3MTNB

Usp21 in complex with a ubiquitin-based, usp21-specific inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
HMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKWSTLFLLLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 21
total genus 21
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3mtnB00
2FCMA 3VH3B 2L7RA 3GZNI 1V80A 2LD9A 3PREA 3APFA 5BO4B 4GDKB 2V4LA 2DZKA 3K9OB 4ZRJA 1PQSA 3KH0A 2ZCBA 3VDZA 1H4RA 1WE6A 2NBWB 3QX1A 2ZNVB 1P1AA 1V9JA 1HE8A 4G0NB 3ZIMA 2JF5A 5EDSA 2GBRA 4W9LA 2CR5A 2G3QB 4FA6A 2J0JA 1E8ZA 1KM7A 2D10A 2NPTA 5IA7A 3A4SC 5DPWA 3CSTA 4GN1A 2MQJA 2O2VA 3DOWA 2KXJA 1OQYA 1R4MI 2HD5B 4EZLA 1TZ1A 1NI2A 3M3JA 4BKGA 2ZVNA 4I6PA 2KTRA 4MSMB 1RRBA 1GG3A 1WXAA 3ML9A 3RUIB 1WRDB 4NJ6A 5CTRC 2Z0EB 3A1QB 3KYCD 3DVGY 3W1SA 2N9EB 2GMIC 3L54A 3N30A 1T0YA 2KDIA 2BGFA 3ENEA 2UWQA 1XD3B 1YIWA 1SE9A 4JLCA 3U30A 2KWUB 1WX8A 3H1UA 3X23A 4WQOB 4AP4C 4K7SA 1V5OA 3JSVA 1WXSA 4IW0A 4IG7B 1WR1A 4WJOA 3TIXA 5LXHA 1RFAA 3QWZB 2FIFA 4FBJB 1IYFA 2ZPNA 1LXDA 4EZKA 4FLHA 1U4AA 3PHWB 4BOZB 4GSWA 3L0WB 2LXAA 1WE7A 2JRIB 4HDQA 1JRUA 2KK8A 5GMVA 4HCNB 3VTWA 2KWVB 1E7UA 4BKTA 2KTRB 2DAFA 3AU4A 2G4DB 3IBEA 2DZIA 4TV3A 3UIPB 1WX9A 3UINB 4AJWA 2KJRA 2JPHA 2LXCA 3QQ8B 2KFKB 5DPRA 3TBLD 4W9CA 2BPSA 2K8BA 3B1LX 3RCZA 1WJNA 3JYUA 2EMSA 3DBSA 3APDA 5DPTA 3SD5A 2C5LC 2LRWA 1RLFA 2OOBB 4BBNF 2PE6B 2L8JA 4NPNA 4HWIB 3R66C 3ML8A 3QK0A 5IAAC 3DBHI 3NY5A 1F9JA 1J19A 3NOBA 4MELA 2IO3B 3A4RA 4BBNC 2JZ3B 1YX5B 2Y5BB 4MGZE 1SGHA 1UH6A 1WXVA 4XZ4A 2KFKA 3PS6A 4MDKE 1ZGUB 2ZPYA 3PVLA 1UBQA 2NBVB 4WWNA 3ZNHB 3WAMA 2GBNA 4WJQA 2LGYA 1UGMA 3PRMB 2KN5A 4G50A 1ZKHA 1NBFC 2I1KA 2ZCCA 5J2RA 3U7DA 4FJZA 4NAWB 4NQLB 3R3MA 1LM8B 3L10B 4DWFA 4A3PA 2HE7A 1Z5SB 4JGHB 1UBIA 1WJUA 1WM2A 2BYFA 3W1YA 1WJ4A 3HHMA 4MSQB 2V1YA 3RZWC 4X57B 3ZW3A 2NPTB 3WALA 3K9PB 3HIZA 4W9HA 3QCAA 1TTNA 4LJPB 4HPLB 5CHVC 3ZVVA 2CU1A 3DBRI 3A9KB 1OGWA 2LVQA 2RSUA 1I42A 3D32A 1UZXB 1E7VA 3NS8A 2DHZA 2JWZA 3EC8A 2KVRA 5AEKB 4W9FA 4N9F4 4KDLB 1WGYA 2KANA 5D94A 3H7SA 3WANA 1WIAA 1Q1OA 5C23A 2NVUI 3DVNU 2FCQA 1E8WA 1P9DU 3OJ4B 2JT4B 4MH0E 3MTNB 3NZSA 5G2NA 5E6NA 3A33B 2MBEA 2WX1A 1S3SG 2LUEA 4FHJA 4GDKA 4HPMB 4KSKC 4F8CB 5JZEB 1WGDA 2O6VD 2YVCA 3ALBA 3KUZA 4NAWA 2CHWA 3I3TB 4FADA 4LDTD 1VCBA 2KD0A 2LI5A 2L76A 4GIVA 5AZFA 1Q0WB 5C1ZA 4DK5A 4EFOA 2NCNA 2Z59B 5KHQA 2RPQA 1K8RB 2NS5A 4GGQA 5DCNA 1I35A 4AWJA 2GBKA 1EO6A 2IO0B 5AZHA 3MHSD 2V3SA 3QA8A 2KJ6A 4IWQA 4HJKA 3R7RA 4DDGD 4HXDA 1P98A 2IY1B 4WWPA 4F1SA 4BVUC 3PZDA 2I1JA 3A1QA 2DZMA 2M1MA 2KX3A 3N3KB 3A9JB 4WWOA 4I6NB 3ZLZA 1LQBA 2C9WB 5CHFA 3WAOA 2BYVE 4DHZE 1WMHA 3ONSA 3X0WA 2DAJA 2AL6A 1Y8RC 2LASA 2PPHA 2K6QA 4K7UA 4B9KA 2C7NB 4KSLC 2YLMA 3DBLI 1E5WA 1P0RA 2RGFA 3KYDD 4DXAB 2JRHA 1WYWB 5CHWA 4EKUA 2REXA 1D3ZA 2K6DB 3ZTDA 4DBGA 2D11A 2D2QA 2DYOA 3VUWA 1G6JA 2LGDA 2MX2A 3A9KA 2Z0DB 3H6NA 1OTRB 2M4NA 1WGHA 2IYDB 2FIDA 3L17A 3WA0A 4W9IA 2AYOB 3DQVA 3VUYA 2GBJA 1IP9A 4G3XB 4MM3A 4MJSB 4XC2A 2IZVB 3W1SC 3A9JA 4BOSC 1YX6B 4KIKA 2G4SA 2KO3A 4MGIE 1TGZB 3DVNV 5E6PA 2MBHA 2K8CA 3V62A 2GBMA 4ANUA 3VTUA 4BFRA 4F7ZA 2KJHB 4K7WA 1VD2A 3B08A 3PHXB 5JH5C 2N9PC 3T8MA 3H7PA 4B6WA 3PLVA 4FJYA 1M94A 2J7QB 4M8MA 2MBOA 3NHEB 1WGGA 5TR5A 4ASWC 2MBQA 2C7HA 3TL5A 2BWES 2CS4A 2FUHB 2AL3A 3WAPA 2BF8B 1KOTA 1V6EA 3WIMA 3QC8B 4TKNA 3PRPB 2BWFA 3H9DA 3UGBB 3ZNGC 4II2B 1AARA 3IG3A 2AWTA 4AOFA 1YD8U 1YQBA 3L16A 2N9XA 2ZZPB 2NBUA 4MEMA 2JXXA 2A5UA 2DYBA 2K1FA 4KV2A 3ZTCA 3UF8A 3S2AA 3AULA 3M62B 4IUMB 2N1WA 2D3GA 2MWSB 4G11A 2KX0A 2W9NA 1LFDA 4RM8A 5FR6A 4ICVA 3SHQA 3LDZE 4BKSD 2OJRA 1BT0A 2BKFA 3RT3B 4ANVA 3UQBA 3CF6E 3BY4B 4TQ1A 2C7MB 4P7IA 2J0KA 1RAXA 5E6OA 4IM2A 4MGYE 3GOEA 4HVBA 3B0AA 2KWCA 4OVUA 5CX3A 3PT2B 2R2QA 1NDDA 1WY8A 4IM0A 5D2MB 2L0FA 3UQAA 4CO7A 3QHTA 3VQIA 3CSFA 2D07B 3V6CB 3QAQA 4E71A 4IC7B 1V81A 1R4NI 1GUAB 2BKRB 4YL8A 5JHAA 3NZUA 3SDLC 2FCSA 3PTFC 4MJSA 1FXTB 4NQKE 2N7EA 4K81A 3VUXA 1V2YA 1WZ0A 2CHZA 2L0TA 2MCNB 2GOWA 3O65B 1GJZA 1A5RA 4WJPA 1UD7A 2LVPA 1KJTA 4KVGB 4A3OA 1Q5WB 3H7PB 2IY0B 4OVVA 3DVGX 4DHZB 4M8NA 3HM3A 5AZGA 1TBEA 2DYMA 1WGRA 3IHPC 4LCDE 2J0MA 3ZNZB 2CKHB 4E3CA 2K8HA 1QZEA 3ECIA 3ZDMC 4JL9A 2N7DA 2WX0A 2JUOA 2MLBA 3C0RB 1WMHB 4KZ0A 3TCAA 4DHJD 2N4FA 2MP2A 4K1RB 4NY0A 2WYQA 4WJNA 3T9LA 3ZO5B 1Z2MA 3OLMD 2VRRB 3ZUNA 3ZNID 3VFKA 4ANXA 3KUDB 1WR6E 4KIKB 4DHJB 3BINA 2N1VA 2EMTA 2M8SA 2XEWA 3QJZA 4GMVA 4B95A 1J8CA 2HJ8A 3ZRCA 2KMAA 2KLCA 4EEWA 4I6LB 3N32A 2WDTB 5DPSA 1WF9A 4LDTB 4EOYA 2K39A 4A20A 1J0GA 3L08A 4ANWA 4RMAA 2KDFB 1WM3A 2MW5A 2BYEA 3DCGA 5D7GA 1OEYJ 1YJ1A 3UIOB 1IPGA 4IWPA 2JZZA 2PE9A 4GDLB 3VAWA 4TQ0A 3PSEB 1V5TA 3SU8X 2LWPA 3MJWA 3AXCA 4EZJA 5L83A 2ZVOA 4NJ7A 2LVOA 4PS8A 5HKHA 3VVWB 4ZRKA 2RD0A 4EUTA 2M17A 2CHXA 1EUVB 5L95C 1P3QU 2KMCA 3M95A 3KVFB 3CMMB 3V6EB 3ZDTA 2ZNVC 4HCPB 4AJYB 3DPDA 2KDEB 3EHVA 4II3B 4BKSA 4W9EA 2ZEQA 4W9GA 1WXMA 4URKA 2IO2B 3R7QA 1CMXB 3PPAA 1GC7A 3PLUA 4IWOA 4FULA 4KDIC 1WX7A 1H8CA 4PYZA 2UYZB 3JVZX 3JW0X 4PYUA 2IO1B 3ZRFA 2XK5A 1MG8A 4W9KA 3TMPB 1WZ3A 2L00B 3Q3FA 2MA9B 3DDCB 4LJOB 4JQWC 4W9DA 3AU5A 1X1MA 1E8YA 2C60A 2KC2A 4PS3A 2KKCA 4HK2A 2KNBA 3V61A 1L2NA 3PRZA 2JY6A 3JSVB 2HTHA 2XBBC 2MP2B 1WJ6A 2O6VA 5G55A 1ISNA 2LZ6A 2LGXA 2FCNA 3EECA 5J17A 5LXIB 1ZW7A 3ZKJC 4FN2A 4CHKA 2MRPA 3VXWA 2DX5B 2R2OA 1KLVA 2KFJA 2DENB 2L3ZA 2KTFA 2LJ5A 1OEYA 2PEAA 3VTVA 3QARA 3TJPA 3V60A 3Q3JA 2KQSA 2QHOA 5D6JB 2XK5B 1UELA 2EKEC 4MGKE 3VHTC 2KHWB 2DZJA 4NNJB 3RYTA 3LJ3A 1V49A 2O2VB 2IBIB 4JIOU 3EFUA 3IVFA 4ICUA 2G45B 2M0XA 3VH4B 4CYEA 5J18A 2RR9A 2B3AA 3OJ3A 2L05A 1GNUA 2AEHA 3APCA 2K25A 4WAAA 2ZJDA 4TUUA 4GDLA 1XT9B 3RULA 2O6VB 4RM9A 2ASQA 1WH3A 5LLIA 3KUCB 2FAZA 4AUQC 1E8XA 2MSED 3HK0A 1EF5A 4FHKA 3AI5A 2KDBA 2WWZA 3L13A 4GB9A 1C3TA 3PGEA 1E90A 2A4ZA 2NR2A 1S1QB 3OAWA 3RD2A 4IM3A 3U8ZA 4M0WB 4GXBA 2FNJB 5JHBA 2LRUA 5KHOA 2KQ7A 4XX5A 2KLGA 1GC6A 1SIFA 3RZFA 4KZCA 1V86A 2PJHA 1C1YB 4GU2A 4HDOA 4J6IA 3IFWB 4HLEA 4ZYNA 1WI0A 3QIJA 1WFYA 2KZRA 4FJVB 4E74A 4ZDVA 2JVCA 3KW5B 4GOCA 2MBBB 1L7YA 2KOXA 4DDID 3M63B 3P2BA 1EF1A 3HM6X 3PV1A 4W9JA 4ZRIA 2KC1A 1XQQA 4PS7A
chains in the Genus database with same CATH superfamily
2FCMA 4KKIA 2BS3B 3GZNI 1V80A 1B9RA 3K9OB 2D3CA 1PQSA 4ZRJA 4RNAA 3VDZA 1XF5L 4G0NB 5EDSA 2G3QB 2K22A 3C19A 1C4CA 3A4SC 5DPWA 3E9SA 4GN1A 3DOWA 1SSNA 1IGCA 1NI2A 3M3JA 4L1BA 2ZVNA 2BW2A 1GG3A 1FFVA 3ML9A 1VJKA 2Z0EB 3A1QB 3N30A 5IKCM 2BGFA 3U30A 4D2KA 2KWUB 1D5XC 1WX8A 3TEYA 4WQOB 4AP4C 5JXVA 2CJNA 4IG7B 4WJOA 5LXHA 1RFAA 4FBJB 1IYFA 1QOGA 2Q5WD 5IP4D 2ZPNA 1SE3A 2UU7A 4HDQA 5GMVA 1WXQA 2KTRB 3IBEA 4TV3A 3U4EG 1WX9A 1K53A 2KJRA 2JPHA 3QQ8B 2DNFA 1V1PA 2AQ3B 3APDA 2LRWA 1RLFA 1K51A 2OOBB 3QK0A 5IAAC 2ZW1A 3NY5A 1AWDA 2NTTA 3VR8B 2L83A 1RYJA 3NOBA 4BBNC 1TS5A 4MGZE 1SGHA 1UH6A 5HG2A 3RMKC 1PYWD 2LGIA 1UBQA 2NBVB 4WWNA 3WAMA 2GBNA 4WJQA 1UGMA 2G1EA 3AE2B 1T0RC 2ZCCA 3BWUD 5J2RA 1AYFA 5BYSA 4ITKA 2V0GA 2HE7A 1Z5SB 4M00A 3HHMA 1I7HA 5C2TB 4C56C 3ZW3A 2NPTB 3TUOA 2KN4A 3K9PB 3DHHC 3TSSA 3QCAA 1TTNA 1TY2A 4ZOHC 1GPXA 3N1XC 2LVQA 4IDIA 4KDLB 2KANA 3H7SA 3WANA 1WIAA 2K5PA 4OZBA 2RPVA 3AEEB 4MH0E 3OJ4B 4JPSA 4F8CB 3HUIA 1WGDA 2YVCA 3ALBA 2CHWA 4LDTD 2WS3B 3MC0B 2L76A 1JROA 4WIPA 4ZHOA 2Z59B 1AN8A 5DCNA 1I35A 2X8XX 1FXIA 2IO0B 4XDDA 1TKEA 4HJKA 4DDGD 2WGSA 2XN9C 1P98A 3N1YC 3A1QA 3ZLZA 1LQBA 2C9WB 2BYVE 2PPHA 4B9KA 2YLMA 3DBLI 3U2SC 1E5WA 2WNMA 3BVMA 4O1NA 1JRPA 2K6DB 1VDVA 3BYYB 2BT6A 2MX2A 1VLBA 2BB6A 1VZ7A 3FILA 1GAQB 2M4NA 1I4HA 3EA6A 1SE2A 3DQVA 1SE4A 4XC2A 2IZVB 3W1SC 4DXFA 1YX6B 3H8HA 5E6PA 3ZJTA 4BFRA 3VTUA 4F7ZA 2KJHB 2LHDA 3NZ3A 4K7WA 1VD2A 3B08A 2N9PC 2Y5PA 4RGOS 3T8MA 5BYRA 1F0ZA 3H7PA 1M94A 2RDGA 4ZRPA 1WGGA 2JXTA 2C7HA 1JWAD 3Q8AA 2WXMA 1V6EA 1V1OA 3WIMA 2QSDA 4OZCA 1KFYB 2BWFA 4QAYA 1YMHE 3H9DA 1AARA 3IG3A 4XGAB 2RDBC 3L16A 2HJ1A 1L0YB 4MEMA 2DYBA 4KV2A 3UF8A 1FPYA 1LO5D 2JYTA 3AEFB 1QILA 2WXHA 2OJRA 3UQBA 3CF6E 4TQ1A 3SEBA 2W55A 2J0KA 1RAXA 5E6OA 4IM2A 3GOEA 4HVBA 1VR9A 2GB1A 3PT2B 1JCKB 1F2RC 1PGBA 4IM0A 1CZPA 3AE1B 4CO7A 3QAQA 1GUAB 2BKRB 4MJSA 3ZXRA 2J4XA 1FXTB 4NQKE 1WZ0A 2MCNB 2LUMA 2GOWA 3FKYA 1GJZA 4S0RA 4WJPA 1C78A 3H7PB 4DHZB 2XNAC 4P16A 3UI3A 2D5GA 1WGRA 3ZNZB 2CKHB 1TIFA 2N9KA 2JUOA 4DHJD 2MP2A 1Z2MA 4WWMA 2PLPA 3KUDB 4KIKB 4DHJB 4GMVA 3QJZA 3Q14C 3EGRA 4EEWA 4I6LB 1STEA 4LDTB 2K39A 3P4QB 4ANWA 3R2IA 2JSVX 1R4MB 3I57A 5D7GA 1YJ1A 4IWPA 2ONQA 3VAWA 4TQ0A 2GRIA 3PSEB 2LWPA 3BYTB 4JWSC 1TS3A 4NZLB 5L83A 3AN1A 2PMVA 4RGMA 2NTSA 4PS8A 2BYTA 2CHXA 1YNTE 1EUVB 4A9AA 2KMCA 3KVFB 3V6EB 2ZNVC 4XWTA 3P1MA 2KDEB 4W9EA 2LJIA 1WXMA 3T3NA 2E3TA 1CMXB 3PPAA 1SJHD 3AE4B 4KDIC 3JW0X 2G9HD 2IO1B 1MG8A 1TS4A 3TMPB 4LTUA 4PK1A 4PS3A 2WXPA 2V9HA 4HK2A 2KNBA 3ZQ4A 1N5WA 3PRZA 2YEPF 3JSVB 2XBBC 3GP7A 3ZYYX 1WJ6A 1BMLC 3RI7C 1L5PA 1TYGB 1HTQA 4CHKA 2MRPA 2LJ5A 1D4BA 2PEAA 3TJPA 2QHOA 5HFYA 1UELA 2EKEC 4ZYSA 1FEHA 2IBIB 4ICUA 3TEXA 4RCOA 1EU3A 1GNUA 2K25A 4WAAA 4GDLA 1XT9B 3AMZA 2ASQA 4C7ZA 4FHKA 1EF5A 2KDBA 1E90A 3W5UB 3U8ZA 4US8A 4XX5A 1QOFA 2KLGA 3RZFA 2QJLA 3L4PA 1WI0A 4FJVB 2JVCA 2MBBB 4DDID 2VH1A 4MH8A 2WU5B 1EF1A 3NUHB 3PV1A 4ZRIA 4PS7A 3R2TA 2L7RA 2LD9A 3APFA 5BO4B 4RGNA 3KH0A 2CJOA 3QX1A 4C00A 3NRZA 2JF5A 2GBRA 2CR5A 4FA6A 4YTNB 1E8ZA 1KM7A 2MQJA 1A70A 3NG0A 2W54A 1QOBA 1TZ1A 3FAHA 2BS2B 1UWXA 4I6PA 2KTRA 2WDQB 4MSMB 1RRBA 4M02A 3GZNB 4NJ6A 2WHIA 5CTRC 3DVGY 2GMIC 2KDIA 3ENEA 4JLCA 3X23A 1V5OA 4YTMB 3JSVA 1MJDA 1WR1A 3TIXA 2ACZB 2L32A 4BOZB 4P1BC 3R8BA 3CWIA 4HCNB 3VTWA 1E7UA 1WSPA 4BKTA 2DAFA 3FILB 1NVID 4AJWA 4OZAA 4W9CA 1WJNA 3JYUA 4YSYB 5D3IB 1V97A 4BBNF 2L8JA 4NPNA 4HKZE 3GB1A 1F9JA 4A55A 1J19A 1NYQA 3A4RA 1E9MA 1YX5B 1WXVA 4XZ4A 1YJIA 2LGYA 3PRMB 3GE3C 3AECB 4M01A 5H92C 4FJZA 1LM8B 1UBIA 1WJUA 4MSQB 2V1YA 1DGJA 4MM3B 2VH2A 1HQRD 4LJPB 5CHVC 3ZVVA 3LXFA 3A9KB 1OGWA 1JW9D 1I42A 3D32A 3NVVA 1CQVA 5AEKB 4W9FA 4N9F4 5D94A 2PVOD 5C23A 2NVUI 2WXRA 2FCQA 3DVNU 1P9DU 4HKQA 1S3SG 2LUEA 4FHJA 5MPOA 5AUKA 3I3TB 2K0PA 2LI5A 4GIVA 1Q0WB 5C1ZA 4DK5A 4EFOA 5KHQA 4AWJA 3AE9B 1EO6A 5AZHA 1F52A 4RF0A 3P4RB 2IY1B 4F1SA 1KLGD 3PZDA 2LMCA 2I1JA 2DZMA 2M1MA 3N3KB 3A9JB 4GLSC 5CHFA 2VZKB 3ZJUA 1HTOA 1WMHA 5T8IA 2ON8A 2AQ1B 3ONSA 2DAJA 3OG5A 2N9LA 2INPE 4K7UA 4KSLC 1FNUA 1P0RA 3Q8BA 4DXAB 2JRHA 4EKUA 2D11A 3VUWA 1FMAD 4WAFA 3A9KA 1KF6B 2LHEA 2V3NA 3NVZA 3L17A 3WA0A 1L6VA 4HPPA 1JQ4A 1P7FA 1N60A 3N9YC 1KLUD 4MM3A 4MJSB 1HZ5A 4M0WA 1E7PB 2IGDA 1BXTA 4ANUA 3ZGZA 5C3JB 3AV8A 1D5ZC 4B6WA 4FJYA 2J7QB 2MBOA 4ASWC 5TR5A 5IOIA 3MC8A 3NJTA 1B1ZA 1ZXHA 4TKNA 1TY0A 5IN7A 1FRDA 4KGRA 3ZNGC 2QILA 5G5HA 1YD8U 1YQBA 1FCCC 2NBUA 3ZTCA 1JWBD 1TKYA 3PO0A 2N1WA 1PGXA 4ICVA 4BKSD 1BT0A 1ET6A 1TJEA 2BKFA 3RT3B 2H88B 2LEKA 3HVDA 4MGYE 1QLBB 3IXSA 5CX3A 2R2QA 3NS1A 4H2AA 2L0FA 4E71A 1QF6A 5GXGB 1R4NI 4IOIE 4OVZA 4YL8A 3SDLC 3PTFC 2JQRB 4LK0M 4N58A 2CHZA 3IAS1 3KWLA 1E10A 1KJTA 4KVGB 3DHIC 1Q5WB 2IY0B 4M8NA 3V05A 2WDVB 1PFDA 1GB4A 4LCDE 4E3CA 1QZEA 2X38A 4JL9A 2MLBA 1WMHB 4NY0A 2V3PA 4HROA 3ZNID 4C4VA 4ANXA 2ICIA 1FNVA 2M8SA 4B95A 1J8CA 2KMAA 2KLCA 2TSSA 2WDTB 4EOYA 2PW9A 1FO4A 4A20A 1J0GA 4YXDB 3GE8C 1TZOA 2KDFB 1WM3A 5FR3A 3UIOB 3Q8EA 2JWUA 4GDLB 1GB1A 1T0SC 1PDXA 3B2FA 4L23A 2FE8A 3BK1A 4A6QA 2LVOA 2IGGA 1DOXA 1P3QU 3M95A 2WU2B 1XLOA 2KAJA 4II3B 4BKSA 4W9GA 2ZEQA 4URKA 3PLUA 4PYZA 3JVZX 1NI3A 3EFCA 1WZ3A 3AE7B 3DDCB 3AEDB 2HTHA 5BMGA 3DWMA 2O6VA 1D6EC 5G55A 4XDCA 5LXIB 1ZW7A 2MJEA 2Y3AA 3VXWA 2R2OA 2KFJA 2CU3A 4OW0A 1OEYA 4YT0B 2XK5B 1F77A 1JWSD 4NNJB 3RYTA 1YQ4B 2FUG1 1FCLA 3IVFA 4CYEA 2RR9A 2L05A 2AQ2B 2ZJDA 4RM9A 1WH3A 3KUCB 2FAZA 2MSED 3AI5A 2K3UA 4GB9A 1ZP0B 4IM3A 4M0WB 4GXBA 2LRUA 3DBHB 1F2RI 4JE3B 3DBRB 4GU2A 4J6IA 4ZYNA 1FIQA 4ZDVA 1WFYA 2KZRA 4E74A 3KW5B 3M63B 3P2BA 4DXGA 1SJED 4W9JA 2DWQA 1CJEA 3BVGA 1XQQA 2WXKA 3U7ZA 3VH3B 3N20C 3PREA 2V4LA 4WH4A 2ZCBA 1WE6A 2NBWB 2D3BA 1V9JA 3ZIMA 1ET9A 4W9LA 3AE3B 1OFFA 3DHGC 2WXOA 2KXJA 4J3OD 1OQYA 4EZLA 3KQ4A 3O13A 1MI0A 1WXAA 2KDMA 1C9FA 3IT4B 2GI9A 2N9EB 3W1SA 3L54A 2UWQA 1XD3B 1SE9A 1ZXIA 4K7SA 4IW0A 1YN4A 2FIFA 1VZ6A 4K3BA 1LXDA 2OHFA 1U4AA 4GSWA 2LXAA 1L6UA 1JRUA 2KK8A 1SF0A 2KWVB 3RNFC 2G4DB 4UDUC 2DZIA 3UIPB 2LXCA 3TBLD 2KFKB 1UGJA 2K8BA 3RCZA 4CQNA 2EMSA 3DBSA 5DPTA 1ACCA 3SD5A 2C5LC 3OWEB 3PZ8A 2J53A 1JWMD 2PE6B 3ML8A 3DBHI 4MELA 2IO3B 3MP9A 5H8YE 3PS6A 3V3XA 1ZGUB 2ZPYA 3Q6BA 3RNEC 2WDRB 5AUIA 2M56B 1N6ZA 3MJ5A 4G50A 1ZKHA 1NBFC 2I1KA 2MHJA 2LFIA 4NAWB 3L10B 1I4RA 2H89B 4JGHB 4XWWA 2BYFA 3W1YA 3RZWC 4X57B 2V4IB 3WALA 1I4PA 3HIZA 4NJCA 3KLSX 2IDYA 4MACA 2W3RA 2CU1A 2WXQA 2RSUA 4TSSA 1UZXB 1E7VA 1ZOYB 3NS8A 3EC8A 2KVRA 1DOYA 1FFUA 1IGDA 1Q1OA 3DWGC 1E8WA 2WXFA 5G2NA 2JT4B 3NZSA 3A33B 2MBEA 2WX1A 1IUEA 4HRSA 2O6VD 2W3SA 4NAWA 4FADA 3DBLB 3MC9A 1TT5B 2QEJC 5AZFA 2NCNA 1UUPA 2L52A 2RPQA 4GGQA 2NS5A 1JWUD 2GBKA 5IO9A 5D3DA 2WP9B 2V3SA 4HEA1 2KJ6A 4IWQA 3R7RA 4HXDA 4BVUC 4ZHPA 2QCZA 1I4XA 2KX3A 2WXJA 3RN9C 4AQ7A 3X0WA 1N61A 2MJ3A 2AL6A 1Y8RC 3C8YA 1R7SA 2R61A 2LASA 2C7NB 3KYDD 2RGFA 4JWUC 4RGTA 5EE9A 1FD6A 2YEPB 2REXA 4DBGA 2DYOA 2BVCA 3P4PB 2PVGC 2Z0DB 3H6NA 1OTRB 1WGHA 2OEDA 2IYDB 1K50A 2AYOB 2EKIA 3VUYA 2GBJA 4G3XB 1RFKA 5HHDG 1DYQA 3A9JA 1PUTA 4BOSC 2KO3A 4MGIE 1TGZB 3BZDB 2K8CA 2GBMA 3BIID 2WQYB 3PHXB 2HDEA 1FNWA 3AB5A 3PLVA 3NHEB 1NEKB 3CIRB 3TL5A 2BWES 2FUHB 2AL3A 2BF8B 1ENFA 1KOTA 3EUB2 3QC8B 4MT5A 3VR9B 2B76B 3PRPB 2QIEB 3B2GA 1ZUD2 1F1HA 4II2B 1D5MC 4AOFA 1NENB 1MPEA 2ZZPB 2A5UA 4ARCA 2PIAA 3AULA 3M62B 2MWSB 2KX0A 1LFDA 5FR6A 4ANVA 2C7MB 1XXGA 3B0AA 2KWCA 4OVUA 2KMMA 1RWSA 1WY8A 1WRIA 3UQAA 1Q10A 3QHTA 3CSFA 2D07B 3V6CB 4IC7B 1V81A 1ZPSA 2FCSA 1T6BX 2N7EA 3VUXA 2LGSA 3IT6B 2LVPA 1WYGA 4A3OA 1XLNA 1YN3A 3DVGX 3HM3A 3MHZA 2K8HA 4P1CC 3ECIA 3ZDMC 3TCAA 2WX0A 3C0RB 4K1RB 4WJNA 3T9LA 3ZO5B 5FKAC 3OLMD 2VRRB 3ZUNA 3VFKA 4LNIA 1SXTA 5LNK1 1UF0A 3BINA 4R3DA 2EMTA 2XEWA 4C4VB 2HJ8A 3ZRCA 2DLBA 3N32A 5DPSA 1WF9A 3L08A 2KACA 2MW5A 3SR6A 1OEYJ 3P63A 3T3OA 2SEBD 1WGKA 2JZZA 1TKGA 2PE9A 4XE0A 1V5TA 1FXAA 3AXCA 1LGRA 1V1PB 4EZJA 1SBBB 4NJ7A 5HKHA 5EE1A 2RD0A 1KTKA 4EUTA 2M17A 4AS1A 3DPDA 1EWYC 4B0EA 2KVZA 4FXCA 2N0SB 2K9XA 1WX7A 3I63C 4REZA 4L2YA 4W9KA 1I4GA 1YOVB 3N1ZC 3Q3FA 1XO3A 4LJOB 3AU5A 1X1MA 1E8YA 2C60A 2KKCA 3V61A 1L2NA 5TSSA 2JY6A 3AEGB 1EM7A 1J7AA 4KGSA 2LZ6A 3TEWA 2LGXA 3P4SB 4RH6A 5J17A 2INDC 4FN2A 1KLVA 2DX5B 2DENB 2SAKA 3VTVA 3QARA 3V60A 3Q3JA 2KQSA 4C80A 1IBXB 1C79A 4MGKE 2KHWB 3ZJVA 2DZJA 4ZRQA 2O2VB 3Q3OC 5BMHA 2G45B 5J18A 1XEEA 3ABVB 2AEHA 2QDFA 4TUUA 4B0MA 2O6VB 2WWZA 3L13A 1C3TA 2A4ZA 3I9V1 2IJ0A 2M0AA 4WURA 1SIJA 5KHOA 2KQ7A 1SIFA 1L0XB 2PJHA 1C1YB 3IFWB 4HLEA 3QIJA 2JZPA 4GOCA 4US9A 2KOXA 2ZW0A 4RF1A 1Y56A 2PKOA 3RPFC 3HM6X 1GOZA 2KC1A 1T0QC 4GDKB 2DZKA 1H4RA 2ZNVB 1C77A 4XYCA 1P1AA 1HE8A 2DBYA 3AEAB 2J0JA 2D10A 2NPTA 5IA7A 3CSTA 2O2VA 4NAMA 2JX5A 1R4MI 2HD5B 1J7CA 3VRAB 3GS2A 4BKGA 4KGTA 1ZDXA 3RUIB 1WRDB 3KYCD 1T0YA 3WCQA 1YIWA 1TS2A 3H1UA 1DOIA 4LNFA 3HVZA 1T3QA 1WXSA 5BMIA 1KRHA 4KX6B 3QWZB 1QT9A 1L0VB 2WXLA 4EZKA 1E6EB 4FLHA 4PT5A 3PHWB 1OQRA 3L0WB 1ROEA 1WE7A 2JRIB 3AU4A 3UINB 2N7JA 5DPRA 2BPSA 4JX1C 4YWGG 1V8CA 3B1LX 2QMTA 1L4ZB 4HWIB 4IKGA 3R66C 5HI1A 3ZXVA 1HEZE 2JZ3B 2Y5BB 2KFKA 4MDKE 3PVLA 3ZNHB 1FM0D 2KN5A 2J52A 3MFGA 3U7DA 4LNKA 4NQLB 3R3MA 3B9JA 4DWFA 2BTEA 2MJDA 3RNBC 4A3PA 2M19A 1WM2A 1WJ4A 3W2DA 2BS4B 1QQRA 1ESFA 4W9HA 3Q8CA 1EWCA 4HPLB 1MFWA 2WLBA 3DBRI 2DHZA 2JWZA 1NYRA 3P42A 1WGYA 2MH7A 3LB8C 4ACFA 1ZDVA 3MTNB 1UWMA 3LYYA 5E6NA 4BZAA 4GDKA 4HPMB 1J7BA 4KSKC 5JZEB 1HZ6A 1P7EA 3KUZA 1JALA 2AX5A 1VCBA 3Q2AC 4A90A 2KD0A 1E0ZA 1VRAB 1MHXA 4LLGM 4YSZB 1K8RB 1XCTL 3MHSD 3QA8A 5G5GA 4WWPA 4WWOA 4I6NB 3WAOA 4DHZE 4HJGE 4S17A 3FC4A 4KKJA 1IBXA 3BK2A 1ZE3D 2K6QA 3Q3MC 1WYWB 5CHWA 1D3ZA 4N59A 3ZTDA 2D2QA 1G6JA 2LGDA 2RDHA 2JYEA 3BVZA 1JMLA 2KQ4X 2FIDA 2BBCA 4W9IA 1IP9A 1HXYD 4KIKA 4Q2JA 2G4SA 3DVNV 2MBHA 1AW7A 3NVWA 3V62A 3VRBB 1XCQL 5JH5C 3RNAC 1K52A 1RM6C 2Z8LA 4M8MA 2OJWA 2WXNA 2MBQA 2NMQA 2RMMA 2MEKA 3J9CA 3AE8B 2CS4A 3WAPA 4RFBA 2E6XA 3Q3NC 3SFDB 1EU4A 3UGBB 3HRDD 1BUIC 1T5XD 1FRRA 1C4PA 2AWTA 2N9XA 1I4QA 2IGHA 1MHHE 2BB5A 2JXXA 2K1FA 5BYQA 3S2AA 4N6EB 4EE2A 4IUMB 2D3GA 4G11A 4TMAB 1M4VA 2W9NA 4ARIA 3E56A 4RM8A 3SHQA 5E6JA 2L1AA 3LDZE 1MG4A 1XLPA 3BY4B 3AEBB 4P7IA 1PGAA 4OHJA 4P6VF 1NDDA 5D2MB 3URYA 3VQIA 3W9CB 3AE5B 2J42A 1SB3C 5JHAA 3NZUA 3AH7A 3I5JC 4K81A 4WQMA 1V2YA 2L0TA 1N62A 3O65B 1QKZA 1A5RA 1YN5A 1UD7A 5I4DA 4OVVA 4BAXA 5AZGA 1TBEA 2DYMA 3IHPC 3U52E 2J0MA 2N7DA 4KZ0A 2BQQA 2N4FA 2WYQA 4LNOA 4C7YA 1WR6E 2N1VA 1WWTA 3NVYA 3KWVA 4RMAA 3RNGC 3Q8FA 3DCGA 2BYEA 2KWDA 1UNSA 1IPGA 1N5XA 3TEZA 3SU8X 3MJWA 2QC8A 2ZVOA 3ETRA 3VVWB 4ZRKA 1KH0A 2KYWA 4DQOC 4YSXB 5L95C 4AJYB 3CMMB 3ZDTA 4HCPB 1SEBD 3EHVA 3PZ7A 3IAM1 2IO2B 2VZKD 3R7QA 1GC7A 4IWOA 4A8XC 4FULA 1H8CA 2UYZB 4PYUA 3ZRFA 2XK5A 2IPKD 2KT7A 2L00B 1C76A 2MA9B 4LNNA 4W9DA 3AE6B 4JQWC 2KC2A 3RFZB 2JU6X 2EELA 2MP2B 1ISNA 5FK9C 2FCNA 3EECA 4YTPB 2PTLA 3ZKJC 4USAA 5EE3A 2L3ZA 2KTFA 2I2YA 5D6JB 3VHTC 3LJ3A 2WXIA 1V49A 3AM9A 1HA5A 4JIOU 3EFUA 3VH4B 2M0XA 1N63A 1QOAA 2GLSA 2B3AA 3OJ3A 3APCA 3RULA 5LLIA 5EE0A 3RNCC 4AUQC 1E8XA 3HK0A 1YQ3B 3PGEA 2HTME 2NR2A 1S1QB 3OAWA 3RD2A 2FBWB 2FNJB 5JHBA 2I38A 1YJJA 1GC6A 4KZCA 1V86A 4K3CA 1MVKA 4HDOA 1L4DB 2W82A 3SFEB 2INNE 2Y5CA 1L7YA 1VZ8A 1CK1A 3W5VB 1XLQA 2D3AA 3Q69A 1C4AA 2INCC 2WXGA 1OQQA 1R4NB
chains in the Genus database with same CATH topology
2FCMA 3VH3B 2L7RA 3GZNI 1V80A 2LD9A 3PREA 3APFA 5BO4B 4GDKB 2V4LA 2DZKA 3K9OB 4ZRJA 1PQSA 3KH0A 2ZCBA 3VDZA 1H4RA 1WE6A 2NBWB 3QX1A 2ZNVB 1P1AA 1V9JA 1HE8A 4G0NB 3ZIMA 2JF5A 5EDSA 2GBRA 4W9LA 2CR5A 2G3QB 4FA6A 2J0JA 1E8ZA 1KM7A 2D10A 2NPTA 5IA7A 3A4SC 5DPWA 3CSTA 4GN1A 2MQJA 2O2VA 3DOWA 2KXJA 1OQYA 1R4MI 2HD5B 4EZLA 1TZ1A 1NI2A 3M3JA 4BKGA 2ZVNA 4I6PA 2KTRA 4MSMB 1RRBA 1GG3A 1WXAA 3ML9A 3RUIB 1WRDB 4NJ6A 5CTRC 2Z0EB 3A1QB 3KYCD 3DVGY 3W1SA 2N9EB 2GMIC 3L54A 3N30A 1T0YA 2KDIA 2BGFA 3ENEA 2UWQA 1XD3B 1YIWA 1SE9A 4JLCA 3U30A 2KWUB 1WX8A 3H1UA 3X23A 4WQOB 4AP4C 4K7SA 1V5OA 3JSVA 1WXSA 4IW0A 4IG7B 1WR1A 4WJOA 3TIXA 5LXHA 1RFAA 3QWZB 2FIFA 4FBJB 1IYFA 2ZPNA 1LXDA 4EZKA 4FLHA 1U4AA 3PHWB 4BOZB 4GSWA 3L0WB 2LXAA 1WE7A 2JRIB 4HDQA 1JRUA 2KK8A 5GMVA 4HCNB 3VTWA 2KWVB 1E7UA 4BKTA 2KTRB 2DAFA 3AU4A 2G4DB 3IBEA 2DZIA 4TV3A 3UIPB 1WX9A 3UINB 4AJWA 2KJRA 2JPHA 2LXCA 3QQ8B 2KFKB 5DPRA 3TBLD 4W9CA 2BPSA 2K8BA 3B1LX 3RCZA 1WJNA 3JYUA 2EMSA 3DBSA 3APDA 5DPTA 3SD5A 2C5LC 2LRWA 1RLFA 2OOBB 4BBNF 2PE6B 2L8JA 4NPNA 4HWIB 3R66C 3ML8A 3QK0A 5IAAC 3DBHI 3NY5A 1F9JA 1J19A 3NOBA 4MELA 2IO3B 3A4RA 4BBNC 2JZ3B 1YX5B 2Y5BB 4MGZE 1SGHA 1UH6A 1WXVA 4XZ4A 2KFKA 3PS6A 4MDKE 1ZGUB 2ZPYA 3PVLA 1UBQA 2NBVB 4WWNA 3ZNHB 3WAMA 2GBNA 4WJQA 2LGYA 1UGMA 3PRMB 2KN5A 4G50A 1ZKHA 1NBFC 2I1KA 2ZCCA 5J2RA 3U7DA 4FJZA 4NAWB 4NQLB 3R3MA 1LM8B 3L10B 4DWFA 4A3PA 2HE7A 1Z5SB 4JGHB 1UBIA 1WJUA 1WM2A 2BYFA 3W1YA 1WJ4A 3HHMA 4MSQB 2V1YA 3RZWC 4X57B 3ZW3A 2NPTB 3WALA 3K9PB 3HIZA 4W9HA 3QCAA 1TTNA 4LJPB 4HPLB 5CHVC 3ZVVA 2CU1A 3DBRI 3A9KB 1OGWA 2LVQA 2RSUA 1I42A 3D32A 1UZXB 1E7VA 3NS8A 2DHZA 2JWZA 3EC8A 2KVRA 5AEKB 4W9FA 4N9F4 4KDLB 1WGYA 2KANA 5D94A 3H7SA 3WANA 1WIAA 1Q1OA 5C23A 2NVUI 3DVNU 2FCQA 1E8WA 1P9DU 3OJ4B 2JT4B 4MH0E 3MTNB 3NZSA 5G2NA 5E6NA 3A33B 2MBEA 2WX1A 1S3SG 2LUEA 4FHJA 4GDKA 4HPMB 4KSKC 4F8CB 5JZEB 1WGDA 2O6VD 2YVCA 3ALBA 3KUZA 4NAWA 2CHWA 3I3TB 4FADA 4LDTD 1VCBA 2KD0A 2LI5A 2L76A 4GIVA 5AZFA 1Q0WB 5C1ZA 4DK5A 4EFOA 2NCNA 2Z59B 5KHQA 2RPQA 1K8RB 2NS5A 4GGQA 5DCNA 1I35A 4AWJA 2GBKA 1EO6A 2IO0B 5AZHA 3MHSD 2V3SA 3QA8A 2KJ6A 4IWQA 4HJKA 3R7RA 4DDGD 4HXDA 1P98A 2IY1B 4WWPA 4F1SA 4BVUC 3PZDA 2I1JA 3A1QA 2DZMA 2M1MA 2KX3A 3N3KB 3A9JB 4WWOA 4I6NB 3ZLZA 1LQBA 2C9WB 5CHFA 3WAOA 2BYVE 4DHZE 1WMHA 3ONSA 3X0WA 2DAJA 2AL6A 1Y8RC 2LASA 2PPHA 2K6QA 4K7UA 4B9KA 2C7NB 4KSLC 2YLMA 3DBLI 1E5WA 1P0RA 2RGFA 3KYDD 4DXAB 2JRHA 1WYWB 5CHWA 4EKUA 2REXA 1D3ZA 2K6DB 3ZTDA 4DBGA 2D11A 2D2QA 2DYOA 3VUWA 1G6JA 2LGDA 2MX2A 3A9KA 2Z0DB 3H6NA 1OTRB 2M4NA 1WGHA 2IYDB 2FIDA 3L17A 3WA0A 4W9IA 2AYOB 3DQVA 3VUYA 2GBJA 1IP9A 4G3XB 4MM3A 4MJSB 4XC2A 2IZVB 3W1SC 3A9JA 4BOSC 1YX6B 4KIKA 2G4SA 2KO3A 4MGIE 1TGZB 3DVNV 5E6PA 2MBHA 2K8CA 3V62A 2GBMA 4ANUA 3VTUA 4BFRA 4F7ZA 2KJHB 4K7WA 1VD2A 3B08A 3PHXB 5JH5C 2N9PC 3T8MA 3H7PA 4B6WA 3PLVA 4FJYA 1M94A 2J7QB 4M8MA 2MBOA 3NHEB 1WGGA 5TR5A 4ASWC 2MBQA 2C7HA 3TL5A 2BWES 2CS4A 2FUHB 2AL3A 3WAPA 2BF8B 1KOTA 1V6EA 3WIMA 3QC8B 4TKNA 3PRPB 2BWFA 3H9DA 3UGBB 3ZNGC 4II2B 1AARA 3IG3A 2AWTA 4AOFA 1YD8U 1YQBA 3L16A 2N9XA 2ZZPB 2NBUA 4MEMA 2JXXA 2A5UA 2DYBA 2K1FA 4KV2A 3ZTCA 3UF8A 3S2AA 3AULA 3M62B 4IUMB 2N1WA 2D3GA 2MWSB 4G11A 2KX0A 2W9NA 1LFDA 4RM8A 5FR6A 4ICVA 3SHQA 3LDZE 4BKSD 2OJRA 1BT0A 2BKFA 3RT3B 4ANVA 3UQBA 3CF6E 3BY4B 4TQ1A 2C7MB 4P7IA 2J0KA 1RAXA 5E6OA 4IM2A 4MGYE 3GOEA 4HVBA 3B0AA 2KWCA 4OVUA 5CX3A 3PT2B 2R2QA 1NDDA 1WY8A 4IM0A 5D2MB 2L0FA 3UQAA 4CO7A 3QHTA 3VQIA 3CSFA 2D07B 3V6CB 3QAQA 4E71A 4IC7B 1V81A 1R4NI 1GUAB 2BKRB 4YL8A 5JHAA 3NZUA 3SDLC 2FCSA 3PTFC 4MJSA 1FXTB 4NQKE 2N7EA 4K81A 3VUXA 1V2YA 1WZ0A 2CHZA 2L0TA 2MCNB 2GOWA 3O65B 1GJZA 1A5RA 4WJPA 1UD7A 2LVPA 1KJTA 4KVGB 4A3OA 1Q5WB 3H7PB 2IY0B 4OVVA 3DVGX 4DHZB 4M8NA 3HM3A 5AZGA 1TBEA 2DYMA 1WGRA 3IHPC 4LCDE 2J0MA 3ZNZB 2CKHB 4E3CA 2K8HA 1QZEA 3ECIA 3ZDMC 4JL9A 2N7DA 2WX0A 2JUOA 2MLBA 3C0RB 1WMHB 4KZ0A 3TCAA 4DHJD 2N4FA 2MP2A 4K1RB 4NY0A 2WYQA 4WJNA 3T9LA 3ZO5B 1Z2MA 3OLMD 2VRRB 3ZUNA 3ZNID 3VFKA 4ANXA 3KUDB 1WR6E 4KIKB 4DHJB 3BINA 2N1VA 2EMTA 2M8SA 2XEWA 3QJZA 4GMVA 4B95A 1J8CA 2HJ8A 3ZRCA 2KMAA 2KLCA 4EEWA 4I6LB 3N32A 2WDTB 5DPSA 1WF9A 4LDTB 4EOYA 2K39A 4A20A 1J0GA 3L08A 4ANWA 4RMAA 2KDFB 1WM3A 2MW5A 2BYEA 3DCGA 5D7GA 1OEYJ 1YJ1A 3UIOB 1IPGA 4IWPA 2JZZA 2PE9A 4GDLB 3VAWA 4TQ0A 3PSEB 1V5TA 3SU8X 2LWPA 3MJWA 3AXCA 4EZJA 5L83A 2ZVOA 4NJ7A 2LVOA 4PS8A 5HKHA 3VVWB 4ZRKA 2RD0A 4EUTA 2M17A 2CHXA 1EUVB 5L95C 1P3QU 2KMCA 3M95A 3KVFB 3CMMB 3V6EB 3ZDTA 2ZNVC 4HCPB 4AJYB 3DPDA 2KDEB 3EHVA 4II3B 4BKSA 4W9EA 2ZEQA 4W9GA 1WXMA 4URKA 2IO2B 3R7QA 1CMXB 3PPAA 1GC7A 3PLUA 4IWOA 4FULA 4KDIC 1WX7A 1H8CA 4PYZA 2UYZB 3JVZX 3JW0X 4PYUA 2IO1B 3ZRFA 2XK5A 1MG8A 4W9KA 3TMPB 1WZ3A 2L00B 3Q3FA 2MA9B 3DDCB 4LJOB 4JQWC 4W9DA 3AU5A 1X1MA 1E8YA 2C60A 2KC2A 4PS3A 2KKCA 4HK2A 2KNBA 3V61A 1L2NA 3PRZA 2JY6A 3JSVB 2HTHA 2XBBC 2MP2B 1WJ6A 2O6VA 5G55A 1ISNA 2LZ6A 2LGXA 2FCNA 3EECA 5J17A 5LXIB 1ZW7A 3ZKJC 4FN2A 4CHKA 2MRPA 3VXWA 2DX5B 2R2OA 1KLVA 2KFJA 2DENB 2L3ZA 2KTFA 2LJ5A 1OEYA 2PEAA 3VTVA 3QARA 3TJPA 3V60A 3Q3JA 2KQSA 2QHOA 5D6JB 2XK5B 1UELA 2EKEC 4MGKE 3VHTC 2KHWB 2DZJA 4NNJB 3RYTA 3LJ3A 1V49A 2O2VB 2IBIB 4JIOU 3EFUA 3IVFA 4ICUA 2G45B 2M0XA 3VH4B 4CYEA 5J18A 2RR9A 2B3AA 3OJ3A 2L05A 1GNUA 2AEHA 3APCA 2K25A 4WAAA 2ZJDA 4TUUA 4GDLA 1XT9B 3RULA 2O6VB 4RM9A 2ASQA 1WH3A 5LLIA 3KUCB 2FAZA 4AUQC 1E8XA 2MSED 3HK0A 1EF5A 4FHKA 3AI5A 2KDBA 2WWZA 3L13A 4GB9A 1C3TA 3PGEA 1E90A 2A4ZA 2NR2A 1S1QB 3OAWA 3RD2A 4IM3A 3U8ZA 4M0WB 4GXBA 2FNJB 5JHBA 2LRUA 5KHOA 2KQ7A 4XX5A 2KLGA 1GC6A 1SIFA 3RZFA 4KZCA 1V86A 2PJHA 1C1YB 4GU2A 4HDOA 4J6IA 3IFWB 4HLEA 4ZYNA 1WI0A 3QIJA 1WFYA 2KZRA 4FJVB 4E74A 4ZDVA 2JVCA 3KW5B 4GOCA 2MBBB 1L7YA 2KOXA 4DDID 3M63B 3P2BA 1EF1A 3HM6X 3PV1A 4W9JA 4ZRIA 2KC1A 1XQQA 4PS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCM A;  3VH3 B;  2L7R A;  3GZN I;  1V80 A;  2LD9 A;  3PRE A;  3APF A;  5BO4 B;  4GDK B;  2V4L A;  2DZK A;  3K9O B;  4ZRJ A;  1PQS A;  3KH0 A;  2ZCB A;  3VDZ A;  1H4R A;  1WE6 A;  2NBW B;  3QX1 A;  2ZNV B;  1P1A A;  1V9J A;  1HE8 A;  4G0N B;  3ZIM A;  2JF5 A;  5EDS A;  2GBR A;  4W9L A;  2CR5 A;  2G3Q B;  4FA6 A;  2J0J A;  1E8Z A;  1KM7 A;  2D10 A;  2NPT A;  5IA7 A;  3A4S C;  5DPW A;  3CST A;  4GN1 A;  2MQJ A;  2O2V A;  3DOW A;  2KXJ A;  1OQY A;  1R4M I;  2HD5 B;  4EZL A;  1TZ1 A;  1NI2 A;  3M3J A;  4BKG A;  2ZVN A;  4I6P A;  2KTR A;  4MSM B;  1RRB A;  1GG3 A;  1WXA A;  3ML9 A;  3RUI B;  1WRD B;  4NJ6 A;  5CTR C;  2Z0E B;  3A1Q B;  3KYC D;  3DVG Y;  3W1S A;  2N9E B;  2GMI C;  3L54 A;  3N30 A;  1T0Y A;  2KDI A;  2BGF A;  3ENE A;  2UWQ A;  1XD3 B;  1YIW A;  1SE9 A;  4JLC A;  3U30 A;  2KWU B;  1WX8 A;  3H1U A;  3X23 A;  4WQO B;  4AP4 C;  4K7S A;  1V5O A;  3JSV A;  1WXS A;  4IW0 A;  4IG7 B;  1WR1 A;  4WJO A;  3TIX A;  5LXH A;  1RFA A;  3QWZ B;  2FIF A;  4FBJ B;  1IYF A;  2ZPN A;  1LXD A;  4EZK A;  4FLH A;  1U4A A;  3PHW B;  4BOZ B;  4GSW A;  3L0W B;  2LXA A;  1WE7 A;  2JRI B;  4HDQ A;  1JRU A;  2KK8 A;  5GMV A;  4HCN B;  3VTW A;  2KWV B;  1E7U A;  4BKT A;  2KTR B;  2DAF A;  3AU4 A;  2G4D B;  3IBE A;  2DZI A;  4TV3 A;  3UIP B;  1WX9 A;  3UIN B;  4AJW A;  2KJR A;  2JPH A;  2LXC A;  3QQ8 B;  2KFK B;  5DPR A;  3TBL D;  4W9C A;  2BPS A;  2K8B A;  3B1L X;  3RCZ A;  1WJN A;  3JYU A;  2EMS A;  3DBS A;  3APD A;  5DPT A;  3SD5 A;  2C5L C;  2LRW A;  1RLF A;  2OOB B;  4BBN F;  2PE6 B;  2L8J A;  4NPN A;  4HWI B;  3R66 C;  3ML8 A;  3QK0 A;  5IAA C;  3DBH I;  3NY5 A;  1F9J A;  1J19 A;  3NOB A;  4MEL A;  2IO3 B;  3A4R A;  4BBN C;  2JZ3 B;  1YX5 B;  2Y5B B;  4MGZ E;  1SGH A;  1UH6 A;  1WXV A;  4XZ4 A;  2KFK A;  3PS6 A;  4MDK E;  1ZGU B;  2ZPY A;  3PVL A;  1UBQ A;  2NBV B;  4WWN A;  3ZNH B;  3WAM A;  2GBN A;  4WJQ A;  2LGY A;  1UGM A;  3PRM B;  2KN5 A;  4G50 A;  1ZKH A;  1NBF C;  2I1K A;  2ZCC A;  5J2R A;  3U7D A;  4FJZ A;  4NAW B;  4NQL B;  3R3M A;  1LM8 B;  3L10 B;  4DWF A;  4A3P A;  2HE7 A;  1Z5S B;  4JGH B;  1UBI A;  1WJU A;  1WM2 A;  2BYF A;  3W1Y A;  1WJ4 A;  3HHM A;  4MSQ B;  2V1Y A;  3RZW C;  4X57 B;  3ZW3 A;  2NPT B;  3WAL A;  3K9P B;  3HIZ A;  4W9H A;  3QCA A;  1TTN A;  4LJP B;  4HPL B;  5CHV C;  3ZVV A;  2CU1 A;  3DBR I;  3A9K B;  1OGW A;  2LVQ A;  2RSU A;  1I42 A;  3D32 A;  1UZX B;  1E7V A;  3NS8 A;  2DHZ A;  2JWZ A;  3EC8 A;  2KVR A;  5AEK B;  4W9F A;  4N9F 4;  4KDL B;  1WGY A;  2KAN A;  5D94 A;  3H7S A;  3WAN A;  1WIA A;  1Q1O A;  5C23 A;  2NVU I;  3DVN U;  2FCQ A;  1E8W A;  1P9D U;  3OJ4 B;  2JT4 B;  4MH0 E;  3MTN B;  3NZS A;  5G2N A;  5E6N A;  3A33 B;  2MBE A;  2WX1 A;  1S3S G;  2LUE A;  4FHJ A;  4GDK A;  4HPM B;  4KSK C;  4F8C B;  5JZE B;  1WGD A;  2O6V D;  2YVC A;  3ALB A;  3KUZ A;  4NAW A;  2CHW A;  3I3T B;  4FAD A;  4LDT D;  1VCB A;  2KD0 A;  2LI5 A;  2L76 A;  4GIV A;  5AZF A;  1Q0W B;  5C1Z A;  4DK5 A;  4EFO A;  2NCN A;  2Z59 B;  5KHQ A;  2RPQ A;  1K8R B;  2NS5 A;  4GGQ A;  5DCN A;  1I35 A;  4AWJ A;  2GBK A;  1EO6 A;  2IO0 B;  5AZH A;  3MHS D;  2V3S A;  3QA8 A;  2KJ6 A;  4IWQ A;  4HJK A;  3R7R A;  4DDG D;  4HXD A;  1P98 A;  2IY1 B;  4WWP A;  4F1S A;  4BVU C;  3PZD A;  2I1J A;  3A1Q A;  2DZM A;  2M1M A;  2KX3 A;  3N3K B;  3A9J B;  4WWO A;  4I6N B;  3ZLZ A;  1LQB A;  2C9W B;  5CHF A;  3WAO A;  2BYV E;  4DHZ E;  1WMH A;  3ONS A;  3X0W A;  2DAJ A;  2AL6 A;  1Y8R C;  2LAS A;  2PPH A;  2K6Q A;  4K7U A;  4B9K A;  2C7N B;  4KSL C;  2YLM A;  3DBL I;  1E5W A;  1P0R A;  2RGF A;  3KYD D;  4DXA B;  2JRH A;  1WYW B;  5CHW A;  4EKU A;  2REX A;  1D3Z A;  2K6D B;  3ZTD A;  4DBG A;  2D11 A;  2D2Q A;  2DYO A;  3VUW A;  1G6J A;  2LGD A;  2MX2 A;  3A9K A;  2Z0D B;  3H6N A;  1OTR B;  2M4N A;  1WGH A;  2IYD B;  2FID A;  3L17 A;  3WA0 A;  4W9I A;  2AYO B;  3DQV A;  3VUY A;  2GBJ A;  1IP9 A;  4G3X B;  4MM3 A;  4MJS B;  4XC2 A;  2IZV B;  3W1S C;  3A9J A;  4BOS C;  1YX6 B;  4KIK A;  2G4S A;  2KO3 A;  4MGI E;  1TGZ B;  3DVN V;  5E6P A;  2MBH A;  2K8C A;  3V62 A;  2GBM A;  4ANU A;  3VTU A;  4BFR A;  4F7Z A;  2KJH B;  4K7W A;  1VD2 A;  3B08 A;  3PHX B;  5JH5 C;  2N9P C;  3T8M A;  3H7P A;  4B6W A;  3PLV A;  4FJY A;  1M94 A;  2J7Q B;  4M8M A;  2MBO A;  3NHE B;  1WGG A;  5TR5 A;  4ASW C;  2MBQ A;  2C7H A;  3TL5 A;  2BWE S;  2CS4 A;  2FUH B;  2AL3 A;  3WAP A;  2BF8 B;  1KOT A;  1V6E A;  3WIM A;  3QC8 B;  4TKN A;  3PRP B;  2BWF A;  3H9D A;  3UGB B;  3ZNG C;  4II2 B;  1AAR A;  3IG3 A;  2AWT A;  4AOF A;  1YD8 U;  1YQB A;  3L16 A;  2N9X A;  2ZZP B;  2NBU A;  4MEM A;  2JXX A;  2A5U A;  2DYB A;  2K1F A;  4KV2 A;  3ZTC A;  3UF8 A;  3S2A A;  3AUL A;  3M62 B;  4IUM B;  2N1W A;  2D3G A;  2MWS B;  4G11 A;  2KX0 A;  2W9N A;  1LFD A;  4RM8 A;  5FR6 A;  4ICV A;  3SHQ A;  3LDZ E;  4BKS D;  2OJR A;  1BT0 A;  2BKF A;  3RT3 B;  4ANV A;  3UQB A;  3CF6 E;  3BY4 B;  4TQ1 A;  2C7M B;  4P7I A;  2J0K A;  1RAX A;  5E6O A;  4IM2 A;  4MGY E;  3GOE A;  4HVB A;  3B0A A;  2KWC A;  4OVU A;  5CX3 A;  3PT2 B;  2R2Q A;  1NDD A;  1WY8 A;  4IM0 A;  5D2M B;  2L0F A;  3UQA A;  4CO7 A;  3QHT A;  3VQI A;  3CSF A;  2D07 B;  3V6C B;  3QAQ A;  4E71 A;  4IC7 B;  1V81 A;  1R4N I;  1GUA B;  2BKR B;  4YL8 A;  5JHA A;  3NZU A;  3SDL C;  2FCS A;  3PTF C;  4MJS A;  1FXT B;  4NQK E;  2N7E A;  4K81 A;  3VUX A;  1V2Y A;  1WZ0 A;  2CHZ A;  2L0T A;  2MCN B;  2GOW A;  3O65 B;  1GJZ A;  1A5R A;  4WJP A;  1UD7 A;  2LVP A;  1KJT A;  4KVG B;  4A3O A;  1Q5W B;  3H7P B;  2IY0 B;  4OVV A;  3DVG X;  4DHZ B;  4M8N A;  3HM3 A;  5AZG A;  1TBE A;  2DYM A;  1WGR A;  3IHP C;  4LCD E;  2J0M A;  3ZNZ B;  2CKH B;  4E3C A;  2K8H A;  1QZE A;  3ECI A;  3ZDM C;  4JL9 A;  2N7D A;  2WX0 A;  2JUO A;  2MLB A;  3C0R B;  1WMH B;  4KZ0 A;  3TCA A;  4DHJ D;  2N4F A;  2MP2 A;  4K1R B;  4NY0 A;  2WYQ A;  4WJN A;  3T9L A;  3ZO5 B;  1Z2M A;  3OLM D;  2VRR B;  3ZUN A;  3ZNI D;  3VFK A;  4ANX A;  3KUD B;  1WR6 E;  4KIK B;  4DHJ B;  3BIN A;  2N1V A;  2EMT A;  2M8S A;  2XEW A;  3QJZ A;  4GMV A;  4B95 A;  1J8C A;  2HJ8 A;  3ZRC A;  2KMA A;  2KLC A;  4EEW A;  4I6L B;  3N32 A;  2WDT B;  5DPS A;  1WF9 A;  4LDT B;  4EOY A;  2K39 A;  4A20 A;  1J0G A;  3L08 A;  4ANW A;  4RMA A;  2KDF B;  1WM3 A;  2MW5 A;  2BYE A;  3DCG A;  5D7G A;  1OEY J;  1YJ1 A;  3UIO B;  1IPG A;  4IWP A;  2JZZ A;  2PE9 A;  4GDL B;  3VAW A;  4TQ0 A;  3PSE B;  1V5T A;  3SU8 X;  2LWP A;  3MJW A;  3AXC A;  4EZJ A;  5L83 A;  2ZVO A;  4NJ7 A;  2LVO A;  4PS8 A;  5HKH A;  3VVW B;  4ZRK A;  2RD0 A;  4EUT A;  2M17 A;  2CHX A;  1EUV B;  5L95 C;  1P3Q U;  2KMC A;  3M95 A;  3KVF B;  3CMM B;  3V6E B;  3ZDT A;  2ZNV C;  4HCP B;  4AJY B;  3DPD A;  2KDE B;  3EHV A;  4II3 B;  4BKS A;  4W9E A;  2ZEQ A;  4W9G A;  1WXM A;  4URK A;  2IO2 B;  3R7Q A;  1CMX B;  3PPA A;  1GC7 A;  3PLU A;  4IWO A;  4FUL A;  4KDI C;  1WX7 A;  1H8C A;  4PYZ A;  2UYZ B;  3JVZ X;  3JW0 X;  4PYU A;  2IO1 B;  3ZRF A;  2XK5 A;  1MG8 A;  4W9K A;  3TMP B;  1WZ3 A;  2L00 B;  3Q3F A;  2MA9 B;  3DDC B;  4LJO B;  4JQW C;  4W9D A;  3AU5 A;  1X1M A;  1E8Y A;  2C60 A;  2KC2 A;  4PS3 A;  2KKC A;  4HK2 A;  2KNB A;  3V61 A;  1L2N A;  3PRZ A;  2JY6 A;  3JSV B;  2HTH A;  2XBB C;  2MP2 B;  1WJ6 A;  2O6V A;  5G55 A;  1ISN A;  2LZ6 A;  2LGX A;  2FCN A;  3EEC A;  5J17 A;  5LXI B;  1ZW7 A;  3ZKJ C;  4FN2 A;  4CHK A;  2MRP A;  3VXW A;  2DX5 B;  2R2O A;  1KLV A;  2KFJ A;  2DEN B;  2L3Z A;  2KTF A;  2LJ5 A;  1OEY A;  2PEA A;  3VTV A;  3QAR A;  3TJP A;  3V60 A;  3Q3J A;  2KQS A;  2QHO A;  5D6J B;  2XK5 B;  1UEL A;  2EKE C;  4MGK E;  3VHT C;  2KHW B;  2DZJ A;  4NNJ B;  3RYT A;  3LJ3 A;  1V49 A;  2O2V B;  2IBI B;  4JIO U;  3EFU A;  3IVF A;  4ICU A;  2G45 B;  2M0X A;  3VH4 B;  4CYE A;  5J18 A;  2RR9 A;  2B3A A;  3OJ3 A;  2L05 A;  1GNU A;  2AEH A;  3APC A;  2K25 A;  4WAA A;  2ZJD A;  4TUU A;  4GDL A;  1XT9 B;  3RUL A;  2O6V B;  4RM9 A;  2ASQ A;  1WH3 A;  5LLI A;  3KUC B;  2FAZ A;  4AUQ C;  1E8X A;  2MSE D;  3HK0 A;  1EF5 A;  4FHK A;  3AI5 A;  2KDB A;  2WWZ A;  3L13 A;  4GB9 A;  1C3T A;  3PGE A;  1E90 A;  2A4Z A;  2NR2 A;  1S1Q B;  3OAW A;  3RD2 A;  4IM3 A;  3U8Z A;  4M0W B;  4GXB A;  2FNJ B;  5JHB A;  2LRU A;  5KHO A;  2KQ7 A;  4XX5 A;  2KLG A;  1GC6 A;  1SIF A;  3RZF A;  4KZC A;  1V86 A;  2PJH A;  1C1Y B;  4GU2 A;  4HDO A;  4J6I A;  3IFW B;  4HLE A;  4ZYN A;  1WI0 A;  3QIJ A;  1WFY A;  2KZR A;  4FJV B;  4E74 A;  4ZDV A;  2JVC A;  3KW5 B;  4GOC A;  2MBB B;  1L7Y A;  2KOX A;  4DDI D;  3M63 B;  3P2B A;  1EF1 A;  3HM6 X;  3PV1 A;  4W9J A;  4ZRI A;  2KC1 A;  1XQQ A;  4PS7 A; 
#chains in the Genus database with same CATH topology
 2FCM A;  4KKI A;  2BS3 B;  3GZN I;  1V80 A;  1B9R A;  3K9O B;  2D3C A;  1PQS A;  4ZRJ A;  4RNA A;  3VDZ A;  1XF5 L;  4G0N B;  5EDS A;  2G3Q B;  2K22 A;  3C19 A;  1C4C A;  3A4S C;  5DPW A;  3E9S A;  4GN1 A;  3DOW A;  1SSN A;  1IGC A;  1NI2 A;  3M3J A;  4L1B A;  2ZVN A;  2BW2 A;  1GG3 A;  1FFV A;  3ML9 A;  1VJK A;  2Z0E B;  3A1Q B;  3N30 A;  5IKC M;  2BGF A;  3U30 A;  4D2K A;  2KWU B;  1D5X C;  1WX8 A;  3TEY A;  4WQO B;  4AP4 C;  5JXV A;  2CJN A;  4IG7 B;  4WJO A;  5LXH A;  1RFA A;  4FBJ B;  1IYF A;  1QOG A;  2Q5W D;  5IP4 D;  2ZPN A;  1SE3 A;  2UU7 A;  4HDQ A;  5GMV A;  1WXQ A;  2KTR B;  3IBE A;  4TV3 A;  3U4E G;  1WX9 A;  1K53 A;  2KJR A;  2JPH A;  3QQ8 B;  2DNF A;  1V1P A;  2AQ3 B;  3APD A;  2LRW A;  1RLF A;  1K51 A;  2OOB B;  3QK0 A;  5IAA C;  2ZW1 A;  3NY5 A;  1AWD A;  2NTT A;  3VR8 B;  2L83 A;  1RYJ A;  3NOB A;  4BBN C;  1TS5 A;  4MGZ E;  1SGH A;  1UH6 A;  5HG2 A;  3RMK C;  1PYW D;  2LGI A;  1UBQ A;  2NBV B;  4WWN A;  3WAM A;  2GBN A;  4WJQ A;  1UGM A;  2G1E A;  3AE2 B;  1T0R C;  2ZCC A;  3BWU D;  5J2R A;  1AYF A;  5BYS A;  4ITK A;  2V0G A;  2HE7 A;  1Z5S B;  4M00 A;  3HHM A;  1I7H A;  5C2T B;  4C56 C;  3ZW3 A;  2NPT B;  3TUO A;  2KN4 A;  3K9P B;  3DHH C;  3TSS A;  3QCA A;  1TTN A;  1TY2 A;  4ZOH C;  1GPX A;  3N1X C;  2LVQ A;  4IDI A;  4KDL B;  2KAN A;  3H7S A;  3WAN A;  1WIA A;  2K5P A;  4OZB A;  2RPV A;  3AEE B;  4MH0 E;  3OJ4 B;  4JPS A;  4F8C B;  3HUI A;  1WGD A;  2YVC A;  3ALB A;  2CHW A;  4LDT D;  2WS3 B;  3MC0 B;  2L76 A;  1JRO A;  4WIP A;  4ZHO A;  2Z59 B;  1AN8 A;  5DCN A;  1I35 A;  2X8X X;  1FXI A;  2IO0 B;  4XDD A;  1TKE A;  4HJK A;  4DDG D;  2WGS A;  2XN9 C;  1P98 A;  3N1Y C;  3A1Q A;  3ZLZ A;  1LQB A;  2C9W B;  2BYV E;  2PPH A;  4B9K A;  2YLM A;  3DBL I;  3U2S C;  1E5W A;  2WNM A;  3BVM A;  4O1N A;  1JRP A;  2K6D B;  1VDV A;  3BYY B;  2BT6 A;  2MX2 A;  1VLB A;  2BB6 A;  1VZ7 A;  3FIL A;  1GAQ B;  2M4N A;  1I4H A;  3EA6 A;  1SE2 A;  3DQV A;  1SE4 A;  4XC2 A;  2IZV B;  3W1S C;  4DXF A;  1YX6 B;  3H8H A;  5E6P A;  3ZJT A;  4BFR A;  3VTU A;  4F7Z A;  2KJH B;  2LHD A;  3NZ3 A;  4K7W A;  1VD2 A;  3B08 A;  2N9P C;  2Y5P A;  4RGO S;  3T8M A;  5BYR A;  1F0Z A;  3H7P A;  1M94 A;  2RDG A;  4ZRP A;  1WGG A;  2JXT A;  2C7H A;  1JWA D;  3Q8A A;  2WXM A;  1V6E A;  1V1O A;  3WIM A;  2QSD A;  4OZC A;  1KFY B;  2BWF A;  4QAY A;  1YMH E;  3H9D A;  1AAR A;  3IG3 A;  4XGA B;  2RDB C;  3L16 A;  2HJ1 A;  1L0Y B;  4MEM A;  2DYB A;  4KV2 A;  3UF8 A;  1FPY A;  1LO5 D;  2JYT A;  3AEF B;  1QIL A;  2WXH A;  2OJR A;  3UQB A;  3CF6 E;  4TQ1 A;  3SEB A;  2W55 A;  2J0K A;  1RAX A;  5E6O A;  4IM2 A;  3GOE A;  4HVB A;  1VR9 A;  2GB1 A;  3PT2 B;  1JCK B;  1F2R C;  1PGB A;  4IM0 A;  1CZP A;  3AE1 B;  4CO7 A;  3QAQ A;  1GUA B;  2BKR B;  4MJS A;  3ZXR A;  2J4X A;  1FXT B;  4NQK E;  1WZ0 A;  2MCN B;  2LUM A;  2GOW A;  3FKY A;  1GJZ A;  4S0R A;  4WJP A;  1C78 A;  3H7P B;  4DHZ B;  2XNA C;  4P16 A;  3UI3 A;  2D5G A;  1WGR A;  3ZNZ B;  2CKH B;  1TIF A;  2N9K A;  2JUO A;  4DHJ D;  2MP2 A;  1Z2M A;  4WWM A;  2PLP A;  3KUD B;  4KIK B;  4DHJ B;  4GMV A;  3QJZ A;  3Q14 C;  3EGR A;  4EEW A;  4I6L B;  1STE A;  4LDT B;  2K39 A;  3P4Q B;  4ANW A;  3R2I A;  2JSV X;  1R4M B;  3I57 A;  5D7G A;  1YJ1 A;  4IWP A;  2ONQ A;  3VAW A;  4TQ0 A;  2GRI A;  3PSE B;  2LWP A;  3BYT B;  4JWS C;  1TS3 A;  4NZL B;  5L83 A;  3AN1 A;  2PMV A;  4RGM A;  2NTS A;  4PS8 A;  2BYT A;  2CHX A;  1YNT E;  1EUV B;  4A9A A;  2KMC A;  3KVF B;  3V6E B;  2ZNV C;  4XWT A;  3P1M A;  2KDE B;  4W9E A;  2LJI A;  1WXM A;  3T3N A;  2E3T A;  1CMX B;  3PPA A;  1SJH D;  3AE4 B;  4KDI C;  3JW0 X;  2G9H D;  2IO1 B;  1MG8 A;  1TS4 A;  3TMP B;  4LTU A;  4PK1 A;  4PS3 A;  2WXP A;  2V9H A;  4HK2 A;  2KNB A;  3ZQ4 A;  1N5W A;  3PRZ A;  2YEP F;  3JSV B;  2XBB C;  3GP7 A;  3ZYY X;  1WJ6 A;  1BML C;  3RI7 C;  1L5P A;  1TYG B;  1HTQ A;  4CHK A;  2MRP A;  2LJ5 A;  1D4B A;  2PEA A;  3TJP A;  2QHO A;  5HFY A;  1UEL A;  2EKE C;  4ZYS A;  1FEH A;  2IBI B;  4ICU A;  3TEX A;  4RCO A;  1EU3 A;  1GNU A;  2K25 A;  4WAA A;  4GDL A;  1XT9 B;  3AMZ A;  2ASQ A;  4C7Z A;  4FHK A;  1EF5 A;  2KDB A;  1E90 A;  3W5U B;  3U8Z A;  4US8 A;  4XX5 A;  1QOF A;  2KLG A;  3RZF A;  2QJL A;  3L4P A;  1WI0 A;  4FJV B;  2JVC A;  2MBB B;  4DDI D;  2VH1 A;  4MH8 A;  2WU5 B;  1EF1 A;  3NUH B;  3PV1 A;  4ZRI A;  4PS7 A;  3R2T A;  2L7R A;  2LD9 A;  3APF A;  5BO4 B;  4RGN A;  3KH0 A;  2CJO A;  3QX1 A;  4C00 A;  3NRZ A;  2JF5 A;  2GBR A;  2CR5 A;  4FA6 A;  4YTN B;  1E8Z A;  1KM7 A;  2MQJ A;  1A70 A;  3NG0 A;  2W54 A;  1QOB A;  1TZ1 A;  3FAH A;  2BS2 B;  1UWX A;  4I6P A;  2KTR A;  2WDQ B;  4MSM B;  1RRB A;  4M02 A;  3GZN B;  4NJ6 A;  2WHI A;  5CTR C;  3DVG Y;  2GMI C;  2KDI A;  3ENE A;  4JLC A;  3X23 A;  1V5O A;  4YTM B;  3JSV A;  1MJD A;  1WR1 A;  3TIX A;  2ACZ B;  2L32 A;  4BOZ B;  4P1B C;  3R8B A;  3CWI A;  4HCN B;  3VTW A;  1E7U A;  1WSP A;  4BKT A;  2DAF A;  3FIL B;  1NVI D;  4AJW A;  4OZA A;  4W9C A;  1WJN A;  3JYU A;  4YSY B;  5D3I B;  1V97 A;  4BBN F;  2L8J A;  4NPN A;  4HKZ E;  3GB1 A;  1F9J A;  4A55 A;  1J19 A;  1NYQ A;  3A4R A;  1E9M A;  1YX5 B;  1WXV A;  4XZ4 A;  1YJI A;  2LGY A;  3PRM B;  3GE3 C;  3AEC B;  4M01 A;  5H92 C;  4FJZ A;  1LM8 B;  1UBI A;  1WJU A;  4MSQ B;  2V1Y A;  1DGJ A;  4MM3 B;  2VH2 A;  1HQR D;  4LJP B;  5CHV C;  3ZVV A;  3LXF A;  3A9K B;  1OGW A;  1JW9 D;  1I42 A;  3D32 A;  3NVV A;  1CQV A;  5AEK B;  4W9F A;  4N9F 4;  5D94 A;  2PVO D;  5C23 A;  2NVU I;  2WXR A;  2FCQ A;  3DVN U;  1P9D U;  4HKQ A;  1S3S G;  2LUE A;  4FHJ A;  5MPO A;  5AUK A;  3I3T B;  2K0P A;  2LI5 A;  4GIV A;  1Q0W B;  5C1Z A;  4DK5 A;  4EFO A;  5KHQ A;  4AWJ A;  3AE9 B;  1EO6 A;  5AZH A;  1F52 A;  4RF0 A;  3P4R B;  2IY1 B;  4F1S A;  1KLG D;  3PZD A;  2LMC A;  2I1J A;  2DZM A;  2M1M A;  3N3K B;  3A9J B;  4GLS C;  5CHF A;  2VZK B;  3ZJU A;  1HTO A;  1WMH A;  5T8I A;  2ON8 A;  2AQ1 B;  3ONS A;  2DAJ A;  3OG5 A;  2N9L A;  2INP E;  4K7U A;  4KSL C;  1FNU A;  1P0R A;  3Q8B A;  4DXA B;  2JRH A;  4EKU A;  2D11 A;  3VUW A;  1FMA D;  4WAF A;  3A9K A;  1KF6 B;  2LHE A;  2V3N A;  3NVZ A;  3L17 A;  3WA0 A;  1L6V A;  4HPP A;  1JQ4 A;  1P7F A;  1N60 A;  3N9Y C;  1KLU D;  4MM3 A;  4MJS B;  1HZ5 A;  4M0W A;  1E7P B;  2IGD A;  1BXT A;  4ANU A;  3ZGZ A;  5C3J B;  3AV8 A;  1D5Z C;  4B6W A;  4FJY A;  2J7Q B;  2MBO A;  4ASW C;  5TR5 A;  5IOI A;  3MC8 A;  3NJT A;  1B1Z A;  1ZXH A;  4TKN A;  1TY0 A;  5IN7 A;  1FRD A;  4KGR A;  3ZNG C;  2QIL A;  5G5H A;  1YD8 U;  1YQB A;  1FCC C;  2NBU A;  3ZTC A;  1JWB D;  1TKY A;  3PO0 A;  2N1W A;  1PGX A;  4ICV A;  4BKS D;  1BT0 A;  1ET6 A;  1TJE A;  2BKF A;  3RT3 B;  2H88 B;  2LEK A;  3HVD A;  4MGY E;  1QLB B;  3IXS A;  5CX3 A;  2R2Q A;  3NS1 A;  4H2A A;  2L0F A;  4E71 A;  1QF6 A;  5GXG B;  1R4N I;  4IOI E;  4OVZ A;  4YL8 A;  3SDL C;  3PTF C;  2JQR B;  4LK0 M;  4N58 A;  2CHZ A;  3IAS 1;  3KWL A;  1E10 A;  1KJT A;  4KVG B;  3DHI C;  1Q5W B;  2IY0 B;  4M8N A;  3V05 A;  2WDV B;  1PFD A;  1GB4 A;  4LCD E;  4E3C A;  1QZE A;  2X38 A;  4JL9 A;  2MLB A;  1WMH B;  4NY0 A;  2V3P A;  4HRO A;  3ZNI D;  4C4V A;  4ANX A;  2ICI A;  1FNV A;  2M8S A;  4B95 A;  1J8C A;  2KMA A;  2KLC A;  2TSS A;  2WDT B;  4EOY A;  2PW9 A;  1FO4 A;  4A20 A;  1J0G A;  4YXD B;  3GE8 C;  1TZO A;  2KDF B;  1WM3 A;  5FR3 A;  3UIO B;  3Q8E A;  2JWU A;  4GDL B;  1GB1 A;  1T0S C;  1PDX A;  3B2F A;  4L23 A;  2FE8 A;  3BK1 A;  4A6Q A;  2LVO A;  2IGG A;  1DOX A;  1P3Q U;  3M95 A;  2WU2 B;  1XLO A;  2KAJ A;  4II3 B;  4BKS A;  4W9G A;  2ZEQ A;  4URK A;  3PLU A;  4PYZ A;  3JVZ X;  1NI3 A;  3EFC A;  1WZ3 A;  3AE7 B;  3DDC B;  3AED B;  2HTH A;  5BMG A;  3DWM A;  2O6V A;  1D6E C;  5G55 A;  4XDC A;  5LXI B;  1ZW7 A;  2MJE A;  2Y3A A;  3VXW A;  2R2O A;  2KFJ A;  2CU3 A;  4OW0 A;  1OEY A;  4YT0 B;  2XK5 B;  1F77 A;  1JWS D;  4NNJ B;  3RYT A;  1YQ4 B;  2FUG 1;  1FCL A;  3IVF A;  4CYE A;  2RR9 A;  2L05 A;  2AQ2 B;  2ZJD A;  4RM9 A;  1WH3 A;  3KUC B;  2FAZ A;  2MSE D;  3AI5 A;  2K3U A;  4GB9 A;  1ZP0 B;  4IM3 A;  4M0W B;  4GXB A;  2LRU A;  3DBH B;  1F2R I;  4JE3 B;  3DBR B;  4GU2 A;  4J6I A;  4ZYN A;  1FIQ A;  4ZDV A;  1WFY A;  2KZR A;  4E74 A;  3KW5 B;  3M63 B;  3P2B A;  4DXG A;  1SJE D;  4W9J A;  2DWQ A;  1CJE A;  3BVG A;  1XQQ A;  2WXK A;  3U7Z A;  3VH3 B;  3N20 C;  3PRE A;  2V4L A;  4WH4 A;  2ZCB A;  1WE6 A;  2NBW B;  2D3B A;  1V9J A;  3ZIM A;  1ET9 A;  4W9L A;  3AE3 B;  1OFF A;  3DHG C;  2WXO A;  2KXJ A;  4J3O D;  1OQY A;  4EZL A;  3KQ4 A;  3O13 A;  1MI0 A;  1WXA A;  2KDM A;  1C9F A;  3IT4 B;  2GI9 A;  2N9E B;  3W1S A;  3L54 A;  2UWQ A;  1XD3 B;  1SE9 A;  1ZXI A;  4K7S A;  4IW0 A;  1YN4 A;  2FIF A;  1VZ6 A;  4K3B A;  1LXD A;  2OHF A;  1U4A A;  4GSW A;  2LXA A;  1L6U A;  1JRU A;  2KK8 A;  1SF0 A;  2KWV B;  3RNF C;  2G4D B;  4UDU C;  2DZI A;  3UIP B;  2LXC A;  3TBL D;  2KFK B;  1UGJ A;  2K8B A;  3RCZ A;  4CQN A;  2EMS A;  3DBS A;  5DPT A;  1ACC A;  3SD5 A;  2C5L C;  3OWE B;  3PZ8 A;  2J53 A;  1JWM D;  2PE6 B;  3ML8 A;  3DBH I;  4MEL A;  2IO3 B;  3MP9 A;  5H8Y E;  3PS6 A;  3V3X A;  1ZGU B;  2ZPY A;  3Q6B A;  3RNE C;  2WDR B;  5AUI A;  2M56 B;  1N6Z A;  3MJ5 A;  4G50 A;  1ZKH A;  1NBF C;  2I1K A;  2MHJ A;  2LFI A;  4NAW B;  3L10 B;  1I4R A;  2H89 B;  4JGH B;  4XWW A;  2BYF A;  3W1Y A;  3RZW C;  4X57 B;  2V4I B;  3WAL A;  1I4P A;  3HIZ A;  4NJC A;  3KLS X;  2IDY A;  4MAC A;  2W3R A;  2CU1 A;  2WXQ A;  2RSU A;  4TSS A;  1UZX B;  1E7V A;  1ZOY B;  3NS8 A;  3EC8 A;  2KVR A;  1DOY A;  1FFU A;  1IGD A;  1Q1O A;  3DWG C;  1E8W A;  2WXF A;  5G2N A;  2JT4 B;  3NZS A;  3A33 B;  2MBE A;  2WX1 A;  1IUE A;  4HRS A;  2O6V D;  2W3S A;  4NAW A;  4FAD A;  3DBL B;  3MC9 A;  1TT5 B;  2QEJ C;  5AZF A;  2NCN A;  1UUP A;  2L52 A;  2RPQ A;  4GGQ A;  2NS5 A;  1JWU D;  2GBK A;  5IO9 A;  5D3D A;  2WP9 B;  2V3S A;  4HEA 1;  2KJ6 A;  4IWQ A;  3R7R A;  4HXD A;  4BVU C;  4ZHP A;  2QCZ A;  1I4X A;  2KX3 A;  2WXJ A;  3RN9 C;  4AQ7 A;  3X0W A;  1N61 A;  2MJ3 A;  2AL6 A;  1Y8R C;  3C8Y A;  1R7S A;  2R61 A;  2LAS A;  2C7N B;  3KYD D;  2RGF A;  4JWU C;  4RGT A;  5EE9 A;  1FD6 A;  2YEP B;  2REX A;  4DBG A;  2DYO A;  2BVC A;  3P4P B;  2PVG C;  2Z0D B;  3H6N A;  1OTR B;  1WGH A;  2OED A;  2IYD B;  1K50 A;  2AYO B;  2EKI A;  3VUY A;  2GBJ A;  4G3X B;  1RFK A;  5HHD G;  1DYQ A;  3A9J A;  1PUT A;  4BOS C;  2KO3 A;  4MGI E;  1TGZ B;  3BZD B;  2K8C A;  2GBM A;  3BII D;  2WQY B;  3PHX B;  2HDE A;  1FNW A;  3AB5 A;  3PLV A;  3NHE B;  1NEK B;  3CIR B;  3TL5 A;  2BWE S;  2FUH B;  2AL3 A;  2BF8 B;  1ENF A;  1KOT A;  3EUB 2;  3QC8 B;  4MT5 A;  3VR9 B;  2B76 B;  3PRP B;  2QIE B;  3B2G A;  1ZUD 2;  1F1H A;  4II2 B;  1D5M C;  4AOF A;  1NEN B;  1MPE A;  2ZZP B;  2A5U A;  4ARC A;  2PIA A;  3AUL A;  3M62 B;  2MWS B;  2KX0 A;  1LFD A;  5FR6 A;  4ANV A;  2C7M B;  1XXG A;  3B0A A;  2KWC A;  4OVU A;  2KMM A;  1RWS A;  1WY8 A;  1WRI A;  3UQA A;  1Q10 A;  3QHT A;  3CSF A;  2D07 B;  3V6C B;  4IC7 B;  1V81 A;  1ZPS A;  2FCS A;  1T6B X;  2N7E A;  3VUX A;  2LGS A;  3IT6 B;  2LVP A;  1WYG A;  4A3O A;  1XLN A;  1YN3 A;  3DVG X;  3HM3 A;  3MHZ A;  2K8H A;  4P1C C;  3ECI A;  3ZDM C;  3TCA A;  2WX0 A;  3C0R B;  4K1R B;  4WJN A;  3T9L A;  3ZO5 B;  5FKA C;  3OLM D;  2VRR B;  3ZUN A;  3VFK A;  4LNI A;  1SXT A;  5LNK 1;  1UF0 A;  3BIN A;  4R3D A;  2EMT A;  2XEW A;  4C4V B;  2HJ8 A;  3ZRC A;  2DLB A;  3N32 A;  5DPS A;  1WF9 A;  3L08 A;  2KAC A;  2MW5 A;  3SR6 A;  1OEY J;  3P63 A;  3T3O A;  2SEB D;  1WGK A;  2JZZ A;  1TKG A;  2PE9 A;  4XE0 A;  1V5T A;  1FXA A;  3AXC A;  1LGR A;  1V1P B;  4EZJ A;  1SBB B;  4NJ7 A;  5HKH A;  5EE1 A;  2RD0 A;  1KTK A;  4EUT A;  2M17 A;  4AS1 A;  3DPD A;  1EWY C;  4B0E A;  2KVZ A;  4FXC A;  2N0S B;  2K9X A;  1WX7 A;  3I63 C;  4REZ A;  4L2Y A;  4W9K A;  1I4G A;  1YOV B;  3N1Z C;  3Q3F A;  1XO3 A;  4LJO B;  3AU5 A;  1X1M A;  1E8Y A;  2C60 A;  2KKC A;  3V61 A;  1L2N A;  5TSS A;  2JY6 A;  3AEG B;  1EM7 A;  1J7A A;  4KGS A;  2LZ6 A;  3TEW A;  2LGX A;  3P4S B;  4RH6 A;  5J17 A;  2IND C;  4FN2 A;  1KLV A;  2DX5 B;  2DEN B;  2SAK A;  3VTV A;  3QAR A;  3V60 A;  3Q3J A;  2KQS A;  4C80 A;  1IBX B;  1C79 A;  4MGK E;  2KHW B;  3ZJV A;  2DZJ A;  4ZRQ A;  2O2V B;  3Q3O C;  5BMH A;  2G45 B;  5J18 A;  1XEE A;  3ABV B;  2AEH A;  2QDF A;  4TUU A;  4B0M A;  2O6V B;  2WWZ A;  3L13 A;  1C3T A;  2A4Z A;  3I9V 1;  2IJ0 A;  2M0A A;  4WUR A;  1SIJ A;  5KHO A;  2KQ7 A;  1SIF A;  1L0X B;  2PJH A;  1C1Y B;  3IFW B;  4HLE A;  3QIJ A;  2JZP A;  4GOC A;  4US9 A;  2KOX A;  2ZW0 A;  4RF1 A;  1Y56 A;  2PKO A;  3RPF C;  3HM6 X;  1GOZ A;  2KC1 A;  1T0Q C;  4GDK B;  2DZK A;  1H4R A;  2ZNV B;  1C77 A;  4XYC A;  1P1A A;  1HE8 A;  2DBY A;  3AEA B;  2J0J A;  2D10 A;  2NPT A;  5IA7 A;  3CST A;  2O2V A;  4NAM A;  2JX5 A;  1R4M I;  2HD5 B;  1J7C A;  3VRA B;  3GS2 A;  4BKG A;  4KGT A;  1ZDX A;  3RUI B;  1WRD B;  3KYC D;  1T0Y A;  3WCQ A;  1YIW A;  1TS2 A;  3H1U A;  1DOI A;  4LNF A;  3HVZ A;  1T3Q A;  1WXS A;  5BMI A;  1KRH A;  4KX6 B;  3QWZ B;  1QT9 A;  1L0V B;  2WXL A;  4EZK A;  1E6E B;  4FLH A;  4PT5 A;  3PHW B;  1OQR A;  3L0W B;  1ROE A;  1WE7 A;  2JRI B;  3AU4 A;  3UIN B;  2N7J A;  5DPR A;  2BPS A;  4JX1 C;  4YWG G;  1V8C A;  3B1L X;  2QMT A;  1L4Z B;  4HWI B;  4IKG A;  3R66 C;  5HI1 A;  3ZXV A;  1HEZ E;  2JZ3 B;  2Y5B B;  2KFK A;  4MDK E;  3PVL A;  3ZNH B;  1FM0 D;  2KN5 A;  2J52 A;  3MFG A;  3U7D A;  4LNK A;  4NQL B;  3R3M A;  3B9J A;  4DWF A;  2BTE A;  2MJD A;  3RNB C;  4A3P A;  2M19 A;  1WM2 A;  1WJ4 A;  3W2D A;  2BS4 B;  1QQR A;  1ESF A;  4W9H A;  3Q8C A;  1EWC A;  4HPL B;  1MFW A;  2WLB A;  3DBR I;  2DHZ A;  2JWZ A;  1NYR A;  3P42 A;  1WGY A;  2MH7 A;  3LB8 C;  4ACF A;  1ZDV A;  3MTN B;  1UWM A;  3LYY A;  5E6N A;  4BZA A;  4GDK A;  4HPM B;  1J7B A;  4KSK C;  5JZE B;  1HZ6 A;  1P7E A;  3KUZ A;  1JAL A;  2AX5 A;  1VCB A;  3Q2A C;  4A90 A;  2KD0 A;  1E0Z A;  1VRA B;  1MHX A;  4LLG M;  4YSZ B;  1K8R B;  1XCT L;  3MHS D;  3QA8 A;  5G5G A;  4WWP A;  4WWO A;  4I6N B;  3WAO A;  4DHZ E;  4HJG E;  4S17 A;  3FC4 A;  4KKJ A;  1IBX A;  3BK2 A;  1ZE3 D;  2K6Q A;  3Q3M C;  1WYW B;  5CHW A;  1D3Z A;  4N59 A;  3ZTD A;  2D2Q A;  1G6J A;  2LGD A;  2RDH A;  2JYE A;  3BVZ A;  1JML A;  2KQ4 X;  2FID A;  2BBC A;  4W9I A;  1IP9 A;  1HXY D;  4KIK A;  4Q2J A;  2G4S A;  3DVN V;  2MBH A;  1AW7 A;  3NVW A;  3V62 A;  3VRB B;  1XCQ L;  5JH5 C;  3RNA C;  1K52 A;  1RM6 C;  2Z8L A;  4M8M A;  2OJW A;  2WXN A;  2MBQ A;  2NMQ A;  2RMM A;  2MEK A;  3J9C A;  3AE8 B;  2CS4 A;  3WAP A;  4RFB A;  2E6X A;  3Q3N C;  3SFD B;  1EU4 A;  3UGB B;  3HRD D;  1BUI C;  1T5X D;  1FRR A;  1C4P A;  2AWT A;  2N9X A;  1I4Q A;  2IGH A;  1MHH E;  2BB5 A;  2JXX A;  2K1F A;  5BYQ A;  3S2A A;  4N6E B;  4EE2 A;  4IUM B;  2D3G A;  4G11 A;  4TMA B;  1M4V A;  2W9N A;  4ARI A;  3E56 A;  4RM8 A;  3SHQ A;  5E6J A;  2L1A A;  3LDZ E;  1MG4 A;  1XLP A;  3BY4 B;  3AEB B;  4P7I A;  1PGA A;  4OHJ A;  4P6V F;  1NDD A;  5D2M B;  3URY A;  3VQI A;  3W9C B;  3AE5 B;  2J42 A;  1SB3 C;  5JHA A;  3NZU A;  3AH7 A;  3I5J C;  4K81 A;  4WQM A;  1V2Y A;  2L0T A;  1N62 A;  3O65 B;  1QKZ A;  1A5R A;  1YN5 A;  1UD7 A;  5I4D A;  4OVV A;  4BAX A;  5AZG A;  1TBE A;  2DYM A;  3IHP C;  3U52 E;  2J0M A;  2N7D A;  4KZ0 A;  2BQQ A;  2N4F A;  2WYQ A;  4LNO A;  4C7Y A;  1WR6 E;  2N1V A;  1WWT A;  3NVY A;  3KWV A;  4RMA A;  3RNG C;  3Q8F A;  3DCG A;  2BYE A;  2KWD A;  1UNS A;  1IPG A;  1N5X A;  3TEZ A;  3SU8 X;  3MJW A;  2QC8 A;  2ZVO A;  3ETR A;  3VVW B;  4ZRK A;  1KH0 A;  2KYW A;  4DQO C;  4YSX B;  5L95 C;  4AJY B;  3CMM B;  3ZDT A;  4HCP B;  1SEB D;  3EHV A;  3PZ7 A;  3IAM 1;  2IO2 B;  2VZK D;  3R7Q A;  1GC7 A;  4IWO A;  4A8X C;  4FUL A;  1H8C A;  2UYZ B;  4PYU A;  3ZRF A;  2XK5 A;  2IPK D;  2KT7 A;  2L00 B;  1C76 A;  2MA9 B;  4LNN A;  4W9D A;  3AE6 B;  4JQW C;  2KC2 A;  3RFZ B;  2JU6 X;  2EEL A;  2MP2 B;  1ISN A;  5FK9 C;  2FCN A;  3EEC A;  4YTP B;  2PTL A;  3ZKJ C;  4USA A;  5EE3 A;  2L3Z A;  2KTF A;  2I2Y A;  5D6J B;  3VHT C;  3LJ3 A;  2WXI A;  1V49 A;  3AM9 A;  1HA5 A;  4JIO U;  3EFU A;  3VH4 B;  2M0X A;  1N63 A;  1QOA A;  2GLS A;  2B3A A;  3OJ3 A;  3APC A;  3RUL A;  5LLI A;  5EE0 A;  3RNC C;  4AUQ C;  1E8X A;  3HK0 A;  1YQ3 B;  3PGE A;  2HTM E;  2NR2 A;  1S1Q B;  3OAW A;  3RD2 A;  2FBW B;  2FNJ B;  5JHB A;  2I38 A;  1YJJ A;  1GC6 A;  4KZC A;  1V86 A;  4K3C A;  1MVK A;  4HDO A;  1L4D B;  2W82 A;  3SFE B;  2INN E;  2Y5C A;  1L7Y A;  1VZ8 A;  1CK1 A;  3W5V B;  1XLQ A;  2D3A A;  3Q69 A;  1C4A A;  2INC C;  2WXG A;  1OQQ A;  1R4N B; 
#chains in the Genus database with same CATH homology
 2FCM A;  3VH3 B;  2L7R A;  3GZN I;  1V80 A;  2LD9 A;  3PRE A;  3APF A;  5BO4 B;  4GDK B;  2V4L A;  2DZK A;  3K9O B;  4ZRJ A;  1PQS A;  3KH0 A;  2ZCB A;  3VDZ A;  1H4R A;  1WE6 A;  2NBW B;  3QX1 A;  2ZNV B;  1P1A A;  1V9J A;  1HE8 A;  4G0N B;  3ZIM A;  2JF5 A;  5EDS A;  2GBR A;  4W9L A;  2CR5 A;  2G3Q B;  4FA6 A;  2J0J A;  1E8Z A;  1KM7 A;  2D10 A;  2NPT A;  5IA7 A;  3A4S C;  5DPW A;  3CST A;  4GN1 A;  2MQJ A;  2O2V A;  3DOW A;  2KXJ A;  1OQY A;  1R4M I;  2HD5 B;  4EZL A;  1TZ1 A;  1NI2 A;  3M3J A;  4BKG A;  2ZVN A;  4I6P A;  2KTR A;  4MSM B;  1RRB A;  1GG3 A;  1WXA A;  3ML9 A;  3RUI B;  1WRD B;  4NJ6 A;  5CTR C;  2Z0E B;  3A1Q B;  3KYC D;  3DVG Y;  3W1S A;  2N9E B;  2GMI C;  3L54 A;  3N30 A;  1T0Y A;  2KDI A;  2BGF A;  3ENE A;  2UWQ A;  1XD3 B;  1YIW A;  1SE9 A;  4JLC A;  3U30 A;  2KWU B;  1WX8 A;  3H1U A;  3X23 A;  4WQO B;  4AP4 C;  4K7S A;  1V5O A;  3JSV A;  1WXS A;  4IW0 A;  4IG7 B;  1WR1 A;  4WJO A;  3TIX A;  5LXH A;  1RFA A;  3QWZ B;  2FIF A;  4FBJ B;  1IYF A;  2ZPN A;  1LXD A;  4EZK A;  4FLH A;  1U4A A;  3PHW B;  4BOZ B;  4GSW A;  3L0W B;  2LXA A;  1WE7 A;  2JRI B;  4HDQ A;  1JRU A;  2KK8 A;  5GMV A;  4HCN B;  3VTW A;  2KWV B;  1E7U A;  4BKT A;  2KTR B;  2DAF A;  3AU4 A;  2G4D B;  3IBE A;  2DZI A;  4TV3 A;  3UIP B;  1WX9 A;  3UIN B;  4AJW A;  2KJR A;  2JPH A;  2LXC A;  3QQ8 B;  2KFK B;  5DPR A;  3TBL D;  4W9C A;  2BPS A;  2K8B A;  3B1L X;  3RCZ A;  1WJN A;  3JYU A;  2EMS A;  3DBS A;  3APD A;  5DPT A;  3SD5 A;  2C5L C;  2LRW A;  1RLF A;  2OOB B;  4BBN F;  2PE6 B;  2L8J A;  4NPN A;  4HWI B;  3R66 C;  3ML8 A;  3QK0 A;  5IAA C;  3DBH I;  3NY5 A;  1F9J A;  1J19 A;  3NOB A;  4MEL A;  2IO3 B;  3A4R A;  4BBN C;  2JZ3 B;  1YX5 B;  2Y5B B;  4MGZ E;  1SGH A;  1UH6 A;  1WXV A;  4XZ4 A;  2KFK A;  3PS6 A;  4MDK E;  1ZGU B;  2ZPY A;  3PVL A;  1UBQ A;  2NBV B;  4WWN A;  3ZNH B;  3WAM A;  2GBN A;  4WJQ A;  2LGY A;  1UGM A;  3PRM B;  2KN5 A;  4G50 A;  1ZKH A;  1NBF C;  2I1K A;  2ZCC A;  5J2R A;  3U7D A;  4FJZ A;  4NAW B;  4NQL B;  3R3M A;  1LM8 B;  3L10 B;  4DWF A;  4A3P A;  2HE7 A;  1Z5S B;  4JGH B;  1UBI A;  1WJU A;  1WM2 A;  2BYF A;  3W1Y A;  1WJ4 A;  3HHM A;  4MSQ B;  2V1Y A;  3RZW C;  4X57 B;  3ZW3 A;  2NPT B;  3WAL A;  3K9P B;  3HIZ A;  4W9H A;  3QCA A;  1TTN A;  4LJP B;  4HPL B;  5CHV C;  3ZVV A;  2CU1 A;  3DBR I;  3A9K B;  1OGW A;  2LVQ A;  2RSU A;  1I42 A;  3D32 A;  1UZX B;  1E7V A;  3NS8 A;  2DHZ A;  2JWZ A;  3EC8 A;  2KVR A;  5AEK B;  4W9F A;  4N9F 4;  4KDL B;  1WGY A;  2KAN A;  5D94 A;  3H7S A;  3WAN A;  1WIA A;  1Q1O A;  5C23 A;  2NVU I;  3DVN U;  2FCQ A;  1E8W A;  1P9D U;  3OJ4 B;  2JT4 B;  4MH0 E;  3MTN B;  3NZS A;  5G2N A;  5E6N A;  3A33 B;  2MBE A;  2WX1 A;  1S3S G;  2LUE A;  4FHJ A;  4GDK A;  4HPM B;  4KSK C;  4F8C B;  5JZE B;  1WGD A;  2O6V D;  2YVC A;  3ALB A;  3KUZ A;  4NAW A;  2CHW A;  3I3T B;  4FAD A;  4LDT D;  1VCB A;  2KD0 A;  2LI5 A;  2L76 A;  4GIV A;  5AZF A;  1Q0W B;  5C1Z A;  4DK5 A;  4EFO A;  2NCN A;  2Z59 B;  5KHQ A;  2RPQ A;  1K8R B;  2NS5 A;  4GGQ A;  5DCN A;  1I35 A;  4AWJ A;  2GBK A;  1EO6 A;  2IO0 B;  5AZH A;  3MHS D;  2V3S A;  3QA8 A;  2KJ6 A;  4IWQ A;  4HJK A;  3R7R A;  4DDG D;  4HXD A;  1P98 A;  2IY1 B;  4WWP A;  4F1S A;  4BVU C;  3PZD A;  2I1J A;  3A1Q A;  2DZM A;  2M1M A;  2KX3 A;  3N3K B;  3A9J B;  4WWO A;  4I6N B;  3ZLZ A;  1LQB A;  2C9W B;  5CHF A;  3WAO A;  2BYV E;  4DHZ E;  1WMH A;  3ONS A;  3X0W A;  2DAJ A;  2AL6 A;  1Y8R C;  2LAS A;  2PPH A;  2K6Q A;  4K7U A;  4B9K A;  2C7N B;  4KSL C;  2YLM A;  3DBL I;  1E5W A;  1P0R A;  2RGF A;  3KYD D;  4DXA B;  2JRH A;  1WYW B;  5CHW A;  4EKU A;  2REX A;  1D3Z A;  2K6D B;  3ZTD A;  4DBG A;  2D11 A;  2D2Q A;  2DYO A;  3VUW A;  1G6J A;  2LGD A;  2MX2 A;  3A9K A;  2Z0D B;  3H6N A;  1OTR B;  2M4N A;  1WGH A;  2IYD B;  2FID A;  3L17 A;  3WA0 A;  4W9I A;  2AYO B;  3DQV A;  3VUY A;  2GBJ A;  1IP9 A;  4G3X B;  4MM3 A;  4MJS B;  4XC2 A;  2IZV B;  3W1S C;  3A9J A;  4BOS C;  1YX6 B;  4KIK A;  2G4S A;  2KO3 A;  4MGI E;  1TGZ B;  3DVN V;  5E6P A;  2MBH A;  2K8C A;  3V62 A;  2GBM A;  4ANU A;  3VTU A;  4BFR A;  4F7Z A;  2KJH B;  4K7W A;  1VD2 A;  3B08 A;  3PHX B;  5JH5 C;  2N9P C;  3T8M A;  3H7P A;  4B6W A;  3PLV A;  4FJY A;  1M94 A;  2J7Q B;  4M8M A;  2MBO A;  3NHE B;  1WGG A;  5TR5 A;  4ASW C;  2MBQ A;  2C7H A;  3TL5 A;  2BWE S;  2CS4 A;  2FUH B;  2AL3 A;  3WAP A;  2BF8 B;  1KOT A;  1V6E A;  3WIM A;  3QC8 B;  4TKN A;  3PRP B;  2BWF A;  3H9D A;  3UGB B;  3ZNG C;  4II2 B;  1AAR A;  3IG3 A;  2AWT A;  4AOF A;  1YD8 U;  1YQB A;  3L16 A;  2N9X A;  2ZZP B;  2NBU A;  4MEM A;  2JXX A;  2A5U A;  2DYB A;  2K1F A;  4KV2 A;  3ZTC A;  3UF8 A;  3S2A A;  3AUL A;  3M62 B;  4IUM B;  2N1W A;  2D3G A;  2MWS B;  4G11 A;  2KX0 A;  2W9N A;  1LFD A;  4RM8 A;  5FR6 A;  4ICV A;  3SHQ A;  3LDZ E;  4BKS D;  2OJR A;  1BT0 A;  2BKF A;  3RT3 B;  4ANV A;  3UQB A;  3CF6 E;  3BY4 B;  4TQ1 A;  2C7M B;  4P7I A;  2J0K A;  1RAX A;  5E6O A;  4IM2 A;  4MGY E;  3GOE A;  4HVB A;  3B0A A;  2KWC A;  4OVU A;  5CX3 A;  3PT2 B;  2R2Q A;  1NDD A;  1WY8 A;  4IM0 A;  5D2M B;  2L0F A;  3UQA A;  4CO7 A;  3QHT A;  3VQI A;  3CSF A;  2D07 B;  3V6C B;  3QAQ A;  4E71 A;  4IC7 B;  1V81 A;  1R4N I;  1GUA B;  2BKR B;  4YL8 A;  5JHA A;  3NZU A;  3SDL C;  2FCS A;  3PTF C;  4MJS A;  1FXT B;  4NQK E;  2N7E A;  4K81 A;  3VUX A;  1V2Y A;  1WZ0 A;  2CHZ A;  2L0T A;  2MCN B;  2GOW A;  3O65 B;  1GJZ A;  1A5R A;  4WJP A;  1UD7 A;  2LVP A;  1KJT A;  4KVG B;  4A3O A;  1Q5W B;  3H7P B;  2IY0 B;  4OVV A;  3DVG X;  4DHZ B;  4M8N A;  3HM3 A;  5AZG A;  1TBE A;  2DYM A;  1WGR A;  3IHP C;  4LCD E;  2J0M A;  3ZNZ B;  2CKH B;  4E3C A;  2K8H A;  1QZE A;  3ECI A;  3ZDM C;  4JL9 A;  2N7D A;  2WX0 A;  2JUO A;  2MLB A;  3C0R B;  1WMH B;  4KZ0 A;  3TCA A;  4DHJ D;  2N4F A;  2MP2 A;  4K1R B;  4NY0 A;  2WYQ A;  4WJN A;  3T9L A;  3ZO5 B;  1Z2M A;  3OLM D;  2VRR B;  3ZUN A;  3ZNI D;  3VFK A;  4ANX A;  3KUD B;  1WR6 E;  4KIK B;  4DHJ B;  3BIN A;  2N1V A;  2EMT A;  2M8S A;  2XEW A;  3QJZ A;  4GMV A;  4B95 A;  1J8C A;  2HJ8 A;  3ZRC A;  2KMA A;  2KLC A;  4EEW A;  4I6L B;  3N32 A;  2WDT B;  5DPS A;  1WF9 A;  4LDT B;  4EOY A;  2K39 A;  4A20 A;  1J0G A;  3L08 A;  4ANW A;  4RMA A;  2KDF B;  1WM3 A;  2MW5 A;  2BYE A;  3DCG A;  5D7G A;  1OEY J;  1YJ1 A;  3UIO B;  1IPG A;  4IWP A;  2JZZ A;  2PE9 A;  4GDL B;  3VAW A;  4TQ0 A;  3PSE B;  1V5T A;  3SU8 X;  2LWP A;  3MJW A;  3AXC A;  4EZJ A;  5L83 A;  2ZVO A;  4NJ7 A;  2LVO A;  4PS8 A;  5HKH A;  3VVW B;  4ZRK A;  2RD0 A;  4EUT A;  2M17 A;  2CHX A;  1EUV B;  5L95 C;  1P3Q U;  2KMC A;  3M95 A;  3KVF B;  3CMM B;  3V6E B;  3ZDT A;  2ZNV C;  4HCP B;  4AJY B;  3DPD A;  2KDE B;  3EHV A;  4II3 B;  4BKS A;  4W9E A;  2ZEQ A;  4W9G A;  1WXM A;  4URK A;  2IO2 B;  3R7Q A;  1CMX B;  3PPA A;  1GC7 A;  3PLU A;  4IWO A;  4FUL A;  4KDI C;  1WX7 A;  1H8C A;  4PYZ A;  2UYZ B;  3JVZ X;  3JW0 X;  4PYU A;  2IO1 B;  3ZRF A;  2XK5 A;  1MG8 A;  4W9K A;  3TMP B;  1WZ3 A;  2L00 B;  3Q3F A;  2MA9 B;  3DDC B;  4LJO B;  4JQW C;  4W9D A;  3AU5 A;  1X1M A;  1E8Y A;  2C60 A;  2KC2 A;  4PS3 A;  2KKC A;  4HK2 A;  2KNB A;  3V61 A;  1L2N A;  3PRZ A;  2JY6 A;  3JSV B;  2HTH A;  2XBB C;  2MP2 B;  1WJ6 A;  2O6V A;  5G55 A;  1ISN A;  2LZ6 A;  2LGX A;  2FCN A;  3EEC A;  5J17 A;  5LXI B;  1ZW7 A;  3ZKJ C;  4FN2 A;  4CHK A;  2MRP A;  3VXW A;  2DX5 B;  2R2O A;  1KLV A;  2KFJ A;  2DEN B;  2L3Z A;  2KTF A;  2LJ5 A;  1OEY A;  2PEA A;  3VTV A;  3QAR A;  3TJP A;  3V60 A;  3Q3J A;  2KQS A;  2QHO A;  5D6J B;  2XK5 B;  1UEL A;  2EKE C;  4MGK E;  3VHT C;  2KHW B;  2DZJ A;  4NNJ B;  3RYT A;  3LJ3 A;  1V49 A;  2O2V B;  2IBI B;  4JIO U;  3EFU A;  3IVF A;  4ICU A;  2G45 B;  2M0X A;  3VH4 B;  4CYE A;  5J18 A;  2RR9 A;  2B3A A;  3OJ3 A;  2L05 A;  1GNU A;  2AEH A;  3APC A;  2K25 A;  4WAA A;  2ZJD A;  4TUU A;  4GDL A;  1XT9 B;  3RUL A;  2O6V B;  4RM9 A;  2ASQ A;  1WH3 A;  5LLI A;  3KUC B;  2FAZ A;  4AUQ C;  1E8X A;  2MSE D;  3HK0 A;  1EF5 A;  4FHK A;  3AI5 A;  2KDB A;  2WWZ A;  3L13 A;  4GB9 A;  1C3T A;  3PGE A;  1E90 A;  2A4Z A;  2NR2 A;  1S1Q B;  3OAW A;  3RD2 A;  4IM3 A;  3U8Z A;  4M0W B;  4GXB A;  2FNJ B;  5JHB A;  2LRU A;  5KHO A;  2KQ7 A;  4XX5 A;  2KLG A;  1GC6 A;  1SIF A;  3RZF A;  4KZC A;  1V86 A;  2PJH A;  1C1Y B;  4GU2 A;  4HDO A;  4J6I A;  3IFW B;  4HLE A;  4ZYN A;  1WI0 A;  3QIJ A;  1WFY A;  2KZR A;  4FJV B;  4E74 A;  4ZDV A;  2JVC A;  3KW5 B;  4GOC A;  2MBB B;  1L7Y A;  2KOX A;  4DDI D;  3M63 B;  3P2B A;  1EF1 A;  3HM6 X;  3PV1 A;  4W9J A;  4ZRI A;  2KC1 A;  1XQQ A;  4PS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...