3ZTDA

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 19
structure length 102
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztdA00
2V4LA 3QK0A 4IWOA 2G45B 3V6CB 2KTRB 4ANXA 2WX1A 5J17A 4AOFA 2PEAA 5C1ZA 2IY1B 2IY0B 2B3AA 2MSED 3PHXB 4W9IA 3PS6A 2L8JA 2L7RA 5TR5A 2KO3A 3SD5A 3ZTCA 2MCNB 4BVUC 4KIKB 2FCQA 1GNUA 4N9F4 3QWZB 5LXIB 4MH0E 3DVNU 2BKRB 1Y8RC 2OJRA 2DX5B 2Z0EB 2BF8B 2GBMA 3L16A 2EMSA 3IG3A 1E8YA 2CKHB 3APDA 3EC8A 3PT2B 1WGYA 4E3CA 1WXAA 3VTVA 4HLEA 3NZSA 3ZLZA 3AI5A 4GDKA 3LDZE 3HHMA 2BWES 1WI0A 4GIVA 2N4FA 3EECA 1ZW7A 3M3JA 3DBSA 1WE6A 1ISNA 2KWUB 3N32A 4IWPA 4BKSD 1P1AA 3IBEA 3DCGA 3CSTA 2C7MB 1R4MI 3PPAA 2J0KA 4WWNA 5CHFA 3PGEA 2V1YA 1SIFA 1J19A 1S1QB 4WJOA 3A9KB 3ZKJC 3ZRCA 4BOZB 2O6VB 4KV2A 2BYVE 2LJ5A 3VHTC 3NHEB 5CHVC 3B0AA 3O65B 4HDQA 2KX3A 5JZEB 3ZTDA 3ENEA 4M8MA 4FJVB 2LGDA 1MG8A 4ZYNA 1GG3A 1YX5B 2NS5A 2VRRB 1LM8B 2UWQA 2DYOA 2C7NB 3AU4A 3PRMB 4KSLC 4KZ0A 4WQOB 3RT3B 1KLVA 1XT9B 1WF9A 3R3MA 3MJWA 1WZ0A 3KYDD 1J0GA 2PJHA 1UH6A 1OQYA 2A5UA 1WRDB 3UGBB 4II2B 5D6JB 2LUEA 4K81A 3V62A 5AEKB 5CHWA 2J7QB 4ICUA 5IAAC 4X57B 2I1JA 3VDZA 4BBNC 5E6OA 4NJ7A 1RRBA 2MWSB 2NBWB 2KLCA 4DHZB 1WY8A 3MTNB 3VUXA 3UQAA 4NQKE 1EO6A 1OEYA 4MGYE 5L83A 2MLBA 1AARA 2AL3A 3IFWB 2MBQA 4HJKA 1E7UA 3B1LX 1GC6A 2JRIB 4ANVA 2NPTA 2LXCA 4K7SA 4KIKA 2KFKB 2JT4B 4AWJA 2JPHA 4P7IA 3APCA 1OTRB 2K6QA 2KJRA 3M63B 3KUZA 3ECIA 2REXA 1TGZB 3QAQA 2L05A 1JRUA 3LJ3A 3WA0A 4DWFA 3PSEB 2RD0A 5AZHA 4W9KA 2FCSA 2KZRA 3P2BA 3TCAA 3PVLA 1UBIA 1VD2A 4B95A 3ZDMC 1EF1A 2MBBB 2EMTA 2GOWA 2ZZPB 1X1MA 1D3ZA 3WAMA 2LZ6A 4GMVA 4W9LA 2O2VA 1WMHB 3SDLC 4K1RB 5FR6A 2ZVNA 2V3SA 3A1QB 1KOTA 2XK5B 3DQVA 2NBUA 1QZEA 3VXWA 4BKSA 2MA9B 2J0JA 3RUIB 2AL6A 3RZFA 2D2QA 3N30A 5AZFA 2LXAA 2HJ8A 1GUAB 3UINB 2L0FA 2LWPA 1OEYJ 2PE9A 5C23A 2KLGA 4ZRJA 4CO7A 1EF5A 2LGXA 5KHOA 1ZGUB 4KVGB 1WIAA 2MQJA 2C9WB 4YL8A 4TUUA 1L2NA 2FAZA 4G0NB 3JVZX 3ZNID 4EUTA 4NQLB 3QC8B 2NCNA 2DENB 2KNBA 3PTFC 5D94A 4DHZE 4FA6A 2FIFA 2KOXA 4G3XB 4GDKB 4ASWC 1VCBA 4LCDE 4HCPB 4GSWA 3TL5A 2FIDA 4FHKA 1H4RA 3L54A 3QA8A 3ZNZB 4TQ0A 4DHJD 2DAJA 2ZPYA 2JZZA 4NJ6A 4ZDVA 2DZKA 4URKA 3R7RA 4RMAA 1WGRA 2G3QB 2CU1A 2M8SA 4HXDA 2Z59B 1Q5WB 4HWIB 2AWTA 4DDID 3AU5A 1E8WA 4BKGA 4OVVA 4FN2A 4WJNA 3R66C 3V6EB 3X23A 2ZJDA 4FADA 2RPQA 3V60A 3TMPB 3HK0A 2CHWA 1LXDA 2JUOA 1I42A 4MGIE 4DBGA 3L17A 4AP4C 4BOSC 4PS3A 4JGHB 3ML9A 1E7VA 3A4SC 2R2QA 2KDEB 3KUDB 3QHTA 4LDTD 4W9FA 1V6EA 3TIXA 2C60A 1WXMA 1WM3A 3VUYA 2WDTB 3PLVA 2KKCA 1BT0A 1S3SG 2GBJA 3M62B 4M0WB 2M0XA 2K25A 4MSQB 2M1MA 1WJ6A 2RGFA 3QIJA 1V80A 2N1VA 3M95A 2IZVB 4B9KA 2JXXA 2WX0A 4PYUA 3BINA 2L0TA 1WJUA 2D10A 3Q3FA 1WGDA 1UELA 3W1SC 3VH3B 1V5TA 4G50A 2PPHA 2GBKA 2KMCA 3VQIA 3DVGX 4IW0A 4ZRKA 3DVGY 4RM8A 4CYEA 5G2NA 1PQSA 2IBIB 3JSVA 5D7GA 2HD5B 1WR1A 2LGYA 3ZW3A 2KC2A 1WJ4A 2ZPNA 3ONSA 5G55A 4EOYA 3ZDTA 1WGHA 3TJPA 4DK5A 1GJZA 2XEWA 2L3ZA 3WALA 1P0RA 3DDCB 3OJ3A 4E74A 2JWZA 4A3OA 3VTWA 1OGWA 1U4AA 2GBRA 3QCAA 2EKEC 1NI2A 2KTFA 4NY0A 2K39A 3UF8A 4EZJA 4IG7B 1I35A 3KUCB 2ZEQA 2KDBA 4I6LB 1LQBA 4ZRIA 1IPGA 1WR6E 3I3TB 1A5RA 1IYFA 2M17A 4W9GA 1WMHA 1UGMA 1KJTA 4MGZE 2N9XA 1WXVA 3L13A 2NBVB 3GOEA 5GMVA 2KWCA 4W9EA 3QQ8B 2LASA 1UBQA 1WFYA 2A4ZA 4HDOA 4K7WA 3JSVB 1WJNA 3JW0X 2NR2A 3H7PA 5HKHA 4PYZA 3TBLD 2MBEA 1CMXB 1NDDA 4M8NA 1P9DU 4A3PA 3DVNV 2KDFB 4HK2A 2AEHA 2K8CA 2L76A 3VAWA 3IVFA 5IA7A 4RM9A 4G11A 2FUHB 4WAAA 2N7DA 4MDKE 3VH4B 1C3TA 3DPDA 5JH5C 4IM0A 2BWFA 2KN5A 3S2AA 2DYMA 3EFUA 2W9NA 3R7QA 5J18A 2KMAA 1Q1OA 4GGQA 1HE8A 3A1QA 1TTNA 3CMMB 2XK5A 3NZUA 3RD2A 1YD8U 3AULA 4KDLB 4MSMB 4TV3A 1TZ1A 2KD0A 2KC1A 3A9JA 3A9KA 3WIMA 3ML8A 4DHJB 1XD3B 2O6VA 3PREA 4NNJB 4ANUA 3U30A 3ALBA 1C1YB 2LVQA 3H7PB 3H6NA 4KSKC 1F9JA 5BO4B 5KHQA 2LVPA 3DBHI 2D11A 3MHSD 4MELA 1Q0WB 2GBNA 3PRPB 4FJYA 2JZ3B 5LLIA 2N1WA 3SU8X 5D2MB 4W9HA 3WAOA 4AJWA 4JL9A 3N3KB 4AUQC 2HTHA 4AJYB 1E90A 5LXHA 1M94A 4NPNA 3WAPA 1EUVB 4IM2A 4JLCA 3B08A 2JF5A 3PV1A 4IWQA 2K1FA 4WWOA 1E5WA 3V61A 1J8CA 4LDTB 2IO0B 3EHVA 1V5OA 1WX7A 3RCZA 2N7EA 4W9JA 4BFRA 3GZNI 3IHPC 3VTUA 2KWVB 3PHWB 3ZO5B 4I6NB 3ZNHB 1V81A 2BYFA 1WGGA 2R2OA 4GDLB 2CS4A 2OOBB 1T0YA 4HPLB 4MJSB 2KXJA 4GOCA 4WJQA 3U7DA 1V9JA 5DPWA 2Y5BB 1L7YA 3Q3JA 4WJPA 4MJSA 1WYWB 3QARA 2WYQA 3PZDA 4II3B 1SE9A 4HPMB 2JRHA 2LI5A 2JY6A 2KHWB 2NPTB 3VFKA 2DHZA 2UYZB 2MX2A 4JIOU 2I1KA 4EFOA 3DBRI 3OLMD 1R4NI 2MP2A 4NAWB 1WZ3A 3L10B 4BBNF 3QX1A 5JHAA 1E8ZA 5AZGA 4A20A 2ZCCA 4B6WA 2LRUA 3ZNGC 3VVWB 4GN1A 2MP2B 4NAWA 2ZCBA 4IC7B 4JQWC 1H8CA 3W1YA 1FXTB 2L00B 2D3GA 3CSFA 2PE6B 3PRZA 2G4DB 1RLFA 1WM2A 4WWPA 2DAFA 2KTRA 1YIWA 1ZKHA 1RFAA 2MW5A 4KDIC 5L95C 1Z2MA 3T8MA 4EKUA 4ANWA 2KANA 1WX9A 3PLUA 4GU2A 2BKFA 5DPRA 3U8ZA 2FCMA 4DDGD 2KDIA 3JYUA 4F8CB 2KVRA 3T9LA 1GC7A 2QHOA 4ICVA 2JVCA 3WANA 2ZNVC 3C0RB 2GMIC 2BPSA 2YLMA 3CF6E 3H1UA 1NBFC 3KH0A 2DYBA 1YQBA 1KM7A 2DZMA 2RR9A 4IM3A 4PS7A 3A33B 2ASQA 4W9CA 3SHQA 5E6PA 1V86A 1V49A 1IP9A 4I6PA 2M4NA 2O2VB 2KQ7A 5CTRC 4F1SA 3KW5B 3KVFB 2MRPA 2IO2B 2KQSA 5J2RA 2CR5A 3APFA 4MGKE 4IUMB 4HCNB 3A4RA 5DPSA 3H9DA 2MBOA 3L08A 4LJOB 4MEMA 3W1SA 5CX3A 2FCNA 4PS8A 3OJ4B 4FULA 2DZJA 3K9OB 4TQ1A 3RZWC 4W9DA 2G4SA 3NS8A 4MM3A 4CHKA 2KX0A 3KYCD 4OVUA 2K8HA 5DCNA 1V2YA 3ZRFA 2IO1B 1P3QU 2ZVOA 3HM6X 3HM3A 2N9EB 5EDSA 5E6NA 4LJPB 3RULA 2KK8A 4XC2A 3VUWA 2DZIA 1XQQA 2ZNVB 3UIOB 5DPTA 3BY4B 4EZLA 4K7UA 4F7ZA 2CHZA 3AXCA 3D32A 1WX8A 2LVOA 1YX6B 4FLHA 2Z0DB 2J0MA 2BYEA 4FHJA 4FBJB 2IO3B 1LFDA 2K8BA 1UZXB 3QJZA 4J6IA 2RSUA 1WH3A 2N9PC 4XZ4A 1P98A 1G6JA 2AYOB 3NOBA 3ZVVA 4GXBA 1UD7A 2LRWA 4E71A 4EEWA 2KJHB 1Z5SB 3A9JB 2C5LC 4FJZA 4TKNA 3X0WA 4KZCA 2K6DB 2C7HA 2KFKA 3UIPB 1RAXA 2BGFA 4GDLA 4BKTA 2YVCA 3ZUNA 3ZIMA 2NVUI 2D07B 2XBBC 2KJ6A 3UQBA 3L0WB 2CHXA 1WXSA 2WWZA 3H7SA 2MBHA 3HIZA 3K9PB 1E8XA 4EZKA 2FNJB 3OAWA 3DOWA 4GB9A 3RYTA 2KFJA 3NY5A 4XX5A 4DXAB 1TBEA 3DBLI 4HVBA 1K8RB 1YJ1A 2O6VD 5JHBA 2IYDB 1WE7A 2HE7A 2LD9A 1SGHA
chains in the Genus database with same CATH superfamily
4XWWA 2OJWA 4KKJA 1BUIC 2G45B 2WX1A 4AOFA 4K3CA 5C1ZA 3AE8B 4W9IA 3PS6A 2L7RA 2SAKA 3SD5A 3URYA 3RMKC 1TJEA 4IKGA 1GNUA 4N9F4 2BKRB 2MJEA 2GBMA 2PVOD 1FCCC 3IG3A 3APDA 1FM0D 3PT2B 1WGYA 1L4DB 1WXAA 1WI0A 2N4FA 3EECA 1E6EB 1N61A 2WDQB 1SIFA 3ZRCA 1B9RA 2O6VB 2BYVE 3VHTC 2RPVA 3NHEB 5CHVC 4N6EB 4M8MA 4FJVB 3Q8EA 4ZYNA 1GG3A 2DYOA 4YTMB 2C7NB 2GLSA 2JU6X 4KZ0A 1XT9B 1WF9A 3NVZA 1J7AA 4C00A 1J0GA 3W5VB 1UH6A 5AUKA 3UGBB 1ZUD2 3GE3C 3P4RB 4K81A 3V62A 5AEKB 3DHGC 2J7QB 1N60A 4X57B 3Q8CA 4BBNC 5E6JA 2KLCA 3VUXA 1OEYA 4MGYE 3ZXVA 3P4PB 1UF0A 1PGAA 4K7SA 2JPHA 3APCA 2MJDA 2KJRA 3P4QB 2WQYB 1FNVA 2RDHA 1JRUA 2B76B 2D3BA 2KZRA 3PVLA 3ZDMC 1E7PB 5HI1A 2GOWA 4HPPA 3AE1B 1WMHB 3SDLC 3W5UB 1JWAD 3A1QB 1F2RI 1QZEA 3SFEB 3EUB2 3RUIB 1I4GA 2D2QA 2IJ0A 2LXAA 3SFDB 2WXOA 1UGJA 2KLGA 1WWTA 5KHOA 2W55A 1BXTA 3N1ZC 4G0NB 3JVZX 3ZNID 4NQLB 3QC8B 1MVKA 4DHZE 4FA6A 4C4VA 5D3DA 4RGTA 1KLUD 4LCDE 4GSWA 1ZDXA 2WXNA 4ZDVA 2DZKA 1QF6A 1CJEA 1JQ4A 1WGRA 3DHIC 1MI0A 4BKGA 4YT0B 4OVVA 4FN2A 1BMLC 4D2KA 1NENB 2G9HD 5IOIA 1V1PA 3E9SA 1AW7A 2NTTA 4LDTD 1SEBD 1ZPSA 3A4SC 3QHTA 1MPEA 3DWMA 4YXDB 3M62B 1WJ6A 2N1VA 4A8XC 4PYUA 3ZXRA 2L0TA 3KQ4A 4YSYB 1PFDA 2INDC 4LNKA 2QC8A 1V5TA 2KMCA 1F52A 3VQIA 4ZRKA 2V3PA 4XDCA 4CQNA 3JSVA 4ZYSA 3ZW3A 5BYSA 1QT9A 3HRDD 5G55A 2NMQA 3TJPA 4DK5A 2XEWA 5G5GA 3OJ3A 2JWZA 1EU4A 4WURA 5G5HA 1U4AA 3QCAA 3UF8A 2RDGA 2ZEQA 1CQVA 2KMMA 2KDBA 1I4RA 4ZRIA 3I3TB 2QILA 1A5RA 4RNAA 2M17A 1UGMA 1A70A 4MGZE 2NBVB 3GOEA 2I2YA 3W2DA 4ZOHC 3AEAB 2LGSA 3JSVB 1XLNA 2QJLA 2JYEA 2MBEA 4A3PA 5BMHA 2K8CA 3IVFA 4G11A 3LB8C 3MC8A 4OHJA 4IM0A 2KN5A 1I7HA 1TKYA 2LUMA 2KMAA 3ABVB 3NVVA 1OQQA 2W82A 1TTNA 3CMMB 3PZ8A 5HFYA 4AS1A 1EM7A 3A9JA 3A9KA 3CIRB 2W3SA 2MJ3A 2WDVB 1XLPA 1ET9A 2JXTA 1I4QA 3MHSD 3WAOA 2Y3AA 2X38A 1SJHD 5LXHA 1M94A 2M56B 3WAPA 5EE3A 1E5WA 1J8CA 1WX7A 3RCZA 2K5PA 1HTOA 3GZNI 1T0QC 3L4PA 1ACCA 1B1ZA 1WGGA 2OOBB 1T0YA 2NTSA 5DPWA 1L7YA 4WJPA 4L1BA 1C4AA 3NJTA 2WYQA 4II3B 1SE9A 2VH2A 4ZRQA 3B2FA 3AV8A 1IBXA 2PLPA 2KHWB 4OZBA 2I1KA 2IGDA 2J52A 1R4NI 5JHAA 1J7CA 4A20A 3VVWB 2V3NA 2BS2B 2MP2B 4NAWA 3WCQA 4L23A 2VH1A 1CZPA 1L0YB 1KRHA 4S17A 1HXYD 1HZ5A 2PE6B 1DOXA 1FIQA 4WWPA 4P16A 3RNGC 2DAFA 2KTRA 2IGHA 4XGAB 1Z2MA 3H8HA 4KGTA 4EKUA 2E6XA 4GU2A 2BKFA 2KDIA 2IDYA 2DWQA 2ICIA 2JVCA 2ZNVC 2DYBA 1KM7A 2QEJC 2DZMA 5C3JB 2WXPA 3A33B 3IXSA 2O2VB 2CJNA 2QMTA 3ETRA 2IO2B 3FILA 1VR9A 1KLGD 5J2RA 2CR5A 4IUMB 3EFCA 3N1YC 2JX5A 3H9DA 4NZLB 1I4PA 4PS8A 3OJ4B 4TSSA 4W9DA 1QOGA 2G4SA 3NS8A 4MM3A 4CHKA 4B0MA 5IP4D 1QILA 1JMLA 1V2YA 2I38A 2WHIA 2IO1B 1L4ZB 3O13A 3RULA 2KK8A 3VUWA 2DZIA 1XQQA 3FAHA 4EZLA 4K7UA 2HJ1A 3HVZA 5BMGA 2BYTA 4PT5A 3AXCA 2PTLA 2LVOA 3IAM1 2Z0DB 4RCOA 3ZQ4A 4N59A 2BYEA 4FBJB 3DBLB 4J6IA 1UZXB 1JWUD 1L0VB 2N9KA 4AQ7A 2LRWA 4E71A 3PZ7A 3UIPB 4BKTA 1FCLA 3ZUNA 3NS1A 3ZIMA 2NVUI 3MJ5A 2D07B 3RNCC 1XXGA 3UQBA 2MH7A 1NVID 3H7SA 2MBHA 1E8XA 2FNJB 3OAWA 3RYTA 4XX5A 1FXIA 1ET6A 3RPFC 3DBLI 3NG0A 2QIEB 1N63A 1FO4A 3BIID 1FRDA 2XN9C 2KTRB 4ANXA 2PEAA 2IY0B 2BW2A 3T3OA 1R4MB 2L8JA 2XNAC 1QOFA 2KO3A 4BVUC 3QWZB 3U2SC 2Z0EB 2OJRA 3U4EG 2PW9A 1UNSA 2EMSA 2CKHB 2BWES 2WNMA 3Q8FA 4IWPA 1WE6A 4BKSD 1D5MC 5T8IA 1P1AA 3IBEA 2V0GA 3MC9A 3PPAA 4WWNA 3PGEA 1J19A 3ZKJC 3NRZA 4LK0M 4ZHOA 2KX3A 5JZEB 3ENEA 2LGDA 1F77A 2NS5A 3PRMB 3AU4A 1TT5B 4KSLC 2BS3B 1PGXA 1YN5A 1D5XC 4MT5A 1WZ0A 3KYDD 1OQYA 2A5UA 4II2B 1MG4A 3P63A 4ICUA 5IAAC 1R4NB 2LMCA 4NJ7A 1RRBA 2MWSB 1WY8A 3MTNB 3UQAA 4NQKE 2Q5WD 1YQ3B 1C79A 1XCQL 2AL3A 2MBQA 4L2YA 1GC6A 2JRIB 4LLGM 2NPTA 4ANVA 4AWJA 2JYTA 2KFKB 1ZXIA 4P7IA 1OTRB 1TGZB 4BAXA 2RD0A 4W9KA 5EE1A 4YTPB 1UBIA 1E9MA 3TEZA 2EMTA 1YNTE 1XLOA 3WAMA 3BZDB 2H88B 2ZVNA 4P6VF 4US9A 4C7YA 3BK2A 3DQVA 1N5WA 2FBWB 3ZYYX 1YOVB 3NUHB 2ZW0A 2L0FA 3B2GA 5C23A 1F1HA 4ZRJA 4CO7A 3TEXA 1ZGUB 2MQJA 2C9WB 2FAZA 3PO0A 2LHDA 2KNBA 5D94A 2FIFA 2KOXA 4G3XB 4GDKB 2KAJA 1VDVA 1RFKA 4FHKA 3L54A 2WU2B 4LNIA 4RGOS 1L5PA 1ZDVA 1N5XA 1K53A 3R7RA 4RMAA 1GB4A 2Z59B 2AWTA 4DDID 2D5GA 1E8WA 3SEBA 3FC4A 4WJNA 3R66C 3TMPB 1C77A 1LXDA 2CHWA 4P1CC 1I42A 2EELA 3L17A 4AP4C 3AEGB 2R2QA 2KDEB 3KUDB 3TIXA 2IPKD 1WM3A 2WDTB 4DQOC 3PLVA 2KKCA 1BT0A 2LFIA 2M1MA 3GS2A 2FE8A 2WX0A 1OQRA 4OZCA 3AE2B 1WGDA 1NI3A 5LNK1 2KT7A 2GBKA 2GI9A 3DVGY 1TY2A 4RM8A 5D7GA 1WR1A 3AEDB 1WGHA 1GOZA 2EKIA 3WALA 1P0RA 3DDCB 2ZW1A 3NVWA 2GBRA 1NEKB 1NI2A 2K39A 4EZJA 2Z8LA 2L52A 1D6EC 5H92C 1IPGA 1KJTA 2MEKA 2N9XA 3L13A 2KWCA 4BZAA 2ACZB 3AE4B 3JW0X 3TBLD 3Q3OC 1P9DU 2R61A 1HA5A 1R7SA 2L76A 1YN4A 4RM9A 2N7DA 1ZE3D 1KH0A 1AN8A 3B9JA 3S2AA 2DYMA 3EFUA 4WIPA 3R7QA 1Q1OA 5JXVA 3NZUA 3RD2A 5IKCM 3AULA 4TV3A 3UI3A 2KC1A 2O6VA 3PREA 4LNFA 4ANUA 5TSSA 3ALBA 1C1YB 3H6NA 4KSKC 1Q0WB 2GBNA 4B0EA 5D2MB 4W9HA 3RNFC 4AUQC 2HTHA 3KLSX 3P1MA 4AJYB 4YSZB 2D3AA 2K3UA 4JLCA 1ZOYB 4IWQA 2AQ2B 3Q8BA 3VTUA 3PHWB 2BT6A 1V81A 4GDLB 2R2OA 2CS4A 1V8CA 3I9V1 4DXFA 4O1NA 2KXJA 4MM3B 1V9JA 4HRSA 4MJSA 1WYWB 1AYFA 1NYRA 4HPMB 3GB1A 2JY6A 4JIOU 2MX2A 4EFOA 3DBRI 2MP2A 4NAWB 2BS4B 1E8ZA 2ZCCA 3ZJVA 4B6WA 4KGSA 2LRUA 4M0WA 3ZNGC 1N6ZA 4RH6A 4A90A 3W1YA 1FXTB 2D3GA 1ESFA 3PRZA 1SF0A 1MJDA 1WM2A 1YIWA 1ZKHA 1RFAA 3T8MA 1WX9A 3U8ZA 5DPRA 2FCMA 1FNUA 4ICVA 3BK1A 2WXKA 3WANA 3KH0A 3P42A 1NBFC 1YQBA 2OEDA 2RR9A 4IM3A 3SHQA 2ASQA 5E6PA 1V86A 4A9AA 4I6PA 2M4NA 2KQ7A 2RMMA 4N58A 3FKYA 1IUEA 4HCNB 1QOAA 3L08A 5CX3A 3RZWC 3RI7C 1QOBA 2M0AA 4OVUA 2K8HA 5DCNA 3ZRFA 3R2IA 2KACA 1JWMD 2FUG1 4KKIA 3Q69A 4C4VB 4F7ZA 3EA6A 1WX8A 1YX6B 3N20C 4FLHA 3IT4B 1JCKB 2J0MA 2ONQA 2IO3B 3QJZA 1G6JA 4GXBA 1UD7A 1HTQA 3TEYA 2C5LC 3X0WA 2TSSA 3U52E 1WYGA 2BQQA 3GE8C 2VZKD 5BMIA 2CHXA 1P7EA 2WWZA 3HIZA 3K9PB 1FNWA 3DOWA 4GB9A 1ROEA 3AEBB 2O6VD 1SJED 5BYRA 4ZHPA 1HEZE 2V4LA 4IWOA 2MSED 2KQ4X 3HVDA 1DOYA 1DOIA 1FD6A 2MCNB 5LXIB 2DLBA 4MH0E 1Y8RC 1JWBD 4A55A 2BF8B 3L16A 1V97A 1RYJA 4E3CA 3KWVA 4HLEA 3NZSA 3LDZE 3M3JA 3DBSA 2KWUB 1ISNA 3VRBB 3DCGA 5CHFA 2D3CA 4KV2A 2LJ5A 2BB6A 3B0AA 3O65B 1TS4A 3MP9A 1LM8B 4R3DA 4WQOB 1I4XA 2X8XX 3R3MA 3VR8B 2PJHA 1RM6C 1WRDB 5FR3A 4XE0A 3VDZA 1SSNA 5E6OA 2CJOA 4DHZB 2HTME 4DXGA 2WLBA 3Q6BA 1WSPA 2MLBA 2DBYA 4WAFA 1FFVA 3IFWB 1E7UA 3B1LX 1T5XD 2LXCA 4KIKA 2JT4B 1SXTA 4XWTA 2K6QA 1QKZA 3M63B 3KUZA 2REXA 2L05A 3WA0A 3PSEB 5AZHA 1L0XB 3AH7A 1VD2A 4TMAB 3U7ZA 1EF1A 1QQRA 1FMAD 4W9LA 1P7FA 1ZXHA 1FFUA 1WRIA 1F0ZA 3VXWA 2MA9B 4KX6B 2AL6A 3RZFA 3C19A 1XCTL 4M00A 5AZFA 2L1AA 2HJ8A 1SE4A 1SBBB 2INCC 1YMHE 2LGXA 4USAA 1WIAA 3BYYB 2WXQA 1L2NA 5IO9A 4EUTA 2DENB 1HQRD 4HCPB 4H2AA 1ENFA 2FIDA 3MFGA 1H4RA 3ZNZB 2DAJA 2ZPYA 3E56A 1TS5A 2G3QB 2CU1A 2M8SA 1Q5WB 4HWIB 1UWXA 3X23A 3V6EB 3CWIA 3ZGZA 2ZJDA 2RPQA 3HK0A 1GAQB 4DBGA 2WU5B 4PS3A 4JGHB 3ML9A 1E7VA 4W9FA 2PIAA 2C60A 3RNBC 1WXMA 1C76A 3VUYA 1S3SG 2GBJA 2INPE 4M0WB 4IDIA 2IZVB 2BBCA 3BINA 1WJUA 2D10A 4MH8A 1UELA 4JPSA 5AUIA 3W1SC 2PVGC 3AE6B 4IW0A 1IBXB 2OHFA 2K0PA 5G2NA 1PQSA 1TY0A 2J42A 2WP9B 3ONSA 4EOYA 3ZDTA 1GJZA 2KN4A 2L3ZA 1I4HA 1XEEA 4HROA 1LGRA 4E74A 2UU7A 3VTWA 4GLSC 2EKEC 2KTFA 4NY0A 1TS2A 1I35A 3KUCB 1LQBA 4W9GA 1WMHA 1T0RC 5GMVA 4W9EA 3QQ8B 2LASA 2LHEA 2A4ZA 4K7WA 4FXCA 1K50A 3H7PA 5HKHA 2L32A 4PYZA 2WS3B 4M8NA 2JZPA 2KDFB 3VAWA 2FUHB 3VH4B 1C78A 1PDXA 1TZOA 4MDKE 1Q10A 1TS3A 5JH5C 2W9NA 1HE8A 3Q3MC 1C4CA 1DGJA 2XK5A 4KDLB 4MSMB 1TZ1A 2Y5CA 1OFFA 4RFBA 3WIMA 3ML8A 4DHJB 1XD3B 3U30A 3H7PB 2JWUA 1GB1A 1LO5D 5BO4B 2LVPA 3DBHI 4MELA 1WGKA 1VZ7A 2N1WA 1VJKA 4JL9A 4AJWA 1RWSA 4NPNA 4NJCA 4IM2A 4YSXB 3PV1A 2WXFA 1SIJA 2K1FA 3R2TA 1K51A 3V61A 5I4DA 2KYWA 2N7EA 1KTKA 1TIFA 3V3XA 4I6NB 3BVGA 2BYFA 3P4SB 1TKGA 2H89B 4HPLB 4MJSB 3DBHB 4WJQA 3U7DA 2Y5BB 3Q3JA 2PKOA 3BYTB 4ZRPA 1XO3A 2LI5A 2NPTB 3OLMD 3I57A 3L10B 5AZGA 2PMVA 1N62A 4GN1A 1T3QA 2WDRB 4NAMA 4IC7B 4JQWC 1H8CA 1XLQA 3CSFA 3LXFA 1RLFA 4C7ZA 2MW5A 4KDIC 4WQMA 2VZKB 3ZJTA 4ANWA 2KANA 3R8BA 5HG2A 3EGRA 1GPXA 2KVRA 2QHOA 3H1UA 1NYQA 1EWYC 1V49A 1IP9A 5CTRC 1WXQA 2WXLA 3KW5B 3KVFB 2MRPA 1HZ6A 2KQSA 1FRRA 4JWUC 3W1SA 5EE9A 3K9OB 4TQ1A 1D4BA 2G1EA 1YQ4B 3KYCD 1P3QU 5BYQA 3HM6X 1VLBA 1YN3A 4PK1A 2BVCA 4XC2A 3UIOB 3BY4B 3VR9B 2CHZA 3AM9A 5H8YE 4JE3B 1LFDA 2K8BA 4HJGE 1M4VA 1SE3A 3AE9B 3J9CA 1L6VA 2AYOB 3ZVVA 3Q2AC 1EWCA 2KJHB 1Z5SB 2K6DB 2KFKA 1RAXA 2Y5PA 2YVCA 2XBBC 4KGRA 3L0WB 5IN7A 4IOIE 4EZKA 3GP7A 4ARCA 2KFJA 3NY5A 4DXAB 4HVBA 1K8RB 1YJ1A 1FXAA 5JHBA 2L83A 4J3OD 3HUIA 2LD9A 3AEFB 1SGHA 1Y56A 3QK0A 3TEWA 3V6CB 4LTUA 5J17A 1T0SC 2IY1B 2B3AA 2LJIA 3PHXB 2MHJA 5TR5A 1STEA 3ZTCA 1VZ6A 4KIKB 3KWLA 2FCQA 3DVNU 2DX5B 3RFZB 1E8YA 3EC8A 3OG5A 3VTVA 3ZLZA 3AI5A 4GDKA 3HHMA 4GIVA 1J7BA 1ZW7A 3N32A 3CSTA 5HHDG 2C7MB 3N9YC 1R4MI 4EE2A 2J0KA 1PUTA 2V1YA 4RGMA 2M19A 4WJOA 1S1QB 4BOZB 3A9KB 1XF5L 3GZNB 1IGDA 4HDQA 3DWGC 5D3IB 3AECB 3ZTDA 1MG8A 1YX5B 2VRRB 2UWQA 1KLVA 3RT3B 1JALA 3Q3NC 3MJWA 2ON8A 4JWSC 5D6JB 2LUEA 2N7JA 3RNEC 5CHWA 3AB5A 2I1JA 2AQ1B 1FEHA 4XDDA 2DNFA 2NBWB 1YJJA 2WXJA 3MHZA 1EO6A 5L83A 1AARA 4HJKA 1D5ZC 2SEBD 1UWMA 3ECIA 3QAQA 4DWFA 3LJ3A 1JWSD 2V9HA 2FCSA 4A6QA 3P2BA 3TCAA 5MPOA 4B95A 2MBBB 2ZZPB 1JW9D 1X1MA 1D3ZA 2LZ6A 2JSVX 4GMVA 4ACFA 2O2VA 1TKEA 4K1RB 5FR6A 1EU3A 2V3SA 1MHXA 3FILB 1KOTA 2XK5B 2NBUA 4BKSA 2J0JA 2WGSA 2W54A 3N30A 2KDMA 3TUOA 1VRAB 1GUAB 3UINB 2LWPA 1OEYJ 2PE9A 1EF5A 4KVGB 4YL8A 3AE3B 4TUUA 1C9FA 1TYGB 2NCNA 3PTFC 4ASWC 1VCBA 3TL5A 3QA8A 4TQ0A 2RDBC 4DHJD 4NJ6A 2JZZA 4URKA 2AX5A 4HEA1 4HXDA 3AU5A 2WXIA 2KVZA 4FADA 3V60A 2JUOA 4MGIE 4RF1A 4BOSC 1V6EA 1KFYB 4QAYA 1VZ8A 1C4PA 2M0XA 4WH4A 2K25A 4MSQB 4MACA 2RGFA 2JQRB 3QIJA 1V80A 3M95A 4B9KA 2JXXA 4HKQA 3Q3FA 4XYCA 4M02A 5C2TB 1KF6B 3VH3B 2WXGA 4G50A 2PPHA 3DVGX 4CYEA 2WXHA 2IBIB 3AEEB 2HD5B 1YJIA 2LGYA 2BB5A 2J53A 2KC2A 1WJ4A 2ZPNA 2E3TA 1PYWD 1JROA 4A3OA 1OGWA 2WXRA 4IG7B 4YTNB 4I6LB 1V1OA 1WR6E 1IYFA 4K3BA 1WXVA 3RN9C 1CK1A 1UBQA 1WFYA 1E0ZA 4HDOA 1WJNA 2NR2A 1CMXB 1NDDA 3DVNV 4HK2A 2AEHA 1UUPA 5IA7A 1C3TA 4WAAA 3MC0B 4US8A 4YWGG 3DPDA 2BWFA 5FK9C 3T3NA 1QLBB 5J18A 4GGQA 3A1QA 2GRIA 4RF0A 1YD8U 2KD0A 4NNJB 4LNOA 4OZAA 2LVQA 2YEPB 1F9JA 5KHQA 2D11A 3IAS1 3PRPB 4FJYA 5LLIA 2JZ3B 3SU8X 1FPYA 5FKAC 3N3KB 1E90A 1EUVB 3B08A 2JF5A 4WWOA 3N1XC 4LDTB 4Q2JA 3ZJUA 2IO0B 2IGGA 1V5OA 3BWUD 3EHVA 4W9JA 4BFRA 3IHPC 2KWVB 3AE7B 3ZO5B 3ZNHB 2HDEA 4GOCA 3RNAC 3Q14C 3QARA 3PZDA 1V1PB 2JRHA 3VFKA 2DHZA 2UYZB 4BBNF 1WZ3A 3QX1A 1E10A 2QDFA 2ZCBA 2K22A 4HKZE 2GB1A 2L00B 1ZP0B 2G4DB 4LNNA 1DYQA 2J4XA 4P1BC 5L95C 4UDUC 3V05A 4C56C 4WWMA 1JRPA 3IT6B 4REZA 3PLUA 3DBRB 3LYYA 4DDGD 3JYUA 4F8CB 1T6BX 1GC7A 3T9LA 1IGCA 2K9XA 3C0RB 2GMIC 2BPSA 2YLMA 3CF6E 4C80A 4PS7A 4W9CA 3VRAB 2LEKA 4M01A 4S0RA 4F1SA 3AMZA 3TSSA 2N9LA 1SB3C 3APFA 2QSDA 4MGKE 3A4RA 5DPSA 4MEMA 2MBOA 3I63C 4LJOB 3BVMA 2LGIA 2FCNA 4FULA 2DZJA 3I5JC 4ARIA 2KX0A 1SE2A 1PGBA 1MFWA 3NVYA 2BTEA 4OW0A 2ZVOA 2N0SB 3HM3A 2N9EB 5EDSA 5E6NA 4LJPB 2V4IB 2W3RA 2ZNVB 5DPTA 1AWDA 3DHHC 3D32A 1L6UA 2CU3A 4RGNA 4FHJA 3NZ3A 4OVZA 1F2RC 4XZ4A 2RSUA 1WH3A 2N9PC 1P98A 3NOBA 3AE5B 4EEWA 3A9JB 2QCZA 3AN1A 4FJZA 4TKNA 4KZCA 2C7HA 3C8YA 4JX1C 2BGFA 4GDLA 1K52A 5GXGB 2KJ6A 3Q8AA 2KWDA 2INNE 2WXMA 5EE0A 1WXSA 1MHHE 3BVZA 3W9CB 4ITKA 2YEPF 1TBEA 3OWEB 3SR6A 2AQ3B 2IYDB 1WE7A 2HE7A
chains in the Genus database with same CATH topology
2V4LA 3QK0A 4IWOA 2G45B 3V6CB 2KTRB 4ANXA 2WX1A 5J17A 4AOFA 2PEAA 5C1ZA 2IY1B 2IY0B 2B3AA 2MSED 3PHXB 4W9IA 3PS6A 2L8JA 2L7RA 5TR5A 2KO3A 3SD5A 3ZTCA 2MCNB 4BVUC 4KIKB 2FCQA 1GNUA 4N9F4 3QWZB 5LXIB 4MH0E 3DVNU 2BKRB 1Y8RC 2OJRA 2DX5B 2Z0EB 2BF8B 2GBMA 3L16A 2EMSA 3IG3A 1E8YA 2CKHB 3APDA 3EC8A 3PT2B 1WGYA 4E3CA 1WXAA 3VTVA 4HLEA 3NZSA 3ZLZA 3AI5A 4GDKA 3LDZE 3HHMA 2BWES 1WI0A 4GIVA 2N4FA 3EECA 1ZW7A 3M3JA 3DBSA 1WE6A 1ISNA 2KWUB 3N32A 4IWPA 4BKSD 1P1AA 3IBEA 3DCGA 3CSTA 2C7MB 1R4MI 3PPAA 2J0KA 4WWNA 5CHFA 3PGEA 2V1YA 1SIFA 1J19A 1S1QB 4WJOA 3A9KB 3ZKJC 3ZRCA 4BOZB 2O6VB 4KV2A 2BYVE 2LJ5A 3VHTC 3NHEB 5CHVC 3B0AA 3O65B 4HDQA 2KX3A 5JZEB 3ZTDA 3ENEA 4M8MA 4FJVB 2LGDA 1MG8A 4ZYNA 1GG3A 1YX5B 2NS5A 2VRRB 1LM8B 2UWQA 2DYOA 2C7NB 3AU4A 3PRMB 4KSLC 4KZ0A 4WQOB 3RT3B 1KLVA 1XT9B 1WF9A 3R3MA 3MJWA 1WZ0A 3KYDD 1J0GA 2PJHA 1UH6A 1OQYA 2A5UA 1WRDB 3UGBB 4II2B 5D6JB 2LUEA 4K81A 3V62A 5AEKB 5CHWA 2J7QB 4ICUA 5IAAC 4X57B 2I1JA 3VDZA 4BBNC 5E6OA 4NJ7A 1RRBA 2MWSB 2NBWB 2KLCA 4DHZB 1WY8A 3MTNB 3VUXA 3UQAA 4NQKE 1EO6A 1OEYA 4MGYE 5L83A 2MLBA 1AARA 2AL3A 3IFWB 2MBQA 4HJKA 1E7UA 3B1LX 1GC6A 2JRIB 4ANVA 2NPTA 2LXCA 4K7SA 4KIKA 2KFKB 2JT4B 4AWJA 2JPHA 4P7IA 3APCA 1OTRB 2K6QA 2KJRA 3M63B 3KUZA 3ECIA 2REXA 1TGZB 3QAQA 2L05A 1JRUA 3LJ3A 3WA0A 4DWFA 3PSEB 2RD0A 5AZHA 4W9KA 2FCSA 2KZRA 3P2BA 3TCAA 3PVLA 1UBIA 1VD2A 4B95A 3ZDMC 1EF1A 2MBBB 2EMTA 2GOWA 2ZZPB 1X1MA 1D3ZA 3WAMA 2LZ6A 4GMVA 4W9LA 2O2VA 1WMHB 3SDLC 4K1RB 5FR6A 2ZVNA 2V3SA 3A1QB 1KOTA 2XK5B 3DQVA 2NBUA 1QZEA 3VXWA 4BKSA 2MA9B 2J0JA 3RUIB 2AL6A 3RZFA 2D2QA 3N30A 5AZFA 2LXAA 2HJ8A 1GUAB 3UINB 2L0FA 2LWPA 1OEYJ 2PE9A 5C23A 2KLGA 4ZRJA 4CO7A 1EF5A 2LGXA 5KHOA 1ZGUB 4KVGB 1WIAA 2MQJA 2C9WB 4YL8A 4TUUA 1L2NA 2FAZA 4G0NB 3JVZX 3ZNID 4EUTA 4NQLB 3QC8B 2NCNA 2DENB 2KNBA 3PTFC 5D94A 4DHZE 4FA6A 2FIFA 2KOXA 4G3XB 4GDKB 4ASWC 1VCBA 4LCDE 4HCPB 4GSWA 3TL5A 2FIDA 4FHKA 1H4RA 3L54A 3QA8A 3ZNZB 4TQ0A 4DHJD 2DAJA 2ZPYA 2JZZA 4NJ6A 4ZDVA 2DZKA 4URKA 3R7RA 4RMAA 1WGRA 2G3QB 2CU1A 2M8SA 4HXDA 2Z59B 1Q5WB 4HWIB 2AWTA 4DDID 3AU5A 1E8WA 4BKGA 4OVVA 4FN2A 4WJNA 3R66C 3V6EB 3X23A 2ZJDA 4FADA 2RPQA 3V60A 3TMPB 3HK0A 2CHWA 1LXDA 2JUOA 1I42A 4MGIE 4DBGA 3L17A 4AP4C 4BOSC 4PS3A 4JGHB 3ML9A 1E7VA 3A4SC 2R2QA 2KDEB 3KUDB 3QHTA 4LDTD 4W9FA 1V6EA 3TIXA 2C60A 1WXMA 1WM3A 3VUYA 2WDTB 3PLVA 2KKCA 1BT0A 1S3SG 2GBJA 3M62B 4M0WB 2M0XA 2K25A 4MSQB 2M1MA 1WJ6A 2RGFA 3QIJA 1V80A 2N1VA 3M95A 2IZVB 4B9KA 2JXXA 2WX0A 4PYUA 3BINA 2L0TA 1WJUA 2D10A 3Q3FA 1WGDA 1UELA 3W1SC 3VH3B 1V5TA 4G50A 2PPHA 2GBKA 2KMCA 3VQIA 3DVGX 4IW0A 4ZRKA 3DVGY 4RM8A 4CYEA 5G2NA 1PQSA 2IBIB 3JSVA 5D7GA 2HD5B 1WR1A 2LGYA 3ZW3A 2KC2A 1WJ4A 2ZPNA 3ONSA 5G55A 4EOYA 3ZDTA 1WGHA 3TJPA 4DK5A 1GJZA 2XEWA 2L3ZA 3WALA 1P0RA 3DDCB 3OJ3A 4E74A 2JWZA 4A3OA 3VTWA 1OGWA 1U4AA 2GBRA 3QCAA 2EKEC 1NI2A 2KTFA 4NY0A 2K39A 3UF8A 4EZJA 4IG7B 1I35A 3KUCB 2ZEQA 2KDBA 4I6LB 1LQBA 4ZRIA 1IPGA 1WR6E 3I3TB 1A5RA 1IYFA 2M17A 4W9GA 1WMHA 1UGMA 1KJTA 4MGZE 2N9XA 1WXVA 3L13A 2NBVB 3GOEA 5GMVA 2KWCA 4W9EA 3QQ8B 2LASA 1UBQA 1WFYA 2A4ZA 4HDOA 4K7WA 3JSVB 1WJNA 3JW0X 2NR2A 3H7PA 5HKHA 4PYZA 3TBLD 2MBEA 1CMXB 1NDDA 4M8NA 1P9DU 4A3PA 3DVNV 2KDFB 4HK2A 2AEHA 2K8CA 2L76A 3VAWA 3IVFA 5IA7A 4RM9A 4G11A 2FUHB 4WAAA 2N7DA 4MDKE 3VH4B 1C3TA 3DPDA 5JH5C 4IM0A 2BWFA 2KN5A 3S2AA 2DYMA 3EFUA 2W9NA 3R7QA 5J18A 2KMAA 1Q1OA 4GGQA 1HE8A 3A1QA 1TTNA 3CMMB 2XK5A 3NZUA 3RD2A 1YD8U 3AULA 4KDLB 4MSMB 4TV3A 1TZ1A 2KD0A 2KC1A 3A9JA 3A9KA 3WIMA 3ML8A 4DHJB 1XD3B 2O6VA 3PREA 4NNJB 4ANUA 3U30A 3ALBA 1C1YB 2LVQA 3H7PB 3H6NA 4KSKC 1F9JA 5BO4B 5KHQA 2LVPA 3DBHI 2D11A 3MHSD 4MELA 1Q0WB 2GBNA 3PRPB 4FJYA 2JZ3B 5LLIA 2N1WA 3SU8X 5D2MB 4W9HA 3WAOA 4AJWA 4JL9A 3N3KB 4AUQC 2HTHA 4AJYB 1E90A 5LXHA 1M94A 4NPNA 3WAPA 1EUVB 4IM2A 4JLCA 3B08A 2JF5A 3PV1A 4IWQA 2K1FA 4WWOA 1E5WA 3V61A 1J8CA 4LDTB 2IO0B 3EHVA 1V5OA 1WX7A 3RCZA 2N7EA 4W9JA 4BFRA 3GZNI 3IHPC 3VTUA 2KWVB 3PHWB 3ZO5B 4I6NB 3ZNHB 1V81A 2BYFA 1WGGA 2R2OA 4GDLB 2CS4A 2OOBB 1T0YA 4HPLB 4MJSB 2KXJA 4GOCA 4WJQA 3U7DA 1V9JA 5DPWA 2Y5BB 1L7YA 3Q3JA 4WJPA 4MJSA 1WYWB 3QARA 2WYQA 3PZDA 4II3B 1SE9A 4HPMB 2JRHA 2LI5A 2JY6A 2KHWB 2NPTB 3VFKA 2DHZA 2UYZB 2MX2A 4JIOU 2I1KA 4EFOA 3DBRI 3OLMD 1R4NI 2MP2A 4NAWB 1WZ3A 3L10B 4BBNF 3QX1A 5JHAA 1E8ZA 5AZGA 4A20A 2ZCCA 4B6WA 2LRUA 3ZNGC 3VVWB 4GN1A 2MP2B 4NAWA 2ZCBA 4IC7B 4JQWC 1H8CA 3W1YA 1FXTB 2L00B 2D3GA 3CSFA 2PE6B 3PRZA 2G4DB 1RLFA 1WM2A 4WWPA 2DAFA 2KTRA 1YIWA 1ZKHA 1RFAA 2MW5A 4KDIC 5L95C 1Z2MA 3T8MA 4EKUA 4ANWA 2KANA 1WX9A 3PLUA 4GU2A 2BKFA 5DPRA 3U8ZA 2FCMA 4DDGD 2KDIA 3JYUA 4F8CB 2KVRA 3T9LA 1GC7A 2QHOA 4ICVA 2JVCA 3WANA 2ZNVC 3C0RB 2GMIC 2BPSA 2YLMA 3CF6E 3H1UA 1NBFC 3KH0A 2DYBA 1YQBA 1KM7A 2DZMA 2RR9A 4IM3A 4PS7A 3A33B 2ASQA 4W9CA 3SHQA 5E6PA 1V86A 1V49A 1IP9A 4I6PA 2M4NA 2O2VB 2KQ7A 5CTRC 4F1SA 3KW5B 3KVFB 2MRPA 2IO2B 2KQSA 5J2RA 2CR5A 3APFA 4MGKE 4IUMB 4HCNB 3A4RA 5DPSA 3H9DA 2MBOA 3L08A 4LJOB 4MEMA 3W1SA 5CX3A 2FCNA 4PS8A 3OJ4B 4FULA 2DZJA 3K9OB 4TQ1A 3RZWC 4W9DA 2G4SA 3NS8A 4MM3A 4CHKA 2KX0A 3KYCD 4OVUA 2K8HA 5DCNA 1V2YA 3ZRFA 2IO1B 1P3QU 2ZVOA 3HM6X 3HM3A 2N9EB 5EDSA 5E6NA 4LJPB 3RULA 2KK8A 4XC2A 3VUWA 2DZIA 1XQQA 2ZNVB 3UIOB 5DPTA 3BY4B 4EZLA 4K7UA 4F7ZA 2CHZA 3AXCA 3D32A 1WX8A 2LVOA 1YX6B 4FLHA 2Z0DB 2J0MA 2BYEA 4FHJA 4FBJB 2IO3B 1LFDA 2K8BA 1UZXB 3QJZA 4J6IA 2RSUA 1WH3A 2N9PC 4XZ4A 1P98A 1G6JA 2AYOB 3NOBA 3ZVVA 4GXBA 1UD7A 2LRWA 4E71A 4EEWA 2KJHB 1Z5SB 3A9JB 2C5LC 4FJZA 4TKNA 3X0WA 4KZCA 2K6DB 2C7HA 2KFKA 3UIPB 1RAXA 2BGFA 4GDLA 4BKTA 2YVCA 3ZUNA 3ZIMA 2NVUI 2D07B 2XBBC 2KJ6A 3UQBA 3L0WB 2CHXA 1WXSA 2WWZA 3H7SA 2MBHA 3HIZA 3K9PB 1E8XA 4EZKA 2FNJB 3OAWA 3DOWA 4GB9A 3RYTA 2KFJA 3NY5A 4XX5A 4DXAB 1TBEA 3DBLI 4HVBA 1K8RB 1YJ1A 2O6VD 5JHBA 2IYDB 1WE7A 2HE7A 2LD9A 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4L A;  3QK0 A;  4IWO A;  2G45 B;  3V6C B;  2KTR B;  4ANX A;  2WX1 A;  5J17 A;  4AOF A;  2PEA A;  5C1Z A;  2IY1 B;  2IY0 B;  2B3A A;  2MSE D;  3PHX B;  4W9I A;  3PS6 A;  2L8J A;  2L7R A;  5TR5 A;  2KO3 A;  3SD5 A;  3ZTC A;  2MCN B;  4BVU C;  4KIK B;  2FCQ A;  1GNU A;  4N9F 4;  3QWZ B;  5LXI B;  4MH0 E;  3DVN U;  2BKR B;  1Y8R C;  2OJR A;  2DX5 B;  2Z0E B;  2BF8 B;  2GBM A;  3L16 A;  2EMS A;  3IG3 A;  1E8Y A;  2CKH B;  3APD A;  3EC8 A;  3PT2 B;  1WGY A;  4E3C A;  1WXA A;  3VTV A;  4HLE A;  3NZS A;  3ZLZ A;  3AI5 A;  4GDK A;  3LDZ E;  3HHM A;  2BWE S;  1WI0 A;  4GIV A;  2N4F A;  3EEC A;  1ZW7 A;  3M3J A;  3DBS A;  1WE6 A;  1ISN A;  2KWU B;  3N32 A;  4IWP A;  4BKS D;  1P1A A;  3IBE A;  3DCG A;  3CST A;  2C7M B;  1R4M I;  3PPA A;  2J0K A;  4WWN A;  5CHF A;  3PGE A;  2V1Y A;  1SIF A;  1J19 A;  1S1Q B;  4WJO A;  3A9K B;  3ZKJ C;  3ZRC A;  4BOZ B;  2O6V B;  4KV2 A;  2BYV E;  2LJ5 A;  3VHT C;  3NHE B;  5CHV C;  3B0A A;  3O65 B;  4HDQ A;  2KX3 A;  5JZE B;  3ZTD A;  3ENE A;  4M8M A;  4FJV B;  2LGD A;  1MG8 A;  4ZYN A;  1GG3 A;  1YX5 B;  2NS5 A;  2VRR B;  1LM8 B;  2UWQ A;  2DYO A;  2C7N B;  3AU4 A;  3PRM B;  4KSL C;  4KZ0 A;  4WQO B;  3RT3 B;  1KLV A;  1XT9 B;  1WF9 A;  3R3M A;  3MJW A;  1WZ0 A;  3KYD D;  1J0G A;  2PJH A;  1UH6 A;  1OQY A;  2A5U A;  1WRD B;  3UGB B;  4II2 B;  5D6J B;  2LUE A;  4K81 A;  3V62 A;  5AEK B;  5CHW A;  2J7Q B;  4ICU A;  5IAA C;  4X57 B;  2I1J A;  3VDZ A;  4BBN C;  5E6O A;  4NJ7 A;  1RRB A;  2MWS B;  2NBW B;  2KLC A;  4DHZ B;  1WY8 A;  3MTN B;  3VUX A;  3UQA A;  4NQK E;  1EO6 A;  1OEY A;  4MGY E;  5L83 A;  2MLB A;  1AAR A;  2AL3 A;  3IFW B;  2MBQ A;  4HJK A;  1E7U A;  3B1L X;  1GC6 A;  2JRI B;  4ANV A;  2NPT A;  2LXC A;  4K7S A;  4KIK A;  2KFK B;  2JT4 B;  4AWJ A;  2JPH A;  4P7I A;  3APC A;  1OTR B;  2K6Q A;  2KJR A;  3M63 B;  3KUZ A;  3ECI A;  2REX A;  1TGZ B;  3QAQ A;  2L05 A;  1JRU A;  3LJ3 A;  3WA0 A;  4DWF A;  3PSE B;  2RD0 A;  5AZH A;  4W9K A;  2FCS A;  2KZR A;  3P2B A;  3TCA A;  3PVL A;  1UBI A;  1VD2 A;  4B95 A;  3ZDM C;  1EF1 A;  2MBB B;  2EMT A;  2GOW A;  2ZZP B;  1X1M A;  1D3Z A;  3WAM A;  2LZ6 A;  4GMV A;  4W9L A;  2O2V A;  1WMH B;  3SDL C;  4K1R B;  5FR6 A;  2ZVN A;  2V3S A;  3A1Q B;  1KOT A;  2XK5 B;  3DQV A;  2NBU A;  1QZE A;  3VXW A;  4BKS A;  2MA9 B;  2J0J A;  3RUI B;  2AL6 A;  3RZF A;  2D2Q A;  3N30 A;  5AZF A;  2LXA A;  2HJ8 A;  1GUA B;  3UIN B;  2L0F A;  2LWP A;  1OEY J;  2PE9 A;  5C23 A;  2KLG A;  4ZRJ A;  4CO7 A;  1EF5 A;  2LGX A;  5KHO A;  1ZGU B;  4KVG B;  1WIA A;  2MQJ A;  2C9W B;  4YL8 A;  4TUU A;  1L2N A;  2FAZ A;  4G0N B;  3JVZ X;  3ZNI D;  4EUT A;  4NQL B;  3QC8 B;  2NCN A;  2DEN B;  2KNB A;  3PTF C;  5D94 A;  4DHZ E;  4FA6 A;  2FIF A;  2KOX A;  4G3X B;  4GDK B;  4ASW C;  1VCB A;  4LCD E;  4HCP B;  4GSW A;  3TL5 A;  2FID A;  4FHK A;  1H4R A;  3L54 A;  3QA8 A;  3ZNZ B;  4TQ0 A;  4DHJ D;  2DAJ A;  2ZPY A;  2JZZ A;  4NJ6 A;  4ZDV A;  2DZK A;  4URK A;  3R7R A;  4RMA A;  1WGR A;  2G3Q B;  2CU1 A;  2M8S A;  4HXD A;  2Z59 B;  1Q5W B;  4HWI B;  2AWT A;  4DDI D;  3AU5 A;  1E8W A;  4BKG A;  4OVV A;  4FN2 A;  4WJN A;  3R66 C;  3V6E B;  3X23 A;  2ZJD A;  4FAD A;  2RPQ A;  3V60 A;  3TMP B;  3HK0 A;  2CHW A;  1LXD A;  2JUO A;  1I42 A;  4MGI E;  4DBG A;  3L17 A;  4AP4 C;  4BOS C;  4PS3 A;  4JGH B;  3ML9 A;  1E7V A;  3A4S C;  2R2Q A;  2KDE B;  3KUD B;  3QHT A;  4LDT D;  4W9F A;  1V6E A;  3TIX A;  2C60 A;  1WXM A;  1WM3 A;  3VUY A;  2WDT B;  3PLV A;  2KKC A;  1BT0 A;  1S3S G;  2GBJ A;  3M62 B;  4M0W B;  2M0X A;  2K25 A;  4MSQ B;  2M1M A;  1WJ6 A;  2RGF A;  3QIJ A;  1V80 A;  2N1V A;  3M95 A;  2IZV B;  4B9K A;  2JXX A;  2WX0 A;  4PYU A;  3BIN A;  2L0T A;  1WJU A;  2D10 A;  3Q3F A;  1WGD A;  1UEL A;  3W1S C;  3VH3 B;  1V5T A;  4G50 A;  2PPH A;  2GBK A;  2KMC A;  3VQI A;  3DVG X;  4IW0 A;  4ZRK A;  3DVG Y;  4RM8 A;  4CYE A;  5G2N A;  1PQS A;  2IBI B;  3JSV A;  5D7G A;  2HD5 B;  1WR1 A;  2LGY A;  3ZW3 A;  2KC2 A;  1WJ4 A;  2ZPN A;  3ONS A;  5G55 A;  4EOY A;  3ZDT A;  1WGH A;  3TJP A;  4DK5 A;  1GJZ A;  2XEW A;  2L3Z A;  3WAL A;  1P0R A;  3DDC B;  3OJ3 A;  4E74 A;  2JWZ A;  4A3O A;  3VTW A;  1OGW A;  1U4A A;  2GBR A;  3QCA A;  2EKE C;  1NI2 A;  2KTF A;  4NY0 A;  2K39 A;  3UF8 A;  4EZJ A;  4IG7 B;  1I35 A;  3KUC B;  2ZEQ A;  2KDB A;  4I6L B;  1LQB A;  4ZRI A;  1IPG A;  1WR6 E;  3I3T B;  1A5R A;  1IYF A;  2M17 A;  4W9G A;  1WMH A;  1UGM A;  1KJT A;  4MGZ E;  2N9X A;  1WXV A;  3L13 A;  2NBV B;  3GOE A;  5GMV A;  2KWC A;  4W9E A;  3QQ8 B;  2LAS A;  1UBQ A;  1WFY A;  2A4Z A;  4HDO A;  4K7W A;  3JSV B;  1WJN A;  3JW0 X;  2NR2 A;  3H7P A;  5HKH A;  4PYZ A;  3TBL D;  2MBE A;  1CMX B;  1NDD A;  4M8N A;  1P9D U;  4A3P A;  3DVN V;  2KDF B;  4HK2 A;  2AEH A;  2K8C A;  2L76 A;  3VAW A;  3IVF A;  5IA7 A;  4RM9 A;  4G11 A;  2FUH B;  4WAA A;  2N7D A;  4MDK E;  3VH4 B;  1C3T A;  3DPD A;  5JH5 C;  4IM0 A;  2BWF A;  2KN5 A;  3S2A A;  2DYM A;  3EFU A;  2W9N A;  3R7Q A;  5J18 A;  2KMA A;  1Q1O A;  4GGQ A;  1HE8 A;  3A1Q A;  1TTN A;  3CMM B;  2XK5 A;  3NZU A;  3RD2 A;  1YD8 U;  3AUL A;  4KDL B;  4MSM B;  4TV3 A;  1TZ1 A;  2KD0 A;  2KC1 A;  3A9J A;  3A9K A;  3WIM A;  3ML8 A;  4DHJ B;  1XD3 B;  2O6V A;  3PRE A;  4NNJ B;  4ANU A;  3U30 A;  3ALB A;  1C1Y B;  2LVQ A;  3H7P B;  3H6N A;  4KSK C;  1F9J A;  5BO4 B;  5KHQ A;  2LVP A;  3DBH I;  2D11 A;  3MHS D;  4MEL A;  1Q0W B;  2GBN A;  3PRP B;  4FJY A;  2JZ3 B;  5LLI A;  2N1W A;  3SU8 X;  5D2M B;  4W9H A;  3WAO A;  4AJW A;  4JL9 A;  3N3K B;  4AUQ C;  2HTH A;  4AJY B;  1E90 A;  5LXH A;  1M94 A;  4NPN A;  3WAP A;  1EUV B;  4IM2 A;  4JLC A;  3B08 A;  2JF5 A;  3PV1 A;  4IWQ A;  2K1F A;  4WWO A;  1E5W A;  3V61 A;  1J8C A;  4LDT B;  2IO0 B;  3EHV A;  1V5O A;  1WX7 A;  3RCZ A;  2N7E A;  4W9J A;  4BFR A;  3GZN I;  3IHP C;  3VTU A;  2KWV B;  3PHW B;  3ZO5 B;  4I6N B;  3ZNH B;  1V81 A;  2BYF A;  1WGG A;  2R2O A;  4GDL B;  2CS4 A;  2OOB B;  1T0Y A;  4HPL B;  4MJS B;  2KXJ A;  4GOC A;  4WJQ A;  3U7D A;  1V9J A;  5DPW A;  2Y5B B;  1L7Y A;  3Q3J A;  4WJP A;  4MJS A;  1WYW B;  3QAR A;  2WYQ A;  3PZD A;  4II3 B;  1SE9 A;  4HPM B;  2JRH A;  2LI5 A;  2JY6 A;  2KHW B;  2NPT B;  3VFK A;  2DHZ A;  2UYZ B;  2MX2 A;  4JIO U;  2I1K A;  4EFO A;  3DBR I;  3OLM D;  1R4N I;  2MP2 A;  4NAW B;  1WZ3 A;  3L10 B;  4BBN F;  3QX1 A;  5JHA A;  1E8Z A;  5AZG A;  4A20 A;  2ZCC A;  4B6W A;  2LRU A;  3ZNG C;  3VVW B;  4GN1 A;  2MP2 B;  4NAW A;  2ZCB A;  4IC7 B;  4JQW C;  1H8C A;  3W1Y A;  1FXT B;  2L00 B;  2D3G A;  3CSF A;  2PE6 B;  3PRZ A;  2G4D B;  1RLF A;  1WM2 A;  4WWP A;  2DAF A;  2KTR A;  1YIW A;  1ZKH A;  1RFA A;  2MW5 A;  4KDI C;  5L95 C;  1Z2M A;  3T8M A;  4EKU A;  4ANW A;  2KAN A;  1WX9 A;  3PLU A;  4GU2 A;  2BKF A;  5DPR A;  3U8Z A;  2FCM A;  4DDG D;  2KDI A;  3JYU A;  4F8C B;  2KVR A;  3T9L A;  1GC7 A;  2QHO A;  4ICV A;  2JVC A;  3WAN A;  2ZNV C;  3C0R B;  2GMI C;  2BPS A;  2YLM A;  3CF6 E;  3H1U A;  1NBF C;  3KH0 A;  2DYB A;  1YQB A;  1KM7 A;  2DZM A;  2RR9 A;  4IM3 A;  4PS7 A;  3A33 B;  2ASQ A;  4W9C A;  3SHQ A;  5E6P A;  1V86 A;  1V49 A;  1IP9 A;  4I6P A;  2M4N A;  2O2V B;  2KQ7 A;  5CTR C;  4F1S A;  3KW5 B;  3KVF B;  2MRP A;  2IO2 B;  2KQS A;  5J2R A;  2CR5 A;  3APF A;  4MGK E;  4IUM B;  4HCN B;  3A4R A;  5DPS A;  3H9D A;  2MBO A;  3L08 A;  4LJO B;  4MEM A;  3W1S A;  5CX3 A;  2FCN A;  4PS8 A;  3OJ4 B;  4FUL A;  2DZJ A;  3K9O B;  4TQ1 A;  3RZW C;  4W9D A;  2G4S A;  3NS8 A;  4MM3 A;  4CHK A;  2KX0 A;  3KYC D;  4OVU A;  2K8H A;  5DCN A;  1V2Y A;  3ZRF A;  2IO1 B;  1P3Q U;  2ZVO A;  3HM6 X;  3HM3 A;  2N9E B;  5EDS A;  5E6N A;  4LJP B;  3RUL A;  2KK8 A;  4XC2 A;  3VUW A;  2DZI A;  1XQQ A;  2ZNV B;  3UIO B;  5DPT A;  3BY4 B;  4EZL A;  4K7U A;  4F7Z A;  2CHZ A;  3AXC A;  3D32 A;  1WX8 A;  2LVO A;  1YX6 B;  4FLH A;  2Z0D B;  2J0M A;  2BYE A;  4FHJ A;  4FBJ B;  2IO3 B;  1LFD A;  2K8B A;  1UZX B;  3QJZ A;  4J6I A;  2RSU A;  1WH3 A;  2N9P C;  4XZ4 A;  1P98 A;  1G6J A;  2AYO B;  3NOB A;  3ZVV A;  4GXB A;  1UD7 A;  2LRW A;  4E71 A;  4EEW A;  2KJH B;  1Z5S B;  3A9J B;  2C5L C;  4FJZ A;  4TKN A;  3X0W A;  4KZC A;  2K6D B;  2C7H A;  2KFK A;  3UIP B;  1RAX A;  2BGF A;  4GDL A;  4BKT A;  2YVC A;  3ZUN A;  3ZIM A;  2NVU I;  2D07 B;  2XBB C;  2KJ6 A;  3UQB A;  3L0W B;  2CHX A;  1WXS A;  2WWZ A;  3H7S A;  2MBH A;  3HIZ A;  3K9P B;  1E8X A;  4EZK A;  2FNJ B;  3OAW A;  3DOW A;  4GB9 A;  3RYT A;  2KFJ A;  3NY5 A;  4XX5 A;  4DXA B;  1TBE A;  3DBL I;  4HVB A;  1K8R B;  1YJ1 A;  2O6V D;  5JHB A;  2IYD B;  1WE7 A;  2HE7 A;  2LD9 A;  1SGH A; 
#chains in the Genus database with same CATH topology
 4XWW A;  2OJW A;  4KKJ A;  1BUI C;  2G45 B;  2WX1 A;  4AOF A;  4K3C A;  5C1Z A;  3AE8 B;  4W9I A;  3PS6 A;  2L7R A;  2SAK A;  3SD5 A;  3URY A;  3RMK C;  1TJE A;  4IKG A;  1GNU A;  4N9F 4;  2BKR B;  2MJE A;  2GBM A;  2PVO D;  1FCC C;  3IG3 A;  3APD A;  1FM0 D;  3PT2 B;  1WGY A;  1L4D B;  1WXA A;  1WI0 A;  2N4F A;  3EEC A;  1E6E B;  1N61 A;  2WDQ B;  1SIF A;  3ZRC A;  1B9R A;  2O6V B;  2BYV E;  3VHT C;  2RPV A;  3NHE B;  5CHV C;  4N6E B;  4M8M A;  4FJV B;  3Q8E A;  4ZYN A;  1GG3 A;  2DYO A;  4YTM B;  2C7N B;  2GLS A;  2JU6 X;  4KZ0 A;  1XT9 B;  1WF9 A;  3NVZ A;  1J7A A;  4C00 A;  1J0G A;  3W5V B;  1UH6 A;  5AUK A;  3UGB B;  1ZUD 2;  3GE3 C;  3P4R B;  4K81 A;  3V62 A;  5AEK B;  3DHG C;  2J7Q B;  1N60 A;  4X57 B;  3Q8C A;  4BBN C;  5E6J A;  2KLC A;  3VUX A;  1OEY A;  4MGY E;  3ZXV A;  3P4P B;  1UF0 A;  1PGA A;  4K7S A;  2JPH A;  3APC A;  2MJD A;  2KJR A;  3P4Q B;  2WQY B;  1FNV A;  2RDH A;  1JRU A;  2B76 B;  2D3B A;  2KZR A;  3PVL A;  3ZDM C;  1E7P B;  5HI1 A;  2GOW A;  4HPP A;  3AE1 B;  1WMH B;  3SDL C;  3W5U B;  1JWA D;  3A1Q B;  1F2R I;  1QZE A;  3SFE B;  3EUB 2;  3RUI B;  1I4G A;  2D2Q A;  2IJ0 A;  2LXA A;  3SFD B;  2WXO A;  1UGJ A;  2KLG A;  1WWT A;  5KHO A;  2W55 A;  1BXT A;  3N1Z C;  4G0N B;  3JVZ X;  3ZNI D;  4NQL B;  3QC8 B;  1MVK A;  4DHZ E;  4FA6 A;  4C4V A;  5D3D A;  4RGT A;  1KLU D;  4LCD E;  4GSW A;  1ZDX A;  2WXN A;  4ZDV A;  2DZK A;  1QF6 A;  1CJE A;  1JQ4 A;  1WGR A;  3DHI C;  1MI0 A;  4BKG A;  4YT0 B;  4OVV A;  4FN2 A;  1BML C;  4D2K A;  1NEN B;  2G9H D;  5IOI A;  1V1P A;  3E9S A;  1AW7 A;  2NTT A;  4LDT D;  1SEB D;  1ZPS A;  3A4S C;  3QHT A;  1MPE A;  3DWM A;  4YXD B;  3M62 B;  1WJ6 A;  2N1V A;  4A8X C;  4PYU A;  3ZXR A;  2L0T A;  3KQ4 A;  4YSY B;  1PFD A;  2IND C;  4LNK A;  2QC8 A;  1V5T A;  2KMC A;  1F52 A;  3VQI A;  4ZRK A;  2V3P A;  4XDC A;  4CQN A;  3JSV A;  4ZYS A;  3ZW3 A;  5BYS A;  1QT9 A;  3HRD D;  5G55 A;  2NMQ A;  3TJP A;  4DK5 A;  2XEW A;  5G5G A;  3OJ3 A;  2JWZ A;  1EU4 A;  4WUR A;  5G5H A;  1U4A A;  3QCA A;  3UF8 A;  2RDG A;  2ZEQ A;  1CQV A;  2KMM A;  2KDB A;  1I4R A;  4ZRI A;  3I3T B;  2QIL A;  1A5R A;  4RNA A;  2M17 A;  1UGM A;  1A70 A;  4MGZ E;  2NBV B;  3GOE A;  2I2Y A;  3W2D A;  4ZOH C;  3AEA B;  2LGS A;  3JSV B;  1XLN A;  2QJL A;  2JYE A;  2MBE A;  4A3P A;  5BMH A;  2K8C A;  3IVF A;  4G11 A;  3LB8 C;  3MC8 A;  4OHJ A;  4IM0 A;  2KN5 A;  1I7H A;  1TKY A;  2LUM A;  2KMA A;  3ABV B;  3NVV A;  1OQQ A;  2W82 A;  1TTN A;  3CMM B;  3PZ8 A;  5HFY A;  4AS1 A;  1EM7 A;  3A9J A;  3A9K A;  3CIR B;  2W3S A;  2MJ3 A;  2WDV B;  1XLP A;  1ET9 A;  2JXT A;  1I4Q A;  3MHS D;  3WAO A;  2Y3A A;  2X38 A;  1SJH D;  5LXH A;  1M94 A;  2M56 B;  3WAP A;  5EE3 A;  1E5W A;  1J8C A;  1WX7 A;  3RCZ A;  2K5P A;  1HTO A;  3GZN I;  1T0Q C;  3L4P A;  1ACC A;  1B1Z A;  1WGG A;  2OOB B;  1T0Y A;  2NTS A;  5DPW A;  1L7Y A;  4WJP A;  4L1B A;  1C4A A;  3NJT A;  2WYQ A;  4II3 B;  1SE9 A;  2VH2 A;  4ZRQ A;  3B2F A;  3AV8 A;  1IBX A;  2PLP A;  2KHW B;  4OZB A;  2I1K A;  2IGD A;  2J52 A;  1R4N I;  5JHA A;  1J7C A;  4A20 A;  3VVW B;  2V3N A;  2BS2 B;  2MP2 B;  4NAW A;  3WCQ A;  4L23 A;  2VH1 A;  1CZP A;  1L0Y B;  1KRH A;  4S17 A;  1HXY D;  1HZ5 A;  2PE6 B;  1DOX A;  1FIQ A;  4WWP A;  4P16 A;  3RNG C;  2DAF A;  2KTR A;  2IGH A;  4XGA B;  1Z2M A;  3H8H A;  4KGT A;  4EKU A;  2E6X A;  4GU2 A;  2BKF A;  2KDI A;  2IDY A;  2DWQ A;  2ICI A;  2JVC A;  2ZNV C;  2DYB A;  1KM7 A;  2QEJ C;  2DZM A;  5C3J B;  2WXP A;  3A33 B;  3IXS A;  2O2V B;  2CJN A;  2QMT A;  3ETR A;  2IO2 B;  3FIL A;  1VR9 A;  1KLG D;  5J2R A;  2CR5 A;  4IUM B;  3EFC A;  3N1Y C;  2JX5 A;  3H9D A;  4NZL B;  1I4P A;  4PS8 A;  3OJ4 B;  4TSS A;  4W9D A;  1QOG A;  2G4S A;  3NS8 A;  4MM3 A;  4CHK A;  4B0M A;  5IP4 D;  1QIL A;  1JML A;  1V2Y A;  2I38 A;  2WHI A;  2IO1 B;  1L4Z B;  3O13 A;  3RUL A;  2KK8 A;  3VUW A;  2DZI A;  1XQQ A;  3FAH A;  4EZL A;  4K7U A;  2HJ1 A;  3HVZ A;  5BMG A;  2BYT A;  4PT5 A;  3AXC A;  2PTL A;  2LVO A;  3IAM 1;  2Z0D B;  4RCO A;  3ZQ4 A;  4N59 A;  2BYE A;  4FBJ B;  3DBL B;  4J6I A;  1UZX B;  1JWU D;  1L0V B;  2N9K A;  4AQ7 A;  2LRW A;  4E71 A;  3PZ7 A;  3UIP B;  4BKT A;  1FCL A;  3ZUN A;  3NS1 A;  3ZIM A;  2NVU I;  3MJ5 A;  2D07 B;  3RNC C;  1XXG A;  3UQB A;  2MH7 A;  1NVI D;  3H7S A;  2MBH A;  1E8X A;  2FNJ B;  3OAW A;  3RYT A;  4XX5 A;  1FXI A;  1ET6 A;  3RPF C;  3DBL I;  3NG0 A;  2QIE B;  1N63 A;  1FO4 A;  3BII D;  1FRD A;  2XN9 C;  2KTR B;  4ANX A;  2PEA A;  2IY0 B;  2BW2 A;  3T3O A;  1R4M B;  2L8J A;  2XNA C;  1QOF A;  2KO3 A;  4BVU C;  3QWZ B;  3U2S C;  2Z0E B;  2OJR A;  3U4E G;  2PW9 A;  1UNS A;  2EMS A;  2CKH B;  2BWE S;  2WNM A;  3Q8F A;  4IWP A;  1WE6 A;  4BKS D;  1D5M C;  5T8I A;  1P1A A;  3IBE A;  2V0G A;  3MC9 A;  3PPA A;  4WWN A;  3PGE A;  1J19 A;  3ZKJ C;  3NRZ A;  4LK0 M;  4ZHO A;  2KX3 A;  5JZE B;  3ENE A;  2LGD A;  1F77 A;  2NS5 A;  3PRM B;  3AU4 A;  1TT5 B;  4KSL C;  2BS3 B;  1PGX A;  1YN5 A;  1D5X C;  4MT5 A;  1WZ0 A;  3KYD D;  1OQY A;  2A5U A;  4II2 B;  1MG4 A;  3P63 A;  4ICU A;  5IAA C;  1R4N B;  2LMC A;  4NJ7 A;  1RRB A;  2MWS B;  1WY8 A;  3MTN B;  3UQA A;  4NQK E;  2Q5W D;  1YQ3 B;  1C79 A;  1XCQ L;  2AL3 A;  2MBQ A;  4L2Y A;  1GC6 A;  2JRI B;  4LLG M;  2NPT A;  4ANV A;  4AWJ A;  2JYT A;  2KFK B;  1ZXI A;  4P7I A;  1OTR B;  1TGZ B;  4BAX A;  2RD0 A;  4W9K A;  5EE1 A;  4YTP B;  1UBI A;  1E9M A;  3TEZ A;  2EMT A;  1YNT E;  1XLO A;  3WAM A;  3BZD B;  2H88 B;  2ZVN A;  4P6V F;  4US9 A;  4C7Y A;  3BK2 A;  3DQV A;  1N5W A;  2FBW B;  3ZYY X;  1YOV B;  3NUH B;  2ZW0 A;  2L0F A;  3B2G A;  5C23 A;  1F1H A;  4ZRJ A;  4CO7 A;  3TEX A;  1ZGU B;  2MQJ A;  2C9W B;  2FAZ A;  3PO0 A;  2LHD A;  2KNB A;  5D94 A;  2FIF A;  2KOX A;  4G3X B;  4GDK B;  2KAJ A;  1VDV A;  1RFK A;  4FHK A;  3L54 A;  2WU2 B;  4LNI A;  4RGO S;  1L5P A;  1ZDV A;  1N5X A;  1K53 A;  3R7R A;  4RMA A;  1GB4 A;  2Z59 B;  2AWT A;  4DDI D;  2D5G A;  1E8W A;  3SEB A;  3FC4 A;  4WJN A;  3R66 C;  3TMP B;  1C77 A;  1LXD A;  2CHW A;  4P1C C;  1I42 A;  2EEL A;  3L17 A;  4AP4 C;  3AEG B;  2R2Q A;  2KDE B;  3KUD B;  3TIX A;  2IPK D;  1WM3 A;  2WDT B;  4DQO C;  3PLV A;  2KKC A;  1BT0 A;  2LFI A;  2M1M A;  3GS2 A;  2FE8 A;  2WX0 A;  1OQR A;  4OZC A;  3AE2 B;  1WGD A;  1NI3 A;  5LNK 1;  2KT7 A;  2GBK A;  2GI9 A;  3DVG Y;  1TY2 A;  4RM8 A;  5D7G A;  1WR1 A;  3AED B;  1WGH A;  1GOZ A;  2EKI A;  3WAL A;  1P0R A;  3DDC B;  2ZW1 A;  3NVW A;  2GBR A;  1NEK B;  1NI2 A;  2K39 A;  4EZJ A;  2Z8L A;  2L52 A;  1D6E C;  5H92 C;  1IPG A;  1KJT A;  2MEK A;  2N9X A;  3L13 A;  2KWC A;  4BZA A;  2ACZ B;  3AE4 B;  3JW0 X;  3TBL D;  3Q3O C;  1P9D U;  2R61 A;  1HA5 A;  1R7S A;  2L76 A;  1YN4 A;  4RM9 A;  2N7D A;  1ZE3 D;  1KH0 A;  1AN8 A;  3B9J A;  3S2A A;  2DYM A;  3EFU A;  4WIP A;  3R7Q A;  1Q1O A;  5JXV A;  3NZU A;  3RD2 A;  5IKC M;  3AUL A;  4TV3 A;  3UI3 A;  2KC1 A;  2O6V A;  3PRE A;  4LNF A;  4ANU A;  5TSS A;  3ALB A;  1C1Y B;  3H6N A;  4KSK C;  1Q0W B;  2GBN A;  4B0E A;  5D2M B;  4W9H A;  3RNF C;  4AUQ C;  2HTH A;  3KLS X;  3P1M A;  4AJY B;  4YSZ B;  2D3A A;  2K3U A;  4JLC A;  1ZOY B;  4IWQ A;  2AQ2 B;  3Q8B A;  3VTU A;  3PHW B;  2BT6 A;  1V81 A;  4GDL B;  2R2O A;  2CS4 A;  1V8C A;  3I9V 1;  4DXF A;  4O1N A;  2KXJ A;  4MM3 B;  1V9J A;  4HRS A;  4MJS A;  1WYW B;  1AYF A;  1NYR A;  4HPM B;  3GB1 A;  2JY6 A;  4JIO U;  2MX2 A;  4EFO A;  3DBR I;  2MP2 A;  4NAW B;  2BS4 B;  1E8Z A;  2ZCC A;  3ZJV A;  4B6W A;  4KGS A;  2LRU A;  4M0W A;  3ZNG C;  1N6Z A;  4RH6 A;  4A90 A;  3W1Y A;  1FXT B;  2D3G A;  1ESF A;  3PRZ A;  1SF0 A;  1MJD A;  1WM2 A;  1YIW A;  1ZKH A;  1RFA A;  3T8M A;  1WX9 A;  3U8Z A;  5DPR A;  2FCM A;  1FNU A;  4ICV A;  3BK1 A;  2WXK A;  3WAN A;  3KH0 A;  3P42 A;  1NBF C;  1YQB A;  2OED A;  2RR9 A;  4IM3 A;  3SHQ A;  2ASQ A;  5E6P A;  1V86 A;  4A9A A;  4I6P A;  2M4N A;  2KQ7 A;  2RMM A;  4N58 A;  3FKY A;  1IUE A;  4HCN B;  1QOA A;  3L08 A;  5CX3 A;  3RZW C;  3RI7 C;  1QOB A;  2M0A A;  4OVU A;  2K8H A;  5DCN A;  3ZRF A;  3R2I A;  2KAC A;  1JWM D;  2FUG 1;  4KKI A;  3Q69 A;  4C4V B;  4F7Z A;  3EA6 A;  1WX8 A;  1YX6 B;  3N20 C;  4FLH A;  3IT4 B;  1JCK B;  2J0M A;  2ONQ A;  2IO3 B;  3QJZ A;  1G6J A;  4GXB A;  1UD7 A;  1HTQ A;  3TEY A;  2C5L C;  3X0W A;  2TSS A;  3U52 E;  1WYG A;  2BQQ A;  3GE8 C;  2VZK D;  5BMI A;  2CHX A;  1P7E A;  2WWZ A;  3HIZ A;  3K9P B;  1FNW A;  3DOW A;  4GB9 A;  1ROE A;  3AEB B;  2O6V D;  1SJE D;  5BYR A;  4ZHP A;  1HEZ E;  2V4L A;  4IWO A;  2MSE D;  2KQ4 X;  3HVD A;  1DOY A;  1DOI A;  1FD6 A;  2MCN B;  5LXI B;  2DLB A;  4MH0 E;  1Y8R C;  1JWB D;  4A55 A;  2BF8 B;  3L16 A;  1V97 A;  1RYJ A;  4E3C A;  3KWV A;  4HLE A;  3NZS A;  3LDZ E;  3M3J A;  3DBS A;  2KWU B;  1ISN A;  3VRB B;  3DCG A;  5CHF A;  2D3C A;  4KV2 A;  2LJ5 A;  2BB6 A;  3B0A A;  3O65 B;  1TS4 A;  3MP9 A;  1LM8 B;  4R3D A;  4WQO B;  1I4X A;  2X8X X;  3R3M A;  3VR8 B;  2PJH A;  1RM6 C;  1WRD B;  5FR3 A;  4XE0 A;  3VDZ A;  1SSN A;  5E6O A;  2CJO A;  4DHZ B;  2HTM E;  4DXG A;  2WLB A;  3Q6B A;  1WSP A;  2MLB A;  2DBY A;  4WAF A;  1FFV A;  3IFW B;  1E7U A;  3B1L X;  1T5X D;  2LXC A;  4KIK A;  2JT4 B;  1SXT A;  4XWT A;  2K6Q A;  1QKZ A;  3M63 B;  3KUZ A;  2REX A;  2L05 A;  3WA0 A;  3PSE B;  5AZH A;  1L0X B;  3AH7 A;  1VD2 A;  4TMA B;  3U7Z A;  1EF1 A;  1QQR A;  1FMA D;  4W9L A;  1P7F A;  1ZXH A;  1FFU A;  1WRI A;  1F0Z A;  3VXW A;  2MA9 B;  4KX6 B;  2AL6 A;  3RZF A;  3C19 A;  1XCT L;  4M00 A;  5AZF A;  2L1A A;  2HJ8 A;  1SE4 A;  1SBB B;  2INC C;  1YMH E;  2LGX A;  4USA A;  1WIA A;  3BYY B;  2WXQ A;  1L2N A;  5IO9 A;  4EUT A;  2DEN B;  1HQR D;  4HCP B;  4H2A A;  1ENF A;  2FID A;  3MFG A;  1H4R A;  3ZNZ B;  2DAJ A;  2ZPY A;  3E56 A;  1TS5 A;  2G3Q B;  2CU1 A;  2M8S A;  1Q5W B;  4HWI B;  1UWX A;  3X23 A;  3V6E B;  3CWI A;  3ZGZ A;  2ZJD A;  2RPQ A;  3HK0 A;  1GAQ B;  4DBG A;  2WU5 B;  4PS3 A;  4JGH B;  3ML9 A;  1E7V A;  4W9F A;  2PIA A;  2C60 A;  3RNB C;  1WXM A;  1C76 A;  3VUY A;  1S3S G;  2GBJ A;  2INP E;  4M0W B;  4IDI A;  2IZV B;  2BBC A;  3BIN A;  1WJU A;  2D10 A;  4MH8 A;  1UEL A;  4JPS A;  5AUI A;  3W1S C;  2PVG C;  3AE6 B;  4IW0 A;  1IBX B;  2OHF A;  2K0P A;  5G2N A;  1PQS A;  1TY0 A;  2J42 A;  2WP9 B;  3ONS A;  4EOY A;  3ZDT A;  1GJZ A;  2KN4 A;  2L3Z A;  1I4H A;  1XEE A;  4HRO A;  1LGR A;  4E74 A;  2UU7 A;  3VTW A;  4GLS C;  2EKE C;  2KTF A;  4NY0 A;  1TS2 A;  1I35 A;  3KUC B;  1LQB A;  4W9G A;  1WMH A;  1T0R C;  5GMV A;  4W9E A;  3QQ8 B;  2LAS A;  2LHE A;  2A4Z A;  4K7W A;  4FXC A;  1K50 A;  3H7P A;  5HKH A;  2L32 A;  4PYZ A;  2WS3 B;  4M8N A;  2JZP A;  2KDF B;  3VAW A;  2FUH B;  3VH4 B;  1C78 A;  1PDX A;  1TZO A;  4MDK E;  1Q10 A;  1TS3 A;  5JH5 C;  2W9N A;  1HE8 A;  3Q3M C;  1C4C A;  1DGJ A;  2XK5 A;  4KDL B;  4MSM B;  1TZ1 A;  2Y5C A;  1OFF A;  4RFB A;  3WIM A;  3ML8 A;  4DHJ B;  1XD3 B;  3U30 A;  3H7P B;  2JWU A;  1GB1 A;  1LO5 D;  5BO4 B;  2LVP A;  3DBH I;  4MEL A;  1WGK A;  1VZ7 A;  2N1W A;  1VJK A;  4JL9 A;  4AJW A;  1RWS A;  4NPN A;  4NJC A;  4IM2 A;  4YSX B;  3PV1 A;  2WXF A;  1SIJ A;  2K1F A;  3R2T A;  1K51 A;  3V61 A;  5I4D A;  2KYW A;  2N7E A;  1KTK A;  1TIF A;  3V3X A;  4I6N B;  3BVG A;  2BYF A;  3P4S B;  1TKG A;  2H89 B;  4HPL B;  4MJS B;  3DBH B;  4WJQ A;  3U7D A;  2Y5B B;  3Q3J A;  2PKO A;  3BYT B;  4ZRP A;  1XO3 A;  2LI5 A;  2NPT B;  3OLM D;  3I57 A;  3L10 B;  5AZG A;  2PMV A;  1N62 A;  4GN1 A;  1T3Q A;  2WDR B;  4NAM A;  4IC7 B;  4JQW C;  1H8C A;  1XLQ A;  3CSF A;  3LXF A;  1RLF A;  4C7Z A;  2MW5 A;  4KDI C;  4WQM A;  2VZK B;  3ZJT A;  4ANW A;  2KAN A;  3R8B A;  5HG2 A;  3EGR A;  1GPX A;  2KVR A;  2QHO A;  3H1U A;  1NYQ A;  1EWY C;  1V49 A;  1IP9 A;  5CTR C;  1WXQ A;  2WXL A;  3KW5 B;  3KVF B;  2MRP A;  1HZ6 A;  2KQS A;  1FRR A;  4JWU C;  3W1S A;  5EE9 A;  3K9O B;  4TQ1 A;  1D4B A;  2G1E A;  1YQ4 B;  3KYC D;  1P3Q U;  5BYQ A;  3HM6 X;  1VLB A;  1YN3 A;  4PK1 A;  2BVC A;  4XC2 A;  3UIO B;  3BY4 B;  3VR9 B;  2CHZ A;  3AM9 A;  5H8Y E;  4JE3 B;  1LFD A;  2K8B A;  4HJG E;  1M4V A;  1SE3 A;  3AE9 B;  3J9C A;  1L6V A;  2AYO B;  3ZVV A;  3Q2A C;  1EWC A;  2KJH B;  1Z5S B;  2K6D B;  2KFK A;  1RAX A;  2Y5P A;  2YVC A;  2XBB C;  4KGR A;  3L0W B;  5IN7 A;  4IOI E;  4EZK A;  3GP7 A;  4ARC A;  2KFJ A;  3NY5 A;  4DXA B;  4HVB A;  1K8R B;  1YJ1 A;  1FXA A;  5JHB A;  2L83 A;  4J3O D;  3HUI A;  2LD9 A;  3AEF B;  1SGH A;  1Y56 A;  3QK0 A;  3TEW A;  3V6C B;  4LTU A;  5J17 A;  1T0S C;  2IY1 B;  2B3A A;  2LJI A;  3PHX B;  2MHJ A;  5TR5 A;  1STE A;  3ZTC A;  1VZ6 A;  4KIK B;  3KWL A;  2FCQ A;  3DVN U;  2DX5 B;  3RFZ B;  1E8Y A;  3EC8 A;  3OG5 A;  3VTV A;  3ZLZ A;  3AI5 A;  4GDK A;  3HHM A;  4GIV A;  1J7B A;  1ZW7 A;  3N32 A;  3CST A;  5HHD G;  2C7M B;  3N9Y C;  1R4M I;  4EE2 A;  2J0K A;  1PUT A;  2V1Y A;  4RGM A;  2M19 A;  4WJO A;  1S1Q B;  4BOZ B;  3A9K B;  1XF5 L;  3GZN B;  1IGD A;  4HDQ A;  3DWG C;  5D3I B;  3AEC B;  3ZTD A;  1MG8 A;  1YX5 B;  2VRR B;  2UWQ A;  1KLV A;  3RT3 B;  1JAL A;  3Q3N C;  3MJW A;  2ON8 A;  4JWS C;  5D6J B;  2LUE A;  2N7J A;  3RNE C;  5CHW A;  3AB5 A;  2I1J A;  2AQ1 B;  1FEH A;  4XDD A;  2DNF A;  2NBW B;  1YJJ A;  2WXJ A;  3MHZ A;  1EO6 A;  5L83 A;  1AAR A;  4HJK A;  1D5Z C;  2SEB D;  1UWM A;  3ECI A;  3QAQ A;  4DWF A;  3LJ3 A;  1JWS D;  2V9H A;  2FCS A;  4A6Q A;  3P2B A;  3TCA A;  5MPO A;  4B95 A;  2MBB B;  2ZZP B;  1JW9 D;  1X1M A;  1D3Z A;  2LZ6 A;  2JSV X;  4GMV A;  4ACF A;  2O2V A;  1TKE A;  4K1R B;  5FR6 A;  1EU3 A;  2V3S A;  1MHX A;  3FIL B;  1KOT A;  2XK5 B;  2NBU A;  4BKS A;  2J0J A;  2WGS A;  2W54 A;  3N30 A;  2KDM A;  3TUO A;  1VRA B;  1GUA B;  3UIN B;  2LWP A;  1OEY J;  2PE9 A;  1EF5 A;  4KVG B;  4YL8 A;  3AE3 B;  4TUU A;  1C9F A;  1TYG B;  2NCN A;  3PTF C;  4ASW C;  1VCB A;  3TL5 A;  3QA8 A;  4TQ0 A;  2RDB C;  4DHJ D;  4NJ6 A;  2JZZ A;  4URK A;  2AX5 A;  4HEA 1;  4HXD A;  3AU5 A;  2WXI A;  2KVZ A;  4FAD A;  3V60 A;  2JUO A;  4MGI E;  4RF1 A;  4BOS C;  1V6E A;  1KFY B;  4QAY A;  1VZ8 A;  1C4P A;  2M0X A;  4WH4 A;  2K25 A;  4MSQ B;  4MAC A;  2RGF A;  2JQR B;  3QIJ A;  1V80 A;  3M95 A;  4B9K A;  2JXX A;  4HKQ A;  3Q3F A;  4XYC A;  4M02 A;  5C2T B;  1KF6 B;  3VH3 B;  2WXG A;  4G50 A;  2PPH A;  3DVG X;  4CYE A;  2WXH A;  2IBI B;  3AEE B;  2HD5 B;  1YJI A;  2LGY A;  2BB5 A;  2J53 A;  2KC2 A;  1WJ4 A;  2ZPN A;  2E3T A;  1PYW D;  1JRO A;  4A3O A;  1OGW A;  2WXR A;  4IG7 B;  4YTN B;  4I6L B;  1V1O A;  1WR6 E;  1IYF A;  4K3B A;  1WXV A;  3RN9 C;  1CK1 A;  1UBQ A;  1WFY A;  1E0Z A;  4HDO A;  1WJN A;  2NR2 A;  1CMX B;  1NDD A;  3DVN V;  4HK2 A;  2AEH A;  1UUP A;  5IA7 A;  1C3T A;  4WAA A;  3MC0 B;  4US8 A;  4YWG G;  3DPD A;  2BWF A;  5FK9 C;  3T3N A;  1QLB B;  5J18 A;  4GGQ A;  3A1Q A;  2GRI A;  4RF0 A;  1YD8 U;  2KD0 A;  4NNJ B;  4LNO A;  4OZA A;  2LVQ A;  2YEP B;  1F9J A;  5KHQ A;  2D11 A;  3IAS 1;  3PRP B;  4FJY A;  5LLI A;  2JZ3 B;  3SU8 X;  1FPY A;  5FKA C;  3N3K B;  1E90 A;  1EUV B;  3B08 A;  2JF5 A;  4WWO A;  3N1X C;  4LDT B;  4Q2J A;  3ZJU A;  2IO0 B;  2IGG A;  1V5O A;  3BWU D;  3EHV A;  4W9J A;  4BFR A;  3IHP C;  2KWV B;  3AE7 B;  3ZO5 B;  3ZNH B;  2HDE A;  4GOC A;  3RNA C;  3Q14 C;  3QAR A;  3PZD A;  1V1P B;  2JRH A;  3VFK A;  2DHZ A;  2UYZ B;  4BBN F;  1WZ3 A;  3QX1 A;  1E10 A;  2QDF A;  2ZCB A;  2K22 A;  4HKZ E;  2GB1 A;  2L00 B;  1ZP0 B;  2G4D B;  4LNN A;  1DYQ A;  2J4X A;  4P1B C;  5L95 C;  4UDU C;  3V05 A;  4C56 C;  4WWM A;  1JRP A;  3IT6 B;  4REZ A;  3PLU A;  3DBR B;  3LYY A;  4DDG D;  3JYU A;  4F8C B;  1T6B X;  1GC7 A;  3T9L A;  1IGC A;  2K9X A;  3C0R B;  2GMI C;  2BPS A;  2YLM A;  3CF6 E;  4C80 A;  4PS7 A;  4W9C A;  3VRA B;  2LEK A;  4M01 A;  4S0R A;  4F1S A;  3AMZ A;  3TSS A;  2N9L A;  1SB3 C;  3APF A;  2QSD A;  4MGK E;  3A4R A;  5DPS A;  4MEM A;  2MBO A;  3I63 C;  4LJO B;  3BVM A;  2LGI A;  2FCN A;  4FUL A;  2DZJ A;  3I5J C;  4ARI A;  2KX0 A;  1SE2 A;  1PGB A;  1MFW A;  3NVY A;  2BTE A;  4OW0 A;  2ZVO A;  2N0S B;  3HM3 A;  2N9E B;  5EDS A;  5E6N A;  4LJP B;  2V4I B;  2W3R A;  2ZNV B;  5DPT A;  1AWD A;  3DHH C;  3D32 A;  1L6U A;  2CU3 A;  4RGN A;  4FHJ A;  3NZ3 A;  4OVZ A;  1F2R C;  4XZ4 A;  2RSU A;  1WH3 A;  2N9P C;  1P98 A;  3NOB A;  3AE5 B;  4EEW A;  3A9J B;  2QCZ A;  3AN1 A;  4FJZ A;  4TKN A;  4KZC A;  2C7H A;  3C8Y A;  4JX1 C;  2BGF A;  4GDL A;  1K52 A;  5GXG B;  2KJ6 A;  3Q8A A;  2KWD A;  2INN E;  2WXM A;  5EE0 A;  1WXS A;  1MHH E;  3BVZ A;  3W9C B;  4ITK A;  2YEP F;  1TBE A;  3OWE B;  3SR6 A;  2AQ3 B;  2IYD B;  1WE7 A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 2V4L A;  3QK0 A;  4IWO A;  2G45 B;  3V6C B;  2KTR B;  4ANX A;  2WX1 A;  5J17 A;  4AOF A;  2PEA A;  5C1Z A;  2IY1 B;  2IY0 B;  2B3A A;  2MSE D;  3PHX B;  4W9I A;  3PS6 A;  2L8J A;  2L7R A;  5TR5 A;  2KO3 A;  3SD5 A;  3ZTC A;  2MCN B;  4BVU C;  4KIK B;  2FCQ A;  1GNU A;  4N9F 4;  3QWZ B;  5LXI B;  4MH0 E;  3DVN U;  2BKR B;  1Y8R C;  2OJR A;  2DX5 B;  2Z0E B;  2BF8 B;  2GBM A;  3L16 A;  2EMS A;  3IG3 A;  1E8Y A;  2CKH B;  3APD A;  3EC8 A;  3PT2 B;  1WGY A;  4E3C A;  1WXA A;  3VTV A;  4HLE A;  3NZS A;  3ZLZ A;  3AI5 A;  4GDK A;  3LDZ E;  3HHM A;  2BWE S;  1WI0 A;  4GIV A;  2N4F A;  3EEC A;  1ZW7 A;  3M3J A;  3DBS A;  1WE6 A;  1ISN A;  2KWU B;  3N32 A;  4IWP A;  4BKS D;  1P1A A;  3IBE A;  3DCG A;  3CST A;  2C7M B;  1R4M I;  3PPA A;  2J0K A;  4WWN A;  5CHF A;  3PGE A;  2V1Y A;  1SIF A;  1J19 A;  1S1Q B;  4WJO A;  3A9K B;  3ZKJ C;  3ZRC A;  4BOZ B;  2O6V B;  4KV2 A;  2BYV E;  2LJ5 A;  3VHT C;  3NHE B;  5CHV C;  3B0A A;  3O65 B;  4HDQ A;  2KX3 A;  5JZE B;  3ZTD A;  3ENE A;  4M8M A;  4FJV B;  2LGD A;  1MG8 A;  4ZYN A;  1GG3 A;  1YX5 B;  2NS5 A;  2VRR B;  1LM8 B;  2UWQ A;  2DYO A;  2C7N B;  3AU4 A;  3PRM B;  4KSL C;  4KZ0 A;  4WQO B;  3RT3 B;  1KLV A;  1XT9 B;  1WF9 A;  3R3M A;  3MJW A;  1WZ0 A;  3KYD D;  1J0G A;  2PJH A;  1UH6 A;  1OQY A;  2A5U A;  1WRD B;  3UGB B;  4II2 B;  5D6J B;  2LUE A;  4K81 A;  3V62 A;  5AEK B;  5CHW A;  2J7Q B;  4ICU A;  5IAA C;  4X57 B;  2I1J A;  3VDZ A;  4BBN C;  5E6O A;  4NJ7 A;  1RRB A;  2MWS B;  2NBW B;  2KLC A;  4DHZ B;  1WY8 A;  3MTN B;  3VUX A;  3UQA A;  4NQK E;  1EO6 A;  1OEY A;  4MGY E;  5L83 A;  2MLB A;  1AAR A;  2AL3 A;  3IFW B;  2MBQ A;  4HJK A;  1E7U A;  3B1L X;  1GC6 A;  2JRI B;  4ANV A;  2NPT A;  2LXC A;  4K7S A;  4KIK A;  2KFK B;  2JT4 B;  4AWJ A;  2JPH A;  4P7I A;  3APC A;  1OTR B;  2K6Q A;  2KJR A;  3M63 B;  3KUZ A;  3ECI A;  2REX A;  1TGZ B;  3QAQ A;  2L05 A;  1JRU A;  3LJ3 A;  3WA0 A;  4DWF A;  3PSE B;  2RD0 A;  5AZH A;  4W9K A;  2FCS A;  2KZR A;  3P2B A;  3TCA A;  3PVL A;  1UBI A;  1VD2 A;  4B95 A;  3ZDM C;  1EF1 A;  2MBB B;  2EMT A;  2GOW A;  2ZZP B;  1X1M A;  1D3Z A;  3WAM A;  2LZ6 A;  4GMV A;  4W9L A;  2O2V A;  1WMH B;  3SDL C;  4K1R B;  5FR6 A;  2ZVN A;  2V3S A;  3A1Q B;  1KOT A;  2XK5 B;  3DQV A;  2NBU A;  1QZE A;  3VXW A;  4BKS A;  2MA9 B;  2J0J A;  3RUI B;  2AL6 A;  3RZF A;  2D2Q A;  3N30 A;  5AZF A;  2LXA A;  2HJ8 A;  1GUA B;  3UIN B;  2L0F A;  2LWP A;  1OEY J;  2PE9 A;  5C23 A;  2KLG A;  4ZRJ A;  4CO7 A;  1EF5 A;  2LGX A;  5KHO A;  1ZGU B;  4KVG B;  1WIA A;  2MQJ A;  2C9W B;  4YL8 A;  4TUU A;  1L2N A;  2FAZ A;  4G0N B;  3JVZ X;  3ZNI D;  4EUT A;  4NQL B;  3QC8 B;  2NCN A;  2DEN B;  2KNB A;  3PTF C;  5D94 A;  4DHZ E;  4FA6 A;  2FIF A;  2KOX A;  4G3X B;  4GDK B;  4ASW C;  1VCB A;  4LCD E;  4HCP B;  4GSW A;  3TL5 A;  2FID A;  4FHK A;  1H4R A;  3L54 A;  3QA8 A;  3ZNZ B;  4TQ0 A;  4DHJ D;  2DAJ A;  2ZPY A;  2JZZ A;  4NJ6 A;  4ZDV A;  2DZK A;  4URK A;  3R7R A;  4RMA A;  1WGR A;  2G3Q B;  2CU1 A;  2M8S A;  4HXD A;  2Z59 B;  1Q5W B;  4HWI B;  2AWT A;  4DDI D;  3AU5 A;  1E8W A;  4BKG A;  4OVV A;  4FN2 A;  4WJN A;  3R66 C;  3V6E B;  3X23 A;  2ZJD A;  4FAD A;  2RPQ A;  3V60 A;  3TMP B;  3HK0 A;  2CHW A;  1LXD A;  2JUO A;  1I42 A;  4MGI E;  4DBG A;  3L17 A;  4AP4 C;  4BOS C;  4PS3 A;  4JGH B;  3ML9 A;  1E7V A;  3A4S C;  2R2Q A;  2KDE B;  3KUD B;  3QHT A;  4LDT D;  4W9F A;  1V6E A;  3TIX A;  2C60 A;  1WXM A;  1WM3 A;  3VUY A;  2WDT B;  3PLV A;  2KKC A;  1BT0 A;  1S3S G;  2GBJ A;  3M62 B;  4M0W B;  2M0X A;  2K25 A;  4MSQ B;  2M1M A;  1WJ6 A;  2RGF A;  3QIJ A;  1V80 A;  2N1V A;  3M95 A;  2IZV B;  4B9K A;  2JXX A;  2WX0 A;  4PYU A;  3BIN A;  2L0T A;  1WJU A;  2D10 A;  3Q3F A;  1WGD A;  1UEL A;  3W1S C;  3VH3 B;  1V5T A;  4G50 A;  2PPH A;  2GBK A;  2KMC A;  3VQI A;  3DVG X;  4IW0 A;  4ZRK A;  3DVG Y;  4RM8 A;  4CYE A;  5G2N A;  1PQS A;  2IBI B;  3JSV A;  5D7G A;  2HD5 B;  1WR1 A;  2LGY A;  3ZW3 A;  2KC2 A;  1WJ4 A;  2ZPN A;  3ONS A;  5G55 A;  4EOY A;  3ZDT A;  1WGH A;  3TJP A;  4DK5 A;  1GJZ A;  2XEW A;  2L3Z A;  3WAL A;  1P0R A;  3DDC B;  3OJ3 A;  4E74 A;  2JWZ A;  4A3O A;  3VTW A;  1OGW A;  1U4A A;  2GBR A;  3QCA A;  2EKE C;  1NI2 A;  2KTF A;  4NY0 A;  2K39 A;  3UF8 A;  4EZJ A;  4IG7 B;  1I35 A;  3KUC B;  2ZEQ A;  2KDB A;  4I6L B;  1LQB A;  4ZRI A;  1IPG A;  1WR6 E;  3I3T B;  1A5R A;  1IYF A;  2M17 A;  4W9G A;  1WMH A;  1UGM A;  1KJT A;  4MGZ E;  2N9X A;  1WXV A;  3L13 A;  2NBV B;  3GOE A;  5GMV A;  2KWC A;  4W9E A;  3QQ8 B;  2LAS A;  1UBQ A;  1WFY A;  2A4Z A;  4HDO A;  4K7W A;  3JSV B;  1WJN A;  3JW0 X;  2NR2 A;  3H7P A;  5HKH A;  4PYZ A;  3TBL D;  2MBE A;  1CMX B;  1NDD A;  4M8N A;  1P9D U;  4A3P A;  3DVN V;  2KDF B;  4HK2 A;  2AEH A;  2K8C A;  2L76 A;  3VAW A;  3IVF A;  5IA7 A;  4RM9 A;  4G11 A;  2FUH B;  4WAA A;  2N7D A;  4MDK E;  3VH4 B;  1C3T A;  3DPD A;  5JH5 C;  4IM0 A;  2BWF A;  2KN5 A;  3S2A A;  2DYM A;  3EFU A;  2W9N A;  3R7Q A;  5J18 A;  2KMA A;  1Q1O A;  4GGQ A;  1HE8 A;  3A1Q A;  1TTN A;  3CMM B;  2XK5 A;  3NZU A;  3RD2 A;  1YD8 U;  3AUL A;  4KDL B;  4MSM B;  4TV3 A;  1TZ1 A;  2KD0 A;  2KC1 A;  3A9J A;  3A9K A;  3WIM A;  3ML8 A;  4DHJ B;  1XD3 B;  2O6V A;  3PRE A;  4NNJ B;  4ANU A;  3U30 A;  3ALB A;  1C1Y B;  2LVQ A;  3H7P B;  3H6N A;  4KSK C;  1F9J A;  5BO4 B;  5KHQ A;  2LVP A;  3DBH I;  2D11 A;  3MHS D;  4MEL A;  1Q0W B;  2GBN A;  3PRP B;  4FJY A;  2JZ3 B;  5LLI A;  2N1W A;  3SU8 X;  5D2M B;  4W9H A;  3WAO A;  4AJW A;  4JL9 A;  3N3K B;  4AUQ C;  2HTH A;  4AJY B;  1E90 A;  5LXH A;  1M94 A;  4NPN A;  3WAP A;  1EUV B;  4IM2 A;  4JLC A;  3B08 A;  2JF5 A;  3PV1 A;  4IWQ A;  2K1F A;  4WWO A;  1E5W A;  3V61 A;  1J8C A;  4LDT B;  2IO0 B;  3EHV A;  1V5O A;  1WX7 A;  3RCZ A;  2N7E A;  4W9J A;  4BFR A;  3GZN I;  3IHP C;  3VTU A;  2KWV B;  3PHW B;  3ZO5 B;  4I6N B;  3ZNH B;  1V81 A;  2BYF A;  1WGG A;  2R2O A;  4GDL B;  2CS4 A;  2OOB B;  1T0Y A;  4HPL B;  4MJS B;  2KXJ A;  4GOC A;  4WJQ A;  3U7D A;  1V9J A;  5DPW A;  2Y5B B;  1L7Y A;  3Q3J A;  4WJP A;  4MJS A;  1WYW B;  3QAR A;  2WYQ A;  3PZD A;  4II3 B;  1SE9 A;  4HPM B;  2JRH A;  2LI5 A;  2JY6 A;  2KHW B;  2NPT B;  3VFK A;  2DHZ A;  2UYZ B;  2MX2 A;  4JIO U;  2I1K A;  4EFO A;  3DBR I;  3OLM D;  1R4N I;  2MP2 A;  4NAW B;  1WZ3 A;  3L10 B;  4BBN F;  3QX1 A;  5JHA A;  1E8Z A;  5AZG A;  4A20 A;  2ZCC A;  4B6W A;  2LRU A;  3ZNG C;  3VVW B;  4GN1 A;  2MP2 B;  4NAW A;  2ZCB A;  4IC7 B;  4JQW C;  1H8C A;  3W1Y A;  1FXT B;  2L00 B;  2D3G A;  3CSF A;  2PE6 B;  3PRZ A;  2G4D B;  1RLF A;  1WM2 A;  4WWP A;  2DAF A;  2KTR A;  1YIW A;  1ZKH A;  1RFA A;  2MW5 A;  4KDI C;  5L95 C;  1Z2M A;  3T8M A;  4EKU A;  4ANW A;  2KAN A;  1WX9 A;  3PLU A;  4GU2 A;  2BKF A;  5DPR A;  3U8Z A;  2FCM A;  4DDG D;  2KDI A;  3JYU A;  4F8C B;  2KVR A;  3T9L A;  1GC7 A;  2QHO A;  4ICV A;  2JVC A;  3WAN A;  2ZNV C;  3C0R B;  2GMI C;  2BPS A;  2YLM A;  3CF6 E;  3H1U A;  1NBF C;  3KH0 A;  2DYB A;  1YQB A;  1KM7 A;  2DZM A;  2RR9 A;  4IM3 A;  4PS7 A;  3A33 B;  2ASQ A;  4W9C A;  3SHQ A;  5E6P A;  1V86 A;  1V49 A;  1IP9 A;  4I6P A;  2M4N A;  2O2V B;  2KQ7 A;  5CTR C;  4F1S A;  3KW5 B;  3KVF B;  2MRP A;  2IO2 B;  2KQS A;  5J2R A;  2CR5 A;  3APF A;  4MGK E;  4IUM B;  4HCN B;  3A4R A;  5DPS A;  3H9D A;  2MBO A;  3L08 A;  4LJO B;  4MEM A;  3W1S A;  5CX3 A;  2FCN A;  4PS8 A;  3OJ4 B;  4FUL A;  2DZJ A;  3K9O B;  4TQ1 A;  3RZW C;  4W9D A;  2G4S A;  3NS8 A;  4MM3 A;  4CHK A;  2KX0 A;  3KYC D;  4OVU A;  2K8H A;  5DCN A;  1V2Y A;  3ZRF A;  2IO1 B;  1P3Q U;  2ZVO A;  3HM6 X;  3HM3 A;  2N9E B;  5EDS A;  5E6N A;  4LJP B;  3RUL A;  2KK8 A;  4XC2 A;  3VUW A;  2DZI A;  1XQQ A;  2ZNV B;  3UIO B;  5DPT A;  3BY4 B;  4EZL A;  4K7U A;  4F7Z A;  2CHZ A;  3AXC A;  3D32 A;  1WX8 A;  2LVO A;  1YX6 B;  4FLH A;  2Z0D B;  2J0M A;  2BYE A;  4FHJ A;  4FBJ B;  2IO3 B;  1LFD A;  2K8B A;  1UZX B;  3QJZ A;  4J6I A;  2RSU A;  1WH3 A;  2N9P C;  4XZ4 A;  1P98 A;  1G6J A;  2AYO B;  3NOB A;  3ZVV A;  4GXB A;  1UD7 A;  2LRW A;  4E71 A;  4EEW A;  2KJH B;  1Z5S B;  3A9J B;  2C5L C;  4FJZ A;  4TKN A;  3X0W A;  4KZC A;  2K6D B;  2C7H A;  2KFK A;  3UIP B;  1RAX A;  2BGF A;  4GDL A;  4BKT A;  2YVC A;  3ZUN A;  3ZIM A;  2NVU I;  2D07 B;  2XBB C;  2KJ6 A;  3UQB A;  3L0W B;  2CHX A;  1WXS A;  2WWZ A;  3H7S A;  2MBH A;  3HIZ A;  3K9P B;  1E8X A;  4EZK A;  2FNJ B;  3OAW A;  3DOW A;  4GB9 A;  3RYT A;  2KFJ A;  3NY5 A;  4XX5 A;  4DXA B;  1TBE A;  3DBL I;  4HVB A;  1K8R B;  1YJ1 A;  2O6V D;  5JHB A;  2IYD B;  1WE7 A;  2HE7 A;  2LD9 A;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...