3RNCC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i100a double mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 23
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rncC00
3RN9C 3Q3MC 3I5JC 3RI7C 3RNCC 3DHHC 3DHIC 3RNAC 3N20C 4P1BC 3RNEC 3N1ZC 1T0SC 2INDC 3DHGC 3Q3NC 2INCC 3N1XC 4P1CC 3RNFC 3GE3C 3Q3OC 3Q14C 3RMKC 3RNBC 2RDBC 3I63C 3GE8C 3Q2AC 3RNGC 1T0QC 1T0RC 3N1YC
chains in the Genus database with same CATH superfamily
4NAMA 2SEBD 1L0XB 2J42A 4A3PA 2BS2B 4JWUC 3ZNID 3N1ZC 3DHGC 2J53A 1YQBA 2XK5A 4WQMA 1IP9A 4NAWA 4KKJA 4XE0A 3OLMD 1IGDA 2V4IB 3VDZA 1SF0A 1RWSA 4L2YA 2MA9B 4G3XB 1QZEA 3BWUD 2KWDA 2L83A 5AEKB 2M0XA 3RZFA 3AU5A 4GN1A 1XF5L 4ANWA 1V1OA 4LDTD 3P4QB 3H6NA 4ASWC 3AB5A 2L05A 1V49A 2WXRA 2G4DB 2AQ2B 2WU5B 3W1YA 3BVMA 3R2TA 3DBLI 3NS1A 4E71A 2IYDB 1FFVA 4FLHA 4HXDA 1QOGA 4XC2A 2AL6A 1XLOA 5TR5A 1RRBA 2K0PA 1UGJA 3W1SA 2Z0DB 2A5UA 2KLGA 3ML8A 2K25A 4P6VF 1C9FA 2LI5A 1WF9A 3JSVB 3UINB 1VZ7A 1ROEA 3BK1A 3MC8A 2NCNA 2IO2B 2WGSA 4A6QA 3EHVA 1AYFA 2GBNA 4GOCA 2NR2A 2KDEB 2PPHA 4RM9A 3U30A 2WLBA 4KZCA 2WWZA 2AQ3B 2LASA 4K7WA 4TKNA 2BWES 5CX3A 5LXIB 2PKOA 4RGMA 5JXVA 2LRWA 3LYYA 2ZZPB 2WU2B 3R3MA 5C1ZA 1OEYJ 5IA7A 2VZKD 2WXIA 4FXCA 1FRDA 1YN4A 1ZP0B 3Q3OC 2KQ7A 2EELA 2LVPA 3AE7B 1GJZA 4OHJA 4E3CA 3RNAC 1J0GA 4WWPA 2MCNB 5T8IA 2QJLA 2QEJC 4EZLA 3CMMB 5AZHA 5D6JB 1NVID 1EF5A 1DOXA 1MFWA 2FNJB 4FN2A 2IGDA 1ZGUB 5J17A 4HWIB 3IT6B 2XNAC 4P16A 1RFAA 4MJSA 1E8YA 1OQYA 3VAWA 3K9PB 2BYTA 1FMAD 1NDDA 2Z8LA 3DVNU 1WIAA 1R4NI 2PE6B 3P42A 3LDZE 3QHTA 2KVZA 1UD7A 2E3TA 3U52E 3L08A 3BVZA 1E8XA 2RPQA 3VRAB 2KK8A 2ASQA 4W9LA 2NTTA 3C8YA 3VTVA 3KYCD 2I1JA 3RI7C 5IN7A 3PT2B 2C60A 2KANA 3TMPB 4WJPA 1HZ5A 4FJVB 3QA8A 4DXFA 4G11A 3A1QB 2L8JA 5AZGA 5C2TB 1N5WA 2QHOA 3AE6B 4JQWC 4HCNB 2LUMA 2WX0A 3NZSA 4HDOA 3IVFA 3ZKJC 3TEYA 1PGXA 3O65B 4MGYE 3AECB 3V6EB 5FR3A 3H7PA 4DHJD 3NJTA 3KUZA 4JGHB 3V05A 4XWWA 4GSWA 4N59A 3UIPB 2YEPF 2ONQA 3PZDA 4B6WA 2WXOA 3N30A 1EUVB 3VTUA 2TSSA 1P1AA 2JSVX 3ZO5B 3O13A 5E6JA 2I1KA 1WX9A 2EMSA 5H8YE 2V4LA 2BF8B 3Q8AA 3AN1A 3P4PB 3U7ZA 3S2AA 3MC9A 2IY1B 2LVQA 4IWOA 2BYEA 3VQIA 2KN5A 3PPAA 5L83A 1OTRB 5D2MB 3URYA 2FUHB 1FXIA 5EE3A 2V3PA 3L10B 1HZ6A 4HLEA 3QQ8B 2BPSA 4NY0A 4L1BA 2AYOB 2BYFA 1YX6B 2L1AA 3Q2AC 3Q6BA 2N1WA 2CU3A 2WQYB 1SJED 2WNMA 1D5XC 4EKUA 3NVVA 4II2B 1WR6E 1C77A 2J4XA 1I4RA 3QIJA 3UI3A 1ZOYB 3UGBB 1WMHA 3L17A 3RNBC 2BBCA 1FNWA 1P98A 3UQAA 3NG0A 2RDBC 4HKQA 2AL3A 1N63A 2BB5A 4K3BA 1V8CA 3ZXRA 4BKSA 3HM6X 2FIFA 2KFJA 1QILA 2K8CA 1D5ZC 5MPOA 2KYWA 1WRDB 1ZKHA 1WY8A 4N58A 3L54A 1C78A 1SJHD 1JWSD 4XYCA 2NMQA 1C76A 3ZLZA 5FK9C 2KOXA 4IM2A 4RNAA 2KQSA 3R8BA 5FKAC 1L4DB 1WH3A 1A5RA 4DWFA 3ONSA 2RD0A 4GB9A 4A3OA 3WIMA 4FADA 4XZ4A 2LGYA 3DBLB 4FHJA 2KZRA 2H89B 2GMIC 3AE8B 2QILA 3DDCB 4K81A 2CU1A 4YL8A 2QCZA 5G5GA 3CF6E 2XEWA 4FA6A 2D3BA 4AQ7A 2KO3A 1FPYA 4WJNA 2GB1A 4ZRJA 2C9WB 1L7YA 2RDGA 4ZHOA 2IBIB 2DYBA 4FBJB 1K53A 1D6EC 2KQ4X 3NVWA 3AE5B 3KW5B 3I5JC 2MP2A 2I38A 2PE9A 3RNCC 1I35A 3VR8B 2M1MA 2D11A 1G6JA 2INDC 3EFCA 3PHXB 5TSSA 3RMKC 2K5PA 3PRPB 3QWZB 4K7SA 4GDLA 2W55A 4PS7A 2C7MB 3BVGA 1LQBA 1Z5SB 2HDEA 3JYUA 1GPXA 4ARIA 4M8NA 3ZJTA 4WAFA 5HHDG 2D2QA 1DGJA 3VXWA 4DHZB 4HEA1 2FAZA 3N3KB 4M01A 1JWMD 4MT5A 2IDYA 1LFDA 3RD2A 2MLBA 2MSED 4HPLB 3P4RB 1VD2A 2M56B 1KF6B 2WDTB 2WXMA 1T5XD 3H8HA 3ZQ4A 2JYTA 2Q5WD 2GBMA 1LGRA 1DOIA 2L32A 1I4XA 4M00A 2EMTA 2LXAA 3DQVA 3ENEA 5J2RA 1STEA 1WJUA 3KWLA 3L0WB 1CZPA 4ZRQA 3TUOA 2BKRB 2DZIA 3A9KB 1UF0A 1FNVA 2J0KA 1HTOA 5BMGA 1R4NB 1GB4A 2WXLA 4NNJB 4C4VB 4K7UA 3ZYYX 3LB8C 5C3JB 2KX3A 5FR6A 3TEWA 2V0GA 1OGWA 1YN3A 4YTNB 3V3XA 1K52A 2HD5B 4PT5A 1TS2A 4RMAA 5BMHA 4WWNA 3M63B 2KAJA 1BXTA 2PW9A 1L6VA 3ETRA 1WRIA 1SEBD 4IM3A 5EE0A 1AWDA 1WSPA 1P3QU 1ZDVA 1GB1A 1ACCA 4EUTA 1VZ8A 3TEXA 2M19A 4AUQC 3OWEB 4OZCA 3B08A 3ECIA 1FM0D 2QC8A 3NVZA 2LJ5A 3AH7A 3WANA 1P7EA 2H88B 1QOAA 3OAWA 4AJWA 1JW9D 2UWQA 1V2YA 4LDTB 2KDFB 1LM8B 4TMAB 3WAMA 1MPEA 2O6VA 1TTNA 2BVCA 2XBBC 4RF0A 2LVOA 2MBEA 4AS1A 4W9JA 3NUHB 4KGTA 1WGKA 3R7RA 2KMAA 2DZKA 4YSZB 1SSNA 2G45B 3AM9A 1KTKA 1CQVA 3CWIA 2GBRA 2PLPA 3RNGC 2DYOA 3U2SC 2INPE 2J52A 1TBEA 1MI0A 1T6BX 5D3IB 2OOBB 4LCDE 3H1UA 1XLQA 5IO9A 2KT7A 1FFUA 3A9JA 4B95A 1EO6A 3UIOB 3SDLC 3CSFA 1M4VA 5D94A 3T9LA 4A8XC 3P2BA 4EEWA 2BT6A 1RLFA 1WI0A 2YVCA 5DPRA 1ET9A 2JXXA 2LWPA 2WXHA 4XDCA 4OZBA 3L13A 3FILA 1MJDA 1PQSA 3ZNZB 2KMCA 4FULA 2K3UA 4M8MA 2WP9B 3M95A 1QOFA 5KHQA 1UBIA 3ZRFA 1GAQB 2WHIA 1T0YA 3PREA 4O1NA 3B0AA 4DXGA 1ZUD2 2KWUB 1P0RA 2WXNA 2DX5B 2VZKB 2ZW1A 2L52A 1L0YB 1RM6C 5DPTA 4IWQA 1FIQA 4KVGB 4IUMB 4UDUC 3DOWA 4TUUA 4BKGA 1ZPSA 2NBUA 1E10A 3Q3JA 3W1SC 2SAKA 3ZW3A 4ICVA 1UUPA 3QC8B 4MELA 1YNTE 4TSSA 5EE9A 1ZDXA 3Q14C 1MVKA 4X57B 3ZRCA 3WAOA 4HJKA 4WWMA 2LRUA 1FEHA 3LXFA 2DHZA 4WWOA 5BYSA 4MSQB 1V5OA 2G3QB 2LGDA 1J7AA 5G2NA 3W2DA 1WZ0A 1D3ZA 1E7UA 2DBYA 5C23A 2WDVB 3JW0X 5GXGB 1ESFA 3GB1A 1U4AA 3WA0A 4I6LB 2WX1A 3IFWB 3P1MA 1K51A 1Q5WB 3C19A 1F0ZA 3IT4B 1NI2A 2NPTB 3QAQA 4HDQA 2JRHA 4ITKA 4J6IA 1KOTA 4NQKE 2KMMA 2KX0A 4LJOB 4RFBA 1F52A 3IAM1 3GE3C 1MHXA 3EUB2 3AMZA 2RR9A 2FIDA 3Q8BA 2OJWA 5HI1A 1L4ZB 4N6EB 1TS4A 4M0WA 1WFYA 3PVLA 4JE3B 1M94A 4DHJB 1JROA 2KC2A 3N1XC 4I6NB 2B76B 5D7GA 3DVGX 2N1VA 1L0VB 3DBRB 2CHWA 3AE4B 2V1YA 5CHVC 2QIEB 2PJHA 4DK5A 3B1LX 3AEEB 3Q8CA 4NJ7A 5JHBA 3UF8A 4BBNC 1Q10A 2KD0A 4ICUA 3AE3B 3V62A 2AEHA 4RGNA 1C4CA 5IOIA 4MEMA 2LGSA 3V61A 2HTHA 2N4FA 5BYQA 4USAA 5HG2A 3TJPA 3A33B 1QF6A 2C7HA 1V86A 3PLVA 3HHMA 4P1BC 1SB3C 1WJ4A 4AJYB 4C00A 1L6UA 1P7FA 1SBBB 3VVWB 2QMTA 3B2FA 2L00B 3QJZA 4BKSD 1L5PA 5G55A 4KKIA 1BT0A 5DPSA 1XLNA 3ZNGC 2JT4B 3ZJUA 3E56A 4IM0A 3RYTA 4PYUA 2WS3B 2K8BA 3RULA 3SR6A 1K50A 4BVUC 2JXTA 1F1HA 2CJOA 2CS4A 4OW0A 4XDDA 2MEKA 4MH0E 4MGKE 2J0JA 4KDLB 4XX5A 4BZAA 1J8CA 3KWVA 1WGDA 2KDBA 2O2VB 3AE2B 3EC8A 3P4SB 2Y3AA 2WXPA 1AW7A 2N7DA 1NI3A 1KLVA 2AX5A 1JWBD 1CMXB 1WGYA 2PMVA 3I63C 1UBQA 2A4ZA 3HUIA 2LGIA 3TIXA 3RN9C 4TQ0A 2ZJDA 3RCZA 3HVDA 3BINA 3MC0B 4R3DA 3Q69A 3SFEB 2JPHA 4PS8A 1WXVA 4P1CC 2BB6A 2V3NA 2MBHA 1WXSA 2D3AA 4NZLB 3GS2A 4GLSC 2WXGA 1ET6A 5E6NA 1KFYB 1HE8A 2CHZA 1FCLA 1Y8RC 2N7EA 2ZVOA 2Z0EB 1E8ZA 5CHFA 5BYRA 3EA6A 1RAXA 2WYQA 2FUG1 2KTRB 1I4QA 3JSVA 2N9EB 2E6XA 5D3DA 1GOZA 2ICIA 3VUWA 2RDHA 2PTLA 1V9JA 4ZOHC 1JMLA 2CR5A 1T0RC 2C7NB 2D07B 3ZDTA 2N7JA 5CHWA 4EE2A 1IGCA 3AE9B 5LNK1 1A70A 3PS6A 4KIKB 2EKIA 3KUCB 4LLGM 2DAJA 4LK0M 4C7ZA 3MHZA 1N61A 1VZ6A 4NQLB 2Y5BB 3IBEA 1TY2A 5L95C 1B1ZA 2BKFA 1N60A 4F8CB 3ML9A 1ZXHA 2NS5A 2IJ0A 1N5XA 5GMVA 2DAFA 2K9XA 1GNUA 4XGAB 1T0QC 2IGGA 2NTSA 1ENFA 2R2QA 4AP4C 4GU2A 2PEAA 1S1QB 4HRSA 2FE8A 4KGRA 2KXJA 1VRAB 3BY4B 5H92C 3X0WA 2XK5B 2D5GA 2HJ8A 4IOIE 4NAWB 4WJOA 4B9KA 1UWXA 2FCSA 3MFGA 1ZXIA 1YJJA 4GXBA 1VR9A 3ZVVA 2RMMA 2N9LA 2KHWB 3Q3FA 3I9V1 1JWAD 3N20C 3DBHI 5JH5C 1J19A 1YOVB 2ZNVB 1KLGD 3A1QA 3L16A 4YTPB 2KNBA 3ZDMC 2AWTA 3ALBA 3NOBA 3WALA 2O6VD 2D3CA 3KH0A 1YJIA 2BWFA 1YMHE 4GIVA 2KJ6A 1SXTA 1VJKA 1E90A 2VH1A 3RFZB 4ARCA 5BO4B 1JRPA 2IY0B 3VH4B 4C80A 1I4HA 1QQRA 4FHKA 3V6CB 2JRIB 2PIAA 4IC7B 2NVUI 2KJHB 1QKZA 2YLMA 4OZAA 3NHEB 1WX7A 1MG8A 1IBXA 3DHIC 4ANUA 1FXAA 1I4GA 1V81A 3VFKA 4ANVA 4MM3A 2HTME 3APFA 4G0NB 3BYYB 1Q1OA 4W9EA 4AWJA 1XEEA 3Q8EA 1N6ZA 1V1PA 1F77A 2BS3B 1R4MI 1KJTA 4JPSA 3EGRA 4RF1A 4EZKA 4LTUA 4KV2A 1HXYD 4NJ6A 4ZYNA 1GG3A 3B9JA 2B3AA 2REXA 1YN5A 4OVVA 3SFDB 2G1EA 1N62A 2DYMA 4IW0A 4RGOS 1H4RA 4YTMB 3IAS1 3J9CA 2ZW0A 4BBNF 1BMLC 2M4NA 4LNFA 1WR1A 1V97A 1V5TA 4MSMB 1S3SG 3BYTB 2BTEA 1XT9B 2MWSB 4M0WB 3M62B 4BFRA 1F2RI 1WX8A 2L0TA 1WE6A 3KVFB 2M8SA 1H8CA 4BAXA 3TSSA 2K1FA 2X38A 3AE1B 3R66C 1MHHE 4ZYSA 4W9GA 1UH6A 1NBFC 2ACZB 1TZ1A 1WM2A 4MJSB 2GOWA 2WDQB 3A4RA 1D4BA 3TEZA 1CK1A 2FCMA 4HPPA 1TS5A 3VUXA 4W9IA 3AEAB 1WXAA 4DBGA 4HCPB 1XCTL 1HQRD 4HK2A 5LXHA 2W54A 1F9JA 4PYZA 1RFKA 5AUIA 2KFKA 5IP4D 1XCQL 3PGEA 3GP7A 4W9KA 3RUIB 1PDXA 4KX6B 3AEDB 3U4EG 1VLBA 4ZDVA 3ZTDA 4TV3A 5AUKA 3R2IA 4NJCA 1T3QA 2LEKA 1JCKB 5E6OA 3RZWC 3BK2A 1UELA 4E74A 2LJIA 3TCAA 2L76A 2MBBB 2X8XX 3GE8C 1X1MA 4HVBA 2LFIA 2ZNVC 4DDID 4FJYA 2M17A 5J18A 3H7PB 1WGRA 1UZXB 3H9DA 4CYEA 2JQRB 3GZNI 1SE9A 1KH0A 4IDIA 4DHZE 3IG3A 4K1RB 2PVGC 2INCC 4WJQA 4ANXA 4MH8A 2VRRB 3DVNV 2G4SA 1PGAA 3BIID 4GDKA 1E9MA 1LO5D 2WDRB 1P9DU 4D2KA 5JHAA 1T0SC 4LNIA 1E7PB 4W9HA 4AOFA 3RPFC 3WCQA 1GC6A 4ZRKA 3T8MA 3N9YC 2NBVB 5EDSA 1YIWA 2INNE 1D5MC 4CQNA 4H2AA 4MGZE 1DYQA 3U8ZA 3NZUA 2D10A 1WM3A 3GOEA 2DZMA 3HIZA 3KQ4A 3IHPC 1HA5A 2MH7A 5HKHA 1J7CA 3Q8FA 1SE3A 4URKA 4ZRIA 1IUEA 3HM3A 3W5VB 2KKCA 3A4SC 2OHFA 3ZGZA 4KGSA 1XQQA 2ZCBA 5KHOA 4GGQA 1V6EA 3DHHC 4JL9A 3T3NA 2JX5A 1HEZE 1J7BA 4S0RA 2DLBA 1WMHB 3PV1A 3MJ5A 1NYQA 4K3CA 2K8HA 2MBQA 1EU4A 3A9KA 1EU3A 1ZW7A 1NYRA 4YWGG 1GC7A 2NBWB 1C4AA 1C79A 4C4VA 2XN9C 4WURA 1E0ZA 3V60A 2IO1B 1WXMA 3DVGY 4MDKE 4RM8A 3Q3NC 2JY6A 2K6QA 4ZRPA 1FRRA 3NRZA 3R7QA 2KDIA 3PLUA 1WYGA 3APDA 3DBHB 1WZ3A 4BOSC 3Q3MC 3VH3B 3PSEB 5E6PA 3VRBB 2PVOD 2LZ6A 1XD3B 3VTWA 4TQ1A 4A90A 3VUYA 3T3OA 4KSLC 4WQOB 1DOYA 2IGHA 3QK0A 2L0FA 2BW2A 1SIJA 2IPKD 4DXAB 2ZPYA 3DWMA 3I3TB 3E9SA 3IXSA 2W9NA 1TKYA 1EM7A 4REZA 4QAYA 4JWSC 2D3GA 1JALA 1OQRA 1IYFA 2K6DB 2KVRA 3QCAA 4BOZB 5JZEB 4II3B 3KLSX 4LNNA 2FCQA 1Q0WB 5G5HA 1EWYC 2ZVNA 1YQ3B 2DENB 1TYGB 2MJ3A 3AEGB 1TKGA 3NZ3A 4EFOA 2MP2B 3M3JA 1R7SA 2L3ZA 2MJEA 1WE7A 4KDIC 1R4MB 2RSUA 2KWCA 4W9FA 2J7QB 1FO4A 4GMVA 4N9F4 4HROA 3MJWA 5CTRC 1FD6A 4GDLB 2G9HD 2JUOA 2GBJA 3L4PA 1QT9A 3QARA 1WJ6A 2Y5CA 1NENB 1SE2A 2MBOA 4G50A 1Y56A 1PUTA 4YXDB 2MHJA 2MRPA 2C5LC 2CJNA 1RYJA 2GI9A 3HRDD 3MP9A 2KLCA 1YQ4B 2RGFA 1UNSA 2KACA 1WXQA 4C56C 1IBXB 4US9A 2DZJA 3ZIMA 2N9KA 3PHWB 3MTNB 4MM3B 2JU6X 2J0MA 4WIPA 4ZHPA 1VCBA 2LGXA 4RGTA 2BS4B 1AARA 1OQQA 3CSTA 1HTQA 3CIRB 3DPDA 3ZNHB 1V1PB 4JX1C 2ZPNA 2OJRA 1KRHA 2KN4A 3K9OB 1IPGA 3PRZA 1EWCA 1Z2MA 4OVZA 2AQ1B 3NVYA 2IZVB 1ISNA 3N32A 3P63A 4W9CA 1QLBB 2KC1A 2QDFA 1JRUA 1FCCC 2LXCA 1WJNA 4RCOA 4HJGE 2N0SB 1LXDA 2YEPB 2RPVA 3PRMB 4M02A 3ZXVA 1KLUD 4F7ZA 4CHKA 1TS3A 3VR9B 1K8RB 4C7YA 4J3OD 4L23A 3FKYA 5IKCM 1ZE3D 1OEYA 4F1SA 3W9CB 2NPTA 3HVZA 4LNOA 1TT5B 2GBKA 1SIFA 4A20A 4MGIE 3AXCA 2KWVB 1I4PA 3GZNB 2OEDA 1WYWB 2ZCCA 3AEBB 4RH6A 3DWGC 4DDGD 2LUEA 2JZ3B 2O6VB 2MJDA 4EZJA 1PYWD 2MQJA 3AI5A 3DBSA 4PK1A 1WGHA 3ZUNA 2DNFA 4LNKA 4B0MA 2KFKB 2N9XA 4JLCA 3W5UB 1BUIC 1AN8A 3H7SA 1E6EB 3N1YC 1E5WA 4PS3A 2R2OA 4I6PA 2WXJA 1I7HA 1MG4A 3A9JB 5IAAC 3AULA 3HK0A 1XLPA 3RNEC 2UYZB 5DPWA 1L2NA 2MX2A 2EKEC 1EF1A 1TGZB 3FILB 3VHTC 1TIFA 2CHXA 2WXFA 5LLIA 3WAPA 2QSDA 3JVZX 5BMIA 1TY0A 1WWTA 3SEBA 5DCNA 4A55A 4NPNA 4EOYA 1GUAB 2K39A 1CJEA 3B2GA 3ZJVA 3U7DA 2K22A 1QOBA 5EE1A 4GDKB 3OG5A 2KJRA 1TKEA 2JZZA 4OVUA 3DBRI 1F2RC 3PO0A 1OFFA 3PTFC 3TL5A 2R61A 1E7VA 1V80A 3X23A 2LHEA 4P7IA 1C4PA 1PGBA 2WXQA 2JYEA 2BYVE 1JWUD 3RT3B 3LJ3A 2I2YA 5HFYA 2HE7A 2UU7A 2KTFA 2MW5A 2O2VA 5AZFA 2KDMA 2BGFA 2V3SA 2CKHB 3KUDB 4FJZA 1FXTB 3QX1A 3APCA 2IO3B 2L7RA 1XO3A 4DQOC 3TBLD 1C3TA 4YT0B 3SHQA 1C1YB 4MACA 3DCGA 5I4DA 3EECA 2HJ1A 1PFDA 3PZ7A 4HKZE 4W9DA 3AV8A 1YJ1A 3NY5A 2Z59B 4YSXB 1VDVA 2N9PC 3I57A 2GRIA 3OJ4B 2M0AA 1KM7A 2JZPA 3FC4A 1WGGA 1YD8U 2JF5A 4HPMB 4S17A 1NEKB 2ON8A 3OJ3A 4KSKC 3SU8X 4IWPA 2KTRA 2FCNA 1UGMA 3SD5A 1SE4A 2IO0B 3KYDD 2GLSA 2V9HA 2VH2A 4XWTA 4LJPB 3AU4A 3EFUA 3MHSD 2ZEQA 1B9RA 2W3SA 2FBWB 1UWMA 2LMCA 3C0RB 4WH4A 4Q2JA 1E8WA 3PZ8A 3ABVB 3ZTCA 2W82A 2LHDA 4KZ0A 3AEFB 1I42A 4CO7A 3RNFC 4KIKA 3UQBA 4US8A 1TJEA 4B0EA 1FNUA 4A9AA 1XXGA 4YSYB 4JIOU 4IG7B 2Y5PA 2DWQA 1JQ4A 2JWUA 2LD9A 3FAHA 4WAAA 1YX5B 3BZDB 1TZOA 2JWZA 2W3RA 4ACFA 2BQQA 1SGHA 3D32A 2WXKA 3NS8A 4IKGA 2JVCA 4BKTA
chains in the Genus database with same CATH topology
3RN9C 3Q3MC 3I5JC 3RI7C 3RNCC 3DHHC 3DHIC 3RNAC 3N20C 4P1BC 3RNEC 3N1ZC 1T0SC 2INDC 3DHGC 3Q3NC 2INCC 3N1XC 4P1CC 3RNFC 3GE3C 3Q3OC 3Q14C 3RMKC 3RNBC 2RDBC 3I63C 3GE8C 3Q2AC 3RNGC 1T0QC 1T0RC 3N1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN9 C;  3Q3M C;  3I5J C;  3RI7 C;  3RNC C;  3DHH C;  3DHI C;  3RNA C;  3N20 C;  4P1B C;  3RNE C;  3N1Z C;  1T0S C;  2IND C;  3DHG C;  3Q3N C;  2INC C;  3N1X C;  4P1C C;  3RNF C;  3GE3 C;  3Q3O C;  3Q14 C;  3RMK C;  3RNB C;  2RDB C;  3I63 C;  3GE8 C;  3Q2A C;  3RNG C;  1T0Q C;  1T0R C;  3N1Y C; 
#chains in the Genus database with same CATH topology
 4NAM A;  2SEB D;  1L0X B;  2J42 A;  4A3P A;  2BS2 B;  4JWU C;  3ZNI D;  3N1Z C;  3DHG C;  2J53 A;  1YQB A;  2XK5 A;  4WQM A;  1IP9 A;  4NAW A;  4KKJ A;  4XE0 A;  3OLM D;  1IGD A;  2V4I B;  3VDZ A;  1SF0 A;  1RWS A;  4L2Y A;  2MA9 B;  4G3X B;  1QZE A;  3BWU D;  2KWD A;  2L83 A;  5AEK B;  2M0X A;  3RZF A;  3AU5 A;  4GN1 A;  1XF5 L;  4ANW A;  1V1O A;  4LDT D;  3P4Q B;  3H6N A;  4ASW C;  3AB5 A;  2L05 A;  1V49 A;  2WXR A;  2G4D B;  2AQ2 B;  2WU5 B;  3W1Y A;  3BVM A;  3R2T A;  3DBL I;  3NS1 A;  4E71 A;  2IYD B;  1FFV A;  4FLH A;  4HXD A;  1QOG A;  4XC2 A;  2AL6 A;  1XLO A;  5TR5 A;  1RRB A;  2K0P A;  1UGJ A;  3W1S A;  2Z0D B;  2A5U A;  2KLG A;  3ML8 A;  2K25 A;  4P6V F;  1C9F A;  2LI5 A;  1WF9 A;  3JSV B;  3UIN B;  1VZ7 A;  1ROE A;  3BK1 A;  3MC8 A;  2NCN A;  2IO2 B;  2WGS A;  4A6Q A;  3EHV A;  1AYF A;  2GBN A;  4GOC A;  2NR2 A;  2KDE B;  2PPH A;  4RM9 A;  3U30 A;  2WLB A;  4KZC A;  2WWZ A;  2AQ3 B;  2LAS A;  4K7W A;  4TKN A;  2BWE S;  5CX3 A;  5LXI B;  2PKO A;  4RGM A;  5JXV A;  2LRW A;  3LYY A;  2ZZP B;  2WU2 B;  3R3M A;  5C1Z A;  1OEY J;  5IA7 A;  2VZK D;  2WXI A;  4FXC A;  1FRD A;  1YN4 A;  1ZP0 B;  3Q3O C;  2KQ7 A;  2EEL A;  2LVP A;  3AE7 B;  1GJZ A;  4OHJ A;  4E3C A;  3RNA C;  1J0G A;  4WWP A;  2MCN B;  5T8I A;  2QJL A;  2QEJ C;  4EZL A;  3CMM B;  5AZH A;  5D6J B;  1NVI D;  1EF5 A;  1DOX A;  1MFW A;  2FNJ B;  4FN2 A;  2IGD A;  1ZGU B;  5J17 A;  4HWI B;  3IT6 B;  2XNA C;  4P16 A;  1RFA A;  4MJS A;  1E8Y A;  1OQY A;  3VAW A;  3K9P B;  2BYT A;  1FMA D;  1NDD A;  2Z8L A;  3DVN U;  1WIA A;  1R4N I;  2PE6 B;  3P42 A;  3LDZ E;  3QHT A;  2KVZ A;  1UD7 A;  2E3T A;  3U52 E;  3L08 A;  3BVZ A;  1E8X A;  2RPQ A;  3VRA B;  2KK8 A;  2ASQ A;  4W9L A;  2NTT A;  3C8Y A;  3VTV A;  3KYC D;  2I1J A;  3RI7 C;  5IN7 A;  3PT2 B;  2C60 A;  2KAN A;  3TMP B;  4WJP A;  1HZ5 A;  4FJV B;  3QA8 A;  4DXF A;  4G11 A;  3A1Q B;  2L8J A;  5AZG A;  5C2T B;  1N5W A;  2QHO A;  3AE6 B;  4JQW C;  4HCN B;  2LUM A;  2WX0 A;  3NZS A;  4HDO A;  3IVF A;  3ZKJ C;  3TEY A;  1PGX A;  3O65 B;  4MGY E;  3AEC B;  3V6E B;  5FR3 A;  3H7P A;  4DHJ D;  3NJT A;  3KUZ A;  4JGH B;  3V05 A;  4XWW A;  4GSW A;  4N59 A;  3UIP B;  2YEP F;  2ONQ A;  3PZD A;  4B6W A;  2WXO A;  3N30 A;  1EUV B;  3VTU A;  2TSS A;  1P1A A;  2JSV X;  3ZO5 B;  3O13 A;  5E6J A;  2I1K A;  1WX9 A;  2EMS A;  5H8Y E;  2V4L A;  2BF8 B;  3Q8A A;  3AN1 A;  3P4P B;  3U7Z A;  3S2A A;  3MC9 A;  2IY1 B;  2LVQ A;  4IWO A;  2BYE A;  3VQI A;  2KN5 A;  3PPA A;  5L83 A;  1OTR B;  5D2M B;  3URY A;  2FUH B;  1FXI A;  5EE3 A;  2V3P A;  3L10 B;  1HZ6 A;  4HLE A;  3QQ8 B;  2BPS A;  4NY0 A;  4L1B A;  2AYO B;  2BYF A;  1YX6 B;  2L1A A;  3Q2A C;  3Q6B A;  2N1W A;  2CU3 A;  2WQY B;  1SJE D;  2WNM A;  1D5X C;  4EKU A;  3NVV A;  4II2 B;  1WR6 E;  1C77 A;  2J4X A;  1I4R A;  3QIJ A;  3UI3 A;  1ZOY B;  3UGB B;  1WMH A;  3L17 A;  3RNB C;  2BBC A;  1FNW A;  1P98 A;  3UQA A;  3NG0 A;  2RDB C;  4HKQ A;  2AL3 A;  1N63 A;  2BB5 A;  4K3B A;  1V8C A;  3ZXR A;  4BKS A;  3HM6 X;  2FIF A;  2KFJ A;  1QIL A;  2K8C A;  1D5Z C;  5MPO A;  2KYW A;  1WRD B;  1ZKH A;  1WY8 A;  4N58 A;  3L54 A;  1C78 A;  1SJH D;  1JWS D;  4XYC A;  2NMQ A;  1C76 A;  3ZLZ A;  5FK9 C;  2KOX A;  4IM2 A;  4RNA A;  2KQS A;  3R8B A;  5FKA C;  1L4D B;  1WH3 A;  1A5R A;  4DWF A;  3ONS A;  2RD0 A;  4GB9 A;  4A3O A;  3WIM A;  4FAD A;  4XZ4 A;  2LGY A;  3DBL B;  4FHJ A;  2KZR A;  2H89 B;  2GMI C;  3AE8 B;  2QIL A;  3DDC B;  4K81 A;  2CU1 A;  4YL8 A;  2QCZ A;  5G5G A;  3CF6 E;  2XEW A;  4FA6 A;  2D3B A;  4AQ7 A;  2KO3 A;  1FPY A;  4WJN A;  2GB1 A;  4ZRJ A;  2C9W B;  1L7Y A;  2RDG A;  4ZHO A;  2IBI B;  2DYB A;  4FBJ B;  1K53 A;  1D6E C;  2KQ4 X;  3NVW A;  3AE5 B;  3KW5 B;  3I5J C;  2MP2 A;  2I38 A;  2PE9 A;  3RNC C;  1I35 A;  3VR8 B;  2M1M A;  2D11 A;  1G6J A;  2IND C;  3EFC A;  3PHX B;  5TSS A;  3RMK C;  2K5P A;  3PRP B;  3QWZ B;  4K7S A;  4GDL A;  2W55 A;  4PS7 A;  2C7M B;  3BVG A;  1LQB A;  1Z5S B;  2HDE A;  3JYU A;  1GPX A;  4ARI A;  4M8N A;  3ZJT A;  4WAF A;  5HHD G;  2D2Q A;  1DGJ A;  3VXW A;  4DHZ B;  4HEA 1;  2FAZ A;  3N3K B;  4M01 A;  1JWM D;  4MT5 A;  2IDY A;  1LFD A;  3RD2 A;  2MLB A;  2MSE D;  4HPL B;  3P4R B;  1VD2 A;  2M56 B;  1KF6 B;  2WDT B;  2WXM A;  1T5X D;  3H8H A;  3ZQ4 A;  2JYT A;  2Q5W D;  2GBM A;  1LGR A;  1DOI A;  2L32 A;  1I4X A;  4M00 A;  2EMT A;  2LXA A;  3DQV A;  3ENE A;  5J2R A;  1STE A;  1WJU A;  3KWL A;  3L0W B;  1CZP A;  4ZRQ A;  3TUO A;  2BKR B;  2DZI A;  3A9K B;  1UF0 A;  1FNV A;  2J0K A;  1HTO A;  5BMG A;  1R4N B;  1GB4 A;  2WXL A;  4NNJ B;  4C4V B;  4K7U A;  3ZYY X;  3LB8 C;  5C3J B;  2KX3 A;  5FR6 A;  3TEW A;  2V0G A;  1OGW A;  1YN3 A;  4YTN B;  3V3X A;  1K52 A;  2HD5 B;  4PT5 A;  1TS2 A;  4RMA A;  5BMH A;  4WWN A;  3M63 B;  2KAJ A;  1BXT A;  2PW9 A;  1L6V A;  3ETR A;  1WRI A;  1SEB D;  4IM3 A;  5EE0 A;  1AWD A;  1WSP A;  1P3Q U;  1ZDV A;  1GB1 A;  1ACC A;  4EUT A;  1VZ8 A;  3TEX A;  2M19 A;  4AUQ C;  3OWE B;  4OZC A;  3B08 A;  3ECI A;  1FM0 D;  2QC8 A;  3NVZ A;  2LJ5 A;  3AH7 A;  3WAN A;  1P7E A;  2H88 B;  1QOA A;  3OAW A;  4AJW A;  1JW9 D;  2UWQ A;  1V2Y A;  4LDT B;  2KDF B;  1LM8 B;  4TMA B;  3WAM A;  1MPE A;  2O6V A;  1TTN A;  2BVC A;  2XBB C;  4RF0 A;  2LVO A;  2MBE A;  4AS1 A;  4W9J A;  3NUH B;  4KGT A;  1WGK A;  3R7R A;  2KMA A;  2DZK A;  4YSZ B;  1SSN A;  2G45 B;  3AM9 A;  1KTK A;  1CQV A;  3CWI A;  2GBR A;  2PLP A;  3RNG C;  2DYO A;  3U2S C;  2INP E;  2J52 A;  1TBE A;  1MI0 A;  1T6B X;  5D3I B;  2OOB B;  4LCD E;  3H1U A;  1XLQ A;  5IO9 A;  2KT7 A;  1FFU A;  3A9J A;  4B95 A;  1EO6 A;  3UIO B;  3SDL C;  3CSF A;  1M4V A;  5D94 A;  3T9L A;  4A8X C;  3P2B A;  4EEW A;  2BT6 A;  1RLF A;  1WI0 A;  2YVC A;  5DPR A;  1ET9 A;  2JXX A;  2LWP A;  2WXH A;  4XDC A;  4OZB A;  3L13 A;  3FIL A;  1MJD A;  1PQS A;  3ZNZ B;  2KMC A;  4FUL A;  2K3U A;  4M8M A;  2WP9 B;  3M95 A;  1QOF A;  5KHQ A;  1UBI A;  3ZRF A;  1GAQ B;  2WHI A;  1T0Y A;  3PRE A;  4O1N A;  3B0A A;  4DXG A;  1ZUD 2;  2KWU B;  1P0R A;  2WXN A;  2DX5 B;  2VZK B;  2ZW1 A;  2L52 A;  1L0Y B;  1RM6 C;  5DPT A;  4IWQ A;  1FIQ A;  4KVG B;  4IUM B;  4UDU C;  3DOW A;  4TUU A;  4BKG A;  1ZPS A;  2NBU A;  1E10 A;  3Q3J A;  3W1S C;  2SAK A;  3ZW3 A;  4ICV A;  1UUP A;  3QC8 B;  4MEL A;  1YNT E;  4TSS A;  5EE9 A;  1ZDX A;  3Q14 C;  1MVK A;  4X57 B;  3ZRC A;  3WAO A;  4HJK A;  4WWM A;  2LRU A;  1FEH A;  3LXF A;  2DHZ A;  4WWO A;  5BYS A;  4MSQ B;  1V5O A;  2G3Q B;  2LGD A;  1J7A A;  5G2N A;  3W2D A;  1WZ0 A;  1D3Z A;  1E7U A;  2DBY A;  5C23 A;  2WDV B;  3JW0 X;  5GXG B;  1ESF A;  3GB1 A;  1U4A A;  3WA0 A;  4I6L B;  2WX1 A;  3IFW B;  3P1M A;  1K51 A;  1Q5W B;  3C19 A;  1F0Z A;  3IT4 B;  1NI2 A;  2NPT B;  3QAQ A;  4HDQ A;  2JRH A;  4ITK A;  4J6I A;  1KOT A;  4NQK E;  2KMM A;  2KX0 A;  4LJO B;  4RFB A;  1F52 A;  3IAM 1;  3GE3 C;  1MHX A;  3EUB 2;  3AMZ A;  2RR9 A;  2FID A;  3Q8B A;  2OJW A;  5HI1 A;  1L4Z B;  4N6E B;  1TS4 A;  4M0W A;  1WFY A;  3PVL A;  4JE3 B;  1M94 A;  4DHJ B;  1JRO A;  2KC2 A;  3N1X C;  4I6N B;  2B76 B;  5D7G A;  3DVG X;  2N1V A;  1L0V B;  3DBR B;  2CHW A;  3AE4 B;  2V1Y A;  5CHV C;  2QIE B;  2PJH A;  4DK5 A;  3B1L X;  3AEE B;  3Q8C A;  4NJ7 A;  5JHB A;  3UF8 A;  4BBN C;  1Q10 A;  2KD0 A;  4ICU A;  3AE3 B;  3V62 A;  2AEH A;  4RGN A;  1C4C A;  5IOI A;  4MEM A;  2LGS A;  3V61 A;  2HTH A;  2N4F A;  5BYQ A;  4USA A;  5HG2 A;  3TJP A;  3A33 B;  1QF6 A;  2C7H A;  1V86 A;  3PLV A;  3HHM A;  4P1B C;  1SB3 C;  1WJ4 A;  4AJY B;  4C00 A;  1L6U A;  1P7F A;  1SBB B;  3VVW B;  2QMT A;  3B2F A;  2L00 B;  3QJZ A;  4BKS D;  1L5P A;  5G55 A;  4KKI A;  1BT0 A;  5DPS A;  1XLN A;  3ZNG C;  2JT4 B;  3ZJU A;  3E56 A;  4IM0 A;  3RYT A;  4PYU A;  2WS3 B;  2K8B A;  3RUL A;  3SR6 A;  1K50 A;  4BVU C;  2JXT A;  1F1H A;  2CJO A;  2CS4 A;  4OW0 A;  4XDD A;  2MEK A;  4MH0 E;  4MGK E;  2J0J A;  4KDL B;  4XX5 A;  4BZA A;  1J8C A;  3KWV A;  1WGD A;  2KDB A;  2O2V B;  3AE2 B;  3EC8 A;  3P4S B;  2Y3A A;  2WXP A;  1AW7 A;  2N7D A;  1NI3 A;  1KLV A;  2AX5 A;  1JWB D;  1CMX B;  1WGY A;  2PMV A;  3I63 C;  1UBQ A;  2A4Z A;  3HUI A;  2LGI A;  3TIX A;  3RN9 C;  4TQ0 A;  2ZJD A;  3RCZ A;  3HVD A;  3BIN A;  3MC0 B;  4R3D A;  3Q69 A;  3SFE B;  2JPH A;  4PS8 A;  1WXV A;  4P1C C;  2BB6 A;  2V3N A;  2MBH A;  1WXS A;  2D3A A;  4NZL B;  3GS2 A;  4GLS C;  2WXG A;  1ET6 A;  5E6N A;  1KFY B;  1HE8 A;  2CHZ A;  1FCL A;  1Y8R C;  2N7E A;  2ZVO A;  2Z0E B;  1E8Z A;  5CHF A;  5BYR A;  3EA6 A;  1RAX A;  2WYQ A;  2FUG 1;  2KTR B;  1I4Q A;  3JSV A;  2N9E B;  2E6X A;  5D3D A;  1GOZ A;  2ICI A;  3VUW A;  2RDH A;  2PTL A;  1V9J A;  4ZOH C;  1JML A;  2CR5 A;  1T0R C;  2C7N B;  2D07 B;  3ZDT A;  2N7J A;  5CHW A;  4EE2 A;  1IGC A;  3AE9 B;  5LNK 1;  1A70 A;  3PS6 A;  4KIK B;  2EKI A;  3KUC B;  4LLG M;  2DAJ A;  4LK0 M;  4C7Z A;  3MHZ A;  1N61 A;  1VZ6 A;  4NQL B;  2Y5B B;  3IBE A;  1TY2 A;  5L95 C;  1B1Z A;  2BKF A;  1N60 A;  4F8C B;  3ML9 A;  1ZXH A;  2NS5 A;  2IJ0 A;  1N5X A;  5GMV A;  2DAF A;  2K9X A;  1GNU A;  4XGA B;  1T0Q C;  2IGG A;  2NTS A;  1ENF A;  2R2Q A;  4AP4 C;  4GU2 A;  2PEA A;  1S1Q B;  4HRS A;  2FE8 A;  4KGR A;  2KXJ A;  1VRA B;  3BY4 B;  5H92 C;  3X0W A;  2XK5 B;  2D5G A;  2HJ8 A;  4IOI E;  4NAW B;  4WJO A;  4B9K A;  1UWX A;  2FCS A;  3MFG A;  1ZXI A;  1YJJ A;  4GXB A;  1VR9 A;  3ZVV A;  2RMM A;  2N9L A;  2KHW B;  3Q3F A;  3I9V 1;  1JWA D;  3N20 C;  3DBH I;  5JH5 C;  1J19 A;  1YOV B;  2ZNV B;  1KLG D;  3A1Q A;  3L16 A;  4YTP B;  2KNB A;  3ZDM C;  2AWT A;  3ALB A;  3NOB A;  3WAL A;  2O6V D;  2D3C A;  3KH0 A;  1YJI A;  2BWF A;  1YMH E;  4GIV A;  2KJ6 A;  1SXT A;  1VJK A;  1E90 A;  2VH1 A;  3RFZ B;  4ARC A;  5BO4 B;  1JRP A;  2IY0 B;  3VH4 B;  4C80 A;  1I4H A;  1QQR A;  4FHK A;  3V6C B;  2JRI B;  2PIA A;  4IC7 B;  2NVU I;  2KJH B;  1QKZ A;  2YLM A;  4OZA A;  3NHE B;  1WX7 A;  1MG8 A;  1IBX A;  3DHI C;  4ANU A;  1FXA A;  1I4G A;  1V81 A;  3VFK A;  4ANV A;  4MM3 A;  2HTM E;  3APF A;  4G0N B;  3BYY B;  1Q1O A;  4W9E A;  4AWJ A;  1XEE A;  3Q8E A;  1N6Z A;  1V1P A;  1F77 A;  2BS3 B;  1R4M I;  1KJT A;  4JPS A;  3EGR A;  4RF1 A;  4EZK A;  4LTU A;  4KV2 A;  1HXY D;  4NJ6 A;  4ZYN A;  1GG3 A;  3B9J A;  2B3A A;  2REX A;  1YN5 A;  4OVV A;  3SFD B;  2G1E A;  1N62 A;  2DYM A;  4IW0 A;  4RGO S;  1H4R A;  4YTM B;  3IAS 1;  3J9C A;  2ZW0 A;  4BBN F;  1BML C;  2M4N A;  4LNF A;  1WR1 A;  1V97 A;  1V5T A;  4MSM B;  1S3S G;  3BYT B;  2BTE A;  1XT9 B;  2MWS B;  4M0W B;  3M62 B;  4BFR A;  1F2R I;  1WX8 A;  2L0T A;  1WE6 A;  3KVF B;  2M8S A;  1H8C A;  4BAX A;  3TSS A;  2K1F A;  2X38 A;  3AE1 B;  3R66 C;  1MHH E;  4ZYS A;  4W9G A;  1UH6 A;  1NBF C;  2ACZ B;  1TZ1 A;  1WM2 A;  4MJS B;  2GOW A;  2WDQ B;  3A4R A;  1D4B A;  3TEZ A;  1CK1 A;  2FCM A;  4HPP A;  1TS5 A;  3VUX A;  4W9I A;  3AEA B;  1WXA A;  4DBG A;  4HCP B;  1XCT L;  1HQR D;  4HK2 A;  5LXH A;  2W54 A;  1F9J A;  4PYZ A;  1RFK A;  5AUI A;  2KFK A;  5IP4 D;  1XCQ L;  3PGE A;  3GP7 A;  4W9K A;  3RUI B;  1PDX A;  4KX6 B;  3AED B;  3U4E G;  1VLB A;  4ZDV A;  3ZTD A;  4TV3 A;  5AUK A;  3R2I A;  4NJC A;  1T3Q A;  2LEK A;  1JCK B;  5E6O A;  3RZW C;  3BK2 A;  1UEL A;  4E74 A;  2LJI A;  3TCA A;  2L76 A;  2MBB B;  2X8X X;  3GE8 C;  1X1M A;  4HVB A;  2LFI A;  2ZNV C;  4DDI D;  4FJY A;  2M17 A;  5J18 A;  3H7P B;  1WGR A;  1UZX B;  3H9D A;  4CYE A;  2JQR B;  3GZN I;  1SE9 A;  1KH0 A;  4IDI A;  4DHZ E;  3IG3 A;  4K1R B;  2PVG C;  2INC C;  4WJQ A;  4ANX A;  4MH8 A;  2VRR B;  3DVN V;  2G4S A;  1PGA A;  3BII D;  4GDK A;  1E9M A;  1LO5 D;  2WDR B;  1P9D U;  4D2K A;  5JHA A;  1T0S C;  4LNI A;  1E7P B;  4W9H A;  4AOF A;  3RPF C;  3WCQ A;  1GC6 A;  4ZRK A;  3T8M A;  3N9Y C;  2NBV B;  5EDS A;  1YIW A;  2INN E;  1D5M C;  4CQN A;  4H2A A;  4MGZ E;  1DYQ A;  3U8Z A;  3NZU A;  2D10 A;  1WM3 A;  3GOE A;  2DZM A;  3HIZ A;  3KQ4 A;  3IHP C;  1HA5 A;  2MH7 A;  5HKH A;  1J7C A;  3Q8F A;  1SE3 A;  4URK A;  4ZRI A;  1IUE A;  3HM3 A;  3W5V B;  2KKC A;  3A4S C;  2OHF A;  3ZGZ A;  4KGS A;  1XQQ A;  2ZCB A;  5KHO A;  4GGQ A;  1V6E A;  3DHH C;  4JL9 A;  3T3N A;  2JX5 A;  1HEZ E;  1J7B A;  4S0R A;  2DLB A;  1WMH B;  3PV1 A;  3MJ5 A;  1NYQ A;  4K3C A;  2K8H A;  2MBQ A;  1EU4 A;  3A9K A;  1EU3 A;  1ZW7 A;  1NYR A;  4YWG G;  1GC7 A;  2NBW B;  1C4A A;  1C79 A;  4C4V A;  2XN9 C;  4WUR A;  1E0Z A;  3V60 A;  2IO1 B;  1WXM A;  3DVG Y;  4MDK E;  4RM8 A;  3Q3N C;  2JY6 A;  2K6Q A;  4ZRP A;  1FRR A;  3NRZ A;  3R7Q A;  2KDI A;  3PLU A;  1WYG A;  3APD A;  3DBH B;  1WZ3 A;  4BOS C;  3Q3M C;  3VH3 B;  3PSE B;  5E6P A;  3VRB B;  2PVO D;  2LZ6 A;  1XD3 B;  3VTW A;  4TQ1 A;  4A90 A;  3VUY A;  3T3O A;  4KSL C;  4WQO B;  1DOY A;  2IGH A;  3QK0 A;  2L0F A;  2BW2 A;  1SIJ A;  2IPK D;  4DXA B;  2ZPY A;  3DWM A;  3I3T B;  3E9S A;  3IXS A;  2W9N A;  1TKY A;  1EM7 A;  4REZ A;  4QAY A;  4JWS C;  2D3G A;  1JAL A;  1OQR A;  1IYF A;  2K6D B;  2KVR A;  3QCA A;  4BOZ B;  5JZE B;  4II3 B;  3KLS X;  4LNN A;  2FCQ A;  1Q0W B;  5G5H A;  1EWY C;  2ZVN A;  1YQ3 B;  2DEN B;  1TYG B;  2MJ3 A;  3AEG B;  1TKG A;  3NZ3 A;  4EFO A;  2MP2 B;  3M3J A;  1R7S A;  2L3Z A;  2MJE A;  1WE7 A;  4KDI C;  1R4M B;  2RSU A;  2KWC A;  4W9F A;  2J7Q B;  1FO4 A;  4GMV A;  4N9F 4;  4HRO A;  3MJW A;  5CTR C;  1FD6 A;  4GDL B;  2G9H D;  2JUO A;  2GBJ A;  3L4P A;  1QT9 A;  3QAR A;  1WJ6 A;  2Y5C A;  1NEN B;  1SE2 A;  2MBO A;  4G50 A;  1Y56 A;  1PUT A;  4YXD B;  2MHJ A;  2MRP A;  2C5L C;  2CJN A;  1RYJ A;  2GI9 A;  3HRD D;  3MP9 A;  2KLC A;  1YQ4 B;  2RGF A;  1UNS A;  2KAC A;  1WXQ A;  4C56 C;  1IBX B;  4US9 A;  2DZJ A;  3ZIM A;  2N9K A;  3PHW B;  3MTN B;  4MM3 B;  2JU6 X;  2J0M A;  4WIP A;  4ZHP A;  1VCB A;  2LGX A;  4RGT A;  2BS4 B;  1AAR A;  1OQQ A;  3CST A;  1HTQ A;  3CIR B;  3DPD A;  3ZNH B;  1V1P B;  4JX1 C;  2ZPN A;  2OJR A;  1KRH A;  2KN4 A;  3K9O B;  1IPG A;  3PRZ A;  1EWC A;  1Z2M A;  4OVZ A;  2AQ1 B;  3NVY A;  2IZV B;  1ISN A;  3N32 A;  3P63 A;  4W9C A;  1QLB B;  2KC1 A;  2QDF A;  1JRU A;  1FCC C;  2LXC A;  1WJN A;  4RCO A;  4HJG E;  2N0S B;  1LXD A;  2YEP B;  2RPV A;  3PRM B;  4M02 A;  3ZXV A;  1KLU D;  4F7Z A;  4CHK A;  1TS3 A;  3VR9 B;  1K8R B;  4C7Y A;  4J3O D;  4L23 A;  3FKY A;  5IKC M;  1ZE3 D;  1OEY A;  4F1S A;  3W9C B;  2NPT A;  3HVZ A;  4LNO A;  1TT5 B;  2GBK A;  1SIF A;  4A20 A;  4MGI E;  3AXC A;  2KWV B;  1I4P A;  3GZN B;  2OED A;  1WYW B;  2ZCC A;  3AEB B;  4RH6 A;  3DWG C;  4DDG D;  2LUE A;  2JZ3 B;  2O6V B;  2MJD A;  4EZJ A;  1PYW D;  2MQJ A;  3AI5 A;  3DBS A;  4PK1 A;  1WGH A;  3ZUN A;  2DNF A;  4LNK A;  4B0M A;  2KFK B;  2N9X A;  4JLC A;  3W5U B;  1BUI C;  1AN8 A;  3H7S A;  1E6E B;  3N1Y C;  1E5W A;  4PS3 A;  2R2O A;  4I6P A;  2WXJ A;  1I7H A;  1MG4 A;  3A9J B;  5IAA C;  3AUL A;  3HK0 A;  1XLP A;  3RNE C;  2UYZ B;  5DPW A;  1L2N A;  2MX2 A;  2EKE C;  1EF1 A;  1TGZ B;  3FIL B;  3VHT C;  1TIF A;  2CHX A;  2WXF A;  5LLI A;  3WAP A;  2QSD A;  3JVZ X;  5BMI A;  1TY0 A;  1WWT A;  3SEB A;  5DCN A;  4A55 A;  4NPN A;  4EOY A;  1GUA B;  2K39 A;  1CJE A;  3B2G A;  3ZJV A;  3U7D A;  2K22 A;  1QOB A;  5EE1 A;  4GDK B;  3OG5 A;  2KJR A;  1TKE A;  2JZZ A;  4OVU A;  3DBR I;  1F2R C;  3PO0 A;  1OFF A;  3PTF C;  3TL5 A;  2R61 A;  1E7V A;  1V80 A;  3X23 A;  2LHE A;  4P7I A;  1C4P A;  1PGB A;  2WXQ A;  2JYE A;  2BYV E;  1JWU D;  3RT3 B;  3LJ3 A;  2I2Y A;  5HFY A;  2HE7 A;  2UU7 A;  2KTF A;  2MW5 A;  2O2V A;  5AZF A;  2KDM A;  2BGF A;  2V3S A;  2CKH B;  3KUD B;  4FJZ A;  1FXT B;  3QX1 A;  3APC A;  2IO3 B;  2L7R A;  1XO3 A;  4DQO C;  3TBL D;  1C3T A;  4YT0 B;  3SHQ A;  1C1Y B;  4MAC A;  3DCG A;  5I4D A;  3EEC A;  2HJ1 A;  1PFD A;  3PZ7 A;  4HKZ E;  4W9D A;  3AV8 A;  1YJ1 A;  3NY5 A;  2Z59 B;  4YSX B;  1VDV A;  2N9P C;  3I57 A;  2GRI A;  3OJ4 B;  2M0A A;  1KM7 A;  2JZP A;  3FC4 A;  1WGG A;  1YD8 U;  2JF5 A;  4HPM B;  4S17 A;  1NEK B;  2ON8 A;  3OJ3 A;  4KSK C;  3SU8 X;  4IWP A;  2KTR A;  2FCN A;  1UGM A;  3SD5 A;  1SE4 A;  2IO0 B;  3KYD D;  2GLS A;  2V9H A;  2VH2 A;  4XWT A;  4LJP B;  3AU4 A;  3EFU A;  3MHS D;  2ZEQ A;  1B9R A;  2W3S A;  2FBW B;  1UWM A;  2LMC A;  3C0R B;  4WH4 A;  4Q2J A;  1E8W A;  3PZ8 A;  3ABV B;  3ZTC A;  2W82 A;  2LHD A;  4KZ0 A;  3AEF B;  1I42 A;  4CO7 A;  3RNF C;  4KIK A;  3UQB A;  4US8 A;  1TJE A;  4B0E A;  1FNU A;  4A9A A;  1XXG A;  4YSY B;  4JIO U;  4IG7 B;  2Y5P A;  2DWQ A;  1JQ4 A;  2JWU A;  2LD9 A;  3FAH A;  4WAA A;  1YX5 B;  3BZD B;  1TZO A;  2JWZ A;  2W3R A;  4ACF A;  2BQQ A;  1SGH A;  3D32 A;  2WXK A;  3NS8 A;  4IKG A;  2JVC A;  4BKT A; 
#chains in the Genus database with same CATH homology
 3RN9 C;  3Q3M C;  3I5J C;  3RI7 C;  3RNC C;  3DHH C;  3DHI C;  3RNA C;  3N20 C;  4P1B C;  3RNE C;  3N1Z C;  1T0S C;  2IND C;  3DHG C;  3Q3N C;  2INC C;  3N1X C;  4P1C C;  3RNF C;  3GE3 C;  3Q3O C;  3Q14 C;  3RMK C;  3RNB C;  2RDB C;  3I63 C;  3GE8 C;  3Q2A C;  3RNG C;  1T0Q C;  1T0R C;  3N1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...