1OEYA

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'GSHMAYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyA00
5JHAA 1ZKHA 3KUZA 2NPTA 1GUAB 4FULA 3PREA 3ZW3A 4P7IA 3QX1A 2K6DB 4KSKC 1NBFC 2JPHA 3VH3B 1CMXB 2I1KA 4E3CA 2KTRA 2XBBC 5JH5C 3JSVB 5C1ZA 3H7PA 3DVNV 5AZHA 2V4LA 1Q0WB 2O6VA 4J6IA 2PE9A 3PHXB 1XD3B 4LDTB 4ZDVA 2LVQA 4IWPA 5C23A 2K25A 4B6WA 4HCPB 4XX5A 4JL9A 3QHTA 3CF6E 1OQYA 1WH3A 2K8BA 2O6VD 4M8NA 3IHPC 3R3MA 2WDTB 3IBEA 5D2MB 2D10A 3W1SC 5HKHA 2BKRB 4FA6A 2JUOA 2IO2B 4WJNA 1ZGUB 2IZVB 5DCNA 1TGZB 3SHQA 4AOFA 2JT4B 5KHOA 4URKA 1YX6B 4IWOA 2LWPA 4XZ4A 5J2RA 2UWQA 1LM8B 5KHQA 2MW5A 4FBJB 3B08A 2J7QB 2JZ3B 4HWIB 3TIXA 3QA8A 2CS4A 5CHVC 2NVUI 2JRHA 3EC8A 3ML9A 4MGIE 1V86A 1VCBA 3WAMA 3A33B 2GBMA 2NCNA 5AZFA 3L13A 2PPHA 4IG7B 4AUQC 4X57B 4KV2A 2G4DB 2MWSB 1X1MA 3VHTC 5IAAC 1WM2A 4EOYA 3DVGY 2KO3A 2BF8B 4HDOA 2N9XA 1J8CA 2R2QA 4M0WB 2M0XA 4W9LA 2FUHB 3RZFA 4WJOA 5G55A 3OAWA 1OEYA 2KKCA 3Q3JA 3PTFC 4MDKE 4DHZB 4KZCA 1WGRA 4II2B 4MH0E 5LXIB 2KX3A 2ZNVC 3DBSA 1Y8RC 4EFOA 3ECIA 3SU8X 2KJRA 1RRBA 3UINB 1GG3A 4GOCA 1AARA 3L16A 5L83A 3H7SA 2N7DA 4NPNA 2IY1B 1TTNA 3TMPB 2JRIB 4PYUA 5JHBA 1J19A 2ZVOA 3EHVA 4NAWB 2A4ZA 4K1RB 4DHJB 3VTVA 3I3TB 3U7DA 2WX0A 5E6OA 2J0KA 2MBEA 4OVVA 1EUVB 2KN5A 3GZNI 2FIDA 4TQ0A 4MSQB 4BFRA 3NZSA 3N3KB 1P3QU 2L76A 3NS8A 2BPSA 3VUWA 3PT2B 2KK8A 4W9GA 2K1FA 3L54A 2R2OA 3DQVA 3WIMA 2BWFA 2MA9B 3DDCB 1Z2MA 1E7UA 2ZZPB 2MBQA 4HDQA 3H1UA 3WAPA 1OTRB 2MSED 5CHWA 2LGDA 4PS7A 4PYZA 3CSFA 4A3OA 1WJ4A 2NBWB 2ASQA 4IM3A 2Y5BB 4IC7B 3A9JB 2L0FA 4DDID 4AWJA 2KDBA 4JLCA 4AP4C 2BYEA 2C7NB 2FCQA 4RM9A 1T0YA 3ZUNA 3M3JA 3Q3FA 3DPDA 3KW5B 2LI5A 1XQQA 4K81A 2KMAA 4E71A 2PEAA 5D7GA 3L08A 2K6QA 2O2VA 1EF5A 2KDEB 2RD0A 4TV3A 1KM7A 2BYFA 3A1QB 3ZNHB 1R4MI 2MP2A 1WX7A 3VUXA 4TUUA 2L8JA 4W9HA 2RSUA 3CSTA 3PPAA 2J0JA 3T8MA 4GDLB 1F9JA 4EZJA 3ZNGC 4MJSB 3PRMB 4ANXA 1NI2A 5IA7A 3VVWB 2IBIB 2NBVB 2B3AA 2KANA 3A4SC 4ICVA 1WR1A 4EUTA 3ZDTA 1UBIA 1WXAA 3H9DA 2M17A 1LFDA 2GBJA 1P0RA 4E74A 2JF5A 2L7RA 3LDZE 3S2AA 3ZO5B 2RPQA 5GMVA 3VUYA 4BOZB 2M4NA 2IY0B 1WMHB 4W9IA 2FCMA 2KXJA 2YLMA 2KQSA 2DZIA 2YVCA 5DPRA 3DCGA 2HTHA 2N1WA 1SE9A 2KJHB 3K9PB 4FJVB 4HCNB 1V9JA 4I6PA 3JYUA 1E5WA 3DVGX 2ZCBA 2ZPNA 3QIJA 1WF9A 1I42A 2KWVB 5J18A 3ZDMC 1V5TA 1WIAA 1YQBA 4IWQA 3EFUA 2WYQA 3IVFA 1Q5WB 5CX3A 2EMTA 2ZNVB 2DAFA 2IO1B 2KC2A 2NPTB 4EKUA 3IFWB 2KX0A 4MELA 1V2YA 1YJ1A 4CYEA 2KTFA 1UBQA 1WRDB 4JIOU 1WXVA 2AYOB 4LCDE 4NQKE 2AWTA 5AZGA 3QC8B 1WGHA 4I6LB 4CO7A 3ENEA 4MEMA 2KTRB 4NJ6A 3V61A 2AEHA 3QQ8B 2NS5A 3H7PB 4ZRJA 4DHZE 4GDKA 3L17A 2KFKB 2ZCCA 1WJ6A 1WXSA 2K8HA 4W9EA 1V80A 4EEWA 3MTNB 2KC1A 3ZTDA 1WE6A 4JGHB 4LJOB 2KDIA 1WX9A 1WR6E 2MRPA 3T9LA 2D11A 4DXAB 4NAWA 5AEKB 4HPMB 5CHFA 1QZEA 2N9EB 5E6PA 2V3SA 1NDDA 1UD7A 3LJ3A 3A9KA 1XT9B 3NZUA 4G3XB 4TQ1A 1P9DU 1YX5B 4BOSC 1EO6A 1A5RA 1H8CA 2DHZA 2XK5A 2RGFA 1SGHA 3O65B 4FHJA 3BINA 4GGQA 4TKNA 4DHJD 3TCAA 5LXHA 3ZLZA 2Z0EB 2DYBA 2K39A 4MGKE 2LJ5A 2DAJA 3V6CB 4MM3A 5J17A 4EZLA 2JXXA 3W1YA 2Z0DB 5D6JB 2WX1A 2KWUB 1YIWA 3PHWB 4WQOB 1WZ0A 4ASWC 4BKGA 4WWOA 3PLUA 1MG8A 1I35A 2LGYA 3AU4A 3RT3B 3WANA 1E90A 1S3SG 3BY4B 1P1AA 3ZNID 1C3TA 4NJ7A 2FCSA 3OJ4B 2AL6A 3AI5A 3UIPB 3PLVA 1Q1OA 1FXTB 2BGFA 4W9JA 3UGBB 2LZ6A 2DX5B 4G0NB 2JVCA 5DPSA 4KDLB 1WJNA 4I6NB 3OLMD 4BKSA 3P2BA 2KWCA 3ALBA 3DBRI 2GBRA 3V60A 4F8CB 2ZPYA 2ZEQA 3X0WA 2LXCA 3ONSA 3APDA 2FNJB 4BKSD 4FJYA 1ZW7A 2BWES 3L10B 1GNUA 3APFA 4GDLA 1UZXB 2KZRA 3U8ZA 3VDZA 4GB9A 4KIKB 3R7RA 4ZYNA 3U30A 1UH6A 1J0GA 3JSVA 1E8ZA 2C9WB 3KUCB 2NR2A 5L95C 3WA0A 4K7UA 4BKTA 2D3GA 1WYWB 3SDLC 3M62B 2ZVNA 4FLHA 3ML8A 4GU2A 1WM3A 2AL3A 3SD5A 3C0RB 1L7YA 3TJPA 2GOWA 3OJ3A 2LGXA 1Z5SB 2LD9A 5LLIA 4IM2A 4K7SA 3ZTCA 3DBLI 1GJZA 1HE8A 1WJUA 2PE6B 4LDTD 2JZZA 3HIZA 2N7EA 4NY0A 3TBLD 4IW0A 2CHZA 3KUDB 3VH4B 1YD8U 3QJZA 3K9OB 3PV1A 4F1SA 2GMIC 3RZWC 1D3ZA 3DVNU 3N30A 3ZKJC 1K8RB 2CHXA 5D94A 2ZJDA 3IG3A 3RD2A 3VTWA 3ZRCA 4HJKA 3ZVVA 4DBGA 2OOBB 2N9PC 4N9F4 2DYMA 4WAAA 2L00B 4K7WA 4KVGB 2LRWA 2LASA 3APCA 3QARA 2G3QB 3VXWA 3JVZX 2L05A 3WAOA 2KJ6A 2O2VB 3UF8A 1U4AA 1VD2A 1PQSA 1V49A 2KFJA 2J0MA 4ZRIA 4FHKA 4BBNC 2XEWA 4HLEA 2V1YA 3NHEB 2KFKA 3VAWA 1WGDA 4DWFA 3KYCD 2FIFA 1M94A 2EMSA 2MP2B 4YL8A 2MQJA 2MCNB 4EZKA 2LXAA 2QHOA 4RMAA 4W9DA 4BBNF 4B95A 1UELA 3HHMA 4KZ0A 1GC7A 3PRZA 3HK0A 4HVBA 1WE7A 2L0TA 5DPTA 1LQBA 1GC6A 2RR9A 2CR5A 1TZ1A 2KOXA 3PRPB 3NOBA 3N32A 4HPLB 2C7HA 3DOWA 4NNJB 2G45B 3DBHI 3PSEB 3QAQA 1KLVA 5BO4B 4GN1A 2CHWA 3NY5A 3QWZB 3R66C 4ANUA 1OGWA 2O6VB 3R7QA 3UQBA 4MSMB 4M8MA 1UGMA 4XC2A 1EF1A 4A20A 2DZJA 3M95A 4BVUC 4NQLB 2DZMA 3CMMB 1P98A 2DENB 4HXDA 5CTRC 3PVLA 4IM0A 3X23A 1IYFA 1WFYA 1WXMA 2WWZA 2K8CA 4LJPB 4ZRKA 4AJWA 4DDGD 2MBHA 4OVUA 3QCAA 4G11A 1WX8A 2GBKA 2C7MB 1KJTA 4MGZE 3PZDA 1IP9A 2C5LC 1WY8A 3A4RA 2KLCA 4II3B 2N1VA 4AJYB 2PJHA 2LVOA 2KHWB 2KNBA 3PGEA 3WALA 1V6EA 1R4NI 2LVPA 2HJ8A 4ANWA 1C1YB 2KVRA 3ZIMA 2FCNA 1ISNA 5E6NA 2OJRA 2W9NA 3B0AA 3KH0A 3A9JA 3RUIB 2JY6A 3B1LX 1RAXA 3VTUA 2N4FA 4FADA 1OEYJ 3VQIA 1TBEA 3RYTA 5TR5A 4GDKB 1G6JA 1H4RA 1V81A 3KVFB 2IYDB 1SIFA 2D07B 1E8WA 1E7VA 2LUEA 2NBUA 2DYOA 2KDFB 2MLBA 4KIKA 4ANVA 2LRUA 2G4SA 2JWZA 2KMCA 4W9FA 4B9KA 4W9CA 2A5UA 2CU1A 2BYVE 4DK5A 3A1QA 2EKEC 2KLGA 1WI0A 4ICUA 2DZKA 3W1SA 2MBBB 3RULA 3ZRFA 4F7ZA 4CHKA 1IPGA 2M1MA 3A9KB 3H6NA 3JW0X 4FJZA 2C60A 2M8SA 2MX2A 3L0WB 3D32A 3PS6A 4GIVA 2XK5B 4GSWA 5DPWA 2IO3B 5FR6A 3VFKA 3ZNZB 4MJSA 1RFAA 2IO0B 3TL5A 1L2NA 3EECA 2VRRB 4IUMB 3RCZA 4WWNA 2D2QA 3AXCA 5EDSA 2Z59B 2L3ZA 2KQ7A 5JZEB 1WZ3A 4GXBA 2MBOA 2REXA 1WGGA 4G50A 4W9KA 4MGYE 5G2NA 1WMHA 1V5OA 2BKFA 3UIOB 3GOEA 4PS3A 1JRUA 3M63B 4A3PA 3AU5A 1WGYA 1KOTA 1E8YA 2UYZB 3V6EB 3V62A 1LXDA 4KSLC 2CKHB 3MJWA 4GMVA 4JQWC 1E8XA 2I1JA 3MHSD 4RM8A 2FAZA 4KDIC 2HD5B 2HE7A 3AULA 3KYDD 4WJQA 4WWPA 1RLFA 2KD0A 4WJPA 1S1QB 3QK0A 4HK2A 4PS8A 2GBNA 3HM6X 1BT0A 3UQAA 3HM3A 4FN2A
chains in the Genus database with same CATH superfamily
1ZKHA 1C76A 4FULA 3PREA 4LNFA 3ZW3A 2K6DB 4KSKC 1NBFC 1V1PB 3VH3B 2I1KA 4RNAA 2WXKA 1R4NB 1JRPA 1L4ZB 4ZHPA 2M56B 1B9RA 3CWIA 5C23A 2HTME 1VR9A 4M8NA 4XWWA 3IHPC 3R3MA 2WDTB 1P7FA 5D2MB 4FA6A 2JUOA 1ENFA 1I7HA 2WDVB 2G1EA 2AQ2B 5D3IB 4OHJA 1FRRA 3I63C 5J2RA 3AE4B 3R2TA 3LYYA 4FBJB 1D6EC 2BBCA 4HWIB 2JZ3B 3QA8A 1L4DB 4C56C 1VCBA 5AZFA 2PPHA 3EA6A 1DGJA 1VLBA 3TSSA 1T5XD 4MACA 4EOYA 2KO3A 2LEKA 2J4XA 4KGSA 2M0XA 4M01A 1SF0A 5IP4D 4KZCA 4II2B 2H88B 1GPXA 3R8BA 3L16A 5L83A 3AE8B 2JRIB 1J19A 1K53A 2ZVOA 5AUKA 2Y5CA 3I3TB 3L4PA 3URYA 1XLPA 1N62A 4BFRA 3FAHA 5HG2A 1P3QU 2L76A 2BPSA 4W9GA 3L54A 2BWFA 2MA9B 3DDCB 3NJTA 4UDUC 4HDQA 3H1UA 1QKZA 3R2IA 4PS7A 2QILA 4DDID 2KDBA 2E6XA 2BYEA 2FCQA 1T0YA 3DPDA 2PEAA 4C7ZA 5D7GA 2KDEB 1GB4A 2QJLA 1KM7A 2WNMA 3ZNHB 3RNAC 4TUUA 4WQMA 3NUHB 3RFZB 1UF0A 1OQQA 3GS2A 4MJSB 4ANXA 2NBVB 1XLOA 1LO5D 2M19A 2GBJA 4YTMB 1E0ZA 2L7RA 3AE1B 2RPQA 1MHXA 1BXTA 4W9IA 1N61A 2KXJA 2J53A 3Q3NC 2HTHA 1KLUD 1SE9A 3ZQ4A 2KJHB 4YSXB 4HCNB 4LNNA 2ZPNA 1TS4A 2INPE 1WF9A 1FNUA 1FFVA 1OFFA 4ZYSA 1V5TA 5GXGB 2WYQA 3IVFA 2EMTA 1NEKB 2ZNVB 4GLSC 2IO1B 3O13A 2WDRB 4MELA 1DYQA 2GB1A 3HVDA 3V3XA 2AWTA 3SEBA 1WGHA 3VR8B 4MEMA 1ZXHA 3V61A 2AEHA 3H7PB 1KRHA 3L17A 2KFKB 2ZCCA 1WXSA 3AECB 4W9EA 4K3CA 4EEWA 4LJOB 1XO3A 1WX9A 3KWVA 2WXNA 3N9YC 4HPMB 1QZEA 3P1MA 4OZCA 2V3SA 4ZRQA 3LJ3A 1N6ZA 1EO6A 2DHZA 3W5VB 2ZW1A 3BINA 4GGQA 3P4RB 2Y5PA 3ZLZA 2DYBA 2K39A 4MGKE 2JXXA 2Z0DB 5D6JB 3MC9A 1YIWA 4ARCA 1WZ0A 1EU3A 1MG8A 4EE2A 4YSZB 1S3SG 3BY4B 3AEDB 3AI5A 1ET9A 1FFUA 2BGFA 4W9JA 3AB5A 3UGBB 2LZ6A 5MPOA 2JVCA 3DWGC 3ALBA 1HA5A 3X0WA 2LXCA 4FJYA 1ZW7A 1JROA 2K3UA 2RDHA 4ZYNA 3U30A 1J0GA 3KUCB 3WA0A 1JALA 1SE3A 1WYWB 4RF1A 5BMHA 1V1OA 2ZVNA 3ML8A 2WXPA 4GU2A 4FLHA 4RGNA 3TJPA 4JX1C 1Z5SB 1WJUA 2JZZA 4NY0A 3VH4B 4C00A 3ZJUA 2DNFA 3DVNU 3N30A 3ZKJC 5D94A 4RGTA 4DBGA 1R7SA 4N9F4 3RNCC 4K7WA 2WXRA 4DXFA 1L5PA 1VD2A 1ZUD2 1ZPSA 3NHEB 2INDC 1RFKA 2KFKA 1NENB 3VAWA 2MP2B 2MCNB 1D4BA 3HHMA 1GC7A 3CIRB 4HVBA 2YEPF 4M0WA 2L0TA 4YXDB 4US9A 1B1ZA 2BB6A 2CR5A 3PRPB 3DOWA 3RPFC 3R66C 2LUMA 2BB5A 4ANUA 4L1BA 4MSMB 2ONQA 4NQLB 3CMMB 1P98A 2DENB 2W82A 3PVLA 4IM0A 3X23A 4LNOA 2C7MB 4MGZE 1WGKA 2WXGA 1GAQB 1IP9A 2WU5B 5IN7A 4AJYB 1YNTE 2L52A 4N6EB 3PGEA 1R4NI 2WXOA 1C1YB 2LGSA 1ISNA 5EE3A 3KH0A 1N60A 1RAXA 2OHFA 4FADA 3VQIA 4GDKB 1H4RA 3AE7B 3W2DA 1E7VA 1F0ZA 2G4SA 2JWZA 4M00A 4W9CA 2A5UA 1F2RC 2J52A 1SJED 1AN8A 4FXCA 1JWMD 4CHKA 3H6NA 5G5GA 2M8SA 4GIVA 1HQRD 2IO3B 5FR6A 3ZNZB 1MPEA 1L6UA 3TL5A 4US8A 2JYTA 1YJJA 1K51A 4G50A 1T0QC 4W9KA 1WYGA 1WMHA 2WXFA 3GOEA 4PS3A 2WXJA 1LXDA 2CKHB 1ET6A 4GMVA 3RNGC 2HD5B 3AULA 1JWUD 4WJQA 4WWPA 4HK2A 1JMLA 1L6VA 3HM6X 3UQAA 2NPTA 4RCOA 2JPHA 4E3CA 3I5JC 5AZHA 1P7EA 2V4LA 2JXTA 2MJ3A 4J6IA 2EKIA 2LVQA 3N1ZC 4XX5A 3TEZA 3QHTA 1OQYA 2K8BA 2O6VD 1UNSA 4HEA1 3W1SC 4AQ7A 2BKRB 1ZGUB 5HFYA 4B0EA 2JT4B 5KHOA 1XCTL 4URKA 3AEAB 3BYYB 4XZ4A 2UWQA 5C3JB 1LM8B 5KHQA 1KFYB 3B08A 1ZP0B 1RYJA 5IO9A 1C9FA 5CHVC 3ZGZA 2NVUI 3EC8A 4MGIE 1V86A 2GBMA 2HJ1A 2XN9C 4X57B 2MWSB 3VHTC 1WM2A 3TEWA 1TIFA 2BF8B 1N5XA 2R2QA 4RF0A 4W9LA 2W54A 1HTOA 3OAWA 1OEYA 1VDVA 3I9V1 5D3DA 5LXIB 2JWUA 4YWGG 1SIJA 4EFOA 3ECIA 4NZLB 1PUTA 1RRBA 1GG3A 4R3DA 4GOCA 3EFCA 4RH6A 2N7DA 3DHIC 4NPNA 2IY1B 1TTNA 1QOFA 1ZDXA 1I4XA 4K3BA 4PYUA 3BZDB 1SJHD 5JHBA 4DHJB 3U7DA 3Q3MC 2J0KA 4OVVA 2WU2B 2FIDA 4TQ0A 4MSQB 4YTPB 1I4GA 3OG5A 3WIMA 2R2OA 3U7ZA 3B9JA 1E7UA 3BWUD 2NBWB 4IM3A 2KDMA 4JLCA 2C7NB 2GI9A 5T8IA 3ZUNA 3Q3FA 3FILB 2LI5A 4K81A 4E71A 2K6QA 2O2VA 4BZAA 2BYFA 3HVZA 3VUXA 4W9HA 3CSTA 1EM7A 2QMTA 3BIID 4GDLB 1F9JA 2KN4A 1NI2A 5IA7A 1EWCA 2B3AA 4ICVA 1WR1A 4EUTA 1UBIA 3H9DA 2M17A 4HPPA 1P0RA 2JF5A 3S2AA 2K5PA 4YSYB 5GMVA 3VUYA 2MHJA 2IY0B 2WGSA 2DBYA 2YVCA 5DPRA 2KQSA 2DZIA 3ZJTA 1IBXA 1CZPA 1TYGB 2WXQA 4LLGM 2KWVB 3Q8CA 4WH4A 3TEXA 1WIAA 1YQBA 1Q5WB 2BS4B 2DLBA 2DAFA 2OJWA 2KC2A 2K0PA 4CYEA 1YJ1A 3RNBC 2KTFA 1UBQA 4NQKE 4CO7A 1KTKA 3QC8B 3ENEA 2KTRB 3QQ8B 2NS5A 4DHZE 2KAJA 4NJCA 1WJ6A 4PK1A 1QOAA 2ICIA 3ABVB 3VR9B 2KC1A 3ZTDA 4JGHB 2KDIA 4B0MA 1WR6E 2MRPA 3T9LA 2D11A 3AH7A 4DXAB 5AEKB 1T6BX 1I4QA 5E6PA 3A9KA 1XT9B 1YX5B 2D3CA 5TSSA 1L0YB 2Z0EB 2BS2B 4MM3A 1PDXA 2WX1A 4RFBA 1I35A 2LGYA 3WANA 5FK9C 1IGDA 3FILA 1AYFA 1ROEA 4XDCA 1C3TA 2FCSA 2AL6A 2BW2A 1FCCC 1FXTB 4G0NB 2DX5B 2J42A 4I6NB 3P2BA 2KWCA 4F8CB 2LMCA 1JWAD 2W3SA 3APDA 3ONSA 3RMKC 1N63A 4BKSD 3L10B 4GDLA 1WWTA 3BVMA 2KZRA 1V1PA 2E3TA 3B2GA 2QDFA 4BKTA 2L1AA 2D3GA 3SDLC 2WXHA 2N7JA 2AL3A 3LXFA 2EELA 3OJ3A 4J3OD 4ZHOA 4KKIA 2VZKD 4IM2A 3ZTCA 3DBLI 3VRBB 1HE8A 2WDQB 2X8XX 4LDTD 3AEGB 1VRAB 4IW0A 1YD8U 2ON8A 2CHXA 3ZVVA 4HJKA 3P4SB 1SXTA 2OOBB 2DYMA 3V05A 1FXIA 2L00B 3NS1A 2LASA 3QARA 1JW9D 3SR6A 3WAOA 3UF8A 1PQSA 3Q8FA 1EU4A 1V49A 2KFJA 2J0MA 4FHKA 4BBNC 2V1YA 1MI0A 1K52A 3U52E 2FIFA 1M94A 1NYRA 2EMSA 2LXAA 4RMAA 4W9DA 4BBNF 4KZ0A 3I57A 4KKJA 4ACFA 1WE7A 5DPTA 2W3RA 1LQBA 1GC6A 2KOXA 3AEEB 3NOBA 2C7HA 5BO4B 1GOZA 3QWZB 1OGWA 5BMGA 2KYWA 2WXLA 1A70A 1UGMA 1EF1A 2DZJA 2IDYA 4BVUC 4RGMA 2MJDA 4HROA 1FM0D 2K8CA 1TS5A 4OVUA 2KMMA 2NTSA 1KJTA 3PZDA 1WY8A 3A4RA 4II3B 2PJHA 3WALA 1V6EA 2HJ8A 1LGRA 2KVRA 5E6NA 1OQRA 2JY6A 1OEYJ 5IKCM 1TBEA 1MHHE 2QCZA 1V81A 1MVKA 1SIFA 1E8WA 1J7AA 2LJIA 2X38A 4KGTA 2KDFB 1I4PA 4W9FA 2SAKA 2BYVE 2DZKA 4F7ZA 2C60A 2XK5B 3BYTB 5DPWA 3VFKA 4MJSA 3MC8A 3EECA 2N0SB 2VRRB 2D2QA 5C2TB 2WLBA 3T3NA 1XXGA 1AW7A 2JU6X 3AE5B 1V5OA 4A3PA 2B76B 3AN1A 1WGYA 4A90A 2YEPB 1NI3A 2OEDA 4KSLC 4REZA 3MJWA 4JQWC 2I1JA 2FAZA 1QOGA 3KYDD 4WJPA 1S1QB 5EE0A 1BT0A 1TY2A 1TJEA 2WQYB 3NVWA 1GUAB 2BS3B 3GB1A 2QC8A 1QLBB 4P7IA 3QX1A 3KQ4A 1CMXB 2N9KA 5JH5C 3JSVB 3H7PA 1V8CA 2FUG1 3N20C 1Q0WB 2VZKB 2INCC 1XD3B 4LDTB 2K25A 1QF6A 1WH3A 3IBEA 4D2KA 3DHGC 4WJNA 3AV8A 2IZVB 5DCNA 3SHQA 1YX6B 4IWOA 1KF6B 2LWPA 2HDEA 2JZPA 4XYCA 4OZAA 2MW5A 3TIXA 2J7QB 4P6VF 2CS4A 1PGXA 2JRHA 3AEFB 2Z8LA 3A33B 4S0RA 3E9SA 2VH2A 2BQQA 3L13A 4IG7B 3SFEB 4AUQC 2NMQA 2G4DB 1X1MA 2I2YA 1HZ6A 2WS3B 3DVGY 3DWMA 2N9XA 1J8CA 2FUHB 4WJOA 1TT5B 2INNE 1JWBD 2KKCA 3Q3JA 3PTFC 3P4PB 3DBLB 5BMIA 3DBSA 1Y8RC 3E56A 2V3NA 2KJRA 4N59A 1NYQA 3IT6B 3IAS1 2PVGC 1AARA 2L32A 3H7SA 3TMPB 1HZ5A 3EHVA 4NAWB 2Y3AA 2RMMA 1C79A 4L23A 2WX0A 5E6OA 2MBEA 1EUVB 2KN5A 3U2SC 3N3KB 3NS8A 2VH1A 1E7PB 2BT6A 2KK8A 3P4QB 4LK0M 1QILA 1Q10A 2MBQA 3WAPA 1OTRB 2MSED 5CHWA 3CSFA 2ASQA 4PT5A 3A9JB 2L0FA 2PMVA 4HRSA 4AWJA 4HJGE 1HEZE 3M3JA 4USAA 1XQQA 1WSPA 3AE6B 4TV3A 3A1QB 2MP2A 1WX7A 3NVZA 4MH8A 1VZ7A 2L8JA 3PPAA 2J0JA 3T8MA 4CQNA 3PRMB 1VZ8A 3VVWB 2IBIB 4HKZE 4LNKA 3A4SC 2KANA 4RGOS 4IDIA 1WXAA 1IUEA 3ZO5B 2LHDA 4BOZB 3FKYA 3EUB2 1FEHA 4DXGA 2IJ0A 2WP9B 2N1WA 1E6EB 4M02A 1TS3A 4FJVB 1V9JA 4I6PA 3JYUA 1E5WA 3DVGX 2ZCBA 3P63A 2RDGA 3QIJA 3TUOA 3AE2B 3ZDMC 4IWQA 5CX3A 4Q2JA 3UI3A 2KVZA 3GZNB 4EKUA 4JIOU 4LCDE 2AYOB 5AZGA 2BVCA 1XEEA 1STEA 4GDKA 1V80A 2SEBD 4OZBA 4A9AA 4A55A 4ARIA 4NAWA 5CHFA 3RNFC 4BAXA 2KWDA 1NDDA 3NZUA 3VRAB 4G3XB 1DOYA 4TQ1A 1H8CA 2RGFA 1SGHA 3O65B 4FHJA 2QSDA 4TKNA 5LXHA 1R4MB 2LJ5A 2DAJA 3HUIA 3V6CB 5J17A 4EZLA 3W1YA 1T0SC 3PHWB 1YQ4B 4BKGA 4WWOA 3PLUA 1P1AA 5EE9A 1I4RA 1IGCA 3PO0A 1FNWA 1WJNA 3BK1A 1XF5L 1MG4A 2ZEQA 2FNJB 4JE3B 1UZXB 2FE8A 3U8ZA 5E6JA 3BVZA 4GB9A 3H8HA 3Q8AA 4KIKB 3R7RA 1E8ZA 2QEJC 2NR2A 4WAFA 1JQ4A 4OVZA 2KQ4X 4AS1A 1YMHE 4H2AA 1BUIC 1T3QA 2LGIA 5BYSA 3SD5A 1L7YA 3PZ7A 2GOWA 2JSVX 2LD9A 3KWLA 5LLIA 4K7SA 2CU3A 1GJZA 1JWSD 2PVOD 3TBLD 3TEYA 3QJZA 5EE1A 4F1SA 2GMIC 1PGBA 1K8RB 3VTWA 3ZRCA 1K50A 1QOBA 4WAAA 1EWYC 4KVGB 3APCA 3Q69A 1D5MC 2QIEB 2KJ6A 1U4AA 4ZRIA 5H8YE 2R61A 2XEWA 4HLEA 4N58A 2LHEA 2ACZB 5FKAC 4EZKA 2QHOA 1SB3C 3PRZA 4YT0B 1UGJA 3NRZA 4IKGA 1TZ1A 3AE3B 4NNJB 2G45B 3PSEB 3QAQA 1KLVA 2CHWA 3IT4B 3NY5A 3B2FA 1SSNA 2O6VB 3R7QA 3UQBA 1FMAD 3DBRB 2V4IB 1FXAA 3GE8C 4O1NA 5IOIA 4XC2A 4A20A 2DZMA 1IYFA 5CTRC 4HXDA 4TMAB 4ZRKA 4DDGD 2MBHA 1NVID 4G11A 2GBKA 4P16A 1XLQA 2CJNA 2LFIA 2KLCA 2N1VA 2LVPA 1FNVA 4ANWA 2W9NA 3RUIB 1FRDA 3VTUA 2N4FA 5TR5A 2AQ3B 2IYDB 2D07B 1KLGD 3Q2AC 2LUEA 4IOIE 2DYOA 1TKYA 1YN4A 2MLBA 3GP7A 4KIKA 2LRUA 3EGRA 4YTNB 2CU1A 2EKEC 4XDDA 1YQ3B 2MBBB 3RULA 3OWEB 4TSSA 1AWDA 2H89B 2MX2A 4GSWA 1RFAA 1L2NA 3RCZA 4WWNA 1F2RI 1PGAA 2L3ZA 2KQ7A 1WZ3A 2K22A 2MBOA 1WGGA 4MGYE 4C7YA 1MFWA 5G2NA 3AE9B 2V3PA 1L0VB 2BKFA 1SE4A 4JWSC 1FCLA 1KOTA 1E8YA 3DBHB 1CK1A 3V6EB 3V62A 1M4VA 4RM8A 4KDIC 5HI1A 5AUIA 2HE7A 2NTTA 1PYWD 5I4DA 2PIAA 3QK0A 1E9MA 1F1HA 1RWSA 1WRIA 4DQOC 2PW9A 2IO2B 4C80A 3HM3A 1FPYA 1C78A 1I4HA 5JHAA 1E10A 3KUZA 2IGDA 1J7CA 3ETRA 3PZ8A 4HKQA 2KTRA 2XBBC 2KACA 5C1ZA 1JCKB 3DVNV 3N1XC 2O6VA 1TZOA 2PE9A 3PHXB 4ZDVA 4IWPA 4B6WA 4HCPB 4JL9A 3CF6E 2PTLA 1FIQA 1ZE3D 5HKHA 2AQ1B 2D10A 3AM9A 1TGZB 4AOFA 2WXIA 5LNK1 1D5XC 1ZOYB 1L0XB 1CJEA 4XWTA 3ZJVA 2BYTA 3ML9A 3WAMA 2NCNA 4KV2A 4LNIA 5IAAC 2WHIA 2AX5A 4HDOA 4WWMA 4M0WB 3RZFA 3T3OA 3RN9C 2BTEA 5G55A 4MDKE 3N1YC 4DHZB 1WGRA 4MH0E 4QAYA 2MJEA 1SEBD 2KX3A 2ZNVC 4A6QA 3NZ3A 3SU8X 4P1BC 3UINB 5H92C 3NG0A 2A4ZA 2D3BA 4K1RB 3VTVA 3GZNI 2XNAC 3NZSA 1UWMA 3Q14C 3VUWA 3PT2B 2K1FA 3DQVA 1Z2MA 2ZZPB 2LGDA 4PYZA 4A3OA 1WJ4A 3AMZA 2Y5BB 4IC7B 1ZXIA 2FBWB 4AP4C 4RM9A 4ZRPA 3KW5B 2KMAA 1TY0A 3L08A 3BK2A 3Q8EA 1EF5A 2RD0A 2PLPA 4S17A 1R4MI 2D5GA 2DWQA 2I38A 2RSUA 3NVVA 4EZJA 3ZNGC 4A8XC 3ZDTA 2IGGA 5HHDG 1ESFA 1LFDA 4E74A 3LDZE 2D3AA 2M4NA 1WMHB 1SE2A 3J9CA 2FCMA 2YLMA 3DCGA 2MH7A 1VJKA 3K9PB 1I42A 2RPVA 4OW0A 1VZ6A 5J18A 1FD6A 3LB8C 3EFUA 3FC4A 1WXQA 2Q5WD 1ACCA 2NPTB 3AEBB 3IFWB 2KX0A 1V2YA 3C19A 1WRDB 1WXVA 3MFGA 2KT7A 4I6LB 4P1CC 4NJ6A 4ITKA 4ZRJA 2N9LA 5FR3A 1C4PA 1GB1A 2K8HA 3P42A 3MTNB 1WE6A 4WIPA 5BYQA 1HTQA 2N9EB 3Q6BA 3Q3OC 1UD7A 1YN3A 3C8YA 4BOSC 1P9DU 2XK5A 4KGRA 4DHJD 3TCAA 2IGHA 3SFDB 3DHHC 2K9XA 2PKOA 2W55A 5G5HA 1UUPA 1F77A 2KWUB 1V97A 4WURA 4WQOB 4ASWC 2TSSA 2L83A 3AU4A 3RT3B 3ZYYX 1E90A 1BMLC 4L2YA 3ZNID 1YJIA 2JYEA 3BVGA 3OJ4B 4NJ7A 1N5WA 4C4VB 2V0GA 1F52A 3PLVA 3UIPB 1Q1OA 5JXVA 1XCQL 5DPSA 2GRIA 2WXMA 1T0RC 4KDLB 3OLMD 4XGAB 4BKSA 3DBRI 2GBRA 3V60A 2ZPYA 1TS2A 2BWES 1GNUA 3APFA 3VDZA 3MP9A 1UH6A 3JSVA 2C9WB 5L95C 4K7UA 3M62B 1Y56A 3RI7C 1WM3A 3C0RB 2RDBC 2LGXA 2PE6B 2ZW0A 3KLSX 1SBBB 4ZOHC 3HIZA 2N7EA 3MC0B 2CHZA 3KUDB 3K9OB 3PV1A 1UWXA 2MEKA 2M0AA 3RZWC 1D3ZA 1MJDA 2ZJDA 3IG3A 3RD2A 1KH0A 2N9PC 3RNEC 2LRWA 2G3QB 3VXWA 3W9CB 1CQVA 3JVZX 2L05A 2O2VB 1RM6C 5BYRA 1WGDA 4DWFA 3KYCD 4YL8A 2MQJA 4LTUA 1C77A 4B95A 1UELA 2G9HD 3HK0A 1QT9A 2RR9A 3N32A 4HPLB 1YOVB 3DBHI 2CJOA 4GN1A 3GE3C 1XLNA 1TKEA 4M8MA 3M95A 4XE0A 4KX6B 1IBXB 1WFYA 1WXMA 2WWZA 4LJPB 4AJWA 3QCAA 3MJ5A 1WX8A 2C5LC 2JQRB 1J7BA 2JX5A 4C4VA 3MHZA 2LVOA 2KHWB 2UU7A 1YN5A 2KNBA 3ZXRA 2IPKD 3U4EG 3Q8BA 3ZIMA 1TKGA 2FCNA 2V9HA 2OJRA 3B0AA 3A9JA 1QQRA 3B1LX 3IAM1 3RYTA 3ZXVA 1G6JA 3KVFB 4MT5A 2NBUA 1DOXA 4ANVA 3IXSA 2KMCA 4B9KA 4DK5A 3A1QA 2KLGA 1WI0A 4ICUA 3WCQA 3W1SA 4NAMA 3ZRFA 1IPGA 2M1MA 3A9KB 2GLSA 3JW0X 4FJZA 3L0WB 3D32A 3PS6A 1D5ZC 2IO0B 1C4AA 1PFDA 4IUMB 1DOIA 3AXCA 4MM3B 5EDSA 2Z59B 5JZEB 4GXBA 1C4CA 4JWUC 1FO4A 2REXA 1ZDVA 1HXYD 3UIOB 3NVYA 1JRUA 3M63B 3AU5A 2UYZB 4JPSA 1E8XA 3MHSD 1RLFA 2KD0A 3W5UB 4PS8A 3HRDD 2GBNA 1A5RA 4FN2A
chains in the Genus database with same CATH topology
5JHAA 1ZKHA 3KUZA 2NPTA 1GUAB 4FULA 3PREA 3ZW3A 4P7IA 3QX1A 2K6DB 4KSKC 1NBFC 2JPHA 3VH3B 1CMXB 2I1KA 4E3CA 2KTRA 2XBBC 5JH5C 3JSVB 5C1ZA 3H7PA 3DVNV 5AZHA 2V4LA 1Q0WB 2O6VA 4J6IA 2PE9A 3PHXB 1XD3B 4LDTB 4ZDVA 2LVQA 4IWPA 5C23A 2K25A 4B6WA 4HCPB 4XX5A 4JL9A 3QHTA 3CF6E 1OQYA 1WH3A 2K8BA 2O6VD 4M8NA 3IHPC 3R3MA 2WDTB 3IBEA 5D2MB 2D10A 3W1SC 5HKHA 2BKRB 4FA6A 2JUOA 2IO2B 4WJNA 1ZGUB 2IZVB 5DCNA 1TGZB 3SHQA 4AOFA 2JT4B 5KHOA 4URKA 1YX6B 4IWOA 2LWPA 4XZ4A 5J2RA 2UWQA 1LM8B 5KHQA 2MW5A 4FBJB 3B08A 2J7QB 2JZ3B 4HWIB 3TIXA 3QA8A 2CS4A 5CHVC 2NVUI 2JRHA 3EC8A 3ML9A 4MGIE 1V86A 1VCBA 3WAMA 3A33B 2GBMA 2NCNA 5AZFA 3L13A 2PPHA 4IG7B 4AUQC 4X57B 4KV2A 2G4DB 2MWSB 1X1MA 3VHTC 5IAAC 1WM2A 4EOYA 3DVGY 2KO3A 2BF8B 4HDOA 2N9XA 1J8CA 2R2QA 4M0WB 2M0XA 4W9LA 2FUHB 3RZFA 4WJOA 5G55A 3OAWA 1OEYA 2KKCA 3Q3JA 3PTFC 4MDKE 4DHZB 4KZCA 1WGRA 4II2B 4MH0E 5LXIB 2KX3A 2ZNVC 3DBSA 1Y8RC 4EFOA 3ECIA 3SU8X 2KJRA 1RRBA 3UINB 1GG3A 4GOCA 1AARA 3L16A 5L83A 3H7SA 2N7DA 4NPNA 2IY1B 1TTNA 3TMPB 2JRIB 4PYUA 5JHBA 1J19A 2ZVOA 3EHVA 4NAWB 2A4ZA 4K1RB 4DHJB 3VTVA 3I3TB 3U7DA 2WX0A 5E6OA 2J0KA 2MBEA 4OVVA 1EUVB 2KN5A 3GZNI 2FIDA 4TQ0A 4MSQB 4BFRA 3NZSA 3N3KB 1P3QU 2L76A 3NS8A 2BPSA 3VUWA 3PT2B 2KK8A 4W9GA 2K1FA 3L54A 2R2OA 3DQVA 3WIMA 2BWFA 2MA9B 3DDCB 1Z2MA 1E7UA 2ZZPB 2MBQA 4HDQA 3H1UA 3WAPA 1OTRB 2MSED 5CHWA 2LGDA 4PS7A 4PYZA 3CSFA 4A3OA 1WJ4A 2NBWB 2ASQA 4IM3A 2Y5BB 4IC7B 3A9JB 2L0FA 4DDID 4AWJA 2KDBA 4JLCA 4AP4C 2BYEA 2C7NB 2FCQA 4RM9A 1T0YA 3ZUNA 3M3JA 3Q3FA 3DPDA 3KW5B 2LI5A 1XQQA 4K81A 2KMAA 4E71A 2PEAA 5D7GA 3L08A 2K6QA 2O2VA 1EF5A 2KDEB 2RD0A 4TV3A 1KM7A 2BYFA 3A1QB 3ZNHB 1R4MI 2MP2A 1WX7A 3VUXA 4TUUA 2L8JA 4W9HA 2RSUA 3CSTA 3PPAA 2J0JA 3T8MA 4GDLB 1F9JA 4EZJA 3ZNGC 4MJSB 3PRMB 4ANXA 1NI2A 5IA7A 3VVWB 2IBIB 2NBVB 2B3AA 2KANA 3A4SC 4ICVA 1WR1A 4EUTA 3ZDTA 1UBIA 1WXAA 3H9DA 2M17A 1LFDA 2GBJA 1P0RA 4E74A 2JF5A 2L7RA 3LDZE 3S2AA 3ZO5B 2RPQA 5GMVA 3VUYA 4BOZB 2M4NA 2IY0B 1WMHB 4W9IA 2FCMA 2KXJA 2YLMA 2KQSA 2DZIA 2YVCA 5DPRA 3DCGA 2HTHA 2N1WA 1SE9A 2KJHB 3K9PB 4FJVB 4HCNB 1V9JA 4I6PA 3JYUA 1E5WA 3DVGX 2ZCBA 2ZPNA 3QIJA 1WF9A 1I42A 2KWVB 5J18A 3ZDMC 1V5TA 1WIAA 1YQBA 4IWQA 3EFUA 2WYQA 3IVFA 1Q5WB 5CX3A 2EMTA 2ZNVB 2DAFA 2IO1B 2KC2A 2NPTB 4EKUA 3IFWB 2KX0A 4MELA 1V2YA 1YJ1A 4CYEA 2KTFA 1UBQA 1WRDB 4JIOU 1WXVA 2AYOB 4LCDE 4NQKE 2AWTA 5AZGA 3QC8B 1WGHA 4I6LB 4CO7A 3ENEA 4MEMA 2KTRB 4NJ6A 3V61A 2AEHA 3QQ8B 2NS5A 3H7PB 4ZRJA 4DHZE 4GDKA 3L17A 2KFKB 2ZCCA 1WJ6A 1WXSA 2K8HA 4W9EA 1V80A 4EEWA 3MTNB 2KC1A 3ZTDA 1WE6A 4JGHB 4LJOB 2KDIA 1WX9A 1WR6E 2MRPA 3T9LA 2D11A 4DXAB 4NAWA 5AEKB 4HPMB 5CHFA 1QZEA 2N9EB 5E6PA 2V3SA 1NDDA 1UD7A 3LJ3A 3A9KA 1XT9B 3NZUA 4G3XB 4TQ1A 1P9DU 1YX5B 4BOSC 1EO6A 1A5RA 1H8CA 2DHZA 2XK5A 2RGFA 1SGHA 3O65B 4FHJA 3BINA 4GGQA 4TKNA 4DHJD 3TCAA 5LXHA 3ZLZA 2Z0EB 2DYBA 2K39A 4MGKE 2LJ5A 2DAJA 3V6CB 4MM3A 5J17A 4EZLA 2JXXA 3W1YA 2Z0DB 5D6JB 2WX1A 2KWUB 1YIWA 3PHWB 4WQOB 1WZ0A 4ASWC 4BKGA 4WWOA 3PLUA 1MG8A 1I35A 2LGYA 3AU4A 3RT3B 3WANA 1E90A 1S3SG 3BY4B 1P1AA 3ZNID 1C3TA 4NJ7A 2FCSA 3OJ4B 2AL6A 3AI5A 3UIPB 3PLVA 1Q1OA 1FXTB 2BGFA 4W9JA 3UGBB 2LZ6A 2DX5B 4G0NB 2JVCA 5DPSA 4KDLB 1WJNA 4I6NB 3OLMD 4BKSA 3P2BA 2KWCA 3ALBA 3DBRI 2GBRA 3V60A 4F8CB 2ZPYA 2ZEQA 3X0WA 2LXCA 3ONSA 3APDA 2FNJB 4BKSD 4FJYA 1ZW7A 2BWES 3L10B 1GNUA 3APFA 4GDLA 1UZXB 2KZRA 3U8ZA 3VDZA 4GB9A 4KIKB 3R7RA 4ZYNA 3U30A 1UH6A 1J0GA 3JSVA 1E8ZA 2C9WB 3KUCB 2NR2A 5L95C 3WA0A 4K7UA 4BKTA 2D3GA 1WYWB 3SDLC 3M62B 2ZVNA 4FLHA 3ML8A 4GU2A 1WM3A 2AL3A 3SD5A 3C0RB 1L7YA 3TJPA 2GOWA 3OJ3A 2LGXA 1Z5SB 2LD9A 5LLIA 4IM2A 4K7SA 3ZTCA 3DBLI 1GJZA 1HE8A 1WJUA 2PE6B 4LDTD 2JZZA 3HIZA 2N7EA 4NY0A 3TBLD 4IW0A 2CHZA 3KUDB 3VH4B 1YD8U 3QJZA 3K9OB 3PV1A 4F1SA 2GMIC 3RZWC 1D3ZA 3DVNU 3N30A 3ZKJC 1K8RB 2CHXA 5D94A 2ZJDA 3IG3A 3RD2A 3VTWA 3ZRCA 4HJKA 3ZVVA 4DBGA 2OOBB 2N9PC 4N9F4 2DYMA 4WAAA 2L00B 4K7WA 4KVGB 2LRWA 2LASA 3APCA 3QARA 2G3QB 3VXWA 3JVZX 2L05A 3WAOA 2KJ6A 2O2VB 3UF8A 1U4AA 1VD2A 1PQSA 1V49A 2KFJA 2J0MA 4ZRIA 4FHKA 4BBNC 2XEWA 4HLEA 2V1YA 3NHEB 2KFKA 3VAWA 1WGDA 4DWFA 3KYCD 2FIFA 1M94A 2EMSA 2MP2B 4YL8A 2MQJA 2MCNB 4EZKA 2LXAA 2QHOA 4RMAA 4W9DA 4BBNF 4B95A 1UELA 3HHMA 4KZ0A 1GC7A 3PRZA 3HK0A 4HVBA 1WE7A 2L0TA 5DPTA 1LQBA 1GC6A 2RR9A 2CR5A 1TZ1A 2KOXA 3PRPB 3NOBA 3N32A 4HPLB 2C7HA 3DOWA 4NNJB 2G45B 3DBHI 3PSEB 3QAQA 1KLVA 5BO4B 4GN1A 2CHWA 3NY5A 3QWZB 3R66C 4ANUA 1OGWA 2O6VB 3R7QA 3UQBA 4MSMB 4M8MA 1UGMA 4XC2A 1EF1A 4A20A 2DZJA 3M95A 4BVUC 4NQLB 2DZMA 3CMMB 1P98A 2DENB 4HXDA 5CTRC 3PVLA 4IM0A 3X23A 1IYFA 1WFYA 1WXMA 2WWZA 2K8CA 4LJPB 4ZRKA 4AJWA 4DDGD 2MBHA 4OVUA 3QCAA 4G11A 1WX8A 2GBKA 2C7MB 1KJTA 4MGZE 3PZDA 1IP9A 2C5LC 1WY8A 3A4RA 2KLCA 4II3B 2N1VA 4AJYB 2PJHA 2LVOA 2KHWB 2KNBA 3PGEA 3WALA 1V6EA 1R4NI 2LVPA 2HJ8A 4ANWA 1C1YB 2KVRA 3ZIMA 2FCNA 1ISNA 5E6NA 2OJRA 2W9NA 3B0AA 3KH0A 3A9JA 3RUIB 2JY6A 3B1LX 1RAXA 3VTUA 2N4FA 4FADA 1OEYJ 3VQIA 1TBEA 3RYTA 5TR5A 4GDKB 1G6JA 1H4RA 1V81A 3KVFB 2IYDB 1SIFA 2D07B 1E8WA 1E7VA 2LUEA 2NBUA 2DYOA 2KDFB 2MLBA 4KIKA 4ANVA 2LRUA 2G4SA 2JWZA 2KMCA 4W9FA 4B9KA 4W9CA 2A5UA 2CU1A 2BYVE 4DK5A 3A1QA 2EKEC 2KLGA 1WI0A 4ICUA 2DZKA 3W1SA 2MBBB 3RULA 3ZRFA 4F7ZA 4CHKA 1IPGA 2M1MA 3A9KB 3H6NA 3JW0X 4FJZA 2C60A 2M8SA 2MX2A 3L0WB 3D32A 3PS6A 4GIVA 2XK5B 4GSWA 5DPWA 2IO3B 5FR6A 3VFKA 3ZNZB 4MJSA 1RFAA 2IO0B 3TL5A 1L2NA 3EECA 2VRRB 4IUMB 3RCZA 4WWNA 2D2QA 3AXCA 5EDSA 2Z59B 2L3ZA 2KQ7A 5JZEB 1WZ3A 4GXBA 2MBOA 2REXA 1WGGA 4G50A 4W9KA 4MGYE 5G2NA 1WMHA 1V5OA 2BKFA 3UIOB 3GOEA 4PS3A 1JRUA 3M63B 4A3PA 3AU5A 1WGYA 1KOTA 1E8YA 2UYZB 3V6EB 3V62A 1LXDA 4KSLC 2CKHB 3MJWA 4GMVA 4JQWC 1E8XA 2I1JA 3MHSD 4RM8A 2FAZA 4KDIC 2HD5B 2HE7A 3AULA 3KYDD 4WJQA 4WWPA 1RLFA 2KD0A 4WJPA 1S1QB 3QK0A 4HK2A 4PS8A 2GBNA 3HM6X 1BT0A 3UQAA 3HM3A 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHA A;  1ZKH A;  3KUZ A;  2NPT A;  1GUA B;  4FUL A;  3PRE A;  3ZW3 A;  4P7I A;  3QX1 A;  2K6D B;  4KSK C;  1NBF C;  2JPH A;  3VH3 B;  1CMX B;  2I1K A;  4E3C A;  2KTR A;  2XBB C;  5JH5 C;  3JSV B;  5C1Z A;  3H7P A;  3DVN V;  5AZH A;  2V4L A;  1Q0W B;  2O6V A;  4J6I A;  2PE9 A;  3PHX B;  1XD3 B;  4LDT B;  4ZDV A;  2LVQ A;  4IWP A;  5C23 A;  2K25 A;  4B6W A;  4HCP B;  4XX5 A;  4JL9 A;  3QHT A;  3CF6 E;  1OQY A;  1WH3 A;  2K8B A;  2O6V D;  4M8N A;  3IHP C;  3R3M A;  2WDT B;  3IBE A;  5D2M B;  2D10 A;  3W1S C;  5HKH A;  2BKR B;  4FA6 A;  2JUO A;  2IO2 B;  4WJN A;  1ZGU B;  2IZV B;  5DCN A;  1TGZ B;  3SHQ A;  4AOF A;  2JT4 B;  5KHO A;  4URK A;  1YX6 B;  4IWO A;  2LWP A;  4XZ4 A;  5J2R A;  2UWQ A;  1LM8 B;  5KHQ A;  2MW5 A;  4FBJ B;  3B08 A;  2J7Q B;  2JZ3 B;  4HWI B;  3TIX A;  3QA8 A;  2CS4 A;  5CHV C;  2NVU I;  2JRH A;  3EC8 A;  3ML9 A;  4MGI E;  1V86 A;  1VCB A;  3WAM A;  3A33 B;  2GBM A;  2NCN A;  5AZF A;  3L13 A;  2PPH A;  4IG7 B;  4AUQ C;  4X57 B;  4KV2 A;  2G4D B;  2MWS B;  1X1M A;  3VHT C;  5IAA C;  1WM2 A;  4EOY A;  3DVG Y;  2KO3 A;  2BF8 B;  4HDO A;  2N9X A;  1J8C A;  2R2Q A;  4M0W B;  2M0X A;  4W9L A;  2FUH B;  3RZF A;  4WJO A;  5G55 A;  3OAW A;  1OEY A;  2KKC A;  3Q3J A;  3PTF C;  4MDK E;  4DHZ B;  4KZC A;  1WGR A;  4II2 B;  4MH0 E;  5LXI B;  2KX3 A;  2ZNV C;  3DBS A;  1Y8R C;  4EFO A;  3ECI A;  3SU8 X;  2KJR A;  1RRB A;  3UIN B;  1GG3 A;  4GOC A;  1AAR A;  3L16 A;  5L83 A;  3H7S A;  2N7D A;  4NPN A;  2IY1 B;  1TTN A;  3TMP B;  2JRI B;  4PYU A;  5JHB A;  1J19 A;  2ZVO A;  3EHV A;  4NAW B;  2A4Z A;  4K1R B;  4DHJ B;  3VTV A;  3I3T B;  3U7D A;  2WX0 A;  5E6O A;  2J0K A;  2MBE A;  4OVV A;  1EUV B;  2KN5 A;  3GZN I;  2FID A;  4TQ0 A;  4MSQ B;  4BFR A;  3NZS A;  3N3K B;  1P3Q U;  2L76 A;  3NS8 A;  2BPS A;  3VUW A;  3PT2 B;  2KK8 A;  4W9G A;  2K1F A;  3L54 A;  2R2O A;  3DQV A;  3WIM A;  2BWF A;  2MA9 B;  3DDC B;  1Z2M A;  1E7U A;  2ZZP B;  2MBQ A;  4HDQ A;  3H1U A;  3WAP A;  1OTR B;  2MSE D;  5CHW A;  2LGD A;  4PS7 A;  4PYZ A;  3CSF A;  4A3O A;  1WJ4 A;  2NBW B;  2ASQ A;  4IM3 A;  2Y5B B;  4IC7 B;  3A9J B;  2L0F A;  4DDI D;  4AWJ A;  2KDB A;  4JLC A;  4AP4 C;  2BYE A;  2C7N B;  2FCQ A;  4RM9 A;  1T0Y A;  3ZUN A;  3M3J A;  3Q3F A;  3DPD A;  3KW5 B;  2LI5 A;  1XQQ A;  4K81 A;  2KMA A;  4E71 A;  2PEA A;  5D7G A;  3L08 A;  2K6Q A;  2O2V A;  1EF5 A;  2KDE B;  2RD0 A;  4TV3 A;  1KM7 A;  2BYF A;  3A1Q B;  3ZNH B;  1R4M I;  2MP2 A;  1WX7 A;  3VUX A;  4TUU A;  2L8J A;  4W9H A;  2RSU A;  3CST A;  3PPA A;  2J0J A;  3T8M A;  4GDL B;  1F9J A;  4EZJ A;  3ZNG C;  4MJS B;  3PRM B;  4ANX A;  1NI2 A;  5IA7 A;  3VVW B;  2IBI B;  2NBV B;  2B3A A;  2KAN A;  3A4S C;  4ICV A;  1WR1 A;  4EUT A;  3ZDT A;  1UBI A;  1WXA A;  3H9D A;  2M17 A;  1LFD A;  2GBJ A;  1P0R A;  4E74 A;  2JF5 A;  2L7R A;  3LDZ E;  3S2A A;  3ZO5 B;  2RPQ A;  5GMV A;  3VUY A;  4BOZ B;  2M4N A;  2IY0 B;  1WMH B;  4W9I A;  2FCM A;  2KXJ A;  2YLM A;  2KQS A;  2DZI A;  2YVC A;  5DPR A;  3DCG A;  2HTH A;  2N1W A;  1SE9 A;  2KJH B;  3K9P B;  4FJV B;  4HCN B;  1V9J A;  4I6P A;  3JYU A;  1E5W A;  3DVG X;  2ZCB A;  2ZPN A;  3QIJ A;  1WF9 A;  1I42 A;  2KWV B;  5J18 A;  3ZDM C;  1V5T A;  1WIA A;  1YQB A;  4IWQ A;  3EFU A;  2WYQ A;  3IVF A;  1Q5W B;  5CX3 A;  2EMT A;  2ZNV B;  2DAF A;  2IO1 B;  2KC2 A;  2NPT B;  4EKU A;  3IFW B;  2KX0 A;  4MEL A;  1V2Y A;  1YJ1 A;  4CYE A;  2KTF A;  1UBQ A;  1WRD B;  4JIO U;  1WXV A;  2AYO B;  4LCD E;  4NQK E;  2AWT A;  5AZG A;  3QC8 B;  1WGH A;  4I6L B;  4CO7 A;  3ENE A;  4MEM A;  2KTR B;  4NJ6 A;  3V61 A;  2AEH A;  3QQ8 B;  2NS5 A;  3H7P B;  4ZRJ A;  4DHZ E;  4GDK A;  3L17 A;  2KFK B;  2ZCC A;  1WJ6 A;  1WXS A;  2K8H A;  4W9E A;  1V80 A;  4EEW A;  3MTN B;  2KC1 A;  3ZTD A;  1WE6 A;  4JGH B;  4LJO B;  2KDI A;  1WX9 A;  1WR6 E;  2MRP A;  3T9L A;  2D11 A;  4DXA B;  4NAW A;  5AEK B;  4HPM B;  5CHF A;  1QZE A;  2N9E B;  5E6P A;  2V3S A;  1NDD A;  1UD7 A;  3LJ3 A;  3A9K A;  1XT9 B;  3NZU A;  4G3X B;  4TQ1 A;  1P9D U;  1YX5 B;  4BOS C;  1EO6 A;  1A5R A;  1H8C A;  2DHZ A;  2XK5 A;  2RGF A;  1SGH A;  3O65 B;  4FHJ A;  3BIN A;  4GGQ A;  4TKN A;  4DHJ D;  3TCA A;  5LXH A;  3ZLZ A;  2Z0E B;  2DYB A;  2K39 A;  4MGK E;  2LJ5 A;  2DAJ A;  3V6C B;  4MM3 A;  5J17 A;  4EZL A;  2JXX A;  3W1Y A;  2Z0D B;  5D6J B;  2WX1 A;  2KWU B;  1YIW A;  3PHW B;  4WQO B;  1WZ0 A;  4ASW C;  4BKG A;  4WWO A;  3PLU A;  1MG8 A;  1I35 A;  2LGY A;  3AU4 A;  3RT3 B;  3WAN A;  1E90 A;  1S3S G;  3BY4 B;  1P1A A;  3ZNI D;  1C3T A;  4NJ7 A;  2FCS A;  3OJ4 B;  2AL6 A;  3AI5 A;  3UIP B;  3PLV A;  1Q1O A;  1FXT B;  2BGF A;  4W9J A;  3UGB B;  2LZ6 A;  2DX5 B;  4G0N B;  2JVC A;  5DPS A;  4KDL B;  1WJN A;  4I6N B;  3OLM D;  4BKS A;  3P2B A;  2KWC A;  3ALB A;  3DBR I;  2GBR A;  3V60 A;  4F8C B;  2ZPY A;  2ZEQ A;  3X0W A;  2LXC A;  3ONS A;  3APD A;  2FNJ B;  4BKS D;  4FJY A;  1ZW7 A;  2BWE S;  3L10 B;  1GNU A;  3APF A;  4GDL A;  1UZX B;  2KZR A;  3U8Z A;  3VDZ A;  4GB9 A;  4KIK B;  3R7R A;  4ZYN A;  3U30 A;  1UH6 A;  1J0G A;  3JSV A;  1E8Z A;  2C9W B;  3KUC B;  2NR2 A;  5L95 C;  3WA0 A;  4K7U A;  4BKT A;  2D3G A;  1WYW B;  3SDL C;  3M62 B;  2ZVN A;  4FLH A;  3ML8 A;  4GU2 A;  1WM3 A;  2AL3 A;  3SD5 A;  3C0R B;  1L7Y A;  3TJP A;  2GOW A;  3OJ3 A;  2LGX A;  1Z5S B;  2LD9 A;  5LLI A;  4IM2 A;  4K7S A;  3ZTC A;  3DBL I;  1GJZ A;  1HE8 A;  1WJU A;  2PE6 B;  4LDT D;  2JZZ A;  3HIZ A;  2N7E A;  4NY0 A;  3TBL D;  4IW0 A;  2CHZ A;  3KUD B;  3VH4 B;  1YD8 U;  3QJZ A;  3K9O B;  3PV1 A;  4F1S A;  2GMI C;  3RZW C;  1D3Z A;  3DVN U;  3N30 A;  3ZKJ C;  1K8R B;  2CHX A;  5D94 A;  2ZJD A;  3IG3 A;  3RD2 A;  3VTW A;  3ZRC A;  4HJK A;  3ZVV A;  4DBG A;  2OOB B;  2N9P C;  4N9F 4;  2DYM A;  4WAA A;  2L00 B;  4K7W A;  4KVG B;  2LRW A;  2LAS A;  3APC A;  3QAR A;  2G3Q B;  3VXW A;  3JVZ X;  2L05 A;  3WAO A;  2KJ6 A;  2O2V B;  3UF8 A;  1U4A A;  1VD2 A;  1PQS A;  1V49 A;  2KFJ A;  2J0M A;  4ZRI A;  4FHK A;  4BBN C;  2XEW A;  4HLE A;  2V1Y A;  3NHE B;  2KFK A;  3VAW A;  1WGD A;  4DWF A;  3KYC D;  2FIF A;  1M94 A;  2EMS A;  2MP2 B;  4YL8 A;  2MQJ A;  2MCN B;  4EZK A;  2LXA A;  2QHO A;  4RMA A;  4W9D A;  4BBN F;  4B95 A;  1UEL A;  3HHM A;  4KZ0 A;  1GC7 A;  3PRZ A;  3HK0 A;  4HVB A;  1WE7 A;  2L0T A;  5DPT A;  1LQB A;  1GC6 A;  2RR9 A;  2CR5 A;  1TZ1 A;  2KOX A;  3PRP B;  3NOB A;  3N32 A;  4HPL B;  2C7H A;  3DOW A;  4NNJ B;  2G45 B;  3DBH I;  3PSE B;  3QAQ A;  1KLV A;  5BO4 B;  4GN1 A;  2CHW A;  3NY5 A;  3QWZ B;  3R66 C;  4ANU A;  1OGW A;  2O6V B;  3R7Q A;  3UQB A;  4MSM B;  4M8M A;  1UGM A;  4XC2 A;  1EF1 A;  4A20 A;  2DZJ A;  3M95 A;  4BVU C;  4NQL B;  2DZM A;  3CMM B;  1P98 A;  2DEN B;  4HXD A;  5CTR C;  3PVL A;  4IM0 A;  3X23 A;  1IYF A;  1WFY A;  1WXM A;  2WWZ A;  2K8C A;  4LJP B;  4ZRK A;  4AJW A;  4DDG D;  2MBH A;  4OVU A;  3QCA A;  4G11 A;  1WX8 A;  2GBK A;  2C7M B;  1KJT A;  4MGZ E;  3PZD A;  1IP9 A;  2C5L C;  1WY8 A;  3A4R A;  2KLC A;  4II3 B;  2N1V A;  4AJY B;  2PJH A;  2LVO A;  2KHW B;  2KNB A;  3PGE A;  3WAL A;  1V6E A;  1R4N I;  2LVP A;  2HJ8 A;  4ANW A;  1C1Y B;  2KVR A;  3ZIM A;  2FCN A;  1ISN A;  5E6N A;  2OJR A;  2W9N A;  3B0A A;  3KH0 A;  3A9J A;  3RUI B;  2JY6 A;  3B1L X;  1RAX A;  3VTU A;  2N4F A;  4FAD A;  1OEY J;  3VQI A;  1TBE A;  3RYT A;  5TR5 A;  4GDK B;  1G6J A;  1H4R A;  1V81 A;  3KVF B;  2IYD B;  1SIF A;  2D07 B;  1E8W A;  1E7V A;  2LUE A;  2NBU A;  2DYO A;  2KDF B;  2MLB A;  4KIK A;  4ANV A;  2LRU A;  2G4S A;  2JWZ A;  2KMC A;  4W9F A;  4B9K A;  4W9C A;  2A5U A;  2CU1 A;  2BYV E;  4DK5 A;  3A1Q A;  2EKE C;  2KLG A;  1WI0 A;  4ICU A;  2DZK A;  3W1S A;  2MBB B;  3RUL A;  3ZRF A;  4F7Z A;  4CHK A;  1IPG A;  2M1M A;  3A9K B;  3H6N A;  3JW0 X;  4FJZ A;  2C60 A;  2M8S A;  2MX2 A;  3L0W B;  3D32 A;  3PS6 A;  4GIV A;  2XK5 B;  4GSW A;  5DPW A;  2IO3 B;  5FR6 A;  3VFK A;  3ZNZ B;  4MJS A;  1RFA A;  2IO0 B;  3TL5 A;  1L2N A;  3EEC A;  2VRR B;  4IUM B;  3RCZ A;  4WWN A;  2D2Q A;  3AXC A;  5EDS A;  2Z59 B;  2L3Z A;  2KQ7 A;  5JZE B;  1WZ3 A;  4GXB A;  2MBO A;  2REX A;  1WGG A;  4G50 A;  4W9K A;  4MGY E;  5G2N A;  1WMH A;  1V5O A;  2BKF A;  3UIO B;  3GOE A;  4PS3 A;  1JRU A;  3M63 B;  4A3P A;  3AU5 A;  1WGY A;  1KOT A;  1E8Y A;  2UYZ B;  3V6E B;  3V62 A;  1LXD A;  4KSL C;  2CKH B;  3MJW A;  4GMV A;  4JQW C;  1E8X A;  2I1J A;  3MHS D;  4RM8 A;  2FAZ A;  4KDI C;  2HD5 B;  2HE7 A;  3AUL A;  3KYD D;  4WJQ A;  4WWP A;  1RLF A;  2KD0 A;  4WJP A;  1S1Q B;  3QK0 A;  4HK2 A;  4PS8 A;  2GBN A;  3HM6 X;  1BT0 A;  3UQA A;  3HM3 A;  4FN2 A; 
#chains in the Genus database with same CATH topology
 1ZKH A;  1C76 A;  4FUL A;  3PRE A;  4LNF A;  3ZW3 A;  2K6D B;  4KSK C;  1NBF C;  1V1P B;  3VH3 B;  2I1K A;  4RNA A;  2WXK A;  1R4N B;  1JRP A;  1L4Z B;  4ZHP A;  2M56 B;  1B9R A;  3CWI A;  5C23 A;  2HTM E;  1VR9 A;  4M8N A;  4XWW A;  3IHP C;  3R3M A;  2WDT B;  1P7F A;  5D2M B;  4FA6 A;  2JUO A;  1ENF A;  1I7H A;  2WDV B;  2G1E A;  2AQ2 B;  5D3I B;  4OHJ A;  1FRR A;  3I63 C;  5J2R A;  3AE4 B;  3R2T A;  3LYY A;  4FBJ B;  1D6E C;  2BBC A;  4HWI B;  2JZ3 B;  3QA8 A;  1L4D B;  4C56 C;  1VCB A;  5AZF A;  2PPH A;  3EA6 A;  1DGJ A;  1VLB A;  3TSS A;  1T5X D;  4MAC A;  4EOY A;  2KO3 A;  2LEK A;  2J4X A;  4KGS A;  2M0X A;  4M01 A;  1SF0 A;  5IP4 D;  4KZC A;  4II2 B;  2H88 B;  1GPX A;  3R8B A;  3L16 A;  5L83 A;  3AE8 B;  2JRI B;  1J19 A;  1K53 A;  2ZVO A;  5AUK A;  2Y5C A;  3I3T B;  3L4P A;  3URY A;  1XLP A;  1N62 A;  4BFR A;  3FAH A;  5HG2 A;  1P3Q U;  2L76 A;  2BPS A;  4W9G A;  3L54 A;  2BWF A;  2MA9 B;  3DDC B;  3NJT A;  4UDU C;  4HDQ A;  3H1U A;  1QKZ A;  3R2I A;  4PS7 A;  2QIL A;  4DDI D;  2KDB A;  2E6X A;  2BYE A;  2FCQ A;  1T0Y A;  3DPD A;  2PEA A;  4C7Z A;  5D7G A;  2KDE B;  1GB4 A;  2QJL A;  1KM7 A;  2WNM A;  3ZNH B;  3RNA C;  4TUU A;  4WQM A;  3NUH B;  3RFZ B;  1UF0 A;  1OQQ A;  3GS2 A;  4MJS B;  4ANX A;  2NBV B;  1XLO A;  1LO5 D;  2M19 A;  2GBJ A;  4YTM B;  1E0Z A;  2L7R A;  3AE1 B;  2RPQ A;  1MHX A;  1BXT A;  4W9I A;  1N61 A;  2KXJ A;  2J53 A;  3Q3N C;  2HTH A;  1KLU D;  1SE9 A;  3ZQ4 A;  2KJH B;  4YSX B;  4HCN B;  4LNN A;  2ZPN A;  1TS4 A;  2INP E;  1WF9 A;  1FNU A;  1FFV A;  1OFF A;  4ZYS A;  1V5T A;  5GXG B;  2WYQ A;  3IVF A;  2EMT A;  1NEK B;  2ZNV B;  4GLS C;  2IO1 B;  3O13 A;  2WDR B;  4MEL A;  1DYQ A;  2GB1 A;  3HVD A;  3V3X A;  2AWT A;  3SEB A;  1WGH A;  3VR8 B;  4MEM A;  1ZXH A;  3V61 A;  2AEH A;  3H7P B;  1KRH A;  3L17 A;  2KFK B;  2ZCC A;  1WXS A;  3AEC B;  4W9E A;  4K3C A;  4EEW A;  4LJO B;  1XO3 A;  1WX9 A;  3KWV A;  2WXN A;  3N9Y C;  4HPM B;  1QZE A;  3P1M A;  4OZC A;  2V3S A;  4ZRQ A;  3LJ3 A;  1N6Z A;  1EO6 A;  2DHZ A;  3W5V B;  2ZW1 A;  3BIN A;  4GGQ A;  3P4R B;  2Y5P A;  3ZLZ A;  2DYB A;  2K39 A;  4MGK E;  2JXX A;  2Z0D B;  5D6J B;  3MC9 A;  1YIW A;  4ARC A;  1WZ0 A;  1EU3 A;  1MG8 A;  4EE2 A;  4YSZ B;  1S3S G;  3BY4 B;  3AED B;  3AI5 A;  1ET9 A;  1FFU A;  2BGF A;  4W9J A;  3AB5 A;  3UGB B;  2LZ6 A;  5MPO A;  2JVC A;  3DWG C;  3ALB A;  1HA5 A;  3X0W A;  2LXC A;  4FJY A;  1ZW7 A;  1JRO A;  2K3U A;  2RDH A;  4ZYN A;  3U30 A;  1J0G A;  3KUC B;  3WA0 A;  1JAL A;  1SE3 A;  1WYW B;  4RF1 A;  5BMH A;  1V1O A;  2ZVN A;  3ML8 A;  2WXP A;  4GU2 A;  4FLH A;  4RGN A;  3TJP A;  4JX1 C;  1Z5S B;  1WJU A;  2JZZ A;  4NY0 A;  3VH4 B;  4C00 A;  3ZJU A;  2DNF A;  3DVN U;  3N30 A;  3ZKJ C;  5D94 A;  4RGT A;  4DBG A;  1R7S A;  4N9F 4;  3RNC C;  4K7W A;  2WXR A;  4DXF A;  1L5P A;  1VD2 A;  1ZUD 2;  1ZPS A;  3NHE B;  2IND C;  1RFK A;  2KFK A;  1NEN B;  3VAW A;  2MP2 B;  2MCN B;  1D4B A;  3HHM A;  1GC7 A;  3CIR B;  4HVB A;  2YEP F;  4M0W A;  2L0T A;  4YXD B;  4US9 A;  1B1Z A;  2BB6 A;  2CR5 A;  3PRP B;  3DOW A;  3RPF C;  3R66 C;  2LUM A;  2BB5 A;  4ANU A;  4L1B A;  4MSM B;  2ONQ A;  4NQL B;  3CMM B;  1P98 A;  2DEN B;  2W82 A;  3PVL A;  4IM0 A;  3X23 A;  4LNO A;  2C7M B;  4MGZ E;  1WGK A;  2WXG A;  1GAQ B;  1IP9 A;  2WU5 B;  5IN7 A;  4AJY B;  1YNT E;  2L52 A;  4N6E B;  3PGE A;  1R4N I;  2WXO A;  1C1Y B;  2LGS A;  1ISN A;  5EE3 A;  3KH0 A;  1N60 A;  1RAX A;  2OHF A;  4FAD A;  3VQI A;  4GDK B;  1H4R A;  3AE7 B;  3W2D A;  1E7V A;  1F0Z A;  2G4S A;  2JWZ A;  4M00 A;  4W9C A;  2A5U A;  1F2R C;  2J52 A;  1SJE D;  1AN8 A;  4FXC A;  1JWM D;  4CHK A;  3H6N A;  5G5G A;  2M8S A;  4GIV A;  1HQR D;  2IO3 B;  5FR6 A;  3ZNZ B;  1MPE A;  1L6U A;  3TL5 A;  4US8 A;  2JYT A;  1YJJ A;  1K51 A;  4G50 A;  1T0Q C;  4W9K A;  1WYG A;  1WMH A;  2WXF A;  3GOE A;  4PS3 A;  2WXJ A;  1LXD A;  2CKH B;  1ET6 A;  4GMV A;  3RNG C;  2HD5 B;  3AUL A;  1JWU D;  4WJQ A;  4WWP A;  4HK2 A;  1JML A;  1L6V A;  3HM6 X;  3UQA A;  2NPT A;  4RCO A;  2JPH A;  4E3C A;  3I5J C;  5AZH A;  1P7E A;  2V4L A;  2JXT A;  2MJ3 A;  4J6I A;  2EKI A;  2LVQ A;  3N1Z C;  4XX5 A;  3TEZ A;  3QHT A;  1OQY A;  2K8B A;  2O6V D;  1UNS A;  4HEA 1;  3W1S C;  4AQ7 A;  2BKR B;  1ZGU B;  5HFY A;  4B0E A;  2JT4 B;  5KHO A;  1XCT L;  4URK A;  3AEA B;  3BYY B;  4XZ4 A;  2UWQ A;  5C3J B;  1LM8 B;  5KHQ A;  1KFY B;  3B08 A;  1ZP0 B;  1RYJ A;  5IO9 A;  1C9F A;  5CHV C;  3ZGZ A;  2NVU I;  3EC8 A;  4MGI E;  1V86 A;  2GBM A;  2HJ1 A;  2XN9 C;  4X57 B;  2MWS B;  3VHT C;  1WM2 A;  3TEW A;  1TIF A;  2BF8 B;  1N5X A;  2R2Q A;  4RF0 A;  4W9L A;  2W54 A;  1HTO A;  3OAW A;  1OEY A;  1VDV A;  3I9V 1;  5D3D A;  5LXI B;  2JWU A;  4YWG G;  1SIJ A;  4EFO A;  3ECI A;  4NZL B;  1PUT A;  1RRB A;  1GG3 A;  4R3D A;  4GOC A;  3EFC A;  4RH6 A;  2N7D A;  3DHI C;  4NPN A;  2IY1 B;  1TTN A;  1QOF A;  1ZDX A;  1I4X A;  4K3B A;  4PYU A;  3BZD B;  1SJH D;  5JHB A;  4DHJ B;  3U7D A;  3Q3M C;  2J0K A;  4OVV A;  2WU2 B;  2FID A;  4TQ0 A;  4MSQ B;  4YTP B;  1I4G A;  3OG5 A;  3WIM A;  2R2O A;  3U7Z A;  3B9J A;  1E7U A;  3BWU D;  2NBW B;  4IM3 A;  2KDM A;  4JLC A;  2C7N B;  2GI9 A;  5T8I A;  3ZUN A;  3Q3F A;  3FIL B;  2LI5 A;  4K81 A;  4E71 A;  2K6Q A;  2O2V A;  4BZA A;  2BYF A;  3HVZ A;  3VUX A;  4W9H A;  3CST A;  1EM7 A;  2QMT A;  3BII D;  4GDL B;  1F9J A;  2KN4 A;  1NI2 A;  5IA7 A;  1EWC A;  2B3A A;  4ICV A;  1WR1 A;  4EUT A;  1UBI A;  3H9D A;  2M17 A;  4HPP A;  1P0R A;  2JF5 A;  3S2A A;  2K5P A;  4YSY B;  5GMV A;  3VUY A;  2MHJ A;  2IY0 B;  2WGS A;  2DBY A;  2YVC A;  5DPR A;  2KQS A;  2DZI A;  3ZJT A;  1IBX A;  1CZP A;  1TYG B;  2WXQ A;  4LLG M;  2KWV B;  3Q8C A;  4WH4 A;  3TEX A;  1WIA A;  1YQB A;  1Q5W B;  2BS4 B;  2DLB A;  2DAF A;  2OJW A;  2KC2 A;  2K0P A;  4CYE A;  1YJ1 A;  3RNB C;  2KTF A;  1UBQ A;  4NQK E;  4CO7 A;  1KTK A;  3QC8 B;  3ENE A;  2KTR B;  3QQ8 B;  2NS5 A;  4DHZ E;  2KAJ A;  4NJC A;  1WJ6 A;  4PK1 A;  1QOA A;  2ICI A;  3ABV B;  3VR9 B;  2KC1 A;  3ZTD A;  4JGH B;  2KDI A;  4B0M A;  1WR6 E;  2MRP A;  3T9L A;  2D11 A;  3AH7 A;  4DXA B;  5AEK B;  1T6B X;  1I4Q A;  5E6P A;  3A9K A;  1XT9 B;  1YX5 B;  2D3C A;  5TSS A;  1L0Y B;  2Z0E B;  2BS2 B;  4MM3 A;  1PDX A;  2WX1 A;  4RFB A;  1I35 A;  2LGY A;  3WAN A;  5FK9 C;  1IGD A;  3FIL A;  1AYF A;  1ROE A;  4XDC A;  1C3T A;  2FCS A;  2AL6 A;  2BW2 A;  1FCC C;  1FXT B;  4G0N B;  2DX5 B;  2J42 A;  4I6N B;  3P2B A;  2KWC A;  4F8C B;  2LMC A;  1JWA D;  2W3S A;  3APD A;  3ONS A;  3RMK C;  1N63 A;  4BKS D;  3L10 B;  4GDL A;  1WWT A;  3BVM A;  2KZR A;  1V1P A;  2E3T A;  3B2G A;  2QDF A;  4BKT A;  2L1A A;  2D3G A;  3SDL C;  2WXH A;  2N7J A;  2AL3 A;  3LXF A;  2EEL A;  3OJ3 A;  4J3O D;  4ZHO A;  4KKI A;  2VZK D;  4IM2 A;  3ZTC A;  3DBL I;  3VRB B;  1HE8 A;  2WDQ B;  2X8X X;  4LDT D;  3AEG B;  1VRA B;  4IW0 A;  1YD8 U;  2ON8 A;  2CHX A;  3ZVV A;  4HJK A;  3P4S B;  1SXT A;  2OOB B;  2DYM A;  3V05 A;  1FXI A;  2L00 B;  3NS1 A;  2LAS A;  3QAR A;  1JW9 D;  3SR6 A;  3WAO A;  3UF8 A;  1PQS A;  3Q8F A;  1EU4 A;  1V49 A;  2KFJ A;  2J0M A;  4FHK A;  4BBN C;  2V1Y A;  1MI0 A;  1K52 A;  3U52 E;  2FIF A;  1M94 A;  1NYR A;  2EMS A;  2LXA A;  4RMA A;  4W9D A;  4BBN F;  4KZ0 A;  3I57 A;  4KKJ A;  4ACF A;  1WE7 A;  5DPT A;  2W3R A;  1LQB A;  1GC6 A;  2KOX A;  3AEE B;  3NOB A;  2C7H A;  5BO4 B;  1GOZ A;  3QWZ B;  1OGW A;  5BMG A;  2KYW A;  2WXL A;  1A70 A;  1UGM A;  1EF1 A;  2DZJ A;  2IDY A;  4BVU C;  4RGM A;  2MJD A;  4HRO A;  1FM0 D;  2K8C A;  1TS5 A;  4OVU A;  2KMM A;  2NTS A;  1KJT A;  3PZD A;  1WY8 A;  3A4R A;  4II3 B;  2PJH A;  3WAL A;  1V6E A;  2HJ8 A;  1LGR A;  2KVR A;  5E6N A;  1OQR A;  2JY6 A;  1OEY J;  5IKC M;  1TBE A;  1MHH E;  2QCZ A;  1V81 A;  1MVK A;  1SIF A;  1E8W A;  1J7A A;  2LJI A;  2X38 A;  4KGT A;  2KDF B;  1I4P A;  4W9F A;  2SAK A;  2BYV E;  2DZK A;  4F7Z A;  2C60 A;  2XK5 B;  3BYT B;  5DPW A;  3VFK A;  4MJS A;  3MC8 A;  3EEC A;  2N0S B;  2VRR B;  2D2Q A;  5C2T B;  2WLB A;  3T3N A;  1XXG A;  1AW7 A;  2JU6 X;  3AE5 B;  1V5O A;  4A3P A;  2B76 B;  3AN1 A;  1WGY A;  4A90 A;  2YEP B;  1NI3 A;  2OED A;  4KSL C;  4REZ A;  3MJW A;  4JQW C;  2I1J A;  2FAZ A;  1QOG A;  3KYD D;  4WJP A;  1S1Q B;  5EE0 A;  1BT0 A;  1TY2 A;  1TJE A;  2WQY B;  3NVW A;  1GUA B;  2BS3 B;  3GB1 A;  2QC8 A;  1QLB B;  4P7I A;  3QX1 A;  3KQ4 A;  1CMX B;  2N9K A;  5JH5 C;  3JSV B;  3H7P A;  1V8C A;  2FUG 1;  3N20 C;  1Q0W B;  2VZK B;  2INC C;  1XD3 B;  4LDT B;  2K25 A;  1QF6 A;  1WH3 A;  3IBE A;  4D2K A;  3DHG C;  4WJN A;  3AV8 A;  2IZV B;  5DCN A;  3SHQ A;  1YX6 B;  4IWO A;  1KF6 B;  2LWP A;  2HDE A;  2JZP A;  4XYC A;  4OZA A;  2MW5 A;  3TIX A;  2J7Q B;  4P6V F;  2CS4 A;  1PGX A;  2JRH A;  3AEF B;  2Z8L A;  3A33 B;  4S0R A;  3E9S A;  2VH2 A;  2BQQ A;  3L13 A;  4IG7 B;  3SFE B;  4AUQ C;  2NMQ A;  2G4D B;  1X1M A;  2I2Y A;  1HZ6 A;  2WS3 B;  3DVG Y;  3DWM A;  2N9X A;  1J8C A;  2FUH B;  4WJO A;  1TT5 B;  2INN E;  1JWB D;  2KKC A;  3Q3J A;  3PTF C;  3P4P B;  3DBL B;  5BMI A;  3DBS A;  1Y8R C;  3E56 A;  2V3N A;  2KJR A;  4N59 A;  1NYQ A;  3IT6 B;  3IAS 1;  2PVG C;  1AAR A;  2L32 A;  3H7S A;  3TMP B;  1HZ5 A;  3EHV A;  4NAW B;  2Y3A A;  2RMM A;  1C79 A;  4L23 A;  2WX0 A;  5E6O A;  2MBE A;  1EUV B;  2KN5 A;  3U2S C;  3N3K B;  3NS8 A;  2VH1 A;  1E7P B;  2BT6 A;  2KK8 A;  3P4Q B;  4LK0 M;  1QIL A;  1Q10 A;  2MBQ A;  3WAP A;  1OTR B;  2MSE D;  5CHW A;  3CSF A;  2ASQ A;  4PT5 A;  3A9J B;  2L0F A;  2PMV A;  4HRS A;  4AWJ A;  4HJG E;  1HEZ E;  3M3J A;  4USA A;  1XQQ A;  1WSP A;  3AE6 B;  4TV3 A;  3A1Q B;  2MP2 A;  1WX7 A;  3NVZ A;  4MH8 A;  1VZ7 A;  2L8J A;  3PPA A;  2J0J A;  3T8M A;  4CQN A;  3PRM B;  1VZ8 A;  3VVW B;  2IBI B;  4HKZ E;  4LNK A;  3A4S C;  2KAN A;  4RGO S;  4IDI A;  1WXA A;  1IUE A;  3ZO5 B;  2LHD A;  4BOZ B;  3FKY A;  3EUB 2;  1FEH A;  4DXG A;  2IJ0 A;  2WP9 B;  2N1W A;  1E6E B;  4M02 A;  1TS3 A;  4FJV B;  1V9J A;  4I6P A;  3JYU A;  1E5W A;  3DVG X;  2ZCB A;  3P63 A;  2RDG A;  3QIJ A;  3TUO A;  3AE2 B;  3ZDM C;  4IWQ A;  5CX3 A;  4Q2J A;  3UI3 A;  2KVZ A;  3GZN B;  4EKU A;  4JIO U;  4LCD E;  2AYO B;  5AZG A;  2BVC A;  1XEE A;  1STE A;  4GDK A;  1V80 A;  2SEB D;  4OZB A;  4A9A A;  4A55 A;  4ARI A;  4NAW A;  5CHF A;  3RNF C;  4BAX A;  2KWD A;  1NDD A;  3NZU A;  3VRA B;  4G3X B;  1DOY A;  4TQ1 A;  1H8C A;  2RGF A;  1SGH A;  3O65 B;  4FHJ A;  2QSD A;  4TKN A;  5LXH A;  1R4M B;  2LJ5 A;  2DAJ A;  3HUI A;  3V6C B;  5J17 A;  4EZL A;  3W1Y A;  1T0S C;  3PHW B;  1YQ4 B;  4BKG A;  4WWO A;  3PLU A;  1P1A A;  5EE9 A;  1I4R A;  1IGC A;  3PO0 A;  1FNW A;  1WJN A;  3BK1 A;  1XF5 L;  1MG4 A;  2ZEQ A;  2FNJ B;  4JE3 B;  1UZX B;  2FE8 A;  3U8Z A;  5E6J A;  3BVZ A;  4GB9 A;  3H8H A;  3Q8A A;  4KIK B;  3R7R A;  1E8Z A;  2QEJ C;  2NR2 A;  4WAF A;  1JQ4 A;  4OVZ A;  2KQ4 X;  4AS1 A;  1YMH E;  4H2A A;  1BUI C;  1T3Q A;  2LGI A;  5BYS A;  3SD5 A;  1L7Y A;  3PZ7 A;  2GOW A;  2JSV X;  2LD9 A;  3KWL A;  5LLI A;  4K7S A;  2CU3 A;  1GJZ A;  1JWS D;  2PVO D;  3TBL D;  3TEY A;  3QJZ A;  5EE1 A;  4F1S A;  2GMI C;  1PGB A;  1K8R B;  3VTW A;  3ZRC A;  1K50 A;  1QOB A;  4WAA A;  1EWY C;  4KVG B;  3APC A;  3Q69 A;  1D5M C;  2QIE B;  2KJ6 A;  1U4A A;  4ZRI A;  5H8Y E;  2R61 A;  2XEW A;  4HLE A;  4N58 A;  2LHE A;  2ACZ B;  5FKA C;  4EZK A;  2QHO A;  1SB3 C;  3PRZ A;  4YT0 B;  1UGJ A;  3NRZ A;  4IKG A;  1TZ1 A;  3AE3 B;  4NNJ B;  2G45 B;  3PSE B;  3QAQ A;  1KLV A;  2CHW A;  3IT4 B;  3NY5 A;  3B2F A;  1SSN A;  2O6V B;  3R7Q A;  3UQB A;  1FMA D;  3DBR B;  2V4I B;  1FXA A;  3GE8 C;  4O1N A;  5IOI A;  4XC2 A;  4A20 A;  2DZM A;  1IYF A;  5CTR C;  4HXD A;  4TMA B;  4ZRK A;  4DDG D;  2MBH A;  1NVI D;  4G11 A;  2GBK A;  4P16 A;  1XLQ A;  2CJN A;  2LFI A;  2KLC A;  2N1V A;  2LVP A;  1FNV A;  4ANW A;  2W9N A;  3RUI B;  1FRD A;  3VTU A;  2N4F A;  5TR5 A;  2AQ3 B;  2IYD B;  2D07 B;  1KLG D;  3Q2A C;  2LUE A;  4IOI E;  2DYO A;  1TKY A;  1YN4 A;  2MLB A;  3GP7 A;  4KIK A;  2LRU A;  3EGR A;  4YTN B;  2CU1 A;  2EKE C;  4XDD A;  1YQ3 B;  2MBB B;  3RUL A;  3OWE B;  4TSS A;  1AWD A;  2H89 B;  2MX2 A;  4GSW A;  1RFA A;  1L2N A;  3RCZ A;  4WWN A;  1F2R I;  1PGA A;  2L3Z A;  2KQ7 A;  1WZ3 A;  2K22 A;  2MBO A;  1WGG A;  4MGY E;  4C7Y A;  1MFW A;  5G2N A;  3AE9 B;  2V3P A;  1L0V B;  2BKF A;  1SE4 A;  4JWS C;  1FCL A;  1KOT A;  1E8Y A;  3DBH B;  1CK1 A;  3V6E B;  3V62 A;  1M4V A;  4RM8 A;  4KDI C;  5HI1 A;  5AUI A;  2HE7 A;  2NTT A;  1PYW D;  5I4D A;  2PIA A;  3QK0 A;  1E9M A;  1F1H A;  1RWS A;  1WRI A;  4DQO C;  2PW9 A;  2IO2 B;  4C80 A;  3HM3 A;  1FPY A;  1C78 A;  1I4H A;  5JHA A;  1E10 A;  3KUZ A;  2IGD A;  1J7C A;  3ETR A;  3PZ8 A;  4HKQ A;  2KTR A;  2XBB C;  2KAC A;  5C1Z A;  1JCK B;  3DVN V;  3N1X C;  2O6V A;  1TZO A;  2PE9 A;  3PHX B;  4ZDV A;  4IWP A;  4B6W A;  4HCP B;  4JL9 A;  3CF6 E;  2PTL A;  1FIQ A;  1ZE3 D;  5HKH A;  2AQ1 B;  2D10 A;  3AM9 A;  1TGZ B;  4AOF A;  2WXI A;  5LNK 1;  1D5X C;  1ZOY B;  1L0X B;  1CJE A;  4XWT A;  3ZJV A;  2BYT A;  3ML9 A;  3WAM A;  2NCN A;  4KV2 A;  4LNI A;  5IAA C;  2WHI A;  2AX5 A;  4HDO A;  4WWM A;  4M0W B;  3RZF A;  3T3O A;  3RN9 C;  2BTE A;  5G55 A;  4MDK E;  3N1Y C;  4DHZ B;  1WGR A;  4MH0 E;  4QAY A;  2MJE A;  1SEB D;  2KX3 A;  2ZNV C;  4A6Q A;  3NZ3 A;  3SU8 X;  4P1B C;  3UIN B;  5H92 C;  3NG0 A;  2A4Z A;  2D3B A;  4K1R B;  3VTV A;  3GZN I;  2XNA C;  3NZS A;  1UWM A;  3Q14 C;  3VUW A;  3PT2 B;  2K1F A;  3DQV A;  1Z2M A;  2ZZP B;  2LGD A;  4PYZ A;  4A3O A;  1WJ4 A;  3AMZ A;  2Y5B B;  4IC7 B;  1ZXI A;  2FBW B;  4AP4 C;  4RM9 A;  4ZRP A;  3KW5 B;  2KMA A;  1TY0 A;  3L08 A;  3BK2 A;  3Q8E A;  1EF5 A;  2RD0 A;  2PLP A;  4S17 A;  1R4M I;  2D5G A;  2DWQ A;  2I38 A;  2RSU A;  3NVV A;  4EZJ A;  3ZNG C;  4A8X C;  3ZDT A;  2IGG A;  5HHD G;  1ESF A;  1LFD A;  4E74 A;  3LDZ E;  2D3A A;  2M4N A;  1WMH B;  1SE2 A;  3J9C A;  2FCM A;  2YLM A;  3DCG A;  2MH7 A;  1VJK A;  3K9P B;  1I42 A;  2RPV A;  4OW0 A;  1VZ6 A;  5J18 A;  1FD6 A;  3LB8 C;  3EFU A;  3FC4 A;  1WXQ A;  2Q5W D;  1ACC A;  2NPT B;  3AEB B;  3IFW B;  2KX0 A;  1V2Y A;  3C19 A;  1WRD B;  1WXV A;  3MFG A;  2KT7 A;  4I6L B;  4P1C C;  4NJ6 A;  4ITK A;  4ZRJ A;  2N9L A;  5FR3 A;  1C4P A;  1GB1 A;  2K8H A;  3P42 A;  3MTN B;  1WE6 A;  4WIP A;  5BYQ A;  1HTQ A;  2N9E B;  3Q6B A;  3Q3O C;  1UD7 A;  1YN3 A;  3C8Y A;  4BOS C;  1P9D U;  2XK5 A;  4KGR A;  4DHJ D;  3TCA A;  2IGH A;  3SFD B;  3DHH C;  2K9X A;  2PKO A;  2W55 A;  5G5H A;  1UUP A;  1F77 A;  2KWU B;  1V97 A;  4WUR A;  4WQO B;  4ASW C;  2TSS A;  2L83 A;  3AU4 A;  3RT3 B;  3ZYY X;  1E90 A;  1BML C;  4L2Y A;  3ZNI D;  1YJI A;  2JYE A;  3BVG A;  3OJ4 B;  4NJ7 A;  1N5W A;  4C4V B;  2V0G A;  1F52 A;  3PLV A;  3UIP B;  1Q1O A;  5JXV A;  1XCQ L;  5DPS A;  2GRI A;  2WXM A;  1T0R C;  4KDL B;  3OLM D;  4XGA B;  4BKS A;  3DBR I;  2GBR A;  3V60 A;  2ZPY A;  1TS2 A;  2BWE S;  1GNU A;  3APF A;  3VDZ A;  3MP9 A;  1UH6 A;  3JSV A;  2C9W B;  5L95 C;  4K7U A;  3M62 B;  1Y56 A;  3RI7 C;  1WM3 A;  3C0R B;  2RDB C;  2LGX A;  2PE6 B;  2ZW0 A;  3KLS X;  1SBB B;  4ZOH C;  3HIZ A;  2N7E A;  3MC0 B;  2CHZ A;  3KUD B;  3K9O B;  3PV1 A;  1UWX A;  2MEK A;  2M0A A;  3RZW C;  1D3Z A;  1MJD A;  2ZJD A;  3IG3 A;  3RD2 A;  1KH0 A;  2N9P C;  3RNE C;  2LRW A;  2G3Q B;  3VXW A;  3W9C B;  1CQV A;  3JVZ X;  2L05 A;  2O2V B;  1RM6 C;  5BYR A;  1WGD A;  4DWF A;  3KYC D;  4YL8 A;  2MQJ A;  4LTU A;  1C77 A;  4B95 A;  1UEL A;  2G9H D;  3HK0 A;  1QT9 A;  2RR9 A;  3N32 A;  4HPL B;  1YOV B;  3DBH I;  2CJO A;  4GN1 A;  3GE3 C;  1XLN A;  1TKE A;  4M8M A;  3M95 A;  4XE0 A;  4KX6 B;  1IBX B;  1WFY A;  1WXM A;  2WWZ A;  4LJP B;  4AJW A;  3QCA A;  3MJ5 A;  1WX8 A;  2C5L C;  2JQR B;  1J7B A;  2JX5 A;  4C4V A;  3MHZ A;  2LVO A;  2KHW B;  2UU7 A;  1YN5 A;  2KNB A;  3ZXR A;  2IPK D;  3U4E G;  3Q8B A;  3ZIM A;  1TKG A;  2FCN A;  2V9H A;  2OJR A;  3B0A A;  3A9J A;  1QQR A;  3B1L X;  3IAM 1;  3RYT A;  3ZXV A;  1G6J A;  3KVF B;  4MT5 A;  2NBU A;  1DOX A;  4ANV A;  3IXS A;  2KMC A;  4B9K A;  4DK5 A;  3A1Q A;  2KLG A;  1WI0 A;  4ICU A;  3WCQ A;  3W1S A;  4NAM A;  3ZRF A;  1IPG A;  2M1M A;  3A9K B;  2GLS A;  3JW0 X;  4FJZ A;  3L0W B;  3D32 A;  3PS6 A;  1D5Z C;  2IO0 B;  1C4A A;  1PFD A;  4IUM B;  1DOI A;  3AXC A;  4MM3 B;  5EDS A;  2Z59 B;  5JZE B;  4GXB A;  1C4C A;  4JWU C;  1FO4 A;  2REX A;  1ZDV A;  1HXY D;  3UIO B;  3NVY A;  1JRU A;  3M63 B;  3AU5 A;  2UYZ B;  4JPS A;  1E8X A;  3MHS D;  1RLF A;  2KD0 A;  3W5U B;  4PS8 A;  3HRD D;  2GBN A;  1A5R A;  4FN2 A; 
#chains in the Genus database with same CATH homology
 5JHA A;  1ZKH A;  3KUZ A;  2NPT A;  1GUA B;  4FUL A;  3PRE A;  3ZW3 A;  4P7I A;  3QX1 A;  2K6D B;  4KSK C;  1NBF C;  2JPH A;  3VH3 B;  1CMX B;  2I1K A;  4E3C A;  2KTR A;  2XBB C;  5JH5 C;  3JSV B;  5C1Z A;  3H7P A;  3DVN V;  5AZH A;  2V4L A;  1Q0W B;  2O6V A;  4J6I A;  2PE9 A;  3PHX B;  1XD3 B;  4LDT B;  4ZDV A;  2LVQ A;  4IWP A;  5C23 A;  2K25 A;  4B6W A;  4HCP B;  4XX5 A;  4JL9 A;  3QHT A;  3CF6 E;  1OQY A;  1WH3 A;  2K8B A;  2O6V D;  4M8N A;  3IHP C;  3R3M A;  2WDT B;  3IBE A;  5D2M B;  2D10 A;  3W1S C;  5HKH A;  2BKR B;  4FA6 A;  2JUO A;  2IO2 B;  4WJN A;  1ZGU B;  2IZV B;  5DCN A;  1TGZ B;  3SHQ A;  4AOF A;  2JT4 B;  5KHO A;  4URK A;  1YX6 B;  4IWO A;  2LWP A;  4XZ4 A;  5J2R A;  2UWQ A;  1LM8 B;  5KHQ A;  2MW5 A;  4FBJ B;  3B08 A;  2J7Q B;  2JZ3 B;  4HWI B;  3TIX A;  3QA8 A;  2CS4 A;  5CHV C;  2NVU I;  2JRH A;  3EC8 A;  3ML9 A;  4MGI E;  1V86 A;  1VCB A;  3WAM A;  3A33 B;  2GBM A;  2NCN A;  5AZF A;  3L13 A;  2PPH A;  4IG7 B;  4AUQ C;  4X57 B;  4KV2 A;  2G4D B;  2MWS B;  1X1M A;  3VHT C;  5IAA C;  1WM2 A;  4EOY A;  3DVG Y;  2KO3 A;  2BF8 B;  4HDO A;  2N9X A;  1J8C A;  2R2Q A;  4M0W B;  2M0X A;  4W9L A;  2FUH B;  3RZF A;  4WJO A;  5G55 A;  3OAW A;  1OEY A;  2KKC A;  3Q3J A;  3PTF C;  4MDK E;  4DHZ B;  4KZC A;  1WGR A;  4II2 B;  4MH0 E;  5LXI B;  2KX3 A;  2ZNV C;  3DBS A;  1Y8R C;  4EFO A;  3ECI A;  3SU8 X;  2KJR A;  1RRB A;  3UIN B;  1GG3 A;  4GOC A;  1AAR A;  3L16 A;  5L83 A;  3H7S A;  2N7D A;  4NPN A;  2IY1 B;  1TTN A;  3TMP B;  2JRI B;  4PYU A;  5JHB A;  1J19 A;  2ZVO A;  3EHV A;  4NAW B;  2A4Z A;  4K1R B;  4DHJ B;  3VTV A;  3I3T B;  3U7D A;  2WX0 A;  5E6O A;  2J0K A;  2MBE A;  4OVV A;  1EUV B;  2KN5 A;  3GZN I;  2FID A;  4TQ0 A;  4MSQ B;  4BFR A;  3NZS A;  3N3K B;  1P3Q U;  2L76 A;  3NS8 A;  2BPS A;  3VUW A;  3PT2 B;  2KK8 A;  4W9G A;  2K1F A;  3L54 A;  2R2O A;  3DQV A;  3WIM A;  2BWF A;  2MA9 B;  3DDC B;  1Z2M A;  1E7U A;  2ZZP B;  2MBQ A;  4HDQ A;  3H1U A;  3WAP A;  1OTR B;  2MSE D;  5CHW A;  2LGD A;  4PS7 A;  4PYZ A;  3CSF A;  4A3O A;  1WJ4 A;  2NBW B;  2ASQ A;  4IM3 A;  2Y5B B;  4IC7 B;  3A9J B;  2L0F A;  4DDI D;  4AWJ A;  2KDB A;  4JLC A;  4AP4 C;  2BYE A;  2C7N B;  2FCQ A;  4RM9 A;  1T0Y A;  3ZUN A;  3M3J A;  3Q3F A;  3DPD A;  3KW5 B;  2LI5 A;  1XQQ A;  4K81 A;  2KMA A;  4E71 A;  2PEA A;  5D7G A;  3L08 A;  2K6Q A;  2O2V A;  1EF5 A;  2KDE B;  2RD0 A;  4TV3 A;  1KM7 A;  2BYF A;  3A1Q B;  3ZNH B;  1R4M I;  2MP2 A;  1WX7 A;  3VUX A;  4TUU A;  2L8J A;  4W9H A;  2RSU A;  3CST A;  3PPA A;  2J0J A;  3T8M A;  4GDL B;  1F9J A;  4EZJ A;  3ZNG C;  4MJS B;  3PRM B;  4ANX A;  1NI2 A;  5IA7 A;  3VVW B;  2IBI B;  2NBV B;  2B3A A;  2KAN A;  3A4S C;  4ICV A;  1WR1 A;  4EUT A;  3ZDT A;  1UBI A;  1WXA A;  3H9D A;  2M17 A;  1LFD A;  2GBJ A;  1P0R A;  4E74 A;  2JF5 A;  2L7R A;  3LDZ E;  3S2A A;  3ZO5 B;  2RPQ A;  5GMV A;  3VUY A;  4BOZ B;  2M4N A;  2IY0 B;  1WMH B;  4W9I A;  2FCM A;  2KXJ A;  2YLM A;  2KQS A;  2DZI A;  2YVC A;  5DPR A;  3DCG A;  2HTH A;  2N1W A;  1SE9 A;  2KJH B;  3K9P B;  4FJV B;  4HCN B;  1V9J A;  4I6P A;  3JYU A;  1E5W A;  3DVG X;  2ZCB A;  2ZPN A;  3QIJ A;  1WF9 A;  1I42 A;  2KWV B;  5J18 A;  3ZDM C;  1V5T A;  1WIA A;  1YQB A;  4IWQ A;  3EFU A;  2WYQ A;  3IVF A;  1Q5W B;  5CX3 A;  2EMT A;  2ZNV B;  2DAF A;  2IO1 B;  2KC2 A;  2NPT B;  4EKU A;  3IFW B;  2KX0 A;  4MEL A;  1V2Y A;  1YJ1 A;  4CYE A;  2KTF A;  1UBQ A;  1WRD B;  4JIO U;  1WXV A;  2AYO B;  4LCD E;  4NQK E;  2AWT A;  5AZG A;  3QC8 B;  1WGH A;  4I6L B;  4CO7 A;  3ENE A;  4MEM A;  2KTR B;  4NJ6 A;  3V61 A;  2AEH A;  3QQ8 B;  2NS5 A;  3H7P B;  4ZRJ A;  4DHZ E;  4GDK A;  3L17 A;  2KFK B;  2ZCC A;  1WJ6 A;  1WXS A;  2K8H A;  4W9E A;  1V80 A;  4EEW A;  3MTN B;  2KC1 A;  3ZTD A;  1WE6 A;  4JGH B;  4LJO B;  2KDI A;  1WX9 A;  1WR6 E;  2MRP A;  3T9L A;  2D11 A;  4DXA B;  4NAW A;  5AEK B;  4HPM B;  5CHF A;  1QZE A;  2N9E B;  5E6P A;  2V3S A;  1NDD A;  1UD7 A;  3LJ3 A;  3A9K A;  1XT9 B;  3NZU A;  4G3X B;  4TQ1 A;  1P9D U;  1YX5 B;  4BOS C;  1EO6 A;  1A5R A;  1H8C A;  2DHZ A;  2XK5 A;  2RGF A;  1SGH A;  3O65 B;  4FHJ A;  3BIN A;  4GGQ A;  4TKN A;  4DHJ D;  3TCA A;  5LXH A;  3ZLZ A;  2Z0E B;  2DYB A;  2K39 A;  4MGK E;  2LJ5 A;  2DAJ A;  3V6C B;  4MM3 A;  5J17 A;  4EZL A;  2JXX A;  3W1Y A;  2Z0D B;  5D6J B;  2WX1 A;  2KWU B;  1YIW A;  3PHW B;  4WQO B;  1WZ0 A;  4ASW C;  4BKG A;  4WWO A;  3PLU A;  1MG8 A;  1I35 A;  2LGY A;  3AU4 A;  3RT3 B;  3WAN A;  1E90 A;  1S3S G;  3BY4 B;  1P1A A;  3ZNI D;  1C3T A;  4NJ7 A;  2FCS A;  3OJ4 B;  2AL6 A;  3AI5 A;  3UIP B;  3PLV A;  1Q1O A;  1FXT B;  2BGF A;  4W9J A;  3UGB B;  2LZ6 A;  2DX5 B;  4G0N B;  2JVC A;  5DPS A;  4KDL B;  1WJN A;  4I6N B;  3OLM D;  4BKS A;  3P2B A;  2KWC A;  3ALB A;  3DBR I;  2GBR A;  3V60 A;  4F8C B;  2ZPY A;  2ZEQ A;  3X0W A;  2LXC A;  3ONS A;  3APD A;  2FNJ B;  4BKS D;  4FJY A;  1ZW7 A;  2BWE S;  3L10 B;  1GNU A;  3APF A;  4GDL A;  1UZX B;  2KZR A;  3U8Z A;  3VDZ A;  4GB9 A;  4KIK B;  3R7R A;  4ZYN A;  3U30 A;  1UH6 A;  1J0G A;  3JSV A;  1E8Z A;  2C9W B;  3KUC B;  2NR2 A;  5L95 C;  3WA0 A;  4K7U A;  4BKT A;  2D3G A;  1WYW B;  3SDL C;  3M62 B;  2ZVN A;  4FLH A;  3ML8 A;  4GU2 A;  1WM3 A;  2AL3 A;  3SD5 A;  3C0R B;  1L7Y A;  3TJP A;  2GOW A;  3OJ3 A;  2LGX A;  1Z5S B;  2LD9 A;  5LLI A;  4IM2 A;  4K7S A;  3ZTC A;  3DBL I;  1GJZ A;  1HE8 A;  1WJU A;  2PE6 B;  4LDT D;  2JZZ A;  3HIZ A;  2N7E A;  4NY0 A;  3TBL D;  4IW0 A;  2CHZ A;  3KUD B;  3VH4 B;  1YD8 U;  3QJZ A;  3K9O B;  3PV1 A;  4F1S A;  2GMI C;  3RZW C;  1D3Z A;  3DVN U;  3N30 A;  3ZKJ C;  1K8R B;  2CHX A;  5D94 A;  2ZJD A;  3IG3 A;  3RD2 A;  3VTW A;  3ZRC A;  4HJK A;  3ZVV A;  4DBG A;  2OOB B;  2N9P C;  4N9F 4;  2DYM A;  4WAA A;  2L00 B;  4K7W A;  4KVG B;  2LRW A;  2LAS A;  3APC A;  3QAR A;  2G3Q B;  3VXW A;  3JVZ X;  2L05 A;  3WAO A;  2KJ6 A;  2O2V B;  3UF8 A;  1U4A A;  1VD2 A;  1PQS A;  1V49 A;  2KFJ A;  2J0M A;  4ZRI A;  4FHK A;  4BBN C;  2XEW A;  4HLE A;  2V1Y A;  3NHE B;  2KFK A;  3VAW A;  1WGD A;  4DWF A;  3KYC D;  2FIF A;  1M94 A;  2EMS A;  2MP2 B;  4YL8 A;  2MQJ A;  2MCN B;  4EZK A;  2LXA A;  2QHO A;  4RMA A;  4W9D A;  4BBN F;  4B95 A;  1UEL A;  3HHM A;  4KZ0 A;  1GC7 A;  3PRZ A;  3HK0 A;  4HVB A;  1WE7 A;  2L0T A;  5DPT A;  1LQB A;  1GC6 A;  2RR9 A;  2CR5 A;  1TZ1 A;  2KOX A;  3PRP B;  3NOB A;  3N32 A;  4HPL B;  2C7H A;  3DOW A;  4NNJ B;  2G45 B;  3DBH I;  3PSE B;  3QAQ A;  1KLV A;  5BO4 B;  4GN1 A;  2CHW A;  3NY5 A;  3QWZ B;  3R66 C;  4ANU A;  1OGW A;  2O6V B;  3R7Q A;  3UQB A;  4MSM B;  4M8M A;  1UGM A;  4XC2 A;  1EF1 A;  4A20 A;  2DZJ A;  3M95 A;  4BVU C;  4NQL B;  2DZM A;  3CMM B;  1P98 A;  2DEN B;  4HXD A;  5CTR C;  3PVL A;  4IM0 A;  3X23 A;  1IYF A;  1WFY A;  1WXM A;  2WWZ A;  2K8C A;  4LJP B;  4ZRK A;  4AJW A;  4DDG D;  2MBH A;  4OVU A;  3QCA A;  4G11 A;  1WX8 A;  2GBK A;  2C7M B;  1KJT A;  4MGZ E;  3PZD A;  1IP9 A;  2C5L C;  1WY8 A;  3A4R A;  2KLC A;  4II3 B;  2N1V A;  4AJY B;  2PJH A;  2LVO A;  2KHW B;  2KNB A;  3PGE A;  3WAL A;  1V6E A;  1R4N I;  2LVP A;  2HJ8 A;  4ANW A;  1C1Y B;  2KVR A;  3ZIM A;  2FCN A;  1ISN A;  5E6N A;  2OJR A;  2W9N A;  3B0A A;  3KH0 A;  3A9J A;  3RUI B;  2JY6 A;  3B1L X;  1RAX A;  3VTU A;  2N4F A;  4FAD A;  1OEY J;  3VQI A;  1TBE A;  3RYT A;  5TR5 A;  4GDK B;  1G6J A;  1H4R A;  1V81 A;  3KVF B;  2IYD B;  1SIF A;  2D07 B;  1E8W A;  1E7V A;  2LUE A;  2NBU A;  2DYO A;  2KDF B;  2MLB A;  4KIK A;  4ANV A;  2LRU A;  2G4S A;  2JWZ A;  2KMC A;  4W9F A;  4B9K A;  4W9C A;  2A5U A;  2CU1 A;  2BYV E;  4DK5 A;  3A1Q A;  2EKE C;  2KLG A;  1WI0 A;  4ICU A;  2DZK A;  3W1S A;  2MBB B;  3RUL A;  3ZRF A;  4F7Z A;  4CHK A;  1IPG A;  2M1M A;  3A9K B;  3H6N A;  3JW0 X;  4FJZ A;  2C60 A;  2M8S A;  2MX2 A;  3L0W B;  3D32 A;  3PS6 A;  4GIV A;  2XK5 B;  4GSW A;  5DPW A;  2IO3 B;  5FR6 A;  3VFK A;  3ZNZ B;  4MJS A;  1RFA A;  2IO0 B;  3TL5 A;  1L2N A;  3EEC A;  2VRR B;  4IUM B;  3RCZ A;  4WWN A;  2D2Q A;  3AXC A;  5EDS A;  2Z59 B;  2L3Z A;  2KQ7 A;  5JZE B;  1WZ3 A;  4GXB A;  2MBO A;  2REX A;  1WGG A;  4G50 A;  4W9K A;  4MGY E;  5G2N A;  1WMH A;  1V5O A;  2BKF A;  3UIO B;  3GOE A;  4PS3 A;  1JRU A;  3M63 B;  4A3P A;  3AU5 A;  1WGY A;  1KOT A;  1E8Y A;  2UYZ B;  3V6E B;  3V62 A;  1LXD A;  4KSL C;  2CKH B;  3MJW A;  4GMV A;  4JQW C;  1E8X A;  2I1J A;  3MHS D;  4RM8 A;  2FAZ A;  4KDI C;  2HD5 B;  2HE7 A;  3AUL A;  3KYD D;  4WJQ A;  4WWP A;  1RLF A;  2KD0 A;  4WJP A;  1S1Q B;  3QK0 A;  4HK2 A;  4PS8 A;  2GBN A;  3HM6 X;  1BT0 A;  3UQA A;  3HM3 A;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...