4YSZB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yszB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yszB01
5AUIA 3VRBB 1SF0A 2BS2B 1CJEA 1JRPA 3P4PB 2LEKA 4JWUC 3L4PA 1FFVA 3AE2B 1TKYA 1RFKA 4YTMB 1R7SA 3SFEB 3AEBB 1NVID 1FM0D 1N61A 1ZUD2 1ROEA 3AEDB 1PUTA 2CJNA 3NRZA 5G5HA 2OHFA 1VDVA 3AE9B 2W55A 3W5VB 2WU5B 4N6EB 1TKEA 2JQRB 1JALA 2MJ3A 3AB5A 2BS4B 5GXGB 3AECB 2QJLA 4US8A 1FMAD 3SR6A 2WLBA 1A70A 2PVOD 1TKGA 3AE8B 3P4RB 1XLNA 5EE1A 1PFDA 2WDQB 4P6VF 3AEGB 1GTHA 1JW9D 2QIEB 1QOGA 4IDIA 2ACZB 1FIQA 1NEKB 1V8CA 4N58A 5C2TB 1N5WA 1PDXA 1I7HA 1L6UA 1QOBA 1VLBA 3AV8A 3ABVB 1CZPA 4C7ZA 3ETRA 2AX5A 2K5PA 2W3SA 1E7PB 2FBWB 1FRRA 1L6VA 3VR9B 3KWLA 1ZOYB 1XO3A 2WQYB 2K9XA 3VR8B 4C7YA 1WWTA 2WDVB 1SB3C 4HROA 1NENB 3HVZA 2B76B 2K22A 1YJJA 3B2FA 1YJIA 3AMZA 3AEAB 3CF4A 3AM9A 3RPFC 1FXIA 2PIAA 1E10A 1DOIA 1QLBB 2WDRB 5C3JB 1N5XA 1L0VB 1VJKA 2W3RA 5H8YE 5AUKA 1JWBD 1E6EB 2HTME 1QF6A 3LB8C 1V97A 2Q5WD 3FC4A 5G5GA 1E0ZA 3P4QB 2JX5A 5EE0A 1WYGA 3AE4B 1GTEA 2L52A 3HRDD 1NYQA 3P1MA 1JQ4A 2E3TA 3AH7A 1FXAA 4ZHPA 3PO0A 1TJEA 3NVYA 3AE3B 3AEEB 1QT9A 1DOXA 3AEFB 1GAQB 1J7CA 1KFYB 5H92C 1H7XA 3NVVA 2PVGC 2KAJA 3AE1B 2M56B 4ITKA 4YTNB 1B9RA 3EUB2 2WU2B 1QOAA 2WS3B 4YTPB 3FAHA 3AE5B 3P4SB 1EWYC 4ZOHC 1ZP0B 1FRDA 1N62A 1QOFA 1OFFA 2G1EA 4YT0B 3B9JA 3HUIA 3P63A 1XLOA 3BIID 2DBYA 4WQMA 5EE3A 3AE7B 1J7AA 1FFUA 1KF6B 3AN1A 1RWSA 1N60A 1AYFA 4FXCA 3W5UB 1OQRA 1RYJA 3B2GA 4JWSC 1FO4A 2DWQA 2H89B 2MH7A 3DWGC 2L83A 3VRAB 1NYRA 2MJDA 1L5PA 1AWDA 1E9MA 5EE9A 1GT8A 4YSZB 1WXQA 1YQ4B 4YSYB 3SFDB 1XLQA 4KX6B 3LXFA 3ZYYX 3NS1A 4ZHOA 1DOYA 4LTUA 5MPOA 2CJOA 1N63A 1JROA 3CWIA 4HRSA 4WWMA 2BT6A 2EKIA 4N59A 1ZXIA 1J7BA 4YXDB 1DGJA 1GPXA 2PKOA 1IUEA 4USAA 2N0SB 1KRHA 1JWAD 1TYGB 2W54A 3NVWA 1YQ3B 2M19A 4A9AA 4YSXB 3AE6B 4JX1C 2BS3B 2H88B 1WGKA 2KMMA 1F0ZA 3CIRB 1SIJA 1NI3A 1H7WA 1XLPA 1UWMA 3NVZA 3W9CB 1RM6C 3DWMA 2WP9B 1WRIA 2MJEA 4US9A 2Y5CA 1OQQA 1T3QA 4C80A 3WCQA 2CU3A
chains in the Genus database with same CATH superfamily
2JF5A 2IBIB 3PGEA 1JRPA 1RLFA 4RH6A 2D10A 1JWUD 2KNBA 3SFEB 3AEBB 1YX5B 4FN2A 3H7PA 2GBNA 3VDZA 4AOFA 1TGZB 2MP2A 3RNGC 2AQ3B 1WGHA 2BS4B 4PK1A 4MH0E 3SR6A 2REXA 1PFDA 1SE2A 4K81A 2LUMA 5C23A 3T8MA 1L4ZB 3VR8B 2XBBC 2WXRA 3B08A 1CQVA 5G2NA 2G45B 1YJIA 1ZE3D 2N7EA 3RPFC 2NPTB 3TIXA 2BW2A 3SU8X 2E6XA 3A4SC 3I63C 3MC9A 1ESFA 2G3QB 4A8XC 2NS5A 4HCNB 2W82A 1E7UA 4K7WA 2PE9A 4GDKB 1QKZA 2M0XA 1WI0A 4ZYNA 3VXWA 2WXLA 4NAWA 4KV2A 2LGIA 2M56B 3MP9A 2NR2A 1KJTA 3K9PB 2ZW1A 2IGDA 3QA8A 4BKGA 1NBFC 1L0XB 1WF9A 2HDEA 1XLQA 1I4HA 2LD9A 4F1SA 2D11A 1IBXB 1XQQA 2EKIA 3RYTA 2J52A 3M62B 1WGDA 2OJRA 2JRHA 3LDZE 1VZ6A 3UQAA 5HKHA 1UWMA 2K8HA 4BOSC 3VH4B 2MRPA 2K8CA 2Y5BB 3A1QA 1R7SA 4JL9A 4RM9A 1VCBA 1ROEA 3EFUA 4O1NA 4F8CB 2LJIA 4MSMB 4N6EB 1ET6A 3ZO5B 3ZQ4A 1D3ZA 3Q14C 4EEWA 4RGTA 1TKGA 3UGBB 1T0YA 3M63B 2BB6A 1MG8A 1TT5B 1V8CA 2SAKA 3OLMD 3RFZB 4TQ1A 4OZBA 4AJWA 5L83A 3HVZA 3B2FA 3RMKC 1PGBA 4ARCA 1WY8A 5J17A 1VJKA 3NOBA 2NTTA 2D2QA 1GTEA 4CYEA 3H1UA 2TSSA 3ZRCA 3AEEB 2HE7A 3AEFB 2L32A 3NVVA 3BINA 3QK0A 3ZVVA 2WXQA 3N3KB 5EE3A 1J8CA 4DHJB 3W5UB 4FXCA 2INPE 1YNTE 2MH7A 2O2VB 3HM6X 3C19A 1R4NI 2AYOB 3ZYYX 2MP2B 2NCNA 2RPQA 2KTFA 1HTOA 3KUDB 4MGZE 1ZDXA 2MA9B 1WSPA 1KRHA 3APCA 4RF1A 1WGKA 3DWMA 1T3QA 5J18A 4LNKA 1E8WA 2DYMA 1CJEA 4LDTD 2MHJA 4M01A 2IDYA 5JH5C 1UF0A 2KMCA 2QILA 3AE9B 2J4XA 4JIOU 4AP4C 1Q10A 4AJYB 1FNVA 4RNAA 4LJOB 4DWFA 4WJNA 1JCKB 2KTRA 1TIFA 1FRRA 2KDEB 2PW9A 1F9JA 1EF5A 5IN7A 3CF4A 2KKCA 1L0VB 1JWBD 1E6EB 3AULA 1WGYA 4LDTB 1QF6A 2M1MA 1WE6A 2PE6B 1WX7A 2FNJB 2WGSA 4M8MA 1EUVB 1UGMA 4W9EA 4ZHPA 2KJHB 4Q2JA 4LNOA 1TZOA 3TUOA 4XX5A 1J7CA 4HKQA 1I4XA 3TBLD 4IM2A 3CSFA 1QOAA 2NTSA 4YTPB 1GUAB 1QOFA 3HUIA 4W9DA 4WQMA 2INNE 3PZDA 3OWEB 2DZJA 4PS8A 1F77A 1P0RA 4K3BA 3LXFA 3ZIMA 2J42A 3CWIA 4FJZA 4EOYA 1FCLA 2RPVA 4USAA 2LGXA 2KDIA 3KYDD 1YQ3B 2BS3B 5BMHA 2YLMA 2WXMA 1N6ZA 1RM6C 2QDFA 1BMLC 4XZ4A 1TY0A 4XDDA 5JZEB 4YTMB 3ZDTA 1NVID 1UELA 3NZSA 3R7QA 3DHHC 5HHDG 4IG7B 5G5HA 3S2AA 1FEHA 4YL8A 1GB4A 3SEBA 4OHJA 2J0KA 1YOVB 1E7VA 2ZJDA 5CX3A 1D5ZC 3A4RA 3ABVB 2C7HA 4DHZE 2FBWB 2WQYB 5TR5A 4WJPA 1WM3A 1ACCA 3WAOA 1QILA 1MPEA 2PIAA 1E10A 1B1ZA 2HTME 3LB8C 4KDLB 5EE0A 3RCZA 2WXIA 2X8XX 3P1MA 2MBBB 1OEYJ 1VZ7A 4BBNC 2LXCA 1QT9A 3SD5A 4KVGB 1GAQB 1T6BX 1KFYB 2D3CA 4WAFA 4M0WA 1BXTA 2L3ZA 4UDUC 1EU4A 3EUB2 2KWUB 3Q3OC 3B9JA 5AUKA 1V9JA 2Y5PA 4WURA 1WJ4A 3AN1A 2CHZA 1R4MB 2H89B 3PHXB 3Q8EA 4D2KA 5L95C 2LHEA 1GT8A 4YSYB 4BBNF 2K6QA 3U4EG 2CJOA 2PPHA 2A5UA 1ET9A 1J7BA 1EO6A 2PKOA 1R4MI 1M4VA 1JWAD 2L0FA 1SIJA 3WA0A 2X38A 1IGDA 2N1VA 2KWDA 1H4RA 3V62A 2NPTA 2I1JA 1HTQA 3GP7A 4NJCA 2WXFA 3DVGX 4DDID 3NHEB 1WGGA 4GDKA 1SGHA 1K50A 3PVLA 3AU5A 4WWNA 3JSVB 4GGQA 1WR6E 1XLNA 2KHWB 4E3CA 1GTHA 3HVDA 4RGOS 4IUMB 3D32A 4BKTA 1CZPA 2WYQA 2K5PA 3VR9B 3N1ZC 3FILB 4E71A 3EECA 4IWOA 4W9GA 4A90A 1VZ8A 4HJGE 1F1HA 2KDMA 2ZNVB 5E6NA 3K9OB 1IBXA 3RI7C 3IHPC 4ZRJA 1BUIC 1EU3A 3ECIA 2N7JA 4K1RB 1BT0A 2E3TA 4W9LA 1FXAA 2MEKA 3AXCA 1TJEA 4H2AA 2MCNB 1JWMD 1FNUA 3RD2A 3BYTB 3WAMA 2JSVX 4ZOHC 2ZNVC 3P4SB 4ZRQA 2KFJA 4G11A 1C79A 1UWXA 2LI5A 3QCAA 1XLOA 1I4GA 2DBYA 4FHKA 5IP4D 1AYFA 5KHOA 1OQRA 1E5WA 4PT5A 4KSKC 4GIVA 3R2IA 3MTNB 3MC8A 4MGYE 2BT6A 3UINB 3R2TA 3TEWA 1DGJA 3GE3C 1GPXA 1I4QA 2MLBA 2XEWA 1WMHB 1V86A 3LJ3A 4MACA 2KMAA 3RNFC 3ZUNA 4HWIB 1I42A 1XLPA 4US9A 2Y5CA 2DAFA 1EF1A 3ZXRA 2BS2B 1C1YB 5D6JB 3EGRA 1SJED 1TKYA 4WIPA 2C5LC 5IOIA 1SBBB 1QZEA 1I35A 4P1CC 1V5TA 4FA6A 3AEDB 2VH1A 2CJNA 3ZJVA 4NNJB 1IPGA 1TKEA 2MJ3A 3CSTA 3MHZA 3VFKA 4NQKE 4GSWA 1A70A 4XE0A 2QC8A 5FK9C 4IDIA 2QIEB 4GU2A 1FIQA 1WH3A 4DXGA 5CHFA 2K1FA 5E6JA 2K9XA 3RZFA 2JT4B 3GZNI 4FBJB 1DYQA 2KJ6A 2O2VA 2KQSA 3AM9A 2PMVA 1C4CA 2M0AA 2V3SA 5C3JB 2PJHA 3P42A 3EA6A 3O13A 4GB9A 2KQ7A 1P3QU 2N7DA 2ZZPB 1PGXA 3QWZB 3A33B 3M95A 3KQ4A 5JXVA 2RSUA 1YD8U 2WU2B 3HHMA 2XNAC 4ICUA 1EWYC 1ZP0B 3P63A 4L23A 4P7IA 2KX0A 2KOXA 3DBHB 2WHIA 1FO4A 2DWQA 2LMCA 3Q3JA 4IM0A 1WXQA 4YSZB 4KGRA 2EKEC 2GMIC 1EWCA 3Q6BA 4K3CA 5FR6A 2LRWA 5BMGA 2KDBA 3NZ3A 3DBHI 4W9JA 2IJ0A 3NVWA 1TBEA 2LXAA 4WWOA 1KOTA 2YVCA 1A5RA 2GBRA 5D2MB 2MJEA 3DDCB 4ICVA 2FCNA 2KO3A 2EMSA 2WDTB 1MFWA 2KWVB 5AUIA 2IY1B 1C3TA 2DNFA 2J7QB 4M00A 4NAMA 3B1LX 2OHFA 4OZAA 2HJ1A 3KUZA 3RZWC 1TZ1A 1SE4A 5D7GA 2QJLA 1OQYA 3BWUD 3L13A 2W9NA 5G55A 4NJ7A 4A3OA 1L6UA 2C7MB 2GLSA 4C7ZA 5LNK1 1SIFA 4XGAB 1E7PB 1SE9A 4C7YA 1WWTA 1C78A 1SB3C 2LHDA 1IP9A 4PYUA 3N9YC 2J53A 5IKCM 2WDRB 1N5XA 2W3RA 2RMMA 4DQOC 4S17A 4CO7A 4B6WA 3PSEB 3DQVA 2L52A 3MC0B 3Q69A 4KKJA 1T0QC 2OJWA 2MQJA 1XXGA 2KVZA 3DBRB 1LM8B 4DHJD 2VRRB 2QEJC 1F2RI 3IG3A 2BYTA 2ICIA 2KD0A 4BZAA 1B9RA 1F2RC 2L05A 2AEHA 3Q8BA 3RUIB 3DBRI 2KACA 2JXXA 2JU6X 2IPKD 4FADA 1ISNA 1WX9A 3R8BA 3SDLC 2IGHA 4A6QA 1XCQL 2WXPA 5BYSA 1C4AA 3VUWA 3W1SC 1ZXIA 4RMAA 3KYCD 2EMTA 2B3AA 1R4NB 3U30A 4MM3B 4ZDVA 1GNUA 2R2OA 3NVZA 2QHOA 1MJDA 3UQBA 3VTWA 3PZ7A 1OQQA 3PLUA 2BWFA 3KH0A 4KGTA 4L2YA 5LLIA 3ZKJC 2J0MA 2NBVB 3J9CA 3E56A 1N61A 3T3NA 2LWPA 4R3DA 4MH8A 4II3B 1KLVA 4RF0A 1JALA 4ZRIA 1F52A 5FR3A 3VTVA 2DZIA 2LGSA 1YN3A 5TSSA 1QOGA 2JY6A 4MELA 2J0JA 4KSLC 3U7ZA 4ASWC 1GJZA 3MFGA 3DOWA 1E90A 2B76B 2WX0A 1WJNA 1ZGUB 3AEAB 4LLGM 5CTRC 2KQ4X 1QLBB 4I6PA 4DHZB 1XEEA 5DCNA 2D5GA 2AL6A 3GB1A 3P4QB 1PQSA 2CR5A 3HRDD 4P16A 4F7ZA 1ZXHA 2ZW0A 2ON8A 3AI5A 3NVYA 1LFDA 2NVUI 2JZ3B 2KAJA 3AE1B 1AN8A 3RNAC 3VUXA 1WZ3A 3URYA 4DBGA 2G1EA 4YT0B 1AARA 1UD7A 2RGFA 1WR1A 3ML9A 3NZUA 1S1QB 4JGHB 4G50A 3DWGC 5IA7A 3VRAB 4JQWC 1GOZA 1V5OA 2G4SA 3NY5A 1DOYA 2IO1B 3JSVA 4LTUA 2L8JA 1WRDB 1T0SC 3X23A 3JW0X 2WWZA 1WM2A 3BK2A 2N0SB 3AE6B 1TY2A 3ZGZA 2BQQA 2BKRB 2V3NA 3FILA 2AQ2B 1D6EC 1ENFA 4C4VA 2OOBB 1RFKA 3QIJA 4TV3A 3WALA 4ANUA 1IGCA 1FM0D 2KLCA 4W9CA 5D3IB 2MWSB 3I5JC 3U52E 3OJ4B 4C00A 4XDCA 4US8A 2N9LA 1XCTL 3ZW3A 3Q3FA 4B9KA 1VLBA 1RFAA 1QQRA 2V4LA 2PTLA 4LJPB 4KIKB 2Z8LA 1MVKA 4FULA 3AU4A 4W9HA 2KN5A 2AQ1B 4CHKA 4AUQC 3CF6E 4ZRPA 4HXDA 3U8ZA 1V81A 3ML8A 3I3TB 1WMHA 2JZZA 3PO0A 1WIAA 2LVQA 3N30A 4MT5A 2PVGC 1P1AA 3X0WA 4FLHA 4ITKA 3RT3B 3APFA 2EELA 3JVZX 3C8YA 2GBJA 1HXYD 2KFKB 2L1AA 2K3UA 2FIDA 2DZMA 1P9DU 1XF5L 3R66C 2MJDA 1E9MA 1N63A 1L2NA 1YN4A 3QARA 3IFWB 2D07B 3U7DA 2M19A 1T5XD 1WXMA 4YWGG 1JRUA 1NI3A 1SJHD 2QMTA 4IKGA 5C1ZA 3WCQA 4HEA1 3ZNID 1TS2A 2L0TA 2QCZA 3H6NA 2LZ6A 3AE2B 1WJ6A 4OVVA 2PEAA 3WANA 2GOWA 2IY0B 5IAAC 4DXAB 1G6JA 2AL3A 2INCC 2KK8A 4GDLB 4RGMA 1V80A 2W55A 4TQ0A 3PTFC 4IM3A 4LNFA 2ONQA 3ZNGC 1E8ZA 1Z2MA 2KJRA 4PS7A 1YMHE 2ACZB 1NEKB 2K25A 5JHAA 1OEYA 3E9SA 3Q8AA 1UUPA 4FJVB 4REZA 1ZOYB 5D94A 1P7EA 4HROA 4NY0A 3ZLZA 3V6EB 2K22A 3QQ8B 3ZJUA 4ARIA 3U2SC 4EZKA 2G9HD 5G5GA 3L17A 2WXKA 1WYGA 3RNEC 3AE4B 1RRBA 4TKNA 2KT7A 4WH4A 1Q5WB 4ZRKA 1OGWA 1XD3B 4AWJA 4FHJA 2KX3A 3GE8C 1V6EA 2A4ZA 3TL5A 4YTNB 2M17A 3DBLB 3VAWA 3PREA 1L0YB 1WGRA 2I1KA 2L7RA 1OFFA 3PS6A 2JYEA 3ZXVA 3BIID 1U4AA 4C4VB 1JMLA 3MHSD 4HVBA 1T0RC 1WX8A 1UGJA 2KC2A 4I6LB 1MI0A 1SSNA 2ZCBA 2DENB 1AWDA 4AS1A 1TS5A 3DBLI 3HIZA 5MPOA 4HRSA 2V0GA 2BYFA 1XT9B 1WE7A 1IUEA 1LQBA 2NBUA 3BK1A 4A9AA 3BYYB 3UIPB 1YQBA 2HD5B 2WX1A 2FIFA 1H7WA 2QSDA 2LJ5A 3L54A 3VRBB 2GRIA 4JWUC 1KLGD 1K51A 2IO3B 4HPMB 2UYZB 3H8HA 5CHWA 2ZEQA 3SHQA 2HTHA 1PUTA 1HZ6A 1I4PA 2AWTA 5GXGB 4KKIA 2DZKA 4W9FA 3DVNV 3AEGB 3W1SA 3DVGY 1QOBA 1I7HA 1D5XC 3ZNHB 3RULA 4HDOA 1UZXB 4LCDE 5AZFA 3KWLA 2BWES 3MJWA 1HZ5A 4HK2A 3PRZA 2KXJA 2WDVB 2C7NB 2XN9C 2FUG1 5CHVC 1DOIA 2I2YA 1FCCC 2WXHA 1E0ZA 1JWSD 2KLGA 3GZNB 5BYRA 1V1OA 3A9JB 3N32A 3APDA 4LNIA 4WWPA 4MM3A 3EHVA 4LNNA 2CHXA 3EC8A 2DAJA 2WXGA 5IO9A 2Z0EB 1V2YA 5T8IA 2JRIB 2KWCA 3L16A 4IWPA 1D5MC 2IGGA 1FRDA 4AQ7A 4N9F4 3T3OA 4IW0A 3TEXA 3OJ3A 3NS8A 3TEZA 1RYJA 4MDKE 1HQRD 1NYRA 2NMQA 4B0MA 3Q3NC 3NS1A 1PYWD 4MEMA 1L7YA 5GMVA 1WXVA 4RM8A 2ZPYA 2IYDB 4XC2A 4JX1C 3BVGA 1KLUD 3TEYA 2HJ8A 3W9CB 1M94A 2FAZA 4C80A 2XK5A 1WXAA 1HEZE 1HE8A 4BAXA 3P4PB 5DPRA 2O6VB 2R2QA 1SE3A 2KN4A 2JWUA 1VD2A 1YJ1A 1ZPSA 1AW7A 1K52A 4IOIE 2PVOD 3AE8B 3KW5B 2BBCA 2D3AA 3ETRA 2W3SA 1L6VA 1XO3A 2WXNA 3PT2B 1YJJA 3BVZA 3AMZA 1FXIA 1V49A 1IYFA 2D3GA 1X1MA 2Q5WD 3FC4A 2JVCA 2DX5B 3OG5A 5AEKB 4ANXA 2INDC 3ZTDA 1V1PA 1UBQA 1GB1A 4GMVA 4ANWA 4X57B 1E8YA 1SXTA 5H92C 4G0NB 2WNMA 1S3SG 4GN1A 1CMXB 5E6PA 3KUCB 2JPHA 4DK5A 5AZGA 5FKAC 3FAHA 4OVUA 3DBSA 1N62A 1C77A 3VVWB 2BB5A 2RDHA 4OZCA 4TSSA 2MBQA 5D3DA 3I57A 4MSQB 4WAAA 1OTRB 3L10B 4N59A 2BTEA 3JYUA 1MHXA 3L08A 1D4BA 1C76A 4KDIC 4OVZA 2R61A 4BOZB 3ZTCA 2L00B 4A20A 1TTNA 1YN5A 1PGAA 4KIKA 2KC1A 2MBOA 2K6DB 4RFBA 1WYWB 1C9FA 3NG0A 3KVFB 4MJSB 2N9XA 5DPSA 3W1YA 2V3PA 4M8NA 4NPNA 2CKHB 4QAYA 3AB5A 2MBEA 3ONSA 1FMAD 3A9KB 4J3OD 2RR9A 3NJTA 1JW9D 4G3XB 2FCMA 4TUUA 3VHTC 2MSED 4JE3B 4N58A 4OW0A 3V3XA 2KFKA 1NENB 1K53A 4JPSA 2JWZA 1L4DB 2KZRA 2ZPNA 2JUOA 4GLSC 2N1WA 3VTUA 2VH2A 4A55A 3DHIC 4TMAB 1V97A 2SEBD 5BYQA 5E6OA 3H7PB 1NYQA 3UI3A 3RNCC 1LGRA 3Q8FA 4J6IA 3VH3B 3BZDB 3N20C 5I4DA 1RAXA 4HPLB 2RDBC 2XK5B 2WS3B 3ZDMC 4HDQA 1H8CA 3W5VB 3ENEA 1FD6A 1K8RB 4HKZE 5BMIA 1FFUA 1I4RA 1Q1OA 1KF6B 3ZNZB 1RWSA 4DDGD 3VUYA 4BFRA 2RD0A 3B2GA 4JWSC 4EZJA 1KH0A 3V60A 4GDLA 1MHHE 2DYBA 4XWWA 1YQ4B 1GG3A 5KHQA 1JROA 2C60A 4C56C 3Q2AC 2DHZA 2YEPB 3IBEA 3LYYA 3N1YC 2BKFA 1YIWA 2KMMA 1F0ZA 3CIRB 2OEDA 3ZJTA 1UH6A 4NAWB 4WJOA 3PHWB 1WFYA 2RDGA 4IC7B 1UNSA 3GS2A 1P7FA 1FFVA 1HA5A 1YX6B 3NUHB 1ZUD2 2LGYA 1ZW7A 1V1PB 2ASQA 1VDVA 1Y8RC 3I9V1 2JYTA 1FPYA 1KM7A 3BVMA 3P4RB 4FJYA 1Z5SB 2N9KA 3QAQA 2AX5A 4HJKA 2VZKD 3QC8B 2JZPA 2UWQA 2BPSA 3N1XC 2GI9A 2YEPF 1CK1A 1LXDA 1WZ0A 5H8YE 4NQLB 4PYZA 3A1QB 4BKSA 5LXIB 2CU1A 3O65B 2LFIA 5BO4B 2V4IB 4A3PA 3AH7A 4LK0M 3PV1A 3AE3B 4KZ0A 1FXTB 1DOXA 2CHWA 2I38A 2G4DB 2DYOA 3H9DA 3WIMA 3QJZA 2JXTA 2IZVB 2LRUA 2KVRA 1J7AA 2BGFA 3Q3MC 2VZKB 1N60A 2ZVNA 1L5PA 2BYVE 3SFDB 2DLBA 2FUHB 3PLVA 4GOCA 2ZVOA 4I6NB 3DCGA 5HI1A 3DVNU 5HFYA 1WRIA 3EFCA 3V05A 5DPWA 2ZCCA 2FCSA 2LEKA 3IT4B 4M02A 2FE8A 4JLCA 3M3JA 3UIOB 3A9JA 2IO0B 4GXBA 2LUEA 2Z59B 2JQRB 3AECB 2L76A 3TSSA 5EE1A 3WAPA 4P6VF 2V1YA 4WQOB 4XYCA 4NJ6A 4EKUA 1ZKHA 1N5WA 3PPAA 4DXFA 5DPTA 3HM3A 1SEBD 3OAWA 3TCAA 1Q0WB 3QX1A 2K8BA 3Q8CA 5AZHA 1C4PA 3IXSA 3ZRFA 4EE2A 3W2DA 2KDFB 4E74A 3GOEA 2LGDA 1UBIA 4IWQA 1WXSA 3PRPB 4MGIE 5EDSA 4URKA 1H7XA 3B0AA 2GBMA 3C0RB 3V61A 3H7SA 3HK0A 3PRMB 2KTRB 2LVPA 5EE9A 2C9WB 5HG2A 3AE7B 4BKSD 2O6VA 1STEA 2WXOA 3PZ8A 1FNWA 2L83A 4CQNA 2WXJA 3TMPB 1NDDA 5J2RA 4HPPA 3MJ5A 4WWMA 3L0WB 2BYEA 2N9EB 4KZCA 2IO2B 4ZYSA 1TYGB 3IVFA 2H88B 4KGSA 2D3BA 4MGKE 2CU3A 4PS3A 1SF0A 4K7SA 4HLEA 4XWTA 3L4PA 4EUTA 4EFOA 4RGNA 3QHTA 1TS4A 2GBKA 3NRZA 2LVOA 2WU5B 3DHGC 3BY4B 1MG4A 2FCQA 3V6CB 4II2B 2MBHA 2WLBA 1LO5D 3TJPA 1EM7A 2WDQB 4S0RA 3KLSX 3VQIA 2BVCA 5C2TB 1PDXA 3R7RA 3AV8A 2N4FA 3RNBC 4B0EA 1E8XA 1ZDVA 1NI2A 2NBWB 1KTKA 4K7UA 3IAM1 2MW5A 2PLPA 2MX2A 2M8SA 1J0GA 4BVUC 2Y3AA 4EZLA 2JX5A 2K39A 1WJUA 1JQ4A 5JHBA 3DPDA 4P1BC 3P2BA 2KYWA 4B95A 2KANA 1P98A 2BF8B 4NZLB 1VRAB 3AE5B 4W9IA 1TS3A 3T9LA 2GB1A 4MJSA 1GC7A 1Y56A 4W9KA 2V9HA 2LASA 5LXHA 3CMMB 4ACFA 3IAS1 3R3MA 4HCPB 3IT6B 3KWVA 1VR9A 1J19A 4ZHOA 4KX6B 4ANVA 3RN9C 3A9KA 3ALBA 2Z0DB 4RCOA 4YXDB 1GC6A 4L1BA 2UU7A 2N9PC 2W54A 4WJQA 4YSXB 2K0PA 3FKYA 2O6VD 2WP9B 4M0WB 2M4NA 2CS4A 3UF8A
chains in the Genus database with same CATH topology
1D6EC 1JRPA 4RH6A 3GP7A 4RFBA 1JWUD 4NJCA 1ENFA 2WXFA 1RFKA 1C9FA 3SFEB 3AEBB 1IGCA 1FM0D 2V3PA 1K50A 5D3IB 3U52E 2AQ3B 3AB5A 2BS4B 4J3OD 4XDCA 1FMAD 3SR6A 4US8A 2N9LA 1XCTL 1XLNA 1PFDA 1SE2A 1GTHA 1JW9D 3HVDA 4RGOS 2LUMA 4JE3B 4N58A 1VLBA 1CZPA 1L4ZB 4OW0A 2K5PA 3VR9B 3V3XA 3VR8B 1QQRA 2PTLA 1NENB 2WXRA 1CQVA 1K53A 3FILB 2Z8LA 4JPSA 1YJIA 1L4DB 1ZE3D 3RPFC 1MVKA 4A90A 1VZ8A 4HJGE 4GLSC 4A55A 2AQ1B 2BW2A 2KDMA 4TMAB 2E6XA 1V97A 1IBXA 4ZRPA 2SEBD 5BYQA 1ESFA 4A8XC 1BUIC 2W82A 1EU3A 1NYQA 2N7JA 3UI3A 2E3TA 4GDKB 1QKZA 1FXAA 2MEKA 3Q8FA 3PO0A 1TJEA 4H2AA 1JWMD 1FNUA 2WXLA 3BZDB 3BYTB 5I4DA 4MT5A 2PVGC 2JSVX 2LGIA 2M56B 4ITKA 2EELA 3MP9A 2WS3B 4ZOHC 3P4SB 2ZW1A 2IGDA 4ZRQA 3C8YA 3W5VB 1C79A 1UWXA 1FD6A 1XLOA 1I4GA 2DBYA 4HKZE 5BMIA 1FFUA 1I4RA 1KF6B 1HXYD 1RWSA 1AYFA 1L0XB 2HDEA 2L1AA 2K3UA 1OQRA 3B2GA 4JWSC 1KH0A 1XF5L 4PT5A 2MJDA 1E9MA 1MHHE 3R2IA 4XWWA 1YQ4B 1XLQA 1I4HA 1N63A 1JROA 1YN4A 4C56C 1IBXB 2BT6A 2EKIA 2J52A 2YEPB 3R2TA 3TEWA 1DGJA 1GPXA 3LYYA 1I4QA 2M19A 1T5XD 4MACA 2KMMA 1F0ZA 1VZ6A 3CIRB 4YWGG 2OEDA 1NI3A 1XLPA 1UWMA 3ZJTA 1SJHD 2QMTA 4IKGA 4NAWB 4US9A 2Y5CA 3WCQA 4HEA1 1TS2A 2RDGA 2BS2B 1UNSA 3GS2A 3EGRA 1P7FA 1FFVA 3AE2B 1HA5A 1SJED 1TKYA 4WIPA 1R7SA 1SBBB 3NUHB 1ZUD2 1ROEA 3AEDB 2CJNA 3ZJVA 1V1PB 4O1NA 4GDLB 4RGMA 2LJIA 1VDVA 2W55A 4TQ0A 4N6EB 1ET6A 3ZQ4A 1TKEA 2MJ3A 3MHZA 2ONQA 3I9V1 2JYTA 1A70A 4XE0A 3BVMA 4RGTA 1TKGA 3P4RB 5FK9C 4IDIA 1YMHE 2QIEB 2BB6A 2ACZB 1FIQA 1NEKB 1V8CA 2SAKA 3E9SA 2N9KA 4DXGA 2AX5A 3Q8AA 1UUPA 2VZKD 4REZA 5E6JA 2JZPA 3RFZB 1ZOYB 2K9XA 4TQ1A 1P7EA 4HROA 4OZBA 1DYQA 3HVZA 2GI9A 2K22A 3B2FA 2YEPF 4ARCA 1PGBA 1CK1A 3AM9A 2PMVA 3ZJUA 1C4CA 2M0AA 4ARIA 5C3JB 5H8YE 3U2SC 1VJKA 2G9HD 2NTTA 5G5GA 3P42A 2LFIA 2WXKA 1WYGA 3EA6A 3AE4B 2V4IB 1GTEA 3O13A 3AH7A 4WH4A 1PGXA 2TSSA 4LK0M 3AE3B 3AEEB 1DOXA 3AEFB 2L32A 2I38A 3NVVA 3KQ4A 2DYOA 5JXVA 4YTNB 2WU2B 2JXTA 2XNAC 2WXQA 1L0YB 1EWYC 1ZP0B 1OFFA 2JYEA 3P63A 4L23A 3BIID 5EE3A 1J7AA 2VZKB 1JMLA 1N60A 3W5UB 4FXCA 2INPE 1YNTE 1UGJA 2DWQA 2MH7A 1FO4A 1MI0A 2LMCA 1SSNA 1L5PA 1AWDA 1WXQA 4YSZB 3ZYYX 4AS1A 3SFDB 1TS5A 4KGRA 5MPOA 1EWCA 4HRSA 2DLBA 2V0GA 5BMGA 3NZ3A 1ZDXA 1IUEA 1WSPA 1KRHA 2IJ0A 3NVWA 4RF1A 3BK1A 4A9AA 5HI1A 1WGKA 3BYYB 5HFYA 1H7WA 3DWMA 2QSDA 1WRIA 2MJEA 1T3QA 3V05A 5AUIA 3VRBB 2DYMA 1CJEA 2GRIA 2LEKA 4JWUC 1KLGD 1K51A 3H8HA 3IT4B 2IDYA 4NAMA 2FE8A 1PUTA 2OHFA 1HZ6A 4OZAA 2QILA 3AE9B 1I4PA 2JQRB 2J4XA 5GXGB 1SE4A 5D7GA 3AECB 2QJLA 4KKIA 1Q10A 3TSSA 3BWUD 1FNVA 5EE1A 4RNAA 4P6VF 3AEGB 3W1SA 1JCKB 1N5WA 1QOBA 1I7HA 1L6UA 1D5XC 4DXFA 4C7ZA 5LNK1 1E7PB 1FRRA 3KWLA 1SEBD 1HZ5A 2PW9A 4C7YA 1WWTA 2WDVB 1C78A 1SB3C 2LHDA 3Q8CA 1C4PA 2XN9C 3IXSA 3N9YC 3CF4A 2J53A 2FUG1 1DOIA 2WDRB 1N5XA 2W3RA 1L0VB 4EE2A 2I2YA 1JWBD 1E6EB 2RMMA 1QF6A 4DQOC 1FCCC 2WXHA 1E0ZA 1JWSD 3W2DA 2L52A 3MC0B 3Q69A 5BYRA 4KKJA 4ZHPA 1V1OA 4Q2JA 1XXGA 1TZOA 3TUOA 1J7CA 2QEJC 1F2RI 4HKQA 1H7XA 2WXGA 1I4XA 2BYTA 5T8IA 2ICIA 1B9RA 1QOAA 1D5MC 1F2RC 2NTSA 4YTPB 2IGGA 1FRDA 1QOFA 3HUIA 5EE9A 4AQ7A 3Q8BA 5HG2A 4WQMA 2INNE 3AE7B 2KACA 3T3OA 2JU6X 2IPKD 3TEXA 3OWEB 3TEZA 1RYJA 1STEA 2WXOA 3PZ8A 1FNWA 2L83A 4CQNA 1HQRD 1NYRA 2WXJA 3R8BA 1F77A 2NMQA 2IGHA 4A6QA 4B0MA 3LXFA 1XCQL 3NS1A 2WXPA 5BYSA 3MJ5A 2J42A 3CWIA 1C4AA 1PYWD 4WWMA 1ZXIA 1FCLA 2RPVA 4USAA 4ZYSA 1TYGB 1YQ3B 4JX1C 3BVGA 1KLUD 2BS3B 2H88B 4MM3B 3TEYA 4KGSA 5BMHA 2WXMA 3W9CB 3NVZA 1RM6C 3PZ7A 1BMLC 1OQQA 4C80A 2CU3A 1TY0A 1SF0A 1HEZE 3P4PB 4XDDA 4XWTA 3L4PA 4KGTA 4L2YA 4RGNA 4YTMB 1NVID 1SE3A 1TS4A 3J9CA 2KN4A 3E56A 1N61A 3T3NA 2JWUA 5HHDG 4R3DA 3NRZA 5G5HA 4MH8A 1FEHA 1ZPSA 2WU5B 1GB4A 3SEBA 1AW7A 1JALA 1K52A 4IOIE 4OHJA 4RF0A 2WLBA 1LO5D 2PVOD 5FR3A 3AE8B 1EM7A 2WDQB 1YN3A 5TSSA 1QOGA 3KLSX 3VQIA 5C2TB 1PDXA 2BBCA 1D5ZC 3AV8A 3ABVB 3ETRA 2W3SA 3U7ZA 2FBWB 1L6VA 4B0EA 1ZDVA 1XO3A 2WQYB 2WXNA 3MFGA 1KTKA 2B76B 1ACCA 1YJJA 3BVZA 3AMZA 1QILA 3IAM1 1MPEA 3AEAB 4LLGM 1FXIA 2PIAA 2PLPA 2KQ4X 1E10A 1QLBB 1B1ZA 2HTME 1XEEA 2D5GA 3LB8C 2Q5WD 3GB1A 2Y3AA 3FC4A 3P4QB 2JX5A 5EE0A 2WXIA 3HRDD 3P1MA 1JQ4A 1V1PA 4P16A 1GB1A 1VZ7A 1ZXHA 2ZW0A 2ON8A 3NVYA 1QT9A 1GAQB 1T6BX 1KFYB 1SXTA 5H92C 2WNMA 4WAFA 4M0WA 4NZLB 1BXTA 2KAJA 3AE1B 4UDUC 1AN8A 1EU4A 3EUB2 5FKAC 1VRAB 3FAHA 3AE5B 3URYA 1N62A 1TS3A 3B9JA 5AUKA 2G1EA 4YT0B 2GB1A 1C77A 2Y5PA 4WURA 2BB5A 1Y56A 3AN1A 2RDHA 4OZCA 3IAS1 2H89B 3Q8EA 3DWGC 4TSSA 3IT6B 3VRAB 3KWVA 4D2KA 1GOZA 2LHEA 1VR9A 5D3DA 3I57A 1GT8A 4YSYB 4ZHOA 1DOYA 4KX6B 3U4EG 4LTUA 2CJOA 4N59A 2BTEA 4RCOA 1ET9A 1J7BA 4YXDB 1MHXA 3BK2A 2PKOA 4L1BA 2N0SB 1M4VA 1D4BA 1JWAD 2W54A 1C76A 4YSXB 3AE6B 2K0PA 4OVZA 2R61A 1TY2A 3ZGZA 1SIJA 1YN5A 1PGAA 2V3NA 2X38A 2WP9B 1IGDA 3FILA 2KWDA 2AQ2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUI A;  3VRB B;  1SF0 A;  2BS2 B;  1CJE A;  1JRP A;  3P4P B;  2LEK A;  4JWU C;  3L4P A;  1FFV A;  3AE2 B;  1TKY A;  1RFK A;  4YTM B;  1R7S A;  3SFE B;  3AEB B;  1NVI D;  1FM0 D;  1N61 A;  1ZUD 2;  1ROE A;  3AED B;  1PUT A;  2CJN A;  3NRZ A;  5G5H A;  2OHF A;  1VDV A;  3AE9 B;  2W55 A;  3W5V B;  2WU5 B;  4N6E B;  1TKE A;  2JQR B;  1JAL A;  2MJ3 A;  3AB5 A;  2BS4 B;  5GXG B;  3AEC B;  2QJL A;  4US8 A;  1FMA D;  3SR6 A;  2WLB A;  1A70 A;  2PVO D;  1TKG A;  3AE8 B;  3P4R B;  1XLN A;  5EE1 A;  1PFD A;  2WDQ B;  4P6V F;  3AEG B;  1GTH A;  1JW9 D;  2QIE B;  1QOG A;  4IDI A;  2ACZ B;  1FIQ A;  1NEK B;  1V8C A;  4N58 A;  5C2T B;  1N5W A;  1PDX A;  1I7H A;  1L6U A;  1QOB A;  1VLB A;  3AV8 A;  3ABV B;  1CZP A;  4C7Z A;  3ETR A;  2AX5 A;  2K5P A;  2W3S A;  1E7P B;  2FBW B;  1FRR A;  1L6V A;  3VR9 B;  3KWL A;  1ZOY B;  1XO3 A;  2WQY B;  2K9X A;  3VR8 B;  4C7Y A;  1WWT A;  2WDV B;  1SB3 C;  4HRO A;  1NEN B;  3HVZ A;  2B76 B;  2K22 A;  1YJJ A;  3B2F A;  1YJI A;  3AMZ A;  3AEA B;  3CF4 A;  3AM9 A;  3RPF C;  1FXI A;  2PIA A;  1E10 A;  1DOI A;  1QLB B;  2WDR B;  5C3J B;  1N5X A;  1L0V B;  1VJK A;  2W3R A;  5H8Y E;  5AUK A;  1JWB D;  1E6E B;  2HTM E;  1QF6 A;  3LB8 C;  1V97 A;  2Q5W D;  3FC4 A;  5G5G A;  1E0Z A;  3P4Q B;  2JX5 A;  5EE0 A;  1WYG A;  3AE4 B;  1GTE A;  2L52 A;  3HRD D;  1NYQ A;  3P1M A;  1JQ4 A;  2E3T A;  3AH7 A;  1FXA A;  4ZHP A;  3PO0 A;  1TJE A;  3NVY A;  3AE3 B;  3AEE B;  1QT9 A;  1DOX A;  3AEF B;  1GAQ B;  1J7C A;  1KFY B;  5H92 C;  1H7X A;  3NVV A;  2PVG C;  2KAJ A;  3AE1 B;  2M56 B;  4ITK A;  4YTN B;  1B9R A;  3EUB 2;  2WU2 B;  1QOA A;  2WS3 B;  4YTP B;  3FAH A;  3AE5 B;  3P4S B;  1EWY C;  4ZOH C;  1ZP0 B;  1FRD A;  1N62 A;  1QOF A;  1OFF A;  2G1E A;  4YT0 B;  3B9J A;  3HUI A;  3P63 A;  1XLO A;  3BII D;  2DBY A;  4WQM A;  5EE3 A;  3AE7 B;  1J7A A;  1FFU A;  1KF6 B;  3AN1 A;  1RWS A;  1N60 A;  1AYF A;  4FXC A;  3W5U B;  1OQR A;  1RYJ A;  3B2G A;  4JWS C;  1FO4 A;  2DWQ A;  2H89 B;  2MH7 A;  3DWG C;  2L83 A;  3VRA B;  1NYR A;  2MJD A;  1L5P A;  1AWD A;  1E9M A;  5EE9 A;  1GT8 A;  4YSZ B;  1WXQ A;  1YQ4 B;  4YSY B;  3SFD B;  1XLQ A;  4KX6 B;  3LXF A;  3ZYY X;  3NS1 A;  4ZHO A;  1DOY A;  4LTU A;  5MPO A;  2CJO A;  1N63 A;  1JRO A;  3CWI A;  4HRS A;  4WWM A;  2BT6 A;  2EKI A;  4N59 A;  1ZXI A;  1J7B A;  4YXD B;  1DGJ A;  1GPX A;  2PKO A;  1IUE A;  4USA A;  2N0S B;  1KRH A;  1JWA D;  1TYG B;  2W54 A;  3NVW A;  1YQ3 B;  2M19 A;  4A9A A;  4YSX B;  3AE6 B;  4JX1 C;  2BS3 B;  2H88 B;  1WGK A;  2KMM A;  1F0Z A;  3CIR B;  1SIJ A;  1NI3 A;  1H7W A;  1XLP A;  1UWM A;  3NVZ A;  3W9C B;  1RM6 C;  3DWM A;  2WP9 B;  1WRI A;  2MJE A;  4US9 A;  2Y5C A;  1OQQ A;  1T3Q A;  4C80 A;  3WCQ A;  2CU3 A; 
#chains in the Genus database with same CATH topology
 2JF5 A;  2IBI B;  3PGE A;  1JRP A;  1RLF A;  4RH6 A;  2D10 A;  1JWU D;  2KNB A;  3SFE B;  3AEB B;  1YX5 B;  4FN2 A;  3H7P A;  2GBN A;  3VDZ A;  4AOF A;  1TGZ B;  2MP2 A;  3RNG C;  2AQ3 B;  1WGH A;  2BS4 B;  4PK1 A;  4MH0 E;  3SR6 A;  2REX A;  1PFD A;  1SE2 A;  4K81 A;  2LUM A;  5C23 A;  3T8M A;  1L4Z B;  3VR8 B;  2XBB C;  2WXR A;  3B08 A;  1CQV A;  5G2N A;  2G45 B;  1YJI A;  1ZE3 D;  2N7E A;  3RPF C;  2NPT B;  3TIX A;  2BW2 A;  3SU8 X;  2E6X A;  3A4S C;  3I63 C;  3MC9 A;  1ESF A;  2G3Q B;  4A8X C;  2NS5 A;  4HCN B;  2W82 A;  1E7U A;  4K7W A;  2PE9 A;  4GDK B;  1QKZ A;  2M0X A;  1WI0 A;  4ZYN A;  3VXW A;  2WXL A;  4NAW A;  4KV2 A;  2LGI A;  2M56 B;  3MP9 A;  2NR2 A;  1KJT A;  3K9P B;  2ZW1 A;  2IGD A;  3QA8 A;  4BKG A;  1NBF C;  1L0X B;  1WF9 A;  2HDE A;  1XLQ A;  1I4H A;  2LD9 A;  4F1S A;  2D11 A;  1IBX B;  1XQQ A;  2EKI A;  3RYT A;  2J52 A;  3M62 B;  1WGD A;  2OJR A;  2JRH A;  3LDZ E;  1VZ6 A;  3UQA A;  5HKH A;  1UWM A;  2K8H A;  4BOS C;  3VH4 B;  2MRP A;  2K8C A;  2Y5B B;  3A1Q A;  1R7S A;  4JL9 A;  4RM9 A;  1VCB A;  1ROE A;  3EFU A;  4O1N A;  4F8C B;  2LJI A;  4MSM B;  4N6E B;  1ET6 A;  3ZO5 B;  3ZQ4 A;  1D3Z A;  3Q14 C;  4EEW A;  4RGT A;  1TKG A;  3UGB B;  1T0Y A;  3M63 B;  2BB6 A;  1MG8 A;  1TT5 B;  1V8C A;  2SAK A;  3OLM D;  3RFZ B;  4TQ1 A;  4OZB A;  4AJW A;  5L83 A;  3HVZ A;  3B2F A;  3RMK C;  1PGB A;  4ARC A;  1WY8 A;  5J17 A;  1VJK A;  3NOB A;  2NTT A;  2D2Q A;  1GTE A;  4CYE A;  3H1U A;  2TSS A;  3ZRC A;  3AEE B;  2HE7 A;  3AEF B;  2L32 A;  3NVV A;  3BIN A;  3QK0 A;  3ZVV A;  2WXQ A;  3N3K B;  5EE3 A;  1J8C A;  4DHJ B;  3W5U B;  4FXC A;  2INP E;  1YNT E;  2MH7 A;  2O2V B;  3HM6 X;  3C19 A;  1R4N I;  2AYO B;  3ZYY X;  2MP2 B;  2NCN A;  2RPQ A;  2KTF A;  1HTO A;  3KUD B;  4MGZ E;  1ZDX A;  2MA9 B;  1WSP A;  1KRH A;  3APC A;  4RF1 A;  1WGK A;  3DWM A;  1T3Q A;  5J18 A;  4LNK A;  1E8W A;  2DYM A;  1CJE A;  4LDT D;  2MHJ A;  4M01 A;  2IDY A;  5JH5 C;  1UF0 A;  2KMC A;  2QIL A;  3AE9 B;  2J4X A;  4JIO U;  4AP4 C;  1Q10 A;  4AJY B;  1FNV A;  4RNA A;  4LJO B;  4DWF A;  4WJN A;  1JCK B;  2KTR A;  1TIF A;  1FRR A;  2KDE B;  2PW9 A;  1F9J A;  1EF5 A;  5IN7 A;  3CF4 A;  2KKC A;  1L0V B;  1JWB D;  1E6E B;  3AUL A;  1WGY A;  4LDT B;  1QF6 A;  2M1M A;  1WE6 A;  2PE6 B;  1WX7 A;  2FNJ B;  2WGS A;  4M8M A;  1EUV B;  1UGM A;  4W9E A;  4ZHP A;  2KJH B;  4Q2J A;  4LNO A;  1TZO A;  3TUO A;  4XX5 A;  1J7C A;  4HKQ A;  1I4X A;  3TBL D;  4IM2 A;  3CSF A;  1QOA A;  2NTS A;  4YTP B;  1GUA B;  1QOF A;  3HUI A;  4W9D A;  4WQM A;  2INN E;  3PZD A;  3OWE B;  2DZJ A;  4PS8 A;  1F77 A;  1P0R A;  4K3B A;  3LXF A;  3ZIM A;  2J42 A;  3CWI A;  4FJZ A;  4EOY A;  1FCL A;  2RPV A;  4USA A;  2LGX A;  2KDI A;  3KYD D;  1YQ3 B;  2BS3 B;  5BMH A;  2YLM A;  2WXM A;  1N6Z A;  1RM6 C;  2QDF A;  1BML C;  4XZ4 A;  1TY0 A;  4XDD A;  5JZE B;  4YTM B;  3ZDT A;  1NVI D;  1UEL A;  3NZS A;  3R7Q A;  3DHH C;  5HHD G;  4IG7 B;  5G5H A;  3S2A A;  1FEH A;  4YL8 A;  1GB4 A;  3SEB A;  4OHJ A;  2J0K A;  1YOV B;  1E7V A;  2ZJD A;  5CX3 A;  1D5Z C;  3A4R A;  3ABV B;  2C7H A;  4DHZ E;  2FBW B;  2WQY B;  5TR5 A;  4WJP A;  1WM3 A;  1ACC A;  3WAO A;  1QIL A;  1MPE A;  2PIA A;  1E10 A;  1B1Z A;  2HTM E;  3LB8 C;  4KDL B;  5EE0 A;  3RCZ A;  2WXI A;  2X8X X;  3P1M A;  2MBB B;  1OEY J;  1VZ7 A;  4BBN C;  2LXC A;  1QT9 A;  3SD5 A;  4KVG B;  1GAQ B;  1T6B X;  1KFY B;  2D3C A;  4WAF A;  4M0W A;  1BXT A;  2L3Z A;  4UDU C;  1EU4 A;  3EUB 2;  2KWU B;  3Q3O C;  3B9J A;  5AUK A;  1V9J A;  2Y5P A;  4WUR A;  1WJ4 A;  3AN1 A;  2CHZ A;  1R4M B;  2H89 B;  3PHX B;  3Q8E A;  4D2K A;  5L95 C;  2LHE A;  1GT8 A;  4YSY B;  4BBN F;  2K6Q A;  3U4E G;  2CJO A;  2PPH A;  2A5U A;  1ET9 A;  1J7B A;  1EO6 A;  2PKO A;  1R4M I;  1M4V A;  1JWA D;  2L0F A;  1SIJ A;  3WA0 A;  2X38 A;  1IGD A;  2N1V A;  2KWD A;  1H4R A;  3V62 A;  2NPT A;  2I1J A;  1HTQ A;  3GP7 A;  4NJC A;  2WXF A;  3DVG X;  4DDI D;  3NHE B;  1WGG A;  4GDK A;  1SGH A;  1K50 A;  3PVL A;  3AU5 A;  4WWN A;  3JSV B;  4GGQ A;  1WR6 E;  1XLN A;  2KHW B;  4E3C A;  1GTH A;  3HVD A;  4RGO S;  4IUM B;  3D32 A;  4BKT A;  1CZP A;  2WYQ A;  2K5P A;  3VR9 B;  3N1Z C;  3FIL B;  4E71 A;  3EEC A;  4IWO A;  4W9G A;  4A90 A;  1VZ8 A;  4HJG E;  1F1H A;  2KDM A;  2ZNV B;  5E6N A;  3K9O B;  1IBX A;  3RI7 C;  3IHP C;  4ZRJ A;  1BUI C;  1EU3 A;  3ECI A;  2N7J A;  4K1R B;  1BT0 A;  2E3T A;  4W9L A;  1FXA A;  2MEK A;  3AXC A;  1TJE A;  4H2A A;  2MCN B;  1JWM D;  1FNU A;  3RD2 A;  3BYT B;  3WAM A;  2JSV X;  4ZOH C;  2ZNV C;  3P4S B;  4ZRQ A;  2KFJ A;  4G11 A;  1C79 A;  1UWX A;  2LI5 A;  3QCA A;  1XLO A;  1I4G A;  2DBY A;  4FHK A;  5IP4 D;  1AYF A;  5KHO A;  1OQR A;  1E5W A;  4PT5 A;  4KSK C;  4GIV A;  3R2I A;  3MTN B;  3MC8 A;  4MGY E;  2BT6 A;  3UIN B;  3R2T A;  3TEW A;  1DGJ A;  3GE3 C;  1GPX A;  1I4Q A;  2MLB A;  2XEW A;  1WMH B;  1V86 A;  3LJ3 A;  4MAC A;  2KMA A;  3RNF C;  3ZUN A;  4HWI B;  1I42 A;  1XLP A;  4US9 A;  2Y5C A;  2DAF A;  1EF1 A;  3ZXR A;  2BS2 B;  1C1Y B;  5D6J B;  3EGR A;  1SJE D;  1TKY A;  4WIP A;  2C5L C;  5IOI A;  1SBB B;  1QZE A;  1I35 A;  4P1C C;  1V5T A;  4FA6 A;  3AED B;  2VH1 A;  2CJN A;  3ZJV A;  4NNJ B;  1IPG A;  1TKE A;  2MJ3 A;  3CST A;  3MHZ A;  3VFK A;  4NQK E;  4GSW A;  1A70 A;  4XE0 A;  2QC8 A;  5FK9 C;  4IDI A;  2QIE B;  4GU2 A;  1FIQ A;  1WH3 A;  4DXG A;  5CHF A;  2K1F A;  5E6J A;  2K9X A;  3RZF A;  2JT4 B;  3GZN I;  4FBJ B;  1DYQ A;  2KJ6 A;  2O2V A;  2KQS A;  3AM9 A;  2PMV A;  1C4C A;  2M0A A;  2V3S A;  5C3J B;  2PJH A;  3P42 A;  3EA6 A;  3O13 A;  4GB9 A;  2KQ7 A;  1P3Q U;  2N7D A;  2ZZP B;  1PGX A;  3QWZ B;  3A33 B;  3M95 A;  3KQ4 A;  5JXV A;  2RSU A;  1YD8 U;  2WU2 B;  3HHM A;  2XNA C;  4ICU A;  1EWY C;  1ZP0 B;  3P63 A;  4L23 A;  4P7I A;  2KX0 A;  2KOX A;  3DBH B;  2WHI A;  1FO4 A;  2DWQ A;  2LMC A;  3Q3J A;  4IM0 A;  1WXQ A;  4YSZ B;  4KGR A;  2EKE C;  2GMI C;  1EWC A;  3Q6B A;  4K3C A;  5FR6 A;  2LRW A;  5BMG A;  2KDB A;  3NZ3 A;  3DBH I;  4W9J A;  2IJ0 A;  3NVW A;  1TBE A;  2LXA A;  4WWO A;  1KOT A;  2YVC A;  1A5R A;  2GBR A;  5D2M B;  2MJE A;  3DDC B;  4ICV A;  2FCN A;  2KO3 A;  2EMS A;  2WDT B;  1MFW A;  2KWV B;  5AUI A;  2IY1 B;  1C3T A;  2DNF A;  2J7Q B;  4M00 A;  4NAM A;  3B1L X;  2OHF A;  4OZA A;  2HJ1 A;  3KUZ A;  3RZW C;  1TZ1 A;  1SE4 A;  5D7G A;  2QJL A;  1OQY A;  3BWU D;  3L13 A;  2W9N A;  5G55 A;  4NJ7 A;  4A3O A;  1L6U A;  2C7M B;  2GLS A;  4C7Z A;  5LNK 1;  1SIF A;  4XGA B;  1E7P B;  1SE9 A;  4C7Y A;  1WWT A;  1C78 A;  1SB3 C;  2LHD A;  1IP9 A;  4PYU A;  3N9Y C;  2J53 A;  5IKC M;  2WDR B;  1N5X A;  2W3R A;  2RMM A;  4DQO C;  4S17 A;  4CO7 A;  4B6W A;  3PSE B;  3DQV A;  2L52 A;  3MC0 B;  3Q69 A;  4KKJ A;  1T0Q C;  2OJW A;  2MQJ A;  1XXG A;  2KVZ A;  3DBR B;  1LM8 B;  4DHJ D;  2VRR B;  2QEJ C;  1F2R I;  3IG3 A;  2BYT A;  2ICI A;  2KD0 A;  4BZA A;  1B9R A;  1F2R C;  2L05 A;  2AEH A;  3Q8B A;  3RUI B;  3DBR I;  2KAC A;  2JXX A;  2JU6 X;  2IPK D;  4FAD A;  1ISN A;  1WX9 A;  3R8B A;  3SDL C;  2IGH A;  4A6Q A;  1XCQ L;  2WXP A;  5BYS A;  1C4A A;  3VUW A;  3W1S C;  1ZXI A;  4RMA A;  3KYC D;  2EMT A;  2B3A A;  1R4N B;  3U30 A;  4MM3 B;  4ZDV A;  1GNU A;  2R2O A;  3NVZ A;  2QHO A;  1MJD A;  3UQB A;  3VTW A;  3PZ7 A;  1OQQ A;  3PLU A;  2BWF A;  3KH0 A;  4KGT A;  4L2Y A;  5LLI A;  3ZKJ C;  2J0M A;  2NBV B;  3J9C A;  3E56 A;  1N61 A;  3T3N A;  2LWP A;  4R3D A;  4MH8 A;  4II3 B;  1KLV A;  4RF0 A;  1JAL A;  4ZRI A;  1F52 A;  5FR3 A;  3VTV A;  2DZI A;  2LGS A;  1YN3 A;  5TSS A;  1QOG A;  2JY6 A;  4MEL A;  2J0J A;  4KSL C;  3U7Z A;  4ASW C;  1GJZ A;  3MFG A;  3DOW A;  1E90 A;  2B76 B;  2WX0 A;  1WJN A;  1ZGU B;  3AEA B;  4LLG M;  5CTR C;  2KQ4 X;  1QLB B;  4I6P A;  4DHZ B;  1XEE A;  5DCN A;  2D5G A;  2AL6 A;  3GB1 A;  3P4Q B;  1PQS A;  2CR5 A;  3HRD D;  4P16 A;  4F7Z A;  1ZXH A;  2ZW0 A;  2ON8 A;  3AI5 A;  3NVY A;  1LFD A;  2NVU I;  2JZ3 B;  2KAJ A;  3AE1 B;  1AN8 A;  3RNA C;  3VUX A;  1WZ3 A;  3URY A;  4DBG A;  2G1E A;  4YT0 B;  1AAR A;  1UD7 A;  2RGF A;  1WR1 A;  3ML9 A;  3NZU A;  1S1Q B;  4JGH B;  4G50 A;  3DWG C;  5IA7 A;  3VRA B;  4JQW C;  1GOZ A;  1V5O A;  2G4S A;  3NY5 A;  1DOY A;  2IO1 B;  3JSV A;  4LTU A;  2L8J A;  1WRD B;  1T0S C;  3X23 A;  3JW0 X;  2WWZ A;  1WM2 A;  3BK2 A;  2N0S B;  3AE6 B;  1TY2 A;  3ZGZ A;  2BQQ A;  2BKR B;  2V3N A;  3FIL A;  2AQ2 B;  1D6E C;  1ENF A;  4C4V A;  2OOB B;  1RFK A;  3QIJ A;  4TV3 A;  3WAL A;  4ANU A;  1IGC A;  1FM0 D;  2KLC A;  4W9C A;  5D3I B;  2MWS B;  3I5J C;  3U52 E;  3OJ4 B;  4C00 A;  4XDC A;  4US8 A;  2N9L A;  1XCT L;  3ZW3 A;  3Q3F A;  4B9K A;  1VLB A;  1RFA A;  1QQR A;  2V4L A;  2PTL A;  4LJP B;  4KIK B;  2Z8L A;  1MVK A;  4FUL A;  3AU4 A;  4W9H A;  2KN5 A;  2AQ1 B;  4CHK A;  4AUQ C;  3CF6 E;  4ZRP A;  4HXD A;  3U8Z A;  1V81 A;  3ML8 A;  3I3T B;  1WMH A;  2JZZ A;  3PO0 A;  1WIA A;  2LVQ A;  3N30 A;  4MT5 A;  2PVG C;  1P1A A;  3X0W A;  4FLH A;  4ITK A;  3RT3 B;  3APF A;  2EEL A;  3JVZ X;  3C8Y A;  2GBJ A;  1HXY D;  2KFK B;  2L1A A;  2K3U A;  2FID A;  2DZM A;  1P9D U;  1XF5 L;  3R66 C;  2MJD A;  1E9M A;  1N63 A;  1L2N A;  1YN4 A;  3QAR A;  3IFW B;  2D07 B;  3U7D A;  2M19 A;  1T5X D;  1WXM A;  4YWG G;  1JRU A;  1NI3 A;  1SJH D;  2QMT A;  4IKG A;  5C1Z A;  3WCQ A;  4HEA 1;  3ZNI D;  1TS2 A;  2L0T A;  2QCZ A;  3H6N A;  2LZ6 A;  3AE2 B;  1WJ6 A;  4OVV A;  2PEA A;  3WAN A;  2GOW A;  2IY0 B;  5IAA C;  4DXA B;  1G6J A;  2AL3 A;  2INC C;  2KK8 A;  4GDL B;  4RGM A;  1V80 A;  2W55 A;  4TQ0 A;  3PTF C;  4IM3 A;  4LNF A;  2ONQ A;  3ZNG C;  1E8Z A;  1Z2M A;  2KJR A;  4PS7 A;  1YMH E;  2ACZ B;  1NEK B;  2K25 A;  5JHA A;  1OEY A;  3E9S A;  3Q8A A;  1UUP A;  4FJV B;  4REZ A;  1ZOY B;  5D94 A;  1P7E A;  4HRO A;  4NY0 A;  3ZLZ A;  3V6E B;  2K22 A;  3QQ8 B;  3ZJU A;  4ARI A;  3U2S C;  4EZK A;  2G9H D;  5G5G A;  3L17 A;  2WXK A;  1WYG A;  3RNE C;  3AE4 B;  1RRB A;  4TKN A;  2KT7 A;  4WH4 A;  1Q5W B;  4ZRK A;  1OGW A;  1XD3 B;  4AWJ A;  4FHJ A;  2KX3 A;  3GE8 C;  1V6E A;  2A4Z A;  3TL5 A;  4YTN B;  2M17 A;  3DBL B;  3VAW A;  3PRE A;  1L0Y B;  1WGR A;  2I1K A;  2L7R A;  1OFF A;  3PS6 A;  2JYE A;  3ZXV A;  3BII D;  1U4A A;  4C4V B;  1JML A;  3MHS D;  4HVB A;  1T0R C;  1WX8 A;  1UGJ A;  2KC2 A;  4I6L B;  1MI0 A;  1SSN A;  2ZCB A;  2DEN B;  1AWD A;  4AS1 A;  1TS5 A;  3DBL I;  3HIZ A;  5MPO A;  4HRS A;  2V0G A;  2BYF A;  1XT9 B;  1WE7 A;  1IUE A;  1LQB A;  2NBU A;  3BK1 A;  4A9A A;  3BYY B;  3UIP B;  1YQB A;  2HD5 B;  2WX1 A;  2FIF A;  1H7W A;  2QSD A;  2LJ5 A;  3L54 A;  3VRB B;  2GRI A;  4JWU C;  1KLG D;  1K51 A;  2IO3 B;  4HPM B;  2UYZ B;  3H8H A;  5CHW A;  2ZEQ A;  3SHQ A;  2HTH A;  1PUT A;  1HZ6 A;  1I4P A;  2AWT A;  5GXG B;  4KKI A;  2DZK A;  4W9F A;  3DVN V;  3AEG B;  3W1S A;  3DVG Y;  1QOB A;  1I7H A;  1D5X C;  3ZNH B;  3RUL A;  4HDO A;  1UZX B;  4LCD E;  5AZF A;  3KWL A;  2BWE S;  3MJW A;  1HZ5 A;  4HK2 A;  3PRZ A;  2KXJ A;  2WDV B;  2C7N B;  2XN9 C;  2FUG 1;  5CHV C;  1DOI A;  2I2Y A;  1FCC C;  2WXH A;  1E0Z A;  1JWS D;  2KLG A;  3GZN B;  5BYR A;  1V1O A;  3A9J B;  3N32 A;  3APD A;  4LNI A;  4WWP A;  4MM3 A;  3EHV A;  4LNN A;  2CHX A;  3EC8 A;  2DAJ A;  2WXG A;  5IO9 A;  2Z0E B;  1V2Y A;  5T8I A;  2JRI B;  2KWC A;  3L16 A;  4IWP A;  1D5M C;  2IGG A;  1FRD A;  4AQ7 A;  4N9F 4;  3T3O A;  4IW0 A;  3TEX A;  3OJ3 A;  3NS8 A;  3TEZ A;  1RYJ A;  4MDK E;  1HQR D;  1NYR A;  2NMQ A;  4B0M A;  3Q3N C;  3NS1 A;  1PYW D;  4MEM A;  1L7Y A;  5GMV A;  1WXV A;  4RM8 A;  2ZPY A;  2IYD B;  4XC2 A;  4JX1 C;  3BVG A;  1KLU D;  3TEY A;  2HJ8 A;  3W9C B;  1M94 A;  2FAZ A;  4C80 A;  2XK5 A;  1WXA A;  1HEZ E;  1HE8 A;  4BAX A;  3P4P B;  5DPR A;  2O6V B;  2R2Q A;  1SE3 A;  2KN4 A;  2JWU A;  1VD2 A;  1YJ1 A;  1ZPS A;  1AW7 A;  1K52 A;  4IOI E;  2PVO D;  3AE8 B;  3KW5 B;  2BBC A;  2D3A A;  3ETR A;  2W3S A;  1L6V A;  1XO3 A;  2WXN A;  3PT2 B;  1YJJ A;  3BVZ A;  3AMZ A;  1FXI A;  1V49 A;  1IYF A;  2D3G A;  1X1M A;  2Q5W D;  3FC4 A;  2JVC A;  2DX5 B;  3OG5 A;  5AEK B;  4ANX A;  2IND C;  3ZTD A;  1V1P A;  1UBQ A;  1GB1 A;  4GMV A;  4ANW A;  4X57 B;  1E8Y A;  1SXT A;  5H92 C;  4G0N B;  2WNM A;  1S3S G;  4GN1 A;  1CMX B;  5E6P A;  3KUC B;  2JPH A;  4DK5 A;  5AZG A;  5FKA C;  3FAH A;  4OVU A;  3DBS A;  1N62 A;  1C77 A;  3VVW B;  2BB5 A;  2RDH A;  4OZC A;  4TSS A;  2MBQ A;  5D3D A;  3I57 A;  4MSQ B;  4WAA A;  1OTR B;  3L10 B;  4N59 A;  2BTE A;  3JYU A;  1MHX A;  3L08 A;  1D4B A;  1C76 A;  4KDI C;  4OVZ A;  2R61 A;  4BOZ B;  3ZTC A;  2L00 B;  4A20 A;  1TTN A;  1YN5 A;  1PGA A;  4KIK A;  2KC1 A;  2MBO A;  2K6D B;  4RFB A;  1WYW B;  1C9F A;  3NG0 A;  3KVF B;  4MJS B;  2N9X A;  5DPS A;  3W1Y A;  2V3P A;  4M8N A;  4NPN A;  2CKH B;  4QAY A;  3AB5 A;  2MBE A;  3ONS A;  1FMA D;  3A9K B;  4J3O D;  2RR9 A;  3NJT A;  1JW9 D;  4G3X B;  2FCM A;  4TUU A;  3VHT C;  2MSE D;  4JE3 B;  4N58 A;  4OW0 A;  3V3X A;  2KFK A;  1NEN B;  1K53 A;  4JPS A;  2JWZ A;  1L4D B;  2KZR A;  2ZPN A;  2JUO A;  4GLS C;  2N1W A;  3VTU A;  2VH2 A;  4A55 A;  3DHI C;  4TMA B;  1V97 A;  2SEB D;  5BYQ A;  5E6O A;  3H7P B;  1NYQ A;  3UI3 A;  3RNC C;  1LGR A;  3Q8F A;  4J6I A;  3VH3 B;  3BZD B;  3N20 C;  5I4D A;  1RAX A;  4HPL B;  2RDB C;  2XK5 B;  2WS3 B;  3ZDM C;  4HDQ A;  1H8C A;  3W5V B;  3ENE A;  1FD6 A;  1K8R B;  4HKZ E;  5BMI A;  1FFU A;  1I4R A;  1Q1O A;  1KF6 B;  3ZNZ B;  1RWS A;  4DDG D;  3VUY A;  4BFR A;  2RD0 A;  3B2G A;  4JWS C;  4EZJ A;  1KH0 A;  3V60 A;  4GDL A;  1MHH E;  2DYB A;  4XWW A;  1YQ4 B;  1GG3 A;  5KHQ A;  1JRO A;  2C60 A;  4C56 C;  3Q2A C;  2DHZ A;  2YEP B;  3IBE A;  3LYY A;  3N1Y C;  2BKF A;  1YIW A;  2KMM A;  1F0Z A;  3CIR B;  2OED A;  3ZJT A;  1UH6 A;  4NAW B;  4WJO A;  3PHW B;  1WFY A;  2RDG A;  4IC7 B;  1UNS A;  3GS2 A;  1P7F A;  1FFV A;  1HA5 A;  1YX6 B;  3NUH B;  1ZUD 2;  2LGY A;  1ZW7 A;  1V1P B;  2ASQ A;  1VDV A;  1Y8R C;  3I9V 1;  2JYT A;  1FPY A;  1KM7 A;  3BVM A;  3P4R B;  4FJY A;  1Z5S B;  2N9K A;  3QAQ A;  2AX5 A;  4HJK A;  2VZK D;  3QC8 B;  2JZP A;  2UWQ A;  2BPS A;  3N1X C;  2GI9 A;  2YEP F;  1CK1 A;  1LXD A;  1WZ0 A;  5H8Y E;  4NQL B;  4PYZ A;  3A1Q B;  4BKS A;  5LXI B;  2CU1 A;  3O65 B;  2LFI A;  5BO4 B;  2V4I B;  4A3P A;  3AH7 A;  4LK0 M;  3PV1 A;  3AE3 B;  4KZ0 A;  1FXT B;  1DOX A;  2CHW A;  2I38 A;  2G4D B;  2DYO A;  3H9D A;  3WIM A;  3QJZ A;  2JXT A;  2IZV B;  2LRU A;  2KVR A;  1J7A A;  2BGF A;  3Q3M C;  2VZK B;  1N60 A;  2ZVN A;  1L5P A;  2BYV E;  3SFD B;  2DLB A;  2FUH B;  3PLV A;  4GOC A;  2ZVO A;  4I6N B;  3DCG A;  5HI1 A;  3DVN U;  5HFY A;  1WRI A;  3EFC A;  3V05 A;  5DPW A;  2ZCC A;  2FCS A;  2LEK A;  3IT4 B;  4M02 A;  2FE8 A;  4JLC A;  3M3J A;  3UIO B;  3A9J A;  2IO0 B;  4GXB A;  2LUE A;  2Z59 B;  2JQR B;  3AEC B;  2L76 A;  3TSS A;  5EE1 A;  3WAP A;  4P6V F;  2V1Y A;  4WQO B;  4XYC A;  4NJ6 A;  4EKU A;  1ZKH A;  1N5W A;  3PPA A;  4DXF A;  5DPT A;  3HM3 A;  1SEB D;  3OAW A;  3TCA A;  1Q0W B;  3QX1 A;  2K8B A;  3Q8C A;  5AZH A;  1C4P A;  3IXS A;  3ZRF A;  4EE2 A;  3W2D A;  2KDF B;  4E74 A;  3GOE A;  2LGD A;  1UBI A;  4IWQ A;  1WXS A;  3PRP B;  4MGI E;  5EDS A;  4URK A;  1H7X A;  3B0A A;  2GBM A;  3C0R B;  3V61 A;  3H7S A;  3HK0 A;  3PRM B;  2KTR B;  2LVP A;  5EE9 A;  2C9W B;  5HG2 A;  3AE7 B;  4BKS D;  2O6V A;  1STE A;  2WXO A;  3PZ8 A;  1FNW A;  2L83 A;  4CQN A;  2WXJ A;  3TMP B;  1NDD A;  5J2R A;  4HPP A;  3MJ5 A;  4WWM A;  3L0W B;  2BYE A;  2N9E B;  4KZC A;  2IO2 B;  4ZYS A;  1TYG B;  3IVF A;  2H88 B;  4KGS A;  2D3B A;  4MGK E;  2CU3 A;  4PS3 A;  1SF0 A;  4K7S A;  4HLE A;  4XWT A;  3L4P A;  4EUT A;  4EFO A;  4RGN A;  3QHT A;  1TS4 A;  2GBK A;  3NRZ A;  2LVO A;  2WU5 B;  3DHG C;  3BY4 B;  1MG4 A;  2FCQ A;  3V6C B;  4II2 B;  2MBH A;  2WLB A;  1LO5 D;  3TJP A;  1EM7 A;  2WDQ B;  4S0R A;  3KLS X;  3VQI A;  2BVC A;  5C2T B;  1PDX A;  3R7R A;  3AV8 A;  2N4F A;  3RNB C;  4B0E A;  1E8X A;  1ZDV A;  1NI2 A;  2NBW B;  1KTK A;  4K7U A;  3IAM 1;  2MW5 A;  2PLP A;  2MX2 A;  2M8S A;  1J0G A;  4BVU C;  2Y3A A;  4EZL A;  2JX5 A;  2K39 A;  1WJU A;  1JQ4 A;  5JHB A;  3DPD A;  4P1B C;  3P2B A;  2KYW A;  4B95 A;  2KAN A;  1P98 A;  2BF8 B;  4NZL B;  1VRA B;  3AE5 B;  4W9I A;  1TS3 A;  3T9L A;  2GB1 A;  4MJS A;  1GC7 A;  1Y56 A;  4W9K A;  2V9H A;  2LAS A;  5LXH A;  3CMM B;  4ACF A;  3IAS 1;  3R3M A;  4HCP B;  3IT6 B;  3KWV A;  1VR9 A;  1J19 A;  4ZHO A;  4KX6 B;  4ANV A;  3RN9 C;  3A9K A;  3ALB A;  2Z0D B;  4RCO A;  4YXD B;  1GC6 A;  4L1B A;  2UU7 A;  2N9P C;  2W54 A;  4WJQ A;  4YSX B;  2K0P A;  3FKY A;  2O6V D;  2WP9 B;  4M0W B;  2M4N A;  2CS4 A;  3UF8 A; 
#chains in the Genus database with same CATH homology
 1D6E C;  1JRP A;  4RH6 A;  3GP7 A;  4RFB A;  1JWU D;  4NJC A;  1ENF A;  2WXF A;  1RFK A;  1C9F A;  3SFE B;  3AEB B;  1IGC A;  1FM0 D;  2V3P A;  1K50 A;  5D3I B;  3U52 E;  2AQ3 B;  3AB5 A;  2BS4 B;  4J3O D;  4XDC A;  1FMA D;  3SR6 A;  4US8 A;  2N9L A;  1XCT L;  1XLN A;  1PFD A;  1SE2 A;  1GTH A;  1JW9 D;  3HVD A;  4RGO S;  2LUM A;  4JE3 B;  4N58 A;  1VLB A;  1CZP A;  1L4Z B;  4OW0 A;  2K5P A;  3VR9 B;  3V3X A;  3VR8 B;  1QQR A;  2PTL A;  1NEN B;  2WXR A;  1CQV A;  1K53 A;  3FIL B;  2Z8L A;  4JPS A;  1YJI A;  1L4D B;  1ZE3 D;  3RPF C;  1MVK A;  4A90 A;  1VZ8 A;  4HJG E;  4GLS C;  4A55 A;  2AQ1 B;  2BW2 A;  2KDM A;  4TMA B;  2E6X A;  1V97 A;  1IBX A;  4ZRP A;  2SEB D;  5BYQ A;  1ESF A;  4A8X C;  1BUI C;  2W82 A;  1EU3 A;  1NYQ A;  2N7J A;  3UI3 A;  2E3T A;  4GDK B;  1QKZ A;  1FXA A;  2MEK A;  3Q8F A;  3PO0 A;  1TJE A;  4H2A A;  1JWM D;  1FNU A;  2WXL A;  3BZD B;  3BYT B;  5I4D A;  4MT5 A;  2PVG C;  2JSV X;  2LGI A;  2M56 B;  4ITK A;  2EEL A;  3MP9 A;  2WS3 B;  4ZOH C;  3P4S B;  2ZW1 A;  2IGD A;  4ZRQ A;  3C8Y A;  3W5V B;  1C79 A;  1UWX A;  1FD6 A;  1XLO A;  1I4G A;  2DBY A;  4HKZ E;  5BMI A;  1FFU A;  1I4R A;  1KF6 B;  1HXY D;  1RWS A;  1AYF A;  1L0X B;  2HDE A;  2L1A A;  2K3U A;  1OQR A;  3B2G A;  4JWS C;  1KH0 A;  1XF5 L;  4PT5 A;  2MJD A;  1E9M A;  1MHH E;  3R2I A;  4XWW A;  1YQ4 B;  1XLQ A;  1I4H A;  1N63 A;  1JRO A;  1YN4 A;  4C56 C;  1IBX B;  2BT6 A;  2EKI A;  2J52 A;  2YEP B;  3R2T A;  3TEW A;  1DGJ A;  1GPX A;  3LYY A;  1I4Q A;  2M19 A;  1T5X D;  4MAC A;  2KMM A;  1F0Z A;  1VZ6 A;  3CIR B;  4YWG G;  2OED A;  1NI3 A;  1XLP A;  1UWM A;  3ZJT A;  1SJH D;  2QMT A;  4IKG A;  4NAW B;  4US9 A;  2Y5C A;  3WCQ A;  4HEA 1;  1TS2 A;  2RDG A;  2BS2 B;  1UNS A;  3GS2 A;  3EGR A;  1P7F A;  1FFV A;  3AE2 B;  1HA5 A;  1SJE D;  1TKY A;  4WIP A;  1R7S A;  1SBB B;  3NUH B;  1ZUD 2;  1ROE A;  3AED B;  2CJN A;  3ZJV A;  1V1P B;  4O1N A;  4GDL B;  4RGM A;  2LJI A;  1VDV A;  2W55 A;  4TQ0 A;  4N6E B;  1ET6 A;  3ZQ4 A;  1TKE A;  2MJ3 A;  3MHZ A;  2ONQ A;  3I9V 1;  2JYT A;  1A70 A;  4XE0 A;  3BVM A;  4RGT A;  1TKG A;  3P4R B;  5FK9 C;  4IDI A;  1YMH E;  2QIE B;  2BB6 A;  2ACZ B;  1FIQ A;  1NEK B;  1V8C A;  2SAK A;  3E9S A;  2N9K A;  4DXG A;  2AX5 A;  3Q8A A;  1UUP A;  2VZK D;  4REZ A;  5E6J A;  2JZP A;  3RFZ B;  1ZOY B;  2K9X A;  4TQ1 A;  1P7E A;  4HRO A;  4OZB A;  1DYQ A;  3HVZ A;  2GI9 A;  2K22 A;  3B2F A;  2YEP F;  4ARC A;  1PGB A;  1CK1 A;  3AM9 A;  2PMV A;  3ZJU A;  1C4C A;  2M0A A;  4ARI A;  5C3J B;  5H8Y E;  3U2S C;  1VJK A;  2G9H D;  2NTT A;  5G5G A;  3P42 A;  2LFI A;  2WXK A;  1WYG A;  3EA6 A;  3AE4 B;  2V4I B;  1GTE A;  3O13 A;  3AH7 A;  4WH4 A;  1PGX A;  2TSS A;  4LK0 M;  3AE3 B;  3AEE B;  1DOX A;  3AEF B;  2L32 A;  2I38 A;  3NVV A;  3KQ4 A;  2DYO A;  5JXV A;  4YTN B;  2WU2 B;  2JXT A;  2XNA C;  2WXQ A;  1L0Y B;  1EWY C;  1ZP0 B;  1OFF A;  2JYE A;  3P63 A;  4L23 A;  3BII D;  5EE3 A;  1J7A A;  2VZK B;  1JML A;  1N60 A;  3W5U B;  4FXC A;  2INP E;  1YNT E;  1UGJ A;  2DWQ A;  2MH7 A;  1FO4 A;  1MI0 A;  2LMC A;  1SSN A;  1L5P A;  1AWD A;  1WXQ A;  4YSZ B;  3ZYY X;  4AS1 A;  3SFD B;  1TS5 A;  4KGR A;  5MPO A;  1EWC A;  4HRS A;  2DLB A;  2V0G A;  5BMG A;  3NZ3 A;  1ZDX A;  1IUE A;  1WSP A;  1KRH A;  2IJ0 A;  3NVW A;  4RF1 A;  3BK1 A;  4A9A A;  5HI1 A;  1WGK A;  3BYY B;  5HFY A;  1H7W A;  3DWM A;  2QSD A;  1WRI A;  2MJE A;  1T3Q A;  3V05 A;  5AUI A;  3VRB B;  2DYM A;  1CJE A;  2GRI A;  2LEK A;  4JWU C;  1KLG D;  1K51 A;  3H8H A;  3IT4 B;  2IDY A;  4NAM A;  2FE8 A;  1PUT A;  2OHF A;  1HZ6 A;  4OZA A;  2QIL A;  3AE9 B;  1I4P A;  2JQR B;  2J4X A;  5GXG B;  1SE4 A;  5D7G A;  3AEC B;  2QJL A;  4KKI A;  1Q10 A;  3TSS A;  3BWU D;  1FNV A;  5EE1 A;  4RNA A;  4P6V F;  3AEG B;  3W1S A;  1JCK B;  1N5W A;  1QOB A;  1I7H A;  1L6U A;  1D5X C;  4DXF A;  4C7Z A;  5LNK 1;  1E7P B;  1FRR A;  3KWL A;  1SEB D;  1HZ5 A;  2PW9 A;  4C7Y A;  1WWT A;  2WDV B;  1C78 A;  1SB3 C;  2LHD A;  3Q8C A;  1C4P A;  2XN9 C;  3IXS A;  3N9Y C;  3CF4 A;  2J53 A;  2FUG 1;  1DOI A;  2WDR B;  1N5X A;  2W3R A;  1L0V B;  4EE2 A;  2I2Y A;  1JWB D;  1E6E B;  2RMM A;  1QF6 A;  4DQO C;  1FCC C;  2WXH A;  1E0Z A;  1JWS D;  3W2D A;  2L52 A;  3MC0 B;  3Q69 A;  5BYR A;  4KKJ A;  4ZHP A;  1V1O A;  4Q2J A;  1XXG A;  1TZO A;  3TUO A;  1J7C A;  2QEJ C;  1F2R I;  4HKQ A;  1H7X A;  2WXG A;  1I4X A;  2BYT A;  5T8I A;  2ICI A;  1B9R A;  1QOA A;  1D5M C;  1F2R C;  2NTS A;  4YTP B;  2IGG A;  1FRD A;  1QOF A;  3HUI A;  5EE9 A;  4AQ7 A;  3Q8B A;  5HG2 A;  4WQM A;  2INN E;  3AE7 B;  2KAC A;  3T3O A;  2JU6 X;  2IPK D;  3TEX A;  3OWE B;  3TEZ A;  1RYJ A;  1STE A;  2WXO A;  3PZ8 A;  1FNW A;  2L83 A;  4CQN A;  1HQR D;  1NYR A;  2WXJ A;  3R8B A;  1F77 A;  2NMQ A;  2IGH A;  4A6Q A;  4B0M A;  3LXF A;  1XCQ L;  3NS1 A;  2WXP A;  5BYS A;  3MJ5 A;  2J42 A;  3CWI A;  1C4A A;  1PYW D;  4WWM A;  1ZXI A;  1FCL A;  2RPV A;  4USA A;  4ZYS A;  1TYG B;  1YQ3 B;  4JX1 C;  3BVG A;  1KLU D;  2BS3 B;  2H88 B;  4MM3 B;  3TEY A;  4KGS A;  5BMH A;  2WXM A;  3W9C B;  3NVZ A;  1RM6 C;  3PZ7 A;  1BML C;  1OQQ A;  4C80 A;  2CU3 A;  1TY0 A;  1SF0 A;  1HEZ E;  3P4P B;  4XDD A;  4XWT A;  3L4P A;  4KGT A;  4L2Y A;  4RGN A;  4YTM B;  1NVI D;  1SE3 A;  1TS4 A;  3J9C A;  2KN4 A;  3E56 A;  1N61 A;  3T3N A;  2JWU A;  5HHD G;  4R3D A;  3NRZ A;  5G5H A;  4MH8 A;  1FEH A;  1ZPS A;  2WU5 B;  1GB4 A;  3SEB A;  1AW7 A;  1JAL A;  1K52 A;  4IOI E;  4OHJ A;  4RF0 A;  2WLB A;  1LO5 D;  2PVO D;  5FR3 A;  3AE8 B;  1EM7 A;  2WDQ B;  1YN3 A;  5TSS A;  1QOG A;  3KLS X;  3VQI A;  5C2T B;  1PDX A;  2BBC A;  1D5Z C;  3AV8 A;  3ABV B;  3ETR A;  2W3S A;  3U7Z A;  2FBW B;  1L6V A;  4B0E A;  1ZDV A;  1XO3 A;  2WQY B;  2WXN A;  3MFG A;  1KTK A;  2B76 B;  1ACC A;  1YJJ A;  3BVZ A;  3AMZ A;  1QIL A;  3IAM 1;  1MPE A;  3AEA B;  4LLG M;  1FXI A;  2PIA A;  2PLP A;  2KQ4 X;  1E10 A;  1QLB B;  1B1Z A;  2HTM E;  1XEE A;  2D5G A;  3LB8 C;  2Q5W D;  3GB1 A;  2Y3A A;  3FC4 A;  3P4Q B;  2JX5 A;  5EE0 A;  2WXI A;  3HRD D;  3P1M A;  1JQ4 A;  1V1P A;  4P16 A;  1GB1 A;  1VZ7 A;  1ZXH A;  2ZW0 A;  2ON8 A;  3NVY A;  1QT9 A;  1GAQ B;  1T6B X;  1KFY B;  1SXT A;  5H92 C;  2WNM A;  4WAF A;  4M0W A;  4NZL B;  1BXT A;  2KAJ A;  3AE1 B;  4UDU C;  1AN8 A;  1EU4 A;  3EUB 2;  5FKA C;  1VRA B;  3FAH A;  3AE5 B;  3URY A;  1N62 A;  1TS3 A;  3B9J A;  5AUK A;  2G1E A;  4YT0 B;  2GB1 A;  1C77 A;  2Y5P A;  4WUR A;  2BB5 A;  1Y56 A;  3AN1 A;  2RDH A;  4OZC A;  3IAS 1;  2H89 B;  3Q8E A;  3DWG C;  4TSS A;  3IT6 B;  3VRA B;  3KWV A;  4D2K A;  1GOZ A;  2LHE A;  1VR9 A;  5D3D A;  3I57 A;  1GT8 A;  4YSY B;  4ZHO A;  1DOY A;  4KX6 B;  3U4E G;  4LTU A;  2CJO A;  4N59 A;  2BTE A;  4RCO A;  1ET9 A;  1J7B A;  4YXD B;  1MHX A;  3BK2 A;  2PKO A;  4L1B A;  2N0S B;  1M4V A;  1D4B A;  1JWA D;  2W54 A;  1C76 A;  4YSX B;  3AE6 B;  2K0P A;  4OVZ A;  2R61 A;  1TY2 A;  3ZGZ A;  1SIJ A;  1YN5 A;  1PGA A;  2V3N A;  2X38 A;  2WP9 B;  1IGD A;  3FIL A;  2KWD A;  2AQ2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...