2H88B

Avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
b'TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
molecule tags Oxidoreductase
total genus 71
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h88B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h88B01
5C3JB 1JQ4A 3ZYYX 3AE3B 2PVGC 1H7WA 1JWBD 2W54A 3AE9B 3SFEB 3AH7A 3W5UB 3AEEB 2LEKA 1JWAD 1YQ3B 4C7ZA 4N58A 1RWSA 1TKGA 3NVZA 3P4RB 2PIAA 3AM9A 2PVOD 1E9MA 1TYGB 3P4SB 1I7HA 1KRHA 1YQ4B 4YSXB 1NVID 1QOFA 1WGKA 1YJJA 1ZXIA 4YTNB 2W3SA 1L6VA 1FMAD 5C2TB 1OQQA 1PUTA 3VR9B 2BS4B 2H89B 2WDQB 4US9A 1FXAA 4YXDB 4N6EB 2M19A 1FIQA 1FO4A 2WU5B 3SR6A 1GAQB 1L0VB 1QLBB 1PFDA 3AE7B 1L5PA 1NI3A 1JROA 3AE1B 2BT6A 2PKOA 2WDRB 3HRDD 3VRBB 3P4QB 1QT9A 3WCQA 3AE6B 1FM0D 1FRRA 2JX5A 3VRAB 3EUB2 2L52A 1V8CA 2E3TA 2BS2B 5H8YE 1WYGA 4ZHPA 2WU2B 1F0ZA 1ROEA 3LXFA 1RFKA 3AEFB 3B2FA 4HROA 2FBWB 1V97A 1UWMA 3VR8B 4C80A 1J7AA 1N62A 1CZPA 1WWTA 1WXQA 2KMMA 3DWMA 2Y5CA 4ZOHC 2WQYB 1E7PB 1FRDA 4ZHOA 4ITKA 4JWSC 3CIRB 1XLOA 1GPXA 5GXGB 1QOGA 5EE3A 1ZOYB 3AE8B 1JALA 1N63A 4YTPB 1FFUA 1R7SA 3PO0A 4FXCA 1QOBA 4WQMA 1E10A 1E0ZA 3B9JA 1CJEA 1RYJA 1N61A 1GT8A 2K22A 1KFYB 2QJLA 3AE2B 2W3RA 3HVZA 4KX6B 2CU3A 3AEDB 2OHFA 1DOIA 3NVWA 4IDIA 1J7CA 2MJEA 1PDXA 3ETRA 1AYFA 4WWMA 5EE9A 1OFFA 3FC4A 3LB8C 5G5GA 2WDVB 1ZP0B 3AEGB 2CJOA 1SF0A 2CJNA 4A9AA 3DWGC 2AX5A 1OQRA 1NYQA 3FAHA 4HRSA 1TKYA 2QIEB 3HUIA 5EE1A 1XO3A 2DWQA 1VDVA 2N0SB 1T3QA 1NENB 1XLPA 2B76B 4N59A 3W9CB 2ACZB 1NEKB 1N5WA 2K5PA 1GTHA 2G1EA 3BIID 3KWLA 3NVVA 2H88B 5H92C 1IUEA 3AEAB 1DOYA 4JX1C 3CWIA 4C7YA 1XLQA 2MJ3A 2L83A 1SIJA 3P4PB 2MH7A 4US8A 3CF4A 1FFVA 4USAA 2WP9B 2WLBA 3ABVB 3SFDB 1EWYC 3B2GA 4YTMB 3AN1A 3L4PA 1N60A 5AUIA 4YSYB 3P1MA 1A70A 1TKEA 3AV8A 1B9RA 1GTEA 1QOAA 1SB3C 1DOXA 1N5XA 3NS1A 1YJIA 3W5VB 4YSZB 2JQRB 1L6UA 1H7XA 1JW9D 4JWUC 3AB5A 1VJKA 1FXIA 2HTME 1WRIA 2BS3B 2WS3B 5EE0A 3AECB 1E6EB 1NYRA 1ZUD2 1J7BA 3RPFC 4P6VF 3AEBB 2KAJA 2EKIA 3NRZA 3P63A 1XLNA 3AE5B 4LTUA 2DBYA 2Q5WD 3AMZA 5AUKA 2MJDA 2W55A 3NVYA 1AWDA 1RM6C 2M56B 5G5HA 1KF6B 4YT0B 1QF6A 1VLBA 2K9XA 1DGJA 1JRPA 3AE4B 5MPOA 1TJEA
chains in the Genus database with same CATH superfamily
1SIFA 3AE3B 1H7WA 3AEEB 1LFDA 2KYWA 4IM2A 4Q2JA 1TTNA 1YN4A 3U52E 3P4SB 2MEKA 4DXAB 3NZSA 5G55A 1HTQA 1NVID 3NY5A 3E56A 1ZE3D 3VR9B 4TV3A 4A3PA 4US9A 2KKCA 4IW0A 1IYFA 1NBFC 3VUXA 3AE1B 4OVUA 4WIPA 1WY8A 1GUAB 4GGQA 4ZDVA 4KDIC 2DHZA 3OJ4B 2O6VA 4KSLC 3VTWA 1JWSD 2JRHA 2N9LA 1WF9A 4NPNA 3BK2A 1C4AA 1C3TA 1UELA 2WXOA 4HEA1 3ZTCA 2KT7A 3PO0A 3Q69A 4WJNA 4WAFA 5LLIA 3AEDB 4MDKE 1SE4A 1H4RA 3N3KB 3A4RA 3RI7C 4ZRPA 1UBIA 3L0WB 2LWPA 4MGIE 2IGDA 4KGTA 1GTHA 1D5XC 3PPAA 2E6XA 4FULA 1DOYA 4JX1C 1ESFA 1MHHE 5JZEB 4FJYA 4EUTA 5LXIB 2AQ2B 2AL3A 3TIXA 3W1SC 4HLEA 5D3IB 1J0GA 1SB3C 1GOZA 2LVOA 1BUIC 2CHXA 4HDQA 3QA8A 3IBEA 2HTHA 1SJED 4K7WA 4B0MA 3GE8C 3JW0X 2FNJB 4ANUA 2DBYA 3DVGY 4W9IA 3V3XA 3PT2B 4IM3A 4C4VA 1K50A 2QMTA 4FJZA 2K9XA 5MPOA 1WE6A 5CHVC 1EM7A 1JWAD 1YQ3B 2PIAA 3VH4B 2RSUA 5HKHA 2GBRA 2Y3AA 1TS2A 2IYDB 4XYCA 4LNNA 1PFDA 1E7UA 4L1BA 2G3QB 1FRRA 5D94A 1D5MC 2WU2B 3PV1A 1D5ZC 2INNE 3TEXA 4ICUA 3U7ZA 1VCBA 3H7PB 2WQYB 3M95A 2L32A 2BKFA 3UGBB 4A90A 1OQYA 2OJWA 1V9JA 1R4MB 4R3DA 1ZPSA 4W9HA 2JYTA 1K51A 1QILA 4RGTA 1FPYA 1TS3A 2J0MA 3DBSA 3I3TB 2VZKB 1FNUA 1KTKA 2FCMA 2KZRA 2UYZB 4ACFA 2K0PA 3L17A 2ACZB 1EF1A 4XWWA 2OJRA 3APDA 1F2RI 3AULA 4LJOB 2C9WB 4TSSA 2D3CA 1TIFA 1L4DB 1V1PB 2NTSA 1WMHA 4BKTA 3MJ5A 3MC9A 1FXTB 4ZRJA 3L08A 3ZXVA 2PJHA 3NZ3A 3TBLD 4A8XC 5LNK1 3DPDA 3RPFC 1EF5A 2V4LA 1LXDA 1TGZB 1XLNA 5HG2A 4TMAB 1FNVA 5AZHA 3AMZA 2KNBA 5AUKA 2W55A 4J3OD 2PTLA 1WSPA 4YT0B 1Z5SB 3ZJVA 4AJYB 2KDFB 1M94A 5C3JB 2RDGA 2AWTA 1CMXB 3DVNV 3ZUNA 1WXVA 3IVFA 1I4HA 1I42A 3IHPC 2LUEA 1WZ0A 1P7EA 2FCQA 3VQIA 1V86A 2KMCA 4BOZB 2KQ4X 4II3B 3WCQA 4L2YA 1S1QB 4ARIA 2KANA 1GB1A 5JXVA 3AEFB 2IZVB 2LXAA 4HXDA 4M0WB 4KIKB 4NY0A 2IO1B 3RD2A 1N63A 3A1QB 1C76A 2JPHA 2QEJC 1Y56A 1MFWA 5D3DA 2BB5A 4A9AA 2ZW1A 3FAHA 5EE1A 3N1XC 1VDVA 1NENB 3GZNI 4EZLA 4A6QA 3L54A 1LGRA 2DNFA 2N1VA 2X38A 3Q8BA 2MBOA 1MPEA 1EWYC 2ZPYA 3SDLC 3FILA 1DYQA 4NAWB 4QAYA 2D3BA 3BINA 4J6IA 2JZPA 4ZYNA 3PZ7A 2LMCA 3RNGC 1HQRD 4M0WA 5AZFA 1KJTA 1ZKHA 3N20C 3A1QA 3A9JA 1J19A 2M56B 5G5HA 2D5GA 4UDUC 1EO6A 3AE4B 2KFJA 3U2SC 3DVGX 1Q10A 1IPGA 3U4EG 5BMIA 2WNMA 2DAJA 4LDTD 4FLHA 3EFCA 4DHJD 1KRHA 2XEWA 2MBBB 4WWNA 4PYZA 1V81A 5D2MB 2PLPA 4GDKB 3SR6A 4ANVA 2K6QA 1UNSA 3ZNGC 1OTRB 2ZPNA 1UUPA 1FM0D 4K3BA 3MHSD 3R2IA 4HPLB 2FCSA 5J18A 3WAOA 4OVVA 1WFYA 4ZRKA 2CS4A 3DBRI 1Q1OA 2GMIC 4LK0M 1E7PB 3WA0A 4WH4A 2DLBA 1GG3A 3HM6X 2ONQA 5DPTA 2FUG1 1YNTE 5EE9A 3O13A 1OQRA 4W9GA 1WGDA 2MA9B 2QIEB 3UF8A 1WX7A 3W9CB 3LDZE 3R2TA 4B9KA 4M8NA 4TQ0A 3H9DA 3AU4A 2O6VD 2MJ3A 1MG8A 1UGMA 1FFVA 4N9F4 4MGZE 2V4IB 2INPE 5BYRA 1TKEA 3KUDB 4HPMB 1F1HA 3Q8FA 4M00A 5IKCM 1H7XA 1RRBA 1FXIA 4W9DA 2BS3B 1JCKB 4PT5A 2KWCA 3VXWA 5FK9C 1WYWB 1P9DU 5TSSA 2WXJA 5HI1A 4HKQA 1WR6E 3QARA 1VZ6A 1VLBA 3MHZA 1GC7A 3MTNB 2EKEC 3PLVA 3ZNID 3MC0B 1JWBD 4DBGA 4C56C 4FHJA 1GNUA 3N9YC 1TS4A 1ET9A 2D2QA 2PVOD 4K1RB 1YJJA 1I4PA 5C2TB 1FD6A 2LHEA 3GP7A 2WDQB 2I1JA 2QILA 3UQAA 2K8HA 1KOTA 2M19A 2WXNA 3WAMA 2LGIA 1JROA 5H8YE 4DK5A 3BY4B 4XE0A 2KHWB 3R3MA 2ZCCA 4AP4C 3TEYA 2L1AA 5D7GA 3VR8B 3ALBA 4W9FA 5E6JA 1FRDA 3Q6BA 4LNKA 1S3SG 3VVWB 1EU4A 3WIMA 3EGRA 4WWOA 4W9JA 4DHJB 5D6JB 1OFFA 1MG4A 1I4GA 4WJPA 5T8IA 4GMVA 2YVCA 2HD5B 2DWQA 4EE2A 1P1AA 2G1EA 2YLMA 2H88B 3AEAB 1ENFA 5IN7A 3CF4A 2LGXA 1FCLA 3GZNB 2BBCA 4GLSC 3L4PA 3P42A 4YSYB 3RCZA 4JLCA 3DHHC 4AJWA 4YSZB 1SEBD 3GB1A 4JWUC 3CF6E 2IO0B 2DYOA 4TUUA 3AE5B 4KVGB 2Q5WD 1X1MA 4HWIB 1LQBA 4LCDE 2MX2A 2IGHA 4WWPA 2Y5BB 1WXSA 1WM2A 1IGCA 2WYQA 1L0XB 2MQJA 4ZYSA 2O6VB 2KTRB 3VTVA 1V49A 3EC8A 1SXTA 2XNAC 3ZGZA 4K3CA 1IP9A 2WXHA 4KGSA 2KN5A 2LFIA 1L0VB 3QQ8B 3VRAB 3EUB2 2LASA 3H7SA 2FAZA 2IO2B 2VH2A 2R2QA 1ROEA 2LGYA 3CMMB 1TZOA 1T0RC 1V97A 3QIJA 2C7NB 1AARA 3BWUD 3V6CB 2IDYA 3E9SA 5HHDG 2VZKD 4GN1A 2KLGA 3DBRB 1FFUA 3RUIB 1MHXA 3B9JA 2JU6X 1RYJA 2INDC 3ECIA 5DPWA 1B9RA 3N30A 1OEYJ 4RM8A 1ZP0B 3BK1A 2KTRA 3DCGA 3SEBA 1EWCA 4HJKA 2AX5A 1C4PA 2MBEA 3MFGA 1TKYA 2VRRB 3L10B 4N59A 2G4DB 2B76B 2N9KA 5I4DA 2K5PA 5LXHA 5BMGA 4C7YA 1I4RA 1Z2MA 3NZUA 2FIDA 1BXTA 4G50A 2WP9B 3DBLB 4ANWA 2WX0A 4IOIE 4C4VB 3ZXRA 3DBHI 4KKJA 2M0XA 3TL5A 4GOCA 4XDCA 2WX1A 4NZLB 4JIOU 1QQRA 3P63A 4HDOA 4JL9A 2PE6B 4RF0A 1V5TA 3UI3A 2DZJA 2N9PC 1YMHE 3PREA 2KDEB 3TSSA 2GRIA 4N58A 4EEWA 2L0FA 1E9MA 3DHGC 1D3ZA 2KQSA 3JSVA 1YIWA 2DENB 3K9OB 5BMHA 1WGYA 1YX6B 2HJ8A 4HVBA 4BKGA 4AS1A 2JWZA 5CX3A 2ZNVC 4ASWC 4P16A 3KUZA 5E6NA 2I1KA 3PTFC 4XWTA 1RFKA 2MBHA 2BYFA 3Q8CA 2KX3A 2V1YA 3ZKJC 2G45B 4EZKA 2QCZA 1KH0A 4M02A 4ZHOA 4JWSC 4DDID 1QOGA 2KLCA 4YTPB 2W9NA 4FJVB 1NDDA 4I6LB 1Q0WB 1ET6A 3QC8B 3T3NA 2QJLA 3AE2B 1WMHB 2D3GA 1FNWA 2LRWA 1XO3A 4W9LA 2KJHB 3ZW3A 3NVVA 2DZMA 1QZEA 3KWLA 2B3AA 2L3ZA 4WJOA 2XK5B 1XEEA 1PYWD 2K3UA 3PVLA 3A9KA 3P4PB 2J42A 2LJIA 2KMAA 4US8A 3M63B 3Q3NC 2Z8LA 2KQ7A 4NNJB 1F9JA 1WIAA 4L23A 2KVRA 2V3SA 3ZIMA 1F77A 3OWEB 4ANXA 2HTME 3AECB 2AL6A 3VUYA 5L95C 3H8HA 2LGSA 5TR5A 3NRZA 4K7SA 1UH6A 2BW2A 3HVDA 1AWDA 2JSVX 5J2RA 1VZ7A 5JHBA 2LUMA 1WXAA 1GC6A 1UF0A 3BVGA 1HZ6A 3ZDMC 3PSEB 5DPRA 1XCQL 1ZXIA 2BYVE 2KC1A 2XK5A 3VH3B 1FMAD 1HA5A 1UBQA 3EHVA 4JGHB 2RDHA 3T3OA 1WJ4A 2BGFA 3AE7B 1ISNA 2BT6A 3APCA 4XZ4A 1NI2A 3P4QB 1QT9A 2LXCA 3ZVVA 1MJDA 3TUOA 2GBMA 1C4CA 1WYGA 2J53A 2DYBA 4MH8A 1SSNA 4C80A 2L0TA 1STEA 3B08A 5G2NA 2FUHB 2FCNA 4A3OA 4IWQA 2WHIA 2PE9A 5EE3A 1V80A 3SHQA 2J0JA 1CJEA 2MWSB 2KACA 4F8CB 2CU3A 3PS6A 4IDIA 3S2AA 3FC4A 1KM7A 3AEGB 2CJOA 3FILB 3KWVA 3X23A 1PGBA 2KWVB 3HUIA 2N0SB 1JWUD 3M62B 1HXYD 3RNBC 3PRZA 2DAFA 3CWIA 4URKA 1XLQA 1PGXA 2V9HA 3EECA 2ON8A 3URYA 3A9JB 2ZVNA 2WGSA 3I57A 3ZO5B 3ZRFA 3OLMD 3W5VB 1JW9D 4HJGE 1TY0A 4A20A 1OGWA 1L4ZB 1E6EB 4XC2A 1JWMD 4WJQA 1VZ8A 2KAJA 4KKIA 3W2DA 2N7EA 2I38A 2KN4A 3NVYA 3GE3C 1YX5B 2REXA 4K81A 2GOWA 1E8WA 2KWUB 4MELA 3W5UB 4WURA 3IAS1 2LVQA 2J52A 2N1WA 4OHJA 3NVZA 1A5RA 3P4RB 2JVCA 4LJPB 1TYGB 4ICVA 3SU8X 1GJZA 1I7HA 3C0RB 5E6PA 4K7UA 3VAWA 2EMSA 4YTNB 2CR5A 2G4SA 2KXJA 4YXDB 4MACA 2I2YA 2R61A 2WDRB 2KJ6A 4A55A 4X57B 4II2B 4XDDA 1V8CA 3BYTB 5J17A 4NQLB 2WXPA 4HROA 2FBWB 2KJRA 2MP2A 1WXQA 4OZBA 4MJSA 5JHAA 3ZNZB 4WQOB 1GPXA 3TEWA 4IWOA 1JALA 4WQMA 2BYEA 1IGDA 3RT3B 2JWUA 2MJEA 1AYFA 4EZJA 2V0GA 4RGMA 1WGHA 1XF5L 3DWGC 4W9KA 1TBEA 1H8CA 4IM0A 3BIID 1D6EC 2JUOA 2WXKA 2L83A 4IKGA 3SFDB 4MEMA 1WJUA 2QHOA 2KTFA 2NR2A 2WXIA 1HZ5A 1JRUA 1HTOA 4GU2A 4MM3A 2WS3B 3KQ4A 1NYRA 1MVKA 2X8XX 3AEBB 4BKSA 4BBNF 4BAXA 1I35A 4XGAB 1WM3A 2KWDA 3UQBA 2IPKD 2AQ1B 3TMPB 3RULA 1N6ZA 1F2RC 3DOWA 2WXGA 2WXMA 2LEKA 4C7ZA 4MGKE 5L83A 2RPQA 2M0AA 4PYUA 1QOFA 2BYTA 1GB4A 4CYEA 4GSWA 2AQ3B 2NTTA 1V1OA 1YQBA 2WXQA 1L5PA 3U8ZA 2PKOA 5IO9A 2NMQA 1LO5D 4RMAA 5FR3A 5C1ZA 4NJ6A 3LXFA 1UGJA 1P0RA 3B2FA 3MJWA 3ONSA 4KGRA 3DWMA 3EFUA 2KOXA 3CIRB 4B6WA 1QOBA 3QWZB 2O2VA 4MGYE 2OHFA 4WWMA 1SE9A 2K1FA 4OVZA 2WDVB 1CK1A 2KD0A 1E7VA 3VFKA 4IUMB 1T3QA 1NEKB 4EFOA 3HM3A 1IUEA 3RNCC 1AW7A 3WAPA 1K8RB 1XD3B 2ZCBA 4FHKA 3H6NA 2AYOB 1J8CA 3DQVA 3O65B 1SBBB 1L0YB 1WJNA 1WGGA 1ZGUB 1C79A 2IBIB 2NS5A 1ZUD2 4IWPA 1G6JA 3UINB 2JF5A 2VH1A 5JH5C 1QKZA 1WX8A 3L13A 1DGJA 1TJEA 4NQKE 3RNAC 5CTRC 3ZYYX 2WXFA 4GDLB 1L7YA 1R4MI 1RWSA 3RZWC 3OJ3A 1C78A 4AUQC 2W3SA 4NJCA 3C8YA 4KV2A 3R66C 5E6OA 2Z59B 3FKYA 4N6EB 4NJ7A 4CHKA 4G0NB 1C77A 1FO4A 1I4QA 3KVFB 1L2NA 2QSDA 2BS2B 3IAM1 3QK0A 2ZW0A 2KMMA 4LNIA 2D07B 2Y5CA 4ZOHC 2M17A 4PK1A 2N7JA 4RF1A 3V61A 1ZOYB 3AE8B 1R7SA 1YOVB 3C19A 4GB9A 1ACCA 1VD2A 2K22A 3APFA 2W3RA 2XBBC 5DPSA 4GDLA 3PRMB 1SF0A 2CJNA 2NBUA 2HJ1A 1NYQA 3QCAA 3KLSX 3BZDB 1WR1A 1E5WA 2J7QB 1KLVA 1YN3A 2WXRA 1XCTL 3QHTA 4AQ7A 4FN2A 4MSMB 2N9XA 4S17A 4YTMB 2BWES 4FA6A 2BWFA 1IBXA 1A70A 3AV8A 1QOAA 1T0SC 2L05A 3VUWA 1UWXA 3I5JC 2KX0A 4B95A 2N4FA 1VJKA 1R4NI 1HE8A 2KC2A 2WWZA 4BOSC 4PS3A 2EKIA 3VDZA 4LTUA 3WANA 3JSVB 2LVPA 3ZJTA 1ZW7A 3ZDTA 4RFBA 2KDIA 3CSFA 2JT4B 2R2OA 3SFEB 3AH7A 2V3PA 4M01A 1V2YA 4F7ZA 4PS7A 3N32A 4KDLB 3TEZA 1L6VA 2D10A 3PZ8A 3KW5B 1T0QC 2JZ3B 1XXGA 1VR9A 3RFZB 3ZQ4A 2PPHA 3UIPB 4RH6A 1WWTA 1MI0A 2MHJA 3B0AA 5HFYA 2MSED 2NPTB 2UWQA 1F52A 5GXGB 1V5OA 3V6EB 5C23A 5AZGA 1K52A 4HK2A 4FXCA 3A9KB 2ZNVB 1B1ZA 3GOEA 4M8MA 4E74A 3NVWA 2FE8A 5FR6A 1TZ1A 4P1BC 2YEPB 4REZA 3R8BA 3R7RA 2LHDA 4AOFA 4HRSA 2SAKA 2NBVB 1XLPA 4B0EA 2CU1A 5H92C 1PGAA 2OEDA 1SIJA 2IJ0A 2CHWA 2MLBA 3ABVB 2GBKA 4W9EA 5AUIA 3P1MA 4LNOA 4DQOC 1N5XA 1EUVB 3EA6A 4KZ0A 2W82A 3N1ZC 1J7BA 1JMLA 2NPTA 3TCAA 3H1UA 4ARCA 4RGOS 2MJDA 3W1SA 2WXLA 4O1NA 4YL8A 3NHEB 1KLUD 4HCPB 2PVGC 3BVZA 3R7QA 1ZXHA 3RYTA 3V05A 4EOYA 4FBJB 1TY2A 1TKGA 2KDBA 2GLSA 2RR9A 1ZDXA 1BT0A 3PHWB 1P98A 4E3CA 1FXAA 2LZ6A 2WU5B 1QLBB 3Q8EA 3HRDD 4RGNA 3U7DA 5IA7A 2KFKB 1ZDVA 4BKSD 4PS8A 4G3XB 3ZJUA 3M3JA 4I6NB 2C60A 5CHFA 1N62A 1WX9A 1U4AA 1Q5WB 2BPSA 3NOBA 1E10A 2LJ5A 2D3AA 3ML9A 3T9LA 1N61A 1GT8A 3IFWB 3HVZA 3DVNU 2CKHB 3AXCA 4ZRIA 1VRAB 5G5GA 3IT4B 4H2AA 3T8MA 2GB1A 2ZEQA 3H7PA 4BFRA 4W9CA 1YN5A 4NAMA 4F1SA 2QDFA 4OW0A 3QAQA 1K53A 4BVUC 4USAA 3RNFC 3IXSA 1UZXB 2UU7A 2XN9C 2OOBB 1N60A 2KFKA 2MW5A 3MP9A 3AI5A 1WH3A 1GTEA 1DOXA 1WXMA 4LNFA 1YJIA 3CSTA 2JQRB 4KSKC 2IY1B 2KO3A 2RD0A 2C7MB 1FCCC 1P3QU 5EE0A 3Q14C 1OEYA 3QX1A 3NUHB 1V1PA 2PMVA 1R4NB 1RM6C 1HEZE 3OG5A 4P1CC 1WRDB 3Q3MC 5DCNA 2RDBC 3PHXB 4E71A 2Z0EB 2W54A 3AE9B 4MH0E 3DDCB 4IC7B 2ASQA 4GIVA 2V3NA 3NG0A 2ICIA 5IAAC 2TSSA 4JE3B 1YQ4B 4YSXB 2MP2B 5CHWA 2KVZA 1T0YA 1OQQA 3DHIC 4MJSB 3DBHB 1E8XA 1TS5A 1GAQB 5IOIA 2EMTA 4TQ1A 3VRBB 1PQSA 4EKUA 2L52A 5IP4D 1F0ZA 1UWMA 1CZPA 2L8JA 1LM8B 4ITKA 2PEAA 3HIZA 2GBJA 3IG3A 2N7DA 2GBNA 2ZVOA 4KX6B 1AN8A 3ENEA 1DOIA 3LYYA 1PDXA 3LB8C 1E8ZA 2D11A 2MRPA 5AEKB 1FEHA 1P7FA 4KIKA 1N5WA 3ZTDA 4MM3B 3KYCD 2NVUI 3N1YC 3B2GA 2M8SA 1SE3A 3AN1A 4MSQB 3SD5A 1CQVA 3GS2A 2IO3B 2JYEA 4HKZE 2EELA 4KZCA 1WRIA 2ZJDA 3W1YA 4P7IA 3RZFA 4HPPA 1WE7A 2BVCA 1RFAA 2A5UA 1JRPA 4MT5A 4BZAA 4NAWA 3A4SC 1JQ4A 3BVMA 4WAAA 3A33B 4CQNA 4FADA 1E8YA 1WGKA 1KLGD 2J0KA 1PUTA 1SGHA 2BS4B 2H89B 4CO7A 4OZCA 1UD7A 3RMKC 3ZNHB 1BMLC 1NI3A 1WGRA 2K25A 3AE6B 2K8BA 2O2VB 3Q3JA 2JX5A 5BO4B 4DWFA 3L16A 3IT6B 2K39A 2RPVA 3HHMA 1C1YB 3D32A 3V60A 1J7AA 3DBLI 2RMMA 4GDKA 2QC8A 2DZIA 3ZLZA 2RGFA 3MC8A 3I9V1 2DZKA 2K8CA 4XX5A 1KFYB 4S0RA 2INCC 2Y5PA 1J7CA 1TT5B 2M4NA 3K9PB 3NS8A 4D2KA 4I6PA 1D4BA 2MCNB 3J9CA 2C7HA 2M1MA 1T6BX 2L7RA 3RN9C 2JXTA 3P2BA 4DDGD 2HE7A 2PW9A 3TJPA 2DYMA 2L76A 2WLBA 2A4ZA 2HDEA 1WZ3A 1WJ6A 3RNEC 2L00B 4G11A 2LI5A 2BF8B 1I4XA 3I63C 3NS1A 1L6UA 4JPSA 4AWJA 3AB5A 4OZAA 1SE2A 4DXFA 3PZDA 4RNAA 2WDTB 1Y8RC 1XT9B 1XQQA 4P6VF 3B1LX 1T5XD 3BYYB 3PGEA 3Q3FA 3ZRCA 4ZRQA 1M4VA 2LD9A 4TKNA 3PLUA 3VTUA 1QF6A 1KF6B 2FIFA 2GI9A 3Q2AC 3X0WA 2KDMA 2N9EB 2Z0DB 2JXXA 3NJTA 3PRPB 5BYQA 2AEHA 4YWGG 3Q8AA 2ZZPB 3AM9A 2C5LC 1SJHD 3Q3OC 1V6EA 3U30A 1FIQA 3KYDD 4GXBA 2J4XA 1RLFA 4LDTB 2CHZA 1YJ1A 2BQQA 2E3TA 3KH0A 3KUCB 4ZHPA 4IG7B 2NCNA 3VHTC 2LGDA 4JQWC 2BTEA 3HK0A 2BB6A 3JVZX 4HCNB 1XLOA 2JZZA 1C9FA 2MBQA 3V62A 1E0ZA 3LJ3A 4LLGM 5FKAC 3ETRA 2IY0B 1IBXB 2YEPF 3UIOB 2IGGA 2G9HD 2SEBD 5KHQA 3JYUA 2JY6A 1YD8U 4BBNC 4RCOA 5KHOA 1WI0A 3ML8A 2MH7A 1RAXA 4RM9A 3OAWA 3QJZA 2K6DB 2KK8A 1E90A 4DXGA 2NBWB 3WALA 2DX5B 5EDSA 2LRUA 4DHZE 4DHZB 5GMVA 5BYSA 4C00A 2JRIB 1EU3A 2BKRB 3AU5A
chains in the Genus database with same CATH topology
3MC0B 3AE3B 2PVGC 1H7WA 1JWBD 3BVZA 3W5UB 1ZXHA 4C56C 3AEEB 4WURA 3N9YC 3IAS1 3V05A 1TS4A 1ET9A 4Q2JA 2J52A 1TY2A 1TKGA 4OHJA 3NVZA 3P4RB 1YN4A 3U52E 2PVOD 1TYGB 3P4SB 2MEKA 1I7HA 1NVID 1YJJA 1I4PA 1ZDXA 3E56A 4YTNB 1ZE3D 5C2TB 1FD6A 2LHEA 3VR9B 3GP7A 2WDQB 2QILA 4US9A 1FXAA 4YXDB 2M19A 4MACA 2WXNA 2WU5B 2I2YA 1QLBB 2R61A 2LGIA 1JROA 3AE1B 3Q8EA 3HRDD 2WDRB 4WIPA 4RGNA 4XE0A 5H8YE 4A55A 4XDDA 1V8CA 1ZDVA 3BYTB 3TEYA 1JWSD 2L1AA 2N9LA 5D7GA 3ZJUA 2WXPA 4HROA 2FBWB 3BK2A 3VR8B 1C4AA 1N62A 1WXQA 5E6JA 4OZBA 1FRDA 2WXOA 4HEA1 1EU4A 1GPXA 3TEWA 1JALA 3EGRA 3PO0A 1E10A 4WQMA 3Q69A 1IGDA 1N61A 1GT8A 4WAFA 3HVZA 2JWUA 3AEDB 1VRAB 2MJEA 1AYFA 5G5GA 1OFFA 3IT4B 1SE4A 4H2AA 2V0GA 4RGMA 2GB1A 4ZRPA 1I4GA 1XF5L 3DWGC 5T8IA 2DWQA 2IGDA 4EE2A 1YN5A 4KGTA 4NAMA 1GTHA 2G1EA 1D6EC 1D5XC 3BIID 2H88B 2E6XA 3AEAB 1ENFA 1DOYA 4JX1C 2WXKA 1ESFA 1MHHE 4OW0A 2L83A 1K53A 4IKGA 3CF4A 4USAA 1FCLA 2AQ2B 2BBCA 3IXSA 3SFDB 2XN9C 4GLSC 3L4PA 1N60A 3P42A 5D3IB 4YSYB 3MP9A 1GTEA 1SB3C 1DOXA 1GOZA 1YJIA 1BUIC 4YSZB 2JQRB 2WXIA 1SEBD 3GB1A 4JWUC 1HZ5A 1FCCC 2WS3B 3KQ4A 5EE0A 1NYRA 1SJED 1MVKA 2DYOA 4B0MA 3AEBB 3AE5B 3NUHB 2DBYA 1V1PA 2Q5WD 2PMVA 3V3XA 2KWDA 1RM6C 1HEZE 1K50A 2IGHA 2QMTA 2IPKD 2K9XA 5MPOA 2AQ1B 1IGCA 1F2RC 2W54A 3AE9B 2WXGA 1L0XB 2WXMA 4ZYSA 2LEKA 1EM7A 1JWAD 1YQ3B 4C7ZA 2V3NA 2ICIA 2PIAA 2TSSA 1SXTA 2XNAC 3ZGZA 2M0AA 4JE3B 1YQ4B 4YSXB 1QOFA 2Y3AA 2WXHA 2BYTA 1GB4A 1TS2A 1OQQA 2AQ3B 2NTTA 1TS5A 1V1OA 4KGSA 2LFIA 2WXQA 1GAQB 1L0VB 1PFDA 1L5PA 2PKOA 4TQ1A 4L1BA 3VRBB 2NMQA 1LO5D 1FRRA 3VRAB 3EUB2 2L52A 5FR3A 1D5MC 2WU2B 1F0ZA 1ROEA 3LXFA 1D5ZC 2INNE 3TEXA 1UGJA 1TZOA 3B2FA 1V97A 1UWMA 4KGRA 3DWMA 1CZPA 3U7ZA 3BWUD 2IDYA 3E9SA 5HHDG 2WQYB 2L32A 2VZKD 4A90A 4ITKA 3CIRB 4R3DA 1ZPSA 1FFUA 1QOBA 1MHXA 2JYTA 3B9JA 2JU6X 1RYJA 1K51A 1QILA 4RGTA 4KX6B 1TS3A 2OHFA 1AN8A 1DOIA 3LYYA 4WWMA 1B9RA 1PDXA 2VZKB 3LB8C 4OVZA 2WDVB 1ZP0B 1CK1A 3BK1A 3SEBA 1EWCA 1FNUA 2AX5A 1KTKA 1C4PA 3MFGA 1TKYA 1FEHA 2K0PA 1T3QA 1P7FA 4N59A 2B76B 2N9KA 5I4DA 2ACZB 1NEKB 1N5WA 2K5PA 4MM3B 4XWWA 1F2RI 1IUEA 1AW7A 5BMGA 4TSSA 4C7YA 1I4RA 1L4DB 1BXTA 1V1PB 2WP9B 2NTSA 3MJ5A 4IOIE 3B2GA 1SE3A 3AN1A 1SBBB 1L0YB 1CQVA 3GS2A 4HKZE 2JYEA 2EELA 1C79A 4KKJA 4XDCA 1WRIA 3NZ3A 4NZLB 4A8XC 1ZUD2 3RPFC 5LNK1 1QQRA 3P63A 1XLNA 5HG2A 4TMAB 1FNVA 1QKZA 3AMZA 5AUKA 2W55A 4J3OD 4RF0A 2PTLA 1WSPA 4YT0B 3ZJVA 3UI3A 1DGJA 1JRPA 4MT5A 1TJEA 1YMHE 5C3JB 3TSSA 3ZYYX 2WXFA 1JQ4A 3BVMA 2RDGA 4GDLB 4CQNA 2GRIA 4N58A 1RWSA 1C78A 1E9MA 1WGKA 1KLGD 2W3SA 4NJCA 1I4HA 3C8YA 1PUTA 2BS4B 2H89B 5BMHA 4OZCA 1P7EA 4N6EB 3VQIA 1C77A 1FO4A 4AS1A 1BMLC 1I4QA 4P16A 1NI3A 2KQ4X 3WCQA 3AE6B 2QSDA 2JX5A 3IT6B 4L2YA 2BS2B 4ARIA 2RPVA 4XWTA 1RFKA 1GB1A 5JXVA 3AEFB 3IAM1 3Q8CA 1J7AA 2KMMA 2ZW0A 2RMMA 2Y5CA 4ZOHC 1KH0A 4ZHOA 2N7JA 4JWSC 4RF1A 1QOGA 1ZOYB 3AE8B 1N63A 1R7SA 4YTPB 1ACCA 1ET6A 3I9V1 1C76A 2QEJC 2K22A 1KFYB 1Y56A 3AE2B 2QJLA 2W3RA 3T3NA 2Y5PA 1J7CA 5D3DA 2BB5A 1FNWA 4D2KA 1SF0A 2CJNA 4A9AA 2ZW1A 1NYQA 3FAHA 1D4BA 3KLSX 5EE1A 1XO3A 3BZDB 1VDVA 1NENB 3J9CA 4A6QA 3NVVA 3KWLA 1T6BX 1XEEA 1PYWD 2K3UA 1YN3A 2JXTA 2WXRA 1XCTL 3P4PB 2J42A 2LJIA 2X38A 4US8A 2PW9A 4AQ7A 3Q8BA 2DYMA 2WLBA 1MPEA 1EWYC 2HDEA 2Z8LA 4YTMB 1IBXA 1A70A 3AV8A 3FILA 1DYQA 1I4XA 1QOAA 4NAWB 3NS1A 4L23A 1UWXA 1L6UA 4JPSA 2JZPA 3PZ7A 1F77A 2LMCA 1VJKA 1SE2A 2HTME 3AB5A 3OWEB 1HQRD 4OZAA 4DXFA 3AECB 4RNAA 4M0WA 3H8HA 4P6VF 2EKIA 3NRZA 1T5XD 3BYYB 2BW2A 4LTUA 4ZRQA 3ZJTA 1M4VA 3HVDA 1AWDA 2JSVX 2M56B 5G5HA 1KF6B 1VZ7A 2D5GA 2LUMA 4RFBA 1QF6A 4UDUC 2GI9A 3AE4B 3U2SC 2KDMA 1Q10A 3SFEB 3AH7A 2V3PA 5BYQA 3U4EG 3BVGA 1HZ6A 4YWGG 2WNMA 5BMIA 3Q8AA 3AM9A 1XCQL 1KRHA 1ZXIA 1SJHD 3TEZA 1L6VA 1FMAD 1HA5A 2PLPA 4GDKB 2RDHA 3T3OA 1FIQA 3SR6A 2J4XA 3PZ8A 1UNSA 3AE7B 2BT6A 1UUPA 1QT9A 3P4QB 1FM0D 3R2IA 3TUOA 1XXGA 1VR9A 2E3TA 1C4CA 4ZHPA 3RFZB 1WYGA 2J53A 3ZQ4A 4MH8A 1SSNA 4RH6A 4C80A 1WWTA 1MI0A 1STEA 2BTEA 2BB6A 1E7PB 4LK0M 5HFYA 1XLOA 4WH4A 1C9FA 5GXGB 5EE3A 2DLBA 1K52A 4FXCA 1E0ZA 2ONQA 1CJEA 4LLGM 1B1ZA 2KACA 2CU3A 5FKAC 2FUG1 3NVWA 1YNTE 2FE8A 3ETRA 4IDIA 5EE9A 3FC4A 1IBXB 3AEGB 2YEPB 2YEPF 2CJOA 3FILB 3O13A 4REZA 3KWVA 3R8BA 1OQRA 1PGBA 2LHDA 2IGGA 4HRSA 2G9HD 2QIEB 3HUIA 2SEBD 2N0SB 1JWUD 2SAKA 1HXYD 1XLPA 3W9CB 4B0EA 3R2TA 4TQ0A 5H92C 1PGAA 2OEDA 4RCOA 3CWIA 1XLQA 2MJ3A 1SIJA 2MH7A 1PGXA 2IJ0A 2ON8A 1FFVA 3URYA 3ABVB 2V4IB 3I57A 2INPE 5AUIA 3P1MA 5BYRA 1TKEA 4DXGA 4DQOC 3Q8FA 1N5XA 3W5VB 3EA6A 1H7XA 1JW9D 4HJGE 1TY0A 2W82A 1FXIA 2BS3B 1JCKB 4PT5A 1L4ZB 1E6EB 5FK9C 1J7BA 1JWMD 5TSSA 1JMLA 2WXJA 1VZ8A 2KAJA 5HI1A 4ARCA 4RGOS 4KKIA 3W2DA 4HKQA 2I38A 2MJDA 2KN4A 3NVYA 3W1SA 5BYSA 1VZ6A 2WXLA 1VLBA 1EU3A 3MHZA 4O1NA 1KLUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J B;  1JQ4 A;  3ZYY X;  3AE3 B;  2PVG C;  1H7W A;  1JWB D;  2W54 A;  3AE9 B;  3SFE B;  3AH7 A;  3W5U B;  3AEE B;  2LEK A;  1JWA D;  1YQ3 B;  4C7Z A;  4N58 A;  1RWS A;  1TKG A;  3NVZ A;  3P4R B;  2PIA A;  3AM9 A;  2PVO D;  1E9M A;  1TYG B;  3P4S B;  1I7H A;  1KRH A;  1YQ4 B;  4YSX B;  1NVI D;  1QOF A;  1WGK A;  1YJJ A;  1ZXI A;  4YTN B;  2W3S A;  1L6V A;  1FMA D;  5C2T B;  1OQQ A;  1PUT A;  3VR9 B;  2BS4 B;  2H89 B;  2WDQ B;  4US9 A;  1FXA A;  4YXD B;  4N6E B;  2M19 A;  1FIQ A;  1FO4 A;  2WU5 B;  3SR6 A;  1GAQ B;  1L0V B;  1QLB B;  1PFD A;  3AE7 B;  1L5P A;  1NI3 A;  1JRO A;  3AE1 B;  2BT6 A;  2PKO A;  2WDR B;  3HRD D;  3VRB B;  3P4Q B;  1QT9 A;  3WCQ A;  3AE6 B;  1FM0 D;  1FRR A;  2JX5 A;  3VRA B;  3EUB 2;  2L52 A;  1V8C A;  2E3T A;  2BS2 B;  5H8Y E;  1WYG A;  4ZHP A;  2WU2 B;  1F0Z A;  1ROE A;  3LXF A;  1RFK A;  3AEF B;  3B2F A;  4HRO A;  2FBW B;  1V97 A;  1UWM A;  3VR8 B;  4C80 A;  1J7A A;  1N62 A;  1CZP A;  1WWT A;  1WXQ A;  2KMM A;  3DWM A;  2Y5C A;  4ZOH C;  2WQY B;  1E7P B;  1FRD A;  4ZHO A;  4ITK A;  4JWS C;  3CIR B;  1XLO A;  1GPX A;  5GXG B;  1QOG A;  5EE3 A;  1ZOY B;  3AE8 B;  1JAL A;  1N63 A;  4YTP B;  1FFU A;  1R7S A;  3PO0 A;  4FXC A;  1QOB A;  4WQM A;  1E10 A;  1E0Z A;  3B9J A;  1CJE A;  1RYJ A;  1N61 A;  1GT8 A;  2K22 A;  1KFY B;  2QJL A;  3AE2 B;  2W3R A;  3HVZ A;  4KX6 B;  2CU3 A;  3AED B;  2OHF A;  1DOI A;  3NVW A;  4IDI A;  1J7C A;  2MJE A;  1PDX A;  3ETR A;  1AYF A;  4WWM A;  5EE9 A;  1OFF A;  3FC4 A;  3LB8 C;  5G5G A;  2WDV B;  1ZP0 B;  3AEG B;  2CJO A;  1SF0 A;  2CJN A;  4A9A A;  3DWG C;  2AX5 A;  1OQR A;  1NYQ A;  3FAH A;  4HRS A;  1TKY A;  2QIE B;  3HUI A;  5EE1 A;  1XO3 A;  2DWQ A;  1VDV A;  2N0S B;  1T3Q A;  1NEN B;  1XLP A;  2B76 B;  4N59 A;  3W9C B;  2ACZ B;  1NEK B;  1N5W A;  2K5P A;  1GTH A;  2G1E A;  3BII D;  3KWL A;  3NVV A;  2H88 B;  5H92 C;  1IUE A;  3AEA B;  1DOY A;  4JX1 C;  3CWI A;  4C7Y A;  1XLQ A;  2MJ3 A;  2L83 A;  1SIJ A;  3P4P B;  2MH7 A;  4US8 A;  3CF4 A;  1FFV A;  4USA A;  2WP9 B;  2WLB A;  3ABV B;  3SFD B;  1EWY C;  3B2G A;  4YTM B;  3AN1 A;  3L4P A;  1N60 A;  5AUI A;  4YSY B;  3P1M A;  1A70 A;  1TKE A;  3AV8 A;  1B9R A;  1GTE A;  1QOA A;  1SB3 C;  1DOX A;  1N5X A;  3NS1 A;  1YJI A;  3W5V B;  4YSZ B;  2JQR B;  1L6U A;  1H7X A;  1JW9 D;  4JWU C;  3AB5 A;  1VJK A;  1FXI A;  2HTM E;  1WRI A;  2BS3 B;  2WS3 B;  5EE0 A;  3AEC B;  1E6E B;  1NYR A;  1ZUD 2;  1J7B A;  3RPF C;  4P6V F;  3AEB B;  2KAJ A;  2EKI A;  3NRZ A;  3P63 A;  1XLN A;  3AE5 B;  4LTU A;  2DBY A;  2Q5W D;  3AMZ A;  5AUK A;  2MJD A;  2W55 A;  3NVY A;  1AWD A;  1RM6 C;  2M56 B;  5G5H A;  1KF6 B;  4YT0 B;  1QF6 A;  1VLB A;  2K9X A;  1DGJ A;  1JRP A;  3AE4 B;  5MPO A;  1TJE A; 
#chains in the Genus database with same CATH topology
 1SIF A;  3AE3 B;  1H7W A;  3AEE B;  1LFD A;  2KYW A;  4IM2 A;  4Q2J A;  1TTN A;  1YN4 A;  3U52 E;  3P4S B;  2MEK A;  4DXA B;  3NZS A;  5G55 A;  1HTQ A;  1NVI D;  3NY5 A;  3E56 A;  1ZE3 D;  3VR9 B;  4TV3 A;  4A3P A;  4US9 A;  2KKC A;  4IW0 A;  1IYF A;  1NBF C;  3VUX A;  3AE1 B;  4OVU A;  4WIP A;  1WY8 A;  1GUA B;  4GGQ A;  4ZDV A;  4KDI C;  2DHZ A;  3OJ4 B;  2O6V A;  4KSL C;  3VTW A;  1JWS D;  2JRH A;  2N9L A;  1WF9 A;  4NPN A;  3BK2 A;  1C4A A;  1C3T A;  1UEL A;  2WXO A;  4HEA 1;  3ZTC A;  2KT7 A;  3PO0 A;  3Q69 A;  4WJN A;  4WAF A;  5LLI A;  3AED B;  4MDK E;  1SE4 A;  1H4R A;  3N3K B;  3A4R A;  3RI7 C;  4ZRP A;  1UBI A;  3L0W B;  2LWP A;  4MGI E;  2IGD A;  4KGT A;  1GTH A;  1D5X C;  3PPA A;  2E6X A;  4FUL A;  1DOY A;  4JX1 C;  1ESF A;  1MHH E;  5JZE B;  4FJY A;  4EUT A;  5LXI B;  2AQ2 B;  2AL3 A;  3TIX A;  3W1S C;  4HLE A;  5D3I B;  1J0G A;  1SB3 C;  1GOZ A;  2LVO A;  1BUI C;  2CHX A;  4HDQ A;  3QA8 A;  3IBE A;  2HTH A;  1SJE D;  4K7W A;  4B0M A;  3GE8 C;  3JW0 X;  2FNJ B;  4ANU A;  2DBY A;  3DVG Y;  4W9I A;  3V3X A;  3PT2 B;  4IM3 A;  4C4V A;  1K50 A;  2QMT A;  4FJZ A;  2K9X A;  5MPO A;  1WE6 A;  5CHV C;  1EM7 A;  1JWA D;  1YQ3 B;  2PIA A;  3VH4 B;  2RSU A;  5HKH A;  2GBR A;  2Y3A A;  1TS2 A;  2IYD B;  4XYC A;  4LNN A;  1PFD A;  1E7U A;  4L1B A;  2G3Q B;  1FRR A;  5D94 A;  1D5M C;  2WU2 B;  3PV1 A;  1D5Z C;  2INN E;  3TEX A;  4ICU A;  3U7Z A;  1VCB A;  3H7P B;  2WQY B;  3M95 A;  2L32 A;  2BKF A;  3UGB B;  4A90 A;  1OQY A;  2OJW A;  1V9J A;  1R4M B;  4R3D A;  1ZPS A;  4W9H A;  2JYT A;  1K51 A;  1QIL A;  4RGT A;  1FPY A;  1TS3 A;  2J0M A;  3DBS A;  3I3T B;  2VZK B;  1FNU A;  1KTK A;  2FCM A;  2KZR A;  2UYZ B;  4ACF A;  2K0P A;  3L17 A;  2ACZ B;  1EF1 A;  4XWW A;  2OJR A;  3APD A;  1F2R I;  3AUL A;  4LJO B;  2C9W B;  4TSS A;  2D3C A;  1TIF A;  1L4D B;  1V1P B;  2NTS A;  1WMH A;  4BKT A;  3MJ5 A;  3MC9 A;  1FXT B;  4ZRJ A;  3L08 A;  3ZXV A;  2PJH A;  3NZ3 A;  3TBL D;  4A8X C;  5LNK 1;  3DPD A;  3RPF C;  1EF5 A;  2V4L A;  1LXD A;  1TGZ B;  1XLN A;  5HG2 A;  4TMA B;  1FNV A;  5AZH A;  3AMZ A;  2KNB A;  5AUK A;  2W55 A;  4J3O D;  2PTL A;  1WSP A;  4YT0 B;  1Z5S B;  3ZJV A;  4AJY B;  2KDF B;  1M94 A;  5C3J B;  2RDG A;  2AWT A;  1CMX B;  3DVN V;  3ZUN A;  1WXV A;  3IVF A;  1I4H A;  1I42 A;  3IHP C;  2LUE A;  1WZ0 A;  1P7E A;  2FCQ A;  3VQI A;  1V86 A;  2KMC A;  4BOZ B;  2KQ4 X;  4II3 B;  3WCQ A;  4L2Y A;  1S1Q B;  4ARI A;  2KAN A;  1GB1 A;  5JXV A;  3AEF B;  2IZV B;  2LXA A;  4HXD A;  4M0W B;  4KIK B;  4NY0 A;  2IO1 B;  3RD2 A;  1N63 A;  3A1Q B;  1C76 A;  2JPH A;  2QEJ C;  1Y56 A;  1MFW A;  5D3D A;  2BB5 A;  4A9A A;  2ZW1 A;  3FAH A;  5EE1 A;  3N1X C;  1VDV A;  1NEN B;  3GZN I;  4EZL A;  4A6Q A;  3L54 A;  1LGR A;  2DNF A;  2N1V A;  2X38 A;  3Q8B A;  2MBO A;  1MPE A;  1EWY C;  2ZPY A;  3SDL C;  3FIL A;  1DYQ A;  4NAW B;  4QAY A;  2D3B A;  3BIN A;  4J6I A;  2JZP A;  4ZYN A;  3PZ7 A;  2LMC A;  3RNG C;  1HQR D;  4M0W A;  5AZF A;  1KJT A;  1ZKH A;  3N20 C;  3A1Q A;  3A9J A;  1J19 A;  2M56 B;  5G5H A;  2D5G A;  4UDU C;  1EO6 A;  3AE4 B;  2KFJ A;  3U2S C;  3DVG X;  1Q10 A;  1IPG A;  3U4E G;  5BMI A;  2WNM A;  2DAJ A;  4LDT D;  4FLH A;  3EFC A;  4DHJ D;  1KRH A;  2XEW A;  2MBB B;  4WWN A;  4PYZ A;  1V81 A;  5D2M B;  2PLP A;  4GDK B;  3SR6 A;  4ANV A;  2K6Q A;  1UNS A;  3ZNG C;  1OTR B;  2ZPN A;  1UUP A;  1FM0 D;  4K3B A;  3MHS D;  3R2I A;  4HPL B;  2FCS A;  5J18 A;  3WAO A;  4OVV A;  1WFY A;  4ZRK A;  2CS4 A;  3DBR I;  1Q1O A;  2GMI C;  4LK0 M;  1E7P B;  3WA0 A;  4WH4 A;  2DLB A;  1GG3 A;  3HM6 X;  2ONQ A;  5DPT A;  2FUG 1;  1YNT E;  5EE9 A;  3O13 A;  1OQR A;  4W9G A;  1WGD A;  2MA9 B;  2QIE B;  3UF8 A;  1WX7 A;  3W9C B;  3LDZ E;  3R2T A;  4B9K A;  4M8N A;  4TQ0 A;  3H9D A;  3AU4 A;  2O6V D;  2MJ3 A;  1MG8 A;  1UGM A;  1FFV A;  4N9F 4;  4MGZ E;  2V4I B;  2INP E;  5BYR A;  1TKE A;  3KUD B;  4HPM B;  1F1H A;  3Q8F A;  4M00 A;  5IKC M;  1H7X A;  1RRB A;  1FXI A;  4W9D A;  2BS3 B;  1JCK B;  4PT5 A;  2KWC A;  3VXW A;  5FK9 C;  1WYW B;  1P9D U;  5TSS A;  2WXJ A;  5HI1 A;  4HKQ A;  1WR6 E;  3QAR A;  1VZ6 A;  1VLB A;  3MHZ A;  1GC7 A;  3MTN B;  2EKE C;  3PLV A;  3ZNI D;  3MC0 B;  1JWB D;  4DBG A;  4C56 C;  4FHJ A;  1GNU A;  3N9Y C;  1TS4 A;  1ET9 A;  2D2Q A;  2PVO D;  4K1R B;  1YJJ A;  1I4P A;  5C2T B;  1FD6 A;  2LHE A;  3GP7 A;  2WDQ B;  2I1J A;  2QIL A;  3UQA A;  2K8H A;  1KOT A;  2M19 A;  2WXN A;  3WAM A;  2LGI A;  1JRO A;  5H8Y E;  4DK5 A;  3BY4 B;  4XE0 A;  2KHW B;  3R3M A;  2ZCC A;  4AP4 C;  3TEY A;  2L1A A;  5D7G A;  3VR8 B;  3ALB A;  4W9F A;  5E6J A;  1FRD A;  3Q6B A;  4LNK A;  1S3S G;  3VVW B;  1EU4 A;  3WIM A;  3EGR A;  4WWO A;  4W9J A;  4DHJ B;  5D6J B;  1OFF A;  1MG4 A;  1I4G A;  4WJP A;  5T8I A;  4GMV A;  2YVC A;  2HD5 B;  2DWQ A;  4EE2 A;  1P1A A;  2G1E A;  2YLM A;  2H88 B;  3AEA B;  1ENF A;  5IN7 A;  3CF4 A;  2LGX A;  1FCL A;  3GZN B;  2BBC A;  4GLS C;  3L4P A;  3P42 A;  4YSY B;  3RCZ A;  4JLC A;  3DHH C;  4AJW A;  4YSZ B;  1SEB D;  3GB1 A;  4JWU C;  3CF6 E;  2IO0 B;  2DYO A;  4TUU A;  3AE5 B;  4KVG B;  2Q5W D;  1X1M A;  4HWI B;  1LQB A;  4LCD E;  2MX2 A;  2IGH A;  4WWP A;  2Y5B B;  1WXS A;  1WM2 A;  1IGC A;  2WYQ A;  1L0X B;  2MQJ A;  4ZYS A;  2O6V B;  2KTR B;  3VTV A;  1V49 A;  3EC8 A;  1SXT A;  2XNA C;  3ZGZ A;  4K3C A;  1IP9 A;  2WXH A;  4KGS A;  2KN5 A;  2LFI A;  1L0V B;  3QQ8 B;  3VRA B;  3EUB 2;  2LAS A;  3H7S A;  2FAZ A;  2IO2 B;  2VH2 A;  2R2Q A;  1ROE A;  2LGY A;  3CMM B;  1TZO A;  1T0R C;  1V97 A;  3QIJ A;  2C7N B;  1AAR A;  3BWU D;  3V6C B;  2IDY A;  3E9S A;  5HHD G;  2VZK D;  4GN1 A;  2KLG A;  3DBR B;  1FFU A;  3RUI B;  1MHX A;  3B9J A;  2JU6 X;  1RYJ A;  2IND C;  3ECI A;  5DPW A;  1B9R A;  3N30 A;  1OEY J;  4RM8 A;  1ZP0 B;  3BK1 A;  2KTR A;  3DCG A;  3SEB A;  1EWC A;  4HJK A;  2AX5 A;  1C4P A;  2MBE A;  3MFG A;  1TKY A;  2VRR B;  3L10 B;  4N59 A;  2G4D B;  2B76 B;  2N9K A;  5I4D A;  2K5P A;  5LXH A;  5BMG A;  4C7Y A;  1I4R A;  1Z2M A;  3NZU A;  2FID A;  1BXT A;  4G50 A;  2WP9 B;  3DBL B;  4ANW A;  2WX0 A;  4IOI E;  4C4V B;  3ZXR A;  3DBH I;  4KKJ A;  2M0X A;  3TL5 A;  4GOC A;  4XDC A;  2WX1 A;  4NZL B;  4JIO U;  1QQR A;  3P63 A;  4HDO A;  4JL9 A;  2PE6 B;  4RF0 A;  1V5T A;  3UI3 A;  2DZJ A;  2N9P C;  1YMH E;  3PRE A;  2KDE B;  3TSS A;  2GRI A;  4N58 A;  4EEW A;  2L0F A;  1E9M A;  3DHG C;  1D3Z A;  2KQS A;  3JSV A;  1YIW A;  2DEN B;  3K9O B;  5BMH A;  1WGY A;  1YX6 B;  2HJ8 A;  4HVB A;  4BKG A;  4AS1 A;  2JWZ A;  5CX3 A;  2ZNV C;  4ASW C;  4P16 A;  3KUZ A;  5E6N A;  2I1K A;  3PTF C;  4XWT A;  1RFK A;  2MBH A;  2BYF A;  3Q8C A;  2KX3 A;  2V1Y A;  3ZKJ C;  2G45 B;  4EZK A;  2QCZ A;  1KH0 A;  4M02 A;  4ZHO A;  4JWS C;  4DDI D;  1QOG A;  2KLC A;  4YTP B;  2W9N A;  4FJV B;  1NDD A;  4I6L B;  1Q0W B;  1ET6 A;  3QC8 B;  3T3N A;  2QJL A;  3AE2 B;  1WMH B;  2D3G A;  1FNW A;  2LRW A;  1XO3 A;  4W9L A;  2KJH B;  3ZW3 A;  3NVV A;  2DZM A;  1QZE A;  3KWL A;  2B3A A;  2L3Z A;  4WJO A;  2XK5 B;  1XEE A;  1PYW D;  2K3U A;  3PVL A;  3A9K A;  3P4P B;  2J42 A;  2LJI A;  2KMA A;  4US8 A;  3M63 B;  3Q3N C;  2Z8L A;  2KQ7 A;  4NNJ B;  1F9J A;  1WIA A;  4L23 A;  2KVR A;  2V3S A;  3ZIM A;  1F77 A;  3OWE B;  4ANX A;  2HTM E;  3AEC B;  2AL6 A;  3VUY A;  5L95 C;  3H8H A;  2LGS A;  5TR5 A;  3NRZ A;  4K7S A;  1UH6 A;  2BW2 A;  3HVD A;  1AWD A;  2JSV X;  5J2R A;  1VZ7 A;  5JHB A;  2LUM A;  1WXA A;  1GC6 A;  1UF0 A;  3BVG A;  1HZ6 A;  3ZDM C;  3PSE B;  5DPR A;  1XCQ L;  1ZXI A;  2BYV E;  2KC1 A;  2XK5 A;  3VH3 B;  1FMA D;  1HA5 A;  1UBQ A;  3EHV A;  4JGH B;  2RDH A;  3T3O A;  1WJ4 A;  2BGF A;  3AE7 B;  1ISN A;  2BT6 A;  3APC A;  4XZ4 A;  1NI2 A;  3P4Q B;  1QT9 A;  2LXC A;  3ZVV A;  1MJD A;  3TUO A;  2GBM A;  1C4C A;  1WYG A;  2J53 A;  2DYB A;  4MH8 A;  1SSN A;  4C80 A;  2L0T A;  1STE A;  3B08 A;  5G2N A;  2FUH B;  2FCN A;  4A3O A;  4IWQ A;  2WHI A;  2PE9 A;  5EE3 A;  1V80 A;  3SHQ A;  2J0J A;  1CJE A;  2MWS B;  2KAC A;  4F8C B;  2CU3 A;  3PS6 A;  4IDI A;  3S2A A;  3FC4 A;  1KM7 A;  3AEG B;  2CJO A;  3FIL B;  3KWV A;  3X23 A;  1PGB A;  2KWV B;  3HUI A;  2N0S B;  1JWU D;  3M62 B;  1HXY D;  3RNB C;  3PRZ A;  2DAF A;  3CWI A;  4URK A;  1XLQ A;  1PGX A;  2V9H A;  3EEC A;  2ON8 A;  3URY A;  3A9J B;  2ZVN A;  2WGS A;  3I57 A;  3ZO5 B;  3ZRF A;  3OLM D;  3W5V B;  1JW9 D;  4HJG E;  1TY0 A;  4A20 A;  1OGW A;  1L4Z B;  1E6E B;  4XC2 A;  1JWM D;  4WJQ A;  1VZ8 A;  2KAJ A;  4KKI A;  3W2D A;  2N7E A;  2I38 A;  2KN4 A;  3NVY A;  3GE3 C;  1YX5 B;  2REX A;  4K81 A;  2GOW A;  1E8W A;  2KWU B;  4MEL A;  3W5U B;  4WUR A;  3IAS 1;  2LVQ A;  2J52 A;  2N1W A;  4OHJ A;  3NVZ A;  1A5R A;  3P4R B;  2JVC A;  4LJP B;  1TYG B;  4ICV A;  3SU8 X;  1GJZ A;  1I7H A;  3C0R B;  5E6P A;  4K7U A;  3VAW A;  2EMS A;  4YTN B;  2CR5 A;  2G4S A;  2KXJ A;  4YXD B;  4MAC A;  2I2Y A;  2R61 A;  2WDR B;  2KJ6 A;  4A55 A;  4X57 B;  4II2 B;  4XDD A;  1V8C A;  3BYT B;  5J17 A;  4NQL B;  2WXP A;  4HRO A;  2FBW B;  2KJR A;  2MP2 A;  1WXQ A;  4OZB A;  4MJS A;  5JHA A;  3ZNZ B;  4WQO B;  1GPX A;  3TEW A;  4IWO A;  1JAL A;  4WQM A;  2BYE A;  1IGD A;  3RT3 B;  2JWU A;  2MJE A;  1AYF A;  4EZJ A;  2V0G A;  4RGM A;  1WGH A;  1XF5 L;  3DWG C;  4W9K A;  1TBE A;  1H8C A;  4IM0 A;  3BII D;  1D6E C;  2JUO A;  2WXK A;  2L83 A;  4IKG A;  3SFD B;  4MEM A;  1WJU A;  2QHO A;  2KTF A;  2NR2 A;  2WXI A;  1HZ5 A;  1JRU A;  1HTO A;  4GU2 A;  4MM3 A;  2WS3 B;  3KQ4 A;  1NYR A;  1MVK A;  2X8X X;  3AEB B;  4BKS A;  4BBN F;  4BAX A;  1I35 A;  4XGA B;  1WM3 A;  2KWD A;  3UQB A;  2IPK D;  2AQ1 B;  3TMP B;  3RUL A;  1N6Z A;  1F2R C;  3DOW A;  2WXG A;  2WXM A;  2LEK A;  4C7Z A;  4MGK E;  5L83 A;  2RPQ A;  2M0A A;  4PYU A;  1QOF A;  2BYT A;  1GB4 A;  4CYE A;  4GSW A;  2AQ3 B;  2NTT A;  1V1O A;  1YQB A;  2WXQ A;  1L5P A;  3U8Z A;  2PKO A;  5IO9 A;  2NMQ A;  1LO5 D;  4RMA A;  5FR3 A;  5C1Z A;  4NJ6 A;  3LXF A;  1UGJ A;  1P0R A;  3B2F A;  3MJW A;  3ONS A;  4KGR A;  3DWM A;  3EFU A;  2KOX A;  3CIR B;  4B6W A;  1QOB A;  3QWZ B;  2O2V A;  4MGY E;  2OHF A;  4WWM A;  1SE9 A;  2K1F A;  4OVZ A;  2WDV B;  1CK1 A;  2KD0 A;  1E7V A;  3VFK A;  4IUM B;  1T3Q A;  1NEK B;  4EFO A;  3HM3 A;  1IUE A;  3RNC C;  1AW7 A;  3WAP A;  1K8R B;  1XD3 B;  2ZCB A;  4FHK A;  3H6N A;  2AYO B;  1J8C A;  3DQV A;  3O65 B;  1SBB B;  1L0Y B;  1WJN A;  1WGG A;  1ZGU B;  1C79 A;  2IBI B;  2NS5 A;  1ZUD 2;  4IWP A;  1G6J A;  3UIN B;  2JF5 A;  2VH1 A;  5JH5 C;  1QKZ A;  1WX8 A;  3L13 A;  1DGJ A;  1TJE A;  4NQK E;  3RNA C;  5CTR C;  3ZYY X;  2WXF A;  4GDL B;  1L7Y A;  1R4M I;  1RWS A;  3RZW C;  3OJ3 A;  1C78 A;  4AUQ C;  2W3S A;  4NJC A;  3C8Y A;  4KV2 A;  3R66 C;  5E6O A;  2Z59 B;  3FKY A;  4N6E B;  4NJ7 A;  4CHK A;  4G0N B;  1C77 A;  1FO4 A;  1I4Q A;  3KVF B;  1L2N A;  2QSD A;  2BS2 B;  3IAM 1;  3QK0 A;  2ZW0 A;  2KMM A;  4LNI A;  2D07 B;  2Y5C A;  4ZOH C;  2M17 A;  4PK1 A;  2N7J A;  4RF1 A;  3V61 A;  1ZOY B;  3AE8 B;  1R7S A;  1YOV B;  3C19 A;  4GB9 A;  1ACC A;  1VD2 A;  2K22 A;  3APF A;  2W3R A;  2XBB C;  5DPS A;  4GDL A;  3PRM B;  1SF0 A;  2CJN A;  2NBU A;  2HJ1 A;  1NYQ A;  3QCA A;  3KLS X;  3BZD B;  1WR1 A;  1E5W A;  2J7Q B;  1KLV A;  1YN3 A;  2WXR A;  1XCT L;  3QHT A;  4AQ7 A;  4FN2 A;  4MSM B;  2N9X A;  4S17 A;  4YTM B;  2BWE S;  4FA6 A;  2BWF A;  1IBX A;  1A70 A;  3AV8 A;  1QOA A;  1T0S C;  2L05 A;  3VUW A;  1UWX A;  3I5J C;  2KX0 A;  4B95 A;  2N4F A;  1VJK A;  1R4N I;  1HE8 A;  2KC2 A;  2WWZ A;  4BOS C;  4PS3 A;  2EKI A;  3VDZ A;  4LTU A;  3WAN A;  3JSV B;  2LVP A;  3ZJT A;  1ZW7 A;  3ZDT A;  4RFB A;  2KDI A;  3CSF A;  2JT4 B;  2R2O A;  3SFE B;  3AH7 A;  2V3P A;  4M01 A;  1V2Y A;  4F7Z A;  4PS7 A;  3N32 A;  4KDL B;  3TEZ A;  1L6V A;  2D10 A;  3PZ8 A;  3KW5 B;  1T0Q C;  2JZ3 B;  1XXG A;  1VR9 A;  3RFZ B;  3ZQ4 A;  2PPH A;  3UIP B;  4RH6 A;  1WWT A;  1MI0 A;  2MHJ A;  3B0A A;  5HFY A;  2MSE D;  2NPT B;  2UWQ A;  1F52 A;  5GXG B;  1V5O A;  3V6E B;  5C23 A;  5AZG A;  1K52 A;  4HK2 A;  4FXC A;  3A9K B;  2ZNV B;  1B1Z A;  3GOE A;  4M8M A;  4E74 A;  3NVW A;  2FE8 A;  5FR6 A;  1TZ1 A;  4P1B C;  2YEP B;  4REZ A;  3R8B A;  3R7R A;  2LHD A;  4AOF A;  4HRS A;  2SAK A;  2NBV B;  1XLP A;  4B0E A;  2CU1 A;  5H92 C;  1PGA A;  2OED A;  1SIJ A;  2IJ0 A;  2CHW A;  2MLB A;  3ABV B;  2GBK A;  4W9E A;  5AUI A;  3P1M A;  4LNO A;  4DQO C;  1N5X A;  1EUV B;  3EA6 A;  4KZ0 A;  2W82 A;  3N1Z C;  1J7B A;  1JML A;  2NPT A;  3TCA A;  3H1U A;  4ARC A;  4RGO S;  2MJD A;  3W1S A;  2WXL A;  4O1N A;  4YL8 A;  3NHE B;  1KLU D;  4HCP B;  2PVG C;  3BVZ A;  3R7Q A;  1ZXH A;  3RYT A;  3V05 A;  4EOY A;  4FBJ B;  1TY2 A;  1TKG A;  2KDB A;  2GLS A;  2RR9 A;  1ZDX A;  1BT0 A;  3PHW B;  1P98 A;  4E3C A;  1FXA A;  2LZ6 A;  2WU5 B;  1QLB B;  3Q8E A;  3HRD D;  4RGN A;  3U7D A;  5IA7 A;  2KFK B;  1ZDV A;  4BKS D;  4PS8 A;  4G3X B;  3ZJU A;  3M3J A;  4I6N B;  2C60 A;  5CHF A;  1N62 A;  1WX9 A;  1U4A A;  1Q5W B;  2BPS A;  3NOB A;  1E10 A;  2LJ5 A;  2D3A A;  3ML9 A;  3T9L A;  1N61 A;  1GT8 A;  3IFW B;  3HVZ A;  3DVN U;  2CKH B;  3AXC A;  4ZRI A;  1VRA B;  5G5G A;  3IT4 B;  4H2A A;  3T8M A;  2GB1 A;  2ZEQ A;  3H7P A;  4BFR A;  4W9C A;  1YN5 A;  4NAM A;  4F1S A;  2QDF A;  4OW0 A;  3QAQ A;  1K53 A;  4BVU C;  4USA A;  3RNF C;  3IXS A;  1UZX B;  2UU7 A;  2XN9 C;  2OOB B;  1N60 A;  2KFK A;  2MW5 A;  3MP9 A;  3AI5 A;  1WH3 A;  1GTE A;  1DOX A;  1WXM A;  4LNF A;  1YJI A;  3CST A;  2JQR B;  4KSK C;  2IY1 B;  2KO3 A;  2RD0 A;  2C7M B;  1FCC C;  1P3Q U;  5EE0 A;  3Q14 C;  1OEY A;  3QX1 A;  3NUH B;  1V1P A;  2PMV A;  1R4N B;  1RM6 C;  1HEZ E;  3OG5 A;  4P1C C;  1WRD B;  3Q3M C;  5DCN A;  2RDB C;  3PHX B;  4E71 A;  2Z0E B;  2W54 A;  3AE9 B;  4MH0 E;  3DDC B;  4IC7 B;  2ASQ A;  4GIV A;  2V3N A;  3NG0 A;  2ICI A;  5IAA C;  2TSS A;  4JE3 B;  1YQ4 B;  4YSX B;  2MP2 B;  5CHW A;  2KVZ A;  1T0Y A;  1OQQ A;  3DHI C;  4MJS B;  3DBH B;  1E8X A;  1TS5 A;  1GAQ B;  5IOI A;  2EMT A;  4TQ1 A;  3VRB B;  1PQS A;  4EKU A;  2L52 A;  5IP4 D;  1F0Z A;  1UWM A;  1CZP A;  2L8J A;  1LM8 B;  4ITK A;  2PEA A;  3HIZ A;  2GBJ A;  3IG3 A;  2N7D A;  2GBN A;  2ZVO A;  4KX6 B;  1AN8 A;  3ENE A;  1DOI A;  3LYY A;  1PDX A;  3LB8 C;  1E8Z A;  2D11 A;  2MRP A;  5AEK B;  1FEH A;  1P7F A;  4KIK A;  1N5W A;  3ZTD A;  4MM3 B;  3KYC D;  2NVU I;  3N1Y C;  3B2G A;  2M8S A;  1SE3 A;  3AN1 A;  4MSQ B;  3SD5 A;  1CQV A;  3GS2 A;  2IO3 B;  2JYE A;  4HKZ E;  2EEL A;  4KZC A;  1WRI A;  2ZJD A;  3W1Y A;  4P7I A;  3RZF A;  4HPP A;  1WE7 A;  2BVC A;  1RFA A;  2A5U A;  1JRP A;  4MT5 A;  4BZA A;  4NAW A;  3A4S C;  1JQ4 A;  3BVM A;  4WAA A;  3A33 B;  4CQN A;  4FAD A;  1E8Y A;  1WGK A;  1KLG D;  2J0K A;  1PUT A;  1SGH A;  2BS4 B;  2H89 B;  4CO7 A;  4OZC A;  1UD7 A;  3RMK C;  3ZNH B;  1BML C;  1NI3 A;  1WGR A;  2K25 A;  3AE6 B;  2K8B A;  2O2V B;  3Q3J A;  2JX5 A;  5BO4 B;  4DWF A;  3L16 A;  3IT6 B;  2K39 A;  2RPV A;  3HHM A;  1C1Y B;  3D32 A;  3V60 A;  1J7A A;  3DBL I;  2RMM A;  4GDK A;  2QC8 A;  2DZI A;  3ZLZ A;  2RGF A;  3MC8 A;  3I9V 1;  2DZK A;  2K8C A;  4XX5 A;  1KFY B;  4S0R A;  2INC C;  2Y5P A;  1J7C A;  1TT5 B;  2M4N A;  3K9P B;  3NS8 A;  4D2K A;  4I6P A;  1D4B A;  2MCN B;  3J9C A;  2C7H A;  2M1M A;  1T6B X;  2L7R A;  3RN9 C;  2JXT A;  3P2B A;  4DDG D;  2HE7 A;  2PW9 A;  3TJP A;  2DYM A;  2L76 A;  2WLB A;  2A4Z A;  2HDE A;  1WZ3 A;  1WJ6 A;  3RNE C;  2L00 B;  4G11 A;  2LI5 A;  2BF8 B;  1I4X A;  3I63 C;  3NS1 A;  1L6U A;  4JPS A;  4AWJ A;  3AB5 A;  4OZA A;  1SE2 A;  4DXF A;  3PZD A;  4RNA A;  2WDT B;  1Y8R C;  1XT9 B;  1XQQ A;  4P6V F;  3B1L X;  1T5X D;  3BYY B;  3PGE A;  3Q3F A;  3ZRC A;  4ZRQ A;  1M4V A;  2LD9 A;  4TKN A;  3PLU A;  3VTU A;  1QF6 A;  1KF6 B;  2FIF A;  2GI9 A;  3Q2A C;  3X0W A;  2KDM A;  2N9E B;  2Z0D B;  2JXX A;  3NJT A;  3PRP B;  5BYQ A;  2AEH A;  4YWG G;  3Q8A A;  2ZZP B;  3AM9 A;  2C5L C;  1SJH D;  3Q3O C;  1V6E A;  3U30 A;  1FIQ A;  3KYD D;  4GXB A;  2J4X A;  1RLF A;  4LDT B;  2CHZ A;  1YJ1 A;  2BQQ A;  2E3T A;  3KH0 A;  3KUC B;  4ZHP A;  4IG7 B;  2NCN A;  3VHT C;  2LGD A;  4JQW C;  2BTE A;  3HK0 A;  2BB6 A;  3JVZ X;  4HCN B;  1XLO A;  2JZZ A;  1C9F A;  2MBQ A;  3V62 A;  1E0Z A;  3LJ3 A;  4LLG M;  5FKA C;  3ETR A;  2IY0 B;  1IBX B;  2YEP F;  3UIO B;  2IGG A;  2G9H D;  2SEB D;  5KHQ A;  3JYU A;  2JY6 A;  1YD8 U;  4BBN C;  4RCO A;  5KHO A;  1WI0 A;  3ML8 A;  2MH7 A;  1RAX A;  4RM9 A;  3OAW A;  3QJZ A;  2K6D B;  2KK8 A;  1E90 A;  4DXG A;  2NBW B;  3WAL A;  2DX5 B;  5EDS A;  2LRU A;  4DHZ E;  4DHZ B;  5GMV A;  5BYS A;  4C00 A;  2JRI B;  1EU3 A;  2BKR B;  3AU5 A; 
#chains in the Genus database with same CATH homology
 3MC0 B;  3AE3 B;  2PVG C;  1H7W A;  1JWB D;  3BVZ A;  3W5U B;  1ZXH A;  4C56 C;  3AEE B;  4WUR A;  3N9Y C;  3IAS 1;  3V05 A;  1TS4 A;  1ET9 A;  4Q2J A;  2J52 A;  1TY2 A;  1TKG A;  4OHJ A;  3NVZ A;  3P4R B;  1YN4 A;  3U52 E;  2PVO D;  1TYG B;  3P4S B;  2MEK A;  1I7H A;  1NVI D;  1YJJ A;  1I4P A;  1ZDX A;  3E56 A;  4YTN B;  1ZE3 D;  5C2T B;  1FD6 A;  2LHE A;  3VR9 B;  3GP7 A;  2WDQ B;  2QIL A;  4US9 A;  1FXA A;  4YXD B;  2M19 A;  4MAC A;  2WXN A;  2WU5 B;  2I2Y A;  1QLB B;  2R61 A;  2LGI A;  1JRO A;  3AE1 B;  3Q8E A;  3HRD D;  2WDR B;  4WIP A;  4RGN A;  4XE0 A;  5H8Y E;  4A55 A;  4XDD A;  1V8C A;  1ZDV A;  3BYT B;  3TEY A;  1JWS D;  2L1A A;  2N9L A;  5D7G A;  3ZJU A;  2WXP A;  4HRO A;  2FBW B;  3BK2 A;  3VR8 B;  1C4A A;  1N62 A;  1WXQ A;  5E6J A;  4OZB A;  1FRD A;  2WXO A;  4HEA 1;  1EU4 A;  1GPX A;  3TEW A;  1JAL A;  3EGR A;  3PO0 A;  1E10 A;  4WQM A;  3Q69 A;  1IGD A;  1N61 A;  1GT8 A;  4WAF A;  3HVZ A;  2JWU A;  3AED B;  1VRA B;  2MJE A;  1AYF A;  5G5G A;  1OFF A;  3IT4 B;  1SE4 A;  4H2A A;  2V0G A;  4RGM A;  2GB1 A;  4ZRP A;  1I4G A;  1XF5 L;  3DWG C;  5T8I A;  2DWQ A;  2IGD A;  4EE2 A;  1YN5 A;  4KGT A;  4NAM A;  1GTH A;  2G1E A;  1D6E C;  1D5X C;  3BII D;  2H88 B;  2E6X A;  3AEA B;  1ENF A;  1DOY A;  4JX1 C;  2WXK A;  1ESF A;  1MHH E;  4OW0 A;  2L83 A;  1K53 A;  4IKG A;  3CF4 A;  4USA A;  1FCL A;  2AQ2 B;  2BBC A;  3IXS A;  3SFD B;  2XN9 C;  4GLS C;  3L4P A;  1N60 A;  3P42 A;  5D3I B;  4YSY B;  3MP9 A;  1GTE A;  1SB3 C;  1DOX A;  1GOZ A;  1YJI A;  1BUI C;  4YSZ B;  2JQR B;  2WXI A;  1SEB D;  3GB1 A;  4JWU C;  1HZ5 A;  1FCC C;  2WS3 B;  3KQ4 A;  5EE0 A;  1NYR A;  1SJE D;  1MVK A;  2DYO A;  4B0M A;  3AEB B;  3AE5 B;  3NUH B;  2DBY A;  1V1P A;  2Q5W D;  2PMV A;  3V3X A;  2KWD A;  1RM6 C;  1HEZ E;  1K50 A;  2IGH A;  2QMT A;  2IPK D;  2K9X A;  5MPO A;  2AQ1 B;  1IGC A;  1F2R C;  2W54 A;  3AE9 B;  2WXG A;  1L0X B;  2WXM A;  4ZYS A;  2LEK A;  1EM7 A;  1JWA D;  1YQ3 B;  4C7Z A;  2V3N A;  2ICI A;  2PIA A;  2TSS A;  1SXT A;  2XNA C;  3ZGZ A;  2M0A A;  4JE3 B;  1YQ4 B;  4YSX B;  1QOF A;  2Y3A A;  2WXH A;  2BYT A;  1GB4 A;  1TS2 A;  1OQQ A;  2AQ3 B;  2NTT A;  1TS5 A;  1V1O A;  4KGS A;  2LFI A;  2WXQ A;  1GAQ B;  1L0V B;  1PFD A;  1L5P A;  2PKO A;  4TQ1 A;  4L1B A;  3VRB B;  2NMQ A;  1LO5 D;  1FRR A;  3VRA B;  3EUB 2;  2L52 A;  5FR3 A;  1D5M C;  2WU2 B;  1F0Z A;  1ROE A;  3LXF A;  1D5Z C;  2INN E;  3TEX A;  1UGJ A;  1TZO A;  3B2F A;  1V97 A;  1UWM A;  4KGR A;  3DWM A;  1CZP A;  3U7Z A;  3BWU D;  2IDY A;  3E9S A;  5HHD G;  2WQY B;  2L32 A;  2VZK D;  4A90 A;  4ITK A;  3CIR B;  4R3D A;  1ZPS A;  1FFU A;  1QOB A;  1MHX A;  2JYT A;  3B9J A;  2JU6 X;  1RYJ A;  1K51 A;  1QIL A;  4RGT A;  4KX6 B;  1TS3 A;  2OHF A;  1AN8 A;  1DOI A;  3LYY A;  4WWM A;  1B9R A;  1PDX A;  2VZK B;  3LB8 C;  4OVZ A;  2WDV B;  1ZP0 B;  1CK1 A;  3BK1 A;  3SEB A;  1EWC A;  1FNU A;  2AX5 A;  1KTK A;  1C4P A;  3MFG A;  1TKY A;  1FEH A;  2K0P A;  1T3Q A;  1P7F A;  4N59 A;  2B76 B;  2N9K A;  5I4D A;  2ACZ B;  1NEK B;  1N5W A;  2K5P A;  4MM3 B;  4XWW A;  1F2R I;  1IUE A;  1AW7 A;  5BMG A;  4TSS A;  4C7Y A;  1I4R A;  1L4D B;  1BXT A;  1V1P B;  2WP9 B;  2NTS A;  3MJ5 A;  4IOI E;  3B2G A;  1SE3 A;  3AN1 A;  1SBB B;  1L0Y B;  1CQV A;  3GS2 A;  4HKZ E;  2JYE A;  2EEL A;  1C79 A;  4KKJ A;  4XDC A;  1WRI A;  3NZ3 A;  4NZL B;  4A8X C;  1ZUD 2;  3RPF C;  5LNK 1;  1QQR A;  3P63 A;  1XLN A;  5HG2 A;  4TMA B;  1FNV A;  1QKZ A;  3AMZ A;  5AUK A;  2W55 A;  4J3O D;  4RF0 A;  2PTL A;  1WSP A;  4YT0 B;  3ZJV A;  3UI3 A;  1DGJ A;  1JRP A;  4MT5 A;  1TJE A;  1YMH E;  5C3J B;  3TSS A;  3ZYY X;  2WXF A;  1JQ4 A;  3BVM A;  2RDG A;  4GDL B;  4CQN A;  2GRI A;  4N58 A;  1RWS A;  1C78 A;  1E9M A;  1WGK A;  1KLG D;  2W3S A;  4NJC A;  1I4H A;  3C8Y A;  1PUT A;  2BS4 B;  2H89 B;  5BMH A;  4OZC A;  1P7E A;  4N6E B;  3VQI A;  1C77 A;  1FO4 A;  4AS1 A;  1BML C;  1I4Q A;  4P16 A;  1NI3 A;  2KQ4 X;  3WCQ A;  3AE6 B;  2QSD A;  2JX5 A;  3IT6 B;  4L2Y A;  2BS2 B;  4ARI A;  2RPV A;  4XWT A;  1RFK A;  1GB1 A;  5JXV A;  3AEF B;  3IAM 1;  3Q8C A;  1J7A A;  2KMM A;  2ZW0 A;  2RMM A;  2Y5C A;  4ZOH C;  1KH0 A;  4ZHO A;  2N7J A;  4JWS C;  4RF1 A;  1QOG A;  1ZOY B;  3AE8 B;  1N63 A;  1R7S A;  4YTP B;  1ACC A;  1ET6 A;  3I9V 1;  1C76 A;  2QEJ C;  2K22 A;  1KFY B;  1Y56 A;  3AE2 B;  2QJL A;  2W3R A;  3T3N A;  2Y5P A;  1J7C A;  5D3D A;  2BB5 A;  1FNW A;  4D2K A;  1SF0 A;  2CJN A;  4A9A A;  2ZW1 A;  1NYQ A;  3FAH A;  1D4B A;  3KLS X;  5EE1 A;  1XO3 A;  3BZD B;  1VDV A;  1NEN B;  3J9C A;  4A6Q A;  3NVV A;  3KWL A;  1T6B X;  1XEE A;  1PYW D;  2K3U A;  1YN3 A;  2JXT A;  2WXR A;  1XCT L;  3P4P B;  2J42 A;  2LJI A;  2X38 A;  4US8 A;  2PW9 A;  4AQ7 A;  3Q8B A;  2DYM A;  2WLB A;  1MPE A;  1EWY C;  2HDE A;  2Z8L A;  4YTM B;  1IBX A;  1A70 A;  3AV8 A;  3FIL A;  1DYQ A;  1I4X A;  1QOA A;  4NAW B;  3NS1 A;  4L23 A;  1UWX A;  1L6U A;  4JPS A;  2JZP A;  3PZ7 A;  1F77 A;  2LMC A;  1VJK A;  1SE2 A;  2HTM E;  3AB5 A;  3OWE B;  1HQR D;  4OZA A;  4DXF A;  3AEC B;  4RNA A;  4M0W A;  3H8H A;  4P6V F;  2EKI A;  3NRZ A;  1T5X D;  3BYY B;  2BW2 A;  4LTU A;  4ZRQ A;  3ZJT A;  1M4V A;  3HVD A;  1AWD A;  2JSV X;  2M56 B;  5G5H A;  1KF6 B;  1VZ7 A;  2D5G A;  2LUM A;  4RFB A;  1QF6 A;  4UDU C;  2GI9 A;  3AE4 B;  3U2S C;  2KDM A;  1Q10 A;  3SFE B;  3AH7 A;  2V3P A;  5BYQ A;  3U4E G;  3BVG A;  1HZ6 A;  4YWG G;  2WNM A;  5BMI A;  3Q8A A;  3AM9 A;  1XCQ L;  1KRH A;  1ZXI A;  1SJH D;  3TEZ A;  1L6V A;  1FMA D;  1HA5 A;  2PLP A;  4GDK B;  2RDH A;  3T3O A;  1FIQ A;  3SR6 A;  2J4X A;  3PZ8 A;  1UNS A;  3AE7 B;  2BT6 A;  1UUP A;  1QT9 A;  3P4Q B;  1FM0 D;  3R2I A;  3TUO A;  1XXG A;  1VR9 A;  2E3T A;  1C4C A;  4ZHP A;  3RFZ B;  1WYG A;  2J53 A;  3ZQ4 A;  4MH8 A;  1SSN A;  4RH6 A;  4C80 A;  1WWT A;  1MI0 A;  1STE A;  2BTE A;  2BB6 A;  1E7P B;  4LK0 M;  5HFY A;  1XLO A;  4WH4 A;  1C9F A;  5GXG B;  5EE3 A;  2DLB A;  1K52 A;  4FXC A;  1E0Z A;  2ONQ A;  1CJE A;  4LLG M;  1B1Z A;  2KAC A;  2CU3 A;  5FKA C;  2FUG 1;  3NVW A;  1YNT E;  2FE8 A;  3ETR A;  4IDI A;  5EE9 A;  3FC4 A;  1IBX B;  3AEG B;  2YEP B;  2YEP F;  2CJO A;  3FIL B;  3O13 A;  4REZ A;  3KWV A;  3R8B A;  1OQR A;  1PGB A;  2LHD A;  2IGG A;  4HRS A;  2G9H D;  2QIE B;  3HUI A;  2SEB D;  2N0S B;  1JWU D;  2SAK A;  1HXY D;  1XLP A;  3W9C B;  4B0E A;  3R2T A;  4TQ0 A;  5H92 C;  1PGA A;  2OED A;  4RCO A;  3CWI A;  1XLQ A;  2MJ3 A;  1SIJ A;  2MH7 A;  1PGX A;  2IJ0 A;  2ON8 A;  1FFV A;  3URY A;  3ABV B;  2V4I B;  3I57 A;  2INP E;  5AUI A;  3P1M A;  5BYR A;  1TKE A;  4DXG A;  4DQO C;  3Q8F A;  1N5X A;  3W5V B;  3EA6 A;  1H7X A;  1JW9 D;  4HJG E;  1TY0 A;  2W82 A;  1FXI A;  2BS3 B;  1JCK B;  4PT5 A;  1L4Z B;  1E6E B;  5FK9 C;  1J7B A;  1JWM D;  5TSS A;  1JML A;  2WXJ A;  1VZ8 A;  2KAJ A;  5HI1 A;  4ARC A;  4RGO S;  4KKI A;  3W2D A;  4HKQ A;  2I38 A;  2MJD A;  2KN4 A;  3NVY A;  3W1S A;  5BYS A;  1VZ6 A;  2WXL A;  1VLB A;  1EU3 A;  3MHZ A;  4O1N A;  1KLU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...