4YSZB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yszB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yszB01
2BS2B 1N63A 4US8A 3ETRA 1NI3A 5MPOA 3AM9A 1V97A 2JX5A 3VR8B 1QF6A 1ZOYB 1FFVA 3VR9B 4YXDB 1YJIA 3AE2B 1RWSA 1R7SA 2HTME 2W55A 1XLNA 2JQRB 5AUKA 4WWMA 4KX6B 4ITKA 1CZPA 1L6VA 1QOBA 2BT6A 1N5XA 3W5VB 1GT8A 4YT0B 1IUEA 4P6VF 3AB5A 2WDRB 4YTMB 3VRBB 1AYFA 3CF4A 1XLOA 1AWDA 1KRHA 2CJNA 1T3QA 2MH7A 2BS3B 3WCQA 2M56B 4ZHOA 4WQMA 1VJKA 1H7XA 3SFDB 2MJDA 1A70A 1ROEA 2MJEA 1L6UA 2N0SB 5EE9A 4A9AA 3SR6A 4LTUA 4N59A 1SB3C 3AE9B 3NS1A 1N62A 2B76B 3SFEB 1FM0D 1TKGA 3FAHA 4N58A 2WDVB 2K9XA 2WLBA 1DOIA 1NENB 1WXQA 1QOAA 3LB8C 5AUIA 2PKOA 3P4QB 1L0VB 3AN1A 4YSXB 2M19A 2Y5CA 1I7HA 3AE5B 1NYQA 1RYJA 1JALA 1TYGB 1XO3A 2PVOD 3NRZA 3NVZA 4ZOHC 1B9RA 2BS4B 4YTNB 1GTEA 3HRDD 1FFUA 2AX5A 2WP9B 1QOGA 3DWGC 5EE3A 1ZP0B 1FIQA 1QOFA 3FC4A 2CU3A 2H89B 1E9MA 4YSYB 1N60A 2EKIA 3B2FA 4USAA 4US9A 3NVYA 1JW9D 3CIRB 1KFYB 3HUIA 3P4PB 1PFDA 1DGJA 1OFFA 2W3RA 3W9CB 1DOYA 3B2GA 3ABVB 4HROA 1JWBD 2K5PA 5H8YE 1FXAA 2G1EA 1L5PA 2QIEB 4C80A 1PUTA 1FXIA 3AEEB 3ZYYX 1YQ3B 2DWQA 1UWMA 1FO4A 1WGKA 5C2TB 2PVGC 3NVVA 2K22A 3AE6B 2L52A 4ZHPA 1F0ZA 3AV8A 1PDXA 1TJEA 1JWAD 3CWIA 2W54A 1VLBA 1GAQB 2KAJA 3P63A 5EE0A 1SF0A 1NYRA 2MJ3A 1DOXA 3AEFB 1TKYA 3P4RB 1JROA 3AEBB 3AMZA 1WYGA 2QJLA 1E6EB 4YSZB 4C7ZA 5C3JB 3VRAB 1ZUD2 4HRSA 4YTPB 4IDIA 2WQYB 2Q5WD 2WU5B 2E3TA 1H7WA 2PIAA 3AH7A 3KWLA 4JWSC 2ACZB 1FRRA 2OHFA 1WRIA 2W3SA 2DBYA 3AECB 1OQQA 1FMAD 5EE1A 5H92C 3AEGB 4N6EB 1CJEA 3B9JA 5GXGB 1N5WA 1QLBB 3AE3B 2WU2B 4FXCA 3P1MA 1GTHA 1V8CA 4JX1C 2WS3B 3HVZA 1RM6C 2CJOA 2LEKA 3W5UB 2WDQB 1YQ4B 2L83A 4JWUC 1KF6B 1QT9A 5G5GA 4C7YA 1JQ4A 3AE4B 3AE8B 1EWYC 3P4SB 3AEAB 1XLPA 2FBWB 3BIID 3DWMA 1OQRA 1XLQA 5G5HA 1J7AA 2H88B 1RFKA 3L4PA 1E7PB 3NVWA 1J7BA 3PO0A 1WWTA 2KMMA 3LXFA 1JRPA 1E10A 3RPFC 1NEKB 1GPXA 1NVID 1VDVA 3AEDB 1TKEA 1SIJA 1YJJA 1N61A 3EUB2 3AE7B 1ZXIA 1J7CA 1E0ZA 3AE1B 1FRDA
chains in the Genus database with same CATH superfamily
3ZNZB 3ETRA 3NUHB 4LNOA 1KH0A 1ZOYB 3VR9B 4YXDB 4MH8A 3O65B 1MJDA 2ZW1A 3A1QB 4IM0A 1JRUA 1R4MB 1CZPA 3DHGC 5FK9C 1PGAA 1WJUA 1GG3A 3QAQA 4YTMB 1V1OA 2A5UA 1KLGD 3SFDB 2N4FA 2WXOA 3GP7A 3DHHC 1VZ8A 1WXVA 5E6JA 2J52A 2GB1A 4OVZA 4R3DA 2BS4B 2WP9B 1P9DU 3ZNID 4ZRJA 2ICIA 4DHJD 2K8HA 4FULA 2C60A 2W3RA 2WHIA 4OHJA 1WXAA 3A4SC 3TL5A 3ZYYX 3N1XC 3KW5B 3EFUA 1ENFA 2L7RA 1PYWD 2L52A 3CWIA 1NYRA 3UIPB 1EU4A 4GIVA 4MGZE 2WXKA 4A8XC 2L32A 3DOWA 3VRAB 2VH1A 1FCLA 3QQ8B 5FR6A 2DBYA 2R61A 4YWGG 3C19A 1PGXA 2JRIB 3FILB 2WGSA 4W9IA 4WJPA 3APCA 2K8CA 5AZFA 2CJOA 4JLCA 1MHXA 2HJ1A 2INDC 3M3JA 1NBFC 2EMTA 3ZJTA 2LHDA 4OVUA 1WXMA 5BMGA 5BYSA 2K8BA 3E9SA 4LNNA 2M0XA 5D7GA 3I5JC 3URYA 3OJ4B 2L8JA 1AARA 3EUB2 4GDKA 3AE1B 1FRDA 1IGCA 2DNFA 1FPYA 1OQYA 2KDIA 2D10A 4W9FA 2NCNA 2L00B 2QSDA 3PHXB 4FBJB 1SGHA 1GB1A 3VVWB 1BXTA 2JU6X 3RNGC 1TY2A 3BY4B 5FKAC 2HJ8A 2D5GA 3HM3A 2E6XA 4W9GA 3ZDTA 4WQMA 4LCDE 3TJPA 3SDLC 3SFEB 1TKGA 2AEHA 4M8NA 2V3PA 2RDGA 1J19A 2NMQA 1FNVA 1HZ6A 4WAAA 4YTNB 3UQAA 2JRHA 2B3AA 1ZP0B 2ZW0A 2CS4A 1ISNA 5D6JB 2OJWA 2LGSA 3DPDA 4W9DA 2ZVNA 2M8SA 1WGKA 4NJ7A 5L83A 4MJSB 3H7SA 1PDXA 1GAQB 1SF0A 5IAAC 1DOXA 2CKHB 3AEFB 4DK5A 5D3DA 2BB5A 2ACZB 2W3SA 1WRIA 4MM3A 3AECB 3AEGB 4N6EB 2V0GA 1FD6A 2KACA 2BGFA 5CHFA 2ZZPB 4C4VA 4C7YA 4DHZB 2MHJA 3P4SB 1XLPA 1U4AA 1D6EC 2KFKA 1XF5L 2KMMA 2WX1A 3VDZA 5HI1A 2KMAA 2LD9A 2IO3B 1TS4A 3CSFA 1UBQA 4US8A 2PJHA 2FUG1 2KTRA 1XCQL 4DWFA 5IKCM 4L23A 4GOCA 1WH3A 1P98A 2KC2A 5AUKA 3KWVA 4DXFA 1QOBA 3W5VB 2V3NA 4NY0A 3R3MA 2ZCCA 2K1FA 4URKA 1V80A 2M56B 2NPTB 2O6VD 1JWMD 3VUYA 2FE8A 2JZZA 1C78A 2G9HD 3KUCB 4ANXA 5D2MB 4HCPB 3RCZA 3AN1A 4NQLB 4K7UA 2N9LA 4IWOA 4ZOHC 4BOSC 4BKGA 2LVOA 1E8YA 2LUEA 2M0AA 4MSQB 2CU1A 4TSSA 1JW9D 3CIRB 2J0MA 2MP2B 3W9CB 5H8YE 4HLEA 2JVCA 4OZAA 2YEPF 1PUTA 4C00A 1UWMA 1KJTA 1MI0A 4HKQA 2LGIA 3EA6A 1JWAD 2JXXA 3DVNV 3ZQ4A 3TMPB 3T8MA 3EC8A 5JXVA 2FCQA 4YTPB 1WGDA 1EM7A 4L2YA 3APFA 3RNEC 1OQQA 2L3ZA 3B9JA 3J9CA 1QLBB 1UD7A 5DPSA 3WA0A 1L0YB 2HDEA 2NS5A 3V61A 3DDCB 2C5LC 1XLQA 2AQ3B 2K6QA 1WRDB 3R7QA 4RGMA 3Q2AC 1V1PB 1GPXA 2RSUA 2VH2A 1FEHA 3AU4A 2L0FA 4PS3A 4W9HA 2IPKD 1H4RA 1TGZB 1K53A 2WXPA 5C1ZA 1C9FA 4FA6A 5HFYA 5KHOA 1FFVA 4AJWA 3H6NA 2JYEA 5L95C 2J0KA 1ESFA 3JYUA 1L6VA 5CHVC 1V5TA 2RGFA 2DYMA 1GT8A 3DVNU 3B08A 4FN2A 1KRHA 2M4NA 3QHTA 3ZXRA 1PQSA 3NS1A 4C56C 2NTTA 3FAHA 3LB8C 2MBEA 3HIZA 2PVOD 1J0GA 1E8XA 3H7PB 4UDUC 2O2VA 3RN9C 1E9MA 1V2YA 1WF9A 1OFFA 3QIJA 1UH6A 2GBMA 1JWBD 4XE0A 1FXIA 1YX5B 4RGTA 2PVGC 2K3UA 3MC8A 4IG7B 3NG0A 1VLBA 4KV2A 3UF8A 3W1SC 1BUIC 4FLHA 4S17A 1UBIA 4IWPA 3RNCC 4WWNA 2BYFA 3LYYA 1RFAA 1D5ZC 4BBNC 1WYWB 1T0YA 4GN1A 3R8BA 2BTEA 1P3QU 3IT6B 1WE7A 2LRUA 2RD0A 1V9JA 5T8IA 2DZMA 1P7FA 2WU2B 3IHPC 1Q1OA 2ZPYA 1WZ3A 4JX1C 1P1AA 3A9JA 1LGRA 1WGRA 2D3AA 2KWVB 1QILA 3X0WA 1QKZA 1EUVB 4GSWA 3LJ3A 4GMVA 1D3ZA 3AE7B 2CHWA 1EF1A 3GE8C 1R4NI 1NI3A 1V97A 2YLMA 2Y5BB 3B1LX 4DDGD 1PGBA 3GZNI 3D32A 5G55A 2PE9A 1ZXHA 1E7VA 1V6EA 1IUEA 3ZRFA 2WDRB 1AYFA 2X8XX 1T5XD 2W9NA 3BVZA 3QARA 4KIKB 4REZA 1VJKA 3OWEB 2AQ1B 2RPQA 2YVCA 1SE3A 2JF5A 2B76B 1FM0D 4WURA 5CX3A 5LXIB 2KK8A 2BKFA 2DENB 4RM8A 3AE5B 4LNFA 4BKTA 1GTEA 3U7DA 1FIQA 4AWJA 3I63C 4ZDVA 1KFYB 1STEA 1JCKB 5CTRC 2KWDA 3QWZB 2K5PA 2KYWA 1L5PA 4F7ZA 2Z0EB 3WANA 2NBWB 1HE8A 1UGJA 2FCSA 2RDHA 2BVCA 3TUOA 3K9OB 4B9KA 5FR3A 2LGDA 3AMZA 5AZGA 4NJCA 4K7SA 4RF0A 1E8WA 3AH7A 4YL8A 2MBHA 3PZDA 1TZOA 1IP9A 1FNUA 5GXGB 2WWZA 1GTHA 3GOEA 3PT2B 3HVZA 1ET9A 3ZTCA 3JSVB 1I4HA 1QQRA 5G5GA 5BYQA 4ZYNA 1F2RC 3S2AA 3VAWA 3ZO5B 3PO0A 2KFJA 3U7ZA 2J42A 4JPSA 2DYBA 2C7NB 1C4CA 2LMCA 4RM9A 4N9F4 2IYDB 4RMAA 4HDQA 3WIMA 1N63A 2XNAC 4AQ7A 2V9HA 4LNIA 4XDCA 1I42A 4XZ4A 3N30A 2WXRA 4BKSA 3RUIB 1F52A 2LJIA 3BZDB 5BYRA 4P1CC 3PLUA 3NY5A 2DZJA 2N0SB 4O1NA 2D3CA 1VCBA 5J2RA 3JW0X 4WWOA 2QCZA 4JE3B 1WXQA 1YOVB 2M19A 3N3KB 1D5MC 1X1MA 4KVGB 2WYQA 1KM7A 3MFGA 2REXA 2H89B 4MJSA 2K0PA 2KJRA 1FXAA 2O6VB 2KJ6A 3QA8A 4CYEA 4ZHPA 1V81A 3ONSA 3LDZE 2QC8A 2V4IB 1TKYA 3WAPA 4HJKA 2PW9A 2KOXA 3ZW3A 2D2QA 2I1JA 2WXQA 1F9JA 3ZRCA 2FUHB 1TTNA 1VR9A 1HQRD 1L4ZB 1R4NB 2QMTA 3W5UB 4I6LB 3U8ZA 1KF6B 2XN9C 3VUWA 4MDKE 4WIPA 3GZNB 2ZNVC 5IN7A 2N7JA 1E10A 3O13A 1CQVA 3VFKA 4HXDA 4XYCA 4KSKC 4RGOS 1I4QA 4E3CA 3AM9A 2RMMA 2IJ0A 1R7SA 2BPSA 2GLSA 3U4EG 4KX6B 2MQJA 1K8RB 2JYTA 3PHWB 2MW5A 1WX7A 1F77A 1TIFA 1YN5A 2C7HA 3BK2A 1AWDA 3V6EB 3PZ8A 3MJWA 2EMSA 2LI5A 5DPRA 5IA7A 4WH4A 1YX6B 2OJRA 2I38A 5J17A 3BWUD 4IOIE 1WR6E 2MP2A 4KGRA 5KHQA 4AP4C 3TCAA 1SJHD 2MX2A 2WXMA 4AUQC 3CSTA 3NVYA 1PFDA 1UGMA 2GBNA 2MRPA 2DYOA 2IZVB 3NVVA 1ZPSA 1MHHE 1WGYA 2WXFA 2JSVX 4RF1A 2FCMA 3VH3B 2KLGA 2VZKD 3ML8A 2KWUB 2AQ2B 2QILA 4JWSC 2WU5B 1FRRA 2N9XA 2AL3A 3ZXVA 4KDLB 3ENEA 4J6IA 2JZ3B 1I4XA 2WXGA 4W9KA 3WAMA 2PLPA 1RM6C 1V1PA 2LEKA 1UZXB 4DHZE 1SJED 3L10B 4GLSC 1C3TA 3L4PA 3SHQA 1QZEA 4ZRKA 1WY8A 4HPLB 3RZFA 1JWUD 1E0ZA 3A9KA 1XEEA 4A3OA 5MPOA 4PYUA 1VRAB 3TBLD 2D11A 3M95A 3Q14C 1RWSA 4G11A 1YIWA 2JQRB 2BYVE 3N1YC 2FNJB 4GGQA 4B6WA 4NJ6A 3AB5A 1K51A 3RZWC 4ZRQA 2ASQA 1C77A 1XXGA 4ICVA 4HEA1 2K9XA 2LGXA 3B0AA 5BMHA 4IC7B 3VTVA 1JALA 1B9RA 2CHXA 2R2QA 3FC4A 3RD2A 3CMMB 2RPVA 3HM6X 4BAXA 1C4AA 3OLMD 4K81A 4MGKE 1YQBA 1P0RA 3NZ3A 3SEBA 3QC8B 4JGHB 4KGTA 2BKRB 2MEKA 3HHMA 1I4PA 1MFWA 1WYGA 2SEBD 2OOBB 4ASWC 4TQ1A 4M02A 3VHTC 1A5RA 3RI7C 4A90A 4A20A 1CJEA 1C4PA 4EFOA 4LLGM 2WS3B 3OAWA 1C79A 3AE8B 1EWYC 3IT4B 3DWMA 2R2OA 2PE6B 3N9YC 2WNMA 1JRPA 4BFRA 5GMVA 1ZDXA 2DLBA 1L7YA 2GI9A 1J7CA 2BWES 4DXGA 1BMLC 2J0JA 4IWQA 1E7UA 2HTME 1XLNA 1F1HA 3X23A 4KIKA 4WJNA 5E6NA 1HTOA 4JL9A 3NHEB 1E90A 1LM8B 1EU3A 2D3GA 3KH0A 5JHAA 1G6JA 4FHJA 4XC2A 2MJDA 2MJEA 2L0TA 1L2NA 3SR6A 1XQQA 3RULA 2KZRA 2KO3A 2N9PC 3C8YA 2RR9A 4J3OD 5LNK1 1NENB 3ALBA 2WXNA 2K39A 4HVBA 3RNAC 3V05A 2AWTA 1WI0A 4C80A 3P4PB 1CMXB 2QEJC 4X57B 5C23A 2N7EA 4EZLA 4I6NB 2LZ6A 4F1SA 4MM3B 1FXTB 2HD5B 2MSED 2A4ZA 2W54A 2IY1B 2LVQA 1RLFA 3BYYB 1JROA 3AEBB 2QJLA 2JWUA 4C4VB 1L0XB 4K3BA 4LJOB 1NDDA 2WX0A 3JSVA 5H92C 4BKSD 4IKGA 3BVGA 1JMLA 4ARIA 3C0RB 2G45B 4RNAA 4KGSA 4W9LA 4AS1A 1T0RC 4KSLC 4LK0M 3L13A 2MLBA 2H88B 2KTRB 3Q3NC 3CF6E 3DVGY 3LXFA 1WM2A 2RDBC 3Q8AA 4DHJB 3IVFA 3IFWB 4W9EA 2K6DB 1YD8U 2IO1B 1MG8A 1WE6A 4A55A 5DPWA 2J4XA 4OVVA 2HTHA 1XD3B 1E8ZA 3AXCA 4P6VF 5D94A 4M00A 3CF4A 4I6PA 1UELA 4MELA 3P42A 3ZNHB 3A1QA 2JUOA 4A9AA 2CR5A 5HKHA 2SAKA 1Z5SB 1HA5A 1TBEA 2L05A 2PKOA 3A33B 2Y5CA 1NYQA 2KQ7A 1UUPA 1IBXB 3VH4B 1D5XC 3DWGC 1WSPA 3H9DA 2EKIA 2WDTB 1OEYA 2WXIA 4PS7A 3PTFC 1J8CA 3R2TA 4P1BC 1DOYA 4A6QA 1XT9B 1P7EA 4MACA 1WXSA 3RNFC 2QIEB 2KN5A 3L16A 2BW2A 1KOTA 2DWQA 5J18A 3DBLB 1S1QB 5DPTA 4XWWA 2GBJA 3P63A 2ON8A 3Q8BA 1GB4A 1L4DB 2DZKA 5C3JB 3UI3A 2FAZA 1VD2A 4RCOA 1H7WA 2ZPNA 2INNE 3ML9A 2ZEQA 1GJZA 3R66C 2BQQA 4OZCA 1YQ4B 4JWUC 1QT9A 1JWSD 1JQ4A 2WXJA 4FJZA 3UGBB 2FBWB 3BIID 4M0WB 2DAJA 2Y3AA 3FILA 2VZKB 1J7BA 2KT7A 3MC0B 2MCNB 2M1MA 1NVID 3ZNGC 4MGYE 3Q6BA 2LHEA 1WJ6A 2XBBC 3RMKC 5EDSA 1HEZE 2IO0B 3PVLA 1UF0A 3DHIC 3QX1A 3NOBA 2BB6A 2Z8LA 4ZRPA 4ACFA 3Q3FA 4GB9A 3T9LA 1K52A 3UINB 3MHZA 2BYEA 1A70A 3W2DA 5AEKB 2O2VB 3PGEA 2INCC 4LNKA 1DOIA 3Q69A 2LUMA 2C7MB 2LASA 5D3IB 4NQKE 1QOFA 4A3PA 2CU3A 3B2FA 4E71A 1GNUA 2XEWA 4HROA 2ZCBA 4GDLB 2G1EA 2N1WA 2GRIA 4EE2A 4ICUA 2BF8B 5DCNA 2MJ3A 3VTUA 1WGHA 2N7DA 2MBQA 1LQBA 3PRMB 3GB1A 1KTKA 4C7ZA 4EZJA 1WX8A 2LXCA 3A9JB 5LLIA 2WQYB 1F2RI 1ET6A 2NBUA 3KVFB 3NS8A 4FXCA 3P1MA 4CQNA 1V8CA 1WMHB 4CO7A 3KUZA 1HXYD 4MT5A 4TQ0A 1I4RA 2JPHA 3RYTA 2FIFA 1E7PB 3SU8X 5HHDG 4NAWB 3DCGA 3AEDB 4FJYA 2G4SA 2KMCA 3L54A 3TEYA 3NJTA 4BVUC 2FCNA 2KDFB 3KLSX 2BT6A 1N5XA 4G3XB 5AZHA 2J7QB 2IO2B 1T3QA 2BS3B 3M62B 1M4VA 1NI2A 1ROEA 3AI5A 1FNWA 1SB3C 3ZGZA 4W9JA 1N62A 3MC9A 5E6PA 2C9WB 2LFIA 1I35A 4AJYB 3VUXA 4ANUA 1I7HA 4BZAA 4G50A 2KX0A 4D2KA 2NPTA 2LRWA 5LXHA 1KLUD 4RFBA 2AL6A 3ZIMA 1N60A 2LVPA 4USAA 4US9A 1SBBB 1WJ4A 1GUAB 2DZIA 2IY0B 5JZEB 2D3BA 3U52E 4WQOB 4IM2A 2MWSB 3OJ3A 3U2SC 5IOIA 1WGGA 1AW7A 1TY0A 3VTWA 4B95A 3ZUNA 1WFYA 4PS8A 1ZGUB 2BYTA 3DBRB 2JWZA 3NZUA 1T0QC 3ECIA 4TMAB 3PPAA 4KDIC 3L17A 4LDTD 2G3QB 5E6OA 3AE4B 4L1BA 3ZVVA 3AEAB 3VQIA 4K3CA 3NVWA 4M8MA 1WWTA 2XK5B 4P7IA 1V5OA 4XX5A 3R7RA 1MG4A 1TYGB 2BS2B 3MTNB 3PV1A 1IGDA 1ZDVA 2MA9B 1QF6A 3VR8B 4DBGA 3IG3A 1YJIA 1EO6A 4HK2A 1MPEA 3P2BA 2W55A 2W82A 4EEWA 1YMHE 4ANVA 2KX3A 4KZ0A 2KD0A 2MBOA 2CJNA 3RNBC 4MGIE 2I1KA 2KDBA 3AE9B 2UYZB 4N58A 1SXTA 2WDVB 4HJGE 1MVKA 1SIFA 1T6BX 2IBIB 1L0VB 4RH6A 3T3NA 1RYJA 2KHWB 3NVZA 1WR1A 4OW0A 3NRZA 1HZ5A 4Q2JA 2AX5A 4WWPA 2FIDA 2IGHA 2MBBB 2X38A 1C1YB 1YN3A 2UU7A 4DQOC 3QJZA 3EFCA 1DGJA 1Q5WB 1V49A 3KYDD 4KZCA 3B2GA 3PSEB 4EKUA 3PLVA 2M17A 1FO4A 2GOWA 1Q0WB 3AE6B 1F0ZA 3Q3OC 3H7PA 2KAJA 4AOFA 3OG5A 2LXAA 3QCAA 3P4RB 1HTQA 2DAFA 3HK0A 4HRSA 2CHZA 2EKEC 3KWLA 4OZBA 4G0NB 3T3OA 4PK1A 3H8HA 2OEDA 1N5WA 4F8CB 3AE3B 2LWPA 3KYCD 2ZVOA 3UQBA 4MH0E 3FKYA 3V62A 2KQ4X 5IO9A 1ZKHA 5G5HA 1J7AA 1RFKA 3DQVA 2IGDA 4HDOA 1EF5A 1I4GA 3V3XA 5JH5C 1FFUA 1RRBA 3DVGX 1T0SC 3KUDB 3DBLI 4K1RB 4HKZE 2KVRA 3W1YA 4GDKB 2KTFA 4ITKA 1OTRB 3Q8FA 1KLVA 2WXHA 4E74A 4YT0B 5TR5A 4PYZA 3VRBB 1B1ZA 1XLOA 4S0RA 2G4DB 3AU5A 3Q8CA 4GU2A 5EE9A 3L0WB 4LTUA 3WALA 1IBXA 2PTLA 5IP4D 3VXWA 1RAXA 2J53A 1QOAA 1IPGA 1XO3A 3EHVA 2GBRA 3I57A 2EELA 2Y5PA 1QOGA 2K25A 3M63B 2I2YA 1AN8A 1ACCA 3HUIA 3PS6A 1EWCA 2ZNVB 4PT5A 3ZJUA 4JQWC 2GBKA 2KJHB 3V6CB 1ZE3D 5C2TB 3SD5A 2NTSA 1SSNA 3AV8A 3IAM1 3TEWA 4NZLB 4HWIB 3TEXA 1LXDA 1IYFA 1E6EB 1ZUD2 3BYTB 4IDIA 5TSSA 2E3TA 4HPPA 2OHFA 4EUTA 1FMAD 2KQSA 2Z59B 3TIXA 4M01A 3DBHI 2JXTA 4M0WA 1Y56A 3BK1A 2KNBA 2WXLA 3E56A 3ZLZA 3A9KB 1DYQA 3DBSA 2KXJA 1Q10A 3RPFC 1NEKB 1WZ0A 4FHKA 4EZKA 1VDVA 3MJ5A 3PZ7A 4BBNF 3I3TB 2BBCA 2NBVB 5BO4B 4TV3A 2KANA 2KFKB 4KKJA 4NAMA 2JX5A 5HG2A 3WAOA 3ZJVA 1SE2A 1YN4A 4WWMA 2NVUI 2QDFA 4CHKA 3IXSA 4JIOU 2KN4A 3AULA 3IAS1 3WCQA 2MH7A 1TS5A 2IGGA 3NZSA 1L6UA 1Z2MA 4WJOA 3UIOB 3ZDMC 4XWTA 2UWQA 4YSXB 1OEYJ 1R4MI 1S3SG 2JZPA 2DHZA 1V86A 4GDLA 3MP9A 3HRDD 3TEZA 4BOZB 1BT0A 5BMIA 4FJVB 4YSYB 4K7WA 4NPNA 4TKNA 3Q3JA 3EGRA 2HE7A 2GMIC 4WAFA 1D4BA 2PMVA 3AEEB 2PPHA 1YQ3B 2V3SA 3GS2A 2KLCA 5EE0A 2N1VA 4YSZB 4P16A 4XDDA 2N9KA 2O6VA 4TUUA 2Q5WD 1WMHA 2PIAA 1WIAA 3KQ4A 1TS2A 4ANWA 4HPMB 1LFDA 2ZJDA 4NAWA 2WDQB 2L83A 4FADA 3PREA 3N1ZC 1WJNA 1C76A 3Q3MC 4MEMA 1WX9A 2LJ5A 1Y8RC 1SIJA 2KC1A 1YJJA 2KVZA 1N61A 1XCTL 3RT3B 1ZXIA 1VZ6A 4LDTB 1UWXA 2L76A 1CK1A 1N6ZA 4II3B 4II2B 2LGYA 4ARCA 1SEBD 3AE2B 3BVMA 5CHWA 3W1SA 5G2NA 2KDMA 3K9PB 4DDID 3DBRI 1OGWA 4IM3A 4QAYA 2JT4B 4ZRIA 1VZ7A 3I9V1 4IUMB 4RGNA 2V4LA 4WJQA 1TT5B 1YJ1A 4W9CA 3V60A 4ZHOA 1H7XA 3L08A 4B0MA 4LJPB 4N59A 2KDEB 1GC7A 2WLBA 1H8CA 2TSSA 4EOYA 3PRPB 4NNJB 5AUIA 4XGAB 3P4QB 4H2AA 1K50A 3GE3C 1M94A 3N20C 1E5WA 3IBEA 3EECA 5EE3A 1TS3A 2INPE 1LO5D 4HCNB 1WM3A 3TSSA 5JHBA 4GXBA 1GC6A 3ABVB 3Q8EA 2V1YA 2ONQA 3RFZB 2IDYA 3DBHB 3BINA 2L1AA 4B0EA 2D07B 2K22A 1TJEA 3A4RA 1YNTE 2NR2A 4IW0A 3PRZA 1GOZA 3R2IA 5I4DA 3H1UA 2DX5B 3JVZX 3HVDA 2JY6A 4KKIA 2AYOB 5EE1A 3QK0A 3ZTDA 2KKCA 4MSMB 2XK5A 3MHSD 2YEPB 2QHOA 1ZW7A 2KWCA 1UNSA 1SE4A 2PEAA 1OQRA 3U30A 2Z0DB 2BWFA 1FCCC 1SE9A 4ZYSA 3ZKJC 3N32A 1TKEA 2N9EB 3APDA 1TZ1A 4DXAB 2VRRB
chains in the Genus database with same CATH topology
2BS2B 4DXGA 3ETRA 3NUHB 1IGDA 1ZDVA 1NI3A 1KH0A 1V97A 3VR8B 1BMLC 1QF6A 1ZOYB 3VR9B 4YXDB 4MH8A 1YJIA 1MPEA 2HTME 2W55A 2ZW1A 1XLNA 2W82A 1PGBA 1CZPA 1YMHE 5FK9C 1ZXHA 1PGAA 1IUEA 2WDRB 4YTMB 1AYFA 1V1OA 1EU3A 1T5XD 3BVZA 2CJNA 1KLGD 4REZA 1VJKA 3SFDB 2WXOA 2MJDA 3GP7A 2MJEA 3OWEB 2AQ1B 3SR6A 3AE9B 1SE3A 2B76B 1FM0D 4WURA 4N58A 1VZ8A 1SXTA 2WDVB 4HJGE 5E6JA 2J52A 3C8YA 5LNK1 4J3OD 1NENB 1MVKA 1T6BX 4RH6A 1L0VB 2WXNA 3T3NA 2GB1A 3AE5B 1RYJA 3NVZA 4OVZA 4R3DA 4OW0A 3NRZA 1HZ5A 2BS4B 4Q2JA 3V05A 1GTEA 2AX5A 2WP9B 1FIQA 2IGHA 2ICIA 2X38A 1YN3A 4DQOC 4C80A 1KFYB 1STEA 3P4PB 1DGJA 1JCKB 2W3RA 3B2GA 2KWDA 2QEJC 4OHJA 2K5PA 1L5PA 3ZYYX 1FO4A 4MM3B 1ENFA 1PYWD 3AE6B 2L52A 1F0ZA 1UGJA 3CWIA 2W54A 2KAJA 2RDHA 3TUOA 1NYRA 1EU4A 3BYYB 3P4RB 5FR3A 1JROA 3AEBB 3AMZA 2WXKA 4NJCA 2QJLA 2JWUA 4A8XC 2L32A 3VRAB 1L0XB 4HRSA 4RF0A 1FCLA 3KWLA 3AH7A 4OZBA 2DBYA 2R61A 3T3OA 4YWGG 1PGXA 5H92C 1TZOA 3FILB 3H8HA 1FNUA 2OEDA 1N5WA 4IKGA 5GXGB 3BVGA 3AE3B 1JMLA 1GTHA 4ARIA 3HVZA 2CJOA 1ET9A 1MHXA 4RNAA 4KGSA 1I4HA 1QQRA 5G5GA 5BYQA 2KQ4X 4AS1A 1F2RC 4LK0M 2LHDA 3ZJTA 5G5HA 1J7AA 2H88B 1RFKA 5BMGA 5BYSA 3PO0A 2IGDA 3LXFA 3U7ZA 3E9SA 3Q8AA 2J42A 4JPSA 1I4GA 5D7GA 1C4CA 2LMCA 3URYA 3EUB2 3V3XA 1FFUA 3AE1B 1FRDA 1IGCA 1N63A 4A55A 2XNAC 4AQ7A 4HKZE 4GDKB 2J4XA 2QSDA 4XDCA 4ITKA 3Q8FA 1GB1A 1BXTA 2JU6X 2WXHA 1TY2A 2WXRA 4YT0B 4P6VF 5FKAC 3VRBB 2D5GA 3CF4A 1B1ZA 1XLOA 2LJIA 3BZDB 2E6XA 5BYRA 4WQMA 3P42A 3Q8CA 4A9AA 2N0SB 4O1NA 5EE9A 4LTUA 1IBXA 3SFEB 1TKGA 2PTLA 2SAKA 4JE3B 2J53A 1HA5A 1WXQA 1QOAA 2PKOA 2V3PA 2RDGA 2NMQA 2M19A 2Y5CA 1XO3A 1NYQA 1FNVA 1D5MC 3I57A 1HZ6A 1UUPA 4YTNB 2EELA 1IBXB 1D5XC 2Y5PA 1QOGA 3DWGC 1WSPA 1ZP0B 2I2YA 3MFGA 2ZW0A 1AN8A 2H89B 2EKIA 2WXIA 1ACCA 3R2TA 3HUIA 2K0PA 1EWCA 4PT5A 3ZJUA 1DOYA 4A6QA 4MACA 1P7EA 1FXAA 2QIEB 2BW2A 1ZE3D 2DWQA 1WGKA 5C2TB 2NTSA 4ZHPA 1SSNA 3AV8A 1PDXA 4XWWA 3IAM1 3TEWA 1GAQB 3P63A 4NZLB 1SF0A 2ON8A 3Q8BA 1DOXA 3TEXA 2V4IB 3AEFB 1TKYA 1GB4A 1L4DB 2PW9A 1E6EB 5D3DA 5C3JB 3UI3A 1ZUD2 3BYTB 4IDIA 5TSSA 2WXQA 4RCOA 2E3TA 1H7WA 2BB5A 2ACZB 2OHFA 2W3SA 1WRIA 2INNE 3AECB 1FMAD 3AEGB 4N6EB 2V0GA 1FD6A 1VR9A 1HQRD 2KACA 2JXTA 1L4ZB 4M0WA 1Y56A 3BK1A 2WXLA 4OZCA 2QMTA 3W5UB 1YQ4B 4JWUC 4C7YA 1KF6B 1JWSD 1QT9A 2WXJA 1JQ4A 3E56A 2XN9C 3P4SB 4WIPA 1XLPA 2FBWB 3BIID 1DYQA 2Y3AA 1D6EC 3FILA 2VZKB 1J7BA 1XF5L 2KMMA 3MC0B 2N7JA 1E10A 3O13A 1Q10A 1CQVA 3RPFC 1NEKB 1NVID 5HI1A 1VDVA 3MJ5A 3PZ7A 4RGOS 1I4QA 1TS4A 2LHEA 2BBCA 1HEZE 4KKJA 4NAMA 4US8A 2FUG1 3AM9A 1XCQL 2JX5A 5HG2A 4L23A 2RMMA 2IJ0A 3ZJVA 1SE2A 1R7SA 1YN4A 5AUKA 3U4EG 4WWMA 4KX6B 3KWVA 4DXFA 2BB6A 1QOBA 2JYTA 2Z8LA 4ZRPA 3W5VB 2V3NA 1F77A 1YN5A 3IXSA 1K52A 3BK2A 2KN4A 1AWDA 3IAS1 3WCQA 2MH7A 3PZ8A 1TS5A 2M56B 2IGGA 3MHZA 1JWMD 1A70A 2FE8A 3W2DA 1L6UA 1C78A 4WH4A 2G9HD 4XWTA 2I38A 1DOIA 3BWUD 4IOIE 3Q69A 2LUMA 3AN1A 4YSXB 4KGRA 2JZPA 2N9LA 4ZOHC 3MP9A 3HRDD 1SJHD 3TEZA 2WXMA 5D3IB 1QOFA 2CU3A 5BMIA 4YSYB 2M0AA 3B2FA 3NVYA 1JW9D 3CIRB 4TSSA 3W9CB 1PFDA 4HROA 4GDLB 3EGRA 5H8YE 2G1EA 4OZAA 2YEPF 4WAFA 1PUTA 2PMVA 3AEEB 1D4BA 1YQ3B 3GS2A 1UWMA 2DYOA 2GRIA 1MI0A 4HKQA 3NVVA 2LGIA 3EA6A 4EE2A 1ZPSA 1MHHE 1JWAD 2WXFA 5EE0A 2JSVX 4RF1A 3ZQ4A 2MJ3A 2VZKD 3GB1A 5JXVA 2AQ2B 2QILA 1KTKA 4C7ZA 4YSZB 4P16A 4YTPB 4XDDA 1EM7A 2N9KA 2WQYB 2Q5WD 2WU5B 4JWSC 1F2RI 1ET6A 2PIAA 1FRRA 4L2YA 3KQ4A 1OQQA 1TS2A 1I4XA 3B9JA 3J9CA 1QLBB 2WXGA 4FXCA 3P1MA 4CQNA 1V8CA 2PLPA 1HXYD 1RM6C 1V1PA 2LEKA 2WDQB 4MT5A 2L83A 4TQ0A 1I4RA 1L0YB 1SJED 2HDEA 4GLSC 2AQ3B 1C76A 1XLQA 3L4PA 1E7PB 4RGMA 5HHDG 1V1PB 4NAWB 1GPXA 3AEDB 1SIJA 1FEHA 1YJJA 1N61A 1JWUD 1XCTL 2IPKD 1ZXIA 1VZ6A 1K53A 1E0ZA 2WXPA 1XEEA 1UWXA 3TEYA 1C9FA 1CK1A 5HFYA 5MPOA 1VRAB 1FFVA 2JYEA 4ARCA 1SEBD 3AE2B 3BVMA 1RWSA 3W1SA 2JQRB 1ESFA 2KDMA 1L6VA 3KLSX 2BT6A 1N5XA 2DYMA 1GT8A 3AB5A 1VZ7A 3I9V1 4RGNA 1KRHA 1T3QA 2BS3B 1K51A 4ZHOA 4ZRQA 1H7XA 4B0MA 1M4VA 1ROEA 1C77A 1FNWA 4N59A 1SB3C 3ZGZA 3NS1A 1XXGA 4C56C 1N62A 2NTTA 3FAHA 4HEA1 2K9XA 2WLBA 2LFIA 2TSSA 5BMHA 3LB8C 5AUIA 3P4QB 4H2AA 1K50A 1I7HA 4D2KA 1JALA 2PVOD 1B9RA 1KLUD 4RFBA 5EE3A 1TS3A 2INPE 3FC4A 4UDUC 1LO5D 1N60A 1E9MA 4USAA 3TSSA 4US9A 1SBBB 2RPVA 1OFFA 3ABVB 3Q8EA 1JWBD 1C4AA 4XE0A 2ONQA 3U52E 1FXIA 3RFZB 2IDYA 3SEBA 3NZ3A 4RGTA 2L1AA 2PVGC 4B0EA 2K3UA 2K22A 3U2SC 1TJEA 4KGTA 1VLBA 1YNTE 2MEKA 1AW7A 1BUIC 1TY0A 1GOZA 1I4PA 2SEBD 1WYGA 3R2IA 5I4DA 3LYYA 2BYTA 1D5ZC 3HVDA 4TQ1A 3R8BA 2BTEA 4KKIA 3IT6B 4TMAB 5EE1A 4A90A 1CJEA 5T8IA 1C4PA 1P7FA 2WU2B 4LLGM 4JX1C 2WS3B 1C79A 2YEPB 3AE4B 3AE8B 1UNSA 1EWYC 4L1BA 1SE4A 3IT4B 3AEAB 3VQIA 3DWMA 1OQRA 1QILA 1QKZA 3NVWA 3N9YC 1WWTA 2WNMA 1JRPA 1FCCC 4ZYSA 1ZDXA 2DLBA 1TKEA 2GI9A 3AE7B 1J7CA 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS2 B;  1N63 A;  4US8 A;  3ETR A;  1NI3 A;  5MPO A;  3AM9 A;  1V97 A;  2JX5 A;  3VR8 B;  1QF6 A;  1ZOY B;  1FFV A;  3VR9 B;  4YXD B;  1YJI A;  3AE2 B;  1RWS A;  1R7S A;  2HTM E;  2W55 A;  1XLN A;  2JQR B;  5AUK A;  4WWM A;  4KX6 B;  4ITK A;  1CZP A;  1L6V A;  1QOB A;  2BT6 A;  1N5X A;  3W5V B;  1GT8 A;  4YT0 B;  1IUE A;  4P6V F;  3AB5 A;  2WDR B;  4YTM B;  3VRB B;  1AYF A;  3CF4 A;  1XLO A;  1AWD A;  1KRH A;  2CJN A;  1T3Q A;  2MH7 A;  2BS3 B;  3WCQ A;  2M56 B;  4ZHO A;  4WQM A;  1VJK A;  1H7X A;  3SFD B;  2MJD A;  1A70 A;  1ROE A;  2MJE A;  1L6U A;  2N0S B;  5EE9 A;  4A9A A;  3SR6 A;  4LTU A;  4N59 A;  1SB3 C;  3AE9 B;  3NS1 A;  1N62 A;  2B76 B;  3SFE B;  1FM0 D;  1TKG A;  3FAH A;  4N58 A;  2WDV B;  2K9X A;  2WLB A;  1DOI A;  1NEN B;  1WXQ A;  1QOA A;  3LB8 C;  5AUI A;  2PKO A;  3P4Q B;  1L0V B;  3AN1 A;  4YSX B;  2M19 A;  2Y5C A;  1I7H A;  3AE5 B;  1NYQ A;  1RYJ A;  1JAL A;  1TYG B;  1XO3 A;  2PVO D;  3NRZ A;  3NVZ A;  4ZOH C;  1B9R A;  2BS4 B;  4YTN B;  1GTE A;  3HRD D;  1FFU A;  2AX5 A;  2WP9 B;  1QOG A;  3DWG C;  5EE3 A;  1ZP0 B;  1FIQ A;  1QOF A;  3FC4 A;  2CU3 A;  2H89 B;  1E9M A;  4YSY B;  1N60 A;  2EKI A;  3B2F A;  4USA A;  4US9 A;  3NVY A;  1JW9 D;  3CIR B;  1KFY B;  3HUI A;  3P4P B;  1PFD A;  1DGJ A;  1OFF A;  2W3R A;  3W9C B;  1DOY A;  3B2G A;  3ABV B;  4HRO A;  1JWB D;  2K5P A;  5H8Y E;  1FXA A;  2G1E A;  1L5P A;  2QIE B;  4C80 A;  1PUT A;  1FXI A;  3AEE B;  3ZYY X;  1YQ3 B;  2DWQ A;  1UWM A;  1FO4 A;  1WGK A;  5C2T B;  2PVG C;  3NVV A;  2K22 A;  3AE6 B;  2L52 A;  4ZHP A;  1F0Z A;  3AV8 A;  1PDX A;  1TJE A;  1JWA D;  3CWI A;  2W54 A;  1VLB A;  1GAQ B;  2KAJ A;  3P63 A;  5EE0 A;  1SF0 A;  1NYR A;  2MJ3 A;  1DOX A;  3AEF B;  1TKY A;  3P4R B;  1JRO A;  3AEB B;  3AMZ A;  1WYG A;  2QJL A;  1E6E B;  4YSZ B;  4C7Z A;  5C3J B;  3VRA B;  1ZUD 2;  4HRS A;  4YTP B;  4IDI A;  2WQY B;  2Q5W D;  2WU5 B;  2E3T A;  1H7W A;  2PIA A;  3AH7 A;  3KWL A;  4JWS C;  2ACZ B;  1FRR A;  2OHF A;  1WRI A;  2W3S A;  2DBY A;  3AEC B;  1OQQ A;  1FMA D;  5EE1 A;  5H92 C;  3AEG B;  4N6E B;  1CJE A;  3B9J A;  5GXG B;  1N5W A;  1QLB B;  3AE3 B;  2WU2 B;  4FXC A;  3P1M A;  1GTH A;  1V8C A;  4JX1 C;  2WS3 B;  3HVZ A;  1RM6 C;  2CJO A;  2LEK A;  3W5U B;  2WDQ B;  1YQ4 B;  2L83 A;  4JWU C;  1KF6 B;  1QT9 A;  5G5G A;  4C7Y A;  1JQ4 A;  3AE4 B;  3AE8 B;  1EWY C;  3P4S B;  3AEA B;  1XLP A;  2FBW B;  3BII D;  3DWM A;  1OQR A;  1XLQ A;  5G5H A;  1J7A A;  2H88 B;  1RFK A;  3L4P A;  1E7P B;  3NVW A;  1J7B A;  3PO0 A;  1WWT A;  2KMM A;  3LXF A;  1JRP A;  1E10 A;  3RPF C;  1NEK B;  1GPX A;  1NVI D;  1VDV A;  3AED B;  1TKE A;  1SIJ A;  1YJJ A;  1N61 A;  3EUB 2;  3AE7 B;  1ZXI A;  1J7C A;  1E0Z A;  3AE1 B;  1FRD A; 
#chains in the Genus database with same CATH topology
 3ZNZ B;  3ETR A;  3NUH B;  4LNO A;  1KH0 A;  1ZOY B;  3VR9 B;  4YXD B;  4MH8 A;  3O65 B;  1MJD A;  2ZW1 A;  3A1Q B;  4IM0 A;  1JRU A;  1R4M B;  1CZP A;  3DHG C;  5FK9 C;  1PGA A;  1WJU A;  1GG3 A;  3QAQ A;  4YTM B;  1V1O A;  2A5U A;  1KLG D;  3SFD B;  2N4F A;  2WXO A;  3GP7 A;  3DHH C;  1VZ8 A;  1WXV A;  5E6J A;  2J52 A;  2GB1 A;  4OVZ A;  4R3D A;  2BS4 B;  2WP9 B;  1P9D U;  3ZNI D;  4ZRJ A;  2ICI A;  4DHJ D;  2K8H A;  4FUL A;  2C60 A;  2W3R A;  2WHI A;  4OHJ A;  1WXA A;  3A4S C;  3TL5 A;  3ZYY X;  3N1X C;  3KW5 B;  3EFU A;  1ENF A;  2L7R A;  1PYW D;  2L52 A;  3CWI A;  1NYR A;  3UIP B;  1EU4 A;  4GIV A;  4MGZ E;  2WXK A;  4A8X C;  2L32 A;  3DOW A;  3VRA B;  2VH1 A;  1FCL A;  3QQ8 B;  5FR6 A;  2DBY A;  2R61 A;  4YWG G;  3C19 A;  1PGX A;  2JRI B;  3FIL B;  2WGS A;  4W9I A;  4WJP A;  3APC A;  2K8C A;  5AZF A;  2CJO A;  4JLC A;  1MHX A;  2HJ1 A;  2IND C;  3M3J A;  1NBF C;  2EMT A;  3ZJT A;  2LHD A;  4OVU A;  1WXM A;  5BMG A;  5BYS A;  2K8B A;  3E9S A;  4LNN A;  2M0X A;  5D7G A;  3I5J C;  3URY A;  3OJ4 B;  2L8J A;  1AAR A;  3EUB 2;  4GDK A;  3AE1 B;  1FRD A;  1IGC A;  2DNF A;  1FPY A;  1OQY A;  2KDI A;  2D10 A;  4W9F A;  2NCN A;  2L00 B;  2QSD A;  3PHX B;  4FBJ B;  1SGH A;  1GB1 A;  3VVW B;  1BXT A;  2JU6 X;  3RNG C;  1TY2 A;  3BY4 B;  5FKA C;  2HJ8 A;  2D5G A;  3HM3 A;  2E6X A;  4W9G A;  3ZDT A;  4WQM A;  4LCD E;  3TJP A;  3SDL C;  3SFE B;  1TKG A;  2AEH A;  4M8N A;  2V3P A;  2RDG A;  1J19 A;  2NMQ A;  1FNV A;  1HZ6 A;  4WAA A;  4YTN B;  3UQA A;  2JRH A;  2B3A A;  1ZP0 B;  2ZW0 A;  2CS4 A;  1ISN A;  5D6J B;  2OJW A;  2LGS A;  3DPD A;  4W9D A;  2ZVN A;  2M8S A;  1WGK A;  4NJ7 A;  5L83 A;  4MJS B;  3H7S A;  1PDX A;  1GAQ B;  1SF0 A;  5IAA C;  1DOX A;  2CKH B;  3AEF B;  4DK5 A;  5D3D A;  2BB5 A;  2ACZ B;  2W3S A;  1WRI A;  4MM3 A;  3AEC B;  3AEG B;  4N6E B;  2V0G A;  1FD6 A;  2KAC A;  2BGF A;  5CHF A;  2ZZP B;  4C4V A;  4C7Y A;  4DHZ B;  2MHJ A;  3P4S B;  1XLP A;  1U4A A;  1D6E C;  2KFK A;  1XF5 L;  2KMM A;  2WX1 A;  3VDZ A;  5HI1 A;  2KMA A;  2LD9 A;  2IO3 B;  1TS4 A;  3CSF A;  1UBQ A;  4US8 A;  2PJH A;  2FUG 1;  2KTR A;  1XCQ L;  4DWF A;  5IKC M;  4L23 A;  4GOC A;  1WH3 A;  1P98 A;  2KC2 A;  5AUK A;  3KWV A;  4DXF A;  1QOB A;  3W5V B;  2V3N A;  4NY0 A;  3R3M A;  2ZCC A;  2K1F A;  4URK A;  1V80 A;  2M56 B;  2NPT B;  2O6V D;  1JWM D;  3VUY A;  2FE8 A;  2JZZ A;  1C78 A;  2G9H D;  3KUC B;  4ANX A;  5D2M B;  4HCP B;  3RCZ A;  3AN1 A;  4NQL B;  4K7U A;  2N9L A;  4IWO A;  4ZOH C;  4BOS C;  4BKG A;  2LVO A;  1E8Y A;  2LUE A;  2M0A A;  4MSQ B;  2CU1 A;  4TSS A;  1JW9 D;  3CIR B;  2J0M A;  2MP2 B;  3W9C B;  5H8Y E;  4HLE A;  2JVC A;  4OZA A;  2YEP F;  1PUT A;  4C00 A;  1UWM A;  1KJT A;  1MI0 A;  4HKQ A;  2LGI A;  3EA6 A;  1JWA D;  2JXX A;  3DVN V;  3ZQ4 A;  3TMP B;  3T8M A;  3EC8 A;  5JXV A;  2FCQ A;  4YTP B;  1WGD A;  1EM7 A;  4L2Y A;  3APF A;  3RNE C;  1OQQ A;  2L3Z A;  3B9J A;  3J9C A;  1QLB B;  1UD7 A;  5DPS A;  3WA0 A;  1L0Y B;  2HDE A;  2NS5 A;  3V61 A;  3DDC B;  2C5L C;  1XLQ A;  2AQ3 B;  2K6Q A;  1WRD B;  3R7Q A;  4RGM A;  3Q2A C;  1V1P B;  1GPX A;  2RSU A;  2VH2 A;  1FEH A;  3AU4 A;  2L0F A;  4PS3 A;  4W9H A;  2IPK D;  1H4R A;  1TGZ B;  1K53 A;  2WXP A;  5C1Z A;  1C9F A;  4FA6 A;  5HFY A;  5KHO A;  1FFV A;  4AJW A;  3H6N A;  2JYE A;  5L95 C;  2J0K A;  1ESF A;  3JYU A;  1L6V A;  5CHV C;  1V5T A;  2RGF A;  2DYM A;  1GT8 A;  3DVN U;  3B08 A;  4FN2 A;  1KRH A;  2M4N A;  3QHT A;  3ZXR A;  1PQS A;  3NS1 A;  4C56 C;  2NTT A;  3FAH A;  3LB8 C;  2MBE A;  3HIZ A;  2PVO D;  1J0G A;  1E8X A;  3H7P B;  4UDU C;  2O2V A;  3RN9 C;  1E9M A;  1V2Y A;  1WF9 A;  1OFF A;  3QIJ A;  1UH6 A;  2GBM A;  1JWB D;  4XE0 A;  1FXI A;  1YX5 B;  4RGT A;  2PVG C;  2K3U A;  3MC8 A;  4IG7 B;  3NG0 A;  1VLB A;  4KV2 A;  3UF8 A;  3W1S C;  1BUI C;  4FLH A;  4S17 A;  1UBI A;  4IWP A;  3RNC C;  4WWN A;  2BYF A;  3LYY A;  1RFA A;  1D5Z C;  4BBN C;  1WYW B;  1T0Y A;  4GN1 A;  3R8B A;  2BTE A;  1P3Q U;  3IT6 B;  1WE7 A;  2LRU A;  2RD0 A;  1V9J A;  5T8I A;  2DZM A;  1P7F A;  2WU2 B;  3IHP C;  1Q1O A;  2ZPY A;  1WZ3 A;  4JX1 C;  1P1A A;  3A9J A;  1LGR A;  1WGR A;  2D3A A;  2KWV B;  1QIL A;  3X0W A;  1QKZ A;  1EUV B;  4GSW A;  3LJ3 A;  4GMV A;  1D3Z A;  3AE7 B;  2CHW A;  1EF1 A;  3GE8 C;  1R4N I;  1NI3 A;  1V97 A;  2YLM A;  2Y5B B;  3B1L X;  4DDG D;  1PGB A;  3GZN I;  3D32 A;  5G55 A;  2PE9 A;  1ZXH A;  1E7V A;  1V6E A;  1IUE A;  3ZRF A;  2WDR B;  1AYF A;  2X8X X;  1T5X D;  2W9N A;  3BVZ A;  3QAR A;  4KIK B;  4REZ A;  1VJK A;  3OWE B;  2AQ1 B;  2RPQ A;  2YVC A;  1SE3 A;  2JF5 A;  2B76 B;  1FM0 D;  4WUR A;  5CX3 A;  5LXI B;  2KK8 A;  2BKF A;  2DEN B;  4RM8 A;  3AE5 B;  4LNF A;  4BKT A;  1GTE A;  3U7D A;  1FIQ A;  4AWJ A;  3I63 C;  4ZDV A;  1KFY B;  1STE A;  1JCK B;  5CTR C;  2KWD A;  3QWZ B;  2K5P A;  2KYW A;  1L5P A;  4F7Z A;  2Z0E B;  3WAN A;  2NBW B;  1HE8 A;  1UGJ A;  2FCS A;  2RDH A;  2BVC A;  3TUO A;  3K9O B;  4B9K A;  5FR3 A;  2LGD A;  3AMZ A;  5AZG A;  4NJC A;  4K7S A;  4RF0 A;  1E8W A;  3AH7 A;  4YL8 A;  2MBH A;  3PZD A;  1TZO A;  1IP9 A;  1FNU A;  5GXG B;  2WWZ A;  1GTH A;  3GOE A;  3PT2 B;  3HVZ A;  1ET9 A;  3ZTC A;  3JSV B;  1I4H A;  1QQR A;  5G5G A;  5BYQ A;  4ZYN A;  1F2R C;  3S2A A;  3VAW A;  3ZO5 B;  3PO0 A;  2KFJ A;  3U7Z A;  2J42 A;  4JPS A;  2DYB A;  2C7N B;  1C4C A;  2LMC A;  4RM9 A;  4N9F 4;  2IYD B;  4RMA A;  4HDQ A;  3WIM A;  1N63 A;  2XNA C;  4AQ7 A;  2V9H A;  4LNI A;  4XDC A;  1I42 A;  4XZ4 A;  3N30 A;  2WXR A;  4BKS A;  3RUI B;  1F52 A;  2LJI A;  3BZD B;  5BYR A;  4P1C C;  3PLU A;  3NY5 A;  2DZJ A;  2N0S B;  4O1N A;  2D3C A;  1VCB A;  5J2R A;  3JW0 X;  4WWO A;  2QCZ A;  4JE3 B;  1WXQ A;  1YOV B;  2M19 A;  3N3K B;  1D5M C;  1X1M A;  4KVG B;  2WYQ A;  1KM7 A;  3MFG A;  2REX A;  2H89 B;  4MJS A;  2K0P A;  2KJR A;  1FXA A;  2O6V B;  2KJ6 A;  3QA8 A;  4CYE A;  4ZHP A;  1V81 A;  3ONS A;  3LDZ E;  2QC8 A;  2V4I B;  1TKY A;  3WAP A;  4HJK A;  2PW9 A;  2KOX A;  3ZW3 A;  2D2Q A;  2I1J A;  2WXQ A;  1F9J A;  3ZRC A;  2FUH B;  1TTN A;  1VR9 A;  1HQR D;  1L4Z B;  1R4N B;  2QMT A;  3W5U B;  4I6L B;  3U8Z A;  1KF6 B;  2XN9 C;  3VUW A;  4MDK E;  4WIP A;  3GZN B;  2ZNV C;  5IN7 A;  2N7J A;  1E10 A;  3O13 A;  1CQV A;  3VFK A;  4HXD A;  4XYC A;  4KSK C;  4RGO S;  1I4Q A;  4E3C A;  3AM9 A;  2RMM A;  2IJ0 A;  1R7S A;  2BPS A;  2GLS A;  3U4E G;  4KX6 B;  2MQJ A;  1K8R B;  2JYT A;  3PHW B;  2MW5 A;  1WX7 A;  1F77 A;  1TIF A;  1YN5 A;  2C7H A;  3BK2 A;  1AWD A;  3V6E B;  3PZ8 A;  3MJW A;  2EMS A;  2LI5 A;  5DPR A;  5IA7 A;  4WH4 A;  1YX6 B;  2OJR A;  2I38 A;  5J17 A;  3BWU D;  4IOI E;  1WR6 E;  2MP2 A;  4KGR A;  5KHQ A;  4AP4 C;  3TCA A;  1SJH D;  2MX2 A;  2WXM A;  4AUQ C;  3CST A;  3NVY A;  1PFD A;  1UGM A;  2GBN A;  2MRP A;  2DYO A;  2IZV B;  3NVV A;  1ZPS A;  1MHH E;  1WGY A;  2WXF A;  2JSV X;  4RF1 A;  2FCM A;  3VH3 B;  2KLG A;  2VZK D;  3ML8 A;  2KWU B;  2AQ2 B;  2QIL A;  4JWS C;  2WU5 B;  1FRR A;  2N9X A;  2AL3 A;  3ZXV A;  4KDL B;  3ENE A;  4J6I A;  2JZ3 B;  1I4X A;  2WXG A;  4W9K A;  3WAM A;  2PLP A;  1RM6 C;  1V1P A;  2LEK A;  1UZX B;  4DHZ E;  1SJE D;  3L10 B;  4GLS C;  1C3T A;  3L4P A;  3SHQ A;  1QZE A;  4ZRK A;  1WY8 A;  4HPL B;  3RZF A;  1JWU D;  1E0Z A;  3A9K A;  1XEE A;  4A3O A;  5MPO A;  4PYU A;  1VRA B;  3TBL D;  2D11 A;  3M95 A;  3Q14 C;  1RWS A;  4G11 A;  1YIW A;  2JQR B;  2BYV E;  3N1Y C;  2FNJ B;  4GGQ A;  4B6W A;  4NJ6 A;  3AB5 A;  1K51 A;  3RZW C;  4ZRQ A;  2ASQ A;  1C77 A;  1XXG A;  4ICV A;  4HEA 1;  2K9X A;  2LGX A;  3B0A A;  5BMH A;  4IC7 B;  3VTV A;  1JAL A;  1B9R A;  2CHX A;  2R2Q A;  3FC4 A;  3RD2 A;  3CMM B;  2RPV A;  3HM6 X;  4BAX A;  1C4A A;  3OLM D;  4K81 A;  4MGK E;  1YQB A;  1P0R A;  3NZ3 A;  3SEB A;  3QC8 B;  4JGH B;  4KGT A;  2BKR B;  2MEK A;  3HHM A;  1I4P A;  1MFW A;  1WYG A;  2SEB D;  2OOB B;  4ASW C;  4TQ1 A;  4M02 A;  3VHT C;  1A5R A;  3RI7 C;  4A90 A;  4A20 A;  1CJE A;  1C4P A;  4EFO A;  4LLG M;  2WS3 B;  3OAW A;  1C79 A;  3AE8 B;  1EWY C;  3IT4 B;  3DWM A;  2R2O A;  2PE6 B;  3N9Y C;  2WNM A;  1JRP A;  4BFR A;  5GMV A;  1ZDX A;  2DLB A;  1L7Y A;  2GI9 A;  1J7C A;  2BWE S;  4DXG A;  1BML C;  2J0J A;  4IWQ A;  1E7U A;  2HTM E;  1XLN A;  1F1H A;  3X23 A;  4KIK A;  4WJN A;  5E6N A;  1HTO A;  4JL9 A;  3NHE B;  1E90 A;  1LM8 B;  1EU3 A;  2D3G A;  3KH0 A;  5JHA A;  1G6J A;  4FHJ A;  4XC2 A;  2MJD A;  2MJE A;  2L0T A;  1L2N A;  3SR6 A;  1XQQ A;  3RUL A;  2KZR A;  2KO3 A;  2N9P C;  3C8Y A;  2RR9 A;  4J3O D;  5LNK 1;  1NEN B;  3ALB A;  2WXN A;  2K39 A;  4HVB A;  3RNA C;  3V05 A;  2AWT A;  1WI0 A;  4C80 A;  3P4P B;  1CMX B;  2QEJ C;  4X57 B;  5C23 A;  2N7E A;  4EZL A;  4I6N B;  2LZ6 A;  4F1S A;  4MM3 B;  1FXT B;  2HD5 B;  2MSE D;  2A4Z A;  2W54 A;  2IY1 B;  2LVQ A;  1RLF A;  3BYY B;  1JRO A;  3AEB B;  2QJL A;  2JWU A;  4C4V B;  1L0X B;  4K3B A;  4LJO B;  1NDD A;  2WX0 A;  3JSV A;  5H92 C;  4BKS D;  4IKG A;  3BVG A;  1JML A;  4ARI A;  3C0R B;  2G45 B;  4RNA A;  4KGS A;  4W9L A;  4AS1 A;  1T0R C;  4KSL C;  4LK0 M;  3L13 A;  2MLB A;  2H88 B;  2KTR B;  3Q3N C;  3CF6 E;  3DVG Y;  3LXF A;  1WM2 A;  2RDB C;  3Q8A A;  4DHJ B;  3IVF A;  3IFW B;  4W9E A;  2K6D B;  1YD8 U;  2IO1 B;  1MG8 A;  1WE6 A;  4A55 A;  5DPW A;  2J4X A;  4OVV A;  2HTH A;  1XD3 B;  1E8Z A;  3AXC A;  4P6V F;  5D94 A;  4M00 A;  3CF4 A;  4I6P A;  1UEL A;  4MEL A;  3P42 A;  3ZNH B;  3A1Q A;  2JUO A;  4A9A A;  2CR5 A;  5HKH A;  2SAK A;  1Z5S B;  1HA5 A;  1TBE A;  2L05 A;  2PKO A;  3A33 B;  2Y5C A;  1NYQ A;  2KQ7 A;  1UUP A;  1IBX B;  3VH4 B;  1D5X C;  3DWG C;  1WSP A;  3H9D A;  2EKI A;  2WDT B;  1OEY A;  2WXI A;  4PS7 A;  3PTF C;  1J8C A;  3R2T A;  4P1B C;  1DOY A;  4A6Q A;  1XT9 B;  1P7E A;  4MAC A;  1WXS A;  3RNF C;  2QIE B;  2KN5 A;  3L16 A;  2BW2 A;  1KOT A;  2DWQ A;  5J18 A;  3DBL B;  1S1Q B;  5DPT A;  4XWW A;  2GBJ A;  3P63 A;  2ON8 A;  3Q8B A;  1GB4 A;  1L4D B;  2DZK A;  5C3J B;  3UI3 A;  2FAZ A;  1VD2 A;  4RCO A;  1H7W A;  2ZPN A;  2INN E;  3ML9 A;  2ZEQ A;  1GJZ A;  3R66 C;  2BQQ A;  4OZC A;  1YQ4 B;  4JWU C;  1QT9 A;  1JWS D;  1JQ4 A;  2WXJ A;  4FJZ A;  3UGB B;  2FBW B;  3BII D;  4M0W B;  2DAJ A;  2Y3A A;  3FIL A;  2VZK B;  1J7B A;  2KT7 A;  3MC0 B;  2MCN B;  2M1M A;  1NVI D;  3ZNG C;  4MGY E;  3Q6B A;  2LHE A;  1WJ6 A;  2XBB C;  3RMK C;  5EDS A;  1HEZ E;  2IO0 B;  3PVL A;  1UF0 A;  3DHI C;  3QX1 A;  3NOB A;  2BB6 A;  2Z8L A;  4ZRP A;  4ACF A;  3Q3F A;  4GB9 A;  3T9L A;  1K52 A;  3UIN B;  3MHZ A;  2BYE A;  1A70 A;  3W2D A;  5AEK B;  2O2V B;  3PGE A;  2INC C;  4LNK A;  1DOI A;  3Q69 A;  2LUM A;  2C7M B;  2LAS A;  5D3I B;  4NQK E;  1QOF A;  4A3P A;  2CU3 A;  3B2F A;  4E71 A;  1GNU A;  2XEW A;  4HRO A;  2ZCB A;  4GDL B;  2G1E A;  2N1W A;  2GRI A;  4EE2 A;  4ICU A;  2BF8 B;  5DCN A;  2MJ3 A;  3VTU A;  1WGH A;  2N7D A;  2MBQ A;  1LQB A;  3PRM B;  3GB1 A;  1KTK A;  4C7Z A;  4EZJ A;  1WX8 A;  2LXC A;  3A9J B;  5LLI A;  2WQY B;  1F2R I;  1ET6 A;  2NBU A;  3KVF B;  3NS8 A;  4FXC A;  3P1M A;  4CQN A;  1V8C A;  1WMH B;  4CO7 A;  3KUZ A;  1HXY D;  4MT5 A;  4TQ0 A;  1I4R A;  2JPH A;  3RYT A;  2FIF A;  1E7P B;  3SU8 X;  5HHD G;  4NAW B;  3DCG A;  3AED B;  4FJY A;  2G4S A;  2KMC A;  3L54 A;  3TEY A;  3NJT A;  4BVU C;  2FCN A;  2KDF B;  3KLS X;  2BT6 A;  1N5X A;  4G3X B;  5AZH A;  2J7Q B;  2IO2 B;  1T3Q A;  2BS3 B;  3M62 B;  1M4V A;  1NI2 A;  1ROE A;  3AI5 A;  1FNW A;  1SB3 C;  3ZGZ A;  4W9J A;  1N62 A;  3MC9 A;  5E6P A;  2C9W B;  2LFI A;  1I35 A;  4AJY B;  3VUX A;  4ANU A;  1I7H A;  4BZA A;  4G50 A;  2KX0 A;  4D2K A;  2NPT A;  2LRW A;  5LXH A;  1KLU D;  4RFB A;  2AL6 A;  3ZIM A;  1N60 A;  2LVP A;  4USA A;  4US9 A;  1SBB B;  1WJ4 A;  1GUA B;  2DZI A;  2IY0 B;  5JZE B;  2D3B A;  3U52 E;  4WQO B;  4IM2 A;  2MWS B;  3OJ3 A;  3U2S C;  5IOI A;  1WGG A;  1AW7 A;  1TY0 A;  3VTW A;  4B95 A;  3ZUN A;  1WFY A;  4PS8 A;  1ZGU B;  2BYT A;  3DBR B;  2JWZ A;  3NZU A;  1T0Q C;  3ECI A;  4TMA B;  3PPA A;  4KDI C;  3L17 A;  4LDT D;  2G3Q B;  5E6O A;  3AE4 B;  4L1B A;  3ZVV A;  3AEA B;  3VQI A;  4K3C A;  3NVW A;  4M8M A;  1WWT A;  2XK5 B;  4P7I A;  1V5O A;  4XX5 A;  3R7R A;  1MG4 A;  1TYG B;  2BS2 B;  3MTN B;  3PV1 A;  1IGD A;  1ZDV A;  2MA9 B;  1QF6 A;  3VR8 B;  4DBG A;  3IG3 A;  1YJI A;  1EO6 A;  4HK2 A;  1MPE A;  3P2B A;  2W55 A;  2W82 A;  4EEW A;  1YMH E;  4ANV A;  2KX3 A;  4KZ0 A;  2KD0 A;  2MBO A;  2CJN A;  3RNB C;  4MGI E;  2I1K A;  2KDB A;  3AE9 B;  2UYZ B;  4N58 A;  1SXT A;  2WDV B;  4HJG E;  1MVK A;  1SIF A;  1T6B X;  2IBI B;  1L0V B;  4RH6 A;  3T3N A;  1RYJ A;  2KHW B;  3NVZ A;  1WR1 A;  4OW0 A;  3NRZ A;  1HZ5 A;  4Q2J A;  2AX5 A;  4WWP A;  2FID A;  2IGH A;  2MBB B;  2X38 A;  1C1Y B;  1YN3 A;  2UU7 A;  4DQO C;  3QJZ A;  3EFC A;  1DGJ A;  1Q5W B;  1V49 A;  3KYD D;  4KZC A;  3B2G A;  3PSE B;  4EKU A;  3PLV A;  2M17 A;  1FO4 A;  2GOW A;  1Q0W B;  3AE6 B;  1F0Z A;  3Q3O C;  3H7P A;  2KAJ A;  4AOF A;  3OG5 A;  2LXA A;  3QCA A;  3P4R B;  1HTQ A;  2DAF A;  3HK0 A;  4HRS A;  2CHZ A;  2EKE C;  3KWL A;  4OZB A;  4G0N B;  3T3O A;  4PK1 A;  3H8H A;  2OED A;  1N5W A;  4F8C B;  3AE3 B;  2LWP A;  3KYC D;  2ZVO A;  3UQB A;  4MH0 E;  3FKY A;  3V62 A;  2KQ4 X;  5IO9 A;  1ZKH A;  5G5H A;  1J7A A;  1RFK A;  3DQV A;  2IGD A;  4HDO A;  1EF5 A;  1I4G A;  3V3X A;  5JH5 C;  1FFU A;  1RRB A;  3DVG X;  1T0S C;  3KUD B;  3DBL I;  4K1R B;  4HKZ E;  2KVR A;  3W1Y A;  4GDK B;  2KTF A;  4ITK A;  1OTR B;  3Q8F A;  1KLV A;  2WXH A;  4E74 A;  4YT0 B;  5TR5 A;  4PYZ A;  3VRB B;  1B1Z A;  1XLO A;  4S0R A;  2G4D B;  3AU5 A;  3Q8C A;  4GU2 A;  5EE9 A;  3L0W B;  4LTU A;  3WAL A;  1IBX A;  2PTL A;  5IP4 D;  3VXW A;  1RAX A;  2J53 A;  1QOA A;  1IPG A;  1XO3 A;  3EHV A;  2GBR A;  3I57 A;  2EEL A;  2Y5P A;  1QOG A;  2K25 A;  3M63 B;  2I2Y A;  1AN8 A;  1ACC A;  3HUI A;  3PS6 A;  1EWC A;  2ZNV B;  4PT5 A;  3ZJU A;  4JQW C;  2GBK A;  2KJH B;  3V6C B;  1ZE3 D;  5C2T B;  3SD5 A;  2NTS A;  1SSN A;  3AV8 A;  3IAM 1;  3TEW A;  4NZL B;  4HWI B;  3TEX A;  1LXD A;  1IYF A;  1E6E B;  1ZUD 2;  3BYT B;  4IDI A;  5TSS A;  2E3T A;  4HPP A;  2OHF A;  4EUT A;  1FMA D;  2KQS A;  2Z59 B;  3TIX A;  4M01 A;  3DBH I;  2JXT A;  4M0W A;  1Y56 A;  3BK1 A;  2KNB A;  2WXL A;  3E56 A;  3ZLZ A;  3A9K B;  1DYQ A;  3DBS A;  2KXJ A;  1Q10 A;  3RPF C;  1NEK B;  1WZ0 A;  4FHK A;  4EZK A;  1VDV A;  3MJ5 A;  3PZ7 A;  4BBN F;  3I3T B;  2BBC A;  2NBV B;  5BO4 B;  4TV3 A;  2KAN A;  2KFK B;  4KKJ A;  4NAM A;  2JX5 A;  5HG2 A;  3WAO A;  3ZJV A;  1SE2 A;  1YN4 A;  4WWM A;  2NVU I;  2QDF A;  4CHK A;  3IXS A;  4JIO U;  2KN4 A;  3AUL A;  3IAS 1;  3WCQ A;  2MH7 A;  1TS5 A;  2IGG A;  3NZS A;  1L6U A;  1Z2M A;  4WJO A;  3UIO B;  3ZDM C;  4XWT A;  2UWQ A;  4YSX B;  1OEY J;  1R4M I;  1S3S G;  2JZP A;  2DHZ A;  1V86 A;  4GDL A;  3MP9 A;  3HRD D;  3TEZ A;  4BOZ B;  1BT0 A;  5BMI A;  4FJV B;  4YSY B;  4K7W A;  4NPN A;  4TKN A;  3Q3J A;  3EGR A;  2HE7 A;  2GMI C;  4WAF A;  1D4B A;  2PMV A;  3AEE B;  2PPH A;  1YQ3 B;  2V3S A;  3GS2 A;  2KLC A;  5EE0 A;  2N1V A;  4YSZ B;  4P16 A;  4XDD A;  2N9K A;  2O6V A;  4TUU A;  2Q5W D;  1WMH A;  2PIA A;  1WIA A;  3KQ4 A;  1TS2 A;  4ANW A;  4HPM B;  1LFD A;  2ZJD A;  4NAW A;  2WDQ B;  2L83 A;  4FAD A;  3PRE A;  3N1Z C;  1WJN A;  1C76 A;  3Q3M C;  4MEM A;  1WX9 A;  2LJ5 A;  1Y8R C;  1SIJ A;  2KC1 A;  1YJJ A;  2KVZ A;  1N61 A;  1XCT L;  3RT3 B;  1ZXI A;  1VZ6 A;  4LDT B;  1UWX A;  2L76 A;  1CK1 A;  1N6Z A;  4II3 B;  4II2 B;  2LGY A;  4ARC A;  1SEB D;  3AE2 B;  3BVM A;  5CHW A;  3W1S A;  5G2N A;  2KDM A;  3K9P B;  4DDI D;  3DBR I;  1OGW A;  4IM3 A;  4QAY A;  2JT4 B;  4ZRI A;  1VZ7 A;  3I9V 1;  4IUM B;  4RGN A;  2V4L A;  4WJQ A;  1TT5 B;  1YJ1 A;  4W9C A;  3V60 A;  4ZHO A;  1H7X A;  3L08 A;  4B0M A;  4LJP B;  4N59 A;  2KDE B;  1GC7 A;  2WLB A;  1H8C A;  2TSS A;  4EOY A;  3PRP B;  4NNJ B;  5AUI A;  4XGA B;  3P4Q B;  4H2A A;  1K50 A;  3GE3 C;  1M94 A;  3N20 C;  1E5W A;  3IBE A;  3EEC A;  5EE3 A;  1TS3 A;  2INP E;  1LO5 D;  4HCN B;  1WM3 A;  3TSS A;  5JHB A;  4GXB A;  1GC6 A;  3ABV B;  3Q8E A;  2V1Y A;  2ONQ A;  3RFZ B;  2IDY A;  3DBH B;  3BIN A;  2L1A A;  4B0E A;  2D07 B;  2K22 A;  1TJE A;  3A4R A;  1YNT E;  2NR2 A;  4IW0 A;  3PRZ A;  1GOZ A;  3R2I A;  5I4D A;  3H1U A;  2DX5 B;  3JVZ X;  3HVD A;  2JY6 A;  4KKI A;  2AYO B;  5EE1 A;  3QK0 A;  3ZTD A;  2KKC A;  4MSM B;  2XK5 A;  3MHS D;  2YEP B;  2QHO A;  1ZW7 A;  2KWC A;  1UNS A;  1SE4 A;  2PEA A;  1OQR A;  3U30 A;  2Z0D B;  2BWF A;  1FCC C;  1SE9 A;  4ZYS A;  3ZKJ C;  3N32 A;  1TKE A;  2N9E B;  3APD A;  1TZ1 A;  4DXA B;  2VRR B; 
#chains in the Genus database with same CATH homology
 2BS2 B;  4DXG A;  3ETR A;  3NUH B;  1IGD A;  1ZDV A;  1NI3 A;  1KH0 A;  1V97 A;  3VR8 B;  1BML C;  1QF6 A;  1ZOY B;  3VR9 B;  4YXD B;  4MH8 A;  1YJI A;  1MPE A;  2HTM E;  2W55 A;  2ZW1 A;  1XLN A;  2W82 A;  1PGB A;  1CZP A;  1YMH E;  5FK9 C;  1ZXH A;  1PGA A;  1IUE A;  2WDR B;  4YTM B;  1AYF A;  1V1O A;  1EU3 A;  1T5X D;  3BVZ A;  2CJN A;  1KLG D;  4REZ A;  1VJK A;  3SFD B;  2WXO A;  2MJD A;  3GP7 A;  2MJE A;  3OWE B;  2AQ1 B;  3SR6 A;  3AE9 B;  1SE3 A;  2B76 B;  1FM0 D;  4WUR A;  4N58 A;  1VZ8 A;  1SXT A;  2WDV B;  4HJG E;  5E6J A;  2J52 A;  3C8Y A;  5LNK 1;  4J3O D;  1NEN B;  1MVK A;  1T6B X;  4RH6 A;  1L0V B;  2WXN A;  3T3N A;  2GB1 A;  3AE5 B;  1RYJ A;  3NVZ A;  4OVZ A;  4R3D A;  4OW0 A;  3NRZ A;  1HZ5 A;  2BS4 B;  4Q2J A;  3V05 A;  1GTE A;  2AX5 A;  2WP9 B;  1FIQ A;  2IGH A;  2ICI A;  2X38 A;  1YN3 A;  4DQO C;  4C80 A;  1KFY B;  1STE A;  3P4P B;  1DGJ A;  1JCK B;  2W3R A;  3B2G A;  2KWD A;  2QEJ C;  4OHJ A;  2K5P A;  1L5P A;  3ZYY X;  1FO4 A;  4MM3 B;  1ENF A;  1PYW D;  3AE6 B;  2L52 A;  1F0Z A;  1UGJ A;  3CWI A;  2W54 A;  2KAJ A;  2RDH A;  3TUO A;  1NYR A;  1EU4 A;  3BYY B;  3P4R B;  5FR3 A;  1JRO A;  3AEB B;  3AMZ A;  2WXK A;  4NJC A;  2QJL A;  2JWU A;  4A8X C;  2L32 A;  3VRA B;  1L0X B;  4HRS A;  4RF0 A;  1FCL A;  3KWL A;  3AH7 A;  4OZB A;  2DBY A;  2R61 A;  3T3O A;  4YWG G;  1PGX A;  5H92 C;  1TZO A;  3FIL B;  3H8H A;  1FNU A;  2OED A;  1N5W A;  4IKG A;  5GXG B;  3BVG A;  3AE3 B;  1JML A;  1GTH A;  4ARI A;  3HVZ A;  2CJO A;  1ET9 A;  1MHX A;  4RNA A;  4KGS A;  1I4H A;  1QQR A;  5G5G A;  5BYQ A;  2KQ4 X;  4AS1 A;  1F2R C;  4LK0 M;  2LHD A;  3ZJT A;  5G5H A;  1J7A A;  2H88 B;  1RFK A;  5BMG A;  5BYS A;  3PO0 A;  2IGD A;  3LXF A;  3U7Z A;  3E9S A;  3Q8A A;  2J42 A;  4JPS A;  1I4G A;  5D7G A;  1C4C A;  2LMC A;  3URY A;  3EUB 2;  3V3X A;  1FFU A;  3AE1 B;  1FRD A;  1IGC A;  1N63 A;  4A55 A;  2XNA C;  4AQ7 A;  4HKZ E;  4GDK B;  2J4X A;  2QSD A;  4XDC A;  4ITK A;  3Q8F A;  1GB1 A;  1BXT A;  2JU6 X;  2WXH A;  1TY2 A;  2WXR A;  4YT0 B;  4P6V F;  5FKA C;  3VRB B;  2D5G A;  3CF4 A;  1B1Z A;  1XLO A;  2LJI A;  3BZD B;  2E6X A;  5BYR A;  4WQM A;  3P42 A;  3Q8C A;  4A9A A;  2N0S B;  4O1N A;  5EE9 A;  4LTU A;  1IBX A;  3SFE B;  1TKG A;  2PTL A;  2SAK A;  4JE3 B;  2J53 A;  1HA5 A;  1WXQ A;  1QOA A;  2PKO A;  2V3P A;  2RDG A;  2NMQ A;  2M19 A;  2Y5C A;  1XO3 A;  1NYQ A;  1FNV A;  1D5M C;  3I57 A;  1HZ6 A;  1UUP A;  4YTN B;  2EEL A;  1IBX B;  1D5X C;  2Y5P A;  1QOG A;  3DWG C;  1WSP A;  1ZP0 B;  2I2Y A;  3MFG A;  2ZW0 A;  1AN8 A;  2H89 B;  2EKI A;  2WXI A;  1ACC A;  3R2T A;  3HUI A;  2K0P A;  1EWC A;  4PT5 A;  3ZJU A;  1DOY A;  4A6Q A;  4MAC A;  1P7E A;  1FXA A;  2QIE B;  2BW2 A;  1ZE3 D;  2DWQ A;  1WGK A;  5C2T B;  2NTS A;  4ZHP A;  1SSN A;  3AV8 A;  1PDX A;  4XWW A;  3IAM 1;  3TEW A;  1GAQ B;  3P63 A;  4NZL B;  1SF0 A;  2ON8 A;  3Q8B A;  1DOX A;  3TEX A;  2V4I B;  3AEF B;  1TKY A;  1GB4 A;  1L4D B;  2PW9 A;  1E6E B;  5D3D A;  5C3J B;  3UI3 A;  1ZUD 2;  3BYT B;  4IDI A;  5TSS A;  2WXQ A;  4RCO A;  2E3T A;  1H7W A;  2BB5 A;  2ACZ B;  2OHF A;  2W3S A;  1WRI A;  2INN E;  3AEC B;  1FMA D;  3AEG B;  4N6E B;  2V0G A;  1FD6 A;  1VR9 A;  1HQR D;  2KAC A;  2JXT A;  1L4Z B;  4M0W A;  1Y56 A;  3BK1 A;  2WXL A;  4OZC A;  2QMT A;  3W5U B;  1YQ4 B;  4JWU C;  4C7Y A;  1KF6 B;  1JWS D;  1QT9 A;  2WXJ A;  1JQ4 A;  3E56 A;  2XN9 C;  3P4S B;  4WIP A;  1XLP A;  2FBW B;  3BII D;  1DYQ A;  2Y3A A;  1D6E C;  3FIL A;  2VZK B;  1J7B A;  1XF5 L;  2KMM A;  3MC0 B;  2N7J A;  1E10 A;  3O13 A;  1Q10 A;  1CQV A;  3RPF C;  1NEK B;  1NVI D;  5HI1 A;  1VDV A;  3MJ5 A;  3PZ7 A;  4RGO S;  1I4Q A;  1TS4 A;  2LHE A;  2BBC A;  1HEZ E;  4KKJ A;  4NAM A;  4US8 A;  2FUG 1;  3AM9 A;  1XCQ L;  2JX5 A;  5HG2 A;  4L23 A;  2RMM A;  2IJ0 A;  3ZJV A;  1SE2 A;  1R7S A;  1YN4 A;  5AUK A;  3U4E G;  4WWM A;  4KX6 B;  3KWV A;  4DXF A;  2BB6 A;  1QOB A;  2JYT A;  2Z8L A;  4ZRP A;  3W5V B;  2V3N A;  1F77 A;  1YN5 A;  3IXS A;  1K52 A;  3BK2 A;  2KN4 A;  1AWD A;  3IAS 1;  3WCQ A;  2MH7 A;  3PZ8 A;  1TS5 A;  2M56 B;  2IGG A;  3MHZ A;  1JWM D;  1A70 A;  2FE8 A;  3W2D A;  1L6U A;  1C78 A;  4WH4 A;  2G9H D;  4XWT A;  2I38 A;  1DOI A;  3BWU D;  4IOI E;  3Q69 A;  2LUM A;  3AN1 A;  4YSX B;  4KGR A;  2JZP A;  2N9L A;  4ZOH C;  3MP9 A;  3HRD D;  1SJH D;  3TEZ A;  2WXM A;  5D3I B;  1QOF A;  2CU3 A;  5BMI A;  4YSY B;  2M0A A;  3B2F A;  3NVY A;  1JW9 D;  3CIR B;  4TSS A;  3W9C B;  1PFD A;  4HRO A;  4GDL B;  3EGR A;  5H8Y E;  2G1E A;  4OZA A;  2YEP F;  4WAF A;  1PUT A;  2PMV A;  3AEE B;  1D4B A;  1YQ3 B;  3GS2 A;  1UWM A;  2DYO A;  2GRI A;  1MI0 A;  4HKQ A;  3NVV A;  2LGI A;  3EA6 A;  4EE2 A;  1ZPS A;  1MHH E;  1JWA D;  2WXF A;  5EE0 A;  2JSV X;  4RF1 A;  3ZQ4 A;  2MJ3 A;  2VZK D;  3GB1 A;  5JXV A;  2AQ2 B;  2QIL A;  1KTK A;  4C7Z A;  4YSZ B;  4P16 A;  4YTP B;  4XDD A;  1EM7 A;  2N9K A;  2WQY B;  2Q5W D;  2WU5 B;  4JWS C;  1F2R I;  1ET6 A;  2PIA A;  1FRR A;  4L2Y A;  3KQ4 A;  1OQQ A;  1TS2 A;  1I4X A;  3B9J A;  3J9C A;  1QLB B;  2WXG A;  4FXC A;  3P1M A;  4CQN A;  1V8C A;  2PLP A;  1HXY D;  1RM6 C;  1V1P A;  2LEK A;  2WDQ B;  4MT5 A;  2L83 A;  4TQ0 A;  1I4R A;  1L0Y B;  1SJE D;  2HDE A;  4GLS C;  2AQ3 B;  1C76 A;  1XLQ A;  3L4P A;  1E7P B;  4RGM A;  5HHD G;  1V1P B;  4NAW B;  1GPX A;  3AED B;  1SIJ A;  1FEH A;  1YJJ A;  1N61 A;  1JWU D;  1XCT L;  2IPK D;  1ZXI A;  1VZ6 A;  1K53 A;  1E0Z A;  2WXP A;  1XEE A;  1UWX A;  3TEY A;  1C9F A;  1CK1 A;  5HFY A;  5MPO A;  1VRA B;  1FFV A;  2JYE A;  4ARC A;  1SEB D;  3AE2 B;  3BVM A;  1RWS A;  3W1S A;  2JQR B;  1ESF A;  2KDM A;  1L6V A;  3KLS X;  2BT6 A;  1N5X A;  2DYM A;  1GT8 A;  3AB5 A;  1VZ7 A;  3I9V 1;  4RGN A;  1KRH A;  1T3Q A;  2BS3 B;  1K51 A;  4ZHO A;  4ZRQ A;  1H7X A;  4B0M A;  1M4V A;  1ROE A;  1C77 A;  1FNW A;  4N59 A;  1SB3 C;  3ZGZ A;  3NS1 A;  1XXG A;  4C56 C;  1N62 A;  2NTT A;  3FAH A;  4HEA 1;  2K9X A;  2WLB A;  2LFI A;  2TSS A;  5BMH A;  3LB8 C;  5AUI A;  3P4Q B;  4H2A A;  1K50 A;  1I7H A;  4D2K A;  1JAL A;  2PVO D;  1B9R A;  1KLU D;  4RFB A;  5EE3 A;  1TS3 A;  2INP E;  3FC4 A;  4UDU C;  1LO5 D;  1N60 A;  1E9M A;  4USA A;  3TSS A;  4US9 A;  1SBB B;  2RPV A;  1OFF A;  3ABV B;  3Q8E A;  1JWB D;  1C4A A;  4XE0 A;  2ONQ A;  3U52 E;  1FXI A;  3RFZ B;  2IDY A;  3SEB A;  3NZ3 A;  4RGT A;  2L1A A;  2PVG C;  4B0E A;  2K3U A;  2K22 A;  3U2S C;  1TJE A;  4KGT A;  1VLB A;  1YNT E;  2MEK A;  1AW7 A;  1BUI C;  1TY0 A;  1GOZ A;  1I4P A;  2SEB D;  1WYG A;  3R2I A;  5I4D A;  3LYY A;  2BYT A;  1D5Z C;  3HVD A;  4TQ1 A;  3R8B A;  2BTE A;  4KKI A;  3IT6 B;  4TMA B;  5EE1 A;  4A90 A;  1CJE A;  5T8I A;  1C4P A;  1P7F A;  2WU2 B;  4LLG M;  4JX1 C;  2WS3 B;  1C79 A;  2YEP B;  3AE4 B;  3AE8 B;  1UNS A;  1EWY C;  4L1B A;  1SE4 A;  3IT4 B;  3AEA B;  3VQI A;  3DWM A;  1OQR A;  1QIL A;  1QKZ A;  3NVW A;  3N9Y C;  1WWT A;  2WNM A;  1JRP A;  1FCC C;  4ZYS A;  1ZDX A;  2DLB A;  1TKE A;  2GI9 A;  3AE7 B;  1J7C A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...