1OEYA

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
GSHMAYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyA00
3QQ8B 4DDID 3V60A 2DYOA 5DPTA 4HVBA 1WZ3A 3AULA 4LDTB 2LRUA 2DHZA 4KIKB 1EF1A 4K7WA 2ZVNA 2OOBB 3B0AA 2NS5A 2DAFA 4GSWA 1VCBA 4ANXA 2MCNB 3AI5A 5AZGA 2LVOA 2FAZA 4LJPB 3U30A 4ANVA 2YLMA 1GJZA 1D3ZA 1V9JA 4MSMB 1WH3A 4DHZB 1WYWB 3ONSA 4URKA 5G55A 4HK2A 2I1JA 1R4NI 2AL3A 1E8WA 3D32A 3ALBA 5IA7A 5DPRA 2WX0A 4FN2A 3DVGY 1Z5SB 2RR9A 1WY8A 1P98A 2BKFA 2KFKB 3KUDB 4WWNA 2GOWA 5IAAC 3S2AA 4FJVB 3VFKA 3VH3B 4DHJB 2FCNA 2ZJDA 4PYZA 1V80A 3ZLZA 4MGYE 2MBHA 2KDBA 1WJ6A 4DHZE 3A4SC 4TKNA 1OQYA 3PPAA 1K8RB 4RM9A 2IO2B 1V49A 2N7EA 2Z0EB 3IG3A 3PLUA 2O6VB 4LJOB 3ZNZB 1KJTA 2G4DB 3A9JB 3V61A 5BO4B 2DENB 5GMVA 2JZZA 2FNJB 2WYQA 1P0RA 4KSKC 1UD7A 2IBIB 4BBNF 2XK5A 4PS3A 5CHFA 4RM8A 4GB9A 2R2OA 2I1KA 1YJ1A 1R4MI 2KLCA 2WWZA 4MDKE 4N9F4 3RUIB 1Q1OA 3PHXB 5JHAA 3ZO5B 3CSTA 5KHQA 1ISNA 4BFRA 3HK0A 4W9HA 1WGGA 1WJ4A 2FCSA 2KWUB 3VTWA 2ZCBA 2RGFA 4BKTA 4HCPB 3IBEA 3L54A 1WF9A 3DBRI 3ML9A 4NJ7A 2RPQA 1YX6B 2LXAA 3TL5A 2C7MB 3IHPC 3RZFA 4EZKA 2HE7A 1OEYA 2KKCA 4AJWA 3VHTC 5L83A 1YX5B 4HDOA 3PLVA 4W9LA 2DYBA 3PV1A 2JY6A 3L16A 3ZNGC 4EZJA 2KO3A 1YQBA 1KOTA 2MSED 4W9GA 3JYUA 2EMTA 4KVGB 1WM3A 3R7QA 2JF5A 1I42A 2HTHA 2BF8B 4HPLB 4EUTA 4AWJA 2MBBB 3ECIA 1V5OA 3IVFA 4FADA 4JIOU 5D7GA 3KUZA 3DBLI 3VUXA 1UBIA 3PZDA 2KJRA 1WGYA 2OJRA 3IFWB 4II2B 4WJNA 2ZZPB 4PS8A 2KMCA 4NAWA 3RT3B 4W9IA 1L7YA 2KANA 4WJOA 2MBQA 5DPSA 3R7RA 1I35A 4A3OA 5CTRC 2IY1B 4BOZB 2FIFA 1JRUA 4AJYB 4FHJA 5J2RA 1WGHA 1WXMA 4ICUA 1WR1A 3K9OB 3WAOA 1EO6A 2Z0DB 1E8XA 5CX3A 2IO3B 4E71A 4PS7A 3VDZA 1E5WA 3APCA 3ZNHB 3DVNU 2XBBC 3ML8A 2AL6A 2AWTA 2KDEB 2WDTB 1E8ZA 2LGXA 4XC2A 2NBVB 5CHWA 4KZ0A 3Q3FA 4DDGD 3R3MA 3QARA 2LZ6A 4KDIC 2KJ6A 5G2NA 4ZDVA 1C1YB 4EOYA 3DVGX 2XK5B 3A1QB 2D07B 3H9DA 1WXSA 1Y8RC 2LUEA 3T8MA 2LRWA 1H4RA 4ANUA 1NI2A 4HDQA 2KFJA 2FUHB 2KN5A 2J0MA 4MM3A 2MBEA 1UH6A 2D3GA 3QX1A 4G3XB 4MEMA 4B9KA 2KDFB 3NY5A 2BKRB 1VD2A 4GXBA 2CU1A 3UQAA 4TQ1A 3NZSA 3PVLA 2JZ3B 3OLMD 4TV3A 4WWOA 2EMSA 4DBGA 1V5TA 2N1VA 4I6LB 2NPTA 2HD5B 3QJZA 1WGDA 2ZCCA 1SIFA 1LFDA 4W9CA 1XD3B 1GG3A 1J0GA 4ZYNA 2JT4B 4I6PA 4BKSD 1NDDA 3PREA 2L76A 3Q3JA 1OGWA 4F7ZA 1U4AA 1UBQA 3JSVA 4M8NA 4ANWA 2WX1A 4HPMB 1J8CA 2JXXA 5FR6A 2K8BA 3TJPA 4KDLB 3KYDD 4BVUC 4EZLA 5AZFA 3H6NA 4AOFA 1V6EA 2IZVB 3PGEA 4FULA 2DZKA 3RD2A 1SGHA 2CR5A 4K7SA 4MJSA 2A4ZA 2BYEA 5LXIB 4NQLB 4IG7B 2L05A 3M95A 2KLGA 4NAWB 3H1UA 3ZTDA 4MH0E 3NHEB 3VTVA 5L95C 1P1AA 2MRPA 2FCMA 2JWZA 4WWPA 2GBNA 1YIWA 3KH0A 4IM2A 1E7VA 1Z2MA 3P2BA 5D2MB 3SU8X 4KSLC 4GDKA 4EEWA 5JH5C 1S1QB 1WJUA 3A1QA 3RULA 3WAPA 4FHKA 3PRPB 2LI5A 4LDTD 4M0WB 2MW5A 3QIJA 1WZ0A 3L13A 2K25A 2MP2A 2EKEC 4K7UA 2ZEQA 3TIXA 3UGBB 3VXWA 1XQQA 2C5LC 2C9WB 2DX5B 4TUUA 1WX7A 3KYCD 1TBEA 3M3JA 3QC8B 4XX5A 3HM6X 4A20A 2D11A 5LXHA 2Z59B 3DOWA 4JQWC 4NJ6A 1IYFA 2ASQA 2J0JA 2NVUI 3W1SC 3ZIMA 1QZEA 4MSQB 3W1SA 1V2YA 1FXTB 5HKHA 4IW0A 2R2QA 1IP9A 4ZRIA 2LASA 2KC2A 2PE6B 4A3PA 3N32A 3QWZB 4NQKE 2L0TA 1WIAA 5J17A 2AEHA 4IC7B 4DHJD 1WJNA 3DQVA 4ZRKA 1WX9A 3V6EB 3GOEA 4HXDA 3KW5B 2NPTB 1LXDA 2CKHB 4MGKE 2DZIA 5AEKB 4GIVA 2KZRA 2ZNVC 3PRZA 4GN1A 2YVCA 4K1RB 4HJKA 3DPDA 5LLIA 1KLVA 2KWVB 4PYUA 2K6QA 2KXJA 1V81A 2VRRB 2O6VD 3ZRFA 1HE8A 2BWFA 5C1ZA 3X23A 3JSVB 5DPWA 2UYZB 2RD0A 3BINA 3CF6E 3LDZE 3UIOB 2L3ZA 3ZRCA 4NY0A 1T0YA 2PEAA 4W9EA 3SDLC 1RAXA 1GNUA 4IM0A 3L0WB 3QCAA 2V3SA 4K81A 4MGIE 1EUVB 2DZJA 2N4FA 3VUWA 3DVNV 4MJSB 1ZKHA 2NBWB 2ZVOA 4E74A 2V1YA 1UELA 2KQSA 3EECA 4GDLB 1BT0A 2KWCA 3M63B 4IM3A 3NS8A 3ZVVA 4DXAB 4HWIB 1WFYA 5JHBA 4TQ0A 3VQIA 2KMAA 5E6OA 5J18A 3ZW3A 5EDSA 3MJWA 4ZRJA 4GDKB 2C7NB 2JRIB 4XZ4A 4EKUA 3WANA 4EFOA 2DAJA 3L08A 2RSUA 4B95A 1IPGA 2BYFA 2Y5BB 3OAWA 1WE7A 2J0KA 2K8CA 3H7SA 4WJPA 4ICVA 1S3SG 2K6DB 2MWSB 2PJHA 5E6NA 1V86A 4CO7A 4HLEA 2MBOA 3PSEB 2MP2B 1GUAB 4WJQA 3R66C 3EFUA 2KTRA 4I6NB 3ZKJC 2FIDA 3PT2B 3RCZA 3DBSA 1TZ1A 3A33B 2AYOB 3AU5A 2KTFA 4G50A 4IWQA 2KQ7A 2CHWA 3H7PA 1UZXB 2J7QB 4II3B 1E90A 4IWOA 2UWQA 3TMPB 2C60A 2KK8A 3U8ZA 4HCNB 2BGFA 2V4LA 1LM8B 4BOSC 3QK0A 3TCAA 1WXVA 3ZDMC 1GC6A 2GBMA 2G3QB 4BKGA 3PTFC 3ZUNA 3WALA 1OTRB 3A4RA 2ZNVB 4ASWC 5D6JB 2KX0A 2K1FA 2QHOA 3MHSD 1WX8A 3NOBA 3B08A 4WQOB 2LJ5A 2O2VA 2KDIA 2G45B 4FBJB 1XT9B 3ENEA 3EHVA 4E3CA 4CHKA 3U7DA 3A9KA 3UINB 1TTNA 1RLFA 4NPNA 1KM7A 5AZHA 2N7DA 3HM3A 2D2QA 1E7UA 3RZWC 1EF5A 4BKSA 1ZGUB 3PHWB 4GGQA 5C23A 1WGRA 4B6WA 3ZNID 4CYEA 3N3KB 4JL9A 3ZDTA 2XEWA 2LWPA 3CSFA 1OEYJ 3M62B 1RFAA 2N9EB 4WAAA 2L8JA 1L2NA 1Q5WB 4OVUA 3X0WA 2PE9A 2GBJA 3UQBA 2JPHA 3DCGA 2KNBA 3APDA 3CMMB 2NCNA 2IO1B 3VUYA 3BY4B 2JUOA 2M4NA 2W9NA 2KJHB 3DDCB 4YL8A 3TBLD 3KVFB 3PRMB 2IYDB 2M1MA 3QHTA 4W9FA 2LVPA 1UGMA 1WRDB 4FJYA 2PPHA 4G11A 1Q0WB 1P3QU 4W9JA 1WMHA 2L0FA 4P7IA 3L17A 2ZPYA 3V6CB 1F9JA 4LCDE 2KTRB 4KZCA 3QAQA 3JW0X 2LXCA 4GU2A 4GDLA 4DWFA 3RYTA 4MELA 2K8HA 2KX3A 5KHOA 4DK5A 2D10A 5E6PA 2KVRA 1M94A 4OVVA 4BBNC 4F1SA 3HHMA 3N30A 4KIKA 4AP4C 1RRBA 3H7PB 3ZTCA 1WI0A 2MA9B 3WIMA 4J6IA 3WA0A 2N1WA 2BPSA 2MLBA 2KHWB 3JVZX 3VH4B 2LGDA 1A5RA 1WR6E 3AU4A 2L00B 4IUMB 2DYMA 2CS4A 4NNJB 1GC7A 2KC1A 4W9KA 3AXCA 4F8CB 2N9PC 2GBKA 4FA6A 2M8SA 4M8MA 4MGZE 2HJ8A 3WAMA 3VVWB 1WM2A 2JRHA 3EC8A 3PS6A 1WE6A 2O2VB 2KFKA 3OJ4B 2NBUA 2BWES 3HIZA 4IWPA 4JGHB 2REXA 3V62A 2C7HA 3VTUA 3A9KB 2FCQA 2N9XA 4G0NB 1MG8A 3T9LA 2IO0B 2IY0B 2ZPNA 3UIPB 4AUQC 2NR2A 2GBRA 3SD5A 3L10B 5CHVC 2KOXA 1SE9A 2L7RA 2MX2A 3KUCB 2O6VA 4FLHA 2M0XA 3GZNI 3NZUA 2M17A 1LQBA 3A9JA 5D94A 2DZMA 2K39A 1TGZB 5JZEB 3O65B 2BYVE 2LD9A 4FJZA 1G6JA 1YD8U 4RMAA 2KD0A 2JVCA 1WXAA 3SHQA 3DBHI 2MQJA 1H8CA 2A5UA 1CMXB 3MTNB 1NBFC 3C0RB 2CHXA 1P9DU 5TR5A 2LGYA 2G4SA 1J19A 1E8YA 1AARA 3W1YA 1ZW7A 3LJ3A 4GOCA 3K9PB 1X1MA 2GMIC 4GMVA 1C3TA 2LVQA 3QA8A 4JLCA 5DCNA 4W9DA 4KV2A 1WMHB 3VAWA 2CHZA 3APFA 3I3TB 3UF8A 3OJ3A 1PQSA 4X57B 3B1LX 2B3AA
chains in the Genus database with same CATH superfamily
3QQ8B 4OZBA 1WZ3A 4LDTB 2LRUA 1PUTA 4K7WA 1HZ6A 2ZVNA 1ET6A 4OZCA 2DAFA 5AZGA 3C19A 4ANVA 3U30A 1GJZA 4MACA 4DHZB 1WXQA 1SEBD 2JYTA 1MHHE 3RI7C 3D32A 2JZPA 2QC8A 4FN2A 2RR9A 1WY8A 1DYQA 1P98A 3HUIA 3TEZA 2ZJDA 4PYZA 2JSVX 1WJ6A 3Q8BA 2QMTA 1GB4A 1K8RB 3PLUA 4LJOB 3E9SA 3ZNZB 1T5XD 1KJTA 2G4DB 3A9JB 5BO4B 2DENB 4TMAB 4OHJA 1P0RA 1JALA 4RM8A 4GB9A 1JWMD 1B9RA 2I1KA 2XN9C 1R4MI 1C4AA 1XLOA 1JWAD 2W3SA 3OWEB 1ISNA 4BFRA 4C4VB 1WJ4A 2FCSA 4OVZA 2RGFA 4WH4A 3L54A 1SBBB 3DBRI 3ML9A 5IP4D 1NI3A 2LXAA 5BMHA 3IHPC 4EZKA 3ZJUA 1OEYA 2KKCA 4AJWA 4HDOA 4W9LA 1RFKA 3L16A 1E6EB 1KOTA 2MSED 4KVGB 1WM3A 1RYJA 1I42A 4HPLB 4EUTA 3NVYA 3IVFA 5D7GA 3AE9B 3DBLI 1UBIA 2X38A 3PZDA 3TUOA 3IFWB 4N58A 4ZYSA 4PS8A 4NAWA 3RT3B 1L7YA 2Q5WD 2MBQA 2NTTA 5CTRC 2LFIA 2WXKA 1VR9A 1E8XA 2BS4B 2WDVB 2IGDA 2L52A 2KDEB 2WDTB 1E8ZA 4RGNA 2R61A 5CHWA 3Q3FA 3QARA 4NAMA 3Q3OC 3URYA 2YEPB 1VLBA 3A1QB 1YN3A 3H9DA 2PKOA 2LUEA 1NI2A 2E6XA 3Q8FA 2FUHB 3QX1A 3GZNB 4B9KA 2GLSA 2L83A 2I2YA 3UQAA 4TQ1A 3P4PB 4H2AA 3QJZA 1WGDA 1XD3B 4ZYNA 4BKSD 3RNCC 3PREA 4YTMB 4M8NA 1SE4A 1ZOYB 2ICIA 5FR6A 3TJPA 1EU3A 1V6EA 2W54A 2IZVB 4FULA 1FRRA 2CR5A 4K7SA 4MJSA 2WDQB 2YEPF 4IG7B 5JXVA 4A9AA 1C4PA 4AQ7A 3N1YC 3B2FA 3IT4B 1E7VA 2W82A 4RF0A 2WXRA 1S1QB 1WJUA 2DLBA 4FHKA 2BB5A 4M0WB 3DWGC 1CQVA 2NTSA 3L13A 3TIXA 1V1OA 1XQQA 1BXTA 1TBEA 3M3JA 2HDEA 2D11A 1AN8A 1T0RC 2Z59B 5LXHA 4JQWC 4NJ6A 5BMIA 4K3CA 2RMMA 3W1SC 1VZ6A 3ZIMA 4MSQB 1FXTB 4J3OD 4MM3B 1I7HA 4KGSA 1N5XA 3W5UB 4MT5A 5J17A 1I4QA 4DHJD 1WJNA 3DQVA 4WURA 1FEHA 1LXDA 2BB6A 2CKHB 2DZIA 1VDVA 1C4CA 5LLIA 2KXJA 2VRRB 2O6VD 3ZRFA 5C1ZA 1ROEA 2RD0A 3CF6E 3IAS1 2L3ZA 4KKJA 4W9EA 2PMVA 3AE3B 1GNUA 2V3SA 4K81A 3DVNV 4D2KA 3FC4A 1F0ZA 3M63B 1E7PB 3DHHC 3MFGA 4HWIB 2IDYA 1XO3A 2ON8A 4GDKB 4EKUA 2DAJA 4B95A 1C76A 1IPGA 1FCLA 2D3BA 4ICVA 4M00A 1S3SG 5E6NA 4CO7A 3R66C 2KTRA 2J4XA 1TKGA 2IJ0A 2M19A 3AU5A 2KTFA 4G50A 1XLNA 1UZXB 1TS3A 3TMPB 2KT7A 3KWLA 3AE8B 1GAQB 2V4LA 1WXVA 1T0QC 1GC6A 1L6UA 3SFDB 1DOIA 5EE1A 3PTFC 1NEKB 1OTRB 3B9JA 2J52A 3NOBA 2O2VA 2KDIA 3P4SB 1VZ8A 2WXHA 3EHVA 5FR3A 3A9KA 3NZ3A 2N7DA 1E7UA 1EF5A 4BKSA 2WP9B 1WGRA 4JL9A 2XEWA 1R4NB 2H89B 5D3IB 2PE9A 2MHJA 3UQBA 3ZJTA 1R7SA 2KNBA 3RNFC 3APDA 2JUOA 1GB1A 2WXOA 2VH1A 5H92C 3PRMB 2IYDB 4JX1C 1UGMA 1LGRA 1WRDB 2PPHA 1JW9D 1Q0WB 4W9JA 1V8CA 1VRAB 1FRDA 1D4BA 2ZPYA 3V6CB 4XDDA 3W9CB 4GDLA 1C78A 4DK5A 2QSDA 3HHMA 3AM9A 3N30A 4KIKA 3ZJVA 3NVVA 3CIRB 1DGJA 3IAM1 1MHXA 3AE6B 3AU4A 2L00B 4F8CB 1N61A 2AQ2B 2N9KA 3VVWB 2JRHA 3PS6A 1B1ZA 3OJ4B 2KFKA 2PVGC 3HIZA 4JGHB 4YXDB 2Z8LA 2N9XA 2VH2A 2ZPNA 3SD5A 3L10B 1SE9A 3ABVB 2O6VA 2BTEA 3NZUA 1HZ5A 2BQQA 1PYWD 4P1BC 5C2TB 3ZGZA 1H8CA 1C9FA 2D3AA 3BWUD 1ZW7A 3LJ3A 3VR9B 3K9PB 2LVQA 3QA8A 4JLCA 5DCNA 4KV2A 4RH6A 3AECB 3OJ3A 4X57B 4L2YA 3AULA 1EWYC 1V97A 2NS5A 4M02A 2VZKB 3AI5A 1E9MA 2LVOA 1I4HA 3MC0B 2RDGA 4JPSA 1D3ZA 4MSMB 1WYWB 2WGSA 3BZDB 3H8HA 5AUIA 1UWXA 4N6EB 3L4PA 5IA7A 3KUDB 3FAHA 2GOWA 3NJTA 3HRDD 4REZA 5IAAC 3S2AA 3VH3B 1QOBA 3EA6A 5HHDG 2IGHA 2FCNA 3AMZA 4ZRQA 1V80A 3ZLZA 4MGYE 1EU4A 3PPAA 4RM9A 1V49A 2N7EA 4RFBA 3V61A 5GMVA 2JZZA 4WQMA 2WYQA 1GPXA 4KSKC 1UD7A 2IBIB 2XK5A 4PS3A 2R2OA 1PGAA 5BMGA 4N9F4 3PHXB 3CSTA 5H8YE 1I4GA 3C8YA 3HK0A 4W9HA 1WGGA 2KWUB 3VTWA 1T0SC 5JH5C 2ZCBA 1SE2A 1QOAA 4HCPB 1BMLC 3IBEA 1KRHA 3TL5A 2C7MB 3RZFA 1YX5B 2DYBA 2JY6A 1TKYA 3ZNGC 4EZJA 4RGTA 3BK1A 1HXYD 2EMTA 4AWJA 3W2DA 3ECIA 1V5OA 3VUXA 1WRIA 2OJRA 4WJNA 2KMCA 3NVWA 4RCOA 1I35A 2FIFA 1UWMA 4AJYB 2WXQA 4PK1A 4ICUA 4LNOA 1HQRD 3LXFA 3ZNHB 4IKGA 4YSYB 2EKIA 2AL6A 2AWTA 1T6BX 2LGXA 2Y3AA 4XC2A 4KZ0A 3R3MA 1IBXA 4KDIC 2LZ6A 5G2NA 1C1YB 4EOYA 1KH0A 3DVGX 2SAKA 1FXAA 1WXSA 1N62A 3P4QB 4ANUA 1PGXA 1L6VA 3BVGA 2KN5A 4G3XB 2KDFB 2BKRB 4GXBA 2CU1A 1L4DB 3NZSA 3PVLA 4WWOA 2KDMA 1V5TA 4ZOHC 1J0GA 2LJIA 4LNNA 2D3CA 3ZXRA 3RFZB 3TSSA 5AZFA 1YNTE 4A6QA 3PGEA 3RD2A 1C79A 4BAXA 3ETRA 3M95A 3Q8EA 2ZW0A 1WWTA 3NHEB 3VTVA 1P1AA 1JQ4A 1JWUD 2JQRB 4WWPA 3KH0A 3P2BA 5D2MB 1KLGD 4WAFA 3SEBA 1QF6A 3AN1A 4LDTD 4PT5A 2ONQA 3QIJA 4P16A 1WZ0A 3N9YC 3ZQ4A 2MP2A 2EKEC 4K7UA 4XE0A 1QKZA 3UGBB 2KWDA 3VXWA 4TUUA 4XX5A 2BVCA 3DOWA 3GS2A 2WXIA 2OHFA 1QZEA 3RPFC 1IP9A 4IW0A 2BS2B 1NVID 4A3PA 1K50A 2L0TA 3GOEA 4HXDA 3KW5B 2NPTB 5EE9A 4RF1A 5AEKB 4GIVA 2ZNVC 3PRZA 4ZRPA 4HJKA 1KLVA 5LNK1 2QDFA 4PYUA 1V81A 1R4MB 1HE8A 3Q14C 3JSVB 3BINA 3KLSX 1ET9A 2DWQA 2PEAA 2WXPA 4IM0A 3L0WB 4MGIE 2DZJA 2N4FA 3VUWA 4E74A 1WSPA 2KWCA 3NS8A 4HROA 1YQ4B 1N63A 4TQ0A 3VQIA 3ZW3A 5EDSA 3MJWA 1NYRA 4XZ4A 1OQQA 2IPKD 2RSUA 1PGBA 2BYFA 2B76B 3DBLB 1WE7A 2K8CA 4WJPA 2PJHA 4HLEA 4JWSC 3O13A 3EFUA 2WU2B 3ZKJC 3DBSA 1TZ1A 1F52A 2AYOB 4IWQA 2CHWA 3H7PA 2PIAA 1ZP0B 1TS2A 4II3B 3HVZA 2UWQA 1ENFA 2C60A 2KK8A 2K9XA 4BOSC 3TCAA 2GBMA 3A4RA 2ZNVB 5D6JB 2K1FA 2QHOA 4RGOS 2LJ5A 4LNIA 1XT9B 3ENEA 4E3CA 5FKAC 1RLFA 4YWGG 1KM7A 5BYSA 2LGIA 3RZWC 1ZGUB 2KVZA 4GGQA 2K5PA 4B6WA 3ZNID 3AB5A 1EWCA 1VZ7A 1TZOA 2L8JA 1L2NA 3EGRA 2JPHA 3CMMB 2NCNA 4LLGM 4S0RA 3TBLD 3KVFB 4W9FA 4FJYA 4LNKA 2QEJC 1P3QU 3Q3NC 1WMHA 1L0YB 2KMMA 3MC8A 1YJJA 4GU2A 1F2RC 3RYTA 4MELA 2K8HA 5KHOA 4C00A 3BK2A 5E6PA 2V0GA 4BBNC 2BT6A 1RRBA 1WI0A 3WIMA 3DHGC 1AW7A 1SJHD 2N1WA 2KHWB 2MEKA 2HJ1A 2BW2A 2QCZA 1A5RA 1SXTA 1WR6E 4NNJB 2DYMA 2CS4A 1A70A 1GC7A 3PZ8A 2CJOA 4OZAA 2N9PC 3MJ5A 4M8MA 5IOIA 3EC8A 3Q3MC 1MVKA 2NBUA 2BWES 1XF5L 3IXSA 2C7HA 1I4PA 1SSNA 4A8XC 2PLPA 1MI0A 2NR2A 3EFCA 2GBRA 5CHVC 1V1PB 2L7RA 3U7ZA 4FLHA 2M0XA 4ITKA 3A9JA 1SJED 2GB1A 1TKEA 5JZEB 4FJZA 2W55A 1G6JA 2KD0A 2JVCA 3GP7A 2L1AA 3DBHI 1MJDA 5AUKA 1YMHE 3MHZA 5TR5A 2G4SA 1J19A 1E8YA 3LB8C 3W1YA 3PZ7A 4GOCA 4NJCA 1TS5A 4Q2JA 4C4VA 2GMIC 4GMVA 1XLQA 4W9DA 3APFA 3I3TB 1FMAD 3B1LX 3QK0A 2B3AA 4DDID 4AS1A 3V60A 4JE3B 2RDHA 4HVBA 4YT0B 4JWUC 3MC9A 1MPEA 2OOBB 2KACA 4KKIA 4LJPB 5T8IA 1V9JA 1WH3A 3ONSA 4URKA 1R4NI 2MJEA 2AL3A 4YTPB 1E8WA 1XCTL 4YSXB 3DVGY 4P1CC 2BKFA 4WWNA 4FJVB 4A55A 1UNSA 4DHZE 4TKNA 2IO2B 3KWVA 2IGGA 3AE4B 2Y5CA 2BYTA 5TSSA 1JWSD 3WCQA 4BBNF 5CHFA 3EUB2 1QOGA 2V3NA 3R2TA 1YJ1A 2KLCA 2WWZA 4MDKE 2LHEA 1Q1OA 1TY0A 1P7FA 2WS3B 3ZO5B 5JHAA 5KHQA 1QOFA 3E56A 4BKTA 1XEEA 1AWDA 1JWBD 4NJ7A 2XNAC 2N7JA 2EELA 3VHTC 5L83A 3TEYA 3U4EG 3PV1A 5IO9A 2KO3A 2H88B 2DBYA 1L5PA 4KX6B 1DOXA 2BF8B 1QLBB 1JCKB 1F1HA 4JIOU 2LUMA 1WGYA 4KGTA 2ZZPB 2Y5PA 5DPSA 3R7RA 3PO0A 1FFUA 1HEZE 3P63A 4FHJA 1FNVA 1MFWA 1WXMA 4YSZB 3K9OB 3WAOA 2Z0DB 1CJEA 4C7YA 4E71A 3NVZA 4PS7A 3VDZA 3GE3C 2WU5B 3I5JC 2INNE 2XBBC 4M0WA 3ML8A 3BYTB 1L0VB 3AH7A 2INCC 1LO5D 1SF0A 2WDRB 5BYQA 2D07B 5D3DA 1IUEA 1XLPA 1Y8RC 4EE2A 3T8MA 3AEFB 4HDQA 2KFJA 1P7EA 4MM3A 2MBEA 2D3GA 1VJKA 3NY5A 1CK1A 4TV3A 1ESFA 2EMSA 4UDUC 4DBGA 2N1VA 3DWMA 3NUHB 2ZCCA 1LFDA 4W9CA 1GG3A 4I6PA 1NDDA 2L76A 3Q3JA 1OGWA 1UBQA 2X8XX 3NRZA 4HPMB 4A90A 1J8CA 3OG5A 4EZLA 4L1BA 4KGRA 3I63C 1SGHA 1EM7A 4NQLB 4NAWB 2L05A 3H1UA 3TEWA 4MH0E 5L95C 4XWTA 2FCMA 3GE8C 2JWZA 1XCQL 3SR6A 1Z2MA 2M56B 3SU8X 4GDKA 4EEWA 3WAPA 3RULA 2LI5A 5IN7A 2INDC 1ZE3D 4DXFA 2K25A 2AQ1B 4XYCA 1UGJA 3I57A 2C5LC 2C9WB 2DX5B 1WX7A 3SFEB 1HA5A 3KYCD 3QC8B 4ARIA 3HM6X 2OEDA 1IYFA 2ASQA 2J0JA 2NVUI 1YN5A 3W1SA 5HKHA 2R2QA 4ZRIA 2LASA 1MG4A 2KC2A 2PE6B 1RM6C 3N32A 1K52A 2BS3B 4NQKE 1WIAA 4TSSA 2AEHA 4IC7B 4ZRKA 2WXGA 4MGKE 2KAJA 1AYFA 2UU7A 3DPDA 2KWVB 3RNEC 2K6QA 2WLBA 3X23A 5DPWA 1HTQA 3ZRCA 2MJDA 2JX5A 3QCAA 2TSSA 1EUVB 2E3TA 4MJSB 2FE8A 1YOVB 2V1YA 1UELA 2KQSA 3V6EB 1OFFA 3FILA 2KQ4X 1WFYA 5JHBA 5J18A 1SE3A 5BYRA 3AEBB 1FFVA 3AV8A 4OW0A 4ZRJA 2JRIB 3MP9A 1KF6B 3OAWA 4B0EA 2J0KA 3H7SA 5I4DA 2K6DB 1V86A 3PSEB 1GUAB 4I6NB 1D5MC 3PT2B 3RCZA 3N1XC 3A33B 1BUIC 5HI1A 4LTUA 1E90A 1J7CA 2J42A 2L32A 4HCNB 1XXGA 1LM8B 2QJLA 1IGDA 2M0AA 1N6ZA 4BKGA 3WALA 4HJGE 3Q8AA 4ASWC 1YN4A 1DOYA 4WQOB 4FBJB 1D6EC 4CHKA 3U7DA 1C77A 3AEGB 3UINB 1TTNA 2PVOD 2KN4A 5AZHA 3HM3A 2MH7A 5C23A 4CYEA 3BVZA 1TS4A 3N3KB 2LWPA 3CSFA 1OQRA 3R2IA 4WAAA 3X0WA 1NENB 3VUYA 3BY4B 2KJHB 1QQRA 4YL8A 2M1MA 1KLUD 2FBWB 2N0SB 4G11A 1ACCA 4P7IA 4K3BA 2KTRB 1CZPA 5G5HA 4C7ZA 2QILA 2W3RA 4F1SA 3ZTCA 5E6JA 3WA0A 3HVDA 4IUMB 1D5ZC 1FD6A 2GBKA 4FA6A 3DBRB 4MGZE 4XGAB 3WAMA 2O2VB 4IWPA 3T3NA 3VTUA 3A9KB 3T9LA 1MG8A 4MH8A 2IO0B 2IY0B 4M01A 3UIPB 4AUQC 2KOXA 3Q69A 1FNUA 3U52E 3GZNI 1LQBA 4HKZE 2DZMA 3P4RB 1ZXHA 1TGZB 4HKQA 2LD9A 1E10A 1YD8U 3I9V1 3SHQA 2MQJA 2A5UA 1CMXB 3C0RB 1ZDXA 2RPVA 1P9DU 1AARA 1K53A 3RNBC 3J9CA 3VAWA 3UF8A 1PQSA 4GDLB 1TT5B 2DYOA 5DPTA 3RMKC 2DHZA 3DHIC 1EF1A 4KIKB 3B0AA 3VRAB 3AE1B 4GSWA 1VCBA 4ANXA 2MCNB 2WQYB 2FAZA 4C56C 2YLMA 5G55A 4HK2A 2I1JA 1QT9A 1WYGA 2JWUA 2INPE 1WGKA 1TYGB 3ALBA 5DPRA 2WX0A 1Z5SB 1J7BA 4WIPA 2KFKB 4DHJB 3VFKA 3Q8CA 1UF0A 4HEA1 2MBHA 3B2GA 2KDBA 3A4SC 1OQYA 2Z0EB 3IG3A 1J7AA 2O6VB 2J53A 3GB1A 4L23A 2LEKA 2FNJB 5IKCM 4S17A 2SEBD 1JMLA 1ZDVA 3RUIB 4XDCA 3CWIA 3BIID 4R3DA 1WF9A 2RPQA 1YX6B 1TY2A 2HE7A 1E0ZA 1N60A 2WHIA 4IOIE 3PLVA 1YQBA 2NMQA 4W9GA 3JYUA 4NZLB 1N5WA 3FKYA 3R7QA 2JF5A 1QILA 2HTHA 3UI3A 1GOZA 2MBBB 3V05A 4FADA 3KUZA 2KJRA 4II2B 3ZXVA 4W9IA 1ZXIA 2KANA 4WJOA 4ZHPA 1JRPA 2GI9A 4A3OA 2IY1B 4BOZB 1JRUA 1UUPA 4US8A 5J2RA 1WGHA 2WXNA 1WR1A 1EO6A 2FUG1 5CX3A 2IO3B 1RWSA 1E5WA 3APCA 3P1MA 3DVNU 2WXLA 2K22A 3AEAB 2K3UA 1F2RI 2HTME 2NBVB 4DDGD 4CQNA 1Q10A 2KJ6A 4ZDVA 1TIFA 2XK5B 2D5GA 3T3OA 2LRWA 1H4RA 5GXGB 5G5GA 3VRBB 2J0MA 1UH6A 4MEMA 1VD2A 1L4ZB 2JZ3B 3OLMD 4O1NA 4I6LB 2NPTA 2HD5B 1SIFA 4USAA 3RN9C 2BBCA 3DBHB 2JT4B 1FPYA 4P6VF 4ZHOA 4F7ZA 2CJNA 1U4AA 3JSVA 4ANWA 2WX1A 2JXXA 2K8BA 4KDLB 3KYDD 1KFYB 2OJWA 4BVUC 1M4VA 3H6NA 4AOFA 2DZKA 1PDXA 4BZAA 2A4ZA 3BVMA 2BYEA 5LXIB 2AQ3B 2GRIA 2KLGA 3ZTDA 1TJEA 2MRPA 3TEXA 2GBNA 1YIWA 4IM2A 2JXTA 4HPPA 1PFDA 2G9HD 4KSLC 3AE2B 2WXFA 3A1QA 3FILB 3PRPB 2ACZB 2MW5A 1ZUD2 2ZEQA 1IBXB 1JROA 4A20A 1K51A 4C80A 4FXCA 1V2YA 5EE3A 3QWZB 1SB3C 1FO4A 3AEDB 1WX9A 2JYEA 2KZRA 4GN1A 2YVCA 4K1RB 2N9LA 1KTKA 3KQ4A 3Q6BA 1YJIA 2BWFA 4RGMA 3RNGC 2UYZB 3LDZE 3UIOB 4NY0A 5HFYA 1T0YA 3SDLC 1RAXA 2MJ3A 5C3JB 3NS1A 1ZKHA 2NBWB 2ZVOA 3EECA 1BT0A 4DXAB 4IM3A 3ZVVA 3NG0A 3BYYB 4B0MA 2KMAA 5E6OA 3AE7B 3R8BA 2C7NB 3WANA 4EFOA 3L08A 2Y5BB 1F77A 1HTOA 3V3XA 1IGCA 2MWSB 2PW9A 5MPOA 2LHDA 2MBOA 2MP2B 4WJQA 1NYQA 2FIDA 2RDBC 3AE5B 2KQ7A 2J7QB 4IWOA 2WXJA 3U8ZA 4WWMA 2BGFA 1YQ3B 3ZDMC 2G3QB 3ZUNA 2PTLA 2KX0A 3MHSD 3Q2AC 1WX8A 1ZPSA 3B08A 1STEA 4IDIA 2G45B 1FXIA 3N1ZC 4DQOC 2K0PA 1FNWA 4NPNA 2D2QA 3PHWB 1V1PA 4YTNB 3ZDTA 2QIEB 2AX5A 1OEYJ 3LYYA 3M62B 1RFAA 2JU6X 2N9EB 1Q5WB 4OVUA 2GBJA 2KYWA 2VZKD 1FM0D 4HRSA 5FK9C 3DCGA 3IT6B 2IO1B 3N20C 2M4NA 2W9NA 3DDCB 4N59A 3QHTA 1D5XC 2LVPA 1I4RA 2DNFA 4DXGA 4GLSC 2L0FA 3L17A 5HG2A 1F9JA 1Y56A 1SIJA 2V3PA 4LCDE 4KZCA 3QAQA 3JW0X 2LXCA 1I4XA 4DWFA 2KX3A 2D10A 2KVRA 1M94A 4OVVA 3W5VB 4AP4C 3H7PB 2MA9B 4J6IA 2BPSA 2MLBA 3JVZX 3VH4B 2LGDA 2KC1A 4W9KA 3AXCA 3P42A 3U2SC 1FIQA 2M8SA 2HJ8A 2WXMA 3AEEB 1WM2A 2I38A 1WE6A 4QAYA 3RNAC 2ZW1A 3V62A 2REXA 2FCQA 4G0NB 2LGSA 3VR8B 2V4IB 2G1EA 4RNAA 2MX2A 3KUCB 2M17A 5D94A 2K39A 3ZYYX 2WNMA 3O65B 2BYVE 4LK0M 4RMAA 1WXAA 2V9HA 3MTNB 1NBFC 2CHXA 1L0XB 2LGYA 5EE0A 2CU3A 4LNFA 4ARCA 1X1MA 1FCCC 2LMCA 1C3TA 1T3QA 1WMHB 4US9A 2CHZA 4ACFA 4XWWA
chains in the Genus database with same CATH topology
3QQ8B 4DDID 3V60A 2DYOA 5DPTA 4HVBA 1WZ3A 3AULA 4LDTB 2LRUA 2DHZA 4KIKB 1EF1A 4K7WA 2ZVNA 2OOBB 3B0AA 2NS5A 2DAFA 4GSWA 1VCBA 4ANXA 2MCNB 3AI5A 5AZGA 2LVOA 2FAZA 4LJPB 3U30A 4ANVA 2YLMA 1GJZA 1D3ZA 1V9JA 4MSMB 1WH3A 4DHZB 1WYWB 3ONSA 4URKA 5G55A 4HK2A 2I1JA 1R4NI 2AL3A 1E8WA 3D32A 3ALBA 5IA7A 5DPRA 2WX0A 4FN2A 3DVGY 1Z5SB 2RR9A 1WY8A 1P98A 2BKFA 2KFKB 3KUDB 4WWNA 2GOWA 5IAAC 3S2AA 4FJVB 3VFKA 3VH3B 4DHJB 2FCNA 2ZJDA 4PYZA 1V80A 3ZLZA 4MGYE 2MBHA 2KDBA 1WJ6A 4DHZE 3A4SC 4TKNA 1OQYA 3PPAA 1K8RB 4RM9A 2IO2B 1V49A 2N7EA 2Z0EB 3IG3A 3PLUA 2O6VB 4LJOB 3ZNZB 1KJTA 2G4DB 3A9JB 3V61A 5BO4B 2DENB 5GMVA 2JZZA 2FNJB 2WYQA 1P0RA 4KSKC 1UD7A 2IBIB 4BBNF 2XK5A 4PS3A 5CHFA 4RM8A 4GB9A 2R2OA 2I1KA 1YJ1A 1R4MI 2KLCA 2WWZA 4MDKE 4N9F4 3RUIB 1Q1OA 3PHXB 5JHAA 3ZO5B 3CSTA 5KHQA 1ISNA 4BFRA 3HK0A 4W9HA 1WGGA 1WJ4A 2FCSA 2KWUB 3VTWA 2ZCBA 2RGFA 4BKTA 4HCPB 3IBEA 3L54A 1WF9A 3DBRI 3ML9A 4NJ7A 2RPQA 1YX6B 2LXAA 3TL5A 2C7MB 3IHPC 3RZFA 4EZKA 2HE7A 1OEYA 2KKCA 4AJWA 3VHTC 5L83A 1YX5B 4HDOA 3PLVA 4W9LA 2DYBA 3PV1A 2JY6A 3L16A 3ZNGC 4EZJA 2KO3A 1YQBA 1KOTA 2MSED 4W9GA 3JYUA 2EMTA 4KVGB 1WM3A 3R7QA 2JF5A 1I42A 2HTHA 2BF8B 4HPLB 4EUTA 4AWJA 2MBBB 3ECIA 1V5OA 3IVFA 4FADA 4JIOU 5D7GA 3KUZA 3DBLI 3VUXA 1UBIA 3PZDA 2KJRA 1WGYA 2OJRA 3IFWB 4II2B 4WJNA 2ZZPB 4PS8A 2KMCA 4NAWA 3RT3B 4W9IA 1L7YA 2KANA 4WJOA 2MBQA 5DPSA 3R7RA 1I35A 4A3OA 5CTRC 2IY1B 4BOZB 2FIFA 1JRUA 4AJYB 4FHJA 5J2RA 1WGHA 1WXMA 4ICUA 1WR1A 3K9OB 3WAOA 1EO6A 2Z0DB 1E8XA 5CX3A 2IO3B 4E71A 4PS7A 3VDZA 1E5WA 3APCA 3ZNHB 3DVNU 2XBBC 3ML8A 2AL6A 2AWTA 2KDEB 2WDTB 1E8ZA 2LGXA 4XC2A 2NBVB 5CHWA 4KZ0A 3Q3FA 4DDGD 3R3MA 3QARA 2LZ6A 4KDIC 2KJ6A 5G2NA 4ZDVA 1C1YB 4EOYA 3DVGX 2XK5B 3A1QB 2D07B 3H9DA 1WXSA 1Y8RC 2LUEA 3T8MA 2LRWA 1H4RA 4ANUA 1NI2A 4HDQA 2KFJA 2FUHB 2KN5A 2J0MA 4MM3A 2MBEA 1UH6A 2D3GA 3QX1A 4G3XB 4MEMA 4B9KA 2KDFB 3NY5A 2BKRB 1VD2A 4GXBA 2CU1A 3UQAA 4TQ1A 3NZSA 3PVLA 2JZ3B 3OLMD 4TV3A 4WWOA 2EMSA 4DBGA 1V5TA 2N1VA 4I6LB 2NPTA 2HD5B 3QJZA 1WGDA 2ZCCA 1SIFA 1LFDA 4W9CA 1XD3B 1GG3A 1J0GA 4ZYNA 2JT4B 4I6PA 4BKSD 1NDDA 3PREA 2L76A 3Q3JA 1OGWA 4F7ZA 1U4AA 1UBQA 3JSVA 4M8NA 4ANWA 2WX1A 4HPMB 1J8CA 2JXXA 5FR6A 2K8BA 3TJPA 4KDLB 3KYDD 4BVUC 4EZLA 5AZFA 3H6NA 4AOFA 1V6EA 2IZVB 3PGEA 4FULA 2DZKA 3RD2A 1SGHA 2CR5A 4K7SA 4MJSA 2A4ZA 2BYEA 5LXIB 4NQLB 4IG7B 2L05A 3M95A 2KLGA 4NAWB 3H1UA 3ZTDA 4MH0E 3NHEB 3VTVA 5L95C 1P1AA 2MRPA 2FCMA 2JWZA 4WWPA 2GBNA 1YIWA 3KH0A 4IM2A 1E7VA 1Z2MA 3P2BA 5D2MB 3SU8X 4KSLC 4GDKA 4EEWA 5JH5C 1S1QB 1WJUA 3A1QA 3RULA 3WAPA 4FHKA 3PRPB 2LI5A 4LDTD 4M0WB 2MW5A 3QIJA 1WZ0A 3L13A 2K25A 2MP2A 2EKEC 4K7UA 2ZEQA 3TIXA 3UGBB 3VXWA 1XQQA 2C5LC 2C9WB 2DX5B 4TUUA 1WX7A 3KYCD 1TBEA 3M3JA 3QC8B 4XX5A 3HM6X 4A20A 2D11A 5LXHA 2Z59B 3DOWA 4JQWC 4NJ6A 1IYFA 2ASQA 2J0JA 2NVUI 3W1SC 3ZIMA 1QZEA 4MSQB 3W1SA 1V2YA 1FXTB 5HKHA 4IW0A 2R2QA 1IP9A 4ZRIA 2LASA 2KC2A 2PE6B 4A3PA 3N32A 3QWZB 4NQKE 2L0TA 1WIAA 5J17A 2AEHA 4IC7B 4DHJD 1WJNA 3DQVA 4ZRKA 1WX9A 3V6EB 3GOEA 4HXDA 3KW5B 2NPTB 1LXDA 2CKHB 4MGKE 2DZIA 5AEKB 4GIVA 2KZRA 2ZNVC 3PRZA 4GN1A 2YVCA 4K1RB 4HJKA 3DPDA 5LLIA 1KLVA 2KWVB 4PYUA 2K6QA 2KXJA 1V81A 2VRRB 2O6VD 3ZRFA 1HE8A 2BWFA 5C1ZA 3X23A 3JSVB 5DPWA 2UYZB 2RD0A 3BINA 3CF6E 3LDZE 3UIOB 2L3ZA 3ZRCA 4NY0A 1T0YA 2PEAA 4W9EA 3SDLC 1RAXA 1GNUA 4IM0A 3L0WB 3QCAA 2V3SA 4K81A 4MGIE 1EUVB 2DZJA 2N4FA 3VUWA 3DVNV 4MJSB 1ZKHA 2NBWB 2ZVOA 4E74A 2V1YA 1UELA 2KQSA 3EECA 4GDLB 1BT0A 2KWCA 3M63B 4IM3A 3NS8A 3ZVVA 4DXAB 4HWIB 1WFYA 5JHBA 4TQ0A 3VQIA 2KMAA 5E6OA 5J18A 3ZW3A 5EDSA 3MJWA 4ZRJA 4GDKB 2C7NB 2JRIB 4XZ4A 4EKUA 3WANA 4EFOA 2DAJA 3L08A 2RSUA 4B95A 1IPGA 2BYFA 2Y5BB 3OAWA 1WE7A 2J0KA 2K8CA 3H7SA 4WJPA 4ICVA 1S3SG 2K6DB 2MWSB 2PJHA 5E6NA 1V86A 4CO7A 4HLEA 2MBOA 3PSEB 2MP2B 1GUAB 4WJQA 3R66C 3EFUA 2KTRA 4I6NB 3ZKJC 2FIDA 3PT2B 3RCZA 3DBSA 1TZ1A 3A33B 2AYOB 3AU5A 2KTFA 4G50A 4IWQA 2KQ7A 2CHWA 3H7PA 1UZXB 2J7QB 4II3B 1E90A 4IWOA 2UWQA 3TMPB 2C60A 2KK8A 3U8ZA 4HCNB 2BGFA 2V4LA 1LM8B 4BOSC 3QK0A 3TCAA 1WXVA 3ZDMC 1GC6A 2GBMA 2G3QB 4BKGA 3PTFC 3ZUNA 3WALA 1OTRB 3A4RA 2ZNVB 4ASWC 5D6JB 2KX0A 2K1FA 2QHOA 3MHSD 1WX8A 3NOBA 3B08A 4WQOB 2LJ5A 2O2VA 2KDIA 2G45B 4FBJB 1XT9B 3ENEA 3EHVA 4E3CA 4CHKA 3U7DA 3A9KA 3UINB 1TTNA 1RLFA 4NPNA 1KM7A 5AZHA 2N7DA 3HM3A 2D2QA 1E7UA 3RZWC 1EF5A 4BKSA 1ZGUB 3PHWB 4GGQA 5C23A 1WGRA 4B6WA 3ZNID 4CYEA 3N3KB 4JL9A 3ZDTA 2XEWA 2LWPA 3CSFA 1OEYJ 3M62B 1RFAA 2N9EB 4WAAA 2L8JA 1L2NA 1Q5WB 4OVUA 3X0WA 2PE9A 2GBJA 3UQBA 2JPHA 3DCGA 2KNBA 3APDA 3CMMB 2NCNA 2IO1B 3VUYA 3BY4B 2JUOA 2M4NA 2W9NA 2KJHB 3DDCB 4YL8A 3TBLD 3KVFB 3PRMB 2IYDB 2M1MA 3QHTA 4W9FA 2LVPA 1UGMA 1WRDB 4FJYA 2PPHA 4G11A 1Q0WB 1P3QU 4W9JA 1WMHA 2L0FA 4P7IA 3L17A 2ZPYA 3V6CB 1F9JA 4LCDE 2KTRB 4KZCA 3QAQA 3JW0X 2LXCA 4GU2A 4GDLA 4DWFA 3RYTA 4MELA 2K8HA 2KX3A 5KHOA 4DK5A 2D10A 5E6PA 2KVRA 1M94A 4OVVA 4BBNC 4F1SA 3HHMA 3N30A 4KIKA 4AP4C 1RRBA 3H7PB 3ZTCA 1WI0A 2MA9B 3WIMA 4J6IA 3WA0A 2N1WA 2BPSA 2MLBA 2KHWB 3JVZX 3VH4B 2LGDA 1A5RA 1WR6E 3AU4A 2L00B 4IUMB 2DYMA 2CS4A 4NNJB 1GC7A 2KC1A 4W9KA 3AXCA 4F8CB 2N9PC 2GBKA 4FA6A 2M8SA 4M8MA 4MGZE 2HJ8A 3WAMA 3VVWB 1WM2A 2JRHA 3EC8A 3PS6A 1WE6A 2O2VB 2KFKA 3OJ4B 2NBUA 2BWES 3HIZA 4IWPA 4JGHB 2REXA 3V62A 2C7HA 3VTUA 3A9KB 2FCQA 2N9XA 4G0NB 1MG8A 3T9LA 2IO0B 2IY0B 2ZPNA 3UIPB 4AUQC 2NR2A 2GBRA 3SD5A 3L10B 5CHVC 2KOXA 1SE9A 2L7RA 2MX2A 3KUCB 2O6VA 4FLHA 2M0XA 3GZNI 3NZUA 2M17A 1LQBA 3A9JA 5D94A 2DZMA 2K39A 1TGZB 5JZEB 3O65B 2BYVE 2LD9A 4FJZA 1G6JA 1YD8U 4RMAA 2KD0A 2JVCA 1WXAA 3SHQA 3DBHI 2MQJA 1H8CA 2A5UA 1CMXB 3MTNB 1NBFC 3C0RB 2CHXA 1P9DU 5TR5A 2LGYA 2G4SA 1J19A 1E8YA 1AARA 3W1YA 1ZW7A 3LJ3A 4GOCA 3K9PB 1X1MA 2GMIC 4GMVA 1C3TA 2LVQA 3QA8A 4JLCA 5DCNA 4W9DA 4KV2A 1WMHB 3VAWA 2CHZA 3APFA 3I3TB 3UF8A 3OJ3A 1PQSA 4X57B 3B1LX 2B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  4DDI D;  3V60 A;  2DYO A;  5DPT A;  4HVB A;  1WZ3 A;  3AUL A;  4LDT B;  2LRU A;  2DHZ A;  4KIK B;  1EF1 A;  4K7W A;  2ZVN A;  2OOB B;  3B0A A;  2NS5 A;  2DAF A;  4GSW A;  1VCB A;  4ANX A;  2MCN B;  3AI5 A;  5AZG A;  2LVO A;  2FAZ A;  4LJP B;  3U30 A;  4ANV A;  2YLM A;  1GJZ A;  1D3Z A;  1V9J A;  4MSM B;  1WH3 A;  4DHZ B;  1WYW B;  3ONS A;  4URK A;  5G55 A;  4HK2 A;  2I1J A;  1R4N I;  2AL3 A;  1E8W A;  3D32 A;  3ALB A;  5IA7 A;  5DPR A;  2WX0 A;  4FN2 A;  3DVG Y;  1Z5S B;  2RR9 A;  1WY8 A;  1P98 A;  2BKF A;  2KFK B;  3KUD B;  4WWN A;  2GOW A;  5IAA C;  3S2A A;  4FJV B;  3VFK A;  3VH3 B;  4DHJ B;  2FCN A;  2ZJD A;  4PYZ A;  1V80 A;  3ZLZ A;  4MGY E;  2MBH A;  2KDB A;  1WJ6 A;  4DHZ E;  3A4S C;  4TKN A;  1OQY A;  3PPA A;  1K8R B;  4RM9 A;  2IO2 B;  1V49 A;  2N7E A;  2Z0E B;  3IG3 A;  3PLU A;  2O6V B;  4LJO B;  3ZNZ B;  1KJT A;  2G4D B;  3A9J B;  3V61 A;  5BO4 B;  2DEN B;  5GMV A;  2JZZ A;  2FNJ B;  2WYQ A;  1P0R A;  4KSK C;  1UD7 A;  2IBI B;  4BBN F;  2XK5 A;  4PS3 A;  5CHF A;  4RM8 A;  4GB9 A;  2R2O A;  2I1K A;  1YJ1 A;  1R4M I;  2KLC A;  2WWZ A;  4MDK E;  4N9F 4;  3RUI B;  1Q1O A;  3PHX B;  5JHA A;  3ZO5 B;  3CST A;  5KHQ A;  1ISN A;  4BFR A;  3HK0 A;  4W9H A;  1WGG A;  1WJ4 A;  2FCS A;  2KWU B;  3VTW A;  2ZCB A;  2RGF A;  4BKT A;  4HCP B;  3IBE A;  3L54 A;  1WF9 A;  3DBR I;  3ML9 A;  4NJ7 A;  2RPQ A;  1YX6 B;  2LXA A;  3TL5 A;  2C7M B;  3IHP C;  3RZF A;  4EZK A;  2HE7 A;  1OEY A;  2KKC A;  4AJW A;  3VHT C;  5L83 A;  1YX5 B;  4HDO A;  3PLV A;  4W9L A;  2DYB A;  3PV1 A;  2JY6 A;  3L16 A;  3ZNG C;  4EZJ A;  2KO3 A;  1YQB A;  1KOT A;  2MSE D;  4W9G A;  3JYU A;  2EMT A;  4KVG B;  1WM3 A;  3R7Q A;  2JF5 A;  1I42 A;  2HTH A;  2BF8 B;  4HPL B;  4EUT A;  4AWJ A;  2MBB B;  3ECI A;  1V5O A;  3IVF A;  4FAD A;  4JIO U;  5D7G A;  3KUZ A;  3DBL I;  3VUX A;  1UBI A;  3PZD A;  2KJR A;  1WGY A;  2OJR A;  3IFW B;  4II2 B;  4WJN A;  2ZZP B;  4PS8 A;  2KMC A;  4NAW A;  3RT3 B;  4W9I A;  1L7Y A;  2KAN A;  4WJO A;  2MBQ A;  5DPS A;  3R7R A;  1I35 A;  4A3O A;  5CTR C;  2IY1 B;  4BOZ B;  2FIF A;  1JRU A;  4AJY B;  4FHJ A;  5J2R A;  1WGH A;  1WXM A;  4ICU A;  1WR1 A;  3K9O B;  3WAO A;  1EO6 A;  2Z0D B;  1E8X A;  5CX3 A;  2IO3 B;  4E71 A;  4PS7 A;  3VDZ A;  1E5W A;  3APC A;  3ZNH B;  3DVN U;  2XBB C;  3ML8 A;  2AL6 A;  2AWT A;  2KDE B;  2WDT B;  1E8Z A;  2LGX A;  4XC2 A;  2NBV B;  5CHW A;  4KZ0 A;  3Q3F A;  4DDG D;  3R3M A;  3QAR A;  2LZ6 A;  4KDI C;  2KJ6 A;  5G2N A;  4ZDV A;  1C1Y B;  4EOY A;  3DVG X;  2XK5 B;  3A1Q B;  2D07 B;  3H9D A;  1WXS A;  1Y8R C;  2LUE A;  3T8M A;  2LRW A;  1H4R A;  4ANU A;  1NI2 A;  4HDQ A;  2KFJ A;  2FUH B;  2KN5 A;  2J0M A;  4MM3 A;  2MBE A;  1UH6 A;  2D3G A;  3QX1 A;  4G3X B;  4MEM A;  4B9K A;  2KDF B;  3NY5 A;  2BKR B;  1VD2 A;  4GXB A;  2CU1 A;  3UQA A;  4TQ1 A;  3NZS A;  3PVL A;  2JZ3 B;  3OLM D;  4TV3 A;  4WWO A;  2EMS A;  4DBG A;  1V5T A;  2N1V A;  4I6L B;  2NPT A;  2HD5 B;  3QJZ A;  1WGD A;  2ZCC A;  1SIF A;  1LFD A;  4W9C A;  1XD3 B;  1GG3 A;  1J0G A;  4ZYN A;  2JT4 B;  4I6P A;  4BKS D;  1NDD A;  3PRE A;  2L76 A;  3Q3J A;  1OGW A;  4F7Z A;  1U4A A;  1UBQ A;  3JSV A;  4M8N A;  4ANW A;  2WX1 A;  4HPM B;  1J8C A;  2JXX A;  5FR6 A;  2K8B A;  3TJP A;  4KDL B;  3KYD D;  4BVU C;  4EZL A;  5AZF A;  3H6N A;  4AOF A;  1V6E A;  2IZV B;  3PGE A;  4FUL A;  2DZK A;  3RD2 A;  1SGH A;  2CR5 A;  4K7S A;  4MJS A;  2A4Z A;  2BYE A;  5LXI B;  4NQL B;  4IG7 B;  2L05 A;  3M95 A;  2KLG A;  4NAW B;  3H1U A;  3ZTD A;  4MH0 E;  3NHE B;  3VTV A;  5L95 C;  1P1A A;  2MRP A;  2FCM A;  2JWZ A;  4WWP A;  2GBN A;  1YIW A;  3KH0 A;  4IM2 A;  1E7V A;  1Z2M A;  3P2B A;  5D2M B;  3SU8 X;  4KSL C;  4GDK A;  4EEW A;  5JH5 C;  1S1Q B;  1WJU A;  3A1Q A;  3RUL A;  3WAP A;  4FHK A;  3PRP B;  2LI5 A;  4LDT D;  4M0W B;  2MW5 A;  3QIJ A;  1WZ0 A;  3L13 A;  2K25 A;  2MP2 A;  2EKE C;  4K7U A;  2ZEQ A;  3TIX A;  3UGB B;  3VXW A;  1XQQ A;  2C5L C;  2C9W B;  2DX5 B;  4TUU A;  1WX7 A;  3KYC D;  1TBE A;  3M3J A;  3QC8 B;  4XX5 A;  3HM6 X;  4A20 A;  2D11 A;  5LXH A;  2Z59 B;  3DOW A;  4JQW C;  4NJ6 A;  1IYF A;  2ASQ A;  2J0J A;  2NVU I;  3W1S C;  3ZIM A;  1QZE A;  4MSQ B;  3W1S A;  1V2Y A;  1FXT B;  5HKH A;  4IW0 A;  2R2Q A;  1IP9 A;  4ZRI A;  2LAS A;  2KC2 A;  2PE6 B;  4A3P A;  3N32 A;  3QWZ B;  4NQK E;  2L0T A;  1WIA A;  5J17 A;  2AEH A;  4IC7 B;  4DHJ D;  1WJN A;  3DQV A;  4ZRK A;  1WX9 A;  3V6E B;  3GOE A;  4HXD A;  3KW5 B;  2NPT B;  1LXD A;  2CKH B;  4MGK E;  2DZI A;  5AEK B;  4GIV A;  2KZR A;  2ZNV C;  3PRZ A;  4GN1 A;  2YVC A;  4K1R B;  4HJK A;  3DPD A;  5LLI A;  1KLV A;  2KWV B;  4PYU A;  2K6Q A;  2KXJ A;  1V81 A;  2VRR B;  2O6V D;  3ZRF A;  1HE8 A;  2BWF A;  5C1Z A;  3X23 A;  3JSV B;  5DPW A;  2UYZ B;  2RD0 A;  3BIN A;  3CF6 E;  3LDZ E;  3UIO B;  2L3Z A;  3ZRC A;  4NY0 A;  1T0Y A;  2PEA A;  4W9E A;  3SDL C;  1RAX A;  1GNU A;  4IM0 A;  3L0W B;  3QCA A;  2V3S A;  4K81 A;  4MGI E;  1EUV B;  2DZJ A;  2N4F A;  3VUW A;  3DVN V;  4MJS B;  1ZKH A;  2NBW B;  2ZVO A;  4E74 A;  2V1Y A;  1UEL A;  2KQS A;  3EEC A;  4GDL B;  1BT0 A;  2KWC A;  3M63 B;  4IM3 A;  3NS8 A;  3ZVV A;  4DXA B;  4HWI B;  1WFY A;  5JHB A;  4TQ0 A;  3VQI A;  2KMA A;  5E6O A;  5J18 A;  3ZW3 A;  5EDS A;  3MJW A;  4ZRJ A;  4GDK B;  2C7N B;  2JRI B;  4XZ4 A;  4EKU A;  3WAN A;  4EFO A;  2DAJ A;  3L08 A;  2RSU A;  4B95 A;  1IPG A;  2BYF A;  2Y5B B;  3OAW A;  1WE7 A;  2J0K A;  2K8C A;  3H7S A;  4WJP A;  4ICV A;  1S3S G;  2K6D B;  2MWS B;  2PJH A;  5E6N A;  1V86 A;  4CO7 A;  4HLE A;  2MBO A;  3PSE B;  2MP2 B;  1GUA B;  4WJQ A;  3R66 C;  3EFU A;  2KTR A;  4I6N B;  3ZKJ C;  2FID A;  3PT2 B;  3RCZ A;  3DBS A;  1TZ1 A;  3A33 B;  2AYO B;  3AU5 A;  2KTF A;  4G50 A;  4IWQ A;  2KQ7 A;  2CHW A;  3H7P A;  1UZX B;  2J7Q B;  4II3 B;  1E90 A;  4IWO A;  2UWQ A;  3TMP B;  2C60 A;  2KK8 A;  3U8Z A;  4HCN B;  2BGF A;  2V4L A;  1LM8 B;  4BOS C;  3QK0 A;  3TCA A;  1WXV A;  3ZDM C;  1GC6 A;  2GBM A;  2G3Q B;  4BKG A;  3PTF C;  3ZUN A;  3WAL A;  1OTR B;  3A4R A;  2ZNV B;  4ASW C;  5D6J B;  2KX0 A;  2K1F A;  2QHO A;  3MHS D;  1WX8 A;  3NOB A;  3B08 A;  4WQO B;  2LJ5 A;  2O2V A;  2KDI A;  2G45 B;  4FBJ B;  1XT9 B;  3ENE A;  3EHV A;  4E3C A;  4CHK A;  3U7D A;  3A9K A;  3UIN B;  1TTN A;  1RLF A;  4NPN A;  1KM7 A;  5AZH A;  2N7D A;  3HM3 A;  2D2Q A;  1E7U A;  3RZW C;  1EF5 A;  4BKS A;  1ZGU B;  3PHW B;  4GGQ A;  5C23 A;  1WGR A;  4B6W A;  3ZNI D;  4CYE A;  3N3K B;  4JL9 A;  3ZDT A;  2XEW A;  2LWP A;  3CSF A;  1OEY J;  3M62 B;  1RFA A;  2N9E B;  4WAA A;  2L8J A;  1L2N A;  1Q5W B;  4OVU A;  3X0W A;  2PE9 A;  2GBJ A;  3UQB A;  2JPH A;  3DCG A;  2KNB A;  3APD A;  3CMM B;  2NCN A;  2IO1 B;  3VUY A;  3BY4 B;  2JUO A;  2M4N A;  2W9N A;  2KJH B;  3DDC B;  4YL8 A;  3TBL D;  3KVF B;  3PRM B;  2IYD B;  2M1M A;  3QHT A;  4W9F A;  2LVP A;  1UGM A;  1WRD B;  4FJY A;  2PPH A;  4G11 A;  1Q0W B;  1P3Q U;  4W9J A;  1WMH A;  2L0F A;  4P7I A;  3L17 A;  2ZPY A;  3V6C B;  1F9J A;  4LCD E;  2KTR B;  4KZC A;  3QAQ A;  3JW0 X;  2LXC A;  4GU2 A;  4GDL A;  4DWF A;  3RYT A;  4MEL A;  2K8H A;  2KX3 A;  5KHO A;  4DK5 A;  2D10 A;  5E6P A;  2KVR A;  1M94 A;  4OVV A;  4BBN C;  4F1S A;  3HHM A;  3N30 A;  4KIK A;  4AP4 C;  1RRB A;  3H7P B;  3ZTC A;  1WI0 A;  2MA9 B;  3WIM A;  4J6I A;  3WA0 A;  2N1W A;  2BPS A;  2MLB A;  2KHW B;  3JVZ X;  3VH4 B;  2LGD A;  1A5R A;  1WR6 E;  3AU4 A;  2L00 B;  4IUM B;  2DYM A;  2CS4 A;  4NNJ B;  1GC7 A;  2KC1 A;  4W9K A;  3AXC A;  4F8C B;  2N9P C;  2GBK A;  4FA6 A;  2M8S A;  4M8M A;  4MGZ E;  2HJ8 A;  3WAM A;  3VVW B;  1WM2 A;  2JRH A;  3EC8 A;  3PS6 A;  1WE6 A;  2O2V B;  2KFK A;  3OJ4 B;  2NBU A;  2BWE S;  3HIZ A;  4IWP A;  4JGH B;  2REX A;  3V62 A;  2C7H A;  3VTU A;  3A9K B;  2FCQ A;  2N9X A;  4G0N B;  1MG8 A;  3T9L A;  2IO0 B;  2IY0 B;  2ZPN A;  3UIP B;  4AUQ C;  2NR2 A;  2GBR A;  3SD5 A;  3L10 B;  5CHV C;  2KOX A;  1SE9 A;  2L7R A;  2MX2 A;  3KUC B;  2O6V A;  4FLH A;  2M0X A;  3GZN I;  3NZU A;  2M17 A;  1LQB A;  3A9J A;  5D94 A;  2DZM A;  2K39 A;  1TGZ B;  5JZE B;  3O65 B;  2BYV E;  2LD9 A;  4FJZ A;  1G6J A;  1YD8 U;  4RMA A;  2KD0 A;  2JVC A;  1WXA A;  3SHQ A;  3DBH I;  2MQJ A;  1H8C A;  2A5U A;  1CMX B;  3MTN B;  1NBF C;  3C0R B;  2CHX A;  1P9D U;  5TR5 A;  2LGY A;  2G4S A;  1J19 A;  1E8Y A;  1AAR A;  3W1Y A;  1ZW7 A;  3LJ3 A;  4GOC A;  3K9P B;  1X1M A;  2GMI C;  4GMV A;  1C3T A;  2LVQ A;  3QA8 A;  4JLC A;  5DCN A;  4W9D A;  4KV2 A;  1WMH B;  3VAW A;  2CHZ A;  3APF A;  3I3T B;  3UF8 A;  3OJ3 A;  1PQS A;  4X57 B;  3B1L X;  2B3A A; 
#chains in the Genus database with same CATH topology
 3QQ8 B;  4OZB A;  1WZ3 A;  4LDT B;  2LRU A;  1PUT A;  4K7W A;  1HZ6 A;  2ZVN A;  1ET6 A;  4OZC A;  2DAF A;  5AZG A;  3C19 A;  4ANV A;  3U30 A;  1GJZ A;  4MAC A;  4DHZ B;  1WXQ A;  1SEB D;  2JYT A;  1MHH E;  3RI7 C;  3D32 A;  2JZP A;  2QC8 A;  4FN2 A;  2RR9 A;  1WY8 A;  1DYQ A;  1P98 A;  3HUI A;  3TEZ A;  2ZJD A;  4PYZ A;  2JSV X;  1WJ6 A;  3Q8B A;  2QMT A;  1GB4 A;  1K8R B;  3PLU A;  4LJO B;  3E9S A;  3ZNZ B;  1T5X D;  1KJT A;  2G4D B;  3A9J B;  5BO4 B;  2DEN B;  4TMA B;  4OHJ A;  1P0R A;  1JAL A;  4RM8 A;  4GB9 A;  1JWM D;  1B9R A;  2I1K A;  2XN9 C;  1R4M I;  1C4A A;  1XLO A;  1JWA D;  2W3S A;  3OWE B;  1ISN A;  4BFR A;  4C4V B;  1WJ4 A;  2FCS A;  4OVZ A;  2RGF A;  4WH4 A;  3L54 A;  1SBB B;  3DBR I;  3ML9 A;  5IP4 D;  1NI3 A;  2LXA A;  5BMH A;  3IHP C;  4EZK A;  3ZJU A;  1OEY A;  2KKC A;  4AJW A;  4HDO A;  4W9L A;  1RFK A;  3L16 A;  1E6E B;  1KOT A;  2MSE D;  4KVG B;  1WM3 A;  1RYJ A;  1I42 A;  4HPL B;  4EUT A;  3NVY A;  3IVF A;  5D7G A;  3AE9 B;  3DBL I;  1UBI A;  2X38 A;  3PZD A;  3TUO A;  3IFW B;  4N58 A;  4ZYS A;  4PS8 A;  4NAW A;  3RT3 B;  1L7Y A;  2Q5W D;  2MBQ A;  2NTT A;  5CTR C;  2LFI A;  2WXK A;  1VR9 A;  1E8X A;  2BS4 B;  2WDV B;  2IGD A;  2L52 A;  2KDE B;  2WDT B;  1E8Z A;  4RGN A;  2R61 A;  5CHW A;  3Q3F A;  3QAR A;  4NAM A;  3Q3O C;  3URY A;  2YEP B;  1VLB A;  3A1Q B;  1YN3 A;  3H9D A;  2PKO A;  2LUE A;  1NI2 A;  2E6X A;  3Q8F A;  2FUH B;  3QX1 A;  3GZN B;  4B9K A;  2GLS A;  2L83 A;  2I2Y A;  3UQA A;  4TQ1 A;  3P4P B;  4H2A A;  3QJZ A;  1WGD A;  1XD3 B;  4ZYN A;  4BKS D;  3RNC C;  3PRE A;  4YTM B;  4M8N A;  1SE4 A;  1ZOY B;  2ICI A;  5FR6 A;  3TJP A;  1EU3 A;  1V6E A;  2W54 A;  2IZV B;  4FUL A;  1FRR A;  2CR5 A;  4K7S A;  4MJS A;  2WDQ B;  2YEP F;  4IG7 B;  5JXV A;  4A9A A;  1C4P A;  4AQ7 A;  3N1Y C;  3B2F A;  3IT4 B;  1E7V A;  2W82 A;  4RF0 A;  2WXR A;  1S1Q B;  1WJU A;  2DLB A;  4FHK A;  2BB5 A;  4M0W B;  3DWG C;  1CQV A;  2NTS A;  3L13 A;  3TIX A;  1V1O A;  1XQQ A;  1BXT A;  1TBE A;  3M3J A;  2HDE A;  2D11 A;  1AN8 A;  1T0R C;  2Z59 B;  5LXH A;  4JQW C;  4NJ6 A;  5BMI A;  4K3C A;  2RMM A;  3W1S C;  1VZ6 A;  3ZIM A;  4MSQ B;  1FXT B;  4J3O D;  4MM3 B;  1I7H A;  4KGS A;  1N5X A;  3W5U B;  4MT5 A;  5J17 A;  1I4Q A;  4DHJ D;  1WJN A;  3DQV A;  4WUR A;  1FEH A;  1LXD A;  2BB6 A;  2CKH B;  2DZI A;  1VDV A;  1C4C A;  5LLI A;  2KXJ A;  2VRR B;  2O6V D;  3ZRF A;  5C1Z A;  1ROE A;  2RD0 A;  3CF6 E;  3IAS 1;  2L3Z A;  4KKJ A;  4W9E A;  2PMV A;  3AE3 B;  1GNU A;  2V3S A;  4K81 A;  3DVN V;  4D2K A;  3FC4 A;  1F0Z A;  3M63 B;  1E7P B;  3DHH C;  3MFG A;  4HWI B;  2IDY A;  1XO3 A;  2ON8 A;  4GDK B;  4EKU A;  2DAJ A;  4B95 A;  1C76 A;  1IPG A;  1FCL A;  2D3B A;  4ICV A;  4M00 A;  1S3S G;  5E6N A;  4CO7 A;  3R66 C;  2KTR A;  2J4X A;  1TKG A;  2IJ0 A;  2M19 A;  3AU5 A;  2KTF A;  4G50 A;  1XLN A;  1UZX B;  1TS3 A;  3TMP B;  2KT7 A;  3KWL A;  3AE8 B;  1GAQ B;  2V4L A;  1WXV A;  1T0Q C;  1GC6 A;  1L6U A;  3SFD B;  1DOI A;  5EE1 A;  3PTF C;  1NEK B;  1OTR B;  3B9J A;  2J52 A;  3NOB A;  2O2V A;  2KDI A;  3P4S B;  1VZ8 A;  2WXH A;  3EHV A;  5FR3 A;  3A9K A;  3NZ3 A;  2N7D A;  1E7U A;  1EF5 A;  4BKS A;  2WP9 B;  1WGR A;  4JL9 A;  2XEW A;  1R4N B;  2H89 B;  5D3I B;  2PE9 A;  2MHJ A;  3UQB A;  3ZJT A;  1R7S A;  2KNB A;  3RNF C;  3APD A;  2JUO A;  1GB1 A;  2WXO A;  2VH1 A;  5H92 C;  3PRM B;  2IYD B;  4JX1 C;  1UGM A;  1LGR A;  1WRD B;  2PPH A;  1JW9 D;  1Q0W B;  4W9J A;  1V8C A;  1VRA B;  1FRD A;  1D4B A;  2ZPY A;  3V6C B;  4XDD A;  3W9C B;  4GDL A;  1C78 A;  4DK5 A;  2QSD A;  3HHM A;  3AM9 A;  3N30 A;  4KIK A;  3ZJV A;  3NVV A;  3CIR B;  1DGJ A;  3IAM 1;  1MHX A;  3AE6 B;  3AU4 A;  2L00 B;  4F8C B;  1N61 A;  2AQ2 B;  2N9K A;  3VVW B;  2JRH A;  3PS6 A;  1B1Z A;  3OJ4 B;  2KFK A;  2PVG C;  3HIZ A;  4JGH B;  4YXD B;  2Z8L A;  2N9X A;  2VH2 A;  2ZPN A;  3SD5 A;  3L10 B;  1SE9 A;  3ABV B;  2O6V A;  2BTE A;  3NZU A;  1HZ5 A;  2BQQ A;  1PYW D;  4P1B C;  5C2T B;  3ZGZ A;  1H8C A;  1C9F A;  2D3A A;  3BWU D;  1ZW7 A;  3LJ3 A;  3VR9 B;  3K9P B;  2LVQ A;  3QA8 A;  4JLC A;  5DCN A;  4KV2 A;  4RH6 A;  3AEC B;  3OJ3 A;  4X57 B;  4L2Y A;  3AUL A;  1EWY C;  1V97 A;  2NS5 A;  4M02 A;  2VZK B;  3AI5 A;  1E9M A;  2LVO A;  1I4H A;  3MC0 B;  2RDG A;  4JPS A;  1D3Z A;  4MSM B;  1WYW B;  2WGS A;  3BZD B;  3H8H A;  5AUI A;  1UWX A;  4N6E B;  3L4P A;  5IA7 A;  3KUD B;  3FAH A;  2GOW A;  3NJT A;  3HRD D;  4REZ A;  5IAA C;  3S2A A;  3VH3 B;  1QOB A;  3EA6 A;  5HHD G;  2IGH A;  2FCN A;  3AMZ A;  4ZRQ A;  1V80 A;  3ZLZ A;  4MGY E;  1EU4 A;  3PPA A;  4RM9 A;  1V49 A;  2N7E A;  4RFB A;  3V61 A;  5GMV A;  2JZZ A;  4WQM A;  2WYQ A;  1GPX A;  4KSK C;  1UD7 A;  2IBI B;  2XK5 A;  4PS3 A;  2R2O A;  1PGA A;  5BMG A;  4N9F 4;  3PHX B;  3CST A;  5H8Y E;  1I4G A;  3C8Y A;  3HK0 A;  4W9H A;  1WGG A;  2KWU B;  3VTW A;  1T0S C;  5JH5 C;  2ZCB A;  1SE2 A;  1QOA A;  4HCP B;  1BML C;  3IBE A;  1KRH A;  3TL5 A;  2C7M B;  3RZF A;  1YX5 B;  2DYB A;  2JY6 A;  1TKY A;  3ZNG C;  4EZJ A;  4RGT A;  3BK1 A;  1HXY D;  2EMT A;  4AWJ A;  3W2D A;  3ECI A;  1V5O A;  3VUX A;  1WRI A;  2OJR A;  4WJN A;  2KMC A;  3NVW A;  4RCO A;  1I35 A;  2FIF A;  1UWM A;  4AJY B;  2WXQ A;  4PK1 A;  4ICU A;  4LNO A;  1HQR D;  3LXF A;  3ZNH B;  4IKG A;  4YSY B;  2EKI A;  2AL6 A;  2AWT A;  1T6B X;  2LGX A;  2Y3A A;  4XC2 A;  4KZ0 A;  3R3M A;  1IBX A;  4KDI C;  2LZ6 A;  5G2N A;  1C1Y B;  4EOY A;  1KH0 A;  3DVG X;  2SAK A;  1FXA A;  1WXS A;  1N62 A;  3P4Q B;  4ANU A;  1PGX A;  1L6V A;  3BVG A;  2KN5 A;  4G3X B;  2KDF B;  2BKR B;  4GXB A;  2CU1 A;  1L4D B;  3NZS A;  3PVL A;  4WWO A;  2KDM A;  1V5T A;  4ZOH C;  1J0G A;  2LJI A;  4LNN A;  2D3C A;  3ZXR A;  3RFZ B;  3TSS A;  5AZF A;  1YNT E;  4A6Q A;  3PGE A;  3RD2 A;  1C79 A;  4BAX A;  3ETR A;  3M95 A;  3Q8E A;  2ZW0 A;  1WWT A;  3NHE B;  3VTV A;  1P1A A;  1JQ4 A;  1JWU D;  2JQR B;  4WWP A;  3KH0 A;  3P2B A;  5D2M B;  1KLG D;  4WAF A;  3SEB A;  1QF6 A;  3AN1 A;  4LDT D;  4PT5 A;  2ONQ A;  3QIJ A;  4P16 A;  1WZ0 A;  3N9Y C;  3ZQ4 A;  2MP2 A;  2EKE C;  4K7U A;  4XE0 A;  1QKZ A;  3UGB B;  2KWD A;  3VXW A;  4TUU A;  4XX5 A;  2BVC A;  3DOW A;  3GS2 A;  2WXI A;  2OHF A;  1QZE A;  3RPF C;  1IP9 A;  4IW0 A;  2BS2 B;  1NVI D;  4A3P A;  1K50 A;  2L0T A;  3GOE A;  4HXD A;  3KW5 B;  2NPT B;  5EE9 A;  4RF1 A;  5AEK B;  4GIV A;  2ZNV C;  3PRZ A;  4ZRP A;  4HJK A;  1KLV A;  5LNK 1;  2QDF A;  4PYU A;  1V81 A;  1R4M B;  1HE8 A;  3Q14 C;  3JSV B;  3BIN A;  3KLS X;  1ET9 A;  2DWQ A;  2PEA A;  2WXP A;  4IM0 A;  3L0W B;  4MGI E;  2DZJ A;  2N4F A;  3VUW A;  4E74 A;  1WSP A;  2KWC A;  3NS8 A;  4HRO A;  1YQ4 B;  1N63 A;  4TQ0 A;  3VQI A;  3ZW3 A;  5EDS A;  3MJW A;  1NYR A;  4XZ4 A;  1OQQ A;  2IPK D;  2RSU A;  1PGB A;  2BYF A;  2B76 B;  3DBL B;  1WE7 A;  2K8C A;  4WJP A;  2PJH A;  4HLE A;  4JWS C;  3O13 A;  3EFU A;  2WU2 B;  3ZKJ C;  3DBS A;  1TZ1 A;  1F52 A;  2AYO B;  4IWQ A;  2CHW A;  3H7P A;  2PIA A;  1ZP0 B;  1TS2 A;  4II3 B;  3HVZ A;  2UWQ A;  1ENF A;  2C60 A;  2KK8 A;  2K9X A;  4BOS C;  3TCA A;  2GBM A;  3A4R A;  2ZNV B;  5D6J B;  2K1F A;  2QHO A;  4RGO S;  2LJ5 A;  4LNI A;  1XT9 B;  3ENE A;  4E3C A;  5FKA C;  1RLF A;  4YWG G;  1KM7 A;  5BYS A;  2LGI A;  3RZW C;  1ZGU B;  2KVZ A;  4GGQ A;  2K5P A;  4B6W A;  3ZNI D;  3AB5 A;  1EWC A;  1VZ7 A;  1TZO A;  2L8J A;  1L2N A;  3EGR A;  2JPH A;  3CMM B;  2NCN A;  4LLG M;  4S0R A;  3TBL D;  3KVF B;  4W9F A;  4FJY A;  4LNK A;  2QEJ C;  1P3Q U;  3Q3N C;  1WMH A;  1L0Y B;  2KMM A;  3MC8 A;  1YJJ A;  4GU2 A;  1F2R C;  3RYT A;  4MEL A;  2K8H A;  5KHO A;  4C00 A;  3BK2 A;  5E6P A;  2V0G A;  4BBN C;  2BT6 A;  1RRB A;  1WI0 A;  3WIM A;  3DHG C;  1AW7 A;  1SJH D;  2N1W A;  2KHW B;  2MEK A;  2HJ1 A;  2BW2 A;  2QCZ A;  1A5R A;  1SXT A;  1WR6 E;  4NNJ B;  2DYM A;  2CS4 A;  1A70 A;  1GC7 A;  3PZ8 A;  2CJO A;  4OZA A;  2N9P C;  3MJ5 A;  4M8M A;  5IOI A;  3EC8 A;  3Q3M C;  1MVK A;  2NBU A;  2BWE S;  1XF5 L;  3IXS A;  2C7H A;  1I4P A;  1SSN A;  4A8X C;  2PLP A;  1MI0 A;  2NR2 A;  3EFC A;  2GBR A;  5CHV C;  1V1P B;  2L7R A;  3U7Z A;  4FLH A;  2M0X A;  4ITK A;  3A9J A;  1SJE D;  2GB1 A;  1TKE A;  5JZE B;  4FJZ A;  2W55 A;  1G6J A;  2KD0 A;  2JVC A;  3GP7 A;  2L1A A;  3DBH I;  1MJD A;  5AUK A;  1YMH E;  3MHZ A;  5TR5 A;  2G4S A;  1J19 A;  1E8Y A;  3LB8 C;  3W1Y A;  3PZ7 A;  4GOC A;  4NJC A;  1TS5 A;  4Q2J A;  4C4V A;  2GMI C;  4GMV A;  1XLQ A;  4W9D A;  3APF A;  3I3T B;  1FMA D;  3B1L X;  3QK0 A;  2B3A A;  4DDI D;  4AS1 A;  3V60 A;  4JE3 B;  2RDH A;  4HVB A;  4YT0 B;  4JWU C;  3MC9 A;  1MPE A;  2OOB B;  2KAC A;  4KKI A;  4LJP B;  5T8I A;  1V9J A;  1WH3 A;  3ONS A;  4URK A;  1R4N I;  2MJE A;  2AL3 A;  4YTP B;  1E8W A;  1XCT L;  4YSX B;  3DVG Y;  4P1C C;  2BKF A;  4WWN A;  4FJV B;  4A55 A;  1UNS A;  4DHZ E;  4TKN A;  2IO2 B;  3KWV A;  2IGG A;  3AE4 B;  2Y5C A;  2BYT A;  5TSS A;  1JWS D;  3WCQ A;  4BBN F;  5CHF A;  3EUB 2;  1QOG A;  2V3N A;  3R2T A;  1YJ1 A;  2KLC A;  2WWZ A;  4MDK E;  2LHE A;  1Q1O A;  1TY0 A;  1P7F A;  2WS3 B;  3ZO5 B;  5JHA A;  5KHQ A;  1QOF A;  3E56 A;  4BKT A;  1XEE A;  1AWD A;  1JWB D;  4NJ7 A;  2XNA C;  2N7J A;  2EEL A;  3VHT C;  5L83 A;  3TEY A;  3U4E G;  3PV1 A;  5IO9 A;  2KO3 A;  2H88 B;  2DBY A;  1L5P A;  4KX6 B;  1DOX A;  2BF8 B;  1QLB B;  1JCK B;  1F1H A;  4JIO U;  2LUM A;  1WGY A;  4KGT A;  2ZZP B;  2Y5P A;  5DPS A;  3R7R A;  3PO0 A;  1FFU A;  1HEZ E;  3P63 A;  4FHJ A;  1FNV A;  1MFW A;  1WXM A;  4YSZ B;  3K9O B;  3WAO A;  2Z0D B;  1CJE A;  4C7Y A;  4E71 A;  3NVZ A;  4PS7 A;  3VDZ A;  3GE3 C;  2WU5 B;  3I5J C;  2INN E;  2XBB C;  4M0W A;  3ML8 A;  3BYT B;  1L0V B;  3AH7 A;  2INC C;  1LO5 D;  1SF0 A;  2WDR B;  5BYQ A;  2D07 B;  5D3D A;  1IUE A;  1XLP A;  1Y8R C;  4EE2 A;  3T8M A;  3AEF B;  4HDQ A;  2KFJ A;  1P7E A;  4MM3 A;  2MBE A;  2D3G A;  1VJK A;  3NY5 A;  1CK1 A;  4TV3 A;  1ESF A;  2EMS A;  4UDU C;  4DBG A;  2N1V A;  3DWM A;  3NUH B;  2ZCC A;  1LFD A;  4W9C A;  1GG3 A;  4I6P A;  1NDD A;  2L76 A;  3Q3J A;  1OGW A;  1UBQ A;  2X8X X;  3NRZ A;  4HPM B;  4A90 A;  1J8C A;  3OG5 A;  4EZL A;  4L1B A;  4KGR A;  3I63 C;  1SGH A;  1EM7 A;  4NQL B;  4NAW B;  2L05 A;  3H1U A;  3TEW A;  4MH0 E;  5L95 C;  4XWT A;  2FCM A;  3GE8 C;  2JWZ A;  1XCQ L;  3SR6 A;  1Z2M A;  2M56 B;  3SU8 X;  4GDK A;  4EEW A;  3WAP A;  3RUL A;  2LI5 A;  5IN7 A;  2IND C;  1ZE3 D;  4DXF A;  2K25 A;  2AQ1 B;  4XYC A;  1UGJ A;  3I57 A;  2C5L C;  2C9W B;  2DX5 B;  1WX7 A;  3SFE B;  1HA5 A;  3KYC D;  3QC8 B;  4ARI A;  3HM6 X;  2OED A;  1IYF A;  2ASQ A;  2J0J A;  2NVU I;  1YN5 A;  3W1S A;  5HKH A;  2R2Q A;  4ZRI A;  2LAS A;  1MG4 A;  2KC2 A;  2PE6 B;  1RM6 C;  3N32 A;  1K52 A;  2BS3 B;  4NQK E;  1WIA A;  4TSS A;  2AEH A;  4IC7 B;  4ZRK A;  2WXG A;  4MGK E;  2KAJ A;  1AYF A;  2UU7 A;  3DPD A;  2KWV B;  3RNE C;  2K6Q A;  2WLB A;  3X23 A;  5DPW A;  1HTQ A;  3ZRC A;  2MJD A;  2JX5 A;  3QCA A;  2TSS A;  1EUV B;  2E3T A;  4MJS B;  2FE8 A;  1YOV B;  2V1Y A;  1UEL A;  2KQS A;  3V6E B;  1OFF A;  3FIL A;  2KQ4 X;  1WFY A;  5JHB A;  5J18 A;  1SE3 A;  5BYR A;  3AEB B;  1FFV A;  3AV8 A;  4OW0 A;  4ZRJ A;  2JRI B;  3MP9 A;  1KF6 B;  3OAW A;  4B0E A;  2J0K A;  3H7S A;  5I4D A;  2K6D B;  1V86 A;  3PSE B;  1GUA B;  4I6N B;  1D5M C;  3PT2 B;  3RCZ A;  3N1X C;  3A33 B;  1BUI C;  5HI1 A;  4LTU A;  1E90 A;  1J7C A;  2J42 A;  2L32 A;  4HCN B;  1XXG A;  1LM8 B;  2QJL A;  1IGD A;  2M0A A;  1N6Z A;  4BKG A;  3WAL A;  4HJG E;  3Q8A A;  4ASW C;  1YN4 A;  1DOY A;  4WQO B;  4FBJ B;  1D6E C;  4CHK A;  3U7D A;  1C77 A;  3AEG B;  3UIN B;  1TTN A;  2PVO D;  2KN4 A;  5AZH A;  3HM3 A;  2MH7 A;  5C23 A;  4CYE A;  3BVZ A;  1TS4 A;  3N3K B;  2LWP A;  3CSF A;  1OQR A;  3R2I A;  4WAA A;  3X0W A;  1NEN B;  3VUY A;  3BY4 B;  2KJH B;  1QQR A;  4YL8 A;  2M1M A;  1KLU D;  2FBW B;  2N0S B;  4G11 A;  1ACC A;  4P7I A;  4K3B A;  2KTR B;  1CZP A;  5G5H A;  4C7Z A;  2QIL A;  2W3R A;  4F1S A;  3ZTC A;  5E6J A;  3WA0 A;  3HVD A;  4IUM B;  1D5Z C;  1FD6 A;  2GBK A;  4FA6 A;  3DBR B;  4MGZ E;  4XGA B;  3WAM A;  2O2V B;  4IWP A;  3T3N A;  3VTU A;  3A9K B;  3T9L A;  1MG8 A;  4MH8 A;  2IO0 B;  2IY0 B;  4M01 A;  3UIP B;  4AUQ C;  2KOX A;  3Q69 A;  1FNU A;  3U52 E;  3GZN I;  1LQB A;  4HKZ E;  2DZM A;  3P4R B;  1ZXH A;  1TGZ B;  4HKQ A;  2LD9 A;  1E10 A;  1YD8 U;  3I9V 1;  3SHQ A;  2MQJ A;  2A5U A;  1CMX B;  3C0R B;  1ZDX A;  2RPV A;  1P9D U;  1AAR A;  1K53 A;  3RNB C;  3J9C A;  3VAW A;  3UF8 A;  1PQS A;  4GDL B;  1TT5 B;  2DYO A;  5DPT A;  3RMK C;  2DHZ A;  3DHI C;  1EF1 A;  4KIK B;  3B0A A;  3VRA B;  3AE1 B;  4GSW A;  1VCB A;  4ANX A;  2MCN B;  2WQY B;  2FAZ A;  4C56 C;  2YLM A;  5G55 A;  4HK2 A;  2I1J A;  1QT9 A;  1WYG A;  2JWU A;  2INP E;  1WGK A;  1TYG B;  3ALB A;  5DPR A;  2WX0 A;  1Z5S B;  1J7B A;  4WIP A;  2KFK B;  4DHJ B;  3VFK A;  3Q8C A;  1UF0 A;  4HEA 1;  2MBH A;  3B2G A;  2KDB A;  3A4S C;  1OQY A;  2Z0E B;  3IG3 A;  1J7A A;  2O6V B;  2J53 A;  3GB1 A;  4L23 A;  2LEK A;  2FNJ B;  5IKC M;  4S17 A;  2SEB D;  1JML A;  1ZDV A;  3RUI B;  4XDC A;  3CWI A;  3BII D;  4R3D A;  1WF9 A;  2RPQ A;  1YX6 B;  1TY2 A;  2HE7 A;  1E0Z A;  1N60 A;  2WHI A;  4IOI E;  3PLV A;  1YQB A;  2NMQ A;  4W9G A;  3JYU A;  4NZL B;  1N5W A;  3FKY A;  3R7Q A;  2JF5 A;  1QIL A;  2HTH A;  3UI3 A;  1GOZ A;  2MBB B;  3V05 A;  4FAD A;  3KUZ A;  2KJR A;  4II2 B;  3ZXV A;  4W9I A;  1ZXI A;  2KAN A;  4WJO A;  4ZHP A;  1JRP A;  2GI9 A;  4A3O A;  2IY1 B;  4BOZ B;  1JRU A;  1UUP A;  4US8 A;  5J2R A;  1WGH A;  2WXN A;  1WR1 A;  1EO6 A;  2FUG 1;  5CX3 A;  2IO3 B;  1RWS A;  1E5W A;  3APC A;  3P1M A;  3DVN U;  2WXL A;  2K22 A;  3AEA B;  2K3U A;  1F2R I;  2HTM E;  2NBV B;  4DDG D;  4CQN A;  1Q10 A;  2KJ6 A;  4ZDV A;  1TIF A;  2XK5 B;  2D5G A;  3T3O A;  2LRW A;  1H4R A;  5GXG B;  5G5G A;  3VRB B;  2J0M A;  1UH6 A;  4MEM A;  1VD2 A;  1L4Z B;  2JZ3 B;  3OLM D;  4O1N A;  4I6L B;  2NPT A;  2HD5 B;  1SIF A;  4USA A;  3RN9 C;  2BBC A;  3DBH B;  2JT4 B;  1FPY A;  4P6V F;  4ZHO A;  4F7Z A;  2CJN A;  1U4A A;  3JSV A;  4ANW A;  2WX1 A;  2JXX A;  2K8B A;  4KDL B;  3KYD D;  1KFY B;  2OJW A;  4BVU C;  1M4V A;  3H6N A;  4AOF A;  2DZK A;  1PDX A;  4BZA A;  2A4Z A;  3BVM A;  2BYE A;  5LXI B;  2AQ3 B;  2GRI A;  2KLG A;  3ZTD A;  1TJE A;  2MRP A;  3TEX A;  2GBN A;  1YIW A;  4IM2 A;  2JXT A;  4HPP A;  1PFD A;  2G9H D;  4KSL C;  3AE2 B;  2WXF A;  3A1Q A;  3FIL B;  3PRP B;  2ACZ B;  2MW5 A;  1ZUD 2;  2ZEQ A;  1IBX B;  1JRO A;  4A20 A;  1K51 A;  4C80 A;  4FXC A;  1V2Y A;  5EE3 A;  3QWZ B;  1SB3 C;  1FO4 A;  3AED B;  1WX9 A;  2JYE A;  2KZR A;  4GN1 A;  2YVC A;  4K1R B;  2N9L A;  1KTK A;  3KQ4 A;  3Q6B A;  1YJI A;  2BWF A;  4RGM A;  3RNG C;  2UYZ B;  3LDZ E;  3UIO B;  4NY0 A;  5HFY A;  1T0Y A;  3SDL C;  1RAX A;  2MJ3 A;  5C3J B;  3NS1 A;  1ZKH A;  2NBW B;  2ZVO A;  3EEC A;  1BT0 A;  4DXA B;  4IM3 A;  3ZVV A;  3NG0 A;  3BYY B;  4B0M A;  2KMA A;  5E6O A;  3AE7 B;  3R8B A;  2C7N B;  3WAN A;  4EFO A;  3L08 A;  2Y5B B;  1F77 A;  1HTO A;  3V3X A;  1IGC A;  2MWS B;  2PW9 A;  5MPO A;  2LHD A;  2MBO A;  2MP2 B;  4WJQ A;  1NYQ A;  2FID A;  2RDB C;  3AE5 B;  2KQ7 A;  2J7Q B;  4IWO A;  2WXJ A;  3U8Z A;  4WWM A;  2BGF A;  1YQ3 B;  3ZDM C;  2G3Q B;  3ZUN A;  2PTL A;  2KX0 A;  3MHS D;  3Q2A C;  1WX8 A;  1ZPS A;  3B08 A;  1STE A;  4IDI A;  2G45 B;  1FXI A;  3N1Z C;  4DQO C;  2K0P A;  1FNW A;  4NPN A;  2D2Q A;  3PHW B;  1V1P A;  4YTN B;  3ZDT A;  2QIE B;  2AX5 A;  1OEY J;  3LYY A;  3M62 B;  1RFA A;  2JU6 X;  2N9E B;  1Q5W B;  4OVU A;  2GBJ A;  2KYW A;  2VZK D;  1FM0 D;  4HRS A;  5FK9 C;  3DCG A;  3IT6 B;  2IO1 B;  3N20 C;  2M4N A;  2W9N A;  3DDC B;  4N59 A;  3QHT A;  1D5X C;  2LVP A;  1I4R A;  2DNF A;  4DXG A;  4GLS C;  2L0F A;  3L17 A;  5HG2 A;  1F9J A;  1Y56 A;  1SIJ A;  2V3P A;  4LCD E;  4KZC A;  3QAQ A;  3JW0 X;  2LXC A;  1I4X A;  4DWF A;  2KX3 A;  2D10 A;  2KVR A;  1M94 A;  4OVV A;  3W5V B;  4AP4 C;  3H7P B;  2MA9 B;  4J6I A;  2BPS A;  2MLB A;  3JVZ X;  3VH4 B;  2LGD A;  2KC1 A;  4W9K A;  3AXC A;  3P42 A;  3U2S C;  1FIQ A;  2M8S A;  2HJ8 A;  2WXM A;  3AEE B;  1WM2 A;  2I38 A;  1WE6 A;  4QAY A;  3RNA C;  2ZW1 A;  3V62 A;  2REX A;  2FCQ A;  4G0N B;  2LGS A;  3VR8 B;  2V4I B;  2G1E A;  4RNA A;  2MX2 A;  3KUC B;  2M17 A;  5D94 A;  2K39 A;  3ZYY X;  2WNM A;  3O65 B;  2BYV E;  4LK0 M;  4RMA A;  1WXA A;  2V9H A;  3MTN B;  1NBF C;  2CHX A;  1L0X B;  2LGY A;  5EE0 A;  2CU3 A;  4LNF A;  4ARC A;  1X1M A;  1FCC C;  2LMC A;  1C3T A;  1T3Q A;  1WMH B;  4US9 A;  2CHZ A;  4ACF A;  4XWW A; 
#chains in the Genus database with same CATH homology
 3QQ8 B;  4DDI D;  3V60 A;  2DYO A;  5DPT A;  4HVB A;  1WZ3 A;  3AUL A;  4LDT B;  2LRU A;  2DHZ A;  4KIK B;  1EF1 A;  4K7W A;  2ZVN A;  2OOB B;  3B0A A;  2NS5 A;  2DAF A;  4GSW A;  1VCB A;  4ANX A;  2MCN B;  3AI5 A;  5AZG A;  2LVO A;  2FAZ A;  4LJP B;  3U30 A;  4ANV A;  2YLM A;  1GJZ A;  1D3Z A;  1V9J A;  4MSM B;  1WH3 A;  4DHZ B;  1WYW B;  3ONS A;  4URK A;  5G55 A;  4HK2 A;  2I1J A;  1R4N I;  2AL3 A;  1E8W A;  3D32 A;  3ALB A;  5IA7 A;  5DPR A;  2WX0 A;  4FN2 A;  3DVG Y;  1Z5S B;  2RR9 A;  1WY8 A;  1P98 A;  2BKF A;  2KFK B;  3KUD B;  4WWN A;  2GOW A;  5IAA C;  3S2A A;  4FJV B;  3VFK A;  3VH3 B;  4DHJ B;  2FCN A;  2ZJD A;  4PYZ A;  1V80 A;  3ZLZ A;  4MGY E;  2MBH A;  2KDB A;  1WJ6 A;  4DHZ E;  3A4S C;  4TKN A;  1OQY A;  3PPA A;  1K8R B;  4RM9 A;  2IO2 B;  1V49 A;  2N7E A;  2Z0E B;  3IG3 A;  3PLU A;  2O6V B;  4LJO B;  3ZNZ B;  1KJT A;  2G4D B;  3A9J B;  3V61 A;  5BO4 B;  2DEN B;  5GMV A;  2JZZ A;  2FNJ B;  2WYQ A;  1P0R A;  4KSK C;  1UD7 A;  2IBI B;  4BBN F;  2XK5 A;  4PS3 A;  5CHF A;  4RM8 A;  4GB9 A;  2R2O A;  2I1K A;  1YJ1 A;  1R4M I;  2KLC A;  2WWZ A;  4MDK E;  4N9F 4;  3RUI B;  1Q1O A;  3PHX B;  5JHA A;  3ZO5 B;  3CST A;  5KHQ A;  1ISN A;  4BFR A;  3HK0 A;  4W9H A;  1WGG A;  1WJ4 A;  2FCS A;  2KWU B;  3VTW A;  2ZCB A;  2RGF A;  4BKT A;  4HCP B;  3IBE A;  3L54 A;  1WF9 A;  3DBR I;  3ML9 A;  4NJ7 A;  2RPQ A;  1YX6 B;  2LXA A;  3TL5 A;  2C7M B;  3IHP C;  3RZF A;  4EZK A;  2HE7 A;  1OEY A;  2KKC A;  4AJW A;  3VHT C;  5L83 A;  1YX5 B;  4HDO A;  3PLV A;  4W9L A;  2DYB A;  3PV1 A;  2JY6 A;  3L16 A;  3ZNG C;  4EZJ A;  2KO3 A;  1YQB A;  1KOT A;  2MSE D;  4W9G A;  3JYU A;  2EMT A;  4KVG B;  1WM3 A;  3R7Q A;  2JF5 A;  1I42 A;  2HTH A;  2BF8 B;  4HPL B;  4EUT A;  4AWJ A;  2MBB B;  3ECI A;  1V5O A;  3IVF A;  4FAD A;  4JIO U;  5D7G A;  3KUZ A;  3DBL I;  3VUX A;  1UBI A;  3PZD A;  2KJR A;  1WGY A;  2OJR A;  3IFW B;  4II2 B;  4WJN A;  2ZZP B;  4PS8 A;  2KMC A;  4NAW A;  3RT3 B;  4W9I A;  1L7Y A;  2KAN A;  4WJO A;  2MBQ A;  5DPS A;  3R7R A;  1I35 A;  4A3O A;  5CTR C;  2IY1 B;  4BOZ B;  2FIF A;  1JRU A;  4AJY B;  4FHJ A;  5J2R A;  1WGH A;  1WXM A;  4ICU A;  1WR1 A;  3K9O B;  3WAO A;  1EO6 A;  2Z0D B;  1E8X A;  5CX3 A;  2IO3 B;  4E71 A;  4PS7 A;  3VDZ A;  1E5W A;  3APC A;  3ZNH B;  3DVN U;  2XBB C;  3ML8 A;  2AL6 A;  2AWT A;  2KDE B;  2WDT B;  1E8Z A;  2LGX A;  4XC2 A;  2NBV B;  5CHW A;  4KZ0 A;  3Q3F A;  4DDG D;  3R3M A;  3QAR A;  2LZ6 A;  4KDI C;  2KJ6 A;  5G2N A;  4ZDV A;  1C1Y B;  4EOY A;  3DVG X;  2XK5 B;  3A1Q B;  2D07 B;  3H9D A;  1WXS A;  1Y8R C;  2LUE A;  3T8M A;  2LRW A;  1H4R A;  4ANU A;  1NI2 A;  4HDQ A;  2KFJ A;  2FUH B;  2KN5 A;  2J0M A;  4MM3 A;  2MBE A;  1UH6 A;  2D3G A;  3QX1 A;  4G3X B;  4MEM A;  4B9K A;  2KDF B;  3NY5 A;  2BKR B;  1VD2 A;  4GXB A;  2CU1 A;  3UQA A;  4TQ1 A;  3NZS A;  3PVL A;  2JZ3 B;  3OLM D;  4TV3 A;  4WWO A;  2EMS A;  4DBG A;  1V5T A;  2N1V A;  4I6L B;  2NPT A;  2HD5 B;  3QJZ A;  1WGD A;  2ZCC A;  1SIF A;  1LFD A;  4W9C A;  1XD3 B;  1GG3 A;  1J0G A;  4ZYN A;  2JT4 B;  4I6P A;  4BKS D;  1NDD A;  3PRE A;  2L76 A;  3Q3J A;  1OGW A;  4F7Z A;  1U4A A;  1UBQ A;  3JSV A;  4M8N A;  4ANW A;  2WX1 A;  4HPM B;  1J8C A;  2JXX A;  5FR6 A;  2K8B A;  3TJP A;  4KDL B;  3KYD D;  4BVU C;  4EZL A;  5AZF A;  3H6N A;  4AOF A;  1V6E A;  2IZV B;  3PGE A;  4FUL A;  2DZK A;  3RD2 A;  1SGH A;  2CR5 A;  4K7S A;  4MJS A;  2A4Z A;  2BYE A;  5LXI B;  4NQL B;  4IG7 B;  2L05 A;  3M95 A;  2KLG A;  4NAW B;  3H1U A;  3ZTD A;  4MH0 E;  3NHE B;  3VTV A;  5L95 C;  1P1A A;  2MRP A;  2FCM A;  2JWZ A;  4WWP A;  2GBN A;  1YIW A;  3KH0 A;  4IM2 A;  1E7V A;  1Z2M A;  3P2B A;  5D2M B;  3SU8 X;  4KSL C;  4GDK A;  4EEW A;  5JH5 C;  1S1Q B;  1WJU A;  3A1Q A;  3RUL A;  3WAP A;  4FHK A;  3PRP B;  2LI5 A;  4LDT D;  4M0W B;  2MW5 A;  3QIJ A;  1WZ0 A;  3L13 A;  2K25 A;  2MP2 A;  2EKE C;  4K7U A;  2ZEQ A;  3TIX A;  3UGB B;  3VXW A;  1XQQ A;  2C5L C;  2C9W B;  2DX5 B;  4TUU A;  1WX7 A;  3KYC D;  1TBE A;  3M3J A;  3QC8 B;  4XX5 A;  3HM6 X;  4A20 A;  2D11 A;  5LXH A;  2Z59 B;  3DOW A;  4JQW C;  4NJ6 A;  1IYF A;  2ASQ A;  2J0J A;  2NVU I;  3W1S C;  3ZIM A;  1QZE A;  4MSQ B;  3W1S A;  1V2Y A;  1FXT B;  5HKH A;  4IW0 A;  2R2Q A;  1IP9 A;  4ZRI A;  2LAS A;  2KC2 A;  2PE6 B;  4A3P A;  3N32 A;  3QWZ B;  4NQK E;  2L0T A;  1WIA A;  5J17 A;  2AEH A;  4IC7 B;  4DHJ D;  1WJN A;  3DQV A;  4ZRK A;  1WX9 A;  3V6E B;  3GOE A;  4HXD A;  3KW5 B;  2NPT B;  1LXD A;  2CKH B;  4MGK E;  2DZI A;  5AEK B;  4GIV A;  2KZR A;  2ZNV C;  3PRZ A;  4GN1 A;  2YVC A;  4K1R B;  4HJK A;  3DPD A;  5LLI A;  1KLV A;  2KWV B;  4PYU A;  2K6Q A;  2KXJ A;  1V81 A;  2VRR B;  2O6V D;  3ZRF A;  1HE8 A;  2BWF A;  5C1Z A;  3X23 A;  3JSV B;  5DPW A;  2UYZ B;  2RD0 A;  3BIN A;  3CF6 E;  3LDZ E;  3UIO B;  2L3Z A;  3ZRC A;  4NY0 A;  1T0Y A;  2PEA A;  4W9E A;  3SDL C;  1RAX A;  1GNU A;  4IM0 A;  3L0W B;  3QCA A;  2V3S A;  4K81 A;  4MGI E;  1EUV B;  2DZJ A;  2N4F A;  3VUW A;  3DVN V;  4MJS B;  1ZKH A;  2NBW B;  2ZVO A;  4E74 A;  2V1Y A;  1UEL A;  2KQS A;  3EEC A;  4GDL B;  1BT0 A;  2KWC A;  3M63 B;  4IM3 A;  3NS8 A;  3ZVV A;  4DXA B;  4HWI B;  1WFY A;  5JHB A;  4TQ0 A;  3VQI A;  2KMA A;  5E6O A;  5J18 A;  3ZW3 A;  5EDS A;  3MJW A;  4ZRJ A;  4GDK B;  2C7N B;  2JRI B;  4XZ4 A;  4EKU A;  3WAN A;  4EFO A;  2DAJ A;  3L08 A;  2RSU A;  4B95 A;  1IPG A;  2BYF A;  2Y5B B;  3OAW A;  1WE7 A;  2J0K A;  2K8C A;  3H7S A;  4WJP A;  4ICV A;  1S3S G;  2K6D B;  2MWS B;  2PJH A;  5E6N A;  1V86 A;  4CO7 A;  4HLE A;  2MBO A;  3PSE B;  2MP2 B;  1GUA B;  4WJQ A;  3R66 C;  3EFU A;  2KTR A;  4I6N B;  3ZKJ C;  2FID A;  3PT2 B;  3RCZ A;  3DBS A;  1TZ1 A;  3A33 B;  2AYO B;  3AU5 A;  2KTF A;  4G50 A;  4IWQ A;  2KQ7 A;  2CHW A;  3H7P A;  1UZX B;  2J7Q B;  4II3 B;  1E90 A;  4IWO A;  2UWQ A;  3TMP B;  2C60 A;  2KK8 A;  3U8Z A;  4HCN B;  2BGF A;  2V4L A;  1LM8 B;  4BOS C;  3QK0 A;  3TCA A;  1WXV A;  3ZDM C;  1GC6 A;  2GBM A;  2G3Q B;  4BKG A;  3PTF C;  3ZUN A;  3WAL A;  1OTR B;  3A4R A;  2ZNV B;  4ASW C;  5D6J B;  2KX0 A;  2K1F A;  2QHO A;  3MHS D;  1WX8 A;  3NOB A;  3B08 A;  4WQO B;  2LJ5 A;  2O2V A;  2KDI A;  2G45 B;  4FBJ B;  1XT9 B;  3ENE A;  3EHV A;  4E3C A;  4CHK A;  3U7D A;  3A9K A;  3UIN B;  1TTN A;  1RLF A;  4NPN A;  1KM7 A;  5AZH A;  2N7D A;  3HM3 A;  2D2Q A;  1E7U A;  3RZW C;  1EF5 A;  4BKS A;  1ZGU B;  3PHW B;  4GGQ A;  5C23 A;  1WGR A;  4B6W A;  3ZNI D;  4CYE A;  3N3K B;  4JL9 A;  3ZDT A;  2XEW A;  2LWP A;  3CSF A;  1OEY J;  3M62 B;  1RFA A;  2N9E B;  4WAA A;  2L8J A;  1L2N A;  1Q5W B;  4OVU A;  3X0W A;  2PE9 A;  2GBJ A;  3UQB A;  2JPH A;  3DCG A;  2KNB A;  3APD A;  3CMM B;  2NCN A;  2IO1 B;  3VUY A;  3BY4 B;  2JUO A;  2M4N A;  2W9N A;  2KJH B;  3DDC B;  4YL8 A;  3TBL D;  3KVF B;  3PRM B;  2IYD B;  2M1M A;  3QHT A;  4W9F A;  2LVP A;  1UGM A;  1WRD B;  4FJY A;  2PPH A;  4G11 A;  1Q0W B;  1P3Q U;  4W9J A;  1WMH A;  2L0F A;  4P7I A;  3L17 A;  2ZPY A;  3V6C B;  1F9J A;  4LCD E;  2KTR B;  4KZC A;  3QAQ A;  3JW0 X;  2LXC A;  4GU2 A;  4GDL A;  4DWF A;  3RYT A;  4MEL A;  2K8H A;  2KX3 A;  5KHO A;  4DK5 A;  2D10 A;  5E6P A;  2KVR A;  1M94 A;  4OVV A;  4BBN C;  4F1S A;  3HHM A;  3N30 A;  4KIK A;  4AP4 C;  1RRB A;  3H7P B;  3ZTC A;  1WI0 A;  2MA9 B;  3WIM A;  4J6I A;  3WA0 A;  2N1W A;  2BPS A;  2MLB A;  2KHW B;  3JVZ X;  3VH4 B;  2LGD A;  1A5R A;  1WR6 E;  3AU4 A;  2L00 B;  4IUM B;  2DYM A;  2CS4 A;  4NNJ B;  1GC7 A;  2KC1 A;  4W9K A;  3AXC A;  4F8C B;  2N9P C;  2GBK A;  4FA6 A;  2M8S A;  4M8M A;  4MGZ E;  2HJ8 A;  3WAM A;  3VVW B;  1WM2 A;  2JRH A;  3EC8 A;  3PS6 A;  1WE6 A;  2O2V B;  2KFK A;  3OJ4 B;  2NBU A;  2BWE S;  3HIZ A;  4IWP A;  4JGH B;  2REX A;  3V62 A;  2C7H A;  3VTU A;  3A9K B;  2FCQ A;  2N9X A;  4G0N B;  1MG8 A;  3T9L A;  2IO0 B;  2IY0 B;  2ZPN A;  3UIP B;  4AUQ C;  2NR2 A;  2GBR A;  3SD5 A;  3L10 B;  5CHV C;  2KOX A;  1SE9 A;  2L7R A;  2MX2 A;  3KUC B;  2O6V A;  4FLH A;  2M0X A;  3GZN I;  3NZU A;  2M17 A;  1LQB A;  3A9J A;  5D94 A;  2DZM A;  2K39 A;  1TGZ B;  5JZE B;  3O65 B;  2BYV E;  2LD9 A;  4FJZ A;  1G6J A;  1YD8 U;  4RMA A;  2KD0 A;  2JVC A;  1WXA A;  3SHQ A;  3DBH I;  2MQJ A;  1H8C A;  2A5U A;  1CMX B;  3MTN B;  1NBF C;  3C0R B;  2CHX A;  1P9D U;  5TR5 A;  2LGY A;  2G4S A;  1J19 A;  1E8Y A;  1AAR A;  3W1Y A;  1ZW7 A;  3LJ3 A;  4GOC A;  3K9P B;  1X1M A;  2GMI C;  4GMV A;  1C3T A;  2LVQ A;  3QA8 A;  4JLC A;  5DCN A;  4W9D A;  4KV2 A;  1WMH B;  3VAW A;  2CHZ A;  3APF A;  3I3T B;  3UF8 A;  3OJ3 A;  1PQS A;  4X57 B;  3B1L X;  2B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...