2H88B

Avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 71
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h88B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h88B01
1EWYC 1XLOA 3AE8B 1WRIA 1TKYA 5EE1A 3ABVB 2H88B 2BS3B 3ZYYX 4US9A 2QJLA 1FM0D 1GPXA 3AE6B 4YT0B 3NVZA 4N58A 4ZHOA 5EE3A 1A70A 1YQ4B 4HROA 1L6UA 3VRAB 2W3RA 3WCQA 4YSZB 4YTMB 2CU3A 1QOFA 2WU2B 3AV8A 2PIAA 1NYRA 2AX5A 2WLBA 3RPFC 1OQQA 2DBYA 5C2TB 2DWQA 1E10A 3AMZA 3P4RB 1QT9A 2G1EA 1N63A 1T3QA 3HVZA 3AEBB 1E7PB 1ZXIA 4USAA 1J7BA 3B2FA 1ROEA 3W9CB 5EE9A 2W54A 1H7XA 3NVYA 1DGJA 3AECB 4YTPB 1QOAA 1SF0A 1V97A 3VRBB 4YSXB 1KF6B 2M56B 3SR6A 1B9RA 4JWSC 1PFDA 1JW9D 1N62A 2JQRB 3AN1A 3P1MA 4ZHPA 4WQMA 3PO0A 3AE2B 2LEKA 3AE1B 5EE0A 4N59A 1OFFA 2KMMA 5GXGB 3CIRB 1XO3A 2HTME 3AEEB 1JRPA 1NENB 3AB5A 2WDRB 3CF4A 1JQ4A 1NEKB 1JROA 3AEAB 1N60A 1OQRA 1SIJA 1VDVA 3CWIA 4JX1C 2EKIA 5AUIA 5G5GA 3B2GA 4N6EB 2H89B 1JALA 1JWAD 3NRZA 5AUKA 1GT8A 2Q5WD 3B9JA 1I7HA 1FFUA 2PVGC 1ZP0B 3DWMA 5H92C 1WXQA 1FMAD 1ZUD2 2L52A 1N5XA 5H8YE 1QOBA 4YTNB 3P63A 4C7YA 2B76B 2WDQB 1FXIA 1PUTA 3DWGC 1J7CA 1AWDA 1TKGA 1XLQA 2M19A 4KX6B 1ZOYB 2N0SB 3NVWA 5C3JB 4US8A 2FBWB 1UWMA 3NVVA 1J7AA 1NI3A 2BT6A 3ETRA 3KWLA 1TJEA 4C7ZA 4WWMA 1E9MA 1CZPA 3AEDB 1AYFA 1DOXA 1L6VA 1E6EB 2WDVB 1RYJA 1VLBA 2K22A 3P4SB 2OHFA 2JX5A 3FC4A 1E0ZA 2KAJA 1FRRA 1R7SA 4C80A 3AE3B 3FAHA 3W5VB 1H7WA 1L0VB 3AE4B 2K5PA 1XLPA 2Y5CA 3HUIA 3NS1A 2MJEA 3P4PB 4FXCA 1GAQB 2WQYB 3VR8B 1FFVA 1TYGB 1FRDA 4A9AA 3AEGB 1WWTA 2WU5B 4ZOHC 2L83A 3AE5B 4P6VF 1GTEA 2WP9B 3SFDB 1JWBD 1YJIA 2W3SA 3SFEB 1KRHA 3AE9B 1NYQA 1F0ZA 3P4QB 1PDXA 4IDIA 3LB8C 3BIID 2CJNA 1FIQA 3AEFB 5MPOA 4HRSA 1XLNA 1IUEA 1N61A 3L4PA 2ACZB 1KFYB 1WGKA 1GTHA 3LXFA 1QLBB 3EUB2 1DOIA 1RFKA 2CJOA 1NVID 2WS3B 4LTUA 2BS2B 2PVOD 2E3TA 4ITKA 1RM6C 5G5HA 1N5WA 1L5PA 1V8CA 4YSYB 3HRDD 1VJKA 1SB3C 1RWSA 3VR9B 2MJDA 3W5UB 1QF6A 1QOGA 1YQ3B 1WYGA 1CJEA 1YJJA 2BS4B 3AE7B 2W55A 1FXAA 2K9XA 1TKEA 3AM9A 2PKOA 4JWUC 1FO4A 1DOYA 2MJ3A 2QIEB 3AH7A 2MH7A 4YXDB
chains in the Genus database with same CATH superfamily
4WWNA 3ZYYX 3NVZA 4G11A 1UWXA 4PS8A 1ZGUB 3RNCC 2J42A 4K3CA 3RPFC 2L0TA 5BO4B 4KZ0A 3Q8FA 4GMVA 3WANA 1GB1A 4IM3A 2JZPA 2WX1A 3W1SA 1N62A 2VZKB 2BBCA 4G50A 3V60A 2HTME 2C7NB 4LDTD 2I1KA 2WXLA 3JSVA 1E8XA 4B0MA 2EKIA 4GDLB 2O2VA 4WWOA 2V4IB 1WY8A 5BYSA 1JWUD 2IO2B 1TY2A 1TKGA 2IO1B 1ZOYB 2N0SB 1T0RC 4I6NB 2L8JA 1WJUA 1KLVA 2WGSA 3ETRA 2V9HA 1F77A 2KZRA 1L6VA 4RH6A 1OGWA 2XBBC 4YL8A 2REXA 2AQ3B 3NS1A 3Q3JA 4KZCA 1IBXB 3VR8B 5JH5C 1C4CA 3BK2A 4KSLC 4MT5A 3MFGA 1P9DU 4MEMA 2KVRA 4KKIA 3Q2AC 2KX0A 2BW2A 2MSED 3PLUA 2V3PA 3VHTC 3GP7A 2LASA 2KTFA 3H7PA 3ZJTA 1SE9A 1H4RA 4REZA 2MH7A 1TS2A 3KYCD 2WXJA 2QJLA 1FM0D 4WWPA 1WMHB 1YQ4B 4S17A 4WJNA 1GG3A 2LVQA 3LYYA 3TUOA 2W3RA 4DWFA 5L83A 3IXSA 1SJED 2PIAA 1RLFA 2K25A 4K1RB 2V4LA 1F52A 3P4RB 4LNKA 1WR1A 1E7PB 2DAFA 1AN8A 5IO9A 4KGTA 3NVYA 2KJ6A 1X1MA 2V0GA 3L13A 1BXTA 3DBRB 3NZSA 3AE2B 3L08A 2ZCCA 4N59A 2KMMA 4B95A 5GXGB 5KHOA 4ZRPA 1NENB 3AI5A 4KDIC 1QILA 1YJ1A 1T0YA 5G5GA 3IT6B 1V5OA 3MHSD 3B9JA 5JHAA 4RCOA 3TEZA 4LLGM 4B9KA 1V9JA 2KDEB 2M19A 3R2IA 2SEBD 2KHWB 1E9MA 2BB5A 4XWWA 4O1NA 1VR9A 2BWES 1XQQA 3P4SB 2N7EA 2KAJA 3A9JB 1L0VB 1BT0A 2L76A 1V1PB 5BYQA 3ZW3A 1MVKA 4MSQB 5DPWA 1YX5B 2L83A 3RUIB 2GI9A 1KRHA 1NYQA 4M0WA 3P4QB 3LB8C 2WYQA 3AEFB 1M94A 1IUEA 1KOTA 3U52E 2XK5A 1VZ8A 3NY5A 1HQRD 1AARA 2KT7A 5FR6A 2Y5BB 4ANUA 4AWJA 2E6XA 2PVOD 2CS4A 4BKGA 2ICIA 3VR9B 3GB1A 3PTFC 1TBEA 1KJTA 3ZNHB 1SGHA 4M01A 1WZ0A 2AL6A 3QARA 1VCBA 1YQBA 3GZNI 1S1QB 3AE8B 3AXCA 4FA6A 1UGMA 1ZPSA 3NZ3A 1H8CA 3RNFC 2KFKB 4YTMB 2JPHA 2AX5A 4KGSA 2IZVB 4TMAB 4OZBA 4RM8A 1N63A 1R4NB 2ON8A 2KDMA 3J9CA 3R7QA 4HCPB 1TZOA 2W54A 2TSSA 4YSXB 2C60A 2FUG1 1PFDA 1UNSA 4MGZE 1D3ZA 1WJ6A 4IOIE 1E8WA 2JXXA 2A5UA 2W9NA 1V2YA 3ZNID 3AU5A 3CF4A 3U7ZA 3BYYB 3W5VB 3RT3B 4FJVB 4K7SA 4BFRA 4XZ4A 2PVGC 1I42A 4IWPA 1K51A 3ZRFA 3DWGC 2LGIA 2A4ZA 2KK8A 2CHXA 2M0XA 1VZ6A 3Q6BA 1DOXA 3MJWA 2HJ8A 3NJTA 2BF8B 2ASQA 3K9OB 1A5RA 4C4VA 2DZKA 2PE6B 3PRPB 1ZXHA 5DPSA 3KWVA 3VTWA 2W82A 2D3AA 4KKJA 2KNBA 1TGZB 3T8MA 2RSUA 3W5UB 4HKQA 5TR5A 1SJHD 1HXYD 1SE4A 2WXIA 2G45B 3EC8A 2MJ3A 1ZDXA 3A1QB 3M3JA 4XDDA 3A4SC 3ALBA 1CMXB 4FHKA 4ZRKA 3EFUA 3HM6X 1V1OA 3DVNV 5C2TB 3R3MA 2RPVA 1WGRA 2GMIC 2CHWA 3AEBB 4USAA 2WHIA 2WNMA 3B2FA 2AYOB 2NS5A 4GDKA 4OVVA 5EE9A 3VRBB 4ZDVA 4MSMB 1JW9D 3EFCA 3PHXB 2KFJA 3KUCB 1C77A 3N1ZC 5FK9C 1EF1A 3OJ3A 3VTUA 3OWEB 3PV1A 2GBKA 3CWIA 4AJWA 4PS3A 2BWFA 3DWMA 2SAKA 1J0GA 1PUTA 3I9V1 3LDZE 3C0RB 5HFYA 4BOZB 1AYFA 2IO0B 3QJZA 3CSFA 3NHEB 4MM3B 2MBEA 4KIKA 5E6PA 2PLPA 1EUVB 2O6VD 2ZEQA 1SE2A 4NQKE 3H7PB 4DHZE 3IHPC 2IY0B 1E5WA 4HVBA 3TEYA 1XLNA 5AZGA 1M4VA 2MCNB 1P7EA 3H9DA 2I1JA 1QLBB 2WXFA 4W9HA 2E3TA 4AP4C 1N5WA 3U7DA 4IWQA 2KWVB 3DDCB 2Z8LA 2LRUA 4W9GA 1YJJA 1YN5A 2R2QA 3ZDMC 5D3DA 2WX0A 3TEWA 2PTLA 3N9YC 2M1MA 3T9LA 4FN2A 4IWOA 3TBLD 4HCNB 2BQQA 4GN1A 5EE3A 1JRUA 2PJHA 4CHKA 4K81A 1AW7A 5C23A 3AMZA 2WXPA 2G1EA 1ROEA 4W9LA 4M8MA 5DPTA 2G4SA 1TTNA 3B08A 1C76A 3H1UA 2PEAA 3CIRB 2JWUA 3PPAA 5IKCM 4A90A 5D7GA 1HA5A 2FUHB 2WXRA 1NEKB 1L0XB 3QAQA 2R2OA 4JE3B 1JWAD 3DHIC 1U4AA 4AQ7A 1WJNA 1WXQA 2L05A 3ZKJC 1NI3A 4PYUA 4ZYSA 1HZ6A 4MELA 2KMAA 2LVPA 1V80A 3FAHA 1C1YB 5IAAC 2MJEA 4P1BC 2BYEA 2KTRA 2GRIA 3MC0B 2KDFB 1GTEA 2WP9B 4AUQC 5HG2A 4IDIA 5JHBA 5MPOA 1HZ5A 2K8HA 1ZW7A 1LGRA 3X23A 1OQYA 2KJRA 3X0WA 3RYTA 1JCKB 2LI5A 1NVID 3P42A 3A9KB 5LLIA 2IY1B 2D11A 1Q1OA 3GS2A 2RMMA 3DHHC 1I4XA 2MEKA 4W9JA 2QIEB 2X38A 3PZDA 3ABVB 4KIKB 4XC2A 4W9DA 2BS3B 1GPXA 3DBLI 3A1QA 2MLBA 1LO5D 2BVCA 3TSSA 3ZGZA 2Z59B 2NR2A 1GC7A 2GB1A 2LXCA 1T6BX 2LVOA 2QDFA 2BYFA 2MP2B 3IVFA 3Q14C 2J0JA 4LNNA 3B0AA 4ZHPA 3VH4B 1Y56A 2BKRB 1L7YA 1B1ZA 1L0YB 1F2RI 1Y8RC 3A4RA 5IOIA 2UYZB 1WE7A 3M95A 4IC7B 3H6NA 1SXTA 1VDVA 1SIJA 5JXVA 2Y5PA 1GNUA 1WSPA 4HDOA 2I2YA 1XD3B 5H92C 4GIVA 3SHQA 2WDQB 4X57B 5D3IB 2QC8A 1AWDA 4KX6B 3QIJA 5D2MB 4US8A 2NBUA 4NNJB 2OEDA 5D94A 2JX5A 1V6EA 1FRRA 2M8SA 3HUIA 3TEXA 3VQIA 2D10A 5EDSA 4A9AA 1SEBD 2ZNVB 2ZNVC 1YJIA 3HM3A 3BIID 4D2KA 2C9WB 3NZUA 4OVZA 1PGXA 1WX8A 1XT9B 2JF5A 3U2SC 1V49A 2L32A 3JYUA 2LHEA 1ZDVA 2JUOA 2C7MB 2XK5B 4K7WA 3MC9A 4LCDE 4R3DA 2PKOA 1UF0A 4YXDB 5G2NA 1PGAA 2N9EB 1I4GA 3BY4B 4N9F4 3VTVA 4LJPB 2GBNA 4WAAA 4YSZB 3AV8A 3VH3B 1WMHA 2NCNA 1V1PA 3UQBA 3UI3A 2DWQA 3I63C 2JSVX 2KN5A 3ZJVA 1T3QA 2BTEA 1J7BA 1E8YA 2KWDA 3AU4A 3BVMA 5AZHA 4UDUC 5IA7A 2NBVB 1V97A 2INDC 3ZO5B 3ZJUA 3I3TB 2D2QA 1GJZA 4ANWA 1HTQA 3AN1A 2UWQA 4URKA 3PO0A 4ARCA 3VAWA 4BBNF 2KN4A 3M63B 1GC6A 2FAZA 2MWSB 2WDRB 1G6JA 3CMMB 4J6IA 2JYEA 4N6EB 3WAMA 2KQ4X 1Z5SB 3QK0A 1ZUD2 1QKZA 1XLQA 3BZDB 5J18A 3BINA 4TKNA 3IBEA 2J0MA 3RNGC 1UELA 2MP2A 5E6OA 3EECA 4OVUA 2JY6A 1ET6A 4RGNA 2OJRA 3P4PB 4RGTA 4DHJB 3URYA 3EGRA 2C5LC 4P6VF 5LXIB 3SFEB 3BVGA 3RCZA 1GTHA 4KSKC 2LXAA 2K0PA 4C4VB 2NBWB 5L95C 3R7RA 2BS2B 1TT5B 4MACA 4YSYB 3DBRI 1QF6A 4GU2A 2O6VB 4FHJA 3VFKA 4IUMB 3KYDD 4HKZE 2BS4B 2W55A 1TKEA 1MHXA 1FO4A 1EM7A 2HDEA 1WRIA 5J17A 1WE6A 1LM8B 3AE6B 4AJYB 4P7IA 2JRHA 1A70A 5BYRA 1KM7A 3SU8X 4P1CC 4EE2A 1IBXA 1QOFA 3KLSX 2K1FA 2ZW1A 3N3KB 1L4ZB 4NAWB 4WJQA 4LK0M 5LXHA 1WXSA 4YTPB 1UBIA 1SF0A 1HEZE 1UBQA 2O6VA 4HJKA 3ENEA 3TCAA 2DAJA 3OJ4B 3VXWA 2LMCA 3SDLC 2L7RA 2RDBC 2QCZA 3PVLA 2INCC 1F2RC 2YEPF 1LFDA 3APDA 5DCNA 1JQ4A 3DVGY 3ZVVA 4TV3A 1DYQA 2IGDA 4ZRIA 4HPPA 4JQWC 3RULA 4TQ0A 4FLHA 1GT8A 2QILA 1I7HA 2KD0A 3TJPA 4BOSC 2JWZA 4DHZB 4JIOU 1FXIA 2C7HA 4GB9A 1PYWD 2ZPNA 2WXNA 3KWLA 3DBHB 1I35A 2ZVNA 4NJ6A 4C80A 2L00B 2DYOA 2KX3A 1UH6A 3IAS1 2G9HD 3ZXRA 4K3BA 2WQYB 4FJZA 4BKSA 1NDDA 2HJ1A 2LUMA 2ZJDA 4II2B 4GXBA 2CJNA 4IW0A 2WXOA 4DK5A 3W1SC 4QAYA 1GUAB 1DOIA 2V3NA 3QQ8B 3QWZB 2Z0EB 1TZ1A 3PRZA 2KLCA 2MJDA 4A3OA 2ONQA 2LGDA 3V05A 3AM9A 2PE9A 3VUYA 1DOYA 4B6WA 1EWYC 1XLOA 2KC2A 4RF0A 1FXTB 3UINB 3IFWB 4I6PA 4CO7A 2N4FA 1VRAB 2XNAC 1K52A 2BB6A 2JU6X 2N1VA 3BYTB 2NVUI 4GLSC 2MQJA 4EZJA 1MG8A 1QOAA 4GDLA 4E71A 2KDBA 2JQRB 1EO6A 2LEKA 4XGAB 1OFFA 2M4NA 1T0QC 4TQ1A 3JW0X 3L54A 1C4AA 2L3ZA 3Q3NC 3DBLB 3B2GA 1JALA 3NRZA 2EMTA 1VZ7A 1FD6A 1ZP0B 4Q2JA 3L10B 3UIOB 3H7SA 1TS3A 3OG5A 3P63A 2IGGA 1F1HA 2NTSA 1WXVA 1TJEA 1TIFA 4LNIA 3FC4A 1R7SA 2LJ5A 3DHGC 1QZEA 1WWTA 1WM2A 4XWTA 1OTRB 1Q10A 2EELA 2W3SA 1ZE3D 3MHZA 1KFYB 3LXFA 3DBHI 3DQVA 2DHZA 5CHVC 4E3CA 2BGFA 2IPKD 4ITKA 2YEPB 1P7FA 3PT2B 1KLUD 2JRIB 1V5TA 2ZCBA 3AE7B 1FXAA 1XEEA 1FNWA 3Q8BA 1P98A 2KDIA 1ESFA 1WH3A 1EF5A 3RN9C 1J19A 1SE3A 1LQBA 4YT0B 2CR5A 2V3SA 4BBNC 2FCSA 4LNFA 3KQ4A 4ZRQA 1K50A 2J52A 1QT9A 3JSVB 1YN3A 1HE8A 1WRDB 3W9CB 1JWMD 1SBBB 2D5GA 1KF6B 2NPTA 1KLGD 4GOCA 3Q3OC 5HI1A 4L23A 1XF5L 3P1MA 3R2TA 2V1YA 3S2AA 4WIPA 2LGXA 3B1LX 4PYZA 4KVGB 1YIWA 3MTNB 2CKHB 3LJ3A 1JROA 3AEAB 4JX1C 2AWTA 2KVZA 3MP9A 1N6ZA 3APCA 2KTRB 1J7CA 3BWUD 3NG0A 5TSSA 2MX2A 2AQ1B 4XDCA 3W2DA 5IP4D 5IN7A 2WDVB 2K22A 1E0ZA 4MM3A 1WM3A 3P2BA 4OZAA 4TUUA 4FBJB 1CK1A 4OHJA 2KFKA 3DPDA 2WU5B 5BMGA 4MGIE 3KVFB 1F0ZA 2N9PC 5CTRC 2VRRB 2LZ6A 1N61A 1GOZA 1P0RA 2FCMA 3K9PB 3EUB2 4ACFA 1RFKA 3U8ZA 2KOXA 2MA9B 3MC8A 4EKUA 3UGBB 1VJKA 2GBRA 1WYGA 2KKCA 1TS5A 2R61A 4CYEA 1WGGA 3AH7A 2DLBA 2HD5B 4EEWA 2BYVE 3QCAA 1PQSA 1C79A 4JLCA 4GDKB 1EWCA 2DYBA 2WU2B 3ZXVA 2GLSA 2MBQA 4EZKA 3U4EG 3ZTCA 2LJIA 5LNK1 4L1BA 5HKHA 1YNTE 3N20C 4A8XC 1DGJA 3SR6A 4MGKE 4JWSC 2XN9C 3O65B 1LXDA 1WXMA 1IGCA 3AE1B 1WR6E 4F1SA 2FE8A 4PS7A 1RRBA 4W9IA 1E7UA 4MDKE 4DDID 5AZFA 1SIFA 4RNAA 2HTHA 4W9FA 4C00A 4YWGG 1WX9A 2JYTA 1FMAD 2L52A 1XCQL 1N5XA 4W9KA 4W9CA 3NS8A 1R4NI 4KV2A 1WGDA 4HJGE 3KH0A 1P1AA 4XYCA 4WWMA 4DXGA 1E6EB 4W9EA 3AE3B 2NTTA 4K7UA 1HTOA 3HIZA 3PSEB 5HHDG 3VDZA 1IYFA 3PLVA 4WURA 4IM0A 3RFZB 2K3UA 3QC8B 3RMKC 1WIAA 1WJ4A 1I4QA 3RNBC 5KHQA 2CU1A 3PZ8A 1KH0A 3BVZA 4LTUA 1P3QU 2KMCA 3WIMA 1SB3C 4G3XB 2J4XA 1QOGA 2WDTB 1OEYA 4LNOA 2X8XX 2JXTA 4M00A 4JGHB 2H88B 3NOBA 4M8NA 3A9JA 3M62B 4WQOB 3EA6A 5GMVA 3WCQA 2OJWA 1EU3A 1WGHA 2KJHB 1BUIC 3Q3MC 2MBHA 3GZNB 2Z0DB 2K6QA 2RGFA 3ZTDA 2M0AA 2N1WA 1WZ3A 3T3NA 3RZFA 4BKSD 2LRWA 3V6EB 1TS4A 4FJYA 4OW0A 3C19A 4LDTB 1JRPA 4F8CB 1YOVB 3APFA 1NBFC 2ZW0A 2D3GA 2NPTB 1V81A 2D3BA 2H89B 3FKYA 4BZAA 1I4HA 4HXDA 4DXAB 4GGQA 2K8BA 2LD9A 4M0WB 2YLMA 2FBWB 2BT6A 3TMPB 1VLBA 4EZLA 3ZLZA 1MHHE 3E56A 1E90A 1WYWB 2KACA 2Y5CA 1UUPA 3ZIMA 1YMHE 2DNFA 2KXJA 4DHJD 2QSDA 4ZOHC 3AE5B 2WXKA 1IGDA 2UU7A 3I57A 4IG7B 4NAMA 1UGJA 1FIQA 5DPRA 2JT4B 1XXGA 2ACZB 4L2YA 2N9KA 2LHDA 5D6JB 1L5PA 2LUEA 3E9SA 3HRDD 1RWSA 2YVCA 2OOBB 3NUHB 2K9XA 3UF8A 3PGEA 4PK1A 2B3AA 2JZ3B 4US9A 2IJ0A 4I6LB 3VRAB 2XEWA 2CU3A 2GBJA 1NYRA 1E10A 1V86A 1WF9A 2DBYA 1WFYA 2G3QB 2IGHA 5E6NA 3V61A 4GSWA 3U30A 3OLMD 3GE3C 2M56B 2IYDB 3N32A 4RFBA 3CSTA 3D32A 1FPYA 2NMQA 2D3CA 3EHVA 3N1XC 1XO3A 4ARIA 1KTKA 2KQSA 3C8YA 3HVDA 2AEHA 4JL9A 2FIFA 2PW9A 5AUIA 3VUXA 2MHJA 4FULA 2N9LA 2Q5WD 2KYWA 1FFUA 5H8YE 3BK1A 3NVWA 1C78A 1L4DB 1YX6B 1UWMA 2RDHA 2INNE 1E7VA 5CX3A 4RMAA 2KWUB 1RYJA 3OAWA 4ICUA 3UIPB 3ZNGC 3WALA 3AE4B 4E74A 3CF6E 1UZXB 3GOEA 1ISNA 3AEGB 2N7JA 3ZUNA 2VZKD 2DX5B 1MJDA 3SFDB 1JWBD 4HEA1 2DZIA 5CHWA 5E6JA 1WX7A 4HRSA 3L16A 4A20A 5JZEB 3L4PA 1S3SG 1J8CA 2CJOA 2M17A 5C1ZA 2RPQA 1GB4A 2ZPYA 3FILA 1Q0WB 4WH4A 1YQ3B 4EOYA 4BVUC 4KDLB 4WJOA 2LGSA 3ZDTA 2ZVOA 2AQ2B 1WI0A 2WXGA 3DOWA 3PHWB 4HROA 3ZRCA 1RFAA 3H8HA 4P16A 3JVZX 4HPMB 4S0RA 3PS6A 1FEHA 3ZNZB 1ZXIA 1L2NA 3DBSA 1H7XA 2FCQA 4KGRA 1FCCC 1B9RA 4ASWC 3V6CB 2WXHA 2K39A 4WQMA 3WA0A 3DVNU 1ZKHA 2I38A 4BKTA 3ECIA 3AEEB 1MG4A 1UD7A 3AB5A 1QQRA 2EMSA 4HK2A 3W1YA 2K8CA 4AOFA 4C7YA 1OQRA 3VVWB 2G4DB 3IT4B 2N9XA 3GE8C 4NPNA 4B0EA 2PPHA 5I4DA 3IAM1 1IP9A 2Y3AA 4NAWA 3UQAA 4TSSA 1FNUA 3Q8CA 2VH1A 1CQVA 2KLGA 5BMHA 1ACCA 3WAPA 2N7DA 4XX5A 3TIXA 1C9FA 2JVCA 1H7WA 1XLPA 4A6QA 4FXCA 3RD2A 1TYGB 1FRDA 4RGMA 4AS1A 2O2VB 2L1AA 2QEJC 1D5ZC 2J53A 4IM2A 1MFWA 2MBOA 2DZJA 4ZRJA 2WXMA 1FNVA 3N1YC 1ET9A 1D4BA 2ZZPB 2PMVA 2WXQA 4HPLB 2WS3B 1OEYJ 4DQOC 4ANXA 2BKFA 3KW5B 3R8BA 4JPSA 3IG3A 5CHFA 3ZQ4A 1T5XD 5EE1A 5FKAC 1MPEA 1STEA 3A33B 5BMIA 3AULA 4EFOA 4ZYNA 3AECB 4WJPA 3Q8AA 4HDQA 1EU4A 1ENFA 2DYMA 5AEKB 3TL5A 3A9KA 4IKGA 2DZMA 5EE0A 2KWCA 5FR3A 4J3OD 4ANVA 3HK0A 3HHMA 1D5MC 1C4PA 4HLEA 2JZZA 3KUZA 1JMLA 2MRPA 1SSNA 4XE0A 2J0KA 3PREA 5J2RA 2KQ7A 2VH2A 2HE7A 1QOBA 4DBGA 4M02A 2DENB 4H2AA 1BMLC 4C7ZA 1J7AA 5T8IA 3AEDB 3RZWC 2QHOA 4MJSA 3DVGX 1I4PA 2OHFA 4C56C 3Q3FA 1GAQB 1YD8U 1D6EC 1K8RB 1FCLA 1VD2A 3AE9B 1R4MI 1C3TA 1PDXA 2FCNA 4RF1A 4MGYE 3V62A 2QMTA 1WGKA 4FADA 4BAXA 2RR9A 1XCTL 2IO3B 4G0NB 2BPSA 1WXAA 2RDGA 5G5HA 1RM6C 1T0SC 2FIDA 2GBMA 1IPGA 2LWPA 1PGBA 4PT5A 1Q5WB 1CJEA 3Q69A 3R66C 3RI7C 2RD0A 4DXFA 4CQNA 2BYTA 3V3XA 2K6DB 1TKYA 4F7ZA 2CHZA 2GOWA 4ZHOA 4N58A 2J7QB 2L0FA 1E8ZA 1L6UA 4HWIB 1WGYA 3VUWA 4MH0E 2WLBA 1OQQA 2IDYA 3FILB 3L17A 4RM9A 3HVZA 3QHTA 2LFIA 3SD5A 3PZ7A 4WAFA 2IBIB 1I4RA 3WAOA 4NJ7A 4LJOB 3MJ5A 1YN4A 2INPE 1N60A 2KO3A 3RNEC 5AUKA 4NJCA 1K53A 4MH8A 4YTNB 2B76B 4OZCA 2LGYA 5C3JB 3ML8A 1NI2A 3NVVA 4NZLB 3KUDB 1CZPA 1D5XC 4MJSB 2WWZA 3ML9A 4NQLB 3O13A 4NY0A 3T3OA 3Q8EA 3N30A 2K5PA 1TY0A 3PRMB 1FFVA 2D07B 4DDGD 2EKEC 3L0WB 4ICVA 1F9JA 4RGOS 1MI0A 2MW5A 4A55A 3I5JC 2KANA 1RAXA 4EUTA 3SEBA 2MBBB 3RNAC 1JWSD 3QX1A 2FNJB 1V8CA 3QA8A 5G55A 1R4MB 3ONSA 2AL3A 1Z2MA 2KC1A 3DCGA 4II3B 4JWUC 4A3PA
chains in the Genus database with same CATH topology
3TEWA 1EWYC 1XLOA 2PTLA 3N9YC 4RF0A 3ZYYX 4US9A 3NVZA 2IJ0A 1UWXA 5EE3A 3VRAB 2CU3A 1VRAB 1AW7A 2J42A 2XNAC 1NYRA 3RPFC 1E10A 1K52A 2DBYA 2BB6A 3AMZA 2WXPA 2JU6X 3Q8FA 2G1EA 3BYTB 1GB1A 2IGHA 4GLSC 2JZPA 1ROEA 1QOAA 2M56B 3W1SA 4RFBA 1N62A 2JQRB 1C76A 2VZKB 2BBCA 2NMQA 2LEKA 1OFFA 3CIRB 1XO3A 2HTME 4ARIA 2JWUA 4TQ1A 1KTKA 1C4AA 4A90A 2WXLA 5D7GA 1HA5A 3C8YA 2WXRA 3HVDA 4B0MA 1NEKB 1L0XB 2PW9A 2EKIA 5AUIA 4GDLB 3B2GA 2N9LA 4JE3B 1JALA 1JWAD 3NRZA 4AQ7A 1VZ7A 2Q5WD 2V4IB 1FFUA 1FD6A 1ZP0B 4Q2JA 5BYSA 1JWUD 1WXQA 5H8YE 1TS3A 3P63A 3BK1A 2IGGA 1TY2A 1TKGA 2N0SB 1ZOYB 3NVWA 1C78A 2NTSA 1L4DB 1UWMA 1NI3A 3ETRA 1TJEA 2RDHA 4ZYSA 2INNE 1F77A 1HZ6A 1L6VA 1RYJA 4RH6A 3FC4A 1R7SA 2AQ3B 3FAHA 3AE4B 3NS1A 2MJEA 1IBXB 3VR8B 3AEGB 1WWTA 2GRIA 2N7JA 1C4CA 3MC0B 2VZKD 4XWTA 1GTEA 2WP9B 1Q10A 3SFDB 1JWBD 2EELA 2W3SA 3BK2A 4MT5A 4HEA1 3MFGA 5HG2A 4IDIA 5E6JA 5MPOA 1HZ5A 4HRSA 1ZE3D 3L4PA 3MHZA 1KFYB 4KKIA 3LXFA 1JCKB 2CJOA 1NVID 3P42A 2BW2A 2IPKD 2V3PA 4ITKA 2YEPB 1P7FA 1GB4A 3GP7A 3GS2A 1KLUD 3FILA 2RMMA 4WH4A 1YQ3B 3ZJTA 3AE7B 1FXAA 1I4XA 1XEEA 1FNWA 2MEKA 3Q8BA 4REZA 1ESFA 2QIEB 2MH7A 2X38A 1TS2A 3ABVB 2AQ2B 2WXJA 2BS3B 1GPXA 2QJLA 1FM0D 1SE3A 4YT0B 2WXGA 1YQ4B 4HROA 3LYYA 3KQ4A 3TUOA 2W3RA 1LO5D 3H8HA 4P16A 4ZRQA 3IXSA 3TSSA 1SJED 3ZGZA 2PIAA 2GB1A 1FEHA 1K50A 2J52A 3P4RB 1T6BX 1QT9A 1E7PB 1ZXIA 1AN8A 1YN3A 3W9CB 4KGTA 1JWMD 1SBBB 3NVYA 1H7XA 2D5GA 4KGRA 1FCCC 1KF6B 2V0GA 1B9RA 1KLGD 1BXTA 5HI1A 4L23A 1XF5L 3P1MA 3R2TA 2WXHA 4ZHPA 1Y56A 4WQMA 1B1ZA 1L0YB 3AE2B 1F2RI 2I38A 4N59A 2KMMA 5GXGB 4WIPA 3AEEB 4ZRPA 1NENB 3AB5A 1QQRA 1QILA 1SXTA 1VDVA 1JROA 3AEAB 1SIJA 1OQRA 4JX1C 5G5GA 4C7YA 5JXVA 3IT6B 3IT4B 2Y5PA 3MP9A 1WSPA 3B9JA 4B0EA 2I2YA 5H92C 5I4DA 4RCOA 3IAM1 2WDQB 4LLGM 5D3IB 3TEZA 1J7CA 1AWDA 2Y3AA 2M19A 4KX6B 4TSSA 3R2IA 1FNUA 4US8A 3BWUD 3Q8CA 2SEBD 5TSSA 2AQ1B 4XDCA 3W2DA 1E9MA 1CQVA 2BB5A 5BMHA 4XWWA 4O1NA 1VR9A 1ACCA 2WDVB 2OEDA 2K22A 3P4SB 1C9FA 2JX5A 1E0ZA 2KAJA 1FRRA 1H7WA 1L0VB 1XLPA 3HUIA 3TEXA 3VQIA 1V1PB 4A6QA 4FXCA 4OZAA 5BYQA 1CK1A 1TYGB 4OHJA 1FRDA 4A9AA 4RGMA 4AS1A 2WU5B 1MVKA 1SEBD 2L83A 5BMGA 2L1AA 2GI9A 1YJIA 1D5ZC 2J53A 2QEJC 1KRHA 1NYQA 1F0ZA 4M0WA 3P4QB 3LB8C 3BIID 3AEFB 4D2KA 1IUEA 1N61A 4OVZA 2WXMA 1GOZA 1FNVA 3U52E 1VZ8A 1ET9A 1PGXA 1HQRD 3EUB2 1RFKA 1D4BA 2PMVA 3U2SC 2WXQA 2WS3B 2E6XA 2PVOD 2L32A 4DQOC 2ICIA 2LHEA 1VJKA 1ZDVA 3VR9B 3GB1A 3R8BA 1WYGA 4JPSA 1TS5A 2R61A 4R3DA 2PKOA 3ZQ4A 1T5XD 3AH7A 4YXDB 2DLBA 3AE8B 5EE1A 1PGAA 1I4GA 3NZ3A 1ZPSA 5FKAC 1MPEA 1C79A 4GDKB 1EWCA 1STEA 4YSZB 4YTMB 2WU2B 3AV8A 1V1PA 2AX5A 4KGSA 3UI3A 2DWQA 4TMAB 4OZBA 2JSVX 3U4EG 3ZJVA 1N63A 1T3QA 2ON8A 2LJIA 5LNK1 2BTEA 5BMIA 1J7BA 2KWDA 4L1BA 2KDMA 3J9CA 3BVMA 1TZOA 1YNTE 4A8XC 2W54A 4UDUC 1DGJA 3AECB 2TSSA 1V97A 4YSXB 3SR6A 3ZJUA 3Q8AA 4JWSC 2FUG1 1PFDA 1UNSA 2XN9C 1EU4A 3AN1A 1ENFA 2DYMA 3PO0A 4ARCA 2KN4A 4IKGA 1IGCA 3AE1B 5EE0A 4IOIE 5FR3A 4J3OD 2FE8A 1D5MC 1C4PA 2WDRB 3CF4A 1JMLA 3U7ZA 3BYYB 3W5VB 4RNAA 1SSNA 4XE0A 2JYEA 4N6EB 2KQ4X 2PVGC 4YWGG 2JYTA 1FMAD 1ZUD2 1K51A 1N5XA 1XCQL 1QKZA 1QOBA 2L52A 3DWGC 1XLQA 3BZDB 1BMLC 4H2AA 4HJGE 2LGIA 4C7ZA 1J7AA 1VZ6A 4WWMA 5T8IA 3AEDB 4DXGA 1DOXA 1E6EB 1I4PA 2OHFA 4C56C 1ET6A 4RGNA 3AE3B 2NTTA 3P4PB 1GAQB 5HHDG 4RGTA 1D6EC 4WURA 3URYA 3EGRA 1FCLA 3RFZB 2K3UA 4P6VF 3SFEB 3AE9B 1PDXA 4RF1A 1ZXHA 2QMTA 1I4QA 3KWVA 3BVGA 1WGKA 2W82A 3PZ8A 1KH0A 1GTHA 4KKJA 2K0PA 1XCTL 3BVZA 4LTUA 2BS2B 2RDGA 5G5HA 1RM6C 4MACA 4YSYB 1SB3C 3W5UB 1QF6A 4HKQA 2J4XA 1PGBA 4PT5A 1QOGA 4HKZE 1CJEA 2BS4B 1HXYD 1SE4A 1SJHD 2W55A 3Q69A 2WXIA 1TKEA 1MHXA 4DXFA 1FO4A 1EM7A 4CQNA 2HDEA 2MJ3A 1ZDXA 2JXTA 2BYTA 3V3XA 1WRIA 1TKYA 2H88B 4XDDA 3AE6B 4ZHOA 4N58A 5BYRA 1A70A 1L6UA 3EA6A 3WCQA 4EE2A 1IBXA 1QOFA 1EU3A 1V1OA 3KLSX 2WLBA 1OQQA 5C2TB 2ZW1A 2IDYA 1L4ZB 2RPVA 3FILB 4NAWB 1BUIC 3HVZA 3AEBB 4LK0M 4USAA 2WNMA 3B2FA 2M0AA 5EE9A 4YTPB 3T3NA 1SF0A 3VRBB 1HEZE 2LFIA 3PZ7A 4WAFA 1JW9D 1I4RA 1TS4A 4OW0A 2LMCA 1C77A 3MJ5A 1JRPA 5FK9C 1F2RC 2YEPF 1YN4A 3OWEB 1JQ4A 2ZW0A 2INPE 1N60A 1DYQA 3CWIA 2IGDA 2H89B 4TQ0A 5AUKA 1GT8A 2QILA 1I7HA 1K53A 4MH8A 4NJCA 1I4HA 3DWMA 2SAKA 4YTNB 2B76B 1PUTA 1FXIA 3I9V1 5HFYA 4OZCA 1PYWD 5C3JB 2FBWB 3NVVA 4NZLB 2BT6A 2WXNA 3KWLA 1CZPA 1D5XC 1AYFA 1VLBA 3O13A 1MHHE 3E56A 4C80A 3T3OA 2DYOA 3Q8EA 3IAS1 2KACA 2K5PA 2Y5CA 4MM3B 1TY0A 1UUPA 2G9HD 2PLPA 2WQYB 1YMHE 1FFVA 1SE2A 2QSDA 4ZOHC 3AE5B 2WXKA 2LUMA 1IGDA 3I57A 4RGOS 4NAMA 3TEYA 1UGJA 2CJNA 1FIQA 1MI0A 1XLNA 1XXGA 2WXOA 1M4VA 1P7EA 4A55A 2ACZB 1QLBB 4L2YA 2WXFA 1DOIA 2V3NA 3SEBA 2N9KA 2LHDA 2E3TA 1JWSD 1N5WA 1L5PA 1V8CA 3E9SA 3HRDD 1RWSA 2MJDA 2Z8LA 2ONQA 3NUHB 1YJJA 1YN5A 3V05A 2K9XA 3AM9A 4JWUC 1DOYA 5D3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWY C;  1XLO A;  3AE8 B;  1WRI A;  1TKY A;  5EE1 A;  3ABV B;  2H88 B;  2BS3 B;  3ZYY X;  4US9 A;  2QJL A;  1FM0 D;  1GPX A;  3AE6 B;  4YT0 B;  3NVZ A;  4N58 A;  4ZHO A;  5EE3 A;  1A70 A;  1YQ4 B;  4HRO A;  1L6U A;  3VRA B;  2W3R A;  3WCQ A;  4YSZ B;  4YTM B;  2CU3 A;  1QOF A;  2WU2 B;  3AV8 A;  2PIA A;  1NYR A;  2AX5 A;  2WLB A;  3RPF C;  1OQQ A;  2DBY A;  5C2T B;  2DWQ A;  1E10 A;  3AMZ A;  3P4R B;  1QT9 A;  2G1E A;  1N63 A;  1T3Q A;  3HVZ A;  3AEB B;  1E7P B;  1ZXI A;  4USA A;  1J7B A;  3B2F A;  1ROE A;  3W9C B;  5EE9 A;  2W54 A;  1H7X A;  3NVY A;  1DGJ A;  3AEC B;  4YTP B;  1QOA A;  1SF0 A;  1V97 A;  3VRB B;  4YSX B;  1KF6 B;  2M56 B;  3SR6 A;  1B9R A;  4JWS C;  1PFD A;  1JW9 D;  1N62 A;  2JQR B;  3AN1 A;  3P1M A;  4ZHP A;  4WQM A;  3PO0 A;  3AE2 B;  2LEK A;  3AE1 B;  5EE0 A;  4N59 A;  1OFF A;  2KMM A;  5GXG B;  3CIR B;  1XO3 A;  2HTM E;  3AEE B;  1JRP A;  1NEN B;  3AB5 A;  2WDR B;  3CF4 A;  1JQ4 A;  1NEK B;  1JRO A;  3AEA B;  1N60 A;  1OQR A;  1SIJ A;  1VDV A;  3CWI A;  4JX1 C;  2EKI A;  5AUI A;  5G5G A;  3B2G A;  4N6E B;  2H89 B;  1JAL A;  1JWA D;  3NRZ A;  5AUK A;  1GT8 A;  2Q5W D;  3B9J A;  1I7H A;  1FFU A;  2PVG C;  1ZP0 B;  3DWM A;  5H92 C;  1WXQ A;  1FMA D;  1ZUD 2;  2L52 A;  1N5X A;  5H8Y E;  1QOB A;  4YTN B;  3P63 A;  4C7Y A;  2B76 B;  2WDQ B;  1FXI A;  1PUT A;  3DWG C;  1J7C A;  1AWD A;  1TKG A;  1XLQ A;  2M19 A;  4KX6 B;  1ZOY B;  2N0S B;  3NVW A;  5C3J B;  4US8 A;  2FBW B;  1UWM A;  3NVV A;  1J7A A;  1NI3 A;  2BT6 A;  3ETR A;  3KWL A;  1TJE A;  4C7Z A;  4WWM A;  1E9M A;  1CZP A;  3AED B;  1AYF A;  1DOX A;  1L6V A;  1E6E B;  2WDV B;  1RYJ A;  1VLB A;  2K22 A;  3P4S B;  2OHF A;  2JX5 A;  3FC4 A;  1E0Z A;  2KAJ A;  1FRR A;  1R7S A;  4C80 A;  3AE3 B;  3FAH A;  3W5V B;  1H7W A;  1L0V B;  3AE4 B;  2K5P A;  1XLP A;  2Y5C A;  3HUI A;  3NS1 A;  2MJE A;  3P4P B;  4FXC A;  1GAQ B;  2WQY B;  3VR8 B;  1FFV A;  1TYG B;  1FRD A;  4A9A A;  3AEG B;  1WWT A;  2WU5 B;  4ZOH C;  2L83 A;  3AE5 B;  4P6V F;  1GTE A;  2WP9 B;  3SFD B;  1JWB D;  1YJI A;  2W3S A;  3SFE B;  1KRH A;  3AE9 B;  1NYQ A;  1F0Z A;  3P4Q B;  1PDX A;  4IDI A;  3LB8 C;  3BII D;  2CJN A;  1FIQ A;  3AEF B;  5MPO A;  4HRS A;  1XLN A;  1IUE A;  1N61 A;  3L4P A;  2ACZ B;  1KFY B;  1WGK A;  1GTH A;  3LXF A;  1QLB B;  3EUB 2;  1DOI A;  1RFK A;  2CJO A;  1NVI D;  2WS3 B;  4LTU A;  2BS2 B;  2PVO D;  2E3T A;  4ITK A;  1RM6 C;  5G5H A;  1N5W A;  1L5P A;  1V8C A;  4YSY B;  3HRD D;  1VJK A;  1SB3 C;  1RWS A;  3VR9 B;  2MJD A;  3W5U B;  1QF6 A;  1QOG A;  1YQ3 B;  1WYG A;  1CJE A;  1YJJ A;  2BS4 B;  3AE7 B;  2W55 A;  1FXA A;  2K9X A;  1TKE A;  3AM9 A;  2PKO A;  4JWU C;  1FO4 A;  1DOY A;  2MJ3 A;  2QIE B;  3AH7 A;  2MH7 A;  4YXD B; 
#chains in the Genus database with same CATH topology
 4WWN A;  3ZYY X;  3NVZ A;  4G11 A;  1UWX A;  4PS8 A;  1ZGU B;  3RNC C;  2J42 A;  4K3C A;  3RPF C;  2L0T A;  5BO4 B;  4KZ0 A;  3Q8F A;  4GMV A;  3WAN A;  1GB1 A;  4IM3 A;  2JZP A;  2WX1 A;  3W1S A;  1N62 A;  2VZK B;  2BBC A;  4G50 A;  3V60 A;  2HTM E;  2C7N B;  4LDT D;  2I1K A;  2WXL A;  3JSV A;  1E8X A;  4B0M A;  2EKI A;  4GDL B;  2O2V A;  4WWO A;  2V4I B;  1WY8 A;  5BYS A;  1JWU D;  2IO2 B;  1TY2 A;  1TKG A;  2IO1 B;  1ZOY B;  2N0S B;  1T0R C;  4I6N B;  2L8J A;  1WJU A;  1KLV A;  2WGS A;  3ETR A;  2V9H A;  1F77 A;  2KZR A;  1L6V A;  4RH6 A;  1OGW A;  2XBB C;  4YL8 A;  2REX A;  2AQ3 B;  3NS1 A;  3Q3J A;  4KZC A;  1IBX B;  3VR8 B;  5JH5 C;  1C4C A;  3BK2 A;  4KSL C;  4MT5 A;  3MFG A;  1P9D U;  4MEM A;  2KVR A;  4KKI A;  3Q2A C;  2KX0 A;  2BW2 A;  2MSE D;  3PLU A;  2V3P A;  3VHT C;  3GP7 A;  2LAS A;  2KTF A;  3H7P A;  3ZJT A;  1SE9 A;  1H4R A;  4REZ A;  2MH7 A;  1TS2 A;  3KYC D;  2WXJ A;  2QJL A;  1FM0 D;  4WWP A;  1WMH B;  1YQ4 B;  4S17 A;  4WJN A;  1GG3 A;  2LVQ A;  3LYY A;  3TUO A;  2W3R A;  4DWF A;  5L83 A;  3IXS A;  1SJE D;  2PIA A;  1RLF A;  2K25 A;  4K1R B;  2V4L A;  1F52 A;  3P4R B;  4LNK A;  1WR1 A;  1E7P B;  2DAF A;  1AN8 A;  5IO9 A;  4KGT A;  3NVY A;  2KJ6 A;  1X1M A;  2V0G A;  3L13 A;  1BXT A;  3DBR B;  3NZS A;  3AE2 B;  3L08 A;  2ZCC A;  4N59 A;  2KMM A;  4B95 A;  5GXG B;  5KHO A;  4ZRP A;  1NEN B;  3AI5 A;  4KDI C;  1QIL A;  1YJ1 A;  1T0Y A;  5G5G A;  3IT6 B;  1V5O A;  3MHS D;  3B9J A;  5JHA A;  4RCO A;  3TEZ A;  4LLG M;  4B9K A;  1V9J A;  2KDE B;  2M19 A;  3R2I A;  2SEB D;  2KHW B;  1E9M A;  2BB5 A;  4XWW A;  4O1N A;  1VR9 A;  2BWE S;  1XQQ A;  3P4S B;  2N7E A;  2KAJ A;  3A9J B;  1L0V B;  1BT0 A;  2L76 A;  1V1P B;  5BYQ A;  3ZW3 A;  1MVK A;  4MSQ B;  5DPW A;  1YX5 B;  2L83 A;  3RUI B;  2GI9 A;  1KRH A;  1NYQ A;  4M0W A;  3P4Q B;  3LB8 C;  2WYQ A;  3AEF B;  1M94 A;  1IUE A;  1KOT A;  3U52 E;  2XK5 A;  1VZ8 A;  3NY5 A;  1HQR D;  1AAR A;  2KT7 A;  5FR6 A;  2Y5B B;  4ANU A;  4AWJ A;  2E6X A;  2PVO D;  2CS4 A;  4BKG A;  2ICI A;  3VR9 B;  3GB1 A;  3PTF C;  1TBE A;  1KJT A;  3ZNH B;  1SGH A;  4M01 A;  1WZ0 A;  2AL6 A;  3QAR A;  1VCB A;  1YQB A;  3GZN I;  1S1Q B;  3AE8 B;  3AXC A;  4FA6 A;  1UGM A;  1ZPS A;  3NZ3 A;  1H8C A;  3RNF C;  2KFK B;  4YTM B;  2JPH A;  2AX5 A;  4KGS A;  2IZV B;  4TMA B;  4OZB A;  4RM8 A;  1N63 A;  1R4N B;  2ON8 A;  2KDM A;  3J9C A;  3R7Q A;  4HCP B;  1TZO A;  2W54 A;  2TSS A;  4YSX B;  2C60 A;  2FUG 1;  1PFD A;  1UNS A;  4MGZ E;  1D3Z A;  1WJ6 A;  4IOI E;  1E8W A;  2JXX A;  2A5U A;  2W9N A;  1V2Y A;  3ZNI D;  3AU5 A;  3CF4 A;  3U7Z A;  3BYY B;  3W5V B;  3RT3 B;  4FJV B;  4K7S A;  4BFR A;  4XZ4 A;  2PVG C;  1I42 A;  4IWP A;  1K51 A;  3ZRF A;  3DWG C;  2LGI A;  2A4Z A;  2KK8 A;  2CHX A;  2M0X A;  1VZ6 A;  3Q6B A;  1DOX A;  3MJW A;  2HJ8 A;  3NJT A;  2BF8 B;  2ASQ A;  3K9O B;  1A5R A;  4C4V A;  2DZK A;  2PE6 B;  3PRP B;  1ZXH A;  5DPS A;  3KWV A;  3VTW A;  2W82 A;  2D3A A;  4KKJ A;  2KNB A;  1TGZ B;  3T8M A;  2RSU A;  3W5U B;  4HKQ A;  5TR5 A;  1SJH D;  1HXY D;  1SE4 A;  2WXI A;  2G45 B;  3EC8 A;  2MJ3 A;  1ZDX A;  3A1Q B;  3M3J A;  4XDD A;  3A4S C;  3ALB A;  1CMX B;  4FHK A;  4ZRK A;  3EFU A;  3HM6 X;  1V1O A;  3DVN V;  5C2T B;  3R3M A;  2RPV A;  1WGR A;  2GMI C;  2CHW A;  3AEB B;  4USA A;  2WHI A;  2WNM A;  3B2F A;  2AYO B;  2NS5 A;  4GDK A;  4OVV A;  5EE9 A;  3VRB B;  4ZDV A;  4MSM B;  1JW9 D;  3EFC A;  3PHX B;  2KFJ A;  3KUC B;  1C77 A;  3N1Z C;  5FK9 C;  1EF1 A;  3OJ3 A;  3VTU A;  3OWE B;  3PV1 A;  2GBK A;  3CWI A;  4AJW A;  4PS3 A;  2BWF A;  3DWM A;  2SAK A;  1J0G A;  1PUT A;  3I9V 1;  3LDZ E;  3C0R B;  5HFY A;  4BOZ B;  1AYF A;  2IO0 B;  3QJZ A;  3CSF A;  3NHE B;  4MM3 B;  2MBE A;  4KIK A;  5E6P A;  2PLP A;  1EUV B;  2O6V D;  2ZEQ A;  1SE2 A;  4NQK E;  3H7P B;  4DHZ E;  3IHP C;  2IY0 B;  1E5W A;  4HVB A;  3TEY A;  1XLN A;  5AZG A;  1M4V A;  2MCN B;  1P7E A;  3H9D A;  2I1J A;  1QLB B;  2WXF A;  4W9H A;  2E3T A;  4AP4 C;  1N5W A;  3U7D A;  4IWQ A;  2KWV B;  3DDC B;  2Z8L A;  2LRU A;  4W9G A;  1YJJ A;  1YN5 A;  2R2Q A;  3ZDM C;  5D3D A;  2WX0 A;  3TEW A;  2PTL A;  3N9Y C;  2M1M A;  3T9L A;  4FN2 A;  4IWO A;  3TBL D;  4HCN B;  2BQQ A;  4GN1 A;  5EE3 A;  1JRU A;  2PJH A;  4CHK A;  4K81 A;  1AW7 A;  5C23 A;  3AMZ A;  2WXP A;  2G1E A;  1ROE A;  4W9L A;  4M8M A;  5DPT A;  2G4S A;  1TTN A;  3B08 A;  1C76 A;  3H1U A;  2PEA A;  3CIR B;  2JWU A;  3PPA A;  5IKC M;  4A90 A;  5D7G A;  1HA5 A;  2FUH B;  2WXR A;  1NEK B;  1L0X B;  3QAQ A;  2R2O A;  4JE3 B;  1JWA D;  3DHI C;  1U4A A;  4AQ7 A;  1WJN A;  1WXQ A;  2L05 A;  3ZKJ C;  1NI3 A;  4PYU A;  4ZYS A;  1HZ6 A;  4MEL A;  2KMA A;  2LVP A;  1V80 A;  3FAH A;  1C1Y B;  5IAA C;  2MJE A;  4P1B C;  2BYE A;  2KTR A;  2GRI A;  3MC0 B;  2KDF B;  1GTE A;  2WP9 B;  4AUQ C;  5HG2 A;  4IDI A;  5JHB A;  5MPO A;  1HZ5 A;  2K8H A;  1ZW7 A;  1LGR A;  3X23 A;  1OQY A;  2KJR A;  3X0W A;  3RYT A;  1JCK B;  2LI5 A;  1NVI D;  3P42 A;  3A9K B;  5LLI A;  2IY1 B;  2D11 A;  1Q1O A;  3GS2 A;  2RMM A;  3DHH C;  1I4X A;  2MEK A;  4W9J A;  2QIE B;  2X38 A;  3PZD A;  3ABV B;  4KIK B;  4XC2 A;  4W9D A;  2BS3 B;  1GPX A;  3DBL I;  3A1Q A;  2MLB A;  1LO5 D;  2BVC A;  3TSS A;  3ZGZ A;  2Z59 B;  2NR2 A;  1GC7 A;  2GB1 A;  2LXC A;  1T6B X;  2LVO A;  2QDF A;  2BYF A;  2MP2 B;  3IVF A;  3Q14 C;  2J0J A;  4LNN A;  3B0A A;  4ZHP A;  3VH4 B;  1Y56 A;  2BKR B;  1L7Y A;  1B1Z A;  1L0Y B;  1F2R I;  1Y8R C;  3A4R A;  5IOI A;  2UYZ B;  1WE7 A;  3M95 A;  4IC7 B;  3H6N A;  1SXT A;  1VDV A;  1SIJ A;  5JXV A;  2Y5P A;  1GNU A;  1WSP A;  4HDO A;  2I2Y A;  1XD3 B;  5H92 C;  4GIV A;  3SHQ A;  2WDQ B;  4X57 B;  5D3I B;  2QC8 A;  1AWD A;  4KX6 B;  3QIJ A;  5D2M B;  4US8 A;  2NBU A;  4NNJ B;  2OED A;  5D94 A;  2JX5 A;  1V6E A;  1FRR A;  2M8S A;  3HUI A;  3TEX A;  3VQI A;  2D10 A;  5EDS A;  4A9A A;  1SEB D;  2ZNV B;  2ZNV C;  1YJI A;  3HM3 A;  3BII D;  4D2K A;  2C9W B;  3NZU A;  4OVZ A;  1PGX A;  1WX8 A;  1XT9 B;  2JF5 A;  3U2S C;  1V49 A;  2L32 A;  3JYU A;  2LHE A;  1ZDV A;  2JUO A;  2C7M B;  2XK5 B;  4K7W A;  3MC9 A;  4LCD E;  4R3D A;  2PKO A;  1UF0 A;  4YXD B;  5G2N A;  1PGA A;  2N9E B;  1I4G A;  3BY4 B;  4N9F 4;  3VTV A;  4LJP B;  2GBN A;  4WAA A;  4YSZ B;  3AV8 A;  3VH3 B;  1WMH A;  2NCN A;  1V1P A;  3UQB A;  3UI3 A;  2DWQ A;  3I63 C;  2JSV X;  2KN5 A;  3ZJV A;  1T3Q A;  2BTE A;  1J7B A;  1E8Y A;  2KWD A;  3AU4 A;  3BVM A;  5AZH A;  4UDU C;  5IA7 A;  2NBV B;  1V97 A;  2IND C;  3ZO5 B;  3ZJU A;  3I3T B;  2D2Q A;  1GJZ A;  4ANW A;  1HTQ A;  3AN1 A;  2UWQ A;  4URK A;  3PO0 A;  4ARC A;  3VAW A;  4BBN F;  2KN4 A;  3M63 B;  1GC6 A;  2FAZ A;  2MWS B;  2WDR B;  1G6J A;  3CMM B;  4J6I A;  2JYE A;  4N6E B;  3WAM A;  2KQ4 X;  1Z5S B;  3QK0 A;  1ZUD 2;  1QKZ A;  1XLQ A;  3BZD B;  5J18 A;  3BIN A;  4TKN A;  3IBE A;  2J0M A;  3RNG C;  1UEL A;  2MP2 A;  5E6O A;  3EEC A;  4OVU A;  2JY6 A;  1ET6 A;  4RGN A;  2OJR A;  3P4P B;  4RGT A;  4DHJ B;  3URY A;  3EGR A;  2C5L C;  4P6V F;  5LXI B;  3SFE B;  3BVG A;  3RCZ A;  1GTH A;  4KSK C;  2LXA A;  2K0P A;  4C4V B;  2NBW B;  5L95 C;  3R7R A;  2BS2 B;  1TT5 B;  4MAC A;  4YSY B;  3DBR I;  1QF6 A;  4GU2 A;  2O6V B;  4FHJ A;  3VFK A;  4IUM B;  3KYD D;  4HKZ E;  2BS4 B;  2W55 A;  1TKE A;  1MHX A;  1FO4 A;  1EM7 A;  2HDE A;  1WRI A;  5J17 A;  1WE6 A;  1LM8 B;  3AE6 B;  4AJY B;  4P7I A;  2JRH A;  1A70 A;  5BYR A;  1KM7 A;  3SU8 X;  4P1C C;  4EE2 A;  1IBX A;  1QOF A;  3KLS X;  2K1F A;  2ZW1 A;  3N3K B;  1L4Z B;  4NAW B;  4WJQ A;  4LK0 M;  5LXH A;  1WXS A;  4YTP B;  1UBI A;  1SF0 A;  1HEZ E;  1UBQ A;  2O6V A;  4HJK A;  3ENE A;  3TCA A;  2DAJ A;  3OJ4 B;  3VXW A;  2LMC A;  3SDL C;  2L7R A;  2RDB C;  2QCZ A;  3PVL A;  2INC C;  1F2R C;  2YEP F;  1LFD A;  3APD A;  5DCN A;  1JQ4 A;  3DVG Y;  3ZVV A;  4TV3 A;  1DYQ A;  2IGD A;  4ZRI A;  4HPP A;  4JQW C;  3RUL A;  4TQ0 A;  4FLH A;  1GT8 A;  2QIL A;  1I7H A;  2KD0 A;  3TJP A;  4BOS C;  2JWZ A;  4DHZ B;  4JIO U;  1FXI A;  2C7H A;  4GB9 A;  1PYW D;  2ZPN A;  2WXN A;  3KWL A;  3DBH B;  1I35 A;  2ZVN A;  4NJ6 A;  4C80 A;  2L00 B;  2DYO A;  2KX3 A;  1UH6 A;  3IAS 1;  2G9H D;  3ZXR A;  4K3B A;  2WQY B;  4FJZ A;  4BKS A;  1NDD A;  2HJ1 A;  2LUM A;  2ZJD A;  4II2 B;  4GXB A;  2CJN A;  4IW0 A;  2WXO A;  4DK5 A;  3W1S C;  4QAY A;  1GUA B;  1DOI A;  2V3N A;  3QQ8 B;  3QWZ B;  2Z0E B;  1TZ1 A;  3PRZ A;  2KLC A;  2MJD A;  4A3O A;  2ONQ A;  2LGD A;  3V05 A;  3AM9 A;  2PE9 A;  3VUY A;  1DOY A;  4B6W A;  1EWY C;  1XLO A;  2KC2 A;  4RF0 A;  1FXT B;  3UIN B;  3IFW B;  4I6P A;  4CO7 A;  2N4F A;  1VRA B;  2XNA C;  1K52 A;  2BB6 A;  2JU6 X;  2N1V A;  3BYT B;  2NVU I;  4GLS C;  2MQJ A;  4EZJ A;  1MG8 A;  1QOA A;  4GDL A;  4E71 A;  2KDB A;  2JQR B;  1EO6 A;  2LEK A;  4XGA B;  1OFF A;  2M4N A;  1T0Q C;  4TQ1 A;  3JW0 X;  3L54 A;  1C4A A;  2L3Z A;  3Q3N C;  3DBL B;  3B2G A;  1JAL A;  3NRZ A;  2EMT A;  1VZ7 A;  1FD6 A;  1ZP0 B;  4Q2J A;  3L10 B;  3UIO B;  3H7S A;  1TS3 A;  3OG5 A;  3P63 A;  2IGG A;  1F1H A;  2NTS A;  1WXV A;  1TJE A;  1TIF A;  4LNI A;  3FC4 A;  1R7S A;  2LJ5 A;  3DHG C;  1QZE A;  1WWT A;  1WM2 A;  4XWT A;  1OTR B;  1Q10 A;  2EEL A;  2W3S A;  1ZE3 D;  3MHZ A;  1KFY B;  3LXF A;  3DBH I;  3DQV A;  2DHZ A;  5CHV C;  4E3C A;  2BGF A;  2IPK D;  4ITK A;  2YEP B;  1P7F A;  3PT2 B;  1KLU D;  2JRI B;  1V5T A;  2ZCB A;  3AE7 B;  1FXA A;  1XEE A;  1FNW A;  3Q8B A;  1P98 A;  2KDI A;  1ESF A;  1WH3 A;  1EF5 A;  3RN9 C;  1J19 A;  1SE3 A;  1LQB A;  4YT0 B;  2CR5 A;  2V3S A;  4BBN C;  2FCS A;  4LNF A;  3KQ4 A;  4ZRQ A;  1K50 A;  2J52 A;  1QT9 A;  3JSV B;  1YN3 A;  1HE8 A;  1WRD B;  3W9C B;  1JWM D;  1SBB B;  2D5G A;  1KF6 B;  2NPT A;  1KLG D;  4GOC A;  3Q3O C;  5HI1 A;  4L23 A;  1XF5 L;  3P1M A;  3R2T A;  2V1Y A;  3S2A A;  4WIP A;  2LGX A;  3B1L X;  4PYZ A;  4KVG B;  1YIW A;  3MTN B;  2CKH B;  3LJ3 A;  1JRO A;  3AEA B;  4JX1 C;  2AWT A;  2KVZ A;  3MP9 A;  1N6Z A;  3APC A;  2KTR B;  1J7C A;  3BWU D;  3NG0 A;  5TSS A;  2MX2 A;  2AQ1 B;  4XDC A;  3W2D A;  5IP4 D;  5IN7 A;  2WDV B;  2K22 A;  1E0Z A;  4MM3 A;  1WM3 A;  3P2B A;  4OZA A;  4TUU A;  4FBJ B;  1CK1 A;  4OHJ A;  2KFK A;  3DPD A;  2WU5 B;  5BMG A;  4MGI E;  3KVF B;  1F0Z A;  2N9P C;  5CTR C;  2VRR B;  2LZ6 A;  1N61 A;  1GOZ A;  1P0R A;  2FCM A;  3K9P B;  3EUB 2;  4ACF A;  1RFK A;  3U8Z A;  2KOX A;  2MA9 B;  3MC8 A;  4EKU A;  3UGB B;  1VJK A;  2GBR A;  1WYG A;  2KKC A;  1TS5 A;  2R61 A;  4CYE A;  1WGG A;  3AH7 A;  2DLB A;  2HD5 B;  4EEW A;  2BYV E;  3QCA A;  1PQS A;  1C79 A;  4JLC A;  4GDK B;  1EWC A;  2DYB A;  2WU2 B;  3ZXV A;  2GLS A;  2MBQ A;  4EZK A;  3U4E G;  3ZTC A;  2LJI A;  5LNK 1;  4L1B A;  5HKH A;  1YNT E;  3N20 C;  4A8X C;  1DGJ A;  3SR6 A;  4MGK E;  4JWS C;  2XN9 C;  3O65 B;  1LXD A;  1WXM A;  1IGC A;  3AE1 B;  1WR6 E;  4F1S A;  2FE8 A;  4PS7 A;  1RRB A;  4W9I A;  1E7U A;  4MDK E;  4DDI D;  5AZF A;  1SIF A;  4RNA A;  2HTH A;  4W9F A;  4C00 A;  4YWG G;  1WX9 A;  2JYT A;  1FMA D;  2L52 A;  1XCQ L;  1N5X A;  4W9K A;  4W9C A;  3NS8 A;  1R4N I;  4KV2 A;  1WGD A;  4HJG E;  3KH0 A;  1P1A A;  4XYC A;  4WWM A;  4DXG A;  1E6E B;  4W9E A;  3AE3 B;  2NTT A;  4K7U A;  1HTO A;  3HIZ A;  3PSE B;  5HHD G;  3VDZ A;  1IYF A;  3PLV A;  4WUR A;  4IM0 A;  3RFZ B;  2K3U A;  3QC8 B;  3RMK C;  1WIA A;  1WJ4 A;  1I4Q A;  3RNB C;  5KHQ A;  2CU1 A;  3PZ8 A;  1KH0 A;  3BVZ A;  4LTU A;  1P3Q U;  2KMC A;  3WIM A;  1SB3 C;  4G3X B;  2J4X A;  1QOG A;  2WDT B;  1OEY A;  4LNO A;  2X8X X;  2JXT A;  4M00 A;  4JGH B;  2H88 B;  3NOB A;  4M8N A;  3A9J A;  3M62 B;  4WQO B;  3EA6 A;  5GMV A;  3WCQ A;  2OJW A;  1EU3 A;  1WGH A;  2KJH B;  1BUI C;  3Q3M C;  2MBH A;  3GZN B;  2Z0D B;  2K6Q A;  2RGF A;  3ZTD A;  2M0A A;  2N1W A;  1WZ3 A;  3T3N A;  3RZF A;  4BKS D;  2LRW A;  3V6E B;  1TS4 A;  4FJY A;  4OW0 A;  3C19 A;  4LDT B;  1JRP A;  4F8C B;  1YOV B;  3APF A;  1NBF C;  2ZW0 A;  2D3G A;  2NPT B;  1V81 A;  2D3B A;  2H89 B;  3FKY A;  4BZA A;  1I4H A;  4HXD A;  4DXA B;  4GGQ A;  2K8B A;  2LD9 A;  4M0W B;  2YLM A;  2FBW B;  2BT6 A;  3TMP B;  1VLB A;  4EZL A;  3ZLZ A;  1MHH E;  3E56 A;  1E90 A;  1WYW B;  2KAC A;  2Y5C A;  1UUP A;  3ZIM A;  1YMH E;  2DNF A;  2KXJ A;  4DHJ D;  2QSD A;  4ZOH C;  3AE5 B;  2WXK A;  1IGD A;  2UU7 A;  3I57 A;  4IG7 B;  4NAM A;  1UGJ A;  1FIQ A;  5DPR A;  2JT4 B;  1XXG A;  2ACZ B;  4L2Y A;  2N9K A;  2LHD A;  5D6J B;  1L5P A;  2LUE A;  3E9S A;  3HRD D;  1RWS A;  2YVC A;  2OOB B;  3NUH B;  2K9X A;  3UF8 A;  3PGE A;  4PK1 A;  2B3A A;  2JZ3 B;  4US9 A;  2IJ0 A;  4I6L B;  3VRA B;  2XEW A;  2CU3 A;  2GBJ A;  1NYR A;  1E10 A;  1V86 A;  1WF9 A;  2DBY A;  1WFY A;  2G3Q B;  2IGH A;  5E6N A;  3V61 A;  4GSW A;  3U30 A;  3OLM D;  3GE3 C;  2M56 B;  2IYD B;  3N32 A;  4RFB A;  3CST A;  3D32 A;  1FPY A;  2NMQ A;  2D3C A;  3EHV A;  3N1X C;  1XO3 A;  4ARI A;  1KTK A;  2KQS A;  3C8Y A;  3HVD A;  2AEH A;  4JL9 A;  2FIF A;  2PW9 A;  5AUI A;  3VUX A;  2MHJ A;  4FUL A;  2N9L A;  2Q5W D;  2KYW A;  1FFU A;  5H8Y E;  3BK1 A;  3NVW A;  1C78 A;  1L4D B;  1YX6 B;  1UWM A;  2RDH A;  2INN E;  1E7V A;  5CX3 A;  4RMA A;  2KWU B;  1RYJ A;  3OAW A;  4ICU A;  3UIP B;  3ZNG C;  3WAL A;  3AE4 B;  4E74 A;  3CF6 E;  1UZX B;  3GOE A;  1ISN A;  3AEG B;  2N7J A;  3ZUN A;  2VZK D;  2DX5 B;  1MJD A;  3SFD B;  1JWB D;  4HEA 1;  2DZI A;  5CHW A;  5E6J A;  1WX7 A;  4HRS A;  3L16 A;  4A20 A;  5JZE B;  3L4P A;  1S3S G;  1J8C A;  2CJO A;  2M17 A;  5C1Z A;  2RPQ A;  1GB4 A;  2ZPY A;  3FIL A;  1Q0W B;  4WH4 A;  1YQ3 B;  4EOY A;  4BVU C;  4KDL B;  4WJO A;  2LGS A;  3ZDT A;  2ZVO A;  2AQ2 B;  1WI0 A;  2WXG A;  3DOW A;  3PHW B;  4HRO A;  3ZRC A;  1RFA A;  3H8H A;  4P16 A;  3JVZ X;  4HPM B;  4S0R A;  3PS6 A;  1FEH A;  3ZNZ B;  1ZXI A;  1L2N A;  3DBS A;  1H7X A;  2FCQ A;  4KGR A;  1FCC C;  1B9R A;  4ASW C;  3V6C B;  2WXH A;  2K39 A;  4WQM A;  3WA0 A;  3DVN U;  1ZKH A;  2I38 A;  4BKT A;  3ECI A;  3AEE B;  1MG4 A;  1UD7 A;  3AB5 A;  1QQR A;  2EMS A;  4HK2 A;  3W1Y A;  2K8C A;  4AOF A;  4C7Y A;  1OQR A;  3VVW B;  2G4D B;  3IT4 B;  2N9X A;  3GE8 C;  4NPN A;  4B0E A;  2PPH A;  5I4D A;  3IAM 1;  1IP9 A;  2Y3A A;  4NAW A;  3UQA A;  4TSS A;  1FNU A;  3Q8C A;  2VH1 A;  1CQV A;  2KLG A;  5BMH A;  1ACC A;  3WAP A;  2N7D A;  4XX5 A;  3TIX A;  1C9F A;  2JVC A;  1H7W A;  1XLP A;  4A6Q A;  4FXC A;  3RD2 A;  1TYG B;  1FRD A;  4RGM A;  4AS1 A;  2O2V B;  2L1A A;  2QEJ C;  1D5Z C;  2J53 A;  4IM2 A;  1MFW A;  2MBO A;  2DZJ A;  4ZRJ A;  2WXM A;  1FNV A;  3N1Y C;  1ET9 A;  1D4B A;  2ZZP B;  2PMV A;  2WXQ A;  4HPL B;  2WS3 B;  1OEY J;  4DQO C;  4ANX A;  2BKF A;  3KW5 B;  3R8B A;  4JPS A;  3IG3 A;  5CHF A;  3ZQ4 A;  1T5X D;  5EE1 A;  5FKA C;  1MPE A;  1STE A;  3A33 B;  5BMI A;  3AUL A;  4EFO A;  4ZYN A;  3AEC B;  4WJP A;  3Q8A A;  4HDQ A;  1EU4 A;  1ENF A;  2DYM A;  5AEK B;  3TL5 A;  3A9K A;  4IKG A;  2DZM A;  5EE0 A;  2KWC A;  5FR3 A;  4J3O D;  4ANV A;  3HK0 A;  3HHM A;  1D5M C;  1C4P A;  4HLE A;  2JZZ A;  3KUZ A;  1JML A;  2MRP A;  1SSN A;  4XE0 A;  2J0K A;  3PRE A;  5J2R A;  2KQ7 A;  2VH2 A;  2HE7 A;  1QOB A;  4DBG A;  4M02 A;  2DEN B;  4H2A A;  1BML C;  4C7Z A;  1J7A A;  5T8I A;  3AED B;  3RZW C;  2QHO A;  4MJS A;  3DVG X;  1I4P A;  2OHF A;  4C56 C;  3Q3F A;  1GAQ B;  1YD8 U;  1D6E C;  1K8R B;  1FCL A;  1VD2 A;  3AE9 B;  1R4M I;  1C3T A;  1PDX A;  2FCN A;  4RF1 A;  4MGY E;  3V62 A;  2QMT A;  1WGK A;  4FAD A;  4BAX A;  2RR9 A;  1XCT L;  2IO3 B;  4G0N B;  2BPS A;  1WXA A;  2RDG A;  5G5H A;  1RM6 C;  1T0S C;  2FID A;  2GBM A;  1IPG A;  2LWP A;  1PGB A;  4PT5 A;  1Q5W B;  1CJE A;  3Q69 A;  3R66 C;  3RI7 C;  2RD0 A;  4DXF A;  4CQN A;  2BYT A;  3V3X A;  2K6D B;  1TKY A;  4F7Z A;  2CHZ A;  2GOW A;  4ZHO A;  4N58 A;  2J7Q B;  2L0F A;  1E8Z A;  1L6U A;  4HWI B;  1WGY A;  3VUW A;  4MH0 E;  2WLB A;  1OQQ A;  2IDY A;  3FIL B;  3L17 A;  4RM9 A;  3HVZ A;  3QHT A;  2LFI A;  3SD5 A;  3PZ7 A;  4WAF A;  2IBI B;  1I4R A;  3WAO A;  4NJ7 A;  4LJO B;  3MJ5 A;  1YN4 A;  2INP E;  1N60 A;  2KO3 A;  3RNE C;  5AUK A;  4NJC A;  1K53 A;  4MH8 A;  4YTN B;  2B76 B;  4OZC A;  2LGY A;  5C3J B;  3ML8 A;  1NI2 A;  3NVV A;  4NZL B;  3KUD B;  1CZP A;  1D5X C;  4MJS B;  2WWZ A;  3ML9 A;  4NQL B;  3O13 A;  4NY0 A;  3T3O A;  3Q8E A;  3N30 A;  2K5P A;  1TY0 A;  3PRM B;  1FFV A;  2D07 B;  4DDG D;  2EKE C;  3L0W B;  4ICV A;  1F9J A;  4RGO S;  1MI0 A;  2MW5 A;  4A55 A;  3I5J C;  2KAN A;  1RAX A;  4EUT A;  3SEB A;  2MBB B;  3RNA C;  1JWS D;  3QX1 A;  2FNJ B;  1V8C A;  3QA8 A;  5G55 A;  1R4M B;  3ONS A;  2AL3 A;  1Z2M A;  2KC1 A;  3DCG A;  4II3 B;  4JWU C;  4A3P A; 
#chains in the Genus database with same CATH homology
 3TEW A;  1EWY C;  1XLO A;  2PTL A;  3N9Y C;  4RF0 A;  3ZYY X;  4US9 A;  3NVZ A;  2IJ0 A;  1UWX A;  5EE3 A;  3VRA B;  2CU3 A;  1VRA B;  1AW7 A;  2J42 A;  2XNA C;  1NYR A;  3RPF C;  1E10 A;  1K52 A;  2DBY A;  2BB6 A;  3AMZ A;  2WXP A;  2JU6 X;  3Q8F A;  2G1E A;  3BYT B;  1GB1 A;  2IGH A;  4GLS C;  2JZP A;  1ROE A;  1QOA A;  2M56 B;  3W1S A;  4RFB A;  1N62 A;  2JQR B;  1C76 A;  2VZK B;  2BBC A;  2NMQ A;  2LEK A;  1OFF A;  3CIR B;  1XO3 A;  2HTM E;  4ARI A;  2JWU A;  4TQ1 A;  1KTK A;  1C4A A;  4A90 A;  2WXL A;  5D7G A;  1HA5 A;  3C8Y A;  2WXR A;  3HVD A;  4B0M A;  1NEK B;  1L0X B;  2PW9 A;  2EKI A;  5AUI A;  4GDL B;  3B2G A;  2N9L A;  4JE3 B;  1JAL A;  1JWA D;  3NRZ A;  4AQ7 A;  1VZ7 A;  2Q5W D;  2V4I B;  1FFU A;  1FD6 A;  1ZP0 B;  4Q2J A;  5BYS A;  1JWU D;  1WXQ A;  5H8Y E;  1TS3 A;  3P63 A;  3BK1 A;  2IGG A;  1TY2 A;  1TKG A;  2N0S B;  1ZOY B;  3NVW A;  1C78 A;  2NTS A;  1L4D B;  1UWM A;  1NI3 A;  3ETR A;  1TJE A;  2RDH A;  4ZYS A;  2INN E;  1F77 A;  1HZ6 A;  1L6V A;  1RYJ A;  4RH6 A;  3FC4 A;  1R7S A;  2AQ3 B;  3FAH A;  3AE4 B;  3NS1 A;  2MJE A;  1IBX B;  3VR8 B;  3AEG B;  1WWT A;  2GRI A;  2N7J A;  1C4C A;  3MC0 B;  2VZK D;  4XWT A;  1GTE A;  2WP9 B;  1Q10 A;  3SFD B;  1JWB D;  2EEL A;  2W3S A;  3BK2 A;  4MT5 A;  4HEA 1;  3MFG A;  5HG2 A;  4IDI A;  5E6J A;  5MPO A;  1HZ5 A;  4HRS A;  1ZE3 D;  3L4P A;  3MHZ A;  1KFY B;  4KKI A;  3LXF A;  1JCK B;  2CJO A;  1NVI D;  3P42 A;  2BW2 A;  2IPK D;  2V3P A;  4ITK A;  2YEP B;  1P7F A;  1GB4 A;  3GP7 A;  3GS2 A;  1KLU D;  3FIL A;  2RMM A;  4WH4 A;  1YQ3 B;  3ZJT A;  3AE7 B;  1FXA A;  1I4X A;  1XEE A;  1FNW A;  2MEK A;  3Q8B A;  4REZ A;  1ESF A;  2QIE B;  2MH7 A;  2X38 A;  1TS2 A;  3ABV B;  2AQ2 B;  2WXJ A;  2BS3 B;  1GPX A;  2QJL A;  1FM0 D;  1SE3 A;  4YT0 B;  2WXG A;  1YQ4 B;  4HRO A;  3LYY A;  3KQ4 A;  3TUO A;  2W3R A;  1LO5 D;  3H8H A;  4P16 A;  4ZRQ A;  3IXS A;  3TSS A;  1SJE D;  3ZGZ A;  2PIA A;  2GB1 A;  1FEH A;  1K50 A;  2J52 A;  3P4R B;  1T6B X;  1QT9 A;  1E7P B;  1ZXI A;  1AN8 A;  1YN3 A;  3W9C B;  4KGT A;  1JWM D;  1SBB B;  3NVY A;  1H7X A;  2D5G A;  4KGR A;  1FCC C;  1KF6 B;  2V0G A;  1B9R A;  1KLG D;  1BXT A;  5HI1 A;  4L23 A;  1XF5 L;  3P1M A;  3R2T A;  2WXH A;  4ZHP A;  1Y56 A;  4WQM A;  1B1Z A;  1L0Y B;  3AE2 B;  1F2R I;  2I38 A;  4N59 A;  2KMM A;  5GXG B;  4WIP A;  3AEE B;  4ZRP A;  1NEN B;  3AB5 A;  1QQR A;  1QIL A;  1SXT A;  1VDV A;  1JRO A;  3AEA B;  1SIJ A;  1OQR A;  4JX1 C;  5G5G A;  4C7Y A;  5JXV A;  3IT6 B;  3IT4 B;  2Y5P A;  3MP9 A;  1WSP A;  3B9J A;  4B0E A;  2I2Y A;  5H92 C;  5I4D A;  4RCO A;  3IAM 1;  2WDQ B;  4LLG M;  5D3I B;  3TEZ A;  1J7C A;  1AWD A;  2Y3A A;  2M19 A;  4KX6 B;  4TSS A;  3R2I A;  1FNU A;  4US8 A;  3BWU D;  3Q8C A;  2SEB D;  5TSS A;  2AQ1 B;  4XDC A;  3W2D A;  1E9M A;  1CQV A;  2BB5 A;  5BMH A;  4XWW A;  4O1N A;  1VR9 A;  1ACC A;  2WDV B;  2OED A;  2K22 A;  3P4S B;  1C9F A;  2JX5 A;  1E0Z A;  2KAJ A;  1FRR A;  1H7W A;  1L0V B;  1XLP A;  3HUI A;  3TEX A;  3VQI A;  1V1P B;  4A6Q A;  4FXC A;  4OZA A;  5BYQ A;  1CK1 A;  1TYG B;  4OHJ A;  1FRD A;  4A9A A;  4RGM A;  4AS1 A;  2WU5 B;  1MVK A;  1SEB D;  2L83 A;  5BMG A;  2L1A A;  2GI9 A;  1YJI A;  1D5Z C;  2J53 A;  2QEJ C;  1KRH A;  1NYQ A;  1F0Z A;  4M0W A;  3P4Q B;  3LB8 C;  3BII D;  3AEF B;  4D2K A;  1IUE A;  1N61 A;  4OVZ A;  2WXM A;  1GOZ A;  1FNV A;  3U52 E;  1VZ8 A;  1ET9 A;  1PGX A;  1HQR D;  3EUB 2;  1RFK A;  1D4B A;  2PMV A;  3U2S C;  2WXQ A;  2WS3 B;  2E6X A;  2PVO D;  2L32 A;  4DQO C;  2ICI A;  2LHE A;  1VJK A;  1ZDV A;  3VR9 B;  3GB1 A;  3R8B A;  1WYG A;  4JPS A;  1TS5 A;  2R61 A;  4R3D A;  2PKO A;  3ZQ4 A;  1T5X D;  3AH7 A;  4YXD B;  2DLB A;  3AE8 B;  5EE1 A;  1PGA A;  1I4G A;  3NZ3 A;  1ZPS A;  5FKA C;  1MPE A;  1C79 A;  4GDK B;  1EWC A;  1STE A;  4YSZ B;  4YTM B;  2WU2 B;  3AV8 A;  1V1P A;  2AX5 A;  4KGS A;  3UI3 A;  2DWQ A;  4TMA B;  4OZB A;  2JSV X;  3U4E G;  3ZJV A;  1N63 A;  1T3Q A;  2ON8 A;  2LJI A;  5LNK 1;  2BTE A;  5BMI A;  1J7B A;  2KWD A;  4L1B A;  2KDM A;  3J9C A;  3BVM A;  1TZO A;  1YNT E;  4A8X C;  2W54 A;  4UDU C;  1DGJ A;  3AEC B;  2TSS A;  1V97 A;  4YSX B;  3SR6 A;  3ZJU A;  3Q8A A;  4JWS C;  2FUG 1;  1PFD A;  1UNS A;  2XN9 C;  1EU4 A;  3AN1 A;  1ENF A;  2DYM A;  3PO0 A;  4ARC A;  2KN4 A;  4IKG A;  1IGC A;  3AE1 B;  5EE0 A;  4IOI E;  5FR3 A;  4J3O D;  2FE8 A;  1D5M C;  1C4P A;  2WDR B;  3CF4 A;  1JML A;  3U7Z A;  3BYY B;  3W5V B;  4RNA A;  1SSN A;  4XE0 A;  2JYE A;  4N6E B;  2KQ4 X;  2PVG C;  4YWG G;  2JYT A;  1FMA D;  1ZUD 2;  1K51 A;  1N5X A;  1XCQ L;  1QKZ A;  1QOB A;  2L52 A;  3DWG C;  1XLQ A;  3BZD B;  1BML C;  4H2A A;  4HJG E;  2LGI A;  4C7Z A;  1J7A A;  1VZ6 A;  4WWM A;  5T8I A;  3AED B;  4DXG A;  1DOX A;  1E6E B;  1I4P A;  2OHF A;  4C56 C;  1ET6 A;  4RGN A;  3AE3 B;  2NTT A;  3P4P B;  1GAQ B;  5HHD G;  4RGT A;  1D6E C;  4WUR A;  3URY A;  3EGR A;  1FCL A;  3RFZ B;  2K3U A;  4P6V F;  3SFE B;  3AE9 B;  1PDX A;  4RF1 A;  1ZXH A;  2QMT A;  1I4Q A;  3KWV A;  3BVG A;  1WGK A;  2W82 A;  3PZ8 A;  1KH0 A;  1GTH A;  4KKJ A;  2K0P A;  1XCT L;  3BVZ A;  4LTU A;  2BS2 B;  2RDG A;  5G5H A;  1RM6 C;  4MAC A;  4YSY B;  1SB3 C;  3W5U B;  1QF6 A;  4HKQ A;  2J4X A;  1PGB A;  4PT5 A;  1QOG A;  4HKZ E;  1CJE A;  2BS4 B;  1HXY D;  1SE4 A;  1SJH D;  2W55 A;  3Q69 A;  2WXI A;  1TKE A;  1MHX A;  4DXF A;  1FO4 A;  1EM7 A;  4CQN A;  2HDE A;  2MJ3 A;  1ZDX A;  2JXT A;  2BYT A;  3V3X A;  1WRI A;  1TKY A;  2H88 B;  4XDD A;  3AE6 B;  4ZHO A;  4N58 A;  5BYR A;  1A70 A;  1L6U A;  3EA6 A;  3WCQ A;  4EE2 A;  1IBX A;  1QOF A;  1EU3 A;  1V1O A;  3KLS X;  2WLB A;  1OQQ A;  5C2T B;  2ZW1 A;  2IDY A;  1L4Z B;  2RPV A;  3FIL B;  4NAW B;  1BUI C;  3HVZ A;  3AEB B;  4LK0 M;  4USA A;  2WNM A;  3B2F A;  2M0A A;  5EE9 A;  4YTP B;  3T3N A;  1SF0 A;  3VRB B;  1HEZ E;  2LFI A;  3PZ7 A;  4WAF A;  1JW9 D;  1I4R A;  1TS4 A;  4OW0 A;  2LMC A;  1C77 A;  3MJ5 A;  1JRP A;  5FK9 C;  1F2R C;  2YEP F;  1YN4 A;  3OWE B;  1JQ4 A;  2ZW0 A;  2INP E;  1N60 A;  1DYQ A;  3CWI A;  2IGD A;  2H89 B;  4TQ0 A;  5AUK A;  1GT8 A;  2QIL A;  1I7H A;  1K53 A;  4MH8 A;  4NJC A;  1I4H A;  3DWM A;  2SAK A;  4YTN B;  2B76 B;  1PUT A;  1FXI A;  3I9V 1;  5HFY A;  4OZC A;  1PYW D;  5C3J B;  2FBW B;  3NVV A;  4NZL B;  2BT6 A;  2WXN A;  3KWL A;  1CZP A;  1D5X C;  1AYF A;  1VLB A;  3O13 A;  1MHH E;  3E56 A;  4C80 A;  3T3O A;  2DYO A;  3Q8E A;  3IAS 1;  2KAC A;  2K5P A;  2Y5C A;  4MM3 B;  1TY0 A;  1UUP A;  2G9H D;  2PLP A;  2WQY B;  1YMH E;  1FFV A;  1SE2 A;  2QSD A;  4ZOH C;  3AE5 B;  2WXK A;  2LUM A;  1IGD A;  3I57 A;  4RGO S;  4NAM A;  3TEY A;  1UGJ A;  2CJN A;  1FIQ A;  1MI0 A;  1XLN A;  1XXG A;  2WXO A;  1M4V A;  1P7E A;  4A55 A;  2ACZ B;  1QLB B;  4L2Y A;  2WXF A;  1DOI A;  2V3N A;  3SEB A;  2N9K A;  2LHD A;  2E3T A;  1JWS D;  1N5W A;  1L5P A;  1V8C A;  3E9S A;  3HRD D;  1RWS A;  2MJD A;  2Z8L A;  2ONQ A;  3NUH B;  1YJJ A;  1YN5 A;  3V05 A;  2K9X A;  3AM9 A;  4JWU C;  1DOY A;  5D3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...