3D32A

Complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Ligand Binding Mode of GABA(A) Receptor-Associated Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3d32A00
3H7PA 1P9DU 1WXVA 4NNJB 2KK8A 3DPDA 2K25A 3PRZA 1S3SG 3AU4A 3ONSA 1YQBA 3QX1A 2KDBA 3L54A 4N9F4 4WQOB 3N30A 3BY4B 3W1SA 4URKA 5IA7A 2DAFA 4W9KA 2JZ3B 3A9JB 2KOXA 1Q0WB 1V86A 4JLCA 4HDQA 5D6JB 3IFWB 2KLCA 2ZZPB 3O65B 3PRPB 3QK0A 5JHBA 3PS6A 2K8HA 2N9EB 2NBVB 3IG3A 4FBJB 3TJPA 2KDIA 3P2BA 2NBWB 4F1SA 2BYEA 3WIMA 2O6VD 1H4RA 3JVZX 5DCNA 2KDFB 2JVCA 3ZDMC 1XD3B 4RM8A 4MH0E 2N1VA 1V81A 2A5UA 4PS7A 4E3CA 1I35A 2KWVB 4RMAA 4I6PA 3M95A 1XQQA 3R7QA 2BYFA 5CX3A 4DDID 1P0RA 1YJ1A 3VAWA 2M17A 3W1YA 2HJ8A 4BFRA 2JRHA 3SDLC 5AZHA 1WXAA 2JF5A 5CHVC 4WJOA 1XT9B 4WJPA 2IY0B 3DBRI 2HD5B 1OGWA 4DXAB 2VRRB 1M94A 3QHTA 3AU5A 3DCGA 4ZRJA 5G2NA 3UF8A 2BYVE 2L05A 1WI0A 1WGYA 2I1KA 3ZO5B 4AJYB 4M0WB 2O6VA 3NHEB 1BT0A 1X1MA 2EMTA 2KN5A 1WR6E 1WXSA 4EZKA 4G3XB 3L0WB 4HPMB 2KDEB 1EF5A 2JY6A 2W9NA 4CO7A 2PJHA 2LRWA 2NPTA 3JW0X 3ZNZB 1WGRA 1EF1A 3VHTC 1GNUA 1YD8U 2FCMA 1WFYA 4W9IA 3HK0A 2GBKA 3UGBB 2OOBB 4MSQB 4IM3A 1T0YA 3NS8A 3C0RB 4NAWA 3PGEA 3AI5A 4MELA 1GUAB 4XX5A 5JH5C 1GC6A 1WRDB 5LXIB 1UD7A 2JXXA 3Q3JA 3X23A 3U8ZA 1LFDA 4PYZA 3QAQA 2CS4A 2R2QA 3VVWB 4BOZB 2A4ZA 4W9EA 4II2B 4WJNA 1Z2MA 4JIOU 4FJZA 2MQJA 1GJZA 2LGXA 2IO0B 3R7RA 3QC8B 3PSEB 2KFKA 5G55A 2FCNA 2KMCA 4MEMA 2AWTA 2JRIB 4I6LB 3ZW3A 4W9CA 2BF8B 2RSUA 2NR2A 5DPRA 1PQSA 2O2VB 2BKRB 1ZKHA 2EKEC 2J7QB 1H8CA 1P98A 4EKUA 1E8XA 3QCAA 1VCBA 2KQSA 4A20A 2KKCA 2KO3A 3PT2B 4MGIE 3PTFC 3L10B 1GC7A 2IO2B 2L3ZA 2L76A 3B08A 3HIZA 3TBLD 1Q1OA 3JSVA 3DOWA 2KNBA 1WMHA 3SU8X 2N7DA 2IZVB 1C3TA 4HPLB 4DHJB 2L8JA 4FA6A 2G3QB 1A5RA 2GBJA 5JZEB 2NCNA 1V2YA 2RD0A 2KVRA 1WYWB 3M62B 4MJSA 3ZVVA 4BBNF 2KXJA 1WM2A 3L08A 3EC8A 4FN2A 4A3PA 3A9KA 4JQWC 3T9LA 1SGHA 3OAWA 2MP2A 4ZDVA 4K7WA 4EEWA 1E8YA 4GN1A 3DBSA 3PPAA 2LUEA 4GDKA 5DPWA 1OTRB 5C1ZA 2ZNVC 2C5LC 3PHXB 1IYFA 2ZEQA 2KLGA 3M63B 5GMVA 4GGQA 4B9KA 3MJWA 2LVPA 3W1SC 4JL9A 2JUOA 4NJ7A 4FULA 1L7YA 1WM3A 2XEWA 4K7UA 5E6OA 4GDLB 4LDTD 2KJRA 4B95A 2FAZA 3KYCD 4IG7B 2N4FA 2KQ7A 2PEAA 3EHVA 4F8CB 2K6QA 2KTRB 4FJYA 1YIWA 2GBMA 1E7UA 2GOWA 2MLBA 3MTNB 4PYUA 3CF6E 1WX9A 4IW0A 3VQIA 5JHAA 4DHZE 3KW5B 2MBOA 3N3KB 3H9DA 3PHWB 1KJTA 4G50A 4TQ0A 1R4MI 4E71A 5LXHA 3S2AA 2MWSB 3L16A 2RR9A 4HXDA 4CHKA 3VXWA 3ZTDA 1TBEA 3A9JA 2ZPYA 4ICUA 5L95C 3KUCB 5CHFA 3QIJA 3V61A 4DHZB 2DX5B 5LLIA 1V49A 1WGGA 2BWES 4X57B 4AOFA 1WJUA 2V3SA 3PREA 4BOSC 1YX6B 2L0TA 3VUYA 3SHQA 2D11A 2IO1B 3V62A 3IHPC 4LCDE 1D3ZA 2FNJB 1IPGA 4HJKA 4WJQA 1U4AA 3ZNHB 4FLHA 1OEYJ 2AEHA 1UBIA 2CHXA 3WAOA 2KZRA 3R66C 3M3JA 4HDOA 3WANA 1F9JA 4W9FA 4EOYA 3A4SC 2C7MB 5DPTA 3K9PB 5FR6A 4GIVA 2G45B 4GU2A 1C1YB 3HM6X 3H7SA 1QZEA 2I1JA 5AZGA 3RT3B 3PV1A 2V1YA 2NBUA 4KSKC 5TR5A 3U7DA 1J8CA 3OJ4B 3Q3FA 1UGMA 4AJWA 3A1QB 4MGZE 3NZSA 4KSLC 4DBGA 5E6PA 3KYDD 1JRUA 2IY1B 4ANWA 2DZMA 5J18A 2Z0DB 1EUVB 1R4NI 1UH6A 2C7HA 4BKSD 2DZJA 4DK5A 2R2OA 4ZYNA 4P7IA 3PZDA 4F7ZA 2XK5B 4J6IA 3D32A 1FXTB 3KUDB 3ZLZA 2MCNB 2KMAA 2M1MA 2MSED 2J0MA 4GB9A 3ZTCA 1V5OA 1WJ6A 4MGYE 3ZRCA 2KTFA 1YX5B 3RZFA 2MBHA 3IVFA 2K8BA 2ZVOA 4IC7B 3RULA 2CR5A 4DDGD 2C60A 2LVQA 2C9WB 3HHMA 2ASQA 2DYOA 2AYOB 2WX0A 3GZNI 4KZ0A 3VTWA 4E74A 2BPSA 2WDTB 5AZFA 2PE9A 2Z0EB 4HCNB 2MBEA 4KIKB 3NZUA 5J17A 1LXDA 4M8NA 4AP4C 3A4RA 3QWZB 2CHWA 1LM8B 3DBHI 3IBEA 4GSWA 2LXAA 4KVGB 2LRUA 4IWOA 2UWQA 2BWFA 4MDKE 3H7PB 1ZGUB 2BKFA 3ZIMA 2JPHA 3RD2A 4BKGA 3GOEA 1RLFA 4BVUC 2ZNVB 4A3OA 4GXBA 2N1WA 2AL3A 4TKNA 2MA9B 3WAMA 3VFKA 4BKSA 4CYEA 5KHOA 2K8CA 3PRMB 3RYTA 3EECA 3BINA 3NOBA 4FADA 3LJ3A 2GMIC 4ANUA 2O2VA 4JGHB 3AXCA 3OLMD 4K1RB 1V9JA 4I6NB 1WGHA 2ZPNA 3L13A 4IM0A 3DQVA 3UQAA 2YVCA 3B1LX 2GBNA 2MX2A 1RRBA 1WXMA 2N9XA 3CSTA 4ICVA 2LJ5A 4LJOB 4NJ6A 3H1UA 2K1FA 4TUUA 2CHZA 1TZ1A 3EFUA 5DPSA 3QJZA 4IUMB 5D7GA 3ZUNA 3DVGX 4B6WA 2M0XA 3AULA 2CU1A 2OJRA 4HCPB 3DDCB 2G4DB 2LI5A 2Y5BB 3CMMB 2JT4B 2KHWB 3TMPB 5L83A 1HE8A 4NPNA 2DYMA 3UIOB 1V6EA 2LGYA 3CSFA 4FJVB 4IM2A 1IP9A 4WWPA 1J0GA 3ZNGC 1WR1A 2LD9A 2ZVNA 3RUIB 2LXCA 4HVBA 5HKHA 3APCA 2V4LA 1J19A 2WX1A 4IWPA 2MW5A 4W9HA 2D2QA 2YLMA 2KANA 2Z59B 3ECIA 3KVFB 4EUTA 3V6EB 4WWNA 4XZ4A 3DBLI 1KM7A 4W9JA 1SE9A 2PE6B 2LZ6A 4MGKE 1LQBA 1NDDA 4EZJA 4ZRKA 1VD2A 4II3B 2EMSA 3WA0A 4PS8A 2O6VB 2DZKA 3HM3A 2LVOA 4LDTB 5D2MB 1WGDA 4GDLA 4YL8A 3VH4B 1EO6A 4IWQA 4W9DA 1KOTA 3QARA 1G6JA 3N32A 1OQYA 3K9OB 4HK2A 2NPTB 2KTRA 1Q5WB 3UQBA 4K81A 2K39A 1K8RB 4NQKE 2REXA 3WALA 4WWOA 2DHZA 4BBNC 4KV2A 1GG3A 3JYUA 1E7VA 3V6CB 4AWJA 3PVLA 5D94A 3ENEA 3KH0A 1WJNA 3B0AA 1RAXA 4GMVA 4KDLB 4NAWB 1WZ3A 3ALBA 3ZRFA 1WE7A 2D10A 3I3TB 1OEYA 4BKTA 2WWZA 3V60A 1TGZB 2IBIB 4ANXA 2XBBC 2L7RA 4ASWC 3VUXA 2KX3A 1I42A 1UBQA 4KZCA 3RZWC 3ZNID 2LGDA 3VUWA 3DVNV 1ZW7A 4OVUA 1MG8A 3ML9A 1KLVA 2L0FA 2K6DB 2QHOA 2MBBB 2WYQA 1V80A 2JWZA 4G0NB 1UZXB 2J0KA 2BGFA 3KUZA 2KFKB 3DVNU 1UELA 2KFJA 4FHJA 4W9GA 4PS3A 4MSMB 4TV3A 4NQLB 2RPQA 5J2RA 2C7NB 1RFAA 2D3GA 3QA8A 3VH3B 2KWUB 4ZRIA 3LDZE 3PLVA 2HE7A 2ZCBA 4K7SA 3WAPA 3NY5A 3RCZA 1NBFC 2ZJDA 2FUHB 3VTUA 2DYBA 1WF9A 1WX8A 2UYZB 4ANVA 5KHQA 1L2NA 1TTNA 3X0WA 3ZKJC 1ISNA 2L00B 2N9PC 1E8ZA 4NY0A 2AL6A 2RGFA 3SD5A 2KD0A 2M8SA 3JSVB 3TCAA 4HLEA 1WMHB 2NS5A 4FHKA 4EZLA 1P3QU 5E6NA 2ZCCA 2D07B 2GBRA 4TQ1A 3A1QA 3ML8A 4M8MA 2B3AA 4DHJD 3TIXA 3QQ8B 2G4SA 5C23A 4LJPB 2M4NA 1V5TA 3MHSD 4KDIC 1WJ4A 4MJSB 4MM3A 4W9LA 4G11A 1Y8RC 2FIFA 1WE6A 2NVUI 2IO3B 2LASA 2KC1A 3ZDTA 5AEKB 3A9KB 4OVVA 1WH3A 2DAJA 2XK5A 5CTRC 2DZIA 2KWCA 2FIDA 2FCSA 4AUQC 2MP2B 1E5WA 3APDA 3H6NA 3A33B 2DENB 4XC2A 4WAAA 2J0JA 3PLUA 1SIFA 4HWIB 5BO4B 1S1QB 2N7EA 4DWFA 2MBQA 4GDKB 2KC2A 3R3MA 3VTVA 1WZ0A 2LWPA 2KJ6A 3OJ3A 5CHWA 2HTHA 1WY8A 3U30A 4RM9A 5IAAC 3APFA 3TL5A 3UIPB 1P1AA 4KIKA 1CMXB 1E8WA 2PPHA 4EFOA 2CKHB 3UINB 3VDZA 1WIAA 1AARA 1NI2A 3DVGY 1WX7A 2IYDB 3T8MA 2FCQA 3L17A 1Z5SB 2MRPA 1E90A 2JZZA 5EDSA 4GOCA 2KX0A 2KJHB
chains in the Genus database with same CATH superfamily
1WXVA 3PRZA 2QEJC 1S3SG 4ZRPA 3ONSA 4NZLB 3QX1A 3N30A 5IA7A 1N62A 1F77A 1IUEA 5G5HA 4C4VB 1Q0WB 2N9EB 3CWIA 1TIFA 3P2BA 3WIMA 5DCNA 2KDFB 2KDMA 1ACCA 1AW7A 3AB5A 4HROA 4RMAA 4I6PA 1JWUD 1WXQA 4ZOHC 4C56C 3I5JC 1YJ1A 3SDLC 4KKIA 4WJPA 1K50A 2HD5B 3GS2A 4WIPA 4JWUC 3QHTA 4RH6A 4LLGM 4XWWA 2BYVE 1XF5L 1WGYA 2KN4A 4ZRQA 2EMTA 2KN5A 1WXSA 4EZKA 2KDEB 1EF5A 4P1CC 3JW0X 1TJEA 5IO9A 1QILA 2GBKA 4MSQB 1T0YA 2BQQA 4MELA 4RF0A 3Q3JA 3TEXA 4PYZA 1E6EB 3P4RB 2CS4A 4W9EA 2BT6A 2INDC 1F0ZA 3MP9A 1Z2MA 4FJZA 1F2RC 4WAFA 1N5WA 3ZW3A 2NR2A 5DPRA 1P98A 2KQ4X 3QCAA 4A20A 1L0XB 3TSSA 1TY0A 2RMMA 2IO2B 3B08A 1KTKA 3P4QB 1Q1OA 3DOWA 3AEGB 1XO3A 4ZHPA 1UNSA 2K3UA 2DBYA 5JZEB 1MG4A 2R61A 4BBNF 3M62B 4S0RA 4FN2A 2K5PA 2IPKD 2D3AA 2AQ3B 4ZDVA 1SJED 2ON8A 5HHDG 5C1ZA 3AEBB 3PHXB 3BK2A 3BZDB 1SIJA 2K9XA 1V1OA 4FXCA 1JWSD 2KJRA 2FAZA 3KYCD 2DLBA 2KQ7A 3EHVA 2M0AA 1YN5A 2GBMA 1KLGD 1WX9A 3GE3C 2MBOA 3Q8EA 3P42A 4E71A 5LXHA 1FM0D 3T3OA 3L16A 2G1EA 4RNAA 2ONQA 4KGRA 4ICUA 4C4VA 5CHFA 1J7AA 3B2GA 2QC8A 2L0TA 3SHQA 1FNWA 3IHPC 2FNJB 1IPGA 1KH0A 5D3IB 1WYGA 4J3OD 3WAOA 4HKQA 3R66C 2C7MB 5DPTA 4GIVA 1PUTA 5BYQA 3LXFA 1HXYD 3RNEC 2NBUA 2MH7A 3OJ4B 1NEKB 1I4XA 2LJIA 4DBGA 3NZSA 3KYDD 1JRUA 4ANWA 2PVOD 4MM3B 3P1MA 3PZDA 4F7ZA 3D32A 3EA6A 3TEYA 3BYTB 1V5OA 4MGYE 3ZRCA 3RZFA 3IVFA 4EE2A 2ZVOA 2CR5A 3HHMA 2LHEA 2WX0A 4KZ0A 4E74A 5AZFA 1N63A 3R2IA 2QDFA 1T6BX 2CHWA 2LXAA 5I4DA 1F1HA 2ZW0A 3PO0A 3RD2A 4BVUC 2ZNVB 4A3OA 2N1WA 2AL3A 4CYEA 2MA9B 2K8CA 3Q8FA 4ARCA 1JW9D 3KWVA 3EECA 3LJ3A 2WXLA 4JGHB 2XNAC 2ZPNA 4IM0A 3UQAA 3HUIA 2LJ5A 4LJOB 2JXTA 4TUUA 2CHZA 4IUMB 1ZP0B 5HFYA 2WXIA 3C8YA 4JX1C 4B6WA 2BB5A 2M0XA 3TEWA 2CU1A 1ET9A 2OJRA 2JT4B 2KHWB 1HE8A 4NPNA 1V6EA 2ZVNA 3Q14C 3MJ5A 1J8CA 3ECIA 1GB4A 1JALA 3KLSX 2FE8A 2OJWA 3J9CA 4W9JA 2MHJA 2LZ6A 4MGKE 4EZJA 3FAHA 2WNMA 3AE5B 4PS8A 5IN7A 4IWQA 1T0QC 1OQYA 1UF0A 2AX5A 4HK2A 3OWEB 2K39A 2REXA 3WALA 4BBNC 2INNE 3PVLA 3ZRFA 1WZ3A 2NTSA 2WWZA 2MJDA 4RGTA 2WXKA 2IBIB 2XBBC 3VUXA 1AN8A 3P4SB 1JWMD 1MPEA 3DVNV 2PIAA 1P7EA 1KLVA 2WYQA 2K0PA 4P6VF 4DXFA 1I4PA 2KFKB 4W9GA 1UELA 1VZ7A 5J2RA 3RN9C 1VLBA 4HPPA 2C7NB 2JZPA 3VH3B 3TUOA 2KWUB 2BBCA 5IP4D 3LDZE 1RM6C 2ZCBA 3AEFB 4K7SA 3RCZA 1NBFC 3VTUA 2DYBA 2G9HD 1WF9A 2UYZB 2NTTA 3IT6B 1L2NA 4ZYSA 2N9PC 2M8SA 4JE3B 2CJNA 2X8XX 4BZAA 2NS5A 3HVZA 3ML8A 4LJPB 1PFDA 4MJSB 4MM3A 2KC1A 3ZDTA 3AMZA 2DAJA 2FIDA 1JWAD 2FCSA 4AUQC 3A33B 2WLBA 4LTUA 4WAAA 3PLUA 4HWIB 5BO4B 1C77A 2N7EA 4DWFA 3VTVA 2LWPA 5CHWA 1YMHE 5H8YE 3R8BA 2V3NA 3NRZA 1FO4A 3ZQ4A 1L6VA 1NI2A 2IYDB 3BVGA 3L17A 2MRPA 4QAYA 4GOCA 2KX0A 2HTME 2KJHB 1HTOA 2INCC 1P9DU 4NNJB 5FK9C 2KK8A 3NVWA 2K25A 5IKCM 1XLOA 2KT7A 2KDBA 1FD6A 2KAJA 2AQ1B 3E9SA 4URKA 2JZ3B 5BYSA 5D6JB 3QK0A 1OQRA 2WDQB 2ZZPB 2K8HA 2WXMA 2M56B 2WXRA 4F1SA 4JWSC 2O6VD 4OVZA 1B9RA 1H4RA 3JVZX 3ZDMC 1XD3B 3N1YC 4MH0E 2N1VA 2WGSA 1V81A 1NYRA 2LGSA 1EU4A 1SSNA 5MPOA 3M95A 1XQQA 2M17A 2WS3B 3W1YA 1FRDA 2JF5A 5CHVC 5BMHA 4WJOA 3N1ZC 1XT9B 2IY0B 1FNUA 3DBRI 2PVGC 3RI7C 5LNK1 3AU5A 4PK1A 2WU5B 5BYRA 4OHJA 4AJYB 2AQ2B 3HVDA 3L0WB 2JY6A 2LRWA 3ZNZB 1I4HA 1I4GA 1DOXA 2FUG1 4W9IA 3HK0A 4IM3A 3NS8A 2DWQA 1GUAB 3AE2B 3KWLA 1WWTA 2JXXA 3U8ZA 1UWMA 3QAQA 1D5XC 2MJEA 1VZ8A 2RDHA 4II2B 1Y56A 2MQJA 3L4PA 2IO0B 3PSEB 2KFKA 1E9MA 1CK1A 2KMCA 4I6LB 2RDBC 4W9CA 1SXTA 2RSUA 1DGJA 2WU2B 3V3XA 2KQSA 3PT2B 4MGIE 3PTFC 3L10B 1GC7A 2L3ZA 5C2TB 4US8A 3HIZA 4YTPB 4DHJB 2L8JA 2G3QB 3BK1A 1V2YA 2KVRA 1WYWB 4MJSA 1SF0A 3SR6A 2KXJA 3EC8A 1MI0A 1SGHA 3BYYB 3GP7A 1DYQA 4DQOC 3OAWA 4LNOA 4RCOA 4C00A 4EEWA 1DOIA 1HZ5A 2ZNVC 5GMVA 4GGQA 1RYJA 2JUOA 4JL9A 4NJ7A 3B9JA 3I9V1 4IOIE 2K6QA 1E0ZA 3MTNB 1F2RI 4DHZE 1FRRA 3PHWB 1R4MI 2LGIA 2WXJA 4CHKA 1HTQA 2W3RA 3KUCB 2WXNA 5LLIA 1WGGA 4AOFA 2V3SA 2VH2A 4BOSC 1YX6B 3VUYA 4RGOS 3V62A 2WDVB 1QKZA 4HJKA 4FLHA 1JWBD 1UBIA 3CIRB 1ROEA 2KZRA 5IOIA 3IT4B 3BVMA 2WXOA 5FR6A 4K3BA 1JRPA 1C1YB 3HM6X 4L1BA 3RT3B 3H8HA 1FEHA 2QIEB 5TR5A 3U7DA 3AE4B 2INPE 4AJWA 1CQVA 3V05A 4MGZE 5E6PA 1T5XD 5J18A 2DZMA 2C7HA 4BKSD 2YEPF 4LNFA 4P7IA 3LB8C 3VRAB 2XK5B 4J6IA 3ZLZA 2MCNB 2KMAA 2VH1A 3ZTCA 1SJHD 1VRAB 4N6EB 1FFVA 1YX5B 1T3QA 2IJ0A 2LVQA 1LGRA 1N60A 3VR8B 3GZNI 3VTWA 2BPSA 1XCQL 2PE9A 4L23A 4KIKB 3NZUA 4MH8A 1YN4A 5J17A 2J53A 2BS4B 1FXIA 2LRUA 3ZIMA 4BKGA 4GXBA 2CU3A 3VFKA 5KHOA 2ZW1A 1MVKA 2GMIC 4ANUA 1QQRA 5D3DA 3AXCA 3OLMD 1V9JA 3IXSA 4A8XC 3L13A 1ESFA 2Q5WD 2GBNA 3CSTA 1VDVA 2VZKB 4NJ6A 3H1UA 2K1FA 1TZ1A 1T0SC 3NG0A 3QJZA 4A9AA 2IGHA 3AULA 1EWYC 1YQ3B 3DDCB 2Y5BB 3CMMB 3TMPB 5C3JB 3P63A 4R3DA 4TMAB 4RFBA 5HKHA 3RUIB 3APCA 2NMQA 2V4LA 2GLSA 2D2QA 1LO5D 2YLMA 2Z59B 4XZ4A 3DBLI 3DHHC 1KM7A 2PE6B 3W2DA 5JXVA 3AH7A 3AV8A 2WXQA 2O6VB 2DZKA 3HM3A 2LVOA 4LDTB 1WGDA 3VH4B 1EO6A 2QSDA 4W9DA 5E6JA 1G6JA 3K9OB 1SBBB 4K81A 1K8RB 4NQKE 3U7ZA 2DHZA 3GE8C 4P16A 4KV2A 1GG3A 4OZCA 1E7VA 2WXGA 2XN9C 5D94A 3ENEA 4KGSA 1WJNA 4GMVA 3ALBA 1WE7A 1OEYA 4K3CA 1FXAA 3U2SC 2LGDA 3EGRA 1ZW7A 4OVUA 1QF6A 3ML9A 2QHOA 1NENB 2JWZA 4US9A 4G0NB 3DVNU 2KFJA 4FHJA 4MSMB 4TV3A 3DHGC 1I4RA 1RFAA 3QA8A 1EWCA 4ZRIA 3WAPA 1JROA 2BW2A 1GAQB 4AQ7A 1E8ZA 4NY0A 2AL6A 2RGFA 4WH4A 4XGAB 4YXDB 3FILB 4EZLA 1P3QU 5G5GA 2D07B 4M8MA 4DHJD 5C23A 2G4SA 4KDIC 2FIFA 2NVUI 5AEKB 3A9KB 4OVVA 2XK5A 2KWCA 1XLPA 2MP2B 4XC2A 5EE0A 1SE3A 4GDKB 3R3MA 1WRIA 3OJ3A 2HTHA 1V1PB 5IAAC 1P1AA 4KIKA 1CMXB 1E8WA 2BTEA 4EFOA 3N20C 3UINB 3VDZA 1AARA 1WX7A 3T8MA 2JSVX 1Z5SB 2HJ1A 3AU4A 4WQOB 4N9F4 1ZPSA 4BAXA 3W1SA 2DAFA 3GB1A 4W9KA 1QOGA 5AUKA 2KOXA 1D6EC 1V86A 2EKIA 4JLCA 3O65B 2KLCA 3PRPB 5BMGA 1FCCC 2WP9B 2BYTA 2RDGA 4FBJB 2KDIA 1IGCA 3AE1B 2WXHA 5AUIA 2IGDA 2JVCA 4RM8A 4PS7A 4E3CA 5FR3A 1I35A 2KWVB 4KGTA 3R7QA 5CX3A 3SFDB 4DDID 4USAA 1P0RA 3VAWA 2V0GA 4O1NA 1M4VA 2JRHA 2WXPA 2X38A 3OG5A 2VRRB 3SFEB 3BWUD 4KX6B 2RPVA 5G2NA 3UF8A 2L05A 1KLUD 1WI0A 2I1KA 4M0WB 2O6VA 3NHEB 1X1MA 4IDIA 1WR6E 4HPMB 2W9NA 4CO7A 2PJHA 3E56A 4ITKA 3NS1A 1EF1A 3VHTC 1OQQA 1YOVB 2PTLA 4UDUC 4HEA1 2OOBB 3WCQA 3C0RB 3PGEA 3AI5A 5JH5C 1WRDB 3RPFC 1R4MB 1UD7A 2WDRB 1D5ZC 3X23A 2PW9A 1LFDA 5GXGB 3VVWB 2A4ZA 4H2AA 1MHXA 4WJNA 4JIOU 3O13A 1GJZA 2J52A 2LGXA 3R7RA 1YJIA 5G55A 4MEMA 2JRIB 3U4EG 2FBWB 2W82A 2BKRB 2J7QB 4EKUA 3VR9B 1VCBA 4PT5A 2KO3A 4LNIA 3AEDB 2L76A 2QMTA 2VZKD 3Q8BA 3TBLD 4YT0B 2KNBA 4XWTA 3FILA 3SU8X 2IZVB 3FKYA 1L0VB 1MHHE 4FA6A 1A5RA 2GBJA 2NCNA 2QILA 2RD0A 3ZVVA 2Z8LA 1WM2A 4A3PA 1TY2A 3A9KA 4JQWC 3T9LA 2MP2A 3PZ7A 4K7WA 4XDCA 4GN1A 3DBSA 2ACZB 2LUEA 3DWGC 4GDKA 5DPWA 1OTRB 2C5LC 2KLGA 3M63B 3NVYA 4B9KA 3MJWA 3W1SC 2BS3B 1L7YA 3GZNB 1WM3A 4K7UA 1OFFA 4GDLB 4LDTD 4B95A 1V97A 2PEAA 3AE6B 2KTRB 2LEKA 2N9KA 3AEEB 1E7UA 2GOWA 2MLBA 4PYUA 3CF6E 5JHAA 3KW5B 4G50A 1FPYA 2Y3AA 1V8CA 2RR9A 4HXDA 2KVZA 3VXWA 3ZTDA 1TBEA 5EE3A 3AE8B 3IAM1 3V61A 1V49A 3NZ3A 4X57B 1P7FA 2IO1B 4MACA 1D3ZA 1K51A 2CHXA 1C4PA 2LMCA 1L6UA 3M3JA 4C7YA 3Q8AA 2J4XA 1BXTA 1QLBB 2SEBD 1VJKA 2LHDA 1QZEA 2I1JA 5AZGA 2V1YA 4KSKC 2KMMA 4KSLC 4HRSA 3DBLB 2IY1B 2Z0DB 4WQMA 1R4NI 2DZJA 4M0WA 3RNGC 1UWXA 4ZYNA 1MFWA 1BUIC 3KUDB 3W9CB 2M1MA 1WJ6A 2KTFA 2K8BA 4DDGD 2C9WB 3PZ8A 2DYOA 3W5VB 3UI3A 2Z0EB 4HCNB 2MBEA 2E3TA 1LXDA 4AP4C 3A4RA 3DBHI 3FC4A 2JX5A 4GSWA 4DXGA 3TEZA 4M02A 1GPXA 1N6ZA 4LNNA 3H7PB 1ZGUB 5HI1A 2JPHA 1RLFA 2L32A 3RMKC 4BKSA 2W3SA 1NI3A 1ENFA 3ZJTA 3NOBA 4FADA 1ZOYB 4K1RB 4I6NB 3B1LX 1RRBA 3Q3OC 5D7GA 3ZUNA 1PDXA 1XXGA 4HCPB 1YJJA 5L83A 2LGYA 3ZYYX 1IP9A 4WWPA 1J0GA 3ZNGC 2LD9A 2IDYA 1PGBA 4IWPA 3KVFB 2KANA 4EUTA 3NVVA 1K52A 1QOFA 1SE9A 1LQBA 2GRIA 3AN1A 2UU7A 3WA0A 3BIID 4OW0A 5D2MB 3EFCA 1D5MC 4GDLA 1WSPA 3QARA 3N32A 3RNCC 2JWUA 2NPTB 2KTRA 3NVZA 2H88B 2J42A 3SEBA 4AWJA 2PLPA 2QJLA 2LFIA 2I2YA 2L83A 1CZPA 1KF6B 3B2FA 3B0AA 4KDLB 1RAXA 4NAWB 2D10A 3V60A 1KRHA 2BS2B 4AS1A 2L7RA 1UBQA 4A6QA 3ZJUA 2K6DB 2MBBB 1GB1A 4WWMA 1TS4A 2J0KA 2RPQA 1XLNA 2D3GA 3PLVA 2HE7A 1C76A 4TSSA 3NY5A 1QOAA 2ZJDA 1NVID 2JQRB 1TTNA 1ISNA 3SD5A 3JSVB 3TCAA 4HLEA 2WQYB 1WMHB 4FHKA 1STEA 2ZCCA 2GBRA 4OZAA 2GB1A 3DHIC 2HDEA 2V9HA 3U52E 1V5TA 2IGGA 1SE4A 4W9LA 1FMAD 3Q2AC 2W54A 5CTRC 2V3PA 2DZIA 1E5WA 3APDA 3H6NA 2DENB 2J0JA 1SIFA 1EU3A 1I7HA 2KC2A 1GOZA 4LNKA 1SE2A 2PKOA 4M00A 4Q2JA 1WZ0A 3ETRA 2EELA 3U30A 4RM9A 3AE3B 2M19A 1A70A 5T8IA 2WXFA 1UGJA 2PPHA 2CKHB 3DVGY 1YN3A 2FCQA 4XE0A 4IM2A 3H7PA 3RNFC 3DPDA 1TZOA 1YQBA 1IBXB 3L54A 1FFUA 3BY4B 1C4AA 1J7CA 3AE9B 3ZXRA 1AYFA 2KACA 3A9JB 3Q8CA 4HDQA 3IFWB 2BB6A 5JHBA 3PS6A 4LK0M 2NBVB 1TS3A 3IG3A 1R7SA 3TJPA 2NBWB 2BYEA 5EE1A 2I38A 1WGKA 1Q10A 3AEAB 4RF1A 3URYA 2A5UA 4RGNA 1TKGA 2BYFA 2Y5CA 2D3CA 3AE7B 2HJ8A 4BFRA 3EUB2 4IKGA 5AZHA 1WXAA 3I63C 4CQNA 1E10A 1OGWA 4DXAB 3N1XC 4JPSA 2JYTA 1L0YB 1M94A 3DCGA 4ZRJA 1C4CA 4S17A 2N9LA 3ZO5B 1YQ4B 2WHIA 1BT0A 2MEKA 3KQ4A 1AWDA 4G3XB 1BMLC 2NPTA 1WGRA 1UUPA 2ICIA 4GLSC 1CJEA 1FIQA 1GNUA 1YD8U 2FCMA 4YSYB 1WFYA 3AM9A 5H92C 3UGBB 4NAWA 4XX5A 1GC6A 2N0SB 5LXIB 4WURA 3RNAC 3RFZB 2W55A 2R2QA 4BOZB 3DBRB 3MC0B 1L4DB 1DOYA 3QC8B 1ZXHA 2FCNA 2AWTA 2L52A 2LUMA 1L4ZB 2BF8B 1PQSA 2O2VB 4M01A 1EM7A 1ZKHA 2EKEC 4C7ZA 2KYWA 1H8CA 1E8XA 3LYYA 2KKCA 1TKEA 2SAKA 2DNFA 3JSVA 1XLQA 1WMHA 2N7DA 1C3TA 1YNTE 2GI9A 4HPLB 4RGMA 1HZ6A 2K22A 1TYGB 1FCLA 3L08A 4YSXB 5FKAC 1SB3C 1R4NB 1N5XA 1ZDVA 1E8YA 3PPAA 1HEZE 1D4BA 3Q6BA 1IYFA 2ZEQA 2LVPA 4FULA 1JQ4A 2XEWA 5E6OA 4IG7B 2N4FA 4F8CB 4A90A 4FJYA 1YIWA 3DBHB 4IW0A 3VQIA 3N3KB 3H9DA 1KJTA 1IBXA 4TQ0A 3S2AA 3MC9A 2MWSB 3Q3NC 1TT5B 1RWSA 3A9JA 1TS5A 2ZPYA 5L95C 3QIJA 4DHZB 2DX5B 2BWES 1WJUA 3PREA 4ZHOA 2D11A 4MT5A 4LCDE 4WJQA 1U4AA 3ZNHB 5EE9A 4N58A 3I57A 1OEYJ 2AEHA 4HDOA 3WANA 1F9JA 4W9FA 4EOYA 3A4SC 3K9PB 2G45B 2TSSA 4YWGG 3AECB 4GU2A 3Q3MC 1E7PB 3H7SA 3PV1A 4REZA 3Q3FA 1UGMA 3A1QB 1XCTL 1EUVB 1UH6A 3MC8A 4DK5A 2R2OA 4ARIA 3P4PB 1FXTB 4GB9A 2MSED 2J0MA 1TKYA 3N9YC 2MBHA 3BVZA 4IC7B 3RULA 4YTMB 2C60A 2JYEA 2ASQA 2AYOB 1MJDA 1XEEA 2WDTB 2BVCA 2PMVA 4M8NA 3QWZB 3IBEA 1LM8B 1TS2A 4KVGB 1VR9A 4IWOA 3RNBC 2UWQA 2BWFA 4MDKE 3VRBB 3R2TA 2BKFA 3GOEA 4D2KA 1N61A 4TKNA 3WAMA 3PRMB 3RYTA 3Q69A 2L1AA 3BINA 1K53A 4B0MA 2O2VA 2V4IB 1WGHA 4P1BC 3DQVA 2YVCA 2MX2A 2N9XA 4XYCA 1WXMA 4ICVA 3ABVB 1RFKA 3EFUA 5DPSA 4C80A 1V1PA 4XDDA 3NUHB 3DVGX 2KWDA 1QT9A 5HG2A 2G4DB 2LI5A 1C79A 2DYMA 3UIOB 4FJVB 3CSFA 3T3NA 3MFGA 1WR1A 4HVBA 2LXCA 1J19A 2WX1A 2JU6X 2MW5A 4W9HA 1FNVA 2H89B 3V6EB 4WWNA 2N7JA 1NDDA 2D5GA 4ZRKA 1VD2A 2Y5PA 4II3B 3ZJVA 2CJOA 2EMSA 1C78A 1PYWD 2OHFA 4YL8A 3ZGZA 1KOTA 4NAMA 1J7BA 1ZXIA 4YTNB 1Q5WB 3UQBA 2MJ3A 4WWOA 4HJGE 3JYUA 2OEDA 3V6CB 4KKJA 3HRDD 3KH0A 1C9FA 2QCZA 3I3TB 4BKTA 1TGZB 4ANXA 2B76B 1ZE3D 4ASWC 2KX3A 1I42A 3RZWC 4KZCA 1SEBD 3ZNID 3VUWA 4NJCA 1MG8A 2E6XA 1ZUD2 2L0FA 1V80A 1UZXB 2BGFA 3KUZA 1PGXA 4PS3A 4NQLB 3W5UB 4OZBA 1I4QA 2FUHB 3C19A 1WX8A 1L5PA 4ANVA 5BMIA 5KHQA 4A55A 3X0WA 3ZKJC 2L00B 1ZDXA 2KD0A 4B0EA 4L2YA 1QOBA 5E6NA 3MHZA 4TQ1A 1ET6A 3A1QA 2B3AA 3DWMA 3TIXA 3QQ8B 3ZXVA 2M4NA 3MHSD 1WJ4A 4G11A 1Y8RC 1WE6A 2IO3B 2LASA 1WH3A 1HQRD 2D3BA 1IGDA 1S1QB 2MBQA 1F52A 1T0RC 4N59A 2KJ6A 1JCKB 2YEPB 1JMLA 1WY8A 3TL5A 3UIPB 3APFA 3IAS1 4YSZB 3NJTA 4HKZE 5TSSA 1WIAA 1HA5A 1B1ZA 1KFYB 1VZ6A 1E90A 2JZZA 5EDSA 4ACFA 1PGAA 1NYQA
chains in the Genus database with same CATH topology
3H7PA 1P9DU 1WXVA 4NNJB 2KK8A 3DPDA 2K25A 3PRZA 1S3SG 3AU4A 3ONSA 1YQBA 3QX1A 2KDBA 3L54A 4N9F4 4WQOB 3N30A 3BY4B 3W1SA 4URKA 5IA7A 2DAFA 4W9KA 2JZ3B 3A9JB 2KOXA 1Q0WB 1V86A 4JLCA 4HDQA 5D6JB 3IFWB 2KLCA 2ZZPB 3O65B 3PRPB 3QK0A 5JHBA 3PS6A 2K8HA 2N9EB 2NBVB 3IG3A 4FBJB 3TJPA 2KDIA 3P2BA 2NBWB 4F1SA 2BYEA 3WIMA 2O6VD 1H4RA 3JVZX 5DCNA 2KDFB 2JVCA 3ZDMC 1XD3B 4RM8A 4MH0E 2N1VA 1V81A 2A5UA 4PS7A 4E3CA 1I35A 2KWVB 4RMAA 4I6PA 3M95A 1XQQA 3R7QA 2BYFA 5CX3A 4DDID 1P0RA 1YJ1A 3VAWA 2M17A 3W1YA 2HJ8A 4BFRA 2JRHA 3SDLC 5AZHA 1WXAA 2JF5A 5CHVC 4WJOA 1XT9B 4WJPA 2IY0B 3DBRI 2HD5B 1OGWA 4DXAB 2VRRB 1M94A 3QHTA 3AU5A 3DCGA 4ZRJA 5G2NA 3UF8A 2BYVE 2L05A 1WI0A 1WGYA 2I1KA 3ZO5B 4AJYB 4M0WB 2O6VA 3NHEB 1BT0A 1X1MA 2EMTA 2KN5A 1WR6E 1WXSA 4EZKA 4G3XB 3L0WB 4HPMB 2KDEB 1EF5A 2JY6A 2W9NA 4CO7A 2PJHA 2LRWA 2NPTA 3JW0X 3ZNZB 1WGRA 1EF1A 3VHTC 1GNUA 1YD8U 2FCMA 1WFYA 4W9IA 3HK0A 2GBKA 3UGBB 2OOBB 4MSQB 4IM3A 1T0YA 3NS8A 3C0RB 4NAWA 3PGEA 3AI5A 4MELA 1GUAB 4XX5A 5JH5C 1GC6A 1WRDB 5LXIB 1UD7A 2JXXA 3Q3JA 3X23A 3U8ZA 1LFDA 4PYZA 3QAQA 2CS4A 2R2QA 3VVWB 4BOZB 2A4ZA 4W9EA 4II2B 4WJNA 1Z2MA 4JIOU 4FJZA 2MQJA 1GJZA 2LGXA 2IO0B 3R7RA 3QC8B 3PSEB 2KFKA 5G55A 2FCNA 2KMCA 4MEMA 2AWTA 2JRIB 4I6LB 3ZW3A 4W9CA 2BF8B 2RSUA 2NR2A 5DPRA 1PQSA 2O2VB 2BKRB 1ZKHA 2EKEC 2J7QB 1H8CA 1P98A 4EKUA 1E8XA 3QCAA 1VCBA 2KQSA 4A20A 2KKCA 2KO3A 3PT2B 4MGIE 3PTFC 3L10B 1GC7A 2IO2B 2L3ZA 2L76A 3B08A 3HIZA 3TBLD 1Q1OA 3JSVA 3DOWA 2KNBA 1WMHA 3SU8X 2N7DA 2IZVB 1C3TA 4HPLB 4DHJB 2L8JA 4FA6A 2G3QB 1A5RA 2GBJA 5JZEB 2NCNA 1V2YA 2RD0A 2KVRA 1WYWB 3M62B 4MJSA 3ZVVA 4BBNF 2KXJA 1WM2A 3L08A 3EC8A 4FN2A 4A3PA 3A9KA 4JQWC 3T9LA 1SGHA 3OAWA 2MP2A 4ZDVA 4K7WA 4EEWA 1E8YA 4GN1A 3DBSA 3PPAA 2LUEA 4GDKA 5DPWA 1OTRB 5C1ZA 2ZNVC 2C5LC 3PHXB 1IYFA 2ZEQA 2KLGA 3M63B 5GMVA 4GGQA 4B9KA 3MJWA 2LVPA 3W1SC 4JL9A 2JUOA 4NJ7A 4FULA 1L7YA 1WM3A 2XEWA 4K7UA 5E6OA 4GDLB 4LDTD 2KJRA 4B95A 2FAZA 3KYCD 4IG7B 2N4FA 2KQ7A 2PEAA 3EHVA 4F8CB 2K6QA 2KTRB 4FJYA 1YIWA 2GBMA 1E7UA 2GOWA 2MLBA 3MTNB 4PYUA 3CF6E 1WX9A 4IW0A 3VQIA 5JHAA 4DHZE 3KW5B 2MBOA 3N3KB 3H9DA 3PHWB 1KJTA 4G50A 4TQ0A 1R4MI 4E71A 5LXHA 3S2AA 2MWSB 3L16A 2RR9A 4HXDA 4CHKA 3VXWA 3ZTDA 1TBEA 3A9JA 2ZPYA 4ICUA 5L95C 3KUCB 5CHFA 3QIJA 3V61A 4DHZB 2DX5B 5LLIA 1V49A 1WGGA 2BWES 4X57B 4AOFA 1WJUA 2V3SA 3PREA 4BOSC 1YX6B 2L0TA 3VUYA 3SHQA 2D11A 2IO1B 3V62A 3IHPC 4LCDE 1D3ZA 2FNJB 1IPGA 4HJKA 4WJQA 1U4AA 3ZNHB 4FLHA 1OEYJ 2AEHA 1UBIA 2CHXA 3WAOA 2KZRA 3R66C 3M3JA 4HDOA 3WANA 1F9JA 4W9FA 4EOYA 3A4SC 2C7MB 5DPTA 3K9PB 5FR6A 4GIVA 2G45B 4GU2A 1C1YB 3HM6X 3H7SA 1QZEA 2I1JA 5AZGA 3RT3B 3PV1A 2V1YA 2NBUA 4KSKC 5TR5A 3U7DA 1J8CA 3OJ4B 3Q3FA 1UGMA 4AJWA 3A1QB 4MGZE 3NZSA 4KSLC 4DBGA 5E6PA 3KYDD 1JRUA 2IY1B 4ANWA 2DZMA 5J18A 2Z0DB 1EUVB 1R4NI 1UH6A 2C7HA 4BKSD 2DZJA 4DK5A 2R2OA 4ZYNA 4P7IA 3PZDA 4F7ZA 2XK5B 4J6IA 3D32A 1FXTB 3KUDB 3ZLZA 2MCNB 2KMAA 2M1MA 2MSED 2J0MA 4GB9A 3ZTCA 1V5OA 1WJ6A 4MGYE 3ZRCA 2KTFA 1YX5B 3RZFA 2MBHA 3IVFA 2K8BA 2ZVOA 4IC7B 3RULA 2CR5A 4DDGD 2C60A 2LVQA 2C9WB 3HHMA 2ASQA 2DYOA 2AYOB 2WX0A 3GZNI 4KZ0A 3VTWA 4E74A 2BPSA 2WDTB 5AZFA 2PE9A 2Z0EB 4HCNB 2MBEA 4KIKB 3NZUA 5J17A 1LXDA 4M8NA 4AP4C 3A4RA 3QWZB 2CHWA 1LM8B 3DBHI 3IBEA 4GSWA 2LXAA 4KVGB 2LRUA 4IWOA 2UWQA 2BWFA 4MDKE 3H7PB 1ZGUB 2BKFA 3ZIMA 2JPHA 3RD2A 4BKGA 3GOEA 1RLFA 4BVUC 2ZNVB 4A3OA 4GXBA 2N1WA 2AL3A 4TKNA 2MA9B 3WAMA 3VFKA 4BKSA 4CYEA 5KHOA 2K8CA 3PRMB 3RYTA 3EECA 3BINA 3NOBA 4FADA 3LJ3A 2GMIC 4ANUA 2O2VA 4JGHB 3AXCA 3OLMD 4K1RB 1V9JA 4I6NB 1WGHA 2ZPNA 3L13A 4IM0A 3DQVA 3UQAA 2YVCA 3B1LX 2GBNA 2MX2A 1RRBA 1WXMA 2N9XA 3CSTA 4ICVA 2LJ5A 4LJOB 4NJ6A 3H1UA 2K1FA 4TUUA 2CHZA 1TZ1A 3EFUA 5DPSA 3QJZA 4IUMB 5D7GA 3ZUNA 3DVGX 4B6WA 2M0XA 3AULA 2CU1A 2OJRA 4HCPB 3DDCB 2G4DB 2LI5A 2Y5BB 3CMMB 2JT4B 2KHWB 3TMPB 5L83A 1HE8A 4NPNA 2DYMA 3UIOB 1V6EA 2LGYA 3CSFA 4FJVB 4IM2A 1IP9A 4WWPA 1J0GA 3ZNGC 1WR1A 2LD9A 2ZVNA 3RUIB 2LXCA 4HVBA 5HKHA 3APCA 2V4LA 1J19A 2WX1A 4IWPA 2MW5A 4W9HA 2D2QA 2YLMA 2KANA 2Z59B 3ECIA 3KVFB 4EUTA 3V6EB 4WWNA 4XZ4A 3DBLI 1KM7A 4W9JA 1SE9A 2PE6B 2LZ6A 4MGKE 1LQBA 1NDDA 4EZJA 4ZRKA 1VD2A 4II3B 2EMSA 3WA0A 4PS8A 2O6VB 2DZKA 3HM3A 2LVOA 4LDTB 5D2MB 1WGDA 4GDLA 4YL8A 3VH4B 1EO6A 4IWQA 4W9DA 1KOTA 3QARA 1G6JA 3N32A 1OQYA 3K9OB 4HK2A 2NPTB 2KTRA 1Q5WB 3UQBA 4K81A 2K39A 1K8RB 4NQKE 2REXA 3WALA 4WWOA 2DHZA 4BBNC 4KV2A 1GG3A 3JYUA 1E7VA 3V6CB 4AWJA 3PVLA 5D94A 3ENEA 3KH0A 1WJNA 3B0AA 1RAXA 4GMVA 4KDLB 4NAWB 1WZ3A 3ALBA 3ZRFA 1WE7A 2D10A 3I3TB 1OEYA 4BKTA 2WWZA 3V60A 1TGZB 2IBIB 4ANXA 2XBBC 2L7RA 4ASWC 3VUXA 2KX3A 1I42A 1UBQA 4KZCA 3RZWC 3ZNID 2LGDA 3VUWA 3DVNV 1ZW7A 4OVUA 1MG8A 3ML9A 1KLVA 2L0FA 2K6DB 2QHOA 2MBBB 2WYQA 1V80A 2JWZA 4G0NB 1UZXB 2J0KA 2BGFA 3KUZA 2KFKB 3DVNU 1UELA 2KFJA 4FHJA 4W9GA 4PS3A 4MSMB 4TV3A 4NQLB 2RPQA 5J2RA 2C7NB 1RFAA 2D3GA 3QA8A 3VH3B 2KWUB 4ZRIA 3LDZE 3PLVA 2HE7A 2ZCBA 4K7SA 3WAPA 3NY5A 3RCZA 1NBFC 2ZJDA 2FUHB 3VTUA 2DYBA 1WF9A 1WX8A 2UYZB 4ANVA 5KHQA 1L2NA 1TTNA 3X0WA 3ZKJC 1ISNA 2L00B 2N9PC 1E8ZA 4NY0A 2AL6A 2RGFA 3SD5A 2KD0A 2M8SA 3JSVB 3TCAA 4HLEA 1WMHB 2NS5A 4FHKA 4EZLA 1P3QU 5E6NA 2ZCCA 2D07B 2GBRA 4TQ1A 3A1QA 3ML8A 4M8MA 2B3AA 4DHJD 3TIXA 3QQ8B 2G4SA 5C23A 4LJPB 2M4NA 1V5TA 3MHSD 4KDIC 1WJ4A 4MJSB 4MM3A 4W9LA 4G11A 1Y8RC 2FIFA 1WE6A 2NVUI 2IO3B 2LASA 2KC1A 3ZDTA 5AEKB 3A9KB 4OVVA 1WH3A 2DAJA 2XK5A 5CTRC 2DZIA 2KWCA 2FIDA 2FCSA 4AUQC 2MP2B 1E5WA 3APDA 3H6NA 3A33B 2DENB 4XC2A 4WAAA 2J0JA 3PLUA 1SIFA 4HWIB 5BO4B 1S1QB 2N7EA 4DWFA 2MBQA 4GDKB 2KC2A 3R3MA 3VTVA 1WZ0A 2LWPA 2KJ6A 3OJ3A 5CHWA 2HTHA 1WY8A 3U30A 4RM9A 5IAAC 3APFA 3TL5A 3UIPB 1P1AA 4KIKA 1CMXB 1E8WA 2PPHA 4EFOA 2CKHB 3UINB 3VDZA 1WIAA 1AARA 1NI2A 3DVGY 1WX7A 2IYDB 3T8MA 2FCQA 3L17A 1Z5SB 2MRPA 1E90A 2JZZA 5EDSA 4GOCA 2KX0A 2KJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7P A;  1P9D U;  1WXV A;  4NNJ B;  2KK8 A;  3DPD A;  2K25 A;  3PRZ A;  1S3S G;  3AU4 A;  3ONS A;  1YQB A;  3QX1 A;  2KDB A;  3L54 A;  4N9F 4;  4WQO B;  3N30 A;  3BY4 B;  3W1S A;  4URK A;  5IA7 A;  2DAF A;  4W9K A;  2JZ3 B;  3A9J B;  2KOX A;  1Q0W B;  1V86 A;  4JLC A;  4HDQ A;  5D6J B;  3IFW B;  2KLC A;  2ZZP B;  3O65 B;  3PRP B;  3QK0 A;  5JHB A;  3PS6 A;  2K8H A;  2N9E B;  2NBV B;  3IG3 A;  4FBJ B;  3TJP A;  2KDI A;  3P2B A;  2NBW B;  4F1S A;  2BYE A;  3WIM A;  2O6V D;  1H4R A;  3JVZ X;  5DCN A;  2KDF B;  2JVC A;  3ZDM C;  1XD3 B;  4RM8 A;  4MH0 E;  2N1V A;  1V81 A;  2A5U A;  4PS7 A;  4E3C A;  1I35 A;  2KWV B;  4RMA A;  4I6P A;  3M95 A;  1XQQ A;  3R7Q A;  2BYF A;  5CX3 A;  4DDI D;  1P0R A;  1YJ1 A;  3VAW A;  2M17 A;  3W1Y A;  2HJ8 A;  4BFR A;  2JRH A;  3SDL C;  5AZH A;  1WXA A;  2JF5 A;  5CHV C;  4WJO A;  1XT9 B;  4WJP A;  2IY0 B;  3DBR I;  2HD5 B;  1OGW A;  4DXA B;  2VRR B;  1M94 A;  3QHT A;  3AU5 A;  3DCG A;  4ZRJ A;  5G2N A;  3UF8 A;  2BYV E;  2L05 A;  1WI0 A;  1WGY A;  2I1K A;  3ZO5 B;  4AJY B;  4M0W B;  2O6V A;  3NHE B;  1BT0 A;  1X1M A;  2EMT A;  2KN5 A;  1WR6 E;  1WXS A;  4EZK A;  4G3X B;  3L0W B;  4HPM B;  2KDE B;  1EF5 A;  2JY6 A;  2W9N A;  4CO7 A;  2PJH A;  2LRW A;  2NPT A;  3JW0 X;  3ZNZ B;  1WGR A;  1EF1 A;  3VHT C;  1GNU A;  1YD8 U;  2FCM A;  1WFY A;  4W9I A;  3HK0 A;  2GBK A;  3UGB B;  2OOB B;  4MSQ B;  4IM3 A;  1T0Y A;  3NS8 A;  3C0R B;  4NAW A;  3PGE A;  3AI5 A;  4MEL A;  1GUA B;  4XX5 A;  5JH5 C;  1GC6 A;  1WRD B;  5LXI B;  1UD7 A;  2JXX A;  3Q3J A;  3X23 A;  3U8Z A;  1LFD A;  4PYZ A;  3QAQ A;  2CS4 A;  2R2Q A;  3VVW B;  4BOZ B;  2A4Z A;  4W9E A;  4II2 B;  4WJN A;  1Z2M A;  4JIO U;  4FJZ A;  2MQJ A;  1GJZ A;  2LGX A;  2IO0 B;  3R7R A;  3QC8 B;  3PSE B;  2KFK A;  5G55 A;  2FCN A;  2KMC A;  4MEM A;  2AWT A;  2JRI B;  4I6L B;  3ZW3 A;  4W9C A;  2BF8 B;  2RSU A;  2NR2 A;  5DPR A;  1PQS A;  2O2V B;  2BKR B;  1ZKH A;  2EKE C;  2J7Q B;  1H8C A;  1P98 A;  4EKU A;  1E8X A;  3QCA A;  1VCB A;  2KQS A;  4A20 A;  2KKC A;  2KO3 A;  3PT2 B;  4MGI E;  3PTF C;  3L10 B;  1GC7 A;  2IO2 B;  2L3Z A;  2L76 A;  3B08 A;  3HIZ A;  3TBL D;  1Q1O A;  3JSV A;  3DOW A;  2KNB A;  1WMH A;  3SU8 X;  2N7D A;  2IZV B;  1C3T A;  4HPL B;  4DHJ B;  2L8J A;  4FA6 A;  2G3Q B;  1A5R A;  2GBJ A;  5JZE B;  2NCN A;  1V2Y A;  2RD0 A;  2KVR A;  1WYW B;  3M62 B;  4MJS A;  3ZVV A;  4BBN F;  2KXJ A;  1WM2 A;  3L08 A;  3EC8 A;  4FN2 A;  4A3P A;  3A9K A;  4JQW C;  3T9L A;  1SGH A;  3OAW A;  2MP2 A;  4ZDV A;  4K7W A;  4EEW A;  1E8Y A;  4GN1 A;  3DBS A;  3PPA A;  2LUE A;  4GDK A;  5DPW A;  1OTR B;  5C1Z A;  2ZNV C;  2C5L C;  3PHX B;  1IYF A;  2ZEQ A;  2KLG A;  3M63 B;  5GMV A;  4GGQ A;  4B9K A;  3MJW A;  2LVP A;  3W1S C;  4JL9 A;  2JUO A;  4NJ7 A;  4FUL A;  1L7Y A;  1WM3 A;  2XEW A;  4K7U A;  5E6O A;  4GDL B;  4LDT D;  2KJR A;  4B95 A;  2FAZ A;  3KYC D;  4IG7 B;  2N4F A;  2KQ7 A;  2PEA A;  3EHV A;  4F8C B;  2K6Q A;  2KTR B;  4FJY A;  1YIW A;  2GBM A;  1E7U A;  2GOW A;  2MLB A;  3MTN B;  4PYU A;  3CF6 E;  1WX9 A;  4IW0 A;  3VQI A;  5JHA A;  4DHZ E;  3KW5 B;  2MBO A;  3N3K B;  3H9D A;  3PHW B;  1KJT A;  4G50 A;  4TQ0 A;  1R4M I;  4E71 A;  5LXH A;  3S2A A;  2MWS B;  3L16 A;  2RR9 A;  4HXD A;  4CHK A;  3VXW A;  3ZTD A;  1TBE A;  3A9J A;  2ZPY A;  4ICU A;  5L95 C;  3KUC B;  5CHF A;  3QIJ A;  3V61 A;  4DHZ B;  2DX5 B;  5LLI A;  1V49 A;  1WGG A;  2BWE S;  4X57 B;  4AOF A;  1WJU A;  2V3S A;  3PRE A;  4BOS C;  1YX6 B;  2L0T A;  3VUY A;  3SHQ A;  2D11 A;  2IO1 B;  3V62 A;  3IHP C;  4LCD E;  1D3Z A;  2FNJ B;  1IPG A;  4HJK A;  4WJQ A;  1U4A A;  3ZNH B;  4FLH A;  1OEY J;  2AEH A;  1UBI A;  2CHX A;  3WAO A;  2KZR A;  3R66 C;  3M3J A;  4HDO A;  3WAN A;  1F9J A;  4W9F A;  4EOY A;  3A4S C;  2C7M B;  5DPT A;  3K9P B;  5FR6 A;  4GIV A;  2G45 B;  4GU2 A;  1C1Y B;  3HM6 X;  3H7S A;  1QZE A;  2I1J A;  5AZG A;  3RT3 B;  3PV1 A;  2V1Y A;  2NBU A;  4KSK C;  5TR5 A;  3U7D A;  1J8C A;  3OJ4 B;  3Q3F A;  1UGM A;  4AJW A;  3A1Q B;  4MGZ E;  3NZS A;  4KSL C;  4DBG A;  5E6P A;  3KYD D;  1JRU A;  2IY1 B;  4ANW A;  2DZM A;  5J18 A;  2Z0D B;  1EUV B;  1R4N I;  1UH6 A;  2C7H A;  4BKS D;  2DZJ A;  4DK5 A;  2R2O A;  4ZYN A;  4P7I A;  3PZD A;  4F7Z A;  2XK5 B;  4J6I A;  3D32 A;  1FXT B;  3KUD B;  3ZLZ A;  2MCN B;  2KMA A;  2M1M A;  2MSE D;  2J0M A;  4GB9 A;  3ZTC A;  1V5O A;  1WJ6 A;  4MGY E;  3ZRC A;  2KTF A;  1YX5 B;  3RZF A;  2MBH A;  3IVF A;  2K8B A;  2ZVO A;  4IC7 B;  3RUL A;  2CR5 A;  4DDG D;  2C60 A;  2LVQ A;  2C9W B;  3HHM A;  2ASQ A;  2DYO A;  2AYO B;  2WX0 A;  3GZN I;  4KZ0 A;  3VTW A;  4E74 A;  2BPS A;  2WDT B;  5AZF A;  2PE9 A;  2Z0E B;  4HCN B;  2MBE A;  4KIK B;  3NZU A;  5J17 A;  1LXD A;  4M8N A;  4AP4 C;  3A4R A;  3QWZ B;  2CHW A;  1LM8 B;  3DBH I;  3IBE A;  4GSW A;  2LXA A;  4KVG B;  2LRU A;  4IWO A;  2UWQ A;  2BWF A;  4MDK E;  3H7P B;  1ZGU B;  2BKF A;  3ZIM A;  2JPH A;  3RD2 A;  4BKG A;  3GOE A;  1RLF A;  4BVU C;  2ZNV B;  4A3O A;  4GXB A;  2N1W A;  2AL3 A;  4TKN A;  2MA9 B;  3WAM A;  3VFK A;  4BKS A;  4CYE A;  5KHO A;  2K8C A;  3PRM B;  3RYT A;  3EEC A;  3BIN A;  3NOB A;  4FAD A;  3LJ3 A;  2GMI C;  4ANU A;  2O2V A;  4JGH B;  3AXC A;  3OLM D;  4K1R B;  1V9J A;  4I6N B;  1WGH A;  2ZPN A;  3L13 A;  4IM0 A;  3DQV A;  3UQA A;  2YVC A;  3B1L X;  2GBN A;  2MX2 A;  1RRB A;  1WXM A;  2N9X A;  3CST A;  4ICV A;  2LJ5 A;  4LJO B;  4NJ6 A;  3H1U A;  2K1F A;  4TUU A;  2CHZ A;  1TZ1 A;  3EFU A;  5DPS A;  3QJZ A;  4IUM B;  5D7G A;  3ZUN A;  3DVG X;  4B6W A;  2M0X A;  3AUL A;  2CU1 A;  2OJR A;  4HCP B;  3DDC B;  2G4D B;  2LI5 A;  2Y5B B;  3CMM B;  2JT4 B;  2KHW B;  3TMP B;  5L83 A;  1HE8 A;  4NPN A;  2DYM A;  3UIO B;  1V6E A;  2LGY A;  3CSF A;  4FJV B;  4IM2 A;  1IP9 A;  4WWP A;  1J0G A;  3ZNG C;  1WR1 A;  2LD9 A;  2ZVN A;  3RUI B;  2LXC A;  4HVB A;  5HKH A;  3APC A;  2V4L A;  1J19 A;  2WX1 A;  4IWP A;  2MW5 A;  4W9H A;  2D2Q A;  2YLM A;  2KAN A;  2Z59 B;  3ECI A;  3KVF B;  4EUT A;  3V6E B;  4WWN A;  4XZ4 A;  3DBL I;  1KM7 A;  4W9J A;  1SE9 A;  2PE6 B;  2LZ6 A;  4MGK E;  1LQB A;  1NDD A;  4EZJ A;  4ZRK A;  1VD2 A;  4II3 B;  2EMS A;  3WA0 A;  4PS8 A;  2O6V B;  2DZK A;  3HM3 A;  2LVO A;  4LDT B;  5D2M B;  1WGD A;  4GDL A;  4YL8 A;  3VH4 B;  1EO6 A;  4IWQ A;  4W9D A;  1KOT A;  3QAR A;  1G6J A;  3N32 A;  1OQY A;  3K9O B;  4HK2 A;  2NPT B;  2KTR A;  1Q5W B;  3UQB A;  4K81 A;  2K39 A;  1K8R B;  4NQK E;  2REX A;  3WAL A;  4WWO A;  2DHZ A;  4BBN C;  4KV2 A;  1GG3 A;  3JYU A;  1E7V A;  3V6C B;  4AWJ A;  3PVL A;  5D94 A;  3ENE A;  3KH0 A;  1WJN A;  3B0A A;  1RAX A;  4GMV A;  4KDL B;  4NAW B;  1WZ3 A;  3ALB A;  3ZRF A;  1WE7 A;  2D10 A;  3I3T B;  1OEY A;  4BKT A;  2WWZ A;  3V60 A;  1TGZ B;  2IBI B;  4ANX A;  2XBB C;  2L7R A;  4ASW C;  3VUX A;  2KX3 A;  1I42 A;  1UBQ A;  4KZC A;  3RZW C;  3ZNI D;  2LGD A;  3VUW A;  3DVN V;  1ZW7 A;  4OVU A;  1MG8 A;  3ML9 A;  1KLV A;  2L0F A;  2K6D B;  2QHO A;  2MBB B;  2WYQ A;  1V80 A;  2JWZ A;  4G0N B;  1UZX B;  2J0K A;  2BGF A;  3KUZ A;  2KFK B;  3DVN U;  1UEL A;  2KFJ A;  4FHJ A;  4W9G A;  4PS3 A;  4MSM B;  4TV3 A;  4NQL B;  2RPQ A;  5J2R A;  2C7N B;  1RFA A;  2D3G A;  3QA8 A;  3VH3 B;  2KWU B;  4ZRI A;  3LDZ E;  3PLV A;  2HE7 A;  2ZCB A;  4K7S A;  3WAP A;  3NY5 A;  3RCZ A;  1NBF C;  2ZJD A;  2FUH B;  3VTU A;  2DYB A;  1WF9 A;  1WX8 A;  2UYZ B;  4ANV A;  5KHQ A;  1L2N A;  1TTN A;  3X0W A;  3ZKJ C;  1ISN A;  2L00 B;  2N9P C;  1E8Z A;  4NY0 A;  2AL6 A;  2RGF A;  3SD5 A;  2KD0 A;  2M8S A;  3JSV B;  3TCA A;  4HLE A;  1WMH B;  2NS5 A;  4FHK A;  4EZL A;  1P3Q U;  5E6N A;  2ZCC A;  2D07 B;  2GBR A;  4TQ1 A;  3A1Q A;  3ML8 A;  4M8M A;  2B3A A;  4DHJ D;  3TIX A;  3QQ8 B;  2G4S A;  5C23 A;  4LJP B;  2M4N A;  1V5T A;  3MHS D;  4KDI C;  1WJ4 A;  4MJS B;  4MM3 A;  4W9L A;  4G11 A;  1Y8R C;  2FIF A;  1WE6 A;  2NVU I;  2IO3 B;  2LAS A;  2KC1 A;  3ZDT A;  5AEK B;  3A9K B;  4OVV A;  1WH3 A;  2DAJ A;  2XK5 A;  5CTR C;  2DZI A;  2KWC A;  2FID A;  2FCS A;  4AUQ C;  2MP2 B;  1E5W A;  3APD A;  3H6N A;  3A33 B;  2DEN B;  4XC2 A;  4WAA A;  2J0J A;  3PLU A;  1SIF A;  4HWI B;  5BO4 B;  1S1Q B;  2N7E A;  4DWF A;  2MBQ A;  4GDK B;  2KC2 A;  3R3M A;  3VTV A;  1WZ0 A;  2LWP A;  2KJ6 A;  3OJ3 A;  5CHW A;  2HTH A;  1WY8 A;  3U30 A;  4RM9 A;  5IAA C;  3APF A;  3TL5 A;  3UIP B;  1P1A A;  4KIK A;  1CMX B;  1E8W A;  2PPH A;  4EFO A;  2CKH B;  3UIN B;  3VDZ A;  1WIA A;  1AAR A;  1NI2 A;  3DVG Y;  1WX7 A;  2IYD B;  3T8M A;  2FCQ A;  3L17 A;  1Z5S B;  2MRP A;  1E90 A;  2JZZ A;  5EDS A;  4GOC A;  2KX0 A;  2KJH B; 
#chains in the Genus database with same CATH topology
 1WXV A;  3PRZ A;  2QEJ C;  1S3S G;  4ZRP A;  3ONS A;  4NZL B;  3QX1 A;  3N30 A;  5IA7 A;  1N62 A;  1F77 A;  1IUE A;  5G5H A;  4C4V B;  1Q0W B;  2N9E B;  3CWI A;  1TIF A;  3P2B A;  3WIM A;  5DCN A;  2KDF B;  2KDM A;  1ACC A;  1AW7 A;  3AB5 A;  4HRO A;  4RMA A;  4I6P A;  1JWU D;  1WXQ A;  4ZOH C;  4C56 C;  3I5J C;  1YJ1 A;  3SDL C;  4KKI A;  4WJP A;  1K50 A;  2HD5 B;  3GS2 A;  4WIP A;  4JWU C;  3QHT A;  4RH6 A;  4LLG M;  4XWW A;  2BYV E;  1XF5 L;  1WGY A;  2KN4 A;  4ZRQ A;  2EMT A;  2KN5 A;  1WXS A;  4EZK A;  2KDE B;  1EF5 A;  4P1C C;  3JW0 X;  1TJE A;  5IO9 A;  1QIL A;  2GBK A;  4MSQ B;  1T0Y A;  2BQQ A;  4MEL A;  4RF0 A;  3Q3J A;  3TEX A;  4PYZ A;  1E6E B;  3P4R B;  2CS4 A;  4W9E A;  2BT6 A;  2IND C;  1F0Z A;  3MP9 A;  1Z2M A;  4FJZ A;  1F2R C;  4WAF A;  1N5W A;  3ZW3 A;  2NR2 A;  5DPR A;  1P98 A;  2KQ4 X;  3QCA A;  4A20 A;  1L0X B;  3TSS A;  1TY0 A;  2RMM A;  2IO2 B;  3B08 A;  1KTK A;  3P4Q B;  1Q1O A;  3DOW A;  3AEG B;  1XO3 A;  4ZHP A;  1UNS A;  2K3U A;  2DBY A;  5JZE B;  1MG4 A;  2R61 A;  4BBN F;  3M62 B;  4S0R A;  4FN2 A;  2K5P A;  2IPK D;  2D3A A;  2AQ3 B;  4ZDV A;  1SJE D;  2ON8 A;  5HHD G;  5C1Z A;  3AEB B;  3PHX B;  3BK2 A;  3BZD B;  1SIJ A;  2K9X A;  1V1O A;  4FXC A;  1JWS D;  2KJR A;  2FAZ A;  3KYC D;  2DLB A;  2KQ7 A;  3EHV A;  2M0A A;  1YN5 A;  2GBM A;  1KLG D;  1WX9 A;  3GE3 C;  2MBO A;  3Q8E A;  3P42 A;  4E71 A;  5LXH A;  1FM0 D;  3T3O A;  3L16 A;  2G1E A;  4RNA A;  2ONQ A;  4KGR A;  4ICU A;  4C4V A;  5CHF A;  1J7A A;  3B2G A;  2QC8 A;  2L0T A;  3SHQ A;  1FNW A;  3IHP C;  2FNJ B;  1IPG A;  1KH0 A;  5D3I B;  1WYG A;  4J3O D;  3WAO A;  4HKQ A;  3R66 C;  2C7M B;  5DPT A;  4GIV A;  1PUT A;  5BYQ A;  3LXF A;  1HXY D;  3RNE C;  2NBU A;  2MH7 A;  3OJ4 B;  1NEK B;  1I4X A;  2LJI A;  4DBG A;  3NZS A;  3KYD D;  1JRU A;  4ANW A;  2PVO D;  4MM3 B;  3P1M A;  3PZD A;  4F7Z A;  3D32 A;  3EA6 A;  3TEY A;  3BYT B;  1V5O A;  4MGY E;  3ZRC A;  3RZF A;  3IVF A;  4EE2 A;  2ZVO A;  2CR5 A;  3HHM A;  2LHE A;  2WX0 A;  4KZ0 A;  4E74 A;  5AZF A;  1N63 A;  3R2I A;  2QDF A;  1T6B X;  2CHW A;  2LXA A;  5I4D A;  1F1H A;  2ZW0 A;  3PO0 A;  3RD2 A;  4BVU C;  2ZNV B;  4A3O A;  2N1W A;  2AL3 A;  4CYE A;  2MA9 B;  2K8C A;  3Q8F A;  4ARC A;  1JW9 D;  3KWV A;  3EEC A;  3LJ3 A;  2WXL A;  4JGH B;  2XNA C;  2ZPN A;  4IM0 A;  3UQA A;  3HUI A;  2LJ5 A;  4LJO B;  2JXT A;  4TUU A;  2CHZ A;  4IUM B;  1ZP0 B;  5HFY A;  2WXI A;  3C8Y A;  4JX1 C;  4B6W A;  2BB5 A;  2M0X A;  3TEW A;  2CU1 A;  1ET9 A;  2OJR A;  2JT4 B;  2KHW B;  1HE8 A;  4NPN A;  1V6E A;  2ZVN A;  3Q14 C;  3MJ5 A;  1J8C A;  3ECI A;  1GB4 A;  1JAL A;  3KLS X;  2FE8 A;  2OJW A;  3J9C A;  4W9J A;  2MHJ A;  2LZ6 A;  4MGK E;  4EZJ A;  3FAH A;  2WNM A;  3AE5 B;  4PS8 A;  5IN7 A;  4IWQ A;  1T0Q C;  1OQY A;  1UF0 A;  2AX5 A;  4HK2 A;  3OWE B;  2K39 A;  2REX A;  3WAL A;  4BBN C;  2INN E;  3PVL A;  3ZRF A;  1WZ3 A;  2NTS A;  2WWZ A;  2MJD A;  4RGT A;  2WXK A;  2IBI B;  2XBB C;  3VUX A;  1AN8 A;  3P4S B;  1JWM D;  1MPE A;  3DVN V;  2PIA A;  1P7E A;  1KLV A;  2WYQ A;  2K0P A;  4P6V F;  4DXF A;  1I4P A;  2KFK B;  4W9G A;  1UEL A;  1VZ7 A;  5J2R A;  3RN9 C;  1VLB A;  4HPP A;  2C7N B;  2JZP A;  3VH3 B;  3TUO A;  2KWU B;  2BBC A;  5IP4 D;  3LDZ E;  1RM6 C;  2ZCB A;  3AEF B;  4K7S A;  3RCZ A;  1NBF C;  3VTU A;  2DYB A;  2G9H D;  1WF9 A;  2UYZ B;  2NTT A;  3IT6 B;  1L2N A;  4ZYS A;  2N9P C;  2M8S A;  4JE3 B;  2CJN A;  2X8X X;  4BZA A;  2NS5 A;  3HVZ A;  3ML8 A;  4LJP B;  1PFD A;  4MJS B;  4MM3 A;  2KC1 A;  3ZDT A;  3AMZ A;  2DAJ A;  2FID A;  1JWA D;  2FCS A;  4AUQ C;  3A33 B;  2WLB A;  4LTU A;  4WAA A;  3PLU A;  4HWI B;  5BO4 B;  1C77 A;  2N7E A;  4DWF A;  3VTV A;  2LWP A;  5CHW A;  1YMH E;  5H8Y E;  3R8B A;  2V3N A;  3NRZ A;  1FO4 A;  3ZQ4 A;  1L6V A;  1NI2 A;  2IYD B;  3BVG A;  3L17 A;  2MRP A;  4QAY A;  4GOC A;  2KX0 A;  2HTM E;  2KJH B;  1HTO A;  2INC C;  1P9D U;  4NNJ B;  5FK9 C;  2KK8 A;  3NVW A;  2K25 A;  5IKC M;  1XLO A;  2KT7 A;  2KDB A;  1FD6 A;  2KAJ A;  2AQ1 B;  3E9S A;  4URK A;  2JZ3 B;  5BYS A;  5D6J B;  3QK0 A;  1OQR A;  2WDQ B;  2ZZP B;  2K8H A;  2WXM A;  2M56 B;  2WXR A;  4F1S A;  4JWS C;  2O6V D;  4OVZ A;  1B9R A;  1H4R A;  3JVZ X;  3ZDM C;  1XD3 B;  3N1Y C;  4MH0 E;  2N1V A;  2WGS A;  1V81 A;  1NYR A;  2LGS A;  1EU4 A;  1SSN A;  5MPO A;  3M95 A;  1XQQ A;  2M17 A;  2WS3 B;  3W1Y A;  1FRD A;  2JF5 A;  5CHV C;  5BMH A;  4WJO A;  3N1Z C;  1XT9 B;  2IY0 B;  1FNU A;  3DBR I;  2PVG C;  3RI7 C;  5LNK 1;  3AU5 A;  4PK1 A;  2WU5 B;  5BYR A;  4OHJ A;  4AJY B;  2AQ2 B;  3HVD A;  3L0W B;  2JY6 A;  2LRW A;  3ZNZ B;  1I4H A;  1I4G A;  1DOX A;  2FUG 1;  4W9I A;  3HK0 A;  4IM3 A;  3NS8 A;  2DWQ A;  1GUA B;  3AE2 B;  3KWL A;  1WWT A;  2JXX A;  3U8Z A;  1UWM A;  3QAQ A;  1D5X C;  2MJE A;  1VZ8 A;  2RDH A;  4II2 B;  1Y56 A;  2MQJ A;  3L4P A;  2IO0 B;  3PSE B;  2KFK A;  1E9M A;  1CK1 A;  2KMC A;  4I6L B;  2RDB C;  4W9C A;  1SXT A;  2RSU A;  1DGJ A;  2WU2 B;  3V3X A;  2KQS A;  3PT2 B;  4MGI E;  3PTF C;  3L10 B;  1GC7 A;  2L3Z A;  5C2T B;  4US8 A;  3HIZ A;  4YTP B;  4DHJ B;  2L8J A;  2G3Q B;  3BK1 A;  1V2Y A;  2KVR A;  1WYW B;  4MJS A;  1SF0 A;  3SR6 A;  2KXJ A;  3EC8 A;  1MI0 A;  1SGH A;  3BYY B;  3GP7 A;  1DYQ A;  4DQO C;  3OAW A;  4LNO A;  4RCO A;  4C00 A;  4EEW A;  1DOI A;  1HZ5 A;  2ZNV C;  5GMV A;  4GGQ A;  1RYJ A;  2JUO A;  4JL9 A;  4NJ7 A;  3B9J A;  3I9V 1;  4IOI E;  2K6Q A;  1E0Z A;  3MTN B;  1F2R I;  4DHZ E;  1FRR A;  3PHW B;  1R4M I;  2LGI A;  2WXJ A;  4CHK A;  1HTQ A;  2W3R A;  3KUC B;  2WXN A;  5LLI A;  1WGG A;  4AOF A;  2V3S A;  2VH2 A;  4BOS C;  1YX6 B;  3VUY A;  4RGO S;  3V62 A;  2WDV B;  1QKZ A;  4HJK A;  4FLH A;  1JWB D;  1UBI A;  3CIR B;  1ROE A;  2KZR A;  5IOI A;  3IT4 B;  3BVM A;  2WXO A;  5FR6 A;  4K3B A;  1JRP A;  1C1Y B;  3HM6 X;  4L1B A;  3RT3 B;  3H8H A;  1FEH A;  2QIE B;  5TR5 A;  3U7D A;  3AE4 B;  2INP E;  4AJW A;  1CQV A;  3V05 A;  4MGZ E;  5E6P A;  1T5X D;  5J18 A;  2DZM A;  2C7H A;  4BKS D;  2YEP F;  4LNF A;  4P7I A;  3LB8 C;  3VRA B;  2XK5 B;  4J6I A;  3ZLZ A;  2MCN B;  2KMA A;  2VH1 A;  3ZTC A;  1SJH D;  1VRA B;  4N6E B;  1FFV A;  1YX5 B;  1T3Q A;  2IJ0 A;  2LVQ A;  1LGR A;  1N60 A;  3VR8 B;  3GZN I;  3VTW A;  2BPS A;  1XCQ L;  2PE9 A;  4L23 A;  4KIK B;  3NZU A;  4MH8 A;  1YN4 A;  5J17 A;  2J53 A;  2BS4 B;  1FXI A;  2LRU A;  3ZIM A;  4BKG A;  4GXB A;  2CU3 A;  3VFK A;  5KHO A;  2ZW1 A;  1MVK A;  2GMI C;  4ANU A;  1QQR A;  5D3D A;  3AXC A;  3OLM D;  1V9J A;  3IXS A;  4A8X C;  3L13 A;  1ESF A;  2Q5W D;  2GBN A;  3CST A;  1VDV A;  2VZK B;  4NJ6 A;  3H1U A;  2K1F A;  1TZ1 A;  1T0S C;  3NG0 A;  3QJZ A;  4A9A A;  2IGH A;  3AUL A;  1EWY C;  1YQ3 B;  3DDC B;  2Y5B B;  3CMM B;  3TMP B;  5C3J B;  3P63 A;  4R3D A;  4TMA B;  4RFB A;  5HKH A;  3RUI B;  3APC A;  2NMQ A;  2V4L A;  2GLS A;  2D2Q A;  1LO5 D;  2YLM A;  2Z59 B;  4XZ4 A;  3DBL I;  3DHH C;  1KM7 A;  2PE6 B;  3W2D A;  5JXV A;  3AH7 A;  3AV8 A;  2WXQ A;  2O6V B;  2DZK A;  3HM3 A;  2LVO A;  4LDT B;  1WGD A;  3VH4 B;  1EO6 A;  2QSD A;  4W9D A;  5E6J A;  1G6J A;  3K9O B;  1SBB B;  4K81 A;  1K8R B;  4NQK E;  3U7Z A;  2DHZ A;  3GE8 C;  4P16 A;  4KV2 A;  1GG3 A;  4OZC A;  1E7V A;  2WXG A;  2XN9 C;  5D94 A;  3ENE A;  4KGS A;  1WJN A;  4GMV A;  3ALB A;  1WE7 A;  1OEY A;  4K3C A;  1FXA A;  3U2S C;  2LGD A;  3EGR A;  1ZW7 A;  4OVU A;  1QF6 A;  3ML9 A;  2QHO A;  1NEN B;  2JWZ A;  4US9 A;  4G0N B;  3DVN U;  2KFJ A;  4FHJ A;  4MSM B;  4TV3 A;  3DHG C;  1I4R A;  1RFA A;  3QA8 A;  1EWC A;  4ZRI A;  3WAP A;  1JRO A;  2BW2 A;  1GAQ B;  4AQ7 A;  1E8Z A;  4NY0 A;  2AL6 A;  2RGF A;  4WH4 A;  4XGA B;  4YXD B;  3FIL B;  4EZL A;  1P3Q U;  5G5G A;  2D07 B;  4M8M A;  4DHJ D;  5C23 A;  2G4S A;  4KDI C;  2FIF A;  2NVU I;  5AEK B;  3A9K B;  4OVV A;  2XK5 A;  2KWC A;  1XLP A;  2MP2 B;  4XC2 A;  5EE0 A;  1SE3 A;  4GDK B;  3R3M A;  1WRI A;  3OJ3 A;  2HTH A;  1V1P B;  5IAA C;  1P1A A;  4KIK A;  1CMX B;  1E8W A;  2BTE A;  4EFO A;  3N20 C;  3UIN B;  3VDZ A;  1AAR A;  1WX7 A;  3T8M A;  2JSV X;  1Z5S B;  2HJ1 A;  3AU4 A;  4WQO B;  4N9F 4;  1ZPS A;  4BAX A;  3W1S A;  2DAF A;  3GB1 A;  4W9K A;  1QOG A;  5AUK A;  2KOX A;  1D6E C;  1V86 A;  2EKI A;  4JLC A;  3O65 B;  2KLC A;  3PRP B;  5BMG A;  1FCC C;  2WP9 B;  2BYT A;  2RDG A;  4FBJ B;  2KDI A;  1IGC A;  3AE1 B;  2WXH A;  5AUI A;  2IGD A;  2JVC A;  4RM8 A;  4PS7 A;  4E3C A;  5FR3 A;  1I35 A;  2KWV B;  4KGT A;  3R7Q A;  5CX3 A;  3SFD B;  4DDI D;  4USA A;  1P0R A;  3VAW A;  2V0G A;  4O1N A;  1M4V A;  2JRH A;  2WXP A;  2X38 A;  3OG5 A;  2VRR B;  3SFE B;  3BWU D;  4KX6 B;  2RPV A;  5G2N A;  3UF8 A;  2L05 A;  1KLU D;  1WI0 A;  2I1K A;  4M0W B;  2O6V A;  3NHE B;  1X1M A;  4IDI A;  1WR6 E;  4HPM B;  2W9N A;  4CO7 A;  2PJH A;  3E56 A;  4ITK A;  3NS1 A;  1EF1 A;  3VHT C;  1OQQ A;  1YOV B;  2PTL A;  4UDU C;  4HEA 1;  2OOB B;  3WCQ A;  3C0R B;  3PGE A;  3AI5 A;  5JH5 C;  1WRD B;  3RPF C;  1R4M B;  1UD7 A;  2WDR B;  1D5Z C;  3X23 A;  2PW9 A;  1LFD A;  5GXG B;  3VVW B;  2A4Z A;  4H2A A;  1MHX A;  4WJN A;  4JIO U;  3O13 A;  1GJZ A;  2J52 A;  2LGX A;  3R7R A;  1YJI A;  5G55 A;  4MEM A;  2JRI B;  3U4E G;  2FBW B;  2W82 A;  2BKR B;  2J7Q B;  4EKU A;  3VR9 B;  1VCB A;  4PT5 A;  2KO3 A;  4LNI A;  3AED B;  2L76 A;  2QMT A;  2VZK D;  3Q8B A;  3TBL D;  4YT0 B;  2KNB A;  4XWT A;  3FIL A;  3SU8 X;  2IZV B;  3FKY A;  1L0V B;  1MHH E;  4FA6 A;  1A5R A;  2GBJ A;  2NCN A;  2QIL A;  2RD0 A;  3ZVV A;  2Z8L A;  1WM2 A;  4A3P A;  1TY2 A;  3A9K A;  4JQW C;  3T9L A;  2MP2 A;  3PZ7 A;  4K7W A;  4XDC A;  4GN1 A;  3DBS A;  2ACZ B;  2LUE A;  3DWG C;  4GDK A;  5DPW A;  1OTR B;  2C5L C;  2KLG A;  3M63 B;  3NVY A;  4B9K A;  3MJW A;  3W1S C;  2BS3 B;  1L7Y A;  3GZN B;  1WM3 A;  4K7U A;  1OFF A;  4GDL B;  4LDT D;  4B95 A;  1V97 A;  2PEA A;  3AE6 B;  2KTR B;  2LEK A;  2N9K A;  3AEE B;  1E7U A;  2GOW A;  2MLB A;  4PYU A;  3CF6 E;  5JHA A;  3KW5 B;  4G50 A;  1FPY A;  2Y3A A;  1V8C A;  2RR9 A;  4HXD A;  2KVZ A;  3VXW A;  3ZTD A;  1TBE A;  5EE3 A;  3AE8 B;  3IAM 1;  3V61 A;  1V49 A;  3NZ3 A;  4X57 B;  1P7F A;  2IO1 B;  4MAC A;  1D3Z A;  1K51 A;  2CHX A;  1C4P A;  2LMC A;  1L6U A;  3M3J A;  4C7Y A;  3Q8A A;  2J4X A;  1BXT A;  1QLB B;  2SEB D;  1VJK A;  2LHD A;  1QZE A;  2I1J A;  5AZG A;  2V1Y A;  4KSK C;  2KMM A;  4KSL C;  4HRS A;  3DBL B;  2IY1 B;  2Z0D B;  4WQM A;  1R4N I;  2DZJ A;  4M0W A;  3RNG C;  1UWX A;  4ZYN A;  1MFW A;  1BUI C;  3KUD B;  3W9C B;  2M1M A;  1WJ6 A;  2KTF A;  2K8B A;  4DDG D;  2C9W B;  3PZ8 A;  2DYO A;  3W5V B;  3UI3 A;  2Z0E B;  4HCN B;  2MBE A;  2E3T A;  1LXD A;  4AP4 C;  3A4R A;  3DBH I;  3FC4 A;  2JX5 A;  4GSW A;  4DXG A;  3TEZ A;  4M02 A;  1GPX A;  1N6Z A;  4LNN A;  3H7P B;  1ZGU B;  5HI1 A;  2JPH A;  1RLF A;  2L32 A;  3RMK C;  4BKS A;  2W3S A;  1NI3 A;  1ENF A;  3ZJT A;  3NOB A;  4FAD A;  1ZOY B;  4K1R B;  4I6N B;  3B1L X;  1RRB A;  3Q3O C;  5D7G A;  3ZUN A;  1PDX A;  1XXG A;  4HCP B;  1YJJ A;  5L83 A;  2LGY A;  3ZYY X;  1IP9 A;  4WWP A;  1J0G A;  3ZNG C;  2LD9 A;  2IDY A;  1PGB A;  4IWP A;  3KVF B;  2KAN A;  4EUT A;  3NVV A;  1K52 A;  1QOF A;  1SE9 A;  1LQB A;  2GRI A;  3AN1 A;  2UU7 A;  3WA0 A;  3BII D;  4OW0 A;  5D2M B;  3EFC A;  1D5M C;  4GDL A;  1WSP A;  3QAR A;  3N32 A;  3RNC C;  2JWU A;  2NPT B;  2KTR A;  3NVZ A;  2H88 B;  2J42 A;  3SEB A;  4AWJ A;  2PLP A;  2QJL A;  2LFI A;  2I2Y A;  2L83 A;  1CZP A;  1KF6 B;  3B2F A;  3B0A A;  4KDL B;  1RAX A;  4NAW B;  2D10 A;  3V60 A;  1KRH A;  2BS2 B;  4AS1 A;  2L7R A;  1UBQ A;  4A6Q A;  3ZJU A;  2K6D B;  2MBB B;  1GB1 A;  4WWM A;  1TS4 A;  2J0K A;  2RPQ A;  1XLN A;  2D3G A;  3PLV A;  2HE7 A;  1C76 A;  4TSS A;  3NY5 A;  1QOA A;  2ZJD A;  1NVI D;  2JQR B;  1TTN A;  1ISN A;  3SD5 A;  3JSV B;  3TCA A;  4HLE A;  2WQY B;  1WMH B;  4FHK A;  1STE A;  2ZCC A;  2GBR A;  4OZA A;  2GB1 A;  3DHI C;  2HDE A;  2V9H A;  3U52 E;  1V5T A;  2IGG A;  1SE4 A;  4W9L A;  1FMA D;  3Q2A C;  2W54 A;  5CTR C;  2V3P A;  2DZI A;  1E5W A;  3APD A;  3H6N A;  2DEN B;  2J0J A;  1SIF A;  1EU3 A;  1I7H A;  2KC2 A;  1GOZ A;  4LNK A;  1SE2 A;  2PKO A;  4M00 A;  4Q2J A;  1WZ0 A;  3ETR A;  2EEL A;  3U30 A;  4RM9 A;  3AE3 B;  2M19 A;  1A70 A;  5T8I A;  2WXF A;  1UGJ A;  2PPH A;  2CKH B;  3DVG Y;  1YN3 A;  2FCQ A;  4XE0 A;  4IM2 A;  3H7P A;  3RNF C;  3DPD A;  1TZO A;  1YQB A;  1IBX B;  3L54 A;  1FFU A;  3BY4 B;  1C4A A;  1J7C A;  3AE9 B;  3ZXR A;  1AYF A;  2KAC A;  3A9J B;  3Q8C A;  4HDQ A;  3IFW B;  2BB6 A;  5JHB A;  3PS6 A;  4LK0 M;  2NBV B;  1TS3 A;  3IG3 A;  1R7S A;  3TJP A;  2NBW B;  2BYE A;  5EE1 A;  2I38 A;  1WGK A;  1Q10 A;  3AEA B;  4RF1 A;  3URY A;  2A5U A;  4RGN A;  1TKG A;  2BYF A;  2Y5C A;  2D3C A;  3AE7 B;  2HJ8 A;  4BFR A;  3EUB 2;  4IKG A;  5AZH A;  1WXA A;  3I63 C;  4CQN A;  1E10 A;  1OGW A;  4DXA B;  3N1X C;  4JPS A;  2JYT A;  1L0Y B;  1M94 A;  3DCG A;  4ZRJ A;  1C4C A;  4S17 A;  2N9L A;  3ZO5 B;  1YQ4 B;  2WHI A;  1BT0 A;  2MEK A;  3KQ4 A;  1AWD A;  4G3X B;  1BML C;  2NPT A;  1WGR A;  1UUP A;  2ICI A;  4GLS C;  1CJE A;  1FIQ A;  1GNU A;  1YD8 U;  2FCM A;  4YSY B;  1WFY A;  3AM9 A;  5H92 C;  3UGB B;  4NAW A;  4XX5 A;  1GC6 A;  2N0S B;  5LXI B;  4WUR A;  3RNA C;  3RFZ B;  2W55 A;  2R2Q A;  4BOZ B;  3DBR B;  3MC0 B;  1L4D B;  1DOY A;  3QC8 B;  1ZXH A;  2FCN A;  2AWT A;  2L52 A;  2LUM A;  1L4Z B;  2BF8 B;  1PQS A;  2O2V B;  4M01 A;  1EM7 A;  1ZKH A;  2EKE C;  4C7Z A;  2KYW A;  1H8C A;  1E8X A;  3LYY A;  2KKC A;  1TKE A;  2SAK A;  2DNF A;  3JSV A;  1XLQ A;  1WMH A;  2N7D A;  1C3T A;  1YNT E;  2GI9 A;  4HPL B;  4RGM A;  1HZ6 A;  2K22 A;  1TYG B;  1FCL A;  3L08 A;  4YSX B;  5FKA C;  1SB3 C;  1R4N B;  1N5X A;  1ZDV A;  1E8Y A;  3PPA A;  1HEZ E;  1D4B A;  3Q6B A;  1IYF A;  2ZEQ A;  2LVP A;  4FUL A;  1JQ4 A;  2XEW A;  5E6O A;  4IG7 B;  2N4F A;  4F8C B;  4A90 A;  4FJY A;  1YIW A;  3DBH B;  4IW0 A;  3VQI A;  3N3K B;  3H9D A;  1KJT A;  1IBX A;  4TQ0 A;  3S2A A;  3MC9 A;  2MWS B;  3Q3N C;  1TT5 B;  1RWS A;  3A9J A;  1TS5 A;  2ZPY A;  5L95 C;  3QIJ A;  4DHZ B;  2DX5 B;  2BWE S;  1WJU A;  3PRE A;  4ZHO A;  2D11 A;  4MT5 A;  4LCD E;  4WJQ A;  1U4A A;  3ZNH B;  5EE9 A;  4N58 A;  3I57 A;  1OEY J;  2AEH A;  4HDO A;  3WAN A;  1F9J A;  4W9F A;  4EOY A;  3A4S C;  3K9P B;  2G45 B;  2TSS A;  4YWG G;  3AEC B;  4GU2 A;  3Q3M C;  1E7P B;  3H7S A;  3PV1 A;  4REZ A;  3Q3F A;  1UGM A;  3A1Q B;  1XCT L;  1EUV B;  1UH6 A;  3MC8 A;  4DK5 A;  2R2O A;  4ARI A;  3P4P B;  1FXT B;  4GB9 A;  2MSE D;  2J0M A;  1TKY A;  3N9Y C;  2MBH A;  3BVZ A;  4IC7 B;  3RUL A;  4YTM B;  2C60 A;  2JYE A;  2ASQ A;  2AYO B;  1MJD A;  1XEE A;  2WDT B;  2BVC A;  2PMV A;  4M8N A;  3QWZ B;  3IBE A;  1LM8 B;  1TS2 A;  4KVG B;  1VR9 A;  4IWO A;  3RNB C;  2UWQ A;  2BWF A;  4MDK E;  3VRB B;  3R2T A;  2BKF A;  3GOE A;  4D2K A;  1N61 A;  4TKN A;  3WAM A;  3PRM B;  3RYT A;  3Q69 A;  2L1A A;  3BIN A;  1K53 A;  4B0M A;  2O2V A;  2V4I B;  1WGH A;  4P1B C;  3DQV A;  2YVC A;  2MX2 A;  2N9X A;  4XYC A;  1WXM A;  4ICV A;  3ABV B;  1RFK A;  3EFU A;  5DPS A;  4C80 A;  1V1P A;  4XDD A;  3NUH B;  3DVG X;  2KWD A;  1QT9 A;  5HG2 A;  2G4D B;  2LI5 A;  1C79 A;  2DYM A;  3UIO B;  4FJV B;  3CSF A;  3T3N A;  3MFG A;  1WR1 A;  4HVB A;  2LXC A;  1J19 A;  2WX1 A;  2JU6 X;  2MW5 A;  4W9H A;  1FNV A;  2H89 B;  3V6E B;  4WWN A;  2N7J A;  1NDD A;  2D5G A;  4ZRK A;  1VD2 A;  2Y5P A;  4II3 B;  3ZJV A;  2CJO A;  2EMS A;  1C78 A;  1PYW D;  2OHF A;  4YL8 A;  3ZGZ A;  1KOT A;  4NAM A;  1J7B A;  1ZXI A;  4YTN B;  1Q5W B;  3UQB A;  2MJ3 A;  4WWO A;  4HJG E;  3JYU A;  2OED A;  3V6C B;  4KKJ A;  3HRD D;  3KH0 A;  1C9F A;  2QCZ A;  3I3T B;  4BKT A;  1TGZ B;  4ANX A;  2B76 B;  1ZE3 D;  4ASW C;  2KX3 A;  1I42 A;  3RZW C;  4KZC A;  1SEB D;  3ZNI D;  3VUW A;  4NJC A;  1MG8 A;  2E6X A;  1ZUD 2;  2L0F A;  1V80 A;  1UZX B;  2BGF A;  3KUZ A;  1PGX A;  4PS3 A;  4NQL B;  3W5U B;  4OZB A;  1I4Q A;  2FUH B;  3C19 A;  1WX8 A;  1L5P A;  4ANV A;  5BMI A;  5KHQ A;  4A55 A;  3X0W A;  3ZKJ C;  2L00 B;  1ZDX A;  2KD0 A;  4B0E A;  4L2Y A;  1QOB A;  5E6N A;  3MHZ A;  4TQ1 A;  1ET6 A;  3A1Q A;  2B3A A;  3DWM A;  3TIX A;  3QQ8 B;  3ZXV A;  2M4N A;  3MHS D;  1WJ4 A;  4G11 A;  1Y8R C;  1WE6 A;  2IO3 B;  2LAS A;  1WH3 A;  1HQR D;  2D3B A;  1IGD A;  1S1Q B;  2MBQ A;  1F52 A;  1T0R C;  4N59 A;  2KJ6 A;  1JCK B;  2YEP B;  1JML A;  1WY8 A;  3TL5 A;  3UIP B;  3APF A;  3IAS 1;  4YSZ B;  3NJT A;  4HKZ E;  5TSS A;  1WIA A;  1HA5 A;  1B1Z A;  1KFY B;  1VZ6 A;  1E90 A;  2JZZ A;  5EDS A;  4ACF A;  1PGA A;  1NYQ A; 
#chains in the Genus database with same CATH homology
 3H7P A;  1P9D U;  1WXV A;  4NNJ B;  2KK8 A;  3DPD A;  2K25 A;  3PRZ A;  1S3S G;  3AU4 A;  3ONS A;  1YQB A;  3QX1 A;  2KDB A;  3L54 A;  4N9F 4;  4WQO B;  3N30 A;  3BY4 B;  3W1S A;  4URK A;  5IA7 A;  2DAF A;  4W9K A;  2JZ3 B;  3A9J B;  2KOX A;  1Q0W B;  1V86 A;  4JLC A;  4HDQ A;  5D6J B;  3IFW B;  2KLC A;  2ZZP B;  3O65 B;  3PRP B;  3QK0 A;  5JHB A;  3PS6 A;  2K8H A;  2N9E B;  2NBV B;  3IG3 A;  4FBJ B;  3TJP A;  2KDI A;  3P2B A;  2NBW B;  4F1S A;  2BYE A;  3WIM A;  2O6V D;  1H4R A;  3JVZ X;  5DCN A;  2KDF B;  2JVC A;  3ZDM C;  1XD3 B;  4RM8 A;  4MH0 E;  2N1V A;  1V81 A;  2A5U A;  4PS7 A;  4E3C A;  1I35 A;  2KWV B;  4RMA A;  4I6P A;  3M95 A;  1XQQ A;  3R7Q A;  2BYF A;  5CX3 A;  4DDI D;  1P0R A;  1YJ1 A;  3VAW A;  2M17 A;  3W1Y A;  2HJ8 A;  4BFR A;  2JRH A;  3SDL C;  5AZH A;  1WXA A;  2JF5 A;  5CHV C;  4WJO A;  1XT9 B;  4WJP A;  2IY0 B;  3DBR I;  2HD5 B;  1OGW A;  4DXA B;  2VRR B;  1M94 A;  3QHT A;  3AU5 A;  3DCG A;  4ZRJ A;  5G2N A;  3UF8 A;  2BYV E;  2L05 A;  1WI0 A;  1WGY A;  2I1K A;  3ZO5 B;  4AJY B;  4M0W B;  2O6V A;  3NHE B;  1BT0 A;  1X1M A;  2EMT A;  2KN5 A;  1WR6 E;  1WXS A;  4EZK A;  4G3X B;  3L0W B;  4HPM B;  2KDE B;  1EF5 A;  2JY6 A;  2W9N A;  4CO7 A;  2PJH A;  2LRW A;  2NPT A;  3JW0 X;  3ZNZ B;  1WGR A;  1EF1 A;  3VHT C;  1GNU A;  1YD8 U;  2FCM A;  1WFY A;  4W9I A;  3HK0 A;  2GBK A;  3UGB B;  2OOB B;  4MSQ B;  4IM3 A;  1T0Y A;  3NS8 A;  3C0R B;  4NAW A;  3PGE A;  3AI5 A;  4MEL A;  1GUA B;  4XX5 A;  5JH5 C;  1GC6 A;  1WRD B;  5LXI B;  1UD7 A;  2JXX A;  3Q3J A;  3X23 A;  3U8Z A;  1LFD A;  4PYZ A;  3QAQ A;  2CS4 A;  2R2Q A;  3VVW B;  4BOZ B;  2A4Z A;  4W9E A;  4II2 B;  4WJN A;  1Z2M A;  4JIO U;  4FJZ A;  2MQJ A;  1GJZ A;  2LGX A;  2IO0 B;  3R7R A;  3QC8 B;  3PSE B;  2KFK A;  5G55 A;  2FCN A;  2KMC A;  4MEM A;  2AWT A;  2JRI B;  4I6L B;  3ZW3 A;  4W9C A;  2BF8 B;  2RSU A;  2NR2 A;  5DPR A;  1PQS A;  2O2V B;  2BKR B;  1ZKH A;  2EKE C;  2J7Q B;  1H8C A;  1P98 A;  4EKU A;  1E8X A;  3QCA A;  1VCB A;  2KQS A;  4A20 A;  2KKC A;  2KO3 A;  3PT2 B;  4MGI E;  3PTF C;  3L10 B;  1GC7 A;  2IO2 B;  2L3Z A;  2L76 A;  3B08 A;  3HIZ A;  3TBL D;  1Q1O A;  3JSV A;  3DOW A;  2KNB A;  1WMH A;  3SU8 X;  2N7D A;  2IZV B;  1C3T A;  4HPL B;  4DHJ B;  2L8J A;  4FA6 A;  2G3Q B;  1A5R A;  2GBJ A;  5JZE B;  2NCN A;  1V2Y A;  2RD0 A;  2KVR A;  1WYW B;  3M62 B;  4MJS A;  3ZVV A;  4BBN F;  2KXJ A;  1WM2 A;  3L08 A;  3EC8 A;  4FN2 A;  4A3P A;  3A9K A;  4JQW C;  3T9L A;  1SGH A;  3OAW A;  2MP2 A;  4ZDV A;  4K7W A;  4EEW A;  1E8Y A;  4GN1 A;  3DBS A;  3PPA A;  2LUE A;  4GDK A;  5DPW A;  1OTR B;  5C1Z A;  2ZNV C;  2C5L C;  3PHX B;  1IYF A;  2ZEQ A;  2KLG A;  3M63 B;  5GMV A;  4GGQ A;  4B9K A;  3MJW A;  2LVP A;  3W1S C;  4JL9 A;  2JUO A;  4NJ7 A;  4FUL A;  1L7Y A;  1WM3 A;  2XEW A;  4K7U A;  5E6O A;  4GDL B;  4LDT D;  2KJR A;  4B95 A;  2FAZ A;  3KYC D;  4IG7 B;  2N4F A;  2KQ7 A;  2PEA A;  3EHV A;  4F8C B;  2K6Q A;  2KTR B;  4FJY A;  1YIW A;  2GBM A;  1E7U A;  2GOW A;  2MLB A;  3MTN B;  4PYU A;  3CF6 E;  1WX9 A;  4IW0 A;  3VQI A;  5JHA A;  4DHZ E;  3KW5 B;  2MBO A;  3N3K B;  3H9D A;  3PHW B;  1KJT A;  4G50 A;  4TQ0 A;  1R4M I;  4E71 A;  5LXH A;  3S2A A;  2MWS B;  3L16 A;  2RR9 A;  4HXD A;  4CHK A;  3VXW A;  3ZTD A;  1TBE A;  3A9J A;  2ZPY A;  4ICU A;  5L95 C;  3KUC B;  5CHF A;  3QIJ A;  3V61 A;  4DHZ B;  2DX5 B;  5LLI A;  1V49 A;  1WGG A;  2BWE S;  4X57 B;  4AOF A;  1WJU A;  2V3S A;  3PRE A;  4BOS C;  1YX6 B;  2L0T A;  3VUY A;  3SHQ A;  2D11 A;  2IO1 B;  3V62 A;  3IHP C;  4LCD E;  1D3Z A;  2FNJ B;  1IPG A;  4HJK A;  4WJQ A;  1U4A A;  3ZNH B;  4FLH A;  1OEY J;  2AEH A;  1UBI A;  2CHX A;  3WAO A;  2KZR A;  3R66 C;  3M3J A;  4HDO A;  3WAN A;  1F9J A;  4W9F A;  4EOY A;  3A4S C;  2C7M B;  5DPT A;  3K9P B;  5FR6 A;  4GIV A;  2G45 B;  4GU2 A;  1C1Y B;  3HM6 X;  3H7S A;  1QZE A;  2I1J A;  5AZG A;  3RT3 B;  3PV1 A;  2V1Y A;  2NBU A;  4KSK C;  5TR5 A;  3U7D A;  1J8C A;  3OJ4 B;  3Q3F A;  1UGM A;  4AJW A;  3A1Q B;  4MGZ E;  3NZS A;  4KSL C;  4DBG A;  5E6P A;  3KYD D;  1JRU A;  2IY1 B;  4ANW A;  2DZM A;  5J18 A;  2Z0D B;  1EUV B;  1R4N I;  1UH6 A;  2C7H A;  4BKS D;  2DZJ A;  4DK5 A;  2R2O A;  4ZYN A;  4P7I A;  3PZD A;  4F7Z A;  2XK5 B;  4J6I A;  3D32 A;  1FXT B;  3KUD B;  3ZLZ A;  2MCN B;  2KMA A;  2M1M A;  2MSE D;  2J0M A;  4GB9 A;  3ZTC A;  1V5O A;  1WJ6 A;  4MGY E;  3ZRC A;  2KTF A;  1YX5 B;  3RZF A;  2MBH A;  3IVF A;  2K8B A;  2ZVO A;  4IC7 B;  3RUL A;  2CR5 A;  4DDG D;  2C60 A;  2LVQ A;  2C9W B;  3HHM A;  2ASQ A;  2DYO A;  2AYO B;  2WX0 A;  3GZN I;  4KZ0 A;  3VTW A;  4E74 A;  2BPS A;  2WDT B;  5AZF A;  2PE9 A;  2Z0E B;  4HCN B;  2MBE A;  4KIK B;  3NZU A;  5J17 A;  1LXD A;  4M8N A;  4AP4 C;  3A4R A;  3QWZ B;  2CHW A;  1LM8 B;  3DBH I;  3IBE A;  4GSW A;  2LXA A;  4KVG B;  2LRU A;  4IWO A;  2UWQ A;  2BWF A;  4MDK E;  3H7P B;  1ZGU B;  2BKF A;  3ZIM A;  2JPH A;  3RD2 A;  4BKG A;  3GOE A;  1RLF A;  4BVU C;  2ZNV B;  4A3O A;  4GXB A;  2N1W A;  2AL3 A;  4TKN A;  2MA9 B;  3WAM A;  3VFK A;  4BKS A;  4CYE A;  5KHO A;  2K8C A;  3PRM B;  3RYT A;  3EEC A;  3BIN A;  3NOB A;  4FAD A;  3LJ3 A;  2GMI C;  4ANU A;  2O2V A;  4JGH B;  3AXC A;  3OLM D;  4K1R B;  1V9J A;  4I6N B;  1WGH A;  2ZPN A;  3L13 A;  4IM0 A;  3DQV A;  3UQA A;  2YVC A;  3B1L X;  2GBN A;  2MX2 A;  1RRB A;  1WXM A;  2N9X A;  3CST A;  4ICV A;  2LJ5 A;  4LJO B;  4NJ6 A;  3H1U A;  2K1F A;  4TUU A;  2CHZ A;  1TZ1 A;  3EFU A;  5DPS A;  3QJZ A;  4IUM B;  5D7G A;  3ZUN A;  3DVG X;  4B6W A;  2M0X A;  3AUL A;  2CU1 A;  2OJR A;  4HCP B;  3DDC B;  2G4D B;  2LI5 A;  2Y5B B;  3CMM B;  2JT4 B;  2KHW B;  3TMP B;  5L83 A;  1HE8 A;  4NPN A;  2DYM A;  3UIO B;  1V6E A;  2LGY A;  3CSF A;  4FJV B;  4IM2 A;  1IP9 A;  4WWP A;  1J0G A;  3ZNG C;  1WR1 A;  2LD9 A;  2ZVN A;  3RUI B;  2LXC A;  4HVB A;  5HKH A;  3APC A;  2V4L A;  1J19 A;  2WX1 A;  4IWP A;  2MW5 A;  4W9H A;  2D2Q A;  2YLM A;  2KAN A;  2Z59 B;  3ECI A;  3KVF B;  4EUT A;  3V6E B;  4WWN A;  4XZ4 A;  3DBL I;  1KM7 A;  4W9J A;  1SE9 A;  2PE6 B;  2LZ6 A;  4MGK E;  1LQB A;  1NDD A;  4EZJ A;  4ZRK A;  1VD2 A;  4II3 B;  2EMS A;  3WA0 A;  4PS8 A;  2O6V B;  2DZK A;  3HM3 A;  2LVO A;  4LDT B;  5D2M B;  1WGD A;  4GDL A;  4YL8 A;  3VH4 B;  1EO6 A;  4IWQ A;  4W9D A;  1KOT A;  3QAR A;  1G6J A;  3N32 A;  1OQY A;  3K9O B;  4HK2 A;  2NPT B;  2KTR A;  1Q5W B;  3UQB A;  4K81 A;  2K39 A;  1K8R B;  4NQK E;  2REX A;  3WAL A;  4WWO A;  2DHZ A;  4BBN C;  4KV2 A;  1GG3 A;  3JYU A;  1E7V A;  3V6C B;  4AWJ A;  3PVL A;  5D94 A;  3ENE A;  3KH0 A;  1WJN A;  3B0A A;  1RAX A;  4GMV A;  4KDL B;  4NAW B;  1WZ3 A;  3ALB A;  3ZRF A;  1WE7 A;  2D10 A;  3I3T B;  1OEY A;  4BKT A;  2WWZ A;  3V60 A;  1TGZ B;  2IBI B;  4ANX A;  2XBB C;  2L7R A;  4ASW C;  3VUX A;  2KX3 A;  1I42 A;  1UBQ A;  4KZC A;  3RZW C;  3ZNI D;  2LGD A;  3VUW A;  3DVN V;  1ZW7 A;  4OVU A;  1MG8 A;  3ML9 A;  1KLV A;  2L0F A;  2K6D B;  2QHO A;  2MBB B;  2WYQ A;  1V80 A;  2JWZ A;  4G0N B;  1UZX B;  2J0K A;  2BGF A;  3KUZ A;  2KFK B;  3DVN U;  1UEL A;  2KFJ A;  4FHJ A;  4W9G A;  4PS3 A;  4MSM B;  4TV3 A;  4NQL B;  2RPQ A;  5J2R A;  2C7N B;  1RFA A;  2D3G A;  3QA8 A;  3VH3 B;  2KWU B;  4ZRI A;  3LDZ E;  3PLV A;  2HE7 A;  2ZCB A;  4K7S A;  3WAP A;  3NY5 A;  3RCZ A;  1NBF C;  2ZJD A;  2FUH B;  3VTU A;  2DYB A;  1WF9 A;  1WX8 A;  2UYZ B;  4ANV A;  5KHQ A;  1L2N A;  1TTN A;  3X0W A;  3ZKJ C;  1ISN A;  2L00 B;  2N9P C;  1E8Z A;  4NY0 A;  2AL6 A;  2RGF A;  3SD5 A;  2KD0 A;  2M8S A;  3JSV B;  3TCA A;  4HLE A;  1WMH B;  2NS5 A;  4FHK A;  4EZL A;  1P3Q U;  5E6N A;  2ZCC A;  2D07 B;  2GBR A;  4TQ1 A;  3A1Q A;  3ML8 A;  4M8M A;  2B3A A;  4DHJ D;  3TIX A;  3QQ8 B;  2G4S A;  5C23 A;  4LJP B;  2M4N A;  1V5T A;  3MHS D;  4KDI C;  1WJ4 A;  4MJS B;  4MM3 A;  4W9L A;  4G11 A;  1Y8R C;  2FIF A;  1WE6 A;  2NVU I;  2IO3 B;  2LAS A;  2KC1 A;  3ZDT A;  5AEK B;  3A9K B;  4OVV A;  1WH3 A;  2DAJ A;  2XK5 A;  5CTR C;  2DZI A;  2KWC A;  2FID A;  2FCS A;  4AUQ C;  2MP2 B;  1E5W A;  3APD A;  3H6N A;  3A33 B;  2DEN B;  4XC2 A;  4WAA A;  2J0J A;  3PLU A;  1SIF A;  4HWI B;  5BO4 B;  1S1Q B;  2N7E A;  4DWF A;  2MBQ A;  4GDK B;  2KC2 A;  3R3M A;  3VTV A;  1WZ0 A;  2LWP A;  2KJ6 A;  3OJ3 A;  5CHW A;  2HTH A;  1WY8 A;  3U30 A;  4RM9 A;  5IAA C;  3APF A;  3TL5 A;  3UIP B;  1P1A A;  4KIK A;  1CMX B;  1E8W A;  2PPH A;  4EFO A;  2CKH B;  3UIN B;  3VDZ A;  1WIA A;  1AAR A;  1NI2 A;  3DVG Y;  1WX7 A;  2IYD B;  3T8M A;  2FCQ A;  3L17 A;  1Z5S B;  2MRP A;  1E90 A;  2JZZ A;  5EDS A;  4GOC A;  2KX0 A;  2KJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...