3D32A

Complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
b'GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Ligand Binding Mode of GABA(A) Receptor-Associated Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3d32A00
2KQ7A 2RD0A 3HK0A 3M95A 4MGZE 4BFRA 2N4FA 1J0GA 1WXAA 3APCA 3R7QA 3PRZA 5BO4B 5D2MB 1TTNA 2ZZPB 3RT3B 2L8JA 3ZLZA 3DBLI 3H1UA 2NBVB 2M0XA 4M8MA 2CHZA 4NJ6A 3A4SC 1OTRB 1WE6A 2LI5A 4BKSA 2HE7A 4FN2A 2K8CA 4HLEA 1LM8B 2ZCCA 3AI5A 4HJKA 2EKEC 4WJNA 3OAWA 1WGGA 4GU2A 1R4MI 3PHXB 3L10B 3ZNZB 2K1FA 2QHOA 1E7VA 2KWCA 4EKUA 5E6PA 3VTWA 5L95C 1P0RA 1XT9B 4IWQA 4BBNF 1KM7A 4EEWA 2LGXA 3R7RA 4W9HA 2MBOA 2MA9B 3CSFA 4N9F4 2DX5B 3QIJA 2DHZA 3PLUA 2ZJDA 2OOBB 2RPQA 5D94A 3QCAA 2K8HA 3DVNV 4PYZA 2HTHA 4MGYE 2RGFA 2KLCA 4MM3A 3B08A 1WMHA 2MP2A 2L76A 1Z5SB 4TQ1A 3UQBA 1LFDA 2KWVB 1TBEA 2ZEQA 2K6QA 3KW5B 1C1YB 3AXCA 2DENB 4OVVA 1GC6A 2ZCBA 2L3ZA 3Q3FA 3IVFA 3QC8B 1LQBA 1IP9A 3WIMA 4NAWB 4ANVA 4DXAB 3NZUA 4G50A 2CHWA 1U4AA 2KFJA 2KX0A 4W9GA 1UBQA 3DQVA 3PHWB 3UGBB 4AP4C 1EO6A 4B95A 3X23A 2W9NA 1GC7A 2KJRA 1WYWB 4WAAA 4ANXA 2ZVOA 4GN1A 4PYUA 2LJ5A 2NBWB 2NS5A 4HXDA 4ICUA 4LDTD 4W9JA 3IFWB 3PZDA 2KJ6A 2EMTA 2DAFA 4II3B 3DPDA 4HK2A 1YJ1A 2C7HA 1V86A 2K8BA 4JL9A 2LGDA 1E8XA 3NHEB 3KUZA 4XX5A 3QHTA 4HDQA 2AWTA 2IO2B 2JXXA 2ZVNA 4NQKE 3N30A 2MLBA 2KLGA 4DDID 2IBIB 4IM2A 3VDZA 4JGHB 2KO3A 2O6VD 3RZFA 5CTRC 2KDIA 4M8NA 2CS4A 2G45B 2BPSA 3NS8A 1YIWA 3RD2A 1E5WA 3T8MA 3VH4B 2JPHA 2VRRB 1XQQA 2NPTB 4HDOA 4BOSC 4YL8A 1D3ZA 2ZNVC 1I42A 2M8SA 2L00B 1WGDA 2OJRA 3NOBA 2DZJA 4F8CB 5GMVA 2FNJB 5G2NA 3VUWA 1WI0A 1WIAA 4MSMB 4MSQB 2IY1B 2V3SA 2K39A 2DAJA 4EZJA 1V80A 1GJZA 3PGEA 3VUYA 3OLMD 2FUHB 2C9WB 5J2RA 1EUVB 4DK5A 3RZWC 1ZGUB 2GBNA 3I3TB 4W9LA 4A3OA 1RAXA 3DVGX 3CF6E 4NJ7A 1V5OA 1RLFA 4DWFA 2KHWB 2D10A 3JSVA 4B9KA 3U8ZA 3SD5A 2WDTB 3R66C 4AJWA 1QZEA 1SIFA 2YVCA 2AL3A 2ZNVB 3KVFB 1YQBA 4W9KA 3UIPB 3NZSA 1I35A 1E7UA 3EECA 3DBSA 3ZNHB 2JRIB 5AZHA 1RRBA 5CX3A 3ZNID 2K25A 2JY6A 1CMXB 5CHVC 5J17A 4DBGA 2KMAA 3VXWA 4ZDVA 3ECIA 3LJ3A 2GMIC 2NPTA 1UZXB 3UINB 3B0AA 2XBBC 3JYUA 5JHBA 2JZ3B 2KXJA 3ZKJC 1A5RA 2UYZB 4M0WB 3EFUA 4RM9A 3L0WB 3IG3A 2DZIA 4BKTA 2M1MA 4FHKA 4HCNB 3PREA 1WE7A 2AL6A 2KVRA 2XEWA 3HHMA 1NDDA 3PV1A 2MBBB 1P9DU 1WXMA 4FHJA 3RUIB 3C0RB 4EZLA 3TJPA 2KX3A 3VAWA 4IWPA 4KV2A 2MBQA 1WJUA 2BKFA 2N1VA 1WX9A 2G4SA 2LGYA 2WX1A 3VVWB 4HVBA 3ZIMA 1WF9A 2NCNA 2BGFA 3IBEA 4DDGD 4GMVA 3H7PB 4KDIC 2KJHB 3MTNB 3PT2B 4RMAA 2JF5A 1OEYJ 4G3XB 5DCNA 2J7QB 4NNJB 1ISNA 1V6EA 4WJPA 2N7DA 1Q1OA 1WRDB 2IO0B 4W9EA 1WGYA 4FJVB 2BYVE 3CMMB 3R3MA 2XK5B 1TZ1A 3TL5A 2ASQA 4ANUA 5D6JB 5JH5C 2I1JA 3ZTDA 1UBIA 3PTFC 2KTFA 4TUUA 3H9DA 1E8ZA 3SHQA 1KLVA 3PRPB 2JWZA 4CO7A 2LRWA 2FCNA 5J18A 3KYDD 5AZGA 4KIKB 2N9EB 1YD8U 1WH3A 4KVGB 3SDLC 4ASWC 3KUDB 4LJOB 2NBUA 1VD2A 5E6NA 4FLHA 3PRMB 2KC1A 2FIFA 3LDZE 3ZTCA 4IM3A 4EUTA 2GBJA 2KDFB 1Z2MA 1UGMA 2M17A 4BKGA 2LWPA 1UH6A 4IM0A 4W9DA 4AOFA 3Q3JA 2J0MA 2JUOA 3DBHI 3B1LX 3HIZA 5IA7A 5KHQA 3N32A 4GDKB 2L7RA 2BYFA 4LDTB 1P1AA 3S2AA 3DDCB 2WYQA 4WWOA 2M4NA 2MSED 4GOCA 3L16A 3H7PA 2DYOA 2BWFA 5E6OA 1EF5A 1UD7A 2C5LC 5G55A 2JVCA 3EHVA 3TBLD 1V9JA 2CKHB 2IO1B 2LD9A 2WWZA 3PLVA 4HWIB 4JLCA 2LVQA 4KZ0A 4CHKA 2I1KA 2LASA 2N7EA 2O6VB 3DOWA 2BF8B 4ZRKA 3VTUA 2JT4B 4MH0E 4II2B 4MELA 1WR1A 1EF1A 2MCNB 4BBNC 2LRUA 2CHXA 1Y8RC 1WZ3A 2Z0EB 3APDA 4KSLC 2EMSA 3A33B 4NAWA 3AU5A 2DZMA 4W9FA 2K6DB 3KUCB 4KIKA 4HPLB 4IW0A 4J6IA 3VTVA 3ZRFA 4BKSD 4E3CA 2KANA 4I6PA 3UQAA 4MEMA 3JW0X 1G6JA 3RCZA 3QJZA 4IC7B 4DHJD 2CU1A 1KOTA 4A20A 4GSWA 3V6CB 2MBHA 2NVUI 3V6EB 3ZRCA 2GBKA 1WX7A 2BYEA 2HD5B 4CYEA 5LLIA 3ZVVA 1S1QB 3BINA 2Y5BB 2O2VB 4KSKC 4GDKA 4GIVA 2KD0A 1WXSA 3WA0A 2V4LA 2PPHA 3WAMA 3GOEA 2IZVB 1XD3B 3A9JB 2BWES 4ICVA 3VH3B 2GBMA 1SE9A 1ZKHA 2JRHA 2Z0DB 2KN5A 2GBRA 3A9KB 3DVNU 2KK8A 3ML8A 2MRPA 3CSTA 2D2QA 4G11A 4IUMB 1AARA 2N9XA 5DPWA 3DBRI 4I6NB 3QAQA 3MJWA 4A3PA 2O6VA 2KC2A 1SGHA 1WJ6A 4KZCA 2G3QB 2R2OA 1WXVA 2KDBA 2L05A 4IG7B 4FADA 2MWSB 3OJ3A 3P2BA 4HCPB 5IAAC 4DHZE 3K9PB 3W1SC 3NY5A 1V5TA 2DYMA 4W9IA 4IWOA 2MW5A 3QX1A 5TR5A 1OEYA 1WZ0A 1J19A 2AEHA 1P3QU 4PS3A 4XZ4A 4LJPB 5DPTA 2JZZA 3HM6X 3KH0A 4MGKE 1V2YA 3RYTA 1RFAA 5JHAA 1C3TA 4KDLB 4MDKE 1M94A 2WX0A 1WFYA 2MX2A 3JVZX 2AYOB 2LVPA 3UF8A 3DCGA 2KKCA 3IHPC 2FAZA 2Z59B 4NQLB 2C60A 1T0YA 2MBEA 4GXBA 4EOYA 2ZPNA 3VHTC 2A5UA 1Q0WB 2O2VA 1WGRA 3W1YA 1NBFC 4FA6A 2KTRB 1YX6B 1HE8A 4PS8A 2LUEA 3WALA 1V81A 4K7UA 2IO3B 3EC8A 3T9LA 1E8WA 4E71A 3A9JA 3U30A 3GZNI 3TCAA 1L2NA 2REXA 4AUQC 2LVOA 2V1YA 5D7GA 4FULA 4X57B 3A9KA 5AZFA 1PQSA 2KDEB 4JQWC 1WM3A 3ZUNA 3APFA 1J8CA 3V62A 2CR5A 4TQ0A 1K8RB 2PE6B 2D11A 3VFKA 2C7NB 3N3KB 2KWUB 3RULA 1FXTB 4F7ZA 3AULA 3UIOB 4F1SA 4ZRJA 4I6LB 1TGZB 4G0NB 2L0TA 4ANWA 1YX5B 1NI2A 3TMPB 4MJSB 2D07B 4WQOB 4HPMB 3QQ8B 5EDSA 5C23A 3L08A 3PSEB 4ZRIA 4LCDE 2YLMA 1Q5WB 4K1RB 1LXDA 4GGQA 2KFKB 5JZEB 2RSUA 2A4ZA 3H6NA 1BT0A 3ALBA 5KHOA 3AU4A 2J0KA 4WJOA 1S3SG 1UELA 3VQIA 4BOZB 5CHFA 4EZKA 5LXHA 3L17A 2C7MB 3DVGY 4P7IA 3X0WA 2LXCA 2L0FA 4DHZB 4K7SA 3A4RA 2KTRA 3WAOA 3WAPA 3L54A 4AJYB 2B3AA 4BVUC 1F9JA 3QK0A 2RR9A 5DPRA 3ZW3A 2PE9A 4AWJA 3ENEA 2KZRA 3K9OB 4GDLB 5L83A 2XK5A 3JSVB 4NPNA 1VCBA 1WM2A 2KNBA 3U7DA 3W1SA 3WANA 3ZDTA 5LXIB 2DYBA 2LXAA 2NR2A 2J0JA 3MHSD 4OVUA 3A1QB 4K7WA 2MQJA 3O65B 1X1MA 4B6WA 1KJTA 4EFOA 4TV3A 2FIDA 2DZKA 4FJZA 2N1WA 2UWQA 2D3GA 2FCQA 3VUXA 3QWZB 4WWNA 1MG8A 3H7SA 5HKHA 1V49A 3ZO5B 5DPSA 3V61A 1IPGA 4MJSA 2IY0B 1GG3A 2GOWA 3M63B 4NY0A 1GNUA 3V60A 3ONSA 1IYFA 4JIOU 2FCSA 4PS7A 5CHWA 3ZDMC 3PS6A 4DHJB 1OQYA 2KFKA 2LZ6A 3M3JA 2PEAA 3KYCD 3M62B 3ML9A 1E90A 3D32A 3TIXA 3BY4B 4XC2A 4K81A 1OGWA 1WR6E 4MGIE 4W9CA 4URKA 2BKRB 4TKNA 1ZW7A 2HJ8A 1H4RA 4WWPA 1WJ4A 1WX8A 3QARA 2IYDB 5C1ZA 1R4NI 1GUAB 1WJNA 2ZPYA 2KQSA 4GDLA 4FJYA 2R2QA 2PJHA 1L7YA 2N9PC 4GB9A 4FBJB 1H8CA 3ZNGC 1E8YA 3PVLA 2KOXA 3QA8A 4RM8A 5AEKB 1WMHB 1WY8A 2MP2B 1P98A 4E74A 2G4DB 1JRUA 3A1QA 3HM3A 3L13A 3OJ4B 3PPAA 5FR6A 3SU8X 4WJQA 2FCMA 2KMCA 4ZYNA 1WGHA
chains in the Genus database with same CATH superfamily
3HK0A 4BFRA 2PW9A 4HJGE 5BO4B 3ZLZA 2L8JA 1L5PA 4M8MA 4NJ6A 3A4SC 3AI5A 1L6UA 1R4MI 3L10B 4US8A 1LO5D 2K1FA 1TYGB 3ZNZB 3Q3NC 4EKUA 1SJED 1T0SC 3EUB2 5E6PA 1P0RA 1RYJA 3RNCC 1DOYA 2LGXA 2Y3AA 3R7RA 2MBOA 2QJLA 4N9F4 4C56C 2GI9A 1UF0A 3PLUA 1N5XA 4IOIE 5D94A 2K9XA 1ZDXA 2N7JA 2LMCA 3C8YA 4MGYE 4LTUA 3B08A 1F77A 2EELA 2ZW1A 1LFDA 2KWVB 3UQBA 1TBEA 2JXTA 1YN5A 2WDRB 1C1YB 4WQMA 2PMVA 4OVVA 3U2SC 3AB5A 5D3DA 1CJEA 1IP9A 3WIMA 1DYQA 4ANVA 1GB1A 3BK2A 2FBWB 1TKEA 4AP4C 4B95A 1WYWB 4ANXA 2ZVOA 2LJ5A 4W9JA 3IFWB 1YNTE 2KJ6A 3AV8A 1E6EB 5IKCM 3DPDA 4YSYB 2C7HA 4XGAB 2LGDA 1TS2A 3NHEB 2J42A 3QHTA 2IO2B 4ZHOA 1I4XA 1IGDA 4C4VA 3N30A 4ZHPA 2MLBA 4JGHB 2KDIA 4ITKA 4M8NA 2G45B 1YIWA 3RD2A 2QMTA 1E5WA 3T8MA 3N1ZC 1XQQA 2NPTB 3AEDB 3NOBA 2DZJA 2RDHA 2IGDA 2R61A 1R7SA 2EKIA 2FNJB 3AE4B 2BVCA 2K39A 5EE9A 1V80A 3AECB 2WXMA 2LFIA 1K53A 1QT9A 1N6ZA 1BUIC 2GBNA 1L4DB 4A3OA 2LJIA 3GP7A 4YWGG 1RLFA 1TY2A 3SD5A 1MHHE 2KN4A 2ZW0A 1I35A 2KVZA 1FNWA 1KLGD 3ZNHB 1RRBA 1CMXB 4DBGA 2KMAA 1V1PA 2GMIC 1MJDA 3KLSX 1TS5A 2KXJA 4M0WB 1ZOYB 5EE1A 4FHKA 2BQQA 2DBYA 2IGGA 1WXMA 4FHJA 1EU3A 1WWTA 2MBQA 2H89B 2I2YA 1VZ8A 1QQRA 2JZPA 4GMVA 1F2RI 3RI7C 3E56A 2J53A 1HTQA 3PT2B 4HROA 1OEYJ 5DCNA 1UGJA 4H2AA 1V6EA 4W9EA 1WGYA 4FJVB 3R3MA 4P6VF 1P7FA 2KT7A 5JH5C 3N9YC 1UBIA 2INCC 4TUUA 4CO7A 2LRWA 4USAA 5AZGA 1WH3A 1E7PB 3GE8C 5E6NA 2JX5A 3PRMB 1TT5B 1N63A 1VRAB 2B76B 2GBJA 1EU4A 2WU5B 3Q8AA 2JUOA 3DBHI 5IA7A 5IN7A 5EE0A 2L7RA 1D6EC 1P1AA 2M4NA 2MSED 2WLBA 3MC9A 3BYTB 3H7PA 1FO4A 4HPPA 1D5ZC 3LXFA 5E6OA 2M56B 1EF5A 2C5LC 2TSSA 2CJNA 2LD9A 4HWIB 3Q3MC 2HJ1A 4KZ0A 2LASA 2ACZB 3VTUA 1SE2A 4MH0E 1Y8RC 2Z0EB 2M0AA 3A33B 1C78A 1JRPA 3AU5A 5EE3A 3KUCB 4KIKA 4TMAB 4E3CA 4I6PA 1FCLA 3AE1B 4A20A 3V6CB 5H92C 2GBKA 2HD5B 4CYEA 5LLIA 3ZVVA 3ZQ4A 4GIVA 1WXSA 3GS2A 2V4LA 2W3RA 3GOEA 3A9JB 2BWES 2DLBA 2Z0DB 2XNAC 4I6NB 3FILB 3MJWA 1MG4A 2O6VA 5MPOA 1SGHA 1PFDA 1AW7A 1WXVA 2KDBA 2L05A 3EA6A 4IG7B 2WXHA 3Q3OC 1XLPA 3HUIA 4DHZE 1I7HA 5IAAC 3W1SC 1XCQL 2DYMA 3ZGZA 2AEHA 1P3QU 3VR9B 5DPTA 3HM6X 2JYEA 4OW0A 4MDKE 1FRDA 1M94A 2AYOB 2LVPA 2FAZA 4RNAA 4GXBA 4NZLB 4LNFA 1A70A 1QOFA 3VHTC 2A5UA 1PGBA 2KTRB 3WALA 1JQ4A 2IO3B 3T9LA 4E71A 3HVZA 2D3BA 4MACA 1VLBA 5AZFA 3AMZA 1WM3A 3ZUNA 1J8CA 3N3KB 5TSSA 5BYRA 4I6LB 1TGZB 4RGMA 2JU6X 1ZP0B 2D07B 2V4IB 1VR9A 5H8YE 4HPMB 5EDSA 3L08A 3NUHB 1I4QA 4K1RB 1LXDA 1EWCA 2RMMA 5AUKA 4WJOA 1RWSA 3O13A 1UWXA 1ROEA 3L17A 4O1NA 4HRSA 4K7SA 3WAOA 3L54A 4JWSC 1F9JA 3W2DA 3JSVB 3WANA 1VCBA 2N9LA 2J0JA 4OVUA 4B0EA 4ZYSA 2SEBD 4US9A 3I9V1 3O65B 1YQ4B 2FIDA 4FJZA 2D3GA 3VUXA 3MP9A 1C4PA 1AWDA 5DPSA 3V61A 3DBRB 2WP9B 4MJSA 2IY0B 2QDFA 1GNUA 3KQ4A 4GLSC 3PS6A 1OQYA 1J7BA 2KFKA 2LZ6A 4R3DA 3TIXA 3BIID 3Q14C 2WXRA 4URKA 1YJJA 4W9CA 4RGOS 2Z8LA 3ZJVA 1WJNA 4GB9A 2N9PC 5HFYA 4BZAA 5AEKB 4L1BA 3L13A 3PPAA 3A1QA 5FR6A 3OJ4B 4C7ZA 1C77A 2KQ7A 3R7QA 4M00A 3PRZA 5D2MB 1TTNA 2ZZPB 3H1UA 2D3CA 1WE6A 4BKSA 2K8CA 2ZCCA 4HJKA 2MEKA 4PK1A 3OAWA 1QKZA 4DXGA 4GU2A 1FXAA 1E7VA 5IOIA 3TUOA 1P7EA 1KM7A 5BYQA 4EEWA 1WGKA 4W9HA 3AEGB 3H8HA 3I57A 1KFYB 2K5PA 4C4VB 4PYZA 2HTHA 3RNBC 2KLCA 3FKYA 2L76A 1Z5SB 2BYTA 2DENB 1GC6A 2BT6A 3TSSA 3IVFA 1LQBA 5C2TB 4DXAB 3NZUA 1V8CA 4OVZA 4W9GA 1D5XC 2L1AA 3UGBB 1QOGA 2NMQA 1I4PA 4WAAA 4PYUA 2NS5A 4HXDA 3R2IA 3PZDA 2VH2A 2DAFA 2YEPF 4RCOA 4II3B 4K3CA 4B0MA 1TKGA 2K22A 1V86A 4JL9A 4XX5A 4WH4A 1MPEA 2N0SB 2KO3A 1JMLA 1FXIA 3RZFA 5CTRC 3ZJTA 2CS4A 2BPSA 2DWQA 3C19A 1RM6C 2ON8A 4LNKA 3AE2B 1V1PB 3ZXRA 2MH7A 4BOSC 3RN9C 1I42A 2M8SA 2L00B 4XWTA 4A8XC 1ET6A 4MSQB 2V3SA 3P4PB 2J4XA 4YSXB 2V0GA 5J2RA 2WXPA 3N1XC 1ZGUB 2W3SA 1FD6A 1VJKA 1RAXA 2WXOA 4NJ7A 1R4MB 4DWFA 2KHWB 3JSVA 3U8ZA 2WDTB 3J9CA 3R66C 3V3XA 4AJWA 2YVCA 2ZNVB 4W9KA 3NZSA 1HA5A 3DBSA 1QLBB 5AZHA 1BXTA 3BK1A 2JY6A 5J17A 3ECIA 5BMGA 3UINB 3B0AA 4ZRQA 2UYZB 4RM9A 1SE4A 2DZIA 3IAM1 4IDIA 1ZUD2 2AL6A 2KVRA 1AN8A 1E9MA 1P9DU 4YTNB 2LHEA 3C0RB 3TJPA 3VAWA 4N59A 1WJUA 2G4SA 1NENB 2LGYA 1TKYA 3ZIMA 1WF9A 3B2GA 2BGFA 3H7PB 4KDIC 1N5WA 1OQRA 2V9HA 2J7QB 2CU3A 1FCCC 1Q1OA 1WRDB 1KF6B 3AE6B 1TZ1A 3TL5A 4ANUA 2I1JA 1OQQA 2LHDA 3PRPB 2JWZA 3U7ZA 4KIKB 2N9EB 4FLHA 3T3OA 3KWLA 4IM3A 2KDFB 1Z2MA 4BKGA 4AOFA 2Y5CA 1QOAA 1F52A 3S2AA 3DDCB 2MJ3A 4GOCA 2LEKA 5G55A 2JVCA 3EHVA 1V9JA 3RNFC 3PLVA 3RNGC 1PGXA 3W5UB 2I1KA 2O6VB 4OHJA 2BF8B 3AEEB 5HI1A 3WCQA 2JT4B 4BBNC 4LK0M 2LRUA 4KSLC 2WDQB 3U4EG 2KDMA 4HPLB 4IW0A 3ZRFA 1F1HA 4HKQA 2Q5WD 4MEMA 3JW0X 3QJZA 1GOZA 1KOTA 4JPSA 2MBHA 2NVUI 3ZRCA 4LNNA 3BINA 4GDKA 1VZ6A 2KD0A 4JX1C 3WA0A 4A90A 4ICVA 1NI3A 4ARIA 4DQOC 2JRHA 2GBRA 4LLGM 3I5JC 2OJWA 2D2QA 3AEAB 1N60A 3AE9B 5DPWA 1C79A 4ZRPA 4A3PA 2WXIA 2KC2A 3IT6B 1STEA 2G1EA 1MHXA 1YQ3B 4RFBA 3NY5A 2IPKD 3QX1A 4PS3A 2JZZA 2WXQA 1V2YA 2MJDA 4KDLB 1NEKB 1NVID 1ZDVA 3IHPC 4EOYA 2MBEA 3BVGA 1PUTA 3Q8FA 4AQ7A 1WGRA 3IXSA 4FA6A 1HE8A 2LUEA 4K7UA 3EC8A 1L4ZB 3U30A 3GZNI 2REXA 3DBHB 2LVOA 3BZDB 2LGSA 3A9KA 2KDEB 1D4BA 2WXJA 3APFA 2M19A 4KKJA 3V62A 2QSDA 4F7ZA 1FXTB 2INNE 4ANWA 4YXDB 3W5VB 1YX5B 1NI2A 3GE3C 4MJSB 4WQOB 3QQ8B 3T3NA 5C23A 2IGHA 2KFKB 1L0XB 2A4ZA 3H6NA 2LUMA 3VQIA 3ABVB 2L32A 2QEJC 4P16A 1WSPA 2KYWA 1NYQA 5JXVA 2IJ0A 4IKGA 3WAPA 4AJYB 4BVUC 3QK0A 2RR9A 4AWJA 2KZRA 3K9OB 1CZPA 3W1SA 1WM2A 2KNBA 2WXNA 3U7DA 1I4RA 2LXAA 3A1QB 3P4QB 4B6WA 4TV3A 3AEFB 3QWZB 4WWNA 3H7SA 3VRAB 5HKHA 3ZO5B 2Y5PA 4NY0A 3V60A 4ARCA 2FCSA 5IO9A 1HTOA 2INPE 2PEAA 3ML9A 1XXGA 2OHFA 4XC2A 3CIRB 1FFUA 2HJ8A 1FRRA 1H4RA 1WX8A 2W55A 2BS3B 4KGSA 4DXFA 4C80A 1GB4A 1R4NI 2BB5A 2ZPYA 2KQSA 2R2QA 2PJHA 2KOXA 4RM8A 5FKAC 4E74A 1JRUA 3HM3A 4A9AA 3SU8X 2VZKB 4WJQA 1FM0D 2KMCA 1K50A 4MGZE 2N4FA 3APCA 2MHJA 1WRIA 3RT3B 3DBLI 2CHZA 1OTRB 1JWMD 5I4DA 2HE7A 1C4CA 1SXTA 1WGGA 1SE3A 3VTWA 3HVDA 4BBNF 5BMHA 2QC8A 3U52E 2MA9B 3CSFA 4N58A 3DHIC 2ZJDA 2OOBB 2RPQA 2BTEA 1V1OA 2I38A 2K8HA 3DVNV 3RNAC 2WHIA 1T0QC 2RGFA 1ZE3D 4MM3A 1WMHA 1N62A 1WXQA 1HXYD 3KW5B 3AXCA 2L83A 3QC8B 2FE8A 2X38A 2AQ1B 3NG0A 4G50A 1U4AA 2KFJA 4YTPB 3DQVA 1FNUA 1YN4A 1XO3A 3PHWB 3X23A 1I4HA 1YJIA 4OZAA 4S17A 3LB8C 3BWUD 2NTTA 3SEBA 3EGRA 1HQRD 4KGRA 1YJ1A 2K8BA 3Q8EA 3KUZA 3ZYYX 4HDQA 2JXXA 1SEBD 2KQ4X 2KLGA 2IBIB 2O6VD 2X8XX 2WS3B 3NS8A 4HEA1 1MFWA 2K0PA 5AUIA 4YSZB 1ZXHA 5D3IB 4HDOA 4YL8A 1D3ZA 1ESFA 2OJRA 4WIPA 5GMVA 3P4RB 5G2NA 4LNIA 4MSMB 4EZJA 4A6QA 3MC8A 3DWMA 2FUHB 4C00A 1EUVB 3RZWC 4NJCA 3HRDD 2D10A 1XLOA 2W82A 3NRZA 2QIEB 4XYCA 2QCZA 3UIPB 3P1MA 2UU7A 1XEEA 3EECA 3ZNID 3NS1A 2PVOD 4ZDVA 1XF5L 1JWUD 3LJ3A 1UZXB 5JHBA 2XBBC 1A5RA 2WXKA 3L0WB 2WQYB 4BKTA 4YT0B 1Y56A 1WE7A 2XEWA 3HHMA 1B1ZA 4MH8A 2MBBB 4D2KA 1JWAD 4EZLA 4KV2A 2BKFA 2N1VA 1WX9A 2WX1A 3VVWB 1ZPSA 3IBEA 4DDGD 1BMLC 4RGTA 2V3PA 2ICIA 2XN9C 2KJHB 4RMAA 2G9HD 4RH6A 4YTMB 2FUG1 2WXLA 3B9JA 3NJTA 1KH0A 2IO0B 1T6BX 1KLUD 3CMMB 2XK5B 2ASQA 3SFDB 1IUEA 1JW9D 3PTFC 3SHQA 3H9DA 1E8ZA 3R8BA 2FCNA 5J18A 4NAMA 3KYDD 3SDLC 1YD8U 4KVGB 3KUDB 1VD2A 3E9SA 3AM9A 2KC1A 2KACA 2FIFA 3LDZE 2GB1A 2KMMA 2LWPA 4IM0A 4W9DA 3Q3JA 3B1LX 3N32A 4GDKB 2BYFA 4A55A 4LDTB 5FR3A 4WWOA 4XWWA 1J7AA 3L16A 4UDUC 2BS2B 1D5MC 1YMHE 1UD7A 4FXCA 1TIFA 2IO1B 2LVQA 2VH1A 3DWGC 3ZXVA 3DOWA 4ZRKA 4MELA 1EF1A 1WZ3A 3APDA 2DZMA 4W9FA 2K6DB 4J6IA 3VTVA 1PGAA 4BKSD 2KANA 3UQAA 4IC7B 3IAS1 4GSWA 5HHDG 4C7YA 3V6EB 1FNVA 1WX7A 1IGCA 3R2TA 1S1QB 1DOXA 1XLNA 4CQNA 3WAMA 1XD3B 3VH3B 3AEBB 2GBMA 1SE9A 1ZKHA 3MHZA 4KKIA 3A9KB 2KK8A 3ML8A 2MRPA 1AARA 2N9XA 1IBXA 3QAQA 5T8IA 3AE3B 1WJ6A 2VZKD 2G3QB 4KZCA 2BB6A 4FADA 3OJ3A 3P2BA 2AQ3B 4HCPB 3K9PB 4W9IA 1MI0A 4IWOA 3DHGC 1OEYA 1QOBA 1J19A 1WZ0A 3TEZA 3RYTA 5JHAA 3KH0A 1RFAA 1UWMA 4RGNA 2MX2A 3DCGA 2Z59B 1C76A 2C60A 4K3BA 3BYYB 2O2VA 2AQ2B 3FAHA 1YOVB 3TCAA 2JWUA 3NVZA 1CQVA 4FULA 3MC0B 4X57B 2IDYA 2YEPB 4JQWC 1K8RB 3VFKA 1EWYC 2D11A 4QAYA 1TS3A 3TEXA 3AULA 4F1SA 2L52A 4G0NB 2L0TA 5LNK1 3MFGA 1FIQA 3Q8BA 3PSEB 3OWEB 3N1YC 2YLMA 4LCDE 1GPXA 4GGQA 2RSUA 1BT0A 3ALBA 5KHOA 2J0KA 2INDC 1S3SG 1UELA 4BOZB 3IT4B 2KAJA 4P7IA 3X0WA 2LXCA 1SSNA 3A4RA 3KWVA 1K52A 4REZA 3ZW3A 5DPRA 2PE9A 1FFVA 4RF1A 5L83A 2XK5A 4NPNA 1ENFA 3TEYA 2E3TA 3N20C 2LGIA 1KJTA 2N1WA 2FCQA 1V49A 1XCTL 1IPGA 4JWUC 1GG3A 1JROA 3ONSA 1IYFA 4JIOU 5CHWA 4DHJB 3M3JA 3M62B 1E90A 3D32A 1T3QA 1VDVA 4AS1A 1WR6E 2BKRB 4TKNA 1ZW7A 3NVWA 4WWPA 5C1ZA 4PT5A 1GUAB 1L0VB 4GDLA 4FJYA 2GRIA 1H8CA 1E8YA 3PVLA 3QA8A 4MM3B 1WMHB 2PKOA 1P98A 3GZNB 1SF0A 3OG5A 4NQLB 2RD0A 3M95A 1J0GA 1WXAA 4XDDA 2NBVB 2M0XA 1L0YB 1C4AA 1I4GA 2LI5A 1K51A 4HLEA 4FN2A 2KWDA 1LM8B 4WJNA 2EKEC 4JE3B 2DNFA 3BVMA 3PHXB 2QHOA 2KWCA 5G5GA 5L95C 1XT9B 4IWQA 3SFEB 4M02A 3LYYA 1PYWD 2DX5B 3QIJA 2DHZA 3QCAA 2D3AA 1YN3A 2E6XA 2MP2A 4TQ1A 2ZEQA 3RNEC 2K6QA 3FC4A 3I63C 1F0ZA 2ZCBA 2L3ZA 3Q3FA 1FEHA 3CWIA 4NAWB 1XLQA 2CHWA 2KX0A 1UBQA 4WURA 3P42A 1EO6A 3Q2AC 4XDCA 1AYFA 2N9KA 4J3OD 2W9NA 4Q2JA 1GC7A 2KJRA 4GN1A 4BAXA 4ICUA 2NBWB 4LDTD 2EMTA 4RF0A 2GLSA 4HK2A 2JYTA 1E8XA 2AWTA 2ZVNA 4NQKE 2WXFA 1HZ6A 1J7CA 4DDID 4IM2A 3VDZA 3AH7A 2RPVA 1R4NB 3AE7B 1VZ7A 1ET9A 3VH4B 2JPHA 2VRRB 2WU2B 2ZNVC 4TSSA 1CK1A 2PIAA 4F8CB 1WGDA 5GXGB 3VUWA 1V97A 1WI0A 1WIAA 2IY1B 2DAJA 1GJZA 3PGEA 3VUYA 5G5HA 3OLMD 3DBLB 1LGRA 4N6EB 2C9WB 5HG2A 4DK5A 3BVZA 3RFZB 4W9LA 3I3TB 4KX6B 3DVGX 2H88B 3CF6E 1DOIA 1FMAD 1V5OA 4B9KA 3AN1A 4LNOA 1PDXA 1QZEA 1SIFA 4OZBA 2AL3A 3KVFB 2V3NA 1YQBA 3GB1A 2PVGC 1ACCA 2OEDA 1E7UA 3URYA 1MVKA 2JRIB 5CX3A 2K25A 3NZ3A 5CHVC 3VXWA 1GAQB 2NPTA 3JYUA 2JZ3B 3ZKJC 3EFUA 3IG3A 3VR8B 2M1MA 3ETRA 4HCNB 3PREA 1NDDA 3PV1A 3RUIB 2KX3A 4IWPA 3AE8B 3V05A 1JALA 4HVBA 2NCNA 2BW2A 1TS4A 1UUPA 4M01A 3MTNB 2JQRB 2JF5A 2WDVB 1KRHA 4G3XB 4NNJB 1ISNA 3Q6BA 4WJPA 2N7DA 3Q69A 1SJHD 2BYVE 1SIJA 5D6JB 3ZTDA 2KTFA 1KLVA 1E10A 3MJ5A 4ASWC 2MJEA 4LJOB 2NBUA 4M0WA 1HZ5A 4OZCA 3ZTCA 4EUTA 1EM7A 1UGMA 2M17A 1UH6A 2J0MA 5BYSA 1UNSA 3HIZA 5KHQA 5BMIA 5C3JB 2WYQA 2DYOA 2BWFA 4P1BC 3TBLD 3Q8CA 2CKHB 2WWZA 4JLCA 1L6VA 1IBXB 4CHKA 2N7EA 2RDBC 2CJOA 4II2B 1WR1A 2MCNB 3B2FA 2CHXA 3ZJUA 2EMSA 4NAWA 4HKZE 1F2RC 1E0ZA 1G6JA 4S0RA 3RCZA 2BS4B 2WGSA 4DHJD 2CU1A 2W54A 4L2YA 2K3UA 3RMKC 2BYEA 2PLPA 2Y5BB 2O2VB 4KSKC 2PPHA 2IZVB 1B9RA 2RDGA 2NTSA 3P63A 2KN5A 1QF6A 2JSVX 3DVNU 3CSTA 1RFKA 2ONQA 4G11A 4IUMB 5IP4D 3DBRI 4XE0A 1SB3C 2PTLA 2R2OA 1WYGA 4MT5A 2MWSB 2WNMA 1V5TA 2MW5A 5TR5A 1TY0A 4XZ4A 4LJPB 4MGKE 1Q10A 2QILA 1C3TA 2WX0A 1WFYA 1TZOA 3JVZX 3VRBB 3UF8A 1DGJA 1M4VA 2KKCA 1T0YA 2ZPNA 3UI3A 1Q0WB 3W1YA 1NBFC 1YX6B 4PS8A 1V81A 1E8WA 3A9JA 2SAKA 1L2NA 4AUQC 4KGTA 2V1YA 1T5XD 5D7GA 1SBBB 4EE2A 1PQSA 3P4SB 3NVVA 2AX5A 2CR5A 4TQ0A 2PE6B 2C7NB 2KWUB 1JCKB 3FILA 3RULA 3UIOB 4ZRJA 4ACFA 3PZ7A 2HDEA 1TJEA 4WWMA 3TEWA 3TMPB 4P1CC 1QILA 4ZRIA 1HEZE 2D5GA 1Q5WB 1FPYA 5JZEB 3DHHC 3AU4A 1ZXIA 5CHFA 4EZKA 5LXHA 2C7MB 3DVGY 2L0FA 4DHZB 2KTRA 1OFFA 2B3AA 3PZ8A 3EFCA 3ENEA 4GDLB 2HTME 3ZDTA 4ZOHC 5LXIB 2DYBA 2NR2A 3MHSD 4K7WA 2MQJA 1X1MA 4EFOA 2DZKA 2UWQA 1MG8A 1NYRA 2GOWA 3M63B 5E6JA 1T0RC 3RPFC 1JWSD 4PS7A 3ZDMC 3PO0A 3W9CB 3SR6A 3KYCD 3BY4B 4K81A 1OGWA 4MGIE 1KTKA 4WAFA 1N61A 3L4PA 4L23A 1WJ4A 3QARA 2IYDB 3AE5B 4FBJB 1L7YA 3ZNGC 1WY8A 2BBCA 2MP2B 2G4DB 1C9FA 5FK9C 3NVYA 2J52A 2FCMA 4ZYNA 1JWBD 2WXGA 1WGHA
chains in the Genus database with same CATH topology
2KQ7A 2RD0A 3HK0A 3M95A 4MGZE 4BFRA 2N4FA 1J0GA 1WXAA 3APCA 3R7QA 3PRZA 5BO4B 5D2MB 1TTNA 2ZZPB 3RT3B 2L8JA 3ZLZA 3DBLI 3H1UA 2NBVB 2M0XA 4M8MA 2CHZA 4NJ6A 3A4SC 1OTRB 1WE6A 2LI5A 4BKSA 2HE7A 4FN2A 2K8CA 4HLEA 1LM8B 2ZCCA 3AI5A 4HJKA 2EKEC 4WJNA 3OAWA 1WGGA 4GU2A 1R4MI 3PHXB 3L10B 3ZNZB 2K1FA 2QHOA 1E7VA 2KWCA 4EKUA 5E6PA 3VTWA 5L95C 1P0RA 1XT9B 4IWQA 4BBNF 1KM7A 4EEWA 2LGXA 3R7RA 4W9HA 2MBOA 2MA9B 3CSFA 4N9F4 2DX5B 3QIJA 2DHZA 3PLUA 2ZJDA 2OOBB 2RPQA 5D94A 3QCAA 2K8HA 3DVNV 4PYZA 2HTHA 4MGYE 2RGFA 2KLCA 4MM3A 3B08A 1WMHA 2MP2A 2L76A 1Z5SB 4TQ1A 3UQBA 1LFDA 2KWVB 1TBEA 2ZEQA 2K6QA 3KW5B 1C1YB 3AXCA 2DENB 4OVVA 1GC6A 2ZCBA 2L3ZA 3Q3FA 3IVFA 3QC8B 1LQBA 1IP9A 3WIMA 4NAWB 4ANVA 4DXAB 3NZUA 4G50A 2CHWA 1U4AA 2KFJA 2KX0A 4W9GA 1UBQA 3DQVA 3PHWB 3UGBB 4AP4C 1EO6A 4B95A 3X23A 2W9NA 1GC7A 2KJRA 1WYWB 4WAAA 4ANXA 2ZVOA 4GN1A 4PYUA 2LJ5A 2NBWB 2NS5A 4HXDA 4ICUA 4LDTD 4W9JA 3IFWB 3PZDA 2KJ6A 2EMTA 2DAFA 4II3B 3DPDA 4HK2A 1YJ1A 2C7HA 1V86A 2K8BA 4JL9A 2LGDA 1E8XA 3NHEB 3KUZA 4XX5A 3QHTA 4HDQA 2AWTA 2IO2B 2JXXA 2ZVNA 4NQKE 3N30A 2MLBA 2KLGA 4DDID 2IBIB 4IM2A 3VDZA 4JGHB 2KO3A 2O6VD 3RZFA 5CTRC 2KDIA 4M8NA 2CS4A 2G45B 2BPSA 3NS8A 1YIWA 3RD2A 1E5WA 3T8MA 3VH4B 2JPHA 2VRRB 1XQQA 2NPTB 4HDOA 4BOSC 4YL8A 1D3ZA 2ZNVC 1I42A 2M8SA 2L00B 1WGDA 2OJRA 3NOBA 2DZJA 4F8CB 5GMVA 2FNJB 5G2NA 3VUWA 1WI0A 1WIAA 4MSMB 4MSQB 2IY1B 2V3SA 2K39A 2DAJA 4EZJA 1V80A 1GJZA 3PGEA 3VUYA 3OLMD 2FUHB 2C9WB 5J2RA 1EUVB 4DK5A 3RZWC 1ZGUB 2GBNA 3I3TB 4W9LA 4A3OA 1RAXA 3DVGX 3CF6E 4NJ7A 1V5OA 1RLFA 4DWFA 2KHWB 2D10A 3JSVA 4B9KA 3U8ZA 3SD5A 2WDTB 3R66C 4AJWA 1QZEA 1SIFA 2YVCA 2AL3A 2ZNVB 3KVFB 1YQBA 4W9KA 3UIPB 3NZSA 1I35A 1E7UA 3EECA 3DBSA 3ZNHB 2JRIB 5AZHA 1RRBA 5CX3A 3ZNID 2K25A 2JY6A 1CMXB 5CHVC 5J17A 4DBGA 2KMAA 3VXWA 4ZDVA 3ECIA 3LJ3A 2GMIC 2NPTA 1UZXB 3UINB 3B0AA 2XBBC 3JYUA 5JHBA 2JZ3B 2KXJA 3ZKJC 1A5RA 2UYZB 4M0WB 3EFUA 4RM9A 3L0WB 3IG3A 2DZIA 4BKTA 2M1MA 4FHKA 4HCNB 3PREA 1WE7A 2AL6A 2KVRA 2XEWA 3HHMA 1NDDA 3PV1A 2MBBB 1P9DU 1WXMA 4FHJA 3RUIB 3C0RB 4EZLA 3TJPA 2KX3A 3VAWA 4IWPA 4KV2A 2MBQA 1WJUA 2BKFA 2N1VA 1WX9A 2G4SA 2LGYA 2WX1A 3VVWB 4HVBA 3ZIMA 1WF9A 2NCNA 2BGFA 3IBEA 4DDGD 4GMVA 3H7PB 4KDIC 2KJHB 3MTNB 3PT2B 4RMAA 2JF5A 1OEYJ 4G3XB 5DCNA 2J7QB 4NNJB 1ISNA 1V6EA 4WJPA 2N7DA 1Q1OA 1WRDB 2IO0B 4W9EA 1WGYA 4FJVB 2BYVE 3CMMB 3R3MA 2XK5B 1TZ1A 3TL5A 2ASQA 4ANUA 5D6JB 5JH5C 2I1JA 3ZTDA 1UBIA 3PTFC 2KTFA 4TUUA 3H9DA 1E8ZA 3SHQA 1KLVA 3PRPB 2JWZA 4CO7A 2LRWA 2FCNA 5J18A 3KYDD 5AZGA 4KIKB 2N9EB 1YD8U 1WH3A 4KVGB 3SDLC 4ASWC 3KUDB 4LJOB 2NBUA 1VD2A 5E6NA 4FLHA 3PRMB 2KC1A 2FIFA 3LDZE 3ZTCA 4IM3A 4EUTA 2GBJA 2KDFB 1Z2MA 1UGMA 2M17A 4BKGA 2LWPA 1UH6A 4IM0A 4W9DA 4AOFA 3Q3JA 2J0MA 2JUOA 3DBHI 3B1LX 3HIZA 5IA7A 5KHQA 3N32A 4GDKB 2L7RA 2BYFA 4LDTB 1P1AA 3S2AA 3DDCB 2WYQA 4WWOA 2M4NA 2MSED 4GOCA 3L16A 3H7PA 2DYOA 2BWFA 5E6OA 1EF5A 1UD7A 2C5LC 5G55A 2JVCA 3EHVA 3TBLD 1V9JA 2CKHB 2IO1B 2LD9A 2WWZA 3PLVA 4HWIB 4JLCA 2LVQA 4KZ0A 4CHKA 2I1KA 2LASA 2N7EA 2O6VB 3DOWA 2BF8B 4ZRKA 3VTUA 2JT4B 4MH0E 4II2B 4MELA 1WR1A 1EF1A 2MCNB 4BBNC 2LRUA 2CHXA 1Y8RC 1WZ3A 2Z0EB 3APDA 4KSLC 2EMSA 3A33B 4NAWA 3AU5A 2DZMA 4W9FA 2K6DB 3KUCB 4KIKA 4HPLB 4IW0A 4J6IA 3VTVA 3ZRFA 4BKSD 4E3CA 2KANA 4I6PA 3UQAA 4MEMA 3JW0X 1G6JA 3RCZA 3QJZA 4IC7B 4DHJD 2CU1A 1KOTA 4A20A 4GSWA 3V6CB 2MBHA 2NVUI 3V6EB 3ZRCA 2GBKA 1WX7A 2BYEA 2HD5B 4CYEA 5LLIA 3ZVVA 1S1QB 3BINA 2Y5BB 2O2VB 4KSKC 4GDKA 4GIVA 2KD0A 1WXSA 3WA0A 2V4LA 2PPHA 3WAMA 3GOEA 2IZVB 1XD3B 3A9JB 2BWES 4ICVA 3VH3B 2GBMA 1SE9A 1ZKHA 2JRHA 2Z0DB 2KN5A 2GBRA 3A9KB 3DVNU 2KK8A 3ML8A 2MRPA 3CSTA 2D2QA 4G11A 4IUMB 1AARA 2N9XA 5DPWA 3DBRI 4I6NB 3QAQA 3MJWA 4A3PA 2O6VA 2KC2A 1SGHA 1WJ6A 4KZCA 2G3QB 2R2OA 1WXVA 2KDBA 2L05A 4IG7B 4FADA 2MWSB 3OJ3A 3P2BA 4HCPB 5IAAC 4DHZE 3K9PB 3W1SC 3NY5A 1V5TA 2DYMA 4W9IA 4IWOA 2MW5A 3QX1A 5TR5A 1OEYA 1WZ0A 1J19A 2AEHA 1P3QU 4PS3A 4XZ4A 4LJPB 5DPTA 2JZZA 3HM6X 3KH0A 4MGKE 1V2YA 3RYTA 1RFAA 5JHAA 1C3TA 4KDLB 4MDKE 1M94A 2WX0A 1WFYA 2MX2A 3JVZX 2AYOB 2LVPA 3UF8A 3DCGA 2KKCA 3IHPC 2FAZA 2Z59B 4NQLB 2C60A 1T0YA 2MBEA 4GXBA 4EOYA 2ZPNA 3VHTC 2A5UA 1Q0WB 2O2VA 1WGRA 3W1YA 1NBFC 4FA6A 2KTRB 1YX6B 1HE8A 4PS8A 2LUEA 3WALA 1V81A 4K7UA 2IO3B 3EC8A 3T9LA 1E8WA 4E71A 3A9JA 3U30A 3GZNI 3TCAA 1L2NA 2REXA 4AUQC 2LVOA 2V1YA 5D7GA 4FULA 4X57B 3A9KA 5AZFA 1PQSA 2KDEB 4JQWC 1WM3A 3ZUNA 3APFA 1J8CA 3V62A 2CR5A 4TQ0A 1K8RB 2PE6B 2D11A 3VFKA 2C7NB 3N3KB 2KWUB 3RULA 1FXTB 4F7ZA 3AULA 3UIOB 4F1SA 4ZRJA 4I6LB 1TGZB 4G0NB 2L0TA 4ANWA 1YX5B 1NI2A 3TMPB 4MJSB 2D07B 4WQOB 4HPMB 3QQ8B 5EDSA 5C23A 3L08A 3PSEB 4ZRIA 4LCDE 2YLMA 1Q5WB 4K1RB 1LXDA 4GGQA 2KFKB 5JZEB 2RSUA 2A4ZA 3H6NA 1BT0A 3ALBA 5KHOA 3AU4A 2J0KA 4WJOA 1S3SG 1UELA 3VQIA 4BOZB 5CHFA 4EZKA 5LXHA 3L17A 2C7MB 3DVGY 4P7IA 3X0WA 2LXCA 2L0FA 4DHZB 4K7SA 3A4RA 2KTRA 3WAOA 3WAPA 3L54A 4AJYB 2B3AA 4BVUC 1F9JA 3QK0A 2RR9A 5DPRA 3ZW3A 2PE9A 4AWJA 3ENEA 2KZRA 3K9OB 4GDLB 5L83A 2XK5A 3JSVB 4NPNA 1VCBA 1WM2A 2KNBA 3U7DA 3W1SA 3WANA 3ZDTA 5LXIB 2DYBA 2LXAA 2NR2A 2J0JA 3MHSD 4OVUA 3A1QB 4K7WA 2MQJA 3O65B 1X1MA 4B6WA 1KJTA 4EFOA 4TV3A 2FIDA 2DZKA 4FJZA 2N1WA 2UWQA 2D3GA 2FCQA 3VUXA 3QWZB 4WWNA 1MG8A 3H7SA 5HKHA 1V49A 3ZO5B 5DPSA 3V61A 1IPGA 4MJSA 2IY0B 1GG3A 2GOWA 3M63B 4NY0A 1GNUA 3V60A 3ONSA 1IYFA 4JIOU 2FCSA 4PS7A 5CHWA 3ZDMC 3PS6A 4DHJB 1OQYA 2KFKA 2LZ6A 3M3JA 2PEAA 3KYCD 3M62B 3ML9A 1E90A 3D32A 3TIXA 3BY4B 4XC2A 4K81A 1OGWA 1WR6E 4MGIE 4W9CA 4URKA 2BKRB 4TKNA 1ZW7A 2HJ8A 1H4RA 4WWPA 1WJ4A 1WX8A 3QARA 2IYDB 5C1ZA 1R4NI 1GUAB 1WJNA 2ZPYA 2KQSA 4GDLA 4FJYA 2R2QA 2PJHA 1L7YA 2N9PC 4GB9A 4FBJB 1H8CA 3ZNGC 1E8YA 3PVLA 2KOXA 3QA8A 4RM8A 5AEKB 1WMHB 1WY8A 2MP2B 1P98A 4E74A 2G4DB 1JRUA 3A1QA 3HM3A 3L13A 3OJ4B 3PPAA 5FR6A 3SU8X 4WJQA 2FCMA 2KMCA 4ZYNA 1WGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ7 A;  2RD0 A;  3HK0 A;  3M95 A;  4MGZ E;  4BFR A;  2N4F A;  1J0G A;  1WXA A;  3APC A;  3R7Q A;  3PRZ A;  5BO4 B;  5D2M B;  1TTN A;  2ZZP B;  3RT3 B;  2L8J A;  3ZLZ A;  3DBL I;  3H1U A;  2NBV B;  2M0X A;  4M8M A;  2CHZ A;  4NJ6 A;  3A4S C;  1OTR B;  1WE6 A;  2LI5 A;  4BKS A;  2HE7 A;  4FN2 A;  2K8C A;  4HLE A;  1LM8 B;  2ZCC A;  3AI5 A;  4HJK A;  2EKE C;  4WJN A;  3OAW A;  1WGG A;  4GU2 A;  1R4M I;  3PHX B;  3L10 B;  3ZNZ B;  2K1F A;  2QHO A;  1E7V A;  2KWC A;  4EKU A;  5E6P A;  3VTW A;  5L95 C;  1P0R A;  1XT9 B;  4IWQ A;  4BBN F;  1KM7 A;  4EEW A;  2LGX A;  3R7R A;  4W9H A;  2MBO A;  2MA9 B;  3CSF A;  4N9F 4;  2DX5 B;  3QIJ A;  2DHZ A;  3PLU A;  2ZJD A;  2OOB B;  2RPQ A;  5D94 A;  3QCA A;  2K8H A;  3DVN V;  4PYZ A;  2HTH A;  4MGY E;  2RGF A;  2KLC A;  4MM3 A;  3B08 A;  1WMH A;  2MP2 A;  2L76 A;  1Z5S B;  4TQ1 A;  3UQB A;  1LFD A;  2KWV B;  1TBE A;  2ZEQ A;  2K6Q A;  3KW5 B;  1C1Y B;  3AXC A;  2DEN B;  4OVV A;  1GC6 A;  2ZCB A;  2L3Z A;  3Q3F A;  3IVF A;  3QC8 B;  1LQB A;  1IP9 A;  3WIM A;  4NAW B;  4ANV A;  4DXA B;  3NZU A;  4G50 A;  2CHW A;  1U4A A;  2KFJ A;  2KX0 A;  4W9G A;  1UBQ A;  3DQV A;  3PHW B;  3UGB B;  4AP4 C;  1EO6 A;  4B95 A;  3X23 A;  2W9N A;  1GC7 A;  2KJR A;  1WYW B;  4WAA A;  4ANX A;  2ZVO A;  4GN1 A;  4PYU A;  2LJ5 A;  2NBW B;  2NS5 A;  4HXD A;  4ICU A;  4LDT D;  4W9J A;  3IFW B;  3PZD A;  2KJ6 A;  2EMT A;  2DAF A;  4II3 B;  3DPD A;  4HK2 A;  1YJ1 A;  2C7H A;  1V86 A;  2K8B A;  4JL9 A;  2LGD A;  1E8X A;  3NHE B;  3KUZ A;  4XX5 A;  3QHT A;  4HDQ A;  2AWT A;  2IO2 B;  2JXX A;  2ZVN A;  4NQK E;  3N30 A;  2MLB A;  2KLG A;  4DDI D;  2IBI B;  4IM2 A;  3VDZ A;  4JGH B;  2KO3 A;  2O6V D;  3RZF A;  5CTR C;  2KDI A;  4M8N A;  2CS4 A;  2G45 B;  2BPS A;  3NS8 A;  1YIW A;  3RD2 A;  1E5W A;  3T8M A;  3VH4 B;  2JPH A;  2VRR B;  1XQQ A;  2NPT B;  4HDO A;  4BOS C;  4YL8 A;  1D3Z A;  2ZNV C;  1I42 A;  2M8S A;  2L00 B;  1WGD A;  2OJR A;  3NOB A;  2DZJ A;  4F8C B;  5GMV A;  2FNJ B;  5G2N A;  3VUW A;  1WI0 A;  1WIA A;  4MSM B;  4MSQ B;  2IY1 B;  2V3S A;  2K39 A;  2DAJ A;  4EZJ A;  1V80 A;  1GJZ A;  3PGE A;  3VUY A;  3OLM D;  2FUH B;  2C9W B;  5J2R A;  1EUV B;  4DK5 A;  3RZW C;  1ZGU B;  2GBN A;  3I3T B;  4W9L A;  4A3O A;  1RAX A;  3DVG X;  3CF6 E;  4NJ7 A;  1V5O A;  1RLF A;  4DWF A;  2KHW B;  2D10 A;  3JSV A;  4B9K A;  3U8Z A;  3SD5 A;  2WDT B;  3R66 C;  4AJW A;  1QZE A;  1SIF A;  2YVC A;  2AL3 A;  2ZNV B;  3KVF B;  1YQB A;  4W9K A;  3UIP B;  3NZS A;  1I35 A;  1E7U A;  3EEC A;  3DBS A;  3ZNH B;  2JRI B;  5AZH A;  1RRB A;  5CX3 A;  3ZNI D;  2K25 A;  2JY6 A;  1CMX B;  5CHV C;  5J17 A;  4DBG A;  2KMA A;  3VXW A;  4ZDV A;  3ECI A;  3LJ3 A;  2GMI C;  2NPT A;  1UZX B;  3UIN B;  3B0A A;  2XBB C;  3JYU A;  5JHB A;  2JZ3 B;  2KXJ A;  3ZKJ C;  1A5R A;  2UYZ B;  4M0W B;  3EFU A;  4RM9 A;  3L0W B;  3IG3 A;  2DZI A;  4BKT A;  2M1M A;  4FHK A;  4HCN B;  3PRE A;  1WE7 A;  2AL6 A;  2KVR A;  2XEW A;  3HHM A;  1NDD A;  3PV1 A;  2MBB B;  1P9D U;  1WXM A;  4FHJ A;  3RUI B;  3C0R B;  4EZL A;  3TJP A;  2KX3 A;  3VAW A;  4IWP A;  4KV2 A;  2MBQ A;  1WJU A;  2BKF A;  2N1V A;  1WX9 A;  2G4S A;  2LGY A;  2WX1 A;  3VVW B;  4HVB A;  3ZIM A;  1WF9 A;  2NCN A;  2BGF A;  3IBE A;  4DDG D;  4GMV A;  3H7P B;  4KDI C;  2KJH B;  3MTN B;  3PT2 B;  4RMA A;  2JF5 A;  1OEY J;  4G3X B;  5DCN A;  2J7Q B;  4NNJ B;  1ISN A;  1V6E A;  4WJP A;  2N7D A;  1Q1O A;  1WRD B;  2IO0 B;  4W9E A;  1WGY A;  4FJV B;  2BYV E;  3CMM B;  3R3M A;  2XK5 B;  1TZ1 A;  3TL5 A;  2ASQ A;  4ANU A;  5D6J B;  5JH5 C;  2I1J A;  3ZTD A;  1UBI A;  3PTF C;  2KTF A;  4TUU A;  3H9D A;  1E8Z A;  3SHQ A;  1KLV A;  3PRP B;  2JWZ A;  4CO7 A;  2LRW A;  2FCN A;  5J18 A;  3KYD D;  5AZG A;  4KIK B;  2N9E B;  1YD8 U;  1WH3 A;  4KVG B;  3SDL C;  4ASW C;  3KUD B;  4LJO B;  2NBU A;  1VD2 A;  5E6N A;  4FLH A;  3PRM B;  2KC1 A;  2FIF A;  3LDZ E;  3ZTC A;  4IM3 A;  4EUT A;  2GBJ A;  2KDF B;  1Z2M A;  1UGM A;  2M17 A;  4BKG A;  2LWP A;  1UH6 A;  4IM0 A;  4W9D A;  4AOF A;  3Q3J A;  2J0M A;  2JUO A;  3DBH I;  3B1L X;  3HIZ A;  5IA7 A;  5KHQ A;  3N32 A;  4GDK B;  2L7R A;  2BYF A;  4LDT B;  1P1A A;  3S2A A;  3DDC B;  2WYQ A;  4WWO A;  2M4N A;  2MSE D;  4GOC A;  3L16 A;  3H7P A;  2DYO A;  2BWF A;  5E6O A;  1EF5 A;  1UD7 A;  2C5L C;  5G55 A;  2JVC A;  3EHV A;  3TBL D;  1V9J A;  2CKH B;  2IO1 B;  2LD9 A;  2WWZ A;  3PLV A;  4HWI B;  4JLC A;  2LVQ A;  4KZ0 A;  4CHK A;  2I1K A;  2LAS A;  2N7E A;  2O6V B;  3DOW A;  2BF8 B;  4ZRK A;  3VTU A;  2JT4 B;  4MH0 E;  4II2 B;  4MEL A;  1WR1 A;  1EF1 A;  2MCN B;  4BBN C;  2LRU A;  2CHX A;  1Y8R C;  1WZ3 A;  2Z0E B;  3APD A;  4KSL C;  2EMS A;  3A33 B;  4NAW A;  3AU5 A;  2DZM A;  4W9F A;  2K6D B;  3KUC B;  4KIK A;  4HPL B;  4IW0 A;  4J6I A;  3VTV A;  3ZRF A;  4BKS D;  4E3C A;  2KAN A;  4I6P A;  3UQA A;  4MEM A;  3JW0 X;  1G6J A;  3RCZ A;  3QJZ A;  4IC7 B;  4DHJ D;  2CU1 A;  1KOT A;  4A20 A;  4GSW A;  3V6C B;  2MBH A;  2NVU I;  3V6E B;  3ZRC A;  2GBK A;  1WX7 A;  2BYE A;  2HD5 B;  4CYE A;  5LLI A;  3ZVV A;  1S1Q B;  3BIN A;  2Y5B B;  2O2V B;  4KSK C;  4GDK A;  4GIV A;  2KD0 A;  1WXS A;  3WA0 A;  2V4L A;  2PPH A;  3WAM A;  3GOE A;  2IZV B;  1XD3 B;  3A9J B;  2BWE S;  4ICV A;  3VH3 B;  2GBM A;  1SE9 A;  1ZKH A;  2JRH A;  2Z0D B;  2KN5 A;  2GBR A;  3A9K B;  3DVN U;  2KK8 A;  3ML8 A;  2MRP A;  3CST A;  2D2Q A;  4G11 A;  4IUM B;  1AAR A;  2N9X A;  5DPW A;  3DBR I;  4I6N B;  3QAQ A;  3MJW A;  4A3P A;  2O6V A;  2KC2 A;  1SGH A;  1WJ6 A;  4KZC A;  2G3Q B;  2R2O A;  1WXV A;  2KDB A;  2L05 A;  4IG7 B;  4FAD A;  2MWS B;  3OJ3 A;  3P2B A;  4HCP B;  5IAA C;  4DHZ E;  3K9P B;  3W1S C;  3NY5 A;  1V5T A;  2DYM A;  4W9I A;  4IWO A;  2MW5 A;  3QX1 A;  5TR5 A;  1OEY A;  1WZ0 A;  1J19 A;  2AEH A;  1P3Q U;  4PS3 A;  4XZ4 A;  4LJP B;  5DPT A;  2JZZ A;  3HM6 X;  3KH0 A;  4MGK E;  1V2Y A;  3RYT A;  1RFA A;  5JHA A;  1C3T A;  4KDL B;  4MDK E;  1M94 A;  2WX0 A;  1WFY A;  2MX2 A;  3JVZ X;  2AYO B;  2LVP A;  3UF8 A;  3DCG A;  2KKC A;  3IHP C;  2FAZ A;  2Z59 B;  4NQL B;  2C60 A;  1T0Y A;  2MBE A;  4GXB A;  4EOY A;  2ZPN A;  3VHT C;  2A5U A;  1Q0W B;  2O2V A;  1WGR A;  3W1Y A;  1NBF C;  4FA6 A;  2KTR B;  1YX6 B;  1HE8 A;  4PS8 A;  2LUE A;  3WAL A;  1V81 A;  4K7U A;  2IO3 B;  3EC8 A;  3T9L A;  1E8W A;  4E71 A;  3A9J A;  3U30 A;  3GZN I;  3TCA A;  1L2N A;  2REX A;  4AUQ C;  2LVO A;  2V1Y A;  5D7G A;  4FUL A;  4X57 B;  3A9K A;  5AZF A;  1PQS A;  2KDE B;  4JQW C;  1WM3 A;  3ZUN A;  3APF A;  1J8C A;  3V62 A;  2CR5 A;  4TQ0 A;  1K8R B;  2PE6 B;  2D11 A;  3VFK A;  2C7N B;  3N3K B;  2KWU B;  3RUL A;  1FXT B;  4F7Z A;  3AUL A;  3UIO B;  4F1S A;  4ZRJ A;  4I6L B;  1TGZ B;  4G0N B;  2L0T A;  4ANW A;  1YX5 B;  1NI2 A;  3TMP B;  4MJS B;  2D07 B;  4WQO B;  4HPM B;  3QQ8 B;  5EDS A;  5C23 A;  3L08 A;  3PSE B;  4ZRI A;  4LCD E;  2YLM A;  1Q5W B;  4K1R B;  1LXD A;  4GGQ A;  2KFK B;  5JZE B;  2RSU A;  2A4Z A;  3H6N A;  1BT0 A;  3ALB A;  5KHO A;  3AU4 A;  2J0K A;  4WJO A;  1S3S G;  1UEL A;  3VQI A;  4BOZ B;  5CHF A;  4EZK A;  5LXH A;  3L17 A;  2C7M B;  3DVG Y;  4P7I A;  3X0W A;  2LXC A;  2L0F A;  4DHZ B;  4K7S A;  3A4R A;  2KTR A;  3WAO A;  3WAP A;  3L54 A;  4AJY B;  2B3A A;  4BVU C;  1F9J A;  3QK0 A;  2RR9 A;  5DPR A;  3ZW3 A;  2PE9 A;  4AWJ A;  3ENE A;  2KZR A;  3K9O B;  4GDL B;  5L83 A;  2XK5 A;  3JSV B;  4NPN A;  1VCB A;  1WM2 A;  2KNB A;  3U7D A;  3W1S A;  3WAN A;  3ZDT A;  5LXI B;  2DYB A;  2LXA A;  2NR2 A;  2J0J A;  3MHS D;  4OVU A;  3A1Q B;  4K7W A;  2MQJ A;  3O65 B;  1X1M A;  4B6W A;  1KJT A;  4EFO A;  4TV3 A;  2FID A;  2DZK A;  4FJZ A;  2N1W A;  2UWQ A;  2D3G A;  2FCQ A;  3VUX A;  3QWZ B;  4WWN A;  1MG8 A;  3H7S A;  5HKH A;  1V49 A;  3ZO5 B;  5DPS A;  3V61 A;  1IPG A;  4MJS A;  2IY0 B;  1GG3 A;  2GOW A;  3M63 B;  4NY0 A;  1GNU A;  3V60 A;  3ONS A;  1IYF A;  4JIO U;  2FCS A;  4PS7 A;  5CHW A;  3ZDM C;  3PS6 A;  4DHJ B;  1OQY A;  2KFK A;  2LZ6 A;  3M3J A;  2PEA A;  3KYC D;  3M62 B;  3ML9 A;  1E90 A;  3D32 A;  3TIX A;  3BY4 B;  4XC2 A;  4K81 A;  1OGW A;  1WR6 E;  4MGI E;  4W9C A;  4URK A;  2BKR B;  4TKN A;  1ZW7 A;  2HJ8 A;  1H4R A;  4WWP A;  1WJ4 A;  1WX8 A;  3QAR A;  2IYD B;  5C1Z A;  1R4N I;  1GUA B;  1WJN A;  2ZPY A;  2KQS A;  4GDL A;  4FJY A;  2R2Q A;  2PJH A;  1L7Y A;  2N9P C;  4GB9 A;  4FBJ B;  1H8C A;  3ZNG C;  1E8Y A;  3PVL A;  2KOX A;  3QA8 A;  4RM8 A;  5AEK B;  1WMH B;  1WY8 A;  2MP2 B;  1P98 A;  4E74 A;  2G4D B;  1JRU A;  3A1Q A;  3HM3 A;  3L13 A;  3OJ4 B;  3PPA A;  5FR6 A;  3SU8 X;  4WJQ A;  2FCM A;  2KMC A;  4ZYN A;  1WGH A; 
#chains in the Genus database with same CATH topology
 3HK0 A;  4BFR A;  2PW9 A;  4HJG E;  5BO4 B;  3ZLZ A;  2L8J A;  1L5P A;  4M8M A;  4NJ6 A;  3A4S C;  3AI5 A;  1L6U A;  1R4M I;  3L10 B;  4US8 A;  1LO5 D;  2K1F A;  1TYG B;  3ZNZ B;  3Q3N C;  4EKU A;  1SJE D;  1T0S C;  3EUB 2;  5E6P A;  1P0R A;  1RYJ A;  3RNC C;  1DOY A;  2LGX A;  2Y3A A;  3R7R A;  2MBO A;  2QJL A;  4N9F 4;  4C56 C;  2GI9 A;  1UF0 A;  3PLU A;  1N5X A;  4IOI E;  5D94 A;  2K9X A;  1ZDX A;  2N7J A;  2LMC A;  3C8Y A;  4MGY E;  4LTU A;  3B08 A;  1F77 A;  2EEL A;  2ZW1 A;  1LFD A;  2KWV B;  3UQB A;  1TBE A;  2JXT A;  1YN5 A;  2WDR B;  1C1Y B;  4WQM A;  2PMV A;  4OVV A;  3U2S C;  3AB5 A;  5D3D A;  1CJE A;  1IP9 A;  3WIM A;  1DYQ A;  4ANV A;  1GB1 A;  3BK2 A;  2FBW B;  1TKE A;  4AP4 C;  4B95 A;  1WYW B;  4ANX A;  2ZVO A;  2LJ5 A;  4W9J A;  3IFW B;  1YNT E;  2KJ6 A;  3AV8 A;  1E6E B;  5IKC M;  3DPD A;  4YSY B;  2C7H A;  4XGA B;  2LGD A;  1TS2 A;  3NHE B;  2J42 A;  3QHT A;  2IO2 B;  4ZHO A;  1I4X A;  1IGD A;  4C4V A;  3N30 A;  4ZHP A;  2MLB A;  4JGH B;  2KDI A;  4ITK A;  4M8N A;  2G45 B;  1YIW A;  3RD2 A;  2QMT A;  1E5W A;  3T8M A;  3N1Z C;  1XQQ A;  2NPT B;  3AED B;  3NOB A;  2DZJ A;  2RDH A;  2IGD A;  2R61 A;  1R7S A;  2EKI A;  2FNJ B;  3AE4 B;  2BVC A;  2K39 A;  5EE9 A;  1V80 A;  3AEC B;  2WXM A;  2LFI A;  1K53 A;  1QT9 A;  1N6Z A;  1BUI C;  2GBN A;  1L4D B;  4A3O A;  2LJI A;  3GP7 A;  4YWG G;  1RLF A;  1TY2 A;  3SD5 A;  1MHH E;  2KN4 A;  2ZW0 A;  1I35 A;  2KVZ A;  1FNW A;  1KLG D;  3ZNH B;  1RRB A;  1CMX B;  4DBG A;  2KMA A;  1V1P A;  2GMI C;  1MJD A;  3KLS X;  1TS5 A;  2KXJ A;  4M0W B;  1ZOY B;  5EE1 A;  4FHK A;  2BQQ A;  2DBY A;  2IGG A;  1WXM A;  4FHJ A;  1EU3 A;  1WWT A;  2MBQ A;  2H89 B;  2I2Y A;  1VZ8 A;  1QQR A;  2JZP A;  4GMV A;  1F2R I;  3RI7 C;  3E56 A;  2J53 A;  1HTQ A;  3PT2 B;  4HRO A;  1OEY J;  5DCN A;  1UGJ A;  4H2A A;  1V6E A;  4W9E A;  1WGY A;  4FJV B;  3R3M A;  4P6V F;  1P7F A;  2KT7 A;  5JH5 C;  3N9Y C;  1UBI A;  2INC C;  4TUU A;  4CO7 A;  2LRW A;  4USA A;  5AZG A;  1WH3 A;  1E7P B;  3GE8 C;  5E6N A;  2JX5 A;  3PRM B;  1TT5 B;  1N63 A;  1VRA B;  2B76 B;  2GBJ A;  1EU4 A;  2WU5 B;  3Q8A A;  2JUO A;  3DBH I;  5IA7 A;  5IN7 A;  5EE0 A;  2L7R A;  1D6E C;  1P1A A;  2M4N A;  2MSE D;  2WLB A;  3MC9 A;  3BYT B;  3H7P A;  1FO4 A;  4HPP A;  1D5Z C;  3LXF A;  5E6O A;  2M56 B;  1EF5 A;  2C5L C;  2TSS A;  2CJN A;  2LD9 A;  4HWI B;  3Q3M C;  2HJ1 A;  4KZ0 A;  2LAS A;  2ACZ B;  3VTU A;  1SE2 A;  4MH0 E;  1Y8R C;  2Z0E B;  2M0A A;  3A33 B;  1C78 A;  1JRP A;  3AU5 A;  5EE3 A;  3KUC B;  4KIK A;  4TMA B;  4E3C A;  4I6P A;  1FCL A;  3AE1 B;  4A20 A;  3V6C B;  5H92 C;  2GBK A;  2HD5 B;  4CYE A;  5LLI A;  3ZVV A;  3ZQ4 A;  4GIV A;  1WXS A;  3GS2 A;  2V4L A;  2W3R A;  3GOE A;  3A9J B;  2BWE S;  2DLB A;  2Z0D B;  2XNA C;  4I6N B;  3FIL B;  3MJW A;  1MG4 A;  2O6V A;  5MPO A;  1SGH A;  1PFD A;  1AW7 A;  1WXV A;  2KDB A;  2L05 A;  3EA6 A;  4IG7 B;  2WXH A;  3Q3O C;  1XLP A;  3HUI A;  4DHZ E;  1I7H A;  5IAA C;  3W1S C;  1XCQ L;  2DYM A;  3ZGZ A;  2AEH A;  1P3Q U;  3VR9 B;  5DPT A;  3HM6 X;  2JYE A;  4OW0 A;  4MDK E;  1FRD A;  1M94 A;  2AYO B;  2LVP A;  2FAZ A;  4RNA A;  4GXB A;  4NZL B;  4LNF A;  1A70 A;  1QOF A;  3VHT C;  2A5U A;  1PGB A;  2KTR B;  3WAL A;  1JQ4 A;  2IO3 B;  3T9L A;  4E71 A;  3HVZ A;  2D3B A;  4MAC A;  1VLB A;  5AZF A;  3AMZ A;  1WM3 A;  3ZUN A;  1J8C A;  3N3K B;  5TSS A;  5BYR A;  4I6L B;  1TGZ B;  4RGM A;  2JU6 X;  1ZP0 B;  2D07 B;  2V4I B;  1VR9 A;  5H8Y E;  4HPM B;  5EDS A;  3L08 A;  3NUH B;  1I4Q A;  4K1R B;  1LXD A;  1EWC A;  2RMM A;  5AUK A;  4WJO A;  1RWS A;  3O13 A;  1UWX A;  1ROE A;  3L17 A;  4O1N A;  4HRS A;  4K7S A;  3WAO A;  3L54 A;  4JWS C;  1F9J A;  3W2D A;  3JSV B;  3WAN A;  1VCB A;  2N9L A;  2J0J A;  4OVU A;  4B0E A;  4ZYS A;  2SEB D;  4US9 A;  3I9V 1;  3O65 B;  1YQ4 B;  2FID A;  4FJZ A;  2D3G A;  3VUX A;  3MP9 A;  1C4P A;  1AWD A;  5DPS A;  3V61 A;  3DBR B;  2WP9 B;  4MJS A;  2IY0 B;  2QDF A;  1GNU A;  3KQ4 A;  4GLS C;  3PS6 A;  1OQY A;  1J7B A;  2KFK A;  2LZ6 A;  4R3D A;  3TIX A;  3BII D;  3Q14 C;  2WXR A;  4URK A;  1YJJ A;  4W9C A;  4RGO S;  2Z8L A;  3ZJV A;  1WJN A;  4GB9 A;  2N9P C;  5HFY A;  4BZA A;  5AEK B;  4L1B A;  3L13 A;  3PPA A;  3A1Q A;  5FR6 A;  3OJ4 B;  4C7Z A;  1C77 A;  2KQ7 A;  3R7Q A;  4M00 A;  3PRZ A;  5D2M B;  1TTN A;  2ZZP B;  3H1U A;  2D3C A;  1WE6 A;  4BKS A;  2K8C A;  2ZCC A;  4HJK A;  2MEK A;  4PK1 A;  3OAW A;  1QKZ A;  4DXG A;  4GU2 A;  1FXA A;  1E7V A;  5IOI A;  3TUO A;  1P7E A;  1KM7 A;  5BYQ A;  4EEW A;  1WGK A;  4W9H A;  3AEG B;  3H8H A;  3I57 A;  1KFY B;  2K5P A;  4C4V B;  4PYZ A;  2HTH A;  3RNB C;  2KLC A;  3FKY A;  2L76 A;  1Z5S B;  2BYT A;  2DEN B;  1GC6 A;  2BT6 A;  3TSS A;  3IVF A;  1LQB A;  5C2T B;  4DXA B;  3NZU A;  1V8C A;  4OVZ A;  4W9G A;  1D5X C;  2L1A A;  3UGB B;  1QOG A;  2NMQ A;  1I4P A;  4WAA A;  4PYU A;  2NS5 A;  4HXD A;  3R2I A;  3PZD A;  2VH2 A;  2DAF A;  2YEP F;  4RCO A;  4II3 B;  4K3C A;  4B0M A;  1TKG A;  2K22 A;  1V86 A;  4JL9 A;  4XX5 A;  4WH4 A;  1MPE A;  2N0S B;  2KO3 A;  1JML A;  1FXI A;  3RZF A;  5CTR C;  3ZJT A;  2CS4 A;  2BPS A;  2DWQ A;  3C19 A;  1RM6 C;  2ON8 A;  4LNK A;  3AE2 B;  1V1P B;  3ZXR A;  2MH7 A;  4BOS C;  3RN9 C;  1I42 A;  2M8S A;  2L00 B;  4XWT A;  4A8X C;  1ET6 A;  4MSQ B;  2V3S A;  3P4P B;  2J4X A;  4YSX B;  2V0G A;  5J2R A;  2WXP A;  3N1X C;  1ZGU B;  2W3S A;  1FD6 A;  1VJK A;  1RAX A;  2WXO A;  4NJ7 A;  1R4M B;  4DWF A;  2KHW B;  3JSV A;  3U8Z A;  2WDT B;  3J9C A;  3R66 C;  3V3X A;  4AJW A;  2YVC A;  2ZNV B;  4W9K A;  3NZS A;  1HA5 A;  3DBS A;  1QLB B;  5AZH A;  1BXT A;  3BK1 A;  2JY6 A;  5J17 A;  3ECI A;  5BMG A;  3UIN B;  3B0A A;  4ZRQ A;  2UYZ B;  4RM9 A;  1SE4 A;  2DZI A;  3IAM 1;  4IDI A;  1ZUD 2;  2AL6 A;  2KVR A;  1AN8 A;  1E9M A;  1P9D U;  4YTN B;  2LHE A;  3C0R B;  3TJP A;  3VAW A;  4N59 A;  1WJU A;  2G4S A;  1NEN B;  2LGY A;  1TKY A;  3ZIM A;  1WF9 A;  3B2G A;  2BGF A;  3H7P B;  4KDI C;  1N5W A;  1OQR A;  2V9H A;  2J7Q B;  2CU3 A;  1FCC C;  1Q1O A;  1WRD B;  1KF6 B;  3AE6 B;  1TZ1 A;  3TL5 A;  4ANU A;  2I1J A;  1OQQ A;  2LHD A;  3PRP B;  2JWZ A;  3U7Z A;  4KIK B;  2N9E B;  4FLH A;  3T3O A;  3KWL A;  4IM3 A;  2KDF B;  1Z2M A;  4BKG A;  4AOF A;  2Y5C A;  1QOA A;  1F52 A;  3S2A A;  3DDC B;  2MJ3 A;  4GOC A;  2LEK A;  5G55 A;  2JVC A;  3EHV A;  1V9J A;  3RNF C;  3PLV A;  3RNG C;  1PGX A;  3W5U B;  2I1K A;  2O6V B;  4OHJ A;  2BF8 B;  3AEE B;  5HI1 A;  3WCQ A;  2JT4 B;  4BBN C;  4LK0 M;  2LRU A;  4KSL C;  2WDQ B;  3U4E G;  2KDM A;  4HPL B;  4IW0 A;  3ZRF A;  1F1H A;  4HKQ A;  2Q5W D;  4MEM A;  3JW0 X;  3QJZ A;  1GOZ A;  1KOT A;  4JPS A;  2MBH A;  2NVU I;  3ZRC A;  4LNN A;  3BIN A;  4GDK A;  1VZ6 A;  2KD0 A;  4JX1 C;  3WA0 A;  4A90 A;  4ICV A;  1NI3 A;  4ARI A;  4DQO C;  2JRH A;  2GBR A;  4LLG M;  3I5J C;  2OJW A;  2D2Q A;  3AEA B;  1N60 A;  3AE9 B;  5DPW A;  1C79 A;  4ZRP A;  4A3P A;  2WXI A;  2KC2 A;  3IT6 B;  1STE A;  2G1E A;  1MHX A;  1YQ3 B;  4RFB A;  3NY5 A;  2IPK D;  3QX1 A;  4PS3 A;  2JZZ A;  2WXQ A;  1V2Y A;  2MJD A;  4KDL B;  1NEK B;  1NVI D;  1ZDV A;  3IHP C;  4EOY A;  2MBE A;  3BVG A;  1PUT A;  3Q8F A;  4AQ7 A;  1WGR A;  3IXS A;  4FA6 A;  1HE8 A;  2LUE A;  4K7U A;  3EC8 A;  1L4Z B;  3U30 A;  3GZN I;  2REX A;  3DBH B;  2LVO A;  3BZD B;  2LGS A;  3A9K A;  2KDE B;  1D4B A;  2WXJ A;  3APF A;  2M19 A;  4KKJ A;  3V62 A;  2QSD A;  4F7Z A;  1FXT B;  2INN E;  4ANW A;  4YXD B;  3W5V B;  1YX5 B;  1NI2 A;  3GE3 C;  4MJS B;  4WQO B;  3QQ8 B;  3T3N A;  5C23 A;  2IGH A;  2KFK B;  1L0X B;  2A4Z A;  3H6N A;  2LUM A;  3VQI A;  3ABV B;  2L32 A;  2QEJ C;  4P16 A;  1WSP A;  2KYW A;  1NYQ A;  5JXV A;  2IJ0 A;  4IKG A;  3WAP A;  4AJY B;  4BVU C;  3QK0 A;  2RR9 A;  4AWJ A;  2KZR A;  3K9O B;  1CZP A;  3W1S A;  1WM2 A;  2KNB A;  2WXN A;  3U7D A;  1I4R A;  2LXA A;  3A1Q B;  3P4Q B;  4B6W A;  4TV3 A;  3AEF B;  3QWZ B;  4WWN A;  3H7S A;  3VRA B;  5HKH A;  3ZO5 B;  2Y5P A;  4NY0 A;  3V60 A;  4ARC A;  2FCS A;  5IO9 A;  1HTO A;  2INP E;  2PEA A;  3ML9 A;  1XXG A;  2OHF A;  4XC2 A;  3CIR B;  1FFU A;  2HJ8 A;  1FRR A;  1H4R A;  1WX8 A;  2W55 A;  2BS3 B;  4KGS A;  4DXF A;  4C80 A;  1GB4 A;  1R4N I;  2BB5 A;  2ZPY A;  2KQS A;  2R2Q A;  2PJH A;  2KOX A;  4RM8 A;  5FKA C;  4E74 A;  1JRU A;  3HM3 A;  4A9A A;  3SU8 X;  2VZK B;  4WJQ A;  1FM0 D;  2KMC A;  1K50 A;  4MGZ E;  2N4F A;  3APC A;  2MHJ A;  1WRI A;  3RT3 B;  3DBL I;  2CHZ A;  1OTR B;  1JWM D;  5I4D A;  2HE7 A;  1C4C A;  1SXT A;  1WGG A;  1SE3 A;  3VTW A;  3HVD A;  4BBN F;  5BMH A;  2QC8 A;  3U52 E;  2MA9 B;  3CSF A;  4N58 A;  3DHI C;  2ZJD A;  2OOB B;  2RPQ A;  2BTE A;  1V1O A;  2I38 A;  2K8H A;  3DVN V;  3RNA C;  2WHI A;  1T0Q C;  2RGF A;  1ZE3 D;  4MM3 A;  1WMH A;  1N62 A;  1WXQ A;  1HXY D;  3KW5 B;  3AXC A;  2L83 A;  3QC8 B;  2FE8 A;  2X38 A;  2AQ1 B;  3NG0 A;  4G50 A;  1U4A A;  2KFJ A;  4YTP B;  3DQV A;  1FNU A;  1YN4 A;  1XO3 A;  3PHW B;  3X23 A;  1I4H A;  1YJI A;  4OZA A;  4S17 A;  3LB8 C;  3BWU D;  2NTT A;  3SEB A;  3EGR A;  1HQR D;  4KGR A;  1YJ1 A;  2K8B A;  3Q8E A;  3KUZ A;  3ZYY X;  4HDQ A;  2JXX A;  1SEB D;  2KQ4 X;  2KLG A;  2IBI B;  2O6V D;  2X8X X;  2WS3 B;  3NS8 A;  4HEA 1;  1MFW A;  2K0P A;  5AUI A;  4YSZ B;  1ZXH A;  5D3I B;  4HDO A;  4YL8 A;  1D3Z A;  1ESF A;  2OJR A;  4WIP A;  5GMV A;  3P4R B;  5G2N A;  4LNI A;  4MSM B;  4EZJ A;  4A6Q A;  3MC8 A;  3DWM A;  2FUH B;  4C00 A;  1EUV B;  3RZW C;  4NJC A;  3HRD D;  2D10 A;  1XLO A;  2W82 A;  3NRZ A;  2QIE B;  4XYC A;  2QCZ A;  3UIP B;  3P1M A;  2UU7 A;  1XEE A;  3EEC A;  3ZNI D;  3NS1 A;  2PVO D;  4ZDV A;  1XF5 L;  1JWU D;  3LJ3 A;  1UZX B;  5JHB A;  2XBB C;  1A5R A;  2WXK A;  3L0W B;  2WQY B;  4BKT A;  4YT0 B;  1Y56 A;  1WE7 A;  2XEW A;  3HHM A;  1B1Z A;  4MH8 A;  2MBB B;  4D2K A;  1JWA D;  4EZL A;  4KV2 A;  2BKF A;  2N1V A;  1WX9 A;  2WX1 A;  3VVW B;  1ZPS A;  3IBE A;  4DDG D;  1BML C;  4RGT A;  2V3P A;  2ICI A;  2XN9 C;  2KJH B;  4RMA A;  2G9H D;  4RH6 A;  4YTM B;  2FUG 1;  2WXL A;  3B9J A;  3NJT A;  1KH0 A;  2IO0 B;  1T6B X;  1KLU D;  3CMM B;  2XK5 B;  2ASQ A;  3SFD B;  1IUE A;  1JW9 D;  3PTF C;  3SHQ A;  3H9D A;  1E8Z A;  3R8B A;  2FCN A;  5J18 A;  4NAM A;  3KYD D;  3SDL C;  1YD8 U;  4KVG B;  3KUD B;  1VD2 A;  3E9S A;  3AM9 A;  2KC1 A;  2KAC A;  2FIF A;  3LDZ E;  2GB1 A;  2KMM A;  2LWP A;  4IM0 A;  4W9D A;  3Q3J A;  3B1L X;  3N32 A;  4GDK B;  2BYF A;  4A55 A;  4LDT B;  5FR3 A;  4WWO A;  4XWW A;  1J7A A;  3L16 A;  4UDU C;  2BS2 B;  1D5M C;  1YMH E;  1UD7 A;  4FXC A;  1TIF A;  2IO1 B;  2LVQ A;  2VH1 A;  3DWG C;  3ZXV A;  3DOW A;  4ZRK A;  4MEL A;  1EF1 A;  1WZ3 A;  3APD A;  2DZM A;  4W9F A;  2K6D B;  4J6I A;  3VTV A;  1PGA A;  4BKS D;  2KAN A;  3UQA A;  4IC7 B;  3IAS 1;  4GSW A;  5HHD G;  4C7Y A;  3V6E B;  1FNV A;  1WX7 A;  1IGC A;  3R2T A;  1S1Q B;  1DOX A;  1XLN A;  4CQN A;  3WAM A;  1XD3 B;  3VH3 B;  3AEB B;  2GBM A;  1SE9 A;  1ZKH A;  3MHZ A;  4KKI A;  3A9K B;  2KK8 A;  3ML8 A;  2MRP A;  1AAR A;  2N9X A;  1IBX A;  3QAQ A;  5T8I A;  3AE3 B;  1WJ6 A;  2VZK D;  2G3Q B;  4KZC A;  2BB6 A;  4FAD A;  3OJ3 A;  3P2B A;  2AQ3 B;  4HCP B;  3K9P B;  4W9I A;  1MI0 A;  4IWO A;  3DHG C;  1OEY A;  1QOB A;  1J19 A;  1WZ0 A;  3TEZ A;  3RYT A;  5JHA A;  3KH0 A;  1RFA A;  1UWM A;  4RGN A;  2MX2 A;  3DCG A;  2Z59 B;  1C76 A;  2C60 A;  4K3B A;  3BYY B;  2O2V A;  2AQ2 B;  3FAH A;  1YOV B;  3TCA A;  2JWU A;  3NVZ A;  1CQV A;  4FUL A;  3MC0 B;  4X57 B;  2IDY A;  2YEP B;  4JQW C;  1K8R B;  3VFK A;  1EWY C;  2D11 A;  4QAY A;  1TS3 A;  3TEX A;  3AUL A;  4F1S A;  2L52 A;  4G0N B;  2L0T A;  5LNK 1;  3MFG A;  1FIQ A;  3Q8B A;  3PSE B;  3OWE B;  3N1Y C;  2YLM A;  4LCD E;  1GPX A;  4GGQ A;  2RSU A;  1BT0 A;  3ALB A;  5KHO A;  2J0K A;  2IND C;  1S3S G;  1UEL A;  4BOZ B;  3IT4 B;  2KAJ A;  4P7I A;  3X0W A;  2LXC A;  1SSN A;  3A4R A;  3KWV A;  1K52 A;  4REZ A;  3ZW3 A;  5DPR A;  2PE9 A;  1FFV A;  4RF1 A;  5L83 A;  2XK5 A;  4NPN A;  1ENF A;  3TEY A;  2E3T A;  3N20 C;  2LGI A;  1KJT A;  2N1W A;  2FCQ A;  1V49 A;  1XCT L;  1IPG A;  4JWU C;  1GG3 A;  1JRO A;  3ONS A;  1IYF A;  4JIO U;  5CHW A;  4DHJ B;  3M3J A;  3M62 B;  1E90 A;  3D32 A;  1T3Q A;  1VDV A;  4AS1 A;  1WR6 E;  2BKR B;  4TKN A;  1ZW7 A;  3NVW A;  4WWP A;  5C1Z A;  4PT5 A;  1GUA B;  1L0V B;  4GDL A;  4FJY A;  2GRI A;  1H8C A;  1E8Y A;  3PVL A;  3QA8 A;  4MM3 B;  1WMH B;  2PKO A;  1P98 A;  3GZN B;  1SF0 A;  3OG5 A;  4NQL B;  2RD0 A;  3M95 A;  1J0G A;  1WXA A;  4XDD A;  2NBV B;  2M0X A;  1L0Y B;  1C4A A;  1I4G A;  2LI5 A;  1K51 A;  4HLE A;  4FN2 A;  2KWD A;  1LM8 B;  4WJN A;  2EKE C;  4JE3 B;  2DNF A;  3BVM A;  3PHX B;  2QHO A;  2KWC A;  5G5G A;  5L95 C;  1XT9 B;  4IWQ A;  3SFE B;  4M02 A;  3LYY A;  1PYW D;  2DX5 B;  3QIJ A;  2DHZ A;  3QCA A;  2D3A A;  1YN3 A;  2E6X A;  2MP2 A;  4TQ1 A;  2ZEQ A;  3RNE C;  2K6Q A;  3FC4 A;  3I63 C;  1F0Z A;  2ZCB A;  2L3Z A;  3Q3F A;  1FEH A;  3CWI A;  4NAW B;  1XLQ A;  2CHW A;  2KX0 A;  1UBQ A;  4WUR A;  3P42 A;  1EO6 A;  3Q2A C;  4XDC A;  1AYF A;  2N9K A;  4J3O D;  2W9N A;  4Q2J A;  1GC7 A;  2KJR A;  4GN1 A;  4BAX A;  4ICU A;  2NBW B;  4LDT D;  2EMT A;  4RF0 A;  2GLS A;  4HK2 A;  2JYT A;  1E8X A;  2AWT A;  2ZVN A;  4NQK E;  2WXF A;  1HZ6 A;  1J7C A;  4DDI D;  4IM2 A;  3VDZ A;  3AH7 A;  2RPV A;  1R4N B;  3AE7 B;  1VZ7 A;  1ET9 A;  3VH4 B;  2JPH A;  2VRR B;  2WU2 B;  2ZNV C;  4TSS A;  1CK1 A;  2PIA A;  4F8C B;  1WGD A;  5GXG B;  3VUW A;  1V97 A;  1WI0 A;  1WIA A;  2IY1 B;  2DAJ A;  1GJZ A;  3PGE A;  3VUY A;  5G5H A;  3OLM D;  3DBL B;  1LGR A;  4N6E B;  2C9W B;  5HG2 A;  4DK5 A;  3BVZ A;  3RFZ B;  4W9L A;  3I3T B;  4KX6 B;  3DVG X;  2H88 B;  3CF6 E;  1DOI A;  1FMA D;  1V5O A;  4B9K A;  3AN1 A;  4LNO A;  1PDX A;  1QZE A;  1SIF A;  4OZB A;  2AL3 A;  3KVF B;  2V3N A;  1YQB A;  3GB1 A;  2PVG C;  1ACC A;  2OED A;  1E7U A;  3URY A;  1MVK A;  2JRI B;  5CX3 A;  2K25 A;  3NZ3 A;  5CHV C;  3VXW A;  1GAQ B;  2NPT A;  3JYU A;  2JZ3 B;  3ZKJ C;  3EFU A;  3IG3 A;  3VR8 B;  2M1M A;  3ETR A;  4HCN B;  3PRE A;  1NDD A;  3PV1 A;  3RUI B;  2KX3 A;  4IWP A;  3AE8 B;  3V05 A;  1JAL A;  4HVB A;  2NCN A;  2BW2 A;  1TS4 A;  1UUP A;  4M01 A;  3MTN B;  2JQR B;  2JF5 A;  2WDV B;  1KRH A;  4G3X B;  4NNJ B;  1ISN A;  3Q6B A;  4WJP A;  2N7D A;  3Q69 A;  1SJH D;  2BYV E;  1SIJ A;  5D6J B;  3ZTD A;  2KTF A;  1KLV A;  1E10 A;  3MJ5 A;  4ASW C;  2MJE A;  4LJO B;  2NBU A;  4M0W A;  1HZ5 A;  4OZC A;  3ZTC A;  4EUT A;  1EM7 A;  1UGM A;  2M17 A;  1UH6 A;  2J0M A;  5BYS A;  1UNS A;  3HIZ A;  5KHQ A;  5BMI A;  5C3J B;  2WYQ A;  2DYO A;  2BWF A;  4P1B C;  3TBL D;  3Q8C A;  2CKH B;  2WWZ A;  4JLC A;  1L6V A;  1IBX B;  4CHK A;  2N7E A;  2RDB C;  2CJO A;  4II2 B;  1WR1 A;  2MCN B;  3B2F A;  2CHX A;  3ZJU A;  2EMS A;  4NAW A;  4HKZ E;  1F2R C;  1E0Z A;  1G6J A;  4S0R A;  3RCZ A;  2BS4 B;  2WGS A;  4DHJ D;  2CU1 A;  2W54 A;  4L2Y A;  2K3U A;  3RMK C;  2BYE A;  2PLP A;  2Y5B B;  2O2V B;  4KSK C;  2PPH A;  2IZV B;  1B9R A;  2RDG A;  2NTS A;  3P63 A;  2KN5 A;  1QF6 A;  2JSV X;  3DVN U;  3CST A;  1RFK A;  2ONQ A;  4G11 A;  4IUM B;  5IP4 D;  3DBR I;  4XE0 A;  1SB3 C;  2PTL A;  2R2O A;  1WYG A;  4MT5 A;  2MWS B;  2WNM A;  1V5T A;  2MW5 A;  5TR5 A;  1TY0 A;  4XZ4 A;  4LJP B;  4MGK E;  1Q10 A;  2QIL A;  1C3T A;  2WX0 A;  1WFY A;  1TZO A;  3JVZ X;  3VRB B;  3UF8 A;  1DGJ A;  1M4V A;  2KKC A;  1T0Y A;  2ZPN A;  3UI3 A;  1Q0W B;  3W1Y A;  1NBF C;  1YX6 B;  4PS8 A;  1V81 A;  1E8W A;  3A9J A;  2SAK A;  1L2N A;  4AUQ C;  4KGT A;  2V1Y A;  1T5X D;  5D7G A;  1SBB B;  4EE2 A;  1PQS A;  3P4S B;  3NVV A;  2AX5 A;  2CR5 A;  4TQ0 A;  2PE6 B;  2C7N B;  2KWU B;  1JCK B;  3FIL A;  3RUL A;  3UIO B;  4ZRJ A;  4ACF A;  3PZ7 A;  2HDE A;  1TJE A;  4WWM A;  3TEW A;  3TMP B;  4P1C C;  1QIL A;  4ZRI A;  1HEZ E;  2D5G A;  1Q5W B;  1FPY A;  5JZE B;  3DHH C;  3AU4 A;  1ZXI A;  5CHF A;  4EZK A;  5LXH A;  2C7M B;  3DVG Y;  2L0F A;  4DHZ B;  2KTR A;  1OFF A;  2B3A A;  3PZ8 A;  3EFC A;  3ENE A;  4GDL B;  2HTM E;  3ZDT A;  4ZOH C;  5LXI B;  2DYB A;  2NR2 A;  3MHS D;  4K7W A;  2MQJ A;  1X1M A;  4EFO A;  2DZK A;  2UWQ A;  1MG8 A;  1NYR A;  2GOW A;  3M63 B;  5E6J A;  1T0R C;  3RPF C;  1JWS D;  4PS7 A;  3ZDM C;  3PO0 A;  3W9C B;  3SR6 A;  3KYC D;  3BY4 B;  4K81 A;  1OGW A;  4MGI E;  1KTK A;  4WAF A;  1N61 A;  3L4P A;  4L23 A;  1WJ4 A;  3QAR A;  2IYD B;  3AE5 B;  4FBJ B;  1L7Y A;  3ZNG C;  1WY8 A;  2BBC A;  2MP2 B;  2G4D B;  1C9F A;  5FK9 C;  3NVY A;  2J52 A;  2FCM A;  4ZYN A;  1JWB D;  2WXG A;  1WGH A; 
#chains in the Genus database with same CATH homology
 2KQ7 A;  2RD0 A;  3HK0 A;  3M95 A;  4MGZ E;  4BFR A;  2N4F A;  1J0G A;  1WXA A;  3APC A;  3R7Q A;  3PRZ A;  5BO4 B;  5D2M B;  1TTN A;  2ZZP B;  3RT3 B;  2L8J A;  3ZLZ A;  3DBL I;  3H1U A;  2NBV B;  2M0X A;  4M8M A;  2CHZ A;  4NJ6 A;  3A4S C;  1OTR B;  1WE6 A;  2LI5 A;  4BKS A;  2HE7 A;  4FN2 A;  2K8C A;  4HLE A;  1LM8 B;  2ZCC A;  3AI5 A;  4HJK A;  2EKE C;  4WJN A;  3OAW A;  1WGG A;  4GU2 A;  1R4M I;  3PHX B;  3L10 B;  3ZNZ B;  2K1F A;  2QHO A;  1E7V A;  2KWC A;  4EKU A;  5E6P A;  3VTW A;  5L95 C;  1P0R A;  1XT9 B;  4IWQ A;  4BBN F;  1KM7 A;  4EEW A;  2LGX A;  3R7R A;  4W9H A;  2MBO A;  2MA9 B;  3CSF A;  4N9F 4;  2DX5 B;  3QIJ A;  2DHZ A;  3PLU A;  2ZJD A;  2OOB B;  2RPQ A;  5D94 A;  3QCA A;  2K8H A;  3DVN V;  4PYZ A;  2HTH A;  4MGY E;  2RGF A;  2KLC A;  4MM3 A;  3B08 A;  1WMH A;  2MP2 A;  2L76 A;  1Z5S B;  4TQ1 A;  3UQB A;  1LFD A;  2KWV B;  1TBE A;  2ZEQ A;  2K6Q A;  3KW5 B;  1C1Y B;  3AXC A;  2DEN B;  4OVV A;  1GC6 A;  2ZCB A;  2L3Z A;  3Q3F A;  3IVF A;  3QC8 B;  1LQB A;  1IP9 A;  3WIM A;  4NAW B;  4ANV A;  4DXA B;  3NZU A;  4G50 A;  2CHW A;  1U4A A;  2KFJ A;  2KX0 A;  4W9G A;  1UBQ A;  3DQV A;  3PHW B;  3UGB B;  4AP4 C;  1EO6 A;  4B95 A;  3X23 A;  2W9N A;  1GC7 A;  2KJR A;  1WYW B;  4WAA A;  4ANX A;  2ZVO A;  4GN1 A;  4PYU A;  2LJ5 A;  2NBW B;  2NS5 A;  4HXD A;  4ICU A;  4LDT D;  4W9J A;  3IFW B;  3PZD A;  2KJ6 A;  2EMT A;  2DAF A;  4II3 B;  3DPD A;  4HK2 A;  1YJ1 A;  2C7H A;  1V86 A;  2K8B A;  4JL9 A;  2LGD A;  1E8X A;  3NHE B;  3KUZ A;  4XX5 A;  3QHT A;  4HDQ A;  2AWT A;  2IO2 B;  2JXX A;  2ZVN A;  4NQK E;  3N30 A;  2MLB A;  2KLG A;  4DDI D;  2IBI B;  4IM2 A;  3VDZ A;  4JGH B;  2KO3 A;  2O6V D;  3RZF A;  5CTR C;  2KDI A;  4M8N A;  2CS4 A;  2G45 B;  2BPS A;  3NS8 A;  1YIW A;  3RD2 A;  1E5W A;  3T8M A;  3VH4 B;  2JPH A;  2VRR B;  1XQQ A;  2NPT B;  4HDO A;  4BOS C;  4YL8 A;  1D3Z A;  2ZNV C;  1I42 A;  2M8S A;  2L00 B;  1WGD A;  2OJR A;  3NOB A;  2DZJ A;  4F8C B;  5GMV A;  2FNJ B;  5G2N A;  3VUW A;  1WI0 A;  1WIA A;  4MSM B;  4MSQ B;  2IY1 B;  2V3S A;  2K39 A;  2DAJ A;  4EZJ A;  1V80 A;  1GJZ A;  3PGE A;  3VUY A;  3OLM D;  2FUH B;  2C9W B;  5J2R A;  1EUV B;  4DK5 A;  3RZW C;  1ZGU B;  2GBN A;  3I3T B;  4W9L A;  4A3O A;  1RAX A;  3DVG X;  3CF6 E;  4NJ7 A;  1V5O A;  1RLF A;  4DWF A;  2KHW B;  2D10 A;  3JSV A;  4B9K A;  3U8Z A;  3SD5 A;  2WDT B;  3R66 C;  4AJW A;  1QZE A;  1SIF A;  2YVC A;  2AL3 A;  2ZNV B;  3KVF B;  1YQB A;  4W9K A;  3UIP B;  3NZS A;  1I35 A;  1E7U A;  3EEC A;  3DBS A;  3ZNH B;  2JRI B;  5AZH A;  1RRB A;  5CX3 A;  3ZNI D;  2K25 A;  2JY6 A;  1CMX B;  5CHV C;  5J17 A;  4DBG A;  2KMA A;  3VXW A;  4ZDV A;  3ECI A;  3LJ3 A;  2GMI C;  2NPT A;  1UZX B;  3UIN B;  3B0A A;  2XBB C;  3JYU A;  5JHB A;  2JZ3 B;  2KXJ A;  3ZKJ C;  1A5R A;  2UYZ B;  4M0W B;  3EFU A;  4RM9 A;  3L0W B;  3IG3 A;  2DZI A;  4BKT A;  2M1M A;  4FHK A;  4HCN B;  3PRE A;  1WE7 A;  2AL6 A;  2KVR A;  2XEW A;  3HHM A;  1NDD A;  3PV1 A;  2MBB B;  1P9D U;  1WXM A;  4FHJ A;  3RUI B;  3C0R B;  4EZL A;  3TJP A;  2KX3 A;  3VAW A;  4IWP A;  4KV2 A;  2MBQ A;  1WJU A;  2BKF A;  2N1V A;  1WX9 A;  2G4S A;  2LGY A;  2WX1 A;  3VVW B;  4HVB A;  3ZIM A;  1WF9 A;  2NCN A;  2BGF A;  3IBE A;  4DDG D;  4GMV A;  3H7P B;  4KDI C;  2KJH B;  3MTN B;  3PT2 B;  4RMA A;  2JF5 A;  1OEY J;  4G3X B;  5DCN A;  2J7Q B;  4NNJ B;  1ISN A;  1V6E A;  4WJP A;  2N7D A;  1Q1O A;  1WRD B;  2IO0 B;  4W9E A;  1WGY A;  4FJV B;  2BYV E;  3CMM B;  3R3M A;  2XK5 B;  1TZ1 A;  3TL5 A;  2ASQ A;  4ANU A;  5D6J B;  5JH5 C;  2I1J A;  3ZTD A;  1UBI A;  3PTF C;  2KTF A;  4TUU A;  3H9D A;  1E8Z A;  3SHQ A;  1KLV A;  3PRP B;  2JWZ A;  4CO7 A;  2LRW A;  2FCN A;  5J18 A;  3KYD D;  5AZG A;  4KIK B;  2N9E B;  1YD8 U;  1WH3 A;  4KVG B;  3SDL C;  4ASW C;  3KUD B;  4LJO B;  2NBU A;  1VD2 A;  5E6N A;  4FLH A;  3PRM B;  2KC1 A;  2FIF A;  3LDZ E;  3ZTC A;  4IM3 A;  4EUT A;  2GBJ A;  2KDF B;  1Z2M A;  1UGM A;  2M17 A;  4BKG A;  2LWP A;  1UH6 A;  4IM0 A;  4W9D A;  4AOF A;  3Q3J A;  2J0M A;  2JUO A;  3DBH I;  3B1L X;  3HIZ A;  5IA7 A;  5KHQ A;  3N32 A;  4GDK B;  2L7R A;  2BYF A;  4LDT B;  1P1A A;  3S2A A;  3DDC B;  2WYQ A;  4WWO A;  2M4N A;  2MSE D;  4GOC A;  3L16 A;  3H7P A;  2DYO A;  2BWF A;  5E6O A;  1EF5 A;  1UD7 A;  2C5L C;  5G55 A;  2JVC A;  3EHV A;  3TBL D;  1V9J A;  2CKH B;  2IO1 B;  2LD9 A;  2WWZ A;  3PLV A;  4HWI B;  4JLC A;  2LVQ A;  4KZ0 A;  4CHK A;  2I1K A;  2LAS A;  2N7E A;  2O6V B;  3DOW A;  2BF8 B;  4ZRK A;  3VTU A;  2JT4 B;  4MH0 E;  4II2 B;  4MEL A;  1WR1 A;  1EF1 A;  2MCN B;  4BBN C;  2LRU A;  2CHX A;  1Y8R C;  1WZ3 A;  2Z0E B;  3APD A;  4KSL C;  2EMS A;  3A33 B;  4NAW A;  3AU5 A;  2DZM A;  4W9F A;  2K6D B;  3KUC B;  4KIK A;  4HPL B;  4IW0 A;  4J6I A;  3VTV A;  3ZRF A;  4BKS D;  4E3C A;  2KAN A;  4I6P A;  3UQA A;  4MEM A;  3JW0 X;  1G6J A;  3RCZ A;  3QJZ A;  4IC7 B;  4DHJ D;  2CU1 A;  1KOT A;  4A20 A;  4GSW A;  3V6C B;  2MBH A;  2NVU I;  3V6E B;  3ZRC A;  2GBK A;  1WX7 A;  2BYE A;  2HD5 B;  4CYE A;  5LLI A;  3ZVV A;  1S1Q B;  3BIN A;  2Y5B B;  2O2V B;  4KSK C;  4GDK A;  4GIV A;  2KD0 A;  1WXS A;  3WA0 A;  2V4L A;  2PPH A;  3WAM A;  3GOE A;  2IZV B;  1XD3 B;  3A9J B;  2BWE S;  4ICV A;  3VH3 B;  2GBM A;  1SE9 A;  1ZKH A;  2JRH A;  2Z0D B;  2KN5 A;  2GBR A;  3A9K B;  3DVN U;  2KK8 A;  3ML8 A;  2MRP A;  3CST A;  2D2Q A;  4G11 A;  4IUM B;  1AAR A;  2N9X A;  5DPW A;  3DBR I;  4I6N B;  3QAQ A;  3MJW A;  4A3P A;  2O6V A;  2KC2 A;  1SGH A;  1WJ6 A;  4KZC A;  2G3Q B;  2R2O A;  1WXV A;  2KDB A;  2L05 A;  4IG7 B;  4FAD A;  2MWS B;  3OJ3 A;  3P2B A;  4HCP B;  5IAA C;  4DHZ E;  3K9P B;  3W1S C;  3NY5 A;  1V5T A;  2DYM A;  4W9I A;  4IWO A;  2MW5 A;  3QX1 A;  5TR5 A;  1OEY A;  1WZ0 A;  1J19 A;  2AEH A;  1P3Q U;  4PS3 A;  4XZ4 A;  4LJP B;  5DPT A;  2JZZ A;  3HM6 X;  3KH0 A;  4MGK E;  1V2Y A;  3RYT A;  1RFA A;  5JHA A;  1C3T A;  4KDL B;  4MDK E;  1M94 A;  2WX0 A;  1WFY A;  2MX2 A;  3JVZ X;  2AYO B;  2LVP A;  3UF8 A;  3DCG A;  2KKC A;  3IHP C;  2FAZ A;  2Z59 B;  4NQL B;  2C60 A;  1T0Y A;  2MBE A;  4GXB A;  4EOY A;  2ZPN A;  3VHT C;  2A5U A;  1Q0W B;  2O2V A;  1WGR A;  3W1Y A;  1NBF C;  4FA6 A;  2KTR B;  1YX6 B;  1HE8 A;  4PS8 A;  2LUE A;  3WAL A;  1V81 A;  4K7U A;  2IO3 B;  3EC8 A;  3T9L A;  1E8W A;  4E71 A;  3A9J A;  3U30 A;  3GZN I;  3TCA A;  1L2N A;  2REX A;  4AUQ C;  2LVO A;  2V1Y A;  5D7G A;  4FUL A;  4X57 B;  3A9K A;  5AZF A;  1PQS A;  2KDE B;  4JQW C;  1WM3 A;  3ZUN A;  3APF A;  1J8C A;  3V62 A;  2CR5 A;  4TQ0 A;  1K8R B;  2PE6 B;  2D11 A;  3VFK A;  2C7N B;  3N3K B;  2KWU B;  3RUL A;  1FXT B;  4F7Z A;  3AUL A;  3UIO B;  4F1S A;  4ZRJ A;  4I6L B;  1TGZ B;  4G0N B;  2L0T A;  4ANW A;  1YX5 B;  1NI2 A;  3TMP B;  4MJS B;  2D07 B;  4WQO B;  4HPM B;  3QQ8 B;  5EDS A;  5C23 A;  3L08 A;  3PSE B;  4ZRI A;  4LCD E;  2YLM A;  1Q5W B;  4K1R B;  1LXD A;  4GGQ A;  2KFK B;  5JZE B;  2RSU A;  2A4Z A;  3H6N A;  1BT0 A;  3ALB A;  5KHO A;  3AU4 A;  2J0K A;  4WJO A;  1S3S G;  1UEL A;  3VQI A;  4BOZ B;  5CHF A;  4EZK A;  5LXH A;  3L17 A;  2C7M B;  3DVG Y;  4P7I A;  3X0W A;  2LXC A;  2L0F A;  4DHZ B;  4K7S A;  3A4R A;  2KTR A;  3WAO A;  3WAP A;  3L54 A;  4AJY B;  2B3A A;  4BVU C;  1F9J A;  3QK0 A;  2RR9 A;  5DPR A;  3ZW3 A;  2PE9 A;  4AWJ A;  3ENE A;  2KZR A;  3K9O B;  4GDL B;  5L83 A;  2XK5 A;  3JSV B;  4NPN A;  1VCB A;  1WM2 A;  2KNB A;  3U7D A;  3W1S A;  3WAN A;  3ZDT A;  5LXI B;  2DYB A;  2LXA A;  2NR2 A;  2J0J A;  3MHS D;  4OVU A;  3A1Q B;  4K7W A;  2MQJ A;  3O65 B;  1X1M A;  4B6W A;  1KJT A;  4EFO A;  4TV3 A;  2FID A;  2DZK A;  4FJZ A;  2N1W A;  2UWQ A;  2D3G A;  2FCQ A;  3VUX A;  3QWZ B;  4WWN A;  1MG8 A;  3H7S A;  5HKH A;  1V49 A;  3ZO5 B;  5DPS A;  3V61 A;  1IPG A;  4MJS A;  2IY0 B;  1GG3 A;  2GOW A;  3M63 B;  4NY0 A;  1GNU A;  3V60 A;  3ONS A;  1IYF A;  4JIO U;  2FCS A;  4PS7 A;  5CHW A;  3ZDM C;  3PS6 A;  4DHJ B;  1OQY A;  2KFK A;  2LZ6 A;  3M3J A;  2PEA A;  3KYC D;  3M62 B;  3ML9 A;  1E90 A;  3D32 A;  3TIX A;  3BY4 B;  4XC2 A;  4K81 A;  1OGW A;  1WR6 E;  4MGI E;  4W9C A;  4URK A;  2BKR B;  4TKN A;  1ZW7 A;  2HJ8 A;  1H4R A;  4WWP A;  1WJ4 A;  1WX8 A;  3QAR A;  2IYD B;  5C1Z A;  1R4N I;  1GUA B;  1WJN A;  2ZPY A;  2KQS A;  4GDL A;  4FJY A;  2R2Q A;  2PJH A;  1L7Y A;  2N9P C;  4GB9 A;  4FBJ B;  1H8C A;  3ZNG C;  1E8Y A;  3PVL A;  2KOX A;  3QA8 A;  4RM8 A;  5AEK B;  1WMH B;  1WY8 A;  2MP2 B;  1P98 A;  4E74 A;  2G4D B;  1JRU A;  3A1Q A;  3HM3 A;  3L13 A;  3OJ4 B;  3PPA A;  5FR6 A;  3SU8 X;  4WJQ A;  2FCM A;  2KMC A;  4ZYN A;  1WGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...