3MTNB

Usp21 in complex with a ubiquitin-based, usp21-specific inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
HMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKWSTLFLLLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 21
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3mtnB00
4LCDE 4MGKE 1Q1OA 4K7WA 4NQKE 4ZYNA 2HJ8A 3LJ3A 1Y8RC 2L3ZA 4FJYA 2KQ7A 3BY4B 4J6IA 3VUYA 5C1ZA 3JSVA 3MHSD 1GC7A 4HXDA 2DZJA 4OVVA 2JXXA 2YLMA 4HWIB 2MCNB 3PSEB 5LLIA 4BKSA 1WM2A 4WWOA 2FCMA 4NJ7A 3V62A 4DHJD 2C9WB 4IW0A 4KZ0A 4W9JA 4FJVB 2MWSB 1WMHB 5LXHA 2M17A 3W1SC 2ZVNA 2KTFA 5D94A 3VUWA 3ML8A 3DPDA 2IBIB 3PVLA 3QAQA 3UIOB 4TV3A 2BPSA 5AZGA 3DBRI 2FIDA 3APCA 3KUDB 3W1SA 2L0TA 4MM3A 3U30A 4W9CA 1UGMA 2AL6A 3R7RA 3QARA 3H7PA 1WM3A 1ZW7A 2LVPA 3ZNGC 3ZUNA 2O6VA 2PJHA 3WAOA 1L2NA 4GMVA 2MSED 3QJZA 5CX3A 4I6LB 1WXSA 4MH0E 4B95A 1E8YA 2JZZA 3KH0A 4GIVA 4E74A 4HCNB 2DHZA 2FUHB 2LRUA 3HK0A 2KK8A 2IY0B 3H1UA 2IZVB 3VAWA 4GGQA 1EF5A 2G3QB 3JVZX 2I1JA 4ZRJA 3O65B 2N9EB 3B1LX 1LQBA 1SE9A 2DAJA 2KC1A 1WGRA 1Q0WB 3WA0A 3DOWA 1E7UA 4K7SA 1SGHA 3QC8B 1OTRB 2KD0A 3AU4A 3KYDD 1WIAA 2KDEB 2LRWA 2XK5B 2ZCBA 2KANA 3KW5B 1Z2MA 4WWNA 3RZWC 4DDGD 5DPWA 1IP9A 2IO0B 4GN1A 4IWQA 1RAXA 3H6NA 3PT2B 5D7GA 3DCGA 3VH3B 1YIWA 2D07B 1NBFC 4K1RB 1V49A 4ZRIA 3TL5A 1XQQA 5D2MB 2LASA 1WMHA 4KVGB 5G55A 1WR1A 2KOXA 3IVFA 4X57B 5CTRC 4BVUC 1NI2A 3VFKA 2RD0A 2WWZA 4BKTA 1KLVA 1Q5WB 2Z0DB 4HPMB 2MQJA 4K7UA 4FJZA 2CHWA 1WX8A 3A4SC 3EHVA 5GMVA 3VTWA 2PPHA 4WJOA 5E6OA 2N1WA 4TQ1A 3B0AA 2C7NB 4XC2A 3QK0A 5KHQA 3VUXA 2K6QA 4JL9A 5BO4B 1KJTA 4WQOB 1LM8B 4KV2A 1Z5SB 4GU2A 3M3JA 4LDTD 4B9KA 4BOZB 4WJQA 3L08A 3RULA 2CR5A 1GUAB 3OAWA 3A1QB 2C7HA 4YL8A 4FHJA 1WGGA 4NPNA 5CHFA 3L54A 4LJPB 4NNJB 3WAMA 3L16A 1V86A 2NR2A 5AZHA 3ZVVA 4EZJA 4ANWA 3VH4B 4DHZB 3QX1A 1ISNA 4I6NB 1H8CA 4GDKA 4HDOA 2DYMA 4DDID 3LDZE 4LJOB 2L76A 1GC6A 3TMPB 4IWPA 2MBHA 4W9IA 4W9LA 4DHZE 5AEKB 2PE6B 1WZ3A 2O2VA 2KJ6A 3PLUA 4E3CA 2AYOB 3CSFA 1P0RA 1R4MI 2J0MA 4G50A 1BT0A 2ZZPB 2KX3A 2N7DA 2ZNVB 1F9JA 1OQYA 2XK5A 3QWZB 4MSQB 3RD2A 1ZGUB 3OLMD 4KDIC 3H9DA 3S2AA 4M0WB 1UELA 3PZDA 3NZSA 3ZTCA 2WDTB 1UBQA 4NJ6A 2GBMA 5DPTA 2LXAA 3ZDMC 1C3TA 5JH5C 1GNUA 2IY1B 4JIOU 4MELA 1LXDA 2JVCA 3A4RA 5IAAC 3QQ8B 4FLHA 2IO3B 1VCBA 3PHWB 1E8XA 4AJWA 4F7ZA 3PREA 4GXBA 3HM3A 3R66C 1OGWA 2FAZA 3R3MA 2DYBA 1E8ZA 3MJWA 2KDFB 1LFDA 4II3B 3RYTA 1YQBA 1XT9B 5G2NA 3WALA 3AULA 1X1MA 2NBUA 4GDLB 3V6EB 3VXWA 2B3AA 3UGBB 2BWES 3A1QA 4TQ0A 2M4NA 2D3GA 1OEYA 2C60A 1MG8A 2BKRB 4KDLB 1UD7A 2MBEA 4GSWA 4ANVA 3DVNV 4WWPA 4DHJB 4PS8A 2LWPA 4JQWC 3A9JA 2BWFA 3V60A 1WX9A 2JF5A 4JGHB 4IM2A 4P7IA 2MLBA 3PRMB 4FA6A 2JZ3B 1V5OA 4PS3A 3ML9A 3K9PB 1WE6A 1J8CA 3ZTDA 2ZPNA 2FCNA 4EUTA 4IWOA 4PYUA 1WXMA 2KJRA 4ZDVA 1GG3A 2ZNVC 2M0XA 2W9NA 3L10B 4W9HA 2JY6A 3VDZA 2KVRA 4MGYE 4GDKB 3DVGX 2Y5BB 3IFWB 3AI5A 2KFJA 2LXCA 1WF9A 4HJKA 4DWFA 1SIFA 4KIKB 3CMMB 3ECIA 2O2VB 1WXAA 3OJ4B 5DCNA 1RRBA 1CMXB 2YVCA 2G45B 1U4AA 3QHTA 2LGDA 3ONSA 2RGFA 2ZCCA 4PYZA 5L95C 2I1KA 1FXTB 2KLGA 2L7RA 3AU5A 2QHOA 1QZEA 2L0FA 3QIJA 4RM8A 3ZRCA 2K25A 4E71A 2NPTB 5D6JB 1TBEA 2FNJB 3AXCA 1A5RA 3N32A 4EOYA 4HLEA 3WAPA 2CU1A 2JPHA 2KNBA 2DZMA 4BBNF 3M62B 1E90A 3PHXB 2XBBC 4MGIE 1WZ0A 4AUQC 2FIFA 4TUUA 2LGYA 4G11A 2IYDB 1E8WA 3KYCD 5AZFA 1IYFA 2CKHB 2FCQA 3DQVA 4GDLA 1KM7A 2KFKB 4M8MA 4TKNA 4IG7B 2LVOA 2GBRA 1P3QU 3HIZA 2LUEA 1T0YA 2EMSA 2ZPYA 2DAFA 4ANUA 2WX1A 3V61A 3UQAA 2MP2A 3T8MA 1D3ZA 1WR6E 3ZNID 3ALBA 1YX5B 2KMCA 3GZNI 2J7QB 2ZVOA 3UIPB 3ZNZB 1WXVA 3A33B 4AWJA 4W9EA 3DBLI 3HM6X 3VQIA 1XD3B 2KC2A 4ICUA 4JLCA 4MGZE 4AOFA 2REXA 3I3TB 2LD9A 1WJNA 2O6VD 3K9OB 2BKFA 2NVUI 3A9JB 3B08A 4W9KA 5CHVC 3VTVA 2MA9B 2FCSA 2MX2A 4AJYB 4DK5A 4FBJB 3WIMA 1J0GA 2K39A 2ZEQA 2A5UA 2KWUB 3DVNU 1WRDB 2KN5A 3JW0X 4HCPB 2UYZB 4HVBA 5CHWA 4ANXA 1WH3A 4W9GA 4EEWA 1H4RA 4EKUA 2IO1B 3ZO5B 1KOTA 2IO2B 1ZKHA 4KIKA 4LDTB 4NAWA 4MJSB 1UBIA 2KLCA 3BINA 3CF6E 1V2YA 3MTNB 5DPRA 2D10A 4GOCA 1V80A 3L13A 3ZNHB 3PS6A 1UH6A 4WJNA 2N9PC 1EF1A 3NZUA 3A9KB 3H7SA 3NS8A 4ICVA 5JHAA 2NPTA 3Q3JA 1V81A 3EFUA 4CYEA 1WYWB 2WX0A 5JHBA 3PPAA 3HHMA 2MBBB 2L8JA 2NCNA 4G3XB 5TR5A 3C0RB 1K8RB 5JZEB 3PGEA 3W1YA 4KSLC 2KFKA 2RSUA 2KJHB 4XX5A 2LZ6A 3RZFA 3ZDTA 4M8NA 2M8SA 4IM0A 3IBEA 2LGXA 3U7DA 1YD8U 1WGDA 3WANA 4OVUA 3ZIMA 5J17A 2M1MA 2K8BA 4BKGA 4B6WA 4NQLB 4BOSC 5EDSA 2NBVB 3TIXA 2Z0EB 4FHKA 4KZCA 1RFAA 3TBLD 4A20A 1TGZB 3TJPA 2GBJA 2KWCA 3IHPC 2KTRA 1WGYA 4HK2A 2BYVE 3KUCB 2MP2B 1P98A 3PTFC 5KHOA 3APDA 2KWVB 3QA8A 2N9XA 3UQBA 5C23A 2A4ZA 4N9F4 2KZRA 4EFOA 1RLFA 1V9JA 2L00B 5FR6A 2N7EA 3VVWB 3SDLC 3UINB 4ASWC 4DXAB 1TTNA 1UZXB 3L17A 2KDIA 3APFA 3M95A 4HPLB 3X23A 3ZW3A 1R4NI 1WJUA 2KHWB 1L7YA 1V6EA 2GBNA 4MJSA 2EKEC 2MRPA 2OJRA 2KDBA 2G4SA 4AP4C 2J0JA 3NY5A 3VHTC 2GMIC 2LJ5A 5IA7A 1HE8A 2AL3A 1EUVB 3RT3B 2D2QA 4I6PA 2JWZA 3EECA 2D11A 3R7QA 1V5TA 4NAWB 4CO7A 2GOWA 2Z59B 3A9KA 2K6DB 1VD2A 3KUZA 3NOBA 1S3SG 3L0WB 4NY0A 2DX5B 1J19A 1E7VA 3PV1A 4RM9A 5L83A 2R2OA 1WGHA 4GB9A 1OEYJ 5J2RA 2N1VA 2VRRB 2RPQA 3PRPB 1M94A 5HKHA 3SHQA 3KVFB 4XZ4A 4W9FA 1JRUA 1PQSA 2KQSA 4MDKE 2MBOA 4FN2A 2AWTA 1TZ1A 1WJ6A 2CHZA 3N30A 3V6CB 2BYEA 3QCAA 2NS5A 3ENEA 4K81A 3VTUA 3DBSA 4BKSD 3N3KB 3T9LA 2KKCA 2HTHA 2V1YA 5DPSA 2C7MB 1WJ4A 1C1YB 4G0NB 4URKA 4PS7A 3GOEA 3NHEB 5E6PA 3EC8A 3Q3FA 3PRZA 2C5LC 3TCAA 2BGFA 4IUMB 1G6JA 3D32A 2OOBB 5LXIB 4BFRA 4IM3A 2CS4A 2BYFA 3JSVB 2R2QA 4EZKA 3PLVA 1WI0A 2DZKA 2MW5A 3UF8A 2HE7A 3P2BA 2JT4B 4WJPA 4EZLA 3ZRFA 2KTRB 1WFYA 1WE7A 4ZRKA 4A3PA 2V4LA 2ASQA 4DBGA 1IPGA 1S1QB 2CHXA 2GBKA 4A3OA 1YJ1A 2DENB 2DYOA 3DDCB 2JRIB 2L05A 3U8ZA 3SD5A 4F8CB 4F1SA 2UWQA 4FADA 3DBHI 2J0KA 1GJZA 1EO6A 2EMTA 3CSTA 3IG3A 2XEWA 2V3SA 2MBQA 1YX6B 3DVGY 2G4DB 2KXJA 3RUIB 4WAAA 1I42A 4KSKC 5J18A 2NBWB 5E6NA 3H7PB 2K1FA 2K8CA 2N4FA 4II2B 1P9DU 2O6VB 3JYUA 2ZJDA 3ZLZA 4CHKA 2PEAA 2AEHA 3OJ3A 1E5WA 1AARA 2JRHA 2JUOA 4BBNC 2LI5A 2HD5B 1P1AA 2RR9A 4RMAA 3RCZA 3ZKJC 1WX7A 2PE9A 2KMAA 2BF8B 2DZIA 4HDQA 3X0WA 2KX0A 4W9DA 3SU8X 4MSMB 4MEMA 1NDDA 4IC7B 2WYQA 2LVQA 2KO3A 2K8HA 1WY8A 4FULA 3M63B 1I35A
chains in the Genus database with same CATH superfamily
4LCDE 1DOYA 5C3JB 1FXAA 4NQKE 1XEEA 1B1ZA 1D5ZC 3JSVA 3MHSD 4KGTA 4OVVA 2INDC 2YLMA 4HWIB 1WM2A 4WWOA 3V62A 3SFEB 4W9JA 2MWSB 3VUWA 2IBIB 5BMHA 3QAQA 4LK0M 5AZGA 2BYTA 2FIDA 4RGMA 3W1SA 1L4DB 2L0TA 1UGMA 2RDBC 2EELA 1ZW7A 2LVPA 3AEFB 2QEJC 2O6VA 3WAOA 2B76B 1L2NA 4PK1A 3NG0A 2MSED 1IGCA 5CX3A 4HKQA 1QOAA 4MH0E 2WXQA 4NAMA 4E74A 2LRUA 3HK0A 5E6JA 3NUHB 3JVZX 2I1JA 3O65B 2N9EB 1LQBA 2IJ0A 1J7BA 3Q6BA 3QC8B 1OTRB 1L0XB 4HRSA 1FNUA 1I7HA 2KDEB 3MFGA 2ZCBA 3KW5B 4WWNA 4DDGD 1Z2MA 3RZWC 3N1XC 3V3XA 3H6NA 3PT2B 4JWUC 2K22A 1L6UA 1WMHA 3IVFA 4BVUC 3VFKA 2RD0A 2Z0DB 2MQJA 4RF1A 4FJZA 2PPHA 1F0ZA 3B0AA 2K6QA 3AB5A 2GB1A 3Q69A 4JL9A 5BO4B 1KJTA 4WQOB 1EWYC 1JWBD 3M3JA 4B9KA 3U52E 4BOZB 4WJQA 1XLNA 1ET6A 2CR5A 3A1QB 1XCTL 1XCQL 3WAMA 3L54A 2NR2A 2N7JA 3QX1A 1PGXA 4I6NB 1WSPA 4IWPA 2QIEB 3BWUD 3TUOA 4W9LA 5AEKB 3PLUA 1WZ3A 1ESFA 1FO4A 3B2FA 2KX3A 2N7DA 1YJJA 1OQYA 4C4VB 1YN5A 3NVYA 2LJIA 2WXFA 3PZDA 2IPKD 2SEBD 3TEZA 4NJ6A 3ZJTA 2GBMA 4ACFA 2LXAA 4L2YA 5IOIA 4MELA 3QQ8B 1J7AA 2IO3B 1E8XA 4AJWA 2IDYA 3T3OA 3CIRB 3MJWA 3NVWA 4RNAA 3RYTA 5G2NA 3WALA 3AULA 1X1MA 4C80A 3V6EB 1AW7A 4TQ0A 2M4NA 1QQRA 4KDLB 1D5MC 2MBEA 4WWPA 1TS5A 4JQWC 1SSNA 3A9JA 4P7IA 4IM2A 3PRMB 2JZ3B 4LNFA 3ML9A 1HXYD 1L5PA 2FCNA 3RNGC 3NJTA 1GG3A 2ZNVC 2JY6A 1FFUA 4XE0A 2IGHA 3CMMB 1YMHE 1WXAA 1RRBA 1CMXB 2K0PA 1Y56A 2ZCCA 4OZCA 2YEPF 3QIJA 4LNKA 5D6JB 3AXCA 4AQ7A 1KLUD 1A5RA 1ZOYB 2AQ3B 3M62B 1SBBB 4AUQC 1XF5L 2LGYA 1BXTA 1KM7A 1XXGA 4XGAB 3HIZA 2INPE 3TEXA 4K3BA 3UQAA 2MP2A 4YWGG 3GZNI 2ZVOA 2MJEA 1XD3B 2KC2A 3GP7A 4AOFA 1SE4A 4FBJB 4DK5A 4AJYB 1J0GA 1N63A 3P4PB 3WIMA 2K39A 3B9JA 3GE8C 2V9HA 1WRDB 3AE5B 4YTNB 2K9XA 3DBLB 2WXNA 3N9YC 1H4RA 1SEBD 4MT5A 3AEAB 1ZUD2 1R7SA 4ZRQA 1FRDA 1UBIA 3R8BA 2VH1A 3RNFC 3PS6A 4XDCA 1RYJA 3NZUA 1F52A 3NS8A 4ICVA 5HG2A 5JHAA 1DOXA 1V81A 3EA6A 1FIQA 4C7ZA 2WX0A 3PPAA 2NCNA 2WNMA 2WXMA 1QT9A 1YN4A 3PGEA 1QOGA 3W1YA 2KFKA 2BVCA 4N6EB 2KJHB 3RZFA 3L4PA 3U7ZA 1YD8U 5J17A 1V1PB 4B6WA 2KAJA 5EDSA 2NBVB 4KZCA 3FILB 4A20A 3TJPA 2PVOD 1C4PA 1WGYA 2BYVE 3PTFC 4XWWA 3DWMA 4FXCA 5FKAC 4EFOA 5FR6A 3VVWB 1EWCA 3SDLC 1LGRA 3ZW3A 1R4NI 4MJSA 1V6EA 4AP4C 2J0JA 3VHTC 2E6XA 1GB1A 2D2QA 2JWZA 1V5TA 3E56A 4NAWB 4YSZB 4CO7A 2K6DB 3KUZA 1J19A 1M94A 4A8XC 3IAM1 2GRIA 2JSVX 2QILA 3BVMA 2MBOA 2AWTA 1MJDA 2CHZA 1KFYB 3I57A 4JX1C 4BKSD 3VTUA 3RMKC 3AEDB 3T9LA 2TSSA 4URKA 4PS7A 5E6PA 3Q3FA 1V1OA 3TCAA 2BGFA 3D32A 5LXIB 4BFRA 4IM3A 4NJCA 2CS4A 1V8CA 4WJPA 2JT4B 4EZLA 4ZRKA 2XN9C 2ASQA 3BYYB 1IPGA 2DENB 3DDCB 4USAA 4BAXA 3BYTB 1WWTA 3DBHI 2MBQA 3RNAC 4WAAA 1I42A 1VZ7A 5E6NA 3H7PB 2K1FA 2INNE 3AE2B 3MP9A 1L0YB 1E5WA 4HEA1 1P1AA 4M00A 1WX7A 2PE9A 5EE3A 2KMAA 2BF8B 3PZ7A 1AWDA 3Q8CA 4MEMA 1NDDA 4P6VF 2KO3A 4AS1A 1HA5A 4FULA 4RF0A 3PO0A 1I35A 4J3OD 1Q1OA 1CJEA 1K53A 2KQ7A 2CJOA 3VUYA 5C1ZA 4TMAB 1T3QA 1D6EC 1C4CA 2WXIA 2C9WB 3BK2A 2D3BA 2G9HD 4IW0A 4KZ0A 4A6QA 2IGDA 3BIID 2M17A 3W1SC 2ZVNA 5D94A 5AUIA 3DPDA 4HKZE 1E10A 2LEKA 3LB8C 1F1HA 1JROA 3DBRI 3APCA 1BMLC 2WLBA 4YTMB 2L32A 1WM3A 4A90A 2I2YA 1WXSA 2PKOA 4B95A 1E8YA 2JZZA 3KH0A 4GIVA 2D5GA 4HCNB 2FUHB 2IY0B 3AE6B 1EF5A 2JYTA 1KH0A 1SE9A 2RPVA 1Q0WB 3AM9A 1DGJA 3DOWA 3HUIA 1SGHA 2D3CA 2D3AA 1E0ZA 1KRHA 3KYDD 2LRWA 2XK5B 1FM0D 2NMQA 1NYQA 3VH3B 4H2AA 2D07B 5G55A 2WWZA 3AEGB 2J4XA 5BYQA 1Q5WB 4BKTA 4HPMB 1NEKB 3AMZA 1HEZE 3A4SC 1WX8A 3EHVA 3VTWA 4WJOA 1CK1A 3OWEB 4XC2A 1P7FA 5KHQA 3VUXA 1MHXA 1LM8B 2QC8A 4LDTD 1XLQA 1TKEA 3RULA 5MPOA 3OAWA 4YL8A 1VR9A 4FHJA 2BBCA 4MM3B 4NPNA 4LJPB 4NNJB 1M4VA 4DHZB 1H8CA 4LJOB 1GC6A 1E6EB 2ON8A 2PE6B 2KJ6A 1PYWD 1R4MI 3I9V1 1SJED 4YT0B 3RNBC 5IO9A 3FAHA 2ZNVB 3QWZB 1K52A 3OLMD 1PFDA 4KDIC 3S2AA 1UELA 1ZP0B 2J53A 1UBQA 2LUMA 1AYFA 4RCOA 5DPTA 1UWXA 4DXFA 3A4RA 4F7ZA 1ZXHA 2QJLA 2OHFA 4GXBA 2I38A 2WXGA 3R3MA 1YQBA 1I4QA 4P1CC 3UGBB 2FE8A 5G5HA 1MG8A 2BKRB 3IXSA 3GS2A 3DVNV 2ZW0A 3IT6B 2BWFA 1JQ4A 1WX9A 2JF5A 5IN7A 1KF6B 4EUTA 2ZPNA 2KMMA 4PYUA 3R2IA 1JCKB 3L10B 4WQMA 4XWTA 2MJDA 2Y5BB 2KFJA 4DWFA 4B0MA 4KIKB 1T0RC 2O2VB 1I4RA 3N1YC 3OJ4B 5DCNA 1N61A 1YJIA 2X8XX 4YSXB 2L7RA 3AU5A 1CQVA 1FRRA 1DOIA 2BS4B 1FEHA 2AQ1B 3I5JC 3ZRCA 2NPTB 1TBEA 2FNJB 2N0SB 1EM7A 2KNBA 2JWUA 1TZOA 2DZMA 1E90A 3PHXB 4MGIE 1WZ0A 2FIFA 1ROEA 4L23A 3KYCD 1V1PA 2CKHB 2N9LA 4GDLA 4RGTA 4P1BC 2GBRA 1K50A 1KLGD 4RGNA 2DAFA 1D3ZA 3ZNID 1YX5B 4EE2A 3ZNZB 1L0VB 2WXHA 1GJZA 2LD9A 1WJNA 2O6VD 4W9KA 2BKFA 3B08A 3HVZA 2QMTA 1HTOA 1FXIA 1MG4A 2FCSA 3GZNB 2ZEQA 3DVNU 3JW0X 4IDIA 2UYZB 5CHWA 4W9GA 1PGBA 3ZO5B 1KOTA 4LDTB 4NAWA 3TEYA 3NS1A 1V80A 2VZKD 1T0SC 3EFUA 1VJKA 4CYEA 3HHMA 2MBBB 5TR5A 1JWAD 5JZEB 4JWSC 4N58A 4OZAA 2RMMA 3IBEA 4HJGE 3RI7C 4OVUA 4US9A 4BOSC 4NQLB 3Q8EA 1TGZB 2GBJA 2KWCA 3IHPC 3LYYA 2R61A 1MVKA 5KHOA 1P98A 3APDA 3QA8A 3SEBA 1V9JA 2L00B 3EUB2 4XDDA 3UINB 4DXAB 1UZXB 3X23A 2KHWB 5T8IA 3FKYA 2GBNA 2MRPA 4YTPB 2LJ5A 5IA7A 1HE8A 1ZPSA 5EE9A 4I6PA 5D3DA 3EECA 3R7QA 1R4NB 2Z59B 3A9KA 1S3SG 1C76A 1E7VA 3PV1A 5IKCM 2R2OA 4WURA 2N1VA 3W5UB 4XYCA 3OG5A 3KVFB 4XZ4A 2BTEA 4W9FA 1TS4A 4FN2A 1TZ1A 2RDGA 2YEPB 4HROA 1WJ6A 3U4EG 2NS5A 3N3KB 2KKCA 2HTHA 2WDRB 5DPSA 2C7MB 3W5VB 1WJ4A 4G0NB 3GOEA 1HTQA 4M01A 1T5XD 4RH6A 1Q10A 4ZRPA 3JSVB 2R2QA 3Q2AC 3PLVA 2MW5A 4ZHOA 2KTRB 1WE7A 2W54A 4LNOA 4DBGA 3Q3OC 2WP9B 4A3OA 1YJ1A 3SR6A 3U8ZA 1TJEA 4F1SA 3AE1B 3IG3A 2HJ1A 2V3SA 1YX6B 2E3TA 3DVGY 2KXJA 3P63A 2AX5A 3MHZA 2OEDA 2H88B 1B9RA 3DBHB 4II2B 1P9DU 2O6VB 2ZJDA 1QILA 2PEAA 2AEHA 2WQYB 2JRHA 2RR9A 2BS2B 3VR8B 3ZKJC 5HFYA 2DZIA 4HDQA 3X0WA 4DQOC 4W9DA 3SU8X 4YXDB 2LVQA 3M63B 2VZKB 3AV8A 1WXQA 2PMVA 4ZYNA 2HJ8A 4J6IA 1NENB 3RN9C 4HXDA 2H89B 2MCNB 5LLIA 4BKSA 2FCMA 4NJ7A 4DHJD 3MJ5A 4MH8A 4FJVB 3DHHC 1WMHB 3DHIC 2KTFA 1ENFA 3PVLA 2ZW1A 1RM6C 3UIOB 1TY2A 4TV3A 4K3CA 4Q2JA 2W3SA 4MM3A 3U30A 4W9CA 3R7RA 3Q3MC 1IBXA 1I4PA 2PJHA 3DBRB 1TKGA 4I6LB 2JZPA 2WS3B 1BUIC 2KK8A 3H1UA 4GGQA 4ZRJA 2DAJA 2KT7A 3WA0A 4K7SA 1NVID 2KD0A 3AU4A 4JPSA 1QOFA 2KACA 2KANA 2IO0B 5D7GA 2JYEA 3DCGA 2WDQB 4K1RB 1TKYA 3TL5A 1XQQA 1YQ4B 5D2MB 4KVGB 2Y5PA 2KOXA 3ZYYX 5CTRC 1GPXA 1NI2A 1JRPA 3ZJVA 2CHWA 5GMVA 4KGRA 2N1WA 4TQ1A 2C7NB 2HDEA 1TS2A 1SE2A 3HRDD 5BYSA 1Z5SB 4GU2A 3L08A 3KWLA 1GUAB 2C7HA 2DBYA 1FMAD 5AZHA 3ZVVA 1P7EA 4EZJA 4ANWA 3AE3B 1QOBA 3C8YA 1CZPA 3BK1A 1ISNA 2M0AA 4HDOA 4DDID 2L76A 1YN3A 3P4QB 3TMPB 2MBHA 4W9IA 4DHZE 1DYQA 2O2VA 4E3CA 1STEA 3CSFA 3P42A 3Q8FA 4G50A 1BT0A 2ZZPB 1MI0A 2IGGA 1F9JA 4MSQB 1R4MB 4M0WB 2KYWA 3NZSA 2WDTB 3O13A 2WXOA 3ABVB 1D5XC 5EE0A 1GNUA 4JIOU 2JVCA 1C9FA 4FLHA 3PHWB 2KDMA 2LFIA 3PREA 3RNCC 3HM3A 1OGWA 2FAZA 3DHGC 2DYBA 1E8ZA 1PDXA 1LFDA 3VXWA 2B3AA 2BWES 4BZAA 3A1QA 1OEYA 2C60A 3ZXVA 3N1ZC 2V3PA 2PLPA 1UD7A 3AE8B 4ANVA 5EE1A 4DHJB 2WXPA 4PS8A 2BB6A 3V60A 3P4SB 4JGHB 2MLBA 4FA6A 1V5OA 4PS3A 2KVZA 3K9PB 1V97A 1WE6A 2PIAA 1UWMA 3ZTDA 1EU4A 1JMLA 3N20C 4IWOA 2KJRA 4ZDVA 1FD6A 4D2KA 1VDVA 4W9HA 4GDKB 2FUG1 2GLSA 3AI5A 2LXCA 3EGRA 5HHDG 2V0GA 5JXVA 1QLBB 4C4VA 4IKGA 1I4GA 1I4XA 2YVCA 1U4AA 3QHTA 3ONSA 4DXGA 2RGFA 3TSSA 2I1KA 1FXTB 2KLGA 3SFDB 1NYRA 4RM8A 2K25A 2SAKA 4E71A 3GB1A 3GE3C 4KKJA 1D4BA 1VRAB 4EOYA 3E9SA 3WAPA 4BBNF 3W9CB 2JX5A 2XBBC 4G11A 1IYFA 5BMIA 2KFKB 4M8MA 4TKNA 1F2RI 3AN1A 1T0YA 3C19A 2ZPYA 4TSSA 1T0QC 4ANUA 2GI9A 1ZXIA 3ALBA 2KMCA 4ARCA 3UIPB 1WXVA 2M56B 3A33B 5LNK1 1OQRA 1OFFA 3HM6X 3VQIA 5FR3A 3K9OB 5CHVC 2ONQA 2A5UA 2KWUB 2KN5A 4HCPB 4ANXA 2PW9A 4EEWA 4EKUA 4UDUC 4MJSB 2KLCA 2WDVB 2AQ2B 3BINA 3MC9A 2CU3A 3CF6E 1V2YA 5DPRA 4QAYA 1SIJA 4WH4A 1ZDXA 1L6VA 2WXKA 4CQNA 1UH6A 4WJNA 2WU2B 1EF1A 3AEEB 4P16A 3Q3JA 3FC4A 2BB5A 2LGIA 5IP4D 5I4DA 3Q8BA 2QSDA 4YSYB 4G3XB 1ZDVA 1VZ8A 2WXJA 1K8RB 1JALA 4KSLC 2RSUA 3NRZA 1F2RC 4M8NA 2M8SA 1C77A 4IM0A 3URYA 1WGDA 1N60A 3WANA 2M1MA 4WWMA 4BKGA 1FFVA 3ETRA 4IOIE 4ZOHC 2G1EA 3Q3NC 3MC0B 2KTRA 4HK2A 3KUCB 2KWVB 2N9XA 3B2GA 2J42A 1MHHE 4N9F4 2KZRA 1RLFA 2DLBA 4ARIA 2WHIA 2N7EA 4ASWC 1TTNA 3L17A 2KDIA 3APFA 4HPLB 1WJUA 1L7YA 3ZGZA 2EKEC 2OJRA 2KDBA 1IGDA 1KTKA 2GOWA 2NTSA 1ACCA 2DX5B 4LLGM 5L83A 2L1AA 2RPQA 3SHQA 3KLSX 2KQSA 3Q8AA 4MDKE 3WCQA 2BYEA 3ENEA 3DBSA 1SJHD 1TYGB 1F77A 3AE9B 1C1YB 2MH7A 3NHEB 3EC8A 3FILA 3UI3A 1YOVB 2LHDA 1J7CA 3I63C 2BYFA 4ZYSA 1SF0A 4RGOS 2HE7A 2WXLA 3P2BA 3ZRFA 4HPPA 4N59A 4A3PA 3W2DA 3HVDA 2N9KA 2PTLA 5TSSA 2L05A 1IUEA 3SD5A 3AE4B 4S17A 3NVZA 2UWQA 2J0KA 4OZBA 1EO6A 2EMTA 2XEWA 2LGSA 2RDHA 2G4DB 4KX6B 3RUIB 4KSKC 5J18A 2FBWB 1FCLA 5C2TB 2ICIA 3OJ3A 5G5GA 2J52A 2JUOA 4BBNC 2LI5A 2HD5B 3CWIA 1GOZA 4RMAA 2WYQA 3BZDB 2ACZB 2K8HA 2W3RA 4MGKE 4K7WA 3TEWA 4GLSC 1MFWA 3LJ3A 1Y8RC 2L3ZA 4FJYA 3BY4B 3R2TA 1GC7A 2DZJA 2JXXA 3PSEB 1ZE3D 5H92C 2MJ3A 1OQQA 2BS3B 5LXHA 3ML8A 3KWVA 2JU6X 2BPSA 3KUDB 1N6ZA 2AL6A 3VRBB 1I4HA 3QARA 3H7PA 4OW0A 1N5XA 3ZNGC 3ZUNA 2Y5CA 2UU7A 2V3NA 2BT6A 4GMVA 2BW2A 3QJZA 1A70A 3BVZA 2DHZA 3RPFC 2IZVB 3VAWA 2G3QB 4LTUA 3B1LX 2KC1A 1WGRA 1UUPA 1XLOA 1E7UA 3ZXRA 1WYGA 5H8YE 1TS3A 4M0WA 1AN8A 1RFKA 1WIAA 3ZQ4A 5DPWA 1IP9A 4GN1A 4IWQA 2CJNA 1RAXA 4KGSA 1PGAA 1WGKA 1YIWA 1YNTE 1NBFC 3KQ4A 1V49A 4ZRIA 2L83A 2LASA 1WR1A 3ZJUA 4X57B 1KLVA 1C4AA 4K7UA 5E6OA 2DNFA 2V4IB 3IAS1 3QK0A 4KKIA 2M19A 5HI1A 4LNIA 4O1NA 4KV2A 2QDFA 1T6BX 2EKIA 3AEBB 3MC8A 1WGGA 1VLBA 1XLPA 5CHFA 3L16A 1V86A 3VH4B 5FK9C 2DWQA 1FCCC 4GDKA 2DYMA 1EU3A 1FNWA 3LDZE 2AYOB 1P0RA 4US8A 2J0MA 2XK5A 3RD2A 1ZGUB 2VH2A 3H9DA 2KQ4X 3LXFA 2W55A 3ZTCA 3ZDMC 1C3TA 5JH5C 2IY1B 2WXRA 3T3NA 1LXDA 3U2SC 5IAAC 1UNSA 1VCBA 1NI3A 3AE7B 4A55A 4M02A 3VRAB 4WAFA 3R66C 5BYRA 2L52A 3P1MA 2KDFB 1L4ZB 4II3B 1XT9B 2NBUA 1WRIA 4GDLB 1UGJA 2KWDA 2D3GA 4GSWA 2LWPA 2Q5WD 3H8HA 1J8CA 1WXMA 5D3IB 2M0XA 1E9MA 2W9NA 1QF6A 3VDZA 2KVRA 4MGYE 3J9CA 3DVGX 3IFWB 1WF9A 4HJKA 4A9AA 1SIFA 3RNEC 3RFZB 2OJWA 3ECIA 3EFCA 2G45B 2KN4A 5AUKA 2LGDA 1SXTA 4PYZA 5L95C 2QHOA 1GB4A 3BVGA 1QZEA 1C79A 2L0FA 3PZ8A 2BQQA 3N32A 4HLEA 2CU1A 2JPHA 4TUUA 5AZFA 2IYDB 1E8WA 1N5WA 2FCQA 4OHJA 3DQVA 4C00A 4IG7B 2LVOA 1P3QU 2LUEA 2MHJA 2W82A 2EMSA 2WX1A 3V61A 3T8MA 1WR6E 2J7QB 4PT5A 1LO5D 1PUTA 4AWJA 4W9EA 3DBLI 2LMCA 4JLCA 4ICUA 4MGZE 2REXA 3I3TB 3A9JB 2NVUI 3VTVA 2MA9B 2JQRB 2MX2A 4HVBA 2X38A 3IT4B 1WH3A 1SE3A 4JE3B 4NZLB 2IO1B 2IO2B 1ZKHA 4KIKA 2WGSA 3MTNB 2QCZA 2D10A 4GOCA 3L13A 3ZNHB 2N9PC 3A9KB 3H7SA 2NPTA 3NZ3A 1RWSA 1TY0A 5BMGA 1WYWB 2PVGC 5JHBA 2L8JA 3C0RB 1HQRD 1MPEA 2Y3AA 4XX5A 2LZ6A 3ZDTA 2LHEA 1TT5B 2LGXA 3U7DA 3ZIMA 2K8BA 3TIXA 2Z0EB 4FHKA 1RFAA 3TBLD 4ITKA 4L1BA 2MEKA 2MP2B 1JWUD 2Z8LA 1HZ6A 3UQBA 5C23A 2A4ZA 3M95A 2NTTA 1FNVA 3P4RB 4RFBA 2G4SA 1HZ5A 3NY5A 2GMIC 2AL3A 1EUVB 3RT3B 2D11A 1VD2A 3NOBA 4C7YA 3L0WB 4NY0A 4RM9A 4GB9A 1N62A 1WGHA 1OEYJ 5J2RA 4LNNA 2VRRB 1SB3C 3PRPB 5HKHA 1JRUA 1PQSA 1K51A 1C78A 3DWGC 3N30A 3V6CB 3QCAA 4K81A 3VR9B 2JXTA 1JWSD 2V1YA 3AECB 4REZA 1VZ6A 3PRZA 1XO3A 2C5LC 1G6JA 4IUMB 1JWMD 2OOBB 5GXGB 4EZKA 1WI0A 1E7PB 2DZKA 2HTME 3UF8A 1WFYA 4ZHPA 4S0RA 4C56C 2V4LA 1ET9A 2CHXA 1S1QB 2GBKA 2K3UA 2WU5B 2DYOA 2JRIB 4F8CB 4FADA 2K5PA 3CSTA 3NVVA 4WIPA 1GAQB 1YQ3B 3V05A 2XNAC 2NBWB 4B0EA 1TIFA 1IBXB 2K8CA 2N4FA 4MACA 3AH7A 3JYUA 1FPYA 3ZLZA 4CHKA 1AARA 3RCZA 1JW9D 1UF0A 4R3DA 3Q14C 2KX0A 4MSMB 4OVZA 4IC7B 1WY8A 2INCC 1QKZA
chains in the Genus database with same CATH topology
4LCDE 4MGKE 1Q1OA 4K7WA 4NQKE 4ZYNA 2HJ8A 3LJ3A 1Y8RC 2L3ZA 4FJYA 2KQ7A 3BY4B 4J6IA 3VUYA 5C1ZA 3JSVA 3MHSD 1GC7A 4HXDA 2DZJA 4OVVA 2JXXA 2YLMA 4HWIB 2MCNB 3PSEB 5LLIA 4BKSA 1WM2A 4WWOA 2FCMA 4NJ7A 3V62A 4DHJD 2C9WB 4IW0A 4KZ0A 4W9JA 4FJVB 2MWSB 1WMHB 5LXHA 2M17A 3W1SC 2ZVNA 2KTFA 5D94A 3VUWA 3ML8A 3DPDA 2IBIB 3PVLA 3QAQA 3UIOB 4TV3A 2BPSA 5AZGA 3DBRI 2FIDA 3APCA 3KUDB 3W1SA 2L0TA 4MM3A 3U30A 4W9CA 1UGMA 2AL6A 3R7RA 3QARA 3H7PA 1WM3A 1ZW7A 2LVPA 3ZNGC 3ZUNA 2O6VA 2PJHA 3WAOA 1L2NA 4GMVA 2MSED 3QJZA 5CX3A 4I6LB 1WXSA 4MH0E 4B95A 1E8YA 2JZZA 3KH0A 4GIVA 4E74A 4HCNB 2DHZA 2FUHB 2LRUA 3HK0A 2KK8A 2IY0B 3H1UA 2IZVB 3VAWA 4GGQA 1EF5A 2G3QB 3JVZX 2I1JA 4ZRJA 3O65B 2N9EB 3B1LX 1LQBA 1SE9A 2DAJA 2KC1A 1WGRA 1Q0WB 3WA0A 3DOWA 1E7UA 4K7SA 1SGHA 3QC8B 1OTRB 2KD0A 3AU4A 3KYDD 1WIAA 2KDEB 2LRWA 2XK5B 2ZCBA 2KANA 3KW5B 1Z2MA 4WWNA 3RZWC 4DDGD 5DPWA 1IP9A 2IO0B 4GN1A 4IWQA 1RAXA 3H6NA 3PT2B 5D7GA 3DCGA 3VH3B 1YIWA 2D07B 1NBFC 4K1RB 1V49A 4ZRIA 3TL5A 1XQQA 5D2MB 2LASA 1WMHA 4KVGB 5G55A 1WR1A 2KOXA 3IVFA 4X57B 5CTRC 4BVUC 1NI2A 3VFKA 2RD0A 2WWZA 4BKTA 1KLVA 1Q5WB 2Z0DB 4HPMB 2MQJA 4K7UA 4FJZA 2CHWA 1WX8A 3A4SC 3EHVA 5GMVA 3VTWA 2PPHA 4WJOA 5E6OA 2N1WA 4TQ1A 3B0AA 2C7NB 4XC2A 3QK0A 5KHQA 3VUXA 2K6QA 4JL9A 5BO4B 1KJTA 4WQOB 1LM8B 4KV2A 1Z5SB 4GU2A 3M3JA 4LDTD 4B9KA 4BOZB 4WJQA 3L08A 3RULA 2CR5A 1GUAB 3OAWA 3A1QB 2C7HA 4YL8A 4FHJA 1WGGA 4NPNA 5CHFA 3L54A 4LJPB 4NNJB 3WAMA 3L16A 1V86A 2NR2A 5AZHA 3ZVVA 4EZJA 4ANWA 3VH4B 4DHZB 3QX1A 1ISNA 4I6NB 1H8CA 4GDKA 4HDOA 2DYMA 4DDID 3LDZE 4LJOB 2L76A 1GC6A 3TMPB 4IWPA 2MBHA 4W9IA 4W9LA 4DHZE 5AEKB 2PE6B 1WZ3A 2O2VA 2KJ6A 3PLUA 4E3CA 2AYOB 3CSFA 1P0RA 1R4MI 2J0MA 4G50A 1BT0A 2ZZPB 2KX3A 2N7DA 2ZNVB 1F9JA 1OQYA 2XK5A 3QWZB 4MSQB 3RD2A 1ZGUB 3OLMD 4KDIC 3H9DA 3S2AA 4M0WB 1UELA 3PZDA 3NZSA 3ZTCA 2WDTB 1UBQA 4NJ6A 2GBMA 5DPTA 2LXAA 3ZDMC 1C3TA 5JH5C 1GNUA 2IY1B 4JIOU 4MELA 1LXDA 2JVCA 3A4RA 5IAAC 3QQ8B 4FLHA 2IO3B 1VCBA 3PHWB 1E8XA 4AJWA 4F7ZA 3PREA 4GXBA 3HM3A 3R66C 1OGWA 2FAZA 3R3MA 2DYBA 1E8ZA 3MJWA 2KDFB 1LFDA 4II3B 3RYTA 1YQBA 1XT9B 5G2NA 3WALA 3AULA 1X1MA 2NBUA 4GDLB 3V6EB 3VXWA 2B3AA 3UGBB 2BWES 3A1QA 4TQ0A 2M4NA 2D3GA 1OEYA 2C60A 1MG8A 2BKRB 4KDLB 1UD7A 2MBEA 4GSWA 4ANVA 3DVNV 4WWPA 4DHJB 4PS8A 2LWPA 4JQWC 3A9JA 2BWFA 3V60A 1WX9A 2JF5A 4JGHB 4IM2A 4P7IA 2MLBA 3PRMB 4FA6A 2JZ3B 1V5OA 4PS3A 3ML9A 3K9PB 1WE6A 1J8CA 3ZTDA 2ZPNA 2FCNA 4EUTA 4IWOA 4PYUA 1WXMA 2KJRA 4ZDVA 1GG3A 2ZNVC 2M0XA 2W9NA 3L10B 4W9HA 2JY6A 3VDZA 2KVRA 4MGYE 4GDKB 3DVGX 2Y5BB 3IFWB 3AI5A 2KFJA 2LXCA 1WF9A 4HJKA 4DWFA 1SIFA 4KIKB 3CMMB 3ECIA 2O2VB 1WXAA 3OJ4B 5DCNA 1RRBA 1CMXB 2YVCA 2G45B 1U4AA 3QHTA 2LGDA 3ONSA 2RGFA 2ZCCA 4PYZA 5L95C 2I1KA 1FXTB 2KLGA 2L7RA 3AU5A 2QHOA 1QZEA 2L0FA 3QIJA 4RM8A 3ZRCA 2K25A 4E71A 2NPTB 5D6JB 1TBEA 2FNJB 3AXCA 1A5RA 3N32A 4EOYA 4HLEA 3WAPA 2CU1A 2JPHA 2KNBA 2DZMA 4BBNF 3M62B 1E90A 3PHXB 2XBBC 4MGIE 1WZ0A 4AUQC 2FIFA 4TUUA 2LGYA 4G11A 2IYDB 1E8WA 3KYCD 5AZFA 1IYFA 2CKHB 2FCQA 3DQVA 4GDLA 1KM7A 2KFKB 4M8MA 4TKNA 4IG7B 2LVOA 2GBRA 1P3QU 3HIZA 2LUEA 1T0YA 2EMSA 2ZPYA 2DAFA 4ANUA 2WX1A 3V61A 3UQAA 2MP2A 3T8MA 1D3ZA 1WR6E 3ZNID 3ALBA 1YX5B 2KMCA 3GZNI 2J7QB 2ZVOA 3UIPB 3ZNZB 1WXVA 3A33B 4AWJA 4W9EA 3DBLI 3HM6X 3VQIA 1XD3B 2KC2A 4ICUA 4JLCA 4MGZE 4AOFA 2REXA 3I3TB 2LD9A 1WJNA 2O6VD 3K9OB 2BKFA 2NVUI 3A9JB 3B08A 4W9KA 5CHVC 3VTVA 2MA9B 2FCSA 2MX2A 4AJYB 4DK5A 4FBJB 3WIMA 1J0GA 2K39A 2ZEQA 2A5UA 2KWUB 3DVNU 1WRDB 2KN5A 3JW0X 4HCPB 2UYZB 4HVBA 5CHWA 4ANXA 1WH3A 4W9GA 4EEWA 1H4RA 4EKUA 2IO1B 3ZO5B 1KOTA 2IO2B 1ZKHA 4KIKA 4LDTB 4NAWA 4MJSB 1UBIA 2KLCA 3BINA 3CF6E 1V2YA 3MTNB 5DPRA 2D10A 4GOCA 1V80A 3L13A 3ZNHB 3PS6A 1UH6A 4WJNA 2N9PC 1EF1A 3NZUA 3A9KB 3H7SA 3NS8A 4ICVA 5JHAA 2NPTA 3Q3JA 1V81A 3EFUA 4CYEA 1WYWB 2WX0A 5JHBA 3PPAA 3HHMA 2MBBB 2L8JA 2NCNA 4G3XB 5TR5A 3C0RB 1K8RB 5JZEB 3PGEA 3W1YA 4KSLC 2KFKA 2RSUA 2KJHB 4XX5A 2LZ6A 3RZFA 3ZDTA 4M8NA 2M8SA 4IM0A 3IBEA 2LGXA 3U7DA 1YD8U 1WGDA 3WANA 4OVUA 3ZIMA 5J17A 2M1MA 2K8BA 4BKGA 4B6WA 4NQLB 4BOSC 5EDSA 2NBVB 3TIXA 2Z0EB 4FHKA 4KZCA 1RFAA 3TBLD 4A20A 1TGZB 3TJPA 2GBJA 2KWCA 3IHPC 2KTRA 1WGYA 4HK2A 2BYVE 3KUCB 2MP2B 1P98A 3PTFC 5KHOA 3APDA 2KWVB 3QA8A 2N9XA 3UQBA 5C23A 2A4ZA 4N9F4 2KZRA 4EFOA 1RLFA 1V9JA 2L00B 5FR6A 2N7EA 3VVWB 3SDLC 3UINB 4ASWC 4DXAB 1TTNA 1UZXB 3L17A 2KDIA 3APFA 3M95A 4HPLB 3X23A 3ZW3A 1R4NI 1WJUA 2KHWB 1L7YA 1V6EA 2GBNA 4MJSA 2EKEC 2MRPA 2OJRA 2KDBA 2G4SA 4AP4C 2J0JA 3NY5A 3VHTC 2GMIC 2LJ5A 5IA7A 1HE8A 2AL3A 1EUVB 3RT3B 2D2QA 4I6PA 2JWZA 3EECA 2D11A 3R7QA 1V5TA 4NAWB 4CO7A 2GOWA 2Z59B 3A9KA 2K6DB 1VD2A 3KUZA 3NOBA 1S3SG 3L0WB 4NY0A 2DX5B 1J19A 1E7VA 3PV1A 4RM9A 5L83A 2R2OA 1WGHA 4GB9A 1OEYJ 5J2RA 2N1VA 2VRRB 2RPQA 3PRPB 1M94A 5HKHA 3SHQA 3KVFB 4XZ4A 4W9FA 1JRUA 1PQSA 2KQSA 4MDKE 2MBOA 4FN2A 2AWTA 1TZ1A 1WJ6A 2CHZA 3N30A 3V6CB 2BYEA 3QCAA 2NS5A 3ENEA 4K81A 3VTUA 3DBSA 4BKSD 3N3KB 3T9LA 2KKCA 2HTHA 2V1YA 5DPSA 2C7MB 1WJ4A 1C1YB 4G0NB 4URKA 4PS7A 3GOEA 3NHEB 5E6PA 3EC8A 3Q3FA 3PRZA 2C5LC 3TCAA 2BGFA 4IUMB 1G6JA 3D32A 2OOBB 5LXIB 4BFRA 4IM3A 2CS4A 2BYFA 3JSVB 2R2QA 4EZKA 3PLVA 1WI0A 2DZKA 2MW5A 3UF8A 2HE7A 3P2BA 2JT4B 4WJPA 4EZLA 3ZRFA 2KTRB 1WFYA 1WE7A 4ZRKA 4A3PA 2V4LA 2ASQA 4DBGA 1IPGA 1S1QB 2CHXA 2GBKA 4A3OA 1YJ1A 2DENB 2DYOA 3DDCB 2JRIB 2L05A 3U8ZA 3SD5A 4F8CB 4F1SA 2UWQA 4FADA 3DBHI 2J0KA 1GJZA 1EO6A 2EMTA 3CSTA 3IG3A 2XEWA 2V3SA 2MBQA 1YX6B 3DVGY 2G4DB 2KXJA 3RUIB 4WAAA 1I42A 4KSKC 5J18A 2NBWB 5E6NA 3H7PB 2K1FA 2K8CA 2N4FA 4II2B 1P9DU 2O6VB 3JYUA 2ZJDA 3ZLZA 4CHKA 2PEAA 2AEHA 3OJ3A 1E5WA 1AARA 2JRHA 2JUOA 4BBNC 2LI5A 2HD5B 1P1AA 2RR9A 4RMAA 3RCZA 3ZKJC 1WX7A 2PE9A 2KMAA 2BF8B 2DZIA 4HDQA 3X0WA 2KX0A 4W9DA 3SU8X 4MSMB 4MEMA 1NDDA 4IC7B 2WYQA 2LVQA 2KO3A 2K8HA 1WY8A 4FULA 3M63B 1I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCD E;  4MGK E;  1Q1O A;  4K7W A;  4NQK E;  4ZYN A;  2HJ8 A;  3LJ3 A;  1Y8R C;  2L3Z A;  4FJY A;  2KQ7 A;  3BY4 B;  4J6I A;  3VUY A;  5C1Z A;  3JSV A;  3MHS D;  1GC7 A;  4HXD A;  2DZJ A;  4OVV A;  2JXX A;  2YLM A;  4HWI B;  2MCN B;  3PSE B;  5LLI A;  4BKS A;  1WM2 A;  4WWO A;  2FCM A;  4NJ7 A;  3V62 A;  4DHJ D;  2C9W B;  4IW0 A;  4KZ0 A;  4W9J A;  4FJV B;  2MWS B;  1WMH B;  5LXH A;  2M17 A;  3W1S C;  2ZVN A;  2KTF A;  5D94 A;  3VUW A;  3ML8 A;  3DPD A;  2IBI B;  3PVL A;  3QAQ A;  3UIO B;  4TV3 A;  2BPS A;  5AZG A;  3DBR I;  2FID A;  3APC A;  3KUD B;  3W1S A;  2L0T A;  4MM3 A;  3U30 A;  4W9C A;  1UGM A;  2AL6 A;  3R7R A;  3QAR A;  3H7P A;  1WM3 A;  1ZW7 A;  2LVP A;  3ZNG C;  3ZUN A;  2O6V A;  2PJH A;  3WAO A;  1L2N A;  4GMV A;  2MSE D;  3QJZ A;  5CX3 A;  4I6L B;  1WXS A;  4MH0 E;  4B95 A;  1E8Y A;  2JZZ A;  3KH0 A;  4GIV A;  4E74 A;  4HCN B;  2DHZ A;  2FUH B;  2LRU A;  3HK0 A;  2KK8 A;  2IY0 B;  3H1U A;  2IZV B;  3VAW A;  4GGQ A;  1EF5 A;  2G3Q B;  3JVZ X;  2I1J A;  4ZRJ A;  3O65 B;  2N9E B;  3B1L X;  1LQB A;  1SE9 A;  2DAJ A;  2KC1 A;  1WGR A;  1Q0W B;  3WA0 A;  3DOW A;  1E7U A;  4K7S A;  1SGH A;  3QC8 B;  1OTR B;  2KD0 A;  3AU4 A;  3KYD D;  1WIA A;  2KDE B;  2LRW A;  2XK5 B;  2ZCB A;  2KAN A;  3KW5 B;  1Z2M A;  4WWN A;  3RZW C;  4DDG D;  5DPW A;  1IP9 A;  2IO0 B;  4GN1 A;  4IWQ A;  1RAX A;  3H6N A;  3PT2 B;  5D7G A;  3DCG A;  3VH3 B;  1YIW A;  2D07 B;  1NBF C;  4K1R B;  1V49 A;  4ZRI A;  3TL5 A;  1XQQ A;  5D2M B;  2LAS A;  1WMH A;  4KVG B;  5G55 A;  1WR1 A;  2KOX A;  3IVF A;  4X57 B;  5CTR C;  4BVU C;  1NI2 A;  3VFK A;  2RD0 A;  2WWZ A;  4BKT A;  1KLV A;  1Q5W B;  2Z0D B;  4HPM B;  2MQJ A;  4K7U A;  4FJZ A;  2CHW A;  1WX8 A;  3A4S C;  3EHV A;  5GMV A;  3VTW A;  2PPH A;  4WJO A;  5E6O A;  2N1W A;  4TQ1 A;  3B0A A;  2C7N B;  4XC2 A;  3QK0 A;  5KHQ A;  3VUX A;  2K6Q A;  4JL9 A;  5BO4 B;  1KJT A;  4WQO B;  1LM8 B;  4KV2 A;  1Z5S B;  4GU2 A;  3M3J A;  4LDT D;  4B9K A;  4BOZ B;  4WJQ A;  3L08 A;  3RUL A;  2CR5 A;  1GUA B;  3OAW A;  3A1Q B;  2C7H A;  4YL8 A;  4FHJ A;  1WGG A;  4NPN A;  5CHF A;  3L54 A;  4LJP B;  4NNJ B;  3WAM A;  3L16 A;  1V86 A;  2NR2 A;  5AZH A;  3ZVV A;  4EZJ A;  4ANW A;  3VH4 B;  4DHZ B;  3QX1 A;  1ISN A;  4I6N B;  1H8C A;  4GDK A;  4HDO A;  2DYM A;  4DDI D;  3LDZ E;  4LJO B;  2L76 A;  1GC6 A;  3TMP B;  4IWP A;  2MBH A;  4W9I A;  4W9L A;  4DHZ E;  5AEK B;  2PE6 B;  1WZ3 A;  2O2V A;  2KJ6 A;  3PLU A;  4E3C A;  2AYO B;  3CSF A;  1P0R A;  1R4M I;  2J0M A;  4G50 A;  1BT0 A;  2ZZP B;  2KX3 A;  2N7D A;  2ZNV B;  1F9J A;  1OQY A;  2XK5 A;  3QWZ B;  4MSQ B;  3RD2 A;  1ZGU B;  3OLM D;  4KDI C;  3H9D A;  3S2A A;  4M0W B;  1UEL A;  3PZD A;  3NZS A;  3ZTC A;  2WDT B;  1UBQ A;  4NJ6 A;  2GBM A;  5DPT A;  2LXA A;  3ZDM C;  1C3T A;  5JH5 C;  1GNU A;  2IY1 B;  4JIO U;  4MEL A;  1LXD A;  2JVC A;  3A4R A;  5IAA C;  3QQ8 B;  4FLH A;  2IO3 B;  1VCB A;  3PHW B;  1E8X A;  4AJW A;  4F7Z A;  3PRE A;  4GXB A;  3HM3 A;  3R66 C;  1OGW A;  2FAZ A;  3R3M A;  2DYB A;  1E8Z A;  3MJW A;  2KDF B;  1LFD A;  4II3 B;  3RYT A;  1YQB A;  1XT9 B;  5G2N A;  3WAL A;  3AUL A;  1X1M A;  2NBU A;  4GDL B;  3V6E B;  3VXW A;  2B3A A;  3UGB B;  2BWE S;  3A1Q A;  4TQ0 A;  2M4N A;  2D3G A;  1OEY A;  2C60 A;  1MG8 A;  2BKR B;  4KDL B;  1UD7 A;  2MBE A;  4GSW A;  4ANV A;  3DVN V;  4WWP A;  4DHJ B;  4PS8 A;  2LWP A;  4JQW C;  3A9J A;  2BWF A;  3V60 A;  1WX9 A;  2JF5 A;  4JGH B;  4IM2 A;  4P7I A;  2MLB A;  3PRM B;  4FA6 A;  2JZ3 B;  1V5O A;  4PS3 A;  3ML9 A;  3K9P B;  1WE6 A;  1J8C A;  3ZTD A;  2ZPN A;  2FCN A;  4EUT A;  4IWO A;  4PYU A;  1WXM A;  2KJR A;  4ZDV A;  1GG3 A;  2ZNV C;  2M0X A;  2W9N A;  3L10 B;  4W9H A;  2JY6 A;  3VDZ A;  2KVR A;  4MGY E;  4GDK B;  3DVG X;  2Y5B B;  3IFW B;  3AI5 A;  2KFJ A;  2LXC A;  1WF9 A;  4HJK A;  4DWF A;  1SIF A;  4KIK B;  3CMM B;  3ECI A;  2O2V B;  1WXA A;  3OJ4 B;  5DCN A;  1RRB A;  1CMX B;  2YVC A;  2G45 B;  1U4A A;  3QHT A;  2LGD A;  3ONS A;  2RGF A;  2ZCC A;  4PYZ A;  5L95 C;  2I1K A;  1FXT B;  2KLG A;  2L7R A;  3AU5 A;  2QHO A;  1QZE A;  2L0F A;  3QIJ A;  4RM8 A;  3ZRC A;  2K25 A;  4E71 A;  2NPT B;  5D6J B;  1TBE A;  2FNJ B;  3AXC A;  1A5R A;  3N32 A;  4EOY A;  4HLE A;  3WAP A;  2CU1 A;  2JPH A;  2KNB A;  2DZM A;  4BBN F;  3M62 B;  1E90 A;  3PHX B;  2XBB C;  4MGI E;  1WZ0 A;  4AUQ C;  2FIF A;  4TUU A;  2LGY A;  4G11 A;  2IYD B;  1E8W A;  3KYC D;  5AZF A;  1IYF A;  2CKH B;  2FCQ A;  3DQV A;  4GDL A;  1KM7 A;  2KFK B;  4M8M A;  4TKN A;  4IG7 B;  2LVO A;  2GBR A;  1P3Q U;  3HIZ A;  2LUE A;  1T0Y A;  2EMS A;  2ZPY A;  2DAF A;  4ANU A;  2WX1 A;  3V61 A;  3UQA A;  2MP2 A;  3T8M A;  1D3Z A;  1WR6 E;  3ZNI D;  3ALB A;  1YX5 B;  2KMC A;  3GZN I;  2J7Q B;  2ZVO A;  3UIP B;  3ZNZ B;  1WXV A;  3A33 B;  4AWJ A;  4W9E A;  3DBL I;  3HM6 X;  3VQI A;  1XD3 B;  2KC2 A;  4ICU A;  4JLC A;  4MGZ E;  4AOF A;  2REX A;  3I3T B;  2LD9 A;  1WJN A;  2O6V D;  3K9O B;  2BKF A;  2NVU I;  3A9J B;  3B08 A;  4W9K A;  5CHV C;  3VTV A;  2MA9 B;  2FCS A;  2MX2 A;  4AJY B;  4DK5 A;  4FBJ B;  3WIM A;  1J0G A;  2K39 A;  2ZEQ A;  2A5U A;  2KWU B;  3DVN U;  1WRD B;  2KN5 A;  3JW0 X;  4HCP B;  2UYZ B;  4HVB A;  5CHW A;  4ANX A;  1WH3 A;  4W9G A;  4EEW A;  1H4R A;  4EKU A;  2IO1 B;  3ZO5 B;  1KOT A;  2IO2 B;  1ZKH A;  4KIK A;  4LDT B;  4NAW A;  4MJS B;  1UBI A;  2KLC A;  3BIN A;  3CF6 E;  1V2Y A;  3MTN B;  5DPR A;  2D10 A;  4GOC A;  1V80 A;  3L13 A;  3ZNH B;  3PS6 A;  1UH6 A;  4WJN A;  2N9P C;  1EF1 A;  3NZU A;  3A9K B;  3H7S A;  3NS8 A;  4ICV A;  5JHA A;  2NPT A;  3Q3J A;  1V81 A;  3EFU A;  4CYE A;  1WYW B;  2WX0 A;  5JHB A;  3PPA A;  3HHM A;  2MBB B;  2L8J A;  2NCN A;  4G3X B;  5TR5 A;  3C0R B;  1K8R B;  5JZE B;  3PGE A;  3W1Y A;  4KSL C;  2KFK A;  2RSU A;  2KJH B;  4XX5 A;  2LZ6 A;  3RZF A;  3ZDT A;  4M8N A;  2M8S A;  4IM0 A;  3IBE A;  2LGX A;  3U7D A;  1YD8 U;  1WGD A;  3WAN A;  4OVU A;  3ZIM A;  5J17 A;  2M1M A;  2K8B A;  4BKG A;  4B6W A;  4NQL B;  4BOS C;  5EDS A;  2NBV B;  3TIX A;  2Z0E B;  4FHK A;  4KZC A;  1RFA A;  3TBL D;  4A20 A;  1TGZ B;  3TJP A;  2GBJ A;  2KWC A;  3IHP C;  2KTR A;  1WGY A;  4HK2 A;  2BYV E;  3KUC B;  2MP2 B;  1P98 A;  3PTF C;  5KHO A;  3APD A;  2KWV B;  3QA8 A;  2N9X A;  3UQB A;  5C23 A;  2A4Z A;  4N9F 4;  2KZR A;  4EFO A;  1RLF A;  1V9J A;  2L00 B;  5FR6 A;  2N7E A;  3VVW B;  3SDL C;  3UIN B;  4ASW C;  4DXA B;  1TTN A;  1UZX B;  3L17 A;  2KDI A;  3APF A;  3M95 A;  4HPL B;  3X23 A;  3ZW3 A;  1R4N I;  1WJU A;  2KHW B;  1L7Y A;  1V6E A;  2GBN A;  4MJS A;  2EKE C;  2MRP A;  2OJR A;  2KDB A;  2G4S A;  4AP4 C;  2J0J A;  3NY5 A;  3VHT C;  2GMI C;  2LJ5 A;  5IA7 A;  1HE8 A;  2AL3 A;  1EUV B;  3RT3 B;  2D2Q A;  4I6P A;  2JWZ A;  3EEC A;  2D11 A;  3R7Q A;  1V5T A;  4NAW B;  4CO7 A;  2GOW A;  2Z59 B;  3A9K A;  2K6D B;  1VD2 A;  3KUZ A;  3NOB A;  1S3S G;  3L0W B;  4NY0 A;  2DX5 B;  1J19 A;  1E7V A;  3PV1 A;  4RM9 A;  5L83 A;  2R2O A;  1WGH A;  4GB9 A;  1OEY J;  5J2R A;  2N1V A;  2VRR B;  2RPQ A;  3PRP B;  1M94 A;  5HKH A;  3SHQ A;  3KVF B;  4XZ4 A;  4W9F A;  1JRU A;  1PQS A;  2KQS A;  4MDK E;  2MBO A;  4FN2 A;  2AWT A;  1TZ1 A;  1WJ6 A;  2CHZ A;  3N30 A;  3V6C B;  2BYE A;  3QCA A;  2NS5 A;  3ENE A;  4K81 A;  3VTU A;  3DBS A;  4BKS D;  3N3K B;  3T9L A;  2KKC A;  2HTH A;  2V1Y A;  5DPS A;  2C7M B;  1WJ4 A;  1C1Y B;  4G0N B;  4URK A;  4PS7 A;  3GOE A;  3NHE B;  5E6P A;  3EC8 A;  3Q3F A;  3PRZ A;  2C5L C;  3TCA A;  2BGF A;  4IUM B;  1G6J A;  3D32 A;  2OOB B;  5LXI B;  4BFR A;  4IM3 A;  2CS4 A;  2BYF A;  3JSV B;  2R2Q A;  4EZK A;  3PLV A;  1WI0 A;  2DZK A;  2MW5 A;  3UF8 A;  2HE7 A;  3P2B A;  2JT4 B;  4WJP A;  4EZL A;  3ZRF A;  2KTR B;  1WFY A;  1WE7 A;  4ZRK A;  4A3P A;  2V4L A;  2ASQ A;  4DBG A;  1IPG A;  1S1Q B;  2CHX A;  2GBK A;  4A3O A;  1YJ1 A;  2DEN B;  2DYO A;  3DDC B;  2JRI B;  2L05 A;  3U8Z A;  3SD5 A;  4F8C B;  4F1S A;  2UWQ A;  4FAD A;  3DBH I;  2J0K A;  1GJZ A;  1EO6 A;  2EMT A;  3CST A;  3IG3 A;  2XEW A;  2V3S A;  2MBQ A;  1YX6 B;  3DVG Y;  2G4D B;  2KXJ A;  3RUI B;  4WAA A;  1I42 A;  4KSK C;  5J18 A;  2NBW B;  5E6N A;  3H7P B;  2K1F A;  2K8C A;  2N4F A;  4II2 B;  1P9D U;  2O6V B;  3JYU A;  2ZJD A;  3ZLZ A;  4CHK A;  2PEA A;  2AEH A;  3OJ3 A;  1E5W A;  1AAR A;  2JRH A;  2JUO A;  4BBN C;  2LI5 A;  2HD5 B;  1P1A A;  2RR9 A;  4RMA A;  3RCZ A;  3ZKJ C;  1WX7 A;  2PE9 A;  2KMA A;  2BF8 B;  2DZI A;  4HDQ A;  3X0W A;  2KX0 A;  4W9D A;  3SU8 X;  4MSM B;  4MEM A;  1NDD A;  4IC7 B;  2WYQ A;  2LVQ A;  2KO3 A;  2K8H A;  1WY8 A;  4FUL A;  3M63 B;  1I35 A; 
#chains in the Genus database with same CATH topology
 4LCD E;  1DOY A;  5C3J B;  1FXA A;  4NQK E;  1XEE A;  1B1Z A;  1D5Z C;  3JSV A;  3MHS D;  4KGT A;  4OVV A;  2IND C;  2YLM A;  4HWI B;  1WM2 A;  4WWO A;  3V62 A;  3SFE B;  4W9J A;  2MWS B;  3VUW A;  2IBI B;  5BMH A;  3QAQ A;  4LK0 M;  5AZG A;  2BYT A;  2FID A;  4RGM A;  3W1S A;  1L4D B;  2L0T A;  1UGM A;  2RDB C;  2EEL A;  1ZW7 A;  2LVP A;  3AEF B;  2QEJ C;  2O6V A;  3WAO A;  2B76 B;  1L2N A;  4PK1 A;  3NG0 A;  2MSE D;  1IGC A;  5CX3 A;  4HKQ A;  1QOA A;  4MH0 E;  2WXQ A;  4NAM A;  4E74 A;  2LRU A;  3HK0 A;  5E6J A;  3NUH B;  3JVZ X;  2I1J A;  3O65 B;  2N9E B;  1LQB A;  2IJ0 A;  1J7B A;  3Q6B A;  3QC8 B;  1OTR B;  1L0X B;  4HRS A;  1FNU A;  1I7H A;  2KDE B;  3MFG A;  2ZCB A;  3KW5 B;  4WWN A;  4DDG D;  1Z2M A;  3RZW C;  3N1X C;  3V3X A;  3H6N A;  3PT2 B;  4JWU C;  2K22 A;  1L6U A;  1WMH A;  3IVF A;  4BVU C;  3VFK A;  2RD0 A;  2Z0D B;  2MQJ A;  4RF1 A;  4FJZ A;  2PPH A;  1F0Z A;  3B0A A;  2K6Q A;  3AB5 A;  2GB1 A;  3Q69 A;  4JL9 A;  5BO4 B;  1KJT A;  4WQO B;  1EWY C;  1JWB D;  3M3J A;  4B9K A;  3U52 E;  4BOZ B;  4WJQ A;  1XLN A;  1ET6 A;  2CR5 A;  3A1Q B;  1XCT L;  1XCQ L;  3WAM A;  3L54 A;  2NR2 A;  2N7J A;  3QX1 A;  1PGX A;  4I6N B;  1WSP A;  4IWP A;  2QIE B;  3BWU D;  3TUO A;  4W9L A;  5AEK B;  3PLU A;  1WZ3 A;  1ESF A;  1FO4 A;  3B2F A;  2KX3 A;  2N7D A;  1YJJ A;  1OQY A;  4C4V B;  1YN5 A;  3NVY A;  2LJI A;  2WXF A;  3PZD A;  2IPK D;  2SEB D;  3TEZ A;  4NJ6 A;  3ZJT A;  2GBM A;  4ACF A;  2LXA A;  4L2Y A;  5IOI A;  4MEL A;  3QQ8 B;  1J7A A;  2IO3 B;  1E8X A;  4AJW A;  2IDY A;  3T3O A;  3CIR B;  3MJW A;  3NVW A;  4RNA A;  3RYT A;  5G2N A;  3WAL A;  3AUL A;  1X1M A;  4C80 A;  3V6E B;  1AW7 A;  4TQ0 A;  2M4N A;  1QQR A;  4KDL B;  1D5M C;  2MBE A;  4WWP A;  1TS5 A;  4JQW C;  1SSN A;  3A9J A;  4P7I A;  4IM2 A;  3PRM B;  2JZ3 B;  4LNF A;  3ML9 A;  1HXY D;  1L5P A;  2FCN A;  3RNG C;  3NJT A;  1GG3 A;  2ZNV C;  2JY6 A;  1FFU A;  4XE0 A;  2IGH A;  3CMM B;  1YMH E;  1WXA A;  1RRB A;  1CMX B;  2K0P A;  1Y56 A;  2ZCC A;  4OZC A;  2YEP F;  3QIJ A;  4LNK A;  5D6J B;  3AXC A;  4AQ7 A;  1KLU D;  1A5R A;  1ZOY B;  2AQ3 B;  3M62 B;  1SBB B;  4AUQ C;  1XF5 L;  2LGY A;  1BXT A;  1KM7 A;  1XXG A;  4XGA B;  3HIZ A;  2INP E;  3TEX A;  4K3B A;  3UQA A;  2MP2 A;  4YWG G;  3GZN I;  2ZVO A;  2MJE A;  1XD3 B;  2KC2 A;  3GP7 A;  4AOF A;  1SE4 A;  4FBJ B;  4DK5 A;  4AJY B;  1J0G A;  1N63 A;  3P4P B;  3WIM A;  2K39 A;  3B9J A;  3GE8 C;  2V9H A;  1WRD B;  3AE5 B;  4YTN B;  2K9X A;  3DBL B;  2WXN A;  3N9Y C;  1H4R A;  1SEB D;  4MT5 A;  3AEA B;  1ZUD 2;  1R7S A;  4ZRQ A;  1FRD A;  1UBI A;  3R8B A;  2VH1 A;  3RNF C;  3PS6 A;  4XDC A;  1RYJ A;  3NZU A;  1F52 A;  3NS8 A;  4ICV A;  5HG2 A;  5JHA A;  1DOX A;  1V81 A;  3EA6 A;  1FIQ A;  4C7Z A;  2WX0 A;  3PPA A;  2NCN A;  2WNM A;  2WXM A;  1QT9 A;  1YN4 A;  3PGE A;  1QOG A;  3W1Y A;  2KFK A;  2BVC A;  4N6E B;  2KJH B;  3RZF A;  3L4P A;  3U7Z A;  1YD8 U;  5J17 A;  1V1P B;  4B6W A;  2KAJ A;  5EDS A;  2NBV B;  4KZC A;  3FIL B;  4A20 A;  3TJP A;  2PVO D;  1C4P A;  1WGY A;  2BYV E;  3PTF C;  4XWW A;  3DWM A;  4FXC A;  5FKA C;  4EFO A;  5FR6 A;  3VVW B;  1EWC A;  3SDL C;  1LGR A;  3ZW3 A;  1R4N I;  4MJS A;  1V6E A;  4AP4 C;  2J0J A;  3VHT C;  2E6X A;  1GB1 A;  2D2Q A;  2JWZ A;  1V5T A;  3E56 A;  4NAW B;  4YSZ B;  4CO7 A;  2K6D B;  3KUZ A;  1J19 A;  1M94 A;  4A8X C;  3IAM 1;  2GRI A;  2JSV X;  2QIL A;  3BVM A;  2MBO A;  2AWT A;  1MJD A;  2CHZ A;  1KFY B;  3I57 A;  4JX1 C;  4BKS D;  3VTU A;  3RMK C;  3AED B;  3T9L A;  2TSS A;  4URK A;  4PS7 A;  5E6P A;  3Q3F A;  1V1O A;  3TCA A;  2BGF A;  3D32 A;  5LXI B;  4BFR A;  4IM3 A;  4NJC A;  2CS4 A;  1V8C A;  4WJP A;  2JT4 B;  4EZL A;  4ZRK A;  2XN9 C;  2ASQ A;  3BYY B;  1IPG A;  2DEN B;  3DDC B;  4USA A;  4BAX A;  3BYT B;  1WWT A;  3DBH I;  2MBQ A;  3RNA C;  4WAA A;  1I42 A;  1VZ7 A;  5E6N A;  3H7P B;  2K1F A;  2INN E;  3AE2 B;  3MP9 A;  1L0Y B;  1E5W A;  4HEA 1;  1P1A A;  4M00 A;  1WX7 A;  2PE9 A;  5EE3 A;  2KMA A;  2BF8 B;  3PZ7 A;  1AWD A;  3Q8C A;  4MEM A;  1NDD A;  4P6V F;  2KO3 A;  4AS1 A;  1HA5 A;  4FUL A;  4RF0 A;  3PO0 A;  1I35 A;  4J3O D;  1Q1O A;  1CJE A;  1K53 A;  2KQ7 A;  2CJO A;  3VUY A;  5C1Z A;  4TMA B;  1T3Q A;  1D6E C;  1C4C A;  2WXI A;  2C9W B;  3BK2 A;  2D3B A;  2G9H D;  4IW0 A;  4KZ0 A;  4A6Q A;  2IGD A;  3BII D;  2M17 A;  3W1S C;  2ZVN A;  5D94 A;  5AUI A;  3DPD A;  4HKZ E;  1E10 A;  2LEK A;  3LB8 C;  1F1H A;  1JRO A;  3DBR I;  3APC A;  1BML C;  2WLB A;  4YTM B;  2L32 A;  1WM3 A;  4A90 A;  2I2Y A;  1WXS A;  2PKO A;  4B95 A;  1E8Y A;  2JZZ A;  3KH0 A;  4GIV A;  2D5G A;  4HCN B;  2FUH B;  2IY0 B;  3AE6 B;  1EF5 A;  2JYT A;  1KH0 A;  1SE9 A;  2RPV A;  1Q0W B;  3AM9 A;  1DGJ A;  3DOW A;  3HUI A;  1SGH A;  2D3C A;  2D3A A;  1E0Z A;  1KRH A;  3KYD D;  2LRW A;  2XK5 B;  1FM0 D;  2NMQ A;  1NYQ A;  3VH3 B;  4H2A A;  2D07 B;  5G55 A;  2WWZ A;  3AEG B;  2J4X A;  5BYQ A;  1Q5W B;  4BKT A;  4HPM B;  1NEK B;  3AMZ A;  1HEZ E;  3A4S C;  1WX8 A;  3EHV A;  3VTW A;  4WJO A;  1CK1 A;  3OWE B;  4XC2 A;  1P7F A;  5KHQ A;  3VUX A;  1MHX A;  1LM8 B;  2QC8 A;  4LDT D;  1XLQ A;  1TKE A;  3RUL A;  5MPO A;  3OAW A;  4YL8 A;  1VR9 A;  4FHJ A;  2BBC A;  4MM3 B;  4NPN A;  4LJP B;  4NNJ B;  1M4V A;  4DHZ B;  1H8C A;  4LJO B;  1GC6 A;  1E6E B;  2ON8 A;  2PE6 B;  2KJ6 A;  1PYW D;  1R4M I;  3I9V 1;  1SJE D;  4YT0 B;  3RNB C;  5IO9 A;  3FAH A;  2ZNV B;  3QWZ B;  1K52 A;  3OLM D;  1PFD A;  4KDI C;  3S2A A;  1UEL A;  1ZP0 B;  2J53 A;  1UBQ A;  2LUM A;  1AYF A;  4RCO A;  5DPT A;  1UWX A;  4DXF A;  3A4R A;  4F7Z A;  1ZXH A;  2QJL A;  2OHF A;  4GXB A;  2I38 A;  2WXG A;  3R3M A;  1YQB A;  1I4Q A;  4P1C C;  3UGB B;  2FE8 A;  5G5H A;  1MG8 A;  2BKR B;  3IXS A;  3GS2 A;  3DVN V;  2ZW0 A;  3IT6 B;  2BWF A;  1JQ4 A;  1WX9 A;  2JF5 A;  5IN7 A;  1KF6 B;  4EUT A;  2ZPN A;  2KMM A;  4PYU A;  3R2I A;  1JCK B;  3L10 B;  4WQM A;  4XWT A;  2MJD A;  2Y5B B;  2KFJ A;  4DWF A;  4B0M A;  4KIK B;  1T0R C;  2O2V B;  1I4R A;  3N1Y C;  3OJ4 B;  5DCN A;  1N61 A;  1YJI A;  2X8X X;  4YSX B;  2L7R A;  3AU5 A;  1CQV A;  1FRR A;  1DOI A;  2BS4 B;  1FEH A;  2AQ1 B;  3I5J C;  3ZRC A;  2NPT B;  1TBE A;  2FNJ B;  2N0S B;  1EM7 A;  2KNB A;  2JWU A;  1TZO A;  2DZM A;  1E90 A;  3PHX B;  4MGI E;  1WZ0 A;  2FIF A;  1ROE A;  4L23 A;  3KYC D;  1V1P A;  2CKH B;  2N9L A;  4GDL A;  4RGT A;  4P1B C;  2GBR A;  1K50 A;  1KLG D;  4RGN A;  2DAF A;  1D3Z A;  3ZNI D;  1YX5 B;  4EE2 A;  3ZNZ B;  1L0V B;  2WXH A;  1GJZ A;  2LD9 A;  1WJN A;  2O6V D;  4W9K A;  2BKF A;  3B08 A;  3HVZ A;  2QMT A;  1HTO A;  1FXI A;  1MG4 A;  2FCS A;  3GZN B;  2ZEQ A;  3DVN U;  3JW0 X;  4IDI A;  2UYZ B;  5CHW A;  4W9G A;  1PGB A;  3ZO5 B;  1KOT A;  4LDT B;  4NAW A;  3TEY A;  3NS1 A;  1V80 A;  2VZK D;  1T0S C;  3EFU A;  1VJK A;  4CYE A;  3HHM A;  2MBB B;  5TR5 A;  1JWA D;  5JZE B;  4JWS C;  4N58 A;  4OZA A;  2RMM A;  3IBE A;  4HJG E;  3RI7 C;  4OVU A;  4US9 A;  4BOS C;  4NQL B;  3Q8E A;  1TGZ B;  2GBJ A;  2KWC A;  3IHP C;  3LYY A;  2R61 A;  1MVK A;  5KHO A;  1P98 A;  3APD A;  3QA8 A;  3SEB A;  1V9J A;  2L00 B;  3EUB 2;  4XDD A;  3UIN B;  4DXA B;  1UZX B;  3X23 A;  2KHW B;  5T8I A;  3FKY A;  2GBN A;  2MRP A;  4YTP B;  2LJ5 A;  5IA7 A;  1HE8 A;  1ZPS A;  5EE9 A;  4I6P A;  5D3D A;  3EEC A;  3R7Q A;  1R4N B;  2Z59 B;  3A9K A;  1S3S G;  1C76 A;  1E7V A;  3PV1 A;  5IKC M;  2R2O A;  4WUR A;  2N1V A;  3W5U B;  4XYC A;  3OG5 A;  3KVF B;  4XZ4 A;  2BTE A;  4W9F A;  1TS4 A;  4FN2 A;  1TZ1 A;  2RDG A;  2YEP B;  4HRO A;  1WJ6 A;  3U4E G;  2NS5 A;  3N3K B;  2KKC A;  2HTH A;  2WDR B;  5DPS A;  2C7M B;  3W5V B;  1WJ4 A;  4G0N B;  3GOE A;  1HTQ A;  4M01 A;  1T5X D;  4RH6 A;  1Q10 A;  4ZRP A;  3JSV B;  2R2Q A;  3Q2A C;  3PLV A;  2MW5 A;  4ZHO A;  2KTR B;  1WE7 A;  2W54 A;  4LNO A;  4DBG A;  3Q3O C;  2WP9 B;  4A3O A;  1YJ1 A;  3SR6 A;  3U8Z A;  1TJE A;  4F1S A;  3AE1 B;  3IG3 A;  2HJ1 A;  2V3S A;  1YX6 B;  2E3T A;  3DVG Y;  2KXJ A;  3P63 A;  2AX5 A;  3MHZ A;  2OED A;  2H88 B;  1B9R A;  3DBH B;  4II2 B;  1P9D U;  2O6V B;  2ZJD A;  1QIL A;  2PEA A;  2AEH A;  2WQY B;  2JRH A;  2RR9 A;  2BS2 B;  3VR8 B;  3ZKJ C;  5HFY A;  2DZI A;  4HDQ A;  3X0W A;  4DQO C;  4W9D A;  3SU8 X;  4YXD B;  2LVQ A;  3M63 B;  2VZK B;  3AV8 A;  1WXQ A;  2PMV A;  4ZYN A;  2HJ8 A;  4J6I A;  1NEN B;  3RN9 C;  4HXD A;  2H89 B;  2MCN B;  5LLI A;  4BKS A;  2FCM A;  4NJ7 A;  4DHJ D;  3MJ5 A;  4MH8 A;  4FJV B;  3DHH C;  1WMH B;  3DHI C;  2KTF A;  1ENF A;  3PVL A;  2ZW1 A;  1RM6 C;  3UIO B;  1TY2 A;  4TV3 A;  4K3C A;  4Q2J A;  2W3S A;  4MM3 A;  3U30 A;  4W9C A;  3R7R A;  3Q3M C;  1IBX A;  1I4P A;  2PJH A;  3DBR B;  1TKG A;  4I6L B;  2JZP A;  2WS3 B;  1BUI C;  2KK8 A;  3H1U A;  4GGQ A;  4ZRJ A;  2DAJ A;  2KT7 A;  3WA0 A;  4K7S A;  1NVI D;  2KD0 A;  3AU4 A;  4JPS A;  1QOF A;  2KAC A;  2KAN A;  2IO0 B;  5D7G A;  2JYE A;  3DCG A;  2WDQ B;  4K1R B;  1TKY A;  3TL5 A;  1XQQ A;  1YQ4 B;  5D2M B;  4KVG B;  2Y5P A;  2KOX A;  3ZYY X;  5CTR C;  1GPX A;  1NI2 A;  1JRP A;  3ZJV A;  2CHW A;  5GMV A;  4KGR A;  2N1W A;  4TQ1 A;  2C7N B;  2HDE A;  1TS2 A;  1SE2 A;  3HRD D;  5BYS A;  1Z5S B;  4GU2 A;  3L08 A;  3KWL A;  1GUA B;  2C7H A;  2DBY A;  1FMA D;  5AZH A;  3ZVV A;  1P7E A;  4EZJ A;  4ANW A;  3AE3 B;  1QOB A;  3C8Y A;  1CZP A;  3BK1 A;  1ISN A;  2M0A A;  4HDO A;  4DDI D;  2L76 A;  1YN3 A;  3P4Q B;  3TMP B;  2MBH A;  4W9I A;  4DHZ E;  1DYQ A;  2O2V A;  4E3C A;  1STE A;  3CSF A;  3P42 A;  3Q8F A;  4G50 A;  1BT0 A;  2ZZP B;  1MI0 A;  2IGG A;  1F9J A;  4MSQ B;  1R4M B;  4M0W B;  2KYW A;  3NZS A;  2WDT B;  3O13 A;  2WXO A;  3ABV B;  1D5X C;  5EE0 A;  1GNU A;  4JIO U;  2JVC A;  1C9F A;  4FLH A;  3PHW B;  2KDM A;  2LFI A;  3PRE A;  3RNC C;  3HM3 A;  1OGW A;  2FAZ A;  3DHG C;  2DYB A;  1E8Z A;  1PDX A;  1LFD A;  3VXW A;  2B3A A;  2BWE S;  4BZA A;  3A1Q A;  1OEY A;  2C60 A;  3ZXV A;  3N1Z C;  2V3P A;  2PLP A;  1UD7 A;  3AE8 B;  4ANV A;  5EE1 A;  4DHJ B;  2WXP A;  4PS8 A;  2BB6 A;  3V60 A;  3P4S B;  4JGH B;  2MLB A;  4FA6 A;  1V5O A;  4PS3 A;  2KVZ A;  3K9P B;  1V97 A;  1WE6 A;  2PIA A;  1UWM A;  3ZTD A;  1EU4 A;  1JML A;  3N20 C;  4IWO A;  2KJR A;  4ZDV A;  1FD6 A;  4D2K A;  1VDV A;  4W9H A;  4GDK B;  2FUG 1;  2GLS A;  3AI5 A;  2LXC A;  3EGR A;  5HHD G;  2V0G A;  5JXV A;  1QLB B;  4C4V A;  4IKG A;  1I4G A;  1I4X A;  2YVC A;  1U4A A;  3QHT A;  3ONS A;  4DXG A;  2RGF A;  3TSS A;  2I1K A;  1FXT B;  2KLG A;  3SFD B;  1NYR A;  4RM8 A;  2K25 A;  2SAK A;  4E71 A;  3GB1 A;  3GE3 C;  4KKJ A;  1D4B A;  1VRA B;  4EOY A;  3E9S A;  3WAP A;  4BBN F;  3W9C B;  2JX5 A;  2XBB C;  4G11 A;  1IYF A;  5BMI A;  2KFK B;  4M8M A;  4TKN A;  1F2R I;  3AN1 A;  1T0Y A;  3C19 A;  2ZPY A;  4TSS A;  1T0Q C;  4ANU A;  2GI9 A;  1ZXI A;  3ALB A;  2KMC A;  4ARC A;  3UIP B;  1WXV A;  2M56 B;  3A33 B;  5LNK 1;  1OQR A;  1OFF A;  3HM6 X;  3VQI A;  5FR3 A;  3K9O B;  5CHV C;  2ONQ A;  2A5U A;  2KWU B;  2KN5 A;  4HCP B;  4ANX A;  2PW9 A;  4EEW A;  4EKU A;  4UDU C;  4MJS B;  2KLC A;  2WDV B;  2AQ2 B;  3BIN A;  3MC9 A;  2CU3 A;  3CF6 E;  1V2Y A;  5DPR A;  4QAY A;  1SIJ A;  4WH4 A;  1ZDX A;  1L6V A;  2WXK A;  4CQN A;  1UH6 A;  4WJN A;  2WU2 B;  1EF1 A;  3AEE B;  4P16 A;  3Q3J A;  3FC4 A;  2BB5 A;  2LGI A;  5IP4 D;  5I4D A;  3Q8B A;  2QSD A;  4YSY B;  4G3X B;  1ZDV A;  1VZ8 A;  2WXJ A;  1K8R B;  1JAL A;  4KSL C;  2RSU A;  3NRZ A;  1F2R C;  4M8N A;  2M8S A;  1C77 A;  4IM0 A;  3URY A;  1WGD A;  1N60 A;  3WAN A;  2M1M A;  4WWM A;  4BKG A;  1FFV A;  3ETR A;  4IOI E;  4ZOH C;  2G1E A;  3Q3N C;  3MC0 B;  2KTR A;  4HK2 A;  3KUC B;  2KWV B;  2N9X A;  3B2G A;  2J42 A;  1MHH E;  4N9F 4;  2KZR A;  1RLF A;  2DLB A;  4ARI A;  2WHI A;  2N7E A;  4ASW C;  1TTN A;  3L17 A;  2KDI A;  3APF A;  4HPL B;  1WJU A;  1L7Y A;  3ZGZ A;  2EKE C;  2OJR A;  2KDB A;  1IGD A;  1KTK A;  2GOW A;  2NTS A;  1ACC A;  2DX5 B;  4LLG M;  5L83 A;  2L1A A;  2RPQ A;  3SHQ A;  3KLS X;  2KQS A;  3Q8A A;  4MDK E;  3WCQ A;  2BYE A;  3ENE A;  3DBS A;  1SJH D;  1TYG B;  1F77 A;  3AE9 B;  1C1Y B;  2MH7 A;  3NHE B;  3EC8 A;  3FIL A;  3UI3 A;  1YOV B;  2LHD A;  1J7C A;  3I63 C;  2BYF A;  4ZYS A;  1SF0 A;  4RGO S;  2HE7 A;  2WXL A;  3P2B A;  3ZRF A;  4HPP A;  4N59 A;  4A3P A;  3W2D A;  3HVD A;  2N9K A;  2PTL A;  5TSS A;  2L05 A;  1IUE A;  3SD5 A;  3AE4 B;  4S17 A;  3NVZ A;  2UWQ A;  2J0K A;  4OZB A;  1EO6 A;  2EMT A;  2XEW A;  2LGS A;  2RDH A;  2G4D B;  4KX6 B;  3RUI B;  4KSK C;  5J18 A;  2FBW B;  1FCL A;  5C2T B;  2ICI A;  3OJ3 A;  5G5G A;  2J52 A;  2JUO A;  4BBN C;  2LI5 A;  2HD5 B;  3CWI A;  1GOZ A;  4RMA A;  2WYQ A;  3BZD B;  2ACZ B;  2K8H A;  2W3R A;  4MGK E;  4K7W A;  3TEW A;  4GLS C;  1MFW A;  3LJ3 A;  1Y8R C;  2L3Z A;  4FJY A;  3BY4 B;  3R2T A;  1GC7 A;  2DZJ A;  2JXX A;  3PSE B;  1ZE3 D;  5H92 C;  2MJ3 A;  1OQQ A;  2BS3 B;  5LXH A;  3ML8 A;  3KWV A;  2JU6 X;  2BPS A;  3KUD B;  1N6Z A;  2AL6 A;  3VRB B;  1I4H A;  3QAR A;  3H7P A;  4OW0 A;  1N5X A;  3ZNG C;  3ZUN A;  2Y5C A;  2UU7 A;  2V3N A;  2BT6 A;  4GMV A;  2BW2 A;  3QJZ A;  1A70 A;  3BVZ A;  2DHZ A;  3RPF C;  2IZV B;  3VAW A;  2G3Q B;  4LTU A;  3B1L X;  2KC1 A;  1WGR A;  1UUP A;  1XLO A;  1E7U A;  3ZXR A;  1WYG A;  5H8Y E;  1TS3 A;  4M0W A;  1AN8 A;  1RFK A;  1WIA A;  3ZQ4 A;  5DPW A;  1IP9 A;  4GN1 A;  4IWQ A;  2CJN A;  1RAX A;  4KGS A;  1PGA A;  1WGK A;  1YIW A;  1YNT E;  1NBF C;  3KQ4 A;  1V49 A;  4ZRI A;  2L83 A;  2LAS A;  1WR1 A;  3ZJU A;  4X57 B;  1KLV A;  1C4A A;  4K7U A;  5E6O A;  2DNF A;  2V4I B;  3IAS 1;  3QK0 A;  4KKI A;  2M19 A;  5HI1 A;  4LNI A;  4O1N A;  4KV2 A;  2QDF A;  1T6B X;  2EKI A;  3AEB B;  3MC8 A;  1WGG A;  1VLB A;  1XLP A;  5CHF A;  3L16 A;  1V86 A;  3VH4 B;  5FK9 C;  2DWQ A;  1FCC C;  4GDK A;  2DYM A;  1EU3 A;  1FNW A;  3LDZ E;  2AYO B;  1P0R A;  4US8 A;  2J0M A;  2XK5 A;  3RD2 A;  1ZGU B;  2VH2 A;  3H9D A;  2KQ4 X;  3LXF A;  2W55 A;  3ZTC A;  3ZDM C;  1C3T A;  5JH5 C;  2IY1 B;  2WXR A;  3T3N A;  1LXD A;  3U2S C;  5IAA C;  1UNS A;  1VCB A;  1NI3 A;  3AE7 B;  4A55 A;  4M02 A;  3VRA B;  4WAF A;  3R66 C;  5BYR A;  2L52 A;  3P1M A;  2KDF B;  1L4Z B;  4II3 B;  1XT9 B;  2NBU A;  1WRI A;  4GDL B;  1UGJ A;  2KWD A;  2D3G A;  4GSW A;  2LWP A;  2Q5W D;  3H8H A;  1J8C A;  1WXM A;  5D3I B;  2M0X A;  1E9M A;  2W9N A;  1QF6 A;  3VDZ A;  2KVR A;  4MGY E;  3J9C A;  3DVG X;  3IFW B;  1WF9 A;  4HJK A;  4A9A A;  1SIF A;  3RNE C;  3RFZ B;  2OJW A;  3ECI A;  3EFC A;  2G45 B;  2KN4 A;  5AUK A;  2LGD A;  1SXT A;  4PYZ A;  5L95 C;  2QHO A;  1GB4 A;  3BVG A;  1QZE A;  1C79 A;  2L0F A;  3PZ8 A;  2BQQ A;  3N32 A;  4HLE A;  2CU1 A;  2JPH A;  4TUU A;  5AZF A;  2IYD B;  1E8W A;  1N5W A;  2FCQ A;  4OHJ A;  3DQV A;  4C00 A;  4IG7 B;  2LVO A;  1P3Q U;  2LUE A;  2MHJ A;  2W82 A;  2EMS A;  2WX1 A;  3V61 A;  3T8M A;  1WR6 E;  2J7Q B;  4PT5 A;  1LO5 D;  1PUT A;  4AWJ A;  4W9E A;  3DBL I;  2LMC A;  4JLC A;  4ICU A;  4MGZ E;  2REX A;  3I3T B;  3A9J B;  2NVU I;  3VTV A;  2MA9 B;  2JQR B;  2MX2 A;  4HVB A;  2X38 A;  3IT4 B;  1WH3 A;  1SE3 A;  4JE3 B;  4NZL B;  2IO1 B;  2IO2 B;  1ZKH A;  4KIK A;  2WGS A;  3MTN B;  2QCZ A;  2D10 A;  4GOC A;  3L13 A;  3ZNH B;  2N9P C;  3A9K B;  3H7S A;  2NPT A;  3NZ3 A;  1RWS A;  1TY0 A;  5BMG A;  1WYW B;  2PVG C;  5JHB A;  2L8J A;  3C0R B;  1HQR D;  1MPE A;  2Y3A A;  4XX5 A;  2LZ6 A;  3ZDT A;  2LHE A;  1TT5 B;  2LGX A;  3U7D A;  3ZIM A;  2K8B A;  3TIX A;  2Z0E B;  4FHK A;  1RFA A;  3TBL D;  4ITK A;  4L1B A;  2MEK A;  2MP2 B;  1JWU D;  2Z8L A;  1HZ6 A;  3UQB A;  5C23 A;  2A4Z A;  3M95 A;  2NTT A;  1FNV A;  3P4R B;  4RFB A;  2G4S A;  1HZ5 A;  3NY5 A;  2GMI C;  2AL3 A;  1EUV B;  3RT3 B;  2D11 A;  1VD2 A;  3NOB A;  4C7Y A;  3L0W B;  4NY0 A;  4RM9 A;  4GB9 A;  1N62 A;  1WGH A;  1OEY J;  5J2R A;  4LNN A;  2VRR B;  1SB3 C;  3PRP B;  5HKH A;  1JRU A;  1PQS A;  1K51 A;  1C78 A;  3DWG C;  3N30 A;  3V6C B;  3QCA A;  4K81 A;  3VR9 B;  2JXT A;  1JWS D;  2V1Y A;  3AEC B;  4REZ A;  1VZ6 A;  3PRZ A;  1XO3 A;  2C5L C;  1G6J A;  4IUM B;  1JWM D;  2OOB B;  5GXG B;  4EZK A;  1WI0 A;  1E7P B;  2DZK A;  2HTM E;  3UF8 A;  1WFY A;  4ZHP A;  4S0R A;  4C56 C;  2V4L A;  1ET9 A;  2CHX A;  1S1Q B;  2GBK A;  2K3U A;  2WU5 B;  2DYO A;  2JRI B;  4F8C B;  4FAD A;  2K5P A;  3CST A;  3NVV A;  4WIP A;  1GAQ B;  1YQ3 B;  3V05 A;  2XNA C;  2NBW B;  4B0E A;  1TIF A;  1IBX B;  2K8C A;  2N4F A;  4MAC A;  3AH7 A;  3JYU A;  1FPY A;  3ZLZ A;  4CHK A;  1AAR A;  3RCZ A;  1JW9 D;  1UF0 A;  4R3D A;  3Q14 C;  2KX0 A;  4MSM B;  4OVZ A;  4IC7 B;  1WY8 A;  2INC C;  1QKZ A; 
#chains in the Genus database with same CATH homology
 4LCD E;  4MGK E;  1Q1O A;  4K7W A;  4NQK E;  4ZYN A;  2HJ8 A;  3LJ3 A;  1Y8R C;  2L3Z A;  4FJY A;  2KQ7 A;  3BY4 B;  4J6I A;  3VUY A;  5C1Z A;  3JSV A;  3MHS D;  1GC7 A;  4HXD A;  2DZJ A;  4OVV A;  2JXX A;  2YLM A;  4HWI B;  2MCN B;  3PSE B;  5LLI A;  4BKS A;  1WM2 A;  4WWO A;  2FCM A;  4NJ7 A;  3V62 A;  4DHJ D;  2C9W B;  4IW0 A;  4KZ0 A;  4W9J A;  4FJV B;  2MWS B;  1WMH B;  5LXH A;  2M17 A;  3W1S C;  2ZVN A;  2KTF A;  5D94 A;  3VUW A;  3ML8 A;  3DPD A;  2IBI B;  3PVL A;  3QAQ A;  3UIO B;  4TV3 A;  2BPS A;  5AZG A;  3DBR I;  2FID A;  3APC A;  3KUD B;  3W1S A;  2L0T A;  4MM3 A;  3U30 A;  4W9C A;  1UGM A;  2AL6 A;  3R7R A;  3QAR A;  3H7P A;  1WM3 A;  1ZW7 A;  2LVP A;  3ZNG C;  3ZUN A;  2O6V A;  2PJH A;  3WAO A;  1L2N A;  4GMV A;  2MSE D;  3QJZ A;  5CX3 A;  4I6L B;  1WXS A;  4MH0 E;  4B95 A;  1E8Y A;  2JZZ A;  3KH0 A;  4GIV A;  4E74 A;  4HCN B;  2DHZ A;  2FUH B;  2LRU A;  3HK0 A;  2KK8 A;  2IY0 B;  3H1U A;  2IZV B;  3VAW A;  4GGQ A;  1EF5 A;  2G3Q B;  3JVZ X;  2I1J A;  4ZRJ A;  3O65 B;  2N9E B;  3B1L X;  1LQB A;  1SE9 A;  2DAJ A;  2KC1 A;  1WGR A;  1Q0W B;  3WA0 A;  3DOW A;  1E7U A;  4K7S A;  1SGH A;  3QC8 B;  1OTR B;  2KD0 A;  3AU4 A;  3KYD D;  1WIA A;  2KDE B;  2LRW A;  2XK5 B;  2ZCB A;  2KAN A;  3KW5 B;  1Z2M A;  4WWN A;  3RZW C;  4DDG D;  5DPW A;  1IP9 A;  2IO0 B;  4GN1 A;  4IWQ A;  1RAX A;  3H6N A;  3PT2 B;  5D7G A;  3DCG A;  3VH3 B;  1YIW A;  2D07 B;  1NBF C;  4K1R B;  1V49 A;  4ZRI A;  3TL5 A;  1XQQ A;  5D2M B;  2LAS A;  1WMH A;  4KVG B;  5G55 A;  1WR1 A;  2KOX A;  3IVF A;  4X57 B;  5CTR C;  4BVU C;  1NI2 A;  3VFK A;  2RD0 A;  2WWZ A;  4BKT A;  1KLV A;  1Q5W B;  2Z0D B;  4HPM B;  2MQJ A;  4K7U A;  4FJZ A;  2CHW A;  1WX8 A;  3A4S C;  3EHV A;  5GMV A;  3VTW A;  2PPH A;  4WJO A;  5E6O A;  2N1W A;  4TQ1 A;  3B0A A;  2C7N B;  4XC2 A;  3QK0 A;  5KHQ A;  3VUX A;  2K6Q A;  4JL9 A;  5BO4 B;  1KJT A;  4WQO B;  1LM8 B;  4KV2 A;  1Z5S B;  4GU2 A;  3M3J A;  4LDT D;  4B9K A;  4BOZ B;  4WJQ A;  3L08 A;  3RUL A;  2CR5 A;  1GUA B;  3OAW A;  3A1Q B;  2C7H A;  4YL8 A;  4FHJ A;  1WGG A;  4NPN A;  5CHF A;  3L54 A;  4LJP B;  4NNJ B;  3WAM A;  3L16 A;  1V86 A;  2NR2 A;  5AZH A;  3ZVV A;  4EZJ A;  4ANW A;  3VH4 B;  4DHZ B;  3QX1 A;  1ISN A;  4I6N B;  1H8C A;  4GDK A;  4HDO A;  2DYM A;  4DDI D;  3LDZ E;  4LJO B;  2L76 A;  1GC6 A;  3TMP B;  4IWP A;  2MBH A;  4W9I A;  4W9L A;  4DHZ E;  5AEK B;  2PE6 B;  1WZ3 A;  2O2V A;  2KJ6 A;  3PLU A;  4E3C A;  2AYO B;  3CSF A;  1P0R A;  1R4M I;  2J0M A;  4G50 A;  1BT0 A;  2ZZP B;  2KX3 A;  2N7D A;  2ZNV B;  1F9J A;  1OQY A;  2XK5 A;  3QWZ B;  4MSQ B;  3RD2 A;  1ZGU B;  3OLM D;  4KDI C;  3H9D A;  3S2A A;  4M0W B;  1UEL A;  3PZD A;  3NZS A;  3ZTC A;  2WDT B;  1UBQ A;  4NJ6 A;  2GBM A;  5DPT A;  2LXA A;  3ZDM C;  1C3T A;  5JH5 C;  1GNU A;  2IY1 B;  4JIO U;  4MEL A;  1LXD A;  2JVC A;  3A4R A;  5IAA C;  3QQ8 B;  4FLH A;  2IO3 B;  1VCB A;  3PHW B;  1E8X A;  4AJW A;  4F7Z A;  3PRE A;  4GXB A;  3HM3 A;  3R66 C;  1OGW A;  2FAZ A;  3R3M A;  2DYB A;  1E8Z A;  3MJW A;  2KDF B;  1LFD A;  4II3 B;  3RYT A;  1YQB A;  1XT9 B;  5G2N A;  3WAL A;  3AUL A;  1X1M A;  2NBU A;  4GDL B;  3V6E B;  3VXW A;  2B3A A;  3UGB B;  2BWE S;  3A1Q A;  4TQ0 A;  2M4N A;  2D3G A;  1OEY A;  2C60 A;  1MG8 A;  2BKR B;  4KDL B;  1UD7 A;  2MBE A;  4GSW A;  4ANV A;  3DVN V;  4WWP A;  4DHJ B;  4PS8 A;  2LWP A;  4JQW C;  3A9J A;  2BWF A;  3V60 A;  1WX9 A;  2JF5 A;  4JGH B;  4IM2 A;  4P7I A;  2MLB A;  3PRM B;  4FA6 A;  2JZ3 B;  1V5O A;  4PS3 A;  3ML9 A;  3K9P B;  1WE6 A;  1J8C A;  3ZTD A;  2ZPN A;  2FCN A;  4EUT A;  4IWO A;  4PYU A;  1WXM A;  2KJR A;  4ZDV A;  1GG3 A;  2ZNV C;  2M0X A;  2W9N A;  3L10 B;  4W9H A;  2JY6 A;  3VDZ A;  2KVR A;  4MGY E;  4GDK B;  3DVG X;  2Y5B B;  3IFW B;  3AI5 A;  2KFJ A;  2LXC A;  1WF9 A;  4HJK A;  4DWF A;  1SIF A;  4KIK B;  3CMM B;  3ECI A;  2O2V B;  1WXA A;  3OJ4 B;  5DCN A;  1RRB A;  1CMX B;  2YVC A;  2G45 B;  1U4A A;  3QHT A;  2LGD A;  3ONS A;  2RGF A;  2ZCC A;  4PYZ A;  5L95 C;  2I1K A;  1FXT B;  2KLG A;  2L7R A;  3AU5 A;  2QHO A;  1QZE A;  2L0F A;  3QIJ A;  4RM8 A;  3ZRC A;  2K25 A;  4E71 A;  2NPT B;  5D6J B;  1TBE A;  2FNJ B;  3AXC A;  1A5R A;  3N32 A;  4EOY A;  4HLE A;  3WAP A;  2CU1 A;  2JPH A;  2KNB A;  2DZM A;  4BBN F;  3M62 B;  1E90 A;  3PHX B;  2XBB C;  4MGI E;  1WZ0 A;  4AUQ C;  2FIF A;  4TUU A;  2LGY A;  4G11 A;  2IYD B;  1E8W A;  3KYC D;  5AZF A;  1IYF A;  2CKH B;  2FCQ A;  3DQV A;  4GDL A;  1KM7 A;  2KFK B;  4M8M A;  4TKN A;  4IG7 B;  2LVO A;  2GBR A;  1P3Q U;  3HIZ A;  2LUE A;  1T0Y A;  2EMS A;  2ZPY A;  2DAF A;  4ANU A;  2WX1 A;  3V61 A;  3UQA A;  2MP2 A;  3T8M A;  1D3Z A;  1WR6 E;  3ZNI D;  3ALB A;  1YX5 B;  2KMC A;  3GZN I;  2J7Q B;  2ZVO A;  3UIP B;  3ZNZ B;  1WXV A;  3A33 B;  4AWJ A;  4W9E A;  3DBL I;  3HM6 X;  3VQI A;  1XD3 B;  2KC2 A;  4ICU A;  4JLC A;  4MGZ E;  4AOF A;  2REX A;  3I3T B;  2LD9 A;  1WJN A;  2O6V D;  3K9O B;  2BKF A;  2NVU I;  3A9J B;  3B08 A;  4W9K A;  5CHV C;  3VTV A;  2MA9 B;  2FCS A;  2MX2 A;  4AJY B;  4DK5 A;  4FBJ B;  3WIM A;  1J0G A;  2K39 A;  2ZEQ A;  2A5U A;  2KWU B;  3DVN U;  1WRD B;  2KN5 A;  3JW0 X;  4HCP B;  2UYZ B;  4HVB A;  5CHW A;  4ANX A;  1WH3 A;  4W9G A;  4EEW A;  1H4R A;  4EKU A;  2IO1 B;  3ZO5 B;  1KOT A;  2IO2 B;  1ZKH A;  4KIK A;  4LDT B;  4NAW A;  4MJS B;  1UBI A;  2KLC A;  3BIN A;  3CF6 E;  1V2Y A;  3MTN B;  5DPR A;  2D10 A;  4GOC A;  1V80 A;  3L13 A;  3ZNH B;  3PS6 A;  1UH6 A;  4WJN A;  2N9P C;  1EF1 A;  3NZU A;  3A9K B;  3H7S A;  3NS8 A;  4ICV A;  5JHA A;  2NPT A;  3Q3J A;  1V81 A;  3EFU A;  4CYE A;  1WYW B;  2WX0 A;  5JHB A;  3PPA A;  3HHM A;  2MBB B;  2L8J A;  2NCN A;  4G3X B;  5TR5 A;  3C0R B;  1K8R B;  5JZE B;  3PGE A;  3W1Y A;  4KSL C;  2KFK A;  2RSU A;  2KJH B;  4XX5 A;  2LZ6 A;  3RZF A;  3ZDT A;  4M8N A;  2M8S A;  4IM0 A;  3IBE A;  2LGX A;  3U7D A;  1YD8 U;  1WGD A;  3WAN A;  4OVU A;  3ZIM A;  5J17 A;  2M1M A;  2K8B A;  4BKG A;  4B6W A;  4NQL B;  4BOS C;  5EDS A;  2NBV B;  3TIX A;  2Z0E B;  4FHK A;  4KZC A;  1RFA A;  3TBL D;  4A20 A;  1TGZ B;  3TJP A;  2GBJ A;  2KWC A;  3IHP C;  2KTR A;  1WGY A;  4HK2 A;  2BYV E;  3KUC B;  2MP2 B;  1P98 A;  3PTF C;  5KHO A;  3APD A;  2KWV B;  3QA8 A;  2N9X A;  3UQB A;  5C23 A;  2A4Z A;  4N9F 4;  2KZR A;  4EFO A;  1RLF A;  1V9J A;  2L00 B;  5FR6 A;  2N7E A;  3VVW B;  3SDL C;  3UIN B;  4ASW C;  4DXA B;  1TTN A;  1UZX B;  3L17 A;  2KDI A;  3APF A;  3M95 A;  4HPL B;  3X23 A;  3ZW3 A;  1R4N I;  1WJU A;  2KHW B;  1L7Y A;  1V6E A;  2GBN A;  4MJS A;  2EKE C;  2MRP A;  2OJR A;  2KDB A;  2G4S A;  4AP4 C;  2J0J A;  3NY5 A;  3VHT C;  2GMI C;  2LJ5 A;  5IA7 A;  1HE8 A;  2AL3 A;  1EUV B;  3RT3 B;  2D2Q A;  4I6P A;  2JWZ A;  3EEC A;  2D11 A;  3R7Q A;  1V5T A;  4NAW B;  4CO7 A;  2GOW A;  2Z59 B;  3A9K A;  2K6D B;  1VD2 A;  3KUZ A;  3NOB A;  1S3S G;  3L0W B;  4NY0 A;  2DX5 B;  1J19 A;  1E7V A;  3PV1 A;  4RM9 A;  5L83 A;  2R2O A;  1WGH A;  4GB9 A;  1OEY J;  5J2R A;  2N1V A;  2VRR B;  2RPQ A;  3PRP B;  1M94 A;  5HKH A;  3SHQ A;  3KVF B;  4XZ4 A;  4W9F A;  1JRU A;  1PQS A;  2KQS A;  4MDK E;  2MBO A;  4FN2 A;  2AWT A;  1TZ1 A;  1WJ6 A;  2CHZ A;  3N30 A;  3V6C B;  2BYE A;  3QCA A;  2NS5 A;  3ENE A;  4K81 A;  3VTU A;  3DBS A;  4BKS D;  3N3K B;  3T9L A;  2KKC A;  2HTH A;  2V1Y A;  5DPS A;  2C7M B;  1WJ4 A;  1C1Y B;  4G0N B;  4URK A;  4PS7 A;  3GOE A;  3NHE B;  5E6P A;  3EC8 A;  3Q3F A;  3PRZ A;  2C5L C;  3TCA A;  2BGF A;  4IUM B;  1G6J A;  3D32 A;  2OOB B;  5LXI B;  4BFR A;  4IM3 A;  2CS4 A;  2BYF A;  3JSV B;  2R2Q A;  4EZK A;  3PLV A;  1WI0 A;  2DZK A;  2MW5 A;  3UF8 A;  2HE7 A;  3P2B A;  2JT4 B;  4WJP A;  4EZL A;  3ZRF A;  2KTR B;  1WFY A;  1WE7 A;  4ZRK A;  4A3P A;  2V4L A;  2ASQ A;  4DBG A;  1IPG A;  1S1Q B;  2CHX A;  2GBK A;  4A3O A;  1YJ1 A;  2DEN B;  2DYO A;  3DDC B;  2JRI B;  2L05 A;  3U8Z A;  3SD5 A;  4F8C B;  4F1S A;  2UWQ A;  4FAD A;  3DBH I;  2J0K A;  1GJZ A;  1EO6 A;  2EMT A;  3CST A;  3IG3 A;  2XEW A;  2V3S A;  2MBQ A;  1YX6 B;  3DVG Y;  2G4D B;  2KXJ A;  3RUI B;  4WAA A;  1I42 A;  4KSK C;  5J18 A;  2NBW B;  5E6N A;  3H7P B;  2K1F A;  2K8C A;  2N4F A;  4II2 B;  1P9D U;  2O6V B;  3JYU A;  2ZJD A;  3ZLZ A;  4CHK A;  2PEA A;  2AEH A;  3OJ3 A;  1E5W A;  1AAR A;  2JRH A;  2JUO A;  4BBN C;  2LI5 A;  2HD5 B;  1P1A A;  2RR9 A;  4RMA A;  3RCZ A;  3ZKJ C;  1WX7 A;  2PE9 A;  2KMA A;  2BF8 B;  2DZI A;  4HDQ A;  3X0W A;  2KX0 A;  4W9D A;  3SU8 X;  4MSM B;  4MEM A;  1NDD A;  4IC7 B;  2WYQ A;  2LVQ A;  2KO3 A;  2K8H A;  1WY8 A;  4FUL A;  3M63 B;  1I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...