2H88B

Avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
b'TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
molecule tags Oxidoreductase
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
total genus 71
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h88B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h88B01
3RPFC 1XLQA 1JWBD 3ABVB 5MPOA 1JQ4A 5H92C 1L5PA 1RM6C 2PVGC 3VR9B 2Y5CA 4HROA 5EE1A 3AE8B 1N63A 1YQ3B 2WDQB 1N60A 4WQMA 4ZHPA 2JQRB 2WP9B 3CIRB 1N5WA 1RFKA 2W55A 1FXIA 3AB5A 3LXFA 5G5GA 2QIEB 3AH7A 1L6UA 1QOFA 1TKGA 2OHFA 1TKYA 1CJEA 3VR8B 1CZPA 1TKEA 1UWMA 1E6EB 3AE6B 1ZUD2 2PVOD 2QJLA 3FAHA 3P63A 1FRDA 2M19A 1YJJA 2MJ3A 3B2FA 3AEAB 2CU3A 1FM0D 1SB3C 2BT6A 3DWGC 1XO3A 1FFVA 3LB8C 2W3RA 3HUIA 2HTME 3AN1A 5EE0A 4N6EB 1J7CA 1H7WA 1RYJA 1ZP0B 2DBYA 1L0VB 1ZOYB 2JX5A 2PIAA 1GPXA 2WS3B 2K22A 2WU5B 1VLBA 1T3QA 4JWUC 4KX6B 5C3JB 1JRPA 1L6VA 1N62A 2KMMA 5EE9A 5G5HA 1NEKB 3NVYA 1QF6A 2WLBA 1SF0A 1R7SA 4USAA 1GAQB 1KRHA 1WRIA 1E10A 2BS2B 4LTUA 3NRZA 1PUTA 1AYFA 1J7AA 1NYQA 1JWAD 3ETRA 2DWQA 1OQRA 1KFYB 1N61A 1WXQA 3HVZA 3AEFB 1OFFA 1NENB 2H89B 1VJKA 2W54A 1YJIA 3CF4A 3HRDD 2BS4B 5H8YE 3AE5B 1GTHA 3AM9A 3AEGB 4YSZB 3P4SB 2L83A 3DWMA 1GTEA 2ACZB 3AEBB 3WCQA 2K5PA 1QT9A 3AE3B 1DOIA 1WWTA 3B9JA 4C7ZA 1WYGA 1A70A 1GT8A 2G1EA 1NYRA 4YSXB 1FIQA 1N5XA 2N0SB 3L4PA 3SR6A 4A9AA 1F0ZA 4FXCA 3AV8A 1EWYC 1V97A 2EKIA 2MH7A 3W5UB 2MJDA 2CJOA 4US8A 2WQYB 3AE9B 2M56B 3EUB2 2E3TA 3AE4B 4JWSC 1VDVA 4ZOHC 5AUIA 2WDRB 3VRBB 4US9A 2L52A 3AE1B 1FRRA 1PFDA 4N59A 1TYGB 4YTPB 3W5VB 3FC4A 1DOXA 2KAJA 4C80A 1V8CA 5AUKA 1FO4A 1E0ZA 2WDVB 4YSYB 2PKOA 3P4QB 1IUEA 4JX1C 1OQQA 1XLPA 2MJEA 1KF6B 1FMAD 3ZYYX 2BS3B 2AX5A 4C7YA 1WGKA 3AECB 3P4PB 3P1MA 3CWIA 3PO0A 3AE7B 1NVID 3NVWA 1B9RA 1E7PB 3B2GA 1FXAA 3AEEB 4WWMA 2CJNA 4ZHOA 3KWLA 1XLOA 1H7XA 2K9XA 4N58A 1QLBB 2H88B 4ITKA 4YT0B 5EE3A 1TJEA 3SFDB 1NI3A 5GXGB 2WU2B 1DOYA 1QOGA 2B76B 2FBWB 4YXDB 3BIID 1AWDA 1XLNA 1JW9D 1RWSA 1ROEA 1QOAA 1SIJA 1JROA 1JALA 5C2TB 3NVZA 3AEDB 3P4RB 1FFUA 4YTMB 1ZXIA 1PDXA 4YTNB 3AE2B 3NVVA 4P6VF 1YQ4B 3AMZA 4HRSA 1J7BA 4IDIA 1E9MA 1DGJA 2Q5WD 1I7HA 3W9CB 3NS1A 1QOBA 3VRAB 2W3SA 2LEKA 3SFEB
chains in the Genus database with same CATH superfamily
4OW0A 2AYOB 3ECIA 4W9HA 1JWBD 3PREA 3ZNID 2MP2B 1XCTL 3LXFA 3CIRB 2B3AA 4A55A 4HJGE 5JXVA 2D5GA 2BKFA 1TKEA 2DYOA 4AJWA 3AE6B 3E56A 2PTLA 4KZCA 4M8MA 3M95A 1WXMA 5D3DA 1T0YA 1VZ6A 1KOTA 4B95A 4AUQC 2K0PA 1H7WA 2IPKD 1AARA 2NBUA 4KX6B 2D3CA 1TS5A 1NEKB 2YEPB 5E6NA 4CYEA 1E10A 4A8XC 2R61A 2KX3A 3PSEB 4LNNA 1PGBA 3WAOA 2WXPA 2IJ0A 1NENB 4ANWA 2KQ4X 3JYUA 3LJ3A 2N9EB 4MSQB 1WM3A 2PPHA 4KDIC 4XC2A 1V81A 2BW2A 5T8IA 2KVRA 3EFCA 3IVFA 5HHDG 3AE9B 3UF8A 1K8RB 3KVFB 4DXFA 1HXYD 1D5XC 1PYWD 2C5LC 2JZ3B 1GUAB 2DZKA 1R4MB 3Q8FA 3KUDB 1V1PB 3EFUA 3ZYYX 1UGJA 3R2TA 3AE7B 2NMQA 4LDTB 2CJNA 4GDKA 3MHSD 4HDQA 3BINA 4KKIA 2LJ5A 3EC8A 4GMVA 1UBIA 1WJUA 4GDLB 1XLNA 3IHPC 1JALA 4KGTA 5AZFA 2MQJA 2MCNB 4JGHB 1LGRA 1YJ1A 1E9MA 1QOBA 3L4PA 3RPFC 4KIKB 2N1WA 1RM6C 2Y5CA 2WDQB 3Q3MC 2JY6A 2AL3A 3H6NA 2IO2B 3VDZA 1Q0WB 4XYCA 1ZUD2 1ISNA 3K9OB 3P63A 4JQWC 4EZJA 3FILA 5J2RA 2BT6A 2JT4B 4LJPB 2JXTA 2KLGA 5CHVC 2R2QA 3KH0A 5C1ZA 4AP4C 1STEA 2N4FA 4WQOB 4I6NB 3KQ4A 1YN3A 1M94A 3DBHI 2XEWA 1IBXB 2FCNA 1WYWB 2MEKA 3GB1A 1V49A 2WDTB 3ONSA 3AEBB 2ACZB 4XE0A 2RPQA 3N9YC 4ANVA 5BMIA 3Q3NC 3ML8A 1EWYC 3N30A 2RD0A 1HE8A 4MSMB 4US9A 3GOEA 4BOZB 2R2OA 3CSFA 4W9CA 3WALA 2LGIA 4OZCA 4HCPB 2BS3B 3H8HA 3CWIA 3QA8A 2KTFA 4NAWA 4BAXA 4IM3A 3V3XA 3SD5A 1TZOA 2PW9A 4MELA 4EE2A 5EE3A 4AS1A 2KDBA 2RDHA 1KLGD 5J17A 2IO3B 3UQAA 1Y56A 3M63B 1Q1OA 2N9KA 2Y5PA 5E6PA 4YTNB 2GB1A 2KVZA 4EZKA 2L7RA 4HCNB 2BYVE 5C23A 1C3TA 3VRAB 2W3SA 4HKQA 3SFEB 2NTTA 4HEA1 4ZYNA 2D11A 4WAAA 1JQ4A 2PVGC 3T8MA 3ZNGC 3DBHB 3ZJTA 2ZJDA 1DOXA 2QJLA 4OZBA 3GZNI 1GNUA 3V61A 1TS4A 2CU3A 3C0RB 4P1CC 3Q3OC 1V86A 3Q69A 3JW0X 1ZOYB 4F1SA 1PQSA 1WY8A 2IBIB 4FLHA 4ARCA 1QF6A 5DPSA 1WZ3A 1A5RA 2I2YA 3PZ7A 2KWCA 2QILA 3ZRFA 1MG4A 3VH3B 1D3ZA 3BYTB 4KGRA 3CF4A 2C60A 2LGSA 3FILB 3UI3A 3MHZA 2W9NA 1TIFA 2G1EA 4FADA 3OAWA 1N6ZA 1F1HA 1G6JA 1B1ZA 2EKEC 2KMAA 4ZOHC 4BKTA 1VRAB 4URKA 4YTPB 2KWUB 1OEYA 1WXSA 1LM8B 2KWDA 1FMAD 1TY2A 3AECB 4GDLA 1FXAA 3VH4B 3AU4A 1ET9A 4BOSC 1QLBB 3V62A 1OQYA 3EHVA 3PLUA 3MC0B 1GOZA 3SFDB 5GXGB 2WU2B 3ZNZB 2INPE 4FHKA 3APCA 2C9WB 1JROA 2KJ6A 2WWZA 4WJQA 1P3QU 4F7ZA 1FFUA 4YTMB 3TBLD 1UELA 3DQVA 2V3NA 4A20A 4C00A 3W9CB 4I6PA 3BYYB 1VZ8A 2MX2A 2UWQA 5KHQA 1L5PA 3QAQA 3QCAA 1P7EA 2W55A 4R3DA 3AH7A 3SEBA 3M3JA 1HEZE 1MG8A 3GE8C 1CJEA 3VR8B 2BWES 3W2DA 4LCDE 2KC2A 1PGAA 4II2B 2JZZA 4REZA 4YL8A 4IWQA 1FM0D 1E8WA 2OEDA 2WXMA 4GXBA 1IBXA 2KHWB 2KKCA 1J7CA 4DHZE 5C3JB 3DVNU 4XWTA 2N9PC 4USAA 2G9HD 1JWAD 2MBQA 5E6OA 1D4BA 3ZDMC 2LVQA 4MH0E 3P4SB 2ZCBA 1WH3A 2GMIC 2IGHA 2N0SB 2MHJA 2X8XX 2J4XA 4Q2JA 2FAZA 1WRDB 2DZJA 5AUIA 3VRBB 3UIOB 2L3ZA 1TYGB 3APFA 3FC4A 3KW5B 3P42A 1E0ZA 4YSYB 1EU3A 1JRUA 2AX5A 1UGMA 1NI2A 1JMLA 2DYBA 3PO0A 2CS4A 2AQ1B 1WI0A 2H88B 4GDKB 2AQ2B 2JSVX 4D2KA 2N7JA 3PV1A 4C56C 2QCZA 4MM3A 2WXOA 4E74A 1JW9D 4PYUA 1OTRB 2LGDA 3BK1A 5HG2A 1MHHE 2VH2A 2IO0B 4IUMB 2WXGA 3R3MA 3ZLZA 2A4ZA 4K7WA 2WGSA 2IO1B 1N60A 3VAWA 1RFKA 1T6BX 4OZAA 2M17A 4BKSD 2ZPYA 1XT9B 2OHFA 4HKZE 4M8NA 1T0QC 1K53A 1I4HA 1C76A 3PVLA 1ZDXA 3KYDD 4DDGD 2L05A 1SSNA 1WGGA 3Q3JA 2KN4A 3W1YA 3VVWB 3R2IA 1I4PA 2ASQA 1SF0A 3JVZX 3ZRCA 5CHWA 1TZ1A 3R7QA 4MGZE 1DYQA 2KZRA 3PGEA 4EOYA 5IA7A 4GOCA 3BVZA 2BKRB 3ZTDA 2MSED 2MH7A 2WXQA 2MJDA 1E7UA 4W9EA 2MBEA 3AE4B 4IM2A 2QHOA 2JYEA 3IAM1 4HWIB 3QHTA 1SGHA 4W9IA 3OJ3A 3Q14C 1WGDA 4H2AA 4XX5A 1FO4A 3T3NA 2PKOA 2X38A 2KOXA 3X0WA 2D10A 3AXCA 3DBSA 4MH8A 4WWMA 2N7EA 1HZ6A 3RNAC 3KUZA 1OGWA 2CHXA 3TIXA 1F2RI 2WX0A 3N1XC 4P7IA 4A3OA 3UIPB 1TS3A 2GBKA 4P6VF 2FCSA 2V3SA 2DNFA 3RFZB 4ACFA 4W9LA 1JWSD 1BUIC 1ZXHA 3NZUA 3RMKC 3WAMA 4TSSA 1D5MC 1N5WA 1ZKHA 3AB5A 1L4DB 2C7MB 2K39A 4C7YA 1SE4A 1WX8A 4MEMA 1YN5A 4NJ7A 5IOIA 2BF8B 3LYYA 4NQLB 5EE0A 2RR9A 4IOIE 5IO9A 1WJ4A 2GBNA 1L0VB 5CX3A 2WU5B 1ZW7A 4HPMB 3NJTA 4K81A 3C8YA 4E3CA 3V6CB 3PRPB 3RN9C 3AEFB 1RAXA 4QAYA 4XGAB 4RM9A 2LUEA 2K8CA 3QARA 4AOFA 5AZGA 3L17A 1UNSA 1RFAA 1EWCA 3ZNHB 4WAFA 3PPAA 3W5UB 2CJOA 2MWSB 1C4AA 2GBMA 2OOBB 4RGMA 2FE8A 2Y3AA 1F52A 1GJZA 2PMVA 3CMMB 2KK8A 1XD3B 3A4SC 1PGXA 2WDVB 1WXVA 1FCCC 2E6XA 4K7SA 2RSUA 3BVGA 3PS6A 4P16A 3QQ8B 3GE3C 3KWLA 4JIOU 4GGQA 2KNBA 1E8XA 1L4ZB 5D6JB 4CHKA 2PE6B 2JXXA 3VTVA 1XF5L 1VD2A 1TY0A 3PRMB 2KDMA 1PDXA 1CK1A 3PHWB 3PZ8A 4A6QA 5D3IB 3PZDA 2KC1A 5E6JA 1BMLC 2MRPA 3GZNB 1P98A 1XLQA 2NCNA 1R4MI 4G3XB 3ZVVA 2QIEB 3BVMA 4ZRIA 1C4PA 3H7PB 2O2VB 4ICVA 1YOVB 4RGOS 2V0GA 3WAPA 2KJRA 1T5XD 1RYJA 3MFGA 2JX5A 2JYTA 1D5ZC 1EO6A 1T3QA 3U2SC 1L6VA 3WIMA 5EDSA 4KVGB 1WXAA 1GAQB 2LXCA 4X57B 2CU1A 3S2AA 1H4RA 4XZ4A 4BZAA 1JCKB 2AEHA 1MFWA 4DHJB 2ON8A 4OVVA 1WWTA 3I9V1 1P7FA 3NS8A 4NAMA 4JPSA 2ZCCA 5AEKB 4US8A 1WFYA 3EGRA 4NY0A 4MJSB 1C79A 2GI9A 4KGSA 1RLFA 3MP9A 4PYZA 4WJNA 3OJ4B 4JX1C 1UH6A 4WIPA 4NAWB 3UINB 1UD7A 2V3PA 2VZKD 4ZHOA 3RT3B 2K6QA 4GSWA 4ITKA 2LMCA 3O13A 2DYMA 2NR2A 3SU8X 5LXIB 3RUIB 2SEBD 5CTRC 2LVPA 3MJWA 3DVGY 2LXAA 1WSPA 3H1UA 1FXTB 3NVVA 1L0XB 5BMHA 5L95C 1DGJA 3O65B 1HTOA 1LO5D 2LFIA 1JWUD 3RZFA 3VXWA 3TEXA 2ZVNA 5MPOA 2LVOA 4L2YA 1GB4A 3ZDTA 1KLUD 1N63A 1WE7A 5JH5C 4PS3A 5D2MB 5KHOA 2TSSA 3TUOA 4N6EB 4W9FA 3M62B 1UWMA 3T9LA 2RDBC 4LNKA 4EUTA 4KIKA 2FCQA 1XO3A 2K8HA 2L76A 3V6EB 3L10B 2INCC 2WYQA 4G50A 1QKZA 2WNMA 4JWUC 2IDYA 3OG5A 1E8ZA 3HHMA 2QSDA 2K1FA 2AQ3B 1WJ6A 3ETRA 4G0NB 1OQRA 4BKSA 4DHJD 3GP7A 1GTHA 1J0GA 1XEEA 3WANA 3TEYA 1Z2MA 1GT8A 4B6WA 4YSXB 3DHGC 4A9AA 3AV8A 3VUXA 4NJCA 4CO7A 3L08A 3Q2AC 4N9F4 3WA0A 2KAJA 4C4VB 2RGFA 2O6VA 2ZW1A 1IUEA 2J7QB 1H8CA 3ZGZA 5IKCM 1E7PB 3AEEB 2J53A 2RDGA 1C77A 1VR9A 1SJHD 2ZPNA 2N9LA 3IT4B 5AZHA 4LLGM 3SHQA 2GRIA 4E71A 2B76B 2L1AA 3NZ3A 2AWTA 1QOAA 1E8YA 4S17A 3AE2B 3AMZA 2CKHB 1TTNA 3AI5A 2BGFA 4KZ0A 2ZVOA 2FUHB 5LNK1 2MP2A 2ZNVB 3Q3FA 4B9KA 4WWOA 1BXTA 1YNTE 4IWPA 3PLVA 1LFDA 1CZPA 4IWOA 3FAHA 3ENEA 3R8BA 4FJVB 4M0WB 2Y5BB 4M0WA 2FCMA 2KN5A 1ZP0B 3V60A 2KMMA 2KFJA 5IP4D 4AWJA 2HDEA 2GOWA 3RYTA 2LGYA 1R7SA 4BBNF 5TSSA 1D6EC 1J7AA 1OEYJ 1EF5A 3CF6E 3VTWA 4ZDVA 1V1OA 4II3B 5H8YE 3IG3A 3AEGB 3PHXB 3N1ZC 1A70A 2KTRB 3R66C 3ZXRA 2KXJA 1MHXA 2GBRA 5FKAC 3DDCB 1PFDA 5DCNA 4BVUC 4F8CB 3ZTCA 2C7HA 2ONQA 3PRZA 1EU4A 2JPHA 1YD8U 1WM2A 3I5JC 1K51A 2IGDA 2KDIA 4HJKA 4J6IA 3NG0A 1DOYA 1AWDA 1FEHA 1UF0A 1KM7A 3MC9A 1E90A 1S1QB 3IBEA 3JSVA 3NVZA 5L83A 3AEDB 4LNFA 1UUPA 3JSVB 2KMCA 3ML9A 2IY1B 1J7BA 2Z0DB 2LD9A 2LRWA 1MVKA 4NPNA 4NJ6A 2DLBA 1YIWA 4L1BA 2LI5A 4LJOB 2WXJA 1WGYA 1WX9A 3EECA 2DENB 1WGHA 2JQRB 4EEWA 3HVDA 3DBLI 2J52A 4K7UA 2C7NB 2XBBC 2EMTA 2D2QA 1WX7A 3AN1A 1F9JA 2XK5A 3ALBA 2WS3B 1E5WA 2V4IB 3HK0A 2N1VA 2LJIA 4DQOC 4W9JA 1AN8A 4LTUA 1RRBA 3N32A 3PTFC 1KJTA 2W54A 2JUOA 4YSZB 1YQBA 2L83A 3RD2A 3A9JA 2HD5B 1YN4A 3I3TB 2PJHA 5FK9C 1V5OA 4A90A 2WQYB 3ZO5B 2JRIB 2WDRB 3U7DA 3FKYA 1ZDVA 1QZEA 2CHWA 3VUWA 3NUHB 1P0RA 5AUKA 2RMMA 4W9DA 1LXDA 2MJEA 5DPWA 3RI7C 2NBWB 2G4DB 4ZYSA 1B9RA 1V2YA 1IGDA 1Y8RC 2KJHB 3TJPA 4ZRJA 4BFRA 5DPRA 2K6DB 3U8ZA 4RCOA 1FNUA 4YXDB 1SXTA 3H9DA 3J9CA 1ROEA 2QMTA 2KFKB 3DCGA 5JZEB 1TT5B 2KFKA 1E7VA 3NS1A 3ZW3A 2GLSA 2A5UA 2JRHA 3K9PB 5EE1A 4GIVA 4GB9A 3AU5A 3ZXVA 1L6UA 1QOFA 1MJDA 1FRDA 2V9HA 2UYZB 3AEAB 2OJRA 3BK2A 1WR1A 1CQVA 4DDID 1P1AA 2LHDA 3UQBA 4OVZA 1ACCA 4LNIA 2BVCA 3KLSX 3W1SC 1K52A 1SE3A 1GC6A 1F77A 1I4RA 3NRZA 3R7RA 2ZEQA 1N61A 1WXQA 4DWFA 1SIFA 2JWUA 4WURA 5IAAC 2JZPA 4FBJB 3AE3B 2Z8LA 1S3SG 1NYRA 2KDFB 2BQQA 2FNJB 3KUCB 3LDZE 1GC7A 2M56B 3DVNV 3VHTC 5HFYA 3APDA 4N59A 1AW7A 3A1QA 3B1LX 2KLCA 3P4QB 2NVUI 3N20C 2WHIA 4JE3B 2V1YA 1I35A 2NTSA 3P1MA 1QQRA 4M01A 3A9JB 3TSSA 3MTNB 2KANA 3UGBB 2K9XA 2XN9C 2NS5A 2N7DA 5G2NA 2KWVB 4TKNA 2V4LA 2KO3A 2EELA 3Q8EA 4ASWC 2WXHA 4XWWA 4RMAA 4EZLA 1V6EA 4WWNA 1YQ4B 4DBGA 2HE7A 3NHEB 4WWPA 3DBRB 2AL6A 2SAKA 2PLPA 3VTUA 4KKJA 2WXRA 1EF1A 2K8BA 3E9SA 1TKYA 4K3CA 2G3QB 2PVOD 5D94A 4ZRPA 2VH1A 3CSTA 3HM3A 2M19A 2LZ6A 2FIFA 3B08A 3DWGC 3D32A 2CR5A 3QWZB 3U4EG 1UZXB 5FR3A 4ANUA 2MA9B 1VLBA 2G45B 3DHIC 3Q8CA 3NVYA 1NDDA 2WXKA 2QDFA 1WRIA 4K1RB 5BMGA 5DPTA 2J0JA 4RF1A 2DWQA 1EUVB 3L16A 1HZ5A 4OHJA 1L2NA 3HRDD 2NPTA 2M8SA 3DWMA 2BB5A 1GTEA 3ZKJC 2D3AA 1WYGA 1ENFA 3N3KB 1FIQA 4M02A 1I4QA 2XNAC 1HA5A 4FXCA 1J8CA 5JHBA 1ET6A 1KH0A 2O6VD 2WXIA 2D3BA 4M00A 1OQQA 3DBRI 2I38A 1NVID 1C1YB 2JU6X 3KWVA 3QX1A 4KDLB 1GB1A 4N58A 2L32A 2JWZA 3A4RA 1TJEA 5GMVA 2MBBB 2ICIA 1MPEA 4RFBA 4LNOA 3V05A 2BYEA 1IP9A 4IDIA 2Z0EB 3BIID 2LEKA 1C78A 2REXA 4HROA 2MW5A 2WP9B 4GLSC 1E6EB 2L0FA 1IGCA 4K3BA 3B2FA 2QC8A 3NY5A 2ZZPB 1Q5WB 4BKGA 4L23A 2W3RA 1SBBB 2DBYA 3ZIMA 2K3UA 2KX0A 2XK5B 2O2VA 2WLBA 4NZLB 4ZRQA 4MGIE 5HI1A 4OVUA 3OWEB 4RGNA 2BS2B 2YLMA 3RZWC 4HLEA 1KFYB 1M4VA 3QK0A 2FUG1 2JVCA 3AM9A 1TBEA 4PS8A 1CMXB 3L13A 3A1QB 4NNJB 3Q6BA 2EKIA 1UBQA 3ZQ4A 4GN1A 4HPLB 4J3OD 5I4DA 3HIZA 2O6VB 3QIJA 4TMAB 2UU7A 2KT7A 3ZUNA 1FRRA 4WJPA 1XXGA 2M0XA 1TGZB 1KF6B 2NPTB 1VCBA 1BT0A 2BBCA 3U52E 3P4PB 2J0KA 4JL9A 4BBNC 4MT5A 2G4SA 1QILA 1XLOA 1H7XA 4TUUA 1JWMD 1V9JA 2W82A 5FR6A 4YT0B 1ESFA 3NOBA 2ZW0A 4TQ0A 1HQRD 1KLVA 1LQBA 4IKGA 1SIJA 3I57A 2JF5A 1J19A 4HRSA 2HTHA 1T0RC 1I7HA 1IPGA 3L0WB 2DZMA 2RPVA 3GS2A 5G5GA 3W1SA 3DVGX 1FCLA 3A9KB 3Q8BA 2KD0A 1ZPSA 4MM3B 2BYTA 2KQSA 2YEPF 3IXSA 1GG3A 1YJJA 2WXNA 2BTEA 1TS2A 4YWGG 2BYFA 2K22A 3RNEC 2ZNVC 5G5HA 2WX1A 5EE9A 4MGYE 2DX5B 4B0MA 4IG7B 2BWFA 1Q10A 4MJSA 3EA6A 5IN7A 4XDDA 1AYFA 2DAFA 2YVCA 1OFFA 4IM0A 1VJKA 2IZVB 2M1MA 1YJIA 3AE5B 1Z5SB 3P2BA 3C19A 3VFKA 2K5PA 1DOIA 4B0EA 3B9JA 4C7ZA 3SR6A 1F0ZA 1WF9A 4RH6A 3H7SA 2K25A 4JWSC 1P9DU 1WJNA 2L52A 5BYRA 3ZJUA 1KTKA 2J42A 1V8CA 2HJ1A 5G55A 2GBJA 3BWUD 4DK5A 4XDCA 5CHFA 3NVWA 1C9FA 4RF0A 3RNFC 2DAJA 4JLCA 1SJED 5LXHA 2IGGA 5J18A 2LHEA 1U4AA 3T3OA 2L00B 1RWSA 3AULA 3U7ZA 4MGKE 4DXGA 3BZDB 1X1MA 1SE9A 4FA6A 1L7YA 2BB6A 1L0YB 3VR9B 4A3PA 3SDLC 3AE8B 1WZ0A 2MBHA 4NQKE 1FXIA 2KQ7A 4FJYA 3RCZA 1TKGA 4HDOA 3RNCC 3VQIA 2MJ3A 1XQQA 4KSLC 2LGXA 2D07B 2FIDA 1FFVA 3HUIA 4HK2A 2NBVB 2PE9A 2D3GA 2PIAA 1FPYA 1MI0A 1JRPA 3Q8AA 1N62A 4S0RA 2WXFA 3RNBC 2INNE 2WXLA 2IY0B 3L54A 2QEJC 1PUTA 3OLMD 1NYQA 4ICUA 3HVZA 4PS7A 2VRRB 2CHZA 3I63C 2LRUA 1UWXA 2N9XA 2BS4B 3DHHC 3A33B 4EFOA 1F2RC 1N5XA 3TEZA 3QJZA 1K50A 5LLIA 4MACA 3DOWA 4KSKC 4ANXA 4RNAA 3EUB2 1VDVA 4LK0M 1YMHE 2DZIA 3AE1B 1V80A 1I42A 1FNWA 5BYQA 3W5VB 3RNGC 4C80A 1WE6A 1WMHA 1XLPA 1XCQL 1YX5B 4TQ1A 1I4XA 3TMPB 4DHZB 4HXDA 3ZJVA 2FBWB 1SEBD 5C2TB 2I1KA 3DPDA 3IAS1 4RGTA 3A9KA 4UDUC 4PT5A 2Q5WD 2VZKB 2HJ8A 2EMSA 3DBLB 3QC8B 4TV3A 5BO4B 3VUYA 3ABVB 5H92C 4KV2A 4ZHPA 1YQ3B 4WQMA 4GU2A 4WH4A 4FULA 4AQ7A 5HKHA 1V5TA 2KYWA 4W9GA 4PK1A 1WGRA 2IYDB 3NZSA 3RULA 5D7GA 5TR5A 2MLBA 1SB3C 2LASA 3LB8C 3TCAA 3URYA 2DHZA 2LUMA 2OJWA 2HTME 2KTRA 4I6LB 2KDEB 1C4CA 1GPXA 1HTQA 3MC8A 3U30A 3TEWA 1KRHA 1R4NB 4O1NA 4P1BC 1V1PA 3H7PA 2H89B 1R4NI 4W9KA 1ZGUB 5BYSA 3TL5A 1ZE3D 3WCQA 1SE2A 2L0TA 2PEAA 1QT9A 2LWPA 1WIAA 1FD6A 4FHJA 2I1JA 4CQNA 1WR6E 1V97A 1VZ7A 2KACA 3PT2B 4FN2A 2E3TA 1FNVA 4IW0A 3KYCD 4MDKE 4HPPA 4HVBA 3B0AA 4RM8A 4C4VA 4IC7B 3IFWB 1WGKA 4FJZA 4AJYB 3B2GA 1NBFC 4LDTD 4ZRKA 5JHAA 1T0SC 3MJ5A 3HM6X 3IT6B 2Z59B 1NI3A 2MBOA 3BY4B 3X23A 1QOGA 1I4GA 3N1YC 4DXAB 4ARIA 4WJOA 2M0AA 1WMHB 4G11A 1EM7A 4EKUA 3P4RB 2INDC 1YX6B 2J0MA 2M4NA 2BPSA 1IYFA 1ZXIA 2L8JA
chains in the Genus database with same CATH topology
4OW0A 1C78A 1JWBD 5LNK1 4HROA 1N60A 1XCTL 3LXFA 2WP9B 3CIRB 1BXTA 1RFKA 1YNTE 1T6BX 4HJGE 4A55A 4OZAA 5JXVA 4GLSC 2OHFA 2D5GA 1CZPA 4HKZE 1TKEA 2DYOA 1E6EB 3AE6B 3FAHA 3E56A 2PTLA 1IGCA 3R8BA 1K53A 3B2FA 1I4HA 1C76A 1ZDXA 4M0WA 5D3DA 1VZ6A 4L23A 2W3RA 1SBBB 1SSNA 2K0PA 2KN4A 1H7WA 2IPKD 3R2IA 1ZP0B 2DBYA 2K3UA 4KX6B 2KMMA 1TS5A 1NEKB 2YEPB 1I4PA 2WLBA 2HDEA 4NZLB 1SF0A 4ZRQA 5HI1A 1R7SA 5TSSA 1D6EC 3OWEB 4RGNA 1E10A 2BS2B 4A8XC 1J7AA 2R61A 1PGBA 1KFYB 2WXPA 2IJ0A 1NENB 1DYQA 1M4VA 1V1OA 2KQ4X 2FUG1 5H8YE 3AM9A 3AEGB 1A70A 3BVZA 2BW2A 5T8IA 2EKIA 2MH7A 2WXQA 3ZQ4A 2MJDA 4J3OD 5HHDG 3AE9B 5I4DA 1MHXA 4DXFA 3AE4B 1HXYD 1D5XC 5FKAC 2JYEA 1PYWD 3IAM1 4TMAB 1FRRA 1PFDA 4H2AA 3Q8FA 1FO4A 3T3NA 2ONQA 1V1PB 2PKOA 1XXGA 2X38A 3ZYYX 1KF6B 1UGJA 2BBCA 3U52E 3P4PB 3R2TA 3AE7B 1EU4A 4MH8A 4MT5A 2NMQA 4WWMA 2CJNA 1HZ6A 1QILA 1XLOA 1H7XA 1K51A 2IGDA 4KKIA 1JWMD 2W82A 4YT0B 1F2RI 1ESFA 2ZW0A 4TQ0A 1HQRD 1DOYA 1AWDA 1FEHA 4GDLB 1XLNA 4IKGA 1SIJA 3I57A 1JALA 3NVZA 3AEDB 4KGTA 1TS3A 1UUPA 4P6VF 4HRSA 1J7BA 1E9MA 3RFZB 1I7HA 1QOBA 3L4PA 3RPFC 1MVKA 2DLBA 1JWSD 4L1BA 1BUIC 1ZXHA 1RM6C 2WXJA 2Y5CA 4TSSA 2WDQB 1D5MC 2JQRB 1N5WA 2RPVA 3GS2A 5G5GA 3W1SA 1FCLA 3AB5A 1L4DB 3Q8BA 4MM3B 1ZPSA 4C7YA 2BYTA 3HVDA 1SE4A 1ZUD2 3P63A 2YEPF 1YN5A 3IXSA 1YJJA 2J52A 2WXNA 3FILA 2BTEA 2BT6A 1TS2A 3LYYA 2JXTA 4YWGG 3AN1A 5EE0A 4IOIE 1L0VB 2WS3B 2K22A 2WU5B 1STEA 2V4IB 5G5HA 5EE9A 2LJIA 4B0MA 3KQ4A 1YN3A 1Q10A 4DQOC 3EA6A 1AN8A 3C8YA 4LTUA 4XDDA 1AYFA 1IBXB 3AEFB 1OFFA 2MEKA 1VJKA 3GB1A 2W54A 1YJIA 3AE5B 4YSZB 2L83A 3AEBB 2ACZB 4XE0A 2K5PA 3N9YC 1DOIA 4B0EA 1YN4A 3B9JA 1UNSA 4C7ZA 5BMIA 1EWCA 5FK9C 3SR6A 1F0ZA 4WAFA 1EWYC 3W5UB 2CJOA 4A90A 2WQYB 1C4AA 4RH6A 4JWSC 4RGMA 2WDRB 2FE8A 2Y3AA 4US9A 2L52A 1ZDVA 5BYRA 2PMVA 1KTKA 3ZJUA 2J42A 1V8CA 3NUHB 5AUKA 2RMMA 1PGXA 2WDVB 2LGIA 3BWUD 4OZCA 2MJEA 2E6XA 1FCCC 2BS3B 3H8HA 4XDCA 3CWIA 4ZYSA 3NVWA 1B9RA 3BVGA 4P16A 1C9FA 1IGDA 4RF0A 3KWLA 3V3XA 1TZOA 2PW9A 4EE2A 5EE3A 1L4ZB 1SJED 4RCOA 1FNUA 4AS1A 2IGGA 2RDHA 1KLGD 3BIID 4YXDB 2LHEA 1SXTA 3T3OA 3J9CA 1RWSA 1ROEA 3U7ZA 4DXGA 1Y56A 3BZDB 2QMTA 1XF5L 2N9KA 2Y5PA 1TY0A 2KDMA 1PDXA 4YTNB 1CK1A 2GB1A 3PZ8A 4A6QA 5D3IB 5E6JA 1BMLC 3NS1A 3VRAB 2W3SA 4HKQA 2BB6A 3SFEB 1L0YB 2NTTA 1XLQA 4HEA1 1JQ4A 2PVGC 5EE1A 3VR9B 3AE8B 3ZJTA 1FXIA 2QIEB 3BVMA 1L6UA 1QOFA 1TKGA 1DOXA 3VQIA 2QJLA 4OZBA 1C4PA 1FRDA 2MJ3A 3AEAB 3BK2A 1TS4A 2CU3A 1CQVA 1FFVA 4RGOS 2V0GA 3HUIA 2LHDA 3Q69A 4OVZA 1T5XD 1RYJA 1ACCA 2JX5A 1ZOYB 2JYTA 2PIAA 3MFGA 1D5ZC 1MI0A 1T3QA 1JRPA 3Q8AA 1L6VA 1N62A 3U2SC 3KLSX 4ARCA 1K52A 1SE3A 2WXFA 1QF6A 2INNE 2WXLA 1GAQB 2I2YA 1F77A 1I4RA 2QEJC 1PUTA 3NRZA 3PZ7A 2QILA 1NYQA 1N61A 1WXQA 3HVZA 2JWUA 3BYTB 1JCKB 1UWXA 4WURA 4KGRA 3CF4A 2BS4B 3FILB 2JZPA 3UI3A 3MHZA 2ON8A 3AE3B 1F2RC 2Z8LA 1WWTA 3I9V1 1P7FA 4NAMA 2G1EA 1NYRA 1N5XA 4JPSA 3TEZA 1K50A 4MACA 4US8A 1B1ZA 4RNAA 2M56B 3EUB2 3EGRA 1VDVA 4LK0M 4ZOHC 1YMHE 3AE1B 1VRAB 5HFYA 1C79A 4N59A 4YTPB 1FNWA 2GI9A 4KGSA 5BYQA 3W5VB 3MP9A 4C80A 1AW7A 3P4QB 4JX1C 1XLPA 2KWDA 1FMAD 1XCQL 1TY2A 4JE3B 4NAWB 4WIPA 3AECB 4TQ1A 2NTSA 3P1MA 1QQRA 3TSSA 1FXAA 2V3PA 2VZKD 4ZHOA 1ET9A 1I4XA 2K9XA 1QLBB 2XN9C 3MC0B 2LMCA 4ITKA 3O13A 1GOZA 3ZJVA 3SFDB 2DYMA 5GXGB 2WU2B 2FBWB 2EELA 2INPE 3Q8EA 2SEBD 1SEBD 2WXHA 1JROA 4XWWA 5C2TB 1WSPA 1FFUA 4YTMB 3IAS1 4RGTA 3NVVA 1L0XB 1YQ4B 4UDUC 4PT5A 5BMHA 1DGJA 2Q5WD 2V3NA 3W9CB 1LO5D 2LFIA 2VZKB 1JWUD 3BYYB 2SAKA 1VZ8A 3TEXA 2PLPA 4KKJA 3ABVB 4L2YA 5MPOA 1GB4A 5H92C 1L5PA 2WXRA 1KLUD 1N63A 1YQ3B 4WQMA 1P7EA 4ZHPA 4WH4A 4AQ7A 2W55A 4R3DA 3E9SA 3AH7A 3SEBA 2TSSA 1HEZE 4N6EB 3TUOA 1TKYA 1CJEA 3VR8B 3W2DA 1UWMA 2PVOD 4ZRPA 1PGAA 2M19A 4REZA 5D7GA 1FM0D 1SB3C 3DWGC 1XO3A 2OEDA 2WXMA 3LB8C 3URYA 1IBXA 2LUMA 3U4EG 2HTME 5FR3A 1J7CA 1C4CA 1GPXA 1QKZA 1VLBA 2WNMA 4JWUC 5C3JB 3Q8CA 2IDYA 4XWTA 2QSDA 3NVYA 2WXKA 3TEWA 4USAA 1KRHA 2AQ3B 1WRIA 5BMGA 2G9HD 4O1NA 1JWAD 3ETRA 4RF1A 2DWQA 1OQRA 1V1PA 1HZ5A 2H89B 4OHJA 1D4BA 5BYSA 3HRDD 3GP7A 1GTHA 1ZE3D 3DWMA 3P4SB 3WCQA 1SE2A 1GTEA 2BB5A 1XEEA 1QT9A 3TEYA 2IGHA 1FD6A 1WYGA 1ENFA 1GT8A 2N0SB 4CQNA 4YSXB 1FIQA 1I4QA 4A9AA 2J4XA 2XNAC 1HA5A 3AV8A 4FXCA 1V97A 1VZ7A 2KACA 1ET6A 4Q2JA 1KH0A 2E3TA 4NJCA 1FNVA 5AUIA 3VRBB 2WXIA 1TYGB 3FC4A 2KAJA 3P42A 1E0ZA 4YSYB 1EU3A 2ZW1A 1IUEA 1OQQA 2AX5A 2I38A 1WGKA 1JMLA 3PO0A 1NVID 3ZGZA 1E7PB 3B2GA 3AEEB 2AQ1B 2JU6X 3KWVA 2J53A 1GB1A 4N58A 2RDGA 1C77A 1VR9A 2L32A 2H88B 1SJHD 2N9LA 3MJ5A 1TJEA 4GDKB 2AQ2B 2JSVX 3IT4B 4D2KA 2ICIA 3IT6B 1MPEA 1NI3A 2N7JA 4LLGM 4RFBA 4C56C 2GRIA 1QOGA 2B76B 2L1AA 1I4GA 2WXOA 3NZ3A 1JW9D 4ARIA 1QOAA 2M0AA 1EM7A 3V05A 3P4RB 3BK1A 3AE2B 5HG2A 3AMZA 1MHHE 4IDIA 1ZXIA 2LEKA 2WXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPF C;  1XLQ A;  1JWB D;  3ABV B;  5MPO A;  1JQ4 A;  5H92 C;  1L5P A;  1RM6 C;  2PVG C;  3VR9 B;  2Y5C A;  4HRO A;  5EE1 A;  3AE8 B;  1N63 A;  1YQ3 B;  2WDQ B;  1N60 A;  4WQM A;  4ZHP A;  2JQR B;  2WP9 B;  3CIR B;  1N5W A;  1RFK A;  2W55 A;  1FXI A;  3AB5 A;  3LXF A;  5G5G A;  2QIE B;  3AH7 A;  1L6U A;  1QOF A;  1TKG A;  2OHF A;  1TKY A;  1CJE A;  3VR8 B;  1CZP A;  1TKE A;  1UWM A;  1E6E B;  3AE6 B;  1ZUD 2;  2PVO D;  2QJL A;  3FAH A;  3P63 A;  1FRD A;  2M19 A;  1YJJ A;  2MJ3 A;  3B2F A;  3AEA B;  2CU3 A;  1FM0 D;  1SB3 C;  2BT6 A;  3DWG C;  1XO3 A;  1FFV A;  3LB8 C;  2W3R A;  3HUI A;  2HTM E;  3AN1 A;  5EE0 A;  4N6E B;  1J7C A;  1H7W A;  1RYJ A;  1ZP0 B;  2DBY A;  1L0V B;  1ZOY B;  2JX5 A;  2PIA A;  1GPX A;  2WS3 B;  2K22 A;  2WU5 B;  1VLB A;  1T3Q A;  4JWU C;  4KX6 B;  5C3J B;  1JRP A;  1L6V A;  1N62 A;  2KMM A;  5EE9 A;  5G5H A;  1NEK B;  3NVY A;  1QF6 A;  2WLB A;  1SF0 A;  1R7S A;  4USA A;  1GAQ B;  1KRH A;  1WRI A;  1E10 A;  2BS2 B;  4LTU A;  3NRZ A;  1PUT A;  1AYF A;  1J7A A;  1NYQ A;  1JWA D;  3ETR A;  2DWQ A;  1OQR A;  1KFY B;  1N61 A;  1WXQ A;  3HVZ A;  3AEF B;  1OFF A;  1NEN B;  2H89 B;  1VJK A;  2W54 A;  1YJI A;  3CF4 A;  3HRD D;  2BS4 B;  5H8Y E;  3AE5 B;  1GTH A;  3AM9 A;  3AEG B;  4YSZ B;  3P4S B;  2L83 A;  3DWM A;  1GTE A;  2ACZ B;  3AEB B;  3WCQ A;  2K5P A;  1QT9 A;  3AE3 B;  1DOI A;  1WWT A;  3B9J A;  4C7Z A;  1WYG A;  1A70 A;  1GT8 A;  2G1E A;  1NYR A;  4YSX B;  1FIQ A;  1N5X A;  2N0S B;  3L4P A;  3SR6 A;  4A9A A;  1F0Z A;  4FXC A;  3AV8 A;  1EWY C;  1V97 A;  2EKI A;  2MH7 A;  3W5U B;  2MJD A;  2CJO A;  4US8 A;  2WQY B;  3AE9 B;  2M56 B;  3EUB 2;  2E3T A;  3AE4 B;  4JWS C;  1VDV A;  4ZOH C;  5AUI A;  2WDR B;  3VRB B;  4US9 A;  2L52 A;  3AE1 B;  1FRR A;  1PFD A;  4N59 A;  1TYG B;  4YTP B;  3W5V B;  3FC4 A;  1DOX A;  2KAJ A;  4C80 A;  1V8C A;  5AUK A;  1FO4 A;  1E0Z A;  2WDV B;  4YSY B;  2PKO A;  3P4Q B;  1IUE A;  4JX1 C;  1OQQ A;  1XLP A;  2MJE A;  1KF6 B;  1FMA D;  3ZYY X;  2BS3 B;  2AX5 A;  4C7Y A;  1WGK A;  3AEC B;  3P4P B;  3P1M A;  3CWI A;  3PO0 A;  3AE7 B;  1NVI D;  3NVW A;  1B9R A;  1E7P B;  3B2G A;  1FXA A;  3AEE B;  4WWM A;  2CJN A;  4ZHO A;  3KWL A;  1XLO A;  1H7X A;  2K9X A;  4N58 A;  1QLB B;  2H88 B;  4ITK A;  4YT0 B;  5EE3 A;  1TJE A;  3SFD B;  1NI3 A;  5GXG B;  2WU2 B;  1DOY A;  1QOG A;  2B76 B;  2FBW B;  4YXD B;  3BII D;  1AWD A;  1XLN A;  1JW9 D;  1RWS A;  1ROE A;  1QOA A;  1SIJ A;  1JRO A;  1JAL A;  5C2T B;  3NVZ A;  3AED B;  3P4R B;  1FFU A;  4YTM B;  1ZXI A;  1PDX A;  4YTN B;  3AE2 B;  3NVV A;  4P6V F;  1YQ4 B;  3AMZ A;  4HRS A;  1J7B A;  4IDI A;  1E9M A;  1DGJ A;  2Q5W D;  1I7H A;  3W9C B;  3NS1 A;  1QOB A;  3VRA B;  2W3S A;  2LEK A;  3SFE B; 
#chains in the Genus database with same CATH topology
 4OW0 A;  2AYO B;  3ECI A;  4W9H A;  1JWB D;  3PRE A;  3ZNI D;  2MP2 B;  1XCT L;  3LXF A;  3CIR B;  2B3A A;  4A55 A;  4HJG E;  5JXV A;  2D5G A;  2BKF A;  1TKE A;  2DYO A;  4AJW A;  3AE6 B;  3E56 A;  2PTL A;  4KZC A;  4M8M A;  3M95 A;  1WXM A;  5D3D A;  1T0Y A;  1VZ6 A;  1KOT A;  4B95 A;  4AUQ C;  2K0P A;  1H7W A;  2IPK D;  1AAR A;  2NBU A;  4KX6 B;  2D3C A;  1TS5 A;  1NEK B;  2YEP B;  5E6N A;  4CYE A;  1E10 A;  4A8X C;  2R61 A;  2KX3 A;  3PSE B;  4LNN A;  1PGB A;  3WAO A;  2WXP A;  2IJ0 A;  1NEN B;  4ANW A;  2KQ4 X;  3JYU A;  3LJ3 A;  2N9E B;  4MSQ B;  1WM3 A;  2PPH A;  4KDI C;  4XC2 A;  1V81 A;  2BW2 A;  5T8I A;  2KVR A;  3EFC A;  3IVF A;  5HHD G;  3AE9 B;  3UF8 A;  1K8R B;  3KVF B;  4DXF A;  1HXY D;  1D5X C;  1PYW D;  2C5L C;  2JZ3 B;  1GUA B;  2DZK A;  1R4M B;  3Q8F A;  3KUD B;  1V1P B;  3EFU A;  3ZYY X;  1UGJ A;  3R2T A;  3AE7 B;  2NMQ A;  4LDT B;  2CJN A;  4GDK A;  3MHS D;  4HDQ A;  3BIN A;  4KKI A;  2LJ5 A;  3EC8 A;  4GMV A;  1UBI A;  1WJU A;  4GDL B;  1XLN A;  3IHP C;  1JAL A;  4KGT A;  5AZF A;  2MQJ A;  2MCN B;  4JGH B;  1LGR A;  1YJ1 A;  1E9M A;  1QOB A;  3L4P A;  3RPF C;  4KIK B;  2N1W A;  1RM6 C;  2Y5C A;  2WDQ B;  3Q3M C;  2JY6 A;  2AL3 A;  3H6N A;  2IO2 B;  3VDZ A;  1Q0W B;  4XYC A;  1ZUD 2;  1ISN A;  3K9O B;  3P63 A;  4JQW C;  4EZJ A;  3FIL A;  5J2R A;  2BT6 A;  2JT4 B;  4LJP B;  2JXT A;  2KLG A;  5CHV C;  2R2Q A;  3KH0 A;  5C1Z A;  4AP4 C;  1STE A;  2N4F A;  4WQO B;  4I6N B;  3KQ4 A;  1YN3 A;  1M94 A;  3DBH I;  2XEW A;  1IBX B;  2FCN A;  1WYW B;  2MEK A;  3GB1 A;  1V49 A;  2WDT B;  3ONS A;  3AEB B;  2ACZ B;  4XE0 A;  2RPQ A;  3N9Y C;  4ANV A;  5BMI A;  3Q3N C;  3ML8 A;  1EWY C;  3N30 A;  2RD0 A;  1HE8 A;  4MSM B;  4US9 A;  3GOE A;  4BOZ B;  2R2O A;  3CSF A;  4W9C A;  3WAL A;  2LGI A;  4OZC A;  4HCP B;  2BS3 B;  3H8H A;  3CWI A;  3QA8 A;  2KTF A;  4NAW A;  4BAX A;  4IM3 A;  3V3X A;  3SD5 A;  1TZO A;  2PW9 A;  4MEL A;  4EE2 A;  5EE3 A;  4AS1 A;  2KDB A;  2RDH A;  1KLG D;  5J17 A;  2IO3 B;  3UQA A;  1Y56 A;  3M63 B;  1Q1O A;  2N9K A;  2Y5P A;  5E6P A;  4YTN B;  2GB1 A;  2KVZ A;  4EZK A;  2L7R A;  4HCN B;  2BYV E;  5C23 A;  1C3T A;  3VRA B;  2W3S A;  4HKQ A;  3SFE B;  2NTT A;  4HEA 1;  4ZYN A;  2D11 A;  4WAA A;  1JQ4 A;  2PVG C;  3T8M A;  3ZNG C;  3DBH B;  3ZJT A;  2ZJD A;  1DOX A;  2QJL A;  4OZB A;  3GZN I;  1GNU A;  3V61 A;  1TS4 A;  2CU3 A;  3C0R B;  4P1C C;  3Q3O C;  1V86 A;  3Q69 A;  3JW0 X;  1ZOY B;  4F1S A;  1PQS A;  1WY8 A;  2IBI B;  4FLH A;  4ARC A;  1QF6 A;  5DPS A;  1WZ3 A;  1A5R A;  2I2Y A;  3PZ7 A;  2KWC A;  2QIL A;  3ZRF A;  1MG4 A;  3VH3 B;  1D3Z A;  3BYT B;  4KGR A;  3CF4 A;  2C60 A;  2LGS A;  3FIL B;  3UI3 A;  3MHZ A;  2W9N A;  1TIF A;  2G1E A;  4FAD A;  3OAW A;  1N6Z A;  1F1H A;  1G6J A;  1B1Z A;  2EKE C;  2KMA A;  4ZOH C;  4BKT A;  1VRA B;  4URK A;  4YTP B;  2KWU B;  1OEY A;  1WXS A;  1LM8 B;  2KWD A;  1FMA D;  1TY2 A;  3AEC B;  4GDL A;  1FXA A;  3VH4 B;  3AU4 A;  1ET9 A;  4BOS C;  1QLB B;  3V62 A;  1OQY A;  3EHV A;  3PLU A;  3MC0 B;  1GOZ A;  3SFD B;  5GXG B;  2WU2 B;  3ZNZ B;  2INP E;  4FHK A;  3APC A;  2C9W B;  1JRO A;  2KJ6 A;  2WWZ A;  4WJQ A;  1P3Q U;  4F7Z A;  1FFU A;  4YTM B;  3TBL D;  1UEL A;  3DQV A;  2V3N A;  4A20 A;  4C00 A;  3W9C B;  4I6P A;  3BYY B;  1VZ8 A;  2MX2 A;  2UWQ A;  5KHQ A;  1L5P A;  3QAQ A;  3QCA A;  1P7E A;  2W55 A;  4R3D A;  3AH7 A;  3SEB A;  3M3J A;  1HEZ E;  1MG8 A;  3GE8 C;  1CJE A;  3VR8 B;  2BWE S;  3W2D A;  4LCD E;  2KC2 A;  1PGA A;  4II2 B;  2JZZ A;  4REZ A;  4YL8 A;  4IWQ A;  1FM0 D;  1E8W A;  2OED A;  2WXM A;  4GXB A;  1IBX A;  2KHW B;  2KKC A;  1J7C A;  4DHZ E;  5C3J B;  3DVN U;  4XWT A;  2N9P C;  4USA A;  2G9H D;  1JWA D;  2MBQ A;  5E6O A;  1D4B A;  3ZDM C;  2LVQ A;  4MH0 E;  3P4S B;  2ZCB A;  1WH3 A;  2GMI C;  2IGH A;  2N0S B;  2MHJ A;  2X8X X;  2J4X A;  4Q2J A;  2FAZ A;  1WRD B;  2DZJ A;  5AUI A;  3VRB B;  3UIO B;  2L3Z A;  1TYG B;  3APF A;  3FC4 A;  3KW5 B;  3P42 A;  1E0Z A;  4YSY B;  1EU3 A;  1JRU A;  2AX5 A;  1UGM A;  1NI2 A;  1JML A;  2DYB A;  3PO0 A;  2CS4 A;  2AQ1 B;  1WI0 A;  2H88 B;  4GDK B;  2AQ2 B;  2JSV X;  4D2K A;  2N7J A;  3PV1 A;  4C56 C;  2QCZ A;  4MM3 A;  2WXO A;  4E74 A;  1JW9 D;  4PYU A;  1OTR B;  2LGD A;  3BK1 A;  5HG2 A;  1MHH E;  2VH2 A;  2IO0 B;  4IUM B;  2WXG A;  3R3M A;  3ZLZ A;  2A4Z A;  4K7W A;  2WGS A;  2IO1 B;  1N60 A;  3VAW A;  1RFK A;  1T6B X;  4OZA A;  2M17 A;  4BKS D;  2ZPY A;  1XT9 B;  2OHF A;  4HKZ E;  4M8N A;  1T0Q C;  1K53 A;  1I4H A;  1C76 A;  3PVL A;  1ZDX A;  3KYD D;  4DDG D;  2L05 A;  1SSN A;  1WGG A;  3Q3J A;  2KN4 A;  3W1Y A;  3VVW B;  3R2I A;  1I4P A;  2ASQ A;  1SF0 A;  3JVZ X;  3ZRC A;  5CHW A;  1TZ1 A;  3R7Q A;  4MGZ E;  1DYQ A;  2KZR A;  3PGE A;  4EOY A;  5IA7 A;  4GOC A;  3BVZ A;  2BKR B;  3ZTD A;  2MSE D;  2MH7 A;  2WXQ A;  2MJD A;  1E7U A;  4W9E A;  2MBE A;  3AE4 B;  4IM2 A;  2QHO A;  2JYE A;  3IAM 1;  4HWI B;  3QHT A;  1SGH A;  4W9I A;  3OJ3 A;  3Q14 C;  1WGD A;  4H2A A;  4XX5 A;  1FO4 A;  3T3N A;  2PKO A;  2X38 A;  2KOX A;  3X0W A;  2D10 A;  3AXC A;  3DBS A;  4MH8 A;  4WWM A;  2N7E A;  1HZ6 A;  3RNA C;  3KUZ A;  1OGW A;  2CHX A;  3TIX A;  1F2R I;  2WX0 A;  3N1X C;  4P7I A;  4A3O A;  3UIP B;  1TS3 A;  2GBK A;  4P6V F;  2FCS A;  2V3S A;  2DNF A;  3RFZ B;  4ACF A;  4W9L A;  1JWS D;  1BUI C;  1ZXH A;  3NZU A;  3RMK C;  3WAM A;  4TSS A;  1D5M C;  1N5W A;  1ZKH A;  3AB5 A;  1L4D B;  2C7M B;  2K39 A;  4C7Y A;  1SE4 A;  1WX8 A;  4MEM A;  1YN5 A;  4NJ7 A;  5IOI A;  2BF8 B;  3LYY A;  4NQL B;  5EE0 A;  2RR9 A;  4IOI E;  5IO9 A;  1WJ4 A;  2GBN A;  1L0V B;  5CX3 A;  2WU5 B;  1ZW7 A;  4HPM B;  3NJT A;  4K81 A;  3C8Y A;  4E3C A;  3V6C B;  3PRP B;  3RN9 C;  3AEF B;  1RAX A;  4QAY A;  4XGA B;  4RM9 A;  2LUE A;  2K8C A;  3QAR A;  4AOF A;  5AZG A;  3L17 A;  1UNS A;  1RFA A;  1EWC A;  3ZNH B;  4WAF A;  3PPA A;  3W5U B;  2CJO A;  2MWS B;  1C4A A;  2GBM A;  2OOB B;  4RGM A;  2FE8 A;  2Y3A A;  1F52 A;  1GJZ A;  2PMV A;  3CMM B;  2KK8 A;  1XD3 B;  3A4S C;  1PGX A;  2WDV B;  1WXV A;  1FCC C;  2E6X A;  4K7S A;  2RSU A;  3BVG A;  3PS6 A;  4P16 A;  3QQ8 B;  3GE3 C;  3KWL A;  4JIO U;  4GGQ A;  2KNB A;  1E8X A;  1L4Z B;  5D6J B;  4CHK A;  2PE6 B;  2JXX A;  3VTV A;  1XF5 L;  1VD2 A;  1TY0 A;  3PRM B;  2KDM A;  1PDX A;  1CK1 A;  3PHW B;  3PZ8 A;  4A6Q A;  5D3I B;  3PZD A;  2KC1 A;  5E6J A;  1BML C;  2MRP A;  3GZN B;  1P98 A;  1XLQ A;  2NCN A;  1R4M I;  4G3X B;  3ZVV A;  2QIE B;  3BVM A;  4ZRI A;  1C4P A;  3H7P B;  2O2V B;  4ICV A;  1YOV B;  4RGO S;  2V0G A;  3WAP A;  2KJR A;  1T5X D;  1RYJ A;  3MFG A;  2JX5 A;  2JYT A;  1D5Z C;  1EO6 A;  1T3Q A;  3U2S C;  1L6V A;  3WIM A;  5EDS A;  4KVG B;  1WXA A;  1GAQ B;  2LXC A;  4X57 B;  2CU1 A;  3S2A A;  1H4R A;  4XZ4 A;  4BZA A;  1JCK B;  2AEH A;  1MFW A;  4DHJ B;  2ON8 A;  4OVV A;  1WWT A;  3I9V 1;  1P7F A;  3NS8 A;  4NAM A;  4JPS A;  2ZCC A;  5AEK B;  4US8 A;  1WFY A;  3EGR A;  4NY0 A;  4MJS B;  1C79 A;  2GI9 A;  4KGS A;  1RLF A;  3MP9 A;  4PYZ A;  4WJN A;  3OJ4 B;  4JX1 C;  1UH6 A;  4WIP A;  4NAW B;  3UIN B;  1UD7 A;  2V3P A;  2VZK D;  4ZHO A;  3RT3 B;  2K6Q A;  4GSW A;  4ITK A;  2LMC A;  3O13 A;  2DYM A;  2NR2 A;  3SU8 X;  5LXI B;  3RUI B;  2SEB D;  5CTR C;  2LVP A;  3MJW A;  3DVG Y;  2LXA A;  1WSP A;  3H1U A;  1FXT B;  3NVV A;  1L0X B;  5BMH A;  5L95 C;  1DGJ A;  3O65 B;  1HTO A;  1LO5 D;  2LFI A;  1JWU D;  3RZF A;  3VXW A;  3TEX A;  2ZVN A;  5MPO A;  2LVO A;  4L2Y A;  1GB4 A;  3ZDT A;  1KLU D;  1N63 A;  1WE7 A;  5JH5 C;  4PS3 A;  5D2M B;  5KHO A;  2TSS A;  3TUO A;  4N6E B;  4W9F A;  3M62 B;  1UWM A;  3T9L A;  2RDB C;  4LNK A;  4EUT A;  4KIK A;  2FCQ A;  1XO3 A;  2K8H A;  2L76 A;  3V6E B;  3L10 B;  2INC C;  2WYQ A;  4G50 A;  1QKZ A;  2WNM A;  4JWU C;  2IDY A;  3OG5 A;  1E8Z A;  3HHM A;  2QSD A;  2K1F A;  2AQ3 B;  1WJ6 A;  3ETR A;  4G0N B;  1OQR A;  4BKS A;  4DHJ D;  3GP7 A;  1GTH A;  1J0G A;  1XEE A;  3WAN A;  3TEY A;  1Z2M A;  1GT8 A;  4B6W A;  4YSX B;  3DHG C;  4A9A A;  3AV8 A;  3VUX A;  4NJC A;  4CO7 A;  3L08 A;  3Q2A C;  4N9F 4;  3WA0 A;  2KAJ A;  4C4V B;  2RGF A;  2O6V A;  2ZW1 A;  1IUE A;  2J7Q B;  1H8C A;  3ZGZ A;  5IKC M;  1E7P B;  3AEE B;  2J53 A;  2RDG A;  1C77 A;  1VR9 A;  1SJH D;  2ZPN A;  2N9L A;  3IT4 B;  5AZH A;  4LLG M;  3SHQ A;  2GRI A;  4E71 A;  2B76 B;  2L1A A;  3NZ3 A;  2AWT A;  1QOA A;  1E8Y A;  4S17 A;  3AE2 B;  3AMZ A;  2CKH B;  1TTN A;  3AI5 A;  2BGF A;  4KZ0 A;  2ZVO A;  2FUH B;  5LNK 1;  2MP2 A;  2ZNV B;  3Q3F A;  4B9K A;  4WWO A;  1BXT A;  1YNT E;  4IWP A;  3PLV A;  1LFD A;  1CZP A;  4IWO A;  3FAH A;  3ENE A;  3R8B A;  4FJV B;  4M0W B;  2Y5B B;  4M0W A;  2FCM A;  2KN5 A;  1ZP0 B;  3V60 A;  2KMM A;  2KFJ A;  5IP4 D;  4AWJ A;  2HDE A;  2GOW A;  3RYT A;  2LGY A;  1R7S A;  4BBN F;  5TSS A;  1D6E C;  1J7A A;  1OEY J;  1EF5 A;  3CF6 E;  3VTW A;  4ZDV A;  1V1O A;  4II3 B;  5H8Y E;  3IG3 A;  3AEG B;  3PHX B;  3N1Z C;  1A70 A;  2KTR B;  3R66 C;  3ZXR A;  2KXJ A;  1MHX A;  2GBR A;  5FKA C;  3DDC B;  1PFD A;  5DCN A;  4BVU C;  4F8C B;  3ZTC A;  2C7H A;  2ONQ A;  3PRZ A;  1EU4 A;  2JPH A;  1YD8 U;  1WM2 A;  3I5J C;  1K51 A;  2IGD A;  2KDI A;  4HJK A;  4J6I A;  3NG0 A;  1DOY A;  1AWD A;  1FEH A;  1UF0 A;  1KM7 A;  3MC9 A;  1E90 A;  1S1Q B;  3IBE A;  3JSV A;  3NVZ A;  5L83 A;  3AED B;  4LNF A;  1UUP A;  3JSV B;  2KMC A;  3ML9 A;  2IY1 B;  1J7B A;  2Z0D B;  2LD9 A;  2LRW A;  1MVK A;  4NPN A;  4NJ6 A;  2DLB A;  1YIW A;  4L1B A;  2LI5 A;  4LJO B;  2WXJ A;  1WGY A;  1WX9 A;  3EEC A;  2DEN B;  1WGH A;  2JQR B;  4EEW A;  3HVD A;  3DBL I;  2J52 A;  4K7U A;  2C7N B;  2XBB C;  2EMT A;  2D2Q A;  1WX7 A;  3AN1 A;  1F9J A;  2XK5 A;  3ALB A;  2WS3 B;  1E5W A;  2V4I B;  3HK0 A;  2N1V A;  2LJI A;  4DQO C;  4W9J A;  1AN8 A;  4LTU A;  1RRB A;  3N32 A;  3PTF C;  1KJT A;  2W54 A;  2JUO A;  4YSZ B;  1YQB A;  2L83 A;  3RD2 A;  3A9J A;  2HD5 B;  1YN4 A;  3I3T B;  2PJH A;  5FK9 C;  1V5O A;  4A90 A;  2WQY B;  3ZO5 B;  2JRI B;  2WDR B;  3U7D A;  3FKY A;  1ZDV A;  1QZE A;  2CHW A;  3VUW A;  3NUH B;  1P0R A;  5AUK A;  2RMM A;  4W9D A;  1LXD A;  2MJE A;  5DPW A;  3RI7 C;  2NBW B;  2G4D B;  4ZYS A;  1B9R A;  1V2Y A;  1IGD A;  1Y8R C;  2KJH B;  3TJP A;  4ZRJ A;  4BFR A;  5DPR A;  2K6D B;  3U8Z A;  4RCO A;  1FNU A;  4YXD B;  1SXT A;  3H9D A;  3J9C A;  1ROE A;  2QMT A;  2KFK B;  3DCG A;  5JZE B;  1TT5 B;  2KFK A;  1E7V A;  3NS1 A;  3ZW3 A;  2GLS A;  2A5U A;  2JRH A;  3K9P B;  5EE1 A;  4GIV A;  4GB9 A;  3AU5 A;  3ZXV A;  1L6U A;  1QOF A;  1MJD A;  1FRD A;  2V9H A;  2UYZ B;  3AEA B;  2OJR A;  3BK2 A;  1WR1 A;  1CQV A;  4DDI D;  1P1A A;  2LHD A;  3UQB A;  4OVZ A;  1ACC A;  4LNI A;  2BVC A;  3KLS X;  3W1S C;  1K52 A;  1SE3 A;  1GC6 A;  1F77 A;  1I4R A;  3NRZ A;  3R7R A;  2ZEQ A;  1N61 A;  1WXQ A;  4DWF A;  1SIF A;  2JWU A;  4WUR A;  5IAA C;  2JZP A;  4FBJ B;  3AE3 B;  2Z8L A;  1S3S G;  1NYR A;  2KDF B;  2BQQ A;  2FNJ B;  3KUC B;  3LDZ E;  1GC7 A;  2M56 B;  3DVN V;  3VHT C;  5HFY A;  3APD A;  4N59 A;  1AW7 A;  3A1Q A;  3B1L X;  2KLC A;  3P4Q B;  2NVU I;  3N20 C;  2WHI A;  4JE3 B;  2V1Y A;  1I35 A;  2NTS A;  3P1M A;  1QQR A;  4M01 A;  3A9J B;  3TSS A;  3MTN B;  2KAN A;  3UGB B;  2K9X A;  2XN9 C;  2NS5 A;  2N7D A;  5G2N A;  2KWV B;  4TKN A;  2V4L A;  2KO3 A;  2EEL A;  3Q8E A;  4ASW C;  2WXH A;  4XWW A;  4RMA A;  4EZL A;  1V6E A;  4WWN A;  1YQ4 B;  4DBG A;  2HE7 A;  3NHE B;  4WWP A;  3DBR B;  2AL6 A;  2SAK A;  2PLP A;  3VTU A;  4KKJ A;  2WXR A;  1EF1 A;  2K8B A;  3E9S A;  1TKY A;  4K3C A;  2G3Q B;  2PVO D;  5D94 A;  4ZRP A;  2VH1 A;  3CST A;  3HM3 A;  2M19 A;  2LZ6 A;  2FIF A;  3B08 A;  3DWG C;  3D32 A;  2CR5 A;  3QWZ B;  3U4E G;  1UZX B;  5FR3 A;  4ANU A;  2MA9 B;  1VLB A;  2G45 B;  3DHI C;  3Q8C A;  3NVY A;  1NDD A;  2WXK A;  2QDF A;  1WRI A;  4K1R B;  5BMG A;  5DPT A;  2J0J A;  4RF1 A;  2DWQ A;  1EUV B;  3L16 A;  1HZ5 A;  4OHJ A;  1L2N A;  3HRD D;  2NPT A;  2M8S A;  3DWM A;  2BB5 A;  1GTE A;  3ZKJ C;  2D3A A;  1WYG A;  1ENF A;  3N3K B;  1FIQ A;  4M02 A;  1I4Q A;  2XNA C;  1HA5 A;  4FXC A;  1J8C A;  5JHB A;  1ET6 A;  1KH0 A;  2O6V D;  2WXI A;  2D3B A;  4M00 A;  1OQQ A;  3DBR I;  2I38 A;  1NVI D;  1C1Y B;  2JU6 X;  3KWV A;  3QX1 A;  4KDL B;  1GB1 A;  4N58 A;  2L32 A;  2JWZ A;  3A4R A;  1TJE A;  5GMV A;  2MBB B;  2ICI A;  1MPE A;  4RFB A;  4LNO A;  3V05 A;  2BYE A;  1IP9 A;  4IDI A;  2Z0E B;  3BII D;  2LEK A;  1C78 A;  2REX A;  4HRO A;  2MW5 A;  2WP9 B;  4GLS C;  1E6E B;  2L0F A;  1IGC A;  4K3B A;  3B2F A;  2QC8 A;  3NY5 A;  2ZZP B;  1Q5W B;  4BKG A;  4L23 A;  2W3R A;  1SBB B;  2DBY A;  3ZIM A;  2K3U A;  2KX0 A;  2XK5 B;  2O2V A;  2WLB A;  4NZL B;  4ZRQ A;  4MGI E;  5HI1 A;  4OVU A;  3OWE B;  4RGN A;  2BS2 B;  2YLM A;  3RZW C;  4HLE A;  1KFY B;  1M4V A;  3QK0 A;  2FUG 1;  2JVC A;  3AM9 A;  1TBE A;  4PS8 A;  1CMX B;  3L13 A;  3A1Q B;  4NNJ B;  3Q6B A;  2EKI A;  1UBQ A;  3ZQ4 A;  4GN1 A;  4HPL B;  4J3O D;  5I4D A;  3HIZ A;  2O6V B;  3QIJ A;  4TMA B;  2UU7 A;  2KT7 A;  3ZUN A;  1FRR A;  4WJP A;  1XXG A;  2M0X A;  1TGZ B;  1KF6 B;  2NPT B;  1VCB A;  1BT0 A;  2BBC A;  3U52 E;  3P4P B;  2J0K A;  4JL9 A;  4BBN C;  4MT5 A;  2G4S A;  1QIL A;  1XLO A;  1H7X A;  4TUU A;  1JWM D;  1V9J A;  2W82 A;  5FR6 A;  4YT0 B;  1ESF A;  3NOB A;  2ZW0 A;  4TQ0 A;  1HQR D;  1KLV A;  1LQB A;  4IKG A;  1SIJ A;  3I57 A;  2JF5 A;  1J19 A;  4HRS A;  2HTH A;  1T0R C;  1I7H A;  1IPG A;  3L0W B;  2DZM A;  2RPV A;  3GS2 A;  5G5G A;  3W1S A;  3DVG X;  1FCL A;  3A9K B;  3Q8B A;  2KD0 A;  1ZPS A;  4MM3 B;  2BYT A;  2KQS A;  2YEP F;  3IXS A;  1GG3 A;  1YJJ A;  2WXN A;  2BTE A;  1TS2 A;  4YWG G;  2BYF A;  2K22 A;  3RNE C;  2ZNV C;  5G5H A;  2WX1 A;  5EE9 A;  4MGY E;  2DX5 B;  4B0M A;  4IG7 B;  2BWF A;  1Q10 A;  4MJS A;  3EA6 A;  5IN7 A;  4XDD A;  1AYF A;  2DAF A;  2YVC A;  1OFF A;  4IM0 A;  1VJK A;  2IZV B;  2M1M A;  1YJI A;  3AE5 B;  1Z5S B;  3P2B A;  3C19 A;  3VFK A;  2K5P A;  1DOI A;  4B0E A;  3B9J A;  4C7Z A;  3SR6 A;  1F0Z A;  1WF9 A;  4RH6 A;  3H7S A;  2K25 A;  4JWS C;  1P9D U;  1WJN A;  2L52 A;  5BYR A;  3ZJU A;  1KTK A;  2J42 A;  1V8C A;  2HJ1 A;  5G55 A;  2GBJ A;  3BWU D;  4DK5 A;  4XDC A;  5CHF A;  3NVW A;  1C9F A;  4RF0 A;  3RNF C;  2DAJ A;  4JLC A;  1SJE D;  5LXH A;  2IGG A;  5J18 A;  2LHE A;  1U4A A;  3T3O A;  2L00 B;  1RWS A;  3AUL A;  3U7Z A;  4MGK E;  4DXG A;  3BZD B;  1X1M A;  1SE9 A;  4FA6 A;  1L7Y A;  2BB6 A;  1L0Y B;  3VR9 B;  4A3P A;  3SDL C;  3AE8 B;  1WZ0 A;  2MBH A;  4NQK E;  1FXI A;  2KQ7 A;  4FJY A;  3RCZ A;  1TKG A;  4HDO A;  3RNC C;  3VQI A;  2MJ3 A;  1XQQ A;  4KSL C;  2LGX A;  2D07 B;  2FID A;  1FFV A;  3HUI A;  4HK2 A;  2NBV B;  2PE9 A;  2D3G A;  2PIA A;  1FPY A;  1MI0 A;  1JRP A;  3Q8A A;  1N62 A;  4S0R A;  2WXF A;  3RNB C;  2INN E;  2WXL A;  2IY0 B;  3L54 A;  2QEJ C;  1PUT A;  3OLM D;  1NYQ A;  4ICU A;  3HVZ A;  4PS7 A;  2VRR B;  2CHZ A;  3I63 C;  2LRU A;  1UWX A;  2N9X A;  2BS4 B;  3DHH C;  3A33 B;  4EFO A;  1F2R C;  1N5X A;  3TEZ A;  3QJZ A;  1K50 A;  5LLI A;  4MAC A;  3DOW A;  4KSK C;  4ANX A;  4RNA A;  3EUB 2;  1VDV A;  4LK0 M;  1YMH E;  2DZI A;  3AE1 B;  1V80 A;  1I42 A;  1FNW A;  5BYQ A;  3W5V B;  3RNG C;  4C80 A;  1WE6 A;  1WMH A;  1XLP A;  1XCQ L;  1YX5 B;  4TQ1 A;  1I4X A;  3TMP B;  4DHZ B;  4HXD A;  3ZJV A;  2FBW B;  1SEB D;  5C2T B;  2I1K A;  3DPD A;  3IAS 1;  4RGT A;  3A9K A;  4UDU C;  4PT5 A;  2Q5W D;  2VZK B;  2HJ8 A;  2EMS A;  3DBL B;  3QC8 B;  4TV3 A;  5BO4 B;  3VUY A;  3ABV B;  5H92 C;  4KV2 A;  4ZHP A;  1YQ3 B;  4WQM A;  4GU2 A;  4WH4 A;  4FUL A;  4AQ7 A;  5HKH A;  1V5T A;  2KYW A;  4W9G A;  4PK1 A;  1WGR A;  2IYD B;  3NZS A;  3RUL A;  5D7G A;  5TR5 A;  2MLB A;  1SB3 C;  2LAS A;  3LB8 C;  3TCA A;  3URY A;  2DHZ A;  2LUM A;  2OJW A;  2HTM E;  2KTR A;  4I6L B;  2KDE B;  1C4C A;  1GPX A;  1HTQ A;  3MC8 A;  3U30 A;  3TEW A;  1KRH A;  1R4N B;  4O1N A;  4P1B C;  1V1P A;  3H7P A;  2H89 B;  1R4N I;  4W9K A;  1ZGU B;  5BYS A;  3TL5 A;  1ZE3 D;  3WCQ A;  1SE2 A;  2L0T A;  2PEA A;  1QT9 A;  2LWP A;  1WIA A;  1FD6 A;  4FHJ A;  2I1J A;  4CQN A;  1WR6 E;  1V97 A;  1VZ7 A;  2KAC A;  3PT2 B;  4FN2 A;  2E3T A;  1FNV A;  4IW0 A;  3KYC D;  4MDK E;  4HPP A;  4HVB A;  3B0A A;  4RM8 A;  4C4V A;  4IC7 B;  3IFW B;  1WGK A;  4FJZ A;  4AJY B;  3B2G A;  1NBF C;  4LDT D;  4ZRK A;  5JHA A;  1T0S C;  3MJ5 A;  3HM6 X;  3IT6 B;  2Z59 B;  1NI3 A;  2MBO A;  3BY4 B;  3X23 A;  1QOG A;  1I4G A;  3N1Y C;  4DXA B;  4ARI A;  4WJO A;  2M0A A;  1WMH B;  4G11 A;  1EM7 A;  4EKU A;  3P4R B;  2IND C;  1YX6 B;  2J0M A;  2M4N A;  2BPS A;  1IYF A;  1ZXI A;  2L8J A; 
#chains in the Genus database with same CATH homology
 4OW0 A;  1C78 A;  1JWB D;  5LNK 1;  4HRO A;  1N60 A;  1XCT L;  3LXF A;  2WP9 B;  3CIR B;  1BXT A;  1RFK A;  1YNT E;  1T6B X;  4HJG E;  4A55 A;  4OZA A;  5JXV A;  4GLS C;  2OHF A;  2D5G A;  1CZP A;  4HKZ E;  1TKE A;  2DYO A;  1E6E B;  3AE6 B;  3FAH A;  3E56 A;  2PTL A;  1IGC A;  3R8B A;  1K53 A;  3B2F A;  1I4H A;  1C76 A;  1ZDX A;  4M0W A;  5D3D A;  1VZ6 A;  4L23 A;  2W3R A;  1SBB B;  1SSN A;  2K0P A;  2KN4 A;  1H7W A;  2IPK D;  3R2I A;  1ZP0 B;  2DBY A;  2K3U A;  4KX6 B;  2KMM A;  1TS5 A;  1NEK B;  2YEP B;  1I4P A;  2WLB A;  2HDE A;  4NZL B;  1SF0 A;  4ZRQ A;  5HI1 A;  1R7S A;  5TSS A;  1D6E C;  3OWE B;  4RGN A;  1E10 A;  2BS2 B;  4A8X C;  1J7A A;  2R61 A;  1PGB A;  1KFY B;  2WXP A;  2IJ0 A;  1NEN B;  1DYQ A;  1M4V A;  1V1O A;  2KQ4 X;  2FUG 1;  5H8Y E;  3AM9 A;  3AEG B;  1A70 A;  3BVZ A;  2BW2 A;  5T8I A;  2EKI A;  2MH7 A;  2WXQ A;  3ZQ4 A;  2MJD A;  4J3O D;  5HHD G;  3AE9 B;  5I4D A;  1MHX A;  4DXF A;  3AE4 B;  1HXY D;  1D5X C;  5FKA C;  2JYE A;  1PYW D;  3IAM 1;  4TMA B;  1FRR A;  1PFD A;  4H2A A;  3Q8F A;  1FO4 A;  3T3N A;  2ONQ A;  1V1P B;  2PKO A;  1XXG A;  2X38 A;  3ZYY X;  1KF6 B;  1UGJ A;  2BBC A;  3U52 E;  3P4P B;  3R2T A;  3AE7 B;  1EU4 A;  4MH8 A;  4MT5 A;  2NMQ A;  4WWM A;  2CJN A;  1HZ6 A;  1QIL A;  1XLO A;  1H7X A;  1K51 A;  2IGD A;  4KKI A;  1JWM D;  2W82 A;  4YT0 B;  1F2R I;  1ESF A;  2ZW0 A;  4TQ0 A;  1HQR D;  1DOY A;  1AWD A;  1FEH A;  4GDL B;  1XLN A;  4IKG A;  1SIJ A;  3I57 A;  1JAL A;  3NVZ A;  3AED B;  4KGT A;  1TS3 A;  1UUP A;  4P6V F;  4HRS A;  1J7B A;  1E9M A;  3RFZ B;  1I7H A;  1QOB A;  3L4P A;  3RPF C;  1MVK A;  2DLB A;  1JWS D;  4L1B A;  1BUI C;  1ZXH A;  1RM6 C;  2WXJ A;  2Y5C A;  4TSS A;  2WDQ B;  1D5M C;  2JQR B;  1N5W A;  2RPV A;  3GS2 A;  5G5G A;  3W1S A;  1FCL A;  3AB5 A;  1L4D B;  3Q8B A;  4MM3 B;  1ZPS A;  4C7Y A;  2BYT A;  3HVD A;  1SE4 A;  1ZUD 2;  3P63 A;  2YEP F;  1YN5 A;  3IXS A;  1YJJ A;  2J52 A;  2WXN A;  3FIL A;  2BTE A;  2BT6 A;  1TS2 A;  3LYY A;  2JXT A;  4YWG G;  3AN1 A;  5EE0 A;  4IOI E;  1L0V B;  2WS3 B;  2K22 A;  2WU5 B;  1STE A;  2V4I B;  5G5H A;  5EE9 A;  2LJI A;  4B0M A;  3KQ4 A;  1YN3 A;  1Q10 A;  4DQO C;  3EA6 A;  1AN8 A;  3C8Y A;  4LTU A;  4XDD A;  1AYF A;  1IBX B;  3AEF B;  1OFF A;  2MEK A;  1VJK A;  3GB1 A;  2W54 A;  1YJI A;  3AE5 B;  4YSZ B;  2L83 A;  3AEB B;  2ACZ B;  4XE0 A;  2K5P A;  3N9Y C;  1DOI A;  4B0E A;  1YN4 A;  3B9J A;  1UNS A;  4C7Z A;  5BMI A;  1EWC A;  5FK9 C;  3SR6 A;  1F0Z A;  4WAF A;  1EWY C;  3W5U B;  2CJO A;  4A90 A;  2WQY B;  1C4A A;  4RH6 A;  4JWS C;  4RGM A;  2WDR B;  2FE8 A;  2Y3A A;  4US9 A;  2L52 A;  1ZDV A;  5BYR A;  2PMV A;  1KTK A;  3ZJU A;  2J42 A;  1V8C A;  3NUH B;  5AUK A;  2RMM A;  1PGX A;  2WDV B;  2LGI A;  3BWU D;  4OZC A;  2MJE A;  2E6X A;  1FCC C;  2BS3 B;  3H8H A;  4XDC A;  3CWI A;  4ZYS A;  3NVW A;  1B9R A;  3BVG A;  4P16 A;  1C9F A;  1IGD A;  4RF0 A;  3KWL A;  3V3X A;  1TZO A;  2PW9 A;  4EE2 A;  5EE3 A;  1L4Z B;  1SJE D;  4RCO A;  1FNU A;  4AS1 A;  2IGG A;  2RDH A;  1KLG D;  3BII D;  4YXD B;  2LHE A;  1SXT A;  3T3O A;  3J9C A;  1RWS A;  1ROE A;  3U7Z A;  4DXG A;  1Y56 A;  3BZD B;  2QMT A;  1XF5 L;  2N9K A;  2Y5P A;  1TY0 A;  2KDM A;  1PDX A;  4YTN B;  1CK1 A;  2GB1 A;  3PZ8 A;  4A6Q A;  5D3I B;  5E6J A;  1BML C;  3NS1 A;  3VRA B;  2W3S A;  4HKQ A;  2BB6 A;  3SFE B;  1L0Y B;  2NTT A;  1XLQ A;  4HEA 1;  1JQ4 A;  2PVG C;  5EE1 A;  3VR9 B;  3AE8 B;  3ZJT A;  1FXI A;  2QIE B;  3BVM A;  1L6U A;  1QOF A;  1TKG A;  1DOX A;  3VQI A;  2QJL A;  4OZB A;  1C4P A;  1FRD A;  2MJ3 A;  3AEA B;  3BK2 A;  1TS4 A;  2CU3 A;  1CQV A;  1FFV A;  4RGO S;  2V0G A;  3HUI A;  2LHD A;  3Q69 A;  4OVZ A;  1T5X D;  1RYJ A;  1ACC A;  2JX5 A;  1ZOY B;  2JYT A;  2PIA A;  3MFG A;  1D5Z C;  1MI0 A;  1T3Q A;  1JRP A;  3Q8A A;  1L6V A;  1N62 A;  3U2S C;  3KLS X;  4ARC A;  1K52 A;  1SE3 A;  2WXF A;  1QF6 A;  2INN E;  2WXL A;  1GAQ B;  2I2Y A;  1F77 A;  1I4R A;  2QEJ C;  1PUT A;  3NRZ A;  3PZ7 A;  2QIL A;  1NYQ A;  1N61 A;  1WXQ A;  3HVZ A;  2JWU A;  3BYT B;  1JCK B;  1UWX A;  4WUR A;  4KGR A;  3CF4 A;  2BS4 B;  3FIL B;  2JZP A;  3UI3 A;  3MHZ A;  2ON8 A;  3AE3 B;  1F2R C;  2Z8L A;  1WWT A;  3I9V 1;  1P7F A;  4NAM A;  2G1E A;  1NYR A;  1N5X A;  4JPS A;  3TEZ A;  1K50 A;  4MAC A;  4US8 A;  1B1Z A;  4RNA A;  2M56 B;  3EUB 2;  3EGR A;  1VDV A;  4LK0 M;  4ZOH C;  1YMH E;  3AE1 B;  1VRA B;  5HFY A;  1C79 A;  4N59 A;  4YTP B;  1FNW A;  2GI9 A;  4KGS A;  5BYQ A;  3W5V B;  3MP9 A;  4C80 A;  1AW7 A;  3P4Q B;  4JX1 C;  1XLP A;  2KWD A;  1FMA D;  1XCQ L;  1TY2 A;  4JE3 B;  4NAW B;  4WIP A;  3AEC B;  4TQ1 A;  2NTS A;  3P1M A;  1QQR A;  3TSS A;  1FXA A;  2V3P A;  2VZK D;  4ZHO A;  1ET9 A;  1I4X A;  2K9X A;  1QLB B;  2XN9 C;  3MC0 B;  2LMC A;  4ITK A;  3O13 A;  1GOZ A;  3ZJV A;  3SFD B;  2DYM A;  5GXG B;  2WU2 B;  2FBW B;  2EEL A;  2INP E;  3Q8E A;  2SEB D;  1SEB D;  2WXH A;  1JRO A;  4XWW A;  5C2T B;  1WSP A;  1FFU A;  4YTM B;  3IAS 1;  4RGT A;  3NVV A;  1L0X B;  1YQ4 B;  4UDU C;  4PT5 A;  5BMH A;  1DGJ A;  2Q5W D;  2V3N A;  3W9C B;  1LO5 D;  2LFI A;  2VZK B;  1JWU D;  3BYY B;  2SAK A;  1VZ8 A;  3TEX A;  2PLP A;  4KKJ A;  3ABV B;  4L2Y A;  5MPO A;  1GB4 A;  5H92 C;  1L5P A;  2WXR A;  1KLU D;  1N63 A;  1YQ3 B;  4WQM A;  1P7E A;  4ZHP A;  4WH4 A;  4AQ7 A;  2W55 A;  4R3D A;  3E9S A;  3AH7 A;  3SEB A;  2TSS A;  1HEZ E;  4N6E B;  3TUO A;  1TKY A;  1CJE A;  3VR8 B;  3W2D A;  1UWM A;  2PVO D;  4ZRP A;  1PGA A;  2M19 A;  4REZ A;  5D7G A;  1FM0 D;  1SB3 C;  3DWG C;  1XO3 A;  2OED A;  2WXM A;  3LB8 C;  3URY A;  1IBX A;  2LUM A;  3U4E G;  2HTM E;  5FR3 A;  1J7C A;  1C4C A;  1GPX A;  1QKZ A;  1VLB A;  2WNM A;  4JWU C;  5C3J B;  3Q8C A;  2IDY A;  4XWT A;  2QSD A;  3NVY A;  2WXK A;  3TEW A;  4USA A;  1KRH A;  2AQ3 B;  1WRI A;  5BMG A;  2G9H D;  4O1N A;  1JWA D;  3ETR A;  4RF1 A;  2DWQ A;  1OQR A;  1V1P A;  1HZ5 A;  2H89 B;  4OHJ A;  1D4B A;  5BYS A;  3HRD D;  3GP7 A;  1GTH A;  1ZE3 D;  3DWM A;  3P4S B;  3WCQ A;  1SE2 A;  1GTE A;  2BB5 A;  1XEE A;  1QT9 A;  3TEY A;  2IGH A;  1FD6 A;  1WYG A;  1ENF A;  1GT8 A;  2N0S B;  4CQN A;  4YSX B;  1FIQ A;  1I4Q A;  4A9A A;  2J4X A;  2XNA C;  1HA5 A;  3AV8 A;  4FXC A;  1V97 A;  1VZ7 A;  2KAC A;  1ET6 A;  4Q2J A;  1KH0 A;  2E3T A;  4NJC A;  1FNV A;  5AUI A;  3VRB B;  2WXI A;  1TYG B;  3FC4 A;  2KAJ A;  3P42 A;  1E0Z A;  4YSY B;  1EU3 A;  2ZW1 A;  1IUE A;  1OQQ A;  2AX5 A;  2I38 A;  1WGK A;  1JML A;  3PO0 A;  1NVI D;  3ZGZ A;  1E7P B;  3B2G A;  3AEE B;  2AQ1 B;  2JU6 X;  3KWV A;  2J53 A;  1GB1 A;  4N58 A;  2RDG A;  1C77 A;  1VR9 A;  2L32 A;  2H88 B;  1SJH D;  2N9L A;  3MJ5 A;  1TJE A;  4GDK B;  2AQ2 B;  2JSV X;  3IT4 B;  4D2K A;  2ICI A;  3IT6 B;  1MPE A;  1NI3 A;  2N7J A;  4LLG M;  4RFB A;  4C56 C;  2GRI A;  1QOG A;  2B76 B;  2L1A A;  1I4G A;  2WXO A;  3NZ3 A;  1JW9 D;  4ARI A;  1QOA A;  2M0A A;  1EM7 A;  3V05 A;  3P4R B;  3BK1 A;  3AE2 B;  5HG2 A;  3AMZ A;  1MHH E;  4IDI A;  1ZXI A;  2LEK A;  2WXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...