3KYDD

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kydD00
4BKSD 3OAWA 4I6LB 2GMIC 3VDZA 2KDEB 4CHKA 1MG8A 2KLGA 3IBEA 3R66C 1UBQA 2KKCA 2KANA 2Z59B 3H6NA 3PRPB 4GDKB 3VVWB 4CYEA 2KDIA 2KLCA 2JZ3B 2BKRB 2HD5B 2IYDB 3VAWA 2MW5A 1WZ0A 1NDDA 3QJZA 1NI2A 1JRUA 4II2B 4KIKA 3UGBB 4AJYB 3QWZB 2N1VA 1WJNA 4FJYA 4KIKB 1WE6A 3APFA 2IZVB 2O6VB 4W9JA 3HK0A 2AEHA 4P7IA 2KFJA 1RRBA 3EC8A 2CHWA 2ZCBA 4G0NB 4NAWA 4WWOA 3OJ3A 3ZIMA 1KLVA 2KX0A 1UZXB 1VD2A 2LVOA 4IC7B 1L7YA 4GU2A 1S3SG 3CMMB 4EZLA 5AEKB 3UQAA 1LM8B 2M1MA 2M4NA 3JSVA 3QIJA 4MM3A 2KVRA 3UF8A 2FAZA 1WX9A 2IO0B 3AI5A 1IYFA 2RD0A 2JXXA 2NPTA 2L3ZA 4B95A 2BGFA 3PREA 1WJUA 2IY1B 2DX5B 2JVCA 2LGYA 3VQIA 1WGDA 2GOWA 1WZ3A 5G55A 3ZTDA 4MGZE 2LI5A 2ZNVB 1V9JA 3JYUA 3KW5B 4NAWB 2K6DB 1RAXA 4FA6A 1E5WA 3ZO5B 1H8CA 5DCNA 1YJ1A 3H7PB 1YQBA 3V61A 2D07B 2MSED 2N7EA 3W1SA 4E74A 4IM3A 1HE8A 2MLBA 3A1QB 4JLCA 4OVUA 3QK0A 2KZRA 2PE9A 2MA9B 3PHXB 3PRMB 1RFAA 2DZKA 5G2NA 4FHJA 2MBHA 1X1MA 1UBIA 2W9NA 2C60A 2MP2B 3EFUA 3HIZA 3DOWA 3QC8B 2XK5A 4W9GA 3GZNI 1EO6A 1V2YA 2EKEC 3NHEB 4W9KA 2PPHA 1E8ZA 1NBFC 3OLMD 4MGYE 5CHVC 3TMPB 2Y5BB 3QAQA 1E8YA 1WX7A 3R7QA 3ZDMC 1LQBA 4PS8A 3UIOB 3GOEA 1P1AA 1E7VA 3QA8A 3PS6A 4ZYNA 1SE9A 4FULA 4EZJA 4YL8A 3VUYA 2D11A 2N9EB 2DZIA 2KHWB 3ECIA 3B1LX 3WALA 4AP4C 4A3PA 3H1UA 4ICVA 4GOCA 2O6VD 4NY0A 1U4AA 4HDQA 2R2QA 2N9XA 2K25A 4W9LA 3RULA 1WR6E 4TUUA 3I3TB 2QHOA 3NY5A 3RUIB 1P0RA 4W9FA 2ZCCA 2C7MB 2JY6A 2Z0DB 2YVCA 3DCGA 3TBLD 2FCNA 1J8CA 4ASWC 3PVLA 2I1JA 4MDKE 2LD9A 3ZRCA 5DPTA 1TGZB 2FUHB 2FCMA 2DAFA 2LASA 4DHZE 5JZEB 3UQBA 1T0YA 2KMCA 2I1KA 4IG7B 5KHOA 4BKSA 1H4RA 3KVFB 1R4NI 4IWQA 1TBEA 4NJ7A 3U8ZA 4AOFA 4I6NB 3AU4A 3L16A 3N3KB 3L54A 4FN2A 2FIFA 5CHWA 4HPMB 2M17A 2RR9A 2PEAA 4KDLB 1Q5WB 3M63B 3IFWB 4GGQA 3ZNGC 2CHZA 2LRWA 4KDIC 3VXWA 4PS3A 1K8RB 4BBNC 4HCNB 4I6PA 2DHZA 2FNJB 2MQJA 1WI0A 4EEWA 3ONSA 3A4RA 3MTNB 2WX0A 3SU8X 3VTVA 2GBNA 4NNJB 4ZRKA 2ZVOA 2CR5A 3KUZA 3ZW3A 3DBSA 1D3ZA 2C7NB 1OTRB 2KXJA 2MBQA 4M0WB 5J17A 5JH5C 3WAPA 4K7WA 4AWJA 3QX1A 4IW0A 4HK2A 4B9KA 2IO1B 3SDLC 2PJHA 4TV3A 3WAOA 3V6CB 1Q1OA 1C3TA 4HLEA 4KSLC 2KDFB 2Z0EB 3TL5A 2KOXA 3W1YA 2N7DA 4HDOA 4DDID 4HXDA 4WWPA 2V3SA 4KZCA 1WFYA 5J18A 4DK5A 3VTUA 4EKUA 4X57B 1WGYA 4HCPB 3AXCA 4CO7A 4BBNF 1YIWA 2B3AA 4BFRA 2NBWB 3MJWA 4KVGB 2KQSA 1WX8A 4JGHB 4GMVA 4ICUA 3B0AA 3PT2B 4RM8A 3T8MA 1YD8U 4B6WA 2IO3B 1A5RA 4TKNA 1P98A 1V80A 3AU5A 3CF6E 3TIXA 2G3QB 5LXIB 2JRIB 4G50A 4XZ4A 4ANVA 3PZDA 2EMTA 3BINA 2KWUB 3HM6X 3KUDB 4M8NA 3ZTCA 1ZGUB 2KN5A 3KH0A 1WM3A 3RZWC 1VCBA 3ZRFA 3NZUA 1GC6A 4II3B 3LDZE 1WXVA 2WWZA 3NOBA 3U7DA 2MBBB 1R4MI 4ANUA 2C9WB 3DBLI 4GN1A 5CX3A 2CKHB 5E6PA 1I35A 3PTFC 2D2QA 2GBRA 1GUAB 2IO2B 4MGIE 1OQYA 3ZNZB 2NS5A 2UWQA 4WJPA 3DBRI 4ANWA 3ZLZA 2MBEA 2MWSB 1AARA 3U30A 4HPLB 1ZW7A 4WAAA 2R2OA 4MJSB 2CHXA 2LUEA 4LJOB 3ZNHB 1Y8RC 3JVZX 1V5OA 5BO4B 4DBGA 4G3XB 3L10B 3SD5A 3VH3B 4FHKA 4M8MA 1RLFA 1WE7A 4GB9A 2K8CA 3APCA 2VRRB 3D32A 2ZEQA 1EUVB 1C1YB 3DVNV 3DPDA 4AJWA 2HE7A 4WWNA 3VTWA 2LVQA 5L95C 3NS8A 2KO3A 2KC1A 3ALBA 1V86A 2ZVNA 3IVFA 3DVGX 4RMAA 5C23A 3H7SA 4BKTA 4ZRJA 4GSWA 1OEYJ 1P9DU 2LWPA 4GIVA 4BVUC 1G6JA 1UD7A 1F9JA 2CU1A 3DQVA 3PLVA 2KFKB 2JF5A 4XX5A 5LXHA 4E71A 3H7PA 2JZZA 2K6QA 3PPAA 3VUWA 4EUTA 2JWZA 4DXAB 4LJPB 2BYFA 2ASQA 3TCAA 2KK8A 4LCDE 1WXMA 5FR6A 3L17A 1WIAA 1WGRA 2LXCA 1EF5A 3A4SC 1TTNA 2DAJA 3ML9A 2L00B 3R3MA 4E3CA 1SIFA 2KMAA 3JW0X 1ZKHA 3VHTC 3P2BA 2DZMA 1P3QU 1WJ6A 4N9F4 1GNUA 4KSKC 4NPNA 1UELA 5LLIA 2J7QB 1QZEA 3K9OB 2BF8B 2XK5B 4TQ0A 4K1RB 4JQWC 2KJ6A 4MJSA 5E6OA 4EFOA 2KNBA 1I42A 2DYMA 4EOYA 1J0GA 1UH6A 2FCQA 2L7RA 1WR1A 2MP2A 2NVUI 4MEMA 3C0RB 5DPRA 4XC2A 3WAMA 4F1SA 1WM2A 2AL6A 3ML8A 1FXTB 3T9LA 3QARA 4IWOA 3UINB 4WJQA 1WXAA 3DVNU 3IG3A 2GBMA 1V81A 2UYZB 1OGWA 4F8CB 3PHWB 2LGDA 4W9IA 3DDCB 2RPQA 3ZNID 3OJ4B 4DWFA 1S1QB 2FCSA 3LJ3A 2ZNVC 2LRUA 4AUQC 3W1SC 5L83A 1WGHA 1E8WA 5J2RA 2LGXA 2ZZPB 2JPHA 3ENEA 4RM9A 1LXDA 4W9DA 3L08A 4MELA 3PGEA 3KYDD 2NPTB 4JL9A 4MSQB 2ZJDA 3ZDTA 4EZKA 3N32A 3QCAA 4NJ6A 2AWTA 4WJOA 2G4SA 2DENB 1E7UA 2IBIB 1YX5B 2KFKA 2OOBB 4KV2A 2IY0B 2DYBA 5AZFA 3V62A 4TQ1A 5JHAA 3S2AA 4ZDVA 3M62B 3RD2A 2NBVB 1WGGA 2LXAA 1TZ1A 3A9JA 3RT3B 1LFDA 2KD0A 2L8JA 4DDGD 3Q3JA 2WYQA 4ANXA 4KZ0A 5D6JB 2NCNA 1V49A 3SHQA 3PRZA 1XQQA 2BWES 2LJ5A 1M94A 2A5UA 4HWIB 1Q0WB 4FBJB 4K81A 2N4FA 2LVPA 1WMHB 3UIPB 2K8BA 5AZGA 2KJRA 2V1YA 3VH4B 3A33B 3CSFA 3A1QA 1E8XA 2J0MA 4MH0E 5CTRC 2KWVB 3N30A 2OJRA 1WRDB 1ISNA 1YX6B 2BYEA 4PYUA 2D3GA 4W9CA 4A3OA 2D10A 2M0XA 4DHJD 1SGHA 2JUOA 4JIOU 1V6EA 2ZPYA 3X23A 2NR2A 5KHQA 1GJZA 2BYVE 1CMXB 1XD3B 4WQOB 1Z5SB 1WMHA 3VFKA 3ZKJC 3DVGY 2EMSA 2BKFA 3VUXA 4LDTB 4A20A 5IAAC 3RCZA 3WIMA 2KJHB 3Q3FA 3MHSD 4ZRIA 2G4DB 2N1WA 2JRHA 2O6VA 3BY4B 2KWCA 3TJPA 4BOSC 2KTRA 1GC7A 2L05A 3QQ8B 1Z2MA 4DHZB 2NBUA 2RGFA 4PYZA 5C1ZA 2WDTB 3M3JA 2J0JA 4HVBA 3APDA 3QHTA 2KQ7A 2WX1A 1GG3A 2A4ZA 5JHBA 2K39A 2MBOA 3B08A 4FJZA 4GXBA 3R7RA 3A9JB 3A9KA 5CHFA 3WANA 2O2VB 3RZFA 2MCNB 1WF9A 4PS7A 4URKA 3A9KB 3DBHI 4IWPA 1WYWB 2KX3A 3KYCD 2FIDA 3KUCB 2K8HA 5AZHA 2G45B 4GDLB 3PLUA 2V4LA 2K1FA 5DPWA 4FADA 2HJ8A 5GMVA 1OEYA 2AYOB 2KDBA 2L0TA 5D2MB 4HJKA 4IM0A 4NQKE 5EDSA 1WJ4A 4GDLA 1IP9A 1E90A 1KM7A 2KTFA 4G11A 4GDKA 2MRPA 3AULA 4FLHA 5IA7A 4K7UA 3H9DA 3WA0A 2C5LC 4J6IA 4BKGA 2BWFA 1J19A 3JSVB 4F7ZA 4MSMB 3O65B 4LDTD 3K9PB 2KC2A 4W9HA 1KJTA 2O2VA 1PQSA 2MX2A 3L13A 3PV1A 4IUMB 4MGKE 3HM3A 2DYOA 5D7GA 3ZUNA 3PSEB 3EECA 2L0FA 5HKHA 2M8SA 5D94A 2DZJA 2AL3A 4BOZB 2RSUA 1BT0A 4FJVB 1EF1A 2C7HA 3ZVVA 4OVVA 3RYTA 1WY8A 2REXA 3NZSA 1L2NA 1V5TA 3M95A 1KOTA 2KTRB 5DPSA 2CS4A 2XEWA 3L0WB 1IPGA 2HTHA 2YLMA 1WXSA 2J0KA 3EHVA 4W9EA 3V60A 2ZPNA 3V6EB 2GBJA 3HHMA 2PE6B 4IM2A 2N9PC 2XBBC 5TR5A 3IHPC 4K7SA 2GBKA 3CSTA 4NQLB 2L76A 4WJNA 4DHJB 5E6NA 3X0WA 2JT4B 1UGMA 2LZ6A 1XT9B 1WH3A 2BPSA
chains in the Genus database with same CATH superfamily
1MG4A 2KDEB 3IBEA 1UBQA 2Z59B 1FPYA 3AN1A 2KACA 1QOFA 3V05A 3VVWB 4CYEA 2BKRB 1FO4A 3VAWA 5LNK1 3URYA 3W2DA 2IZVB 4RH6A 1DYQA 2RPVA 1D5ZC 3QIJA 2WXKA 3Q2AC 2KVRA 4WWMA 3MC9A 2IGDA 1WX9A 2FBWB 1V1OA 3FKYA 3FAHA 4RNAA 2ICIA 1TJEA 4B95A 2BGFA 2INDC 4HJGE 2GOWA 1QOBA 4C80A 4NAMA 4JWUC 5G55A 1V9JA 1WYGA 3Q3OC 1I4QA 1GB1A 1YJ1A 3V61A 4E74A 1C4CA 1L0YB 4FHJA 2MBHA 4NAWB 1UBIA 2W9NA 3HIZA 3GZNI 1D6EC 1V2YA 2EKEC 4W9KA 1NBFC 4MGYE 3VR8B 4RF0A 2H88B 2M0AA 3R7QA 1LQBA 3GOEA 1K53A 2LGSA 1SE9A 1YQ4B 4EZJA 4YL8A 3VUYA 2D11A 2N9EB 3TSSA 4AP4C 1E6EB 2OJWA 3NRZA 2O6VD 4NY0A 4HDQA 2K25A 2NTSA 2K9XA 3LB8C 1E10A 1N6ZA 1P0RA 1SE4A 4YT0B 2FCNA 1J8CA 4ASWC 4MDKE 1T0QC 1A70A 4P6VF 2LASA 2DAFA 4DHZE 4OVZA 1H4RA 1GOZA 3NS1A 1TBEA 4AOFA 1Y56A 4I6NB 2RR9A 3U2SC 1EWCA 3IFWB 4GGQA 1NVID 2KMMA 4BBNC 4HCNB 4I6PA 2DHZA 3FC4A 3ONSA 2WX0A 4NNJB 1D3ZA 3ZW3A 3NUHB 1OTRB 2KXJA 3WAPA 4K7WA 4AWJA 4B9KA 2DWQA 3P4RB 2IO1B 3SDLC 2PJHA 4TV3A 3PZ8A 4KSLC 4C7ZA 1LO5D 1L0XB 4DDID 2WXGA 1EWYC 3RNCC 1YQ3B 4X57B 2PIAA 4CO7A 2Y5CA 2KQSA 2MEKA 4JGHB 4RM8A 4B6WA 1TS4A 5FR3A 1V80A 5LXIB 3CF6E 1TS5A 4ANVA 3BINA 3AE9B 4A6QA 1OQQA 3RZWC 3NZUA 1GC6A 1R4MI 3C8YA 3DBLI 4GN1A 1D5XC 3BYTB 3I9V1 4ZOHC 4MGIE 2NS5A 2UWQA 2WDRB 3AEEB 4HPLB 2WXLA 2LUEA 4LLGM 5T8IA 4G3XB 3SD5A 4GB9A 3D32A 4OZAA 5GXGB 3NS8A 2KC1A 5C23A 2ZVNA 1CK1A 3H7SA 4BVUC 4GIVA 1UD7A 5H92C 4XX5A 3EGRA 3H7PA 4EUTA 3VUWA 3ZXRA 1XXGA 4DXAB 4KKIA 2BYFA 2ASQA 1V1PA 1UWXA 2LXCA 3A4SC 2DAJA 3ML9A 3DHGC 1PGXA 3JW0X 1JALA 5LLIA 2J7QB 1QZEA 2XK5B 1L6UA 4EFOA 4NZLB 1I42A 4EOYA 4MEMA 2FCQA 2L1AA 1WM2A 1OQRA 3ML8A 3T9LA 3UINB 2BS2B 2GBMA 4UDUC 1V81A 1OGWA 4C4VB 4L1BA 4DXFA 3LJ3A 2DNFA 1I4RA 1E8WA 5J2RA 4P1BC 2JPHA 3AH7A 2RDGA 1RWSA 4MELA 3PGEA 4EZKA 5TSSA 2AWTA 1VZ7A 4WJOA 1YX5B 1C9FA 1C76A 4ZDVA 3DWGC 3M62B 1SE3A 2NBVB 1TZ1A 4WIPA 3A9JA 2BVCA 2Q5WD 3Q3JA 1FFVA 2WYQA 1SXTA 2ZW0A 1HXYD 1V49A 3SHQA 2BWES 4YSXB 4HWIB 3ZJVA 5IOIA 3HUIA 1KTKA 2MJEA 4K81A 3UIPB 3GE3C 2K8BA 4CQNA 2KJRA 4MH0E 1SBBB 4PYUA 4P1CC 2M0XA 1SGHA 1FEHA 2NR2A 1GJZA 1F77A 2H89B 2BYVE 1XD3B 4C56C 2JQRB 3VFKA 3RMKC 1ZXIA 2BKFA 4LDTB 3RCZA 5IKCM 3WIMA 2KAJA 3MHSD 4QAYA 2WDVB 5EE0A 1GC7A 1V8CA 3RN9C 2KQ7A 2W3RA 2K39A 2O2VB 2MCNB 3AE3B 2KX3A 1WRIA 3KYCD 1YJJA 2V4LA 4FADA 1OEYA 2PW9A 2INPE 5D2MB 4IM0A 2WXHA 5EDSA 4GDLA 2KTFA 1ET6A 3E56A 3HRDD 2JZPA 2WXNA 3BK2A 5IO9A 3H9DA 2C5LC 2BWFA 4LDTD 3ETRA 3L13A 4IUMB 2XN9C 1MPEA 3EECA 1I4HA 1KF6B 2DZJA 2RSUA 2C7HA 5BYSA 4OW0A 5DPSA 1IPGA 3BVGA 3MJ5A 3V6EB 1GAQB 2GBJA 4XGAB 4NQLB 4K7SA 3O13A 2L76A 3L4PA 1KH0A 2BPSA 4I6LB 1JRPA 3R66C 2KLGA 3GZNB 2PTLA 2KKCA 2KANA 2GI9A 4Q2JA 4GDKB 2KLCA 2QDFA 4D2KA 5EE1A 4AJYB 1FMAD 4N59A 2N1VA 1WJNA 4FJYA 1WE6A 1JWSD 2O6VB 3Q14C 3HK0A 4P7IA 1ZOYB 1DOIA 2G1EA 3P42A 4G0NB 4WWOA 3OJ3A 2BB6A 3ZIMA 1KLVA 1VD2A 3T3OA 1L7YA 1TKYA 3UQAA 2M1MA 2BTEA 2M4NA 1T3QA 4YTMB 2IO0B 1IGDA 2JXXA 5C3JB 2JVCA 3VQIA 3U52E 5FKAC 2QC8A 5H8YE 4MGZE 2ZNVB 2K6DB 4FA6A 1E5WA 3P63A 3H7PB 1YQBA 1JWMD 4RGTA 1X1MA 2MP2B 3QC8B 3DOWA 2XK5A 2PPHA 1QQRA 3QAQA 1WX7A 1VRAB 2BW2A 2D3CA 1GB4A 4PS8A 3UIOB 3RNGC 3QA8A 1E7VA 1E7PB 4XDDA 1XLOA 2MJDA 2DZIA 1JWBD 3B1LX 3AE5B 1SEBD 3MC0B 4OZCA 2R2QA 5HG2A 3RULA 3I3TB 2HDEA 3NY5A 3RUIB 2C7MB 2JY6A 2Z0DB 1C79A 3DCGA 4KKJA 1VZ6A 2I1JA 2FUHB 3R2IA 3HVZA 4BZAA 2J42A 3DBLB 3KVFB 4IWQA 4NJ7A 3U8ZA 1I4XA 3L54A 4HPMB 2M17A 3RNAC 2PEAA 1Q5WB 4HRSA 1SSNA 3U7ZA 3ZNGC 1T5XD 4PS3A 2NMQA 2E3TA 2MQJA 2LJIA 2M56B 4ARCA 3SU8X 2GBNA 4ZRKA 2CR5A 2MBQA 3P4SB 3NVWA 4XDCA 4YWGG 4HEA1 3OG5A 3I5JC 3GP7A 2I2YA 1AYFA 3W1YA 4HDOA 4YTNB 3ABVB 3RNFC 4WWPA 1C4PA 1WFYA 1ZP0B 3SEBA 1WGYA 3KWVA 4DXGA 1R7SA 3AM9A 4KVGB 4IKGA 4ICUA 2LHDA 3B0AA 3PT2B 2WLBA 4TKNA 1P98A 3TIXA 2G3QB 2JRIB 3KUDB 4FXCA 2PVGC 4ZHPA 2KQ4X 4RF1A 1UNSA 2QCZA 4IOIE 3TUOA 1WM3A 3B2GA 1VCBA 4HROA 4II3B 3NOBA 3U7DA 2MBBB 2WXIA 3AMZA 4ANUA 3NG0A 5CX3A 1ZXHA 5E6PA 2VH2A 3PTFC 2D2QA 2GBRA 4JE3B 3ZNZB 2TSSA 2K22A 3DBRI 3ZLZA 1E0ZA 2MWSB 3NZ3A 4RGNA 2R2OA 1V5OA 5BO4B 2JYEA 1UGJA 1YN4A 2K8CA 3APCA 3IT6B 2VRRB 2ZEQA 3DVNV 3DPDA 4AJWA 5AUKA 4WWNA 3VTWA 5L95C 2KO3A 3IVFA 1V86A 2DBYA 1ESFA 1V1PB 2SEBD 3W5VB 2VZKB 1P9DU 1G6JA 2CU1A 4M01A 3DQVA 2WHIA 1IBXB 1HEZE 5LXHA 1TS3A 4E71A 2K6QA 3T3NA 3I63C 1GPXA 5BMHA 3AV8A 1TYGB 2KK8A 2WXFA 5FR6A 3L17A 3TEYA 1WIAA 1EF5A 1TTNA 4E3CA 2L00B 2KMAA 2QIEB 3VHTC 2W82A 3P2BA 1P3QU 1WJ6A 3I57A 4K3CA 1FXAA 4NPNA 1WSPA 4JQWC 1J0GA 2L7RA 3J9CA 5DPRA 1FXTB 3GE8C 2V3PA 3IG3A 2UYZB 4F8CB 1VJKA 3P1MA 3Q8EA 2LGDA 1AWDA 2FCSA 1V97A 1FNUA 2GB1A 2X38A 4YSZB 4XYCA 3SR6A 2NPTB 4ZRQA 2ZJDA 3ZDTA 3N32A 2IBIB 1IBXA 2OOBB 4KV2A 2IY0B 2DYBA 5AZFA 3V62A 1L4DB 5JHAA 2R61A 3AEGB 1N60A 1WGGA 2LXAA 1JWAD 2KD0A 4J3OD 2LEKA 1OFFA 2EKIA 2NCNA 1FCCC 1K50A 2WXOA 5IP4D 3LXFA 3Q69A 1Q0WB 2AX5A 2V3NA 4LNIA 2V1YA 3VH4B 3A33B 3CSFA 5CTRC 2J0MA 2KN4A 2KWVB 3N30A 1ISNA 1YX6B 2BYEA 1L4ZB 4A3OA 2PLPA 2D10A 3X23A 1V6EA 2W55A 1FIQA 3PZ7A 1CMXB 3DVGY 2EMSA 3VUXA 2G4DB 2O6VA 2KTRA 2L05A 4KX6B 4A90A 2RGFA 5C1ZA 4N58A 4HVBA 3APDA 3U4EG 2WX1A 3BVZA 1FNWA 4C4VA 1PUTA 3A9KA 1PDXA 4PS7A 2BQQA 3LYYA 1F1HA 3A9KB 3PO0A 1KLGD 3DBHI 4HPPA 1QKZA 5AZHA 4GDLB 4IDIA 1FRDA 2K1FA 4LNFA 2NTTA 4WURA 5DPWA 3IT4B 2PKOA 2KDBA 4HJKA 3W5UB 3WA0A 4BKGA 2KC2A 3SFEB 3BK1A 4W9HA 1PQSA 3PV1A 2DYOA 2UU7A 2M8SA 5D94A 2B76B 2AL3A 4A55A 4FJVB 1WY8A 1KOTA 2KTRB 2WGSA 5I4DA 4ITKA 3EHVA 3BYYB 5FK9C 3ZYYX 2PE6B 2N9PC 2INNE 2XBBC 1D4BA 5E6NA 3X0WA 2JT4B 3GB1A 1XT9B 4BKSD 1C4AA 2GMIC 2GRIA 4CHKA 1MG8A 3DHIC 3H6NA 1HZ6A 3PRPB 1YJIA 1QILA 3ZJTA 4RGMA 1F2RC 2IYDB 5IN7A 2MW5A 2QSDA 4II2B 3H8HA 1JRUA 3AEAB 3N20C 1QOAA 1HZ5A 3EFCA 1QF6A 2AEHA 3EC8A 2ZCBA 5BYRA 2IGGA 1PGAA 1UZXB 2LVOA 4XWWA 4IC7B 2M19A 3CMMB 4EZLA 3Q6BA 5AEKB 4WH4A 3UF8A 2FAZA 4L23A 3AI5A 1IYFA 3AE6B 2RD0A 2L3ZA 3PREA 4WAFA 2AQ2B 1P7FA 2DX5B 4XWTA 3JYUA 3KW5B 4RCOA 1B1ZA 2W54A 4REZA 2WU5B 2IJ0A 2D07B 2MSED 3W1SA 4IM3A 1HE8A 3A1QB 2LHEA 4JLCA 4OVUA 3TEWA 2ON8A 3QK0A 2KZRA 3N1YC 3PRMB 2DZKA 4US8A 3EFUA 2C60A 1M4VA 1EO6A 4TSSA 3NHEB 1E8ZA 2N9KA 5JXVA 5CHVC 3TMPB 1QLBB 2Y5BB 1T0SC 2ZW1A 3ZDMC 1P1AA 4ZYNA 2WXJA 3NVZA 1L5PA 2KHWB 3ECIA 1KLUD 4A3PA 1SE2A 4GOCA 2IGHA 5C2TB 2XNAC 2N9XA 4W9LA 1WR6E 3B2FA 2ZCCA 3DBHB 2YVCA 3TBLD 1NYQA 3PVLA 1VDVA 4H2AA 1ZE3D 2LD9A 5DPTA 4K3BA 1P7EA 3UQBA 5JZEB 2KMCA 4IG7B 3BZDB 4BKSA 1XEEA 3CIRB 3V3XA 3AU4A 3L16A 3N3KB 1EU4A 3Q8CA 4FN2A 2FIFA 5CHWA 3IAM1 3M63B 4ZHOA 4L2YA 4KDIC 3VXWA 1K8RB 3EUB2 2Y3AA 1PYWD 2EELA 2FNJB 4S17A 1XCTL 3NVVA 3VTVA 3KUZA 3DBSA 5J17A 5JH5C 3QX1A 4IW0A 2LFIA 1Q1OA 3VR9B 1C3TA 1JQ4A 5AUIA 3TL5A 3AE1B 4C7YA 3AEBB 4KZCA 5J18A 4HCPB 3AXCA 4PK1A 2B3AA 5D3IB 4BFRA 3MJWA 2KYWA 1WX8A 4GMVA 1R4MB 3T8MA 4HKQA 2IO3B 1VR9A 4G50A 4XZ4A 3PZDA 2EMTA 4M8NA 2KWUB 3HM6X 3ZTCA 1ZGUB 2KN5A 2WXMA 3P4QB 3TEXA 4B0EA 3ZRFA 3LDZE 4WQMA 2C9WB 1R4NB 3C19A 2SAKA 1CZPA 1NI3A 2IO2B 4KGRA 1JWUD 1OQYA 4ANWA 1AARA 3U30A 1ZW7A 2JU6X 4WAAA 2CHXA 2J4XA 4LJOB 3JVZX 2LGIA 4JX1C 4FHKA 4A8XC 3MC8A 2LVQA 1N63A 3RD2A 3DVGX 4BKTA 4GSWA 1OEYJ 2LWPA 3KQ4A 1F9JA 3PLVA 2KFKB 2K0PA 2JZZA 3PPAA 3TCAA 4LCDE 1WXMA 1TY0A 1WGRA 2KWDA 1SIFA 2KT7A 3MHZA 3BIID 1ZKHA 3DBRB 4LNKA 2DZMA 2Z8LA 4KSKC 1UELA 3K9OB 4TQ0A 2QJLA 4K1RB 4MJSA 5E6OA 2KNBA 2DYMA 4F1SA 3WAMA 3QARA 5HHDG 1WXAA 4GLSC 4YSYB 2RDHA 3PHWB 4W9IA 2PVOD 3OJ4B 4DWFA 2RMMA 3W1SC 3ENEA 1MHXA 1J7BA 4W9DA 2V4IB 1BMLC 4JL9A 4MSQB 4NJ6A 4O1NA 1JMLA 1SIJA 1SJHD 2G4SA 2DENB 2KFKA 1ROEA 3DHHC 1FXIA 4TQ1A 2K5PA 1T0RC 1N61A 3RT3B 1LFDA 4LK0M 4DDGD 1ACCA 4KZ0A 1XQQA 1ZPSA 2WXRA 2LJ5A 3Q8FA 1EU3A 2HJ1A 4FBJB 1JROA 2LVPA 3AE2B 1F0ZA 4LNNA 1XLQA 3A1QA 1E8XA 1E9MA 2BT6A 2OJRA 1WRDB 2D3GA 2IPKD 4DHJD 2WP9B 2ZPYA 5KHQA 1Z5SB 1WMHA 3ZKJC 1TKGA 3SFDB 4MH8A 4ZRIA 2N1WA 4BOSC 3BY4B 2KWCA 2FUG1 2L32A 3QQ8B 1Z2MA 4DHZB 2NBUA 1YNTE 1J7CA 2WDTB 3M3JA 2J0JA 3QHTA 3RFZB 1GG3A 2MH7A 3R7RA 1YOVB 3A9JB 5CHFA 1MFWA 4URKA 1I4GA 4IWPA 1N5XA 1WYWB 1XF5L 2QMTA 3UI3A 1ZUD2 2OHFA 4RFBA 2K8HA 4PT5A 3FILB 2G45B 3AB5A 3GS2A 2YEPF 4NJCA 2HJ8A 2L0TA 4NQKE 4G11A 2ONQA 1UWMA 2MRPA 2OEDA 4FLHA 5D3DA 5IA7A 1NYRA 4K7UA 4J6IA 1J19A 1N62A 2AQ3B 3JSVB 3AE4B 3O65B 3K9PB 1KJTA 2MX2A 2J53A 3HM3A 5D7GA 3ZUNA 3PSEB 2L0FA 4BOZB 1BT0A 2CU3A 1LGRA 1V5TA 2CS4A 3NJTA 3L0WB 2HTHA 2Y5PA 2YLMA 1WXSA 2J0KA 4MACA 4W9EA 5BMIA 2FE8A 2ZPNA 3AE7B 1NENB 3HHMA 4IM2A 2L83A 1K52A 2GBKA 3CSTA 4WJNA 2N0SB 1UGMA 1J7AA 1HA5A 1I4PA 3OAWA 3VDZA 4OZBA 1RYJA 4HKZE 2KDIA 2JZ3B 2HD5B 1DOXA 1WZ0A 3KLSX 1NDDA 3QJZA 1NI2A 1ZDVA 4KIKA 3UGBB 3QWZB 2ACZB 4KIKB 3APFA 1F52A 4USAA 4W9JA 1HTOA 1XCQL 2KFJA 1RRBA 3N9YC 3RPFC 2CHWA 2GLSA 4NAWA 2BS3B 2KX0A 2MJ3A 4LNOA 2WS3B 4GU2A 1S3SG 2WQYB 4P16A 1LM8B 3P4PB 3JSVA 4LTUA 5G5HA 4MM3A 1TIFA 2NPTA 1QT9A 2BB5A 1WJUA 2IY1B 2D3AA 2LGYA 1WGDA 1WZ3A 2WNMA 3ZTDA 2LI5A 1RAXA 3ZO5B 2BS4B 1H8CA 3AE8B 5DCNA 1FD6A 2KVZA 2N7EA 2MLBA 2X8XX 1B9RA 2PE9A 2MA9B 4OHJA 1KFYB 1RFAA 3PHXB 5G2NA 4W9GA 3OLMD 1YN3A 1STEA 1E8YA 3FILA 3PS6A 1TS2A 4FULA 3WALA 3H1UA 4ICVA 1U4AA 5EE3A 1Q10A 3AECB 4TUUA 2I38A 2QHOA 3AEFB 4W9FA 1SJED 1AN8A 5BMGA 5HFYA 2QILA 3ZRCA 1TGZB 1NEKB 2FCMA 1T0YA 2INCC 1JW9D 2I1KA 5KHOA 4JWSC 3CWIA 3VRAB 1R4NI 1TZOA 2BYTA 1UF0A 4KDLB 2CHZA 1HQRD 2LRWA 2N7JA 1C77A 4BAXA 1IUEA 1WI0A 4EEWA 1F2RI 3A4RA 3MTNB 5BYQA 2ZVOA 2JYTA 2C7NB 4M0WB 1RFKA 4HK2A 2D5GA 3WAOA 3V6CB 2LMCA 4HLEA 1EM7A 3Q8AA 2L52A 2KDFB 2Z0EB 2KOXA 4N6EB 3Q3MC 2G9HD 2N7DA 2YEPB 4HXDA 2V3SA 4DK5A 4R3DA 3VTUA 1WGKA 4EKUA 1UUPA 4BBNF 1YIWA 2PMVA 2NBWB 1YD8U 2V9HA 3Q3NC 1ET9A 1A5RA 1IGCA 3AU5A 4S0RA 1L6VA 1I7HA 1PFDA 3ZQ4A 3KH0A 1RM6C 3WCQA 2WXPA 1WXVA 2WWZA 3ZXVA 4KGSA 2CKHB 1I35A 1GUAB 3HVDA 4TMAB 4ACFA 4WJPA 1HTQA 2MBEA 2LUMA 4MJSB 2CJOA 3ZNHB 1Y8RC 2QEJC 2WDQB 4DBGA 1C78A 3L10B 3VH3B 4M8MA 1RLFA 1WE7A 1TT5B 1EUVB 1C1YB 2IDYA 2HE7A 3W9CB 1BUIC 3ALBA 4RMAA 2D3BA 2JXTA 4ZRJA 4XE0A 2JF5A 4MT5A 1FCLA 2JWZA 1SB3C 1SF0A 3AEDB 4LJPB 4B0MA 3B9JA 3ZJUA 5EE9A 2CJNA 2VZKD 3R3MA 4M0WA 1ZDXA 4N9F4 4A9AA 1GNUA 4JPSA 3R8BA 3NVYA 2BF8B 2KJ6A 2RDBC 1UH6A 2MP2A 3ZGZA 1WR1A 1FRRA 1YMHE 1XLNA 2NVUI 3C0RB 3N1ZC 4XC2A 2AL6A 1WWTA 4IWOA 2N9LA 4WJQA 1WXQA 3DVNU 3RNEC 2DLBA 3DDCB 2RPQA 3RI7C 3ZNID 1DOYA 1S1QB 2J52A 2ZNVC 2LRUA 4AUQC 5L83A 2V0GA 2E6XA 1WGHA 2LGXA 2ZZPB 1MJDA 4RM9A 1LXDA 3BWUD 3L08A 1QOGA 1CQVA 3KYDD 1FFUA 1N5WA 3QCAA 3N1XC 1FM0D 1E7UA 4MM3B 3S2AA 1BXTA 1MHHE 4AS1A 1PGBA 4YXDB 3Q8BA 3TEZA 2L8JA 2MHJA 1AW7A 4ANXA 5D6JB 3PRZA 3IAS1 3EA6A 1M94A 2A5UA 3R2TA 2W3SA 4ARIA 4YTPB 5HI1A 2N4FA 1WMHB 3RNBC 5AZGA 1XLPA 3E9SA 2JSVX 4W9CA 2KDMA 2JUOA 4JIOU 4M00A 4WQOB 2VH1A 5E6JA 4C00A 4A20A 2HTME 5IAAC 4AQ7A 2KJHB 3Q3FA 2JRHA 3TJPA 1CJEA 4ZRPA 4PYZA 1K51A 4DQOC 4US9A 1DGJA 2A4ZA 3DWMA 1KRHA 5JHBA 2MBOA 3B08A 4FJZA 3MP9A 3BVMA 4GXBA 3WANA 4ZYSA 2BBCA 1L0VB 1JCKB 3RZFA 1WF9A 4RGOS 1T6BX 1MI0A 4KGTA 2FIDA 3KUCB 3KWLA 3PLUA 1D5MC 2K3UA 5GMVA 2WXQA 2AYOB 1IP9A 1WJ4A 1E90A 1KM7A 4GDKA 3AULA 2AQ1B 3IXSA 4F7ZA 4MSMB 4EE2A 2JWUA 2JX5A 1VLBA 2O2VA 3OWEB 4MGKE 1TY2A 1MVKA 3MFGA 5HKHA 3VRBB 1EF1A 3ZVVA 4OVVA 3RYTA 2REXA 3NZSA 1L2NA 3M95A 2XEWA 2WU2B 1XO3A 1FNVA 1ENFA 1VZ8A 5G5GA 3V60A 4M02A 4DHJB 5TR5A 3IHPC 5MPOA 1TKEA 1YN5A 2LZ6A 1WH3A
chains in the Genus database with same CATH topology
4BKSD 3OAWA 4I6LB 2GMIC 3VDZA 2KDEB 4CHKA 1MG8A 2KLGA 3IBEA 3R66C 1UBQA 2KKCA 2KANA 2Z59B 3H6NA 3PRPB 4GDKB 3VVWB 4CYEA 2KDIA 2KLCA 2JZ3B 2BKRB 2HD5B 2IYDB 3VAWA 2MW5A 1WZ0A 1NDDA 3QJZA 1NI2A 1JRUA 4II2B 4KIKA 3UGBB 4AJYB 3QWZB 2N1VA 1WJNA 4FJYA 4KIKB 1WE6A 3APFA 2IZVB 2O6VB 4W9JA 3HK0A 2AEHA 4P7IA 2KFJA 1RRBA 3EC8A 2CHWA 2ZCBA 4G0NB 4NAWA 4WWOA 3OJ3A 3ZIMA 1KLVA 2KX0A 1UZXB 1VD2A 2LVOA 4IC7B 1L7YA 4GU2A 1S3SG 3CMMB 4EZLA 5AEKB 3UQAA 1LM8B 2M1MA 2M4NA 3JSVA 3QIJA 4MM3A 2KVRA 3UF8A 2FAZA 1WX9A 2IO0B 3AI5A 1IYFA 2RD0A 2JXXA 2NPTA 2L3ZA 4B95A 2BGFA 3PREA 1WJUA 2IY1B 2DX5B 2JVCA 2LGYA 3VQIA 1WGDA 2GOWA 1WZ3A 5G55A 3ZTDA 4MGZE 2LI5A 2ZNVB 1V9JA 3JYUA 3KW5B 4NAWB 2K6DB 1RAXA 4FA6A 1E5WA 3ZO5B 1H8CA 5DCNA 1YJ1A 3H7PB 1YQBA 3V61A 2D07B 2MSED 2N7EA 3W1SA 4E74A 4IM3A 1HE8A 2MLBA 3A1QB 4JLCA 4OVUA 3QK0A 2KZRA 2PE9A 2MA9B 3PHXB 3PRMB 1RFAA 2DZKA 5G2NA 4FHJA 2MBHA 1X1MA 1UBIA 2W9NA 2C60A 2MP2B 3EFUA 3HIZA 3DOWA 3QC8B 2XK5A 4W9GA 3GZNI 1EO6A 1V2YA 2EKEC 3NHEB 4W9KA 2PPHA 1E8ZA 1NBFC 3OLMD 4MGYE 5CHVC 3TMPB 2Y5BB 3QAQA 1E8YA 1WX7A 3R7QA 3ZDMC 1LQBA 4PS8A 3UIOB 3GOEA 1P1AA 1E7VA 3QA8A 3PS6A 4ZYNA 1SE9A 4FULA 4EZJA 4YL8A 3VUYA 2D11A 2N9EB 2DZIA 2KHWB 3ECIA 3B1LX 3WALA 4AP4C 4A3PA 3H1UA 4ICVA 4GOCA 2O6VD 4NY0A 1U4AA 4HDQA 2R2QA 2N9XA 2K25A 4W9LA 3RULA 1WR6E 4TUUA 3I3TB 2QHOA 3NY5A 3RUIB 1P0RA 4W9FA 2ZCCA 2C7MB 2JY6A 2Z0DB 2YVCA 3DCGA 3TBLD 2FCNA 1J8CA 4ASWC 3PVLA 2I1JA 4MDKE 2LD9A 3ZRCA 5DPTA 1TGZB 2FUHB 2FCMA 2DAFA 2LASA 4DHZE 5JZEB 3UQBA 1T0YA 2KMCA 2I1KA 4IG7B 5KHOA 4BKSA 1H4RA 3KVFB 1R4NI 4IWQA 1TBEA 4NJ7A 3U8ZA 4AOFA 4I6NB 3AU4A 3L16A 3N3KB 3L54A 4FN2A 2FIFA 5CHWA 4HPMB 2M17A 2RR9A 2PEAA 4KDLB 1Q5WB 3M63B 3IFWB 4GGQA 3ZNGC 2CHZA 2LRWA 4KDIC 3VXWA 4PS3A 1K8RB 4BBNC 4HCNB 4I6PA 2DHZA 2FNJB 2MQJA 1WI0A 4EEWA 3ONSA 3A4RA 3MTNB 2WX0A 3SU8X 3VTVA 2GBNA 4NNJB 4ZRKA 2ZVOA 2CR5A 3KUZA 3ZW3A 3DBSA 1D3ZA 2C7NB 1OTRB 2KXJA 2MBQA 4M0WB 5J17A 5JH5C 3WAPA 4K7WA 4AWJA 3QX1A 4IW0A 4HK2A 4B9KA 2IO1B 3SDLC 2PJHA 4TV3A 3WAOA 3V6CB 1Q1OA 1C3TA 4HLEA 4KSLC 2KDFB 2Z0EB 3TL5A 2KOXA 3W1YA 2N7DA 4HDOA 4DDID 4HXDA 4WWPA 2V3SA 4KZCA 1WFYA 5J18A 4DK5A 3VTUA 4EKUA 4X57B 1WGYA 4HCPB 3AXCA 4CO7A 4BBNF 1YIWA 2B3AA 4BFRA 2NBWB 3MJWA 4KVGB 2KQSA 1WX8A 4JGHB 4GMVA 4ICUA 3B0AA 3PT2B 4RM8A 3T8MA 1YD8U 4B6WA 2IO3B 1A5RA 4TKNA 1P98A 1V80A 3AU5A 3CF6E 3TIXA 2G3QB 5LXIB 2JRIB 4G50A 4XZ4A 4ANVA 3PZDA 2EMTA 3BINA 2KWUB 3HM6X 3KUDB 4M8NA 3ZTCA 1ZGUB 2KN5A 3KH0A 1WM3A 3RZWC 1VCBA 3ZRFA 3NZUA 1GC6A 4II3B 3LDZE 1WXVA 2WWZA 3NOBA 3U7DA 2MBBB 1R4MI 4ANUA 2C9WB 3DBLI 4GN1A 5CX3A 2CKHB 5E6PA 1I35A 3PTFC 2D2QA 2GBRA 1GUAB 2IO2B 4MGIE 1OQYA 3ZNZB 2NS5A 2UWQA 4WJPA 3DBRI 4ANWA 3ZLZA 2MBEA 2MWSB 1AARA 3U30A 4HPLB 1ZW7A 4WAAA 2R2OA 4MJSB 2CHXA 2LUEA 4LJOB 3ZNHB 1Y8RC 3JVZX 1V5OA 5BO4B 4DBGA 4G3XB 3L10B 3SD5A 3VH3B 4FHKA 4M8MA 1RLFA 1WE7A 4GB9A 2K8CA 3APCA 2VRRB 3D32A 2ZEQA 1EUVB 1C1YB 3DVNV 3DPDA 4AJWA 2HE7A 4WWNA 3VTWA 2LVQA 5L95C 3NS8A 2KO3A 2KC1A 3ALBA 1V86A 2ZVNA 3IVFA 3DVGX 4RMAA 5C23A 3H7SA 4BKTA 4ZRJA 4GSWA 1OEYJ 1P9DU 2LWPA 4GIVA 4BVUC 1G6JA 1UD7A 1F9JA 2CU1A 3DQVA 3PLVA 2KFKB 2JF5A 4XX5A 5LXHA 4E71A 3H7PA 2JZZA 2K6QA 3PPAA 3VUWA 4EUTA 2JWZA 4DXAB 4LJPB 2BYFA 2ASQA 3TCAA 2KK8A 4LCDE 1WXMA 5FR6A 3L17A 1WIAA 1WGRA 2LXCA 1EF5A 3A4SC 1TTNA 2DAJA 3ML9A 2L00B 3R3MA 4E3CA 1SIFA 2KMAA 3JW0X 1ZKHA 3VHTC 3P2BA 2DZMA 1P3QU 1WJ6A 4N9F4 1GNUA 4KSKC 4NPNA 1UELA 5LLIA 2J7QB 1QZEA 3K9OB 2BF8B 2XK5B 4TQ0A 4K1RB 4JQWC 2KJ6A 4MJSA 5E6OA 4EFOA 2KNBA 1I42A 2DYMA 4EOYA 1J0GA 1UH6A 2FCQA 2L7RA 1WR1A 2MP2A 2NVUI 4MEMA 3C0RB 5DPRA 4XC2A 3WAMA 4F1SA 1WM2A 2AL6A 3ML8A 1FXTB 3T9LA 3QARA 4IWOA 3UINB 4WJQA 1WXAA 3DVNU 3IG3A 2GBMA 1V81A 2UYZB 1OGWA 4F8CB 3PHWB 2LGDA 4W9IA 3DDCB 2RPQA 3ZNID 3OJ4B 4DWFA 1S1QB 2FCSA 3LJ3A 2ZNVC 2LRUA 4AUQC 3W1SC 5L83A 1WGHA 1E8WA 5J2RA 2LGXA 2ZZPB 2JPHA 3ENEA 4RM9A 1LXDA 4W9DA 3L08A 4MELA 3PGEA 3KYDD 2NPTB 4JL9A 4MSQB 2ZJDA 3ZDTA 4EZKA 3N32A 3QCAA 4NJ6A 2AWTA 4WJOA 2G4SA 2DENB 1E7UA 2IBIB 1YX5B 2KFKA 2OOBB 4KV2A 2IY0B 2DYBA 5AZFA 3V62A 4TQ1A 5JHAA 3S2AA 4ZDVA 3M62B 3RD2A 2NBVB 1WGGA 2LXAA 1TZ1A 3A9JA 3RT3B 1LFDA 2KD0A 2L8JA 4DDGD 3Q3JA 2WYQA 4ANXA 4KZ0A 5D6JB 2NCNA 1V49A 3SHQA 3PRZA 1XQQA 2BWES 2LJ5A 1M94A 2A5UA 4HWIB 1Q0WB 4FBJB 4K81A 2N4FA 2LVPA 1WMHB 3UIPB 2K8BA 5AZGA 2KJRA 2V1YA 3VH4B 3A33B 3CSFA 3A1QA 1E8XA 2J0MA 4MH0E 5CTRC 2KWVB 3N30A 2OJRA 1WRDB 1ISNA 1YX6B 2BYEA 4PYUA 2D3GA 4W9CA 4A3OA 2D10A 2M0XA 4DHJD 1SGHA 2JUOA 4JIOU 1V6EA 2ZPYA 3X23A 2NR2A 5KHQA 1GJZA 2BYVE 1CMXB 1XD3B 4WQOB 1Z5SB 1WMHA 3VFKA 3ZKJC 3DVGY 2EMSA 2BKFA 3VUXA 4LDTB 4A20A 5IAAC 3RCZA 3WIMA 2KJHB 3Q3FA 3MHSD 4ZRIA 2G4DB 2N1WA 2JRHA 2O6VA 3BY4B 2KWCA 3TJPA 4BOSC 2KTRA 1GC7A 2L05A 3QQ8B 1Z2MA 4DHZB 2NBUA 2RGFA 4PYZA 5C1ZA 2WDTB 3M3JA 2J0JA 4HVBA 3APDA 3QHTA 2KQ7A 2WX1A 1GG3A 2A4ZA 5JHBA 2K39A 2MBOA 3B08A 4FJZA 4GXBA 3R7RA 3A9JB 3A9KA 5CHFA 3WANA 2O2VB 3RZFA 2MCNB 1WF9A 4PS7A 4URKA 3A9KB 3DBHI 4IWPA 1WYWB 2KX3A 3KYCD 2FIDA 3KUCB 2K8HA 5AZHA 2G45B 4GDLB 3PLUA 2V4LA 2K1FA 5DPWA 4FADA 2HJ8A 5GMVA 1OEYA 2AYOB 2KDBA 2L0TA 5D2MB 4HJKA 4IM0A 4NQKE 5EDSA 1WJ4A 4GDLA 1IP9A 1E90A 1KM7A 2KTFA 4G11A 4GDKA 2MRPA 3AULA 4FLHA 5IA7A 4K7UA 3H9DA 3WA0A 2C5LC 4J6IA 4BKGA 2BWFA 1J19A 3JSVB 4F7ZA 4MSMB 3O65B 4LDTD 3K9PB 2KC2A 4W9HA 1KJTA 2O2VA 1PQSA 2MX2A 3L13A 3PV1A 4IUMB 4MGKE 3HM3A 2DYOA 5D7GA 3ZUNA 3PSEB 3EECA 2L0FA 5HKHA 2M8SA 5D94A 2DZJA 2AL3A 4BOZB 2RSUA 1BT0A 4FJVB 1EF1A 2C7HA 3ZVVA 4OVVA 3RYTA 1WY8A 2REXA 3NZSA 1L2NA 1V5TA 3M95A 1KOTA 2KTRB 5DPSA 2CS4A 2XEWA 3L0WB 1IPGA 2HTHA 2YLMA 1WXSA 2J0KA 3EHVA 4W9EA 3V60A 2ZPNA 3V6EB 2GBJA 3HHMA 2PE6B 4IM2A 2N9PC 2XBBC 5TR5A 3IHPC 4K7SA 2GBKA 3CSTA 4NQLB 2L76A 4WJNA 4DHJB 5E6NA 3X0WA 2JT4B 1UGMA 2LZ6A 1XT9B 1WH3A 2BPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BKS D;  3OAW A;  4I6L B;  2GMI C;  3VDZ A;  2KDE B;  4CHK A;  1MG8 A;  2KLG A;  3IBE A;  3R66 C;  1UBQ A;  2KKC A;  2KAN A;  2Z59 B;  3H6N A;  3PRP B;  4GDK B;  3VVW B;  4CYE A;  2KDI A;  2KLC A;  2JZ3 B;  2BKR B;  2HD5 B;  2IYD B;  3VAW A;  2MW5 A;  1WZ0 A;  1NDD A;  3QJZ A;  1NI2 A;  1JRU A;  4II2 B;  4KIK A;  3UGB B;  4AJY B;  3QWZ B;  2N1V A;  1WJN A;  4FJY A;  4KIK B;  1WE6 A;  3APF A;  2IZV B;  2O6V B;  4W9J A;  3HK0 A;  2AEH A;  4P7I A;  2KFJ A;  1RRB A;  3EC8 A;  2CHW A;  2ZCB A;  4G0N B;  4NAW A;  4WWO A;  3OJ3 A;  3ZIM A;  1KLV A;  2KX0 A;  1UZX B;  1VD2 A;  2LVO A;  4IC7 B;  1L7Y A;  4GU2 A;  1S3S G;  3CMM B;  4EZL A;  5AEK B;  3UQA A;  1LM8 B;  2M1M A;  2M4N A;  3JSV A;  3QIJ A;  4MM3 A;  2KVR A;  3UF8 A;  2FAZ A;  1WX9 A;  2IO0 B;  3AI5 A;  1IYF A;  2RD0 A;  2JXX A;  2NPT A;  2L3Z A;  4B95 A;  2BGF A;  3PRE A;  1WJU A;  2IY1 B;  2DX5 B;  2JVC A;  2LGY A;  3VQI A;  1WGD A;  2GOW A;  1WZ3 A;  5G55 A;  3ZTD A;  4MGZ E;  2LI5 A;  2ZNV B;  1V9J A;  3JYU A;  3KW5 B;  4NAW B;  2K6D B;  1RAX A;  4FA6 A;  1E5W A;  3ZO5 B;  1H8C A;  5DCN A;  1YJ1 A;  3H7P B;  1YQB A;  3V61 A;  2D07 B;  2MSE D;  2N7E A;  3W1S A;  4E74 A;  4IM3 A;  1HE8 A;  2MLB A;  3A1Q B;  4JLC A;  4OVU A;  3QK0 A;  2KZR A;  2PE9 A;  2MA9 B;  3PHX B;  3PRM B;  1RFA A;  2DZK A;  5G2N A;  4FHJ A;  2MBH A;  1X1M A;  1UBI A;  2W9N A;  2C60 A;  2MP2 B;  3EFU A;  3HIZ A;  3DOW A;  3QC8 B;  2XK5 A;  4W9G A;  3GZN I;  1EO6 A;  1V2Y A;  2EKE C;  3NHE B;  4W9K A;  2PPH A;  1E8Z A;  1NBF C;  3OLM D;  4MGY E;  5CHV C;  3TMP B;  2Y5B B;  3QAQ A;  1E8Y A;  1WX7 A;  3R7Q A;  3ZDM C;  1LQB A;  4PS8 A;  3UIO B;  3GOE A;  1P1A A;  1E7V A;  3QA8 A;  3PS6 A;  4ZYN A;  1SE9 A;  4FUL A;  4EZJ A;  4YL8 A;  3VUY A;  2D11 A;  2N9E B;  2DZI A;  2KHW B;  3ECI A;  3B1L X;  3WAL A;  4AP4 C;  4A3P A;  3H1U A;  4ICV A;  4GOC A;  2O6V D;  4NY0 A;  1U4A A;  4HDQ A;  2R2Q A;  2N9X A;  2K25 A;  4W9L A;  3RUL A;  1WR6 E;  4TUU A;  3I3T B;  2QHO A;  3NY5 A;  3RUI B;  1P0R A;  4W9F A;  2ZCC A;  2C7M B;  2JY6 A;  2Z0D B;  2YVC A;  3DCG A;  3TBL D;  2FCN A;  1J8C A;  4ASW C;  3PVL A;  2I1J A;  4MDK E;  2LD9 A;  3ZRC A;  5DPT A;  1TGZ B;  2FUH B;  2FCM A;  2DAF A;  2LAS A;  4DHZ E;  5JZE B;  3UQB A;  1T0Y A;  2KMC A;  2I1K A;  4IG7 B;  5KHO A;  4BKS A;  1H4R A;  3KVF B;  1R4N I;  4IWQ A;  1TBE A;  4NJ7 A;  3U8Z A;  4AOF A;  4I6N B;  3AU4 A;  3L16 A;  3N3K B;  3L54 A;  4FN2 A;  2FIF A;  5CHW A;  4HPM B;  2M17 A;  2RR9 A;  2PEA A;  4KDL B;  1Q5W B;  3M63 B;  3IFW B;  4GGQ A;  3ZNG C;  2CHZ A;  2LRW A;  4KDI C;  3VXW A;  4PS3 A;  1K8R B;  4BBN C;  4HCN B;  4I6P A;  2DHZ A;  2FNJ B;  2MQJ A;  1WI0 A;  4EEW A;  3ONS A;  3A4R A;  3MTN B;  2WX0 A;  3SU8 X;  3VTV A;  2GBN A;  4NNJ B;  4ZRK A;  2ZVO A;  2CR5 A;  3KUZ A;  3ZW3 A;  3DBS A;  1D3Z A;  2C7N B;  1OTR B;  2KXJ A;  2MBQ A;  4M0W B;  5J17 A;  5JH5 C;  3WAP A;  4K7W A;  4AWJ A;  3QX1 A;  4IW0 A;  4HK2 A;  4B9K A;  2IO1 B;  3SDL C;  2PJH A;  4TV3 A;  3WAO A;  3V6C B;  1Q1O A;  1C3T A;  4HLE A;  4KSL C;  2KDF B;  2Z0E B;  3TL5 A;  2KOX A;  3W1Y A;  2N7D A;  4HDO A;  4DDI D;  4HXD A;  4WWP A;  2V3S A;  4KZC A;  1WFY A;  5J18 A;  4DK5 A;  3VTU A;  4EKU A;  4X57 B;  1WGY A;  4HCP B;  3AXC A;  4CO7 A;  4BBN F;  1YIW A;  2B3A A;  4BFR A;  2NBW B;  3MJW A;  4KVG B;  2KQS A;  1WX8 A;  4JGH B;  4GMV A;  4ICU A;  3B0A A;  3PT2 B;  4RM8 A;  3T8M A;  1YD8 U;  4B6W A;  2IO3 B;  1A5R A;  4TKN A;  1P98 A;  1V80 A;  3AU5 A;  3CF6 E;  3TIX A;  2G3Q B;  5LXI B;  2JRI B;  4G50 A;  4XZ4 A;  4ANV A;  3PZD A;  2EMT A;  3BIN A;  2KWU B;  3HM6 X;  3KUD B;  4M8N A;  3ZTC A;  1ZGU B;  2KN5 A;  3KH0 A;  1WM3 A;  3RZW C;  1VCB A;  3ZRF A;  3NZU A;  1GC6 A;  4II3 B;  3LDZ E;  1WXV A;  2WWZ A;  3NOB A;  3U7D A;  2MBB B;  1R4M I;  4ANU A;  2C9W B;  3DBL I;  4GN1 A;  5CX3 A;  2CKH B;  5E6P A;  1I35 A;  3PTF C;  2D2Q A;  2GBR A;  1GUA B;  2IO2 B;  4MGI E;  1OQY A;  3ZNZ B;  2NS5 A;  2UWQ A;  4WJP A;  3DBR I;  4ANW A;  3ZLZ A;  2MBE A;  2MWS B;  1AAR A;  3U30 A;  4HPL B;  1ZW7 A;  4WAA A;  2R2O A;  4MJS B;  2CHX A;  2LUE A;  4LJO B;  3ZNH B;  1Y8R C;  3JVZ X;  1V5O A;  5BO4 B;  4DBG A;  4G3X B;  3L10 B;  3SD5 A;  3VH3 B;  4FHK A;  4M8M A;  1RLF A;  1WE7 A;  4GB9 A;  2K8C A;  3APC A;  2VRR B;  3D32 A;  2ZEQ A;  1EUV B;  1C1Y B;  3DVN V;  3DPD A;  4AJW A;  2HE7 A;  4WWN A;  3VTW A;  2LVQ A;  5L95 C;  3NS8 A;  2KO3 A;  2KC1 A;  3ALB A;  1V86 A;  2ZVN A;  3IVF A;  3DVG X;  4RMA A;  5C23 A;  3H7S A;  4BKT A;  4ZRJ A;  4GSW A;  1OEY J;  1P9D U;  2LWP A;  4GIV A;  4BVU C;  1G6J A;  1UD7 A;  1F9J A;  2CU1 A;  3DQV A;  3PLV A;  2KFK B;  2JF5 A;  4XX5 A;  5LXH A;  4E71 A;  3H7P A;  2JZZ A;  2K6Q A;  3PPA A;  3VUW A;  4EUT A;  2JWZ A;  4DXA B;  4LJP B;  2BYF A;  2ASQ A;  3TCA A;  2KK8 A;  4LCD E;  1WXM A;  5FR6 A;  3L17 A;  1WIA A;  1WGR A;  2LXC A;  1EF5 A;  3A4S C;  1TTN A;  2DAJ A;  3ML9 A;  2L00 B;  3R3M A;  4E3C A;  1SIF A;  2KMA A;  3JW0 X;  1ZKH A;  3VHT C;  3P2B A;  2DZM A;  1P3Q U;  1WJ6 A;  4N9F 4;  1GNU A;  4KSK C;  4NPN A;  1UEL A;  5LLI A;  2J7Q B;  1QZE A;  3K9O B;  2BF8 B;  2XK5 B;  4TQ0 A;  4K1R B;  4JQW C;  2KJ6 A;  4MJS A;  5E6O A;  4EFO A;  2KNB A;  1I42 A;  2DYM A;  4EOY A;  1J0G A;  1UH6 A;  2FCQ A;  2L7R A;  1WR1 A;  2MP2 A;  2NVU I;  4MEM A;  3C0R B;  5DPR A;  4XC2 A;  3WAM A;  4F1S A;  1WM2 A;  2AL6 A;  3ML8 A;  1FXT B;  3T9L A;  3QAR A;  4IWO A;  3UIN B;  4WJQ A;  1WXA A;  3DVN U;  3IG3 A;  2GBM A;  1V81 A;  2UYZ B;  1OGW A;  4F8C B;  3PHW B;  2LGD A;  4W9I A;  3DDC B;  2RPQ A;  3ZNI D;  3OJ4 B;  4DWF A;  1S1Q B;  2FCS A;  3LJ3 A;  2ZNV C;  2LRU A;  4AUQ C;  3W1S C;  5L83 A;  1WGH A;  1E8W A;  5J2R A;  2LGX A;  2ZZP B;  2JPH A;  3ENE A;  4RM9 A;  1LXD A;  4W9D A;  3L08 A;  4MEL A;  3PGE A;  3KYD D;  2NPT B;  4JL9 A;  4MSQ B;  2ZJD A;  3ZDT A;  4EZK A;  3N32 A;  3QCA A;  4NJ6 A;  2AWT A;  4WJO A;  2G4S A;  2DEN B;  1E7U A;  2IBI B;  1YX5 B;  2KFK A;  2OOB B;  4KV2 A;  2IY0 B;  2DYB A;  5AZF A;  3V62 A;  4TQ1 A;  5JHA A;  3S2A A;  4ZDV A;  3M62 B;  3RD2 A;  2NBV B;  1WGG A;  2LXA A;  1TZ1 A;  3A9J A;  3RT3 B;  1LFD A;  2KD0 A;  2L8J A;  4DDG D;  3Q3J A;  2WYQ A;  4ANX A;  4KZ0 A;  5D6J B;  2NCN A;  1V49 A;  3SHQ A;  3PRZ A;  1XQQ A;  2BWE S;  2LJ5 A;  1M94 A;  2A5U A;  4HWI B;  1Q0W B;  4FBJ B;  4K81 A;  2N4F A;  2LVP A;  1WMH B;  3UIP B;  2K8B A;  5AZG A;  2KJR A;  2V1Y A;  3VH4 B;  3A33 B;  3CSF A;  3A1Q A;  1E8X A;  2J0M A;  4MH0 E;  5CTR C;  2KWV B;  3N30 A;  2OJR A;  1WRD B;  1ISN A;  1YX6 B;  2BYE A;  4PYU A;  2D3G A;  4W9C A;  4A3O A;  2D10 A;  2M0X A;  4DHJ D;  1SGH A;  2JUO A;  4JIO U;  1V6E A;  2ZPY A;  3X23 A;  2NR2 A;  5KHQ A;  1GJZ A;  2BYV E;  1CMX B;  1XD3 B;  4WQO B;  1Z5S B;  1WMH A;  3VFK A;  3ZKJ C;  3DVG Y;  2EMS A;  2BKF A;  3VUX A;  4LDT B;  4A20 A;  5IAA C;  3RCZ A;  3WIM A;  2KJH B;  3Q3F A;  3MHS D;  4ZRI A;  2G4D B;  2N1W A;  2JRH A;  2O6V A;  3BY4 B;  2KWC A;  3TJP A;  4BOS C;  2KTR A;  1GC7 A;  2L05 A;  3QQ8 B;  1Z2M A;  4DHZ B;  2NBU A;  2RGF A;  4PYZ A;  5C1Z A;  2WDT B;  3M3J A;  2J0J A;  4HVB A;  3APD A;  3QHT A;  2KQ7 A;  2WX1 A;  1GG3 A;  2A4Z A;  5JHB A;  2K39 A;  2MBO A;  3B08 A;  4FJZ A;  4GXB A;  3R7R A;  3A9J B;  3A9K A;  5CHF A;  3WAN A;  2O2V B;  3RZF A;  2MCN B;  1WF9 A;  4PS7 A;  4URK A;  3A9K B;  3DBH I;  4IWP A;  1WYW B;  2KX3 A;  3KYC D;  2FID A;  3KUC B;  2K8H A;  5AZH A;  2G45 B;  4GDL B;  3PLU A;  2V4L A;  2K1F A;  5DPW A;  4FAD A;  2HJ8 A;  5GMV A;  1OEY A;  2AYO B;  2KDB A;  2L0T A;  5D2M B;  4HJK A;  4IM0 A;  4NQK E;  5EDS A;  1WJ4 A;  4GDL A;  1IP9 A;  1E90 A;  1KM7 A;  2KTF A;  4G11 A;  4GDK A;  2MRP A;  3AUL A;  4FLH A;  5IA7 A;  4K7U A;  3H9D A;  3WA0 A;  2C5L C;  4J6I A;  4BKG A;  2BWF A;  1J19 A;  3JSV B;  4F7Z A;  4MSM B;  3O65 B;  4LDT D;  3K9P B;  2KC2 A;  4W9H A;  1KJT A;  2O2V A;  1PQS A;  2MX2 A;  3L13 A;  3PV1 A;  4IUM B;  4MGK E;  3HM3 A;  2DYO A;  5D7G A;  3ZUN A;  3PSE B;  3EEC A;  2L0F A;  5HKH A;  2M8S A;  5D94 A;  2DZJ A;  2AL3 A;  4BOZ B;  2RSU A;  1BT0 A;  4FJV B;  1EF1 A;  2C7H A;  3ZVV A;  4OVV A;  3RYT A;  1WY8 A;  2REX A;  3NZS A;  1L2N A;  1V5T A;  3M95 A;  1KOT A;  2KTR B;  5DPS A;  2CS4 A;  2XEW A;  3L0W B;  1IPG A;  2HTH A;  2YLM A;  1WXS A;  2J0K A;  3EHV A;  4W9E A;  3V60 A;  2ZPN A;  3V6E B;  2GBJ A;  3HHM A;  2PE6 B;  4IM2 A;  2N9P C;  2XBB C;  5TR5 A;  3IHP C;  4K7S A;  2GBK A;  3CST A;  4NQL B;  2L76 A;  4WJN A;  4DHJ B;  5E6N A;  3X0W A;  2JT4 B;  1UGM A;  2LZ6 A;  1XT9 B;  1WH3 A;  2BPS A; 
#chains in the Genus database with same CATH topology
 1MG4 A;  2KDE B;  3IBE A;  1UBQ A;  2Z59 B;  1FPY A;  3AN1 A;  2KAC A;  1QOF A;  3V05 A;  3VVW B;  4CYE A;  2BKR B;  1FO4 A;  3VAW A;  5LNK 1;  3URY A;  3W2D A;  2IZV B;  4RH6 A;  1DYQ A;  2RPV A;  1D5Z C;  3QIJ A;  2WXK A;  3Q2A C;  2KVR A;  4WWM A;  3MC9 A;  2IGD A;  1WX9 A;  2FBW B;  1V1O A;  3FKY A;  3FAH A;  4RNA A;  2ICI A;  1TJE A;  4B95 A;  2BGF A;  2IND C;  4HJG E;  2GOW A;  1QOB A;  4C80 A;  4NAM A;  4JWU C;  5G55 A;  1V9J A;  1WYG A;  3Q3O C;  1I4Q A;  1GB1 A;  1YJ1 A;  3V61 A;  4E74 A;  1C4C A;  1L0Y B;  4FHJ A;  2MBH A;  4NAW B;  1UBI A;  2W9N A;  3HIZ A;  3GZN I;  1D6E C;  1V2Y A;  2EKE C;  4W9K A;  1NBF C;  4MGY E;  3VR8 B;  4RF0 A;  2H88 B;  2M0A A;  3R7Q A;  1LQB A;  3GOE A;  1K53 A;  2LGS A;  1SE9 A;  1YQ4 B;  4EZJ A;  4YL8 A;  3VUY A;  2D11 A;  2N9E B;  3TSS A;  4AP4 C;  1E6E B;  2OJW A;  3NRZ A;  2O6V D;  4NY0 A;  4HDQ A;  2K25 A;  2NTS A;  2K9X A;  3LB8 C;  1E10 A;  1N6Z A;  1P0R A;  1SE4 A;  4YT0 B;  2FCN A;  1J8C A;  4ASW C;  4MDK E;  1T0Q C;  1A70 A;  4P6V F;  2LAS A;  2DAF A;  4DHZ E;  4OVZ A;  1H4R A;  1GOZ A;  3NS1 A;  1TBE A;  4AOF A;  1Y56 A;  4I6N B;  2RR9 A;  3U2S C;  1EWC A;  3IFW B;  4GGQ A;  1NVI D;  2KMM A;  4BBN C;  4HCN B;  4I6P A;  2DHZ A;  3FC4 A;  3ONS A;  2WX0 A;  4NNJ B;  1D3Z A;  3ZW3 A;  3NUH B;  1OTR B;  2KXJ A;  3WAP A;  4K7W A;  4AWJ A;  4B9K A;  2DWQ A;  3P4R B;  2IO1 B;  3SDL C;  2PJH A;  4TV3 A;  3PZ8 A;  4KSL C;  4C7Z A;  1LO5 D;  1L0X B;  4DDI D;  2WXG A;  1EWY C;  3RNC C;  1YQ3 B;  4X57 B;  2PIA A;  4CO7 A;  2Y5C A;  2KQS A;  2MEK A;  4JGH B;  4RM8 A;  4B6W A;  1TS4 A;  5FR3 A;  1V80 A;  5LXI B;  3CF6 E;  1TS5 A;  4ANV A;  3BIN A;  3AE9 B;  4A6Q A;  1OQQ A;  3RZW C;  3NZU A;  1GC6 A;  1R4M I;  3C8Y A;  3DBL I;  4GN1 A;  1D5X C;  3BYT B;  3I9V 1;  4ZOH C;  4MGI E;  2NS5 A;  2UWQ A;  2WDR B;  3AEE B;  4HPL B;  2WXL A;  2LUE A;  4LLG M;  5T8I A;  4G3X B;  3SD5 A;  4GB9 A;  3D32 A;  4OZA A;  5GXG B;  3NS8 A;  2KC1 A;  5C23 A;  2ZVN A;  1CK1 A;  3H7S A;  4BVU C;  4GIV A;  1UD7 A;  5H92 C;  4XX5 A;  3EGR A;  3H7P A;  4EUT A;  3VUW A;  3ZXR A;  1XXG A;  4DXA B;  4KKI A;  2BYF A;  2ASQ A;  1V1P A;  1UWX A;  2LXC A;  3A4S C;  2DAJ A;  3ML9 A;  3DHG C;  1PGX A;  3JW0 X;  1JAL A;  5LLI A;  2J7Q B;  1QZE A;  2XK5 B;  1L6U A;  4EFO A;  4NZL B;  1I42 A;  4EOY A;  4MEM A;  2FCQ A;  2L1A A;  1WM2 A;  1OQR A;  3ML8 A;  3T9L A;  3UIN B;  2BS2 B;  2GBM A;  4UDU C;  1V81 A;  1OGW A;  4C4V B;  4L1B A;  4DXF A;  3LJ3 A;  2DNF A;  1I4R A;  1E8W A;  5J2R A;  4P1B C;  2JPH A;  3AH7 A;  2RDG A;  1RWS A;  4MEL A;  3PGE A;  4EZK A;  5TSS A;  2AWT A;  1VZ7 A;  4WJO A;  1YX5 B;  1C9F A;  1C76 A;  4ZDV A;  3DWG C;  3M62 B;  1SE3 A;  2NBV B;  1TZ1 A;  4WIP A;  3A9J A;  2BVC A;  2Q5W D;  3Q3J A;  1FFV A;  2WYQ A;  1SXT A;  2ZW0 A;  1HXY D;  1V49 A;  3SHQ A;  2BWE S;  4YSX B;  4HWI B;  3ZJV A;  5IOI A;  3HUI A;  1KTK A;  2MJE A;  4K81 A;  3UIP B;  3GE3 C;  2K8B A;  4CQN A;  2KJR A;  4MH0 E;  1SBB B;  4PYU A;  4P1C C;  2M0X A;  1SGH A;  1FEH A;  2NR2 A;  1GJZ A;  1F77 A;  2H89 B;  2BYV E;  1XD3 B;  4C56 C;  2JQR B;  3VFK A;  3RMK C;  1ZXI A;  2BKF A;  4LDT B;  3RCZ A;  5IKC M;  3WIM A;  2KAJ A;  3MHS D;  4QAY A;  2WDV B;  5EE0 A;  1GC7 A;  1V8C A;  3RN9 C;  2KQ7 A;  2W3R A;  2K39 A;  2O2V B;  2MCN B;  3AE3 B;  2KX3 A;  1WRI A;  3KYC D;  1YJJ A;  2V4L A;  4FAD A;  1OEY A;  2PW9 A;  2INP E;  5D2M B;  4IM0 A;  2WXH A;  5EDS A;  4GDL A;  2KTF A;  1ET6 A;  3E56 A;  3HRD D;  2JZP A;  2WXN A;  3BK2 A;  5IO9 A;  3H9D A;  2C5L C;  2BWF A;  4LDT D;  3ETR A;  3L13 A;  4IUM B;  2XN9 C;  1MPE A;  3EEC A;  1I4H A;  1KF6 B;  2DZJ A;  2RSU A;  2C7H A;  5BYS A;  4OW0 A;  5DPS A;  1IPG A;  3BVG A;  3MJ5 A;  3V6E B;  1GAQ B;  2GBJ A;  4XGA B;  4NQL B;  4K7S A;  3O13 A;  2L76 A;  3L4P A;  1KH0 A;  2BPS A;  4I6L B;  1JRP A;  3R66 C;  2KLG A;  3GZN B;  2PTL A;  2KKC A;  2KAN A;  2GI9 A;  4Q2J A;  4GDK B;  2KLC A;  2QDF A;  4D2K A;  5EE1 A;  4AJY B;  1FMA D;  4N59 A;  2N1V A;  1WJN A;  4FJY A;  1WE6 A;  1JWS D;  2O6V B;  3Q14 C;  3HK0 A;  4P7I A;  1ZOY B;  1DOI A;  2G1E A;  3P42 A;  4G0N B;  4WWO A;  3OJ3 A;  2BB6 A;  3ZIM A;  1KLV A;  1VD2 A;  3T3O A;  1L7Y A;  1TKY A;  3UQA A;  2M1M A;  2BTE A;  2M4N A;  1T3Q A;  4YTM B;  2IO0 B;  1IGD A;  2JXX A;  5C3J B;  2JVC A;  3VQI A;  3U52 E;  5FKA C;  2QC8 A;  5H8Y E;  4MGZ E;  2ZNV B;  2K6D B;  4FA6 A;  1E5W A;  3P63 A;  3H7P B;  1YQB A;  1JWM D;  4RGT A;  1X1M A;  2MP2 B;  3QC8 B;  3DOW A;  2XK5 A;  2PPH A;  1QQR A;  3QAQ A;  1WX7 A;  1VRA B;  2BW2 A;  2D3C A;  1GB4 A;  4PS8 A;  3UIO B;  3RNG C;  3QA8 A;  1E7V A;  1E7P B;  4XDD A;  1XLO A;  2MJD A;  2DZI A;  1JWB D;  3B1L X;  3AE5 B;  1SEB D;  3MC0 B;  4OZC A;  2R2Q A;  5HG2 A;  3RUL A;  3I3T B;  2HDE A;  3NY5 A;  3RUI B;  2C7M B;  2JY6 A;  2Z0D B;  1C79 A;  3DCG A;  4KKJ A;  1VZ6 A;  2I1J A;  2FUH B;  3R2I A;  3HVZ A;  4BZA A;  2J42 A;  3DBL B;  3KVF B;  4IWQ A;  4NJ7 A;  3U8Z A;  1I4X A;  3L54 A;  4HPM B;  2M17 A;  3RNA C;  2PEA A;  1Q5W B;  4HRS A;  1SSN A;  3U7Z A;  3ZNG C;  1T5X D;  4PS3 A;  2NMQ A;  2E3T A;  2MQJ A;  2LJI A;  2M56 B;  4ARC A;  3SU8 X;  2GBN A;  4ZRK A;  2CR5 A;  2MBQ A;  3P4S B;  3NVW A;  4XDC A;  4YWG G;  4HEA 1;  3OG5 A;  3I5J C;  3GP7 A;  2I2Y A;  1AYF A;  3W1Y A;  4HDO A;  4YTN B;  3ABV B;  3RNF C;  4WWP A;  1C4P A;  1WFY A;  1ZP0 B;  3SEB A;  1WGY A;  3KWV A;  4DXG A;  1R7S A;  3AM9 A;  4KVG B;  4IKG A;  4ICU A;  2LHD A;  3B0A A;  3PT2 B;  2WLB A;  4TKN A;  1P98 A;  3TIX A;  2G3Q B;  2JRI B;  3KUD B;  4FXC A;  2PVG C;  4ZHP A;  2KQ4 X;  4RF1 A;  1UNS A;  2QCZ A;  4IOI E;  3TUO A;  1WM3 A;  3B2G A;  1VCB A;  4HRO A;  4II3 B;  3NOB A;  3U7D A;  2MBB B;  2WXI A;  3AMZ A;  4ANU A;  3NG0 A;  5CX3 A;  1ZXH A;  5E6P A;  2VH2 A;  3PTF C;  2D2Q A;  2GBR A;  4JE3 B;  3ZNZ B;  2TSS A;  2K22 A;  3DBR I;  3ZLZ A;  1E0Z A;  2MWS B;  3NZ3 A;  4RGN A;  2R2O A;  1V5O A;  5BO4 B;  2JYE A;  1UGJ A;  1YN4 A;  2K8C A;  3APC A;  3IT6 B;  2VRR B;  2ZEQ A;  3DVN V;  3DPD A;  4AJW A;  5AUK A;  4WWN A;  3VTW A;  5L95 C;  2KO3 A;  3IVF A;  1V86 A;  2DBY A;  1ESF A;  1V1P B;  2SEB D;  3W5V B;  2VZK B;  1P9D U;  1G6J A;  2CU1 A;  4M01 A;  3DQV A;  2WHI A;  1IBX B;  1HEZ E;  5LXH A;  1TS3 A;  4E71 A;  2K6Q A;  3T3N A;  3I63 C;  1GPX A;  5BMH A;  3AV8 A;  1TYG B;  2KK8 A;  2WXF A;  5FR6 A;  3L17 A;  3TEY A;  1WIA A;  1EF5 A;  1TTN A;  4E3C A;  2L00 B;  2KMA A;  2QIE B;  3VHT C;  2W82 A;  3P2B A;  1P3Q U;  1WJ6 A;  3I57 A;  4K3C A;  1FXA A;  4NPN A;  1WSP A;  4JQW C;  1J0G A;  2L7R A;  3J9C A;  5DPR A;  1FXT B;  3GE8 C;  2V3P A;  3IG3 A;  2UYZ B;  4F8C B;  1VJK A;  3P1M A;  3Q8E A;  2LGD A;  1AWD A;  2FCS A;  1V97 A;  1FNU A;  2GB1 A;  2X38 A;  4YSZ B;  4XYC A;  3SR6 A;  2NPT B;  4ZRQ A;  2ZJD A;  3ZDT A;  3N32 A;  2IBI B;  1IBX A;  2OOB B;  4KV2 A;  2IY0 B;  2DYB A;  5AZF A;  3V62 A;  1L4D B;  5JHA A;  2R61 A;  3AEG B;  1N60 A;  1WGG A;  2LXA A;  1JWA D;  2KD0 A;  4J3O D;  2LEK A;  1OFF A;  2EKI A;  2NCN A;  1FCC C;  1K50 A;  2WXO A;  5IP4 D;  3LXF A;  3Q69 A;  1Q0W B;  2AX5 A;  2V3N A;  4LNI A;  2V1Y A;  3VH4 B;  3A33 B;  3CSF A;  5CTR C;  2J0M A;  2KN4 A;  2KWV B;  3N30 A;  1ISN A;  1YX6 B;  2BYE A;  1L4Z B;  4A3O A;  2PLP A;  2D10 A;  3X23 A;  1V6E A;  2W55 A;  1FIQ A;  3PZ7 A;  1CMX B;  3DVG Y;  2EMS A;  3VUX A;  2G4D B;  2O6V A;  2KTR A;  2L05 A;  4KX6 B;  4A90 A;  2RGF A;  5C1Z A;  4N58 A;  4HVB A;  3APD A;  3U4E G;  2WX1 A;  3BVZ A;  1FNW A;  4C4V A;  1PUT A;  3A9K A;  1PDX A;  4PS7 A;  2BQQ A;  3LYY A;  1F1H A;  3A9K B;  3PO0 A;  1KLG D;  3DBH I;  4HPP A;  1QKZ A;  5AZH A;  4GDL B;  4IDI A;  1FRD A;  2K1F A;  4LNF A;  2NTT A;  4WUR A;  5DPW A;  3IT4 B;  2PKO A;  2KDB A;  4HJK A;  3W5U B;  3WA0 A;  4BKG A;  2KC2 A;  3SFE B;  3BK1 A;  4W9H A;  1PQS A;  3PV1 A;  2DYO A;  2UU7 A;  2M8S A;  5D94 A;  2B76 B;  2AL3 A;  4A55 A;  4FJV B;  1WY8 A;  1KOT A;  2KTR B;  2WGS A;  5I4D A;  4ITK A;  3EHV A;  3BYY B;  5FK9 C;  3ZYY X;  2PE6 B;  2N9P C;  2INN E;  2XBB C;  1D4B A;  5E6N A;  3X0W A;  2JT4 B;  3GB1 A;  1XT9 B;  4BKS D;  1C4A A;  2GMI C;  2GRI A;  4CHK A;  1MG8 A;  3DHI C;  3H6N A;  1HZ6 A;  3PRP B;  1YJI A;  1QIL A;  3ZJT A;  4RGM A;  1F2R C;  2IYD B;  5IN7 A;  2MW5 A;  2QSD A;  4II2 B;  3H8H A;  1JRU A;  3AEA B;  3N20 C;  1QOA A;  1HZ5 A;  3EFC A;  1QF6 A;  2AEH A;  3EC8 A;  2ZCB A;  5BYR A;  2IGG A;  1PGA A;  1UZX B;  2LVO A;  4XWW A;  4IC7 B;  2M19 A;  3CMM B;  4EZL A;  3Q6B A;  5AEK B;  4WH4 A;  3UF8 A;  2FAZ A;  4L23 A;  3AI5 A;  1IYF A;  3AE6 B;  2RD0 A;  2L3Z A;  3PRE A;  4WAF A;  2AQ2 B;  1P7F A;  2DX5 B;  4XWT A;  3JYU A;  3KW5 B;  4RCO A;  1B1Z A;  2W54 A;  4REZ A;  2WU5 B;  2IJ0 A;  2D07 B;  2MSE D;  3W1S A;  4IM3 A;  1HE8 A;  3A1Q B;  2LHE A;  4JLC A;  4OVU A;  3TEW A;  2ON8 A;  3QK0 A;  2KZR A;  3N1Y C;  3PRM B;  2DZK A;  4US8 A;  3EFU A;  2C60 A;  1M4V A;  1EO6 A;  4TSS A;  3NHE B;  1E8Z A;  2N9K A;  5JXV A;  5CHV C;  3TMP B;  1QLB B;  2Y5B B;  1T0S C;  2ZW1 A;  3ZDM C;  1P1A A;  4ZYN A;  2WXJ A;  3NVZ A;  1L5P A;  2KHW B;  3ECI A;  1KLU D;  4A3P A;  1SE2 A;  4GOC A;  2IGH A;  5C2T B;  2XNA C;  2N9X A;  4W9L A;  1WR6 E;  3B2F A;  2ZCC A;  3DBH B;  2YVC A;  3TBL D;  1NYQ A;  3PVL A;  1VDV A;  4H2A A;  1ZE3 D;  2LD9 A;  5DPT A;  4K3B A;  1P7E A;  3UQB A;  5JZE B;  2KMC A;  4IG7 B;  3BZD B;  4BKS A;  1XEE A;  3CIR B;  3V3X A;  3AU4 A;  3L16 A;  3N3K B;  1EU4 A;  3Q8C A;  4FN2 A;  2FIF A;  5CHW A;  3IAM 1;  3M63 B;  4ZHO A;  4L2Y A;  4KDI C;  3VXW A;  1K8R B;  3EUB 2;  2Y3A A;  1PYW D;  2EEL A;  2FNJ B;  4S17 A;  1XCT L;  3NVV A;  3VTV A;  3KUZ A;  3DBS A;  5J17 A;  5JH5 C;  3QX1 A;  4IW0 A;  2LFI A;  1Q1O A;  3VR9 B;  1C3T A;  1JQ4 A;  5AUI A;  3TL5 A;  3AE1 B;  4C7Y A;  3AEB B;  4KZC A;  5J18 A;  4HCP B;  3AXC A;  4PK1 A;  2B3A A;  5D3I B;  4BFR A;  3MJW A;  2KYW A;  1WX8 A;  4GMV A;  1R4M B;  3T8M A;  4HKQ A;  2IO3 B;  1VR9 A;  4G50 A;  4XZ4 A;  3PZD A;  2EMT A;  4M8N A;  2KWU B;  3HM6 X;  3ZTC A;  1ZGU B;  2KN5 A;  2WXM A;  3P4Q B;  3TEX A;  4B0E A;  3ZRF A;  3LDZ E;  4WQM A;  2C9W B;  1R4N B;  3C19 A;  2SAK A;  1CZP A;  1NI3 A;  2IO2 B;  4KGR A;  1JWU D;  1OQY A;  4ANW A;  1AAR A;  3U30 A;  1ZW7 A;  2JU6 X;  4WAA A;  2CHX A;  2J4X A;  4LJO B;  3JVZ X;  2LGI A;  4JX1 C;  4FHK A;  4A8X C;  3MC8 A;  2LVQ A;  1N63 A;  3RD2 A;  3DVG X;  4BKT A;  4GSW A;  1OEY J;  2LWP A;  3KQ4 A;  1F9J A;  3PLV A;  2KFK B;  2K0P A;  2JZZ A;  3PPA A;  3TCA A;  4LCD E;  1WXM A;  1TY0 A;  1WGR A;  2KWD A;  1SIF A;  2KT7 A;  3MHZ A;  3BII D;  1ZKH A;  3DBR B;  4LNK A;  2DZM A;  2Z8L A;  4KSK C;  1UEL A;  3K9O B;  4TQ0 A;  2QJL A;  4K1R B;  4MJS A;  5E6O A;  2KNB A;  2DYM A;  4F1S A;  3WAM A;  3QAR A;  5HHD G;  1WXA A;  4GLS C;  4YSY B;  2RDH A;  3PHW B;  4W9I A;  2PVO D;  3OJ4 B;  4DWF A;  2RMM A;  3W1S C;  3ENE A;  1MHX A;  1J7B A;  4W9D A;  2V4I B;  1BML C;  4JL9 A;  4MSQ B;  4NJ6 A;  4O1N A;  1JML A;  1SIJ A;  1SJH D;  2G4S A;  2DEN B;  2KFK A;  1ROE A;  3DHH C;  1FXI A;  4TQ1 A;  2K5P A;  1T0R C;  1N61 A;  3RT3 B;  1LFD A;  4LK0 M;  4DDG D;  1ACC A;  4KZ0 A;  1XQQ A;  1ZPS A;  2WXR A;  2LJ5 A;  3Q8F A;  1EU3 A;  2HJ1 A;  4FBJ B;  1JRO A;  2LVP A;  3AE2 B;  1F0Z A;  4LNN A;  1XLQ A;  3A1Q A;  1E8X A;  1E9M A;  2BT6 A;  2OJR A;  1WRD B;  2D3G A;  2IPK D;  4DHJ D;  2WP9 B;  2ZPY A;  5KHQ A;  1Z5S B;  1WMH A;  3ZKJ C;  1TKG A;  3SFD B;  4MH8 A;  4ZRI A;  2N1W A;  4BOS C;  3BY4 B;  2KWC A;  2FUG 1;  2L32 A;  3QQ8 B;  1Z2M A;  4DHZ B;  2NBU A;  1YNT E;  1J7C A;  2WDT B;  3M3J A;  2J0J A;  3QHT A;  3RFZ B;  1GG3 A;  2MH7 A;  3R7R A;  1YOV B;  3A9J B;  5CHF A;  1MFW A;  4URK A;  1I4G A;  4IWP A;  1N5X A;  1WYW B;  1XF5 L;  2QMT A;  3UI3 A;  1ZUD 2;  2OHF A;  4RFB A;  2K8H A;  4PT5 A;  3FIL B;  2G45 B;  3AB5 A;  3GS2 A;  2YEP F;  4NJC A;  2HJ8 A;  2L0T A;  4NQK E;  4G11 A;  2ONQ A;  1UWM A;  2MRP A;  2OED A;  4FLH A;  5D3D A;  5IA7 A;  1NYR A;  4K7U A;  4J6I A;  1J19 A;  1N62 A;  2AQ3 B;  3JSV B;  3AE4 B;  3O65 B;  3K9P B;  1KJT A;  2MX2 A;  2J53 A;  3HM3 A;  5D7G A;  3ZUN A;  3PSE B;  2L0F A;  4BOZ B;  1BT0 A;  2CU3 A;  1LGR A;  1V5T A;  2CS4 A;  3NJT A;  3L0W B;  2HTH A;  2Y5P A;  2YLM A;  1WXS A;  2J0K A;  4MAC A;  4W9E A;  5BMI A;  2FE8 A;  2ZPN A;  3AE7 B;  1NEN B;  3HHM A;  4IM2 A;  2L83 A;  1K52 A;  2GBK A;  3CST A;  4WJN A;  2N0S B;  1UGM A;  1J7A A;  1HA5 A;  1I4P A;  3OAW A;  3VDZ A;  4OZB A;  1RYJ A;  4HKZ E;  2KDI A;  2JZ3 B;  2HD5 B;  1DOX A;  1WZ0 A;  3KLS X;  1NDD A;  3QJZ A;  1NI2 A;  1ZDV A;  4KIK A;  3UGB B;  3QWZ B;  2ACZ B;  4KIK B;  3APF A;  1F52 A;  4USA A;  4W9J A;  1HTO A;  1XCQ L;  2KFJ A;  1RRB A;  3N9Y C;  3RPF C;  2CHW A;  2GLS A;  4NAW A;  2BS3 B;  2KX0 A;  2MJ3 A;  4LNO A;  2WS3 B;  4GU2 A;  1S3S G;  2WQY B;  4P16 A;  1LM8 B;  3P4P B;  3JSV A;  4LTU A;  5G5H A;  4MM3 A;  1TIF A;  2NPT A;  1QT9 A;  2BB5 A;  1WJU A;  2IY1 B;  2D3A A;  2LGY A;  1WGD A;  1WZ3 A;  2WNM A;  3ZTD A;  2LI5 A;  1RAX A;  3ZO5 B;  2BS4 B;  1H8C A;  3AE8 B;  5DCN A;  1FD6 A;  2KVZ A;  2N7E A;  2MLB A;  2X8X X;  1B9R A;  2PE9 A;  2MA9 B;  4OHJ A;  1KFY B;  1RFA A;  3PHX B;  5G2N A;  4W9G A;  3OLM D;  1YN3 A;  1STE A;  1E8Y A;  3FIL A;  3PS6 A;  1TS2 A;  4FUL A;  3WAL A;  3H1U A;  4ICV A;  1U4A A;  5EE3 A;  1Q10 A;  3AEC B;  4TUU A;  2I38 A;  2QHO A;  3AEF B;  4W9F A;  1SJE D;  1AN8 A;  5BMG A;  5HFY A;  2QIL A;  3ZRC A;  1TGZ B;  1NEK B;  2FCM A;  1T0Y A;  2INC C;  1JW9 D;  2I1K A;  5KHO A;  4JWS C;  3CWI A;  3VRA B;  1R4N I;  1TZO A;  2BYT A;  1UF0 A;  4KDL B;  2CHZ A;  1HQR D;  2LRW A;  2N7J A;  1C77 A;  4BAX A;  1IUE A;  1WI0 A;  4EEW A;  1F2R I;  3A4R A;  3MTN B;  5BYQ A;  2ZVO A;  2JYT A;  2C7N B;  4M0W B;  1RFK A;  4HK2 A;  2D5G A;  3WAO A;  3V6C B;  2LMC A;  4HLE A;  1EM7 A;  3Q8A A;  2L52 A;  2KDF B;  2Z0E B;  2KOX A;  4N6E B;  3Q3M C;  2G9H D;  2N7D A;  2YEP B;  4HXD A;  2V3S A;  4DK5 A;  4R3D A;  3VTU A;  1WGK A;  4EKU A;  1UUP A;  4BBN F;  1YIW A;  2PMV A;  2NBW B;  1YD8 U;  2V9H A;  3Q3N C;  1ET9 A;  1A5R A;  1IGC A;  3AU5 A;  4S0R A;  1L6V A;  1I7H A;  1PFD A;  3ZQ4 A;  3KH0 A;  1RM6 C;  3WCQ A;  2WXP A;  1WXV A;  2WWZ A;  3ZXV A;  4KGS A;  2CKH B;  1I35 A;  1GUA B;  3HVD A;  4TMA B;  4ACF A;  4WJP A;  1HTQ A;  2MBE A;  2LUM A;  4MJS B;  2CJO A;  3ZNH B;  1Y8R C;  2QEJ C;  2WDQ B;  4DBG A;  1C78 A;  3L10 B;  3VH3 B;  4M8M A;  1RLF A;  1WE7 A;  1TT5 B;  1EUV B;  1C1Y B;  2IDY A;  2HE7 A;  3W9C B;  1BUI C;  3ALB A;  4RMA A;  2D3B A;  2JXT A;  4ZRJ A;  4XE0 A;  2JF5 A;  4MT5 A;  1FCL A;  2JWZ A;  1SB3 C;  1SF0 A;  3AED B;  4LJP B;  4B0M A;  3B9J A;  3ZJU A;  5EE9 A;  2CJN A;  2VZK D;  3R3M A;  4M0W A;  1ZDX A;  4N9F 4;  4A9A A;  1GNU A;  4JPS A;  3R8B A;  3NVY A;  2BF8 B;  2KJ6 A;  2RDB C;  1UH6 A;  2MP2 A;  3ZGZ A;  1WR1 A;  1FRR A;  1YMH E;  1XLN A;  2NVU I;  3C0R B;  3N1Z C;  4XC2 A;  2AL6 A;  1WWT A;  4IWO A;  2N9L A;  4WJQ A;  1WXQ A;  3DVN U;  3RNE C;  2DLB A;  3DDC B;  2RPQ A;  3RI7 C;  3ZNI D;  1DOY A;  1S1Q B;  2J52 A;  2ZNV C;  2LRU A;  4AUQ C;  5L83 A;  2V0G A;  2E6X A;  1WGH A;  2LGX A;  2ZZP B;  1MJD A;  4RM9 A;  1LXD A;  3BWU D;  3L08 A;  1QOG A;  1CQV A;  3KYD D;  1FFU A;  1N5W A;  3QCA A;  3N1X C;  1FM0 D;  1E7U A;  4MM3 B;  3S2A A;  1BXT A;  1MHH E;  4AS1 A;  1PGB A;  4YXD B;  3Q8B A;  3TEZ A;  2L8J A;  2MHJ A;  1AW7 A;  4ANX A;  5D6J B;  3PRZ A;  3IAS 1;  3EA6 A;  1M94 A;  2A5U A;  3R2T A;  2W3S A;  4ARI A;  4YTP B;  5HI1 A;  2N4F A;  1WMH B;  3RNB C;  5AZG A;  1XLP A;  3E9S A;  2JSV X;  4W9C A;  2KDM A;  2JUO A;  4JIO U;  4M00 A;  4WQO B;  2VH1 A;  5E6J A;  4C00 A;  4A20 A;  2HTM E;  5IAA C;  4AQ7 A;  2KJH B;  3Q3F A;  2JRH A;  3TJP A;  1CJE A;  4ZRP A;  4PYZ A;  1K51 A;  4DQO C;  4US9 A;  1DGJ A;  2A4Z A;  3DWM A;  1KRH A;  5JHB A;  2MBO A;  3B08 A;  4FJZ A;  3MP9 A;  3BVM A;  4GXB A;  3WAN A;  4ZYS A;  2BBC A;  1L0V B;  1JCK B;  3RZF A;  1WF9 A;  4RGO S;  1T6B X;  1MI0 A;  4KGT A;  2FID A;  3KUC B;  3KWL A;  3PLU A;  1D5M C;  2K3U A;  5GMV A;  2WXQ A;  2AYO B;  1IP9 A;  1WJ4 A;  1E90 A;  1KM7 A;  4GDK A;  3AUL A;  2AQ1 B;  3IXS A;  4F7Z A;  4MSM B;  4EE2 A;  2JWU A;  2JX5 A;  1VLB A;  2O2V A;  3OWE B;  4MGK E;  1TY2 A;  1MVK A;  3MFG A;  5HKH A;  3VRB B;  1EF1 A;  3ZVV A;  4OVV A;  3RYT A;  2REX A;  3NZS A;  1L2N A;  3M95 A;  2XEW A;  2WU2 B;  1XO3 A;  1FNV A;  1ENF A;  1VZ8 A;  5G5G A;  3V60 A;  4M02 A;  4DHJ B;  5TR5 A;  3IHP C;  5MPO A;  1TKE A;  1YN5 A;  2LZ6 A;  1WH3 A; 
#chains in the Genus database with same CATH homology
 4BKS D;  3OAW A;  4I6L B;  2GMI C;  3VDZ A;  2KDE B;  4CHK A;  1MG8 A;  2KLG A;  3IBE A;  3R66 C;  1UBQ A;  2KKC A;  2KAN A;  2Z59 B;  3H6N A;  3PRP B;  4GDK B;  3VVW B;  4CYE A;  2KDI A;  2KLC A;  2JZ3 B;  2BKR B;  2HD5 B;  2IYD B;  3VAW A;  2MW5 A;  1WZ0 A;  1NDD A;  3QJZ A;  1NI2 A;  1JRU A;  4II2 B;  4KIK A;  3UGB B;  4AJY B;  3QWZ B;  2N1V A;  1WJN A;  4FJY A;  4KIK B;  1WE6 A;  3APF A;  2IZV B;  2O6V B;  4W9J A;  3HK0 A;  2AEH A;  4P7I A;  2KFJ A;  1RRB A;  3EC8 A;  2CHW A;  2ZCB A;  4G0N B;  4NAW A;  4WWO A;  3OJ3 A;  3ZIM A;  1KLV A;  2KX0 A;  1UZX B;  1VD2 A;  2LVO A;  4IC7 B;  1L7Y A;  4GU2 A;  1S3S G;  3CMM B;  4EZL A;  5AEK B;  3UQA A;  1LM8 B;  2M1M A;  2M4N A;  3JSV A;  3QIJ A;  4MM3 A;  2KVR A;  3UF8 A;  2FAZ A;  1WX9 A;  2IO0 B;  3AI5 A;  1IYF A;  2RD0 A;  2JXX A;  2NPT A;  2L3Z A;  4B95 A;  2BGF A;  3PRE A;  1WJU A;  2IY1 B;  2DX5 B;  2JVC A;  2LGY A;  3VQI A;  1WGD A;  2GOW A;  1WZ3 A;  5G55 A;  3ZTD A;  4MGZ E;  2LI5 A;  2ZNV B;  1V9J A;  3JYU A;  3KW5 B;  4NAW B;  2K6D B;  1RAX A;  4FA6 A;  1E5W A;  3ZO5 B;  1H8C A;  5DCN A;  1YJ1 A;  3H7P B;  1YQB A;  3V61 A;  2D07 B;  2MSE D;  2N7E A;  3W1S A;  4E74 A;  4IM3 A;  1HE8 A;  2MLB A;  3A1Q B;  4JLC A;  4OVU A;  3QK0 A;  2KZR A;  2PE9 A;  2MA9 B;  3PHX B;  3PRM B;  1RFA A;  2DZK A;  5G2N A;  4FHJ A;  2MBH A;  1X1M A;  1UBI A;  2W9N A;  2C60 A;  2MP2 B;  3EFU A;  3HIZ A;  3DOW A;  3QC8 B;  2XK5 A;  4W9G A;  3GZN I;  1EO6 A;  1V2Y A;  2EKE C;  3NHE B;  4W9K A;  2PPH A;  1E8Z A;  1NBF C;  3OLM D;  4MGY E;  5CHV C;  3TMP B;  2Y5B B;  3QAQ A;  1E8Y A;  1WX7 A;  3R7Q A;  3ZDM C;  1LQB A;  4PS8 A;  3UIO B;  3GOE A;  1P1A A;  1E7V A;  3QA8 A;  3PS6 A;  4ZYN A;  1SE9 A;  4FUL A;  4EZJ A;  4YL8 A;  3VUY A;  2D11 A;  2N9E B;  2DZI A;  2KHW B;  3ECI A;  3B1L X;  3WAL A;  4AP4 C;  4A3P A;  3H1U A;  4ICV A;  4GOC A;  2O6V D;  4NY0 A;  1U4A A;  4HDQ A;  2R2Q A;  2N9X A;  2K25 A;  4W9L A;  3RUL A;  1WR6 E;  4TUU A;  3I3T B;  2QHO A;  3NY5 A;  3RUI B;  1P0R A;  4W9F A;  2ZCC A;  2C7M B;  2JY6 A;  2Z0D B;  2YVC A;  3DCG A;  3TBL D;  2FCN A;  1J8C A;  4ASW C;  3PVL A;  2I1J A;  4MDK E;  2LD9 A;  3ZRC A;  5DPT A;  1TGZ B;  2FUH B;  2FCM A;  2DAF A;  2LAS A;  4DHZ E;  5JZE B;  3UQB A;  1T0Y A;  2KMC A;  2I1K A;  4IG7 B;  5KHO A;  4BKS A;  1H4R A;  3KVF B;  1R4N I;  4IWQ A;  1TBE A;  4NJ7 A;  3U8Z A;  4AOF A;  4I6N B;  3AU4 A;  3L16 A;  3N3K B;  3L54 A;  4FN2 A;  2FIF A;  5CHW A;  4HPM B;  2M17 A;  2RR9 A;  2PEA A;  4KDL B;  1Q5W B;  3M63 B;  3IFW B;  4GGQ A;  3ZNG C;  2CHZ A;  2LRW A;  4KDI C;  3VXW A;  4PS3 A;  1K8R B;  4BBN C;  4HCN B;  4I6P A;  2DHZ A;  2FNJ B;  2MQJ A;  1WI0 A;  4EEW A;  3ONS A;  3A4R A;  3MTN B;  2WX0 A;  3SU8 X;  3VTV A;  2GBN A;  4NNJ B;  4ZRK A;  2ZVO A;  2CR5 A;  3KUZ A;  3ZW3 A;  3DBS A;  1D3Z A;  2C7N B;  1OTR B;  2KXJ A;  2MBQ A;  4M0W B;  5J17 A;  5JH5 C;  3WAP A;  4K7W A;  4AWJ A;  3QX1 A;  4IW0 A;  4HK2 A;  4B9K A;  2IO1 B;  3SDL C;  2PJH A;  4TV3 A;  3WAO A;  3V6C B;  1Q1O A;  1C3T A;  4HLE A;  4KSL C;  2KDF B;  2Z0E B;  3TL5 A;  2KOX A;  3W1Y A;  2N7D A;  4HDO A;  4DDI D;  4HXD A;  4WWP A;  2V3S A;  4KZC A;  1WFY A;  5J18 A;  4DK5 A;  3VTU A;  4EKU A;  4X57 B;  1WGY A;  4HCP B;  3AXC A;  4CO7 A;  4BBN F;  1YIW A;  2B3A A;  4BFR A;  2NBW B;  3MJW A;  4KVG B;  2KQS A;  1WX8 A;  4JGH B;  4GMV A;  4ICU A;  3B0A A;  3PT2 B;  4RM8 A;  3T8M A;  1YD8 U;  4B6W A;  2IO3 B;  1A5R A;  4TKN A;  1P98 A;  1V80 A;  3AU5 A;  3CF6 E;  3TIX A;  2G3Q B;  5LXI B;  2JRI B;  4G50 A;  4XZ4 A;  4ANV A;  3PZD A;  2EMT A;  3BIN A;  2KWU B;  3HM6 X;  3KUD B;  4M8N A;  3ZTC A;  1ZGU B;  2KN5 A;  3KH0 A;  1WM3 A;  3RZW C;  1VCB A;  3ZRF A;  3NZU A;  1GC6 A;  4II3 B;  3LDZ E;  1WXV A;  2WWZ A;  3NOB A;  3U7D A;  2MBB B;  1R4M I;  4ANU A;  2C9W B;  3DBL I;  4GN1 A;  5CX3 A;  2CKH B;  5E6P A;  1I35 A;  3PTF C;  2D2Q A;  2GBR A;  1GUA B;  2IO2 B;  4MGI E;  1OQY A;  3ZNZ B;  2NS5 A;  2UWQ A;  4WJP A;  3DBR I;  4ANW A;  3ZLZ A;  2MBE A;  2MWS B;  1AAR A;  3U30 A;  4HPL B;  1ZW7 A;  4WAA A;  2R2O A;  4MJS B;  2CHX A;  2LUE A;  4LJO B;  3ZNH B;  1Y8R C;  3JVZ X;  1V5O A;  5BO4 B;  4DBG A;  4G3X B;  3L10 B;  3SD5 A;  3VH3 B;  4FHK A;  4M8M A;  1RLF A;  1WE7 A;  4GB9 A;  2K8C A;  3APC A;  2VRR B;  3D32 A;  2ZEQ A;  1EUV B;  1C1Y B;  3DVN V;  3DPD A;  4AJW A;  2HE7 A;  4WWN A;  3VTW A;  2LVQ A;  5L95 C;  3NS8 A;  2KO3 A;  2KC1 A;  3ALB A;  1V86 A;  2ZVN A;  3IVF A;  3DVG X;  4RMA A;  5C23 A;  3H7S A;  4BKT A;  4ZRJ A;  4GSW A;  1OEY J;  1P9D U;  2LWP A;  4GIV A;  4BVU C;  1G6J A;  1UD7 A;  1F9J A;  2CU1 A;  3DQV A;  3PLV A;  2KFK B;  2JF5 A;  4XX5 A;  5LXH A;  4E71 A;  3H7P A;  2JZZ A;  2K6Q A;  3PPA A;  3VUW A;  4EUT A;  2JWZ A;  4DXA B;  4LJP B;  2BYF A;  2ASQ A;  3TCA A;  2KK8 A;  4LCD E;  1WXM A;  5FR6 A;  3L17 A;  1WIA A;  1WGR A;  2LXC A;  1EF5 A;  3A4S C;  1TTN A;  2DAJ A;  3ML9 A;  2L00 B;  3R3M A;  4E3C A;  1SIF A;  2KMA A;  3JW0 X;  1ZKH A;  3VHT C;  3P2B A;  2DZM A;  1P3Q U;  1WJ6 A;  4N9F 4;  1GNU A;  4KSK C;  4NPN A;  1UEL A;  5LLI A;  2J7Q B;  1QZE A;  3K9O B;  2BF8 B;  2XK5 B;  4TQ0 A;  4K1R B;  4JQW C;  2KJ6 A;  4MJS A;  5E6O A;  4EFO A;  2KNB A;  1I42 A;  2DYM A;  4EOY A;  1J0G A;  1UH6 A;  2FCQ A;  2L7R A;  1WR1 A;  2MP2 A;  2NVU I;  4MEM A;  3C0R B;  5DPR A;  4XC2 A;  3WAM A;  4F1S A;  1WM2 A;  2AL6 A;  3ML8 A;  1FXT B;  3T9L A;  3QAR A;  4IWO A;  3UIN B;  4WJQ A;  1WXA A;  3DVN U;  3IG3 A;  2GBM A;  1V81 A;  2UYZ B;  1OGW A;  4F8C B;  3PHW B;  2LGD A;  4W9I A;  3DDC B;  2RPQ A;  3ZNI D;  3OJ4 B;  4DWF A;  1S1Q B;  2FCS A;  3LJ3 A;  2ZNV C;  2LRU A;  4AUQ C;  3W1S C;  5L83 A;  1WGH A;  1E8W A;  5J2R A;  2LGX A;  2ZZP B;  2JPH A;  3ENE A;  4RM9 A;  1LXD A;  4W9D A;  3L08 A;  4MEL A;  3PGE A;  3KYD D;  2NPT B;  4JL9 A;  4MSQ B;  2ZJD A;  3ZDT A;  4EZK A;  3N32 A;  3QCA A;  4NJ6 A;  2AWT A;  4WJO A;  2G4S A;  2DEN B;  1E7U A;  2IBI B;  1YX5 B;  2KFK A;  2OOB B;  4KV2 A;  2IY0 B;  2DYB A;  5AZF A;  3V62 A;  4TQ1 A;  5JHA A;  3S2A A;  4ZDV A;  3M62 B;  3RD2 A;  2NBV B;  1WGG A;  2LXA A;  1TZ1 A;  3A9J A;  3RT3 B;  1LFD A;  2KD0 A;  2L8J A;  4DDG D;  3Q3J A;  2WYQ A;  4ANX A;  4KZ0 A;  5D6J B;  2NCN A;  1V49 A;  3SHQ A;  3PRZ A;  1XQQ A;  2BWE S;  2LJ5 A;  1M94 A;  2A5U A;  4HWI B;  1Q0W B;  4FBJ B;  4K81 A;  2N4F A;  2LVP A;  1WMH B;  3UIP B;  2K8B A;  5AZG A;  2KJR A;  2V1Y A;  3VH4 B;  3A33 B;  3CSF A;  3A1Q A;  1E8X A;  2J0M A;  4MH0 E;  5CTR C;  2KWV B;  3N30 A;  2OJR A;  1WRD B;  1ISN A;  1YX6 B;  2BYE A;  4PYU A;  2D3G A;  4W9C A;  4A3O A;  2D10 A;  2M0X A;  4DHJ D;  1SGH A;  2JUO A;  4JIO U;  1V6E A;  2ZPY A;  3X23 A;  2NR2 A;  5KHQ A;  1GJZ A;  2BYV E;  1CMX B;  1XD3 B;  4WQO B;  1Z5S B;  1WMH A;  3VFK A;  3ZKJ C;  3DVG Y;  2EMS A;  2BKF A;  3VUX A;  4LDT B;  4A20 A;  5IAA C;  3RCZ A;  3WIM A;  2KJH B;  3Q3F A;  3MHS D;  4ZRI A;  2G4D B;  2N1W A;  2JRH A;  2O6V A;  3BY4 B;  2KWC A;  3TJP A;  4BOS C;  2KTR A;  1GC7 A;  2L05 A;  3QQ8 B;  1Z2M A;  4DHZ B;  2NBU A;  2RGF A;  4PYZ A;  5C1Z A;  2WDT B;  3M3J A;  2J0J A;  4HVB A;  3APD A;  3QHT A;  2KQ7 A;  2WX1 A;  1GG3 A;  2A4Z A;  5JHB A;  2K39 A;  2MBO A;  3B08 A;  4FJZ A;  4GXB A;  3R7R A;  3A9J B;  3A9K A;  5CHF A;  3WAN A;  2O2V B;  3RZF A;  2MCN B;  1WF9 A;  4PS7 A;  4URK A;  3A9K B;  3DBH I;  4IWP A;  1WYW B;  2KX3 A;  3KYC D;  2FID A;  3KUC B;  2K8H A;  5AZH A;  2G45 B;  4GDL B;  3PLU A;  2V4L A;  2K1F A;  5DPW A;  4FAD A;  2HJ8 A;  5GMV A;  1OEY A;  2AYO B;  2KDB A;  2L0T A;  5D2M B;  4HJK A;  4IM0 A;  4NQK E;  5EDS A;  1WJ4 A;  4GDL A;  1IP9 A;  1E90 A;  1KM7 A;  2KTF A;  4G11 A;  4GDK A;  2MRP A;  3AUL A;  4FLH A;  5IA7 A;  4K7U A;  3H9D A;  3WA0 A;  2C5L C;  4J6I A;  4BKG A;  2BWF A;  1J19 A;  3JSV B;  4F7Z A;  4MSM B;  3O65 B;  4LDT D;  3K9P B;  2KC2 A;  4W9H A;  1KJT A;  2O2V A;  1PQS A;  2MX2 A;  3L13 A;  3PV1 A;  4IUM B;  4MGK E;  3HM3 A;  2DYO A;  5D7G A;  3ZUN A;  3PSE B;  3EEC A;  2L0F A;  5HKH A;  2M8S A;  5D94 A;  2DZJ A;  2AL3 A;  4BOZ B;  2RSU A;  1BT0 A;  4FJV B;  1EF1 A;  2C7H A;  3ZVV A;  4OVV A;  3RYT A;  1WY8 A;  2REX A;  3NZS A;  1L2N A;  1V5T A;  3M95 A;  1KOT A;  2KTR B;  5DPS A;  2CS4 A;  2XEW A;  3L0W B;  1IPG A;  2HTH A;  2YLM A;  1WXS A;  2J0K A;  3EHV A;  4W9E A;  3V60 A;  2ZPN A;  3V6E B;  2GBJ A;  3HHM A;  2PE6 B;  4IM2 A;  2N9P C;  2XBB C;  5TR5 A;  3IHP C;  4K7S A;  2GBK A;  3CST A;  4NQL B;  2L76 A;  4WJN A;  4DHJ B;  5E6N A;  3X0W A;  2JT4 B;  1UGM A;  2LZ6 A;  1XT9 B;  1WH3 A;  2BPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...