1N6ZA

Solution nmr structure of protein yml108w from saccharomyces cerevisiae. a novel member of the split bab fold. northeast structural genomics consortium target yt601.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 12.3 kDa protein in ZDS2-URA5 intergenic region
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08987 DUF1892 Protein of unknown function (DUF1892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.250 Alpha Beta Roll Ubiquitin-like (UB roll) YML108W-like 1n6zA00
1N6ZA
chains in the Genus database with same CATH superfamily
1EWYC 1WM2A 4IM3A 2QCZA 3IBEA 3MC8A 2H88B 2NTTA 4BOSC 2JU6X 1XCTL 2I38A 1Q10A 4WURA 4CQNA 4LLGM 2KWCA 2BS3B 1I35A 4E71A 3PZ7A 2GB1A 3C8YA 3SFEB 3Q14C 2QIEB 2WXJA 4NQKE 2DYOA 2KFKB 4K3BA 1XQQA 2LGDA 4KDLB 4ASWC 3FC4A 3QQ8B 4FA6A 2G1EA 2NR2A 3NUHB 2CHZA 1EU3A 1Y8RC 1VZ8A 1T3QA 3ZKJC 3MTNB 2O2VB 4H2AA 5FR6A 1E9MA 4DHJD 2INDC 2OEDA 1G6JA 1HZ6A 1ET6A 4NAWA 4RFBA 3R2TA 3EFCA 1JWUD 4KVGB 4GN1A 4GDLA 5IA7A 5J2RA 3SDLC 2INCC 2N1WA 4DBGA 3QWZB 3DVNV 2PEAA 2M0AA 2GBJA 3J9CA 2N7DA 3I3TB 1HA5A 1XEEA 4C80A 4N9F4 4KGTA 1GOZA 3DBRB 2EELA 2JSVX 2AWTA 2AX5A 2BYFA 1WXSA 4TMAB 4YTMB 3CSFA 1N6ZA 4GDKA 2LASA 2KZRA 4XGAB 3R7RA 4OVZA 2AYOB 2JX5A 1V6EA 2HJ8A 3A9KA 2H89B 4HKQA 4C7ZA 3AEAB 4P7IA 1ZP0B 1F1HA 3A9KB 1IP9A 3BYYB 4ARCA 1F2RI 3DWGC 2I2YA 5DPRA 2VH1A 2GOWA 1TGZB 2MP2A 2N7EA 3N32A 1MG8A 4J3OD 1JWAD 1RFKA 1WGRA 4CYEA 4IM0A 2RR9A 1UZXB 2ZNVC 2LGYA 2RDHA 3ZIMA 2AL3A 4HROA 1WGGA 1HTOA 2KTRA 3KYDD 5D3DA 2PMVA 2Z0DB 3TEZA 3HM6X 1V49A 4MGKE 2LRUA 3FILA 1QKZA 2KYWA 4P6VF 3DDCB 2K0PA 1EWCA 3NS8A 4OZCA 4WH4A 2N1VA 3RZWC 4PYZA 3SD5A 1WF9A 2WXLA 3RN9C 2O6VB 4WWPA 3UQBA 4JGHB 4ZHPA 1ZKHA 1WSPA 2KMAA 4ZDVA 2MRPA 4X57B 1N60A 3QJZA 4A90A 3BK1A 3GE3C 3ML8A 3NZUA 1Q0WB 1XT9B 2GRIA 4XYCA 4ANVA 1PQSA 1EUVB 4MM3A 1WX7A 4ICUA 4LNNA 1XLQA 1FO4A 2K22A 3NRZA 3RYTA 2PJHA 2KN4A 3ZLZA 1FCCC 3AE2B 5T8IA 2JWZA 1EM7A 2AQ3B 1SEBD 1HQRD 1MFWA 2IGDA 2V9HA 2HJ1A 1SE3A 2KJRA 1WWTA 3W1SA 1N5XA 3KVFB 1GAQB 1TTNA 4LDTB 2N0SB 3ALBA 4JLCA 1OEYA 2GI9A 1V1OA 2C7NB 5AZFA 1F77A 3ZVVA 3KLSX 4M8NA 3HVDA 4RH6A 2MBQA 3V61A 3KQ4A 2KD0A 2NMQA 1YN5A 3VUWA 3P4PB 1V8CA 3SR6A 2GMIC 4OVUA 5KHQA 2MJDA 3N30A 3ZNHB 3KUDB 1Z5SB 2I1JA 3LJ3A 4DK5A 5BMHA 3DVGX 2J0MA 3KUZA 4GXBA 3TEWA 1IBXA 3BINA 4Q2JA 3P42A 1KH0A 3DHIC 3ZTDA 1KJTA 1P3QU 3I9V1 2JZPA 2LVOA 3DVNU 2AEHA 4IKGA 3UF8A 1PUTA 1YMHE 4A20A 1TYGB 2JF5A 3WAPA 2JXXA 1XLNA 3RCZA 3CWIA 2KJHB 2HE7A 5HFYA 5D3IB 2IO1B 5HKHA 3BVZA 1SIFA 2WXRA 3LYYA 4NJ7A 1D3ZA 4MGZE 4GB9A 3B08A 2LWPA 2LI5A 3AB5A 4IWQA 2N4FA 4NAWB 1VCBA 2KWUB 1T5XD 1N63A 2YEPF 4K3CA 2JQRB 3VTUA 1DYQA 3DBLB 1YQ4B 2KTFA 5IN7A 1YJIA 1TZ1A 2L8JA 4ACFA 2DNFA 2Y5CA 3H7PB 3GS2A 1FXIA 3PLUA 4YSXB 1UF0A 1SB3C 3L17A 1C79A 1IPGA 4KIKB 3RZFA 1F52A 3HUIA 4M01A 3WANA 2FUG1 3ZJVA 4L2YA 4KIKA 1WZ3A 3JSVB 4BKSA 1SJED 4W9CA 1FFVA 3PVLA 2KQ4X 4IWPA 2KN5A 4B9KA 4I6LB 2WXOA 3BYTB 5AZHA 4AJYB 4TSSA 1KRHA 3UGBB 2BB6A 1NDDA 4ITKA 3PV1A 3L16A 2WDQB 3ZRCA 3APFA 4MGYE 3VTVA 1UNSA 3UIOB 2DZMA 3ENEA 3KW5B 2M1MA 1XLOA 3X0WA 4NPNA 3W9CB 2Z0EB 4HJKA 4HKZE 2J4XA 1SJHD 2FCSA 3AEGB 3PPAA 4GU2A 3TCAA 2L52A 1ISNA 1MPEA 1SE9A 4M8MA 2DLBA 4RGNA 1H8CA 1XD3B 1I7HA 1QT9A 1ET9A 3PRMB 4XWWA 4GDLB 3BZDB 2WXIA 2NPTB 3PRZA 2OHFA 4C56C 3P4SB 4F1SA 2KDEB 3Q3OC 2BS2B 1TY2A 2M8SA 3VUXA 1HZ5A 2RPQA 4BAXA 4RGMA 1YQ3B 2G9HD 5HHDG 4J6IA 4FBJB 1YN4A 2JZ3B 2Y5BB 3APCA 2M19A 4LK0M 5TSSA 3TL5A 2L3ZA 3NZ3A 2NCNA 2INNE 1HTQA 1GC7A 2CKHB 4OZBA 3NVWA 3RD2A 1L4ZB 2HD5B 1JMLA 4ANXA 5AUIA 4LNKA 4LNIA 4WJPA 2XK5B 2DX5B 3P4RB 1V1PA 4W9EA 3K9PB 3R66C 2KDMA 3SFDB 3N20C 1WXAA 2PKOA 4I6NB 2K6DB 4M00A 3JSVA 1D5MC 5L95C 3KYCD 3VH3B 2KWDA 4NAMA 1VRAB 4NZLB 3DOWA 4FHKA 3QAQA 1BXTA 2PVOD 4FADA 1QLBB 4F7ZA 4A3OA 2KKCA 4S0RA 2L32A 1ZXIA 2FE8A 1DOYA 5BYSA 3Q6BA 2L83A 2O6VD 4TQ0A 5KHOA 4TQ1A 2KLGA 1FNUA 3AU4A 2D3CA 1C4CA 1PGXA 3ZNID 2WYQA 4FJZA 2BYVE 3C0RB 3IXSA 1I4PA 1CMXB 2WXKA 1WGKA 1OQQA 3H8HA 4GSWA 3VAWA 3KWVA 3ZXVA 2PTLA 3PZ8A 1YQBA 3T9LA 2QMTA 3BIID 4EOYA 3TMPB 3Q8EA 2OOBB 1WXQA 2D11A 1ZUD2 2ASQA 2LEKA 1D5ZC 1UBIA 5CHVC 2JYEA 1SGHA 4W9JA 2A5UA 4RM9A 3ABVB 3VVWB 3ZNGC 1S3SG 1WRIA 2BGFA 4N59A 5CTRC 2K8CA 4B0MA 2AL6A 4KSLC 3ZYYX 4FHJA 4WAAA 2MJ3A 4WJOA 4YXDB 1X1MA 3JW0X 1ENFA 4HXDA 3RNFC 2GBRA 3MFGA 1E90A 2JPHA 2RDBC 1P9DU 2V3SA 3QC8B 1Y56A 4I6PA 2NVUI 1MI0A 1FD6A 2CU3A 2PE6B 3RT3B 1WYGA 1GUAB 2J42A 4WJNA 3N3KB 2LGSA 4PS8A 1FCLA 2ZEQA 1AWDA 5IAAC 3SEBA 5LXIB 3IAM1 3ONSA 3T3OA 1PDXA 3LDZE 4HEA1 3EC8A 1ZXHA 3AU5A 4MH0E 3AE6B 3AM9A 1WM3A 2Y5PA 2MA9B 4JWUC 2IYDB 2KC1A 4DQOC 2KFKA 2G3QB 2KMMA 3LB8C 4WJQA 1I42A 2LRWA 3L4PA 5E6JA 3KWLA 2FCMA 4AOFA 3Q3NC 1NVID 4NJ6A 4OHJA 4R3DA 2MBEA 2TSSA 4NY0A 3AE7B 2IO0B 2WXNA 5AZGA 1TS4A 4YL8A 5H92C 1UBQA 2QSDA 1LFDA 3AE4B 1FRRA 2RPVA 1TS2A 1L7YA 1IYFA 3V05A 1OTRB 3APDA 3HM3A 2KC2A 2V3NA 2DZJA 5TR5A 1C77A 3N1YC 2I1KA 5EE9A 2GLSA 3Q8AA 1IGCA 3M63B 4LNOA 2ZJDA 2NBWB 2IO2B 5BYQA 1C4AA 2REXA 3U7ZA 5CHFA 1CZPA 4BBNC 3MHSD 4MDKE 4NJCA 3TEYA 1KLUD 3PS6A 2BW2A 1VLBA 4W9LA 5JXVA 1L6VA 3OLMD 2MEKA 3OJ3A 4AWJA 1WRDB 3D32A 1C3TA 2N9PC 1D5XC 2L7RA 3GE8C 2G4DB 2QJLA 1WE7A 2BWFA 3IT6B 4MGIE 2MP2B 4KDIC 2UYZB 1STEA 5HG2A 3DBHI 4USAA 1RWSA 2BS4B 4IUMB 4EZKA 1RM6C 1EO6A 1EF5A 3DHGC 3HRDD 1E7UA 3BVGA 1P1AA 4IC7B 1RFAA 3B1LX 3TEXA 4ZYNA 1LGRA 2D5GA 2ZVNA 1XO3A 2JWUA 4WWNA 4W9DA 2WDVB 2VZKD 4RCOA 3V6CB 1WJ6A 2JUOA 3T3NA 2MW5A 1J7BA 2Z59B 1UELA 2WLBA 1C78A 1LQBA 2IZVB 3ZW3A 5G2NA 4HPLB 1NI3A 3AE8B 4IW0A 3EGRA 5EDSA 4HCPB 2QEJC 3N1ZC 4G50A 3FILB 1J7CA 2WDRB 2KVRA 1JWSD 1UH6A 1NYRA 1KF6B 2G45B 4KGSA 1EU4A 5IOIA 2DWQA 1U4AA 2NPTA 1NBFC 3TIXA 3AE5B 2C7MB 4LCDE 1YX5B 3BVMA 3T8MA 1OEYJ 2WHIA 1YOVB 2B76B 1FRDA 3RNAC 1I4HA 2LXAA 2N7JA 5EE1A 1E10A 3RULA 3DBHB 1F0ZA 4US9A 2LJ5A 4MELA 3H7PA 1AYFA 4XC2A 4BKSD 3AE1B 1WXMA 2D07B 2ZNVB 2WXPA 2PW9A 4EFOA 5IKCM 3WAMA 1RLFA 1E8YA 4G3XB 2INPE 2V3PA 3UIPB 3AMZA 3ZJTA 4P1CC 4MACA 2KFJA 3VRAB 3NVYA 1GB4A 5C1ZA 1WJUA 1MG4A 4DXFA 3LXFA 1FMAD 4MT5A 1GNUA 5CX3A 1FIQA 4IG7B 2BF8B 3Q8BA 5L83A 1QOGA 4IDIA 4BFRA 4EE2A 4C4VB 3OWEB 1KTKA 1N5WA 2LVPA 4EZLA 3MP9A 4HVBA 1K50A 2ICIA 3ECIA 2MCNB 3FAHA 4YWGG 3QIJA 3QARA 3MC9A 4XWTA 4ANUA 2M56B 3IVFA 2ZVOA 4C00A 4GLSC 2VRRB 3ZGZA 3NZSA 2KTRB 3CIRB 2KVZA 3DPDA 3WALA 4URKA 1VZ6A 2WQYB 2W55A 4EZJA 2KK8A 3Q3JA 1YD8U 2XBBC 4DHJB 1TKEA 3L54A 4G11A 2CJNA 2IBIB 3CF6E 2E6XA 1R4MB 3M95A 5BYRA 2XK5A 3VRBB 2AQ1B 1Q1OA 2J53A 2MBOA 5D94A 2VZKB 3IAS1 1LXDA 3HVZA 2R2QA 3IFWB 3RNBC 2KANA 3VTWA 1TS5A 4LTUA 3NVZA 2JRHA 2B3AA 2LD9A 1MVKA 2CHWA 1K53A 1WX9A 1QQRA 1TZOA 1I4GA 1S1QB 5BMIA 3ZRFA 4IWOA 1F2RC 2WXHA 2WXGA 3DHHC 4C7YA 4DXGA 3L08A 4XDDA 5LNK1 3RI7C 3R2IA 4ZOHC 4MH8A 4REZA 2WXMA 2FIFA 3IT4B 2J0JA 2WX1A 3BY4B 3B9JA 1FXAA 3U30A 3NS1A 3W5UB 5D2MB 2LGIA 1T6BX 2DAFA 1WFYA 2JXTA 2MHJA 2QHOA 2BKRB 4ZRPA 1VDVA 2KNBA 3RNEC 1YJ1A 1FEHA 4AQ7A 2BTEA 1ROEA 4B6WA 2RMMA 2IY1B 4A55A 1SE2A 3CSTA 2JVCA 5C2TB 5DPWA 3I57A 3O65B 2C60A 4LNFA 3WCQA 1GPXA 3QCAA 2L00B 1WX8A 2IO3B 1E7PB 1T0RC 3A1QA 2HDEA 2V4LA 2MX2A 2CHXA 2KWVB 4QAYA 1JROA 1WR6E 2LGXA 2OJRA 4W9FA 1E5WA 4EKUA 3HIZA 4XDCA 2WU5B 3ZDTA 1D6EC 2DHZA 1N62A 1SIJA 4MEMA 1YJJA 4UDUC 2PE9A 3AULA 1JWBD 3WAOA 2LHEA 2R2OA 1OQRA 4FXCA 1FNVA 2AQ2B 5AEKB 3QK0A 5H8YE 1VJKA 4TKNA 4XX5A 1C4PA 1Q5WB 1JALA 2FCQA 5G5HA 3AEBB 4L23A 3PHXB 2KX3A 4KKJA 2N9EB 4LJOB 2IPKD 3B2FA 2BYTA 1JWMD 2C9WB 2MQJA 3ZJUA 3Q2AC 3I5JC 1FNWA 3RUIB 2JY6A 3A9JA 2NBUA 3Q69A 3GB1A 4FLHA 1TBEA 1T0SC 1J8CA 1ZDXA 1R4NI 3EA6A 3W5VB 1I4XA 1P7EA 2CR5A 2JT4B 1FFUA 1TJEA 3V3XA 3I63C 2WS3B 4FJYA 4ZYSA 2V1YA 3EHVA 3V60A 2L76A 2D3BA 2LUEA 1B1ZA 1WGDA 3EUB2 4GIVA 3L13A 3NVVA 2BBCA 3U2SC 2LVQA 3Q8CA 4AJWA 4C4VA 2D10A 2ZPYA 4A3PA 3ZUNA 3UI3A 1XLPA 1KM7A 3AE3B 1JRUA 5DCNA 1QOAA 4RGOS 2JYTA 3NG0A 1WE6A 3HK0A 4B0EA 1T0YA 2LJIA 1L6UA 3PSEB 1AN8A 3ZTCA 2E3TA 2K8BA 2HTME 2FIDA 2IGHA 3VR8B 1LM8B 2R61A 1OGWA 1AARA 1V5TA 2WXQA 3TSSA 3PO0A 1E7VA 3ZNZB 2IY0B 1WH3A 1JRPA 1ZE3D 3ETRA 3U4EG 2K9XA 3DWMA 2IGGA 1ZDVA 3VFKA 1YN3A 1QZEA 1TT5B 3AI5A 1VR9A 3N9YC 2UU7A 3MHZA 4KV2A 3AECB 5FK9C 1SE4A 3P4QB 1EF1A 5CHWA 4HWIB 2GBKA 3BWUD 3QA8A 4S17A 3JYUA 5E6PA 3R8BA 2JRIB 3RMKC 2PIAA 4GMVA 4M02A 3OAWA 4RNAA 3B2GA 1OFFA 1L0VB 1UD7A 1WY8A 1WXVA 1GJZA 2CS4A 2M0XA 2YLMA 4RMAA 1IUEA 2EKIA 3VDZA 4YT0B 3PGEA 2KO3A 1A5RA 2SEBD 4HLEA 4DWFA 4HPPA 1YX6B 4RGTA 2UWQA 3A4SC 1QOBA 1J7AA 1R4MI 3V6EB 3VUYA 1K52A 1OQYA 2LMCA 2J0KA 3RNGC 4G0NB 2ZPNA 3EFUA 3A33B 1WGYA 1MJDA 1L4DB 4CO7A 4RM8A 1P7FA 2L1AA 1P98A 4M0WA 4LJPB 5AUKA 1FM0D 1D4BA 1E0ZA 3C19A 1LO5D 2YEPB 3V62A 2LHDA 1TKYA 4II2B 3DBSA 1PFDA 4JIOU 1TY0A 3AH7A 1V97A 3AV8A 1GC6A 4NQLB 3URYA 3TJPA 1KOTA 4IM2A 1E8WA 5JH5C 4BOZB 1RRBA 3GOEA 3Q3MC 3M3JA 5C23A 3B0AA 5GXGB 4BZAA 2MWSB 1XCQL 2WWZA 1H4RA 1WMHB 4HDOA 1N61A 5LXHA 2BB5A 2KHWB 4PS7A 2LUMA 4F8CB 3AEEB 4YTPB 5DPTA 4FN2A 3W1SC 5FR3A 4L1BA 2V0GA 4ICVA 4WQMA 3FKYA 1R4NB 4DHZB 5D6JB 3L10B 2K25A 4JE3B 1V5OA 2D3AA 2X38A 4YTNB 4MM3B 3DVGY 2ON8A 4A8XC 3GZNI 3H6NA 1ACCA 5E6OA 3MC0B 4HCNB 1C1YB 3RFZB 1ZW7A 1CQVA 2DZKA 1UGJA 4EUTA 4KZ0A 2KOXA 4ZHOA 3VH4B 3DBLI 4E3CA 4A6QA 2V4IB 3VHTC 2KMCA 2ZCCA 4W9IA 2C7HA 5C3JB 2WGSA 1CK1A 2KDIA 3W2DA 4HRSA 2GBMA 4YSZB 2RD0A 3PZDA 1T0QC 2DZIA 1PYWD 2WNMA 4JX1C 5G5GA 1V9JA 3PRPB 1SSNA 2WP9B 1F9JA 3NJTA 2QDFA 2K6QA 1DGJA 2BT6A 1GB1A 4KX6B 1UWXA 1K8RB 1C76A 2K3UA 3AN1A 5IO9A 1QILA 2W3SA 4WWOA 4K7WA 2W82A 5HI1A 4IOIE 2CJOA 4W9GA 2QILA 1I4RA 3MJWA 2KDBA 2MLBA 3WA0A 2KQSA 1L5PA 2W3RA 2Q5WD 2JZZA 3IG3A 1RYJA 2M17A 2CU1A 2LZ6A 2BYEA 2KJ6A 2QC8A 2N9XA 2WU2B 3SU8X 1NI2A 1J19A 3QX1A 3S2AA 1WIAA 4ZRKA 1V80A 1M94A 4GOCA 1QOFA 1PGAA 2D3GA 5DPSA 1NYQA 4DDGD 3KUCB 2HTHA 4XZ4A 1RAXA 2IDYA 2XEWA 4M0WB 2YVCA 2MBBB 3X23A 5LLIA 2A4ZA 2W54A 3E9SA 2WXFA 3ZQ4A 2ZW0A 3U8ZA 1ZGUB 5FKAC 1V1PB 5D7GA 5IP4D 1NENB 5JZEB 2BKFA 3U7DA 3PLVA 2OJWA 5BMGA 4WQOB 2N9LA 3H7SA 2X8XX 1KFYB 2PVGC 1L0YB 1YIWA 2DYMA 2BQQA 1MHXA 4PS3A 2RDGA 1P0RA 1SBBB 5GMVA 1XXGA 4GDKB 2PPHA 2W9NA 1HEZE 3DCGA 3TUOA 2K5PA 2MSED 3GP7A 3SHQA 3M62B 3PT2B 2MBHA 2K1FA 2RSUA 4KKIA 1FPYA 4BKGA 3K9OB 2KXJA 2IJ0A 1TS3A 2G4SA 1B9RA 4TV3A 2C5LC 1E8ZA 4O1NA 2ZW1A 2ZCBA 4AS1A 1E8XA 5J17A 2FCNA 5E6NA 3JVZX 3PREA 3PTFC 4ARIA 1CJEA 2O2VA 3AXCA 3VXWA 1WZ0A 4WIPA 2KQ7A 1TIFA 3NOBA 2FUHB 4GGQA 4ZRJA 2GBNA 1V81A 4MJSB 2DBYA 1C9FA 2L0TA 4ZRQA 1UUPA 4PK1A 4MJSA 5JHAA 4WWMA 2WDTB 3DQVA 3R7QA 4JPSA 2M4NA 1JCKB 2L05A 1UGMA 2O6VA 4HPMB 4FJVB 3QHTA 1BT0A 2LXCA 4A9AA 5MPOA 1L0XB 3UQAA 1IBXB 3E56A 2J7QB 3Q8FA 5EE3A 4BBNF 1NEKB 1XF5L 4K1RB 4WAFA 2KACA 1R7SA 4YSYB 1L2NA 3OJ4B 4EEWA 1K51A 1ZOYB 3RNCC 2KT7A 2MH7A 1SXTA 3GZNB 4D2KA 1TKGA 1HE8A 1UWMA 3A9JB 2ACZB 3TBLD 4W9HA 2XNAC 1WJNA 1VD2A 4W9KA 1FXTB 4K81A 4HDQA 1ESFA 3NHEB 2DAJA 3P63A 3A4RA 3CMMB 2EKEC 3MJ5A 4DDID 3P1MA 2FBWB 3VQIA 2RGFA 3W1YA 2KDFB 4BVUC 4KZCA 4CHKA 2FAZA 3IHPC 3UINB 4PT5A 4DXAB 3DBRI 5I4DA 4II3B 4LDTD 4US8A 5EE0A 3AEFB 2VH2A 4K7UA 4KSKC 4MSMB 1WI0A 2J52A 2KX0A 2L0FA 3Q3FA 3ML9A 1DOIA 1SF0A 2N9KA 1YNTE 5G55A 3H9DA 3ZXRA 3BK2A 3VR9B 5JHBA 1I4QA 1KLGD 3WIMA 1WR1A 3O13A 4ZRIA 4HJGE 2MJEA 1E6EB 3AE9B 2XN9C 3ZO5B 1IGDA 2D2QA 2BWES 2Z8LA 1ZPSA 3A1QB 4E74A 2ZZPB 1V2YA 5J18A 1WYWB 2DENB 3L0WB 3EECA 2NS5A 2BVCA 4DHZE 1WMHA 4JWSC 4B95A 1QF6A 4AP4C 3N1XC 2K39A 1BUIC 4JQWC 3RPFC 1WJ4A 3KH0A 3P2BA 2K8HA 1VZ7A 3R3MA 1J0GA 3NY5A 4PYUA 3AEDB 4NNJB 4HK2A 4AUQC 4N6EB 2KAJA 1KLVA 1WGHA 4ANWA 4K7SA 2DYBA 4FULA 1BMLC 2FNJB 4N58A 4XE0A 1V86A 1GG3A 2PLPA 1JQ4A 1HXYD 2BPSA 3H1UA 4KGRA 1A70A 2WX0A 4JL9A 2LFIA 2KLCA 1AW7A 4P16A 1PGBA 4P1BC 3ZDMC 3HHMA 1M4VA 3OG5A 1DOXA 1MHHE 3PHWB 4BKTA 2Y3AA 5BO4B 2EMTA 2ONQA 2SAKA 3U52E 4MSQB 4OZAA 4RF1A 2NTSA 4RF0A 4OW0A 1Z2MA 4OVVA 1JW9D 4TUUA 2EMSA 2NBVB
chains in the Genus database with same CATH topology
1N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6Z A; 
#chains in the Genus database with same CATH topology
 1EWY C;  1WM2 A;  4IM3 A;  2QCZ A;  3IBE A;  3MC8 A;  2H88 B;  2NTT A;  4BOS C;  2JU6 X;  1XCT L;  2I38 A;  1Q10 A;  4WUR A;  4CQN A;  4LLG M;  2KWC A;  2BS3 B;  1I35 A;  4E71 A;  3PZ7 A;  2GB1 A;  3C8Y A;  3SFE B;  3Q14 C;  2QIE B;  2WXJ A;  4NQK E;  2DYO A;  2KFK B;  4K3B A;  1XQQ A;  2LGD A;  4KDL B;  4ASW C;  3FC4 A;  3QQ8 B;  4FA6 A;  2G1E A;  2NR2 A;  3NUH B;  2CHZ A;  1EU3 A;  1Y8R C;  1VZ8 A;  1T3Q A;  3ZKJ C;  3MTN B;  2O2V B;  4H2A A;  5FR6 A;  1E9M A;  4DHJ D;  2IND C;  2OED A;  1G6J A;  1HZ6 A;  1ET6 A;  4NAW A;  4RFB A;  3R2T A;  3EFC A;  1JWU D;  4KVG B;  4GN1 A;  4GDL A;  5IA7 A;  5J2R A;  3SDL C;  2INC C;  2N1W A;  4DBG A;  3QWZ B;  3DVN V;  2PEA A;  2M0A A;  2GBJ A;  3J9C A;  2N7D A;  3I3T B;  1HA5 A;  1XEE A;  4C80 A;  4N9F 4;  4KGT A;  1GOZ A;  3DBR B;  2EEL A;  2JSV X;  2AWT A;  2AX5 A;  2BYF A;  1WXS A;  4TMA B;  4YTM B;  3CSF A;  1N6Z A;  4GDK A;  2LAS A;  2KZR A;  4XGA B;  3R7R A;  4OVZ A;  2AYO B;  2JX5 A;  1V6E A;  2HJ8 A;  3A9K A;  2H89 B;  4HKQ A;  4C7Z A;  3AEA B;  4P7I A;  1ZP0 B;  1F1H A;  3A9K B;  1IP9 A;  3BYY B;  4ARC A;  1F2R I;  3DWG C;  2I2Y A;  5DPR A;  2VH1 A;  2GOW A;  1TGZ B;  2MP2 A;  2N7E A;  3N32 A;  1MG8 A;  4J3O D;  1JWA D;  1RFK A;  1WGR A;  4CYE A;  4IM0 A;  2RR9 A;  1UZX B;  2ZNV C;  2LGY A;  2RDH A;  3ZIM A;  2AL3 A;  4HRO A;  1WGG A;  1HTO A;  2KTR A;  3KYD D;  5D3D A;  2PMV A;  2Z0D B;  3TEZ A;  3HM6 X;  1V49 A;  4MGK E;  2LRU A;  3FIL A;  1QKZ A;  2KYW A;  4P6V F;  3DDC B;  2K0P A;  1EWC A;  3NS8 A;  4OZC A;  4WH4 A;  2N1V A;  3RZW C;  4PYZ A;  3SD5 A;  1WF9 A;  2WXL A;  3RN9 C;  2O6V B;  4WWP A;  3UQB A;  4JGH B;  4ZHP A;  1ZKH A;  1WSP A;  2KMA A;  4ZDV A;  2MRP A;  4X57 B;  1N60 A;  3QJZ A;  4A90 A;  3BK1 A;  3GE3 C;  3ML8 A;  3NZU A;  1Q0W B;  1XT9 B;  2GRI A;  4XYC A;  4ANV A;  1PQS A;  1EUV B;  4MM3 A;  1WX7 A;  4ICU A;  4LNN A;  1XLQ A;  1FO4 A;  2K22 A;  3NRZ A;  3RYT A;  2PJH A;  2KN4 A;  3ZLZ A;  1FCC C;  3AE2 B;  5T8I A;  2JWZ A;  1EM7 A;  2AQ3 B;  1SEB D;  1HQR D;  1MFW A;  2IGD A;  2V9H A;  2HJ1 A;  1SE3 A;  2KJR A;  1WWT A;  3W1S A;  1N5X A;  3KVF B;  1GAQ B;  1TTN A;  4LDT B;  2N0S B;  3ALB A;  4JLC A;  1OEY A;  2GI9 A;  1V1O A;  2C7N B;  5AZF A;  1F77 A;  3ZVV A;  3KLS X;  4M8N A;  3HVD A;  4RH6 A;  2MBQ A;  3V61 A;  3KQ4 A;  2KD0 A;  2NMQ A;  1YN5 A;  3VUW A;  3P4P B;  1V8C A;  3SR6 A;  2GMI C;  4OVU A;  5KHQ A;  2MJD A;  3N30 A;  3ZNH B;  3KUD B;  1Z5S B;  2I1J A;  3LJ3 A;  4DK5 A;  5BMH A;  3DVG X;  2J0M A;  3KUZ A;  4GXB A;  3TEW A;  1IBX A;  3BIN A;  4Q2J A;  3P42 A;  1KH0 A;  3DHI C;  3ZTD A;  1KJT A;  1P3Q U;  3I9V 1;  2JZP A;  2LVO A;  3DVN U;  2AEH A;  4IKG A;  3UF8 A;  1PUT A;  1YMH E;  4A20 A;  1TYG B;  2JF5 A;  3WAP A;  2JXX A;  1XLN A;  3RCZ A;  3CWI A;  2KJH B;  2HE7 A;  5HFY A;  5D3I B;  2IO1 B;  5HKH A;  3BVZ A;  1SIF A;  2WXR A;  3LYY A;  4NJ7 A;  1D3Z A;  4MGZ E;  4GB9 A;  3B08 A;  2LWP A;  2LI5 A;  3AB5 A;  4IWQ A;  2N4F A;  4NAW B;  1VCB A;  2KWU B;  1T5X D;  1N63 A;  2YEP F;  4K3C A;  2JQR B;  3VTU A;  1DYQ A;  3DBL B;  1YQ4 B;  2KTF A;  5IN7 A;  1YJI A;  1TZ1 A;  2L8J A;  4ACF A;  2DNF A;  2Y5C A;  3H7P B;  3GS2 A;  1FXI A;  3PLU A;  4YSX B;  1UF0 A;  1SB3 C;  3L17 A;  1C79 A;  1IPG A;  4KIK B;  3RZF A;  1F52 A;  3HUI A;  4M01 A;  3WAN A;  2FUG 1;  3ZJV A;  4L2Y A;  4KIK A;  1WZ3 A;  3JSV B;  4BKS A;  1SJE D;  4W9C A;  1FFV A;  3PVL A;  2KQ4 X;  4IWP A;  2KN5 A;  4B9K A;  4I6L B;  2WXO A;  3BYT B;  5AZH A;  4AJY B;  4TSS A;  1KRH A;  3UGB B;  2BB6 A;  1NDD A;  4ITK A;  3PV1 A;  3L16 A;  2WDQ B;  3ZRC A;  3APF A;  4MGY E;  3VTV A;  1UNS A;  3UIO B;  2DZM A;  3ENE A;  3KW5 B;  2M1M A;  1XLO A;  3X0W A;  4NPN A;  3W9C B;  2Z0E B;  4HJK A;  4HKZ E;  2J4X A;  1SJH D;  2FCS A;  3AEG B;  3PPA A;  4GU2 A;  3TCA A;  2L52 A;  1ISN A;  1MPE A;  1SE9 A;  4M8M A;  2DLB A;  4RGN A;  1H8C A;  1XD3 B;  1I7H A;  1QT9 A;  1ET9 A;  3PRM B;  4XWW A;  4GDL B;  3BZD B;  2WXI A;  2NPT B;  3PRZ A;  2OHF A;  4C56 C;  3P4S B;  4F1S A;  2KDE B;  3Q3O C;  2BS2 B;  1TY2 A;  2M8S A;  3VUX A;  1HZ5 A;  2RPQ A;  4BAX A;  4RGM A;  1YQ3 B;  2G9H D;  5HHD G;  4J6I A;  4FBJ B;  1YN4 A;  2JZ3 B;  2Y5B B;  3APC A;  2M19 A;  4LK0 M;  5TSS A;  3TL5 A;  2L3Z A;  3NZ3 A;  2NCN A;  2INN E;  1HTQ A;  1GC7 A;  2CKH B;  4OZB A;  3NVW A;  3RD2 A;  1L4Z B;  2HD5 B;  1JML A;  4ANX A;  5AUI A;  4LNK A;  4LNI A;  4WJP A;  2XK5 B;  2DX5 B;  3P4R B;  1V1P A;  4W9E A;  3K9P B;  3R66 C;  2KDM A;  3SFD B;  3N20 C;  1WXA A;  2PKO A;  4I6N B;  2K6D B;  4M00 A;  3JSV A;  1D5M C;  5L95 C;  3KYC D;  3VH3 B;  2KWD A;  4NAM A;  1VRA B;  4NZL B;  3DOW A;  4FHK A;  3QAQ A;  1BXT A;  2PVO D;  4FAD A;  1QLB B;  4F7Z A;  4A3O A;  2KKC A;  4S0R A;  2L32 A;  1ZXI A;  2FE8 A;  1DOY A;  5BYS A;  3Q6B A;  2L83 A;  2O6V D;  4TQ0 A;  5KHO A;  4TQ1 A;  2KLG A;  1FNU A;  3AU4 A;  2D3C A;  1C4C A;  1PGX A;  3ZNI D;  2WYQ A;  4FJZ A;  2BYV E;  3C0R B;  3IXS A;  1I4P A;  1CMX B;  2WXK A;  1WGK A;  1OQQ A;  3H8H A;  4GSW A;  3VAW A;  3KWV A;  3ZXV A;  2PTL A;  3PZ8 A;  1YQB A;  3T9L A;  2QMT A;  3BII D;  4EOY A;  3TMP B;  3Q8E A;  2OOB B;  1WXQ A;  2D11 A;  1ZUD 2;  2ASQ A;  2LEK A;  1D5Z C;  1UBI A;  5CHV C;  2JYE A;  1SGH A;  4W9J A;  2A5U A;  4RM9 A;  3ABV B;  3VVW B;  3ZNG C;  1S3S G;  1WRI A;  2BGF A;  4N59 A;  5CTR C;  2K8C A;  4B0M A;  2AL6 A;  4KSL C;  3ZYY X;  4FHJ A;  4WAA A;  2MJ3 A;  4WJO A;  4YXD B;  1X1M A;  3JW0 X;  1ENF A;  4HXD A;  3RNF C;  2GBR A;  3MFG A;  1E90 A;  2JPH A;  2RDB C;  1P9D U;  2V3S A;  3QC8 B;  1Y56 A;  4I6P A;  2NVU I;  1MI0 A;  1FD6 A;  2CU3 A;  2PE6 B;  3RT3 B;  1WYG A;  1GUA B;  2J42 A;  4WJN A;  3N3K B;  2LGS A;  4PS8 A;  1FCL A;  2ZEQ A;  1AWD A;  5IAA C;  3SEB A;  5LXI B;  3IAM 1;  3ONS A;  3T3O A;  1PDX A;  3LDZ E;  4HEA 1;  3EC8 A;  1ZXH A;  3AU5 A;  4MH0 E;  3AE6 B;  3AM9 A;  1WM3 A;  2Y5P A;  2MA9 B;  4JWU C;  2IYD B;  2KC1 A;  4DQO C;  2KFK A;  2G3Q B;  2KMM A;  3LB8 C;  4WJQ A;  1I42 A;  2LRW A;  3L4P A;  5E6J A;  3KWL A;  2FCM A;  4AOF A;  3Q3N C;  1NVI D;  4NJ6 A;  4OHJ A;  4R3D A;  2MBE A;  2TSS A;  4NY0 A;  3AE7 B;  2IO0 B;  2WXN A;  5AZG A;  1TS4 A;  4YL8 A;  5H92 C;  1UBQ A;  2QSD A;  1LFD A;  3AE4 B;  1FRR A;  2RPV A;  1TS2 A;  1L7Y A;  1IYF A;  3V05 A;  1OTR B;  3APD A;  3HM3 A;  2KC2 A;  2V3N A;  2DZJ A;  5TR5 A;  1C77 A;  3N1Y C;  2I1K A;  5EE9 A;  2GLS A;  3Q8A A;  1IGC A;  3M63 B;  4LNO A;  2ZJD A;  2NBW B;  2IO2 B;  5BYQ A;  1C4A A;  2REX A;  3U7Z A;  5CHF A;  1CZP A;  4BBN C;  3MHS D;  4MDK E;  4NJC A;  3TEY A;  1KLU D;  3PS6 A;  2BW2 A;  1VLB A;  4W9L A;  5JXV A;  1L6V A;  3OLM D;  2MEK A;  3OJ3 A;  4AWJ A;  1WRD B;  3D32 A;  1C3T A;  2N9P C;  1D5X C;  2L7R A;  3GE8 C;  2G4D B;  2QJL A;  1WE7 A;  2BWF A;  3IT6 B;  4MGI E;  2MP2 B;  4KDI C;  2UYZ B;  1STE A;  5HG2 A;  3DBH I;  4USA A;  1RWS A;  2BS4 B;  4IUM B;  4EZK A;  1RM6 C;  1EO6 A;  1EF5 A;  3DHG C;  3HRD D;  1E7U A;  3BVG A;  1P1A A;  4IC7 B;  1RFA A;  3B1L X;  3TEX A;  4ZYN A;  1LGR A;  2D5G A;  2ZVN A;  1XO3 A;  2JWU A;  4WWN A;  4W9D A;  2WDV B;  2VZK D;  4RCO A;  3V6C B;  1WJ6 A;  2JUO A;  3T3N A;  2MW5 A;  1J7B A;  2Z59 B;  1UEL A;  2WLB A;  1C78 A;  1LQB A;  2IZV B;  3ZW3 A;  5G2N A;  4HPL B;  1NI3 A;  3AE8 B;  4IW0 A;  3EGR A;  5EDS A;  4HCP B;  2QEJ C;  3N1Z C;  4G50 A;  3FIL B;  1J7C A;  2WDR B;  2KVR A;  1JWS D;  1UH6 A;  1NYR A;  1KF6 B;  2G45 B;  4KGS A;  1EU4 A;  5IOI A;  2DWQ A;  1U4A A;  2NPT A;  1NBF C;  3TIX A;  3AE5 B;  2C7M B;  4LCD E;  1YX5 B;  3BVM A;  3T8M A;  1OEY J;  2WHI A;  1YOV B;  2B76 B;  1FRD A;  3RNA C;  1I4H A;  2LXA A;  2N7J A;  5EE1 A;  1E10 A;  3RUL A;  3DBH B;  1F0Z A;  4US9 A;  2LJ5 A;  4MEL A;  3H7P A;  1AYF A;  4XC2 A;  4BKS D;  3AE1 B;  1WXM A;  2D07 B;  2ZNV B;  2WXP A;  2PW9 A;  4EFO A;  5IKC M;  3WAM A;  1RLF A;  1E8Y A;  4G3X B;  2INP E;  2V3P A;  3UIP B;  3AMZ A;  3ZJT A;  4P1C C;  4MAC A;  2KFJ A;  3VRA B;  3NVY A;  1GB4 A;  5C1Z A;  1WJU A;  1MG4 A;  4DXF A;  3LXF A;  1FMA D;  4MT5 A;  1GNU A;  5CX3 A;  1FIQ A;  4IG7 B;  2BF8 B;  3Q8B A;  5L83 A;  1QOG A;  4IDI A;  4BFR A;  4EE2 A;  4C4V B;  3OWE B;  1KTK A;  1N5W A;  2LVP A;  4EZL A;  3MP9 A;  4HVB A;  1K50 A;  2ICI A;  3ECI A;  2MCN B;  3FAH A;  4YWG G;  3QIJ A;  3QAR A;  3MC9 A;  4XWT A;  4ANU A;  2M56 B;  3IVF A;  2ZVO A;  4C00 A;  4GLS C;  2VRR B;  3ZGZ A;  3NZS A;  2KTR B;  3CIR B;  2KVZ A;  3DPD A;  3WAL A;  4URK A;  1VZ6 A;  2WQY B;  2W55 A;  4EZJ A;  2KK8 A;  3Q3J A;  1YD8 U;  2XBB C;  4DHJ B;  1TKE A;  3L54 A;  4G11 A;  2CJN A;  2IBI B;  3CF6 E;  2E6X A;  1R4M B;  3M95 A;  5BYR A;  2XK5 A;  3VRB B;  2AQ1 B;  1Q1O A;  2J53 A;  2MBO A;  5D94 A;  2VZK B;  3IAS 1;  1LXD A;  3HVZ A;  2R2Q A;  3IFW B;  3RNB C;  2KAN A;  3VTW A;  1TS5 A;  4LTU A;  3NVZ A;  2JRH A;  2B3A A;  2LD9 A;  1MVK A;  2CHW A;  1K53 A;  1WX9 A;  1QQR A;  1TZO A;  1I4G A;  1S1Q B;  5BMI A;  3ZRF A;  4IWO A;  1F2R C;  2WXH A;  2WXG A;  3DHH C;  4C7Y A;  4DXG A;  3L08 A;  4XDD A;  5LNK 1;  3RI7 C;  3R2I A;  4ZOH C;  4MH8 A;  4REZ A;  2WXM A;  2FIF A;  3IT4 B;  2J0J A;  2WX1 A;  3BY4 B;  3B9J A;  1FXA A;  3U30 A;  3NS1 A;  3W5U B;  5D2M B;  2LGI A;  1T6B X;  2DAF A;  1WFY A;  2JXT A;  2MHJ A;  2QHO A;  2BKR B;  4ZRP A;  1VDV A;  2KNB A;  3RNE C;  1YJ1 A;  1FEH A;  4AQ7 A;  2BTE A;  1ROE A;  4B6W A;  2RMM A;  2IY1 B;  4A55 A;  1SE2 A;  3CST A;  2JVC A;  5C2T B;  5DPW A;  3I57 A;  3O65 B;  2C60 A;  4LNF A;  3WCQ A;  1GPX A;  3QCA A;  2L00 B;  1WX8 A;  2IO3 B;  1E7P B;  1T0R C;  3A1Q A;  2HDE A;  2V4L A;  2MX2 A;  2CHX A;  2KWV B;  4QAY A;  1JRO A;  1WR6 E;  2LGX A;  2OJR A;  4W9F A;  1E5W A;  4EKU A;  3HIZ A;  4XDC A;  2WU5 B;  3ZDT A;  1D6E C;  2DHZ A;  1N62 A;  1SIJ A;  4MEM A;  1YJJ A;  4UDU C;  2PE9 A;  3AUL A;  1JWB D;  3WAO A;  2LHE A;  2R2O A;  1OQR A;  4FXC A;  1FNV A;  2AQ2 B;  5AEK B;  3QK0 A;  5H8Y E;  1VJK A;  4TKN A;  4XX5 A;  1C4P A;  1Q5W B;  1JAL A;  2FCQ A;  5G5H A;  3AEB B;  4L23 A;  3PHX B;  2KX3 A;  4KKJ A;  2N9E B;  4LJO B;  2IPK D;  3B2F A;  2BYT A;  1JWM D;  2C9W B;  2MQJ A;  3ZJU A;  3Q2A C;  3I5J C;  1FNW A;  3RUI B;  2JY6 A;  3A9J A;  2NBU A;  3Q69 A;  3GB1 A;  4FLH A;  1TBE A;  1T0S C;  1J8C A;  1ZDX A;  1R4N I;  3EA6 A;  3W5V B;  1I4X A;  1P7E A;  2CR5 A;  2JT4 B;  1FFU A;  1TJE A;  3V3X A;  3I63 C;  2WS3 B;  4FJY A;  4ZYS A;  2V1Y A;  3EHV A;  3V60 A;  2L76 A;  2D3B A;  2LUE A;  1B1Z A;  1WGD A;  3EUB 2;  4GIV A;  3L13 A;  3NVV A;  2BBC A;  3U2S C;  2LVQ A;  3Q8C A;  4AJW A;  4C4V A;  2D10 A;  2ZPY A;  4A3P A;  3ZUN A;  3UI3 A;  1XLP A;  1KM7 A;  3AE3 B;  1JRU A;  5DCN A;  1QOA A;  4RGO S;  2JYT A;  3NG0 A;  1WE6 A;  3HK0 A;  4B0E A;  1T0Y A;  2LJI A;  1L6U A;  3PSE B;  1AN8 A;  3ZTC A;  2E3T A;  2K8B A;  2HTM E;  2FID A;  2IGH A;  3VR8 B;  1LM8 B;  2R61 A;  1OGW A;  1AAR A;  1V5T A;  2WXQ A;  3TSS A;  3PO0 A;  1E7V A;  3ZNZ B;  2IY0 B;  1WH3 A;  1JRP A;  1ZE3 D;  3ETR A;  3U4E G;  2K9X A;  3DWM A;  2IGG A;  1ZDV A;  3VFK A;  1YN3 A;  1QZE A;  1TT5 B;  3AI5 A;  1VR9 A;  3N9Y C;  2UU7 A;  3MHZ A;  4KV2 A;  3AEC B;  5FK9 C;  1SE4 A;  3P4Q B;  1EF1 A;  5CHW A;  4HWI B;  2GBK A;  3BWU D;  3QA8 A;  4S17 A;  3JYU A;  5E6P A;  3R8B A;  2JRI B;  3RMK C;  2PIA A;  4GMV A;  4M02 A;  3OAW A;  4RNA A;  3B2G A;  1OFF A;  1L0V B;  1UD7 A;  1WY8 A;  1WXV A;  1GJZ A;  2CS4 A;  2M0X A;  2YLM A;  4RMA A;  1IUE A;  2EKI A;  3VDZ A;  4YT0 B;  3PGE A;  2KO3 A;  1A5R A;  2SEB D;  4HLE A;  4DWF A;  4HPP A;  1YX6 B;  4RGT A;  2UWQ A;  3A4S C;  1QOB A;  1J7A A;  1R4M I;  3V6E B;  3VUY A;  1K52 A;  1OQY A;  2LMC A;  2J0K A;  3RNG C;  4G0N B;  2ZPN A;  3EFU A;  3A33 B;  1WGY A;  1MJD A;  1L4D B;  4CO7 A;  4RM8 A;  1P7F A;  2L1A A;  1P98 A;  4M0W A;  4LJP B;  5AUK A;  1FM0 D;  1D4B A;  1E0Z A;  3C19 A;  1LO5 D;  2YEP B;  3V62 A;  2LHD A;  1TKY A;  4II2 B;  3DBS A;  1PFD A;  4JIO U;  1TY0 A;  3AH7 A;  1V97 A;  3AV8 A;  1GC6 A;  4NQL B;  3URY A;  3TJP A;  1KOT A;  4IM2 A;  1E8W A;  5JH5 C;  4BOZ B;  1RRB A;  3GOE A;  3Q3M C;  3M3J A;  5C23 A;  3B0A A;  5GXG B;  4BZA A;  2MWS B;  1XCQ L;  2WWZ A;  1H4R A;  1WMH B;  4HDO A;  1N61 A;  5LXH A;  2BB5 A;  2KHW B;  4PS7 A;  2LUM A;  4F8C B;  3AEE B;  4YTP B;  5DPT A;  4FN2 A;  3W1S C;  5FR3 A;  4L1B A;  2V0G A;  4ICV A;  4WQM A;  3FKY A;  1R4N B;  4DHZ B;  5D6J B;  3L10 B;  2K25 A;  4JE3 B;  1V5O A;  2D3A A;  2X38 A;  4YTN B;  4MM3 B;  3DVG Y;  2ON8 A;  4A8X C;  3GZN I;  3H6N A;  1ACC A;  5E6O A;  3MC0 B;  4HCN B;  1C1Y B;  3RFZ B;  1ZW7 A;  1CQV A;  2DZK A;  1UGJ A;  4EUT A;  4KZ0 A;  2KOX A;  4ZHO A;  3VH4 B;  3DBL I;  4E3C A;  4A6Q A;  2V4I B;  3VHT C;  2KMC A;  2ZCC A;  4W9I A;  2C7H A;  5C3J B;  2WGS A;  1CK1 A;  2KDI A;  3W2D A;  4HRS A;  2GBM A;  4YSZ B;  2RD0 A;  3PZD A;  1T0Q C;  2DZI A;  1PYW D;  2WNM A;  4JX1 C;  5G5G A;  1V9J A;  3PRP B;  1SSN A;  2WP9 B;  1F9J A;  3NJT A;  2QDF A;  2K6Q A;  1DGJ A;  2BT6 A;  1GB1 A;  4KX6 B;  1UWX A;  1K8R B;  1C76 A;  2K3U A;  3AN1 A;  5IO9 A;  1QIL A;  2W3S A;  4WWO A;  4K7W A;  2W82 A;  5HI1 A;  4IOI E;  2CJO A;  4W9G A;  2QIL A;  1I4R A;  3MJW A;  2KDB A;  2MLB A;  3WA0 A;  2KQS A;  1L5P A;  2W3R A;  2Q5W D;  2JZZ A;  3IG3 A;  1RYJ A;  2M17 A;  2CU1 A;  2LZ6 A;  2BYE A;  2KJ6 A;  2QC8 A;  2N9X A;  2WU2 B;  3SU8 X;  1NI2 A;  1J19 A;  3QX1 A;  3S2A A;  1WIA A;  4ZRK A;  1V80 A;  1M94 A;  4GOC A;  1QOF A;  1PGA A;  2D3G A;  5DPS A;  1NYQ A;  4DDG D;  3KUC B;  2HTH A;  4XZ4 A;  1RAX A;  2IDY A;  2XEW A;  4M0W B;  2YVC A;  2MBB B;  3X23 A;  5LLI A;  2A4Z A;  2W54 A;  3E9S A;  2WXF A;  3ZQ4 A;  2ZW0 A;  3U8Z A;  1ZGU B;  5FKA C;  1V1P B;  5D7G A;  5IP4 D;  1NEN B;  5JZE B;  2BKF A;  3U7D A;  3PLV A;  2OJW A;  5BMG A;  4WQO B;  2N9L A;  3H7S A;  2X8X X;  1KFY B;  2PVG C;  1L0Y B;  1YIW A;  2DYM A;  2BQQ A;  1MHX A;  4PS3 A;  2RDG A;  1P0R A;  1SBB B;  5GMV A;  1XXG A;  4GDK B;  2PPH A;  2W9N A;  1HEZ E;  3DCG A;  3TUO A;  2K5P A;  2MSE D;  3GP7 A;  3SHQ A;  3M62 B;  3PT2 B;  2MBH A;  2K1F A;  2RSU A;  4KKI A;  1FPY A;  4BKG A;  3K9O B;  2KXJ A;  2IJ0 A;  1TS3 A;  2G4S A;  1B9R A;  4TV3 A;  2C5L C;  1E8Z A;  4O1N A;  2ZW1 A;  2ZCB A;  4AS1 A;  1E8X A;  5J17 A;  2FCN A;  5E6N A;  3JVZ X;  3PRE A;  3PTF C;  4ARI A;  1CJE A;  2O2V A;  3AXC A;  3VXW A;  1WZ0 A;  4WIP A;  2KQ7 A;  1TIF A;  3NOB A;  2FUH B;  4GGQ A;  4ZRJ A;  2GBN A;  1V81 A;  4MJS B;  2DBY A;  1C9F A;  2L0T A;  4ZRQ A;  1UUP A;  4PK1 A;  4MJS A;  5JHA A;  4WWM A;  2WDT B;  3DQV A;  3R7Q A;  4JPS A;  2M4N A;  1JCK B;  2L05 A;  1UGM A;  2O6V A;  4HPM B;  4FJV B;  3QHT A;  1BT0 A;  2LXC A;  4A9A A;  5MPO A;  1L0X B;  3UQA A;  1IBX B;  3E56 A;  2J7Q B;  3Q8F A;  5EE3 A;  4BBN F;  1NEK B;  1XF5 L;  4K1R B;  4WAF A;  2KAC A;  1R7S A;  4YSY B;  1L2N A;  3OJ4 B;  4EEW A;  1K51 A;  1ZOY B;  3RNC C;  2KT7 A;  2MH7 A;  1SXT A;  3GZN B;  4D2K A;  1TKG A;  1HE8 A;  1UWM A;  3A9J B;  2ACZ B;  3TBL D;  4W9H A;  2XNA C;  1WJN A;  1VD2 A;  4W9K A;  1FXT B;  4K81 A;  4HDQ A;  1ESF A;  3NHE B;  2DAJ A;  3P63 A;  3A4R A;  3CMM B;  2EKE C;  3MJ5 A;  4DDI D;  3P1M A;  2FBW B;  3VQI A;  2RGF A;  3W1Y A;  2KDF B;  4BVU C;  4KZC A;  4CHK A;  2FAZ A;  3IHP C;  3UIN B;  4PT5 A;  4DXA B;  3DBR I;  5I4D A;  4II3 B;  4LDT D;  4US8 A;  5EE0 A;  3AEF B;  2VH2 A;  4K7U A;  4KSK C;  4MSM B;  1WI0 A;  2J52 A;  2KX0 A;  2L0F A;  3Q3F A;  3ML9 A;  1DOI A;  1SF0 A;  2N9K A;  1YNT E;  5G55 A;  3H9D A;  3ZXR A;  3BK2 A;  3VR9 B;  5JHB A;  1I4Q A;  1KLG D;  3WIM A;  1WR1 A;  3O13 A;  4ZRI A;  4HJG E;  2MJE A;  1E6E B;  3AE9 B;  2XN9 C;  3ZO5 B;  1IGD A;  2D2Q A;  2BWE S;  2Z8L A;  1ZPS A;  3A1Q B;  4E74 A;  2ZZP B;  1V2Y A;  5J18 A;  1WYW B;  2DEN B;  3L0W B;  3EEC A;  2NS5 A;  2BVC A;  4DHZ E;  1WMH A;  4JWS C;  4B95 A;  1QF6 A;  4AP4 C;  3N1X C;  2K39 A;  1BUI C;  4JQW C;  3RPF C;  1WJ4 A;  3KH0 A;  3P2B A;  2K8H A;  1VZ7 A;  3R3M A;  1J0G A;  3NY5 A;  4PYU A;  3AED B;  4NNJ B;  4HK2 A;  4AUQ C;  4N6E B;  2KAJ A;  1KLV A;  1WGH A;  4ANW A;  4K7S A;  2DYB A;  4FUL A;  1BML C;  2FNJ B;  4N58 A;  4XE0 A;  1V86 A;  1GG3 A;  2PLP A;  1JQ4 A;  1HXY D;  2BPS A;  3H1U A;  4KGR A;  1A70 A;  2WX0 A;  4JL9 A;  2LFI A;  2KLC A;  1AW7 A;  4P16 A;  1PGB A;  4P1B C;  3ZDM C;  3HHM A;  1M4V A;  3OG5 A;  1DOX A;  1MHH E;  3PHW B;  4BKT A;  2Y3A A;  5BO4 B;  2EMT A;  2ONQ A;  2SAK A;  3U52 E;  4MSQ B;  4OZA A;  4RF1 A;  2NTS A;  4RF0 A;  4OW0 A;  1Z2M A;  4OVV A;  1JW9 D;  4TUU A;  2EMS A;  2NBV B; 
#chains in the Genus database with same CATH homology
 1N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...