1N6ZA

Solution nmr structure of protein yml108w from saccharomyces cerevisiae. a novel member of the split bab fold. northeast structural genomics consortium target yt601.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
b'MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 12.3 kDa protein in ZDS2-URA5 intergenic region
publication title A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08987 DUF1892 Protein of unknown function (DUF1892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.250 Alpha Beta Roll Ubiquitin-like (UB roll) YML108W-like 1n6zA00
1N6ZA
chains in the Genus database with same CATH superfamily
1G6JA 1YJJA 5DCNA 4OZCA 4MGZE 3N30A 2WXHA 4P16A 3Q8FA 1PGXA 2Y5PA 2L05A 3UGBB 3CIRB 3GE8C 3V6EB 5IKCM 1QOGA 1YN3A 5H8YE 2WU5B 1FRDA 2R61A 1OFFA 3Q2AC 1RWSA 1FO4A 3ZQ4A 4GU2A 3VTWA 2IO1B 5LNK1 3N32A 5J17A 2LI5A 2WXKA 5G5GA 1T5XD 4W9KA 2PLPA 1TS4A 3V60A 4KDLB 2BKRB 4P1CC 1Y56A 4OW0A 2FCSA 3A9JA 2WS3B 1I7HA 1GJZA 2JZZA 4MSQB 4G11A 2ZVOA 3DQVA 1I42A 2LZ6A 4WQOB 2J4XA 1CJEA 2INCC 3GB1A 2I2YA 1P3QU 2K9XA 1CK1A 1YQ4B 4FJYA 3APFA 1P98A 4XYCA 5G55A 2M8SA 3RCZA 2AL6A 1YIWA 1JWMD 1R4NI 4C4VB 4DXFA 1WRDB 4BKTA 5MPOA 4TKNA 4RGOS 3AECB 1I4GA 1VDVA 1MVKA 1R4MI 2MJDA 2PKOA 3DVGY 2DAFA 3NHEB 4OVUA 2L32A 1P0RA 1SIFA 3TL5A 4GDKB 3CMMB 2V3SA 3DBHI 2ICIA 3CSFA 2NTSA 1HE8A 2C7MB 1PDXA 4HVBA 1WY8A 2G9HD 4BVUC 1RAXA 2HDEA 1Z5SB 1SB3C 3W2DA 1ZGUB 5CX3A 1JROA 4KGTA 2KMCA 4NAMA 2ZPYA 1OQRA 4ZRPA 2PVGC 1SF0A 2V3PA 3V05A 1WXMA 2DZJA 1XCTL 4M02A 4B95A 2PEAA 3T3OA 3WANA 1Q1OA 2INPE 4DHJD 3Q69A 1TKYA 2QHOA 1Z2MA 5BMIA 2KJ6A 4YL8A 4NZLB 3RNEC 4EZJA 1U4AA 5BMGA 5CHFA 3TUOA 2DZKA 4RNAA 2NBVB 3SFDB 1FCLA 2N1VA 4IM3A 1R4MB 1E7VA 1UZXB 2O2VA 3L54A 1E5WA 4MEMA 3DBHB 2MHJA 3LJ3A 3B1LX 4M01A 1FD6A 1XLQA 2YEPB 2KLCA 1ET9A 2V4LA 4W9LA 4YSZB 1L6VA 2JZ3B 2AQ3B 2BF8B 1VJKA 3W5VB 2N9KA 2FCQA 4HPLB 4FHJA 1T0YA 4ZYSA 1IGDA 2MQJA 2CHXA 4ASWC 3H8HA 1WGKA 3DBLI 4YXDB 3MHSD 2KKCA 3HIZA 2IDYA 3NOBA 1UGJA 1C77A 3ABVB 4HWIB 3RI7C 1QLBB 2FIFA 2WXOA 2V1YA 5LXHA 3QCAA 1E6EB 3BYTB 3AE1B 5D94A 4NQLB 1WGGA 4ANVA 3VAWA 2D2QA 4RF1A 2LXCA 4N59A 1F2RI 3TCAA 3LDZE 3HVDA 3JSVA 1MHXA 3WAPA 2PIAA 2JXXA 2WXRA 2GBMA 4ZDVA 2MP2B 2JXTA 4A90A 1HTOA 1KLVA 2K6QA 4KDIC 4IG7B 4WJNA 2VRRB 4RGMA 1UBQA 1ESFA 3P42A 3VUYA 4RCOA 2CJNA 3PS6A 2MW5A 5HFYA 1N62A 2PE6B 2LHDA 2G45B 3U7ZA 2BS4B 2LFIA 4KIKB 2E6XA 2OJRA 1J19A 2FAZA 1QQRA 2YLMA 1OQQA 4GDLB 4DDGD 4OVVA 1AARA 2L83A 5H92C 4WAFA 1BMLC 1V2YA 3FILB 3H7PA 2ZNVB 4IUMB 3CF6E 4BBNC 1RFAA 2J0JA 3B2FA 1E9MA 4BKGA 2G4SA 3PLUA 1EF1A 2MJEA 1GB4A 4YSXB 2D11A 4RH6A 3SR6A 3AU4A 4S0RA 4LCDE 1TYGB 1F77A 1NI3A 3J9CA 4A8XC 4D2KA 1LFDA 3ETRA 3WAOA 3QAQA 3ZRCA 1RLFA 3DBRI 2WDTB 1P1AA 4NAWB 4NPNA 5BMHA 3KUZA 5FK9C 3NZUA 2KWCA 3NVWA 3I63C 1TIFA 1V97A 3APCA 2RPVA 2BS2B 3DVNV 1UBIA 2FE8A 2XNAC 2JRHA 2W55A 5IOIA 1K53A 2M17A 1NYRA 3P1MA 3L13A 2D3BA 2K5PA 1ZUD2 1EF5A 2HD5B 4US8A 2BT6A 1JMLA 3ENEA 2XN9C 2WXQA 1SXTA 1HXYD 1YX5B 3BVZA 1BXTA 4JL9A 2FNJB 3U30A 2K25A 5KHOA 3DWMA 4FJZA 4A3OA 1QZEA 3RZWC 2HE7A 5TSSA 4MH0E 5EE9A 3I57A 2KZRA 2N9XA 4C4VA 4BKSD 2EELA 2NVUI 3ZDTA 2KDEB 1SE4A 2HTHA 2WWZA 1AWDA 1NI2A 1PUTA 5DPTA 5BO4B 2JX5A 1M4VA 1SE3A 2KMMA 2N0SB 3C8YA 1C4PA 4GDKA 3DBRB 2D5GA 3GE3C 3MC8A 2BBCA 2WDVB 1TY2A 3HHMA 1I4PA 2JY6A 1MG4A 1D5XC 4W9EA 2M0AA 4YTNB 3JW0X 3KLSX 4C00A 2LGDA 3VXWA 2H88B 4HKZE 1TKGA 2LGIA 3GS2A 2FCMA 1WFYA 1WXSA 2JZPA 1A5RA 1B9RA 1GC7A 4M0WB 2MBBB 3PRZA 3RN9C 4N9F4 1SIJA 2EMTA 1WH3A 1C78A 1Q5WB 1XEEA 2KANA 2MBOA 4BOSC 1FXTB 2C60A 1ZDXA 5AUKA 3PZ7A 1YNTE 4G3XB 4OVZA 1UWXA 4C56C 5FKAC 3NS1A 4KX6B 2K39A 3NY5A 3RYTA 3AH7A 4FA6A 4FADA 2WXFA 4GXBA 3Q14C 3KH0A 3B0AA 3ZTDA 2V0GA 4HKQA 4WWOA 2BGFA 3KWVA 1GUAB 2WXIA 3M95A 4IKGA 1HZ5A 2L1AA 5AZHA 3X23A 1MHHE 2VZKD 5G2NA 3ZGZA 2D3AA 3S2AA 4KKIA 3SHQA 4CQNA 2M19A 4MJSB 1FFUA 3PSEB 3N3KB 2KAJA 4RM9A 2JWZA 4S17A 3M3JA 2I1JA 3V61A 2INDC 4DXAB 1V86A 4B0EA 3TEYA 5E6PA 1ZKHA 2N7JA 2IJ0A 1WX8A 1YD8U 5IAAC 2KQ4X 3IAM1 3VTUA 2AQ2B 2Z59B 4YWGG 4K3CA 1ACCA 1VRAB 2Q5WD 1LM8B 5JZEB 2V3NA 3SU8X 3PZDA 2L76A 4LNIA 2X38A 1FNUA 3H6NA 4PYUA 3L08A 3TJPA 1WR1A 1GAQB 2BWES 2NBUA 4NQKE 2BB6A 2MP2A 4WJOA 5L83A 3N1YC 1FRRA 2KFJA 1D3ZA 2M56B 2KT7A 2PMVA 4J3OD 2VZKB 1HEZE 4M00A 2K22A 2ZCCA 2ZVNA 1TY0A 4GB9A 2LUEA 4F7ZA 3VUXA 4TQ1A 3DBSA 4ICVA 1F1HA 1LGRA 3AEAB 4KIKA 4AOFA 4IW0A 4ZRJA 2DX5B 4J6IA 4DK5A 2MRPA 4MGYE 4GDLA 1CQVA 2K6DB 2KDIA 2PW9A 2JWUA 3FILA 1M94A 2FIDA 2GOWA 2BW2A 4EFOA 3I5JC 2K1FA 5AZFA 2KWUB 2NBWB 3P4RB 3DCGA 1FFVA 1WXQA 4HJGE 4EOYA 5JHBA 1CMXB 2A5UA 1AYFA 1MI0A 1XLNA 3AE2B 2QC8A 2CU3A 1V81A 4CO7A 2IO2B 2WXGA 1IPGA 3TMPB 3M62B 1WZ3A 4II3B 4ZRQA 4XC2A 4IOIE 2GB1A 3R2IA 1GOZA 4AP4C 2KN4A 2KNBA 4KVGB 2Y5BB 2SEBD 2WQYB 2CKHB 1HA5A 3C0RB 1ZDVA 4NAWA 2DWQA 3AE6B 1VR9A 5GXGB 3M63B 3B9JA 1PFDA 2GBKA 2BTEA 1UWMA 2DAJA 2GLSA 2J0MA 3OWEB 1UNSA 3R66C 1N5WA 3HM3A 3VDZA 4IM0A 4PS3A 2LVOA 2G1EA 4W9JA 4FBJB 3VR8B 1HQRD 3BK2A 4L23A 4HJKA 1F52A 4NY0A 1J0GA 1K50A 1YQBA 4BZAA 1YOVB 2RDHA 3KYDD 2YEPF 1DYQA 4LNOA 4EE2A 1WMHA 3JYUA 2DYMA 2DNFA 4K3BA 1RFKA 2MBEA 1D4BA 1TGZB 1XT9B 3UIPB 2JYEA 3LXFA 4GOCA 1JWAD 4JIOU 4GGQA 2EMSA 1VLBA 3A4SC 2C7NB 4GN1A 2WXJA 1NENB 2R2OA 2BB5A 1K52A 4DHZB 3RNFC 1TBEA 3HRDD 3BVGA 3EFCA 4K81A 1TKEA 2DYBA 2FCNA 1N61A 2PVOD 5C1ZA 1NYQA 3NRZA 2LASA 1XF5L 1UELA 3VH3B 3ML8A 2JU6X 1WF9A 4NJ7A 1UH6A 1L4DB 2KVRA 2JVCA 3AE9B 3Q3OC 4M0WA 1JQ4A 5FR3A 3PRPB 2L52A 3AI5A 2L0TA 3CSTA 4BKSA 2QCZA 1X1MA 4AUQC 2BVCA 4B9KA 2WHIA 1E8WA 4A6QA 2LGSA 1KJTA 1IBXB 4BAXA 2C7HA 1CZPA 3AE4B 1TS2A 4US9A 2IGHA 4XWWA 2QSDA 3VR9B 2G3QB 4YTMB 1AW7A 4MACA 2LHEA 3HUIA 3ML9A 4G0NB 1TJEA 1YMHE 2LVQA 3IT4B 2LGXA 1SEBD 2XBBC 2KC1A 2CHWA 4HXDA 2LUMA 2M0XA 2LXAA 4KZCA 4BOZB 2D07B 3N1ZC 2MCNB 5LLIA 1SJHD 2BWFA 2OEDA 2BYFA 3O13A 2RDBC 4YTPB 1YN5A 1IP9A 2WU2B 3K9OB 3ZJUA 5CHWA 3RULA 1T0RC 1E8XA 1EU3A 4DHZE 4ITKA 3OG5A 2B3AA 3BK1A 3PREA 4MJSA 4XX5A 2JYTA 2LEKA 1V1PB 1XD3B 1HZ6A 3CWIA 1MG8A 1K8RB 3APDA 3RUIB 1LQBA 3Q3MC 4AS1A 1FCCC 2KD0A 3KQ4A 4USAA 4E3CA 3QC8B 1WJ4A 2ZW0A 4ARCA 1I4XA 2PPHA 2N4FA 1MJDA 3ZNID 3R7RA 4REZA 2XEWA 2KYWA 3IT6B 2DZIA 4W9DA 3QX1A 4E74A 1SBBB 2KTRB 2ZZPB 3PV1A 3BIID 3E9SA 3NZ3A 3DPDA 2JUOA 2ON8A 4JX1C 3GZNI 4O1NA 1EWYC 5FR6A 3W9CB 3VRBB 5E6OA 5HKHA 1QILA 2AX5A 2LJ5A 2NPTB 5DPRA 1WX9A 2J52A 1QF6A 1SE2A 4XZ4A 1LXDA 2WYQA 1F9JA 3AEFB 4L2YA 4GMVA 3W1YA 3AULA 4GIVA 1E8YA 2L8JA 3MFGA 3R8BA 3HK0A 5D2MB 2RD0A 2CS4A 3QHTA 4OZBA 2IO0B 2KO3A 5AZGA 2KMAA 3ZXVA 3BWUD 3IG3A 2IY1B 2QDFA 1KTKA 1V80A 3LB8C 4MSMB 1PGAA 2W3RA 1A70A 2UYZB 1IYFA 4XWTA 2D10A 3Q3NC 2KN5A 2D3CA 2WNMA 2WDRB 2DLBA 2QIEB 3V62A 2ZPNA 3NVYA 1V8CA 1RRBA 3AU5A 3DVGX 3ZDMC 3VVWB 1I4QA 1XQQA 1L0YB 2WDQB 3GZNB 1FIQA 2IBIB 3AB5A 4MT5A 2GMIC 5IA7A 3Q3FA 1C76A 1J7BA 4WAAA 1JWBD 1WM2A 1WMHB 4KGRA 1GC6A 4MM3B 3W1SA 1E10A 1WSPA 3WCQA 2AWTA 1TTNA 3ALBA 2V9HA 3PHXB 2BKFA 4HPPA 5D7GA 4RMAA 2ACZB 3NZSA 3PGEA 5EDSA 4MDKE 4LDTD 4DXGA 2KDBA 5EE1A 5BYSA 4HEA1 4CHKA 3ZW3A 2GBJA 2BYVE 1R7SA 3FAHA 4HROA 4ICUA 4Q2JA 1HTQA 2K8HA 4FHKA 1J8CA 4W9GA 2MX2A 5E6JA 1ENFA 3LYYA 1FEHA 2AYOB 1C1YB 1QT9A 2JSVX 3WA0A 2EKEC 3KW5B 3BVMA 3QK0A 1WXAA 1Q0WB 2L3ZA 4LNFA 4KKJA 3IHPC 4RGTA 3N9YC 2JF5A 1VZ8A 4JLCA 4HCNB 2RDGA 3AE5B 4AJWA 2LGYA 4PT5A 4JGHB 2JQRB 1NDDA 5IN7A 2CJOA 4JE3B 3DHGC 1F2RC 1SJED 2ZEQA 3PVLA 4LDTB 3L4PA 1RM6C 2MSED 3TIXA 5GMVA 4URKA 3U7DA 3E56A 3NVZA 3AXCA 2WP9B 1E90A 5E6NA 4XGAB 4RM8A 5HI1A 3C19A 3OAWA 2GRIA 5G5HA 3L17A 2K0PA 1IBXA 3ZLZA 1L7YA 3A1QB 4NJCA 1WI0A 5IO9A 2B76B 4AWJA 1D5MC 4TSSA 1B1ZA 1T6BX 3P63A 3HM6X 3P4SB 2XK5B 3KUCB 3FC4A 4M8NA 4OZAA 4MH8A 1WGDA 4AJYB 1DOIA 3PZ8A 3D32A 3T3NA 4NJ6A 1WJNA 1YJ1A 2KVZA 2KACA 3RT3B 2DZMA 2IY0B 3IVFA 3OLMD 4WH4A 3AM9A 3QJZA 3NUHB 3TSSA 2KC2A 4WQMA 5HHDG 1ZP0B 2VH1A 1NVID 3T8MA 1KM7A 4B6WA 1E7PB 1EWCA 5JH5C 3ECIA 3BY4B 3QIJA 2DENB 4WWNA 1N60A 1V1PA 4IWQA 2FBWB 1QKZA 1OGWA 1V5TA 2N1WA 2MEKA 5BYRA 4LJOB 1WGYA 4GLSC 5I4DA 3NG0A 1J7AA 3RPFC 1WZ0A 2WXLA 1STEA 3PPAA 2OOBB 2OJWA 5EE3A 2QJLA 1OQYA 3L16A 4QAYA 4IM2A 1KH0A 1EU4A 2V4IB 1ROEA 2G4DB 3P4PB 5AEKB 5T8IA 4X57B 1WYGA 2KTRA 1GNUA 4HCPB 3KVFB 2KHWB 3EHVA 3RNBC 2L7RA 2J42A 4UDUC 1UD7A 3B2GA 2Z0DB 3AEDB 2GBNA 4EKUA 1NEKB 3RD2A 3ZRFA 3SEBA 2W54A 4JQWC 2NPTA 1H4RA 3Q3JA 4E71A 4HK2A 1I35A 4TV3A 3RFZB 3MC0B 2ONQA 3TEWA 2OHFA 1PGBA 3GP7A 1WGHA 1T0SC 3R7QA 2N7DA 3RNCC 2H89B 1C4AA 4P6VF 5DPSA 3H7SA 1GB1A 1ZOYB 4KV2A 3I3TB 1P7FA 4F8CB 2RSUA 4FN2A 1ZW7A 4H2AA 4RF0A 3PHWB 2KFKB 1ZPSA 1WE6A 4KSKC 4PK1A 5EE0A 1WR6E 4B0MA 4CYEA 3ZVVA 2BYTA 2WXNA 2WLBA 2ASQA 1XLPA 1DOXA 3A4RA 4JWSC 3Q8BA 2LWPA 4HRSA 4TUUA 3UI3A 4I6PA 4BBNF 2GBRA 4YT0B 2W3SA 3I9V1 2DBYA 4XE0A 4K1RB 3HVZA 1AN8A 4EZLA 1EO6A 1Q10A 3VQIA 4HLEA 4N6EB 3OJ3A 2KDMA 2KQ7A 4EZKA 1XXGA 2NMQA 4C80A 4G50A 2LRUA 3AEEB 2NS5A 2NTTA 2K8CA 2UWQA 3PLVA 1K51A 1FM0D 2RPQA 3RMKC 4MM3A 3ZNGC 1FPYA 4KSLC 2KDFB 2A4ZA 4IWOA 1WIAA 2DHZA 1I4RA 2N9LA 3ZJVA 1V5OA 1KOTA 4BFRA 3Q6BA 4RFBA 3ZKJC 3AE7B 5C3JB 1YN4A 2MJ3A 1UGMA 3PTFC 1IUEA 3U4EG 1ISNA 3EFUA 3MJWA 3L0WB 3UF8A 3TEXA 1KLGD 2N7EA 2O6VD 3IBEA 2VH2A 3PRMB 3P2BA 1WX7A 2LMCA 2TSSA 3A9KB 3EGRA 3BZDB 3MC9A 2KJHB 1JW9D 3Q8CA 3R2TA 3P4QB 3NJTA 2CU1A 1R4NB 1WRIA 4ZYNA 2AEHA 4FXCA 1WM3A 3QARA 5C2TB 3ZTCA 3URYA 2K8BA 2FUHB 4DQOC 3T9LA 1D6EC 3ZIMA 4K7UA 1T3QA 1KFYB 1S3SG 2WX1A 4C7YA 3ONSA 3O65B 1JWSD 1SSNA 3MHZA 3AE8B 4ANWA 4EUTA 4DDID 4ARIA 5LXIB 2QMTA 3KWLA 1OEYA 3DDCB 4IWPA 1C79A 1KF6B 1TS5A 3ZO5B 3Q8EA 2MH7A 2O6VB 2D3GA 3AV8A 3W5UB 2N9EB 4ZOHC 1C4CA 3WAMA 5CHVC 2CR5A 3L10B 4K7SA 3W1SC 2FUG1 3QQ8B 1IGCA 3X0WA 2JT4B 2KK8A 3GOEA 1T0QC 4DHJB 3IAS1 5JXVA 1KLUD 4MELA 3SFEB 3A1QA 1TT5B 3DOWA 1EUVB 2L0FA 1I4HA 1L5PA 3A33B 1H8CA 5D3DA 4HDQA 4IDIA 3U2SC 1WJ6A 3SD5A 3UQBA 2XK5A 3AMZA 3TBLD 3DHIC 1D5ZC 1L6UA 2IGDA 4LNKA 4XDDA 2INNE 2Y5CA 4W9IA 2KTFA 3JVZX 5DPWA 1N63A 2JRIB 1L0VB 1V9JA 4JWUC 4YSYB 1BT0A 3V6CB 4I6NB 2MBHA 4WIPA 3KYCD 3ZJTA 2NR2A 2IPKD 2HJ1A 5JHAA 2KWDA 3EA6A 2WGSA 2C9WB 1VZ6A 2KOXA 2E3TA 4WJPA 4RGNA 2RR9A 3VHTC 2ZCBA 1N5XA 4A55A 3QA8A 3ZXRA 1PQSA 2QEJC 1TZ1A 2RMMA 4PS8A 2Z8LA 1P7EA 3WALA 1FXAA 2M1MA 3N1XC 4DBGA 1C3TA 3TEZA 1WJUA 2KWVB 5CTRC 4XDCA 1WWTA 1ZXHA 3DBLB 2NCNA 3EC8A 1MFWA 3VUWA 4PS7A 3EUB2 1OTRB 5J18A 3A9JB 2KJRA 3DHHC 4W9HA 3B08A 5TR5A 2Z0EB 3PT2B 1V49A 3VH4B 2IYDB 2AQ1B 2DYOA 3MJ5A 1ZE3D 1YJIA 2LRWA 3VTVA 2KQSA 4ANXA 1JCKB 2IO3B 4WURA 2PE9A 2BS3B 1XLOA 5C23A 3RZFA 1P9DU 4JPSA 4F1SA 5J2RA 1QOBA 2PTLA 4EEWA 1XCQL 1FNWA 3H1UA 2YVCA 4A9AA 3ZNHB 2PJHA 2MBQA 2RGFA 1NBFC 1JALA 4L1BA 4N58A 3WIMA 2J53A 4P1BC 2KFKA 4W9FA 3AN1A 1UUPA 3FKYA 1DGJA 1V1OA 2EKIA 3RNGC 3V3XA 1L0XB 1OEYJ 5KHQA 1C9FA 2BPSA 1N6ZA 4NNJB 2SAKA 1S1QB 2W82A 4K7WA 2HTME 1KRHA 1SGHA 4KGSA 1L4ZB 4TMAB 4A20A 5AUIA 3OJ4B 3UQAA 4HPMB 1E0ZA 1LO5D 4DWFA 2ZW1A 4IC7B 1DOYA 2C5LC 1FMAD 2QILA 1F0ZA 3DVNU 3BINA 1V6EA 2ZNVC 1BUIC 2JPHA 3UINB 3EECA 4ZHOA 3K9PB 1WYWB 1ET6A 4LK0M 2KLGA 2CHZA 2MA9B 2KX0A 2ZJDA 2LVPA 1SE9A 1JWUD 2WXPA 4FLHA 4WWPA 4M8MA 2O2VB 5HG2A 1XO3A 3SDLC 4LLGM 1QOFA 3N20C 4C7ZA 4II2B 4I6LB 3U8ZA 2L00B 4LNNA 3R3MA 3A9KA 2MWSB 2N9PC 1UF0A 3AEBB 3PO0A 1FNVA 4MGKE 2KXJA 3NVVA 3NS8A 4FJVB 1YQ3B 2REXA 4PYZA 1VCBA 4ANUA 1Y8RC 4GSWA 4P7IA 2AL3A 1ZXIA 2I38A 2W9NA 2Y3AA 4LTUA 1FXIA 1E8ZA 2HJ8A 2LJIA 1GG3A 4LJPB 4KZ0A 3Q8AA 1VZ7A 2M4NA 3VFKA 2GI9A 2R2QA 1J7CA 2BYEA 3ZYYX 3RNAC 3JSVB 3UIOB 1WGRA 4FULA 4ACFA 2O6VA 4ZHPA 4TQ0A 2UU7A 1MPEA 4AQ7A 3BYYB 1YX6B 2J0KA 2IGGA 3ZNZB 2IZVB 5D3IB 5IP4D 1PYWD 4MGIE 2J7QB 1E7UA 1JRUA 1RYJA 4WJQA 1JRPA 1QOAA 1GPXA 3IFWB 1TS3A 4A3PA 3MP9A 1L2NA 3AE3B 5L95C 4W9CA 3H9DA 5BYQA 4ZRIA 4ZRKA 2LD9A 3AEGB 3VRAB 3H7PB 2MLBA 4HDOA 3ZUNA 4WWMA 3U52E 3MTNB 2BQQA 1TZOA 2KX3A 2X8XX 2WX0A 3QWZB 5D6JB 2WXMA 3KUDB 4OHJA 3IXSA 1EM7A 2K3UA 3DWGC 1WE7A 4R3DA 1WXVA 1VD2A 2I1KA
chains in the Genus database with same CATH topology
1N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6Z A; 
#chains in the Genus database with same CATH topology
 1G6J A;  1YJJ A;  5DCN A;  4OZC A;  4MGZ E;  3N30 A;  2WXH A;  4P16 A;  3Q8F A;  1PGX A;  2Y5P A;  2L05 A;  3UGB B;  3CIR B;  3GE8 C;  3V6E B;  5IKC M;  1QOG A;  1YN3 A;  5H8Y E;  2WU5 B;  1FRD A;  2R61 A;  1OFF A;  3Q2A C;  1RWS A;  1FO4 A;  3ZQ4 A;  4GU2 A;  3VTW A;  2IO1 B;  5LNK 1;  3N32 A;  5J17 A;  2LI5 A;  2WXK A;  5G5G A;  1T5X D;  4W9K A;  2PLP A;  1TS4 A;  3V60 A;  4KDL B;  2BKR B;  4P1C C;  1Y56 A;  4OW0 A;  2FCS A;  3A9J A;  2WS3 B;  1I7H A;  1GJZ A;  2JZZ A;  4MSQ B;  4G11 A;  2ZVO A;  3DQV A;  1I42 A;  2LZ6 A;  4WQO B;  2J4X A;  1CJE A;  2INC C;  3GB1 A;  2I2Y A;  1P3Q U;  2K9X A;  1CK1 A;  1YQ4 B;  4FJY A;  3APF A;  1P98 A;  4XYC A;  5G55 A;  2M8S A;  3RCZ A;  2AL6 A;  1YIW A;  1JWM D;  1R4N I;  4C4V B;  4DXF A;  1WRD B;  4BKT A;  5MPO A;  4TKN A;  4RGO S;  3AEC B;  1I4G A;  1VDV A;  1MVK A;  1R4M I;  2MJD A;  2PKO A;  3DVG Y;  2DAF A;  3NHE B;  4OVU A;  2L32 A;  1P0R A;  1SIF A;  3TL5 A;  4GDK B;  3CMM B;  2V3S A;  3DBH I;  2ICI A;  3CSF A;  2NTS A;  1HE8 A;  2C7M B;  1PDX A;  4HVB A;  1WY8 A;  2G9H D;  4BVU C;  1RAX A;  2HDE A;  1Z5S B;  1SB3 C;  3W2D A;  1ZGU B;  5CX3 A;  1JRO A;  4KGT A;  2KMC A;  4NAM A;  2ZPY A;  1OQR A;  4ZRP A;  2PVG C;  1SF0 A;  2V3P A;  3V05 A;  1WXM A;  2DZJ A;  1XCT L;  4M02 A;  4B95 A;  2PEA A;  3T3O A;  3WAN A;  1Q1O A;  2INP E;  4DHJ D;  3Q69 A;  1TKY A;  2QHO A;  1Z2M A;  5BMI A;  2KJ6 A;  4YL8 A;  4NZL B;  3RNE C;  4EZJ A;  1U4A A;  5BMG A;  5CHF A;  3TUO A;  2DZK A;  4RNA A;  2NBV B;  3SFD B;  1FCL A;  2N1V A;  4IM3 A;  1R4M B;  1E7V A;  1UZX B;  2O2V A;  3L54 A;  1E5W A;  4MEM A;  3DBH B;  2MHJ A;  3LJ3 A;  3B1L X;  4M01 A;  1FD6 A;  1XLQ A;  2YEP B;  2KLC A;  1ET9 A;  2V4L A;  4W9L A;  4YSZ B;  1L6V A;  2JZ3 B;  2AQ3 B;  2BF8 B;  1VJK A;  3W5V B;  2N9K A;  2FCQ A;  4HPL B;  4FHJ A;  1T0Y A;  4ZYS A;  1IGD A;  2MQJ A;  2CHX A;  4ASW C;  3H8H A;  1WGK A;  3DBL I;  4YXD B;  3MHS D;  2KKC A;  3HIZ A;  2IDY A;  3NOB A;  1UGJ A;  1C77 A;  3ABV B;  4HWI B;  3RI7 C;  1QLB B;  2FIF A;  2WXO A;  2V1Y A;  5LXH A;  3QCA A;  1E6E B;  3BYT B;  3AE1 B;  5D94 A;  4NQL B;  1WGG A;  4ANV A;  3VAW A;  2D2Q A;  4RF1 A;  2LXC A;  4N59 A;  1F2R I;  3TCA A;  3LDZ E;  3HVD A;  3JSV A;  1MHX A;  3WAP A;  2PIA A;  2JXX A;  2WXR A;  2GBM A;  4ZDV A;  2MP2 B;  2JXT A;  4A90 A;  1HTO A;  1KLV A;  2K6Q A;  4KDI C;  4IG7 B;  4WJN A;  2VRR B;  4RGM A;  1UBQ A;  1ESF A;  3P42 A;  3VUY A;  4RCO A;  2CJN A;  3PS6 A;  2MW5 A;  5HFY A;  1N62 A;  2PE6 B;  2LHD A;  2G45 B;  3U7Z A;  2BS4 B;  2LFI A;  4KIK B;  2E6X A;  2OJR A;  1J19 A;  2FAZ A;  1QQR A;  2YLM A;  1OQQ A;  4GDL B;  4DDG D;  4OVV A;  1AAR A;  2L83 A;  5H92 C;  4WAF A;  1BML C;  1V2Y A;  3FIL B;  3H7P A;  2ZNV B;  4IUM B;  3CF6 E;  4BBN C;  1RFA A;  2J0J A;  3B2F A;  1E9M A;  4BKG A;  2G4S A;  3PLU A;  1EF1 A;  2MJE A;  1GB4 A;  4YSX B;  2D11 A;  4RH6 A;  3SR6 A;  3AU4 A;  4S0R A;  4LCD E;  1TYG B;  1F77 A;  1NI3 A;  3J9C A;  4A8X C;  4D2K A;  1LFD A;  3ETR A;  3WAO A;  3QAQ A;  3ZRC A;  1RLF A;  3DBR I;  2WDT B;  1P1A A;  4NAW B;  4NPN A;  5BMH A;  3KUZ A;  5FK9 C;  3NZU A;  2KWC A;  3NVW A;  3I63 C;  1TIF A;  1V97 A;  3APC A;  2RPV A;  2BS2 B;  3DVN V;  1UBI A;  2FE8 A;  2XNA C;  2JRH A;  2W55 A;  5IOI A;  1K53 A;  2M17 A;  1NYR A;  3P1M A;  3L13 A;  2D3B A;  2K5P A;  1ZUD 2;  1EF5 A;  2HD5 B;  4US8 A;  2BT6 A;  1JML A;  3ENE A;  2XN9 C;  2WXQ A;  1SXT A;  1HXY D;  1YX5 B;  3BVZ A;  1BXT A;  4JL9 A;  2FNJ B;  3U30 A;  2K25 A;  5KHO A;  3DWM A;  4FJZ A;  4A3O A;  1QZE A;  3RZW C;  2HE7 A;  5TSS A;  4MH0 E;  5EE9 A;  3I57 A;  2KZR A;  2N9X A;  4C4V A;  4BKS D;  2EEL A;  2NVU I;  3ZDT A;  2KDE B;  1SE4 A;  2HTH A;  2WWZ A;  1AWD A;  1NI2 A;  1PUT A;  5DPT A;  5BO4 B;  2JX5 A;  1M4V A;  1SE3 A;  2KMM A;  2N0S B;  3C8Y A;  1C4P A;  4GDK A;  3DBR B;  2D5G A;  3GE3 C;  3MC8 A;  2BBC A;  2WDV B;  1TY2 A;  3HHM A;  1I4P A;  2JY6 A;  1MG4 A;  1D5X C;  4W9E A;  2M0A A;  4YTN B;  3JW0 X;  3KLS X;  4C00 A;  2LGD A;  3VXW A;  2H88 B;  4HKZ E;  1TKG A;  2LGI A;  3GS2 A;  2FCM A;  1WFY A;  1WXS A;  2JZP A;  1A5R A;  1B9R A;  1GC7 A;  4M0W B;  2MBB B;  3PRZ A;  3RN9 C;  4N9F 4;  1SIJ A;  2EMT A;  1WH3 A;  1C78 A;  1Q5W B;  1XEE A;  2KAN A;  2MBO A;  4BOS C;  1FXT B;  2C60 A;  1ZDX A;  5AUK A;  3PZ7 A;  1YNT E;  4G3X B;  4OVZ A;  1UWX A;  4C56 C;  5FKA C;  3NS1 A;  4KX6 B;  2K39 A;  3NY5 A;  3RYT A;  3AH7 A;  4FA6 A;  4FAD A;  2WXF A;  4GXB A;  3Q14 C;  3KH0 A;  3B0A A;  3ZTD A;  2V0G A;  4HKQ A;  4WWO A;  2BGF A;  3KWV A;  1GUA B;  2WXI A;  3M95 A;  4IKG A;  1HZ5 A;  2L1A A;  5AZH A;  3X23 A;  1MHH E;  2VZK D;  5G2N A;  3ZGZ A;  2D3A A;  3S2A A;  4KKI A;  3SHQ A;  4CQN A;  2M19 A;  4MJS B;  1FFU A;  3PSE B;  3N3K B;  2KAJ A;  4RM9 A;  2JWZ A;  4S17 A;  3M3J A;  2I1J A;  3V61 A;  2IND C;  4DXA B;  1V86 A;  4B0E A;  3TEY A;  5E6P A;  1ZKH A;  2N7J A;  2IJ0 A;  1WX8 A;  1YD8 U;  5IAA C;  2KQ4 X;  3IAM 1;  3VTU A;  2AQ2 B;  2Z59 B;  4YWG G;  4K3C A;  1ACC A;  1VRA B;  2Q5W D;  1LM8 B;  5JZE B;  2V3N A;  3SU8 X;  3PZD A;  2L76 A;  4LNI A;  2X38 A;  1FNU A;  3H6N A;  4PYU A;  3L08 A;  3TJP A;  1WR1 A;  1GAQ B;  2BWE S;  2NBU A;  4NQK E;  2BB6 A;  2MP2 A;  4WJO A;  5L83 A;  3N1Y C;  1FRR A;  2KFJ A;  1D3Z A;  2M56 B;  2KT7 A;  2PMV A;  4J3O D;  2VZK B;  1HEZ E;  4M00 A;  2K22 A;  2ZCC A;  2ZVN A;  1TY0 A;  4GB9 A;  2LUE A;  4F7Z A;  3VUX A;  4TQ1 A;  3DBS A;  4ICV A;  1F1H A;  1LGR A;  3AEA B;  4KIK A;  4AOF A;  4IW0 A;  4ZRJ A;  2DX5 B;  4J6I A;  4DK5 A;  2MRP A;  4MGY E;  4GDL A;  1CQV A;  2K6D B;  2KDI A;  2PW9 A;  2JWU A;  3FIL A;  1M94 A;  2FID A;  2GOW A;  2BW2 A;  4EFO A;  3I5J C;  2K1F A;  5AZF A;  2KWU B;  2NBW B;  3P4R B;  3DCG A;  1FFV A;  1WXQ A;  4HJG E;  4EOY A;  5JHB A;  1CMX B;  2A5U A;  1AYF A;  1MI0 A;  1XLN A;  3AE2 B;  2QC8 A;  2CU3 A;  1V81 A;  4CO7 A;  2IO2 B;  2WXG A;  1IPG A;  3TMP B;  3M62 B;  1WZ3 A;  4II3 B;  4ZRQ A;  4XC2 A;  4IOI E;  2GB1 A;  3R2I A;  1GOZ A;  4AP4 C;  2KN4 A;  2KNB A;  4KVG B;  2Y5B B;  2SEB D;  2WQY B;  2CKH B;  1HA5 A;  3C0R B;  1ZDV A;  4NAW A;  2DWQ A;  3AE6 B;  1VR9 A;  5GXG B;  3M63 B;  3B9J A;  1PFD A;  2GBK A;  2BTE A;  1UWM A;  2DAJ A;  2GLS A;  2J0M A;  3OWE B;  1UNS A;  3R66 C;  1N5W A;  3HM3 A;  3VDZ A;  4IM0 A;  4PS3 A;  2LVO A;  2G1E A;  4W9J A;  4FBJ B;  3VR8 B;  1HQR D;  3BK2 A;  4L23 A;  4HJK A;  1F52 A;  4NY0 A;  1J0G A;  1K50 A;  1YQB A;  4BZA A;  1YOV B;  2RDH A;  3KYD D;  2YEP F;  1DYQ A;  4LNO A;  4EE2 A;  1WMH A;  3JYU A;  2DYM A;  2DNF A;  4K3B A;  1RFK A;  2MBE A;  1D4B A;  1TGZ B;  1XT9 B;  3UIP B;  2JYE A;  3LXF A;  4GOC A;  1JWA D;  4JIO U;  4GGQ A;  2EMS A;  1VLB A;  3A4S C;  2C7N B;  4GN1 A;  2WXJ A;  1NEN B;  2R2O A;  2BB5 A;  1K52 A;  4DHZ B;  3RNF C;  1TBE A;  3HRD D;  3BVG A;  3EFC A;  4K81 A;  1TKE A;  2DYB A;  2FCN A;  1N61 A;  2PVO D;  5C1Z A;  1NYQ A;  3NRZ A;  2LAS A;  1XF5 L;  1UEL A;  3VH3 B;  3ML8 A;  2JU6 X;  1WF9 A;  4NJ7 A;  1UH6 A;  1L4D B;  2KVR A;  2JVC A;  3AE9 B;  3Q3O C;  4M0W A;  1JQ4 A;  5FR3 A;  3PRP B;  2L52 A;  3AI5 A;  2L0T A;  3CST A;  4BKS A;  2QCZ A;  1X1M A;  4AUQ C;  2BVC A;  4B9K A;  2WHI A;  1E8W A;  4A6Q A;  2LGS A;  1KJT A;  1IBX B;  4BAX A;  2C7H A;  1CZP A;  3AE4 B;  1TS2 A;  4US9 A;  2IGH A;  4XWW A;  2QSD A;  3VR9 B;  2G3Q B;  4YTM B;  1AW7 A;  4MAC A;  2LHE A;  3HUI A;  3ML9 A;  4G0N B;  1TJE A;  1YMH E;  2LVQ A;  3IT4 B;  2LGX A;  1SEB D;  2XBB C;  2KC1 A;  2CHW A;  4HXD A;  2LUM A;  2M0X A;  2LXA A;  4KZC A;  4BOZ B;  2D07 B;  3N1Z C;  2MCN B;  5LLI A;  1SJH D;  2BWF A;  2OED A;  2BYF A;  3O13 A;  2RDB C;  4YTP B;  1YN5 A;  1IP9 A;  2WU2 B;  3K9O B;  3ZJU A;  5CHW A;  3RUL A;  1T0R C;  1E8X A;  1EU3 A;  4DHZ E;  4ITK A;  3OG5 A;  2B3A A;  3BK1 A;  3PRE A;  4MJS A;  4XX5 A;  2JYT A;  2LEK A;  1V1P B;  1XD3 B;  1HZ6 A;  3CWI A;  1MG8 A;  1K8R B;  3APD A;  3RUI B;  1LQB A;  3Q3M C;  4AS1 A;  1FCC C;  2KD0 A;  3KQ4 A;  4USA A;  4E3C A;  3QC8 B;  1WJ4 A;  2ZW0 A;  4ARC A;  1I4X A;  2PPH A;  2N4F A;  1MJD A;  3ZNI D;  3R7R A;  4REZ A;  2XEW A;  2KYW A;  3IT6 B;  2DZI A;  4W9D A;  3QX1 A;  4E74 A;  1SBB B;  2KTR B;  2ZZP B;  3PV1 A;  3BII D;  3E9S A;  3NZ3 A;  3DPD A;  2JUO A;  2ON8 A;  4JX1 C;  3GZN I;  4O1N A;  1EWY C;  5FR6 A;  3W9C B;  3VRB B;  5E6O A;  5HKH A;  1QIL A;  2AX5 A;  2LJ5 A;  2NPT B;  5DPR A;  1WX9 A;  2J52 A;  1QF6 A;  1SE2 A;  4XZ4 A;  1LXD A;  2WYQ A;  1F9J A;  3AEF B;  4L2Y A;  4GMV A;  3W1Y A;  3AUL A;  4GIV A;  1E8Y A;  2L8J A;  3MFG A;  3R8B A;  3HK0 A;  5D2M B;  2RD0 A;  2CS4 A;  3QHT A;  4OZB A;  2IO0 B;  2KO3 A;  5AZG A;  2KMA A;  3ZXV A;  3BWU D;  3IG3 A;  2IY1 B;  2QDF A;  1KTK A;  1V80 A;  3LB8 C;  4MSM B;  1PGA A;  2W3R A;  1A70 A;  2UYZ B;  1IYF A;  4XWT A;  2D10 A;  3Q3N C;  2KN5 A;  2D3C A;  2WNM A;  2WDR B;  2DLB A;  2QIE B;  3V62 A;  2ZPN A;  3NVY A;  1V8C A;  1RRB A;  3AU5 A;  3DVG X;  3ZDM C;  3VVW B;  1I4Q A;  1XQQ A;  1L0Y B;  2WDQ B;  3GZN B;  1FIQ A;  2IBI B;  3AB5 A;  4MT5 A;  2GMI C;  5IA7 A;  3Q3F A;  1C76 A;  1J7B A;  4WAA A;  1JWB D;  1WM2 A;  1WMH B;  4KGR A;  1GC6 A;  4MM3 B;  3W1S A;  1E10 A;  1WSP A;  3WCQ A;  2AWT A;  1TTN A;  3ALB A;  2V9H A;  3PHX B;  2BKF A;  4HPP A;  5D7G A;  4RMA A;  2ACZ B;  3NZS A;  3PGE A;  5EDS A;  4MDK E;  4LDT D;  4DXG A;  2KDB A;  5EE1 A;  5BYS A;  4HEA 1;  4CHK A;  3ZW3 A;  2GBJ A;  2BYV E;  1R7S A;  3FAH A;  4HRO A;  4ICU A;  4Q2J A;  1HTQ A;  2K8H A;  4FHK A;  1J8C A;  4W9G A;  2MX2 A;  5E6J A;  1ENF A;  3LYY A;  1FEH A;  2AYO B;  1C1Y B;  1QT9 A;  2JSV X;  3WA0 A;  2EKE C;  3KW5 B;  3BVM A;  3QK0 A;  1WXA A;  1Q0W B;  2L3Z A;  4LNF A;  4KKJ A;  3IHP C;  4RGT A;  3N9Y C;  2JF5 A;  1VZ8 A;  4JLC A;  4HCN B;  2RDG A;  3AE5 B;  4AJW A;  2LGY A;  4PT5 A;  4JGH B;  2JQR B;  1NDD A;  5IN7 A;  2CJO A;  4JE3 B;  3DHG C;  1F2R C;  1SJE D;  2ZEQ A;  3PVL A;  4LDT B;  3L4P A;  1RM6 C;  2MSE D;  3TIX A;  5GMV A;  4URK A;  3U7D A;  3E56 A;  3NVZ A;  3AXC A;  2WP9 B;  1E90 A;  5E6N A;  4XGA B;  4RM8 A;  5HI1 A;  3C19 A;  3OAW A;  2GRI A;  5G5H A;  3L17 A;  2K0P A;  1IBX A;  3ZLZ A;  1L7Y A;  3A1Q B;  4NJC A;  1WI0 A;  5IO9 A;  2B76 B;  4AWJ A;  1D5M C;  4TSS A;  1B1Z A;  1T6B X;  3P63 A;  3HM6 X;  3P4S B;  2XK5 B;  3KUC B;  3FC4 A;  4M8N A;  4OZA A;  4MH8 A;  1WGD A;  4AJY B;  1DOI A;  3PZ8 A;  3D32 A;  3T3N A;  4NJ6 A;  1WJN A;  1YJ1 A;  2KVZ A;  2KAC A;  3RT3 B;  2DZM A;  2IY0 B;  3IVF A;  3OLM D;  4WH4 A;  3AM9 A;  3QJZ A;  3NUH B;  3TSS A;  2KC2 A;  4WQM A;  5HHD G;  1ZP0 B;  2VH1 A;  1NVI D;  3T8M A;  1KM7 A;  4B6W A;  1E7P B;  1EWC A;  5JH5 C;  3ECI A;  3BY4 B;  3QIJ A;  2DEN B;  4WWN A;  1N60 A;  1V1P A;  4IWQ A;  2FBW B;  1QKZ A;  1OGW A;  1V5T A;  2N1W A;  2MEK A;  5BYR A;  4LJO B;  1WGY A;  4GLS C;  5I4D A;  3NG0 A;  1J7A A;  3RPF C;  1WZ0 A;  2WXL A;  1STE A;  3PPA A;  2OOB B;  2OJW A;  5EE3 A;  2QJL A;  1OQY A;  3L16 A;  4QAY A;  4IM2 A;  1KH0 A;  1EU4 A;  2V4I B;  1ROE A;  2G4D B;  3P4P B;  5AEK B;  5T8I A;  4X57 B;  1WYG A;  2KTR A;  1GNU A;  4HCP B;  3KVF B;  2KHW B;  3EHV A;  3RNB C;  2L7R A;  2J42 A;  4UDU C;  1UD7 A;  3B2G A;  2Z0D B;  3AED B;  2GBN A;  4EKU A;  1NEK B;  3RD2 A;  3ZRF A;  3SEB A;  2W54 A;  4JQW C;  2NPT A;  1H4R A;  3Q3J A;  4E71 A;  4HK2 A;  1I35 A;  4TV3 A;  3RFZ B;  3MC0 B;  2ONQ A;  3TEW A;  2OHF A;  1PGB A;  3GP7 A;  1WGH A;  1T0S C;  3R7Q A;  2N7D A;  3RNC C;  2H89 B;  1C4A A;  4P6V F;  5DPS A;  3H7S A;  1GB1 A;  1ZOY B;  4KV2 A;  3I3T B;  1P7F A;  4F8C B;  2RSU A;  4FN2 A;  1ZW7 A;  4H2A A;  4RF0 A;  3PHW B;  2KFK B;  1ZPS A;  1WE6 A;  4KSK C;  4PK1 A;  5EE0 A;  1WR6 E;  4B0M A;  4CYE A;  3ZVV A;  2BYT A;  2WXN A;  2WLB A;  2ASQ A;  1XLP A;  1DOX A;  3A4R A;  4JWS C;  3Q8B A;  2LWP A;  4HRS A;  4TUU A;  3UI3 A;  4I6P A;  4BBN F;  2GBR A;  4YT0 B;  2W3S A;  3I9V 1;  2DBY A;  4XE0 A;  4K1R B;  3HVZ A;  1AN8 A;  4EZL A;  1EO6 A;  1Q10 A;  3VQI A;  4HLE A;  4N6E B;  3OJ3 A;  2KDM A;  2KQ7 A;  4EZK A;  1XXG A;  2NMQ A;  4C80 A;  4G50 A;  2LRU A;  3AEE B;  2NS5 A;  2NTT A;  2K8C A;  2UWQ A;  3PLV A;  1K51 A;  1FM0 D;  2RPQ A;  3RMK C;  4MM3 A;  3ZNG C;  1FPY A;  4KSL C;  2KDF B;  2A4Z A;  4IWO A;  1WIA A;  2DHZ A;  1I4R A;  2N9L A;  3ZJV A;  1V5O A;  1KOT A;  4BFR A;  3Q6B A;  4RFB A;  3ZKJ C;  3AE7 B;  5C3J B;  1YN4 A;  2MJ3 A;  1UGM A;  3PTF C;  1IUE A;  3U4E G;  1ISN A;  3EFU A;  3MJW A;  3L0W B;  3UF8 A;  3TEX A;  1KLG D;  2N7E A;  2O6V D;  3IBE A;  2VH2 A;  3PRM B;  3P2B A;  1WX7 A;  2LMC A;  2TSS A;  3A9K B;  3EGR A;  3BZD B;  3MC9 A;  2KJH B;  1JW9 D;  3Q8C A;  3R2T A;  3P4Q B;  3NJT A;  2CU1 A;  1R4N B;  1WRI A;  4ZYN A;  2AEH A;  4FXC A;  1WM3 A;  3QAR A;  5C2T B;  3ZTC A;  3URY A;  2K8B A;  2FUH B;  4DQO C;  3T9L A;  1D6E C;  3ZIM A;  4K7U A;  1T3Q A;  1KFY B;  1S3S G;  2WX1 A;  4C7Y A;  3ONS A;  3O65 B;  1JWS D;  1SSN A;  3MHZ A;  3AE8 B;  4ANW A;  4EUT A;  4DDI D;  4ARI A;  5LXI B;  2QMT A;  3KWL A;  1OEY A;  3DDC B;  4IWP A;  1C79 A;  1KF6 B;  1TS5 A;  3ZO5 B;  3Q8E A;  2MH7 A;  2O6V B;  2D3G A;  3AV8 A;  3W5U B;  2N9E B;  4ZOH C;  1C4C A;  3WAM A;  5CHV C;  2CR5 A;  3L10 B;  4K7S A;  3W1S C;  2FUG 1;  3QQ8 B;  1IGC A;  3X0W A;  2JT4 B;  2KK8 A;  3GOE A;  1T0Q C;  4DHJ B;  3IAS 1;  5JXV A;  1KLU D;  4MEL A;  3SFE B;  3A1Q A;  1TT5 B;  3DOW A;  1EUV B;  2L0F A;  1I4H A;  1L5P A;  3A33 B;  1H8C A;  5D3D A;  4HDQ A;  4IDI A;  3U2S C;  1WJ6 A;  3SD5 A;  3UQB A;  2XK5 A;  3AMZ A;  3TBL D;  3DHI C;  1D5Z C;  1L6U A;  2IGD A;  4LNK A;  4XDD A;  2INN E;  2Y5C A;  4W9I A;  2KTF A;  3JVZ X;  5DPW A;  1N63 A;  2JRI B;  1L0V B;  1V9J A;  4JWU C;  4YSY B;  1BT0 A;  3V6C B;  4I6N B;  2MBH A;  4WIP A;  3KYC D;  3ZJT A;  2NR2 A;  2IPK D;  2HJ1 A;  5JHA A;  2KWD A;  3EA6 A;  2WGS A;  2C9W B;  1VZ6 A;  2KOX A;  2E3T A;  4WJP A;  4RGN A;  2RR9 A;  3VHT C;  2ZCB A;  1N5X A;  4A55 A;  3QA8 A;  3ZXR A;  1PQS A;  2QEJ C;  1TZ1 A;  2RMM A;  4PS8 A;  2Z8L A;  1P7E A;  3WAL A;  1FXA A;  2M1M A;  3N1X C;  4DBG A;  1C3T A;  3TEZ A;  1WJU A;  2KWV B;  5CTR C;  4XDC A;  1WWT A;  1ZXH A;  3DBL B;  2NCN A;  3EC8 A;  1MFW A;  3VUW A;  4PS7 A;  3EUB 2;  1OTR B;  5J18 A;  3A9J B;  2KJR A;  3DHH C;  4W9H A;  3B08 A;  5TR5 A;  2Z0E B;  3PT2 B;  1V49 A;  3VH4 B;  2IYD B;  2AQ1 B;  2DYO A;  3MJ5 A;  1ZE3 D;  1YJI A;  2LRW A;  3VTV A;  2KQS A;  4ANX A;  1JCK B;  2IO3 B;  4WUR A;  2PE9 A;  2BS3 B;  1XLO A;  5C23 A;  3RZF A;  1P9D U;  4JPS A;  4F1S A;  5J2R A;  1QOB A;  2PTL A;  4EEW A;  1XCQ L;  1FNW A;  3H1U A;  2YVC A;  4A9A A;  3ZNH B;  2PJH A;  2MBQ A;  2RGF A;  1NBF C;  1JAL A;  4L1B A;  4N58 A;  3WIM A;  2J53 A;  4P1B C;  2KFK A;  4W9F A;  3AN1 A;  1UUP A;  3FKY A;  1DGJ A;  1V1O A;  2EKI A;  3RNG C;  3V3X A;  1L0X B;  1OEY J;  5KHQ A;  1C9F A;  2BPS A;  1N6Z A;  4NNJ B;  2SAK A;  1S1Q B;  2W82 A;  4K7W A;  2HTM E;  1KRH A;  1SGH A;  4KGS A;  1L4Z B;  4TMA B;  4A20 A;  5AUI A;  3OJ4 B;  3UQA A;  4HPM B;  1E0Z A;  1LO5 D;  4DWF A;  2ZW1 A;  4IC7 B;  1DOY A;  2C5L C;  1FMA D;  2QIL A;  1F0Z A;  3DVN U;  3BIN A;  1V6E A;  2ZNV C;  1BUI C;  2JPH A;  3UIN B;  3EEC A;  4ZHO A;  3K9P B;  1WYW B;  1ET6 A;  4LK0 M;  2KLG A;  2CHZ A;  2MA9 B;  2KX0 A;  2ZJD A;  2LVP A;  1SE9 A;  1JWU D;  2WXP A;  4FLH A;  4WWP A;  4M8M A;  2O2V B;  5HG2 A;  1XO3 A;  3SDL C;  4LLG M;  1QOF A;  3N20 C;  4C7Z A;  4II2 B;  4I6L B;  3U8Z A;  2L00 B;  4LNN A;  3R3M A;  3A9K A;  2MWS B;  2N9P C;  1UF0 A;  3AEB B;  3PO0 A;  1FNV A;  4MGK E;  2KXJ A;  3NVV A;  3NS8 A;  4FJV B;  1YQ3 B;  2REX A;  4PYZ A;  1VCB A;  4ANU A;  1Y8R C;  4GSW A;  4P7I A;  2AL3 A;  1ZXI A;  2I38 A;  2W9N A;  2Y3A A;  4LTU A;  1FXI A;  1E8Z A;  2HJ8 A;  2LJI A;  1GG3 A;  4LJP B;  4KZ0 A;  3Q8A A;  1VZ7 A;  2M4N A;  3VFK A;  2GI9 A;  2R2Q A;  1J7C A;  2BYE A;  3ZYY X;  3RNA C;  3JSV B;  3UIO B;  1WGR A;  4FUL A;  4ACF A;  2O6V A;  4ZHP A;  4TQ0 A;  2UU7 A;  1MPE A;  4AQ7 A;  3BYY B;  1YX6 B;  2J0K A;  2IGG A;  3ZNZ B;  2IZV B;  5D3I B;  5IP4 D;  1PYW D;  4MGI E;  2J7Q B;  1E7U A;  1JRU A;  1RYJ A;  4WJQ A;  1JRP A;  1QOA A;  1GPX A;  3IFW B;  1TS3 A;  4A3P A;  3MP9 A;  1L2N A;  3AE3 B;  5L95 C;  4W9C A;  3H9D A;  5BYQ A;  4ZRI A;  4ZRK A;  2LD9 A;  3AEG B;  3VRA B;  3H7P B;  2MLB A;  4HDO A;  3ZUN A;  4WWM A;  3U52 E;  3MTN B;  2BQQ A;  1TZO A;  2KX3 A;  2X8X X;  2WX0 A;  3QWZ B;  5D6J B;  2WXM A;  3KUD B;  4OHJ A;  3IXS A;  1EM7 A;  2K3U A;  3DWG C;  1WE7 A;  4R3D A;  1WXV A;  1VD2 A;  2I1K A; 
#chains in the Genus database with same CATH homology
 1N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...