3RNCC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i100a double mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 23
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rncC00
3Q2AC 3RNAC 2RDBC 3N1XC 3Q14C 3DHHC 2INCC 2INDC 3I63C 3N20C 3Q3NC 3GE8C 3I5JC 1T0SC 4P1CC 3DHGC 4P1BC 3RI7C 3GE3C 3N1YC 3RNBC 3RNEC 3Q3OC 3N1ZC 3RNCC 1T0RC 3RNGC 3RN9C 3RMKC 3Q3MC 3RNFC 1T0QC 3DHIC
chains in the Genus database with same CATH superfamily
1I35A 2BPSA 2MBHA 1WJUA 2BW2A 2CR5A 3L16A 4LCDE 2KO3A 3KH0A 3AMZA 3PSEB 5HFYA 2KMCA 4LJOB 2BYFA 2GI9A 1QOGA 1E10A 2KWVB 1J8CA 1WE7A 5EDSA 3ML9A 3ZYYX 1JWBD 2WU5B 4XYCA 1EU3A 4PYUA 1TS5A 2MJ3A 4W9GA 2CHWA 2FCQA 2KNBA 1PYWD 4RFBA 4DHJB 4FBJB 5HG2A 2N7JA 2RPQA 2AQ2B 3CSFA 4RGTA 2MCNB 1WRIA 3P2BA 2BQQA 2HJ8A 3SR6A 4M00A 1WXMA 1TJEA 5E6NA 5AUKA 2MJDA 1WGHA 1QKZA 1P7FA 2FNJB 2ICIA 2BWES 4GU2A 4HCPB 1KTKA 2FUG1 3NZUA 3ZTCA 2KVRA 3DVGY 3FKYA 2K39A 2V9HA 2EMTA 2MSED 1EF1A 1GJZA 2WLBA 4A3PA 2KHWB 3H9DA 2QHOA 2PIAA 3ABVB 1YN4A 4HK2A 4PK1A 4XDDA 3TMPB 1A70A 3VRBB 4I6PA 1CJEA 3Q3NC 1A5RA 1XLNA 2NCNA 4EZJA 3W1SC 1NI2A 3P4QB 3U4EG 4OVZA 4A55A 3C19A 4GN1A 3TBLD 5G2NA 1IUEA 4JQWC 4RM9A 2DYOA 2OEDA 2J52A 1RAXA 4A9AA 1YX5B 1WH3A 1FEHA 3TJPA 1I4GA 2R2OA 4CHKA 1EO6A 1QILA 1WM2A 3FILB 4HEA1 2M8SA 2RPVA 1FPYA 4HRSA 2DHZA 4HPMB 4WJNA 3QCAA 4RNAA 4X57B 4HVBA 2KWCA 2MW5A 3UI3A 4AQ7A 3B1LX 1TYGB 1KF6B 4P7IA 3NHEB 3LDZE 3JYUA 2QEJC 4C56C 1GUAB 3H7PB 1LQBA 3APDA 3L13A 1SGHA 3P4PB 4GLSC 4TMAB 1SEBD 3TSSA 3NVVA 3AEAB 2N4FA 2K22A 1F77A 4YTMB 3PHXB 1ZGUB 4E74A 4YTPB 3K9OB 4WAAA 1FNVA 2WWZA 3A33B 3V3XA 2MWSB 2D2QA 2YLMA 3B2GA 3H7SA 3VH4B 1YJJA 3L0WB 5EE1A 2L00B 5AEKB 2MP2B 3U52E 3N32A 2PEAA 3VTVA 2BYTA 1ZDXA 1WFYA 3BK1A 1E8XA 4BZAA 1MPEA 2Q5WD 1JQ4A 1V5TA 2KDMA 4YSYB 2K6QA 3IHPC 4M0WA 2INCC 4NAWB 2K9XA 2DWQA 1V6EA 4PS7A 2JRIB 2GB1A 1STEA 4TQ1A 4F1SA 1JW9D 3AEFB 4AS1A 5H92C 3WCQA 2GBKA 1C4AA 2REXA 1B1ZA 4N6EB 4K3BA 2R2QA 4YT0B 5FKAC 1VZ6A 2KD0A 1VR9A 2D07B 3KLSX 4JWUC 3V6CB 5C3JB 3ZKJC 1V80A 2AQ3B 3AULA 2ZEQA 4I6NB 5BYSA 2N9XA 5CHWA 1KFYB 3DBRI 4P1BC 4FA6A 3ZNHB 1LO5D 3C0RB 1WX7A 5BO4B 2VH1A 1F52A 3QWZB 4FN2A 1P0RA 1YQ4B 3X0WA 2E3TA 4WAFA 2IYDB 2V0GA 3R3MA 2KTFA 3OAWA 3Q2AC 3W9CB 3B0AA 3AM9A 2CU1A 2KMMA 1XT9B 4NQKE 2M19A 3N20C 2L3ZA 2N9EB 5BYRA 4IUMB 4MSMB 5IP4D 2HTHA 4XX5A 4EUTA 1C3TA 2BTEA 4DDID 2C7NB 4YSXB 3KUDB 1TT5B 4WURA 5CHVC 1S1QB 3ZIMA 2XBBC 3A9KA 4IM0A 4KGRA 1Z5SB 4BFRA 4K7WA 5MPOA 1JRUA 1IGCA 1D3ZA 5TR5A 1WYGA 5DCNA 2KFKA 3HUIA 4KGTA 3WANA 5LNK1 2AYOB 5LLIA 1ZDVA 2Z8LA 4KX6B 4P6VF 4RGNA 1SF0A 3KYCD 3DBLI 4GMVA 4WWMA 3ZXRA 5FK9C 2FCMA 3W1SA 2ZCBA 4W9CA 4LNIA 3DBHB 2O6VD 4W9HA 2LGXA 1WXVA 2CJNA 3DOWA 4XWTA 1E7PB 1J0GA 2KFJA 5BMIA 1I4XA 1T0YA 4FADA 4HDQA 3RNCC 1MFWA 2WXFA 5JHBA 4GDLB 3DHIC 2DBYA 3AXCA 3IG3A 2QC8A 1RM6C 1P3QU 2KDEB 3R2IA 4DXGA 5CHFA 4XE0A 2DX5B 3SHQA 2AQ1B 2WXQA 3CF6E 3RI7C 2Z0DB 1YQ3B 5LXHA 4B6WA 1WRDB 4BOZB 4BBNF 3WAMA 1M94A 2N9PC 4KDIC 3AEBB 3N9YC 1ZXIA 1ROEA 4PT5A 2NTTA 2KTRA 1L7YA 1YN3A 2M0AA 2WDTB 2HTME 1YD8U 4W9FA 3MJ5A 4XWWA 1AW7A 3N1YC 3AN1A 4MGZE 3CMMB 4ZRQA 2PW9A 5J2RA 3Q6BA 2UYZB 3KUCB 4CQNA 1FRRA 3K9PB 2DAFA 3S2AA 4HPPA 3ZJTA 2JSVX 1WY8A 2B76B 1TTNA 2CU3A 2MA9B 4XDCA 2XN9C 1QT9A 2JZPA 5GMVA 2MBEA 2QCZA 1WR1A 5G5GA 2WU2B 2LWPA 2Y5CA 1C9FA 3AE5B 1DYQA 1UWXA 3Q14C 2N7DA 2WHIA 3VTUA 2OJRA 2V3PA 3RZWC 1EU4A 1XLOA 3BK2A 1XLQA 4ZRPA 1SE3A 1XLPA 4JLCA 3SFEB 2C5LC 2KDBA 4LK0M 4OVVA 3NOBA 3R2TA 2BB6A 4US9A 3T9LA 3WIMA 3QAQA 1X1MA 3Q8BA 2WNMA 4II3B 1V2YA 4BVUC 2WX0A 3LXFA 4P1CC 2ACZB 2IO0B 1IPGA 2FBWB 3ZDTA 4MSQB 4R3DA 5IA7A 4D2KA 4M0WB 3HVZA 3ZNID 1WF9A 3RNAC 4KV2A 1CQVA 3V61A 2KMAA 3SDLC 4WWOA 4NJCA 3HHMA 3Q8EA 2L52A 2DZMA 3PVLA 2BKRB 4WJQA 2OHFA 1FXIA 4MACA 2V1YA 3I57A 3AEDB 4G50A 3RFZB 2RDBC 3NZSA 4EE2A 2I1KA 2PJHA 2ZJDA 2LI5A 1FM0D 2RSUA 1FXAA 1N62A 2VRRB 1TBEA 3VXWA 2MBBB 1FFVA 2BYEA 1UNSA 4NAWA 2BYVE 4W9DA 2AL3A 3UIPB 3AECB 4HKQA 2DZJA 2N1VA 3QHTA 3Q69A 3RD2A 3EA6A 3OJ4B 4NZLB 1WXSA 1KLVA 4NJ7A 2WXIA 1V81A 3A9KB 1IP9A 4IDIA 2JYEA 1QF6A 2KLCA 2WDRB 3AE7B 1L2NA 3RNFC 2KFKB 3W2DA 1YN5A 4MH8A 3TIXA 5D3IB 2W54A 2ZZPB 2LZ6A 1OGWA 4DXFA 2KN4A 1XCTL 1N5WA 1V5OA 2EMSA 1NBFC 1IGDA 2LASA 2VH2A 3VUWA 2JZZA 2ZPYA 1QOBA 2ASQA 2WDQB 3QARA 1PQSA 3PO0A 3APFA 4FXCA 4N59A 5AUIA 1E7UA 4CO7A 4LLGM 4ACFA 3C8YA 1ET6A 2WS3B 2LRUA 1GPXA 4EKUA 4ASWC 4LTUA 3HM3A 3IBEA 3GS2A 4FHKA 5CX3A 3VR9B 1FCCC 2N0SB 1NI3A 1WGKA 1EWYC 1NENB 1KLGD 2GBJA 4MGYE 1WX8A 4MM3A 5EE0A 2DAJA 4RF0A 1NYQA 2V3NA 2DZIA 4K3CA 2AEHA 5IOIA 3T3NA 3AE8B 3NG0A 3U30A 1T3QA 1T0SC 3PZ7A 5D94A 2DYMA 2WXJA 2L7RA 4ICVA 2KTRB 4YWGG 5L83A 3IT4B 2NMQA 1WZ3A 3DVNV 4M01A 4EFOA 1RFAA 4GDLA 2VZKD 1PGBA 1AARA 4H2AA 1SIJA 2IGGA 2KVZA 4GDKA 3PLUA 1VZ8A 2WQYB 5G55A 1HTOA 4LNKA 2CHZA 2X38A 3AU4A 3EHVA 1JCKB 2G45B 1J7AA 3L4PA 1XQQA 4MDKE 3SFDB 2H88B 3B9JA 4B0MA 3AE1B 2KKCA 3JSVA 3PT2B 5JHAA 3KWVA 2W9NA 2JPHA 2J0MA 4JIOU 2L05A 4A90A 2BB5A 2YEPF 4IOIE 3VUXA 2Z0EB 1UGMA 3NVWA 2C9WB 2ON8A 3DPDA 3VTWA 2L1AA 2KN5A 2CJOA 2PKOA 4EEWA 3VHTC 1XCQL 3J9CA 4AP4C 4XGAB 3UQAA 2M0XA 2HD5B 5D2MB 2QIEB 4FHJA 2KLGA 4IG7B 3A1QA 4MJSA 4GIVA 2DLBA 3PZDA 1BUIC 1T5XD 1ISNA 1UGJA 1SIFA 4J3OD 2KQ7A 3PRMB 4YTNB 3OWEB 4JWSC 1KLUD 2O6VA 2WDVB 2FAZA 3W1YA 1ZE3D 1V9JA 3VAWA 3Q3JA 2KJHB 2I1JA 2CS4A 4L2YA 2V3SA 1JALA 1TKGA 2VZKB 5JZEB 3WALA 3QQ8B 2AL6A 1K8RB 3EGRA 2EKEC 2DYBA 3TUOA 1TS2A 1ZUD2 2IO3B 2WP9B 4UDUC 4JX1C 2LGYA 4WH4A 4RMAA 1WXQA 3MC9A 2FE8A 1UF0A 1D4BA 1WGDA 1WGRA 1DOXA 1D5MC 1Z2MA 4DHZB 1E6EB 2GBNA 2LUEA 2PVOD 1M4VA 3RMKC 3AE6B 2DNFA 1TKYA 2Y5PA 5C23A 3BIID 4C80A 1QQRA 1Q0WB 3BYYB 3Q8AA 4IC7B 4IWPA 4MEMA 3LYYA 2H89B 1KJTA 1UWMA 2RDHA 1R4MB 4HPLB 2HE7A 3ZDMC 1MVKA 3I3TB 2L76A 2WYQA 1VRAB 4TUUA 1MHHE 4KKIA 5BMHA 3VR8B 1CMXB 1ZP0B 4J6IA 1SJED 2K0PA 1RLFA 4BKGA 4W9JA 2IZVB 2WXRA 2IY0B 2PE6B 2L32A 5EE3A 3JVZX 3UF8A 4BAXA 3ML8A 2G9HD 5FR3A 3KWLA 2BBCA 4S17A 2ZVOA 1OQQA 2WXNA 5JH5C 2JZ3B 2I38A 3IAM1 1VZ7A 4A8XC 2W55A 5BMGA 2FCSA 4NJ6A 1P98A 2G4DB 1R7SA 2V4LA 3RNEC 3Q3FA 1J7BA 1SSNA 2HDEA 2MH7A 2O2VA 3PLVA 4P16A 1Y56A 3U7ZA 3QX1A 4E71A 2KDIA 1L6VA 4GSWA 1KOTA 4MM3B 1ACCA 3AB5A 2L83A 1F2RI 4HLEA 2RGFA 1WJ6A 3BZDB 3ZRFA 4N58A 4US8A 4DK5A 5DPTA 5KHQA 2D3BA 4K7SA 1VJKA 3BY4B 1L0XB 2JY6A 2XNAC 2KZRA 3A9JA 2LGIA 1L4DB 3DVNU 4C7ZA 4NAMA 1F1HA 1FNWA 2MHJA 1SE4A 4MH0E 1IYFA 3HRDD 1FO4A 4GXBA 5HKHA 2KWDA 2AX5A 5H8YE 4GDKB 2KACA 3DBSA 1MJDA 4BKTA 2RDGA 1E90A 2QDFA 2EKIA 5E6OA 2TSSA 3IXSA 3CSTA 5LXIB 4M8NA 1ZW7A 4JGHB 3IFWB 2RMMA 2ZW0A 4I6LB 1V1OA 5T8IA 3MP9A 3Q3MC 4K81A 1SJHD 3APCA 4IWQA 2GOWA 2K8CA 4AJWA 3DWMA 3JSVB 4K1RB 2BS2B 2NTSA 3VFKA 4M8MA 4TV3A 2LHEA 3WA0A 1L6UA 2J0KA 2IO1B 2KQ4X 2V4IB 4RH6A 1R4NB 1WI0A 3CWIA 3IT6B 1I4QA 1C4PA 3VDZA 4AWJA 3TCAA 4W9KA 2NS5A 3PV1A 4ZHPA 1JRPA 3A1QB 4HKZE 4MJSB 3MJWA 5D7GA 4HJGE 3P1MA 1GC6A 2RR9A 1XEEA 1Y8RC 2O6VB 2BGFA 1ESFA 3FC4A 3MC8A 4S0RA 3V60A 2N7EA 1JWSD 2XK5A 1L0VB 2PMVA 1YMHE 1OEYJ 1I42A 4ANXA 4ZRJA 1N6ZA 4WJPA 3DCGA 1IBXA 2PLPA 2I2YA 1ZKHA 1E8ZA 3PS6A 5DPRA 3ZO5B 1PFDA 1PGXA 1D6EC 2ZCCA 1UD7A 4LNFA 4KGSA 1RRBA 3URYA 2GBMA 2WGSA 3MC0B 4W9EA 2WXPA 3L17A 5IN7A 3W5UB 2PVGC 1V49A 3HIZA 3NY5A 4MGKE 3ZJVA 4OZAA 1V97A 1BXTA 4ZYNA 3GB1A 3OJ3A 1T0RC 1QOFA 4CYEA 1WM3A 3GP7A 3P4RB 3U8ZA 3ETRA 1EF5A 2L8JA 4L23A 4HDOA 4BKSA 4LNOA 2IGHA 1VD2A 3ZLZA 1WJNA 1SXTA 1HXYD 5I4DA 4AJYB 2KDFB 1L4ZB 1U4AA 2KC2A 4FJYA 2NR2A 4ZYSA 1C77A 3ZQ4A 2BWFA 2KWUB 2D3GA 4USAA 1L0YB 1TS3A 2IPKD 1K50A 2WX1A 4OHJA 2C7HA 4B0EA 2JWUA 1N5XA 2EELA 3BVZA 1JMLA 3MHZA 1C78A 4C4VA 2BVCA 1DGJA 2W3SA 4LNNA 3X23A 4OVUA 2A5UA 1TY2A 1XXGA 3U7DA 1CZPA 2CHXA 3H1UA 3PHWB 3OG5A 4BBNC 5BYQA 2G1EA 3KUZA 4A20A 2JYTA 3R7QA 2LVQA 2K8HA 2O2VB 2PPHA 1H8CA 1TKEA 1SE2A 1WJ4A 1OQYA 4WQMA 3AV8A 3KW5B 4ZOHC 3MHSD 2D3CA 2LRWA 3ZJUA 2LFIA 3Q8CA 1PDXA 3HM6X 2FCNA 5FR6A 1ZPSA 2LXAA 1Q10A 2N1WA 4TSSA 2K25A 3GZNB 4JL9A 4W9IA 2MRPA 4G3XB 4F7ZA 3A9JB 1E5WA 3JW0X 5IO9A 3AE3B 4KKJA 2K1FA 1AYFA 1FRDA 1NVID 3DHGC 1V8CA 2J0JA 2KJRA 1GB1A 3Q3OC 3ECIA 2LEKA 3R7RA 1FCLA 3NS8A 1JROA 3H8HA 4ARCA 3ONSA 2KC1A 4WWNA 3L10B 2AWTA 3N30A 4E3CA 1QZEA 1WMHA 2E6XA 3QC8B 3A4RA 1BMLC 3NRZA 3ZVVA 2M1MA 4IM3A 2L0FA 3HK0A 3I9V1 3NUHB 4DXAB 2LJ5A 4W9LA 4YL8A 2MX2A 2ZW1A 2IDYA 3ZTDA 1YX6B 3R66C 4WWPA 1UH6A 2LVPA 3DDCB 1WZ0A 4FULA 3I5JC 3NVYA 3VH3B 2KX3A 4BKSD 2KK8A 4WJOA 3RNBC 1ENFA 1HZ6A 3PZ8A 4JPSA 2GLSA 4XZ4A 3UIOB 1T6BX 3LB8C 4ANUA 2FUHB 3BVGA 1WYWB 5AZFA 2LGDA 1C79A 2Y3AA 2PE9A 3E9SA 4M02A 1K52A 2FIDA 1GC7A 3GE3C 2XK5B 1E8WA 1G6JA 3NZ3A 1ZXHA 4OZCA 3SU8X 1ET9A 5HI1A 1V1PA 3VQIA 1T0QC 3PPAA 2OOBB 5IAAC 1IBXB 3QK0A 4GOCA 5DPSA 3L08A 5C2TB 1QOAA 2R61A 4JE3B 2INPE 4DWFA 4HJKA 2LJIA 2M56B 3T8MA 4HXDA 4II2B 1MI0A 4URKA 2ZNVC 1UZXB 1K51A 1WX9A 3QA8A 4Q2JA 1NEKB 3FAHA 2JRHA 4ITKA 3Q8FA 2IY1B 3PRPB 5AZHA 2RD0A 1YQBA 2A4ZA 3DWGC 4B9KA 3VRAB 4HWIB 2JF5A 2J7QB 1FFUA 1FXTB 3PGEA 4HROA 1JWMD 3B2FA 4FJZA 4RCOA 1HE8A 3TEWA 4OW0A 3IVFA 4WQOB 4EZKA 4TKNA 3WAOA 2BF8B 1FD6A 1K53A 1OFFA 2KT7A 5D3DA 4QAYA 1XD3B 1R4MI 3DQVA 3TL5A 3BINA 4DDGD 2L0TA 2HJ1A 1S3SG 4WIPA 1I4HA 2YEPB 1UBQA 2DENB 4ANWA 1Q1OA 3LJ3A 4C7YA 3N1XC 3P4SB 2K8BA 4FJVB 1FIQA 4DQOC 1HZ5A 3NVZA 1QLBB 3QJZA 2LUMA 3PTFC 4C4VB 5J17A 2NPTA 1MG8A 1TZ1A 1ZOYB 2JXTA 1HTQA 3V6EB 3AEGB 1KH0A 3KYDD 1LXDA 2LMCA 3RZFA 2SAKA 2WXHA 4EZLA 3SD5A 1F0ZA 2LVOA 2JWZA 1RWSA 2IO2B 2NBUA 2D10A 3EECA 2M4NA 3T3OA 3UGBB 4BOSC 1P7EA 2KQSA 1WGGA 2MBQA 1BT0A 2UU7A 1E8YA 4RGOS 3WAPA 1GB4A 2JUOA 4L1BA 1LM8B 2GBRA 2LXCA 1VLBA 3D32A 1AWDA 2QMTA 3ENEA 3UINB 3CIRB 5AZGA 2YVCA 2IBIB 3EFCA 1KRHA 4ZDVA 4IKGA 2D5GA 5EE9A 2FIFA 5CTRC 3MTNB 1YNTE 2N9KA 3BWUD 1AN8A 2NBWB 4RGMA 1VCBA 3DBHI 3TEYA 2PTLA 3M3JA 3DBRB 4XC2A 2XEWA 1HEZE 1GNUA 2KJ6A 3ZNZB 4FLHA 3UQBA 1H4RA 4KZ0A 2ZPNA 1OQRA 3DHHC 1WMHB 1N61A 3KVFB 2JXXA 4AUQC 3BYTB 3BVMA 1WSPA 1F9JA 2JT4B 3GOEA 1YIWA 2JVCA 1P9DU 2J42A 3RPFC 2MBOA 3AI5A 3RN9C 1EWCA 1LFDA 1KM7A 1WGYA 4ARIA 1DOIA 1L5PA 4KIKA 1DOYA 1GAQB 2N9LA 4DHZE 1VDVA 3P63A 4K7UA 4O1NA 4EOYA 2WXLA 1OTRB 1EM7A 1R4NI 3DBLB 5E6JA 2WXGA 2BT6A 3A4SC 4PYZA 2Y5BB 4KZCA 2C7MB 3KQ4A 1E0ZA 1UUPA 3AH7A 2JX5A 3ZXVA 2OJWA 1N60A 4MELA 3PREA 5IKCM 2LGSA 4YSZB 1FMAD 1V1PB 1XO3A 4ICUA 4NNJB 1D5ZC 1D5XC 1B9RA 4ZRKA 3N1ZC 4A6QA 2C60A 2K3UA 2G3QB 1P1AA 5G5HA 4ZRIA 2GMIC 1J7CA 3M62B 3ALBA 1EUVB 1RYJA 3QIJA 1WE6A 3NS1A 1C76A 3HVDA 1YOVB 2MQJA 2X8XX 2UWQA 3DVGX 1HQRD 2M17A 5GXGB 3NJTA 1NDDA 4MT5A 3O65B 3EC8A 4N9F4 1WWTA 4NPNA 1FNUA 5C1ZA 3TEXA 1I4PA 2INDC 1TY0A 1MHXA 4PS3A 1N63A 3M63B 3OLMD 3V05A 3N3KB 3W5VB 1C1YB 2W3RA 1SE9A 1SBBB 2J4XA 1YJIA 3AEEB 4IWOA 2INNE 1LGRA 1V86A 3M95A 3MFGA 3V62A 2WXKA 3RCZA 1F2RC 3VUYA 3ZNGC 4C00A 4GGQA 4ZHOA 5L95C 3E56A 3ZRCA 2B3AA 1CK1A 3H6NA 2LD9A 1GOZA 4DBGA 4AOFA 3FILA 1J19A 3TEZA 1SB3C 4LDTD 1WIAA 4KSKC 1YJ1A 4LJPB 2QJLA 3AE2B 2QSDA 2NPTB 4NQLB 5D6JB 1WR6E 3H7PA 1E9MA 4OZBA 5HHDG 1GG3A 4F8CB 2K5PA 2JQRB 1PUTA 2NBVB 1I7HA 2JU6X 2QILA 4IW0A 2MLBA 5J18A 2D11A 4MGIE 2IJ0A 2WXMA 1PGAA 1TS4A 2GRIA 3ZUNA 2LHDA 3EUB2 3VVWB 1HA5A 2ONQA 1TZOA 5E6PA 2KOXA 1Q5WB 2KANA 2MEKA 1UELA 3IAS1 2BS3B 2MP2A 2WXOA 4IM2A 5KHOA 3RULA 2D3AA 1JWUD 2KX0A 3RT3B 4B95A 5JXVA 2IGDA 3O13A 1TGZB 4TQ0A 3SEBA 2ZVNA 3AE9B 3GE8C 2J53A 4ANVA 3L54A 4HCNB 4DHJD 4RM8A 1TIFA 1C4CA 3P42A 2Z59B 2G4SA 3RNGC 1WXAA 2CKHB 3RUIB 3GZNI 3B08A 3RYTA 2KXJA 5TSSA 2KAJA 4RF1A 4KVGB 4G0NB 4KDLB 3U2SC 1MG4A 2BKFA 1UBIA 2NVUI 4REZA 1I4RA 4YXDB 4GB9A 4LDTB 1JWAD 2DZKA 2W82A 1RFKA 3R8BA 2BS4B 2K6DB 3ZW3A 2SEBD 1XF5L 4G11A 3I63C 1OEYA 1E7VA 5DPWA 3ZGZA 2MJEA 3EFUA 3AE4B 3AU5A 4PS8A 4NY0A 3PRZA 2ZNVB 4KSLC 4KIKB 2KYWA 4A3OA 1NYRA
chains in the Genus database with same CATH topology
3Q2AC 3RNAC 2RDBC 3N1XC 3Q14C 3DHHC 2INCC 2INDC 3I63C 3N20C 3Q3NC 3GE8C 3I5JC 1T0SC 4P1CC 3DHGC 4P1BC 3RI7C 3GE3C 3N1YC 3RNBC 3RNEC 3Q3OC 3N1ZC 3RNCC 1T0RC 3RNGC 3RN9C 3RMKC 3Q3MC 3RNFC 1T0QC 3DHIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2A C;  3RNA C;  2RDB C;  3N1X C;  3Q14 C;  3DHH C;  2INC C;  2IND C;  3I63 C;  3N20 C;  3Q3N C;  3GE8 C;  3I5J C;  1T0S C;  4P1C C;  3DHG C;  4P1B C;  3RI7 C;  3GE3 C;  3N1Y C;  3RNB C;  3RNE C;  3Q3O C;  3N1Z C;  3RNC C;  1T0R C;  3RNG C;  3RN9 C;  3RMK C;  3Q3M C;  3RNF C;  1T0Q C;  3DHI C; 
#chains in the Genus database with same CATH topology
 1I35 A;  2BPS A;  2MBH A;  1WJU A;  2BW2 A;  2CR5 A;  3L16 A;  4LCD E;  2KO3 A;  3KH0 A;  3AMZ A;  3PSE B;  5HFY A;  2KMC A;  4LJO B;  2BYF A;  2GI9 A;  1QOG A;  1E10 A;  2KWV B;  1J8C A;  1WE7 A;  5EDS A;  3ML9 A;  3ZYY X;  1JWB D;  2WU5 B;  4XYC A;  1EU3 A;  4PYU A;  1TS5 A;  2MJ3 A;  4W9G A;  2CHW A;  2FCQ A;  2KNB A;  1PYW D;  4RFB A;  4DHJ B;  4FBJ B;  5HG2 A;  2N7J A;  2RPQ A;  2AQ2 B;  3CSF A;  4RGT A;  2MCN B;  1WRI A;  3P2B A;  2BQQ A;  2HJ8 A;  3SR6 A;  4M00 A;  1WXM A;  1TJE A;  5E6N A;  5AUK A;  2MJD A;  1WGH A;  1QKZ A;  1P7F A;  2FNJ B;  2ICI A;  2BWE S;  4GU2 A;  4HCP B;  1KTK A;  2FUG 1;  3NZU A;  3ZTC A;  2KVR A;  3DVG Y;  3FKY A;  2K39 A;  2V9H A;  2EMT A;  2MSE D;  1EF1 A;  1GJZ A;  2WLB A;  4A3P A;  2KHW B;  3H9D A;  2QHO A;  2PIA A;  3ABV B;  1YN4 A;  4HK2 A;  4PK1 A;  4XDD A;  3TMP B;  1A70 A;  3VRB B;  4I6P A;  1CJE A;  3Q3N C;  1A5R A;  1XLN A;  2NCN A;  4EZJ A;  3W1S C;  1NI2 A;  3P4Q B;  3U4E G;  4OVZ A;  4A55 A;  3C19 A;  4GN1 A;  3TBL D;  5G2N A;  1IUE A;  4JQW C;  4RM9 A;  2DYO A;  2OED A;  2J52 A;  1RAX A;  4A9A A;  1YX5 B;  1WH3 A;  1FEH A;  3TJP A;  1I4G A;  2R2O A;  4CHK A;  1EO6 A;  1QIL A;  1WM2 A;  3FIL B;  4HEA 1;  2M8S A;  2RPV A;  1FPY A;  4HRS A;  2DHZ A;  4HPM B;  4WJN A;  3QCA A;  4RNA A;  4X57 B;  4HVB A;  2KWC A;  2MW5 A;  3UI3 A;  4AQ7 A;  3B1L X;  1TYG B;  1KF6 B;  4P7I A;  3NHE B;  3LDZ E;  3JYU A;  2QEJ C;  4C56 C;  1GUA B;  3H7P B;  1LQB A;  3APD A;  3L13 A;  1SGH A;  3P4P B;  4GLS C;  4TMA B;  1SEB D;  3TSS A;  3NVV A;  3AEA B;  2N4F A;  2K22 A;  1F77 A;  4YTM B;  3PHX B;  1ZGU B;  4E74 A;  4YTP B;  3K9O B;  4WAA A;  1FNV A;  2WWZ A;  3A33 B;  3V3X A;  2MWS B;  2D2Q A;  2YLM A;  3B2G A;  3H7S A;  3VH4 B;  1YJJ A;  3L0W B;  5EE1 A;  2L00 B;  5AEK B;  2MP2 B;  3U52 E;  3N32 A;  2PEA A;  3VTV A;  2BYT A;  1ZDX A;  1WFY A;  3BK1 A;  1E8X A;  4BZA A;  1MPE A;  2Q5W D;  1JQ4 A;  1V5T A;  2KDM A;  4YSY B;  2K6Q A;  3IHP C;  4M0W A;  2INC C;  4NAW B;  2K9X A;  2DWQ A;  1V6E A;  4PS7 A;  2JRI B;  2GB1 A;  1STE A;  4TQ1 A;  4F1S A;  1JW9 D;  3AEF B;  4AS1 A;  5H92 C;  3WCQ A;  2GBK A;  1C4A A;  2REX A;  1B1Z A;  4N6E B;  4K3B A;  2R2Q A;  4YT0 B;  5FKA C;  1VZ6 A;  2KD0 A;  1VR9 A;  2D07 B;  3KLS X;  4JWU C;  3V6C B;  5C3J B;  3ZKJ C;  1V80 A;  2AQ3 B;  3AUL A;  2ZEQ A;  4I6N B;  5BYS A;  2N9X A;  5CHW A;  1KFY B;  3DBR I;  4P1B C;  4FA6 A;  3ZNH B;  1LO5 D;  3C0R B;  1WX7 A;  5BO4 B;  2VH1 A;  1F52 A;  3QWZ B;  4FN2 A;  1P0R A;  1YQ4 B;  3X0W A;  2E3T A;  4WAF A;  2IYD B;  2V0G A;  3R3M A;  2KTF A;  3OAW A;  3Q2A C;  3W9C B;  3B0A A;  3AM9 A;  2CU1 A;  2KMM A;  1XT9 B;  4NQK E;  2M19 A;  3N20 C;  2L3Z A;  2N9E B;  5BYR A;  4IUM B;  4MSM B;  5IP4 D;  2HTH A;  4XX5 A;  4EUT A;  1C3T A;  2BTE A;  4DDI D;  2C7N B;  4YSX B;  3KUD B;  1TT5 B;  4WUR A;  5CHV C;  1S1Q B;  3ZIM A;  2XBB C;  3A9K A;  4IM0 A;  4KGR A;  1Z5S B;  4BFR A;  4K7W A;  5MPO A;  1JRU A;  1IGC A;  1D3Z A;  5TR5 A;  1WYG A;  5DCN A;  2KFK A;  3HUI A;  4KGT A;  3WAN A;  5LNK 1;  2AYO B;  5LLI A;  1ZDV A;  2Z8L A;  4KX6 B;  4P6V F;  4RGN A;  1SF0 A;  3KYC D;  3DBL I;  4GMV A;  4WWM A;  3ZXR A;  5FK9 C;  2FCM A;  3W1S A;  2ZCB A;  4W9C A;  4LNI A;  3DBH B;  2O6V D;  4W9H A;  2LGX A;  1WXV A;  2CJN A;  3DOW A;  4XWT A;  1E7P B;  1J0G A;  2KFJ A;  5BMI A;  1I4X A;  1T0Y A;  4FAD A;  4HDQ A;  3RNC C;  1MFW A;  2WXF A;  5JHB A;  4GDL B;  3DHI C;  2DBY A;  3AXC A;  3IG3 A;  2QC8 A;  1RM6 C;  1P3Q U;  2KDE B;  3R2I A;  4DXG A;  5CHF A;  4XE0 A;  2DX5 B;  3SHQ A;  2AQ1 B;  2WXQ A;  3CF6 E;  3RI7 C;  2Z0D B;  1YQ3 B;  5LXH A;  4B6W A;  1WRD B;  4BOZ B;  4BBN F;  3WAM A;  1M94 A;  2N9P C;  4KDI C;  3AEB B;  3N9Y C;  1ZXI A;  1ROE A;  4PT5 A;  2NTT A;  2KTR A;  1L7Y A;  1YN3 A;  2M0A A;  2WDT B;  2HTM E;  1YD8 U;  4W9F A;  3MJ5 A;  4XWW A;  1AW7 A;  3N1Y C;  3AN1 A;  4MGZ E;  3CMM B;  4ZRQ A;  2PW9 A;  5J2R A;  3Q6B A;  2UYZ B;  3KUC B;  4CQN A;  1FRR A;  3K9P B;  2DAF A;  3S2A A;  4HPP A;  3ZJT A;  2JSV X;  1WY8 A;  2B76 B;  1TTN A;  2CU3 A;  2MA9 B;  4XDC A;  2XN9 C;  1QT9 A;  2JZP A;  5GMV A;  2MBE A;  2QCZ A;  1WR1 A;  5G5G A;  2WU2 B;  2LWP A;  2Y5C A;  1C9F A;  3AE5 B;  1DYQ A;  1UWX A;  3Q14 C;  2N7D A;  2WHI A;  3VTU A;  2OJR A;  2V3P A;  3RZW C;  1EU4 A;  1XLO A;  3BK2 A;  1XLQ A;  4ZRP A;  1SE3 A;  1XLP A;  4JLC A;  3SFE B;  2C5L C;  2KDB A;  4LK0 M;  4OVV A;  3NOB A;  3R2T A;  2BB6 A;  4US9 A;  3T9L A;  3WIM A;  3QAQ A;  1X1M A;  3Q8B A;  2WNM A;  4II3 B;  1V2Y A;  4BVU C;  2WX0 A;  3LXF A;  4P1C C;  2ACZ B;  2IO0 B;  1IPG A;  2FBW B;  3ZDT A;  4MSQ B;  4R3D A;  5IA7 A;  4D2K A;  4M0W B;  3HVZ A;  3ZNI D;  1WF9 A;  3RNA C;  4KV2 A;  1CQV A;  3V61 A;  2KMA A;  3SDL C;  4WWO A;  4NJC A;  3HHM A;  3Q8E A;  2L52 A;  2DZM A;  3PVL A;  2BKR B;  4WJQ A;  2OHF A;  1FXI A;  4MAC A;  2V1Y A;  3I57 A;  3AED B;  4G50 A;  3RFZ B;  2RDB C;  3NZS A;  4EE2 A;  2I1K A;  2PJH A;  2ZJD A;  2LI5 A;  1FM0 D;  2RSU A;  1FXA A;  1N62 A;  2VRR B;  1TBE A;  3VXW A;  2MBB B;  1FFV A;  2BYE A;  1UNS A;  4NAW A;  2BYV E;  4W9D A;  2AL3 A;  3UIP B;  3AEC B;  4HKQ A;  2DZJ A;  2N1V A;  3QHT A;  3Q69 A;  3RD2 A;  3EA6 A;  3OJ4 B;  4NZL B;  1WXS A;  1KLV A;  4NJ7 A;  2WXI A;  1V81 A;  3A9K B;  1IP9 A;  4IDI A;  2JYE A;  1QF6 A;  2KLC A;  2WDR B;  3AE7 B;  1L2N A;  3RNF C;  2KFK B;  3W2D A;  1YN5 A;  4MH8 A;  3TIX A;  5D3I B;  2W54 A;  2ZZP B;  2LZ6 A;  1OGW A;  4DXF A;  2KN4 A;  1XCT L;  1N5W A;  1V5O A;  2EMS A;  1NBF C;  1IGD A;  2LAS A;  2VH2 A;  3VUW A;  2JZZ A;  2ZPY A;  1QOB A;  2ASQ A;  2WDQ B;  3QAR A;  1PQS A;  3PO0 A;  3APF A;  4FXC A;  4N59 A;  5AUI A;  1E7U A;  4CO7 A;  4LLG M;  4ACF A;  3C8Y A;  1ET6 A;  2WS3 B;  2LRU A;  1GPX A;  4EKU A;  4ASW C;  4LTU A;  3HM3 A;  3IBE A;  3GS2 A;  4FHK A;  5CX3 A;  3VR9 B;  1FCC C;  2N0S B;  1NI3 A;  1WGK A;  1EWY C;  1NEN B;  1KLG D;  2GBJ A;  4MGY E;  1WX8 A;  4MM3 A;  5EE0 A;  2DAJ A;  4RF0 A;  1NYQ A;  2V3N A;  2DZI A;  4K3C A;  2AEH A;  5IOI A;  3T3N A;  3AE8 B;  3NG0 A;  3U30 A;  1T3Q A;  1T0S C;  3PZ7 A;  5D94 A;  2DYM A;  2WXJ A;  2L7R A;  4ICV A;  2KTR B;  4YWG G;  5L83 A;  3IT4 B;  2NMQ A;  1WZ3 A;  3DVN V;  4M01 A;  4EFO A;  1RFA A;  4GDL A;  2VZK D;  1PGB A;  1AAR A;  4H2A A;  1SIJ A;  2IGG A;  2KVZ A;  4GDK A;  3PLU A;  1VZ8 A;  2WQY B;  5G55 A;  1HTO A;  4LNK A;  2CHZ A;  2X38 A;  3AU4 A;  3EHV A;  1JCK B;  2G45 B;  1J7A A;  3L4P A;  1XQQ A;  4MDK E;  3SFD B;  2H88 B;  3B9J A;  4B0M A;  3AE1 B;  2KKC A;  3JSV A;  3PT2 B;  5JHA A;  3KWV A;  2W9N A;  2JPH A;  2J0M A;  4JIO U;  2L05 A;  4A90 A;  2BB5 A;  2YEP F;  4IOI E;  3VUX A;  2Z0E B;  1UGM A;  3NVW A;  2C9W B;  2ON8 A;  3DPD A;  3VTW A;  2L1A A;  2KN5 A;  2CJO A;  2PKO A;  4EEW A;  3VHT C;  1XCQ L;  3J9C A;  4AP4 C;  4XGA B;  3UQA A;  2M0X A;  2HD5 B;  5D2M B;  2QIE B;  4FHJ A;  2KLG A;  4IG7 B;  3A1Q A;  4MJS A;  4GIV A;  2DLB A;  3PZD A;  1BUI C;  1T5X D;  1ISN A;  1UGJ A;  1SIF A;  4J3O D;  2KQ7 A;  3PRM B;  4YTN B;  3OWE B;  4JWS C;  1KLU D;  2O6V A;  2WDV B;  2FAZ A;  3W1Y A;  1ZE3 D;  1V9J A;  3VAW A;  3Q3J A;  2KJH B;  2I1J A;  2CS4 A;  4L2Y A;  2V3S A;  1JAL A;  1TKG A;  2VZK B;  5JZE B;  3WAL A;  3QQ8 B;  2AL6 A;  1K8R B;  3EGR A;  2EKE C;  2DYB A;  3TUO A;  1TS2 A;  1ZUD 2;  2IO3 B;  2WP9 B;  4UDU C;  4JX1 C;  2LGY A;  4WH4 A;  4RMA A;  1WXQ A;  3MC9 A;  2FE8 A;  1UF0 A;  1D4B A;  1WGD A;  1WGR A;  1DOX A;  1D5M C;  1Z2M A;  4DHZ B;  1E6E B;  2GBN A;  2LUE A;  2PVO D;  1M4V A;  3RMK C;  3AE6 B;  2DNF A;  1TKY A;  2Y5P A;  5C23 A;  3BII D;  4C80 A;  1QQR A;  1Q0W B;  3BYY B;  3Q8A A;  4IC7 B;  4IWP A;  4MEM A;  3LYY A;  2H89 B;  1KJT A;  1UWM A;  2RDH A;  1R4M B;  4HPL B;  2HE7 A;  3ZDM C;  1MVK A;  3I3T B;  2L76 A;  2WYQ A;  1VRA B;  4TUU A;  1MHH E;  4KKI A;  5BMH A;  3VR8 B;  1CMX B;  1ZP0 B;  4J6I A;  1SJE D;  2K0P A;  1RLF A;  4BKG A;  4W9J A;  2IZV B;  2WXR A;  2IY0 B;  2PE6 B;  2L32 A;  5EE3 A;  3JVZ X;  3UF8 A;  4BAX A;  3ML8 A;  2G9H D;  5FR3 A;  3KWL A;  2BBC A;  4S17 A;  2ZVO A;  1OQQ A;  2WXN A;  5JH5 C;  2JZ3 B;  2I38 A;  3IAM 1;  1VZ7 A;  4A8X C;  2W55 A;  5BMG A;  2FCS A;  4NJ6 A;  1P98 A;  2G4D B;  1R7S A;  2V4L A;  3RNE C;  3Q3F A;  1J7B A;  1SSN A;  2HDE A;  2MH7 A;  2O2V A;  3PLV A;  4P16 A;  1Y56 A;  3U7Z A;  3QX1 A;  4E71 A;  2KDI A;  1L6V A;  4GSW A;  1KOT A;  4MM3 B;  1ACC A;  3AB5 A;  2L83 A;  1F2R I;  4HLE A;  2RGF A;  1WJ6 A;  3BZD B;  3ZRF A;  4N58 A;  4US8 A;  4DK5 A;  5DPT A;  5KHQ A;  2D3B A;  4K7S A;  1VJK A;  3BY4 B;  1L0X B;  2JY6 A;  2XNA C;  2KZR A;  3A9J A;  2LGI A;  1L4D B;  3DVN U;  4C7Z A;  4NAM A;  1F1H A;  1FNW A;  2MHJ A;  1SE4 A;  4MH0 E;  1IYF A;  3HRD D;  1FO4 A;  4GXB A;  5HKH A;  2KWD A;  2AX5 A;  5H8Y E;  4GDK B;  2KAC A;  3DBS A;  1MJD A;  4BKT A;  2RDG A;  1E90 A;  2QDF A;  2EKI A;  5E6O A;  2TSS A;  3IXS A;  3CST A;  5LXI B;  4M8N A;  1ZW7 A;  4JGH B;  3IFW B;  2RMM A;  2ZW0 A;  4I6L B;  1V1O A;  5T8I A;  3MP9 A;  3Q3M C;  4K81 A;  1SJH D;  3APC A;  4IWQ A;  2GOW A;  2K8C A;  4AJW A;  3DWM A;  3JSV B;  4K1R B;  2BS2 B;  2NTS A;  3VFK A;  4M8M A;  4TV3 A;  2LHE A;  3WA0 A;  1L6U A;  2J0K A;  2IO1 B;  2KQ4 X;  2V4I B;  4RH6 A;  1R4N B;  1WI0 A;  3CWI A;  3IT6 B;  1I4Q A;  1C4P A;  3VDZ A;  4AWJ A;  3TCA A;  4W9K A;  2NS5 A;  3PV1 A;  4ZHP A;  1JRP A;  3A1Q B;  4HKZ E;  4MJS B;  3MJW A;  5D7G A;  4HJG E;  3P1M A;  1GC6 A;  2RR9 A;  1XEE A;  1Y8R C;  2O6V B;  2BGF A;  1ESF A;  3FC4 A;  3MC8 A;  4S0R A;  3V60 A;  2N7E A;  1JWS D;  2XK5 A;  1L0V B;  2PMV A;  1YMH E;  1OEY J;  1I42 A;  4ANX A;  4ZRJ A;  1N6Z A;  4WJP A;  3DCG A;  1IBX A;  2PLP A;  2I2Y A;  1ZKH A;  1E8Z A;  3PS6 A;  5DPR A;  3ZO5 B;  1PFD A;  1PGX A;  1D6E C;  2ZCC A;  1UD7 A;  4LNF A;  4KGS A;  1RRB A;  3URY A;  2GBM A;  2WGS A;  3MC0 B;  4W9E A;  2WXP A;  3L17 A;  5IN7 A;  3W5U B;  2PVG C;  1V49 A;  3HIZ A;  3NY5 A;  4MGK E;  3ZJV A;  4OZA A;  1V97 A;  1BXT A;  4ZYN A;  3GB1 A;  3OJ3 A;  1T0R C;  1QOF A;  4CYE A;  1WM3 A;  3GP7 A;  3P4R B;  3U8Z A;  3ETR A;  1EF5 A;  2L8J A;  4L23 A;  4HDO A;  4BKS A;  4LNO A;  2IGH A;  1VD2 A;  3ZLZ A;  1WJN A;  1SXT A;  1HXY D;  5I4D A;  4AJY B;  2KDF B;  1L4Z B;  1U4A A;  2KC2 A;  4FJY A;  2NR2 A;  4ZYS A;  1C77 A;  3ZQ4 A;  2BWF A;  2KWU B;  2D3G A;  4USA A;  1L0Y B;  1TS3 A;  2IPK D;  1K50 A;  2WX1 A;  4OHJ A;  2C7H A;  4B0E A;  2JWU A;  1N5X A;  2EEL A;  3BVZ A;  1JML A;  3MHZ A;  1C78 A;  4C4V A;  2BVC A;  1DGJ A;  2W3S A;  4LNN A;  3X23 A;  4OVU A;  2A5U A;  1TY2 A;  1XXG A;  3U7D A;  1CZP A;  2CHX A;  3H1U A;  3PHW B;  3OG5 A;  4BBN C;  5BYQ A;  2G1E A;  3KUZ A;  4A20 A;  2JYT A;  3R7Q A;  2LVQ A;  2K8H A;  2O2V B;  2PPH A;  1H8C A;  1TKE A;  1SE2 A;  1WJ4 A;  1OQY A;  4WQM A;  3AV8 A;  3KW5 B;  4ZOH C;  3MHS D;  2D3C A;  2LRW A;  3ZJU A;  2LFI A;  3Q8C A;  1PDX A;  3HM6 X;  2FCN A;  5FR6 A;  1ZPS A;  2LXA A;  1Q10 A;  2N1W A;  4TSS A;  2K25 A;  3GZN B;  4JL9 A;  4W9I A;  2MRP A;  4G3X B;  4F7Z A;  3A9J B;  1E5W A;  3JW0 X;  5IO9 A;  3AE3 B;  4KKJ A;  2K1F A;  1AYF A;  1FRD A;  1NVI D;  3DHG C;  1V8C A;  2J0J A;  2KJR A;  1GB1 A;  3Q3O C;  3ECI A;  2LEK A;  3R7R A;  1FCL A;  3NS8 A;  1JRO A;  3H8H A;  4ARC A;  3ONS A;  2KC1 A;  4WWN A;  3L10 B;  2AWT A;  3N30 A;  4E3C A;  1QZE A;  1WMH A;  2E6X A;  3QC8 B;  3A4R A;  1BML C;  3NRZ A;  3ZVV A;  2M1M A;  4IM3 A;  2L0F A;  3HK0 A;  3I9V 1;  3NUH B;  4DXA B;  2LJ5 A;  4W9L A;  4YL8 A;  2MX2 A;  2ZW1 A;  2IDY A;  3ZTD A;  1YX6 B;  3R66 C;  4WWP A;  1UH6 A;  2LVP A;  3DDC B;  1WZ0 A;  4FUL A;  3I5J C;  3NVY A;  3VH3 B;  2KX3 A;  4BKS D;  2KK8 A;  4WJO A;  3RNB C;  1ENF A;  1HZ6 A;  3PZ8 A;  4JPS A;  2GLS A;  4XZ4 A;  3UIO B;  1T6B X;  3LB8 C;  4ANU A;  2FUH B;  3BVG A;  1WYW B;  5AZF A;  2LGD A;  1C79 A;  2Y3A A;  2PE9 A;  3E9S A;  4M02 A;  1K52 A;  2FID A;  1GC7 A;  3GE3 C;  2XK5 B;  1E8W A;  1G6J A;  3NZ3 A;  1ZXH A;  4OZC A;  3SU8 X;  1ET9 A;  5HI1 A;  1V1P A;  3VQI A;  1T0Q C;  3PPA A;  2OOB B;  5IAA C;  1IBX B;  3QK0 A;  4GOC A;  5DPS A;  3L08 A;  5C2T B;  1QOA A;  2R61 A;  4JE3 B;  2INP E;  4DWF A;  4HJK A;  2LJI A;  2M56 B;  3T8M A;  4HXD A;  4II2 B;  1MI0 A;  4URK A;  2ZNV C;  1UZX B;  1K51 A;  1WX9 A;  3QA8 A;  4Q2J A;  1NEK B;  3FAH A;  2JRH A;  4ITK A;  3Q8F A;  2IY1 B;  3PRP B;  5AZH A;  2RD0 A;  1YQB A;  2A4Z A;  3DWG C;  4B9K A;  3VRA B;  4HWI B;  2JF5 A;  2J7Q B;  1FFU A;  1FXT B;  3PGE A;  4HRO A;  1JWM D;  3B2F A;  4FJZ A;  4RCO A;  1HE8 A;  3TEW A;  4OW0 A;  3IVF A;  4WQO B;  4EZK A;  4TKN A;  3WAO A;  2BF8 B;  1FD6 A;  1K53 A;  1OFF A;  2KT7 A;  5D3D A;  4QAY A;  1XD3 B;  1R4M I;  3DQV A;  3TL5 A;  3BIN A;  4DDG D;  2L0T A;  2HJ1 A;  1S3S G;  4WIP A;  1I4H A;  2YEP B;  1UBQ A;  2DEN B;  4ANW A;  1Q1O A;  3LJ3 A;  4C7Y A;  3N1X C;  3P4S B;  2K8B A;  4FJV B;  1FIQ A;  4DQO C;  1HZ5 A;  3NVZ A;  1QLB B;  3QJZ A;  2LUM A;  3PTF C;  4C4V B;  5J17 A;  2NPT A;  1MG8 A;  1TZ1 A;  1ZOY B;  2JXT A;  1HTQ A;  3V6E B;  3AEG B;  1KH0 A;  3KYD D;  1LXD A;  2LMC A;  3RZF A;  2SAK A;  2WXH A;  4EZL A;  3SD5 A;  1F0Z A;  2LVO A;  2JWZ A;  1RWS A;  2IO2 B;  2NBU A;  2D10 A;  3EEC A;  2M4N A;  3T3O A;  3UGB B;  4BOS C;  1P7E A;  2KQS A;  1WGG A;  2MBQ A;  1BT0 A;  2UU7 A;  1E8Y A;  4RGO S;  3WAP A;  1GB4 A;  2JUO A;  4L1B A;  1LM8 B;  2GBR A;  2LXC A;  1VLB A;  3D32 A;  1AWD A;  2QMT A;  3ENE A;  3UIN B;  3CIR B;  5AZG A;  2YVC A;  2IBI B;  3EFC A;  1KRH A;  4ZDV A;  4IKG A;  2D5G A;  5EE9 A;  2FIF A;  5CTR C;  3MTN B;  1YNT E;  2N9K A;  3BWU D;  1AN8 A;  2NBW B;  4RGM A;  1VCB A;  3DBH I;  3TEY A;  2PTL A;  3M3J A;  3DBR B;  4XC2 A;  2XEW A;  1HEZ E;  1GNU A;  2KJ6 A;  3ZNZ B;  4FLH A;  3UQB A;  1H4R A;  4KZ0 A;  2ZPN A;  1OQR A;  3DHH C;  1WMH B;  1N61 A;  3KVF B;  2JXX A;  4AUQ C;  3BYT B;  3BVM A;  1WSP A;  1F9J A;  2JT4 B;  3GOE A;  1YIW A;  2JVC A;  1P9D U;  2J42 A;  3RPF C;  2MBO A;  3AI5 A;  3RN9 C;  1EWC A;  1LFD A;  1KM7 A;  1WGY A;  4ARI A;  1DOI A;  1L5P A;  4KIK A;  1DOY A;  1GAQ B;  2N9L A;  4DHZ E;  1VDV A;  3P63 A;  4K7U A;  4O1N A;  4EOY A;  2WXL A;  1OTR B;  1EM7 A;  1R4N I;  3DBL B;  5E6J A;  2WXG A;  2BT6 A;  3A4S C;  4PYZ A;  2Y5B B;  4KZC A;  2C7M B;  3KQ4 A;  1E0Z A;  1UUP A;  3AH7 A;  2JX5 A;  3ZXV A;  2OJW A;  1N60 A;  4MEL A;  3PRE A;  5IKC M;  2LGS A;  4YSZ B;  1FMA D;  1V1P B;  1XO3 A;  4ICU A;  4NNJ B;  1D5Z C;  1D5X C;  1B9R A;  4ZRK A;  3N1Z C;  4A6Q A;  2C60 A;  2K3U A;  2G3Q B;  1P1A A;  5G5H A;  4ZRI A;  2GMI C;  1J7C A;  3M62 B;  3ALB A;  1EUV B;  1RYJ A;  3QIJ A;  1WE6 A;  3NS1 A;  1C76 A;  3HVD A;  1YOV B;  2MQJ A;  2X8X X;  2UWQ A;  3DVG X;  1HQR D;  2M17 A;  5GXG B;  3NJT A;  1NDD A;  4MT5 A;  3O65 B;  3EC8 A;  4N9F 4;  1WWT A;  4NPN A;  1FNU A;  5C1Z A;  3TEX A;  1I4P A;  2IND C;  1TY0 A;  1MHX A;  4PS3 A;  1N63 A;  3M63 B;  3OLM D;  3V05 A;  3N3K B;  3W5V B;  1C1Y B;  2W3R A;  1SE9 A;  1SBB B;  2J4X A;  1YJI A;  3AEE B;  4IWO A;  2INN E;  1LGR A;  1V86 A;  3M95 A;  3MFG A;  3V62 A;  2WXK A;  3RCZ A;  1F2R C;  3VUY A;  3ZNG C;  4C00 A;  4GGQ A;  4ZHO A;  5L95 C;  3E56 A;  3ZRC A;  2B3A A;  1CK1 A;  3H6N A;  2LD9 A;  1GOZ A;  4DBG A;  4AOF A;  3FIL A;  1J19 A;  3TEZ A;  1SB3 C;  4LDT D;  1WIA A;  4KSK C;  1YJ1 A;  4LJP B;  2QJL A;  3AE2 B;  2QSD A;  2NPT B;  4NQL B;  5D6J B;  1WR6 E;  3H7P A;  1E9M A;  4OZB A;  5HHD G;  1GG3 A;  4F8C B;  2K5P A;  2JQR B;  1PUT A;  2NBV B;  1I7H A;  2JU6 X;  2QIL A;  4IW0 A;  2MLB A;  5J18 A;  2D11 A;  4MGI E;  2IJ0 A;  2WXM A;  1PGA A;  1TS4 A;  2GRI A;  3ZUN A;  2LHD A;  3EUB 2;  3VVW B;  1HA5 A;  2ONQ A;  1TZO A;  5E6P A;  2KOX A;  1Q5W B;  2KAN A;  2MEK A;  1UEL A;  3IAS 1;  2BS3 B;  2MP2 A;  2WXO A;  4IM2 A;  5KHO A;  3RUL A;  2D3A A;  1JWU D;  2KX0 A;  3RT3 B;  4B95 A;  5JXV A;  2IGD A;  3O13 A;  1TGZ B;  4TQ0 A;  3SEB A;  2ZVN A;  3AE9 B;  3GE8 C;  2J53 A;  4ANV A;  3L54 A;  4HCN B;  4DHJ D;  4RM8 A;  1TIF A;  1C4C A;  3P42 A;  2Z59 B;  2G4S A;  3RNG C;  1WXA A;  2CKH B;  3RUI B;  3GZN I;  3B08 A;  3RYT A;  2KXJ A;  5TSS A;  2KAJ A;  4RF1 A;  4KVG B;  4G0N B;  4KDL B;  3U2S C;  1MG4 A;  2BKF A;  1UBI A;  2NVU I;  4REZ A;  1I4R A;  4YXD B;  4GB9 A;  4LDT B;  1JWA D;  2DZK A;  2W82 A;  1RFK A;  3R8B A;  2BS4 B;  2K6D B;  3ZW3 A;  2SEB D;  1XF5 L;  4G11 A;  3I63 C;  1OEY A;  1E7V A;  5DPW A;  3ZGZ A;  2MJE A;  3EFU A;  3AE4 B;  3AU5 A;  4PS8 A;  4NY0 A;  3PRZ A;  2ZNV B;  4KSL C;  4KIK B;  2KYW A;  4A3O A;  1NYR A; 
#chains in the Genus database with same CATH homology
 3Q2A C;  3RNA C;  2RDB C;  3N1X C;  3Q14 C;  3DHH C;  2INC C;  2IND C;  3I63 C;  3N20 C;  3Q3N C;  3GE8 C;  3I5J C;  1T0S C;  4P1C C;  3DHG C;  4P1B C;  3RI7 C;  3GE3 C;  3N1Y C;  3RNB C;  3RNE C;  3Q3O C;  3N1Z C;  3RNC C;  1T0R C;  3RNG C;  3RN9 C;  3RMK C;  3Q3M C;  3RNF C;  1T0Q C;  3DHI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...