4YTPB

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 60
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytpB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytpB01
1XLPA 3LXFA 1JROA 1H7XA 4YTMB 1YQ4B 4ZHOA 1E10A 5EE1A 1RM6C 1QOBA 2QIEB 3AEEB 4FXCA 4YSYB 1OFFA 1B9RA 3AEFB 1FRRA 1I7HA 2PVOD 4JX1C 1V8CA 1SF0A 1YJIA 1KRHA 4ITKA 4WQMA 1E9MA 1SB3C 3B9JA 4KX6B 3AE7B 1JALA 2H89B 1VDVA 2CU3A 2WDQB 3SR6A 2AX5A 4YT0B 1YJJA 3NVYA 1E7PB 4N6EB 2MH7A 4US9A 2MJEA 3AEAB 3VR8B 3AE8B 1PUTA 2CJOA 1DGJA 5AUIA 1QOGA 1KFYB 2BT6A 1GAQB 2W3SA 1TKYA 1N5WA 3SFEB 3LB8C 3P4QB 3WCQA 2KMMA 1IUEA 1E0ZA 5AUKA 2EKIA 1GTHA 1L6VA 1YQ3B 1QOAA 3AN1A 1VLBA 4HROA 3AH7A 1L6UA 5H92C 2H88B 2WP9B 5C3JB 4US8A 2BS4B 2BS2B 4JWUC 4C7YA 1OQQA 1JWAD 4C80A 1QLBB 3SFDB 1QT9A 4YXDB 5EE3A 3VRAB 1J7CA 2PIAA 3ABVB 2OHFA 5EE9A 3VR9B 2MJDA 2WQYB 1CZPA 3HVZA 1J7AA 1N5XA 2Y5CA 1T3QA 2MJ3A 1ZOYB 1NYQA 3AB5A 2G1EA 1RWSA 1WYGA 2WLBA 1XLNA 1DOIA 3DWGC 3FAHA 1GPXA 1ZP0B 1CJEA 1XLOA 1ZXIA 1DOXA 2B76B 5GXGB 2JQRB 2WDRB 3CIRB 3ETRA 4YSZB 2WDVB 1FIQA 1FO4A 3W5VB 5H8YE 3NVWA 2L83A 3P1MA 2WU2B 4HRSA 3PO0A 2Q5WD 3B2GA 3P63A 1E6EB 3AMZA 1FXIA 1NVID 1FFUA 1RYJA 3CF4A 1FFVA 2ACZB 2PVGC 3AECB 3P4SB 2LEKA 5G5HA 2FBWB 3AEBB 2W3RA 3NVVA 1NENB 3DWMA 3RPFC 1QF6A 3AM9A 3L4PA 3VRBB 3AE9B 3W9CB 2WU5B 1A70A 4USAA 1SIJA 1DOYA 1WWTA 1OQRA 1XLQA 3AEGB 1GT8A 3NVZA 1PDXA 3ZYYX 1TKGA 5G5GA 2W54A 3AEDB 1XO3A 3W5UB 1TJEA 1TYGB 3HUIA 4C7ZA 2DBYA 1AYFA 2KAJA 1RFKA 1JQ4A 2QJLA 3HRDD 3AE3B 3EUB2 1WGKA 3AE6B 3NS1A 1N63A 1PFDA 1JWBD 3AE2B 2L52A 4P6VF 1ZUD2 4YSXB 2PKOA 5EE0A 4ZHPA 2E3TA 4WWMA 1QOFA 1ROEA 1VJKA 2DWQA 5C2TB 1JRPA 2K9XA 4JWSC 1H7WA 3AE5B 1NEKB 2N0SB 1NI3A 3P4RB 1V97A 3AE4B 1NYRA 1UWMA 1J7BA 2WS3B 1R7SA 1WRIA 1WXQA 4YTNB 1KF6B 1FRDA 3KWLA 1N61A 2HTME 2JX5A 1JW9D 4LTUA 1TKEA 4ZOHC 1EWYC 3AE1B 3P4PB 1L5PA 3FC4A 1F0ZA 3NRZA 1L0VB 1FM0D 1GTEA 1N60A 3B2FA 4IDIA 1FXAA 1FMAD 1N62A 3CWIA 4N59A 2CJNA 4A9AA 4YTPB 2M19A 2M56B 2BS3B 3BIID 3AV8A 2K5PA 4N58A 2W55A 1AWDA 5MPOA 2K22A
chains in the Genus database with same CATH superfamily
3ZQ4A 2KMAA 3SD5A 1V8CA 1YJIA 4HJKA 2BTEA 3DVGX 3N20C 4E3CA 4KGRA 1GC6A 2EMTA 3EFUA 1XD3B 2R2OA 1H8CA 2KJHB 1E7PB 4YL8A 2C7NB 2MJEA 3VR8B 4FULA 1KFYB 4G50A 2BB5A 4BAXA 4E74A 1E0ZA 2N7DA 1L6VA 2O6VA 2EKEC 2BS2B 3P2BA 2FCSA 1D4BA 3ABVB 1C79A 4GLSC 3VR9B 2Y5CA 4GDKA 2O6VB 2G1EA 3MHZA 2WDRB 1SGHA 5HG2A 3ZXVA 3GZNI 1GB4A 2K0PA 2DX5B 4I6LB 1CK1A 4GDKB 3U8ZA 2CHXA 3OAWA 2JVCA 3ZDMC 1ZW7A 1TS5A 2G4SA 2JF5A 2ZNVC 4MJSA 3AE9B 2WU5B 4IWPA 4F8CB 1TS2A 1YOVB 3ZTDA 4JL9A 3NVZA 2IGGA 4XYCA 1TT5B 4OVVA 2KDIA 3AEDB 2KACA 4FJVB 3KQ4A 4ACFA 2GBJA 3EUB2 3AE6B 4MJSB 5L95C 3QCAA 4AJYB 1K51A 1VJKA 2DWQA 5C1ZA 4I6NB 3P4RB 1ZGUB 4PYZA 2HTHA 2Z0EB 1F1HA 3IT4B 1V9JA 3V60A 1J8CA 2MCNB 2I1KA 2XEWA 3VVWB 2KKCA 3CWIA 4A9AA 1TTNA 2J53A 2LFIA 4A3PA 1AWDA 4RFBA 5EE1A 1VD2A 1C4AA 4HXDA 2RDBC 2JSVX 1KRHA 2M8SA 1I42A 1VDVA 4J6IA 2AX5A 3NVYA 2D2QA 1SJED 2CJOA 5DCNA 1ENFA 3ZTCA 1YN3A 1R4NI 4GB9A 1YQ3B 4HROA 4WWPA 2MX2A 3DVGY 3ZGZA 4IG7B 4YXDB 5EE3A 2RR9A 4B6WA 1QQRA 1WRDB 1FCCC 2MJ3A 2KN4A 1T0QC 3WA0A 1XXGA 1K50A 2C5LC 3L0WB 1ZP0B 3TSSA 1KH0A 2W9NA 1YN4A 2WU2B 5IAAC 2BBCA 2LZ6A 1MG4A 3V3XA 2C9WB 2FBWB 2JWZA 3VUWA 2K8CA 2HJ1A 2WXOA 3W9CB 1GB1A 2FE8A 1DOYA 1HXYD 2HDEA 1SIFA 5CX3A 2OOBB 2W54A 1GJZA 1JWMD 3QHTA 4P1CC 1H4RA 3E56A 4M8MA 2XK5A 1RFKA 1LO5D 2LVQA 2MSED 3Q69A 1GUAB 4W9EA 2IO2B 2KFKA 4DDID 1V1OA 5DPWA 2M17A 2NBUA 4W9KA 2IO3B 2XK5B 1GOZA 4TMAB 3KWLA 4RNAA 3RNFC 2FCMA 1UWXA 2KZRA 3NZUA 1V81A 2D5GA 4HJGE 4GXBA 5D94A 5AZHA 4WQOB 2N9XA 4HEA1 3PVLA 1RM6C 3NY5A 2LASA 2MA9B 3HK0A 2N4FA 3Q3NC 1AW7A 1SEBD 3AE7B 4MACA 3PHWB 4WAAA 3UQAA 4WJOA 3TIXA 4RMAA 2KDEB 4RGTA 2G3QB 4CQNA 1DYQA 5DPSA 1VZ6A 4HPPA 4MGZE 1U4AA 4WJNA 3SFDB 3ZRCA 3RNAC 1PYWD 5IP4D 3T3OA 2KNBA 2TSSA 1DOXA 3ETRA 1LGRA 4OZCA 2QEJC 3RZFA 3W1SC 1HE8A 2K1FA 2L76A 3AECB 2IJ0A 1NENB 3DWMA 1F2RI 5IO9A 1T5XD 2DZJA 4OVZA 4MGKE 4NZLB 2JPHA 1B1ZA 3AEGB 3O65B 1WJNA 1K53A 1YMHE 1TYGB 3HIZA 1KLGD 2C7MB 3TEZA 1JQ4A 2QC8A 2GLSA 4P6VF 3DBRI 2J42A 3DDCB 3TJPA 1JRPA 3A9KA 2PJHA 1NI3A 4I6PA 3DBHB 2AL3A 2DLBA 3MTNB 4ZRQA 1FRDA 1JW9D 3I63C 3U2SC 4JQWC 5DPRA 3TMPB 1UH6A 4A6QA 4PS8A 4YTPB 2M56B 1VCBA 1WY8A 1UGMA 4RF1A 5IA7A 1JROA 4PS3A 3IHPC 3AEEB 3PRMB 3ENEA 1I7HA 2K8HA 4JX1C 2MHJA 4REZA 2CU3A 3TEYA 2Y3AA 4PK1A 4NJ6A 5AUIA 1QOGA 2HJ8A 4IW0A 4AP4C 1IUEA 3N3KB 1WXSA 2RSUA 4RF0A 4MH0E 1D3ZA 5LXIB 3AH7A 1L6UA 3BZDB 1MVKA 1SE4A 1P1AA 3QK0A 1KOTA 1F77A 2L3ZA 4DXFA 3PSEB 2DYOA 2JYTA 3I3TB 1NYQA 1P0RA 2J0MA 2DENB 3S2AA 4RH6A 1SXTA 1SJHD 4KSKC 5JHAA 3D32A 1Q0WB 2K8BA 2L83A 3AMZA 4J3OD 1WF9A 1E7UA 1T0SC 4N9F4 3UGBB 4DHZE 2D3GA 2G4DB 3AEBB 3ZJVA 4KV2A 4XWTA 4NAWA 3IAS1 3UINB 4KIKA 2I1JA 2BF8B 2KC1A 2QJLA 3PHXB 1WI0A 4DHJD 2QCZA 3BVMA 3B0AA 5LNK1 1MFWA 4NAWB 5G55A 4WJPA 3DVNV 5IN7A 2LHEA 2O2VA 4LNFA 1MG8A 2ICIA 2BGFA 4URKA 5HFYA 1I4GA 4A20A 3SDLC 2LRWA 1L5PA 2JRHA 3BYYB 4NAMA 3NRZA 1F0ZA 2DHZA 3ZKJC 4Q2JA 4R3DA 2BWES 2O2VB 2PE6B 5LXHA 1WGDA 2KC2A 4GGQA 5GMVA 2R2QA 2QIEB 4FXCA 3WIMA 2N9KA 3PREA 2PVOD 4LJOB 4RM9A 1SE3A 3UQBA 2QILA 3LYYA 1TZOA 1V6EA 2MW5A 4F1SA 4E71A 2W82A 2UU7A 4FHJA 1QLBB 2YLMA 2KDBA 5EE9A 3U7DA 2GRIA 4DDGD 1VZ7A 1F2RC 4DXAB 3NUHB 1GPXA 4AJWA 4BVUC 4IC7B 3CIRB 4EUTA 1IBXA 2DAJA 2DZMA 2NVUI 1I4HA 3B2GA 1KM7A 3IXSA 1JMLA 3ZJUA 1S3SG 1RYJA 1FFUA 2CKHB 1IPGA 1FFVA 4GDLA 2KLCA 2MBEA 4QAYA 2MLBA 4B95A 1MHXA 3N30A 3DOWA 4RGNA 3ZUNA 3QQ8B 2NBVB 3EC8A 1TKGA 2WX1A 1HEZE 3RMKC 4GDLB 4ANXA 1E8YA 2KX3A 1P7FA 2ZPNA 4GOCA 1RRBA 4BKSD 1VR9A 2LRUA 4ANVA 1QOFA 1IGDA 4W9FA 5C2TB 4KDIC 4BFRA 4AWJA 3B1LX 1WGRA 1MJDA 1R7SA 2AEHA 2LGXA 4WWOA 2KANA 1I4QA 2HTME 2XBBC 1FM0D 1L0YB 1EO6A 3L16A 3X0WA 3L08A 4OHJA 1SBBB 4MSMB 3LXFA 4ZHOA 4G11A 1LXDA 1P3QU 4EZKA 2IO0B 1FD6A 1FRRA 2LJ5A 4L1BA 1XQQA 2GBNA 3VTVA 1E9MA 2JU6X 2WNMA 3OJ4B 1MPEA 2H89B 2RMMA 4BKGA 2CS4A 4JGHB 3GE3C 1P7EA 2WWZA 3SU8X 5JZEB 2KT7A 1F9JA 2R61A 3NZ3A 1T0YA 2LUMA 3M3JA 3AU4A 4US8A 4JWUC 3RNGC 5EDSA 3PZ7A 3PGEA 4B9KA 4IOIE 1M94A 3QAQA 4C4VA 1XLNA 1CJEA 1ZXIA 2RPVA 4D2KA 2DZKA 1V1PA 5FR6A 4BZAA 1VZ8A 2BKRB 4ZYNA 3UIPB 4S17A 2LXAA 3NJTA 2CHWA 3KUDB 4W9HA 4C4VB 2V4LA 2ASQA 3B08A 2W3RA 1QF6A 3I9V1 3KUZA 3ZNHB 1V1PB 1HTOA 2BPSA 2NS5A 4LK0M 2NTTA 3H7PB 1E8XA 3VTWA 3ZRFA 1GG3A 3I57A 2D10A 4ZHPA 4WWMA 2ZVOA 3L13A 2KWCA 4II3B 1NEKB 4BBNC 4XE0A 3WALA 1TGZB 1HZ5A 2ZNVB 4ZOHC 3ZLZA 1EWYC 2V1YA 2V3PA 3B2FA 3EFCA 3DCGA 2BS3B 2QDFA 2K5PA 5TR5A 4HDOA 3A4SC 1WH3A 4WAFA 2WXNA 2J4XA 2L32A 1WYWB 2GBKA 3AEFB 1RFAA 4GU2A 2WDQB 2QHOA 3JW0X 4FJZA 3MC0B 3SFEB 3MJWA 3QARA 3P4QB 2C7HA 3H8HA 2BVCA 2HE7A 3AN1A 1PGXA 2ZPYA 2PE9A 2H88B 2FIFA 2I38A 3H6NA 4WURA 1TY0A 4NQLB 3W1YA 2BS4B 2J7QB 2IGHA 4GIVA 1V86A 2NPTA 2RPQA 4K1RB 4DXGA 4XDCA 2WXHA 3H9DA 1TY2A 3DBHI 3NVWA 1YQBA 2KXJA 1OEYJ 3PLUA 2NPTB 5FR3A 4XX5A 4ARCA 3CF4A 4II2B 1GNUA 3IT6B 2PMVA 4EKUA 1E8ZA 4MM3B 1WWTA 1GT8A 3DBLB 1TJEA 1C78A 3L17A 2JUOA 1CQVA 3CMMB 3HM3A 3E9SA 1AARA 1ROEA 4HWIB 3VUYA 4K3BA 4LDTD 3M63B 3M62B 3C19A 1D5XC 3A1QA 4DWFA 1KLVA 1S1QB 2JX5A 2MWSB 3ALBA 2LXCA 2CJNA 2M19A 3WANA 5JHBA 3RT3B 3A1QB 2CR5A 3CF6E 2D3BA 1SF0A 2LUEA 2YVCA 4O1NA 3C8YA 1JRUA 3DHHC 1FEHA 5AUKA 1WGHA 3EGRA 3HM6X 3QIJA 4HLEA 4CO7A 1WR1A 1A5RA 3TEWA 2MJDA 4K7SA 4MT5A 3MC8A 1WYGA 1DOIA 3R2TA 5D3DA 3BY4B 1UELA 2UYZB 2DYMA 4XGAB 2KQ4X 2ACZB 4IM0A 4TSSA 1XT9B 3EA6A 3ZNID 1XEEA 2LHDA 2A4ZA 3Q3FA 4G3XB 2G45B 1YNTE 2AQ1B 4P1BC 3KH0A 3PRPB 3W1SA 1BT0A 3PRZA 1N6ZA 1YX5B 2KHWB 4KDLB 3VHTC 2YEPB 5HKHA 3RCZA 4TKNA 5LLIA 2NTSA 3T9LA 2LD9A 5KHQA 4JWSC 4LDTB 2J0KA 4L23A 1FNWA 1V97A 1J7BA 5L83A 2BQQA 1WR6E 2NCNA 1EWCA 3Q8BA 2D3AA 2I2YA 3AE1B 3BK1A 1FXTB 2BWFA 1L0VB 1N60A 3CSTA 1QILA 3TCAA 5CHVC 1KJTA 1NDDA 1R4MB 4WH4A 3WAMA 1WGYA 4NY0A 5MPOA 2MBOA 4ZRKA 1E10A 2V4IB 4HPMB 4P7IA 4ITKA 3PZDA 2CHZA 4MEMA 1HA5A 3Q8CA 3KVFB 1V80A 2G9HD 3WAOA 4ASWC 3SR6A 4FHKA 4YT0B 3AEAB 1PUTA 3RD2A 3LB8C 3WCQA 2JT4B 3VDZA 2DYBA 2E6XA 4NPNA 2KFJA 2AQ3B 1ZE3D 3PZ8A 1Y8RC 2AYOB 5CHWA 3HVZA 4PYUA 4KGTA 2EMSA 5CTRC 1L2NA 1XLOA 1PGAA 5GXGB 3R8BA 1WM3A 4YSZB 4HKZE 4C00A 4KGSA 2Q5WD 3FILA 1FXIA 1NVID 3NG0A 3U52E 1OTRB 1WJ6A 5G5HA 3NVVA 1L4ZB 4NJ7A 4LJPB 4H2AA 1SIJA 4L2YA 1WX9A 3R3MA 3FILB 4W9JA 1PDXA 1L4DB 2JXTA 3VXWA 2LGYA 2AL6A 1ESFA 4LNOA 1WGKA 1L0XB 2JYEA 2GMIC 3DHIC 2KTFA 2K39A 4ZRJA 4LLGM 1E7VA 2WXKA 3DVNU 4KKJA 3APCA 3KWVA 2GBRA 2ZZPB 4W9CA 3Q2AC 3IBEA 3K9PB 4IDIA 2K6QA 2FUHB 2WYQA 3VUXA 3NS1A 4NJCA 4YTMB 2LVPA 4WWNA 4PT5A 3KUCB 5HHDG 2EELA 2M0XA 4BKTA 4ZDVA 1SB3C 2WXIA 4BOZB 4US9A 1ZPSA 2V9HA 4MGIE 4KZ0A 1Q10A 1STEA 2XN9C 4TV3A 4GSWA 4AQ7A 2WP9B 1WX7A 2LGIA 4FJYA 1JWAD 1JWSD 2WXQA 3MFGA 2OHFA 1XCTL 4HVBA 2IO1B 1CZPA 3TL5A 3GOEA 5BMIA 2D07B 3PS6A 1SE2A 3FAHA 3HVDA 5H8YE 3P1MA 4HRSA 3Q3MC 1CMXB 1E6EB 2IGDA 2LEKA 2GBMA 1XF5L 2AQ2B 3APFA 3RFZB 1C4CA 3IVFA 2ZCCA 4USAA 1SE9A 1OQRA 1XLQA 4HCPB 2KLGA 4ICVA 1KTKA 3EHVA 3HUIA 2BB6A 3VAWA 3Q3OC 2L1AA 1D5MC 3Q6BA 2WXJA 1I4XA 1H7WA 3AE4B 1FNUA 4KZCA 2WS3B 3GB1A 5AEKB 4OW0A 1WXQA 2X38A 3U7ZA 3DBRB 3P4PB 1WX8A 1T6BX 1BXTA 1FXAA 4DHJB 1EU3A 5G2NA 2FNJB 2K22A 2UWQA 5BMHA 4HDQA 4XWWA 4W9GA 3N32A 3FKYA 1I35A 1B9RA 1AN8A 1D5ZC 4IKGA 3BYTB 2O6VD 2OEDA 2MH7A 1DGJA 2BT6A 4RCOA 3Q8AA 4RGMA 2PTLA 3PPAA 3VH4B 3KYDD 2WDTB 2ZW0A 1Z2MA 5IOIA 4EE2A 5D6JB 3VFKA 2MP2A 4CYEA 4MSQB 4TQ1A 5BYQA 3Q3JA 3RN9C 3ZVVA 3ML9A 3GS2A 3PV1A 2KQ7A 5C23A 3ONSA 2RDGA 2JQRB 2MP2B 4YWGG 2LI5A 5D3IB 1PQSA 3PO0A 1EM7A 4W9IA 2MBBB 2VH2A 4X57B 2OJRA 1JWUD 3QC8B 2Z0DB 3RPFC 4EFOA 2KOXA 3RNEC 3VQIA 2FIDA 2INCC 2N9LA 2N9EB 4WJQA 3DQVA 2L7RA 3RUIB 3NZSA 2M1MA 2D11A 3ZNGC 2IDYA 3H7PA 2WXPA 1ISNA 4HKQA 2LMCA 4IUMB 3APDA 4BKSA 1ZDVA 2K3UA 4LTUA 3U4EG 1WMHA 5J18A 1GTEA 5AZFA 4KVGB 2J0JA 1FPYA 5HI1A 1TIFA 1E5WA 4K7UA 1H7XA 4YSYB 5D2MB 3BVGA 1OFFA 1WMHB 1OQYA 3B9JA 1HZ6A 2KN5A 1YJJA 2KJRA 2VRRB 1N5WA 3PT2B 5J17A 3V62A 2PW9A 1TS4A 1WZ3A 2QMTA 3UI3A 1VLBA 3GE8C 3M95A 2LVOA 4BBNF 5FK9C 2IY1B 3JYUA 1IP9A 2KVZA 3ZO5B 2WQYB 2X8XX 2SEBD 3A4RA 5IKCM 3I5JC 2WDVB 3C0RB 4XZ4A 3W5VB 1WM2A 2KK8A 4DHZB 2L05A 3U30A 3P63A 1UD7A 1T0RC 2DAFA 4IWQA 3Q14C 3ZNZB 4G0NB 1V49A 3PLVA 1C1YB 1R4MI 4DBGA 2IZVB 1Q1OA 4ZRIA 1SSNA 1F52A 4KKIA 2IPKD 2DBYA 2NR2A 4MM3A 4A8XC 1JWBD 4LNKA 1ZUD2 5EE0A 1EUVB 1YJ1A 1I4PA 2K9XA 2PPHA 1Y56A 2AWTA 4ANUA 1N61A 3OLMD 2KX0A 2GOWA 4NNJB 3BIID 1ZDXA 2W55A 2B3AA 2BYVE 5AZGA 2KWVB 3LJ3A 3BVZA 4WQMA 4EZLA 4KX6B 2MQJA 3SEBA 4N6EB 3RI7C 3CSFA 1D6EC 4TQ0A 3RNBC 2D3CA 2MBHA 2EKIA 1GTHA 1UNSA 1QOAA 4M01A 4JLCA 2KDMA 2FCQA 4C7YA 1HTQA 5E6OA 2PIAA 3MHSD 1T3QA 3K9OB 1WIAA 2WLBA 2V3NA 1L7YA 2OJWA 3NS8A 4ARIA 1UUPA 1MHHE 4IWOA 1TBEA 4LNIA 1WJUA 1VRAB 5E6PA 2KVRA 3LDZE 1UBIA 2C60A 3DPDA 1LFDA 1WE7A 2L00B 3VH3B 3AM9A 2WHIA 1YN5A 1WGGA 3NHEB 3PTFC 1TZ1A 2INDC 4AOFA 2KFKB 1ACCA 2WXRA 3UF8A 3ML8A 2ZW1A 2GI9A 2BW2A 1MI0A 1IGCA 1AYFA 1BUIC 3H1UA 3W2DA 1UF0A 2IBIB 1FNVA 3BWUD 3QA8A 1N63A 1ZKHA 4P16A 2KO3A 3L10B 2PKOA 5BYRA 1WXVA 4CHKA 3AE5B 3ZDTA 3SHQA 3GZNB 2N9PC 2DZIA 1TKEA 1WXMA 4F7ZA 4AUQC 4RM8A 4MELA 4OZBA 4ZRPA 1NBFC 1N62A 1FMAD 2L8JA 3MC9A 3DBSA 3AV8A 3OWEB 3EECA 4FN2A 4NQKE 2MBQA 2RGFA 1YQ4B 3N1ZC 3BK2A 3RZWC 4AS1A 2NBWB 5D7GA 4ANWA 5KHOA 5DPTA 3AE8B 1GAQB 1WZ0A 4M00A 1UGJA 1EU4A 5FKAC 1FCLA 1YX6B 3ZW3A 5C3JB 4M02A 4GN1A 2N7JA 1XCQL 1OQQA 4C80A 3ECIA 1QT9A 4TUUA 2YEPF 4IM3A 2GB1A 1E8WA 2ZVNA 2V3SA 3URYA 2M0AA 1J7AA 1N5XA 3T8MA 4HK2A 4HCNB 1IYFA 3V05A 5BO4B 4XDDA 2VZKD 1FIQA 5E6JA 1J0GA 4ZYSA 2FUG1 1Z5SB 2Y5PA 1M4VA 5J2RA 2JZZA 2JWUA 1J19A 3L4PA 1C76A 2M4NA 1A70A 2IYDB 4W9DA 1R4NB 2WXLA 5JH5C 1XO3A 3R7RA 5JXVA 2JXXA 5E6NA 3A9KB 3AE3B 2JRIB 4IM2A 1QKZA 4FADA 3ZJTA 1WJ4A 3AE2B 2L52A 4BOSC 4OZAA 2FAZA 2IY0B 2N7EA 2N0SB 1UZXB 4MGYE 1UWMA 1NYRA 4EEWA 1WRIA 2SAKA 3VTUA 1C3TA 1C77A 3QJZA 3FC4A 1RAXA 2L0FA 1WXAA 2KYWA 3DHGC 2ON8A 2HD5B 4N58A 3JVZX 4JE3B 2KJ6A 4M0WA 1XLPA 1QOBA 2XNAC 1E90A 2MEKA 3OG5A 3A33B 1JALA 1YD8U 3IG3A 4PS7A 1WE6A 4M0WB 1NI2A 2RDHA 2W3SA 1TKYA 1JCKB 2LGSA 3HHMA 5T8IA 3MJ5A 3N1YC 3RYTA 5H92C 3NOBA 1KLUD 2REXA 2INPE 2KTRA 2KQSA 4B0EA 2INNE 1ZOYB 3T3NA 1UBQA 3AB5A 2K25A 3IFWB 3OJ3A 1EF5A 2VZKB 2WXGA 4K7WA 2KTRB 1FO4A 2WXFA 4B0MA 3R7QA 1PGBA 2RD0A 4LCDE 2KMCA 2WGSA 4KIKB 2PVGC 3P4SB 4GMVA 1G6JA 4EZJA 1EF1A 2JZPA 4JPSA 2ZEQA 3ZYYX 1V2YA 1C9FA 2Z8LA 3RULA 1C4PA 4C7ZA 3P42A 1QZEA 3HRDD 2J52A 3UIOB 4LNNA 3V6CB 3R2IA 3QX1A 3MP9A 1HQRD 2K6DB 2E3TA 3AI5A 3KYCD 2Y5BB 1I4RA 3AXCA 2VH1A 1V5OA 5CHFA 2Z59B 3Q8FA 4YTNB 2BKFA 2MRPA 1OGWA 2ZCBA 3RNCC 2JZ3B 4A90A 2KWDA 3KW5B 2DNFA 4K81A 3ZXRA 2ZJDA 2LGDA 4FLHA 4XC2A 4RGOS 4MH8A 1TS3A 1V5TA 4DK5A 3N1XC 2KWUB 3V6EB 4UDUC 1X1MA 2A5UA 3JSVA 2L0TA 1K52A 4OVUA 3A9JA 3BINA 1BMLC 3TEXA 2KMMA 3X23A 1P9DU 2WX0A 1LM8B 1OEYA 2V0GA 4WIPA 4DQOC 3L54A 2QSDA 2JY6A 3VRAB 1J7CA 3JSVB 4ICUA 4MDKE 3AU5A 3IAM1 1IBXB 3A9JB 4KSLC 2CU1A 1ZXHA 2BYFA 3ZIMA 1P98A 1RWSA 2LJIA 3DWGC 4JIOU 1LQBA 4FBJB 5I4DA 5TSSA 2B76B 4C56C 2FCNA 2NMQA 1WSPA 4K3CA 3AULA 4A3OA 1K8RB 3DBLI 3R66C 3V61A 1ET9A 2N1VA 1Q5WB 3H7SA 3VRBB 2BYTA 4FA6A 3WAPA 5BMGA 5G5GA 2LWPA 4A55A 4W9LA 3W5UB 2KAJA 2KDFB 2PLPA 4HPLB 5BYSA 1PFDA 2KD0A 3Q8EA 2N1WA 3TBLD 4YSXB 3TUOA 3KLSX 3J9CA 4M8NA 3N9YC 2PEAA 1KF6B 2ONQA 3O13A 4EOYA 1YIWA 3QWZB 1ET6A 1GC7A 4S0RA 4N59A 1RLFA 2WXMA 3GP7A 2BYEA 1WFYA
chains in the Genus database with same CATH topology
3ZQ4A 1E10A 2V4IB 2QIEB 4FXCA 2N9KA 3BVZA 2PVOD 1V8CA 1YJIA 4ITKA 2BTEA 4WQMA 4KX6B 1HA5A 3Q8CA 4KGRA 2G9HD 1SE3A 3SR6A 4YT0B 3SEBA 1E7PB 4N6EB 2MJEA 3AEAB 3VR8B 1PUTA 1KFYB 2QILA 2BB5A 1D6EC 3LB8C 3WCQA 4TQ0A 3LYYA 1TZOA 1E0ZA 2EKIA 1GTHA 1L6VA 1UNSA 1QOAA 2E6XA 2W82A 2KDMA 2AQ3B 1ZE3D 2BS2B 4C7YA 1QLBB 3PZ8A 1D4BA 2PIAA 3ABVB 1C79A 5EE9A 4GLSC 3VR9B 2GRIA 3HVZA 2Y5CA 4KGTA 1T3QA 2G1EA 1VZ7A 1F2RC 2WLBA 2V3NA 4ARIA 1UUPA 3NUHB 1GPXA 1XLOA 3MHZA 1PGAA 1MHHE 5GXGB 3R8BA 2WDRB 3CIRB 5HG2A 4YSZB 1IBXA 4HKZE 4KGSA 1I4HA 1GB4A 2Q5WD 2K0PA 3B2GA 3FILA 3IXSA 1VRAB 1CK1A 1JMLA 1FXIA 3ZJUA 1NVID 1FFUA 1RYJA 4GDKB 1FFVA 3U52E 5G5HA 1TS5A 3NVVA 1L4ZB 3AM9A 3AE9B 1YN5A 2WU5B 1MHXA 1TS2A 4H2AA 1SIJA 4L2YA 4RGNA 3NVZA 2IGGA 3FILB 1PDXA 1L4DB 1ACCA 1TKGA 2WXRA 2JXTA 3AEDB 2KACA 2ZW1A 1HEZE 2GI9A 2BW2A 3KQ4A 1MI0A 4GDLB 1IGCA 1AYFA 1BUIC 1P7FA 3W2DA 1ESFA 1FNVA 3BWUD 1WGKA 3AE6B 3EUB2 1L0XB 1N63A 2JYEA 4P16A 1VR9A 2PKOA 5BYRA 1QOFA 1IGDA 1K51A 1VJKA 2DWQA 4LLGM 2WXKA 5C2TB 3AE5B 3P4RB 4KKJA 1R7SA 1I4QA 2HTME 3IT4B 1TKEA 3KWVA 1FM0D 1L0YB 4OZBA 4ZRPA 4IDIA 1N62A 1FMAD 3CWIA 4OHJA 4A9AA 2J53A 1SBBB 3AV8A 2LFIA 3OWEB 1AWDA 3NS1A 4NJCA 3LXFA 4YTMB 1YQ4B 4ZHOA 4RFBA 5EE1A 1C4AA 3BK2A 4PT5A 5HHDG 2EELA 1FD6A 1FRRA 4L1BA 2JSVX 1KRHA 1E9MA 1SB3C 2JU6X 2WNMA 4AS1A 1MPEA 2H89B 1VDVA 2WXIA 2RMMA 5D7GA 2AX5A 3NVYA 4US9A 1P7EA 1SJED 3AE8B 2CJOA 1ZPSA 1GAQB 1Q10A 1ENFA 1UGJA 1YN3A 1EU4A 1STEA 2R61A 3NZ3A 5FKAC 1FCLA 2XN9C 1YQ3B 2LUMA 4HROA 4AQ7A 2WP9B 5C3JB 4US8A 2LGIA 4JWUC 2N7JA 1XCQL 1OQQA 1JWAD 1JWSD 4C80A 3ZGZA 1QT9A 4YXDB 2WXQA 2YEPF 5EE3A 2GB1A 3MFGA 3PZ7A 4IOIE 1QQRA 1XCTL 2OHFA 1CZPA 3URYA 2M0AA 1J7AA 1N5XA 5BMIA 1FCCC 2MJ3A 2KN4A 1XLNA 1XXGA 1K50A 1SE2A 3FAHA 3HVDA 3V05A 1ZP0B 1CJEA 1ZXIA 4XDDA 2RPVA 2VZKD 3TSSA 4D2KA 1KH0A 1FIQA 1V1PA 5E6JA 1YN4A 5H8YE 4ZYSA 1VZ8A 3P1MA 2WU2B 4HRSA 2FUG1 1E6EB 2Y5PA 1M4VA 2BBCA 3V3XA 2JWUA 2IGDA 2LEKA 2FBWB 2W3RA 1QF6A 1XF5L 2AQ2B 3I9V1 3L4PA 1C76A 3RFZB 1C4CA 2WXOA 3W9CB 1GB1A 1A70A 1V1PB 4USAA 2FE8A 1DOYA 1OQRA 2WXLA 1XLQA 1HXYD 2HDEA 4LK0M 2NTTA 2W54A 1XO3A 1KTKA 1JWMD 5JXVA 3HUIA 2BB6A 3E56A 1RFKA 1LO5D 3Q69A 3AE3B 2L1AA 1D5MC 1QKZA 3I57A 3ZJTA 3AE2B 2L52A 4ZHPA 4OZAA 4WWMA 2WXJA 1I4XA 1H7WA 1NEKB 1V1OA 4XE0A 2N0SB 3AE4B 1FNUA 1NYRA 1UWMA 2WS3B 3GB1A 1HZ5A 1GOZA 1WRIA 4OW0A 1WXQA 4TMAB 2SAKA 3KWLA 2X38A 3U7ZA 4ZOHC 4RNAA 1C77A 1EWYC 3P4PB 3FC4A 2V3PA 1T6BX 1UWXA 1BXTA 3B2FA 1FXAA 2D5GA 2ON8A 4HJGE 2BS3B 4N58A 2K5PA 1EU3A 4JE3B 4M0WA 4WAFA 2K22A 1XLPA 5BMHA 2WXNA 4XWWA 2J4XA 2L32A 4HEA1 1RM6C 1QOBA 2XNAC 1B9RA 1AN8A 2MEKA 3AEFB 1D5ZC 4IKGA 1AW7A 3BYTB 1SEBD 3AE7B 1JALA 2OEDA 2WDQB 4MACA 2MH7A 1DGJA 2BT6A 2RDHA 2W3SA 4RCOA 1TKYA 3MC0B 3Q8AA 3SFEB 4RGMA 3P4QB 1JCKB 2PTLA 4RGTA 3H8HA 3AN1A 5T8IA 1PGXA 3MJ5A 4CQNA 1DYQA 1VZ6A 2ZW0A 4EE2A 5H92C 2H88B 4WURA 2I38A 1KLUD 1TY0A 2BS4B 2INPE 3SFDB 2IGHA 4TQ1A 5BYQA 1PYWD 4B0EA 2INNE 4DXGA 3T3OA 1ZOYB 3GS2A 4XDCA 3AB5A 3T3NA 2WXHA 2TSSA 1TY2A 2VZKB 2WXGA 2RDGA 1DOXA 2JQRB 3ETRA 1FO4A 3NVWA 2WXFA 5D3IB 4YWGG 4B0MA 3PO0A 4OZCA 2QEJC 1EM7A 1PGBA 5FR3A 4ARCA 3CF4A 1JWUD 2PVGC 3AECB 3P4SB 2IJ0A 1NENB 3DWMA 1F2RI 3RPFC 1T5XD 4OVZA 3IT6B 3VQIA 4NZLB 2PMVA 4MM3B 2JZPA 4JPSA 1WWTA 1B1ZA 3AEGB 1GT8A 2N9LA 1C9FA 3ZYYX 1K53A 1YMHE 2Z8LA 1C4PA 1TJEA 1TYGB 1KLGD 4C7ZA 3P42A 3TEZA 1C78A 1JQ4A 3HRDD 2J52A 1CQVA 3E9SA 4P6VF 3R2IA 2IDYA 2J42A 3MP9A 1HQRD 2E3TA 1ROEA 2WXPA 4HKQA 2LMCA 1JRPA 1I4RA 1NI3A 1D5XC 2DLBA 3Q8FA 4ZRQA 4YTNB 1FRDA 1ZDVA 2JX5A 2K3UA 4LTUA 1JW9D 3U4EG 3U2SC 4A6QA 1GTEA 4A90A 2KWDA 2CJNA 4YTPB 2M19A 2M56B 5HI1A 4RF1A 1JROA 1H7XA 4RGOS 3AEEB 4YSYB 4MH8A 3BVGA 1OFFA 1TS3A 1I7HA 4JX1C 1SF0A 4REZA 3B9JA 1HZ6A 2CU3A 4O1NA 3TEYA 2Y3AA 3C8YA 4UDUC 1YJJA 5AUIA 1K52A 1QOGA 1N5WA 1BMLC 3TEXA 2KMMA 1IUEA 2PW9A 1FEHA 1TS4A 5AUKA 2QMTA 3UI3A 3EGRA 1VLBA 4RF0A 3AH7A 1L6UA 2V0GA 3BZDB 1MVKA 1SE4A 4WIPA 5FK9C 4DQOC 2QSDA 3VRAB 1J7CA 1F77A 3IAM1 3TEWA 1IBXB 2MJDA 2WQYB 4MT5A 4DXFA 2SEBD 1ZXHA 2DYOA 2JYTA 1NYQA 1RWSA 1WYGA 4RH6A 1DOIA 2LJIA 3DWGC 3R2TA 1SXTA 5D3DA 5I4DA 5TSSA 1SJHD 2B76B 4C56C 2WDVB 3W5VB 2NMQA 1WSPA 2L83A 3P63A 3AMZA 4J3OD 2DYMA 1ET9A 2KQ4X 2ACZB 4TSSA 3AEBB 3ZJVA 3EA6A 3VRBB 1XEEA 2LHDA 2BYTA 4XWTA 1YNTE 2AQ1B 3IAS1 3W1SA 1SSNA 5G5GA 5BMGA 4A55A 3W5UB 2YEPB 4KKIA 2IPKD 2DBYA 2KAJA 2QJLA 2PLPA 2NTSA 3BVMA 4A8XC 5BYSA 1PFDA 5LNK1 1JWBD 3Q8EA 4NAWB 1ZUD2 4YSXB 5EE0A 3TUOA 3KLSX 1I4PA 2K9XA 4JWSC 4L23A 2LHEA 1FNWA 1V97A 1J7BA 2ICIA 1Y56A 5HFYA 3J9CA 3N9YC 1I4GA 1KF6B 2ONQA 1N61A 1EWCA 3Q8BA 2I2YA 3O13A 3AE1B 3BK1A 1L5PA 3BYYB 1F0ZA 4NAMA 3NRZA 1L0VB 1N60A 1QILA 1ET6A 4N59A 4Q2JA 4R3DA 3BIID 2WXMA 4WH4A 3GP7A 1ZDXA 2W55A 5MPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLP A;  3LXF A;  1JRO A;  1H7X A;  4YTM B;  1YQ4 B;  4ZHO A;  1E10 A;  5EE1 A;  1RM6 C;  1QOB A;  2QIE B;  3AEE B;  4FXC A;  4YSY B;  1OFF A;  1B9R A;  3AEF B;  1FRR A;  1I7H A;  2PVO D;  4JX1 C;  1V8C A;  1SF0 A;  1YJI A;  1KRH A;  4ITK A;  4WQM A;  1E9M A;  1SB3 C;  3B9J A;  4KX6 B;  3AE7 B;  1JAL A;  2H89 B;  1VDV A;  2CU3 A;  2WDQ B;  3SR6 A;  2AX5 A;  4YT0 B;  1YJJ A;  3NVY A;  1E7P B;  4N6E B;  2MH7 A;  4US9 A;  2MJE A;  3AEA B;  3VR8 B;  3AE8 B;  1PUT A;  2CJO A;  1DGJ A;  5AUI A;  1QOG A;  1KFY B;  2BT6 A;  1GAQ B;  2W3S A;  1TKY A;  1N5W A;  3SFE B;  3LB8 C;  3P4Q B;  3WCQ A;  2KMM A;  1IUE A;  1E0Z A;  5AUK A;  2EKI A;  1GTH A;  1L6V A;  1YQ3 B;  1QOA A;  3AN1 A;  1VLB A;  4HRO A;  3AH7 A;  1L6U A;  5H92 C;  2H88 B;  2WP9 B;  5C3J B;  4US8 A;  2BS4 B;  2BS2 B;  4JWU C;  4C7Y A;  1OQQ A;  1JWA D;  4C80 A;  1QLB B;  3SFD B;  1QT9 A;  4YXD B;  5EE3 A;  3VRA B;  1J7C A;  2PIA A;  3ABV B;  2OHF A;  5EE9 A;  3VR9 B;  2MJD A;  2WQY B;  1CZP A;  3HVZ A;  1J7A A;  1N5X A;  2Y5C A;  1T3Q A;  2MJ3 A;  1ZOY B;  1NYQ A;  3AB5 A;  2G1E A;  1RWS A;  1WYG A;  2WLB A;  1XLN A;  1DOI A;  3DWG C;  3FAH A;  1GPX A;  1ZP0 B;  1CJE A;  1XLO A;  1ZXI A;  1DOX A;  2B76 B;  5GXG B;  2JQR B;  2WDR B;  3CIR B;  3ETR A;  4YSZ B;  2WDV B;  1FIQ A;  1FO4 A;  3W5V B;  5H8Y E;  3NVW A;  2L83 A;  3P1M A;  2WU2 B;  4HRS A;  3PO0 A;  2Q5W D;  3B2G A;  3P63 A;  1E6E B;  3AMZ A;  1FXI A;  1NVI D;  1FFU A;  1RYJ A;  3CF4 A;  1FFV A;  2ACZ B;  2PVG C;  3AEC B;  3P4S B;  2LEK A;  5G5H A;  2FBW B;  3AEB B;  2W3R A;  3NVV A;  1NEN B;  3DWM A;  3RPF C;  1QF6 A;  3AM9 A;  3L4P A;  3VRB B;  3AE9 B;  3W9C B;  2WU5 B;  1A70 A;  4USA A;  1SIJ A;  1DOY A;  1WWT A;  1OQR A;  1XLQ A;  3AEG B;  1GT8 A;  3NVZ A;  1PDX A;  3ZYY X;  1TKG A;  5G5G A;  2W54 A;  3AED B;  1XO3 A;  3W5U B;  1TJE A;  1TYG B;  3HUI A;  4C7Z A;  2DBY A;  1AYF A;  2KAJ A;  1RFK A;  1JQ4 A;  2QJL A;  3HRD D;  3AE3 B;  3EUB 2;  1WGK A;  3AE6 B;  3NS1 A;  1N63 A;  1PFD A;  1JWB D;  3AE2 B;  2L52 A;  4P6V F;  1ZUD 2;  4YSX B;  2PKO A;  5EE0 A;  4ZHP A;  2E3T A;  4WWM A;  1QOF A;  1ROE A;  1VJK A;  2DWQ A;  5C2T B;  1JRP A;  2K9X A;  4JWS C;  1H7W A;  3AE5 B;  1NEK B;  2N0S B;  1NI3 A;  3P4R B;  1V97 A;  3AE4 B;  1NYR A;  1UWM A;  1J7B A;  2WS3 B;  1R7S A;  1WRI A;  1WXQ A;  4YTN B;  1KF6 B;  1FRD A;  3KWL A;  1N61 A;  2HTM E;  2JX5 A;  1JW9 D;  4LTU A;  1TKE A;  4ZOH C;  1EWY C;  3AE1 B;  3P4P B;  1L5P A;  3FC4 A;  1F0Z A;  3NRZ A;  1L0V B;  1FM0 D;  1GTE A;  1N60 A;  3B2F A;  4IDI A;  1FXA A;  1FMA D;  1N62 A;  3CWI A;  4N59 A;  2CJN A;  4A9A A;  4YTP B;  2M19 A;  2M56 B;  2BS3 B;  3BII D;  3AV8 A;  2K5P A;  4N58 A;  2W55 A;  1AWD A;  5MPO A;  2K22 A; 
#chains in the Genus database with same CATH topology
 3ZQ4 A;  2KMA A;  3SD5 A;  1V8C A;  1YJI A;  4HJK A;  2BTE A;  3DVG X;  3N20 C;  4E3C A;  4KGR A;  1GC6 A;  2EMT A;  3EFU A;  1XD3 B;  2R2O A;  1H8C A;  2KJH B;  1E7P B;  4YL8 A;  2C7N B;  2MJE A;  3VR8 B;  4FUL A;  1KFY B;  4G50 A;  2BB5 A;  4BAX A;  4E74 A;  1E0Z A;  2N7D A;  1L6V A;  2O6V A;  2EKE C;  2BS2 B;  3P2B A;  2FCS A;  1D4B A;  3ABV B;  1C79 A;  4GLS C;  3VR9 B;  2Y5C A;  4GDK A;  2O6V B;  2G1E A;  3MHZ A;  2WDR B;  1SGH A;  5HG2 A;  3ZXV A;  3GZN I;  1GB4 A;  2K0P A;  2DX5 B;  4I6L B;  1CK1 A;  4GDK B;  3U8Z A;  2CHX A;  3OAW A;  2JVC A;  3ZDM C;  1ZW7 A;  1TS5 A;  2G4S A;  2JF5 A;  2ZNV C;  4MJS A;  3AE9 B;  2WU5 B;  4IWP A;  4F8C B;  1TS2 A;  1YOV B;  3ZTD A;  4JL9 A;  3NVZ A;  2IGG A;  4XYC A;  1TT5 B;  4OVV A;  2KDI A;  3AED B;  2KAC A;  4FJV B;  3KQ4 A;  4ACF A;  2GBJ A;  3EUB 2;  3AE6 B;  4MJS B;  5L95 C;  3QCA A;  4AJY B;  1K51 A;  1VJK A;  2DWQ A;  5C1Z A;  4I6N B;  3P4R B;  1ZGU B;  4PYZ A;  2HTH A;  2Z0E B;  1F1H A;  3IT4 B;  1V9J A;  3V60 A;  1J8C A;  2MCN B;  2I1K A;  2XEW A;  3VVW B;  2KKC A;  3CWI A;  4A9A A;  1TTN A;  2J53 A;  2LFI A;  4A3P A;  1AWD A;  4RFB A;  5EE1 A;  1VD2 A;  1C4A A;  4HXD A;  2RDB C;  2JSV X;  1KRH A;  2M8S A;  1I42 A;  1VDV A;  4J6I A;  2AX5 A;  3NVY A;  2D2Q A;  1SJE D;  2CJO A;  5DCN A;  1ENF A;  3ZTC A;  1YN3 A;  1R4N I;  4GB9 A;  1YQ3 B;  4HRO A;  4WWP A;  2MX2 A;  3DVG Y;  3ZGZ A;  4IG7 B;  4YXD B;  5EE3 A;  2RR9 A;  4B6W A;  1QQR A;  1WRD B;  1FCC C;  2MJ3 A;  2KN4 A;  1T0Q C;  3WA0 A;  1XXG A;  1K50 A;  2C5L C;  3L0W B;  1ZP0 B;  3TSS A;  1KH0 A;  2W9N A;  1YN4 A;  2WU2 B;  5IAA C;  2BBC A;  2LZ6 A;  1MG4 A;  3V3X A;  2C9W B;  2FBW B;  2JWZ A;  3VUW A;  2K8C A;  2HJ1 A;  2WXO A;  3W9C B;  1GB1 A;  2FE8 A;  1DOY A;  1HXY D;  2HDE A;  1SIF A;  5CX3 A;  2OOB B;  2W54 A;  1GJZ A;  1JWM D;  3QHT A;  4P1C C;  1H4R A;  3E56 A;  4M8M A;  2XK5 A;  1RFK A;  1LO5 D;  2LVQ A;  2MSE D;  3Q69 A;  1GUA B;  4W9E A;  2IO2 B;  2KFK A;  4DDI D;  1V1O A;  5DPW A;  2M17 A;  2NBU A;  4W9K A;  2IO3 B;  2XK5 B;  1GOZ A;  4TMA B;  3KWL A;  4RNA A;  3RNF C;  2FCM A;  1UWX A;  2KZR A;  3NZU A;  1V81 A;  2D5G A;  4HJG E;  4GXB A;  5D94 A;  5AZH A;  4WQO B;  2N9X A;  4HEA 1;  3PVL A;  1RM6 C;  3NY5 A;  2LAS A;  2MA9 B;  3HK0 A;  2N4F A;  3Q3N C;  1AW7 A;  1SEB D;  3AE7 B;  4MAC A;  3PHW B;  4WAA A;  3UQA A;  4WJO A;  3TIX A;  4RMA A;  2KDE B;  4RGT A;  2G3Q B;  4CQN A;  1DYQ A;  5DPS A;  1VZ6 A;  4HPP A;  4MGZ E;  1U4A A;  4WJN A;  3SFD B;  3ZRC A;  3RNA C;  1PYW D;  5IP4 D;  3T3O A;  2KNB A;  2TSS A;  1DOX A;  3ETR A;  1LGR A;  4OZC A;  2QEJ C;  3RZF A;  3W1S C;  1HE8 A;  2K1F A;  2L76 A;  3AEC B;  2IJ0 A;  1NEN B;  3DWM A;  1F2R I;  5IO9 A;  1T5X D;  2DZJ A;  4OVZ A;  4MGK E;  4NZL B;  2JPH A;  1B1Z A;  3AEG B;  3O65 B;  1WJN A;  1K53 A;  1YMH E;  1TYG B;  3HIZ A;  1KLG D;  2C7M B;  3TEZ A;  1JQ4 A;  2QC8 A;  2GLS A;  4P6V F;  3DBR I;  2J42 A;  3DDC B;  3TJP A;  1JRP A;  3A9K A;  2PJH A;  1NI3 A;  4I6P A;  3DBH B;  2AL3 A;  2DLB A;  3MTN B;  4ZRQ A;  1FRD A;  1JW9 D;  3I63 C;  3U2S C;  4JQW C;  5DPR A;  3TMP B;  1UH6 A;  4A6Q A;  4PS8 A;  4YTP B;  2M56 B;  1VCB A;  1WY8 A;  1UGM A;  4RF1 A;  5IA7 A;  1JRO A;  4PS3 A;  3IHP C;  3AEE B;  3PRM B;  3ENE A;  1I7H A;  2K8H A;  4JX1 C;  2MHJ A;  4REZ A;  2CU3 A;  3TEY A;  2Y3A A;  4PK1 A;  4NJ6 A;  5AUI A;  1QOG A;  2HJ8 A;  4IW0 A;  4AP4 C;  1IUE A;  3N3K B;  1WXS A;  2RSU A;  4RF0 A;  4MH0 E;  1D3Z A;  5LXI B;  3AH7 A;  1L6U A;  3BZD B;  1MVK A;  1SE4 A;  1P1A A;  3QK0 A;  1KOT A;  1F77 A;  2L3Z A;  4DXF A;  3PSE B;  2DYO A;  2JYT A;  3I3T B;  1NYQ A;  1P0R A;  2J0M A;  2DEN B;  3S2A A;  4RH6 A;  1SXT A;  1SJH D;  4KSK C;  5JHA A;  3D32 A;  1Q0W B;  2K8B A;  2L83 A;  3AMZ A;  4J3O D;  1WF9 A;  1E7U A;  1T0S C;  4N9F 4;  3UGB B;  4DHZ E;  2D3G A;  2G4D B;  3AEB B;  3ZJV A;  4KV2 A;  4XWT A;  4NAW A;  3IAS 1;  3UIN B;  4KIK A;  2I1J A;  2BF8 B;  2KC1 A;  2QJL A;  3PHX B;  1WI0 A;  4DHJ D;  2QCZ A;  3BVM A;  3B0A A;  5LNK 1;  1MFW A;  4NAW B;  5G55 A;  4WJP A;  3DVN V;  5IN7 A;  2LHE A;  2O2V A;  4LNF A;  1MG8 A;  2ICI A;  2BGF A;  4URK A;  5HFY A;  1I4G A;  4A20 A;  3SDL C;  2LRW A;  1L5P A;  2JRH A;  3BYY B;  4NAM A;  3NRZ A;  1F0Z A;  2DHZ A;  3ZKJ C;  4Q2J A;  4R3D A;  2BWE S;  2O2V B;  2PE6 B;  5LXH A;  1WGD A;  2KC2 A;  4GGQ A;  5GMV A;  2R2Q A;  2QIE B;  4FXC A;  3WIM A;  2N9K A;  3PRE A;  2PVO D;  4LJO B;  4RM9 A;  1SE3 A;  3UQB A;  2QIL A;  3LYY A;  1TZO A;  1V6E A;  2MW5 A;  4F1S A;  4E71 A;  2W82 A;  2UU7 A;  4FHJ A;  1QLB B;  2YLM A;  2KDB A;  5EE9 A;  3U7D A;  2GRI A;  4DDG D;  1VZ7 A;  1F2R C;  4DXA B;  3NUH B;  1GPX A;  4AJW A;  4BVU C;  4IC7 B;  3CIR B;  4EUT A;  1IBX A;  2DAJ A;  2DZM A;  2NVU I;  1I4H A;  3B2G A;  1KM7 A;  3IXS A;  1JML A;  3ZJU A;  1S3S G;  1RYJ A;  1FFU A;  2CKH B;  1IPG A;  1FFV A;  4GDL A;  2KLC A;  2MBE A;  4QAY A;  2MLB A;  4B95 A;  1MHX A;  3N30 A;  3DOW A;  4RGN A;  3ZUN A;  3QQ8 B;  2NBV B;  3EC8 A;  1TKG A;  2WX1 A;  1HEZ E;  3RMK C;  4GDL B;  4ANX A;  1E8Y A;  2KX3 A;  1P7F A;  2ZPN A;  4GOC A;  1RRB A;  4BKS D;  1VR9 A;  2LRU A;  4ANV A;  1QOF A;  1IGD A;  4W9F A;  5C2T B;  4KDI C;  4BFR A;  4AWJ A;  3B1L X;  1WGR A;  1MJD A;  1R7S A;  2AEH A;  2LGX A;  4WWO A;  2KAN A;  1I4Q A;  2HTM E;  2XBB C;  1FM0 D;  1L0Y B;  1EO6 A;  3L16 A;  3X0W A;  3L08 A;  4OHJ A;  1SBB B;  4MSM B;  3LXF A;  4ZHO A;  4G11 A;  1LXD A;  1P3Q U;  4EZK A;  2IO0 B;  1FD6 A;  1FRR A;  2LJ5 A;  4L1B A;  1XQQ A;  2GBN A;  3VTV A;  1E9M A;  2JU6 X;  2WNM A;  3OJ4 B;  1MPE A;  2H89 B;  2RMM A;  4BKG A;  2CS4 A;  4JGH B;  3GE3 C;  1P7E A;  2WWZ A;  3SU8 X;  5JZE B;  2KT7 A;  1F9J A;  2R61 A;  3NZ3 A;  1T0Y A;  2LUM A;  3M3J A;  3AU4 A;  4US8 A;  4JWU C;  3RNG C;  5EDS A;  3PZ7 A;  3PGE A;  4B9K A;  4IOI E;  1M94 A;  3QAQ A;  4C4V A;  1XLN A;  1CJE A;  1ZXI A;  2RPV A;  4D2K A;  2DZK A;  1V1P A;  5FR6 A;  4BZA A;  1VZ8 A;  2BKR B;  4ZYN A;  3UIP B;  4S17 A;  2LXA A;  3NJT A;  2CHW A;  3KUD B;  4W9H A;  4C4V B;  2V4L A;  2ASQ A;  3B08 A;  2W3R A;  1QF6 A;  3I9V 1;  3KUZ A;  3ZNH B;  1V1P B;  1HTO A;  2BPS A;  2NS5 A;  4LK0 M;  2NTT A;  3H7P B;  1E8X A;  3VTW A;  3ZRF A;  1GG3 A;  3I57 A;  2D10 A;  4ZHP A;  4WWM A;  2ZVO A;  3L13 A;  2KWC A;  4II3 B;  1NEK B;  4BBN C;  4XE0 A;  3WAL A;  1TGZ B;  1HZ5 A;  2ZNV B;  4ZOH C;  3ZLZ A;  1EWY C;  2V1Y A;  2V3P A;  3B2F A;  3EFC A;  3DCG A;  2BS3 B;  2QDF A;  2K5P A;  5TR5 A;  4HDO A;  3A4S C;  1WH3 A;  4WAF A;  2WXN A;  2J4X A;  2L32 A;  1WYW B;  2GBK A;  3AEF B;  1RFA A;  4GU2 A;  2WDQ B;  2QHO A;  3JW0 X;  4FJZ A;  3MC0 B;  3SFE B;  3MJW A;  3QAR A;  3P4Q B;  2C7H A;  3H8H A;  2BVC A;  2HE7 A;  3AN1 A;  1PGX A;  2ZPY A;  2PE9 A;  2H88 B;  2FIF A;  2I38 A;  3H6N A;  4WUR A;  1TY0 A;  4NQL B;  3W1Y A;  2BS4 B;  2J7Q B;  2IGH A;  4GIV A;  1V86 A;  2NPT A;  2RPQ A;  4K1R B;  4DXG A;  4XDC A;  2WXH A;  3H9D A;  1TY2 A;  3DBH I;  3NVW A;  1YQB A;  2KXJ A;  1OEY J;  3PLU A;  2NPT B;  5FR3 A;  4XX5 A;  4ARC A;  3CF4 A;  4II2 B;  1GNU A;  3IT6 B;  2PMV A;  4EKU A;  1E8Z A;  4MM3 B;  1WWT A;  1GT8 A;  3DBL B;  1TJE A;  1C78 A;  3L17 A;  2JUO A;  1CQV A;  3CMM B;  3HM3 A;  3E9S A;  1AAR A;  1ROE A;  4HWI B;  3VUY A;  4K3B A;  4LDT D;  3M63 B;  3M62 B;  3C19 A;  1D5X C;  3A1Q A;  4DWF A;  1KLV A;  1S1Q B;  2JX5 A;  2MWS B;  3ALB A;  2LXC A;  2CJN A;  2M19 A;  3WAN A;  5JHB A;  3RT3 B;  3A1Q B;  2CR5 A;  3CF6 E;  2D3B A;  1SF0 A;  2LUE A;  2YVC A;  4O1N A;  3C8Y A;  1JRU A;  3DHH C;  1FEH A;  5AUK A;  1WGH A;  3EGR A;  3HM6 X;  3QIJ A;  4HLE A;  4CO7 A;  1WR1 A;  1A5R A;  3TEW A;  2MJD A;  4K7S A;  4MT5 A;  3MC8 A;  1WYG A;  1DOI A;  3R2T A;  5D3D A;  3BY4 B;  1UEL A;  2UYZ B;  2DYM A;  4XGA B;  2KQ4 X;  2ACZ B;  4IM0 A;  4TSS A;  1XT9 B;  3EA6 A;  3ZNI D;  1XEE A;  2LHD A;  2A4Z A;  3Q3F A;  4G3X B;  2G45 B;  1YNT E;  2AQ1 B;  4P1B C;  3KH0 A;  3PRP B;  3W1S A;  1BT0 A;  3PRZ A;  1N6Z A;  1YX5 B;  2KHW B;  4KDL B;  3VHT C;  2YEP B;  5HKH A;  3RCZ A;  4TKN A;  5LLI A;  2NTS A;  3T9L A;  2LD9 A;  5KHQ A;  4JWS C;  4LDT B;  2J0K A;  4L23 A;  1FNW A;  1V97 A;  1J7B A;  5L83 A;  2BQQ A;  1WR6 E;  2NCN A;  1EWC A;  3Q8B A;  2D3A A;  2I2Y A;  3AE1 B;  3BK1 A;  1FXT B;  2BWF A;  1L0V B;  1N60 A;  3CST A;  1QIL A;  3TCA A;  5CHV C;  1KJT A;  1NDD A;  1R4M B;  4WH4 A;  3WAM A;  1WGY A;  4NY0 A;  5MPO A;  2MBO A;  4ZRK A;  1E10 A;  2V4I B;  4HPM B;  4P7I A;  4ITK A;  3PZD A;  2CHZ A;  4MEM A;  1HA5 A;  3Q8C A;  3KVF B;  1V80 A;  2G9H D;  3WAO A;  4ASW C;  3SR6 A;  4FHK A;  4YT0 B;  3AEA B;  1PUT A;  3RD2 A;  3LB8 C;  3WCQ A;  2JT4 B;  3VDZ A;  2DYB A;  2E6X A;  4NPN A;  2KFJ A;  2AQ3 B;  1ZE3 D;  3PZ8 A;  1Y8R C;  2AYO B;  5CHW A;  3HVZ A;  4PYU A;  4KGT A;  2EMS A;  5CTR C;  1L2N A;  1XLO A;  1PGA A;  5GXG B;  3R8B A;  1WM3 A;  4YSZ B;  4HKZ E;  4C00 A;  4KGS A;  2Q5W D;  3FIL A;  1FXI A;  1NVI D;  3NG0 A;  3U52 E;  1OTR B;  1WJ6 A;  5G5H A;  3NVV A;  1L4Z B;  4NJ7 A;  4LJP B;  4H2A A;  1SIJ A;  4L2Y A;  1WX9 A;  3R3M A;  3FIL B;  4W9J A;  1PDX A;  1L4D B;  2JXT A;  3VXW A;  2LGY A;  2AL6 A;  1ESF A;  4LNO A;  1WGK A;  1L0X B;  2JYE A;  2GMI C;  3DHI C;  2KTF A;  2K39 A;  4ZRJ A;  4LLG M;  1E7V A;  2WXK A;  3DVN U;  4KKJ A;  3APC A;  3KWV A;  2GBR A;  2ZZP B;  4W9C A;  3Q2A C;  3IBE A;  3K9P B;  4IDI A;  2K6Q A;  2FUH B;  2WYQ A;  3VUX A;  3NS1 A;  4NJC A;  4YTM B;  2LVP A;  4WWN A;  4PT5 A;  3KUC B;  5HHD G;  2EEL A;  2M0X A;  4BKT A;  4ZDV A;  1SB3 C;  2WXI A;  4BOZ B;  4US9 A;  1ZPS A;  2V9H A;  4MGI E;  4KZ0 A;  1Q10 A;  1STE A;  2XN9 C;  4TV3 A;  4GSW A;  4AQ7 A;  2WP9 B;  1WX7 A;  2LGI A;  4FJY A;  1JWA D;  1JWS D;  2WXQ A;  3MFG A;  2OHF A;  1XCT L;  4HVB A;  2IO1 B;  1CZP A;  3TL5 A;  3GOE A;  5BMI A;  2D07 B;  3PS6 A;  1SE2 A;  3FAH A;  3HVD A;  5H8Y E;  3P1M A;  4HRS A;  3Q3M C;  1CMX B;  1E6E B;  2IGD A;  2LEK A;  2GBM A;  1XF5 L;  2AQ2 B;  3APF A;  3RFZ B;  1C4C A;  3IVF A;  2ZCC A;  4USA A;  1SE9 A;  1OQR A;  1XLQ A;  4HCP B;  2KLG A;  4ICV A;  1KTK A;  3EHV A;  3HUI A;  2BB6 A;  3VAW A;  3Q3O C;  2L1A A;  1D5M C;  3Q6B A;  2WXJ A;  1I4X A;  1H7W A;  3AE4 B;  1FNU A;  4KZC A;  2WS3 B;  3GB1 A;  5AEK B;  4OW0 A;  1WXQ A;  2X38 A;  3U7Z A;  3DBR B;  3P4P B;  1WX8 A;  1T6B X;  1BXT A;  1FXA A;  4DHJ B;  1EU3 A;  5G2N A;  2FNJ B;  2K22 A;  2UWQ A;  5BMH A;  4HDQ A;  4XWW A;  4W9G A;  3N32 A;  3FKY A;  1I35 A;  1B9R A;  1AN8 A;  1D5Z C;  4IKG A;  3BYT B;  2O6V D;  2OED A;  2MH7 A;  1DGJ A;  2BT6 A;  4RCO A;  3Q8A A;  4RGM A;  2PTL A;  3PPA A;  3VH4 B;  3KYD D;  2WDT B;  2ZW0 A;  1Z2M A;  5IOI A;  4EE2 A;  5D6J B;  3VFK A;  2MP2 A;  4CYE A;  4MSQ B;  4TQ1 A;  5BYQ A;  3Q3J A;  3RN9 C;  3ZVV A;  3ML9 A;  3GS2 A;  3PV1 A;  2KQ7 A;  5C23 A;  3ONS A;  2RDG A;  2JQR B;  2MP2 B;  4YWG G;  2LI5 A;  5D3I B;  1PQS A;  3PO0 A;  1EM7 A;  4W9I A;  2MBB B;  2VH2 A;  4X57 B;  2OJR A;  1JWU D;  3QC8 B;  2Z0D B;  3RPF C;  4EFO A;  2KOX A;  3RNE C;  3VQI A;  2FID A;  2INC C;  2N9L A;  2N9E B;  4WJQ A;  3DQV A;  2L7R A;  3RUI B;  3NZS A;  2M1M A;  2D11 A;  3ZNG C;  2IDY A;  3H7P A;  2WXP A;  1ISN A;  4HKQ A;  2LMC A;  4IUM B;  3APD A;  4BKS A;  1ZDV A;  2K3U A;  4LTU A;  3U4E G;  1WMH A;  5J18 A;  1GTE A;  5AZF A;  4KVG B;  2J0J A;  1FPY A;  5HI1 A;  1TIF A;  1E5W A;  4K7U A;  1H7X A;  4YSY B;  5D2M B;  3BVG A;  1OFF A;  1WMH B;  1OQY A;  3B9J A;  1HZ6 A;  2KN5 A;  1YJJ A;  2KJR A;  2VRR B;  1N5W A;  3PT2 B;  5J17 A;  3V62 A;  2PW9 A;  1TS4 A;  1WZ3 A;  2QMT A;  3UI3 A;  1VLB A;  3GE8 C;  3M95 A;  2LVO A;  4BBN F;  5FK9 C;  2IY1 B;  3JYU A;  1IP9 A;  2KVZ A;  3ZO5 B;  2WQY B;  2X8X X;  2SEB D;  3A4R A;  5IKC M;  3I5J C;  2WDV B;  3C0R B;  4XZ4 A;  3W5V B;  1WM2 A;  2KK8 A;  4DHZ B;  2L05 A;  3U30 A;  3P63 A;  1UD7 A;  1T0R C;  2DAF A;  4IWQ A;  3Q14 C;  3ZNZ B;  4G0N B;  1V49 A;  3PLV A;  1C1Y B;  1R4M I;  4DBG A;  2IZV B;  1Q1O A;  4ZRI A;  1SSN A;  1F52 A;  4KKI A;  2IPK D;  2DBY A;  2NR2 A;  4MM3 A;  4A8X C;  1JWB D;  4LNK A;  1ZUD 2;  5EE0 A;  1EUV B;  1YJ1 A;  1I4P A;  2K9X A;  2PPH A;  1Y56 A;  2AWT A;  4ANU A;  1N61 A;  3OLM D;  2KX0 A;  2GOW A;  4NNJ B;  3BII D;  1ZDX A;  2W55 A;  2B3A A;  2BYV E;  5AZG A;  2KWV B;  3LJ3 A;  3BVZ A;  4WQM A;  4EZL A;  4KX6 B;  2MQJ A;  3SEB A;  4N6E B;  3RI7 C;  3CSF A;  1D6E C;  4TQ0 A;  3RNB C;  2D3C A;  2MBH A;  2EKI A;  1GTH A;  1UNS A;  1QOA A;  4M01 A;  4JLC A;  2KDM A;  2FCQ A;  4C7Y A;  1HTQ A;  5E6O A;  2PIA A;  3MHS D;  1T3Q A;  3K9O B;  1WIA A;  2WLB A;  2V3N A;  1L7Y A;  2OJW A;  3NS8 A;  4ARI A;  1UUP A;  1MHH E;  4IWO A;  1TBE A;  4LNI A;  1WJU A;  1VRA B;  5E6P A;  2KVR A;  3LDZ E;  1UBI A;  2C60 A;  3DPD A;  1LFD A;  1WE7 A;  2L00 B;  3VH3 B;  3AM9 A;  2WHI A;  1YN5 A;  1WGG A;  3NHE B;  3PTF C;  1TZ1 A;  2IND C;  4AOF A;  2KFK B;  1ACC A;  2WXR A;  3UF8 A;  3ML8 A;  2ZW1 A;  2GI9 A;  2BW2 A;  1MI0 A;  1IGC A;  1AYF A;  1BUI C;  3H1U A;  3W2D A;  1UF0 A;  2IBI B;  1FNV A;  3BWU D;  3QA8 A;  1N63 A;  1ZKH A;  4P16 A;  2KO3 A;  3L10 B;  2PKO A;  5BYR A;  1WXV A;  4CHK A;  3AE5 B;  3ZDT A;  3SHQ A;  3GZN B;  2N9P C;  2DZI A;  1TKE A;  1WXM A;  4F7Z A;  4AUQ C;  4RM8 A;  4MEL A;  4OZB A;  4ZRP A;  1NBF C;  1N62 A;  1FMA D;  2L8J A;  3MC9 A;  3DBS A;  3AV8 A;  3OWE B;  3EEC A;  4FN2 A;  4NQK E;  2MBQ A;  2RGF A;  1YQ4 B;  3N1Z C;  3BK2 A;  3RZW C;  4AS1 A;  2NBW B;  5D7G A;  4ANW A;  5KHO A;  5DPT A;  3AE8 B;  1GAQ B;  1WZ0 A;  4M00 A;  1UGJ A;  1EU4 A;  5FKA C;  1FCL A;  1YX6 B;  3ZW3 A;  5C3J B;  4M02 A;  4GN1 A;  2N7J A;  1XCQ L;  1OQQ A;  4C80 A;  3ECI A;  1QT9 A;  4TUU A;  2YEP F;  4IM3 A;  2GB1 A;  1E8W A;  2ZVN A;  2V3S A;  3URY A;  2M0A A;  1J7A A;  1N5X A;  3T8M A;  4HK2 A;  4HCN B;  1IYF A;  3V05 A;  5BO4 B;  4XDD A;  2VZK D;  1FIQ A;  5E6J A;  1J0G A;  4ZYS A;  2FUG 1;  1Z5S B;  2Y5P A;  1M4V A;  5J2R A;  2JZZ A;  2JWU A;  1J19 A;  3L4P A;  1C76 A;  2M4N A;  1A70 A;  2IYD B;  4W9D A;  1R4N B;  2WXL A;  5JH5 C;  1XO3 A;  3R7R A;  5JXV A;  2JXX A;  5E6N A;  3A9K B;  3AE3 B;  2JRI B;  4IM2 A;  1QKZ A;  4FAD A;  3ZJT A;  1WJ4 A;  3AE2 B;  2L52 A;  4BOS C;  4OZA A;  2FAZ A;  2IY0 B;  2N7E A;  2N0S B;  1UZX B;  4MGY E;  1UWM A;  1NYR A;  4EEW A;  1WRI A;  2SAK A;  3VTU A;  1C3T A;  1C77 A;  3QJZ A;  3FC4 A;  1RAX A;  2L0F A;  1WXA A;  2KYW A;  3DHG C;  2ON8 A;  2HD5 B;  4N58 A;  3JVZ X;  4JE3 B;  2KJ6 A;  4M0W A;  1XLP A;  1QOB A;  2XNA C;  1E90 A;  2MEK A;  3OG5 A;  3A33 B;  1JAL A;  1YD8 U;  3IG3 A;  4PS7 A;  1WE6 A;  4M0W B;  1NI2 A;  2RDH A;  2W3S A;  1TKY A;  1JCK B;  2LGS A;  3HHM A;  5T8I A;  3MJ5 A;  3N1Y C;  3RYT A;  5H92 C;  3NOB A;  1KLU D;  2REX A;  2INP E;  2KTR A;  2KQS A;  4B0E A;  2INN E;  1ZOY B;  3T3N A;  1UBQ A;  3AB5 A;  2K25 A;  3IFW B;  3OJ3 A;  1EF5 A;  2VZK B;  2WXG A;  4K7W A;  2KTR B;  1FO4 A;  2WXF A;  4B0M A;  3R7Q A;  1PGB A;  2RD0 A;  4LCD E;  2KMC A;  2WGS A;  4KIK B;  2PVG C;  3P4S B;  4GMV A;  1G6J A;  4EZJ A;  1EF1 A;  2JZP A;  4JPS A;  2ZEQ A;  3ZYY X;  1V2Y A;  1C9F A;  2Z8L A;  3RUL A;  1C4P A;  4C7Z A;  3P42 A;  1QZE A;  3HRD D;  2J52 A;  3UIO B;  4LNN A;  3V6C B;  3R2I A;  3QX1 A;  3MP9 A;  1HQR D;  2K6D B;  2E3T A;  3AI5 A;  3KYC D;  2Y5B B;  1I4R A;  3AXC A;  2VH1 A;  1V5O A;  5CHF A;  2Z59 B;  3Q8F A;  4YTN B;  2BKF A;  2MRP A;  1OGW A;  2ZCB A;  3RNC C;  2JZ3 B;  4A90 A;  2KWD A;  3KW5 B;  2DNF A;  4K81 A;  3ZXR A;  2ZJD A;  2LGD A;  4FLH A;  4XC2 A;  4RGO S;  4MH8 A;  1TS3 A;  1V5T A;  4DK5 A;  3N1X C;  2KWU B;  3V6E B;  4UDU C;  1X1M A;  2A5U A;  3JSV A;  2L0T A;  1K52 A;  4OVU A;  3A9J A;  3BIN A;  1BML C;  3TEX A;  2KMM A;  3X23 A;  1P9D U;  2WX0 A;  1LM8 B;  1OEY A;  2V0G A;  4WIP A;  4DQO C;  3L54 A;  2QSD A;  2JY6 A;  3VRA B;  1J7C A;  3JSV B;  4ICU A;  4MDK E;  3AU5 A;  3IAM 1;  1IBX B;  3A9J B;  4KSL C;  2CU1 A;  1ZXH A;  2BYF A;  3ZIM A;  1P98 A;  1RWS A;  2LJI A;  3DWG C;  4JIO U;  1LQB A;  4FBJ B;  5I4D A;  5TSS A;  2B76 B;  4C56 C;  2FCN A;  2NMQ A;  1WSP A;  4K3C A;  3AUL A;  4A3O A;  1K8R B;  3DBL I;  3R66 C;  3V61 A;  1ET9 A;  2N1V A;  1Q5W B;  3H7S A;  3VRB B;  2BYT A;  4FA6 A;  3WAP A;  5BMG A;  5G5G A;  2LWP A;  4A55 A;  4W9L A;  3W5U B;  2KAJ A;  2KDF B;  2PLP A;  4HPL B;  5BYS A;  1PFD A;  2KD0 A;  3Q8E A;  2N1W A;  3TBL D;  4YSX B;  3TUO A;  3KLS X;  3J9C A;  4M8N A;  3N9Y C;  2PEA A;  1KF6 B;  2ONQ A;  3O13 A;  4EOY A;  1YIW A;  3QWZ B;  1ET6 A;  1GC7 A;  4S0R A;  4N59 A;  1RLF A;  2WXM A;  3GP7 A;  2BYE A;  1WFY A; 
#chains in the Genus database with same CATH homology
 3ZQ4 A;  1E10 A;  2V4I B;  2QIE B;  4FXC A;  2N9K A;  3BVZ A;  2PVO D;  1V8C A;  1YJI A;  4ITK A;  2BTE A;  4WQM A;  4KX6 B;  1HA5 A;  3Q8C A;  4KGR A;  2G9H D;  1SE3 A;  3SR6 A;  4YT0 B;  3SEB A;  1E7P B;  4N6E B;  2MJE A;  3AEA B;  3VR8 B;  1PUT A;  1KFY B;  2QIL A;  2BB5 A;  1D6E C;  3LB8 C;  3WCQ A;  4TQ0 A;  3LYY A;  1TZO A;  1E0Z A;  2EKI A;  1GTH A;  1L6V A;  1UNS A;  1QOA A;  2E6X A;  2W82 A;  2KDM A;  2AQ3 B;  1ZE3 D;  2BS2 B;  4C7Y A;  1QLB B;  3PZ8 A;  1D4B A;  2PIA A;  3ABV B;  1C79 A;  5EE9 A;  4GLS C;  3VR9 B;  2GRI A;  3HVZ A;  2Y5C A;  4KGT A;  1T3Q A;  2G1E A;  1VZ7 A;  1F2R C;  2WLB A;  2V3N A;  4ARI A;  1UUP A;  3NUH B;  1GPX A;  1XLO A;  3MHZ A;  1PGA A;  1MHH E;  5GXG B;  3R8B A;  2WDR B;  3CIR B;  5HG2 A;  4YSZ B;  1IBX A;  4HKZ E;  4KGS A;  1I4H A;  1GB4 A;  2Q5W D;  2K0P A;  3B2G A;  3FIL A;  3IXS A;  1VRA B;  1CK1 A;  1JML A;  1FXI A;  3ZJU A;  1NVI D;  1FFU A;  1RYJ A;  4GDK B;  1FFV A;  3U52 E;  5G5H A;  1TS5 A;  3NVV A;  1L4Z B;  3AM9 A;  3AE9 B;  1YN5 A;  2WU5 B;  1MHX A;  1TS2 A;  4H2A A;  1SIJ A;  4L2Y A;  4RGN A;  3NVZ A;  2IGG A;  3FIL B;  1PDX A;  1L4D B;  1ACC A;  1TKG A;  2WXR A;  2JXT A;  3AED B;  2KAC A;  2ZW1 A;  1HEZ E;  2GI9 A;  2BW2 A;  3KQ4 A;  1MI0 A;  4GDL B;  1IGC A;  1AYF A;  1BUI C;  1P7F A;  3W2D A;  1ESF A;  1FNV A;  3BWU D;  1WGK A;  3AE6 B;  3EUB 2;  1L0X B;  1N63 A;  2JYE A;  4P16 A;  1VR9 A;  2PKO A;  5BYR A;  1QOF A;  1IGD A;  1K51 A;  1VJK A;  2DWQ A;  4LLG M;  2WXK A;  5C2T B;  3AE5 B;  3P4R B;  4KKJ A;  1R7S A;  1I4Q A;  2HTM E;  3IT4 B;  1TKE A;  3KWV A;  1FM0 D;  1L0Y B;  4OZB A;  4ZRP A;  4IDI A;  1N62 A;  1FMA D;  3CWI A;  4OHJ A;  4A9A A;  2J53 A;  1SBB B;  3AV8 A;  2LFI A;  3OWE B;  1AWD A;  3NS1 A;  4NJC A;  3LXF A;  4YTM B;  1YQ4 B;  4ZHO A;  4RFB A;  5EE1 A;  1C4A A;  3BK2 A;  4PT5 A;  5HHD G;  2EEL A;  1FD6 A;  1FRR A;  4L1B A;  2JSV X;  1KRH A;  1E9M A;  1SB3 C;  2JU6 X;  2WNM A;  4AS1 A;  1MPE A;  2H89 B;  1VDV A;  2WXI A;  2RMM A;  5D7G A;  2AX5 A;  3NVY A;  4US9 A;  1P7E A;  1SJE D;  3AE8 B;  2CJO A;  1ZPS A;  1GAQ B;  1Q10 A;  1ENF A;  1UGJ A;  1YN3 A;  1EU4 A;  1STE A;  2R61 A;  3NZ3 A;  5FKA C;  1FCL A;  2XN9 C;  1YQ3 B;  2LUM A;  4HRO A;  4AQ7 A;  2WP9 B;  5C3J B;  4US8 A;  2LGI A;  4JWU C;  2N7J A;  1XCQ L;  1OQQ A;  1JWA D;  1JWS D;  4C80 A;  3ZGZ A;  1QT9 A;  4YXD B;  2WXQ A;  2YEP F;  5EE3 A;  2GB1 A;  3MFG A;  3PZ7 A;  4IOI E;  1QQR A;  1XCT L;  2OHF A;  1CZP A;  3URY A;  2M0A A;  1J7A A;  1N5X A;  5BMI A;  1FCC C;  2MJ3 A;  2KN4 A;  1XLN A;  1XXG A;  1K50 A;  1SE2 A;  3FAH A;  3HVD A;  3V05 A;  1ZP0 B;  1CJE A;  1ZXI A;  4XDD A;  2RPV A;  2VZK D;  3TSS A;  4D2K A;  1KH0 A;  1FIQ A;  1V1P A;  5E6J A;  1YN4 A;  5H8Y E;  4ZYS A;  1VZ8 A;  3P1M A;  2WU2 B;  4HRS A;  2FUG 1;  1E6E B;  2Y5P A;  1M4V A;  2BBC A;  3V3X A;  2JWU A;  2IGD A;  2LEK A;  2FBW B;  2W3R A;  1QF6 A;  1XF5 L;  2AQ2 B;  3I9V 1;  3L4P A;  1C76 A;  3RFZ B;  1C4C A;  2WXO A;  3W9C B;  1GB1 A;  1A70 A;  1V1P B;  4USA A;  2FE8 A;  1DOY A;  1OQR A;  2WXL A;  1XLQ A;  1HXY D;  2HDE A;  4LK0 M;  2NTT A;  2W54 A;  1XO3 A;  1KTK A;  1JWM D;  5JXV A;  3HUI A;  2BB6 A;  3E56 A;  1RFK A;  1LO5 D;  3Q69 A;  3AE3 B;  2L1A A;  1D5M C;  1QKZ A;  3I57 A;  3ZJT A;  3AE2 B;  2L52 A;  4ZHP A;  4OZA A;  4WWM A;  2WXJ A;  1I4X A;  1H7W A;  1NEK B;  1V1O A;  4XE0 A;  2N0S B;  3AE4 B;  1FNU A;  1NYR A;  1UWM A;  2WS3 B;  3GB1 A;  1HZ5 A;  1GOZ A;  1WRI A;  4OW0 A;  1WXQ A;  4TMA B;  2SAK A;  3KWL A;  2X38 A;  3U7Z A;  4ZOH C;  4RNA A;  1C77 A;  1EWY C;  3P4P B;  3FC4 A;  2V3P A;  1T6B X;  1UWX A;  1BXT A;  3B2F A;  1FXA A;  2D5G A;  2ON8 A;  4HJG E;  2BS3 B;  4N58 A;  2K5P A;  1EU3 A;  4JE3 B;  4M0W A;  4WAF A;  2K22 A;  1XLP A;  5BMH A;  2WXN A;  4XWW A;  2J4X A;  2L32 A;  4HEA 1;  1RM6 C;  1QOB A;  2XNA C;  1B9R A;  1AN8 A;  2MEK A;  3AEF B;  1D5Z C;  4IKG A;  1AW7 A;  3BYT B;  1SEB D;  3AE7 B;  1JAL A;  2OED A;  2WDQ B;  4MAC A;  2MH7 A;  1DGJ A;  2BT6 A;  2RDH A;  2W3S A;  4RCO A;  1TKY A;  3MC0 B;  3Q8A A;  3SFE B;  4RGM A;  3P4Q B;  1JCK B;  2PTL A;  4RGT A;  3H8H A;  3AN1 A;  5T8I A;  1PGX A;  3MJ5 A;  4CQN A;  1DYQ A;  1VZ6 A;  2ZW0 A;  4EE2 A;  5H92 C;  2H88 B;  4WUR A;  2I38 A;  1KLU D;  1TY0 A;  2BS4 B;  2INP E;  3SFD B;  2IGH A;  4TQ1 A;  5BYQ A;  1PYW D;  4B0E A;  2INN E;  4DXG A;  3T3O A;  1ZOY B;  3GS2 A;  4XDC A;  3AB5 A;  3T3N A;  2WXH A;  2TSS A;  1TY2 A;  2VZK B;  2WXG A;  2RDG A;  1DOX A;  2JQR B;  3ETR A;  1FO4 A;  3NVW A;  2WXF A;  5D3I B;  4YWG G;  4B0M A;  3PO0 A;  4OZC A;  2QEJ C;  1EM7 A;  1PGB A;  5FR3 A;  4ARC A;  3CF4 A;  1JWU D;  2PVG C;  3AEC B;  3P4S B;  2IJ0 A;  1NEN B;  3DWM A;  1F2R I;  3RPF C;  1T5X D;  4OVZ A;  3IT6 B;  3VQI A;  4NZL B;  2PMV A;  4MM3 B;  2JZP A;  4JPS A;  1WWT A;  1B1Z A;  3AEG B;  1GT8 A;  2N9L A;  1C9F A;  3ZYY X;  1K53 A;  1YMH E;  2Z8L A;  1C4P A;  1TJE A;  1TYG B;  1KLG D;  4C7Z A;  3P42 A;  3TEZ A;  1C78 A;  1JQ4 A;  3HRD D;  2J52 A;  1CQV A;  3E9S A;  4P6V F;  3R2I A;  2IDY A;  2J42 A;  3MP9 A;  1HQR D;  2E3T A;  1ROE A;  2WXP A;  4HKQ A;  2LMC A;  1JRP A;  1I4R A;  1NI3 A;  1D5X C;  2DLB A;  3Q8F A;  4ZRQ A;  4YTN B;  1FRD A;  1ZDV A;  2JX5 A;  2K3U A;  4LTU A;  1JW9 D;  3U4E G;  3U2S C;  4A6Q A;  1GTE A;  4A90 A;  2KWD A;  2CJN A;  4YTP B;  2M19 A;  2M56 B;  5HI1 A;  4RF1 A;  1JRO A;  1H7X A;  4RGO S;  3AEE B;  4YSY B;  4MH8 A;  3BVG A;  1OFF A;  1TS3 A;  1I7H A;  4JX1 C;  1SF0 A;  4REZ A;  3B9J A;  1HZ6 A;  2CU3 A;  4O1N A;  3TEY A;  2Y3A A;  3C8Y A;  4UDU C;  1YJJ A;  5AUI A;  1K52 A;  1QOG A;  1N5W A;  1BML C;  3TEX A;  2KMM A;  1IUE A;  2PW9 A;  1FEH A;  1TS4 A;  5AUK A;  2QMT A;  3UI3 A;  3EGR A;  1VLB A;  4RF0 A;  3AH7 A;  1L6U A;  2V0G A;  3BZD B;  1MVK A;  1SE4 A;  4WIP A;  5FK9 C;  4DQO C;  2QSD A;  3VRA B;  1J7C A;  1F77 A;  3IAM 1;  3TEW A;  1IBX B;  2MJD A;  2WQY B;  4MT5 A;  4DXF A;  2SEB D;  1ZXH A;  2DYO A;  2JYT A;  1NYQ A;  1RWS A;  1WYG A;  4RH6 A;  1DOI A;  2LJI A;  3DWG C;  3R2T A;  1SXT A;  5D3D A;  5I4D A;  5TSS A;  1SJH D;  2B76 B;  4C56 C;  2WDV B;  3W5V B;  2NMQ A;  1WSP A;  2L83 A;  3P63 A;  3AMZ A;  4J3O D;  2DYM A;  1ET9 A;  2KQ4 X;  2ACZ B;  4TSS A;  3AEB B;  3ZJV A;  3EA6 A;  3VRB B;  1XEE A;  2LHD A;  2BYT A;  4XWT A;  1YNT E;  2AQ1 B;  3IAS 1;  3W1S A;  1SSN A;  5G5G A;  5BMG A;  4A55 A;  3W5U B;  2YEP B;  4KKI A;  2IPK D;  2DBY A;  2KAJ A;  2QJL A;  2PLP A;  2NTS A;  3BVM A;  4A8X C;  5BYS A;  1PFD A;  5LNK 1;  1JWB D;  3Q8E A;  4NAW B;  1ZUD 2;  4YSX B;  5EE0 A;  3TUO A;  3KLS X;  1I4P A;  2K9X A;  4JWS C;  4L23 A;  2LHE A;  1FNW A;  1V97 A;  1J7B A;  2ICI A;  1Y56 A;  5HFY A;  3J9C A;  3N9Y C;  1I4G A;  1KF6 B;  2ONQ A;  1N61 A;  1EWC A;  3Q8B A;  2I2Y A;  3O13 A;  3AE1 B;  3BK1 A;  1L5P A;  3BYY B;  1F0Z A;  4NAM A;  3NRZ A;  1L0V B;  1N60 A;  1QIL A;  1ET6 A;  4N59 A;  4Q2J A;  4R3D A;  3BII D;  2WXM A;  4WH4 A;  3GP7 A;  1ZDX A;  2W55 A;  5MPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...