3D32A

Complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Ligand Binding Mode of GABA(A) Receptor-Associated Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3d32A00
2MLBA 2GBJA 2DZJA 4K7SA 4N9F4 2ZCCA 4FULA 1E8XA 4BOZB 5CHWA 3GOEA 4PS3A 1QZEA 1MG8A 3DBRI 1OQYA 1XT9B 3KYDD 4FJVB 3HM3A 4HDQA 2PJHA 2AL3A 1E8WA 3DOWA 2CHZA 3V6EB 2V3SA 1YX6B 2FNJB 3L16A 2JZ3B 3PTFC 2ZCBA 1WM2A 4BOSC 2N9PC 4OVUA 1WX7A 1ZKHA 2RD0A 4II3B 4F1SA 5HKHA 2LVPA 2BF8B 3HHMA 3ZNID 5IA7A 1UBIA 3PLVA 2M1MA 4IM2A 2MX2A 4PS7A 3ZTCA 3ZNHB 1E8YA 2R2QA 2FAZA 2ZVNA 2G4SA 4TQ1A 3ML8A 4HDOA 3KVFB 4LDTD 2I1JA 3V61A 2MBBB 2MW5A 4XZ4A 3A4RA 3ZNZB 2XK5B 2IY1B 2KDBA 4LJPB 2JPHA 3P2BA 3ZDMC 4FBJB 2KJ6A 2JWZA 2KDFB 2KLCA 3RULA 3VUWA 1FXTB 2KZRA 2DAFA 3W1SC 2KX3A 2FCQA 2CU1A 3NS8A 1RFAA 2GBKA 1F9JA 3QJZA 2L0FA 3PGEA 4PS8A 1UELA 3VHTC 3QCAA 1P1AA 4FJZA 2LI5A 1RRBA 4RMAA 1E5WA 1CMXB 3QQ8B 1WXMA 1E90A 1WZ3A 4GDLA 4W9DA 1H8CA 2GBMA 1Q5WB 1IPGA 1P0RA 2KQ7A 4GOCA 4NJ7A 1WGRA 4EZJA 3EHVA 2D2QA 3OLMD 4GN1A 5C1ZA 2FCNA 3IFWB 4GGQA 1UBQA 3AU4A 1YJ1A 2K6DB 2L3ZA 3PS6A 2PEAA 4WJOA 2J0KA 5JH5C 4MJSA 4NAWA 2KDEB 5LLIA 2KN5A 4W9FA 4IW0A 2KD0A 3ALBA 3IBEA 1K8RB 2FCMA 2AYOB 2V4LA 4DWFA 3QAQA 2KFKA 4CYEA 3H7PA 4JIOU 1OTRB 3PVLA 4B9KA 3H9DA 2FCSA 1VD2A 4ANVA 3ECIA 3RD2A 1C1YB 2N1VA 3M62B 3OJ3A 1WE7A 5G2NA 4RM9A 2CR5A 4TUUA 2HTHA 5G55A 1WX9A 2G4DB 3QX1A 2UWQA 4GU2A 3PPAA 2N1WA 5JZEB 2MWSB 2ZNVB 2KX0A 1WGYA 4EZLA 2I1KA 1GUAB 4DDID 4KDIC 2LXAA 2B3AA 3CF6E 4GSWA 4JL9A 3ZTDA 2J0JA 1R4NI 4GDKB 2LUEA 2K1FA 3W1YA 2KWUB 1ZGUB 4ZRIA 1WRDB 3T9LA 2LASA 4P7IA 4AWJA 4JGHB 4NY0A 2LD9A 2LWPA 3A9JB 5AEKB 4FHJA 3WA0A 2N7EA 3SD5A 1L7YA 2IZVB 2K6QA 2CHWA 1V49A 2WX0A 1WH3A 3MHSD 1V6EA 3O65B 4ICUA 4IWOA 3ZO5B 4AOFA 1J0GA 3Q3FA 4CO7A 3CSFA 2KWVB 2V1YA 2MBOA 5IAAC 4FADA 2HE7A 4I6LB 4FJYA 4W9LA 1UZXB 3H7SA 3AXCA 1WM3A 4II2B 5AZFA 2OJRA 3ONSA 2YVCA 2O6VB 3DBHI 3B08A 4E71A 3PLUA 4BBNC 3A1QB 4K81A 2O2VA 3T8MA 5D7GA 4BKSD 2MQJA 3L13A 2IO0B 3WAOA 4MM3A 2JT4B 3JSVA 3KUDB 2KOXA 4NPNA 1XQQA 3NY5A 4FHKA 4FA6A 3DPDA 4NQKE 3TIXA 2AEHA 2K8CA 2KTFA 1TZ1A 3LDZE 3MJWA 2DENB 2KWCA 4IG7B 2GBNA 2N4FA 4KZ0A 2HJ8A 3VVWB 1WR1A 4WWNA 3WAMA 5GMVA 5FR6A 3TMPB 4E3CA 2KTRA 1G6JA 3GZNI 1WE6A 1I35A 1WR6E 3PHXB 2MBQA 3APFA 4A3PA 3VUYA 2NCNA 3CMMB 4JQWC 3H6NA 4KIKA 1KOTA 1OGWA 1GG3A 4KSKC 4B6WA 3V60A 2ASQA 2BKFA 2M8SA 4HJKA 4K1RB 2FUHB 3W1SA 4KSLC 4BKGA 3VH3B 2EMSA 4JLCA 3HM6X 1ISNA 1M94A 2KDIA 1P98A 4W9HA 3ZW3A 1V86A 2M4NA 3IVFA 2LGYA 2KLGA 5KHQA 3WANA 1WJUA 2IBIB 3PRMB 3L0WB 2OOBB 3DVNU 3NZSA 1WJ6A 4EUTA 3UQAA 2Z0DB 3UGBB 4A20A 4PYUA 2BWES 3VTVA 5CTRC 2NR2A 3DVGY 2CS4A 3ML9A 4EKUA 2NVUI 3HIZA 5D6JB 3X0WA 2RGFA 4IM3A 5DPTA 2LGXA 1KLVA 4KDLB 1UD7A 2DHZA 2JF5A 2JRIB 4M8NA 3VH4B 4TV3A 3QC8B 3OJ4B 3ZLZA 3N3KB 4W9IA 4GB9A 2QHOA 2MP2A 5DCNA 4DDGD 1KM7A 5LXHA 4BFRA 1PQSA 4XC2A 1LFDA 3L10B 4MSMB 2KFJA 3CSTA 4MGYE 4HLEA 4GIVA 5EDSA 3QK0A 3RT3B 2BWFA 3M95A 1V5OA 2DAJA 3JYUA 3IG3A 4MGKE 4I6NB 1R4MI 2MRPA 4MEMA 4EZKA 1Y8RC 3IHPC 3DVGX 3R7QA 2GOWA 4BBNF 3DDCB 2A4ZA 1L2NA 2J0MA 3RCZA 3QIJA 1VCBA 3A4SC 1WZ0A 3U7DA 3ZNGC 2C9WB 1I42A 2KNBA 2LVOA 1YX5B 3ZVVA 4GDLB 3SHQA 1U4AA 2NPTA 1Z2MA 1Q0WB 3ZKJC 4G3XB 1D3ZA 2LXCA 3WIMA 2NBVB 1BT0A 1RAXA 4K7WA 5DPSA 4DBGA 3A9KA 3R7RA 2LRWA 1S1QB 2C7MB 3NOBA 3EECA 2DYBA 3RZWC 3VFKA 4AP4C 2N7DA 2ZNVC 4FLHA 4KVGB 3U8ZA 2JY6A 4IC7B 4G0NB 3EFUA 4MJSB 4NAWB 4HK2A 2REXA 4E74A 1SIFA 2AL6A 3S2AA 2Y5BB 3APDA 2C60A 5DPWA 1YQBA 3SDLC 5DPRA 2IO1B 2KFKB 3N32A 2L8JA 3UINB 2O6VD 3H7PB 2K39A 3TJPA 4K7UA 2KMCA 1LXDA 2JXXA 5L83A 3AU5A 3RUIB 3ZRCA 2LGDA 2UYZB 2MBEA 1KJTA 3L17A 3QA8A 1A5RA 4MDKE 3VTWA 4BVUC 3BINA 3ZDTA 4CHKA 2L0TA 1Z5SB 2BKRB 2M17A 3ZUNA 3ENEA 2KQSA 5CHFA 5KHOA 1WFYA 2IY0B 2ZVOA 5D94A 3KW5B 4NJ6A 3DVNV 2KJHB 2Z59B 5AZGA 3UIPB 3VUXA 2RR9A 5J18A 1AARA 2JVCA 1NI2A 2DX5B 3Q3JA 1UGMA 4ZRJA 2ZPYA 3M63B 3K9PB 1P9DU 1WGGA 1WYWB 2WDTB 1IYFA 3QHTA 2XEWA 1TGZB 2D3GA 2RSUA 1S3SG 1YD8U 2NS5A 4RM8A 5AZHA 5JHBA 2LVQA 3MTNB 1X1MA 5E6OA 3DCGA 3WAPA 4EOYA 4F8CB 5J2RA 2G45B 3PV1A 4FN2A 4BKSA 1EF5A 3DQVA 3A33B 5E6PA 3VXWA 1E8ZA 3BY4B 1J19A 2NBUA 1GJZA 2A5UA 2BYEA 4TQ0A 4G11A 4IM0A 3B1LX 3OAWA 4DHJD 2XK5A 4EEWA 2DZKA 2CKHB 2LZ6A 5J17A 5JHAA 3UF8A 2JZZA 4IUMB 2DZIA 1J8CA 4W9EA 1WJ4A 3LJ3A 3VDZA 3PRZA 1V2YA 1TTNA 2D07B 4DXAB 3DBSA 5C23A 1LM8B 2KK8A 2O2VB 2ZJDA 3KUZA 4ZRKA 2D10A 2PE6B 4PYZA 1NBFC 2DYOA 2K8BA 3JSVB 2FIFA 2WWZA 2RPQA 3JVZX 3UIOB 3WALA 2CHXA 3TCAA 1SE9A 4I6PA 4WJNA 2GMIC 1EO6A 3PHWB 2YLMA 4DHJB 1SGHA 1NDDA 4WAAA 2ZEQA 3NHEB 2GBRA 1GNUA 1WXSA 1HE8A 4IWQA 1WGHA 4DHZE 1C3TA 2PE9A 4HWIB 1P3QU 4ANUA 2KTRB 2WYQA 3HK0A 3PREA 4W9JA 4W9GA 3TBLD 2J7QB 2G3QB 3L08A 4M0WB 1OEYA 1Q1OA 3U30A 1EUVB 1LQBA 5L95C 1WXAA 2PPHA 4KIKB 1JRUA 1H4RA 2C7HA 1V81A 3TL5A 3DBLI 1RLFA 5E6NA 1WMHA 3KH0A 4DK5A 3NZUA 3M3JA 2NBWB 2L76A 4MELA 5TR5A 2M0XA 3V6CB 3C0RB 2C7NB 4WWOA 2AWTA 2FIDA 2C5LC 2L7RA 4LDTB 1IP9A 4URKA 4DHZB 4ZDVA 2KC2A 2JRHA 4AJWA 1WI0A 4ZYNA 2EMTA 1YIWA 4WQOB 4TKNA 4XX5A 3I3TB 4LCDE 3B0AA 4ANXA 2XBBC 3R3MA 4KZCA 4W9KA 4W9CA 1UH6A 4MH0E 2WX1A 4OVVA 2IO3B 2KVRA 3PT2B 4WJPA 4AJYB 4HCNB 3VAWA 4J6IA 3QARA 4IWPA 2IYDB 1OEYJ 1V9JA 1V5TA 2KANA 1E7VA 1WXVA 2W9NA 3KYCD 3RZFA 3JW0X 4YL8A 2DZMA 1XD3B 2MP2B 3VQIA 3PZDA 3PRPB 4GXBA 4HXDA 1WMHB 4NNJB 1WJNA 4GDKA 2Z0EB 3H1UA 4MSQB 2MA9B 1GC7A 3D32A 4M8MA 3KUCB 3UQBA 2MSED 2DYMA 2N9XA 3A9JA 2BGFA 3APCA 3QWZB 2MCNB 5D2MB 4LJOB 4A3OA 1WX8A 4ASWC 4ANWA 2KJRA 4B95A 4WJQA 2BPSA 3AI5A 4HCPB 4F7ZA 3ZRFA 2BYFA 2KKCA 2ZZPB 3K9OB 2NPTB 1E7UA 3EC8A 2KXJA 2R2OA 2O6VA 2L00B 2LRUA 2JUOA 3A1QA 3L54A 3A9KB 4KV2A 3VTUA 2N9EB 5CHVC 1WF9A 3RYTA 4HPLB 1EF1A 2L05A 4BKTA 2KO3A 4NQLB 5BO4B 2HD5B 2KC1A 1WY8A 3SU8X 2VRRB 2K8HA 3ZIMA 1TBEA 2BYVE 5LXIB 2LJ5A 4AUQC 2IO2B 1WGDA 2ZPNA 4EFOA 2EKEC 3PSEB 3AULA 4MGZE 2KMAA 4MGIE 1V80A 2KHWB 2MBHA 4ICVA 4HVBA 3V62A 4HPMB 1WIAA 2K25A 1ZW7A 1T0YA 4GMVA 4WWPA 3R66C 5CX3A 3N30A 3X23A 4G50A 4X57B 1GC6A 2D11A
chains in the Genus database with same CATH superfamily
4K7SA 3AE3B 1C4PA 3FKYA 1QZEA 3DBRI 2ON8A 3HM3A 4N58A 2PJHA 2AL3A 2W55A 3DOWA 1YX6B 2Y3AA 3ZQ4A 4RF1A 4OVUA 3AEBB 4II3B 3FILA 5IA7A 1MG4A 1FO4A 2ZW0A 4PS7A 3ZTCA 2ZVNA 1WSPA 4XZ4A 2XK5B 2JPHA 2KJ6A 2KLCA 3RULA 1P7FA 2PTLA 4RMAA 3QQ8B 1WXMA 2IGHA 2RDBC 1WZ3A 4WQMA 4W9DA 1K50A 3NVZA 2KQ7A 3OLMD 1YJJA 4GGQA 1UBQA 1YJ1A 1N63A 2V9HA 3NVVA 2J0KA 4NAWA 1XLOA 2KDEB 5EE1A 3IBEA 2V4LA 3KWVA 4B0MA 2W3RA 3N1XC 3P1MA 4JIOU 1OTRB 4C00A 3W2DA 4RM9A 2CR5A 4TUUA 5G55A 2INCC 2G4DB 5BMHA 1TIFA 3QX1A 2UWQA 2N1WA 2INPE 2JZPA 5JZEB 3P42A 1M4VA 2MWSB 2ZNVB 2KX0A 2NMQA 2GI9A 1GUAB 4MACA 4DDID 4KDIC 2MEKA 1BXTA 4GDKB 3BWUD 2K1FA 3W1YA 1ZGUB 1WRDB 3I5JC 3PO0A 1NENB 3E9SA 4AWJA 4JGHB 1J7AA 1RM6C 2NTSA 1T0QC 2E3TA 1MHXA 2IZVB 2K6QA 1V49A 4CO7A 5LNK1 2V1YA 5IAAC 2HE7A 4FJYA 1E0ZA 2AX5A 4A9AA 4II2B 5AZFA 3ONSA 2IGGA 2O6VB 4BBNC 4K81A 2O2VA 4BKSD 1QT9A 2K22A 2FBWB 1NYRA 1SF0A 1TT5B 2KYWA 3DPDA 5D3DA 1TZ1A 3LDZE 1ROEA 4AS1A 4KZ0A 2RDGA 1WR1A 5FR6A 2KTRA 1KFYB 1G6JA 1WE6A 1I35A 4M0WA 3APFA 3BK2A 4JQWC 1SJED 3H6NA 1OGWA 4KSKC 2ASQA 2BKFA 2FUHB 4BKGA 1TS4A 1T0RC 2KDIA 4W9HA 3ZW3A 1V86A 3PRMB 2OOBB 3NZSA 1WJ6A 3UQAA 2Z0DB 2BWES 1ET6A 1Y56A 4K3CA 2WXMA 1JWMD 2RGFA 1I4GA 1TY0A 1HTOA 4M8NA 4W9IA 4KGRA 2AQ2B 1KM7A 5LXHA 4BFRA 4MSMB 2GLSA 2VZKB 4HLEA 3IXSA 4NAMA 2BWFA 4C7ZA 1V5OA 2DAJA 4C4VA 1HZ5A 3IG3A 4I6NB 3HVDA 4MEMA 3IHPC 1VZ8A 3AV8A 3R7QA 1JWAD 2K3UA 1SE4A 4ACFA 3U7DA 3ZNGC 2KNBA 3RI7C 4GDLB 1Z2MA 2RMMA 2NBVB 1RAXA 1D5ZC 4K7WA 5DPSA 5E6JA 3R7RA 2C7MB 3EECA 2DYBA 3RZWC 3VFKA 1FNUA 2DWQA 3BK1A 2PLPA 3U8ZA 2JY6A 3E56A 4G0NB 3EFUA 4HK2A 2AL6A 2Y5BB 1YQBA 2IO1B 3N32A 3H7PB 2K39A 3DHHC 3I9V1 1V1PA 2JXXA 3ZRCA 4MDKE 2WDRB 4RCOA 2KQSA 5CHFA 2BS2B 5H8YE 3TEZA 1NVID 4PT5A 2WHIA 2JVCA 1BMLC 1WRIA 3K9PB 1P9DU 1L0YB 1TGZB 2D3GA 2NS5A 5AZHA 2IDYA 5FR3A 1N62A 1WYGA 1VJKA 5E6OA 3DCGA 3WAPA 2J4XA 5J2RA 3U4EG 3A33B 3VXWA 1GJZA 2RPVA 2BYEA 2HTME 1P7EA 2LMCA 2XK5A 2DZKA 2CKHB 2LZ6A 1ESFA 2DZIA 1J8CA 1WJ4A 4KGSA 1QOAA 1ZXIA 1TTNA 3IAM1 3DBSA 2JYEA 3KUZA 4PYZA 2DYOA 2FIFA 1JRPA 1IGDA 2WXFA 4I6PA 2GMIC 5FK9C 3T3NA 3NHEB 1E10A 2BW2A 1WGHA 2WYQA 4W9GA 2W82A 1C9FA 3L08A 4QAYA 1Q1OA 3U30A 4S17A 1EUVB 2WXLA 1JRUA 1H4RA 2WXHA 4DK5A 2L76A 4IKGA 4MELA 2HDEA 3RNFC 4WWOA 2AWTA 1IP9A 4URKA 4DHZB 4O1NA 1OQRA 4ARCA 3VRAB 2QEJC 4ZDVA 2JRHA 4ZYNA 2I2YA 2EMTA 4XX5A 1DOYA 3I3TB 2XBBC 4W9KA 5FKAC 4W9CA 4MH0E 2L83A 2IO3B 2KVRA 2WP9B 1OEYJ 4EE2A 1V5TA 4ZHOA 3TEWA 1E9MA 4JX1C 4YL8A 4K3BA 2V0GA 1XD3B 3PZDA 4GXBA 1WJNA 4GDKA 2ICIA 3H1UA 4M8MA 1T0SC 3RNBC 2IJ0A 1L5PA 3APCA 4LJOB 1QOBA 2KJRA 5C3JB 3W5UB 4WJQA 3AI5A 3P4QB 2NTTA 3ZRFA 2R61A 4N6EB 1N61A 2LHEA 4HJGE 1E7UA 3EC8A 2MJ3A 2O6VA 3A9KB 4YSXB 5G5GA 2N9EB 1WF9A 2Q5WD 4BKTA 2DBYA 4NQLB 3AN1A 5BO4B 3HUIA 3SU8X 4ZRPA 4AUQC 1ZDXA 2ZPNA 3B2GA 2KMAA 2MBHA 4ICVA 1WIAA 2K25A 2QMTA 5JXVA 5CX3A 3N30A 3X23A 2OJWA 1GG3A 4TMAB 2D11A 2GBJA 2EELA 2ZCCA 4BOZB 2WXKA 1MG8A 3C8YA 2WXPA 1HQRD 1E8WA 2FNJB 4LNNA 1FFUA 4BOSC 1WX7A 1ZKHA 4F1SA 2LVPA 3U7ZA 2PMVA 3ZNHB 1QF6A 1E8YA 1STEA 1XCTL 4HDOA 4LDTD 3GS2A 2INDC 3V61A 2MBBB 3ZNZB 3A4RA 4HROA 4DXFA 2KACA 2KDBA 4LJPB 4HPPA 3VUWA 1FNVA 1GB4A 2BS4B 1FXTB 2KZRA 3W1SC 3NS8A 1RFAA 2GBKA 4J3OD 1I4QA 1YOVB 3QJZA 3PGEA 4XGAB 1SE2A 4PS8A 1UELA 1E5WA 1E90A 4GDLA 4OZCA 2GBMA 3NZ3A 4EZJA 2D2QA 2INNE 5GXGB 3AU4A 3TUOA 2K6DB 3PS6A 2PEAA 1V1OA 3FC4A 5LLIA 4W9FA 4IW0A 3Q2AC 3ZYYX 2KD0A 2FCMA 2QDFA 2AYOB 3MJ5A 1ET9A 4YTNB 3H7PA 3H9DA 5C2TB 1EU3A 3M62B 1WE7A 1ZPSA 2JQRB 5AUIA 4AQ7A 4A90A 2J52A 1E6EB 2KWDA 1QLBB 2I1KA 1L0VB 2LXAA 3CF6E 4GSWA 3C19A 1YMHE 4ZRIA 3AE4B 2Y5PA 3WA0A 1UF0A 5BMGA 3MHSD 1WH3A 4OW0A 1V6EA 4ICUA 4KKJA 3ZO5B 3CSFA 2KWVB 2MBOA 3Q3MC 1OQQA 4I6LB 4W9LA 1UZXB 2N0SB 3AXCA 1JALA 2M0AA 1WWTA 3A1QB 4USAA 4YTMB 3T8MA 2B76B 5D7GA 3L13A 4GLSC 1L6VA 3KUDB 1XQQA 4FHKA 3P4RB 4NQKE 2AEHA 2K8CA 3AE9B 1FFVA 2DENB 2KWCA 2PIAA 2HJ8A 1F2RC 2L32A 4WWNA 5GMVA 3NVWA 4E3CA 2I38A 4US8A 3RNAC 2MBQA 4HJKA 4KGTA 2EMSA 3RMKC 1M94A 2WXIA 4RFBA 3IVFA 2LGYA 2KLGA 5KHQA 2IGDA 4YWGG 2BYTA 1BUIC 2W54A 4PYUA 3VTVA 3DVGY 3P4SB 1HEZE 1FMAD 4IM3A 3RPFC 4KDLB 2IPKD 2DHZA 3VH4B 4TV3A 3QC8B 3OJ4B 1KRHA 2KN4A 4WAFA 4LNKA 1PQSA 3HRDD 1FCCC 3RT3B 3JYUA 4M00A 2MRPA 1Y8RC 4BBNF 1YQ3B 1XO3A 3T3OA 2A4ZA 3RCZA 1PGXA 1VCBA 1WZ0A 1F52A 4UDUC 1YX5B 3ZVVA 3AEAB 1Q0WB 4G3XB 1D3ZA 1MI0A 4DBGA 3A9KA 2LRWA 2SAKA 4LNIA 4AP4C 4LNFA 3DBLB 2N7DA 3B9JA 4FLHA 4KVGB 3SFDB 2BBCA 4E74A 2N9LA 3S2AA 3SDLC 5DPRA 2KFKB 3Q69A 4K7UA 2KMCA 1LXDA 5TSSA 3Q8EA 3RUIB 3QA8A 3L17A 3GP7A 3VTWA 3BINA 3ZDTA 4CHKA 4XWWA 2PVGC 2M17A 3ENEA 4A6QA 2KJHB 2Z59B 3UIPB 2WS3B 3VUXA 1VRAB 1I4RA 4REZA 1OFFA 2RR9A 1NI2A 2DX5B 5BMIA 2WXOA 2ZPYA 4BZAA 1WYWB 2WDTB 3QHTA 2RSUA 2JYTA 4EOYA 4F8CB 4B0EA 3DHIC 1EF5A 4JE3B 1E8ZA 3BY4B 1C76A 1J19A 4ARIA 2A5UA 3EGRA 4G11A 3DWMA 4IM0A 3RFZB 3B1LX 1PGAA 4EEWA 4HKZE 1JCKB 4LTUA 3AH7A 3LJ3A 4DXAB 4XWTA 5C23A 1LM8B 2KK8A 2ZJDA 2D10A 2PE6B 1C77A 1NBFC 3DHGC 5BYRA 2WWZA 3JVZX 4XYCA 3WALA 3W9CB 3TCAA 1SE9A 4WJNA 4L1BA 3ETRA 4DHJB 1ACCA 2Y5CA 4WAAA 2ZEQA 1HXYD 2MH7A 1HE8A 4RGTA 2PE9A 3I57A 3HK0A 3AEEB 1D6EC 1OEYA 5BYQA 1LQBA 1GOZA 4KIKB 4A55A 1MFWA 1V81A 3DBLI 1RLFA 5E6NA 3KH0A 3BVZA 3SFEB 2NBWB 2M0XA 3V3XA 1GPXA 2RDHA 5D3IB 4IOIE 1UWMA 2MJDA 1K52A 1T5XD 2AQ1B 1JROA 1WI0A 1YIWA 3B0AA 3FAHA 1UH6A 4IDIA 2WX1A 4OVVA 2J42A 3AE2B 2HJ1A 4IWPA 2KANA 2JX5A 2W9NA 3KYCD 4YSZB 2MP2B 1HA5A 3VQIA 4HXDA 2V4IB 3AE6B 1WMHB 2H89B 4MSQB 2MA9B 3KQ4A 3TEYA 2MSED 5D2MB 4A3OA 4B95A 4HCPB 5T8IA 5H92C 3K9OB 2D3CA 2KXJA 3EUB2 1DOXA 1YN4A 2LRUA 3A1QA 4JWSC 3RYTA 2KAJA 1EF1A 2L05A 3BZDB 3RN9C 1WY8A 2VRRB 2BYVE 2VH1A 1WGDA 2V3PA 3AULA 4MGIE 2KHWB 4L2YA 1T0YA 4GMVA 1AYFA 3R66C 3U52E 2MLBA 4N9F4 4FULA 5CHWA 3GOEA 4PS3A 1QILA 1N6ZA 4FJVB 4HDQA 3AECB 3L16A 4YT0B 4C80A 2ZCBA 1JWUD 1YN3A 3IAS1 2N9PC 2BT6A 2RD0A 5HKHA 3W5VB 4CQNA 3HHMA 4XDCA 1UBIA 2N9KA 3PLVA 3AM9A 2M1MA 2MX2A 2R2QA 2KQ4X 2G4SA 4TQ1A 3ML8A 2H88B 1F1HA 3KVFB 2MJEA 2MW5A 3AE5B 3RNGC 1XLNA 3P2BA 4FBJB 2KDFB 1FRDA 2DAFA 2KX3A 1VZ7A 2CU1A 1NYQA 3GE8C 1UUPA 3QCAA 1P1AA 1A70A 1MVKA 2FE8A 2LI5A 3CIRB 2D3AA 1CMXB 4WURA 1J7CA 4RGMA 1Q5WB 4GOCA 1JMLA 3EHVA 4GN1A 1SB3C 5C1ZA 2FCNA 3IFWB 1YQ4B 1SEBD 3CWIA 3EA6A 4WJOA 1YNTE 4ITKA 2KN5A 1TY2A 3ALBA 1SBBB 1TKYA 3GE3C 2KFKA 4CYEA 3H8HA 1XCQL 4B9KA 1VD2A 1NEKB 1UWXA 2D5GA 1C1YB 1NI3A 3OJ3A 5IN7A 4RH6A 3N1YC 1TZOA 1N60A 4P1CC 5EE3A 2OHFA 1YJIA 1KF6B 3I63C 1WGYA 3ZTDA 2B3AA 2J0JA 1FNWA 2KWUB 1ZUD2 3NVYA 3EFCA 2LASA 4NY0A 3A9JB 5AEKB 1XLPA 4FHJA 2LGSA 2N7EA 2JU6X 1R7SA 1L7YA 5I4DA 2WX0A 4AOFA 2WXNA 1J0GA 2CJOA 2WXRA 1CK1A 4FADA 3KWLA 2VH2A 3H7SA 1WM3A 4P6VF 2YVCA 3B08A 5IKCM 2IO0B 4D2KA 3WAOA 4DXGA 3PZ8A 4NPNA 1K51A 1TS3A 3TIXA 1VR9A 3MJWA 2GBNA 2N4FA 3VVWB 1FPYA 2G1EA 3AEFB 3TMPB 3MP9A 1DGJA 1WR6E 2ACZB 4A3PA 3VUYA 4KIKA 3V60A 3R2TA 2WXQA 4K1RB 4KSLC 3VH3B 3HM6X 1P98A 1HTQA 2M4NA 3WANA 2IBIB 3L0WB 3DVNU 1PFDA 2KDMA 3UGBB 5CTRC 2NR2A 3L4PA 2YEPB 4EKUA 2NVUI 1KLVA 3R2IA 1QOFA 2JF5A 2JRIB 4Q2JA 4C56C 4GB9A 2MP2A 5DCNA 4RGOS 4DDGD 1VZ6A 2E6XA 3SR6A 4BAXA 1SSNA 4XC2A 3L10B 2KFJA 4GIVA 5EDSA 3M95A 2SEBD 1VDVA 4EZKA 1TS2A 3VRBB 2GOWA 3ZJTA 5HG2A 1QQRA 2J0MA 3KLSX 3A4SC 2WDQB 2N7JA 2C9WB 1I42A 1MJDA 3SHQA 3ZKJC 1FIQA 3WIMA 3NOBA 1V8CA 5AUKA 4P1BC 1ZP0B 2ZNVC 2V3NA 1JWSD 4MJSB 2REXA 4S0RA 3BVMA 1SIFA 4A8XC 2C60A 5DPWA 2L8JA 3UINB 2O6VD 1F77A 2AQ3B 5L83A 4RF0A 2MBEA 1KJTA 1A5RA 3Q6BA 3P63A 3O13A 3ZUNA 1WFYA 2ZVOA 4NJ6A 3DVNV 2QILA 1V97A 3NS1A 4TSSA 5J18A 2ZW1A 1AWDA 3Q3JA 1CQVA 4ZRJA 3M63B 1WGGA 1KTKA 1YD8U 1I4HA 1VLBA 2LEKA 2BS3B 1X1MA 1V1PB 3Q14C 4WWMA 4BKSA 3DQVA 2D3BA 3OAWA 4DHJD 2PW9A 1UNSA 5JHAA 2JZZA 4IUMB 4W9EA 3MC0B 3TEXA 1RWSA 1SE3A 3J9CA 1SIJA 4MM3B 3JSVB 2RPQA 3UIOB 4JWUC 1EO6A 2VZKD 2YLMA 3PHWB 1GNUA 1QKZA 4LNOA 4DHZE 1C3TA 1F0ZA 4HWIB 1TKGA 1P3QU 4ANUA 1FD6A 2M56B 5EE0A 3TBLD 4W9JA 4OHJA 2J7QB 2G3QB 3N1ZC 1HZ6A 1LO5D 3Q3NC 1PYWD 4MH8A 1IBXB 2PPHA 2DNFA 3TL5A 2QSDA 3RNCC 2BQQA 5IO9A 2C7NB 1D5MC 1MPEA 4LDTB 1FRRA 1N5XA 4WQOB 4TKNA 4LCDE 2BB6A 4KZCA 4ZHPA 4HEA1 3PT2B 4AJYB 4HCNB 4J6IA 2JSVX 1C78A 1EWYC 4ZYSA 1WXVA 3JW0X 2DZMA 3PRPB 4NNJB 1I4PA 1T3QA 1GC7A 3D32A 3A9JA 2DYMA 2N9XA 2MCNB 1FXAA 4HRSA 1WX8A 4ASWC 4ANWA 1ZOYB 4F7ZA 3NUHB 2BYFA 1EU4A 2KVZA 4OZAA 2NPTB 2R2OA 2WQYB 4HPLB 2KO3A 1RYJA 2WLBA 3ZIMA 1TBEA 2QC8A 4KKIA 4EFOA 3PSEB 1J7BA 1V80A 4HVBA 2BTEA 4WWPA 4X57B 2QIEB 3Q8BA 2DZJA 1JQ4A 1E8XA 4US9A 4N59A 1AW7A 1OQYA 1XT9B 3KYDD 1R4NB 1WXQA 2CHZA 3V6EB 1XEEA 2V3SA 2JZ3B 3PTFC 1PGBA 1WM2A 1KLUD 2BF8B 3ZNID 1MHHE 4KX6B 3AE8B 4IM2A 4HKQA 2FAZA 1K53A 3P4PB 3BYTB 2I1JA 3N20C 3DBHB 3BIID 2IY1B 3ZDMC 1FCLA 2JWZA 1XXGA 3IT4B 1PDXA 2CJNA 1JW9D 2FCQA 2LHDA 1FEHA 1F9JA 2L0FA 3VHTC 1YN5A 4FJZA 3ZXRA 2LGIA 1RRBA 4NZLB 1H8CA 1C79A 4M01A 1IPGA 1P0RA 3GZNB 4NJ7A 1WGRA 2LFIA 1IUEA 1C4CA 3OG5A 1JWBD 1CZPA 2X38A 1FXIA 2L3ZA 5JH5C 4MJSA 3B2FA 1K8RB 1LGRA 4DWFA 3QAQA 2XN9C 3WCQA 3PVLA 2FCSA 5IOIA 4ANVA 3ECIA 3RD2A 4DQOC 2N1VA 3LB8C 5G2NA 2HTHA 1ZE3D 1WX9A 1SJHD 3AEGB 1L4ZB 4GU2A 1FM0D 3ZXVA 3PPAA 4YSYB 3UI3A 2UU7A 2TSSA 3ZJVA 3NG0A 4EZLA 2YEPF 2K5PA 1EWCA 2L52A 4JL9A 1R4NI 1R4MB 2LUEA 3T9LA 2WU5B 4P7IA 2LD9A 2LWPA 5HHDG 3VR9B 1UGJA 3V05A 1AN8A 1F2RI 2KT7A 3SEBA 1SXTA 4JPSA 3NJTA 5EE9A 3SD5A 2CHWA 2GRIA 4L23A 4IWOA 3O65B 2J53A 3R8BA 3Q3FA 4YXDB 2Z8LA 2OJRA 3DBHI 4E71A 1KH0A 3PLUA 4OZBA 2MQJA 1GB1A 4MM3A 1Q10A 2JT4B 3JSVA 2KOXA 4XE0A 3RNEC 3NY5A 4FA6A 2KTFA 4IG7B 1DYQA 2MHJA 2QCZA 3Q8FA 3WAMA 2WDVB 1TJEA 4R3DA 3GZNI 3URYA 3PHXB 2NCNA 3DWGC 3CMMB 2KMMA 1L6UA 1IBXA 1KOTA 4B6WA 2M8SA 2JWUA 5BYSA 1IGCA 3W1SA 4JLCA 5HFYA 1ISNA 2LUMA 1T6BX 3AB5A 1WJUA 3MFGA 2LJIA 3AE1B 4EUTA 4A20A 1ZXHA 2CS4A 3ML9A 2FUG1 3HIZA 5D6JB 3FILB 3X0WA 5DPTA 2LGXA 1UD7A 3TSSA 3ZLZA 3N3KB 1I4XA 2QHOA 3LYYA 1LFDA 4XDDA 4ZOHC 3CSTA 4MGYE 3QK0A 2M19A 4MGKE 1R4MI 1TS5A 3NRZA 3DVGX 4NJCA 3DDCB 1L2NA 3QIJA 1B9RA 5MPOA 2LVOA 2W3SA 2X8XX 1U4AA 2NPTA 3LXFA 2LXCA 1BT0A 1ENFA 2QJLA 1S1QB 3MC8A 2OEDA 1I7HA 2WXJA 4IC7B 2CU3A 4NAWB 3APDA 4H2AA 3TJPA 4OVZA 3AU5A 3GB1A 2LGDA 2UYZB 3AE7B 4BVUC 2L0TA 3ABVB 1Z5SB 2BKRB 5KHOA 5D94A 2IY0B 3KW5B 1TYGB 3AEDB 5AZGA 1TKEA 3AMZA 1AARA 1UGMA 2K0PA 1IYFA 2XEWA 1S3SG 4M02A 4RM8A 5JHBA 1EM7A 4MT5A 2LVQA 3MTNB 5G5HA 4LLGM 2G45B 3PV1A 4FN2A 5E6PA 5HI1A 2NBUA 4TQ0A 2WGSA 1KLGD 5J17A 3Q8CA 3UF8A 3VDZA 2K9XA 1V2YA 3PRZA 2D07B 2O2VB 4ZRKA 2K8BA 1ZDVA 4RNAA 2CHXA 2XNAC 3BYYB 2BB5A 1D5XC 1SGHA 3PZ7A 4WH4A 4YTPB 1NDDA 2GBRA 3ZJUA 1WXSA 3OWEB 4IWQA 1XLQA 2KTRB 3PREA 2L1AA 4M0WB 5L95C 1WXAA 2C7HA 3DBRB 1WMHA 1GAQB 3NZUA 3M3JA 1L0XB 1XF5L 5TR5A 3V6CB 3C0RB 4ZRQA 2FIDA 2C5LC 2WU2B 4WIPA 2L7RA 1N5WA 4FXCA 3Q8AA 2JXTA 3BVGA 5IP4D 2KC2A 4AJWA 3MHZA 4ANXA 3N9YC 4C7YA 3R3MA 2WNMA 2ONQA 4WJPA 3VAWA 1B1ZA 3QARA 2IYDB 1V9JA 1PUTA 1E7VA 3RZFA 3Q3OC 3VR8B 2Z0EB 1E7PB 3KUCB 2BVCA 1WGKA 4C4VB 3UQBA 1RFKA 3MC9A 2BGFA 3QWZB 1CJEA 2G9HD 2BPSA 1QOGA 2WXGA 2KKCA 3U2SC 2ZZPB 2PVOD 4RGNA 1C4AA 2DLBA 2L00B 4P16A 2JUOA 3L54A 4KV2A 3VTUA 5CHVC 1DOIA 1L4DB 4LK0M 3HVZA 2PKOA 2HD5B 2KC1A 3ZGZA 2K8HA 3IT6B 5LXIB 2LJ5A 2IO2B 2EKEC 4MGZE 2EKIA 3V62A 4HPMB 1ZW7A 4G50A 1GC6A 2GB1A 1D4BA 4PK1A
chains in the Genus database with same CATH topology
2MLBA 2GBJA 2DZJA 4K7SA 4N9F4 2ZCCA 4FULA 1E8XA 4BOZB 5CHWA 3GOEA 4PS3A 1QZEA 1MG8A 3DBRI 1OQYA 1XT9B 3KYDD 4FJVB 3HM3A 4HDQA 2PJHA 2AL3A 1E8WA 3DOWA 2CHZA 3V6EB 2V3SA 1YX6B 2FNJB 3L16A 2JZ3B 3PTFC 2ZCBA 1WM2A 4BOSC 2N9PC 4OVUA 1WX7A 1ZKHA 2RD0A 4II3B 4F1SA 5HKHA 2LVPA 2BF8B 3HHMA 3ZNID 5IA7A 1UBIA 3PLVA 2M1MA 4IM2A 2MX2A 4PS7A 3ZTCA 3ZNHB 1E8YA 2R2QA 2FAZA 2ZVNA 2G4SA 4TQ1A 3ML8A 4HDOA 3KVFB 4LDTD 2I1JA 3V61A 2MBBB 2MW5A 4XZ4A 3A4RA 3ZNZB 2XK5B 2IY1B 2KDBA 4LJPB 2JPHA 3P2BA 3ZDMC 4FBJB 2KJ6A 2JWZA 2KDFB 2KLCA 3RULA 3VUWA 1FXTB 2KZRA 2DAFA 3W1SC 2KX3A 2FCQA 2CU1A 3NS8A 1RFAA 2GBKA 1F9JA 3QJZA 2L0FA 3PGEA 4PS8A 1UELA 3VHTC 3QCAA 1P1AA 4FJZA 2LI5A 1RRBA 4RMAA 1E5WA 1CMXB 3QQ8B 1WXMA 1E90A 1WZ3A 4GDLA 4W9DA 1H8CA 2GBMA 1Q5WB 1IPGA 1P0RA 2KQ7A 4GOCA 4NJ7A 1WGRA 4EZJA 3EHVA 2D2QA 3OLMD 4GN1A 5C1ZA 2FCNA 3IFWB 4GGQA 1UBQA 3AU4A 1YJ1A 2K6DB 2L3ZA 3PS6A 2PEAA 4WJOA 2J0KA 5JH5C 4MJSA 4NAWA 2KDEB 5LLIA 2KN5A 4W9FA 4IW0A 2KD0A 3ALBA 3IBEA 1K8RB 2FCMA 2AYOB 2V4LA 4DWFA 3QAQA 2KFKA 4CYEA 3H7PA 4JIOU 1OTRB 3PVLA 4B9KA 3H9DA 2FCSA 1VD2A 4ANVA 3ECIA 3RD2A 1C1YB 2N1VA 3M62B 3OJ3A 1WE7A 5G2NA 4RM9A 2CR5A 4TUUA 2HTHA 5G55A 1WX9A 2G4DB 3QX1A 2UWQA 4GU2A 3PPAA 2N1WA 5JZEB 2MWSB 2ZNVB 2KX0A 1WGYA 4EZLA 2I1KA 1GUAB 4DDID 4KDIC 2LXAA 2B3AA 3CF6E 4GSWA 4JL9A 3ZTDA 2J0JA 1R4NI 4GDKB 2LUEA 2K1FA 3W1YA 2KWUB 1ZGUB 4ZRIA 1WRDB 3T9LA 2LASA 4P7IA 4AWJA 4JGHB 4NY0A 2LD9A 2LWPA 3A9JB 5AEKB 4FHJA 3WA0A 2N7EA 3SD5A 1L7YA 2IZVB 2K6QA 2CHWA 1V49A 2WX0A 1WH3A 3MHSD 1V6EA 3O65B 4ICUA 4IWOA 3ZO5B 4AOFA 1J0GA 3Q3FA 4CO7A 3CSFA 2KWVB 2V1YA 2MBOA 5IAAC 4FADA 2HE7A 4I6LB 4FJYA 4W9LA 1UZXB 3H7SA 3AXCA 1WM3A 4II2B 5AZFA 2OJRA 3ONSA 2YVCA 2O6VB 3DBHI 3B08A 4E71A 3PLUA 4BBNC 3A1QB 4K81A 2O2VA 3T8MA 5D7GA 4BKSD 2MQJA 3L13A 2IO0B 3WAOA 4MM3A 2JT4B 3JSVA 3KUDB 2KOXA 4NPNA 1XQQA 3NY5A 4FHKA 4FA6A 3DPDA 4NQKE 3TIXA 2AEHA 2K8CA 2KTFA 1TZ1A 3LDZE 3MJWA 2DENB 2KWCA 4IG7B 2GBNA 2N4FA 4KZ0A 2HJ8A 3VVWB 1WR1A 4WWNA 3WAMA 5GMVA 5FR6A 3TMPB 4E3CA 2KTRA 1G6JA 3GZNI 1WE6A 1I35A 1WR6E 3PHXB 2MBQA 3APFA 4A3PA 3VUYA 2NCNA 3CMMB 4JQWC 3H6NA 4KIKA 1KOTA 1OGWA 1GG3A 4KSKC 4B6WA 3V60A 2ASQA 2BKFA 2M8SA 4HJKA 4K1RB 2FUHB 3W1SA 4KSLC 4BKGA 3VH3B 2EMSA 4JLCA 3HM6X 1ISNA 1M94A 2KDIA 1P98A 4W9HA 3ZW3A 1V86A 2M4NA 3IVFA 2LGYA 2KLGA 5KHQA 3WANA 1WJUA 2IBIB 3PRMB 3L0WB 2OOBB 3DVNU 3NZSA 1WJ6A 4EUTA 3UQAA 2Z0DB 3UGBB 4A20A 4PYUA 2BWES 3VTVA 5CTRC 2NR2A 3DVGY 2CS4A 3ML9A 4EKUA 2NVUI 3HIZA 5D6JB 3X0WA 2RGFA 4IM3A 5DPTA 2LGXA 1KLVA 4KDLB 1UD7A 2DHZA 2JF5A 2JRIB 4M8NA 3VH4B 4TV3A 3QC8B 3OJ4B 3ZLZA 3N3KB 4W9IA 4GB9A 2QHOA 2MP2A 5DCNA 4DDGD 1KM7A 5LXHA 4BFRA 1PQSA 4XC2A 1LFDA 3L10B 4MSMB 2KFJA 3CSTA 4MGYE 4HLEA 4GIVA 5EDSA 3QK0A 3RT3B 2BWFA 3M95A 1V5OA 2DAJA 3JYUA 3IG3A 4MGKE 4I6NB 1R4MI 2MRPA 4MEMA 4EZKA 1Y8RC 3IHPC 3DVGX 3R7QA 2GOWA 4BBNF 3DDCB 2A4ZA 1L2NA 2J0MA 3RCZA 3QIJA 1VCBA 3A4SC 1WZ0A 3U7DA 3ZNGC 2C9WB 1I42A 2KNBA 2LVOA 1YX5B 3ZVVA 4GDLB 3SHQA 1U4AA 2NPTA 1Z2MA 1Q0WB 3ZKJC 4G3XB 1D3ZA 2LXCA 3WIMA 2NBVB 1BT0A 1RAXA 4K7WA 5DPSA 4DBGA 3A9KA 3R7RA 2LRWA 1S1QB 2C7MB 3NOBA 3EECA 2DYBA 3RZWC 3VFKA 4AP4C 2N7DA 2ZNVC 4FLHA 4KVGB 3U8ZA 2JY6A 4IC7B 4G0NB 3EFUA 4MJSB 4NAWB 4HK2A 2REXA 4E74A 1SIFA 2AL6A 3S2AA 2Y5BB 3APDA 2C60A 5DPWA 1YQBA 3SDLC 5DPRA 2IO1B 2KFKB 3N32A 2L8JA 3UINB 2O6VD 3H7PB 2K39A 3TJPA 4K7UA 2KMCA 1LXDA 2JXXA 5L83A 3AU5A 3RUIB 3ZRCA 2LGDA 2UYZB 2MBEA 1KJTA 3L17A 3QA8A 1A5RA 4MDKE 3VTWA 4BVUC 3BINA 3ZDTA 4CHKA 2L0TA 1Z5SB 2BKRB 2M17A 3ZUNA 3ENEA 2KQSA 5CHFA 5KHOA 1WFYA 2IY0B 2ZVOA 5D94A 3KW5B 4NJ6A 3DVNV 2KJHB 2Z59B 5AZGA 3UIPB 3VUXA 2RR9A 5J18A 1AARA 2JVCA 1NI2A 2DX5B 3Q3JA 1UGMA 4ZRJA 2ZPYA 3M63B 3K9PB 1P9DU 1WGGA 1WYWB 2WDTB 1IYFA 3QHTA 2XEWA 1TGZB 2D3GA 2RSUA 1S3SG 1YD8U 2NS5A 4RM8A 5AZHA 5JHBA 2LVQA 3MTNB 1X1MA 5E6OA 3DCGA 3WAPA 4EOYA 4F8CB 5J2RA 2G45B 3PV1A 4FN2A 4BKSA 1EF5A 3DQVA 3A33B 5E6PA 3VXWA 1E8ZA 3BY4B 1J19A 2NBUA 1GJZA 2A5UA 2BYEA 4TQ0A 4G11A 4IM0A 3B1LX 3OAWA 4DHJD 2XK5A 4EEWA 2DZKA 2CKHB 2LZ6A 5J17A 5JHAA 3UF8A 2JZZA 4IUMB 2DZIA 1J8CA 4W9EA 1WJ4A 3LJ3A 3VDZA 3PRZA 1V2YA 1TTNA 2D07B 4DXAB 3DBSA 5C23A 1LM8B 2KK8A 2O2VB 2ZJDA 3KUZA 4ZRKA 2D10A 2PE6B 4PYZA 1NBFC 2DYOA 2K8BA 3JSVB 2FIFA 2WWZA 2RPQA 3JVZX 3UIOB 3WALA 2CHXA 3TCAA 1SE9A 4I6PA 4WJNA 2GMIC 1EO6A 3PHWB 2YLMA 4DHJB 1SGHA 1NDDA 4WAAA 2ZEQA 3NHEB 2GBRA 1GNUA 1WXSA 1HE8A 4IWQA 1WGHA 4DHZE 1C3TA 2PE9A 4HWIB 1P3QU 4ANUA 2KTRB 2WYQA 3HK0A 3PREA 4W9JA 4W9GA 3TBLD 2J7QB 2G3QB 3L08A 4M0WB 1OEYA 1Q1OA 3U30A 1EUVB 1LQBA 5L95C 1WXAA 2PPHA 4KIKB 1JRUA 1H4RA 2C7HA 1V81A 3TL5A 3DBLI 1RLFA 5E6NA 1WMHA 3KH0A 4DK5A 3NZUA 3M3JA 2NBWB 2L76A 4MELA 5TR5A 2M0XA 3V6CB 3C0RB 2C7NB 4WWOA 2AWTA 2FIDA 2C5LC 2L7RA 4LDTB 1IP9A 4URKA 4DHZB 4ZDVA 2KC2A 2JRHA 4AJWA 1WI0A 4ZYNA 2EMTA 1YIWA 4WQOB 4TKNA 4XX5A 3I3TB 4LCDE 3B0AA 4ANXA 2XBBC 3R3MA 4KZCA 4W9KA 4W9CA 1UH6A 4MH0E 2WX1A 4OVVA 2IO3B 2KVRA 3PT2B 4WJPA 4AJYB 4HCNB 3VAWA 4J6IA 3QARA 4IWPA 2IYDB 1OEYJ 1V9JA 1V5TA 2KANA 1E7VA 1WXVA 2W9NA 3KYCD 3RZFA 3JW0X 4YL8A 2DZMA 1XD3B 2MP2B 3VQIA 3PZDA 3PRPB 4GXBA 4HXDA 1WMHB 4NNJB 1WJNA 4GDKA 2Z0EB 3H1UA 4MSQB 2MA9B 1GC7A 3D32A 4M8MA 3KUCB 3UQBA 2MSED 2DYMA 2N9XA 3A9JA 2BGFA 3APCA 3QWZB 2MCNB 5D2MB 4LJOB 4A3OA 1WX8A 4ASWC 4ANWA 2KJRA 4B95A 4WJQA 2BPSA 3AI5A 4HCPB 4F7ZA 3ZRFA 2BYFA 2KKCA 2ZZPB 3K9OB 2NPTB 1E7UA 3EC8A 2KXJA 2R2OA 2O6VA 2L00B 2LRUA 2JUOA 3A1QA 3L54A 3A9KB 4KV2A 3VTUA 2N9EB 5CHVC 1WF9A 3RYTA 4HPLB 1EF1A 2L05A 4BKTA 2KO3A 4NQLB 5BO4B 2HD5B 2KC1A 1WY8A 3SU8X 2VRRB 2K8HA 3ZIMA 1TBEA 2BYVE 5LXIB 2LJ5A 4AUQC 2IO2B 1WGDA 2ZPNA 4EFOA 2EKEC 3PSEB 3AULA 4MGZE 2KMAA 4MGIE 1V80A 2KHWB 2MBHA 4ICVA 4HVBA 3V62A 4HPMB 1WIAA 2K25A 1ZW7A 1T0YA 4GMVA 4WWPA 3R66C 5CX3A 3N30A 3X23A 4G50A 4X57B 1GC6A 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLB A;  2GBJ A;  2DZJ A;  4K7S A;  4N9F 4;  2ZCC A;  4FUL A;  1E8X A;  4BOZ B;  5CHW A;  3GOE A;  4PS3 A;  1QZE A;  1MG8 A;  3DBR I;  1OQY A;  1XT9 B;  3KYD D;  4FJV B;  3HM3 A;  4HDQ A;  2PJH A;  2AL3 A;  1E8W A;  3DOW A;  2CHZ A;  3V6E B;  2V3S A;  1YX6 B;  2FNJ B;  3L16 A;  2JZ3 B;  3PTF C;  2ZCB A;  1WM2 A;  4BOS C;  2N9P C;  4OVU A;  1WX7 A;  1ZKH A;  2RD0 A;  4II3 B;  4F1S A;  5HKH A;  2LVP A;  2BF8 B;  3HHM A;  3ZNI D;  5IA7 A;  1UBI A;  3PLV A;  2M1M A;  4IM2 A;  2MX2 A;  4PS7 A;  3ZTC A;  3ZNH B;  1E8Y A;  2R2Q A;  2FAZ A;  2ZVN A;  2G4S A;  4TQ1 A;  3ML8 A;  4HDO A;  3KVF B;  4LDT D;  2I1J A;  3V61 A;  2MBB B;  2MW5 A;  4XZ4 A;  3A4R A;  3ZNZ B;  2XK5 B;  2IY1 B;  2KDB A;  4LJP B;  2JPH A;  3P2B A;  3ZDM C;  4FBJ B;  2KJ6 A;  2JWZ A;  2KDF B;  2KLC A;  3RUL A;  3VUW A;  1FXT B;  2KZR A;  2DAF A;  3W1S C;  2KX3 A;  2FCQ A;  2CU1 A;  3NS8 A;  1RFA A;  2GBK A;  1F9J A;  3QJZ A;  2L0F A;  3PGE A;  4PS8 A;  1UEL A;  3VHT C;  3QCA A;  1P1A A;  4FJZ A;  2LI5 A;  1RRB A;  4RMA A;  1E5W A;  1CMX B;  3QQ8 B;  1WXM A;  1E90 A;  1WZ3 A;  4GDL A;  4W9D A;  1H8C A;  2GBM A;  1Q5W B;  1IPG A;  1P0R A;  2KQ7 A;  4GOC A;  4NJ7 A;  1WGR A;  4EZJ A;  3EHV A;  2D2Q A;  3OLM D;  4GN1 A;  5C1Z A;  2FCN A;  3IFW B;  4GGQ A;  1UBQ A;  3AU4 A;  1YJ1 A;  2K6D B;  2L3Z A;  3PS6 A;  2PEA A;  4WJO A;  2J0K A;  5JH5 C;  4MJS A;  4NAW A;  2KDE B;  5LLI A;  2KN5 A;  4W9F A;  4IW0 A;  2KD0 A;  3ALB A;  3IBE A;  1K8R B;  2FCM A;  2AYO B;  2V4L A;  4DWF A;  3QAQ A;  2KFK A;  4CYE A;  3H7P A;  4JIO U;  1OTR B;  3PVL A;  4B9K A;  3H9D A;  2FCS A;  1VD2 A;  4ANV A;  3ECI A;  3RD2 A;  1C1Y B;  2N1V A;  3M62 B;  3OJ3 A;  1WE7 A;  5G2N A;  4RM9 A;  2CR5 A;  4TUU A;  2HTH A;  5G55 A;  1WX9 A;  2G4D B;  3QX1 A;  2UWQ A;  4GU2 A;  3PPA A;  2N1W A;  5JZE B;  2MWS B;  2ZNV B;  2KX0 A;  1WGY A;  4EZL A;  2I1K A;  1GUA B;  4DDI D;  4KDI C;  2LXA A;  2B3A A;  3CF6 E;  4GSW A;  4JL9 A;  3ZTD A;  2J0J A;  1R4N I;  4GDK B;  2LUE A;  2K1F A;  3W1Y A;  2KWU B;  1ZGU B;  4ZRI A;  1WRD B;  3T9L A;  2LAS A;  4P7I A;  4AWJ A;  4JGH B;  4NY0 A;  2LD9 A;  2LWP A;  3A9J B;  5AEK B;  4FHJ A;  3WA0 A;  2N7E A;  3SD5 A;  1L7Y A;  2IZV B;  2K6Q A;  2CHW A;  1V49 A;  2WX0 A;  1WH3 A;  3MHS D;  1V6E A;  3O65 B;  4ICU A;  4IWO A;  3ZO5 B;  4AOF A;  1J0G A;  3Q3F A;  4CO7 A;  3CSF A;  2KWV B;  2V1Y A;  2MBO A;  5IAA C;  4FAD A;  2HE7 A;  4I6L B;  4FJY A;  4W9L A;  1UZX B;  3H7S A;  3AXC A;  1WM3 A;  4II2 B;  5AZF A;  2OJR A;  3ONS A;  2YVC A;  2O6V B;  3DBH I;  3B08 A;  4E71 A;  3PLU A;  4BBN C;  3A1Q B;  4K81 A;  2O2V A;  3T8M A;  5D7G A;  4BKS D;  2MQJ A;  3L13 A;  2IO0 B;  3WAO A;  4MM3 A;  2JT4 B;  3JSV A;  3KUD B;  2KOX A;  4NPN A;  1XQQ A;  3NY5 A;  4FHK A;  4FA6 A;  3DPD A;  4NQK E;  3TIX A;  2AEH A;  2K8C A;  2KTF A;  1TZ1 A;  3LDZ E;  3MJW A;  2DEN B;  2KWC A;  4IG7 B;  2GBN A;  2N4F A;  4KZ0 A;  2HJ8 A;  3VVW B;  1WR1 A;  4WWN A;  3WAM A;  5GMV A;  5FR6 A;  3TMP B;  4E3C A;  2KTR A;  1G6J A;  3GZN I;  1WE6 A;  1I35 A;  1WR6 E;  3PHX B;  2MBQ A;  3APF A;  4A3P A;  3VUY A;  2NCN A;  3CMM B;  4JQW C;  3H6N A;  4KIK A;  1KOT A;  1OGW A;  1GG3 A;  4KSK C;  4B6W A;  3V60 A;  2ASQ A;  2BKF A;  2M8S A;  4HJK A;  4K1R B;  2FUH B;  3W1S A;  4KSL C;  4BKG A;  3VH3 B;  2EMS A;  4JLC A;  3HM6 X;  1ISN A;  1M94 A;  2KDI A;  1P98 A;  4W9H A;  3ZW3 A;  1V86 A;  2M4N A;  3IVF A;  2LGY A;  2KLG A;  5KHQ A;  3WAN A;  1WJU A;  2IBI B;  3PRM B;  3L0W B;  2OOB B;  3DVN U;  3NZS A;  1WJ6 A;  4EUT A;  3UQA A;  2Z0D B;  3UGB B;  4A20 A;  4PYU A;  2BWE S;  3VTV A;  5CTR C;  2NR2 A;  3DVG Y;  2CS4 A;  3ML9 A;  4EKU A;  2NVU I;  3HIZ A;  5D6J B;  3X0W A;  2RGF A;  4IM3 A;  5DPT A;  2LGX A;  1KLV A;  4KDL B;  1UD7 A;  2DHZ A;  2JF5 A;  2JRI B;  4M8N A;  3VH4 B;  4TV3 A;  3QC8 B;  3OJ4 B;  3ZLZ A;  3N3K B;  4W9I A;  4GB9 A;  2QHO A;  2MP2 A;  5DCN A;  4DDG D;  1KM7 A;  5LXH A;  4BFR A;  1PQS A;  4XC2 A;  1LFD A;  3L10 B;  4MSM B;  2KFJ A;  3CST A;  4MGY E;  4HLE A;  4GIV A;  5EDS A;  3QK0 A;  3RT3 B;  2BWF A;  3M95 A;  1V5O A;  2DAJ A;  3JYU A;  3IG3 A;  4MGK E;  4I6N B;  1R4M I;  2MRP A;  4MEM A;  4EZK A;  1Y8R C;  3IHP C;  3DVG X;  3R7Q A;  2GOW A;  4BBN F;  3DDC B;  2A4Z A;  1L2N A;  2J0M A;  3RCZ A;  3QIJ A;  1VCB A;  3A4S C;  1WZ0 A;  3U7D A;  3ZNG C;  2C9W B;  1I42 A;  2KNB A;  2LVO A;  1YX5 B;  3ZVV A;  4GDL B;  3SHQ A;  1U4A A;  2NPT A;  1Z2M A;  1Q0W B;  3ZKJ C;  4G3X B;  1D3Z A;  2LXC A;  3WIM A;  2NBV B;  1BT0 A;  1RAX A;  4K7W A;  5DPS A;  4DBG A;  3A9K A;  3R7R A;  2LRW A;  1S1Q B;  2C7M B;  3NOB A;  3EEC A;  2DYB A;  3RZW C;  3VFK A;  4AP4 C;  2N7D A;  2ZNV C;  4FLH A;  4KVG B;  3U8Z A;  2JY6 A;  4IC7 B;  4G0N B;  3EFU A;  4MJS B;  4NAW B;  4HK2 A;  2REX A;  4E74 A;  1SIF A;  2AL6 A;  3S2A A;  2Y5B B;  3APD A;  2C60 A;  5DPW A;  1YQB A;  3SDL C;  5DPR A;  2IO1 B;  2KFK B;  3N32 A;  2L8J A;  3UIN B;  2O6V D;  3H7P B;  2K39 A;  3TJP A;  4K7U A;  2KMC A;  1LXD A;  2JXX A;  5L83 A;  3AU5 A;  3RUI B;  3ZRC A;  2LGD A;  2UYZ B;  2MBE A;  1KJT A;  3L17 A;  3QA8 A;  1A5R A;  4MDK E;  3VTW A;  4BVU C;  3BIN A;  3ZDT A;  4CHK A;  2L0T A;  1Z5S B;  2BKR B;  2M17 A;  3ZUN A;  3ENE A;  2KQS A;  5CHF A;  5KHO A;  1WFY A;  2IY0 B;  2ZVO A;  5D94 A;  3KW5 B;  4NJ6 A;  3DVN V;  2KJH B;  2Z59 B;  5AZG A;  3UIP B;  3VUX A;  2RR9 A;  5J18 A;  1AAR A;  2JVC A;  1NI2 A;  2DX5 B;  3Q3J A;  1UGM A;  4ZRJ A;  2ZPY A;  3M63 B;  3K9P B;  1P9D U;  1WGG A;  1WYW B;  2WDT B;  1IYF A;  3QHT A;  2XEW A;  1TGZ B;  2D3G A;  2RSU A;  1S3S G;  1YD8 U;  2NS5 A;  4RM8 A;  5AZH A;  5JHB A;  2LVQ A;  3MTN B;  1X1M A;  5E6O A;  3DCG A;  3WAP A;  4EOY A;  4F8C B;  5J2R A;  2G45 B;  3PV1 A;  4FN2 A;  4BKS A;  1EF5 A;  3DQV A;  3A33 B;  5E6P A;  3VXW A;  1E8Z A;  3BY4 B;  1J19 A;  2NBU A;  1GJZ A;  2A5U A;  2BYE A;  4TQ0 A;  4G11 A;  4IM0 A;  3B1L X;  3OAW A;  4DHJ D;  2XK5 A;  4EEW A;  2DZK A;  2CKH B;  2LZ6 A;  5J17 A;  5JHA A;  3UF8 A;  2JZZ A;  4IUM B;  2DZI A;  1J8C A;  4W9E A;  1WJ4 A;  3LJ3 A;  3VDZ A;  3PRZ A;  1V2Y A;  1TTN A;  2D07 B;  4DXA B;  3DBS A;  5C23 A;  1LM8 B;  2KK8 A;  2O2V B;  2ZJD A;  3KUZ A;  4ZRK A;  2D10 A;  2PE6 B;  4PYZ A;  1NBF C;  2DYO A;  2K8B A;  3JSV B;  2FIF A;  2WWZ A;  2RPQ A;  3JVZ X;  3UIO B;  3WAL A;  2CHX A;  3TCA A;  1SE9 A;  4I6P A;  4WJN A;  2GMI C;  1EO6 A;  3PHW B;  2YLM A;  4DHJ B;  1SGH A;  1NDD A;  4WAA A;  2ZEQ A;  3NHE B;  2GBR A;  1GNU A;  1WXS A;  1HE8 A;  4IWQ A;  1WGH A;  4DHZ E;  1C3T A;  2PE9 A;  4HWI B;  1P3Q U;  4ANU A;  2KTR B;  2WYQ A;  3HK0 A;  3PRE A;  4W9J A;  4W9G A;  3TBL D;  2J7Q B;  2G3Q B;  3L08 A;  4M0W B;  1OEY A;  1Q1O A;  3U30 A;  1EUV B;  1LQB A;  5L95 C;  1WXA A;  2PPH A;  4KIK B;  1JRU A;  1H4R A;  2C7H A;  1V81 A;  3TL5 A;  3DBL I;  1RLF A;  5E6N A;  1WMH A;  3KH0 A;  4DK5 A;  3NZU A;  3M3J A;  2NBW B;  2L76 A;  4MEL A;  5TR5 A;  2M0X A;  3V6C B;  3C0R B;  2C7N B;  4WWO A;  2AWT A;  2FID A;  2C5L C;  2L7R A;  4LDT B;  1IP9 A;  4URK A;  4DHZ B;  4ZDV A;  2KC2 A;  2JRH A;  4AJW A;  1WI0 A;  4ZYN A;  2EMT A;  1YIW A;  4WQO B;  4TKN A;  4XX5 A;  3I3T B;  4LCD E;  3B0A A;  4ANX A;  2XBB C;  3R3M A;  4KZC A;  4W9K A;  4W9C A;  1UH6 A;  4MH0 E;  2WX1 A;  4OVV A;  2IO3 B;  2KVR A;  3PT2 B;  4WJP A;  4AJY B;  4HCN B;  3VAW A;  4J6I A;  3QAR A;  4IWP A;  2IYD B;  1OEY J;  1V9J A;  1V5T A;  2KAN A;  1E7V A;  1WXV A;  2W9N A;  3KYC D;  3RZF A;  3JW0 X;  4YL8 A;  2DZM A;  1XD3 B;  2MP2 B;  3VQI A;  3PZD A;  3PRP B;  4GXB A;  4HXD A;  1WMH B;  4NNJ B;  1WJN A;  4GDK A;  2Z0E B;  3H1U A;  4MSQ B;  2MA9 B;  1GC7 A;  3D32 A;  4M8M A;  3KUC B;  3UQB A;  2MSE D;  2DYM A;  2N9X A;  3A9J A;  2BGF A;  3APC A;  3QWZ B;  2MCN B;  5D2M B;  4LJO B;  4A3O A;  1WX8 A;  4ASW C;  4ANW A;  2KJR A;  4B95 A;  4WJQ A;  2BPS A;  3AI5 A;  4HCP B;  4F7Z A;  3ZRF A;  2BYF A;  2KKC A;  2ZZP B;  3K9O B;  2NPT B;  1E7U A;  3EC8 A;  2KXJ A;  2R2O A;  2O6V A;  2L00 B;  2LRU A;  2JUO A;  3A1Q A;  3L54 A;  3A9K B;  4KV2 A;  3VTU A;  2N9E B;  5CHV C;  1WF9 A;  3RYT A;  4HPL B;  1EF1 A;  2L05 A;  4BKT A;  2KO3 A;  4NQL B;  5BO4 B;  2HD5 B;  2KC1 A;  1WY8 A;  3SU8 X;  2VRR B;  2K8H A;  3ZIM A;  1TBE A;  2BYV E;  5LXI B;  2LJ5 A;  4AUQ C;  2IO2 B;  1WGD A;  2ZPN A;  4EFO A;  2EKE C;  3PSE B;  3AUL A;  4MGZ E;  2KMA A;  4MGI E;  1V80 A;  2KHW B;  2MBH A;  4ICV A;  4HVB A;  3V62 A;  4HPM B;  1WIA A;  2K25 A;  1ZW7 A;  1T0Y A;  4GMV A;  4WWP A;  3R66 C;  5CX3 A;  3N30 A;  3X23 A;  4G50 A;  4X57 B;  1GC6 A;  2D11 A; 
#chains in the Genus database with same CATH topology
 4K7S A;  3AE3 B;  1C4P A;  3FKY A;  1QZE A;  3DBR I;  2ON8 A;  3HM3 A;  4N58 A;  2PJH A;  2AL3 A;  2W55 A;  3DOW A;  1YX6 B;  2Y3A A;  3ZQ4 A;  4RF1 A;  4OVU A;  3AEB B;  4II3 B;  3FIL A;  5IA7 A;  1MG4 A;  1FO4 A;  2ZW0 A;  4PS7 A;  3ZTC A;  2ZVN A;  1WSP A;  4XZ4 A;  2XK5 B;  2JPH A;  2KJ6 A;  2KLC A;  3RUL A;  1P7F A;  2PTL A;  4RMA A;  3QQ8 B;  1WXM A;  2IGH A;  2RDB C;  1WZ3 A;  4WQM A;  4W9D A;  1K50 A;  3NVZ A;  2KQ7 A;  3OLM D;  1YJJ A;  4GGQ A;  1UBQ A;  1YJ1 A;  1N63 A;  2V9H A;  3NVV A;  2J0K A;  4NAW A;  1XLO A;  2KDE B;  5EE1 A;  3IBE A;  2V4L A;  3KWV A;  4B0M A;  2W3R A;  3N1X C;  3P1M A;  4JIO U;  1OTR B;  4C00 A;  3W2D A;  4RM9 A;  2CR5 A;  4TUU A;  5G55 A;  2INC C;  2G4D B;  5BMH A;  1TIF A;  3QX1 A;  2UWQ A;  2N1W A;  2INP E;  2JZP A;  5JZE B;  3P42 A;  1M4V A;  2MWS B;  2ZNV B;  2KX0 A;  2NMQ A;  2GI9 A;  1GUA B;  4MAC A;  4DDI D;  4KDI C;  2MEK A;  1BXT A;  4GDK B;  3BWU D;  2K1F A;  3W1Y A;  1ZGU B;  1WRD B;  3I5J C;  3PO0 A;  1NEN B;  3E9S A;  4AWJ A;  4JGH B;  1J7A A;  1RM6 C;  2NTS A;  1T0Q C;  2E3T A;  1MHX A;  2IZV B;  2K6Q A;  1V49 A;  4CO7 A;  5LNK 1;  2V1Y A;  5IAA C;  2HE7 A;  4FJY A;  1E0Z A;  2AX5 A;  4A9A A;  4II2 B;  5AZF A;  3ONS A;  2IGG A;  2O6V B;  4BBN C;  4K81 A;  2O2V A;  4BKS D;  1QT9 A;  2K22 A;  2FBW B;  1NYR A;  1SF0 A;  1TT5 B;  2KYW A;  3DPD A;  5D3D A;  1TZ1 A;  3LDZ E;  1ROE A;  4AS1 A;  4KZ0 A;  2RDG A;  1WR1 A;  5FR6 A;  2KTR A;  1KFY B;  1G6J A;  1WE6 A;  1I35 A;  4M0W A;  3APF A;  3BK2 A;  4JQW C;  1SJE D;  3H6N A;  1OGW A;  4KSK C;  2ASQ A;  2BKF A;  2FUH B;  4BKG A;  1TS4 A;  1T0R C;  2KDI A;  4W9H A;  3ZW3 A;  1V86 A;  3PRM B;  2OOB B;  3NZS A;  1WJ6 A;  3UQA A;  2Z0D B;  2BWE S;  1ET6 A;  1Y56 A;  4K3C A;  2WXM A;  1JWM D;  2RGF A;  1I4G A;  1TY0 A;  1HTO A;  4M8N A;  4W9I A;  4KGR A;  2AQ2 B;  1KM7 A;  5LXH A;  4BFR A;  4MSM B;  2GLS A;  2VZK B;  4HLE A;  3IXS A;  4NAM A;  2BWF A;  4C7Z A;  1V5O A;  2DAJ A;  4C4V A;  1HZ5 A;  3IG3 A;  4I6N B;  3HVD A;  4MEM A;  3IHP C;  1VZ8 A;  3AV8 A;  3R7Q A;  1JWA D;  2K3U A;  1SE4 A;  4ACF A;  3U7D A;  3ZNG C;  2KNB A;  3RI7 C;  4GDL B;  1Z2M A;  2RMM A;  2NBV B;  1RAX A;  1D5Z C;  4K7W A;  5DPS A;  5E6J A;  3R7R A;  2C7M B;  3EEC A;  2DYB A;  3RZW C;  3VFK A;  1FNU A;  2DWQ A;  3BK1 A;  2PLP A;  3U8Z A;  2JY6 A;  3E56 A;  4G0N B;  3EFU A;  4HK2 A;  2AL6 A;  2Y5B B;  1YQB A;  2IO1 B;  3N32 A;  3H7P B;  2K39 A;  3DHH C;  3I9V 1;  1V1P A;  2JXX A;  3ZRC A;  4MDK E;  2WDR B;  4RCO A;  2KQS A;  5CHF A;  2BS2 B;  5H8Y E;  3TEZ A;  1NVI D;  4PT5 A;  2WHI A;  2JVC A;  1BML C;  1WRI A;  3K9P B;  1P9D U;  1L0Y B;  1TGZ B;  2D3G A;  2NS5 A;  5AZH A;  2IDY A;  5FR3 A;  1N62 A;  1WYG A;  1VJK A;  5E6O A;  3DCG A;  3WAP A;  2J4X A;  5J2R A;  3U4E G;  3A33 B;  3VXW A;  1GJZ A;  2RPV A;  2BYE A;  2HTM E;  1P7E A;  2LMC A;  2XK5 A;  2DZK A;  2CKH B;  2LZ6 A;  1ESF A;  2DZI A;  1J8C A;  1WJ4 A;  4KGS A;  1QOA A;  1ZXI A;  1TTN A;  3IAM 1;  3DBS A;  2JYE A;  3KUZ A;  4PYZ A;  2DYO A;  2FIF A;  1JRP A;  1IGD A;  2WXF A;  4I6P A;  2GMI C;  5FK9 C;  3T3N A;  3NHE B;  1E10 A;  2BW2 A;  1WGH A;  2WYQ A;  4W9G A;  2W82 A;  1C9F A;  3L08 A;  4QAY A;  1Q1O A;  3U30 A;  4S17 A;  1EUV B;  2WXL A;  1JRU A;  1H4R A;  2WXH A;  4DK5 A;  2L76 A;  4IKG A;  4MEL A;  2HDE A;  3RNF C;  4WWO A;  2AWT A;  1IP9 A;  4URK A;  4DHZ B;  4O1N A;  1OQR A;  4ARC A;  3VRA B;  2QEJ C;  4ZDV A;  2JRH A;  4ZYN A;  2I2Y A;  2EMT A;  4XX5 A;  1DOY A;  3I3T B;  2XBB C;  4W9K A;  5FKA C;  4W9C A;  4MH0 E;  2L83 A;  2IO3 B;  2KVR A;  2WP9 B;  1OEY J;  4EE2 A;  1V5T A;  4ZHO A;  3TEW A;  1E9M A;  4JX1 C;  4YL8 A;  4K3B A;  2V0G A;  1XD3 B;  3PZD A;  4GXB A;  1WJN A;  4GDK A;  2ICI A;  3H1U A;  4M8M A;  1T0S C;  3RNB C;  2IJ0 A;  1L5P A;  3APC A;  4LJO B;  1QOB A;  2KJR A;  5C3J B;  3W5U B;  4WJQ A;  3AI5 A;  3P4Q B;  2NTT A;  3ZRF A;  2R61 A;  4N6E B;  1N61 A;  2LHE A;  4HJG E;  1E7U A;  3EC8 A;  2MJ3 A;  2O6V A;  3A9K B;  4YSX B;  5G5G A;  2N9E B;  1WF9 A;  2Q5W D;  4BKT A;  2DBY A;  4NQL B;  3AN1 A;  5BO4 B;  3HUI A;  3SU8 X;  4ZRP A;  4AUQ C;  1ZDX A;  2ZPN A;  3B2G A;  2KMA A;  2MBH A;  4ICV A;  1WIA A;  2K25 A;  2QMT A;  5JXV A;  5CX3 A;  3N30 A;  3X23 A;  2OJW A;  1GG3 A;  4TMA B;  2D11 A;  2GBJ A;  2EEL A;  2ZCC A;  4BOZ B;  2WXK A;  1MG8 A;  3C8Y A;  2WXP A;  1HQR D;  1E8W A;  2FNJ B;  4LNN A;  1FFU A;  4BOS C;  1WX7 A;  1ZKH A;  4F1S A;  2LVP A;  3U7Z A;  2PMV A;  3ZNH B;  1QF6 A;  1E8Y A;  1STE A;  1XCT L;  4HDO A;  4LDT D;  3GS2 A;  2IND C;  3V61 A;  2MBB B;  3ZNZ B;  3A4R A;  4HRO A;  4DXF A;  2KAC A;  2KDB A;  4LJP B;  4HPP A;  3VUW A;  1FNV A;  1GB4 A;  2BS4 B;  1FXT B;  2KZR A;  3W1S C;  3NS8 A;  1RFA A;  2GBK A;  4J3O D;  1I4Q A;  1YOV B;  3QJZ A;  3PGE A;  4XGA B;  1SE2 A;  4PS8 A;  1UEL A;  1E5W A;  1E90 A;  4GDL A;  4OZC A;  2GBM A;  3NZ3 A;  4EZJ A;  2D2Q A;  2INN E;  5GXG B;  3AU4 A;  3TUO A;  2K6D B;  3PS6 A;  2PEA A;  1V1O A;  3FC4 A;  5LLI A;  4W9F A;  4IW0 A;  3Q2A C;  3ZYY X;  2KD0 A;  2FCM A;  2QDF A;  2AYO B;  3MJ5 A;  1ET9 A;  4YTN B;  3H7P A;  3H9D A;  5C2T B;  1EU3 A;  3M62 B;  1WE7 A;  1ZPS A;  2JQR B;  5AUI A;  4AQ7 A;  4A90 A;  2J52 A;  1E6E B;  2KWD A;  1QLB B;  2I1K A;  1L0V B;  2LXA A;  3CF6 E;  4GSW A;  3C19 A;  1YMH E;  4ZRI A;  3AE4 B;  2Y5P A;  3WA0 A;  1UF0 A;  5BMG A;  3MHS D;  1WH3 A;  4OW0 A;  1V6E A;  4ICU A;  4KKJ A;  3ZO5 B;  3CSF A;  2KWV B;  2MBO A;  3Q3M C;  1OQQ A;  4I6L B;  4W9L A;  1UZX B;  2N0S B;  3AXC A;  1JAL A;  2M0A A;  1WWT A;  3A1Q B;  4USA A;  4YTM B;  3T8M A;  2B76 B;  5D7G A;  3L13 A;  4GLS C;  1L6V A;  3KUD B;  1XQQ A;  4FHK A;  3P4R B;  4NQK E;  2AEH A;  2K8C A;  3AE9 B;  1FFV A;  2DEN B;  2KWC A;  2PIA A;  2HJ8 A;  1F2R C;  2L32 A;  4WWN A;  5GMV A;  3NVW A;  4E3C A;  2I38 A;  4US8 A;  3RNA C;  2MBQ A;  4HJK A;  4KGT A;  2EMS A;  3RMK C;  1M94 A;  2WXI A;  4RFB A;  3IVF A;  2LGY A;  2KLG A;  5KHQ A;  2IGD A;  4YWG G;  2BYT A;  1BUI C;  2W54 A;  4PYU A;  3VTV A;  3DVG Y;  3P4S B;  1HEZ E;  1FMA D;  4IM3 A;  3RPF C;  4KDL B;  2IPK D;  2DHZ A;  3VH4 B;  4TV3 A;  3QC8 B;  3OJ4 B;  1KRH A;  2KN4 A;  4WAF A;  4LNK A;  1PQS A;  3HRD D;  1FCC C;  3RT3 B;  3JYU A;  4M00 A;  2MRP A;  1Y8R C;  4BBN F;  1YQ3 B;  1XO3 A;  3T3O A;  2A4Z A;  3RCZ A;  1PGX A;  1VCB A;  1WZ0 A;  1F52 A;  4UDU C;  1YX5 B;  3ZVV A;  3AEA B;  1Q0W B;  4G3X B;  1D3Z A;  1MI0 A;  4DBG A;  3A9K A;  2LRW A;  2SAK A;  4LNI A;  4AP4 C;  4LNF A;  3DBL B;  2N7D A;  3B9J A;  4FLH A;  4KVG B;  3SFD B;  2BBC A;  4E74 A;  2N9L A;  3S2A A;  3SDL C;  5DPR A;  2KFK B;  3Q69 A;  4K7U A;  2KMC A;  1LXD A;  5TSS A;  3Q8E A;  3RUI B;  3QA8 A;  3L17 A;  3GP7 A;  3VTW A;  3BIN A;  3ZDT A;  4CHK A;  4XWW A;  2PVG C;  2M17 A;  3ENE A;  4A6Q A;  2KJH B;  2Z59 B;  3UIP B;  2WS3 B;  3VUX A;  1VRA B;  1I4R A;  4REZ A;  1OFF A;  2RR9 A;  1NI2 A;  2DX5 B;  5BMI A;  2WXO A;  2ZPY A;  4BZA A;  1WYW B;  2WDT B;  3QHT A;  2RSU A;  2JYT A;  4EOY A;  4F8C B;  4B0E A;  3DHI C;  1EF5 A;  4JE3 B;  1E8Z A;  3BY4 B;  1C76 A;  1J19 A;  4ARI A;  2A5U A;  3EGR A;  4G11 A;  3DWM A;  4IM0 A;  3RFZ B;  3B1L X;  1PGA A;  4EEW A;  4HKZ E;  1JCK B;  4LTU A;  3AH7 A;  3LJ3 A;  4DXA B;  4XWT A;  5C23 A;  1LM8 B;  2KK8 A;  2ZJD A;  2D10 A;  2PE6 B;  1C77 A;  1NBF C;  3DHG C;  5BYR A;  2WWZ A;  3JVZ X;  4XYC A;  3WAL A;  3W9C B;  3TCA A;  1SE9 A;  4WJN A;  4L1B A;  3ETR A;  4DHJ B;  1ACC A;  2Y5C A;  4WAA A;  2ZEQ A;  1HXY D;  2MH7 A;  1HE8 A;  4RGT A;  2PE9 A;  3I57 A;  3HK0 A;  3AEE B;  1D6E C;  1OEY A;  5BYQ A;  1LQB A;  1GOZ A;  4KIK B;  4A55 A;  1MFW A;  1V81 A;  3DBL I;  1RLF A;  5E6N A;  3KH0 A;  3BVZ A;  3SFE B;  2NBW B;  2M0X A;  3V3X A;  1GPX A;  2RDH A;  5D3I B;  4IOI E;  1UWM A;  2MJD A;  1K52 A;  1T5X D;  2AQ1 B;  1JRO A;  1WI0 A;  1YIW A;  3B0A A;  3FAH A;  1UH6 A;  4IDI A;  2WX1 A;  4OVV A;  2J42 A;  3AE2 B;  2HJ1 A;  4IWP A;  2KAN A;  2JX5 A;  2W9N A;  3KYC D;  4YSZ B;  2MP2 B;  1HA5 A;  3VQI A;  4HXD A;  2V4I B;  3AE6 B;  1WMH B;  2H89 B;  4MSQ B;  2MA9 B;  3KQ4 A;  3TEY A;  2MSE D;  5D2M B;  4A3O A;  4B95 A;  4HCP B;  5T8I A;  5H92 C;  3K9O B;  2D3C A;  2KXJ A;  3EUB 2;  1DOX A;  1YN4 A;  2LRU A;  3A1Q A;  4JWS C;  3RYT A;  2KAJ A;  1EF1 A;  2L05 A;  3BZD B;  3RN9 C;  1WY8 A;  2VRR B;  2BYV E;  2VH1 A;  1WGD A;  2V3P A;  3AUL A;  4MGI E;  2KHW B;  4L2Y A;  1T0Y A;  4GMV A;  1AYF A;  3R66 C;  3U52 E;  2MLB A;  4N9F 4;  4FUL A;  5CHW A;  3GOE A;  4PS3 A;  1QIL A;  1N6Z A;  4FJV B;  4HDQ A;  3AEC B;  3L16 A;  4YT0 B;  4C80 A;  2ZCB A;  1JWU D;  1YN3 A;  3IAS 1;  2N9P C;  2BT6 A;  2RD0 A;  5HKH A;  3W5V B;  4CQN A;  3HHM A;  4XDC A;  1UBI A;  2N9K A;  3PLV A;  3AM9 A;  2M1M A;  2MX2 A;  2R2Q A;  2KQ4 X;  2G4S A;  4TQ1 A;  3ML8 A;  2H88 B;  1F1H A;  3KVF B;  2MJE A;  2MW5 A;  3AE5 B;  3RNG C;  1XLN A;  3P2B A;  4FBJ B;  2KDF B;  1FRD A;  2DAF A;  2KX3 A;  1VZ7 A;  2CU1 A;  1NYQ A;  3GE8 C;  1UUP A;  3QCA A;  1P1A A;  1A70 A;  1MVK A;  2FE8 A;  2LI5 A;  3CIR B;  2D3A A;  1CMX B;  4WUR A;  1J7C A;  4RGM A;  1Q5W B;  4GOC A;  1JML A;  3EHV A;  4GN1 A;  1SB3 C;  5C1Z A;  2FCN A;  3IFW B;  1YQ4 B;  1SEB D;  3CWI A;  3EA6 A;  4WJO A;  1YNT E;  4ITK A;  2KN5 A;  1TY2 A;  3ALB A;  1SBB B;  1TKY A;  3GE3 C;  2KFK A;  4CYE A;  3H8H A;  1XCQ L;  4B9K A;  1VD2 A;  1NEK B;  1UWX A;  2D5G A;  1C1Y B;  1NI3 A;  3OJ3 A;  5IN7 A;  4RH6 A;  3N1Y C;  1TZO A;  1N60 A;  4P1C C;  5EE3 A;  2OHF A;  1YJI A;  1KF6 B;  3I63 C;  1WGY A;  3ZTD A;  2B3A A;  2J0J A;  1FNW A;  2KWU B;  1ZUD 2;  3NVY A;  3EFC A;  2LAS A;  4NY0 A;  3A9J B;  5AEK B;  1XLP A;  4FHJ A;  2LGS A;  2N7E A;  2JU6 X;  1R7S A;  1L7Y A;  5I4D A;  2WX0 A;  4AOF A;  2WXN A;  1J0G A;  2CJO A;  2WXR A;  1CK1 A;  4FAD A;  3KWL A;  2VH2 A;  3H7S A;  1WM3 A;  4P6V F;  2YVC A;  3B08 A;  5IKC M;  2IO0 B;  4D2K A;  3WAO A;  4DXG A;  3PZ8 A;  4NPN A;  1K51 A;  1TS3 A;  3TIX A;  1VR9 A;  3MJW A;  2GBN A;  2N4F A;  3VVW B;  1FPY A;  2G1E A;  3AEF B;  3TMP B;  3MP9 A;  1DGJ A;  1WR6 E;  2ACZ B;  4A3P A;  3VUY A;  4KIK A;  3V60 A;  3R2T A;  2WXQ A;  4K1R B;  4KSL C;  3VH3 B;  3HM6 X;  1P98 A;  1HTQ A;  2M4N A;  3WAN A;  2IBI B;  3L0W B;  3DVN U;  1PFD A;  2KDM A;  3UGB B;  5CTR C;  2NR2 A;  3L4P A;  2YEP B;  4EKU A;  2NVU I;  1KLV A;  3R2I A;  1QOF A;  2JF5 A;  2JRI B;  4Q2J A;  4C56 C;  4GB9 A;  2MP2 A;  5DCN A;  4RGO S;  4DDG D;  1VZ6 A;  2E6X A;  3SR6 A;  4BAX A;  1SSN A;  4XC2 A;  3L10 B;  2KFJ A;  4GIV A;  5EDS A;  3M95 A;  2SEB D;  1VDV A;  4EZK A;  1TS2 A;  3VRB B;  2GOW A;  3ZJT A;  5HG2 A;  1QQR A;  2J0M A;  3KLS X;  3A4S C;  2WDQ B;  2N7J A;  2C9W B;  1I42 A;  1MJD A;  3SHQ A;  3ZKJ C;  1FIQ A;  3WIM A;  3NOB A;  1V8C A;  5AUK A;  4P1B C;  1ZP0 B;  2ZNV C;  2V3N A;  1JWS D;  4MJS B;  2REX A;  4S0R A;  3BVM A;  1SIF A;  4A8X C;  2C60 A;  5DPW A;  2L8J A;  3UIN B;  2O6V D;  1F77 A;  2AQ3 B;  5L83 A;  4RF0 A;  2MBE A;  1KJT A;  1A5R A;  3Q6B A;  3P63 A;  3O13 A;  3ZUN A;  1WFY A;  2ZVO A;  4NJ6 A;  3DVN V;  2QIL A;  1V97 A;  3NS1 A;  4TSS A;  5J18 A;  2ZW1 A;  1AWD A;  3Q3J A;  1CQV A;  4ZRJ A;  3M63 B;  1WGG A;  1KTK A;  1YD8 U;  1I4H A;  1VLB A;  2LEK A;  2BS3 B;  1X1M A;  1V1P B;  3Q14 C;  4WWM A;  4BKS A;  3DQV A;  2D3B A;  3OAW A;  4DHJ D;  2PW9 A;  1UNS A;  5JHA A;  2JZZ A;  4IUM B;  4W9E A;  3MC0 B;  3TEX A;  1RWS A;  1SE3 A;  3J9C A;  1SIJ A;  4MM3 B;  3JSV B;  2RPQ A;  3UIO B;  4JWU C;  1EO6 A;  2VZK D;  2YLM A;  3PHW B;  1GNU A;  1QKZ A;  4LNO A;  4DHZ E;  1C3T A;  1F0Z A;  4HWI B;  1TKG A;  1P3Q U;  4ANU A;  1FD6 A;  2M56 B;  5EE0 A;  3TBL D;  4W9J A;  4OHJ A;  2J7Q B;  2G3Q B;  3N1Z C;  1HZ6 A;  1LO5 D;  3Q3N C;  1PYW D;  4MH8 A;  1IBX B;  2PPH A;  2DNF A;  3TL5 A;  2QSD A;  3RNC C;  2BQQ A;  5IO9 A;  2C7N B;  1D5M C;  1MPE A;  4LDT B;  1FRR A;  1N5X A;  4WQO B;  4TKN A;  4LCD E;  2BB6 A;  4KZC A;  4ZHP A;  4HEA 1;  3PT2 B;  4AJY B;  4HCN B;  4J6I A;  2JSV X;  1C78 A;  1EWY C;  4ZYS A;  1WXV A;  3JW0 X;  2DZM A;  3PRP B;  4NNJ B;  1I4P A;  1T3Q A;  1GC7 A;  3D32 A;  3A9J A;  2DYM A;  2N9X A;  2MCN B;  1FXA A;  4HRS A;  1WX8 A;  4ASW C;  4ANW A;  1ZOY B;  4F7Z A;  3NUH B;  2BYF A;  1EU4 A;  2KVZ A;  4OZA A;  2NPT B;  2R2O A;  2WQY B;  4HPL B;  2KO3 A;  1RYJ A;  2WLB A;  3ZIM A;  1TBE A;  2QC8 A;  4KKI A;  4EFO A;  3PSE B;  1J7B A;  1V80 A;  4HVB A;  2BTE A;  4WWP A;  4X57 B;  2QIE B;  3Q8B A;  2DZJ A;  1JQ4 A;  1E8X A;  4US9 A;  4N59 A;  1AW7 A;  1OQY A;  1XT9 B;  3KYD D;  1R4N B;  1WXQ A;  2CHZ A;  3V6E B;  1XEE A;  2V3S A;  2JZ3 B;  3PTF C;  1PGB A;  1WM2 A;  1KLU D;  2BF8 B;  3ZNI D;  1MHH E;  4KX6 B;  3AE8 B;  4IM2 A;  4HKQ A;  2FAZ A;  1K53 A;  3P4P B;  3BYT B;  2I1J A;  3N20 C;  3DBH B;  3BII D;  2IY1 B;  3ZDM C;  1FCL A;  2JWZ A;  1XXG A;  3IT4 B;  1PDX A;  2CJN A;  1JW9 D;  2FCQ A;  2LHD A;  1FEH A;  1F9J A;  2L0F A;  3VHT C;  1YN5 A;  4FJZ A;  3ZXR A;  2LGI A;  1RRB A;  4NZL B;  1H8C A;  1C79 A;  4M01 A;  1IPG A;  1P0R A;  3GZN B;  4NJ7 A;  1WGR A;  2LFI A;  1IUE A;  1C4C A;  3OG5 A;  1JWB D;  1CZP A;  2X38 A;  1FXI A;  2L3Z A;  5JH5 C;  4MJS A;  3B2F A;  1K8R B;  1LGR A;  4DWF A;  3QAQ A;  2XN9 C;  3WCQ A;  3PVL A;  2FCS A;  5IOI A;  4ANV A;  3ECI A;  3RD2 A;  4DQO C;  2N1V A;  3LB8 C;  5G2N A;  2HTH A;  1ZE3 D;  1WX9 A;  1SJH D;  3AEG B;  1L4Z B;  4GU2 A;  1FM0 D;  3ZXV A;  3PPA A;  4YSY B;  3UI3 A;  2UU7 A;  2TSS A;  3ZJV A;  3NG0 A;  4EZL A;  2YEP F;  2K5P A;  1EWC A;  2L52 A;  4JL9 A;  1R4N I;  1R4M B;  2LUE A;  3T9L A;  2WU5 B;  4P7I A;  2LD9 A;  2LWP A;  5HHD G;  3VR9 B;  1UGJ A;  3V05 A;  1AN8 A;  1F2R I;  2KT7 A;  3SEB A;  1SXT A;  4JPS A;  3NJT A;  5EE9 A;  3SD5 A;  2CHW A;  2GRI A;  4L23 A;  4IWO A;  3O65 B;  2J53 A;  3R8B A;  3Q3F A;  4YXD B;  2Z8L A;  2OJR A;  3DBH I;  4E71 A;  1KH0 A;  3PLU A;  4OZB A;  2MQJ A;  1GB1 A;  4MM3 A;  1Q10 A;  2JT4 B;  3JSV A;  2KOX A;  4XE0 A;  3RNE C;  3NY5 A;  4FA6 A;  2KTF A;  4IG7 B;  1DYQ A;  2MHJ A;  2QCZ A;  3Q8F A;  3WAM A;  2WDV B;  1TJE A;  4R3D A;  3GZN I;  3URY A;  3PHX B;  2NCN A;  3DWG C;  3CMM B;  2KMM A;  1L6U A;  1IBX A;  1KOT A;  4B6W A;  2M8S A;  2JWU A;  5BYS A;  1IGC A;  3W1S A;  4JLC A;  5HFY A;  1ISN A;  2LUM A;  1T6B X;  3AB5 A;  1WJU A;  3MFG A;  2LJI A;  3AE1 B;  4EUT A;  4A20 A;  1ZXH A;  2CS4 A;  3ML9 A;  2FUG 1;  3HIZ A;  5D6J B;  3FIL B;  3X0W A;  5DPT A;  2LGX A;  1UD7 A;  3TSS A;  3ZLZ A;  3N3K B;  1I4X A;  2QHO A;  3LYY A;  1LFD A;  4XDD A;  4ZOH C;  3CST A;  4MGY E;  3QK0 A;  2M19 A;  4MGK E;  1R4M I;  1TS5 A;  3NRZ A;  3DVG X;  4NJC A;  3DDC B;  1L2N A;  3QIJ A;  1B9R A;  5MPO A;  2LVO A;  2W3S A;  2X8X X;  1U4A A;  2NPT A;  3LXF A;  2LXC A;  1BT0 A;  1ENF A;  2QJL A;  1S1Q B;  3MC8 A;  2OED A;  1I7H A;  2WXJ A;  4IC7 B;  2CU3 A;  4NAW B;  3APD A;  4H2A A;  3TJP A;  4OVZ A;  3AU5 A;  3GB1 A;  2LGD A;  2UYZ B;  3AE7 B;  4BVU C;  2L0T A;  3ABV B;  1Z5S B;  2BKR B;  5KHO A;  5D94 A;  2IY0 B;  3KW5 B;  1TYG B;  3AED B;  5AZG A;  1TKE A;  3AMZ A;  1AAR A;  1UGM A;  2K0P A;  1IYF A;  2XEW A;  1S3S G;  4M02 A;  4RM8 A;  5JHB A;  1EM7 A;  4MT5 A;  2LVQ A;  3MTN B;  5G5H A;  4LLG M;  2G45 B;  3PV1 A;  4FN2 A;  5E6P A;  5HI1 A;  2NBU A;  4TQ0 A;  2WGS A;  1KLG D;  5J17 A;  3Q8C A;  3UF8 A;  3VDZ A;  2K9X A;  1V2Y A;  3PRZ A;  2D07 B;  2O2V B;  4ZRK A;  2K8B A;  1ZDV A;  4RNA A;  2CHX A;  2XNA C;  3BYY B;  2BB5 A;  1D5X C;  1SGH A;  3PZ7 A;  4WH4 A;  4YTP B;  1NDD A;  2GBR A;  3ZJU A;  1WXS A;  3OWE B;  4IWQ A;  1XLQ A;  2KTR B;  3PRE A;  2L1A A;  4M0W B;  5L95 C;  1WXA A;  2C7H A;  3DBR B;  1WMH A;  1GAQ B;  3NZU A;  3M3J A;  1L0X B;  1XF5 L;  5TR5 A;  3V6C B;  3C0R B;  4ZRQ A;  2FID A;  2C5L C;  2WU2 B;  4WIP A;  2L7R A;  1N5W A;  4FXC A;  3Q8A A;  2JXT A;  3BVG A;  5IP4 D;  2KC2 A;  4AJW A;  3MHZ A;  4ANX A;  3N9Y C;  4C7Y A;  3R3M A;  2WNM A;  2ONQ A;  4WJP A;  3VAW A;  1B1Z A;  3QAR A;  2IYD B;  1V9J A;  1PUT A;  1E7V A;  3RZF A;  3Q3O C;  3VR8 B;  2Z0E B;  1E7P B;  3KUC B;  2BVC A;  1WGK A;  4C4V B;  3UQB A;  1RFK A;  3MC9 A;  2BGF A;  3QWZ B;  1CJE A;  2G9H D;  2BPS A;  1QOG A;  2WXG A;  2KKC A;  3U2S C;  2ZZP B;  2PVO D;  4RGN A;  1C4A A;  2DLB A;  2L00 B;  4P16 A;  2JUO A;  3L54 A;  4KV2 A;  3VTU A;  5CHV C;  1DOI A;  1L4D B;  4LK0 M;  3HVZ A;  2PKO A;  2HD5 B;  2KC1 A;  3ZGZ A;  2K8H A;  3IT6 B;  5LXI B;  2LJ5 A;  2IO2 B;  2EKE C;  4MGZ E;  2EKI A;  3V62 A;  4HPM B;  1ZW7 A;  4G50 A;  1GC6 A;  2GB1 A;  1D4B A;  4PK1 A; 
#chains in the Genus database with same CATH homology
 2MLB A;  2GBJ A;  2DZJ A;  4K7S A;  4N9F 4;  2ZCC A;  4FUL A;  1E8X A;  4BOZ B;  5CHW A;  3GOE A;  4PS3 A;  1QZE A;  1MG8 A;  3DBR I;  1OQY A;  1XT9 B;  3KYD D;  4FJV B;  3HM3 A;  4HDQ A;  2PJH A;  2AL3 A;  1E8W A;  3DOW A;  2CHZ A;  3V6E B;  2V3S A;  1YX6 B;  2FNJ B;  3L16 A;  2JZ3 B;  3PTF C;  2ZCB A;  1WM2 A;  4BOS C;  2N9P C;  4OVU A;  1WX7 A;  1ZKH A;  2RD0 A;  4II3 B;  4F1S A;  5HKH A;  2LVP A;  2BF8 B;  3HHM A;  3ZNI D;  5IA7 A;  1UBI A;  3PLV A;  2M1M A;  4IM2 A;  2MX2 A;  4PS7 A;  3ZTC A;  3ZNH B;  1E8Y A;  2R2Q A;  2FAZ A;  2ZVN A;  2G4S A;  4TQ1 A;  3ML8 A;  4HDO A;  3KVF B;  4LDT D;  2I1J A;  3V61 A;  2MBB B;  2MW5 A;  4XZ4 A;  3A4R A;  3ZNZ B;  2XK5 B;  2IY1 B;  2KDB A;  4LJP B;  2JPH A;  3P2B A;  3ZDM C;  4FBJ B;  2KJ6 A;  2JWZ A;  2KDF B;  2KLC A;  3RUL A;  3VUW A;  1FXT B;  2KZR A;  2DAF A;  3W1S C;  2KX3 A;  2FCQ A;  2CU1 A;  3NS8 A;  1RFA A;  2GBK A;  1F9J A;  3QJZ A;  2L0F A;  3PGE A;  4PS8 A;  1UEL A;  3VHT C;  3QCA A;  1P1A A;  4FJZ A;  2LI5 A;  1RRB A;  4RMA A;  1E5W A;  1CMX B;  3QQ8 B;  1WXM A;  1E90 A;  1WZ3 A;  4GDL A;  4W9D A;  1H8C A;  2GBM A;  1Q5W B;  1IPG A;  1P0R A;  2KQ7 A;  4GOC A;  4NJ7 A;  1WGR A;  4EZJ A;  3EHV A;  2D2Q A;  3OLM D;  4GN1 A;  5C1Z A;  2FCN A;  3IFW B;  4GGQ A;  1UBQ A;  3AU4 A;  1YJ1 A;  2K6D B;  2L3Z A;  3PS6 A;  2PEA A;  4WJO A;  2J0K A;  5JH5 C;  4MJS A;  4NAW A;  2KDE B;  5LLI A;  2KN5 A;  4W9F A;  4IW0 A;  2KD0 A;  3ALB A;  3IBE A;  1K8R B;  2FCM A;  2AYO B;  2V4L A;  4DWF A;  3QAQ A;  2KFK A;  4CYE A;  3H7P A;  4JIO U;  1OTR B;  3PVL A;  4B9K A;  3H9D A;  2FCS A;  1VD2 A;  4ANV A;  3ECI A;  3RD2 A;  1C1Y B;  2N1V A;  3M62 B;  3OJ3 A;  1WE7 A;  5G2N A;  4RM9 A;  2CR5 A;  4TUU A;  2HTH A;  5G55 A;  1WX9 A;  2G4D B;  3QX1 A;  2UWQ A;  4GU2 A;  3PPA A;  2N1W A;  5JZE B;  2MWS B;  2ZNV B;  2KX0 A;  1WGY A;  4EZL A;  2I1K A;  1GUA B;  4DDI D;  4KDI C;  2LXA A;  2B3A A;  3CF6 E;  4GSW A;  4JL9 A;  3ZTD A;  2J0J A;  1R4N I;  4GDK B;  2LUE A;  2K1F A;  3W1Y A;  2KWU B;  1ZGU B;  4ZRI A;  1WRD B;  3T9L A;  2LAS A;  4P7I A;  4AWJ A;  4JGH B;  4NY0 A;  2LD9 A;  2LWP A;  3A9J B;  5AEK B;  4FHJ A;  3WA0 A;  2N7E A;  3SD5 A;  1L7Y A;  2IZV B;  2K6Q A;  2CHW A;  1V49 A;  2WX0 A;  1WH3 A;  3MHS D;  1V6E A;  3O65 B;  4ICU A;  4IWO A;  3ZO5 B;  4AOF A;  1J0G A;  3Q3F A;  4CO7 A;  3CSF A;  2KWV B;  2V1Y A;  2MBO A;  5IAA C;  4FAD A;  2HE7 A;  4I6L B;  4FJY A;  4W9L A;  1UZX B;  3H7S A;  3AXC A;  1WM3 A;  4II2 B;  5AZF A;  2OJR A;  3ONS A;  2YVC A;  2O6V B;  3DBH I;  3B08 A;  4E71 A;  3PLU A;  4BBN C;  3A1Q B;  4K81 A;  2O2V A;  3T8M A;  5D7G A;  4BKS D;  2MQJ A;  3L13 A;  2IO0 B;  3WAO A;  4MM3 A;  2JT4 B;  3JSV A;  3KUD B;  2KOX A;  4NPN A;  1XQQ A;  3NY5 A;  4FHK A;  4FA6 A;  3DPD A;  4NQK E;  3TIX A;  2AEH A;  2K8C A;  2KTF A;  1TZ1 A;  3LDZ E;  3MJW A;  2DEN B;  2KWC A;  4IG7 B;  2GBN A;  2N4F A;  4KZ0 A;  2HJ8 A;  3VVW B;  1WR1 A;  4WWN A;  3WAM A;  5GMV A;  5FR6 A;  3TMP B;  4E3C A;  2KTR A;  1G6J A;  3GZN I;  1WE6 A;  1I35 A;  1WR6 E;  3PHX B;  2MBQ A;  3APF A;  4A3P A;  3VUY A;  2NCN A;  3CMM B;  4JQW C;  3H6N A;  4KIK A;  1KOT A;  1OGW A;  1GG3 A;  4KSK C;  4B6W A;  3V60 A;  2ASQ A;  2BKF A;  2M8S A;  4HJK A;  4K1R B;  2FUH B;  3W1S A;  4KSL C;  4BKG A;  3VH3 B;  2EMS A;  4JLC A;  3HM6 X;  1ISN A;  1M94 A;  2KDI A;  1P98 A;  4W9H A;  3ZW3 A;  1V86 A;  2M4N A;  3IVF A;  2LGY A;  2KLG A;  5KHQ A;  3WAN A;  1WJU A;  2IBI B;  3PRM B;  3L0W B;  2OOB B;  3DVN U;  3NZS A;  1WJ6 A;  4EUT A;  3UQA A;  2Z0D B;  3UGB B;  4A20 A;  4PYU A;  2BWE S;  3VTV A;  5CTR C;  2NR2 A;  3DVG Y;  2CS4 A;  3ML9 A;  4EKU A;  2NVU I;  3HIZ A;  5D6J B;  3X0W A;  2RGF A;  4IM3 A;  5DPT A;  2LGX A;  1KLV A;  4KDL B;  1UD7 A;  2DHZ A;  2JF5 A;  2JRI B;  4M8N A;  3VH4 B;  4TV3 A;  3QC8 B;  3OJ4 B;  3ZLZ A;  3N3K B;  4W9I A;  4GB9 A;  2QHO A;  2MP2 A;  5DCN A;  4DDG D;  1KM7 A;  5LXH A;  4BFR A;  1PQS A;  4XC2 A;  1LFD A;  3L10 B;  4MSM B;  2KFJ A;  3CST A;  4MGY E;  4HLE A;  4GIV A;  5EDS A;  3QK0 A;  3RT3 B;  2BWF A;  3M95 A;  1V5O A;  2DAJ A;  3JYU A;  3IG3 A;  4MGK E;  4I6N B;  1R4M I;  2MRP A;  4MEM A;  4EZK A;  1Y8R C;  3IHP C;  3DVG X;  3R7Q A;  2GOW A;  4BBN F;  3DDC B;  2A4Z A;  1L2N A;  2J0M A;  3RCZ A;  3QIJ A;  1VCB A;  3A4S C;  1WZ0 A;  3U7D A;  3ZNG C;  2C9W B;  1I42 A;  2KNB A;  2LVO A;  1YX5 B;  3ZVV A;  4GDL B;  3SHQ A;  1U4A A;  2NPT A;  1Z2M A;  1Q0W B;  3ZKJ C;  4G3X B;  1D3Z A;  2LXC A;  3WIM A;  2NBV B;  1BT0 A;  1RAX A;  4K7W A;  5DPS A;  4DBG A;  3A9K A;  3R7R A;  2LRW A;  1S1Q B;  2C7M B;  3NOB A;  3EEC A;  2DYB A;  3RZW C;  3VFK A;  4AP4 C;  2N7D A;  2ZNV C;  4FLH A;  4KVG B;  3U8Z A;  2JY6 A;  4IC7 B;  4G0N B;  3EFU A;  4MJS B;  4NAW B;  4HK2 A;  2REX A;  4E74 A;  1SIF A;  2AL6 A;  3S2A A;  2Y5B B;  3APD A;  2C60 A;  5DPW A;  1YQB A;  3SDL C;  5DPR A;  2IO1 B;  2KFK B;  3N32 A;  2L8J A;  3UIN B;  2O6V D;  3H7P B;  2K39 A;  3TJP A;  4K7U A;  2KMC A;  1LXD A;  2JXX A;  5L83 A;  3AU5 A;  3RUI B;  3ZRC A;  2LGD A;  2UYZ B;  2MBE A;  1KJT A;  3L17 A;  3QA8 A;  1A5R A;  4MDK E;  3VTW A;  4BVU C;  3BIN A;  3ZDT A;  4CHK A;  2L0T A;  1Z5S B;  2BKR B;  2M17 A;  3ZUN A;  3ENE A;  2KQS A;  5CHF A;  5KHO A;  1WFY A;  2IY0 B;  2ZVO A;  5D94 A;  3KW5 B;  4NJ6 A;  3DVN V;  2KJH B;  2Z59 B;  5AZG A;  3UIP B;  3VUX A;  2RR9 A;  5J18 A;  1AAR A;  2JVC A;  1NI2 A;  2DX5 B;  3Q3J A;  1UGM A;  4ZRJ A;  2ZPY A;  3M63 B;  3K9P B;  1P9D U;  1WGG A;  1WYW B;  2WDT B;  1IYF A;  3QHT A;  2XEW A;  1TGZ B;  2D3G A;  2RSU A;  1S3S G;  1YD8 U;  2NS5 A;  4RM8 A;  5AZH A;  5JHB A;  2LVQ A;  3MTN B;  1X1M A;  5E6O A;  3DCG A;  3WAP A;  4EOY A;  4F8C B;  5J2R A;  2G45 B;  3PV1 A;  4FN2 A;  4BKS A;  1EF5 A;  3DQV A;  3A33 B;  5E6P A;  3VXW A;  1E8Z A;  3BY4 B;  1J19 A;  2NBU A;  1GJZ A;  2A5U A;  2BYE A;  4TQ0 A;  4G11 A;  4IM0 A;  3B1L X;  3OAW A;  4DHJ D;  2XK5 A;  4EEW A;  2DZK A;  2CKH B;  2LZ6 A;  5J17 A;  5JHA A;  3UF8 A;  2JZZ A;  4IUM B;  2DZI A;  1J8C A;  4W9E A;  1WJ4 A;  3LJ3 A;  3VDZ A;  3PRZ A;  1V2Y A;  1TTN A;  2D07 B;  4DXA B;  3DBS A;  5C23 A;  1LM8 B;  2KK8 A;  2O2V B;  2ZJD A;  3KUZ A;  4ZRK A;  2D10 A;  2PE6 B;  4PYZ A;  1NBF C;  2DYO A;  2K8B A;  3JSV B;  2FIF A;  2WWZ A;  2RPQ A;  3JVZ X;  3UIO B;  3WAL A;  2CHX A;  3TCA A;  1SE9 A;  4I6P A;  4WJN A;  2GMI C;  1EO6 A;  3PHW B;  2YLM A;  4DHJ B;  1SGH A;  1NDD A;  4WAA A;  2ZEQ A;  3NHE B;  2GBR A;  1GNU A;  1WXS A;  1HE8 A;  4IWQ A;  1WGH A;  4DHZ E;  1C3T A;  2PE9 A;  4HWI B;  1P3Q U;  4ANU A;  2KTR B;  2WYQ A;  3HK0 A;  3PRE A;  4W9J A;  4W9G A;  3TBL D;  2J7Q B;  2G3Q B;  3L08 A;  4M0W B;  1OEY A;  1Q1O A;  3U30 A;  1EUV B;  1LQB A;  5L95 C;  1WXA A;  2PPH A;  4KIK B;  1JRU A;  1H4R A;  2C7H A;  1V81 A;  3TL5 A;  3DBL I;  1RLF A;  5E6N A;  1WMH A;  3KH0 A;  4DK5 A;  3NZU A;  3M3J A;  2NBW B;  2L76 A;  4MEL A;  5TR5 A;  2M0X A;  3V6C B;  3C0R B;  2C7N B;  4WWO A;  2AWT A;  2FID A;  2C5L C;  2L7R A;  4LDT B;  1IP9 A;  4URK A;  4DHZ B;  4ZDV A;  2KC2 A;  2JRH A;  4AJW A;  1WI0 A;  4ZYN A;  2EMT A;  1YIW A;  4WQO B;  4TKN A;  4XX5 A;  3I3T B;  4LCD E;  3B0A A;  4ANX A;  2XBB C;  3R3M A;  4KZC A;  4W9K A;  4W9C A;  1UH6 A;  4MH0 E;  2WX1 A;  4OVV A;  2IO3 B;  2KVR A;  3PT2 B;  4WJP A;  4AJY B;  4HCN B;  3VAW A;  4J6I A;  3QAR A;  4IWP A;  2IYD B;  1OEY J;  1V9J A;  1V5T A;  2KAN A;  1E7V A;  1WXV A;  2W9N A;  3KYC D;  3RZF A;  3JW0 X;  4YL8 A;  2DZM A;  1XD3 B;  2MP2 B;  3VQI A;  3PZD A;  3PRP B;  4GXB A;  4HXD A;  1WMH B;  4NNJ B;  1WJN A;  4GDK A;  2Z0E B;  3H1U A;  4MSQ B;  2MA9 B;  1GC7 A;  3D32 A;  4M8M A;  3KUC B;  3UQB A;  2MSE D;  2DYM A;  2N9X A;  3A9J A;  2BGF A;  3APC A;  3QWZ B;  2MCN B;  5D2M B;  4LJO B;  4A3O A;  1WX8 A;  4ASW C;  4ANW A;  2KJR A;  4B95 A;  4WJQ A;  2BPS A;  3AI5 A;  4HCP B;  4F7Z A;  3ZRF A;  2BYF A;  2KKC A;  2ZZP B;  3K9O B;  2NPT B;  1E7U A;  3EC8 A;  2KXJ A;  2R2O A;  2O6V A;  2L00 B;  2LRU A;  2JUO A;  3A1Q A;  3L54 A;  3A9K B;  4KV2 A;  3VTU A;  2N9E B;  5CHV C;  1WF9 A;  3RYT A;  4HPL B;  1EF1 A;  2L05 A;  4BKT A;  2KO3 A;  4NQL B;  5BO4 B;  2HD5 B;  2KC1 A;  1WY8 A;  3SU8 X;  2VRR B;  2K8H A;  3ZIM A;  1TBE A;  2BYV E;  5LXI B;  2LJ5 A;  4AUQ C;  2IO2 B;  1WGD A;  2ZPN A;  4EFO A;  2EKE C;  3PSE B;  3AUL A;  4MGZ E;  2KMA A;  4MGI E;  1V80 A;  2KHW B;  2MBH A;  4ICV A;  4HVB A;  3V62 A;  4HPM B;  1WIA A;  2K25 A;  1ZW7 A;  1T0Y A;  4GMV A;  4WWP A;  3R66 C;  5CX3 A;  3N30 A;  3X23 A;  4G50 A;  4X57 B;  1GC6 A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...