2H88B

Avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
total genus 71
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h88B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h88B01
3AB5A 1KFYB 2WQYB 1FMAD 1J7CA 2MJDA 3BIID 4YTPB 3NVWA 3AE6B 1QOAA 1TJEA 2JX5A 5AUIA 2L83A 2EKIA 3NVZA 2KMMA 2WP9B 1ZUD2 1JWAD 4JX1C 1WWTA 1A70A 1FXAA 1XLOA 5GXGB 1XLPA 2QJLA 1R7SA 2H89B 5EE1A 1N5XA 5EE0A 1VLBA 1GTEA 5G5GA 1N5WA 1GPXA 1N63A 2CJOA 3CIRB 3AECB 1RFKA 3AH7A 1PUTA 3VR9B 3KWLA 1YQ3B 2BT6A 5H8YE 1N62A 2WDQB 3PO0A 3W5VB 1RM6C 1NEKB 1JALA 5EE3A 1E0ZA 4HROA 1L6UA 3AEFB 1OQQA 1YJIA 4N58A 1QOFA 3ABVB 2M19A 3AE8B 3CF4A 1QF6A 1FFUA 1XLNA 2AX5A 1H7XA 1I7HA 1RYJA 1CJEA 2PVGC 3W9CB 1F0ZA 1JRPA 4JWUC 2M56B 2BS2B 4ZHOA 1ROEA 4HRSA 1L6VA 3AM9A 5H92C 4USAA 4YSXB 2QIEB 1VJKA 1YQ4B 3SFEB 1DOYA 1TKGA 1XO3A 2K5PA 3EUB2 3AE5B 3AEEB 1CZPA 1KRHA 3P4SB 5G5HA 1AWDA 2CU3A 1QLBB 1V97A 2WU5B 1FXIA 1NVID 1QOBA 3AE7B 3AN1A 2PVOD 1QT9A 3DWGC 3NS1A 1JROA 3P4PB 1E6EB 1IUEA 2G1EA 1DOXA 4US9A 3WCQA 5C3JB 4YXDB 1FM0D 1FRDA 3B2GA 2OHFA 1UWMA 2H88B 1GTHA 2MH7A 1N60A 1PDXA 3AV8A 5AUKA 2WU2B 1J7BA 1VDVA 3AMZA 1FFVA 1GT8A 1GAQB 3AE1B 2B76B 4WWMA 4US8A 5C2TB 5MPOA 3FC4A 3DWMA 3AE3B 4C80A 4C7YA 2WDRB 2W55A 3CWIA 2BS4B 2WS3B 3AE4B 1FRRA 2FBWB 1SB3C 1ZXIA 1NYQA 1E9MA 3AE2B 4WQMA 4YSZB 1DGJA 4YSYB 3NVVA 4ZHPA 1T3QA 1DOIA 3NVYA 4YTNB 3VR8B 3NRZA 1TKEA 4YT0B 1N61A 1XLQA 1NENB 1OQRA 4N6EB 2LEKA 1RWSA 3HVZA 3AEDB 3VRBB 1OFFA 1KF6B 1L0VB 1V8CA 1TKYA 2CJNA 2JQRB 2K9XA 2WLBA 3B2FA 3HUIA 4IDIA 3P4QB 2MJ3A 1WYGA 3L4PA 1PFDA 4N59A 3RPFC 1J7AA 2K22A 1JWBD 1E7PB 1WXQA 2BS3B 1FO4A 1TYGB 1QOGA 1WGKA 2MJEA 3AE9B 2N0SB 1ZP0B 1FIQA 1L5PA 4ITKA 2HTME 1NYRA 2ACZB 3ETRA 1H7WA 1NI3A 2DWQA 4P6VF 3SR6A 2PIAA 3P1MA 1B9RA 4FXCA 2W3SA 1E10A 3AEAB 1WRIA 2DBYA 4KX6B 2L52A 2Y5CA 4LTUA 2W54A 5EE9A 4YTMB 1YJJA 3FAHA 1EWYC 4JWSC 4ZOHC 3B9JA 2WDVB 3LB8C 3W5UB 1ZOYB 1AYFA 1SF0A 1SIJA 3P63A 1JQ4A 3AEGB 3SFDB 3VRAB 2W3RA 2Q5WD 3P4RB 4C7ZA 3ZYYX 2PKOA 2KAJA 3LXFA 2E3TA 4A9AA 3AEBB 3HRDD 1JW9D
chains in the Genus database with same CATH superfamily
1TGZB 4HKZE 2WXKA 4E74A 2WP9B 1XF5L 1WXVA 1FXAA 2KDFB 5EE1A 2WXRA 5KHOA 3RYTA 1RFKA 2MRPA 1OEYA 3T8MA 4WJNA 1Q5WB 3CF4A 2WXFA 3N1ZC 1FFUA 4A8XC 5IA7A 1IBXB 1C76A 4BFRA 3A9KA 1V2YA 5J2RA 4ZRKA 3R2TA 2MQJA 1WRDB 4JQWC 4FBJB 1SJED 3DBRB 1KOTA 4LCDE 2KQ4X 2NTSA 4FJYA 1V97A 1R4NI 5AZGA 2GRIA 4A9AA 2LWPA 1E6EB 3VH4B 1WY8A 1ZDVA 2MHJA 4KGSA 3V6CB 2WU2B 5EDSA 3AE1B 4MM3A 3B0AA 3VTUA 4PS3A 1K51A 3L0WB 4WJOA 2KQ7A 4FHJA 2LUEA 4YSYB 1FCLA 2DX5B 2WNMA 4YT0B 1N61A 1C4CA 3U7ZA 1L4DB 2ZPNA 1KF6B 2K9XA 2D3GA 4MH0E 2WGSA 4NNJB 2J52A 1C1YB 1SXTA 3UGBB 2BYTA 1C79A 2HTME 5D6JB 5CHFA 4B6WA 4RF1A 4KX6B 3DHIC 2GBRA 2WXLA 4IOIE 3ALBA 2BBCA 2BYVE 4J6IA 4MEMA 2ZJDA 2J7QB 2PEAA 3BIID 3QAQA 1F2RC 3KYDD 3QX1A 3BVZA 1FXTB 1JWAD 4FADA 1E8ZA 4P7IA 3NZ3A 2IO1B 1FO4A 3VR9B 3W5VB 2IGDA 2V9HA 5IOIA 2M19A 3AE8B 3JYUA 1KLUD 2AX5A 2VH2A 2NTTA 4PT5A 1F0ZA 2BS2B 5CHVC 3QA8A 1E7VA 4RM9A 3SU8X 1ZXHA 4RF0A 3VQIA 5DPTA 2C7MB 3AEEB 4ZRJA 3RNFC 4JIOU 4EUTA 2EMTA 4XX5A 3ZTCA 4GIVA 1WM2A 3R66C 2LI5A 2BYEA 3EFCA 1PDXA 2LVOA 4LNIA 3KWVA 4WWMA 3KQ4A 2KWCA 3FC4A 1Q1OA 2KC1A 4CO7A 4W9JA 1D5XC 2VRRB 2BS4B 2FBWB 4HDQA 1DGJA 2XK5A 4BVUC 5LNK1 1EUVB 1RWSA 1TIFA 3HVZA 2CJNA 1V8CA 4MSMB 4N59A 1PFDA 1UUPA 1EU4A 4EFOA 1WGKA 1V80A 4XE0A 3Q8FA 1I4XA 1K53A 3FILA 2W3SA 4I6PA 2Y5CA 5EE9A 3RUIB 3R7RA 4M0WB 2M1MA 3Q8EA 2G45B 2WDVB 3W5UB 1TT5B 1ZOYB 1WX8A 2VZKD 2I1JA 3GB1A 2N9KA 1GOZA 2E3TA 2N1VA 2MJDA 4FHKA 3BK1A 3RNAC 4BAXA 4LDTD 1GNUA 1TBEA 3I63C 1LQBA 1MHHE 4LJPB 1VCBA 1WJ4A 2CKHB 4H2AA 3PO0A 2WDQB 1K52A 3RNEC 3U52E 1L6UA 1OQQA 2YVCA 1WGYA 1EWCA 2JXTA 1RYJA 2LASA 1JRPA 2RGFA 4ICUA 2Z8LA 3SHQA 1XD3B 5FKAC 4ZHOA 1OEYJ 2LHEA 1WX7A 3M95A 2J0JA 1YX6B 4EZKA 4MACA 1V5TA 1G6JA 1JCKB 3HK0A 3U2SC 4KKIA 3P4PB 2MLBA 2VH1A 1V49A 1YIWA 2L32A 2H88B 3AV8A 5AUKA 3PV1A 4WAAA 4C80A 2W55A 1HA5A 5BYRA 4DBGA 2IPKD 3OJ3A 3IVFA 4IG7B 3RI7C 1DOIA 4HJGE 1WR1A 2AL6A 2I2YA 2WX1A 2G3QB 3B2FA 1WJUA 3HUIA 3PT2B 3P4QB 2KKCA 2HD5B 3RPFC 1YQBA 2KK8A 2KQSA 2KWUB 3N1YC 2FIFA 1TS4A 1B9RA 1A5RA 3TEZA 4IWQA 1YJJA 4DWFA 2A4ZA 5D2MB 2KMCA 1SF0A 3KH0A 3V3XA 4ARCA 4UDUC 2BB5A 4GSWA 4NY0A 5HI1A 5J17A 4K7WA 3HRDD 1RAXA 4RGNA 3MHZA 2VZKB 5G55A 3EC8A 3ML8A 1WH3A 2L83A 3A9JA 2KN5A 1WGGA 1A70A 4BKTA 1STEA 4TUUA 2QCZA 3L17A 4LDTB 2N1WA 3BINA 1Q10A 1YJIA 3U7DA 1TY2A 4WQOB 2JRHA 4BBNC 1XEEA 3GE3C 1ZKHA 2KMAA 2RDGA 3SFEB 4FJZA 4B0MA 1V81A 2V3SA 2WU5B 2BQQA 3V62A 1V6EA 2D07B 3U8ZA 4CYEA 2G1EA 2PW9A 4F8CB 2L3ZA 3M63B 2KT7A 5IO9A 2PMVA 3ZJTA 2WDRB 3CWIA 2FCQA 1V86A 4C4VA 3A1QB 4S0RA 2AQ3B 3ZVVA 3WALA 3RCZA 1U4AA 3NRZA 1OFFA 3IBEA 5BMIA 2EELA 3X23A 2KTRB 2HE7A 4REZA 2L7RA 1C9FA 3WA0A 4WAFA 4NJ7A 1VZ6A 2INDC 2X8XX 4NAWA 3ZLZA 2CHWA 3APCA 4P6VF 2DWQA 2YEPB 1H8CA 1SBBB 4LTUA 1E8XA 1V1OA 4DXFA 4ZOHC 3S2AA 2GI9A 2DAFA 4NZLB 2K3UA 2YEPF 4C7ZA 4NAMA 3DPDA 4HPLB 5LXHA 1WX9A 3AB5A 3KUCB 1J8CA 2DENB 3DVGX 3C19A 3EGRA 1UGJA 2K6QA 2LMCA 3PRPB 5KHQA 2IGHA 3O65B 2LGSA 2IO3B 4Q2JA 1KLVA 3IXSA 1L7YA 1V1PA 2D10A 2BT6A 5H8YE 3GOEA 4K3BA 1YN5A 1XLNA 2K8BA 1CJEA 3VDZA 2X38A 2ZEQA 2UU7A 4A3OA 4EE2A 3RNCC 4USAA 1DOYA 4P16A 1XO3A 1C4PA 2O6VA 1AWDA 1P1AA 4M8NA 1QLBB 2ZCBA 4IWPA 2PVOD 3DVNU 3B2GA 1GTHA 3TSSA 2C7HA 2TSSA 3ML9A 2HTHA 1JWMD 2ZVOA 2ZW1A 3WANA 4C7YA 1SE9A 4A6QA 3AE4B 3SD5A 3IAM1 1T3QA 4K7SA 1UH6A 2LEKA 1GC6A 2KZRA 5CTRC 2BTEA 4IUMB 1WMHA 3PTFC 4DHZB 3L4PA 4OW0A 3J9CA 4KZCA 1NYRA 3WAOA 1GB1A 2J0KA 1MG4A 2MBOA 3N20C 4W9LA 1UELA 3B08A 1EWYC 4W9EA 1HEZE 2KWDA 2QEJC 4D2KA 2SEBD 3ZNID 1BUIC 2KAJA 2JY6A 4KGRA 2NBWB 2LZ6A 4YTPB 5I4DA 1VLBA 4FLHA 4OZBA 3TEXA 1CQVA 3UQBA 3T3NA 1ET6A 2FAZA 2NPTB 3AEFB 4XDCA 4FJVB 5AEKB 2D3BA 2LGYA 3APFA 2FUG1 2LHDA 2MBQA 3GZNI 5BO4B 4KZ0A 5H92C 2KDBA 5DPSA 3JSVB 3HM6X 1HZ6A 1V5OA 1HQRD 1NVID 3AE7B 1QT9A 3NS1A 1JROA 2V3NA 3Q8AA 3ONSA 1LGRA 5E6OA 2ASQA 2DYBA 4R3DA 5DPRA 2RDHA 2WDTB 1PGAA 2Z59B 4WQMA 3MC0B 3ZGZA 1ZGUB 4KVGB 3AEDB 1L0VB 3OJ4B 4IDIA 2BW2A 3N1XC 4W9GA 3MC9A 5BYSA 2KNBA 3HVDA 3NS8A 2N4FA 4EOYA 1E7PB 1NI2A 2KFKB 3DVGY 1MHXA 1JWUD 2QILA 1IGCA 1WJ6A 5HFYA 3ZIMA 1Z5SB 1UWXA 2L52A 1I35A 2RR9A 1N6ZA 2ZW0A 2NMQA 1AYFA 1QZEA 2WWZA 5HKHA 3DCGA 3P4RB 2IZVB 2JYEA 2DZKA 4L1BA 3PRZA 2PPHA 3TMPB 5AUIA 1QOAA 2JX5A 3ZJVA 3KUDB 4HEA1 1MPEA 2KANA 3DOWA 1XLPA 1RFAA 2GMIC 4MT5A 1I4GA 2L00B 1SJHD 2MBBB 3AI5A 3RN9C 1XQQA 3L08A 4M0WA 1R4NB 4N58A 5HHDG 1I7HA 4A90A 4WH4A 1EM7A 1L6VA 2XNAC 3KYCD 4RGMA 1HXYD 2R2QA 4NJCA 5D94A 2LFIA 4LNFA 2JZ3B 3I5JC 3URYA 1T0YA 3P4SB 3Q3OC 3ZW3A 4DXGA 2GLSA 4LNOA 2M8SA 1WGHA 2BKFA 3T3OA 4GDKB 2MW5A 3P2BA 4WURA 2IY0B 2BGFA 5C3JB 3PGEA 1GJZA 1WXSA 5JHBA 3H9DA 1J7BA 5E6NA 2B76B 5JXVA 5L95C 1J0GA 3EFUA 1C78A 1EO6A 2J4XA 1P7FA 3DHHC 4GDLA 4ASWC 2BWES 5BMHA 4JE3B 4AP4C 4G0NB 4ZHPA 2RD0A 4M02A 5HG2A 3PS6A 4URKA 2QMTA 2JQRB 3BYYB 2KOXA 4KSKC 2LD9A 2MX2A 4CHKA 2K22A 1KJTA 1WGDA 3RT3B 2N0SB 2G4DB 2NR2A 1ZDXA 4ANWA 3P1MA 4E71A 4YTMB 3L10B 2KX0A 5C23A 3ZNGC 3DBHI 4M8MA 2EMSA 4MM3B 3QJZA 2ZCCA 3K9OB 4RCOA 3AE6B 3V6EB 4ANUA 4OZAA 1WWTA 4TKNA 2ZNVC 3PLUA 5EE0A 1N5WA 1GPXA 4AOFA 3NOBA 1L0XB 3AH7A 1PUTA 1YOVB 1NEKB 1PQSA 2ONQA 2O2VA 4K1RB 1J19A 3FKYA 3ZXVA 2D3CA 4BBNF 1CK1A 3NJTA 3N30A 3MJWA 3UIPB 4DHJD 4YSXB 2NBVB 2N9XA 1YQ4B 1KM7A 1CZPA 5CX3A 4E3CA 1P7EA 1VZ7A 2DZJA 3DBHB 3N32A 2LRUA 3ZRFA 1R4MI 3DWMA 2G9HD 3APDA 1E8YA 4TV3A 3NY5A 4YSZB 2KYWA 2WXMA 2Z0EB 2XN9C 2RMMA 4HLEA 4KIKA 3Q3NC 4PK1A 5AZFA 1YNTE 2KDMA 2DZMA 4RMAA 4G50A 3RNBC 1ZP0B 1T5XD 1D6EC 4HCPB 3Q3JA 4FXCA 3KVFB 3MJ5A 1SIJA 1HTOA 3LDZE 3AEGB 1FNVA 1ZPSA 4FA6A 5BYQA 3AEBB 3IFWB 1T0QC 4MSQB 1FMAD 1F1HA 2KTRA 1R4MB 4NQLB 3ENEA 3RZWC 2IGGA 3PHWB 2XK5B 5LLIA 2V3PA 2E6XA 1ENFA 3DHGC 2BF8B 1D5ZC 1JALA 2FCMA 3BVMA 1QOFA 2KDEB 1WE7A 2G4SA 3FILB 3R3MA 1QQRA 3PLVA 2FCSA 3PZDA 3ZDMC 1YN3A 1UBQA 2K5PA 3M3JA 1QKZA 4DHJB 2NS5A 3KLSX 4L2YA 5CHWA 3TBLD 1JRUA 5D3IB 1M94A 4GGQA 1FRDA 3M62B 3DDCB 2MH7A 4W9HA 1WGRA 5C2TB 1ACCA 2K0PA 4HCNB 3DBSA 2KVZA 2C60A 1NYQA 3ECIA 2LJ5A 2BB6A 4C00A 2A5UA 4C56C 3SEBA 4WWPA 4YTNB 5E6PA 1BT0A 2C7NB 2JWZA 3PREA 4MJSA 1D5MC 1WFYA 2DLBA 4AS1A 2WXOA 3PRMB 2JU6X 1Q0WB 1JMLA 3AE9B 3Q14C 2PTLA 1FIQA 2V4LA 3D32A 1NBFC 1E10A 1I4PA 2N7JA 3CSFA 3L54A 4I6NB 5IKCM 3LB8C 4NQKE 3I57A 2Q5WD 2WXQA 3ZYYX 4KKJA 4KV2A 2PLPA 3LYYA 4TQ1A 3TEWA 2M0XA 1J7CA 1SGHA 2WHIA 2V1YA 4W9IA 4JLCA 2MP2A 5FK9C 2AQ1B 3DBLI 1C3TA 4PYUA 1SIFA 2I38A 4K3CA 5G5GA 2LUMA 1N63A 3V61A 1WXAA 2L05A 4OHJA 1E0ZA 2KACA 1WZ0A 3EA6A 3QIJA 5JH5C 2KD0A 5L83A 3Q3MC 2PVGC 1ROEA 1IYFA 1WJNA 3AM9A 3GS2A 2BVCA 3AE5B 2OEDA 1XXGA 5G5HA 4ACFA 1P9DU 4W9DA 4BOSC 4B0EA 4US9A 4IW0A 4YXDB 3A9JB 1N60A 1EF5A 3AMZA 4JGHB 3Q6BA 3DBLB 3CF6E 3BWUD 2N9LA 4LNNA 2W82A 2ZVNA 2D3AA 2RPQA 2AWTA 3JSVA 2BYFA 4GOCA 3VXWA 4MGZE 2KX3A 3U30A 1I4HA 3EECA 1GUAB 2JVCA 4MGIE 4HPPA 1IBXA 1JWSD 4WIPA 1WI0A 1NI3A 1S3SG 1P98A 1XCQL 3AEAB 3K9PB 3VAWA 2AQ2B 3WAMA 2LVQA 1TTNA 2KJHB 1JQ4A 3P63A 4CQNA 2UYZB 4BZAA 4YWGG 3NZSA 4ZRQA 1HE8A 2PJHA 2L76A 1JW9D 1KFYB 2WQYB 3H1UA 1P0RA 1D4BA 3VHTC 1YD8U 1VZ8A 1MJDA 2HJ1A 3NVWA 4MGYE 2KMMA 1ZUD2 4C4VB 4ICVA 5GXGB 3PSEB 1R7SA 2ICIA 1N5XA 1BMLC 1TZOA 4DDGD 4HROA 2WYQA 2PE9A 5C1ZA 2JSVX 3ABVB 2NCNA 2EKEC 3BYTB 4A55A 1FNUA 1OGWA 4RH6A 2FNJB 1LXDA 2M56B 2GOWA 4IKGA 3CMMB 2DYOA 2SAKA 1T0RC 2WXPA 1VJKA 4EZLA 1C4AA 1Y56A 4HWIB 2KLGA 3R2IA 2ZPYA 2BWFA 1HZ5A 1IUEA 2D2QA 4BKSD 3TUOA 1YJ1A 2JUOA 2GBNA 4ANVA 1GT8A 5J18A 4LJOB 2DAJA 5D7GA 1E90A 3P42A 4XZ4A 3HIZA 3QWZB 4DHZE 1TS2A 3SDLC 2YLMA 3A33B 1WXMA 3MHSD 1Z2MA 3VR8B 1TKEA 2LXCA 1OQRA 3VRBB 4WJQA 4MDKE 1XT9B 2MJ3A 3HM3A 1SE3A 1LFDA 2INPE 4FULA 3TEYA 1QOGA 2R2OA 3MC8A 1L5PA 2KHWB 4GMVA 4HJKA 2O6VB 1ISNA 1YN4A 5DCNA 1TS5A 3Q3FA 4HK2A 3B9JA 2M0AA 5BMGA 1UZXB 4EEWA 2W3RA 3PPAA 1AW7A 3DQVA 2ZNVB 3LXFA 4KSLC 2ON8A 2DYMA 2PIAA 4ZYNA 4EKUA 2L0TA 3GZNB 3W1SA 1ET9A 1B1ZA 2LRWA 3A4RA 2H89B 3BY4B 2GBJA 3ZNHB 4G11A 2CJOA 4L23A 3CIRB 1F9JA 4A3PA 1WMHB 2Y3AA 4TMAB 2GBMA 2INNE 1PYWD 4RGOS 1L2NA 5FR6A 3H7PB 4MGKE 2INCC 2OOBB 1OTRB 2LGIA 4K81A 4P1CC 2I1KA 2MCNB 4HRSA 3V05A 4WWOA 4DK5A 1L0YB 2W9NA 1EF1A 3IG3A 4S17A 3L13A 1QILA 3PZ8A 1RLFA 1ZE3D 4XYCA 3VUWA 4RNAA 3A4SC 1L4ZB 3VVWB 3VTWA 1FFVA 1VRAB 1TY0A 2CS4A 2CR5A 2XBBC 2N9EB 4F7ZA 4JPSA 2KJRA 2JYTA 5E6JA 3RULA 1D3ZA 2N7EA 2V4IB 4RGTA 2QSDA 2WLBA 1TKYA 3Q8BA 3AXCA 3ZDTA 3OLMD 2MJEA 4MH8A 4X57B 4OZCA 2N9PC 4TSSA 2FIDA 1H7WA 1GC7A 1F77A 1VR9A 2LVPA 1WRIA 2KLCA 3IAS1 2RSUA 2RDBC 4JWSC 1EU3A 2IO0B 2Y5PA 1K50A 3MFGA 3C8YA 4KGTA 4AJYB 4RFBA 2PKOA 2D5GA 2DNFA 3A9KB 2UWQA 3VUYA 1FNWA 1TJEA 3NVZA 1PGBA 2QJLA 2K1FA 5DPWA 3GE8C 3AECB 3TCAA 2CU1A 3BZDB 1FD6A 2V0GA 3N3KB 4ZRPA 3UIOB 4HVBA 5IAAC 3AU4A 4KDLB 4WWNA 3W9CB 2IBIB 4JWUC 2L8JA 2KWVB 4O1NA 3H6NA 3LJ3A 3WAPA 3RNGC 2QDFA 5AZHA 2FUHB 3EUB2 2L1AA 1UNSA 3QHTA 5JHAA 2KXJA 3IHPC 3Q2AC 4A20A 1SE2A 2D11A 2KVRA 3AN1A 4LK0M 3TJPA 3VFKA 2JPHA 2FCNA 3O13A 3NHEB 1FM0D 4M00A 1GAQB 1WYWB 4B9KA 3ZQ4A 1DYQA 3CSTA 2WXNA 4WJPA 4XDDA 3H8HA 1FRRA 3RFZB 4MELA 3Q8CA 3AE2B 1BXTA 4XC2A 1RRBA 2J53A 2JZZA 3W1YA 1K8RB 1TYGB 3ZUNA 1VD2A 2K8HA 5G2NA 4KDIC 3L16A 1E7UA 4PS7A 4F1SA 2MA9B 3ZJUA 2N7DA 3RMKC 3PZ7A 4W9CA 1P3QU 3H7SA 2KFJA 1WIAA 2C5LC 2BPSA 2CHXA 3NG0A 1T0SC 2IY1B 3B1LX 3UI3A 3X0WA 1IGDA 4GU2A 1FCCC 3KW5B 3AULA 1E5WA 4GDLB 2AL3A 4OVUA 1GG3A 4IM2A 3MTNB 3TIXA 1MFWA 1N62A 1RM6C 2WX0A 3A1QA 5FR3A 2WXJA 3V60A 2JWUA 4DDID 1QF6A 3IT6B 4K7UA 1SEBD 2M4NA 4AJWA 1TZ1A 2HJ8A 1TS3A 4XWWA 2PE6B 1SE4A 2BKRB 3C0RB 4XWTA 4HXDA 4FN2A 1LO5D 2AEHA 1QOBA 1KLGD 2JRIB 3UINB 3WCQA 4ANXA 3R8BA 4TQ0A 2AYOB 4M01A 4US8A 1I42A 4HDOA 1IPGA 3AE3B 1F52A 2L0FA 3DVNV 3JW0X 1ZXIA 1SB3C 1OQYA 3HHMA 3W1SC 1E8WA 3QARA 4W9FA 3E56A 4GXBA 2O2VB 1XLQA 1NENB 2GBKA 4N6EB 2R61A 2IDYA 2NBUA 3I3TB 3IT4B 3OAWA 3QK0A 2JXXA 1SSNA 2C9WB 5JZEB 2MBHA 2DBYA 3W2DA 1C77A 2W54A 1NDDA 5TR5A 3FAHA 1AARA 4ARIA 5T8IA 2XEWA 3GP7A 3VRAB 2WXHA 1MG8A 3NUHB 2K8CA 4ZRIA 3TL5A 1V9JA 5LXIB 1ESFA 3QCAA 4JX1C 2LGXA 3WIMA 2RPVA 3ZNZB 2K25A 4PYZA 2GB1A 3KWLA 1YX5B 4KIKB 4NJ6A 3ZTDA 2IJ0A 4NPNA 3VTVA 3JVZX 4IWOA 1YMHE 1S1QB 3UQAA 3KUZA 2LJIA 2B3AA 4B95A 4HPMB 2QIEB 4GN1A 1I4RA 2KO3A 2K6DB 1UGMA 1FXIA 4II2B 2Z0DB 1UBIA 3DWGC 5GMVA 3T9LA 1UF0A 3PHXB 3RD2A 2REXA 3MP9A 5IP4D 1UWMA 4GB9A 2MBEA 3AU5A 1VDVA 4JL9A 5D3DA 3BK2A 2IO2B 5MPOA 3PVLA 2NVUI 2OJRA 2WS3B 1X1MA 2KJ6A 4AUQC 2JT4B 2KDIA 4BKGA 4RM8A 2MEKA 4DXAB 2NPTA 4LLGM 1WR6E 1J7AA 2K39A 3Q69A 1WXQA 2BS3B 1AN8A 4OVZA 2ZZPB 4ITKA 2M17A 3VUXA 2ACZB 3ETRA 2LXAA 4EZJA 3R7QA 4BOZB 4N9F4 4ZDVA 4W9KA 3SFDB 4QAYA 1CMXB 1WM3A 1MVKA 3UF8A 3VH3B 2WXGA 4LNKA 4IM0A 1LM8B 2O6VD 3EHVA 1WE6A 3BVGA 3N9YC 2JZPA 2EKIA 2Y5BB 1PGXA 1XLOA 2J42A 2KN4A 1GTEA 3RZFA 1XCTL 2JF5A 1HTQA 4MJSB 4AWJA 1YQ3B 1F2RI 2MWSB 5EE3A 5TSSA 3OG5A 4I6LB 4GLSC 1KH0A 1H7XA 1Y8RC 2DHZA 1H4RA 2OJWA 2WXIA 1FPYA 1M4VA 1FEHA 3I9V1 2KFKA 1I4QA 4OVVA 1TKGA 5IN7A 2HDEA 1KRHA 1T6BX 2KTFA 4II3B 2CU3A 3QC8B 4XGAB 4P1BC 3QQ8B 4DQOC 1KTKA 3E9SA 2KC2A 1DOXA 3NZUA 4HKQA 2OHFA 2MP2B 4YL8A 4NAWB 2LGDA 2IYDB 3ZO5B 1IP9A 3H7PA 4PS8A 2QC8A 4J3OD 1E9MA 3NVVA 1GB4A 3NVYA 1UD7A 4G3XB 2DZIA 2FE8A 3OWEB 1WYGA 2CHZA 1JWBD 2QHOA 4AQ7A 3ZRCA 3SR6A 4ZYSA 4BKSA 3U4EG 3ZXRA 1ZW7A 1V1PB 4IM3A 1WSPA 3DBRI 1MI0A 2MSED 1WZ3A 3ZKJC 1WF9A 2J0MA 4IC7B 4GDKA
chains in the Genus database with same CATH topology
3AB5A 1FNWA 1FMAD 4HKZE 1TJEA 3EGRA 2WXKA 1UGJA 3NVZA 2LMCA 2WP9B 1PGBA 1XF5L 1FXAA 2IGGA 2IGHA 2QJLA 2WXRA 5EE1A 2V3PA 2E6XA 1ENFA 4Q2JA 3AECB 1RFKA 3IXSA 1V1PA 3BZDB 1D5ZC 2BT6A 5H8YE 1JALA 1FD6A 2V0GA 4ZRPA 3BVMA 1QOFA 3CF4A 1YN5A 2WXFA 1FFUA 4A8XC 1XLNA 1IBXB 1CJEA 3W9CB 4JWUC 1C76A 2X38A 3FILB 1QQRA 4O1NA 4EE2A 4USAA 1YN3A 3R2TA 1DOYA 4P16A 1XO3A 2K5PA 1SJED 2L1AA 3EUB2 1C4PA 1UNSA 1QKZA 2KQ4X 2NTSA 1AWDA 1QLBB 1V97A 3KLSX 4L2YA 1SE2A 3AN1A 4LK0M 2PVOD 5D3IB 2GRIA 3O13A 1E6EB 1FRDA 1ZDVA 1FM0D 3B2GA 1GTHA 2MH7A 4KGSA 3TSSA 2TSSA 2WU2B 1GAQB 3AE1B 1JWMD 3ZQ4A 1DYQA 5C2TB 1ACCA 2K0PA 1K51A 2ZW1A 4C7YA 2WXNA 4A6QA 4XDDA 3H8HA 1FRRA 3AE4B 3RFZB 3Q8CA 1NYQA 3AE2B 4YSYB 2BB6A 3IAM1 1FCLA 1BXTA 1T3QA 4C56C 3SEBA 4YTNB 2WNMA 4YT0B 1N61A 1C4CA 3U7ZA 2LEKA 1D5MC 1L4DB 2BTEA 1KF6B 2K9XA 4AS1A 2DLBA 3L4PA 2J53A 2WXOA 2JU6X 4OW0A 3J9CA 1JMLA 1TYGB 2J52A 3AE9B 1SXTA 2BYTA 2PTLA 1FIQA 1C79A 2HTME 1NYRA 1GB1A 4RF1A 1E10A 1I4PA 4KX6B 2N7JA 3ZJUA 1EWYC 1HEZE 2KWDA 2QEJC 3PZ7A 3LB8C 4D2KA 2SEBD 2WXLA 3I57A 4IOIE 2Q5WD 2WXQA 2BBCA 1BUIC 3ZYYX 3UI3A 4KKJA 2KAJA 2PLPA 3LYYA 4TQ1A 1IGDA 4KGRA 3TEWA 1J7CA 3BIID 1F2RC 1FCCC 4YTPB 5FK9C 3BVZA 2AQ1B 1JWAD 4GDLB 2I38A 5I4DA 1VLBA 5G5GA 4OZBA 2LUMA 3TEXA 3NZ3A 1N63A 1CQVA 3T3NA 1FO4A 3VR9B 3W5VB 1N62A 2IGDA 1RM6C 1ET6A 4OHJA 1E0ZA 5FR3A 2KACA 3AEFB 2WXJA 4XDCA 2JWUA 3EA6A 2M19A 3AE8B 1QF6A 1KLUD 2AX5A 4PT5A 2NTTA 2PVGC 3IT6B 1F0ZA 2FUG1 1SEBD 2LHDA 2BS2B 1ROEA 3AM9A 5H92C 1TS3A 1ZXHA 4XWWA 1SE4A 4RF0A 3VQIA 3GS2A 3AE5B 3AEEB 1HZ6A 2OEDA 4XWTA 1XXGA 5G5HA 1LO5D 1HQRD 1NVID 1QOBA 3AE7B 1KLGD 4B0EA 1QT9A 3NS1A 1JROA 2V3NA 4US9A 3WCQA 4YXDB 3Q8AA 1N60A 1PDXA 3R8BA 3AMZA 4TQ0A 3KWVA 4WWMA 3KQ4A 4US8A 3FC4A 4R3DA 3AE3B 3BWUD 1D5XC 2RDHA 2N9LA 2BS4B 1ZXIA 1SB3C 2FBWB 1PGAA 2W82A 4WQMA 1DGJA 3E56A 3MC0B 3ZGZA 1XLQA 1NENB 5LNK1 4N6EB 1RWSA 2R61A 3AEDB 3HVZA 2IDYA 1L0VB 1V8CA 2CJNA 4IDIA 1I4HA 2BW2A 3IT4B 4N59A 1PFDA 5BYSA 1UUPA 1EU4A 3HVDA 1E7PB 1SSNA 1WGKA 1MHXA 4XE0A 3Q8FA 1IBXA 1I4XA 1JWSD 1K53A 1JWUD 2QILA 4WIPA 1IGCA 1NI3A 3FILA 5HFYA 1XCQL 2W3SA 3AEAB 1UWXA 2DBYA 2L52A 2Y5CA 1C77A 5EE9A 2W54A 3W2DA 4ARIA 3FAHA 2AQ2B 2ZW0A 3Q8EA 5T8IA 2WDVB 3W5UB 2NMQA 1ZOYB 1AYFA 1JQ4A 3P63A 3GP7A 3VRAB 4CQNA 2VZKD 3GB1A 2WXHA 2N9KA 1GOZA 4YWGG 3P4RB 3NUHB 2JYEA 4ZRQA 2E3TA 4L1BA 1JW9D 1KFYB 2WQYB 1ESFA 2MJDA 1D4BA 3BK1A 1VZ8A 3NVWA 5AUIA 1QOAA 2JX5A 3ZJVA 4HEA1 1MPEA 2KMMA 1ZUD2 4JX1C 5GXGB 1XLPA 1R7SA 2ICIA 1N5XA 2RPVA 4MT5A 1I4GA 1BMLC 2GB1A 1TZOA 1MHHE 1SJHD 3KWLA 4H2AA 3PO0A 2WDQB 4M0WA 1K52A 3U52E 4HROA 1L6UA 1OQQA 2JSVX 4N58A 3ABVB 4A55A 3BYTB 1EWCA 1FNUA 4RH6A 2IJ0A 5HHDG 2JXTA 1I7HA 1RYJA 1JRPA 1YMHE 4A90A 2M56B 4IKGA 2Z8LA 2DYOA 4WH4A 1EM7A 2LJIA 2SAKA 5FKAC 4ZHOA 1L6VA 2XNAC 4RGMA 2WXPA 1HXYD 2LHEA 4NJCA 2QIEB 1VJKA 2LFIA 1C4AA 1I4RA 1Y56A 4MACA 3URYA 3P4SB 3R2IA 4DXGA 1FXIA 3T3OA 4GDKB 1JCKB 3U2SC 3DWGC 4KKIA 3P4PB 1HZ5A 1IUEA 4WURA 3TUOA 3MP9A 5C3JB 2L32A 1UWMA 2H88B 3AV8A 5AUKA 1J7BA 1VDVA 1GT8A 5D3DA 3BK2A 2B76B 5JXVA 5MPOA 1C78A 5D7GA 4C80A 2W55A 3P42A 2J4XA 2WS3B 1HA5A 1P7FA 5BYRA 2IPKD 5BMHA 1TS2A 4JE3B 4ZHPA 1DOIA 4HJGE 3VR8B 1TKEA 5HG2A 2I2YA 1OQRA 2MEKA 3VRBB 3B2FA 2QMTA 2JQRB 3BYYB 3HUIA 4LLGM 3P4QB 2MJ3A 1SE3A 3RPFC 2INPE 1J7AA 2K22A 1WXQA 3Q69A 3TEYA 2BS3B 1QOGA 1AN8A 4OVZA 2N0SB 1L5PA 4ITKA 1ZDXA 2ACZB 1TS4A 3ETRA 3P1MA 1YN4A 1B9RA 1TS5A 4YTMB 3TEZA 1YJJA 3B9JA 2M0AA 5BMGA 1SF0A 3V3XA 3SFDB 2W3RA 4ARCA 4UDUC 2BB5A 1AW7A 5HI1A 4MM3B 1MVKA 3LXFA 2WXGA 2ON8A 2DYMA 3HRDD 2PIAA 4RGNA 3MHZA 2VZKB 4RCOA 3AE6B 4OZAA 3BVGA 3N9YC 2JZPA 2EKIA 2L83A 1WWTA 3W1SA 1A70A 1PGXA 1XLOA 1ET9A 1B1ZA 2H89B 2J42A 2KN4A 5EE0A 1GTEA 1N5WA 1GPXA 1L0XB 1XCTL 1STEA 2CJOA 3CIRB 4L23A 3AH7A 1PUTA 1YQ3B 2Y3AA 1F2RI 4TMAB 1NEKB 5EE3A 1Q10A 1YJIA 2INNE 1PYWD 5TSSA 1TY2A 4RGOS 2ONQA 4GLSC 1KH0A 1H7XA 2LGIA 1CK1A 1XEEA 2WXIA 4HRSA 1M4VA 3V05A 1FEHA 3I9V1 2RDGA 1I4QA 4YSXB 1YQ4B 3SFEB 1L0YB 1TKGA 2HDEA 1CZPA 1KRHA 1QILA 1T6BX 3PZ8A 4B0MA 1P7EA 1VZ7A 2CU3A 1ZE3D 2WU5B 4DQOC 2G1EA 1KTKA 3E9SA 1DOXA 2PW9A 4RNAA 4HKQA 2OHFA 1L4ZB 4NAWB 1FFVA 1VRAB 2PMVA 3ZJTA 3DWMA 2G9HD 1TY0A 2WDRB 3CWIA 4J3OD 1E9MA 4YSZB 4JPSA 3NVVA 1GB4A 2AQ3B 2WXMA 2JYTA 3NVYA 5E6JA 3NRZA 2V4IB 2XN9C 4RGTA 2FE8A 2RMMA 3OWEB 1OFFA 2QSDA 2WLBA 1TKYA 5BMIA 2EELA 1WYGA 3Q8BA 4REZA 1JWBD 1C9FA 1YNTE 4WAFA 2MJEA 2KDMA 4MH8A 1VZ6A 1ZP0B 4OZCA 1T5XD 4TSSA 1D6EC 4AQ7A 4P6VF 1H7WA 2DWQA 3SR6A 4ZYSA 1F77A 1VR9A 2YEPB 3U4EG 4FXCA 1SBBB 1V1PB 1WRIA 1WSPA 3IAS1 4LTUA 1MI0A 1V1OA 4JWSC 4DXFA 4ZOHC 3MJ5A 1EU3A 2Y5PA 1SIJA 2GI9A 3AEGB 1K50A 1FNVA 1ZPSA 3C8YA 3MFGA 4KGTA 2K3UA 2YEPF 4NZLB 4C7ZA 4RFBA 4NAMA 5BYQA 2PKOA 2D5GA 4A9AA 3AEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB5 A;  1KFY B;  2WQY B;  1FMA D;  1J7C A;  2MJD A;  3BII D;  4YTP B;  3NVW A;  3AE6 B;  1QOA A;  1TJE A;  2JX5 A;  5AUI A;  2L83 A;  2EKI A;  3NVZ A;  2KMM A;  2WP9 B;  1ZUD 2;  1JWA D;  4JX1 C;  1WWT A;  1A70 A;  1FXA A;  1XLO A;  5GXG B;  1XLP A;  2QJL A;  1R7S A;  2H89 B;  5EE1 A;  1N5X A;  5EE0 A;  1VLB A;  1GTE A;  5G5G A;  1N5W A;  1GPX A;  1N63 A;  2CJO A;  3CIR B;  3AEC B;  1RFK A;  3AH7 A;  1PUT A;  3VR9 B;  3KWL A;  1YQ3 B;  2BT6 A;  5H8Y E;  1N62 A;  2WDQ B;  3PO0 A;  3W5V B;  1RM6 C;  1NEK B;  1JAL A;  5EE3 A;  1E0Z A;  4HRO A;  1L6U A;  3AEF B;  1OQQ A;  1YJI A;  4N58 A;  1QOF A;  3ABV B;  2M19 A;  3AE8 B;  3CF4 A;  1QF6 A;  1FFU A;  1XLN A;  2AX5 A;  1H7X A;  1I7H A;  1RYJ A;  1CJE A;  2PVG C;  3W9C B;  1F0Z A;  1JRP A;  4JWU C;  2M56 B;  2BS2 B;  4ZHO A;  1ROE A;  4HRS A;  1L6V A;  3AM9 A;  5H92 C;  4USA A;  4YSX B;  2QIE B;  1VJK A;  1YQ4 B;  3SFE B;  1DOY A;  1TKG A;  1XO3 A;  2K5P A;  3EUB 2;  3AE5 B;  3AEE B;  1CZP A;  1KRH A;  3P4S B;  5G5H A;  1AWD A;  2CU3 A;  1QLB B;  1V97 A;  2WU5 B;  1FXI A;  1NVI D;  1QOB A;  3AE7 B;  3AN1 A;  2PVO D;  1QT9 A;  3DWG C;  3NS1 A;  1JRO A;  3P4P B;  1E6E B;  1IUE A;  2G1E A;  1DOX A;  4US9 A;  3WCQ A;  5C3J B;  4YXD B;  1FM0 D;  1FRD A;  3B2G A;  2OHF A;  1UWM A;  2H88 B;  1GTH A;  2MH7 A;  1N60 A;  1PDX A;  3AV8 A;  5AUK A;  2WU2 B;  1J7B A;  1VDV A;  3AMZ A;  1FFV A;  1GT8 A;  1GAQ B;  3AE1 B;  2B76 B;  4WWM A;  4US8 A;  5C2T B;  5MPO A;  3FC4 A;  3DWM A;  3AE3 B;  4C80 A;  4C7Y A;  2WDR B;  2W55 A;  3CWI A;  2BS4 B;  2WS3 B;  3AE4 B;  1FRR A;  2FBW B;  1SB3 C;  1ZXI A;  1NYQ A;  1E9M A;  3AE2 B;  4WQM A;  4YSZ B;  1DGJ A;  4YSY B;  3NVV A;  4ZHP A;  1T3Q A;  1DOI A;  3NVY A;  4YTN B;  3VR8 B;  3NRZ A;  1TKE A;  4YT0 B;  1N61 A;  1XLQ A;  1NEN B;  1OQR A;  4N6E B;  2LEK A;  1RWS A;  3HVZ A;  3AED B;  3VRB B;  1OFF A;  1KF6 B;  1L0V B;  1V8C A;  1TKY A;  2CJN A;  2JQR B;  2K9X A;  2WLB A;  3B2F A;  3HUI A;  4IDI A;  3P4Q B;  2MJ3 A;  1WYG A;  3L4P A;  1PFD A;  4N59 A;  3RPF C;  1J7A A;  2K22 A;  1JWB D;  1E7P B;  1WXQ A;  2BS3 B;  1FO4 A;  1TYG B;  1QOG A;  1WGK A;  2MJE A;  3AE9 B;  2N0S B;  1ZP0 B;  1FIQ A;  1L5P A;  4ITK A;  2HTM E;  1NYR A;  2ACZ B;  3ETR A;  1H7W A;  1NI3 A;  2DWQ A;  4P6V F;  3SR6 A;  2PIA A;  3P1M A;  1B9R A;  4FXC A;  2W3S A;  1E10 A;  3AEA B;  1WRI A;  2DBY A;  4KX6 B;  2L52 A;  2Y5C A;  4LTU A;  2W54 A;  5EE9 A;  4YTM B;  1YJJ A;  3FAH A;  1EWY C;  4JWS C;  4ZOH C;  3B9J A;  2WDV B;  3LB8 C;  3W5U B;  1ZOY B;  1AYF A;  1SF0 A;  1SIJ A;  3P63 A;  1JQ4 A;  3AEG B;  3SFD B;  3VRA B;  2W3R A;  2Q5W D;  3P4R B;  4C7Z A;  3ZYY X;  2PKO A;  2KAJ A;  3LXF A;  2E3T A;  4A9A A;  3AEB B;  3HRD D;  1JW9 D; 
#chains in the Genus database with same CATH topology
 1TGZ B;  4HKZ E;  2WXK A;  4E74 A;  2WP9 B;  1XF5 L;  1WXV A;  1FXA A;  2KDF B;  5EE1 A;  2WXR A;  5KHO A;  3RYT A;  1RFK A;  2MRP A;  1OEY A;  3T8M A;  4WJN A;  1Q5W B;  3CF4 A;  2WXF A;  3N1Z C;  1FFU A;  4A8X C;  5IA7 A;  1IBX B;  1C76 A;  4BFR A;  3A9K A;  1V2Y A;  5J2R A;  4ZRK A;  3R2T A;  2MQJ A;  1WRD B;  4JQW C;  4FBJ B;  1SJE D;  3DBR B;  1KOT A;  4LCD E;  2KQ4 X;  2NTS A;  4FJY A;  1V97 A;  1R4N I;  5AZG A;  2GRI A;  4A9A A;  2LWP A;  1E6E B;  3VH4 B;  1WY8 A;  1ZDV A;  2MHJ A;  4KGS A;  3V6C B;  2WU2 B;  5EDS A;  3AE1 B;  4MM3 A;  3B0A A;  3VTU A;  4PS3 A;  1K51 A;  3L0W B;  4WJO A;  2KQ7 A;  4FHJ A;  2LUE A;  4YSY B;  1FCL A;  2DX5 B;  2WNM A;  4YT0 B;  1N61 A;  1C4C A;  3U7Z A;  1L4D B;  2ZPN A;  1KF6 B;  2K9X A;  2D3G A;  4MH0 E;  2WGS A;  4NNJ B;  2J52 A;  1C1Y B;  1SXT A;  3UGB B;  2BYT A;  1C79 A;  2HTM E;  5D6J B;  5CHF A;  4B6W A;  4RF1 A;  4KX6 B;  3DHI C;  2GBR A;  2WXL A;  4IOI E;  3ALB A;  2BBC A;  2BYV E;  4J6I A;  4MEM A;  2ZJD A;  2J7Q B;  2PEA A;  3BII D;  3QAQ A;  1F2R C;  3KYD D;  3QX1 A;  3BVZ A;  1FXT B;  1JWA D;  4FAD A;  1E8Z A;  4P7I A;  3NZ3 A;  2IO1 B;  1FO4 A;  3VR9 B;  3W5V B;  2IGD A;  2V9H A;  5IOI A;  2M19 A;  3AE8 B;  3JYU A;  1KLU D;  2AX5 A;  2VH2 A;  2NTT A;  4PT5 A;  1F0Z A;  2BS2 B;  5CHV C;  3QA8 A;  1E7V A;  4RM9 A;  3SU8 X;  1ZXH A;  4RF0 A;  3VQI A;  5DPT A;  2C7M B;  3AEE B;  4ZRJ A;  3RNF C;  4JIO U;  4EUT A;  2EMT A;  4XX5 A;  3ZTC A;  4GIV A;  1WM2 A;  3R66 C;  2LI5 A;  2BYE A;  3EFC A;  1PDX A;  2LVO A;  4LNI A;  3KWV A;  4WWM A;  3KQ4 A;  2KWC A;  3FC4 A;  1Q1O A;  2KC1 A;  4CO7 A;  4W9J A;  1D5X C;  2VRR B;  2BS4 B;  2FBW B;  4HDQ A;  1DGJ A;  2XK5 A;  4BVU C;  5LNK 1;  1EUV B;  1RWS A;  1TIF A;  3HVZ A;  2CJN A;  1V8C A;  4MSM B;  4N59 A;  1PFD A;  1UUP A;  1EU4 A;  4EFO A;  1WGK A;  1V80 A;  4XE0 A;  3Q8F A;  1I4X A;  1K53 A;  3FIL A;  2W3S A;  4I6P A;  2Y5C A;  5EE9 A;  3RUI B;  3R7R A;  4M0W B;  2M1M A;  3Q8E A;  2G45 B;  2WDV B;  3W5U B;  1TT5 B;  1ZOY B;  1WX8 A;  2VZK D;  2I1J A;  3GB1 A;  2N9K A;  1GOZ A;  2E3T A;  2N1V A;  2MJD A;  4FHK A;  3BK1 A;  3RNA C;  4BAX A;  4LDT D;  1GNU A;  1TBE A;  3I63 C;  1LQB A;  1MHH E;  4LJP B;  1VCB A;  1WJ4 A;  2CKH B;  4H2A A;  3PO0 A;  2WDQ B;  1K52 A;  3RNE C;  3U52 E;  1L6U A;  1OQQ A;  2YVC A;  1WGY A;  1EWC A;  2JXT A;  1RYJ A;  2LAS A;  1JRP A;  2RGF A;  4ICU A;  2Z8L A;  3SHQ A;  1XD3 B;  5FKA C;  4ZHO A;  1OEY J;  2LHE A;  1WX7 A;  3M95 A;  2J0J A;  1YX6 B;  4EZK A;  4MAC A;  1V5T A;  1G6J A;  1JCK B;  3HK0 A;  3U2S C;  4KKI A;  3P4P B;  2MLB A;  2VH1 A;  1V49 A;  1YIW A;  2L32 A;  2H88 B;  3AV8 A;  5AUK A;  3PV1 A;  4WAA A;  4C80 A;  2W55 A;  1HA5 A;  5BYR A;  4DBG A;  2IPK D;  3OJ3 A;  3IVF A;  4IG7 B;  3RI7 C;  1DOI A;  4HJG E;  1WR1 A;  2AL6 A;  2I2Y A;  2WX1 A;  2G3Q B;  3B2F A;  1WJU A;  3HUI A;  3PT2 B;  3P4Q B;  2KKC A;  2HD5 B;  3RPF C;  1YQB A;  2KK8 A;  2KQS A;  2KWU B;  3N1Y C;  2FIF A;  1TS4 A;  1B9R A;  1A5R A;  3TEZ A;  4IWQ A;  1YJJ A;  4DWF A;  2A4Z A;  5D2M B;  2KMC A;  1SF0 A;  3KH0 A;  3V3X A;  4ARC A;  4UDU C;  2BB5 A;  4GSW A;  4NY0 A;  5HI1 A;  5J17 A;  4K7W A;  3HRD D;  1RAX A;  4RGN A;  3MHZ A;  2VZK B;  5G55 A;  3EC8 A;  3ML8 A;  1WH3 A;  2L83 A;  3A9J A;  2KN5 A;  1WGG A;  1A70 A;  4BKT A;  1STE A;  4TUU A;  2QCZ A;  3L17 A;  4LDT B;  2N1W A;  3BIN A;  1Q10 A;  1YJI A;  3U7D A;  1TY2 A;  4WQO B;  2JRH A;  4BBN C;  1XEE A;  3GE3 C;  1ZKH A;  2KMA A;  2RDG A;  3SFE B;  4FJZ A;  4B0M A;  1V81 A;  2V3S A;  2WU5 B;  2BQQ A;  3V62 A;  1V6E A;  2D07 B;  3U8Z A;  4CYE A;  2G1E A;  2PW9 A;  4F8C B;  2L3Z A;  3M63 B;  2KT7 A;  5IO9 A;  2PMV A;  3ZJT A;  2WDR B;  3CWI A;  2FCQ A;  1V86 A;  4C4V A;  3A1Q B;  4S0R A;  2AQ3 B;  3ZVV A;  3WAL A;  3RCZ A;  1U4A A;  3NRZ A;  1OFF A;  3IBE A;  5BMI A;  2EEL A;  3X23 A;  2KTR B;  2HE7 A;  4REZ A;  2L7R A;  1C9F A;  3WA0 A;  4WAF A;  4NJ7 A;  1VZ6 A;  2IND C;  2X8X X;  4NAW A;  3ZLZ A;  2CHW A;  3APC A;  4P6V F;  2DWQ A;  2YEP B;  1H8C A;  1SBB B;  4LTU A;  1E8X A;  1V1O A;  4DXF A;  4ZOH C;  3S2A A;  2GI9 A;  2DAF A;  4NZL B;  2K3U A;  2YEP F;  4C7Z A;  4NAM A;  3DPD A;  4HPL B;  5LXH A;  1WX9 A;  3AB5 A;  3KUC B;  1J8C A;  2DEN B;  3DVG X;  3C19 A;  3EGR A;  1UGJ A;  2K6Q A;  2LMC A;  3PRP B;  5KHQ A;  2IGH A;  3O65 B;  2LGS A;  2IO3 B;  4Q2J A;  1KLV A;  3IXS A;  1L7Y A;  1V1P A;  2D10 A;  2BT6 A;  5H8Y E;  3GOE A;  4K3B A;  1YN5 A;  1XLN A;  2K8B A;  1CJE A;  3VDZ A;  2X38 A;  2ZEQ A;  2UU7 A;  4A3O A;  4EE2 A;  3RNC C;  4USA A;  1DOY A;  4P16 A;  1XO3 A;  1C4P A;  2O6V A;  1AWD A;  1P1A A;  4M8N A;  1QLB B;  2ZCB A;  4IWP A;  2PVO D;  3DVN U;  3B2G A;  1GTH A;  3TSS A;  2C7H A;  2TSS A;  3ML9 A;  2HTH A;  1JWM D;  2ZVO A;  2ZW1 A;  3WAN A;  4C7Y A;  1SE9 A;  4A6Q A;  3AE4 B;  3SD5 A;  3IAM 1;  1T3Q A;  4K7S A;  1UH6 A;  2LEK A;  1GC6 A;  2KZR A;  5CTR C;  2BTE A;  4IUM B;  1WMH A;  3PTF C;  4DHZ B;  3L4P A;  4OW0 A;  3J9C A;  4KZC A;  1NYR A;  3WAO A;  1GB1 A;  2J0K A;  1MG4 A;  2MBO A;  3N20 C;  4W9L A;  1UEL A;  3B08 A;  1EWY C;  4W9E A;  1HEZ E;  2KWD A;  2QEJ C;  4D2K A;  2SEB D;  3ZNI D;  1BUI C;  2KAJ A;  2JY6 A;  4KGR A;  2NBW B;  2LZ6 A;  4YTP B;  5I4D A;  1VLB A;  4FLH A;  4OZB A;  3TEX A;  1CQV A;  3UQB A;  3T3N A;  1ET6 A;  2FAZ A;  2NPT B;  3AEF B;  4XDC A;  4FJV B;  5AEK B;  2D3B A;  2LGY A;  3APF A;  2FUG 1;  2LHD A;  2MBQ A;  3GZN I;  5BO4 B;  4KZ0 A;  5H92 C;  2KDB A;  5DPS A;  3JSV B;  3HM6 X;  1HZ6 A;  1V5O A;  1HQR D;  1NVI D;  3AE7 B;  1QT9 A;  3NS1 A;  1JRO A;  2V3N A;  3Q8A A;  3ONS A;  1LGR A;  5E6O A;  2ASQ A;  2DYB A;  4R3D A;  5DPR A;  2RDH A;  2WDT B;  1PGA A;  2Z59 B;  4WQM A;  3MC0 B;  3ZGZ A;  1ZGU B;  4KVG B;  3AED B;  1L0V B;  3OJ4 B;  4IDI A;  2BW2 A;  3N1X C;  4W9G A;  3MC9 A;  5BYS A;  2KNB A;  3HVD A;  3NS8 A;  2N4F A;  4EOY A;  1E7P B;  1NI2 A;  2KFK B;  3DVG Y;  1MHX A;  1JWU D;  2QIL A;  1IGC A;  1WJ6 A;  5HFY A;  3ZIM A;  1Z5S B;  1UWX A;  2L52 A;  1I35 A;  2RR9 A;  1N6Z A;  2ZW0 A;  2NMQ A;  1AYF A;  1QZE A;  2WWZ A;  5HKH A;  3DCG A;  3P4R B;  2IZV B;  2JYE A;  2DZK A;  4L1B A;  3PRZ A;  2PPH A;  3TMP B;  5AUI A;  1QOA A;  2JX5 A;  3ZJV A;  3KUD B;  4HEA 1;  1MPE A;  2KAN A;  3DOW A;  1XLP A;  1RFA A;  2GMI C;  4MT5 A;  1I4G A;  2L00 B;  1SJH D;  2MBB B;  3AI5 A;  3RN9 C;  1XQQ A;  3L08 A;  4M0W A;  1R4N B;  4N58 A;  5HHD G;  1I7H A;  4A90 A;  4WH4 A;  1EM7 A;  1L6V A;  2XNA C;  3KYC D;  4RGM A;  1HXY D;  2R2Q A;  4NJC A;  5D94 A;  2LFI A;  4LNF A;  2JZ3 B;  3I5J C;  3URY A;  1T0Y A;  3P4S B;  3Q3O C;  3ZW3 A;  4DXG A;  2GLS A;  4LNO A;  2M8S A;  1WGH A;  2BKF A;  3T3O A;  4GDK B;  2MW5 A;  3P2B A;  4WUR A;  2IY0 B;  2BGF A;  5C3J B;  3PGE A;  1GJZ A;  1WXS A;  5JHB A;  3H9D A;  1J7B A;  5E6N A;  2B76 B;  5JXV A;  5L95 C;  1J0G A;  3EFU A;  1C78 A;  1EO6 A;  2J4X A;  1P7F A;  3DHH C;  4GDL A;  4ASW C;  2BWE S;  5BMH A;  4JE3 B;  4AP4 C;  4G0N B;  4ZHP A;  2RD0 A;  4M02 A;  5HG2 A;  3PS6 A;  4URK A;  2QMT A;  2JQR B;  3BYY B;  2KOX A;  4KSK C;  2LD9 A;  2MX2 A;  4CHK A;  2K22 A;  1KJT A;  1WGD A;  3RT3 B;  2N0S B;  2G4D B;  2NR2 A;  1ZDX A;  4ANW A;  3P1M A;  4E71 A;  4YTM B;  3L10 B;  2KX0 A;  5C23 A;  3ZNG C;  3DBH I;  4M8M A;  2EMS A;  4MM3 B;  3QJZ A;  2ZCC A;  3K9O B;  4RCO A;  3AE6 B;  3V6E B;  4ANU A;  4OZA A;  1WWT A;  4TKN A;  2ZNV C;  3PLU A;  5EE0 A;  1N5W A;  1GPX A;  4AOF A;  3NOB A;  1L0X B;  3AH7 A;  1PUT A;  1YOV B;  1NEK B;  1PQS A;  2ONQ A;  2O2V A;  4K1R B;  1J19 A;  3FKY A;  3ZXV A;  2D3C A;  4BBN F;  1CK1 A;  3NJT A;  3N30 A;  3MJW A;  3UIP B;  4DHJ D;  4YSX B;  2NBV B;  2N9X A;  1YQ4 B;  1KM7 A;  1CZP A;  5CX3 A;  4E3C A;  1P7E A;  1VZ7 A;  2DZJ A;  3DBH B;  3N32 A;  2LRU A;  3ZRF A;  1R4M I;  3DWM A;  2G9H D;  3APD A;  1E8Y A;  4TV3 A;  3NY5 A;  4YSZ B;  2KYW A;  2WXM A;  2Z0E B;  2XN9 C;  2RMM A;  4HLE A;  4KIK A;  3Q3N C;  4PK1 A;  5AZF A;  1YNT E;  2KDM A;  2DZM A;  4RMA A;  4G50 A;  3RNB C;  1ZP0 B;  1T5X D;  1D6E C;  4HCP B;  3Q3J A;  4FXC A;  3KVF B;  3MJ5 A;  1SIJ A;  1HTO A;  3LDZ E;  3AEG B;  1FNV A;  1ZPS A;  4FA6 A;  5BYQ A;  3AEB B;  3IFW B;  1T0Q C;  4MSQ B;  1FMA D;  1F1H A;  2KTR A;  1R4M B;  4NQL B;  3ENE A;  3RZW C;  2IGG A;  3PHW B;  2XK5 B;  5LLI A;  2V3P A;  2E6X A;  1ENF A;  3DHG C;  2BF8 B;  1D5Z C;  1JAL A;  2FCM A;  3BVM A;  1QOF A;  2KDE B;  1WE7 A;  2G4S A;  3FIL B;  3R3M A;  1QQR A;  3PLV A;  2FCS A;  3PZD A;  3ZDM C;  1YN3 A;  1UBQ A;  2K5P A;  3M3J A;  1QKZ A;  4DHJ B;  2NS5 A;  3KLS X;  4L2Y A;  5CHW A;  3TBL D;  1JRU A;  5D3I B;  1M94 A;  4GGQ A;  1FRD A;  3M62 B;  3DDC B;  2MH7 A;  4W9H A;  1WGR A;  5C2T B;  1ACC A;  2K0P A;  4HCN B;  3DBS A;  2KVZ A;  2C60 A;  1NYQ A;  3ECI A;  2LJ5 A;  2BB6 A;  4C00 A;  2A5U A;  4C56 C;  3SEB A;  4WWP A;  4YTN B;  5E6P A;  1BT0 A;  2C7N B;  2JWZ A;  3PRE A;  4MJS A;  1D5M C;  1WFY A;  2DLB A;  4AS1 A;  2WXO A;  3PRM B;  2JU6 X;  1Q0W B;  1JML A;  3AE9 B;  3Q14 C;  2PTL A;  1FIQ A;  2V4L A;  3D32 A;  1NBF C;  1E10 A;  1I4P A;  2N7J A;  3CSF A;  3L54 A;  4I6N B;  5IKC M;  3LB8 C;  4NQK E;  3I57 A;  2Q5W D;  2WXQ A;  3ZYY X;  4KKJ A;  4KV2 A;  2PLP A;  3LYY A;  4TQ1 A;  3TEW A;  2M0X A;  1J7C A;  1SGH A;  2WHI A;  2V1Y A;  4W9I A;  4JLC A;  2MP2 A;  5FK9 C;  2AQ1 B;  3DBL I;  1C3T A;  4PYU A;  1SIF A;  2I38 A;  4K3C A;  5G5G A;  2LUM A;  1N63 A;  3V61 A;  1WXA A;  2L05 A;  4OHJ A;  1E0Z A;  2KAC A;  1WZ0 A;  3EA6 A;  3QIJ A;  5JH5 C;  2KD0 A;  5L83 A;  3Q3M C;  2PVG C;  1ROE A;  1IYF A;  1WJN A;  3AM9 A;  3GS2 A;  2BVC A;  3AE5 B;  2OED A;  1XXG A;  5G5H A;  4ACF A;  1P9D U;  4W9D A;  4BOS C;  4B0E A;  4US9 A;  4IW0 A;  4YXD B;  3A9J B;  1N60 A;  1EF5 A;  3AMZ A;  4JGH B;  3Q6B A;  3DBL B;  3CF6 E;  3BWU D;  2N9L A;  4LNN A;  2W82 A;  2ZVN A;  2D3A A;  2RPQ A;  2AWT A;  3JSV A;  2BYF A;  4GOC A;  3VXW A;  4MGZ E;  2KX3 A;  3U30 A;  1I4H A;  3EEC A;  1GUA B;  2JVC A;  4MGI E;  4HPP A;  1IBX A;  1JWS D;  4WIP A;  1WI0 A;  1NI3 A;  1S3S G;  1P98 A;  1XCQ L;  3AEA B;  3K9P B;  3VAW A;  2AQ2 B;  3WAM A;  2LVQ A;  1TTN A;  2KJH B;  1JQ4 A;  3P63 A;  4CQN A;  2UYZ B;  4BZA A;  4YWG G;  3NZS A;  4ZRQ A;  1HE8 A;  2PJH A;  2L76 A;  1JW9 D;  1KFY B;  2WQY B;  3H1U A;  1P0R A;  1D4B A;  3VHT C;  1YD8 U;  1VZ8 A;  1MJD A;  2HJ1 A;  3NVW A;  4MGY E;  2KMM A;  1ZUD 2;  4C4V B;  4ICV A;  5GXG B;  3PSE B;  1R7S A;  2ICI A;  1N5X A;  1BML C;  1TZO A;  4DDG D;  4HRO A;  2WYQ A;  2PE9 A;  5C1Z A;  2JSV X;  3ABV B;  2NCN A;  2EKE C;  3BYT B;  4A55 A;  1FNU A;  1OGW A;  4RH6 A;  2FNJ B;  1LXD A;  2M56 B;  2GOW A;  4IKG A;  3CMM B;  2DYO A;  2SAK A;  1T0R C;  2WXP A;  1VJK A;  4EZL A;  1C4A A;  1Y56 A;  4HWI B;  2KLG A;  3R2I A;  2ZPY A;  2BWF A;  1HZ5 A;  1IUE A;  2D2Q A;  4BKS D;  3TUO A;  1YJ1 A;  2JUO A;  2GBN A;  4ANV A;  1GT8 A;  5J18 A;  4LJO B;  2DAJ A;  5D7G A;  1E90 A;  3P42 A;  4XZ4 A;  3HIZ A;  3QWZ B;  4DHZ E;  1TS2 A;  3SDL C;  2YLM A;  3A33 B;  1WXM A;  3MHS D;  1Z2M A;  3VR8 B;  1TKE A;  2LXC A;  1OQR A;  3VRB B;  4WJQ A;  4MDK E;  1XT9 B;  2MJ3 A;  3HM3 A;  1SE3 A;  1LFD A;  2INP E;  4FUL A;  3TEY A;  1QOG A;  2R2O A;  3MC8 A;  1L5P A;  2KHW B;  4GMV A;  4HJK A;  2O6V B;  1ISN A;  1YN4 A;  5DCN A;  1TS5 A;  3Q3F A;  4HK2 A;  3B9J A;  2M0A A;  5BMG A;  1UZX B;  4EEW A;  2W3R A;  3PPA A;  1AW7 A;  3DQV A;  2ZNV B;  3LXF A;  4KSL C;  2ON8 A;  2DYM A;  2PIA A;  4ZYN A;  4EKU A;  2L0T A;  3GZN B;  3W1S A;  1ET9 A;  1B1Z A;  2LRW A;  3A4R A;  2H89 B;  3BY4 B;  2GBJ A;  3ZNH B;  4G11 A;  2CJO A;  4L23 A;  3CIR B;  1F9J A;  4A3P A;  1WMH B;  2Y3A A;  4TMA B;  2GBM A;  2INN E;  1PYW D;  4RGO S;  1L2N A;  5FR6 A;  3H7P B;  4MGK E;  2INC C;  2OOB B;  1OTR B;  2LGI A;  4K81 A;  4P1C C;  2I1K A;  2MCN B;  4HRS A;  3V05 A;  4WWO A;  4DK5 A;  1L0Y B;  2W9N A;  1EF1 A;  3IG3 A;  4S17 A;  3L13 A;  1QIL A;  3PZ8 A;  1RLF A;  1ZE3 D;  4XYC A;  3VUW A;  4RNA A;  3A4S C;  1L4Z B;  3VVW B;  3VTW A;  1FFV A;  1VRA B;  1TY0 A;  2CS4 A;  2CR5 A;  2XBB C;  2N9E B;  4F7Z A;  4JPS A;  2KJR A;  2JYT A;  5E6J A;  3RUL A;  1D3Z A;  2N7E A;  2V4I B;  4RGT A;  2QSD A;  2WLB A;  1TKY A;  3Q8B A;  3AXC A;  3ZDT A;  3OLM D;  2MJE A;  4MH8 A;  4X57 B;  4OZC A;  2N9P C;  4TSS A;  2FID A;  1H7W A;  1GC7 A;  1F77 A;  1VR9 A;  2LVP A;  1WRI A;  2KLC A;  3IAS 1;  2RSU A;  2RDB C;  4JWS C;  1EU3 A;  2IO0 B;  2Y5P A;  1K50 A;  3MFG A;  3C8Y A;  4KGT A;  4AJY B;  4RFB A;  2PKO A;  2D5G A;  2DNF A;  3A9K B;  2UWQ A;  3VUY A;  1FNW A;  1TJE A;  3NVZ A;  1PGB A;  2QJL A;  2K1F A;  5DPW A;  3GE8 C;  3AEC B;  3TCA A;  2CU1 A;  3BZD B;  1FD6 A;  2V0G A;  3N3K B;  4ZRP A;  3UIO B;  4HVB A;  5IAA C;  3AU4 A;  4KDL B;  4WWN A;  3W9C B;  2IBI B;  4JWU C;  2L8J A;  2KWV B;  4O1N A;  3H6N A;  3LJ3 A;  3WAP A;  3RNG C;  2QDF A;  5AZH A;  2FUH B;  3EUB 2;  2L1A A;  1UNS A;  3QHT A;  5JHA A;  2KXJ A;  3IHP C;  3Q2A C;  4A20 A;  1SE2 A;  2D11 A;  2KVR A;  3AN1 A;  4LK0 M;  3TJP A;  3VFK A;  2JPH A;  2FCN A;  3O13 A;  3NHE B;  1FM0 D;  4M00 A;  1GAQ B;  1WYW B;  4B9K A;  3ZQ4 A;  1DYQ A;  3CST A;  2WXN A;  4WJP A;  4XDD A;  3H8H A;  1FRR A;  3RFZ B;  4MEL A;  3Q8C A;  3AE2 B;  1BXT A;  4XC2 A;  1RRB A;  2J53 A;  2JZZ A;  3W1Y A;  1K8R B;  1TYG B;  3ZUN A;  1VD2 A;  2K8H A;  5G2N A;  4KDI C;  3L16 A;  1E7U A;  4PS7 A;  4F1S A;  2MA9 B;  3ZJU A;  2N7D A;  3RMK C;  3PZ7 A;  4W9C A;  1P3Q U;  3H7S A;  2KFJ A;  1WIA A;  2C5L C;  2BPS A;  2CHX A;  3NG0 A;  1T0S C;  2IY1 B;  3B1L X;  3UI3 A;  3X0W A;  1IGD A;  4GU2 A;  1FCC C;  3KW5 B;  3AUL A;  1E5W A;  4GDL B;  2AL3 A;  4OVU A;  1GG3 A;  4IM2 A;  3MTN B;  3TIX A;  1MFW A;  1N62 A;  1RM6 C;  2WX0 A;  3A1Q A;  5FR3 A;  2WXJ A;  3V60 A;  2JWU A;  4DDI D;  1QF6 A;  3IT6 B;  4K7U A;  1SEB D;  2M4N A;  4AJW A;  1TZ1 A;  2HJ8 A;  1TS3 A;  4XWW A;  2PE6 B;  1SE4 A;  2BKR B;  3C0R B;  4XWT A;  4HXD A;  4FN2 A;  1LO5 D;  2AEH A;  1QOB A;  1KLG D;  2JRI B;  3UIN B;  3WCQ A;  4ANX A;  3R8B A;  4TQ0 A;  2AYO B;  4M01 A;  4US8 A;  1I42 A;  4HDO A;  1IPG A;  3AE3 B;  1F52 A;  2L0F A;  3DVN V;  3JW0 X;  1ZXI A;  1SB3 C;  1OQY A;  3HHM A;  3W1S C;  1E8W A;  3QAR A;  4W9F A;  3E56 A;  4GXB A;  2O2V B;  1XLQ A;  1NEN B;  2GBK A;  4N6E B;  2R61 A;  2IDY A;  2NBU A;  3I3T B;  3IT4 B;  3OAW A;  3QK0 A;  2JXX A;  1SSN A;  2C9W B;  5JZE B;  2MBH A;  2DBY A;  3W2D A;  1C77 A;  2W54 A;  1NDD A;  5TR5 A;  3FAH A;  1AAR A;  4ARI A;  5T8I A;  2XEW A;  3GP7 A;  3VRA B;  2WXH A;  1MG8 A;  3NUH B;  2K8C A;  4ZRI A;  3TL5 A;  1V9J A;  5LXI B;  1ESF A;  3QCA A;  4JX1 C;  2LGX A;  3WIM A;  2RPV A;  3ZNZ B;  2K25 A;  4PYZ A;  2GB1 A;  3KWL A;  1YX5 B;  4KIK B;  4NJ6 A;  3ZTD A;  2IJ0 A;  4NPN A;  3VTV A;  3JVZ X;  4IWO A;  1YMH E;  1S1Q B;  3UQA A;  3KUZ A;  2LJI A;  2B3A A;  4B95 A;  4HPM B;  2QIE B;  4GN1 A;  1I4R A;  2KO3 A;  2K6D B;  1UGM A;  1FXI A;  4II2 B;  2Z0D B;  1UBI A;  3DWG C;  5GMV A;  3T9L A;  1UF0 A;  3PHX B;  3RD2 A;  2REX A;  3MP9 A;  5IP4 D;  1UWM A;  4GB9 A;  2MBE A;  3AU5 A;  1VDV A;  4JL9 A;  5D3D A;  3BK2 A;  2IO2 B;  5MPO A;  3PVL A;  2NVU I;  2OJR A;  2WS3 B;  1X1M A;  2KJ6 A;  4AUQ C;  2JT4 B;  2KDI A;  4BKG A;  4RM8 A;  2MEK A;  4DXA B;  2NPT A;  4LLG M;  1WR6 E;  1J7A A;  2K39 A;  3Q69 A;  1WXQ A;  2BS3 B;  1AN8 A;  4OVZ A;  2ZZP B;  4ITK A;  2M17 A;  3VUX A;  2ACZ B;  3ETR A;  2LXA A;  4EZJ A;  3R7Q A;  4BOZ B;  4N9F 4;  4ZDV A;  4W9K A;  3SFD B;  4QAY A;  1CMX B;  1WM3 A;  1MVK A;  3UF8 A;  3VH3 B;  2WXG A;  4LNK A;  4IM0 A;  1LM8 B;  2O6V D;  3EHV A;  1WE6 A;  3BVG A;  3N9Y C;  2JZP A;  2EKI A;  2Y5B B;  1PGX A;  1XLO A;  2J42 A;  2KN4 A;  1GTE A;  3RZF A;  1XCT L;  2JF5 A;  1HTQ A;  4MJS B;  4AWJ A;  1YQ3 B;  1F2R I;  2MWS B;  5EE3 A;  5TSS A;  3OG5 A;  4I6L B;  4GLS C;  1KH0 A;  1H7X A;  1Y8R C;  2DHZ A;  1H4R A;  2OJW A;  2WXI A;  1FPY A;  1M4V A;  1FEH A;  3I9V 1;  2KFK A;  1I4Q A;  4OVV A;  1TKG A;  5IN7 A;  2HDE A;  1KRH A;  1T6B X;  2KTF A;  4II3 B;  2CU3 A;  3QC8 B;  4XGA B;  4P1B C;  3QQ8 B;  4DQO C;  1KTK A;  3E9S A;  2KC2 A;  1DOX A;  3NZU A;  4HKQ A;  2OHF A;  2MP2 B;  4YL8 A;  4NAW B;  2LGD A;  2IYD B;  3ZO5 B;  1IP9 A;  3H7P A;  4PS8 A;  2QC8 A;  4J3O D;  1E9M A;  3NVV A;  1GB4 A;  3NVY A;  1UD7 A;  4G3X B;  2DZI A;  2FE8 A;  3OWE B;  1WYG A;  2CHZ A;  1JWB D;  2QHO A;  4AQ7 A;  3ZRC A;  3SR6 A;  4ZYS A;  4BKS A;  3U4E G;  3ZXR A;  1ZW7 A;  1V1P B;  4IM3 A;  1WSP A;  3DBR I;  1MI0 A;  2MSE D;  1WZ3 A;  3ZKJ C;  1WF9 A;  2J0M A;  4IC7 B;  4GDK A; 
#chains in the Genus database with same CATH homology
 3AB5 A;  1FNW A;  1FMA D;  4HKZ E;  1TJE A;  3EGR A;  2WXK A;  1UGJ A;  3NVZ A;  2LMC A;  2WP9 B;  1PGB A;  1XF5 L;  1FXA A;  2IGG A;  2IGH A;  2QJL A;  2WXR A;  5EE1 A;  2V3P A;  2E6X A;  1ENF A;  4Q2J A;  3AEC B;  1RFK A;  3IXS A;  1V1P A;  3BZD B;  1D5Z C;  2BT6 A;  5H8Y E;  1JAL A;  1FD6 A;  2V0G A;  4ZRP A;  3BVM A;  1QOF A;  3CF4 A;  1YN5 A;  2WXF A;  1FFU A;  4A8X C;  1XLN A;  1IBX B;  1CJE A;  3W9C B;  4JWU C;  1C76 A;  2X38 A;  3FIL B;  1QQR A;  4O1N A;  4EE2 A;  4USA A;  1YN3 A;  3R2T A;  1DOY A;  4P16 A;  1XO3 A;  2K5P A;  1SJE D;  2L1A A;  3EUB 2;  1C4P A;  1UNS A;  1QKZ A;  2KQ4 X;  2NTS A;  1AWD A;  1QLB B;  1V97 A;  3KLS X;  4L2Y A;  1SE2 A;  3AN1 A;  4LK0 M;  2PVO D;  5D3I B;  2GRI A;  3O13 A;  1E6E B;  1FRD A;  1ZDV A;  1FM0 D;  3B2G A;  1GTH A;  2MH7 A;  4KGS A;  3TSS A;  2TSS A;  2WU2 B;  1GAQ B;  3AE1 B;  1JWM D;  3ZQ4 A;  1DYQ A;  5C2T B;  1ACC A;  2K0P A;  1K51 A;  2ZW1 A;  4C7Y A;  2WXN A;  4A6Q A;  4XDD A;  3H8H A;  1FRR A;  3AE4 B;  3RFZ B;  3Q8C A;  1NYQ A;  3AE2 B;  4YSY B;  2BB6 A;  3IAM 1;  1FCL A;  1BXT A;  1T3Q A;  4C56 C;  3SEB A;  4YTN B;  2WNM A;  4YT0 B;  1N61 A;  1C4C A;  3U7Z A;  2LEK A;  1D5M C;  1L4D B;  2BTE A;  1KF6 B;  2K9X A;  4AS1 A;  2DLB A;  3L4P A;  2J53 A;  2WXO A;  2JU6 X;  4OW0 A;  3J9C A;  1JML A;  1TYG B;  2J52 A;  3AE9 B;  1SXT A;  2BYT A;  2PTL A;  1FIQ A;  1C79 A;  2HTM E;  1NYR A;  1GB1 A;  4RF1 A;  1E10 A;  1I4P A;  4KX6 B;  2N7J A;  3ZJU A;  1EWY C;  1HEZ E;  2KWD A;  2QEJ C;  3PZ7 A;  3LB8 C;  4D2K A;  2SEB D;  2WXL A;  3I57 A;  4IOI E;  2Q5W D;  2WXQ A;  2BBC A;  1BUI C;  3ZYY X;  3UI3 A;  4KKJ A;  2KAJ A;  2PLP A;  3LYY A;  4TQ1 A;  1IGD A;  4KGR A;  3TEW A;  1J7C A;  3BII D;  1F2R C;  1FCC C;  4YTP B;  5FK9 C;  3BVZ A;  2AQ1 B;  1JWA D;  4GDL B;  2I38 A;  5I4D A;  1VLB A;  5G5G A;  4OZB A;  2LUM A;  3TEX A;  3NZ3 A;  1N63 A;  1CQV A;  3T3N A;  1FO4 A;  3VR9 B;  3W5V B;  1N62 A;  2IGD A;  1RM6 C;  1ET6 A;  4OHJ A;  1E0Z A;  5FR3 A;  2KAC A;  3AEF B;  2WXJ A;  4XDC A;  2JWU A;  3EA6 A;  2M19 A;  3AE8 B;  1QF6 A;  1KLU D;  2AX5 A;  4PT5 A;  2NTT A;  2PVG C;  3IT6 B;  1F0Z A;  2FUG 1;  1SEB D;  2LHD A;  2BS2 B;  1ROE A;  3AM9 A;  5H92 C;  1TS3 A;  1ZXH A;  4XWW A;  1SE4 A;  4RF0 A;  3VQI A;  3GS2 A;  3AE5 B;  3AEE B;  1HZ6 A;  2OED A;  4XWT A;  1XXG A;  5G5H A;  1LO5 D;  1HQR D;  1NVI D;  1QOB A;  3AE7 B;  1KLG D;  4B0E A;  1QT9 A;  3NS1 A;  1JRO A;  2V3N A;  4US9 A;  3WCQ A;  4YXD B;  3Q8A A;  1N60 A;  1PDX A;  3R8B A;  3AMZ A;  4TQ0 A;  3KWV A;  4WWM A;  3KQ4 A;  4US8 A;  3FC4 A;  4R3D A;  3AE3 B;  3BWU D;  1D5X C;  2RDH A;  2N9L A;  2BS4 B;  1ZXI A;  1SB3 C;  2FBW B;  1PGA A;  2W82 A;  4WQM A;  1DGJ A;  3E56 A;  3MC0 B;  3ZGZ A;  1XLQ A;  1NEN B;  5LNK 1;  4N6E B;  1RWS A;  2R61 A;  3AED B;  3HVZ A;  2IDY A;  1L0V B;  1V8C A;  2CJN A;  4IDI A;  1I4H A;  2BW2 A;  3IT4 B;  4N59 A;  1PFD A;  5BYS A;  1UUP A;  1EU4 A;  3HVD A;  1E7P B;  1SSN A;  1WGK A;  1MHX A;  4XE0 A;  3Q8F A;  1IBX A;  1I4X A;  1JWS D;  1K53 A;  1JWU D;  2QIL A;  4WIP A;  1IGC A;  1NI3 A;  3FIL A;  5HFY A;  1XCQ L;  2W3S A;  3AEA B;  1UWX A;  2DBY A;  2L52 A;  2Y5C A;  1C77 A;  5EE9 A;  2W54 A;  3W2D A;  4ARI A;  3FAH A;  2AQ2 B;  2ZW0 A;  3Q8E A;  5T8I A;  2WDV B;  3W5U B;  2NMQ A;  1ZOY B;  1AYF A;  1JQ4 A;  3P63 A;  3GP7 A;  3VRA B;  4CQN A;  2VZK D;  3GB1 A;  2WXH A;  2N9K A;  1GOZ A;  4YWG G;  3P4R B;  3NUH B;  2JYE A;  4ZRQ A;  2E3T A;  4L1B A;  1JW9 D;  1KFY B;  2WQY B;  1ESF A;  2MJD A;  1D4B A;  3BK1 A;  1VZ8 A;  3NVW A;  5AUI A;  1QOA A;  2JX5 A;  3ZJV A;  4HEA 1;  1MPE A;  2KMM A;  1ZUD 2;  4JX1 C;  5GXG B;  1XLP A;  1R7S A;  2ICI A;  1N5X A;  2RPV A;  4MT5 A;  1I4G A;  1BML C;  2GB1 A;  1TZO A;  1MHH E;  1SJH D;  3KWL A;  4H2A A;  3PO0 A;  2WDQ B;  4M0W A;  1K52 A;  3U52 E;  4HRO A;  1L6U A;  1OQQ A;  2JSV X;  4N58 A;  3ABV B;  4A55 A;  3BYT B;  1EWC A;  1FNU A;  4RH6 A;  2IJ0 A;  5HHD G;  2JXT A;  1I7H A;  1RYJ A;  1JRP A;  1YMH E;  4A90 A;  2M56 B;  4IKG A;  2Z8L A;  2DYO A;  4WH4 A;  1EM7 A;  2LJI A;  2SAK A;  5FKA C;  4ZHO A;  1L6V A;  2XNA C;  4RGM A;  2WXP A;  1HXY D;  2LHE A;  4NJC A;  2QIE B;  1VJK A;  2LFI A;  1C4A A;  1I4R A;  1Y56 A;  4MAC A;  3URY A;  3P4S B;  3R2I A;  4DXG A;  1FXI A;  3T3O A;  4GDK B;  1JCK B;  3U2S C;  3DWG C;  4KKI A;  3P4P B;  1HZ5 A;  1IUE A;  4WUR A;  3TUO A;  3MP9 A;  5C3J B;  2L32 A;  1UWM A;  2H88 B;  3AV8 A;  5AUK A;  1J7B A;  1VDV A;  1GT8 A;  5D3D A;  3BK2 A;  2B76 B;  5JXV A;  5MPO A;  1C78 A;  5D7G A;  4C80 A;  2W55 A;  3P42 A;  2J4X A;  2WS3 B;  1HA5 A;  1P7F A;  5BYR A;  2IPK D;  5BMH A;  1TS2 A;  4JE3 B;  4ZHP A;  1DOI A;  4HJG E;  3VR8 B;  1TKE A;  5HG2 A;  2I2Y A;  1OQR A;  2MEK A;  3VRB B;  3B2F A;  2QMT A;  2JQR B;  3BYY B;  3HUI A;  4LLG M;  3P4Q B;  2MJ3 A;  1SE3 A;  3RPF C;  2INP E;  1J7A A;  2K22 A;  1WXQ A;  3Q69 A;  3TEY A;  2BS3 B;  1QOG A;  1AN8 A;  4OVZ A;  2N0S B;  1L5P A;  4ITK A;  1ZDX A;  2ACZ B;  1TS4 A;  3ETR A;  3P1M A;  1YN4 A;  1B9R A;  1TS5 A;  4YTM B;  3TEZ A;  1YJJ A;  3B9J A;  2M0A A;  5BMG A;  1SF0 A;  3V3X A;  3SFD B;  2W3R A;  4ARC A;  4UDU C;  2BB5 A;  1AW7 A;  5HI1 A;  4MM3 B;  1MVK A;  3LXF A;  2WXG A;  2ON8 A;  2DYM A;  3HRD D;  2PIA A;  4RGN A;  3MHZ A;  2VZK B;  4RCO A;  3AE6 B;  4OZA A;  3BVG A;  3N9Y C;  2JZP A;  2EKI A;  2L83 A;  1WWT A;  3W1S A;  1A70 A;  1PGX A;  1XLO A;  1ET9 A;  1B1Z A;  2H89 B;  2J42 A;  2KN4 A;  5EE0 A;  1GTE A;  1N5W A;  1GPX A;  1L0X B;  1XCT L;  1STE A;  2CJO A;  3CIR B;  4L23 A;  3AH7 A;  1PUT A;  1YQ3 B;  2Y3A A;  1F2R I;  4TMA B;  1NEK B;  5EE3 A;  1Q10 A;  1YJI A;  2INN E;  1PYW D;  5TSS A;  1TY2 A;  4RGO S;  2ONQ A;  4GLS C;  1KH0 A;  1H7X A;  2LGI A;  1CK1 A;  1XEE A;  2WXI A;  4HRS A;  1M4V A;  3V05 A;  1FEH A;  3I9V 1;  2RDG A;  1I4Q A;  4YSX B;  1YQ4 B;  3SFE B;  1L0Y B;  1TKG A;  2HDE A;  1CZP A;  1KRH A;  1QIL A;  1T6B X;  3PZ8 A;  4B0M A;  1P7E A;  1VZ7 A;  2CU3 A;  1ZE3 D;  2WU5 B;  4DQO C;  2G1E A;  1KTK A;  3E9S A;  1DOX A;  2PW9 A;  4RNA A;  4HKQ A;  2OHF A;  1L4Z B;  4NAW B;  1FFV A;  1VRA B;  2PMV A;  3ZJT A;  3DWM A;  2G9H D;  1TY0 A;  2WDR B;  3CWI A;  4J3O D;  1E9M A;  4YSZ B;  4JPS A;  3NVV A;  1GB4 A;  2AQ3 B;  2WXM A;  2JYT A;  3NVY A;  5E6J A;  3NRZ A;  2V4I B;  2XN9 C;  4RGT A;  2FE8 A;  2RMM A;  3OWE B;  1OFF A;  2QSD A;  2WLB A;  1TKY A;  5BMI A;  2EEL A;  1WYG A;  3Q8B A;  4REZ A;  1JWB D;  1C9F A;  1YNT E;  4WAF A;  2MJE A;  2KDM A;  4MH8 A;  1VZ6 A;  1ZP0 B;  4OZC A;  1T5X D;  4TSS A;  1D6E C;  4AQ7 A;  4P6V F;  1H7W A;  2DWQ A;  3SR6 A;  4ZYS A;  1F77 A;  1VR9 A;  2YEP B;  3U4E G;  4FXC A;  1SBB B;  1V1P B;  1WRI A;  1WSP A;  3IAS 1;  4LTU A;  1MI0 A;  1V1O A;  4JWS C;  4DXF A;  4ZOH C;  3MJ5 A;  1EU3 A;  2Y5P A;  1SIJ A;  2GI9 A;  3AEG B;  1K50 A;  1FNV A;  1ZPS A;  3C8Y A;  3MFG A;  4KGT A;  2K3U A;  2YEP F;  4NZL B;  4C7Z A;  4RFB A;  4NAM A;  5BYQ A;  2PKO A;  2D5G A;  4A9A A;  3AEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...