2ZW1A

Crystal structure of a streptococcal protein g b1 mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MDTYKLILNGKTLKGETTTEAVDAATAEKVFKHYANEHGVHGHWTYDPETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein LG
publication title Optimizing pH response of affinity between protein G and IgG Fc: how electrostatic modulations affect protein-protein interactions.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2zw1A00
5BMHA 1C9FA 4OZCA 5HI1A 2ON8A 2KDMA 1K53A 1MHHE 1IBXB 1MHXA 2LGIA 2K0PA 2KWDA 2PW9A 4D2KA 5BMGA 1GB4A 1FCLA 4MACA 1P7FA 2KQ4X 1UWXA 4IOIE 1Q10A 2LHEA 1MI0A 1K52A 1FCCC 3FILB 2N9KA 2J53A 1FD6A 3FILA 2PLPA 5HFYA 1GB1A 1IGCA 2JXTA 1XF5L 1XCQL 2EELA 2IGHA 1F2RC 1QKZA 1HEZE 1JMLA 2JSVX 2QSDA 5JXVA 3MP9A 4HKZE 1K50A 2KACA 1YNTE 2QMTA 3UI3A 4GLSC 2N7JA 2I38A 2IGGA 4WH4A 2JZPA 2JWUA 2ONQA 2KN4A 4HJGE 2J52A 5HG2A 2JU6X 2GI9A 2LUMA 1HZ6A 2GB1A 4KGTA 1MPEA 2OEDA 1PGBA 4OZAA 4OZBA 2PTLA 1HZ5A 1IGDA 1XCTL 2RPVA 2ZW0A 2LHDA 1KH0A 1P7EA 2I2YA 1EM7A 2IGDA 1IBXA 1YMHE 1PGAA 4KGRA 4KGSA 2RMMA 1F2RI 2N9LA 2ZW1A 2NMQA 1D4BA 1K51A 1MVKA 3GB1A 3V3XA 5BMIA 1ZXHA 4IKGA 5HHDG 1PGXA
chains in the Genus database with same CATH superfamily
2MLBA 1JWBD 1E10A 1E7VA 1KF6B 3NHEB 2AX5A 1E7UA 2KDMA 3ENEA 5D6JB 4EEWA 2KTFA 1F0ZA 4HKQA 1MFWA 3R3MA 2PW9A 4IDIA 2KDIA 3DWMA 4WWOA 4NY0A 4R3DA 4YXDB 5G5GA 2B3AA 1E8XA 4GXBA 5AZGA 1R4MB 1V49A 2NTTA 1C79A 2K3UA 4DHJD 3DCGA 1E8YA 4RGOS 3HM3A 1RYJA 5IOIA 4HEA1 4LNIA 3GE8C 4LJPB 2IGHA 1PQSA 1WZ0A 2KTRB 5JH5C 1WXVA 2O2VA 4K7SA 2QHOA 3LDZE 5D3DA 3UGBB 4NAMA 1U4AA 4W9CA 2WYQA 4AWJA 5FKAC 1M4VA 1ZDXA 2N7JA 4A9AA 2WXLA 2MBQA 3QQ8B 2W3SA 3MHSD 3HM6X 3RMKC 2JU6X 2KLGA 1E5WA 2GBJA 3L08A 2RGFA 4AJWA 4GDLB 1D3ZA 2XN9C 3PTFC 4ZRJA 4ITKA 3U52E 4OVVA 3HUIA 4P1BC 2BW2A 1SE2A 3AE9B 2B76B 3AU5A 3NRZA 3AE1B 2CHWA 2R2OA 1MVKA 2DAJA 4MGYE 1TJEA 2L32A 2Z0EB 1EO6A 3WALA 1K50A 1E9MA 1I4RA 1WX7A 2WDVB 2DLBA 2EKEC 1WJNA 4KSKC 3AXCA 2H88B 2D5GA 3WANA 3PRMB 1LM8B 4TKNA 2GBMA 2BYVE 4N58A 1VZ6A 1FFVA 4XC2A 1YJ1A 1C77A 2R61A 2KQ4X 3TBLD 4QAYA 3Q8FA 4N9F4 1QOGA 2HJ8A 2CHXA 4YTMB 4WIPA 1AWDA 1L0YB 3MJWA 4HDOA 3P4RB 2HD5B 4TV3A 5HFYA 4IW0A 4JE3B 2KT7A 1I4HA 1ZXIA 1QKZA 4P1CC 4A20A 4W9HA 4XDCA 4W9GA 4C7ZA 4NQKE 1I4XA 5LXHA 3U30A 2RDGA 2QMTA 3TJPA 2KX0A 1YQ3B 3L4PA 3C0RB 3LXFA 1J8CA 4KDLB 4A3PA 3QAQA 3RNBC 5J17A 2IO2B 3ZJVA 1R4NB 1GNUA 1ENFA 2KWVB 3RUIB 1D6EC 2GI9A 3BINA 4KGTA 4YT0B 2DYBA 1ZW7A 4FN2A 4HLEA 3DVGY 5EE0A 4OZBA 3O13A 5DPSA 2XEWA 2ZNVC 3UIPB 1HZ5A 1E6EB 3ML9A 1KH0A 4IM3A 1Q0WB 3L16A 4NPNA 1IBXA 4WAFA 3VFKA 1WRDB 3EA6A 2QILA 3IT4B 1YQBA 2CU1A 4ZHOA 3U7ZA 1MG8A 1TY2A 4DXGA 1HTOA 3VUXA 3N1YC 2LEKA 4L2YA 1L4ZB 5HI1A 1RLFA 1BT0A 1Y8RC 3NJTA 3PREA 4EFOA 4GU2A 2KX3A 3AULA 5G5HA 2L0TA 1MHXA 2J42A 4KDIC 1PYWD 1TT5B 3Q3OC 1QT9A 2V4IB 3H7PB 1BMLC 4GMVA 3Q8EA 2LXAA 2DWQA 2LRUA 1V5TA 4II3B 4W9FA 2K25A 4E3CA 3RNAC 2KMCA 3VR8B 4TQ0A 3AE8B 3PV1A 4ICUA 2ASQA 1L6UA 5C23A 3N32A 2LUEA 4ZRPA 3OLMD 2BKRB 1WF9A 4E71A 4M0WA 1HTQA 2IDYA 1XF5L 3WIMA 2V9HA 3KYDD 2XK5A 4O1NA 2KD0A 2RPQA 2ZPYA 2JF5A 3HVDA 2WS3B 4GDKB 1WFYA 1XXGA 2M56B 3TSSA 2K8HA 4REZA 2KAJA 4GN1A 5JHBA 4KKJA 1WR1A 1HZ6A 4EOYA 2XNAC 3Q14C 2G9HD 5EE1A 1I4GA 3M63B 3K9OB 2DNFA 2DZJA 4C4VB 1C76A 1XO3A 3P2BA 2RPVA 2WDRB 2INPE 4XE0A 4US8A 2ZVNA 1VRAB 3IFWB 3O65B 3AECB 4BBNC 1NI2A 2MBOA 1V9JA 3ZIMA 4FBJB 2KVRA 4EKUA 1L0VB 2KHWB 2N1WA 1SJED 2LASA 5FK9C 3TMPB 4LLGM 1WXSA 5D7GA 4P16A 3Q2AC 2DYMA 2LJ5A 4KZ0A 2KN5A 4OHJA 3N20C 3H1UA 1ROEA 2JZZA 3VRAB 1SE4A 3AM9A 1F52A 3IG3A 1ZE3D 4FHKA 2ZPNA 4PT5A 4C7YA 4B6WA 1N63A 1Q10A 2RD0A 3ZNGC 4LDTB 4ANVA 1K52A 3AI5A 2WXQA 2AL3A 2CU3A 3Q8CA 4HPPA 5H8YE 1L4DB 2O2VB 4F1SA 2K39A 2YEPB 2BBCA 1WGYA 3QC8B 2PVGC 3FKYA 3IVFA 2BWES 2G4DB 2CHZA 3AE7B 1WMHB 2I38A 4FJYA 3KUZA 1I4PA 2JZPA 3DVGX 3CWIA 2KJHB 3RZFA 1Z2MA 2NCNA 3TCAA 2VH2A 2DZIA 1IPGA 1JWMD 4OZAA 3UIOB 4JL9A 2I1JA 1EF1A 3KW5B 3PPAA 4XYCA 4XWWA 1DGJA 1Q1OA 3N1ZC 1FXIA 4W9JA 4HJKA 4FULA 3R8BA 2KC2A 5GMVA 3ZTCA 2WDQB 3KQ4A 2L76A 1N61A 4TUUA 4M01A 4EZKA 2NMQA 2X38A 4B95A 5TSSA 4F7ZA 1UD7A 2V3PA 4HDQA 2O6VA 1J0GA 5BMHA 2KANA 1CK1A 2OHFA 1WJ4A 3NVYA 2BS3B 2BTEA 4P7IA 3NS8A 2KWDA 2A4ZA 4G11A 1EF5A 1FCLA 1L2NA 4WURA 1TZOA 3AE5B 2V0GA 4WJPA 1SXTA 5CHVC 1QLBB 4G50A 2QJLA 1N60A 3PVLA 1MI0A 2CS4A 2BVCA 3PRZA 2PKOA 3VVWB 1GC6A 1IGCA 1EWCA 1UZXB 3A9KA 3L10B 3QHTA 4AOFA 3AE3B 1JRPA 4XDDA 1C78A 1KLUD 3ZNHB 4LNOA 1QOBA 2LRWA 2IY1B 3MJ5A 3BY4B 4NQLB 1TS2A 2KFKA 1SIJA 4CO7A 1OEYA 3DQVA 4MJSA 2EMSA 3AEAB 4WJQA 1WYWB 3MFGA 3AE6B 3WAPA 1L5PA 3QIJA 1UBIA 1HA5A 4ZYNA 1I42A 4JX1C 1LFDA 2JUOA 1X1MA 1IGDA 1KM7A 4M8MA 2PJHA 3RFZB 1G6JA 2K8BA 2RMMA 2LGDA 4W9DA 1OFFA 3NG0A 5TR5A 2KJRA 2C7HA 2K1FA 1SIFA 2KQSA 1OEYJ 1T6BX 2JXXA 5BYQA 1HXYD 3R7QA 4MH0E 3E9SA 3P42A 2M19A 1V86A 2D3GA 1GB4A 1DYQA 2C7MB 3BVMA 3NZUA 4XGAB 1ZP0B 4DQOC 4B9KA 2WGSA 1UWXA 4IM0A 2PE9A 4W9KA 1C4PA 3I9V1 4BKTA 3R2TA 3AN1A 2V3NA 3ZDTA 1WYGA 1T0SC 4TSSA 5DPTA 1RFAA 1V1OA 3R2IA 3ZGZA 3L0WB 1GB1A 4M0WB 2MW5A 2Z0DB 2WXFA 2J7QB 2XK5B 2FIFA 2KMAA 2HJ1A 3QA8A 4FA6A 4MT5A 2AWTA 2IO3B 3U7DA 1QOFA 1JALA 1VD2A 2GMIC 2NPTB 4GLSC 1FPYA 4FXCA 1E90A 1T5XD 4WH4A 2D11A 2ONQA 2WWZA 3B9JA 2MCNB 2NBWB 2ICIA 1STEA 1OQRA 4FLHA 1OQQA 1WH3A 4EZLA 2KC1A 2CJOA 3ZNID 3N9YC 1XCTL 2INCC 2LHDA 4AS1A 3URYA 1VZ8A 1C3TA 4ZYSA 3W1SA 1YMHE 1PGAA 4KGRA 3MC0B 4YTPB 2C9WB 1KLGD 1UELA 3ALBA 3AU4A 2GBNA 4EZJA 4K81A 3EFCA 3T3NA 4UDUC 1Y56A 1QOAA 4N59A 1SF0A 4TQ1A 3RZWC 3W9CB 3RPFC 2PPHA 2AQ2B 4IWPA 2AL6A 5LXIB 1UGJA 4DXAB 2M0AA 2MX2A 2ZNVB 1MJDA 1P7FA 2IJ0A 2W55A 3KVFB 4NJ7A 2PMVA 1DOXA 2XBBC 1VLBA 1TGZB 4MGZE 1TKYA 1GOZA 1IP9A 2L0FA 2YVCA 2REXA 5CHWA 5IP4D 2NVUI 2JXTA 3RNFC 2FUHB 1VJKA 3SHQA 2N7EA 2WXMA 3BZDB 4HKZE 1VZ7A 1XLNA 4MDKE 1ACCA 4WJNA 2RDHA 4DWFA 1WRIA 4IUMB 4HXDA 1YOVB 2IGGA 2KVZA 2PVOD 1XEEA 3DBLB 2J52A 4HWIB 2BPSA 3TIXA 2CR5A 2ZZPB 1FRRA 1IYFA 1FO4A 4NJ6A 3BVZA 1VDVA 1GUAB 2WQYB 3ZUNA 3I63C 1PGBA 2WX1A 4I6NB 4WQOB 3HK0A 3P4PB 4L1BA 2LVQA 4JLCA 4ZRQA 3N3KB 1ET9A 4NAWB 3KYCD 2QC8A 1EU3A 4X57B 3U2SC 2ZW1A 3DBSA 3BVGA 2D2QA 3U4EG 3B0AA 2O6VB 3UINB 1TKGA 3M95A 1YIWA 3SU8X 3PSEB 2JQRB 4TMAB 1C9FA 3JYUA 4BKGA 2UWQA 3W1YA 1JWUD 3H8HA 4KIKA 3P4QB 2BB5A 1TBEA 3GZNI 1J7AA 3TEWA 5E6NA 4ZRKA 3AE2B 4NNJB 1N6ZA 2MBEA 1N5WA 4IWQA 2NBVB 4ICVA 2WXIA 3A9JA 3X23A 3E56A 3RULA 1ZPSA 4C00A 3A1QB 2IO0B 2KXJA 1QILA 3PHXB 4WAAA 1KTKA 1FD6A 4YTNB 1GPXA 2NTSA 2MP2A 4KKIA 1XD3B 3PT2B 1NBFC 3A9KB 3BIID 3HHMA 1TS3A 2L3ZA 3EC8A 4G0NB 2BQQA 1YQ4B 3W5UB 2KACA 1YNTE 3JSVB 1RAXA 3DBRB 3IHPC 2D3AA 2KFKB 2D3CA 1XQQA 2WXKA 3NVZA 4MJSB 1SJHD 1R4MI 5IA7A 5EE3A 4RFBA 2BKFA 5DPWA 1SBBB 1JCKB 4A8XC 2J0JA 1QZEA 2G4SA 5EDSA 1NVID 5KHQA 4MM3B 3RNEC 2J0MA 5L83A 4ASWC 5J18A 4LJOB 2ZJDA 2G1EA 2I2YA 3C8YA 2ZCCA 3C19A 4HK2A 1K51A 3QX1A 3RNCC 3MC9A 3GB1A 2BGFA 3OJ4B 4LK0M 2LFIA 1M94A 4RGMA 3DHIC 2DENB 1YX5B 3H6NA 1ISNA 2CKHB 5FR3A 3JVZX 4D2KA 4S17A 3UF8A 3EFUA 4PK1A 2GBRA 3Q3FA 4HRSA 2KTRA 5BYRA 3IXSA 2WXJA 1AW7A 2L83A 3IBEA 3SR6A 2JPHA 2FCQA 4JWUC 1BUIC 2KLCA 3IAM1 2KZRA 3VH4B 3U8ZA 4PS3A 2D07B 3VAWA 1ESFA 3VXWA 3VQIA 4KV2A 3LJ3A 2KNBA 4GIVA 2VRRB 3A4RA 3CSFA 1FMAD 3PGEA 1I35A 2LGSA 1E8ZA 2Z59B 5DCNA 1TKEA 3R66C 5JHAA 1B9RA 2M17A 2BB6A 4HJGE 1T3QA 2VH1A 2LXCA 3Q3MC 2EKIA 2GB1A 3RCZA 1P9DU 1YJJA 1WJ6A 1QF6A 1TIFA 3DBLI 4B0MA 1D5ZC 3KLSX 4YSZB 4J6IA 2WXPA 4HROA 2IGDA 2IPKD 1AN8A 2E3TA 4KGSA 5AEKB 3P63A 1WGRA 4LDTD 4ACFA 1D4BA 2N7DA 3DBHB 1T0QC 1YX6B 3EUB2 4YWGG 4BVUC 2CJNA 2BF8B 1R4NI 2FE8A 1WX9A 4DK5A 4FHJA 1XLQA 5E6OA 4A90A 2DX5B 1K53A 1UF0A 2IBIB 1F77A 1PFDA 5T8IA 1L0XB 4WJOA 1NYRA 1SE3A 5IKCM 4CQNA 3QARA 3QWZB 1J7CA 2Y3AA 3HRDD 1Z5SB 1V2YA 3ZJTA 2N4FA 4IWOA 1JW9D 4S0RA 2BYEA 2LGYA 1BXTA 4RGTA 3WCQA 3I57A 2K6QA 2J53A 1KFYB 3FILA 1T0RC 4WWMA 2FAZA 2L05A 2WNMA 2H89B 2INNE 1A5RA 3H9DA 1FNWA 1HQRD 5E6PA 1V5OA 1F2RC 2FCMA 2WHIA 2JRHA 1EU4A 1JRUA 2W82A 2UU7A 2Y5PA 3SEBA 3APFA 3NVWA 1I4QA 2INDC 1ZDVA 3TEZA 4HPLB 1WM3A 3NZSA 3WAOA 2MRPA 1WXMA 1FEHA 4PS8A 2RSUA 4XX5A 4W9LA 1WR6E 2JVCA 4URKA 3Q8AA 1YN5A 1FRDA 1NYQA 3RT3B 3W1SC 1V6EA 1C4AA 3DVNV 2W3RA 4YSYB 1VR9A 2AQ3B 4MGIE 4JWSC 2WX0A 4K3BA 5FR6A 4KVGB 2JYTA 4KX6B 3GE3C 3R7RA 4W9EA 2MEKA 3RI7C 3S2AA 2OJWA 3DHHC 3Q69A 2LD9A 2KKCA 5AZHA 3AH7A 5HHDG 3KWLA 1KJTA 2JYEA 2R2QA 2KDEB 4G3XB 4FADA 1WSPA 4KIKB 3V60A 1E0ZA 2Y5CA 1IBXB 3ZVVA 1FNUA 1FNVA 2K0PA 2IYDB 4ZRIA 2DBYA 3AEEB 4MACA 4FJZA 1WX8A 3I3TB 2KDBA 4LNFA 3A9JB 3ZQ4A 4BZAA 2DAFA 4IOIE 1KOTA 5JZEB 3KH0A 2BYFA 2LHEA 2WXNA 3ZTDA 2WDTB 2MP2B 3V62A 2LVPA 1CZPA 2PLPA 1E7PB 3NS1A 1P98A 1WE6A 3GP7A 4IG7B 1NDDA 3SDLC 5IN7A 1WGDA 3JW0X 5JXVA 2BS4B 1FXAA 4Q2JA 1B1ZA 2PE6B 1GJZA 1NENB 4C4VA 2LVOA 1WGGA 3DDCB 1TYGB 2LZ6A 3VTVA 4EE2A 4RGNA 3HVZA 4XZ4A 1LO5D 2D3BA 2WXHA 2LUMA 1KLVA 2MQJA 1WY8A 4KZCA 5C2TB 2MHJA 1R7SA 2BWFA 3CIRB 2IZVB 2QDFA 1VCBA 2ZVOA 5KHOA 2KJ6A 1C4CA 1XT9B 2GRIA 1F9JA 2KK8A 4I6LB 3X0WA 1FM0D 3BYYB 1E8WA 4DBGA 2DZMA 1ZXHA 3L13A 1S1QB 3V61A 3WAMA 1PGXA 5C3JB 1V8CA 1AYFA 1TTNA 3DBHI 1WM2A 4DXFA 2ON8A 1JROA 3FC4A 4M8NA 3T3OA 2QIEB 2FIDA 3I5JC 3B2GA 2MJ3A 3N1XC 1LXDA 4BOSC 3AB5A 3OWEB 4NZLB 2V3SA 2JX5A 3RN9C 4CYEA 2QCZA 4M00A 4JIOU 2DYOA 2K5PA 2PEAA 4WWPA 3EECA 3OG5A 5AUIA 1HE8A 5CTRC 2WU2B 4RCOA 1WMHA 3AEDB 3NOBA 1UUPA 4B0EA 3VTWA 4PS7A 2FUG1 3QCAA 3ABVB 1UNSA 1XCQL 4A6QA 3APDA 2JZ3B 1JMLA 1XLPA 3A4SC 2I1KA 1V1PA 3AEGB 1RM6C 1EUVB 4PYZA 3DWGC 3NY5A 1MG4A 2KO3A 3DHGC 3W5VB 2JWUA 2M4NA 4L23A 4NJCA 5HG2A 2AEHA 1WGKA 3N30A 2VZKB 4M02A 2OEDA 4LNKA 5DPRA 3T9LA 2LWPA 2FCSA 1YJIA 3NZ3A 3V6EB 2GOWA 3ZNZB 4JPSA 1P7EA 1IUEA 4I6PA 4MELA 1S3SG 3ONSA 3PS6A 1UWMA 3ZXVA 4MEMA 3UQAA 3VUWA 2IY0B 2SAKA 3PRPB 2BS2B 4BKSA 3Q6BA 1V80A 3FAHA 3DVNU 5D2MB 2L00B 2VZKD 1ET6A 2FBWB 2FCNA 4MH8A 3PLUA 1P1AA 5J2RA 3OJ3A 1N5XA 1J19A 5AUKA 2LJIA 5BMGA 5CX3A 4AJYB 3MC8A 5BYSA 2JT4B 3TEYA 4K7UA 4HVBA 3ZYYX 1TS4A 1QQRA 2SEBD 2YEPF 1GG3A 3HIZA 3WA0A 3RNGC 1CQVA 3ZO5B 4AUQC 2RR9A 3BK2A 1FCCC 4DDGD 1D5MC 3FILB 3EGRA 3Q8BA 1C1YB 1L6VA 4RF1A 2EELA 1GC7A 2KWCA 2L1AA 4BFRA 1HEZE 4HCPB 4A3OA 2C5LC 4EUTA 3IAS1 5L95C 2M1MA 3MTNB 3ZLZA 3B08A 3NUHB 3ZW3A 1K8RB 3ML8A 4F8CB 1WIAA 3Q3NC 4KSLC 2O6VD 2KN4A 1F1HA 1WI0A 3AE4B 2JY6A 3AMZA 4ARIA 3W2DA 4ZHPA 4OVUA 3GOEA 1UGMA 1PDXA 3TL5A 2M0XA 1V97A 2GBKA 3KUDB 3OAWA 1DOYA 2C60A 2ZEQA 3QJZA 3L54A 4C56C 2WXRA 2ACZB 2C7NB 2NBUA 1FFUA 2WXOA 5G55A 1ZGUB 2N9XA 3PLVA 4GB9A 4MSQB 3D32A 1I7HA 3LB8C 1AARA 4ZOHC 1OGWA 5LNK1 2KOXA 2RDBC 3PZDA 3L17A 1NI3A 4ANXA 4C80A 4MSMB 4GGQA 1H4RA 5IO9A 3SD5A 2DZKA 3ETRA 3RD2A 1N62A 1NEKB 3SFDB 5C1ZA 3DOWA 2KDFB 2WXGA 3ZRCA 1P3QU 2E6XA 4BOZB 5D94A 1SB3C 2N9KA 2NPTA 4K7WA 3VH3B 5MPOA 1SEBD 4RMAA 3J9CA 3MP9A 2PIAA 2K9XA 5E6JA 4YL8A 3UI3A 5LLIA 3CMMB 3MHZA 3TEXA 4K1RB 3ZDMC 1L7YA 2A5UA 3KUCB 3V05A 1MPEA 3GS2A 2HE7A 4GDLA 2MBBB 2PTLA 1J7BA 2ZW0A 5H92C 4OW0A 2EMTA 1TY0A 2GLSA 3IT6B 2HTHA 3AEFB 4ANWA 4YSXB 1LGRA 4HCNB 2MJEA 1YD8U 2FNJB 3NVVA 2N1VA 3V3XA 1GAQB 3PZ8A 3Q3JA 5HKHA 2Z8LA 1WJUA 2MWSB 2Q5WD 4CHKA 2MA9B 1A70A 4ZDVA 2YLMA 5GXGB 2MJDA 4OZCA 4RF0A 2N0SB 1ZKHA 5EE9A 5AZFA 2L52A 1LQBA 2BYTA 2V4LA 1V81A 3B2FA 1XLOA 2N9EB 1SSNA 1KRHA 2L8JA 4XWTA 4IC7B 2NS5A 2OJRA 2MBHA 1ZOYB 2DHZA 1WE7A 3APCA 2AQ1B 3BYTB 3AEBB 3BK1A 3A33B 1SGHA 4JGHB 3CF6E 2LI5A 2HDEA 3ZRFA 4DDID 4H2AA 3VHTC 3DPDA 2M8SA 1CMXB 4HPMB 3P1MA 1FIQA 2JSVX 3ZJUA 1V1PB 3P4SB 2N9PC 2WU5B 2JRIB 4WWNA 3VUYA 2K22A 1P0RA 4LCDE 4NAWA 4MGKE 4AQ7A 1FXTB 2WLBA 3PO0A 1JWSD 4ANUA 2JWZA 3T8MA 4W9IA 2X8XX 3VTUA 3H7SA 4IM2A 3QK0A 1EWYC 2Y5BB 1WXAA 1RWSA 4GOCA 1WGHA 3DBRI 5BO4B 1ZUD2 2BT6A 3CSTA 1DOIA 3ZXRA 2N9LA 4LTUA 4RM9A 4US9A 1OTRB 1YN3A 2IO1B 3VRBB 3ZKJC 5BMIA 4IKGA 3SFEB 1WWTA 4A55A 3V6CB 2V1YA 3A1QA 2AYOB 1MHHE 1T0YA 2LGIA 2ZCBA 1D5XC 4JQWC 2K8CA 3H7PA 5CHFA 3RYTA 4P6VF 3ECIA 4LNNA 3TUOA 4AP4C 1WZ3A 2LMCA 4WQMA 2K6DB 4RNAA 2OOBB 3PHWB 2TSSA 1OQYA 3JSVA 4E74A 3EHVA 4BKSD 4N6EB 2KFJA 3AV8A 2MSED 2KWUB 1JQ4A 1YN4A 4DHZE 2J4XA 2QEJC 4DHZB 3PZ7A 2KYWA 2W54A 1UBQA 2QSDA 4PYUA 4FJVB 4MM3A 4USAA 5D3IB 2W9NA 2NR2A 2G3QB 4GDKA 2KQ7A 2HTME 1WXQA 1Q5WB 3UQBA 1TS5A 5IAAC 4BAXA 3VR9B 2MH7A 3B1LX 3BWUD 3VDZA 2KMMA 3M62B 1PUTA 3GZNB 1RRBA 2UYZB 2WP9B 1UH6A 4II2B 4RM8A 5G2NA 4OVZA 1SE9A 1H8CA 4RH6A 1EM7A 1CJEA 2G45B 2J0KA 4GSWA 4ARCA 2LGXA 1F2RI 2D10A 1RFKA 3K9PB 4J3OD 1TZ1A 3M3JA 1JWAD 3LYYA 4BBNF 4DHJB 5I4DA 4K3CA 2L7RA 3KWVA
chains in the Genus database with same CATH topology
5BMHA 1JWBD 1E10A 3FAHA 1KF6B 4RGMA 1CK1A 2AX5A 2VZKD 1ET6A 2KDMA 2OHFA 2FBWB 3NVYA 2BTEA 2BS3B 4MH8A 1F0ZA 4HKQA 5FR3A 1N5XA 2KWDA 2PW9A 4D2KA 5AUKA 4IDIA 3DWMA 2LJIA 5BMGA 5BYSA 3TEYA 1FCLA 4R3DA 4WURA 4YXDB 1TZOA 3AE5B 2V0GA 1SXTA 3ZYYX 5G5GA 1QLBB 1TS4A 1QQRA 2SEBD 2YEPF 4HRSA 5BYRA 2QJLA 3IXSA 2WXJA 1AW7A 2L83A 3SR6A 1CQVA 1N60A 4JWUC 2NTTA 1BUIC 1MI0A 1C79A 1FCCC 3BK2A 1D5MC 3FILB 3IAM1 3EGRA 2K3UA 3Q8BA 4RGOS 2PKOA 1RYJA 4HEA1 1L6VA 1IGCA 1EWCA 4RF1A 2EELA 1ESFA 2L1AA 2IGHA 1HEZE 3AE3B 3VQIA 1JRPA 4XDDA 1C78A 1KLUD 5D3DA 3IAS1 4NAMA 1QOBA 1FMAD 5FKAC 3NUHB 1M4VA 3MJ5A 1ZDXA 1TS2A 2N7JA 1SIJA 4A9AA 1TKEA 2WXLA 1B9RA 2KN4A 3AEAB 2BB6A 4HJGE 1T3QA 3MFGA 2W3SA 3AE4B 3AMZA 4ARIA 3AE6B 2JU6X 1L5PA 4LK0M 2EKIA 3W2DA 2GB1A 4ZHPA 1YJJA 1QF6A 1HA5A 1PDXA 4GDLB 1V97A 4B0MA 1D5ZC 2XN9C 3KLSX 4JX1C 4YSZB 4ITKA 3U52E 1DOYA 2WXPA 1IGDA 3HUIA 4HROA 4C56C 2IGDA 2IPKD 2WXRA 1AN8A 2E3TA 3RFZB 2ACZB 4KGSA 2BW2A 2RMMA 3P63A 1OFFA 1SE2A 3AE9B 1FFUA 2WXOA 2B76B 1D4BA 3NRZA 3AE1B 1MVKA 3EUB2 1TJEA 4YWGG 2L32A 1I7HA 2CJNA 3LB8C 1T6BX 4ZOHC 1K50A 1E9MA 1I4RA 5LNK1 2FE8A 2WDVB 2DLBA 5BYQA 1HXYD 1XLQA 1NI3A 4A90A 1K53A 1F77A 2D5GA 2H88B 4C80A 1PFDA 5T8IA 3E9SA 1L0XB 3P42A 1NYRA 2M19A 1SE3A 4N58A 4CQNA 1VZ6A 1GB4A 1FFVA 1DYQA 3BVMA 1J7CA 1C77A 2Y3AA 3HRDD 1ZP0B 4DQOC 2R61A 3ZJTA 2KQ4X 1UWXA 3ETRA 1C4PA 3I9V1 3Q8FA 1N62A 1NEKB 3R2TA 3SFDB 3AN1A 2V3NA 1JW9D 1QOGA 2WXGA 1WYGA 4YTMB 2E6XA 1BXTA 4RGTA 4TSSA 4WIPA 1AWDA 3WCQA 1SB3C 3I57A 1V1OA 1L0YB 2N9KA 2J53A 1KFYB 3FILA 3P4RB 3R2IA 3ZGZA 5MPOA 5HFYA 1GB1A 1SEBD 4WWMA 4JE3B 2WNMA 2WXFA 2H89B 2INNE 1I4HA 1FNWA 1HQRD 1ZXIA 3J9CA 1F2RC 1QKZA 4MT5A 1EU4A 2W82A 4XDCA 4C7ZA 2Y5PA 3SEBA 3MP9A 1I4XA 2PIAA 1QOFA 1JALA 3NVWA 1I4QA 2RDGA 2K9XA 2QMTA 1ZDVA 3TEZA 5E6JA 1YQ3B 3L4PA 3UI3A 4GLSC 3LXFA 4FXCA 1T5XD 3MHZA 4WH4A 3TEXA 1FEHA 2ONQA 3ZJVA 3B9JA 1ENFA 2ICIA 1D6EC 3Q8AA 1STEA 2GI9A 1YN5A 1FRDA 1NYQA 4KGTA 4YT0B 3V05A 1MPEA 3GS2A 5EE0A 1OQRA 4OZBA 1C4AA 1OQQA 3O13A 2W3RA 4YSYB 2CJOA 2PTLA 1VR9A 1HZ5A 3N9YC 1XCTL 1E6EB 1J7BA 2ZW0A 2LHDA 2AQ3B 1KH0A 5H92C 4JWSC 4OW0A 3URYA 4AS1A 1IBXA 1VZ8A 1TY0A 4WAFA 4ZYSA 3W1SA 1YMHE 2JYTA 1PGAA 4KX6B 4KGRA 3IT6B 3MC0B 4YTPB 3EA6A 3AEFB 2MEKA 2QILA 3IT4B 4YSXB 1KLGD 2MJEA 4ZHOA 3U7ZA 3Q69A 3NVVA 3V3XA 1GAQB 3PZ8A 1TY2A 4DXGA 2Z8LA 2Q5WD 3AH7A 5HHDG 3KWLA 2LEKA 4L2YA 1L4ZB 5HI1A 3T3NA 2JYEA 1A70A 4UDUC 5GXGB 1Y56A 2MJDA 4OZCA 4RF0A 1QOAA 1WSPA 4N59A 1SF0A 4TQ1A 3W9CB 1E0ZA 2N0SB 2Y5CA 5G5HA 1IBXB 1MHXA 2J42A 5EE9A 3RPFC 1PYWD 1FNUA 1FNVA 2AQ2B 2L52A 2K0PA 1QT9A 2V4IB 2DBYA 1UGJA 3AEEB 2BYTA 1BMLC 4MACA 2M0AA 3Q8EA 1P7FA 2IJ0A 2W55A 3B2FA 2DWQA 1XLOA 1SSNA 1KRHA 3ZQ4A 4XWTA 2PMVA 1DOXA 4IOIE 3VR8B 1VLBA 4TQ0A 3AE8B 1TKYA 1ZOYB 2LHEA 2WXNA 1GOZA 1L6UA 2AQ1B 3BYTB 1CZPA 3AEBB 3BK1A 2PLPA 4ZRPA 1E7PB 3NS1A 3GP7A 2HDEA 4M0WA 4H2AA 2JXTA 2IDYA 1XF5L 4O1NA 1VJKA 3P1MA 1FIQA 2JSVX 5JXVA 3ZJUA 1V1PB 2BS4B 1FXAA 4Q2JA 2WXMA 3BZDB 3HVDA 3P4SB 4HKZE 1B1ZA 1VZ7A 1XLNA 2WS3B 4GDKB 1ACCA 1NENB 1XXGA 2M56B 2RDHA 2WU5B 3TSSA 1TYGB 1WRIA 2K22A 2IGGA 2PVOD 4REZA 4EE2A 1XEEA 2KAJA 4AQ7A 4RGNA 3HVZA 2WLBA 4KKJA 2J52A 1LO5D 3PO0A 2WXHA 1FRRA 1JWSD 1FO4A 2LUMA 1HZ6A 2XNAC 2G9HD 5EE1A 3BVZA 1I4GA 1VDVA 5C2TB 2WQYB 1R7SA 1PGBA 3CIRB 1EWYC 3P4PB 1C76A 4L1BA 1XO3A 1C4CA 2GRIA 2RPVA 2INPE 2WDRB 4XE0A 4ZRQA 4US8A 1VRAB 1ET9A 4NAWB 1RWSA 3AECB 1FM0D 1EU3A 3BYYB 1ZUD2 2BT6A 1DOIA 3U2SC 2N9LA 2ZW1A 4LTUA 4US9A 3BVGA 1YN3A 1L0VB 3VRBB 5BMIA 3U4EG 1SJED 1ZXHA 4IKGA 1TKGA 5FK9C 1PGXA 5C3JB 1V8CA 3SFEB 1AYFA 2JQRB 1WWTA 4LLGM 4A55A 4TMAB 1C9FA 5D7GA 4P16A 2DYMA 2ON8A 4DXFA 1JROA 3FC4A 3T3OA 1MHHE 1JWUD 2QIEB 4OHJA 3H8HA 3B2GA 1ROEA 3P4QB 2LGIA 2MJ3A 1SE4A 2BB5A 3AM9A 3VRAB 1J7AA 1D5XC 3TEWA 3AB5A 1ZE3D 3OWEB 4NZLB 3AE2B 4P6VF 2JX5A 1N5WA 4PT5A 3TUOA 2LMCA 4WQMA 2WXIA 4C7YA 3E56A 1N63A 1Q10A 2DYOA 4RNAA 2K5PA 2TSSA 1ZPSA 5AUIA 1K52A 1QILA 2WU2B 4RCOA 1KTKA 1FD6A 4YTNB 1GPXA 2NTSA 4N6EB 4KKIA 3AEDB 2WXQA 1UUPA 3AV8A 4B0EA 1JQ4A 2CU3A 1YN4A 3BIID 2J4XA 2QEJC 3Q8CA 2FUG1 3PZ7A 3ABVB 1UNSA 1TS3A 2W54A 1XCQL 5H8YE 4A6QA 1L4DB 1JMLA 2QSDA 1XLPA 1YQ4B 2YEPB 3W5UB 4USAA 5D3IB 2BBCA 2KACA 1V1PA 1YNTE 3AEGB 2PVGC 1RM6C 2HTME 1WXQA 2WXKA 3AE7B 3NVZA 2I38A 1TS5A 3DWGC 1SJHD 1I4PA 2JZPA 3VR9B 3W5VB 2JWUA 4L23A 5EE3A 3CWIA 4NJCA 4RFBA 2MH7A 5HG2A 1SBBB 1JCKB 4A8XC 1WGKA 2VZKB 2OEDA 1NVID 1JWMD 3BWUD 4MM3B 4OZAA 2KMMA 1PUTA 2WP9B 4XWWA 1DGJA 1YJIA 3NZ3A 1FXIA 4OVZA 4JPSA 2G1EA 1P7EA 1IUEA 4RH6A 1EM7A 3C8YA 2I2YA 3R8BA 1CJEA 2WDQB 3KQ4A 4ARCA 1UWMA 1F2RI 1N61A 2NMQA 1RFKA 4J3OD 1K51A 2X38A 3GB1A 1JWAD 2SAKA 3LYYA 5TSSA 2BS2B 5I4DA 2V3PA 2LFIA 3KWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMH A;  1C9F A;  4OZC A;  5HI1 A;  2ON8 A;  2KDM A;  1K53 A;  1MHH E;  1IBX B;  1MHX A;  2LGI A;  2K0P A;  2KWD A;  2PW9 A;  4D2K A;  5BMG A;  1GB4 A;  1FCL A;  4MAC A;  1P7F A;  2KQ4 X;  1UWX A;  4IOI E;  1Q10 A;  2LHE A;  1MI0 A;  1K52 A;  1FCC C;  3FIL B;  2N9K A;  2J53 A;  1FD6 A;  3FIL A;  2PLP A;  5HFY A;  1GB1 A;  1IGC A;  2JXT A;  1XF5 L;  1XCQ L;  2EEL A;  2IGH A;  1F2R C;  1QKZ A;  1HEZ E;  1JML A;  2JSV X;  2QSD A;  5JXV A;  3MP9 A;  4HKZ E;  1K50 A;  2KAC A;  1YNT E;  2QMT A;  3UI3 A;  4GLS C;  2N7J A;  2I38 A;  2IGG A;  4WH4 A;  2JZP A;  2JWU A;  2ONQ A;  2KN4 A;  4HJG E;  2J52 A;  5HG2 A;  2JU6 X;  2GI9 A;  2LUM A;  1HZ6 A;  2GB1 A;  4KGT A;  1MPE A;  2OED A;  1PGB A;  4OZA A;  4OZB A;  2PTL A;  1HZ5 A;  1IGD A;  1XCT L;  2RPV A;  2ZW0 A;  2LHD A;  1KH0 A;  1P7E A;  2I2Y A;  1EM7 A;  2IGD A;  1IBX A;  1YMH E;  1PGA A;  4KGR A;  4KGS A;  2RMM A;  1F2R I;  2N9L A;  2ZW1 A;  2NMQ A;  1D4B A;  1K51 A;  1MVK A;  3GB1 A;  3V3X A;  5BMI A;  1ZXH A;  4IKG A;  5HHD G;  1PGX A; 
#chains in the Genus database with same CATH topology
 2MLB A;  1JWB D;  1E10 A;  1E7V A;  1KF6 B;  3NHE B;  2AX5 A;  1E7U A;  2KDM A;  3ENE A;  5D6J B;  4EEW A;  2KTF A;  1F0Z A;  4HKQ A;  1MFW A;  3R3M A;  2PW9 A;  4IDI A;  2KDI A;  3DWM A;  4WWO A;  4NY0 A;  4R3D A;  4YXD B;  5G5G A;  2B3A A;  1E8X A;  4GXB A;  5AZG A;  1R4M B;  1V49 A;  2NTT A;  1C79 A;  2K3U A;  4DHJ D;  3DCG A;  1E8Y A;  4RGO S;  3HM3 A;  1RYJ A;  5IOI A;  4HEA 1;  4LNI A;  3GE8 C;  4LJP B;  2IGH A;  1PQS A;  1WZ0 A;  2KTR B;  5JH5 C;  1WXV A;  2O2V A;  4K7S A;  2QHO A;  3LDZ E;  5D3D A;  3UGB B;  4NAM A;  1U4A A;  4W9C A;  2WYQ A;  4AWJ A;  5FKA C;  1M4V A;  1ZDX A;  2N7J A;  4A9A A;  2WXL A;  2MBQ A;  3QQ8 B;  2W3S A;  3MHS D;  3HM6 X;  3RMK C;  2JU6 X;  2KLG A;  1E5W A;  2GBJ A;  3L08 A;  2RGF A;  4AJW A;  4GDL B;  1D3Z A;  2XN9 C;  3PTF C;  4ZRJ A;  4ITK A;  3U52 E;  4OVV A;  3HUI A;  4P1B C;  2BW2 A;  1SE2 A;  3AE9 B;  2B76 B;  3AU5 A;  3NRZ A;  3AE1 B;  2CHW A;  2R2O A;  1MVK A;  2DAJ A;  4MGY E;  1TJE A;  2L32 A;  2Z0E B;  1EO6 A;  3WAL A;  1K50 A;  1E9M A;  1I4R A;  1WX7 A;  2WDV B;  2DLB A;  2EKE C;  1WJN A;  4KSK C;  3AXC A;  2H88 B;  2D5G A;  3WAN A;  3PRM B;  1LM8 B;  4TKN A;  2GBM A;  2BYV E;  4N58 A;  1VZ6 A;  1FFV A;  4XC2 A;  1YJ1 A;  1C77 A;  2R61 A;  2KQ4 X;  3TBL D;  4QAY A;  3Q8F A;  4N9F 4;  1QOG A;  2HJ8 A;  2CHX A;  4YTM B;  4WIP A;  1AWD A;  1L0Y B;  3MJW A;  4HDO A;  3P4R B;  2HD5 B;  4TV3 A;  5HFY A;  4IW0 A;  4JE3 B;  2KT7 A;  1I4H A;  1ZXI A;  1QKZ A;  4P1C C;  4A20 A;  4W9H A;  4XDC A;  4W9G A;  4C7Z A;  4NQK E;  1I4X A;  5LXH A;  3U30 A;  2RDG A;  2QMT A;  3TJP A;  2KX0 A;  1YQ3 B;  3L4P A;  3C0R B;  3LXF A;  1J8C A;  4KDL B;  4A3P A;  3QAQ A;  3RNB C;  5J17 A;  2IO2 B;  3ZJV A;  1R4N B;  1GNU A;  1ENF A;  2KWV B;  3RUI B;  1D6E C;  2GI9 A;  3BIN A;  4KGT A;  4YT0 B;  2DYB A;  1ZW7 A;  4FN2 A;  4HLE A;  3DVG Y;  5EE0 A;  4OZB A;  3O13 A;  5DPS A;  2XEW A;  2ZNV C;  3UIP B;  1HZ5 A;  1E6E B;  3ML9 A;  1KH0 A;  4IM3 A;  1Q0W B;  3L16 A;  4NPN A;  1IBX A;  4WAF A;  3VFK A;  1WRD B;  3EA6 A;  2QIL A;  3IT4 B;  1YQB A;  2CU1 A;  4ZHO A;  3U7Z A;  1MG8 A;  1TY2 A;  4DXG A;  1HTO A;  3VUX A;  3N1Y C;  2LEK A;  4L2Y A;  1L4Z B;  5HI1 A;  1RLF A;  1BT0 A;  1Y8R C;  3NJT A;  3PRE A;  4EFO A;  4GU2 A;  2KX3 A;  3AUL A;  5G5H A;  2L0T A;  1MHX A;  2J42 A;  4KDI C;  1PYW D;  1TT5 B;  3Q3O C;  1QT9 A;  2V4I B;  3H7P B;  1BML C;  4GMV A;  3Q8E A;  2LXA A;  2DWQ A;  2LRU A;  1V5T A;  4II3 B;  4W9F A;  2K25 A;  4E3C A;  3RNA C;  2KMC A;  3VR8 B;  4TQ0 A;  3AE8 B;  3PV1 A;  4ICU A;  2ASQ A;  1L6U A;  5C23 A;  3N32 A;  2LUE A;  4ZRP A;  3OLM D;  2BKR B;  1WF9 A;  4E71 A;  4M0W A;  1HTQ A;  2IDY A;  1XF5 L;  3WIM A;  2V9H A;  3KYD D;  2XK5 A;  4O1N A;  2KD0 A;  2RPQ A;  2ZPY A;  2JF5 A;  3HVD A;  2WS3 B;  4GDK B;  1WFY A;  1XXG A;  2M56 B;  3TSS A;  2K8H A;  4REZ A;  2KAJ A;  4GN1 A;  5JHB A;  4KKJ A;  1WR1 A;  1HZ6 A;  4EOY A;  2XNA C;  3Q14 C;  2G9H D;  5EE1 A;  1I4G A;  3M63 B;  3K9O B;  2DNF A;  2DZJ A;  4C4V B;  1C76 A;  1XO3 A;  3P2B A;  2RPV A;  2WDR B;  2INP E;  4XE0 A;  4US8 A;  2ZVN A;  1VRA B;  3IFW B;  3O65 B;  3AEC B;  4BBN C;  1NI2 A;  2MBO A;  1V9J A;  3ZIM A;  4FBJ B;  2KVR A;  4EKU A;  1L0V B;  2KHW B;  2N1W A;  1SJE D;  2LAS A;  5FK9 C;  3TMP B;  4LLG M;  1WXS A;  5D7G A;  4P16 A;  3Q2A C;  2DYM A;  2LJ5 A;  4KZ0 A;  2KN5 A;  4OHJ A;  3N20 C;  3H1U A;  1ROE A;  2JZZ A;  3VRA B;  1SE4 A;  3AM9 A;  1F52 A;  3IG3 A;  1ZE3 D;  4FHK A;  2ZPN A;  4PT5 A;  4C7Y A;  4B6W A;  1N63 A;  1Q10 A;  2RD0 A;  3ZNG C;  4LDT B;  4ANV A;  1K52 A;  3AI5 A;  2WXQ A;  2AL3 A;  2CU3 A;  3Q8C A;  4HPP A;  5H8Y E;  1L4D B;  2O2V B;  4F1S A;  2K39 A;  2YEP B;  2BBC A;  1WGY A;  3QC8 B;  2PVG C;  3FKY A;  3IVF A;  2BWE S;  2G4D B;  2CHZ A;  3AE7 B;  1WMH B;  2I38 A;  4FJY A;  3KUZ A;  1I4P A;  2JZP A;  3DVG X;  3CWI A;  2KJH B;  3RZF A;  1Z2M A;  2NCN A;  3TCA A;  2VH2 A;  2DZI A;  1IPG A;  1JWM D;  4OZA A;  3UIO B;  4JL9 A;  2I1J A;  1EF1 A;  3KW5 B;  3PPA A;  4XYC A;  4XWW A;  1DGJ A;  1Q1O A;  3N1Z C;  1FXI A;  4W9J A;  4HJK A;  4FUL A;  3R8B A;  2KC2 A;  5GMV A;  3ZTC A;  2WDQ B;  3KQ4 A;  2L76 A;  1N61 A;  4TUU A;  4M01 A;  4EZK A;  2NMQ A;  2X38 A;  4B95 A;  5TSS A;  4F7Z A;  1UD7 A;  2V3P A;  4HDQ A;  2O6V A;  1J0G A;  5BMH A;  2KAN A;  1CK1 A;  2OHF A;  1WJ4 A;  3NVY A;  2BS3 B;  2BTE A;  4P7I A;  3NS8 A;  2KWD A;  2A4Z A;  4G11 A;  1EF5 A;  1FCL A;  1L2N A;  4WUR A;  1TZO A;  3AE5 B;  2V0G A;  4WJP A;  1SXT A;  5CHV C;  1QLB B;  4G50 A;  2QJL A;  1N60 A;  3PVL A;  1MI0 A;  2CS4 A;  2BVC A;  3PRZ A;  2PKO A;  3VVW B;  1GC6 A;  1IGC A;  1EWC A;  1UZX B;  3A9K A;  3L10 B;  3QHT A;  4AOF A;  3AE3 B;  1JRP A;  4XDD A;  1C78 A;  1KLU D;  3ZNH B;  4LNO A;  1QOB A;  2LRW A;  2IY1 B;  3MJ5 A;  3BY4 B;  4NQL B;  1TS2 A;  2KFK A;  1SIJ A;  4CO7 A;  1OEY A;  3DQV A;  4MJS A;  2EMS A;  3AEA B;  4WJQ A;  1WYW B;  3MFG A;  3AE6 B;  3WAP A;  1L5P A;  3QIJ A;  1UBI A;  1HA5 A;  4ZYN A;  1I42 A;  4JX1 C;  1LFD A;  2JUO A;  1X1M A;  1IGD A;  1KM7 A;  4M8M A;  2PJH A;  3RFZ B;  1G6J A;  2K8B A;  2RMM A;  2LGD A;  4W9D A;  1OFF A;  3NG0 A;  5TR5 A;  2KJR A;  2C7H A;  2K1F A;  1SIF A;  2KQS A;  1OEY J;  1T6B X;  2JXX A;  5BYQ A;  1HXY D;  3R7Q A;  4MH0 E;  3E9S A;  3P42 A;  2M19 A;  1V86 A;  2D3G A;  1GB4 A;  1DYQ A;  2C7M B;  3BVM A;  3NZU A;  4XGA B;  1ZP0 B;  4DQO C;  4B9K A;  2WGS A;  1UWX A;  4IM0 A;  2PE9 A;  4W9K A;  1C4P A;  3I9V 1;  4BKT A;  3R2T A;  3AN1 A;  2V3N A;  3ZDT A;  1WYG A;  1T0S C;  4TSS A;  5DPT A;  1RFA A;  1V1O A;  3R2I A;  3ZGZ A;  3L0W B;  1GB1 A;  4M0W B;  2MW5 A;  2Z0D B;  2WXF A;  2J7Q B;  2XK5 B;  2FIF A;  2KMA A;  2HJ1 A;  3QA8 A;  4FA6 A;  4MT5 A;  2AWT A;  2IO3 B;  3U7D A;  1QOF A;  1JAL A;  1VD2 A;  2GMI C;  2NPT B;  4GLS C;  1FPY A;  4FXC A;  1E90 A;  1T5X D;  4WH4 A;  2D11 A;  2ONQ A;  2WWZ A;  3B9J A;  2MCN B;  2NBW B;  2ICI A;  1STE A;  1OQR A;  4FLH A;  1OQQ A;  1WH3 A;  4EZL A;  2KC1 A;  2CJO A;  3ZNI D;  3N9Y C;  1XCT L;  2INC C;  2LHD A;  4AS1 A;  3URY A;  1VZ8 A;  1C3T A;  4ZYS A;  3W1S A;  1YMH E;  1PGA A;  4KGR A;  3MC0 B;  4YTP B;  2C9W B;  1KLG D;  1UEL A;  3ALB A;  3AU4 A;  2GBN A;  4EZJ A;  4K81 A;  3EFC A;  3T3N A;  4UDU C;  1Y56 A;  1QOA A;  4N59 A;  1SF0 A;  4TQ1 A;  3RZW C;  3W9C B;  3RPF C;  2PPH A;  2AQ2 B;  4IWP A;  2AL6 A;  5LXI B;  1UGJ A;  4DXA B;  2M0A A;  2MX2 A;  2ZNV B;  1MJD A;  1P7F A;  2IJ0 A;  2W55 A;  3KVF B;  4NJ7 A;  2PMV A;  1DOX A;  2XBB C;  1VLB A;  1TGZ B;  4MGZ E;  1TKY A;  1GOZ A;  1IP9 A;  2L0F A;  2YVC A;  2REX A;  5CHW A;  5IP4 D;  2NVU I;  2JXT A;  3RNF C;  2FUH B;  1VJK A;  3SHQ A;  2N7E A;  2WXM A;  3BZD B;  4HKZ E;  1VZ7 A;  1XLN A;  4MDK E;  1ACC A;  4WJN A;  2RDH A;  4DWF A;  1WRI A;  4IUM B;  4HXD A;  1YOV B;  2IGG A;  2KVZ A;  2PVO D;  1XEE A;  3DBL B;  2J52 A;  4HWI B;  2BPS A;  3TIX A;  2CR5 A;  2ZZP B;  1FRR A;  1IYF A;  1FO4 A;  4NJ6 A;  3BVZ A;  1VDV A;  1GUA B;  2WQY B;  3ZUN A;  3I63 C;  1PGB A;  2WX1 A;  4I6N B;  4WQO B;  3HK0 A;  3P4P B;  4L1B A;  2LVQ A;  4JLC A;  4ZRQ A;  3N3K B;  1ET9 A;  4NAW B;  3KYC D;  2QC8 A;  1EU3 A;  4X57 B;  3U2S C;  2ZW1 A;  3DBS A;  3BVG A;  2D2Q A;  3U4E G;  3B0A A;  2O6V B;  3UIN B;  1TKG A;  3M95 A;  1YIW A;  3SU8 X;  3PSE B;  2JQR B;  4TMA B;  1C9F A;  3JYU A;  4BKG A;  2UWQ A;  3W1Y A;  1JWU D;  3H8H A;  4KIK A;  3P4Q B;  2BB5 A;  1TBE A;  3GZN I;  1J7A A;  3TEW A;  5E6N A;  4ZRK A;  3AE2 B;  4NNJ B;  1N6Z A;  2MBE A;  1N5W A;  4IWQ A;  2NBV B;  4ICV A;  2WXI A;  3A9J A;  3X23 A;  3E56 A;  3RUL A;  1ZPS A;  4C00 A;  3A1Q B;  2IO0 B;  2KXJ A;  1QIL A;  3PHX B;  4WAA A;  1KTK A;  1FD6 A;  4YTN B;  1GPX A;  2NTS A;  2MP2 A;  4KKI A;  1XD3 B;  3PT2 B;  1NBF C;  3A9K B;  3BII D;  3HHM A;  1TS3 A;  2L3Z A;  3EC8 A;  4G0N B;  2BQQ A;  1YQ4 B;  3W5U B;  2KAC A;  1YNT E;  3JSV B;  1RAX A;  3DBR B;  3IHP C;  2D3A A;  2KFK B;  2D3C A;  1XQQ A;  2WXK A;  3NVZ A;  4MJS B;  1SJH D;  1R4M I;  5IA7 A;  5EE3 A;  4RFB A;  2BKF A;  5DPW A;  1SBB B;  1JCK B;  4A8X C;  2J0J A;  1QZE A;  2G4S A;  5EDS A;  1NVI D;  5KHQ A;  4MM3 B;  3RNE C;  2J0M A;  5L83 A;  4ASW C;  5J18 A;  4LJO B;  2ZJD A;  2G1E A;  2I2Y A;  3C8Y A;  2ZCC A;  3C19 A;  4HK2 A;  1K51 A;  3QX1 A;  3RNC C;  3MC9 A;  3GB1 A;  2BGF A;  3OJ4 B;  4LK0 M;  2LFI A;  1M94 A;  4RGM A;  3DHI C;  2DEN B;  1YX5 B;  3H6N A;  1ISN A;  2CKH B;  5FR3 A;  3JVZ X;  4D2K A;  4S17 A;  3UF8 A;  3EFU A;  4PK1 A;  2GBR A;  3Q3F A;  4HRS A;  2KTR A;  5BYR A;  3IXS A;  2WXJ A;  1AW7 A;  2L83 A;  3IBE A;  3SR6 A;  2JPH A;  2FCQ A;  4JWU C;  1BUI C;  2KLC A;  3IAM 1;  2KZR A;  3VH4 B;  3U8Z A;  4PS3 A;  2D07 B;  3VAW A;  1ESF A;  3VXW A;  3VQI A;  4KV2 A;  3LJ3 A;  2KNB A;  4GIV A;  2VRR B;  3A4R A;  3CSF A;  1FMA D;  3PGE A;  1I35 A;  2LGS A;  1E8Z A;  2Z59 B;  5DCN A;  1TKE A;  3R66 C;  5JHA A;  1B9R A;  2M17 A;  2BB6 A;  4HJG E;  1T3Q A;  2VH1 A;  2LXC A;  3Q3M C;  2EKI A;  2GB1 A;  3RCZ A;  1P9D U;  1YJJ A;  1WJ6 A;  1QF6 A;  1TIF A;  3DBL I;  4B0M A;  1D5Z C;  3KLS X;  4YSZ B;  4J6I A;  2WXP A;  4HRO A;  2IGD A;  2IPK D;  1AN8 A;  2E3T A;  4KGS A;  5AEK B;  3P63 A;  1WGR A;  4LDT D;  4ACF A;  1D4B A;  2N7D A;  3DBH B;  1T0Q C;  1YX6 B;  3EUB 2;  4YWG G;  4BVU C;  2CJN A;  2BF8 B;  1R4N I;  2FE8 A;  1WX9 A;  4DK5 A;  4FHJ A;  1XLQ A;  5E6O A;  4A90 A;  2DX5 B;  1K53 A;  1UF0 A;  2IBI B;  1F77 A;  1PFD A;  5T8I A;  1L0X B;  4WJO A;  1NYR A;  1SE3 A;  5IKC M;  4CQN A;  3QAR A;  3QWZ B;  1J7C A;  2Y3A A;  3HRD D;  1Z5S B;  1V2Y A;  3ZJT A;  2N4F A;  4IWO A;  1JW9 D;  4S0R A;  2BYE A;  2LGY A;  1BXT A;  4RGT A;  3WCQ A;  3I57 A;  2K6Q A;  2J53 A;  1KFY B;  3FIL A;  1T0R C;  4WWM A;  2FAZ A;  2L05 A;  2WNM A;  2H89 B;  2INN E;  1A5R A;  3H9D A;  1FNW A;  1HQR D;  5E6P A;  1V5O A;  1F2R C;  2FCM A;  2WHI A;  2JRH A;  1EU4 A;  1JRU A;  2W82 A;  2UU7 A;  2Y5P A;  3SEB A;  3APF A;  3NVW A;  1I4Q A;  2IND C;  1ZDV A;  3TEZ A;  4HPL B;  1WM3 A;  3NZS A;  3WAO A;  2MRP A;  1WXM A;  1FEH A;  4PS8 A;  2RSU A;  4XX5 A;  4W9L A;  1WR6 E;  2JVC A;  4URK A;  3Q8A A;  1YN5 A;  1FRD A;  1NYQ A;  3RT3 B;  3W1S C;  1V6E A;  1C4A A;  3DVN V;  2W3R A;  4YSY B;  1VR9 A;  2AQ3 B;  4MGI E;  4JWS C;  2WX0 A;  4K3B A;  5FR6 A;  4KVG B;  2JYT A;  4KX6 B;  3GE3 C;  3R7R A;  4W9E A;  2MEK A;  3RI7 C;  3S2A A;  2OJW A;  3DHH C;  3Q69 A;  2LD9 A;  2KKC A;  5AZH A;  3AH7 A;  5HHD G;  3KWL A;  1KJT A;  2JYE A;  2R2Q A;  2KDE B;  4G3X B;  4FAD A;  1WSP A;  4KIK B;  3V60 A;  1E0Z A;  2Y5C A;  1IBX B;  3ZVV A;  1FNU A;  1FNV A;  2K0P A;  2IYD B;  4ZRI A;  2DBY A;  3AEE B;  4MAC A;  4FJZ A;  1WX8 A;  3I3T B;  2KDB A;  4LNF A;  3A9J B;  3ZQ4 A;  4BZA A;  2DAF A;  4IOI E;  1KOT A;  5JZE B;  3KH0 A;  2BYF A;  2LHE A;  2WXN A;  3ZTD A;  2WDT B;  2MP2 B;  3V62 A;  2LVP A;  1CZP A;  2PLP A;  1E7P B;  3NS1 A;  1P98 A;  1WE6 A;  3GP7 A;  4IG7 B;  1NDD A;  3SDL C;  5IN7 A;  1WGD A;  3JW0 X;  5JXV A;  2BS4 B;  1FXA A;  4Q2J A;  1B1Z A;  2PE6 B;  1GJZ A;  1NEN B;  4C4V A;  2LVO A;  1WGG A;  3DDC B;  1TYG B;  2LZ6 A;  3VTV A;  4EE2 A;  4RGN A;  3HVZ A;  4XZ4 A;  1LO5 D;  2D3B A;  2WXH A;  2LUM A;  1KLV A;  2MQJ A;  1WY8 A;  4KZC A;  5C2T B;  2MHJ A;  1R7S A;  2BWF A;  3CIR B;  2IZV B;  2QDF A;  1VCB A;  2ZVO A;  5KHO A;  2KJ6 A;  1C4C A;  1XT9 B;  2GRI A;  1F9J A;  2KK8 A;  4I6L B;  3X0W A;  1FM0 D;  3BYY B;  1E8W A;  4DBG A;  2DZM A;  1ZXH A;  3L13 A;  1S1Q B;  3V61 A;  3WAM A;  1PGX A;  5C3J B;  1V8C A;  1AYF A;  1TTN A;  3DBH I;  1WM2 A;  4DXF A;  2ON8 A;  1JRO A;  3FC4 A;  4M8N A;  3T3O A;  2QIE B;  2FID A;  3I5J C;  3B2G A;  2MJ3 A;  3N1X C;  1LXD A;  4BOS C;  3AB5 A;  3OWE B;  4NZL B;  2V3S A;  2JX5 A;  3RN9 C;  4CYE A;  2QCZ A;  4M00 A;  4JIO U;  2DYO A;  2K5P A;  2PEA A;  4WWP A;  3EEC A;  3OG5 A;  5AUI A;  1HE8 A;  5CTR C;  2WU2 B;  4RCO A;  1WMH A;  3AED B;  3NOB A;  1UUP A;  4B0E A;  3VTW A;  4PS7 A;  2FUG 1;  3QCA A;  3ABV B;  1UNS A;  1XCQ L;  4A6Q A;  3APD A;  2JZ3 B;  1JML A;  1XLP A;  3A4S C;  2I1K A;  1V1P A;  3AEG B;  1RM6 C;  1EUV B;  4PYZ A;  3DWG C;  3NY5 A;  1MG4 A;  2KO3 A;  3DHG C;  3W5V B;  2JWU A;  2M4N A;  4L23 A;  4NJC A;  5HG2 A;  2AEH A;  1WGK A;  3N30 A;  2VZK B;  4M02 A;  2OED A;  4LNK A;  5DPR A;  3T9L A;  2LWP A;  2FCS A;  1YJI A;  3NZ3 A;  3V6E B;  2GOW A;  3ZNZ B;  4JPS A;  1P7E A;  1IUE A;  4I6P A;  4MEL A;  1S3S G;  3ONS A;  3PS6 A;  1UWM A;  3ZXV A;  4MEM A;  3UQA A;  3VUW A;  2IY0 B;  2SAK A;  3PRP B;  2BS2 B;  4BKS A;  3Q6B A;  1V80 A;  3FAH A;  3DVN U;  5D2M B;  2L00 B;  2VZK D;  1ET6 A;  2FBW B;  2FCN A;  4MH8 A;  3PLU A;  1P1A A;  5J2R A;  3OJ3 A;  1N5X A;  1J19 A;  5AUK A;  2LJI A;  5BMG A;  5CX3 A;  4AJY B;  3MC8 A;  5BYS A;  2JT4 B;  3TEY A;  4K7U A;  4HVB A;  3ZYY X;  1TS4 A;  1QQR A;  2SEB D;  2YEP F;  1GG3 A;  3HIZ A;  3WA0 A;  3RNG C;  1CQV A;  3ZO5 B;  4AUQ C;  2RR9 A;  3BK2 A;  1FCC C;  4DDG D;  1D5M C;  3FIL B;  3EGR A;  3Q8B A;  1C1Y B;  1L6V A;  4RF1 A;  2EEL A;  1GC7 A;  2KWC A;  2L1A A;  4BFR A;  1HEZ E;  4HCP B;  4A3O A;  2C5L C;  4EUT A;  3IAS 1;  5L95 C;  2M1M A;  3MTN B;  3ZLZ A;  3B08 A;  3NUH B;  3ZW3 A;  1K8R B;  3ML8 A;  4F8C B;  1WIA A;  3Q3N C;  4KSL C;  2O6V D;  2KN4 A;  1F1H A;  1WI0 A;  3AE4 B;  2JY6 A;  3AMZ A;  4ARI A;  3W2D A;  4ZHP A;  4OVU A;  3GOE A;  1UGM A;  1PDX A;  3TL5 A;  2M0X A;  1V97 A;  2GBK A;  3KUD B;  3OAW A;  1DOY A;  2C60 A;  2ZEQ A;  3QJZ A;  3L54 A;  4C56 C;  2WXR A;  2ACZ B;  2C7N B;  2NBU A;  1FFU A;  2WXO A;  5G55 A;  1ZGU B;  2N9X A;  3PLV A;  4GB9 A;  4MSQ B;  3D32 A;  1I7H A;  3LB8 C;  1AAR A;  4ZOH C;  1OGW A;  5LNK 1;  2KOX A;  2RDB C;  3PZD A;  3L17 A;  1NI3 A;  4ANX A;  4C80 A;  4MSM B;  4GGQ A;  1H4R A;  5IO9 A;  3SD5 A;  2DZK A;  3ETR A;  3RD2 A;  1N62 A;  1NEK B;  3SFD B;  5C1Z A;  3DOW A;  2KDF B;  2WXG A;  3ZRC A;  1P3Q U;  2E6X A;  4BOZ B;  5D94 A;  1SB3 C;  2N9K A;  2NPT A;  4K7W A;  3VH3 B;  5MPO A;  1SEB D;  4RMA A;  3J9C A;  3MP9 A;  2PIA A;  2K9X A;  5E6J A;  4YL8 A;  3UI3 A;  5LLI A;  3CMM B;  3MHZ A;  3TEX A;  4K1R B;  3ZDM C;  1L7Y A;  2A5U A;  3KUC B;  3V05 A;  1MPE A;  3GS2 A;  2HE7 A;  4GDL A;  2MBB B;  2PTL A;  1J7B A;  2ZW0 A;  5H92 C;  4OW0 A;  2EMT A;  1TY0 A;  2GLS A;  3IT6 B;  2HTH A;  3AEF B;  4ANW A;  4YSX B;  1LGR A;  4HCN B;  2MJE A;  1YD8 U;  2FNJ B;  3NVV A;  2N1V A;  3V3X A;  1GAQ B;  3PZ8 A;  3Q3J A;  5HKH A;  2Z8L A;  1WJU A;  2MWS B;  2Q5W D;  4CHK A;  2MA9 B;  1A70 A;  4ZDV A;  2YLM A;  5GXG B;  2MJD A;  4OZC A;  4RF0 A;  2N0S B;  1ZKH A;  5EE9 A;  5AZF A;  2L52 A;  1LQB A;  2BYT A;  2V4L A;  1V81 A;  3B2F A;  1XLO A;  2N9E B;  1SSN A;  1KRH A;  2L8J A;  4XWT A;  4IC7 B;  2NS5 A;  2OJR A;  2MBH A;  1ZOY B;  2DHZ A;  1WE7 A;  3APC A;  2AQ1 B;  3BYT B;  3AEB B;  3BK1 A;  3A33 B;  1SGH A;  4JGH B;  3CF6 E;  2LI5 A;  2HDE A;  3ZRF A;  4DDI D;  4H2A A;  3VHT C;  3DPD A;  2M8S A;  1CMX B;  4HPM B;  3P1M A;  1FIQ A;  2JSV X;  3ZJU A;  1V1P B;  3P4S B;  2N9P C;  2WU5 B;  2JRI B;  4WWN A;  3VUY A;  2K22 A;  1P0R A;  4LCD E;  4NAW A;  4MGK E;  4AQ7 A;  1FXT B;  2WLB A;  3PO0 A;  1JWS D;  4ANU A;  2JWZ A;  3T8M A;  4W9I A;  2X8X X;  3VTU A;  3H7S A;  4IM2 A;  3QK0 A;  1EWY C;  2Y5B B;  1WXA A;  1RWS A;  4GOC A;  1WGH A;  3DBR I;  5BO4 B;  1ZUD 2;  2BT6 A;  3CST A;  1DOI A;  3ZXR A;  2N9L A;  4LTU A;  4RM9 A;  4US9 A;  1OTR B;  1YN3 A;  2IO1 B;  3VRB B;  3ZKJ C;  5BMI A;  4IKG A;  3SFE B;  1WWT A;  4A55 A;  3V6C B;  2V1Y A;  3A1Q A;  2AYO B;  1MHH E;  1T0Y A;  2LGI A;  2ZCB A;  1D5X C;  4JQW C;  2K8C A;  3H7P A;  5CHF A;  3RYT A;  4P6V F;  3ECI A;  4LNN A;  3TUO A;  4AP4 C;  1WZ3 A;  2LMC A;  4WQM A;  2K6D B;  4RNA A;  2OOB B;  3PHW B;  2TSS A;  1OQY A;  3JSV A;  4E74 A;  3EHV A;  4BKS D;  4N6E B;  2KFJ A;  3AV8 A;  2MSE D;  2KWU B;  1JQ4 A;  1YN4 A;  4DHZ E;  2J4X A;  2QEJ C;  4DHZ B;  3PZ7 A;  2KYW A;  2W54 A;  1UBQ A;  2QSD A;  4PYU A;  4FJV B;  4MM3 A;  4USA A;  5D3I B;  2W9N A;  2NR2 A;  2G3Q B;  4GDK A;  2KQ7 A;  2HTM E;  1WXQ A;  1Q5W B;  3UQB A;  1TS5 A;  5IAA C;  4BAX A;  3VR9 B;  2MH7 A;  3B1L X;  3BWU D;  3VDZ A;  2KMM A;  3M62 B;  1PUT A;  3GZN B;  1RRB A;  2UYZ B;  2WP9 B;  1UH6 A;  4II2 B;  4RM8 A;  5G2N A;  4OVZ A;  1SE9 A;  1H8C A;  4RH6 A;  1EM7 A;  1CJE A;  2G45 B;  2J0K A;  4GSW A;  4ARC A;  2LGX A;  1F2R I;  2D10 A;  1RFK A;  3K9P B;  4J3O D;  1TZ1 A;  3M3J A;  1JWA D;  3LYY A;  4BBN F;  4DHJ B;  5I4D A;  4K3C A;  2L7R A;  3KWV A; 
#chains in the Genus database with same CATH homology
 5BMH A;  1JWB D;  1E10 A;  3FAH A;  1KF6 B;  4RGM A;  1CK1 A;  2AX5 A;  2VZK D;  1ET6 A;  2KDM A;  2OHF A;  2FBW B;  3NVY A;  2BTE A;  2BS3 B;  4MH8 A;  1F0Z A;  4HKQ A;  5FR3 A;  1N5X A;  2KWD A;  2PW9 A;  4D2K A;  5AUK A;  4IDI A;  3DWM A;  2LJI A;  5BMG A;  5BYS A;  3TEY A;  1FCL A;  4R3D A;  4WUR A;  4YXD B;  1TZO A;  3AE5 B;  2V0G A;  1SXT A;  3ZYY X;  5G5G A;  1QLB B;  1TS4 A;  1QQR A;  2SEB D;  2YEP F;  4HRS A;  5BYR A;  2QJL A;  3IXS A;  2WXJ A;  1AW7 A;  2L83 A;  3SR6 A;  1CQV A;  1N60 A;  4JWU C;  2NTT A;  1BUI C;  1MI0 A;  1C79 A;  1FCC C;  3BK2 A;  1D5M C;  3FIL B;  3IAM 1;  3EGR A;  2K3U A;  3Q8B A;  4RGO S;  2PKO A;  1RYJ A;  4HEA 1;  1L6V A;  1IGC A;  1EWC A;  4RF1 A;  2EEL A;  1ESF A;  2L1A A;  2IGH A;  1HEZ E;  3AE3 B;  3VQI A;  1JRP A;  4XDD A;  1C78 A;  1KLU D;  5D3D A;  3IAS 1;  4NAM A;  1QOB A;  1FMA D;  5FKA C;  3NUH B;  1M4V A;  3MJ5 A;  1ZDX A;  1TS2 A;  2N7J A;  1SIJ A;  4A9A A;  1TKE A;  2WXL A;  1B9R A;  2KN4 A;  3AEA B;  2BB6 A;  4HJG E;  1T3Q A;  3MFG A;  2W3S A;  3AE4 B;  3AMZ A;  4ARI A;  3AE6 B;  2JU6 X;  1L5P A;  4LK0 M;  2EKI A;  3W2D A;  2GB1 A;  4ZHP A;  1YJJ A;  1QF6 A;  1HA5 A;  1PDX A;  4GDL B;  1V97 A;  4B0M A;  1D5Z C;  2XN9 C;  3KLS X;  4JX1 C;  4YSZ B;  4ITK A;  3U52 E;  1DOY A;  2WXP A;  1IGD A;  3HUI A;  4HRO A;  4C56 C;  2IGD A;  2IPK D;  2WXR A;  1AN8 A;  2E3T A;  3RFZ B;  2ACZ B;  4KGS A;  2BW2 A;  2RMM A;  3P63 A;  1OFF A;  1SE2 A;  3AE9 B;  1FFU A;  2WXO A;  2B76 B;  1D4B A;  3NRZ A;  3AE1 B;  1MVK A;  3EUB 2;  1TJE A;  4YWG G;  2L32 A;  1I7H A;  2CJN A;  3LB8 C;  1T6B X;  4ZOH C;  1K50 A;  1E9M A;  1I4R A;  5LNK 1;  2FE8 A;  2WDV B;  2DLB A;  5BYQ A;  1HXY D;  1XLQ A;  1NI3 A;  4A90 A;  1K53 A;  1F77 A;  2D5G A;  2H88 B;  4C80 A;  1PFD A;  5T8I A;  3E9S A;  1L0X B;  3P42 A;  1NYR A;  2M19 A;  1SE3 A;  4N58 A;  4CQN A;  1VZ6 A;  1GB4 A;  1FFV A;  1DYQ A;  3BVM A;  1J7C A;  1C77 A;  2Y3A A;  3HRD D;  1ZP0 B;  4DQO C;  2R61 A;  3ZJT A;  2KQ4 X;  1UWX A;  3ETR A;  1C4P A;  3I9V 1;  3Q8F A;  1N62 A;  1NEK B;  3R2T A;  3SFD B;  3AN1 A;  2V3N A;  1JW9 D;  1QOG A;  2WXG A;  1WYG A;  4YTM B;  2E6X A;  1BXT A;  4RGT A;  4TSS A;  4WIP A;  1AWD A;  3WCQ A;  1SB3 C;  3I57 A;  1V1O A;  1L0Y B;  2N9K A;  2J53 A;  1KFY B;  3FIL A;  3P4R B;  3R2I A;  3ZGZ A;  5MPO A;  5HFY A;  1GB1 A;  1SEB D;  4WWM A;  4JE3 B;  2WNM A;  2WXF A;  2H89 B;  2INN E;  1I4H A;  1FNW A;  1HQR D;  1ZXI A;  3J9C A;  1F2R C;  1QKZ A;  4MT5 A;  1EU4 A;  2W82 A;  4XDC A;  4C7Z A;  2Y5P A;  3SEB A;  3MP9 A;  1I4X A;  2PIA A;  1QOF A;  1JAL A;  3NVW A;  1I4Q A;  2RDG A;  2K9X A;  2QMT A;  1ZDV A;  3TEZ A;  5E6J A;  1YQ3 B;  3L4P A;  3UI3 A;  4GLS C;  3LXF A;  4FXC A;  1T5X D;  3MHZ A;  4WH4 A;  3TEX A;  1FEH A;  2ONQ A;  3ZJV A;  3B9J A;  1ENF A;  2ICI A;  1D6E C;  3Q8A A;  1STE A;  2GI9 A;  1YN5 A;  1FRD A;  1NYQ A;  4KGT A;  4YT0 B;  3V05 A;  1MPE A;  3GS2 A;  5EE0 A;  1OQR A;  4OZB A;  1C4A A;  1OQQ A;  3O13 A;  2W3R A;  4YSY B;  2CJO A;  2PTL A;  1VR9 A;  1HZ5 A;  3N9Y C;  1XCT L;  1E6E B;  1J7B A;  2ZW0 A;  2LHD A;  2AQ3 B;  1KH0 A;  5H92 C;  4JWS C;  4OW0 A;  3URY A;  4AS1 A;  1IBX A;  1VZ8 A;  1TY0 A;  4WAF A;  4ZYS A;  3W1S A;  1YMH E;  2JYT A;  1PGA A;  4KX6 B;  4KGR A;  3IT6 B;  3MC0 B;  4YTP B;  3EA6 A;  3AEF B;  2MEK A;  2QIL A;  3IT4 B;  4YSX B;  1KLG D;  2MJE A;  4ZHO A;  3U7Z A;  3Q69 A;  3NVV A;  3V3X A;  1GAQ B;  3PZ8 A;  1TY2 A;  4DXG A;  2Z8L A;  2Q5W D;  3AH7 A;  5HHD G;  3KWL A;  2LEK A;  4L2Y A;  1L4Z B;  5HI1 A;  3T3N A;  2JYE A;  1A70 A;  4UDU C;  5GXG B;  1Y56 A;  2MJD A;  4OZC A;  4RF0 A;  1QOA A;  1WSP A;  4N59 A;  1SF0 A;  4TQ1 A;  3W9C B;  1E0Z A;  2N0S B;  2Y5C A;  5G5H A;  1IBX B;  1MHX A;  2J42 A;  5EE9 A;  3RPF C;  1PYW D;  1FNU A;  1FNV A;  2AQ2 B;  2L52 A;  2K0P A;  1QT9 A;  2V4I B;  2DBY A;  1UGJ A;  3AEE B;  2BYT A;  1BML C;  4MAC A;  2M0A A;  3Q8E A;  1P7F A;  2IJ0 A;  2W55 A;  3B2F A;  2DWQ A;  1XLO A;  1SSN A;  1KRH A;  3ZQ4 A;  4XWT A;  2PMV A;  1DOX A;  4IOI E;  3VR8 B;  1VLB A;  4TQ0 A;  3AE8 B;  1TKY A;  1ZOY B;  2LHE A;  2WXN A;  1GOZ A;  1L6U A;  2AQ1 B;  3BYT B;  1CZP A;  3AEB B;  3BK1 A;  2PLP A;  4ZRP A;  1E7P B;  3NS1 A;  3GP7 A;  2HDE A;  4M0W A;  4H2A A;  2JXT A;  2IDY A;  1XF5 L;  4O1N A;  1VJK A;  3P1M A;  1FIQ A;  2JSV X;  5JXV A;  3ZJU A;  1V1P B;  2BS4 B;  1FXA A;  4Q2J A;  2WXM A;  3BZD B;  3HVD A;  3P4S B;  4HKZ E;  1B1Z A;  1VZ7 A;  1XLN A;  2WS3 B;  4GDK B;  1ACC A;  1NEN B;  1XXG A;  2M56 B;  2RDH A;  2WU5 B;  3TSS A;  1TYG B;  1WRI A;  2K22 A;  2IGG A;  2PVO D;  4REZ A;  4EE2 A;  1XEE A;  2KAJ A;  4AQ7 A;  4RGN A;  3HVZ A;  2WLB A;  4KKJ A;  2J52 A;  1LO5 D;  3PO0 A;  2WXH A;  1FRR A;  1JWS D;  1FO4 A;  2LUM A;  1HZ6 A;  2XNA C;  2G9H D;  5EE1 A;  3BVZ A;  1I4G A;  1VDV A;  5C2T B;  2WQY B;  1R7S A;  1PGB A;  3CIR B;  1EWY C;  3P4P B;  1C76 A;  4L1B A;  1XO3 A;  1C4C A;  2GRI A;  2RPV A;  2INP E;  2WDR B;  4XE0 A;  4ZRQ A;  4US8 A;  1VRA B;  1ET9 A;  4NAW B;  1RWS A;  3AEC B;  1FM0 D;  1EU3 A;  3BYY B;  1ZUD 2;  2BT6 A;  1DOI A;  3U2S C;  2N9L A;  2ZW1 A;  4LTU A;  4US9 A;  3BVG A;  1YN3 A;  1L0V B;  3VRB B;  5BMI A;  3U4E G;  1SJE D;  1ZXH A;  4IKG A;  1TKG A;  5FK9 C;  1PGX A;  5C3J B;  1V8C A;  3SFE B;  1AYF A;  2JQR B;  1WWT A;  4LLG M;  4A55 A;  4TMA B;  1C9F A;  5D7G A;  4P16 A;  2DYM A;  2ON8 A;  4DXF A;  1JRO A;  3FC4 A;  3T3O A;  1MHH E;  1JWU D;  2QIE B;  4OHJ A;  3H8H A;  3B2G A;  1ROE A;  3P4Q B;  2LGI A;  2MJ3 A;  1SE4 A;  2BB5 A;  3AM9 A;  3VRA B;  1J7A A;  1D5X C;  3TEW A;  3AB5 A;  1ZE3 D;  3OWE B;  4NZL B;  3AE2 B;  4P6V F;  2JX5 A;  1N5W A;  4PT5 A;  3TUO A;  2LMC A;  4WQM A;  2WXI A;  4C7Y A;  3E56 A;  1N63 A;  1Q10 A;  2DYO A;  4RNA A;  2K5P A;  2TSS A;  1ZPS A;  5AUI A;  1K52 A;  1QIL A;  2WU2 B;  4RCO A;  1KTK A;  1FD6 A;  4YTN B;  1GPX A;  2NTS A;  4N6E B;  4KKI A;  3AED B;  2WXQ A;  1UUP A;  3AV8 A;  4B0E A;  1JQ4 A;  2CU3 A;  1YN4 A;  3BII D;  2J4X A;  2QEJ C;  3Q8C A;  2FUG 1;  3PZ7 A;  3ABV B;  1UNS A;  1TS3 A;  2W54 A;  1XCQ L;  5H8Y E;  4A6Q A;  1L4D B;  1JML A;  2QSD A;  1XLP A;  1YQ4 B;  2YEP B;  3W5U B;  4USA A;  5D3I B;  2BBC A;  2KAC A;  1V1P A;  1YNT E;  3AEG B;  2PVG C;  1RM6 C;  2HTM E;  1WXQ A;  2WXK A;  3AE7 B;  3NVZ A;  2I38 A;  1TS5 A;  3DWG C;  1SJH D;  1I4P A;  2JZP A;  3VR9 B;  3W5V B;  2JWU A;  4L23 A;  5EE3 A;  3CWI A;  4NJC A;  4RFB A;  2MH7 A;  5HG2 A;  1SBB B;  1JCK B;  4A8X C;  1WGK A;  2VZK B;  2OED A;  1NVI D;  1JWM D;  3BWU D;  4MM3 B;  4OZA A;  2KMM A;  1PUT A;  2WP9 B;  4XWW A;  1DGJ A;  1YJI A;  3NZ3 A;  1FXI A;  4OVZ A;  4JPS A;  2G1E A;  1P7E A;  1IUE A;  4RH6 A;  1EM7 A;  3C8Y A;  2I2Y A;  3R8B A;  1CJE A;  2WDQ B;  3KQ4 A;  4ARC A;  1UWM A;  1F2R I;  1N61 A;  2NMQ A;  1RFK A;  4J3O D;  1K51 A;  2X38 A;  3GB1 A;  1JWA D;  2SAK A;  3LYY A;  5TSS A;  2BS2 B;  5I4D A;  2V3P A;  2LFI A;  3KWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...