3KYDD

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kydD00
1WR6E 3M3JA 3ML8A 1V86A 1ZW7A 1YX5B 1JRUA 3RD2A 3X23A 4K1RB 1E7VA 2MP2A 2MA9B 4W9LA 5DCNA 5DPTA 2R2QA 3VH4B 5IAAC 2LXAA 2KC1A 2PE6B 1OEYJ 1GG3A 4BKTA 2KK8A 2K39A 2Z59B 2KFKA 2G4DB 4I6LB 2A5UA 5EDSA 2HJ8A 3MJWA 4KDIC 4NPNA 4PYZA 3NHEB 3V60A 2N9PC 2MCNB 4HDOA 1WMHB 3GOEA 2KFJA 3U8ZA 4DWFA 2JY6A 3DBLI 2BWFA 3AXCA 2DYMA 4HCNB 2K25A 4EEWA 1KOTA 1WZ3A 1T0YA 2BYFA 3L13A 5IA7A 5LXIB 2KTFA 3IG3A 2V4LA 4DHJB 1RLFA 3R7RA 3UF8A 2UYZB 3ZNID 1GUAB 2C7MB 1SIFA 4PS7A 2K8BA 4EZLA 1J0GA 3VUXA 2KX0A 3PHXB 4XZ4A 1OQYA 5HKHA 2G45B 2XEWA 4NQLB 2KJHB 2Y5BB 3N3KB 3T9LA 2FIFA 4AJWA 2IO1B 3SHQA 2FCNA 2BKFA 2NPTA 2UWQA 4KZ0A 4GDLB 5D2MB 2VRRB 2KQ7A 2WYQA 4DHJD 4B95A 1E5WA 1EO6A 3ZRCA 1AARA 2FCSA 4A20A 3RYTA 4AUQC 1K8RB 4M8MA 1KLVA 2MP2B 4IWQA 2YLMA 4EZJA 4CHKA 1E7UA 5G55A 1HE8A 1VCBA 2M8SA 2O2VA 3OJ3A 2DZMA 4HWIB 4KSLC 4WJNA 4BVUC 1GJZA 4WAAA 1PQSA 3NY5A 1UGMA 1E8YA 1WJNA 4DDID 3CMMB 4HVBA 1NDDA 2CR5A 5LLIA 3PREA 3UQBA 4KIKB 1E90A 3T8MA 3VFKA 3L0WB 2KFKB 5CX3A 2NCNA 1NBFC 2PE9A 3A9JA 4ZRKA 1F9JA 2MQJA 3DVGX 4JQWC 3PZDA 1V49A 1GC6A 1YX6B 4PS8A 2KMAA 3B1LX 3TL5A 4MGYE 1KM7A 2ZNVC 2LGXA 4GDKA 3CF6E 2CHZA 4W9IA 3HIZA 4DK5A 5L95C 4TQ0A 1EF1A 4HLEA 2C7NB 4IC7B 4JLCA 1XT9B 2N7DA 5KHOA 3VUYA 1WGRA 4IM0A 3ZNZB 2L0FA 1V9JA 3OLMD 4BOZB 2ZPNA 3PRZA 1L7YA 1QZEA 1SE9A 2DYBA 3KVFB 4G3XB 4EKUA 3H1UA 3KUZA 3QA8A 3PGEA 4B6WA 3P2BA 3JSVA 4GMVA 3O65B 2KC2A 1TGZB 3OAWA 5AZHA 2KWVB 4RM9A 3APFA 4A3OA 1WX9A 1WR1A 4WJOA 3ZTDA 4MSQB 5DPWA 2GOWA 4KZCA 1WX8A 2KLGA 3MHSD 2NPTB 4W9GA 2OOBB 3PSEB 3WANA 2J0MA 2MSED 4MGKE 2ZJDA 1WYWB 1Q1OA 2LD9A 3L08A 3PRMB 3BY4B 3IHPC 4I6NB 2WX1A 1S1QB 3UIPB 3L54A 5AZGA 3S2AA 5J17A 2DZIA 2HE7A 1V2YA 1VD2A 1WXMA 3VQIA 2O2VB 2NBVB 2RGFA 1WFYA 3JW0X 2MBOA 4II2B 2DHZA 2IO2B 2KHWB 3IBEA 3N32A 1WGYA 4W9FA 3EFUA 3KYCD 3ECIA 1H4RA 2LUEA 2KKCA 5AEKB 3A9JB 4CYEA 1WJ4A 3AULA 1GC7A 2DX5B 2GBMA 1WX7A 4BKGA 4AWJA 3A9KA 1R4NI 3WAPA 2N9EB 2KO3A 2DAFA 3U30A 3ZO5B 4GDKB 2PPHA 3LDZE 3ALBA 4M0WB 2BWES 1H8CA 1WJUA 4FADA 1KJTA 1RAXA 1WH3A 3CSFA 5DPSA 4YL8A 2K8HA 3QK0A 4LJPB 1J8CA 4WJPA 4PS3A 4TKNA 5FR6A 4IG7B 2KZRA 3ZUNA 2OJRA 3JSVB 1WI0A 1BT0A 2DENB 4FHJA 4KVGB 1V5OA 1Y8RC 2XK5A 2DAJA 3B08A 3H9DA 4IUMB 4FA6A 3VH3B 1UBQA 4GB9A 3U7DA 1WGDA 3K9PB 5J18A 2KDIA 2JF5A 1WGGA 3HHMA 4JIOU 1ZGUB 2LZ6A 2N7EA 2IBIB 2N9XA 3SU8X 4MGIE 3H7PB 5D94A 4HPLB 2RPQA 4LDTB 3ZIMA 2JZ3B 1WGHA 1YD8U 4MJSA 2BYVE 4GXBA 1E8WA 2CHXA 2V3SA 3A33B 1M94A 4FJZA 5C1ZA 4FBJB 2QHOA 1XQQA 4N9F4 1Z5SB 2CU1A 2B3AA 2M17A 2G3QB 4XX5A 1YQBA 4NJ6A 2WX0A 3DVGY 3ZNGC 3HK0A 4LDTD 1GNUA 2LXCA 4FHKA 1S3SG 4ZRJA 4K7WA 3M63B 3A9KB 2ZCCA 4FJYA 1I35A 2KDEB 3K9OB 3L17A 3ZKJC 2ZNVB 4E3CA 1WF9A 3A1QA 2GMIC 2L00B 2JUOA 5CHFA 3ZDTA 3WAOA 3QIJA 3H7SA 5JHAA 2GBNA 4W9KA 2KQSA 4IM3A 3PV1A 5GMVA 1TZ1A 2CHWA 3C0RB 3WALA 3NZSA 4HPMB 2O6VA 2LGYA 1EUVB 1V81A 2MBHA 5DPRA 2J0JA 5D7GA 3DBHI 3VHTC 2M4NA 2N1WA 2J0KA 4NY0A 4JGHB 5D6JB 4ANWA 4P7IA 2D11A 3R7QA 2JPHA 2KD0A 2XK5B 1SGHA 5KHQA 2IO0B 2L7RA 3UGBB 2I1JA 5E6PA 2RD0A 2ZVOA 1P0RA 4I6PA 4TV3A 1LFDA 4F1SA 3ENEA 2L05A 4BKSA 3ML9A 4IW0A 1RRBA 2DZJA 4GN1A 2L76A 2RSUA 3QJZA 4GU2A 3KUDB 2G4SA 2GBKA 4HJKA 4AJYB 2NVUI 3KH0A 4CO7A 2V1YA 4MM3A 4DXAB 1OGWA 2ZEQA 4ANXA 2LRUA 3PS6A 4MJSB 1WIAA 2NBWB 4WWPA 3W1YA 4X57B 2EMSA 3TMPB 1LXDA 3PT2B 4NNJB 1XD3B 3QC8B 4FN2A 2MRPA 3A4RA 2KWCA 4ICVA 2K1FA 4FLHA 2N1VA 3V61A 4URKA 2BYEA 2D2QA 4W9DA 2KNBA 3RZWC 1UBIA 3ZVVA 2K6QA 3HM6X 2KTRA 2W9NA 4A3PA 2BGFA 4AP4C 2LWPA 2KANA 3DOWA 1V5TA 2XBBC 5L83A 1IP9A 1YIWA 2C5LC 1OTRB 3ZW3A 4HCPB 3SD5A 3Q3FA 2AL6A 5J2RA 4OVVA 5JHBA 1E8ZA 2JRHA 2GBRA 3A1QB 3N30A 4EZKA 2JRIB 3KYDD 3R3MA 2BF8B 3VXWA 4FULA 3GZNI 3TIXA 4GIVA 4WJQA 3R66C 3TBLD 1IPGA 2LI5A 3NZUA 2O6VB 2KMCA 4TUUA 2LRWA 3TCAA 3VDZA 3RT3B 2YVCA 1WXSA 4IM2A 2C7HA 3L16A 4XC2A 3VTWA 4MSMB 4ZRIA 3APCA 3DVNV 4HK2A 2K6DB 4OVUA 3AU4A 3CSTA 3I3TB 1WM3A 2ZCBA 4MELA 2LVQA 4IWOA 4ZYNA 4BBNF 4G50A 4EOYA 1Z2MA 4TQ1A 4ASWC 4EFOA 4W9EA 4M8NA 2Z0EB 2ASQA 2L3ZA 2KJRA 2FCMA 2AYOB 2DYOA 2WDTB 4JL9A 2KLCA 1L2NA 1Q0WB 2L8JA 3ZTCA 5JZEB 3DBSA 1LQBA 2MLBA 4GOCA 1TBEA 1ZKHA 2MWSB 4KIKA 2KDBA 3LJ3A 4K81A 2IZVB 2C9WB 3V6CB 4BKSD 2JVCA 2JWZA 1YJ1A 2WWZA 3MTNB 3DVNU 5CHVC 3VTVA 4MDKE 3OJ4B 2KTRB 2Z0DB 3SDLC 4ZDVA 2CKHB 1UELA 2NR2A 4HDQA 1WRDB 2HTHA 3DBRI 2M0XA 4RM8A 3M95A 3WA0A 3RULA 5TR5A 1OEYA 4F7ZA 2IO3B 4LJOB 1UH6A 1WE6A 1WZ0A 1V6EA 2AWTA 2HD5B 2LJ5A 3DCGA 4GSWA 2MBBB 4IWPA 4AOFA 2D3GA 3VTUA 3UQAA 1WM2A 5E6OA 4MH0E 3AU5A 3HM3A 3ONSA 4WWOA 2KOXA 2ZZPB 1P98A 4E74A 2LVOA 1P3QU 2NS5A 3L10B 5JH5C 1P1AA 4WWNA 1UZXB 2C60A 4MEMA 2JXXA 3H6NA 3VAWA 2N4FA 1UD7A 3JYUA 5CHWA 3V6EB 5AZFA 2GBJA 1TTNA 4HXDA 1C3TA 3PPAA 3PHWB 1IYFA 1Q5WB 2I1KA 3QHTA 1MG8A 2MBEA 4F8CB 4EUTA 2FAZA 2FIDA 1J19A 3W1SC 4NQKE 1C1YB 1I42A 3QAQA 1P9DU 4KDLB 3UINB 2LASA 3RCZA 3A4SC 1RFAA 2L0TA 4NJ7A 2D10A 2IYDB 2PEAA 3DQVA 4MGZE 2LVPA 3QX1A 4W9JA 3IFWB 2BKRB 3KUCB 2KWUB 4II3B 4BOSC 2JZZA 3QARA 4KSKC 1LM8B 3VUWA 2FCQA 2IY1B 2D07B 2KDFB 2JT4B 4G0NB 3VVWB 3B0AA 4ANUA 4NAWA 2MX2A 2R2OA 2DZKA 3EECA 4KV2A 3PTFC 4NAWB 2KJ6A 2FNJB 4BBNC 1WY8A 4FJVB 2A4ZA 1WXAA 2EMTA 2IY0B 4DBGA 4ANVA 4W9CA 3NOBA 1CMXB 4PYUA 2LGDA 5C23A 4K7UA 4DHZE 4ICUA 3DPDA 2RR9A 3QWZB 4GGQA 5CTRC 3M62B 2ZPYA 3ZNHB 1A5RA 3D32A 4BFRA 2AEHA 2MBQA 1WJ6A 3APDA 2J7QB 3PVLA 4DDGD 1WMHA 3EHVA 2M1MA 3PLVA 2PJHA 4B9KA 3Q3JA 4LCDE 5LXHA 3AI5A 1FXTB 2BPSA 4RMAA 3X0WA 3RZFA 2AL3A 1WXVA 4G11A 1ISNA 3ZLZA 3UIOB 1R4MI 1U4AA 1EF5A 1V80A 2KXJA 2CS4A 3PRPB 3QQ8B 3RUIB 3TJPA 3WAMA 3H7PA 3WIMA 3NS8A 5E6NA 3JVZX 3QCAA 3BINA 4J6IA 4W9HA 2FUHB 3W1SA 4E71A 1WE7A 2KN5A 2MW5A 2ZVNA 3IVFA 2REXA 2EKEC 2KVRA 1D3ZA 3V62A 4DHZB 3EC8A 3ZDMC 5G2NA 1X1MA 4GDLA 3PLUA 4WQOB 2NBUA 1G6JA 3DDCB 1E8XA 5BO4B 2KX3A 2O6VD 1NI2A 2K8CA 4K7SA 3KW5B 3ZRFA
chains in the Genus database with same CATH superfamily
3DBHB 1ZW7A 1YX5B 2HTME 4HROA 3RD2A 3X23A 1SSNA 5DPTA 1HTOA 3LYYA 2KC1A 5D3IB 2Z59B 3EA6A 2V3NA 3P42A 2N9PC 2MCNB 3RNFC 1QOAA 3KQ4A 2GLSA 2BWFA 4EEWA 3DWMA 2QEJC 4B0EA 3IG3A 2V4LA 1RLFA 3R7RA 3VRBB 1SB3C 1SIFA 4KKJA 3PHXB 4NQLB 3W5VB 1I4HA 2KJHB 1R7SA 4YT0B 1QOGA 2NPTA 4GDLB 2J42A 2QIEB 2KQ7A 3VRAB 4B95A 4A20A 2ZW0A 4EZJA 2FE8A 1SF0A 1WXQA 4HWIB 2O2VA 2DZMA 1PQSA 3NY5A 4L1BA 2V0GA 4DDID 4HVBA 4MACA 5LLIA 1UWXA 3NVVA 2WS3B 3AN1A 3ZGZA 5HI1A 2NCNA 1YN4A 2PE9A 1IBXA 4NAMA 2MQJA 3DVGX 3PZDA 4MGYE 1PGXA 2LGXA 1JWAD 4GDKA 4YSYB 5L95C 1FFUA 1EF1A 2WXIA 2C7NB 4JLCA 1XT9B 5KHOA 3VUYA 3BVGA 1V9JA 2FUG1 3KVFB 2DYBA 1MPEA 3PGEA 2QMTA 3O65B 2KC2A 3R8BA 4RM9A 1SJED 4L2YA 1WX9A 3AB5A 3BK2A 4RGNA 1SE3A 2NTTA 3MHSD 2NPTB 4W9GA 2WXFA 3PSEB 3WANA 4PK1A 4I6NB 3UIPB 2EELA 1FRDA 2HE7A 2O2VB 2RGFA 3NUHB 2MBOA 1FPYA 3IBEA 4N59A 1F77A 3N32A 5AEKB 3C8YA 1K50A 3AULA 1XCQL 2GBMA 3WAPA 1STEA 4GDKB 2PPHA 2JWUA 4BZAA 4FADA 4XE0A 4ARIA 1PGBA 1KJTA 1RAXA 5DPSA 1IGCA 3RNAC 4J3OD 4LJPB 4WJPA 1ZPSA 4DXFA 3GS2A 4IG7B 2KZRA 1BT0A 4FHJA 1PUTA 2XK5A 4FA6A 1JWSD 3VH3B 2QJLA 3K9PB 4B0MA 5J17A 1ZGUB 3SU8X 4LDTB 5D3DA 1YD8U 2GB1A 4HJGE 4ZYSA 1ZDXA 1M94A 4FBJB 2AQ3B 3AM9A 1Z5SB 3VR8B 2B3AA 2D3CA 1YQBA 2I2YA 1JRPA 1NEKB 3HK0A 4LDTD 4FHKA 1F52A 1C76A 1C4PA 2ZCCA 4FJYA 2Y5CA 1WF9A 3A1QA 3WAOA 2KQSA 3ZJVA 4IM3A 1K53A 1VRAB 3WALA 2KACA 2D3BA 1ZUD2 2MBHA 2WXOA 1NI3A 2N1WA 4NY0A 1L4DB 3MC8A 4ANWA 2D11A 2XK5B 5KHQA 1V8CA 2RD0A 4F1SA 3ENEA 3ML9A 2DZJA 4S17A 2RSUA 1WSPA 1JW9D 2W55A 1UUPA 1UWMA 4TMAB 1YMHE 2Q5WD 3NVYA 4X57B 1GB4A 1XD3B 1ACCA 3GP7A 3QC8B 3A4RA 4WIPA 4ICVA 2K1FA 3RZWC 2KTRA 3DOWA 2XBBC 5L83A 3ZW3A 1DOXA 5J2RA 2ON8A 3A1QB 3KYDD 2BF8B 3TIXA 4GIVA 2BW2A 2KN4A 3TCAA 1P7FA 1WXSA 1RYJA 1I4RA 4XC2A 2BS3B 3APCA 4HK2A 3CSTA 4NZLB 1D4BA 4TSSA 4MELA 1C78A 4IOIE 4BBNF 2QDFA 1ZDVA 4RGOS 3EGRA 2FCMA 2MLBA 1JWBD 2BT6A 2MWSB 3LJ3A 4K81A 2IZVB 2C9WB 3CIRB 2JVCA 1YJ1A 3MTNB 2WGSA 3OJ4B 2KTRB 1YJJA 2Z0DB 3SDLC 4RCOA 2HTHA 2M0XA 5IOIA 3T3NA 4LJOB 3U2SC 3ABVB 1MG4A 3DCGA 2MJEA 2H89B 4IWPA 4AOFA 4YTPB 5AUIA 1TY0A 2D3GA 4C7YA 1WM2A 2SAKA 2ZZPB 4E74A 5EE3A 5IO9A 3DHIC 3L10B 5JH5C 4WWNA 2CJNA 3I57A 5H92C 2GBJA 1TTNA 1IYFA 3L4PA 4D2KA 4EUTA 2FIDA 5I4DA 1C1YB 4KDLB 1JWMD 3RCZA 1XCTL 2KDMA 3DQVA 4MGZE 3BYTB 2KWUB 4P6VF 1LM8B 2FCQA 2KDFB 1MVKA 4G0NB 2NTSA 1YJIA 1HQRD 2FNJB 3NRZA 1HZ6A 2IY0B 1EWCA 1KH0A 1FFVA 3DPDA 2ZPYA 4KGSA 1VZ7A 2AEHA 4JE3B 2MBQA 1WJ6A 5T8IA 2J7QB 3PVLA 4DDGD 1WMHA 3EHVA 2M1MA 4PT5A 3AE5B 4RMAA 4L23A 1JROA 1EF5A 2J52A 3H7PA 4C56C 4J6IA 1QKZA 2ZVNA 1FIQA 2KVRA 2INDC 2Y3AA 5G2NA 1X1MA 2PTLA 1G6JA 2K5PA 2MP2A 3RT3B 3KW5B 3ZRFA 3M3JA 3ML8A 1V86A 1XO3A 4K1RB 2MA9B 5IAAC 1GG3A 3SEBA 2KK8A 1AWDA 1C9FA 3NJTA 1QQRA 4I6LB 2A5UA 2LHDA 1WMHB 2KFJA 3U8ZA 2KT7A 2JY6A 4HCNB 1OFFA 1WZ3A 3L13A 2DNFA 3T3OA 1L5PA 5IA7A 4K3BA 4DHJB 1NYQA 1ZOYB 1GUAB 2C7MB 4PS7A 2K8BA 2G45B 2XEWA 2Y5BB 4HEA1 2BKFA 2UWQA 3TEZA 2KAJA 4DHJD 1E5WA 3ZRCA 1AARA 2M19A 1FRRA 1K8RB 4USAA 2MP2B 4EE2A 3AEEB 2PKOA 1E7UA 2M8SA 3OJ3A 4WJNA 4KSLC 4WAAA 1WJNA 1NDDA 2CR5A 3PREA 3UQBA 4KIKB 3T8MA 3VFKA 3L0WB 5CX3A 3A9JA 3AE8B 1F9JA 1FCCC 1YX6B 4PS8A 2KMAA 5AUKA 3ZYYX 3AEFB 3CF6E 1Q10A 4DK5A 2N7DA 4GLSC 3PO0A 4IM0A 2JQRB 2QSDA 2IDYA 2ZPNA 4P1CC 2K3UA 4EKUA 3Q3OC 1A70A 3B2GA 2CJOA 1C4AA 1TS5A 2RDHA 3JSVA 1L6VA 5AZHA 3P1MA 2IGDA 3APFA 4A3OA 3N1YC 3EFCA 3ZTDA 4M00A 4AQ7A 2KLGA 2J0MA 2ZJDA 1WYWB 1Q1OA 1MFWA 1S1QB 2WX1A 3L54A 2MJDA 1WXMA 2NBVB 1WFYA 4O1NA 2DHZA 2IO2B 2KHWB 3RPFC 3RNEC 2INNE 3EFUA 3IXSA 3A9JB 1N60A 1GPXA 1GC7A 2DX5B 1WX7A 2INCC 4BKGA 1CQVA 3A9KA 4RGMA 1ZXHA 2DAFA 2YEPB 3ZO5B 3LDZE 1FEHA 3ALBA 1UNSA 3GE8C 1WH3A 5G5HA 2LMCA 4YL8A 1TY2A 3AE1B 2JXTA 4MH8A 3NVWA 2MHJA 1PGAA 3BVMA 4DQOC 1V1PA 3R2IA 3P4RB 3JSVB 1WI0A 3ZJTA 3B08A 2DAJA 1IUEA 2DBYA 1TKGA 1WGDA 2N0SB 4M02A 3HHMA 1WGGA 4JIOU 2HDEA 2IBIB 1D5MC 4A90A 4HPLB 2RPQA 2N9KA 3ZXVA 1TKEA 2BYVE 4GXBA 2V3SA 4FJZA 3AMZA 1HEZE 4N9F4 2X8XX 2G3QB 4ZOHC 3DVGY 2KWDA 1GNUA 4JWSC 4K7WA 3M63B 3A9KB 3ZKJC 4E3CA 2BQQA 2WLBA 2OEDA 2WXRA 5CHFA 5JHAA 2GBNA 2IPKD 4QAYA 3PV1A 5BMGA 5BMIA 2LGYA 1EUVB 1V1PB 2J0JA 3DBHI 2TSSA 4JGHB 5D6JB 3P4SB 4P7IA 3CWIA 1SGHA 2L7RA 3UGBB 2I38A 4XGAB 2ZVOA 4I6PA 2L05A 1RRBA 4GN1A 2L76A 3QJZA 1TJEA 2GBKA 1V97A 3E9SA 4MM3A 4DXAB 3P4PB 2ZEQA 1WIAA 3U7ZA 1PYWD 3DBLB 4WWPA 2EMSA 3TMPB 1LXDA 2JZPA 3V61A 2N1VA 4URKA 1UBIA 1FNUA 2LWPA 2KANA 2WNMA 4OVVA 1N61A 2GBRA 3N30A 2JRIB 1ZE3D 4FULA 2WHIA 3TBLD 1IBXB 2LI5A 2LRWA 3VDZA 1HXYD 1Y56A 1FXIA 4IM2A 2C7HA 3PZ7A 5EE9A 4ZRIA 3I3TB 1TS4A 2ZCBA 4IWOA 4P1BC 4EOYA 3LB8C 4Q2JA 2ASQA 2WXJA 1HA5A 2KJRA 4JL9A 1L2NA 4IDIA 3TEYA 1Q0WB 4MM3B 5JZEB 1XLPA 4ZRQA 4KGRA 1F2RC 1ZKHA 2KDBA 4XDDA 2OJWA 3DHHC 2BYTA 3HVZA 3VTVA 1UELA 1L0YB 3AEGB 4HDQA 2W3RA 4RM8A 2IGGA 4JWUC 3M95A 1UH6A 4JX1C 1R4MB 1V6EA 4GSWA 3SR6A 4A6QA 2RDGA 4MH0E 2UU7A 1DOYA 2KOXA 1P98A 2KYWA 2NS5A 1UZXB 3H6NA 2J4XA 2N4FA 4HXDA 3PHWB 1Q5WB 1XF5L 5C3JB 2PIAA 3FC4A 3AEDB 3HUIA 2LASA 1ET9A 2L0TA 3FKYA 2IYDB 1TZOA 2PEAA 1YQ4B 2FBWB 3QX1A 2LVPA 4W9JA 3KUCB 4BOSC 1ENFA 2IY1B 2JT4B 3B0AA 4ZRPA 4ANUA 2KMMA 2W3SA 2WP9B 4KV2A 4NAWB 2KJ6A 1WY8A 4WWMA 4LNKA 4WH4A 4DBGA 5FR3A 3RNGC 3HVDA 5EE1A 4DHZE 2RR9A 4DXGA 3M62B 1A5RA 3D32A 2ONQA 2PMVA 3BK1A 1KFYB 3PLVA 4B9KA 2MJ3A 1JQ4A 3AI5A 2BPSA 4US9A 1FNVA 4G11A 3AV8A 1ISNA 3ZLZA 1R4MI 3OWEB 3MC9A 3R2TA 5E6NA 1YQ3B 3JVZX 1WE7A 1RM6C 1SE2A 1YN5A 3EC8A 3ZDMC 3PLUA 1CK1A 1M4VA 1E8XA 2KX3A 3B9JA 4K7SA 2GRIA 4W9LA 5DCNA 2R2QA 2LXAA 3W5UB 2PE6B 2K39A 4OZCA 1SXTA 2KFKA 4KKIA 4YXDB 1T0QC 1K51A 1JALA 1LGRA 2N9LA 4KDIC 1VDVA 4NPNA 1IGDA 3TEWA 3NHEB 3V60A 3GOEA 4DWFA 1VZ6A 4ACFA 2K25A 1KOTA 1T0YA 2BYFA 3EUB2 2KTFA 2UYZB 3Q14C 2M0AA 2KX0A 5HKHA 3IT4B 4AJWA 1C79A 2FIFA 2FCNA 4KZ0A 3GZNB 4XWWA 2X38A 3RYTA 4AUQC 4IWQA 2YLMA 1HE8A 1C4CA 1E8YA 1OQQA 2AQ1B 2WXPA 3UI3A 1E90A 2KFKB 1F2RI 1E7PB 4JQWC 1GC6A 4C7ZA 1KM7A 3VR9B 2K22A 1BUIC 3HIZA 4HLEA 4IC7B 1J7AA 2D3AA 1DOIA 2L0FA 1L7YA 1QZEA 1SE9A 4HKQA 1KLUD 3H1UA 3KUZA 3P2BA 3O13A 3N9YC 1WR1A 4WJOA 1TS3A 2W54A 4MSQB 5DPWA 2GOWA 3Q6BA 2MSED 4MGKE 1WRIA 3ZQ4A 3L08A 3BY4B 3AECB 1L4ZB 4LNOA 5AZGA 3GB1A 3FAHA 3VQIA 1VD2A 3WCQA 1JMLA 3MHZA 4II2B 3ECIA 1XEEA 1NYRA 1T0SC 4CYEA 2WXMA 2BVCA 3J9CA 4AWJA 3U30A 1FNWA 2BWES 1WJUA 2K8HA 1I4PA 4XWTA 1I4QA 4TKNA 1PFDA 2RDBC 5FR6A 3BVZA 3ZUNA 2OJRA 1Y8RC 4OW0A 4IUMB 2CU3A 1WGKA 4GB9A 3KWVA 1T3QA 1SIJA 5J18A 2JF5A 5MPOA 3Q8EA 4MGIE 1MJDA 3H7PB 5D94A 3ZIMA 2DWQA 2JZ3B 4MJSA 1E8WA 2G9HD 1BMLC 2QHOA 1J7BA 2M56B 4XX5A 1UGJA 3ZNGC 1D6EC 2Z8LA 2LXCA 1S3SG 4ZRJA 4LLGM 5BYRA 2KDEB 3L17A 2JX5A 2VZKB 2H88B 4A9AA 2GMIC 3ZDTA 2JUOA 5FK9C 1UF0A 3MJ5A 5GMVA 3AH7A 2CHWA 3NZSA 4HPMB 2O6VA 3P63A 4RF1A 2K9XA 1V81A 5DPRA 3VHTC 2WU5B 2M4NA 2J0KA 2VZKD 1AYFA 2JPHA 2KD0A 4C80A 2IO0B 1I4XA 1AN8A 4KX6B 4TV3A 4BKSA 3RMKC 3KUDB 3NVZA 3KH0A 2V1YA 3DBRB 2OHFA 4ANXA 2LRUA 4MJSB 2NBWB 3W1YA 4C4VA 3DWGC 3PT2B 4NNJB 4H2AA 2MRPA 4FLHA 2BYEA 2KNBA 3ZVVA 2K6QA 2WDVB 4XDCA 4A3PA 1YIWA 1OTRB 4HCPB 3RFZB 1E8ZA 5JXVA 1SBBB 2HJ1A 3VXWA 2WXQA 4WJQA 3R66C 1IPGA 2N7JA 1F0ZA 2O6VB 2KMCA 3MC0B 1J7CA 4LNFA 3L16A 3VTWA 2K6DB 3AU4A 3Q8AA 1WM3A 1I4GA 2LVQA 1LO5D 2QCZA 4ASWC 2Z0EB 2B76B 3P4QB 4OVZA 2Y5PA 2AYOB 2DYOA 2KLCA 1LQBA 4C4VB 1B1ZA 3V6CB 4BKSD 1HZ5A 2JWZA 2WWZA 5E6JA 3V05A 1KTKA 1T6BX 4MDKE 4ZDVA 2CKHB 2NR2A 2LFIA 1WRDB 3AEBB 5HG2A 4IKGA 3DBRI 2BB6A 1OEYA 2E6XA 1WE6A 2AWTA 2HD5B 2LJ5A 1QLBB 4OZBA 3PZ8A 1DGJA 1N5WA 4A55A 3RNBC 4XYCA 2WQYB 3VTUA 3UQAA 3ONSA 4WWOA 1GOZA 2LVOA 1C77A 1P3QU 4CQNA 1MI0A 1DYQA 2C60A 2JXXA 4BAXA 5AZFA 1L0XB 3PPAA 1MG8A 2MBEA 2PLPA 3AE3B 3TUOA 1J19A 3QAQA 2SEBD 3UINB 1E0ZA 4RNAA 4FXCA 2D10A 4NJ7A 3W2DA 2LGSA 2BTEA 1EM7A 2BKRB 5HFYA 2JZZA 3VUWA 2D07B 2WDQB 1T0RC 3DHGC 2R2OA 3EECA 2NMQA 2KVZA 3SFEB 3AE4B 4ANVA 4RFBA 4KGTA 1CMXB 1XLQA 3Q69A 4PYUA 2EKIA 3BZDB 4GGQA 5CTRC 1TT5B 4HKZE 3APDA 1SEBD 1ZP0B 1XLOA 3Q8FA 1XXGA 2LJIA 5LNK1 1WYGA 1QF6A 2PJHA 5LXHA 3MP9A 1FXTB 1KF6B 3RZFA 1WXVA 1GB1A 3UIOB 1U4AA 1CZPA 3WAMA 3WIMA 3NS8A 4S0RA 3MFGA 3BINA 3I5JC 2MW5A 2IGHA 3IVFA 2REXA 2EKEC 4NJCA 1D3ZA 4LK0M 1QOFA 5FKAC 1FMAD 2L1AA 1B9RA 5BO4B 4REZA 1KLGD 1ET6A 2LGIA 1WR6E 1FD6A 1JRUA 1E7VA 2R61A 1OQRA 3VH4B 1OEYJ 3AE7B 4BKTA 1VLBA 1NENB 3BYYB 1FO4A 1YN3A 2G4DB 2K0PA 5EDSA 2HJ8A 3MJWA 5HHDG 4LNNA 1VJKA 4PYZA 1D5ZC 4HDOA 5IKCM 2VH2A 2L83A 3Q3MC 3DBLI 3AXCA 2DYMA 4AS1A 1L0VB 4YWGG 5LXIB 3UF8A 2QILA 3ZNID 4ITKA 4EZLA 1HTQA 1J0GA 3VUXA 2WXHA 4XZ4A 1OQYA 2WXLA 3T9LA 2ZW1A 3N3KB 2IO1B 1SJHD 2PW9A 3SHQA 4WQMA 4OHJA 3B2FA 5TSSA 5D2MB 2QC8A 2VRRB 2WYQA 1EO6A 2FCSA 1KLVA 4M8MA 1R4NB 4CHKA 2KQ4X 5G55A 1VCBA 4BVUC 1GJZA 2BS4B 4K3CA 1TIFA 1UGMA 3CMMB 4US8A 2YEPF 1NBFC 1KRHA 4RH6A 4ZRKA 1AW7A 1V49A 5H8YE 3B1LX 3TL5A 2MH7A 2ZNVC 1WWTA 2CHZA 4M0WA 4W9IA 3W9CB 1GAQB 4TQ0A 1I7HA 2G1EA 1WGRA 2J53A 3ZNZB 5C2TB 3OLMD 2LUMA 4BOZB 3PRZA 4G3XB 3QA8A 3N20C 4B6WA 4GMVA 3N1ZC 1TGZB 3OAWA 4C00A 2KWVB 3SFDB 2V4IB 2E3TA 2XNAC 4KZCA 1WX8A 2INPE 3TSSA 2OOBB 2BB5A 4N6EB 5EE0A 3RNCC 3PRMB 2LD9A 3IHPC 4RGTA 4ZHOA 3S2AA 2DZIA 2LHEA 1V2YA 1N5XA 1VR9A 2V3PA 3BIID 3JW0X 3U52E 1SE4A 1WGYA 4W9FA 4HPPA 3KYCD 1H4RA 2LUEA 2KKCA 1WJ4A 1VZ8A 1R4NI 1TYGB 2N9EB 2KO3A 4A8XC 4MT5A 1XLNA 3U4EG 4M0WB 1H8CA 1N63A 3NZ3A 2WXGA 3CSFA 3QK0A 1N62A 1J8CA 4PS3A 2JU6X 1YNTE 4ARCA 4WAFA 2DENB 3LXFA 4KVGB 1V5OA 2ACZB 3H9DA 1CJEA 1UBQA 3U7DA 2KDIA 3Q8BA 1EU4A 2LZ6A 2N7EA 2N9XA 4M01A 2L52A 2BS2B 1WGHA 1FM0D 2CHXA 3A33B 5C1ZA 1XQQA 2CU1A 2M17A 3FILA 2GI9A 5BYQA 4NJ6A 2WX0A 2WU2B 1I35A 3K9OB 2ZNVB 2VH1A 5IN7A 1T5XD 2L00B 3QIJA 3H7SA 3H8HA 4W9KA 1TZ1A 3C0RB 3AE6B 5D7GA 4RF0A 1TKYA 3V3XA 5BMHA 1RWSA 3R7QA 2I1JA 5E6PA 1V1OA 4LTUA 4UDUC 1P0RA 1LFDA 4IW0A 1FCLA 4GU2A 2G4SA 4HJKA 4AJYB 2ICIA 2NVUI 2WXKA 4CO7A 2PVGC 2DLBA 1OGWA 4R3DA 3PS6A 4JPSA 3Q3NC 1JWUD 1D5XC 4FN2A 2L32A 2KWCA 3OG5A 3FILB 4P16A 1EU3A 2D2QA 4W9DA 3HM6X 2W9NA 4AP4C 2BGFA 2RMMA 1V5TA 1IP9A 1E9MA 2C5LC 2IJ0A 4HRSA 3SD5A 3Q3FA 2AL6A 2D5GA 5JHBA 3GE3C 2JRHA 1E10A 4EZKA 3R3MA 3GZNI 2JYEA 2WXNA 3NZUA 4TUUA 1YOVB 3KLSX 1TS2A 3ZXRA 3TEXA 2W82A 2YVCA 4LNIA 4MSMB 3DVNV 4OVUA 4OZAA 3AE9B 3NS1A 4ZYNA 4G50A 3AEAB 1Z2MA 4TQ1A 4EFOA 4W9EA 4M8NA 2L3ZA 5GXGB 1NVID 2WDTB 2L8JA 3ZTCA 3DBSA 3N1XC 4GOCA 1TBEA 3URYA 4KIKA 1ZXIA 2AX5A 4YTMB 2LEKA 1P7EA 3DVNU 5CHVC 1JCKB 1EWYC 1RFKA 2WDRB 3WA0A 3E56A 3RULA 5TR5A 1MHHE 4F7ZA 2IO3B 1WZ0A 4WURA 2MBBB 5G5GA 5IP4D 3AE2B 5E6OA 1E6EB 3AU5A 3HM3A 3ETRA 1N6ZA 4YSXB 3RN9C 1P1AA 3IT6B 4MEMA 1L6UA 2JSVX 3VAWA 3JYUA 1UD7A 5CHWA 3V6EB 1C3TA 4N58A 3RI7C 1K52A 2I1KA 1FXAA 3QHTA 1BXTA 4F8CB 2FAZA 3W1SC 4NQKE 4YTNB 1I42A 1P9DU 3ZJUA 3HRDD 1MHXA 3A4SC 1RFAA 3Q2AC 2MEKA 3IFWB 3IAM1 4II3B 3QARA 4KSKC 1PDXA 3VVWB 3Q8CA 4YSZB 4NAWA 2MX2A 2DZKA 2XN9C 3PTFC 1QOBA 4BBNC 4FJVB 2A4ZA 2JYTA 1WXAA 2EMTA 3NG0A 3BWUD 4W9CA 3NOBA 3KWLA 2LGDA 5C23A 4K7UA 2PVOD 4ICUA 3QWZB 3ZNHB 4BFRA 1QT9A 3Q3JA 4LCDE 3X0WA 2AL3A 1V80A 1ROEA 2CS4A 2KXJA 3PRPB 3QQ8B 3RUIB 3TJPA 2BBCA 2V9HA 1F1HA 2RPVA 3QCAA 4W9HA 4E71A 2AQ2B 2FUHB 3W1SA 2KN5A 1QILA 3IAS1 3V62A 4DHZB 1ESFA 3I63C 3I9V1 4GDLA 4WQOB 2NBUA 4ZHPA 5BYSA 3DDCB 2O6VD 1NI2A 2K8CA 3C19A
chains in the Genus database with same CATH topology
1WR6E 3M3JA 3ML8A 1V86A 1ZW7A 1YX5B 1JRUA 3RD2A 3X23A 4K1RB 1E7VA 2MP2A 2MA9B 4W9LA 5DCNA 5DPTA 2R2QA 3VH4B 5IAAC 2LXAA 2KC1A 2PE6B 1OEYJ 1GG3A 4BKTA 2KK8A 2K39A 2Z59B 2KFKA 2G4DB 4I6LB 2A5UA 5EDSA 2HJ8A 3MJWA 4KDIC 4NPNA 4PYZA 3NHEB 3V60A 2N9PC 2MCNB 4HDOA 1WMHB 3GOEA 2KFJA 3U8ZA 4DWFA 2JY6A 3DBLI 2BWFA 3AXCA 2DYMA 4HCNB 2K25A 4EEWA 1KOTA 1WZ3A 1T0YA 2BYFA 3L13A 5IA7A 5LXIB 2KTFA 3IG3A 2V4LA 4DHJB 1RLFA 3R7RA 3UF8A 2UYZB 3ZNID 1GUAB 2C7MB 1SIFA 4PS7A 2K8BA 4EZLA 1J0GA 3VUXA 2KX0A 3PHXB 4XZ4A 1OQYA 5HKHA 2G45B 2XEWA 4NQLB 2KJHB 2Y5BB 3N3KB 3T9LA 2FIFA 4AJWA 2IO1B 3SHQA 2FCNA 2BKFA 2NPTA 2UWQA 4KZ0A 4GDLB 5D2MB 2VRRB 2KQ7A 2WYQA 4DHJD 4B95A 1E5WA 1EO6A 3ZRCA 1AARA 2FCSA 4A20A 3RYTA 4AUQC 1K8RB 4M8MA 1KLVA 2MP2B 4IWQA 2YLMA 4EZJA 4CHKA 1E7UA 5G55A 1HE8A 1VCBA 2M8SA 2O2VA 3OJ3A 2DZMA 4HWIB 4KSLC 4WJNA 4BVUC 1GJZA 4WAAA 1PQSA 3NY5A 1UGMA 1E8YA 1WJNA 4DDID 3CMMB 4HVBA 1NDDA 2CR5A 5LLIA 3PREA 3UQBA 4KIKB 1E90A 3T8MA 3VFKA 3L0WB 2KFKB 5CX3A 2NCNA 1NBFC 2PE9A 3A9JA 4ZRKA 1F9JA 2MQJA 3DVGX 4JQWC 3PZDA 1V49A 1GC6A 1YX6B 4PS8A 2KMAA 3B1LX 3TL5A 4MGYE 1KM7A 2ZNVC 2LGXA 4GDKA 3CF6E 2CHZA 4W9IA 3HIZA 4DK5A 5L95C 4TQ0A 1EF1A 4HLEA 2C7NB 4IC7B 4JLCA 1XT9B 2N7DA 5KHOA 3VUYA 1WGRA 4IM0A 3ZNZB 2L0FA 1V9JA 3OLMD 4BOZB 2ZPNA 3PRZA 1L7YA 1QZEA 1SE9A 2DYBA 3KVFB 4G3XB 4EKUA 3H1UA 3KUZA 3QA8A 3PGEA 4B6WA 3P2BA 3JSVA 4GMVA 3O65B 2KC2A 1TGZB 3OAWA 5AZHA 2KWVB 4RM9A 3APFA 4A3OA 1WX9A 1WR1A 4WJOA 3ZTDA 4MSQB 5DPWA 2GOWA 4KZCA 1WX8A 2KLGA 3MHSD 2NPTB 4W9GA 2OOBB 3PSEB 3WANA 2J0MA 2MSED 4MGKE 2ZJDA 1WYWB 1Q1OA 2LD9A 3L08A 3PRMB 3BY4B 3IHPC 4I6NB 2WX1A 1S1QB 3UIPB 3L54A 5AZGA 3S2AA 5J17A 2DZIA 2HE7A 1V2YA 1VD2A 1WXMA 3VQIA 2O2VB 2NBVB 2RGFA 1WFYA 3JW0X 2MBOA 4II2B 2DHZA 2IO2B 2KHWB 3IBEA 3N32A 1WGYA 4W9FA 3EFUA 3KYCD 3ECIA 1H4RA 2LUEA 2KKCA 5AEKB 3A9JB 4CYEA 1WJ4A 3AULA 1GC7A 2DX5B 2GBMA 1WX7A 4BKGA 4AWJA 3A9KA 1R4NI 3WAPA 2N9EB 2KO3A 2DAFA 3U30A 3ZO5B 4GDKB 2PPHA 3LDZE 3ALBA 4M0WB 2BWES 1H8CA 1WJUA 4FADA 1KJTA 1RAXA 1WH3A 3CSFA 5DPSA 4YL8A 2K8HA 3QK0A 4LJPB 1J8CA 4WJPA 4PS3A 4TKNA 5FR6A 4IG7B 2KZRA 3ZUNA 2OJRA 3JSVB 1WI0A 1BT0A 2DENB 4FHJA 4KVGB 1V5OA 1Y8RC 2XK5A 2DAJA 3B08A 3H9DA 4IUMB 4FA6A 3VH3B 1UBQA 4GB9A 3U7DA 1WGDA 3K9PB 5J18A 2KDIA 2JF5A 1WGGA 3HHMA 4JIOU 1ZGUB 2LZ6A 2N7EA 2IBIB 2N9XA 3SU8X 4MGIE 3H7PB 5D94A 4HPLB 2RPQA 4LDTB 3ZIMA 2JZ3B 1WGHA 1YD8U 4MJSA 2BYVE 4GXBA 1E8WA 2CHXA 2V3SA 3A33B 1M94A 4FJZA 5C1ZA 4FBJB 2QHOA 1XQQA 4N9F4 1Z5SB 2CU1A 2B3AA 2M17A 2G3QB 4XX5A 1YQBA 4NJ6A 2WX0A 3DVGY 3ZNGC 3HK0A 4LDTD 1GNUA 2LXCA 4FHKA 1S3SG 4ZRJA 4K7WA 3M63B 3A9KB 2ZCCA 4FJYA 1I35A 2KDEB 3K9OB 3L17A 3ZKJC 2ZNVB 4E3CA 1WF9A 3A1QA 2GMIC 2L00B 2JUOA 5CHFA 3ZDTA 3WAOA 3QIJA 3H7SA 5JHAA 2GBNA 4W9KA 2KQSA 4IM3A 3PV1A 5GMVA 1TZ1A 2CHWA 3C0RB 3WALA 3NZSA 4HPMB 2O6VA 2LGYA 1EUVB 1V81A 2MBHA 5DPRA 2J0JA 5D7GA 3DBHI 3VHTC 2M4NA 2N1WA 2J0KA 4NY0A 4JGHB 5D6JB 4ANWA 4P7IA 2D11A 3R7QA 2JPHA 2KD0A 2XK5B 1SGHA 5KHQA 2IO0B 2L7RA 3UGBB 2I1JA 5E6PA 2RD0A 2ZVOA 1P0RA 4I6PA 4TV3A 1LFDA 4F1SA 3ENEA 2L05A 4BKSA 3ML9A 4IW0A 1RRBA 2DZJA 4GN1A 2L76A 2RSUA 3QJZA 4GU2A 3KUDB 2G4SA 2GBKA 4HJKA 4AJYB 2NVUI 3KH0A 4CO7A 2V1YA 4MM3A 4DXAB 1OGWA 2ZEQA 4ANXA 2LRUA 3PS6A 4MJSB 1WIAA 2NBWB 4WWPA 3W1YA 4X57B 2EMSA 3TMPB 1LXDA 3PT2B 4NNJB 1XD3B 3QC8B 4FN2A 2MRPA 3A4RA 2KWCA 4ICVA 2K1FA 4FLHA 2N1VA 3V61A 4URKA 2BYEA 2D2QA 4W9DA 2KNBA 3RZWC 1UBIA 3ZVVA 2K6QA 3HM6X 2KTRA 2W9NA 4A3PA 2BGFA 4AP4C 2LWPA 2KANA 3DOWA 1V5TA 2XBBC 5L83A 1IP9A 1YIWA 2C5LC 1OTRB 3ZW3A 4HCPB 3SD5A 3Q3FA 2AL6A 5J2RA 4OVVA 5JHBA 1E8ZA 2JRHA 2GBRA 3A1QB 3N30A 4EZKA 2JRIB 3KYDD 3R3MA 2BF8B 3VXWA 4FULA 3GZNI 3TIXA 4GIVA 4WJQA 3R66C 3TBLD 1IPGA 2LI5A 3NZUA 2O6VB 2KMCA 4TUUA 2LRWA 3TCAA 3VDZA 3RT3B 2YVCA 1WXSA 4IM2A 2C7HA 3L16A 4XC2A 3VTWA 4MSMB 4ZRIA 3APCA 3DVNV 4HK2A 2K6DB 4OVUA 3AU4A 3CSTA 3I3TB 1WM3A 2ZCBA 4MELA 2LVQA 4IWOA 4ZYNA 4BBNF 4G50A 4EOYA 1Z2MA 4TQ1A 4ASWC 4EFOA 4W9EA 4M8NA 2Z0EB 2ASQA 2L3ZA 2KJRA 2FCMA 2AYOB 2DYOA 2WDTB 4JL9A 2KLCA 1L2NA 1Q0WB 2L8JA 3ZTCA 5JZEB 3DBSA 1LQBA 2MLBA 4GOCA 1TBEA 1ZKHA 2MWSB 4KIKA 2KDBA 3LJ3A 4K81A 2IZVB 2C9WB 3V6CB 4BKSD 2JVCA 2JWZA 1YJ1A 2WWZA 3MTNB 3DVNU 5CHVC 3VTVA 4MDKE 3OJ4B 2KTRB 2Z0DB 3SDLC 4ZDVA 2CKHB 1UELA 2NR2A 4HDQA 1WRDB 2HTHA 3DBRI 2M0XA 4RM8A 3M95A 3WA0A 3RULA 5TR5A 1OEYA 4F7ZA 2IO3B 4LJOB 1UH6A 1WE6A 1WZ0A 1V6EA 2AWTA 2HD5B 2LJ5A 3DCGA 4GSWA 2MBBB 4IWPA 4AOFA 2D3GA 3VTUA 3UQAA 1WM2A 5E6OA 4MH0E 3AU5A 3HM3A 3ONSA 4WWOA 2KOXA 2ZZPB 1P98A 4E74A 2LVOA 1P3QU 2NS5A 3L10B 5JH5C 1P1AA 4WWNA 1UZXB 2C60A 4MEMA 2JXXA 3H6NA 3VAWA 2N4FA 1UD7A 3JYUA 5CHWA 3V6EB 5AZFA 2GBJA 1TTNA 4HXDA 1C3TA 3PPAA 3PHWB 1IYFA 1Q5WB 2I1KA 3QHTA 1MG8A 2MBEA 4F8CB 4EUTA 2FAZA 2FIDA 1J19A 3W1SC 4NQKE 1C1YB 1I42A 3QAQA 1P9DU 4KDLB 3UINB 2LASA 3RCZA 3A4SC 1RFAA 2L0TA 4NJ7A 2D10A 2IYDB 2PEAA 3DQVA 4MGZE 2LVPA 3QX1A 4W9JA 3IFWB 2BKRB 3KUCB 2KWUB 4II3B 4BOSC 2JZZA 3QARA 4KSKC 1LM8B 3VUWA 2FCQA 2IY1B 2D07B 2KDFB 2JT4B 4G0NB 3VVWB 3B0AA 4ANUA 4NAWA 2MX2A 2R2OA 2DZKA 3EECA 4KV2A 3PTFC 4NAWB 2KJ6A 2FNJB 4BBNC 1WY8A 4FJVB 2A4ZA 1WXAA 2EMTA 2IY0B 4DBGA 4ANVA 4W9CA 3NOBA 1CMXB 4PYUA 2LGDA 5C23A 4K7UA 4DHZE 4ICUA 3DPDA 2RR9A 3QWZB 4GGQA 5CTRC 3M62B 2ZPYA 3ZNHB 1A5RA 3D32A 4BFRA 2AEHA 2MBQA 1WJ6A 3APDA 2J7QB 3PVLA 4DDGD 1WMHA 3EHVA 2M1MA 3PLVA 2PJHA 4B9KA 3Q3JA 4LCDE 5LXHA 3AI5A 1FXTB 2BPSA 4RMAA 3X0WA 3RZFA 2AL3A 1WXVA 4G11A 1ISNA 3ZLZA 3UIOB 1R4MI 1U4AA 1EF5A 1V80A 2KXJA 2CS4A 3PRPB 3QQ8B 3RUIB 3TJPA 3WAMA 3H7PA 3WIMA 3NS8A 5E6NA 3JVZX 3QCAA 3BINA 4J6IA 4W9HA 2FUHB 3W1SA 4E71A 1WE7A 2KN5A 2MW5A 2ZVNA 3IVFA 2REXA 2EKEC 2KVRA 1D3ZA 3V62A 4DHZB 3EC8A 3ZDMC 5G2NA 1X1MA 4GDLA 3PLUA 4WQOB 2NBUA 1G6JA 3DDCB 1E8XA 5BO4B 2KX3A 2O6VD 1NI2A 2K8CA 4K7SA 3KW5B 3ZRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR6 E;  3M3J A;  3ML8 A;  1V86 A;  1ZW7 A;  1YX5 B;  1JRU A;  3RD2 A;  3X23 A;  4K1R B;  1E7V A;  2MP2 A;  2MA9 B;  4W9L A;  5DCN A;  5DPT A;  2R2Q A;  3VH4 B;  5IAA C;  2LXA A;  2KC1 A;  2PE6 B;  1OEY J;  1GG3 A;  4BKT A;  2KK8 A;  2K39 A;  2Z59 B;  2KFK A;  2G4D B;  4I6L B;  2A5U A;  5EDS A;  2HJ8 A;  3MJW A;  4KDI C;  4NPN A;  4PYZ A;  3NHE B;  3V60 A;  2N9P C;  2MCN B;  4HDO A;  1WMH B;  3GOE A;  2KFJ A;  3U8Z A;  4DWF A;  2JY6 A;  3DBL I;  2BWF A;  3AXC A;  2DYM A;  4HCN B;  2K25 A;  4EEW A;  1KOT A;  1WZ3 A;  1T0Y A;  2BYF A;  3L13 A;  5IA7 A;  5LXI B;  2KTF A;  3IG3 A;  2V4L A;  4DHJ B;  1RLF A;  3R7R A;  3UF8 A;  2UYZ B;  3ZNI D;  1GUA B;  2C7M B;  1SIF A;  4PS7 A;  2K8B A;  4EZL A;  1J0G A;  3VUX A;  2KX0 A;  3PHX B;  4XZ4 A;  1OQY A;  5HKH A;  2G45 B;  2XEW A;  4NQL B;  2KJH B;  2Y5B B;  3N3K B;  3T9L A;  2FIF A;  4AJW A;  2IO1 B;  3SHQ A;  2FCN A;  2BKF A;  2NPT A;  2UWQ A;  4KZ0 A;  4GDL B;  5D2M B;  2VRR B;  2KQ7 A;  2WYQ A;  4DHJ D;  4B95 A;  1E5W A;  1EO6 A;  3ZRC A;  1AAR A;  2FCS A;  4A20 A;  3RYT A;  4AUQ C;  1K8R B;  4M8M A;  1KLV A;  2MP2 B;  4IWQ A;  2YLM A;  4EZJ A;  4CHK A;  1E7U A;  5G55 A;  1HE8 A;  1VCB A;  2M8S A;  2O2V A;  3OJ3 A;  2DZM A;  4HWI B;  4KSL C;  4WJN A;  4BVU C;  1GJZ A;  4WAA A;  1PQS A;  3NY5 A;  1UGM A;  1E8Y A;  1WJN A;  4DDI D;  3CMM B;  4HVB A;  1NDD A;  2CR5 A;  5LLI A;  3PRE A;  3UQB A;  4KIK B;  1E90 A;  3T8M A;  3VFK A;  3L0W B;  2KFK B;  5CX3 A;  2NCN A;  1NBF C;  2PE9 A;  3A9J A;  4ZRK A;  1F9J A;  2MQJ A;  3DVG X;  4JQW C;  3PZD A;  1V49 A;  1GC6 A;  1YX6 B;  4PS8 A;  2KMA A;  3B1L X;  3TL5 A;  4MGY E;  1KM7 A;  2ZNV C;  2LGX A;  4GDK A;  3CF6 E;  2CHZ A;  4W9I A;  3HIZ A;  4DK5 A;  5L95 C;  4TQ0 A;  1EF1 A;  4HLE A;  2C7N B;  4IC7 B;  4JLC A;  1XT9 B;  2N7D A;  5KHO A;  3VUY A;  1WGR A;  4IM0 A;  3ZNZ B;  2L0F A;  1V9J A;  3OLM D;  4BOZ B;  2ZPN A;  3PRZ A;  1L7Y A;  1QZE A;  1SE9 A;  2DYB A;  3KVF B;  4G3X B;  4EKU A;  3H1U A;  3KUZ A;  3QA8 A;  3PGE A;  4B6W A;  3P2B A;  3JSV A;  4GMV A;  3O65 B;  2KC2 A;  1TGZ B;  3OAW A;  5AZH A;  2KWV B;  4RM9 A;  3APF A;  4A3O A;  1WX9 A;  1WR1 A;  4WJO A;  3ZTD A;  4MSQ B;  5DPW A;  2GOW A;  4KZC A;  1WX8 A;  2KLG A;  3MHS D;  2NPT B;  4W9G A;  2OOB B;  3PSE B;  3WAN A;  2J0M A;  2MSE D;  4MGK E;  2ZJD A;  1WYW B;  1Q1O A;  2LD9 A;  3L08 A;  3PRM B;  3BY4 B;  3IHP C;  4I6N B;  2WX1 A;  1S1Q B;  3UIP B;  3L54 A;  5AZG A;  3S2A A;  5J17 A;  2DZI A;  2HE7 A;  1V2Y A;  1VD2 A;  1WXM A;  3VQI A;  2O2V B;  2NBV B;  2RGF A;  1WFY A;  3JW0 X;  2MBO A;  4II2 B;  2DHZ A;  2IO2 B;  2KHW B;  3IBE A;  3N32 A;  1WGY A;  4W9F A;  3EFU A;  3KYC D;  3ECI A;  1H4R A;  2LUE A;  2KKC A;  5AEK B;  3A9J B;  4CYE A;  1WJ4 A;  3AUL A;  1GC7 A;  2DX5 B;  2GBM A;  1WX7 A;  4BKG A;  4AWJ A;  3A9K A;  1R4N I;  3WAP A;  2N9E B;  2KO3 A;  2DAF A;  3U30 A;  3ZO5 B;  4GDK B;  2PPH A;  3LDZ E;  3ALB A;  4M0W B;  2BWE S;  1H8C A;  1WJU A;  4FAD A;  1KJT A;  1RAX A;  1WH3 A;  3CSF A;  5DPS A;  4YL8 A;  2K8H A;  3QK0 A;  4LJP B;  1J8C A;  4WJP A;  4PS3 A;  4TKN A;  5FR6 A;  4IG7 B;  2KZR A;  3ZUN A;  2OJR A;  3JSV B;  1WI0 A;  1BT0 A;  2DEN B;  4FHJ A;  4KVG B;  1V5O A;  1Y8R C;  2XK5 A;  2DAJ A;  3B08 A;  3H9D A;  4IUM B;  4FA6 A;  3VH3 B;  1UBQ A;  4GB9 A;  3U7D A;  1WGD A;  3K9P B;  5J18 A;  2KDI A;  2JF5 A;  1WGG A;  3HHM A;  4JIO U;  1ZGU B;  2LZ6 A;  2N7E A;  2IBI B;  2N9X A;  3SU8 X;  4MGI E;  3H7P B;  5D94 A;  4HPL B;  2RPQ A;  4LDT B;  3ZIM A;  2JZ3 B;  1WGH A;  1YD8 U;  4MJS A;  2BYV E;  4GXB A;  1E8W A;  2CHX A;  2V3S A;  3A33 B;  1M94 A;  4FJZ A;  5C1Z A;  4FBJ B;  2QHO A;  1XQQ A;  4N9F 4;  1Z5S B;  2CU1 A;  2B3A A;  2M17 A;  2G3Q B;  4XX5 A;  1YQB A;  4NJ6 A;  2WX0 A;  3DVG Y;  3ZNG C;  3HK0 A;  4LDT D;  1GNU A;  2LXC A;  4FHK A;  1S3S G;  4ZRJ A;  4K7W A;  3M63 B;  3A9K B;  2ZCC A;  4FJY A;  1I35 A;  2KDE B;  3K9O B;  3L17 A;  3ZKJ C;  2ZNV B;  4E3C A;  1WF9 A;  3A1Q A;  2GMI C;  2L00 B;  2JUO A;  5CHF A;  3ZDT A;  3WAO A;  3QIJ A;  3H7S A;  5JHA A;  2GBN A;  4W9K A;  2KQS A;  4IM3 A;  3PV1 A;  5GMV A;  1TZ1 A;  2CHW A;  3C0R B;  3WAL A;  3NZS A;  4HPM B;  2O6V A;  2LGY A;  1EUV B;  1V81 A;  2MBH A;  5DPR A;  2J0J A;  5D7G A;  3DBH I;  3VHT C;  2M4N A;  2N1W A;  2J0K A;  4NY0 A;  4JGH B;  5D6J B;  4ANW A;  4P7I A;  2D11 A;  3R7Q A;  2JPH A;  2KD0 A;  2XK5 B;  1SGH A;  5KHQ A;  2IO0 B;  2L7R A;  3UGB B;  2I1J A;  5E6P A;  2RD0 A;  2ZVO A;  1P0R A;  4I6P A;  4TV3 A;  1LFD A;  4F1S A;  3ENE A;  2L05 A;  4BKS A;  3ML9 A;  4IW0 A;  1RRB A;  2DZJ A;  4GN1 A;  2L76 A;  2RSU A;  3QJZ A;  4GU2 A;  3KUD B;  2G4S A;  2GBK A;  4HJK A;  4AJY B;  2NVU I;  3KH0 A;  4CO7 A;  2V1Y A;  4MM3 A;  4DXA B;  1OGW A;  2ZEQ A;  4ANX A;  2LRU A;  3PS6 A;  4MJS B;  1WIA A;  2NBW B;  4WWP A;  3W1Y A;  4X57 B;  2EMS A;  3TMP B;  1LXD A;  3PT2 B;  4NNJ B;  1XD3 B;  3QC8 B;  4FN2 A;  2MRP A;  3A4R A;  2KWC A;  4ICV A;  2K1F A;  4FLH A;  2N1V A;  3V61 A;  4URK A;  2BYE A;  2D2Q A;  4W9D A;  2KNB A;  3RZW C;  1UBI A;  3ZVV A;  2K6Q A;  3HM6 X;  2KTR A;  2W9N A;  4A3P A;  2BGF A;  4AP4 C;  2LWP A;  2KAN A;  3DOW A;  1V5T A;  2XBB C;  5L83 A;  1IP9 A;  1YIW A;  2C5L C;  1OTR B;  3ZW3 A;  4HCP B;  3SD5 A;  3Q3F A;  2AL6 A;  5J2R A;  4OVV A;  5JHB A;  1E8Z A;  2JRH A;  2GBR A;  3A1Q B;  3N30 A;  4EZK A;  2JRI B;  3KYD D;  3R3M A;  2BF8 B;  3VXW A;  4FUL A;  3GZN I;  3TIX A;  4GIV A;  4WJQ A;  3R66 C;  3TBL D;  1IPG A;  2LI5 A;  3NZU A;  2O6V B;  2KMC A;  4TUU A;  2LRW A;  3TCA A;  3VDZ A;  3RT3 B;  2YVC A;  1WXS A;  4IM2 A;  2C7H A;  3L16 A;  4XC2 A;  3VTW A;  4MSM B;  4ZRI A;  3APC A;  3DVN V;  4HK2 A;  2K6D B;  4OVU A;  3AU4 A;  3CST A;  3I3T B;  1WM3 A;  2ZCB A;  4MEL A;  2LVQ A;  4IWO A;  4ZYN A;  4BBN F;  4G50 A;  4EOY A;  1Z2M A;  4TQ1 A;  4ASW C;  4EFO A;  4W9E A;  4M8N A;  2Z0E B;  2ASQ A;  2L3Z A;  2KJR A;  2FCM A;  2AYO B;  2DYO A;  2WDT B;  4JL9 A;  2KLC A;  1L2N A;  1Q0W B;  2L8J A;  3ZTC A;  5JZE B;  3DBS A;  1LQB A;  2MLB A;  4GOC A;  1TBE A;  1ZKH A;  2MWS B;  4KIK A;  2KDB A;  3LJ3 A;  4K81 A;  2IZV B;  2C9W B;  3V6C B;  4BKS D;  2JVC A;  2JWZ A;  1YJ1 A;  2WWZ A;  3MTN B;  3DVN U;  5CHV C;  3VTV A;  4MDK E;  3OJ4 B;  2KTR B;  2Z0D B;  3SDL C;  4ZDV A;  2CKH B;  1UEL A;  2NR2 A;  4HDQ A;  1WRD B;  2HTH A;  3DBR I;  2M0X A;  4RM8 A;  3M95 A;  3WA0 A;  3RUL A;  5TR5 A;  1OEY A;  4F7Z A;  2IO3 B;  4LJO B;  1UH6 A;  1WE6 A;  1WZ0 A;  1V6E A;  2AWT A;  2HD5 B;  2LJ5 A;  3DCG A;  4GSW A;  2MBB B;  4IWP A;  4AOF A;  2D3G A;  3VTU A;  3UQA A;  1WM2 A;  5E6O A;  4MH0 E;  3AU5 A;  3HM3 A;  3ONS A;  4WWO A;  2KOX A;  2ZZP B;  1P98 A;  4E74 A;  2LVO A;  1P3Q U;  2NS5 A;  3L10 B;  5JH5 C;  1P1A A;  4WWN A;  1UZX B;  2C60 A;  4MEM A;  2JXX A;  3H6N A;  3VAW A;  2N4F A;  1UD7 A;  3JYU A;  5CHW A;  3V6E B;  5AZF A;  2GBJ A;  1TTN A;  4HXD A;  1C3T A;  3PPA A;  3PHW B;  1IYF A;  1Q5W B;  2I1K A;  3QHT A;  1MG8 A;  2MBE A;  4F8C B;  4EUT A;  2FAZ A;  2FID A;  1J19 A;  3W1S C;  4NQK E;  1C1Y B;  1I42 A;  3QAQ A;  1P9D U;  4KDL B;  3UIN B;  2LAS A;  3RCZ A;  3A4S C;  1RFA A;  2L0T A;  4NJ7 A;  2D10 A;  2IYD B;  2PEA A;  3DQV A;  4MGZ E;  2LVP A;  3QX1 A;  4W9J A;  3IFW B;  2BKR B;  3KUC B;  2KWU B;  4II3 B;  4BOS C;  2JZZ A;  3QAR A;  4KSK C;  1LM8 B;  3VUW A;  2FCQ A;  2IY1 B;  2D07 B;  2KDF B;  2JT4 B;  4G0N B;  3VVW B;  3B0A A;  4ANU A;  4NAW A;  2MX2 A;  2R2O A;  2DZK A;  3EEC A;  4KV2 A;  3PTF C;  4NAW B;  2KJ6 A;  2FNJ B;  4BBN C;  1WY8 A;  4FJV B;  2A4Z A;  1WXA A;  2EMT A;  2IY0 B;  4DBG A;  4ANV A;  4W9C A;  3NOB A;  1CMX B;  4PYU A;  2LGD A;  5C23 A;  4K7U A;  4DHZ E;  4ICU A;  3DPD A;  2RR9 A;  3QWZ B;  4GGQ A;  5CTR C;  3M62 B;  2ZPY A;  3ZNH B;  1A5R A;  3D32 A;  4BFR A;  2AEH A;  2MBQ A;  1WJ6 A;  3APD A;  2J7Q B;  3PVL A;  4DDG D;  1WMH A;  3EHV A;  2M1M A;  3PLV A;  2PJH A;  4B9K A;  3Q3J A;  4LCD E;  5LXH A;  3AI5 A;  1FXT B;  2BPS A;  4RMA A;  3X0W A;  3RZF A;  2AL3 A;  1WXV A;  4G11 A;  1ISN A;  3ZLZ A;  3UIO B;  1R4M I;  1U4A A;  1EF5 A;  1V80 A;  2KXJ A;  2CS4 A;  3PRP B;  3QQ8 B;  3RUI B;  3TJP A;  3WAM A;  3H7P A;  3WIM A;  3NS8 A;  5E6N A;  3JVZ X;  3QCA A;  3BIN A;  4J6I A;  4W9H A;  2FUH B;  3W1S A;  4E71 A;  1WE7 A;  2KN5 A;  2MW5 A;  2ZVN A;  3IVF A;  2REX A;  2EKE C;  2KVR A;  1D3Z A;  3V62 A;  4DHZ B;  3EC8 A;  3ZDM C;  5G2N A;  1X1M A;  4GDL A;  3PLU A;  4WQO B;  2NBU A;  1G6J A;  3DDC B;  1E8X A;  5BO4 B;  2KX3 A;  2O6V D;  1NI2 A;  2K8C A;  4K7S A;  3KW5 B;  3ZRF A; 
#chains in the Genus database with same CATH topology
 3DBH B;  1ZW7 A;  1YX5 B;  2HTM E;  4HRO A;  3RD2 A;  3X23 A;  1SSN A;  5DPT A;  1HTO A;  3LYY A;  2KC1 A;  5D3I B;  2Z59 B;  3EA6 A;  2V3N A;  3P42 A;  2N9P C;  2MCN B;  3RNF C;  1QOA A;  3KQ4 A;  2GLS A;  2BWF A;  4EEW A;  3DWM A;  2QEJ C;  4B0E A;  3IG3 A;  2V4L A;  1RLF A;  3R7R A;  3VRB B;  1SB3 C;  1SIF A;  4KKJ A;  3PHX B;  4NQL B;  3W5V B;  1I4H A;  2KJH B;  1R7S A;  4YT0 B;  1QOG A;  2NPT A;  4GDL B;  2J42 A;  2QIE B;  2KQ7 A;  3VRA B;  4B95 A;  4A20 A;  2ZW0 A;  4EZJ A;  2FE8 A;  1SF0 A;  1WXQ A;  4HWI B;  2O2V A;  2DZM A;  1PQS A;  3NY5 A;  4L1B A;  2V0G A;  4DDI D;  4HVB A;  4MAC A;  5LLI A;  1UWX A;  3NVV A;  2WS3 B;  3AN1 A;  3ZGZ A;  5HI1 A;  2NCN A;  1YN4 A;  2PE9 A;  1IBX A;  4NAM A;  2MQJ A;  3DVG X;  3PZD A;  4MGY E;  1PGX A;  2LGX A;  1JWA D;  4GDK A;  4YSY B;  5L95 C;  1FFU A;  1EF1 A;  2WXI A;  2C7N B;  4JLC A;  1XT9 B;  5KHO A;  3VUY A;  3BVG A;  1V9J A;  2FUG 1;  3KVF B;  2DYB A;  1MPE A;  3PGE A;  2QMT A;  3O65 B;  2KC2 A;  3R8B A;  4RM9 A;  1SJE D;  4L2Y A;  1WX9 A;  3AB5 A;  3BK2 A;  4RGN A;  1SE3 A;  2NTT A;  3MHS D;  2NPT B;  4W9G A;  2WXF A;  3PSE B;  3WAN A;  4PK1 A;  4I6N B;  3UIP B;  2EEL A;  1FRD A;  2HE7 A;  2O2V B;  2RGF A;  3NUH B;  2MBO A;  1FPY A;  3IBE A;  4N59 A;  1F77 A;  3N32 A;  5AEK B;  3C8Y A;  1K50 A;  3AUL A;  1XCQ L;  2GBM A;  3WAP A;  1STE A;  4GDK B;  2PPH A;  2JWU A;  4BZA A;  4FAD A;  4XE0 A;  4ARI A;  1PGB A;  1KJT A;  1RAX A;  5DPS A;  1IGC A;  3RNA C;  4J3O D;  4LJP B;  4WJP A;  1ZPS A;  4DXF A;  3GS2 A;  4IG7 B;  2KZR A;  1BT0 A;  4FHJ A;  1PUT A;  2XK5 A;  4FA6 A;  1JWS D;  3VH3 B;  2QJL A;  3K9P B;  4B0M A;  5J17 A;  1ZGU B;  3SU8 X;  4LDT B;  5D3D A;  1YD8 U;  2GB1 A;  4HJG E;  4ZYS A;  1ZDX A;  1M94 A;  4FBJ B;  2AQ3 B;  3AM9 A;  1Z5S B;  3VR8 B;  2B3A A;  2D3C A;  1YQB A;  2I2Y A;  1JRP A;  1NEK B;  3HK0 A;  4LDT D;  4FHK A;  1F52 A;  1C76 A;  1C4P A;  2ZCC A;  4FJY A;  2Y5C A;  1WF9 A;  3A1Q A;  3WAO A;  2KQS A;  3ZJV A;  4IM3 A;  1K53 A;  1VRA B;  3WAL A;  2KAC A;  2D3B A;  1ZUD 2;  2MBH A;  2WXO A;  1NI3 A;  2N1W A;  4NY0 A;  1L4D B;  3MC8 A;  4ANW A;  2D11 A;  2XK5 B;  5KHQ A;  1V8C A;  2RD0 A;  4F1S A;  3ENE A;  3ML9 A;  2DZJ A;  4S17 A;  2RSU A;  1WSP A;  1JW9 D;  2W55 A;  1UUP A;  1UWM A;  4TMA B;  1YMH E;  2Q5W D;  3NVY A;  4X57 B;  1GB4 A;  1XD3 B;  1ACC A;  3GP7 A;  3QC8 B;  3A4R A;  4WIP A;  4ICV A;  2K1F A;  3RZW C;  2KTR A;  3DOW A;  2XBB C;  5L83 A;  3ZW3 A;  1DOX A;  5J2R A;  2ON8 A;  3A1Q B;  3KYD D;  2BF8 B;  3TIX A;  4GIV A;  2BW2 A;  2KN4 A;  3TCA A;  1P7F A;  1WXS A;  1RYJ A;  1I4R A;  4XC2 A;  2BS3 B;  3APC A;  4HK2 A;  3CST A;  4NZL B;  1D4B A;  4TSS A;  4MEL A;  1C78 A;  4IOI E;  4BBN F;  2QDF A;  1ZDV A;  4RGO S;  3EGR A;  2FCM A;  2MLB A;  1JWB D;  2BT6 A;  2MWS B;  3LJ3 A;  4K81 A;  2IZV B;  2C9W B;  3CIR B;  2JVC A;  1YJ1 A;  3MTN B;  2WGS A;  3OJ4 B;  2KTR B;  1YJJ A;  2Z0D B;  3SDL C;  4RCO A;  2HTH A;  2M0X A;  5IOI A;  3T3N A;  4LJO B;  3U2S C;  3ABV B;  1MG4 A;  3DCG A;  2MJE A;  2H89 B;  4IWP A;  4AOF A;  4YTP B;  5AUI A;  1TY0 A;  2D3G A;  4C7Y A;  1WM2 A;  2SAK A;  2ZZP B;  4E74 A;  5EE3 A;  5IO9 A;  3DHI C;  3L10 B;  5JH5 C;  4WWN A;  2CJN A;  3I57 A;  5H92 C;  2GBJ A;  1TTN A;  1IYF A;  3L4P A;  4D2K A;  4EUT A;  2FID A;  5I4D A;  1C1Y B;  4KDL B;  1JWM D;  3RCZ A;  1XCT L;  2KDM A;  3DQV A;  4MGZ E;  3BYT B;  2KWU B;  4P6V F;  1LM8 B;  2FCQ A;  2KDF B;  1MVK A;  4G0N B;  2NTS A;  1YJI A;  1HQR D;  2FNJ B;  3NRZ A;  1HZ6 A;  2IY0 B;  1EWC A;  1KH0 A;  1FFV A;  3DPD A;  2ZPY A;  4KGS A;  1VZ7 A;  2AEH A;  4JE3 B;  2MBQ A;  1WJ6 A;  5T8I A;  2J7Q B;  3PVL A;  4DDG D;  1WMH A;  3EHV A;  2M1M A;  4PT5 A;  3AE5 B;  4RMA A;  4L23 A;  1JRO A;  1EF5 A;  2J52 A;  3H7P A;  4C56 C;  4J6I A;  1QKZ A;  2ZVN A;  1FIQ A;  2KVR A;  2IND C;  2Y3A A;  5G2N A;  1X1M A;  2PTL A;  1G6J A;  2K5P A;  2MP2 A;  3RT3 B;  3KW5 B;  3ZRF A;  3M3J A;  3ML8 A;  1V86 A;  1XO3 A;  4K1R B;  2MA9 B;  5IAA C;  1GG3 A;  3SEB A;  2KK8 A;  1AWD A;  1C9F A;  3NJT A;  1QQR A;  4I6L B;  2A5U A;  2LHD A;  1WMH B;  2KFJ A;  3U8Z A;  2KT7 A;  2JY6 A;  4HCN B;  1OFF A;  1WZ3 A;  3L13 A;  2DNF A;  3T3O A;  1L5P A;  5IA7 A;  4K3B A;  4DHJ B;  1NYQ A;  1ZOY B;  1GUA B;  2C7M B;  4PS7 A;  2K8B A;  2G45 B;  2XEW A;  2Y5B B;  4HEA 1;  2BKF A;  2UWQ A;  3TEZ A;  2KAJ A;  4DHJ D;  1E5W A;  3ZRC A;  1AAR A;  2M19 A;  1FRR A;  1K8R B;  4USA A;  2MP2 B;  4EE2 A;  3AEE B;  2PKO A;  1E7U A;  2M8S A;  3OJ3 A;  4WJN A;  4KSL C;  4WAA A;  1WJN A;  1NDD A;  2CR5 A;  3PRE A;  3UQB A;  4KIK B;  3T8M A;  3VFK A;  3L0W B;  5CX3 A;  3A9J A;  3AE8 B;  1F9J A;  1FCC C;  1YX6 B;  4PS8 A;  2KMA A;  5AUK A;  3ZYY X;  3AEF B;  3CF6 E;  1Q10 A;  4DK5 A;  2N7D A;  4GLS C;  3PO0 A;  4IM0 A;  2JQR B;  2QSD A;  2IDY A;  2ZPN A;  4P1C C;  2K3U A;  4EKU A;  3Q3O C;  1A70 A;  3B2G A;  2CJO A;  1C4A A;  1TS5 A;  2RDH A;  3JSV A;  1L6V A;  5AZH A;  3P1M A;  2IGD A;  3APF A;  4A3O A;  3N1Y C;  3EFC A;  3ZTD A;  4M00 A;  4AQ7 A;  2KLG A;  2J0M A;  2ZJD A;  1WYW B;  1Q1O A;  1MFW A;  1S1Q B;  2WX1 A;  3L54 A;  2MJD A;  1WXM A;  2NBV B;  1WFY A;  4O1N A;  2DHZ A;  2IO2 B;  2KHW B;  3RPF C;  3RNE C;  2INN E;  3EFU A;  3IXS A;  3A9J B;  1N60 A;  1GPX A;  1GC7 A;  2DX5 B;  1WX7 A;  2INC C;  4BKG A;  1CQV A;  3A9K A;  4RGM A;  1ZXH A;  2DAF A;  2YEP B;  3ZO5 B;  3LDZ E;  1FEH A;  3ALB A;  1UNS A;  3GE8 C;  1WH3 A;  5G5H A;  2LMC A;  4YL8 A;  1TY2 A;  3AE1 B;  2JXT A;  4MH8 A;  3NVW A;  2MHJ A;  1PGA A;  3BVM A;  4DQO C;  1V1P A;  3R2I A;  3P4R B;  3JSV B;  1WI0 A;  3ZJT A;  3B08 A;  2DAJ A;  1IUE A;  2DBY A;  1TKG A;  1WGD A;  2N0S B;  4M02 A;  3HHM A;  1WGG A;  4JIO U;  2HDE A;  2IBI B;  1D5M C;  4A90 A;  4HPL B;  2RPQ A;  2N9K A;  3ZXV A;  1TKE A;  2BYV E;  4GXB A;  2V3S A;  4FJZ A;  3AMZ A;  1HEZ E;  4N9F 4;  2X8X X;  2G3Q B;  4ZOH C;  3DVG Y;  2KWD A;  1GNU A;  4JWS C;  4K7W A;  3M63 B;  3A9K B;  3ZKJ C;  4E3C A;  2BQQ A;  2WLB A;  2OED A;  2WXR A;  5CHF A;  5JHA A;  2GBN A;  2IPK D;  4QAY A;  3PV1 A;  5BMG A;  5BMI A;  2LGY A;  1EUV B;  1V1P B;  2J0J A;  3DBH I;  2TSS A;  4JGH B;  5D6J B;  3P4S B;  4P7I A;  3CWI A;  1SGH A;  2L7R A;  3UGB B;  2I38 A;  4XGA B;  2ZVO A;  4I6P A;  2L05 A;  1RRB A;  4GN1 A;  2L76 A;  3QJZ A;  1TJE A;  2GBK A;  1V97 A;  3E9S A;  4MM3 A;  4DXA B;  3P4P B;  2ZEQ A;  1WIA A;  3U7Z A;  1PYW D;  3DBL B;  4WWP A;  2EMS A;  3TMP B;  1LXD A;  2JZP A;  3V61 A;  2N1V A;  4URK A;  1UBI A;  1FNU A;  2LWP A;  2KAN A;  2WNM A;  4OVV A;  1N61 A;  2GBR A;  3N30 A;  2JRI B;  1ZE3 D;  4FUL A;  2WHI A;  3TBL D;  1IBX B;  2LI5 A;  2LRW A;  3VDZ A;  1HXY D;  1Y56 A;  1FXI A;  4IM2 A;  2C7H A;  3PZ7 A;  5EE9 A;  4ZRI A;  3I3T B;  1TS4 A;  2ZCB A;  4IWO A;  4P1B C;  4EOY A;  3LB8 C;  4Q2J A;  2ASQ A;  2WXJ A;  1HA5 A;  2KJR A;  4JL9 A;  1L2N A;  4IDI A;  3TEY A;  1Q0W B;  4MM3 B;  5JZE B;  1XLP A;  4ZRQ A;  4KGR A;  1F2R C;  1ZKH A;  2KDB A;  4XDD A;  2OJW A;  3DHH C;  2BYT A;  3HVZ A;  3VTV A;  1UEL A;  1L0Y B;  3AEG B;  4HDQ A;  2W3R A;  4RM8 A;  2IGG A;  4JWU C;  3M95 A;  1UH6 A;  4JX1 C;  1R4M B;  1V6E A;  4GSW A;  3SR6 A;  4A6Q A;  2RDG A;  4MH0 E;  2UU7 A;  1DOY A;  2KOX A;  1P98 A;  2KYW A;  2NS5 A;  1UZX B;  3H6N A;  2J4X A;  2N4F A;  4HXD A;  3PHW B;  1Q5W B;  1XF5 L;  5C3J B;  2PIA A;  3FC4 A;  3AED B;  3HUI A;  2LAS A;  1ET9 A;  2L0T A;  3FKY A;  2IYD B;  1TZO A;  2PEA A;  1YQ4 B;  2FBW B;  3QX1 A;  2LVP A;  4W9J A;  3KUC B;  4BOS C;  1ENF A;  2IY1 B;  2JT4 B;  3B0A A;  4ZRP A;  4ANU A;  2KMM A;  2W3S A;  2WP9 B;  4KV2 A;  4NAW B;  2KJ6 A;  1WY8 A;  4WWM A;  4LNK A;  4WH4 A;  4DBG A;  5FR3 A;  3RNG C;  3HVD A;  5EE1 A;  4DHZ E;  2RR9 A;  4DXG A;  3M62 B;  1A5R A;  3D32 A;  2ONQ A;  2PMV A;  3BK1 A;  1KFY B;  3PLV A;  4B9K A;  2MJ3 A;  1JQ4 A;  3AI5 A;  2BPS A;  4US9 A;  1FNV A;  4G11 A;  3AV8 A;  1ISN A;  3ZLZ A;  1R4M I;  3OWE B;  3MC9 A;  3R2T A;  5E6N A;  1YQ3 B;  3JVZ X;  1WE7 A;  1RM6 C;  1SE2 A;  1YN5 A;  3EC8 A;  3ZDM C;  3PLU A;  1CK1 A;  1M4V A;  1E8X A;  2KX3 A;  3B9J A;  4K7S A;  2GRI A;  4W9L A;  5DCN A;  2R2Q A;  2LXA A;  3W5U B;  2PE6 B;  2K39 A;  4OZC A;  1SXT A;  2KFK A;  4KKI A;  4YXD B;  1T0Q C;  1K51 A;  1JAL A;  1LGR A;  2N9L A;  4KDI C;  1VDV A;  4NPN A;  1IGD A;  3TEW A;  3NHE B;  3V60 A;  3GOE A;  4DWF A;  1VZ6 A;  4ACF A;  2K25 A;  1KOT A;  1T0Y A;  2BYF A;  3EUB 2;  2KTF A;  2UYZ B;  3Q14 C;  2M0A A;  2KX0 A;  5HKH A;  3IT4 B;  4AJW A;  1C79 A;  2FIF A;  2FCN A;  4KZ0 A;  3GZN B;  4XWW A;  2X38 A;  3RYT A;  4AUQ C;  4IWQ A;  2YLM A;  1HE8 A;  1C4C A;  1E8Y A;  1OQQ A;  2AQ1 B;  2WXP A;  3UI3 A;  1E90 A;  2KFK B;  1F2R I;  1E7P B;  4JQW C;  1GC6 A;  4C7Z A;  1KM7 A;  3VR9 B;  2K22 A;  1BUI C;  3HIZ A;  4HLE A;  4IC7 B;  1J7A A;  2D3A A;  1DOI A;  2L0F A;  1L7Y A;  1QZE A;  1SE9 A;  4HKQ A;  1KLU D;  3H1U A;  3KUZ A;  3P2B A;  3O13 A;  3N9Y C;  1WR1 A;  4WJO A;  1TS3 A;  2W54 A;  4MSQ B;  5DPW A;  2GOW A;  3Q6B A;  2MSE D;  4MGK E;  1WRI A;  3ZQ4 A;  3L08 A;  3BY4 B;  3AEC B;  1L4Z B;  4LNO A;  5AZG A;  3GB1 A;  3FAH A;  3VQI A;  1VD2 A;  3WCQ A;  1JML A;  3MHZ A;  4II2 B;  3ECI A;  1XEE A;  1NYR A;  1T0S C;  4CYE A;  2WXM A;  2BVC A;  3J9C A;  4AWJ A;  3U30 A;  1FNW A;  2BWE S;  1WJU A;  2K8H A;  1I4P A;  4XWT A;  1I4Q A;  4TKN A;  1PFD A;  2RDB C;  5FR6 A;  3BVZ A;  3ZUN A;  2OJR A;  1Y8R C;  4OW0 A;  4IUM B;  2CU3 A;  1WGK A;  4GB9 A;  3KWV A;  1T3Q A;  1SIJ A;  5J18 A;  2JF5 A;  5MPO A;  3Q8E A;  4MGI E;  1MJD A;  3H7P B;  5D94 A;  3ZIM A;  2DWQ A;  2JZ3 B;  4MJS A;  1E8W A;  2G9H D;  1BML C;  2QHO A;  1J7B A;  2M56 B;  4XX5 A;  1UGJ A;  3ZNG C;  1D6E C;  2Z8L A;  2LXC A;  1S3S G;  4ZRJ A;  4LLG M;  5BYR A;  2KDE B;  3L17 A;  2JX5 A;  2VZK B;  2H88 B;  4A9A A;  2GMI C;  3ZDT A;  2JUO A;  5FK9 C;  1UF0 A;  3MJ5 A;  5GMV A;  3AH7 A;  2CHW A;  3NZS A;  4HPM B;  2O6V A;  3P63 A;  4RF1 A;  2K9X A;  1V81 A;  5DPR A;  3VHT C;  2WU5 B;  2M4N A;  2J0K A;  2VZK D;  1AYF A;  2JPH A;  2KD0 A;  4C80 A;  2IO0 B;  1I4X A;  1AN8 A;  4KX6 B;  4TV3 A;  4BKS A;  3RMK C;  3KUD B;  3NVZ A;  3KH0 A;  2V1Y A;  3DBR B;  2OHF A;  4ANX A;  2LRU A;  4MJS B;  2NBW B;  3W1Y A;  4C4V A;  3DWG C;  3PT2 B;  4NNJ B;  4H2A A;  2MRP A;  4FLH A;  2BYE A;  2KNB A;  3ZVV A;  2K6Q A;  2WDV B;  4XDC A;  4A3P A;  1YIW A;  1OTR B;  4HCP B;  3RFZ B;  1E8Z A;  5JXV A;  1SBB B;  2HJ1 A;  3VXW A;  2WXQ A;  4WJQ A;  3R66 C;  1IPG A;  2N7J A;  1F0Z A;  2O6V B;  2KMC A;  3MC0 B;  1J7C A;  4LNF A;  3L16 A;  3VTW A;  2K6D B;  3AU4 A;  3Q8A A;  1WM3 A;  1I4G A;  2LVQ A;  1LO5 D;  2QCZ A;  4ASW C;  2Z0E B;  2B76 B;  3P4Q B;  4OVZ A;  2Y5P A;  2AYO B;  2DYO A;  2KLC A;  1LQB A;  4C4V B;  1B1Z A;  3V6C B;  4BKS D;  1HZ5 A;  2JWZ A;  2WWZ A;  5E6J A;  3V05 A;  1KTK A;  1T6B X;  4MDK E;  4ZDV A;  2CKH B;  2NR2 A;  2LFI A;  1WRD B;  3AEB B;  5HG2 A;  4IKG A;  3DBR I;  2BB6 A;  1OEY A;  2E6X A;  1WE6 A;  2AWT A;  2HD5 B;  2LJ5 A;  1QLB B;  4OZB A;  3PZ8 A;  1DGJ A;  1N5W A;  4A55 A;  3RNB C;  4XYC A;  2WQY B;  3VTU A;  3UQA A;  3ONS A;  4WWO A;  1GOZ A;  2LVO A;  1C77 A;  1P3Q U;  4CQN A;  1MI0 A;  1DYQ A;  2C60 A;  2JXX A;  4BAX A;  5AZF A;  1L0X B;  3PPA A;  1MG8 A;  2MBE A;  2PLP A;  3AE3 B;  3TUO A;  1J19 A;  3QAQ A;  2SEB D;  3UIN B;  1E0Z A;  4RNA A;  4FXC A;  2D10 A;  4NJ7 A;  3W2D A;  2LGS A;  2BTE A;  1EM7 A;  2BKR B;  5HFY A;  2JZZ A;  3VUW A;  2D07 B;  2WDQ B;  1T0R C;  3DHG C;  2R2O A;  3EEC A;  2NMQ A;  2KVZ A;  3SFE B;  3AE4 B;  4ANV A;  4RFB A;  4KGT A;  1CMX B;  1XLQ A;  3Q69 A;  4PYU A;  2EKI A;  3BZD B;  4GGQ A;  5CTR C;  1TT5 B;  4HKZ E;  3APD A;  1SEB D;  1ZP0 B;  1XLO A;  3Q8F A;  1XXG A;  2LJI A;  5LNK 1;  1WYG A;  1QF6 A;  2PJH A;  5LXH A;  3MP9 A;  1FXT B;  1KF6 B;  3RZF A;  1WXV A;  1GB1 A;  3UIO B;  1U4A A;  1CZP A;  3WAM A;  3WIM A;  3NS8 A;  4S0R A;  3MFG A;  3BIN A;  3I5J C;  2MW5 A;  2IGH A;  3IVF A;  2REX A;  2EKE C;  4NJC A;  1D3Z A;  4LK0 M;  1QOF A;  5FKA C;  1FMA D;  2L1A A;  1B9R A;  5BO4 B;  4REZ A;  1KLG D;  1ET6 A;  2LGI A;  1WR6 E;  1FD6 A;  1JRU A;  1E7V A;  2R61 A;  1OQR A;  3VH4 B;  1OEY J;  3AE7 B;  4BKT A;  1VLB A;  1NEN B;  3BYY B;  1FO4 A;  1YN3 A;  2G4D B;  2K0P A;  5EDS A;  2HJ8 A;  3MJW A;  5HHD G;  4LNN A;  1VJK A;  4PYZ A;  1D5Z C;  4HDO A;  5IKC M;  2VH2 A;  2L83 A;  3Q3M C;  3DBL I;  3AXC A;  2DYM A;  4AS1 A;  1L0V B;  4YWG G;  5LXI B;  3UF8 A;  2QIL A;  3ZNI D;  4ITK A;  4EZL A;  1HTQ A;  1J0G A;  3VUX A;  2WXH A;  4XZ4 A;  1OQY A;  2WXL A;  3T9L A;  2ZW1 A;  3N3K B;  2IO1 B;  1SJH D;  2PW9 A;  3SHQ A;  4WQM A;  4OHJ A;  3B2F A;  5TSS A;  5D2M B;  2QC8 A;  2VRR B;  2WYQ A;  1EO6 A;  2FCS A;  1KLV A;  4M8M A;  1R4N B;  4CHK A;  2KQ4 X;  5G55 A;  1VCB A;  4BVU C;  1GJZ A;  2BS4 B;  4K3C A;  1TIF A;  1UGM A;  3CMM B;  4US8 A;  2YEP F;  1NBF C;  1KRH A;  4RH6 A;  4ZRK A;  1AW7 A;  1V49 A;  5H8Y E;  3B1L X;  3TL5 A;  2MH7 A;  2ZNV C;  1WWT A;  2CHZ A;  4M0W A;  4W9I A;  3W9C B;  1GAQ B;  4TQ0 A;  1I7H A;  2G1E A;  1WGR A;  2J53 A;  3ZNZ B;  5C2T B;  3OLM D;  2LUM A;  4BOZ B;  3PRZ A;  4G3X B;  3QA8 A;  3N20 C;  4B6W A;  4GMV A;  3N1Z C;  1TGZ B;  3OAW A;  4C00 A;  2KWV B;  3SFD B;  2V4I B;  2E3T A;  2XNA C;  4KZC A;  1WX8 A;  2INP E;  3TSS A;  2OOB B;  2BB5 A;  4N6E B;  5EE0 A;  3RNC C;  3PRM B;  2LD9 A;  3IHP C;  4RGT A;  4ZHO A;  3S2A A;  2DZI A;  2LHE A;  1V2Y A;  1N5X A;  1VR9 A;  2V3P A;  3BII D;  3JW0 X;  3U52 E;  1SE4 A;  1WGY A;  4W9F A;  4HPP A;  3KYC D;  1H4R A;  2LUE A;  2KKC A;  1WJ4 A;  1VZ8 A;  1R4N I;  1TYG B;  2N9E B;  2KO3 A;  4A8X C;  4MT5 A;  1XLN A;  3U4E G;  4M0W B;  1H8C A;  1N63 A;  3NZ3 A;  2WXG A;  3CSF A;  3QK0 A;  1N62 A;  1J8C A;  4PS3 A;  2JU6 X;  1YNT E;  4ARC A;  4WAF A;  2DEN B;  3LXF A;  4KVG B;  1V5O A;  2ACZ B;  3H9D A;  1CJE A;  1UBQ A;  3U7D A;  2KDI A;  3Q8B A;  1EU4 A;  2LZ6 A;  2N7E A;  2N9X A;  4M01 A;  2L52 A;  2BS2 B;  1WGH A;  1FM0 D;  2CHX A;  3A33 B;  5C1Z A;  1XQQ A;  2CU1 A;  2M17 A;  3FIL A;  2GI9 A;  5BYQ A;  4NJ6 A;  2WX0 A;  2WU2 B;  1I35 A;  3K9O B;  2ZNV B;  2VH1 A;  5IN7 A;  1T5X D;  2L00 B;  3QIJ A;  3H7S A;  3H8H A;  4W9K A;  1TZ1 A;  3C0R B;  3AE6 B;  5D7G A;  4RF0 A;  1TKY A;  3V3X A;  5BMH A;  1RWS A;  3R7Q A;  2I1J A;  5E6P A;  1V1O A;  4LTU A;  4UDU C;  1P0R A;  1LFD A;  4IW0 A;  1FCL A;  4GU2 A;  2G4S A;  4HJK A;  4AJY B;  2ICI A;  2NVU I;  2WXK A;  4CO7 A;  2PVG C;  2DLB A;  1OGW A;  4R3D A;  3PS6 A;  4JPS A;  3Q3N C;  1JWU D;  1D5X C;  4FN2 A;  2L32 A;  2KWC A;  3OG5 A;  3FIL B;  4P16 A;  1EU3 A;  2D2Q A;  4W9D A;  3HM6 X;  2W9N A;  4AP4 C;  2BGF A;  2RMM A;  1V5T A;  1IP9 A;  1E9M A;  2C5L C;  2IJ0 A;  4HRS A;  3SD5 A;  3Q3F A;  2AL6 A;  2D5G A;  5JHB A;  3GE3 C;  2JRH A;  1E10 A;  4EZK A;  3R3M A;  3GZN I;  2JYE A;  2WXN A;  3NZU A;  4TUU A;  1YOV B;  3KLS X;  1TS2 A;  3ZXR A;  3TEX A;  2W82 A;  2YVC A;  4LNI A;  4MSM B;  3DVN V;  4OVU A;  4OZA A;  3AE9 B;  3NS1 A;  4ZYN A;  4G50 A;  3AEA B;  1Z2M A;  4TQ1 A;  4EFO A;  4W9E A;  4M8N A;  2L3Z A;  5GXG B;  1NVI D;  2WDT B;  2L8J A;  3ZTC A;  3DBS A;  3N1X C;  4GOC A;  1TBE A;  3URY A;  4KIK A;  1ZXI A;  2AX5 A;  4YTM B;  2LEK A;  1P7E A;  3DVN U;  5CHV C;  1JCK B;  1EWY C;  1RFK A;  2WDR B;  3WA0 A;  3E56 A;  3RUL A;  5TR5 A;  1MHH E;  4F7Z A;  2IO3 B;  1WZ0 A;  4WUR A;  2MBB B;  5G5G A;  5IP4 D;  3AE2 B;  5E6O A;  1E6E B;  3AU5 A;  3HM3 A;  3ETR A;  1N6Z A;  4YSX B;  3RN9 C;  1P1A A;  3IT6 B;  4MEM A;  1L6U A;  2JSV X;  3VAW A;  3JYU A;  1UD7 A;  5CHW A;  3V6E B;  1C3T A;  4N58 A;  3RI7 C;  1K52 A;  2I1K A;  1FXA A;  3QHT A;  1BXT A;  4F8C B;  2FAZ A;  3W1S C;  4NQK E;  4YTN B;  1I42 A;  1P9D U;  3ZJU A;  3HRD D;  1MHX A;  3A4S C;  1RFA A;  3Q2A C;  2MEK A;  3IFW B;  3IAM 1;  4II3 B;  3QAR A;  4KSK C;  1PDX A;  3VVW B;  3Q8C A;  4YSZ B;  4NAW A;  2MX2 A;  2DZK A;  2XN9 C;  3PTF C;  1QOB A;  4BBN C;  4FJV B;  2A4Z A;  2JYT A;  1WXA A;  2EMT A;  3NG0 A;  3BWU D;  4W9C A;  3NOB A;  3KWL A;  2LGD A;  5C23 A;  4K7U A;  2PVO D;  4ICU A;  3QWZ B;  3ZNH B;  4BFR A;  1QT9 A;  3Q3J A;  4LCD E;  3X0W A;  2AL3 A;  1V80 A;  1ROE A;  2CS4 A;  2KXJ A;  3PRP B;  3QQ8 B;  3RUI B;  3TJP A;  2BBC A;  2V9H A;  1F1H A;  2RPV A;  3QCA A;  4W9H A;  4E71 A;  2AQ2 B;  2FUH B;  3W1S A;  2KN5 A;  1QIL A;  3IAS 1;  3V62 A;  4DHZ B;  1ESF A;  3I63 C;  3I9V 1;  4GDL A;  4WQO B;  2NBU A;  4ZHP A;  5BYS A;  3DDC B;  2O6V D;  1NI2 A;  2K8C A;  3C19 A; 
#chains in the Genus database with same CATH homology
 1WR6 E;  3M3J A;  3ML8 A;  1V86 A;  1ZW7 A;  1YX5 B;  1JRU A;  3RD2 A;  3X23 A;  4K1R B;  1E7V A;  2MP2 A;  2MA9 B;  4W9L A;  5DCN A;  5DPT A;  2R2Q A;  3VH4 B;  5IAA C;  2LXA A;  2KC1 A;  2PE6 B;  1OEY J;  1GG3 A;  4BKT A;  2KK8 A;  2K39 A;  2Z59 B;  2KFK A;  2G4D B;  4I6L B;  2A5U A;  5EDS A;  2HJ8 A;  3MJW A;  4KDI C;  4NPN A;  4PYZ A;  3NHE B;  3V60 A;  2N9P C;  2MCN B;  4HDO A;  1WMH B;  3GOE A;  2KFJ A;  3U8Z A;  4DWF A;  2JY6 A;  3DBL I;  2BWF A;  3AXC A;  2DYM A;  4HCN B;  2K25 A;  4EEW A;  1KOT A;  1WZ3 A;  1T0Y A;  2BYF A;  3L13 A;  5IA7 A;  5LXI B;  2KTF A;  3IG3 A;  2V4L A;  4DHJ B;  1RLF A;  3R7R A;  3UF8 A;  2UYZ B;  3ZNI D;  1GUA B;  2C7M B;  1SIF A;  4PS7 A;  2K8B A;  4EZL A;  1J0G A;  3VUX A;  2KX0 A;  3PHX B;  4XZ4 A;  1OQY A;  5HKH A;  2G45 B;  2XEW A;  4NQL B;  2KJH B;  2Y5B B;  3N3K B;  3T9L A;  2FIF A;  4AJW A;  2IO1 B;  3SHQ A;  2FCN A;  2BKF A;  2NPT A;  2UWQ A;  4KZ0 A;  4GDL B;  5D2M B;  2VRR B;  2KQ7 A;  2WYQ A;  4DHJ D;  4B95 A;  1E5W A;  1EO6 A;  3ZRC A;  1AAR A;  2FCS A;  4A20 A;  3RYT A;  4AUQ C;  1K8R B;  4M8M A;  1KLV A;  2MP2 B;  4IWQ A;  2YLM A;  4EZJ A;  4CHK A;  1E7U A;  5G55 A;  1HE8 A;  1VCB A;  2M8S A;  2O2V A;  3OJ3 A;  2DZM A;  4HWI B;  4KSL C;  4WJN A;  4BVU C;  1GJZ A;  4WAA A;  1PQS A;  3NY5 A;  1UGM A;  1E8Y A;  1WJN A;  4DDI D;  3CMM B;  4HVB A;  1NDD A;  2CR5 A;  5LLI A;  3PRE A;  3UQB A;  4KIK B;  1E90 A;  3T8M A;  3VFK A;  3L0W B;  2KFK B;  5CX3 A;  2NCN A;  1NBF C;  2PE9 A;  3A9J A;  4ZRK A;  1F9J A;  2MQJ A;  3DVG X;  4JQW C;  3PZD A;  1V49 A;  1GC6 A;  1YX6 B;  4PS8 A;  2KMA A;  3B1L X;  3TL5 A;  4MGY E;  1KM7 A;  2ZNV C;  2LGX A;  4GDK A;  3CF6 E;  2CHZ A;  4W9I A;  3HIZ A;  4DK5 A;  5L95 C;  4TQ0 A;  1EF1 A;  4HLE A;  2C7N B;  4IC7 B;  4JLC A;  1XT9 B;  2N7D A;  5KHO A;  3VUY A;  1WGR A;  4IM0 A;  3ZNZ B;  2L0F A;  1V9J A;  3OLM D;  4BOZ B;  2ZPN A;  3PRZ A;  1L7Y A;  1QZE A;  1SE9 A;  2DYB A;  3KVF B;  4G3X B;  4EKU A;  3H1U A;  3KUZ A;  3QA8 A;  3PGE A;  4B6W A;  3P2B A;  3JSV A;  4GMV A;  3O65 B;  2KC2 A;  1TGZ B;  3OAW A;  5AZH A;  2KWV B;  4RM9 A;  3APF A;  4A3O A;  1WX9 A;  1WR1 A;  4WJO A;  3ZTD A;  4MSQ B;  5DPW A;  2GOW A;  4KZC A;  1WX8 A;  2KLG A;  3MHS D;  2NPT B;  4W9G A;  2OOB B;  3PSE B;  3WAN A;  2J0M A;  2MSE D;  4MGK E;  2ZJD A;  1WYW B;  1Q1O A;  2LD9 A;  3L08 A;  3PRM B;  3BY4 B;  3IHP C;  4I6N B;  2WX1 A;  1S1Q B;  3UIP B;  3L54 A;  5AZG A;  3S2A A;  5J17 A;  2DZI A;  2HE7 A;  1V2Y A;  1VD2 A;  1WXM A;  3VQI A;  2O2V B;  2NBV B;  2RGF A;  1WFY A;  3JW0 X;  2MBO A;  4II2 B;  2DHZ A;  2IO2 B;  2KHW B;  3IBE A;  3N32 A;  1WGY A;  4W9F A;  3EFU A;  3KYC D;  3ECI A;  1H4R A;  2LUE A;  2KKC A;  5AEK B;  3A9J B;  4CYE A;  1WJ4 A;  3AUL A;  1GC7 A;  2DX5 B;  2GBM A;  1WX7 A;  4BKG A;  4AWJ A;  3A9K A;  1R4N I;  3WAP A;  2N9E B;  2KO3 A;  2DAF A;  3U30 A;  3ZO5 B;  4GDK B;  2PPH A;  3LDZ E;  3ALB A;  4M0W B;  2BWE S;  1H8C A;  1WJU A;  4FAD A;  1KJT A;  1RAX A;  1WH3 A;  3CSF A;  5DPS A;  4YL8 A;  2K8H A;  3QK0 A;  4LJP B;  1J8C A;  4WJP A;  4PS3 A;  4TKN A;  5FR6 A;  4IG7 B;  2KZR A;  3ZUN A;  2OJR A;  3JSV B;  1WI0 A;  1BT0 A;  2DEN B;  4FHJ A;  4KVG B;  1V5O A;  1Y8R C;  2XK5 A;  2DAJ A;  3B08 A;  3H9D A;  4IUM B;  4FA6 A;  3VH3 B;  1UBQ A;  4GB9 A;  3U7D A;  1WGD A;  3K9P B;  5J18 A;  2KDI A;  2JF5 A;  1WGG A;  3HHM A;  4JIO U;  1ZGU B;  2LZ6 A;  2N7E A;  2IBI B;  2N9X A;  3SU8 X;  4MGI E;  3H7P B;  5D94 A;  4HPL B;  2RPQ A;  4LDT B;  3ZIM A;  2JZ3 B;  1WGH A;  1YD8 U;  4MJS A;  2BYV E;  4GXB A;  1E8W A;  2CHX A;  2V3S A;  3A33 B;  1M94 A;  4FJZ A;  5C1Z A;  4FBJ B;  2QHO A;  1XQQ A;  4N9F 4;  1Z5S B;  2CU1 A;  2B3A A;  2M17 A;  2G3Q B;  4XX5 A;  1YQB A;  4NJ6 A;  2WX0 A;  3DVG Y;  3ZNG C;  3HK0 A;  4LDT D;  1GNU A;  2LXC A;  4FHK A;  1S3S G;  4ZRJ A;  4K7W A;  3M63 B;  3A9K B;  2ZCC A;  4FJY A;  1I35 A;  2KDE B;  3K9O B;  3L17 A;  3ZKJ C;  2ZNV B;  4E3C A;  1WF9 A;  3A1Q A;  2GMI C;  2L00 B;  2JUO A;  5CHF A;  3ZDT A;  3WAO A;  3QIJ A;  3H7S A;  5JHA A;  2GBN A;  4W9K A;  2KQS A;  4IM3 A;  3PV1 A;  5GMV A;  1TZ1 A;  2CHW A;  3C0R B;  3WAL A;  3NZS A;  4HPM B;  2O6V A;  2LGY A;  1EUV B;  1V81 A;  2MBH A;  5DPR A;  2J0J A;  5D7G A;  3DBH I;  3VHT C;  2M4N A;  2N1W A;  2J0K A;  4NY0 A;  4JGH B;  5D6J B;  4ANW A;  4P7I A;  2D11 A;  3R7Q A;  2JPH A;  2KD0 A;  2XK5 B;  1SGH A;  5KHQ A;  2IO0 B;  2L7R A;  3UGB B;  2I1J A;  5E6P A;  2RD0 A;  2ZVO A;  1P0R A;  4I6P A;  4TV3 A;  1LFD A;  4F1S A;  3ENE A;  2L05 A;  4BKS A;  3ML9 A;  4IW0 A;  1RRB A;  2DZJ A;  4GN1 A;  2L76 A;  2RSU A;  3QJZ A;  4GU2 A;  3KUD B;  2G4S A;  2GBK A;  4HJK A;  4AJY B;  2NVU I;  3KH0 A;  4CO7 A;  2V1Y A;  4MM3 A;  4DXA B;  1OGW A;  2ZEQ A;  4ANX A;  2LRU A;  3PS6 A;  4MJS B;  1WIA A;  2NBW B;  4WWP A;  3W1Y A;  4X57 B;  2EMS A;  3TMP B;  1LXD A;  3PT2 B;  4NNJ B;  1XD3 B;  3QC8 B;  4FN2 A;  2MRP A;  3A4R A;  2KWC A;  4ICV A;  2K1F A;  4FLH A;  2N1V A;  3V61 A;  4URK A;  2BYE A;  2D2Q A;  4W9D A;  2KNB A;  3RZW C;  1UBI A;  3ZVV A;  2K6Q A;  3HM6 X;  2KTR A;  2W9N A;  4A3P A;  2BGF A;  4AP4 C;  2LWP A;  2KAN A;  3DOW A;  1V5T A;  2XBB C;  5L83 A;  1IP9 A;  1YIW A;  2C5L C;  1OTR B;  3ZW3 A;  4HCP B;  3SD5 A;  3Q3F A;  2AL6 A;  5J2R A;  4OVV A;  5JHB A;  1E8Z A;  2JRH A;  2GBR A;  3A1Q B;  3N30 A;  4EZK A;  2JRI B;  3KYD D;  3R3M A;  2BF8 B;  3VXW A;  4FUL A;  3GZN I;  3TIX A;  4GIV A;  4WJQ A;  3R66 C;  3TBL D;  1IPG A;  2LI5 A;  3NZU A;  2O6V B;  2KMC A;  4TUU A;  2LRW A;  3TCA A;  3VDZ A;  3RT3 B;  2YVC A;  1WXS A;  4IM2 A;  2C7H A;  3L16 A;  4XC2 A;  3VTW A;  4MSM B;  4ZRI A;  3APC A;  3DVN V;  4HK2 A;  2K6D B;  4OVU A;  3AU4 A;  3CST A;  3I3T B;  1WM3 A;  2ZCB A;  4MEL A;  2LVQ A;  4IWO A;  4ZYN A;  4BBN F;  4G50 A;  4EOY A;  1Z2M A;  4TQ1 A;  4ASW C;  4EFO A;  4W9E A;  4M8N A;  2Z0E B;  2ASQ A;  2L3Z A;  2KJR A;  2FCM A;  2AYO B;  2DYO A;  2WDT B;  4JL9 A;  2KLC A;  1L2N A;  1Q0W B;  2L8J A;  3ZTC A;  5JZE B;  3DBS A;  1LQB A;  2MLB A;  4GOC A;  1TBE A;  1ZKH A;  2MWS B;  4KIK A;  2KDB A;  3LJ3 A;  4K81 A;  2IZV B;  2C9W B;  3V6C B;  4BKS D;  2JVC A;  2JWZ A;  1YJ1 A;  2WWZ A;  3MTN B;  3DVN U;  5CHV C;  3VTV A;  4MDK E;  3OJ4 B;  2KTR B;  2Z0D B;  3SDL C;  4ZDV A;  2CKH B;  1UEL A;  2NR2 A;  4HDQ A;  1WRD B;  2HTH A;  3DBR I;  2M0X A;  4RM8 A;  3M95 A;  3WA0 A;  3RUL A;  5TR5 A;  1OEY A;  4F7Z A;  2IO3 B;  4LJO B;  1UH6 A;  1WE6 A;  1WZ0 A;  1V6E A;  2AWT A;  2HD5 B;  2LJ5 A;  3DCG A;  4GSW A;  2MBB B;  4IWP A;  4AOF A;  2D3G A;  3VTU A;  3UQA A;  1WM2 A;  5E6O A;  4MH0 E;  3AU5 A;  3HM3 A;  3ONS A;  4WWO A;  2KOX A;  2ZZP B;  1P98 A;  4E74 A;  2LVO A;  1P3Q U;  2NS5 A;  3L10 B;  5JH5 C;  1P1A A;  4WWN A;  1UZX B;  2C60 A;  4MEM A;  2JXX A;  3H6N A;  3VAW A;  2N4F A;  1UD7 A;  3JYU A;  5CHW A;  3V6E B;  5AZF A;  2GBJ A;  1TTN A;  4HXD A;  1C3T A;  3PPA A;  3PHW B;  1IYF A;  1Q5W B;  2I1K A;  3QHT A;  1MG8 A;  2MBE A;  4F8C B;  4EUT A;  2FAZ A;  2FID A;  1J19 A;  3W1S C;  4NQK E;  1C1Y B;  1I42 A;  3QAQ A;  1P9D U;  4KDL B;  3UIN B;  2LAS A;  3RCZ A;  3A4S C;  1RFA A;  2L0T A;  4NJ7 A;  2D10 A;  2IYD B;  2PEA A;  3DQV A;  4MGZ E;  2LVP A;  3QX1 A;  4W9J A;  3IFW B;  2BKR B;  3KUC B;  2KWU B;  4II3 B;  4BOS C;  2JZZ A;  3QAR A;  4KSK C;  1LM8 B;  3VUW A;  2FCQ A;  2IY1 B;  2D07 B;  2KDF B;  2JT4 B;  4G0N B;  3VVW B;  3B0A A;  4ANU A;  4NAW A;  2MX2 A;  2R2O A;  2DZK A;  3EEC A;  4KV2 A;  3PTF C;  4NAW B;  2KJ6 A;  2FNJ B;  4BBN C;  1WY8 A;  4FJV B;  2A4Z A;  1WXA A;  2EMT A;  2IY0 B;  4DBG A;  4ANV A;  4W9C A;  3NOB A;  1CMX B;  4PYU A;  2LGD A;  5C23 A;  4K7U A;  4DHZ E;  4ICU A;  3DPD A;  2RR9 A;  3QWZ B;  4GGQ A;  5CTR C;  3M62 B;  2ZPY A;  3ZNH B;  1A5R A;  3D32 A;  4BFR A;  2AEH A;  2MBQ A;  1WJ6 A;  3APD A;  2J7Q B;  3PVL A;  4DDG D;  1WMH A;  3EHV A;  2M1M A;  3PLV A;  2PJH A;  4B9K A;  3Q3J A;  4LCD E;  5LXH A;  3AI5 A;  1FXT B;  2BPS A;  4RMA A;  3X0W A;  3RZF A;  2AL3 A;  1WXV A;  4G11 A;  1ISN A;  3ZLZ A;  3UIO B;  1R4M I;  1U4A A;  1EF5 A;  1V80 A;  2KXJ A;  2CS4 A;  3PRP B;  3QQ8 B;  3RUI B;  3TJP A;  3WAM A;  3H7P A;  3WIM A;  3NS8 A;  5E6N A;  3JVZ X;  3QCA A;  3BIN A;  4J6I A;  4W9H A;  2FUH B;  3W1S A;  4E71 A;  1WE7 A;  2KN5 A;  2MW5 A;  2ZVN A;  3IVF A;  2REX A;  2EKE C;  2KVR A;  1D3Z A;  3V62 A;  4DHZ B;  3EC8 A;  3ZDM C;  5G2N A;  1X1M A;  4GDL A;  3PLU A;  4WQO B;  2NBU A;  1G6J A;  3DDC B;  1E8X A;  5BO4 B;  2KX3 A;  2O6V D;  1NI2 A;  2K8C A;  4K7S A;  3KW5 B;  3ZRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...