2ZW1A

Crystal structure of a streptococcal protein g b1 mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MDTYKLILNGKTLKGETTTEAVDAATAEKVFKHYANEHGVHGHWTYDPETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Protein LG
publication title Optimizing pH response of affinity between protein G and IgG Fc: how electrostatic modulations affect protein-protein interactions.
pubmed doi rcsb
source organism Finegoldia magna
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2zw1A00
2IGDA 1XCTL 4OZBA 5BMGA 1MVKA 2OEDA 5BMIA 2KACA 1YMHE 2NMQA 3FILB 4D2KA 3V3XA 2PTLA 1JMLA 1FD6A 1QKZA 2N7JA 4WH4A 2KDMA 5HHDG 2KQ4X 1P7FA 1KH0A 4OZAA 4OZCA 2ZW0A 2LHEA 1XCQL 1IGDA 2RMMA 5HFYA 1PGBA 3MP9A 2GB1A 1K53A 2I2YA 1YNTE 2QMTA 4IOIE 1HZ6A 1F2RI 2JZPA 4HKZE 1IBXB 1P7EA 1EM7A 2J53A 3FILA 2QSDA 2LUMA 2ON8A 1HZ5A 2K0PA 5BMHA 1K50A 2LGIA 2I38A 5JXVA 1K51A 1ZXHA 3UI3A 2PLPA 4HJGE 1K52A 2KN4A 4IKGA 1PGXA 1IBXA 1D4BA 1HEZE 1MI0A 2ONQA 1FCLA 5HI1A 5HG2A 2ZW1A 1MHXA 1F2RC 1C9FA 2JXTA 2LHDA 2IGHA 4MACA 2IGGA 1FCCC 1MPEA 2EELA 1XF5L 3GB1A 4GLSC 2RPVA 4KGRA 2N9LA 1GB1A 2KWDA 2J52A 1PGAA 1UWXA 2JSVX 4KGTA 2N9KA 2GI9A 4KGSA 2PW9A 1Q10A 2JWUA 1IGCA 1GB4A 1MHHE 2JU6X
chains in the Genus database with same CATH superfamily
1GC6A 1YOVB 4AUQC 3ZJUA 3AE1B 4LDTD 2FBWB 3AE4B 1WI0A 4M02A 4A3PA 4G50A 1QOAA 2PVOD 3C0RB 3M95A 3O65B 1TJEA 3VRAB 2K5PA 4KVGB 5J18A 4ACFA 4K7UA 1KH0A 3SFDB 4LDTB 1T0YA 4TQ0A 2K8HA 3DHIC 3M62B 2LJIA 3R3MA 2Z0EB 4GN1A 4HEA1 2C7HA 2BVCA 2J53A 2V3PA 3U4EG 2QHOA 1HQRD 3L0WB 2W3SA 1YJ1A 3Q8BA 2LGSA 3DBHB 1A5RA 1GG3A 2C5LC 4DXFA 4KSLC 2R2QA 2NBWB 2D2QA 3NZUA 3KW5B 1SIJA 3SFEB 5CHVC 1K52A 3P1MA 1P0RA 2HJ1A 3WAOA 2N7DA 3RCZA 2QDFA 2FUG1 2K6QA 2LHDA 3QQ8B 4TKNA 1WGKA 1L7YA 1E90A 2E6XA 3UGBB 1WFYA 2R2OA 4B95A 4J3OD 5L95C 2LUEA 5IAAC 1J19A 4KZ0A 2N9KA 4JGHB 2FIFA 4IWQA 4AWJA 4E3CA 2JU6X 3MJWA 2KJHB 3NOBA 4HWIB 3Q6BA 4ICUA 4B6WA 3MHSD 4WAAA 2KANA 2JRIB 4IM2A 3KUZA 5CHWA 1JCKB 3K9OB 4UDUC 4GSWA 1QOBA 3IT6B 2K3UA 3MP9A 1K53A 4NQKE 2GMIC 3P4SB 5IA7A 3CSFA 3AE2B 3N20C 3NY5A 4CQNA 3AEBB 1YX5B 3Q3MC 1TY0A 2MBOA 3O13A 1DOYA 4KX6B 3VH3B 1AARA 5AUIA 4AOFA 5BMHA 3FKYA 2M19A 2LI5A 2KLCA 1P98A 2HJ8A 1XO3A 5AUKA 3HK0A 4YWGG 4MSMB 1STEA 3ZQ4A 2LXCA 3P4QB 2MSED 3AI5A 1L6UA 3DHHC 2LVOA 2GBRA 4W9EA 3BVZA 4W9GA 2KQ7A 1XQQA 4KSKC 4NY0A 5G5GA 4M8MA 3NRZA 2IGHA 4ANXA 1KFYB 1L4ZB 3VR8B 2AEHA 2V1YA 1J7BA 2D07B 3LYYA 4JWUC 3PZDA 1VCBA 3EC8A 3IAS1 2KK8A 1Q0WB 4HJKA 2G4DB 2DYOA 3AEGB 3UIPB 1QZEA 3ZXVA 2IGDA 2M56B 1XCTL 4XGAB 3N32A 2ZNVC 5E6OA 1GUAB 4TQ1A 3ZW3A 3TIXA 4D2KA 1JWAD 1KF6B 1VRAB 2RGFA 1JMLA 4MH8A 1SE9A 2FNJB 2KLGA 3JYUA 1TBEA 4AQ7A 3HUIA 2LD9A 1E6EB 1RFAA 4ZRPA 5TSSA 4K3BA 1E8WA 4HRSA 1G6JA 2M0XA 3RNFC 2DENB 4X57B 3SR6A 3DBLI 1F2RI 3GOEA 5AZFA 4RF1A 2MBQA 4GGQA 1C4AA 1M94A 1UD7A 2ZCCA 1F9JA 1E10A 1UGJA 2FUHB 2KFKA 2JF5A 4REZA 4C56C 3APCA 4E74A 3UINB 2ZNVB 4GDLA 2Z0DB 2CU3A 3C19A 1C1YB 4WQMA 3RZFA 4BBNF 2KN4A 4KDLB 3ENEA 3IXSA 1FXIA 2MA9B 3VRBB 2L0TA 5HG2A 4YTPB 2N1WA 3OJ4B 4LNKA 4NJ6A 3RI7C 2NR2A 3AN1A 1V86A 1TS3A 4XDDA 2LRWA 3PLVA 4MH0E 2LJ5A 2KX0A 3SEBA 3SD5A 4I6NB 2J0MA 4XE0A 4RH6A 2AL6A 2RPVA 2N9LA 3KWLA 1UZXB 3CSTA 4B9KA 3DWMA 2PKOA 2J7QB 2NBVB 1V5OA 3Q14C 3D32A 2WGSA 1E7VA 3Q8AA 3P4RB 2EKIA 3PT2B 4MGKE 4RM8A 2OEDA 1XLPA 2Q5WD 4K81A 4TV3A 1QILA 2XK5B 2BS4B 3DHGC 1XD3B 3AECB 1QKZA 2WXFA 3ONSA 4IWOA 5FKAC 2KFKB 3ABVB 4HPMB 3B9JA 4GDLB 2I2YA 2INDC 4FN2A 1FNUA 4M0WA 3PRPB 1C79A 1V2YA 4FHJA 4XDCA 3KH0A 3ZGZA 2KJRA 4HKZE 3QK0A 2MWSB 2N9PC 1FO4A 5C23A 1KM7A 3W5UB 3TBLD 1F52A 5LXIB 4PS8A 2NCNA 3T9LA 4NJ7A 4LJOB 2WQYB 2LMCA 2AWTA 2WXPA 4AJYB 4DK5A 3MFGA 3RZWC 3A9KA 3GS2A 4C4VA 1TS4A 1D3ZA 2WU5B 3BK1A 3VTUA 3QA8A 3RMKC 5IOIA 4XZ4A 1PGXA 3MC9A 4IG7B 1QLBB 2DZKA 4A20A 2M1MA 1AWDA 3A4SC 3RT3B 1I4RA 2IO2B 3HIZA 2PMVA 2IGGA 1RYJA 1OFFA 2ASQA 2WYQA 2KMAA 3GB1A 4ANUA 1C78A 4BZAA 2KWVB 4F1SA 1IP9A 3NJTA 3HVDA 2ZPNA 1B1ZA 4II2B 2KDIA 1MFWA 5TR5A 4ASWC 2BF8B 5I4DA 3AEAB 4M0WB 2BYTA 4N59A 1CZPA 1U4AA 4RGMA 2PEAA 1X1MA 3GZNI 4P6VF 1M4VA 3N30A 2O6VA 5CX3A 4FJVB 2MQJA 3UQAA 4WH4A 2K22A 2Z8LA 2KMMA 3X0WA 4RGNA 2QEJC 3ZNGC 1XCQL 1WJ6A 2KJ6A 3A9KB 2NPTA 3Q2AC 4USAA 1SE2A 4C4VB 4PT5A 2D11A 2MCNB 1FXAA 2CKHB 2GOWA 1L5PA 2JUOA 1T6BX 4JQWC 5EE3A 1CMXB 2KC1A 1UNSA 2KHWB 3L16A 2VZKD 4WJQA 5E6PA 2KN5A 1ESFA 3RNGC 1F77A 1JWBD 5DCNA 1YN3A 1RM6C 4ZRIA 1K51A 4MM3A 2K6DB 4NPNA 3VH4B 1V6EA 1WE7A 2VZKB 1D4BA 3ZTCA 3L54A 2JZZA 2BYEA 1NYQA 4Q2JA 1SE3A 3R2TA 1WX9A 1F2RC 2KX3A 1C4CA 1RLFA 2GBMA 1FCCC 3PSEB 1TYGB 3H7SA 4HK2A 5BYRA 1RRBA 3PS6A 2M0AA 3URYA 2O6VB 4RGTA 1WMHA 3TJPA 1WXSA 1OQQA 4IUMB 2J52A 3V62A 3R66C 3VXWA 2NPTB 1MHHE 2LXAA 4S0RA 2E3TA 3CWIA 2LGXA 5C1ZA 2L05A 1Z2MA 4HKQA 4R3DA 1DOXA 2BQQA 2DHZA 2K8BA 3I57A 3TEXA 1OQYA 2BKFA 2PTLA 2W54A 3M3JA 4PS3A 4EFOA 3DBLB 3VDZA 2LFIA 2I1JA 3NG0A 2BKRB 2W82A 4ZHPA 4JL9A 2XN9C 2V9HA 2WXRA 2YLMA 2QILA 4IDIA 2MBEA 2RSUA 4MM3B 2N1VA 3KVFB 2K39A 2BT6A 3ZRFA 1WX8A 4E71A 3AE5B 4N9F4 3RN9C 3IVFA 2CR5A 4GB9A 1ZXIA 1R7SA 3AE8B 1N61A 4HDOA 4BFRA 1WH3A 4RM9A 2L52A 2L32A 3ZO5B 2NVUI 4EE2A 3AXCA 2HE7A 4DXGA 1WMHB 2DZMA 3IBEA 3AM9A 3APDA 2H88B 3QHTA 3AU5A 1Y56A 1C9FA 2JXTA 2KTRA 4YL8A 4FA6A 3QIJA 4KDIC 2CJOA 4B0EA 4EKUA 2ZEQA 2EELA 3QX1A 4HPLB 1SF0A 4JIOU 4FHKA 4MGZE 2OHFA 1GB1A 2VH1A 3PRMB 2ZCBA 2I1KA 1YQ4B 2L76A 1ZUD2 4F7ZA 1OTRB 4PYZA 1FFUA 5T8IA 5LXHA 1HTOA 3CMMB 3VFKA 3JW0X 1YMHE 4W9FA 1T0RC 1WYWB 1GC7A 2REXA 4YTNB 2KDMA 4W9IA 1SJHD 2BBCA 4NAWA 2QCZA 1YIWA 2JQRB 1MG8A 4A8XC 2KWUB 5BYSA 1VZ7A 2L8JA 1HZ6A 1HTQA 3AEFB 1N62A 3W9CB 1N5WA 2N7EA 1V1OA 3Q3OC 1N63A 2LUMA 3GP7A 2QC8A 3HHMA 3KLSX 2WX1A 4P1CC 4BOZB 1WF9A 4IM3A 2KYWA 1QOGA 2KTRB 3JVZX 5G55A 2KKCA 4DHZE 1ZOYB 3IG3A 2DX5B 1PYWD 2PLPA 5D7GA 1GJZA 1I4PA 4C7ZA 1T3QA 3L08A 3TCAA 1YX6B 1I4XA 1YJIA 2LRUA 4US9A 1OEYA 2AL3A 5FK9C 3H6NA 4WJOA 2N0SB 2NS5A 1XT9B 4JX1C 5J17A 4LCDE 1C4PA 1YD8U 1UF0A 4KGRA 2WWZA 1WJ4A 4KGTA 4NAWB 2JX5A 2JWUA 2H89B 3N1ZC 3PV1A 1TKEA 3V61A 1I4QA 3IHPC 3LB8C 5GMVA 3CF6E 1TIFA 3NVVA 2NTSA 4S17A 2WDRB 4DHJD 4US8A 3DBRI 1SJED 3TSSA 2QIEB 2IO1B 4WQOB 3H9DA 1SE4A 3OWEB 4MT5A 3ZNHB 1GAQB 4OZCA 4FADA 3BIID 3ML8A 1UBQA 1UBIA 2AQ3B 2B76B 3AEDB 3V60A 2XEWA 4DHJB 3NZ3A 2G1EA 1VDVA 4ZDVA 1V97A 3ZLZA 1D5ZC 4TSSA 5CHFA 1LFDA 3ZYYX 2WDTB 2DNFA 2EKEC 2LVPA 4A3OA 1C3TA 2YEPB 4YTMB 4L23A 3VHTC 2LGIA 1H8CA 4TMAB 5D2MB 2JPHA 3SU8X 1MG4A 2IO0B 4NAMA 4LLGM 2Y5CA 1SGHA 3KUCB 3GE8C 1OQRA 2KWCA 1TY2A 5IKCM 1TTNA 4HJGE 1P9DU 1NI2A 3RPFC 1IBXA 4II3B 2XK5A 2GBJA 2KMCA 2KVZA 3U30A 2N4FA 4JE3B 2WXJA 2HTHA 4GMVA 4IWPA 4ZYNA 1T5XD 4FBJB 2VRRB 2KDBA 1WX7A 1MPEA 2WDQB 2ZVOA 1BT0A 3HM6X 4LK0M 4ZRQA 1EO6A 4YXDB 4GLSC 2KOXA 2AQ2B 1YN5A 1Q1OA 1UWXA 2V3NA 4HDQA 2MBBB 2IZVB 4KKIA 4NNJB 2FCMA 2PW9A 4AS1A 5C3JB 2RR9A 1R4NI 3B0AA 1FEHA 5BMGA 4JLCA 3NZSA 4ANVA 2ZZPB 2L1AA 1EU4A 2V3SA 2DZJA 4H2AA 3RNBC 1ROEA 4ICVA 1EWYC 2RDBC 2BB5A 4O1NA 3T3OA 1WR6E 3TUOA 2V4IB 1WXAA 3MC8A 2WXNA 4MGIE 1KJTA 2INNE 3PHXB 1T0SC 3P63A 1WY8A 1YNTE 4IOIE 4I6PA 2JZPA 3DBHI 4WJPA 1IBXB 1WJUA 2BWES 1SB3C 3L13A 4EZKA 2KAJA 2WXOA 1D6EC 1N5XA 1L0YB 3WANA 2D5GA 5JXVA 3AE6B 2M17A 5CTRC 3PZ8A 4CYEA 2BS3B 4YSXB 4W9KA 4IKGA 1MI0A 4XWWA 2UWQA 2Y5BB 1YJJA 3OJ3A 2KTFA 1F0ZA 1SIFA 1S1QB 1FRRA 2D10A 1SXTA 1LGRA 1EF5A 1GOZA 5BO4B 1ZDVA 3BYTB 1VZ8A 2BGFA 1IGCA 3AV8A 2JZ3B 1P3QU 4W9DA 4N58A 3TEWA 1N60A 4MELA 3Q8FA 3VUXA 1P1AA 1HXYD 1XLOA 3AU4A 1FD6A 3A9JA 3H7PA 3PREA 3PGEA 4WWNA 2EMTA 2WXIA 4LNFA 2RDHA 1V80A 1J7AA 4CHKA 1FFVA 5D94A 2AX5A 4ITKA 1I4GA 2WU2B 3PTFC 2IBIB 4K3CA 3V05A 1ACCA 1C77A 2GBKA 2MW5A 3H8HA 2ON8A 1WRDB 5JHAA 1D5MC 3N1XC 2K0PA 4NQLB 2A5UA 4RCOA 3N9YC 1NI3A 3E9SA 2KO3A 3DVGX 2QJLA 3VR9B 3MHZA 3U2SC 5JZEB 4G11A 2INCC 3WALA 3AB5A 1JWMD 4QAYA 4A6QA 3ZJVA 2K9XA 3TMPB 4OHJA 3PVLA 3DVNV 2JVCA 1ISNA 1AN8A 2BW2A 5GXGB 4BKSA 1FCLA 5HKHA 3Q8EA 4RNAA 2CHZA 2O2VA 4GU2A 1A70A 3EECA 2CHXA 1Y8RC 2D3BA 2BB6A 3UIOB 3APFA 3SDLC 4EOYA 2MEKA 3B2GA 3A9JB 3H7PB 2JSVX 1ENFA 2O6VD 1IPGA 2TSSA 4ARIA 4WWPA 3DBRB 3J9CA 2YEPF 3QAQA 3RNCC 3HVZA 4RFBA 1IUEA 2DBYA 5MPOA 4C80A 3L4PA 1JWUD 1V9JA 3DWGC 2N7JA 4W9LA 2L00B 1FNWA 3U52E 1QQRA 2MX2A 4BBNC 4FXCA 2RMMA 4BKSD 4PYUA 2V0GA 1ZE3D 2INPE 5DPSA 3N1YC 2X38A 1Z5SB 1JWSD 1ET9A 3AEEB 2Y3AA 3VAWA 2K1FA 2JRHA 1WR1A 4M01A 1ZP0B 2XBBC 4K1RB 3ZIMA 1KRHA 3KUDB 4ZYSA 3FC4A 1K50A 2R61A 1CJEA 2SEBD 4OVUA 2O2VB 4OVZA 3ZNID 2WXMA 3WA0A 4PK1A 4GIVA 2HTME 1WXMA 2IJ0A 2RPQA 4IC7B 5AZHA 5G2NA 2XNAC 2KFJA 4YSYB 4MJSA 2HDEA 3NVZA 1WJNA 2KQSA 4RGOS 1WZ0A 4DDID 2ZJDA 3U7DA 2ZVNA 2Z59B 4DDGD 4WWMA 4MACA 1UWMA 2D3GA 2KC2A 3VUYA 4LNIA 4RF0A 2CU1A 2MLBA 1R4MI 3HM3A 5D6JB 3EFCA 1R4NB 2WXQA 1UH6A 2KZRA 3BINA 1UGMA 4K7WA 2K8CA 2JYEA 3IFWB 4ZHOA 1GB4A 2DWQA 2L3ZA 1LQBA 3I3TB 4FJYA 3V6CB 4KZCA 2IY1B 1WGHA 1EU3A 4EZLA 4OZBA 5IP4D 2JT4B 3DCGA 2C9WB 1FXTB 5D3IB 3A4RA 2IDYA 1WGGA 4C7YA 3V3XA 1WWTA 3VTVA 3EGRA 1OEYJ 5HHDG 3ZUNA 1FMAD 2MJDA 2W55A 2ZW0A 3BWUD 5LNK1 1IGDA 1JALA 3ZNZB 3H1UA 2LGDA 3V6EB 3ZXRA 1I4HA 1B9RA 1AW7A 1EM7A 3DPDA 2KDEB 4AP4C 1E8YA 4ZOHC 3QJZA 4MJSB 2DZIA 2N9EB 1IYFA 1WXQA 3GE3C 1Q5WB 2I38A 3M63B 3PRZA 1RAXA 1VJKA 4BVUC 1QOFA 3NS1A 1PQSA 1ZPSA 4YSZB 4YT0B 1NENB 1V5TA 1BUIC 1E7PB 4A9AA 1HA5A 3L10B 1CK1A 1L4DB 5HI1A 2MHJA 1J8CA 5E6JA 3JSVA 1FPYA 2WXLA 1XF5L 2JWZA 4LJPB 2LEKA 2WXGA 2KT7A 3DQVA 2RDGA 4P16A 2GI9A 1N6ZA 4KGSA 5FR6A 4GDKA 3ZKJC 1TZOA 2ZPYA 3A1QA 4ZRJA 3UF8A 2CJNA 3N3KB 1ET6A 3KWVA 3FAHA 1WGYA 5JHBA 2DYBA 5DPRA 1SEBD 1EF1A 1SSNA 1PDXA 1LXDA 1OGWA 1WM2A 3ZVVA 1TKYA 4HLEA 2LHEA 3GZNB 3KYDD 3QC8B 1UUPA 5HFYA 1NDDA 1DYQA 3EUB2 5DPTA 4MGYE 1RWSA 2NBUA 2BYFA 4GOCA 5KHOA 3EFUA 2FE8A 1WXVA 3U7ZA 2QMTA 4BOSC 2WLBA 1V49A 2D3AA 4EZJA 2D3CA 4G0NB 1TKGA 4JWSC 3E56A 3EHVA 2IPKD 1KLUD 2MRPA 3BK2A 3PHWB 3BYYB 1HZ5A 2V4LA 5EE9A 3W1YA 4MDKE 3R7RA 1L2NA 5LLIA 2VH2A 1BMLC 5J2RA 3AE7B 1TS5A 4I6LB 3JSVB 1TT5B 3VVWB 4WAFA 4BKGA 2G3QB 2WDVB 3B2FA 1ZXHA 5EE1A 2B3AA 1XXGA 4B0MA 4P1BC 3AH7A 2DLBA 3B08A 2LZ6A 2MP2A 4GXBA 4DQOC 3PPAA 5JH5C 4GDKB 3EA6A 3PO0A 2K25A 3A1QB 3TL5A 4P7IA 4EEWA 3ZDTA 4NJCA 3NS8A 1L0VB 2M4NA 4N6EB 3NUHB 3NVYA 1BXTA 3WAPA 2KXJA 1E9MA 4W9JA 2UU7A 2FAZA 1WE6A 4HCNB 4DWFA 4FULA 2WS3B 3ZJTA 2DAJA 1EUVB 1VZ6A 2A4ZA 5DPWA 1MVKA 2PVGC 2KNBA 5BMIA 1E5WA 2GRIA 3ZTDA 1WYGA 3HRDD 1E8ZA 2KDFB 2FCSA 1TS2A 2KQ4X 2MH7A 1V1PA 3I5JC 4OZAA 1JQ4A 4WWOA 2BPSA 1CQVA 1PGBA 1FM0D 3NVWA 4XWTA 2PIAA 2FCQA 3Q3JA 4EUTA 5IN7A 4A90A 4BAXA 1PUTA 4OW0A 3OG5A 2PPHA 1WM3A 4F8CB 3W1SA 5EDSA 3KYCD 3RNAC 4G3XB 2MP2B 4ZRKA 4BKTA 2MJEA 1I7HA 2KVRA 3QARA 1I35A 4KV2A 3VTWA 3Q3NC 2WXKA 4JPSA 4A55A 2GLSA 1MJDA 3VQIA 3LDZE 3PZ7A 2J0JA 4PS7A 3W5VB 3Q69A 3W1SC 4AJWA 3K9PB 4NZLB 2C7NB 2IO3B 5AZGA 1HEZE 3BY4B 2WP9B 3R2IA 5AEKB 2ZW1A 2EMSA 3QWZB 2W9NA 2LASA 2AQ1B 1QT9A 2M8SA 5KHQA 1R4MB 3IAM1 2J0KA 1L6VA 2FCNA 4FJZA 3PLUA 3ZDMC 2PE6B 4XYCA 3OAWA 1JRUA 2Y5PA 3A33B 1T0QC 1ZDXA 2W3RA 1V1PB 3X23A 1NBFC 1Q10A 2JXXA 1DGJA 3ECIA 1JROA 2AYOB 1XLQA 4IM0A 3AULA 2HD5B 4HXDA 1LM8B 3R7QA 1KTKA 2C7MB 2J42A 3ZRCA 3S2AA 1KOTA 1V8CA 2KACA 2NMQA 3T3NA 4KIKA 3BVMA 3RUIB 1J7CA 1ZW7A 1NVID 5G5HA 3RFZB 4HROA 3UQBA 1P7FA 1WZ3A 3VUWA 3AE9B 3L17A 1YQBA 2DYMA 1KLGD 2L0FA 3BVGA 1NEKB 2MJ3A 3MC0B 1YQ3B 3DDCB 2N9XA 4HPPA 2CHWA 3FILA 1UELA 2QSDA 3P42A 1K8RB 4W9CA 1C76A 3KQ4A 1L0XB 5E6NA 4ANWA 3U8ZA 4K7SA 4M8NA 2JYTA 1WGRA 3WCQA 1FIQA 3P2BA 2CS4A 5D3DA 1TZ1A 3RNEC 2ONQA 2OJWA 2ICIA 3T8MA 2IY0B 3W2DA 5IO9A 4WIPA 2PE9A 2IYDB 2DAFA 4MEMA 2BS2B 4ARCA 3NHEB 1WIAA 4W9HA 3B1LX 2KD0A 5EE0A 3BZDB 1JW9D 1LO5D 1XEEA 3MJ5A 2PJHA 1HE8A 4KIKB 1PFDA 2YVCA 1PGAA 1WRIA 5L83A 4L2YA 2MBHA 3ML9A 1WGDA 4L1BA 3P4PB 3SHQA 4HCPB 4HVBA 1E0ZA 1D5XC 2SAKA 3WAMA 2J4XA 2ACZB 1V81A 4MSQB 3DVGY 2RD0A 4KKJA 1VLBA 1RFKA 1NYRA 3FILB 2L83A 2LGYA 1ZKHA 5C2TB 3LJ3A 4RMAA 3ETRA 5FR3A 1YN4A 1ZGUB 1J0GA 5H92C 3RYTA 2GB1A 2G4SA 1E7UA 2L7RA 4IW0A 1P7EA 4DXAB 1DOIA 2WNMA 2BWFA 2LVQA 2G9HD 4J6IA 3LXFA 2BTEA 2LWPA 3CIRB 4WURA 2OJRA 3I63C 3QCAA 2WX0A 3DVNU 3Q8CA 1VR9A 2BYVE 1FRDA 4WJNA 4CO7A 1FNVA 4XC2A 3RULA 5BYQA 3ALBA 3RD2A 2FIDA 2G45B 3UI3A 4DHZB 1VD2A 2WXHA 4XX5A 2WHIA 1GPXA 2X8XX 1F1HA 3OLMD 4LTUA 1E8XA 2UYZB 2GBNA 1MHXA 1QF6A 4LNOA 1SBBB 2OOBB 3AE3B 5H8YE 3TEZA 4TUUA 3WIMA 4OVVA 4LNNA 4M00A 1JRPA 1S3SG 3DBSA 3IT4B 2JY6A 4DBGA 1H4RA 3TEYA 3DOWA 3MTNB 1TGZB 2KWDA 1AYFA 3R8BA 2NTTA 4FLHA 1KLVA 4URKA 3Q3FA 1XLNA 2C60A 4C00A 3AMZA 3I9V1 1I42A 1WSPA 3C8YA 1EWCA 1GNUA
chains in the Genus database with same CATH topology
2BYTA 4N59A 1CZPA 2CJNA 1FEHA 5BMGA 1ET6A 3AE1B 4RGMA 3ZJUA 3KWVA 2L1AA 3FAHA 2FBWB 1EU4A 3AE4B 3AEAB 4P6VF 1M4VA 4H2AA 1SEBD 1QOAA 2PVOD 1ROEA 1SSNA 1PDXA 1EWYC 1TJEA 4WH4A 2BB5A 2K22A 2Z8LA 4O1NA 2KMMA 3T3OA 3VRAB 2K5PA 4RGNA 2V4IB 2QEJC 3TUOA 1KH0A 1TKYA 2LHEA 3SFDB 1XCQL 2WXNA 1UUPA 5HFYA 4TQ0A 1DYQA 3EUB2 4USAA 1SE2A 1RWSA 4PT5A 2INNE 2FE8A 3P63A 3U7ZA 2LJIA 1FXAA 1YNTE 2QMTA 4IOIE 2WLBA 4HEA1 2JZPA 1L5PA 5EE3A 1T6BX 1IBXB 1TKGA 2J53A 4JWSC 1UNSA 3E56A 2IPKD 2V3PA 1KLUD 3BK2A 1SB3C 3U4EG 3BYYB 1HQRD 1HZ5A 5EE9A 2KAJA 2W3SA 2WXOA 3Q8BA 1D6EC 1N5XA 2VZKD 1L0YB 1BMLC 2D5GA 5JXVA 3AE6B 1ESFA 3AE7B 4DXFA 1TS5A 1F77A 4WAFA 1JWBD 1YN3A 3PZ8A 1SIJA 1RM6C 2WDVB 1K51A 3B2FA 2BS3B 4YSXB 1ZXHA 3SFEB 5EE1A 1XXGA 1K52A 4B0MA 3AH7A 2DLBA 2VZKB 4IKGA 3P1MA 1D4BA 1MI0A 4XWWA 4DQOC 1YJJA 1NYQA 4Q2JA 1SE3A 3R2TA 4GDKB 3EA6A 3PO0A 1F2RC 1F0ZA 2FUG1 2LHDA 4NJCA 1C4CA 1L0VB 1FRRA 1FCCC 1TYGB 4N6EB 1WGKA 3NUHB 3NVYA 5BYRA 1SXTA 2M0AA 3URYA 1BXTA 2E6XA 1GOZA 4RGTA 4J3OD 1E9MA 1OQQA 1ZDVA 3BYTB 2J52A 1VZ8A 2N9KA 2WS3B 3ZJTA 1IGCA 1MHHE 3AV8A 2JU6X 2E3TA 1VZ6A 3CWIA 4N58A 3TEWA 1MVKA 2PVGC 4HKQA 4R3DA 1N60A 5BMIA 1DOXA 3I57A 3Q8FA 1JCKB 3TEXA 2GRIA 1HXYD 2PTLA 1XLOA 4UDUC 1FD6A 1WYGA 1QOBA 3HRDD 2W54A 1TS2A 2KQ4X 2MH7A 1V1PA 3IT6B 2K3UA 4OZAA 1JQ4A 2LFIA 2W82A 1CQVA 1PGBA 3MP9A 4ZHPA 1K53A 1FM0D 2XN9C 3NVWA 4XWTA 2PIAA 2WXRA 2WXIA 3P4SB 2QILA 2RDHA 4IDIA 4A90A 1J7AA 1FFVA 4MM3B 1PUTA 3AE2B 4OW0A 2AX5A 4CQNA 4ITKA 1I4GA 3W1SA 2WU2B 3AEBB 2BT6A 3V05A 1TY0A 3O13A 1DOYA 3AE5B 4KX6B 1ACCA 1C77A 2MJEA 3H8HA 2ON8A 1I7HA 1ZXIA 1D5MC 1R7SA 5AUIA 3AE8B 2K0PA 5BMHA 1N61A 2M19A 4RCOA 3N9YC 1NI3A 2WXKA 3E9SA 4JPSA 2L52A 1XO3A 5AUKA 2L32A 2QJLA 4A55A 3VR9B 3MHZA 3U2SC 4YWGG 4EE2A 3VQIA 3AB5A 1JWMD 3PZ7A 4A6QA 3ZJVA 2K9XA 3W5VB 3Q69A 4DXGA 1STEA 4OHJA 3P4QB 3ZQ4A 1AN8A 2BW2A 4NZLB 5GXGB 3AM9A 1HEZE 1L6UA 2WP9B 1FCLA 3R2IA 2H88B 2ZW1A 3BVZA 3Q8EA 2AQ1B 1Y56A 1QT9A 4RNAA 5G5GA 2JXTA 1C9FA 3IAM1 1L6VA 3NRZA 2IGHA 2CJOA 1KFYB 1L4ZB 4B0EA 3VR8B 2EELA 1J7BA 1A70A 3LYYA 1SF0A 4JWUC 2OHFA 2Y5PA 2BB6A 1GB1A 1YQ4B 2MEKA 3B2GA 1ZDXA 1ZUD2 2W3RA 3IAS1 2JSVX 1V1PB 1ENFA 1Q10A 1DGJA 2DYOA 1JROA 1XLQA 3AEGB 2TSSA 2IGDA 2M56B 1XCTL 1FFUA 5T8IA 4ARIA 3J9CA 2YEPF 1KTKA 2J42A 3HVZA 4RFBA 1V8CA 1IUEA 2DBYA 5MPOA 4TQ1A 3L4PA 4C80A 1JWUD 1YMHE 2KACA 2NMQA 3T3NA 4D2KA 3BVMA 1JWAD 3DWGC 1KF6B 1VRAB 1JMLA 1J7CA 2N7JA 4MH8A 4YTNB 1NVID 2KDMA 5G5HA 3RFZB 4HROA 4AQ7A 1FNWA 3U52E 1SJHD 1P7FA 3HUIA 2BBCA 1E6EB 1QQRA 4ZRPA 5TSSA 3AE9B 4FXCA 2JQRB 2RMMA 4HRSA 2V0GA 4A8XC 1ZE3D 2INPE 2DYMA 2X38A 5BYSA 1KLGD 1JWSD 3BVGA 1VZ7A 1ET9A 3AEEB 1NEKB 3SR6A 2MJ3A 1HZ6A 2Y3AA 3MC0B 1YQ3B 1F2RI 3AEFB 1N62A 1ZP0B 4RF1A 3W9CB 1N5WA 1C4AA 3FILA 1KRHA 2QSDA 1V1OA 1N63A 2LUMA 4ZYSA 3P42A 3FC4A 3GP7A 1E10A 1K50A 3KLSX 2R61A 1C76A 1UGJA 1CJEA 2SEBD 1QOGA 4REZA 3KQ4A 4C56C 1L0XB 4OVZA 2WXMA 2HTME 1ZOYB 2CU3A 1PYWD 2JYTA 2IJ0A 4WQMA 3WCQA 2PLPA 2KN4A 5D7GA 1FIQA 2XNAC 5D3DA 1I4PA 4C7ZA 4YSYB 1T3QA 2ONQA 2HDEA 3IXSA 1FXIA 1I4XA 3NVZA 3VRBB 4RGOS 2ICIA 5HG2A 1YJIA 4US9A 4YTPB 3W2DA 4WIPA 3AN1A 1TS3A 4XDDA 5FK9C 2BS2B 4ARCA 4WWMA 4MACA 3SEBA 2N0SB 1UWMA 5EE0A 3BZDB 1JW9D 1LO5D 1XEEA 4XE0A 4RF0A 3MJ5A 4JX1C 4RH6A 1C4PA 2RPVA 4KGRA 2N9LA 1PFDA 3KWLA 2WXQA 1PGAA 1WRIA 4KGTA 4L2YA 2JYEA 4NAWB 3DWMA 2JX5A 2JWUA 4L1BA 2H89B 2PKOA 3P4PB 4ZHOA 1GB4A 2DWQA 1E0ZA 1D5XC 1TKEA 2SAKA 3Q8AA 1I4QA 3LB8C 3P4RB 1EU3A 2EKIA 2J4XA 3NVVA 4OZBA 2NTSA 2ACZB 2WDRB 2OEDA 1XLPA 2Q5WD 4KKJA 5D3IB 1VLBA 1QILA 1RFKA 2IDYA 2BS4B 1NYRA 3FILB 4C7YA 2L83A 4US8A 3V3XA 5C2TB 1SJED 1WWTA 3TSSA 2QIEB 3AECB 1QKZA 2WXFA 3EGRA 5HHDG 3ETRA 1SE4A 3OWEB 4MT5A 1FMAD 2MJDA 5FKAC 1GAQB 2W55A 4OZCA 2ZW0A 3ABVB 3BWUD 5FR3A 1YN4A 5LNK1 1IGDA 3BIID 1JALA 2AQ3B 2B76B 3AEDB 3B9JA 4GDLB 2GB1A 5H92C 2I2YA 3NZ3A 1FNUA 4M0WA 2G1EA 1VDVA 1C79A 1V97A 1D5ZC 1I4HA 4XDCA 3ZGZA 4TSSA 1B9RA 4HKZE 1AW7A 3ZYYX 1P7EA 1FO4A 1DOIA 1EM7A 3W5UB 2WNMA 4ZOHC 2YEPB 2G9HD 2BTEA 3LXFA 4YTMB 4L23A 1WXQA 3CIRB 2WQYB 2LMCA 2WXPA 4WURA 2LGIA 2I38A 4TMAB 3MFGA 1VJKA 4NAMA 3GS2A 3Q8CA 1QOFA 1VR9A 3NS1A 4LLGM 2Y5CA 1TS4A 1FRDA 2WU5B 1ZPSA 3BK1A 4YSZB 1FNVA 4YT0B 1NENB 5BYQA 1OQRA 1BUIC 1E7PB 1TY2A 3UI3A 4A9AA 1HA5A 4HJGE 2WXHA 3RPFC 1PGXA 1IBXA 1GPXA 1CK1A 1QLBB 1L4DB 5HI1A 4JE3B 2WXJA 1AWDA 4LTUA 1T5XD 1QF6A 1I4RA 1MHXA 1SBBB 5E6JA 3AE3B 5H8YE 3TEZA 2PMVA 2IGGA 1RYJA 1MPEA 2WDQB 2WXLA 1XF5L 4LK0M 1OFFA 1JRPA 4ZRQA 3IT4B 4YXDB 3GB1A 2LEKA 4GLSC 3TEYA 2AQ2B 2WXGA 1C78A 2KWDA 1AYFA 3R8BA 1YN5A 2NTTA 3HVDA 2RDGA 1UWXA 4P16A 2V3NA 1B1ZA 1XLNA 2GI9A 4KGSA 4KKIA 2PW9A 3AMZA 3I9V1 1WSPA 3C8YA 4AS1A 5C3JB 5I4DA 1EWCA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  1XCT L;  4OZB A;  5BMG A;  1MVK A;  2OED A;  5BMI A;  2KAC A;  1YMH E;  2NMQ A;  3FIL B;  4D2K A;  3V3X A;  2PTL A;  1JML A;  1FD6 A;  1QKZ A;  2N7J A;  4WH4 A;  2KDM A;  5HHD G;  2KQ4 X;  1P7F A;  1KH0 A;  4OZA A;  4OZC A;  2ZW0 A;  2LHE A;  1XCQ L;  1IGD A;  2RMM A;  5HFY A;  1PGB A;  3MP9 A;  2GB1 A;  1K53 A;  2I2Y A;  1YNT E;  2QMT A;  4IOI E;  1HZ6 A;  1F2R I;  2JZP A;  4HKZ E;  1IBX B;  1P7E A;  1EM7 A;  2J53 A;  3FIL A;  2QSD A;  2LUM A;  2ON8 A;  1HZ5 A;  2K0P A;  5BMH A;  1K50 A;  2LGI A;  2I38 A;  5JXV A;  1K51 A;  1ZXH A;  3UI3 A;  2PLP A;  4HJG E;  1K52 A;  2KN4 A;  4IKG A;  1PGX A;  1IBX A;  1D4B A;  1HEZ E;  1MI0 A;  2ONQ A;  1FCL A;  5HI1 A;  5HG2 A;  2ZW1 A;  1MHX A;  1F2R C;  1C9F A;  2JXT A;  2LHD A;  2IGH A;  4MAC A;  2IGG A;  1FCC C;  1MPE A;  2EEL A;  1XF5 L;  3GB1 A;  4GLS C;  2RPV A;  4KGR A;  2N9L A;  1GB1 A;  2KWD A;  2J52 A;  1PGA A;  1UWX A;  2JSV X;  4KGT A;  2N9K A;  2GI9 A;  4KGS A;  2PW9 A;  1Q10 A;  2JWU A;  1IGC A;  1GB4 A;  1MHH E;  2JU6 X; 
#chains in the Genus database with same CATH topology
 1GC6 A;  1YOV B;  4AUQ C;  3ZJU A;  3AE1 B;  4LDT D;  2FBW B;  3AE4 B;  1WI0 A;  4M02 A;  4A3P A;  4G50 A;  1QOA A;  2PVO D;  3C0R B;  3M95 A;  3O65 B;  1TJE A;  3VRA B;  2K5P A;  4KVG B;  5J18 A;  4ACF A;  4K7U A;  1KH0 A;  3SFD B;  4LDT B;  1T0Y A;  4TQ0 A;  2K8H A;  3DHI C;  3M62 B;  2LJI A;  3R3M A;  2Z0E B;  4GN1 A;  4HEA 1;  2C7H A;  2BVC A;  2J53 A;  2V3P A;  3U4E G;  2QHO A;  1HQR D;  3L0W B;  2W3S A;  1YJ1 A;  3Q8B A;  2LGS A;  3DBH B;  1A5R A;  1GG3 A;  2C5L C;  4DXF A;  4KSL C;  2R2Q A;  2NBW B;  2D2Q A;  3NZU A;  3KW5 B;  1SIJ A;  3SFE B;  5CHV C;  1K52 A;  3P1M A;  1P0R A;  2HJ1 A;  3WAO A;  2N7D A;  3RCZ A;  2QDF A;  2FUG 1;  2K6Q A;  2LHD A;  3QQ8 B;  4TKN A;  1WGK A;  1L7Y A;  1E90 A;  2E6X A;  3UGB B;  1WFY A;  2R2O A;  4B95 A;  4J3O D;  5L95 C;  2LUE A;  5IAA C;  1J19 A;  4KZ0 A;  2N9K A;  4JGH B;  2FIF A;  4IWQ A;  4AWJ A;  4E3C A;  2JU6 X;  3MJW A;  2KJH B;  3NOB A;  4HWI B;  3Q6B A;  4ICU A;  4B6W A;  3MHS D;  4WAA A;  2KAN A;  2JRI B;  4IM2 A;  3KUZ A;  5CHW A;  1JCK B;  3K9O B;  4UDU C;  4GSW A;  1QOB A;  3IT6 B;  2K3U A;  3MP9 A;  1K53 A;  4NQK E;  2GMI C;  3P4S B;  5IA7 A;  3CSF A;  3AE2 B;  3N20 C;  3NY5 A;  4CQN A;  3AEB B;  1YX5 B;  3Q3M C;  1TY0 A;  2MBO A;  3O13 A;  1DOY A;  4KX6 B;  3VH3 B;  1AAR A;  5AUI A;  4AOF A;  5BMH A;  3FKY A;  2M19 A;  2LI5 A;  2KLC A;  1P98 A;  2HJ8 A;  1XO3 A;  5AUK A;  3HK0 A;  4YWG G;  4MSM B;  1STE A;  3ZQ4 A;  2LXC A;  3P4Q B;  2MSE D;  3AI5 A;  1L6U A;  3DHH C;  2LVO A;  2GBR A;  4W9E A;  3BVZ A;  4W9G A;  2KQ7 A;  1XQQ A;  4KSK C;  4NY0 A;  5G5G A;  4M8M A;  3NRZ A;  2IGH A;  4ANX A;  1KFY B;  1L4Z B;  3VR8 B;  2AEH A;  2V1Y A;  1J7B A;  2D07 B;  3LYY A;  4JWU C;  3PZD A;  1VCB A;  3EC8 A;  3IAS 1;  2KK8 A;  1Q0W B;  4HJK A;  2G4D B;  2DYO A;  3AEG B;  3UIP B;  1QZE A;  3ZXV A;  2IGD A;  2M56 B;  1XCT L;  4XGA B;  3N32 A;  2ZNV C;  5E6O A;  1GUA B;  4TQ1 A;  3ZW3 A;  3TIX A;  4D2K A;  1JWA D;  1KF6 B;  1VRA B;  2RGF A;  1JML A;  4MH8 A;  1SE9 A;  2FNJ B;  2KLG A;  3JYU A;  1TBE A;  4AQ7 A;  3HUI A;  2LD9 A;  1E6E B;  1RFA A;  4ZRP A;  5TSS A;  4K3B A;  1E8W A;  4HRS A;  1G6J A;  2M0X A;  3RNF C;  2DEN B;  4X57 B;  3SR6 A;  3DBL I;  1F2R I;  3GOE A;  5AZF A;  4RF1 A;  2MBQ A;  4GGQ A;  1C4A A;  1M94 A;  1UD7 A;  2ZCC A;  1F9J A;  1E10 A;  1UGJ A;  2FUH B;  2KFK A;  2JF5 A;  4REZ A;  4C56 C;  3APC A;  4E74 A;  3UIN B;  2ZNV B;  4GDL A;  2Z0D B;  2CU3 A;  3C19 A;  1C1Y B;  4WQM A;  3RZF A;  4BBN F;  2KN4 A;  4KDL B;  3ENE A;  3IXS A;  1FXI A;  2MA9 B;  3VRB B;  2L0T A;  5HG2 A;  4YTP B;  2N1W A;  3OJ4 B;  4LNK A;  4NJ6 A;  3RI7 C;  2NR2 A;  3AN1 A;  1V86 A;  1TS3 A;  4XDD A;  2LRW A;  3PLV A;  4MH0 E;  2LJ5 A;  2KX0 A;  3SEB A;  3SD5 A;  4I6N B;  2J0M A;  4XE0 A;  4RH6 A;  2AL6 A;  2RPV A;  2N9L A;  3KWL A;  1UZX B;  3CST A;  4B9K A;  3DWM A;  2PKO A;  2J7Q B;  2NBV B;  1V5O A;  3Q14 C;  3D32 A;  2WGS A;  1E7V A;  3Q8A A;  3P4R B;  2EKI A;  3PT2 B;  4MGK E;  4RM8 A;  2OED A;  1XLP A;  2Q5W D;  4K81 A;  4TV3 A;  1QIL A;  2XK5 B;  2BS4 B;  3DHG C;  1XD3 B;  3AEC B;  1QKZ A;  2WXF A;  3ONS A;  4IWO A;  5FKA C;  2KFK B;  3ABV B;  4HPM B;  3B9J A;  4GDL B;  2I2Y A;  2IND C;  4FN2 A;  1FNU A;  4M0W A;  3PRP B;  1C79 A;  1V2Y A;  4FHJ A;  4XDC A;  3KH0 A;  3ZGZ A;  2KJR A;  4HKZ E;  3QK0 A;  2MWS B;  2N9P C;  1FO4 A;  5C23 A;  1KM7 A;  3W5U B;  3TBL D;  1F52 A;  5LXI B;  4PS8 A;  2NCN A;  3T9L A;  4NJ7 A;  4LJO B;  2WQY B;  2LMC A;  2AWT A;  2WXP A;  4AJY B;  4DK5 A;  3MFG A;  3RZW C;  3A9K A;  3GS2 A;  4C4V A;  1TS4 A;  1D3Z A;  2WU5 B;  3BK1 A;  3VTU A;  3QA8 A;  3RMK C;  5IOI A;  4XZ4 A;  1PGX A;  3MC9 A;  4IG7 B;  1QLB B;  2DZK A;  4A20 A;  2M1M A;  1AWD A;  3A4S C;  3RT3 B;  1I4R A;  2IO2 B;  3HIZ A;  2PMV A;  2IGG A;  1RYJ A;  1OFF A;  2ASQ A;  2WYQ A;  2KMA A;  3GB1 A;  4ANU A;  1C78 A;  4BZA A;  2KWV B;  4F1S A;  1IP9 A;  3NJT A;  3HVD A;  2ZPN A;  1B1Z A;  4II2 B;  2KDI A;  1MFW A;  5TR5 A;  4ASW C;  2BF8 B;  5I4D A;  3AEA B;  4M0W B;  2BYT A;  4N59 A;  1CZP A;  1U4A A;  4RGM A;  2PEA A;  1X1M A;  3GZN I;  4P6V F;  1M4V A;  3N30 A;  2O6V A;  5CX3 A;  4FJV B;  2MQJ A;  3UQA A;  4WH4 A;  2K22 A;  2Z8L A;  2KMM A;  3X0W A;  4RGN A;  2QEJ C;  3ZNG C;  1XCQ L;  1WJ6 A;  2KJ6 A;  3A9K B;  2NPT A;  3Q2A C;  4USA A;  1SE2 A;  4C4V B;  4PT5 A;  2D11 A;  2MCN B;  1FXA A;  2CKH B;  2GOW A;  1L5P A;  2JUO A;  1T6B X;  4JQW C;  5EE3 A;  1CMX B;  2KC1 A;  1UNS A;  2KHW B;  3L16 A;  2VZK D;  4WJQ A;  5E6P A;  2KN5 A;  1ESF A;  3RNG C;  1F77 A;  1JWB D;  5DCN A;  1YN3 A;  1RM6 C;  4ZRI A;  1K51 A;  4MM3 A;  2K6D B;  4NPN A;  3VH4 B;  1V6E A;  1WE7 A;  2VZK B;  1D4B A;  3ZTC A;  3L54 A;  2JZZ A;  2BYE A;  1NYQ A;  4Q2J A;  1SE3 A;  3R2T A;  1WX9 A;  1F2R C;  2KX3 A;  1C4C A;  1RLF A;  2GBM A;  1FCC C;  3PSE B;  1TYG B;  3H7S A;  4HK2 A;  5BYR A;  1RRB A;  3PS6 A;  2M0A A;  3URY A;  2O6V B;  4RGT A;  1WMH A;  3TJP A;  1WXS A;  1OQQ A;  4IUM B;  2J52 A;  3V62 A;  3R66 C;  3VXW A;  2NPT B;  1MHH E;  2LXA A;  4S0R A;  2E3T A;  3CWI A;  2LGX A;  5C1Z A;  2L05 A;  1Z2M A;  4HKQ A;  4R3D A;  1DOX A;  2BQQ A;  2DHZ A;  2K8B A;  3I57 A;  3TEX A;  1OQY A;  2BKF A;  2PTL A;  2W54 A;  3M3J A;  4PS3 A;  4EFO A;  3DBL B;  3VDZ A;  2LFI A;  2I1J A;  3NG0 A;  2BKR B;  2W82 A;  4ZHP A;  4JL9 A;  2XN9 C;  2V9H A;  2WXR A;  2YLM A;  2QIL A;  4IDI A;  2MBE A;  2RSU A;  4MM3 B;  2N1V A;  3KVF B;  2K39 A;  2BT6 A;  3ZRF A;  1WX8 A;  4E71 A;  3AE5 B;  4N9F 4;  3RN9 C;  3IVF A;  2CR5 A;  4GB9 A;  1ZXI A;  1R7S A;  3AE8 B;  1N61 A;  4HDO A;  4BFR A;  1WH3 A;  4RM9 A;  2L52 A;  2L32 A;  3ZO5 B;  2NVU I;  4EE2 A;  3AXC A;  2HE7 A;  4DXG A;  1WMH B;  2DZM A;  3IBE A;  3AM9 A;  3APD A;  2H88 B;  3QHT A;  3AU5 A;  1Y56 A;  1C9F A;  2JXT A;  2KTR A;  4YL8 A;  4FA6 A;  3QIJ A;  4KDI C;  2CJO A;  4B0E A;  4EKU A;  2ZEQ A;  2EEL A;  3QX1 A;  4HPL B;  1SF0 A;  4JIO U;  4FHK A;  4MGZ E;  2OHF A;  1GB1 A;  2VH1 A;  3PRM B;  2ZCB A;  2I1K A;  1YQ4 B;  2L76 A;  1ZUD 2;  4F7Z A;  1OTR B;  4PYZ A;  1FFU A;  5T8I A;  5LXH A;  1HTO A;  3CMM B;  3VFK A;  3JW0 X;  1YMH E;  4W9F A;  1T0R C;  1WYW B;  1GC7 A;  2REX A;  4YTN B;  2KDM A;  4W9I A;  1SJH D;  2BBC A;  4NAW A;  2QCZ A;  1YIW A;  2JQR B;  1MG8 A;  4A8X C;  2KWU B;  5BYS A;  1VZ7 A;  2L8J A;  1HZ6 A;  1HTQ A;  3AEF B;  1N62 A;  3W9C B;  1N5W A;  2N7E A;  1V1O A;  3Q3O C;  1N63 A;  2LUM A;  3GP7 A;  2QC8 A;  3HHM A;  3KLS X;  2WX1 A;  4P1C C;  4BOZ B;  1WF9 A;  4IM3 A;  2KYW A;  1QOG A;  2KTR B;  3JVZ X;  5G55 A;  2KKC A;  4DHZ E;  1ZOY B;  3IG3 A;  2DX5 B;  1PYW D;  2PLP A;  5D7G A;  1GJZ A;  1I4P A;  4C7Z A;  1T3Q A;  3L08 A;  3TCA A;  1YX6 B;  1I4X A;  1YJI A;  2LRU A;  4US9 A;  1OEY A;  2AL3 A;  5FK9 C;  3H6N A;  4WJO A;  2N0S B;  2NS5 A;  1XT9 B;  4JX1 C;  5J17 A;  4LCD E;  1C4P A;  1YD8 U;  1UF0 A;  4KGR A;  2WWZ A;  1WJ4 A;  4KGT A;  4NAW B;  2JX5 A;  2JWU A;  2H89 B;  3N1Z C;  3PV1 A;  1TKE A;  3V61 A;  1I4Q A;  3IHP C;  3LB8 C;  5GMV A;  3CF6 E;  1TIF A;  3NVV A;  2NTS A;  4S17 A;  2WDR B;  4DHJ D;  4US8 A;  3DBR I;  1SJE D;  3TSS A;  2QIE B;  2IO1 B;  4WQO B;  3H9D A;  1SE4 A;  3OWE B;  4MT5 A;  3ZNH B;  1GAQ B;  4OZC A;  4FAD A;  3BII D;  3ML8 A;  1UBQ A;  1UBI A;  2AQ3 B;  2B76 B;  3AED B;  3V60 A;  2XEW A;  4DHJ B;  3NZ3 A;  2G1E A;  1VDV A;  4ZDV A;  1V97 A;  3ZLZ A;  1D5Z C;  4TSS A;  5CHF A;  1LFD A;  3ZYY X;  2WDT B;  2DNF A;  2EKE C;  2LVP A;  4A3O A;  1C3T A;  2YEP B;  4YTM B;  4L23 A;  3VHT C;  2LGI A;  1H8C A;  4TMA B;  5D2M B;  2JPH A;  3SU8 X;  1MG4 A;  2IO0 B;  4NAM A;  4LLG M;  2Y5C A;  1SGH A;  3KUC B;  3GE8 C;  1OQR A;  2KWC A;  1TY2 A;  5IKC M;  1TTN A;  4HJG E;  1P9D U;  1NI2 A;  3RPF C;  1IBX A;  4II3 B;  2XK5 A;  2GBJ A;  2KMC A;  2KVZ A;  3U30 A;  2N4F A;  4JE3 B;  2WXJ A;  2HTH A;  4GMV A;  4IWP A;  4ZYN A;  1T5X D;  4FBJ B;  2VRR B;  2KDB A;  1WX7 A;  1MPE A;  2WDQ B;  2ZVO A;  1BT0 A;  3HM6 X;  4LK0 M;  4ZRQ A;  1EO6 A;  4YXD B;  4GLS C;  2KOX A;  2AQ2 B;  1YN5 A;  1Q1O A;  1UWX A;  2V3N A;  4HDQ A;  2MBB B;  2IZV B;  4KKI A;  4NNJ B;  2FCM A;  2PW9 A;  4AS1 A;  5C3J B;  2RR9 A;  1R4N I;  3B0A A;  1FEH A;  5BMG A;  4JLC A;  3NZS A;  4ANV A;  2ZZP B;  2L1A A;  1EU4 A;  2V3S A;  2DZJ A;  4H2A A;  3RNB C;  1ROE A;  4ICV A;  1EWY C;  2RDB C;  2BB5 A;  4O1N A;  3T3O A;  1WR6 E;  3TUO A;  2V4I B;  1WXA A;  3MC8 A;  2WXN A;  4MGI E;  1KJT A;  2INN E;  3PHX B;  1T0S C;  3P63 A;  1WY8 A;  1YNT E;  4IOI E;  4I6P A;  2JZP A;  3DBH I;  4WJP A;  1IBX B;  1WJU A;  2BWE S;  1SB3 C;  3L13 A;  4EZK A;  2KAJ A;  2WXO A;  1D6E C;  1N5X A;  1L0Y B;  3WAN A;  2D5G A;  5JXV A;  3AE6 B;  2M17 A;  5CTR C;  3PZ8 A;  4CYE A;  2BS3 B;  4YSX B;  4W9K A;  4IKG A;  1MI0 A;  4XWW A;  2UWQ A;  2Y5B B;  1YJJ A;  3OJ3 A;  2KTF A;  1F0Z A;  1SIF A;  1S1Q B;  1FRR A;  2D10 A;  1SXT A;  1LGR A;  1EF5 A;  1GOZ A;  5BO4 B;  1ZDV A;  3BYT B;  1VZ8 A;  2BGF A;  1IGC A;  3AV8 A;  2JZ3 B;  1P3Q U;  4W9D A;  4N58 A;  3TEW A;  1N60 A;  4MEL A;  3Q8F A;  3VUX A;  1P1A A;  1HXY D;  1XLO A;  3AU4 A;  1FD6 A;  3A9J A;  3H7P A;  3PRE A;  3PGE A;  4WWN A;  2EMT A;  2WXI A;  4LNF A;  2RDH A;  1V80 A;  1J7A A;  4CHK A;  1FFV A;  5D94 A;  2AX5 A;  4ITK A;  1I4G A;  2WU2 B;  3PTF C;  2IBI B;  4K3C A;  3V05 A;  1ACC A;  1C77 A;  2GBK A;  2MW5 A;  3H8H A;  2ON8 A;  1WRD B;  5JHA A;  1D5M C;  3N1X C;  2K0P A;  4NQL B;  2A5U A;  4RCO A;  3N9Y C;  1NI3 A;  3E9S A;  2KO3 A;  3DVG X;  2QJL A;  3VR9 B;  3MHZ A;  3U2S C;  5JZE B;  4G11 A;  2INC C;  3WAL A;  3AB5 A;  1JWM D;  4QAY A;  4A6Q A;  3ZJV A;  2K9X A;  3TMP B;  4OHJ A;  3PVL A;  3DVN V;  2JVC A;  1ISN A;  1AN8 A;  2BW2 A;  5GXG B;  4BKS A;  1FCL A;  5HKH A;  3Q8E A;  4RNA A;  2CHZ A;  2O2V A;  4GU2 A;  1A70 A;  3EEC A;  2CHX A;  1Y8R C;  2D3B A;  2BB6 A;  3UIO B;  3APF A;  3SDL C;  4EOY A;  2MEK A;  3B2G A;  3A9J B;  3H7P B;  2JSV X;  1ENF A;  2O6V D;  1IPG A;  2TSS A;  4ARI A;  4WWP A;  3DBR B;  3J9C A;  2YEP F;  3QAQ A;  3RNC C;  3HVZ A;  4RFB A;  1IUE A;  2DBY A;  5MPO A;  4C80 A;  3L4P A;  1JWU D;  1V9J A;  3DWG C;  2N7J A;  4W9L A;  2L00 B;  1FNW A;  3U52 E;  1QQR A;  2MX2 A;  4BBN C;  4FXC A;  2RMM A;  4BKS D;  4PYU A;  2V0G A;  1ZE3 D;  2INP E;  5DPS A;  3N1Y C;  2X38 A;  1Z5S B;  1JWS D;  1ET9 A;  3AEE B;  2Y3A A;  3VAW A;  2K1F A;  2JRH A;  1WR1 A;  4M01 A;  1ZP0 B;  2XBB C;  4K1R B;  3ZIM A;  1KRH A;  3KUD B;  4ZYS A;  3FC4 A;  1K50 A;  2R61 A;  1CJE A;  2SEB D;  4OVU A;  2O2V B;  4OVZ A;  3ZNI D;  2WXM A;  3WA0 A;  4PK1 A;  4GIV A;  2HTM E;  1WXM A;  2IJ0 A;  2RPQ A;  4IC7 B;  5AZH A;  5G2N A;  2XNA C;  2KFJ A;  4YSY B;  4MJS A;  2HDE A;  3NVZ A;  1WJN A;  2KQS A;  4RGO S;  1WZ0 A;  4DDI D;  2ZJD A;  3U7D A;  2ZVN A;  2Z59 B;  4DDG D;  4WWM A;  4MAC A;  1UWM A;  2D3G A;  2KC2 A;  3VUY A;  4LNI A;  4RF0 A;  2CU1 A;  2MLB A;  1R4M I;  3HM3 A;  5D6J B;  3EFC A;  1R4N B;  2WXQ A;  1UH6 A;  2KZR A;  3BIN A;  1UGM A;  4K7W A;  2K8C A;  2JYE A;  3IFW B;  4ZHO A;  1GB4 A;  2DWQ A;  2L3Z A;  1LQB A;  3I3T B;  4FJY A;  3V6C B;  4KZC A;  2IY1 B;  1WGH A;  1EU3 A;  4EZL A;  4OZB A;  5IP4 D;  2JT4 B;  3DCG A;  2C9W B;  1FXT B;  5D3I B;  3A4R A;  2IDY A;  1WGG A;  4C7Y A;  3V3X A;  1WWT A;  3VTV A;  3EGR A;  1OEY J;  5HHD G;  3ZUN A;  1FMA D;  2MJD A;  2W55 A;  2ZW0 A;  3BWU D;  5LNK 1;  1IGD A;  1JAL A;  3ZNZ B;  3H1U A;  2LGD A;  3V6E B;  3ZXR A;  1I4H A;  1B9R A;  1AW7 A;  1EM7 A;  3DPD A;  2KDE B;  4AP4 C;  1E8Y A;  4ZOH C;  3QJZ A;  4MJS B;  2DZI A;  2N9E B;  1IYF A;  1WXQ A;  3GE3 C;  1Q5W B;  2I38 A;  3M63 B;  3PRZ A;  1RAX A;  1VJK A;  4BVU C;  1QOF A;  3NS1 A;  1PQS A;  1ZPS A;  4YSZ B;  4YT0 B;  1NEN B;  1V5T A;  1BUI C;  1E7P B;  4A9A A;  1HA5 A;  3L10 B;  1CK1 A;  1L4D B;  5HI1 A;  2MHJ A;  1J8C A;  5E6J A;  3JSV A;  1FPY A;  2WXL A;  1XF5 L;  2JWZ A;  4LJP B;  2LEK A;  2WXG A;  2KT7 A;  3DQV A;  2RDG A;  4P16 A;  2GI9 A;  1N6Z A;  4KGS A;  5FR6 A;  4GDK A;  3ZKJ C;  1TZO A;  2ZPY A;  3A1Q A;  4ZRJ A;  3UF8 A;  2CJN A;  3N3K B;  1ET6 A;  3KWV A;  3FAH A;  1WGY A;  5JHB A;  2DYB A;  5DPR A;  1SEB D;  1EF1 A;  1SSN A;  1PDX A;  1LXD A;  1OGW A;  1WM2 A;  3ZVV A;  1TKY A;  4HLE A;  2LHE A;  3GZN B;  3KYD D;  3QC8 B;  1UUP A;  5HFY A;  1NDD A;  1DYQ A;  3EUB 2;  5DPT A;  4MGY E;  1RWS A;  2NBU A;  2BYF A;  4GOC A;  5KHO A;  3EFU A;  2FE8 A;  1WXV A;  3U7Z A;  2QMT A;  4BOS C;  2WLB A;  1V49 A;  2D3A A;  4EZJ A;  2D3C A;  4G0N B;  1TKG A;  4JWS C;  3E56 A;  3EHV A;  2IPK D;  1KLU D;  2MRP A;  3BK2 A;  3PHW B;  3BYY B;  1HZ5 A;  2V4L A;  5EE9 A;  3W1Y A;  4MDK E;  3R7R A;  1L2N A;  5LLI A;  2VH2 A;  1BML C;  5J2R A;  3AE7 B;  1TS5 A;  4I6L B;  3JSV B;  1TT5 B;  3VVW B;  4WAF A;  4BKG A;  2G3Q B;  2WDV B;  3B2F A;  1ZXH A;  5EE1 A;  2B3A A;  1XXG A;  4B0M A;  4P1B C;  3AH7 A;  2DLB A;  3B08 A;  2LZ6 A;  2MP2 A;  4GXB A;  4DQO C;  3PPA A;  5JH5 C;  4GDK B;  3EA6 A;  3PO0 A;  2K25 A;  3A1Q B;  3TL5 A;  4P7I A;  4EEW A;  3ZDT A;  4NJC A;  3NS8 A;  1L0V B;  2M4N A;  4N6E B;  3NUH B;  3NVY A;  1BXT A;  3WAP A;  2KXJ A;  1E9M A;  4W9J A;  2UU7 A;  2FAZ A;  1WE6 A;  4HCN B;  4DWF A;  4FUL A;  2WS3 B;  3ZJT A;  2DAJ A;  1EUV B;  1VZ6 A;  2A4Z A;  5DPW A;  1MVK A;  2PVG C;  2KNB A;  5BMI A;  1E5W A;  2GRI A;  3ZTD A;  1WYG A;  3HRD D;  1E8Z A;  2KDF B;  2FCS A;  1TS2 A;  2KQ4 X;  2MH7 A;  1V1P A;  3I5J C;  4OZA A;  1JQ4 A;  4WWO A;  2BPS A;  1CQV A;  1PGB A;  1FM0 D;  3NVW A;  4XWT A;  2PIA A;  2FCQ A;  3Q3J A;  4EUT A;  5IN7 A;  4A90 A;  4BAX A;  1PUT A;  4OW0 A;  3OG5 A;  2PPH A;  1WM3 A;  4F8C B;  3W1S A;  5EDS A;  3KYC D;  3RNA C;  4G3X B;  2MP2 B;  4ZRK A;  4BKT A;  2MJE A;  1I7H A;  2KVR A;  3QAR A;  1I35 A;  4KV2 A;  3VTW A;  3Q3N C;  2WXK A;  4JPS A;  4A55 A;  2GLS A;  1MJD A;  3VQI A;  3LDZ E;  3PZ7 A;  2J0J A;  4PS7 A;  3W5V B;  3Q69 A;  3W1S C;  4AJW A;  3K9P B;  4NZL B;  2C7N B;  2IO3 B;  5AZG A;  1HEZ E;  3BY4 B;  2WP9 B;  3R2I A;  5AEK B;  2ZW1 A;  2EMS A;  3QWZ B;  2W9N A;  2LAS A;  2AQ1 B;  1QT9 A;  2M8S A;  5KHQ A;  1R4M B;  3IAM 1;  2J0K A;  1L6V A;  2FCN A;  4FJZ A;  3PLU A;  3ZDM C;  2PE6 B;  4XYC A;  3OAW A;  1JRU A;  2Y5P A;  3A33 B;  1T0Q C;  1ZDX A;  2W3R A;  1V1P B;  3X23 A;  1NBF C;  1Q10 A;  2JXX A;  1DGJ A;  3ECI A;  1JRO A;  2AYO B;  1XLQ A;  4IM0 A;  3AUL A;  2HD5 B;  4HXD A;  1LM8 B;  3R7Q A;  1KTK A;  2C7M B;  2J42 A;  3ZRC A;  3S2A A;  1KOT A;  1V8C A;  2KAC A;  2NMQ A;  3T3N A;  4KIK A;  3BVM A;  3RUI B;  1J7C A;  1ZW7 A;  1NVI D;  5G5H A;  3RFZ B;  4HRO A;  3UQB A;  1P7F A;  1WZ3 A;  3VUW A;  3AE9 B;  3L17 A;  1YQB A;  2DYM A;  1KLG D;  2L0F A;  3BVG A;  1NEK B;  2MJ3 A;  3MC0 B;  1YQ3 B;  3DDC B;  2N9X A;  4HPP A;  2CHW A;  3FIL A;  1UEL A;  2QSD A;  3P42 A;  1K8R B;  4W9C A;  1C76 A;  3KQ4 A;  1L0X B;  5E6N A;  4ANW A;  3U8Z A;  4K7S A;  4M8N A;  2JYT A;  1WGR A;  3WCQ A;  1FIQ A;  3P2B A;  2CS4 A;  5D3D A;  1TZ1 A;  3RNE C;  2ONQ A;  2OJW A;  2ICI A;  3T8M A;  2IY0 B;  3W2D A;  5IO9 A;  4WIP A;  2PE9 A;  2IYD B;  2DAF A;  4MEM A;  2BS2 B;  4ARC A;  3NHE B;  1WIA A;  4W9H A;  3B1L X;  2KD0 A;  5EE0 A;  3BZD B;  1JW9 D;  1LO5 D;  1XEE A;  3MJ5 A;  2PJH A;  1HE8 A;  4KIK B;  1PFD A;  2YVC A;  1PGA A;  1WRI A;  5L83 A;  4L2Y A;  2MBH A;  3ML9 A;  1WGD A;  4L1B A;  3P4P B;  3SHQ A;  4HCP B;  4HVB A;  1E0Z A;  1D5X C;  2SAK A;  3WAM A;  2J4X A;  2ACZ B;  1V81 A;  4MSQ B;  3DVG Y;  2RD0 A;  4KKJ A;  1VLB A;  1RFK A;  1NYR A;  3FIL B;  2L83 A;  2LGY A;  1ZKH A;  5C2T B;  3LJ3 A;  4RMA A;  3ETR A;  5FR3 A;  1YN4 A;  1ZGU B;  1J0G A;  5H92 C;  3RYT A;  2GB1 A;  2G4S A;  1E7U A;  2L7R A;  4IW0 A;  1P7E A;  4DXA B;  1DOI A;  2WNM A;  2BWF A;  2LVQ A;  2G9H D;  4J6I A;  3LXF A;  2BTE A;  2LWP A;  3CIR B;  4WUR A;  2OJR A;  3I63 C;  3QCA A;  2WX0 A;  3DVN U;  3Q8C A;  1VR9 A;  2BYV E;  1FRD A;  4WJN A;  4CO7 A;  1FNV A;  4XC2 A;  3RUL A;  5BYQ A;  3ALB A;  3RD2 A;  2FID A;  2G45 B;  3UI3 A;  4DHZ B;  1VD2 A;  2WXH A;  4XX5 A;  2WHI A;  1GPX A;  2X8X X;  1F1H A;  3OLM D;  4LTU A;  1E8X A;  2UYZ B;  2GBN A;  1MHX A;  1QF6 A;  4LNO A;  1SBB B;  2OOB B;  3AE3 B;  5H8Y E;  3TEZ A;  4TUU A;  3WIM A;  4OVV A;  4LNN A;  4M00 A;  1JRP A;  1S3S G;  3DBS A;  3IT4 B;  2JY6 A;  4DBG A;  1H4R A;  3TEY A;  3DOW A;  3MTN B;  1TGZ B;  2KWD A;  1AYF A;  3R8B A;  2NTT A;  4FLH A;  1KLV A;  4URK A;  3Q3F A;  1XLN A;  2C60 A;  4C00 A;  3AMZ A;  3I9V 1;  1I42 A;  1WSP A;  3C8Y A;  1EWC A;  1GNU A; 
#chains in the Genus database with same CATH homology
 2BYT A;  4N59 A;  1CZP A;  2CJN A;  1FEH A;  5BMG A;  1ET6 A;  3AE1 B;  4RGM A;  3ZJU A;  3KWV A;  2L1A A;  3FAH A;  2FBW B;  1EU4 A;  3AE4 B;  3AEA B;  4P6V F;  1M4V A;  4H2A A;  1SEB D;  1QOA A;  2PVO D;  1ROE A;  1SSN A;  1PDX A;  1EWY C;  1TJE A;  4WH4 A;  2BB5 A;  2K22 A;  2Z8L A;  4O1N A;  2KMM A;  3T3O A;  3VRA B;  2K5P A;  4RGN A;  2V4I B;  2QEJ C;  3TUO A;  1KH0 A;  1TKY A;  2LHE A;  3SFD B;  1XCQ L;  2WXN A;  1UUP A;  5HFY A;  4TQ0 A;  1DYQ A;  3EUB 2;  4USA A;  1SE2 A;  1RWS A;  4PT5 A;  2INN E;  2FE8 A;  3P63 A;  3U7Z A;  2LJI A;  1FXA A;  1YNT E;  2QMT A;  4IOI E;  2WLB A;  4HEA 1;  2JZP A;  1L5P A;  5EE3 A;  1T6B X;  1IBX B;  1TKG A;  2J53 A;  4JWS C;  1UNS A;  3E56 A;  2IPK D;  2V3P A;  1KLU D;  3BK2 A;  1SB3 C;  3U4E G;  3BYY B;  1HQR D;  1HZ5 A;  5EE9 A;  2KAJ A;  2W3S A;  2WXO A;  3Q8B A;  1D6E C;  1N5X A;  2VZK D;  1L0Y B;  1BML C;  2D5G A;  5JXV A;  3AE6 B;  1ESF A;  3AE7 B;  4DXF A;  1TS5 A;  1F77 A;  4WAF A;  1JWB D;  1YN3 A;  3PZ8 A;  1SIJ A;  1RM6 C;  2WDV B;  1K51 A;  3B2F A;  2BS3 B;  4YSX B;  1ZXH A;  3SFE B;  5EE1 A;  1XXG A;  1K52 A;  4B0M A;  3AH7 A;  2DLB A;  2VZK B;  4IKG A;  3P1M A;  1D4B A;  1MI0 A;  4XWW A;  4DQO C;  1YJJ A;  1NYQ A;  4Q2J A;  1SE3 A;  3R2T A;  4GDK B;  3EA6 A;  3PO0 A;  1F2R C;  1F0Z A;  2FUG 1;  2LHD A;  4NJC A;  1C4C A;  1L0V B;  1FRR A;  1FCC C;  1TYG B;  4N6E B;  1WGK A;  3NUH B;  3NVY A;  5BYR A;  1SXT A;  2M0A A;  3URY A;  1BXT A;  2E6X A;  1GOZ A;  4RGT A;  4J3O D;  1E9M A;  1OQQ A;  1ZDV A;  3BYT B;  2J52 A;  1VZ8 A;  2N9K A;  2WS3 B;  3ZJT A;  1IGC A;  1MHH E;  3AV8 A;  2JU6 X;  2E3T A;  1VZ6 A;  3CWI A;  4N58 A;  3TEW A;  1MVK A;  2PVG C;  4HKQ A;  4R3D A;  1N60 A;  5BMI A;  1DOX A;  3I57 A;  3Q8F A;  1JCK B;  3TEX A;  2GRI A;  1HXY D;  2PTL A;  1XLO A;  4UDU C;  1FD6 A;  1WYG A;  1QOB A;  3HRD D;  2W54 A;  1TS2 A;  2KQ4 X;  2MH7 A;  1V1P A;  3IT6 B;  2K3U A;  4OZA A;  1JQ4 A;  2LFI A;  2W82 A;  1CQV A;  1PGB A;  3MP9 A;  4ZHP A;  1K53 A;  1FM0 D;  2XN9 C;  3NVW A;  4XWT A;  2PIA A;  2WXR A;  2WXI A;  3P4S B;  2QIL A;  2RDH A;  4IDI A;  4A90 A;  1J7A A;  1FFV A;  4MM3 B;  1PUT A;  3AE2 B;  4OW0 A;  2AX5 A;  4CQN A;  4ITK A;  1I4G A;  3W1S A;  2WU2 B;  3AEB B;  2BT6 A;  3V05 A;  1TY0 A;  3O13 A;  1DOY A;  3AE5 B;  4KX6 B;  1ACC A;  1C77 A;  2MJE A;  3H8H A;  2ON8 A;  1I7H A;  1ZXI A;  1D5M C;  1R7S A;  5AUI A;  3AE8 B;  2K0P A;  5BMH A;  1N61 A;  2M19 A;  4RCO A;  3N9Y C;  1NI3 A;  2WXK A;  3E9S A;  4JPS A;  2L52 A;  1XO3 A;  5AUK A;  2L32 A;  2QJL A;  4A55 A;  3VR9 B;  3MHZ A;  3U2S C;  4YWG G;  4EE2 A;  3VQI A;  3AB5 A;  1JWM D;  3PZ7 A;  4A6Q A;  3ZJV A;  2K9X A;  3W5V B;  3Q69 A;  4DXG A;  1STE A;  4OHJ A;  3P4Q B;  3ZQ4 A;  1AN8 A;  2BW2 A;  4NZL B;  5GXG B;  3AM9 A;  1HEZ E;  1L6U A;  2WP9 B;  1FCL A;  3R2I A;  2H88 B;  2ZW1 A;  3BVZ A;  3Q8E A;  2AQ1 B;  1Y56 A;  1QT9 A;  4RNA A;  5G5G A;  2JXT A;  1C9F A;  3IAM 1;  1L6V A;  3NRZ A;  2IGH A;  2CJO A;  1KFY B;  1L4Z B;  4B0E A;  3VR8 B;  2EEL A;  1J7B A;  1A70 A;  3LYY A;  1SF0 A;  4JWU C;  2OHF A;  2Y5P A;  2BB6 A;  1GB1 A;  1YQ4 B;  2MEK A;  3B2G A;  1ZDX A;  1ZUD 2;  2W3R A;  3IAS 1;  2JSV X;  1V1P B;  1ENF A;  1Q10 A;  1DGJ A;  2DYO A;  1JRO A;  1XLQ A;  3AEG B;  2TSS A;  2IGD A;  2M56 B;  1XCT L;  1FFU A;  5T8I A;  4ARI A;  3J9C A;  2YEP F;  1KTK A;  2J42 A;  3HVZ A;  4RFB A;  1V8C A;  1IUE A;  2DBY A;  5MPO A;  4TQ1 A;  3L4P A;  4C80 A;  1JWU D;  1YMH E;  2KAC A;  2NMQ A;  3T3N A;  4D2K A;  3BVM A;  1JWA D;  3DWG C;  1KF6 B;  1VRA B;  1JML A;  1J7C A;  2N7J A;  4MH8 A;  4YTN B;  1NVI D;  2KDM A;  5G5H A;  3RFZ B;  4HRO A;  4AQ7 A;  1FNW A;  3U52 E;  1SJH D;  1P7F A;  3HUI A;  2BBC A;  1E6E B;  1QQR A;  4ZRP A;  5TSS A;  3AE9 B;  4FXC A;  2JQR B;  2RMM A;  4HRS A;  2V0G A;  4A8X C;  1ZE3 D;  2INP E;  2DYM A;  2X38 A;  5BYS A;  1KLG D;  1JWS D;  3BVG A;  1VZ7 A;  1ET9 A;  3AEE B;  1NEK B;  3SR6 A;  2MJ3 A;  1HZ6 A;  2Y3A A;  3MC0 B;  1YQ3 B;  1F2R I;  3AEF B;  1N62 A;  1ZP0 B;  4RF1 A;  3W9C B;  1N5W A;  1C4A A;  3FIL A;  1KRH A;  2QSD A;  1V1O A;  1N63 A;  2LUM A;  4ZYS A;  3P42 A;  3FC4 A;  3GP7 A;  1E10 A;  1K50 A;  3KLS X;  2R61 A;  1C76 A;  1UGJ A;  1CJE A;  2SEB D;  1QOG A;  4REZ A;  3KQ4 A;  4C56 C;  1L0X B;  4OVZ A;  2WXM A;  2HTM E;  1ZOY B;  2CU3 A;  1PYW D;  2JYT A;  2IJ0 A;  4WQM A;  3WCQ A;  2PLP A;  2KN4 A;  5D7G A;  1FIQ A;  2XNA C;  5D3D A;  1I4P A;  4C7Z A;  4YSY B;  1T3Q A;  2ONQ A;  2HDE A;  3IXS A;  1FXI A;  1I4X A;  3NVZ A;  3VRB B;  4RGO S;  2ICI A;  5HG2 A;  1YJI A;  4US9 A;  4YTP B;  3W2D A;  4WIP A;  3AN1 A;  1TS3 A;  4XDD A;  5FK9 C;  2BS2 B;  4ARC A;  4WWM A;  4MAC A;  3SEB A;  2N0S B;  1UWM A;  5EE0 A;  3BZD B;  1JW9 D;  1LO5 D;  1XEE A;  4XE0 A;  4RF0 A;  3MJ5 A;  4JX1 C;  4RH6 A;  1C4P A;  2RPV A;  4KGR A;  2N9L A;  1PFD A;  3KWL A;  2WXQ A;  1PGA A;  1WRI A;  4KGT A;  4L2Y A;  2JYE A;  4NAW B;  3DWM A;  2JX5 A;  2JWU A;  4L1B A;  2H89 B;  2PKO A;  3P4P B;  4ZHO A;  1GB4 A;  2DWQ A;  1E0Z A;  1D5X C;  1TKE A;  2SAK A;  3Q8A A;  1I4Q A;  3LB8 C;  3P4R B;  1EU3 A;  2EKI A;  2J4X A;  3NVV A;  4OZB A;  2NTS A;  2ACZ B;  2WDR B;  2OED A;  1XLP A;  2Q5W D;  4KKJ A;  5D3I B;  1VLB A;  1QIL A;  1RFK A;  2IDY A;  2BS4 B;  1NYR A;  3FIL B;  4C7Y A;  2L83 A;  4US8 A;  3V3X A;  5C2T B;  1SJE D;  1WWT A;  3TSS A;  2QIE B;  3AEC B;  1QKZ A;  2WXF A;  3EGR A;  5HHD G;  3ETR A;  1SE4 A;  3OWE B;  4MT5 A;  1FMA D;  2MJD A;  5FKA C;  1GAQ B;  2W55 A;  4OZC A;  2ZW0 A;  3ABV B;  3BWU D;  5FR3 A;  1YN4 A;  5LNK 1;  1IGD A;  3BII D;  1JAL A;  2AQ3 B;  2B76 B;  3AED B;  3B9J A;  4GDL B;  2GB1 A;  5H92 C;  2I2Y A;  3NZ3 A;  1FNU A;  4M0W A;  2G1E A;  1VDV A;  1C79 A;  1V97 A;  1D5Z C;  1I4H A;  4XDC A;  3ZGZ A;  4TSS A;  1B9R A;  4HKZ E;  1AW7 A;  3ZYY X;  1P7E A;  1FO4 A;  1DOI A;  1EM7 A;  3W5U B;  2WNM A;  4ZOH C;  2YEP B;  2G9H D;  2BTE A;  3LXF A;  4YTM B;  4L23 A;  1WXQ A;  3CIR B;  2WQY B;  2LMC A;  2WXP A;  4WUR A;  2LGI A;  2I38 A;  4TMA B;  3MFG A;  1VJK A;  4NAM A;  3GS2 A;  3Q8C A;  1QOF A;  1VR9 A;  3NS1 A;  4LLG M;  2Y5C A;  1TS4 A;  1FRD A;  2WU5 B;  1ZPS A;  3BK1 A;  4YSZ B;  1FNV A;  4YT0 B;  1NEN B;  5BYQ A;  1OQR A;  1BUI C;  1E7P B;  1TY2 A;  3UI3 A;  4A9A A;  1HA5 A;  4HJG E;  2WXH A;  3RPF C;  1PGX A;  1IBX A;  1GPX A;  1CK1 A;  1QLB B;  1L4D B;  5HI1 A;  4JE3 B;  2WXJ A;  1AWD A;  4LTU A;  1T5X D;  1QF6 A;  1I4R A;  1MHX A;  1SBB B;  5E6J A;  3AE3 B;  5H8Y E;  3TEZ A;  2PMV A;  2IGG A;  1RYJ A;  1MPE A;  2WDQ B;  2WXL A;  1XF5 L;  4LK0 M;  1OFF A;  1JRP A;  4ZRQ A;  3IT4 B;  4YXD B;  3GB1 A;  2LEK A;  4GLS C;  3TEY A;  2AQ2 B;  2WXG A;  1C78 A;  2KWD A;  1AYF A;  3R8B A;  1YN5 A;  2NTT A;  3HVD A;  2RDG A;  1UWX A;  4P16 A;  2V3N A;  1B1Z A;  1XLN A;  2GI9 A;  4KGS A;  4KKI A;  2PW9 A;  3AMZ A;  3I9V 1;  1WSP A;  3C8Y A;  4AS1 A;  5C3J B;  5I4D A;  1EWC A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...