2H88B

Avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 71
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h88B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h88B01
2B76B 1DOYA 1QT9A 1FFUA 4JX1C 1NENB 1OQQA 2OHFA 3AE1B 3AEFB 1NVID 5C2TB 2N0SB 3LXFA 1GTHA 1WYGA 5EE1A 4ZOHC 3NVYA 1CZPA 1J7CA 1JALA 3SR6A 4N6EB 3DWMA 2DWQA 3ETRA 1ZOYB 1OQRA 1N5XA 5EE0A 5MPOA 4YXDB 1EWYC 1XO3A 1E9MA 2L52A 3DWGC 3FAHA 3W5VB 1FIQA 3AE2B 1OFFA 2M19A 3NS1A 4FXCA 1RYJA 4C80A 3P63A 3PO0A 4C7ZA 1VDVA 1T3QA 1VJKA 3B9JA 1L5PA 1N5WA 1QOGA 1R7SA 2H88B 1SIJA 1L6UA 1AWDA 1E7PB 4YTNB 2W55A 3FC4A 1XLOA 2LEKA 4A9AA 3B2GA 2CJNA 4ZHPA 4YSZB 4WWMA 2DBYA 1L6VA 2L83A 2EKIA 4YTMB 1DOIA 3P4QB 1PFDA 2M56B 2BS3B 3AEEB 1XLPA 2WDVB 1KF6B 2QJLA 1NI3A 1V8CA 3HRDD 1H7WA 1VLBA 3P4RB 3W5UB 3AE5B 3VRAB 3VR9B 1SF0A 3AE9B 1TKYA 4HRSA 4IDIA 4N58A 1GAQB 1TKEA 1V97A 4YTPB 1AYFA 1RWSA 2W3SA 4WQMA 1QF6A 2WDRB 3AM9A 4HROA 1E6EB 1JWAD 5EE9A 2MJ3A 1YQ3B 1N63A 2WLBA 5AUIA 1FXIA 1JROA 4KX6B 2MJEA 4LTUA 2W3RA 3CWIA 3L4PA 1DOXA 1GTEA 3KWLA 3HVZA 1B9RA 5H8YE 1ZUD2 3AE7B 2CJOA 1JWBD 2PVOD 1E10A 3AEBB 1TYGB 4P6VF 1FO4A 3AEDB 1RFKA 3W9CB 4US9A 3HUIA 3AE4B 2FBWB 3SFDB 2WS3B 1YJIA 3LB8C 1J7AA 3B2FA 3WCQA 1F0ZA 5C3JB 1NYQA 1PUTA 1ZXIA 3AN1A 1IUEA 3AEAB 1TKGA 4YT0B 3SFEB 1QOAA 1L0VB 3AB5A 1UWMA 1CJEA 3CIRB 1A70A 2WQYB 2MJDA 2PKOA 2WU2B 3AE3B 4YSYB 4JWSC 2ACZB 5AUKA 1ROEA 3P4SB 3RPFC 1XLNA 1DGJA 1KRHA 2K9XA 4USAA 2Q5WD 1WGKA 1XLQA 5G5HA 1E0ZA 1N62A 4US8A 3NVWA 3VR8B 1KFYB 3CF4A 1QOFA 3AV8A 2CU3A 2BT6A 1JRPA 4JWUC 1QLBB 2BS2B 3AECB 2JX5A 4ZHOA 1WRIA 1YJJA 2KAJA 2Y5CA 1I7HA 3EUB2 3NRZA 1JQ4A 1QOBA 2WDQB 1NYRA 1WXQA 2HTME 2K22A 2K5PA 1FMAD 3BIID 2QIEB 3NVVA 1FXAA 1N60A 2KMMA 4N59A 1H7XA 2H89B 5GXGB 1GPXA 3ZYYX 3AEGB 5EE3A 1SB3C 1WWTA 3P4PB 1TJEA 2E3TA 2JQRB 1GT8A 4YSXB 1FRDA 3ABVB 1ZP0B 4ITKA 1FRRA 2WP9B 3P1MA 2BS4B 3AE6B 2PIAA 3AE8B 3VRBB 2WU5B 1FM0D 1JW9D 2W54A 3AH7A 1NEKB 1YQ4B 5H92C 2AX5A 1N61A 5G5GA 1PDXA 1J7BA 1RM6C 3NVZA 2MH7A 2PVGC 1FFVA 3AMZA 2G1EA 4C7YA
chains in the Genus database with same CATH superfamily
2Y5PA 2Y5BB 2DZIA 3NHEB 3L08A 4BFRA 5EE1A 2KLCA 2DAFA 1GTHA 2HD5B 2KJ6A 1YQBA 2D10A 5EE0A 3FAHA 2M19A 1FD6A 1XF5L 2KOXA 3IG3A 3VH3B 1VJKA 2J0KA 2WXMA 3E9SA 5L95C 4K3CA 4E74A 1L6UA 2W55A 4XWTA 2KFKB 3RNFC 2CJNA 2JF5A 3GB1A 1L2NA 4YTMB 4XGAB 2DHZA 4TV3A 1M94A 3RD2A 4W9FA 4P7IA 3U7ZA 3HRDD 3AI5A 1N6ZA 4HJGE 1TKYA 4HRSA 2RDBC 3RNCC 1I4QA 3MC9A 4DXFA 4EFOA 2L1AA 1YQ3B 1WJUA 3CWIA 2Z59B 1RAXA 4IW0A 2JVCA 4M8MA 3W1YA 2I1JA 4F8CB 2O6VA 3RCZA 3DBLI 3BYTB 3L0WB 1R4MI 2ZVNA 4I6LB 1UWMA 1WGRA 3V60A 5CHFA 5D3DA 4YSYB 2ACZB 3NZUA 5G5HA 1VZ6A 3Q2AC 4AUQC 3RZWC 4JWUC 3RYTA 1AARA 1I7HA 3NRZA 1NYRA 4XC2A 4KIKA 2KMMA 5GXGB 1TJEA 3KWVA 2M0AA 4I6PA 1R4NI 2ONQA 4W9GA 3EFCA 5H92C 3X0WA 1EU3A 1J7BA 4GSWA 2BKRB 3AMZA 1WE7A 2YVCA 3K9OB 1RLFA 5DPSA 2ON8A 4S17A 2NR2A 5MPOA 1E8ZA 4JLCA 4WJPA 4DHJD 2RMMA 1BT0A 3WIMA 4AWJA 2WXKA 3P2BA 2PE9A 2ZVOA 4FHKA 4MH8A 2MLBA 5JHAA 4PYUA 2DAJA 4LNIA 3P4QB 1WGYA 3ZTDA 4IUMB 1KF6B 2JZZA 1V8CA 1SJED 2L76A 1JWSD 4BOSC 4F7ZA 4JE3B 1WXVA 3VR9B 1STEA 3JSVB 2MBEA 2BYVE 4BBNF 2OJRA 2KZRA 5IA7A 2LVQA 1MHHE 2V4LA 3QK0A 3ZXVA 1I4PA 5EE9A 3EA6A 1F2RC 2YEPB 1ZXHA 4MGZE 1FO4A 4P6VF 1YJIA 3W1SA 3B2FA 2KDEB 4GDKA 3AEAB 4RGMA 2UWQA 1A70A 2WU2B 3UINB 1TT5B 2L3ZA 1D5ZC 4TSSA 3J9CA 1EF1A 4FADA 2CU3A 4C4VB 4HJKA 1FMAD 2QMTA 3PPAA 1ET6A 4ITKA 4ARCA 2M1MA 4KKIA 1F52A 5G5GA 3QA8A 2K3UA 4TQ0A 4LNNA 1E8XA 3BY4B 2UU7A 4NQLB 2N7EA 1OQYA 4FA6A 2J53A 2D3GA 3VFKA 1M4VA 3FILB 2KN4A 3ETRA 1UD7A 4KGSA 3DDCB 2GI9A 2BTEA 4EE2A 2LRUA 2ZNVC 2KDFB 1OEYJ 3RNAC 2GRIA 3T3OA 3KQ4A 4ZRJA 4M00A 2JWZA 2L83A 5DPRA 5JZEB 1KM7A 1OTRB 2LFIA 3N9YC 2C7MB 3ZUNA 3ML8A 4G0NB 4IDIA 3B1LX 3I5JC 3KUDB 3RNBC 3K9PB 3SHQA 3BK1A 1FXIA 4RM8A 3HM6X 2BQQA 3HK0A 1WJ6A 3Q8CA 2YEPF 2KWDA 3WCQA 3VVWB 1TS3A 4LCDE 5C3JB 2DZJA 4K3BA 1YJ1A 2D11A 2K39A 1PYWD 4IM0A 4GDLA 1AW7A 1DGJA 3WAOA 3VTUA 4BKSD 1E7UA 4H2AA 2RGFA 1JRPA 1QLBB 2BS2B 3RFZB 3C8YA 2WDQB 4OZCA 2DZMA 2GBJA 3ZYYX 3AEGB 4PYZA 4NJ7A 2FIDA 4BKGA 3N30A 2BYEA 1WR1A 1J19A 3AH7A 1ZPSA 2RPQA 3DVNV 2LI5A 2AWTA 1KJTA 1LFDA 1HA5A 2TSSA 1V1PB 1MVKA 3U4EG 1J7CA 3NUHB 2DWQA 4RH6A 3TEWA 2JXTA 3A4SC 4MEMA 3IVFA 2NVUI 3BK2A 4B9KA 2L8JA 1LO5D 4FJVB 2ZNVB 3UGBB 2R2OA 1V6EA 2M56B 3DBRB 3AEEB 4KVGB 4AOFA 3AULA 2KLGA 2WX0A 2GBNA 1VLBA 4ICVA 3A1QB 4N58A 3AE9B 1WJ4A 3OWEB 2W3SA 2K1FA 1IGDA 4ZRIA 1VR9A 2D3AA 1GNUA 4HROA 3RULA 3U7DA 4KX6B 4LTUA 1DOXA 5FK9C 5H8YE 3MC0B 4NPNA 3TEYA 4A20A 1ET9A 3AE4B 1UNSA 5G55A 1J7AA 5J18A 5DPWA 3O65B 1TS2A 1F1HA 3CSFA 3A9KA 1WM2A 2KKCA 3IBEA 4MH0E 5HI1A 2INCC 3ZKJC 2NPTB 3NVWA 3PGEA 3HM3A 3NS8A 4RGTA 2UYZB 3PREA 2PJHA 5AEKB 1MHXA 1QOBA 1TS5A 4NAWA 2AL6A 2IDYA 2RR9A 1H7XA 4W9IA 2C60A 5EE3A 1J8CA 4HCPB 3M62B 2ZZPB 2KQ7A 4NZLB 1UBIA 4MGIE 1F2RI 1FNVA 4MT5A 2QSDA 3L13A 2G1EA 1UWXA 2B76B 1T0SC 1FFUA 2XK5B 5E6JA 1P1AA 3SR6A 1TBEA 2WXPA 3DWGC 3T8MA 4OHJA 3P63A 3B9JA 3PZ7A 2H88B 3KW5B 4BKSA 4RGNA 1E7VA 1IPGA 1QKZA 4HXDA 1DOIA 2BS3B 2N1WA 4HPPA 3MTNB 2WHIA 2CKHB 1H7WA 4MM3A 1A5RA 2O6VD 3DCGA 4CO7A 2IPKD 5J2RA 2WXLA 2JPHA 1YN5A 3RN9C 1BUIC 4MACA 4LJPB 3KYDD 3T9LA 1N63A 3WA0A 1P7FA 3TUOA 3ZQ4A 1OGWA 3M63B 2KANA 5LXHA 2FBWB 4I6NB 4Q2JA 3RT3B 2JZPA 2LWPA 3R66C 4J3OD 2R61A 1QOAA 5JXVA 2MJDA 1ROEA 3QAQA 1P0RA 2K9XA 4HK2A 3DVGX 3OAWA 4URKA 4OZAA 1HXYD 2JYEA 3GE8C 3H9DA 3CMMB 3V61A 4ZHOA 1GB1A 4REZA 2ZPYA 1P98A 2LGYA 1T0QC 1FRDA 2N7JA 2M8SA 1FRRA 1VZ7A 1Q10A 2HE7A 2ZCCA 5CTRC 1RM6C 2EMSA 4P1BC 2MX2A 4X57B 3C19A 3R2IA 2V0GA 3ZJUA 5C2TB 4E3CA 4KDLB 3ZNGC 3A9JA 2BVCA 2I2YA 2ASQA 2L52A 4GU2A 4RF1A 3HIZA 2X38A 1N5WA 3MHSD 2PMVA 5AZGA 1PGAA 2IZVB 4AJYB 2INNE 4L23A 4W9HA 1F77A 2C9WB 2EKIA 2SEBD 4J6IA 1C79A 4AQ7A 1WJNA 2WXNA 4RFBA 4KSLC 3W5UB 1CK1A 3Q8BA 4ZDVA 1HZ6A 1GC6A 2L7RA 3ALBA 4WQMA 1TTNA 2JYTA 2JWUA 1JWAD 3KYCD 1SBBB 2QDFA 1SE9A 5AZFA 3ZIMA 1JWMD 3CF6E 3ZRCA 3H8HA 3ZGZA 4M0WA 2MEKA 2KK8A 1L0YB 3QX1A 4RMAA 4FJYA 3Q6BA 1QILA 5HFYA 2XBBC 1Z2MA 3WAMA 5E6NA 2I38A 1XLNA 5DPTA 1KRHA 2Y3AA 4IG7B 1V5OA 2JT4B 3MP9A 3N1ZC 2CS4A 1T0YA 3VR8B 1KFYB 4FHJA 2QCZA 4EKUA 1SSNA 2Z0DB 4JIOU 3GE3C 1UUPA 4GGQA 3PZDA 4GMVA 2MSED 2M0XA 4CQNA 2QIEB 1GPXA 3ZXRA 4YSXB 3BZDB 1FM0D 2BB6A 1UGMA 1NBFC 1MG8A 2K6QA 3MJ5A 4DK5A 2HTHA 3VUWA 2ICIA 3GZNI 5J17A 3E56A 4A90A 4C7ZA 1R7SA 1E7PB 1P9DU 1XLOA 2LEKA 3LYYA 2DNFA 2SAKA 1L6VA 3BYYB 3MC8A 3P4RB 4IWPA 3SD5A 1YX6B 1EU4A 1WH3A 2WX1A 1H8CA 1E8YA 3QWZB 1E6EB 4B6WA 5LLIA 3JW0X 1JROA 3PHXB 4DWFA 5IAAC 4F1SA 3HHMA 2PVOD 2FUHB 1RFKA 4PS8A 4NQKE 3O13A 2KFKA 3V3XA 3LB8C 2AEHA 2V3NA 2KX3A 2FCQA 2K6DB 2BBCA 4LNFA 1WGKA 2V1YA 1FPYA 3QARA 2MP2B 4LNOA 5KHOA 4LJOB 4XZ4A 1IBXB 3EUB2 1IP9A 1FNWA 2XNAC 2N9KA 1HE8A 1YNTE 2D2QA 1GT8A 3NZ3A 4RM9A 3P1MA 2PIAA 3EFUA 5BYRA 2RDGA 4WH4A 4ANUA 4DHJB 3N1XC 1MG4A 4O1NA 2KN5A 2JSVX 1F9JA 1IYFA 3AEFB 2MBOA 2N0SB 4ZOHC 3KUCB 3DHHC 3HVDA 1DYQA 2KJRA 1B1ZA 3AE2B 3NS1A 1CQVA 3DBHB 1TGZB 3KLSX 1JMLA 1HZ5A 1E90A 3ZO5B 4KDIC 3CSTA 3MJWA 4XDCA 2IBIB 2KHWB 1WE6A 2WDVB 1PGBA 4DDGD 2CHXA 2JU6X 4A3OA 2IJ0A 1FNUA 1X1MA 1WZ3A 3AM9A 4ZRQA 1GTEA 4KKJA 3PT2B 3AEBB 1TYGB 2WYQA 3AEDB 4ZRKA 5TSSA 3APFA 2RPVA 2OJWA 3SEBA 1NYQA 4WJOA 1WZ0A 1TKGA 2FUG1 3PS6A 2IGGA 3DBSA 3CIRB 2AL3A 1I4GA 4K7WA 2EMTA 1I42A 1UGJA 3R8BA 1XLQA 4E71A 4W9EA 2LGXA 3L17A 3CF4A 1QOFA 4EZJA 3JSVA 2D5GA 4GB9A 1WGHA 2Y5CA 1WF9A 2VH1A 3QJZA 2O2VB 4NAMA 4IM2A 2MCNB 1FXAA 1SJHD 3VUYA 5TR5A 2NBUA 2WXOA 2JQRB 2WWZA 1VRAB 1JW9D 2LXCA 2AX5A 3ZJTA 3NVZA 4C7YA 2GBMA 1SE3A 2XEWA 2EELA 3LDZE 1NENB 4LDTD 4RNAA 2INDC 3Q3OC 3RUIB 2CHWA 2MRPA 4FN2A 4MJSB 4K1RB 4C4VA 3UIPB 4B0EA 3RZFA 1P3QU 5LXIB 1GC7A 4FLHA 2DZKA 4W9DA 4YSZB 2DBYA 2AYOB 3APCA 2KWUB 4EUTA 2RSUA 2QJLA 2C5LC 3AE5B 3VRAB 1V86A 3IXSA 1C1YB 1SXTA 2JUOA 4HDOA 1ZE3D 1C9FA 2ZPNA 2IY0B 1RWSA 1K51A 2J42A 3FILA 2WLBA 4NY0A 3FKYA 4BKTA 3IT4B 2W3RA 2FAZA 3HVZA 4XX5A 1ZUD2 1E8WA 3AE7B 2QC8A 1WR6E 3DVNU 3PLUA 1TY0A 4DHZE 2M17A 4ACFA 4KGTA 3AN1A 2BPSA 1D5XC 3PLVA 1L0VB 1Y8RC 2KD0A 1WGGA 2L0FA 2HDEA 2KXJA 3C0RB 2QEJC 4HWIB 3NVVA 4G3XB 1VCBA 4D2KA 1SB3C 3P4PB 3ZNHB 2ZW1A 2KTRA 2NTSA 3VRBB 4MDKE 4ASWC 1PDXA 2K0PA 2MBHA 3TEZA 2MH7A 3TSSA 3N1YC 1DOYA 4LLGM 1KLVA 5E6OA 3A4RA 1WX7A 1KOTA 2V3SA 4YXDB 5L83A 3M95A 1V2YA 1UZXB 4FXCA 5BMIA 5I4DA 3RI7C 1I4HA 2K25A 3Q69A 2HJ8A 3TJPA 1Z5SB 2FIFA 4WWMA 3OJ4B 2KMCA 3NG0A 4HVBA 1YD8U 2KACA 4ZRPA 4RGOS 2E6XA 3EECA 2D07B 2NBVB 1SF0A 3N32A 1T5XD 1IGCA 1V80A 2KO3A 3B08A 4OVZA 2J52A 2ZCBA 1E0ZA 2CJOA 4EZKA 4BVUC 2FCSA 4CHKA 2N9XA 3HUIA 2JZ3B 2REXA 3SFDB 2Z8LA 1HQRD 4JGHB 1ZKHA 3OG5A 3RNEC 3NJTA 2BYFA 3QQ8B 3VUXA 4C00A 2LGIA 3JYUA 5FR6A 1D3ZA 2LVOA 1WXAA 1GB4A 1N62A 2PPHA 3AU4A 2RDHA 2KDIA 2WXFA 3A1QA 2R2QA 3IAS1 2LGDA 2JX5A 2WXRA 5BO4B 3BINA 1WXQA 1WGDA 3Q8FA 2OEDA 1WWTA 1C76A 3W2DA 1ZP0B 5IN7A 2WDTB 1V9JA 3DBRI 2MQJA 4WWPA 4WJQA 4DQOC 1GG3A 2QILA 3VXWA 3DBLB 1KTKA 4GIVA 1QQRA 4DXAB 5BYQA 4A8XC 3AE1B 3JVZX 3DQVA 1WYGA 3NVYA 1C3TA 2BWFA 2IO0B 4N6EB 4UDUC 2NPTA 4P1CC 2INPE 3ONSA 3W1SC 2IYDB 2FCMA 4WURA 4IWQA 5AZHA 1Q1OA 3H1UA 4OZBA 1LGRA 2O6VB 1VD2A 1U4AA 2VZKB 5HHDG 3M3JA 1VZ8A 1ZGUB 3Q8EA 1FCCC 2WXIA 3Q3NC 1SEBD 1YX5B 2DX5B 1K52A 2BB5A 1GAQB 2XK5A 4IC7B 1HTOA 1G6JA 3BWUD 3B0AA 4ARIA 1QF6A 3U8ZA 1BXTA 1YN3A 3ECIA 3V62A 3VH4B 4KIKB 2LUMA 3TMPB 2PW9A 4ANWA 1YN4A 4ANVA 4KZCA 2WS3B 4EOYA 4MSQB 3VTWA 2KNBA 4YT0B 3AB5A 4EEWA 1CJEA 4NJ6A 3AE3B 4YWGG 4USAA 4CYEA 2LGSA 2XN9C 1ZW7A 3RMKC 5E6PA 3V05A 4RCOA 2BKFA 1WRIA 3DVGY 3GOEA 3ZDTA 2L05A 5JHBA 2K5PA 3PSEB 1SGHA 3H7PA 2NS5A 5HG2A 3UI3A 1HEZE 2BS4B 2LMCA 3AE8B 2G45B 1TZOA 1WYWB 4W9LA 2LUEA 5DCNA 1FFVA 4FBJB 1UELA 2K8HA 1OQQA 5IP4D 4MGKE 2N1VA 1MJDA 1ZOYB 4LNKA 1FIQA 1WMHA 2DYMA 3BVZA 3PO0A 2BYTA 1D5MC 1QOGA 3I9V1 1LM8B 3APDA 3OLMD 4HKQA 3R7QA 2KJHB 4TMAB 4HPMB 3ZNZB 4A9AA 1C4PA 3UQAA 4GDKB 2IGHA 3UQBA 4N9F4 1FXTB 2I1KA 2MW5A 3BVMA 2LD9A 5EDSA 3H7SA 4IM3A 1MI0A 3PTFC 2GBKA 2WDRB 1ZDXA 4HLEA 1EO6A 5AUIA 3X23A 2X8XX 1E10A 3ZRFA 1ESFA 1Q5WB 3W9CB 4BZAA 1JWUD 3P42A 2KDMA 1WIAA 3TIXA 4C56C 1ZXIA 2KC2A 3GP7A 1V5TA 4XYCA 4JWSC 2NMQA 3L10B 3P4SB 1I4RA 3NZSA 2JXXA 3U30A 1CMXB 1WI0A 4NNJB 2MBQA 4XDDA 2KAJA 2K8BA 2IO3B 3LJ3A 2K22A 3BIID 1EWCA 3SU8X 3PHWB 4IKGA 2E3TA 3TL5A 3D32A 3V6EB 3DHIC 1WX9A 2NCNA 5D2MB 2WNMA 2KVRA 1EUVB 3N3KB 2CR5A 4M8NA 2FE8A 2WXQA 1WM3A 4JX1C 3WALA 4GLSC 4EZLA 1H4RA 3SDLC 3KH0A 2W82A 2AQ2B 1FEHA 1GUAB 1OQRA 2N9EB 3W5VB 3Q14C 1RYJA 4WWNA 4C80A 3OJ3A 3Q3FA 2LRWA 2ZJDA 4ANXA 5D7GA 3A33B 2LXAA 1UF0A 3R2TA 1L7YA 2NBWB 3QIJA 2KTFA 3L54A 1YOVB 2FNJB 4GDLB 3ZJVA 2C7HA 2LHDA 1NI3A 2M4NA 1EF5A 2JRHA 1V1OA 1RRBA 1XXGA 4YTPB 1AN8A 2IO2B 3TBLD 4OW0A 1Y56A 2OOBB 2V4IB 1MPEA 1TS4A 5C23A 2MJ3A 5BMGA 1I35A 2VH2A 1KLUD 2BW2A 3IFWB 3UIOB 5FR3A 4P16A 5C1ZA 1V49A 2L0TA 4A6QA 2ZEQA 1IUEA 3T3NA 2MBBB 1KH0A 3GS2A 4IOIE 1TY2A 4WIPA 3MHZA 1C4CA 5D6JB 3IT6B 1XCTL 2PTLA 2LVPA 2ZW0A 2LASA 3PRZA 1WRDB 4DHZB 4MELA 3Q8AA 3MFGA 1QZEA 4W9JA 4BOZB 1NDDA 4KSKC 4BAXA 4WAAA 3V6CB 4GOCA 2YLMA 1UBQA 1JQ4A 2JY6A 4II2B 1ENFA 5D3IB 4ICUA 3ABVB 5BYSA 3AE6B 1FCLA 2KDBA 2W54A 1N61A 3L16A 2PEAA 1QT9A 2MWSB 3WANA 5T8IA 1WSPA 3IHPC 2GLSA 3TEXA 1CZPA 1JALA 4WJNA 3PZ8A 1C78A 4PT5A 3UF8A 1N5XA 2KC1A 1XO3A 1E9MA 2V9HA 2GOWA 2MP2A 4KGRA 1IBXA 3B2GA 5IO9A 2GB1A 4K81A 2EKEC 3A9KB 2KTRB 2KWVB 3IAM1 1HTQA 2K8CA 2HJ1A 4HCNB 2KT7A 1JRUA 1ISNA 2IY1B 1TKEA 4XE0A 3AXCA 1AYFA 3TCAA 2AQ1B 3DPDA 4NAWB 2D3BA 2A4ZA 3RNGC 5CHWA 3KWLA 1JWBD 4WQOB 3VDZA 1PQSA 4W9CA 4B95A 4US9A 4HPLB 2DENB 5KHQA 4K7UA 1RFAA 3Q3MC 1F0ZA 2MHJA 4LK0M 1WXMA 3VHTC 3I3TB 3ZDMC 3Q3JA 1T0RC 4L2YA 1S3SG 5AUKA 4PS7A 3RPFC 1BMLC 4QAYA 1XD3B 4PK1A 1WXSA 3AV8A 3DBHI 4TQ1A 3AECB 2WGSA 1L4DB 2GBRA 1N60A 2FCNA 4LDTB 4R3DA 2J0JA 4IWOA 4JPSA 1I4XA 2CU1A 3BVGA 3R3MA 3EC8A 3VQIA 2PVGC 3NY5A 4ZYNA 1K8RB 4MM3B 4OVVA 1S1QB 1GJZA 1E5WA 3VAWA 1NI2A 2G4SA 2WXJA 1NVID 3QC8B 4WWOA 5D94A 2VRRB 2KFJA 1SE4A 1OEYA 3ZW3A 1OFFA 3AU5A 4MSMB 1T3QA 1L5PA 3ZNID 3ZVVA 1PGXA 1WY8A 3VTVA 2O2VA 2MA9B 1WFYA 4A55A 1YMHE 3KUZA 2J7QB 4G11A 2CHZA 1LQBA 3URYA 1XLPA 2N4FA 4W9KA 3I63C 3R7RA 1XCQL 1XQQA 1V97A 2N9PC 4L1BA 1TZ1A 2C7NB 1V81A 2IO1B 3WAPA 1P7EA 2KVZA 2MJEA 1B9RA 4JQWC 2DLBA 1D6EC 4MJSA 3PRPB 1SE2A 2G9HD 3S2AA 1L0XB 1TIFA 4TUUA 4MGYE 2DYBA 1T6BX 2L00B 2A5UA 1XEEA 1V1PA 2QHOA 4NJCA 1J0GA 2GMIC 1UH6A 4DDID 3A9JB 1K50A 1XT9B 2KYWA 2Q5WD 3H6NA 4US8A 2BF8B 4AS1A 3PVLA 1ACCA 5BMHA 2LHEA 4KZ0A 5G2NA 1YJJA 4B0MA 1Q0WB 2HTME 3PRMB 2H89B 2KX0A 1EM7A 2WP9B 5FKAC 3ENEA 2WU5B 1YQ4B 4XWWA 2Z0EB 2G3QB 4FULA 2KQSA 4TKNA 4K7SA 5IOIA 2OHFA 3LXFA 1C4AA 2LJIA 3DWMA 4GN1A 1EWYC 4DXGA 2J4XA 2VZKD 1VDVA 5LNK1 3U52E 1SIJA 2LJ5A 3FC4A 1AWDA 4YTNB 4M0WB 4PS3A 3H7PB 5CHVC 4FJZA 4BBNC 4ZHPA 1R4MB 1PFDA 2JRIB 3DHGC 4JL9A 1LXDA 2J0MA 5IKCM 3NOBA 4II3B 4RF0A 4ZYSA 2KQ4X 2IGDA 3QCAA 1MFWA 4G50A 4WAFA 5GMVA 2D3CA 3ZTCA 2AQ3B 5CX3A 2KMAA 1WMHB 3GZNB 3L4PA 3ML9A 2RD0A 4HKZE 1L4ZB 1R4NB 2KWCA 2L32A 4DBGA 2B3AA 1PUTA 4AJWA 3QHTA 3U2SC 3EGRA 4OVUA 2PLPA 1SIFA 3SFEB 3I57A 4HDQA 1ZDVA 1WX8A 2DYOA 2WQYB 3KVFB 2PKOA 2W9NA 2V3PA 1JCKB 1KLGD 1YIWA 3N20C 2BGFA 2N7DA 1C77A 2LZ6A 4GXBA 4HEA1 2BWES 1K53A 5HKHA 2BT6A 4YL8A 4M02A 1D4BA 3PV1A 4N59A 4S0RA 4AP4C 3ZLZA 5JH5C 3EHVA 2G4DB 4A3PA 2NTTA 2N9LA 2WXHA 4KV2A 3DOWA 4M01A 1NEKB 1GOZA 2PE6B 2WXGA
chains in the Genus database with same CATH topology
2WXQA 2B76B 1FFUA 4JX1C 1NENB 2Y5PA 4GLSC 5E6JA 4RNAA 5EE1A 2W82A 1GTHA 2AQ2B 1FEHA 2BYTA 3SR6A 2WXPA 1OQRA 5EE0A 3W5VB 3DWGC 3FAHA 2M19A 1FD6A 1XF5L 1RYJA 4OHJA 4C80A 3P63A 1VJKA 3B9JA 2WXMA 3E9SA 3PZ7A 2H88B 1L6UA 2W55A 4XWTA 5D7GA 4B0EA 3R2TA 4RGNA 2CJNA 1QKZA 3GB1A 4YSZB 2DBYA 4YTMB 1DOIA 2BS3B 4GDLB 3ZJVA 2LHDA 2QJLA 1NI3A 3U7ZA 3HRDD 1H7WA 3AE5B 3VRAB 4HJGE 1TKYA 3IXSA 1SXTA 4HRSA 1C9FA 1V1OA 1ZE3D 2IPKD 2WXLA 1XXGA 4YTPB 1AN8A 1RWSA 1YN5A 1I4QA 4OW0A 1BUIC 1Y56A 4MACA 4DXFA 2V4IB 1K51A 1MPEA 1TS4A 2J42A 3FILA 2L1AA 2MJ3A 1YQ3B 1N63A 2WLBA 5BMGA 3IT4B 2W3RA 3CWIA 3HVZA 1KLUD 1ZUD2 3AE7B 1P7FA 3TUOA 2BW2A 3ZQ4A 5FR3A 4P16A 1TY0A 2FBWB 4Q2JA 4KGTA 2JZPA 3AN1A 4A6QA 4J3OD 1IUEA 3BYTB 3T3NA 1D5XC 1KH0A 3GS2A 4IOIE 1TY2A 2R61A 4WIPA 1QOAA 3MHZA 1L0VB 1UWMA 1C4CA 5JXVA 2MJDA 3IT6B 5D3DA 4YSYB 2ACZB 1ROEA 1XCTL 2PTLA 2ZW0A 2K9XA 5G5HA 1VZ6A 3Q8AA 3MFGA 2HDEA 4OZAA 2QEJC 4JWUC 1HXYD 2JYEA 4ZHOA 1I7HA 3NRZA 1JQ4A 1GB1A 1NYRA 4REZA 3NVVA 2KMMA 5GXGB 4D2KA 1SB3C 3P4PB 2ZW1A 1TJEA 3KWVA 1ENFA 2M0AA 5D3IB 1FRDA 2N7JA 3ABVB 1FRRA 2NTSA 3AE6B 2ONQA 5BYSA 1FCLA 1VZ7A 3VRBB 2W54A 1Q10A 5H92C 1N61A 1EU3A 1PDXA 2K0PA 1J7BA 1RM6C 3TEZA 2MH7A 3AMZA 3TSSA 1DOYA 1QT9A 4LLGM 5T8IA 1WSPA 3R2IA 2V0GA 3ZJUA 5C2TB 2ON8A 2G1EA 3TEXA 1CZPA 1JALA 3PZ8A 1C78A 4PT5A 5MPOA 1N5XA 2I2YA 4RF1A 4YXDB 1XO3A 2L52A 1E9MA 2X38A 4FXCA 5BMIA 5I4DA 4KGRA 2RMMA 1N5WA 1I4HA 2PMVA 1IBXA 3Q69A 2WXKA 1PGAA 3B2GA 2GB1A 2INNE 4L23A 4MH8A 1F77A 4WWMA 3IAM1 2EKIA 3P4QB 2SEBD 1C79A 1KF6B 4AQ7A 1V8CA 2KACA 4ZRPA 2WXNA 1SJED 4RGOS 1JWSD 2E6XA 4JE3B 4RFBA 3W5UB 1CK1A 3VR9B 3Q8BA 1SF0A 1STEA 1T5XD 1TKEA 1HZ6A 1IGCA 4XE0A 1AYFA 4WQMA 4OVZA 2AQ1B 2J52A 2JYTA 4NAWB 1MHHE 2JWUA 1JWAD 1I4PA 5EE9A 3EA6A 1E0ZA 1F2RC 1SBBB 3KWLA 2YEPB 1JWMD 1ZXHA 2CJOA 1JWBD 1FO4A 4P6VF 3H8HA 4US9A 3ZGZA 4M0WA 3HUIA 2MEKA 1L0YB 3SFDB 1YJIA 2Z8LA 3W1SA 1HQRD 3B2FA 1F0ZA 4LK0M 3AEAB 4RGMA 1QILA 5HFYA 1A70A 2WU2B 4L2YA 5AUKA 2LGIA 3RPFC 1BMLC 1XLNA 2I38A 1KRHA 2Y3AA 1D5ZC 1GB4A 3MP9A 4TSSA 1N62A 3VR8B 1KFYB 3J9CA 2RDHA 3AV8A 2WXFA 1SSNA 2CU3A 4TQ1A 3IAS1 1UUPA 3AECB 2JX5A 2WXRA 1L4DB 1WXQA 1FMAD 4CQNA 2QIEB 1N60A 1GPXA 3Q8FA 2OEDA 4R3DA 2QMTA 1WWTA 1ET6A 4YSXB 1C76A 3UI3A 3W2DA 1ZP0B 4ITKA 4JPSA 4ARCA 1I4XA 3BVGA 3BZDB 1FM0D 4KKIA 4DQOC 2BB6A 5G5GA 2QILA 3VQIA 2K3UA 2PVGC 4TQ0A 1KTKA 1QQRA 4MM3B 5BYQA 4A8XC 2J53A 3AE1B 2WXJA 1NVID 1WYGA 3NVYA 1M4VA 4N6EB 3FILB 3MJ5A 4UDUC 2KN4A 3ETRA 4KGSA 2ICIA 1SE4A 2INPE 1OFFA 2GI9A 2BTEA 3E56A 4A90A 4EE2A 4C7ZA 1T3QA 1L5PA 4WURA 1R7SA 1E7PB 1PGXA 2GRIA 4OZBA 3KQ4A 3T3OA 1XLOA 2LEKA 3LYYA 2SAKA 2VZKB 5HHDG 4A55A 1YMHE 1L6VA 1VZ8A 2L83A 3Q8EA 3BYYB 1FCCC 2LFIA 1XLPA 2WXIA 3URYA 3N9YC 1SEBD 1K52A 3P4RB 2BB5A 4IDIA 1GAQB 1XCQL 1V97A 4L1BA 1EU4A 3BWUD 4ARIA 1QF6A 1BXTA 1YN3A 1E6EB 3BK1A 1FXIA 1P7EA 1JROA 2MJEA 2LUMA 1B9RA 2PW9A 2PVOD 2DLBA 1RFKA 3Q8CA 1D6EC 1YN4A 1SE2A 3O13A 2G9HD 3V3XA 2YEPF 2KWDA 2WS3B 1L0XB 3LB8C 3WCQA 1TS3A 5C3JB 2V3NA 4YT0B 3AB5A 1PYWD 1CJEA 1T6BX 1SE3A 3AE3B 1XEEA 1V1PA 4NJCA 1AW7A 2BBCA 1DGJA 4YWGG 1K50A 4USAA 2Q5WD 1WGKA 2XN9C 4US8A 4H2AA 4AS1A 3V05A 1ACCA 5BMHA 1JRPA 2LHEA 4RCOA 1QLBB 2BS2B 1IBXB 1WRIA 1YJJA 3RFZB 3EUB2 3C8YA 4B0MA 2WDQB 2HTME 2K5PA 4OZCA 1FNWA 2XNAC 2H89B 2N9KA 3ZYYX 3AEGB 1YNTE 1EM7A 1GT8A 3NZ3A 5HG2A 2WP9B 1HEZE 2BS4B 2LMCA 3P1MA 2PIAA 3AE8B 5FKAC 2WU5B 1TZOA 3AH7A 5BYRA 1YQ4B 2RDGA 4WH4A 4XWWA 1ZPSA 1FFVA 4O1NA 1HA5A 2JSVX 2TSSA 1OQQA 2OHFA 3AEFB 2N0SB 3LXFA 1V1PB 1MVKA 3U4EG 4ZOHC 1J7CA 3NUHB 1C4AA 2LJIA 3DWMA 2DWQA 1DYQA 1ZOYB 3HVDA 1B1ZA 1EWYC 4RH6A 3TEWA 2JXTA 1FIQA 3AE2B 3NS1A 1CQVA 4DXGA 3KLSX 1JMLA 2DYMA 2J4XA 2VZKD 1VDVA 3BVZA 1D5MC 3PO0A 3U52E 5LNK1 1QOGA 1HZ5A 1SIJA 3BK2A 3I9V1 3FC4A 1AWDA 4YTNB 4HKQA 1LO5D 4TMAB 4A9AA 1C4PA 4ZHPA 4GDKB 4XDCA 2IGHA 1PFDA 2M56B 3AEEB 2WDVB 1PGBA 3BVMA 1VLBA 4RF0A 4ZYSA 1MI0A 2KQ4X 4N58A 3AE9B 2IGDA 2JU6X 3OWEB 4WAFA 2IJ0A 2W3SA 1IGDA 1FNUA 1VR9A 2WDRB 3AM9A 2AQ3B 1ZDXA 4HROA 5AUIA 4ZRQA 4KX6B 4LTUA 1DOXA 3L4PA 1GTEA 4HKZE 5FK9C 5H8YE 3MC0B 1L4ZB 4KKJA 1E10A 3AEBB 1TYGB 2L32A 3TEYA 3AEDB 1ESFA 5TSSA 3W9CB 1JWUD 3P42A 2KDMA 1ET9A 3AE4B 2RPVA 1UNSA 1J7AA 4C56C 3SEBA 1NYQA 1PUTA 1ZXIA 1TS2A 3U2SC 3EGRA 1TKGA 2FUG1 2PLPA 3GP7A 3SFEB 3I57A 5HI1A 2IGGA 1ZDVA 3CIRB 2DYOA 2WQYB 2NMQA 2PKOA 1I4GA 2V3PA 4JWSC 1JCKB 1KLGD 3P4SB 1I4RA 1UGJA 3R8BA 1XLQA 1C77A 4HEA1 3NVWA 4RGTA 3CF4A 1QOFA 1K53A 2D5GA 2BT6A 4XDDA 2KAJA 1D4BA 2Y5CA 1MHXA 1QOBA 1TS5A 2K22A 4NAMA 2IDYA 3BIID 4N59A 1FXAA 1EWCA 1H7XA 1SJHD 5EE3A 4IKGA 2WXOA 2E3TA 2JQRB 2NTTA 2N9LA 2WXHA 1VRAB 1JW9D 4NZLB 1NEKB 2WNMA 2AX5A 1F2RI 1FNVA 4MT5A 1GOZA 3ZJTA 3NVZA 2QSDA 4C7YA 1UWXA 2FE8A 2EELA 2WXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B76 B;  1DOY A;  1QT9 A;  1FFU A;  4JX1 C;  1NEN B;  1OQQ A;  2OHF A;  3AE1 B;  3AEF B;  1NVI D;  5C2T B;  2N0S B;  3LXF A;  1GTH A;  1WYG A;  5EE1 A;  4ZOH C;  3NVY A;  1CZP A;  1J7C A;  1JAL A;  3SR6 A;  4N6E B;  3DWM A;  2DWQ A;  3ETR A;  1ZOY B;  1OQR A;  1N5X A;  5EE0 A;  5MPO A;  4YXD B;  1EWY C;  1XO3 A;  1E9M A;  2L52 A;  3DWG C;  3FAH A;  3W5V B;  1FIQ A;  3AE2 B;  1OFF A;  2M19 A;  3NS1 A;  4FXC A;  1RYJ A;  4C80 A;  3P63 A;  3PO0 A;  4C7Z A;  1VDV A;  1T3Q A;  1VJK A;  3B9J A;  1L5P A;  1N5W A;  1QOG A;  1R7S A;  2H88 B;  1SIJ A;  1L6U A;  1AWD A;  1E7P B;  4YTN B;  2W55 A;  3FC4 A;  1XLO A;  2LEK A;  4A9A A;  3B2G A;  2CJN A;  4ZHP A;  4YSZ B;  4WWM A;  2DBY A;  1L6V A;  2L83 A;  2EKI A;  4YTM B;  1DOI A;  3P4Q B;  1PFD A;  2M56 B;  2BS3 B;  3AEE B;  1XLP A;  2WDV B;  1KF6 B;  2QJL A;  1NI3 A;  1V8C A;  3HRD D;  1H7W A;  1VLB A;  3P4R B;  3W5U B;  3AE5 B;  3VRA B;  3VR9 B;  1SF0 A;  3AE9 B;  1TKY A;  4HRS A;  4IDI A;  4N58 A;  1GAQ B;  1TKE A;  1V97 A;  4YTP B;  1AYF A;  1RWS A;  2W3S A;  4WQM A;  1QF6 A;  2WDR B;  3AM9 A;  4HRO A;  1E6E B;  1JWA D;  5EE9 A;  2MJ3 A;  1YQ3 B;  1N63 A;  2WLB A;  5AUI A;  1FXI A;  1JRO A;  4KX6 B;  2MJE A;  4LTU A;  2W3R A;  3CWI A;  3L4P A;  1DOX A;  1GTE A;  3KWL A;  3HVZ A;  1B9R A;  5H8Y E;  1ZUD 2;  3AE7 B;  2CJO A;  1JWB D;  2PVO D;  1E10 A;  3AEB B;  1TYG B;  4P6V F;  1FO4 A;  3AED B;  1RFK A;  3W9C B;  4US9 A;  3HUI A;  3AE4 B;  2FBW B;  3SFD B;  2WS3 B;  1YJI A;  3LB8 C;  1J7A A;  3B2F A;  3WCQ A;  1F0Z A;  5C3J B;  1NYQ A;  1PUT A;  1ZXI A;  3AN1 A;  1IUE A;  3AEA B;  1TKG A;  4YT0 B;  3SFE B;  1QOA A;  1L0V B;  3AB5 A;  1UWM A;  1CJE A;  3CIR B;  1A70 A;  2WQY B;  2MJD A;  2PKO A;  2WU2 B;  3AE3 B;  4YSY B;  4JWS C;  2ACZ B;  5AUK A;  1ROE A;  3P4S B;  3RPF C;  1XLN A;  1DGJ A;  1KRH A;  2K9X A;  4USA A;  2Q5W D;  1WGK A;  1XLQ A;  5G5H A;  1E0Z A;  1N62 A;  4US8 A;  3NVW A;  3VR8 B;  1KFY B;  3CF4 A;  1QOF A;  3AV8 A;  2CU3 A;  2BT6 A;  1JRP A;  4JWU C;  1QLB B;  2BS2 B;  3AEC B;  2JX5 A;  4ZHO A;  1WRI A;  1YJJ A;  2KAJ A;  2Y5C A;  1I7H A;  3EUB 2;  3NRZ A;  1JQ4 A;  1QOB A;  2WDQ B;  1NYR A;  1WXQ A;  2HTM E;  2K22 A;  2K5P A;  1FMA D;  3BII D;  2QIE B;  3NVV A;  1FXA A;  1N60 A;  2KMM A;  4N59 A;  1H7X A;  2H89 B;  5GXG B;  1GPX A;  3ZYY X;  3AEG B;  5EE3 A;  1SB3 C;  1WWT A;  3P4P B;  1TJE A;  2E3T A;  2JQR B;  1GT8 A;  4YSX B;  1FRD A;  3ABV B;  1ZP0 B;  4ITK A;  1FRR A;  2WP9 B;  3P1M A;  2BS4 B;  3AE6 B;  2PIA A;  3AE8 B;  3VRB B;  2WU5 B;  1FM0 D;  1JW9 D;  2W54 A;  3AH7 A;  1NEK B;  1YQ4 B;  5H92 C;  2AX5 A;  1N61 A;  5G5G A;  1PDX A;  1J7B A;  1RM6 C;  3NVZ A;  2MH7 A;  2PVG C;  1FFV A;  3AMZ A;  2G1E A;  4C7Y A; 
#chains in the Genus database with same CATH topology
 2Y5P A;  2Y5B B;  2DZI A;  3NHE B;  3L08 A;  4BFR A;  5EE1 A;  2KLC A;  2DAF A;  1GTH A;  2HD5 B;  2KJ6 A;  1YQB A;  2D10 A;  5EE0 A;  3FAH A;  2M19 A;  1FD6 A;  1XF5 L;  2KOX A;  3IG3 A;  3VH3 B;  1VJK A;  2J0K A;  2WXM A;  3E9S A;  5L95 C;  4K3C A;  4E74 A;  1L6U A;  2W55 A;  4XWT A;  2KFK B;  3RNF C;  2CJN A;  2JF5 A;  3GB1 A;  1L2N A;  4YTM B;  4XGA B;  2DHZ A;  4TV3 A;  1M94 A;  3RD2 A;  4W9F A;  4P7I A;  3U7Z A;  3HRD D;  3AI5 A;  1N6Z A;  4HJG E;  1TKY A;  4HRS A;  2RDB C;  3RNC C;  1I4Q A;  3MC9 A;  4DXF A;  4EFO A;  2L1A A;  1YQ3 B;  1WJU A;  3CWI A;  2Z59 B;  1RAX A;  4IW0 A;  2JVC A;  4M8M A;  3W1Y A;  2I1J A;  4F8C B;  2O6V A;  3RCZ A;  3DBL I;  3BYT B;  3L0W B;  1R4M I;  2ZVN A;  4I6L B;  1UWM A;  1WGR A;  3V60 A;  5CHF A;  5D3D A;  4YSY B;  2ACZ B;  3NZU A;  5G5H A;  1VZ6 A;  3Q2A C;  4AUQ C;  3RZW C;  4JWU C;  3RYT A;  1AAR A;  1I7H A;  3NRZ A;  1NYR A;  4XC2 A;  4KIK A;  2KMM A;  5GXG B;  1TJE A;  3KWV A;  2M0A A;  4I6P A;  1R4N I;  2ONQ A;  4W9G A;  3EFC A;  5H92 C;  3X0W A;  1EU3 A;  1J7B A;  4GSW A;  2BKR B;  3AMZ A;  1WE7 A;  2YVC A;  3K9O B;  1RLF A;  5DPS A;  2ON8 A;  4S17 A;  2NR2 A;  5MPO A;  1E8Z A;  4JLC A;  4WJP A;  4DHJ D;  2RMM A;  1BT0 A;  3WIM A;  4AWJ A;  2WXK A;  3P2B A;  2PE9 A;  2ZVO A;  4FHK A;  4MH8 A;  2MLB A;  5JHA A;  4PYU A;  2DAJ A;  4LNI A;  3P4Q B;  1WGY A;  3ZTD A;  4IUM B;  1KF6 B;  2JZZ A;  1V8C A;  1SJE D;  2L76 A;  1JWS D;  4BOS C;  4F7Z A;  4JE3 B;  1WXV A;  3VR9 B;  1STE A;  3JSV B;  2MBE A;  2BYV E;  4BBN F;  2OJR A;  2KZR A;  5IA7 A;  2LVQ A;  1MHH E;  2V4L A;  3QK0 A;  3ZXV A;  1I4P A;  5EE9 A;  3EA6 A;  1F2R C;  2YEP B;  1ZXH A;  4MGZ E;  1FO4 A;  4P6V F;  1YJI A;  3W1S A;  3B2F A;  2KDE B;  4GDK A;  3AEA B;  4RGM A;  2UWQ A;  1A70 A;  2WU2 B;  3UIN B;  1TT5 B;  2L3Z A;  1D5Z C;  4TSS A;  3J9C A;  1EF1 A;  4FAD A;  2CU3 A;  4C4V B;  4HJK A;  1FMA D;  2QMT A;  3PPA A;  1ET6 A;  4ITK A;  4ARC A;  2M1M A;  4KKI A;  1F52 A;  5G5G A;  3QA8 A;  2K3U A;  4TQ0 A;  4LNN A;  1E8X A;  3BY4 B;  2UU7 A;  4NQL B;  2N7E A;  1OQY A;  4FA6 A;  2J53 A;  2D3G A;  3VFK A;  1M4V A;  3FIL B;  2KN4 A;  3ETR A;  1UD7 A;  4KGS A;  3DDC B;  2GI9 A;  2BTE A;  4EE2 A;  2LRU A;  2ZNV C;  2KDF B;  1OEY J;  3RNA C;  2GRI A;  3T3O A;  3KQ4 A;  4ZRJ A;  4M00 A;  2JWZ A;  2L83 A;  5DPR A;  5JZE B;  1KM7 A;  1OTR B;  2LFI A;  3N9Y C;  2C7M B;  3ZUN A;  3ML8 A;  4G0N B;  4IDI A;  3B1L X;  3I5J C;  3KUD B;  3RNB C;  3K9P B;  3SHQ A;  3BK1 A;  1FXI A;  4RM8 A;  3HM6 X;  2BQQ A;  3HK0 A;  1WJ6 A;  3Q8C A;  2YEP F;  2KWD A;  3WCQ A;  3VVW B;  1TS3 A;  4LCD E;  5C3J B;  2DZJ A;  4K3B A;  1YJ1 A;  2D11 A;  2K39 A;  1PYW D;  4IM0 A;  4GDL A;  1AW7 A;  1DGJ A;  3WAO A;  3VTU A;  4BKS D;  1E7U A;  4H2A A;  2RGF A;  1JRP A;  1QLB B;  2BS2 B;  3RFZ B;  3C8Y A;  2WDQ B;  4OZC A;  2DZM A;  2GBJ A;  3ZYY X;  3AEG B;  4PYZ A;  4NJ7 A;  2FID A;  4BKG A;  3N30 A;  2BYE A;  1WR1 A;  1J19 A;  3AH7 A;  1ZPS A;  2RPQ A;  3DVN V;  2LI5 A;  2AWT A;  1KJT A;  1LFD A;  1HA5 A;  2TSS A;  1V1P B;  1MVK A;  3U4E G;  1J7C A;  3NUH B;  2DWQ A;  4RH6 A;  3TEW A;  2JXT A;  3A4S C;  4MEM A;  3IVF A;  2NVU I;  3BK2 A;  4B9K A;  2L8J A;  1LO5 D;  4FJV B;  2ZNV B;  3UGB B;  2R2O A;  1V6E A;  2M56 B;  3DBR B;  3AEE B;  4KVG B;  4AOF A;  3AUL A;  2KLG A;  2WX0 A;  2GBN A;  1VLB A;  4ICV A;  3A1Q B;  4N58 A;  3AE9 B;  1WJ4 A;  3OWE B;  2W3S A;  2K1F A;  1IGD A;  4ZRI A;  1VR9 A;  2D3A A;  1GNU A;  4HRO A;  3RUL A;  3U7D A;  4KX6 B;  4LTU A;  1DOX A;  5FK9 C;  5H8Y E;  3MC0 B;  4NPN A;  3TEY A;  4A20 A;  1ET9 A;  3AE4 B;  1UNS A;  5G55 A;  1J7A A;  5J18 A;  5DPW A;  3O65 B;  1TS2 A;  1F1H A;  3CSF A;  3A9K A;  1WM2 A;  2KKC A;  3IBE A;  4MH0 E;  5HI1 A;  2INC C;  3ZKJ C;  2NPT B;  3NVW A;  3PGE A;  3HM3 A;  3NS8 A;  4RGT A;  2UYZ B;  3PRE A;  2PJH A;  5AEK B;  1MHX A;  1QOB A;  1TS5 A;  4NAW A;  2AL6 A;  2IDY A;  2RR9 A;  1H7X A;  4W9I A;  2C60 A;  5EE3 A;  1J8C A;  4HCP B;  3M62 B;  2ZZP B;  2KQ7 A;  4NZL B;  1UBI A;  4MGI E;  1F2R I;  1FNV A;  4MT5 A;  2QSD A;  3L13 A;  2G1E A;  1UWX A;  2B76 B;  1T0S C;  1FFU A;  2XK5 B;  5E6J A;  1P1A A;  3SR6 A;  1TBE A;  2WXP A;  3DWG C;  3T8M A;  4OHJ A;  3P63 A;  3B9J A;  3PZ7 A;  2H88 B;  3KW5 B;  4BKS A;  4RGN A;  1E7V A;  1IPG A;  1QKZ A;  4HXD A;  1DOI A;  2BS3 B;  2N1W A;  4HPP A;  3MTN B;  2WHI A;  2CKH B;  1H7W A;  4MM3 A;  1A5R A;  2O6V D;  3DCG A;  4CO7 A;  2IPK D;  5J2R A;  2WXL A;  2JPH A;  1YN5 A;  3RN9 C;  1BUI C;  4MAC A;  4LJP B;  3KYD D;  3T9L A;  1N63 A;  3WA0 A;  1P7F A;  3TUO A;  3ZQ4 A;  1OGW A;  3M63 B;  2KAN A;  5LXH A;  2FBW B;  4I6N B;  4Q2J A;  3RT3 B;  2JZP A;  2LWP A;  3R66 C;  4J3O D;  2R61 A;  1QOA A;  5JXV A;  2MJD A;  1ROE A;  3QAQ A;  1P0R A;  2K9X A;  4HK2 A;  3DVG X;  3OAW A;  4URK A;  4OZA A;  1HXY D;  2JYE A;  3GE8 C;  3H9D A;  3CMM B;  3V61 A;  4ZHO A;  1GB1 A;  4REZ A;  2ZPY A;  1P98 A;  2LGY A;  1T0Q C;  1FRD A;  2N7J A;  2M8S A;  1FRR A;  1VZ7 A;  1Q10 A;  2HE7 A;  2ZCC A;  5CTR C;  1RM6 C;  2EMS A;  4P1B C;  2MX2 A;  4X57 B;  3C19 A;  3R2I A;  2V0G A;  3ZJU A;  5C2T B;  4E3C A;  4KDL B;  3ZNG C;  3A9J A;  2BVC A;  2I2Y A;  2ASQ A;  2L52 A;  4GU2 A;  4RF1 A;  3HIZ A;  2X38 A;  1N5W A;  3MHS D;  2PMV A;  5AZG A;  1PGA A;  2IZV B;  4AJY B;  2INN E;  4L23 A;  4W9H A;  1F77 A;  2C9W B;  2EKI A;  2SEB D;  4J6I A;  1C79 A;  4AQ7 A;  1WJN A;  2WXN A;  4RFB A;  4KSL C;  3W5U B;  1CK1 A;  3Q8B A;  4ZDV A;  1HZ6 A;  1GC6 A;  2L7R A;  3ALB A;  4WQM A;  1TTN A;  2JYT A;  2JWU A;  1JWA D;  3KYC D;  1SBB B;  2QDF A;  1SE9 A;  5AZF A;  3ZIM A;  1JWM D;  3CF6 E;  3ZRC A;  3H8H A;  3ZGZ A;  4M0W A;  2MEK A;  2KK8 A;  1L0Y B;  3QX1 A;  4RMA A;  4FJY A;  3Q6B A;  1QIL A;  5HFY A;  2XBB C;  1Z2M A;  3WAM A;  5E6N A;  2I38 A;  1XLN A;  5DPT A;  1KRH A;  2Y3A A;  4IG7 B;  1V5O A;  2JT4 B;  3MP9 A;  3N1Z C;  2CS4 A;  1T0Y A;  3VR8 B;  1KFY B;  4FHJ A;  2QCZ A;  4EKU A;  1SSN A;  2Z0D B;  4JIO U;  3GE3 C;  1UUP A;  4GGQ A;  3PZD A;  4GMV A;  2MSE D;  2M0X A;  4CQN A;  2QIE B;  1GPX A;  3ZXR A;  4YSX B;  3BZD B;  1FM0 D;  2BB6 A;  1UGM A;  1NBF C;  1MG8 A;  2K6Q A;  3MJ5 A;  4DK5 A;  2HTH A;  3VUW A;  2ICI A;  3GZN I;  5J17 A;  3E56 A;  4A90 A;  4C7Z A;  1R7S A;  1E7P B;  1P9D U;  1XLO A;  2LEK A;  3LYY A;  2DNF A;  2SAK A;  1L6V A;  3BYY B;  3MC8 A;  3P4R B;  4IWP A;  3SD5 A;  1YX6 B;  1EU4 A;  1WH3 A;  2WX1 A;  1H8C A;  1E8Y A;  3QWZ B;  1E6E B;  4B6W A;  5LLI A;  3JW0 X;  1JRO A;  3PHX B;  4DWF A;  5IAA C;  4F1S A;  3HHM A;  2PVO D;  2FUH B;  1RFK A;  4PS8 A;  4NQK E;  3O13 A;  2KFK A;  3V3X A;  3LB8 C;  2AEH A;  2V3N A;  2KX3 A;  2FCQ A;  2K6D B;  2BBC A;  4LNF A;  1WGK A;  2V1Y A;  1FPY A;  3QAR A;  2MP2 B;  4LNO A;  5KHO A;  4LJO B;  4XZ4 A;  1IBX B;  3EUB 2;  1IP9 A;  1FNW A;  2XNA C;  2N9K A;  1HE8 A;  1YNT E;  2D2Q A;  1GT8 A;  3NZ3 A;  4RM9 A;  3P1M A;  2PIA A;  3EFU A;  5BYR A;  2RDG A;  4WH4 A;  4ANU A;  4DHJ B;  3N1X C;  1MG4 A;  4O1N A;  2KN5 A;  2JSV X;  1F9J A;  1IYF A;  3AEF B;  2MBO A;  2N0S B;  4ZOH C;  3KUC B;  3DHH C;  3HVD A;  1DYQ A;  2KJR A;  1B1Z A;  3AE2 B;  3NS1 A;  1CQV A;  3DBH B;  1TGZ B;  3KLS X;  1JML A;  1HZ5 A;  1E90 A;  3ZO5 B;  4KDI C;  3CST A;  3MJW A;  4XDC A;  2IBI B;  2KHW B;  1WE6 A;  2WDV B;  1PGB A;  4DDG D;  2CHX A;  2JU6 X;  4A3O A;  2IJ0 A;  1FNU A;  1X1M A;  1WZ3 A;  3AM9 A;  4ZRQ A;  1GTE A;  4KKJ A;  3PT2 B;  3AEB B;  1TYG B;  2WYQ A;  3AED B;  4ZRK A;  5TSS A;  3APF A;  2RPV A;  2OJW A;  3SEB A;  1NYQ A;  4WJO A;  1WZ0 A;  1TKG A;  2FUG 1;  3PS6 A;  2IGG A;  3DBS A;  3CIR B;  2AL3 A;  1I4G A;  4K7W A;  2EMT A;  1I42 A;  1UGJ A;  3R8B A;  1XLQ A;  4E71 A;  4W9E A;  2LGX A;  3L17 A;  3CF4 A;  1QOF A;  4EZJ A;  3JSV A;  2D5G A;  4GB9 A;  1WGH A;  2Y5C A;  1WF9 A;  2VH1 A;  3QJZ A;  2O2V B;  4NAM A;  4IM2 A;  2MCN B;  1FXA A;  1SJH D;  3VUY A;  5TR5 A;  2NBU A;  2WXO A;  2JQR B;  2WWZ A;  1VRA B;  1JW9 D;  2LXC A;  2AX5 A;  3ZJT A;  3NVZ A;  4C7Y A;  2GBM A;  1SE3 A;  2XEW A;  2EEL A;  3LDZ E;  1NEN B;  4LDT D;  4RNA A;  2IND C;  3Q3O C;  3RUI B;  2CHW A;  2MRP A;  4FN2 A;  4MJS B;  4K1R B;  4C4V A;  3UIP B;  4B0E A;  3RZF A;  1P3Q U;  5LXI B;  1GC7 A;  4FLH A;  2DZK A;  4W9D A;  4YSZ B;  2DBY A;  2AYO B;  3APC A;  2KWU B;  4EUT A;  2RSU A;  2QJL A;  2C5L C;  3AE5 B;  3VRA B;  1V86 A;  3IXS A;  1C1Y B;  1SXT A;  2JUO A;  4HDO A;  1ZE3 D;  1C9F A;  2ZPN A;  2IY0 B;  1RWS A;  1K51 A;  2J42 A;  3FIL A;  2WLB A;  4NY0 A;  3FKY A;  4BKT A;  3IT4 B;  2W3R A;  2FAZ A;  3HVZ A;  4XX5 A;  1ZUD 2;  1E8W A;  3AE7 B;  2QC8 A;  1WR6 E;  3DVN U;  3PLU A;  1TY0 A;  4DHZ E;  2M17 A;  4ACF A;  4KGT A;  3AN1 A;  2BPS A;  1D5X C;  3PLV A;  1L0V B;  1Y8R C;  2KD0 A;  1WGG A;  2L0F A;  2HDE A;  2KXJ A;  3C0R B;  2QEJ C;  4HWI B;  3NVV A;  4G3X B;  1VCB A;  4D2K A;  1SB3 C;  3P4P B;  3ZNH B;  2ZW1 A;  2KTR A;  2NTS A;  3VRB B;  4MDK E;  4ASW C;  1PDX A;  2K0P A;  2MBH A;  3TEZ A;  2MH7 A;  3TSS A;  3N1Y C;  1DOY A;  4LLG M;  1KLV A;  5E6O A;  3A4R A;  1WX7 A;  1KOT A;  2V3S A;  4YXD B;  5L83 A;  3M95 A;  1V2Y A;  1UZX B;  4FXC A;  5BMI A;  5I4D A;  3RI7 C;  1I4H A;  2K25 A;  3Q69 A;  2HJ8 A;  3TJP A;  1Z5S B;  2FIF A;  4WWM A;  3OJ4 B;  2KMC A;  3NG0 A;  4HVB A;  1YD8 U;  2KAC A;  4ZRP A;  4RGO S;  2E6X A;  3EEC A;  2D07 B;  2NBV B;  1SF0 A;  3N32 A;  1T5X D;  1IGC A;  1V80 A;  2KO3 A;  3B08 A;  4OVZ A;  2J52 A;  2ZCB A;  1E0Z A;  2CJO A;  4EZK A;  4BVU C;  2FCS A;  4CHK A;  2N9X A;  3HUI A;  2JZ3 B;  2REX A;  3SFD B;  2Z8L A;  1HQR D;  4JGH B;  1ZKH A;  3OG5 A;  3RNE C;  3NJT A;  2BYF A;  3QQ8 B;  3VUX A;  4C00 A;  2LGI A;  3JYU A;  5FR6 A;  1D3Z A;  2LVO A;  1WXA A;  1GB4 A;  1N62 A;  2PPH A;  3AU4 A;  2RDH A;  2KDI A;  2WXF A;  3A1Q A;  2R2Q A;  3IAS 1;  2LGD A;  2JX5 A;  2WXR A;  5BO4 B;  3BIN A;  1WXQ A;  1WGD A;  3Q8F A;  2OED A;  1WWT A;  1C76 A;  3W2D A;  1ZP0 B;  5IN7 A;  2WDT B;  1V9J A;  3DBR I;  2MQJ A;  4WWP A;  4WJQ A;  4DQO C;  1GG3 A;  2QIL A;  3VXW A;  3DBL B;  1KTK A;  4GIV A;  1QQR A;  4DXA B;  5BYQ A;  4A8X C;  3AE1 B;  3JVZ X;  3DQV A;  1WYG A;  3NVY A;  1C3T A;  2BWF A;  2IO0 B;  4N6E B;  4UDU C;  2NPT A;  4P1C C;  2INP E;  3ONS A;  3W1S C;  2IYD B;  2FCM A;  4WUR A;  4IWQ A;  5AZH A;  1Q1O A;  3H1U A;  4OZB A;  1LGR A;  2O6V B;  1VD2 A;  1U4A A;  2VZK B;  5HHD G;  3M3J A;  1VZ8 A;  1ZGU B;  3Q8E A;  1FCC C;  2WXI A;  3Q3N C;  1SEB D;  1YX5 B;  2DX5 B;  1K52 A;  2BB5 A;  1GAQ B;  2XK5 A;  4IC7 B;  1HTO A;  1G6J A;  3BWU D;  3B0A A;  4ARI A;  1QF6 A;  3U8Z A;  1BXT A;  1YN3 A;  3ECI A;  3V62 A;  3VH4 B;  4KIK B;  2LUM A;  3TMP B;  2PW9 A;  4ANW A;  1YN4 A;  4ANV A;  4KZC A;  2WS3 B;  4EOY A;  4MSQ B;  3VTW A;  2KNB A;  4YT0 B;  3AB5 A;  4EEW A;  1CJE A;  4NJ6 A;  3AE3 B;  4YWG G;  4USA A;  4CYE A;  2LGS A;  2XN9 C;  1ZW7 A;  3RMK C;  5E6P A;  3V05 A;  4RCO A;  2BKF A;  1WRI A;  3DVG Y;  3GOE A;  3ZDT A;  2L05 A;  5JHB A;  2K5P A;  3PSE B;  1SGH A;  3H7P A;  2NS5 A;  5HG2 A;  3UI3 A;  1HEZ E;  2BS4 B;  2LMC A;  3AE8 B;  2G45 B;  1TZO A;  1WYW B;  4W9L A;  2LUE A;  5DCN A;  1FFV A;  4FBJ B;  1UEL A;  2K8H A;  1OQQ A;  5IP4 D;  4MGK E;  2N1V A;  1MJD A;  1ZOY B;  4LNK A;  1FIQ A;  1WMH A;  2DYM A;  3BVZ A;  3PO0 A;  2BYT A;  1D5M C;  1QOG A;  3I9V 1;  1LM8 B;  3APD A;  3OLM D;  4HKQ A;  3R7Q A;  2KJH B;  4TMA B;  4HPM B;  3ZNZ B;  4A9A A;  1C4P A;  3UQA A;  4GDK B;  2IGH A;  3UQB A;  4N9F 4;  1FXT B;  2I1K A;  2MW5 A;  3BVM A;  2LD9 A;  5EDS A;  3H7S A;  4IM3 A;  1MI0 A;  3PTF C;  2GBK A;  2WDR B;  1ZDX A;  4HLE A;  1EO6 A;  5AUI A;  3X23 A;  2X8X X;  1E10 A;  3ZRF A;  1ESF A;  1Q5W B;  3W9C B;  4BZA A;  1JWU D;  3P42 A;  2KDM A;  1WIA A;  3TIX A;  4C56 C;  1ZXI A;  2KC2 A;  3GP7 A;  1V5T A;  4XYC A;  4JWS C;  2NMQ A;  3L10 B;  3P4S B;  1I4R A;  3NZS A;  2JXX A;  3U30 A;  1CMX B;  1WI0 A;  4NNJ B;  2MBQ A;  4XDD A;  2KAJ A;  2K8B A;  2IO3 B;  3LJ3 A;  2K22 A;  3BII D;  1EWC A;  3SU8 X;  3PHW B;  4IKG A;  2E3T A;  3TL5 A;  3D32 A;  3V6E B;  3DHI C;  1WX9 A;  2NCN A;  5D2M B;  2WNM A;  2KVR A;  1EUV B;  3N3K B;  2CR5 A;  4M8N A;  2FE8 A;  2WXQ A;  1WM3 A;  4JX1 C;  3WAL A;  4GLS C;  4EZL A;  1H4R A;  3SDL C;  3KH0 A;  2W82 A;  2AQ2 B;  1FEH A;  1GUA B;  1OQR A;  2N9E B;  3W5V B;  3Q14 C;  1RYJ A;  4WWN A;  4C80 A;  3OJ3 A;  3Q3F A;  2LRW A;  2ZJD A;  4ANX A;  5D7G A;  3A33 B;  2LXA A;  1UF0 A;  3R2T A;  1L7Y A;  2NBW B;  3QIJ A;  2KTF A;  3L54 A;  1YOV B;  2FNJ B;  4GDL B;  3ZJV A;  2C7H A;  2LHD A;  1NI3 A;  2M4N A;  1EF5 A;  2JRH A;  1V1O A;  1RRB A;  1XXG A;  4YTP B;  1AN8 A;  2IO2 B;  3TBL D;  4OW0 A;  1Y56 A;  2OOB B;  2V4I B;  1MPE A;  1TS4 A;  5C23 A;  2MJ3 A;  5BMG A;  1I35 A;  2VH2 A;  1KLU D;  2BW2 A;  3IFW B;  3UIO B;  5FR3 A;  4P16 A;  5C1Z A;  1V49 A;  2L0T A;  4A6Q A;  2ZEQ A;  1IUE A;  3T3N A;  2MBB B;  1KH0 A;  3GS2 A;  4IOI E;  1TY2 A;  4WIP A;  3MHZ A;  1C4C A;  5D6J B;  3IT6 B;  1XCT L;  2PTL A;  2LVP A;  2ZW0 A;  2LAS A;  3PRZ A;  1WRD B;  4DHZ B;  4MEL A;  3Q8A A;  3MFG A;  1QZE A;  4W9J A;  4BOZ B;  1NDD A;  4KSK C;  4BAX A;  4WAA A;  3V6C B;  4GOC A;  2YLM A;  1UBQ A;  1JQ4 A;  2JY6 A;  4II2 B;  1ENF A;  5D3I B;  4ICU A;  3ABV B;  5BYS A;  3AE6 B;  1FCL A;  2KDB A;  2W54 A;  1N61 A;  3L16 A;  2PEA A;  1QT9 A;  2MWS B;  3WAN A;  5T8I A;  1WSP A;  3IHP C;  2GLS A;  3TEX A;  1CZP A;  1JAL A;  4WJN A;  3PZ8 A;  1C78 A;  4PT5 A;  3UF8 A;  1N5X A;  2KC1 A;  1XO3 A;  1E9M A;  2V9H A;  2GOW A;  2MP2 A;  4KGR A;  1IBX A;  3B2G A;  5IO9 A;  2GB1 A;  4K81 A;  2EKE C;  3A9K B;  2KTR B;  2KWV B;  3IAM 1;  1HTQ A;  2K8C A;  2HJ1 A;  4HCN B;  2KT7 A;  1JRU A;  1ISN A;  2IY1 B;  1TKE A;  4XE0 A;  3AXC A;  1AYF A;  3TCA A;  2AQ1 B;  3DPD A;  4NAW B;  2D3B A;  2A4Z A;  3RNG C;  5CHW A;  3KWL A;  1JWB D;  4WQO B;  3VDZ A;  1PQS A;  4W9C A;  4B95 A;  4US9 A;  4HPL B;  2DEN B;  5KHQ A;  4K7U A;  1RFA A;  3Q3M C;  1F0Z A;  2MHJ A;  4LK0 M;  1WXM A;  3VHT C;  3I3T B;  3ZDM C;  3Q3J A;  1T0R C;  4L2Y A;  1S3S G;  5AUK A;  4PS7 A;  3RPF C;  1BML C;  4QAY A;  1XD3 B;  4PK1 A;  1WXS A;  3AV8 A;  3DBH I;  4TQ1 A;  3AEC B;  2WGS A;  1L4D B;  2GBR A;  1N60 A;  2FCN A;  4LDT B;  4R3D A;  2J0J A;  4IWO A;  4JPS A;  1I4X A;  2CU1 A;  3BVG A;  3R3M A;  3EC8 A;  3VQI A;  2PVG C;  3NY5 A;  4ZYN A;  1K8R B;  4MM3 B;  4OVV A;  1S1Q B;  1GJZ A;  1E5W A;  3VAW A;  1NI2 A;  2G4S A;  2WXJ A;  1NVI D;  3QC8 B;  4WWO A;  5D94 A;  2VRR B;  2KFJ A;  1SE4 A;  1OEY A;  3ZW3 A;  1OFF A;  3AU5 A;  4MSM B;  1T3Q A;  1L5P A;  3ZNI D;  3ZVV A;  1PGX A;  1WY8 A;  3VTV A;  2O2V A;  2MA9 B;  1WFY A;  4A55 A;  1YMH E;  3KUZ A;  2J7Q B;  4G11 A;  2CHZ A;  1LQB A;  3URY A;  1XLP A;  2N4F A;  4W9K A;  3I63 C;  3R7R A;  1XCQ L;  1XQQ A;  1V97 A;  2N9P C;  4L1B A;  1TZ1 A;  2C7N B;  1V81 A;  2IO1 B;  3WAP A;  1P7E A;  2KVZ A;  2MJE A;  1B9R A;  4JQW C;  2DLB A;  1D6E C;  4MJS A;  3PRP B;  1SE2 A;  2G9H D;  3S2A A;  1L0X B;  1TIF A;  4TUU A;  4MGY E;  2DYB A;  1T6B X;  2L00 B;  2A5U A;  1XEE A;  1V1P A;  2QHO A;  4NJC A;  1J0G A;  2GMI C;  1UH6 A;  4DDI D;  3A9J B;  1K50 A;  1XT9 B;  2KYW A;  2Q5W D;  3H6N A;  4US8 A;  2BF8 B;  4AS1 A;  3PVL A;  1ACC A;  5BMH A;  2LHE A;  4KZ0 A;  5G2N A;  1YJJ A;  4B0M A;  1Q0W B;  2HTM E;  3PRM B;  2H89 B;  2KX0 A;  1EM7 A;  2WP9 B;  5FKA C;  3ENE A;  2WU5 B;  1YQ4 B;  4XWW A;  2Z0E B;  2G3Q B;  4FUL A;  2KQS A;  4TKN A;  4K7S A;  5IOI A;  2OHF A;  3LXF A;  1C4A A;  2LJI A;  3DWM A;  4GN1 A;  1EWY C;  4DXG A;  2J4X A;  2VZK D;  1VDV A;  5LNK 1;  3U52 E;  1SIJ A;  2LJ5 A;  3FC4 A;  1AWD A;  4YTN B;  4M0W B;  4PS3 A;  3H7P B;  5CHV C;  4FJZ A;  4BBN C;  4ZHP A;  1R4M B;  1PFD A;  2JRI B;  3DHG C;  4JL9 A;  1LXD A;  2J0M A;  5IKC M;  3NOB A;  4II3 B;  4RF0 A;  4ZYS A;  2KQ4 X;  2IGD A;  3QCA A;  1MFW A;  4G50 A;  4WAF A;  5GMV A;  2D3C A;  3ZTC A;  2AQ3 B;  5CX3 A;  2KMA A;  1WMH B;  3GZN B;  3L4P A;  3ML9 A;  2RD0 A;  4HKZ E;  1L4Z B;  1R4N B;  2KWC A;  2L32 A;  4DBG A;  2B3A A;  1PUT A;  4AJW A;  3QHT A;  3U2S C;  3EGR A;  4OVU A;  2PLP A;  1SIF A;  3SFE B;  3I57 A;  4HDQ A;  1ZDV A;  1WX8 A;  2DYO A;  2WQY B;  3KVF B;  2PKO A;  2W9N A;  2V3P A;  1JCK B;  1KLG D;  1YIW A;  3N20 C;  2BGF A;  2N7D A;  1C77 A;  2LZ6 A;  4GXB A;  4HEA 1;  2BWE S;  1K53 A;  5HKH A;  2BT6 A;  4YL8 A;  4M02 A;  1D4B A;  3PV1 A;  4N59 A;  4S0R A;  4AP4 C;  3ZLZ A;  5JH5 C;  3EHV A;  2G4D B;  4A3P A;  2NTT A;  2N9L A;  2WXH A;  4KV2 A;  3DOW A;  4M01 A;  1NEK B;  1GOZ A;  2PE6 B;  2WXG A; 
#chains in the Genus database with same CATH homology
 2WXQ A;  2B76 B;  1FFU A;  4JX1 C;  1NEN B;  2Y5P A;  4GLS C;  5E6J A;  4RNA A;  5EE1 A;  2W82 A;  1GTH A;  2AQ2 B;  1FEH A;  2BYT A;  3SR6 A;  2WXP A;  1OQR A;  5EE0 A;  3W5V B;  3DWG C;  3FAH A;  2M19 A;  1FD6 A;  1XF5 L;  1RYJ A;  4OHJ A;  4C80 A;  3P63 A;  1VJK A;  3B9J A;  2WXM A;  3E9S A;  3PZ7 A;  2H88 B;  1L6U A;  2W55 A;  4XWT A;  5D7G A;  4B0E A;  3R2T A;  4RGN A;  2CJN A;  1QKZ A;  3GB1 A;  4YSZ B;  2DBY A;  4YTM B;  1DOI A;  2BS3 B;  4GDL B;  3ZJV A;  2LHD A;  2QJL A;  1NI3 A;  3U7Z A;  3HRD D;  1H7W A;  3AE5 B;  3VRA B;  4HJG E;  1TKY A;  3IXS A;  1SXT A;  4HRS A;  1C9F A;  1V1O A;  1ZE3 D;  2IPK D;  2WXL A;  1XXG A;  4YTP B;  1AN8 A;  1RWS A;  1YN5 A;  1I4Q A;  4OW0 A;  1BUI C;  1Y56 A;  4MAC A;  4DXF A;  2V4I B;  1K51 A;  1MPE A;  1TS4 A;  2J42 A;  3FIL A;  2L1A A;  2MJ3 A;  1YQ3 B;  1N63 A;  2WLB A;  5BMG A;  3IT4 B;  2W3R A;  3CWI A;  3HVZ A;  1KLU D;  1ZUD 2;  3AE7 B;  1P7F A;  3TUO A;  2BW2 A;  3ZQ4 A;  5FR3 A;  4P16 A;  1TY0 A;  2FBW B;  4Q2J A;  4KGT A;  2JZP A;  3AN1 A;  4A6Q A;  4J3O D;  1IUE A;  3BYT B;  3T3N A;  1D5X C;  1KH0 A;  3GS2 A;  4IOI E;  1TY2 A;  2R61 A;  4WIP A;  1QOA A;  3MHZ A;  1L0V B;  1UWM A;  1C4C A;  5JXV A;  2MJD A;  3IT6 B;  5D3D A;  4YSY B;  2ACZ B;  1ROE A;  1XCT L;  2PTL A;  2ZW0 A;  2K9X A;  5G5H A;  1VZ6 A;  3Q8A A;  3MFG A;  2HDE A;  4OZA A;  2QEJ C;  4JWU C;  1HXY D;  2JYE A;  4ZHO A;  1I7H A;  3NRZ A;  1JQ4 A;  1GB1 A;  1NYR A;  4REZ A;  3NVV A;  2KMM A;  5GXG B;  4D2K A;  1SB3 C;  3P4P B;  2ZW1 A;  1TJE A;  3KWV A;  1ENF A;  2M0A A;  5D3I B;  1FRD A;  2N7J A;  3ABV B;  1FRR A;  2NTS A;  3AE6 B;  2ONQ A;  5BYS A;  1FCL A;  1VZ7 A;  3VRB B;  2W54 A;  1Q10 A;  5H92 C;  1N61 A;  1EU3 A;  1PDX A;  2K0P A;  1J7B A;  1RM6 C;  3TEZ A;  2MH7 A;  3AMZ A;  3TSS A;  1DOY A;  1QT9 A;  4LLG M;  5T8I A;  1WSP A;  3R2I A;  2V0G A;  3ZJU A;  5C2T B;  2ON8 A;  2G1E A;  3TEX A;  1CZP A;  1JAL A;  3PZ8 A;  1C78 A;  4PT5 A;  5MPO A;  1N5X A;  2I2Y A;  4RF1 A;  4YXD B;  1XO3 A;  2L52 A;  1E9M A;  2X38 A;  4FXC A;  5BMI A;  5I4D A;  4KGR A;  2RMM A;  1N5W A;  1I4H A;  2PMV A;  1IBX A;  3Q69 A;  2WXK A;  1PGA A;  3B2G A;  2GB1 A;  2INN E;  4L23 A;  4MH8 A;  1F77 A;  4WWM A;  3IAM 1;  2EKI A;  3P4Q B;  2SEB D;  1C79 A;  1KF6 B;  4AQ7 A;  1V8C A;  2KAC A;  4ZRP A;  2WXN A;  1SJE D;  4RGO S;  1JWS D;  2E6X A;  4JE3 B;  4RFB A;  3W5U B;  1CK1 A;  3VR9 B;  3Q8B A;  1SF0 A;  1STE A;  1T5X D;  1TKE A;  1HZ6 A;  1IGC A;  4XE0 A;  1AYF A;  4WQM A;  4OVZ A;  2AQ1 B;  2J52 A;  2JYT A;  4NAW B;  1MHH E;  2JWU A;  1JWA D;  1I4P A;  5EE9 A;  3EA6 A;  1E0Z A;  1F2R C;  1SBB B;  3KWL A;  2YEP B;  1JWM D;  1ZXH A;  2CJO A;  1JWB D;  1FO4 A;  4P6V F;  3H8H A;  4US9 A;  3ZGZ A;  4M0W A;  3HUI A;  2MEK A;  1L0Y B;  3SFD B;  1YJI A;  2Z8L A;  3W1S A;  1HQR D;  3B2F A;  1F0Z A;  4LK0 M;  3AEA B;  4RGM A;  1QIL A;  5HFY A;  1A70 A;  2WU2 B;  4L2Y A;  5AUK A;  2LGI A;  3RPF C;  1BML C;  1XLN A;  2I38 A;  1KRH A;  2Y3A A;  1D5Z C;  1GB4 A;  3MP9 A;  4TSS A;  1N62 A;  3VR8 B;  1KFY B;  3J9C A;  2RDH A;  3AV8 A;  2WXF A;  1SSN A;  2CU3 A;  4TQ1 A;  3IAS 1;  1UUP A;  3AEC B;  2JX5 A;  2WXR A;  1L4D B;  1WXQ A;  1FMA D;  4CQN A;  2QIE B;  1N60 A;  1GPX A;  3Q8F A;  2OED A;  4R3D A;  2QMT A;  1WWT A;  1ET6 A;  4YSX B;  1C76 A;  3UI3 A;  3W2D A;  1ZP0 B;  4ITK A;  4JPS A;  4ARC A;  1I4X A;  3BVG A;  3BZD B;  1FM0 D;  4KKI A;  4DQO C;  2BB6 A;  5G5G A;  2QIL A;  3VQI A;  2K3U A;  2PVG C;  4TQ0 A;  1KTK A;  1QQR A;  4MM3 B;  5BYQ A;  4A8X C;  2J53 A;  3AE1 B;  2WXJ A;  1NVI D;  1WYG A;  3NVY A;  1M4V A;  4N6E B;  3FIL B;  3MJ5 A;  4UDU C;  2KN4 A;  3ETR A;  4KGS A;  2ICI A;  1SE4 A;  2INP E;  1OFF A;  2GI9 A;  2BTE A;  3E56 A;  4A90 A;  4EE2 A;  4C7Z A;  1T3Q A;  1L5P A;  4WUR A;  1R7S A;  1E7P B;  1PGX A;  2GRI A;  4OZB A;  3KQ4 A;  3T3O A;  1XLO A;  2LEK A;  3LYY A;  2SAK A;  2VZK B;  5HHD G;  4A55 A;  1YMH E;  1L6V A;  1VZ8 A;  2L83 A;  3Q8E A;  3BYY B;  1FCC C;  2LFI A;  1XLP A;  2WXI A;  3URY A;  3N9Y C;  1SEB D;  1K52 A;  3P4R B;  2BB5 A;  4IDI A;  1GAQ B;  1XCQ L;  1V97 A;  4L1B A;  1EU4 A;  3BWU D;  4ARI A;  1QF6 A;  1BXT A;  1YN3 A;  1E6E B;  3BK1 A;  1FXI A;  1P7E A;  1JRO A;  2MJE A;  2LUM A;  1B9R A;  2PW9 A;  2PVO D;  2DLB A;  1RFK A;  3Q8C A;  1D6E C;  1YN4 A;  1SE2 A;  3O13 A;  2G9H D;  3V3X A;  2YEP F;  2KWD A;  2WS3 B;  1L0X B;  3LB8 C;  3WCQ A;  1TS3 A;  5C3J B;  2V3N A;  4YT0 B;  3AB5 A;  1PYW D;  1CJE A;  1T6B X;  1SE3 A;  3AE3 B;  1XEE A;  1V1P A;  4NJC A;  1AW7 A;  2BBC A;  1DGJ A;  4YWG G;  1K50 A;  4USA A;  2Q5W D;  1WGK A;  2XN9 C;  4US8 A;  4H2A A;  4AS1 A;  3V05 A;  1ACC A;  5BMH A;  1JRP A;  2LHE A;  4RCO A;  1QLB B;  2BS2 B;  1IBX B;  1WRI A;  1YJJ A;  3RFZ B;  3EUB 2;  3C8Y A;  4B0M A;  2WDQ B;  2HTM E;  2K5P A;  4OZC A;  1FNW A;  2XNA C;  2H89 B;  2N9K A;  3ZYY X;  3AEG B;  1YNT E;  1EM7 A;  1GT8 A;  3NZ3 A;  5HG2 A;  2WP9 B;  1HEZ E;  2BS4 B;  2LMC A;  3P1M A;  2PIA A;  3AE8 B;  5FKA C;  2WU5 B;  1TZO A;  3AH7 A;  5BYR A;  1YQ4 B;  2RDG A;  4WH4 A;  4XWW A;  1ZPS A;  1FFV A;  4O1N A;  1HA5 A;  2JSV X;  2TSS A;  1OQQ A;  2OHF A;  3AEF B;  2N0S B;  3LXF A;  1V1P B;  1MVK A;  3U4E G;  4ZOH C;  1J7C A;  3NUH B;  1C4A A;  2LJI A;  3DWM A;  2DWQ A;  1DYQ A;  1ZOY B;  3HVD A;  1B1Z A;  1EWY C;  4RH6 A;  3TEW A;  2JXT A;  1FIQ A;  3AE2 B;  3NS1 A;  1CQV A;  4DXG A;  3KLS X;  1JML A;  2DYM A;  2J4X A;  2VZK D;  1VDV A;  3BVZ A;  1D5M C;  3PO0 A;  3U52 E;  5LNK 1;  1QOG A;  1HZ5 A;  1SIJ A;  3BK2 A;  3I9V 1;  3FC4 A;  1AWD A;  4YTN B;  4HKQ A;  1LO5 D;  4TMA B;  4A9A A;  1C4P A;  4ZHP A;  4GDK B;  4XDC A;  2IGH A;  1PFD A;  2M56 B;  3AEE B;  2WDV B;  1PGB A;  3BVM A;  1VLB A;  4RF0 A;  4ZYS A;  1MI0 A;  2KQ4 X;  4N58 A;  3AE9 B;  2IGD A;  2JU6 X;  3OWE B;  4WAF A;  2IJ0 A;  2W3S A;  1IGD A;  1FNU A;  1VR9 A;  2WDR B;  3AM9 A;  2AQ3 B;  1ZDX A;  4HRO A;  5AUI A;  4ZRQ A;  4KX6 B;  4LTU A;  1DOX A;  3L4P A;  1GTE A;  4HKZ E;  5FK9 C;  5H8Y E;  3MC0 B;  1L4Z B;  4KKJ A;  1E10 A;  3AEB B;  1TYG B;  2L32 A;  3TEY A;  3AED B;  1ESF A;  5TSS A;  3W9C B;  1JWU D;  3P42 A;  2KDM A;  1ET9 A;  3AE4 B;  2RPV A;  1UNS A;  1J7A A;  4C56 C;  3SEB A;  1NYQ A;  1PUT A;  1ZXI A;  1TS2 A;  3U2S C;  3EGR A;  1TKG A;  2FUG 1;  2PLP A;  3GP7 A;  3SFE B;  3I57 A;  5HI1 A;  2IGG A;  1ZDV A;  3CIR B;  2DYO A;  2WQY B;  2NMQ A;  2PKO A;  1I4G A;  2V3P A;  4JWS C;  1JCK B;  1KLG D;  3P4S B;  1I4R A;  1UGJ A;  3R8B A;  1XLQ A;  1C77 A;  4HEA 1;  3NVW A;  4RGT A;  3CF4 A;  1QOF A;  1K53 A;  2D5G A;  2BT6 A;  4XDD A;  2KAJ A;  1D4B A;  2Y5C A;  1MHX A;  1QOB A;  1TS5 A;  2K22 A;  4NAM A;  2IDY A;  3BII D;  4N59 A;  1FXA A;  1EWC A;  1H7X A;  1SJH D;  5EE3 A;  4IKG A;  2WXO A;  2E3T A;  2JQR B;  2NTT A;  2N9L A;  2WXH A;  1VRA B;  1JW9 D;  4NZL B;  1NEK B;  2WNM A;  2AX5 A;  1F2R I;  1FNV A;  4MT5 A;  1GOZ A;  3ZJT A;  3NVZ A;  2QSD A;  4C7Y A;  1UWX A;  2FE8 A;  2EEL A;  2WXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...