3D32A

Complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Ligand Binding Mode of GABA(A) Receptor-Associated Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3d32A00
1L2NA 2MLBA 3JW0X 3PRPB 1WE6A 1WX8A 1MG8A 1LXDA 4MDKE 4P7IA 1RFAA 1WXSA 1S1QB 1GUAB 1G6JA 4A3PA 3NZSA 3IHPC 3RD2A 2KDBA 2N7EA 3H7PB 2FIFA 4DXAB 3DBLI 4II2B 1WJNA 5KHQA 3PSEB 5L83A 4FA6A 3OLMD 4AP4C 2FCQA 2M17A 4FJYA 3VH3B 4ASWC 1E7VA 4DDGD 2IY0B 3ZTCA 2J0KA 4RM9A 3WAMA 2BYVE 4EZLA 3M62B 4IM2A 1E8XA 4NJ6A 3AXCA 3GOEA 4IW0A 4GIVA 4M0WB 2R2OA 4GDKA 4GXBA 4FN2A 2JT4B 2KVRA 3I3TB 4URKA 5E6PA 1UELA 5IA7A 2L0FA 5JZEB 3H9DA 3W1SA 2KXJA 2ZCCA 4I6NB 1YD8U 3A9KA 4OVUA 4A20A 3M63B 1WIAA 4K81A 2G4DB 3WAOA 1QZEA 2JWZA 2N4FA 1WJ6A 3RUIB 2BYEA 3MHSD 1TZ1A 5G2NA 5D7GA 4GSWA 3ZIMA 2KHWB 3ZDMC 4WJOA 5DPWA 3L17A 2D3GA 1EF5A 2ZPNA 2KFKB 4JL9A 1WI0A 4M8NA 3A9JA 3PLVA 5D6JB 3W1SC 4W9GA 3TBLD 2KJ6A 2RR9A 4ZRJA 3DBHI 2IY1B 4MH0E 3MTNB 3PPAA 4LCDE 4BKGA 4DHZB 4FULA 4EZJA 2FUHB 1C1YB 3HIZA 2DAFA 2IO1B 4W9EA 3WALA 2IZVB 4M8MA 3VVWB 1V5OA 1WGDA 2K25A 3K9OB 1WGYA 3EHVA 4LJOB 4WJNA 2DAJA 4W9CA 1K8RB 3L10B 4AWJA 2MA9B 2MX2A 4XX5A 3OJ3A 2FCSA 2WX1A 1P1AA 3QQ8B 2CHXA 2CHZA 3JVZX 3R7RA 3DVNU 1NBFC 2C7HA 3PVLA 3RULA 4FLHA 3QJZA 3PS6A 1WH3A 2L76A 4W9JA 1E8YA 2LASA 2ZCBA 3PGEA 4CYEA 2I1JA 2W9NA 2Y5BB 3ZW3A 4TV3A 2LZ6A 1NI2A 2N9XA 2M0XA 1WM2A 3A1QB 2J7QB 2BWFA 2KJRA 4PS7A 3DPDA 2ZEQA 1GG3A 5J17A 4AOFA 4DHJD 2EMTA 1RLFA 4KDLB 2KDFB 2HJ8A 2NPTB 2CU1A 5D2MB 2MBBB 2WX0A 3ZO5B 1KLVA 1WM3A 1J19A 2K39A 2KDEB 4WQOB 2K8CA 3MJWA 1XQQA 2G45B 2EKEC 2JRHA 1V6EA 3VTWA 4RMAA 4W9DA 3W1YA 2EMSA 2XK5A 4HK2A 4XZ4A 3KH0A 1NDDA 2ZPYA 1R4MI 1WXAA 4A3OA 2JVCA 2HTHA 2LXAA 1E8WA 3IBEA 4WWOA 3VTUA 3N32A 4W9IA 1EF1A 2GMIC 4BOSC 3UIOB 2KO3A 4IWQA 1WJUA 2WYQA 5AZHA 3V60A 3CSTA 2KX0A 3BY4B 4E71A 1LM8B 2LRWA 2N7DA 3ZNID 2LXCA 1TGZB 2KWUB 2LJ5A 2I1KA 4B95A 1V86A 4WJPA 5E6NA 2IO0B 2DZMA 2KFKA 1P98A 3D32A 2L0TA 4G0NB 3VUXA 4J6IA 5J18A 2NCNA 1KM7A 3QAQA 1WE7A 2CHWA 5IAAC 3ZNGC 4EUTA 4NJ7A 4I6LB 4CHKA 5DPRA 1YIWA 4G50A 4ICVA 3VH4B 4DHZE 2UWQA 4KIKB 2K8BA 3UQAA 3L0WB 4PYZA 2N9EB 5JH5C 1IPGA 5E6OA 4G3XB 5DCNA 1S3SG 5C1ZA 1P0RA 3AULA 2CKHB 3C0RB 1WZ0A 3DVGY 2Z59B 4GU2A 2CR5A 3U7DA 3V62A 3IG3A 2LVQA 3NS8A 3RZWC 3WANA 2JPHA 3BINA 3H1UA 5CHFA 2DENB 1WZ3A 1GJZA 2GBJA 2XK5B 2LVPA 4ZRKA 3TCAA 4NNJB 4HPLB 3ZNZB 2OJRA 3KVFB 3TIXA 3VXWA 4GDLA 2BF8B 3RT3B 4PS3A 3KUDB 3HK0A 3M95A 3KW5B 3QARA 2MRPA 3QC8B 4PS8A 3S2AA 3ZKJC 4ZDVA 1KOTA 2DX5B 3A1QA 4FBJB 3L54A 1WGRA 3ZLZA 2WDTB 2ASQA 4ZYNA 4KVGB 1ZW7A 1GC6A 5JHAA 4HCPB 2CS4A 3SDLC 1E5WA 2HD5B 2NPTA 3HHMA 2FNJB 5G55A 2NR2A 2O6VB 1V2YA 2ZVNA 4BKTA 2XBBC 4KZCA 3ALBA 1V5TA 4HWIB 2VRRB 2M8SA 3P2BA 1F9JA 2REXA 4KSKC 3VFKA 1TTNA 3A4RA 3ONSA 2AL6A 2JUOA 4AUQC 5LXIB 2A4ZA 4LJPB 4WWNA 2YVCA 2MW5A 3V6CB 4JQWC 2KMAA 4ZRIA 2JF5A 3R3MA 4LDTD 1ZKHA 3Q3JA 2KZRA 1OTRB 3LDZE 4HDQA 4EZKA 5HKHA 4B6WA 2ZJDA 4W9LA 4IG7B 1E90A 3VAWA 4BKSA 4YL8A 3JYUA 3NHEB 1VD2A 2AYOB 3X23A 2FCNA 4DK5A 2LGYA 1LQBA 1Z5SB 3VDZA 2IO3B 2ZZPB 2PEAA 3UIPB 3N3KB 2JY6A 2YLMA 4K7WA 4NAWB 2C7NB 1KJTA 2Z0DB 4XC2A 1IYFA 2KLCA 2BKRB 4RM8A 4GDLB 4DWFA 3SHQA 5LXHA 3PREA 4MSQB 2L05A 1HE8A 3KYCD 2RSUA 2JZ3B 4ANUA 2FCMA 4KV2A 3VQIA 1YX6B 3TL5A 2HE7A 5TR5A 3DBRI 3K9PB 2K6DB 3L13A 1LFDA 3KUCB 1OGWA 4IM3A 4FJVB 3VUYA 4X57B 3AU4A 2M4NA 2D07B 4KIKA 2DYBA 4TKNA 1Q0WB 2GBKA 2GOWA 2ZVOA 4HLEA 1RAXA 2MQJA 3PV1A 4FHJA 4NQLB 4N9F4 2KTRB 3RZFA 2NVUI 2LD9A 3AI5A 1VCBA 1WR6E 1V9JA 3U8ZA 4JIOU 2DZKA 3DDCB 1WR1A 3GZNI 4ANVA 3APFA 4NY0A 1R4NI 1E8ZA 3JSVB 2KLGA 4CO7A 3PHWB 3UGBB 3B1LX 3TJPA 2KN5A 4MGKE 2L8JA 2BYFA 4BOZB 5C23A 3X0WA 4TQ0A 1WY8A 1YX5B 2LGDA 5CTRC 4BFRA 1YJ1A 3SU8X 2BPSA 2MWSB 2O2VB 2PPHA 1WGHA 4MM3A 2K8HA 1A5RA 4WWPA 1UD7A 3B0AA 4AJWA 2O6VA 2DYOA 3DCGA 1X1MA 3NOBA 1TBEA 3PRZA 3DVNV 5BO4B 3ZDTA 2JZZA 4F1SA 4WJQA 2M1MA 3PRMB 2A5UA 3OJ4B 4F7ZA 2MBQA 2KD0A 3ML9A 3V6EB 1Z2MA 2V3SA 3QA8A 4MJSA 5DPSA 3IFWB 2MBOA 4TQ1A 3VTVA 3DVGX 4GGQA 1JRUA 3R66C 1ISNA 2KOXA 2C9WB 4HJKA 3WAPA 3R7QA 4W9FA 3APDA 2KFJA 3QIJA 4II3B 1UH6A 4NPNA 4KSLC 1OEYJ 4MEMA 4GOCA 2D11A 2KQ7A 3DOWA 2IO2B 4K7SA 5L95C 3DBSA 4EEWA 4E74A 4EKUA 3EECA 2MBHA 3ZTDA 1GNUA 4IC7B 1P9DU 3NZUA 2LUEA 3ML8A 4OVVA 3UF8A 3WIMA 2AEHA 3A4SC 2FIDA 3H6NA 4K1RB 4WAAA 4NAWA 2G4SA 4ICUA 3KYDD 1XD3B 2ZNVB 4MGZE 4F8CB 3ECIA 3V61A 4KDIC 4EOYA 1E7UA 4AJYB 1C3TA 1OEYA 4MGIE 4MGYE 2DHZA 2GBNA 4PYUA 5AZGA 2JXXA 4HDOA 3VUWA 2GBMA 4ANXA 1J0GA 1M94A 1WYWB 3H7SA 1RRBA 5GMVA 1H4RA 4W9KA 3QCAA 2KKCA 2KWVB 4MJSB 2KTRA 4FADA 3QX1A 3M3JA 4IUMB 3CSFA 4DBGA 1I35A 2UYZB 3ZVVA 3CMMB 2KANA 3JSVA 2NBVB 3PTFC 4W9HA 5AZFA 1UBIA 5CHWA 4MELA 3UQBA 2J0MA 3L16A 2LI5A 4EFOA 4TUUA 4BBNC 1WX7A 2MP2A 2PE9A 3UINB 4E3CA 2O2VA 1CMXB 1H8CA 2PE6B 2RPQA 1WXVA 5AEKB 1WFYA 2L00B 1WJ4A 2OOBB 3NY5A 4KZ0A 1BT0A 4ANWA 4HCNB 2LGXA 3O65B 1UZXB 4GN1A 1GC7A 3EFUA 2N1VA 2XEWA 1PQSA 2L3ZA 3OAWA 4HPMB 3TMPB 4BVUC 4MSMB 3ENEA 1YQBA 1V80A 3APCA 3HM3A 2K1FA 3DQVA 2KJHB 2J0JA 2KC1A 2KK8A 1Q1OA 2BWES 3AU5A 3ZNHB 2RD0A 2GBRA 2C7MB 2PJHA 2FAZA 4FHKA 4BKSD 1U4AA 4BBNF 2D2QA 2DYMA 5CX3A 1P3QU 4DDID 1WRDB 3EC8A 2MBEA 5D94A 1ZGUB 2WWZA 2NBUA 2IYDB 4GDKB 1WMHA 2DZIA 3ZRCA 2LRUA 5KHOA 2KMCA 5LLIA 2BGFA 3IVFA 3A9KB 3PT2B 3U30A 4HXDA 3SD5A 3ZRFA 2G3QB 2C5LC 4LDTB 3RCZA 4HVBA 1EO6A 2KWCA 3PLUA 1WXMA 2R2QA 2KX3A 1EUVB 1SE9A 1FXTB 1XT9B 2KNBA 2KTFA 3T9LA 2JRIB 1T0YA 2Z0EB 3T8MA 3H7PA 1UGMA 1UBQA 3RYTA 2B3AA 2MP2B 2V1YA 3CF6E 3PHXB 2D10A 2N9PC 3A9JB 1D3ZA 4JLCA 2AWTA 2MSED 2DZJA 3KUZA 4I6PA 3Q3FA 5J2RA 4IWOA 2V4LA 3QWZB 1V81A 4IWPA 3LJ3A 2K6QA 4FJZA 1V49A 3B08A 5DPTA 2NBWB 2LVOA 3ZUNA 4DHJB 2ZNVC 3QHTA 4JGHB 5FR6A 2KQSA 1OQYA 4GB9A 1I42A 3PZDA 5JHBA 3WA0A 4G11A 1WGGA 2L7RA 3N30A 2C60A 1J8CA 1WF9A 3A33B 2IBIB 3QK0A 1SGHA 1WX9A 1SIFA 2NS5A 4NQKE 2LWPA 2KC2A 1Y8RC 2N1WA 1AARA 2RGFA 4IM0A 4K7UA 2BKFA 3VHTC 1L7YA 2MCNB 3L08A 1IP9A 3HM6X 2O6VD 4GMVA 1WMHB 1Q5WB 2AL3A 2QHOA 5CHVC 4B9KA 5EDSA 2KDIA
chains in the Genus database with same CATH superfamily
1L2NA 5G5HA 1LXDA 4P7IA 1JMLA 1RFAA 1S1QB 1WXSA 3FAHA 3U52E 2N7EA 1GB1A 3DBLI 2Y5PA 4A8XC 1TKYA 1UWXA 2SAKA 2SEBD 4DDGD 4IM2A 4JWUC 3GOEA 4GIVA 2NTTA 4GDKA 4URKA 1UELA 2L0FA 3H9DA 3W1SA 1ZP0B 3A9KA 4OVUA 4A20A 3OWEB 1B1ZA 3LXFA 3DHHC 1QZEA 1WJ6A 3RUIB 1GB4A 2J52A 4YSXB 3MHSD 1TZ1A 5G2NA 2KHWB 4FXCA 3W1SC 2PW9A 2KACA 3MFGA 1I4XA 3MTNB 1SIJA 3HIZA 2W3RA 4JWSC 3WALA 4M8MA 2K25A 1JROA 3AB5A 4XX5A 2MJ3A 3OJ3A 2WX1A 3GP7A 3P4PB 3QQ8B 3IAS1 4DXGA 3R7RA 4WURA 4FLHA 3PS6A 5C3JB 2ZCBA 2WXMA 1F52A 4TV3A 1P7EA 1E7PB 2LHDA 2ZEQA 1TKGA 2KDFB 5BYRA 2NPTB 4N6EB 2WX0A 5D3IB 2WXQA 1YMHE 1J19A 2K39A 3MJWA 2JRHA 2FE8A 5MPOA 3W1YA 1V1PB 2XK5A 1E10A 2ZPYA 4IKGA 4LNIA 3IBEA 4WWOA 3N32A 3V60A 1ENFA 2KX0A 4A6QA 1FXIA 4YSYB 1I4QA 2KYWA 1I7HA 1EU3A 1V86A 2INNE 2IO0B 3D32A 2R61A 3KQ4A 4G0NB 3VUXA 4J6IA 1SXTA 3QAQA 1CZPA 1GOZA 4HKQA 2H89B 1TY2A 4CHKA 4ICVA 5FKAC 2QCZA 3L0WB 5JH5C 2ON8A 3H8HA 4G3XB 5DCNA 1S3SG 1MHHE 4L1BA 3C0RB 3TEWA 2CR5A 3MC9A 3U7DA 3RZWC 3ETRA 1SE3A 2JPHA 3BINA 4YTNB 1A70A 3VR8B 3ZKJC 1HXYD 3QARA 2MRPA 3QC8B 1C78A 2D5GA 2DX5B 3W9CB 2WXLA 3ZLZA 1WRIA 2ASQA 1ZW7A 1GC6A 3SDLC 1C4AA 1V2YA 4C7ZA 3ALBA 4HWIB 2JYEA 3GB1A 5D3DA 3VFKA 3RPFC 1TY0A 1I4HA 2JUOA 4AUQC 5LXIB 4LJPB 4WWNA 2MW5A 4ZRIA 3AE9B 2JF5A 3RN9C 4LDTD 3Q3NC 3N1XC 3LDZE 5HKHA 2BYTA 1BXTA 2FCNA 2LGYA 1LQBA 3KWLA 3UIPB 2E3TA 3BZDB 4L2YA 2MJDA 1KJTA 2WXGA 2Z0DB 4XC2A 1IYFA 4RM8A 4GDLB 3SHQA 5EE9A 1HE8A 4YTMB 3VQIA 3TL5A 2LMCA 4HPPA 1LFDA 1OGWA 4FJVB 2DYBA 2GBKA 2MQJA 3PV1A 4N9F4 2KTRB 1N62A 2QILA 2N7JA 1XXGA 1WR6E 1V9JA 3U8ZA 2DZKA 3DDCB 2WXOA 4M01A 1FFVA 2BYFA 1WY8A 1MFWA 1D4BA 1YNTE 1YJ1A 2MWSB 1WGHA 2ICIA 2J4XA 1XLNA 3B0AA 2B76B 2O6VA 3NOBA 1TBEA 2KWDA 3DVNV 4XE0A 2Y3AA 2JZZA 4WJQA 1L0VB 2M1MA 4F7ZA 1Z2MA 3QA8A 4MJSA 3MHZA 2LJIA 3SFEB 1PYWD 4II3B 2DNFA 1UH6A 2M19A 4MEMA 4K7SA 3KLSX 2QSDA 4E74A 2MBHA 3ZTDA 3IAM1 2LUEA 3WIMA 4WAAA 3H6NA 4P16A 4ZRQA 4ICUA 1LO5D 1V97A 1XEEA 3N1YC 4PYUA 5AZGA 4C80A 3BVZA 1FRDA 1M94A 3H7SA 2G9HD 5GMVA 1YJJA 2KT7A 2IDYA 4C4VA 3M3JA 4DBGA 3DHIC 4XDCA 1I35A 5BMHA 3IT4B 2UYZB 3ZVVA 1HQRD 1TYGB 3JSVA 3AMZA 1JWAD 4XYCA 5AZFA 3UQBA 3FKYA 5H8YE 4BBNC 1Q10A 2MP2A 3UINB 2O2VA 4WH4A 3W2DA 1WJ4A 4MACA 1C79A 4XWTA 1UZXB 1GC7A 2N1VA 2XEWA 5AUIA 4HPMB 3TMPB 3BK1A 2WXPA 1V80A 3HM3A 2KJHB 2DBYA 2J0JA 2PKOA 1Q1OA 2BWES 1ESFA 1XCQL 4YWGG 1T6BX 2PJHA 1EU4A 2FAZA 1U4AA 3N1ZC 2DYMA 2CJOA 5CX3A 3EC8A 3NVYA 4GDKB 3RNGC 1VZ7A 2WLBA 2LRUA 5LLIA 3TEZA 1NEKB 1MHXA 3A9KB 2J42A 4HXDA 3SD5A 2G3QB 2KWCA 3ABVB 1ZE3D 2KNBA 2JRIB 1T0YA 3DBHB 2B3AA 3CF6E 2WXHA 4PK1A 1IGCA 4JLCA 2AWTA 2BW2A 2DZJA 2MSED 4OW0A 1ZUD2 1PGAA 3AEEB 3Q3FA 4WQMA 2V9HA 4IWOA 1CK1A 1V81A 3CIRB 5DPTA 2ZNVC 4WWMA 2WDQB 2KQSA 3PZDA 1WGGA 2C60A 4TMAB 2IJ0A 1SGHA 3NG0A 3AE7B 2KC2A 1Y8RC 1AARA 4IM0A 3VHTC 1L7YA 1UWMA 2AL3A 1Q5WB 2QHOA 2KDIA 1PUTA 3PRPB 2GB1A 1WX8A 1HA5A 2JXTA 1JRPA 1WSPA 5HHDG 3Q8BA 3NZSA 2XNAC 2GI9A 3H7PB 3NVVA 4DXAB 4II2B 5L83A 4FA6A 1E9MA 2FCQA 4FJYA 4ASWC 1E7VA 2K22A 3URYA 2IY0B 3ZTCA 2J0KA 3WAMA 3M62B 4RF1A 1E8XA 4YTPB 4A9AA 3L4PA 2Y5CA 5HI1A 4GXBA 5IA7A 3I3TB 5JZEB 2KXJA 3AE2B 3EUB2 1WIAA 3BWUD 2JWZA 3ZIMA 3BYYB 3TEYA 5DPWA 3W5VB 2WXFA 1EF5A 2JU6X 3HVZA 4W9GA 1FCCC 3DBHI 2IY1B 4BKGA 4N58A 1UGJA 1SJED 1RM6C 2IZVB 1WGYA 3EHVA 4LJOB 4WJNA 2WS3B 4W9CA 1XLOA 2MX2A 2RDBC 1TT5B 2N9LA 4XDDA 3JVZX 3QJZA 3WCQA 1E8YA 2LASA 3PGEA 4CYEA 2I1JA 2Y5BB 1VZ8A 4PS7A 3DPDA 3RI7C 4RFBA 5J17A 4DHJD 4KDLB 3V3XA 4ACFA 2CU1A 2MBBB 3MP9A 2CU3A 1ZDVA 4LLGM 1WWTA 2KDEB 2EKEC 1V6EA 1HEZE 3VTWA 1BUIC 4HK2A 4M0WA 1WXAA 4A3OA 4DXFA 5BMIA 3VTUA 1EF1A 2GMIC 4A55A 4BOSC 3UIOB 4IWQA 5AZHA 1C4CA 1TGZB 2INDC 4WJPA 5E6NA 1ZXIA 2DZMA 2KFKA 1L0XB 2WU5B 1MJDA 1N5XA 2CHWA 2BQQA 5IAAC 1ET6A 2BBCA 4RH6A 5DPRA 4DHZE 3UQAA 1NENB 3AEFB 1IPGA 5E6OA 1Y56A 2CKHB 3V62A 1SB3C 2DENB 1GJZA 1YN5A 1VDVA 2LVPA 4ZRKA 1PGXA 4NNJB 3LYYA 3AE3B 3SFDB 4CQNA 3KUDB 3HK0A 1FO4A 3A1QA 4FBJB 2EELA 1IGDA 2WDTB 4KVGB 2CJNA 2O6VB 2N0SB 1T0SC 3O13A 4BKTA 4KZCA 1V5TA 1F9JA 1AW7A 2OEDA 3NUHB 4KSKC 1TTNA 2AL6A 2A4ZA 3J9CA 3I57A 1HTOA 2LGSA 3R3MA 1ZKHA 2D3BA 3Q3JA 1FRRA 1KFYB 4EE2A 4B6WA 4IG7B 1E90A 4BKSA 4LNFA 4K7WA 1TIFA 2BKRB 1UUPA 5LXHA 3PREA 2RSUA 4ANUA 3VUYA 3KUCB 2M4NA 2D07B 4KIKA 4TKNA 1Q0WB 4NQLB 3AI5A 1VCBA 2V4IB 4C4VB 2WU2B 3JSVB 2KLGA 3B1LX 3TJPA 4MGKE 3X0WA 1SEBD 1DOYA 2QJLA 2BPSA 2MH7A 2O2VB 4S17A 2PPHA 4WWPA 1UD7A 4AJWA 2DYOA 3PRZA 1X1MA 5BO4B 2A5UA 3ML9A 3V6EB 4TQ1A 1JRUA 4PT5A 1BMLC 1N63A 2KOXA 1KLGD 3R7QA 1TS4A 4B0EA 3APDA 2KFJA 3QIJA 1KTKA 4Q2JA 2KQ7A 3N20C 5EE3A 3DBSA 1RWSA 3UF8A 3NZUA 2AEHA 3U7ZA 4NAWA 2G4SA 3KYDD 1XD3B 2ZNVB 3Q14C 3V61A 3T3NA 1NYQA 4MM3B 3ZXVA 1C3TA 3N9YC 1GPXA 2DHZA 5E6JA 4ANXA 2GBMA 2QEJC 1R4MB 2JWUA 1C9FA 4ZHOA 1H4RA 4RGOS 3QCAA 2W82A 2WGSA 4FADA 1GAQB 3AECB 3QX1A 4IUMB 1T3QA 1KH0A 2NBVB 4W9HA 4USAA 1UBIA 2V0GA 1JWMD 2ZW0A 2QDFA 2GRIA 1H8CA 2RPQA 3Q8CA 1WXVA 5AEKB 4KZ0A 1N60A 4HCNB 4GN1A 1IBXA 1PQSA 3OAWA 4BVUC 1YQBA 2K1FA 2KC1A 4BAXA 2GBRA 1QOBA 1TS2A 2C7MB 4ZYSA 2WDRB 4BBNF 1P3QU 4DDID 3V05A 4UDUC 4KX6B 2NBUA 1UF0A 1WMHA 2DZIA 2KMCA 3ZRFA 2N9KA 4C7YA 3PLUA 1WXMA 2R2QA 2KX3A 4ITKA 1SE9A 1FXTB 1XO3A 1XT9B 4BZAA 5IP4D 3C8YA 2Z0EB 1VLBA 3RYTA 1CJEA 2N9PC 2YEPB 1D3ZA 1P7FA 4I6PA 3OG5A 1L5PA 4IWPA 3B08A 1FFUA 2LVOA 4DHJB 1KRHA 1I42A 4GB9A 5JHBA 3FILB 3N30A 4G11A 3BYTB 1J8CA 3R2TA 2IBIB 3QK0A 3ZYYX 1WX9A 1SIFA 4NQKE 3MC0B 1QOFA 4K7UA 2MCNB 2PMVA 3HM6X 2O6VD 4B9KA 5EDSA 3P1MA 1VRAB 1DYQA 1WE6A 1MG8A 1VR9A 2IGDA 3NVWA 1G6JA 3RNEC 3AEBB 1FNUA 1WJNA 3OLMD 4AP4C 2M17A 3VH3B 1C4PA 4IDIA 4RM9A 1DOIA 1N5WA 4NJ6A 5IKCM 2WXNA 4M0WB 3MC8A 3ZJUA 1J7BA 3EGRA 4I6NB 1YD8U 2BB6A 4A90A 1J7CA 4K81A 1ZOYB 3NVZA 3Q69A 2TSSA 2BYEA 1ZXHA 5D7GA 1PGBA 4GSWA 2BTEA 4WJOA 2WXIA 2KFKB 4JL9A 1WI0A 4M8NA 3A9JA 3PZ7A 2RDGA 3PLVA 5D6JB 1SJHD 1V1OA 3VR9B 3P4RB 2KJ6A 4B0MA 1FNWA 4MH0E 4DHZB 4LCDE 4FULA 4HEA1 3AE6B 4D2KA 1V5OA 1WGDA 3K9OB 1D6EC 2DAJA 4AWJA 2JQRB 1P1AA 3DVNU 2C7HA 3PVLA 2L76A 1M4VA 4GLSC 2W9NA 3AM9A 1NI2A 2N9XA 1WM2A 3A1QB 2J7QB 3AV8A 3ZGZA 1ET9A 4HKZE 4QAYA 4AOFA 2EMTA 2HJ8A 2J53A 2K0PA 2YEPF 5D2MB 4ARIA 2KVZA 3ZO5B 1F2RI 1PFDA 1WM3A 3HUIA 2QC8A 4WQOB 4YSZB 2K8CA 4HRSA 1XQQA 2G45B 3AE4B 1MG4A 1ACCA 3ZQ4A 1K52A 1L4ZB 5I4DA 2JVCA 2LXAA 1JW9D 4W9IA 4M02A 4RF0A 2KO3A 3CSTA 3BY4B 4E71A 1ZPSA 1LM8B 1NVID 2LRWA 2LXCA 2LJ5A 3DBRB 4B95A 1JWBD 1NI3A 5BMGA 3VRBB 2L0TA 3E56A 1JWSD 1WYGA 2NCNA 1KM7A 1IUEA 1F0ZA 3ZNGC 4NJ7A 4I6LB 3KWVA 4G50A 1TKEA 2UWQA 4KIKB 3RNBC 5C1ZA 3DVGY 2PIAA 1STEA 4OHJA 2BS3B 2K9XA 3H1UA 5CHFA 1WZ3A 2AQ3B 2D3AA 2XK5B 3TCAA 4HPLB 3TIXA 2HTME 4GDLA 3RT3B 4PS3A 3M95A 3KW5B 4ZDVA 3S2AA 1KOTA 2G1EA 2JZPA 3L54A 2PVOD 2OHFA 5H92C 2W55A 5JHAA 4HCPB 2CS4A 3HHMA 3ZJVA 5G55A 2NR2A 3P63A 2ZVNA 2XBBC 5FR3A 2VRRB 3P2BA 2REXA 3A4RA 1F1HA 3V6CB 2KMAA 4OZCA 3NS1A 1MI0A 1OTRB 3Q8EA 2ZJDA 3EFCA 4YL8A 3JYUA 1VD2A 2AYOB 4DK5A 2PEAA 3N3KB 1LGRA 2JY6A 2YLMA 4NAWB 1T0RC 2C7NB 4MH8A 2KLCA 4NJCA 2L05A 3KYCD 3TEXA 2JZ3B 2FCMA 4YT0B 4KV2A 3DBRI 3K9PB 4OZAA 2K6DB 4X57B 1V8CA 3U4EG 3AU4A 4LNOA 1YN4A 2GLSA 3AEGB 2ZVOA 1RAXA 5EE0A 4FHJA 3RZFA 2NVUI 2LD9A 2Q5WD 1YQ4B 1WR1A 2VH1A 4ANVA 4NY0A 2WHIA 3RNCC 2BB5A 1E8ZA 4LNNA 4P1CC 4K3BA 4ZOHC 4CO7A 2MEKA 1FNVA 2KN5A 4BOZB 2L8JA 5C23A 4RGTA 4TQ0A 1YX5B 1FD6A 5CTRC 3BK2A 3NRZA 3SU8X 1NYRA 2K8HA 1A5RA 1B9RA 1YOVB 3DCGA 1QLBB 2VH2A 2WP9B 1K50A 4F1SA 3AH7A 4AS1A 4J3OD 3AEDB 2MBQA 2KD0A 2V3SA 1QF6A 1FPYA 3HVDA 4K3CA 3VTVA 4GGQA 1ISNA 2ACZB 2LFIA 3WAPA 4W9FA 3LB8C 5LNK1 1N6ZA 4KGRA 1QOAA 4NPNA 4KSLC 2D11A 1AYFA 5L95C 1RYJA 1QT9A 4EEWA 2M0AA 3EECA 4JX1C 1GNUA 2FIDA 4S0RA 1EWCA 2WXJA 4KDIC 1L4DB 4XWWA 4MT5A 3VUWA 1J0GA 3NZ3A 1F77A 1RRBA 2WDVB 3NJTA 4W9KA 2KKCA 4MJSB 2PVGC 2IGHA 1CQVA 3CWIA 1C76A 3CSFA 3CMMB 5HG2A 2KANA 2JSVX 2M56B 3PTFC 1T0QC 2RPVA 5CHWA 2L52A 2J0MA 3L16A 2BT6A 2LI5A 4EFOA 1WX7A 4E3CA 2PE6B 2L00B 4WIPA 2OOBB 4ANWA 2MJEA 2LGXA 3SEBA 3EFUA 1VZ6A 3GE8C 2L3ZA 4RGMA 2BS2B 4AQ7A 3ENEA 3APCA 1N61A 1K51A 1FIQA 3AU5A 3ZNHB 1D5MC 4BKSD 2D2QA 2E6XA 2FUG1 1WRDB 5D94A 3DWGC 3EA6A 2WWZA 2L32A 1HZ5A 2IYDB 3C19A 2BGFA 4US9A 3IVFA 2JX5A 4C00A 3PO0A 1SSNA 4HVBA 1EO6A 5EE1A 2K3UA 1EUVB 2KTFA 3T9LA 3UI3A 3H7PA 1UGMA 1UBQA 2V1YA 2MP2B 2D10A 3A9JB 3KUZA 4XGAB 2DWQA 3GS2A 4KGSA 5J2RA 2V4LA 3QWZB 2IGGA 1V49A 2KN4A 2NBWB 4H2AA 1E0ZA 3QHTA 4JGHB 5FR6A 3W5UB 3B2GA 1OQYA 4LK0M 1WXQA 3R8BA 1C77A 2JYTA 2LWPA 4JPSA 2RGFA 3AE8B 1IP9A 3I5JC 5CHVC 1JWUD 3WA0A 2MLBA 3JW0X 1AN8A 1T5XD 1QQRA 4KKIA 4MDKE 1GUAB 1KF6B 4A3PA 3IHPC 3RD2A 2KDBA 2FIFA 1ZDXA 1L6VA 1YN3A 3PSEB 5KHQA 2DLBA 2H88B 2WXRA 3E9SA 5BYQA 1TZOA 2VZKB 5GXGB 2BYVE 1FEHA 2KAJA 4EZLA 3AE1B 2KMMA 2AX5A 3AXCA 4TSSA 4IW0A 1XLPA 2R2OA 3FC4A 4FN2A 2JT4B 2KVRA 5E6PA 1SE2A 2ZCCA 4R3DA 3M63B 4N59A 2OJWA 2G4DB 3WAOA 2N4FA 2X38A 1KLUD 4ZHPA 1XF5L 3ZDMC 5JXVA 3L17A 1QOGA 2ZPNA 3IXSA 2PLPA 5IN7A 1QKZA 3IT6B 3TBLD 3BIID 2RR9A 4ZRJA 4EZJA 3PPAA 1FMAD 2FUHB 1C1YB 2DAFA 2IO1B 4W9EA 1RFKA 3VVWB 4HJGE 3BVGA 2INCC 1K8RB 3L10B 2MA9B 1HZ6A 2HJ1A 2FCSA 4NZLB 1J7AA 2CHXA 2CHZA 5G5GA 1NBFC 3RULA 4REZA 4LTUA 1WH3A 1TJEA 4W9JA 2KDMA 3SR6A 1FXAA 3Q3OC 3ZW3A 2LZ6A 2M0XA 2BWFA 2KJRA 3P4QB 2AQ1B 1GG3A 1RLFA 1KLVA 2WNMA 3GE3C 5T8IA 5IOIA 3I9V1 4RMAA 4W9DA 2EMSA 4XZ4A 2ONQA 3KH0A 1NDDA 1R4MI 2HTHA 1E8WA 2NTSA 1WJUA 2WYQA 4YXDB 2N7DA 3ZNID 2I2YA 2KWUB 2I1KA 3Q8FA 1P98A 5J18A 1JALA 1FM0D 2WXKA 1WE7A 4EUTA 2LUMA 3R2IA 1QILA 1YIWA 3VH4B 2K8BA 4PYZA 2N9EB 3RNFC 3GZNB 1P0RA 1R4NB 3AULA 1WZ0A 2Z59B 4GU2A 3IG3A 2LVQA 3NS8A 3WANA 2IPKD 2GBJA 3ZNZB 2OJRA 2WQYB 3KVFB 3VXWA 2BF8B 2XN9C 4PS8A 3ZJTA 3ZXRA 1WGRA 4ZYNA 1E5WA 2HD5B 2NPTA 2FNJB 3TUOA 1AWDA 1YJIA 2M8SA 2AQ2B 5TSSA 3ONSA 3U2SC 2L1AA 2YVCA 1JCKB 1EM7A 1V1PA 4JQWC 4OVZA 2KZRA 2L83A 4HDQA 4EZKA 4W9LA 3VAWA 1XCTL 3NHEB 3P4SB 5AUKA 3X23A 1TS3A 3AEAB 1Z5SB 3VDZA 1OQQA 2IO3B 2ZZPB 2W3SA 1PDXA 3MJ5A 4DWFA 3Q8AA 1I4GA 4MSQB 2D3CA 3TSSA 4M00A 1YX6B 2HE7A 5TR5A 4NAMA 1VJKA 2V3PA 3L13A 4IM3A 1SBBB 1WGKA 2K5PA 3B9JA 2GOWA 4HLEA 3P42A 4OZBA 4JIOU 3GZNI 3APFA 1R4NI 2QIEB 5C2TB 3PHWB 3UGBB 1DOXA 3BVMA 2BVCA 2LGDA 4BFRA 4MM3A 1L0YB 1YQ3B 3RMKC 3ZDTA 3T3OA 3PRMB 1D5ZC 3OJ4B 3Q3MC 2VZKD 5DPSA 4DQOC 3IFWB 2MBOA 3DVGX 3R66C 2RDHA 3VRAB 2C9WB 4HJKA 2BS4B 1OEYJ 4RCOA 4ZRPA 1FCLA 1SF0A 2UU7A 4GOCA 3DOWA 2IO2B 4JE3B 1K53A 3HRDD 4EKUA 4OVVA 4IC7B 1P9DU 5IO9A 2Z8LA 3ML8A 3DHGC 3A4SC 4K1RB 2KQ4X 4LNKA 4RGNA 4ARCA 1R7SA 4MGZE 4L23A 4F8CB 3ECIA 5FK9C 4EOYA 4P1BC 1E7UA 2W54A 4AJYB 1OEYA 4MGIE 4MGYE 2GBNA 2JXXA 4HDOA 3PZ8A 1WYWB 3RFZB 3AE5B 2KWVB 2KTRA 2QMTA 4HROA 1I4PA 1OFFA 1L6UA 2LEKA 4MELA 1UNSA 4TUUA 3I63C 1XLQA 2PE9A 1MVKA 4IOIE 1CMXB 3AN1A 1WFYA 3NY5A 2MHJA 4US8A 1MPEA 1BT0A 3DBLB 3O65B 2NMQA 3RNAC 5BYSA 4MSMB 3DQVA 1TS5A 2KK8A 4RNAA 2PTLA 2RD0A 3FILA 1ROEA 4FHKA 1HTQA 1JQ4A 3B2FA 2MBEA 1ZGUB 2LGIA 1EWYC 3ZRCA 5KHOA 3PT2B 3U30A 2C5LC 4LDTB 4P6VF 3RCZA 3Q2AC 3Q6BA 2INPE 3DWMA 3T8MA 2X8XX 1E6EB 3PHXB 1I4RA 2LHEA 1IBXB 1F2RC 2K6QA 3LJ3A 4FJZA 2ZW1A 1D5XC 2RMMA 2HDEA 2FBWB 3ZUNA 2EKIA 1SE4A 4WAFA 4KKJA 4KGTA 2L7RA 5HFYA 2V3NA 1WF9A 4O1NA 3A33B 2NS5A 2N1WA 4C56C 2BKFA 1OQRA 1DGJA 3L08A 2I38A 4GMVA 1WMHB 2D3GA
chains in the Genus database with same CATH topology
1L2NA 2MLBA 3JW0X 3PRPB 1WE6A 1WX8A 1MG8A 1LXDA 4MDKE 4P7IA 1RFAA 1WXSA 1S1QB 1GUAB 1G6JA 4A3PA 3NZSA 3IHPC 3RD2A 2KDBA 2N7EA 3H7PB 2FIFA 4DXAB 3DBLI 4II2B 1WJNA 5KHQA 3PSEB 5L83A 4FA6A 3OLMD 4AP4C 2FCQA 2M17A 4FJYA 3VH3B 4ASWC 1E7VA 4DDGD 2IY0B 3ZTCA 2J0KA 4RM9A 3WAMA 2BYVE 4EZLA 3M62B 4IM2A 1E8XA 4NJ6A 3AXCA 3GOEA 4IW0A 4GIVA 4M0WB 2R2OA 4GDKA 4GXBA 4FN2A 2JT4B 2KVRA 3I3TB 4URKA 5E6PA 1UELA 5IA7A 2L0FA 5JZEB 3H9DA 3W1SA 2KXJA 2ZCCA 4I6NB 1YD8U 3A9KA 4OVUA 4A20A 3M63B 1WIAA 4K81A 2G4DB 3WAOA 1QZEA 2JWZA 2N4FA 1WJ6A 3RUIB 2BYEA 3MHSD 1TZ1A 5G2NA 5D7GA 4GSWA 3ZIMA 2KHWB 3ZDMC 4WJOA 5DPWA 3L17A 2D3GA 1EF5A 2ZPNA 2KFKB 4JL9A 1WI0A 4M8NA 3A9JA 3PLVA 5D6JB 3W1SC 4W9GA 3TBLD 2KJ6A 2RR9A 4ZRJA 3DBHI 2IY1B 4MH0E 3MTNB 3PPAA 4LCDE 4BKGA 4DHZB 4FULA 4EZJA 2FUHB 1C1YB 3HIZA 2DAFA 2IO1B 4W9EA 3WALA 2IZVB 4M8MA 3VVWB 1V5OA 1WGDA 2K25A 3K9OB 1WGYA 3EHVA 4LJOB 4WJNA 2DAJA 4W9CA 1K8RB 3L10B 4AWJA 2MA9B 2MX2A 4XX5A 3OJ3A 2FCSA 2WX1A 1P1AA 3QQ8B 2CHXA 2CHZA 3JVZX 3R7RA 3DVNU 1NBFC 2C7HA 3PVLA 3RULA 4FLHA 3QJZA 3PS6A 1WH3A 2L76A 4W9JA 1E8YA 2LASA 2ZCBA 3PGEA 4CYEA 2I1JA 2W9NA 2Y5BB 3ZW3A 4TV3A 2LZ6A 1NI2A 2N9XA 2M0XA 1WM2A 3A1QB 2J7QB 2BWFA 2KJRA 4PS7A 3DPDA 2ZEQA 1GG3A 5J17A 4AOFA 4DHJD 2EMTA 1RLFA 4KDLB 2KDFB 2HJ8A 2NPTB 2CU1A 5D2MB 2MBBB 2WX0A 3ZO5B 1KLVA 1WM3A 1J19A 2K39A 2KDEB 4WQOB 2K8CA 3MJWA 1XQQA 2G45B 2EKEC 2JRHA 1V6EA 3VTWA 4RMAA 4W9DA 3W1YA 2EMSA 2XK5A 4HK2A 4XZ4A 3KH0A 1NDDA 2ZPYA 1R4MI 1WXAA 4A3OA 2JVCA 2HTHA 2LXAA 1E8WA 3IBEA 4WWOA 3VTUA 3N32A 4W9IA 1EF1A 2GMIC 4BOSC 3UIOB 2KO3A 4IWQA 1WJUA 2WYQA 5AZHA 3V60A 3CSTA 2KX0A 3BY4B 4E71A 1LM8B 2LRWA 2N7DA 3ZNID 2LXCA 1TGZB 2KWUB 2LJ5A 2I1KA 4B95A 1V86A 4WJPA 5E6NA 2IO0B 2DZMA 2KFKA 1P98A 3D32A 2L0TA 4G0NB 3VUXA 4J6IA 5J18A 2NCNA 1KM7A 3QAQA 1WE7A 2CHWA 5IAAC 3ZNGC 4EUTA 4NJ7A 4I6LB 4CHKA 5DPRA 1YIWA 4G50A 4ICVA 3VH4B 4DHZE 2UWQA 4KIKB 2K8BA 3UQAA 3L0WB 4PYZA 2N9EB 5JH5C 1IPGA 5E6OA 4G3XB 5DCNA 1S3SG 5C1ZA 1P0RA 3AULA 2CKHB 3C0RB 1WZ0A 3DVGY 2Z59B 4GU2A 2CR5A 3U7DA 3V62A 3IG3A 2LVQA 3NS8A 3RZWC 3WANA 2JPHA 3BINA 3H1UA 5CHFA 2DENB 1WZ3A 1GJZA 2GBJA 2XK5B 2LVPA 4ZRKA 3TCAA 4NNJB 4HPLB 3ZNZB 2OJRA 3KVFB 3TIXA 3VXWA 4GDLA 2BF8B 3RT3B 4PS3A 3KUDB 3HK0A 3M95A 3KW5B 3QARA 2MRPA 3QC8B 4PS8A 3S2AA 3ZKJC 4ZDVA 1KOTA 2DX5B 3A1QA 4FBJB 3L54A 1WGRA 3ZLZA 2WDTB 2ASQA 4ZYNA 4KVGB 1ZW7A 1GC6A 5JHAA 4HCPB 2CS4A 3SDLC 1E5WA 2HD5B 2NPTA 3HHMA 2FNJB 5G55A 2NR2A 2O6VB 1V2YA 2ZVNA 4BKTA 2XBBC 4KZCA 3ALBA 1V5TA 4HWIB 2VRRB 2M8SA 3P2BA 1F9JA 2REXA 4KSKC 3VFKA 1TTNA 3A4RA 3ONSA 2AL6A 2JUOA 4AUQC 5LXIB 2A4ZA 4LJPB 4WWNA 2YVCA 2MW5A 3V6CB 4JQWC 2KMAA 4ZRIA 2JF5A 3R3MA 4LDTD 1ZKHA 3Q3JA 2KZRA 1OTRB 3LDZE 4HDQA 4EZKA 5HKHA 4B6WA 2ZJDA 4W9LA 4IG7B 1E90A 3VAWA 4BKSA 4YL8A 3JYUA 3NHEB 1VD2A 2AYOB 3X23A 2FCNA 4DK5A 2LGYA 1LQBA 1Z5SB 3VDZA 2IO3B 2ZZPB 2PEAA 3UIPB 3N3KB 2JY6A 2YLMA 4K7WA 4NAWB 2C7NB 1KJTA 2Z0DB 4XC2A 1IYFA 2KLCA 2BKRB 4RM8A 4GDLB 4DWFA 3SHQA 5LXHA 3PREA 4MSQB 2L05A 1HE8A 3KYCD 2RSUA 2JZ3B 4ANUA 2FCMA 4KV2A 3VQIA 1YX6B 3TL5A 2HE7A 5TR5A 3DBRI 3K9PB 2K6DB 3L13A 1LFDA 3KUCB 1OGWA 4IM3A 4FJVB 3VUYA 4X57B 3AU4A 2M4NA 2D07B 4KIKA 2DYBA 4TKNA 1Q0WB 2GBKA 2GOWA 2ZVOA 4HLEA 1RAXA 2MQJA 3PV1A 4FHJA 4NQLB 4N9F4 2KTRB 3RZFA 2NVUI 2LD9A 3AI5A 1VCBA 1WR6E 1V9JA 3U8ZA 4JIOU 2DZKA 3DDCB 1WR1A 3GZNI 4ANVA 3APFA 4NY0A 1R4NI 1E8ZA 3JSVB 2KLGA 4CO7A 3PHWB 3UGBB 3B1LX 3TJPA 2KN5A 4MGKE 2L8JA 2BYFA 4BOZB 5C23A 3X0WA 4TQ0A 1WY8A 1YX5B 2LGDA 5CTRC 4BFRA 1YJ1A 3SU8X 2BPSA 2MWSB 2O2VB 2PPHA 1WGHA 4MM3A 2K8HA 1A5RA 4WWPA 1UD7A 3B0AA 4AJWA 2O6VA 2DYOA 3DCGA 1X1MA 3NOBA 1TBEA 3PRZA 3DVNV 5BO4B 3ZDTA 2JZZA 4F1SA 4WJQA 2M1MA 3PRMB 2A5UA 3OJ4B 4F7ZA 2MBQA 2KD0A 3ML9A 3V6EB 1Z2MA 2V3SA 3QA8A 4MJSA 5DPSA 3IFWB 2MBOA 4TQ1A 3VTVA 3DVGX 4GGQA 1JRUA 3R66C 1ISNA 2KOXA 2C9WB 4HJKA 3WAPA 3R7QA 4W9FA 3APDA 2KFJA 3QIJA 4II3B 1UH6A 4NPNA 4KSLC 1OEYJ 4MEMA 4GOCA 2D11A 2KQ7A 3DOWA 2IO2B 4K7SA 5L95C 3DBSA 4EEWA 4E74A 4EKUA 3EECA 2MBHA 3ZTDA 1GNUA 4IC7B 1P9DU 3NZUA 2LUEA 3ML8A 4OVVA 3UF8A 3WIMA 2AEHA 3A4SC 2FIDA 3H6NA 4K1RB 4WAAA 4NAWA 2G4SA 4ICUA 3KYDD 1XD3B 2ZNVB 4MGZE 4F8CB 3ECIA 3V61A 4KDIC 4EOYA 1E7UA 4AJYB 1C3TA 1OEYA 4MGIE 4MGYE 2DHZA 2GBNA 4PYUA 5AZGA 2JXXA 4HDOA 3VUWA 2GBMA 4ANXA 1J0GA 1M94A 1WYWB 3H7SA 1RRBA 5GMVA 1H4RA 4W9KA 3QCAA 2KKCA 2KWVB 4MJSB 2KTRA 4FADA 3QX1A 3M3JA 4IUMB 3CSFA 4DBGA 1I35A 2UYZB 3ZVVA 3CMMB 2KANA 3JSVA 2NBVB 3PTFC 4W9HA 5AZFA 1UBIA 5CHWA 4MELA 3UQBA 2J0MA 3L16A 2LI5A 4EFOA 4TUUA 4BBNC 1WX7A 2MP2A 2PE9A 3UINB 4E3CA 2O2VA 1CMXB 1H8CA 2PE6B 2RPQA 1WXVA 5AEKB 1WFYA 2L00B 1WJ4A 2OOBB 3NY5A 4KZ0A 1BT0A 4ANWA 4HCNB 2LGXA 3O65B 1UZXB 4GN1A 1GC7A 3EFUA 2N1VA 2XEWA 1PQSA 2L3ZA 3OAWA 4HPMB 3TMPB 4BVUC 4MSMB 3ENEA 1YQBA 1V80A 3APCA 3HM3A 2K1FA 3DQVA 2KJHB 2J0JA 2KC1A 2KK8A 1Q1OA 2BWES 3AU5A 3ZNHB 2RD0A 2GBRA 2C7MB 2PJHA 2FAZA 4FHKA 4BKSD 1U4AA 4BBNF 2D2QA 2DYMA 5CX3A 1P3QU 4DDID 1WRDB 3EC8A 2MBEA 5D94A 1ZGUB 2WWZA 2NBUA 2IYDB 4GDKB 1WMHA 2DZIA 3ZRCA 2LRUA 5KHOA 2KMCA 5LLIA 2BGFA 3IVFA 3A9KB 3PT2B 3U30A 4HXDA 3SD5A 3ZRFA 2G3QB 2C5LC 4LDTB 3RCZA 4HVBA 1EO6A 2KWCA 3PLUA 1WXMA 2R2QA 2KX3A 1EUVB 1SE9A 1FXTB 1XT9B 2KNBA 2KTFA 3T9LA 2JRIB 1T0YA 2Z0EB 3T8MA 3H7PA 1UGMA 1UBQA 3RYTA 2B3AA 2MP2B 2V1YA 3CF6E 3PHXB 2D10A 2N9PC 3A9JB 1D3ZA 4JLCA 2AWTA 2MSED 2DZJA 3KUZA 4I6PA 3Q3FA 5J2RA 4IWOA 2V4LA 3QWZB 1V81A 4IWPA 3LJ3A 2K6QA 4FJZA 1V49A 3B08A 5DPTA 2NBWB 2LVOA 3ZUNA 4DHJB 2ZNVC 3QHTA 4JGHB 5FR6A 2KQSA 1OQYA 4GB9A 1I42A 3PZDA 5JHBA 3WA0A 4G11A 1WGGA 2L7RA 3N30A 2C60A 1J8CA 1WF9A 3A33B 2IBIB 3QK0A 1SGHA 1WX9A 1SIFA 2NS5A 4NQKE 2LWPA 2KC2A 1Y8RC 2N1WA 1AARA 2RGFA 4IM0A 4K7UA 2BKFA 3VHTC 1L7YA 2MCNB 3L08A 1IP9A 3HM6X 2O6VD 4GMVA 1WMHB 1Q5WB 2AL3A 2QHOA 5CHVC 4B9KA 5EDSA 2KDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2N A;  2MLB A;  3JW0 X;  3PRP B;  1WE6 A;  1WX8 A;  1MG8 A;  1LXD A;  4MDK E;  4P7I A;  1RFA A;  1WXS A;  1S1Q B;  1GUA B;  1G6J A;  4A3P A;  3NZS A;  3IHP C;  3RD2 A;  2KDB A;  2N7E A;  3H7P B;  2FIF A;  4DXA B;  3DBL I;  4II2 B;  1WJN A;  5KHQ A;  3PSE B;  5L83 A;  4FA6 A;  3OLM D;  4AP4 C;  2FCQ A;  2M17 A;  4FJY A;  3VH3 B;  4ASW C;  1E7V A;  4DDG D;  2IY0 B;  3ZTC A;  2J0K A;  4RM9 A;  3WAM A;  2BYV E;  4EZL A;  3M62 B;  4IM2 A;  1E8X A;  4NJ6 A;  3AXC A;  3GOE A;  4IW0 A;  4GIV A;  4M0W B;  2R2O A;  4GDK A;  4GXB A;  4FN2 A;  2JT4 B;  2KVR A;  3I3T B;  4URK A;  5E6P A;  1UEL A;  5IA7 A;  2L0F A;  5JZE B;  3H9D A;  3W1S A;  2KXJ A;  2ZCC A;  4I6N B;  1YD8 U;  3A9K A;  4OVU A;  4A20 A;  3M63 B;  1WIA A;  4K81 A;  2G4D B;  3WAO A;  1QZE A;  2JWZ A;  2N4F A;  1WJ6 A;  3RUI B;  2BYE A;  3MHS D;  1TZ1 A;  5G2N A;  5D7G A;  4GSW A;  3ZIM A;  2KHW B;  3ZDM C;  4WJO A;  5DPW A;  3L17 A;  2D3G A;  1EF5 A;  2ZPN A;  2KFK B;  4JL9 A;  1WI0 A;  4M8N A;  3A9J A;  3PLV A;  5D6J B;  3W1S C;  4W9G A;  3TBL D;  2KJ6 A;  2RR9 A;  4ZRJ A;  3DBH I;  2IY1 B;  4MH0 E;  3MTN B;  3PPA A;  4LCD E;  4BKG A;  4DHZ B;  4FUL A;  4EZJ A;  2FUH B;  1C1Y B;  3HIZ A;  2DAF A;  2IO1 B;  4W9E A;  3WAL A;  2IZV B;  4M8M A;  3VVW B;  1V5O A;  1WGD A;  2K25 A;  3K9O B;  1WGY A;  3EHV A;  4LJO B;  4WJN A;  2DAJ A;  4W9C A;  1K8R B;  3L10 B;  4AWJ A;  2MA9 B;  2MX2 A;  4XX5 A;  3OJ3 A;  2FCS A;  2WX1 A;  1P1A A;  3QQ8 B;  2CHX A;  2CHZ A;  3JVZ X;  3R7R A;  3DVN U;  1NBF C;  2C7H A;  3PVL A;  3RUL A;  4FLH A;  3QJZ A;  3PS6 A;  1WH3 A;  2L76 A;  4W9J A;  1E8Y A;  2LAS A;  2ZCB A;  3PGE A;  4CYE A;  2I1J A;  2W9N A;  2Y5B B;  3ZW3 A;  4TV3 A;  2LZ6 A;  1NI2 A;  2N9X A;  2M0X A;  1WM2 A;  3A1Q B;  2J7Q B;  2BWF A;  2KJR A;  4PS7 A;  3DPD A;  2ZEQ A;  1GG3 A;  5J17 A;  4AOF A;  4DHJ D;  2EMT A;  1RLF A;  4KDL B;  2KDF B;  2HJ8 A;  2NPT B;  2CU1 A;  5D2M B;  2MBB B;  2WX0 A;  3ZO5 B;  1KLV A;  1WM3 A;  1J19 A;  2K39 A;  2KDE B;  4WQO B;  2K8C A;  3MJW A;  1XQQ A;  2G45 B;  2EKE C;  2JRH A;  1V6E A;  3VTW A;  4RMA A;  4W9D A;  3W1Y A;  2EMS A;  2XK5 A;  4HK2 A;  4XZ4 A;  3KH0 A;  1NDD A;  2ZPY A;  1R4M I;  1WXA A;  4A3O A;  2JVC A;  2HTH A;  2LXA A;  1E8W A;  3IBE A;  4WWO A;  3VTU A;  3N32 A;  4W9I A;  1EF1 A;  2GMI C;  4BOS C;  3UIO B;  2KO3 A;  4IWQ A;  1WJU A;  2WYQ A;  5AZH A;  3V60 A;  3CST A;  2KX0 A;  3BY4 B;  4E71 A;  1LM8 B;  2LRW A;  2N7D A;  3ZNI D;  2LXC A;  1TGZ B;  2KWU B;  2LJ5 A;  2I1K A;  4B95 A;  1V86 A;  4WJP A;  5E6N A;  2IO0 B;  2DZM A;  2KFK A;  1P98 A;  3D32 A;  2L0T A;  4G0N B;  3VUX A;  4J6I A;  5J18 A;  2NCN A;  1KM7 A;  3QAQ A;  1WE7 A;  2CHW A;  5IAA C;  3ZNG C;  4EUT A;  4NJ7 A;  4I6L B;  4CHK A;  5DPR A;  1YIW A;  4G50 A;  4ICV A;  3VH4 B;  4DHZ E;  2UWQ A;  4KIK B;  2K8B A;  3UQA A;  3L0W B;  4PYZ A;  2N9E B;  5JH5 C;  1IPG A;  5E6O A;  4G3X B;  5DCN A;  1S3S G;  5C1Z A;  1P0R A;  3AUL A;  2CKH B;  3C0R B;  1WZ0 A;  3DVG Y;  2Z59 B;  4GU2 A;  2CR5 A;  3U7D A;  3V62 A;  3IG3 A;  2LVQ A;  3NS8 A;  3RZW C;  3WAN A;  2JPH A;  3BIN A;  3H1U A;  5CHF A;  2DEN B;  1WZ3 A;  1GJZ A;  2GBJ A;  2XK5 B;  2LVP A;  4ZRK A;  3TCA A;  4NNJ B;  4HPL B;  3ZNZ B;  2OJR A;  3KVF B;  3TIX A;  3VXW A;  4GDL A;  2BF8 B;  3RT3 B;  4PS3 A;  3KUD B;  3HK0 A;  3M95 A;  3KW5 B;  3QAR A;  2MRP A;  3QC8 B;  4PS8 A;  3S2A A;  3ZKJ C;  4ZDV A;  1KOT A;  2DX5 B;  3A1Q A;  4FBJ B;  3L54 A;  1WGR A;  3ZLZ A;  2WDT B;  2ASQ A;  4ZYN A;  4KVG B;  1ZW7 A;  1GC6 A;  5JHA A;  4HCP B;  2CS4 A;  3SDL C;  1E5W A;  2HD5 B;  2NPT A;  3HHM A;  2FNJ B;  5G55 A;  2NR2 A;  2O6V B;  1V2Y A;  2ZVN A;  4BKT A;  2XBB C;  4KZC A;  3ALB A;  1V5T A;  4HWI B;  2VRR B;  2M8S A;  3P2B A;  1F9J A;  2REX A;  4KSK C;  3VFK A;  1TTN A;  3A4R A;  3ONS A;  2AL6 A;  2JUO A;  4AUQ C;  5LXI B;  2A4Z A;  4LJP B;  4WWN A;  2YVC A;  2MW5 A;  3V6C B;  4JQW C;  2KMA A;  4ZRI A;  2JF5 A;  3R3M A;  4LDT D;  1ZKH A;  3Q3J A;  2KZR A;  1OTR B;  3LDZ E;  4HDQ A;  4EZK A;  5HKH A;  4B6W A;  2ZJD A;  4W9L A;  4IG7 B;  1E90 A;  3VAW A;  4BKS A;  4YL8 A;  3JYU A;  3NHE B;  1VD2 A;  2AYO B;  3X23 A;  2FCN A;  4DK5 A;  2LGY A;  1LQB A;  1Z5S B;  3VDZ A;  2IO3 B;  2ZZP B;  2PEA A;  3UIP B;  3N3K B;  2JY6 A;  2YLM A;  4K7W A;  4NAW B;  2C7N B;  1KJT A;  2Z0D B;  4XC2 A;  1IYF A;  2KLC A;  2BKR B;  4RM8 A;  4GDL B;  4DWF A;  3SHQ A;  5LXH A;  3PRE A;  4MSQ B;  2L05 A;  1HE8 A;  3KYC D;  2RSU A;  2JZ3 B;  4ANU A;  2FCM A;  4KV2 A;  3VQI A;  1YX6 B;  3TL5 A;  2HE7 A;  5TR5 A;  3DBR I;  3K9P B;  2K6D B;  3L13 A;  1LFD A;  3KUC B;  1OGW A;  4IM3 A;  4FJV B;  3VUY A;  4X57 B;  3AU4 A;  2M4N A;  2D07 B;  4KIK A;  2DYB A;  4TKN A;  1Q0W B;  2GBK A;  2GOW A;  2ZVO A;  4HLE A;  1RAX A;  2MQJ A;  3PV1 A;  4FHJ A;  4NQL B;  4N9F 4;  2KTR B;  3RZF A;  2NVU I;  2LD9 A;  3AI5 A;  1VCB A;  1WR6 E;  1V9J A;  3U8Z A;  4JIO U;  2DZK A;  3DDC B;  1WR1 A;  3GZN I;  4ANV A;  3APF A;  4NY0 A;  1R4N I;  1E8Z A;  3JSV B;  2KLG A;  4CO7 A;  3PHW B;  3UGB B;  3B1L X;  3TJP A;  2KN5 A;  4MGK E;  2L8J A;  2BYF A;  4BOZ B;  5C23 A;  3X0W A;  4TQ0 A;  1WY8 A;  1YX5 B;  2LGD A;  5CTR C;  4BFR A;  1YJ1 A;  3SU8 X;  2BPS A;  2MWS B;  2O2V B;  2PPH A;  1WGH A;  4MM3 A;  2K8H A;  1A5R A;  4WWP A;  1UD7 A;  3B0A A;  4AJW A;  2O6V A;  2DYO A;  3DCG A;  1X1M A;  3NOB A;  1TBE A;  3PRZ A;  3DVN V;  5BO4 B;  3ZDT A;  2JZZ A;  4F1S A;  4WJQ A;  2M1M A;  3PRM B;  2A5U A;  3OJ4 B;  4F7Z A;  2MBQ A;  2KD0 A;  3ML9 A;  3V6E B;  1Z2M A;  2V3S A;  3QA8 A;  4MJS A;  5DPS A;  3IFW B;  2MBO A;  4TQ1 A;  3VTV A;  3DVG X;  4GGQ A;  1JRU A;  3R66 C;  1ISN A;  2KOX A;  2C9W B;  4HJK A;  3WAP A;  3R7Q A;  4W9F A;  3APD A;  2KFJ A;  3QIJ A;  4II3 B;  1UH6 A;  4NPN A;  4KSL C;  1OEY J;  4MEM A;  4GOC A;  2D11 A;  2KQ7 A;  3DOW A;  2IO2 B;  4K7S A;  5L95 C;  3DBS A;  4EEW A;  4E74 A;  4EKU A;  3EEC A;  2MBH A;  3ZTD A;  1GNU A;  4IC7 B;  1P9D U;  3NZU A;  2LUE A;  3ML8 A;  4OVV A;  3UF8 A;  3WIM A;  2AEH A;  3A4S C;  2FID A;  3H6N A;  4K1R B;  4WAA A;  4NAW A;  2G4S A;  4ICU A;  3KYD D;  1XD3 B;  2ZNV B;  4MGZ E;  4F8C B;  3ECI A;  3V61 A;  4KDI C;  4EOY A;  1E7U A;  4AJY B;  1C3T A;  1OEY A;  4MGI E;  4MGY E;  2DHZ A;  2GBN A;  4PYU A;  5AZG A;  2JXX A;  4HDO A;  3VUW A;  2GBM A;  4ANX A;  1J0G A;  1M94 A;  1WYW B;  3H7S A;  1RRB A;  5GMV A;  1H4R A;  4W9K A;  3QCA A;  2KKC A;  2KWV B;  4MJS B;  2KTR A;  4FAD A;  3QX1 A;  3M3J A;  4IUM B;  3CSF A;  4DBG A;  1I35 A;  2UYZ B;  3ZVV A;  3CMM B;  2KAN A;  3JSV A;  2NBV B;  3PTF C;  4W9H A;  5AZF A;  1UBI A;  5CHW A;  4MEL A;  3UQB A;  2J0M A;  3L16 A;  2LI5 A;  4EFO A;  4TUU A;  4BBN C;  1WX7 A;  2MP2 A;  2PE9 A;  3UIN B;  4E3C A;  2O2V A;  1CMX B;  1H8C A;  2PE6 B;  2RPQ A;  1WXV A;  5AEK B;  1WFY A;  2L00 B;  1WJ4 A;  2OOB B;  3NY5 A;  4KZ0 A;  1BT0 A;  4ANW A;  4HCN B;  2LGX A;  3O65 B;  1UZX B;  4GN1 A;  1GC7 A;  3EFU A;  2N1V A;  2XEW A;  1PQS A;  2L3Z A;  3OAW A;  4HPM B;  3TMP B;  4BVU C;  4MSM B;  3ENE A;  1YQB A;  1V80 A;  3APC A;  3HM3 A;  2K1F A;  3DQV A;  2KJH B;  2J0J A;  2KC1 A;  2KK8 A;  1Q1O A;  2BWE S;  3AU5 A;  3ZNH B;  2RD0 A;  2GBR A;  2C7M B;  2PJH A;  2FAZ A;  4FHK A;  4BKS D;  1U4A A;  4BBN F;  2D2Q A;  2DYM A;  5CX3 A;  1P3Q U;  4DDI D;  1WRD B;  3EC8 A;  2MBE A;  5D94 A;  1ZGU B;  2WWZ A;  2NBU A;  2IYD B;  4GDK B;  1WMH A;  2DZI A;  3ZRC A;  2LRU A;  5KHO A;  2KMC A;  5LLI A;  2BGF A;  3IVF A;  3A9K B;  3PT2 B;  3U30 A;  4HXD A;  3SD5 A;  3ZRF A;  2G3Q B;  2C5L C;  4LDT B;  3RCZ A;  4HVB A;  1EO6 A;  2KWC A;  3PLU A;  1WXM A;  2R2Q A;  2KX3 A;  1EUV B;  1SE9 A;  1FXT B;  1XT9 B;  2KNB A;  2KTF A;  3T9L A;  2JRI B;  1T0Y A;  2Z0E B;  3T8M A;  3H7P A;  1UGM A;  1UBQ A;  3RYT A;  2B3A A;  2MP2 B;  2V1Y A;  3CF6 E;  3PHX B;  2D10 A;  2N9P C;  3A9J B;  1D3Z A;  4JLC A;  2AWT A;  2MSE D;  2DZJ A;  3KUZ A;  4I6P A;  3Q3F A;  5J2R A;  4IWO A;  2V4L A;  3QWZ B;  1V81 A;  4IWP A;  3LJ3 A;  2K6Q A;  4FJZ A;  1V49 A;  3B08 A;  5DPT A;  2NBW B;  2LVO A;  3ZUN A;  4DHJ B;  2ZNV C;  3QHT A;  4JGH B;  5FR6 A;  2KQS A;  1OQY A;  4GB9 A;  1I42 A;  3PZD A;  5JHB A;  3WA0 A;  4G11 A;  1WGG A;  2L7R A;  3N30 A;  2C60 A;  1J8C A;  1WF9 A;  3A33 B;  2IBI B;  3QK0 A;  1SGH A;  1WX9 A;  1SIF A;  2NS5 A;  4NQK E;  2LWP A;  2KC2 A;  1Y8R C;  2N1W A;  1AAR A;  2RGF A;  4IM0 A;  4K7U A;  2BKF A;  3VHT C;  1L7Y A;  2MCN B;  3L08 A;  1IP9 A;  3HM6 X;  2O6V D;  4GMV A;  1WMH B;  1Q5W B;  2AL3 A;  2QHO A;  5CHV C;  4B9K A;  5EDS A;  2KDI A; 
#chains in the Genus database with same CATH topology
 1L2N A;  5G5H A;  1LXD A;  4P7I A;  1JML A;  1RFA A;  1S1Q B;  1WXS A;  3FAH A;  3U52 E;  2N7E A;  1GB1 A;  3DBL I;  2Y5P A;  4A8X C;  1TKY A;  1UWX A;  2SAK A;  2SEB D;  4DDG D;  4IM2 A;  4JWU C;  3GOE A;  4GIV A;  2NTT A;  4GDK A;  4URK A;  1UEL A;  2L0F A;  3H9D A;  3W1S A;  1ZP0 B;  3A9K A;  4OVU A;  4A20 A;  3OWE B;  1B1Z A;  3LXF A;  3DHH C;  1QZE A;  1WJ6 A;  3RUI B;  1GB4 A;  2J52 A;  4YSX B;  3MHS D;  1TZ1 A;  5G2N A;  2KHW B;  4FXC A;  3W1S C;  2PW9 A;  2KAC A;  3MFG A;  1I4X A;  3MTN B;  1SIJ A;  3HIZ A;  2W3R A;  4JWS C;  3WAL A;  4M8M A;  2K25 A;  1JRO A;  3AB5 A;  4XX5 A;  2MJ3 A;  3OJ3 A;  2WX1 A;  3GP7 A;  3P4P B;  3QQ8 B;  3IAS 1;  4DXG A;  3R7R A;  4WUR A;  4FLH A;  3PS6 A;  5C3J B;  2ZCB A;  2WXM A;  1F52 A;  4TV3 A;  1P7E A;  1E7P B;  2LHD A;  2ZEQ A;  1TKG A;  2KDF B;  5BYR A;  2NPT B;  4N6E B;  2WX0 A;  5D3I B;  2WXQ A;  1YMH E;  1J19 A;  2K39 A;  3MJW A;  2JRH A;  2FE8 A;  5MPO A;  3W1Y A;  1V1P B;  2XK5 A;  1E10 A;  2ZPY A;  4IKG A;  4LNI A;  3IBE A;  4WWO A;  3N32 A;  3V60 A;  1ENF A;  2KX0 A;  4A6Q A;  1FXI A;  4YSY B;  1I4Q A;  2KYW A;  1I7H A;  1EU3 A;  1V86 A;  2INN E;  2IO0 B;  3D32 A;  2R61 A;  3KQ4 A;  4G0N B;  3VUX A;  4J6I A;  1SXT A;  3QAQ A;  1CZP A;  1GOZ A;  4HKQ A;  2H89 B;  1TY2 A;  4CHK A;  4ICV A;  5FKA C;  2QCZ A;  3L0W B;  5JH5 C;  2ON8 A;  3H8H A;  4G3X B;  5DCN A;  1S3S G;  1MHH E;  4L1B A;  3C0R B;  3TEW A;  2CR5 A;  3MC9 A;  3U7D A;  3RZW C;  3ETR A;  1SE3 A;  2JPH A;  3BIN A;  4YTN B;  1A70 A;  3VR8 B;  3ZKJ C;  1HXY D;  3QAR A;  2MRP A;  3QC8 B;  1C78 A;  2D5G A;  2DX5 B;  3W9C B;  2WXL A;  3ZLZ A;  1WRI A;  2ASQ A;  1ZW7 A;  1GC6 A;  3SDL C;  1C4A A;  1V2Y A;  4C7Z A;  3ALB A;  4HWI B;  2JYE A;  3GB1 A;  5D3D A;  3VFK A;  3RPF C;  1TY0 A;  1I4H A;  2JUO A;  4AUQ C;  5LXI B;  4LJP B;  4WWN A;  2MW5 A;  4ZRI A;  3AE9 B;  2JF5 A;  3RN9 C;  4LDT D;  3Q3N C;  3N1X C;  3LDZ E;  5HKH A;  2BYT A;  1BXT A;  2FCN A;  2LGY A;  1LQB A;  3KWL A;  3UIP B;  2E3T A;  3BZD B;  4L2Y A;  2MJD A;  1KJT A;  2WXG A;  2Z0D B;  4XC2 A;  1IYF A;  4RM8 A;  4GDL B;  3SHQ A;  5EE9 A;  1HE8 A;  4YTM B;  3VQI A;  3TL5 A;  2LMC A;  4HPP A;  1LFD A;  1OGW A;  4FJV B;  2DYB A;  2GBK A;  2MQJ A;  3PV1 A;  4N9F 4;  2KTR B;  1N62 A;  2QIL A;  2N7J A;  1XXG A;  1WR6 E;  1V9J A;  3U8Z A;  2DZK A;  3DDC B;  2WXO A;  4M01 A;  1FFV A;  2BYF A;  1WY8 A;  1MFW A;  1D4B A;  1YNT E;  1YJ1 A;  2MWS B;  1WGH A;  2ICI A;  2J4X A;  1XLN A;  3B0A A;  2B76 B;  2O6V A;  3NOB A;  1TBE A;  2KWD A;  3DVN V;  4XE0 A;  2Y3A A;  2JZZ A;  4WJQ A;  1L0V B;  2M1M A;  4F7Z A;  1Z2M A;  3QA8 A;  4MJS A;  3MHZ A;  2LJI A;  3SFE B;  1PYW D;  4II3 B;  2DNF A;  1UH6 A;  2M19 A;  4MEM A;  4K7S A;  3KLS X;  2QSD A;  4E74 A;  2MBH A;  3ZTD A;  3IAM 1;  2LUE A;  3WIM A;  4WAA A;  3H6N A;  4P16 A;  4ZRQ A;  4ICU A;  1LO5 D;  1V97 A;  1XEE A;  3N1Y C;  4PYU A;  5AZG A;  4C80 A;  3BVZ A;  1FRD A;  1M94 A;  3H7S A;  2G9H D;  5GMV A;  1YJJ A;  2KT7 A;  2IDY A;  4C4V A;  3M3J A;  4DBG A;  3DHI C;  4XDC A;  1I35 A;  5BMH A;  3IT4 B;  2UYZ B;  3ZVV A;  1HQR D;  1TYG B;  3JSV A;  3AMZ A;  1JWA D;  4XYC A;  5AZF A;  3UQB A;  3FKY A;  5H8Y E;  4BBN C;  1Q10 A;  2MP2 A;  3UIN B;  2O2V A;  4WH4 A;  3W2D A;  1WJ4 A;  4MAC A;  1C79 A;  4XWT A;  1UZX B;  1GC7 A;  2N1V A;  2XEW A;  5AUI A;  4HPM B;  3TMP B;  3BK1 A;  2WXP A;  1V80 A;  3HM3 A;  2KJH B;  2DBY A;  2J0J A;  2PKO A;  1Q1O A;  2BWE S;  1ESF A;  1XCQ L;  4YWG G;  1T6B X;  2PJH A;  1EU4 A;  2FAZ A;  1U4A A;  3N1Z C;  2DYM A;  2CJO A;  5CX3 A;  3EC8 A;  3NVY A;  4GDK B;  3RNG C;  1VZ7 A;  2WLB A;  2LRU A;  5LLI A;  3TEZ A;  1NEK B;  1MHX A;  3A9K B;  2J42 A;  4HXD A;  3SD5 A;  2G3Q B;  2KWC A;  3ABV B;  1ZE3 D;  2KNB A;  2JRI B;  1T0Y A;  3DBH B;  2B3A A;  3CF6 E;  2WXH A;  4PK1 A;  1IGC A;  4JLC A;  2AWT A;  2BW2 A;  2DZJ A;  2MSE D;  4OW0 A;  1ZUD 2;  1PGA A;  3AEE B;  3Q3F A;  4WQM A;  2V9H A;  4IWO A;  1CK1 A;  1V81 A;  3CIR B;  5DPT A;  2ZNV C;  4WWM A;  2WDQ B;  2KQS A;  3PZD A;  1WGG A;  2C60 A;  4TMA B;  2IJ0 A;  1SGH A;  3NG0 A;  3AE7 B;  2KC2 A;  1Y8R C;  1AAR A;  4IM0 A;  3VHT C;  1L7Y A;  1UWM A;  2AL3 A;  1Q5W B;  2QHO A;  2KDI A;  1PUT A;  3PRP B;  2GB1 A;  1WX8 A;  1HA5 A;  2JXT A;  1JRP A;  1WSP A;  5HHD G;  3Q8B A;  3NZS A;  2XNA C;  2GI9 A;  3H7P B;  3NVV A;  4DXA B;  4II2 B;  5L83 A;  4FA6 A;  1E9M A;  2FCQ A;  4FJY A;  4ASW C;  1E7V A;  2K22 A;  3URY A;  2IY0 B;  3ZTC A;  2J0K A;  3WAM A;  3M62 B;  4RF1 A;  1E8X A;  4YTP B;  4A9A A;  3L4P A;  2Y5C A;  5HI1 A;  4GXB A;  5IA7 A;  3I3T B;  5JZE B;  2KXJ A;  3AE2 B;  3EUB 2;  1WIA A;  3BWU D;  2JWZ A;  3ZIM A;  3BYY B;  3TEY A;  5DPW A;  3W5V B;  2WXF A;  1EF5 A;  2JU6 X;  3HVZ A;  4W9G A;  1FCC C;  3DBH I;  2IY1 B;  4BKG A;  4N58 A;  1UGJ A;  1SJE D;  1RM6 C;  2IZV B;  1WGY A;  3EHV A;  4LJO B;  4WJN A;  2WS3 B;  4W9C A;  1XLO A;  2MX2 A;  2RDB C;  1TT5 B;  2N9L A;  4XDD A;  3JVZ X;  3QJZ A;  3WCQ A;  1E8Y A;  2LAS A;  3PGE A;  4CYE A;  2I1J A;  2Y5B B;  1VZ8 A;  4PS7 A;  3DPD A;  3RI7 C;  4RFB A;  5J17 A;  4DHJ D;  4KDL B;  3V3X A;  4ACF A;  2CU1 A;  2MBB B;  3MP9 A;  2CU3 A;  1ZDV A;  4LLG M;  1WWT A;  2KDE B;  2EKE C;  1V6E A;  1HEZ E;  3VTW A;  1BUI C;  4HK2 A;  4M0W A;  1WXA A;  4A3O A;  4DXF A;  5BMI A;  3VTU A;  1EF1 A;  2GMI C;  4A55 A;  4BOS C;  3UIO B;  4IWQ A;  5AZH A;  1C4C A;  1TGZ B;  2IND C;  4WJP A;  5E6N A;  1ZXI A;  2DZM A;  2KFK A;  1L0X B;  2WU5 B;  1MJD A;  1N5X A;  2CHW A;  2BQQ A;  5IAA C;  1ET6 A;  2BBC A;  4RH6 A;  5DPR A;  4DHZ E;  3UQA A;  1NEN B;  3AEF B;  1IPG A;  5E6O A;  1Y56 A;  2CKH B;  3V62 A;  1SB3 C;  2DEN B;  1GJZ A;  1YN5 A;  1VDV A;  2LVP A;  4ZRK A;  1PGX A;  4NNJ B;  3LYY A;  3AE3 B;  3SFD B;  4CQN A;  3KUD B;  3HK0 A;  1FO4 A;  3A1Q A;  4FBJ B;  2EEL A;  1IGD A;  2WDT B;  4KVG B;  2CJN A;  2O6V B;  2N0S B;  1T0S C;  3O13 A;  4BKT A;  4KZC A;  1V5T A;  1F9J A;  1AW7 A;  2OED A;  3NUH B;  4KSK C;  1TTN A;  2AL6 A;  2A4Z A;  3J9C A;  3I57 A;  1HTO A;  2LGS A;  3R3M A;  1ZKH A;  2D3B A;  3Q3J A;  1FRR A;  1KFY B;  4EE2 A;  4B6W A;  4IG7 B;  1E90 A;  4BKS A;  4LNF A;  4K7W A;  1TIF A;  2BKR B;  1UUP A;  5LXH A;  3PRE A;  2RSU A;  4ANU A;  3VUY A;  3KUC B;  2M4N A;  2D07 B;  4KIK A;  4TKN A;  1Q0W B;  4NQL B;  3AI5 A;  1VCB A;  2V4I B;  4C4V B;  2WU2 B;  3JSV B;  2KLG A;  3B1L X;  3TJP A;  4MGK E;  3X0W A;  1SEB D;  1DOY A;  2QJL A;  2BPS A;  2MH7 A;  2O2V B;  4S17 A;  2PPH A;  4WWP A;  1UD7 A;  4AJW A;  2DYO A;  3PRZ A;  1X1M A;  5BO4 B;  2A5U A;  3ML9 A;  3V6E B;  4TQ1 A;  1JRU A;  4PT5 A;  1BML C;  1N63 A;  2KOX A;  1KLG D;  3R7Q A;  1TS4 A;  4B0E A;  3APD A;  2KFJ A;  3QIJ A;  1KTK A;  4Q2J A;  2KQ7 A;  3N20 C;  5EE3 A;  3DBS A;  1RWS A;  3UF8 A;  3NZU A;  2AEH A;  3U7Z A;  4NAW A;  2G4S A;  3KYD D;  1XD3 B;  2ZNV B;  3Q14 C;  3V61 A;  3T3N A;  1NYQ A;  4MM3 B;  3ZXV A;  1C3T A;  3N9Y C;  1GPX A;  2DHZ A;  5E6J A;  4ANX A;  2GBM A;  2QEJ C;  1R4M B;  2JWU A;  1C9F A;  4ZHO A;  1H4R A;  4RGO S;  3QCA A;  2W82 A;  2WGS A;  4FAD A;  1GAQ B;  3AEC B;  3QX1 A;  4IUM B;  1T3Q A;  1KH0 A;  2NBV B;  4W9H A;  4USA A;  1UBI A;  2V0G A;  1JWM D;  2ZW0 A;  2QDF A;  2GRI A;  1H8C A;  2RPQ A;  3Q8C A;  1WXV A;  5AEK B;  4KZ0 A;  1N60 A;  4HCN B;  4GN1 A;  1IBX A;  1PQS A;  3OAW A;  4BVU C;  1YQB A;  2K1F A;  2KC1 A;  4BAX A;  2GBR A;  1QOB A;  1TS2 A;  2C7M B;  4ZYS A;  2WDR B;  4BBN F;  1P3Q U;  4DDI D;  3V05 A;  4UDU C;  4KX6 B;  2NBU A;  1UF0 A;  1WMH A;  2DZI A;  2KMC A;  3ZRF A;  2N9K A;  4C7Y A;  3PLU A;  1WXM A;  2R2Q A;  2KX3 A;  4ITK A;  1SE9 A;  1FXT B;  1XO3 A;  1XT9 B;  4BZA A;  5IP4 D;  3C8Y A;  2Z0E B;  1VLB A;  3RYT A;  1CJE A;  2N9P C;  2YEP B;  1D3Z A;  1P7F A;  4I6P A;  3OG5 A;  1L5P A;  4IWP A;  3B08 A;  1FFU A;  2LVO A;  4DHJ B;  1KRH A;  1I42 A;  4GB9 A;  5JHB A;  3FIL B;  3N30 A;  4G11 A;  3BYT B;  1J8C A;  3R2T A;  2IBI B;  3QK0 A;  3ZYY X;  1WX9 A;  1SIF A;  4NQK E;  3MC0 B;  1QOF A;  4K7U A;  2MCN B;  2PMV A;  3HM6 X;  2O6V D;  4B9K A;  5EDS A;  3P1M A;  1VRA B;  1DYQ A;  1WE6 A;  1MG8 A;  1VR9 A;  2IGD A;  3NVW A;  1G6J A;  3RNE C;  3AEB B;  1FNU A;  1WJN A;  3OLM D;  4AP4 C;  2M17 A;  3VH3 B;  1C4P A;  4IDI A;  4RM9 A;  1DOI A;  1N5W A;  4NJ6 A;  5IKC M;  2WXN A;  4M0W B;  3MC8 A;  3ZJU A;  1J7B A;  3EGR A;  4I6N B;  1YD8 U;  2BB6 A;  4A90 A;  1J7C A;  4K81 A;  1ZOY B;  3NVZ A;  3Q69 A;  2TSS A;  2BYE A;  1ZXH A;  5D7G A;  1PGB A;  4GSW A;  2BTE A;  4WJO A;  2WXI A;  2KFK B;  4JL9 A;  1WI0 A;  4M8N A;  3A9J A;  3PZ7 A;  2RDG A;  3PLV A;  5D6J B;  1SJH D;  1V1O A;  3VR9 B;  3P4R B;  2KJ6 A;  4B0M A;  1FNW A;  4MH0 E;  4DHZ B;  4LCD E;  4FUL A;  4HEA 1;  3AE6 B;  4D2K A;  1V5O A;  1WGD A;  3K9O B;  1D6E C;  2DAJ A;  4AWJ A;  2JQR B;  1P1A A;  3DVN U;  2C7H A;  3PVL A;  2L76 A;  1M4V A;  4GLS C;  2W9N A;  3AM9 A;  1NI2 A;  2N9X A;  1WM2 A;  3A1Q B;  2J7Q B;  3AV8 A;  3ZGZ A;  1ET9 A;  4HKZ E;  4QAY A;  4AOF A;  2EMT A;  2HJ8 A;  2J53 A;  2K0P A;  2YEP F;  5D2M B;  4ARI A;  2KVZ A;  3ZO5 B;  1F2R I;  1PFD A;  1WM3 A;  3HUI A;  2QC8 A;  4WQO B;  4YSZ B;  2K8C A;  4HRS A;  1XQQ A;  2G45 B;  3AE4 B;  1MG4 A;  1ACC A;  3ZQ4 A;  1K52 A;  1L4Z B;  5I4D A;  2JVC A;  2LXA A;  1JW9 D;  4W9I A;  4M02 A;  4RF0 A;  2KO3 A;  3CST A;  3BY4 B;  4E71 A;  1ZPS A;  1LM8 B;  1NVI D;  2LRW A;  2LXC A;  2LJ5 A;  3DBR B;  4B95 A;  1JWB D;  1NI3 A;  5BMG A;  3VRB B;  2L0T A;  3E56 A;  1JWS D;  1WYG A;  2NCN A;  1KM7 A;  1IUE A;  1F0Z A;  3ZNG C;  4NJ7 A;  4I6L B;  3KWV A;  4G50 A;  1TKE A;  2UWQ A;  4KIK B;  3RNB C;  5C1Z A;  3DVG Y;  2PIA A;  1STE A;  4OHJ A;  2BS3 B;  2K9X A;  3H1U A;  5CHF A;  1WZ3 A;  2AQ3 B;  2D3A A;  2XK5 B;  3TCA A;  4HPL B;  3TIX A;  2HTM E;  4GDL A;  3RT3 B;  4PS3 A;  3M95 A;  3KW5 B;  4ZDV A;  3S2A A;  1KOT A;  2G1E A;  2JZP A;  3L54 A;  2PVO D;  2OHF A;  5H92 C;  2W55 A;  5JHA A;  4HCP B;  2CS4 A;  3HHM A;  3ZJV A;  5G55 A;  2NR2 A;  3P63 A;  2ZVN A;  2XBB C;  5FR3 A;  2VRR B;  3P2B A;  2REX A;  3A4R A;  1F1H A;  3V6C B;  2KMA A;  4OZC A;  3NS1 A;  1MI0 A;  1OTR B;  3Q8E A;  2ZJD A;  3EFC A;  4YL8 A;  3JYU A;  1VD2 A;  2AYO B;  4DK5 A;  2PEA A;  3N3K B;  1LGR A;  2JY6 A;  2YLM A;  4NAW B;  1T0R C;  2C7N B;  4MH8 A;  2KLC A;  4NJC A;  2L05 A;  3KYC D;  3TEX A;  2JZ3 B;  2FCM A;  4YT0 B;  4KV2 A;  3DBR I;  3K9P B;  4OZA A;  2K6D B;  4X57 B;  1V8C A;  3U4E G;  3AU4 A;  4LNO A;  1YN4 A;  2GLS A;  3AEG B;  2ZVO A;  1RAX A;  5EE0 A;  4FHJ A;  3RZF A;  2NVU I;  2LD9 A;  2Q5W D;  1YQ4 B;  1WR1 A;  2VH1 A;  4ANV A;  4NY0 A;  2WHI A;  3RNC C;  2BB5 A;  1E8Z A;  4LNN A;  4P1C C;  4K3B A;  4ZOH C;  4CO7 A;  2MEK A;  1FNV A;  2KN5 A;  4BOZ B;  2L8J A;  5C23 A;  4RGT A;  4TQ0 A;  1YX5 B;  1FD6 A;  5CTR C;  3BK2 A;  3NRZ A;  3SU8 X;  1NYR A;  2K8H A;  1A5R A;  1B9R A;  1YOV B;  3DCG A;  1QLB B;  2VH2 A;  2WP9 B;  1K50 A;  4F1S A;  3AH7 A;  4AS1 A;  4J3O D;  3AED B;  2MBQ A;  2KD0 A;  2V3S A;  1QF6 A;  1FPY A;  3HVD A;  4K3C A;  3VTV A;  4GGQ A;  1ISN A;  2ACZ B;  2LFI A;  3WAP A;  4W9F A;  3LB8 C;  5LNK 1;  1N6Z A;  4KGR A;  1QOA A;  4NPN A;  4KSL C;  2D11 A;  1AYF A;  5L95 C;  1RYJ A;  1QT9 A;  4EEW A;  2M0A A;  3EEC A;  4JX1 C;  1GNU A;  2FID A;  4S0R A;  1EWC A;  2WXJ A;  4KDI C;  1L4D B;  4XWW A;  4MT5 A;  3VUW A;  1J0G A;  3NZ3 A;  1F77 A;  1RRB A;  2WDV B;  3NJT A;  4W9K A;  2KKC A;  4MJS B;  2PVG C;  2IGH A;  1CQV A;  3CWI A;  1C76 A;  3CSF A;  3CMM B;  5HG2 A;  2KAN A;  2JSV X;  2M56 B;  3PTF C;  1T0Q C;  2RPV A;  5CHW A;  2L52 A;  2J0M A;  3L16 A;  2BT6 A;  2LI5 A;  4EFO A;  1WX7 A;  4E3C A;  2PE6 B;  2L00 B;  4WIP A;  2OOB B;  4ANW A;  2MJE A;  2LGX A;  3SEB A;  3EFU A;  1VZ6 A;  3GE8 C;  2L3Z A;  4RGM A;  2BS2 B;  4AQ7 A;  3ENE A;  3APC A;  1N61 A;  1K51 A;  1FIQ A;  3AU5 A;  3ZNH B;  1D5M C;  4BKS D;  2D2Q A;  2E6X A;  2FUG 1;  1WRD B;  5D94 A;  3DWG C;  3EA6 A;  2WWZ A;  2L32 A;  1HZ5 A;  2IYD B;  3C19 A;  2BGF A;  4US9 A;  3IVF A;  2JX5 A;  4C00 A;  3PO0 A;  1SSN A;  4HVB A;  1EO6 A;  5EE1 A;  2K3U A;  1EUV B;  2KTF A;  3T9L A;  3UI3 A;  3H7P A;  1UGM A;  1UBQ A;  2V1Y A;  2MP2 B;  2D10 A;  3A9J B;  3KUZ A;  4XGA B;  2DWQ A;  3GS2 A;  4KGS A;  5J2R A;  2V4L A;  3QWZ B;  2IGG A;  1V49 A;  2KN4 A;  2NBW B;  4H2A A;  1E0Z A;  3QHT A;  4JGH B;  5FR6 A;  3W5U B;  3B2G A;  1OQY A;  4LK0 M;  1WXQ A;  3R8B A;  1C77 A;  2JYT A;  2LWP A;  4JPS A;  2RGF A;  3AE8 B;  1IP9 A;  3I5J C;  5CHV C;  1JWU D;  3WA0 A;  2MLB A;  3JW0 X;  1AN8 A;  1T5X D;  1QQR A;  4KKI A;  4MDK E;  1GUA B;  1KF6 B;  4A3P A;  3IHP C;  3RD2 A;  2KDB A;  2FIF A;  1ZDX A;  1L6V A;  1YN3 A;  3PSE B;  5KHQ A;  2DLB A;  2H88 B;  2WXR A;  3E9S A;  5BYQ A;  1TZO A;  2VZK B;  5GXG B;  2BYV E;  1FEH A;  2KAJ A;  4EZL A;  3AE1 B;  2KMM A;  2AX5 A;  3AXC A;  4TSS A;  4IW0 A;  1XLP A;  2R2O A;  3FC4 A;  4FN2 A;  2JT4 B;  2KVR A;  5E6P A;  1SE2 A;  2ZCC A;  4R3D A;  3M63 B;  4N59 A;  2OJW A;  2G4D B;  3WAO A;  2N4F A;  2X38 A;  1KLU D;  4ZHP A;  1XF5 L;  3ZDM C;  5JXV A;  3L17 A;  1QOG A;  2ZPN A;  3IXS A;  2PLP A;  5IN7 A;  1QKZ A;  3IT6 B;  3TBL D;  3BII D;  2RR9 A;  4ZRJ A;  4EZJ A;  3PPA A;  1FMA D;  2FUH B;  1C1Y B;  2DAF A;  2IO1 B;  4W9E A;  1RFK A;  3VVW B;  4HJG E;  3BVG A;  2INC C;  1K8R B;  3L10 B;  2MA9 B;  1HZ6 A;  2HJ1 A;  2FCS A;  4NZL B;  1J7A A;  2CHX A;  2CHZ A;  5G5G A;  1NBF C;  3RUL A;  4REZ A;  4LTU A;  1WH3 A;  1TJE A;  4W9J A;  2KDM A;  3SR6 A;  1FXA A;  3Q3O C;  3ZW3 A;  2LZ6 A;  2M0X A;  2BWF A;  2KJR A;  3P4Q B;  2AQ1 B;  1GG3 A;  1RLF A;  1KLV A;  2WNM A;  3GE3 C;  5T8I A;  5IOI A;  3I9V 1;  4RMA A;  4W9D A;  2EMS A;  4XZ4 A;  2ONQ A;  3KH0 A;  1NDD A;  1R4M I;  2HTH A;  1E8W A;  2NTS A;  1WJU A;  2WYQ A;  4YXD B;  2N7D A;  3ZNI D;  2I2Y A;  2KWU B;  2I1K A;  3Q8F A;  1P98 A;  5J18 A;  1JAL A;  1FM0 D;  2WXK A;  1WE7 A;  4EUT A;  2LUM A;  3R2I A;  1QIL A;  1YIW A;  3VH4 B;  2K8B A;  4PYZ A;  2N9E B;  3RNF C;  3GZN B;  1P0R A;  1R4N B;  3AUL A;  1WZ0 A;  2Z59 B;  4GU2 A;  3IG3 A;  2LVQ A;  3NS8 A;  3WAN A;  2IPK D;  2GBJ A;  3ZNZ B;  2OJR A;  2WQY B;  3KVF B;  3VXW A;  2BF8 B;  2XN9 C;  4PS8 A;  3ZJT A;  3ZXR A;  1WGR A;  4ZYN A;  1E5W A;  2HD5 B;  2NPT A;  2FNJ B;  3TUO A;  1AWD A;  1YJI A;  2M8S A;  2AQ2 B;  5TSS A;  3ONS A;  3U2S C;  2L1A A;  2YVC A;  1JCK B;  1EM7 A;  1V1P A;  4JQW C;  4OVZ A;  2KZR A;  2L83 A;  4HDQ A;  4EZK A;  4W9L A;  3VAW A;  1XCT L;  3NHE B;  3P4S B;  5AUK A;  3X23 A;  1TS3 A;  3AEA B;  1Z5S B;  3VDZ A;  1OQQ A;  2IO3 B;  2ZZP B;  2W3S A;  1PDX A;  3MJ5 A;  4DWF A;  3Q8A A;  1I4G A;  4MSQ B;  2D3C A;  3TSS A;  4M00 A;  1YX6 B;  2HE7 A;  5TR5 A;  4NAM A;  1VJK A;  2V3P A;  3L13 A;  4IM3 A;  1SBB B;  1WGK A;  2K5P A;  3B9J A;  2GOW A;  4HLE A;  3P42 A;  4OZB A;  4JIO U;  3GZN I;  3APF A;  1R4N I;  2QIE B;  5C2T B;  3PHW B;  3UGB B;  1DOX A;  3BVM A;  2BVC A;  2LGD A;  4BFR A;  4MM3 A;  1L0Y B;  1YQ3 B;  3RMK C;  3ZDT A;  3T3O A;  3PRM B;  1D5Z C;  3OJ4 B;  3Q3M C;  2VZK D;  5DPS A;  4DQO C;  3IFW B;  2MBO A;  3DVG X;  3R66 C;  2RDH A;  3VRA B;  2C9W B;  4HJK A;  2BS4 B;  1OEY J;  4RCO A;  4ZRP A;  1FCL A;  1SF0 A;  2UU7 A;  4GOC A;  3DOW A;  2IO2 B;  4JE3 B;  1K53 A;  3HRD D;  4EKU A;  4OVV A;  4IC7 B;  1P9D U;  5IO9 A;  2Z8L A;  3ML8 A;  3DHG C;  3A4S C;  4K1R B;  2KQ4 X;  4LNK A;  4RGN A;  4ARC A;  1R7S A;  4MGZ E;  4L23 A;  4F8C B;  3ECI A;  5FK9 C;  4EOY A;  4P1B C;  1E7U A;  2W54 A;  4AJY B;  1OEY A;  4MGI E;  4MGY E;  2GBN A;  2JXX A;  4HDO A;  3PZ8 A;  1WYW B;  3RFZ B;  3AE5 B;  2KWV B;  2KTR A;  2QMT A;  4HRO A;  1I4P A;  1OFF A;  1L6U A;  2LEK A;  4MEL A;  1UNS A;  4TUU A;  3I63 C;  1XLQ A;  2PE9 A;  1MVK A;  4IOI E;  1CMX B;  3AN1 A;  1WFY A;  3NY5 A;  2MHJ A;  4US8 A;  1MPE A;  1BT0 A;  3DBL B;  3O65 B;  2NMQ A;  3RNA C;  5BYS A;  4MSM B;  3DQV A;  1TS5 A;  2KK8 A;  4RNA A;  2PTL A;  2RD0 A;  3FIL A;  1ROE A;  4FHK A;  1HTQ A;  1JQ4 A;  3B2F A;  2MBE A;  1ZGU B;  2LGI A;  1EWY C;  3ZRC A;  5KHO A;  3PT2 B;  3U30 A;  2C5L C;  4LDT B;  4P6V F;  3RCZ A;  3Q2A C;  3Q6B A;  2INP E;  3DWM A;  3T8M A;  2X8X X;  1E6E B;  3PHX B;  1I4R A;  2LHE A;  1IBX B;  1F2R C;  2K6Q A;  3LJ3 A;  4FJZ A;  2ZW1 A;  1D5X C;  2RMM A;  2HDE A;  2FBW B;  3ZUN A;  2EKI A;  1SE4 A;  4WAF A;  4KKJ A;  4KGT A;  2L7R A;  5HFY A;  2V3N A;  1WF9 A;  4O1N A;  3A33 B;  2NS5 A;  2N1W A;  4C56 C;  2BKF A;  1OQR A;  1DGJ A;  3L08 A;  2I38 A;  4GMV A;  1WMH B;  2D3G A; 
#chains in the Genus database with same CATH homology
 1L2N A;  2MLB A;  3JW0 X;  3PRP B;  1WE6 A;  1WX8 A;  1MG8 A;  1LXD A;  4MDK E;  4P7I A;  1RFA A;  1WXS A;  1S1Q B;  1GUA B;  1G6J A;  4A3P A;  3NZS A;  3IHP C;  3RD2 A;  2KDB A;  2N7E A;  3H7P B;  2FIF A;  4DXA B;  3DBL I;  4II2 B;  1WJN A;  5KHQ A;  3PSE B;  5L83 A;  4FA6 A;  3OLM D;  4AP4 C;  2FCQ A;  2M17 A;  4FJY A;  3VH3 B;  4ASW C;  1E7V A;  4DDG D;  2IY0 B;  3ZTC A;  2J0K A;  4RM9 A;  3WAM A;  2BYV E;  4EZL A;  3M62 B;  4IM2 A;  1E8X A;  4NJ6 A;  3AXC A;  3GOE A;  4IW0 A;  4GIV A;  4M0W B;  2R2O A;  4GDK A;  4GXB A;  4FN2 A;  2JT4 B;  2KVR A;  3I3T B;  4URK A;  5E6P A;  1UEL A;  5IA7 A;  2L0F A;  5JZE B;  3H9D A;  3W1S A;  2KXJ A;  2ZCC A;  4I6N B;  1YD8 U;  3A9K A;  4OVU A;  4A20 A;  3M63 B;  1WIA A;  4K81 A;  2G4D B;  3WAO A;  1QZE A;  2JWZ A;  2N4F A;  1WJ6 A;  3RUI B;  2BYE A;  3MHS D;  1TZ1 A;  5G2N A;  5D7G A;  4GSW A;  3ZIM A;  2KHW B;  3ZDM C;  4WJO A;  5DPW A;  3L17 A;  2D3G A;  1EF5 A;  2ZPN A;  2KFK B;  4JL9 A;  1WI0 A;  4M8N A;  3A9J A;  3PLV A;  5D6J B;  3W1S C;  4W9G A;  3TBL D;  2KJ6 A;  2RR9 A;  4ZRJ A;  3DBH I;  2IY1 B;  4MH0 E;  3MTN B;  3PPA A;  4LCD E;  4BKG A;  4DHZ B;  4FUL A;  4EZJ A;  2FUH B;  1C1Y B;  3HIZ A;  2DAF A;  2IO1 B;  4W9E A;  3WAL A;  2IZV B;  4M8M A;  3VVW B;  1V5O A;  1WGD A;  2K25 A;  3K9O B;  1WGY A;  3EHV A;  4LJO B;  4WJN A;  2DAJ A;  4W9C A;  1K8R B;  3L10 B;  4AWJ A;  2MA9 B;  2MX2 A;  4XX5 A;  3OJ3 A;  2FCS A;  2WX1 A;  1P1A A;  3QQ8 B;  2CHX A;  2CHZ A;  3JVZ X;  3R7R A;  3DVN U;  1NBF C;  2C7H A;  3PVL A;  3RUL A;  4FLH A;  3QJZ A;  3PS6 A;  1WH3 A;  2L76 A;  4W9J A;  1E8Y A;  2LAS A;  2ZCB A;  3PGE A;  4CYE A;  2I1J A;  2W9N A;  2Y5B B;  3ZW3 A;  4TV3 A;  2LZ6 A;  1NI2 A;  2N9X A;  2M0X A;  1WM2 A;  3A1Q B;  2J7Q B;  2BWF A;  2KJR A;  4PS7 A;  3DPD A;  2ZEQ A;  1GG3 A;  5J17 A;  4AOF A;  4DHJ D;  2EMT A;  1RLF A;  4KDL B;  2KDF B;  2HJ8 A;  2NPT B;  2CU1 A;  5D2M B;  2MBB B;  2WX0 A;  3ZO5 B;  1KLV A;  1WM3 A;  1J19 A;  2K39 A;  2KDE B;  4WQO B;  2K8C A;  3MJW A;  1XQQ A;  2G45 B;  2EKE C;  2JRH A;  1V6E A;  3VTW A;  4RMA A;  4W9D A;  3W1Y A;  2EMS A;  2XK5 A;  4HK2 A;  4XZ4 A;  3KH0 A;  1NDD A;  2ZPY A;  1R4M I;  1WXA A;  4A3O A;  2JVC A;  2HTH A;  2LXA A;  1E8W A;  3IBE A;  4WWO A;  3VTU A;  3N32 A;  4W9I A;  1EF1 A;  2GMI C;  4BOS C;  3UIO B;  2KO3 A;  4IWQ A;  1WJU A;  2WYQ A;  5AZH A;  3V60 A;  3CST A;  2KX0 A;  3BY4 B;  4E71 A;  1LM8 B;  2LRW A;  2N7D A;  3ZNI D;  2LXC A;  1TGZ B;  2KWU B;  2LJ5 A;  2I1K A;  4B95 A;  1V86 A;  4WJP A;  5E6N A;  2IO0 B;  2DZM A;  2KFK A;  1P98 A;  3D32 A;  2L0T A;  4G0N B;  3VUX A;  4J6I A;  5J18 A;  2NCN A;  1KM7 A;  3QAQ A;  1WE7 A;  2CHW A;  5IAA C;  3ZNG C;  4EUT A;  4NJ7 A;  4I6L B;  4CHK A;  5DPR A;  1YIW A;  4G50 A;  4ICV A;  3VH4 B;  4DHZ E;  2UWQ A;  4KIK B;  2K8B A;  3UQA A;  3L0W B;  4PYZ A;  2N9E B;  5JH5 C;  1IPG A;  5E6O A;  4G3X B;  5DCN A;  1S3S G;  5C1Z A;  1P0R A;  3AUL A;  2CKH B;  3C0R B;  1WZ0 A;  3DVG Y;  2Z59 B;  4GU2 A;  2CR5 A;  3U7D A;  3V62 A;  3IG3 A;  2LVQ A;  3NS8 A;  3RZW C;  3WAN A;  2JPH A;  3BIN A;  3H1U A;  5CHF A;  2DEN B;  1WZ3 A;  1GJZ A;  2GBJ A;  2XK5 B;  2LVP A;  4ZRK A;  3TCA A;  4NNJ B;  4HPL B;  3ZNZ B;  2OJR A;  3KVF B;  3TIX A;  3VXW A;  4GDL A;  2BF8 B;  3RT3 B;  4PS3 A;  3KUD B;  3HK0 A;  3M95 A;  3KW5 B;  3QAR A;  2MRP A;  3QC8 B;  4PS8 A;  3S2A A;  3ZKJ C;  4ZDV A;  1KOT A;  2DX5 B;  3A1Q A;  4FBJ B;  3L54 A;  1WGR A;  3ZLZ A;  2WDT B;  2ASQ A;  4ZYN A;  4KVG B;  1ZW7 A;  1GC6 A;  5JHA A;  4HCP B;  2CS4 A;  3SDL C;  1E5W A;  2HD5 B;  2NPT A;  3HHM A;  2FNJ B;  5G55 A;  2NR2 A;  2O6V B;  1V2Y A;  2ZVN A;  4BKT A;  2XBB C;  4KZC A;  3ALB A;  1V5T A;  4HWI B;  2VRR B;  2M8S A;  3P2B A;  1F9J A;  2REX A;  4KSK C;  3VFK A;  1TTN A;  3A4R A;  3ONS A;  2AL6 A;  2JUO A;  4AUQ C;  5LXI B;  2A4Z A;  4LJP B;  4WWN A;  2YVC A;  2MW5 A;  3V6C B;  4JQW C;  2KMA A;  4ZRI A;  2JF5 A;  3R3M A;  4LDT D;  1ZKH A;  3Q3J A;  2KZR A;  1OTR B;  3LDZ E;  4HDQ A;  4EZK A;  5HKH A;  4B6W A;  2ZJD A;  4W9L A;  4IG7 B;  1E90 A;  3VAW A;  4BKS A;  4YL8 A;  3JYU A;  3NHE B;  1VD2 A;  2AYO B;  3X23 A;  2FCN A;  4DK5 A;  2LGY A;  1LQB A;  1Z5S B;  3VDZ A;  2IO3 B;  2ZZP B;  2PEA A;  3UIP B;  3N3K B;  2JY6 A;  2YLM A;  4K7W A;  4NAW B;  2C7N B;  1KJT A;  2Z0D B;  4XC2 A;  1IYF A;  2KLC A;  2BKR B;  4RM8 A;  4GDL B;  4DWF A;  3SHQ A;  5LXH A;  3PRE A;  4MSQ B;  2L05 A;  1HE8 A;  3KYC D;  2RSU A;  2JZ3 B;  4ANU A;  2FCM A;  4KV2 A;  3VQI A;  1YX6 B;  3TL5 A;  2HE7 A;  5TR5 A;  3DBR I;  3K9P B;  2K6D B;  3L13 A;  1LFD A;  3KUC B;  1OGW A;  4IM3 A;  4FJV B;  3VUY A;  4X57 B;  3AU4 A;  2M4N A;  2D07 B;  4KIK A;  2DYB A;  4TKN A;  1Q0W B;  2GBK A;  2GOW A;  2ZVO A;  4HLE A;  1RAX A;  2MQJ A;  3PV1 A;  4FHJ A;  4NQL B;  4N9F 4;  2KTR B;  3RZF A;  2NVU I;  2LD9 A;  3AI5 A;  1VCB A;  1WR6 E;  1V9J A;  3U8Z A;  4JIO U;  2DZK A;  3DDC B;  1WR1 A;  3GZN I;  4ANV A;  3APF A;  4NY0 A;  1R4N I;  1E8Z A;  3JSV B;  2KLG A;  4CO7 A;  3PHW B;  3UGB B;  3B1L X;  3TJP A;  2KN5 A;  4MGK E;  2L8J A;  2BYF A;  4BOZ B;  5C23 A;  3X0W A;  4TQ0 A;  1WY8 A;  1YX5 B;  2LGD A;  5CTR C;  4BFR A;  1YJ1 A;  3SU8 X;  2BPS A;  2MWS B;  2O2V B;  2PPH A;  1WGH A;  4MM3 A;  2K8H A;  1A5R A;  4WWP A;  1UD7 A;  3B0A A;  4AJW A;  2O6V A;  2DYO A;  3DCG A;  1X1M A;  3NOB A;  1TBE A;  3PRZ A;  3DVN V;  5BO4 B;  3ZDT A;  2JZZ A;  4F1S A;  4WJQ A;  2M1M A;  3PRM B;  2A5U A;  3OJ4 B;  4F7Z A;  2MBQ A;  2KD0 A;  3ML9 A;  3V6E B;  1Z2M A;  2V3S A;  3QA8 A;  4MJS A;  5DPS A;  3IFW B;  2MBO A;  4TQ1 A;  3VTV A;  3DVG X;  4GGQ A;  1JRU A;  3R66 C;  1ISN A;  2KOX A;  2C9W B;  4HJK A;  3WAP A;  3R7Q A;  4W9F A;  3APD A;  2KFJ A;  3QIJ A;  4II3 B;  1UH6 A;  4NPN A;  4KSL C;  1OEY J;  4MEM A;  4GOC A;  2D11 A;  2KQ7 A;  3DOW A;  2IO2 B;  4K7S A;  5L95 C;  3DBS A;  4EEW A;  4E74 A;  4EKU A;  3EEC A;  2MBH A;  3ZTD A;  1GNU A;  4IC7 B;  1P9D U;  3NZU A;  2LUE A;  3ML8 A;  4OVV A;  3UF8 A;  3WIM A;  2AEH A;  3A4S C;  2FID A;  3H6N A;  4K1R B;  4WAA A;  4NAW A;  2G4S A;  4ICU A;  3KYD D;  1XD3 B;  2ZNV B;  4MGZ E;  4F8C B;  3ECI A;  3V61 A;  4KDI C;  4EOY A;  1E7U A;  4AJY B;  1C3T A;  1OEY A;  4MGI E;  4MGY E;  2DHZ A;  2GBN A;  4PYU A;  5AZG A;  2JXX A;  4HDO A;  3VUW A;  2GBM A;  4ANX A;  1J0G A;  1M94 A;  1WYW B;  3H7S A;  1RRB A;  5GMV A;  1H4R A;  4W9K A;  3QCA A;  2KKC A;  2KWV B;  4MJS B;  2KTR A;  4FAD A;  3QX1 A;  3M3J A;  4IUM B;  3CSF A;  4DBG A;  1I35 A;  2UYZ B;  3ZVV A;  3CMM B;  2KAN A;  3JSV A;  2NBV B;  3PTF C;  4W9H A;  5AZF A;  1UBI A;  5CHW A;  4MEL A;  3UQB A;  2J0M A;  3L16 A;  2LI5 A;  4EFO A;  4TUU A;  4BBN C;  1WX7 A;  2MP2 A;  2PE9 A;  3UIN B;  4E3C A;  2O2V A;  1CMX B;  1H8C A;  2PE6 B;  2RPQ A;  1WXV A;  5AEK B;  1WFY A;  2L00 B;  1WJ4 A;  2OOB B;  3NY5 A;  4KZ0 A;  1BT0 A;  4ANW A;  4HCN B;  2LGX A;  3O65 B;  1UZX B;  4GN1 A;  1GC7 A;  3EFU A;  2N1V A;  2XEW A;  1PQS A;  2L3Z A;  3OAW A;  4HPM B;  3TMP B;  4BVU C;  4MSM B;  3ENE A;  1YQB A;  1V80 A;  3APC A;  3HM3 A;  2K1F A;  3DQV A;  2KJH B;  2J0J A;  2KC1 A;  2KK8 A;  1Q1O A;  2BWE S;  3AU5 A;  3ZNH B;  2RD0 A;  2GBR A;  2C7M B;  2PJH A;  2FAZ A;  4FHK A;  4BKS D;  1U4A A;  4BBN F;  2D2Q A;  2DYM A;  5CX3 A;  1P3Q U;  4DDI D;  1WRD B;  3EC8 A;  2MBE A;  5D94 A;  1ZGU B;  2WWZ A;  2NBU A;  2IYD B;  4GDK B;  1WMH A;  2DZI A;  3ZRC A;  2LRU A;  5KHO A;  2KMC A;  5LLI A;  2BGF A;  3IVF A;  3A9K B;  3PT2 B;  3U30 A;  4HXD A;  3SD5 A;  3ZRF A;  2G3Q B;  2C5L C;  4LDT B;  3RCZ A;  4HVB A;  1EO6 A;  2KWC A;  3PLU A;  1WXM A;  2R2Q A;  2KX3 A;  1EUV B;  1SE9 A;  1FXT B;  1XT9 B;  2KNB A;  2KTF A;  3T9L A;  2JRI B;  1T0Y A;  2Z0E B;  3T8M A;  3H7P A;  1UGM A;  1UBQ A;  3RYT A;  2B3A A;  2MP2 B;  2V1Y A;  3CF6 E;  3PHX B;  2D10 A;  2N9P C;  3A9J B;  1D3Z A;  4JLC A;  2AWT A;  2MSE D;  2DZJ A;  3KUZ A;  4I6P A;  3Q3F A;  5J2R A;  4IWO A;  2V4L A;  3QWZ B;  1V81 A;  4IWP A;  3LJ3 A;  2K6Q A;  4FJZ A;  1V49 A;  3B08 A;  5DPT A;  2NBW B;  2LVO A;  3ZUN A;  4DHJ B;  2ZNV C;  3QHT A;  4JGH B;  5FR6 A;  2KQS A;  1OQY A;  4GB9 A;  1I42 A;  3PZD A;  5JHB A;  3WA0 A;  4G11 A;  1WGG A;  2L7R A;  3N30 A;  2C60 A;  1J8C A;  1WF9 A;  3A33 B;  2IBI B;  3QK0 A;  1SGH A;  1WX9 A;  1SIF A;  2NS5 A;  4NQK E;  2LWP A;  2KC2 A;  1Y8R C;  2N1W A;  1AAR A;  2RGF A;  4IM0 A;  4K7U A;  2BKF A;  3VHT C;  1L7Y A;  2MCN B;  3L08 A;  1IP9 A;  3HM6 X;  2O6V D;  4GMV A;  1WMH B;  1Q5W B;  2AL3 A;  2QHO A;  5CHV C;  4B9K A;  5EDS A;  2KDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...