3KYDD

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kydD00
1U4AA 2O6VA 1WFYA 1V5TA 1WZ3A 4YL8A 5CHFA 3W1SA 3SDLC 4IM0A 4FJVB 3SU8X 3VAWA 2KFKA 3QHTA 4FHJA 3IBEA 4JL9A 2KFJA 2KTRA 4HPMB 4W9FA 3ZNHB 3DVNU 1OQYA 2K1FA 5DPRA 4E74A 4RM9A 3ENEA 3HM3A 1WXSA 4G0NB 3DBRI 4NJ6A 2MP2B 1YX5B 3KYCD 1CMXB 4KV2A 4FULA 1LXDA 2GBJA 4LCDE 1C3TA 3A9KA 2DYBA 4JQWC 4ANVA 2K8BA 3QIJA 3VUWA 2C7NB 2CR5A 2R2QA 1KM7A 2XBBC 3V60A 3QAQA 3MJWA 2IY1B 3L10B 4ICVA 2PE6B 3QWZB 5L83A 4LJPB 3H7PA 2LVPA 4TKNA 2K6DB 3L17A 3PS6A 1IP9A 4DDID 4ZYNA 4W9KA 1WM3A 2IO3B 3V6CB 4PS7A 3UIPB 3UIOB 3R7QA 3V62A 3ML9A 5DPTA 2M1MA 2N7DA 2PJHA 4GB9A 3ZRFA 2BPSA 3DBLI 4NQLB 1WJ4A 5CHVC 3L54A 3T9LA 3ZNZB 4K7SA 1I42A 2KX0A 4M8MA 2CHWA 5J2RA 3GOEA 1P9DU 4WJNA 2G3QB 3PV1A 2O2VA 1RLFA 3A9JA 3Q3FA 4IWPA 1UELA 2ZCBA 3DBSA 3QJZA 3TBLD 3QK0A 2CHZA 2DX5B 3VUYA 2AEHA 2NVUI 3EC8A 3APFA 1LFDA 1YQBA 4MEMA 2AL3A 1A5RA 3AULA 4GSWA 3R66C 3MTNB 1J8CA 3ZTDA 3KYDD 1WJ6A 3ZRCA 3QQ8B 4W9IA 4AJYB 3O65B 4CYEA 1WXVA 2KO3A 2PPHA 2LD9A 3AU4A 2JZ3B 3PRPB 1X1MA 2KN5A 2REXA 3NS8A 3RUIB 3HK0A 1WGRA 4KIKA 1H4RA 2RGFA 3QA8A 3NZSA 4ASWC 2BGFA 3TCAA 3WAMA 4BBNC 5JZEB 3R7RA 5AZHA 2J7QB 1V49A 2RD0A 4W9GA 4URKA 2BYFA 2WX1A 1WMHB 2MSED 3RULA 4DWFA 1TZ1A 1GNUA 4GMVA 5C1ZA 4IC7B 5JH5C 1M94A 2G45B 4MGYE 4E71A 4ANWA 2IZVB 2KVRA 3DOWA 4XX5A 5G2NA 4DBGA 5JHBA 5J18A 4AUQC 5D6JB 1RFAA 1E7UA 3ZKJC 2MP2A 3JVZX 3DVGY 4M0WB 1WR1A 2ZZPB 4MELA 3WANA 2LRWA 3NOBA 2K8CA 3IFWB 5L95C 1Q5WB 1WE7A 4WJPA 4IG7B 2KZRA 2M17A 2MBOA 3A1QB 3PZDA 2JXXA 2MBQA 3DPDA 2KANA 3ZIMA 3V61A 4HPLB 1VD2A 1YX6B 2WX0A 4FN2A 3EECA 3H6NA 2CU1A 4HDQA 1RRBA 4NJ7A 3VQIA 1WI0A 3IVFA 2KXJA 2ASQA 4IM2A 4KDLB 2KX3A 3ONSA 5CX3A 4FA6A 2AWTA 1WX7A 1OTRB 2LXAA 2RSUA 2KNBA 1YD8U 4LDTB 3KUZA 4MJSB 5D2MB 2MRPA 2ZEQA 3T8MA 4KVGB 4IUMB 3ZTCA 3ZW3A 4BOZB 5EDSA 5JHAA 5IAAC 4WQOB 3RYTA 2KLGA 3VUXA 1H8CA 3TMPB 2NPTB 2ZCCA 1WF9A 2CS4A 4EUTA 2DZIA 2ZNVB 1Z2MA 2NCNA 2L7RA 2DAJA 3HIZA 1V5OA 5C23A 4FBJB 2NBWB 4GGQA 3H1UA 2FIDA 3VHTC 2JRHA 1UZXB 3KH0A 3MHSD 4FJZA 5DPWA 1L7YA 2GBKA 3L0WB 3SHQA 5AEKB 2HTHA 2MQJA 1WGHA 1ZKHA 3D32A 2LVOA 4NNJB 4ICUA 2KMAA 3PT2B 3U8ZA 2LXCA 2MW5A 2UWQA 4W9EA 3VH3B 3S2AA 1UBQA 3OLMD 1WIAA 1EO6A 1GJZA 3U30A 4KSLC 5AZFA 3NY5A 2DYOA 3L16A 3KUCB 4HXDA 5E6PA 2N7EA 2KMCA 1WMHA 2LGDA 2R2OA 3APDA 2BF8B 1V9JA 2NS5A 1QZEA 2ZPYA 2D3GA 3PTFC 4FJYA 4HK2A 2AL6A 2K25A 3VTUA 1NI2A 2IBIB 2JY6A 4N9F4 4E3CA 2Z59B 2PEAA 3JYUA 3DQVA 3WIMA 1IYFA 4DXAB 2BKRB 2LRUA 3EFUA 2J0KA 2MX2A 3P2BA 2XK5A 4AP4C 4DDGD 2OJRA 3JW0X 2EMTA 1E8YA 2JPHA 3UGBB 4CO7A 2KWVB 3X0WA 5KHQA 3DCGA 2MA9B 3RZWC 1UD7A 4BKTA 3DBHI 3Q3JA 5E6OA 3VVWB 2DENB 3A1QA 4P7IA 4I6PA 2L05A 2JF5A 4G3XB 2MWSB 2GBRA 2N1WA 2C9WB 1WX9A 3CMMB 4BFRA 3W1SC 1XD3B 2L8JA 4GDLB 1NBFC 4NY0A 2I1KA 4IW0A 3GZNI 1WE6A 2IO1B 1C1YB 1V6EA 5J17A 2N4FA 1UBIA 4MJSA 4GDKB 4ZRKA 3TIXA 2WDTB 4LJOB 3NHEB 1P98A 2L00B 4K1RB 3SD5A 2N9EB 2DAFA 4EKUA 1YIWA 3HM6X 4GN1A 2FCNA 3I3TB 4CHKA 2KC1A 2KDBA 2BKFA 3VXWA 2D2QA 2WYQA 2KOXA 2KK8A 2KHWB 1LM8B 1Z5SB 3QARA 2YVCA 3OJ4B 4PYZA 1Q1OA 2FIFA 2KFKB 4IWQA 2IO0B 4F1SA 2UYZB 2J0JA 2BYVE 2NR2A 1R4MI 5AZGA 4W9LA 3L08A 1XQQA 3ZO5B 2LZ6A 1VCBA 1R4NI 2LASA 2KDIA 3WAOA 4B9KA 4RM8A 2C7HA 3M63B 1V86A 5KHOA 4WWPA 1L2NA 3M95A 4A3OA 4AJWA 2ZPNA 2NBUA 1WJNA 2IO2B 2LWPA 3TJPA 3X23A 4BOSC 3KW5B 4MDKE 2LI5A 4FADA 2D10A 3K9PB 1V81A 3AXCA 4GXBA 2CHXA 4MGIE 4TUUA 3OJ3A 1WGDA 5GMVA 2L3ZA 2KTFA 4KZ0A 4B95A 3RCZA 2MLBA 2FCQA 2Z0EB 4I6NB 4TQ0A 1LQBA 1OEYA 2JZZA 3RD2A 4BKSA 3H9DA 4ZRJA 2C7MB 1Q0WB 3A4RA 3CF6E 3PLVA 3BY4B 5G55A 1TGZB 4A20A 4A3PA 3R3MA 2JUOA 2D07B 2GOWA 2KKCA 4W9DA 2L0FA 1S1QB 1E8WA 2CKHB 4FLHA 4GDLA 3ZDMC 4NAWB 2ZVNA 2KDFB 2O6VD 4HJKA 1JRUA 4GU2A 4GDKA 5CHWA 3QC8B 2KDEB 3V6EB 2LJ5A 2QHOA 2KJRA 3ECIA 3WALA 1WY8A 3CSTA 5IA7A 2VRRB 4GOCA 2IY0B 1GC7A 3ZNID 4DHJD 5D94A 3DVNV 2K6QA 4II2B 4W9JA 1WXAA 2I1JA 3QX1A 4PS3A 2AYOB 1WRDB 4WWNA 3VH4B 1IPGA 4MM3A 4ANXA 2KQ7A 2D11A 1V2YA 3VTVA 3A33B 2DYMA 2KD0A 2KJHB 3L13A 2JVCA 2M0XA 3M3JA 2V1YA 3N3KB 1WZ0A 3OAWA 2DZKA 4F8CB 4K7WA 1OEYJ 2M8SA 3PPAA 5LLIA 1RAXA 2LGYA 3PVLA 4TQ1A 4ZDVA 1WR6E 3ALBA 1D3ZA 1J19A 4EEWA 1BT0A 2XEWA 4II3B 3JSVB 1UH6A 3A4SC 4XZ4A 4F7ZA 5FR6A 4HLEA 1P1AA 4ANUA 1P3QU 5LXIB 2HE7A 1V80A 1ISNA 2M4NA 2G4SA 5E6NA 2PE9A 3PSEB 3PGEA 3B08A 2KWUB 3ZVVA 4KSKC 5DCNA 4BBNF 4OVVA 2KC2A 4AOFA 3H7SA 1ZW7A 3ZUNA 2Z0DB 4PS8A 5DPSA 2OOBB 4M8NA 1WM2A 3WAPA 1EF1A 2KLCA 3PREA 4KZCA 2BWFA 5TR5A 4G50A 3C0RB 3CSFA 4K81A 4LDTD 2MBEA 2MBHA 3NZUA 1F9JA 4EFOA 1PQSA 2ZJDA 3ZLZA 3QCAA 3VFKA 1WX8A 1NDDA 3APCA 4HDOA 2NPTA 1Y8RC 3RZFA 2B3AA 3ZDTA 4IM3A 2GMIC 1TTNA 1YJ1A 1P0RA 2GBNA 2LGXA 2LVQA 2V3SA 4IWOA 2BWES 2K39A 4NAWA 2O6VB 2G4DB 2JRIB 2W9NA 1S3SG 3EHVA 1ZGUB 2KTRB 2L0TA 3B0AA 2L76A 3RT3B 2Y5BB 2J0MA 3U7DA 4EZJA 4GIVA 1K8RB 1GC6A 2HD5B 3PHXB 4G11A 2DZJA 1KLVA 4DHJB 4NQKE 3LDZE 5D7GA 1FXTB 1SIFA 2KQSA 1MG8A 3A9KB 3UQBA 5HKHA 4KDIC 3WA0A 2LUEA 4HWIB 4OVUA 1SGHA 1E8ZA 2V4LA 4JIOU 4EZKA 3H7PB 1EF5A 1EUVB 3PRMB 4JLCA 2KJ6A 3ML8A 3IG3A 4XC2A 3UINB 4AWJA 4BKGA 4W9HA 3KVFB 5CTRC 4K7UA 4RMAA 2GBMA 4FHKA 5LXHA 3UF8A 1TBEA 2EMSA 4DHZE 1WJUA 4MSMB 2C60A 1E90A 1G6JA 2XK5B 4WJOA 3W1YA 2C5LC 2DZMA 2FCMA 1XT9B 2NBVB 2YLMA 3BINA 4WAAA 3DVGX 4W9CA 1E5WA 4HVBA 3PHWB 1WYWB 1GG3A 1WGYA 2A5UA 3JSVA 2ZNVC 4BKSD 1E8XA 1KJTA 3DDCB 4NPNA 3PLUA 4HCNB 3VDZA 1KOTA 2O2VB 2EKEC 3A9JB 3HHMA 5BO4B 3B1LX 2RR9A 3AU5A 1OGWA 3LJ3A 4TV3A 2ZVOA 1UGMA 3AI5A 3M62B 4J6IA 1I35A 2K8HA 4MGKE 4DHZB 4EOYA 4PYUA 2IYDB 3IHPC 4MGZE 3TL5A 1AARA 4ZRIA 1HE8A 1WH3A 4MH0E 2N1VA 3PRZA 4MSQB 2FNJB 2RPQA 1WGGA 4X57B 3K9OB 1SE9A 2KWCA 4WWOA 4BVUC 4JGHB 1J0GA 1E7VA 2MBBB 3N32A 4KIKB 2DHZA 2FAZA 2A4ZA 2JWZA 2BYEA 1WXMA 2MCNB 2WWZA 4EZLA 3KUDB 1GUAB 4HCPB 4DK5A 2N9XA 2FUHB 2JT4B 2N9PC 3N30A 2FCSA 3ZNGC 4B6WA 4WJQA 4I6LB 2HJ8A 3UQAA 1T0YA 3VTWA
chains in the Genus database with same CATH superfamily
4WQMA 3SDLC 4IM0A 2L1AA 3IBEA 1L6VA 4HPMB 1XLQA 1WXSA 3DBRI 2IGHA 4NJ6A 1YX5B 3HVDA 4LCDE 1D5MC 2DYBA 1J7BA 5BMHA 3QIJA 4HJGE 1NEKB 5L83A 3H7PA 3BVZA 1IP9A 3R2IA 3AN1A 2BBCA 3R7QA 4A90A 5DPTA 4YXDB 2BPSA 3KLSX 2M56B 3DBLB 3L54A 1I42A 1EM7A 2KX0A 3W9CB 5J2RA 2LGIA 3DBHB 3LYYA 1M4VA 1RLFA 3Q3FA 4IWPA 3NVVA 3QK0A 5BMIA 3NS1A 3VUYA 3MC9A 2AEHA 2NVUI 3EC8A 1LFDA 1J8CA 1QT9A 1JQ4A 5AUIA 2WNMA 2BVCA 4NJCA 3O13A 2BT6A 4C7ZA 2KN5A 3NS8A 3RUIB 1FXIA 2HDEA 3R7RA 2J7QB 3RNCC 4W9GA 2RD0A 5HI1A 1YOVB 3RULA 4DWFA 2ACZB 3MHZA 4GMVA 4KKIA 5JHBA 2PTLA 3FILA 1VZ8A 5D6JB 1FFVA 4M0WB 2G1EA 2ZZPB 4MELA 2LRWA 2N9KA 3URYA 2KAJA 1Q5WB 2KZRA 2M17A 3PZDA 3AE9B 3DPDA 3V61A 4HPLB 4FN2A 3EECA 2CU1A 3IVFA 2KXJA 2ASQA 4KDLB 5CX3A 3GE8C 3C8YA 1KRHA 2KNBA 3KUZA 4MJSB 2ZEQA 3T8MA 3ZTCA 5JHAA 5G5HA 5IAAC 4WQOB 2KLGA 4GLSC 1L5PA 4EUTA 2DZIA 1Z2MA 2RDGA 2QILA 1V5OA 4FBJB 3H1UA 4USAA 2FIDA 3VHTC 2JRHA 1UZXB 3AEGB 1EU3A 2HTHA 3D32A 4S0RA 2FE8A 2B76B 2LVOA 4NNJB 2KMAA 3N1XC 2LXCA 2MW5A 4W9EA 3VH3B 4D2KA 2QEJC 3OLMD 2KQ4X 4HKQA 1GJZA 4C7YA 1AW7A 2DYOA 5FKAC 1NENB 2LGDA 3APDA 1KH0A 1FXAA 1V9JA 3PTFC 2IBIB 4N9F4 4P1BC 2PEAA 3DQVA 2LRUA 3P4QB 2MX2A 4HKZE 4DDGD 2INPE 1BUIC 3W5VB 1A70A 4LNNA 3UGBB 4ITKA 3DBHI 3VVWB 3A1QA 2K3UA 2JF5A 2D5GA 2MWSB 4DXFA 2C9WB 2JXTA 1WX9A 3CMMB 4OZCA 1ET9A 4GDLB 4OZAA 1V6EA 3ZQ4A 4GDKB 1T3QA 4ZRKA 3TIXA 4LJOB 3NHEB 4K1RB 4EKUA 3IAS1 4GN1A 1F2RC 2KDBA 2WYQA 3V3XA 2DWQA 2KOXA 2KK8A 2KHWB 1EWYC 1TKGA 2MEKA 3QARA 5IKCM 4PYZA 1KLGD 2FIFA 3RNAC 2IO0B 3P1MA 3L08A 1R4MB 1HTQA 1R4NI 3CIRB 2LASA 4JWUC 3ZJTA 3RMKC 2IO2B 3X23A 4RCOA 3TJPA 4KX6B 3NZ3A 4FADA 4RFBA 2MLBA 2Z0EB 4DXGA 4TQ0A 1OEYA 3IT4B 3RD2A 4J3OD 3OWEB 1L4DB 4ZOHC 1HA5A 1DOIA 3FAHA 5BYSA 2WS3B 2JUOA 2L0FA 1S1QB 1TS2A 1C76A 2ZVNA 1FPYA 1JRUA 4GU2A 2QC8A 1V8CA 3QC8B 4P1CC 2QHOA 3Q3MC 1WY8A 2HJ1A 1YNTE 4YSZB 4RF1A 2IGDA 1WRDB 5IO9A 2KQ7A 4BZAA 3P4RB 2WXHA 1UWXA 3M3JA 1PDXA 1SB3C 2V1YA 3OAWA 1JWSD 5IP4D 3IT6B 2M8SA 3PPAA 1UWMA 1JWAD 1B9RA 4ZHOA 1D3ZA 1FCLA 1BT0A 2XEWA 3A4SC 4XZ4A 5FR6A 4LNIA 5LXIB 2OEDA 3B2GA 1SBBB 2HE7A 1ISNA 1F77A 2WXLA 3KQ4A 5DCNA 4BBNF 2JYTA 4AOFA 1HTOA 1WM2A 3WAPA 1EF1A 3RNBC 2KLCA 5TR5A 4G50A 4K81A 4LLGM 2MBHA 2I2YA 3CWIA 2K0PA 2N9LA 4BAXA 3BZDB 5HG2A 3HRDD 1TTNA 1YJ1A 2VZKB 3Q8EA 4TMAB 2V3SA 2K39A 2JRIB 1HQRD 1ZGUB 2L0TA 3RT3B 3U7DA 4EZJA 4GIVA 1ACCA 3PHXB 4KKJA 1FXTB 3A9KB 2LUEA 4N59A 1SIJA 1SGHA 1MG4A 1D6EC 1EUVB 3TSSA 2GRIA 2KJ6A 1K51A 3ML8A 3IG3A 4JLCA 4XC2A 4B0MA 4AWJA 2Y5CA 2IJ0A 1G6JA 2XK5B 2C5LC 2FCMA 2NBVB 3BINA 3DVGX 1E5WA 3AEAB 2A5UA 3JSVA 2WGSA 3VDZA 1KTKA 3A9JB 2J52A 4J6IA 3ZJUA 3AEDB 3ZXVA 4KGTA 3ZJVA 1UGJA 1IGCA 1SE9A 4BVUC 1E7VA 2PKOA 3RNEC 2A4ZA 4DK5A 4LNOA 3ETRA 1ZPSA 3W1SA 3KWLA 4FJVB 3QHTA 1TS3A 2RDHA 2KTRA 4W9FA 2V3PA 1OQYA 2K1FA 5DPRA 4RM9A 3ENEA 3HM3A 3BVMA 2MP2B 3KYCD 4KV2A 1C3TA 2BS2B 4JQWC 2K8BA 3VUWA 1AYFA 2CR5A 2R2QA 3V60A 1MI0A 4ICVA 4P6VF 2PE6B 4ZYSA 3QWZB 1PUTA 2WHIA 1FRRA 1DYQA 2JSVX 3L17A 3PS6A 5H92C 4ZYNA 4W9KA 1WM3A 2IO3B 4PS7A 1JMLA 3V62A 3U4EG 4YSYB 3T3OA 2M1MA 2N7DA 2PJHA 4GB9A 4NQLB 3ZNZB 4M8MA 2XNAC 3PV1A 4RF0A 2WU5B 3DBSA 3QJZA 4OZBA 1YQBA 2AL3A 1YN4A 4WWMA 3MTNB 5FR3A 4JX1C 3U52E 1VRAB 1WXVA 2LD9A 2JZ3B 1XLPA 3N1YC 5I4DA 2QCZA 3HK0A 3WAMA 5AZHA 2WX1A 5D3IB 1WMHB 2D3AA 2MSED 1GNUA 1F2RI 4IC7B 3ZXRA 1N63A 3MC8A 2V0GA 5G2NA 1ZUD2 1N60A 2G9HD 1HZ5A 5MPOA 4MACA 1N61A 3ZKJC 1DOXA 3JVZX 2MJEA 3DVGY 3WANA 3IFWB 1IBXB 1SE3A 3RI7C 2MBQA 1VD2A 1L0YB 1YX6B 2INCC 3AE3B 2ICIA 4HDQA 2W54A 1QOGA 2EELA 4IM2A 2BQQA 2Z8LA 3AMZA 3ONSA 2BS4B 4KGRA 1ZDXA 1ZP0B 1QF6A 5EDSA 1CJEA 2R61A 3RYTA 1TS5A 4UDUC 3TMPB 2DBYA 2ZCCA 1WF9A 3W5UB 1JCKB 2NCNA 2L7RA 2WXRA 3UI3A 3AE5B 4WIPA 1SEBD 3KH0A 3ZGZA 2WXFA 3ABVB 1L7YA 1ZKHA 4ICUA 1C78A 2WU2B 1WIAA 4A8XC 1EO6A 2ZW0A 3NY5A 2JWUA 4HXDA 5E6PA 2N7EA 1QZEA 1C4CA 1ZXHA 4CQNA 3VTUA 3JYUA 3WIMA 1IYFA 2CU3A 3EFUA 5IOIA 1WWTA 2OJRA 3JW0X 2AQ1B 2EMTA 1E8YA 4M0WA 1JWMD 4CO7A 3KWVA 1T5XD 1UD7A 3Q3JA 5E6OA 4N6EB 4P7IA 2LEKA 2N1WA 1ENFA 1MFWA 2L8JA 3BWUD 1WRIA 2SEBD 1BMLC 1Q10A 3GZNI 4ARIA 2IO1B 1C1YB 5J17A 1V1OA 1JRPA 4MJSA 3DHHC 1FMAD 2N9EB 3Q3OC 1YIWA 3I3TB 2BKFA 3VXWA 1IUEA 2D2QA 4MM3B 2YVCA 3OJ4B 2W3RA 4OVZA 1Q1OA 4F1SA 1AN8A 2BYVE 4YTMB 2NR2A 2YEPF 1R4NB 3WAOA 1C9FA 4RM8A 1V86A 1SSNA 3M95A 1WJNA 3B2FA 4HROA 4US9A 3VR8B 3K9PB 1V81A 3AXCA 2VH1A 4MGIE 4TUUA 5GMVA 4A6QA 2IGGA 2L3ZA 4B95A 3RCZA 4I6NB 3RN9C 2JZZA 1I4HA 3H9DA 4ZRJA 1Q0WB 3PLVA 3VR9B 1FFUA 2BB5A 1GPXA 3R3MA 2GOWA 2KKCA 2N7JA 4IOIE 3AM9A 1E8WA 2CKHB 4FLHA 4GDLA 1LGRA 1P7EA 1WSPA 3I9V1 2LHDA 2YEPB 1KF6B 4GDKA 1UUPA 1ET6A 2VH2A 2OJWA 2KDEB 2LJ5A 2KDMA 2VRRB 3ZNID 2IY0B 4II2B 1WXAA 2I1JA 2AYOB 1IPGA 4ANXA 1TY0A 1V2YA 5C2TB 3VRAB 2WXGA 3VTVA 2DYMA 3L13A 2KJHB 2JVCA 1FEHA 3L4PA 1PGAA 5C3JB 2TSSA 1FNWA 1WZ0A 3I63C 4F8CB 1TT5B 5LLIA 2LGYA 3ALBA 1VJKA 3Q8CA 4FXCA 4II3B 4HLEA 2GB1A 2M4NA 2G4SA 2WLBA 3B9JA 2ONQA 3PGEA 3ZVVA 4KSKC 4OVVA 3AB5A 4Q2JA 1ROEA 1KLUD 3CSFA 2MBEA 2L83A 1PYWD 5G5GA 4EFOA 2WXIA 3APCA 4HDOA 2NPTA 1Y8RC 1L0VB 2B3AA 2LGXA 4IWOA 1ZOYB 2O6VB 1YN3A 1HZ6A 1NVID 1S3SG 4YSXB 1CQVA 3Q14C 5EE1A 5EE9A 2HD5B 2DZJA 4DHJB 1B1ZA 4US8A 1SIFA 2KQSA 3AE8B 4KDIC 4HWIB 4OVUA 1R7SA 3GS2A 4EZKA 1EF5A 3PRMB 2WXOA 4BKGA 3UINB 5LXHA 4RMAA 1TBEA 1WJUA 4MSMB 1E90A 3Q3NC 3W1YA 2DZMA 4HVBA 3HVZA 3PHWB 1WYWB 4IKGA 1L4ZB 4NPNA 2J4XA 4HCNB 2O2VB 5BO4B 2WXNA 3AU5A 3U7ZA 2ZVOA 1UGMA 4IDIA 3M62B 2KN4A 2K8HA 2LJIA 1E10A 1F52A 2E6XA 2IYDB 3IHPC 3I57A 3TL5A 1JWBD 4MH0E 2N1VA 4MSQB 1FRDA 4WWOA 3N32A 4KIKB 1C4AA 2WWZA 2FUHB 3N30A 3ZNGC 2WQYB 4WJQA 3UQAA 2GI9A 1V5TA 3R8BA 5CHFA 3AE7B 3SU8X 2KFKA 4FHJA 3TEZA 1E0ZA 4JL9A 4P16A 1NI3A 2L32A 2DLBA 4YWGG 4G0NB 4FULA 2GBJA 3A9KA 4ANVA 1JW9D 2C7NB 2XBBC 3QAQA 1HEZE 3L10B 1D5XC 1PGXA 4L1BA 3VRBB 4TKNA 2K6DB 2MJ3A 4XGAB 3DHGC 1WYGA 4M00A 3UIPB 4NAMA 3UIOB 5CHVC 3T9LA 1ZE3D 1P9DU 2G3QB 1E9MA 3A9JA 3DHIC 1UELA 3TBLD 2CHZA 3SEBA 2DX5B 1YMHE 3APFA 3NJTA 4MEMA 3AULA 3ZTDA 3KYDD 4XWWA 4AJYB 1SE2A 4W9IA 2KO3A 2PPHA 3AU4A 4AS1A 3PRPB 1H4RA 3QA8A 1WGKA 3NZSA 4ASWC 2BGFA 5JZEB 1V49A 2BYFA 3BK1A 2IDYA 5JH5C 2G45B 1XXGA 4E71A 4ANWA 1RFKA 2IZVB 2Q5WD 3DOWA 4XX5A 1XLNA 2AX5A 4AUQC 1RFAA 1E7UA 3EGRA 2MP2A 2W55A 1TY2A 1EU4A 4L23A 2PW9A 3ZIMA 1FCCC 2MBOA 2WX0A 4R3DA 1L0XB 1QOAA 1RRBA 1WI0A 3W2DA 1VLBA 1TYGB 1CZPA 2KX3A 2H89B 3WCQA 4FA6A 4C80A 2RSUA 2LXAA 1XF5L 5D2MB 2BYTA 3VUXA 1H8CA 2XN9C 2WDQB 2E3TA 1V1PA 2D3CA 1VZ7A 3EA6A 2DAJA 3HIZA 2NBWB 1YJJA 3MHSD 4FJZA 2IPKD 3L0WB 2M19A 2MQJA 1WGHA 3U8ZA 2KT7A 1FD6A 3S2AA 1OFFA 3Q8BA 3U30A 4KSLC 5AZFA 3L16A 1WMHA 2R2OA 2BF8B 2ZPYA 4FJYA 2AL6A 2K25A 2JY6A 2WDVB 1RM6C 3AE6B 2Z59B 2QSDA 5BYRA 4DXAB 4YT0B 2BKRB 4AP4C 3AE1B 2JPHA 2Y3AA 4M02A 1IBXA 2KWVB 3X0WA 5KHQA 3DCGA 2MA9B 4K3BA 3RZWC 4BKTA 2DENB 4I6PA 2L05A 2WXJA 1TKEA 4G3XB 1FO4A 3AEEB 2X38A 1FNUA 4LNFA 1XD3B 1K50A 4NZLB 1NBFC 2I1KA 3AH7A 3GZNB 2MHJA 2PIAA 1UBIA 2K5PA 1MHXA 2WDTB 4YTPB 2KYWA 2L00B 3SD5A 3HM6X 1SF0A 2FCNA 3N1ZC 2KC1A 3NVYA 1I4RA 1GAQB 1LM8B 3N20C 1C4PA 2UYZB 2J0JA 5D3DA 1FIQA 1XQQA 2LZ6A 1VCBA 4KGSA 1K52A 2UU7A 2KDIA 4C00A 4C4VB 2QDFA 4WWPA 1L2NA 3E9SA 1FNVA 4BOSC 2LWPA 3KW5B 3Q6BA 2OHFA 4MDKE 4JE3B 2JU6X 2BB6A 2CHXA 1T0SC 3AEFB 1GB4A 2KTFA 2FCQA 1VR9A 1LQBA 4EE2A 4S17A 3DWGC 2C7MB 3CF6E 3A4RA 3FKYA 5G55A 3SR6A 1K53A 1TGZB 4A20A 1TKYA 3J9CA 3BYYB 1QKZA 1XLOA 2D07B 3EUB2 4W9DA 2VZKD 2LUMA 4NAWB 2KDFB 1T0QC 5CHWA 2PVOD 4MT5A 2KJRA 3ECIA 3CSTA 5BMGA 4GOCA 1GC7A 5D94A 2K6QA 2PVGC 4WWNA 3VH4B 4C56C 4MM3A 1YQ3B 3A33B 2KD0A 3N3KB 2DZKA 4XWTA 1OEYJ 1RAXA 4OW0A 4ZDVA 1QOBA 4JWSC 1WR6E 4XDCA 2WXMA 2HTME 2K22A 4F7ZA 2ON8A 1P3QU 2L52A 1V80A 2PE9A 2AQ3B 2V3NA 3AEBB 3PZ7A 3B08A 2SAKA 3H7SA 3FC4A 1ZW7A 4PS8A 3MJ5A 1HXYD 4M8NA 1PFDA 4KZCA 3AE2B 4N58A 3C0RB 1FM0D 1F9JA 1MJDA 2KMMA 1J7CA 2INDC 3ZLZA 3VFKA 1WX8A 1T0RC 1DGJA 4IM3A 1I4XA 2GMIC 2GBNA 3LB8C 4REZA 1ESFA 3TEYA 3MC0B 1UNSA 2Y5BB 2JX5A 1E6EB 1GC6A 1I7HA 1JWUD 4NQKE 4B0EA 3LDZE 1MG8A 3UQBA 5HKHA 2V4LA 5IN7A 2KWDA 3H7PB 2FBWB 4W9HA 1BXTA 3KVFB 5CTRC 4FHKA 1OQQA 3NVWA 1ZDVA 4WJOA 4WAAA 1XT9B 1F0ZA 1GG3A 1WGYA 4BKSD 2ZNVC 1KJTA 3DDCB 1XEEA 3PLUA 1KOTA 3HUIA 2KACA 1OGWA 3LJ3A 1N6ZA 1I35A 4MGKE 4DHZB 4EOYA 4PYUA 4MGZE 1AARA 4ZRIA 1WH3A 3K9OB 2KWCA 2WP9B 2V9HA 4JGHB 1J0GA 2MBBB 4PT5A 2DHZA 2FAZA 2JWZA 2MCNB 1WXMA 2PLPA 3NUHB 4EZLA 3KUDB 1GUAB 1Y56A 3P4PB 2N9PC 3R2TA 3TEXA 4B6WA 1QLBB 4I6LB 3Q8AA 3PT2B 1T0YA 2JQRB 3N9YC 3VTWA 1U4AA 2O6VA 2PMVA 1WFYA 1WZ3A 4YL8A 2NMQA 3VAWA 1OQRA 2WDRB 3FILB 2KFJA 3ZNHB 1XCQL 3TEWA 3DVNU 3IAM1 4E74A 1TS4A 4XDDA 3Q8FA 1CMXB 1LXDA 1C77A 2CJOA 3AECB 1KM7A 4XE0A 2RDBC 3MJWA 2IY1B 4LJPB 3SFDB 2LVPA 4WAFA 4DDID 4H2AA 3V6CB 4RGMA 2JZPA 4ZRQA 3ML9A 3ZRFA 5HHDG 3DBLI 1WJ4A 3GE3C 4K7SA 1YJIA 1QOFA 2CHWA 5JXVA 3GOEA 4WJNA 1GB1A 2O2VA 2Y5PA 2ZCBA 3H8HA 1A5RA 2AQ2B 4GSWA 3R66C 1VZ6A 3RFZB 1WJ6A 3ZRCA 3QQ8B 3O65B 4CYEA 3P63A 1X1MA 2REXA 1WGRA 4KIKA 2RGFA 3PZ8A 4BBNC 3TCAA 1XO3A 2I38A 2M0AA 1RYJA 4URKA 1WXQA 1TZ1A 5C1ZA 3V05A 1M94A 3NG0A 4MGYE 2KVRA 4DBGA 5LNK1 5J18A 1WR1A 4LK0M 1F1HA 3NOBA 2K8CA 4O1NA 4WH4A 1QILA 5L95C 1WE7A 4WJPA 4IG7B 2EKIA 3A1QB 2JXXA 2KANA 2RMMA 4ARCA 3H6NA 4NJ7A 3VQIA 2DNFA 5BYQA 1C79A 3C19A 3SFEB 1I4PA 4HPPA 3DWMA 2AWTA 1WX7A 3BYTB 1OTRB 1YD8U 4LDTB 4PK1A 2MRPA 4KVGB 4IUMB 3ZW3A 4BOZB 1SXTA 5T8IA 3RNFC 2NPTB 2CS4A 2ZNVB 4XYCA 5TSSA 5AUKA 5C23A 4GGQA 5DPWA 4ZRPA 2GBKA 3SHQA 5AEKB 4DQOC 2INNE 2MH7A 2UWQA 3I5JC 1UBQA 3KUCB 3MP9A 2KMCA 4M01A 4RGNA 2NS5A 4HK2A 2D3GA 1NI2A 4E3CA 3Q2AC 2J0KA 2J53A 3P2BA 2XK5A 1UF0A 2N0SB 1E7PB 2QMTA 1SE4A 2GBRA 1EWCA 1TJEA 4BFRA 3W1SC 4NY0A 4IW0A 3NVZA 1WE6A 3P4SB 2W3SA 2N4FA 4LTUA 1P98A 2DAFA 4CHKA 1CK1A 1N62A 1NYRA 1STEA 1Z5SB 1JALA 3IXSA 2KFKB 4IWQA 1L6UA 2J42A 2LHEA 4ZHPA 1R4MI 1I4QA 5FK9C 4W9LA 2JYEA 5AZGA 3ZO5B 4RNAA 1MPEA 5E6JA 4B9KA 2C7HA 3M63B 5KHOA 4A3OA 4AJWA 2ZPNA 2NBUA 2WXPA 3GB1A 5HFYA 2LI5A 2D10A 3GP7A 4GXBA 5H8YE 2X8XX 3RPFC 3OJ3A 1WGDA 4KZ0A 1T6BX 4BKSA 2GLSA 3BY4B 4A3PA 3RNGC 3ZDMC 3U2SC 1J7AA 2O6VD 4HJKA 3LXFA 2V4IB 3V6EB 2RPVA 4ACFA 3WALA 5IA7A 1GOZA 1IGDA 4DHJD 4TSSA 4L2YA 2LGSA 3DVNV 4W9JA 5EE3A 4PS3A 3QX1A 3TUOA 4OHJA 1YN5A 1TIFA 1N5WA 2D11A 2M0XA 2KVZA 1QQRA 4K7WA 1I4GA 1SJHD 3NRZA 3DBRB 3PVLA 4TQ1A 3BVGA 4RGOS 1J19A 4EEWA 1KFYB 3JSVB 1UH6A 1NYQA 4C4VA 1P1AA 4ANUA 5E6NA 1VDVA 2MJDA 2KWUB 4HEA1 4WURA 1YQ4B 2BS3B 2KC2A 3ZUNA 2Z0DB 5DPSA 2OOBB 1LO5D 1JROA 2NTTA 1ZXIA 4LNKA 3PREA 2BWFA 2LMCA 1RWSA 2ZW1A 4LDTD 1XCTL 3NZUA 2QIEB 1PQSA 2BW2A 2ZJDA 3QCAA 1NDDA 1N5XA 4RH6A 1V1PB 3RZFA 3ZDTA 3BIID 4RGTA 1P0RA 2H88B 4JPSA 2LVQA 2BWES 4NAWA 2G4DB 2W9NA 4HRSA 4QAYA 3EHVA 1D5ZC 1MVKA 2KTRB 3AE4B 3B0AA 2L76A 2J0MA 1K8RB 4G11A 1V97A 1KLVA 3ZYYX 4YTNB 5D7GA 1DOYA 3OG5A 4A55A 4AQ7A 3WA0A 2WXQA 3T3NA 1D4BA 1E8ZA 4JIOU 5GXGB 1PGBA 5EE0A 4K7UA 2GBMA 3AV8A 3UF8A 4DHZE 2EMSA 2C60A 2FUG1 2YLMA 4A9AA 2D3BA 2W82A 4W9CA 1SJED 2WXKA 1TZOA 1E8XA 3EFCA 3E56A 1P7FA 2BTEA 4MH8A 3PO0A 1MHHE 2EKEC 3HHMA 3B1LX 3P42A 2RR9A 3Q69A 4TV3A 3AI5A 4K3CA 2LFIA 2QJLA 2NTSA 1HE8A 3PRZA 2FNJB 2RPQA 1WGGA 4X57B 2CJNA 2K9XA 2BYEA 4HCPB 2N9XA 2JT4B 2FCSA 3BK2A 3MFGA 1AWDA 2HJ8A 3PSEB
chains in the Genus database with same CATH topology
1U4AA 2O6VA 1WFYA 1V5TA 1WZ3A 4YL8A 5CHFA 3W1SA 3SDLC 4IM0A 4FJVB 3SU8X 3VAWA 2KFKA 3QHTA 4FHJA 3IBEA 4JL9A 2KFJA 2KTRA 4HPMB 4W9FA 3ZNHB 3DVNU 1OQYA 2K1FA 5DPRA 4E74A 4RM9A 3ENEA 3HM3A 1WXSA 4G0NB 3DBRI 4NJ6A 2MP2B 1YX5B 3KYCD 1CMXB 4KV2A 4FULA 1LXDA 2GBJA 4LCDE 1C3TA 3A9KA 2DYBA 4JQWC 4ANVA 2K8BA 3QIJA 3VUWA 2C7NB 2CR5A 2R2QA 1KM7A 2XBBC 3V60A 3QAQA 3MJWA 2IY1B 3L10B 4ICVA 2PE6B 3QWZB 5L83A 4LJPB 3H7PA 2LVPA 4TKNA 2K6DB 3L17A 3PS6A 1IP9A 4DDID 4ZYNA 4W9KA 1WM3A 2IO3B 3V6CB 4PS7A 3UIPB 3UIOB 3R7QA 3V62A 3ML9A 5DPTA 2M1MA 2N7DA 2PJHA 4GB9A 3ZRFA 2BPSA 3DBLI 4NQLB 1WJ4A 5CHVC 3L54A 3T9LA 3ZNZB 4K7SA 1I42A 2KX0A 4M8MA 2CHWA 5J2RA 3GOEA 1P9DU 4WJNA 2G3QB 3PV1A 2O2VA 1RLFA 3A9JA 3Q3FA 4IWPA 1UELA 2ZCBA 3DBSA 3QJZA 3TBLD 3QK0A 2CHZA 2DX5B 3VUYA 2AEHA 2NVUI 3EC8A 3APFA 1LFDA 1YQBA 4MEMA 2AL3A 1A5RA 3AULA 4GSWA 3R66C 3MTNB 1J8CA 3ZTDA 3KYDD 1WJ6A 3ZRCA 3QQ8B 4W9IA 4AJYB 3O65B 4CYEA 1WXVA 2KO3A 2PPHA 2LD9A 3AU4A 2JZ3B 3PRPB 1X1MA 2KN5A 2REXA 3NS8A 3RUIB 3HK0A 1WGRA 4KIKA 1H4RA 2RGFA 3QA8A 3NZSA 4ASWC 2BGFA 3TCAA 3WAMA 4BBNC 5JZEB 3R7RA 5AZHA 2J7QB 1V49A 2RD0A 4W9GA 4URKA 2BYFA 2WX1A 1WMHB 2MSED 3RULA 4DWFA 1TZ1A 1GNUA 4GMVA 5C1ZA 4IC7B 5JH5C 1M94A 2G45B 4MGYE 4E71A 4ANWA 2IZVB 2KVRA 3DOWA 4XX5A 5G2NA 4DBGA 5JHBA 5J18A 4AUQC 5D6JB 1RFAA 1E7UA 3ZKJC 2MP2A 3JVZX 3DVGY 4M0WB 1WR1A 2ZZPB 4MELA 3WANA 2LRWA 3NOBA 2K8CA 3IFWB 5L95C 1Q5WB 1WE7A 4WJPA 4IG7B 2KZRA 2M17A 2MBOA 3A1QB 3PZDA 2JXXA 2MBQA 3DPDA 2KANA 3ZIMA 3V61A 4HPLB 1VD2A 1YX6B 2WX0A 4FN2A 3EECA 3H6NA 2CU1A 4HDQA 1RRBA 4NJ7A 3VQIA 1WI0A 3IVFA 2KXJA 2ASQA 4IM2A 4KDLB 2KX3A 3ONSA 5CX3A 4FA6A 2AWTA 1WX7A 1OTRB 2LXAA 2RSUA 2KNBA 1YD8U 4LDTB 3KUZA 4MJSB 5D2MB 2MRPA 2ZEQA 3T8MA 4KVGB 4IUMB 3ZTCA 3ZW3A 4BOZB 5EDSA 5JHAA 5IAAC 4WQOB 3RYTA 2KLGA 3VUXA 1H8CA 3TMPB 2NPTB 2ZCCA 1WF9A 2CS4A 4EUTA 2DZIA 2ZNVB 1Z2MA 2NCNA 2L7RA 2DAJA 3HIZA 1V5OA 5C23A 4FBJB 2NBWB 4GGQA 3H1UA 2FIDA 3VHTC 2JRHA 1UZXB 3KH0A 3MHSD 4FJZA 5DPWA 1L7YA 2GBKA 3L0WB 3SHQA 5AEKB 2HTHA 2MQJA 1WGHA 1ZKHA 3D32A 2LVOA 4NNJB 4ICUA 2KMAA 3PT2B 3U8ZA 2LXCA 2MW5A 2UWQA 4W9EA 3VH3B 3S2AA 1UBQA 3OLMD 1WIAA 1EO6A 1GJZA 3U30A 4KSLC 5AZFA 3NY5A 2DYOA 3L16A 3KUCB 4HXDA 5E6PA 2N7EA 2KMCA 1WMHA 2LGDA 2R2OA 3APDA 2BF8B 1V9JA 2NS5A 1QZEA 2ZPYA 2D3GA 3PTFC 4FJYA 4HK2A 2AL6A 2K25A 3VTUA 1NI2A 2IBIB 2JY6A 4N9F4 4E3CA 2Z59B 2PEAA 3JYUA 3DQVA 3WIMA 1IYFA 4DXAB 2BKRB 2LRUA 3EFUA 2J0KA 2MX2A 3P2BA 2XK5A 4AP4C 4DDGD 2OJRA 3JW0X 2EMTA 1E8YA 2JPHA 3UGBB 4CO7A 2KWVB 3X0WA 5KHQA 3DCGA 2MA9B 3RZWC 1UD7A 4BKTA 3DBHI 3Q3JA 5E6OA 3VVWB 2DENB 3A1QA 4P7IA 4I6PA 2L05A 2JF5A 4G3XB 2MWSB 2GBRA 2N1WA 2C9WB 1WX9A 3CMMB 4BFRA 3W1SC 1XD3B 2L8JA 4GDLB 1NBFC 4NY0A 2I1KA 4IW0A 3GZNI 1WE6A 2IO1B 1C1YB 1V6EA 5J17A 2N4FA 1UBIA 4MJSA 4GDKB 4ZRKA 3TIXA 2WDTB 4LJOB 3NHEB 1P98A 2L00B 4K1RB 3SD5A 2N9EB 2DAFA 4EKUA 1YIWA 3HM6X 4GN1A 2FCNA 3I3TB 4CHKA 2KC1A 2KDBA 2BKFA 3VXWA 2D2QA 2WYQA 2KOXA 2KK8A 2KHWB 1LM8B 1Z5SB 3QARA 2YVCA 3OJ4B 4PYZA 1Q1OA 2FIFA 2KFKB 4IWQA 2IO0B 4F1SA 2UYZB 2J0JA 2BYVE 2NR2A 1R4MI 5AZGA 4W9LA 3L08A 1XQQA 3ZO5B 2LZ6A 1VCBA 1R4NI 2LASA 2KDIA 3WAOA 4B9KA 4RM8A 2C7HA 3M63B 1V86A 5KHOA 4WWPA 1L2NA 3M95A 4A3OA 4AJWA 2ZPNA 2NBUA 1WJNA 2IO2B 2LWPA 3TJPA 3X23A 4BOSC 3KW5B 4MDKE 2LI5A 4FADA 2D10A 3K9PB 1V81A 3AXCA 4GXBA 2CHXA 4MGIE 4TUUA 3OJ3A 1WGDA 5GMVA 2L3ZA 2KTFA 4KZ0A 4B95A 3RCZA 2MLBA 2FCQA 2Z0EB 4I6NB 4TQ0A 1LQBA 1OEYA 2JZZA 3RD2A 4BKSA 3H9DA 4ZRJA 2C7MB 1Q0WB 3A4RA 3CF6E 3PLVA 3BY4B 5G55A 1TGZB 4A20A 4A3PA 3R3MA 2JUOA 2D07B 2GOWA 2KKCA 4W9DA 2L0FA 1S1QB 1E8WA 2CKHB 4FLHA 4GDLA 3ZDMC 4NAWB 2ZVNA 2KDFB 2O6VD 4HJKA 1JRUA 4GU2A 4GDKA 5CHWA 3QC8B 2KDEB 3V6EB 2LJ5A 2QHOA 2KJRA 3ECIA 3WALA 1WY8A 3CSTA 5IA7A 2VRRB 4GOCA 2IY0B 1GC7A 3ZNID 4DHJD 5D94A 3DVNV 2K6QA 4II2B 4W9JA 1WXAA 2I1JA 3QX1A 4PS3A 2AYOB 1WRDB 4WWNA 3VH4B 1IPGA 4MM3A 4ANXA 2KQ7A 2D11A 1V2YA 3VTVA 3A33B 2DYMA 2KD0A 2KJHB 3L13A 2JVCA 2M0XA 3M3JA 2V1YA 3N3KB 1WZ0A 3OAWA 2DZKA 4F8CB 4K7WA 1OEYJ 2M8SA 3PPAA 5LLIA 1RAXA 2LGYA 3PVLA 4TQ1A 4ZDVA 1WR6E 3ALBA 1D3ZA 1J19A 4EEWA 1BT0A 2XEWA 4II3B 3JSVB 1UH6A 3A4SC 4XZ4A 4F7ZA 5FR6A 4HLEA 1P1AA 4ANUA 1P3QU 5LXIB 2HE7A 1V80A 1ISNA 2M4NA 2G4SA 5E6NA 2PE9A 3PSEB 3PGEA 3B08A 2KWUB 3ZVVA 4KSKC 5DCNA 4BBNF 4OVVA 2KC2A 4AOFA 3H7SA 1ZW7A 3ZUNA 2Z0DB 4PS8A 5DPSA 2OOBB 4M8NA 1WM2A 3WAPA 1EF1A 2KLCA 3PREA 4KZCA 2BWFA 5TR5A 4G50A 3C0RB 3CSFA 4K81A 4LDTD 2MBEA 2MBHA 3NZUA 1F9JA 4EFOA 1PQSA 2ZJDA 3ZLZA 3QCAA 3VFKA 1WX8A 1NDDA 3APCA 4HDOA 2NPTA 1Y8RC 3RZFA 2B3AA 3ZDTA 4IM3A 2GMIC 1TTNA 1YJ1A 1P0RA 2GBNA 2LGXA 2LVQA 2V3SA 4IWOA 2BWES 2K39A 4NAWA 2O6VB 2G4DB 2JRIB 2W9NA 1S3SG 3EHVA 1ZGUB 2KTRB 2L0TA 3B0AA 2L76A 3RT3B 2Y5BB 2J0MA 3U7DA 4EZJA 4GIVA 1K8RB 1GC6A 2HD5B 3PHXB 4G11A 2DZJA 1KLVA 4DHJB 4NQKE 3LDZE 5D7GA 1FXTB 1SIFA 2KQSA 1MG8A 3A9KB 3UQBA 5HKHA 4KDIC 3WA0A 2LUEA 4HWIB 4OVUA 1SGHA 1E8ZA 2V4LA 4JIOU 4EZKA 3H7PB 1EF5A 1EUVB 3PRMB 4JLCA 2KJ6A 3ML8A 3IG3A 4XC2A 3UINB 4AWJA 4BKGA 4W9HA 3KVFB 5CTRC 4K7UA 4RMAA 2GBMA 4FHKA 5LXHA 3UF8A 1TBEA 2EMSA 4DHZE 1WJUA 4MSMB 2C60A 1E90A 1G6JA 2XK5B 4WJOA 3W1YA 2C5LC 2DZMA 2FCMA 1XT9B 2NBVB 2YLMA 3BINA 4WAAA 3DVGX 4W9CA 1E5WA 4HVBA 3PHWB 1WYWB 1GG3A 1WGYA 2A5UA 3JSVA 2ZNVC 4BKSD 1E8XA 1KJTA 3DDCB 4NPNA 3PLUA 4HCNB 3VDZA 1KOTA 2O2VB 2EKEC 3A9JB 3HHMA 5BO4B 3B1LX 2RR9A 3AU5A 1OGWA 3LJ3A 4TV3A 2ZVOA 1UGMA 3AI5A 3M62B 4J6IA 1I35A 2K8HA 4MGKE 4DHZB 4EOYA 4PYUA 2IYDB 3IHPC 4MGZE 3TL5A 1AARA 4ZRIA 1HE8A 1WH3A 4MH0E 2N1VA 3PRZA 4MSQB 2FNJB 2RPQA 1WGGA 4X57B 3K9OB 1SE9A 2KWCA 4WWOA 4BVUC 4JGHB 1J0GA 1E7VA 2MBBB 3N32A 4KIKB 2DHZA 2FAZA 2A4ZA 2JWZA 2BYEA 1WXMA 2MCNB 2WWZA 4EZLA 3KUDB 1GUAB 4HCPB 4DK5A 2N9XA 2FUHB 2JT4B 2N9PC 3N30A 2FCSA 3ZNGC 4B6WA 4WJQA 4I6LB 2HJ8A 3UQAA 1T0YA 3VTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4A A;  2O6V A;  1WFY A;  1V5T A;  1WZ3 A;  4YL8 A;  5CHF A;  3W1S A;  3SDL C;  4IM0 A;  4FJV B;  3SU8 X;  3VAW A;  2KFK A;  3QHT A;  4FHJ A;  3IBE A;  4JL9 A;  2KFJ A;  2KTR A;  4HPM B;  4W9F A;  3ZNH B;  3DVN U;  1OQY A;  2K1F A;  5DPR A;  4E74 A;  4RM9 A;  3ENE A;  3HM3 A;  1WXS A;  4G0N B;  3DBR I;  4NJ6 A;  2MP2 B;  1YX5 B;  3KYC D;  1CMX B;  4KV2 A;  4FUL A;  1LXD A;  2GBJ A;  4LCD E;  1C3T A;  3A9K A;  2DYB A;  4JQW C;  4ANV A;  2K8B A;  3QIJ A;  3VUW A;  2C7N B;  2CR5 A;  2R2Q A;  1KM7 A;  2XBB C;  3V60 A;  3QAQ A;  3MJW A;  2IY1 B;  3L10 B;  4ICV A;  2PE6 B;  3QWZ B;  5L83 A;  4LJP B;  3H7P A;  2LVP A;  4TKN A;  2K6D B;  3L17 A;  3PS6 A;  1IP9 A;  4DDI D;  4ZYN A;  4W9K A;  1WM3 A;  2IO3 B;  3V6C B;  4PS7 A;  3UIP B;  3UIO B;  3R7Q A;  3V62 A;  3ML9 A;  5DPT A;  2M1M A;  2N7D A;  2PJH A;  4GB9 A;  3ZRF A;  2BPS A;  3DBL I;  4NQL B;  1WJ4 A;  5CHV C;  3L54 A;  3T9L A;  3ZNZ B;  4K7S A;  1I42 A;  2KX0 A;  4M8M A;  2CHW A;  5J2R A;  3GOE A;  1P9D U;  4WJN A;  2G3Q B;  3PV1 A;  2O2V A;  1RLF A;  3A9J A;  3Q3F A;  4IWP A;  1UEL A;  2ZCB A;  3DBS A;  3QJZ A;  3TBL D;  3QK0 A;  2CHZ A;  2DX5 B;  3VUY A;  2AEH A;  2NVU I;  3EC8 A;  3APF A;  1LFD A;  1YQB A;  4MEM A;  2AL3 A;  1A5R A;  3AUL A;  4GSW A;  3R66 C;  3MTN B;  1J8C A;  3ZTD A;  3KYD D;  1WJ6 A;  3ZRC A;  3QQ8 B;  4W9I A;  4AJY B;  3O65 B;  4CYE A;  1WXV A;  2KO3 A;  2PPH A;  2LD9 A;  3AU4 A;  2JZ3 B;  3PRP B;  1X1M A;  2KN5 A;  2REX A;  3NS8 A;  3RUI B;  3HK0 A;  1WGR A;  4KIK A;  1H4R A;  2RGF A;  3QA8 A;  3NZS A;  4ASW C;  2BGF A;  3TCA A;  3WAM A;  4BBN C;  5JZE B;  3R7R A;  5AZH A;  2J7Q B;  1V49 A;  2RD0 A;  4W9G A;  4URK A;  2BYF A;  2WX1 A;  1WMH B;  2MSE D;  3RUL A;  4DWF A;  1TZ1 A;  1GNU A;  4GMV A;  5C1Z A;  4IC7 B;  5JH5 C;  1M94 A;  2G45 B;  4MGY E;  4E71 A;  4ANW A;  2IZV B;  2KVR A;  3DOW A;  4XX5 A;  5G2N A;  4DBG A;  5JHB A;  5J18 A;  4AUQ C;  5D6J B;  1RFA A;  1E7U A;  3ZKJ C;  2MP2 A;  3JVZ X;  3DVG Y;  4M0W B;  1WR1 A;  2ZZP B;  4MEL A;  3WAN A;  2LRW A;  3NOB A;  2K8C A;  3IFW B;  5L95 C;  1Q5W B;  1WE7 A;  4WJP A;  4IG7 B;  2KZR A;  2M17 A;  2MBO A;  3A1Q B;  3PZD A;  2JXX A;  2MBQ A;  3DPD A;  2KAN A;  3ZIM A;  3V61 A;  4HPL B;  1VD2 A;  1YX6 B;  2WX0 A;  4FN2 A;  3EEC A;  3H6N A;  2CU1 A;  4HDQ A;  1RRB A;  4NJ7 A;  3VQI A;  1WI0 A;  3IVF A;  2KXJ A;  2ASQ A;  4IM2 A;  4KDL B;  2KX3 A;  3ONS A;  5CX3 A;  4FA6 A;  2AWT A;  1WX7 A;  1OTR B;  2LXA A;  2RSU A;  2KNB A;  1YD8 U;  4LDT B;  3KUZ A;  4MJS B;  5D2M B;  2MRP A;  2ZEQ A;  3T8M A;  4KVG B;  4IUM B;  3ZTC A;  3ZW3 A;  4BOZ B;  5EDS A;  5JHA A;  5IAA C;  4WQO B;  3RYT A;  2KLG A;  3VUX A;  1H8C A;  3TMP B;  2NPT B;  2ZCC A;  1WF9 A;  2CS4 A;  4EUT A;  2DZI A;  2ZNV B;  1Z2M A;  2NCN A;  2L7R A;  2DAJ A;  3HIZ A;  1V5O A;  5C23 A;  4FBJ B;  2NBW B;  4GGQ A;  3H1U A;  2FID A;  3VHT C;  2JRH A;  1UZX B;  3KH0 A;  3MHS D;  4FJZ A;  5DPW A;  1L7Y A;  2GBK A;  3L0W B;  3SHQ A;  5AEK B;  2HTH A;  2MQJ A;  1WGH A;  1ZKH A;  3D32 A;  2LVO A;  4NNJ B;  4ICU A;  2KMA A;  3PT2 B;  3U8Z A;  2LXC A;  2MW5 A;  2UWQ A;  4W9E A;  3VH3 B;  3S2A A;  1UBQ A;  3OLM D;  1WIA A;  1EO6 A;  1GJZ A;  3U30 A;  4KSL C;  5AZF A;  3NY5 A;  2DYO A;  3L16 A;  3KUC B;  4HXD A;  5E6P A;  2N7E A;  2KMC A;  1WMH A;  2LGD A;  2R2O A;  3APD A;  2BF8 B;  1V9J A;  2NS5 A;  1QZE A;  2ZPY A;  2D3G A;  3PTF C;  4FJY A;  4HK2 A;  2AL6 A;  2K25 A;  3VTU A;  1NI2 A;  2IBI B;  2JY6 A;  4N9F 4;  4E3C A;  2Z59 B;  2PEA A;  3JYU A;  3DQV A;  3WIM A;  1IYF A;  4DXA B;  2BKR B;  2LRU A;  3EFU A;  2J0K A;  2MX2 A;  3P2B A;  2XK5 A;  4AP4 C;  4DDG D;  2OJR A;  3JW0 X;  2EMT A;  1E8Y A;  2JPH A;  3UGB B;  4CO7 A;  2KWV B;  3X0W A;  5KHQ A;  3DCG A;  2MA9 B;  3RZW C;  1UD7 A;  4BKT A;  3DBH I;  3Q3J A;  5E6O A;  3VVW B;  2DEN B;  3A1Q A;  4P7I A;  4I6P A;  2L05 A;  2JF5 A;  4G3X B;  2MWS B;  2GBR A;  2N1W A;  2C9W B;  1WX9 A;  3CMM B;  4BFR A;  3W1S C;  1XD3 B;  2L8J A;  4GDL B;  1NBF C;  4NY0 A;  2I1K A;  4IW0 A;  3GZN I;  1WE6 A;  2IO1 B;  1C1Y B;  1V6E A;  5J17 A;  2N4F A;  1UBI A;  4MJS A;  4GDK B;  4ZRK A;  3TIX A;  2WDT B;  4LJO B;  3NHE B;  1P98 A;  2L00 B;  4K1R B;  3SD5 A;  2N9E B;  2DAF A;  4EKU A;  1YIW A;  3HM6 X;  4GN1 A;  2FCN A;  3I3T B;  4CHK A;  2KC1 A;  2KDB A;  2BKF A;  3VXW A;  2D2Q A;  2WYQ A;  2KOX A;  2KK8 A;  2KHW B;  1LM8 B;  1Z5S B;  3QAR A;  2YVC A;  3OJ4 B;  4PYZ A;  1Q1O A;  2FIF A;  2KFK B;  4IWQ A;  2IO0 B;  4F1S A;  2UYZ B;  2J0J A;  2BYV E;  2NR2 A;  1R4M I;  5AZG A;  4W9L A;  3L08 A;  1XQQ A;  3ZO5 B;  2LZ6 A;  1VCB A;  1R4N I;  2LAS A;  2KDI A;  3WAO A;  4B9K A;  4RM8 A;  2C7H A;  3M63 B;  1V86 A;  5KHO A;  4WWP A;  1L2N A;  3M95 A;  4A3O A;  4AJW A;  2ZPN A;  2NBU A;  1WJN A;  2IO2 B;  2LWP A;  3TJP A;  3X23 A;  4BOS C;  3KW5 B;  4MDK E;  2LI5 A;  4FAD A;  2D10 A;  3K9P B;  1V81 A;  3AXC A;  4GXB A;  2CHX A;  4MGI E;  4TUU A;  3OJ3 A;  1WGD A;  5GMV A;  2L3Z A;  2KTF A;  4KZ0 A;  4B95 A;  3RCZ A;  2MLB A;  2FCQ A;  2Z0E B;  4I6N B;  4TQ0 A;  1LQB A;  1OEY A;  2JZZ A;  3RD2 A;  4BKS A;  3H9D A;  4ZRJ A;  2C7M B;  1Q0W B;  3A4R A;  3CF6 E;  3PLV A;  3BY4 B;  5G55 A;  1TGZ B;  4A20 A;  4A3P A;  3R3M A;  2JUO A;  2D07 B;  2GOW A;  2KKC A;  4W9D A;  2L0F A;  1S1Q B;  1E8W A;  2CKH B;  4FLH A;  4GDL A;  3ZDM C;  4NAW B;  2ZVN A;  2KDF B;  2O6V D;  4HJK A;  1JRU A;  4GU2 A;  4GDK A;  5CHW A;  3QC8 B;  2KDE B;  3V6E B;  2LJ5 A;  2QHO A;  2KJR A;  3ECI A;  3WAL A;  1WY8 A;  3CST A;  5IA7 A;  2VRR B;  4GOC A;  2IY0 B;  1GC7 A;  3ZNI D;  4DHJ D;  5D94 A;  3DVN V;  2K6Q A;  4II2 B;  4W9J A;  1WXA A;  2I1J A;  3QX1 A;  4PS3 A;  2AYO B;  1WRD B;  4WWN A;  3VH4 B;  1IPG A;  4MM3 A;  4ANX A;  2KQ7 A;  2D11 A;  1V2Y A;  3VTV A;  3A33 B;  2DYM A;  2KD0 A;  2KJH B;  3L13 A;  2JVC A;  2M0X A;  3M3J A;  2V1Y A;  3N3K B;  1WZ0 A;  3OAW A;  2DZK A;  4F8C B;  4K7W A;  1OEY J;  2M8S A;  3PPA A;  5LLI A;  1RAX A;  2LGY A;  3PVL A;  4TQ1 A;  4ZDV A;  1WR6 E;  3ALB A;  1D3Z A;  1J19 A;  4EEW A;  1BT0 A;  2XEW A;  4II3 B;  3JSV B;  1UH6 A;  3A4S C;  4XZ4 A;  4F7Z A;  5FR6 A;  4HLE A;  1P1A A;  4ANU A;  1P3Q U;  5LXI B;  2HE7 A;  1V80 A;  1ISN A;  2M4N A;  2G4S A;  5E6N A;  2PE9 A;  3PSE B;  3PGE A;  3B08 A;  2KWU B;  3ZVV A;  4KSK C;  5DCN A;  4BBN F;  4OVV A;  2KC2 A;  4AOF A;  3H7S A;  1ZW7 A;  3ZUN A;  2Z0D B;  4PS8 A;  5DPS A;  2OOB B;  4M8N A;  1WM2 A;  3WAP A;  1EF1 A;  2KLC A;  3PRE A;  4KZC A;  2BWF A;  5TR5 A;  4G50 A;  3C0R B;  3CSF A;  4K81 A;  4LDT D;  2MBE A;  2MBH A;  3NZU A;  1F9J A;  4EFO A;  1PQS A;  2ZJD A;  3ZLZ A;  3QCA A;  3VFK A;  1WX8 A;  1NDD A;  3APC A;  4HDO A;  2NPT A;  1Y8R C;  3RZF A;  2B3A A;  3ZDT A;  4IM3 A;  2GMI C;  1TTN A;  1YJ1 A;  1P0R A;  2GBN A;  2LGX A;  2LVQ A;  2V3S A;  4IWO A;  2BWE S;  2K39 A;  4NAW A;  2O6V B;  2G4D B;  2JRI B;  2W9N A;  1S3S G;  3EHV A;  1ZGU B;  2KTR B;  2L0T A;  3B0A A;  2L76 A;  3RT3 B;  2Y5B B;  2J0M A;  3U7D A;  4EZJ A;  4GIV A;  1K8R B;  1GC6 A;  2HD5 B;  3PHX B;  4G11 A;  2DZJ A;  1KLV A;  4DHJ B;  4NQK E;  3LDZ E;  5D7G A;  1FXT B;  1SIF A;  2KQS A;  1MG8 A;  3A9K B;  3UQB A;  5HKH A;  4KDI C;  3WA0 A;  2LUE A;  4HWI B;  4OVU A;  1SGH A;  1E8Z A;  2V4L A;  4JIO U;  4EZK A;  3H7P B;  1EF5 A;  1EUV B;  3PRM B;  4JLC A;  2KJ6 A;  3ML8 A;  3IG3 A;  4XC2 A;  3UIN B;  4AWJ A;  4BKG A;  4W9H A;  3KVF B;  5CTR C;  4K7U A;  4RMA A;  2GBM A;  4FHK A;  5LXH A;  3UF8 A;  1TBE A;  2EMS A;  4DHZ E;  1WJU A;  4MSM B;  2C60 A;  1E90 A;  1G6J A;  2XK5 B;  4WJO A;  3W1Y A;  2C5L C;  2DZM A;  2FCM A;  1XT9 B;  2NBV B;  2YLM A;  3BIN A;  4WAA A;  3DVG X;  4W9C A;  1E5W A;  4HVB A;  3PHW B;  1WYW B;  1GG3 A;  1WGY A;  2A5U A;  3JSV A;  2ZNV C;  4BKS D;  1E8X A;  1KJT A;  3DDC B;  4NPN A;  3PLU A;  4HCN B;  3VDZ A;  1KOT A;  2O2V B;  2EKE C;  3A9J B;  3HHM A;  5BO4 B;  3B1L X;  2RR9 A;  3AU5 A;  1OGW A;  3LJ3 A;  4TV3 A;  2ZVO A;  1UGM A;  3AI5 A;  3M62 B;  4J6I A;  1I35 A;  2K8H A;  4MGK E;  4DHZ B;  4EOY A;  4PYU A;  2IYD B;  3IHP C;  4MGZ E;  3TL5 A;  1AAR A;  4ZRI A;  1HE8 A;  1WH3 A;  4MH0 E;  2N1V A;  3PRZ A;  4MSQ B;  2FNJ B;  2RPQ A;  1WGG A;  4X57 B;  3K9O B;  1SE9 A;  2KWC A;  4WWO A;  4BVU C;  4JGH B;  1J0G A;  1E7V A;  2MBB B;  3N32 A;  4KIK B;  2DHZ A;  2FAZ A;  2A4Z A;  2JWZ A;  2BYE A;  1WXM A;  2MCN B;  2WWZ A;  4EZL A;  3KUD B;  1GUA B;  4HCP B;  4DK5 A;  2N9X A;  2FUH B;  2JT4 B;  2N9P C;  3N30 A;  2FCS A;  3ZNG C;  4B6W A;  4WJQ A;  4I6L B;  2HJ8 A;  3UQA A;  1T0Y A;  3VTW A; 
#chains in the Genus database with same CATH topology
 4WQM A;  3SDL C;  4IM0 A;  2L1A A;  3IBE A;  1L6V A;  4HPM B;  1XLQ A;  1WXS A;  3DBR I;  2IGH A;  4NJ6 A;  1YX5 B;  3HVD A;  4LCD E;  1D5M C;  2DYB A;  1J7B A;  5BMH A;  3QIJ A;  4HJG E;  1NEK B;  5L83 A;  3H7P A;  3BVZ A;  1IP9 A;  3R2I A;  3AN1 A;  2BBC A;  3R7Q A;  4A90 A;  5DPT A;  4YXD B;  2BPS A;  3KLS X;  2M56 B;  3DBL B;  3L54 A;  1I42 A;  1EM7 A;  2KX0 A;  3W9C B;  5J2R A;  2LGI A;  3DBH B;  3LYY A;  1M4V A;  1RLF A;  3Q3F A;  4IWP A;  3NVV A;  3QK0 A;  5BMI A;  3NS1 A;  3VUY A;  3MC9 A;  2AEH A;  2NVU I;  3EC8 A;  1LFD A;  1J8C A;  1QT9 A;  1JQ4 A;  5AUI A;  2WNM A;  2BVC A;  4NJC A;  3O13 A;  2BT6 A;  4C7Z A;  2KN5 A;  3NS8 A;  3RUI B;  1FXI A;  2HDE A;  3R7R A;  2J7Q B;  3RNC C;  4W9G A;  2RD0 A;  5HI1 A;  1YOV B;  3RUL A;  4DWF A;  2ACZ B;  3MHZ A;  4GMV A;  4KKI A;  5JHB A;  2PTL A;  3FIL A;  1VZ8 A;  5D6J B;  1FFV A;  4M0W B;  2G1E A;  2ZZP B;  4MEL A;  2LRW A;  2N9K A;  3URY A;  2KAJ A;  1Q5W B;  2KZR A;  2M17 A;  3PZD A;  3AE9 B;  3DPD A;  3V61 A;  4HPL B;  4FN2 A;  3EEC A;  2CU1 A;  3IVF A;  2KXJ A;  2ASQ A;  4KDL B;  5CX3 A;  3GE8 C;  3C8Y A;  1KRH A;  2KNB A;  3KUZ A;  4MJS B;  2ZEQ A;  3T8M A;  3ZTC A;  5JHA A;  5G5H A;  5IAA C;  4WQO B;  2KLG A;  4GLS C;  1L5P A;  4EUT A;  2DZI A;  1Z2M A;  2RDG A;  2QIL A;  1V5O A;  4FBJ B;  3H1U A;  4USA A;  2FID A;  3VHT C;  2JRH A;  1UZX B;  3AEG B;  1EU3 A;  2HTH A;  3D32 A;  4S0R A;  2FE8 A;  2B76 B;  2LVO A;  4NNJ B;  2KMA A;  3N1X C;  2LXC A;  2MW5 A;  4W9E A;  3VH3 B;  4D2K A;  2QEJ C;  3OLM D;  2KQ4 X;  4HKQ A;  1GJZ A;  4C7Y A;  1AW7 A;  2DYO A;  5FKA C;  1NEN B;  2LGD A;  3APD A;  1KH0 A;  1FXA A;  1V9J A;  3PTF C;  2IBI B;  4N9F 4;  4P1B C;  2PEA A;  3DQV A;  2LRU A;  3P4Q B;  2MX2 A;  4HKZ E;  4DDG D;  2INP E;  1BUI C;  3W5V B;  1A70 A;  4LNN A;  3UGB B;  4ITK A;  3DBH I;  3VVW B;  3A1Q A;  2K3U A;  2JF5 A;  2D5G A;  2MWS B;  4DXF A;  2C9W B;  2JXT A;  1WX9 A;  3CMM B;  4OZC A;  1ET9 A;  4GDL B;  4OZA A;  1V6E A;  3ZQ4 A;  4GDK B;  1T3Q A;  4ZRK A;  3TIX A;  4LJO B;  3NHE B;  4K1R B;  4EKU A;  3IAS 1;  4GN1 A;  1F2R C;  2KDB A;  2WYQ A;  3V3X A;  2DWQ A;  2KOX A;  2KK8 A;  2KHW B;  1EWY C;  1TKG A;  2MEK A;  3QAR A;  5IKC M;  4PYZ A;  1KLG D;  2FIF A;  3RNA C;  2IO0 B;  3P1M A;  3L08 A;  1R4M B;  1HTQ A;  1R4N I;  3CIR B;  2LAS A;  4JWU C;  3ZJT A;  3RMK C;  2IO2 B;  3X23 A;  4RCO A;  3TJP A;  4KX6 B;  3NZ3 A;  4FAD A;  4RFB A;  2MLB A;  2Z0E B;  4DXG A;  4TQ0 A;  1OEY A;  3IT4 B;  3RD2 A;  4J3O D;  3OWE B;  1L4D B;  4ZOH C;  1HA5 A;  1DOI A;  3FAH A;  5BYS A;  2WS3 B;  2JUO A;  2L0F A;  1S1Q B;  1TS2 A;  1C76 A;  2ZVN A;  1FPY A;  1JRU A;  4GU2 A;  2QC8 A;  1V8C A;  3QC8 B;  4P1C C;  2QHO A;  3Q3M C;  1WY8 A;  2HJ1 A;  1YNT E;  4YSZ B;  4RF1 A;  2IGD A;  1WRD B;  5IO9 A;  2KQ7 A;  4BZA A;  3P4R B;  2WXH A;  1UWX A;  3M3J A;  1PDX A;  1SB3 C;  2V1Y A;  3OAW A;  1JWS D;  5IP4 D;  3IT6 B;  2M8S A;  3PPA A;  1UWM A;  1JWA D;  1B9R A;  4ZHO A;  1D3Z A;  1FCL A;  1BT0 A;  2XEW A;  3A4S C;  4XZ4 A;  5FR6 A;  4LNI A;  5LXI B;  2OED A;  3B2G A;  1SBB B;  2HE7 A;  1ISN A;  1F77 A;  2WXL A;  3KQ4 A;  5DCN A;  4BBN F;  2JYT A;  4AOF A;  1HTO A;  1WM2 A;  3WAP A;  1EF1 A;  3RNB C;  2KLC A;  5TR5 A;  4G50 A;  4K81 A;  4LLG M;  2MBH A;  2I2Y A;  3CWI A;  2K0P A;  2N9L A;  4BAX A;  3BZD B;  5HG2 A;  3HRD D;  1TTN A;  1YJ1 A;  2VZK B;  3Q8E A;  4TMA B;  2V3S A;  2K39 A;  2JRI B;  1HQR D;  1ZGU B;  2L0T A;  3RT3 B;  3U7D A;  4EZJ A;  4GIV A;  1ACC A;  3PHX B;  4KKJ A;  1FXT B;  3A9K B;  2LUE A;  4N59 A;  1SIJ A;  1SGH A;  1MG4 A;  1D6E C;  1EUV B;  3TSS A;  2GRI A;  2KJ6 A;  1K51 A;  3ML8 A;  3IG3 A;  4JLC A;  4XC2 A;  4B0M A;  4AWJ A;  2Y5C A;  2IJ0 A;  1G6J A;  2XK5 B;  2C5L C;  2FCM A;  2NBV B;  3BIN A;  3DVG X;  1E5W A;  3AEA B;  2A5U A;  3JSV A;  2WGS A;  3VDZ A;  1KTK A;  3A9J B;  2J52 A;  4J6I A;  3ZJU A;  3AED B;  3ZXV A;  4KGT A;  3ZJV A;  1UGJ A;  1IGC A;  1SE9 A;  4BVU C;  1E7V A;  2PKO A;  3RNE C;  2A4Z A;  4DK5 A;  4LNO A;  3ETR A;  1ZPS A;  3W1S A;  3KWL A;  4FJV B;  3QHT A;  1TS3 A;  2RDH A;  2KTR A;  4W9F A;  2V3P A;  1OQY A;  2K1F A;  5DPR A;  4RM9 A;  3ENE A;  3HM3 A;  3BVM A;  2MP2 B;  3KYC D;  4KV2 A;  1C3T A;  2BS2 B;  4JQW C;  2K8B A;  3VUW A;  1AYF A;  2CR5 A;  2R2Q A;  3V60 A;  1MI0 A;  4ICV A;  4P6V F;  2PE6 B;  4ZYS A;  3QWZ B;  1PUT A;  2WHI A;  1FRR A;  1DYQ A;  2JSV X;  3L17 A;  3PS6 A;  5H92 C;  4ZYN A;  4W9K A;  1WM3 A;  2IO3 B;  4PS7 A;  1JML A;  3V62 A;  3U4E G;  4YSY B;  3T3O A;  2M1M A;  2N7D A;  2PJH A;  4GB9 A;  4NQL B;  3ZNZ B;  4M8M A;  2XNA C;  3PV1 A;  4RF0 A;  2WU5 B;  3DBS A;  3QJZ A;  4OZB A;  1YQB A;  2AL3 A;  1YN4 A;  4WWM A;  3MTN B;  5FR3 A;  4JX1 C;  3U52 E;  1VRA B;  1WXV A;  2LD9 A;  2JZ3 B;  1XLP A;  3N1Y C;  5I4D A;  2QCZ A;  3HK0 A;  3WAM A;  5AZH A;  2WX1 A;  5D3I B;  1WMH B;  2D3A A;  2MSE D;  1GNU A;  1F2R I;  4IC7 B;  3ZXR A;  1N63 A;  3MC8 A;  2V0G A;  5G2N A;  1ZUD 2;  1N60 A;  2G9H D;  1HZ5 A;  5MPO A;  4MAC A;  1N61 A;  3ZKJ C;  1DOX A;  3JVZ X;  2MJE A;  3DVG Y;  3WAN A;  3IFW B;  1IBX B;  1SE3 A;  3RI7 C;  2MBQ A;  1VD2 A;  1L0Y B;  1YX6 B;  2INC C;  3AE3 B;  2ICI A;  4HDQ A;  2W54 A;  1QOG A;  2EEL A;  4IM2 A;  2BQQ A;  2Z8L A;  3AMZ A;  3ONS A;  2BS4 B;  4KGR A;  1ZDX A;  1ZP0 B;  1QF6 A;  5EDS A;  1CJE A;  2R61 A;  3RYT A;  1TS5 A;  4UDU C;  3TMP B;  2DBY A;  2ZCC A;  1WF9 A;  3W5U B;  1JCK B;  2NCN A;  2L7R A;  2WXR A;  3UI3 A;  3AE5 B;  4WIP A;  1SEB D;  3KH0 A;  3ZGZ A;  2WXF A;  3ABV B;  1L7Y A;  1ZKH A;  4ICU A;  1C78 A;  2WU2 B;  1WIA A;  4A8X C;  1EO6 A;  2ZW0 A;  3NY5 A;  2JWU A;  4HXD A;  5E6P A;  2N7E A;  1QZE A;  1C4C A;  1ZXH A;  4CQN A;  3VTU A;  3JYU A;  3WIM A;  1IYF A;  2CU3 A;  3EFU A;  5IOI A;  1WWT A;  2OJR A;  3JW0 X;  2AQ1 B;  2EMT A;  1E8Y A;  4M0W A;  1JWM D;  4CO7 A;  3KWV A;  1T5X D;  1UD7 A;  3Q3J A;  5E6O A;  4N6E B;  4P7I A;  2LEK A;  2N1W A;  1ENF A;  1MFW A;  2L8J A;  3BWU D;  1WRI A;  2SEB D;  1BML C;  1Q10 A;  3GZN I;  4ARI A;  2IO1 B;  1C1Y B;  5J17 A;  1V1O A;  1JRP A;  4MJS A;  3DHH C;  1FMA D;  2N9E B;  3Q3O C;  1YIW A;  3I3T B;  2BKF A;  3VXW A;  1IUE A;  2D2Q A;  4MM3 B;  2YVC A;  3OJ4 B;  2W3R A;  4OVZ A;  1Q1O A;  4F1S A;  1AN8 A;  2BYV E;  4YTM B;  2NR2 A;  2YEP F;  1R4N B;  3WAO A;  1C9F A;  4RM8 A;  1V86 A;  1SSN A;  3M95 A;  1WJN A;  3B2F A;  4HRO A;  4US9 A;  3VR8 B;  3K9P B;  1V81 A;  3AXC A;  2VH1 A;  4MGI E;  4TUU A;  5GMV A;  4A6Q A;  2IGG A;  2L3Z A;  4B95 A;  3RCZ A;  4I6N B;  3RN9 C;  2JZZ A;  1I4H A;  3H9D A;  4ZRJ A;  1Q0W B;  3PLV A;  3VR9 B;  1FFU A;  2BB5 A;  1GPX A;  3R3M A;  2GOW A;  2KKC A;  2N7J A;  4IOI E;  3AM9 A;  1E8W A;  2CKH B;  4FLH A;  4GDL A;  1LGR A;  1P7E A;  1WSP A;  3I9V 1;  2LHD A;  2YEP B;  1KF6 B;  4GDK A;  1UUP A;  1ET6 A;  2VH2 A;  2OJW A;  2KDE B;  2LJ5 A;  2KDM A;  2VRR B;  3ZNI D;  2IY0 B;  4II2 B;  1WXA A;  2I1J A;  2AYO B;  1IPG A;  4ANX A;  1TY0 A;  1V2Y A;  5C2T B;  3VRA B;  2WXG A;  3VTV A;  2DYM A;  3L13 A;  2KJH B;  2JVC A;  1FEH A;  3L4P A;  1PGA A;  5C3J B;  2TSS A;  1FNW A;  1WZ0 A;  3I63 C;  4F8C B;  1TT5 B;  5LLI A;  2LGY A;  3ALB A;  1VJK A;  3Q8C A;  4FXC A;  4II3 B;  4HLE A;  2GB1 A;  2M4N A;  2G4S A;  2WLB A;  3B9J A;  2ONQ A;  3PGE A;  3ZVV A;  4KSK C;  4OVV A;  3AB5 A;  4Q2J A;  1ROE A;  1KLU D;  3CSF A;  2MBE A;  2L83 A;  1PYW D;  5G5G A;  4EFO A;  2WXI A;  3APC A;  4HDO A;  2NPT A;  1Y8R C;  1L0V B;  2B3A A;  2LGX A;  4IWO A;  1ZOY B;  2O6V B;  1YN3 A;  1HZ6 A;  1NVI D;  1S3S G;  4YSX B;  1CQV A;  3Q14 C;  5EE1 A;  5EE9 A;  2HD5 B;  2DZJ A;  4DHJ B;  1B1Z A;  4US8 A;  1SIF A;  2KQS A;  3AE8 B;  4KDI C;  4HWI B;  4OVU A;  1R7S A;  3GS2 A;  4EZK A;  1EF5 A;  3PRM B;  2WXO A;  4BKG A;  3UIN B;  5LXH A;  4RMA A;  1TBE A;  1WJU A;  4MSM B;  1E90 A;  3Q3N C;  3W1Y A;  2DZM A;  4HVB A;  3HVZ A;  3PHW B;  1WYW B;  4IKG A;  1L4Z B;  4NPN A;  2J4X A;  4HCN B;  2O2V B;  5BO4 B;  2WXN A;  3AU5 A;  3U7Z A;  2ZVO A;  1UGM A;  4IDI A;  3M62 B;  2KN4 A;  2K8H A;  2LJI A;  1E10 A;  1F52 A;  2E6X A;  2IYD B;  3IHP C;  3I57 A;  3TL5 A;  1JWB D;  4MH0 E;  2N1V A;  4MSQ B;  1FRD A;  4WWO A;  3N32 A;  4KIK B;  1C4A A;  2WWZ A;  2FUH B;  3N30 A;  3ZNG C;  2WQY B;  4WJQ A;  3UQA A;  2GI9 A;  1V5T A;  3R8B A;  5CHF A;  3AE7 B;  3SU8 X;  2KFK A;  4FHJ A;  3TEZ A;  1E0Z A;  4JL9 A;  4P16 A;  1NI3 A;  2L32 A;  2DLB A;  4YWG G;  4G0N B;  4FUL A;  2GBJ A;  3A9K A;  4ANV A;  1JW9 D;  2C7N B;  2XBB C;  3QAQ A;  1HEZ E;  3L10 B;  1D5X C;  1PGX A;  4L1B A;  3VRB B;  4TKN A;  2K6D B;  2MJ3 A;  4XGA B;  3DHG C;  1WYG A;  4M00 A;  3UIP B;  4NAM A;  3UIO B;  5CHV C;  3T9L A;  1ZE3 D;  1P9D U;  2G3Q B;  1E9M A;  3A9J A;  3DHI C;  1UEL A;  3TBL D;  2CHZ A;  3SEB A;  2DX5 B;  1YMH E;  3APF A;  3NJT A;  4MEM A;  3AUL A;  3ZTD A;  3KYD D;  4XWW A;  4AJY B;  1SE2 A;  4W9I A;  2KO3 A;  2PPH A;  3AU4 A;  4AS1 A;  3PRP B;  1H4R A;  3QA8 A;  1WGK A;  3NZS A;  4ASW C;  2BGF A;  5JZE B;  1V49 A;  2BYF A;  3BK1 A;  2IDY A;  5JH5 C;  2G45 B;  1XXG A;  4E71 A;  4ANW A;  1RFK A;  2IZV B;  2Q5W D;  3DOW A;  4XX5 A;  1XLN A;  2AX5 A;  4AUQ C;  1RFA A;  1E7U A;  3EGR A;  2MP2 A;  2W55 A;  1TY2 A;  1EU4 A;  4L23 A;  2PW9 A;  3ZIM A;  1FCC C;  2MBO A;  2WX0 A;  4R3D A;  1L0X B;  1QOA A;  1RRB A;  1WI0 A;  3W2D A;  1VLB A;  1TYG B;  1CZP A;  2KX3 A;  2H89 B;  3WCQ A;  4FA6 A;  4C80 A;  2RSU A;  2LXA A;  1XF5 L;  5D2M B;  2BYT A;  3VUX A;  1H8C A;  2XN9 C;  2WDQ B;  2E3T A;  1V1P A;  2D3C A;  1VZ7 A;  3EA6 A;  2DAJ A;  3HIZ A;  2NBW B;  1YJJ A;  3MHS D;  4FJZ A;  2IPK D;  3L0W B;  2M19 A;  2MQJ A;  1WGH A;  3U8Z A;  2KT7 A;  1FD6 A;  3S2A A;  1OFF A;  3Q8B A;  3U30 A;  4KSL C;  5AZF A;  3L16 A;  1WMH A;  2R2O A;  2BF8 B;  2ZPY A;  4FJY A;  2AL6 A;  2K25 A;  2JY6 A;  2WDV B;  1RM6 C;  3AE6 B;  2Z59 B;  2QSD A;  5BYR A;  4DXA B;  4YT0 B;  2BKR B;  4AP4 C;  3AE1 B;  2JPH A;  2Y3A A;  4M02 A;  1IBX A;  2KWV B;  3X0W A;  5KHQ A;  3DCG A;  2MA9 B;  4K3B A;  3RZW C;  4BKT A;  2DEN B;  4I6P A;  2L05 A;  2WXJ A;  1TKE A;  4G3X B;  1FO4 A;  3AEE B;  2X38 A;  1FNU A;  4LNF A;  1XD3 B;  1K50 A;  4NZL B;  1NBF C;  2I1K A;  3AH7 A;  3GZN B;  2MHJ A;  2PIA A;  1UBI A;  2K5P A;  1MHX A;  2WDT B;  4YTP B;  2KYW A;  2L00 B;  3SD5 A;  3HM6 X;  1SF0 A;  2FCN A;  3N1Z C;  2KC1 A;  3NVY A;  1I4R A;  1GAQ B;  1LM8 B;  3N20 C;  1C4P A;  2UYZ B;  2J0J A;  5D3D A;  1FIQ A;  1XQQ A;  2LZ6 A;  1VCB A;  4KGS A;  1K52 A;  2UU7 A;  2KDI A;  4C00 A;  4C4V B;  2QDF A;  4WWP A;  1L2N A;  3E9S A;  1FNV A;  4BOS C;  2LWP A;  3KW5 B;  3Q6B A;  2OHF A;  4MDK E;  4JE3 B;  2JU6 X;  2BB6 A;  2CHX A;  1T0S C;  3AEF B;  1GB4 A;  2KTF A;  2FCQ A;  1VR9 A;  1LQB A;  4EE2 A;  4S17 A;  3DWG C;  2C7M B;  3CF6 E;  3A4R A;  3FKY A;  5G55 A;  3SR6 A;  1K53 A;  1TGZ B;  4A20 A;  1TKY A;  3J9C A;  3BYY B;  1QKZ A;  1XLO A;  2D07 B;  3EUB 2;  4W9D A;  2VZK D;  2LUM A;  4NAW B;  2KDF B;  1T0Q C;  5CHW A;  2PVO D;  4MT5 A;  2KJR A;  3ECI A;  3CST A;  5BMG A;  4GOC A;  1GC7 A;  5D94 A;  2K6Q A;  2PVG C;  4WWN A;  3VH4 B;  4C56 C;  4MM3 A;  1YQ3 B;  3A33 B;  2KD0 A;  3N3K B;  2DZK A;  4XWT A;  1OEY J;  1RAX A;  4OW0 A;  4ZDV A;  1QOB A;  4JWS C;  1WR6 E;  4XDC A;  2WXM A;  2HTM E;  2K22 A;  4F7Z A;  2ON8 A;  1P3Q U;  2L52 A;  1V80 A;  2PE9 A;  2AQ3 B;  2V3N A;  3AEB B;  3PZ7 A;  3B08 A;  2SAK A;  3H7S A;  3FC4 A;  1ZW7 A;  4PS8 A;  3MJ5 A;  1HXY D;  4M8N A;  1PFD A;  4KZC A;  3AE2 B;  4N58 A;  3C0R B;  1FM0 D;  1F9J A;  1MJD A;  2KMM A;  1J7C A;  2IND C;  3ZLZ A;  3VFK A;  1WX8 A;  1T0R C;  1DGJ A;  4IM3 A;  1I4X A;  2GMI C;  2GBN A;  3LB8 C;  4REZ A;  1ESF A;  3TEY A;  3MC0 B;  1UNS A;  2Y5B B;  2JX5 A;  1E6E B;  1GC6 A;  1I7H A;  1JWU D;  4NQK E;  4B0E A;  3LDZ E;  1MG8 A;  3UQB A;  5HKH A;  2V4L A;  5IN7 A;  2KWD A;  3H7P B;  2FBW B;  4W9H A;  1BXT A;  3KVF B;  5CTR C;  4FHK A;  1OQQ A;  3NVW A;  1ZDV A;  4WJO A;  4WAA A;  1XT9 B;  1F0Z A;  1GG3 A;  1WGY A;  4BKS D;  2ZNV C;  1KJT A;  3DDC B;  1XEE A;  3PLU A;  1KOT A;  3HUI A;  2KAC A;  1OGW A;  3LJ3 A;  1N6Z A;  1I35 A;  4MGK E;  4DHZ B;  4EOY A;  4PYU A;  4MGZ E;  1AAR A;  4ZRI A;  1WH3 A;  3K9O B;  2KWC A;  2WP9 B;  2V9H A;  4JGH B;  1J0G A;  2MBB B;  4PT5 A;  2DHZ A;  2FAZ A;  2JWZ A;  2MCN B;  1WXM A;  2PLP A;  3NUH B;  4EZL A;  3KUD B;  1GUA B;  1Y56 A;  3P4P B;  2N9P C;  3R2T A;  3TEX A;  4B6W A;  1QLB B;  4I6L B;  3Q8A A;  3PT2 B;  1T0Y A;  2JQR B;  3N9Y C;  3VTW A;  1U4A A;  2O6V A;  2PMV A;  1WFY A;  1WZ3 A;  4YL8 A;  2NMQ A;  3VAW A;  1OQR A;  2WDR B;  3FIL B;  2KFJ A;  3ZNH B;  1XCQ L;  3TEW A;  3DVN U;  3IAM 1;  4E74 A;  1TS4 A;  4XDD A;  3Q8F A;  1CMX B;  1LXD A;  1C77 A;  2CJO A;  3AEC B;  1KM7 A;  4XE0 A;  2RDB C;  3MJW A;  2IY1 B;  4LJP B;  3SFD B;  2LVP A;  4WAF A;  4DDI D;  4H2A A;  3V6C B;  4RGM A;  2JZP A;  4ZRQ A;  3ML9 A;  3ZRF A;  5HHD G;  3DBL I;  1WJ4 A;  3GE3 C;  4K7S A;  1YJI A;  1QOF A;  2CHW A;  5JXV A;  3GOE A;  4WJN A;  1GB1 A;  2O2V A;  2Y5P A;  2ZCB A;  3H8H A;  1A5R A;  2AQ2 B;  4GSW A;  3R66 C;  1VZ6 A;  3RFZ B;  1WJ6 A;  3ZRC A;  3QQ8 B;  3O65 B;  4CYE A;  3P63 A;  1X1M A;  2REX A;  1WGR A;  4KIK A;  2RGF A;  3PZ8 A;  4BBN C;  3TCA A;  1XO3 A;  2I38 A;  2M0A A;  1RYJ A;  4URK A;  1WXQ A;  1TZ1 A;  5C1Z A;  3V05 A;  1M94 A;  3NG0 A;  4MGY E;  2KVR A;  4DBG A;  5LNK 1;  5J18 A;  1WR1 A;  4LK0 M;  1F1H A;  3NOB A;  2K8C A;  4O1N A;  4WH4 A;  1QIL A;  5L95 C;  1WE7 A;  4WJP A;  4IG7 B;  2EKI A;  3A1Q B;  2JXX A;  2KAN A;  2RMM A;  4ARC A;  3H6N A;  4NJ7 A;  3VQI A;  2DNF A;  5BYQ A;  1C79 A;  3C19 A;  3SFE B;  1I4P A;  4HPP A;  3DWM A;  2AWT A;  1WX7 A;  3BYT B;  1OTR B;  1YD8 U;  4LDT B;  4PK1 A;  2MRP A;  4KVG B;  4IUM B;  3ZW3 A;  4BOZ B;  1SXT A;  5T8I A;  3RNF C;  2NPT B;  2CS4 A;  2ZNV B;  4XYC A;  5TSS A;  5AUK A;  5C23 A;  4GGQ A;  5DPW A;  4ZRP A;  2GBK A;  3SHQ A;  5AEK B;  4DQO C;  2INN E;  2MH7 A;  2UWQ A;  3I5J C;  1UBQ A;  3KUC B;  3MP9 A;  2KMC A;  4M01 A;  4RGN A;  2NS5 A;  4HK2 A;  2D3G A;  1NI2 A;  4E3C A;  3Q2A C;  2J0K A;  2J53 A;  3P2B A;  2XK5 A;  1UF0 A;  2N0S B;  1E7P B;  2QMT A;  1SE4 A;  2GBR A;  1EWC A;  1TJE A;  4BFR A;  3W1S C;  4NY0 A;  4IW0 A;  3NVZ A;  1WE6 A;  3P4S B;  2W3S A;  2N4F A;  4LTU A;  1P98 A;  2DAF A;  4CHK A;  1CK1 A;  1N62 A;  1NYR A;  1STE A;  1Z5S B;  1JAL A;  3IXS A;  2KFK B;  4IWQ A;  1L6U A;  2J42 A;  2LHE A;  4ZHP A;  1R4M I;  1I4Q A;  5FK9 C;  4W9L A;  2JYE A;  5AZG A;  3ZO5 B;  4RNA A;  1MPE A;  5E6J A;  4B9K A;  2C7H A;  3M63 B;  5KHO A;  4A3O A;  4AJW A;  2ZPN A;  2NBU A;  2WXP A;  3GB1 A;  5HFY A;  2LI5 A;  2D10 A;  3GP7 A;  4GXB A;  5H8Y E;  2X8X X;  3RPF C;  3OJ3 A;  1WGD A;  4KZ0 A;  1T6B X;  4BKS A;  2GLS A;  3BY4 B;  4A3P A;  3RNG C;  3ZDM C;  3U2S C;  1J7A A;  2O6V D;  4HJK A;  3LXF A;  2V4I B;  3V6E B;  2RPV A;  4ACF A;  3WAL A;  5IA7 A;  1GOZ A;  1IGD A;  4DHJ D;  4TSS A;  4L2Y A;  2LGS A;  3DVN V;  4W9J A;  5EE3 A;  4PS3 A;  3QX1 A;  3TUO A;  4OHJ A;  1YN5 A;  1TIF A;  1N5W A;  2D11 A;  2M0X A;  2KVZ A;  1QQR A;  4K7W A;  1I4G A;  1SJH D;  3NRZ A;  3DBR B;  3PVL A;  4TQ1 A;  3BVG A;  4RGO S;  1J19 A;  4EEW A;  1KFY B;  3JSV B;  1UH6 A;  1NYQ A;  4C4V A;  1P1A A;  4ANU A;  5E6N A;  1VDV A;  2MJD A;  2KWU B;  4HEA 1;  4WUR A;  1YQ4 B;  2BS3 B;  2KC2 A;  3ZUN A;  2Z0D B;  5DPS A;  2OOB B;  1LO5 D;  1JRO A;  2NTT A;  1ZXI A;  4LNK A;  3PRE A;  2BWF A;  2LMC A;  1RWS A;  2ZW1 A;  4LDT D;  1XCT L;  3NZU A;  2QIE B;  1PQS A;  2BW2 A;  2ZJD A;  3QCA A;  1NDD A;  1N5X A;  4RH6 A;  1V1P B;  3RZF A;  3ZDT A;  3BII D;  4RGT A;  1P0R A;  2H88 B;  4JPS A;  2LVQ A;  2BWE S;  4NAW A;  2G4D B;  2W9N A;  4HRS A;  4QAY A;  3EHV A;  1D5Z C;  1MVK A;  2KTR B;  3AE4 B;  3B0A A;  2L76 A;  2J0M A;  1K8R B;  4G11 A;  1V97 A;  1KLV A;  3ZYY X;  4YTN B;  5D7G A;  1DOY A;  3OG5 A;  4A55 A;  4AQ7 A;  3WA0 A;  2WXQ A;  3T3N A;  1D4B A;  1E8Z A;  4JIO U;  5GXG B;  1PGB A;  5EE0 A;  4K7U A;  2GBM A;  3AV8 A;  3UF8 A;  4DHZ E;  2EMS A;  2C60 A;  2FUG 1;  2YLM A;  4A9A A;  2D3B A;  2W82 A;  4W9C A;  1SJE D;  2WXK A;  1TZO A;  1E8X A;  3EFC A;  3E56 A;  1P7F A;  2BTE A;  4MH8 A;  3PO0 A;  1MHH E;  2EKE C;  3HHM A;  3B1L X;  3P42 A;  2RR9 A;  3Q69 A;  4TV3 A;  3AI5 A;  4K3C A;  2LFI A;  2QJL A;  2NTS A;  1HE8 A;  3PRZ A;  2FNJ B;  2RPQ A;  1WGG A;  4X57 B;  2CJN A;  2K9X A;  2BYE A;  4HCP B;  2N9X A;  2JT4 B;  2FCS A;  3BK2 A;  3MFG A;  1AWD A;  2HJ8 A;  3PSE B; 
#chains in the Genus database with same CATH homology
 1U4A A;  2O6V A;  1WFY A;  1V5T A;  1WZ3 A;  4YL8 A;  5CHF A;  3W1S A;  3SDL C;  4IM0 A;  4FJV B;  3SU8 X;  3VAW A;  2KFK A;  3QHT A;  4FHJ A;  3IBE A;  4JL9 A;  2KFJ A;  2KTR A;  4HPM B;  4W9F A;  3ZNH B;  3DVN U;  1OQY A;  2K1F A;  5DPR A;  4E74 A;  4RM9 A;  3ENE A;  3HM3 A;  1WXS A;  4G0N B;  3DBR I;  4NJ6 A;  2MP2 B;  1YX5 B;  3KYC D;  1CMX B;  4KV2 A;  4FUL A;  1LXD A;  2GBJ A;  4LCD E;  1C3T A;  3A9K A;  2DYB A;  4JQW C;  4ANV A;  2K8B A;  3QIJ A;  3VUW A;  2C7N B;  2CR5 A;  2R2Q A;  1KM7 A;  2XBB C;  3V60 A;  3QAQ A;  3MJW A;  2IY1 B;  3L10 B;  4ICV A;  2PE6 B;  3QWZ B;  5L83 A;  4LJP B;  3H7P A;  2LVP A;  4TKN A;  2K6D B;  3L17 A;  3PS6 A;  1IP9 A;  4DDI D;  4ZYN A;  4W9K A;  1WM3 A;  2IO3 B;  3V6C B;  4PS7 A;  3UIP B;  3UIO B;  3R7Q A;  3V62 A;  3ML9 A;  5DPT A;  2M1M A;  2N7D A;  2PJH A;  4GB9 A;  3ZRF A;  2BPS A;  3DBL I;  4NQL B;  1WJ4 A;  5CHV C;  3L54 A;  3T9L A;  3ZNZ B;  4K7S A;  1I42 A;  2KX0 A;  4M8M A;  2CHW A;  5J2R A;  3GOE A;  1P9D U;  4WJN A;  2G3Q B;  3PV1 A;  2O2V A;  1RLF A;  3A9J A;  3Q3F A;  4IWP A;  1UEL A;  2ZCB A;  3DBS A;  3QJZ A;  3TBL D;  3QK0 A;  2CHZ A;  2DX5 B;  3VUY A;  2AEH A;  2NVU I;  3EC8 A;  3APF A;  1LFD A;  1YQB A;  4MEM A;  2AL3 A;  1A5R A;  3AUL A;  4GSW A;  3R66 C;  3MTN B;  1J8C A;  3ZTD A;  3KYD D;  1WJ6 A;  3ZRC A;  3QQ8 B;  4W9I A;  4AJY B;  3O65 B;  4CYE A;  1WXV A;  2KO3 A;  2PPH A;  2LD9 A;  3AU4 A;  2JZ3 B;  3PRP B;  1X1M A;  2KN5 A;  2REX A;  3NS8 A;  3RUI B;  3HK0 A;  1WGR A;  4KIK A;  1H4R A;  2RGF A;  3QA8 A;  3NZS A;  4ASW C;  2BGF A;  3TCA A;  3WAM A;  4BBN C;  5JZE B;  3R7R A;  5AZH A;  2J7Q B;  1V49 A;  2RD0 A;  4W9G A;  4URK A;  2BYF A;  2WX1 A;  1WMH B;  2MSE D;  3RUL A;  4DWF A;  1TZ1 A;  1GNU A;  4GMV A;  5C1Z A;  4IC7 B;  5JH5 C;  1M94 A;  2G45 B;  4MGY E;  4E71 A;  4ANW A;  2IZV B;  2KVR A;  3DOW A;  4XX5 A;  5G2N A;  4DBG A;  5JHB A;  5J18 A;  4AUQ C;  5D6J B;  1RFA A;  1E7U A;  3ZKJ C;  2MP2 A;  3JVZ X;  3DVG Y;  4M0W B;  1WR1 A;  2ZZP B;  4MEL A;  3WAN A;  2LRW A;  3NOB A;  2K8C A;  3IFW B;  5L95 C;  1Q5W B;  1WE7 A;  4WJP A;  4IG7 B;  2KZR A;  2M17 A;  2MBO A;  3A1Q B;  3PZD A;  2JXX A;  2MBQ A;  3DPD A;  2KAN A;  3ZIM A;  3V61 A;  4HPL B;  1VD2 A;  1YX6 B;  2WX0 A;  4FN2 A;  3EEC A;  3H6N A;  2CU1 A;  4HDQ A;  1RRB A;  4NJ7 A;  3VQI A;  1WI0 A;  3IVF A;  2KXJ A;  2ASQ A;  4IM2 A;  4KDL B;  2KX3 A;  3ONS A;  5CX3 A;  4FA6 A;  2AWT A;  1WX7 A;  1OTR B;  2LXA A;  2RSU A;  2KNB A;  1YD8 U;  4LDT B;  3KUZ A;  4MJS B;  5D2M B;  2MRP A;  2ZEQ A;  3T8M A;  4KVG B;  4IUM B;  3ZTC A;  3ZW3 A;  4BOZ B;  5EDS A;  5JHA A;  5IAA C;  4WQO B;  3RYT A;  2KLG A;  3VUX A;  1H8C A;  3TMP B;  2NPT B;  2ZCC A;  1WF9 A;  2CS4 A;  4EUT A;  2DZI A;  2ZNV B;  1Z2M A;  2NCN A;  2L7R A;  2DAJ A;  3HIZ A;  1V5O A;  5C23 A;  4FBJ B;  2NBW B;  4GGQ A;  3H1U A;  2FID A;  3VHT C;  2JRH A;  1UZX B;  3KH0 A;  3MHS D;  4FJZ A;  5DPW A;  1L7Y A;  2GBK A;  3L0W B;  3SHQ A;  5AEK B;  2HTH A;  2MQJ A;  1WGH A;  1ZKH A;  3D32 A;  2LVO A;  4NNJ B;  4ICU A;  2KMA A;  3PT2 B;  3U8Z A;  2LXC A;  2MW5 A;  2UWQ A;  4W9E A;  3VH3 B;  3S2A A;  1UBQ A;  3OLM D;  1WIA A;  1EO6 A;  1GJZ A;  3U30 A;  4KSL C;  5AZF A;  3NY5 A;  2DYO A;  3L16 A;  3KUC B;  4HXD A;  5E6P A;  2N7E A;  2KMC A;  1WMH A;  2LGD A;  2R2O A;  3APD A;  2BF8 B;  1V9J A;  2NS5 A;  1QZE A;  2ZPY A;  2D3G A;  3PTF C;  4FJY A;  4HK2 A;  2AL6 A;  2K25 A;  3VTU A;  1NI2 A;  2IBI B;  2JY6 A;  4N9F 4;  4E3C A;  2Z59 B;  2PEA A;  3JYU A;  3DQV A;  3WIM A;  1IYF A;  4DXA B;  2BKR B;  2LRU A;  3EFU A;  2J0K A;  2MX2 A;  3P2B A;  2XK5 A;  4AP4 C;  4DDG D;  2OJR A;  3JW0 X;  2EMT A;  1E8Y A;  2JPH A;  3UGB B;  4CO7 A;  2KWV B;  3X0W A;  5KHQ A;  3DCG A;  2MA9 B;  3RZW C;  1UD7 A;  4BKT A;  3DBH I;  3Q3J A;  5E6O A;  3VVW B;  2DEN B;  3A1Q A;  4P7I A;  4I6P A;  2L05 A;  2JF5 A;  4G3X B;  2MWS B;  2GBR A;  2N1W A;  2C9W B;  1WX9 A;  3CMM B;  4BFR A;  3W1S C;  1XD3 B;  2L8J A;  4GDL B;  1NBF C;  4NY0 A;  2I1K A;  4IW0 A;  3GZN I;  1WE6 A;  2IO1 B;  1C1Y B;  1V6E A;  5J17 A;  2N4F A;  1UBI A;  4MJS A;  4GDK B;  4ZRK A;  3TIX A;  2WDT B;  4LJO B;  3NHE B;  1P98 A;  2L00 B;  4K1R B;  3SD5 A;  2N9E B;  2DAF A;  4EKU A;  1YIW A;  3HM6 X;  4GN1 A;  2FCN A;  3I3T B;  4CHK A;  2KC1 A;  2KDB A;  2BKF A;  3VXW A;  2D2Q A;  2WYQ A;  2KOX A;  2KK8 A;  2KHW B;  1LM8 B;  1Z5S B;  3QAR A;  2YVC A;  3OJ4 B;  4PYZ A;  1Q1O A;  2FIF A;  2KFK B;  4IWQ A;  2IO0 B;  4F1S A;  2UYZ B;  2J0J A;  2BYV E;  2NR2 A;  1R4M I;  5AZG A;  4W9L A;  3L08 A;  1XQQ A;  3ZO5 B;  2LZ6 A;  1VCB A;  1R4N I;  2LAS A;  2KDI A;  3WAO A;  4B9K A;  4RM8 A;  2C7H A;  3M63 B;  1V86 A;  5KHO A;  4WWP A;  1L2N A;  3M95 A;  4A3O A;  4AJW A;  2ZPN A;  2NBU A;  1WJN A;  2IO2 B;  2LWP A;  3TJP A;  3X23 A;  4BOS C;  3KW5 B;  4MDK E;  2LI5 A;  4FAD A;  2D10 A;  3K9P B;  1V81 A;  3AXC A;  4GXB A;  2CHX A;  4MGI E;  4TUU A;  3OJ3 A;  1WGD A;  5GMV A;  2L3Z A;  2KTF A;  4KZ0 A;  4B95 A;  3RCZ A;  2MLB A;  2FCQ A;  2Z0E B;  4I6N B;  4TQ0 A;  1LQB A;  1OEY A;  2JZZ A;  3RD2 A;  4BKS A;  3H9D A;  4ZRJ A;  2C7M B;  1Q0W B;  3A4R A;  3CF6 E;  3PLV A;  3BY4 B;  5G55 A;  1TGZ B;  4A20 A;  4A3P A;  3R3M A;  2JUO A;  2D07 B;  2GOW A;  2KKC A;  4W9D A;  2L0F A;  1S1Q B;  1E8W A;  2CKH B;  4FLH A;  4GDL A;  3ZDM C;  4NAW B;  2ZVN A;  2KDF B;  2O6V D;  4HJK A;  1JRU A;  4GU2 A;  4GDK A;  5CHW A;  3QC8 B;  2KDE B;  3V6E B;  2LJ5 A;  2QHO A;  2KJR A;  3ECI A;  3WAL A;  1WY8 A;  3CST A;  5IA7 A;  2VRR B;  4GOC A;  2IY0 B;  1GC7 A;  3ZNI D;  4DHJ D;  5D94 A;  3DVN V;  2K6Q A;  4II2 B;  4W9J A;  1WXA A;  2I1J A;  3QX1 A;  4PS3 A;  2AYO B;  1WRD B;  4WWN A;  3VH4 B;  1IPG A;  4MM3 A;  4ANX A;  2KQ7 A;  2D11 A;  1V2Y A;  3VTV A;  3A33 B;  2DYM A;  2KD0 A;  2KJH B;  3L13 A;  2JVC A;  2M0X A;  3M3J A;  2V1Y A;  3N3K B;  1WZ0 A;  3OAW A;  2DZK A;  4F8C B;  4K7W A;  1OEY J;  2M8S A;  3PPA A;  5LLI A;  1RAX A;  2LGY A;  3PVL A;  4TQ1 A;  4ZDV A;  1WR6 E;  3ALB A;  1D3Z A;  1J19 A;  4EEW A;  1BT0 A;  2XEW A;  4II3 B;  3JSV B;  1UH6 A;  3A4S C;  4XZ4 A;  4F7Z A;  5FR6 A;  4HLE A;  1P1A A;  4ANU A;  1P3Q U;  5LXI B;  2HE7 A;  1V80 A;  1ISN A;  2M4N A;  2G4S A;  5E6N A;  2PE9 A;  3PSE B;  3PGE A;  3B08 A;  2KWU B;  3ZVV A;  4KSK C;  5DCN A;  4BBN F;  4OVV A;  2KC2 A;  4AOF A;  3H7S A;  1ZW7 A;  3ZUN A;  2Z0D B;  4PS8 A;  5DPS A;  2OOB B;  4M8N A;  1WM2 A;  3WAP A;  1EF1 A;  2KLC A;  3PRE A;  4KZC A;  2BWF A;  5TR5 A;  4G50 A;  3C0R B;  3CSF A;  4K81 A;  4LDT D;  2MBE A;  2MBH A;  3NZU A;  1F9J A;  4EFO A;  1PQS A;  2ZJD A;  3ZLZ A;  3QCA A;  3VFK A;  1WX8 A;  1NDD A;  3APC A;  4HDO A;  2NPT A;  1Y8R C;  3RZF A;  2B3A A;  3ZDT A;  4IM3 A;  2GMI C;  1TTN A;  1YJ1 A;  1P0R A;  2GBN A;  2LGX A;  2LVQ A;  2V3S A;  4IWO A;  2BWE S;  2K39 A;  4NAW A;  2O6V B;  2G4D B;  2JRI B;  2W9N A;  1S3S G;  3EHV A;  1ZGU B;  2KTR B;  2L0T A;  3B0A A;  2L76 A;  3RT3 B;  2Y5B B;  2J0M A;  3U7D A;  4EZJ A;  4GIV A;  1K8R B;  1GC6 A;  2HD5 B;  3PHX B;  4G11 A;  2DZJ A;  1KLV A;  4DHJ B;  4NQK E;  3LDZ E;  5D7G A;  1FXT B;  1SIF A;  2KQS A;  1MG8 A;  3A9K B;  3UQB A;  5HKH A;  4KDI C;  3WA0 A;  2LUE A;  4HWI B;  4OVU A;  1SGH A;  1E8Z A;  2V4L A;  4JIO U;  4EZK A;  3H7P B;  1EF5 A;  1EUV B;  3PRM B;  4JLC A;  2KJ6 A;  3ML8 A;  3IG3 A;  4XC2 A;  3UIN B;  4AWJ A;  4BKG A;  4W9H A;  3KVF B;  5CTR C;  4K7U A;  4RMA A;  2GBM A;  4FHK A;  5LXH A;  3UF8 A;  1TBE A;  2EMS A;  4DHZ E;  1WJU A;  4MSM B;  2C60 A;  1E90 A;  1G6J A;  2XK5 B;  4WJO A;  3W1Y A;  2C5L C;  2DZM A;  2FCM A;  1XT9 B;  2NBV B;  2YLM A;  3BIN A;  4WAA A;  3DVG X;  4W9C A;  1E5W A;  4HVB A;  3PHW B;  1WYW B;  1GG3 A;  1WGY A;  2A5U A;  3JSV A;  2ZNV C;  4BKS D;  1E8X A;  1KJT A;  3DDC B;  4NPN A;  3PLU A;  4HCN B;  3VDZ A;  1KOT A;  2O2V B;  2EKE C;  3A9J B;  3HHM A;  5BO4 B;  3B1L X;  2RR9 A;  3AU5 A;  1OGW A;  3LJ3 A;  4TV3 A;  2ZVO A;  1UGM A;  3AI5 A;  3M62 B;  4J6I A;  1I35 A;  2K8H A;  4MGK E;  4DHZ B;  4EOY A;  4PYU A;  2IYD B;  3IHP C;  4MGZ E;  3TL5 A;  1AAR A;  4ZRI A;  1HE8 A;  1WH3 A;  4MH0 E;  2N1V A;  3PRZ A;  4MSQ B;  2FNJ B;  2RPQ A;  1WGG A;  4X57 B;  3K9O B;  1SE9 A;  2KWC A;  4WWO A;  4BVU C;  4JGH B;  1J0G A;  1E7V A;  2MBB B;  3N32 A;  4KIK B;  2DHZ A;  2FAZ A;  2A4Z A;  2JWZ A;  2BYE A;  1WXM A;  2MCN B;  2WWZ A;  4EZL A;  3KUD B;  1GUA B;  4HCP B;  4DK5 A;  2N9X A;  2FUH B;  2JT4 B;  2N9P C;  3N30 A;  2FCS A;  3ZNG C;  4B6W A;  4WJQ A;  4I6L B;  2HJ8 A;  3UQA A;  1T0Y A;  3VTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...