4YSZB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yszB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yszB01
1NVID 1JWBD 4LTUA 3AE9B 3HVZA 4JX1C 1R7SA 2BS4B 1TYGB 1UWMA 1ZXIA 1WYGA 1N63A 3B2GA 3AV8A 3CWIA 2PVOD 2B76B 5EE1A 3P4PB 3KWLA 1DOXA 2BT6A 4YTNB 1V8CA 1J7AA 1L6UA 2W3RA 1SF0A 2CJNA 3FC4A 3EUB2 1EWYC 1QOAA 2PKOA 1NI3A 2W54A 1E10A 1FO4A 4IDIA 1PDXA 1N60A 4ZHPA 3NRZA 2QJLA 4N58A 5G5GA 5GXGB 1JW9D 3P4RB 4YSYB 3SFDB 1IUEA 3B2FA 2KMMA 3B9JA 3AH7A 5G5HA 1AYFA 1L6VA 3AE8B 3CIRB 3AEDB 1FFUA 2LEKA 1XLOA 3P4QB 3VR9B 2WDQB 3DWMA 2G1EA 2MH7A 2WU2B 2BS3B 1E0ZA 3DWGC 2WDRB 3AE2B 2WLBA 2BS2B 1B9RA 1F0ZA 1VLBA 1XLNA 2JQRB 1AWDA 2JX5A 1KRHA 1E6EB 1CJEA 1WXQA 2Q5WD 1OFFA 1QOGA 1H7WA 3AEEB 3VRAB 3AE5B 5C3JB 1SB3C 1N62A 1NYQA 4USAA 3L4PA 4JWSC 2H88B 4WQMA 1NENB 5EE0A 2CU3A 3AEAB 2WU5B 1RM6C 1TKGA 2W3SA 2KAJA 1XLPA 1CZPA 1ZP0B 1NEKB 4YTMB 5AUIA 1QT9A 3W5UB 1FM0D 1DGJA 4YTPB 1DOIA 1FRDA 3LB8C 3BIID 3WCQA 1L0VB 3LXFA 4WWMA 5EE3A 1OQQA 1GPXA 1T3QA 4C80A 1JRPA 3AE3B 1KF6B 2E3TA 3HRDD 1PUTA 5H8YE 3AEFB 3PO0A 2FBWB 4YSZB 3NVWA 2WDVB 1N61A 1N5XA 4ITKA 3ABVB 3AMZA 1GTEA 1J7CA 3ZYYX 1WRIA 3NVYA 1ZOYB 1KFYB 2OHFA 5MPOA 3VR8B 3AECB 3AE1B 2L52A 5C2TB 2MJDA 3HUIA 3SR6A 4A9AA 2AX5A 1RWSA 4P6VF 1E9MA 1FMAD 1SIJA 1FFVA 2QIEB 1FXIA 2K5PA 2N0SB 3NVZA 5EE9A 1TJEA 2K22A 3CF4A 2ACZB 1OQRA 4N59A 1NYRA 1FIQA 1ROEA 3VRBB 4ZHOA 4US9A 2DWQA 3AE6B 1RYJA 4ZOHC 4YSXB 1GT8A 2M19A 2MJ3A 4HROA 3RPFC 4US8A 3SFEB 1YQ3B 1J7BA 1JROA 2PVGC 3AM9A 3ETRA 1YQ4B 1JQ4A 3AEBB 3AEGB 4YT0B 3AB5A 1GAQB 3AN1A 3P63A 2WQYB 1VJKA 5H92C 3P1MA 3W9CB 1QOFA 3W5VB 2WS3B 4C7YA 1GTHA 4FXCA 4C7ZA 1VDVA 1I7HA 4HRSA 2PIAA 1DOYA 3NS1A 1N5WA 2M56B 1QLBB 2H89B 2K9XA 2EKIA 5AUKA 4KX6B 2MJEA 4N6EB 3AE7B 1L5PA 3P4SB 1QF6A 1E7PB 1JWAD 2Y5CA 4YXDB 1TKYA 1WGKA 1XO3A 1QOBA 2DBYA 2HTME 1RFKA 3FAHA 1ZUD2 1H7XA 1A70A 1FXAA 1WWTA 1YJIA 2W55A 1PFDA 3NVVA 1FRRA 2L83A 2CJOA 4JWUC 2WP9B 1XLQA 1V97A 1YJJA 3AE4B 1JALA 1TKEA
chains in the Genus database with same CATH superfamily
2CHXA 5DPTA 1ZXIA 4HPPA 5EE1A 4XX5A 3U2SC 3M62B 2BT6A 5DPSA 3N32A 2QHOA 4RH6A 3BVGA 1R4MB 2RDGA 1LM8B 4PS7A 4AJWA 4DHZB 3ENEA 2MP2B 1AYFA 2ASQA 3OLMD 4MH0E 4K3BA 1K50A 4DK5A 2BF8B 4FJYA 3ZJUA 2D2QA 5KHQA 1CJEA 4YL8A 3GE8C 3NHEB 1OGWA 3L17A 4WQMA 1NENB 2JXXA 3U52E 3RMKC 1NEKB 1SIFA 2G4SA 4Q2JA 5BO4B 3R2TA 4AQ7A 1I4GA 4DXAB 3QQ8B 1YJ1A 3C19A 3DPDA 1PYWD 4EEWA 1OQQA 2V4LA 2LRWA 1XCTL 4BAXA 1SXTA 2XK5A 3ABVB 1S1QB 1J7CA 2PE9A 2WXHA 2LVPA 5CHFA 1P0RA 1L4ZB 2FUHB 2LXCA 2GI9A 3DBRB 2DWQA 1T5XD 2WXJA 3Q3OC 1J8CA 1D6EC 3Q6BA 2KO3A 3RN9C 1JQ4A 2PMVA 4MGIE 2OOBB 2ZPYA 2I1KA 4B6WA 4B95A 4AOFA 4W9CA 1QKZA 1VDVA 2RMMA 4TQ1A 2J0JA 3NS1A 3PLVA 3IAS1 5L83A 3SHQA 1TTNA 1R4NI 4MJSB 4KX6B 1JWAD 4WJQA 1MG8A 2BGFA 1WGKA 1WWTA 2IJ0A 1L2NA 2WXNA 4JWUC 1PFDA 2WXOA 1V97A 4P1CC 1NVID 2J0MA 2BS4B 3UIPB 5LXHA 1XEEA 1L6UA 2LJ5A 1C77A 1EWYC 1P7FA 4OZCA 1NI3A 3R66C 2KANA 2BPSA 4DDID 5TSSA 4E71A 3JSVB 3R3MA 2SAKA 2A5UA 2V9HA 5G5HA 4IUMB 1SSNA 4ANVA 2MEKA 2JVCA 5CHWA 2G1EA 1EM7A 2QILA 4G50A 2C7HA 2DYBA 1P9DU 3AE5B 5T8IA 1WXMA 1WIAA 3NG0A 1E8WA 2A4ZA 2K8HA 2LGXA 1XLPA 3VFKA 1LFDA 2KQ4X 3LB8C 4KGTA 1XCQL 4WWMA 3HHMA 1C79A 1EU3A 1KF6B 5BYRA 2FCNA 4HXDA 2KDBA 3AMZA 3ZYYX 3NVYA 3UI3A 3Q8AA 4K81A 3UQAA 3VR8B 1WE6A 3Q8CA 2XEWA 2MJDA 4BKTA 1E9MA 3TEXA 2KWDA 2ACZB 2N7DA 5G2NA 2K39A 4XC2A 4NZLB 1CMXB 1RYJA 2XN9C 2X38A 1P98A 3Q69A 5JHAA 2LMCA 3P63A 1KLGD 2CR5A 4HK2A 4IWOA 4M01A 1GC6A 3PGEA 1GJZA 3LYYA 1N5WA 4II2B 1GB1A 2GB1A 4BBNC 4HEA1 3IT6B 5HKHA 2WX1A 4GOCA 4W9GA 4DDGD 2XNAC 2DZIA 1RRBA 5BYSA 4M8NA 3MJWA 1WGRA 3Q3FA 1TYGB 4I6LB 1UWMA 2I38A 1GOZA 4NY0A 1TS3A 1WGGA 1E5WA 4JPSA 2BBCA 3A33B 1R4NB 2UYZB 1J7AA 3BINA 2CJNA 5CTRC 2L1AA 1D4BA 1UD7A 2NMQA 2DENB 3SEBA 3UQBA 1BXTA 1EO6A 2GBJA 1WRDB 3IT4B 3TL5A 1WE7A 3Q3NC 1L4DB 4W9IA 3H8HA 4WWPA 3RI7C 4URKA 1E8YA 2IY0B 2BS3B 1E0ZA 2AEHA 3IXSA 4J6IA 3I63C 4EKUA 2JX5A 2L0TA 4M8MA 3CSTA 4CO7A 3KUDB 2KFKB 2KMAA 2GBKA 5HI1A 3RNAC 3S2AA 3VHTC 2ZW1A 1FRDA 1P7EA 5AZGA 3GB1A 3RNFC 1I42A 2RDHA 3ZVVA 4G11A 2KWUB 3B0AA 3AE1B 1FMAD 1YNTE 2K5PA 1QZEA 4JE3B 4KZ0A 4IM3A 5HG2A 5D6JB 2ZVOA 2FCQA 1J7BA 5AEKB 1SEBD 1UGMA 1C78A 2IO2B 4XDCA 3IHPC 2D3CA 3DHGC 4A90A 4WH4A 4EOYA 3IVFA 1T0YA 3KVFB 5D3DA 3ZRFA 5AUKA 3DBHI 1L5PA 1E7PB 2RDBC 4IKGA 2HTME 1ZUD2 1A70A 5BMHA 1XF5L 1YIWA 4ZRKA 3WIMA 2Y5BB 4RGNA 3VH4B 2PVOD 2PEAA 3ZKJC 1BT0A 1UZXB 2Y3AA 1VD2A 4BVUC 2X8XX 3EC8A 3QK0A 1MPEA 3DBLI 4KZCA 1WGDA 4F1SA 2RPQA 1QILA 4KDLB 3P4QB 1SGHA 2V0GA 2BYFA 2DYOA 1OTRB 3EA6A 3TCAA 2UU7A 3VRAB 2HJ8A 2KKCA 2BQQA 3APDA 4HCPB 4JWSC 1KJTA 4RM8A 2MBEA 3IBEA 5IOIA 1BMLC 1OEYA 2KFJA 4XDDA 2L3ZA 1L0VB 4C80A 2QSDA 4HKQA 3AEFB 4E74A 1D5MC 1UBIA 4LJPB 4X57B 2K1FA 4DXGA 2AX5A 3NVZA 2WXRA 4ANXA 1TJEA 1HTOA 2C5LC 3QX1A 1TY2A 4YT0B 2LGIA 4LNOA 5H92C 1VJKA 2HDEA 1WJUA 4ZDVA 4MJSA 2MJEA 5DPWA 2GOWA 1QF6A 3R7RA 3N9YC 3ZW3A 2JYEA 3B08A 3Q14C 2INDC 3KQ4A 2WP9B 1EU4A 2D10A 1YJJA 2LGDA 4LNNA 1ET9A 2K3UA 2BYVE 3EFUA 2AYOB 2V3NA 3AV8A 2B76B 4FJVB 2N9PC 2KC2A 4GIVA 5EDSA 2LGSA 2KJ6A 1V1PB 4IDIA 2Y5PA 5D94A 2QJLA 1I4PA 4NQLB 3SFDB 2KMMA 4RCOA 1C76A 3H9DA 3RZFA 2Z0DB 4MSMB 2WLBA 3VUXA 1V86A 1XLNA 1MI0A 4NQKE 3TSSA 1C3TA 2M1MA 4BZAA 1H7WA 3A4SC 4G0NB 5C3JB 2ICIA 1F1HA 2KWVB 4GDLA 4M02A 4R3DA 2CU3A 2VH1A 2W9NA 2V3SA 2JWUA 1CZPA 3NOBA 2KN5A 3W5UB 2AWTA 1DOIA 3U7DA 2LVOA 1YN4A 4HJKA 3T9LA 1NDDA 2LUEA 2IGDA 1TBEA 2KZRA 1WMHA 3ZO5B 5IA7A 2XK5B 4LDTB 2M8SA 2BW2A 4IWPA 3WA0A 5FKAC 2L8JA 1VZ6A 3SFEB 3AEBB 5IP4D 3AB5A 2LGYA 3ZXRA 2DX5B 2WS3B 4A20A 1DOYA 2VZKB 2K8BA 1E7VA 2KN4A 1F2RI 1STEA 3ZDMC 4ANWA 3PVLA 2N7JA 2R2QA 3AE7B 4DXFA 2C9WB 2BKFA 3VUWA 4KKIA 1IPGA 2FUG1 1Q0WB 1V5OA 4FBJB 2BKRB 4YWGG 3W2DA 4CQNA 2RPVA 3HVZA 2YLMA 1N63A 2NBVB 2EELA 3N3KB 3NY5A 3GE3C 3H1UA 5CX3A 4P1BC 3BVMA 4K7WA 4GMVA 3FC4A 2D11A 2PKOA 2D3GA 3IFWB 4IG7B 2MP2A 1N60A 2KDFB 1YQBA 3QCAA 2CKHB 2NTSA 3IG3A 1WJ6A 2FIDA 2O2VA 4KVGB 3V6CB 1BUIC 1Q1OA 4ASWC 3HK0A 1HTQA 1WZ3A 2IO1B 1C4CA 3AEEB 4XYCA 2PPHA 1ENFA 2NR2A 5EE0A 2HJ1A 2LHDA 4AUQC 3ALBA 4YTMB 2BWFA 3VQIA 3UGBB 4YTPB 3WCQA 2JZZA 3ZXVA 2MHJA 2WXFA 3AE3B 2D5GA 5JH5C 4N9F4 2KMCA 2WXPA 5MPOA 4S17A 2J42A 4TKNA 3DCGA 4MM3B 5EE9A 2WGSA 1ROEA 4RMAA 2JYTA 1FNWA 2MJ3A 4HROA 1YQ3B 3I5JC 2N9XA 1TS4A 2WQYB 1ET6A 2G9HD 3B1LX 1I7HA 1WJ4A 2MBHA 1TZ1A 1WX8A 2H89B 2EKIA 2WXMA 5J2RA 4S0RA 3TEYA 2IYDB 2LJIA 3JVZX 3ZGZA 2BYEA 3ONSA 2N1VA 1Y8RC 5FR3A 1JWBD 2KC1A 5BYQA 3B2GA 3TJPA 3GZNB 3DHHC 3CWIA 3PREA 2QC8A 4EZKA 3ZJVA 4QAYA 4W9KA 2R61A 3FILA 2J53A 2W3RA 3UIOB 3EHVA 1QOAA 2N9LA 4IM2A 4W9FA 1M94A 1TS5A 1KOTA 1XT9B 3A4RA 1IUEA 4GDKA 5LLIA 3CSFA 1K53A 2KOXA 1WYWB 3AE8B 1YX6B 3L08A 3O65B 3VVWB 1VLBA 2JQRB 2WX0A 1OFFA 2OJWA 3A9JA 2KTRB 3Q8FA 4MACA 2KNBA 2KQ7A 2MQJA 1I35A 3ZJTA 2L32A 4RGTA 1HEZE 1SE3A 1K51A 3R7QA 5D2MB 3X23A 3BIID 2OJRA 3FILB 1MHXA 1WZ0A 3DBRI 2GLSA 2WYQA 4YSZB 4WWNA 3PZDA 3DBLB 4KSKC 4LCDE 3RNCC 4ICUA 4F8CB 5HHDG 3E9SA 2N9EB 2HD5B 4AP4C 3Q8BA 1A5RA 3RPFC 4AWJA 1C4AA 1SE2A 2G45B 5E6OA 3N1YC 4C4VA 3W9CB 3BYTB 2C7NB 4HDOA 3ZNID 1EF1A 3V60A 1HQRD 4WJPA 3A1QB 3M63B 3KH0A 4ANUA 4A55A 3HM6X 1SBBB 1SE4A 4W9EA 2FCSA 2Z0EB 4MGZE 1WJNA 5E6PA 4HVBA 3OWEB 3AE4B 2G3QB 1TKEA 4IW0A 2M17A 2DYMA 2VZKD 3BYYB 1WYGA 3DVGX 4ZYSA 1WX9A 4TUUA 1JCKB 2EMTA 4FHJA 1FNVA 4BKSD 5E6JA 3KUCB 3EUB2 4K7UA 1HZ6A 1UUPA 4L2YA 4NAWA 4I6NB 4C4VB 2QDFA 4M0WA 1WF9A 1YD8U 2LUMA 5FR6A 2WU2B 2JZ3B 2O6VB 4K3CA 1XXGA 3V61A 4JLCA 1NYQA 2IGGA 2LXAA 3L4PA 1HXYD 4FADA 4EUTA 1Z2MA 4L1BA 3U4EG 1ZP0B 4HWIB 2Z59B 3IAM1 1ZDXA 3C0RB 3V62A 3PSEB 3TBLD 2GBRA 2PJHA 4MM3A 1EWCA 1N5XA 4RF0A 2J52A 2E6XA 3ZDTA 3BY4B 2LRUA 1AARA 2MWSB 1I4HA 5TR5A 3A9JB 3V05A 4XWTA 1NYRA 4EE2A 3TEZA 4WURA 4US8A 1PGAA 2MX2A 3D32A 4XZ4A 4TV3A 2DZMA 2BB5A 4BOZB 3R8BA 2ZPNA 4C7YA 1GTHA 4F7ZA 2M56B 2GBMA 3Q2AC 4RM9A 3MC9A 3PZ8A 3DVGY 4PT5A 2W82A 4ZRQA 3I3TB 1RFKA 4KKJA 3BZDB 3T8MA 2C7MB 2MW5A 3MJ5A 5JZEB 1TIFA 2I1JA 1YMHE 5IAAC 2K6DB 2MBBB 2WXKA 4B9KA 4XE0A 1UWXA 2KACA 2KK8A 5C23A 3TUOA 2KHWB 4ZHPA 3UINB 5GXGB 1WMHB 2N7EA 3WALA 4HPMB 3ZTCA 2LASA 3RYTA 2NBUA 4WJOA 2KLCA 2WDQB 1F2RC 4HPLB 2VRRB 1B9RA 1FXTB 5E6NA 2DLBA 4PK1A 2KQSA 1SJED 4HCNB 2KTFA 2BB6A 3RZWC 1V81A 2LVQA 2ON8A 2LFIA 1TZOA 3QIJA 4EFOA 2L7RA 1T0SC 1ZXHA 2BWES 2E3TA 3AXCA 1PUTA 4GSWA 4ITKA 3L16A 1UF0A 2BYTA 2ZNVB 3AECB 3GZNI 3O13A 1ESFA 3VAWA 2JRHA 2FAZA 1IP9A 1RFAA 1JWSD 3VTUA 1VCBA 3EGRA 3DBHB 4ZOHC 2LHEA 3ZIMA 2M19A 1JROA 3AM9A 1XQQA 4MH8A 4EZJA 1OEYJ 2SEBD 2N1WA 2O2VB 3OG5A 4ARIA 2JZPA 1B1ZA 2ZCBA 2D3BA 2JRIB 2YEPB 1UH6A 2WNMA 2L83A 2L05A 2PE6B 1IBXA 5AZHA 2XBBC 1V1PA 1WM3A 3HM3A 1LXDA 1YN5A 2N9KA 3LJ3A 4RNAA 1XLOA 2L0FA 1F77A 1Q10A 4WQOB 3QA8A 3DQVA 4MT5A 4RGOS 1WM2A 4USAA 3OAWA 2KAJA 4KGSA 4BOSC 1C4PA 1Y56A 1E8ZA 2KVRA 3W1SA 1KM7A 1YOVB 3GP7A 3X0WA 2IO3B 2FBWB 1WXVA 1GTEA 2R2OA 1PQSA 1E8XA 1GNUA 2J4XA 1TS2A 1FXIA 4KV2A 3PHXB 1HE8A 2AL3A 3MHZA 5BMIA 4DBGA 1WXAA 1SJHD 4JQWC 4KSLC 3AE6B 4FN2A 3ETRA 2ZJDA 4O1NA 4AJYB 4ZRJA 1VZ7A 2KTRA 4RFBA 3W5VB 5G55A 3H7PB 3PTFC 4HRSA 4NJ7A 2G4DB 2AQ2B 1QLBB 4IM0A 2K9XA 4MGYE 2KVZA 4II3B 3I9V1 4GB9A 4A8XC 2M0XA 1XO3A 2DBYA 3PLUA 4FHKA 2LZ6A 2CJOA 1YQ4B 4JX1C 1J0GA 3ZQ4A 1KH0A 3KWLA 3P4PB 1D5ZC 1WX7A 5D7GA 2KT7A 2JU6X 1G6JA 4FA6A 4JIOU 4B0MA 1E10A 2PW9A 1ACCA 4YSYB 3B9JA 3TIXA 1V9JA 4ZRPA 2LEKA 4KDIC 3GOEA 3ZTDA 5KHOA 2WDRB 2DZJA 1ZGUB 4NNJB 1UBQA 4MEMA 1JMLA 1RLFA 1T0QC 1IGCA 3ML9A 4NAWB 4GDLB 2H88B 1MG4A 2MBOA 5FK9C 4FULA 5AUIA 1WR6E 4GXBA 2CU1A 2TSSA 3KWVA 4CYEA 4H2AA 3AULA 3RULA 3OJ3A 2YVCA 1U4AA 1R4MI 1N6ZA 3HRDD 1T0RC 1WFYA 4LDTD 4TSSA 1WRIA 1ZOYB 4BBNF 1CK1A 2WHIA 4ACFA 2KX3A 2NPTB 4P6VF 3QARA 2N0SB 2BVCA 2D3AA 2O6VD 3CMMB 3PRZA 1K52A 1FIQA 3FKYA 1X1MA 3ZNZB 1E90A 1JRUA 2DAFA 1ZKHA 2KWCA 1T6BX 1NI2A 1J19A 4PS8A 2FNJB 3ZNHB 5J17A 4FJZA 4TMAB 2IY1B 2KDIA 1WSPA 1C9FA 4NJCA 1CQVA 2MRPA 3WAMA 4XWWA 3H6NA 1OQYA 1QOBA 4P7IA 3NVVA 5IO9A 2K0PA 3RUIB 1FD6A 1XLQA 3P2BA 5C1ZA 1R7SA 1UELA 3NJTA 2NS5A 2NVUI 4YTNB 1I4QA 3L0WB 4KGRA 4LK0M 3VXWA 2REXA 3MHSD 1KLVA 4N58A 3P4RB 1ZDVA 2D07B 3JSVA 3W1YA 3DWMA 1GG3A 2MH7A 3DWGC 2MBQA 3AE2B 4UDUC 1F0ZA 2FE8A 1KRHA 3L10B 1QOGA 5DPRA 2IPKD 2IZVB 2GBNA 2WU5B 3NZUA 2ZNVC 3U8ZA 3PRMB 4NAMA 3SDLC 3UF8A 3AU4A 3APCA 1PGBA 3LXFA 4OVZA 1T3QA 1JRPA 4GGQA 1UGJA 2GMIC 3PO0A 2I2YA 3VH3B 2EKEC 4RGMA 1KFYB 3K9PB 4L23A 3KLSX 4A9AA 2AQ3B 1RWSA 2ZW0A 3T3NA 3NZSA 2K22A 3R2IA 4HDQA 1OQRA 4J3OD 4OHJA 4US9A 1TGZB 4A3PA 2J7QB 3AEGB 1GAQB 2MSED 1QOFA 3M3JA 2ZCCA 4FXCA 1AW7A 4DHJD 4LNFA 3Q8EA 3QHTA 1JWMD 2VH2A 3FAHA 2MLBA 1ZW7A 1H7XA 3J9CA 3KUZA 2UWQA 1FRRA 2CHZA 1E6EB 1JALA 2MA9B 3AE9B 4ZYNA 3MC8A 4ICVA 2NBWB 2O6VA 3P42A 2HTHA 4B0EA 1PGXA 1WY8A 5BMGA 4WAFA 1V8CA 2LD9A 1KTKA 4M0WB 4P16A 1FPYA 1SE9A 2IBIB 3AI5A 3NRZA 2K6QA 1LGRA 2JSVX 3B2FA 4NJ6A 3VR9B 1MJDA 1FCCC 1ZPSA 3BWUD 2Q5WD 4KIKA 1WGHA 2KFKA 3VTWA 2EMSA 3KW5B 3RNBC 2LI5A 4GDKB 1RM6C 1TKGA 2W3SA 3GS2A 3N30A 1P1AA 1V49A 4C00A 1LQBA 4K7SA 4HKZE 1JWUD 3TMPB 4KIKB 3APFA 4MDKE 1YN3A 2INNE 2OHFA 2HE7A 1DOXA 1VZ8A 4BFRA 2L76A 4IOIE 2DHZA 2KX0A 3QAQA 3PS6A 4ZHOA 3VRBB 2K8CA 4A6QA 4DWFA 3PRPB 3E56A 4WJNA 3CF6E 1UNSA 2QCZA 2RSUA 2ONQA 4LNKA 3M95A 2IDYA 3BVZA 1V5TA 3NS8A 2V1YA 2KYWA 1L0XB 4PYUA 2Y5CA 3DVNU 4YXDB 1FXAA 1YJIA 2PLPA 3DHIC 2KD0A 1HA5A 3SU8X 1GB4A 4E3CA 2V4IB 2YEPF 2WXLA 3PT2B 2JXTA 4GLSC 4OZBA 3ZRCA 3PZ7A 4OZAA 1IBXB 5AZFA 4DQOC 5D3IB 2CS4A 1PDXA 3VUYA 2DZKA 1DYQA 2WXQA 3ZLZA 1TT5B 5DCNA 2IGHA 4AS1A 2WWZA 2BS2B 3ZNGC 2KDEB 4HJGE 1SB3C 1N62A 4I6PA 2J0KA 2JF5A 1IYFA 3WAOA 3AEAB 4LNIA 5J18A 1Q5WB 4HLEA 3A9KB 2WXGA 3RCZA 1MFWA 4WWOA 1C1YB 4M00A 3HVDA 1L0YB 3EECA 2Z8LA 3TEWA 2ZVNA 4G3XB 1L7YA 5EE3A 2KXJA 1H4RA 2CHWA 1EF5A 3NVWA 3N1ZC 2B3AA 3OJ4B 4PS3A 3SR6A 5C2TB 2RR9A 4GN1A 2LWPA 4EZLA 1XD3B 4K1RB 1Z5SB 2L00B 5IN7A 1MVKA 2JUOA 4C56C 2PVGC 3N20C 2K25A 3L13A 1E7UA 2INPE 3RNEC 3HIZA 2NPTA 2KJHB 3VDZA 2BTEA 3WANA 3P4SB 4MELA 1D3ZA 2W55A 3MC0B 1WI0A 3N1XC 1I4XA 5LXIB 4LTUA 3DOWA 3MP9A 4DHJB 5IKCM 3Q3MC 1V1OA 4W9HA 1MHHE 2QMTA 2GRIA 2C60A 2OEDA 1EUVB 1FCLA 5G5GA 1JW9D 3U7ZA 1VR9A 3AH7A 1QQRA 1L6VA 1FFUA 3I57A 3T3OA 1WR1A 3MTNB 2DAJA 1ISNA 3BK2A 1AWDA 4JGHB 1WXQA 3JYUA 2AL6A 1H8CA 3WAPA 2WXIA 4MSQB 2RGFA 2JY6A 1FEHA 4OVVA 3RD2A 3V6EB 2JWZA 2KJRA 3H7SA 2JPHA 4MGKE 1FM0D 3PV1A 3KYCD 3SD5A 3ML8A 4DHZE 1GC7A 2ZEQA 1I4RA 1GPXA 3A9KA 2N4FA 3A1QA 4D2KA 2JT4B 3DVNV 1NBFC 4LLGM 4JL9A 2L52A 1F9JA 1SIJA 5JHBA 1FFVA 2ZZPB 1P3QU 4W9DA 3VTVA 3CF4A 3NUHB 4N59A 1V2YA 4OVUA 1IGDA 4OW0A 3EFCA 5LNK1 4XGAB 4YSXB 1GT8A 3AN1A 2WDTB 2FIFA 3Q3JA 4C7ZA 4IWQA 5L95C 2V3PA 1LO5D 3KYDD 4N6EB 1FNUA 3H7PA 3QJZA 2FCMA 3RFZB 3AU5A 4FLHA 4W9LA 3ZUNA 3DBSA 3PHWB 1M4VA 2DNFA 3RT3B 2MCNB 4IC7B 2NTTA 2RD0A 4NPNA 1ZE3D 1SF0A 3QWZB 2AQ1B 5I4DA 1D5XC 2W54A 2INCC 1HZ5A 3U30A 1V80A 2KLGA 4W9JA 4ARCA 4PYZA 3CIRB 3AEDB 4GU2A 4LJOB 3V3XA 2M4NA 4TQ0A 1WH3A 1GUAB 4RF1A 4CHKA 3L54A 2PTLA 2QEJC 1QT9A 1DGJA 3DDCB 3ECIA 4BKGA 5H8YE 2WDVB 1N61A 2M0AA 2IO0B 3W1SC 1VRAB 1WXSA 1WGYA 3HUIA 4ZRIA 1FO4A 2QIEB 3URYA 1RAXA 2NCNA 3PPAA 3MFGA 3NZ3A 5HFYA 5CHVC 1V6EA 3JW0X 3LDZE 4WIPA 5JXVA 1AN8A 3RNGC 3P1MA 1S3SG 2PIAA 3QC8B 1YX5B 4A3OA 5GMVA 1TY0A 4REZA 2KDMA 4WAAA 1F52A 1KLUD 3C8YA 1TKYA 1K8RB 3BK1A 3K9OB 4BKSA
chains in the Genus database with same CATH topology
3MJ5A 3AE9B 1ET9A 2K3UA 1YMHE 1ZXIA 2V3NA 3AV8A 3P42A 2WXKA 5EE1A 2B76B 4B0EA 1PGXA 4XE0A 1UWXA 2KACA 5BMGA 3U2SC 4WAFA 2BT6A 1V8CA 1KTKA 4RH6A 3TUOA 3BVGA 2RDGA 1V1PB 4P16A 4IDIA 2Y5PA 4ZHPA 3NRZA 2QJLA 5GXGB 1I4PA 3SFDB 2JSVX 3B2FA 2KMMA 1AYFA 4RCOA 1C76A 3VR9B 2WDQB 1K50A 1FCCC 1ZPSA 1F2RC 3ZJUA 2WLBA 1B9RA 3BWUD 1XLNA 1MI0A 2DLBA 1CJEA 2Q5WD 3TSSA 1H7WA 5C3JB 1SJED 2ICIA 2BB6A 4R3DA 4WQMA 1NENB 4GDKB 2CU3A 3U52E 1RM6C 1TKGA 2W3SA 3GS2A 2JWUA 1CZPA 1NEKB 2ON8A 4Q2JA 3W5UB 1DOIA 2LFIA 1TZOA 3R2TA 4HKZE 4AQ7A 1I4GA 1YN4A 1ZXHA 1PYWD 1OQQA 1JWUD 2E3TA 1PUTA 2IGDA 1XCTL 4ITKA 1SXTA 3ABVB 1J7CA 1YN3A 2INNE 2BYTA 2WXHA 2OHFA 3AECB 1DOXA 1VZ8A 1ESFA 3O13A 1L4ZB 4IOIE 2BW2A 1JWSD 3EGRA 2GI9A 4ZHOA 3VRBB 2DWQA 4A6QA 4ZOHC 5FKAC 2LHEA 1T5XD 2WXJA 2M19A 1D6EC 1VZ6A 3SFEB 1JROA 3AM9A 1JQ4A 3AEBB 2PMVA 3AB5A 4MH8A 3E56A 2WS3B 1UNSA 2SEBD 1DOYA 1QKZA 1VDVA 2RMMA 2VZKB 4TQ1A 2KN4A 1F2RI 1STEA 2ONQA 3NS1A 3IAS1 2N7JA 2IDYA 3BVZA 4ARIA 2JZPA 1B1ZA 4KX6B 3AE7B 4DXFA 1L0XB 1JWAD 2Y5CA 4KKIA 4YXDB 2FUG1 1WGKA 2YEPB 1FXAA 1WWTA 1YJIA 2IJ0A 2PLPA 1PFDA 2WNMA 2WXOA 2L83A 2WXNA 4JWUC 4YWGG 3W2DA 4CQNA 1HA5A 1V97A 1NVID 1GB4A 2RPVA 3HVZA 2V4IB 2BS4B 1IBXA 1N63A 2EELA 2YEPF 2WXLA 1V1PA 2JXTA 1XEEA 4GLSC 4OZBA 3PZ7A 4OZAA 1L6UA 3BVMA 3FC4A 1IBXB 4DQOC 1C77A 1EWYC 1P7FA 4OZCA 5D3IB 2PKOA 1NI3A 1YN5A 2N9KA 1PDXA 1N60A 5TSSA 1DYQA 2WXQA 4RNAA 2NTSA 2IGHA 2SAKA 5G5HA 1XLOA 4AS1A 1SSNA 2MEKA 1BUIC 1F77A 1Q10A 2G1EA 1EM7A 2BS2B 2QILA 4MT5A 1C4CA 4HJGE 3AEEB 4RGOS 3AE5B 1SB3C 5T8IA 1N62A 4USAA 1ENFA 5EE0A 3AEAB 2LHDA 2KAJA 1XLPA 4KGSA 4YTMB 2WXGA 1C4PA 3VQIA 1Y56A 2KQ4X 4YTPB 3HVDA 1L0YB 3LB8C 4KGTA 3W1SA 3TEWA 2Z8LA 3WCQA 1XCQL 4WWMA 3GP7A 5EE3A 1C79A 2WXFA 1EU3A 3AE3B 1KF6B 5BYRA 2D5GA 2FBWB 3NVWA 3AMZA 1GTEA 3ZYYX 2WXPA 3NVYA 3UI3A 3Q8AA 5MPOA 3VR8B 3Q8CA 3SR6A 5C2TB 2MJDA 2J4XA 2J42A 1E9MA 4MM3B 5EE9A 1TS2A 1FXIA 3TEXA 2KWDA 3MHZA 2ACZB 5BMIA 1ROEA 1SJHD 2JYTA 4NZLB 3AE6B 1RYJA 1MVKA 1FNWA 2MJ3A 2XN9C 4HROA 2X38A 2PVGC 1YQ3B 4C56C 3ETRA 3Q69A 2LMCA 1TS4A 1KLGD 3P63A 4O1NA 2WQYB 1VZ7A 2INPE 4RFBA 3W5VB 1ET6A 2G9HD 4HRSA 1I7HA 3LYYA 1N5WA 2AQ2B 1GB1A 1QLBB 2GB1A 2H89B 4HEA1 2BTEA 2K9XA 2EKIA 3IT6B 2WXMA 3TEYA 3I9V1 2LJIA 3P4SB 4A8XC 1XO3A 2DBYA 2W55A 3ZGZA 2XNAC 5BYSA 2CJOA 3MC0B 1YQ4B 1I4XA 1JWBD 4LTUA 4JX1C 5BYQA 5FR3A 3MP9A 3ZQ4A 1TYGB 1UWMA 1V1OA 3B2GA 2I38A 3CWIA 1GOZA 1KH0A 3P4PB 1D5ZC 1TS3A 3KWLA 5D7GA 3ZJVA 4JPSA 1MHHE 2BBCA 2R61A 2JU6X 3FILA 2J53A 2QMTA 1J7AA 2GRIA 2W3RA 2CJNA 2OEDA 2L1AA 1D4BA 1QOAA 2N9LA 2NMQA 4B0MA 1TS5A 1E10A 2PW9A 3SEBA 1FCLA 5G5GA 1ACCA 1JW9D 4YSYB 3U7ZA 1VR9A 1IUEA 1BXTA 1K53A 3B9JA 3AH7A 1QQRA 1L6VA 3IT4B 3AE8B 1FFUA 4ZRPA 2LEKA 3I57A 3T3OA 1L4DB 3H8HA 2BS3B 1E0ZA 2WDRB 3BK2A 3IXSA 1VLBA 2JQRB 1AWDA 2JX5A 1WXQA 1JMLA 1OFFA 1IGCA 2WXIA 4NAWB 4GDLB 3Q8FA 4MACA 2H88B 1FEHA 5HI1A 5FK9C 3ZJTA 2L32A 4RGTA 5AUIA 1HEZE 2ZW1A 1FM0D 1FRDA 1P7EA 1K51A 1SE3A 2TSSA 3KWVA 3GB1A 3BIID 4H2AA 3FILB 1MHXA 2RDHA 1I4RA 1GPXA 3HRDD 4D2KA 4YSZB 4TSSA 1WRIA 1ZOYB 1CK1A 4LLGM 3AE1B 2L52A 4P6VF 1FMAD 1SIJA 1FFVA 1YNTE 2K5PA 2N0SB 5HHDG 3E9SA 4JE3B 3CF4A 3NUHB 4N59A 3Q8BA 1K52A 1FIQA 1IGDA 4OW0A 5HG2A 5LNK1 4YSXB 1GT8A 3RPFC 1C4AA 1J7BA 1SE2A 1SEBD 1C78A 1T6BX 3AN1A 4XDCA 3W9CB 3BYTB 4A90A 4WH4A 1HQRD 4C7ZA 4TMAB 2V3PA 1WSPA 1C9FA 1LO5D 5D3DA 4NJCA 4A55A 1SBBB 5AUKA 1SE4A 4N6EB 1FNUA 1L5PA 1CQVA 1E7PB 4XWWA 4IKGA 1QOBA 2HTME 1ZUD2 1A70A 5BMHA 3RFZB 3NVVA 1XF5L 2K0PA 1FD6A 1XLQA 3OWEB 4RGNA 3AE4B 2PVOD 1TKEA 1M4VA 2DYMA 2VZKD 1R7SA 3BYYB 1WYGA 4ZYSA 2NTTA 1JCKB 4YTNB 1ZE3D 1FNVA 5E6JA 1SF0A 1I4QA 2AQ1B 5I4DA 1D5XC 4KGRA 2Y3AA 3EUB2 1HZ6A 1UUPA 4L2YA 2W54A 1HZ5A 4LK0M 1MPEA 4N58A 3P4RB 1QILA 1ZDVA 4ARCA 4M0WA 3CIRB 3AEDB 2LUMA 3P4QB 2V0GA 2DYOA 3V3XA 3DWMA 2MH7A 2WU2B 3DWGC 3AE2B 4UDUC 1F0ZA 2FE8A 3EA6A 1KRHA 1E6EB 1XXGA 1QOGA 4TQ0A 3VRAB 2IPKD 1NYQA 2IGGA 3L4PA 1HXYD 4JWSC 4RF1A 2WU5B 4L1BA 2PTLA 2QEJC 1ZP0B 3U4EG 1BMLC 1QT9A 1DGJA 4NAMA 3IAM1 1PGBA 4XDDA 1ZDXA 1L0VB 3LXFA 4OVZA 1T3QA 4C80A 2QSDA 1JRPA 5H8YE 4HKQA 3AEFB 1UGJA 3PO0A 2WDVB 1N61A 1EWCA 1N5XA 2J52A 2E6XA 2M0AA 4RF0A 1D5MC 2I2YA 1VRAB 4RGMA 1KFYB 4L23A 3KLSX 3HUIA 4A9AA 4DXGA 2AQ3B 2AX5A 1RWSA 2ZW0A 1FO4A 2QIEB 1I4HA 3V05A 3URYA 3T3NA 3NVZA 2WXRA 4XWTA 1TJEA 2K22A 3MFGA 3NZ3A 3R2IA 5HFYA 1OQRA 4J3OD 1NYRA 4OHJA 4WIPA 4EE2A 4US9A 3TEZA 1TY2A 4WURA 4US8A 1PGAA 5JXVA 1AN8A 3AEGB 4YT0B 2LGIA 1GAQB 5H92C 1VJKA 3P1MA 1QOFA 2BB5A 3R8BA 4C7YA 1GTHA 2HDEA 1AW7A 4FXCA 2PIAA 2M56B 3Q8EA 2MJEA 1TY0A 3PZ8A 1QF6A 3N9YC 4PT5A 2JYEA 2KDMA 2W82A 4REZA 1KLUD 3C8YA 1JWMD 1TKYA 4ZRQA 3FAHA 1RFKA 3KQ4A 4KKJA 1H7XA 3J9CA 1FRRA 3BK1A 3BZDB 2WP9B 1EU4A 1YJJA 1JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NVI D;  1JWB D;  4LTU A;  3AE9 B;  3HVZ A;  4JX1 C;  1R7S A;  2BS4 B;  1TYG B;  1UWM A;  1ZXI A;  1WYG A;  1N63 A;  3B2G A;  3AV8 A;  3CWI A;  2PVO D;  2B76 B;  5EE1 A;  3P4P B;  3KWL A;  1DOX A;  2BT6 A;  4YTN B;  1V8C A;  1J7A A;  1L6U A;  2W3R A;  1SF0 A;  2CJN A;  3FC4 A;  3EUB 2;  1EWY C;  1QOA A;  2PKO A;  1NI3 A;  2W54 A;  1E10 A;  1FO4 A;  4IDI A;  1PDX A;  1N60 A;  4ZHP A;  3NRZ A;  2QJL A;  4N58 A;  5G5G A;  5GXG B;  1JW9 D;  3P4R B;  4YSY B;  3SFD B;  1IUE A;  3B2F A;  2KMM A;  3B9J A;  3AH7 A;  5G5H A;  1AYF A;  1L6V A;  3AE8 B;  3CIR B;  3AED B;  1FFU A;  2LEK A;  1XLO A;  3P4Q B;  3VR9 B;  2WDQ B;  3DWM A;  2G1E A;  2MH7 A;  2WU2 B;  2BS3 B;  1E0Z A;  3DWG C;  2WDR B;  3AE2 B;  2WLB A;  2BS2 B;  1B9R A;  1F0Z A;  1VLB A;  1XLN A;  2JQR B;  1AWD A;  2JX5 A;  1KRH A;  1E6E B;  1CJE A;  1WXQ A;  2Q5W D;  1OFF A;  1QOG A;  1H7W A;  3AEE B;  3VRA B;  3AE5 B;  5C3J B;  1SB3 C;  1N62 A;  1NYQ A;  4USA A;  3L4P A;  4JWS C;  2H88 B;  4WQM A;  1NEN B;  5EE0 A;  2CU3 A;  3AEA B;  2WU5 B;  1RM6 C;  1TKG A;  2W3S A;  2KAJ A;  1XLP A;  1CZP A;  1ZP0 B;  1NEK B;  4YTM B;  5AUI A;  1QT9 A;  3W5U B;  1FM0 D;  1DGJ A;  4YTP B;  1DOI A;  1FRD A;  3LB8 C;  3BII D;  3WCQ A;  1L0V B;  3LXF A;  4WWM A;  5EE3 A;  1OQQ A;  1GPX A;  1T3Q A;  4C80 A;  1JRP A;  3AE3 B;  1KF6 B;  2E3T A;  3HRD D;  1PUT A;  5H8Y E;  3AEF B;  3PO0 A;  2FBW B;  4YSZ B;  3NVW A;  2WDV B;  1N61 A;  1N5X A;  4ITK A;  3ABV B;  3AMZ A;  1GTE A;  1J7C A;  3ZYY X;  1WRI A;  3NVY A;  1ZOY B;  1KFY B;  2OHF A;  5MPO A;  3VR8 B;  3AEC B;  3AE1 B;  2L52 A;  5C2T B;  2MJD A;  3HUI A;  3SR6 A;  4A9A A;  2AX5 A;  1RWS A;  4P6V F;  1E9M A;  1FMA D;  1SIJ A;  1FFV A;  2QIE B;  1FXI A;  2K5P A;  2N0S B;  3NVZ A;  5EE9 A;  1TJE A;  2K22 A;  3CF4 A;  2ACZ B;  1OQR A;  4N59 A;  1NYR A;  1FIQ A;  1ROE A;  3VRB B;  4ZHO A;  4US9 A;  2DWQ A;  3AE6 B;  1RYJ A;  4ZOH C;  4YSX B;  1GT8 A;  2M19 A;  2MJ3 A;  4HRO A;  3RPF C;  4US8 A;  3SFE B;  1YQ3 B;  1J7B A;  1JRO A;  2PVG C;  3AM9 A;  3ETR A;  1YQ4 B;  1JQ4 A;  3AEB B;  3AEG B;  4YT0 B;  3AB5 A;  1GAQ B;  3AN1 A;  3P63 A;  2WQY B;  1VJK A;  5H92 C;  3P1M A;  3W9C B;  1QOF A;  3W5V B;  2WS3 B;  4C7Y A;  1GTH A;  4FXC A;  4C7Z A;  1VDV A;  1I7H A;  4HRS A;  2PIA A;  1DOY A;  3NS1 A;  1N5W A;  2M56 B;  1QLB B;  2H89 B;  2K9X A;  2EKI A;  5AUK A;  4KX6 B;  2MJE A;  4N6E B;  3AE7 B;  1L5P A;  3P4S B;  1QF6 A;  1E7P B;  1JWA D;  2Y5C A;  4YXD B;  1TKY A;  1WGK A;  1XO3 A;  1QOB A;  2DBY A;  2HTM E;  1RFK A;  3FAH A;  1ZUD 2;  1H7X A;  1A70 A;  1FXA A;  1WWT A;  1YJI A;  2W55 A;  1PFD A;  3NVV A;  1FRR A;  2L83 A;  2CJO A;  4JWU C;  2WP9 B;  1XLQ A;  1V97 A;  1YJJ A;  3AE4 B;  1JAL A;  1TKE A; 
#chains in the Genus database with same CATH topology
 2CHX A;  5DPT A;  1ZXI A;  4HPP A;  5EE1 A;  4XX5 A;  3U2S C;  3M62 B;  2BT6 A;  5DPS A;  3N32 A;  2QHO A;  4RH6 A;  3BVG A;  1R4M B;  2RDG A;  1LM8 B;  4PS7 A;  4AJW A;  4DHZ B;  3ENE A;  2MP2 B;  1AYF A;  2ASQ A;  3OLM D;  4MH0 E;  4K3B A;  1K50 A;  4DK5 A;  2BF8 B;  4FJY A;  3ZJU A;  2D2Q A;  5KHQ A;  1CJE A;  4YL8 A;  3GE8 C;  3NHE B;  1OGW A;  3L17 A;  4WQM A;  1NEN B;  2JXX A;  3U52 E;  3RMK C;  1NEK B;  1SIF A;  2G4S A;  4Q2J A;  5BO4 B;  3R2T A;  4AQ7 A;  1I4G A;  4DXA B;  3QQ8 B;  1YJ1 A;  3C19 A;  3DPD A;  1PYW D;  4EEW A;  1OQQ A;  2V4L A;  2LRW A;  1XCT L;  4BAX A;  1SXT A;  2XK5 A;  3ABV B;  1S1Q B;  1J7C A;  2PE9 A;  2WXH A;  2LVP A;  5CHF A;  1P0R A;  1L4Z B;  2FUH B;  2LXC A;  2GI9 A;  3DBR B;  2DWQ A;  1T5X D;  2WXJ A;  3Q3O C;  1J8C A;  1D6E C;  3Q6B A;  2KO3 A;  3RN9 C;  1JQ4 A;  2PMV A;  4MGI E;  2OOB B;  2ZPY A;  2I1K A;  4B6W A;  4B95 A;  4AOF A;  4W9C A;  1QKZ A;  1VDV A;  2RMM A;  4TQ1 A;  2J0J A;  3NS1 A;  3PLV A;  3IAS 1;  5L83 A;  3SHQ A;  1TTN A;  1R4N I;  4MJS B;  4KX6 B;  1JWA D;  4WJQ A;  1MG8 A;  2BGF A;  1WGK A;  1WWT A;  2IJ0 A;  1L2N A;  2WXN A;  4JWU C;  1PFD A;  2WXO A;  1V97 A;  4P1C C;  1NVI D;  2J0M A;  2BS4 B;  3UIP B;  5LXH A;  1XEE A;  1L6U A;  2LJ5 A;  1C77 A;  1EWY C;  1P7F A;  4OZC A;  1NI3 A;  3R66 C;  2KAN A;  2BPS A;  4DDI D;  5TSS A;  4E71 A;  3JSV B;  3R3M A;  2SAK A;  2A5U A;  2V9H A;  5G5H A;  4IUM B;  1SSN A;  4ANV A;  2MEK A;  2JVC A;  5CHW A;  2G1E A;  1EM7 A;  2QIL A;  4G50 A;  2C7H A;  2DYB A;  1P9D U;  3AE5 B;  5T8I A;  1WXM A;  1WIA A;  3NG0 A;  1E8W A;  2A4Z A;  2K8H A;  2LGX A;  1XLP A;  3VFK A;  1LFD A;  2KQ4 X;  3LB8 C;  4KGT A;  1XCQ L;  4WWM A;  3HHM A;  1C79 A;  1EU3 A;  1KF6 B;  5BYR A;  2FCN A;  4HXD A;  2KDB A;  3AMZ A;  3ZYY X;  3NVY A;  3UI3 A;  3Q8A A;  4K81 A;  3UQA A;  3VR8 B;  1WE6 A;  3Q8C A;  2XEW A;  2MJD A;  4BKT A;  1E9M A;  3TEX A;  2KWD A;  2ACZ B;  2N7D A;  5G2N A;  2K39 A;  4XC2 A;  4NZL B;  1CMX B;  1RYJ A;  2XN9 C;  2X38 A;  1P98 A;  3Q69 A;  5JHA A;  2LMC A;  3P63 A;  1KLG D;  2CR5 A;  4HK2 A;  4IWO A;  4M01 A;  1GC6 A;  3PGE A;  1GJZ A;  3LYY A;  1N5W A;  4II2 B;  1GB1 A;  2GB1 A;  4BBN C;  4HEA 1;  3IT6 B;  5HKH A;  2WX1 A;  4GOC A;  4W9G A;  4DDG D;  2XNA C;  2DZI A;  1RRB A;  5BYS A;  4M8N A;  3MJW A;  1WGR A;  3Q3F A;  1TYG B;  4I6L B;  1UWM A;  2I38 A;  1GOZ A;  4NY0 A;  1TS3 A;  1WGG A;  1E5W A;  4JPS A;  2BBC A;  3A33 B;  1R4N B;  2UYZ B;  1J7A A;  3BIN A;  2CJN A;  5CTR C;  2L1A A;  1D4B A;  1UD7 A;  2NMQ A;  2DEN B;  3SEB A;  3UQB A;  1BXT A;  1EO6 A;  2GBJ A;  1WRD B;  3IT4 B;  3TL5 A;  1WE7 A;  3Q3N C;  1L4D B;  4W9I A;  3H8H A;  4WWP A;  3RI7 C;  4URK A;  1E8Y A;  2IY0 B;  2BS3 B;  1E0Z A;  2AEH A;  3IXS A;  4J6I A;  3I63 C;  4EKU A;  2JX5 A;  2L0T A;  4M8M A;  3CST A;  4CO7 A;  3KUD B;  2KFK B;  2KMA A;  2GBK A;  5HI1 A;  3RNA C;  3S2A A;  3VHT C;  2ZW1 A;  1FRD A;  1P7E A;  5AZG A;  3GB1 A;  3RNF C;  1I42 A;  2RDH A;  3ZVV A;  4G11 A;  2KWU B;  3B0A A;  3AE1 B;  1FMA D;  1YNT E;  2K5P A;  1QZE A;  4JE3 B;  4KZ0 A;  4IM3 A;  5HG2 A;  5D6J B;  2ZVO A;  2FCQ A;  1J7B A;  5AEK B;  1SEB D;  1UGM A;  1C78 A;  2IO2 B;  4XDC A;  3IHP C;  2D3C A;  3DHG C;  4A90 A;  4WH4 A;  4EOY A;  3IVF A;  1T0Y A;  3KVF B;  5D3D A;  3ZRF A;  5AUK A;  3DBH I;  1L5P A;  1E7P B;  2RDB C;  4IKG A;  2HTM E;  1ZUD 2;  1A70 A;  5BMH A;  1XF5 L;  1YIW A;  4ZRK A;  3WIM A;  2Y5B B;  4RGN A;  3VH4 B;  2PVO D;  2PEA A;  3ZKJ C;  1BT0 A;  1UZX B;  2Y3A A;  1VD2 A;  4BVU C;  2X8X X;  3EC8 A;  3QK0 A;  1MPE A;  3DBL I;  4KZC A;  1WGD A;  4F1S A;  2RPQ A;  1QIL A;  4KDL B;  3P4Q B;  1SGH A;  2V0G A;  2BYF A;  2DYO A;  1OTR B;  3EA6 A;  3TCA A;  2UU7 A;  3VRA B;  2HJ8 A;  2KKC A;  2BQQ A;  3APD A;  4HCP B;  4JWS C;  1KJT A;  4RM8 A;  2MBE A;  3IBE A;  5IOI A;  1BML C;  1OEY A;  2KFJ A;  4XDD A;  2L3Z A;  1L0V B;  4C80 A;  2QSD A;  4HKQ A;  3AEF B;  4E74 A;  1D5M C;  1UBI A;  4LJP B;  4X57 B;  2K1F A;  4DXG A;  2AX5 A;  3NVZ A;  2WXR A;  4ANX A;  1TJE A;  1HTO A;  2C5L C;  3QX1 A;  1TY2 A;  4YT0 B;  2LGI A;  4LNO A;  5H92 C;  1VJK A;  2HDE A;  1WJU A;  4ZDV A;  4MJS A;  2MJE A;  5DPW A;  2GOW A;  1QF6 A;  3R7R A;  3N9Y C;  3ZW3 A;  2JYE A;  3B08 A;  3Q14 C;  2IND C;  3KQ4 A;  2WP9 B;  1EU4 A;  2D10 A;  1YJJ A;  2LGD A;  4LNN A;  1ET9 A;  2K3U A;  2BYV E;  3EFU A;  2AYO B;  2V3N A;  3AV8 A;  2B76 B;  4FJV B;  2N9P C;  2KC2 A;  4GIV A;  5EDS A;  2LGS A;  2KJ6 A;  1V1P B;  4IDI A;  2Y5P A;  5D94 A;  2QJL A;  1I4P A;  4NQL B;  3SFD B;  2KMM A;  4RCO A;  1C76 A;  3H9D A;  3RZF A;  2Z0D B;  4MSM B;  2WLB A;  3VUX A;  1V86 A;  1XLN A;  1MI0 A;  4NQK E;  3TSS A;  1C3T A;  2M1M A;  4BZA A;  1H7W A;  3A4S C;  4G0N B;  5C3J B;  2ICI A;  1F1H A;  2KWV B;  4GDL A;  4M02 A;  4R3D A;  2CU3 A;  2VH1 A;  2W9N A;  2V3S A;  2JWU A;  1CZP A;  3NOB A;  2KN5 A;  3W5U B;  2AWT A;  1DOI A;  3U7D A;  2LVO A;  1YN4 A;  4HJK A;  3T9L A;  1NDD A;  2LUE A;  2IGD A;  1TBE A;  2KZR A;  1WMH A;  3ZO5 B;  5IA7 A;  2XK5 B;  4LDT B;  2M8S A;  2BW2 A;  4IWP A;  3WA0 A;  5FKA C;  2L8J A;  1VZ6 A;  3SFE B;  3AEB B;  5IP4 D;  3AB5 A;  2LGY A;  3ZXR A;  2DX5 B;  2WS3 B;  4A20 A;  1DOY A;  2VZK B;  2K8B A;  1E7V A;  2KN4 A;  1F2R I;  1STE A;  3ZDM C;  4ANW A;  3PVL A;  2N7J A;  2R2Q A;  3AE7 B;  4DXF A;  2C9W B;  2BKF A;  3VUW A;  4KKI A;  1IPG A;  2FUG 1;  1Q0W B;  1V5O A;  4FBJ B;  2BKR B;  4YWG G;  3W2D A;  4CQN A;  2RPV A;  3HVZ A;  2YLM A;  1N63 A;  2NBV B;  2EEL A;  3N3K B;  3NY5 A;  3GE3 C;  3H1U A;  5CX3 A;  4P1B C;  3BVM A;  4K7W A;  4GMV A;  3FC4 A;  2D11 A;  2PKO A;  2D3G A;  3IFW B;  4IG7 B;  2MP2 A;  1N60 A;  2KDF B;  1YQB A;  3QCA A;  2CKH B;  2NTS A;  3IG3 A;  1WJ6 A;  2FID A;  2O2V A;  4KVG B;  3V6C B;  1BUI C;  1Q1O A;  4ASW C;  3HK0 A;  1HTQ A;  1WZ3 A;  2IO1 B;  1C4C A;  3AEE B;  4XYC A;  2PPH A;  1ENF A;  2NR2 A;  5EE0 A;  2HJ1 A;  2LHD A;  4AUQ C;  3ALB A;  4YTM B;  2BWF A;  3VQI A;  3UGB B;  4YTP B;  3WCQ A;  2JZZ A;  3ZXV A;  2MHJ A;  2WXF A;  3AE3 B;  2D5G A;  5JH5 C;  4N9F 4;  2KMC A;  2WXP A;  5MPO A;  4S17 A;  2J42 A;  4TKN A;  3DCG A;  4MM3 B;  5EE9 A;  2WGS A;  1ROE A;  4RMA A;  2JYT A;  1FNW A;  2MJ3 A;  4HRO A;  1YQ3 B;  3I5J C;  2N9X A;  1TS4 A;  2WQY B;  1ET6 A;  2G9H D;  3B1L X;  1I7H A;  1WJ4 A;  2MBH A;  1TZ1 A;  1WX8 A;  2H89 B;  2EKI A;  2WXM A;  5J2R A;  4S0R A;  3TEY A;  2IYD B;  2LJI A;  3JVZ X;  3ZGZ A;  2BYE A;  3ONS A;  2N1V A;  1Y8R C;  5FR3 A;  1JWB D;  2KC1 A;  5BYQ A;  3B2G A;  3TJP A;  3GZN B;  3DHH C;  3CWI A;  3PRE A;  2QC8 A;  4EZK A;  3ZJV A;  4QAY A;  4W9K A;  2R61 A;  3FIL A;  2J53 A;  2W3R A;  3UIO B;  3EHV A;  1QOA A;  2N9L A;  4IM2 A;  4W9F A;  1M94 A;  1TS5 A;  1KOT A;  1XT9 B;  3A4R A;  1IUE A;  4GDK A;  5LLI A;  3CSF A;  1K53 A;  2KOX A;  1WYW B;  3AE8 B;  1YX6 B;  3L08 A;  3O65 B;  3VVW B;  1VLB A;  2JQR B;  2WX0 A;  1OFF A;  2OJW A;  3A9J A;  2KTR B;  3Q8F A;  4MAC A;  2KNB A;  2KQ7 A;  2MQJ A;  1I35 A;  3ZJT A;  2L32 A;  4RGT A;  1HEZ E;  1SE3 A;  1K51 A;  3R7Q A;  5D2M B;  3X23 A;  3BII D;  2OJR A;  3FIL B;  1MHX A;  1WZ0 A;  3DBR I;  2GLS A;  2WYQ A;  4YSZ B;  4WWN A;  3PZD A;  3DBL B;  4KSK C;  4LCD E;  3RNC C;  4ICU A;  4F8C B;  5HHD G;  3E9S A;  2N9E B;  2HD5 B;  4AP4 C;  3Q8B A;  1A5R A;  3RPF C;  4AWJ A;  1C4A A;  1SE2 A;  2G45 B;  5E6O A;  3N1Y C;  4C4V A;  3W9C B;  3BYT B;  2C7N B;  4HDO A;  3ZNI D;  1EF1 A;  3V60 A;  1HQR D;  4WJP A;  3A1Q B;  3M63 B;  3KH0 A;  4ANU A;  4A55 A;  3HM6 X;  1SBB B;  1SE4 A;  4W9E A;  2FCS A;  2Z0E B;  4MGZ E;  1WJN A;  5E6P A;  4HVB A;  3OWE B;  3AE4 B;  2G3Q B;  1TKE A;  4IW0 A;  2M17 A;  2DYM A;  2VZK D;  3BYY B;  1WYG A;  3DVG X;  4ZYS A;  1WX9 A;  4TUU A;  1JCK B;  2EMT A;  4FHJ A;  1FNV A;  4BKS D;  5E6J A;  3KUC B;  3EUB 2;  4K7U A;  1HZ6 A;  1UUP A;  4L2Y A;  4NAW A;  4I6N B;  4C4V B;  2QDF A;  4M0W A;  1WF9 A;  1YD8 U;  2LUM A;  5FR6 A;  2WU2 B;  2JZ3 B;  2O6V B;  4K3C A;  1XXG A;  3V61 A;  4JLC A;  1NYQ A;  2IGG A;  2LXA A;  3L4P A;  1HXY D;  4FAD A;  4EUT A;  1Z2M A;  4L1B A;  3U4E G;  1ZP0 B;  4HWI B;  2Z59 B;  3IAM 1;  1ZDX A;  3C0R B;  3V62 A;  3PSE B;  3TBL D;  2GBR A;  2PJH A;  4MM3 A;  1EWC A;  1N5X A;  4RF0 A;  2J52 A;  2E6X A;  3ZDT A;  3BY4 B;  2LRU A;  1AAR A;  2MWS B;  1I4H A;  5TR5 A;  3A9J B;  3V05 A;  4XWT A;  1NYR A;  4EE2 A;  3TEZ A;  4WUR A;  4US8 A;  1PGA A;  2MX2 A;  3D32 A;  4XZ4 A;  4TV3 A;  2DZM A;  2BB5 A;  4BOZ B;  3R8B A;  2ZPN A;  4C7Y A;  1GTH A;  4F7Z A;  2M56 B;  2GBM A;  3Q2A C;  4RM9 A;  3MC9 A;  3PZ8 A;  3DVG Y;  4PT5 A;  2W82 A;  4ZRQ A;  3I3T B;  1RFK A;  4KKJ A;  3BZD B;  3T8M A;  2C7M B;  2MW5 A;  3MJ5 A;  5JZE B;  1TIF A;  2I1J A;  1YMH E;  5IAA C;  2K6D B;  2MBB B;  2WXK A;  4B9K A;  4XE0 A;  1UWX A;  2KAC A;  2KK8 A;  5C23 A;  3TUO A;  2KHW B;  4ZHP A;  3UIN B;  5GXG B;  1WMH B;  2N7E A;  3WAL A;  4HPM B;  3ZTC A;  2LAS A;  3RYT A;  2NBU A;  4WJO A;  2KLC A;  2WDQ B;  1F2R C;  4HPL B;  2VRR B;  1B9R A;  1FXT B;  5E6N A;  2DLB A;  4PK1 A;  2KQS A;  1SJE D;  4HCN B;  2KTF A;  2BB6 A;  3RZW C;  1V81 A;  2LVQ A;  2ON8 A;  2LFI A;  1TZO A;  3QIJ A;  4EFO A;  2L7R A;  1T0S C;  1ZXH A;  2BWE S;  2E3T A;  3AXC A;  1PUT A;  4GSW A;  4ITK A;  3L16 A;  1UF0 A;  2BYT A;  2ZNV B;  3AEC B;  3GZN I;  3O13 A;  1ESF A;  3VAW A;  2JRH A;  2FAZ A;  1IP9 A;  1RFA A;  1JWS D;  3VTU A;  1VCB A;  3EGR A;  3DBH B;  4ZOH C;  2LHE A;  3ZIM A;  2M19 A;  1JRO A;  3AM9 A;  1XQQ A;  4MH8 A;  4EZJ A;  1OEY J;  2SEB D;  2N1W A;  2O2V B;  3OG5 A;  4ARI A;  2JZP A;  1B1Z A;  2ZCB A;  2D3B A;  2JRI B;  2YEP B;  1UH6 A;  2WNM A;  2L83 A;  2L05 A;  2PE6 B;  1IBX A;  5AZH A;  2XBB C;  1V1P A;  1WM3 A;  3HM3 A;  1LXD A;  1YN5 A;  2N9K A;  3LJ3 A;  4RNA A;  1XLO A;  2L0F A;  1F77 A;  1Q10 A;  4WQO B;  3QA8 A;  3DQV A;  4MT5 A;  4RGO S;  1WM2 A;  4USA A;  3OAW A;  2KAJ A;  4KGS A;  4BOS C;  1C4P A;  1Y56 A;  1E8Z A;  2KVR A;  3W1S A;  1KM7 A;  1YOV B;  3GP7 A;  3X0W A;  2IO3 B;  2FBW B;  1WXV A;  1GTE A;  2R2O A;  1PQS A;  1E8X A;  1GNU A;  2J4X A;  1TS2 A;  1FXI A;  4KV2 A;  3PHX B;  1HE8 A;  2AL3 A;  3MHZ A;  5BMI A;  4DBG A;  1WXA A;  1SJH D;  4JQW C;  4KSL C;  3AE6 B;  4FN2 A;  3ETR A;  2ZJD A;  4O1N A;  4AJY B;  4ZRJ A;  1VZ7 A;  2KTR A;  4RFB A;  3W5V B;  5G55 A;  3H7P B;  3PTF C;  4HRS A;  4NJ7 A;  2G4D B;  2AQ2 B;  1QLB B;  4IM0 A;  2K9X A;  4MGY E;  2KVZ A;  4II3 B;  3I9V 1;  4GB9 A;  4A8X C;  2M0X A;  1XO3 A;  2DBY A;  3PLU A;  4FHK A;  2LZ6 A;  2CJO A;  1YQ4 B;  4JX1 C;  1J0G A;  3ZQ4 A;  1KH0 A;  3KWL A;  3P4P B;  1D5Z C;  1WX7 A;  5D7G A;  2KT7 A;  2JU6 X;  1G6J A;  4FA6 A;  4JIO U;  4B0M A;  1E10 A;  2PW9 A;  1ACC A;  4YSY B;  3B9J A;  3TIX A;  1V9J A;  4ZRP A;  2LEK A;  4KDI C;  3GOE A;  3ZTD A;  5KHO A;  2WDR B;  2DZJ A;  1ZGU B;  4NNJ B;  1UBQ A;  4MEM A;  1JML A;  1RLF A;  1T0Q C;  1IGC A;  3ML9 A;  4NAW B;  4GDL B;  2H88 B;  1MG4 A;  2MBO A;  5FK9 C;  4FUL A;  5AUI A;  1WR6 E;  4GXB A;  2CU1 A;  2TSS A;  3KWV A;  4CYE A;  4H2A A;  3AUL A;  3RUL A;  3OJ3 A;  2YVC A;  1U4A A;  1R4M I;  1N6Z A;  3HRD D;  1T0R C;  1WFY A;  4LDT D;  4TSS A;  1WRI A;  1ZOY B;  4BBN F;  1CK1 A;  2WHI A;  4ACF A;  2KX3 A;  2NPT B;  4P6V F;  3QAR A;  2N0S B;  2BVC A;  2D3A A;  2O6V D;  3CMM B;  3PRZ A;  1K52 A;  1FIQ A;  3FKY A;  1X1M A;  3ZNZ B;  1E90 A;  1JRU A;  2DAF A;  1ZKH A;  2KWC A;  1T6B X;  1NI2 A;  1J19 A;  4PS8 A;  2FNJ B;  3ZNH B;  5J17 A;  4FJZ A;  4TMA B;  2IY1 B;  2KDI A;  1WSP A;  1C9F A;  4NJC A;  1CQV A;  2MRP A;  3WAM A;  4XWW A;  3H6N A;  1OQY A;  1QOB A;  4P7I A;  3NVV A;  5IO9 A;  2K0P A;  3RUI B;  1FD6 A;  1XLQ A;  3P2B A;  5C1Z A;  1R7S A;  1UEL A;  3NJT A;  2NS5 A;  2NVU I;  4YTN B;  1I4Q A;  3L0W B;  4KGR A;  4LK0 M;  3VXW A;  2REX A;  3MHS D;  1KLV A;  4N58 A;  3P4R B;  1ZDV A;  2D07 B;  3JSV A;  3W1Y A;  3DWM A;  1GG3 A;  2MH7 A;  3DWG C;  2MBQ A;  3AE2 B;  4UDU C;  1F0Z A;  2FE8 A;  1KRH A;  3L10 B;  1QOG A;  5DPR A;  2IPK D;  2IZV B;  2GBN A;  2WU5 B;  3NZU A;  2ZNV C;  3U8Z A;  3PRM B;  4NAM A;  3SDL C;  3UF8 A;  3AU4 A;  3APC A;  1PGB A;  3LXF A;  4OVZ A;  1T3Q A;  1JRP A;  4GGQ A;  1UGJ A;  2GMI C;  3PO0 A;  2I2Y A;  3VH3 B;  2EKE C;  4RGM A;  1KFY B;  3K9P B;  4L23 A;  3KLS X;  4A9A A;  2AQ3 B;  1RWS A;  2ZW0 A;  3T3N A;  3NZS A;  2K22 A;  3R2I A;  4HDQ A;  1OQR A;  4J3O D;  4OHJ A;  4US9 A;  1TGZ B;  4A3P A;  2J7Q B;  3AEG B;  1GAQ B;  2MSE D;  1QOF A;  3M3J A;  2ZCC A;  4FXC A;  1AW7 A;  4DHJ D;  4LNF A;  3Q8E A;  3QHT A;  1JWM D;  2VH2 A;  3FAH A;  2MLB A;  1ZW7 A;  1H7X A;  3J9C A;  3KUZ A;  2UWQ A;  1FRR A;  2CHZ A;  1E6E B;  1JAL A;  2MA9 B;  3AE9 B;  4ZYN A;  3MC8 A;  4ICV A;  2NBW B;  2O6V A;  3P42 A;  2HTH A;  4B0E A;  1PGX A;  1WY8 A;  5BMG A;  4WAF A;  1V8C A;  2LD9 A;  1KTK A;  4M0W B;  4P16 A;  1FPY A;  1SE9 A;  2IBI B;  3AI5 A;  3NRZ A;  2K6Q A;  1LGR A;  2JSV X;  3B2F A;  4NJ6 A;  3VR9 B;  1MJD A;  1FCC C;  1ZPS A;  3BWU D;  2Q5W D;  4KIK A;  1WGH A;  2KFK A;  3VTW A;  2EMS A;  3KW5 B;  3RNB C;  2LI5 A;  4GDK B;  1RM6 C;  1TKG A;  2W3S A;  3GS2 A;  3N30 A;  1P1A A;  1V49 A;  4C00 A;  1LQB A;  4K7S A;  4HKZ E;  1JWU D;  3TMP B;  4KIK B;  3APF A;  4MDK E;  1YN3 A;  2INN E;  2OHF A;  2HE7 A;  1DOX A;  1VZ8 A;  4BFR A;  2L76 A;  4IOI E;  2DHZ A;  2KX0 A;  3QAQ A;  3PS6 A;  4ZHO A;  3VRB B;  2K8C A;  4A6Q A;  4DWF A;  3PRP B;  3E56 A;  4WJN A;  3CF6 E;  1UNS A;  2QCZ A;  2RSU A;  2ONQ A;  4LNK A;  3M95 A;  2IDY A;  3BVZ A;  1V5T A;  3NS8 A;  2V1Y A;  2KYW A;  1L0X B;  4PYU A;  2Y5C A;  3DVN U;  4YXD B;  1FXA A;  1YJI A;  2PLP A;  3DHI C;  2KD0 A;  1HA5 A;  3SU8 X;  1GB4 A;  4E3C A;  2V4I B;  2YEP F;  2WXL A;  3PT2 B;  2JXT A;  4GLS C;  4OZB A;  3ZRC A;  3PZ7 A;  4OZA A;  1IBX B;  5AZF A;  4DQO C;  5D3I B;  2CS4 A;  1PDX A;  3VUY A;  2DZK A;  1DYQ A;  2WXQ A;  3ZLZ A;  1TT5 B;  5DCN A;  2IGH A;  4AS1 A;  2WWZ A;  2BS2 B;  3ZNG C;  2KDE B;  4HJG E;  1SB3 C;  1N62 A;  4I6P A;  2J0K A;  2JF5 A;  1IYF A;  3WAO A;  3AEA B;  4LNI A;  5J18 A;  1Q5W B;  4HLE A;  3A9K B;  2WXG A;  3RCZ A;  1MFW A;  4WWO A;  1C1Y B;  4M00 A;  3HVD A;  1L0Y B;  3EEC A;  2Z8L A;  3TEW A;  2ZVN A;  4G3X B;  1L7Y A;  5EE3 A;  2KXJ A;  1H4R A;  2CHW A;  1EF5 A;  3NVW A;  3N1Z C;  2B3A A;  3OJ4 B;  4PS3 A;  3SR6 A;  5C2T B;  2RR9 A;  4GN1 A;  2LWP A;  4EZL A;  1XD3 B;  4K1R B;  1Z5S B;  2L00 B;  5IN7 A;  1MVK A;  2JUO A;  4C56 C;  2PVG C;  3N20 C;  2K25 A;  3L13 A;  1E7U A;  2INP E;  3RNE C;  3HIZ A;  2NPT A;  2KJH B;  3VDZ A;  2BTE A;  3WAN A;  3P4S B;  4MEL A;  1D3Z A;  2W55 A;  3MC0 B;  1WI0 A;  3N1X C;  1I4X A;  5LXI B;  4LTU A;  3DOW A;  3MP9 A;  4DHJ B;  5IKC M;  3Q3M C;  1V1O A;  4W9H A;  1MHH E;  2QMT A;  2GRI A;  2C60 A;  2OED A;  1EUV B;  1FCL A;  5G5G A;  1JW9 D;  3U7Z A;  1VR9 A;  3AH7 A;  1QQR A;  1L6V A;  1FFU A;  3I57 A;  3T3O A;  1WR1 A;  3MTN B;  2DAJ A;  1ISN A;  3BK2 A;  1AWD A;  4JGH B;  1WXQ A;  3JYU A;  2AL6 A;  1H8C A;  3WAP A;  2WXI A;  4MSQ B;  2RGF A;  2JY6 A;  1FEH A;  4OVV A;  3RD2 A;  3V6E B;  2JWZ A;  2KJR A;  3H7S A;  2JPH A;  4MGK E;  1FM0 D;  3PV1 A;  3KYC D;  3SD5 A;  3ML8 A;  4DHZ E;  1GC7 A;  2ZEQ A;  1I4R A;  1GPX A;  3A9K A;  2N4F A;  3A1Q A;  4D2K A;  2JT4 B;  3DVN V;  1NBF C;  4LLG M;  4JL9 A;  2L52 A;  1F9J A;  1SIJ A;  5JHB A;  1FFV A;  2ZZP B;  1P3Q U;  4W9D A;  3VTV A;  3CF4 A;  3NUH B;  4N59 A;  1V2Y A;  4OVU A;  1IGD A;  4OW0 A;  3EFC A;  5LNK 1;  4XGA B;  4YSX B;  1GT8 A;  3AN1 A;  2WDT B;  2FIF A;  3Q3J A;  4C7Z A;  4IWQ A;  5L95 C;  2V3P A;  1LO5 D;  3KYD D;  4N6E B;  1FNU A;  3H7P A;  3QJZ A;  2FCM A;  3RFZ B;  3AU5 A;  4FLH A;  4W9L A;  3ZUN A;  3DBS A;  3PHW B;  1M4V A;  2DNF A;  3RT3 B;  2MCN B;  4IC7 B;  2NTT A;  2RD0 A;  4NPN A;  1ZE3 D;  1SF0 A;  3QWZ B;  2AQ1 B;  5I4D A;  1D5X C;  2W54 A;  2INC C;  1HZ5 A;  3U30 A;  1V80 A;  2KLG A;  4W9J A;  4ARC A;  4PYZ A;  3CIR B;  3AED B;  4GU2 A;  4LJO B;  3V3X A;  2M4N A;  4TQ0 A;  1WH3 A;  1GUA B;  4RF1 A;  4CHK A;  3L54 A;  2PTL A;  2QEJ C;  1QT9 A;  1DGJ A;  3DDC B;  3ECI A;  4BKG A;  5H8Y E;  2WDV B;  1N61 A;  2M0A A;  2IO0 B;  3W1S C;  1VRA B;  1WXS A;  1WGY A;  3HUI A;  4ZRI A;  1FO4 A;  2QIE B;  3URY A;  1RAX A;  2NCN A;  3PPA A;  3MFG A;  3NZ3 A;  5HFY A;  5CHV C;  1V6E A;  3JW0 X;  3LDZ E;  4WIP A;  5JXV A;  1AN8 A;  3RNG C;  3P1M A;  1S3S G;  2PIA A;  3QC8 B;  1YX5 B;  4A3O A;  5GMV A;  1TY0 A;  4REZ A;  2KDM A;  4WAA A;  1F52 A;  1KLU D;  3C8Y A;  1TKY A;  1K8R B;  3BK1 A;  3K9O B;  4BKS A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  3AE9 B;  1ET9 A;  2K3U A;  1YMH E;  1ZXI A;  2V3N A;  3AV8 A;  3P42 A;  2WXK A;  5EE1 A;  2B76 B;  4B0E A;  1PGX A;  4XE0 A;  1UWX A;  2KAC A;  5BMG A;  3U2S C;  4WAF A;  2BT6 A;  1V8C A;  1KTK A;  4RH6 A;  3TUO A;  3BVG A;  2RDG A;  1V1P B;  4P16 A;  4IDI A;  2Y5P A;  4ZHP A;  3NRZ A;  2QJL A;  5GXG B;  1I4P A;  3SFD B;  2JSV X;  3B2F A;  2KMM A;  1AYF A;  4RCO A;  1C76 A;  3VR9 B;  2WDQ B;  1K50 A;  1FCC C;  1ZPS A;  1F2R C;  3ZJU A;  2WLB A;  1B9R A;  3BWU D;  1XLN A;  1MI0 A;  2DLB A;  1CJE A;  2Q5W D;  3TSS A;  1H7W A;  5C3J B;  1SJE D;  2ICI A;  2BB6 A;  4R3D A;  4WQM A;  1NEN B;  4GDK B;  2CU3 A;  3U52 E;  1RM6 C;  1TKG A;  2W3S A;  3GS2 A;  2JWU A;  1CZP A;  1NEK B;  2ON8 A;  4Q2J A;  3W5U B;  1DOI A;  2LFI A;  1TZO A;  3R2T A;  4HKZ E;  4AQ7 A;  1I4G A;  1YN4 A;  1ZXH A;  1PYW D;  1OQQ A;  1JWU D;  2E3T A;  1PUT A;  2IGD A;  1XCT L;  4ITK A;  1SXT A;  3ABV B;  1J7C A;  1YN3 A;  2INN E;  2BYT A;  2WXH A;  2OHF A;  3AEC B;  1DOX A;  1VZ8 A;  1ESF A;  3O13 A;  1L4Z B;  4IOI E;  2BW2 A;  1JWS D;  3EGR A;  2GI9 A;  4ZHO A;  3VRB B;  2DWQ A;  4A6Q A;  4ZOH C;  5FKA C;  2LHE A;  1T5X D;  2WXJ A;  2M19 A;  1D6E C;  1VZ6 A;  3SFE B;  1JRO A;  3AM9 A;  1JQ4 A;  3AEB B;  2PMV A;  3AB5 A;  4MH8 A;  3E56 A;  2WS3 B;  1UNS A;  2SEB D;  1DOY A;  1QKZ A;  1VDV A;  2RMM A;  2VZK B;  4TQ1 A;  2KN4 A;  1F2R I;  1STE A;  2ONQ A;  3NS1 A;  3IAS 1;  2N7J A;  2IDY A;  3BVZ A;  4ARI A;  2JZP A;  1B1Z A;  4KX6 B;  3AE7 B;  4DXF A;  1L0X B;  1JWA D;  2Y5C A;  4KKI A;  4YXD B;  2FUG 1;  1WGK A;  2YEP B;  1FXA A;  1WWT A;  1YJI A;  2IJ0 A;  2PLP A;  1PFD A;  2WNM A;  2WXO A;  2L83 A;  2WXN A;  4JWU C;  4YWG G;  3W2D A;  4CQN A;  1HA5 A;  1V97 A;  1NVI D;  1GB4 A;  2RPV A;  3HVZ A;  2V4I B;  2BS4 B;  1IBX A;  1N63 A;  2EEL A;  2YEP F;  2WXL A;  1V1P A;  2JXT A;  1XEE A;  4GLS C;  4OZB A;  3PZ7 A;  4OZA A;  1L6U A;  3BVM A;  3FC4 A;  1IBX B;  4DQO C;  1C77 A;  1EWY C;  1P7F A;  4OZC A;  5D3I B;  2PKO A;  1NI3 A;  1YN5 A;  2N9K A;  1PDX A;  1N60 A;  5TSS A;  1DYQ A;  2WXQ A;  4RNA A;  2NTS A;  2IGH A;  2SAK A;  5G5H A;  1XLO A;  4AS1 A;  1SSN A;  2MEK A;  1BUI C;  1F77 A;  1Q10 A;  2G1E A;  1EM7 A;  2BS2 B;  2QIL A;  4MT5 A;  1C4C A;  4HJG E;  3AEE B;  4RGO S;  3AE5 B;  1SB3 C;  5T8I A;  1N62 A;  4USA A;  1ENF A;  5EE0 A;  3AEA B;  2LHD A;  2KAJ A;  1XLP A;  4KGS A;  4YTM B;  2WXG A;  1C4P A;  3VQI A;  1Y56 A;  2KQ4 X;  4YTP B;  3HVD A;  1L0Y B;  3LB8 C;  4KGT A;  3W1S A;  3TEW A;  2Z8L A;  3WCQ A;  1XCQ L;  4WWM A;  3GP7 A;  5EE3 A;  1C79 A;  2WXF A;  1EU3 A;  3AE3 B;  1KF6 B;  5BYR A;  2D5G A;  2FBW B;  3NVW A;  3AMZ A;  1GTE A;  3ZYY X;  2WXP A;  3NVY A;  3UI3 A;  3Q8A A;  5MPO A;  3VR8 B;  3Q8C A;  3SR6 A;  5C2T B;  2MJD A;  2J4X A;  2J42 A;  1E9M A;  4MM3 B;  5EE9 A;  1TS2 A;  1FXI A;  3TEX A;  2KWD A;  3MHZ A;  2ACZ B;  5BMI A;  1ROE A;  1SJH D;  2JYT A;  4NZL B;  3AE6 B;  1RYJ A;  1MVK A;  1FNW A;  2MJ3 A;  2XN9 C;  4HRO A;  2X38 A;  2PVG C;  1YQ3 B;  4C56 C;  3ETR A;  3Q69 A;  2LMC A;  1TS4 A;  1KLG D;  3P63 A;  4O1N A;  2WQY B;  1VZ7 A;  2INP E;  4RFB A;  3W5V B;  1ET6 A;  2G9H D;  4HRS A;  1I7H A;  3LYY A;  1N5W A;  2AQ2 B;  1GB1 A;  1QLB B;  2GB1 A;  2H89 B;  4HEA 1;  2BTE A;  2K9X A;  2EKI A;  3IT6 B;  2WXM A;  3TEY A;  3I9V 1;  2LJI A;  3P4S B;  4A8X C;  1XO3 A;  2DBY A;  2W55 A;  3ZGZ A;  2XNA C;  5BYS A;  2CJO A;  3MC0 B;  1YQ4 B;  1I4X A;  1JWB D;  4LTU A;  4JX1 C;  5BYQ A;  5FR3 A;  3MP9 A;  3ZQ4 A;  1TYG B;  1UWM A;  1V1O A;  3B2G A;  2I38 A;  3CWI A;  1GOZ A;  1KH0 A;  3P4P B;  1D5Z C;  1TS3 A;  3KWL A;  5D7G A;  3ZJV A;  4JPS A;  1MHH E;  2BBC A;  2R61 A;  2JU6 X;  3FIL A;  2J53 A;  2QMT A;  1J7A A;  2GRI A;  2W3R A;  2CJN A;  2OED A;  2L1A A;  1D4B A;  1QOA A;  2N9L A;  2NMQ A;  4B0M A;  1TS5 A;  1E10 A;  2PW9 A;  3SEB A;  1FCL A;  5G5G A;  1ACC A;  1JW9 D;  4YSY B;  3U7Z A;  1VR9 A;  1IUE A;  1BXT A;  1K53 A;  3B9J A;  3AH7 A;  1QQR A;  1L6V A;  3IT4 B;  3AE8 B;  1FFU A;  4ZRP A;  2LEK A;  3I57 A;  3T3O A;  1L4D B;  3H8H A;  2BS3 B;  1E0Z A;  2WDR B;  3BK2 A;  3IXS A;  1VLB A;  2JQR B;  1AWD A;  2JX5 A;  1WXQ A;  1JML A;  1OFF A;  1IGC A;  2WXI A;  4NAW B;  4GDL B;  3Q8F A;  4MAC A;  2H88 B;  1FEH A;  5HI1 A;  5FK9 C;  3ZJT A;  2L32 A;  4RGT A;  5AUI A;  1HEZ E;  2ZW1 A;  1FM0 D;  1FRD A;  1P7E A;  1K51 A;  1SE3 A;  2TSS A;  3KWV A;  3GB1 A;  3BII D;  4H2A A;  3FIL B;  1MHX A;  2RDH A;  1I4R A;  1GPX A;  3HRD D;  4D2K A;  4YSZ B;  4TSS A;  1WRI A;  1ZOY B;  1CK1 A;  4LLG M;  3AE1 B;  2L52 A;  4P6V F;  1FMA D;  1SIJ A;  1FFV A;  1YNT E;  2K5P A;  2N0S B;  5HHD G;  3E9S A;  4JE3 B;  3CF4 A;  3NUH B;  4N59 A;  3Q8B A;  1K52 A;  1FIQ A;  1IGD A;  4OW0 A;  5HG2 A;  5LNK 1;  4YSX B;  1GT8 A;  3RPF C;  1C4A A;  1J7B A;  1SE2 A;  1SEB D;  1C78 A;  1T6B X;  3AN1 A;  4XDC A;  3W9C B;  3BYT B;  4A90 A;  4WH4 A;  1HQR D;  4C7Z A;  4TMA B;  2V3P A;  1WSP A;  1C9F A;  1LO5 D;  5D3D A;  4NJC A;  4A55 A;  1SBB B;  5AUK A;  1SE4 A;  4N6E B;  1FNU A;  1L5P A;  1CQV A;  1E7P B;  4XWW A;  4IKG A;  1QOB A;  2HTM E;  1ZUD 2;  1A70 A;  5BMH A;  3RFZ B;  3NVV A;  1XF5 L;  2K0P A;  1FD6 A;  1XLQ A;  3OWE B;  4RGN A;  3AE4 B;  2PVO D;  1TKE A;  1M4V A;  2DYM A;  2VZK D;  1R7S A;  3BYY B;  1WYG A;  4ZYS A;  2NTT A;  1JCK B;  4YTN B;  1ZE3 D;  1FNV A;  5E6J A;  1SF0 A;  1I4Q A;  2AQ1 B;  5I4D A;  1D5X C;  4KGR A;  2Y3A A;  3EUB 2;  1HZ6 A;  1UUP A;  4L2Y A;  2W54 A;  1HZ5 A;  4LK0 M;  1MPE A;  4N58 A;  3P4R B;  1QIL A;  1ZDV A;  4ARC A;  4M0W A;  3CIR B;  3AED B;  2LUM A;  3P4Q B;  2V0G A;  2DYO A;  3V3X A;  3DWM A;  2MH7 A;  2WU2 B;  3DWG C;  3AE2 B;  4UDU C;  1F0Z A;  2FE8 A;  3EA6 A;  1KRH A;  1E6E B;  1XXG A;  1QOG A;  4TQ0 A;  3VRA B;  2IPK D;  1NYQ A;  2IGG A;  3L4P A;  1HXY D;  4JWS C;  4RF1 A;  2WU5 B;  4L1B A;  2PTL A;  2QEJ C;  1ZP0 B;  3U4E G;  1BML C;  1QT9 A;  1DGJ A;  4NAM A;  3IAM 1;  1PGB A;  4XDD A;  1ZDX A;  1L0V B;  3LXF A;  4OVZ A;  1T3Q A;  4C80 A;  2QSD A;  1JRP A;  5H8Y E;  4HKQ A;  3AEF B;  1UGJ A;  3PO0 A;  2WDV B;  1N61 A;  1EWC A;  1N5X A;  2J52 A;  2E6X A;  2M0A A;  4RF0 A;  1D5M C;  2I2Y A;  1VRA B;  4RGM A;  1KFY B;  4L23 A;  3KLS X;  3HUI A;  4A9A A;  4DXG A;  2AQ3 B;  2AX5 A;  1RWS A;  2ZW0 A;  1FO4 A;  2QIE B;  1I4H A;  3V05 A;  3URY A;  3T3N A;  3NVZ A;  2WXR A;  4XWT A;  1TJE A;  2K22 A;  3MFG A;  3NZ3 A;  3R2I A;  5HFY A;  1OQR A;  4J3O D;  1NYR A;  4OHJ A;  4WIP A;  4EE2 A;  4US9 A;  3TEZ A;  1TY2 A;  4WUR A;  4US8 A;  1PGA A;  5JXV A;  1AN8 A;  3AEG B;  4YT0 B;  2LGI A;  1GAQ B;  5H92 C;  1VJK A;  3P1M A;  1QOF A;  2BB5 A;  3R8B A;  4C7Y A;  1GTH A;  2HDE A;  1AW7 A;  4FXC A;  2PIA A;  2M56 B;  3Q8E A;  2MJE A;  1TY0 A;  3PZ8 A;  1QF6 A;  3N9Y C;  4PT5 A;  2JYE A;  2KDM A;  2W82 A;  4REZ A;  1KLU D;  3C8Y A;  1JWM D;  1TKY A;  4ZRQ A;  3FAH A;  1RFK A;  3KQ4 A;  4KKJ A;  1H7X A;  3J9C A;  1FRR A;  3BK1 A;  3BZD B;  2WP9 B;  1EU4 A;  1YJJ A;  1JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...