3ZTDA

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
102
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 102
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztdA00
1WMHB 1T0YA 4FADA 3CSFA 2WDTB 2N9EB 5D2MB 3WALA 3ML8A 3PSEB 4NY0A 3MHSD 1WR1A 4N9F4 3T8MA 2CHZA 1WM3A 3RUIB 2MCNB 2J0MA 2V1YA 2D10A 1YQBA 4FULA 1WGGA 1V86A 3NZSA 2KMCA 3JYUA 3QQ8B 2JY6A 2KFKB 4G0NB 2HD5B 4MELA 1HE8A 3JSVB 4KZ0A 1WXVA 1ISNA 1IPGA 1Q1OA 4KIKB 2LRWA 1WRDB 3P2BA 3UF8A 4HVBA 4GU2A 3VUYA 1C1YB 4DHZB 1WIAA 1YX5B 4NNJB 2DHZA 3KUCB 4II3B 1GNUA 3B1LX 4BKSA 2KLCA 2DYBA 3ZRCA 1GG3A 1RAXA 1E5WA 2C5LC 2DX5B 4FJYA 2C7NB 4HXDA 3IVFA 3L17A 1RLFA 2FCMA 3H1UA 4WJPA 1LM8B 2MWSB 1E8WA 4GGQA 4ASWC 2M8SA 3H7SA 4I6NB 1WGRA 4ANWA 1J0GA 1WGHA 4KSLC 2BYFA 3DQVA 4HCPB 4E74A 2GOWA 2D2QA 3PRZA 2HE7A 4MM3A 1EO6A 2L0TA 4TQ1A 3PT2B 3KVFB 2C7HA 4HCNB 4DDGD 4K7UA 5JH5C 4IW0A 4AWJA 3HK0A 2MX2A 2LD9A 4LJPB 5KHOA 4I6LB 3PGEA 3HHMA 4II2B 2MP2A 3NS8A 1WJNA 2L3ZA 2KWUB 4K7SA 2MA9B 1YIWA 2KJ6A 1J8CA 3VFKA 2XK5B 4DHZE 2XBBC 2EKEC 5C23A 3ZO5B 4IUMB 3V60A 1LXDA 2KDFB 5L95C 4MGZE 4KVGB 3A4SC 5J18A 4DXAB 2KDIA 4AJYB 2L76A 2AL3A 1I35A 3VH3B 4G11A 2Y5BB 1P3QU 4NQLB 2DZKA 2KOXA 4PYZA 4X57B 2K6DB 3IFWB 3A9KA 4BOZB 2J0KA 2L00B 3X23A 3PRPB 3R66C 4W9HA 2NPTB 3CSTA 1WE7A 4CYEA 3BY4B 2JWZA 1EF1A 1WF9A 4HJKA 2RGFA 4HLEA 2KC2A 4FA6A 1V81A 2JUOA 5E6NA 3ZDTA 4AJWA 3ZKJC 1VCBA 1TBEA 4MH0E 3ZDMC 3KW5B 2I1KA 1OEYA 3R7RA 3DVGX 1UELA 1LQBA 2Z0DB 3U30A 2DYOA 1WJ6A 2ASQA 2LGXA 1V2YA 4K1RB 3L16A 3ZNGC 2N4FA 3GZNI 4DBGA 3H6NA 4DHJB 2KJRA 2ZPYA 1WR6E 1G6JA 4HDOA 1A5RA 3QK0A 2DYMA 3AI5A 1WE6A 3L54A 4HDQA 5D94A 1TTNA 2EMTA 2HTHA 3DBSA 1P9DU 2FNJB 1WX9A 3KUDB 1VD2A 3V6EB 5L83A 4NJ7A 5JHAA 2GBNA 3ZUNA 1WZ0A 1S1QB 3APDA 4JL9A 4FJZA 2NBVB 2REXA 5CX3A 3QA8A 3L13A 1L2NA 5EDSA 4A3PA 2AL6A 5E6OA 2OJRA 4G3XB 4GMVA 3RCZA 4BKTA 5IAAC 3RT3B 2FIFA 3TCAA 4IC7B 4AP4C 1Z2MA 1V5TA 1WM2A 2PE9A 3R7QA 4DDID 3V61A 3ZNZB 4JLCA 3OAWA 3C0RB 3KH0A 3QJZA 3W1SC 2LUEA 1WXSA 1P98A 2NPTA 2N7DA 4BOSC 4WAAA 4EZLA 2IO3B 1X1MA 3ZVVA 3ECIA 3RZWC 1OTRB 1LFDA 2LI5A 2L05A 4EOYA 2CU1A 2MP2B 2LJ5A 3TL5A 2BPSA 3IG3A 2D07B 5LLIA 2VRRB 2KC1A 2XEWA 1AARA 2NVUI 2O6VD 2KX0A 2KQ7A 4MSQB 1UZXB 2R2QA 2ZCBA 4GN1A 2CKHB 1QZEA 2MBHA 3PZDA 4CHKA 4WJQA 4XZ4A 4NJ6A 5CTRC 1R4MI 1WXAA 2KDBA 3ZRFA 1Q0WB 4WWPA 5JHBA 5LXHA 1KJTA 5DPRA 2K25A 3A9KB 3VH4B 3OLMD 3VUWA 3APFA 4M8NA 1NI2A 1WFYA 1UGMA 4G50A 4W9GA 4GOCA 4GSWA 4XX5A 2ZNVC 5CHFA 2PEAA 2RR9A 5C1ZA 3DOWA 3H9DA 4GDLA 4JQWC 3ML9A 4BFRA 4W9CA 2JXXA 3LJ3A 3PTFC 2JZ3B 4IM3A 4EFOA 3IHPC 3ZIMA 3A9JA 2LGDA 3ALBA 2YVCA 4K7WA 1UBQA 2A5UA 1CMXB 2O2VA 1U4AA 3ZNHB 3WIMA 5AZHA 4FJVB 3H7PA 4W9KA 3ENEA 2JVCA 4EKUA 4TKNA 4DK5A 2N9XA 2GBKA 2JF5A 4WQOB 4F7ZA 2M0XA 4J6IA 2KHWB 4W9LA 1KM7A 4OVVA 4EEWA 5HKHA 3VTVA 3UQAA 2M4NA 2K39A 3RULA 3LDZE 2J0JA 2MBOA 2C7MB 1H4RA 5BO4B 4B6WA 2FCQA 1TZ1A 1GUAB 2JRIB 4ANUA 3DBHI 3S2AA 4M8MA 5CHWA 1ZW7A 2K8CA 5D7GA 3UIOB 3JVZX 1E8YA 2HJ8A 1M94A 2CHWA 4W9EA 2OOBB 3AULA 2ZVNA 3BINA 5E6PA 3UQBA 2N1VA 2JRHA 1V6EA 3Q3JA 1XQQA 2C60A 1IYFA 4MDKE 3PPAA 4ZRJA 1MG8A 1J19A 2KANA 1UBIA 2PJHA 3ZLZA 2ZEQA 3CMMB 3T9LA 1E90A 4F8CB 3HM3A 2G4DB 3CF6E 4LJOB 4WWOA 3TMPB 5J2RA 3UIPB 2BWFA 2FUHB 4ICVA 5KHQA 2I1JA 3VTWA 2KVRA 2KQSA 1WH3A 2LWPA 1L7YA 1WZ3A 5D6JB 2ZJDA 2W9NA 2DAJA 4ZRIA 3PHWB 1XT9B 2KZRA 4B9KA 3QHTA 3NHEB 5LXIB 1WX7A 4IG7B 4LDTB 1RFAA 2K8HA 3WANA 2IBIB 3I3TB 3WAPA 4AOFA 4OVUA 3NZUA 4GB9A 3SDLC 3QCAA 3M3JA 2NBUA 4B95A 2MBQA 3VHTC 5TR5A 4FN2A 4JIOU 1E8XA 3K9OB 5AEKB 4IM0A 3SHQA 4FBJB 4GDLB 1S3SG 4IM2A 2Z59B 3W1YA 4KDIC 1WYWB 1OEYJ 2BGFA 3EC8A 4ICUA 3AU4A 2PE6B 1I42A 3A9JB 1YD8U 2BF8B 1V80A 2RSUA 3ONSA 3VDZA 2CHXA 2V4LA 4ZYNA 4TV3A 2LXAA 2O2VB 4GIVA 5CHVC 3QC8B 2KLGA 3WA0A 3H7PB 3X0WA 3DVNU 3AU5A 4IWPA 3PLUA 3N3KB 2A4ZA 2NBWB 4WJNA 2D3GA 2GBRA 3TBLD 1ZGUB 4ZRKA 5FR6A 1YJ1A 4DHJD 1ZKHA 4HPLB 1BT0A 4GXBA 5AZGA 3WAMA 3DCGA 3GOEA 3VVWB 4MGYE 4RM9A 2NCNA 4RM8A 3M63B 4A20A 3QIJA 3HIZA 2IO2B 3RZFA 3RYTA 2BYVE 5JZEB 3VTUA 4KZCA 3B0AA 1V5OA 4NAWA 4BKSD 3L10B 2MBEA 3AXCA 3QAQA 5G55A 4E3CA 3O65B 1UD7A 4EUTA 2G3QB 4P7IA 2IY0B 2NR2A 1GC6A 3RD2A 4BBNF 1SIFA 2M17A 2V3SA 3PHXB 4WWNA 2DAFA 1V9JA 2BWES 3VXWA 2R2OA 3Q3FA 3HM6X 1K8RB 2MW5A 4PS3A 3APCA 3UINB 2J7QB 4FHKA 3PLVA 1V49A 3R3MA 1XD3B 2JT4B 3TIXA 3EHVA 1JRUA 4EZKA 3A1QA 4ANXA 2MRPA 4KDLB 2ZCCA 1NBFC 2KFJA 3ZW3A 3NOBA 4MJSA 5G2NA 2KN5A 1WJUA 2ZPNA 4I6PA 3OJ3A 5GMVA 4A3OA 4DWFA 4HWIB 2KNBA 2KTRA 3M62B 3DBLI 3EECA 5IA7A 2DZMA 4MGKE 3U8ZA 4NPNA 1NDDA 2WYQA 1YX6B 3EFUA 3PVLA 3SU8X 4GDKA 4TQ0A 1WI0A 2DZJA 1TGZB 3QX1A 2K8BA 2LZ6A 2ZNVB 2O6VA 2KKCA 2RPQA 5DCNA 1KLVA 1UH6A 3L0WB 1WX8A 2N9PC 4PS8A 3PRMB 2WX0A 2LVPA 3KUZA 3JW0X 4BVUC 1WJ4A 2K1FA 4W9IA 4ZDVA 2RD0A 2EMSA 1KOTA 1WXMA 2IO1B 2YLMA 3QWZB 2KK8A 4E71A 2G45B 1WMHA 3D32A 2L0FA 3KYDD 1P0RA 4MGIE 2BKFA 1E7UA 2JPHA 3V6CB 2BKRB 4MEMA 4CO7A 3DVGY 3KYCD 1H8CA 2GBMA 4HK2A 3TJPA 4RMAA 2GBJA 2FCSA 2KXJA 2IYDB 2UWQA 1P1AA 2GMIC 4KV2A 3W1SA 4JGHB 4W9JA 2Z0EB 4IWQA 4NAWB 2LVQA 1F9JA 2M1MA 3K9PB 3VUXA 3B08A 2KWVB 4F1SA 1GC7A 1C3TA 1RRBA 2KTFA 5DPWA 2KFKA 1E8ZA 1EF5A 1D3ZA 3MTNB 2B3AA 2ZZPB 3QARA 4MSMB 4W9DA 2JZZA 2WWZA 2N7EA 4K81A 2MBBB 3JSVA 2KJHB 3PV1A 2KWCA 4LCDE 4BBNC 1R4NI 2G4SA 2IZVB 2CR5A 2FIDA 2LVOA 2DZIA 4KIKA 3U7DA 4FLHA 3DVNV 4IWOA 2NS5A 5AZFA 3ZTCA 3L08A 2IO0B 2FAZA 4NQKE 3NY5A 2MQJA 1PQSA 1WGDA 4BKGA 1EUVB 2MSED 2AYOB 4EZJA 3DDCB 1Y8RC 4KSKC 3A1QB 2IY1B 1WGYA 3N30A 3SD5A 4URKA 1IP9A 1Z5SB 4MJSB 1Q5WB 4FHJA 4XC2A 1SGHA 2QHOA 2AEHA 3DPDA 1GJZA 2C9WB 5DPTA 4PS7A 2KDEB 3OJ4B 3WAOA 4TUUA 3DBRI 3ZNID 2KTRB 3V62A 2AWTA 2L8JA 4LDTD 2KD0A 2LRUA 2FCNA 3IBEA 2N1WA 5DPSA 1E7VA 2BYEA 1OQYA 2PPHA 3N32A 2L7RA 2MLBA 4W9FA 3ZTDA 2K6QA 2D11A 4GDKB 1OGWA 3A4RA 2LASA 3PS6A 4HPMB 2KO3A 2CS4A 2O6VB 3M95A 2KMAA 4AUQC 2LXCA 2DENB 2XK5A 4WJOA 3PREA 2UYZB 3MJWA 4ANVA 2WX1A 1WY8A 3VAWA 4PYUA 2KX3A 1FXTB 2LGYA 2ZVOA 3A33B 4M0WB 3VQIA 1SE9A 4YL8A 3UGBB 5J17A
chains in the Genus database with same CATH superfamily
1WMHB 2N9EB 3PSEB 2MCNB 2D10A 1UNSA 1WWTA 1MJDA 3V05A 2KFKB 2HD5B 1HE8A 3JSVB 1XCTL 4YSXB 2WGSA 4OVZA 1P7FA 1QF6A 3FKYA 1YX5B 3KUCB 1FFVA 1GNUA 2MHJA 1E5WA 1K53A 2C7NB 4HXDA 4WJPA 1LM8B 2RMMA 3H7SA 4ANWA 1WGHA 3UI3A 2BYFA 2GOWA 1SJHD 2BS4B 2Y5PA 2KMMA 3HK0A 3T3OA 4USAA 3HHMA 4KX6B 2MA9B 1YIWA 3P4QB 3CWIA 5H92C 5C2TB 4KVGB 5J18A 2OJWA 5AUIA 2DZKA 1T3QA 3PRPB 3Q69A 1YN4A 4CYEA 3BY4B 1WF9A 1ZPSA 1VJKA 2RGFA 4AJWA 3ZKJC 2ZW1A 3KW5B 3NS1A 1PDXA 3DVGX 2M56B 2Z0DB 2DYOA 1WJ6A 2ASQA 2LGXA 4K1RB 2WXRA 4DBGA 3H6NA 3EUB2 5LNK1 4HDOA 2DLBA 3AI5A 1WE6A 4HDQA 5G5GA 1TTNA 4HROA 2FNJB 3KUDB 1LO5D 2FE8A 5L83A 1XF5L 1IBXB 3APDA 4JL9A 4FJZA 2NBVB 2REXA 5CX3A 3L13A 5EDSA 2PVGC 1SB3C 3ZJTA 1Z2MA 1V5TA 1WM2A 4XWTA 2RDHA 2V4IB 3ZNZB 3ZXVA 3QJZA 3EA6A 2N7DA 2IO3B 1OTRB 2LI5A 1VZ8A 2CU1A 2LJ5A 3DBHB 3IG3A 2D07B 2VRRB 2Y5CA 2NVUI 3FC4A 1WYGA 1R4MI 1WXAA 4C4VA 1Q0WB 5JHBA 1C4PA 1L0VB 3VH4B 3A9KB 1UGMA 1L6UA 5CHFA 3DOWA 1XLQA 3ML9A 3R2TA 4M02A 4W9CA 4OHJA 3PTFC 1T0QC 2JZ3B 2MJDA 4IM3A 3RMKC 3ZIMA 4LK0M 2YVCA 1E0ZA 1JRPA 3MHZA 3WIMA 4RGMA 3H7PA 2JVCA 1V1PB 2LGIA 1I7HA 4WQOB 2L83A 2KHWB 5HKHA 2JYEA 3VTVA 3TEXA 2J0JA 1TJEA 1C76A 4KGSA 3U52E 1VRAB 2WDRB 3JVZX 2HJ8A 2CHWA 2ZVNA 3BINA 1BUIC 2W3SA 2PJHA 2N7JA 3T9LA 1E90A 2ONQA 1ZXIA 1MG4A 2FUHB 2WXGA 4OZCA 3U2SC 4YTPB 1L7YA 2ZJDA 2DAJA 1FXAA 4IG7B 2IBIB 3WAPA 3NZUA 3M3JA 2NBUA 1TIFA 2MBQA 5TR5A 2WXOA 2KQ4X 4YSZB 4JX1C 1RM6C 2ON8A 4RGNA 4GDLB 3EFCA 4KDIC 1WYWB 3KWLA 1R7SA 2BF8B 3ONSA 4ZYNA 2V4LA 4GIVA 3QC8B 3AU5A 4IWPA 3TEYA 2NBWB 2L52A 4ZRKA 1EM7A 4DHJD 1ZKHA 4HPLB 4ARIA 5AZGA 1ZDVA 4RM8A 4A20A 1YOVB 2IO2B 3HIZA 1IGCA 3VTUA 1V5OA 1N6ZA 3L10B 2MBEA 3QAQA 5G55A 3GP7A 3RNCC 4EUTA 4P7IA 4BZAA 2JQRB 2NR2A 1GC6A 3AE7B 1FD6A 2M17A 2V3SA 1V9JA 3ZQ4A 2R2OA 2RDGA 2W82A 3BK2A 5HFYA 2D3BA 1FO4A 3UINB 4LNNA 1VDVA 1JWBD 3EHVA 5JXVA 4EZKA 4ANXA 2MRPA 3ZW3A 3NOBA 3CIRB 2KN5A 1WJUA 1MHXA 4REZA 1OQQA 3EGRA 1NDDA 2WYQA 1YX6B 2DZJA 2O6VA 1UH6A 3L0WB 1WX8A 2LVPA 3KUZA 4BVUC 1N60A 1HTQA 3FILA 2WXIA 3GZNB 2IO1B 1WMHA 1P0RA 2BKFA 3DVGY 3KYCD 4RMAA 2UWQA 4A6QA 2GMIC 3BVZA 4KV2A 1JCKB 2Z0EB 5IO9A 4NAWB 1VZ6A 2KFKA 3QARA 4P16A 3JSVA 1NVID 4BBNC 1R4NI 2G4SA 2LHEA 5GXGB 2LVOA 1FEHA 3L08A 4DXFA 1UWXA 2MSED 2L1AA 1PGAA 1Y8RC 1WGYA 2AQ1B 3N30A 4URKA 1IGDA 1SXTA 4MJSB 2C9WB 3WAOA 2KTRB 4LDTD 1EU3A 1NI3A 3AM9A 2BYEA 1OQYA 3Q8FA 5D3DA 2D11A 1YMHE 3MP9A 1STEA 3P63A 3AEFB 4TMAB 1WY8A 4IDIA 1KLGD 2LGYA 3A33B 3BK1A 3VQIA 1TS2A 3CSFA 3WALA 2W54A 4HJGE 1PGXA 2N0SB 4JWSC 2CHZA 3RPFC 4O1NA 1YQBA 5EE9A 3KQ4A 1WGGA 1V86A 4C7YA 2JY6A 1E10A 2JU6X 2WXHA 4MELA 1JQ4A 1F52A 3HRDD 4KIKB 2LUMA 1WRDB 3AEBB 3NRZA 3N1YC 4P1BC 1WIAA 2KYWA 4II3B 2IGDA 4BKSA 1Y56A 2VZKD 4FJYA 1IBXA 2MWSB 1IUEA 1E8WA 2XNAC 2M8SA 4KSLC 2MEKA 4E74A 2D2QA 2BT6A 3PRZA 2HE7A 3PT2B 1L5PA 3KVFB 4HCNB 1E6EB 5JH5C 3WCQA 2QDFA 2QMTA 3IXSA 2IDYA 4B0MA 1WJNA 4L23A 3VFKA 2XK5B 4DHZE 3ZO5B 1MHHE 5C23A 3BVGA 1ZP0B 1LXDA 5L95C 4MGZE 4DXAB 2L76A 3VH3B 4EE2A 4NQLB 1VLBA 3A9KA 4ARCA 2J0KA 3C8YA 5IP4D 3CSTA 1EF1A 4HJKA 1SJED 5BYRA 4HLEA 1D5XC 2JUOA 3Q2AC 1XLNA 2AQ3B 1JWUD 1OEYA 3W9CB 2ICIA 3GZNI 1V1PA 1WR6E 4WAFA 2XN9C 3Q8BA 1ET9A 3MFGA 2EMTA 4A9AA 2ZW0A 4NJ7A 5JHAA 2BBCA 1KRHA 2V3NA 3Q8CA 2K0PA 2AL6A 3L4PA 4UDUC 4GMVA 2CJNA 2B76B 2FIFA 4AP4C 2PE9A 1F1HA 3DBLB 4DDID 3V61A 2VH1A 1GPXA 3C0RB 3W1SC 2NPTA 4B0EA 2OHFA 4BOSC 4XDCA 3ECIA 3RZWC 2L05A 2HTME 1MPEA 2MP2B 3AH7A 2KC1A 1AW7A 2KQ7A 1PYWD 1QKZA 1QZEA 2MBHA 4P1CC 4XYCA 1M4VA 4WJQA 2K3UA 1KJTA 4XX5A 5H8YE 2J52A 2PEAA 2RR9A 4BFRA 4JQWC 4GDLA 4C80A 2WXKA 3LJ3A 1YNTE 2NTTA 3Q6BA 3IHPC 4OW0A 1QT9A 3ALBA 2EELA 4K7WA 1UBQA 2V0GA 2A5UA 1TS3A 5AZHA 4W9KA 4EKUA 2N9XA 1AWDA 2GBKA 4EEWA 4OVVA 5IKCM 1HXYD 3UQAA 1FRRA 3RULA 3LDZE 2QILA 4AQ7A 5BO4B 1PGBA 1GAQB 4M8MA 1ZW7A 2K8CA 2IGHA 4QAYA 1E8YA 1M94A 2MJEA 3AULA 5E6PA 2JRHA 3FAHA 2KN4A 3Q3JA 3B2GA 3PPAA 1MG8A 4RF0A 1C9FA 2IJ0A 1T0RC 2G4DB 3CF6E 3TMPB 5J2RA 2BWFA 2WU5B 2Y3AA 1WH3A 2LWPA 1DOIA 1JROA 5D6JB 1QLBB 2W9NA 4TSSA 3PHWB 1SBBB 3QHTA 1RFAA 1K51A 2K8HA 3I3TB 4AOFA 5EE0A 3QCAA 2H89B 4JIOU 1E8XA 2YEPB 5HI1A 5AEKB 1S3SG 2Z59B 4MH8A 1OEYJ 3AU4A 3BYTB 1I42A 1TZOA 3W5UB 1V80A 3RFZB 2CHXA 4TV3A 2LXAA 2O2VB 2G1EA 3O13A 3X0WA 3DVNU 2NMQA 2GBRA 1ZGUB 1YJ1A 2LGSA 1BT0A 4GXBA 5IN7A 3WAMA 3VVWB 3M63B 3QIJA 3RZFA 3RYTA 4M00A 5JZEB 4KZCA 4NAWA 4KGRA 4R3DA 3AXCA 3SEBA 1UD7A 2PTLA 2IY0B 2LJIA 1B1ZA 4WWNA 1TKGA 2BWES 3NJTA 1ZDXA 1SIJA 3ETRA 3Q3FA 3APCA 3T3NA 2J7QB 3PLVA 4ZRQA 1V49A 3R3MA 2JT4B 1YJIA 2ZCCA 1NBFC 4MJSA 4I6PA 2KNBA 1FM0D 2KTRA 3DBLI 3EECA 3TEWA 1R4NB 4MGKE 3EFUA 4YTMB 4YTNB 1N5WA 1E7PB 2KKCA 3NVYA 1XO3A 5EE3A 1KLVA 4PS8A 4ACFA 3JW0X 4ITKA 3U4EG 2RD0A 2EMSA 2BW2A 2KACA 4YSYB 1DGJA 3QWZB 2KK8A 4E71A 2G45B 3KYDD 2JPHA 3NVZA 2BKRB 2GBMA 4HK2A 1XLPA 3TJPA 2GBJA 1P1AA 4WURA 3V3XA 4W9JA 1F77A 3K9PB 1B9RA 3AEEB 3VUXA 2E6XA 4ZRPA 1RRBA 1E8ZA 1D3ZA 4RGOS 2R61A 2ZZPB 1KTKA 3PV1A 3C19A 1JWMD 2FIDA 3BYYB 2DZIA 4KIKA 3U7DA 5AZFA 1UF0A 2IO0B 2FAZA 4MACA 1PQSA 1NYQA 2WXFA 1EUVB 4BKGA 1YN3A 2AYOB 2KT7A 3ZGZA 2IY1B 3SD5A 1YQ4B 1IP9A 2GB1A 1Z5SB 2WNMA 2AEHA 3DPDA 3I9V1 2KDEB 2IGGA 3V62A 1E9MA 2KD0A 2JZPA 2N1WA 4H2AA 1SE3A 5DPSA 1E7VA 5I4DA 2PPHA 3N32A 2L7RA 3PZ7A 1OQRA 2K6QA 4J3OD 4HPMB 4C56C 1JWSD 2CS4A 3M95A 2KMAA 2DENB 2XK5A 4LNKA 4ANVA 2WX1A 3VAWA 2KX3A 2N9LA 1KLUD 3Q3MC 4M0WB 2VH2A 2KDMA 2PLPA 3NVVA 2WDTB 1GB1A 4LNIA 3MHSD 4N9F4 2W55A 4YT0B 2V1YA 2QSDA 4KKJA 4FULA 3NZSA 3JYUA 1WXQA 3SFDB 3DHGC 4G0NB 2JXTA 1HEZE 4ZHPA 4KZ0A 1ISNA 1IPGA 1Q1OA 2JYTA 3AE2B 2BS2B 2LRWA 1K50A 3P2BA 3UF8A 4GU2A 3VUYA 2DHZA 3B1LX 1SE2A 2KLCA 1N5XA 3MC8A 1I4HA 1GG3A 1RAXA 2DX5B 3L17A 1CJEA 2D5GA 5HG2A 4GGQA 3AMZA 1J0GA 3TUOA 3B2FA 4HCPB 2WXLA 1EO6A 2L0TA 4TQ1A 3PO0A 1NYRA 2C7HA 3P4SB 4LJPB 3PGEA 5AUKA 1ACCA 1EU4A 2MP2A 3NS8A 4K7SA 2KWUB 2KJ6A 2WXPA 3RNBC 1FXIA 2XBBC 2EKEC 4IUMB 3AEGB 1I4XA 2KDIA 5FK9C 1V8CA 4PYZA 4X57B 2K6DB 4HKQA 3IFWB 4BOZB 2L00B 3X23A 4W9HA 4WQMA 1WE7A 2JWZA 3ZJVA 2INDC 2QIEB 2KC2A 3ZDTA 1TBEA 2AX5A 3IAM1 4MH0E 2H88B 3ZDMC 1I4RA 2I1KA 3U30A 1UELA 1FNWA 1V2YA 3L16A 3LYYA 4DHJB 2QEJC 3E9SA 2DYMA 3L54A 5D94A 3DBSA 1WX9A 5G5HA 3V6EB 4K3CA 3Q3NC 3QA8A 4KGTA 2QCZA 3RNAC 3VR8B 4BKTA 3RT3B 2MH7A 2INPE 3U7ZA 4MM3B 3R7QA 2BQQA 1TY0A 3OAWA 2KVZA 1RWSA 1WGKA 3AE3B 4D2KA 1WXSA 4EZLA 3ZVVA 4HPPA 1LFDA 1RFKA 4EOYA 3TL5A 2BPSA 5LLIA 1XXGA 1KH0A 2XEWA 2G9HD 2O6VD 4MSQB 3GB1A 1UZXB 1KF6B 2R2QA 2K22A 1I4QA 2ZCBA 2CKHB 3PZDA 5BMHA 2DNFA 5CTRC 5BMGA 4WWPA 3DWGC 5LXHA 1NEKB 5DPRA 2K25A 4N6EB 3Q14C 3APFA 1NI2A 4G50A 4YXDB 4GOCA 4GSWA 3MC9A 3VRBB 3H9DA 1EWCA 5D3IB 3I63C 2I38A 2LGDA 1TKEA 1CMXB 2O2VA 3ZNHB 1FFUA 4FJVB 3ENEA 4TKNA 3NVWA 3AE8B 2M0XA 1KM7A 2M4NA 2K39A 1GUAB 4ANUA 2LFIA 5CHWA 2IPKD 1QILA 5D7GA 5FKAC 4W9EA 1D6EC 3UQBA 1CZPA 2GRIA 2C60A 1IYFA 4XE0A 2FBWB 3RNFC 4MDKE 1FCCC 1J19A 2KANA 3ZLZA 3URYA 3CMMB 1L0YB 4GLSC 4LJOB 3UIPB 1GB4A 4ICVA 5KHQA 3VTWA 2KVRA 1L4DB 3ZJUA 4ZRIA 4RNAA 4B9KA 3NHEB 5LXIB 1WX7A 4LDTB 3WANA 1L0XB 4OVUA 3GE3C 5HHDG 3N1XC 1HZ6A 1I4GA 4B95A 3VHTC 4FN2A 1P7EA 4A90A 3K9OB 1CK1A 1ZXHA 4IM2A 1FNUA 3W1YA 3AECB 3DWMA 4L1BA 4ICUA 2PKOA 2PE6B 3A9JB 2RSUA 3VDZA 4ZYSA 1TS4A 1TT5B 2K9XA 3MJ5A 5CHVC 2KLGA 3RNGC 3KLSX 2WXMA 4S17A 2A4ZA 2WXNA 4WJNA 2D3GA 2INNE 3TBLD 3ABVB 1QOBA 3DCGA 1BXTA 2NCNA 3B0AA 2WU2B 4BKSD 4M01A 3O65B 3P4RB 1WSPA 2L32A 2G3QB 3RD2A 1YQ3B 4BBNF 1SIFA 3PHXB 1MI0A 2DAFA 3KWVA 4S0RA 4KKIA 4LTUA 3HM6X 1D5ZC 3R8BA 2MW5A 2VZKB 5BYQA 3TIXA 1XD3B 2K5PA 1VZ7A 4LLGM 1SSNA 3IAS1 4KDLB 2KFJA 4JE3B 2ZPNA 3OJ3A 5GMVA 4A3OA 2PW9A 4DWFA 4HWIB 1MVKA 1ESFA 4C00A 3RI7C 5IA7A 1J7AA 4NPNA 3SU8X 4ZOHC 1WI0A 1ENFA 1TGZB 3QX1A 1LGRA 2K8BA 2LZ6A 2ZNVB 5DCNA 3LXFA 1PFDA 3PRMB 2HDEA 1WJ4A 2FUG1 4W9IA 1KOTA 4M0WA 4OZAA 1E7UA 1DOYA 4IKGA 3V6CB 1N63A 2KXJA 2FCSA 2IYDB 4IOIE 3W1SA 1YN5A 2ACZB 2LVQA 2M1MA 1TYGB 1F2RI 3B08A 2KWVB 5E6JA 1GC7A 4F1SA 2KTFA 5DPWA 3OG5A 1EF5A 4W9DA 2WWZA 2MBBB 2LHDA 2KWCA 2CR5A 2GI9A 3AEDB 2JWUA 4FLHA 1HZ5A 3ZTCA 1HQRD 3J9CA 2TSSA 3NY5A 1WGDA 1GOZA 3DDCB 4KSKC 3A1QB 2V3PA 2KAJA 4Q2JA 2WS3B 4FHJA 1SGHA 2QHOA 5DPTA 1SEBD 4PS7A 1J7CA 3DBRI 2L8JA 4P6VF 3VRAB 4US8A 1T6BX 2MLBA 4GDKB 3A4RA 2LASA 1JMLA 3PS6A 1FMAD 3BWUD 2LXCA 4WJOA 3PREA 1Q10A 2BYTA 2UYZB 3MJWA 3P4PB 3DHIC 2OEDA 2ZVOA 1EWYC 2RPVA 2D3AA 1J7BA 5J17A 1RYJA 1T0YA 4FADA 2BTEA 3TSSA 4NZLB 5D2MB 3AB5A 3ML8A 4NY0A 1WR1A 3T8MA 1WM3A 2HJ1A 3RUIB 4WWMA 2J0MA 2QJLA 4OZBA 1F2RC 1NENB 2KMCA 3SFEB 3QQ8B 4XDDA 2J4XA 3Q8EA 1WXVA 2WDVB 3IT4B 2INCC 4HVBA 2WHIA 1C1YB 4DHZB 4NNJB 2BB6A 4HKZE 2DYBA 3ZRCA 1C4CA 3DHHC 2C5LC 3IVFA 1RLFA 2FCMA 3H1UA 1DOXA 2I2YA 4ASWC 4I6NB 1WGRA 2X8XX 3DQVA 2KWDA 4MM3A 1UUPA 1KFYB 2DBYA 1ROEA 4DDGD 4K7UA 4IW0A 4AWJA 2CJOA 1JALA 2MX2A 2LD9A 5KHOA 4I6LB 4YWGG 4II2B 3ZXRA 4XGAB 2L3ZA 1J8CA 1JW9D 3V60A 3PZ8A 2KDFB 3A4SC 4AJYB 5MPOA 2AL3A 1C77A 1C78A 1I35A 4G11A 2Y5BB 1P3QU 2KOXA 1SE4A 3R66C 2NPTB 3GS2A 1QOAA 4FA6A 1V81A 3AE4B 5E6NA 3AEAB 3TEZA 1VCBA 3P1MA 1ZE3D 1XLOA 3R7RA 3AE5B 1LQBA 4NJCA 3ZNGC 2N4FA 5T8IA 2KJRA 2ZPYA 3I57A 3RNEC 1G6JA 3B9JA 1A5RA 3QK0A 1F0ZA 2BS3B 2HTHA 1C79A 1P9DU 2X38A 1DYQA 1VD2A 4US9A 2GBNA 3ZUNA 1WZ0A 1QQRA 1AYFA 1S1QB 2D3CA 1FIQA 1ZUD2 1C4AA 1L2NA 4A3PA 5E6OA 2OJRA 4G3XB 3RCZA 5IAAC 4FXCA 3TCAA 3N20C 2WXJA 1N62A 4IC7B 1CQVA 4HEA1 4JLCA 3KH0A 1TY2A 2LUEA 3AE1B 1P98A 1A70A 4WAAA 3W2DA 1X1MA 3IT6B 3BZDB 1AARA 2KX0A 1FCLA 4GN1A 2EKIA 4CHKA 4XZ4A 4NJ6A 1OFFA 2KDBA 3ZRFA 3NUHB 3OLMD 3VUWA 4M8NA 4W9GA 1WFYA 1YJJA 2ZNVC 3LB8C 5C1ZA 1N61A 3BIID 2JXXA 4XWWA 1HA5A 3AE6B 4EFOA 3A9JA 1V1OA 1U4AA 4NAMA 5FR3A 4LNOA 4DK5A 2JF5A 4F7ZA 1FPYA 4J6IA 4W9LA 2UU7A 4MT5A 4RF1A 1HTOA 1D4BA 2WXQA 2MBOA 2C7MB 3SR6A 1H4RA 4B6WA 2FCQA 1T0SC 1TZ1A 2N9KA 2JRIB 4WH4A 3DBHI 3S2AA 4CQNA 3BVMA 5EE1A 4HRSA 4WIPA 3UIOB 3OWEB 1UGJA 2OOBB 4JWUC 2LMCA 2MJ3A 2N1VA 1V6EA 4RH6A 1XQQA 3E56A 2PIAA 4ZRJA 1JWAD 1UBIA 1TKYA 4N58A 2ZEQA 3GE8C 4F8CB 3HM3A 2SEBD 3Q3OC 4WWOA 2GLSA 4C7ZA 2JSVX 2I1JA 1XCQL 1K52A 2KQSA 1D5MC 1WZ3A 3RN9C 1XT9B 2KZRA 1L6VA 2DWQA 3AN1A 4K3BA 4C4VB 4GB9A 3SDLC 2SAKA 5IOIA 4ZHOA 4IM0A 3SHQA 4FBJB 2Q5WD 3W5VB 1QOGA 2BGFA 3EC8A 4N59A 1SF0A 1YD8U 3R2IA 2W3RA 4RFBA 4RCOA 3WA0A 3H7PB 3PLUA 3N3KB 5FR6A 3MC0B 5C3JB 4DXGA 2M19A 3GOEA 2J42A 4MGYE 4RM9A 3VR9B 2JX5A 1XEEA 2PMVA 2BYVE 3AE9B 4E3CA 4PK1A 2V9HA 1FRDA 3I5JC 4A55A 4AS1A 2PVOD 1WRIA 3VXWA 1K8RB 2QC8A 1V97A 3HUIA 4PS3A 5TSSA 4FHKA 3P42A 4A8XC 1JRUA 3A1QA 3ZYYX 2LEKA 1TS5A 5G2NA 2CU3A 2M0AA 3M62B 1FNVA 2DZMA 2RDBC 1ZOYB 3U8ZA 3PVLA 2NTSA 4GDKA 4DQOC 4TQ0A 2RPQA 2N9PC 2WX0A 2K1FA 4ZDVA 1ET6A 1WXMA 2WDQB 1BMLC 2YLMA 1UWMA 3D32A 3DBRB 2L0FA 4MGIE 3N1ZC 4MEMA 4CO7A 1H8CA 3H8HA 4RGTA 1MFWA 4JGHB 1I4PA 4LNFA 4IWQA 1F9JA 2WLBA 3NZ3A 1C3TA 2Z8LA 3MTNB 2B3AA 4MSMB 2WP9B 2JZZA 2N7EA 4K81A 2KJHB 4LCDE 2IZVB 3DVNV 3HVZA 2NS5A 4IWOA 3Q8AA 1L4ZB 4NQKE 2MQJA 2BVCA 1PUTA 2E3TA 2AQ2B 4EZJA 1Q5WB 4XC2A 3HVDA 1GJZA 1AN8A 3OJ4B 3AV8A 4TUUA 3ZNID 1R4MB 2AWTA 2LRUA 2FCNA 3IBEA 2J53A 4W9FA 3ZTDA 1OGWA 2KO3A 2O6VB 4AUQC 3NG0A 5BYSA 2WQYB 1QOFA 3N9YC 4JPSA 4L2YA 4PYUA 1FXTB 1VR9A 1T5XD 2YEPF 5BMIA 3FILB 2BB5A 1SE9A 4YL8A 3UGBB 4BAXA 4PT5A
chains in the Genus database with same CATH topology
1WMHB 1T0YA 4FADA 3CSFA 2WDTB 2N9EB 5D2MB 3WALA 3ML8A 3PSEB 4NY0A 3MHSD 1WR1A 4N9F4 3T8MA 2CHZA 1WM3A 3RUIB 2MCNB 2J0MA 2V1YA 2D10A 1YQBA 4FULA 1WGGA 1V86A 3NZSA 2KMCA 3JYUA 3QQ8B 2JY6A 2KFKB 4G0NB 2HD5B 4MELA 1HE8A 3JSVB 4KZ0A 1WXVA 1ISNA 1IPGA 1Q1OA 4KIKB 2LRWA 1WRDB 3P2BA 3UF8A 4HVBA 4GU2A 3VUYA 1C1YB 4DHZB 1WIAA 1YX5B 4NNJB 2DHZA 3KUCB 4II3B 1GNUA 3B1LX 4BKSA 2KLCA 2DYBA 3ZRCA 1GG3A 1RAXA 1E5WA 2C5LC 2DX5B 4FJYA 2C7NB 4HXDA 3IVFA 3L17A 1RLFA 2FCMA 3H1UA 4WJPA 1LM8B 2MWSB 1E8WA 4GGQA 4ASWC 2M8SA 3H7SA 4I6NB 1WGRA 4ANWA 1J0GA 1WGHA 4KSLC 2BYFA 3DQVA 4HCPB 4E74A 2GOWA 2D2QA 3PRZA 2HE7A 4MM3A 1EO6A 2L0TA 4TQ1A 3PT2B 3KVFB 2C7HA 4HCNB 4DDGD 4K7UA 5JH5C 4IW0A 4AWJA 3HK0A 2MX2A 2LD9A 4LJPB 5KHOA 4I6LB 3PGEA 3HHMA 4II2B 2MP2A 3NS8A 1WJNA 2L3ZA 2KWUB 4K7SA 2MA9B 1YIWA 2KJ6A 1J8CA 3VFKA 2XK5B 4DHZE 2XBBC 2EKEC 5C23A 3ZO5B 4IUMB 3V60A 1LXDA 2KDFB 5L95C 4MGZE 4KVGB 3A4SC 5J18A 4DXAB 2KDIA 4AJYB 2L76A 2AL3A 1I35A 3VH3B 4G11A 2Y5BB 1P3QU 4NQLB 2DZKA 2KOXA 4PYZA 4X57B 2K6DB 3IFWB 3A9KA 4BOZB 2J0KA 2L00B 3X23A 3PRPB 3R66C 4W9HA 2NPTB 3CSTA 1WE7A 4CYEA 3BY4B 2JWZA 1EF1A 1WF9A 4HJKA 2RGFA 4HLEA 2KC2A 4FA6A 1V81A 2JUOA 5E6NA 3ZDTA 4AJWA 3ZKJC 1VCBA 1TBEA 4MH0E 3ZDMC 3KW5B 2I1KA 1OEYA 3R7RA 3DVGX 1UELA 1LQBA 2Z0DB 3U30A 2DYOA 1WJ6A 2ASQA 2LGXA 1V2YA 4K1RB 3L16A 3ZNGC 2N4FA 3GZNI 4DBGA 3H6NA 4DHJB 2KJRA 2ZPYA 1WR6E 1G6JA 4HDOA 1A5RA 3QK0A 2DYMA 3AI5A 1WE6A 3L54A 4HDQA 5D94A 1TTNA 2EMTA 2HTHA 3DBSA 1P9DU 2FNJB 1WX9A 3KUDB 1VD2A 3V6EB 5L83A 4NJ7A 5JHAA 2GBNA 3ZUNA 1WZ0A 1S1QB 3APDA 4JL9A 4FJZA 2NBVB 2REXA 5CX3A 3QA8A 3L13A 1L2NA 5EDSA 4A3PA 2AL6A 5E6OA 2OJRA 4G3XB 4GMVA 3RCZA 4BKTA 5IAAC 3RT3B 2FIFA 3TCAA 4IC7B 4AP4C 1Z2MA 1V5TA 1WM2A 2PE9A 3R7QA 4DDID 3V61A 3ZNZB 4JLCA 3OAWA 3C0RB 3KH0A 3QJZA 3W1SC 2LUEA 1WXSA 1P98A 2NPTA 2N7DA 4BOSC 4WAAA 4EZLA 2IO3B 1X1MA 3ZVVA 3ECIA 3RZWC 1OTRB 1LFDA 2LI5A 2L05A 4EOYA 2CU1A 2MP2B 2LJ5A 3TL5A 2BPSA 3IG3A 2D07B 5LLIA 2VRRB 2KC1A 2XEWA 1AARA 2NVUI 2O6VD 2KX0A 2KQ7A 4MSQB 1UZXB 2R2QA 2ZCBA 4GN1A 2CKHB 1QZEA 2MBHA 3PZDA 4CHKA 4WJQA 4XZ4A 4NJ6A 5CTRC 1R4MI 1WXAA 2KDBA 3ZRFA 1Q0WB 4WWPA 5JHBA 5LXHA 1KJTA 5DPRA 2K25A 3A9KB 3VH4B 3OLMD 3VUWA 3APFA 4M8NA 1NI2A 1WFYA 1UGMA 4G50A 4W9GA 4GOCA 4GSWA 4XX5A 2ZNVC 5CHFA 2PEAA 2RR9A 5C1ZA 3DOWA 3H9DA 4GDLA 4JQWC 3ML9A 4BFRA 4W9CA 2JXXA 3LJ3A 3PTFC 2JZ3B 4IM3A 4EFOA 3IHPC 3ZIMA 3A9JA 2LGDA 3ALBA 2YVCA 4K7WA 1UBQA 2A5UA 1CMXB 2O2VA 1U4AA 3ZNHB 3WIMA 5AZHA 4FJVB 3H7PA 4W9KA 3ENEA 2JVCA 4EKUA 4TKNA 4DK5A 2N9XA 2GBKA 2JF5A 4WQOB 4F7ZA 2M0XA 4J6IA 2KHWB 4W9LA 1KM7A 4OVVA 4EEWA 5HKHA 3VTVA 3UQAA 2M4NA 2K39A 3RULA 3LDZE 2J0JA 2MBOA 2C7MB 1H4RA 5BO4B 4B6WA 2FCQA 1TZ1A 1GUAB 2JRIB 4ANUA 3DBHI 3S2AA 4M8MA 5CHWA 1ZW7A 2K8CA 5D7GA 3UIOB 3JVZX 1E8YA 2HJ8A 1M94A 2CHWA 4W9EA 2OOBB 3AULA 2ZVNA 3BINA 5E6PA 3UQBA 2N1VA 2JRHA 1V6EA 3Q3JA 1XQQA 2C60A 1IYFA 4MDKE 3PPAA 4ZRJA 1MG8A 1J19A 2KANA 1UBIA 2PJHA 3ZLZA 2ZEQA 3CMMB 3T9LA 1E90A 4F8CB 3HM3A 2G4DB 3CF6E 4LJOB 4WWOA 3TMPB 5J2RA 3UIPB 2BWFA 2FUHB 4ICVA 5KHQA 2I1JA 3VTWA 2KVRA 2KQSA 1WH3A 2LWPA 1L7YA 1WZ3A 5D6JB 2ZJDA 2W9NA 2DAJA 4ZRIA 3PHWB 1XT9B 2KZRA 4B9KA 3QHTA 3NHEB 5LXIB 1WX7A 4IG7B 4LDTB 1RFAA 2K8HA 3WANA 2IBIB 3I3TB 3WAPA 4AOFA 4OVUA 3NZUA 4GB9A 3SDLC 3QCAA 3M3JA 2NBUA 4B95A 2MBQA 3VHTC 5TR5A 4FN2A 4JIOU 1E8XA 3K9OB 5AEKB 4IM0A 3SHQA 4FBJB 4GDLB 1S3SG 4IM2A 2Z59B 3W1YA 4KDIC 1WYWB 1OEYJ 2BGFA 3EC8A 4ICUA 3AU4A 2PE6B 1I42A 3A9JB 1YD8U 2BF8B 1V80A 2RSUA 3ONSA 3VDZA 2CHXA 2V4LA 4ZYNA 4TV3A 2LXAA 2O2VB 4GIVA 5CHVC 3QC8B 2KLGA 3WA0A 3H7PB 3X0WA 3DVNU 3AU5A 4IWPA 3PLUA 3N3KB 2A4ZA 2NBWB 4WJNA 2D3GA 2GBRA 3TBLD 1ZGUB 4ZRKA 5FR6A 1YJ1A 4DHJD 1ZKHA 4HPLB 1BT0A 4GXBA 5AZGA 3WAMA 3DCGA 3GOEA 3VVWB 4MGYE 4RM9A 2NCNA 4RM8A 3M63B 4A20A 3QIJA 3HIZA 2IO2B 3RZFA 3RYTA 2BYVE 5JZEB 3VTUA 4KZCA 3B0AA 1V5OA 4NAWA 4BKSD 3L10B 2MBEA 3AXCA 3QAQA 5G55A 4E3CA 3O65B 1UD7A 4EUTA 2G3QB 4P7IA 2IY0B 2NR2A 1GC6A 3RD2A 4BBNF 1SIFA 2M17A 2V3SA 3PHXB 4WWNA 2DAFA 1V9JA 2BWES 3VXWA 2R2OA 3Q3FA 3HM6X 1K8RB 2MW5A 4PS3A 3APCA 3UINB 2J7QB 4FHKA 3PLVA 1V49A 3R3MA 1XD3B 2JT4B 3TIXA 3EHVA 1JRUA 4EZKA 3A1QA 4ANXA 2MRPA 4KDLB 2ZCCA 1NBFC 2KFJA 3ZW3A 3NOBA 4MJSA 5G2NA 2KN5A 1WJUA 2ZPNA 4I6PA 3OJ3A 5GMVA 4A3OA 4DWFA 4HWIB 2KNBA 2KTRA 3M62B 3DBLI 3EECA 5IA7A 2DZMA 4MGKE 3U8ZA 4NPNA 1NDDA 2WYQA 1YX6B 3EFUA 3PVLA 3SU8X 4GDKA 4TQ0A 1WI0A 2DZJA 1TGZB 3QX1A 2K8BA 2LZ6A 2ZNVB 2O6VA 2KKCA 2RPQA 5DCNA 1KLVA 1UH6A 3L0WB 1WX8A 2N9PC 4PS8A 3PRMB 2WX0A 2LVPA 3KUZA 3JW0X 4BVUC 1WJ4A 2K1FA 4W9IA 4ZDVA 2RD0A 2EMSA 1KOTA 1WXMA 2IO1B 2YLMA 3QWZB 2KK8A 4E71A 2G45B 1WMHA 3D32A 2L0FA 3KYDD 1P0RA 4MGIE 2BKFA 1E7UA 2JPHA 3V6CB 2BKRB 4MEMA 4CO7A 3DVGY 3KYCD 1H8CA 2GBMA 4HK2A 3TJPA 4RMAA 2GBJA 2FCSA 2KXJA 2IYDB 2UWQA 1P1AA 2GMIC 4KV2A 3W1SA 4JGHB 4W9JA 2Z0EB 4IWQA 4NAWB 2LVQA 1F9JA 2M1MA 3K9PB 3VUXA 3B08A 2KWVB 4F1SA 1GC7A 1C3TA 1RRBA 2KTFA 5DPWA 2KFKA 1E8ZA 1EF5A 1D3ZA 3MTNB 2B3AA 2ZZPB 3QARA 4MSMB 4W9DA 2JZZA 2WWZA 2N7EA 4K81A 2MBBB 3JSVA 2KJHB 3PV1A 2KWCA 4LCDE 4BBNC 1R4NI 2G4SA 2IZVB 2CR5A 2FIDA 2LVOA 2DZIA 4KIKA 3U7DA 4FLHA 3DVNV 4IWOA 2NS5A 5AZFA 3ZTCA 3L08A 2IO0B 2FAZA 4NQKE 3NY5A 2MQJA 1PQSA 1WGDA 4BKGA 1EUVB 2MSED 2AYOB 4EZJA 3DDCB 1Y8RC 4KSKC 3A1QB 2IY1B 1WGYA 3N30A 3SD5A 4URKA 1IP9A 1Z5SB 4MJSB 1Q5WB 4FHJA 4XC2A 1SGHA 2QHOA 2AEHA 3DPDA 1GJZA 2C9WB 5DPTA 4PS7A 2KDEB 3OJ4B 3WAOA 4TUUA 3DBRI 3ZNID 2KTRB 3V62A 2AWTA 2L8JA 4LDTD 2KD0A 2LRUA 2FCNA 3IBEA 2N1WA 5DPSA 1E7VA 2BYEA 1OQYA 2PPHA 3N32A 2L7RA 2MLBA 4W9FA 3ZTDA 2K6QA 2D11A 4GDKB 1OGWA 3A4RA 2LASA 3PS6A 4HPMB 2KO3A 2CS4A 2O6VB 3M95A 2KMAA 4AUQC 2LXCA 2DENB 2XK5A 4WJOA 3PREA 2UYZB 3MJWA 4ANVA 2WX1A 1WY8A 3VAWA 4PYUA 2KX3A 1FXTB 2LGYA 2ZVOA 3A33B 4M0WB 3VQIA 1SE9A 4YL8A 3UGBB 5J17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMH B;  1T0Y A;  4FAD A;  3CSF A;  2WDT B;  2N9E B;  5D2M B;  3WAL A;  3ML8 A;  3PSE B;  4NY0 A;  3MHS D;  1WR1 A;  4N9F 4;  3T8M A;  2CHZ A;  1WM3 A;  3RUI B;  2MCN B;  2J0M A;  2V1Y A;  2D10 A;  1YQB A;  4FUL A;  1WGG A;  1V86 A;  3NZS A;  2KMC A;  3JYU A;  3QQ8 B;  2JY6 A;  2KFK B;  4G0N B;  2HD5 B;  4MEL A;  1HE8 A;  3JSV B;  4KZ0 A;  1WXV A;  1ISN A;  1IPG A;  1Q1O A;  4KIK B;  2LRW A;  1WRD B;  3P2B A;  3UF8 A;  4HVB A;  4GU2 A;  3VUY A;  1C1Y B;  4DHZ B;  1WIA A;  1YX5 B;  4NNJ B;  2DHZ A;  3KUC B;  4II3 B;  1GNU A;  3B1L X;  4BKS A;  2KLC A;  2DYB A;  3ZRC A;  1GG3 A;  1RAX A;  1E5W A;  2C5L C;  2DX5 B;  4FJY A;  2C7N B;  4HXD A;  3IVF A;  3L17 A;  1RLF A;  2FCM A;  3H1U A;  4WJP A;  1LM8 B;  2MWS B;  1E8W A;  4GGQ A;  4ASW C;  2M8S A;  3H7S A;  4I6N B;  1WGR A;  4ANW A;  1J0G A;  1WGH A;  4KSL C;  2BYF A;  3DQV A;  4HCP B;  4E74 A;  2GOW A;  2D2Q A;  3PRZ A;  2HE7 A;  4MM3 A;  1EO6 A;  2L0T A;  4TQ1 A;  3PT2 B;  3KVF B;  2C7H A;  4HCN B;  4DDG D;  4K7U A;  5JH5 C;  4IW0 A;  4AWJ A;  3HK0 A;  2MX2 A;  2LD9 A;  4LJP B;  5KHO A;  4I6L B;  3PGE A;  3HHM A;  4II2 B;  2MP2 A;  3NS8 A;  1WJN A;  2L3Z A;  2KWU B;  4K7S A;  2MA9 B;  1YIW A;  2KJ6 A;  1J8C A;  3VFK A;  2XK5 B;  4DHZ E;  2XBB C;  2EKE C;  5C23 A;  3ZO5 B;  4IUM B;  3V60 A;  1LXD A;  2KDF B;  5L95 C;  4MGZ E;  4KVG B;  3A4S C;  5J18 A;  4DXA B;  2KDI A;  4AJY B;  2L76 A;  2AL3 A;  1I35 A;  3VH3 B;  4G11 A;  2Y5B B;  1P3Q U;  4NQL B;  2DZK A;  2KOX A;  4PYZ A;  4X57 B;  2K6D B;  3IFW B;  3A9K A;  4BOZ B;  2J0K A;  2L00 B;  3X23 A;  3PRP B;  3R66 C;  4W9H A;  2NPT B;  3CST A;  1WE7 A;  4CYE A;  3BY4 B;  2JWZ A;  1EF1 A;  1WF9 A;  4HJK A;  2RGF A;  4HLE A;  2KC2 A;  4FA6 A;  1V81 A;  2JUO A;  5E6N A;  3ZDT A;  4AJW A;  3ZKJ C;  1VCB A;  1TBE A;  4MH0 E;  3ZDM C;  3KW5 B;  2I1K A;  1OEY A;  3R7R A;  3DVG X;  1UEL A;  1LQB A;  2Z0D B;  3U30 A;  2DYO A;  1WJ6 A;  2ASQ A;  2LGX A;  1V2Y A;  4K1R B;  3L16 A;  3ZNG C;  2N4F A;  3GZN I;  4DBG A;  3H6N A;  4DHJ B;  2KJR A;  2ZPY A;  1WR6 E;  1G6J A;  4HDO A;  1A5R A;  3QK0 A;  2DYM A;  3AI5 A;  1WE6 A;  3L54 A;  4HDQ A;  5D94 A;  1TTN A;  2EMT A;  2HTH A;  3DBS A;  1P9D U;  2FNJ B;  1WX9 A;  3KUD B;  1VD2 A;  3V6E B;  5L83 A;  4NJ7 A;  5JHA A;  2GBN A;  3ZUN A;  1WZ0 A;  1S1Q B;  3APD A;  4JL9 A;  4FJZ A;  2NBV B;  2REX A;  5CX3 A;  3QA8 A;  3L13 A;  1L2N A;  5EDS A;  4A3P A;  2AL6 A;  5E6O A;  2OJR A;  4G3X B;  4GMV A;  3RCZ A;  4BKT A;  5IAA C;  3RT3 B;  2FIF A;  3TCA A;  4IC7 B;  4AP4 C;  1Z2M A;  1V5T A;  1WM2 A;  2PE9 A;  3R7Q A;  4DDI D;  3V61 A;  3ZNZ B;  4JLC A;  3OAW A;  3C0R B;  3KH0 A;  3QJZ A;  3W1S C;  2LUE A;  1WXS A;  1P98 A;  2NPT A;  2N7D A;  4BOS C;  4WAA A;  4EZL A;  2IO3 B;  1X1M A;  3ZVV A;  3ECI A;  3RZW C;  1OTR B;  1LFD A;  2LI5 A;  2L05 A;  4EOY A;  2CU1 A;  2MP2 B;  2LJ5 A;  3TL5 A;  2BPS A;  3IG3 A;  2D07 B;  5LLI A;  2VRR B;  2KC1 A;  2XEW A;  1AAR A;  2NVU I;  2O6V D;  2KX0 A;  2KQ7 A;  4MSQ B;  1UZX B;  2R2Q A;  2ZCB A;  4GN1 A;  2CKH B;  1QZE A;  2MBH A;  3PZD A;  4CHK A;  4WJQ A;  4XZ4 A;  4NJ6 A;  5CTR C;  1R4M I;  1WXA A;  2KDB A;  3ZRF A;  1Q0W B;  4WWP A;  5JHB A;  5LXH A;  1KJT A;  5DPR A;  2K25 A;  3A9K B;  3VH4 B;  3OLM D;  3VUW A;  3APF A;  4M8N A;  1NI2 A;  1WFY A;  1UGM A;  4G50 A;  4W9G A;  4GOC A;  4GSW A;  4XX5 A;  2ZNV C;  5CHF A;  2PEA A;  2RR9 A;  5C1Z A;  3DOW A;  3H9D A;  4GDL A;  4JQW C;  3ML9 A;  4BFR A;  4W9C A;  2JXX A;  3LJ3 A;  3PTF C;  2JZ3 B;  4IM3 A;  4EFO A;  3IHP C;  3ZIM A;  3A9J A;  2LGD A;  3ALB A;  2YVC A;  4K7W A;  1UBQ A;  2A5U A;  1CMX B;  2O2V A;  1U4A A;  3ZNH B;  3WIM A;  5AZH A;  4FJV B;  3H7P A;  4W9K A;  3ENE A;  2JVC A;  4EKU A;  4TKN A;  4DK5 A;  2N9X A;  2GBK A;  2JF5 A;  4WQO B;  4F7Z A;  2M0X A;  4J6I A;  2KHW B;  4W9L A;  1KM7 A;  4OVV A;  4EEW A;  5HKH A;  3VTV A;  3UQA A;  2M4N A;  2K39 A;  3RUL A;  3LDZ E;  2J0J A;  2MBO A;  2C7M B;  1H4R A;  5BO4 B;  4B6W A;  2FCQ A;  1TZ1 A;  1GUA B;  2JRI B;  4ANU A;  3DBH I;  3S2A A;  4M8M A;  5CHW A;  1ZW7 A;  2K8C A;  5D7G A;  3UIO B;  3JVZ X;  1E8Y A;  2HJ8 A;  1M94 A;  2CHW A;  4W9E A;  2OOB B;  3AUL A;  2ZVN A;  3BIN A;  5E6P A;  3UQB A;  2N1V A;  2JRH A;  1V6E A;  3Q3J A;  1XQQ A;  2C60 A;  1IYF A;  4MDK E;  3PPA A;  4ZRJ A;  1MG8 A;  1J19 A;  2KAN A;  1UBI A;  2PJH A;  3ZLZ A;  2ZEQ A;  3CMM B;  3T9L A;  1E90 A;  4F8C B;  3HM3 A;  2G4D B;  3CF6 E;  4LJO B;  4WWO A;  3TMP B;  5J2R A;  3UIP B;  2BWF A;  2FUH B;  4ICV A;  5KHQ A;  2I1J A;  3VTW A;  2KVR A;  2KQS A;  1WH3 A;  2LWP A;  1L7Y A;  1WZ3 A;  5D6J B;  2ZJD A;  2W9N A;  2DAJ A;  4ZRI A;  3PHW B;  1XT9 B;  2KZR A;  4B9K A;  3QHT A;  3NHE B;  5LXI B;  1WX7 A;  4IG7 B;  4LDT B;  1RFA A;  2K8H A;  3WAN A;  2IBI B;  3I3T B;  3WAP A;  4AOF A;  4OVU A;  3NZU A;  4GB9 A;  3SDL C;  3QCA A;  3M3J A;  2NBU A;  4B95 A;  2MBQ A;  3VHT C;  5TR5 A;  4FN2 A;  4JIO U;  1E8X A;  3K9O B;  5AEK B;  4IM0 A;  3SHQ A;  4FBJ B;  4GDL B;  1S3S G;  4IM2 A;  2Z59 B;  3W1Y A;  4KDI C;  1WYW B;  1OEY J;  2BGF A;  3EC8 A;  4ICU A;  3AU4 A;  2PE6 B;  1I42 A;  3A9J B;  1YD8 U;  2BF8 B;  1V80 A;  2RSU A;  3ONS A;  3VDZ A;  2CHX A;  2V4L A;  4ZYN A;  4TV3 A;  2LXA A;  2O2V B;  4GIV A;  5CHV C;  3QC8 B;  2KLG A;  3WA0 A;  3H7P B;  3X0W A;  3DVN U;  3AU5 A;  4IWP A;  3PLU A;  3N3K B;  2A4Z A;  2NBW B;  4WJN A;  2D3G A;  2GBR A;  3TBL D;  1ZGU B;  4ZRK A;  5FR6 A;  1YJ1 A;  4DHJ D;  1ZKH A;  4HPL B;  1BT0 A;  4GXB A;  5AZG A;  3WAM A;  3DCG A;  3GOE A;  3VVW B;  4MGY E;  4RM9 A;  2NCN A;  4RM8 A;  3M63 B;  4A20 A;  3QIJ A;  3HIZ A;  2IO2 B;  3RZF A;  3RYT A;  2BYV E;  5JZE B;  3VTU A;  4KZC A;  3B0A A;  1V5O A;  4NAW A;  4BKS D;  3L10 B;  2MBE A;  3AXC A;  3QAQ A;  5G55 A;  4E3C A;  3O65 B;  1UD7 A;  4EUT A;  2G3Q B;  4P7I A;  2IY0 B;  2NR2 A;  1GC6 A;  3RD2 A;  4BBN F;  1SIF A;  2M17 A;  2V3S A;  3PHX B;  4WWN A;  2DAF A;  1V9J A;  2BWE S;  3VXW A;  2R2O A;  3Q3F A;  3HM6 X;  1K8R B;  2MW5 A;  4PS3 A;  3APC A;  3UIN B;  2J7Q B;  4FHK A;  3PLV A;  1V49 A;  3R3M A;  1XD3 B;  2JT4 B;  3TIX A;  3EHV A;  1JRU A;  4EZK A;  3A1Q A;  4ANX A;  2MRP A;  4KDL B;  2ZCC A;  1NBF C;  2KFJ A;  3ZW3 A;  3NOB A;  4MJS A;  5G2N A;  2KN5 A;  1WJU A;  2ZPN A;  4I6P A;  3OJ3 A;  5GMV A;  4A3O A;  4DWF A;  4HWI B;  2KNB A;  2KTR A;  3M62 B;  3DBL I;  3EEC A;  5IA7 A;  2DZM A;  4MGK E;  3U8Z A;  4NPN A;  1NDD A;  2WYQ A;  1YX6 B;  3EFU A;  3PVL A;  3SU8 X;  4GDK A;  4TQ0 A;  1WI0 A;  2DZJ A;  1TGZ B;  3QX1 A;  2K8B A;  2LZ6 A;  2ZNV B;  2O6V A;  2KKC A;  2RPQ A;  5DCN A;  1KLV A;  1UH6 A;  3L0W B;  1WX8 A;  2N9P C;  4PS8 A;  3PRM B;  2WX0 A;  2LVP A;  3KUZ A;  3JW0 X;  4BVU C;  1WJ4 A;  2K1F A;  4W9I A;  4ZDV A;  2RD0 A;  2EMS A;  1KOT A;  1WXM A;  2IO1 B;  2YLM A;  3QWZ B;  2KK8 A;  4E71 A;  2G45 B;  1WMH A;  3D32 A;  2L0F A;  3KYD D;  1P0R A;  4MGI E;  2BKF A;  1E7U A;  2JPH A;  3V6C B;  2BKR B;  4MEM A;  4CO7 A;  3DVG Y;  3KYC D;  1H8C A;  2GBM A;  4HK2 A;  3TJP A;  4RMA A;  2GBJ A;  2FCS A;  2KXJ A;  2IYD B;  2UWQ A;  1P1A A;  2GMI C;  4KV2 A;  3W1S A;  4JGH B;  4W9J A;  2Z0E B;  4IWQ A;  4NAW B;  2LVQ A;  1F9J A;  2M1M A;  3K9P B;  3VUX A;  3B08 A;  2KWV B;  4F1S A;  1GC7 A;  1C3T A;  1RRB A;  2KTF A;  5DPW A;  2KFK A;  1E8Z A;  1EF5 A;  1D3Z A;  3MTN B;  2B3A A;  2ZZP B;  3QAR A;  4MSM B;  4W9D A;  2JZZ A;  2WWZ A;  2N7E A;  4K81 A;  2MBB B;  3JSV A;  2KJH B;  3PV1 A;  2KWC A;  4LCD E;  4BBN C;  1R4N I;  2G4S A;  2IZV B;  2CR5 A;  2FID A;  2LVO A;  2DZI A;  4KIK A;  3U7D A;  4FLH A;  3DVN V;  4IWO A;  2NS5 A;  5AZF A;  3ZTC A;  3L08 A;  2IO0 B;  2FAZ A;  4NQK E;  3NY5 A;  2MQJ A;  1PQS A;  1WGD A;  4BKG A;  1EUV B;  2MSE D;  2AYO B;  4EZJ A;  3DDC B;  1Y8R C;  4KSK C;  3A1Q B;  2IY1 B;  1WGY A;  3N30 A;  3SD5 A;  4URK A;  1IP9 A;  1Z5S B;  4MJS B;  1Q5W B;  4FHJ A;  4XC2 A;  1SGH A;  2QHO A;  2AEH A;  3DPD A;  1GJZ A;  2C9W B;  5DPT A;  4PS7 A;  2KDE B;  3OJ4 B;  3WAO A;  4TUU A;  3DBR I;  3ZNI D;  2KTR B;  3V62 A;  2AWT A;  2L8J A;  4LDT D;  2KD0 A;  2LRU A;  2FCN A;  3IBE A;  2N1W A;  5DPS A;  1E7V A;  2BYE A;  1OQY A;  2PPH A;  3N32 A;  2L7R A;  2MLB A;  4W9F A;  3ZTD A;  2K6Q A;  2D11 A;  4GDK B;  1OGW A;  3A4R A;  2LAS A;  3PS6 A;  4HPM B;  2KO3 A;  2CS4 A;  2O6V B;  3M95 A;  2KMA A;  4AUQ C;  2LXC A;  2DEN B;  2XK5 A;  4WJO A;  3PRE A;  2UYZ B;  3MJW A;  4ANV A;  2WX1 A;  1WY8 A;  3VAW A;  4PYU A;  2KX3 A;  1FXT B;  2LGY A;  2ZVO A;  3A33 B;  4M0W B;  3VQI A;  1SE9 A;  4YL8 A;  3UGB B;  5J17 A; 
#chains in the Genus database with same CATH topology
 1WMH B;  2N9E B;  3PSE B;  2MCN B;  2D10 A;  1UNS A;  1WWT A;  1MJD A;  3V05 A;  2KFK B;  2HD5 B;  1HE8 A;  3JSV B;  1XCT L;  4YSX B;  2WGS A;  4OVZ A;  1P7F A;  1QF6 A;  3FKY A;  1YX5 B;  3KUC B;  1FFV A;  1GNU A;  2MHJ A;  1E5W A;  1K53 A;  2C7N B;  4HXD A;  4WJP A;  1LM8 B;  2RMM A;  3H7S A;  4ANW A;  1WGH A;  3UI3 A;  2BYF A;  2GOW A;  1SJH D;  2BS4 B;  2Y5P A;  2KMM A;  3HK0 A;  3T3O A;  4USA A;  3HHM A;  4KX6 B;  2MA9 B;  1YIW A;  3P4Q B;  3CWI A;  5H92 C;  5C2T B;  4KVG B;  5J18 A;  2OJW A;  5AUI A;  2DZK A;  1T3Q A;  3PRP B;  3Q69 A;  1YN4 A;  4CYE A;  3BY4 B;  1WF9 A;  1ZPS A;  1VJK A;  2RGF A;  4AJW A;  3ZKJ C;  2ZW1 A;  3KW5 B;  3NS1 A;  1PDX A;  3DVG X;  2M56 B;  2Z0D B;  2DYO A;  1WJ6 A;  2ASQ A;  2LGX A;  4K1R B;  2WXR A;  4DBG A;  3H6N A;  3EUB 2;  5LNK 1;  4HDO A;  2DLB A;  3AI5 A;  1WE6 A;  4HDQ A;  5G5G A;  1TTN A;  4HRO A;  2FNJ B;  3KUD B;  1LO5 D;  2FE8 A;  5L83 A;  1XF5 L;  1IBX B;  3APD A;  4JL9 A;  4FJZ A;  2NBV B;  2REX A;  5CX3 A;  3L13 A;  5EDS A;  2PVG C;  1SB3 C;  3ZJT A;  1Z2M A;  1V5T A;  1WM2 A;  4XWT A;  2RDH A;  2V4I B;  3ZNZ B;  3ZXV A;  3QJZ A;  3EA6 A;  2N7D A;  2IO3 B;  1OTR B;  2LI5 A;  1VZ8 A;  2CU1 A;  2LJ5 A;  3DBH B;  3IG3 A;  2D07 B;  2VRR B;  2Y5C A;  2NVU I;  3FC4 A;  1WYG A;  1R4M I;  1WXA A;  4C4V A;  1Q0W B;  5JHB A;  1C4P A;  1L0V B;  3VH4 B;  3A9K B;  1UGM A;  1L6U A;  5CHF A;  3DOW A;  1XLQ A;  3ML9 A;  3R2T A;  4M02 A;  4W9C A;  4OHJ A;  3PTF C;  1T0Q C;  2JZ3 B;  2MJD A;  4IM3 A;  3RMK C;  3ZIM A;  4LK0 M;  2YVC A;  1E0Z A;  1JRP A;  3MHZ A;  3WIM A;  4RGM A;  3H7P A;  2JVC A;  1V1P B;  2LGI A;  1I7H A;  4WQO B;  2L83 A;  2KHW B;  5HKH A;  2JYE A;  3VTV A;  3TEX A;  2J0J A;  1TJE A;  1C76 A;  4KGS A;  3U52 E;  1VRA B;  2WDR B;  3JVZ X;  2HJ8 A;  2CHW A;  2ZVN A;  3BIN A;  1BUI C;  2W3S A;  2PJH A;  2N7J A;  3T9L A;  1E90 A;  2ONQ A;  1ZXI A;  1MG4 A;  2FUH B;  2WXG A;  4OZC A;  3U2S C;  4YTP B;  1L7Y A;  2ZJD A;  2DAJ A;  1FXA A;  4IG7 B;  2IBI B;  3WAP A;  3NZU A;  3M3J A;  2NBU A;  1TIF A;  2MBQ A;  5TR5 A;  2WXO A;  2KQ4 X;  4YSZ B;  4JX1 C;  1RM6 C;  2ON8 A;  4RGN A;  4GDL B;  3EFC A;  4KDI C;  1WYW B;  3KWL A;  1R7S A;  2BF8 B;  3ONS A;  4ZYN A;  2V4L A;  4GIV A;  3QC8 B;  3AU5 A;  4IWP A;  3TEY A;  2NBW B;  2L52 A;  4ZRK A;  1EM7 A;  4DHJ D;  1ZKH A;  4HPL B;  4ARI A;  5AZG A;  1ZDV A;  4RM8 A;  4A20 A;  1YOV B;  2IO2 B;  3HIZ A;  1IGC A;  3VTU A;  1V5O A;  1N6Z A;  3L10 B;  2MBE A;  3QAQ A;  5G55 A;  3GP7 A;  3RNC C;  4EUT A;  4P7I A;  4BZA A;  2JQR B;  2NR2 A;  1GC6 A;  3AE7 B;  1FD6 A;  2M17 A;  2V3S A;  1V9J A;  3ZQ4 A;  2R2O A;  2RDG A;  2W82 A;  3BK2 A;  5HFY A;  2D3B A;  1FO4 A;  3UIN B;  4LNN A;  1VDV A;  1JWB D;  3EHV A;  5JXV A;  4EZK A;  4ANX A;  2MRP A;  3ZW3 A;  3NOB A;  3CIR B;  2KN5 A;  1WJU A;  1MHX A;  4REZ A;  1OQQ A;  3EGR A;  1NDD A;  2WYQ A;  1YX6 B;  2DZJ A;  2O6V A;  1UH6 A;  3L0W B;  1WX8 A;  2LVP A;  3KUZ A;  4BVU C;  1N60 A;  1HTQ A;  3FIL A;  2WXI A;  3GZN B;  2IO1 B;  1WMH A;  1P0R A;  2BKF A;  3DVG Y;  3KYC D;  4RMA A;  2UWQ A;  4A6Q A;  2GMI C;  3BVZ A;  4KV2 A;  1JCK B;  2Z0E B;  5IO9 A;  4NAW B;  1VZ6 A;  2KFK A;  3QAR A;  4P16 A;  3JSV A;  1NVI D;  4BBN C;  1R4N I;  2G4S A;  2LHE A;  5GXG B;  2LVO A;  1FEH A;  3L08 A;  4DXF A;  1UWX A;  2MSE D;  2L1A A;  1PGA A;  1Y8R C;  1WGY A;  2AQ1 B;  3N30 A;  4URK A;  1IGD A;  1SXT A;  4MJS B;  2C9W B;  3WAO A;  2KTR B;  4LDT D;  1EU3 A;  1NI3 A;  3AM9 A;  2BYE A;  1OQY A;  3Q8F A;  5D3D A;  2D11 A;  1YMH E;  3MP9 A;  1STE A;  3P63 A;  3AEF B;  4TMA B;  1WY8 A;  4IDI A;  1KLG D;  2LGY A;  3A33 B;  3BK1 A;  3VQI A;  1TS2 A;  3CSF A;  3WAL A;  2W54 A;  4HJG E;  1PGX A;  2N0S B;  4JWS C;  2CHZ A;  3RPF C;  4O1N A;  1YQB A;  5EE9 A;  3KQ4 A;  1WGG A;  1V86 A;  4C7Y A;  2JY6 A;  1E10 A;  2JU6 X;  2WXH A;  4MEL A;  1JQ4 A;  1F52 A;  3HRD D;  4KIK B;  2LUM A;  1WRD B;  3AEB B;  3NRZ A;  3N1Y C;  4P1B C;  1WIA A;  2KYW A;  4II3 B;  2IGD A;  4BKS A;  1Y56 A;  2VZK D;  4FJY A;  1IBX A;  2MWS B;  1IUE A;  1E8W A;  2XNA C;  2M8S A;  4KSL C;  2MEK A;  4E74 A;  2D2Q A;  2BT6 A;  3PRZ A;  2HE7 A;  3PT2 B;  1L5P A;  3KVF B;  4HCN B;  1E6E B;  5JH5 C;  3WCQ A;  2QDF A;  2QMT A;  3IXS A;  2IDY A;  4B0M A;  1WJN A;  4L23 A;  3VFK A;  2XK5 B;  4DHZ E;  3ZO5 B;  1MHH E;  5C23 A;  3BVG A;  1ZP0 B;  1LXD A;  5L95 C;  4MGZ E;  4DXA B;  2L76 A;  3VH3 B;  4EE2 A;  4NQL B;  1VLB A;  3A9K A;  4ARC A;  2J0K A;  3C8Y A;  5IP4 D;  3CST A;  1EF1 A;  4HJK A;  1SJE D;  5BYR A;  4HLE A;  1D5X C;  2JUO A;  3Q2A C;  1XLN A;  2AQ3 B;  1JWU D;  1OEY A;  3W9C B;  2ICI A;  3GZN I;  1V1P A;  1WR6 E;  4WAF A;  2XN9 C;  3Q8B A;  1ET9 A;  3MFG A;  2EMT A;  4A9A A;  2ZW0 A;  4NJ7 A;  5JHA A;  2BBC A;  1KRH A;  2V3N A;  3Q8C A;  2K0P A;  2AL6 A;  3L4P A;  4UDU C;  4GMV A;  2CJN A;  2B76 B;  2FIF A;  4AP4 C;  2PE9 A;  1F1H A;  3DBL B;  4DDI D;  3V61 A;  2VH1 A;  1GPX A;  3C0R B;  3W1S C;  2NPT A;  4B0E A;  2OHF A;  4BOS C;  4XDC A;  3ECI A;  3RZW C;  2L05 A;  2HTM E;  1MPE A;  2MP2 B;  3AH7 A;  2KC1 A;  1AW7 A;  2KQ7 A;  1PYW D;  1QKZ A;  1QZE A;  2MBH A;  4P1C C;  4XYC A;  1M4V A;  4WJQ A;  2K3U A;  1KJT A;  4XX5 A;  5H8Y E;  2J52 A;  2PEA A;  2RR9 A;  4BFR A;  4JQW C;  4GDL A;  4C80 A;  2WXK A;  3LJ3 A;  1YNT E;  2NTT A;  3Q6B A;  3IHP C;  4OW0 A;  1QT9 A;  3ALB A;  2EEL A;  4K7W A;  1UBQ A;  2V0G A;  2A5U A;  1TS3 A;  5AZH A;  4W9K A;  4EKU A;  2N9X A;  1AWD A;  2GBK A;  4EEW A;  4OVV A;  5IKC M;  1HXY D;  3UQA A;  1FRR A;  3RUL A;  3LDZ E;  2QIL A;  4AQ7 A;  5BO4 B;  1PGB A;  1GAQ B;  4M8M A;  1ZW7 A;  2K8C A;  2IGH A;  4QAY A;  1E8Y A;  1M94 A;  2MJE A;  3AUL A;  5E6P A;  2JRH A;  3FAH A;  2KN4 A;  3Q3J A;  3B2G A;  3PPA A;  1MG8 A;  4RF0 A;  1C9F A;  2IJ0 A;  1T0R C;  2G4D B;  3CF6 E;  3TMP B;  5J2R A;  2BWF A;  2WU5 B;  2Y3A A;  1WH3 A;  2LWP A;  1DOI A;  1JRO A;  5D6J B;  1QLB B;  2W9N A;  4TSS A;  3PHW B;  1SBB B;  3QHT A;  1RFA A;  1K51 A;  2K8H A;  3I3T B;  4AOF A;  5EE0 A;  3QCA A;  2H89 B;  4JIO U;  1E8X A;  2YEP B;  5HI1 A;  5AEK B;  1S3S G;  2Z59 B;  4MH8 A;  1OEY J;  3AU4 A;  3BYT B;  1I42 A;  1TZO A;  3W5U B;  1V80 A;  3RFZ B;  2CHX A;  4TV3 A;  2LXA A;  2O2V B;  2G1E A;  3O13 A;  3X0W A;  3DVN U;  2NMQ A;  2GBR A;  1ZGU B;  1YJ1 A;  2LGS A;  1BT0 A;  4GXB A;  5IN7 A;  3WAM A;  3VVW B;  3M63 B;  3QIJ A;  3RZF A;  3RYT A;  4M00 A;  5JZE B;  4KZC A;  4NAW A;  4KGR A;  4R3D A;  3AXC A;  3SEB A;  1UD7 A;  2PTL A;  2IY0 B;  2LJI A;  1B1Z A;  4WWN A;  1TKG A;  2BWE S;  3NJT A;  1ZDX A;  1SIJ A;  3ETR A;  3Q3F A;  3APC A;  3T3N A;  2J7Q B;  3PLV A;  4ZRQ A;  1V49 A;  3R3M A;  2JT4 B;  1YJI A;  2ZCC A;  1NBF C;  4MJS A;  4I6P A;  2KNB A;  1FM0 D;  2KTR A;  3DBL I;  3EEC A;  3TEW A;  1R4N B;  4MGK E;  3EFU A;  4YTM B;  4YTN B;  1N5W A;  1E7P B;  2KKC A;  3NVY A;  1XO3 A;  5EE3 A;  1KLV A;  4PS8 A;  4ACF A;  3JW0 X;  4ITK A;  3U4E G;  2RD0 A;  2EMS A;  2BW2 A;  2KAC A;  4YSY B;  1DGJ A;  3QWZ B;  2KK8 A;  4E71 A;  2G45 B;  3KYD D;  2JPH A;  3NVZ A;  2BKR B;  2GBM A;  4HK2 A;  1XLP A;  3TJP A;  2GBJ A;  1P1A A;  4WUR A;  3V3X A;  4W9J A;  1F77 A;  3K9P B;  1B9R A;  3AEE B;  3VUX A;  2E6X A;  4ZRP A;  1RRB A;  1E8Z A;  1D3Z A;  4RGO S;  2R61 A;  2ZZP B;  1KTK A;  3PV1 A;  3C19 A;  1JWM D;  2FID A;  3BYY B;  2DZI A;  4KIK A;  3U7D A;  5AZF A;  1UF0 A;  2IO0 B;  2FAZ A;  4MAC A;  1PQS A;  1NYQ A;  2WXF A;  1EUV B;  4BKG A;  1YN3 A;  2AYO B;  2KT7 A;  3ZGZ A;  2IY1 B;  3SD5 A;  1YQ4 B;  1IP9 A;  2GB1 A;  1Z5S B;  2WNM A;  2AEH A;  3DPD A;  3I9V 1;  2KDE B;  2IGG A;  3V62 A;  1E9M A;  2KD0 A;  2JZP A;  2N1W A;  4H2A A;  1SE3 A;  5DPS A;  1E7V A;  5I4D A;  2PPH A;  3N32 A;  2L7R A;  3PZ7 A;  1OQR A;  2K6Q A;  4J3O D;  4HPM B;  4C56 C;  1JWS D;  2CS4 A;  3M95 A;  2KMA A;  2DEN B;  2XK5 A;  4LNK A;  4ANV A;  2WX1 A;  3VAW A;  2KX3 A;  2N9L A;  1KLU D;  3Q3M C;  4M0W B;  2VH2 A;  2KDM A;  2PLP A;  3NVV A;  2WDT B;  1GB1 A;  4LNI A;  3MHS D;  4N9F 4;  2W55 A;  4YT0 B;  2V1Y A;  2QSD A;  4KKJ A;  4FUL A;  3NZS A;  3JYU A;  1WXQ A;  3SFD B;  3DHG C;  4G0N B;  2JXT A;  1HEZ E;  4ZHP A;  4KZ0 A;  1ISN A;  1IPG A;  1Q1O A;  2JYT A;  3AE2 B;  2BS2 B;  2LRW A;  1K50 A;  3P2B A;  3UF8 A;  4GU2 A;  3VUY A;  2DHZ A;  3B1L X;  1SE2 A;  2KLC A;  1N5X A;  3MC8 A;  1I4H A;  1GG3 A;  1RAX A;  2DX5 B;  3L17 A;  1CJE A;  2D5G A;  5HG2 A;  4GGQ A;  3AMZ A;  1J0G A;  3TUO A;  3B2F A;  4HCP B;  2WXL A;  1EO6 A;  2L0T A;  4TQ1 A;  3PO0 A;  1NYR A;  2C7H A;  3P4S B;  4LJP B;  3PGE A;  5AUK A;  1ACC A;  1EU4 A;  2MP2 A;  3NS8 A;  4K7S A;  2KWU B;  2KJ6 A;  2WXP A;  3RNB C;  1FXI A;  2XBB C;  2EKE C;  4IUM B;  3AEG B;  1I4X A;  2KDI A;  5FK9 C;  1V8C A;  4PYZ A;  4X57 B;  2K6D B;  4HKQ A;  3IFW B;  4BOZ B;  2L00 B;  3X23 A;  4W9H A;  4WQM A;  1WE7 A;  2JWZ A;  3ZJV A;  2IND C;  2QIE B;  2KC2 A;  3ZDT A;  1TBE A;  2AX5 A;  3IAM 1;  4MH0 E;  2H88 B;  3ZDM C;  1I4R A;  2I1K A;  3U30 A;  1UEL A;  1FNW A;  1V2Y A;  3L16 A;  3LYY A;  4DHJ B;  2QEJ C;  3E9S A;  2DYM A;  3L54 A;  5D94 A;  3DBS A;  1WX9 A;  5G5H A;  3V6E B;  4K3C A;  3Q3N C;  3QA8 A;  4KGT A;  2QCZ A;  3RNA C;  3VR8 B;  4BKT A;  3RT3 B;  2MH7 A;  2INP E;  3U7Z A;  4MM3 B;  3R7Q A;  2BQQ A;  1TY0 A;  3OAW A;  2KVZ A;  1RWS A;  1WGK A;  3AE3 B;  4D2K A;  1WXS A;  4EZL A;  3ZVV A;  4HPP A;  1LFD A;  1RFK A;  4EOY A;  3TL5 A;  2BPS A;  5LLI A;  1XXG A;  1KH0 A;  2XEW A;  2G9H D;  2O6V D;  4MSQ B;  3GB1 A;  1UZX B;  1KF6 B;  2R2Q A;  2K22 A;  1I4Q A;  2ZCB A;  2CKH B;  3PZD A;  5BMH A;  2DNF A;  5CTR C;  5BMG A;  4WWP A;  3DWG C;  5LXH A;  1NEK B;  5DPR A;  2K25 A;  4N6E B;  3Q14 C;  3APF A;  1NI2 A;  4G50 A;  4YXD B;  4GOC A;  4GSW A;  3MC9 A;  3VRB B;  3H9D A;  1EWC A;  5D3I B;  3I63 C;  2I38 A;  2LGD A;  1TKE A;  1CMX B;  2O2V A;  3ZNH B;  1FFU A;  4FJV B;  3ENE A;  4TKN A;  3NVW A;  3AE8 B;  2M0X A;  1KM7 A;  2M4N A;  2K39 A;  1GUA B;  4ANU A;  2LFI A;  5CHW A;  2IPK D;  1QIL A;  5D7G A;  5FKA C;  4W9E A;  1D6E C;  3UQB A;  1CZP A;  2GRI A;  2C60 A;  1IYF A;  4XE0 A;  2FBW B;  3RNF C;  4MDK E;  1FCC C;  1J19 A;  2KAN A;  3ZLZ A;  3URY A;  3CMM B;  1L0Y B;  4GLS C;  4LJO B;  3UIP B;  1GB4 A;  4ICV A;  5KHQ A;  3VTW A;  2KVR A;  1L4D B;  3ZJU A;  4ZRI A;  4RNA A;  4B9K A;  3NHE B;  5LXI B;  1WX7 A;  4LDT B;  3WAN A;  1L0X B;  4OVU A;  3GE3 C;  5HHD G;  3N1X C;  1HZ6 A;  1I4G A;  4B95 A;  3VHT C;  4FN2 A;  1P7E A;  4A90 A;  3K9O B;  1CK1 A;  1ZXH A;  4IM2 A;  1FNU A;  3W1Y A;  3AEC B;  3DWM A;  4L1B A;  4ICU A;  2PKO A;  2PE6 B;  3A9J B;  2RSU A;  3VDZ A;  4ZYS A;  1TS4 A;  1TT5 B;  2K9X A;  3MJ5 A;  5CHV C;  2KLG A;  3RNG C;  3KLS X;  2WXM A;  4S17 A;  2A4Z A;  2WXN A;  4WJN A;  2D3G A;  2INN E;  3TBL D;  3ABV B;  1QOB A;  3DCG A;  1BXT A;  2NCN A;  3B0A A;  2WU2 B;  4BKS D;  4M01 A;  3O65 B;  3P4R B;  1WSP A;  2L32 A;  2G3Q B;  3RD2 A;  1YQ3 B;  4BBN F;  1SIF A;  3PHX B;  1MI0 A;  2DAF A;  3KWV A;  4S0R A;  4KKI A;  4LTU A;  3HM6 X;  1D5Z C;  3R8B A;  2MW5 A;  2VZK B;  5BYQ A;  3TIX A;  1XD3 B;  2K5P A;  1VZ7 A;  4LLG M;  1SSN A;  3IAS 1;  4KDL B;  2KFJ A;  4JE3 B;  2ZPN A;  3OJ3 A;  5GMV A;  4A3O A;  2PW9 A;  4DWF A;  4HWI B;  1MVK A;  1ESF A;  4C00 A;  3RI7 C;  5IA7 A;  1J7A A;  4NPN A;  3SU8 X;  4ZOH C;  1WI0 A;  1ENF A;  1TGZ B;  3QX1 A;  1LGR A;  2K8B A;  2LZ6 A;  2ZNV B;  5DCN A;  3LXF A;  1PFD A;  3PRM B;  2HDE A;  1WJ4 A;  2FUG 1;  4W9I A;  1KOT A;  4M0W A;  4OZA A;  1E7U A;  1DOY A;  4IKG A;  3V6C B;  1N63 A;  2KXJ A;  2FCS A;  2IYD B;  4IOI E;  3W1S A;  1YN5 A;  2ACZ B;  2LVQ A;  2M1M A;  1TYG B;  1F2R I;  3B08 A;  2KWV B;  5E6J A;  1GC7 A;  4F1S A;  2KTF A;  5DPW A;  3OG5 A;  1EF5 A;  4W9D A;  2WWZ A;  2MBB B;  2LHD A;  2KWC A;  2CR5 A;  2GI9 A;  3AED B;  2JWU A;  4FLH A;  1HZ5 A;  3ZTC A;  1HQR D;  3J9C A;  2TSS A;  3NY5 A;  1WGD A;  1GOZ A;  3DDC B;  4KSK C;  3A1Q B;  2V3P A;  2KAJ A;  4Q2J A;  2WS3 B;  4FHJ A;  1SGH A;  2QHO A;  5DPT A;  1SEB D;  4PS7 A;  1J7C A;  3DBR I;  2L8J A;  4P6V F;  3VRA B;  4US8 A;  1T6B X;  2MLB A;  4GDK B;  3A4R A;  2LAS A;  1JML A;  3PS6 A;  1FMA D;  3BWU D;  2LXC A;  4WJO A;  3PRE A;  1Q10 A;  2BYT A;  2UYZ B;  3MJW A;  3P4P B;  3DHI C;  2OED A;  2ZVO A;  1EWY C;  2RPV A;  2D3A A;  1J7B A;  5J17 A;  1RYJ A;  1T0Y A;  4FAD A;  2BTE A;  3TSS A;  4NZL B;  5D2M B;  3AB5 A;  3ML8 A;  4NY0 A;  1WR1 A;  3T8M A;  1WM3 A;  2HJ1 A;  3RUI B;  4WWM A;  2J0M A;  2QJL A;  4OZB A;  1F2R C;  1NEN B;  2KMC A;  3SFE B;  3QQ8 B;  4XDD A;  2J4X A;  3Q8E A;  1WXV A;  2WDV B;  3IT4 B;  2INC C;  4HVB A;  2WHI A;  1C1Y B;  4DHZ B;  4NNJ B;  2BB6 A;  4HKZ E;  2DYB A;  3ZRC A;  1C4C A;  3DHH C;  2C5L C;  3IVF A;  1RLF A;  2FCM A;  3H1U A;  1DOX A;  2I2Y A;  4ASW C;  4I6N B;  1WGR A;  2X8X X;  3DQV A;  2KWD A;  4MM3 A;  1UUP A;  1KFY B;  2DBY A;  1ROE A;  4DDG D;  4K7U A;  4IW0 A;  4AWJ A;  2CJO A;  1JAL A;  2MX2 A;  2LD9 A;  5KHO A;  4I6L B;  4YWG G;  4II2 B;  3ZXR A;  4XGA B;  2L3Z A;  1J8C A;  1JW9 D;  3V60 A;  3PZ8 A;  2KDF B;  3A4S C;  4AJY B;  5MPO A;  2AL3 A;  1C77 A;  1C78 A;  1I35 A;  4G11 A;  2Y5B B;  1P3Q U;  2KOX A;  1SE4 A;  3R66 C;  2NPT B;  3GS2 A;  1QOA A;  4FA6 A;  1V81 A;  3AE4 B;  5E6N A;  3AEA B;  3TEZ A;  1VCB A;  3P1M A;  1ZE3 D;  1XLO A;  3R7R A;  3AE5 B;  1LQB A;  4NJC A;  3ZNG C;  2N4F A;  5T8I A;  2KJR A;  2ZPY A;  3I57 A;  3RNE C;  1G6J A;  3B9J A;  1A5R A;  3QK0 A;  1F0Z A;  2BS3 B;  2HTH A;  1C79 A;  1P9D U;  2X38 A;  1DYQ A;  1VD2 A;  4US9 A;  2GBN A;  3ZUN A;  1WZ0 A;  1QQR A;  1AYF A;  1S1Q B;  2D3C A;  1FIQ A;  1ZUD 2;  1C4A A;  1L2N A;  4A3P A;  5E6O A;  2OJR A;  4G3X B;  3RCZ A;  5IAA C;  4FXC A;  3TCA A;  3N20 C;  2WXJ A;  1N62 A;  4IC7 B;  1CQV A;  4HEA 1;  4JLC A;  3KH0 A;  1TY2 A;  2LUE A;  3AE1 B;  1P98 A;  1A70 A;  4WAA A;  3W2D A;  1X1M A;  3IT6 B;  3BZD B;  1AAR A;  2KX0 A;  1FCL A;  4GN1 A;  2EKI A;  4CHK A;  4XZ4 A;  4NJ6 A;  1OFF A;  2KDB A;  3ZRF A;  3NUH B;  3OLM D;  3VUW A;  4M8N A;  4W9G A;  1WFY A;  1YJJ A;  2ZNV C;  3LB8 C;  5C1Z A;  1N61 A;  3BII D;  2JXX A;  4XWW A;  1HA5 A;  3AE6 B;  4EFO A;  3A9J A;  1V1O A;  1U4A A;  4NAM A;  5FR3 A;  4LNO A;  4DK5 A;  2JF5 A;  4F7Z A;  1FPY A;  4J6I A;  4W9L A;  2UU7 A;  4MT5 A;  4RF1 A;  1HTO A;  1D4B A;  2WXQ A;  2MBO A;  2C7M B;  3SR6 A;  1H4R A;  4B6W A;  2FCQ A;  1T0S C;  1TZ1 A;  2N9K A;  2JRI B;  4WH4 A;  3DBH I;  3S2A A;  4CQN A;  3BVM A;  5EE1 A;  4HRS A;  4WIP A;  3UIO B;  3OWE B;  1UGJ A;  2OOB B;  4JWU C;  2LMC A;  2MJ3 A;  2N1V A;  1V6E A;  4RH6 A;  1XQQ A;  3E56 A;  2PIA A;  4ZRJ A;  1JWA D;  1UBI A;  1TKY A;  4N58 A;  2ZEQ A;  3GE8 C;  4F8C B;  3HM3 A;  2SEB D;  3Q3O C;  4WWO A;  2GLS A;  4C7Z A;  2JSV X;  2I1J A;  1XCQ L;  1K52 A;  2KQS A;  1D5M C;  1WZ3 A;  3RN9 C;  1XT9 B;  2KZR A;  1L6V A;  2DWQ A;  3AN1 A;  4K3B A;  4C4V B;  4GB9 A;  3SDL C;  2SAK A;  5IOI A;  4ZHO A;  4IM0 A;  3SHQ A;  4FBJ B;  2Q5W D;  3W5V B;  1QOG A;  2BGF A;  3EC8 A;  4N59 A;  1SF0 A;  1YD8 U;  3R2I A;  2W3R A;  4RFB A;  4RCO A;  3WA0 A;  3H7P B;  3PLU A;  3N3K B;  5FR6 A;  3MC0 B;  5C3J B;  4DXG A;  2M19 A;  3GOE A;  2J42 A;  4MGY E;  4RM9 A;  3VR9 B;  2JX5 A;  1XEE A;  2PMV A;  2BYV E;  3AE9 B;  4E3C A;  4PK1 A;  2V9H A;  1FRD A;  3I5J C;  4A55 A;  4AS1 A;  2PVO D;  1WRI A;  3VXW A;  1K8R B;  2QC8 A;  1V97 A;  3HUI A;  4PS3 A;  5TSS A;  4FHK A;  3P42 A;  4A8X C;  1JRU A;  3A1Q A;  3ZYY X;  2LEK A;  1TS5 A;  5G2N A;  2CU3 A;  2M0A A;  3M62 B;  1FNV A;  2DZM A;  2RDB C;  1ZOY B;  3U8Z A;  3PVL A;  2NTS A;  4GDK A;  4DQO C;  4TQ0 A;  2RPQ A;  2N9P C;  2WX0 A;  2K1F A;  4ZDV A;  1ET6 A;  1WXM A;  2WDQ B;  1BML C;  2YLM A;  1UWM A;  3D32 A;  3DBR B;  2L0F A;  4MGI E;  3N1Z C;  4MEM A;  4CO7 A;  1H8C A;  3H8H A;  4RGT A;  1MFW A;  4JGH B;  1I4P A;  4LNF A;  4IWQ A;  1F9J A;  2WLB A;  3NZ3 A;  1C3T A;  2Z8L A;  3MTN B;  2B3A A;  4MSM B;  2WP9 B;  2JZZ A;  2N7E A;  4K81 A;  2KJH B;  4LCD E;  2IZV B;  3DVN V;  3HVZ A;  2NS5 A;  4IWO A;  3Q8A A;  1L4Z B;  4NQK E;  2MQJ A;  2BVC A;  1PUT A;  2E3T A;  2AQ2 B;  4EZJ A;  1Q5W B;  4XC2 A;  3HVD A;  1GJZ A;  1AN8 A;  3OJ4 B;  3AV8 A;  4TUU A;  3ZNI D;  1R4M B;  2AWT A;  2LRU A;  2FCN A;  3IBE A;  2J53 A;  4W9F A;  3ZTD A;  1OGW A;  2KO3 A;  2O6V B;  4AUQ C;  3NG0 A;  5BYS A;  2WQY B;  1QOF A;  3N9Y C;  4JPS A;  4L2Y A;  4PYU A;  1FXT B;  1VR9 A;  1T5X D;  2YEP F;  5BMI A;  3FIL B;  2BB5 A;  1SE9 A;  4YL8 A;  3UGB B;  4BAX A;  4PT5 A; 
#chains in the Genus database with same CATH homology
 1WMH B;  1T0Y A;  4FAD A;  3CSF A;  2WDT B;  2N9E B;  5D2M B;  3WAL A;  3ML8 A;  3PSE B;  4NY0 A;  3MHS D;  1WR1 A;  4N9F 4;  3T8M A;  2CHZ A;  1WM3 A;  3RUI B;  2MCN B;  2J0M A;  2V1Y A;  2D10 A;  1YQB A;  4FUL A;  1WGG A;  1V86 A;  3NZS A;  2KMC A;  3JYU A;  3QQ8 B;  2JY6 A;  2KFK B;  4G0N B;  2HD5 B;  4MEL A;  1HE8 A;  3JSV B;  4KZ0 A;  1WXV A;  1ISN A;  1IPG A;  1Q1O A;  4KIK B;  2LRW A;  1WRD B;  3P2B A;  3UF8 A;  4HVB A;  4GU2 A;  3VUY A;  1C1Y B;  4DHZ B;  1WIA A;  1YX5 B;  4NNJ B;  2DHZ A;  3KUC B;  4II3 B;  1GNU A;  3B1L X;  4BKS A;  2KLC A;  2DYB A;  3ZRC A;  1GG3 A;  1RAX A;  1E5W A;  2C5L C;  2DX5 B;  4FJY A;  2C7N B;  4HXD A;  3IVF A;  3L17 A;  1RLF A;  2FCM A;  3H1U A;  4WJP A;  1LM8 B;  2MWS B;  1E8W A;  4GGQ A;  4ASW C;  2M8S A;  3H7S A;  4I6N B;  1WGR A;  4ANW A;  1J0G A;  1WGH A;  4KSL C;  2BYF A;  3DQV A;  4HCP B;  4E74 A;  2GOW A;  2D2Q A;  3PRZ A;  2HE7 A;  4MM3 A;  1EO6 A;  2L0T A;  4TQ1 A;  3PT2 B;  3KVF B;  2C7H A;  4HCN B;  4DDG D;  4K7U A;  5JH5 C;  4IW0 A;  4AWJ A;  3HK0 A;  2MX2 A;  2LD9 A;  4LJP B;  5KHO A;  4I6L B;  3PGE A;  3HHM A;  4II2 B;  2MP2 A;  3NS8 A;  1WJN A;  2L3Z A;  2KWU B;  4K7S A;  2MA9 B;  1YIW A;  2KJ6 A;  1J8C A;  3VFK A;  2XK5 B;  4DHZ E;  2XBB C;  2EKE C;  5C23 A;  3ZO5 B;  4IUM B;  3V60 A;  1LXD A;  2KDF B;  5L95 C;  4MGZ E;  4KVG B;  3A4S C;  5J18 A;  4DXA B;  2KDI A;  4AJY B;  2L76 A;  2AL3 A;  1I35 A;  3VH3 B;  4G11 A;  2Y5B B;  1P3Q U;  4NQL B;  2DZK A;  2KOX A;  4PYZ A;  4X57 B;  2K6D B;  3IFW B;  3A9K A;  4BOZ B;  2J0K A;  2L00 B;  3X23 A;  3PRP B;  3R66 C;  4W9H A;  2NPT B;  3CST A;  1WE7 A;  4CYE A;  3BY4 B;  2JWZ A;  1EF1 A;  1WF9 A;  4HJK A;  2RGF A;  4HLE A;  2KC2 A;  4FA6 A;  1V81 A;  2JUO A;  5E6N A;  3ZDT A;  4AJW A;  3ZKJ C;  1VCB A;  1TBE A;  4MH0 E;  3ZDM C;  3KW5 B;  2I1K A;  1OEY A;  3R7R A;  3DVG X;  1UEL A;  1LQB A;  2Z0D B;  3U30 A;  2DYO A;  1WJ6 A;  2ASQ A;  2LGX A;  1V2Y A;  4K1R B;  3L16 A;  3ZNG C;  2N4F A;  3GZN I;  4DBG A;  3H6N A;  4DHJ B;  2KJR A;  2ZPY A;  1WR6 E;  1G6J A;  4HDO A;  1A5R A;  3QK0 A;  2DYM A;  3AI5 A;  1WE6 A;  3L54 A;  4HDQ A;  5D94 A;  1TTN A;  2EMT A;  2HTH A;  3DBS A;  1P9D U;  2FNJ B;  1WX9 A;  3KUD B;  1VD2 A;  3V6E B;  5L83 A;  4NJ7 A;  5JHA A;  2GBN A;  3ZUN A;  1WZ0 A;  1S1Q B;  3APD A;  4JL9 A;  4FJZ A;  2NBV B;  2REX A;  5CX3 A;  3QA8 A;  3L13 A;  1L2N A;  5EDS A;  4A3P A;  2AL6 A;  5E6O A;  2OJR A;  4G3X B;  4GMV A;  3RCZ A;  4BKT A;  5IAA C;  3RT3 B;  2FIF A;  3TCA A;  4IC7 B;  4AP4 C;  1Z2M A;  1V5T A;  1WM2 A;  2PE9 A;  3R7Q A;  4DDI D;  3V61 A;  3ZNZ B;  4JLC A;  3OAW A;  3C0R B;  3KH0 A;  3QJZ A;  3W1S C;  2LUE A;  1WXS A;  1P98 A;  2NPT A;  2N7D A;  4BOS C;  4WAA A;  4EZL A;  2IO3 B;  1X1M A;  3ZVV A;  3ECI A;  3RZW C;  1OTR B;  1LFD A;  2LI5 A;  2L05 A;  4EOY A;  2CU1 A;  2MP2 B;  2LJ5 A;  3TL5 A;  2BPS A;  3IG3 A;  2D07 B;  5LLI A;  2VRR B;  2KC1 A;  2XEW A;  1AAR A;  2NVU I;  2O6V D;  2KX0 A;  2KQ7 A;  4MSQ B;  1UZX B;  2R2Q A;  2ZCB A;  4GN1 A;  2CKH B;  1QZE A;  2MBH A;  3PZD A;  4CHK A;  4WJQ A;  4XZ4 A;  4NJ6 A;  5CTR C;  1R4M I;  1WXA A;  2KDB A;  3ZRF A;  1Q0W B;  4WWP A;  5JHB A;  5LXH A;  1KJT A;  5DPR A;  2K25 A;  3A9K B;  3VH4 B;  3OLM D;  3VUW A;  3APF A;  4M8N A;  1NI2 A;  1WFY A;  1UGM A;  4G50 A;  4W9G A;  4GOC A;  4GSW A;  4XX5 A;  2ZNV C;  5CHF A;  2PEA A;  2RR9 A;  5C1Z A;  3DOW A;  3H9D A;  4GDL A;  4JQW C;  3ML9 A;  4BFR A;  4W9C A;  2JXX A;  3LJ3 A;  3PTF C;  2JZ3 B;  4IM3 A;  4EFO A;  3IHP C;  3ZIM A;  3A9J A;  2LGD A;  3ALB A;  2YVC A;  4K7W A;  1UBQ A;  2A5U A;  1CMX B;  2O2V A;  1U4A A;  3ZNH B;  3WIM A;  5AZH A;  4FJV B;  3H7P A;  4W9K A;  3ENE A;  2JVC A;  4EKU A;  4TKN A;  4DK5 A;  2N9X A;  2GBK A;  2JF5 A;  4WQO B;  4F7Z A;  2M0X A;  4J6I A;  2KHW B;  4W9L A;  1KM7 A;  4OVV A;  4EEW A;  5HKH A;  3VTV A;  3UQA A;  2M4N A;  2K39 A;  3RUL A;  3LDZ E;  2J0J A;  2MBO A;  2C7M B;  1H4R A;  5BO4 B;  4B6W A;  2FCQ A;  1TZ1 A;  1GUA B;  2JRI B;  4ANU A;  3DBH I;  3S2A A;  4M8M A;  5CHW A;  1ZW7 A;  2K8C A;  5D7G A;  3UIO B;  3JVZ X;  1E8Y A;  2HJ8 A;  1M94 A;  2CHW A;  4W9E A;  2OOB B;  3AUL A;  2ZVN A;  3BIN A;  5E6P A;  3UQB A;  2N1V A;  2JRH A;  1V6E A;  3Q3J A;  1XQQ A;  2C60 A;  1IYF A;  4MDK E;  3PPA A;  4ZRJ A;  1MG8 A;  1J19 A;  2KAN A;  1UBI A;  2PJH A;  3ZLZ A;  2ZEQ A;  3CMM B;  3T9L A;  1E90 A;  4F8C B;  3HM3 A;  2G4D B;  3CF6 E;  4LJO B;  4WWO A;  3TMP B;  5J2R A;  3UIP B;  2BWF A;  2FUH B;  4ICV A;  5KHQ A;  2I1J A;  3VTW A;  2KVR A;  2KQS A;  1WH3 A;  2LWP A;  1L7Y A;  1WZ3 A;  5D6J B;  2ZJD A;  2W9N A;  2DAJ A;  4ZRI A;  3PHW B;  1XT9 B;  2KZR A;  4B9K A;  3QHT A;  3NHE B;  5LXI B;  1WX7 A;  4IG7 B;  4LDT B;  1RFA A;  2K8H A;  3WAN A;  2IBI B;  3I3T B;  3WAP A;  4AOF A;  4OVU A;  3NZU A;  4GB9 A;  3SDL C;  3QCA A;  3M3J A;  2NBU A;  4B95 A;  2MBQ A;  3VHT C;  5TR5 A;  4FN2 A;  4JIO U;  1E8X A;  3K9O B;  5AEK B;  4IM0 A;  3SHQ A;  4FBJ B;  4GDL B;  1S3S G;  4IM2 A;  2Z59 B;  3W1Y A;  4KDI C;  1WYW B;  1OEY J;  2BGF A;  3EC8 A;  4ICU A;  3AU4 A;  2PE6 B;  1I42 A;  3A9J B;  1YD8 U;  2BF8 B;  1V80 A;  2RSU A;  3ONS A;  3VDZ A;  2CHX A;  2V4L A;  4ZYN A;  4TV3 A;  2LXA A;  2O2V B;  4GIV A;  5CHV C;  3QC8 B;  2KLG A;  3WA0 A;  3H7P B;  3X0W A;  3DVN U;  3AU5 A;  4IWP A;  3PLU A;  3N3K B;  2A4Z A;  2NBW B;  4WJN A;  2D3G A;  2GBR A;  3TBL D;  1ZGU B;  4ZRK A;  5FR6 A;  1YJ1 A;  4DHJ D;  1ZKH A;  4HPL B;  1BT0 A;  4GXB A;  5AZG A;  3WAM A;  3DCG A;  3GOE A;  3VVW B;  4MGY E;  4RM9 A;  2NCN A;  4RM8 A;  3M63 B;  4A20 A;  3QIJ A;  3HIZ A;  2IO2 B;  3RZF A;  3RYT A;  2BYV E;  5JZE B;  3VTU A;  4KZC A;  3B0A A;  1V5O A;  4NAW A;  4BKS D;  3L10 B;  2MBE A;  3AXC A;  3QAQ A;  5G55 A;  4E3C A;  3O65 B;  1UD7 A;  4EUT A;  2G3Q B;  4P7I A;  2IY0 B;  2NR2 A;  1GC6 A;  3RD2 A;  4BBN F;  1SIF A;  2M17 A;  2V3S A;  3PHX B;  4WWN A;  2DAF A;  1V9J A;  2BWE S;  3VXW A;  2R2O A;  3Q3F A;  3HM6 X;  1K8R B;  2MW5 A;  4PS3 A;  3APC A;  3UIN B;  2J7Q B;  4FHK A;  3PLV A;  1V49 A;  3R3M A;  1XD3 B;  2JT4 B;  3TIX A;  3EHV A;  1JRU A;  4EZK A;  3A1Q A;  4ANX A;  2MRP A;  4KDL B;  2ZCC A;  1NBF C;  2KFJ A;  3ZW3 A;  3NOB A;  4MJS A;  5G2N A;  2KN5 A;  1WJU A;  2ZPN A;  4I6P A;  3OJ3 A;  5GMV A;  4A3O A;  4DWF A;  4HWI B;  2KNB A;  2KTR A;  3M62 B;  3DBL I;  3EEC A;  5IA7 A;  2DZM A;  4MGK E;  3U8Z A;  4NPN A;  1NDD A;  2WYQ A;  1YX6 B;  3EFU A;  3PVL A;  3SU8 X;  4GDK A;  4TQ0 A;  1WI0 A;  2DZJ A;  1TGZ B;  3QX1 A;  2K8B A;  2LZ6 A;  2ZNV B;  2O6V A;  2KKC A;  2RPQ A;  5DCN A;  1KLV A;  1UH6 A;  3L0W B;  1WX8 A;  2N9P C;  4PS8 A;  3PRM B;  2WX0 A;  2LVP A;  3KUZ A;  3JW0 X;  4BVU C;  1WJ4 A;  2K1F A;  4W9I A;  4ZDV A;  2RD0 A;  2EMS A;  1KOT A;  1WXM A;  2IO1 B;  2YLM A;  3QWZ B;  2KK8 A;  4E71 A;  2G45 B;  1WMH A;  3D32 A;  2L0F A;  3KYD D;  1P0R A;  4MGI E;  2BKF A;  1E7U A;  2JPH A;  3V6C B;  2BKR B;  4MEM A;  4CO7 A;  3DVG Y;  3KYC D;  1H8C A;  2GBM A;  4HK2 A;  3TJP A;  4RMA A;  2GBJ A;  2FCS A;  2KXJ A;  2IYD B;  2UWQ A;  1P1A A;  2GMI C;  4KV2 A;  3W1S A;  4JGH B;  4W9J A;  2Z0E B;  4IWQ A;  4NAW B;  2LVQ A;  1F9J A;  2M1M A;  3K9P B;  3VUX A;  3B08 A;  2KWV B;  4F1S A;  1GC7 A;  1C3T A;  1RRB A;  2KTF A;  5DPW A;  2KFK A;  1E8Z A;  1EF5 A;  1D3Z A;  3MTN B;  2B3A A;  2ZZP B;  3QAR A;  4MSM B;  4W9D A;  2JZZ A;  2WWZ A;  2N7E A;  4K81 A;  2MBB B;  3JSV A;  2KJH B;  3PV1 A;  2KWC A;  4LCD E;  4BBN C;  1R4N I;  2G4S A;  2IZV B;  2CR5 A;  2FID A;  2LVO A;  2DZI A;  4KIK A;  3U7D A;  4FLH A;  3DVN V;  4IWO A;  2NS5 A;  5AZF A;  3ZTC A;  3L08 A;  2IO0 B;  2FAZ A;  4NQK E;  3NY5 A;  2MQJ A;  1PQS A;  1WGD A;  4BKG A;  1EUV B;  2MSE D;  2AYO B;  4EZJ A;  3DDC B;  1Y8R C;  4KSK C;  3A1Q B;  2IY1 B;  1WGY A;  3N30 A;  3SD5 A;  4URK A;  1IP9 A;  1Z5S B;  4MJS B;  1Q5W B;  4FHJ A;  4XC2 A;  1SGH A;  2QHO A;  2AEH A;  3DPD A;  1GJZ A;  2C9W B;  5DPT A;  4PS7 A;  2KDE B;  3OJ4 B;  3WAO A;  4TUU A;  3DBR I;  3ZNI D;  2KTR B;  3V62 A;  2AWT A;  2L8J A;  4LDT D;  2KD0 A;  2LRU A;  2FCN A;  3IBE A;  2N1W A;  5DPS A;  1E7V A;  2BYE A;  1OQY A;  2PPH A;  3N32 A;  2L7R A;  2MLB A;  4W9F A;  3ZTD A;  2K6Q A;  2D11 A;  4GDK B;  1OGW A;  3A4R A;  2LAS A;  3PS6 A;  4HPM B;  2KO3 A;  2CS4 A;  2O6V B;  3M95 A;  2KMA A;  4AUQ C;  2LXC A;  2DEN B;  2XK5 A;  4WJO A;  3PRE A;  2UYZ B;  3MJW A;  4ANV A;  2WX1 A;  1WY8 A;  3VAW A;  4PYU A;  2KX3 A;  1FXT B;  2LGY A;  2ZVO A;  3A33 B;  4M0W B;  3VQI A;  1SE9 A;  4YL8 A;  3UGB B;  5J17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...