3D32A

Complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Binding Mode of GABA(A) Receptor-Associated Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3d32A00
2N7DA 1TTNA 1Z2MA 2BYEA 3B08A 4IUMB 4LCDE 4FJZA 2R2QA 3AXCA 1OQYA 3GZNI 4GDKA 4MGKE 5TR5A 3PZDA 1RFAA 3UINB 3WAMA 4ANXA 2K8BA 2ZPNA 3QHTA 1YD8U 2WX1A 3QAQA 4KIKB 5CHFA 2MCNB 3X23A 3BY4B 3QCAA 2KD0A 1PQSA 3L54A 1S3SG 3CF6E 2KMCA 4B9KA 2FCSA 2HTHA 2CHWA 2V1YA 1E90A 3MTNB 4FN2A 4W9LA 1A5RA 2PJHA 2MBEA 4PS8A 4FA6A 2RD0A 2WWZA 4DHZE 2GBJA 3PRPB 4EZJA 2KQ7A 3UIOB 1QZEA 3A9JA 3DCGA 4MEMA 4NJ6A 3PT2B 2NBWB 5AZFA 1RRBA 1WZ3A 4KDLB 1WE6A 2J0MA 2N1VA 1WGHA 2L0TA 1E5WA 1FXTB 4WJPA 3GOEA 2KC2A 4ASWC 2IYDB 4TQ0A 4E3CA 2NBVB 2JVCA 2BKRB 1UZXB 1TBEA 4W9DA 3V6CB 3A33B 3IBEA 2MSED 3H7PB 3K9OB 4LDTD 4G11A 4MDKE 3RZFA 3QJZA 3L13A 3ZLZA 1WGRA 1WY8A 2LASA 3P2BA 2DZKA 4W9CA 4ANUA 2KN5A 3DVGX 2GBRA 1V5TA 1GJZA 1KLVA 2CU1A 2KQSA 2RSUA 3ONSA 4IWPA 1WRDB 1WF9A 3DPDA 5DPSA 3M63B 4ICVA 4FBJB 2N4FA 3PS6A 3Q3FA 3A9KA 1F9JA 2D2QA 3JSVB 2GOWA 2LJ5A 3L10B 4XX5A 2GBKA 3DVNU 4GOCA 3QC8B 3KUZA 2ASQA 4NY0A 3VVWB 3B0AA 3R66C 1VCBA 1WX9A 2MBBB 3AU4A 4IM0A 3U7DA 4CHKA 4N9F4 4ZYNA 2B3AA 5L83A 4I6NB 1EUVB 1WFYA 2KANA 3ECIA 4G0NB 2C7HA 2KKCA 1ZGUB 2NPTA 3AULA 1L2NA 2KWVB 1L7YA 2L0FA 1V9JA 3DOWA 2D07B 2JPHA 2KVRA 2KK8A 3VXWA 3MHSD 3H7PA 2KDFB 4DDGD 1EF5A 3W1SC 2LGYA 3R7QA 2JY6A 4PS7A 3QA8A 2KNBA 2K6DB 4GDLA 4KZ0A 3L16A 4ANVA 4HPMB 2HD5B 2IO1B 3DDCB 1WR6E 3HM6X 3R7RA 2BF8B 2BPSA 4MSQB 1GC7A 1WXMA 5EDSA 3VH3B 2M17A 4OVUA 2DX5B 4AWJA 2OOBB 1ZKHA 2AL6A 4NAWA 4E71A 1LM8B 2G4SA 1P0RA 2KC1A 1P3QU 3QARA 2LVQA 2AWTA 4HXDA 4A20A 5GMVA 3AU5A 3UQBA 5FR6A 2PE9A 3ZRCA 4HWIB 2FUHB 3OAWA 3RUIB 3UIPB 4LJPB 4HCNB 3APCA 3ZVVA 1E7UA 1RAXA 3VHTC 1G6JA 1KOTA 3H6NA 2KXJA 4KZCA 2MLBA 3SDLC 1R4MI 3TCAA 2L3ZA 2G4DB 4II3B 2C60A 3IG3A 4XC2A 4F1SA 1E8WA 3ZKJC 1E8ZA 3A9KB 3M62B 2L00B 4HLEA 2NVUI 1T0YA 4IG7B 2JT4B 3ZDTA 2MBOA 1V6EA 1OEYJ 3H1UA 2BKFA 4NQKE 4XZ4A 4EKUA 3U30A 2N9EB 3PRZA 4P7IA 4WWPA 3V6EB 4DXAB 2KJHB 3PTFC 5LXHA 4IW0A 2KFJA 4FHJA 1XD3B 4HVBA 1NI2A 4IM3A 4WJQA 1TZ1A 2Z0DB 1WJNA 1WXVA 2A5UA 4BKSD 4HDQA 4X57B 3MJWA 2LRWA 3WALA 1H8CA 1YIWA 3ENEA 4MSMB 1WH3A 2XEWA 3EC8A 2GMIC 4EZKA 2J0JA 2JZ3B 2R2OA 1IYFA 3DVNV 1WJUA 3D32A 3OLMD 5DPRA 1SIFA 3PPAA 2HJ8A 3ALBA 3APFA 3DBHI 3A1QB 4FHKA 2JF5A 2KLGA 4G3XB 3VUYA 3SU8X 2KTRB 4ICUA 3V61A 2ZPYA 2LZ6A 1P9DU 5IAAC 3TIXA 4LDTB 1OGWA 1NDDA 3NS8A 2JZZA 4M0WB 5D2MB 4URKA 2JRIB 1S1QB 3VFKA 2V4LA 2FCNA 1J0GA 2DENB 4ZRIA 2MX2A 4I6PA 4MM3A 3ZTCA 2LVOA 4MELA 2MA9B 1NBFC 2N9XA 4F7ZA 2IY1B 3DBLI 3L0WB 5CHVC 3SD5A 3LDZE 3EHVA 3N32A 4IM2A 2N7EA 2DYBA 1WX8A 3A4RA 2KMAA 3VH4B 3QK0A 4GN1A 4BKTA 5J17A 3KUDB 4IC7B 3T8MA 1UBQA 3QIJA 2LWPA 2KX3A 1LXDA 2EMTA 2GBMA 1HE8A 2L76A 3PREA 2FCMA 1V49A 5D94A 4TKNA 4B6WA 3I3TB 5J2RA 1WXAA 4HPLB 4BBNC 3L17A 4MH0E 2O2VA 2ZVOA 5C1ZA 3RYTA 2AEHA 2I1JA 3U8ZA 1Q5WB 2O2VB 2LGDA 1U4AA 5HKHA 1OEYA 1R4NI 2O6VD 3EFUA 4AP4C 4F8CB 4NQLB 1UD7A 2ZCBA 2W9NA 3UQAA 1WM2A 3M3JA 2FCQA 5JHAA 1WZ0A 3APDA 4J6IA 1WJ4A 1WMHA 2M0XA 1V86A 1WM3A 3PGEA 4GIVA 4JL9A 4ZRJA 2AYOB 2O6VB 2EKEC 4RM8A 2DAFA 3JVZX 2K1FA 2ZNVC 4KSKC 4TV3A 5DCNA 5IA7A 4IWQA 4WAAA 3ZNGC 2JRHA 3IHPC 3EECA 1YJ1A 2K39A 4IWOA 2LVPA 2JXXA 3OJ3A 2J7QB 3M95A 4NAWB 4CYEA 2Y5BB 4EFOA 1K8RB 4MJSB 2MBQA 1P98A 1LQBA 1UH6A 4A3OA 2KWUB 2L05A 2DHZA 4G50A 3A4SC 3H7SA 5LLIA 3VTUA 3UGBB 3ZDMC 4DWFA 4RM9A 2IBIB 4W9HA 3NZSA 2DZJA 2KX0A 4II2B 2QHOA 4KIKA 4W9FA 3WAOA 4BVUC 2FIFA 1J8CA 3QWZB 3JSVA 4ZDVA 2NR2A 3ML8A 2IZVB 2V3SA 2UWQA 3PHWB 3ZNZB 4KV2A 4PS3A 1GG3A 4LJOB 1E8YA 4KDIC 3ZW3A 4DBGA 3TMPB 5JZEB 2IO2B 4W9GA 1V5OA 4W9KA 4GB9A 1BT0A 1WYWB 5C23A 5JHBA 3WIMA 2G45B 2DZIA 2UYZB 3QQ8B 2ZNVB 4JQWC 2KDIA 2O6VA 2NBUA 3DBSA 4K7WA 2ZCCA 4OVVA 3SHQA 2NS5A 2KJRA 2WX0A 2LXAA 4WWNA 3ZRFA 4WJNA 3JYUA 2DZMA 3A1QA 1YX6B 5KHOA 2LI5A 5DPWA 3DBRI 3W1YA 2M8SA 5JH5C 1JRUA 2LXCA 4DHZB 3OJ4B 1EO6A 4DHJD 2K25A 2KFKB 4PYZA 4K7SA 2YVCA 1C3TA 1Y8RC 4EOYA 4E74A 4JGHB 2Z59B 3KVFB 3WANA 2HE7A 4GDLB 4K81A 2MWSB 4EEWA 1WR1A 2C7MB 1M94A 5L95C 3O65B 5J18A 4MGIE 3PHXB 3PVLA 2L8JA 1RLFA 3VUWA 1X1MA 2M1MA 3TJPA 2D11A 4NNJB 1SGHA 4CO7A 2PE6B 4MGYE 2REXA 4W9EA 4M8MA 2DYMA 3UF8A 4BKSA 4DHJB 1WMHB 3K9PB 1WGGA 4WWOA 4HDOA 3B1LX 2GBNA 1GNUA 2MW5A 3W1SA 2MQJA 2RR9A 4W9JA 2C7NB 2OJRA 2BYVE 3HHMA 3KYDD 2M4NA 4DDID 1WX7A 2WYQA 3NZUA 3RT3B 2J0KA 3H9DA 2JUOA 2XK5A 1VD2A 2BWFA 3JW0X 4ZRKA 3ZUNA 1WI0A 2ZJDA 1ISNA 2RGFA 3V60A 3ZO5B 2A4ZA 1I42A 3DVGY 3NHEB 4BBNF 2KHWB 3NY5A 5LXIB 2CHXA 2K6QA 1UELA 2MRPA 4GDKB 3ZTDA 4A3PA 4KVGB 5BO4B 3R3MA 4W9IA 5CX3A 2I1KA 2MP2A 1KJTA 1GC6A 4M8NA 5D6JB 3RCZA 2L7RA 4EUTA 4FADA 2C9WB 2ZZPB 2MP2B 3RULA 2EMSA 2BGFA 4JIOU 2NCNA 4AJWA 3VQIA 5KHQA 3AI5A 2KWCA 3KUCB 4NPNA 2G3QB 3PSEB 3S2AA 5AZGA 4AOFA 3QX1A 4KSLC 5CTRC 5AEKB 1P1AA 1E8XA 1YX5B 3T9LA 4PYUA 2XBBC 2KOXA 1WGYA 4BFRA 2KFKA 4B95A 2KDEB 2CS4A 2LUEA 2IO3B 5DPTA 3NOBA 4BKGA 2D3GA 3HM3A 4GU2A 3DQVA 2Z0EB 1SE9A 2KLCA 5G55A 3TBLD 4HJKA 1IP9A 3ZNHB 3TL5A 2KZRA 1V2YA 1AARA 1H4RA 2BWES 5D7GA 3X0WA 2PPHA 2FIDA 1WE7A 5G2NA 3VTVA 3N3KB 5E6NA 4I6LB 3WA0A 4YL8A 1V80A 2MBHA 3A9JB 2WDTB 3HIZA 2BYFA 2IY0B 3C0RB 1TGZB 2RPQA 3ML9A 2K8HA 3L08A 2K8CA 2KDBA 2FAZA 4GSWA 1KM7A 4HCPB 3ZIMA 2D10A 2LD9A 2PEAA 3PV1A 1GUAB 1UGMA 2JWZA 4K1RB 2N1WA 1LFDA 1MG8A 3PLVA 1WGDA 4MJSA 1XT9B 4BOZB 1D3ZA 3PRMB 5AZHA 2NPTB 5CHWA 1XQQA 3CSFA 1Q0WB 4NJ7A 3IVFA 3RD2A 3VDZA 1J19A 1OTRB 2C5LC 5E6OA 2KTFA 2YLMA 1UBIA 3CSTA 5E6PA 4ANWA 3CMMB 3VAWA 1YQBA 2KJ6A 3V62A 4AUQC 3HK0A 3IFWB 2KO3A 4FLHA 3ZNID 1CMXB 1V81A 2CHZA 2KTRA 2N9PC 3VUXA 1WXSA 4TQ1A 1EF1A 2CKHB 1WIAA 4JLCA 2DAJA 2FNJB 4FJVB 2ZEQA 3BINA 1Q1OA 4WQOB 3WAPA 3PLUA 4MGZE 4WJOA 4BOSC 4TUUA 1E7VA 1Z5SB 4GGQA 3VTWA 2ZVNA 4GXBA 2LGXA 3KH0A 4GMVA 3N30A 3Q3JA 4RMAA 2DYOA 2AL3A 2IO0B 4EZLA 2VRRB 1I35A 4DK5A 1ZW7A 3RZWC 4K7UA 2LRUA 1C1YB 2XK5B 2CR5A 1WJ6A 1IPGA 3KW5B 3LJ3A 4FJYA 4FULA 3KYCD 4HK2A 4AJYB
chains in the Genus database with same CATH superfamily
2N7DA 1PDXA 4C4VA 4GDKA 3QAQA 2MCNB 1WWTA 3X23A 1J7AA 3QCAA 1ZDVA 2FCSA 1A5RA 1E90A 4OZCA 2MBEA 4PS8A 3TEWA 2RD0A 2WP9B 4RF1A 4NJ6A 3A9JA 3DCGA 3SR6A 1RRBA 1WZ3A 1WE6A 2N1VA 1FNVA 3IT4B 3GOEA 2IYDB 3MFGA 2BKRB 4W9DA 2N7JA 3IBEA 3K9OB 2LGSA 1FPYA 4G11A 1QOGA 1YNTE 2PVOD 1L0VB 1D5ZC 1MHHE 4XWWA 2PLPA 2GBRA 3DVGX 1I4GA 2RSUA 3ONSA 1WRDB 3DPDA 4FBJB 1JCKB 2Y3AA 2PTLA 3Q3FA 4A6QA 3JSVB 4WH4A 4GOCA 2ASQA 4NY0A 3VVWB 3B0AA 3DBRB 4XWTA 1FO4A 4LNKA 2MH7A 2B3AA 1V8CA 3AE8B 2KACA 3VRAB 1L4DB 2KANA 5IO9A 1R4NB 1FNWA 2NPTA 1MPEA 1L7YA 3DOWA 2JPHA 3VXWA 2BT6A 4HROA 4DDGD 2WXQA 4PS7A 2WXMA 2IPKD 4KZ0A 3L16A 2FE8A 4HPMB 4DQOC 2WXLA 1GC7A 1QLBB 1ZDXA 5EDSA 2M17A 4OVUA 4AWJA 2AL6A 3Q6BA 1QOFA 1LM8B 2J42A 1P0RA 1P3QU 4A20A 2AWTA 2G1EA 1BMLC 5GMVA 3AU5A 3OAWA 3UIPB 3T3OA 1B9RA 1RAXA 3VHTC 1G6JA 5AUKA 1SEBD 3PO0A 2J4XA 1E8WA 5BYQA 4ARIA 2L00B 4HLEA 1D5XC 2MBOA 1OEYJ 3H1UA 4NQKE 2D3CA 4EKUA 1D5MC 3U30A 2N9EB 1F77A 4DXAB 2KJHB 4MH8A 2KT7A 4FHJA 3R2TA 4IDIA 4RCOA 1SJED 5IKCM 1WXVA 2QILA 5BMIA 4BAXA 1YMHE 2TSSA 1F1HA 1XLNA 4MSMB 1WH3A 2JZ3B 1IYFA 1MG4A 1SIFA 4C56C 3I57A 1I4QA 2KLGA 2KTRB 4IOIE 1NVID 1P9DU 4YTMB 3KWLA 1NDDA 2JZZA 3NRZA 2JRIB 1S1QB 2QJLA 1XLPA 2V4LA 2OJWA 4ZRIA 2I2YA 4MM3A 3AEDB 1TS4A 2LVOA 4MELA 4MM3B 2JSVX 3EHVA 4IM2A 1WX8A 4GN1A 2PIAA 3T8MA 3QIJA 2GBMA 2L76A 3TEXA 5D94A 4BBNC 3L17A 4MH0E 3L4PA 2AEHA 3RYTA 1Q5WB 5HKHA 1U4AA 2WHIA 3RNCC 3EFUA 3NS1A 3NVVA 1XLQA 1WJ4A 3PGEA 4XYCA 3JVZX 4N6EB 4B0MA 2ZNVC 5DCNA 3ZNGC 3IXSA 3IHPC 1CK1A 1VLBA 2WXFA 4NAWB 1FD6A 4EFOA 1K8RB 2MBQA 3RI7C 2L1AA 2KWUB 4A3OA 1SJHD 2W54A 1XXGA 3UGBB 3ZDMC 4M0WA 2ON8A 4RM9A 2IBIB 2DZJA 2KX0A 1ESFA 1YJIA 4CQNA 1HXYD 4DXGA 5C3JB 4KDIC 3UI3A 3TMPB 5GXGB 1STEA 1CQVA 3QQ8B 4JQWC 4KGRA 5BMHA 1TKGA 4K7WA 1EU4A 2NS5A 2WX0A 2DZMA 5KHOA 1HEZE 2IGDA 4DHJD 1EO6A 2KFKB 4RH6A 2YVCA 3R8BA 1J7BA 2Z8LA 3WANA 4K81A 2MWSB 4EEWA 1I7HA 2C7MB 2H89B 5J18A 2R61A 2XNAC 3VUWA 1X1MA 2M1MA 2D11A 2WXHA 3N1XC 3AE9B 2REXA 4M8MA 3Q3NC 4BKSA 1GNUA 2JU6X 2YEPF 4N58A 3B2FA 2C7NB 3HHMA 3Q8FA 1XO3A 2JWUA 3H9DA 2L83A 5LNK1 3AE3B 2XK5A 3ZUNA 1WI0A 2X8XX 1ISNA 2RGFA 3V60A 1BXTA 3ZO5B 2A4ZA 1WGKA 3DVGY 2WXRA 3ZTDA 4C00A 3V05A 4W9IA 1KJTA 1GC6A 1PGAA 4M8NA 5D6JB 2C9WB 3KUCB 4JE3B 4NPNA 3RNBC 5CTRC 1P1AA 2BYTA 2WU5B 4P6VF 1SE9A 2KLCA 4HJKA 3ZNHB 2J52A 2BWES 2PW9A 1YN4A 3X0WA 2PPHA 2FIDA 3VTVA 4Q2JA 1FM0D 1TS3A 2MBHA 2AQ2B 1NYRA 2BYFA 1EWCA 1R7SA 2K8HA 3L08A 4A90A 2FAZA 4YTNB 1FRDA 4HCPB 3PV1A 4HPPA 1UGMA 4K1RB 4MJSA 4BOZB 5CHWA 1XQQA 3CSFA 3W5VB 3IVFA 3RD2A 2C5LC 2YLMA 3CSTA 3VAWA 2CU3A 3IAM1 3IFWB 3P42A 1UF0A 1RWSA 4TQ1A 1EF1A 1E9MA 2FNJB 3BINA 3WAPA 3PLUA 1D4BA 1E7VA 3LXFA 3N1YC 4GXBA 4GMVA 4RMAA 5HI1A 2IGGA 2VRRB 2INCC 2XK5B 5FKAC 5HFYA 3LJ3A 1GAQB 4HK2A 1LO5D 1I4HA 3GE8C 1Z2MA 2KMMA 4IUMB 4MGKE 3GZNI 5TR5A 1OQYA 3WAMA 1RFAA 2K8BA 4KIKB 2GRIA 1JALA 3BY4B 2KD0A 1PQSA 3L54A 2HTHA 1TKYA 2PJHA 2WWZA 4DHZE 1CJEA 4OVZA 1IBXB 3N1ZC 1TS2A 3AM9A 1ENFA 2ICIA 1FCLA 1I4PA 3BWUD 2J0MA 2L0TA 1E5WA 2KQ4X 2BTEA 3NVZA 1N5XA 3PZ8A 3EFCA 4E3CA 3U4EG 2EELA 2KWDA 3A33B 2MSED 4LDTD 4MDKE 3RZFA 4OZAA 5H8YE 4W9CA 1KH0A 2VZKD 3P4RB 2KN5A 2WU2B 3RN9C 2KQSA 3RFZB 4RGTA 3A9KA 1F9JA 4XX5A 2GBKA 3KUZA 2WS3B 4US9A 5IN7A 2UU7A 1KTKA 3U7DA 1T5XD 1WXQA 2WQYB 5L83A 2W3SA 2AQ1B 3I9V1 4KKJA 3Q2AC 3BK1A 2KKCA 3BK2A 3P4QB 1VZ6A 1F52A 4R3DA 2D07B 3H7PA 2NTSA 2JY6A 2K6DB 1QF6A 2INNE 3HM6X 3R7RA 4YXDB 1UWMA 1ZKHA 1N6ZA 3ZJVA 4MT5A 1JROA 4ACFA 1CZPA 2PE9A 4NJCA 4HWIB 3APCA 1L0YB 3ZVVA 1KOTA 1KLUD 3H6NA 1JWMD 4KZCA 1JMLA 3U52E 1R4MI 1XCQL 4II3B 1JWAD 2C60A 3IG3A 2G9HD 4XC2A 4F1SA 1QOAA 2GLSA 1SF0A 1T0YA 2JQRB 1L4ZB 1GPXA 1FFVA 4P7IA 3V6EB 2KVZA 4L23A 2KFJA 3LB8C 5E6JA 1XD3B 3WCQA 1NI2A 1WJNA 4BKSD 3GP7A 3MJWA 1H8CA 1YIWA 2J0JA 1YN3A 3OLMD 5DPRA 1F2RI 4G3XB 2W82A 5G5GA 1VRAB 4ICUA 3MC0B 2LZ6A 2QCZA 3VFKA 2FCNA 2MHJA 3DWMA 3ZTCA 2MX2A 2MA9B 1FIQA 2N9XA 4F7ZA 3RNGC 3LDZE 3N32A 3Q8EA 2N7EA 3BYYB 1UBQA 2QSDA 1LXDA 1L0XB 3AE2B 2FCMA 2V0GA 1V49A 4TKNA 4XE0A 4HPLB 2ZVOA 1BUIC 1EM7A 2I1JA 1WRIA 2WDRB 3NVWA 1OEYA 1R4NI 2FUG1 1K50A 1ZUD2 2WDQB 1WM2A 3M3JA 1V1PB 2FCQA 5JHAA 2V3PA 2M0XA 1V86A 2M19A 1OFFA 4JL9A 2AYOB 2DAFA 1PGXA 4IWQA 2JRHA 4LNIA 2J7QB 3M95A 4HEA1 2Y5BB 4CYEA 2IDYA 4L1BA 3P4PB 4MJSB 1P98A 1YJJA 4P16A 3KLSX 3V3XA 3ETRA 3NZSA 3WAOA 3QWZB 3ML8A 1T0RC 2UWQA 3PHWB 3ZNZB 1N5WA 4H2AA 2W3RA 2WXJA 1GOZA 2DZIA 2UYZB 2QC8A 2O6VA 2ZCCA 4WWNA 3SFEB 3HVDA 2LI5A 4ZYSA 5JH5C 2LJIA 4K7SA 2DNFA 1PUTA 4EOYA 4JGHB 2HE7A 4GDLB 1AN8A 1M94A 1V97A 3PHXB 2L8JA 4KGTA 3TJPA 1ACCA 2AQ3B 3DHIC 4YSYB 2LGIA 1C79A 4XGAB 1WMHB 1WGGA 3RNFC 4WWOA 1IBXA 3B1LX 2MW5A 2MQJA 1L6VA 2BYVE 3KYDD 4OZBA 2M4NA 1TYGB 2WYQA 3NZUA 2J0KA 2JUOA 2ZJDA 1Q10A 1HA5A 4L2YA 5G5HA 1LGRA 3NY5A 2CHXA 2MRPA 4A3PA 3TSSA 3J9CA 1ROEA 2MP2A 4EUTA 4FADA 2MP2B 2EMSA 2RDBC 2XN9C 3VQIA 3GB1A 3S2AA 5AZGA 1ZP0B 4AOFA 2E3TA 2M56B 4M00A 2XBBC 4K3CA 1R4MB 2SEBD 2KFKA 1VZ7A 4C4VB 5DPTA 1E10A 3HM3A 1NYQA 2Z0EB 3N20C 2QMTA 4RGNA 1V80A 3A9JB 3MC9A 1MVKA 3C0RB 2IY0B 3AEEB 2KDBA 5IOIA 1N60A 2E6XA 4GSWA 3ZXVA 2BQQA 1GUAB 2VH1A 1NI3A 2HJ1A 3PRMB 4EE2A 4REZA 4ZRPA 2OEDA 3ZXRA 1Q0WB 3VDZA 2KN4A 5E6OA 2N9LA 1UBIA 3CMMB 1MFWA 2KJ6A 3V62A 4AUQC 2INPE 2QEJC 4FLHA 1CMXB 2KTRA 1WXSA 1C4AA 1WIAA 4JLCA 2DAJA 1JQ4A 4WQOB 4TUUA 3DWGC 1Z5SB 4GGQA 2INDC 1V1OA 2ZVNA 2LGXA 3KH0A 3N30A 4EZLA 3RNEC 4DK5A 3RZWC 4K7UA 4M02A 1FCCC 1IPGA 3URYA 3AECB 4AJYB 2BYEA 4FJZA 2R2QA 1OQRA 3PZDA 1F2RC 3UINB 3QHTA 3OG5A 1AWDA 1XF5L 4JX1C 5EE1A 3Q14C 3W5UB 4B9KA 4W9LA 2V1YA 2CHWA 3MTNB 5T8IA 4FA6A 3AEBB 1QKZA 2GBJA 3PRPB 4EZJA 2KQ7A 3UIOB 1QZEA 4MEMA 3PT2B 5AZFA 4TMAB 3P4SB 3RPFC 3AMZA 4A8XC 4KDLB 1MHXA 1WGHA 3LYYA 1FXTB 2K0PA 3T3NA 2KC2A 2JVCA 2JYTA 1KRHA 2RMMA 3H7PB 2DLBA 3L13A 1WGRA 2LASA 2LHDA 3BZDB 2WLBA 1PYWD 1GJZA 2K3UA 1KLVA 5DPSA 4ICVA 3CWIA 1RFKA 2GOWA 2LJ5A 3HVZA 3L10B 1IUEA 4PK1A 4C7ZA 5I4DA 1VCBA 3ABVB 2MBBB 3AU4A 4IM0A 4CHKA 5TSSA 4I6NB 1WSPA 3ECIA 4LK0M 3Q3MC 2IJ0A 1ZGUB 3AULA 4ARCA 2L0FA 1V9JA 2KVRA 2KK8A 3MHSD 3SEBA 2KDFB 4AQ7A 3AE6B 2KNBA 2YEPB 4ANVA 4RF0A 2IO1B 1WR6E 2BF8B 4WWMA 2V4IB 4MSQB 3DBHB 1WXMA 2EKIA 2OOBB 3QARA 4HXDA 2LVQA 1QOBA 1T0SC 2ZW1A 3ZYYX 5FR6A 2BS4B 4LJPB 4HCNB 3BVZA 2L52A 3FC4A 3Q3OC 1E7UA 4QAYA 2L3ZA 1IGCA 2G4DB 3MJ5A 3ZKJC 3A9KB 3AE1B 3M62B 1C4PA 2NVUI 1ZE3D 3GZNB 4RNAA 5FR3A 2B76B 2JT4B 1V6EA 5EE0A 3PRZA 3E56A 4WWPA 5LXHA 4IW0A 1MI0A 4MACA 2ACZB 4FXCA 2BS3B 1FXIA 1TZ1A 2GB1A 2D3AA 2LRWA 2XEWA 2BBCA 4EZKA 2R2OA 1WJUA 3PPAA 3DBHI 3ALBA 3VUYA 3A1QB 4KGSA 3SU8X 3V61A 5IAAC 1ET6A 1YN5A 1OGWA 3NS8A 3DHGC 1J0GA 1HZ6A 1K53A 2DENB 3Q8CA 2WXNA 1PFDA 3L0WB 4ZRQA 2DYBA 2KAJA 2NMQA 2RDHA 3A4RA 3VH4B 4BKTA 5J17A 5HHDG 2EMTA 1HE8A 3FAHA 3I3TB 5J2RA 1L5PA 2CJNA 2LGDA 3NG0A 4AP4C 4NQLB 1KF6B 1UD7A 1UNSA 5BMGA 2ZCBA 3UQAA 1YQ4B 3APDA 4J6IA 4XDDA 2O6VB 2EKEC 4KSKC 4KX6B 3TEYA 1XLOA 1YJ1A 4IWOA 2JXXA 2N0SB 2SAKA 2OHFA 2QIEB 1HQRD 1LQBA 1UH6A 2BS2B 2DHZA 4G50A 3H7SA 5LLIA 3VTUA 2IGHA 4W9HA 4II2B 4KIKA 3JSVA 2BB5A 1FMAD 4ITKA 4KV2A 3AH7A 4PS3A 1E8YA 4W9KA 1BT0A 1WYWB 5JHBA 3WIMA 1SE3A 1DOIA 2ZNVB 3BVMA 2KDIA 2Y5CA 2NBUA 2RDGA 3BYTB 5BYRA 4OHJA 4WJNA 1HZ5A 3A1QA 1YX6B 1SE4A 1JRUA 3OJ4B 1TJEA 2K25A 4PYZA 1Y8RC 4E74A 1V1PA 5L95C 1WR1A 1ZPSA 1C76A 2KDMA 3W9CB 3OWEB 3O65B 4MGIE 1RLFA 3Q69A 4RFBA 1UUPA 4CO7A 4MGYE 2FBWB 4W9EA 4ZHPA 3UF8A 2DYMA 4GLSC 2V9HA 4DHJB 3K9PB 2JZPA 2JXTA 3IT6B 2RR9A 4W9JA 2OJRA 4ZRKA 3CIRB 1N61A 3AN1A 1FEHA 1I42A 3NVYA 1TT5B 3AB5A 2ZW0A 5LXIB 1UELA 4JWUC 4KVGB 3R3MA 3FKYA 2I1KA 1SE2A 1VR9A 4WQMA 2X38A 3RULA 4NZLB 1D6EC 2NCNA 3AI5A 1AYFA 2G3QB 3PSEB 1GB4A 1JWUD 4KSLC 2K5PA 5AEKB 3T9LA 3W2DA 4PYUA 4BFRA 1WGYA 1TS5A 2KDEB 3NOBA 4GU2A 3DQVA 5G55A 2LUMA 2KZRA 1V2YA 1AARA 1YOVB 5D7GA 4JPSA 1WE7A 3N3KB 5E6NA 4I6LB 3WA0A 1TKEA 3NJTA 2WDTB 4XDCA 3ML9A 1J7CA 4UDUC 2K8CA 1HTQA 1KM7A 2MJDA 2D10A 2LD9A 2PEAA 2JWZA 2VH2A 1LFDA 1MG8A 3PLVA 3P1MA 5AZHA 2NPTB 4A9AA 3RNAC 2LEKA 4WIPA 4TSSA 2KTFA 5E6PA 4ANWA 1YQBA 5AUIA 3HK0A 1FRRA 1V81A 3PZ7A 1JW9D 2N9PC 3VUXA 3TUOA 1MJDA 2ZEQA 5EE3A 1Q1OA 4MGZE 4WJOA 4M01A 3FILB 1N62A 4D2KA 2PMVA 2M0AA 2DYOA 2AL3A 3Q8BA 2IO0B 5EE9A 3ZJUA 1RM6C 3B2GA 4C7YA 1ZW7A 4P1CC 1C1YB 3BIID 1WJ6A 3AE5B 1TY0A 2D3BA 2WXKA 1TTNA 3B08A 4LCDE 3AXCA 3VR8B 4ANXA 2ZPNA 1YD8U 2WX1A 5CHFA 1E0ZA 1S3SG 3CF6E 2KMCA 4FN2A 2BW2A 2WDVB 1VZ8A 2LFIA 2NBWB 4YSXB 3I5JC 4WJPA 4ASWC 3GE3C 4TQ0A 2NBVB 1UZXB 1TBEA 3V6CB 1C9FA 1FFUA 3QJZA 3ZLZA 4LLGM 1WY8A 3P2BA 2DZKA 2LMCA 4ANUA 1ZOYB 3AV8A 1V5TA 2CU1A 4IWPA 1WF9A 1DGJA 3M63B 1XEEA 2N4FA 2Y5PA 3PS6A 4YWGG 2D2QA 1DOYA 3DVNU 3QC8B 3R66C 1VJKA 1SXTA 1WX9A 1YQ3B 4N59A 5BYSA 4N9F4 4ZYNA 1EUVB 1WFYA 1C4CA 1F0ZA 4G0NB 4S0RA 2C7HA 1A70A 1KLGD 1L2NA 2KWVB 2K22A 2MEKA 3KQ4A 5HG2A 3SFDB 1EF5A 3W1SC 2LGYA 3R7QA 3QA8A 1P7EA 1ZXHA 4GDLA 2HD5B 3DDCB 1L6UA 4B0EA 2BPSA 1ET9A 1I4XA 3IAS1 4US8A 3VH3B 2DX5B 2ONQA 3ZGZA 3R2IA 4NAWA 2KYWA 4E71A 2G4SA 2KC1A 1FXAA 2WXPA 2WXOA 1B1ZA 4ZHOA 4RGOS 3UQBA 4WURA 3ZRCA 2FUHB 3RUIB 4JWSC 2KXJA 3ZQ4A 2MLBA 1EWYC 3SDLC 3TCAA 1WYGA 1E8ZA 1TY2A 3RMKC 2V3NA 4IG7B 1C78A 2BVCA 3ZDTA 1HTOA 2BKFA 4XZ4A 3PTFC 3EGRA 4HVBA 4IM3A 4WJQA 2Z0DB 2A5UA 1I4RA 4HDQA 3AEGB 4X57B 3WALA 3ENEA 3EC8A 2GMIC 2AX5A 3DVNV 3D32A 2W55A 2MJEA 4FHKA 2HJ8A 3APFA 2JF5A 5H92C 1TZOA 2ZPYA 4K3BA 3TIXA 1P7FA 4LDTB 5D2MB 4M0WB 3DHHC 3BVGA 4URKA 4IKGA 1GB1A 3MHZA 4I6PA 3N9YC 1KFYB 3EA6A 4HKQA 1NBFC 2IY1B 3DBLI 5CHVC 3SD5A 3AE4B 1ZXIA 2LHEA 2KMAA 3QK0A 3KUDB 4IC7B 4OW0A 4PT5A 2LWPA 2KX3A 3PREA 1JWSD 4B6WA 3B9JA 2HDEA 1WXAA 5IP4D 2O2VA 1AW7A 5C1ZA 3U8ZA 1JRPA 1OQQA 2O2VB 1SSNA 2O6VD 4F8CB 1SBBB 5JXVA 2W9NA 3VR9B 3ZJTA 1WZ0A 1WMHA 4GIVA 4ZRJA 1WM3A 1E7PB 1NENB 3TEZA 4RM8A 3NZ3A 3C19A 3P63A 2K1FA 4TV3A 5IA7A 4WAAA 3MP9A 5C2TB 3EECA 2K39A 2LVPA 3KWVA 3OJ3A 4LNOA 1UGJA 2HTME 1E6EB 1TIFA 4YTPB 4YT0B 3I63C 2L05A 4HKZE 3A4SC 4O1NA 1SB3C 4DWFA 3AE7B 3HRDD 3DBLB 2QHOA 4W9FA 4NAMA 2FIFA 4BVUC 1J8CA 2WXIA 3AEFB 2NR2A 4ZDVA 2IZVB 2L32A 2V3SA 4USAA 5D3DA 4DBGA 1GG3A 4LJOB 3ZW3A 5JZEB 2H88B 2IO2B 4LNFA 1V5OA 4W9GA 4GB9A 5C23A 2G45B 3GS2A 4BZAA 3DBSA 4OVVA 3SHQA 2KJRA 2LXAA 3ZRFA 3AEAB 1NEKB 3JYUA 2MJ3A 5DPWA 3DBRI 3W1YA 2M8SA 2LXCA 4DHZB 4P1BC 1C3TA 4LTUA 2Z59B 3KVFB 3EUB2 3HUIA 2WNMA 1SIJA 3PVLA 1Y56A 1QILA 1DOXA 4NNJB 1SGHA 2PE6B 5D3IB 5FK9C 3VRBB 1C77A 2PVGC 4HDOA 4HRSA 1K51A 2GBNA 3W1SA 4ZOHC 3C8YA 1M4VA 2I38A 4DDID 1WX7A 1RYJA 3RT3B 2VZKB 1VD2A 2BWFA 3JW0X 3NHEB 3Q8AA 2KHWB 4BBNF 2QDFA 4GDKB 2K6QA 3MC8A 2Q5WD 5BO4B 2RPVA 5CX3A 3RCZA 2L7RA 1T6BX 2ZZPB 3E9SA 4KKIA 2BGFA 3O13A 4JIOU 4LNNA 4AJWA 5KHQA 4YSZB 2KWCA 2WXGA 1IGDA 1VDVA 4WAFA 1XCTL 3QX1A 1E8XA 1YX5B 1T0QC 4DXFA 2KOXA 4B95A 2LUEA 2CS4A 2IO3B 2PKOA 4BKGA 2D3GA 1QT9A 3TBLD 1IP9A 3TL5A 1UWXA 2DWQA 1H4RA 1T3QA 5G2NA 4YL8A 1DYQA 2N9KA 3FILA 2D5GA 3H8HA 4HJGE 3HIZA 1TGZB 2RPQA 3U7ZA 2NTTA 1K52A 1PGBA 1JWBD 3ZIMA 4J3OD 2N1WA 4A55A 1WGDA 2J53A 4AS1A 1XT9B 1D3ZA 4NJ7A 3U2SC 1J19A 1OTRB 2BB6A 1FNUA 1QQRA 4S17A 2GI9A 2JYEA 2KO3A 3ZNID 2DBYA 2CHZA 3NUHB 2CKHB 4FJVB 4RGMA 4BOSC 3VTWA 2JX5A 4C80A 1EU3A 2WGSA 3Q3JA 1I35A 2K9XA 5MPOA 2CJOA 2LRUA 2CR5A 1N63A 3KW5B 4FJYA 4FULA 3KYCD
chains in the Genus database with same CATH topology
2N7DA 1TTNA 1Z2MA 2BYEA 3B08A 4IUMB 4LCDE 4FJZA 2R2QA 3AXCA 1OQYA 3GZNI 4GDKA 4MGKE 5TR5A 3PZDA 1RFAA 3UINB 3WAMA 4ANXA 2K8BA 2ZPNA 3QHTA 1YD8U 2WX1A 3QAQA 4KIKB 5CHFA 2MCNB 3X23A 3BY4B 3QCAA 2KD0A 1PQSA 3L54A 1S3SG 3CF6E 2KMCA 4B9KA 2FCSA 2HTHA 2CHWA 2V1YA 1E90A 3MTNB 4FN2A 4W9LA 1A5RA 2PJHA 2MBEA 4PS8A 4FA6A 2RD0A 2WWZA 4DHZE 2GBJA 3PRPB 4EZJA 2KQ7A 3UIOB 1QZEA 3A9JA 3DCGA 4MEMA 4NJ6A 3PT2B 2NBWB 5AZFA 1RRBA 1WZ3A 4KDLB 1WE6A 2J0MA 2N1VA 1WGHA 2L0TA 1E5WA 1FXTB 4WJPA 3GOEA 2KC2A 4ASWC 2IYDB 4TQ0A 4E3CA 2NBVB 2JVCA 2BKRB 1UZXB 1TBEA 4W9DA 3V6CB 3A33B 3IBEA 2MSED 3H7PB 3K9OB 4LDTD 4G11A 4MDKE 3RZFA 3QJZA 3L13A 3ZLZA 1WGRA 1WY8A 2LASA 3P2BA 2DZKA 4W9CA 4ANUA 2KN5A 3DVGX 2GBRA 1V5TA 1GJZA 1KLVA 2CU1A 2KQSA 2RSUA 3ONSA 4IWPA 1WRDB 1WF9A 3DPDA 5DPSA 3M63B 4ICVA 4FBJB 2N4FA 3PS6A 3Q3FA 3A9KA 1F9JA 2D2QA 3JSVB 2GOWA 2LJ5A 3L10B 4XX5A 2GBKA 3DVNU 4GOCA 3QC8B 3KUZA 2ASQA 4NY0A 3VVWB 3B0AA 3R66C 1VCBA 1WX9A 2MBBB 3AU4A 4IM0A 3U7DA 4CHKA 4N9F4 4ZYNA 2B3AA 5L83A 4I6NB 1EUVB 1WFYA 2KANA 3ECIA 4G0NB 2C7HA 2KKCA 1ZGUB 2NPTA 3AULA 1L2NA 2KWVB 1L7YA 2L0FA 1V9JA 3DOWA 2D07B 2JPHA 2KVRA 2KK8A 3VXWA 3MHSD 3H7PA 2KDFB 4DDGD 1EF5A 3W1SC 2LGYA 3R7QA 2JY6A 4PS7A 3QA8A 2KNBA 2K6DB 4GDLA 4KZ0A 3L16A 4ANVA 4HPMB 2HD5B 2IO1B 3DDCB 1WR6E 3HM6X 3R7RA 2BF8B 2BPSA 4MSQB 1GC7A 1WXMA 5EDSA 3VH3B 2M17A 4OVUA 2DX5B 4AWJA 2OOBB 1ZKHA 2AL6A 4NAWA 4E71A 1LM8B 2G4SA 1P0RA 2KC1A 1P3QU 3QARA 2LVQA 2AWTA 4HXDA 4A20A 5GMVA 3AU5A 3UQBA 5FR6A 2PE9A 3ZRCA 4HWIB 2FUHB 3OAWA 3RUIB 3UIPB 4LJPB 4HCNB 3APCA 3ZVVA 1E7UA 1RAXA 3VHTC 1G6JA 1KOTA 3H6NA 2KXJA 4KZCA 2MLBA 3SDLC 1R4MI 3TCAA 2L3ZA 2G4DB 4II3B 2C60A 3IG3A 4XC2A 4F1SA 1E8WA 3ZKJC 1E8ZA 3A9KB 3M62B 2L00B 4HLEA 2NVUI 1T0YA 4IG7B 2JT4B 3ZDTA 2MBOA 1V6EA 1OEYJ 3H1UA 2BKFA 4NQKE 4XZ4A 4EKUA 3U30A 2N9EB 3PRZA 4P7IA 4WWPA 3V6EB 4DXAB 2KJHB 3PTFC 5LXHA 4IW0A 2KFJA 4FHJA 1XD3B 4HVBA 1NI2A 4IM3A 4WJQA 1TZ1A 2Z0DB 1WJNA 1WXVA 2A5UA 4BKSD 4HDQA 4X57B 3MJWA 2LRWA 3WALA 1H8CA 1YIWA 3ENEA 4MSMB 1WH3A 2XEWA 3EC8A 2GMIC 4EZKA 2J0JA 2JZ3B 2R2OA 1IYFA 3DVNV 1WJUA 3D32A 3OLMD 5DPRA 1SIFA 3PPAA 2HJ8A 3ALBA 3APFA 3DBHI 3A1QB 4FHKA 2JF5A 2KLGA 4G3XB 3VUYA 3SU8X 2KTRB 4ICUA 3V61A 2ZPYA 2LZ6A 1P9DU 5IAAC 3TIXA 4LDTB 1OGWA 1NDDA 3NS8A 2JZZA 4M0WB 5D2MB 4URKA 2JRIB 1S1QB 3VFKA 2V4LA 2FCNA 1J0GA 2DENB 4ZRIA 2MX2A 4I6PA 4MM3A 3ZTCA 2LVOA 4MELA 2MA9B 1NBFC 2N9XA 4F7ZA 2IY1B 3DBLI 3L0WB 5CHVC 3SD5A 3LDZE 3EHVA 3N32A 4IM2A 2N7EA 2DYBA 1WX8A 3A4RA 2KMAA 3VH4B 3QK0A 4GN1A 4BKTA 5J17A 3KUDB 4IC7B 3T8MA 1UBQA 3QIJA 2LWPA 2KX3A 1LXDA 2EMTA 2GBMA 1HE8A 2L76A 3PREA 2FCMA 1V49A 5D94A 4TKNA 4B6WA 3I3TB 5J2RA 1WXAA 4HPLB 4BBNC 3L17A 4MH0E 2O2VA 2ZVOA 5C1ZA 3RYTA 2AEHA 2I1JA 3U8ZA 1Q5WB 2O2VB 2LGDA 1U4AA 5HKHA 1OEYA 1R4NI 2O6VD 3EFUA 4AP4C 4F8CB 4NQLB 1UD7A 2ZCBA 2W9NA 3UQAA 1WM2A 3M3JA 2FCQA 5JHAA 1WZ0A 3APDA 4J6IA 1WJ4A 1WMHA 2M0XA 1V86A 1WM3A 3PGEA 4GIVA 4JL9A 4ZRJA 2AYOB 2O6VB 2EKEC 4RM8A 2DAFA 3JVZX 2K1FA 2ZNVC 4KSKC 4TV3A 5DCNA 5IA7A 4IWQA 4WAAA 3ZNGC 2JRHA 3IHPC 3EECA 1YJ1A 2K39A 4IWOA 2LVPA 2JXXA 3OJ3A 2J7QB 3M95A 4NAWB 4CYEA 2Y5BB 4EFOA 1K8RB 4MJSB 2MBQA 1P98A 1LQBA 1UH6A 4A3OA 2KWUB 2L05A 2DHZA 4G50A 3A4SC 3H7SA 5LLIA 3VTUA 3UGBB 3ZDMC 4DWFA 4RM9A 2IBIB 4W9HA 3NZSA 2DZJA 2KX0A 4II2B 2QHOA 4KIKA 4W9FA 3WAOA 4BVUC 2FIFA 1J8CA 3QWZB 3JSVA 4ZDVA 2NR2A 3ML8A 2IZVB 2V3SA 2UWQA 3PHWB 3ZNZB 4KV2A 4PS3A 1GG3A 4LJOB 1E8YA 4KDIC 3ZW3A 4DBGA 3TMPB 5JZEB 2IO2B 4W9GA 1V5OA 4W9KA 4GB9A 1BT0A 1WYWB 5C23A 5JHBA 3WIMA 2G45B 2DZIA 2UYZB 3QQ8B 2ZNVB 4JQWC 2KDIA 2O6VA 2NBUA 3DBSA 4K7WA 2ZCCA 4OVVA 3SHQA 2NS5A 2KJRA 2WX0A 2LXAA 4WWNA 3ZRFA 4WJNA 3JYUA 2DZMA 3A1QA 1YX6B 5KHOA 2LI5A 5DPWA 3DBRI 3W1YA 2M8SA 5JH5C 1JRUA 2LXCA 4DHZB 3OJ4B 1EO6A 4DHJD 2K25A 2KFKB 4PYZA 4K7SA 2YVCA 1C3TA 1Y8RC 4EOYA 4E74A 4JGHB 2Z59B 3KVFB 3WANA 2HE7A 4GDLB 4K81A 2MWSB 4EEWA 1WR1A 2C7MB 1M94A 5L95C 3O65B 5J18A 4MGIE 3PHXB 3PVLA 2L8JA 1RLFA 3VUWA 1X1MA 2M1MA 3TJPA 2D11A 4NNJB 1SGHA 4CO7A 2PE6B 4MGYE 2REXA 4W9EA 4M8MA 2DYMA 3UF8A 4BKSA 4DHJB 1WMHB 3K9PB 1WGGA 4WWOA 4HDOA 3B1LX 2GBNA 1GNUA 2MW5A 3W1SA 2MQJA 2RR9A 4W9JA 2C7NB 2OJRA 2BYVE 3HHMA 3KYDD 2M4NA 4DDID 1WX7A 2WYQA 3NZUA 3RT3B 2J0KA 3H9DA 2JUOA 2XK5A 1VD2A 2BWFA 3JW0X 4ZRKA 3ZUNA 1WI0A 2ZJDA 1ISNA 2RGFA 3V60A 3ZO5B 2A4ZA 1I42A 3DVGY 3NHEB 4BBNF 2KHWB 3NY5A 5LXIB 2CHXA 2K6QA 1UELA 2MRPA 4GDKB 3ZTDA 4A3PA 4KVGB 5BO4B 3R3MA 4W9IA 5CX3A 2I1KA 2MP2A 1KJTA 1GC6A 4M8NA 5D6JB 3RCZA 2L7RA 4EUTA 4FADA 2C9WB 2ZZPB 2MP2B 3RULA 2EMSA 2BGFA 4JIOU 2NCNA 4AJWA 3VQIA 5KHQA 3AI5A 2KWCA 3KUCB 4NPNA 2G3QB 3PSEB 3S2AA 5AZGA 4AOFA 3QX1A 4KSLC 5CTRC 5AEKB 1P1AA 1E8XA 1YX5B 3T9LA 4PYUA 2XBBC 2KOXA 1WGYA 4BFRA 2KFKA 4B95A 2KDEB 2CS4A 2LUEA 2IO3B 5DPTA 3NOBA 4BKGA 2D3GA 3HM3A 4GU2A 3DQVA 2Z0EB 1SE9A 2KLCA 5G55A 3TBLD 4HJKA 1IP9A 3ZNHB 3TL5A 2KZRA 1V2YA 1AARA 1H4RA 2BWES 5D7GA 3X0WA 2PPHA 2FIDA 1WE7A 5G2NA 3VTVA 3N3KB 5E6NA 4I6LB 3WA0A 4YL8A 1V80A 2MBHA 3A9JB 2WDTB 3HIZA 2BYFA 2IY0B 3C0RB 1TGZB 2RPQA 3ML9A 2K8HA 3L08A 2K8CA 2KDBA 2FAZA 4GSWA 1KM7A 4HCPB 3ZIMA 2D10A 2LD9A 2PEAA 3PV1A 1GUAB 1UGMA 2JWZA 4K1RB 2N1WA 1LFDA 1MG8A 3PLVA 1WGDA 4MJSA 1XT9B 4BOZB 1D3ZA 3PRMB 5AZHA 2NPTB 5CHWA 1XQQA 3CSFA 1Q0WB 4NJ7A 3IVFA 3RD2A 3VDZA 1J19A 1OTRB 2C5LC 5E6OA 2KTFA 2YLMA 1UBIA 3CSTA 5E6PA 4ANWA 3CMMB 3VAWA 1YQBA 2KJ6A 3V62A 4AUQC 3HK0A 3IFWB 2KO3A 4FLHA 3ZNID 1CMXB 1V81A 2CHZA 2KTRA 2N9PC 3VUXA 1WXSA 4TQ1A 1EF1A 2CKHB 1WIAA 4JLCA 2DAJA 2FNJB 4FJVB 2ZEQA 3BINA 1Q1OA 4WQOB 3WAPA 3PLUA 4MGZE 4WJOA 4BOSC 4TUUA 1E7VA 1Z5SB 4GGQA 3VTWA 2ZVNA 4GXBA 2LGXA 3KH0A 4GMVA 3N30A 3Q3JA 4RMAA 2DYOA 2AL3A 2IO0B 4EZLA 2VRRB 1I35A 4DK5A 1ZW7A 3RZWC 4K7UA 2LRUA 1C1YB 2XK5B 2CR5A 1WJ6A 1IPGA 3KW5B 3LJ3A 4FJYA 4FULA 3KYCD 4HK2A 4AJYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7D A;  1TTN A;  1Z2M A;  2BYE A;  3B08 A;  4IUM B;  4LCD E;  4FJZ A;  2R2Q A;  3AXC A;  1OQY A;  3GZN I;  4GDK A;  4MGK E;  5TR5 A;  3PZD A;  1RFA A;  3UIN B;  3WAM A;  4ANX A;  2K8B A;  2ZPN A;  3QHT A;  1YD8 U;  2WX1 A;  3QAQ A;  4KIK B;  5CHF A;  2MCN B;  3X23 A;  3BY4 B;  3QCA A;  2KD0 A;  1PQS A;  3L54 A;  1S3S G;  3CF6 E;  2KMC A;  4B9K A;  2FCS A;  2HTH A;  2CHW A;  2V1Y A;  1E90 A;  3MTN B;  4FN2 A;  4W9L A;  1A5R A;  2PJH A;  2MBE A;  4PS8 A;  4FA6 A;  2RD0 A;  2WWZ A;  4DHZ E;  2GBJ A;  3PRP B;  4EZJ A;  2KQ7 A;  3UIO B;  1QZE A;  3A9J A;  3DCG A;  4MEM A;  4NJ6 A;  3PT2 B;  2NBW B;  5AZF A;  1RRB A;  1WZ3 A;  4KDL B;  1WE6 A;  2J0M A;  2N1V A;  1WGH A;  2L0T A;  1E5W A;  1FXT B;  4WJP A;  3GOE A;  2KC2 A;  4ASW C;  2IYD B;  4TQ0 A;  4E3C A;  2NBV B;  2JVC A;  2BKR B;  1UZX B;  1TBE A;  4W9D A;  3V6C B;  3A33 B;  3IBE A;  2MSE D;  3H7P B;  3K9O B;  4LDT D;  4G11 A;  4MDK E;  3RZF A;  3QJZ A;  3L13 A;  3ZLZ A;  1WGR A;  1WY8 A;  2LAS A;  3P2B A;  2DZK A;  4W9C A;  4ANU A;  2KN5 A;  3DVG X;  2GBR A;  1V5T A;  1GJZ A;  1KLV A;  2CU1 A;  2KQS A;  2RSU A;  3ONS A;  4IWP A;  1WRD B;  1WF9 A;  3DPD A;  5DPS A;  3M63 B;  4ICV A;  4FBJ B;  2N4F A;  3PS6 A;  3Q3F A;  3A9K A;  1F9J A;  2D2Q A;  3JSV B;  2GOW A;  2LJ5 A;  3L10 B;  4XX5 A;  2GBK A;  3DVN U;  4GOC A;  3QC8 B;  3KUZ A;  2ASQ A;  4NY0 A;  3VVW B;  3B0A A;  3R66 C;  1VCB A;  1WX9 A;  2MBB B;  3AU4 A;  4IM0 A;  3U7D A;  4CHK A;  4N9F 4;  4ZYN A;  2B3A A;  5L83 A;  4I6N B;  1EUV B;  1WFY A;  2KAN A;  3ECI A;  4G0N B;  2C7H A;  2KKC A;  1ZGU B;  2NPT A;  3AUL A;  1L2N A;  2KWV B;  1L7Y A;  2L0F A;  1V9J A;  3DOW A;  2D07 B;  2JPH A;  2KVR A;  2KK8 A;  3VXW A;  3MHS D;  3H7P A;  2KDF B;  4DDG D;  1EF5 A;  3W1S C;  2LGY A;  3R7Q A;  2JY6 A;  4PS7 A;  3QA8 A;  2KNB A;  2K6D B;  4GDL A;  4KZ0 A;  3L16 A;  4ANV A;  4HPM B;  2HD5 B;  2IO1 B;  3DDC B;  1WR6 E;  3HM6 X;  3R7R A;  2BF8 B;  2BPS A;  4MSQ B;  1GC7 A;  1WXM A;  5EDS A;  3VH3 B;  2M17 A;  4OVU A;  2DX5 B;  4AWJ A;  2OOB B;  1ZKH A;  2AL6 A;  4NAW A;  4E71 A;  1LM8 B;  2G4S A;  1P0R A;  2KC1 A;  1P3Q U;  3QAR A;  2LVQ A;  2AWT A;  4HXD A;  4A20 A;  5GMV A;  3AU5 A;  3UQB A;  5FR6 A;  2PE9 A;  3ZRC A;  4HWI B;  2FUH B;  3OAW A;  3RUI B;  3UIP B;  4LJP B;  4HCN B;  3APC A;  3ZVV A;  1E7U A;  1RAX A;  3VHT C;  1G6J A;  1KOT A;  3H6N A;  2KXJ A;  4KZC A;  2MLB A;  3SDL C;  1R4M I;  3TCA A;  2L3Z A;  2G4D B;  4II3 B;  2C60 A;  3IG3 A;  4XC2 A;  4F1S A;  1E8W A;  3ZKJ C;  1E8Z A;  3A9K B;  3M62 B;  2L00 B;  4HLE A;  2NVU I;  1T0Y A;  4IG7 B;  2JT4 B;  3ZDT A;  2MBO A;  1V6E A;  1OEY J;  3H1U A;  2BKF A;  4NQK E;  4XZ4 A;  4EKU A;  3U30 A;  2N9E B;  3PRZ A;  4P7I A;  4WWP A;  3V6E B;  4DXA B;  2KJH B;  3PTF C;  5LXH A;  4IW0 A;  2KFJ A;  4FHJ A;  1XD3 B;  4HVB A;  1NI2 A;  4IM3 A;  4WJQ A;  1TZ1 A;  2Z0D B;  1WJN A;  1WXV A;  2A5U A;  4BKS D;  4HDQ A;  4X57 B;  3MJW A;  2LRW A;  3WAL A;  1H8C A;  1YIW A;  3ENE A;  4MSM B;  1WH3 A;  2XEW A;  3EC8 A;  2GMI C;  4EZK A;  2J0J A;  2JZ3 B;  2R2O A;  1IYF A;  3DVN V;  1WJU A;  3D32 A;  3OLM D;  5DPR A;  1SIF A;  3PPA A;  2HJ8 A;  3ALB A;  3APF A;  3DBH I;  3A1Q B;  4FHK A;  2JF5 A;  2KLG A;  4G3X B;  3VUY A;  3SU8 X;  2KTR B;  4ICU A;  3V61 A;  2ZPY A;  2LZ6 A;  1P9D U;  5IAA C;  3TIX A;  4LDT B;  1OGW A;  1NDD A;  3NS8 A;  2JZZ A;  4M0W B;  5D2M B;  4URK A;  2JRI B;  1S1Q B;  3VFK A;  2V4L A;  2FCN A;  1J0G A;  2DEN B;  4ZRI A;  2MX2 A;  4I6P A;  4MM3 A;  3ZTC A;  2LVO A;  4MEL A;  2MA9 B;  1NBF C;  2N9X A;  4F7Z A;  2IY1 B;  3DBL I;  3L0W B;  5CHV C;  3SD5 A;  3LDZ E;  3EHV A;  3N32 A;  4IM2 A;  2N7E A;  2DYB A;  1WX8 A;  3A4R A;  2KMA A;  3VH4 B;  3QK0 A;  4GN1 A;  4BKT A;  5J17 A;  3KUD B;  4IC7 B;  3T8M A;  1UBQ A;  3QIJ A;  2LWP A;  2KX3 A;  1LXD A;  2EMT A;  2GBM A;  1HE8 A;  2L76 A;  3PRE A;  2FCM A;  1V49 A;  5D94 A;  4TKN A;  4B6W A;  3I3T B;  5J2R A;  1WXA A;  4HPL B;  4BBN C;  3L17 A;  4MH0 E;  2O2V A;  2ZVO A;  5C1Z A;  3RYT A;  2AEH A;  2I1J A;  3U8Z A;  1Q5W B;  2O2V B;  2LGD A;  1U4A A;  5HKH A;  1OEY A;  1R4N I;  2O6V D;  3EFU A;  4AP4 C;  4F8C B;  4NQL B;  1UD7 A;  2ZCB A;  2W9N A;  3UQA A;  1WM2 A;  3M3J A;  2FCQ A;  5JHA A;  1WZ0 A;  3APD A;  4J6I A;  1WJ4 A;  1WMH A;  2M0X A;  1V86 A;  1WM3 A;  3PGE A;  4GIV A;  4JL9 A;  4ZRJ A;  2AYO B;  2O6V B;  2EKE C;  4RM8 A;  2DAF A;  3JVZ X;  2K1F A;  2ZNV C;  4KSK C;  4TV3 A;  5DCN A;  5IA7 A;  4IWQ A;  4WAA A;  3ZNG C;  2JRH A;  3IHP C;  3EEC A;  1YJ1 A;  2K39 A;  4IWO A;  2LVP A;  2JXX A;  3OJ3 A;  2J7Q B;  3M95 A;  4NAW B;  4CYE A;  2Y5B B;  4EFO A;  1K8R B;  4MJS B;  2MBQ A;  1P98 A;  1LQB A;  1UH6 A;  4A3O A;  2KWU B;  2L05 A;  2DHZ A;  4G50 A;  3A4S C;  3H7S A;  5LLI A;  3VTU A;  3UGB B;  3ZDM C;  4DWF A;  4RM9 A;  2IBI B;  4W9H A;  3NZS A;  2DZJ A;  2KX0 A;  4II2 B;  2QHO A;  4KIK A;  4W9F A;  3WAO A;  4BVU C;  2FIF A;  1J8C A;  3QWZ B;  3JSV A;  4ZDV A;  2NR2 A;  3ML8 A;  2IZV B;  2V3S A;  2UWQ A;  3PHW B;  3ZNZ B;  4KV2 A;  4PS3 A;  1GG3 A;  4LJO B;  1E8Y A;  4KDI C;  3ZW3 A;  4DBG A;  3TMP B;  5JZE B;  2IO2 B;  4W9G A;  1V5O A;  4W9K A;  4GB9 A;  1BT0 A;  1WYW B;  5C23 A;  5JHB A;  3WIM A;  2G45 B;  2DZI A;  2UYZ B;  3QQ8 B;  2ZNV B;  4JQW C;  2KDI A;  2O6V A;  2NBU A;  3DBS A;  4K7W A;  2ZCC A;  4OVV A;  3SHQ A;  2NS5 A;  2KJR A;  2WX0 A;  2LXA A;  4WWN A;  3ZRF A;  4WJN A;  3JYU A;  2DZM A;  3A1Q A;  1YX6 B;  5KHO A;  2LI5 A;  5DPW A;  3DBR I;  3W1Y A;  2M8S A;  5JH5 C;  1JRU A;  2LXC A;  4DHZ B;  3OJ4 B;  1EO6 A;  4DHJ D;  2K25 A;  2KFK B;  4PYZ A;  4K7S A;  2YVC A;  1C3T A;  1Y8R C;  4EOY A;  4E74 A;  4JGH B;  2Z59 B;  3KVF B;  3WAN A;  2HE7 A;  4GDL B;  4K81 A;  2MWS B;  4EEW A;  1WR1 A;  2C7M B;  1M94 A;  5L95 C;  3O65 B;  5J18 A;  4MGI E;  3PHX B;  3PVL A;  2L8J A;  1RLF A;  3VUW A;  1X1M A;  2M1M A;  3TJP A;  2D11 A;  4NNJ B;  1SGH A;  4CO7 A;  2PE6 B;  4MGY E;  2REX A;  4W9E A;  4M8M A;  2DYM A;  3UF8 A;  4BKS A;  4DHJ B;  1WMH B;  3K9P B;  1WGG A;  4WWO A;  4HDO A;  3B1L X;  2GBN A;  1GNU A;  2MW5 A;  3W1S A;  2MQJ A;  2RR9 A;  4W9J A;  2C7N B;  2OJR A;  2BYV E;  3HHM A;  3KYD D;  2M4N A;  4DDI D;  1WX7 A;  2WYQ A;  3NZU A;  3RT3 B;  2J0K A;  3H9D A;  2JUO A;  2XK5 A;  1VD2 A;  2BWF A;  3JW0 X;  4ZRK A;  3ZUN A;  1WI0 A;  2ZJD A;  1ISN A;  2RGF A;  3V60 A;  3ZO5 B;  2A4Z A;  1I42 A;  3DVG Y;  3NHE B;  4BBN F;  2KHW B;  3NY5 A;  5LXI B;  2CHX A;  2K6Q A;  1UEL A;  2MRP A;  4GDK B;  3ZTD A;  4A3P A;  4KVG B;  5BO4 B;  3R3M A;  4W9I A;  5CX3 A;  2I1K A;  2MP2 A;  1KJT A;  1GC6 A;  4M8N A;  5D6J B;  3RCZ A;  2L7R A;  4EUT A;  4FAD A;  2C9W B;  2ZZP B;  2MP2 B;  3RUL A;  2EMS A;  2BGF A;  4JIO U;  2NCN A;  4AJW A;  3VQI A;  5KHQ A;  3AI5 A;  2KWC A;  3KUC B;  4NPN A;  2G3Q B;  3PSE B;  3S2A A;  5AZG A;  4AOF A;  3QX1 A;  4KSL C;  5CTR C;  5AEK B;  1P1A A;  1E8X A;  1YX5 B;  3T9L A;  4PYU A;  2XBB C;  2KOX A;  1WGY A;  4BFR A;  2KFK A;  4B95 A;  2KDE B;  2CS4 A;  2LUE A;  2IO3 B;  5DPT A;  3NOB A;  4BKG A;  2D3G A;  3HM3 A;  4GU2 A;  3DQV A;  2Z0E B;  1SE9 A;  2KLC A;  5G55 A;  3TBL D;  4HJK A;  1IP9 A;  3ZNH B;  3TL5 A;  2KZR A;  1V2Y A;  1AAR A;  1H4R A;  2BWE S;  5D7G A;  3X0W A;  2PPH A;  2FID A;  1WE7 A;  5G2N A;  3VTV A;  3N3K B;  5E6N A;  4I6L B;  3WA0 A;  4YL8 A;  1V80 A;  2MBH A;  3A9J B;  2WDT B;  3HIZ A;  2BYF A;  2IY0 B;  3C0R B;  1TGZ B;  2RPQ A;  3ML9 A;  2K8H A;  3L08 A;  2K8C A;  2KDB A;  2FAZ A;  4GSW A;  1KM7 A;  4HCP B;  3ZIM A;  2D10 A;  2LD9 A;  2PEA A;  3PV1 A;  1GUA B;  1UGM A;  2JWZ A;  4K1R B;  2N1W A;  1LFD A;  1MG8 A;  3PLV A;  1WGD A;  4MJS A;  1XT9 B;  4BOZ B;  1D3Z A;  3PRM B;  5AZH A;  2NPT B;  5CHW A;  1XQQ A;  3CSF A;  1Q0W B;  4NJ7 A;  3IVF A;  3RD2 A;  3VDZ A;  1J19 A;  1OTR B;  2C5L C;  5E6O A;  2KTF A;  2YLM A;  1UBI A;  3CST A;  5E6P A;  4ANW A;  3CMM B;  3VAW A;  1YQB A;  2KJ6 A;  3V62 A;  4AUQ C;  3HK0 A;  3IFW B;  2KO3 A;  4FLH A;  3ZNI D;  1CMX B;  1V81 A;  2CHZ A;  2KTR A;  2N9P C;  3VUX A;  1WXS A;  4TQ1 A;  1EF1 A;  2CKH B;  1WIA A;  4JLC A;  2DAJ A;  2FNJ B;  4FJV B;  2ZEQ A;  3BIN A;  1Q1O A;  4WQO B;  3WAP A;  3PLU A;  4MGZ E;  4WJO A;  4BOS C;  4TUU A;  1E7V A;  1Z5S B;  4GGQ A;  3VTW A;  2ZVN A;  4GXB A;  2LGX A;  3KH0 A;  4GMV A;  3N30 A;  3Q3J A;  4RMA A;  2DYO A;  2AL3 A;  2IO0 B;  4EZL A;  2VRR B;  1I35 A;  4DK5 A;  1ZW7 A;  3RZW C;  4K7U A;  2LRU A;  1C1Y B;  2XK5 B;  2CR5 A;  1WJ6 A;  1IPG A;  3KW5 B;  3LJ3 A;  4FJY A;  4FUL A;  3KYC D;  4HK2 A;  4AJY B; 
#chains in the Genus database with same CATH topology
 2N7D A;  1PDX A;  4C4V A;  4GDK A;  3QAQ A;  2MCN B;  1WWT A;  3X23 A;  1J7A A;  3QCA A;  1ZDV A;  2FCS A;  1A5R A;  1E90 A;  4OZC A;  2MBE A;  4PS8 A;  3TEW A;  2RD0 A;  2WP9 B;  4RF1 A;  4NJ6 A;  3A9J A;  3DCG A;  3SR6 A;  1RRB A;  1WZ3 A;  1WE6 A;  2N1V A;  1FNV A;  3IT4 B;  3GOE A;  2IYD B;  3MFG A;  2BKR B;  4W9D A;  2N7J A;  3IBE A;  3K9O B;  2LGS A;  1FPY A;  4G11 A;  1QOG A;  1YNT E;  2PVO D;  1L0V B;  1D5Z C;  1MHH E;  4XWW A;  2PLP A;  2GBR A;  3DVG X;  1I4G A;  2RSU A;  3ONS A;  1WRD B;  3DPD A;  4FBJ B;  1JCK B;  2Y3A A;  2PTL A;  3Q3F A;  4A6Q A;  3JSV B;  4WH4 A;  4GOC A;  2ASQ A;  4NY0 A;  3VVW B;  3B0A A;  3DBR B;  4XWT A;  1FO4 A;  4LNK A;  2MH7 A;  2B3A A;  1V8C A;  3AE8 B;  2KAC A;  3VRA B;  1L4D B;  2KAN A;  5IO9 A;  1R4N B;  1FNW A;  2NPT A;  1MPE A;  1L7Y A;  3DOW A;  2JPH A;  3VXW A;  2BT6 A;  4HRO A;  4DDG D;  2WXQ A;  4PS7 A;  2WXM A;  2IPK D;  4KZ0 A;  3L16 A;  2FE8 A;  4HPM B;  4DQO C;  2WXL A;  1GC7 A;  1QLB B;  1ZDX A;  5EDS A;  2M17 A;  4OVU A;  4AWJ A;  2AL6 A;  3Q6B A;  1QOF A;  1LM8 B;  2J42 A;  1P0R A;  1P3Q U;  4A20 A;  2AWT A;  2G1E A;  1BML C;  5GMV A;  3AU5 A;  3OAW A;  3UIP B;  3T3O A;  1B9R A;  1RAX A;  3VHT C;  1G6J A;  5AUK A;  1SEB D;  3PO0 A;  2J4X A;  1E8W A;  5BYQ A;  4ARI A;  2L00 B;  4HLE A;  1D5X C;  2MBO A;  1OEY J;  3H1U A;  4NQK E;  2D3C A;  4EKU A;  1D5M C;  3U30 A;  2N9E B;  1F77 A;  4DXA B;  2KJH B;  4MH8 A;  2KT7 A;  4FHJ A;  3R2T A;  4IDI A;  4RCO A;  1SJE D;  5IKC M;  1WXV A;  2QIL A;  5BMI A;  4BAX A;  1YMH E;  2TSS A;  1F1H A;  1XLN A;  4MSM B;  1WH3 A;  2JZ3 B;  1IYF A;  1MG4 A;  1SIF A;  4C56 C;  3I57 A;  1I4Q A;  2KLG A;  2KTR B;  4IOI E;  1NVI D;  1P9D U;  4YTM B;  3KWL A;  1NDD A;  2JZZ A;  3NRZ A;  2JRI B;  1S1Q B;  2QJL A;  1XLP A;  2V4L A;  2OJW A;  4ZRI A;  2I2Y A;  4MM3 A;  3AED B;  1TS4 A;  2LVO A;  4MEL A;  4MM3 B;  2JSV X;  3EHV A;  4IM2 A;  1WX8 A;  4GN1 A;  2PIA A;  3T8M A;  3QIJ A;  2GBM A;  2L76 A;  3TEX A;  5D94 A;  4BBN C;  3L17 A;  4MH0 E;  3L4P A;  2AEH A;  3RYT A;  1Q5W B;  5HKH A;  1U4A A;  2WHI A;  3RNC C;  3EFU A;  3NS1 A;  3NVV A;  1XLQ A;  1WJ4 A;  3PGE A;  4XYC A;  3JVZ X;  4N6E B;  4B0M A;  2ZNV C;  5DCN A;  3ZNG C;  3IXS A;  3IHP C;  1CK1 A;  1VLB A;  2WXF A;  4NAW B;  1FD6 A;  4EFO A;  1K8R B;  2MBQ A;  3RI7 C;  2L1A A;  2KWU B;  4A3O A;  1SJH D;  2W54 A;  1XXG A;  3UGB B;  3ZDM C;  4M0W A;  2ON8 A;  4RM9 A;  2IBI B;  2DZJ A;  2KX0 A;  1ESF A;  1YJI A;  4CQN A;  1HXY D;  4DXG A;  5C3J B;  4KDI C;  3UI3 A;  3TMP B;  5GXG B;  1STE A;  1CQV A;  3QQ8 B;  4JQW C;  4KGR A;  5BMH A;  1TKG A;  4K7W A;  1EU4 A;  2NS5 A;  2WX0 A;  2DZM A;  5KHO A;  1HEZ E;  2IGD A;  4DHJ D;  1EO6 A;  2KFK B;  4RH6 A;  2YVC A;  3R8B A;  1J7B A;  2Z8L A;  3WAN A;  4K81 A;  2MWS B;  4EEW A;  1I7H A;  2C7M B;  2H89 B;  5J18 A;  2R61 A;  2XNA C;  3VUW A;  1X1M A;  2M1M A;  2D11 A;  2WXH A;  3N1X C;  3AE9 B;  2REX A;  4M8M A;  3Q3N C;  4BKS A;  1GNU A;  2JU6 X;  2YEP F;  4N58 A;  3B2F A;  2C7N B;  3HHM A;  3Q8F A;  1XO3 A;  2JWU A;  3H9D A;  2L83 A;  5LNK 1;  3AE3 B;  2XK5 A;  3ZUN A;  1WI0 A;  2X8X X;  1ISN A;  2RGF A;  3V60 A;  1BXT A;  3ZO5 B;  2A4Z A;  1WGK A;  3DVG Y;  2WXR A;  3ZTD A;  4C00 A;  3V05 A;  4W9I A;  1KJT A;  1GC6 A;  1PGA A;  4M8N A;  5D6J B;  2C9W B;  3KUC B;  4JE3 B;  4NPN A;  3RNB C;  5CTR C;  1P1A A;  2BYT A;  2WU5 B;  4P6V F;  1SE9 A;  2KLC A;  4HJK A;  3ZNH B;  2J52 A;  2BWE S;  2PW9 A;  1YN4 A;  3X0W A;  2PPH A;  2FID A;  3VTV A;  4Q2J A;  1FM0 D;  1TS3 A;  2MBH A;  2AQ2 B;  1NYR A;  2BYF A;  1EWC A;  1R7S A;  2K8H A;  3L08 A;  4A90 A;  2FAZ A;  4YTN B;  1FRD A;  4HCP B;  3PV1 A;  4HPP A;  1UGM A;  4K1R B;  4MJS A;  4BOZ B;  5CHW A;  1XQQ A;  3CSF A;  3W5V B;  3IVF A;  3RD2 A;  2C5L C;  2YLM A;  3CST A;  3VAW A;  2CU3 A;  3IAM 1;  3IFW B;  3P42 A;  1UF0 A;  1RWS A;  4TQ1 A;  1EF1 A;  1E9M A;  2FNJ B;  3BIN A;  3WAP A;  3PLU A;  1D4B A;  1E7V A;  3LXF A;  3N1Y C;  4GXB A;  4GMV A;  4RMA A;  5HI1 A;  2IGG A;  2VRR B;  2INC C;  2XK5 B;  5FKA C;  5HFY A;  3LJ3 A;  1GAQ B;  4HK2 A;  1LO5 D;  1I4H A;  3GE8 C;  1Z2M A;  2KMM A;  4IUM B;  4MGK E;  3GZN I;  5TR5 A;  1OQY A;  3WAM A;  1RFA A;  2K8B A;  4KIK B;  2GRI A;  1JAL A;  3BY4 B;  2KD0 A;  1PQS A;  3L54 A;  2HTH A;  1TKY A;  2PJH A;  2WWZ A;  4DHZ E;  1CJE A;  4OVZ A;  1IBX B;  3N1Z C;  1TS2 A;  3AM9 A;  1ENF A;  2ICI A;  1FCL A;  1I4P A;  3BWU D;  2J0M A;  2L0T A;  1E5W A;  2KQ4 X;  2BTE A;  3NVZ A;  1N5X A;  3PZ8 A;  3EFC A;  4E3C A;  3U4E G;  2EEL A;  2KWD A;  3A33 B;  2MSE D;  4LDT D;  4MDK E;  3RZF A;  4OZA A;  5H8Y E;  4W9C A;  1KH0 A;  2VZK D;  3P4R B;  2KN5 A;  2WU2 B;  3RN9 C;  2KQS A;  3RFZ B;  4RGT A;  3A9K A;  1F9J A;  4XX5 A;  2GBK A;  3KUZ A;  2WS3 B;  4US9 A;  5IN7 A;  2UU7 A;  1KTK A;  3U7D A;  1T5X D;  1WXQ A;  2WQY B;  5L83 A;  2W3S A;  2AQ1 B;  3I9V 1;  4KKJ A;  3Q2A C;  3BK1 A;  2KKC A;  3BK2 A;  3P4Q B;  1VZ6 A;  1F52 A;  4R3D A;  2D07 B;  3H7P A;  2NTS A;  2JY6 A;  2K6D B;  1QF6 A;  2INN E;  3HM6 X;  3R7R A;  4YXD B;  1UWM A;  1ZKH A;  1N6Z A;  3ZJV A;  4MT5 A;  1JRO A;  4ACF A;  1CZP A;  2PE9 A;  4NJC A;  4HWI B;  3APC A;  1L0Y B;  3ZVV A;  1KOT A;  1KLU D;  3H6N A;  1JWM D;  4KZC A;  1JML A;  3U52 E;  1R4M I;  1XCQ L;  4II3 B;  1JWA D;  2C60 A;  3IG3 A;  2G9H D;  4XC2 A;  4F1S A;  1QOA A;  2GLS A;  1SF0 A;  1T0Y A;  2JQR B;  1L4Z B;  1GPX A;  1FFV A;  4P7I A;  3V6E B;  2KVZ A;  4L23 A;  2KFJ A;  3LB8 C;  5E6J A;  1XD3 B;  3WCQ A;  1NI2 A;  1WJN A;  4BKS D;  3GP7 A;  3MJW A;  1H8C A;  1YIW A;  2J0J A;  1YN3 A;  3OLM D;  5DPR A;  1F2R I;  4G3X B;  2W82 A;  5G5G A;  1VRA B;  4ICU A;  3MC0 B;  2LZ6 A;  2QCZ A;  3VFK A;  2FCN A;  2MHJ A;  3DWM A;  3ZTC A;  2MX2 A;  2MA9 B;  1FIQ A;  2N9X A;  4F7Z A;  3RNG C;  3LDZ E;  3N32 A;  3Q8E A;  2N7E A;  3BYY B;  1UBQ A;  2QSD A;  1LXD A;  1L0X B;  3AE2 B;  2FCM A;  2V0G A;  1V49 A;  4TKN A;  4XE0 A;  4HPL B;  2ZVO A;  1BUI C;  1EM7 A;  2I1J A;  1WRI A;  2WDR B;  3NVW A;  1OEY A;  1R4N I;  2FUG 1;  1K50 A;  1ZUD 2;  2WDQ B;  1WM2 A;  3M3J A;  1V1P B;  2FCQ A;  5JHA A;  2V3P A;  2M0X A;  1V86 A;  2M19 A;  1OFF A;  4JL9 A;  2AYO B;  2DAF A;  1PGX A;  4IWQ A;  2JRH A;  4LNI A;  2J7Q B;  3M95 A;  4HEA 1;  2Y5B B;  4CYE A;  2IDY A;  4L1B A;  3P4P B;  4MJS B;  1P98 A;  1YJJ A;  4P16 A;  3KLS X;  3V3X A;  3ETR A;  3NZS A;  3WAO A;  3QWZ B;  3ML8 A;  1T0R C;  2UWQ A;  3PHW B;  3ZNZ B;  1N5W A;  4H2A A;  2W3R A;  2WXJ A;  1GOZ A;  2DZI A;  2UYZ B;  2QC8 A;  2O6V A;  2ZCC A;  4WWN A;  3SFE B;  3HVD A;  2LI5 A;  4ZYS A;  5JH5 C;  2LJI A;  4K7S A;  2DNF A;  1PUT A;  4EOY A;  4JGH B;  2HE7 A;  4GDL B;  1AN8 A;  1M94 A;  1V97 A;  3PHX B;  2L8J A;  4KGT A;  3TJP A;  1ACC A;  2AQ3 B;  3DHI C;  4YSY B;  2LGI A;  1C79 A;  4XGA B;  1WMH B;  1WGG A;  3RNF C;  4WWO A;  1IBX A;  3B1L X;  2MW5 A;  2MQJ A;  1L6V A;  2BYV E;  3KYD D;  4OZB A;  2M4N A;  1TYG B;  2WYQ A;  3NZU A;  2J0K A;  2JUO A;  2ZJD A;  1Q10 A;  1HA5 A;  4L2Y A;  5G5H A;  1LGR A;  3NY5 A;  2CHX A;  2MRP A;  4A3P A;  3TSS A;  3J9C A;  1ROE A;  2MP2 A;  4EUT A;  4FAD A;  2MP2 B;  2EMS A;  2RDB C;  2XN9 C;  3VQI A;  3GB1 A;  3S2A A;  5AZG A;  1ZP0 B;  4AOF A;  2E3T A;  2M56 B;  4M00 A;  2XBB C;  4K3C A;  1R4M B;  2SEB D;  2KFK A;  1VZ7 A;  4C4V B;  5DPT A;  1E10 A;  3HM3 A;  1NYQ A;  2Z0E B;  3N20 C;  2QMT A;  4RGN A;  1V80 A;  3A9J B;  3MC9 A;  1MVK A;  3C0R B;  2IY0 B;  3AEE B;  2KDB A;  5IOI A;  1N60 A;  2E6X A;  4GSW A;  3ZXV A;  2BQQ A;  1GUA B;  2VH1 A;  1NI3 A;  2HJ1 A;  3PRM B;  4EE2 A;  4REZ A;  4ZRP A;  2OED A;  3ZXR A;  1Q0W B;  3VDZ A;  2KN4 A;  5E6O A;  2N9L A;  1UBI A;  3CMM B;  1MFW A;  2KJ6 A;  3V62 A;  4AUQ C;  2INP E;  2QEJ C;  4FLH A;  1CMX B;  2KTR A;  1WXS A;  1C4A A;  1WIA A;  4JLC A;  2DAJ A;  1JQ4 A;  4WQO B;  4TUU A;  3DWG C;  1Z5S B;  4GGQ A;  2IND C;  1V1O A;  2ZVN A;  2LGX A;  3KH0 A;  3N30 A;  4EZL A;  3RNE C;  4DK5 A;  3RZW C;  4K7U A;  4M02 A;  1FCC C;  1IPG A;  3URY A;  3AEC B;  4AJY B;  2BYE A;  4FJZ A;  2R2Q A;  1OQR A;  3PZD A;  1F2R C;  3UIN B;  3QHT A;  3OG5 A;  1AWD A;  1XF5 L;  4JX1 C;  5EE1 A;  3Q14 C;  3W5U B;  4B9K A;  4W9L A;  2V1Y A;  2CHW A;  3MTN B;  5T8I A;  4FA6 A;  3AEB B;  1QKZ A;  2GBJ A;  3PRP B;  4EZJ A;  2KQ7 A;  3UIO B;  1QZE A;  4MEM A;  3PT2 B;  5AZF A;  4TMA B;  3P4S B;  3RPF C;  3AMZ A;  4A8X C;  4KDL B;  1MHX A;  1WGH A;  3LYY A;  1FXT B;  2K0P A;  3T3N A;  2KC2 A;  2JVC A;  2JYT A;  1KRH A;  2RMM A;  3H7P B;  2DLB A;  3L13 A;  1WGR A;  2LAS A;  2LHD A;  3BZD B;  2WLB A;  1PYW D;  1GJZ A;  2K3U A;  1KLV A;  5DPS A;  4ICV A;  3CWI A;  1RFK A;  2GOW A;  2LJ5 A;  3HVZ A;  3L10 B;  1IUE A;  4PK1 A;  4C7Z A;  5I4D A;  1VCB A;  3ABV B;  2MBB B;  3AU4 A;  4IM0 A;  4CHK A;  5TSS A;  4I6N B;  1WSP A;  3ECI A;  4LK0 M;  3Q3M C;  2IJ0 A;  1ZGU B;  3AUL A;  4ARC A;  2L0F A;  1V9J A;  2KVR A;  2KK8 A;  3MHS D;  3SEB A;  2KDF B;  4AQ7 A;  3AE6 B;  2KNB A;  2YEP B;  4ANV A;  4RF0 A;  2IO1 B;  1WR6 E;  2BF8 B;  4WWM A;  2V4I B;  4MSQ B;  3DBH B;  1WXM A;  2EKI A;  2OOB B;  3QAR A;  4HXD A;  2LVQ A;  1QOB A;  1T0S C;  2ZW1 A;  3ZYY X;  5FR6 A;  2BS4 B;  4LJP B;  4HCN B;  3BVZ A;  2L52 A;  3FC4 A;  3Q3O C;  1E7U A;  4QAY A;  2L3Z A;  1IGC A;  2G4D B;  3MJ5 A;  3ZKJ C;  3A9K B;  3AE1 B;  3M62 B;  1C4P A;  2NVU I;  1ZE3 D;  3GZN B;  4RNA A;  5FR3 A;  2B76 B;  2JT4 B;  1V6E A;  5EE0 A;  3PRZ A;  3E56 A;  4WWP A;  5LXH A;  4IW0 A;  1MI0 A;  4MAC A;  2ACZ B;  4FXC A;  2BS3 B;  1FXI A;  1TZ1 A;  2GB1 A;  2D3A A;  2LRW A;  2XEW A;  2BBC A;  4EZK A;  2R2O A;  1WJU A;  3PPA A;  3DBH I;  3ALB A;  3VUY A;  3A1Q B;  4KGS A;  3SU8 X;  3V61 A;  5IAA C;  1ET6 A;  1YN5 A;  1OGW A;  3NS8 A;  3DHG C;  1J0G A;  1HZ6 A;  1K53 A;  2DEN B;  3Q8C A;  2WXN A;  1PFD A;  3L0W B;  4ZRQ A;  2DYB A;  2KAJ A;  2NMQ A;  2RDH A;  3A4R A;  3VH4 B;  4BKT A;  5J17 A;  5HHD G;  2EMT A;  1HE8 A;  3FAH A;  3I3T B;  5J2R A;  1L5P A;  2CJN A;  2LGD A;  3NG0 A;  4AP4 C;  4NQL B;  1KF6 B;  1UD7 A;  1UNS A;  5BMG A;  2ZCB A;  3UQA A;  1YQ4 B;  3APD A;  4J6I A;  4XDD A;  2O6V B;  2EKE C;  4KSK C;  4KX6 B;  3TEY A;  1XLO A;  1YJ1 A;  4IWO A;  2JXX A;  2N0S B;  2SAK A;  2OHF A;  2QIE B;  1HQR D;  1LQB A;  1UH6 A;  2BS2 B;  2DHZ A;  4G50 A;  3H7S A;  5LLI A;  3VTU A;  2IGH A;  4W9H A;  4II2 B;  4KIK A;  3JSV A;  2BB5 A;  1FMA D;  4ITK A;  4KV2 A;  3AH7 A;  4PS3 A;  1E8Y A;  4W9K A;  1BT0 A;  1WYW B;  5JHB A;  3WIM A;  1SE3 A;  1DOI A;  2ZNV B;  3BVM A;  2KDI A;  2Y5C A;  2NBU A;  2RDG A;  3BYT B;  5BYR A;  4OHJ A;  4WJN A;  1HZ5 A;  3A1Q A;  1YX6 B;  1SE4 A;  1JRU A;  3OJ4 B;  1TJE A;  2K25 A;  4PYZ A;  1Y8R C;  4E74 A;  1V1P A;  5L95 C;  1WR1 A;  1ZPS A;  1C76 A;  2KDM A;  3W9C B;  3OWE B;  3O65 B;  4MGI E;  1RLF A;  3Q69 A;  4RFB A;  1UUP A;  4CO7 A;  4MGY E;  2FBW B;  4W9E A;  4ZHP A;  3UF8 A;  2DYM A;  4GLS C;  2V9H A;  4DHJ B;  3K9P B;  2JZP A;  2JXT A;  3IT6 B;  2RR9 A;  4W9J A;  2OJR A;  4ZRK A;  3CIR B;  1N61 A;  3AN1 A;  1FEH A;  1I42 A;  3NVY A;  1TT5 B;  3AB5 A;  2ZW0 A;  5LXI B;  1UEL A;  4JWU C;  4KVG B;  3R3M A;  3FKY A;  2I1K A;  1SE2 A;  1VR9 A;  4WQM A;  2X38 A;  3RUL A;  4NZL B;  1D6E C;  2NCN A;  3AI5 A;  1AYF A;  2G3Q B;  3PSE B;  1GB4 A;  1JWU D;  4KSL C;  2K5P A;  5AEK B;  3T9L A;  3W2D A;  4PYU A;  4BFR A;  1WGY A;  1TS5 A;  2KDE B;  3NOB A;  4GU2 A;  3DQV A;  5G55 A;  2LUM A;  2KZR A;  1V2Y A;  1AAR A;  1YOV B;  5D7G A;  4JPS A;  1WE7 A;  3N3K B;  5E6N A;  4I6L B;  3WA0 A;  1TKE A;  3NJT A;  2WDT B;  4XDC A;  3ML9 A;  1J7C A;  4UDU C;  2K8C A;  1HTQ A;  1KM7 A;  2MJD A;  2D10 A;  2LD9 A;  2PEA A;  2JWZ A;  2VH2 A;  1LFD A;  1MG8 A;  3PLV A;  3P1M A;  5AZH A;  2NPT B;  4A9A A;  3RNA C;  2LEK A;  4WIP A;  4TSS A;  2KTF A;  5E6P A;  4ANW A;  1YQB A;  5AUI A;  3HK0 A;  1FRR A;  1V81 A;  3PZ7 A;  1JW9 D;  2N9P C;  3VUX A;  3TUO A;  1MJD A;  2ZEQ A;  5EE3 A;  1Q1O A;  4MGZ E;  4WJO A;  4M01 A;  3FIL B;  1N62 A;  4D2K A;  2PMV A;  2M0A A;  2DYO A;  2AL3 A;  3Q8B A;  2IO0 B;  5EE9 A;  3ZJU A;  1RM6 C;  3B2G A;  4C7Y A;  1ZW7 A;  4P1C C;  1C1Y B;  3BII D;  1WJ6 A;  3AE5 B;  1TY0 A;  2D3B A;  2WXK A;  1TTN A;  3B08 A;  4LCD E;  3AXC A;  3VR8 B;  4ANX A;  2ZPN A;  1YD8 U;  2WX1 A;  5CHF A;  1E0Z A;  1S3S G;  3CF6 E;  2KMC A;  4FN2 A;  2BW2 A;  2WDV B;  1VZ8 A;  2LFI A;  2NBW B;  4YSX B;  3I5J C;  4WJP A;  4ASW C;  3GE3 C;  4TQ0 A;  2NBV B;  1UZX B;  1TBE A;  3V6C B;  1C9F A;  1FFU A;  3QJZ A;  3ZLZ A;  4LLG M;  1WY8 A;  3P2B A;  2DZK A;  2LMC A;  4ANU A;  1ZOY B;  3AV8 A;  1V5T A;  2CU1 A;  4IWP A;  1WF9 A;  1DGJ A;  3M63 B;  1XEE A;  2N4F A;  2Y5P A;  3PS6 A;  4YWG G;  2D2Q A;  1DOY A;  3DVN U;  3QC8 B;  3R66 C;  1VJK A;  1SXT A;  1WX9 A;  1YQ3 B;  4N59 A;  5BYS A;  4N9F 4;  4ZYN A;  1EUV B;  1WFY A;  1C4C A;  1F0Z A;  4G0N B;  4S0R A;  2C7H A;  1A70 A;  1KLG D;  1L2N A;  2KWV B;  2K22 A;  2MEK A;  3KQ4 A;  5HG2 A;  3SFD B;  1EF5 A;  3W1S C;  2LGY A;  3R7Q A;  3QA8 A;  1P7E A;  1ZXH A;  4GDL A;  2HD5 B;  3DDC B;  1L6U A;  4B0E A;  2BPS A;  1ET9 A;  1I4X A;  3IAS 1;  4US8 A;  3VH3 B;  2DX5 B;  2ONQ A;  3ZGZ A;  3R2I A;  4NAW A;  2KYW A;  4E71 A;  2G4S A;  2KC1 A;  1FXA A;  2WXP A;  2WXO A;  1B1Z A;  4ZHO A;  4RGO S;  3UQB A;  4WUR A;  3ZRC A;  2FUH B;  3RUI B;  4JWS C;  2KXJ A;  3ZQ4 A;  2MLB A;  1EWY C;  3SDL C;  3TCA A;  1WYG A;  1E8Z A;  1TY2 A;  3RMK C;  2V3N A;  4IG7 B;  1C78 A;  2BVC A;  3ZDT A;  1HTO A;  2BKF A;  4XZ4 A;  3PTF C;  3EGR A;  4HVB A;  4IM3 A;  4WJQ A;  2Z0D B;  2A5U A;  1I4R A;  4HDQ A;  3AEG B;  4X57 B;  3WAL A;  3ENE A;  3EC8 A;  2GMI C;  2AX5 A;  3DVN V;  3D32 A;  2W55 A;  2MJE A;  4FHK A;  2HJ8 A;  3APF A;  2JF5 A;  5H92 C;  1TZO A;  2ZPY A;  4K3B A;  3TIX A;  1P7F A;  4LDT B;  5D2M B;  4M0W B;  3DHH C;  3BVG A;  4URK A;  4IKG A;  1GB1 A;  3MHZ A;  4I6P A;  3N9Y C;  1KFY B;  3EA6 A;  4HKQ A;  1NBF C;  2IY1 B;  3DBL I;  5CHV C;  3SD5 A;  3AE4 B;  1ZXI A;  2LHE A;  2KMA A;  3QK0 A;  3KUD B;  4IC7 B;  4OW0 A;  4PT5 A;  2LWP A;  2KX3 A;  3PRE A;  1JWS D;  4B6W A;  3B9J A;  2HDE A;  1WXA A;  5IP4 D;  2O2V A;  1AW7 A;  5C1Z A;  3U8Z A;  1JRP A;  1OQQ A;  2O2V B;  1SSN A;  2O6V D;  4F8C B;  1SBB B;  5JXV A;  2W9N A;  3VR9 B;  3ZJT A;  1WZ0 A;  1WMH A;  4GIV A;  4ZRJ A;  1WM3 A;  1E7P B;  1NEN B;  3TEZ A;  4RM8 A;  3NZ3 A;  3C19 A;  3P63 A;  2K1F A;  4TV3 A;  5IA7 A;  4WAA A;  3MP9 A;  5C2T B;  3EEC A;  2K39 A;  2LVP A;  3KWV A;  3OJ3 A;  4LNO A;  1UGJ A;  2HTM E;  1E6E B;  1TIF A;  4YTP B;  4YT0 B;  3I63 C;  2L05 A;  4HKZ E;  3A4S C;  4O1N A;  1SB3 C;  4DWF A;  3AE7 B;  3HRD D;  3DBL B;  2QHO A;  4W9F A;  4NAM A;  2FIF A;  4BVU C;  1J8C A;  2WXI A;  3AEF B;  2NR2 A;  4ZDV A;  2IZV B;  2L32 A;  2V3S A;  4USA A;  5D3D A;  4DBG A;  1GG3 A;  4LJO B;  3ZW3 A;  5JZE B;  2H88 B;  2IO2 B;  4LNF A;  1V5O A;  4W9G A;  4GB9 A;  5C23 A;  2G45 B;  3GS2 A;  4BZA A;  3DBS A;  4OVV A;  3SHQ A;  2KJR A;  2LXA A;  3ZRF A;  3AEA B;  1NEK B;  3JYU A;  2MJ3 A;  5DPW A;  3DBR I;  3W1Y A;  2M8S A;  2LXC A;  4DHZ B;  4P1B C;  1C3T A;  4LTU A;  2Z59 B;  3KVF B;  3EUB 2;  3HUI A;  2WNM A;  1SIJ A;  3PVL A;  1Y56 A;  1QIL A;  1DOX A;  4NNJ B;  1SGH A;  2PE6 B;  5D3I B;  5FK9 C;  3VRB B;  1C77 A;  2PVG C;  4HDO A;  4HRS A;  1K51 A;  2GBN A;  3W1S A;  4ZOH C;  3C8Y A;  1M4V A;  2I38 A;  4DDI D;  1WX7 A;  1RYJ A;  3RT3 B;  2VZK B;  1VD2 A;  2BWF A;  3JW0 X;  3NHE B;  3Q8A A;  2KHW B;  4BBN F;  2QDF A;  4GDK B;  2K6Q A;  3MC8 A;  2Q5W D;  5BO4 B;  2RPV A;  5CX3 A;  3RCZ A;  2L7R A;  1T6B X;  2ZZP B;  3E9S A;  4KKI A;  2BGF A;  3O13 A;  4JIO U;  4LNN A;  4AJW A;  5KHQ A;  4YSZ B;  2KWC A;  2WXG A;  1IGD A;  1VDV A;  4WAF A;  1XCT L;  3QX1 A;  1E8X A;  1YX5 B;  1T0Q C;  4DXF A;  2KOX A;  4B95 A;  2LUE A;  2CS4 A;  2IO3 B;  2PKO A;  4BKG A;  2D3G A;  1QT9 A;  3TBL D;  1IP9 A;  3TL5 A;  1UWX A;  2DWQ A;  1H4R A;  1T3Q A;  5G2N A;  4YL8 A;  1DYQ A;  2N9K A;  3FIL A;  2D5G A;  3H8H A;  4HJG E;  3HIZ A;  1TGZ B;  2RPQ A;  3U7Z A;  2NTT A;  1K52 A;  1PGB A;  1JWB D;  3ZIM A;  4J3O D;  2N1W A;  4A55 A;  1WGD A;  2J53 A;  4AS1 A;  1XT9 B;  1D3Z A;  4NJ7 A;  3U2S C;  1J19 A;  1OTR B;  2BB6 A;  1FNU A;  1QQR A;  4S17 A;  2GI9 A;  2JYE A;  2KO3 A;  3ZNI D;  2DBY A;  2CHZ A;  3NUH B;  2CKH B;  4FJV B;  4RGM A;  4BOS C;  3VTW A;  2JX5 A;  4C80 A;  1EU3 A;  2WGS A;  3Q3J A;  1I35 A;  2K9X A;  5MPO A;  2CJO A;  2LRU A;  2CR5 A;  1N63 A;  3KW5 B;  4FJY A;  4FUL A;  3KYC D; 
#chains in the Genus database with same CATH homology
 2N7D A;  1TTN A;  1Z2M A;  2BYE A;  3B08 A;  4IUM B;  4LCD E;  4FJZ A;  2R2Q A;  3AXC A;  1OQY A;  3GZN I;  4GDK A;  4MGK E;  5TR5 A;  3PZD A;  1RFA A;  3UIN B;  3WAM A;  4ANX A;  2K8B A;  2ZPN A;  3QHT A;  1YD8 U;  2WX1 A;  3QAQ A;  4KIK B;  5CHF A;  2MCN B;  3X23 A;  3BY4 B;  3QCA A;  2KD0 A;  1PQS A;  3L54 A;  1S3S G;  3CF6 E;  2KMC A;  4B9K A;  2FCS A;  2HTH A;  2CHW A;  2V1Y A;  1E90 A;  3MTN B;  4FN2 A;  4W9L A;  1A5R A;  2PJH A;  2MBE A;  4PS8 A;  4FA6 A;  2RD0 A;  2WWZ A;  4DHZ E;  2GBJ A;  3PRP B;  4EZJ A;  2KQ7 A;  3UIO B;  1QZE A;  3A9J A;  3DCG A;  4MEM A;  4NJ6 A;  3PT2 B;  2NBW B;  5AZF A;  1RRB A;  1WZ3 A;  4KDL B;  1WE6 A;  2J0M A;  2N1V A;  1WGH A;  2L0T A;  1E5W A;  1FXT B;  4WJP A;  3GOE A;  2KC2 A;  4ASW C;  2IYD B;  4TQ0 A;  4E3C A;  2NBV B;  2JVC A;  2BKR B;  1UZX B;  1TBE A;  4W9D A;  3V6C B;  3A33 B;  3IBE A;  2MSE D;  3H7P B;  3K9O B;  4LDT D;  4G11 A;  4MDK E;  3RZF A;  3QJZ A;  3L13 A;  3ZLZ A;  1WGR A;  1WY8 A;  2LAS A;  3P2B A;  2DZK A;  4W9C A;  4ANU A;  2KN5 A;  3DVG X;  2GBR A;  1V5T A;  1GJZ A;  1KLV A;  2CU1 A;  2KQS A;  2RSU A;  3ONS A;  4IWP A;  1WRD B;  1WF9 A;  3DPD A;  5DPS A;  3M63 B;  4ICV A;  4FBJ B;  2N4F A;  3PS6 A;  3Q3F A;  3A9K A;  1F9J A;  2D2Q A;  3JSV B;  2GOW A;  2LJ5 A;  3L10 B;  4XX5 A;  2GBK A;  3DVN U;  4GOC A;  3QC8 B;  3KUZ A;  2ASQ A;  4NY0 A;  3VVW B;  3B0A A;  3R66 C;  1VCB A;  1WX9 A;  2MBB B;  3AU4 A;  4IM0 A;  3U7D A;  4CHK A;  4N9F 4;  4ZYN A;  2B3A A;  5L83 A;  4I6N B;  1EUV B;  1WFY A;  2KAN A;  3ECI A;  4G0N B;  2C7H A;  2KKC A;  1ZGU B;  2NPT A;  3AUL A;  1L2N A;  2KWV B;  1L7Y A;  2L0F A;  1V9J A;  3DOW A;  2D07 B;  2JPH A;  2KVR A;  2KK8 A;  3VXW A;  3MHS D;  3H7P A;  2KDF B;  4DDG D;  1EF5 A;  3W1S C;  2LGY A;  3R7Q A;  2JY6 A;  4PS7 A;  3QA8 A;  2KNB A;  2K6D B;  4GDL A;  4KZ0 A;  3L16 A;  4ANV A;  4HPM B;  2HD5 B;  2IO1 B;  3DDC B;  1WR6 E;  3HM6 X;  3R7R A;  2BF8 B;  2BPS A;  4MSQ B;  1GC7 A;  1WXM A;  5EDS A;  3VH3 B;  2M17 A;  4OVU A;  2DX5 B;  4AWJ A;  2OOB B;  1ZKH A;  2AL6 A;  4NAW A;  4E71 A;  1LM8 B;  2G4S A;  1P0R A;  2KC1 A;  1P3Q U;  3QAR A;  2LVQ A;  2AWT A;  4HXD A;  4A20 A;  5GMV A;  3AU5 A;  3UQB A;  5FR6 A;  2PE9 A;  3ZRC A;  4HWI B;  2FUH B;  3OAW A;  3RUI B;  3UIP B;  4LJP B;  4HCN B;  3APC A;  3ZVV A;  1E7U A;  1RAX A;  3VHT C;  1G6J A;  1KOT A;  3H6N A;  2KXJ A;  4KZC A;  2MLB A;  3SDL C;  1R4M I;  3TCA A;  2L3Z A;  2G4D B;  4II3 B;  2C60 A;  3IG3 A;  4XC2 A;  4F1S A;  1E8W A;  3ZKJ C;  1E8Z A;  3A9K B;  3M62 B;  2L00 B;  4HLE A;  2NVU I;  1T0Y A;  4IG7 B;  2JT4 B;  3ZDT A;  2MBO A;  1V6E A;  1OEY J;  3H1U A;  2BKF A;  4NQK E;  4XZ4 A;  4EKU A;  3U30 A;  2N9E B;  3PRZ A;  4P7I A;  4WWP A;  3V6E B;  4DXA B;  2KJH B;  3PTF C;  5LXH A;  4IW0 A;  2KFJ A;  4FHJ A;  1XD3 B;  4HVB A;  1NI2 A;  4IM3 A;  4WJQ A;  1TZ1 A;  2Z0D B;  1WJN A;  1WXV A;  2A5U A;  4BKS D;  4HDQ A;  4X57 B;  3MJW A;  2LRW A;  3WAL A;  1H8C A;  1YIW A;  3ENE A;  4MSM B;  1WH3 A;  2XEW A;  3EC8 A;  2GMI C;  4EZK A;  2J0J A;  2JZ3 B;  2R2O A;  1IYF A;  3DVN V;  1WJU A;  3D32 A;  3OLM D;  5DPR A;  1SIF A;  3PPA A;  2HJ8 A;  3ALB A;  3APF A;  3DBH I;  3A1Q B;  4FHK A;  2JF5 A;  2KLG A;  4G3X B;  3VUY A;  3SU8 X;  2KTR B;  4ICU A;  3V61 A;  2ZPY A;  2LZ6 A;  1P9D U;  5IAA C;  3TIX A;  4LDT B;  1OGW A;  1NDD A;  3NS8 A;  2JZZ A;  4M0W B;  5D2M B;  4URK A;  2JRI B;  1S1Q B;  3VFK A;  2V4L A;  2FCN A;  1J0G A;  2DEN B;  4ZRI A;  2MX2 A;  4I6P A;  4MM3 A;  3ZTC A;  2LVO A;  4MEL A;  2MA9 B;  1NBF C;  2N9X A;  4F7Z A;  2IY1 B;  3DBL I;  3L0W B;  5CHV C;  3SD5 A;  3LDZ E;  3EHV A;  3N32 A;  4IM2 A;  2N7E A;  2DYB A;  1WX8 A;  3A4R A;  2KMA A;  3VH4 B;  3QK0 A;  4GN1 A;  4BKT A;  5J17 A;  3KUD B;  4IC7 B;  3T8M A;  1UBQ A;  3QIJ A;  2LWP A;  2KX3 A;  1LXD A;  2EMT A;  2GBM A;  1HE8 A;  2L76 A;  3PRE A;  2FCM A;  1V49 A;  5D94 A;  4TKN A;  4B6W A;  3I3T B;  5J2R A;  1WXA A;  4HPL B;  4BBN C;  3L17 A;  4MH0 E;  2O2V A;  2ZVO A;  5C1Z A;  3RYT A;  2AEH A;  2I1J A;  3U8Z A;  1Q5W B;  2O2V B;  2LGD A;  1U4A A;  5HKH A;  1OEY A;  1R4N I;  2O6V D;  3EFU A;  4AP4 C;  4F8C B;  4NQL B;  1UD7 A;  2ZCB A;  2W9N A;  3UQA A;  1WM2 A;  3M3J A;  2FCQ A;  5JHA A;  1WZ0 A;  3APD A;  4J6I A;  1WJ4 A;  1WMH A;  2M0X A;  1V86 A;  1WM3 A;  3PGE A;  4GIV A;  4JL9 A;  4ZRJ A;  2AYO B;  2O6V B;  2EKE C;  4RM8 A;  2DAF A;  3JVZ X;  2K1F A;  2ZNV C;  4KSK C;  4TV3 A;  5DCN A;  5IA7 A;  4IWQ A;  4WAA A;  3ZNG C;  2JRH A;  3IHP C;  3EEC A;  1YJ1 A;  2K39 A;  4IWO A;  2LVP A;  2JXX A;  3OJ3 A;  2J7Q B;  3M95 A;  4NAW B;  4CYE A;  2Y5B B;  4EFO A;  1K8R B;  4MJS B;  2MBQ A;  1P98 A;  1LQB A;  1UH6 A;  4A3O A;  2KWU B;  2L05 A;  2DHZ A;  4G50 A;  3A4S C;  3H7S A;  5LLI A;  3VTU A;  3UGB B;  3ZDM C;  4DWF A;  4RM9 A;  2IBI B;  4W9H A;  3NZS A;  2DZJ A;  2KX0 A;  4II2 B;  2QHO A;  4KIK A;  4W9F A;  3WAO A;  4BVU C;  2FIF A;  1J8C A;  3QWZ B;  3JSV A;  4ZDV A;  2NR2 A;  3ML8 A;  2IZV B;  2V3S A;  2UWQ A;  3PHW B;  3ZNZ B;  4KV2 A;  4PS3 A;  1GG3 A;  4LJO B;  1E8Y A;  4KDI C;  3ZW3 A;  4DBG A;  3TMP B;  5JZE B;  2IO2 B;  4W9G A;  1V5O A;  4W9K A;  4GB9 A;  1BT0 A;  1WYW B;  5C23 A;  5JHB A;  3WIM A;  2G45 B;  2DZI A;  2UYZ B;  3QQ8 B;  2ZNV B;  4JQW C;  2KDI A;  2O6V A;  2NBU A;  3DBS A;  4K7W A;  2ZCC A;  4OVV A;  3SHQ A;  2NS5 A;  2KJR A;  2WX0 A;  2LXA A;  4WWN A;  3ZRF A;  4WJN A;  3JYU A;  2DZM A;  3A1Q A;  1YX6 B;  5KHO A;  2LI5 A;  5DPW A;  3DBR I;  3W1Y A;  2M8S A;  5JH5 C;  1JRU A;  2LXC A;  4DHZ B;  3OJ4 B;  1EO6 A;  4DHJ D;  2K25 A;  2KFK B;  4PYZ A;  4K7S A;  2YVC A;  1C3T A;  1Y8R C;  4EOY A;  4E74 A;  4JGH B;  2Z59 B;  3KVF B;  3WAN A;  2HE7 A;  4GDL B;  4K81 A;  2MWS B;  4EEW A;  1WR1 A;  2C7M B;  1M94 A;  5L95 C;  3O65 B;  5J18 A;  4MGI E;  3PHX B;  3PVL A;  2L8J A;  1RLF A;  3VUW A;  1X1M A;  2M1M A;  3TJP A;  2D11 A;  4NNJ B;  1SGH A;  4CO7 A;  2PE6 B;  4MGY E;  2REX A;  4W9E A;  4M8M A;  2DYM A;  3UF8 A;  4BKS A;  4DHJ B;  1WMH B;  3K9P B;  1WGG A;  4WWO A;  4HDO A;  3B1L X;  2GBN A;  1GNU A;  2MW5 A;  3W1S A;  2MQJ A;  2RR9 A;  4W9J A;  2C7N B;  2OJR A;  2BYV E;  3HHM A;  3KYD D;  2M4N A;  4DDI D;  1WX7 A;  2WYQ A;  3NZU A;  3RT3 B;  2J0K A;  3H9D A;  2JUO A;  2XK5 A;  1VD2 A;  2BWF A;  3JW0 X;  4ZRK A;  3ZUN A;  1WI0 A;  2ZJD A;  1ISN A;  2RGF A;  3V60 A;  3ZO5 B;  2A4Z A;  1I42 A;  3DVG Y;  3NHE B;  4BBN F;  2KHW B;  3NY5 A;  5LXI B;  2CHX A;  2K6Q A;  1UEL A;  2MRP A;  4GDK B;  3ZTD A;  4A3P A;  4KVG B;  5BO4 B;  3R3M A;  4W9I A;  5CX3 A;  2I1K A;  2MP2 A;  1KJT A;  1GC6 A;  4M8N A;  5D6J B;  3RCZ A;  2L7R A;  4EUT A;  4FAD A;  2C9W B;  2ZZP B;  2MP2 B;  3RUL A;  2EMS A;  2BGF A;  4JIO U;  2NCN A;  4AJW A;  3VQI A;  5KHQ A;  3AI5 A;  2KWC A;  3KUC B;  4NPN A;  2G3Q B;  3PSE B;  3S2A A;  5AZG A;  4AOF A;  3QX1 A;  4KSL C;  5CTR C;  5AEK B;  1P1A A;  1E8X A;  1YX5 B;  3T9L A;  4PYU A;  2XBB C;  2KOX A;  1WGY A;  4BFR A;  2KFK A;  4B95 A;  2KDE B;  2CS4 A;  2LUE A;  2IO3 B;  5DPT A;  3NOB A;  4BKG A;  2D3G A;  3HM3 A;  4GU2 A;  3DQV A;  2Z0E B;  1SE9 A;  2KLC A;  5G55 A;  3TBL D;  4HJK A;  1IP9 A;  3ZNH B;  3TL5 A;  2KZR A;  1V2Y A;  1AAR A;  1H4R A;  2BWE S;  5D7G A;  3X0W A;  2PPH A;  2FID A;  1WE7 A;  5G2N A;  3VTV A;  3N3K B;  5E6N A;  4I6L B;  3WA0 A;  4YL8 A;  1V80 A;  2MBH A;  3A9J B;  2WDT B;  3HIZ A;  2BYF A;  2IY0 B;  3C0R B;  1TGZ B;  2RPQ A;  3ML9 A;  2K8H A;  3L08 A;  2K8C A;  2KDB A;  2FAZ A;  4GSW A;  1KM7 A;  4HCP B;  3ZIM A;  2D10 A;  2LD9 A;  2PEA A;  3PV1 A;  1GUA B;  1UGM A;  2JWZ A;  4K1R B;  2N1W A;  1LFD A;  1MG8 A;  3PLV A;  1WGD A;  4MJS A;  1XT9 B;  4BOZ B;  1D3Z A;  3PRM B;  5AZH A;  2NPT B;  5CHW A;  1XQQ A;  3CSF A;  1Q0W B;  4NJ7 A;  3IVF A;  3RD2 A;  3VDZ A;  1J19 A;  1OTR B;  2C5L C;  5E6O A;  2KTF A;  2YLM A;  1UBI A;  3CST A;  5E6P A;  4ANW A;  3CMM B;  3VAW A;  1YQB A;  2KJ6 A;  3V62 A;  4AUQ C;  3HK0 A;  3IFW B;  2KO3 A;  4FLH A;  3ZNI D;  1CMX B;  1V81 A;  2CHZ A;  2KTR A;  2N9P C;  3VUX A;  1WXS A;  4TQ1 A;  1EF1 A;  2CKH B;  1WIA A;  4JLC A;  2DAJ A;  2FNJ B;  4FJV B;  2ZEQ A;  3BIN A;  1Q1O A;  4WQO B;  3WAP A;  3PLU A;  4MGZ E;  4WJO A;  4BOS C;  4TUU A;  1E7V A;  1Z5S B;  4GGQ A;  3VTW A;  2ZVN A;  4GXB A;  2LGX A;  3KH0 A;  4GMV A;  3N30 A;  3Q3J A;  4RMA A;  2DYO A;  2AL3 A;  2IO0 B;  4EZL A;  2VRR B;  1I35 A;  4DK5 A;  1ZW7 A;  3RZW C;  4K7U A;  2LRU A;  1C1Y B;  2XK5 B;  2CR5 A;  1WJ6 A;  1IPG A;  3KW5 B;  3LJ3 A;  4FJY A;  4FUL A;  3KYC D;  4HK2 A;  4AJY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...