1N6ZA

Solution nmr structure of protein yml108w from saccharomyces cerevisiae. a novel member of the split bab fold. northeast structural genomics consortium target yt601.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 12.3 kDa protein in ZDS2-URA5 intergenic region
publication title A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08987 DUF1892 Protein of unknown function (DUF1892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.250 Alpha Beta Roll Ubiquitin-like (UB roll) YML108W-like 1n6zA00
1N6ZA
chains in the Genus database with same CATH superfamily
3RMKC 1T0QC 2KWVB 4EFOA 4L2YA 1RAXA 3C8YA 4GDLB 2PKOA 2RSUA 5T8IA 2WWZA 4MGYE 2DYMA 3FC4A 3CF6E 3VH4B 5AUKA 1UBQA 2Y3AA 4L1BA 1TS5A 2N7EA 1QF6A 3ZLZA 4A3OA 2X8XX 3CMMB 3I3TB 1L0XB 1V97A 3P42A 3PS6A 1ZP0B 2I1JA 1YNTE 2QMTA 1JWBD 1OQQA 1YQBA 3WALA 5L95C 5BYRA 5AZGA 3EGRA 2IBIB 3NVWA 1V49A 2QDFA 4RGMA 3DBHI 3ENEA 2OOBB 1K53A 4KV2A 4LK0M 3DHHC 2N9KA 2LXAA 5EDSA 2LGSA 2D3GA 1T0RC 4HPLB 4F8CB 2ZW1A 4HDQA 3D32A 2LGYA 1MJDA 2ONQA 1ZPSA 4HJGE 2JXXA 2DNFA 1FCCC 2N1VA 1WFYA 5LXHA 3UGBB 3NOBA 4C56C 3I5JC 2WXNA 2LZ6A 1K8RB 1WIAA 1UUPA 3AN1A 3MFGA 4WJQA 5C23A 4IM3A 2PLPA 3ZKJC 2DAFA 4BKSA 1HTOA 2KX0A 2NVUI 2J0JA 1QILA 4WQMA 4MGIE 1JWSD 5GXGB 2WXPA 3MC8A 2KXJA 3AEEB 1WX8A 2IY1B 3H7SA 3KH0A 1H4RA 1LM8B 2Z0DB 4DXGA 4W9FA 2IO3B 1YN5A 3B08A 2HJ1A 2TSSA 3R8BA 3P63A 5IP4D 2Q5WD 4F1SA 2GOWA 2LMCA 5DPWA 2KN4A 3LB8C 4W9IA 2KT7A 2ZW0A 1CQVA 2PPHA 2DYBA 1GC7A 1V9JA 2N7JA 4K81A 2MBQA 4AQ7A 2G4DB 3W2DA 2M19A 1LFDA 4HJKA 4LLGM 4ZOHC 1WXMA 2AL3A 2C7NB 1RRBA 1MPEA 1T0SC 2KZRA 2WXHA 4FJYA 2KWCA 3QJZA 2KJHB 3SD5A 5GMVA 2O6VA 3R66C 2WXQA 3C19A 2K8HA 4FHJA 3V3XA 3O65B 5EE3A 1MHHE 1FFVA 3QAQA 4A8XC 2JRIB 3U8ZA 1HXYD 4KKIA 1KJTA 4HPMB 3A4RA 2HD5B 4XWTA 1F1HA 1TT5B 2QC8A 3N1XC 3NY5A 4EZJA 3IHPC 4W9KA 5JH5C 1GOZA 1HZ5A 3P4QB 2CU1A 1PYWD 1D3ZA 1C78A 2L0FA 3EFCA 1R4NB 4KGSA 3RUIB 1ZKHA 1FNWA 1PGBA 4DHZB 4S0RA 2AX5A 3HUIA 4DQOC 3QA8A 1C3TA 4NQLB 4FADA 4YSYB 3MC9A 3VQIA 4GIVA 1VD2A 1Q0WB 1YX5B 5CHVC 3ZJVA 3AE2B 2W82A 1WJNA 2E6XA 2LWPA 2IO0B 3ZDTA 1D6EC 3L13A 5FK9C 4FLHA 4N58A 3HK0A 3A1QA 1V5OA 2N9XA 3LDZE 2MX2A 5BYSA 1EF1A 1I4XA 1QOAA 5CHFA 4PYUA 4JPSA 1Z2MA 1WF9A 2V4IB 4GMVA 4KX6B 1KM7A 1KH0A 4PT5A 2LI5A 1B1ZA 4RFBA 3WAPA 3ABVB 4BKGA 2LUMA 4C80A 3RFZB 2KAJA 4M02A 4TSSA 5JXVA 1UGJA 1Q5WB 3P4PB 1KLUD 1XF5L 1FNVA 3HHMA 1IBXA 3H8HA 1DOYA 1S1QB 5E6JA 3AEAB 1VDVA 2WXOA 2BBCA 3Q14C 4BKSD 2KD0A 2L05A 4W9LA 1SF0A 3ZJUA 1OTRB 4IWQA 1NBFC 3MHSD 2XNAC 1EU3A 3KWVA 2WYQA 1KFYB 2JQRB 2LASA 1WY8A 3Q3NC 2N9PC 3Q8EA 2WP9B 1GAQB 2V3NA 3L08A 3SFEB 2JZPA 3U7ZA 3IFWB 4BFRA 4NQKE 3E56A 1XCQL 5D3IB 1TKGA 3OLMD 1WGGA 1FIQA 3GE3C 1UNSA 2CJOA 1OQYA 2NMQA 3TEYA 1KTKA 1DOIA 2HTME 3TBLD 4FJZA 3TCAA 3ZYYX 1XQQA 3AEGB 1UELA 2YEPF 3B2GA 1L4DB 4DXAB 3P4RB 2NBUA 2QIEB 4PS3A 1ZDVA 1GUAB 4MM3A 4MELA 2G3QB 4W9HA 3V62A 4WWMA 3ZRFA 3ZIMA 2BKRB 2WXGA 4EOYA 3KVFB 2O2VA 1L7YA 2MHJA 3L17A 1D4BA 4ANWA 4ZRQA 4RF1A 3GZNB 2M8SA 5KHQA 1UZXB 2L52A 1F9JA 4A9AA 2I1KA 3IVFA 3PTFC 2LXCA 4OHJA 1VZ8A 1WE6A 2Y5CA 3UIOB 1SJED 4DHJD 2JZZA 3W1SA 4B0MA 4M0WA 3EECA 2JUOA 4MH0E 3ZJTA 1EWCA 3ONSA 3VRAB 1J7CA 4MGKE 5HI1A 3MC0B 1YMHE 3RI7C 2K6DB 2KLCA 2MLBA 5IN7A 3TEXA 3ZXRA 1UGMA 4YL8A 3A33B 3B9JA 1JALA 2L3ZA 2BPSA 4IM0A 2MBHA 2LJIA 1SXTA 5AZFA 2IJ0A 3Q3FA 5FR3A 2N9LA 1D5XC 4P1CC 4KZCA 1SSNA 2NPTA 2XEWA 3DQVA 3A9KA 2WX1A 5H92C 2NR2A 3Q3OC 3ZNID 3APDA 3UQBA 3PT2B 1ESFA 2KWDA 5E6NA 2HJ8A 2UWQA 2DZIA 1I4PA 3ZUNA 5MPOA 4MSMB 1LXDA 5CX3A 3I9V1 4K1RB 4JIOU 2K5PA 2JVCA 3AULA 2AL6A 4XX5A 5TSSA 1ZUD2 3DWGC 1Q10A 3P1MA 4LNOA 2NTTA 3DBRB 1P7EA 1TBEA 2INPE 2MJDA 5EE9A 2QJLA 3WA0A 4WJNA 3H7PA 4CO7A 4REZA 2N0SB 1NYRA 1VZ7A 2L0TA 4J6IA 2O6VB 3NRZA 2CHXA 4KVGB 4WH4A 4DDID 2AQ1B 2OEDA 2V3PA 2KN5A 2KDIA 3KW5B 2L83A 3V6EB 3IBEA 2RDBC 5EE0A 2DZKA 4MGZE 2W55A 5BMGA 5HHDG 1XLQA 2MCNB 3DHIC 2INDC 2D10A 5IA7A 4ICVA 1DOXA 1WRDB 5DPSA 3KWLA 1FFUA 4A55A 1L6VA 1AYFA 3W1SC 1JWMD 3GP7A 1XCTL 2FUHB 2MWSB 2CR5A 2KK8A 2MP2A 3TEZA 1WX7A 2AWTA 3NZ3A 4UDUC 2KYWA 2KTRA 4N9F4 5H8YE 2LRWA 2BS2B 1SIJA 4KKJA 1VJKA 1WXAA 2K25A 2NBWB 2MEKA 2KNBA 3MJWA 2LGDA 4G3XB 2YVCA 3AEBB 2CU3A 3BYYB 1TJEA 2DAJA 4ZHPA 4FN2A 1VZ6A 3ZDMC 4P6VF 2JF5A 5DCNA 4NNJB 5BMHA 3Q8AA 4KIKA 2IO1B 1CZPA 2JSVX 4IUMB 4E71A 1SE2A 1I7HA 2VH1A 4US9A 3SU8X 3V61A 1E7UA 2KO3A 1WR1A 3Q8BA 3ZTCA 1Y56A 4RGOS 1E8WA 1I4RA 1K50A 4W9DA 3QK0A 1PGAA 2BYFA 3VUXA 1T6BX 3UI3A 2KX3A 1V5TA 1NVID 2LHDA 4N59A 5EE1A 1N62A 5BO4B 1V81A 2XBBC 1QOBA 3Q3MC 1IBXB 1HA5A 4WQOB 1ROEA 2WXKA 2PE9A 3L54A 3A9JA 5D7GA 2H88B 3RN9C 2FUG1 4OZCA 4KSKC 3VVWB 4EE2A 2J52A 4LJPB 3PGEA 4RGNA 4HCNB 1UF0A 1N5WA 4FA6A 4A6QA 2V1YA 3NHEB 3MTNB 4J3OD 3ZRCA 3ZGZA 3H9DA 2QSDA 2RPQA 1JW9D 2KC2A 1P0RA 3P2BA 3AU4A 4KGTA 3L16A 1WJUA 3UINB 3K9OB 3EC8A 1WM3A 2JWZA 2N9EB 3ZW3A 3HM6X 5D3DA 4URKA 2DHZA 5D6JB 2RMMA 2D5GA 3ZNGC 1QOFA 2FAZA 1AN8A 4ZRIA 2C7HA 3Q6BA 5BYQA 4FHKA 2GI9A 3DVGY 1R4NI 5TR5A 3NZUA 5J18A 4LDTD 2C9WB 4EZKA 4YSXB 2GLSA 1YX6B 4HKZE 2BS4B 4RM9A 5IKCM 1JQ4A 1KRHA 1FO4A 4A20A 2FCNA 3DDCB 1RLFA 2K6QA 1ET9A 1XLOA 3AE7B 4M8NA 4GGQA 2BYTA 2K8BA 1V2YA 3DHGC 3RZWC 3VTUA 1ZXHA 5IOIA 3PSEB 4JGHB 3U30A 2NS5A 1FNUA 1BMLC 3RNGC 1QKZA 2J4XA 2VRRB 4C4VA 4K3BA 1WZ0A 1BUIC 1TZ1A 5C2TB 5IAAC 3RNFC 5J2RA 3OJ4B 1R7SA 3PHXB 3PLVA 2O2VB 1C1YB 2ZZPB 3PLUA 2KJ6A 3DVGX 1RFKA 2ZVOA 2EMTA 5KHOA 2Z59B 4WWNA 3AE9B 2J42A 1LGRA 3SDLC 4M0WB 4OZAA 1YN4A 4BBNC 4K7WA 4M00A 2WXFA 3WAOA 3P4SB 4WAFA 5D94A 2LRUA 2ZNVC 2KKCA 2L8JA 1C76A 2DENB 2WHIA 4NAWA 1SJHD 2G45B 3VTVA 2SEBD 1WRIA 4NY0A 1UH6A 4MDKE 2L7RA 1X1MA 2D3CA 1EO6A 1WYWB 2AQ3B 2KFKA 1A5RA 3DBSA 3IT4B 4CQNA 2NPTB 2INCC 2WU5B 2V9HA 3ZXVA 3SHQA 3B2FA 4B0EA 2BTEA 1FEHA 3JSVA 5CHWA 2KOXA 2J0MA 2WU2B 1T3QA 2CJNA 2M1MA 4TUUA 3N3KB 4ARIA 3I57A 1WXSA 3M95A 3R2IA 3AEFB 1E10A 1JMLA 2FIDA 4AP4C 4JX1C 3WAMA 3I63C 2YLMA 4B6WA 3DVNU 4RF0A 1DYQA 2UU7A 2N1WA 2KACA 4LDTB 3OWEB 2LGXA 3V60A 2W3RA 1WH3A 3AV8A 3QHTA 1RYJA 2KJRA 2J0KA 4GLSC 3H7PB 1NDDA 1EF5A 1XO3A 3WANA 1IP9A 4HVBA 4BOSC 2PVGC 4KZ0A 1SGHA 5G5GA 2A4ZA 3U4EG 4IWPA 1V1PB 3BK1A 4IOIE 3NVYA 1MG4A 2KMAA 4DWFA 3NS1A 5HFYA 3SR6A 1UWMA 2JZ3B 1WE7A 3LJ3A 3FAHA 5E6OA 4DK5A 3T3NA 1TGZB 2L00B 3ZNHB 3BWUD 4PK1A 3RZFA 4TKNA 3R7RA 2IPKD 1C4AA 1N6ZA 1WSPA 1J0GA 4JE3B 2DYOA 4LJOB 2LGIA 4OVUA 1MI0A 3VAWA 1C4PA 4K3CA 3BVMA 3AEDB 3PREA 1WM2A 2M4NA 4LNNA 2HTHA 3TSSA 4ASWC 1Z5SB 2BWES 2KTRB 4ARCA 4LNIA 2J53A 4ZRJA 4WWOA 3C0RB 1EU4A 3AE8B 1L5PA 3N1YC 2BVCA 1YQ3B 2MA9B 2VZKD 2IO2B 1V1OA 4O1NA 3GOEA 1FXTB 2JXTA 1E7PB 1IYFA 1HE8A 4A90A 3IXSA 2WDRB 2W54A 2MBEA 1JRUA 3ML8A 2MBBB 1QZEA 2KANA 3NZSA 1N63A 5D2MB 1AW7A 2BW2A 2K0PA 1QOGA 2WGSA 2GBNA 3UIPB 4D2KA 2V0GA 4M01A 4EZLA 2BB6A 2ON8A 2ZEQA 4OVZA 4RGTA 1LO5D 3QCAA 4A3PA 3TIXA 2DBYA 3AU5A 2FCMA 1E6EB 5J17A 3E9SA 2WDQB 1PUTA 1WWTA 2I38A 2BT6A 4B9KA 2JWUA 1L0VB 4QAYA 5C3JB 1WX9A 1N61A 4YTPB 3CWIA 1J19A 2XK5A 3LXFA 1GJZA 3EHVA 2QHOA 1CK1A 5G55A 3DVNV 1WR6E 2W3SA 4K7UA 2JRHA 2KDFB 1HTQA 1QQRA 4YTMB 2RGFA 3IAM1 3DBRI 1HQRD 1V8CA 3VUYA 2FIFA 2GBMA 2C5LC 4C7ZA 1STEA 2ZNVB 2KQSA 1TKEA 5L83A 1WMHA 1JRPA 1FRRA 4NPNA 1YJIA 1KOTA 1SEBD 1TZOA 3DWMA 2JY6A 1MFWA 1PDXA 2K8CA 1XLNA 1D5MC 2MBOA 1MG8A 4G11A 2KC1A 2GBKA 2ACZB 2Y5PA 4HKQA 5AEKB 4IWOA 2B76B 2DLBA 3T8MA 5HG2A 2RD0A 3RT3B 1YQ4B 4OVVA 4GXBA 5C1ZA 1VCBA 2PTLA 1EM7A 1U4AA 4L23A 1TYGB 3H6NA 3N1ZC 4WAAA 1ISNA 3WCQA 1G6JA 2AEHA 4JLCA 2KLGA 1GC6A 2BYVE 3BZDB 4HEA1 1A70A 4F7ZA 1HEZE 4P7IA 5AZHA 1NI3A 5FR6A 3VXWA 2K3UA 1T5XD 5LXIB 3K9PB 2KMCA 3BK2A 3KUCB 2G1EA 1YN3A 3NJTA 4C4VB 1ACCA 4G0NB 4PS8A 3KYCD 4ITKA 2PVOD 1WGKA 2C7MB 3AE5B 2K9XA 2KFJA 3OAWA 1PQSA 3VTWA 4FULA 4S17A 1RFAA 4XYCA 4LCDE 2KDMA 4PS7A 1R4MB 1V80A 3OJ3A 2H89B 1TS2A 1AARA 2R2QA 1PGXA 2KQ4X 4BAXA 4XC2A 3BYTB 1WGRA 2MSED 3AI5A 2WS3B 3DBLB 3DPDA 4JQWC 3PRZA 3LYYA 2SAKA 4WURA 4AOFA 3PRMB 2ZCBA 4GN1A 1F77A 4IG7B 4I6LB 3VFKA 4DHJB 2G4SA 3EUB2 4NAWB 4KSLC 3Q8FA 4AJWA 2L1AA 3O13A 3BY4B 4ZYNA 1EUVB 3NVZA 2JYTA 4MJSA 3IG3A 1ENFA 2BB5A 4JWUC 1F0ZA 2X38A 2REXA 5JHAA 4MH8A 4XWWA 2L76A 3ZO5B 3VUWA 2DZMA 5I4DA 1E0ZA 4JWSC 1M94A 3MJ5A 3QARA 2MW5A 3A1QB 3VR8B 1BT0A 2RDHA 4E3CA 2FE8A 3ECIA 1QT9A 1WJ4A 4NJ7A 2WLBA 2NCNA 1M4VA 1IPGA 3QWZB 4MT5A 4TV3A 1KLGD 4HROA 4EEWA 1ET6A 4OZBA 4CHKA 3X0WA 4W9CA 3NVVA 3MP9A 1Y8RC 2G9HD 3ZNZB 4GB9A 2LHEA 1XEEA 3W5UB 2WNMA 3HRDD 4HCPB 2BWFA 3S2AA 4WWPA 3KYDD 4LNFA 1E90A 2KVRA 4FXCA 4C00A 1UBIA 4P16A 2V4LA 2EKEC 4X57B 3PHWB 2IY0B 3ALBA 2MQJA 1E8YA 4DHZE 4TMAB 3VDZA 1C77A 3ZQ4A 2M56B 2BGFA 2W9NA 3M63B 5JZEB 1P1AA 2CHZA 3PV1A 3TEWA 1E5WA 2ASQA 1TTNA 4GOCA 3UF8A 4E74A 2CHWA 2GRIA 2JT4B 3TMPB 1ZE3D 3CSFA 4HRSA 2KQ7A 2BQQA 2PE6B 4G50A 4XGAB 3TUOA 4BZAA 2QEJC 3BINA 3FILA 1V86A 2WXIA 4BOZB 3RULA 2KDEB 2FCSA 2QILA 2MJ3A 4ZYSA 3AE1B 5DPTA 2ZPYA 4ANUA 3URYA 2FNJB 4MSQB 3VH3B 1F2RI 2J7QB 3DBHB 4P1BC 3HVZA 3QQ8B 3VR9B 4IKGA 3A4SC 1ZOYB 1P98A 4MM3B 4GDKA 1FD6A 3RPFC 4OW0A 1BXTA 1B9RA 1NYQA 4KDIC 1I35A 2Z8LA 4XDDA 2EKIA 1OQRA 2GBJA 2HDEA 4I6NB 2V3SA 1QLBB 2XK5B 2WQYB 4CYEA 4ZRKA 2D07B 4BVUC 3J9CA 3SFDB 1WI0A 1I42A 2D3BA 1XT9B 3L4PA 1VLBA 4HLEA 3JVZX 4YSZB 1HZ6A 4TQ0A 2R61A 3NUHB 3V05A 2I2YA 1WMHB 3KQ4A 1YD8U 2D2QA 3AE4B 3ETRA 2JU6X 4HWIB 3RNCC 2A5UA 1JWUD 2PMVA 1SIFA 2EELA 1SB3C 2ICIA 1N5XA 4II2B 2K39A 1J7AA 3A9KB 3EFUA 2R2OA 2KWUB 3GS2A 2MH7A 2KDBA 2INNE 2ZCCA 4II3B 2IGHA 4H2AA 2WX0A 1FMAD 1IUEA 4FJVB 4GDLA 1SE9A 3ML9A 2M0AA 2Y5BB 4ICUA 2XN9C 4YTNB 1P9DU 3PRPB 3M3JA 1UD7A 4ACFA 1K52A 4B95A 2YEPB 3U2SC 3QX1A 2BS3B 3BVZA 2IGDA 3DOWA 2HE7A 1KF6B 1VRAB 5G2NA 3UQAA 1K51A 1TS4A 3BIID 2C60A 3APCA 4C7YA 3HM3A 3N9YC 5AUIA 1NENB 3T3OA 3OG5A 4USAA 1CMXB 3W5VB 2NBVB 3R2TA 3Q69A 4DBGA 1RM6C 4IDIA 3U52E 3GB1A 2ZVNA 1XLPA 4WJPA 4RH6A 1ZDXA 1S3SG 4RCOA 4R3DA 2IDYA 2WDTB 3AM9A 1C79A 2CKHB 1WGDA 3KUZA 3L10B 3B1LX 2LEKA 1GG3A 4DXFA 2WXMA 1J7BA 3EA6A 1GB4A 1H8CA 2UYZB 4BKTA 2FBWB 2AYOB 1KLVA 2MP2B 3L0WB 1MVKA 3PZDA 3HIZA 4KDLB 2FCQA 3V6CB 3GZNI 4HDOA 3B0AA 3PPAA 4ZHOA 5BMIA 1WYGA 1OEYJ 4PYZA 4MJSB 1GB1A 3PO0A 1TS3A 2PW9A 5CTRC 1P3QU 1CJEA 3GE8C 4AUQC 2OJWA 2LVPA 2ZPNA 2WXLA 4Q2JA 3KLSX 1JROA 4I6PA 1FXAA 3ZTDA 2K22A 3H1UA 1E8XA 4EKUA 1E9MA 2WXJA 4GSWA 2VH2A 3RD2A 1YIWA 3X23A 1J8CA 2NTSA 2PJHA 4KIKB 1D5ZC 3DCGA 4ZDVA 1I4GA 3R7QA 4HPPA 2IGGA 1JWAD 4NJ6A 4HK2A 3W1YA 2M17A 1JCKB 3PZ7A 1WXVA 3PVLA 2BKFA 1IGCA 2LUEA 2O6VD 4XZ4A 3TJPA 3NG0A 4NAMA 3VRBB 2GBRA 4ZRPA 1T0YA 1WZ3A 2D11A 3Q2AC 4RNAA 3WIMA 4MEMA 4LNKA 3QIJA 4US8A 3AXCA 4YXDB 2L32A 4LTUA 3CSTA 4DDGD 4AWJA 4W9EA 1YJ1A 2M0XA 3R3MA 4TQ1A 3AMZA 1E8ZA 3ZVVA 1TY0A 3A9JB 5FKAC 2KMMA 1VR9A 5JHBA 1OGWA 4WJOA 4AS1A 1E7VA 4N6EB 1RWSA 5LLIA 2PEAA 1ZXIA 2GB1A 1LQBA 2MRPA 1C4CA 1IGDA 1AWDA 1N60A 4WIPA 3RYTA 3M62B 4EUTA 3JW0X 1I4HA 2D3AA 4ANVA 2N4FA 1TKYA 2KTFA 2OJRA 2WDVB 1R4MI 2N7DA 4IW0A 2E3TA 3QC8B 5DPRA 2BF8B 2Z0EB 1L4ZB 3N30A 1NEKB 2KVZA 1SBBB 1L0YB 2IZVB 2RDGA 3DBLI 3Q8CA 4XDCA 1L2NA 2DWQA 3RNBC 4NJCA 2PIAA 2AQ2B 3FILB 1FM0D 2KHWB 4IM2A 2VZKB 2WXRA 3N20C 3AH7A 3HVDA 3CIRB 3VHTC 1XXGA 1V6EA 4K7SA 4YWGG 4YT0B 1WXQA 4AJYB 1YJJA 3AB5A 5IO9A 4GDKB 1WJ6A 1GNUA 2LVOA 4M8MA 1NI2A 1TY2A 2LJ5A 1ZW7A 5G5HA 2MJEA 4W9JA 3SEBA 4XE0A 4IC7B 2ZJDA 4MACA 1GPXA 3APFA 2IYDB 2GMIC 1PFDA 1C9FA 1Q1OA 1FPYA 3T9LA 1P7FA 1F52A 2LVQA 3RNAC 4GU2A 1SE3A 4JL9A 1L6UA 3FKYA 1MHXA 1YOVB 5LNK1 3PZ8A 3RNEC 4W9GA 2JX5A 2BYEA 2DZJA 1V1PA 2JPHA 5E6PA 2OHFA 2RPVA 3IT6B 1DGJA 1XD3B 3IAS1 4BBNF 1WGHA 2DX5B 3NS8A 1ZGUB 3N32A 3MHZA 4RMAA 1OFFA 2RR9A 3Q3JA 3JYUA 4KGRA 1FXIA 2EMSA 1EWYC 3BVGA 3RCZA 2K1FA 4NZLB 2JYEA 3W9CB 2B3AA 2KFKB 5HKHA 4HXDA 2LFIA 4RM8A 1WGYA 1SE4A 4FBJB 2CS4A 3AE3B 2LD9A 3TL5A 1OEYA 1FCLA 1I4QA 1UWXA 1F2RC 1FRDA 1TIFA 2QCZA 3AE6B 3JSVB 4ANXA 3KUDB 3U7DA 3AECB
chains in the Genus database with same CATH topology
1N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6Z A; 
#chains in the Genus database with same CATH topology
 3RMK C;  1T0Q C;  2KWV B;  4EFO A;  4L2Y A;  1RAX A;  3C8Y A;  4GDL B;  2PKO A;  2RSU A;  5T8I A;  2WWZ A;  4MGY E;  2DYM A;  3FC4 A;  3CF6 E;  3VH4 B;  5AUK A;  1UBQ A;  2Y3A A;  4L1B A;  1TS5 A;  2N7E A;  1QF6 A;  3ZLZ A;  4A3O A;  2X8X X;  3CMM B;  3I3T B;  1L0X B;  1V97 A;  3P42 A;  3PS6 A;  1ZP0 B;  2I1J A;  1YNT E;  2QMT A;  1JWB D;  1OQQ A;  1YQB A;  3WAL A;  5L95 C;  5BYR A;  5AZG A;  3EGR A;  2IBI B;  3NVW A;  1V49 A;  2QDF A;  4RGM A;  3DBH I;  3ENE A;  2OOB B;  1K53 A;  4KV2 A;  4LK0 M;  3DHH C;  2N9K A;  2LXA A;  5EDS A;  2LGS A;  2D3G A;  1T0R C;  4HPL B;  4F8C B;  2ZW1 A;  4HDQ A;  3D32 A;  2LGY A;  1MJD A;  2ONQ A;  1ZPS A;  4HJG E;  2JXX A;  2DNF A;  1FCC C;  2N1V A;  1WFY A;  5LXH A;  3UGB B;  3NOB A;  4C56 C;  3I5J C;  2WXN A;  2LZ6 A;  1K8R B;  1WIA A;  1UUP A;  3AN1 A;  3MFG A;  4WJQ A;  5C23 A;  4IM3 A;  2PLP A;  3ZKJ C;  2DAF A;  4BKS A;  1HTO A;  2KX0 A;  2NVU I;  2J0J A;  1QIL A;  4WQM A;  4MGI E;  1JWS D;  5GXG B;  2WXP A;  3MC8 A;  2KXJ A;  3AEE B;  1WX8 A;  2IY1 B;  3H7S A;  3KH0 A;  1H4R A;  1LM8 B;  2Z0D B;  4DXG A;  4W9F A;  2IO3 B;  1YN5 A;  3B08 A;  2HJ1 A;  2TSS A;  3R8B A;  3P63 A;  5IP4 D;  2Q5W D;  4F1S A;  2GOW A;  2LMC A;  5DPW A;  2KN4 A;  3LB8 C;  4W9I A;  2KT7 A;  2ZW0 A;  1CQV A;  2PPH A;  2DYB A;  1GC7 A;  1V9J A;  2N7J A;  4K81 A;  2MBQ A;  4AQ7 A;  2G4D B;  3W2D A;  2M19 A;  1LFD A;  4HJK A;  4LLG M;  4ZOH C;  1WXM A;  2AL3 A;  2C7N B;  1RRB A;  1MPE A;  1T0S C;  2KZR A;  2WXH A;  4FJY A;  2KWC A;  3QJZ A;  2KJH B;  3SD5 A;  5GMV A;  2O6V A;  3R66 C;  2WXQ A;  3C19 A;  2K8H A;  4FHJ A;  3V3X A;  3O65 B;  5EE3 A;  1MHH E;  1FFV A;  3QAQ A;  4A8X C;  2JRI B;  3U8Z A;  1HXY D;  4KKI A;  1KJT A;  4HPM B;  3A4R A;  2HD5 B;  4XWT A;  1F1H A;  1TT5 B;  2QC8 A;  3N1X C;  3NY5 A;  4EZJ A;  3IHP C;  4W9K A;  5JH5 C;  1GOZ A;  1HZ5 A;  3P4Q B;  2CU1 A;  1PYW D;  1D3Z A;  1C78 A;  2L0F A;  3EFC A;  1R4N B;  4KGS A;  3RUI B;  1ZKH A;  1FNW A;  1PGB A;  4DHZ B;  4S0R A;  2AX5 A;  3HUI A;  4DQO C;  3QA8 A;  1C3T A;  4NQL B;  4FAD A;  4YSY B;  3MC9 A;  3VQI A;  4GIV A;  1VD2 A;  1Q0W B;  1YX5 B;  5CHV C;  3ZJV A;  3AE2 B;  2W82 A;  1WJN A;  2E6X A;  2LWP A;  2IO0 B;  3ZDT A;  1D6E C;  3L13 A;  5FK9 C;  4FLH A;  4N58 A;  3HK0 A;  3A1Q A;  1V5O A;  2N9X A;  3LDZ E;  2MX2 A;  5BYS A;  1EF1 A;  1I4X A;  1QOA A;  5CHF A;  4PYU A;  4JPS A;  1Z2M A;  1WF9 A;  2V4I B;  4GMV A;  4KX6 B;  1KM7 A;  1KH0 A;  4PT5 A;  2LI5 A;  1B1Z A;  4RFB A;  3WAP A;  3ABV B;  4BKG A;  2LUM A;  4C80 A;  3RFZ B;  2KAJ A;  4M02 A;  4TSS A;  5JXV A;  1UGJ A;  1Q5W B;  3P4P B;  1KLU D;  1XF5 L;  1FNV A;  3HHM A;  1IBX A;  3H8H A;  1DOY A;  1S1Q B;  5E6J A;  3AEA B;  1VDV A;  2WXO A;  2BBC A;  3Q14 C;  4BKS D;  2KD0 A;  2L05 A;  4W9L A;  1SF0 A;  3ZJU A;  1OTR B;  4IWQ A;  1NBF C;  3MHS D;  2XNA C;  1EU3 A;  3KWV A;  2WYQ A;  1KFY B;  2JQR B;  2LAS A;  1WY8 A;  3Q3N C;  2N9P C;  3Q8E A;  2WP9 B;  1GAQ B;  2V3N A;  3L08 A;  3SFE B;  2JZP A;  3U7Z A;  3IFW B;  4BFR A;  4NQK E;  3E56 A;  1XCQ L;  5D3I B;  1TKG A;  3OLM D;  1WGG A;  1FIQ A;  3GE3 C;  1UNS A;  2CJO A;  1OQY A;  2NMQ A;  3TEY A;  1KTK A;  1DOI A;  2HTM E;  3TBL D;  4FJZ A;  3TCA A;  3ZYY X;  1XQQ A;  3AEG B;  1UEL A;  2YEP F;  3B2G A;  1L4D B;  4DXA B;  3P4R B;  2NBU A;  2QIE B;  4PS3 A;  1ZDV A;  1GUA B;  4MM3 A;  4MEL A;  2G3Q B;  4W9H A;  3V62 A;  4WWM A;  3ZRF A;  3ZIM A;  2BKR B;  2WXG A;  4EOY A;  3KVF B;  2O2V A;  1L7Y A;  2MHJ A;  3L17 A;  1D4B A;  4ANW A;  4ZRQ A;  4RF1 A;  3GZN B;  2M8S A;  5KHQ A;  1UZX B;  2L52 A;  1F9J A;  4A9A A;  2I1K A;  3IVF A;  3PTF C;  2LXC A;  4OHJ A;  1VZ8 A;  1WE6 A;  2Y5C A;  3UIO B;  1SJE D;  4DHJ D;  2JZZ A;  3W1S A;  4B0M A;  4M0W A;  3EEC A;  2JUO A;  4MH0 E;  3ZJT A;  1EWC A;  3ONS A;  3VRA B;  1J7C A;  4MGK E;  5HI1 A;  3MC0 B;  1YMH E;  3RI7 C;  2K6D B;  2KLC A;  2MLB A;  5IN7 A;  3TEX A;  3ZXR A;  1UGM A;  4YL8 A;  3A33 B;  3B9J A;  1JAL A;  2L3Z A;  2BPS A;  4IM0 A;  2MBH A;  2LJI A;  1SXT A;  5AZF A;  2IJ0 A;  3Q3F A;  5FR3 A;  2N9L A;  1D5X C;  4P1C C;  4KZC A;  1SSN A;  2NPT A;  2XEW A;  3DQV A;  3A9K A;  2WX1 A;  5H92 C;  2NR2 A;  3Q3O C;  3ZNI D;  3APD A;  3UQB A;  3PT2 B;  1ESF A;  2KWD A;  5E6N A;  2HJ8 A;  2UWQ A;  2DZI A;  1I4P A;  3ZUN A;  5MPO A;  4MSM B;  1LXD A;  5CX3 A;  3I9V 1;  4K1R B;  4JIO U;  2K5P A;  2JVC A;  3AUL A;  2AL6 A;  4XX5 A;  5TSS A;  1ZUD 2;  3DWG C;  1Q10 A;  3P1M A;  4LNO A;  2NTT A;  3DBR B;  1P7E A;  1TBE A;  2INP E;  2MJD A;  5EE9 A;  2QJL A;  3WA0 A;  4WJN A;  3H7P A;  4CO7 A;  4REZ A;  2N0S B;  1NYR A;  1VZ7 A;  2L0T A;  4J6I A;  2O6V B;  3NRZ A;  2CHX A;  4KVG B;  4WH4 A;  4DDI D;  2AQ1 B;  2OED A;  2V3P A;  2KN5 A;  2KDI A;  3KW5 B;  2L83 A;  3V6E B;  3IBE A;  2RDB C;  5EE0 A;  2DZK A;  4MGZ E;  2W55 A;  5BMG A;  5HHD G;  1XLQ A;  2MCN B;  3DHI C;  2IND C;  2D10 A;  5IA7 A;  4ICV A;  1DOX A;  1WRD B;  5DPS A;  3KWL A;  1FFU A;  4A55 A;  1L6V A;  1AYF A;  3W1S C;  1JWM D;  3GP7 A;  1XCT L;  2FUH B;  2MWS B;  2CR5 A;  2KK8 A;  2MP2 A;  3TEZ A;  1WX7 A;  2AWT A;  3NZ3 A;  4UDU C;  2KYW A;  2KTR A;  4N9F 4;  5H8Y E;  2LRW A;  2BS2 B;  1SIJ A;  4KKJ A;  1VJK A;  1WXA A;  2K25 A;  2NBW B;  2MEK A;  2KNB A;  3MJW A;  2LGD A;  4G3X B;  2YVC A;  3AEB B;  2CU3 A;  3BYY B;  1TJE A;  2DAJ A;  4ZHP A;  4FN2 A;  1VZ6 A;  3ZDM C;  4P6V F;  2JF5 A;  5DCN A;  4NNJ B;  5BMH A;  3Q8A A;  4KIK A;  2IO1 B;  1CZP A;  2JSV X;  4IUM B;  4E71 A;  1SE2 A;  1I7H A;  2VH1 A;  4US9 A;  3SU8 X;  3V61 A;  1E7U A;  2KO3 A;  1WR1 A;  3Q8B A;  3ZTC A;  1Y56 A;  4RGO S;  1E8W A;  1I4R A;  1K50 A;  4W9D A;  3QK0 A;  1PGA A;  2BYF A;  3VUX A;  1T6B X;  3UI3 A;  2KX3 A;  1V5T A;  1NVI D;  2LHD A;  4N59 A;  5EE1 A;  1N62 A;  5BO4 B;  1V81 A;  2XBB C;  1QOB A;  3Q3M C;  1IBX B;  1HA5 A;  4WQO B;  1ROE A;  2WXK A;  2PE9 A;  3L54 A;  3A9J A;  5D7G A;  2H88 B;  3RN9 C;  2FUG 1;  4OZC A;  4KSK C;  3VVW B;  4EE2 A;  2J52 A;  4LJP B;  3PGE A;  4RGN A;  4HCN B;  1UF0 A;  1N5W A;  4FA6 A;  4A6Q A;  2V1Y A;  3NHE B;  3MTN B;  4J3O D;  3ZRC A;  3ZGZ A;  3H9D A;  2QSD A;  2RPQ A;  1JW9 D;  2KC2 A;  1P0R A;  3P2B A;  3AU4 A;  4KGT A;  3L16 A;  1WJU A;  3UIN B;  3K9O B;  3EC8 A;  1WM3 A;  2JWZ A;  2N9E B;  3ZW3 A;  3HM6 X;  5D3D A;  4URK A;  2DHZ A;  5D6J B;  2RMM A;  2D5G A;  3ZNG C;  1QOF A;  2FAZ A;  1AN8 A;  4ZRI A;  2C7H A;  3Q6B A;  5BYQ A;  4FHK A;  2GI9 A;  3DVG Y;  1R4N I;  5TR5 A;  3NZU A;  5J18 A;  4LDT D;  2C9W B;  4EZK A;  4YSX B;  2GLS A;  1YX6 B;  4HKZ E;  2BS4 B;  4RM9 A;  5IKC M;  1JQ4 A;  1KRH A;  1FO4 A;  4A20 A;  2FCN A;  3DDC B;  1RLF A;  2K6Q A;  1ET9 A;  1XLO A;  3AE7 B;  4M8N A;  4GGQ A;  2BYT A;  2K8B A;  1V2Y A;  3DHG C;  3RZW C;  3VTU A;  1ZXH A;  5IOI A;  3PSE B;  4JGH B;  3U30 A;  2NS5 A;  1FNU A;  1BML C;  3RNG C;  1QKZ A;  2J4X A;  2VRR B;  4C4V A;  4K3B A;  1WZ0 A;  1BUI C;  1TZ1 A;  5C2T B;  5IAA C;  3RNF C;  5J2R A;  3OJ4 B;  1R7S A;  3PHX B;  3PLV A;  2O2V B;  1C1Y B;  2ZZP B;  3PLU A;  2KJ6 A;  3DVG X;  1RFK A;  2ZVO A;  2EMT A;  5KHO A;  2Z59 B;  4WWN A;  3AE9 B;  2J42 A;  1LGR A;  3SDL C;  4M0W B;  4OZA A;  1YN4 A;  4BBN C;  4K7W A;  4M00 A;  2WXF A;  3WAO A;  3P4S B;  4WAF A;  5D94 A;  2LRU A;  2ZNV C;  2KKC A;  2L8J A;  1C76 A;  2DEN B;  2WHI A;  4NAW A;  1SJH D;  2G45 B;  3VTV A;  2SEB D;  1WRI A;  4NY0 A;  1UH6 A;  4MDK E;  2L7R A;  1X1M A;  2D3C A;  1EO6 A;  1WYW B;  2AQ3 B;  2KFK A;  1A5R A;  3DBS A;  3IT4 B;  4CQN A;  2NPT B;  2INC C;  2WU5 B;  2V9H A;  3ZXV A;  3SHQ A;  3B2F A;  4B0E A;  2BTE A;  1FEH A;  3JSV A;  5CHW A;  2KOX A;  2J0M A;  2WU2 B;  1T3Q A;  2CJN A;  2M1M A;  4TUU A;  3N3K B;  4ARI A;  3I57 A;  1WXS A;  3M95 A;  3R2I A;  3AEF B;  1E10 A;  1JML A;  2FID A;  4AP4 C;  4JX1 C;  3WAM A;  3I63 C;  2YLM A;  4B6W A;  3DVN U;  4RF0 A;  1DYQ A;  2UU7 A;  2N1W A;  2KAC A;  4LDT B;  3OWE B;  2LGX A;  3V60 A;  2W3R A;  1WH3 A;  3AV8 A;  3QHT A;  1RYJ A;  2KJR A;  2J0K A;  4GLS C;  3H7P B;  1NDD A;  1EF5 A;  1XO3 A;  3WAN A;  1IP9 A;  4HVB A;  4BOS C;  2PVG C;  4KZ0 A;  1SGH A;  5G5G A;  2A4Z A;  3U4E G;  4IWP A;  1V1P B;  3BK1 A;  4IOI E;  3NVY A;  1MG4 A;  2KMA A;  4DWF A;  3NS1 A;  5HFY A;  3SR6 A;  1UWM A;  2JZ3 B;  1WE7 A;  3LJ3 A;  3FAH A;  5E6O A;  4DK5 A;  3T3N A;  1TGZ B;  2L00 B;  3ZNH B;  3BWU D;  4PK1 A;  3RZF A;  4TKN A;  3R7R A;  2IPK D;  1C4A A;  1N6Z A;  1WSP A;  1J0G A;  4JE3 B;  2DYO A;  4LJO B;  2LGI A;  4OVU A;  1MI0 A;  3VAW A;  1C4P A;  4K3C A;  3BVM A;  3AED B;  3PRE A;  1WM2 A;  2M4N A;  4LNN A;  2HTH A;  3TSS A;  4ASW C;  1Z5S B;  2BWE S;  2KTR B;  4ARC A;  4LNI A;  2J53 A;  4ZRJ A;  4WWO A;  3C0R B;  1EU4 A;  3AE8 B;  1L5P A;  3N1Y C;  2BVC A;  1YQ3 B;  2MA9 B;  2VZK D;  2IO2 B;  1V1O A;  4O1N A;  3GOE A;  1FXT B;  2JXT A;  1E7P B;  1IYF A;  1HE8 A;  4A90 A;  3IXS A;  2WDR B;  2W54 A;  2MBE A;  1JRU A;  3ML8 A;  2MBB B;  1QZE A;  2KAN A;  3NZS A;  1N63 A;  5D2M B;  1AW7 A;  2BW2 A;  2K0P A;  1QOG A;  2WGS A;  2GBN A;  3UIP B;  4D2K A;  2V0G A;  4M01 A;  4EZL A;  2BB6 A;  2ON8 A;  2ZEQ A;  4OVZ A;  4RGT A;  1LO5 D;  3QCA A;  4A3P A;  3TIX A;  2DBY A;  3AU5 A;  2FCM A;  1E6E B;  5J17 A;  3E9S A;  2WDQ B;  1PUT A;  1WWT A;  2I38 A;  2BT6 A;  4B9K A;  2JWU A;  1L0V B;  4QAY A;  5C3J B;  1WX9 A;  1N61 A;  4YTP B;  3CWI A;  1J19 A;  2XK5 A;  3LXF A;  1GJZ A;  3EHV A;  2QHO A;  1CK1 A;  5G55 A;  3DVN V;  1WR6 E;  2W3S A;  4K7U A;  2JRH A;  2KDF B;  1HTQ A;  1QQR A;  4YTM B;  2RGF A;  3IAM 1;  3DBR I;  1HQR D;  1V8C A;  3VUY A;  2FIF A;  2GBM A;  2C5L C;  4C7Z A;  1STE A;  2ZNV B;  2KQS A;  1TKE A;  5L83 A;  1WMH A;  1JRP A;  1FRR A;  4NPN A;  1YJI A;  1KOT A;  1SEB D;  1TZO A;  3DWM A;  2JY6 A;  1MFW A;  1PDX A;  2K8C A;  1XLN A;  1D5M C;  2MBO A;  1MG8 A;  4G11 A;  2KC1 A;  2GBK A;  2ACZ B;  2Y5P A;  4HKQ A;  5AEK B;  4IWO A;  2B76 B;  2DLB A;  3T8M A;  5HG2 A;  2RD0 A;  3RT3 B;  1YQ4 B;  4OVV A;  4GXB A;  5C1Z A;  1VCB A;  2PTL A;  1EM7 A;  1U4A A;  4L23 A;  1TYG B;  3H6N A;  3N1Z C;  4WAA A;  1ISN A;  3WCQ A;  1G6J A;  2AEH A;  4JLC A;  2KLG A;  1GC6 A;  2BYV E;  3BZD B;  4HEA 1;  1A70 A;  4F7Z A;  1HEZ E;  4P7I A;  5AZH A;  1NI3 A;  5FR6 A;  3VXW A;  2K3U A;  1T5X D;  5LXI B;  3K9P B;  2KMC A;  3BK2 A;  3KUC B;  2G1E A;  1YN3 A;  3NJT A;  4C4V B;  1ACC A;  4G0N B;  4PS8 A;  3KYC D;  4ITK A;  2PVO D;  1WGK A;  2C7M B;  3AE5 B;  2K9X A;  2KFJ A;  3OAW A;  1PQS A;  3VTW A;  4FUL A;  4S17 A;  1RFA A;  4XYC A;  4LCD E;  2KDM A;  4PS7 A;  1R4M B;  1V80 A;  3OJ3 A;  2H89 B;  1TS2 A;  1AAR A;  2R2Q A;  1PGX A;  2KQ4 X;  4BAX A;  4XC2 A;  3BYT B;  1WGR A;  2MSE D;  3AI5 A;  2WS3 B;  3DBL B;  3DPD A;  4JQW C;  3PRZ A;  3LYY A;  2SAK A;  4WUR A;  4AOF A;  3PRM B;  2ZCB A;  4GN1 A;  1F77 A;  4IG7 B;  4I6L B;  3VFK A;  4DHJ B;  2G4S A;  3EUB 2;  4NAW B;  4KSL C;  3Q8F A;  4AJW A;  2L1A A;  3O13 A;  3BY4 B;  4ZYN A;  1EUV B;  3NVZ A;  2JYT A;  4MJS A;  3IG3 A;  1ENF A;  2BB5 A;  4JWU C;  1F0Z A;  2X38 A;  2REX A;  5JHA A;  4MH8 A;  4XWW A;  2L76 A;  3ZO5 B;  3VUW A;  2DZM A;  5I4D A;  1E0Z A;  4JWS C;  1M94 A;  3MJ5 A;  3QAR A;  2MW5 A;  3A1Q B;  3VR8 B;  1BT0 A;  2RDH A;  4E3C A;  2FE8 A;  3ECI A;  1QT9 A;  1WJ4 A;  4NJ7 A;  2WLB A;  2NCN A;  1M4V A;  1IPG A;  3QWZ B;  4MT5 A;  4TV3 A;  1KLG D;  4HRO A;  4EEW A;  1ET6 A;  4OZB A;  4CHK A;  3X0W A;  4W9C A;  3NVV A;  3MP9 A;  1Y8R C;  2G9H D;  3ZNZ B;  4GB9 A;  2LHE A;  1XEE A;  3W5U B;  2WNM A;  3HRD D;  4HCP B;  2BWF A;  3S2A A;  4WWP A;  3KYD D;  4LNF A;  1E90 A;  2KVR A;  4FXC A;  4C00 A;  1UBI A;  4P16 A;  2V4L A;  2EKE C;  4X57 B;  3PHW B;  2IY0 B;  3ALB A;  2MQJ A;  1E8Y A;  4DHZ E;  4TMA B;  3VDZ A;  1C77 A;  3ZQ4 A;  2M56 B;  2BGF A;  2W9N A;  3M63 B;  5JZE B;  1P1A A;  2CHZ A;  3PV1 A;  3TEW A;  1E5W A;  2ASQ A;  1TTN A;  4GOC A;  3UF8 A;  4E74 A;  2CHW A;  2GRI A;  2JT4 B;  3TMP B;  1ZE3 D;  3CSF A;  4HRS A;  2KQ7 A;  2BQQ A;  2PE6 B;  4G50 A;  4XGA B;  3TUO A;  4BZA A;  2QEJ C;  3BIN A;  3FIL A;  1V86 A;  2WXI A;  4BOZ B;  3RUL A;  2KDE B;  2FCS A;  2QIL A;  2MJ3 A;  4ZYS A;  3AE1 B;  5DPT A;  2ZPY A;  4ANU A;  3URY A;  2FNJ B;  4MSQ B;  3VH3 B;  1F2R I;  2J7Q B;  3DBH B;  4P1B C;  3HVZ A;  3QQ8 B;  3VR9 B;  4IKG A;  3A4S C;  1ZOY B;  1P98 A;  4MM3 B;  4GDK A;  1FD6 A;  3RPF C;  4OW0 A;  1BXT A;  1B9R A;  1NYQ A;  4KDI C;  1I35 A;  2Z8L A;  4XDD A;  2EKI A;  1OQR A;  2GBJ A;  2HDE A;  4I6N B;  2V3S A;  1QLB B;  2XK5 B;  2WQY B;  4CYE A;  4ZRK A;  2D07 B;  4BVU C;  3J9C A;  3SFD B;  1WI0 A;  1I42 A;  2D3B A;  1XT9 B;  3L4P A;  1VLB A;  4HLE A;  3JVZ X;  4YSZ B;  1HZ6 A;  4TQ0 A;  2R61 A;  3NUH B;  3V05 A;  2I2Y A;  1WMH B;  3KQ4 A;  1YD8 U;  2D2Q A;  3AE4 B;  3ETR A;  2JU6 X;  4HWI B;  3RNC C;  2A5U A;  1JWU D;  2PMV A;  1SIF A;  2EEL A;  1SB3 C;  2ICI A;  1N5X A;  4II2 B;  2K39 A;  1J7A A;  3A9K B;  3EFU A;  2R2O A;  2KWU B;  3GS2 A;  2MH7 A;  2KDB A;  2INN E;  2ZCC A;  4II3 B;  2IGH A;  4H2A A;  2WX0 A;  1FMA D;  1IUE A;  4FJV B;  4GDL A;  1SE9 A;  3ML9 A;  2M0A A;  2Y5B B;  4ICU A;  2XN9 C;  4YTN B;  1P9D U;  3PRP B;  3M3J A;  1UD7 A;  4ACF A;  1K52 A;  4B95 A;  2YEP B;  3U2S C;  3QX1 A;  2BS3 B;  3BVZ A;  2IGD A;  3DOW A;  2HE7 A;  1KF6 B;  1VRA B;  5G2N A;  3UQA A;  1K51 A;  1TS4 A;  3BII D;  2C60 A;  3APC A;  4C7Y A;  3HM3 A;  3N9Y C;  5AUI A;  1NEN B;  3T3O A;  3OG5 A;  4USA A;  1CMX B;  3W5V B;  2NBV B;  3R2T A;  3Q69 A;  4DBG A;  1RM6 C;  4IDI A;  3U52 E;  3GB1 A;  2ZVN A;  1XLP A;  4WJP A;  4RH6 A;  1ZDX A;  1S3S G;  4RCO A;  4R3D A;  2IDY A;  2WDT B;  3AM9 A;  1C79 A;  2CKH B;  1WGD A;  3KUZ A;  3L10 B;  3B1L X;  2LEK A;  1GG3 A;  4DXF A;  2WXM A;  1J7B A;  3EA6 A;  1GB4 A;  1H8C A;  2UYZ B;  4BKT A;  2FBW B;  2AYO B;  1KLV A;  2MP2 B;  3L0W B;  1MVK A;  3PZD A;  3HIZ A;  4KDL B;  2FCQ A;  3V6C B;  3GZN I;  4HDO A;  3B0A A;  3PPA A;  4ZHO A;  5BMI A;  1WYG A;  1OEY J;  4PYZ A;  4MJS B;  1GB1 A;  3PO0 A;  1TS3 A;  2PW9 A;  5CTR C;  1P3Q U;  1CJE A;  3GE8 C;  4AUQ C;  2OJW A;  2LVP A;  2ZPN A;  2WXL A;  4Q2J A;  3KLS X;  1JRO A;  4I6P A;  1FXA A;  3ZTD A;  2K22 A;  3H1U A;  1E8X A;  4EKU A;  1E9M A;  2WXJ A;  4GSW A;  2VH2 A;  3RD2 A;  1YIW A;  3X23 A;  1J8C A;  2NTS A;  2PJH A;  4KIK B;  1D5Z C;  3DCG A;  4ZDV A;  1I4G A;  3R7Q A;  4HPP A;  2IGG A;  1JWA D;  4NJ6 A;  4HK2 A;  3W1Y A;  2M17 A;  1JCK B;  3PZ7 A;  1WXV A;  3PVL A;  2BKF A;  1IGC A;  2LUE A;  2O6V D;  4XZ4 A;  3TJP A;  3NG0 A;  4NAM A;  3VRB B;  2GBR A;  4ZRP A;  1T0Y A;  1WZ3 A;  2D11 A;  3Q2A C;  4RNA A;  3WIM A;  4MEM A;  4LNK A;  3QIJ A;  4US8 A;  3AXC A;  4YXD B;  2L32 A;  4LTU A;  3CST A;  4DDG D;  4AWJ A;  4W9E A;  1YJ1 A;  2M0X A;  3R3M A;  4TQ1 A;  3AMZ A;  1E8Z A;  3ZVV A;  1TY0 A;  3A9J B;  5FKA C;  2KMM A;  1VR9 A;  5JHB A;  1OGW A;  4WJO A;  4AS1 A;  1E7V A;  4N6E B;  1RWS A;  5LLI A;  2PEA A;  1ZXI A;  2GB1 A;  1LQB A;  2MRP A;  1C4C A;  1IGD A;  1AWD A;  1N60 A;  4WIP A;  3RYT A;  3M62 B;  4EUT A;  3JW0 X;  1I4H A;  2D3A A;  4ANV A;  2N4F A;  1TKY A;  2KTF A;  2OJR A;  2WDV B;  1R4M I;  2N7D A;  4IW0 A;  2E3T A;  3QC8 B;  5DPR A;  2BF8 B;  2Z0E B;  1L4Z B;  3N30 A;  1NEK B;  2KVZ A;  1SBB B;  1L0Y B;  2IZV B;  2RDG A;  3DBL I;  3Q8C A;  4XDC A;  1L2N A;  2DWQ A;  3RNB C;  4NJC A;  2PIA A;  2AQ2 B;  3FIL B;  1FM0 D;  2KHW B;  4IM2 A;  2VZK B;  2WXR A;  3N20 C;  3AH7 A;  3HVD A;  3CIR B;  3VHT C;  1XXG A;  1V6E A;  4K7S A;  4YWG G;  4YT0 B;  1WXQ A;  4AJY B;  1YJJ A;  3AB5 A;  5IO9 A;  4GDK B;  1WJ6 A;  1GNU A;  2LVO A;  4M8M A;  1NI2 A;  1TY2 A;  2LJ5 A;  1ZW7 A;  5G5H A;  2MJE A;  4W9J A;  3SEB A;  4XE0 A;  4IC7 B;  2ZJD A;  4MAC A;  1GPX A;  3APF A;  2IYD B;  2GMI C;  1PFD A;  1C9F A;  1Q1O A;  1FPY A;  3T9L A;  1P7F A;  1F52 A;  2LVQ A;  3RNA C;  4GU2 A;  1SE3 A;  4JL9 A;  1L6U A;  3FKY A;  1MHX A;  1YOV B;  5LNK 1;  3PZ8 A;  3RNE C;  4W9G A;  2JX5 A;  2BYE A;  2DZJ A;  1V1P A;  2JPH A;  5E6P A;  2OHF A;  2RPV A;  3IT6 B;  1DGJ A;  1XD3 B;  3IAS 1;  4BBN F;  1WGH A;  2DX5 B;  3NS8 A;  1ZGU B;  3N32 A;  3MHZ A;  4RMA A;  1OFF A;  2RR9 A;  3Q3J A;  3JYU A;  4KGR A;  1FXI A;  2EMS A;  1EWY C;  3BVG A;  3RCZ A;  2K1F A;  4NZL B;  2JYE A;  3W9C B;  2B3A A;  2KFK B;  5HKH A;  4HXD A;  2LFI A;  4RM8 A;  1WGY A;  1SE4 A;  4FBJ B;  2CS4 A;  3AE3 B;  2LD9 A;  3TL5 A;  1OEY A;  1FCL A;  1I4Q A;  1UWX A;  1F2R C;  1FRD A;  1TIF A;  2QCZ A;  3AE6 B;  3JSV B;  4ANX A;  3KUD B;  3U7D A;  3AEC B; 
#chains in the Genus database with same CATH homology
 1N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...