2ZW1A

Crystal structure of a streptococcal protein g b1 mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MDTYKLILNGKTLKGETTTEAVDAATAEKVFKHYANEHGVHGHWTYDPETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimizing pH response of affinity between protein G and IgG Fc: how electrostatic modulations affect protein-protein interactions.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Protein LG
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2zw1A00
2I2YA 2JWUA 2K0PA 1YNTE 2IGHA 2IGDA 3FILA 3FILB 1MHHE 2N9LA 2ZW0A 4GLSC 1QKZA 4HKZE 1K52A 4OZBA 1EM7A 1MI0A 2JZPA 2QSDA 1KH0A 1HZ5A 1XCQL 1XCTL 1FCLA 3MP9A 2RPVA 1IBXA 1IGDA 1JMLA 1IBXB 5BMHA 1K53A 2QMTA 3V3XA 2GI9A 2LHEA 2PLPA 4KGRA 2RMMA 1MHXA 2GB1A 2ON8A 4OZAA 5HHDG 1GB1A 1F2RC 2LGIA 2JSVX 1PGBA 1D4BA 4MACA 1FCCC 1K50A 5HI1A 5HFYA 1IGCA 1P7EA 1F2RI 5HG2A 2KWDA 2KACA 1PGXA 2N7JA 1P7FA 1ZXHA 1MVKA 2J52A 5BMGA 2PW9A 2JU6X 2PTLA 1C9FA 2I38A 2KQ4X 1K51A 2N9KA 2IGGA 4KGTA 2LHDA 4IOIE 2KN4A 4WH4A 1Q10A 1MPEA 1XF5L 2ONQA 2ZW1A 4OZCA 2KDMA 1HEZE 4IKGA 5BMIA 2EELA 3GB1A 1FD6A 2OEDA 1UWXA 5JXVA 2LUMA 4D2KA 4KGSA 2NMQA 1HZ6A 2J53A 1YMHE 2JXTA 1GB4A 4HJGE 1PGAA 3UI3A
chains in the Genus database with same CATH superfamily
2FAZA 4HDQA 2JZZA 2R61A 3Q3MC 2JVCA 5D3DA 2KTRB 4RMAA 2KNBA 2G3QB 2MRPA 4GLSC 1EM7A 3LYYA 3AB5A 1F0ZA 4HWIB 1KH0A 1WXSA 1SE2A 3NZ3A 2G4SA 1FCLA 3A9KB 2RDGA 3PLUA 2BYTA 4NNJB 1PYWD 3FC4A 1D5ZC 1R7SA 2OHFA 1FO4A 2C60A 4ZHPA 2BYVE 2WXKA 1K8RB 4WWOA 5FR6A 1WR6E 2XEWA 2DZJA 1NVID 3TIXA 3DHHC 1FFUA 1UGMA 2KANA 2LASA 1GG3A 3SDLC 1FRDA 1CJEA 2FCSA 1J7CA 3RNFC 4PS8A 2BVCA 1WX9A 2LRWA 3E56A 5BMGA 3P1MA 2D11A 2LGYA 2KZRA 2PJHA 1SGHA 3LJ3A 3QHTA 3EECA 2B3AA 3HK0A 4US8A 3WCQA 1FD6A 3GP7A 4C56C 4ZRIA 3NS8A 4G11A 4XC2A 1JWMD 1HZ6A 1VRAB 5H8YE 3ZW3A 2DAJA 3OJ4B 1MG4A 3KUDB 3IBEA 5JZEB 2V4LA 5KHQA 2ZW0A 1TYGB 3AEGB 1SXTA 2WDVB 3BIID 4OVUA 4URKA 2C5LC 1KLGD 1E8ZA 4OVVA 4KDIC 3EC8A 3AV8A 3I9V1 4WJPA 2IO0B 5CHFA 1L6UA 2KDFB 4IUMB 3A1QA 3VUYA 2MBOA 2KFKA 4PYZA 1WJ6A 2K39A 4PK1A 4W9CA 4JWSC 1F52A 2KQ7A 3WANA 1OEYJ 5IAAC 3CF6E 3AULA 1PUTA 5E6PA 3ALBA 2QCZA 2CJNA 3SEBA 1N62A 2QIEB 3AN1A 5DCNA 3ZTCA 1IGCA 1RM6C 5LXIB 2MW5A 3N1ZC 3QX1A 1ZUD2 5BO4B 3NUHB 1I4GA 3DBLI 1TY2A 3V6EB 2RSUA 5L95C 2D07B 4ACFA 2J52A 1YOVB 4C7ZA 2INPE 1SB3C 1P3QU 3KWLA 1SIJA 4IOIE 2KN4A 1YJ1A 2K3UA 4HROA 2DYMA 3PREA 5TR5A 1VD2A 5EE3A 2BQQA 4JE3B 2ZNVB 2YEPB 2MX2A 2WQYB 1LXDA 2PVOD 5FK9C 4BZAA 4HJGE 4YXDB 2Q5WD 1L4DB 2LXCA 2DZMA 3MHSD 5JHAA 2KOXA 4HLEA 3B1LX 2BTEA 1RFKA 3Q3NC 2HJ8A 4LNFA 4YTNB 1PFDA 1Q1OA 1WSPA 4IDIA 1R4MB 2N7EA 2DX5B 3QIJA 4KZCA 1C3TA 1LFDA 4E74A 4GGQA 2J4XA 3TEYA 2CU3A 4B6WA 3TEWA 1HZ5A 1BUIC 1ROEA 2KO3A 4I6NB 3Q2AC 2WXGA 3PV1A 1XLOA 1YN4A 3DHGC 4K7SA 1C78A 3HUIA 1NYQA 3IXSA 3VTWA 1K53A 2WXRA 2MQJA 1UNSA 2NS5A 3RFZB 3BZDB 1H8CA 3KQ4A 1YIWA 2EMSA 1VR9A 3AECB 2M1MA 1YQ3B 3QCAA 3NJTA 3VDZA 1ZPSA 1PGBA 1ESFA 3N9YC 3WALA 2MSED 4A6QA 2IYDB 3C19A 2K9XA 1DOXA 5D6JB 1TY0A 4NJ6A 2GLSA 2M4NA 1EF1A 3V05A 4WIPA 1T0RC 3B2FA 1JRPA 2MP2A 5HG2A 2WXNA 1PGXA 5TSSA 4A9AA 3O13A 1P98A 1V1PB 3B9JA 4RNAA 3D32A 3QK0A 3ZIMA 2AWTA 3HM3A 2R2OA 3IFWB 4KSKC 2IBIB 2K22A 4JGHB 3PO0A 3RI7C 2GBJA 4YT0B 3RNAC 2KDMA 1EF5A 2LWPA 5DPRA 1RYJA 3W5VB 3WAPA 2FUHB 3L10B 5BYQA 3PHWB 2L0TA 3P42A 2NBWB 3BK2A 2WXMA 1L6VA 2KT7A 2J53A 4W9HA 2N7DA 4HXDA 3VFKA 2I2YA 3PVLA 1E7VA 2M19A 3U8ZA 2MHJA 4AJWA 3JYUA 1QKZA 2MBHA 4W9DA 1U4AA 3QJZA 2QHOA 2SAKA 3HM6X 4ANXA 2BB6A 1XCQL 1UD7A 1SSNA 3VTUA 2Z0EB 3DVGX 4F1SA 2V3PA 3AE3B 3A1QB 1OGWA 1YX6B 4RCOA 1T6BX 2KVZA 4DQOC 1JWSD 1WGRA 1VLBA 3X23A 3OJ3A 2R2QA 2JXXA 4IM0A 1NYRA 3S2AA 2X38A 3A4RA 3GZNB 2YVCA 2BWES 1YN5A 2J0MA 2K6DB 2RDHA 3P2BA 1E10A 5IN7A 4NAMA 2W3SA 4LK0M 4MACA 1TS3A 2WXHA 4LNOA 3RPFC 3TSSA 5EDSA 1V81A 2K6QA 1WF9A 1DOIA 1JALA 2O2VA 3AEBB 4ASWC 4YWGG 3U7ZA 1SJED 4NQKE 1JCKB 1WX7A 2KJRA 4ZHOA 2FBWB 2WDQB 4FJZA 2HTHA 3RNBC 2W3RA 3L54A 1UF0A 3CWIA 4E3CA 4FA6A 1JWUD 1BXTA 2ASQA 2YEPF 2CJOA 4MH8A 4DHJD 2XBBC 2DYBA 3UF8A 2VH1A 3R8BA 4IW0A 4C80A 1XT9B 3MC0B 4A55A 4B9KA 2NR2A 4CHKA 2I1KA 4OHJA 2KLCA 3ZJUA 2WYQA 3VR8B 5AZHA 4W9JA 2CHWA 3TCAA 1ZP0B 1WJ4A 4JLCA 3EFCA 4II3B 2KTRA 1XO3A 1UBQA 4DHZE 3SFEB 3Q69A 4EZJA 2CHZA 1KF6B 3LB8C 1E8YA 3PGEA 3A4SC 2J42A 3AE2B 2KTFA 3SU8X 4LNNA 3BY4B 4L1BA 1A70A 2A5UA 1FPYA 4MELA 4TV3A 1N5XA 2GBRA 1TT5B 5E6NA 3KH0A 1E7PB 1FXIA 2BWFA 2C7HA 1NEKB 2JT4B 1C79A 2DBYA 2J0KA 2KAJA 3P4RB 2ZVNA 2VZKB 2MBEA 4HRSA 1WXMA 3DBHB 3RN9C 1KRHA 3Q8EA 2M8SA 1V1PA 1A5RA 3WAOA 1V97A 4NJ7A 4N58A 4WJNA 2L8JA 2N9KA 4IWQA 3GE8C 3RMKC 4WH4A 3N20C 4G50A 3L13A 4II2B 2L52A 2KMAA 1L2NA 2ZPNA 5G2NA 1ZGUB 1JWAD 3R7RA 2JQRB 2JZ3B 1I4HA 1P1AA 2M0AA 2PIAA 1JRUA 4DXAB 4CQNA 1ACCA 2E6XA 3NOBA 2RPQA 1HA5A 3ABVB 2IGDA 3AI5A 3RUIB 1C76A 2JYTA 3T3OA 2N1VA 3JSVB 4FJYA 3IHPC 4OZBA 2WWZA 3P4QB 4WAFA 3NZUA 2YLMA 1ZKHA 3ZO5B 4LJPB 1AWDA 3TBLD 2CU1A 3RD2A 3NY5A 2ICIA 3X0WA 5IKCM 1EU3A 2LUEA 5BMHA 1V2YA 3TEZA 4YL8A 4MGYE 2KK8A 4EUTA 3PPAA 1YJJA 3IAS1 3DHIC 1I4RA 3EGRA 2LHEA 2WX0A 5D7GA 4MEMA 2KX0A 5E6JA 3DQVA 1QZEA 2WXQA 4XDCA 3Q8BA 4WWNA 4PYUA 1B9RA 5HI1A 5LNK1 1KFYB 2I1JA 3ZLZA 1QOGA 3AE7B 1RAXA 2KACA 1Q0WB 2KMMA 3DPDA 3DBRB 2O6VB 2PTLA 2V1YA 3HVDA 3LXFA 3P4SB 4K3BA 2LHDA 4P6VF 1L7YA 1WE7A 1XF5L 4YSXB 2VH2A 1GC6A 4IM3A 3RYTA 1TZOA 4YSZB 3ZUNA 1NENB 3ZJTA 5IP4D 4JIOU 2L76A 2LUMA 2NCNA 1L0VB 2RD0A 3KYCD 4A90A 1RWSA 1B1ZA 3EA6A 4JQWC 3DWMA 2HJ1A 4ICUA 1JWBD 1RLFA 2RR9A 3ONSA 4ZDVA 4HDOA 5IO9A 3MTNB 3Q8AA 1STEA 3RNCC 1E90A 4FLHA 2G9HD 1UELA 5EE1A 2ZNVC 5EE9A 3ZNHB 1TKGA 3SD5A 4ZYSA 4MSMB 5J17A 4JPSA 1V9JA 5BYSA 4IC7B 3R3MA 2M56B 1WE6A 1SBBB 4XZ4A 1WMHA 3ZRCA 4I6LB 5C3JB 1MHXA 2GMIC 4KDLB 2N9EB 2D5GA 1TBEA 3C0RB 3U52E 5GMVA 2RDBC 1D4BA 3EUB2 4TQ1A 1WZ3A 2MWSB 2Z8LA 3PZ7A 2Y5PA 2W55A 1XQQA 2L83A 2KWDA 3SR6A 1E7UA 3AMZA 3KVFB 4CO7A 2LD9A 4NY0A 2DYOA 3Q8CA 1FM0D 2INDC 5FKAC 1VZ6A 1C1YB 1PQSA 1QF6A 4MJSB 2V9HA 2PE9A 2QC8A 1IPGA 1D5XC 4GMVA 1CQVA 2GBKA 4E71A 1D5MC 5D3IB 2MBQA 3AH7A 4OW0A 2KVRA 1F77A 1YMHE 3BVZA 1N60A 4XGAB 2V4IB 4IWOA 1FRRA 1DOYA 1SEBD 2IPKD 1PDXA 1GUAB 2IO3B 1FNWA 4BKGA 4M8NA 2ZVOA 4MGKE 3QQ8B 2N9LA 3V61A 1TTNA 3NS1A 3IT6B 1V86A 4DDGD 3B2GA 4FN2A 2QSDA 2DENB 5LLIA 1XCTL 1LO5D 1XLQA 4X57B 3PSEB 1IBXB 3AEFB 5CTRC 1N61A 2IO2B 4MGZE 2D3GA 4W9GA 3ZTDA 1XD3B 1IUEA 1FIQA 1L0YB 2G45B 2PLPA 3TMPB 1F2RC 5BYRA 3ENEA 4A8XC 1EO6A 2JSVX 2W82A 1FCCC 2LGSA 2LFIA 4EZLA 3N30A 4NQLB 5J18A 1V5TA 3I3TB 4A20A 2WDRB 2LGDA 3OWEB 3RULA 1Z2MA 2D2QA 4ICVA 4DWFA 1R4MI 2JU6X 3BVGA 5HKHA 2FCMA 3BYTB 3UQBA 2ZW1A 3GE3C 4AJYB 1FFVA 3PZ8A 2B76B 4IKGA 4YSYB 2LXAA 5C2TB 2PMVA 3L0WB 4LJOB 2UWQA 4P1CC 1HTOA 4GDKA 2K0PA 1Y8RC 1Y56A 3HVZA 4DXGA 3AEEB 4XDDA 2FUG1 2W54A 1TKYA 3L16A 4RH6A 3ZXVA 4C7YA 4LNKA 4ARCA 5AZFA 5L83A 2ZZPB 1QOAA 2KDEB 1JQ4A 3ECIA 4BOZB 4MSQB 2KQSA 2WHIA 3VXWA 4WWPA 2MEKA 3IAM1 3PT2B 3WIMA 2N9XA 1V80A 4AOFA 3V3XA 4C00A 3JVZX 1QILA 5AEKB 5HHDG 3Q8FA 3H7PB 4MJSA 2KC2A 1UUPA 4WQOB 3CSTA 4LCDE 3K9PB 2LGXA 1V6EA 2JY6A 1C4PA 3ZNID 2MP2B 2NBUA 3NG0A 5FR3A 2OJRA 3SHQA 1F2RI 2BBCA 4XWTA 1E5WA 2BGFA 2L3ZA 3DVNV 2KWUB 1EUVB 3BK1A 4FHJA 1K51A 2IZVB 1QQRA 1WJUA 1T0YA 1N63A 4GDKB 2MJEA 4CYEA 2KFJA 1MJDA 3T8MA 3DBHI 4M8MA 4J6IA 3CMMB 2K25A 1GPXA 2XN9C 3MJ5A 3R2IA 1TS2A 2NTSA 4AQ7A 2AQ2B 3AE1B 2LVQA 2C7NB 3RT3B 2ZEQA 1VCBA 3ZXRA 1ZDXA 3W1SA 2BKRB 1LM8B 2DNFA 3H8HA 3VR9B 3QARA 1ZW7A 3FILB 3NVWA 4HCNB 3HIZA 3ZJVA 4HKQA 4QAYA 4HEA1 4TMAB 4KKJA 1XLNA 3TJPA 3RCZA 1BMLC 4MGIE 3PS6A 1JROA 2RPVA 3AE8B 2INCC 1FXTB 4ZRKA 1S1QB 5JHBA 2WX1A 3VUXA 1E6EB 2DZKA 1WGDA 4DBGA 3DOWA 1WGKA 3KWVA 4TUUA 3WA0A 2J0JA 4L2YA 4AWJA 1I4XA 2LGIA 4JWUC 1I4QA 3AE9B 4NZLB 2CKHB 3VUWA 4M01A 1S3SG 4G3XB 1F1HA 2DWQA 1WY8A 4K81A 4XYCA 4ZOHC 3E9SA 3RNEC 2KDBA 2M0XA 1P7EA 3RZWC 2LZ6A 1V49A 2W9NA 2K8CA 1V8CA 1UWMA 1YN3A 5MPOA 4J3OD 3ZNZB 2PW9A 4K7UA 1C9FA 3ZGZA 3H7SA 4KGTA 3N3KB 3ZNGC 2QDFA 2KWVB 4GU2A 3BVMA 1E8XA 3V60A 1Z5SB 3M62B 2WU2B 1T0SC 1V1OA 1WGGA 4FADA 2MJ3A 1KOTA 2GRIA 3APDA 2O6VD 3J9CA 2LMCA 4HK2A 2WXOA 3ZKJC 1GB4A 1SE3A 1BT0A 4H2AA 2NPTB 5JH5C 1LQBA 1ZOYB 4M0WB 2LJ5A 1WXVA 2ZCBA 5D2MB 1J7AA 3BWUD 3ZDMC 3M63B 3W1YA 3FAHA 2AL3A 2EKEC 1MI0A 3L4PA 4NJCA 4F7ZA 1HTQA 3AEDB 1KLUD 4HPPA 2QEJC 5E6OA 1GJZA 3AM9A 2IDYA 1JMLA 4DDID 4BKTA 1WWTA 4GB9A 2JRHA 3RNGC 4ANWA 4FHKA 1L0XB 4B0MA 3Q6BA 1SE4A 4K1RB 2RMMA 2GB1A 2LVOA 3T3NA 2PKOA 2PE6B 3IT4B 2LRUA 2KXJA 2G1EA 3AE4B 3R2TA 4FXCA 4ZYNA 3VH3B 4ARIA 4R3DA 2J7QB 3CIRB 4GN1A 1I42A 3NVYA 4RM9A 1TJEA 3MFGA 1RRBA 4KIKA 2I38A 4OVZA 4B95A 2L0FA 2CR5A 4I6PA 4IM2A 3KUCB 2LVPA 3OLMD 4LNIA 3AU5A 3Q3FA 2QJLA 3DWGC 4AUQC 4TQ0A 1GOZA 4XWWA 4M0WA 3AEAB 5BMIA 4C4VA 2OJWA 3NHEB 1N5WA 1XEEA 1I35A 4XE0A 1OFFA 3C8YA 4D2KA 2BYFA 4KGSA 1DYQA 2EMTA 3A9JB 3TL5A 1E9MA 2MA9B 2AX5A 5T8IA 4S0RA 4DHZB 2WDTB 1IP9A 4BFRA 1P9DU 1YJIA 1NDDA 1D3ZA 4RGNA 4ANVA 1YNTE 4KZ0A 2WNMA 3FILA 4M00A 4AS1A 4PT5A 1MHHE 2AQ3B 3PRPB 4MM3B 1E8WA 4MT5A 1K52A 1VZ7A 3APCA 1HXYD 1M4VA 1C77A 1VJKA 4KSLC 4YTMB 2JF5A 1WZ0A 5C1ZA 4BKSA 3MP9A 2AQ1B 2A4ZA 1TGZB 3GZNI 4DXFA 1IGDA 4BVUC 4P16A 3V6CB 4LDTD 1H4RA 3IG3A 3GOEA 4C4VB 2BW2A 2QILA 2PVGC 3NVZA 2GI9A 3M95A 4IWPA 2JWZA 2Y3AA 2KHWB 4KGRA 3Q3JA 4BBNC 2EKIA 4WURA 1J19A 3PRZA 1R4NI 2CS4A 3PRMB 1OQQA 4EZKA 1EWYC 2JRIB 1Q5WB 3I57A 2V0GA 3FKYA 1C4AA 2IO1B 1QT9A 3KW5B 4M02A 4EEWA 4AP4C 3MJWA 1OTRB 5IOIA 1AARA 4W9FA 4DHJB 1P7FA 1ZXHA 3EFUA 1MVKA 4FULA 1X1MA 5G5GA 2D10A 1LGRA 1AYFA 3Q3OC 1XLPA 3DBLB 4GIVA 3KLSX 1HEZE 2ZJDA 3ZQ4A 3B08A 4N9F4 2BB5A 4EOYA 1UBIA 5DPTA 3LDZE 2NTTA 4HVBA 4ZRQA 3W5UB 3PHXB 2WXLA 3QC8B 2UYZB 3QAQA 4XX5A 4N59A 1TKEA 2JWUA 3DBRI 2MBBB 2VRRB 3M3JA 3R66C 4RGMA 2BS2B 4HKZE 4LLGM 1C4CA 1WYGA 5CHVC 2BS3B 1XXGA 1UGJA 2M17A 4LDTB 1IYFA 1D6EC 3I5JC 1WFYA 1TS4A 4WWMA 4YTPB 3VHTC 2N4FA 4KIKB 1ISNA 2O2VB 1WMHB 4K7WA 1GAQB 2QMTA 1FXAA 4W9KA 1ZE3D 3ZYYX 3H6NA 4WJOA 2FCQA 1ET6A 4TKNA 2MCNB 5KHOA 3MHZA 2KLGA 1J7BA 2Z59B 1K50A 3L08A 5IA7A 1HE8A 1TS5A 1OEYA 2LI5A 2X8XX 3H7PA 1QOFA 2O6VA 1J0GA 4WQMA 4WAAA 1E0ZA 3KUZA 4GXBA 3H1UA 4BOSC 2NVUI 1MFWA 1EU4A 2N0SB 1SJHD 1OQYA 2L05A 5AUIA 2KQ4X 2ZCCA 3ML8A 4S17A 1VZ8A 3VAWA 4USAA 4L23A 2WLBA 2XNAC 4A3OA 2ZPYA 2EELA 2OEDA 3GS2A 4IG7B 3WAMA 3AE5B 2DZIA 3MC8A 2MH7A 2Y5BB 4W9IA 1NI2A 2PPHA 3DBSA 2JXTA 4FBJB 3A9KA 3SFDB 1VDVA 4RM8A 4REZA 2NBVB 2TSSA 5C23A 4NAWB 4EKUA 4WJQA 1R4NB 4P1BC 2DLBA 2XK5B 4HPMB 3VQIA 1YX5B 5DPSA 2FCNA 1SF0A 2WXFA 4NAWA 3NRZA 2DAFA 2KX3A 2KC1A 5G55A 3EHVA 2BYEA 3BINA 1IBXA 5D94A 2JYEA 4RGOS 3HHMA 3QWZB 2K1FA 2OOBB 1OQRA 4ITKA 3W1SC 2JX5A 1GNUA 3VTVA 4HCPB 1DGJA 2KDIA 4KV2A 3UIPB 3RZFA 2INNE 1QOBA 1YD8U 3P4PB 2BS4B 2L32A 5HFYA 3URYA 4ZRJA 3VRBB 1FNUA 2WP9B 2KJHB 1NBFC 1UH6A 2WS3B 4JX1C 1AN8A 2K8BA 2N7JA 2N9PC 4GDLA 2WXIA 4ANUA 1J8CA 3ML9A 3APFA 2WXPA 2E3TA 4GDLB 2KD0A 3V62A 3T9LA 4UDUC 4NPNA 4Q2JA 1ENFA 4K3CA 4OZCA 2VZKD 3VH4B 1N6ZA 3KYDD 3UIOB 2HTME 1JW9D 4KKIA 1KM7A 3CSFA 1WIAA 2REXA 1WRIA 3PLVA 2KKCA 1L5PA 1YQBA 5I4DA 1ZDVA 3UI3A 3N1YC 2BT6A 2C7MB 4TSSA 3DDCB 3Q14C 2IGHA 5AZGA 1WM2A 2N1WA 2C9WB 2LJIA 3BYYB 2BPSA 1KLVA 2D3CA 3H9DA 2KWCA 2K8HA 1WH3A 1M94A 1WXAA 1GC7A 4RF0A 4PS3A 4G0NB 2JZPA 3A9JA 2Y5CA 5LXHA 1WXQA 3NVVA 3A33B 3JSVA 4N6EB 4A3PA 3K9OB 1UZXB 1AW7A 3ZVVA 3W2DA 2HD5B 1FNVA 1F9JA 4MM3A 2IJ0A 2K5PA 2V3SA 2ON8A 4OZAA 2IY1B 1EWCA 3VRAB 3B0AA 2FNJB 2G4DB 1WM3A 1QLBB 3PZDA 4RGTA 3HRDD 2AL6A 5EE0A 2ACZB 4KX6B 2D3AA 1FMAD 1T0QC 2Z0DB 1L4ZB 5CHWA 3DCGA 3OAWA 3OG5A 4FJVB 3U30A 5G5HA 3ZDTA 2V3NA 3NZSA 1TIFA 2KMCA 5H92C 5CX3A 2FIDA 1ZXIA 2BKFA 3UINB 3VVWB 1Q10A 1MPEA 1ET9A 5AUKA 1I4PA 2NPTA 3QA8A 4HJKA 3ZRFA 5GXGB 1WJNA 2KN5A 2JPHA 4LTUA 4RF1A 2L00B 2IY0B 2NMQA 4EE2A 2JUOA 3TEXA 1NI3A 2KFKB 2MJDA 2L1AA 1WI0A 3IVFA 4F8CB 1CK1A 4KVGB 2HDEA 3DVGY 3P63A 4BBNF 3UQAA 2AYOB 2GBMA 1RFAA 1G6JA 1WRDB 1WR1A 3N32A 3JW0X 4BAXA 2RGFA 1YQ4B 4RFBA 5J2RA 1KTKA 3MC9A 1WGYA 3TUOA 2GBNA 1V5OA 1CZPA 2MLBA 3AXCA 4P7IA 4GOCA 2FE8A 2GOWA 3AU4A 4BKSD 1MG8A 2CHXA 2WXJA 4US9A 2H89B 4JL9A 4W9EA 1GB1A 4B0EA 1HQRD 3DVNU 1SE9A 3U7DA 2XK5A 1CMXB 2FIFA 1KJTA 3R7QA 3PTFC 1T5XD 3U4EG 2LEKA 2SEBD 3N1XC 4EFOA 2UU7A 1WX8A 3ETRA 1P0RA 2WU5B 3L17A 1T3QA 2BF8B 4MDKE 4W9LA 1WGHA 4DK5A 2HE7A 4ZRPA 2L7RA 4PS7A 2IGGA 1I7HA 4O1NA 1TZ1A 1FEHA 2ONQA 4MH0E 3O65B 2H88B 3GB1A 3I63C 3AE6B 4HPLB 2AEHA 3W9CB 1UWXA 5JXVA 3U2SC 2DHZA 2D3BA 1WYWB 2KJ6A 3UGBB 2WGSA 1SIFA 2KYWA 5DPWA 2PEAA 1PGAA 4GSWA
chains in the Genus database with same CATH topology
4N59A 1TKEA 2JWUA 2K0PA 2R61A 4OHJA 1Y56A 3HVZA 4DXGA 3AEEB 3ZJUA 5D3DA 3VR8B 4XDDA 2FUG1 2W54A 1TKYA 4RGMA 1ZP0B 2BS2B 4RH6A 4GLSC 4HKZE 4LLGM 4C7YA 4ARCA 1C4CA 1WYGA 1EM7A 3LYYA 1QOAA 1XO3A 1XXGA 2BS3B 3AB5A 1JQ4A 1UGJA 1F0ZA 1KH0A 3SFEB 1D6EC 1SE2A 3Q69A 3NZ3A 1FCLA 1KF6B 1TS4A 2RDGA 4WWMA 4YTPB 3LB8C 2J42A 3AE2B 2BYTA 2MEKA 3IAM1 1PYWD 3FC4A 1GAQB 2QMTA 4L1BA 1FXAA 3V3XA 1D5ZC 1R7SA 1ZE3D 3ZYYX 1A70A 2OHFA 1FO4A 1QILA 4ZHPA 1ET6A 1N5XA 2WXKA 5HHDG 1E7PB 3Q8FA 1FXIA 3MHZA 1NVID 1UUPA 1NEKB 1FFUA 1J7BA 1C79A 1K50A 2DBYA 2KAJA 1TS5A 3P4RB 2VZKB 1QOFA 4HRSA 1FRDA 1CJEA 1C4PA 1J7CA 4WQMA 5FR3A 1E0ZA 1KRHA 1F2RI 2BBCA 3Q8EA 4XWTA 3E56A 1V1PA 1EU4A 5BMGA 2N0SB 1V97A 1SJHD 3P1MA 5AUIA 2KQ4X 4N58A 3BK1A 1K51A 2N9KA 1VZ8A 1QQRA 4WH4A 4USAA 4L23A 1N63A 2WLBA 2L52A 2XNAC 4GDKB 2MJEA 2EELA 4US8A 3WCQA 1FD6A 1JWAD 3GP7A 4C56C 2OEDA 3GS2A 2JQRB 1GPXA 3AE5B 2XN9C 3MJ5A 2MH7A 1I4HA 3R2IA 1TS2A 2NTSA 2M0AA 2PIAA 4AQ7A 1JWMD 1HZ6A 2AQ2B 3AE1B 4CQNA 1ACCA 2E6XA 2JXTA 1VRAB 1ZDXA 3SFDB 1VDVA 5H8YE 1HA5A 4REZA 3W1SA 3ABVB 3H8HA 3VR9B 2IGDA 2TSSA 1C76A 4NAWB 3FILB 3NVWA 2JYTA 3T3OA 3ZJVA 2DLBA 2ZW0A 4HKQA 3VQIA 4HEA1 1TYGB 3AEGB 4OZBA 4TMAB 1SXTA 2WDVB 3BIID 3P4QB 4KKJA 4WAFA 1SF0A 1XLNA 2WXFA 3NRZA 1BMLC 1KLGD 1AWDA 3AV8A 3I9V1 1JROA 2RPVA 1IBXA 3AE8B 1L6UA 2ICIA 2JYEA 4RGOS 1EU3A 5BMHA 3TEZA 1E6EB 1YJJA 3IAS1 1WGKA 1I4RA 3EGRA 3KWVA 2LHEA 5D7GA 1OQRA 4ITKA 5E6JA 4JWSC 2JX5A 4L2YA 1I4XA 1DGJA 2LGIA 4JWUC 1PUTA 1I4QA 3AE9B 4NZLB 2INNE 1QOBA 2CJNA 2WXQA 3SEBA 1N62A 4XDCA 3Q8BA 2DWQA 1B9RA 2QIEB 3AN1A 3P4PB 2BS4B 2L32A 5HI1A 5HFYA 1IGCA 5LNK1 3URYA 4ZOHC 3VRBB 1KFYB 1RM6C 1FNUA 3E9SA 2WP9B 1P7EA 1QOGA 1ZUD2 3AE7B 2WS3B 4JX1C 3NUHB 1AN8A 1I4GA 2KACA 1TY2A 2N7JA 1V8CA 2KMMA 1UWMA 1YN3A 2J52A 5MPOA 4J3OD 2WXIA 2PW9A 1C9FA 2PTLA 4C7ZA 2INPE 1SB3C 3HVDA 3ZGZA 3LXFA 3P4SB 3KWLA 1SIJA 4KGTA 2LHDA 2WXPA 2E3TA 4GDLB 4IOIE 2KN4A 4P6VF 4UDUC 1XF5L 4YSXB 4Q2JA 1ENFA 2K3UA 4OZCA 2VZKD 4HROA 2DYMA 3BVMA 1TZOA 4YSZB 5EE3A 2HTME 1JW9D 4KKIA 2WU2B 4JE3B 1NENB 1V1OA 3ZJTA 2YEPB 2MJ3A 2GRIA 2WQYB 1WRIA 2LUMA 3J9CA 2LMCA 1L5PA 2PVOD 5I4DA 1L0VB 2WXOA 1ZDVA 5FK9C 1GB4A 4HJGE 4YXDB 1SE3A 2Q5WD 1L4DB 3UI3A 4A90A 1RWSA 1B1ZA 3EA6A 2BT6A 4H2AA 4TSSA 3DWMA 2BTEA 1ZOYB 2IGHA 1RFKA 1JWBD 1J7AA 2LJIA 3BWUD 3BYYB 4YTNB 1PFDA 1WSPA 3FAHA 4IDIA 1MI0A 3L4PA 2J4XA 4NJCA 3TEYA 3Q8AA 1STEA 4RF0A 2CU3A 2JZPA 2G9HD 3AEDB 3TEWA 1HZ5A 1KLUD 2Y5CA 1BUIC 5EE1A 1ROEA 2QEJC 1WXQA 2WXGA 3NVVA 5EE9A 4N6EB 3AM9A 1XLOA 1TKGA 1YN4A 4ZYSA 2IDYA 1JMLA 4JPSA 1C78A 3HUIA 1AW7A 1NYQA 1WWTA 3IXSA 5BYSA 1K53A 2WXRA 3W2DA 1FNVA 2M56B 1UNSA 1SBBB 3RFZB 1L0XB 3BZDB 3KQ4A 2IJ0A 4B0MA 1SE4A 5C3JB 1VR9A 2K5PA 3AECB 2RMMA 1YQ3B 1MHXA 2GB1A 3T3NA 2PKOA 2ON8A 4OZAA 3IT4B 2D5GA 1EWCA 3VRAB 3U52E 1ZPSA 2G1EA 3AE4B 1PGBA 1ESFA 1D4BA 3R2TA 4FXCA 3EUB2 1QLBB 3N9YC 4TQ1A 4RGTA 4ARIA 4A6QA 3HRDD 4R3DA 2K9XA 5EE0A 3CIRB 2Z8LA 1DOXA 1TY0A 3NVYA 3PZ7A 2ACZB 2Y5PA 2W55A 4KX6B 3V05A 1FMAD 1TJEA 3MFGA 4WIPA 3B2FA 1JRPA 2L83A 1L4ZB 5HG2A 2KWDA 2WXNA 1PGXA 3SR6A 5TSSA 4A9AA 3O13A 3AMZA 5G5HA 1V1PB 3B9JA 4RNAA 2V3NA 2I38A 4OVZA 5H92C 2DYOA 1ZXIA 1FM0D 3Q8CA 2K22A 5FKAC 1VZ6A 3PO0A 1Q10A 1MPEA 1ET9A 1QF6A 5AUKA 4YT0B 1I4PA 2QJLA 3DWGC 2KDMA 4TQ0A 1GOZA 4XWWA 4M0WA 3AEAB 1D5XC 5BMIA 1RYJA 5GXGB 3W5VB 5BYQA 3P42A 1CQVA 1D5MC 4LTUA 1N5WA 1XEEA 3BK2A 4RF1A 5D3IB 4XE0A 1OFFA 2WXMA 1L6VA 3AH7A 3C8YA 4D2KA 4KGSA 1DYQA 2NMQA 1E9MA 4EE2A 4OW0A 2AX5A 5T8IA 2J53A 1F77A 1YMHE 3BVZA 3TEXA 1NI3A 1N60A 2MJDA 2L1AA 1YJIA 2V4IB 1FRRA 4RGNA 2I2YA 1DOYA 1SEBD 2IPKD 1YNTE 1PDXA 1CK1A 2M19A 2WNMA 1FNWA 2HDEA 3FILA 3P63A 4AS1A 4PT5A 1MHHE 2N9LA 2AQ3B 4MM3B 1QKZA 4MT5A 3NS1A 3IT6B 1K52A 1VZ7A 1YQ4B 2SAKA 1HXYD 3B2GA 1M4VA 1C77A 1VJKA 2QSDA 4YTMB 4RFBA 2BB6A 1XCQL 1XCTL 1KTKA 1LO5D 1SSNA 3MP9A 2AQ1B 2V3PA 3AE3B 4DXFA 1XLQA 1IGDA 1IBXB 3TUOA 4P16A 4RCOA 3AEFB 1T6BX 1N61A 4DQOC 1JWSD 2BW2A 2QILA 2PVGC 3NVZA 1CZPA 1VLBA 2GI9A 2FE8A 1IUEA 1FIQA 1L0YB 2PLPA 2Y3AA 1NYRA 4KGRA 2WXJA 2EKIA 4US9A 2H89B 2X38A 4WURA 1GB1A 1F2RC 4B0EA 1HQRD 1OQQA 5BYRA 4A8XC 1EWYC 3I57A 1YN5A 2RDHA 2JSVX 2V0GA 1E10A 4NAMA 2W3SA 4LK0M 4MACA 1TS3A 2W82A 1FCCC 2WXHA 3RPFC 3TSSA 2LFIA 1T5XD 1C4AA 1DOIA 1JALA 1QT9A 2LEKA 2SEBD 3U4EG 3AEBB 2WDRB 3ETRA 4YWGG 3OWEB 2WU5B 3U7ZA 1T3QA 1P7FA 1ZXHA 1SJED 1MVKA 2JU6X 5G5GA 3BVGA 1JCKB 4ZRPA 4ZHOA 2FBWB 2IGGA 2WDQB 1AYFA 1XLPA 3BYTB 1I7HA 4O1NA 2W3RA 1FEHA 3CWIA 2ONQA 2ZW1A 1FFVA 3PZ8A 2B76B 2H88B 1HEZE 1JWUD 3KLSX 4IKGA 1BXTA 3ZQ4A 2YEPF 4YSYB 2CJOA 3GB1A 3AE6B 2BB5A 4MH8A 3W9CB 1UWXA 5C2TB 5JXVA 3U2SC 3R8BA 2PMVA 2NTTA 4C80A 4ZRQA 3W5UB 3MC0B 2WXLA 4A55A 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2Y A;  2JWU A;  2K0P A;  1YNT E;  2IGH A;  2IGD A;  3FIL A;  3FIL B;  1MHH E;  2N9L A;  2ZW0 A;  4GLS C;  1QKZ A;  4HKZ E;  1K52 A;  4OZB A;  1EM7 A;  1MI0 A;  2JZP A;  2QSD A;  1KH0 A;  1HZ5 A;  1XCQ L;  1XCT L;  1FCL A;  3MP9 A;  2RPV A;  1IBX A;  1IGD A;  1JML A;  1IBX B;  5BMH A;  1K53 A;  2QMT A;  3V3X A;  2GI9 A;  2LHE A;  2PLP A;  4KGR A;  2RMM A;  1MHX A;  2GB1 A;  2ON8 A;  4OZA A;  5HHD G;  1GB1 A;  1F2R C;  2LGI A;  2JSV X;  1PGB A;  1D4B A;  4MAC A;  1FCC C;  1K50 A;  5HI1 A;  5HFY A;  1IGC A;  1P7E A;  1F2R I;  5HG2 A;  2KWD A;  2KAC A;  1PGX A;  2N7J A;  1P7F A;  1ZXH A;  1MVK A;  2J52 A;  5BMG A;  2PW9 A;  2JU6 X;  2PTL A;  1C9F A;  2I38 A;  2KQ4 X;  1K51 A;  2N9K A;  2IGG A;  4KGT A;  2LHD A;  4IOI E;  2KN4 A;  4WH4 A;  1Q10 A;  1MPE A;  1XF5 L;  2ONQ A;  2ZW1 A;  4OZC A;  2KDM A;  1HEZ E;  4IKG A;  5BMI A;  2EEL A;  3GB1 A;  1FD6 A;  2OED A;  1UWX A;  5JXV A;  2LUM A;  4D2K A;  4KGS A;  2NMQ A;  1HZ6 A;  2J53 A;  1YMH E;  2JXT A;  1GB4 A;  4HJG E;  1PGA A;  3UI3 A; 
#chains in the Genus database with same CATH topology
 2FAZ A;  4HDQ A;  2JZZ A;  2R61 A;  3Q3M C;  2JVC A;  5D3D A;  2KTR B;  4RMA A;  2KNB A;  2G3Q B;  2MRP A;  4GLS C;  1EM7 A;  3LYY A;  3AB5 A;  1F0Z A;  4HWI B;  1KH0 A;  1WXS A;  1SE2 A;  3NZ3 A;  2G4S A;  1FCL A;  3A9K B;  2RDG A;  3PLU A;  2BYT A;  4NNJ B;  1PYW D;  3FC4 A;  1D5Z C;  1R7S A;  2OHF A;  1FO4 A;  2C60 A;  4ZHP A;  2BYV E;  2WXK A;  1K8R B;  4WWO A;  5FR6 A;  1WR6 E;  2XEW A;  2DZJ A;  1NVI D;  3TIX A;  3DHH C;  1FFU A;  1UGM A;  2KAN A;  2LAS A;  1GG3 A;  3SDL C;  1FRD A;  1CJE A;  2FCS A;  1J7C A;  3RNF C;  4PS8 A;  2BVC A;  1WX9 A;  2LRW A;  3E56 A;  5BMG A;  3P1M A;  2D11 A;  2LGY A;  2KZR A;  2PJH A;  1SGH A;  3LJ3 A;  3QHT A;  3EEC A;  2B3A A;  3HK0 A;  4US8 A;  3WCQ A;  1FD6 A;  3GP7 A;  4C56 C;  4ZRI A;  3NS8 A;  4G11 A;  4XC2 A;  1JWM D;  1HZ6 A;  1VRA B;  5H8Y E;  3ZW3 A;  2DAJ A;  3OJ4 B;  1MG4 A;  3KUD B;  3IBE A;  5JZE B;  2V4L A;  5KHQ A;  2ZW0 A;  1TYG B;  3AEG B;  1SXT A;  2WDV B;  3BII D;  4OVU A;  4URK A;  2C5L C;  1KLG D;  1E8Z A;  4OVV A;  4KDI C;  3EC8 A;  3AV8 A;  3I9V 1;  4WJP A;  2IO0 B;  5CHF A;  1L6U A;  2KDF B;  4IUM B;  3A1Q A;  3VUY A;  2MBO A;  2KFK A;  4PYZ A;  1WJ6 A;  2K39 A;  4PK1 A;  4W9C A;  4JWS C;  1F52 A;  2KQ7 A;  3WAN A;  1OEY J;  5IAA C;  3CF6 E;  3AUL A;  1PUT A;  5E6P A;  3ALB A;  2QCZ A;  2CJN A;  3SEB A;  1N62 A;  2QIE B;  3AN1 A;  5DCN A;  3ZTC A;  1IGC A;  1RM6 C;  5LXI B;  2MW5 A;  3N1Z C;  3QX1 A;  1ZUD 2;  5BO4 B;  3NUH B;  1I4G A;  3DBL I;  1TY2 A;  3V6E B;  2RSU A;  5L95 C;  2D07 B;  4ACF A;  2J52 A;  1YOV B;  4C7Z A;  2INP E;  1SB3 C;  1P3Q U;  3KWL A;  1SIJ A;  4IOI E;  2KN4 A;  1YJ1 A;  2K3U A;  4HRO A;  2DYM A;  3PRE A;  5TR5 A;  1VD2 A;  5EE3 A;  2BQQ A;  4JE3 B;  2ZNV B;  2YEP B;  2MX2 A;  2WQY B;  1LXD A;  2PVO D;  5FK9 C;  4BZA A;  4HJG E;  4YXD B;  2Q5W D;  1L4D B;  2LXC A;  2DZM A;  3MHS D;  5JHA A;  2KOX A;  4HLE A;  3B1L X;  2BTE A;  1RFK A;  3Q3N C;  2HJ8 A;  4LNF A;  4YTN B;  1PFD A;  1Q1O A;  1WSP A;  4IDI A;  1R4M B;  2N7E A;  2DX5 B;  3QIJ A;  4KZC A;  1C3T A;  1LFD A;  4E74 A;  4GGQ A;  2J4X A;  3TEY A;  2CU3 A;  4B6W A;  3TEW A;  1HZ5 A;  1BUI C;  1ROE A;  2KO3 A;  4I6N B;  3Q2A C;  2WXG A;  3PV1 A;  1XLO A;  1YN4 A;  3DHG C;  4K7S A;  1C78 A;  3HUI A;  1NYQ A;  3IXS A;  3VTW A;  1K53 A;  2WXR A;  2MQJ A;  1UNS A;  2NS5 A;  3RFZ B;  3BZD B;  1H8C A;  3KQ4 A;  1YIW A;  2EMS A;  1VR9 A;  3AEC B;  2M1M A;  1YQ3 B;  3QCA A;  3NJT A;  3VDZ A;  1ZPS A;  1PGB A;  1ESF A;  3N9Y C;  3WAL A;  2MSE D;  4A6Q A;  2IYD B;  3C19 A;  2K9X A;  1DOX A;  5D6J B;  1TY0 A;  4NJ6 A;  2GLS A;  2M4N A;  1EF1 A;  3V05 A;  4WIP A;  1T0R C;  3B2F A;  1JRP A;  2MP2 A;  5HG2 A;  2WXN A;  1PGX A;  5TSS A;  4A9A A;  3O13 A;  1P98 A;  1V1P B;  3B9J A;  4RNA A;  3D32 A;  3QK0 A;  3ZIM A;  2AWT A;  3HM3 A;  2R2O A;  3IFW B;  4KSK C;  2IBI B;  2K22 A;  4JGH B;  3PO0 A;  3RI7 C;  2GBJ A;  4YT0 B;  3RNA C;  2KDM A;  1EF5 A;  2LWP A;  5DPR A;  1RYJ A;  3W5V B;  3WAP A;  2FUH B;  3L10 B;  5BYQ A;  3PHW B;  2L0T A;  3P42 A;  2NBW B;  3BK2 A;  2WXM A;  1L6V A;  2KT7 A;  2J53 A;  4W9H A;  2N7D A;  4HXD A;  3VFK A;  2I2Y A;  3PVL A;  1E7V A;  2M19 A;  3U8Z A;  2MHJ A;  4AJW A;  3JYU A;  1QKZ A;  2MBH A;  4W9D A;  1U4A A;  3QJZ A;  2QHO A;  2SAK A;  3HM6 X;  4ANX A;  2BB6 A;  1XCQ L;  1UD7 A;  1SSN A;  3VTU A;  2Z0E B;  3DVG X;  4F1S A;  2V3P A;  3AE3 B;  3A1Q B;  1OGW A;  1YX6 B;  4RCO A;  1T6B X;  2KVZ A;  4DQO C;  1JWS D;  1WGR A;  1VLB A;  3X23 A;  3OJ3 A;  2R2Q A;  2JXX A;  4IM0 A;  1NYR A;  3S2A A;  2X38 A;  3A4R A;  3GZN B;  2YVC A;  2BWE S;  1YN5 A;  2J0M A;  2K6D B;  2RDH A;  3P2B A;  1E10 A;  5IN7 A;  4NAM A;  2W3S A;  4LK0 M;  4MAC A;  1TS3 A;  2WXH A;  4LNO A;  3RPF C;  3TSS A;  5EDS A;  1V81 A;  2K6Q A;  1WF9 A;  1DOI A;  1JAL A;  2O2V A;  3AEB B;  4ASW C;  4YWG G;  3U7Z A;  1SJE D;  4NQK E;  1JCK B;  1WX7 A;  2KJR A;  4ZHO A;  2FBW B;  2WDQ B;  4FJZ A;  2HTH A;  3RNB C;  2W3R A;  3L54 A;  1UF0 A;  3CWI A;  4E3C A;  4FA6 A;  1JWU D;  1BXT A;  2ASQ A;  2YEP F;  2CJO A;  4MH8 A;  4DHJ D;  2XBB C;  2DYB A;  3UF8 A;  2VH1 A;  3R8B A;  4IW0 A;  4C80 A;  1XT9 B;  3MC0 B;  4A55 A;  4B9K A;  2NR2 A;  4CHK A;  2I1K A;  4OHJ A;  2KLC A;  3ZJU A;  2WYQ A;  3VR8 B;  5AZH A;  4W9J A;  2CHW A;  3TCA A;  1ZP0 B;  1WJ4 A;  4JLC A;  3EFC A;  4II3 B;  2KTR A;  1XO3 A;  1UBQ A;  4DHZ E;  3SFE B;  3Q69 A;  4EZJ A;  2CHZ A;  1KF6 B;  3LB8 C;  1E8Y A;  3PGE A;  3A4S C;  2J42 A;  3AE2 B;  2KTF A;  3SU8 X;  4LNN A;  3BY4 B;  4L1B A;  1A70 A;  2A5U A;  1FPY A;  4MEL A;  4TV3 A;  1N5X A;  2GBR A;  1TT5 B;  5E6N A;  3KH0 A;  1E7P B;  1FXI A;  2BWF A;  2C7H A;  1NEK B;  2JT4 B;  1C79 A;  2DBY A;  2J0K A;  2KAJ A;  3P4R B;  2ZVN A;  2VZK B;  2MBE A;  4HRS A;  1WXM A;  3DBH B;  3RN9 C;  1KRH A;  3Q8E A;  2M8S A;  1V1P A;  1A5R A;  3WAO A;  1V97 A;  4NJ7 A;  4N58 A;  4WJN A;  2L8J A;  2N9K A;  4IWQ A;  3GE8 C;  3RMK C;  4WH4 A;  3N20 C;  4G50 A;  3L13 A;  4II2 B;  2L52 A;  2KMA A;  1L2N A;  2ZPN A;  5G2N A;  1ZGU B;  1JWA D;  3R7R A;  2JQR B;  2JZ3 B;  1I4H A;  1P1A A;  2M0A A;  2PIA A;  1JRU A;  4DXA B;  4CQN A;  1ACC A;  2E6X A;  3NOB A;  2RPQ A;  1HA5 A;  3ABV B;  2IGD A;  3AI5 A;  3RUI B;  1C76 A;  2JYT A;  3T3O A;  2N1V A;  3JSV B;  4FJY A;  3IHP C;  4OZB A;  2WWZ A;  3P4Q B;  4WAF A;  3NZU A;  2YLM A;  1ZKH A;  3ZO5 B;  4LJP B;  1AWD A;  3TBL D;  2CU1 A;  3RD2 A;  3NY5 A;  2ICI A;  3X0W A;  5IKC M;  1EU3 A;  2LUE A;  5BMH A;  1V2Y A;  3TEZ A;  4YL8 A;  4MGY E;  2KK8 A;  4EUT A;  3PPA A;  1YJJ A;  3IAS 1;  3DHI C;  1I4R A;  3EGR A;  2LHE A;  2WX0 A;  5D7G A;  4MEM A;  2KX0 A;  5E6J A;  3DQV A;  1QZE A;  2WXQ A;  4XDC A;  3Q8B A;  4WWN A;  4PYU A;  1B9R A;  5HI1 A;  5LNK 1;  1KFY B;  2I1J A;  3ZLZ A;  1QOG A;  3AE7 B;  1RAX A;  2KAC A;  1Q0W B;  2KMM A;  3DPD A;  3DBR B;  2O6V B;  2PTL A;  2V1Y A;  3HVD A;  3LXF A;  3P4S B;  4K3B A;  2LHD A;  4P6V F;  1L7Y A;  1WE7 A;  1XF5 L;  4YSX B;  2VH2 A;  1GC6 A;  4IM3 A;  3RYT A;  1TZO A;  4YSZ B;  3ZUN A;  1NEN B;  3ZJT A;  5IP4 D;  4JIO U;  2L76 A;  2LUM A;  2NCN A;  1L0V B;  2RD0 A;  3KYC D;  4A90 A;  1RWS A;  1B1Z A;  3EA6 A;  4JQW C;  3DWM A;  2HJ1 A;  4ICU A;  1JWB D;  1RLF A;  2RR9 A;  3ONS A;  4ZDV A;  4HDO A;  5IO9 A;  3MTN B;  3Q8A A;  1STE A;  3RNC C;  1E90 A;  4FLH A;  2G9H D;  1UEL A;  5EE1 A;  2ZNV C;  5EE9 A;  3ZNH B;  1TKG A;  3SD5 A;  4ZYS A;  4MSM B;  5J17 A;  4JPS A;  1V9J A;  5BYS A;  4IC7 B;  3R3M A;  2M56 B;  1WE6 A;  1SBB B;  4XZ4 A;  1WMH A;  3ZRC A;  4I6L B;  5C3J B;  1MHX A;  2GMI C;  4KDL B;  2N9E B;  2D5G A;  1TBE A;  3C0R B;  3U52 E;  5GMV A;  2RDB C;  1D4B A;  3EUB 2;  4TQ1 A;  1WZ3 A;  2MWS B;  2Z8L A;  3PZ7 A;  2Y5P A;  2W55 A;  1XQQ A;  2L83 A;  2KWD A;  3SR6 A;  1E7U A;  3AMZ A;  3KVF B;  4CO7 A;  2LD9 A;  4NY0 A;  2DYO A;  3Q8C A;  1FM0 D;  2IND C;  5FKA C;  1VZ6 A;  1C1Y B;  1PQS A;  1QF6 A;  4MJS B;  2V9H A;  2PE9 A;  2QC8 A;  1IPG A;  1D5X C;  4GMV A;  1CQV A;  2GBK A;  4E71 A;  1D5M C;  5D3I B;  2MBQ A;  3AH7 A;  4OW0 A;  2KVR A;  1F77 A;  1YMH E;  3BVZ A;  1N60 A;  4XGA B;  2V4I B;  4IWO A;  1FRR A;  1DOY A;  1SEB D;  2IPK D;  1PDX A;  1GUA B;  2IO3 B;  1FNW A;  4BKG A;  4M8N A;  2ZVO A;  4MGK E;  3QQ8 B;  2N9L A;  3V61 A;  1TTN A;  3NS1 A;  3IT6 B;  1V86 A;  4DDG D;  3B2G A;  4FN2 A;  2QSD A;  2DEN B;  5LLI A;  1XCT L;  1LO5 D;  1XLQ A;  4X57 B;  3PSE B;  1IBX B;  3AEF B;  5CTR C;  1N61 A;  2IO2 B;  4MGZ E;  2D3G A;  4W9G A;  3ZTD A;  1XD3 B;  1IUE A;  1FIQ A;  1L0Y B;  2G45 B;  2PLP A;  3TMP B;  1F2R C;  5BYR A;  3ENE A;  4A8X C;  1EO6 A;  2JSV X;  2W82 A;  1FCC C;  2LGS A;  2LFI A;  4EZL A;  3N30 A;  4NQL B;  5J18 A;  1V5T A;  3I3T B;  4A20 A;  2WDR B;  2LGD A;  3OWE B;  3RUL A;  1Z2M A;  2D2Q A;  4ICV A;  4DWF A;  1R4M I;  2JU6 X;  3BVG A;  5HKH A;  2FCM A;  3BYT B;  3UQB A;  2ZW1 A;  3GE3 C;  4AJY B;  1FFV A;  3PZ8 A;  2B76 B;  4IKG A;  4YSY B;  2LXA A;  5C2T B;  2PMV A;  3L0W B;  4LJO B;  2UWQ A;  4P1C C;  1HTO A;  4GDK A;  2K0P A;  1Y8R C;  1Y56 A;  3HVZ A;  4DXG A;  3AEE B;  4XDD A;  2FUG 1;  2W54 A;  1TKY A;  3L16 A;  4RH6 A;  3ZXV A;  4C7Y A;  4LNK A;  4ARC A;  5AZF A;  5L83 A;  2ZZP B;  1QOA A;  2KDE B;  1JQ4 A;  3ECI A;  4BOZ B;  4MSQ B;  2KQS A;  2WHI A;  3VXW A;  4WWP A;  2MEK A;  3IAM 1;  3PT2 B;  3WIM A;  2N9X A;  1V80 A;  4AOF A;  3V3X A;  4C00 A;  3JVZ X;  1QIL A;  5AEK B;  5HHD G;  3Q8F A;  3H7P B;  4MJS A;  2KC2 A;  1UUP A;  4WQO B;  3CST A;  4LCD E;  3K9P B;  2LGX A;  1V6E A;  2JY6 A;  1C4P A;  3ZNI D;  2MP2 B;  2NBU A;  3NG0 A;  5FR3 A;  2OJR A;  3SHQ A;  1F2R I;  2BBC A;  4XWT A;  1E5W A;  2BGF A;  2L3Z A;  3DVN V;  2KWU B;  1EUV B;  3BK1 A;  4FHJ A;  1K51 A;  2IZV B;  1QQR A;  1WJU A;  1T0Y A;  1N63 A;  4GDK B;  2MJE A;  4CYE A;  2KFJ A;  1MJD A;  3T8M A;  3DBH I;  4M8M A;  4J6I A;  3CMM B;  2K25 A;  1GPX A;  2XN9 C;  3MJ5 A;  3R2I A;  1TS2 A;  2NTS A;  4AQ7 A;  2AQ2 B;  3AE1 B;  2LVQ A;  2C7N B;  3RT3 B;  2ZEQ A;  1VCB A;  3ZXR A;  1ZDX A;  3W1S A;  2BKR B;  1LM8 B;  2DNF A;  3H8H A;  3VR9 B;  3QAR A;  1ZW7 A;  3FIL B;  3NVW A;  4HCN B;  3HIZ A;  3ZJV A;  4HKQ A;  4QAY A;  4HEA 1;  4TMA B;  4KKJ A;  1XLN A;  3TJP A;  3RCZ A;  1BML C;  4MGI E;  3PS6 A;  1JRO A;  2RPV A;  3AE8 B;  2INC C;  1FXT B;  4ZRK A;  1S1Q B;  5JHB A;  2WX1 A;  3VUX A;  1E6E B;  2DZK A;  1WGD A;  4DBG A;  3DOW A;  1WGK A;  3KWV A;  4TUU A;  3WA0 A;  2J0J A;  4L2Y A;  4AWJ A;  1I4X A;  2LGI A;  4JWU C;  1I4Q A;  3AE9 B;  4NZL B;  2CKH B;  3VUW A;  4M01 A;  1S3S G;  4G3X B;  1F1H A;  2DWQ A;  1WY8 A;  4K81 A;  4XYC A;  4ZOH C;  3E9S A;  3RNE C;  2KDB A;  2M0X A;  1P7E A;  3RZW C;  2LZ6 A;  1V49 A;  2W9N A;  2K8C A;  1V8C A;  1UWM A;  1YN3 A;  5MPO A;  4J3O D;  3ZNZ B;  2PW9 A;  4K7U A;  1C9F A;  3ZGZ A;  3H7S A;  4KGT A;  3N3K B;  3ZNG C;  2QDF A;  2KWV B;  4GU2 A;  3BVM A;  1E8X A;  3V60 A;  1Z5S B;  3M62 B;  2WU2 B;  1T0S C;  1V1O A;  1WGG A;  4FAD A;  2MJ3 A;  1KOT A;  2GRI A;  3APD A;  2O6V D;  3J9C A;  2LMC A;  4HK2 A;  2WXO A;  3ZKJ C;  1GB4 A;  1SE3 A;  1BT0 A;  4H2A A;  2NPT B;  5JH5 C;  1LQB A;  1ZOY B;  4M0W B;  2LJ5 A;  1WXV A;  2ZCB A;  5D2M B;  1J7A A;  3BWU D;  3ZDM C;  3M63 B;  3W1Y A;  3FAH A;  2AL3 A;  2EKE C;  1MI0 A;  3L4P A;  4NJC A;  4F7Z A;  1HTQ A;  3AED B;  1KLU D;  4HPP A;  2QEJ C;  5E6O A;  1GJZ A;  3AM9 A;  2IDY A;  1JML A;  4DDI D;  4BKT A;  1WWT A;  4GB9 A;  2JRH A;  3RNG C;  4ANW A;  4FHK A;  1L0X B;  4B0M A;  3Q6B A;  1SE4 A;  4K1R B;  2RMM A;  2GB1 A;  2LVO A;  3T3N A;  2PKO A;  2PE6 B;  3IT4 B;  2LRU A;  2KXJ A;  2G1E A;  3AE4 B;  3R2T A;  4FXC A;  4ZYN A;  3VH3 B;  4ARI A;  4R3D A;  2J7Q B;  3CIR B;  4GN1 A;  1I42 A;  3NVY A;  4RM9 A;  1TJE A;  3MFG A;  1RRB A;  4KIK A;  2I38 A;  4OVZ A;  4B95 A;  2L0F A;  2CR5 A;  4I6P A;  4IM2 A;  3KUC B;  2LVP A;  3OLM D;  4LNI A;  3AU5 A;  3Q3F A;  2QJL A;  3DWG C;  4AUQ C;  4TQ0 A;  1GOZ A;  4XWW A;  4M0W A;  3AEA B;  5BMI A;  4C4V A;  2OJW A;  3NHE B;  1N5W A;  1XEE A;  1I35 A;  4XE0 A;  1OFF A;  3C8Y A;  4D2K A;  2BYF A;  4KGS A;  1DYQ A;  2EMT A;  3A9J B;  3TL5 A;  1E9M A;  2MA9 B;  2AX5 A;  5T8I A;  4S0R A;  4DHZ B;  2WDT B;  1IP9 A;  4BFR A;  1P9D U;  1YJI A;  1NDD A;  1D3Z A;  4RGN A;  4ANV A;  1YNT E;  4KZ0 A;  2WNM A;  3FIL A;  4M00 A;  4AS1 A;  4PT5 A;  1MHH E;  2AQ3 B;  3PRP B;  4MM3 B;  1E8W A;  4MT5 A;  1K52 A;  1VZ7 A;  3APC A;  1HXY D;  1M4V A;  1C77 A;  1VJK A;  4KSL C;  4YTM B;  2JF5 A;  1WZ0 A;  5C1Z A;  4BKS A;  3MP9 A;  2AQ1 B;  2A4Z A;  1TGZ B;  3GZN I;  4DXF A;  1IGD A;  4BVU C;  4P16 A;  3V6C B;  4LDT D;  1H4R A;  3IG3 A;  3GOE A;  4C4V B;  2BW2 A;  2QIL A;  2PVG C;  3NVZ A;  2GI9 A;  3M95 A;  4IWP A;  2JWZ A;  2Y3A A;  2KHW B;  4KGR A;  3Q3J A;  4BBN C;  2EKI A;  4WUR A;  1J19 A;  3PRZ A;  1R4N I;  2CS4 A;  3PRM B;  1OQQ A;  4EZK A;  1EWY C;  2JRI B;  1Q5W B;  3I57 A;  2V0G A;  3FKY A;  1C4A A;  2IO1 B;  1QT9 A;  3KW5 B;  4M02 A;  4EEW A;  4AP4 C;  3MJW A;  1OTR B;  5IOI A;  1AAR A;  4W9F A;  4DHJ B;  1P7F A;  1ZXH A;  3EFU A;  1MVK A;  4FUL A;  1X1M A;  5G5G A;  2D10 A;  1LGR A;  1AYF A;  3Q3O C;  1XLP A;  3DBL B;  4GIV A;  3KLS X;  1HEZ E;  2ZJD A;  3ZQ4 A;  3B08 A;  4N9F 4;  2BB5 A;  4EOY A;  1UBI A;  5DPT A;  3LDZ E;  2NTT A;  4HVB A;  4ZRQ A;  3W5U B;  3PHX B;  2WXL A;  3QC8 B;  2UYZ B;  3QAQ A;  4XX5 A;  4N59 A;  1TKE A;  2JWU A;  3DBR I;  2MBB B;  2VRR B;  3M3J A;  3R66 C;  4RGM A;  2BS2 B;  4HKZ E;  4LLG M;  1C4C A;  1WYG A;  5CHV C;  2BS3 B;  1XXG A;  1UGJ A;  2M17 A;  4LDT B;  1IYF A;  1D6E C;  3I5J C;  1WFY A;  1TS4 A;  4WWM A;  4YTP B;  3VHT C;  2N4F A;  4KIK B;  1ISN A;  2O2V B;  1WMH B;  4K7W A;  1GAQ B;  2QMT A;  1FXA A;  4W9K A;  1ZE3 D;  3ZYY X;  3H6N A;  4WJO A;  2FCQ A;  1ET6 A;  4TKN A;  2MCN B;  5KHO A;  3MHZ A;  2KLG A;  1J7B A;  2Z59 B;  1K50 A;  3L08 A;  5IA7 A;  1HE8 A;  1TS5 A;  1OEY A;  2LI5 A;  2X8X X;  3H7P A;  1QOF A;  2O6V A;  1J0G A;  4WQM A;  4WAA A;  1E0Z A;  3KUZ A;  4GXB A;  3H1U A;  4BOS C;  2NVU I;  1MFW A;  1EU4 A;  2N0S B;  1SJH D;  1OQY A;  2L05 A;  5AUI A;  2KQ4 X;  2ZCC A;  3ML8 A;  4S17 A;  1VZ8 A;  3VAW A;  4USA A;  4L23 A;  2WLB A;  2XNA C;  4A3O A;  2ZPY A;  2EEL A;  2OED A;  3GS2 A;  4IG7 B;  3WAM A;  3AE5 B;  2DZI A;  3MC8 A;  2MH7 A;  2Y5B B;  4W9I A;  1NI2 A;  2PPH A;  3DBS A;  2JXT A;  4FBJ B;  3A9K A;  3SFD B;  1VDV A;  4RM8 A;  4REZ A;  2NBV B;  2TSS A;  5C23 A;  4NAW B;  4EKU A;  4WJQ A;  1R4N B;  4P1B C;  2DLB A;  2XK5 B;  4HPM B;  3VQI A;  1YX5 B;  5DPS A;  2FCN A;  1SF0 A;  2WXF A;  4NAW A;  3NRZ A;  2DAF A;  2KX3 A;  2KC1 A;  5G55 A;  3EHV A;  2BYE A;  3BIN A;  1IBX A;  5D94 A;  2JYE A;  4RGO S;  3HHM A;  3QWZ B;  2K1F A;  2OOB B;  1OQR A;  4ITK A;  3W1S C;  2JX5 A;  1GNU A;  3VTV A;  4HCP B;  1DGJ A;  2KDI A;  4KV2 A;  3UIP B;  3RZF A;  2INN E;  1QOB A;  1YD8 U;  3P4P B;  2BS4 B;  2L32 A;  5HFY A;  3URY A;  4ZRJ A;  3VRB B;  1FNU A;  2WP9 B;  2KJH B;  1NBF C;  1UH6 A;  2WS3 B;  4JX1 C;  1AN8 A;  2K8B A;  2N7J A;  2N9P C;  4GDL A;  2WXI A;  4ANU A;  1J8C A;  3ML9 A;  3APF A;  2WXP A;  2E3T A;  4GDL B;  2KD0 A;  3V62 A;  3T9L A;  4UDU C;  4NPN A;  4Q2J A;  1ENF A;  4K3C A;  4OZC A;  2VZK D;  3VH4 B;  1N6Z A;  3KYD D;  3UIO B;  2HTM E;  1JW9 D;  4KKI A;  1KM7 A;  3CSF A;  1WIA A;  2REX A;  1WRI A;  3PLV A;  2KKC A;  1L5P A;  1YQB A;  5I4D A;  1ZDV A;  3UI3 A;  3N1Y C;  2BT6 A;  2C7M B;  4TSS A;  3DDC B;  3Q14 C;  2IGH A;  5AZG A;  1WM2 A;  2N1W A;  2C9W B;  2LJI A;  3BYY B;  2BPS A;  1KLV A;  2D3C A;  3H9D A;  2KWC A;  2K8H A;  1WH3 A;  1M94 A;  1WXA A;  1GC7 A;  4RF0 A;  4PS3 A;  4G0N B;  2JZP A;  3A9J A;  2Y5C A;  5LXH A;  1WXQ A;  3NVV A;  3A33 B;  3JSV A;  4N6E B;  4A3P A;  3K9O B;  1UZX B;  1AW7 A;  3ZVV A;  3W2D A;  2HD5 B;  1FNV A;  1F9J A;  4MM3 A;  2IJ0 A;  2K5P A;  2V3S A;  2ON8 A;  4OZA A;  2IY1 B;  1EWC A;  3VRA B;  3B0A A;  2FNJ B;  2G4D B;  1WM3 A;  1QLB B;  3PZD A;  4RGT A;  3HRD D;  2AL6 A;  5EE0 A;  2ACZ B;  4KX6 B;  2D3A A;  1FMA D;  1T0Q C;  2Z0D B;  1L4Z B;  5CHW A;  3DCG A;  3OAW A;  3OG5 A;  4FJV B;  3U30 A;  5G5H A;  3ZDT A;  2V3N A;  3NZS A;  1TIF A;  2KMC A;  5H92 C;  5CX3 A;  2FID A;  1ZXI A;  2BKF A;  3UIN B;  3VVW B;  1Q10 A;  1MPE A;  1ET9 A;  5AUK A;  1I4P A;  2NPT A;  3QA8 A;  4HJK A;  3ZRF A;  5GXG B;  1WJN A;  2KN5 A;  2JPH A;  4LTU A;  4RF1 A;  2L00 B;  2IY0 B;  2NMQ A;  4EE2 A;  2JUO A;  3TEX A;  1NI3 A;  2KFK B;  2MJD A;  2L1A A;  1WI0 A;  3IVF A;  4F8C B;  1CK1 A;  4KVG B;  2HDE A;  3DVG Y;  3P63 A;  4BBN F;  3UQA A;  2AYO B;  2GBM A;  1RFA A;  1G6J A;  1WRD B;  1WR1 A;  3N32 A;  3JW0 X;  4BAX A;  2RGF A;  1YQ4 B;  4RFB A;  5J2R A;  1KTK A;  3MC9 A;  1WGY A;  3TUO A;  2GBN A;  1V5O A;  1CZP A;  2MLB A;  3AXC A;  4P7I A;  4GOC A;  2FE8 A;  2GOW A;  3AU4 A;  4BKS D;  1MG8 A;  2CHX A;  2WXJ A;  4US9 A;  2H89 B;  4JL9 A;  4W9E A;  1GB1 A;  4B0E A;  1HQR D;  3DVN U;  1SE9 A;  3U7D A;  2XK5 A;  1CMX B;  2FIF A;  1KJT A;  3R7Q A;  3PTF C;  1T5X D;  3U4E G;  2LEK A;  2SEB D;  3N1X C;  4EFO A;  2UU7 A;  1WX8 A;  3ETR A;  1P0R A;  2WU5 B;  3L17 A;  1T3Q A;  2BF8 B;  4MDK E;  4W9L A;  1WGH A;  4DK5 A;  2HE7 A;  4ZRP A;  2L7R A;  4PS7 A;  2IGG A;  1I7H A;  4O1N A;  1TZ1 A;  1FEH A;  2ONQ A;  4MH0 E;  3O65 B;  2H88 B;  3GB1 A;  3I63 C;  3AE6 B;  4HPL B;  2AEH A;  3W9C B;  1UWX A;  5JXV A;  3U2S C;  2DHZ A;  2D3B A;  1WYW B;  2KJ6 A;  3UGB B;  2WGS A;  1SIF A;  2KYW A;  5DPW A;  2PEA A;  1PGA A;  4GSW A; 
#chains in the Genus database with same CATH homology
 4N59 A;  1TKE A;  2JWU A;  2K0P A;  2R61 A;  4OHJ A;  1Y56 A;  3HVZ A;  4DXG A;  3AEE B;  3ZJU A;  5D3D A;  3VR8 B;  4XDD A;  2FUG 1;  2W54 A;  1TKY A;  4RGM A;  1ZP0 B;  2BS2 B;  4RH6 A;  4GLS C;  4HKZ E;  4LLG M;  4C7Y A;  4ARC A;  1C4C A;  1WYG A;  1EM7 A;  3LYY A;  1QOA A;  1XO3 A;  1XXG A;  2BS3 B;  3AB5 A;  1JQ4 A;  1UGJ A;  1F0Z A;  1KH0 A;  3SFE B;  1D6E C;  1SE2 A;  3Q69 A;  3NZ3 A;  1FCL A;  1KF6 B;  1TS4 A;  2RDG A;  4WWM A;  4YTP B;  3LB8 C;  2J42 A;  3AE2 B;  2BYT A;  2MEK A;  3IAM 1;  1PYW D;  3FC4 A;  1GAQ B;  2QMT A;  4L1B A;  1FXA A;  3V3X A;  1D5Z C;  1R7S A;  1ZE3 D;  3ZYY X;  1A70 A;  2OHF A;  1FO4 A;  1QIL A;  4ZHP A;  1ET6 A;  1N5X A;  2WXK A;  5HHD G;  1E7P B;  3Q8F A;  1FXI A;  3MHZ A;  1NVI D;  1UUP A;  1NEK B;  1FFU A;  1J7B A;  1C79 A;  1K50 A;  2DBY A;  2KAJ A;  1TS5 A;  3P4R B;  2VZK B;  1QOF A;  4HRS A;  1FRD A;  1CJE A;  1C4P A;  1J7C A;  4WQM A;  5FR3 A;  1E0Z A;  1KRH A;  1F2R I;  2BBC A;  3Q8E A;  4XWT A;  3E56 A;  1V1P A;  1EU4 A;  5BMG A;  2N0S B;  1V97 A;  1SJH D;  3P1M A;  5AUI A;  2KQ4 X;  4N58 A;  3BK1 A;  1K51 A;  2N9K A;  1VZ8 A;  1QQR A;  4WH4 A;  4USA A;  4L23 A;  1N63 A;  2WLB A;  2L52 A;  2XNA C;  4GDK B;  2MJE A;  2EEL A;  4US8 A;  3WCQ A;  1FD6 A;  1JWA D;  3GP7 A;  4C56 C;  2OED A;  3GS2 A;  2JQR B;  1GPX A;  3AE5 B;  2XN9 C;  3MJ5 A;  2MH7 A;  1I4H A;  3R2I A;  1TS2 A;  2NTS A;  2M0A A;  2PIA A;  4AQ7 A;  1JWM D;  1HZ6 A;  2AQ2 B;  3AE1 B;  4CQN A;  1ACC A;  2E6X A;  2JXT A;  1VRA B;  1ZDX A;  3SFD B;  1VDV A;  5H8Y E;  1HA5 A;  4REZ A;  3W1S A;  3ABV B;  3H8H A;  3VR9 B;  2IGD A;  2TSS A;  1C76 A;  4NAW B;  3FIL B;  3NVW A;  2JYT A;  3T3O A;  3ZJV A;  2DLB A;  2ZW0 A;  4HKQ A;  3VQI A;  4HEA 1;  1TYG B;  3AEG B;  4OZB A;  4TMA B;  1SXT A;  2WDV B;  3BII D;  3P4Q B;  4KKJ A;  4WAF A;  1SF0 A;  1XLN A;  2WXF A;  3NRZ A;  1BML C;  1KLG D;  1AWD A;  3AV8 A;  3I9V 1;  1JRO A;  2RPV A;  1IBX A;  3AE8 B;  1L6U A;  2ICI A;  2JYE A;  4RGO S;  1EU3 A;  5BMH A;  3TEZ A;  1E6E B;  1YJJ A;  3IAS 1;  1WGK A;  1I4R A;  3EGR A;  3KWV A;  2LHE A;  5D7G A;  1OQR A;  4ITK A;  5E6J A;  4JWS C;  2JX5 A;  4L2Y A;  1I4X A;  1DGJ A;  2LGI A;  4JWU C;  1PUT A;  1I4Q A;  3AE9 B;  4NZL B;  2INN E;  1QOB A;  2CJN A;  2WXQ A;  3SEB A;  1N62 A;  4XDC A;  3Q8B A;  2DWQ A;  1B9R A;  2QIE B;  3AN1 A;  3P4P B;  2BS4 B;  2L32 A;  5HI1 A;  5HFY A;  1IGC A;  5LNK 1;  3URY A;  4ZOH C;  3VRB B;  1KFY B;  1RM6 C;  1FNU A;  3E9S A;  2WP9 B;  1P7E A;  1QOG A;  1ZUD 2;  3AE7 B;  2WS3 B;  4JX1 C;  3NUH B;  1AN8 A;  1I4G A;  2KAC A;  1TY2 A;  2N7J A;  1V8C A;  2KMM A;  1UWM A;  1YN3 A;  2J52 A;  5MPO A;  4J3O D;  2WXI A;  2PW9 A;  1C9F A;  2PTL A;  4C7Z A;  2INP E;  1SB3 C;  3HVD A;  3ZGZ A;  3LXF A;  3P4S B;  3KWL A;  1SIJ A;  4KGT A;  2LHD A;  2WXP A;  2E3T A;  4GDL B;  4IOI E;  2KN4 A;  4P6V F;  4UDU C;  1XF5 L;  4YSX B;  4Q2J A;  1ENF A;  2K3U A;  4OZC A;  2VZK D;  4HRO A;  2DYM A;  3BVM A;  1TZO A;  4YSZ B;  5EE3 A;  2HTM E;  1JW9 D;  4KKI A;  2WU2 B;  4JE3 B;  1NEN B;  1V1O A;  3ZJT A;  2YEP B;  2MJ3 A;  2GRI A;  2WQY B;  1WRI A;  2LUM A;  3J9C A;  2LMC A;  1L5P A;  2PVO D;  5I4D A;  1L0V B;  2WXO A;  1ZDV A;  5FK9 C;  1GB4 A;  4HJG E;  4YXD B;  1SE3 A;  2Q5W D;  1L4D B;  3UI3 A;  4A90 A;  1RWS A;  1B1Z A;  3EA6 A;  2BT6 A;  4H2A A;  4TSS A;  3DWM A;  2BTE A;  1ZOY B;  2IGH A;  1RFK A;  1JWB D;  1J7A A;  2LJI A;  3BWU D;  3BYY B;  4YTN B;  1PFD A;  1WSP A;  3FAH A;  4IDI A;  1MI0 A;  3L4P A;  2J4X A;  4NJC A;  3TEY A;  3Q8A A;  1STE A;  4RF0 A;  2CU3 A;  2JZP A;  2G9H D;  3AED B;  3TEW A;  1HZ5 A;  1KLU D;  2Y5C A;  1BUI C;  5EE1 A;  1ROE A;  2QEJ C;  1WXQ A;  2WXG A;  3NVV A;  5EE9 A;  4N6E B;  3AM9 A;  1XLO A;  1TKG A;  1YN4 A;  4ZYS A;  2IDY A;  1JML A;  4JPS A;  1C78 A;  3HUI A;  1AW7 A;  1NYQ A;  1WWT A;  3IXS A;  5BYS A;  1K53 A;  2WXR A;  3W2D A;  1FNV A;  2M56 B;  1UNS A;  1SBB B;  3RFZ B;  1L0X B;  3BZD B;  3KQ4 A;  2IJ0 A;  4B0M A;  1SE4 A;  5C3J B;  1VR9 A;  2K5P A;  3AEC B;  2RMM A;  1YQ3 B;  1MHX A;  2GB1 A;  3T3N A;  2PKO A;  2ON8 A;  4OZA A;  3IT4 B;  2D5G A;  1EWC A;  3VRA B;  3U52 E;  1ZPS A;  2G1E A;  3AE4 B;  1PGB A;  1ESF A;  1D4B A;  3R2T A;  4FXC A;  3EUB 2;  1QLB B;  3N9Y C;  4TQ1 A;  4RGT A;  4ARI A;  4A6Q A;  3HRD D;  4R3D A;  2K9X A;  5EE0 A;  3CIR B;  2Z8L A;  1DOX A;  1TY0 A;  3NVY A;  3PZ7 A;  2ACZ B;  2Y5P A;  2W55 A;  4KX6 B;  3V05 A;  1FMA D;  1TJE A;  3MFG A;  4WIP A;  3B2F A;  1JRP A;  2L83 A;  1L4Z B;  5HG2 A;  2KWD A;  2WXN A;  1PGX A;  3SR6 A;  5TSS A;  4A9A A;  3O13 A;  3AMZ A;  5G5H A;  1V1P B;  3B9J A;  4RNA A;  2V3N A;  2I38 A;  4OVZ A;  5H92 C;  2DYO A;  1ZXI A;  1FM0 D;  3Q8C A;  2K22 A;  5FKA C;  1VZ6 A;  3PO0 A;  1Q10 A;  1MPE A;  1ET9 A;  1QF6 A;  5AUK A;  4YT0 B;  1I4P A;  2QJL A;  3DWG C;  2KDM A;  4TQ0 A;  1GOZ A;  4XWW A;  4M0W A;  3AEA B;  1D5X C;  5BMI A;  1RYJ A;  5GXG B;  3W5V B;  5BYQ A;  3P42 A;  1CQV A;  1D5M C;  4LTU A;  1N5W A;  1XEE A;  3BK2 A;  4RF1 A;  5D3I B;  4XE0 A;  1OFF A;  2WXM A;  1L6V A;  3AH7 A;  3C8Y A;  4D2K A;  4KGS A;  1DYQ A;  2NMQ A;  1E9M A;  4EE2 A;  4OW0 A;  2AX5 A;  5T8I A;  2J53 A;  1F77 A;  1YMH E;  3BVZ A;  3TEX A;  1NI3 A;  1N60 A;  2MJD A;  2L1A A;  1YJI A;  2V4I B;  1FRR A;  4RGN A;  2I2Y A;  1DOY A;  1SEB D;  2IPK D;  1YNT E;  1PDX A;  1CK1 A;  2M19 A;  2WNM A;  1FNW A;  2HDE A;  3FIL A;  3P63 A;  4AS1 A;  4PT5 A;  1MHH E;  2N9L A;  2AQ3 B;  4MM3 B;  1QKZ A;  4MT5 A;  3NS1 A;  3IT6 B;  1K52 A;  1VZ7 A;  1YQ4 B;  2SAK A;  1HXY D;  3B2G A;  1M4V A;  1C77 A;  1VJK A;  2QSD A;  4YTM B;  4RFB A;  2BB6 A;  1XCQ L;  1XCT L;  1KTK A;  1LO5 D;  1SSN A;  3MP9 A;  2AQ1 B;  2V3P A;  3AE3 B;  4DXF A;  1XLQ A;  1IGD A;  1IBX B;  3TUO A;  4P16 A;  4RCO A;  3AEF B;  1T6B X;  1N61 A;  4DQO C;  1JWS D;  2BW2 A;  2QIL A;  2PVG C;  3NVZ A;  1CZP A;  1VLB A;  2GI9 A;  2FE8 A;  1IUE A;  1FIQ A;  1L0Y B;  2PLP A;  2Y3A A;  1NYR A;  4KGR A;  2WXJ A;  2EKI A;  4US9 A;  2H89 B;  2X38 A;  4WUR A;  1GB1 A;  1F2R C;  4B0E A;  1HQR D;  1OQQ A;  5BYR A;  4A8X C;  1EWY C;  3I57 A;  1YN5 A;  2RDH A;  2JSV X;  2V0G A;  1E10 A;  4NAM A;  2W3S A;  4LK0 M;  4MAC A;  1TS3 A;  2W82 A;  1FCC C;  2WXH A;  3RPF C;  3TSS A;  2LFI A;  1T5X D;  1C4A A;  1DOI A;  1JAL A;  1QT9 A;  2LEK A;  2SEB D;  3U4E G;  3AEB B;  2WDR B;  3ETR A;  4YWG G;  3OWE B;  2WU5 B;  3U7Z A;  1T3Q A;  1P7F A;  1ZXH A;  1SJE D;  1MVK A;  2JU6 X;  5G5G A;  3BVG A;  1JCK B;  4ZRP A;  4ZHO A;  2FBW B;  2IGG A;  2WDQ B;  1AYF A;  1XLP A;  3BYT B;  1I7H A;  4O1N A;  2W3R A;  1FEH A;  3CWI A;  2ONQ A;  2ZW1 A;  1FFV A;  3PZ8 A;  2B76 B;  2H88 B;  1HEZ E;  1JWU D;  3KLS X;  4IKG A;  1BXT A;  3ZQ4 A;  2YEP F;  4YSY B;  2CJO A;  3GB1 A;  3AE6 B;  2BB5 A;  4MH8 A;  3W9C B;  1UWX A;  5C2T B;  5JXV A;  3U2S C;  3R8B A;  2PMV A;  2NTT A;  4C80 A;  4ZRQ A;  3W5U B;  3MC0 B;  2WXL A;  4A55 A;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...