1N6ZA

Solution nmr structure of protein yml108w from saccharomyces cerevisiae. a novel member of the split bab fold. northeast structural genomics consortium target yt601.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 12.3 kDa protein in ZDS2-URA5 intergenic region
publication title A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08987 DUF1892 Protein of unknown function (DUF1892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.250 Alpha Beta Roll Ubiquitin-like (UB roll) YML108W-like 1n6zA00
1N6ZA
chains in the Genus database with same CATH superfamily
3LJ3A 1WGRA 2KN5A 3P2BA 3UGBB 4BKGA 4MSQB 5TSSA 5EE9A 2FUG1 1NVID 3OAWA 5DPWA 3NY5A 4XDDA 3DWMA 2DZMA 1KLVA 2MP2A 3DVGY 3M3JA 4GIVA 4OW0A 1GC6A 4A8XC 5J18A 2JYEA 2GOWA 3AE2B 3AEAB 2JXTA 1I4QA 2LGIA 4NQKE 4TMAB 4O1NA 2KJ6A 1FNWA 1ZXIA 1FXIA 4BAXA 2AL3A 5HG2A 4MGZE 4TQ1A 1P3QU 1P1AA 1WXQA 2BWES 4DXGA 1F0ZA 2EMSA 2C7NB 1XLQA 1TYGB 4LCDE 2CHWA 2PMVA 2Z0EB 5CTRC 4LDTD 1RFAA 3BYTB 2ZPNA 1UZXB 4A55A 2ASQA 3BVGA 3BK2A 2KX0A 2J4XA 4II2B 3VFKA 1GUAB 1WI0A 4LTUA 3ZJUA 4AJYB 1PUTA 3P4SB 4K1RB 3U2SC 2WHIA 2KX3A 2K22A 3QIJA 2LD9A 2M8SA 2C60A 2NTSA 4GSWA 3DCGA 4KGTA 3BY4B 1WXSA 4KKIA 2DYOA 2WP9B 3CWIA 2KNBA 4FHJA 3AB5A 4D2KA 2D10A 1L2NA 3ZNZB 2LGXA 3N30A 4FN2A 1R7SA 3A9JB 4CQNA 1GJZA 3V61A 2K9XA 3PPAA 3UQAA 2KN4A 2MH7A 4B6WA 2BBCA 1R4MB 2QSDA 5GMVA 4C7ZA 4DHJB 4KKJA 1WSPA 2L52A 4OVZA 2JRHA 4GOCA 2Z8LA 3L4PA 2W3RA 5FK9C 4R3DA 3W1YA 1UF0A 2OEDA 4RGNA 4P1CC 4AP4C 3A9KA 3WANA 3NS8A 4IWQA 3AI5A 1VR9A 3IVFA 3Q8AA 2DYBA 3U7ZA 2PW9A 1EWCA 3MTNB 1OQQA 5IO9A 2ZEQA 3NUHB 3W5VB 1HZ6A 1I4GA 2RDHA 1QKZA 4NPNA 2KQSA 3AU4A 3EGRA 4PS3A 2JU6X 3P42A 2MSED 4US8A 5EE1A 1ZPSA 3IT6B 5E6OA 2KC2A 1T0SC 3AXCA 2PE9A 4RMAA 1VCBA 3APDA 3PS6A 4F7ZA 2ACZB 3JVZX 3QARA 4HPPA 1T5XD 2E6XA 3SFDB 2IPKD 2L1AA 1DOYA 4FADA 4M8MA 2L8JA 2Y5PA 3KUDB 2M19A 4JWSC 3KUCB 4NY0A 3N1YC 5IOIA 4GMVA 4AUQC 3NVVA 4P1BC 4N9F4 1L0YB 2IJ0A 2DHZA 1V81A 4BVUC 1QOFA 2K8HA 5D3IB 3SHQA 3AE5B 3EA6A 3QWZB 2CU1A 3ZIMA 2KAJA 3W1SC 4HXDA 1C3TA 4K7WA 2BS4B 3N9YC 1FD6A 2KC1A 4HROA 5DCNA 3PHWB 2IY0B 2XK5B 2WU5B 1J8CA 2KK8A 3BIID 2WQYB 3I63C 1JWBD 5DPSA 2WGSA 2N7DA 2KDIA 1J7CA 2BF8B 1T0RC 4ICUA 1WZ3A 4EEWA 4IUMB 2IO1B 4DQOC 3GE3C 4W9JA 2YLMA 1KM7A 1VRAB 2N7JA 1MG4A 2LVOA 3ZRFA 1WGKA 1WMHA 4FBJB 1EWYC 1GB1A 1WGDA 2BT6A 5EE0A 3RULA 1TTNA 3K9OB 2BQQA 3NRZA 1VDVA 3APCA 3RFZB 2JT4B 1YQ4B 1FNVA 1P98A 3AECB 1ZDXA 3VXWA 2KXJA 5KHOA 4MDKE 1GPXA 2LVPA 4M01A 4JPSA 1MHHE 2M0AA 1HXYD 2VZKB 3MHSD 1YX5B 3RUIB 2AEHA 4WIPA 3UQBA 5AZGA 1NYRA 1FCCC 2G45B 2REXA 3KQ4A 5EE3A 4A3PA 2J7QB 2QHOA 4S0RA 2X8XX 3HVZA 3O13A 1M94A 2B76B 1Q1OA 2WXFA 4NAWB 3L08A 2ZNVB 2LASA 1JWMD 2INDC 4YT0B 1E7PB 1SIJA 3RNCC 4M02A 2IGDA 4GDKA 5D94A 3NHEB 1EU4A 3KH0A 2JWZA 1ZKHA 1EF5A 3VUWA 3JYUA 2WXMA 5EDSA 4EKUA 1J19A 3B08A 2HTHA 3PSEB 2LRWA 3NZSA 3MFGA 4W9HA 2WXIA 4C80A 3DVNU 1OFFA 2MBHA 3ZDMC 5GXGB 4XC2A 2KJHB 1HE8A 1E8WA 3Q3JA 2VH1A 1SJED 4HVBA 5HI1A 2BYEA 2W82A 2Z0DB 3MP9A 3D32A 3W9CB 2I2YA 1N5XA 4M00A 1JWAD 3U8ZA 3FILB 3VH4B 2MRPA 4ZDVA 4RF1A 1VD2A 3NZUA 1D6EC 1PFDA 4DHZE 1RAXA 1MHXA 3VR8B 1SXTA 4BBNC 4MJSA 5IN7A 4C4VA 3NOBA 2HE7A 1C1YB 4TUUA 2JZ3B 1KOTA 2N7EA 4AS1A 1NYQA 5LNK1 3AE1B 1RRBA 1F2RI 1UD7A 4QAYA 3T3NA 5CHFA 1L4ZB 3AE9B 4RFBA 4C56C 1I4RA 2HJ8A 2O2VB 2C7MB 2AX5A 2BYFA 5G55A 3PTFC 4WJNA 1JCKB 2PJHA 1OQRA 1NENB 1V5TA 4KDIC 5AEKB 4ARIA 5J2RA 2W9NA 4FXCA 1R4MI 2FCNA 4MH8A 2N4FA 1V1PA 1SBBB 4ZRJA 3PLVA 2KDMA 1XLPA 2N9KA 3RZWC 1J7BA 1EUVB 1TKEA 4HCNB 2RGFA 4XGAB 4ZYNA 2MBQA 3NVYA 1GC7A 5HHDG 1N63A 4MELA 4LNKA 1K8RB 2LFIA 2PVGC 3GZNI 2KFKA 1D5ZC 4L1BA 5BYSA 4MSMB 1WRIA 2FIDA 3M63B 2LHDA 2O2VA 3I3TB 5CHVC 3SEBA 4K7SA 4MT5A 1FM0D 1CJEA 2BS3B 1T0YA 2GI9A 3L13A 4LDTB 2AQ2B 2V0GA 2L0TA 1JRPA 1H4RA 1U4AA 3UINB 4BKSD 4KX6B 3N32A 3QX1A 4YXDB 2MJEA 1E8XA 2PEAA 4JIOU 4NAMA 3R7QA 1N62A 5G2NA 4KVGB 1KFYB 2R61A 5FR3A 1ZOYB 1V8CA 3BINA 3VR9B 1T6BX 5MPOA 1ZP0B 4IW0A 1YN5A 2WDQB 3QK0A 3LXFA 1C77A 3U4EG 4OHJA 4WJOA 2PE6B 2LZ6A 3U52E 3R3MA 3N20C 4F8CB 4RM8A 5D6JB 1LM8B 1K50A 4JLCA 3CMMB 1TKGA 4BZAA 1I4PA 2FAZA 1WJUA 2MP2B 1AW7A 4FHKA 2KANA 1YN4A 5E6JA 3FC4A 2LXCA 4P6VF 2LJ5A 2VRRB 2N9LA 2WXQA 1HA5A 3B1LX 4TSSA 2WX0A 3H7SA 5L95C 2V9HA 4CYEA 2MJDA 2JPHA 1TS5A 1P7FA 4E71A 5IAAC 1HTQA 3P4RB 4N58A 1ZXHA 4RH6A 2JY6A 4IWOA 2JX5A 3DBHB 4A20A 1HQRD 1TY0A 2EMTA 1YQBA 2JWUA 2QMTA 3IBEA 3P1MA 2DWQA 3NVWA 1ENFA 1IP9A 3V6CB 2X38A 4RCOA 1SE9A 3P4PB 3RCZA 3RD2A 1D4BA 1WWTA 3UIPB 3WALA 3AU5A 2XBBC 5D3DA 1CK1A 2MJ3A 3TEYA 4M0WA 2KKCA 2UWQA 1K51A 5C2TB 3UIOB 3RNGC 1L7YA 2KLGA 1NDDA 2CKHB 2Y3AA 2JQRB 3AULA 3O65B 4BBNF 2JRIB 4FA6A 2L32A 1KLGD 5CHWA 1G6JA 3HM6X 1YJ1A 1F9JA 2HTME 1C4PA 3H6NA 2IDYA 4HCPB 1OEYA 1OQYA 2O6VD 4USAA 3AE7B 3AEFB 2V4LA 4GDLA 1Q5WB 2KZRA 1UBIA 2ZW0A 1V2YA 1YJIA 2CU3A 2LMCA 3TJPA 5I4DA 3A9KB 2FE8A 2BS2B 3N1XC 3Q2AC 3APFA 5H8YE 1A70A 3WIMA 4N6EB 5AZFA 3B2FA 4LLGM 3PGEA 1T3QA 3ZNHB 1WM2A 1J0GA 3C8YA 2KLCA 2EKEC 3IXSA 3DBLB 1F77A 4N59A 5G5HA 3NJTA 2KQ4X 3OG5A 4HLEA 3PZ7A 4B9KA 1UNSA 2BKFA 1YN3A 3TBLD 1UGMA 4IKGA 2W54A 4WH4A 3GZNB 1RLFA 3RNAC 3VHTC 5BO4B 1CQVA 1ISNA 1A5RA 1E90A 4FULA 2MA9B 1V9JA 4YTPB 1ZGUB 1GG3A 2ZVNA 3MC8A 1E9MA 4W9CA 1EO6A 5D2MB 2BKRB 4MGIE 4YL8A 1C79A 1SE4A 2HD5B 3LB8C 3IAM1 2WYQA 3CIRB 3M62B 3N1ZC 4CO7A 2I1JA 3NG0A 3RPFC 1JQ4A 1WR1A 1D3ZA 2KMCA 3VRBB 4EUTA 3RNEC 1QLBB 1GB4A 3R2IA 1KLUD 2DLBA 4MEMA 1VZ6A 2ZW1A 1P9DU 2BVCA 2KMAA 3CSFA 4WURA 1E5WA 2ON8A 3TSSA 1I4HA 4P16A 2ICIA 3R8BA 2IGGA 2NBWB 1XXGA 1GNUA 2J0JA 1TBEA 4ARCA 1IBXA 2NPTA 3HUIA 2GB1A 2WLBA 2FIFA 1PYWD 2MX2A 3L17A 2MHJA 2D11A 3DWGC 2AYOB 5KHQA 4XYCA 3DOWA 3VTWA 3GE8C 2LRUA 1WMHB 3SFEB 2D07B 3QJZA 2WNMA 3P63A 4WQOB 4CHKA 3A4RA 2PIAA 1XCQL 3TCAA 3BWUD 4IDIA 1FPYA 4S17A 1QQRA 4LJPB 4ZOHC 3RZFA 3E9SA 2ZCBA 2DZIA 4DDID 2FNJB 1Y8RC 1V80A 2LVQA 5LXHA 2C5LC 3VDZA 2BYVE 4K3CA 1D5XC 2L3ZA 4WWNA 4JGHB 2G3QB 4RNAA 4ZRKA 3ZYYX 1WX8A 2NR2A 3Q6BA 3SDLC 2K8BA 3SU8X 2BTEA 1L0VB 2A4ZA 2NMQA 2GBMA 3WAOA 3OLMD 3N3KB 3NZ3A 4ZYSA 2AQ3B 1TIFA 3V3XA 4W9DA 1YOVB 5J17A 4LJOB 1IYFA 4RGMA 1SGHA 5HFYA 1Y56A 4JQWC 1E6EB 1WJ6A 2KVRA 4GDKB 1STEA 3NS1A 2FCSA 1UUPA 3BYYB 1ZW7A 2GRIA 1TZOA 3Q3MC 3ZGZA 4DHJD 2AQ1B 1N6ZA 2N9EB 1QOAA 5LXIB 1I4XA 1TT5B 4RGOS 1MG8A 1KJTA 3PVLA 2ZCCA 2L76A 2RD0A 1VZ7A 2KYWA 4WQMA 3Q3NC 3ZTCA 3RN9C 3QQ8B 3R2TA 2WXNA 1V49A 2DZKA 3DBHI 3W2DA 3AE4B 3KWVA 2BPSA 2DYMA 3VUXA 1R4NB 3EC8A 5IP4D 2DENB 4HJKA 3MC9A 1SE2A 2R2OA 4MJSB 2OJRA 4C4VB 3AEEB 4EZJA 5T8IA 2RSUA 1MJDA 5HKHA 1KRHA 2A5UA 2DAJA 4DXAB 4PK1A 1ZDVA 1WRDB 1WM3A 2G4SA 2DZJA 4M8NA 2LUMA 5E6PA 1DYQA 2XNAC 5CX3A 1EU3A 1FFUA 4JX1C 3R66C 3KUZA 1SB3C 3Q3FA 2LGYA 1QT9A 3C0RB 4BKSA 4LNIA 5BMHA 2J0MA 2OHFA 2CJOA 4KIKB 2FBWB 3PRMB 1V1PB 3PT2B 3GP7A 4US9A 1XCTL 1MPEA 3DHGC 4IWPA 1S1QB 3IFWB 3WCQA 1WGGA 2MBEA 4AWJA 2YEPB 1H8CA 3ZJVA 1I35A 1K52A 3ALBA 2UU7A 1PGBA 2L05A 4XWWA 3PLUA 3K9PB 3UF8A 2KFKB 3AE6B 2H88B 2VH2A 4HPLB 4GN1A 3EFCA 2IY1B 2QIEB 3HVDA 4A3OA 4II3B 1UWMA 4MH0E 3WA0A 1WE6A 3IT4B 3VH3B 2G4DB 3UI3A 3T9LA 4KIKA 4B0EA 1WXMA 3GS2A 2WXHA 1S3SG 3P4QB 3DBLI 1FXTB 4KZCA 3RI7C 1NEKB 2BB6A 2L00B 1NI2A 3ZNID 2WXLA 3ZW3A 2ZVOA 4XDCA 3W1SA 2D2QA 2MBBB 1V97A 3VTUA 1FXAA 2GBJA 2BGFA 3SR6A 1RWSA 1WYWB 1SIFA 4W9LA 4BFRA 2QDFA 3TEZA 1MFWA 1CMXB 1EM7A 3PV1A 2I38A 4WJQA 1WX9A 1QOGA 3Q8BA 1ESFA 1OTRB 1P7EA 1WFYA 2VZKD 4EFOA 2KDFB 4YWGG 1M4VA 2J52A 4EZKA 2MBOA 2WDVB 1E8ZA 5G5GA 1YMHE 1XO3A 2CHZA 3MJWA 1X1MA 4IM2A 2C9WB 5IA7A 2LEKA 1LFDA 1F2RC 1LGRA 4YSZB 1JWSD 2RDGA 2M1MA 2BW2A 1BXTA 3AM9A 2RMMA 1RYJA 2KWDA 4A90A 2D3BA 1P0RA 3ZNGC 3TEXA 5JZEB 4KSKC 4LK0M 1XF5L 2M17A 3VTVA 1E7UA 2C7HA 2KT7A 2DNFA 2KMMA 3ML8A 3RMKC 3DBRB 2INNE 2OOBB 1E8YA 3TL5A 2K6DB 3C19A 2TSSA 3FKYA 3B9JA 3ZUNA 3V6EB 1AWDA 2O6VA 3L16A 2GBNA 1C4CA 2GBKA 1KH0A 1D5MC 3A4SC 5JXVA 1MI0A 2QEJC 1YD8U 3DVNV 1DOIA 1QILA 1DGJA 1OEYJ 2JYTA 3DHHC 2M56B 1SF0A 5FKAC 2XEWA 4YTMB 4M0WB 3AE8B 4MM3A 3KYCD 2PLPA 1E0ZA 5DPRA 3H8HA 4PYZA 4I6PA 4GXBA 3I5JC 2KTFA 2JF5A 1F1HA 5BYQA 2JSVX 3KW5B 4HEA1 3X23A 2JXXA 2JZZA 3Q8FA 3VRAB 2KWUB 2KTRB 3QC8B 3OWEB 2QILA 2WU2B 2JUOA 3QAQA 2BB5A 2G9HD 2K39A 4NJCA 3QCAA 1PGAA 4GDLB 1XD3B 1VLBA 2ZPYA 2BYTA 3WAMA 1TS3A 2KWCA 3KLSX 3PRZA 4HKQA 1YNTE 4WWOA 1FRRA 4F1SA 1SSNA 1FFVA 2V3PA 5C23A 1B9RA 1UWXA 2J0KA 4HRSA 3ZRCA 2KJRA 2YVCA 1JMLA 3ZDTA 4KV2A 5JH5C 4YSYB 2ONQA 2N1VA 1UH6A 2K25A 3ECIA 3ML9A 4A9AA 4REZA 3LYYA 3TUOA 1Z5SB 2KDEB 3DHIC 2NTTA 2KTRA 4W9IA 2MEKA 1TZ1A 3ETRA 4I6LB 3ZQ4A 4YSXB 2V4IB 5BMIA 1PGXA 2QJLA 4KDLB 2KWVB 3QHTA 2KHWB 2LJIA 1BT0A 1WJ4A 2MQJA 1VJKA 2LXAA 3VUYA 2PKOA 4ZHOA 3V60A 4A6QA 4JE3B 3CF6E 4KSLC 2UYZB 1R4NI 4LNNA 1YX6B 2DAFA 2RPVA 2W3SA 1XT9B 3E56A 3HRDD 4HKZE 4JL9A 1ZE3D 2HDEA 2WXOA 4NJ7A 3U30A 3NVZA 3PRPB 2IO3B 5AUKA 3PZ8A 5BMGA 1WZ0A 4HPMB 3Q14C 3QA8A 2M0XA 4L23A 4E74A 4LNOA 2GBRA 2HJ1A 1WGYA 1UBQA 1FCLA 1WXVA 3ZO5B 4IM3A 4OVUA 3MJ5A 4NJ6A 2WDTB 4Q2JA 4WAFA 4E3CA 2JVCA 4OZCA 3Q69A 1WY8A 2FUHB 4EE2A 3DQVA 1B1ZA 1FEHA 3BK1A 3SD5A 1FO4A 1YQ3B 2LGSA 1IBXB 3HIZA 2NPTB 3DBSA 1IGCA 2MW5A 1WF9A 4PYUA 1FIQA 2ZNVC 1L5PA 5DPTA 3GOEA 2KO3A 2V1YA 1IPGA 1C78A 2NBVB 3A1QB 4DK5A 4KGRA 2PPHA 4UDUC 2GLSA 4NNJB 3L0WB 3A9JA 4I6NB 1OGWA 4BKTA 1JW9D 2Y5CA 1C9FA 2RPQA 1HEZE 1LXDA 4DBGA 3B0AA 4W9FA 3ZLZA 3ZVVA 4WWPA 1BUIC 1SE3A 2WX1A 1Q0WB 1HTOA 1IUEA 2BWFA 2INCC 1WGHA 2NS5A 3OJ3A 1XLOA 2FCMA 2ZJDA 4ZRQA 2CS4A 3A1QA 3KWLA 5TR5A 3RNFC 1K53A 3HK0A 2V3NA 3HHMA 3KVFB 2ZZPB 1RFKA 4G11A 1YJJA 3R7RA 4KZ0A 3VAWA 3IG3A 1WX7A 2D5GA 3DVGX 3EUB2 1TKYA 2Q5WD 1WXAA 1EF1A 4BOSC 3LDZE 3ZXRA 4XX5A 4TV3A 1PQSA 1XQQA 1TS2A 1XEEA 1PDXA 3EFUA 1UGJA 2DBYA 1V6EA 3AE3B 3TEWA 4TQ0A 3HM3A 3AEBB 4K81A 4WAAA 4G3XB 3PREA 1QZEA 1V86A 2L0FA 4GGQA 3Q8EA 2K3UA 3B2GA 4IM0A 4BOZB 2IO0B 2J53A 2B3AA 1N60A 3TIXA 1IGDA 3AV8A 4MGKE 3V05A 3AEDB 3ZJTA 3DBRI 2NVUI 4K3BA 1ET6A 2IYDB 2J42A 3W5UB 4DDGD 3H1UA 1AARA 4PS8A 2D3CA 2WXRA 5FR6A 1CZPA 3L10B 2XK5A 1JALA 4GLSC 1DOXA 4NQLB 4AQ7A 2N9PC 5AZHA 4TKNA 2RDBC 4X57B 5C3JB 1I7HA 2KDBA 3M95A 4ICVA 4HWIB 5BYRA 3ENEA 3U7DA 2WDRB 2WWZA 1WJNA 2E3TA 1WR6E 3ABVB 3BZDB 2CJNA 4ZRPA 1V5OA 4IC7B 2AWTA 1C76A 1E10A 2N1WA 3TMPB 4LNFA 1FNUA 4ITKA 4ZHPA 1SJHD 4H2AA 4HDOA 4ANVA 3AN1A 3S2AA 3Q8CA 2R2QA 2IGHA 3VQIA 4G50A 2MCNB 3L54A 4J3OD 3WAPA 1VZ8A 4YTNB 3EHVA 4NZLB 5LLIA 1AN8A 5L83A 3VVWB 2Z59B 4HK2A 3EECA 3ZTDA 4XE0A 2IZVB 3AH7A 4DXFA 2QC8A 4ASWC 3DDCB 3FAHA 4EZLA 1QOBA 4IOIE 5IKCM 4MGYE 4W9EA 4DHZB 4HDQA 3AEGB 2WS3B 3A33B 4NAWA 1NI3A 2WXKA 3Q3OC 4ACFA 4URKA 1KF6B 3CSTA 2EKIA 3RYTA 2M4NA 4P7IA 3H7PB 1TY2A 3ZXVA 5JHAA 1QF6A 3MHZA 1ZUD2 2KFJA 4ANUA 1FRDA 2INPE 4OVVA 4J6IA 2QCZA 1WIAA 1ACCA 4HJGE 4DWFA 2LI5A 3BVMA 4FJYA 4ANWA 2L83A 2FCQA 3T8MA 3I9V1 3IAS1 3J9CA 3BVZA 3H9DA 5D7GA 3URYA 1YIWA 3JSVB 3ONSA 1JWUD 1Z2MA 1N5WA 2H89B 2K0PA 5E6NA 4C00A 2WXGA 2K1FA 2K8CA 2MWSB 4MACA 3FILA 3H7PA 1C4AA 1L0XB 4RM9A 3X0WA 1TGZB 1V1OA 3T3OA 2YEPF 4FJVB 1XLNA 2WXPA 2Y5BB 2W55A 2WXJA 4AOFA 4EOYA 4L2YA 2NCNA 4ANXA 1JRUA 3I57A 3GB1A 2MLBA 2V3SA 1TS4A 2SAKA 4RGTA 4B95A 4OZBA 1J7AA 2O6VB 3JSVA 2RR9A 3OJ4B 5H92C 1UELA 1L4DB 4W9KA 1JROA 4K7UA 1HZ5A 2D3GA 2XN9C 3MC0B 2N9XA 1T0QC 2EELA 2L7RA 2JZPA 1FMAD 1BMLC 4WJPA 4GB9A 4FLHA 1E7VA 4MM3B 2G1EA 5JHBA 3PHXB 2LGDA 2KQ7A 3V62A 2LUEA 4JWUC 4G0NB 1L6UA 1WH3A 4ZRIA 2I1KA 1RM6C 3AMZA 4B0MA 1MVKA 3RNBC 2IO2B 4KGSA 1AYFA 2PVOD 4RF0A 4XWTA 3PO0A 4C7YA 2KACA 3DPDA 1LQBA 4IG7B 2DX5B 2KVZA 3JW0X 1LO5D 1N61A 1F52A 1GAQB 4AJWA 2PTLA 4XZ4A 1I42A 2K5PA 2SEBD 2D3AA 5AUIA 2N0SB 1TJEA 2KD0A 3KYDD 2CHXA 1NBFC 2OJWA 3PZDA 4PS7A 1GOZA 1WE7A 2LHEA 3ZKJC 2LWPA 2CR5A 2IBIB 4GU2A 2K6QA 4WWMA 2KOXA 2NBUA 1ET9A 1L6VA 4W9GA 3IHPC 1Q10A 4OZAA 4FJZA 1ROEA 1SEBD 2GMIC 1WYGA 2AL6A 3RT3B 1KTKA 5C1ZA 4PT5A
chains in the Genus database with same CATH topology
1N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6Z A; 
#chains in the Genus database with same CATH topology
 3LJ3 A;  1WGR A;  2KN5 A;  3P2B A;  3UGB B;  4BKG A;  4MSQ B;  5TSS A;  5EE9 A;  2FUG 1;  1NVI D;  3OAW A;  5DPW A;  3NY5 A;  4XDD A;  3DWM A;  2DZM A;  1KLV A;  2MP2 A;  3DVG Y;  3M3J A;  4GIV A;  4OW0 A;  1GC6 A;  4A8X C;  5J18 A;  2JYE A;  2GOW A;  3AE2 B;  3AEA B;  2JXT A;  1I4Q A;  2LGI A;  4NQK E;  4TMA B;  4O1N A;  2KJ6 A;  1FNW A;  1ZXI A;  1FXI A;  4BAX A;  2AL3 A;  5HG2 A;  4MGZ E;  4TQ1 A;  1P3Q U;  1P1A A;  1WXQ A;  2BWE S;  4DXG A;  1F0Z A;  2EMS A;  2C7N B;  1XLQ A;  1TYG B;  4LCD E;  2CHW A;  2PMV A;  2Z0E B;  5CTR C;  4LDT D;  1RFA A;  3BYT B;  2ZPN A;  1UZX B;  4A55 A;  2ASQ A;  3BVG A;  3BK2 A;  2KX0 A;  2J4X A;  4II2 B;  3VFK A;  1GUA B;  1WI0 A;  4LTU A;  3ZJU A;  4AJY B;  1PUT A;  3P4S B;  4K1R B;  3U2S C;  2WHI A;  2KX3 A;  2K22 A;  3QIJ A;  2LD9 A;  2M8S A;  2C60 A;  2NTS A;  4GSW A;  3DCG A;  4KGT A;  3BY4 B;  1WXS A;  4KKI A;  2DYO A;  2WP9 B;  3CWI A;  2KNB A;  4FHJ A;  3AB5 A;  4D2K A;  2D10 A;  1L2N A;  3ZNZ B;  2LGX A;  3N30 A;  4FN2 A;  1R7S A;  3A9J B;  4CQN A;  1GJZ A;  3V61 A;  2K9X A;  3PPA A;  3UQA A;  2KN4 A;  2MH7 A;  4B6W A;  2BBC A;  1R4M B;  2QSD A;  5GMV A;  4C7Z A;  4DHJ B;  4KKJ A;  1WSP A;  2L52 A;  4OVZ A;  2JRH A;  4GOC A;  2Z8L A;  3L4P A;  2W3R A;  5FK9 C;  4R3D A;  3W1Y A;  1UF0 A;  2OED A;  4RGN A;  4P1C C;  4AP4 C;  3A9K A;  3WAN A;  3NS8 A;  4IWQ A;  3AI5 A;  1VR9 A;  3IVF A;  3Q8A A;  2DYB A;  3U7Z A;  2PW9 A;  1EWC A;  3MTN B;  1OQQ A;  5IO9 A;  2ZEQ A;  3NUH B;  3W5V B;  1HZ6 A;  1I4G A;  2RDH A;  1QKZ A;  4NPN A;  2KQS A;  3AU4 A;  3EGR A;  4PS3 A;  2JU6 X;  3P42 A;  2MSE D;  4US8 A;  5EE1 A;  1ZPS A;  3IT6 B;  5E6O A;  2KC2 A;  1T0S C;  3AXC A;  2PE9 A;  4RMA A;  1VCB A;  3APD A;  3PS6 A;  4F7Z A;  2ACZ B;  3JVZ X;  3QAR A;  4HPP A;  1T5X D;  2E6X A;  3SFD B;  2IPK D;  2L1A A;  1DOY A;  4FAD A;  4M8M A;  2L8J A;  2Y5P A;  3KUD B;  2M19 A;  4JWS C;  3KUC B;  4NY0 A;  3N1Y C;  5IOI A;  4GMV A;  4AUQ C;  3NVV A;  4P1B C;  4N9F 4;  1L0Y B;  2IJ0 A;  2DHZ A;  1V81 A;  4BVU C;  1QOF A;  2K8H A;  5D3I B;  3SHQ A;  3AE5 B;  3EA6 A;  3QWZ B;  2CU1 A;  3ZIM A;  2KAJ A;  3W1S C;  4HXD A;  1C3T A;  4K7W A;  2BS4 B;  3N9Y C;  1FD6 A;  2KC1 A;  4HRO A;  5DCN A;  3PHW B;  2IY0 B;  2XK5 B;  2WU5 B;  1J8C A;  2KK8 A;  3BII D;  2WQY B;  3I63 C;  1JWB D;  5DPS A;  2WGS A;  2N7D A;  2KDI A;  1J7C A;  2BF8 B;  1T0R C;  4ICU A;  1WZ3 A;  4EEW A;  4IUM B;  2IO1 B;  4DQO C;  3GE3 C;  4W9J A;  2YLM A;  1KM7 A;  1VRA B;  2N7J A;  1MG4 A;  2LVO A;  3ZRF A;  1WGK A;  1WMH A;  4FBJ B;  1EWY C;  1GB1 A;  1WGD A;  2BT6 A;  5EE0 A;  3RUL A;  1TTN A;  3K9O B;  2BQQ A;  3NRZ A;  1VDV A;  3APC A;  3RFZ B;  2JT4 B;  1YQ4 B;  1FNV A;  1P98 A;  3AEC B;  1ZDX A;  3VXW A;  2KXJ A;  5KHO A;  4MDK E;  1GPX A;  2LVP A;  4M01 A;  4JPS A;  1MHH E;  2M0A A;  1HXY D;  2VZK B;  3MHS D;  1YX5 B;  3RUI B;  2AEH A;  4WIP A;  3UQB A;  5AZG A;  1NYR A;  1FCC C;  2G45 B;  2REX A;  3KQ4 A;  5EE3 A;  4A3P A;  2J7Q B;  2QHO A;  4S0R A;  2X8X X;  3HVZ A;  3O13 A;  1M94 A;  2B76 B;  1Q1O A;  2WXF A;  4NAW B;  3L08 A;  2ZNV B;  2LAS A;  1JWM D;  2IND C;  4YT0 B;  1E7P B;  1SIJ A;  3RNC C;  4M02 A;  2IGD A;  4GDK A;  5D94 A;  3NHE B;  1EU4 A;  3KH0 A;  2JWZ A;  1ZKH A;  1EF5 A;  3VUW A;  3JYU A;  2WXM A;  5EDS A;  4EKU A;  1J19 A;  3B08 A;  2HTH A;  3PSE B;  2LRW A;  3NZS A;  3MFG A;  4W9H A;  2WXI A;  4C80 A;  3DVN U;  1OFF A;  2MBH A;  3ZDM C;  5GXG B;  4XC2 A;  2KJH B;  1HE8 A;  1E8W A;  3Q3J A;  2VH1 A;  1SJE D;  4HVB A;  5HI1 A;  2BYE A;  2W82 A;  2Z0D B;  3MP9 A;  3D32 A;  3W9C B;  2I2Y A;  1N5X A;  4M00 A;  1JWA D;  3U8Z A;  3FIL B;  3VH4 B;  2MRP A;  4ZDV A;  4RF1 A;  1VD2 A;  3NZU A;  1D6E C;  1PFD A;  4DHZ E;  1RAX A;  1MHX A;  3VR8 B;  1SXT A;  4BBN C;  4MJS A;  5IN7 A;  4C4V A;  3NOB A;  2HE7 A;  1C1Y B;  4TUU A;  2JZ3 B;  1KOT A;  2N7E A;  4AS1 A;  1NYQ A;  5LNK 1;  3AE1 B;  1RRB A;  1F2R I;  1UD7 A;  4QAY A;  3T3N A;  5CHF A;  1L4Z B;  3AE9 B;  4RFB A;  4C56 C;  1I4R A;  2HJ8 A;  2O2V B;  2C7M B;  2AX5 A;  2BYF A;  5G55 A;  3PTF C;  4WJN A;  1JCK B;  2PJH A;  1OQR A;  1NEN B;  1V5T A;  4KDI C;  5AEK B;  4ARI A;  5J2R A;  2W9N A;  4FXC A;  1R4M I;  2FCN A;  4MH8 A;  2N4F A;  1V1P A;  1SBB B;  4ZRJ A;  3PLV A;  2KDM A;  1XLP A;  2N9K A;  3RZW C;  1J7B A;  1EUV B;  1TKE A;  4HCN B;  2RGF A;  4XGA B;  4ZYN A;  2MBQ A;  3NVY A;  1GC7 A;  5HHD G;  1N63 A;  4MEL A;  4LNK A;  1K8R B;  2LFI A;  2PVG C;  3GZN I;  2KFK A;  1D5Z C;  4L1B A;  5BYS A;  4MSM B;  1WRI A;  2FID A;  3M63 B;  2LHD A;  2O2V A;  3I3T B;  5CHV C;  3SEB A;  4K7S A;  4MT5 A;  1FM0 D;  1CJE A;  2BS3 B;  1T0Y A;  2GI9 A;  3L13 A;  4LDT B;  2AQ2 B;  2V0G A;  2L0T A;  1JRP A;  1H4R A;  1U4A A;  3UIN B;  4BKS D;  4KX6 B;  3N32 A;  3QX1 A;  4YXD B;  2MJE A;  1E8X A;  2PEA A;  4JIO U;  4NAM A;  3R7Q A;  1N62 A;  5G2N A;  4KVG B;  1KFY B;  2R61 A;  5FR3 A;  1ZOY B;  1V8C A;  3BIN A;  3VR9 B;  1T6B X;  5MPO A;  1ZP0 B;  4IW0 A;  1YN5 A;  2WDQ B;  3QK0 A;  3LXF A;  1C77 A;  3U4E G;  4OHJ A;  4WJO A;  2PE6 B;  2LZ6 A;  3U52 E;  3R3M A;  3N20 C;  4F8C B;  4RM8 A;  5D6J B;  1LM8 B;  1K50 A;  4JLC A;  3CMM B;  1TKG A;  4BZA A;  1I4P A;  2FAZ A;  1WJU A;  2MP2 B;  1AW7 A;  4FHK A;  2KAN A;  1YN4 A;  5E6J A;  3FC4 A;  2LXC A;  4P6V F;  2LJ5 A;  2VRR B;  2N9L A;  2WXQ A;  1HA5 A;  3B1L X;  4TSS A;  2WX0 A;  3H7S A;  5L95 C;  2V9H A;  4CYE A;  2MJD A;  2JPH A;  1TS5 A;  1P7F A;  4E71 A;  5IAA C;  1HTQ A;  3P4R B;  4N58 A;  1ZXH A;  4RH6 A;  2JY6 A;  4IWO A;  2JX5 A;  3DBH B;  4A20 A;  1HQR D;  1TY0 A;  2EMT A;  1YQB A;  2JWU A;  2QMT A;  3IBE A;  3P1M A;  2DWQ A;  3NVW A;  1ENF A;  1IP9 A;  3V6C B;  2X38 A;  4RCO A;  1SE9 A;  3P4P B;  3RCZ A;  3RD2 A;  1D4B A;  1WWT A;  3UIP B;  3WAL A;  3AU5 A;  2XBB C;  5D3D A;  1CK1 A;  2MJ3 A;  3TEY A;  4M0W A;  2KKC A;  2UWQ A;  1K51 A;  5C2T B;  3UIO B;  3RNG C;  1L7Y A;  2KLG A;  1NDD A;  2CKH B;  2Y3A A;  2JQR B;  3AUL A;  3O65 B;  4BBN F;  2JRI B;  4FA6 A;  2L32 A;  1KLG D;  5CHW A;  1G6J A;  3HM6 X;  1YJ1 A;  1F9J A;  2HTM E;  1C4P A;  3H6N A;  2IDY A;  4HCP B;  1OEY A;  1OQY A;  2O6V D;  4USA A;  3AE7 B;  3AEF B;  2V4L A;  4GDL A;  1Q5W B;  2KZR A;  1UBI A;  2ZW0 A;  1V2Y A;  1YJI A;  2CU3 A;  2LMC A;  3TJP A;  5I4D A;  3A9K B;  2FE8 A;  2BS2 B;  3N1X C;  3Q2A C;  3APF A;  5H8Y E;  1A70 A;  3WIM A;  4N6E B;  5AZF A;  3B2F A;  4LLG M;  3PGE A;  1T3Q A;  3ZNH B;  1WM2 A;  1J0G A;  3C8Y A;  2KLC A;  2EKE C;  3IXS A;  3DBL B;  1F77 A;  4N59 A;  5G5H A;  3NJT A;  2KQ4 X;  3OG5 A;  4HLE A;  3PZ7 A;  4B9K A;  1UNS A;  2BKF A;  1YN3 A;  3TBL D;  1UGM A;  4IKG A;  2W54 A;  4WH4 A;  3GZN B;  1RLF A;  3RNA C;  3VHT C;  5BO4 B;  1CQV A;  1ISN A;  1A5R A;  1E90 A;  4FUL A;  2MA9 B;  1V9J A;  4YTP B;  1ZGU B;  1GG3 A;  2ZVN A;  3MC8 A;  1E9M A;  4W9C A;  1EO6 A;  5D2M B;  2BKR B;  4MGI E;  4YL8 A;  1C79 A;  1SE4 A;  2HD5 B;  3LB8 C;  3IAM 1;  2WYQ A;  3CIR B;  3M62 B;  3N1Z C;  4CO7 A;  2I1J A;  3NG0 A;  3RPF C;  1JQ4 A;  1WR1 A;  1D3Z A;  2KMC A;  3VRB B;  4EUT A;  3RNE C;  1QLB B;  1GB4 A;  3R2I A;  1KLU D;  2DLB A;  4MEM A;  1VZ6 A;  2ZW1 A;  1P9D U;  2BVC A;  2KMA A;  3CSF A;  4WUR A;  1E5W A;  2ON8 A;  3TSS A;  1I4H A;  4P16 A;  2ICI A;  3R8B A;  2IGG A;  2NBW B;  1XXG A;  1GNU A;  2J0J A;  1TBE A;  4ARC A;  1IBX A;  2NPT A;  3HUI A;  2GB1 A;  2WLB A;  2FIF A;  1PYW D;  2MX2 A;  3L17 A;  2MHJ A;  2D11 A;  3DWG C;  2AYO B;  5KHQ A;  4XYC A;  3DOW A;  3VTW A;  3GE8 C;  2LRU A;  1WMH B;  3SFE B;  2D07 B;  3QJZ A;  2WNM A;  3P63 A;  4WQO B;  4CHK A;  3A4R A;  2PIA A;  1XCQ L;  3TCA A;  3BWU D;  4IDI A;  1FPY A;  4S17 A;  1QQR A;  4LJP B;  4ZOH C;  3RZF A;  3E9S A;  2ZCB A;  2DZI A;  4DDI D;  2FNJ B;  1Y8R C;  1V80 A;  2LVQ A;  5LXH A;  2C5L C;  3VDZ A;  2BYV E;  4K3C A;  1D5X C;  2L3Z A;  4WWN A;  4JGH B;  2G3Q B;  4RNA A;  4ZRK A;  3ZYY X;  1WX8 A;  2NR2 A;  3Q6B A;  3SDL C;  2K8B A;  3SU8 X;  2BTE A;  1L0V B;  2A4Z A;  2NMQ A;  2GBM A;  3WAO A;  3OLM D;  3N3K B;  3NZ3 A;  4ZYS A;  2AQ3 B;  1TIF A;  3V3X A;  4W9D A;  1YOV B;  5J17 A;  4LJO B;  1IYF A;  4RGM A;  1SGH A;  5HFY A;  1Y56 A;  4JQW C;  1E6E B;  1WJ6 A;  2KVR A;  4GDK B;  1STE A;  3NS1 A;  2FCS A;  1UUP A;  3BYY B;  1ZW7 A;  2GRI A;  1TZO A;  3Q3M C;  3ZGZ A;  4DHJ D;  2AQ1 B;  1N6Z A;  2N9E B;  1QOA A;  5LXI B;  1I4X A;  1TT5 B;  4RGO S;  1MG8 A;  1KJT A;  3PVL A;  2ZCC A;  2L76 A;  2RD0 A;  1VZ7 A;  2KYW A;  4WQM A;  3Q3N C;  3ZTC A;  3RN9 C;  3QQ8 B;  3R2T A;  2WXN A;  1V49 A;  2DZK A;  3DBH I;  3W2D A;  3AE4 B;  3KWV A;  2BPS A;  2DYM A;  3VUX A;  1R4N B;  3EC8 A;  5IP4 D;  2DEN B;  4HJK A;  3MC9 A;  1SE2 A;  2R2O A;  4MJS B;  2OJR A;  4C4V B;  3AEE B;  4EZJ A;  5T8I A;  2RSU A;  1MJD A;  5HKH A;  1KRH A;  2A5U A;  2DAJ A;  4DXA B;  4PK1 A;  1ZDV A;  1WRD B;  1WM3 A;  2G4S A;  2DZJ A;  4M8N A;  2LUM A;  5E6P A;  1DYQ A;  2XNA C;  5CX3 A;  1EU3 A;  1FFU A;  4JX1 C;  3R66 C;  3KUZ A;  1SB3 C;  3Q3F A;  2LGY A;  1QT9 A;  3C0R B;  4BKS A;  4LNI A;  5BMH A;  2J0M A;  2OHF A;  2CJO A;  4KIK B;  2FBW B;  3PRM B;  1V1P B;  3PT2 B;  3GP7 A;  4US9 A;  1XCT L;  1MPE A;  3DHG C;  4IWP A;  1S1Q B;  3IFW B;  3WCQ A;  1WGG A;  2MBE A;  4AWJ A;  2YEP B;  1H8C A;  3ZJV A;  1I35 A;  1K52 A;  3ALB A;  2UU7 A;  1PGB A;  2L05 A;  4XWW A;  3PLU A;  3K9P B;  3UF8 A;  2KFK B;  3AE6 B;  2H88 B;  2VH2 A;  4HPL B;  4GN1 A;  3EFC A;  2IY1 B;  2QIE B;  3HVD A;  4A3O A;  4II3 B;  1UWM A;  4MH0 E;  3WA0 A;  1WE6 A;  3IT4 B;  3VH3 B;  2G4D B;  3UI3 A;  3T9L A;  4KIK A;  4B0E A;  1WXM A;  3GS2 A;  2WXH A;  1S3S G;  3P4Q B;  3DBL I;  1FXT B;  4KZC A;  3RI7 C;  1NEK B;  2BB6 A;  2L00 B;  1NI2 A;  3ZNI D;  2WXL A;  3ZW3 A;  2ZVO A;  4XDC A;  3W1S A;  2D2Q A;  2MBB B;  1V97 A;  3VTU A;  1FXA A;  2GBJ A;  2BGF A;  3SR6 A;  1RWS A;  1WYW B;  1SIF A;  4W9L A;  4BFR A;  2QDF A;  3TEZ A;  1MFW A;  1CMX B;  1EM7 A;  3PV1 A;  2I38 A;  4WJQ A;  1WX9 A;  1QOG A;  3Q8B A;  1ESF A;  1OTR B;  1P7E A;  1WFY A;  2VZK D;  4EFO A;  2KDF B;  4YWG G;  1M4V A;  2J52 A;  4EZK A;  2MBO A;  2WDV B;  1E8Z A;  5G5G A;  1YMH E;  1XO3 A;  2CHZ A;  3MJW A;  1X1M A;  4IM2 A;  2C9W B;  5IA7 A;  2LEK A;  1LFD A;  1F2R C;  1LGR A;  4YSZ B;  1JWS D;  2RDG A;  2M1M A;  2BW2 A;  1BXT A;  3AM9 A;  2RMM A;  1RYJ A;  2KWD A;  4A90 A;  2D3B A;  1P0R A;  3ZNG C;  3TEX A;  5JZE B;  4KSK C;  4LK0 M;  1XF5 L;  2M17 A;  3VTV A;  1E7U A;  2C7H A;  2KT7 A;  2DNF A;  2KMM A;  3ML8 A;  3RMK C;  3DBR B;  2INN E;  2OOB B;  1E8Y A;  3TL5 A;  2K6D B;  3C19 A;  2TSS A;  3FKY A;  3B9J A;  3ZUN A;  3V6E B;  1AWD A;  2O6V A;  3L16 A;  2GBN A;  1C4C A;  2GBK A;  1KH0 A;  1D5M C;  3A4S C;  5JXV A;  1MI0 A;  2QEJ C;  1YD8 U;  3DVN V;  1DOI A;  1QIL A;  1DGJ A;  1OEY J;  2JYT A;  3DHH C;  2M56 B;  1SF0 A;  5FKA C;  2XEW A;  4YTM B;  4M0W B;  3AE8 B;  4MM3 A;  3KYC D;  2PLP A;  1E0Z A;  5DPR A;  3H8H A;  4PYZ A;  4I6P A;  4GXB A;  3I5J C;  2KTF A;  2JF5 A;  1F1H A;  5BYQ A;  2JSV X;  3KW5 B;  4HEA 1;  3X23 A;  2JXX A;  2JZZ A;  3Q8F A;  3VRA B;  2KWU B;  2KTR B;  3QC8 B;  3OWE B;  2QIL A;  2WU2 B;  2JUO A;  3QAQ A;  2BB5 A;  2G9H D;  2K39 A;  4NJC A;  3QCA A;  1PGA A;  4GDL B;  1XD3 B;  1VLB A;  2ZPY A;  2BYT A;  3WAM A;  1TS3 A;  2KWC A;  3KLS X;  3PRZ A;  4HKQ A;  1YNT E;  4WWO A;  1FRR A;  4F1S A;  1SSN A;  1FFV A;  2V3P A;  5C23 A;  1B9R A;  1UWX A;  2J0K A;  4HRS A;  3ZRC A;  2KJR A;  2YVC A;  1JML A;  3ZDT A;  4KV2 A;  5JH5 C;  4YSY B;  2ONQ A;  2N1V A;  1UH6 A;  2K25 A;  3ECI A;  3ML9 A;  4A9A A;  4REZ A;  3LYY A;  3TUO A;  1Z5S B;  2KDE B;  3DHI C;  2NTT A;  2KTR A;  4W9I A;  2MEK A;  1TZ1 A;  3ETR A;  4I6L B;  3ZQ4 A;  4YSX B;  2V4I B;  5BMI A;  1PGX A;  2QJL A;  4KDL B;  2KWV B;  3QHT A;  2KHW B;  2LJI A;  1BT0 A;  1WJ4 A;  2MQJ A;  1VJK A;  2LXA A;  3VUY A;  2PKO A;  4ZHO A;  3V60 A;  4A6Q A;  4JE3 B;  3CF6 E;  4KSL C;  2UYZ B;  1R4N I;  4LNN A;  1YX6 B;  2DAF A;  2RPV A;  2W3S A;  1XT9 B;  3E56 A;  3HRD D;  4HKZ E;  4JL9 A;  1ZE3 D;  2HDE A;  2WXO A;  4NJ7 A;  3U30 A;  3NVZ A;  3PRP B;  2IO3 B;  5AUK A;  3PZ8 A;  5BMG A;  1WZ0 A;  4HPM B;  3Q14 C;  3QA8 A;  2M0X A;  4L23 A;  4E74 A;  4LNO A;  2GBR A;  2HJ1 A;  1WGY A;  1UBQ A;  1FCL A;  1WXV A;  3ZO5 B;  4IM3 A;  4OVU A;  3MJ5 A;  4NJ6 A;  2WDT B;  4Q2J A;  4WAF A;  4E3C A;  2JVC A;  4OZC A;  3Q69 A;  1WY8 A;  2FUH B;  4EE2 A;  3DQV A;  1B1Z A;  1FEH A;  3BK1 A;  3SD5 A;  1FO4 A;  1YQ3 B;  2LGS A;  1IBX B;  3HIZ A;  2NPT B;  3DBS A;  1IGC A;  2MW5 A;  1WF9 A;  4PYU A;  1FIQ A;  2ZNV C;  1L5P A;  5DPT A;  3GOE A;  2KO3 A;  2V1Y A;  1IPG A;  1C78 A;  2NBV B;  3A1Q B;  4DK5 A;  4KGR A;  2PPH A;  4UDU C;  2GLS A;  4NNJ B;  3L0W B;  3A9J A;  4I6N B;  1OGW A;  4BKT A;  1JW9 D;  2Y5C A;  1C9F A;  2RPQ A;  1HEZ E;  1LXD A;  4DBG A;  3B0A A;  4W9F A;  3ZLZ A;  3ZVV A;  4WWP A;  1BUI C;  1SE3 A;  2WX1 A;  1Q0W B;  1HTO A;  1IUE A;  2BWF A;  2INC C;  1WGH A;  2NS5 A;  3OJ3 A;  1XLO A;  2FCM A;  2ZJD A;  4ZRQ A;  2CS4 A;  3A1Q A;  3KWL A;  5TR5 A;  3RNF C;  1K53 A;  3HK0 A;  2V3N A;  3HHM A;  3KVF B;  2ZZP B;  1RFK A;  4G11 A;  1YJJ A;  3R7R A;  4KZ0 A;  3VAW A;  3IG3 A;  1WX7 A;  2D5G A;  3DVG X;  3EUB 2;  1TKY A;  2Q5W D;  1WXA A;  1EF1 A;  4BOS C;  3LDZ E;  3ZXR A;  4XX5 A;  4TV3 A;  1PQS A;  1XQQ A;  1TS2 A;  1XEE A;  1PDX A;  3EFU A;  1UGJ A;  2DBY A;  1V6E A;  3AE3 B;  3TEW A;  4TQ0 A;  3HM3 A;  3AEB B;  4K81 A;  4WAA A;  4G3X B;  3PRE A;  1QZE A;  1V86 A;  2L0F A;  4GGQ A;  3Q8E A;  2K3U A;  3B2G A;  4IM0 A;  4BOZ B;  2IO0 B;  2J53 A;  2B3A A;  1N60 A;  3TIX A;  1IGD A;  3AV8 A;  4MGK E;  3V05 A;  3AED B;  3ZJT A;  3DBR I;  2NVU I;  4K3B A;  1ET6 A;  2IYD B;  2J42 A;  3W5U B;  4DDG D;  3H1U A;  1AAR A;  4PS8 A;  2D3C A;  2WXR A;  5FR6 A;  1CZP A;  3L10 B;  2XK5 A;  1JAL A;  4GLS C;  1DOX A;  4NQL B;  4AQ7 A;  2N9P C;  5AZH A;  4TKN A;  2RDB C;  4X57 B;  5C3J B;  1I7H A;  2KDB A;  3M95 A;  4ICV A;  4HWI B;  5BYR A;  3ENE A;  3U7D A;  2WDR B;  2WWZ A;  1WJN A;  2E3T A;  1WR6 E;  3ABV B;  3BZD B;  2CJN A;  4ZRP A;  1V5O A;  4IC7 B;  2AWT A;  1C76 A;  1E10 A;  2N1W A;  3TMP B;  4LNF A;  1FNU A;  4ITK A;  4ZHP A;  1SJH D;  4H2A A;  4HDO A;  4ANV A;  3AN1 A;  3S2A A;  3Q8C A;  2R2Q A;  2IGH A;  3VQI A;  4G50 A;  2MCN B;  3L54 A;  4J3O D;  3WAP A;  1VZ8 A;  4YTN B;  3EHV A;  4NZL B;  5LLI A;  1AN8 A;  5L83 A;  3VVW B;  2Z59 B;  4HK2 A;  3EEC A;  3ZTD A;  4XE0 A;  2IZV B;  3AH7 A;  4DXF A;  2QC8 A;  4ASW C;  3DDC B;  3FAH A;  4EZL A;  1QOB A;  4IOI E;  5IKC M;  4MGY E;  4W9E A;  4DHZ B;  4HDQ A;  3AEG B;  2WS3 B;  3A33 B;  4NAW A;  1NI3 A;  2WXK A;  3Q3O C;  4ACF A;  4URK A;  1KF6 B;  3CST A;  2EKI A;  3RYT A;  2M4N A;  4P7I A;  3H7P B;  1TY2 A;  3ZXV A;  5JHA A;  1QF6 A;  3MHZ A;  1ZUD 2;  2KFJ A;  4ANU A;  1FRD A;  2INP E;  4OVV A;  4J6I A;  2QCZ A;  1WIA A;  1ACC A;  4HJG E;  4DWF A;  2LI5 A;  3BVM A;  4FJY A;  4ANW A;  2L83 A;  2FCQ A;  3T8M A;  3I9V 1;  3IAS 1;  3J9C A;  3BVZ A;  3H9D A;  5D7G A;  3URY A;  1YIW A;  3JSV B;  3ONS A;  1JWU D;  1Z2M A;  1N5W A;  2H89 B;  2K0P A;  5E6N A;  4C00 A;  2WXG A;  2K1F A;  2K8C A;  2MWS B;  4MAC A;  3FIL A;  3H7P A;  1C4A A;  1L0X B;  4RM9 A;  3X0W A;  1TGZ B;  1V1O A;  3T3O A;  2YEP F;  4FJV B;  1XLN A;  2WXP A;  2Y5B B;  2W55 A;  2WXJ A;  4AOF A;  4EOY A;  4L2Y A;  2NCN A;  4ANX A;  1JRU A;  3I57 A;  3GB1 A;  2MLB A;  2V3S A;  1TS4 A;  2SAK A;  4RGT A;  4B95 A;  4OZB A;  1J7A A;  2O6V B;  3JSV A;  2RR9 A;  3OJ4 B;  5H92 C;  1UEL A;  1L4D B;  4W9K A;  1JRO A;  4K7U A;  1HZ5 A;  2D3G A;  2XN9 C;  3MC0 B;  2N9X A;  1T0Q C;  2EEL A;  2L7R A;  2JZP A;  1FMA D;  1BML C;  4WJP A;  4GB9 A;  4FLH A;  1E7V A;  4MM3 B;  2G1E A;  5JHB A;  3PHX B;  2LGD A;  2KQ7 A;  3V62 A;  2LUE A;  4JWU C;  4G0N B;  1L6U A;  1WH3 A;  4ZRI A;  2I1K A;  1RM6 C;  3AMZ A;  4B0M A;  1MVK A;  3RNB C;  2IO2 B;  4KGS A;  1AYF A;  2PVO D;  4RF0 A;  4XWT A;  3PO0 A;  4C7Y A;  2KAC A;  3DPD A;  1LQB A;  4IG7 B;  2DX5 B;  2KVZ A;  3JW0 X;  1LO5 D;  1N61 A;  1F52 A;  1GAQ B;  4AJW A;  2PTL A;  4XZ4 A;  1I42 A;  2K5P A;  2SEB D;  2D3A A;  5AUI A;  2N0S B;  1TJE A;  2KD0 A;  3KYD D;  2CHX A;  1NBF C;  2OJW A;  3PZD A;  4PS7 A;  1GOZ A;  1WE7 A;  2LHE A;  3ZKJ C;  2LWP A;  2CR5 A;  2IBI B;  4GU2 A;  2K6Q A;  4WWM A;  2KOX A;  2NBU A;  1ET9 A;  1L6V A;  4W9G A;  3IHP C;  1Q10 A;  4OZA A;  4FJZ A;  1ROE A;  1SEB D;  2GMI C;  1WYG A;  2AL6 A;  3RT3 B;  1KTK A;  5C1Z A;  4PT5 A; 
#chains in the Genus database with same CATH homology
 1N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...