1OEYA

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
GSHMAYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyA00
2OJRA 3EFUA 4BKSA 3CSTA 1AARA 3GOEA 2PEAA 3N32A 4HDOA 1WMHB 2KX3A 3UINB 4CO7A 1M94A 1ZW7A 4WWOA 4K7UA 1XD3B 3TBLD 5G2NA 1EO6A 1TZ1A 2HE7A 5DCNA 4KZCA 4F8CB 3VUYA 4MH0E 1LM8B 3H7PB 4EFOA 3IG3A 3ZNHB 2CR5A 1WJ4A 2M17A 4LJOB 2MP2A 4E3CA 5CHWA 2IY1B 5JZEB 1BT0A 2ASQA 4MGYE 3U8ZA 2LVOA 2R2QA 3NHEB 4LJPB 4ZYNA 4EZLA 2O2VB 1OTRB 2A5UA 3NOBA 1WR1A 1P3QU 2Z59B 2CU1A 2IO0B 3L10B 3RYTA 2Z0DB 3VVWB 4EZJA 4FADA 4GXBA 2LZ6A 1J19A 2I1KA 3TMPB 3ZDTA 2KC2A 5IA7A 1ISNA 4MJSA 3NS8A 4JL9A 2KJRA 3RZFA 2GOWA 4FHJA 1WX8A 2BPSA 2K25A 2NPTB 1KLVA 3H7SA 1WJ6A 4KVGB 3QCAA 1IP9A 2D07B 3ENEA 4G3XB 1L2NA 2LRUA 4TV3A 4KSKC 3PV1A 4KV2A 3UGBB 1OEYA 3PS6A 3VUWA 2ZCCA 4NQLB 4W9EA 3T8MA 4BVUC 3D32A 2JZ3B 5AZFA 2D3GA 5FR6A 1WY8A 1WJUA 2REXA 2DYBA 2W9NA 1QZEA 2KNBA 1WXMA 1WIAA 2MP2B 2L7RA 4WWNA 4HPMB 3LDZE 4GIVA 5CTRC 2KWUB 1LFDA 2UYZB 1T0YA 2KQSA 3GZNI 1V2YA 4DHZE 3M3JA 1ZKHA 4G50A 2M8SA 2K6QA 2DZMA 2DENB 2MLBA 3RCZA 4BKTA 2I1JA 4HCNB 3EECA 4ZRJA 5D2MB 2G3QB 1RRBA 2FAZA 1WE7A 2N4FA 4HLEA 3KUCB 4WAAA 4MJSB 3OJ4B 4NJ7A 3QX1A 3PHWB 2NVUI 2XEWA 3PREA 3NY5A 4J6IA 2N7DA 4PYUA 2KN5A 4W9KA 3X0WA 4KZ0A 2JRIB 5E6PA 1ZGUB 2JWZA 1E5WA 2KDBA 2L00B 2PPHA 3QK0A 1V5OA 2G4SA 4GDLA 2IO3B 4LDTB 2GBJA 2DZJA 1GG3A 4MEMA 1KJTA 1WMHA 4GDKA 4NPNA 4X57B 1E7UA 1A5RA 3L16A 3VHTC 4PYZA 4ANXA 3PPAA 3ML9A 3DPDA 4BKSD 2KDEB 3H1UA 5C23A 4BBNC 2ZPNA 1WJNA 5D6JB 4YL8A 1IYFA 4OVUA 3KUZA 2CHWA 4KSLC 3RULA 2FCNA 3HK0A 3KH0A 2JVCA 4TQ0A 4TKNA 4F7ZA 1YJ1A 2CHXA 2RPQA 2BWES 3TIXA 3WALA 2O2VA 4E71A 4ASWC 2DYOA 2GMIC 2KQ7A 1EF5A 4FULA 2FCMA 3IFWB 1R4NI 3R7RA 3PGEA 1YX6B 5AZHA 4NNJB 3W1SA 2ZCBA 1UELA 4K7SA 5D7GA 2M0XA 2WWZA 3ZNID 2KD0A 2AEHA 3PHXB 3PRZA 2MRPA 3ZRCA 3VTVA 2C7NB 3QWZB 1YX5B 5JHBA 2LXAA 4GMVA 4B9KA 1E8ZA 2KDIA 3M63B 4F1SA 2MW5A 4GDLB 1FXTB 4AUQC 1EF1A 4ANVA 3QQ8B 3WIMA 2EKEC 1P9DU 2G45B 4GDKB 2HD5B 5AZGA 3ZNGC 1SE9A 4JQWC 1VD2A 3ZTCA 2A4ZA 4HJKA 4HWIB 5E6NA 5DPWA 2MX2A 3QJZA 4IM2A 2JY6A 4DBGA 1Y8RC 2LWPA 3ALBA 1S1QB 4KDIC 4JLCA 4RM8A 2KTRA 2DZKA 2JPHA 5L95C 5GMVA 2KLCA 4LDTD 4AJYB 5L83A 1OGWA 3CF6E 1NDDA 1WM2A 4ICUA 2MCNB 2DZIA 3DVGY 2GBKA 3APCA 3MJWA 1V49A 2KWVB 1OEYJ 3SD5A 4BFRA 5EDSA 2L0FA 3L17A 3KVFB 1GNUA 2CKHB 2JF5A 3JSVB 1E7VA 2C9WB 4ANUA 1V6EA 2FIFA 4WJNA 1NI2A 2BKFA 1D3ZA 3QARA 3EHVA 4FLHA 2FNJB 3V6CB 4XX5A 3NZSA 2VRRB 2L8JA 2N7EA 2MQJA 2D10A 4HPLB 4EUTA 2BKRB 4XZ4A 3HM3A 4KIKA 2KK8A 2FIDA 2CS4A 2KJ6A 4MGZE 3TL5A 2LVQA 3VH4B 3C0RB 2FCSA 2KTFA 3W1SC 1SIFA 4EKUA 4EOYA 4IG7B 4NJ6A 2IO1B 3IBEA 3LJ3A 4GB9A 2JUOA 3M62B 4HVBA 3AU5A 3DVNV 4HXDA 2BWFA 2K39A 4DDGD 1UD7A 1NBFC 1MG8A 2J0MA 2ZVOA 1E8YA 1UBIA 4LCDE 3UQBA 5JH5C 2K8BA 1XQQA 4RMAA 2KTRB 1F9JA 2O6VA 4RM9A 4W9LA 2M1MA 2BF8B 2KO3A 2KVRA 3ZNZB 4IWOA 1WGYA 2B3AA 2MA9B 3WA0A 4B6WA 1J8CA 4GN1A 2Z0EB 3HM6X 3UQAA 3ONSA 4KDLB 2BYEA 2XBBC 1UH6A 4BKGA 4DK5A 1C3TA 2MBHA 1WZ3A 2KJHB 3DOWA 2KKCA 3ZW3A 2C60A 3IHPC 2L3ZA 2ZVNA 4GSWA 1RLFA 4HDQA 4KIKB 3S2AA 4WWPA 2MBOA 2C5LC 1V81A 2LJ5A 2OOBB 3T9LA 4CHKA 2WDTB 4W9CA 3H6NA 4N9F4 2KFJA 3SU8X 1WM3A 2JXXA 1WX7A 1X1MA 2K8HA 3HHMA 2PE9A 4GGQA 4W9IA 3R3MA 2D11A 2RD0A 3VTUA 2LXCA 2KFKA 2YVCA 5KHQA 5DPTA 3X23A 4MSMB 3PLVA 2JZZA 2AYOB 2EMSA 1JRUA 4M8NA 4MGIE 1WGRA 4W9GA 4NQKE 3WANA 2RSUA 2WX1A 4GU2A 4MELA 2ZPYA 5LXHA 4BOZB 2N9XA 2O6VB 3NZUA 2BGFA 1UZXB 4XC2A 1I35A 2HTHA 3DDCB 1OQYA 3PLUA 1E8WA 4WJPA 2C7MB 3A9KA 4FBJB 3PSEB 2LRWA 2MBEA 2LD9A 1Z5SB 3PVLA 1YD8U 3IVFA 2WYQA 3DCGA 5BO4B 1GC6A 3VH3B 2N1WA 3JSVA 4EZKA 2KMAA 3I3TB 1WGDA 1TGZB 3PT2B 1J0GA 2L76A 2AL3A 3B1LX 5LLIA 1RFAA 3B0AA 4WJQA 4FA6A 3KUDB 2IYDB 2RGFA 4PS3A 2KX0A 5DPRA 3ZKJC 4PS8A 4CYEA 2MWSB 5CHFA 2BYFA 4URKA 3OAWA 3A4RA 1LQBA 2G4DB 1P1AA 2QHOA 3ECIA 1WE6A 2KC1A 1UGMA 1K8RB 3U7DA 4AOFA 3N30A 1HE8A 3WAOA 1UBQA 2KFKB 2DAFA 3K9OB 4A20A 1Q0WB 1S3SG 5AEKB 4JIOU 2KDFB 3BINA 2L05A 1Q5WB 3V61A 3VFKA 3VQIA 1I42A 2LGDA 4NAWA 2DHZA 2KLGA 3ZUNA 4M0WB 5JHAA 3A1QB 2LI5A 3TCAA 2BYVE 4W9JA 3PRPB 2PJHA 2FUHB 4TQ1A 3A9KB 2C7HA 4E74A 1WYWB 1WI0A 3L13A 3KW5B 4A3OA 1CMXB 1P98A 2NBUA 3MHSD 4DDID 1E8XA 3PTFC 4DWFA 3B08A 3QIJA 1YIWA 3UF8A 3Q3FA 2ZNVB 3PRMB 2L0TA 5CX3A 3DVGX 1RAXA 2KZRA 2O6VD 3ML8A 3PZDA 2N1VA 4G0NB 1GUAB 2IZVB 2LGXA 2IBIB 3QC8B 1H8CA 1WFYA 4II2B 3ZDMC 2ZNVC 3VUXA 3QAQA 2IY0B 1EUVB 2IO2B 4ICVA 1R4MI 1WZ0A 3R7QA 2K8CA 4HCPB 1V5TA 4P7IA 3DQVA 3HIZA 2CHZA 3QHTA 3SHQA 4PS7A 4AWJA 5J17A 3U30A 4K81A 3DBRI 2MBBB 3JW0X 4I6LB 5LXIB 3W1YA 3APFA 1Z2MA 3UIOB 3L08A 3O65B 4IWQA 4FJYA 2AWTA 4BOSC 3ZRFA 5E6OA 2V3SA 1YQBA 4NAWB 3CSFA 1LXDA 3AULA 4IM0A 2R2OA 4DHJB 1Q1OA 4B95A 3RT3B 4A3PA 2XK5A 3JYUA 3P2BA 3ZTDA 1KOTA 2JRHA 2EMTA 3KYDD 4IM3A 3VDZA 2MBQA 2ZEQA 4G11A 2DAJA 1V86A 2NBVB 4AJWA 1GC7A 2V1YA 1WF9A 2N9PC 3AI5A 1E90A 4IWPA 4II3B 2KANA 4IW0A 2PE6B 3VTWA 4HK2A 3SDLC 4ZRIA 3JVZX 5J18A 3DVNU 1L7YA 3WAPA 2GBNA 2NBWB 4GOCA 1GJZA 2ZZPB 3Q3JA 3AXCA 2J0JA 2LUEA 2FCQA 3V60A 3ZVVA 1H4RA 2J0KA 2KHWB 3MTNB 3A9JA 3A33B 1KM7A 3K9PB 4IC7B 2KXJA 3M95A 1WGGA 3BY4B 4W9FA 3ZIMA 4ZDVA 3DBSA 4I6PA 3V62A 3AU4A 5D94A 2HJ8A 3QA8A 1P0RA 3CMMB 2GBRA 4OVVA 4FHKA 2K1FA 4DXAB 1G6JA 3H9DA 5TR5A 4ZRKA 3WAMA 1SGHA 2NS5A 2YLMA 3A1QA 2XK5B 1C1YB 4MDKE 4M8MA 2ZJDA 3APDA 3RZWC 4NY0A 3VAWA 1V9JA 2K6DB 2NR2A 1WGHA 2DX5B 3A4SC 2GBMA 5CHVC 3R66C 4W9HA 1VCBA 2KWCA 3OLMD 4FJZA 2LASA 3UIPB 4DHJD 4BBNF 1XT9B 4JGHB 4FN2A 1WXSA 3KYCD 1PQSA 4I6NB 2NCNA 3ZO5B 1U4AA 3N3KB 3L0WB 2AL6A 2Y5BB 3H7PA 4K7WA 2UWQA 1WXAA 1V80A 3ZLZA 4DHZB 3L54A 5G55A 5J2RA 3RUIB 2RR9A 2V4LA 1WR6E 2M4NA 3EC8A 4FJVB 1TBEA 3A9JB 4IUMB 4WJOA 4WQOB 3VXWA 2KOXA 2LVPA 4MGKE 3RD2A 3TJPA 1WX9A 2D2QA 1TTNA 2DYMA 5KHOA 4ANWA 2JT4B 3V6EB 2WX0A 4K1RB 1IPGA 1WXVA 5HKHA 2N9EB 2LGYA 4MSQB 5DPSA 4EEWA 5IAAC 2KMCA 4AP4C 3OJ3A 2MSED 1WH3A 2J7QB 3DBHI 4W9DA 4MM3A 1WRDB 2NPTA 3DBLI 4TUUA 5C1ZA
chains in the Genus database with same CATH superfamily
4BKSA 5IP4D 3ETRA 3N32A 2J42A 1JWMD 4CO7A 4TSSA 3TBLD 5G2NA 2K3UA 2PIAA 4KZCA 4F8CB 3VUYA 2QCZA 2CR5A 3AEGB 5CHWA 3U4EG 2IY1B 4K3CA 1NENB 3B2GA 3NHEB 1D5ZC 3AE5B 1OTRB 3NOBA 2Z59B 1DGJA 3AEFB 2Z0DB 4FADA 2LZ6A 1T0SC 3TMPB 1DOYA 1YJIA 2LFIA 4MM3B 3TEXA 1WX8A 1KLVA 2K25A 1I4HA 1WJ6A 3QCAA 1TT5B 4G3XB 1L2NA 3RNBC 1F77A 3DBHB 2M0AA 1M4VA 1JROA 2ZCCA 4WURA 1V1PA 3AM9A 1N62A 2REXA 2W9NA 2KNBA 2QC8A 1HXYD 2MP2B 1E0ZA 4LK0M 4C7YA 5HFYA 3LDZE 4GIVA 5CTRC 2SEBD 4YTMB 3GZNI 1V97A 3M3JA 1IGDA 1ZKHA 2M8SA 2WU2B 3RCZA 4BKTA 4XYCA 3RPFC 3LXFA 3IT6B 4RGNA 4XDDA 1WE7A 2JQRB 2K0PA 3OJ4B 3QX1A 3PHWB 2XEWA 2W82A 3RNGC 3NY5A 2N7DA 4PYUA 4W9KA 3X0WA 2L83A 4KZ0A 3N1XC 1E5WA 2IO3B 1GG3A 4JX1C 1E7UA 4AS1A 3L16A 3HVZA 3AE4B 1UWMA 4RGOS 3MJ5A 5C23A 4A90A 3HK0A 1BXTA 4TKNA 1NI3A 2KQ7A 4FULA 3AB5A 4WH4A 2PMVA 2ZCBA 2WWZA 1XLPA 2KD0A 1FNWA 2QJLA 2MRPA 2I2YA 1YX5B 4GMVA 1E8ZA 1Y56A 5T8IA 3VR9B 1FXTB 1STEA 1TKYA 2EKEC 2G45B 4GDKB 4HPPA 4HKZE 4JQWC 1J7CA 1GB4A 3Q2AC 1ZOYB 3BZDB 4HWIB 3DWGC 2JY6A 4DBGA 1Y8RC 1VR9A 1UGJA 3Q8AA 3GB1A 3Q69A 1OGWA 2MCNB 2DZIA 3MJWA 4BFRA 4TMAB 2E3TA 3NVYA 3Q6BA 4IKGA 4WJNA 5FKAC 3AN1A 1D3ZA 3EHVA 3V6CB 3NZSA 2VRRB 2L8JA 2N7EA 4HPLB 4EUTA 4XZ4A 1R4NB 1HQRD 2KJ6A 3EFCA 3C0RB 3Q3OC 4US8A 2BVCA 2JUOA 3AU5A 3DVNV 2KWDA 2BWFA 1UD7A 2ZVOA 3HUIA 5JH5C 2BTEA 1VRAB 4W9LA 2KMMA 3ZNZB 2JU6X 1J8CA 4GN1A 2Z0EB 1SE2A 2JX5A 1SIJA 4BKGA 1C3TA 1YN4A 5FK9C 3IHPC 2WHIA 4KIKB 1VZ8A 3BK2A 2MBOA 2GRIA 1V81A 2OOBB 3RNCC 3SU8X 1MJDA 1WX7A 2W55A 2K8HA 4RFBA 1XLNA 2D11A 3UI3A 1WSPA 3PLVA 2EMSA 4MGIE 3WANA 5LXHA 1N61A 1R7SA 2KT7A 4YTNB 3DHGC 1UZXB 1I35A 3U2SC 1OQYA 1FMAD 1E8WA 3PSEB 2CJOA 4C7ZA 3TEWA 3MC9A 1SB3C 1IBXB 1Z5SB 1D4BA 4XWWA 3IVFA 2Y5CA 5BO4B 4EZKA 2N1WA 2KMAA 4RF1A 1TGZB 3PT2B 3GZNB 1J0GA 2L76A 3FAHA 4KGTA 4WJQA 3IAS1 3V05A 3ZYYX 2H88B 5BMIA 1K51A 2KX0A 2MWSB 5CHFA 2BYFA 2WNMA 1P1AA 1XLQA 4S0RA 1UGMA 3N30A 2KFKB 2DAFA 2MJ3A 3VQIA 2LGDA 1SE4A 1YNTE 2KLGA 2AQ1B 2EKIA 1XLOA 2LI5A 3TCAA 3PRPB 4TQ1A 3A9KB 1F0ZA 1WYWB 1P98A 4DWFA 1TY0A 1YIWA 4ACFA 5D3DA 2L0TA 2OEDA 1RAXA 1ZPSA 1HA5A 3PZDA 4G0NB 2IZVB 2QILA 1XCTL 2LJIA 3ZDMC 2ZNVC 3VUXA 3QAQA 4MT5A 1BUIC 2D5GA 2K8CA 5J17A 3U30A 4K81A 4I6LB 3O65B 4BOSC 4NAWB 3PZ8A 1TS5A 2E6XA 3AULA 1D6EC 4C4VA 4DHJB 1FNUA 3NUHB 4A3PA 1SJED 2JRHA 2WGSA 4IM3A 1C78A 2D3BA 2MBQA 3AMZA 4G11A 3Q8BA 2IGGA 4P1CC 4AJWA 2N9PC 2K22A 1N6ZA 3AE3B 4II3B 3ZXRA 2PE6B 3W5VB 2OJWA 4WQMA 3JVZX 5J18A 3DVNU 4OW0A 1GJZA 3AXCA 1FO4A 2LUEA 2J0KA 2PTLA 3MTNB 3A9JA 1C77A 4ZHOA 1KLGD 2L52A 1WGGA 1OFFA 1P0RA 3CMMB 4FHKA 4ZRKA 1QF6A 2XK5B 3BWUD 3APDA 3VAWA 2KACA 2NR2A 1WGHA 2DX5B 5HI1A 5CHVC 4KGRA 3P63A 4BBNF 3I63C 2J52A 4FN2A 2BS3B 1PQSA 1I4XA 1U4AA 4K7WA 2ZW1A 1GAQB 2V4LA 1NVID 3EC8A 4LNOA 2D2QA 4B0MA 1UNSA 4JWSC 3BVGA 2WX0A 4K1RB 3E9SA 3AECB 4ARCA 2N9EB 2LGYA 2IPKD 5IAAC 5E6JA 1PDXA 3Q3NC 3DBHI 2J7QB 2K5PA 2Y3AA 3BYTB 5D6JB 2AQ2B 2RMMA 2V3PA 1WGKA 3N9YC 3NVWA 2KX3A 3NRZA 1ZW7A 1DYQA 1XD3B 1ESFA 2HE7A 3DHHC 1LM8B 3H7PB 2M17A 4E3CA 2J4XA 3BK1A 4MH8A 1BT0A 4MGYE 1D5MC 4EZLA 1JWAD 1NYQA 2O2VB 2V0GA 1FM0D 5HG2A 3P4QB 2KC2A 5IA7A 4MJSA 2K9XA 1OQRA 2KJRA 2GLSA 2NPTB 1IP9A 1TYGB 3UGBB 1JCKB 3DBLB 4OZAA 4W9EA 4NQLB 2YEPB 2TSSA 3D32A 2B76B 2D3GA 5FR6A 1WJUA 5FR3A 5EE1A 4RH6A 2IDYA 2L32A 1V2YA 4DHZE 2I1JA 4KKIA 2DLBA 4HCNB 2IGDA 5D2MB 2FAZA 3KUCB 4NZLB 2NVUI 1TKEA 3PREA 4J6IA 4ITKA 3N1YC 1ZGUB 2KDBA 2L00B 3ZXVA 4GDLA 4P16A 2GBJA 1JRPA 2DZJA 4MEMA 1KJTA 4X57B 1A5RA 2KAJA 1V1PB 3VHTC 3WCQA 3PPAA 4MACA 3ML9A 3AEAB 3VRAB 3PO0A 4BBNC 2ZPNA 3FKYA 3KUZA 3RULA 4KSLC 4OZBA 5IKCM 4TQ0A 3ZJTA 2BWES 3TIXA 2O2VA 1V8CA 3IFWB 1R4NI 3PGEA 5AZHA 3W1SA 2J53A 2H89B 4K7SA 3ZNID 3PRZA 1RM6C 4B9KA 4DXFA 4F1SA 4UDUC 1YQ3B 3QQ8B 3BYYB 3HRDD 2G9HD 3ZNGC 1L4ZB 1SJHD 1SE9A 1VD2A 3B9JA 3ZTCA 4GLSC 4IM2A 3ALBA 4D2KA 2KTRA 1VZ7A 1AN8A 3AE6B 5L83A 4M02A 1WM2A 3DVGY 3APCA 1V49A 2KWVB 3SD5A 5EDSA 2D3CA 3P4RB 1MFWA 1GNUA 2JF5A 3JSVB 4C56C 1E7VA 4FLHA 2FNJB 1FXIA 2BKRB 1ET6A 3HM3A 2FIDA 2MEKA 2LVQA 3V3XA 4IDIA 2QMTA 2FCSA 2KTFA 3KWVA 1SIFA 4EOYA 4ZHPA 4L1BA 4GB9A 2ZW0A 1NBFC 1FIQA 1E8YA 1UBIA 4LCDE 3UQBA 2BQQA 1XQQA 2O6VA 5HHDG 2BF8B 2KVRA 4OHJA 4IWOA 3WA0A 4B6WA 3UQAA 3ONSA 2XBBC 1L6UA 3DOWA 3ZW3A 1TJEA 4ZOHC 1FFUA 3S2AA 2C5LC 2LJ5A 4R3DA 2WDTB 3P4PB 4W9CA 3H6NA 4N9F4 2JXXA 1X1MA 1PUTA 5IOIA 4C80A 2RSUA 4MELA 2ZPYA 1N63A 4BOZB 2BGFA 3KQ4A 3DDCB 1XEEA 2Q5WD 2C7MB 1TKGA 2LRWA 1YD8U 1ZE3D 1GC6A 4HRSA 1FCLA 3JSVA 1WGDA 2AL3A 4RGMA 2WXMA 2VZKB 1GB1A 1FRRA 1B9RA 3B0AA 4FA6A 3KUDB 2IYDB 4PS3A 5DPRA 3ZKJC 4URKA 4PS8A 3A4RA 3ABVB 2KC1A 1JQ4A 1SSNA 1UWXA 3K9OB 4JIOU 5G5HA 1Q5WB 3V61A 4YWGG 1DOIA 1I42A 2BW2A 1ZP0B 2WXFA 5BYSA 1T0QC 3R8BA 2WXHA 3PZ7A 3GS2A 3L13A 4A3OA 1CMXB 4PK1A 4DDID 3MHSD 2KDMA 3B08A 3Q3FA 4XDCA 1GUAB 3I9V1 2IBIB 3QC8B 1H8CA 4QAYA 4II2B 4YTPB 2AQ3B 2IY0B 1EUVB 4ICVA 1WZ0A 1V5TA 4DXGA 4PS7A 3ZJUA 3APFA 2ICIA 3UIOB 3L08A 4FJYA 5E6OA 1QKZA 2WDRB 1AWDA 3RT3B 3P2BA 3MC8A 4JPSA 4HKQA 3RNEC 2DAJA 2NBVB 1YOVB 1GC7A 1I4QA 1WF9A 2WXKA 3J9CA 1E90A 1VLBA 4IW0A 2WDVB 3IT4B 4RGTA 5C3JB 1QT9A 4HK2A 1MG4A 3SDLC 3WAPA 2GBNA 3FILA 4RNAA 2FCQA 2KHWB 4HJGE 3K9PB 2KXJA 1R4MB 3M95A 3BY4B 4W9FA 4DXAB 4M01A 2JSVX 1XXGA 4HEA1 3DBRB 3TEYA 1YQ4B 5TR5A 3WAMA 4C4VB 2YLMA 1K53A 1TS3A 1FEHA 1VDVA 2V9HA 4CQNA 3RZWC 1V9JA 1FNVA 3A4SC 5BMHA 5H8YE 4W9HA 4FJZA 2LASA 4DHJD 3LB8C 3KYCD 4I6NB 2NCNA 2Y5BB 3ZLZA 3RFZB 1MHHE 5J2RA 2M4NA 4WJOA 3MP9A 3A9JB 3VXWA 2KOXA 3RD2A 2FBWB 1TTNA 2DYMA 1C4AA 4US9A 2WXGA 4MSQB 2KMCA 2UU7A 1WWTA 1AYFA 3AE9B 3DBLI 2OJRA 3EFUA 1QILA 2VH1A 3GOEA 1WMHB 2ONQA 1EO6A 1KH0A 5EE3A 5DCNA 4MH0E 4EFOA 1WJ4A 3RN9C 5JZEB 3U8ZA 4LJPB 5G5GA 3VVWB 4EZJA 4GXBA 1J19A 4AQ7A 1FRDA 3I5JC 3NS8A 2JYEA 3NVZA 3OWEB 2GOWA 2BPSA 1D5XC 4KVGB 4B0EA 3ENEA 2FE8A 3P4SB 4TV3A 4KSKC 2LGSA 4USAA 2BT6A 2HJ1A 4BVUC 1NEKB 3EUB2 1WY8A 2DYBA 1QZEA 1WXMA 1WIAA 2OHFA 4HPMB 2M19A 1FFVA 2RDGA 1AW7A 2UYZB 3OG5A 2K6QA 2MLBA 4K3BA 3EECA 2EELA 1RRBA 4MJSB 5C2TB 1SXTA 4LNIA 1KLUD 1CZPA 3EGRA 2KN5A 2JRIB 3RNAC 2JWZA 3QK0A 2G4SA 3AEDB 4LDTB 1J7BA 1WMHA 2DNFA 4NPNA 1ZXIA 4PYZA 4ANXA 3DPDA 4A8XC 4BKSD 1PYWD 1T5XD 4YL8A 1IYFA 4OVUA 2W3RA 2CHWA 1YJ1A 2WP9B 4LTUA 1GPXA 3WALA 2GMIC 1EF5A 2FCMA 3R7RA 4NNJB 4A6QA 2M0XA 3PHXB 2AEHA 3DWMA 3VTVA 2C7NB 4ARIA 2LXAA 1KFYB 2MW5A 4GDLB 2INDC 4ANVA 1P9DU 1K50A 2HD5B 2PVOD 1XCQL 1DOXA 3RMKC 4HJKA 1EU3A 3QJZA 4A9AA 1N5XA 2LWPA 2RDHA 1S1QB 4KDIC 2DZKA 2KLCA 3W5UB 2RPVA 2FUG1 1NDDA 2JWUA 1LO5D 1C76A 1I4RA 2QEJC 2GBKA 1FD6A 3N1ZC 2CKHB 2C9WB 2FIFA 1T0RC 1NI2A 3QARA 1A70A 1EM7A 1ZUD2 1YMHE 2MQJA 2D10A 2KK8A 2CS4A 4MGZE 2BBCA 4NJ6A 2IO1B 3IBEA 3LJ3A 3N20C 3M62B 4HVBA 1MVKA 2N0SB 2W3SA 4DDGD 1MG8A 5EE0A 1FXAA 2K8BA 4RMAA 1QOAA 5I4DA 1TIFA 2KTRB 1F9JA 1VZ6A 3SFEB 2IGHA 2WU5B 4WAFA 1MI0A 3HM6X 1QLBB 2MBHA 1WZ3A 2KKCA 2C60A 2L3ZA 2XN9C 2SAKA 2KFJA 1WM3A 3AEBB 2PE9A 3HHMA 4GGQA 3R3MA 3VTUA 4PT5A 2YVCA 2CJNA 3X23A 4MSMB 1XO3A 2L1AA 2AYOB 3KLSX 1JRUA 4M8NA 4W9GA 4NQKE 1FCCC 2WX1A 1VJKA 2N9XA 2O6VB 4M0WA 1JW9D 4XC2A 2HTHA 2DWQA 2LUMA 4WJPA 1L0XB 4FBJB 2MJEA 4Q2JA 3AV8A 5GXGB 1C79A 2NMQA 1SF0A 2QSDA 1KRHA 3B1LX 5LLIA 1F2RI 1YN3A 2RGFA 4YSYB 2N7JA 3OAWA 4XE0A 2QHOA 1WXQA 4AOFA 1K8RB 1UBQA 1Q0WB 1S3SG 5AEKB 4YXDB 3BINA 2N9KA 2QIEB 3VFKA 2V4IB 2DHZA 3AE1B 4N6EB 2KN4A 3NVVA 3A1QB 2BYVE 4W9JA 2C7HA 3NJTA 2NBUA 2HDEA 1E8XA 2JXTA 3UF8A 5BYQA 3PRMB 3DVGX 2KZRA 3ML8A 2N1VA 2W54A 3P42A 2XNAC 1R4MI 4HCPB 4P7IA 3DQVA 5IO9A 3SHQA 3QHTA 4AWJA 2BS4B 3DBRI 2MBBB 4J3OD 3JW0X 5LXIB 2VZKD 3W1YA 4IWQA 1B1ZA 3ZRFA 2BS2B 1SEBD 1YQBA 2V3SA 2LHEA 4YT0B 3CIRB 4KX6B 1F2RC 4ZYSA 2R2OA 4B95A 1MHXA 1EWYC 2EMTA 3KYDD 1YN5A 3VDZA 2ZEQA 1UF0A 1FPYA 3Q8EA 2V1YA 3AI5A 1TY2A 3ZJVA 1PFDA 4IWPA 3NS1A 3VRBB 1L7YA 2NBWB 1CQVA 1C4PA 1N5WA 3V60A 2X38A 4BAXA 3A33B 1KM7A 2KYWA 4OVZA 1L6VA 3ZIMA 3V62A 3AU4A 5D94A 2HJ8A 1G6JA 2ACZB 1KTKA 3R2IA 3SR6A 1HZ5A 2WXLA 3U7ZA 3A1QA 2KVZA 1C1YB 1KF6B 4M8MA 2MH7A 2ZJDA 4NY0A 3IXSA 2K6DB 1QQRA 2GBMA 3OLMD 3UIPB 4JGHB 3ZO5B 1JWBD 3L0WB 2UWQA 1RWSA 3H8HA 1V80A 5G55A 2M56B 3W9CB 2BB5A 3FILB 3RUIB 4FJVB 2RR9A 1WR6E 4WQOB 3AE7B 4IUMB 1HZ6A 1RFKA 4MGKE 1E9MA 3TJPA 1WX9A 4JWUC 1I4GA 1HTOA 2JT4B 3MFGA 4EEWA 2LMCA 4AP4C 1WH3A 4W9DA 3TUOA 4MM3A 1WRDB 3GE8C 5C1ZA 4M00A 3AH7A 3CSTA 1AARA 4BZAA 2PEAA 4HDOA 4NAMA 2WXOA 3UINB 1PGXA 1M94A 3O13A 1IGCA 2WXNA 1ROEA 4WWOA 4K7UA 3T3OA 2BYTA 1TZ1A 2X8XX 1UUPA 3IG3A 3ZNHB 4LJOB 2MP2A 2ASQA 2LVOA 2R2QA 4ZYNA 2A5UA 1WR1A 1P3QU 3L10B 2CU1A 2IO0B 3RYTA 4NJCA 2I1KA 1ACCA 3Q14C 3ZDTA 2N9LA 1ISNA 3Q8CA 4JL9A 3RZFA 4FHJA 1YJJA 3H7SA 1E7PB 2WS3B 2D07B 2LRUA 3PV1A 4KV2A 4HROA 2GI9A 1OEYA 3PS6A 3VUWA 3T8MA 2JZ3B 5AZFA 1LGRA 1F52A 2YEPF 3I57A 2L7RA 4WWNA 4ZRQA 2KWUB 1LFDA 4P1BC 1T0YA 2KQSA 4G50A 2DZMA 2DENB 2JZPA 4ZRJA 2G3QB 2D3AA 4HLEA 2N4FA 4WAAA 4NJ7A 5D3IB 3U52E 3E56A 5E6PA 4LNNA 1TZOA 2PPHA 1F1HA 1V5OA 1NYRA 4GDKA 2Y5PA 4LNFA 2G1EA 1XF5L 1J7AA 3FC4A 3GE3C 3EA6A 2BB6A 2KDEB 3H1UA 1WJNA 2NTTA 4A55A 5MPOA 2FCNA 3KH0A 1SE3A 2JVCA 4JE3B 4F7ZA 1E10A 2CHXA 2RPQA 4E71A 4ASWC 2DYOA 1QOBA 1JALA 2INNE 1CK1A 1YX6B 5IN7A 3SEBA 3T3NA 1UELA 5D7GA 2R61A 3BVMA 1N60A 3ZRCA 1QOGA 3QWZB 5JHBA 2KDIA 2WXIA 3M63B 2WQYB 3W2DA 4N58A 4AUQC 2Z8LA 1EF1A 3WIMA 1C9FA 2LEKA 2PVGC 5AZGA 3VR8B 2A4ZA 5E6NA 5DPWA 2MX2A 1I4PA 4RM8A 4JLCA 3URYA 5AUIA 3L4PA 5L95C 2JPHA 5GMVA 4LDTD 1EWCA 4AJYB 1JWUD 3CF6E 4ICUA 1TS4A 1OEYJ 2L0FA 3L17A 3KVFB 4ANUA 1V6EA 2WDQB 2BKFA 4FXCA 1ENFA 4LLGM 4XX5A 1HEZE 3ZGZA 3AE2B 4KIKA 3LYYA 3TL5A 3VH4B 3W1SC 4EKUA 5TSSA 4IG7B 4KKJA 1BMLC 4WWMA 4HXDA 2K39A 2J0MA 2LHDA 4OZCA 3Q3MC 4N59A 3ZQ4A 4RM9A 2M1MA 2KO3A 1GOZA 1E6EB 1WGYA 2B3AA 1IBXA 2MA9B 3BIID 3HVDA 4KDLB 2BYEA 4DK5A 1UH6A 3RNFC 2KJHB 3CWIA 3MC0B 2ZVNA 4GSWA 1RLFA 4HDQA 4WWPA 3T9LA 4CHKA 5H92C 4O1NA 3C19A 4W9IA 1L5PA 2RD0A 4C00A 2LXCA 2KFKA 5KHQA 5DPTA 1PGBA 2JZZA 2PKOA 1WGRA 3MHZA 1CJEA 1P7EA 4GU2A 3KWLA 3NZUA 3AE8B 3RI7C 3PLUA 3A9KA 4L23A 2MBEA 2LD9A 2WXRA 5LNK1 3PVLA 2WYQA 3DCGA 3VH3B 3P1MA 3I3TB 2DBYA 1V1OA 1RFAA 5AUKA 4CYEA 1LQBA 3ECIA 1IUEA 2G4DB 1WE6A 3U7DA 4YSXB 1HE8A 3WAOA 4A20A 2KDFB 2L05A 3TEZA 2PLPA 4NAWA 3NZ3A 3C8YA 1TS2A 3ZUNA 4M0WB 5JHAA 2PJHA 2FUHB 4E74A 1WI0A 3KW5B 3SFDB 4XWTA 2MHJA 4YSZB 1RYJA 3PTFC 2NTSA 3QIJA 2ZNVB 1HTQA 2WXPA 5CX3A 2O6VD 2LGXA 4P6VF 1WFYA 3NG0A 1P7FA 4IOIE 2AX5A 2IO2B 3R7QA 1ET9A 1WYGA 3HIZA 2CHZA 1L0VB 2WXQA 1SBBB 3AEEB 1Z2MA 2AWTA 1MPEA 2MJDA 2PW9A 3CSFA 1LXDA 2RDBC 4IM0A 1Q1OA 3DHIC 2XK5A 3JYUA 3ZTDA 5JXVA 1KOTA 1V86A 2IJ0A 1T6BX 5EE9A 1EU4A 1ZDXA 1I7HA 1PGAA 4WIPA 2KANA 1Q10A 3VTWA 1L0YB 3GP7A 4ZRIA 3BVZA 4GOCA 2ZZPB 3Q3JA 2I38A 2J0JA 3ZVVA 1H4RA 1C4CA 3IAM1 4RF0A 2V3NA 2CU3A 4IC7B 4REZA 2ON8A 4ZDVA 3DBSA 4I6PA 3QA8A 5BYRA 4KGSA 2GBRA 4OVVA 2K1FA 3Q8FA 3H9DA 1SGHA 2NS5A 3B2FA 4ZRPA 2HTME 4MDKE 1JMLA 2WLBA 1L4DB 4S17A 1OQQA 4L2YA 4H2AA 5BMGA 1T3QA 2JYTA 3TSSA 4DQOC 3R66C 1VCBA 2INCC 2KWCA 1WRIA 1XT9B 1ZDVA 1K52A 1WXSA 2KQ4X 3N3KB 2AL6A 3H7PA 2WXJA 1WXAA 4DHZB 3L54A 4XGAB 2LGIA 1TBEA 2QDFA 1QOFA 2LVPA 4LNKA 1ZXHA 1JWSD 5KHOA 4ANWA 2INPE 3V6EB 4EE2A 1IPGA 1WXVA 5HKHA 5DPSA 2VH2A 3R2TA 3OJ3A 2MSED 4RCOA 2NPTA 4TUUA 2GB1A
chains in the Genus database with same CATH topology
2OJRA 3EFUA 4BKSA 3CSTA 1AARA 3GOEA 2PEAA 3N32A 4HDOA 1WMHB 2KX3A 3UINB 4CO7A 1M94A 1ZW7A 4WWOA 4K7UA 1XD3B 3TBLD 5G2NA 1EO6A 1TZ1A 2HE7A 5DCNA 4KZCA 4F8CB 3VUYA 4MH0E 1LM8B 3H7PB 4EFOA 3IG3A 3ZNHB 2CR5A 1WJ4A 2M17A 4LJOB 2MP2A 4E3CA 5CHWA 2IY1B 5JZEB 1BT0A 2ASQA 4MGYE 3U8ZA 2LVOA 2R2QA 3NHEB 4LJPB 4ZYNA 4EZLA 2O2VB 1OTRB 2A5UA 3NOBA 1WR1A 1P3QU 2Z59B 2CU1A 2IO0B 3L10B 3RYTA 2Z0DB 3VVWB 4EZJA 4FADA 4GXBA 2LZ6A 1J19A 2I1KA 3TMPB 3ZDTA 2KC2A 5IA7A 1ISNA 4MJSA 3NS8A 4JL9A 2KJRA 3RZFA 2GOWA 4FHJA 1WX8A 2BPSA 2K25A 2NPTB 1KLVA 3H7SA 1WJ6A 4KVGB 3QCAA 1IP9A 2D07B 3ENEA 4G3XB 1L2NA 2LRUA 4TV3A 4KSKC 3PV1A 4KV2A 3UGBB 1OEYA 3PS6A 3VUWA 2ZCCA 4NQLB 4W9EA 3T8MA 4BVUC 3D32A 2JZ3B 5AZFA 2D3GA 5FR6A 1WY8A 1WJUA 2REXA 2DYBA 2W9NA 1QZEA 2KNBA 1WXMA 1WIAA 2MP2B 2L7RA 4WWNA 4HPMB 3LDZE 4GIVA 5CTRC 2KWUB 1LFDA 2UYZB 1T0YA 2KQSA 3GZNI 1V2YA 4DHZE 3M3JA 1ZKHA 4G50A 2M8SA 2K6QA 2DZMA 2DENB 2MLBA 3RCZA 4BKTA 2I1JA 4HCNB 3EECA 4ZRJA 5D2MB 2G3QB 1RRBA 2FAZA 1WE7A 2N4FA 4HLEA 3KUCB 4WAAA 4MJSB 3OJ4B 4NJ7A 3QX1A 3PHWB 2NVUI 2XEWA 3PREA 3NY5A 4J6IA 2N7DA 4PYUA 2KN5A 4W9KA 3X0WA 4KZ0A 2JRIB 5E6PA 1ZGUB 2JWZA 1E5WA 2KDBA 2L00B 2PPHA 3QK0A 1V5OA 2G4SA 4GDLA 2IO3B 4LDTB 2GBJA 2DZJA 1GG3A 4MEMA 1KJTA 1WMHA 4GDKA 4NPNA 4X57B 1E7UA 1A5RA 3L16A 3VHTC 4PYZA 4ANXA 3PPAA 3ML9A 3DPDA 4BKSD 2KDEB 3H1UA 5C23A 4BBNC 2ZPNA 1WJNA 5D6JB 4YL8A 1IYFA 4OVUA 3KUZA 2CHWA 4KSLC 3RULA 2FCNA 3HK0A 3KH0A 2JVCA 4TQ0A 4TKNA 4F7ZA 1YJ1A 2CHXA 2RPQA 2BWES 3TIXA 3WALA 2O2VA 4E71A 4ASWC 2DYOA 2GMIC 2KQ7A 1EF5A 4FULA 2FCMA 3IFWB 1R4NI 3R7RA 3PGEA 1YX6B 5AZHA 4NNJB 3W1SA 2ZCBA 1UELA 4K7SA 5D7GA 2M0XA 2WWZA 3ZNID 2KD0A 2AEHA 3PHXB 3PRZA 2MRPA 3ZRCA 3VTVA 2C7NB 3QWZB 1YX5B 5JHBA 2LXAA 4GMVA 4B9KA 1E8ZA 2KDIA 3M63B 4F1SA 2MW5A 4GDLB 1FXTB 4AUQC 1EF1A 4ANVA 3QQ8B 3WIMA 2EKEC 1P9DU 2G45B 4GDKB 2HD5B 5AZGA 3ZNGC 1SE9A 4JQWC 1VD2A 3ZTCA 2A4ZA 4HJKA 4HWIB 5E6NA 5DPWA 2MX2A 3QJZA 4IM2A 2JY6A 4DBGA 1Y8RC 2LWPA 3ALBA 1S1QB 4KDIC 4JLCA 4RM8A 2KTRA 2DZKA 2JPHA 5L95C 5GMVA 2KLCA 4LDTD 4AJYB 5L83A 1OGWA 3CF6E 1NDDA 1WM2A 4ICUA 2MCNB 2DZIA 3DVGY 2GBKA 3APCA 3MJWA 1V49A 2KWVB 1OEYJ 3SD5A 4BFRA 5EDSA 2L0FA 3L17A 3KVFB 1GNUA 2CKHB 2JF5A 3JSVB 1E7VA 2C9WB 4ANUA 1V6EA 2FIFA 4WJNA 1NI2A 2BKFA 1D3ZA 3QARA 3EHVA 4FLHA 2FNJB 3V6CB 4XX5A 3NZSA 2VRRB 2L8JA 2N7EA 2MQJA 2D10A 4HPLB 4EUTA 2BKRB 4XZ4A 3HM3A 4KIKA 2KK8A 2FIDA 2CS4A 2KJ6A 4MGZE 3TL5A 2LVQA 3VH4B 3C0RB 2FCSA 2KTFA 3W1SC 1SIFA 4EKUA 4EOYA 4IG7B 4NJ6A 2IO1B 3IBEA 3LJ3A 4GB9A 2JUOA 3M62B 4HVBA 3AU5A 3DVNV 4HXDA 2BWFA 2K39A 4DDGD 1UD7A 1NBFC 1MG8A 2J0MA 2ZVOA 1E8YA 1UBIA 4LCDE 3UQBA 5JH5C 2K8BA 1XQQA 4RMAA 2KTRB 1F9JA 2O6VA 4RM9A 4W9LA 2M1MA 2BF8B 2KO3A 2KVRA 3ZNZB 4IWOA 1WGYA 2B3AA 2MA9B 3WA0A 4B6WA 1J8CA 4GN1A 2Z0EB 3HM6X 3UQAA 3ONSA 4KDLB 2BYEA 2XBBC 1UH6A 4BKGA 4DK5A 1C3TA 2MBHA 1WZ3A 2KJHB 3DOWA 2KKCA 3ZW3A 2C60A 3IHPC 2L3ZA 2ZVNA 4GSWA 1RLFA 4HDQA 4KIKB 3S2AA 4WWPA 2MBOA 2C5LC 1V81A 2LJ5A 2OOBB 3T9LA 4CHKA 2WDTB 4W9CA 3H6NA 4N9F4 2KFJA 3SU8X 1WM3A 2JXXA 1WX7A 1X1MA 2K8HA 3HHMA 2PE9A 4GGQA 4W9IA 3R3MA 2D11A 2RD0A 3VTUA 2LXCA 2KFKA 2YVCA 5KHQA 5DPTA 3X23A 4MSMB 3PLVA 2JZZA 2AYOB 2EMSA 1JRUA 4M8NA 4MGIE 1WGRA 4W9GA 4NQKE 3WANA 2RSUA 2WX1A 4GU2A 4MELA 2ZPYA 5LXHA 4BOZB 2N9XA 2O6VB 3NZUA 2BGFA 1UZXB 4XC2A 1I35A 2HTHA 3DDCB 1OQYA 3PLUA 1E8WA 4WJPA 2C7MB 3A9KA 4FBJB 3PSEB 2LRWA 2MBEA 2LD9A 1Z5SB 3PVLA 1YD8U 3IVFA 2WYQA 3DCGA 5BO4B 1GC6A 3VH3B 2N1WA 3JSVA 4EZKA 2KMAA 3I3TB 1WGDA 1TGZB 3PT2B 1J0GA 2L76A 2AL3A 3B1LX 5LLIA 1RFAA 3B0AA 4WJQA 4FA6A 3KUDB 2IYDB 2RGFA 4PS3A 2KX0A 5DPRA 3ZKJC 4PS8A 4CYEA 2MWSB 5CHFA 2BYFA 4URKA 3OAWA 3A4RA 1LQBA 2G4DB 1P1AA 2QHOA 3ECIA 1WE6A 2KC1A 1UGMA 1K8RB 3U7DA 4AOFA 3N30A 1HE8A 3WAOA 1UBQA 2KFKB 2DAFA 3K9OB 4A20A 1Q0WB 1S3SG 5AEKB 4JIOU 2KDFB 3BINA 2L05A 1Q5WB 3V61A 3VFKA 3VQIA 1I42A 2LGDA 4NAWA 2DHZA 2KLGA 3ZUNA 4M0WB 5JHAA 3A1QB 2LI5A 3TCAA 2BYVE 4W9JA 3PRPB 2PJHA 2FUHB 4TQ1A 3A9KB 2C7HA 4E74A 1WYWB 1WI0A 3L13A 3KW5B 4A3OA 1CMXB 1P98A 2NBUA 3MHSD 4DDID 1E8XA 3PTFC 4DWFA 3B08A 3QIJA 1YIWA 3UF8A 3Q3FA 2ZNVB 3PRMB 2L0TA 5CX3A 3DVGX 1RAXA 2KZRA 2O6VD 3ML8A 3PZDA 2N1VA 4G0NB 1GUAB 2IZVB 2LGXA 2IBIB 3QC8B 1H8CA 1WFYA 4II2B 3ZDMC 2ZNVC 3VUXA 3QAQA 2IY0B 1EUVB 2IO2B 4ICVA 1R4MI 1WZ0A 3R7QA 2K8CA 4HCPB 1V5TA 4P7IA 3DQVA 3HIZA 2CHZA 3QHTA 3SHQA 4PS7A 4AWJA 5J17A 3U30A 4K81A 3DBRI 2MBBB 3JW0X 4I6LB 5LXIB 3W1YA 3APFA 1Z2MA 3UIOB 3L08A 3O65B 4IWQA 4FJYA 2AWTA 4BOSC 3ZRFA 5E6OA 2V3SA 1YQBA 4NAWB 3CSFA 1LXDA 3AULA 4IM0A 2R2OA 4DHJB 1Q1OA 4B95A 3RT3B 4A3PA 2XK5A 3JYUA 3P2BA 3ZTDA 1KOTA 2JRHA 2EMTA 3KYDD 4IM3A 3VDZA 2MBQA 2ZEQA 4G11A 2DAJA 1V86A 2NBVB 4AJWA 1GC7A 2V1YA 1WF9A 2N9PC 3AI5A 1E90A 4IWPA 4II3B 2KANA 4IW0A 2PE6B 3VTWA 4HK2A 3SDLC 4ZRIA 3JVZX 5J18A 3DVNU 1L7YA 3WAPA 2GBNA 2NBWB 4GOCA 1GJZA 2ZZPB 3Q3JA 3AXCA 2J0JA 2LUEA 2FCQA 3V60A 3ZVVA 1H4RA 2J0KA 2KHWB 3MTNB 3A9JA 3A33B 1KM7A 3K9PB 4IC7B 2KXJA 3M95A 1WGGA 3BY4B 4W9FA 3ZIMA 4ZDVA 3DBSA 4I6PA 3V62A 3AU4A 5D94A 2HJ8A 3QA8A 1P0RA 3CMMB 2GBRA 4OVVA 4FHKA 2K1FA 4DXAB 1G6JA 3H9DA 5TR5A 4ZRKA 3WAMA 1SGHA 2NS5A 2YLMA 3A1QA 2XK5B 1C1YB 4MDKE 4M8MA 2ZJDA 3APDA 3RZWC 4NY0A 3VAWA 1V9JA 2K6DB 2NR2A 1WGHA 2DX5B 3A4SC 2GBMA 5CHVC 3R66C 4W9HA 1VCBA 2KWCA 3OLMD 4FJZA 2LASA 3UIPB 4DHJD 4BBNF 1XT9B 4JGHB 4FN2A 1WXSA 3KYCD 1PQSA 4I6NB 2NCNA 3ZO5B 1U4AA 3N3KB 3L0WB 2AL6A 2Y5BB 3H7PA 4K7WA 2UWQA 1WXAA 1V80A 3ZLZA 4DHZB 3L54A 5G55A 5J2RA 3RUIB 2RR9A 2V4LA 1WR6E 2M4NA 3EC8A 4FJVB 1TBEA 3A9JB 4IUMB 4WJOA 4WQOB 3VXWA 2KOXA 2LVPA 4MGKE 3RD2A 3TJPA 1WX9A 2D2QA 1TTNA 2DYMA 5KHOA 4ANWA 2JT4B 3V6EB 2WX0A 4K1RB 1IPGA 1WXVA 5HKHA 2N9EB 2LGYA 4MSQB 5DPSA 4EEWA 5IAAC 2KMCA 4AP4C 3OJ3A 2MSED 1WH3A 2J7QB 3DBHI 4W9DA 4MM3A 1WRDB 2NPTA 3DBLI 4TUUA 5C1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJR A;  3EFU A;  4BKS A;  3CST A;  1AAR A;  3GOE A;  2PEA A;  3N32 A;  4HDO A;  1WMH B;  2KX3 A;  3UIN B;  4CO7 A;  1M94 A;  1ZW7 A;  4WWO A;  4K7U A;  1XD3 B;  3TBL D;  5G2N A;  1EO6 A;  1TZ1 A;  2HE7 A;  5DCN A;  4KZC A;  4F8C B;  3VUY A;  4MH0 E;  1LM8 B;  3H7P B;  4EFO A;  3IG3 A;  3ZNH B;  2CR5 A;  1WJ4 A;  2M17 A;  4LJO B;  2MP2 A;  4E3C A;  5CHW A;  2IY1 B;  5JZE B;  1BT0 A;  2ASQ A;  4MGY E;  3U8Z A;  2LVO A;  2R2Q A;  3NHE B;  4LJP B;  4ZYN A;  4EZL A;  2O2V B;  1OTR B;  2A5U A;  3NOB A;  1WR1 A;  1P3Q U;  2Z59 B;  2CU1 A;  2IO0 B;  3L10 B;  3RYT A;  2Z0D B;  3VVW B;  4EZJ A;  4FAD A;  4GXB A;  2LZ6 A;  1J19 A;  2I1K A;  3TMP B;  3ZDT A;  2KC2 A;  5IA7 A;  1ISN A;  4MJS A;  3NS8 A;  4JL9 A;  2KJR A;  3RZF A;  2GOW A;  4FHJ A;  1WX8 A;  2BPS A;  2K25 A;  2NPT B;  1KLV A;  3H7S A;  1WJ6 A;  4KVG B;  3QCA A;  1IP9 A;  2D07 B;  3ENE A;  4G3X B;  1L2N A;  2LRU A;  4TV3 A;  4KSK C;  3PV1 A;  4KV2 A;  3UGB B;  1OEY A;  3PS6 A;  3VUW A;  2ZCC A;  4NQL B;  4W9E A;  3T8M A;  4BVU C;  3D32 A;  2JZ3 B;  5AZF A;  2D3G A;  5FR6 A;  1WY8 A;  1WJU A;  2REX A;  2DYB A;  2W9N A;  1QZE A;  2KNB A;  1WXM A;  1WIA A;  2MP2 B;  2L7R A;  4WWN A;  4HPM B;  3LDZ E;  4GIV A;  5CTR C;  2KWU B;  1LFD A;  2UYZ B;  1T0Y A;  2KQS A;  3GZN I;  1V2Y A;  4DHZ E;  3M3J A;  1ZKH A;  4G50 A;  2M8S A;  2K6Q A;  2DZM A;  2DEN B;  2MLB A;  3RCZ A;  4BKT A;  2I1J A;  4HCN B;  3EEC A;  4ZRJ A;  5D2M B;  2G3Q B;  1RRB A;  2FAZ A;  1WE7 A;  2N4F A;  4HLE A;  3KUC B;  4WAA A;  4MJS B;  3OJ4 B;  4NJ7 A;  3QX1 A;  3PHW B;  2NVU I;  2XEW A;  3PRE A;  3NY5 A;  4J6I A;  2N7D A;  4PYU A;  2KN5 A;  4W9K A;  3X0W A;  4KZ0 A;  2JRI B;  5E6P A;  1ZGU B;  2JWZ A;  1E5W A;  2KDB A;  2L00 B;  2PPH A;  3QK0 A;  1V5O A;  2G4S A;  4GDL A;  2IO3 B;  4LDT B;  2GBJ A;  2DZJ A;  1GG3 A;  4MEM A;  1KJT A;  1WMH A;  4GDK A;  4NPN A;  4X57 B;  1E7U A;  1A5R A;  3L16 A;  3VHT C;  4PYZ A;  4ANX A;  3PPA A;  3ML9 A;  3DPD A;  4BKS D;  2KDE B;  3H1U A;  5C23 A;  4BBN C;  2ZPN A;  1WJN A;  5D6J B;  4YL8 A;  1IYF A;  4OVU A;  3KUZ A;  2CHW A;  4KSL C;  3RUL A;  2FCN A;  3HK0 A;  3KH0 A;  2JVC A;  4TQ0 A;  4TKN A;  4F7Z A;  1YJ1 A;  2CHX A;  2RPQ A;  2BWE S;  3TIX A;  3WAL A;  2O2V A;  4E71 A;  4ASW C;  2DYO A;  2GMI C;  2KQ7 A;  1EF5 A;  4FUL A;  2FCM A;  3IFW B;  1R4N I;  3R7R A;  3PGE A;  1YX6 B;  5AZH A;  4NNJ B;  3W1S A;  2ZCB A;  1UEL A;  4K7S A;  5D7G A;  2M0X A;  2WWZ A;  3ZNI D;  2KD0 A;  2AEH A;  3PHX B;  3PRZ A;  2MRP A;  3ZRC A;  3VTV A;  2C7N B;  3QWZ B;  1YX5 B;  5JHB A;  2LXA A;  4GMV A;  4B9K A;  1E8Z A;  2KDI A;  3M63 B;  4F1S A;  2MW5 A;  4GDL B;  1FXT B;  4AUQ C;  1EF1 A;  4ANV A;  3QQ8 B;  3WIM A;  2EKE C;  1P9D U;  2G45 B;  4GDK B;  2HD5 B;  5AZG A;  3ZNG C;  1SE9 A;  4JQW C;  1VD2 A;  3ZTC A;  2A4Z A;  4HJK A;  4HWI B;  5E6N A;  5DPW A;  2MX2 A;  3QJZ A;  4IM2 A;  2JY6 A;  4DBG A;  1Y8R C;  2LWP A;  3ALB A;  1S1Q B;  4KDI C;  4JLC A;  4RM8 A;  2KTR A;  2DZK A;  2JPH A;  5L95 C;  5GMV A;  2KLC A;  4LDT D;  4AJY B;  5L83 A;  1OGW A;  3CF6 E;  1NDD A;  1WM2 A;  4ICU A;  2MCN B;  2DZI A;  3DVG Y;  2GBK A;  3APC A;  3MJW A;  1V49 A;  2KWV B;  1OEY J;  3SD5 A;  4BFR A;  5EDS A;  2L0F A;  3L17 A;  3KVF B;  1GNU A;  2CKH B;  2JF5 A;  3JSV B;  1E7V A;  2C9W B;  4ANU A;  1V6E A;  2FIF A;  4WJN A;  1NI2 A;  2BKF A;  1D3Z A;  3QAR A;  3EHV A;  4FLH A;  2FNJ B;  3V6C B;  4XX5 A;  3NZS A;  2VRR B;  2L8J A;  2N7E A;  2MQJ A;  2D10 A;  4HPL B;  4EUT A;  2BKR B;  4XZ4 A;  3HM3 A;  4KIK A;  2KK8 A;  2FID A;  2CS4 A;  2KJ6 A;  4MGZ E;  3TL5 A;  2LVQ A;  3VH4 B;  3C0R B;  2FCS A;  2KTF A;  3W1S C;  1SIF A;  4EKU A;  4EOY A;  4IG7 B;  4NJ6 A;  2IO1 B;  3IBE A;  3LJ3 A;  4GB9 A;  2JUO A;  3M62 B;  4HVB A;  3AU5 A;  3DVN V;  4HXD A;  2BWF A;  2K39 A;  4DDG D;  1UD7 A;  1NBF C;  1MG8 A;  2J0M A;  2ZVO A;  1E8Y A;  1UBI A;  4LCD E;  3UQB A;  5JH5 C;  2K8B A;  1XQQ A;  4RMA A;  2KTR B;  1F9J A;  2O6V A;  4RM9 A;  4W9L A;  2M1M A;  2BF8 B;  2KO3 A;  2KVR A;  3ZNZ B;  4IWO A;  1WGY A;  2B3A A;  2MA9 B;  3WA0 A;  4B6W A;  1J8C A;  4GN1 A;  2Z0E B;  3HM6 X;  3UQA A;  3ONS A;  4KDL B;  2BYE A;  2XBB C;  1UH6 A;  4BKG A;  4DK5 A;  1C3T A;  2MBH A;  1WZ3 A;  2KJH B;  3DOW A;  2KKC A;  3ZW3 A;  2C60 A;  3IHP C;  2L3Z A;  2ZVN A;  4GSW A;  1RLF A;  4HDQ A;  4KIK B;  3S2A A;  4WWP A;  2MBO A;  2C5L C;  1V81 A;  2LJ5 A;  2OOB B;  3T9L A;  4CHK A;  2WDT B;  4W9C A;  3H6N A;  4N9F 4;  2KFJ A;  3SU8 X;  1WM3 A;  2JXX A;  1WX7 A;  1X1M A;  2K8H A;  3HHM A;  2PE9 A;  4GGQ A;  4W9I A;  3R3M A;  2D11 A;  2RD0 A;  3VTU A;  2LXC A;  2KFK A;  2YVC A;  5KHQ A;  5DPT A;  3X23 A;  4MSM B;  3PLV A;  2JZZ A;  2AYO B;  2EMS A;  1JRU A;  4M8N A;  4MGI E;  1WGR A;  4W9G A;  4NQK E;  3WAN A;  2RSU A;  2WX1 A;  4GU2 A;  4MEL A;  2ZPY A;  5LXH A;  4BOZ B;  2N9X A;  2O6V B;  3NZU A;  2BGF A;  1UZX B;  4XC2 A;  1I35 A;  2HTH A;  3DDC B;  1OQY A;  3PLU A;  1E8W A;  4WJP A;  2C7M B;  3A9K A;  4FBJ B;  3PSE B;  2LRW A;  2MBE A;  2LD9 A;  1Z5S B;  3PVL A;  1YD8 U;  3IVF A;  2WYQ A;  3DCG A;  5BO4 B;  1GC6 A;  3VH3 B;  2N1W A;  3JSV A;  4EZK A;  2KMA A;  3I3T B;  1WGD A;  1TGZ B;  3PT2 B;  1J0G A;  2L76 A;  2AL3 A;  3B1L X;  5LLI A;  1RFA A;  3B0A A;  4WJQ A;  4FA6 A;  3KUD B;  2IYD B;  2RGF A;  4PS3 A;  2KX0 A;  5DPR A;  3ZKJ C;  4PS8 A;  4CYE A;  2MWS B;  5CHF A;  2BYF A;  4URK A;  3OAW A;  3A4R A;  1LQB A;  2G4D B;  1P1A A;  2QHO A;  3ECI A;  1WE6 A;  2KC1 A;  1UGM A;  1K8R B;  3U7D A;  4AOF A;  3N30 A;  1HE8 A;  3WAO A;  1UBQ A;  2KFK B;  2DAF A;  3K9O B;  4A20 A;  1Q0W B;  1S3S G;  5AEK B;  4JIO U;  2KDF B;  3BIN A;  2L05 A;  1Q5W B;  3V61 A;  3VFK A;  3VQI A;  1I42 A;  2LGD A;  4NAW A;  2DHZ A;  2KLG A;  3ZUN A;  4M0W B;  5JHA A;  3A1Q B;  2LI5 A;  3TCA A;  2BYV E;  4W9J A;  3PRP B;  2PJH A;  2FUH B;  4TQ1 A;  3A9K B;  2C7H A;  4E74 A;  1WYW B;  1WI0 A;  3L13 A;  3KW5 B;  4A3O A;  1CMX B;  1P98 A;  2NBU A;  3MHS D;  4DDI D;  1E8X A;  3PTF C;  4DWF A;  3B08 A;  3QIJ A;  1YIW A;  3UF8 A;  3Q3F A;  2ZNV B;  3PRM B;  2L0T A;  5CX3 A;  3DVG X;  1RAX A;  2KZR A;  2O6V D;  3ML8 A;  3PZD A;  2N1V A;  4G0N B;  1GUA B;  2IZV B;  2LGX A;  2IBI B;  3QC8 B;  1H8C A;  1WFY A;  4II2 B;  3ZDM C;  2ZNV C;  3VUX A;  3QAQ A;  2IY0 B;  1EUV B;  2IO2 B;  4ICV A;  1R4M I;  1WZ0 A;  3R7Q A;  2K8C A;  4HCP B;  1V5T A;  4P7I A;  3DQV A;  3HIZ A;  2CHZ A;  3QHT A;  3SHQ A;  4PS7 A;  4AWJ A;  5J17 A;  3U30 A;  4K81 A;  3DBR I;  2MBB B;  3JW0 X;  4I6L B;  5LXI B;  3W1Y A;  3APF A;  1Z2M A;  3UIO B;  3L08 A;  3O65 B;  4IWQ A;  4FJY A;  2AWT A;  4BOS C;  3ZRF A;  5E6O A;  2V3S A;  1YQB A;  4NAW B;  3CSF A;  1LXD A;  3AUL A;  4IM0 A;  2R2O A;  4DHJ B;  1Q1O A;  4B95 A;  3RT3 B;  4A3P A;  2XK5 A;  3JYU A;  3P2B A;  3ZTD A;  1KOT A;  2JRH A;  2EMT A;  3KYD D;  4IM3 A;  3VDZ A;  2MBQ A;  2ZEQ A;  4G11 A;  2DAJ A;  1V86 A;  2NBV B;  4AJW A;  1GC7 A;  2V1Y A;  1WF9 A;  2N9P C;  3AI5 A;  1E90 A;  4IWP A;  4II3 B;  2KAN A;  4IW0 A;  2PE6 B;  3VTW A;  4HK2 A;  3SDL C;  4ZRI A;  3JVZ X;  5J18 A;  3DVN U;  1L7Y A;  3WAP A;  2GBN A;  2NBW B;  4GOC A;  1GJZ A;  2ZZP B;  3Q3J A;  3AXC A;  2J0J A;  2LUE A;  2FCQ A;  3V60 A;  3ZVV A;  1H4R A;  2J0K A;  2KHW B;  3MTN B;  3A9J A;  3A33 B;  1KM7 A;  3K9P B;  4IC7 B;  2KXJ A;  3M95 A;  1WGG A;  3BY4 B;  4W9F A;  3ZIM A;  4ZDV A;  3DBS A;  4I6P A;  3V62 A;  3AU4 A;  5D94 A;  2HJ8 A;  3QA8 A;  1P0R A;  3CMM B;  2GBR A;  4OVV A;  4FHK A;  2K1F A;  4DXA B;  1G6J A;  3H9D A;  5TR5 A;  4ZRK A;  3WAM A;  1SGH A;  2NS5 A;  2YLM A;  3A1Q A;  2XK5 B;  1C1Y B;  4MDK E;  4M8M A;  2ZJD A;  3APD A;  3RZW C;  4NY0 A;  3VAW A;  1V9J A;  2K6D B;  2NR2 A;  1WGH A;  2DX5 B;  3A4S C;  2GBM A;  5CHV C;  3R66 C;  4W9H A;  1VCB A;  2KWC A;  3OLM D;  4FJZ A;  2LAS A;  3UIP B;  4DHJ D;  4BBN F;  1XT9 B;  4JGH B;  4FN2 A;  1WXS A;  3KYC D;  1PQS A;  4I6N B;  2NCN A;  3ZO5 B;  1U4A A;  3N3K B;  3L0W B;  2AL6 A;  2Y5B B;  3H7P A;  4K7W A;  2UWQ A;  1WXA A;  1V80 A;  3ZLZ A;  4DHZ B;  3L54 A;  5G55 A;  5J2R A;  3RUI B;  2RR9 A;  2V4L A;  1WR6 E;  2M4N A;  3EC8 A;  4FJV B;  1TBE A;  3A9J B;  4IUM B;  4WJO A;  4WQO B;  3VXW A;  2KOX A;  2LVP A;  4MGK E;  3RD2 A;  3TJP A;  1WX9 A;  2D2Q A;  1TTN A;  2DYM A;  5KHO A;  4ANW A;  2JT4 B;  3V6E B;  2WX0 A;  4K1R B;  1IPG A;  1WXV A;  5HKH A;  2N9E B;  2LGY A;  4MSQ B;  5DPS A;  4EEW A;  5IAA C;  2KMC A;  4AP4 C;  3OJ3 A;  2MSE D;  1WH3 A;  2J7Q B;  3DBH I;  4W9D A;  4MM3 A;  1WRD B;  2NPT A;  3DBL I;  4TUU A;  5C1Z A; 
#chains in the Genus database with same CATH topology
 4BKS A;  5IP4 D;  3ETR A;  3N32 A;  2J42 A;  1JWM D;  4CO7 A;  4TSS A;  3TBL D;  5G2N A;  2K3U A;  2PIA A;  4KZC A;  4F8C B;  3VUY A;  2QCZ A;  2CR5 A;  3AEG B;  5CHW A;  3U4E G;  2IY1 B;  4K3C A;  1NEN B;  3B2G A;  3NHE B;  1D5Z C;  3AE5 B;  1OTR B;  3NOB A;  2Z59 B;  1DGJ A;  3AEF B;  2Z0D B;  4FAD A;  2LZ6 A;  1T0S C;  3TMP B;  1DOY A;  1YJI A;  2LFI A;  4MM3 B;  3TEX A;  1WX8 A;  1KLV A;  2K25 A;  1I4H A;  1WJ6 A;  3QCA A;  1TT5 B;  4G3X B;  1L2N A;  3RNB C;  1F77 A;  3DBH B;  2M0A A;  1M4V A;  1JRO A;  2ZCC A;  4WUR A;  1V1P A;  3AM9 A;  1N62 A;  2REX A;  2W9N A;  2KNB A;  2QC8 A;  1HXY D;  2MP2 B;  1E0Z A;  4LK0 M;  4C7Y A;  5HFY A;  3LDZ E;  4GIV A;  5CTR C;  2SEB D;  4YTM B;  3GZN I;  1V97 A;  3M3J A;  1IGD A;  1ZKH A;  2M8S A;  2WU2 B;  3RCZ A;  4BKT A;  4XYC A;  3RPF C;  3LXF A;  3IT6 B;  4RGN A;  4XDD A;  1WE7 A;  2JQR B;  2K0P A;  3OJ4 B;  3QX1 A;  3PHW B;  2XEW A;  2W82 A;  3RNG C;  3NY5 A;  2N7D A;  4PYU A;  4W9K A;  3X0W A;  2L83 A;  4KZ0 A;  3N1X C;  1E5W A;  2IO3 B;  1GG3 A;  4JX1 C;  1E7U A;  4AS1 A;  3L16 A;  3HVZ A;  3AE4 B;  1UWM A;  4RGO S;  3MJ5 A;  5C23 A;  4A90 A;  3HK0 A;  1BXT A;  4TKN A;  1NI3 A;  2KQ7 A;  4FUL A;  3AB5 A;  4WH4 A;  2PMV A;  2ZCB A;  2WWZ A;  1XLP A;  2KD0 A;  1FNW A;  2QJL A;  2MRP A;  2I2Y A;  1YX5 B;  4GMV A;  1E8Z A;  1Y56 A;  5T8I A;  3VR9 B;  1FXT B;  1STE A;  1TKY A;  2EKE C;  2G45 B;  4GDK B;  4HPP A;  4HKZ E;  4JQW C;  1J7C A;  1GB4 A;  3Q2A C;  1ZOY B;  3BZD B;  4HWI B;  3DWG C;  2JY6 A;  4DBG A;  1Y8R C;  1VR9 A;  1UGJ A;  3Q8A A;  3GB1 A;  3Q69 A;  1OGW A;  2MCN B;  2DZI A;  3MJW A;  4BFR A;  4TMA B;  2E3T A;  3NVY A;  3Q6B A;  4IKG A;  4WJN A;  5FKA C;  3AN1 A;  1D3Z A;  3EHV A;  3V6C B;  3NZS A;  2VRR B;  2L8J A;  2N7E A;  4HPL B;  4EUT A;  4XZ4 A;  1R4N B;  1HQR D;  2KJ6 A;  3EFC A;  3C0R B;  3Q3O C;  4US8 A;  2BVC A;  2JUO A;  3AU5 A;  3DVN V;  2KWD A;  2BWF A;  1UD7 A;  2ZVO A;  3HUI A;  5JH5 C;  2BTE A;  1VRA B;  4W9L A;  2KMM A;  3ZNZ B;  2JU6 X;  1J8C A;  4GN1 A;  2Z0E B;  1SE2 A;  2JX5 A;  1SIJ A;  4BKG A;  1C3T A;  1YN4 A;  5FK9 C;  3IHP C;  2WHI A;  4KIK B;  1VZ8 A;  3BK2 A;  2MBO A;  2GRI A;  1V81 A;  2OOB B;  3RNC C;  3SU8 X;  1MJD A;  1WX7 A;  2W55 A;  2K8H A;  4RFB A;  1XLN A;  2D11 A;  3UI3 A;  1WSP A;  3PLV A;  2EMS A;  4MGI E;  3WAN A;  5LXH A;  1N61 A;  1R7S A;  2KT7 A;  4YTN B;  3DHG C;  1UZX B;  1I35 A;  3U2S C;  1OQY A;  1FMA D;  1E8W A;  3PSE B;  2CJO A;  4C7Z A;  3TEW A;  3MC9 A;  1SB3 C;  1IBX B;  1Z5S B;  1D4B A;  4XWW A;  3IVF A;  2Y5C A;  5BO4 B;  4EZK A;  2N1W A;  2KMA A;  4RF1 A;  1TGZ B;  3PT2 B;  3GZN B;  1J0G A;  2L76 A;  3FAH A;  4KGT A;  4WJQ A;  3IAS 1;  3V05 A;  3ZYY X;  2H88 B;  5BMI A;  1K51 A;  2KX0 A;  2MWS B;  5CHF A;  2BYF A;  2WNM A;  1P1A A;  1XLQ A;  4S0R A;  1UGM A;  3N30 A;  2KFK B;  2DAF A;  2MJ3 A;  3VQI A;  2LGD A;  1SE4 A;  1YNT E;  2KLG A;  2AQ1 B;  2EKI A;  1XLO A;  2LI5 A;  3TCA A;  3PRP B;  4TQ1 A;  3A9K B;  1F0Z A;  1WYW B;  1P98 A;  4DWF A;  1TY0 A;  1YIW A;  4ACF A;  5D3D A;  2L0T A;  2OED A;  1RAX A;  1ZPS A;  1HA5 A;  3PZD A;  4G0N B;  2IZV B;  2QIL A;  1XCT L;  2LJI A;  3ZDM C;  2ZNV C;  3VUX A;  3QAQ A;  4MT5 A;  1BUI C;  2D5G A;  2K8C A;  5J17 A;  3U30 A;  4K81 A;  4I6L B;  3O65 B;  4BOS C;  4NAW B;  3PZ8 A;  1TS5 A;  2E6X A;  3AUL A;  1D6E C;  4C4V A;  4DHJ B;  1FNU A;  3NUH B;  4A3P A;  1SJE D;  2JRH A;  2WGS A;  4IM3 A;  1C78 A;  2D3B A;  2MBQ A;  3AMZ A;  4G11 A;  3Q8B A;  2IGG A;  4P1C C;  4AJW A;  2N9P C;  2K22 A;  1N6Z A;  3AE3 B;  4II3 B;  3ZXR A;  2PE6 B;  3W5V B;  2OJW A;  4WQM A;  3JVZ X;  5J18 A;  3DVN U;  4OW0 A;  1GJZ A;  3AXC A;  1FO4 A;  2LUE A;  2J0K A;  2PTL A;  3MTN B;  3A9J A;  1C77 A;  4ZHO A;  1KLG D;  2L52 A;  1WGG A;  1OFF A;  1P0R A;  3CMM B;  4FHK A;  4ZRK A;  1QF6 A;  2XK5 B;  3BWU D;  3APD A;  3VAW A;  2KAC A;  2NR2 A;  1WGH A;  2DX5 B;  5HI1 A;  5CHV C;  4KGR A;  3P63 A;  4BBN F;  3I63 C;  2J52 A;  4FN2 A;  2BS3 B;  1PQS A;  1I4X A;  1U4A A;  4K7W A;  2ZW1 A;  1GAQ B;  2V4L A;  1NVI D;  3EC8 A;  4LNO A;  2D2Q A;  4B0M A;  1UNS A;  4JWS C;  3BVG A;  2WX0 A;  4K1R B;  3E9S A;  3AEC B;  4ARC A;  2N9E B;  2LGY A;  2IPK D;  5IAA C;  5E6J A;  1PDX A;  3Q3N C;  3DBH I;  2J7Q B;  2K5P A;  2Y3A A;  3BYT B;  5D6J B;  2AQ2 B;  2RMM A;  2V3P A;  1WGK A;  3N9Y C;  3NVW A;  2KX3 A;  3NRZ A;  1ZW7 A;  1DYQ A;  1XD3 B;  1ESF A;  2HE7 A;  3DHH C;  1LM8 B;  3H7P B;  2M17 A;  4E3C A;  2J4X A;  3BK1 A;  4MH8 A;  1BT0 A;  4MGY E;  1D5M C;  4EZL A;  1JWA D;  1NYQ A;  2O2V B;  2V0G A;  1FM0 D;  5HG2 A;  3P4Q B;  2KC2 A;  5IA7 A;  4MJS A;  2K9X A;  1OQR A;  2KJR A;  2GLS A;  2NPT B;  1IP9 A;  1TYG B;  3UGB B;  1JCK B;  3DBL B;  4OZA A;  4W9E A;  4NQL B;  2YEP B;  2TSS A;  3D32 A;  2B76 B;  2D3G A;  5FR6 A;  1WJU A;  5FR3 A;  5EE1 A;  4RH6 A;  2IDY A;  2L32 A;  1V2Y A;  4DHZ E;  2I1J A;  4KKI A;  2DLB A;  4HCN B;  2IGD A;  5D2M B;  2FAZ A;  3KUC B;  4NZL B;  2NVU I;  1TKE A;  3PRE A;  4J6I A;  4ITK A;  3N1Y C;  1ZGU B;  2KDB A;  2L00 B;  3ZXV A;  4GDL A;  4P16 A;  2GBJ A;  1JRP A;  2DZJ A;  4MEM A;  1KJT A;  4X57 B;  1A5R A;  2KAJ A;  1V1P B;  3VHT C;  3WCQ A;  3PPA A;  4MAC A;  3ML9 A;  3AEA B;  3VRA B;  3PO0 A;  4BBN C;  2ZPN A;  3FKY A;  3KUZ A;  3RUL A;  4KSL C;  4OZB A;  5IKC M;  4TQ0 A;  3ZJT A;  2BWE S;  3TIX A;  2O2V A;  1V8C A;  3IFW B;  1R4N I;  3PGE A;  5AZH A;  3W1S A;  2J53 A;  2H89 B;  4K7S A;  3ZNI D;  3PRZ A;  1RM6 C;  4B9K A;  4DXF A;  4F1S A;  4UDU C;  1YQ3 B;  3QQ8 B;  3BYY B;  3HRD D;  2G9H D;  3ZNG C;  1L4Z B;  1SJH D;  1SE9 A;  1VD2 A;  3B9J A;  3ZTC A;  4GLS C;  4IM2 A;  3ALB A;  4D2K A;  2KTR A;  1VZ7 A;  1AN8 A;  3AE6 B;  5L83 A;  4M02 A;  1WM2 A;  3DVG Y;  3APC A;  1V49 A;  2KWV B;  3SD5 A;  5EDS A;  2D3C A;  3P4R B;  1MFW A;  1GNU A;  2JF5 A;  3JSV B;  4C56 C;  1E7V A;  4FLH A;  2FNJ B;  1FXI A;  2BKR B;  1ET6 A;  3HM3 A;  2FID A;  2MEK A;  2LVQ A;  3V3X A;  4IDI A;  2QMT A;  2FCS A;  2KTF A;  3KWV A;  1SIF A;  4EOY A;  4ZHP A;  4L1B A;  4GB9 A;  2ZW0 A;  1NBF C;  1FIQ A;  1E8Y A;  1UBI A;  4LCD E;  3UQB A;  2BQQ A;  1XQQ A;  2O6V A;  5HHD G;  2BF8 B;  2KVR A;  4OHJ A;  4IWO A;  3WA0 A;  4B6W A;  3UQA A;  3ONS A;  2XBB C;  1L6U A;  3DOW A;  3ZW3 A;  1TJE A;  4ZOH C;  1FFU A;  3S2A A;  2C5L C;  2LJ5 A;  4R3D A;  2WDT B;  3P4P B;  4W9C A;  3H6N A;  4N9F 4;  2JXX A;  1X1M A;  1PUT A;  5IOI A;  4C80 A;  2RSU A;  4MEL A;  2ZPY A;  1N63 A;  4BOZ B;  2BGF A;  3KQ4 A;  3DDC B;  1XEE A;  2Q5W D;  2C7M B;  1TKG A;  2LRW A;  1YD8 U;  1ZE3 D;  1GC6 A;  4HRS A;  1FCL A;  3JSV A;  1WGD A;  2AL3 A;  4RGM A;  2WXM A;  2VZK B;  1GB1 A;  1FRR A;  1B9R A;  3B0A A;  4FA6 A;  3KUD B;  2IYD B;  4PS3 A;  5DPR A;  3ZKJ C;  4URK A;  4PS8 A;  3A4R A;  3ABV B;  2KC1 A;  1JQ4 A;  1SSN A;  1UWX A;  3K9O B;  4JIO U;  5G5H A;  1Q5W B;  3V61 A;  4YWG G;  1DOI A;  1I42 A;  2BW2 A;  1ZP0 B;  2WXF A;  5BYS A;  1T0Q C;  3R8B A;  2WXH A;  3PZ7 A;  3GS2 A;  3L13 A;  4A3O A;  1CMX B;  4PK1 A;  4DDI D;  3MHS D;  2KDM A;  3B08 A;  3Q3F A;  4XDC A;  1GUA B;  3I9V 1;  2IBI B;  3QC8 B;  1H8C A;  4QAY A;  4II2 B;  4YTP B;  2AQ3 B;  2IY0 B;  1EUV B;  4ICV A;  1WZ0 A;  1V5T A;  4DXG A;  4PS7 A;  3ZJU A;  3APF A;  2ICI A;  3UIO B;  3L08 A;  4FJY A;  5E6O A;  1QKZ A;  2WDR B;  1AWD A;  3RT3 B;  3P2B A;  3MC8 A;  4JPS A;  4HKQ A;  3RNE C;  2DAJ A;  2NBV B;  1YOV B;  1GC7 A;  1I4Q A;  1WF9 A;  2WXK A;  3J9C A;  1E90 A;  1VLB A;  4IW0 A;  2WDV B;  3IT4 B;  4RGT A;  5C3J B;  1QT9 A;  4HK2 A;  1MG4 A;  3SDL C;  3WAP A;  2GBN A;  3FIL A;  4RNA A;  2FCQ A;  2KHW B;  4HJG E;  3K9P B;  2KXJ A;  1R4M B;  3M95 A;  3BY4 B;  4W9F A;  4DXA B;  4M01 A;  2JSV X;  1XXG A;  4HEA 1;  3DBR B;  3TEY A;  1YQ4 B;  5TR5 A;  3WAM A;  4C4V B;  2YLM A;  1K53 A;  1TS3 A;  1FEH A;  1VDV A;  2V9H A;  4CQN A;  3RZW C;  1V9J A;  1FNV A;  3A4S C;  5BMH A;  5H8Y E;  4W9H A;  4FJZ A;  2LAS A;  4DHJ D;  3LB8 C;  3KYC D;  4I6N B;  2NCN A;  2Y5B B;  3ZLZ A;  3RFZ B;  1MHH E;  5J2R A;  2M4N A;  4WJO A;  3MP9 A;  3A9J B;  3VXW A;  2KOX A;  3RD2 A;  2FBW B;  1TTN A;  2DYM A;  1C4A A;  4US9 A;  2WXG A;  4MSQ B;  2KMC A;  2UU7 A;  1WWT A;  1AYF A;  3AE9 B;  3DBL I;  2OJR A;  3EFU A;  1QIL A;  2VH1 A;  3GOE A;  1WMH B;  2ONQ A;  1EO6 A;  1KH0 A;  5EE3 A;  5DCN A;  4MH0 E;  4EFO A;  1WJ4 A;  3RN9 C;  5JZE B;  3U8Z A;  4LJP B;  5G5G A;  3VVW B;  4EZJ A;  4GXB A;  1J19 A;  4AQ7 A;  1FRD A;  3I5J C;  3NS8 A;  2JYE A;  3NVZ A;  3OWE B;  2GOW A;  2BPS A;  1D5X C;  4KVG B;  4B0E A;  3ENE A;  2FE8 A;  3P4S B;  4TV3 A;  4KSK C;  2LGS A;  4USA A;  2BT6 A;  2HJ1 A;  4BVU C;  1NEK B;  3EUB 2;  1WY8 A;  2DYB A;  1QZE A;  1WXM A;  1WIA A;  2OHF A;  4HPM B;  2M19 A;  1FFV A;  2RDG A;  1AW7 A;  2UYZ B;  3OG5 A;  2K6Q A;  2MLB A;  4K3B A;  3EEC A;  2EEL A;  1RRB A;  4MJS B;  5C2T B;  1SXT A;  4LNI A;  1KLU D;  1CZP A;  3EGR A;  2KN5 A;  2JRI B;  3RNA C;  2JWZ A;  3QK0 A;  2G4S A;  3AED B;  4LDT B;  1J7B A;  1WMH A;  2DNF A;  4NPN A;  1ZXI A;  4PYZ A;  4ANX A;  3DPD A;  4A8X C;  4BKS D;  1PYW D;  1T5X D;  4YL8 A;  1IYF A;  4OVU A;  2W3R A;  2CHW A;  1YJ1 A;  2WP9 B;  4LTU A;  1GPX A;  3WAL A;  2GMI C;  1EF5 A;  2FCM A;  3R7R A;  4NNJ B;  4A6Q A;  2M0X A;  3PHX B;  2AEH A;  3DWM A;  3VTV A;  2C7N B;  4ARI A;  2LXA A;  1KFY B;  2MW5 A;  4GDL B;  2IND C;  4ANV A;  1P9D U;  1K50 A;  2HD5 B;  2PVO D;  1XCQ L;  1DOX A;  3RMK C;  4HJK A;  1EU3 A;  3QJZ A;  4A9A A;  1N5X A;  2LWP A;  2RDH A;  1S1Q B;  4KDI C;  2DZK A;  2KLC A;  3W5U B;  2RPV A;  2FUG 1;  1NDD A;  2JWU A;  1LO5 D;  1C76 A;  1I4R A;  2QEJ C;  2GBK A;  1FD6 A;  3N1Z C;  2CKH B;  2C9W B;  2FIF A;  1T0R C;  1NI2 A;  3QAR A;  1A70 A;  1EM7 A;  1ZUD 2;  1YMH E;  2MQJ A;  2D10 A;  2KK8 A;  2CS4 A;  4MGZ E;  2BBC A;  4NJ6 A;  2IO1 B;  3IBE A;  3LJ3 A;  3N20 C;  3M62 B;  4HVB A;  1MVK A;  2N0S B;  2W3S A;  4DDG D;  1MG8 A;  5EE0 A;  1FXA A;  2K8B A;  4RMA A;  1QOA A;  5I4D A;  1TIF A;  2KTR B;  1F9J A;  1VZ6 A;  3SFE B;  2IGH A;  2WU5 B;  4WAF A;  1MI0 A;  3HM6 X;  1QLB B;  2MBH A;  1WZ3 A;  2KKC A;  2C60 A;  2L3Z A;  2XN9 C;  2SAK A;  2KFJ A;  1WM3 A;  3AEB B;  2PE9 A;  3HHM A;  4GGQ A;  3R3M A;  3VTU A;  4PT5 A;  2YVC A;  2CJN A;  3X23 A;  4MSM B;  1XO3 A;  2L1A A;  2AYO B;  3KLS X;  1JRU A;  4M8N A;  4W9G A;  4NQK E;  1FCC C;  2WX1 A;  1VJK A;  2N9X A;  2O6V B;  4M0W A;  1JW9 D;  4XC2 A;  2HTH A;  2DWQ A;  2LUM A;  4WJP A;  1L0X B;  4FBJ B;  2MJE A;  4Q2J A;  3AV8 A;  5GXG B;  1C79 A;  2NMQ A;  1SF0 A;  2QSD A;  1KRH A;  3B1L X;  5LLI A;  1F2R I;  1YN3 A;  2RGF A;  4YSY B;  2N7J A;  3OAW A;  4XE0 A;  2QHO A;  1WXQ A;  4AOF A;  1K8R B;  1UBQ A;  1Q0W B;  1S3S G;  5AEK B;  4YXD B;  3BIN A;  2N9K A;  2QIE B;  3VFK A;  2V4I B;  2DHZ A;  3AE1 B;  4N6E B;  2KN4 A;  3NVV A;  3A1Q B;  2BYV E;  4W9J A;  2C7H A;  3NJT A;  2NBU A;  2HDE A;  1E8X A;  2JXT A;  3UF8 A;  5BYQ A;  3PRM B;  3DVG X;  2KZR A;  3ML8 A;  2N1V A;  2W54 A;  3P42 A;  2XNA C;  1R4M I;  4HCP B;  4P7I A;  3DQV A;  5IO9 A;  3SHQ A;  3QHT A;  4AWJ A;  2BS4 B;  3DBR I;  2MBB B;  4J3O D;  3JW0 X;  5LXI B;  2VZK D;  3W1Y A;  4IWQ A;  1B1Z A;  3ZRF A;  2BS2 B;  1SEB D;  1YQB A;  2V3S A;  2LHE A;  4YT0 B;  3CIR B;  4KX6 B;  1F2R C;  4ZYS A;  2R2O A;  4B95 A;  1MHX A;  1EWY C;  2EMT A;  3KYD D;  1YN5 A;  3VDZ A;  2ZEQ A;  1UF0 A;  1FPY A;  3Q8E A;  2V1Y A;  3AI5 A;  1TY2 A;  3ZJV A;  1PFD A;  4IWP A;  3NS1 A;  3VRB B;  1L7Y A;  2NBW B;  1CQV A;  1C4P A;  1N5W A;  3V60 A;  2X38 A;  4BAX A;  3A33 B;  1KM7 A;  2KYW A;  4OVZ A;  1L6V A;  3ZIM A;  3V62 A;  3AU4 A;  5D94 A;  2HJ8 A;  1G6J A;  2ACZ B;  1KTK A;  3R2I A;  3SR6 A;  1HZ5 A;  2WXL A;  3U7Z A;  3A1Q A;  2KVZ A;  1C1Y B;  1KF6 B;  4M8M A;  2MH7 A;  2ZJD A;  4NY0 A;  3IXS A;  2K6D B;  1QQR A;  2GBM A;  3OLM D;  3UIP B;  4JGH B;  3ZO5 B;  1JWB D;  3L0W B;  2UWQ A;  1RWS A;  3H8H A;  1V80 A;  5G55 A;  2M56 B;  3W9C B;  2BB5 A;  3FIL B;  3RUI B;  4FJV B;  2RR9 A;  1WR6 E;  4WQO B;  3AE7 B;  4IUM B;  1HZ6 A;  1RFK A;  4MGK E;  1E9M A;  3TJP A;  1WX9 A;  4JWU C;  1I4G A;  1HTO A;  2JT4 B;  3MFG A;  4EEW A;  2LMC A;  4AP4 C;  1WH3 A;  4W9D A;  3TUO A;  4MM3 A;  1WRD B;  3GE8 C;  5C1Z A;  4M00 A;  3AH7 A;  3CST A;  1AAR A;  4BZA A;  2PEA A;  4HDO A;  4NAM A;  2WXO A;  3UIN B;  1PGX A;  1M94 A;  3O13 A;  1IGC A;  2WXN A;  1ROE A;  4WWO A;  4K7U A;  3T3O A;  2BYT A;  1TZ1 A;  2X8X X;  1UUP A;  3IG3 A;  3ZNH B;  4LJO B;  2MP2 A;  2ASQ A;  2LVO A;  2R2Q A;  4ZYN A;  2A5U A;  1WR1 A;  1P3Q U;  3L10 B;  2CU1 A;  2IO0 B;  3RYT A;  4NJC A;  2I1K A;  1ACC A;  3Q14 C;  3ZDT A;  2N9L A;  1ISN A;  3Q8C A;  4JL9 A;  3RZF A;  4FHJ A;  1YJJ A;  3H7S A;  1E7P B;  2WS3 B;  2D07 B;  2LRU A;  3PV1 A;  4KV2 A;  4HRO A;  2GI9 A;  1OEY A;  3PS6 A;  3VUW A;  3T8M A;  2JZ3 B;  5AZF A;  1LGR A;  1F52 A;  2YEP F;  3I57 A;  2L7R A;  4WWN A;  4ZRQ A;  2KWU B;  1LFD A;  4P1B C;  1T0Y A;  2KQS A;  4G50 A;  2DZM A;  2DEN B;  2JZP A;  4ZRJ A;  2G3Q B;  2D3A A;  4HLE A;  2N4F A;  4WAA A;  4NJ7 A;  5D3I B;  3U52 E;  3E56 A;  5E6P A;  4LNN A;  1TZO A;  2PPH A;  1F1H A;  1V5O A;  1NYR A;  4GDK A;  2Y5P A;  4LNF A;  2G1E A;  1XF5 L;  1J7A A;  3FC4 A;  3GE3 C;  3EA6 A;  2BB6 A;  2KDE B;  3H1U A;  1WJN A;  2NTT A;  4A55 A;  5MPO A;  2FCN A;  3KH0 A;  1SE3 A;  2JVC A;  4JE3 B;  4F7Z A;  1E10 A;  2CHX A;  2RPQ A;  4E71 A;  4ASW C;  2DYO A;  1QOB A;  1JAL A;  2INN E;  1CK1 A;  1YX6 B;  5IN7 A;  3SEB A;  3T3N A;  1UEL A;  5D7G A;  2R61 A;  3BVM A;  1N60 A;  3ZRC A;  1QOG A;  3QWZ B;  5JHB A;  2KDI A;  2WXI A;  3M63 B;  2WQY B;  3W2D A;  4N58 A;  4AUQ C;  2Z8L A;  1EF1 A;  3WIM A;  1C9F A;  2LEK A;  2PVG C;  5AZG A;  3VR8 B;  2A4Z A;  5E6N A;  5DPW A;  2MX2 A;  1I4P A;  4RM8 A;  4JLC A;  3URY A;  5AUI A;  3L4P A;  5L95 C;  2JPH A;  5GMV A;  4LDT D;  1EWC A;  4AJY B;  1JWU D;  3CF6 E;  4ICU A;  1TS4 A;  1OEY J;  2L0F A;  3L17 A;  3KVF B;  4ANU A;  1V6E A;  2WDQ B;  2BKF A;  4FXC A;  1ENF A;  4LLG M;  4XX5 A;  1HEZ E;  3ZGZ A;  3AE2 B;  4KIK A;  3LYY A;  3TL5 A;  3VH4 B;  3W1S C;  4EKU A;  5TSS A;  4IG7 B;  4KKJ A;  1BML C;  4WWM A;  4HXD A;  2K39 A;  2J0M A;  2LHD A;  4OZC A;  3Q3M C;  4N59 A;  3ZQ4 A;  4RM9 A;  2M1M A;  2KO3 A;  1GOZ A;  1E6E B;  1WGY A;  2B3A A;  1IBX A;  2MA9 B;  3BII D;  3HVD A;  4KDL B;  2BYE A;  4DK5 A;  1UH6 A;  3RNF C;  2KJH B;  3CWI A;  3MC0 B;  2ZVN A;  4GSW A;  1RLF A;  4HDQ A;  4WWP A;  3T9L A;  4CHK A;  5H92 C;  4O1N A;  3C19 A;  4W9I A;  1L5P A;  2RD0 A;  4C00 A;  2LXC A;  2KFK A;  5KHQ A;  5DPT A;  1PGB A;  2JZZ A;  2PKO A;  1WGR A;  3MHZ A;  1CJE A;  1P7E A;  4GU2 A;  3KWL A;  3NZU A;  3AE8 B;  3RI7 C;  3PLU A;  3A9K A;  4L23 A;  2MBE A;  2LD9 A;  2WXR A;  5LNK 1;  3PVL A;  2WYQ A;  3DCG A;  3VH3 B;  3P1M A;  3I3T B;  2DBY A;  1V1O A;  1RFA A;  5AUK A;  4CYE A;  1LQB A;  3ECI A;  1IUE A;  2G4D B;  1WE6 A;  3U7D A;  4YSX B;  1HE8 A;  3WAO A;  4A20 A;  2KDF B;  2L05 A;  3TEZ A;  2PLP A;  4NAW A;  3NZ3 A;  3C8Y A;  1TS2 A;  3ZUN A;  4M0W B;  5JHA A;  2PJH A;  2FUH B;  4E74 A;  1WI0 A;  3KW5 B;  3SFD B;  4XWT A;  2MHJ A;  4YSZ B;  1RYJ A;  3PTF C;  2NTS A;  3QIJ A;  2ZNV B;  1HTQ A;  2WXP A;  5CX3 A;  2O6V D;  2LGX A;  4P6V F;  1WFY A;  3NG0 A;  1P7F A;  4IOI E;  2AX5 A;  2IO2 B;  3R7Q A;  1ET9 A;  1WYG A;  3HIZ A;  2CHZ A;  1L0V B;  2WXQ A;  1SBB B;  3AEE B;  1Z2M A;  2AWT A;  1MPE A;  2MJD A;  2PW9 A;  3CSF A;  1LXD A;  2RDB C;  4IM0 A;  1Q1O A;  3DHI C;  2XK5 A;  3JYU A;  3ZTD A;  5JXV A;  1KOT A;  1V86 A;  2IJ0 A;  1T6B X;  5EE9 A;  1EU4 A;  1ZDX A;  1I7H A;  1PGA A;  4WIP A;  2KAN A;  1Q10 A;  3VTW A;  1L0Y B;  3GP7 A;  4ZRI A;  3BVZ A;  4GOC A;  2ZZP B;  3Q3J A;  2I38 A;  2J0J A;  3ZVV A;  1H4R A;  1C4C A;  3IAM 1;  4RF0 A;  2V3N A;  2CU3 A;  4IC7 B;  4REZ A;  2ON8 A;  4ZDV A;  3DBS A;  4I6P A;  3QA8 A;  5BYR A;  4KGS A;  2GBR A;  4OVV A;  2K1F A;  3Q8F A;  3H9D A;  1SGH A;  2NS5 A;  3B2F A;  4ZRP A;  2HTM E;  4MDK E;  1JML A;  2WLB A;  1L4D B;  4S17 A;  1OQQ A;  4L2Y A;  4H2A A;  5BMG A;  1T3Q A;  2JYT A;  3TSS A;  4DQO C;  3R66 C;  1VCB A;  2INC C;  2KWC A;  1WRI A;  1XT9 B;  1ZDV A;  1K52 A;  1WXS A;  2KQ4 X;  3N3K B;  2AL6 A;  3H7P A;  2WXJ A;  1WXA A;  4DHZ B;  3L54 A;  4XGA B;  2LGI A;  1TBE A;  2QDF A;  1QOF A;  2LVP A;  4LNK A;  1ZXH A;  1JWS D;  5KHO A;  4ANW A;  2INP E;  3V6E B;  4EE2 A;  1IPG A;  1WXV A;  5HKH A;  5DPS A;  2VH2 A;  3R2T A;  3OJ3 A;  2MSE D;  4RCO A;  2NPT A;  4TUU A;  2GB1 A; 
#chains in the Genus database with same CATH homology
 2OJR A;  3EFU A;  4BKS A;  3CST A;  1AAR A;  3GOE A;  2PEA A;  3N32 A;  4HDO A;  1WMH B;  2KX3 A;  3UIN B;  4CO7 A;  1M94 A;  1ZW7 A;  4WWO A;  4K7U A;  1XD3 B;  3TBL D;  5G2N A;  1EO6 A;  1TZ1 A;  2HE7 A;  5DCN A;  4KZC A;  4F8C B;  3VUY A;  4MH0 E;  1LM8 B;  3H7P B;  4EFO A;  3IG3 A;  3ZNH B;  2CR5 A;  1WJ4 A;  2M17 A;  4LJO B;  2MP2 A;  4E3C A;  5CHW A;  2IY1 B;  5JZE B;  1BT0 A;  2ASQ A;  4MGY E;  3U8Z A;  2LVO A;  2R2Q A;  3NHE B;  4LJP B;  4ZYN A;  4EZL A;  2O2V B;  1OTR B;  2A5U A;  3NOB A;  1WR1 A;  1P3Q U;  2Z59 B;  2CU1 A;  2IO0 B;  3L10 B;  3RYT A;  2Z0D B;  3VVW B;  4EZJ A;  4FAD A;  4GXB A;  2LZ6 A;  1J19 A;  2I1K A;  3TMP B;  3ZDT A;  2KC2 A;  5IA7 A;  1ISN A;  4MJS A;  3NS8 A;  4JL9 A;  2KJR A;  3RZF A;  2GOW A;  4FHJ A;  1WX8 A;  2BPS A;  2K25 A;  2NPT B;  1KLV A;  3H7S A;  1WJ6 A;  4KVG B;  3QCA A;  1IP9 A;  2D07 B;  3ENE A;  4G3X B;  1L2N A;  2LRU A;  4TV3 A;  4KSK C;  3PV1 A;  4KV2 A;  3UGB B;  1OEY A;  3PS6 A;  3VUW A;  2ZCC A;  4NQL B;  4W9E A;  3T8M A;  4BVU C;  3D32 A;  2JZ3 B;  5AZF A;  2D3G A;  5FR6 A;  1WY8 A;  1WJU A;  2REX A;  2DYB A;  2W9N A;  1QZE A;  2KNB A;  1WXM A;  1WIA A;  2MP2 B;  2L7R A;  4WWN A;  4HPM B;  3LDZ E;  4GIV A;  5CTR C;  2KWU B;  1LFD A;  2UYZ B;  1T0Y A;  2KQS A;  3GZN I;  1V2Y A;  4DHZ E;  3M3J A;  1ZKH A;  4G50 A;  2M8S A;  2K6Q A;  2DZM A;  2DEN B;  2MLB A;  3RCZ A;  4BKT A;  2I1J A;  4HCN B;  3EEC A;  4ZRJ A;  5D2M B;  2G3Q B;  1RRB A;  2FAZ A;  1WE7 A;  2N4F A;  4HLE A;  3KUC B;  4WAA A;  4MJS B;  3OJ4 B;  4NJ7 A;  3QX1 A;  3PHW B;  2NVU I;  2XEW A;  3PRE A;  3NY5 A;  4J6I A;  2N7D A;  4PYU A;  2KN5 A;  4W9K A;  3X0W A;  4KZ0 A;  2JRI B;  5E6P A;  1ZGU B;  2JWZ A;  1E5W A;  2KDB A;  2L00 B;  2PPH A;  3QK0 A;  1V5O A;  2G4S A;  4GDL A;  2IO3 B;  4LDT B;  2GBJ A;  2DZJ A;  1GG3 A;  4MEM A;  1KJT A;  1WMH A;  4GDK A;  4NPN A;  4X57 B;  1E7U A;  1A5R A;  3L16 A;  3VHT C;  4PYZ A;  4ANX A;  3PPA A;  3ML9 A;  3DPD A;  4BKS D;  2KDE B;  3H1U A;  5C23 A;  4BBN C;  2ZPN A;  1WJN A;  5D6J B;  4YL8 A;  1IYF A;  4OVU A;  3KUZ A;  2CHW A;  4KSL C;  3RUL A;  2FCN A;  3HK0 A;  3KH0 A;  2JVC A;  4TQ0 A;  4TKN A;  4F7Z A;  1YJ1 A;  2CHX A;  2RPQ A;  2BWE S;  3TIX A;  3WAL A;  2O2V A;  4E71 A;  4ASW C;  2DYO A;  2GMI C;  2KQ7 A;  1EF5 A;  4FUL A;  2FCM A;  3IFW B;  1R4N I;  3R7R A;  3PGE A;  1YX6 B;  5AZH A;  4NNJ B;  3W1S A;  2ZCB A;  1UEL A;  4K7S A;  5D7G A;  2M0X A;  2WWZ A;  3ZNI D;  2KD0 A;  2AEH A;  3PHX B;  3PRZ A;  2MRP A;  3ZRC A;  3VTV A;  2C7N B;  3QWZ B;  1YX5 B;  5JHB A;  2LXA A;  4GMV A;  4B9K A;  1E8Z A;  2KDI A;  3M63 B;  4F1S A;  2MW5 A;  4GDL B;  1FXT B;  4AUQ C;  1EF1 A;  4ANV A;  3QQ8 B;  3WIM A;  2EKE C;  1P9D U;  2G45 B;  4GDK B;  2HD5 B;  5AZG A;  3ZNG C;  1SE9 A;  4JQW C;  1VD2 A;  3ZTC A;  2A4Z A;  4HJK A;  4HWI B;  5E6N A;  5DPW A;  2MX2 A;  3QJZ A;  4IM2 A;  2JY6 A;  4DBG A;  1Y8R C;  2LWP A;  3ALB A;  1S1Q B;  4KDI C;  4JLC A;  4RM8 A;  2KTR A;  2DZK A;  2JPH A;  5L95 C;  5GMV A;  2KLC A;  4LDT D;  4AJY B;  5L83 A;  1OGW A;  3CF6 E;  1NDD A;  1WM2 A;  4ICU A;  2MCN B;  2DZI A;  3DVG Y;  2GBK A;  3APC A;  3MJW A;  1V49 A;  2KWV B;  1OEY J;  3SD5 A;  4BFR A;  5EDS A;  2L0F A;  3L17 A;  3KVF B;  1GNU A;  2CKH B;  2JF5 A;  3JSV B;  1E7V A;  2C9W B;  4ANU A;  1V6E A;  2FIF A;  4WJN A;  1NI2 A;  2BKF A;  1D3Z A;  3QAR A;  3EHV A;  4FLH A;  2FNJ B;  3V6C B;  4XX5 A;  3NZS A;  2VRR B;  2L8J A;  2N7E A;  2MQJ A;  2D10 A;  4HPL B;  4EUT A;  2BKR B;  4XZ4 A;  3HM3 A;  4KIK A;  2KK8 A;  2FID A;  2CS4 A;  2KJ6 A;  4MGZ E;  3TL5 A;  2LVQ A;  3VH4 B;  3C0R B;  2FCS A;  2KTF A;  3W1S C;  1SIF A;  4EKU A;  4EOY A;  4IG7 B;  4NJ6 A;  2IO1 B;  3IBE A;  3LJ3 A;  4GB9 A;  2JUO A;  3M62 B;  4HVB A;  3AU5 A;  3DVN V;  4HXD A;  2BWF A;  2K39 A;  4DDG D;  1UD7 A;  1NBF C;  1MG8 A;  2J0M A;  2ZVO A;  1E8Y A;  1UBI A;  4LCD E;  3UQB A;  5JH5 C;  2K8B A;  1XQQ A;  4RMA A;  2KTR B;  1F9J A;  2O6V A;  4RM9 A;  4W9L A;  2M1M A;  2BF8 B;  2KO3 A;  2KVR A;  3ZNZ B;  4IWO A;  1WGY A;  2B3A A;  2MA9 B;  3WA0 A;  4B6W A;  1J8C A;  4GN1 A;  2Z0E B;  3HM6 X;  3UQA A;  3ONS A;  4KDL B;  2BYE A;  2XBB C;  1UH6 A;  4BKG A;  4DK5 A;  1C3T A;  2MBH A;  1WZ3 A;  2KJH B;  3DOW A;  2KKC A;  3ZW3 A;  2C60 A;  3IHP C;  2L3Z A;  2ZVN A;  4GSW A;  1RLF A;  4HDQ A;  4KIK B;  3S2A A;  4WWP A;  2MBO A;  2C5L C;  1V81 A;  2LJ5 A;  2OOB B;  3T9L A;  4CHK A;  2WDT B;  4W9C A;  3H6N A;  4N9F 4;  2KFJ A;  3SU8 X;  1WM3 A;  2JXX A;  1WX7 A;  1X1M A;  2K8H A;  3HHM A;  2PE9 A;  4GGQ A;  4W9I A;  3R3M A;  2D11 A;  2RD0 A;  3VTU A;  2LXC A;  2KFK A;  2YVC A;  5KHQ A;  5DPT A;  3X23 A;  4MSM B;  3PLV A;  2JZZ A;  2AYO B;  2EMS A;  1JRU A;  4M8N A;  4MGI E;  1WGR A;  4W9G A;  4NQK E;  3WAN A;  2RSU A;  2WX1 A;  4GU2 A;  4MEL A;  2ZPY A;  5LXH A;  4BOZ B;  2N9X A;  2O6V B;  3NZU A;  2BGF A;  1UZX B;  4XC2 A;  1I35 A;  2HTH A;  3DDC B;  1OQY A;  3PLU A;  1E8W A;  4WJP A;  2C7M B;  3A9K A;  4FBJ B;  3PSE B;  2LRW A;  2MBE A;  2LD9 A;  1Z5S B;  3PVL A;  1YD8 U;  3IVF A;  2WYQ A;  3DCG A;  5BO4 B;  1GC6 A;  3VH3 B;  2N1W A;  3JSV A;  4EZK A;  2KMA A;  3I3T B;  1WGD A;  1TGZ B;  3PT2 B;  1J0G A;  2L76 A;  2AL3 A;  3B1L X;  5LLI A;  1RFA A;  3B0A A;  4WJQ A;  4FA6 A;  3KUD B;  2IYD B;  2RGF A;  4PS3 A;  2KX0 A;  5DPR A;  3ZKJ C;  4PS8 A;  4CYE A;  2MWS B;  5CHF A;  2BYF A;  4URK A;  3OAW A;  3A4R A;  1LQB A;  2G4D B;  1P1A A;  2QHO A;  3ECI A;  1WE6 A;  2KC1 A;  1UGM A;  1K8R B;  3U7D A;  4AOF A;  3N30 A;  1HE8 A;  3WAO A;  1UBQ A;  2KFK B;  2DAF A;  3K9O B;  4A20 A;  1Q0W B;  1S3S G;  5AEK B;  4JIO U;  2KDF B;  3BIN A;  2L05 A;  1Q5W B;  3V61 A;  3VFK A;  3VQI A;  1I42 A;  2LGD A;  4NAW A;  2DHZ A;  2KLG A;  3ZUN A;  4M0W B;  5JHA A;  3A1Q B;  2LI5 A;  3TCA A;  2BYV E;  4W9J A;  3PRP B;  2PJH A;  2FUH B;  4TQ1 A;  3A9K B;  2C7H A;  4E74 A;  1WYW B;  1WI0 A;  3L13 A;  3KW5 B;  4A3O A;  1CMX B;  1P98 A;  2NBU A;  3MHS D;  4DDI D;  1E8X A;  3PTF C;  4DWF A;  3B08 A;  3QIJ A;  1YIW A;  3UF8 A;  3Q3F A;  2ZNV B;  3PRM B;  2L0T A;  5CX3 A;  3DVG X;  1RAX A;  2KZR A;  2O6V D;  3ML8 A;  3PZD A;  2N1V A;  4G0N B;  1GUA B;  2IZV B;  2LGX A;  2IBI B;  3QC8 B;  1H8C A;  1WFY A;  4II2 B;  3ZDM C;  2ZNV C;  3VUX A;  3QAQ A;  2IY0 B;  1EUV B;  2IO2 B;  4ICV A;  1R4M I;  1WZ0 A;  3R7Q A;  2K8C A;  4HCP B;  1V5T A;  4P7I A;  3DQV A;  3HIZ A;  2CHZ A;  3QHT A;  3SHQ A;  4PS7 A;  4AWJ A;  5J17 A;  3U30 A;  4K81 A;  3DBR I;  2MBB B;  3JW0 X;  4I6L B;  5LXI B;  3W1Y A;  3APF A;  1Z2M A;  3UIO B;  3L08 A;  3O65 B;  4IWQ A;  4FJY A;  2AWT A;  4BOS C;  3ZRF A;  5E6O A;  2V3S A;  1YQB A;  4NAW B;  3CSF A;  1LXD A;  3AUL A;  4IM0 A;  2R2O A;  4DHJ B;  1Q1O A;  4B95 A;  3RT3 B;  4A3P A;  2XK5 A;  3JYU A;  3P2B A;  3ZTD A;  1KOT A;  2JRH A;  2EMT A;  3KYD D;  4IM3 A;  3VDZ A;  2MBQ A;  2ZEQ A;  4G11 A;  2DAJ A;  1V86 A;  2NBV B;  4AJW A;  1GC7 A;  2V1Y A;  1WF9 A;  2N9P C;  3AI5 A;  1E90 A;  4IWP A;  4II3 B;  2KAN A;  4IW0 A;  2PE6 B;  3VTW A;  4HK2 A;  3SDL C;  4ZRI A;  3JVZ X;  5J18 A;  3DVN U;  1L7Y A;  3WAP A;  2GBN A;  2NBW B;  4GOC A;  1GJZ A;  2ZZP B;  3Q3J A;  3AXC A;  2J0J A;  2LUE A;  2FCQ A;  3V60 A;  3ZVV A;  1H4R A;  2J0K A;  2KHW B;  3MTN B;  3A9J A;  3A33 B;  1KM7 A;  3K9P B;  4IC7 B;  2KXJ A;  3M95 A;  1WGG A;  3BY4 B;  4W9F A;  3ZIM A;  4ZDV A;  3DBS A;  4I6P A;  3V62 A;  3AU4 A;  5D94 A;  2HJ8 A;  3QA8 A;  1P0R A;  3CMM B;  2GBR A;  4OVV A;  4FHK A;  2K1F A;  4DXA B;  1G6J A;  3H9D A;  5TR5 A;  4ZRK A;  3WAM A;  1SGH A;  2NS5 A;  2YLM A;  3A1Q A;  2XK5 B;  1C1Y B;  4MDK E;  4M8M A;  2ZJD A;  3APD A;  3RZW C;  4NY0 A;  3VAW A;  1V9J A;  2K6D B;  2NR2 A;  1WGH A;  2DX5 B;  3A4S C;  2GBM A;  5CHV C;  3R66 C;  4W9H A;  1VCB A;  2KWC A;  3OLM D;  4FJZ A;  2LAS A;  3UIP B;  4DHJ D;  4BBN F;  1XT9 B;  4JGH B;  4FN2 A;  1WXS A;  3KYC D;  1PQS A;  4I6N B;  2NCN A;  3ZO5 B;  1U4A A;  3N3K B;  3L0W B;  2AL6 A;  2Y5B B;  3H7P A;  4K7W A;  2UWQ A;  1WXA A;  1V80 A;  3ZLZ A;  4DHZ B;  3L54 A;  5G55 A;  5J2R A;  3RUI B;  2RR9 A;  2V4L A;  1WR6 E;  2M4N A;  3EC8 A;  4FJV B;  1TBE A;  3A9J B;  4IUM B;  4WJO A;  4WQO B;  3VXW A;  2KOX A;  2LVP A;  4MGK E;  3RD2 A;  3TJP A;  1WX9 A;  2D2Q A;  1TTN A;  2DYM A;  5KHO A;  4ANW A;  2JT4 B;  3V6E B;  2WX0 A;  4K1R B;  1IPG A;  1WXV A;  5HKH A;  2N9E B;  2LGY A;  4MSQ B;  5DPS A;  4EEW A;  5IAA C;  2KMC A;  4AP4 C;  3OJ3 A;  2MSE D;  1WH3 A;  2J7Q B;  3DBH I;  4W9D A;  4MM3 A;  1WRD B;  2NPT A;  3DBL I;  4TUU A;  5C1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...