4HLEA 1RLFA 2BKFA 4G0NB 4LJOB 4M02A 1HTQA 4N58A 3P4RB 3AE7B 3ZYYX 3UGBB 3A1QA 3QARA 3BVGA 4FULA 4MJSB 3JYUA 3R7QA 2LJIA 4K7SA 3QHTA 2WS3B 2JWZA 4DWFA 5KHOA 1UNSA 2A4ZA 5TR5A 1KOTA 1T0YA 3OLMD 3N32A 2N9PC 2M0XA 1SEBD 1SF0A 4YL8A 4ARIA 4CQNA 4NY0A 4MSQB 3ZTDA 1QLBB 4KKIA 2MP2A 3AEAB 4G50A 5EDSA 1PYWD 4MH0E 1PUTA 2B3AA 2KVRA 2KFJA 3V62A 3T3NA 2JXTA 2FUG1 1M4VA 2GOWA 1TBEA 2D11A 4NAWB 1C9FA 3V6CB 4OZCA 1FEHA 4DXGA 2L7RA 2J0KA 4GMVA 1J19A 3IAS1 1OEYJ 2BWFA 2WYQA 4E74A 2KX3A 2MBEA 2DLBA 3ZRCA 3ENEA 3RN9C 1L4ZB 1HZ5A 4BAXA 2KX0A 2DYBA 2JUOA 4DDID 4PS7A 1V1PB 1MPEA 2NTSA 2JX5A 1RFAA 5EE9A 2KANA 2AYOB 4AS1A 5L83A 3M3JA 4BFRA 1SE2A 2NBUA 3GP7A 1MG8A 3APDA 2KQSA 2KD0A 3VQIA 3W1YA 3TEYA 1VJKA 3JVZX 2Y5CA 4DBGA 3WIMA 1L0VB 2DWQA 4QAYA 3UI3A 1WXSA 4WIPA 2JWUA 3KWLA 3WA0A 3A9KB 3QAQA 3IAM1 3LDZE 2PLPA 3TJPA 1MHXA 4NJ7A 3EFCA 1YN5A 4WAFA 1TKYA 2O6VB 3NG0A 3Q3JA 4C56C 2KKCA 3I3TB 2HDEA 3NVVA 4RMAA 2LUMA 4IWOA 2WU2B 4B0EA 3EUB2 3DHGC 5AUKA 3IFWB 1KFYB 1IPGA 3BYTB 4K81A 1CZPA 1BMLC 3AE5B 1FRRA 2JT4B 2IGGA 3U4EG 3W9CB 1JWUD 5I4DA 2BYEA 1EU4A 3W5UB 2DBYA 2WXQA 2DENB 1JWAD 2M0AA 1RM6C 1HXYD 3OG5A 4RH6A 3H6NA 3TEZA 2MH7A 3AE8B 4RGNA 2HJ8A 1JRPA 1GOZA 2BPSA 3U7ZA 4FJYA 2NVUI 3LYYA 2VH1A 1L0XB 5DPSA 3ETRA 5HHDG 2LWPA 5HI1A 2EELA 5JHAA 2PTLA 3SEBA 1SE3A 1V2YA 4L2YA 3Q3FA 2N9XA 2OJRA 4YSXB 1TYGB 2LFIA 3P1MA 1TY0A 3AV8A 5GMVA 3ZLZA 3AXCA 4IW0A 3DVNV 4A90A 2REXA 2QC8A 1E5WA 4MM3B 2AX5A 1WGRA 4W9LA 1HQRD 1SB3C 3Q8CA 5JH5C 3RNBC 2ZPYA 1FCLA 5J2RA 3L17A 2MQJA 1FIQA 2R2QA 4W9IA 5D6JB 4M0WA 2AQ1B 2G9HD 4II3B 2UU7A 5CTRC 4ACFA 1V86A 2KT7A 4AOFA 1WSPA 1N5WA 4C80A 5L95C 3QC8B 5CHWA 2FIFA 4MEMA 2KACA 4G11A 5H92C 2KWUB 2AQ2B 3AN1A 2NMQA 3ZDMC 3VDZA 3AI5A 2QSDA 1WYGA 2W3SA 1EO6A 4LJPB 2KOXA 2KC1A 3ALBA 4A55A 2BT6A 2L8JA 2OEDA 1TS5A 1K51A 3DBRI 2NPTB 4F7ZA 1NEKB 5FK9C 4FHJA 4E71A 3DBRB 1ZOYB 2FCSA 5BYQA 5E6JA 4ZOHC 2CS4A 3V3XA 3IBEA 1OGWA 1WI0A 1I4XA 4NJ6A 3ML8A 2YEPB 1E7PB 3KVFB 2K6DB 2UWQA 3A1QB 2RDGA 2KFKA 5EE1A 4WWMA 2QCZA 2K8BA 5IN7A 1LGRA 1WWTA 3GB1A 2D5GA 2WXOA 3KWVA 3ZXRA 2V9HA 1NDDA 3DVGX 1ZDVA 2G4SA 3B2FA 2VZKD 1UF0A 1JW9D 4A20A 3SR6A 3RD2A 1Y8RC 3SD5A 2KMMA 1C4CA 1D5ZC 4D2KA 3PS6A 2QILA 5HFYA 1T6BX 2NCNA 5KHQA 3RNCC 2J4XA 2MBOA 2ONQA 2ZW0A 2L76A 3B9JA 2LXCA 2MP2B 1TKGA 3NZUA 3ML9A 1VDVA 2KNBA 1C4PA 1WX9A 2HJ1A 3IVFA 2KQ4X 2K39A 4HK2A 1IGCA 3QA8A 1J7CA 2IO0B 1C4AA 4HKZE 2AEHA 1FMAD 1KLUD 3PZ8A 1D6EC 2K25A 2EMTA 4JQWC 2NTTA 2NS5A 2E3TA 4MGIE 3GZNI 2BS2B 4HRSA 4JL9A 3RCZA 4XZ4A 1SIJA 3GZNB 2LRUA 1YNTE 2VZKB 2JZPA 1ENFA 2RD0A 3N1YC 5BYSA 4N59A 2KHWB 3P4SB 5IA7A 1DOIA 2QJLA 4OHJA 4A8XC 5BMHA 4XX5A 5DPRA 1ZXIA 3NVYA 3TSSA 3OJ3A 1A5RA 5LLIA 4P1CC 1JROA 4ANVA 1UELA 4HJGE 3AE3B 2TSSA 1FRDA 2KJRA 3HRDD 3VR9B 1N5XA 1WIAA 2LMCA 2CHWA 2XEWA 4ZRJA 3N20C 1H8CA 1X1MA 4RF0A 1E0ZA 2LXAA 1MI0A 2RPVA 2PVOD 2ZZPB 3M63B 1STEA 2KLCA 2JRHA 3RZFA 3TBLD 3U2SC 4IOIE 3AE6B 2ZVNA 1ZGUB 4EUTA 3IT6B 4W9HA 1UZXB 3QCAA 3VUWA 3ZJVA 2D3BA 4B95A 5LNK1 2MX2A 4PK1A 1MVKA 2BKRB 5BMIA 1UWMA 2W3RA 4OVVA 2GBMA 3K9PB 4YXDB 4RCOA 2JXXA 3LB8C 2FCNA 4PS8A 3UIPB 1WR1A 2RMMA 2QMTA 1P7EA 4RM9A 2H89B 1DGJA 3PHWB 5T8IA 1FCCC 2RDBC 3P4PB 3Q3MC 3N1ZC 3I9V1 2FCMA 1FM0D 5CHFA 1V9JA 3WAPA 1GAQB 2IZVB 2J52A 4XE0A 2V3SA 1N61A 1JALA 3NJTA 1N63A 2LRWA 4HWIB 1I42A 2SEBD 3H7PA 1FNVA 1YQ4B 1FPYA 1WMHA 1XO3A 2KZRA 1SIFA 4FXCA 4WQMA 4YT0B 4TSSA 1TY2A 4WWPA 2WXIA 3MHZA 3L0WB 4MT5A 2R2OA 2KTRA 1S1QB 5E6PA 3H9DA 4I6PA 2HTHA 1V97A 1L7YA 1IBXA 2MEKA 2LD9A 5IAAC 3W1SA 1V6EA 3VAWA 5LXHA 1BXTA 4LCDE 2SAKA 3HHMA 2WHIA 2KWDA 4BBNC 2C7HA 4LNFA 2HTME 3A4RA 4M00A 2ASQA 4MACA 4OZBA 3UINB 2AWTA 4M0WB 3L54A 2IGHA 2WXNA 4KGRA 3RUIB 3PO0A 3U52E 2QDFA 3BIID 3PZ7A 2I38A 3RYTA 1ET6A 5GXGB 4XC2A 3V05A 3SFDB 4IG7B 3EA6A 4NAMA 2WWZA 1YQ3B 1E10A 4GGQA 4HCPB 3AE1B 3B0AA 1OQQA 1EU3A 1I4HA 2Z0DB 5JXVA 4KZ0A 3MC9A 1LQBA 4S0RA 2KK8A 2JSVX 2ON8A 3R2IA 4S17A 2L83A 1I35A 2PJHA 1P3QU 4YTNB 3L16A 3PRZA 4KIKA 2X8XX 4WJOA 4ZYNA 1NBFC 2KTFA 1XLNA 2GI9A 3RI7C 3VTUA 3VTWA 2K22A 3MHSD 1WGKA 2N9LA 4KV2A 1V49A 2INDC 2KN5A 2LGYA 2V3NA 5DPTA 2N7DA 1UH6A 1OTRB 3P2BA 2KXJA 4FJVB 3SU8X 1B1ZA 2WQYB 2JRIB 3ZW3A 2HE7A 2KFKB 3ZTCA 2CJNA 2A5UA 5IO9A 5MPOA 2I2YA 3RNFC 3RFZB 1KM7A 2PW9A 1ISNA 4Q2JA 4IWQA 2WXKA 3ZKJC 1D3ZA 4J6IA 1FFUA 2Z8LA 1ESFA 2N7JA 3KYCD 4DXFA 4FBJB 4BOZB 3Q3NC 5AUIA 4NZLB 2JU6X 2WDQB 1EWCA 3AU4A 3VUXA 4GSWA 3EFUA 1FNUA 4KKJA 2LEKA 2WX1A 2PE9A 3MJ5A 1L2NA 2KDIA 2BVCA 2WXPA 3JSVA 5FKAC 1UBIA 2MBQA 1L6VA 3WCQA 1SE9A 3HVZA 3D32A 1F9JA 1ZUD2 1F52A 1TJEA 4B9KA 3MFGA 3BWUD 4K7UA 3DWMA 2LGSA 2W82A 2ZCCA 4OVZA 3C8YA 2GBKA 2DHZA 4E3CA 2L52A 2JYTA 1XF5L 2WXJA 2KDMA 3R3MA 2KMCA 4EZJA 3FAHA 4W9JA 2CHXA 2N9KA 4RGTA 2K6QA 3A4SC 3HK0A 1TIFA 2WXGA 2E6XA 2BWES 1SE4A 1ZKHA 3RNGC 3J9CA 4W9KA 3AE2B 3L10B 4LDTD 1MFWA 2BB5A 3Q8EA 4AJYB 2H88B 2KWCA 4MGZE 2JZZA 2MW5A 1NI3A 1P7FA 3ZNID 1IYFA 1LFDA 4WURA 1FXIA 1SJED 1T0SC 1PGBA 2IY1B 4YTPB 2DX5B 1EUVB 2G4DB 1LM8B 2KWVB 2EMSA 2LVQA 4W9FA 2YEPF 3B2GA 1HA5A 1B9RA 2N7EA 2WLBA 2BYFA 3WAMA 1F2RC 3Q8BA 4JX1C 4TKNA 3MTNB 2XNAC 3ZVVA 1SJHD 2IDYA 2JYEA 3APCA 2BGFA 4IWPA 4JLCA 4P16A 2W55A 3TCAA 4GLSC 4LDTB 2BBCA 3NVWA 4GB9A 1TTNA 5D94A 2PVGC 3C0RB 5BMGA 2CU1A 1KTKA 5DPWA 1CQVA 2LVPA 2L32A 2GB1A 4WAAA 1QZEA 2V4LA 2LVOA 5C1ZA 2D3GA 2Q5WD 3OJ4B 4ANUA 2J7QB 3CSTA 4JWUC 2DZMA 5AZFA 4IM2A 1WXMA 5D2MB 2D3AA 2BQQA 4JWSC 4C4VA 3A33B 3GS2A 3H7PB 2KJHB 1WJUA 1WMHB 4NQKE 1WXQA 1GNUA 1V80A 5E6NA 1QQRA 2KTRB 3U30A 1IBXB 4IUMB 4OVUA 4TV3A 3AEGB 2C5LC 1TS4A 3B08A 2V4IB 2NBWB 2WXHA 1D5MC 3VR8B 1RFKA 4EOYA 1FXAA 2L05A 4JPSA 1SBBB 1WRDB 1HZ6A 1V1OA 1NENB 4K7WA 3IG3A 1QKZA 2IY0B 2XBBC 3TEWA 3IHPC 3IT4B 2C7NB 1K50A 3PTFC 2ZJDA 4N6EB 3NUHB 1Z2MA 3VTVA 3NY5A 2INPE 1C76A 3W1SC 1E8WA 1ACCA 2M19A 3AEDB 2YVCA 1FO4A 1YIWA 4TQ1A 4W9GA 3PREA 1CK1A 3JW0X 2L0TA 1GUAB 3C19A 4US8A 1VRAB 3DDCB 3OAWA 1EWYC 2KDEB 2V3PA 5JHBA 4YSYB 2I1JA 1WH3A 3KW5B 4DK5A 3AEEB 3DCGA 2PEAA 2OOBB 3T3OA 5G55A 4YSZB 2WDVB 1DOXA 2KMAA 4JIOU 2RGFA 1VLBA 1QT9A 2L00B 4KIKB 1NYQA 1WM3A 5DCNA 3RT3B 2J53A 3ZXVA 3PLVA 2CJOA 1LO5D 2J0JA 4IC7B 4RNAA 4IM0A 4HVBA 1E8XA 3WALA 1WFYA 1V81A 3S2AA 2JPHA 2M8SA 1GPXA 3PLUA 3ZUNA 2IO2B 4IKGA 2L0FA 1BT0A 2FAZA 4P1BC 3PSEB 3ZO5B 1Z5SB 4M8NA 2IYDB 2M1MA 5G2NA 5E6OA 4BBNF 1EM7A 2LJ5A 3WAOA 4PS3A 1PGXA 4BKSA 1AN8A 4LNIA 5FR6A 3VXWA 2LHDA 4P7IA 1SGHA 1E7VA 1YJIA 3HVDA 3AULA 4KX6B 4WWNA 4LNNA 1QILA 3N1XC 5AZGA 4EKUA 3DBHI 4L1BA 4W9EA 2GLSA 1T3QA 3DBHB 4US9A 4FA6A 5IKCM 5IOIA 3NHEB 1P0RA 3JSVB 4AQ7A 1C78A 5CX3A 2KVZA 4EE2A 4ZRQA 1WF9A 4GXBA 3V61A 1TZOA 2W9NA 4AWJA 4W9CA 2MJ3A 3AECB 2JF5A 4F8CB 1YMHE 1WR6E 2JY6A 1XCQL 2BB6A 1R4MB 2AQ3B 2K1FA 2DZKA 3X23A 2AL6A 4ZHOA 2IJ0A 1XCTL 1MHHE 3R8BA 4XWWA 3V60A 1FNWA 1PQSA 1L6UA 2N0SB 4GDLA 1UD7A 3NRZA 2LUEA 4HPMB 3KUZA 1JQ4A 1U4AA 1E6EB 2MHJA 1IGDA 1N62A 4JGHB 4LTUA 3HUIA 4GDKA 2KLGA 4N9F4 2ACZB 3FILA 1WJNA 3QIJA 5C3JB 2QEJC 3FC4A 4GU2A 1GC7A 2DNFA 2WXMA 1EF5A 2O2VA 3PHXB 2WDRB 3UQBA 1CJEA 2LGIA 1I4GA 4ZHPA 1AW7A 4WJQA 2FCQA 1HTOA 1J7AA 4RFBA 1AWDA 1UGJA 5IP4D 1VZ7A 4ICVA 1A70A 1ZW7A 2BF8B 3BK2A 1VR9A 4WH4A 1WZ0A 3R7RA 3CF6E 3UQAA 1TT5B 1RAXA 3R66C 2V1YA 1HE8A 2MA9B 2ZNVB 3RMKC 1VD2A 4TMAB 2MRPA 3Q8AA 1UBQA 3DBSA 4WQOB 3VVWB 3MJWA 2C7MB 2IGDA 4NNJB 2GBNA 1YN3A 4DHZB 3H8HA 2WXRA 2K5PA 3AM9A 3H7SA 4BVUC 1I4PA 1V5OA 1QOBA 4WWOA 5C2TB 2DYMA 2ZCBA 1MG4A 2WXFA 3AEFB 4P6VF 2Z59B 2ZNVC 3DHIC 3VFKA 3QWZB 1TS2A 2G45B 5C23A 1E8ZA 1ZXHA 5BYRA 4HEA1 4K3CA 4ZDVA 4HXDA 3BK1A 4C4VB 1N6ZA 3SDLC 2MJDA 2PMVA 3UF8A 4O1NA 2OJWA 5G5GA 2MJEA 3AB5A 1H4RA 2WXLA 5AEKB 4H2AA 4G3XB 1IP9A 4RGMA 2WNMA 5TSSA 4KDIC 3EHVA 1UWXA 2LASA 2PE6B 3QK0A 3N3KB 3CSFA 3O13A 4NJCA 3GE8C 2DAJA 4XGAB 2G1EA 4PYZA 3W2DA 2GBJA 3QX1A 1PGAA 2I1KA 3VRAB 4MH8A 4LK0M 1XQQA 1D4BA 4C7ZA 4RGOS 4BKTA 4CYEA 1F0ZA 1JWBD 3N30A 1WJ4A 3A9JA 1YX5B 1OFFA 1WXAA 4YWGG 3BINA 3DWGC 3BZDB 4GN1A 5EE0A 3EC8A 3ZJTA 1GG3A 4BOSC 2KO3A 2GMIC 2YLMA 2ZVOA 3HM6X 4DQOC 2FNJB 4ITKA 3ZQ4A 1J8CA 1SSNA 3DVNU 2G3QB 3H1UA 4EEWA 2XK5A 4F1SA 3KQ4A 5G5HA 1KH0A 4LNKA 1WE7A 1ZDXA 1QOAA 2KDFB 1RRBA 3I5JC 3Q6BA 1F77A 3ZNGC 3IXSA 2O6VD 4BKSD 1E9MA 2ZEQA 2J42A 2RSUA 1K8RB 1YQBA 1E90A 1MJDA 4A3PA 1V5TA 1LXDA 1RWSA 3AU5A 3LXFA 1C3TA 1C1YB 3EGRA 2IO3B 1KJTA 3E9SA 2KJ6A 4ZRKA 1DOYA 3QQ8B 2BS4B 2L3ZA 1OEYA 1L0YB 4IM3A 3VHTC 4XDCA 3CMMB 4J3OD 4USAA 2M56B 3M95A 4I6LB 2LI5A 2MBHA 4A3OA 1I7HA 5J18A 1XXGA 4HPLB 3AE9B 3PRPB 1WRIA 4DHZE 4KGTA 2MBBB 1V8CA 3QJZA 4XWTA 3NZ3A 4LNOA 3NZSA 4RM8A 1JRUA 3AEBB 2EKIA 3AH7A 2IPKD 3NOBA 1PDXA 1F2RI 3DHHC 3DOWA 1XT9B 1IUEA 3BYYB 4X57B 3VRBB 4UDUC 4II2B 2KDBA 1GB4A 1G6JA 2WP9B 2N9EB 4REZA 1K52A 1TZ1A 4MGYE 3ZGZA 1AARA 4M01A 1YX6B 3BY4B 3Q8FA 3DQVA 4GOCA 2LGXA 2J0MA 2K0PA 3APFA 1XLOA 2JZ3B 3T8MA 2DYOA 1KF6B 4HCNB 4B6WA 2QIEB 1J7BA 2PIAA 1M94A 1Q0WB 1WY8A 1R7SA 2MSED 3AE4B 4HKQA 1KRHA 4GDLB 2KC2A 5LXIB 3HM3A 2MCNB 4AP4C 4RF1A 3RULA 2UYZB 2N1WA 3ZRFA 1QF6A 2IBIB 1UUPA 3RNEC 1P98A 5CHVC 3SFEB 1TGZB 4GDKB 4W9DA 4GIVA 1HEZE 4HROA 1FXTB 4ZRIA 3FILB 1ET9A 1E7UA 1I4QA 5AZHA 4XDDA 1ZPSA 2D3CA 1OQRA 4EZKA 2KAJA 2O2VB 3RPFC 2K3UA 4TQ0A 3P42A 4FN2A 2Z0EB 2PKOA 4IDIA 2JQRB 4FADA 3TMPB 3CIRB 4AUQC 3KH0A 3MP9A 2WU5B 1YD8U 1QOFA 2KQ7A 3ABVB 3ZIMA 1JMLA 2ICIA 4A6QA 2RDHA 1WX8A 1Q10A 1WM2A 4MJSA 1WYWB 2M4NA 2QHOA 3VH4B 1C77A 4R3DA 3Q2AC 3TL5A 4TUUA 2GRIA 3V6EB 5D3DA 4ZRPA 4NPNA 3T9LA 2K9XA 3ZNZB 3NS8A 4M8MA 4WJNA 2CU3A 3ECIA 2DAFA 1UGMA 4KDLB 3PRMB 4KSKC 1GC6A 5HG2A 1WZ3A 1VCBA 2OHFA 4I6NB 3PVLA 4K3BA 3KUDB 3OWEB 1GJZA 4PT5A 1BUIC 3AMZA 4HJKA 3VUYA 1KLGD 3L4PA 4MELA 5JZEB 4DDGD 1VZ8A 1F1HA 4BZAA 1AYFA 1VZ6A 1YOVB 3U8ZA 2D2QA 2D07B 4NAWA 4PYUA 1FFVA 4HDOA 2NR2A 5FR3A 1NVID 4ARCA 3Q14C 4A9AA 2ZW1A 1N60A 2B76B 4MGKE 4DXAB 3B1LX 2INCC 2BTEA 5HKHA 1V1PA 1TKEA 3ZNHB 3PPAA 4KSLC 1J0GA
chains in the Genus database with same CATH topology
1VZ7A 1A70A 1FD6A 1ROEA 4A90A 3BK2A 5MPOA 1VR9A 4WH4A 4C7YA 4MM3B 2I2YA 2AX5A 1YJJA 3RFZB 1HQRD 3P63A 2PW9A 1SB3C 3Q8CA 4Q2JA 1GB1A 2WXKA 1FCLA 3N9YC 4TMAB 3Q8AA 1FFUA 1FIQA 2Z8LA 1ESFA 2N7JA 4DXFA 4M0WA 2IGDA 3CWIA 2AQ1B 2G9HD 4OZAA 5AUIA 3W5VB 4NZLB 2JU6X 1YN3A 2WDQB 1EWCA 3H8HA 2WXRA 2K5PA 3AM9A 1FNUA 4KKJA 2W54A 2LEKA 1I4PA 1QOBA 3MJ5A 1XLQA 1WSPA 1XEEA 2DYMA 1N5WA 2WXPA 5C2TB 4C80A 1JWSD 2WXFA 3AEFB 5FKAC 4P6VF 2XN9C 1L6VA 2BW2A 3I57A 3WCQA 3HVZA 2KACA 1ZUD2 1TJEA 1TS2A 4ZYSA 5H92C 1TS3A 2AQ2B 3MFGA 1ZXHA 3AN1A 3BWUD 2V0GA 5BYRA 3TEXA 1ZP0B 3DWMA 1YN4A 2NMQA 4HEA1 2QSDA 2W82A 3BK1A 1Y56A 1WYGA 2W3SA 3TUOA 4OVZA 3C8YA 1JCKB 2MJDA 2PMVA 4O1NA 5G5GA 2MJEA 3AB5A 2WXLA 4A55A 2INNE 1XLPA 2L52A 4H2AA 2BYTA 2BT6A 2OEDA 2JYTA 1TS5A 1XF5L 2WXJA 2WNMA 4RGMA 5TSSA 1K51A 1UWXA 2KDMA 1NEKB 5FK9C 3MC0B 3FAHA 1ZOYB 2N9KA 5BYQA 2BS3B 3O13A 4NJCA 4KGSA 4RGTA 5E6JA 4ZOHC 2G1EA 4LLGM 4B0MA 2WXGA 3W2DA 2E6XA 1PGAA 1SE4A 2L1AA 3J9CA 3V3XA 1I4XA 3AE2B 3VRAB 4MH8A 2YEPB 2KN4A 4LK0M 1E7PB 1ZE3D 2BB5A 1K53A 3P4QB 1D4BA 3Q8EA 4C7ZA 2H88B 2RDGA 4RGOS 5EE1A 1D5XC 1NYRA 4WWMA 1F0ZA 1JWBD 3BVMA 1NI3A 1P7FA 1WWTA 1OFFA 3GB1A 2D5GA 2WXOA 4YWGG 3KWVA 5H8YE 1C79A 4WURA 3KLSX 1FXIA 1SJED 1PGBA 3DWGC 3BZDB 5EE0A 4YTPB 3ZJTA 1ZDVA 2FE8A 3B2FA 2VZKD 3E56A 1JW9D 3SR6A 4DQOC 2YEPF 3B2GA 4ITKA 1HA5A 1B9RA 2KMMA 1C4CA 3ZQ4A 1D5ZC 4D2KA 2WLBA 1SSNA 2QILA 5HFYA 1T6BX 1L5PA 1F2RC 2J4XA 3Q8BA 4JX1C 2ONQA 2XNAC 2ZW0A 3URYA 3B9JA 1SJHD 2IDYA 3Q69A 1RYJA 4JE3B 4YTMB 1TKGA 1QOGA 2JYEA 1AWDA 3KQ4A 1VDVA 5G5HA 1C4PA 2R61A 2KQ4X 1PFDA 1KH0A 1IGCA 1J7CA 4P16A 1JWMD 2W55A 1C4AA 4GLSC 1ZDXA 4HKZE 1QOAA 2BBCA 1FMAD 3NVWA 5D3IB 1KLUD 3PZ8A 1F77A 1D6EC 3IXSA 2PVGC 5BMGA 1KTKA 2NTTA 1CQVA 1E9MA 2X38A 2J42A 2L32A 2E3TA 2GB1A 1T5XD 2BS2B 4HRSA 2Q5WD 1RWSA 3LXFA 5D7GA 4JWUC 3BVZA 1SIJA 3EGRA 3R2TA 1YNTE 2VZKB 4JWSC 2JZPA 1ENFA 5BYSA 2Y3AA 3E9SA 5EE3A 3GS2A 1DOYA 3NS1A 4N59A 3P4SB 2BS4B 1DOIA 1SXTA 2QJLA 4OHJA 1DYQA 1WXQA 1L4DB 4A8XC 5BMHA 1ZXIA 2Y5PA 3NVYA 1L0YB 3TSSA 1I4RA 2FBWB 2LHEA 4XDCA 1QQRA 3ZJUA 1JROA 4J3OD 1IBXB 4HJGE 4L23A 3AE3B 4USAA 2M56B 2TSSA 1FRDA 3AEGB 3HRDD 3NVZA 4OW0A 1TS4A 1I7HA 3VR9B 2V4IB 1N5XA 2WXHA 2LMCA 1D5MC 1XXGA 3VR8B 4N58A 3AE9B 1WRIA 3AE7B 3P4RB 1RFKA 4KGTA 4RF0A 3ZYYX 1E0ZA 1FXAA 1V8CA 4JPSA 1SBBB 4XWTA 1MI0A 3NZ3A 2RPVA 2PVOD 1HZ6A 3BVGA 1V1OA 1NENB 1STEA 1QKZA 3AEBB 3TEWA 2EKIA 3AH7A 3IT4B 2IPKD 1PDXA 1F2RI 1K50A 2LJIA 3U2SC 1IUEA 3BYYB 4IOIE 3AE6B 2WS3B 4N6EB 3NUHB 1UNSA 3IT6B 3VRBB 4UDUC 2INPE 1C76A 1GB4A 3ZJVA 2WP9B 1ACCA 2M19A 5LNK1 4REZA 3AEDB 1K52A 1MVKA 1SEBD 1FO4A 5BMIA 1UWMA 1SF0A 3ZGZA 4TQ1A 2W3RA 4ARIA 4CQNA 3Q8FA 1CK1A 4YXDB 4RCOA 2K0PA 4US8A 1QLBB 4KKIA 1VRAB 3LB8C 1EWYC 1XLOA 3AEAB 2DYOA 2V3PA 1KF6B 4YSYB 2QIEB 1J7BA 2RMMA 2PIAA 3AEEB 2QMTA 1P7EA 1PYWD 3T3OA 1PUTA 2H89B 1DGJA 5T8IA 1R7SA 2WDVB 3AE4B 4YSZB 4HKQA 1FCCC 1DOXA 1KRHA 3P4PB 3I9V1 4GDLB 2JXTA 1FM0D 3T3NA 2FUG1 1VLBA 1M4VA 1QT9A 1GAQB 4RF1A 4NAWB 2J52A 4XE0A 1NYQA 1C9FA 1QF6A 4OZCA 1FEHA 1UUPA 2J53A 4DXGA 1N61A 1JALA 2CJOA 1LO5D 3SFEB 1N63A 4RNAA 3IAS1 4GDKB 1HEZE 2SEBD 4HROA 3FILB 1ET9A 1FNVA 2DLBA 1YQ4B 1I4QA 1XO3A 4FXCA 4YT0B 4WQMA 4XDDA 1L4ZB 1HZ5A 1ZPSA 4TSSA 1TY2A 1OQRA 2KAJA 3RPFC 2K3UA 2WXIA 3MHZA 1GPXA 4MT5A 1V1PB 1MPEA 2NTSA 2JX5A 4TQ0A 3P42A 4IKGA 5EE9A 2PKOA 1V97A 4IDIA 1IBXA 2MEKA 2JQRB 3W1SA 4AS1A 3CIRB 1SE2A 3MP9A 2WU5B 1BXTA 3GP7A 1EM7A 1QOFA 3ABVB 3VQIA 3TEYA 1PGXA 1VJKA 2Y5CA 1JMLA 2ICIA 2SAKA 4A6QA 1AN8A 2RDHA 1L0VB 2DWQA 2KWDA 3UI3A 1Q10A 2LHDA 4WIPA 2JWUA 2HTME 1YJIA 3KWLA 3HVDA 4MACA 4OZBA 1C77A 4R3DA 2IGHA 2WXNA 3IAM1 2PLPA 4KGRA 3PO0A 1MHXA 4KX6B 3U52E 2GRIA 5D3DA 4ZRPA 1YN5A 3BIID 4WAFA 1TKYA 3PZ7A 1QILA 2I38A 4C56C 1ET6A 2K9XA 4L1BA 2HDEA 3NVVA 5GXGB 2CU3A 1T3QA 3V05A 4US9A 3SFDB 3EA6A 2LUMA 2WU2B 4NAMA 4B0EA 4AQ7A 3EUB2 5HG2A 5AUKA 1YQ3B 1C78A 1E10A 1KFYB 4EE2A 3BYTB 4ZRQA 3AE1B 1CZPA 2OHFA 1BMLC 1TZOA 2MJ3A 3AE5B 3AECB 1FRRA 1YMHE 3OWEB 1XCQL 2IGGA 4PT5A 2BB6A 2AQ3B 1OQQA 1BUIC 3U4EG 3W9CB 3AMZA 1EU3A 1I4HA 1JWUD 1KLGD 5JXVA 3L4PA 5I4DA 4ZHOA 2IJ0A 1EU4A 3W5UB 1XCTL 2DBYA 1MHHE 2WXQA 2JSVX 1VZ8A 2ON8A 1JWAD 2M0AA 1FNWA 3R2IA 3R8BA 4XWWA 1L6UA 1RM6C 1HXYD 2N0SB 4RH6A 1AYFA 1VZ6A 2L83A 3NRZA 3TEZA 4YTNB 1JQ4A 1FFVA 1E6EB 2MH7A 3AE8B 1IGDA 1N62A 1XLNA 4RGNA 1GOZA 1JRPA 2GI9A 3U7ZA 2K22A 4LTUA 3HUIA 1WGKA 5FR3A 3LYYA 1NVID 2N9LA 1L0XB 4ARCA 3ETRA 2V3NA 5HHDG 2ACZB 3FILA 5HI1A 2EELA 2ZW1A 4A9AA 2PTLA 1N60A 5C3JB 2QEJC 2B76B 3FC4A 3SEBA 1SE3A 4L2YA 2WXMA 1B1ZA 2WQYB 2BTEA 1V1PA 2WDRB 1TKEA 4YSXB 1CJEA 1TYGB 2LFIA 1I4GA 2LGIA 1AW7A 3P1MA 4ZHPA 1TY0A 3AV8A 4RFBA 1J7AA 2CJNA 1UGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGT A;  1FD6 A;  1EM7 A;  4WH4 A;  1MI0 A;  1PGX A;  2RPV A;  2I2Y A;  1JML A;  1HZ6 A;  1P7F A;  3GB1 A;  1QKZ A;  2KWD A;  3UI3 A;  2PW9 A;  1Q10 A;  2LHD A;  2JWU A;  1PGB A;  1GB1 A;  1FCL A;  1F2R I;  4MAC A;  4OZB A;  1K50 A;  2IGH A;  4IOI E;  2N7J A;  2PLP A;  4KGR A;  1MHX A;  1GB4 A;  2IGD A;  4D2K A;  2I38 A;  5HFY A;  4OZA A;  1F2R C;  2JU6 X;  1K52 A;  1MVK A;  5BMI A;  2ONQ A;  2ZW0 A;  2LUM A;  5HG2 A;  2K0P A;  2KQ4 X;  1KH0 A;  1IGC A;  4GLS C;  4HKZ E;  2RMM A;  1YMH E;  2QMT A;  1P7E A;  2KAC A;  1XCQ L;  2IGG A;  5BMG A;  1FCC C;  5JXV A;  1ZXH A;  2GB1 A;  2JXT A;  2NMQ A;  1XCT L;  1MHH E;  2QSD A;  2JSV X;  2ON8 A;  2J52 A;  1YNT E;  1C9F A;  2JZP A;  4OZC A;  2J53 A;  2OED A;  1XF5 L;  1K51 A;  1UWX A;  1HEZ E;  1IGD A;  2KDM A;  2GI9 A;  3FIL B;  5BMH A;  2N9L A;  2N9K A;  1HZ5 A;  5HHD G;  4KGS A;  3FIL A;  5HI1 A;  2LHE A;  2EEL A;  2ZW1 A;  2PTL A;  1IBX B;  4HJG E;  1PGA A;  1MPE A;  3V3X A;  4IKG A;  1IBX A;  2KN4 A;  2LGI A;  1K53 A;  1D4B A;  3MP9 A; 
#chains in the Genus database with same CATH topology
 3A9J B;  3DPD A;  2D10 A;  1FD6 A;  1ROE A;  2N1V A;  4C7Y A;  4ANW A;  4ANX A;  3KUC B;  2FUH B;  2MLB A;  2MWS B;  1YJJ A;  1P9D U;  4HDQ A;  3P63 A;  5BO4 B;  2ZPN A;  1P1A A;  3PGE A;  1GB1 A;  2KYW A;  3N9Y C;  1WE6 A;  3M62 B;  1Q5W B;  4WJP A;  3A9K A;  2AL3 A;  3Q3O C;  3CWI A;  2XK5 B;  4OZA A;  3W5V B;  4KVG B;  4MSM B;  1NI2 A;  2JVC A;  4K1R B;  2O6V A;  2EKE C;  2RR9 A;  2W54 A;  1XLQ A;  1XEE A;  3PV1 A;  1JWS D;  3MC8 A;  2XN9 C;  3L08 A;  2CHZ A;  4HPP A;  2BW2 A;  3I57 A;  3LJ3 A;  2LGD A;  4ZYS A;  1TS3 A;  4C00 A;  2V0G A;  1T0R C;  3TEX A;  1ZP0 B;  1YN4 A;  3WAN A;  1Y56 A;  3TUO A;  2C60 A;  1JCK B;  4CHK A;  2INN E;  1XLP A;  3K9O B;  2BYT A;  3HIZ A;  1YJ1 A;  2FID A;  1R4M I;  1R4N I;  2DZI A;  3SHQ A;  3MC0 B;  1S3S G;  1R4N B;  3I63 C;  3RZW C;  2BS3 B;  1WJ6 A;  2K8C A;  4KGS A;  4DHJ D;  4LLG M;  4B0M A;  2L1A A;  4CO7 A;  3TIX A;  3PT2 B;  4AJW A;  2VH2 A;  2BYV E;  2PPH A;  2KN4 A;  2WX0 A;  1WGG A;  1ZE3 D;  1KLV A;  1K53 A;  3P4Q B;  3L13 A;  3FKY A;  1D5X C;  1NYR A;  2RPQ A;  3BVM A;  4FHK A;  1WGH A;  5H8Y E;  1C79 A;  3KLS X;  4MM3 A;  2CKH B;  2CR5 A;  3E56 A;  2FE8 A;  2WDT B;  1T0Q C;  2IO1 B;  4BKG A;  1CMX B;  1OQY A;  1L5P A;  2GBR A;  3URY A;  4DHJ B;  4URK A;  1EF1 A;  2Y5B B;  3Q69 A;  1RYJ A;  4JE3 B;  4YTM B;  1QOG A;  2VRR B;  2R61 A;  3X0W A;  1PFD A;  2K8H A;  3UIO B;  1JWM D;  1WGY A;  2LZ6 A;  5D3I B;  3ZDT A;  3RNA C;  1WXV A;  1Q1O A;  2X38 A;  3DVG Y;  1T5X D;  2C9W B;  4EZL A;  5J17 A;  4MDK E;  5D7G A;  3PZD A;  3BVZ A;  1XD3 B;  4XYC A;  3VH3 B;  2NBV B;  3R2T A;  2M17 A;  2N4F A;  2Y3A A;  4EFO A;  5EE3 A;  4ASW C;  3NS1 A;  4ICU A;  1SXT A;  3GOE A;  3DBL I;  1DYQ A;  1L4D B;  2WGS A;  3O65 B;  3ONS A;  4FLH A;  3EEC A;  1WX7 A;  2DZJ A;  2Y5P A;  3DBL B;  2NPT A;  2HD5 B;  4KZC A;  1I4R A;  4NQL B;  2FBW B;  2LHE A;  3ZJU A;  3KYD D;  3U7D A;  4L23 A;  1E8Y A;  4FJZ A;  3GE3 C;  1WGD A;  4OW0 A;  3NVZ A;  4HLE A;  1RLF A;  2BKF A;  4G0N B;  4LJO B;  4M02 A;  1HTQ A;  4N58 A;  3P4R B;  3AE7 B;  3ZYY X;  3UGB B;  3A1Q A;  3QAR A;  3BVG A;  4FUL A;  4MJS B;  3JYU A;  3R7Q A;  2LJI A;  4K7S A;  3QHT A;  2WS3 B;  2JWZ A;  4DWF A;  5KHO A;  1UNS A;  2A4Z A;  5TR5 A;  1KOT A;  1T0Y A;  3OLM D;  3N32 A;  2N9P C;  2M0X A;  1SEB D;  1SF0 A;  4YL8 A;  4ARI A;  4CQN A;  4NY0 A;  4MSQ B;  3ZTD A;  1QLB B;  4KKI A;  2MP2 A;  3AEA B;  4G50 A;  5EDS A;  1PYW D;  4MH0 E;  1PUT A;  2B3A A;  2KVR A;  2KFJ A;  3V62 A;  3T3N A;  2JXT A;  2FUG 1;  1M4V A;  2GOW A;  1TBE A;  2D11 A;  4NAW B;  1C9F A;  3V6C B;  4OZC A;  1FEH A;  4DXG A;  2L7R A;  2J0K A;  4GMV A;  1J19 A;  3IAS 1;  1OEY J;  2BWF A;  2WYQ A;  4E74 A;  2KX3 A;  2MBE A;  2DLB A;  3ZRC A;  3ENE A;  3RN9 C;  1L4Z B;  1HZ5 A;  4BAX A;  2KX0 A;  2DYB A;  2JUO A;  4DDI D;  4PS7 A;  1V1P B;  1MPE A;  2NTS A;  2JX5 A;  1RFA A;  5EE9 A;  2KAN A;  2AYO B;  4AS1 A;  5L83 A;  3M3J A;  4BFR A;  1SE2 A;  2NBU A;  3GP7 A;  1MG8 A;  3APD A;  2KQS A;  2KD0 A;  3VQI A;  3W1Y A;  3TEY A;  1VJK A;  3JVZ X;  2Y5C A;  4DBG A;  3WIM A;  1L0V B;  2DWQ A;  4QAY A;  3UI3 A;  1WXS A;  4WIP A;  2JWU A;  3KWL A;  3WA0 A;  3A9K B;  3QAQ A;  3IAM 1;  3LDZ E;  2PLP A;  3TJP A;  1MHX A;  4NJ7 A;  3EFC A;  1YN5 A;  4WAF A;  1TKY A;  2O6V B;  3NG0 A;  3Q3J A;  4C56 C;  2KKC A;  3I3T B;  2HDE A;  3NVV A;  4RMA A;  2LUM A;  4IWO A;  2WU2 B;  4B0E A;  3EUB 2;  3DHG C;  5AUK A;  3IFW B;  1KFY B;  1IPG A;  3BYT B;  4K81 A;  1CZP A;  1BML C;  3AE5 B;  1FRR A;  2JT4 B;  2IGG A;  3U4E G;  3W9C B;  1JWU D;  5I4D A;  2BYE A;  1EU4 A;  3W5U B;  2DBY A;  2WXQ A;  2DEN B;  1JWA D;  2M0A A;  1RM6 C;  1HXY D;  3OG5 A;  4RH6 A;  3H6N A;  3TEZ A;  2MH7 A;  3AE8 B;  4RGN A;  2HJ8 A;  1JRP A;  1GOZ A;  2BPS A;  3U7Z A;  4FJY A;  2NVU I;  3LYY A;  2VH1 A;  1L0X B;  5DPS A;  3ETR A;  5HHD G;  2LWP A;  5HI1 A;  2EEL A;  5JHA A;  2PTL A;  3SEB A;  1SE3 A;  1V2Y A;  4L2Y A;  3Q3F A;  2N9X A;  2OJR A;  4YSX B;  1TYG B;  2LFI A;  3P1M A;  1TY0 A;  3AV8 A;  5GMV A;  3ZLZ A;  3AXC A;  4IW0 A;  3DVN V;  4A90 A;  2REX A;  2QC8 A;  1E5W A;  4MM3 B;  2AX5 A;  1WGR A;  4W9L A;  1HQR D;  1SB3 C;  3Q8C A;  5JH5 C;  3RNB C;  2ZPY A;  1FCL A;  5J2R A;  3L17 A;  2MQJ A;  1FIQ A;  2R2Q A;  4W9I A;  5D6J B;  4M0W A;  2AQ1 B;  2G9H D;  4II3 B;  2UU7 A;  5CTR C;  4ACF A;  1V86 A;  2KT7 A;  4AOF A;  1WSP A;  1N5W A;  4C80 A;  5L95 C;  3QC8 B;  5CHW A;  2FIF A;  4MEM A;  2KAC A;  4G11 A;  5H92 C;  2KWU B;  2AQ2 B;  3AN1 A;  2NMQ A;  3ZDM C;  3VDZ A;  3AI5 A;  2QSD A;  1WYG A;  2W3S A;  1EO6 A;  4LJP B;  2KOX A;  2KC1 A;  3ALB A;  4A55 A;  2BT6 A;  2L8J A;  2OED A;  1TS5 A;  1K51 A;  3DBR I;  2NPT B;  4F7Z A;  1NEK B;  5FK9 C;  4FHJ A;  4E71 A;  3DBR B;  1ZOY B;  2FCS A;  5BYQ A;  5E6J A;  4ZOH C;  2CS4 A;  3V3X A;  3IBE A;  1OGW A;  1WI0 A;  1I4X A;  4NJ6 A;  3ML8 A;  2YEP B;  1E7P B;  3KVF B;  2K6D B;  2UWQ A;  3A1Q B;  2RDG A;  2KFK A;  5EE1 A;  4WWM A;  2QCZ A;  2K8B A;  5IN7 A;  1LGR A;  1WWT A;  3GB1 A;  2D5G A;  2WXO A;  3KWV A;  3ZXR A;  2V9H A;  1NDD A;  3DVG X;  1ZDV A;  2G4S A;  3B2F A;  2VZK D;  1UF0 A;  1JW9 D;  4A20 A;  3SR6 A;  3RD2 A;  1Y8R C;  3SD5 A;  2KMM A;  1C4C A;  1D5Z C;  4D2K A;  3PS6 A;  2QIL A;  5HFY A;  1T6B X;  2NCN A;  5KHQ A;  3RNC C;  2J4X A;  2MBO A;  2ONQ A;  2ZW0 A;  2L76 A;  3B9J A;  2LXC A;  2MP2 B;  1TKG A;  3NZU A;  3ML9 A;  1VDV A;  2KNB A;  1C4P A;  1WX9 A;  2HJ1 A;  3IVF A;  2KQ4 X;  2K39 A;  4HK2 A;  1IGC A;  3QA8 A;  1J7C A;  2IO0 B;  1C4A A;  4HKZ E;  2AEH A;  1FMA D;  1KLU D;  3PZ8 A;  1D6E C;  2K25 A;  2EMT A;  4JQW C;  2NTT A;  2NS5 A;  2E3T A;  4MGI E;  3GZN I;  2BS2 B;  4HRS A;  4JL9 A;  3RCZ A;  4XZ4 A;  1SIJ A;  3GZN B;  2LRU A;  1YNT E;  2VZK B;  2JZP A;  1ENF A;  2RD0 A;  3N1Y C;  5BYS A;  4N59 A;  2KHW B;  3P4S B;  5IA7 A;  1DOI A;  2QJL A;  4OHJ A;  4A8X C;  5BMH A;  4XX5 A;  5DPR A;  1ZXI A;  3NVY A;  3TSS A;  3OJ3 A;  1A5R A;  5LLI A;  4P1C C;  1JRO A;  4ANV A;  1UEL A;  4HJG E;  3AE3 B;  2TSS A;  1FRD A;  2KJR A;  3HRD D;  3VR9 B;  1N5X A;  1WIA A;  2LMC A;  2CHW A;  2XEW A;  4ZRJ A;  3N20 C;  1H8C A;  1X1M A;  4RF0 A;  1E0Z A;  2LXA A;  1MI0 A;  2RPV A;  2PVO D;  2ZZP B;  3M63 B;  1STE A;  2KLC A;  2JRH A;  3RZF A;  3TBL D;  3U2S C;  4IOI E;  3AE6 B;  2ZVN A;  1ZGU B;  4EUT A;  3IT6 B;  4W9H A;  1UZX B;  3QCA A;  3VUW A;  3ZJV A;  2D3B A;  4B95 A;  5LNK 1;  2MX2 A;  4PK1 A;  1MVK A;  2BKR B;  5BMI A;  1UWM A;  2W3R A;  4OVV A;  2GBM A;  3K9P B;  4YXD B;  4RCO A;  2JXX A;  3LB8 C;  2FCN A;  4PS8 A;  3UIP B;  1WR1 A;  2RMM A;  2QMT A;  1P7E A;  4RM9 A;  2H89 B;  1DGJ A;  3PHW B;  5T8I A;  1FCC C;  2RDB C;  3P4P B;  3Q3M C;  3N1Z C;  3I9V 1;  2FCM A;  1FM0 D;  5CHF A;  1V9J A;  3WAP A;  1GAQ B;  2IZV B;  2J52 A;  4XE0 A;  2V3S A;  1N61 A;  1JAL A;  3NJT A;  1N63 A;  2LRW A;  4HWI B;  1I42 A;  2SEB D;  3H7P A;  1FNV A;  1YQ4 B;  1FPY A;  1WMH A;  1XO3 A;  2KZR A;  1SIF A;  4FXC A;  4WQM A;  4YT0 B;  4TSS A;  1TY2 A;  4WWP A;  2WXI A;  3MHZ A;  3L0W B;  4MT5 A;  2R2O A;  2KTR A;  1S1Q B;  5E6P A;  3H9D A;  4I6P A;  2HTH A;  1V97 A;  1L7Y A;  1IBX A;  2MEK A;  2LD9 A;  5IAA C;  3W1S A;  1V6E A;  3VAW A;  5LXH A;  1BXT A;  4LCD E;  2SAK A;  3HHM A;  2WHI A;  2KWD A;  4BBN C;  2C7H A;  4LNF A;  2HTM E;  3A4R A;  4M00 A;  2ASQ A;  4MAC A;  4OZB A;  3UIN B;  2AWT A;  4M0W B;  3L54 A;  2IGH A;  2WXN A;  4KGR A;  3RUI B;  3PO0 A;  3U52 E;  2QDF A;  3BII D;  3PZ7 A;  2I38 A;  3RYT A;  1ET6 A;  5GXG B;  4XC2 A;  3V05 A;  3SFD B;  4IG7 B;  3EA6 A;  4NAM A;  2WWZ A;  1YQ3 B;  1E10 A;  4GGQ A;  4HCP B;  3AE1 B;  3B0A A;  1OQQ A;  1EU3 A;  1I4H A;  2Z0D B;  5JXV A;  4KZ0 A;  3MC9 A;  1LQB A;  4S0R A;  2KK8 A;  2JSV X;  2ON8 A;  3R2I A;  4S17 A;  2L83 A;  1I35 A;  2PJH A;  1P3Q U;  4YTN B;  3L16 A;  3PRZ A;  4KIK A;  2X8X X;  4WJO A;  4ZYN A;  1NBF C;  2KTF A;  1XLN A;  2GI9 A;  3RI7 C;  3VTU A;  3VTW A;  2K22 A;  3MHS D;  1WGK A;  2N9L A;  4KV2 A;  1V49 A;  2IND C;  2KN5 A;  2LGY A;  2V3N A;  5DPT A;  2N7D A;  1UH6 A;  1OTR B;  3P2B A;  2KXJ A;  4FJV B;  3SU8 X;  1B1Z A;  2WQY B;  2JRI B;  3ZW3 A;  2HE7 A;  2KFK B;  3ZTC A;  2CJN A;  2A5U A;  5IO9 A;  5MPO A;  2I2Y A;  3RNF C;  3RFZ B;  1KM7 A;  2PW9 A;  1ISN A;  4Q2J A;  4IWQ A;  2WXK A;  3ZKJ C;  1D3Z A;  4J6I A;  1FFU A;  2Z8L A;  1ESF A;  2N7J A;  3KYC D;  4DXF A;  4FBJ B;  4BOZ B;  3Q3N C;  5AUI A;  4NZL B;  2JU6 X;  2WDQ B;  1EWC A;  3AU4 A;  3VUX A;  4GSW A;  3EFU A;  1FNU A;  4KKJ A;  2LEK A;  2WX1 A;  2PE9 A;  3MJ5 A;  1L2N A;  2KDI A;  2BVC A;  2WXP A;  3JSV A;  5FKA C;  1UBI A;  2MBQ A;  1L6V A;  3WCQ A;  1SE9 A;  3HVZ A;  3D32 A;  1F9J A;  1ZUD 2;  1F52 A;  1TJE A;  4B9K A;  3MFG A;  3BWU D;  4K7U A;  3DWM A;  2LGS A;  2W82 A;  2ZCC A;  4OVZ A;  3C8Y A;  2GBK A;  2DHZ A;  4E3C A;  2L52 A;  2JYT A;  1XF5 L;  2WXJ A;  2KDM A;  3R3M A;  2KMC A;  4EZJ A;  3FAH A;  4W9J A;  2CHX A;  2N9K A;  4RGT A;  2K6Q A;  3A4S C;  3HK0 A;  1TIF A;  2WXG A;  2E6X A;  2BWE S;  1SE4 A;  1ZKH A;  3RNG C;  3J9C A;  4W9K A;  3AE2 B;  3L10 B;  4LDT D;  1MFW A;  2BB5 A;  3Q8E A;  4AJY B;  2H88 B;  2KWC A;  4MGZ E;  2JZZ A;  2MW5 A;  1NI3 A;  1P7F A;  3ZNI D;  1IYF A;  1LFD A;  4WUR A;  1FXI A;  1SJE D;  1T0S C;  1PGB A;  2IY1 B;  4YTP B;  2DX5 B;  1EUV B;  2G4D B;  1LM8 B;  2KWV B;  2EMS A;  2LVQ A;  4W9F A;  2YEP F;  3B2G A;  1HA5 A;  1B9R A;  2N7E A;  2WLB A;  2BYF A;  3WAM A;  1F2R C;  3Q8B A;  4JX1 C;  4TKN A;  3MTN B;  2XNA C;  3ZVV A;  1SJH D;  2IDY A;  2JYE A;  3APC A;  2BGF A;  4IWP A;  4JLC A;  4P16 A;  2W55 A;  3TCA A;  4GLS C;  4LDT B;  2BBC A;  3NVW A;  4GB9 A;  1TTN A;  5D94 A;  2PVG C;  3C0R B;  5BMG A;  2CU1 A;  1KTK A;  5DPW A;  1CQV A;  2LVP A;  2L32 A;  2GB1 A;  4WAA A;  1QZE A;  2V4L A;  2LVO A;  5C1Z A;  2D3G A;  2Q5W D;  3OJ4 B;  4ANU A;  2J7Q B;  3CST A;  4JWU C;  2DZM A;  5AZF A;  4IM2 A;  1WXM A;  5D2M B;  2D3A A;  2BQQ A;  4JWS C;  4C4V A;  3A33 B;  3GS2 A;  3H7P B;  2KJH B;  1WJU A;  1WMH B;  4NQK E;  1WXQ A;  1GNU A;  1V80 A;  5E6N A;  1QQR A;  2KTR B;  3U30 A;  1IBX B;  4IUM B;  4OVU A;  4TV3 A;  3AEG B;  2C5L C;  1TS4 A;  3B08 A;  2V4I B;  2NBW B;  2WXH A;  1D5M C;  3VR8 B;  1RFK A;  4EOY A;  1FXA A;  2L05 A;  4JPS A;  1SBB B;  1WRD B;  1HZ6 A;  1V1O A;  1NEN B;  4K7W A;  3IG3 A;  1QKZ A;  2IY0 B;  2XBB C;  3TEW A;  3IHP C;  3IT4 B;  2C7N B;  1K50 A;  3PTF C;  2ZJD A;  4N6E B;  3NUH B;  1Z2M A;  3VTV A;  3NY5 A;  2INP E;  1C76 A;  3W1S C;  1E8W A;  1ACC A;  2M19 A;  3AED B;  2YVC A;  1FO4 A;  1YIW A;  4TQ1 A;  4W9G A;  3PRE A;  1CK1 A;  3JW0 X;  2L0T A;  1GUA B;  3C19 A;  4US8 A;  1VRA B;  3DDC B;  3OAW A;  1EWY C;  2KDE B;  2V3P A;  5JHB A;  4YSY B;  2I1J A;  1WH3 A;  3KW5 B;  4DK5 A;  3AEE B;  3DCG A;  2PEA A;  2OOB B;  3T3O A;  5G55 A;  4YSZ B;  2WDV B;  1DOX A;  2KMA A;  4JIO U;  2RGF A;  1VLB A;  1QT9 A;  2L00 B;  4KIK B;  1NYQ A;  1WM3 A;  5DCN A;  3RT3 B;  2J53 A;  3ZXV A;  3PLV A;  2CJO A;  1LO5 D;  2J0J A;  4IC7 B;  4RNA A;  4IM0 A;  4HVB A;  1E8X A;  3WAL A;  1WFY A;  1V81 A;  3S2A A;  2JPH A;  2M8S A;  1GPX A;  3PLU A;  3ZUN A;  2IO2 B;  4IKG A;  2L0F A;  1BT0 A;  2FAZ A;  4P1B C;  3PSE B;  3ZO5 B;  1Z5S B;  4M8N A;  2IYD B;  2M1M A;  5G2N A;  5E6O A;  4BBN F;  1EM7 A;  2LJ5 A;  3WAO A;  4PS3 A;  1PGX A;  4BKS A;  1AN8 A;  4LNI A;  5FR6 A;  3VXW A;  2LHD A;  4P7I A;  1SGH A;  1E7V A;  1YJI A;  3HVD A;  3AUL A;  4KX6 B;  4WWN A;  4LNN A;  1QIL A;  3N1X C;  5AZG A;  4EKU A;  3DBH I;  4L1B A;  4W9E A;  2GLS A;  1T3Q A;  3DBH B;  4US9 A;  4FA6 A;  5IKC M;  5IOI A;  3NHE B;  1P0R A;  3JSV B;  4AQ7 A;  1C78 A;  5CX3 A;  2KVZ A;  4EE2 A;  4ZRQ A;  1WF9 A;  4GXB A;  3V61 A;  1TZO A;  2W9N A;  4AWJ A;  4W9C A;  2MJ3 A;  3AEC B;  2JF5 A;  4F8C B;  1YMH E;  1WR6 E;  2JY6 A;  1XCQ L;  2BB6 A;  1R4M B;  2AQ3 B;  2K1F A;  2DZK A;  3X23 A;  2AL6 A;  4ZHO A;  2IJ0 A;  1XCT L;  1MHH E;  3R8B A;  4XWW A;  3V60 A;  1FNW A;  1PQS A;  1L6U A;  2N0S B;  4GDL A;  1UD7 A;  3NRZ A;  2LUE A;  4HPM B;  3KUZ A;  1JQ4 A;  1U4A A;  1E6E B;  2MHJ A;  1IGD A;  1N62 A;  4JGH B;  4LTU A;  3HUI A;  4GDK A;  2KLG A;  4N9F 4;  2ACZ B;  3FIL A;  1WJN A;  3QIJ A;  5C3J B;  2QEJ C;  3FC4 A;  4GU2 A;  1GC7 A;  2DNF A;  2WXM A;  1EF5 A;  2O2V A;  3PHX B;  2WDR B;  3UQB A;  1CJE A;  2LGI A;  1I4G A;  4ZHP A;  1AW7 A;  4WJQ A;  2FCQ A;  1HTO A;  1J7A A;  4RFB A;  1AWD A;  1UGJ A;  5IP4 D;  1VZ7 A;  4ICV A;  1A70 A;  1ZW7 A;  2BF8 B;  3BK2 A;  1VR9 A;  4WH4 A;  1WZ0 A;  3R7R A;  3CF6 E;  3UQA A;  1TT5 B;  1RAX A;  3R66 C;  2V1Y A;  1HE8 A;  2MA9 B;  2ZNV B;  3RMK C;  1VD2 A;  4TMA B;  2MRP A;  3Q8A A;  1UBQ A;  3DBS A;  4WQO B;  3VVW B;  3MJW A;  2C7M B;  2IGD A;  4NNJ B;  2GBN A;  1YN3 A;  4DHZ B;  3H8H A;  2WXR A;  2K5P A;  3AM9 A;  3H7S A;  4BVU C;  1I4P A;  1V5O A;  1QOB A;  4WWO A;  5C2T B;  2DYM A;  2ZCB A;  1MG4 A;  2WXF A;  3AEF B;  4P6V F;  2Z59 B;  2ZNV C;  3DHI C;  3VFK A;  3QWZ B;  1TS2 A;  2G45 B;  5C23 A;  1E8Z A;  1ZXH A;  5BYR A;  4HEA 1;  4K3C A;  4ZDV A;  4HXD A;  3BK1 A;  4C4V B;  1N6Z A;  3SDL C;  2MJD A;  2PMV A;  3UF8 A;  4O1N A;  2OJW A;  5G5G A;  2MJE A;  3AB5 A;  1H4R A;  2WXL A;  5AEK B;  4H2A A;  4G3X B;  1IP9 A;  4RGM A;  2WNM A;  5TSS A;  4KDI C;  3EHV A;  1UWX A;  2LAS A;  2PE6 B;  3QK0 A;  3N3K B;  3CSF A;  3O13 A;  4NJC A;  3GE8 C;  2DAJ A;  4XGA B;  2G1E A;  4PYZ A;  3W2D A;  2GBJ A;  3QX1 A;  1PGA A;  2I1K A;  3VRA B;  4MH8 A;  4LK0 M;  1XQQ A;  1D4B A;  4C7Z A;  4RGO S;  4BKT A;  4CYE A;  1F0Z A;  1JWB D;  3N30 A;  1WJ4 A;  3A9J A;  1YX5 B;  1OFF A;  1WXA A;  4YWG G;  3BIN A;  3DWG C;  3BZD B;  4GN1 A;  5EE0 A;  3EC8 A;  3ZJT A;  1GG3 A;  4BOS C;  2KO3 A;  2GMI C;  2YLM A;  2ZVO A;  3HM6 X;  4DQO C;  2FNJ B;  4ITK A;  3ZQ4 A;  1J8C A;  1SSN A;  3DVN U;  2G3Q B;  3H1U A;  4EEW A;  2XK5 A;  4F1S A;  3KQ4 A;  5G5H A;  1KH0 A;  4LNK A;  1WE7 A;  1ZDX A;  1QOA A;  2KDF B;  1RRB A;  3I5J C;  3Q6B A;  1F77 A;  3ZNG C;  3IXS A;  2O6V D;  4BKS D;  1E9M A;  2ZEQ A;  2J42 A;  2RSU A;  1K8R B;  1YQB A;  1E90 A;  1MJD A;  4A3P A;  1V5T A;  1LXD A;  1RWS A;  3AU5 A;  3LXF A;  1C3T A;  1C1Y B;  3EGR A;  2IO3 B;  1KJT A;  3E9S A;  2KJ6 A;  4ZRK A;  1DOY A;  3QQ8 B;  2BS4 B;  2L3Z A;  1OEY A;  1L0Y B;  4IM3 A;  3VHT C;  4XDC A;  3CMM B;  4J3O D;  4USA A;  2M56 B;  3M95 A;  4I6L B;  2LI5 A;  2MBH A;  4A3O A;  1I7H A;  5J18 A;  1XXG A;  4HPL B;  3AE9 B;  3PRP B;  1WRI A;  4DHZ E;  4KGT A;  2MBB B;  1V8C A;  3QJZ A;  4XWT A;  3NZ3 A;  4LNO A;  3NZS A;  4RM8 A;  1JRU A;  3AEB B;  2EKI A;  3AH7 A;  2IPK D;  3NOB A;  1PDX A;  1F2R I;  3DHH C;  3DOW A;  1XT9 B;  1IUE A;  3BYY B;  4X57 B;  3VRB B;  4UDU C;  4II2 B;  2KDB A;  1GB4 A;  1G6J A;  2WP9 B;  2N9E B;  4REZ A;  1K52 A;  1TZ1 A;  4MGY E;  3ZGZ A;  1AAR A;  4M01 A;  1YX6 B;  3BY4 B;  3Q8F A;  3DQV A;  4GOC A;  2LGX A;  2J0M A;  2K0P A;  3APF A;  1XLO A;  2JZ3 B;  3T8M A;  2DYO A;  1KF6 B;  4HCN B;  4B6W A;  2QIE B;  1J7B A;  2PIA A;  1M94 A;  1Q0W B;  1WY8 A;  1R7S A;  2MSE D;  3AE4 B;  4HKQ A;  1KRH A;  4GDL B;  2KC2 A;  5LXI B;  3HM3 A;  2MCN B;  4AP4 C;  4RF1 A;  3RUL A;  2UYZ B;  2N1W A;  3ZRF A;  1QF6 A;  2IBI B;  1UUP A;  3RNE C;  1P98 A;  5CHV C;  3SFE B;  1TGZ B;  4GDK B;  4W9D A;  4GIV A;  1HEZ E;  4HRO A;  1FXT B;  4ZRI A;  3FIL B;  1ET9 A;  1E7U A;  1I4Q A;  5AZH A;  4XDD A;  1ZPS A;  2D3C A;  1OQR A;  4EZK A;  2KAJ A;  2O2V B;  3RPF C;  2K3U A;  4TQ0 A;  3P42 A;  4FN2 A;  2Z0E B;  2PKO A;  4IDI A;  2JQR B;  4FAD A;  3TMP B;  3CIR B;  4AUQ C;  3KH0 A;  3MP9 A;  2WU5 B;  1YD8 U;  1QOF A;  2KQ7 A;  3ABV B;  3ZIM A;  1JML A;  2ICI A;  4A6Q A;  2RDH A;  1WX8 A;  1Q10 A;  1WM2 A;  4MJS A;  1WYW B;  2M4N A;  2QHO A;  3VH4 B;  1C77 A;  4R3D A;  3Q2A C;  3TL5 A;  4TUU A;  2GRI A;  3V6E B;  5D3D A;  4ZRP A;  4NPN A;  3T9L A;  2K9X A;  3ZNZ B;  3NS8 A;  4M8M A;  4WJN A;  2CU3 A;  3ECI A;  2DAF A;  1UGM A;  4KDL B;  3PRM B;  4KSK C;  1GC6 A;  5HG2 A;  1WZ3 A;  1VCB A;  2OHF A;  4I6N B;  3PVL A;  4K3B A;  3KUD B;  3OWE B;  1GJZ A;  4PT5 A;  1BUI C;  3AMZ A;  4HJK A;  3VUY A;  1KLG D;  3L4P A;  4MEL A;  5JZE B;  4DDG D;  1VZ8 A;  1F1H A;  4BZA A;  1AYF A;  1VZ6 A;  1YOV B;  3U8Z A;  2D2Q A;  2D07 B;  4NAW A;  4PYU A;  1FFV A;  4HDO A;  2NR2 A;  5FR3 A;  1NVI D;  4ARC A;  3Q14 C;  4A9A A;  2ZW1 A;  1N60 A;  2B76 B;  4MGK E;  4DXA B;  3B1L X;  2INC C;  2BTE A;  5HKH A;  1V1P A;  1TKE A;  3ZNH B;  3PPA A;  4KSL C;  1J0G A; 
#chains in the Genus database with same CATH homology
 1VZ7 A;  1A70 A;  1FD6 A;  1ROE A;  4A90 A;  3BK2 A;  5MPO A;  1VR9 A;  4WH4 A;  4C7Y A;  4MM3 B;  2I2Y A;  2AX5 A;  1YJJ A;  3RFZ B;  1HQR D;  3P63 A;  2PW9 A;  1SB3 C;  3Q8C A;  4Q2J A;  1GB1 A;  2WXK A;  1FCL A;  3N9Y C;  4TMA B;  3Q8A A;  1FFU A;  1FIQ A;  2Z8L A;  1ESF A;  2N7J A;  4DXF A;  4M0W A;  2IGD A;  3CWI A;  2AQ1 B;  2G9H D;  4OZA A;  5AUI A;  3W5V B;  4NZL B;  2JU6 X;  1YN3 A;  2WDQ B;  1EWC A;  3H8H A;  2WXR A;  2K5P A;  3AM9 A;  1FNU A;  4KKJ A;  2W54 A;  2LEK A;  1I4P A;  1QOB A;  3MJ5 A;  1XLQ A;  1WSP A;  1XEE A;  2DYM A;  1N5W A;  2WXP A;  5C2T B;  4C80 A;  1JWS D;  2WXF A;  3AEF B;  5FKA C;  4P6V F;  2XN9 C;  1L6V A;  2BW2 A;  3I57 A;  3WCQ A;  3HVZ A;  2KAC A;  1ZUD 2;  1TJE A;  1TS2 A;  4ZYS A;  5H92 C;  1TS3 A;  2AQ2 B;  3MFG A;  1ZXH A;  3AN1 A;  3BWU D;  2V0G A;  5BYR A;  3TEX A;  1ZP0 B;  3DWM A;  1YN4 A;  2NMQ A;  4HEA 1;  2QSD A;  2W82 A;  3BK1 A;  1Y56 A;  1WYG A;  2W3S A;  3TUO A;  4OVZ A;  3C8Y A;  1JCK B;  2MJD A;  2PMV A;  4O1N A;  5G5G A;  2MJE A;  3AB5 A;  2WXL A;  4A55 A;  2INN E;  1XLP A;  2L52 A;  4H2A A;  2BYT A;  2BT6 A;  2OED A;  2JYT A;  1TS5 A;  1XF5 L;  2WXJ A;  2WNM A;  4RGM A;  5TSS A;  1K51 A;  1UWX A;  2KDM A;  1NEK B;  5FK9 C;  3MC0 B;  3FAH A;  1ZOY B;  2N9K A;  5BYQ A;  2BS3 B;  3O13 A;  4NJC A;  4KGS A;  4RGT A;  5E6J A;  4ZOH C;  2G1E A;  4LLG M;  4B0M A;  2WXG A;  3W2D A;  2E6X A;  1PGA A;  1SE4 A;  2L1A A;  3J9C A;  3V3X A;  1I4X A;  3AE2 B;  3VRA B;  4MH8 A;  2YEP B;  2KN4 A;  4LK0 M;  1E7P B;  1ZE3 D;  2BB5 A;  1K53 A;  3P4Q B;  1D4B A;  3Q8E A;  4C7Z A;  2H88 B;  2RDG A;  4RGO S;  5EE1 A;  1D5X C;  1NYR A;  4WWM A;  1F0Z A;  1JWB D;  3BVM A;  1NI3 A;  1P7F A;  1WWT A;  1OFF A;  3GB1 A;  2D5G A;  2WXO A;  4YWG G;  3KWV A;  5H8Y E;  1C79 A;  4WUR A;  3KLS X;  1FXI A;  1SJE D;  1PGB A;  3DWG C;  3BZD B;  5EE0 A;  4YTP B;  3ZJT A;  1ZDV A;  2FE8 A;  3B2F A;  2VZK D;  3E56 A;  1JW9 D;  3SR6 A;  4DQO C;  2YEP F;  3B2G A;  4ITK A;  1HA5 A;  1B9R A;  2KMM A;  1C4C A;  3ZQ4 A;  1D5Z C;  4D2K A;  2WLB A;  1SSN A;  2QIL A;  5HFY A;  1T6B X;  1L5P A;  1F2R C;  2J4X A;  3Q8B A;  4JX1 C;  2ONQ A;  2XNA C;  2ZW0 A;  3URY A;  3B9J A;  1SJH D;  2IDY A;  3Q69 A;  1RYJ A;  4JE3 B;  4YTM B;  1TKG A;  1QOG A;  2JYE A;  1AWD A;  3KQ4 A;  1VDV A;  5G5H A;  1C4P A;  2R61 A;  2KQ4 X;  1PFD A;  1KH0 A;  1IGC A;  1J7C A;  4P16 A;  1JWM D;  2W55 A;  1C4A A;  4GLS C;  1ZDX A;  4HKZ E;  1QOA A;  2BBC A;  1FMA D;  3NVW A;  5D3I B;  1KLU D;  3PZ8 A;  1F77 A;  1D6E C;  3IXS A;  2PVG C;  5BMG A;  1KTK A;  2NTT A;  1CQV A;  1E9M A;  2X38 A;  2J42 A;  2L32 A;  2E3T A;  2GB1 A;  1T5X D;  2BS2 B;  4HRS A;  2Q5W D;  1RWS A;  3LXF A;  5D7G A;  4JWU C;  3BVZ A;  1SIJ A;  3EGR A;  3R2T A;  1YNT E;  2VZK B;  4JWS C;  2JZP A;  1ENF A;  5BYS A;  2Y3A A;  3E9S A;  5EE3 A;  3GS2 A;  1DOY A;  3NS1 A;  4N59 A;  3P4S B;  2BS4 B;  1DOI A;  1SXT A;  2QJL A;  4OHJ A;  1DYQ A;  1WXQ A;  1L4D B;  4A8X C;  5BMH A;  1ZXI A;  2Y5P A;  3NVY A;  1L0Y B;  3TSS A;  1I4R A;  2FBW B;  2LHE A;  4XDC A;  1QQR A;  3ZJU A;  1JRO A;  4J3O D;  1IBX B;  4HJG E;  4L23 A;  3AE3 B;  4USA A;  2M56 B;  2TSS A;  1FRD A;  3AEG B;  3HRD D;  3NVZ A;  4OW0 A;  1TS4 A;  1I7H A;  3VR9 B;  2V4I B;  1N5X A;  2WXH A;  2LMC A;  1D5M C;  1XXG A;  3VR8 B;  4N58 A;  3AE9 B;  1WRI A;  3AE7 B;  3P4R B;  1RFK A;  4KGT A;  4RF0 A;  3ZYY X;  1E0Z A;  1FXA A;  1V8C A;  4JPS A;  1SBB B;  4XWT A;  1MI0 A;  3NZ3 A;  2RPV A;  2PVO D;  1HZ6 A;  3BVG A;  1V1O A;  1NEN B;  1STE A;  1QKZ A;  3AEB B;  3TEW A;  2EKI A;  3AH7 A;  3IT4 B;  2IPK D;  1PDX A;  1F2R I;  1K50 A;  2LJI A;  3U2S C;  1IUE A;  3BYY B;  4IOI E;  3AE6 B;  2WS3 B;  4N6E B;  3NUH B;  1UNS A;  3IT6 B;  3VRB B;  4UDU C;  2INP E;  1C76 A;  1GB4 A;  3ZJV A;  2WP9 B;  1ACC A;  2M19 A;  5LNK 1;  4REZ A;  3AED B;  1K52 A;  1MVK A;  1SEB D;  1FO4 A;  5BMI A;  1UWM A;  1SF0 A;  3ZGZ A;  4TQ1 A;  2W3R A;  4ARI A;  4CQN A;  3Q8F A;  1CK1 A;  4YXD B;  4RCO A;  2K0P A;  4US8 A;  1QLB B;  4KKI A;  1VRA B;  3LB8 C;  1EWY C;  1XLO A;  3AEA B;  2DYO A;  2V3P A;  1KF6 B;  4YSY B;  2QIE B;  1J7B A;  2RMM A;  2PIA A;  3AEE B;  2QMT A;  1P7E A;  1PYW D;  3T3O A;  1PUT A;  2H89 B;  1DGJ A;  5T8I A;  1R7S A;  2WDV B;  3AE4 B;  4YSZ B;  4HKQ A;  1FCC C;  1DOX A;  1KRH A;  3P4P B;  3I9V 1;  4GDL B;  2JXT A;  1FM0 D;  3T3N A;  2FUG 1;  1VLB A;  1M4V A;  1QT9 A;  1GAQ B;  4RF1 A;  4NAW B;  2J52 A;  4XE0 A;  1NYQ A;  1C9F A;  1QF6 A;  4OZC A;  1FEH A;  1UUP A;  2J53 A;  4DXG A;  1N61 A;  1JAL A;  2CJO A;  1LO5 D;  3SFE B;  1N63 A;  4RNA A;  3IAS 1;  4GDK B;  1HEZ E;  2SEB D;  4HRO A;  3FIL B;  1ET9 A;  1FNV A;  2DLB A;  1YQ4 B;  1I4Q A;  1XO3 A;  4FXC A;  4YT0 B;  4WQM A;  4XDD A;  1L4Z B;  1HZ5 A;  1ZPS A;  4TSS A;  1TY2 A;  1OQR A;  2KAJ A;  3RPF C;  2K3U A;  2WXI A;  3MHZ A;  1GPX A;  4MT5 A;  1V1P B;  1MPE A;  2NTS A;  2JX5 A;  4TQ0 A;  3P42 A;  4IKG A;  5EE9 A;  2PKO A;  1V97 A;  4IDI A;  1IBX A;  2MEK A;  2JQR B;  3W1S A;  4AS1 A;  3CIR B;  1SE2 A;  3MP9 A;  2WU5 B;  1BXT A;  3GP7 A;  1EM7 A;  1QOF A;  3ABV B;  3VQI A;  3TEY A;  1PGX A;  1VJK A;  2Y5C A;  1JML A;  2ICI A;  2SAK A;  4A6Q A;  1AN8 A;  2RDH A;  1L0V B;  2DWQ A;  2KWD A;  3UI3 A;  1Q10 A;  2LHD A;  4WIP A;  2JWU A;  2HTM E;  1YJI A;  3KWL A;  3HVD A;  4MAC A;  4OZB A;  1C77 A;  4R3D A;  2IGH A;  2WXN A;  3IAM 1;  2PLP A;  4KGR A;  3PO0 A;  1MHX A;  4KX6 B;  3U52 E;  2GRI A;  5D3D A;  4ZRP A;  1YN5 A;  3BII D;  4WAF A;  1TKY A;  3PZ7 A;  1QIL A;  2I38 A;  4C56 C;  1ET6 A;  2K9X A;  4L1B A;  2HDE A;  3NVV A;  5GXG B;  2CU3 A;  1T3Q A;  3V05 A;  4US9 A;  3SFD B;  3EA6 A;  2LUM A;  2WU2 B;  4NAM A;  4B0E A;  4AQ7 A;  3EUB 2;  5HG2 A;  5AUK A;  1YQ3 B;  1C78 A;  1E10 A;  1KFY B;  4EE2 A;  3BYT B;  4ZRQ A;  3AE1 B;  1CZP A;  2OHF A;  1BML C;  1TZO A;  2MJ3 A;  3AE5 B;  3AEC B;  1FRR A;  1YMH E;  3OWE B;  1XCQ L;  2IGG A;  4PT5 A;  2BB6 A;  2AQ3 B;  1OQQ A;  1BUI C;  3U4E G;  3W9C B;  3AMZ A;  1EU3 A;  1I4H A;  1JWU D;  1KLG D;  5JXV A;  3L4P A;  5I4D A;  4ZHO A;  2IJ0 A;  1EU4 A;  3W5U B;  1XCT L;  2DBY A;  1MHH E;  2WXQ A;  2JSV X;  1VZ8 A;  2ON8 A;  1JWA D;  2M0A A;  1FNW A;  3R2I A;  3R8B A;  4XWW A;  1L6U A;  1RM6 C;  1HXY D;  2N0S B;  4RH6 A;  1AYF A;  1VZ6 A;  2L83 A;  3NRZ A;  3TEZ A;  4YTN B;  1JQ4 A;  1FFV A;  1E6E B;  2MH7 A;  3AE8 B;  1IGD A;  1N62 A;  1XLN A;  4RGN A;  1GOZ A;  1JRP A;  2GI9 A;  3U7Z A;  2K22 A;  4LTU A;  3HUI A;  1WGK A;  5FR3 A;  3LYY A;  1NVI D;  2N9L A;  1L0X B;  4ARC A;  3ETR A;  2V3N A;  5HHD G;  2ACZ B;  3FIL A;  5HI1 A;  2EEL A;  2ZW1 A;  4A9A A;  2PTL A;  1N60 A;  5C3J B;  2QEJ C;  2B76 B;  3FC4 A;  3SEB A;  1SE3 A;  4L2Y A;  2WXM A;  1B1Z A;  2WQY B;  2BTE A;  1V1P A;  2WDR B;  1TKE A;  4YSX B;  1CJE A;  1TYG B;  2LFI A;  1I4G A;  2LGI A;  1AW7 A;  3P1M A;  4ZHP A;  1TY0 A;  3AV8 A;  4RFB A;  1J7A A;  2CJN A;  1UGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...