3MTNB

Usp21 in complex with a ubiquitin-based, usp21-specific inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
HMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKWSTLFLLLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 21
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3mtnB00
2IY0B 1WE6A 3ZTCA 1GNUA 3WALA 4KDIC 2K8CA 3ML9A 4BVUC 2CKHB 4AOFA 4TQ0A 3ZRFA 3QCAA 4XZ4A 4RMAA 1J8CA 2LD9A 1X1MA 2CS4A 2J0KA 3MJWA 4IWQA 4W9HA 3RUIB 3ZNHB 2FIFA 2JZZA 4P7IA 4JL9A 4W9GA 4FHKA 2KD0A 2RPQA 1A5RA 2LXAA 3A1QA 3B1LX 3N32A 4K7UA 1J19A 2ZVNA 2DZKA 4IM0A 2GBKA 2PEAA 4HDQA 4IC7B 5DPRA 4BKTA 3K9PB 5CHVC 2GBNA 3DDCB 3JVZX 4M8MA 4ZRKA 2MP2A 2ASQA 4E71A 2K1FA 3TMPB 3WAMA 2BYVE 2KTRA 1QZEA 1TGZB 4FJVB 3MTNB 2K8BA 4F1SA 1YD8U 2KO3A 5CTRC 1I35A 3PT2B 1XD3B 2C7NB 1P1AA 3KW5B 3ZTDA 1RAXA 3QC8B 4HCNB 1Y8RC 3PRZA 1R4MI 1UBQA 1WYWB 2LGXA 4PS3A 4TV3A 3VTVA 3X0WA 3PRPB 2KDBA 4LCDE 2LVQA 3DBSA 3A4RA 4KZCA 1Q5WB 3NHEB 1YIWA 4MJSB 4EOYA 2M0XA 3R66C 4E74A 3OAWA 3U7DA 2NPTA 3DVNU 5D2MB 2L76A 3BY4B 3VH3B 3GOEA 2NBVB 1C1YB 1E7VA 2CHWA 2KFKB 2N7EA 3JSVB 3ZUNA 3L54A 3BINA 4KDLB 4B9KA 2D3GA 3KH0A 3D32A 5J17A 3S2AA 4K1RB 2WDTB 4JLCA 1CMXB 2DX5B 2YLMA 4II3B 4I6LB 4ZRJA 4EEWA 3PSEB 1WGGA 3V61A 2L0FA 2HD5B 1JRUA 3PRMB 2KLGA 3L08A 4LDTB 4MGZE 4HLEA 1SE9A 2LJ5A 2Y5BB 2LI5A 2J7QB 2R2QA 3EFUA 3KUCB 3PZDA 4GN1A 2LVPA 2ZPNA 2EKEC 3DBHI 1OTRB 1UD7A 4HCPB 3VTWA 2BKRB 1XQQA 2G45B 1YX6B 3MHSD 2Z0DB 2UYZB 4DDGD 4IG7B 2MX2A 2KDIA 2JZ3B 2JT4B 4I6NB 2WX0A 1UH6A 3I3TB 1E7UA 3K9OB 4N9F4 2LGDA 2ZNVC 3NOBA 4HK2A 3W1SA 1D3ZA 4GDLB 3CSFA 5JHBA 3ZIMA 2KJRA 3EC8A 3V60A 3Q3FA 3QA8A 4HWIB 4BKGA 2KQSA 3QWZB 1E8ZA 4IWPA 2ZNVB 5JH5C 2JWZA 4ANVA 3GZNI 2BPSA 2BGFA 2JUOA 2FCNA 1UBIA 3RZFA 4KIKB 4W9IA 3B0AA 3KYDD 3L10B 5TR5A 2O2VB 4NQKE 2BYEA 4OVUA 2KFJA 2K25A 1E5WA 1WE7A 2D11A 4M8NA 4TUUA 2M1MA 4WWOA 5AZHA 3VDZA 3ZRCA 2IYDB 2LWPA 1PQSA 4HDOA 1C3TA 2KK8A 4XC2A 2L05A 2M8SA 3L16A 5G2NA 3U30A 2GBMA 3PV1A 3TL5A 1G6JA 2ZJDA 4A3OA 4W9LA 1WX7A 3M62B 1ZW7A 2ZCBA 1EO6A 5KHQA 2FCMA 5HKHA 4AJYB 1EF1A 1UGMA 3DQVA 5J2RA 2WWZA 3DBLI 4GU2A 1WH3A 4DHJD 3Q3JA 1TZ1A 2D07B 2HTHA 4RM9A 3UQBA 4JIOU 3H1UA 4GMVA 2C7HA 3NS8A 2CR5A 5DPTA 1WM2A 3RULA 1RLFA 2GMIC 1OGWA 1YQBA 4X57B 1WZ0A 1V86A 3T8MA 3VHTC 5DCNA 1EF5A 4NNJB 5JZEB 2GBRA 3DVGY 4WAAA 2MW5A 4FADA 2FCSA 1E8WA 4NQLB 5G55A 2LVOA 2BKFA 2J0JA 2W9NA 3APCA 3P2BA 4GDKA 4IM2A 3VXWA 2IO3B 1GJZA 5LXHA 2L7RA 2D2QA 1GC7A 3A4SC 4W9JA 2Z59B 3AULA 1K8RB 2KMCA 1WI0A 3DOWA 1GC6A 1AARA 1SGHA 1F9JA 2PE9A 3QK0A 1I42A 1E90A 3VTUA 4I6PA 3DCGA 4KSLC 4NPNA 4ASWC 1UZXB 1V5TA 3QHTA 3ZW3A 2C7MB 2G3QB 1R4NI 1OEYA 3IBEA 2LRUA 1WGYA 3JW0X 5CHFA 2IO1B 2KHWB 3A1QB 5D6JB 3IFWB 2DYOA 3M3JA 3VVWB 3NZSA 2C9WB 2K6QA 2V4LA 3WIMA 4HPLB 1GG3A 2N4FA 1IP9A 1RFAA 5AZGA 2BF8B 1E8YA 3UGBB 5E6OA 2MP2B 3A9JB 4PYUA 5KHOA 2ZPYA 3RCZA 2KWVB 2KTRB 1V49A 1WGRA 4NJ7A 1P9DU 1WXVA 2J0MA 2MSED 4G11A 4AUQC 1VCBA 2KDFB 2ZCCA 5BO4B 1M94A 5E6PA 3O65B 2MBQA 2FUHB 2MBHA 2XBBC 2NBUA 4MJSA 2K39A 4LDTD 3DVNV 3UF8A 3HIZA 4TQ1A 2PPHA 2RD0A 3TJPA 1LXDA 2CHZA 2L00B 4XX5A 4MGYE 4CYEA 2KFKA 4GIVA 1WRDB 3A33B 1KJTA 3PREA 2NPTB 2NBWB 2JXXA 4F8CB 1WMHB 2NR2A 3HM3A 3NZUA 4B6WA 4ZYNA 2C60A 4URKA 1WZ3A 3HHMA 4MELA 2AEHA 3H6NA 4JGHB 5L95C 3PPAA 1ZGUB 2FNJB 4CHKA 1FXTB 2GBJA 3W1YA 2KC2A 2N7DA 1WR6E 1V6EA 3CMMB 5IA7A 3VH4B 1V81A 4BBNC 1Q1OA 4W9CA 2EMTA 4BFRA 1Z2MA 4WJOA 3ZDMC 1V9JA 1WY8A 2NS5A 3PHWB 3M95A 1WF9A 2LRWA 4EZJA 3QIJA 3A9KA 4A20A 3W1SC 3WAOA 1GUAB 3IG3A 3KVFB 5FR6A 4HVBA 4FJYA 2LUEA 4GOCA 1BT0A 3ECIA 5D94A 3UIPB 4M0WB 3VUWA 2O6VD 2DYBA 4LJOB 1J0GA 3SU8X 4IM3A 4ANXA 2O2VA 3AXCA 3QARA 3RD2A 3SDLC 2OJRA 2REXA 1WJNA 2Z0EB 3VQIA 3PGEA 1WM3A 2KJ6A 5JHAA 1WXAA 3IVFA 2IO0B 2IO2B 4YL8A 1RRBA 2N1WA 4EZLA 2G4SA 1LQBA 2ZZPB 4DWFA 3LJ3A 3L0WB 4RM8A 4FULA 4NAWA 2O6VA 2MQJA 4ZDVA 2JY6A 4IWOA 1Z5SB 4WWNA 1WR1A 4MGIE 4BBNF 2KJHB 3H7PA 2PJHA 2D10A 3L17A 3ML8A 2I1KA 3SHQA 1ZKHA 2N9XA 5GMVA 3T9LA 2MBBB 5DPWA 5CHWA 2K8HA 2ZEQA 4HJKA 3SD5A 2XK5B 2B3AA 4DHZE 2DHZA 2KXJA 1HE8A 1NBFC 2BWFA 1WIAA 1NDDA 2KN5A 4G3XB 5DPSA 2RSUA 3RT3B 1WXMA 2KC1A 2N9EB 2KANA 2LXCA 3EECA 3B08A 2K6DB 4GB9A 3ZVVA 4DK5A 4G0NB 2XEWA 1V80A 2CHXA 1YX5B 1IPGA 1S3SG 4J6IA 2AYOB 1WX9A 1S1QB 1VD2A 4BOZB 3DBRI 3OLMD 2KX3A 2A5UA 2WYQA 4GGQA 4MGKE 3X23A 5D7GA 5E6NA 4F7ZA 4KVGB 5J18A 3PLUA 2C5LC 4MDKE 2KWUB 3N30A 1ISNA 2KDEB 4DHJB 5C23A 4PS7A 1V5OA 1WJUA 4GDKB 4FA6A 2IZVB 3AI5A 2A4ZA 2L0TA 4ICUA 2LASA 3WAPA 2KMAA 3VUXA 1E8XA 2NCNA 3VFKA 4ANWA 2L3ZA 4WQOB 2V3SA 3R7RA 1H8CA 3KUDB 2KNBA 1OEYJ 4OVVA 5EDSA 4HPMB 2JRHA 3RYTA 2YVCA 4HXDA 3JYUA 3PVLA 5LXIB 2KWCA 4NY0A 1TTNA 1L2NA 2MLBA 4MM3A 1WGHA 3A9JA 2DENB 4B95A 4EUTA 2I1JA 2FAZA 2MBOA 4DXAB 2MBEA 4W9EA 4MSMB 1WX8A 3VUYA 1P3QU 2DZIA 3PTFC 2WX1A 3TBLD 3ENEA 1LM8B 4AWJA 4KV2A 4MH0E 4NJ6A 5IAAC 3C0RB 3APDA 4EZKA 4K7SA 4K81A 3JSVA 5L83A 3OJ4B 4AP4C 2DZJA 3IHPC 2KX0A 2MCNB 4TKNA 2LGYA 1H4RA 3R7QA 2PE6B 4FN2A 2G4DB 3ONSA 4IW0A 3V6EB 3QAQA 2DAJA 2AL6A 2KOXA 2KQ7A 2L8JA 1WMHA 3H7SA 3KUZA 2RR9A 2N9PC 3UIOB 3V62A 2BWES 2KVRA 3ZLZA 4CO7A 4BOSC 2VRRB 3PLVA 3M63B 4W9FA 4WJQA 4G50A 3ZNGC 1WJ6A 1KM7A 2JPHA 2AL3A 2OOBB 4JQWC 4LJPB 3EHVA 3KYCD 4K7WA 4AJWA 4MSQB 3U8ZA 4GDLA 2KLCA 1WGDA 2KKCA 5LLIA 4FLHA 2M17A 1L7YA 2CU1A 2FIDA 3AU5A 3RZWC 1IYFA 2KTFA 3PS6A 3ALBA 4WJPA 4A3PA 4FHJA 1LFDA 2GOWA 2R2OA 4GXBA 4KIKA 3DVGX 2JVCA 4E3CA 2JF5A 4ZRIA 2N1VA 4PS8A 2MRPA 3ZNID 4DDID 4FJZA 3A9KB 3WANA 3N3KB 3QX1A 4EKUA 3QQ8B 3DPDA 1EUVB 2MA9B 1WJ4A 2HJ8A 1U4AA 4W9DA 4GSWA 5AEKB 1TBEA 2HE7A 3APFA 3LDZE 3CSTA 4WJNA 4BKSD 2ZVOA 1T0YA 2UWQA 2DZMA 3PHXB 2KZRA 3CF6E 3UQAA 1KOTA 4PYZA 2EMSA 1MG8A 5CX3A 2JRIB 2FCQA 1P0RA 3ZNZB 1NI2A 3VAWA 3OJ3A 5AZFA 5C1ZA 3UINB 2MWSB 2V1YA 3QJZA 4DBGA 3AU4A 4MEMA 4II2B 4W9KA 2DAFA 2IY1B 1YJ1A 4NAWB 2O6VB 4BKSA 2M4NA 3NY5A 3TIXA 1OQYA 2XK5A 4IUMB 2DYMA 3H7PB 2BYFA 1XT9B 4KSKC 3ZKJC 2RGFA 3HK0A 2LZ6A 1P98A 3R3MA 3H9DA 4WWPA 2AWTA 4DHZB 3WA0A 1V2YA 3TCAA 1KLVA 1WFYA 4ANUA 1UELA 3V6CB 4KZ0A 4ICVA 3HM6X 2IBIB 3ZO5B 4EFOA 4FBJB 3L13A 3ZDTA 2NVUI 1SIFA 1Q0WB 1WXSA 2QHOA
chains in the Genus database with same CATH superfamily
2IY0B 1KRHA 3E9SA 1HEZE 4RMAA 3VR9B 1X1MA 2CS4A 4IWQA 3ZNHB 2J4XA 3RNBC 4FHKA 4A9AA 2L32A 1TJEA 3A1QA 3B1LX 3U4EG 1J19A 2DZKA 4IM0A 2PEAA 4ZOHC 3RNEC 3JVZX 2ASQA 1HTQA 3P4PB 1QZEA 4FJVB 3AV8A 3GB1A 4YXDB 3PT2B 1UF0A 1XD3B 3KW5B 1RAXA 3QC8B 3PRZA 2LGXA 4PS3A 3ZGZA 4LCDE 3DBSA 1D5XC 1EU4A 2PLPA 4KZCA 1YIWA 1J7BA 4MJSB 2M0XA 2NPTA 2ONQA 2AQ3B 3V3XA 3BY4B 1E7VA 2ZW1A 2CHWA 3GE8C 3L54A 2JXTA 1FEHA 5J17A 1JWSD 2YLMA 4II3B 2IGGA 1JRUA 3KUCB 1F2RI 2LVPA 2PTLA 3AE2B 1SE3A 2G45B 2UYZB 3ZXRA 4L23A 2BTEA 1IUEA 2L52A 2WX0A 4R3DA 2QIEB 3K9OB 2ZNVC 4HK2A 5EE3A 1KTKA 3CSFA 2KJRA 3V60A 3MC8A 1T0QC 4XGAB 3RPFC 4IWPA 2ZNVB 5JH5C 3GZNI 2JUOA 2WXQA 4C7YA 2BQQA 2GRIA 2BYEA 3N1YC 4OVUA 2KFJA 1T0RC 2D3AA 2D11A 2VH1A 2M1MA 5AZHA 3VDZA 3ZRCA 4HDOA 4YSZB 1PGAA 2KK8A 3L16A 3ZJTA 3PV1A 3TL5A 4C80A 2ZJDA 1WX7A 1ZW7A 1UGMA 3DQVA 5J2RA 4GU2A 2BT6A 4RM9A 1SB3C 2KACA 1FNWA 1WM2A 3RULA 1RLFA 4LK0M 1TIFA 2EKIA 3VHTC 3CIRB 4L1BA 4NNJB 1TS2A 3KWVA 2MW5A 2FCSA 1E8WA 4C7ZA 2LVOA 2BKFA 2W9NA 3MFGA 2MJEA 4JPSA 2L7RA 1GC6A 3R2IA 1I42A 1NVID 3Q8EA 1VJKA 4KSLC 3QHTA 2WXFA 3E56A 1R4NI 1OEYA 3NG0A 2KHWB 1EWYC 1L0XB 3NZSA 2K6QA 3V05A 2V4LA 1GG3A 2N4FA 3Q8CA 1DYQA 5E6OA 5IN7A 3RCZA 4D2KA 3AE8B 1V49A 1WGRA 1P9DU 1WXVA 2J0MA 4AUQC 1I7HA 1HQRD 2KDFB 5BO4B 2ZCCA 1M94A 1YN4A 3O65B 2RDBC 3DVNV 5BYRA 1FFUA 2PPHA 2RD0A 1ZP0B 4CYEA 1WRDB 1N61A 1ZUD2 5H8YE 1AWDA 1QOFA 1MPEA 4MACA 2CU3A 4ZYNA 4MELA 1ZGUB 2FNJB 4CHKA 1FXTB 4HROA 4W9CA 2JWUA 4BFRA 1QLBB 3M95A 1MHXA 4XDCA 1JQ4A 2QC8A 3W1SC 3WAOA 3KVFB 2INDC 3N1ZC 5FR6A 4HVBA 1KH0A 4FJYA 2ON8A 4GOCA 3ECIA 3UIPB 4M0WB 4LJOB 1J0GA 1VDVA 2D5GA 1WJNA 3N20C 2BYTA 1WXAA 3NUHB 2IO2B 2N1WA 1TY2A 4DWFA 5IP4D 2IDYA 1Z5SB 4BBNF 2L83A 2PJHA 3SFDB 1YOVB 2K8HA 1CQVA 4HPPA 2ACZB 3SD5A 3HVZA 2DHZA 4RGOS 1NBFC 1NDDA 1WRIA 4IKGA 1GB4A 2RSUA 4S17A 1EM7A 2KANA 5D3DA 4GB9A 1T5XD 3DBRI 2WYQA 2KAJA 3DHGC 4ZHOA 2OEDA 1TKYA 1C78A 4F7ZA 2KWUB 2K5PA 1R7SA 2KDEB 4DHJB 1C79A 1VR9A 1WJUA 4GDKB 1J7AA 2A4ZA 1PFDA 3MJ5A 4ICUA 2FBWB 2EELA 5JXVA 1I4RA 3R7RA 1H8CA 1NENB 2JRHA 3RYTA 1MVKA 3GZNB 5EE9A 5D3IB 2MBOA 4DXAB 2MBEA 4W9EA 2QEJC 1WX8A 3VUYA 3P4QB 3TBLD 3ENEA 4AWJA 1IGDA 2WLBA 1IBXB 2PVGC 4AP4C 4C4VB 3H8HA 2DZJA 2KX0A 2MCNB 2LGYA 3TSSA 2PE6B 4IW0A 2KOXA 1AW7A 3NVZA 3TEXA 1WMHA 2RR9A 2N9PC 5IO9A 3V62A 3UI3A 3Q3MC 4BOSC 3BWUD 1ENFA 4JQWC 3EHVA 4K7WA 3Q2AC 3Q3OC 4MSQB 1WGDA 5LLIA 4TSSA 3P63A 3ALBA 2WU2B 4FHJA 1LFDA 1GB1A 1M4VA 3DVGX 2JF5A 2N1VA 2MEKA 4FJZA 3QX1A 3DPDA 1WJ4A 2RPVA 1QOGA 3LDZE 1R4NB 1TS3A 1T0YA 2KZRA 1EWCA 3CF6E 3ABVB 3RFZB 3UQAA 1MG8A 2FCQA 3ZNZB 2WNMA 5BMGA 1NI2A 4NAMA 2V1YA 2SAKA 1K50A 2MJ3A 2M4NA 5C3JB 1FPYA 2XK5A 1XT9B 2RGFA 3HK0A 3R3MA 4WWPA 2AWTA 4DHZB 3TCAA 4ANUA 3V6CB 2IJ0A 4ICVA 4FBJB 3L13A 1WXSA 1WE6A 1GNUA 3WALA 4RFBA 1RFKA 3RMKC 4BVUC 4US8A 4AOFA 1FM0D 1J8CA 2LD9A 3MJWA 4OZAA 3U2SC 2JZZA 1QKZA 4JL9A 4W9GA 1F0ZA 2RPQA 1A5RA 2LXAA 3N32A 4K7UA 2WXMA 2ZVNA 2GBKA 4HDQA 2X8XX 3W5UB 1GAQB 2I38A 4M8MA 1EU3A 3TMPB 3VR8B 4E71A 1JALA 2BYVE 2KTRA 2WXHA 5FKAC 4F1SA 1YD8U 2KO3A 1JMLA 5FK9C 1P1AA 5H92C 1J7CA 4HCNB 1D5ZC 1UWXA 2VH2A 1R4MI 1WYWB 3VTVA 3X0WA 1DOIA 2LVQA 1HZ6A 1Q5WB 3NZ3A 4E74A 3GE3C 1CK1A 3AH7A 3DVNU 5D2MB 4XWWA 3KLSX 2KFKB 2N7EA 3ZUNA 3BINA 4B9KA 3KH0A 3S2AA 4K1RB 2WDTB 4JLCA 1CMXB 4I6LB 4ZRJA 3V61A 2L0FA 1GPXA 1QOAA 3L08A 5C2TB 2EKEC 3DBHI 1YX6B 2PVOD 2Z0DB 4DDGD 2HJ1A 2JZ3B 3DBRB 2V3NA 4I6NB 1UH6A 4N9F4 4J3OD 5JHBA 3EC8A 3Q3FA 4BKGA 2KQSA 2BPSA 2BGFA 1QQRA 2FCNA 2GB1A 4KIKB 2ICIA 5LNK1 1WE7A 4YSYB 4YSXB 3HUIA 3MC9A 3LB8C 4A3OA 3NVYA 4W9LA 2FCMA 2Z8LA 1YN3A 4ITKA 3DBLI 1V1PB 2QMTA 1QF6A 4DHJD 3Q3JA 1TZ1A 1DOXA 3UQBA 1F77A 2TSSA 3H1UA 2C7HA 3NS8A 2CR5A 1NEKB 1SXTA 3GP7A 5DPTA 2HDEA 1OGWA 1OQQA 1V86A 5DCNA 4FADA 1MI0A 5G55A 2J0JA 3VXWA 4KKIA 1E9MA 1YQ3B 1V1OA 1GC7A 4W9JA 3AULA 2KMCA 1WI0A 1AARA 2PE9A 4M01A 3DCGA 3ZW3A 4NPNA 1UZXB 3JW0X 2LRUA 2IO1B 3A1QB 4A8XC 3IFWB 2DYOA 3ETRA 2C9WB 3Q6BA 4HPLB 1IP9A 5AZGA 2AX5A 1PYWD 2ZPYA 1TZOA 4NJ7A 2MSED 2MBHA 1FCCC 2XBBC 4MJSA 2K39A 3HIZA 4TQ1A 1FO4A 3AE9B 4RH6A 5IOIA 2L00B 4MGYE 5HHDG 4AS1A 4LNNA 1A70A 2NPTB 1VRAB 2JXXA 3AN1A 3HM3A 1BXTA 4URKA 3HHMA 1AN8A 2AEHA 3H6NA 3I63C 4LTUA 4RGNA 1ZOYB 4BBNC 1V81A 1Z2MA 1V9JA 1WY8A 2NS5A 3PHWB 4ARCA 3DHIC 2N0SB 4A20A 1GUAB 2K3UA 2BB5A 2V3PA 3SU8X 3BK2A 4ANXA 1F52A 3AXCA 3QARA 2OJRA 2IPKD 2Z0EB 4HKZE 3VQIA 2KJ6A 5EE0A 1XLOA 3IVFA 1FRDA 4USAA 1RRBA 2V9HA 4FULA 2O6VA 1DGJA 2JY6A 2WXJA 3FAHA 3H7PA 3DWGC 3L17A 1P7EA 3BYTB 5AUKA 2Y5CA 5GMVA 3T9LA 1E7PB 2INPE 2ZEQA 5DPSA 1C4AA 4YTNB 2N9EB 3RI7C 2LXCA 3B08A 3FKYA 2WHIA 4G0NB 1L6UA 1D5MC 1S3SG 3IT4B 4MH8A 1D4BA 1S1QB 4P6VF 4BOZB 1VZ6A 3X23A 4MGKE 1V8CA 1ZPSA 5HFYA 3DBHB 4KVGB 1P7FA 5J18A 3PLUA 5BYSA 3N30A 1ACCA 1V5OA 3AEDB 2L0TA 2KVZA 3VUXA 4ANWA 2N9LA 4OVVA 2H89B 3CWIA 2YVCA 5LXIB 4NY0A 3NVWA 1L2NA 1PDXA 1JRPA 1ZXIA 3EA6A 5G5GA 1ZE3D 3L4PA 3NJTA 3PTFC 2OHFA 5G5HA 4KV2A 1FXAA 4K81A 1BUIC 3JSVA 3OJ4B 1NI3A 5L83A 1OFFA 3IHPC 1JW9D 1T6BX 3ONSA 3V6EB 2JZPA 2WXRA 3DBLB 2L8JA 3H7SA 4RGTA 4Q2JA 1N62A 1N6ZA 2VRRB 4ZHPA 3PLVA 3M63B 1WJ6A 4LJPB 4AJWA 2Q5WD 3U8ZA 2WDVB 2BS4B 4GDLA 4FLHA 2CU1A 4EE2A 2FIDA 3RN9C 4WJPA 2GOWA 2R2OA 2W3RA 2JVCA 3ZYYX 2MRPA 1TYGB 3BIID 4US9A 3WANA 1XCTL 4EKUA 2LJIA 2HJ8A 4W9DA 3W9CB 4GSWA 5AEKB 3IXSA 4WJNA 3URYA 1QOBA 4BKSD 3PHXB 3DHHC 2EMSA 5CX3A 1P0RA 5EE1A 2YEPB 4DBGA 2N9KA 4WURA 2IY1B 1YJ1A 2BVCA 2XN9C 3EGRA 3TIXA 4IUMB 2PKOA 3C19A 2BYFA 2CJNA 1KFYB 3Q8AA 3ZKJC 3J9CA 2LZ6A 4N6EB 1SBBB 5BMIA 1L5PA 3WA0A 1KLVA 1WFYA 2DLBA 1UELA 2IBIB 1FRRA 1SF0A 4ARIA 4TKNA 2QHOA 1I4GA 4NZLB 4KDIC 2K8CA 3ML9A 3VRAB 1WGKA 2INNE 2CKHB 3ZRFA 3QCAA 4XZ4A 1WXQA 1TY0A 2J0KA 4P7IA 2XNAC 2WXKA 2WDRB 4IC7B 5DPRA 4BKTA 3AE6B 3K9PB 2V0GA 3W2DA 2MP2A 3WAMA 1ZDVA 1TGZB 1JWAD 2B76B 2K8BA 5CTRC 1I35A 3KQ4A 1GOZA 1XF5L 3ZTDA 1NYQA 1UBQA 1XEEA 3ZQ4A 4JWUC 2KDBA 3AECB 1SIFA 4S0RA 2BW2A 4EOYA 3U7DA 1ZDXA 2L76A 2G9HD 2NBVB 2PIAA 2VZKB 3D32A 5E6JA 2DX5B 4EEWA 3PSEB 1YN5A 3DWMA 5BMHA 4MGZE 2KLGA 2Y5BB 2LI5A 2J7QB 2R2QA 4GN1A 2ZPNA 3PZ8A 1UD7A 1E6EB 2AQ1B 1N63A 4HCPB 1XLNA 3VTWA 2BKRB 1XQQA 3MHSD 4IG7B 2KDIA 3I3TB 3NOBA 1XCQL 3FC4A 3ZIMA 2J52A 1PGBA 3QWZB 1E8ZA 1MFWA 2JWZA 4ANVA 3B0AA 2NMQA 3L10B 5TR5A 2O2VB 4NQKE 4JX1C 3Q8BA 2K25A 1E5WA 4YTMB 3IT6B 3FILA 4M02A 4HRSA 1PQSA 1C3TA 1UNSA 4LNOA 2L05A 2M8SA 2GBMA 3AEEB 2Y5PA 2LHEA 2ZCBA 1EO6A 2BB6A 4IDIA 5HKHA 4AJYB 1CZPA 1EF1A 3R8BA 3AB5A 2LGSA 3P42A 2WWZA 3U52E 1WH3A 4HKQA 2WXNA 2M19A 2D07B 1VZ8A 3VRBB 2NTSA 2JSVX 2GMIC 5HI1A 1KLGD 1SE2A 2M0AA 4X57B 2QSDA 1WZ0A 3SFEB 3R2TA 4ZYSA 2KT7A 1UWMA 4WAAA 4ZRPA 4IM2A 2IO3B 2K0PA 1GJZA 5LXHA 1KF6B 3A4SC 4P1CC 1K8RB 1Q10A 3DOWA 4CQNA 1C77A 1F9JA 3QK0A 1E90A 2JX5A 1HTOA 4RF1A 3VTUA 4I6PA 4ASWC 1V5TA 2C7MB 2DWQA 2G3QB 1WGYA 5CHFA 2W54A 3M3JA 3VVWB 3RNAC 3U7ZA 2BF8B 4MM3B 3A9JB 5KHOA 4KKJA 2KTRB 2WU5B 2KYWA 1VCBA 4P1BC 1L0YB 5E6PA 2NBUA 2QJLA 4OHJA 4LDTD 3UF8A 3TJPA 1LXDA 2CHZA 4XX5A 2KFKA 4GIVA 4XE0A 3N1XC 3A33B 3W5VB 3PREA 1XLQA 2NBWB 2LHDA 4A90A 4F8CB 2NR2A 3NZUA 4BZAA 2C60A 1WZ3A 2JYTA 4JGHB 5L95C 3NVVA 3PPAA 2HTME 1WYGA 2JQRB 2GBJA 2N7JA 3LYYA 1V6EA 3CMMB 3VH4B 1Q1OA 3ZDMC 2OJWA 1JWBD 4EZJA 3A9KA 4XWTA 3IG3A 1FD6A 2LUEA 4K3BA 4XDDA 5D94A 2BS2B 4A6QA 3I5JC 4OZCA 1N5XA 2PW9A 2J42A 1C4CA 2REXA 2LGIA 2QCZA 3LXFA 2W82A 3Q14C 4KGSA 4BAXA 4EZLA 1LQBA 1XLPA 4JWSC 4NAWA 2MQJA 4ZDVA 1TKEA 4IWOA 1WR1A 2KJHB 2D10A 3ML8A 1FIQA 2I1KA 3SHQA 1PGXA 1ZKHA 1N60A 4OZBA 5DPWA 3P4RB 4HJKA 2B3AA 4DHZE 2KXJA 4G3XB 3RT3B 4LLGM 2KC1A 4QAYA 3EECA 4DK5A 2XEWA 1V80A 1I4PA 2CHXA 1YX5B 3BVGA 1WX9A 1VD2A 4C56C 1YQ4B 3AE1B 3AEAB 3OLMD 2A5UA 2IGHA 5E6NA 1C4PA 1B9RA 4MDKE 4FXCA 2WGSA 4OW0A 4PS7A 3WAPA 2KMAA 1E8XA 4WQOB 2V3SA 3NS1A 3KUDB 2KNBA 1OEYJ 4HXDA 3JYUA 1K51A 3ZJUA 2LFIA 2MLBA 2VZKD 4KGRA 1YNTE 4C00A 2RDGA 2FAZA 4WAFA 4MSMB 1P3QU 2WX1A 4WWMA 4MH0E 4NJ6A 5IAAC 3C0RB 3APDA 4EZKA 4K7SA 2G1EA 1T0SC 2X38A 2G4DB 3ZJVA 2KQ7A 1FMAD 1FNVA 2FE8A 3KUZA 1HA5A 3P1MA 2L1AA 3ZLZA 3PZ7A 4CO7A 2ZW0A 2WXGA 4LNIA 1MG4A 4W9FA 4G50A 3ZNGC 1TS5A 1SEBD 3KYCD 1CJEA 3AMZA 2NTTA 2CJOA 1L7YA 4A55A 1SSNA 3PS6A 1RM6C 4GXBA 1FFVA 2D3BA 4PS8A 4DDID 2JU6X 3N3KB 3MHZA 3TEYA 1EUVB 2MA9B 4RGMA 4B0MA 4DXGA 2HE7A 3APFA 4JE3B 2DNFA 1VZ7A 3CSTA 3Q69A 2QDFA 2W55A 2UWQA 2DZMA 2W3SA 2WXOA 1R4MB 3VAWA 5AZFA 1I4QA 3QJZA 4MEMA 4II2B 4W9KA 2O6VB 1OQYA 4TMAB 3H7PB 4KX6B 3GS2A 4RNAA 1JCKB 1P98A 3H9DA 1V2YA 5GXGB 2K9XA 2V4IB 1D6EC 3ZDTA 3ZXVA 1VLBA 1Q0WB 2K22A 2FUG1 3ZTCA 1YJJA 2LMCA 3OWEB 4K3CA 5MPOA 4TQ0A 1I4XA 1HXYD 4W9HA 3RUIB 2FIFA 2MJDA 4YWGG 2KD0A 4AQ7A 2RDHA 1E10A 4GLSC 3C8YA 5CHVC 3NRZA 2GBNA 3DDCB 4ACFA 4ZRKA 4YT0B 2K1FA 3MTNB 4HJGE 2DBYA 2C7NB 1FXIA 1XO3A 1JWUD 1Y8RC 4TV3A 3PRPB 3A4RA 3NHEB 3I57A 3R66C 3OAWA 3AE3B 1ESFA 2BBCA 3VH3B 3GOEA 3BVZA 2KN4A 1C1YB 4WH4A 3JSVB 4KDLB 5I4DA 2D3GA 1B1ZA 1V97A 3AE7B 1WGGA 4NJCA 2H88B 4B0EA 2HD5B 3PRMB 1WSPA 4LDTB 4HLEA 1L4ZB 1SE9A 2LJ5A 3Q8FA 3EFUA 4LNFA 4RF0A 3PZDA 1OTRB 3EUB2 3AE4B 2I2YA 1I4HA 2MX2A 2MHJA 2JT4B 1E7UA 4KGTA 4M0WA 2LGDA 3W1SA 1D3ZA 4GDLB 1SJED 1JWMD 1ROEA 2WP9B 3QA8A 4HWIB 4P16A 4H2AA 3BYYB 2WS3B 1UBIA 3RZFA 4W9IA 3KYDD 2KWDA 1MJDA 4PT5A 4M8NA 2RMMA 4TUUA 1Y56A 4WWOA 1PUTA 4L2YA 2IYDB 2LWPA 1IGCA 1WWTA 4XC2A 5G2NA 3U30A 4N59A 3N9YC 1G6JA 4MT5A 3M62B 3I9V1 5KHQA 4DXFA 3IAS1 5BYQA 2Y3AA 1N5WA 3RNCC 3AEFB 2HTHA 4JIOU 4GMVA 1RWSA 3MC0B 1YQBA 3T8MA 1KLUD 4HEA1 1EF5A 5JZEB 2GBRA 1ET6A 1YMHE 3DVGY 1F2RC 4NQLB 3APCA 4GDKA 3P2BA 4IOIE 3Q3NC 1QT9A 2D2QA 2Z59B 1L0VB 3TUOA 1SGHA 1SJHD 1NYRA 1JROA 1MHHE 3IBEA 5D6JB 1K52A 4ZRQA 3WIMA 1TKGA 3KWLA 1RFAA 1SIJA 3WCQA 3UGBB 1E8YA 2MP2B 4PYUA 3B2FA 2QILA 1IBXA 2KWVB 1OQRA 2WXPA 3TEWA 5AUIA 4C4VA 4G11A 3AEGB 1XXGA 2MBQA 2FUHB 3T3NA 5FR3A 1KJTA 1YJIA 3TEZA 1WMHB 1LO5D 4UDUC 4B6WA 3RNFC 2UU7A 3AE5B 1ZXHA 3W1YA 2KC2A 2N7DA 1WR6E 5IA7A 2EMTA 4WJOA 3O13A 1WF9A 2LRWA 3QIJA 2GI9A 1FNUA 1TT5B 1F1HA 3T3OA 1BT0A 3VUWA 2O6VD 2DYBA 1STEA 4IM3A 2WXLA 2O2VA 3RD2A 3SDLC 2JYEA 3PGEA 1WM3A 4WIPA 5JHAA 2IO0B 3SEBA 4YL8A 2G4SA 2ZZPB 3LJ3A 2KDMA 3L0WB 4RM8A 3B9JA 3HVDA 4WWNA 4MGIE 1L4DB 3BZDB 4XYCA 3FILB 2N9XA 2MBBB 5CHWA 4DQOC 1ET9A 2XK5B 1HE8A 2KQ4X 2BWFA 1WIAA 2KN5A 2E3TA 1QILA 1WXMA 2SEBD 1FCLA 1SE4A 2K6DB 3ZVVA 3MP9A 4YTPB 1IPGA 4J6IA 2AYOB 4GGQA 2KX3A 5D7GA 2INCC 1T3QA 2BS3B 2C5LC 2YEPF 3SR6A 1ISNA 5C23A 4FA6A 2IZVB 3AI5A 3B2GA 2LASA 1TS4A 2NCNA 3VFKA 2L3ZA 3AEBB 3PO0A 5EDSA 1DOYA 4HPMB 4LNKA 1UGJA 3PVLA 2KWCA 1TTNA 1C76A 2J53A 4MM3A 1WGHA 2LUMA 3A9JA 3OG5A 2DENB 4B95A 4EUTA 2I1JA 3RNGC 3P4SB 2DZIA 2LEKA 1HZ5A 1LM8B 1E0ZA 2KMMA 2WDQB 4N58A 4M00A 1H4RA 3R7QA 2WXIA 4FN2A 3QAQA 2DAJA 2AL6A 2AQ2B 2D3CA 3UIOB 4REZA 2BWES 2KVRA 5T8IA 1K53A 2PMVA 4WJQA 1KM7A 2JPHA 2AL3A 2OOBB 2MH7A 4OVZA 2R61A 4RCOA 2GLSA 2KLCA 2KKCA 2M17A 3AU5A 3RZWC 1IYFA 2IGDA 2KTFA 2WQYB 1LGRA 4A3PA 1AYFA 4KIKA 4E3CA 2E6XA 4ZRIA 1C9FA 3BK1A 3ZNID 5IKCM 3A9KB 3QQ8B 1BMLC 1U4AA 3AM9A 1TBEA 3EFCA 1UUPA 4O1NA 2ZVOA 1KOTA 4PYZA 2JRIB 5TSSA 3OJ3A 5C1ZA 3UINB 2MWSB 1L6VA 1V1PA 3AU4A 2DAFA 2M56B 4NAWB 4BKSA 3NY5A 4WQMA 3HRDD 2DYMA 1RYJA 4KSKC 3IAM1 4KZ0A 3ZO5B 3HM6X 4EFOA 4PK1A 5HG2A 2NVUI 3BVMA
chains in the Genus database with same CATH topology
2IY0B 1WE6A 3ZTCA 1GNUA 3WALA 4KDIC 2K8CA 3ML9A 4BVUC 2CKHB 4AOFA 4TQ0A 3ZRFA 3QCAA 4XZ4A 4RMAA 1J8CA 2LD9A 1X1MA 2CS4A 2J0KA 3MJWA 4IWQA 4W9HA 3RUIB 3ZNHB 2FIFA 2JZZA 4P7IA 4JL9A 4W9GA 4FHKA 2KD0A 2RPQA 1A5RA 2LXAA 3A1QA 3B1LX 3N32A 4K7UA 1J19A 2ZVNA 2DZKA 4IM0A 2GBKA 2PEAA 4HDQA 4IC7B 5DPRA 4BKTA 3K9PB 5CHVC 2GBNA 3DDCB 3JVZX 4M8MA 4ZRKA 2MP2A 2ASQA 4E71A 2K1FA 3TMPB 3WAMA 2BYVE 2KTRA 1QZEA 1TGZB 4FJVB 3MTNB 2K8BA 4F1SA 1YD8U 2KO3A 5CTRC 1I35A 3PT2B 1XD3B 2C7NB 1P1AA 3KW5B 3ZTDA 1RAXA 3QC8B 4HCNB 1Y8RC 3PRZA 1R4MI 1UBQA 1WYWB 2LGXA 4PS3A 4TV3A 3VTVA 3X0WA 3PRPB 2KDBA 4LCDE 2LVQA 3DBSA 3A4RA 4KZCA 1Q5WB 3NHEB 1YIWA 4MJSB 4EOYA 2M0XA 3R66C 4E74A 3OAWA 3U7DA 2NPTA 3DVNU 5D2MB 2L76A 3BY4B 3VH3B 3GOEA 2NBVB 1C1YB 1E7VA 2CHWA 2KFKB 2N7EA 3JSVB 3ZUNA 3L54A 3BINA 4KDLB 4B9KA 2D3GA 3KH0A 3D32A 5J17A 3S2AA 4K1RB 2WDTB 4JLCA 1CMXB 2DX5B 2YLMA 4II3B 4I6LB 4ZRJA 4EEWA 3PSEB 1WGGA 3V61A 2L0FA 2HD5B 1JRUA 3PRMB 2KLGA 3L08A 4LDTB 4MGZE 4HLEA 1SE9A 2LJ5A 2Y5BB 2LI5A 2J7QB 2R2QA 3EFUA 3KUCB 3PZDA 4GN1A 2LVPA 2ZPNA 2EKEC 3DBHI 1OTRB 1UD7A 4HCPB 3VTWA 2BKRB 1XQQA 2G45B 1YX6B 3MHSD 2Z0DB 2UYZB 4DDGD 4IG7B 2MX2A 2KDIA 2JZ3B 2JT4B 4I6NB 2WX0A 1UH6A 3I3TB 1E7UA 3K9OB 4N9F4 2LGDA 2ZNVC 3NOBA 4HK2A 3W1SA 1D3ZA 4GDLB 3CSFA 5JHBA 3ZIMA 2KJRA 3EC8A 3V60A 3Q3FA 3QA8A 4HWIB 4BKGA 2KQSA 3QWZB 1E8ZA 4IWPA 2ZNVB 5JH5C 2JWZA 4ANVA 3GZNI 2BPSA 2BGFA 2JUOA 2FCNA 1UBIA 3RZFA 4KIKB 4W9IA 3B0AA 3KYDD 3L10B 5TR5A 2O2VB 4NQKE 2BYEA 4OVUA 2KFJA 2K25A 1E5WA 1WE7A 2D11A 4M8NA 4TUUA 2M1MA 4WWOA 5AZHA 3VDZA 3ZRCA 2IYDB 2LWPA 1PQSA 4HDOA 1C3TA 2KK8A 4XC2A 2L05A 2M8SA 3L16A 5G2NA 3U30A 2GBMA 3PV1A 3TL5A 1G6JA 2ZJDA 4A3OA 4W9LA 1WX7A 3M62B 1ZW7A 2ZCBA 1EO6A 5KHQA 2FCMA 5HKHA 4AJYB 1EF1A 1UGMA 3DQVA 5J2RA 2WWZA 3DBLI 4GU2A 1WH3A 4DHJD 3Q3JA 1TZ1A 2D07B 2HTHA 4RM9A 3UQBA 4JIOU 3H1UA 4GMVA 2C7HA 3NS8A 2CR5A 5DPTA 1WM2A 3RULA 1RLFA 2GMIC 1OGWA 1YQBA 4X57B 1WZ0A 1V86A 3T8MA 3VHTC 5DCNA 1EF5A 4NNJB 5JZEB 2GBRA 3DVGY 4WAAA 2MW5A 4FADA 2FCSA 1E8WA 4NQLB 5G55A 2LVOA 2BKFA 2J0JA 2W9NA 3APCA 3P2BA 4GDKA 4IM2A 3VXWA 2IO3B 1GJZA 5LXHA 2L7RA 2D2QA 1GC7A 3A4SC 4W9JA 2Z59B 3AULA 1K8RB 2KMCA 1WI0A 3DOWA 1GC6A 1AARA 1SGHA 1F9JA 2PE9A 3QK0A 1I42A 1E90A 3VTUA 4I6PA 3DCGA 4KSLC 4NPNA 4ASWC 1UZXB 1V5TA 3QHTA 3ZW3A 2C7MB 2G3QB 1R4NI 1OEYA 3IBEA 2LRUA 1WGYA 3JW0X 5CHFA 2IO1B 2KHWB 3A1QB 5D6JB 3IFWB 2DYOA 3M3JA 3VVWB 3NZSA 2C9WB 2K6QA 2V4LA 3WIMA 4HPLB 1GG3A 2N4FA 1IP9A 1RFAA 5AZGA 2BF8B 1E8YA 3UGBB 5E6OA 2MP2B 3A9JB 4PYUA 5KHOA 2ZPYA 3RCZA 2KWVB 2KTRB 1V49A 1WGRA 4NJ7A 1P9DU 1WXVA 2J0MA 2MSED 4G11A 4AUQC 1VCBA 2KDFB 2ZCCA 5BO4B 1M94A 5E6PA 3O65B 2MBQA 2FUHB 2MBHA 2XBBC 2NBUA 4MJSA 2K39A 4LDTD 3DVNV 3UF8A 3HIZA 4TQ1A 2PPHA 2RD0A 3TJPA 1LXDA 2CHZA 2L00B 4XX5A 4MGYE 4CYEA 2KFKA 4GIVA 1WRDB 3A33B 1KJTA 3PREA 2NPTB 2NBWB 2JXXA 4F8CB 1WMHB 2NR2A 3HM3A 3NZUA 4B6WA 4ZYNA 2C60A 4URKA 1WZ3A 3HHMA 4MELA 2AEHA 3H6NA 4JGHB 5L95C 3PPAA 1ZGUB 2FNJB 4CHKA 1FXTB 2GBJA 3W1YA 2KC2A 2N7DA 1WR6E 1V6EA 3CMMB 5IA7A 3VH4B 1V81A 4BBNC 1Q1OA 4W9CA 2EMTA 4BFRA 1Z2MA 4WJOA 3ZDMC 1V9JA 1WY8A 2NS5A 3PHWB 3M95A 1WF9A 2LRWA 4EZJA 3QIJA 3A9KA 4A20A 3W1SC 3WAOA 1GUAB 3IG3A 3KVFB 5FR6A 4HVBA 4FJYA 2LUEA 4GOCA 1BT0A 3ECIA 5D94A 3UIPB 4M0WB 3VUWA 2O6VD 2DYBA 4LJOB 1J0GA 3SU8X 4IM3A 4ANXA 2O2VA 3AXCA 3QARA 3RD2A 3SDLC 2OJRA 2REXA 1WJNA 2Z0EB 3VQIA 3PGEA 1WM3A 2KJ6A 5JHAA 1WXAA 3IVFA 2IO0B 2IO2B 4YL8A 1RRBA 2N1WA 4EZLA 2G4SA 1LQBA 2ZZPB 4DWFA 3LJ3A 3L0WB 4RM8A 4FULA 4NAWA 2O6VA 2MQJA 4ZDVA 2JY6A 4IWOA 1Z5SB 4WWNA 1WR1A 4MGIE 4BBNF 2KJHB 3H7PA 2PJHA 2D10A 3L17A 3ML8A 2I1KA 3SHQA 1ZKHA 2N9XA 5GMVA 3T9LA 2MBBB 5DPWA 5CHWA 2K8HA 2ZEQA 4HJKA 3SD5A 2XK5B 2B3AA 4DHZE 2DHZA 2KXJA 1HE8A 1NBFC 2BWFA 1WIAA 1NDDA 2KN5A 4G3XB 5DPSA 2RSUA 3RT3B 1WXMA 2KC1A 2N9EB 2KANA 2LXCA 3EECA 3B08A 2K6DB 4GB9A 3ZVVA 4DK5A 4G0NB 2XEWA 1V80A 2CHXA 1YX5B 1IPGA 1S3SG 4J6IA 2AYOB 1WX9A 1S1QB 1VD2A 4BOZB 3DBRI 3OLMD 2KX3A 2A5UA 2WYQA 4GGQA 4MGKE 3X23A 5D7GA 5E6NA 4F7ZA 4KVGB 5J18A 3PLUA 2C5LC 4MDKE 2KWUB 3N30A 1ISNA 2KDEB 4DHJB 5C23A 4PS7A 1V5OA 1WJUA 4GDKB 4FA6A 2IZVB 3AI5A 2A4ZA 2L0TA 4ICUA 2LASA 3WAPA 2KMAA 3VUXA 1E8XA 2NCNA 3VFKA 4ANWA 2L3ZA 4WQOB 2V3SA 3R7RA 1H8CA 3KUDB 2KNBA 1OEYJ 4OVVA 5EDSA 4HPMB 2JRHA 3RYTA 2YVCA 4HXDA 3JYUA 3PVLA 5LXIB 2KWCA 4NY0A 1TTNA 1L2NA 2MLBA 4MM3A 1WGHA 3A9JA 2DENB 4B95A 4EUTA 2I1JA 2FAZA 2MBOA 4DXAB 2MBEA 4W9EA 4MSMB 1WX8A 3VUYA 1P3QU 2DZIA 3PTFC 2WX1A 3TBLD 3ENEA 1LM8B 4AWJA 4KV2A 4MH0E 4NJ6A 5IAAC 3C0RB 3APDA 4EZKA 4K7SA 4K81A 3JSVA 5L83A 3OJ4B 4AP4C 2DZJA 3IHPC 2KX0A 2MCNB 4TKNA 2LGYA 1H4RA 3R7QA 2PE6B 4FN2A 2G4DB 3ONSA 4IW0A 3V6EB 3QAQA 2DAJA 2AL6A 2KOXA 2KQ7A 2L8JA 1WMHA 3H7SA 3KUZA 2RR9A 2N9PC 3UIOB 3V62A 2BWES 2KVRA 3ZLZA 4CO7A 4BOSC 2VRRB 3PLVA 3M63B 4W9FA 4WJQA 4G50A 3ZNGC 1WJ6A 1KM7A 2JPHA 2AL3A 2OOBB 4JQWC 4LJPB 3EHVA 3KYCD 4K7WA 4AJWA 4MSQB 3U8ZA 4GDLA 2KLCA 1WGDA 2KKCA 5LLIA 4FLHA 2M17A 1L7YA 2CU1A 2FIDA 3AU5A 3RZWC 1IYFA 2KTFA 3PS6A 3ALBA 4WJPA 4A3PA 4FHJA 1LFDA 2GOWA 2R2OA 4GXBA 4KIKA 3DVGX 2JVCA 4E3CA 2JF5A 4ZRIA 2N1VA 4PS8A 2MRPA 3ZNID 4DDID 4FJZA 3A9KB 3WANA 3N3KB 3QX1A 4EKUA 3QQ8B 3DPDA 1EUVB 2MA9B 1WJ4A 2HJ8A 1U4AA 4W9DA 4GSWA 5AEKB 1TBEA 2HE7A 3APFA 3LDZE 3CSTA 4WJNA 4BKSD 2ZVOA 1T0YA 2UWQA 2DZMA 3PHXB 2KZRA 3CF6E 3UQAA 1KOTA 4PYZA 2EMSA 1MG8A 5CX3A 2JRIB 2FCQA 1P0RA 3ZNZB 1NI2A 3VAWA 3OJ3A 5AZFA 5C1ZA 3UINB 2MWSB 2V1YA 3QJZA 4DBGA 3AU4A 4MEMA 4II2B 4W9KA 2DAFA 2IY1B 1YJ1A 4NAWB 2O6VB 4BKSA 2M4NA 3NY5A 3TIXA 1OQYA 2XK5A 4IUMB 2DYMA 3H7PB 2BYFA 1XT9B 4KSKC 3ZKJC 2RGFA 3HK0A 2LZ6A 1P98A 3R3MA 3H9DA 4WWPA 2AWTA 4DHZB 3WA0A 1V2YA 3TCAA 1KLVA 1WFYA 4ANUA 1UELA 3V6CB 4KZ0A 4ICVA 3HM6X 2IBIB 3ZO5B 4EFOA 4FBJB 3L13A 3ZDTA 2NVUI 1SIFA 1Q0WB 1WXSA 2QHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 B;  1WE6 A;  3ZTC A;  1GNU A;  3WAL A;  4KDI C;  2K8C A;  3ML9 A;  4BVU C;  2CKH B;  4AOF A;  4TQ0 A;  3ZRF A;  3QCA A;  4XZ4 A;  4RMA A;  1J8C A;  2LD9 A;  1X1M A;  2CS4 A;  2J0K A;  3MJW A;  4IWQ A;  4W9H A;  3RUI B;  3ZNH B;  2FIF A;  2JZZ A;  4P7I A;  4JL9 A;  4W9G A;  4FHK A;  2KD0 A;  2RPQ A;  1A5R A;  2LXA A;  3A1Q A;  3B1L X;  3N32 A;  4K7U A;  1J19 A;  2ZVN A;  2DZK A;  4IM0 A;  2GBK A;  2PEA A;  4HDQ A;  4IC7 B;  5DPR A;  4BKT A;  3K9P B;  5CHV C;  2GBN A;  3DDC B;  3JVZ X;  4M8M A;  4ZRK A;  2MP2 A;  2ASQ A;  4E71 A;  2K1F A;  3TMP B;  3WAM A;  2BYV E;  2KTR A;  1QZE A;  1TGZ B;  4FJV B;  3MTN B;  2K8B A;  4F1S A;  1YD8 U;  2KO3 A;  5CTR C;  1I35 A;  3PT2 B;  1XD3 B;  2C7N B;  1P1A A;  3KW5 B;  3ZTD A;  1RAX A;  3QC8 B;  4HCN B;  1Y8R C;  3PRZ A;  1R4M I;  1UBQ A;  1WYW B;  2LGX A;  4PS3 A;  4TV3 A;  3VTV A;  3X0W A;  3PRP B;  2KDB A;  4LCD E;  2LVQ A;  3DBS A;  3A4R A;  4KZC A;  1Q5W B;  3NHE B;  1YIW A;  4MJS B;  4EOY A;  2M0X A;  3R66 C;  4E74 A;  3OAW A;  3U7D A;  2NPT A;  3DVN U;  5D2M B;  2L76 A;  3BY4 B;  3VH3 B;  3GOE A;  2NBV B;  1C1Y B;  1E7V A;  2CHW A;  2KFK B;  2N7E A;  3JSV B;  3ZUN A;  3L54 A;  3BIN A;  4KDL B;  4B9K A;  2D3G A;  3KH0 A;  3D32 A;  5J17 A;  3S2A A;  4K1R B;  2WDT B;  4JLC A;  1CMX B;  2DX5 B;  2YLM A;  4II3 B;  4I6L B;  4ZRJ A;  4EEW A;  3PSE B;  1WGG A;  3V61 A;  2L0F A;  2HD5 B;  1JRU A;  3PRM B;  2KLG A;  3L08 A;  4LDT B;  4MGZ E;  4HLE A;  1SE9 A;  2LJ5 A;  2Y5B B;  2LI5 A;  2J7Q B;  2R2Q A;  3EFU A;  3KUC B;  3PZD A;  4GN1 A;  2LVP A;  2ZPN A;  2EKE C;  3DBH I;  1OTR B;  1UD7 A;  4HCP B;  3VTW A;  2BKR B;  1XQQ A;  2G45 B;  1YX6 B;  3MHS D;  2Z0D B;  2UYZ B;  4DDG D;  4IG7 B;  2MX2 A;  2KDI A;  2JZ3 B;  2JT4 B;  4I6N B;  2WX0 A;  1UH6 A;  3I3T B;  1E7U A;  3K9O B;  4N9F 4;  2LGD A;  2ZNV C;  3NOB A;  4HK2 A;  3W1S A;  1D3Z A;  4GDL B;  3CSF A;  5JHB A;  3ZIM A;  2KJR A;  3EC8 A;  3V60 A;  3Q3F A;  3QA8 A;  4HWI B;  4BKG A;  2KQS A;  3QWZ B;  1E8Z A;  4IWP A;  2ZNV B;  5JH5 C;  2JWZ A;  4ANV A;  3GZN I;  2BPS A;  2BGF A;  2JUO A;  2FCN A;  1UBI A;  3RZF A;  4KIK B;  4W9I A;  3B0A A;  3KYD D;  3L10 B;  5TR5 A;  2O2V B;  4NQK E;  2BYE A;  4OVU A;  2KFJ A;  2K25 A;  1E5W A;  1WE7 A;  2D11 A;  4M8N A;  4TUU A;  2M1M A;  4WWO A;  5AZH A;  3VDZ A;  3ZRC A;  2IYD B;  2LWP A;  1PQS A;  4HDO A;  1C3T A;  2KK8 A;  4XC2 A;  2L05 A;  2M8S A;  3L16 A;  5G2N A;  3U30 A;  2GBM A;  3PV1 A;  3TL5 A;  1G6J A;  2ZJD A;  4A3O A;  4W9L A;  1WX7 A;  3M62 B;  1ZW7 A;  2ZCB A;  1EO6 A;  5KHQ A;  2FCM A;  5HKH A;  4AJY B;  1EF1 A;  1UGM A;  3DQV A;  5J2R A;  2WWZ A;  3DBL I;  4GU2 A;  1WH3 A;  4DHJ D;  3Q3J A;  1TZ1 A;  2D07 B;  2HTH A;  4RM9 A;  3UQB A;  4JIO U;  3H1U A;  4GMV A;  2C7H A;  3NS8 A;  2CR5 A;  5DPT A;  1WM2 A;  3RUL A;  1RLF A;  2GMI C;  1OGW A;  1YQB A;  4X57 B;  1WZ0 A;  1V86 A;  3T8M A;  3VHT C;  5DCN A;  1EF5 A;  4NNJ B;  5JZE B;  2GBR A;  3DVG Y;  4WAA A;  2MW5 A;  4FAD A;  2FCS A;  1E8W A;  4NQL B;  5G55 A;  2LVO A;  2BKF A;  2J0J A;  2W9N A;  3APC A;  3P2B A;  4GDK A;  4IM2 A;  3VXW A;  2IO3 B;  1GJZ A;  5LXH A;  2L7R A;  2D2Q A;  1GC7 A;  3A4S C;  4W9J A;  2Z59 B;  3AUL A;  1K8R B;  2KMC A;  1WI0 A;  3DOW A;  1GC6 A;  1AAR A;  1SGH A;  1F9J A;  2PE9 A;  3QK0 A;  1I42 A;  1E90 A;  3VTU A;  4I6P A;  3DCG A;  4KSL C;  4NPN A;  4ASW C;  1UZX B;  1V5T A;  3QHT A;  3ZW3 A;  2C7M B;  2G3Q B;  1R4N I;  1OEY A;  3IBE A;  2LRU A;  1WGY A;  3JW0 X;  5CHF A;  2IO1 B;  2KHW B;  3A1Q B;  5D6J B;  3IFW B;  2DYO A;  3M3J A;  3VVW B;  3NZS A;  2C9W B;  2K6Q A;  2V4L A;  3WIM A;  4HPL B;  1GG3 A;  2N4F A;  1IP9 A;  1RFA A;  5AZG A;  2BF8 B;  1E8Y A;  3UGB B;  5E6O A;  2MP2 B;  3A9J B;  4PYU A;  5KHO A;  2ZPY A;  3RCZ A;  2KWV B;  2KTR B;  1V49 A;  1WGR A;  4NJ7 A;  1P9D U;  1WXV A;  2J0M A;  2MSE D;  4G11 A;  4AUQ C;  1VCB A;  2KDF B;  2ZCC A;  5BO4 B;  1M94 A;  5E6P A;  3O65 B;  2MBQ A;  2FUH B;  2MBH A;  2XBB C;  2NBU A;  4MJS A;  2K39 A;  4LDT D;  3DVN V;  3UF8 A;  3HIZ A;  4TQ1 A;  2PPH A;  2RD0 A;  3TJP A;  1LXD A;  2CHZ A;  2L00 B;  4XX5 A;  4MGY E;  4CYE A;  2KFK A;  4GIV A;  1WRD B;  3A33 B;  1KJT A;  3PRE A;  2NPT B;  2NBW B;  2JXX A;  4F8C B;  1WMH B;  2NR2 A;  3HM3 A;  3NZU A;  4B6W A;  4ZYN A;  2C60 A;  4URK A;  1WZ3 A;  3HHM A;  4MEL A;  2AEH A;  3H6N A;  4JGH B;  5L95 C;  3PPA A;  1ZGU B;  2FNJ B;  4CHK A;  1FXT B;  2GBJ A;  3W1Y A;  2KC2 A;  2N7D A;  1WR6 E;  1V6E A;  3CMM B;  5IA7 A;  3VH4 B;  1V81 A;  4BBN C;  1Q1O A;  4W9C A;  2EMT A;  4BFR A;  1Z2M A;  4WJO A;  3ZDM C;  1V9J A;  1WY8 A;  2NS5 A;  3PHW B;  3M95 A;  1WF9 A;  2LRW A;  4EZJ A;  3QIJ A;  3A9K A;  4A20 A;  3W1S C;  3WAO A;  1GUA B;  3IG3 A;  3KVF B;  5FR6 A;  4HVB A;  4FJY A;  2LUE A;  4GOC A;  1BT0 A;  3ECI A;  5D94 A;  3UIP B;  4M0W B;  3VUW A;  2O6V D;  2DYB A;  4LJO B;  1J0G A;  3SU8 X;  4IM3 A;  4ANX A;  2O2V A;  3AXC A;  3QAR A;  3RD2 A;  3SDL C;  2OJR A;  2REX A;  1WJN A;  2Z0E B;  3VQI A;  3PGE A;  1WM3 A;  2KJ6 A;  5JHA A;  1WXA A;  3IVF A;  2IO0 B;  2IO2 B;  4YL8 A;  1RRB A;  2N1W A;  4EZL A;  2G4S A;  1LQB A;  2ZZP B;  4DWF A;  3LJ3 A;  3L0W B;  4RM8 A;  4FUL A;  4NAW A;  2O6V A;  2MQJ A;  4ZDV A;  2JY6 A;  4IWO A;  1Z5S B;  4WWN A;  1WR1 A;  4MGI E;  4BBN F;  2KJH B;  3H7P A;  2PJH A;  2D10 A;  3L17 A;  3ML8 A;  2I1K A;  3SHQ A;  1ZKH A;  2N9X A;  5GMV A;  3T9L A;  2MBB B;  5DPW A;  5CHW A;  2K8H A;  2ZEQ A;  4HJK A;  3SD5 A;  2XK5 B;  2B3A A;  4DHZ E;  2DHZ A;  2KXJ A;  1HE8 A;  1NBF C;  2BWF A;  1WIA A;  1NDD A;  2KN5 A;  4G3X B;  5DPS A;  2RSU A;  3RT3 B;  1WXM A;  2KC1 A;  2N9E B;  2KAN A;  2LXC A;  3EEC A;  3B08 A;  2K6D B;  4GB9 A;  3ZVV A;  4DK5 A;  4G0N B;  2XEW A;  1V80 A;  2CHX A;  1YX5 B;  1IPG A;  1S3S G;  4J6I A;  2AYO B;  1WX9 A;  1S1Q B;  1VD2 A;  4BOZ B;  3DBR I;  3OLM D;  2KX3 A;  2A5U A;  2WYQ A;  4GGQ A;  4MGK E;  3X23 A;  5D7G A;  5E6N A;  4F7Z A;  4KVG B;  5J18 A;  3PLU A;  2C5L C;  4MDK E;  2KWU B;  3N30 A;  1ISN A;  2KDE B;  4DHJ B;  5C23 A;  4PS7 A;  1V5O A;  1WJU A;  4GDK B;  4FA6 A;  2IZV B;  3AI5 A;  2A4Z A;  2L0T A;  4ICU A;  2LAS A;  3WAP A;  2KMA A;  3VUX A;  1E8X A;  2NCN A;  3VFK A;  4ANW A;  2L3Z A;  4WQO B;  2V3S A;  3R7R A;  1H8C A;  3KUD B;  2KNB A;  1OEY J;  4OVV A;  5EDS A;  4HPM B;  2JRH A;  3RYT A;  2YVC A;  4HXD A;  3JYU A;  3PVL A;  5LXI B;  2KWC A;  4NY0 A;  1TTN A;  1L2N A;  2MLB A;  4MM3 A;  1WGH A;  3A9J A;  2DEN B;  4B95 A;  4EUT A;  2I1J A;  2FAZ A;  2MBO A;  4DXA B;  2MBE A;  4W9E A;  4MSM B;  1WX8 A;  3VUY A;  1P3Q U;  2DZI A;  3PTF C;  2WX1 A;  3TBL D;  3ENE A;  1LM8 B;  4AWJ A;  4KV2 A;  4MH0 E;  4NJ6 A;  5IAA C;  3C0R B;  3APD A;  4EZK A;  4K7S A;  4K81 A;  3JSV A;  5L83 A;  3OJ4 B;  4AP4 C;  2DZJ A;  3IHP C;  2KX0 A;  2MCN B;  4TKN A;  2LGY A;  1H4R A;  3R7Q A;  2PE6 B;  4FN2 A;  2G4D B;  3ONS A;  4IW0 A;  3V6E B;  3QAQ A;  2DAJ A;  2AL6 A;  2KOX A;  2KQ7 A;  2L8J A;  1WMH A;  3H7S A;  3KUZ A;  2RR9 A;  2N9P C;  3UIO B;  3V62 A;  2BWE S;  2KVR A;  3ZLZ A;  4CO7 A;  4BOS C;  2VRR B;  3PLV A;  3M63 B;  4W9F A;  4WJQ A;  4G50 A;  3ZNG C;  1WJ6 A;  1KM7 A;  2JPH A;  2AL3 A;  2OOB B;  4JQW C;  4LJP B;  3EHV A;  3KYC D;  4K7W A;  4AJW A;  4MSQ B;  3U8Z A;  4GDL A;  2KLC A;  1WGD A;  2KKC A;  5LLI A;  4FLH A;  2M17 A;  1L7Y A;  2CU1 A;  2FID A;  3AU5 A;  3RZW C;  1IYF A;  2KTF A;  3PS6 A;  3ALB A;  4WJP A;  4A3P A;  4FHJ A;  1LFD A;  2GOW A;  2R2O A;  4GXB A;  4KIK A;  3DVG X;  2JVC A;  4E3C A;  2JF5 A;  4ZRI A;  2N1V A;  4PS8 A;  2MRP A;  3ZNI D;  4DDI D;  4FJZ A;  3A9K B;  3WAN A;  3N3K B;  3QX1 A;  4EKU A;  3QQ8 B;  3DPD A;  1EUV B;  2MA9 B;  1WJ4 A;  2HJ8 A;  1U4A A;  4W9D A;  4GSW A;  5AEK B;  1TBE A;  2HE7 A;  3APF A;  3LDZ E;  3CST A;  4WJN A;  4BKS D;  2ZVO A;  1T0Y A;  2UWQ A;  2DZM A;  3PHX B;  2KZR A;  3CF6 E;  3UQA A;  1KOT A;  4PYZ A;  2EMS A;  1MG8 A;  5CX3 A;  2JRI B;  2FCQ A;  1P0R A;  3ZNZ B;  1NI2 A;  3VAW A;  3OJ3 A;  5AZF A;  5C1Z A;  3UIN B;  2MWS B;  2V1Y A;  3QJZ A;  4DBG A;  3AU4 A;  4MEM A;  4II2 B;  4W9K A;  2DAF A;  2IY1 B;  1YJ1 A;  4NAW B;  2O6V B;  4BKS A;  2M4N A;  3NY5 A;  3TIX A;  1OQY A;  2XK5 A;  4IUM B;  2DYM A;  3H7P B;  2BYF A;  1XT9 B;  4KSK C;  3ZKJ C;  2RGF A;  3HK0 A;  2LZ6 A;  1P98 A;  3R3M A;  3H9D A;  4WWP A;  2AWT A;  4DHZ B;  3WA0 A;  1V2Y A;  3TCA A;  1KLV A;  1WFY A;  4ANU A;  1UEL A;  3V6C B;  4KZ0 A;  4ICV A;  3HM6 X;  2IBI B;  3ZO5 B;  4EFO A;  4FBJ B;  3L13 A;  3ZDT A;  2NVU I;  1SIF A;  1Q0W B;  1WXS A;  2QHO A; 
#chains in the Genus database with same CATH topology
 2IY0 B;  1KRH A;  3E9S A;  1HEZ E;  4RMA A;  3VR9 B;  1X1M A;  2CS4 A;  4IWQ A;  3ZNH B;  2J4X A;  3RNB C;  4FHK A;  4A9A A;  2L32 A;  1TJE A;  3A1Q A;  3B1L X;  3U4E G;  1J19 A;  2DZK A;  4IM0 A;  2PEA A;  4ZOH C;  3RNE C;  3JVZ X;  2ASQ A;  1HTQ A;  3P4P B;  1QZE A;  4FJV B;  3AV8 A;  3GB1 A;  4YXD B;  3PT2 B;  1UF0 A;  1XD3 B;  3KW5 B;  1RAX A;  3QC8 B;  3PRZ A;  2LGX A;  4PS3 A;  3ZGZ A;  4LCD E;  3DBS A;  1D5X C;  1EU4 A;  2PLP A;  4KZC A;  1YIW A;  1J7B A;  4MJS B;  2M0X A;  2NPT A;  2ONQ A;  2AQ3 B;  3V3X A;  3BY4 B;  1E7V A;  2ZW1 A;  2CHW A;  3GE8 C;  3L54 A;  2JXT A;  1FEH A;  5J17 A;  1JWS D;  2YLM A;  4II3 B;  2IGG A;  1JRU A;  3KUC B;  1F2R I;  2LVP A;  2PTL A;  3AE2 B;  1SE3 A;  2G45 B;  2UYZ B;  3ZXR A;  4L23 A;  2BTE A;  1IUE A;  2L52 A;  2WX0 A;  4R3D A;  2QIE B;  3K9O B;  2ZNV C;  4HK2 A;  5EE3 A;  1KTK A;  3CSF A;  2KJR A;  3V60 A;  3MC8 A;  1T0Q C;  4XGA B;  3RPF C;  4IWP A;  2ZNV B;  5JH5 C;  3GZN I;  2JUO A;  2WXQ A;  4C7Y A;  2BQQ A;  2GRI A;  2BYE A;  3N1Y C;  4OVU A;  2KFJ A;  1T0R C;  2D3A A;  2D11 A;  2VH1 A;  2M1M A;  5AZH A;  3VDZ A;  3ZRC A;  4HDO A;  4YSZ B;  1PGA A;  2KK8 A;  3L16 A;  3ZJT A;  3PV1 A;  3TL5 A;  4C80 A;  2ZJD A;  1WX7 A;  1ZW7 A;  1UGM A;  3DQV A;  5J2R A;  4GU2 A;  2BT6 A;  4RM9 A;  1SB3 C;  2KAC A;  1FNW A;  1WM2 A;  3RUL A;  1RLF A;  4LK0 M;  1TIF A;  2EKI A;  3VHT C;  3CIR B;  4L1B A;  4NNJ B;  1TS2 A;  3KWV A;  2MW5 A;  2FCS A;  1E8W A;  4C7Z A;  2LVO A;  2BKF A;  2W9N A;  3MFG A;  2MJE A;  4JPS A;  2L7R A;  1GC6 A;  3R2I A;  1I42 A;  1NVI D;  3Q8E A;  1VJK A;  4KSL C;  3QHT A;  2WXF A;  3E56 A;  1R4N I;  1OEY A;  3NG0 A;  2KHW B;  1EWY C;  1L0X B;  3NZS A;  2K6Q A;  3V05 A;  2V4L A;  1GG3 A;  2N4F A;  3Q8C A;  1DYQ A;  5E6O A;  5IN7 A;  3RCZ A;  4D2K A;  3AE8 B;  1V49 A;  1WGR A;  1P9D U;  1WXV A;  2J0M A;  4AUQ C;  1I7H A;  1HQR D;  2KDF B;  5BO4 B;  2ZCC A;  1M94 A;  1YN4 A;  3O65 B;  2RDB C;  3DVN V;  5BYR A;  1FFU A;  2PPH A;  2RD0 A;  1ZP0 B;  4CYE A;  1WRD B;  1N61 A;  1ZUD 2;  5H8Y E;  1AWD A;  1QOF A;  1MPE A;  4MAC A;  2CU3 A;  4ZYN A;  4MEL A;  1ZGU B;  2FNJ B;  4CHK A;  1FXT B;  4HRO A;  4W9C A;  2JWU A;  4BFR A;  1QLB B;  3M95 A;  1MHX A;  4XDC A;  1JQ4 A;  2QC8 A;  3W1S C;  3WAO A;  3KVF B;  2IND C;  3N1Z C;  5FR6 A;  4HVB A;  1KH0 A;  4FJY A;  2ON8 A;  4GOC A;  3ECI A;  3UIP B;  4M0W B;  4LJO B;  1J0G A;  1VDV A;  2D5G A;  1WJN A;  3N20 C;  2BYT A;  1WXA A;  3NUH B;  2IO2 B;  2N1W A;  1TY2 A;  4DWF A;  5IP4 D;  2IDY A;  1Z5S B;  4BBN F;  2L83 A;  2PJH A;  3SFD B;  1YOV B;  2K8H A;  1CQV A;  4HPP A;  2ACZ B;  3SD5 A;  3HVZ A;  2DHZ A;  4RGO S;  1NBF C;  1NDD A;  1WRI A;  4IKG A;  1GB4 A;  2RSU A;  4S17 A;  1EM7 A;  2KAN A;  5D3D A;  4GB9 A;  1T5X D;  3DBR I;  2WYQ A;  2KAJ A;  3DHG C;  4ZHO A;  2OED A;  1TKY A;  1C78 A;  4F7Z A;  2KWU B;  2K5P A;  1R7S A;  2KDE B;  4DHJ B;  1C79 A;  1VR9 A;  1WJU A;  4GDK B;  1J7A A;  2A4Z A;  1PFD A;  3MJ5 A;  4ICU A;  2FBW B;  2EEL A;  5JXV A;  1I4R A;  3R7R A;  1H8C A;  1NEN B;  2JRH A;  3RYT A;  1MVK A;  3GZN B;  5EE9 A;  5D3I B;  2MBO A;  4DXA B;  2MBE A;  4W9E A;  2QEJ C;  1WX8 A;  3VUY A;  3P4Q B;  3TBL D;  3ENE A;  4AWJ A;  1IGD A;  2WLB A;  1IBX B;  2PVG C;  4AP4 C;  4C4V B;  3H8H A;  2DZJ A;  2KX0 A;  2MCN B;  2LGY A;  3TSS A;  2PE6 B;  4IW0 A;  2KOX A;  1AW7 A;  3NVZ A;  3TEX A;  1WMH A;  2RR9 A;  2N9P C;  5IO9 A;  3V62 A;  3UI3 A;  3Q3M C;  4BOS C;  3BWU D;  1ENF A;  4JQW C;  3EHV A;  4K7W A;  3Q2A C;  3Q3O C;  4MSQ B;  1WGD A;  5LLI A;  4TSS A;  3P63 A;  3ALB A;  2WU2 B;  4FHJ A;  1LFD A;  1GB1 A;  1M4V A;  3DVG X;  2JF5 A;  2N1V A;  2MEK A;  4FJZ A;  3QX1 A;  3DPD A;  1WJ4 A;  2RPV A;  1QOG A;  3LDZ E;  1R4N B;  1TS3 A;  1T0Y A;  2KZR A;  1EWC A;  3CF6 E;  3ABV B;  3RFZ B;  3UQA A;  1MG8 A;  2FCQ A;  3ZNZ B;  2WNM A;  5BMG A;  1NI2 A;  4NAM A;  2V1Y A;  2SAK A;  1K50 A;  2MJ3 A;  2M4N A;  5C3J B;  1FPY A;  2XK5 A;  1XT9 B;  2RGF A;  3HK0 A;  3R3M A;  4WWP A;  2AWT A;  4DHZ B;  3TCA A;  4ANU A;  3V6C B;  2IJ0 A;  4ICV A;  4FBJ B;  3L13 A;  1WXS A;  1WE6 A;  1GNU A;  3WAL A;  4RFB A;  1RFK A;  3RMK C;  4BVU C;  4US8 A;  4AOF A;  1FM0 D;  1J8C A;  2LD9 A;  3MJW A;  4OZA A;  3U2S C;  2JZZ A;  1QKZ A;  4JL9 A;  4W9G A;  1F0Z A;  2RPQ A;  1A5R A;  2LXA A;  3N32 A;  4K7U A;  2WXM A;  2ZVN A;  2GBK A;  4HDQ A;  2X8X X;  3W5U B;  1GAQ B;  2I38 A;  4M8M A;  1EU3 A;  3TMP B;  3VR8 B;  4E71 A;  1JAL A;  2BYV E;  2KTR A;  2WXH A;  5FKA C;  4F1S A;  1YD8 U;  2KO3 A;  1JML A;  5FK9 C;  1P1A A;  5H92 C;  1J7C A;  4HCN B;  1D5Z C;  1UWX A;  2VH2 A;  1R4M I;  1WYW B;  3VTV A;  3X0W A;  1DOI A;  2LVQ A;  1HZ6 A;  1Q5W B;  3NZ3 A;  4E74 A;  3GE3 C;  1CK1 A;  3AH7 A;  3DVN U;  5D2M B;  4XWW A;  3KLS X;  2KFK B;  2N7E A;  3ZUN A;  3BIN A;  4B9K A;  3KH0 A;  3S2A A;  4K1R B;  2WDT B;  4JLC A;  1CMX B;  4I6L B;  4ZRJ A;  3V61 A;  2L0F A;  1GPX A;  1QOA A;  3L08 A;  5C2T B;  2EKE C;  3DBH I;  1YX6 B;  2PVO D;  2Z0D B;  4DDG D;  2HJ1 A;  2JZ3 B;  3DBR B;  2V3N A;  4I6N B;  1UH6 A;  4N9F 4;  4J3O D;  5JHB A;  3EC8 A;  3Q3F A;  4BKG A;  2KQS A;  2BPS A;  2BGF A;  1QQR A;  2FCN A;  2GB1 A;  4KIK B;  2ICI A;  5LNK 1;  1WE7 A;  4YSY B;  4YSX B;  3HUI A;  3MC9 A;  3LB8 C;  4A3O A;  3NVY A;  4W9L A;  2FCM A;  2Z8L A;  1YN3 A;  4ITK A;  3DBL I;  1V1P B;  2QMT A;  1QF6 A;  4DHJ D;  3Q3J A;  1TZ1 A;  1DOX A;  3UQB A;  1F77 A;  2TSS A;  3H1U A;  2C7H A;  3NS8 A;  2CR5 A;  1NEK B;  1SXT A;  3GP7 A;  5DPT A;  2HDE A;  1OGW A;  1OQQ A;  1V86 A;  5DCN A;  4FAD A;  1MI0 A;  5G55 A;  2J0J A;  3VXW A;  4KKI A;  1E9M A;  1YQ3 B;  1V1O A;  1GC7 A;  4W9J A;  3AUL A;  2KMC A;  1WI0 A;  1AAR A;  2PE9 A;  4M01 A;  3DCG A;  3ZW3 A;  4NPN A;  1UZX B;  3JW0 X;  2LRU A;  2IO1 B;  3A1Q B;  4A8X C;  3IFW B;  2DYO A;  3ETR A;  2C9W B;  3Q6B A;  4HPL B;  1IP9 A;  5AZG A;  2AX5 A;  1PYW D;  2ZPY A;  1TZO A;  4NJ7 A;  2MSE D;  2MBH A;  1FCC C;  2XBB C;  4MJS A;  2K39 A;  3HIZ A;  4TQ1 A;  1FO4 A;  3AE9 B;  4RH6 A;  5IOI A;  2L00 B;  4MGY E;  5HHD G;  4AS1 A;  4LNN A;  1A70 A;  2NPT B;  1VRA B;  2JXX A;  3AN1 A;  3HM3 A;  1BXT A;  4URK A;  3HHM A;  1AN8 A;  2AEH A;  3H6N A;  3I63 C;  4LTU A;  4RGN A;  1ZOY B;  4BBN C;  1V81 A;  1Z2M A;  1V9J A;  1WY8 A;  2NS5 A;  3PHW B;  4ARC A;  3DHI C;  2N0S B;  4A20 A;  1GUA B;  2K3U A;  2BB5 A;  2V3P A;  3SU8 X;  3BK2 A;  4ANX A;  1F52 A;  3AXC A;  3QAR A;  2OJR A;  2IPK D;  2Z0E B;  4HKZ E;  3VQI A;  2KJ6 A;  5EE0 A;  1XLO A;  3IVF A;  1FRD A;  4USA A;  1RRB A;  2V9H A;  4FUL A;  2O6V A;  1DGJ A;  2JY6 A;  2WXJ A;  3FAH A;  3H7P A;  3DWG C;  3L17 A;  1P7E A;  3BYT B;  5AUK A;  2Y5C A;  5GMV A;  3T9L A;  1E7P B;  2INP E;  2ZEQ A;  5DPS A;  1C4A A;  4YTN B;  2N9E B;  3RI7 C;  2LXC A;  3B08 A;  3FKY A;  2WHI A;  4G0N B;  1L6U A;  1D5M C;  1S3S G;  3IT4 B;  4MH8 A;  1D4B A;  1S1Q B;  4P6V F;  4BOZ B;  1VZ6 A;  3X23 A;  4MGK E;  1V8C A;  1ZPS A;  5HFY A;  3DBH B;  4KVG B;  1P7F A;  5J18 A;  3PLU A;  5BYS A;  3N30 A;  1ACC A;  1V5O A;  3AED B;  2L0T A;  2KVZ A;  3VUX A;  4ANW A;  2N9L A;  4OVV A;  2H89 B;  3CWI A;  2YVC A;  5LXI B;  4NY0 A;  3NVW A;  1L2N A;  1PDX A;  1JRP A;  1ZXI A;  3EA6 A;  5G5G A;  1ZE3 D;  3L4P A;  3NJT A;  3PTF C;  2OHF A;  5G5H A;  4KV2 A;  1FXA A;  4K81 A;  1BUI C;  3JSV A;  3OJ4 B;  1NI3 A;  5L83 A;  1OFF A;  3IHP C;  1JW9 D;  1T6B X;  3ONS A;  3V6E B;  2JZP A;  2WXR A;  3DBL B;  2L8J A;  3H7S A;  4RGT A;  4Q2J A;  1N62 A;  1N6Z A;  2VRR B;  4ZHP A;  3PLV A;  3M63 B;  1WJ6 A;  4LJP B;  4AJW A;  2Q5W D;  3U8Z A;  2WDV B;  2BS4 B;  4GDL A;  4FLH A;  2CU1 A;  4EE2 A;  2FID A;  3RN9 C;  4WJP A;  2GOW A;  2R2O A;  2W3R A;  2JVC A;  3ZYY X;  2MRP A;  1TYG B;  3BII D;  4US9 A;  3WAN A;  1XCT L;  4EKU A;  2LJI A;  2HJ8 A;  4W9D A;  3W9C B;  4GSW A;  5AEK B;  3IXS A;  4WJN A;  3URY A;  1QOB A;  4BKS D;  3PHX B;  3DHH C;  2EMS A;  5CX3 A;  1P0R A;  5EE1 A;  2YEP B;  4DBG A;  2N9K A;  4WUR A;  2IY1 B;  1YJ1 A;  2BVC A;  2XN9 C;  3EGR A;  3TIX A;  4IUM B;  2PKO A;  3C19 A;  2BYF A;  2CJN A;  1KFY B;  3Q8A A;  3ZKJ C;  3J9C A;  2LZ6 A;  4N6E B;  1SBB B;  5BMI A;  1L5P A;  3WA0 A;  1KLV A;  1WFY A;  2DLB A;  1UEL A;  2IBI B;  1FRR A;  1SF0 A;  4ARI A;  4TKN A;  2QHO A;  1I4G A;  4NZL B;  4KDI C;  2K8C A;  3ML9 A;  3VRA B;  1WGK A;  2INN E;  2CKH B;  3ZRF A;  3QCA A;  4XZ4 A;  1WXQ A;  1TY0 A;  2J0K A;  4P7I A;  2XNA C;  2WXK A;  2WDR B;  4IC7 B;  5DPR A;  4BKT A;  3AE6 B;  3K9P B;  2V0G A;  3W2D A;  2MP2 A;  3WAM A;  1ZDV A;  1TGZ B;  1JWA D;  2B76 B;  2K8B A;  5CTR C;  1I35 A;  3KQ4 A;  1GOZ A;  1XF5 L;  3ZTD A;  1NYQ A;  1UBQ A;  1XEE A;  3ZQ4 A;  4JWU C;  2KDB A;  3AEC B;  1SIF A;  4S0R A;  2BW2 A;  4EOY A;  3U7D A;  1ZDX A;  2L76 A;  2G9H D;  2NBV B;  2PIA A;  2VZK B;  3D32 A;  5E6J A;  2DX5 B;  4EEW A;  3PSE B;  1YN5 A;  3DWM A;  5BMH A;  4MGZ E;  2KLG A;  2Y5B B;  2LI5 A;  2J7Q B;  2R2Q A;  4GN1 A;  2ZPN A;  3PZ8 A;  1UD7 A;  1E6E B;  2AQ1 B;  1N63 A;  4HCP B;  1XLN A;  3VTW A;  2BKR B;  1XQQ A;  3MHS D;  4IG7 B;  2KDI A;  3I3T B;  3NOB A;  1XCQ L;  3FC4 A;  3ZIM A;  2J52 A;  1PGB A;  3QWZ B;  1E8Z A;  1MFW A;  2JWZ A;  4ANV A;  3B0A A;  2NMQ A;  3L10 B;  5TR5 A;  2O2V B;  4NQK E;  4JX1 C;  3Q8B A;  2K25 A;  1E5W A;  4YTM B;  3IT6 B;  3FIL A;  4M02 A;  4HRS A;  1PQS A;  1C3T A;  1UNS A;  4LNO A;  2L05 A;  2M8S A;  2GBM A;  3AEE B;  2Y5P A;  2LHE A;  2ZCB A;  1EO6 A;  2BB6 A;  4IDI A;  5HKH A;  4AJY B;  1CZP A;  1EF1 A;  3R8B A;  3AB5 A;  2LGS A;  3P42 A;  2WWZ A;  3U52 E;  1WH3 A;  4HKQ A;  2WXN A;  2M19 A;  2D07 B;  1VZ8 A;  3VRB B;  2NTS A;  2JSV X;  2GMI C;  5HI1 A;  1KLG D;  1SE2 A;  2M0A A;  4X57 B;  2QSD A;  1WZ0 A;  3SFE B;  3R2T A;  4ZYS A;  2KT7 A;  1UWM A;  4WAA A;  4ZRP A;  4IM2 A;  2IO3 B;  2K0P A;  1GJZ A;  5LXH A;  1KF6 B;  3A4S C;  4P1C C;  1K8R B;  1Q10 A;  3DOW A;  4CQN A;  1C77 A;  1F9J A;  3QK0 A;  1E90 A;  2JX5 A;  1HTO A;  4RF1 A;  3VTU A;  4I6P A;  4ASW C;  1V5T A;  2C7M B;  2DWQ A;  2G3Q B;  1WGY A;  5CHF A;  2W54 A;  3M3J A;  3VVW B;  3RNA C;  3U7Z A;  2BF8 B;  4MM3 B;  3A9J B;  5KHO A;  4KKJ A;  2KTR B;  2WU5 B;  2KYW A;  1VCB A;  4P1B C;  1L0Y B;  5E6P A;  2NBU A;  2QJL A;  4OHJ A;  4LDT D;  3UF8 A;  3TJP A;  1LXD A;  2CHZ A;  4XX5 A;  2KFK A;  4GIV A;  4XE0 A;  3N1X C;  3A33 B;  3W5V B;  3PRE A;  1XLQ A;  2NBW B;  2LHD A;  4A90 A;  4F8C B;  2NR2 A;  3NZU A;  4BZA A;  2C60 A;  1WZ3 A;  2JYT A;  4JGH B;  5L95 C;  3NVV A;  3PPA A;  2HTM E;  1WYG A;  2JQR B;  2GBJ A;  2N7J A;  3LYY A;  1V6E A;  3CMM B;  3VH4 B;  1Q1O A;  3ZDM C;  2OJW A;  1JWB D;  4EZJ A;  3A9K A;  4XWT A;  3IG3 A;  1FD6 A;  2LUE A;  4K3B A;  4XDD A;  5D94 A;  2BS2 B;  4A6Q A;  3I5J C;  4OZC A;  1N5X A;  2PW9 A;  2J42 A;  1C4C A;  2REX A;  2LGI A;  2QCZ A;  3LXF A;  2W82 A;  3Q14 C;  4KGS A;  4BAX A;  4EZL A;  1LQB A;  1XLP A;  4JWS C;  4NAW A;  2MQJ A;  4ZDV A;  1TKE A;  4IWO A;  1WR1 A;  2KJH B;  2D10 A;  3ML8 A;  1FIQ A;  2I1K A;  3SHQ A;  1PGX A;  1ZKH A;  1N60 A;  4OZB A;  5DPW A;  3P4R B;  4HJK A;  2B3A A;  4DHZ E;  2KXJ A;  4G3X B;  3RT3 B;  4LLG M;  2KC1 A;  4QAY A;  3EEC A;  4DK5 A;  2XEW A;  1V80 A;  1I4P A;  2CHX A;  1YX5 B;  3BVG A;  1WX9 A;  1VD2 A;  4C56 C;  1YQ4 B;  3AE1 B;  3AEA B;  3OLM D;  2A5U A;  2IGH A;  5E6N A;  1C4P A;  1B9R A;  4MDK E;  4FXC A;  2WGS A;  4OW0 A;  4PS7 A;  3WAP A;  2KMA A;  1E8X A;  4WQO B;  2V3S A;  3NS1 A;  3KUD B;  2KNB A;  1OEY J;  4HXD A;  3JYU A;  1K51 A;  3ZJU A;  2LFI A;  2MLB A;  2VZK D;  4KGR A;  1YNT E;  4C00 A;  2RDG A;  2FAZ A;  4WAF A;  4MSM B;  1P3Q U;  2WX1 A;  4WWM A;  4MH0 E;  4NJ6 A;  5IAA C;  3C0R B;  3APD A;  4EZK A;  4K7S A;  2G1E A;  1T0S C;  2X38 A;  2G4D B;  3ZJV A;  2KQ7 A;  1FMA D;  1FNV A;  2FE8 A;  3KUZ A;  1HA5 A;  3P1M A;  2L1A A;  3ZLZ A;  3PZ7 A;  4CO7 A;  2ZW0 A;  2WXG A;  4LNI A;  1MG4 A;  4W9F A;  4G50 A;  3ZNG C;  1TS5 A;  1SEB D;  3KYC D;  1CJE A;  3AMZ A;  2NTT A;  2CJO A;  1L7Y A;  4A55 A;  1SSN A;  3PS6 A;  1RM6 C;  4GXB A;  1FFV A;  2D3B A;  4PS8 A;  4DDI D;  2JU6 X;  3N3K B;  3MHZ A;  3TEY A;  1EUV B;  2MA9 B;  4RGM A;  4B0M A;  4DXG A;  2HE7 A;  3APF A;  4JE3 B;  2DNF A;  1VZ7 A;  3CST A;  3Q69 A;  2QDF A;  2W55 A;  2UWQ A;  2DZM A;  2W3S A;  2WXO A;  1R4M B;  3VAW A;  5AZF A;  1I4Q A;  3QJZ A;  4MEM A;  4II2 B;  4W9K A;  2O6V B;  1OQY A;  4TMA B;  3H7P B;  4KX6 B;  3GS2 A;  4RNA A;  1JCK B;  1P98 A;  3H9D A;  1V2Y A;  5GXG B;  2K9X A;  2V4I B;  1D6E C;  3ZDT A;  3ZXV A;  1VLB A;  1Q0W B;  2K22 A;  2FUG 1;  3ZTC A;  1YJJ A;  2LMC A;  3OWE B;  4K3C A;  5MPO A;  4TQ0 A;  1I4X A;  1HXY D;  4W9H A;  3RUI B;  2FIF A;  2MJD A;  4YWG G;  2KD0 A;  4AQ7 A;  2RDH A;  1E10 A;  4GLS C;  3C8Y A;  5CHV C;  3NRZ A;  2GBN A;  3DDC B;  4ACF A;  4ZRK A;  4YT0 B;  2K1F A;  3MTN B;  4HJG E;  2DBY A;  2C7N B;  1FXI A;  1XO3 A;  1JWU D;  1Y8R C;  4TV3 A;  3PRP B;  3A4R A;  3NHE B;  3I57 A;  3R66 C;  3OAW A;  3AE3 B;  1ESF A;  2BBC A;  3VH3 B;  3GOE A;  3BVZ A;  2KN4 A;  1C1Y B;  4WH4 A;  3JSV B;  4KDL B;  5I4D A;  2D3G A;  1B1Z A;  1V97 A;  3AE7 B;  1WGG A;  4NJC A;  2H88 B;  4B0E A;  2HD5 B;  3PRM B;  1WSP A;  4LDT B;  4HLE A;  1L4Z B;  1SE9 A;  2LJ5 A;  3Q8F A;  3EFU A;  4LNF A;  4RF0 A;  3PZD A;  1OTR B;  3EUB 2;  3AE4 B;  2I2Y A;  1I4H A;  2MX2 A;  2MHJ A;  2JT4 B;  1E7U A;  4KGT A;  4M0W A;  2LGD A;  3W1S A;  1D3Z A;  4GDL B;  1SJE D;  1JWM D;  1ROE A;  2WP9 B;  3QA8 A;  4HWI B;  4P16 A;  4H2A A;  3BYY B;  2WS3 B;  1UBI A;  3RZF A;  4W9I A;  3KYD D;  2KWD A;  1MJD A;  4PT5 A;  4M8N A;  2RMM A;  4TUU A;  1Y56 A;  4WWO A;  1PUT A;  4L2Y A;  2IYD B;  2LWP A;  1IGC A;  1WWT A;  4XC2 A;  5G2N A;  3U30 A;  4N59 A;  3N9Y C;  1G6J A;  4MT5 A;  3M62 B;  3I9V 1;  5KHQ A;  4DXF A;  3IAS 1;  5BYQ A;  2Y3A A;  1N5W A;  3RNC C;  3AEF B;  2HTH A;  4JIO U;  4GMV A;  1RWS A;  3MC0 B;  1YQB A;  3T8M A;  1KLU D;  4HEA 1;  1EF5 A;  5JZE B;  2GBR A;  1ET6 A;  1YMH E;  3DVG Y;  1F2R C;  4NQL B;  3APC A;  4GDK A;  3P2B A;  4IOI E;  3Q3N C;  1QT9 A;  2D2Q A;  2Z59 B;  1L0V B;  3TUO A;  1SGH A;  1SJH D;  1NYR A;  1JRO A;  1MHH E;  3IBE A;  5D6J B;  1K52 A;  4ZRQ A;  3WIM A;  1TKG A;  3KWL A;  1RFA A;  1SIJ A;  3WCQ A;  3UGB B;  1E8Y A;  2MP2 B;  4PYU A;  3B2F A;  2QIL A;  1IBX A;  2KWV B;  1OQR A;  2WXP A;  3TEW A;  5AUI A;  4C4V A;  4G11 A;  3AEG B;  1XXG A;  2MBQ A;  2FUH B;  3T3N A;  5FR3 A;  1KJT A;  1YJI A;  3TEZ A;  1WMH B;  1LO5 D;  4UDU C;  4B6W A;  3RNF C;  2UU7 A;  3AE5 B;  1ZXH A;  3W1Y A;  2KC2 A;  2N7D A;  1WR6 E;  5IA7 A;  2EMT A;  4WJO A;  3O13 A;  1WF9 A;  2LRW A;  3QIJ A;  2GI9 A;  1FNU A;  1TT5 B;  1F1H A;  3T3O A;  1BT0 A;  3VUW A;  2O6V D;  2DYB A;  1STE A;  4IM3 A;  2WXL A;  2O2V A;  3RD2 A;  3SDL C;  2JYE A;  3PGE A;  1WM3 A;  4WIP A;  5JHA A;  2IO0 B;  3SEB A;  4YL8 A;  2G4S A;  2ZZP B;  3LJ3 A;  2KDM A;  3L0W B;  4RM8 A;  3B9J A;  3HVD A;  4WWN A;  4MGI E;  1L4D B;  3BZD B;  4XYC A;  3FIL B;  2N9X A;  2MBB B;  5CHW A;  4DQO C;  1ET9 A;  2XK5 B;  1HE8 A;  2KQ4 X;  2BWF A;  1WIA A;  2KN5 A;  2E3T A;  1QIL A;  1WXM A;  2SEB D;  1FCL A;  1SE4 A;  2K6D B;  3ZVV A;  3MP9 A;  4YTP B;  1IPG A;  4J6I A;  2AYO B;  4GGQ A;  2KX3 A;  5D7G A;  2INC C;  1T3Q A;  2BS3 B;  2C5L C;  2YEP F;  3SR6 A;  1ISN A;  5C23 A;  4FA6 A;  2IZV B;  3AI5 A;  3B2G A;  2LAS A;  1TS4 A;  2NCN A;  3VFK A;  2L3Z A;  3AEB B;  3PO0 A;  5EDS A;  1DOY A;  4HPM B;  4LNK A;  1UGJ A;  3PVL A;  2KWC A;  1TTN A;  1C76 A;  2J53 A;  4MM3 A;  1WGH A;  2LUM A;  3A9J A;  3OG5 A;  2DEN B;  4B95 A;  4EUT A;  2I1J A;  3RNG C;  3P4S B;  2DZI A;  2LEK A;  1HZ5 A;  1LM8 B;  1E0Z A;  2KMM A;  2WDQ B;  4N58 A;  4M00 A;  1H4R A;  3R7Q A;  2WXI A;  4FN2 A;  3QAQ A;  2DAJ A;  2AL6 A;  2AQ2 B;  2D3C A;  3UIO B;  4REZ A;  2BWE S;  2KVR A;  5T8I A;  1K53 A;  2PMV A;  4WJQ A;  1KM7 A;  2JPH A;  2AL3 A;  2OOB B;  2MH7 A;  4OVZ A;  2R61 A;  4RCO A;  2GLS A;  2KLC A;  2KKC A;  2M17 A;  3AU5 A;  3RZW C;  1IYF A;  2IGD A;  2KTF A;  2WQY B;  1LGR A;  4A3P A;  1AYF A;  4KIK A;  4E3C A;  2E6X A;  4ZRI A;  1C9F A;  3BK1 A;  3ZNI D;  5IKC M;  3A9K B;  3QQ8 B;  1BML C;  1U4A A;  3AM9 A;  1TBE A;  3EFC A;  1UUP A;  4O1N A;  2ZVO A;  1KOT A;  4PYZ A;  2JRI B;  5TSS A;  3OJ3 A;  5C1Z A;  3UIN B;  2MWS B;  1L6V A;  1V1P A;  3AU4 A;  2DAF A;  2M56 B;  4NAW B;  4BKS A;  3NY5 A;  4WQM A;  3HRD D;  2DYM A;  1RYJ A;  4KSK C;  3IAM 1;  4KZ0 A;  3ZO5 B;  3HM6 X;  4EFO A;  4PK1 A;  5HG2 A;  2NVU I;  3BVM A; 
#chains in the Genus database with same CATH homology
 2IY0 B;  1WE6 A;  3ZTC A;  1GNU A;  3WAL A;  4KDI C;  2K8C A;  3ML9 A;  4BVU C;  2CKH B;  4AOF A;  4TQ0 A;  3ZRF A;  3QCA A;  4XZ4 A;  4RMA A;  1J8C A;  2LD9 A;  1X1M A;  2CS4 A;  2J0K A;  3MJW A;  4IWQ A;  4W9H A;  3RUI B;  3ZNH B;  2FIF A;  2JZZ A;  4P7I A;  4JL9 A;  4W9G A;  4FHK A;  2KD0 A;  2RPQ A;  1A5R A;  2LXA A;  3A1Q A;  3B1L X;  3N32 A;  4K7U A;  1J19 A;  2ZVN A;  2DZK A;  4IM0 A;  2GBK A;  2PEA A;  4HDQ A;  4IC7 B;  5DPR A;  4BKT A;  3K9P B;  5CHV C;  2GBN A;  3DDC B;  3JVZ X;  4M8M A;  4ZRK A;  2MP2 A;  2ASQ A;  4E71 A;  2K1F A;  3TMP B;  3WAM A;  2BYV E;  2KTR A;  1QZE A;  1TGZ B;  4FJV B;  3MTN B;  2K8B A;  4F1S A;  1YD8 U;  2KO3 A;  5CTR C;  1I35 A;  3PT2 B;  1XD3 B;  2C7N B;  1P1A A;  3KW5 B;  3ZTD A;  1RAX A;  3QC8 B;  4HCN B;  1Y8R C;  3PRZ A;  1R4M I;  1UBQ A;  1WYW B;  2LGX A;  4PS3 A;  4TV3 A;  3VTV A;  3X0W A;  3PRP B;  2KDB A;  4LCD E;  2LVQ A;  3DBS A;  3A4R A;  4KZC A;  1Q5W B;  3NHE B;  1YIW A;  4MJS B;  4EOY A;  2M0X A;  3R66 C;  4E74 A;  3OAW A;  3U7D A;  2NPT A;  3DVN U;  5D2M B;  2L76 A;  3BY4 B;  3VH3 B;  3GOE A;  2NBV B;  1C1Y B;  1E7V A;  2CHW A;  2KFK B;  2N7E A;  3JSV B;  3ZUN A;  3L54 A;  3BIN A;  4KDL B;  4B9K A;  2D3G A;  3KH0 A;  3D32 A;  5J17 A;  3S2A A;  4K1R B;  2WDT B;  4JLC A;  1CMX B;  2DX5 B;  2YLM A;  4II3 B;  4I6L B;  4ZRJ A;  4EEW A;  3PSE B;  1WGG A;  3V61 A;  2L0F A;  2HD5 B;  1JRU A;  3PRM B;  2KLG A;  3L08 A;  4LDT B;  4MGZ E;  4HLE A;  1SE9 A;  2LJ5 A;  2Y5B B;  2LI5 A;  2J7Q B;  2R2Q A;  3EFU A;  3KUC B;  3PZD A;  4GN1 A;  2LVP A;  2ZPN A;  2EKE C;  3DBH I;  1OTR B;  1UD7 A;  4HCP B;  3VTW A;  2BKR B;  1XQQ A;  2G45 B;  1YX6 B;  3MHS D;  2Z0D B;  2UYZ B;  4DDG D;  4IG7 B;  2MX2 A;  2KDI A;  2JZ3 B;  2JT4 B;  4I6N B;  2WX0 A;  1UH6 A;  3I3T B;  1E7U A;  3K9O B;  4N9F 4;  2LGD A;  2ZNV C;  3NOB A;  4HK2 A;  3W1S A;  1D3Z A;  4GDL B;  3CSF A;  5JHB A;  3ZIM A;  2KJR A;  3EC8 A;  3V60 A;  3Q3F A;  3QA8 A;  4HWI B;  4BKG A;  2KQS A;  3QWZ B;  1E8Z A;  4IWP A;  2ZNV B;  5JH5 C;  2JWZ A;  4ANV A;  3GZN I;  2BPS A;  2BGF A;  2JUO A;  2FCN A;  1UBI A;  3RZF A;  4KIK B;  4W9I A;  3B0A A;  3KYD D;  3L10 B;  5TR5 A;  2O2V B;  4NQK E;  2BYE A;  4OVU A;  2KFJ A;  2K25 A;  1E5W A;  1WE7 A;  2D11 A;  4M8N A;  4TUU A;  2M1M A;  4WWO A;  5AZH A;  3VDZ A;  3ZRC A;  2IYD B;  2LWP A;  1PQS A;  4HDO A;  1C3T A;  2KK8 A;  4XC2 A;  2L05 A;  2M8S A;  3L16 A;  5G2N A;  3U30 A;  2GBM A;  3PV1 A;  3TL5 A;  1G6J A;  2ZJD A;  4A3O A;  4W9L A;  1WX7 A;  3M62 B;  1ZW7 A;  2ZCB A;  1EO6 A;  5KHQ A;  2FCM A;  5HKH A;  4AJY B;  1EF1 A;  1UGM A;  3DQV A;  5J2R A;  2WWZ A;  3DBL I;  4GU2 A;  1WH3 A;  4DHJ D;  3Q3J A;  1TZ1 A;  2D07 B;  2HTH A;  4RM9 A;  3UQB A;  4JIO U;  3H1U A;  4GMV A;  2C7H A;  3NS8 A;  2CR5 A;  5DPT A;  1WM2 A;  3RUL A;  1RLF A;  2GMI C;  1OGW A;  1YQB A;  4X57 B;  1WZ0 A;  1V86 A;  3T8M A;  3VHT C;  5DCN A;  1EF5 A;  4NNJ B;  5JZE B;  2GBR A;  3DVG Y;  4WAA A;  2MW5 A;  4FAD A;  2FCS A;  1E8W A;  4NQL B;  5G55 A;  2LVO A;  2BKF A;  2J0J A;  2W9N A;  3APC A;  3P2B A;  4GDK A;  4IM2 A;  3VXW A;  2IO3 B;  1GJZ A;  5LXH A;  2L7R A;  2D2Q A;  1GC7 A;  3A4S C;  4W9J A;  2Z59 B;  3AUL A;  1K8R B;  2KMC A;  1WI0 A;  3DOW A;  1GC6 A;  1AAR A;  1SGH A;  1F9J A;  2PE9 A;  3QK0 A;  1I42 A;  1E90 A;  3VTU A;  4I6P A;  3DCG A;  4KSL C;  4NPN A;  4ASW C;  1UZX B;  1V5T A;  3QHT A;  3ZW3 A;  2C7M B;  2G3Q B;  1R4N I;  1OEY A;  3IBE A;  2LRU A;  1WGY A;  3JW0 X;  5CHF A;  2IO1 B;  2KHW B;  3A1Q B;  5D6J B;  3IFW B;  2DYO A;  3M3J A;  3VVW B;  3NZS A;  2C9W B;  2K6Q A;  2V4L A;  3WIM A;  4HPL B;  1GG3 A;  2N4F A;  1IP9 A;  1RFA A;  5AZG A;  2BF8 B;  1E8Y A;  3UGB B;  5E6O A;  2MP2 B;  3A9J B;  4PYU A;  5KHO A;  2ZPY A;  3RCZ A;  2KWV B;  2KTR B;  1V49 A;  1WGR A;  4NJ7 A;  1P9D U;  1WXV A;  2J0M A;  2MSE D;  4G11 A;  4AUQ C;  1VCB A;  2KDF B;  2ZCC A;  5BO4 B;  1M94 A;  5E6P A;  3O65 B;  2MBQ A;  2FUH B;  2MBH A;  2XBB C;  2NBU A;  4MJS A;  2K39 A;  4LDT D;  3DVN V;  3UF8 A;  3HIZ A;  4TQ1 A;  2PPH A;  2RD0 A;  3TJP A;  1LXD A;  2CHZ A;  2L00 B;  4XX5 A;  4MGY E;  4CYE A;  2KFK A;  4GIV A;  1WRD B;  3A33 B;  1KJT A;  3PRE A;  2NPT B;  2NBW B;  2JXX A;  4F8C B;  1WMH B;  2NR2 A;  3HM3 A;  3NZU A;  4B6W A;  4ZYN A;  2C60 A;  4URK A;  1WZ3 A;  3HHM A;  4MEL A;  2AEH A;  3H6N A;  4JGH B;  5L95 C;  3PPA A;  1ZGU B;  2FNJ B;  4CHK A;  1FXT B;  2GBJ A;  3W1Y A;  2KC2 A;  2N7D A;  1WR6 E;  1V6E A;  3CMM B;  5IA7 A;  3VH4 B;  1V81 A;  4BBN C;  1Q1O A;  4W9C A;  2EMT A;  4BFR A;  1Z2M A;  4WJO A;  3ZDM C;  1V9J A;  1WY8 A;  2NS5 A;  3PHW B;  3M95 A;  1WF9 A;  2LRW A;  4EZJ A;  3QIJ A;  3A9K A;  4A20 A;  3W1S C;  3WAO A;  1GUA B;  3IG3 A;  3KVF B;  5FR6 A;  4HVB A;  4FJY A;  2LUE A;  4GOC A;  1BT0 A;  3ECI A;  5D94 A;  3UIP B;  4M0W B;  3VUW A;  2O6V D;  2DYB A;  4LJO B;  1J0G A;  3SU8 X;  4IM3 A;  4ANX A;  2O2V A;  3AXC A;  3QAR A;  3RD2 A;  3SDL C;  2OJR A;  2REX A;  1WJN A;  2Z0E B;  3VQI A;  3PGE A;  1WM3 A;  2KJ6 A;  5JHA A;  1WXA A;  3IVF A;  2IO0 B;  2IO2 B;  4YL8 A;  1RRB A;  2N1W A;  4EZL A;  2G4S A;  1LQB A;  2ZZP B;  4DWF A;  3LJ3 A;  3L0W B;  4RM8 A;  4FUL A;  4NAW A;  2O6V A;  2MQJ A;  4ZDV A;  2JY6 A;  4IWO A;  1Z5S B;  4WWN A;  1WR1 A;  4MGI E;  4BBN F;  2KJH B;  3H7P A;  2PJH A;  2D10 A;  3L17 A;  3ML8 A;  2I1K A;  3SHQ A;  1ZKH A;  2N9X A;  5GMV A;  3T9L A;  2MBB B;  5DPW A;  5CHW A;  2K8H A;  2ZEQ A;  4HJK A;  3SD5 A;  2XK5 B;  2B3A A;  4DHZ E;  2DHZ A;  2KXJ A;  1HE8 A;  1NBF C;  2BWF A;  1WIA A;  1NDD A;  2KN5 A;  4G3X B;  5DPS A;  2RSU A;  3RT3 B;  1WXM A;  2KC1 A;  2N9E B;  2KAN A;  2LXC A;  3EEC A;  3B08 A;  2K6D B;  4GB9 A;  3ZVV A;  4DK5 A;  4G0N B;  2XEW A;  1V80 A;  2CHX A;  1YX5 B;  1IPG A;  1S3S G;  4J6I A;  2AYO B;  1WX9 A;  1S1Q B;  1VD2 A;  4BOZ B;  3DBR I;  3OLM D;  2KX3 A;  2A5U A;  2WYQ A;  4GGQ A;  4MGK E;  3X23 A;  5D7G A;  5E6N A;  4F7Z A;  4KVG B;  5J18 A;  3PLU A;  2C5L C;  4MDK E;  2KWU B;  3N30 A;  1ISN A;  2KDE B;  4DHJ B;  5C23 A;  4PS7 A;  1V5O A;  1WJU A;  4GDK B;  4FA6 A;  2IZV B;  3AI5 A;  2A4Z A;  2L0T A;  4ICU A;  2LAS A;  3WAP A;  2KMA A;  3VUX A;  1E8X A;  2NCN A;  3VFK A;  4ANW A;  2L3Z A;  4WQO B;  2V3S A;  3R7R A;  1H8C A;  3KUD B;  2KNB A;  1OEY J;  4OVV A;  5EDS A;  4HPM B;  2JRH A;  3RYT A;  2YVC A;  4HXD A;  3JYU A;  3PVL A;  5LXI B;  2KWC A;  4NY0 A;  1TTN A;  1L2N A;  2MLB A;  4MM3 A;  1WGH A;  3A9J A;  2DEN B;  4B95 A;  4EUT A;  2I1J A;  2FAZ A;  2MBO A;  4DXA B;  2MBE A;  4W9E A;  4MSM B;  1WX8 A;  3VUY A;  1P3Q U;  2DZI A;  3PTF C;  2WX1 A;  3TBL D;  3ENE A;  1LM8 B;  4AWJ A;  4KV2 A;  4MH0 E;  4NJ6 A;  5IAA C;  3C0R B;  3APD A;  4EZK A;  4K7S A;  4K81 A;  3JSV A;  5L83 A;  3OJ4 B;  4AP4 C;  2DZJ A;  3IHP C;  2KX0 A;  2MCN B;  4TKN A;  2LGY A;  1H4R A;  3R7Q A;  2PE6 B;  4FN2 A;  2G4D B;  3ONS A;  4IW0 A;  3V6E B;  3QAQ A;  2DAJ A;  2AL6 A;  2KOX A;  2KQ7 A;  2L8J A;  1WMH A;  3H7S A;  3KUZ A;  2RR9 A;  2N9P C;  3UIO B;  3V62 A;  2BWE S;  2KVR A;  3ZLZ A;  4CO7 A;  4BOS C;  2VRR B;  3PLV A;  3M63 B;  4W9F A;  4WJQ A;  4G50 A;  3ZNG C;  1WJ6 A;  1KM7 A;  2JPH A;  2AL3 A;  2OOB B;  4JQW C;  4LJP B;  3EHV A;  3KYC D;  4K7W A;  4AJW A;  4MSQ B;  3U8Z A;  4GDL A;  2KLC A;  1WGD A;  2KKC A;  5LLI A;  4FLH A;  2M17 A;  1L7Y A;  2CU1 A;  2FID A;  3AU5 A;  3RZW C;  1IYF A;  2KTF A;  3PS6 A;  3ALB A;  4WJP A;  4A3P A;  4FHJ A;  1LFD A;  2GOW A;  2R2O A;  4GXB A;  4KIK A;  3DVG X;  2JVC A;  4E3C A;  2JF5 A;  4ZRI A;  2N1V A;  4PS8 A;  2MRP A;  3ZNI D;  4DDI D;  4FJZ A;  3A9K B;  3WAN A;  3N3K B;  3QX1 A;  4EKU A;  3QQ8 B;  3DPD A;  1EUV B;  2MA9 B;  1WJ4 A;  2HJ8 A;  1U4A A;  4W9D A;  4GSW A;  5AEK B;  1TBE A;  2HE7 A;  3APF A;  3LDZ E;  3CST A;  4WJN A;  4BKS D;  2ZVO A;  1T0Y A;  2UWQ A;  2DZM A;  3PHX B;  2KZR A;  3CF6 E;  3UQA A;  1KOT A;  4PYZ A;  2EMS A;  1MG8 A;  5CX3 A;  2JRI B;  2FCQ A;  1P0R A;  3ZNZ B;  1NI2 A;  3VAW A;  3OJ3 A;  5AZF A;  5C1Z A;  3UIN B;  2MWS B;  2V1Y A;  3QJZ A;  4DBG A;  3AU4 A;  4MEM A;  4II2 B;  4W9K A;  2DAF A;  2IY1 B;  1YJ1 A;  4NAW B;  2O6V B;  4BKS A;  2M4N A;  3NY5 A;  3TIX A;  1OQY A;  2XK5 A;  4IUM B;  2DYM A;  3H7P B;  2BYF A;  1XT9 B;  4KSK C;  3ZKJ C;  2RGF A;  3HK0 A;  2LZ6 A;  1P98 A;  3R3M A;  3H9D A;  4WWP A;  2AWT A;  4DHZ B;  3WA0 A;  1V2Y A;  3TCA A;  1KLV A;  1WFY A;  4ANU A;  1UEL A;  3V6C B;  4KZ0 A;  4ICV A;  3HM6 X;  2IBI B;  3ZO5 B;  4EFO A;  4FBJ B;  3L13 A;  3ZDT A;  2NVU I;  1SIF A;  1Q0W B;  1WXS A;  2QHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...