3RNCC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i100a double mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
total genus 23
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rncC00
3RMKC 3GE3C 4P1BC 3DHHC 3DHIC 3I63C 2INCC 4P1CC 1T0QC 3Q2AC 3N20C 3Q3MC 1T0RC 1T0SC 3DHGC 3RI7C 3Q14C 3N1ZC 3N1YC 2INDC 2RDBC 3RNGC 3RNBC 3RN9C 3RNAC 3I5JC 3RNEC 3N1XC 3Q3NC 3RNCC 3GE8C 3RNFC 3Q3OC
chains in the Genus database with same CATH superfamily
4FJVB 3B2GA 1ET9A 2KQ4X 1WZ3A 2N1WA 1ZUD2 1J19A 1YN4A 1QQRA 4TQ0A 3VUXA 2MH7A 1T0QC 2KACA 1SXTA 3Q8AA 2XBBC 3NVVA 1FNUA 3KUCB 2M4NA 3AB5A 2MX2A 4I6NB 2OJWA 4YL8A 3AE5B 3NRZA 1DOXA 2DZJA 2WP9B 2MSED 2I2YA 2G9HD 2W82A 5C1ZA 2XK5A 1JCKB 2FCQA 2A4ZA 3AE4B 1B1ZA 5G5HA 3MJ5A 2PW9A 1LXDA 1T3QA 4W9CA 5IAAC 4JQWC 4F1SA 1E9MA 2LASA 1MFWA 4HJGE 1EO6A 4HCPB 1JRUA 2NBVB 1F2RC 2NTSA 3APCA 1J8CA 1MG4A 2JRHA 3MHZA 5BMHA 2J7QB 4H2AA 2JZPA 4YT0B 3W9CB 5C3JB 4P1CC 5C2TB 4WJPA 4W9HA 2Z0DB 3P1MA 2K8CA 4HPPA 4N9F4 4HXDA 3A9JB 3M95A 1XLQA 1D5MC 2RDHA 1CK1A 2Z8LA 3BK1A 1WR1A 4RMAA 3EFUA 2PEAA 4IW0A 1XCTL 1JALA 4S0RA 2EMTA 1JMLA 2N7JA 3TEXA 2B3AA 4ICVA 4Q2JA 4HRSA 1IPGA 1V1OA 5H92C 4YTMB 2JU6X 5AUKA 4AP4C 3VHTC 4KX6B 1WSPA 1KRHA 1E10A 4AJWA 2AL3A 4BBNF 3AEBB 4BZAA 1RAXA 2JWZA 2REXA 1E8XA 1WR6E 1FXIA 3CSTA 2N9KA 1Z2MA 2FCNA 5J17A 4EKUA 5IA7A 4OVZA 4YWGG 1ZDVA 4BAXA 3WAOA 1E6EB 1UGMA 1C79A 1FNWA 2ZW1A 3OAWA 3ZYYX 3H7PA 4ZRIA 3AXCA 2KFKA 1JROA 2L7RA 4NY0A 1GOZA 2KD0A 2GLSA 2DYMA 5AZFA 2FE8A 1MVKA 2SAKA 1D6EC 2L05A 2QEJC 2WXPA 1MHHE 2G1EA 2PVGC 1NDDA 1VZ7A 3RNEC 2BQQA 1HZ6A 1M94A 3W1SC 4PYUA 1QZEA 2ZNVB 4EOYA 3OG5A 1J7AA 3TBLD 1I4PA 2JSVX 3ZW3A 2WXRA 2N9EB 3AE9B 4WIPA 2VH1A 1Q0WB 3SEBA 4IOIE 1FNVA 3ZNGC 1MJDA 3UQBA 3PHWB 1P1AA 5FK9C 1CMXB 2PPHA 2L0TA 1D5ZC 2FIDA 2ZVOA 3CMMB 2LEKA 1YIWA 4YSYB 5DCNA 5E6OA 2KTRB 2YEPF 4HJKA 3U8ZA 3I3TB 4OZCA 3QA8A 4IKGA 3QK0A 2KWVB 3A33B 2KANA 1ZPSA 2WXOA 2JPHA 1D4BA 1NI3A 5EE9A 4ANVA 5AZGA 2KK8A 3ZRCA 4J3OD 3HVDA 3IXSA 2BF8B 3B2FA 3WAPA 2GBRA 1QOFA 3OJ3A 1V2YA 1FRDA 2M0AA 1WGRA 2JVCA 3L17A 3L54A 2PTLA 3PRZA 2PLPA 3RNGC 3R7QA 2IO1B 2WGSA 5DPTA 2LUMA 2PMVA 2EKEC 3SD5A 4ICUA 1GB1A 2KN4A 1NI2A 1JWMD 3DBHI 2KX3A 3DWMA 2WDQB 3L08A 2V1YA 2Y5PA 1N62A 2D3BA 4CHKA 2MLBA 1KF6B 3BINA 2MCNB 4YSZB 2OEDA 2DZMA 4DHZE 3PRMB 1PGAA 2HTME 3ZNHB 1WM2A 2AQ2B 3ZDTA 1HE8A 2WX0A 3R7RA 2WQYB 3ALBA 4MDKE 3WAMA 4K7SA 1ZW7A 2JY6A 5BO4B 3DQVA 2IY0B 1SJHD 3PZDA 4AOFA 1WYWB 4II2B 4IG7B 2KDMA 1V5OA 1TTNA 2K39A 4EFOA 2WXJA 4FA6A 3RFZB 1OGWA 3RNAC 2BKRB 2FNJB 5HFYA 2KO3A 4KZCA 1AYFA 3IAS1 4PS8A 2LUEA 2ZEQA 3PTFC 4MJSA 1LO5D 4FADA 3QHTA 5DPRA 4JWSC 2J0JA 4DWFA 3DHGC 4XZ4A 4MM3A 1WGDA 1L0YB 1NBFC 3VUWA 4BBNC 3VR9B 4KV2A 1EM7A 3ZXRA 1IBXB 3VVWB 5KHOA 4ZRJA 1YX6B 2WLBA 3BYTB 3UIPB 5G55A 1QT9A 2MHJA 2N4FA 2CHWA 3MJWA 2RD0A 2JXXA 2AQ1B 3EUB2 2KMAA 3V3XA 4TKNA 3X23A 1P0RA 2MQJA 2AX5A 4XDCA 1E7VA 5JHBA 1E8ZA 1CZPA 3MC0B 3L4PA 2WS3B 2L8JA 1XEEA 2EMSA 3GS2A 2Y3AA 1DGJA 2IY1B 4LJPB 4W9IA 1YN3A 4RGNA 2BS4B 1JWBD 3HK0A 1M4VA 3FC4A 4L23A 1L4DB 2GB1A 3UGBB 3DHIC 2QILA 3KWVA 2O6VD 1TGZB 1SE9A 3C0RB 4KDIC 1KLVA 2UWQA 3ZDMC 1K51A 1EU3A 5JXVA 1DYQA 1IYFA 3Q69A 2QHOA 1WYGA 2DHZA 3TL5A 1F77A 1PGXA 1UWMA 2OHFA 3PPAA 2MBOA 1FCLA 1ZOYB 2KVZA 2QDFA 2UU7A 4HPMB 5FKAC 1XT9B 1GUAB 3PZ8A 4PS7A 2AL6A 1TYGB 1SIFA 3A9JA 1I7HA 3IT4B 3SHQA 1VZ6A 1J7BA 5C23A 1V6EA 3TJPA 1R4NB 2DAFA 4W9GA 5BMIA 2HE7A 1S3SG 1V81A 1STEA 2L00B 2V3PA 3BIID 2N7EA 1E7UA 2RR9A 4KVGB 2IO2B 1F2RI 2LI5A 2RDGA 1HTOA 2CJOA 2IZVB 2JYEA 2BTEA 1H4RA 5IO9A 1KFYB 1WJ6A 2WXGA 3AN1A 4FLHA 3A4RA 1SE4A 2BWES 2OJRA 3AU4A 1VD2A 1X1MA 2LMCA 3TUOA 4FHKA 1CJEA 2BVCA 3VDZA 2WU5B 1SF0A 3NUHB 1VJKA 2WXIA 5T8IA 3ZGZA 2INCC 4KIKB 4M01A 2MRPA 3QCAA 2HJ1A 3QARA 2IPKD 3LXFA 2MA9B 3QX1A 4JWUC 3MFGA 4FHJA 1UD7A 1EWCA 3PRPB 2I1KA 4GSWA 1H8CA 4DBGA 1V80A 2WX1A 3B08A 3WALA 3ZVVA 5EDSA 1WX9A 4G11A 2D10A 2CHXA 4FXCA 3CWIA 2EKIA 1UBQA 1OQQA 3KYCD 3SFDB 2LZ6A 4S17A 5JHAA 4WWMA 3N9YC 5E6NA 3Q14C 3RUIB 4DQOC 4P6VF 3AEAB 4ANWA 1WRDB 3IFWB 1V97A 1QILA 4URKA 3OWEB 3TEWA 3SU8X 1I4GA 3I5JC 3L13A 1I35A 1PDXA 1OFFA 2X38A 3AU5A 3I9V1 2CU3A 1UWXA 2WXKA 3FAHA 2V0GA 3HM6X 1UELA 4LTUA 3VFKA 3RULA 1OTRB 2KTRA 3TEYA 1HQRD 3ZTCA 2WYQA 3ABVB 2KN5A 5LLIA 2K22A 1R4NI 2DWQA 1JQ4A 5DPWA 1A5RA 2L3ZA 3RZWC 2ZPNA 1EUVB 3JSVB 3DVGX 3LJ3A 3MC8A 1WMHB 2HJ8A 1GNUA 4G3XB 4MSQB 3ZJVA 2KJHB 4YXDB 1T0RC 4DXGA 2CHZA 1GC6A 3T9LA 4XWTA 2KJRA 4RF0A 3RPFC 1ZP0B 1WJ4A 4C4VB 4LNKA 3IAM1 2IBIB 4USAA 4C00A 1SBBB 1PUTA 1KOTA 3NVWA 2H88B 2Q5WD 1TKGA 1SSNA 4PYZA 1E7PB 1N6ZA 1C76A 1WM3A 3ZUNA 4ANXA 5IKCM 4RGMA 5EE1A 2R61A 2DZKA 2G3QB 2MBEA 4RH6A 1C3TA 1RLFA 3APDA 3P4QB 3WANA 4C7YA 1JW9D 2ACZB 3NZUA 3KW5B 4KSKC 2JF5A 3UI3A 1BMLC 4NAMA 2IO3B 2KOXA 1VCBA 1TT5B 4K1RB 2DBYA 4M0WB 2KDIA 1N5XA 2E3TA 4W9LA 2M56B 1L0VB 4C80A 4K3CA 1IGCA 5JZEB 2LXCA 2UYZB 1YQ3B 4B0EA 3IBEA 4WAAA 5D7GA 3B1LX 1QOBA 1YNTE 5AUIA 2ZW0A 3GZNB 5HHDG 3VRAB 3ZNZB 2LVOA 4C7ZA 1IBXA 4IWPA 4JLCA 3PREA 4M02A 4MH8A 3ETRA 4NNJB 3D32A 2IDYA 1C77A 4PS3A 4X57B 2VH2A 3DVNV 3R66C 2QC8A 1TBEA 2N7DA 2ZZPB 2AQ3B 5D2MB 1E8YA 3VH4B 2W55A 4MGZE 2O6VB 4OZBA 3WIMA 2KHWB 2GRIA 3KWLA 2YEPB 1PQSA 1OQYA 3RI7C 1FD6A 3PHXB 2ICIA 2OOBB 1QLBB 2Z59B 2H89B 1K8RB 3DBRB 1TS3A 1GG3A 2NPTB 2GI9A 4EUTA 3AMZA 2ZCBA 4RGTA 2DX5B 1N63A 1TY0A 2KQSA 1FM0D 4W9DA 1L6VA 1VLBA 1UBIA 2NBUA 3I57A 3P4PB 4A3OA 1MI0A 4HKZE 5FR6A 4DXFA 5MPOA 3L0WB 4AUQC 2XEWA 5J2RA 4BKGA 3K9PB 2ZCCA 3NVZA 2JYTA 1Q1OA 2IGGA 4ZRPA 2KWCA 3AEFB 2WNMA 2LRWA 2WWZA 2LXAA 3AI5A 5BYRA 5D3IB 3EC8A 1HXYD 1TS2A 1JRPA 3N1YC 4NZLB 2I1JA 2RGFA 4EE2A 2KLCA 2N9XA 1FIQA 1ZXIA 3A4SC 4WQMA 4L2YA 3RT3B 4MACA 3VXWA 4KGSA 3VUYA 4BKSD 2VRRB 4RFBA 2V3SA 3P2BA 4K7UA 1QF6A 4B9KA 3W5VB 1N60A 1SJED 4II3B 1Z5SB 2MJ3A 4ARCA 4WQOB 4B6WA 4BOZB 3W1SA 4A20A 2INPE 2WXHA 3NHEB 2GOWA 1YN5A 4NPNA 2MBBB 4GDKB 4DHJD 4MGYE 2LD9A 3DBLB 3VRBB 1FCCC 1GAQB 1E5WA 1Q10A 4MH0E 2ZPYA 4LJOB 1F52A 4TV3A 2XN9C 3W1YA 2YLMA 1J0GA 3RZFA 3V6EB 1LM8B 3DBSA 2PIAA 3C19A 4AQ7A 1KLGD 4KIKA 1LFDA 2KC2A 1EF1A 1L7YA 2C7NB 3W2DA 5D94A 1JWAD 1WZ0A 2IJ0A 3MHSD 3FILB 2W9NA 1TS4A 4XDDA 3RN9C 2WDVB 1I4RA 3RNFC 4MGKE 2KMMA 1U4AA 1F1HA 4WWOA 4CQNA 5BYSA 4UDUC 1UUPA 3ZJTA 2DAJA 2W3SA 1OEYJ 3CIRB 1WX7A 4F8CB 1L5PA 3K9OB 1V8CA 4LNIA 4GU2A 4MSMB 2ASQA 3P4SB 3IG3A 1TY2A 2G45B 3DPDA 5BMGA 4K7WA 2KLGA 4WAFA 4ZYNA 2FCMA 4HLEA 2M8SA 4EZJA 2GMIC 5AZHA 3BYYB 4NJ7A 1ROEA 4RF1A 3WCQA 3BY4B 1OQRA 3JSVA 1HZ5A 1WMHA 4JL9A 1IP9A 2XNAC 4PT5A 2X8XX 4RCOA 1L0XB 4A8XC 4FJYA 3PV1A 3AECB 3C8YA 2IGDA 3P4RB 3NOBA 5D3DA 5JH5C 5D6JB 2WU2B 1HA5A 1WGKA 2KYWA 2KJ6A 1BUIC 5H8YE 4ZRKA 4C4VA 3DBLI 1WX8A 2L83A 3GP7A 2TSSA 2BS3B 3Q3MC 3SDLC 2RDBC 4B0MA 3WA0A 1WWTA 1OEYA 4FULA 2GBKA 2GBJA 2B76B 1ZKHA 2JWUA 3BZDB 3H9DA 4XX5A 3M62B 3PGEA 4HROA 4BVUC 3TCAA 1FO4A 1VRAB 4HWIB 4A55A 4DDGD 5GMVA 3VTVA 3NY5A 4GMVA 3TEZA 3TSSA 4IWQA 2C5LC 2Z0EB 4WJNA 2K0PA 1N61A 3BVMA 1GPXA 4JX1C 1T6BX 4HK2A 4A6QA 4M0WA 5GXGB 2NTTA 3QJZA 2MEKA 1TZ1A 2FCSA 2DZIA 3N3KB 5IOIA 4GDLB 3UINB 4DHZB 3T3OA 4GLSC 4W9JA 3UQAA 3O65B 4OVVA 3CF6E 4KKJA 1BT0A 2ON8A 4KKIA 2Y5BB 4KSLC 4ZYSA 1EF5A 1C4AA 3ZKJC 3V05A 1YMHE 4N58A 2L1AA 3RNCC 5HG2A 3LDZE 1FMAD 2G4DB 1P9DU 3VQIA 3PLVA 3U7DA 2KDFB 2C7MB 2YVCA 3DDCB 3AULA 3BWUD 3UIOB 4IM3A 1IGDA 2WDRB 3O13A 1WRIA 1GC7A 2O6VA 2IGHA 2SEBD 1K53A 3ZLZA 3T8MA 1ET6A 1V86A 3DOWA 2KKCA 1K50A 3EHVA 4FJZA 2BYFA 4C56C 1YOVB 3ZTDA 2LGYA 2NPTA 2LGIA 2J0MA 5G2NA 4YTNB 4ZDVA 3R2IA 2C7HA 5KHQA 4KDLB 5E6JA 4DK5A 3OJ4B 1DOYA 3V60A 1KH0A 3V61A 2WHIA 1MPEA 2K8BA 1XLPA 1XLNA 3QC8B 4O1NA 3U52E 1XQQA 2KDBA 4RNAA 4LDTD 2D3CA 3QAQA 3EECA 3BK2A 1NVID 1HTQA 1QOGA 3E56A 2D3GA 2MJEA 2RSUA 3ML8A 1UGJA 2IO0B 3AEDB 3ONSA 4AWJA 4MT5A 5CHVC 4XWWA 3ZJUA 5DPSA 3KYDD 3RD2A 1A70A 3VH3B 4GN1A 1AWDA 2M0XA 1F9JA 2O2VB 3AM9A 2RPVA 3JYUA 1RM6C 3IHPC 2FUG1 1SE2A 2J4XA 4MELA 4HKQA 5TR5A 2JZ3B 4CO7A 1YX5B 2MJDA 1XXGA 1LGRA 2INDC 2WXQA 4DHJB 3U30A 3QQ8B 2JQRB 1SB3C 2A5UA 2BBCA 3N1XC 4K81A 2KDEB 4ARIA 4WJOA 2JUOA 1C4PA 1YJIA 2K25A 1AARA 1VR9A 3VR8B 2J42A 3AE3B 1WJNA 3CSFA 3L16A 3AE1B 2D11A 4M8NA 1XF5L 4NAWB 1V49A 3H7SA 4ZHOA 3Q3FA 1GB4A 1FFVA 2MWSB 4GDKA 3HUIA 4E3CA 3LB8C 4WWNA 2PE6B 1R4MB 1XO3A 2NCNA 2W3RA 3N32A 1EWYC 2BB5A 1R7SA 1I4HA 3A9KB 3EA6A 3U2SC 3IVFA 2IYDB 1K52A 2PKOA 3AE2B 1P3QU 2PE9A 3Q8CA 3R2TA 3ZXVA 4I6PA 4K3BA 3M3JA 4P16A 2AWTA 2JX5A 2MBHA 4GIVA 2V3NA 4CYEA 3N20C 2AEHA 2PJHA 3FILA 4KGRA 3Q3JA 1ACCA 2JXTA 4N59A 3A1QB 1V1PB 1TJEA 1NYQA 1YQBA 2EELA 4IUMB 1RRBA 3GE3C 2L52A 4KZ0A 4AJYB 1P7EA 1FEHA 1F0ZA 1PFDA 3HRDD 1Y56A 1P7FA 4ZOHC 2DYOA 1N5WA 2V4LA 3QWZB 2Y5CA 1ZXHA 2BYEA 2QMTA 2KT7A 4OZAA 2BYVE 3MP9A 4GB9A 4ANUA 3RMKC 1E8WA 1YQ4B 5I4DA 3U4EG 1TKYA 1C4CA 2N1VA 1FXAA 2NMQA 1AN8A 2K1FA 4ZHPA 4IC7B 3JVZX 3DHHC 4YSXB 3PT2B 5IP4D 3H1UA 2K5PA 4EZKA 2BWFA 2MP2B 2GBNA 2BYTA 2KWUB 2V9HA 3Q6BA 1SEBD 1Y8RC 3DBHB 2MW5A 5TSSA 3J9CA 2D3AA 1WY8A 3Q3OC 1J7CA 4A90A 4TMAB 4QAYA 2LJIA 1P98A 3TMPB 3PS6A 3APFA 4FN2A 1R4MI 3ECIA 4HDOA 2WXFA 3L10B 2KFJA 1UNSA 3RYTA 2L76A 4JE3B 2J52A 4HDQA 2R2OA 3DCGA 3MTNB 2AYOB 3NVYA 1WE7A 4HPLB 2WXLA 2KXJA 2VZKD 4GXBA 4LK0M 1WGHA 3KQ4A 3NZ3A 1T0YA 2K9XA 2L32A 1MG8A 4A9AA 2KWDA 1MHXA 1YD8U 1D3ZA 1E90A 3AEEB 4G0NB 2RPQA 2BS2B 4XC2A 2DLBA 4IM2A 2D2QA 2KMCA 1T0SC 1L2NA 2BKFA 4MEMA 2KTFA 2LGSA 4B95A 3GZNI 2BGFA 1GJZA 4P7IA 4GGQA 2KX0A 4XYCA 3NJTA 4GDLA 3JW0X 3OLMD 3IT6B 1G6JA 4HCNB 2WDTB 3E9SA 4IDIA 1JWSD 5J18A 4W9EA 1AW7A 2CR5A 4A3PA 3AE6B 1TZOA 2QCZA 1C1YB 2XK5B 4ZRQA 4REZA 1SE3A 2KQ7A 4JGHB 4RM9A 2NVUI 4L1BA 1DOIA 2ZVNA 3DBRI 4WH4A 4MGIE 1ESFA 4LNNA 2M1MA 4LLGM 2K6QA 4M8MA 4OW0A 1ZE3D 4NQKE 2FAZA 4ASWC 1L6UA 1RWSA 1WE6A 1XD3B 4YTPB 1TKEA 3BVZA 5CHFA 1S1QB 4DDID 3GE8C 1WXMA 1WH3A 1NYRA 4LDTB 1HEZE 2KAJA 2J53A 1I4QA 3Q8EA 2CJNA 1LQBA 3VTWA 4W9KA 4E71A 1FXTB 2C60A 5LXIB 1C9FA 5L95C 5BYQA 1FFUA 2ONQA 5AEKB 2QJLA 2E6XA 3PVLA 2LGXA 1CQVA 1C78A 1RYJA 2RMMA 1VDVA 2V4IB 1TS5A 3ZNID 1ZGUB 3PZ7A 3DWGC 3NS1A 3R8BA 1YJ1A 5HI1A 4BKSA 2FUHB 3Q2AC 3FKYA 2KNBA 4PK1A 1YJJA 1XCQL 1WJUA 1WGYA 3RNBC 3DVNU 3ZO5B 3AE7B 4G50A 1FPYA 3LYYA 3H8HA 1Q5WB 4J6IA 2O2VA 3DVGY 2J0KA 4OHJA 4WWPA 5E6PA 1UZXB 4WJQA 3HM3A 3H7PB 4FBJB 2CS4A 2KFKB 4US9A 2DENB 2KZRA 2JT4B 3Q8BA 5IN7A 1UF0A 3B9JA 3RCZA 4RM8A 3T3NA 3ZQ4A 3VAWA 3NS8A 1NENB 3ZIMA 3HVZA 4M00A 3HHMA 4AS1A 4BFRA 2WXMA 3AV8A 5L83A 4NAWA 4I6LB 2MBQA 2LHEA 3KVFB 4W9FA 2BW2A 4EZLA 4JPSA 1PYWD 2I38A 3ML9A 5EE0A 3KLSX 5HKHA 3M63B 2D5GA 1IUEA 3PSEB 4EEWA 5FR3A 4TSSA 1NEKB 2HD5B 3A9KA 3UF8A 4D2KA 1ENFA 4F7ZA 3PLUA 4IM0A 3SR6A 1UH6A 2QIEB 4NJ6A 2HDEA 3KUZA 2K6DB 1KLUD 3HIZA 3ENEA 3SFEB 3NG0A 5CHWA 3B0AA 3MC9A 2NR2A 2JRIB 2WXNA 4ITKA 1WF9A 1PGBA 1KTKA 2KVRA 3P42A 1BXTA 1WGGA 2BT6A 2NS5A 2K3UA 1T5XD 4LCDE 4BOSC 3Q3NC 2LJ5A 3GB1A 3A1QA 1V1PA 4P1BC 4OVUA 4WURA 2ZNVC 2FBWB 1B9RA 3AE8B 2LWPA 2LVPA 3EFCA 5LNK1 4JIOU 3P63A 3TIXA 1VZ8A 1WFYA 2INNE 4BKTA 2N9LA 1SIJA 1QOAA 1WXVA 1KJTA 1WXAA 2N9PC 4ACFA 4DXAB 3PO0A 3X0WA 1WXSA 4NJCA 4N6EB 2HTHA 4NQLB 5LXHA 3AH7A 1V9JA 5CX3A 3ZRFA 1SGHA 1QKZA 4XE0A 1V5TA 4US8A 2K8HA 5CTRC 2DNFA 3W5UB 2ZJDA 5G5GA 3R3MA 3VTUA 2N0SB 4RGOS 3U7ZA 2MP2A 3URYA 4TUUA 2BPSA 5EE3A 2FIFA 1KM7A 2L0FA 2M17A 4KGTA 3GOEA 2G4SA 2BB6A 4HEA1 3EGRA 3V6CB 2DYBA 3V62A 2VZKB 2KC1A 1ZDXA 4XGAB 4LNOA 2C9WB 2W54A 4R3DA 1RFKA 1FRRA 3KUDB 3Q8FA 1TIFA 2PVOD 4MJSB 1JWUD 1E0ZA 1XLOA 3I63C 2JZZA 1RFAA 4GOCA 4IWOA 4MM3B 2LVQA 2LFIA 3N1ZC 2LRUA 2CU1A 1WI0A 1L4ZB 2R2QA 3AEGB 2LGDA 1D5XC 2QSDA 3KH0A 4E74A 4HVBA 1EU4A 3H6NA 2GBMA 4TQ1A 2NBWB 3S2AA 1WXQA 3QIJA 1WIAA 1ISNA 1I42A 2LHDA 2M19A 3BVGA 2CKHB 3N30A 2D07B 4LNFA 1I4XA 3NZSA
chains in the Genus database with same CATH topology
3RMKC 3GE3C 4P1BC 3DHHC 3DHIC 3I63C 2INCC 4P1CC 1T0QC 3Q2AC 3N20C 3Q3MC 1T0RC 1T0SC 3DHGC 3RI7C 3Q14C 3N1ZC 3N1YC 2INDC 2RDBC 3RNGC 3RNBC 3RN9C 3RNAC 3I5JC 3RNEC 3N1XC 3Q3NC 3RNCC 3GE8C 3RNFC 3Q3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMK C;  3GE3 C;  4P1B C;  3DHH C;  3DHI C;  3I63 C;  2INC C;  4P1C C;  1T0Q C;  3Q2A C;  3N20 C;  3Q3M C;  1T0R C;  1T0S C;  3DHG C;  3RI7 C;  3Q14 C;  3N1Z C;  3N1Y C;  2IND C;  2RDB C;  3RNG C;  3RNB C;  3RN9 C;  3RNA C;  3I5J C;  3RNE C;  3N1X C;  3Q3N C;  3RNC C;  3GE8 C;  3RNF C;  3Q3O C; 
#chains in the Genus database with same CATH topology
 4FJV B;  3B2G A;  1ET9 A;  2KQ4 X;  1WZ3 A;  2N1W A;  1ZUD 2;  1J19 A;  1YN4 A;  1QQR A;  4TQ0 A;  3VUX A;  2MH7 A;  1T0Q C;  2KAC A;  1SXT A;  3Q8A A;  2XBB C;  3NVV A;  1FNU A;  3KUC B;  2M4N A;  3AB5 A;  2MX2 A;  4I6N B;  2OJW A;  4YL8 A;  3AE5 B;  3NRZ A;  1DOX A;  2DZJ A;  2WP9 B;  2MSE D;  2I2Y A;  2G9H D;  2W82 A;  5C1Z A;  2XK5 A;  1JCK B;  2FCQ A;  2A4Z A;  3AE4 B;  1B1Z A;  5G5H A;  3MJ5 A;  2PW9 A;  1LXD A;  1T3Q A;  4W9C A;  5IAA C;  4JQW C;  4F1S A;  1E9M A;  2LAS A;  1MFW A;  4HJG E;  1EO6 A;  4HCP B;  1JRU A;  2NBV B;  1F2R C;  2NTS A;  3APC A;  1J8C A;  1MG4 A;  2JRH A;  3MHZ A;  5BMH A;  2J7Q B;  4H2A A;  2JZP A;  4YT0 B;  3W9C B;  5C3J B;  4P1C C;  5C2T B;  4WJP A;  4W9H A;  2Z0D B;  3P1M A;  2K8C A;  4HPP A;  4N9F 4;  4HXD A;  3A9J B;  3M95 A;  1XLQ A;  1D5M C;  2RDH A;  1CK1 A;  2Z8L A;  3BK1 A;  1WR1 A;  4RMA A;  3EFU A;  2PEA A;  4IW0 A;  1XCT L;  1JAL A;  4S0R A;  2EMT A;  1JML A;  2N7J A;  3TEX A;  2B3A A;  4ICV A;  4Q2J A;  4HRS A;  1IPG A;  1V1O A;  5H92 C;  4YTM B;  2JU6 X;  5AUK A;  4AP4 C;  3VHT C;  4KX6 B;  1WSP A;  1KRH A;  1E10 A;  4AJW A;  2AL3 A;  4BBN F;  3AEB B;  4BZA A;  1RAX A;  2JWZ A;  2REX A;  1E8X A;  1WR6 E;  1FXI A;  3CST A;  2N9K A;  1Z2M A;  2FCN A;  5J17 A;  4EKU A;  5IA7 A;  4OVZ A;  4YWG G;  1ZDV A;  4BAX A;  3WAO A;  1E6E B;  1UGM A;  1C79 A;  1FNW A;  2ZW1 A;  3OAW A;  3ZYY X;  3H7P A;  4ZRI A;  3AXC A;  2KFK A;  1JRO A;  2L7R A;  4NY0 A;  1GOZ A;  2KD0 A;  2GLS A;  2DYM A;  5AZF A;  2FE8 A;  1MVK A;  2SAK A;  1D6E C;  2L05 A;  2QEJ C;  2WXP A;  1MHH E;  2G1E A;  2PVG C;  1NDD A;  1VZ7 A;  3RNE C;  2BQQ A;  1HZ6 A;  1M94 A;  3W1S C;  4PYU A;  1QZE A;  2ZNV B;  4EOY A;  3OG5 A;  1J7A A;  3TBL D;  1I4P A;  2JSV X;  3ZW3 A;  2WXR A;  2N9E B;  3AE9 B;  4WIP A;  2VH1 A;  1Q0W B;  3SEB A;  4IOI E;  1FNV A;  3ZNG C;  1MJD A;  3UQB A;  3PHW B;  1P1A A;  5FK9 C;  1CMX B;  2PPH A;  2L0T A;  1D5Z C;  2FID A;  2ZVO A;  3CMM B;  2LEK A;  1YIW A;  4YSY B;  5DCN A;  5E6O A;  2KTR B;  2YEP F;  4HJK A;  3U8Z A;  3I3T B;  4OZC A;  3QA8 A;  4IKG A;  3QK0 A;  2KWV B;  3A33 B;  2KAN A;  1ZPS A;  2WXO A;  2JPH A;  1D4B A;  1NI3 A;  5EE9 A;  4ANV A;  5AZG A;  2KK8 A;  3ZRC A;  4J3O D;  3HVD A;  3IXS A;  2BF8 B;  3B2F A;  3WAP A;  2GBR A;  1QOF A;  3OJ3 A;  1V2Y A;  1FRD A;  2M0A A;  1WGR A;  2JVC A;  3L17 A;  3L54 A;  2PTL A;  3PRZ A;  2PLP A;  3RNG C;  3R7Q A;  2IO1 B;  2WGS A;  5DPT A;  2LUM A;  2PMV A;  2EKE C;  3SD5 A;  4ICU A;  1GB1 A;  2KN4 A;  1NI2 A;  1JWM D;  3DBH I;  2KX3 A;  3DWM A;  2WDQ B;  3L08 A;  2V1Y A;  2Y5P A;  1N62 A;  2D3B A;  4CHK A;  2MLB A;  1KF6 B;  3BIN A;  2MCN B;  4YSZ B;  2OED A;  2DZM A;  4DHZ E;  3PRM B;  1PGA A;  2HTM E;  3ZNH B;  1WM2 A;  2AQ2 B;  3ZDT A;  1HE8 A;  2WX0 A;  3R7R A;  2WQY B;  3ALB A;  4MDK E;  3WAM A;  4K7S A;  1ZW7 A;  2JY6 A;  5BO4 B;  3DQV A;  2IY0 B;  1SJH D;  3PZD A;  4AOF A;  1WYW B;  4II2 B;  4IG7 B;  2KDM A;  1V5O A;  1TTN A;  2K39 A;  4EFO A;  2WXJ A;  4FA6 A;  3RFZ B;  1OGW A;  3RNA C;  2BKR B;  2FNJ B;  5HFY A;  2KO3 A;  4KZC A;  1AYF A;  3IAS 1;  4PS8 A;  2LUE A;  2ZEQ A;  3PTF C;  4MJS A;  1LO5 D;  4FAD A;  3QHT A;  5DPR A;  4JWS C;  2J0J A;  4DWF A;  3DHG C;  4XZ4 A;  4MM3 A;  1WGD A;  1L0Y B;  1NBF C;  3VUW A;  4BBN C;  3VR9 B;  4KV2 A;  1EM7 A;  3ZXR A;  1IBX B;  3VVW B;  5KHO A;  4ZRJ A;  1YX6 B;  2WLB A;  3BYT B;  3UIP B;  5G55 A;  1QT9 A;  2MHJ A;  2N4F A;  2CHW A;  3MJW A;  2RD0 A;  2JXX A;  2AQ1 B;  3EUB 2;  2KMA A;  3V3X A;  4TKN A;  3X23 A;  1P0R A;  2MQJ A;  2AX5 A;  4XDC A;  1E7V A;  5JHB A;  1E8Z A;  1CZP A;  3MC0 B;  3L4P A;  2WS3 B;  2L8J A;  1XEE A;  2EMS A;  3GS2 A;  2Y3A A;  1DGJ A;  2IY1 B;  4LJP B;  4W9I A;  1YN3 A;  4RGN A;  2BS4 B;  1JWB D;  3HK0 A;  1M4V A;  3FC4 A;  4L23 A;  1L4D B;  2GB1 A;  3UGB B;  3DHI C;  2QIL A;  3KWV A;  2O6V D;  1TGZ B;  1SE9 A;  3C0R B;  4KDI C;  1KLV A;  2UWQ A;  3ZDM C;  1K51 A;  1EU3 A;  5JXV A;  1DYQ A;  1IYF A;  3Q69 A;  2QHO A;  1WYG A;  2DHZ A;  3TL5 A;  1F77 A;  1PGX A;  1UWM A;  2OHF A;  3PPA A;  2MBO A;  1FCL A;  1ZOY B;  2KVZ A;  2QDF A;  2UU7 A;  4HPM B;  5FKA C;  1XT9 B;  1GUA B;  3PZ8 A;  4PS7 A;  2AL6 A;  1TYG B;  1SIF A;  3A9J A;  1I7H A;  3IT4 B;  3SHQ A;  1VZ6 A;  1J7B A;  5C23 A;  1V6E A;  3TJP A;  1R4N B;  2DAF A;  4W9G A;  5BMI A;  2HE7 A;  1S3S G;  1V81 A;  1STE A;  2L00 B;  2V3P A;  3BII D;  2N7E A;  1E7U A;  2RR9 A;  4KVG B;  2IO2 B;  1F2R I;  2LI5 A;  2RDG A;  1HTO A;  2CJO A;  2IZV B;  2JYE A;  2BTE A;  1H4R A;  5IO9 A;  1KFY B;  1WJ6 A;  2WXG A;  3AN1 A;  4FLH A;  3A4R A;  1SE4 A;  2BWE S;  2OJR A;  3AU4 A;  1VD2 A;  1X1M A;  2LMC A;  3TUO A;  4FHK A;  1CJE A;  2BVC A;  3VDZ A;  2WU5 B;  1SF0 A;  3NUH B;  1VJK A;  2WXI A;  5T8I A;  3ZGZ A;  2INC C;  4KIK B;  4M01 A;  2MRP A;  3QCA A;  2HJ1 A;  3QAR A;  2IPK D;  3LXF A;  2MA9 B;  3QX1 A;  4JWU C;  3MFG A;  4FHJ A;  1UD7 A;  1EWC A;  3PRP B;  2I1K A;  4GSW A;  1H8C A;  4DBG A;  1V80 A;  2WX1 A;  3B08 A;  3WAL A;  3ZVV A;  5EDS A;  1WX9 A;  4G11 A;  2D10 A;  2CHX A;  4FXC A;  3CWI A;  2EKI A;  1UBQ A;  1OQQ A;  3KYC D;  3SFD B;  2LZ6 A;  4S17 A;  5JHA A;  4WWM A;  3N9Y C;  5E6N A;  3Q14 C;  3RUI B;  4DQO C;  4P6V F;  3AEA B;  4ANW A;  1WRD B;  3IFW B;  1V97 A;  1QIL A;  4URK A;  3OWE B;  3TEW A;  3SU8 X;  1I4G A;  3I5J C;  3L13 A;  1I35 A;  1PDX A;  1OFF A;  2X38 A;  3AU5 A;  3I9V 1;  2CU3 A;  1UWX A;  2WXK A;  3FAH A;  2V0G A;  3HM6 X;  1UEL A;  4LTU A;  3VFK A;  3RUL A;  1OTR B;  2KTR A;  3TEY A;  1HQR D;  3ZTC A;  2WYQ A;  3ABV B;  2KN5 A;  5LLI A;  2K22 A;  1R4N I;  2DWQ A;  1JQ4 A;  5DPW A;  1A5R A;  2L3Z A;  3RZW C;  2ZPN A;  1EUV B;  3JSV B;  3DVG X;  3LJ3 A;  3MC8 A;  1WMH B;  2HJ8 A;  1GNU A;  4G3X B;  4MSQ B;  3ZJV A;  2KJH B;  4YXD B;  1T0R C;  4DXG A;  2CHZ A;  1GC6 A;  3T9L A;  4XWT A;  2KJR A;  4RF0 A;  3RPF C;  1ZP0 B;  1WJ4 A;  4C4V B;  4LNK A;  3IAM 1;  2IBI B;  4USA A;  4C00 A;  1SBB B;  1PUT A;  1KOT A;  3NVW A;  2H88 B;  2Q5W D;  1TKG A;  1SSN A;  4PYZ A;  1E7P B;  1N6Z A;  1C76 A;  1WM3 A;  3ZUN A;  4ANX A;  5IKC M;  4RGM A;  5EE1 A;  2R61 A;  2DZK A;  2G3Q B;  2MBE A;  4RH6 A;  1C3T A;  1RLF A;  3APD A;  3P4Q B;  3WAN A;  4C7Y A;  1JW9 D;  2ACZ B;  3NZU A;  3KW5 B;  4KSK C;  2JF5 A;  3UI3 A;  1BML C;  4NAM A;  2IO3 B;  2KOX A;  1VCB A;  1TT5 B;  4K1R B;  2DBY A;  4M0W B;  2KDI A;  1N5X A;  2E3T A;  4W9L A;  2M56 B;  1L0V B;  4C80 A;  4K3C A;  1IGC A;  5JZE B;  2LXC A;  2UYZ B;  1YQ3 B;  4B0E A;  3IBE A;  4WAA A;  5D7G A;  3B1L X;  1QOB A;  1YNT E;  5AUI A;  2ZW0 A;  3GZN B;  5HHD G;  3VRA B;  3ZNZ B;  2LVO A;  4C7Z A;  1IBX A;  4IWP A;  4JLC A;  3PRE A;  4M02 A;  4MH8 A;  3ETR A;  4NNJ B;  3D32 A;  2IDY A;  1C77 A;  4PS3 A;  4X57 B;  2VH2 A;  3DVN V;  3R66 C;  2QC8 A;  1TBE A;  2N7D A;  2ZZP B;  2AQ3 B;  5D2M B;  1E8Y A;  3VH4 B;  2W55 A;  4MGZ E;  2O6V B;  4OZB A;  3WIM A;  2KHW B;  2GRI A;  3KWL A;  2YEP B;  1PQS A;  1OQY A;  3RI7 C;  1FD6 A;  3PHX B;  2ICI A;  2OOB B;  1QLB B;  2Z59 B;  2H89 B;  1K8R B;  3DBR B;  1TS3 A;  1GG3 A;  2NPT B;  2GI9 A;  4EUT A;  3AMZ A;  2ZCB A;  4RGT A;  2DX5 B;  1N63 A;  1TY0 A;  2KQS A;  1FM0 D;  4W9D A;  1L6V A;  1VLB A;  1UBI A;  2NBU A;  3I57 A;  3P4P B;  4A3O A;  1MI0 A;  4HKZ E;  5FR6 A;  4DXF A;  5MPO A;  3L0W B;  4AUQ C;  2XEW A;  5J2R A;  4BKG A;  3K9P B;  2ZCC A;  3NVZ A;  2JYT A;  1Q1O A;  2IGG A;  4ZRP A;  2KWC A;  3AEF B;  2WNM A;  2LRW A;  2WWZ A;  2LXA A;  3AI5 A;  5BYR A;  5D3I B;  3EC8 A;  1HXY D;  1TS2 A;  1JRP A;  3N1Y C;  4NZL B;  2I1J A;  2RGF A;  4EE2 A;  2KLC A;  2N9X A;  1FIQ A;  1ZXI A;  3A4S C;  4WQM A;  4L2Y A;  3RT3 B;  4MAC A;  3VXW A;  4KGS A;  3VUY A;  4BKS D;  2VRR B;  4RFB A;  2V3S A;  3P2B A;  4K7U A;  1QF6 A;  4B9K A;  3W5V B;  1N60 A;  1SJE D;  4II3 B;  1Z5S B;  2MJ3 A;  4ARC A;  4WQO B;  4B6W A;  4BOZ B;  3W1S A;  4A20 A;  2INP E;  2WXH A;  3NHE B;  2GOW A;  1YN5 A;  4NPN A;  2MBB B;  4GDK B;  4DHJ D;  4MGY E;  2LD9 A;  3DBL B;  3VRB B;  1FCC C;  1GAQ B;  1E5W A;  1Q10 A;  4MH0 E;  2ZPY A;  4LJO B;  1F52 A;  4TV3 A;  2XN9 C;  3W1Y A;  2YLM A;  1J0G A;  3RZF A;  3V6E B;  1LM8 B;  3DBS A;  2PIA A;  3C19 A;  4AQ7 A;  1KLG D;  4KIK A;  1LFD A;  2KC2 A;  1EF1 A;  1L7Y A;  2C7N B;  3W2D A;  5D94 A;  1JWA D;  1WZ0 A;  2IJ0 A;  3MHS D;  3FIL B;  2W9N A;  1TS4 A;  4XDD A;  3RN9 C;  2WDV B;  1I4R A;  3RNF C;  4MGK E;  2KMM A;  1U4A A;  1F1H A;  4WWO A;  4CQN A;  5BYS A;  4UDU C;  1UUP A;  3ZJT A;  2DAJ A;  2W3S A;  1OEY J;  3CIR B;  1WX7 A;  4F8C B;  1L5P A;  3K9O B;  1V8C A;  4LNI A;  4GU2 A;  4MSM B;  2ASQ A;  3P4S B;  3IG3 A;  1TY2 A;  2G45 B;  3DPD A;  5BMG A;  4K7W A;  2KLG A;  4WAF A;  4ZYN A;  2FCM A;  4HLE A;  2M8S A;  4EZJ A;  2GMI C;  5AZH A;  3BYY B;  4NJ7 A;  1ROE A;  4RF1 A;  3WCQ A;  3BY4 B;  1OQR A;  3JSV A;  1HZ5 A;  1WMH A;  4JL9 A;  1IP9 A;  2XNA C;  4PT5 A;  2X8X X;  4RCO A;  1L0X B;  4A8X C;  4FJY A;  3PV1 A;  3AEC B;  3C8Y A;  2IGD A;  3P4R B;  3NOB A;  5D3D A;  5JH5 C;  5D6J B;  2WU2 B;  1HA5 A;  1WGK A;  2KYW A;  2KJ6 A;  1BUI C;  5H8Y E;  4ZRK A;  4C4V A;  3DBL I;  1WX8 A;  2L83 A;  3GP7 A;  2TSS A;  2BS3 B;  3Q3M C;  3SDL C;  2RDB C;  4B0M A;  3WA0 A;  1WWT A;  1OEY A;  4FUL A;  2GBK A;  2GBJ A;  2B76 B;  1ZKH A;  2JWU A;  3BZD B;  3H9D A;  4XX5 A;  3M62 B;  3PGE A;  4HRO A;  4BVU C;  3TCA A;  1FO4 A;  1VRA B;  4HWI B;  4A55 A;  4DDG D;  5GMV A;  3VTV A;  3NY5 A;  4GMV A;  3TEZ A;  3TSS A;  4IWQ A;  2C5L C;  2Z0E B;  4WJN A;  2K0P A;  1N61 A;  3BVM A;  1GPX A;  4JX1 C;  1T6B X;  4HK2 A;  4A6Q A;  4M0W A;  5GXG B;  2NTT A;  3QJZ A;  2MEK A;  1TZ1 A;  2FCS A;  2DZI A;  3N3K B;  5IOI A;  4GDL B;  3UIN B;  4DHZ B;  3T3O A;  4GLS C;  4W9J A;  3UQA A;  3O65 B;  4OVV A;  3CF6 E;  4KKJ A;  1BT0 A;  2ON8 A;  4KKI A;  2Y5B B;  4KSL C;  4ZYS A;  1EF5 A;  1C4A A;  3ZKJ C;  3V05 A;  1YMH E;  4N58 A;  2L1A A;  3RNC C;  5HG2 A;  3LDZ E;  1FMA D;  2G4D B;  1P9D U;  3VQI A;  3PLV A;  3U7D A;  2KDF B;  2C7M B;  2YVC A;  3DDC B;  3AUL A;  3BWU D;  3UIO B;  4IM3 A;  1IGD A;  2WDR B;  3O13 A;  1WRI A;  1GC7 A;  2O6V A;  2IGH A;  2SEB D;  1K53 A;  3ZLZ A;  3T8M A;  1ET6 A;  1V86 A;  3DOW A;  2KKC A;  1K50 A;  3EHV A;  4FJZ A;  2BYF A;  4C56 C;  1YOV B;  3ZTD A;  2LGY A;  2NPT A;  2LGI A;  2J0M A;  5G2N A;  4YTN B;  4ZDV A;  3R2I A;  2C7H A;  5KHQ A;  4KDL B;  5E6J A;  4DK5 A;  3OJ4 B;  1DOY A;  3V60 A;  1KH0 A;  3V61 A;  2WHI A;  1MPE A;  2K8B A;  1XLP A;  1XLN A;  3QC8 B;  4O1N A;  3U52 E;  1XQQ A;  2KDB A;  4RNA A;  4LDT D;  2D3C A;  3QAQ A;  3EEC A;  3BK2 A;  1NVI D;  1HTQ A;  1QOG A;  3E56 A;  2D3G A;  2MJE A;  2RSU A;  3ML8 A;  1UGJ A;  2IO0 B;  3AED B;  3ONS A;  4AWJ A;  4MT5 A;  5CHV C;  4XWW A;  3ZJU A;  5DPS A;  3KYD D;  3RD2 A;  1A70 A;  3VH3 B;  4GN1 A;  1AWD A;  2M0X A;  1F9J A;  2O2V B;  3AM9 A;  2RPV A;  3JYU A;  1RM6 C;  3IHP C;  2FUG 1;  1SE2 A;  2J4X A;  4MEL A;  4HKQ A;  5TR5 A;  2JZ3 B;  4CO7 A;  1YX5 B;  2MJD A;  1XXG A;  1LGR A;  2IND C;  2WXQ A;  4DHJ B;  3U30 A;  3QQ8 B;  2JQR B;  1SB3 C;  2A5U A;  2BBC A;  3N1X C;  4K81 A;  2KDE B;  4ARI A;  4WJO A;  2JUO A;  1C4P A;  1YJI A;  2K25 A;  1AAR A;  1VR9 A;  3VR8 B;  2J42 A;  3AE3 B;  1WJN A;  3CSF A;  3L16 A;  3AE1 B;  2D11 A;  4M8N A;  1XF5 L;  4NAW B;  1V49 A;  3H7S A;  4ZHO A;  3Q3F A;  1GB4 A;  1FFV A;  2MWS B;  4GDK A;  3HUI A;  4E3C A;  3LB8 C;  4WWN A;  2PE6 B;  1R4M B;  1XO3 A;  2NCN A;  2W3R A;  3N32 A;  1EWY C;  2BB5 A;  1R7S A;  1I4H A;  3A9K B;  3EA6 A;  3U2S C;  3IVF A;  2IYD B;  1K52 A;  2PKO A;  3AE2 B;  1P3Q U;  2PE9 A;  3Q8C A;  3R2T A;  3ZXV A;  4I6P A;  4K3B A;  3M3J A;  4P16 A;  2AWT A;  2JX5 A;  2MBH A;  4GIV A;  2V3N A;  4CYE A;  3N20 C;  2AEH A;  2PJH A;  3FIL A;  4KGR A;  3Q3J A;  1ACC A;  2JXT A;  4N59 A;  3A1Q B;  1V1P B;  1TJE A;  1NYQ A;  1YQB A;  2EEL A;  4IUM B;  1RRB A;  3GE3 C;  2L52 A;  4KZ0 A;  4AJY B;  1P7E A;  1FEH A;  1F0Z A;  1PFD A;  3HRD D;  1Y56 A;  1P7F A;  4ZOH C;  2DYO A;  1N5W A;  2V4L A;  3QWZ B;  2Y5C A;  1ZXH A;  2BYE A;  2QMT A;  2KT7 A;  4OZA A;  2BYV E;  3MP9 A;  4GB9 A;  4ANU A;  3RMK C;  1E8W A;  1YQ4 B;  5I4D A;  3U4E G;  1TKY A;  1C4C A;  2N1V A;  1FXA A;  2NMQ A;  1AN8 A;  2K1F A;  4ZHP A;  4IC7 B;  3JVZ X;  3DHH C;  4YSX B;  3PT2 B;  5IP4 D;  3H1U A;  2K5P A;  4EZK A;  2BWF A;  2MP2 B;  2GBN A;  2BYT A;  2KWU B;  2V9H A;  3Q6B A;  1SEB D;  1Y8R C;  3DBH B;  2MW5 A;  5TSS A;  3J9C A;  2D3A A;  1WY8 A;  3Q3O C;  1J7C A;  4A90 A;  4TMA B;  4QAY A;  2LJI A;  1P98 A;  3TMP B;  3PS6 A;  3APF A;  4FN2 A;  1R4M I;  3ECI A;  4HDO A;  2WXF A;  3L10 B;  2KFJ A;  1UNS A;  3RYT A;  2L76 A;  4JE3 B;  2J52 A;  4HDQ A;  2R2O A;  3DCG A;  3MTN B;  2AYO B;  3NVY A;  1WE7 A;  4HPL B;  2WXL A;  2KXJ A;  2VZK D;  4GXB A;  4LK0 M;  1WGH A;  3KQ4 A;  3NZ3 A;  1T0Y A;  2K9X A;  2L32 A;  1MG8 A;  4A9A A;  2KWD A;  1MHX A;  1YD8 U;  1D3Z A;  1E90 A;  3AEE B;  4G0N B;  2RPQ A;  2BS2 B;  4XC2 A;  2DLB A;  4IM2 A;  2D2Q A;  2KMC A;  1T0S C;  1L2N A;  2BKF A;  4MEM A;  2KTF A;  2LGS A;  4B95 A;  3GZN I;  2BGF A;  1GJZ A;  4P7I A;  4GGQ A;  2KX0 A;  4XYC A;  3NJT A;  4GDL A;  3JW0 X;  3OLM D;  3IT6 B;  1G6J A;  4HCN B;  2WDT B;  3E9S A;  4IDI A;  1JWS D;  5J18 A;  4W9E A;  1AW7 A;  2CR5 A;  4A3P A;  3AE6 B;  1TZO A;  2QCZ A;  1C1Y B;  2XK5 B;  4ZRQ A;  4REZ A;  1SE3 A;  2KQ7 A;  4JGH B;  4RM9 A;  2NVU I;  4L1B A;  1DOI A;  2ZVN A;  3DBR I;  4WH4 A;  4MGI E;  1ESF A;  4LNN A;  2M1M A;  4LLG M;  2K6Q A;  4M8M A;  4OW0 A;  1ZE3 D;  4NQK E;  2FAZ A;  4ASW C;  1L6U A;  1RWS A;  1WE6 A;  1XD3 B;  4YTP B;  1TKE A;  3BVZ A;  5CHF A;  1S1Q B;  4DDI D;  3GE8 C;  1WXM A;  1WH3 A;  1NYR A;  4LDT B;  1HEZ E;  2KAJ A;  2J53 A;  1I4Q A;  3Q8E A;  2CJN A;  1LQB A;  3VTW A;  4W9K A;  4E71 A;  1FXT B;  2C60 A;  5LXI B;  1C9F A;  5L95 C;  5BYQ A;  1FFU A;  2ONQ A;  5AEK B;  2QJL A;  2E6X A;  3PVL A;  2LGX A;  1CQV A;  1C78 A;  1RYJ A;  2RMM A;  1VDV A;  2V4I B;  1TS5 A;  3ZNI D;  1ZGU B;  3PZ7 A;  3DWG C;  3NS1 A;  3R8B A;  1YJ1 A;  5HI1 A;  4BKS A;  2FUH B;  3Q2A C;  3FKY A;  2KNB A;  4PK1 A;  1YJJ A;  1XCQ L;  1WJU A;  1WGY A;  3RNB C;  3DVN U;  3ZO5 B;  3AE7 B;  4G50 A;  1FPY A;  3LYY A;  3H8H A;  1Q5W B;  4J6I A;  2O2V A;  3DVG Y;  2J0K A;  4OHJ A;  4WWP A;  5E6P A;  1UZX B;  4WJQ A;  3HM3 A;  3H7P B;  4FBJ B;  2CS4 A;  2KFK B;  4US9 A;  2DEN B;  2KZR A;  2JT4 B;  3Q8B A;  5IN7 A;  1UF0 A;  3B9J A;  3RCZ A;  4RM8 A;  3T3N A;  3ZQ4 A;  3VAW A;  3NS8 A;  1NEN B;  3ZIM A;  3HVZ A;  4M00 A;  3HHM A;  4AS1 A;  4BFR A;  2WXM A;  3AV8 A;  5L83 A;  4NAW A;  4I6L B;  2MBQ A;  2LHE A;  3KVF B;  4W9F A;  2BW2 A;  4EZL A;  4JPS A;  1PYW D;  2I38 A;  3ML9 A;  5EE0 A;  3KLS X;  5HKH A;  3M63 B;  2D5G A;  1IUE A;  3PSE B;  4EEW A;  5FR3 A;  4TSS A;  1NEK B;  2HD5 B;  3A9K A;  3UF8 A;  4D2K A;  1ENF A;  4F7Z A;  3PLU A;  4IM0 A;  3SR6 A;  1UH6 A;  2QIE B;  4NJ6 A;  2HDE A;  3KUZ A;  2K6D B;  1KLU D;  3HIZ A;  3ENE A;  3SFE B;  3NG0 A;  5CHW A;  3B0A A;  3MC9 A;  2NR2 A;  2JRI B;  2WXN A;  4ITK A;  1WF9 A;  1PGB A;  1KTK A;  2KVR A;  3P42 A;  1BXT A;  1WGG A;  2BT6 A;  2NS5 A;  2K3U A;  1T5X D;  4LCD E;  4BOS C;  3Q3N C;  2LJ5 A;  3GB1 A;  3A1Q A;  1V1P A;  4P1B C;  4OVU A;  4WUR A;  2ZNV C;  2FBW B;  1B9R A;  3AE8 B;  2LWP A;  2LVP A;  3EFC A;  5LNK 1;  4JIO U;  3P63 A;  3TIX A;  1VZ8 A;  1WFY A;  2INN E;  4BKT A;  2N9L A;  1SIJ A;  1QOA A;  1WXV A;  1KJT A;  1WXA A;  2N9P C;  4ACF A;  4DXA B;  3PO0 A;  3X0W A;  1WXS A;  4NJC A;  4N6E B;  2HTH A;  4NQL B;  5LXH A;  3AH7 A;  1V9J A;  5CX3 A;  3ZRF A;  1SGH A;  1QKZ A;  4XE0 A;  1V5T A;  4US8 A;  2K8H A;  5CTR C;  2DNF A;  3W5U B;  2ZJD A;  5G5G A;  3R3M A;  3VTU A;  2N0S B;  4RGO S;  3U7Z A;  2MP2 A;  3URY A;  4TUU A;  2BPS A;  5EE3 A;  2FIF A;  1KM7 A;  2L0F A;  2M17 A;  4KGT A;  3GOE A;  2G4S A;  2BB6 A;  4HEA 1;  3EGR A;  3V6C B;  2DYB A;  3V62 A;  2VZK B;  2KC1 A;  1ZDX A;  4XGA B;  4LNO A;  2C9W B;  2W54 A;  4R3D A;  1RFK A;  1FRR A;  3KUD B;  3Q8F A;  1TIF A;  2PVO D;  4MJS B;  1JWU D;  1E0Z A;  1XLO A;  3I63 C;  2JZZ A;  1RFA A;  4GOC A;  4IWO A;  4MM3 B;  2LVQ A;  2LFI A;  3N1Z C;  2LRU A;  2CU1 A;  1WI0 A;  1L4Z B;  2R2Q A;  3AEG B;  2LGD A;  1D5X C;  2QSD A;  3KH0 A;  4E74 A;  4HVB A;  1EU4 A;  3H6N A;  2GBM A;  4TQ1 A;  2NBW B;  3S2A A;  1WXQ A;  3QIJ A;  1WIA A;  1ISN A;  1I42 A;  2LHD A;  2M19 A;  3BVG A;  2CKH B;  3N30 A;  2D07 B;  4LNF A;  1I4X A;  3NZS A; 
#chains in the Genus database with same CATH homology
 3RMK C;  3GE3 C;  4P1B C;  3DHH C;  3DHI C;  3I63 C;  2INC C;  4P1C C;  1T0Q C;  3Q2A C;  3N20 C;  3Q3M C;  1T0R C;  1T0S C;  3DHG C;  3RI7 C;  3Q14 C;  3N1Z C;  3N1Y C;  2IND C;  2RDB C;  3RNG C;  3RNB C;  3RN9 C;  3RNA C;  3I5J C;  3RNE C;  3N1X C;  3Q3N C;  3RNC C;  3GE8 C;  3RNF C;  3Q3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...