4YSZB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yszB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yszB01
2BS4B 1YJIA 2M56B 2CU3A 2WQYB 3AEAB 4C7ZA 2DWQA 1E9MA 3PO0A 5EE3A 2H89B 1FO4A 4YSXB 3AE8B 3L4PA 1T3QA 1UWMA 1A70A 4HRSA 4C80A 3DWMA 3LXFA 3W5VB 1OFFA 1AWDA 1ZXIA 4HROA 3AE1B 4YTPB 1YQ3B 1FIQA 4US9A 5AUKA 1WXQA 1RYJA 5AUIA 1OQQA 1DGJA 3AE5B 3WCQA 3NRZA 3W9CB 1KRHA 2DBYA 4N6EB 1H7WA 2K22A 3AECB 1WWTA 1B9RA 4YT0B 3NVWA 1JW9D 1QF6A 4YTNB 1FFUA 2ACZB 2WU5B 1RWSA 1YQ4B 2K9XA 1QLBB 1SIJA 3KWLA 5MPOA 1AYFA 1QOBA 1GAQB 4WQMA 3W5UB 2WDRB 2E3TA 2Y5CA 2L52A 1XLOA 3B9JA 1I7HA 4N58A 4P6VF 3AE2B 1VDVA 2JQRB 3HUIA 1RM6C 1PFDA 3AEDB 1L5PA 2HTME 2WLBA 3NVVA 3CF4A 3NVYA 4ITKA 3RPFC 4LTUA 1QOFA 2MJEA 2OHFA 1NENB 2WS3B 2W3SA 3AEFB 1GTEA 3DWGC 3SR6A 1JQ4A 1F0ZA 1ZP0B 1CZPA 2CJNA 3P4RB 2JX5A 3SFDB 2K5PA 1FMAD 1V97A 1XLPA 1PUTA 3AB5A 2KAJA 5EE0A 1SB3C 1WGKA 1N5XA 1VLBA 1FM0D 3VRBB 3EUB2 2L83A 2WP9B 2WDVB 1N61A 1NVID 3ABVB 3AEBB 1NI3A 4JWSC 2Q5WD 3AMZA 5EE9A 1WRIA 2FBWB 1JWBD 1ROEA 5H92C 1VJKA 1NYRA 3HRDD 2W54A 1E7PB 3AE4B 1KF6B 3AE6B 3AEEB 1DOIA 2BS2B 1V8CA 4ZHOA 3P1MA 1ZOYB 3AV8A 3CIRB 1IUEA 1N5WA 2MJDA 2WU2B 1QOGA 3CWIA 3ETRA 1FRRA 1E10A 2QIEB 4FXCA 1SF0A 1EWYC 3AE3B 2KMMA 2PIAA 1CJEA 1XLQA 2PVGC 1KFYB 3P4SB 3VR9B 1J7AA 1E6EB 5C3JB 3B2FA 1GT8A 5G5GA 1GPXA 2MJ3A 2H88B 3VR8B 4WWMA 1R7SA 1TKEA 1RFKA 4YTMB 3P4PB 4ZHPA 3P4QB 1XO3A 2MH7A 3AE9B 2LEKA 1YJJA 2AX5A 1PDXA 2EKIA 3AEGB 1XLNA 2M19A 3AE7B 1WYGA 5G5HA 1FFVA 1JROA 5C2TB 1L0VB 2BS3B 4YSZB 2W55A 4USAA 1QT9A 3B2GA 3FAHA 3NS1A 4JX1C 1JALA 1TKGA 4KX6B 1N60A 3BIID 3P63A 4A9AA 1DOXA 1E0ZA 1QOAA 1L6UA 4IDIA 1J7BA 1H7XA 2N0SB 2BT6A 4JWUC 2QJLA 1OQRA 4US8A 1GTHA 1FXAA 4N59A 2G1EA 3AH7A 5EE1A 1FRDA 4YXDB 3FC4A 1JWAD 3LB8C 4ZOHC 2B76B 1ZUD2 1N63A 1TJEA 5H8YE 1N62A 2PVOD 1NEKB 2W3RA 1L6VA 1NYQA 5GXGB 1DOYA 1J7CA 2WDQB 1JRPA 1TYGB 3HVZA 3NVZA 2PKOA 3AM9A 3AN1A 4YSYB 2CJOA 3ZYYX 4C7YA 1TKYA 3VRAB 3SFEB 1FXIA
chains in the Genus database with same CATH superfamily
2IO0B 2INNE 2LVOA 2DWQA 2DAFA 5TSSA 3BYYB 4URKA 1P9DU 4HRSA 1RRBA 4HROA 1HXYD 3DPDA 4HPLB 4K1RB 3BVGA 2QC8A 4MGYE 4WJOA 2KC1A 3BK1A 2JZZA 1VD2A 4TQ0A 4XE0A 3B9JA 2M0XA 4P6VF 3ZKJC 3R66C 2KDMA 2OOBB 4BZAA 4W9KA 4YWGG 3CF6E 2DZKA 1NENB 2IY1B 2O6VB 1L4DB 5FK9C 1YN3A 2MBOA 1BXTA 3N20C 1TBEA 1NDDA 1MG8A 1JWSD 2B3AA 2N9KA 4IUMB 2Q5WD 1UZXB 3C8YA 3HRDD 4ZYSA 4EFOA 3R7QA 1Q1OA 3DOWA 1K53A 1J19A 2FNJB 4ZRQA 1K52A 1RFAA 3IBEA 2C9WB 3RT3B 2M0AA 4LNNA 1XXGA 3BY4B 2DYMA 2JUOA 4OW0A 3JVZX 1E6EB 5L95C 5JH5C 4WJQA 4XX5A 5BYQA 1Z5SB 1IGDA 4NNJB 1SJHD 3ZNZB 4WAAA 2CS4A 3L17A 1FXAA 3QWZB 1WXMA 1GUAB 2J0MA 3GB1A 2MQJA 4LNIA 3SEBA 1T0RC 3CSTA 3ECIA 4NAWA 3DCGA 2BWFA 2L7RA 2K6DB 2BQQA 2JYTA 4KVGB 2JZPA 5J17A 4GN1A 1P3QU 1DGJA 4FHJA 4WAFA 5HI1A 1H7WA 3AECB 2Y3AA 3NVWA 3DBHB 4YTNB 4C56C 1VZ6A 4HDOA 3RNBC 2AQ3B 3L10B 2VZKB 1ACCA 3RPFC 2FE8A 3AEFB 4J6IA 1F0ZA 2KMCA 4O1NA 1PUTA 1BUIC 1IYFA 2WXGA 5TR5A 4KDIC 4EZJA 3ABVB 1FXTB 1NI3A 3AMZA 1SEBD 2RPQA 1WGGA 3AI5A 2L0FA 1ZOYB 1Y8RC 1EO6A 3NY5A 2VRRB 2O6VA 3NJTA 1SSNA 4WJPA 5CTRC 5E6NA 1TIFA 2NTSA 1GT8A 5LXHA 2CHZA 2JWZA 3JW0X 1HTQA 3VR8B 2Y5BB 2K8BA 2D07B 4AJYB 4GB9A 2C7NB 1L0VB 1K50A 1QT9A 4XC2A 2WXIA 2AEHA 3O65B 4WWNA 1YX6B 3BIID 3P63A 2BYTA 2BPSA 2BT6A 3MC0B 4JWUC 2KJHB 2LJ5A 5BO4B 5H8YE 3RUIB 1N62A 4W9DA 4ANWA 5GXGB 1Q10A 4E71A 1WMHB 2V3NA 1E9MA 3MHZA 2MBEA 2KK8A 1OFFA 1V5OA 2D3BA 1MHXA 2D5GA 1OQQA 3DBRB 3NRZA 3N3KB 4TQ1A 2LZ6A 2XEWA 4GSWA 3TBLD 1R4MB 5MPOA 4KSLC 4HKZE 2KQ4X 1GJZA 2L52A 4FN2A 2FIFA 2OHFA 5G55A 1FNUA 3VHTC 1CZPA 4GDKA 2BVCA 1N5XA 3APDA 3U2SC 3WALA 3TEYA 2EKEC 4AP4C 5FKAC 3V61A 4P1BC 5AZFA 1IUEA 3N32A 4XWWA 1F2RC 3V3XA 4FA6A 3T3OA 1ZE3D 2QMTA 3DVGX 1UGMA 3UF8A 2BYVE 5G5GA 4IWQA 1WFYA 4NY0A 4DK5A 4YTMB 5KHOA 4ZHPA 4FJVB 3MP9A 3NZ3A 1K51A 2GBNA 3A33B 1SE4A 3NS1A 2KTRB 1T5XD 4LNOA 2BB5A 2X8XX 4G11A 1V2YA 1WJUA 2VZKD 1WIAA 2NS5A 2W9NA 3LDZE 4M02A 4K7SA 1XEEA 2IGHA 5D7GA 3GP7A 2WQYB 3PO0A 1FO4A 2MA9B 1SE9A 4F7ZA 5E6JA 1ZXIA 4LNKA 2DX5B 4OVUA 4DHZB 4HJKA 4HCNB 3PZ7A 4C4VB 2V4LA 2WDTB 1LQBA 2KWDA 2CKHB 2J52A 1WMHA 3KWLA 5L83A 1SE2A 2G3QB 1UGJA 3VTUA 2LGSA 2R61A 4EOYA 2LASA 1V6EA 2NCNA 1EF5A 1F77A 2IO2B 3EFUA 3LJ3A 4KZ0A 4CQNA 2BTEA 1XF5L 3VQIA 2ASQA 3A9JB 4L2YA 1NVID 1N6ZA 1EWCA 3HM3A 1WRIA 3A4RA 4W9LA 2Z0DB 3AEEB 1LO5D 3L16A 3AV8A 3TL5A 4EZKA 3RZWC 1N5WA 2BF8B 3ETRA 4MSMB 4I6PA 1GC6A 4FXCA 5LXIB 1I4PA 2KMMA 3Q3FA 1XLQA 3TEZA 2WX0A 4WJNA 4MJSA 4TUUA 2RMMA 1EUVB 3V6EB 1TT5B 3P4QB 4ZDVA 3QAQA 2KFJA 3UIOB 3EA6A 3AE7B 4A3OA 1FFVA 2IO3B 5HFYA 1ET6A 4MACA 4HVBA 2N7DA 3OJ3A 3BVZA 4IM2A 3RNCC 1DOXA 3ALBA 2PTLA 3VXWA 2PE9A 5DCNA 1E8ZA 1QKZA 1N63A 1JRPA 2M17A 1TYGB 1FCLA 3IXSA 3PS6A 3VUXA 3VVWB 3ZO5B 1E90A 2H89B 4DBGA 2KTRA 3V6CB 1D5MC 4EE2A 1C9FA 1V80A 2DZJA 4MGIE 1WGDA 2BB6A 3L08A 5DPWA 3OLMD 2V4IB 3W9CB 4PS8A 4WURA 2LHDA 2ZZPB 1QLBB 4RFBA 2JYEA 4GXBA 1VZ8A 1SXTA 1I4XA 4S0RA 2WXJA 2EMSA 3EECA 2W3SA 3SDLC 4C4VA 4TMAB 3SU8X 2RDGA 3V60A 2CHWA 1EF1A 4CO7A 4TV3A 4LK0M 2WDVB 1HZ6A 1L4ZB 1T6BX 2I1JA 1ROEA 3HM6X 2QILA 4EZLA 5AEKB 1NBFC 4FHKA 3QARA 2V3SA 4HEA1 3PLVA 4I6LB 3KUCB 1CJEA 2IDYA 5IN7A 3A9JA 2WXNA 1TS2A 4MGKE 4WQOB 2H88B 5IOIA 3ML8A 2PJHA 1E8XA 1J8CA 4RNAA 2C5LC 3C19A 4USAA 2GI9A 2OJRA 2AWTA 4FULA 4ARCA 4C00A 1N60A 2L8JA 3DBLI 1MJDA 1OQYA 3DVGY 1D6EC 1NYQA 2RPVA 2GBMA 3AN1A 3HHMA 3ZTCA 3VRAB 3I3TB 2ZPYA 2I38A 4YSXB 2K8HA 4FJYA 2UYZB 2W82A 3W5VB 1PYWD 1MI0A 3NUHB 1A5RA 3M3JA 1ZGUB 4M01A 1HEZE 4DHZE 3AE5B 1B9RA 2GRIA 2C7HA 2LXCA 2ACZB 1RWSA 4OZAA 2LD9A 2MWSB 2DYBA 3TIXA 1XLOA 2N7EA 3VUWA 2CU1A 1JQ4A 1KLVA 4LNFA 3FILB 4DXAB 2NBVB 4KKJA 1JCKB 3X23A 2KLCA 2KXJA 1KM7A 3BVMA 2XBBC 1IP9A 2JSVX 1KF6B 1D5ZC 2FCQA 4A3PA 2N4FA 4W9IA 1QOGA 2WXKA 5E6OA 3A1QB 4LCDE 1QZEA 4F1SA 4IWOA 1J7AA 2HDEA 2LWPA 3GE8C 4B6WA 4BKTA 4AOFA 3N1YC 2PLPA 2WXPA 1V49A 1K8RB 1E7VA 1JROA 3PVLA 2KWCA 5JZEB 1GB4A 4KV2A 1WSPA 4US8A 3NOBA 4ZOHC 2B76B 3V62A 2OEDA 4PS7A 3L0WB 3PZDA 2FCSA 4JIOU 4YSYB 2CJOA 3U30A 4W9GA 2BS4B 1IPGA 1E8YA 2AL6A 2RDBC 4RGNA 1LFDA 3ZRCA 5BYSA 1T3QA 2KDEB 1A70A 4RM9A 4DQOC 1YMHE 1EM7A 2WX1A 2KD0A 2KFKB 4US9A 4FJZA 4FADA 1HE8A 3D32A 2L00B 4Q2JA 4BKSD 2DBYA 1I42A 3SHQA 1FFUA 4P16A 2WU5B 2K9XA 1XQQA 1XCTL 2GOWA 5D2MB 1SIJA 4LJPB 4WQMA 2KDIA 2WDRB 1VDVA 2JQRB 2QHOA 3HUIA 1RM6C 1ENFA 2KN5A 4HXDA 4ZRPA 5BMHA 2K3UA 2MBQA 2CJNA 2KNBA 2XN9C 3IFWB 4GDKB 2D3AA 1FM0D 1MHHE 2MCNB 3TJPA 4KZCA 3AEBB 1I4QA 1MVKA 1QILA 4MM3A 4NQKE 2Z8LA 1NYRA 1RAXA 2KX0A 2KWUB 2LFIA 3DHGC 1L2NA 4GDLB 4JGHB 1ZKHA 4UDUC 4DXGA 3FILA 1YIWA 1FRRA 2NR2A 2Z59B 3R7RA 3H7PB 3ZIMA 2JY6A 3ZNHB 2KLGA 2MJ3A 2WXHA 1I35A 1KJTA 3SD5A 1WF9A 3APCA 1YJJA 3U52E 2I1KA 3PPAA 4CYEA 4MELA 3KQ4A 3A1QA 4RGMA 4PYUA 2QJLA 3N1ZC 4N59A 2GMIC 4KDLB 1FRDA 4YXDB 3Q2AC 4D2KA 4M00A 3LB8C 2BKFA 1F1HA 1AARA 3DHHC 2SAKA 4IWPA 3I63C 3QIJA 4XYCA 4XWTA 1Q5WB 3L54A 4JQWC 2NVUI 1YQ3B 4JL9A 3Q14C 2D2QA 3ZRFA 2JRHA 3T8MA 3E9SA 3GZNB 2LGDA 1Y56A 3UINB 3M95A 1GOZA 1WR1A 4NJ6A 2KFKA 2JXXA 2RR9A 5D94A 3CF4A 3H6NA 1QOFA 1WM2A 1MG4A 1FMAD 2LXAA 2RSUA 1KTKA 5D3IB 1WI0A 2MEKA 4GGQA 1VCBA 1M4VA 4LLGM 2BYEA 2FBWB 1JWBD 3W1SA 4ICUA 1V8CA 3IAS1 3S2AA 2V9HA 3KH0A 2MJDA 4RF0A 4ICVA 1KOTA 1T0QC 4TSSA 4HPPA 1C76A 3RD2A 1WXVA 5HKHA 5C3JB 1S3SG 2TSSA 2EELA 2LHEA 4MSQB 3RZFA 2FCNA 1R7SA 2OJWA 3B0AA 4M8NA 4MJSB 4P7IA 2MH7A 2BGFA 2AX5A 2M19A 4GDLA 3ONSA 3A4SC 1OTRB 2KMAA 4RMAA 4GLSC 4IDIA 2WNMA 1H7XA 3I5JC 3H7PA 1FCCC 1YQBA 4BFRA 2DENB 4JLCA 3AH7A 3X0WA 2PVOD 2AQ2B 1NEKB 3PSEB 2KACA 3EHVA 2PKOA 1G6JA 2V0GA 3ML9A 1TY2A 3EGRA 5EE3A 4WWPA 3KYCD 2LGXA 4C80A 3DWMA 3RCZA 4RGOS 2DAJA 4HWIB 2IPKD 2L32A 3ZW3A 3PLUA 1KRHA 1I4RA 5JHBA 3RN9C 2N9EB 4M0WB 2XK5B 1D5XC 2WXLA 3K9OB 3QCAA 2O2VB 1R4NI 1GAQB 2IGGA 1WZ0A 3J9CA 3W2DA 1V81A 2GBKA 4ITKA 2HJ8A 1GC7A 4AS1A 3H9DA 2MX2A 1U4AA 2LUEA 2KHWB 3RNEC 5EE0A 1TZ1A 2D3CA 1WGKA 1WXAA 2LVQA 2NTTA 4M8MA 1UBQA 4NPNA 2REXA 2CHXA 5IKCM 2N7JA 4W9JA 2PW9A 2LRWA 1P1AA 2KKCA 1FNVA 1IBXB 3AE3B 1P7FA 2PIAA 3NG0A 2INCC 3KWVA 2WWZA 4W9EA 1D3ZA 1GPXA 4IOIE 2KWVB 4REZA 5IAAC 4B9KA 1CQVA 3W1YA 4HK2A 4ZYNA 2LEKA 2A4ZA 5HHDG 3IG3A 2DNFA 3Q3MC 1UELA 2L1AA 3PT2B 2N9PC 2NPTB 3WANA 3AU4A 2YLMA 5BYRA 5DPRA 4EKUA 2QDFA 1I4HA 1JWAD 1E7UA 4QAYA 2YEPF 4BBNC 2NBUA 2J0KA 3NVZA 3VFKA 3KUZA 1I4GA 1P98A 1YJIA 1Z2MA 2HD5B 2PEAA 3RULA 2KOXA 4ANUA 2ZW0A 3TSSA 3B1LX 3U8ZA 2UWQA 4LDTD 4HLEA 2KZRA 2N9XA 2KDBA 2DZMA 2Y5PA 1L7YA 2NBWB 1TS4A 2KX3A 4BKGA 1TGZB 1AYFA 5JHAA 2FUHB 3M63B 3Q8AA 2AL3A 3HVDA 2KT7A 4PYZA 2JVCA 4CHKA 2HTME 3EFCA 2EMTA 2D11A 2LRUA 2M1MA 3PRMB 4L23A 4K7WA 4M0WA 3M62B 1VLBA 2XK5A 4MGZE 2O2VA 2GB1A 2G4SA 2JU6X 3HK0A 3N9YC 3PRPB 2K1FA 3DBHI 1VJKA 3VH3B 2QEJC 4B0MA 3VAWA 3ZQ4A 1ZDXA 2C7MB 1P7EA 2ZNVC 2QIEB 3UGBB 1EWYC 2R2QA 1FPYA 2IO1B 2ZJDA 4KGSA 5FR6A 3AULA 3QX1A 4P1CC 3VTVA 3JSVB 5G5HA 3TEWA 4YSZB 3FAHA 1TZOA 1PQSA 4TKNA 2QSDA 4KX6B 2ZVOA 4L1BA 4IM0A 1IBXA 1UD7A 1J7BA 3QQ8B 4PK1A 2J0JA 2BBCA 2IJ0A 5D3DA 1C4CA 3U4EG 3KLSX 4ZRJA 5FR3A 2D3GA 4FBJB 1DOYA 2DHZA 3AM9A 3KYDD 3TUOA 2MLBA 1V9JA 1OEYA 4W9HA 4KGRA 2NPTA 3LXFA 3DVNV 2KQSA 2MP2B 1AWDA 1YOVB 1IGCA 3VDZA 1RYJA 1OGWA 5G2NA 1XT9B 3K9PB 3QC8B 2WXOA 2K22A 1UUPA 4K3BA 3MC8A 3ZXVA 3TMPB 2GLSA 3VTWA 4II3B 1WX9A 3Q6BA 3IT6B 4DWFA 3DWGC 1TTNA 2JX5A 2LI5A 3ZJVA 2KO3A 1FEHA 4ANXA 1PGAA 2HTHA 3MHSD 2GBRA 3DBRI 1T0YA 4J3OD 1KH0A 2PMVA 1F52A 5AZHA 1WRDB 4XDDA 4MM3B 1R4MI 4RCOA 3KUDB 3P1MA 4IG7B 4WWOA 3MFGA 1JMLA 1KLGD 4IM3A 2MRPA 3ZGZA 2V3PA 4OZCA 3DQVA 4JPSA 3H1UA 3PTFC 1VRAB 1OEYJ 1FD6A 3P4PB 1C77A 1HTOA 3BYTB 2ZEQA 4G0NB 2V1YA 3OWEB 4KSKC 1JALA 4G3XB 1WGRA 1QOAA 3MTNB 3PV1A 3ZNID 3VH4B 3JSVA 4DDID 1PGBA 2ZCCA 1YN5A 3NZSA 4C7ZA 4BKSA 2KJRA 3L4PA 3NZUA 5CHVC 3TEXA 2C60A 3ENEA 3FKYA 5HG2A 5KHQA 3VUYA 4YL8A 4BBNF 1WWTA 2BKRB 1QF6A 2BYFA 4HDQA 1C79A 3UIPB 1YQ4B 2FUG1 4HCPB 1AN8A 2FAZA 3Q3NC 4KGTA 1I7HA 2A5UA 4HKQA 2MP2A 3NVVA 2K8CA 1WXSA 2WS3B 3R3MA 4RGTA 2AQ1B 2KYWA 3AB5A 2WGSA 1CMXB 3U7ZA 2YVCA 2L83A 1TS5A 5LNK1 3MC9A 2CR5A 4GMVA 1E5WA 2FIDA 3O13A 1L0YB 4JWSC 1E7PB 3WIMA 2BS2B 1MFWA 4DDGD 1ISNA 4ZHOA 3E56A 4IKGA 1GG3A 3QHTA 3VR9B 2E6XA 3R2TA 2K0PA 5T8IA 5AZGA 3RNFC 2DYOA 3W5UB 2LMCA 3EC8A 3Q3OC 1WYGA 4W9FA 1C78A 2BS3B 2KDFB 2ZVNA 1TKGA 3BK2A 1ESFA 3R2IA 3DVNU 2MHJA 2QCZA 4E3CA 2M8SA 1WGHA 4F8CB 3RYTA 4MH8A 2G4DB 1H4RA 2WDQB 2IY0B 3ZDTA 1YN4A 1TKYA 2N0SB 3WAMA 2MBBB 2LGYA 2GBJA 1P0RA 3NHEB 1D4BA 1B1ZA 4N6EB 2RD0A 3KVFB 2JT4B 2JF5A 1X1MA 2E3TA 4XDCA 2G45B 3Q8BA 4ZRKA 1T0SC 4K81A 3AEDB 5IA7A 1QQRA 2FCMA 2MJEA 1PGXA 1JWMD 1YD8U 3P4RB 1TS3A 4B95A 4GOCA 3SFDB 4BOSC 2JWUA 1XLPA 2ZCBA 3DBSA 2IYDB 4ZRIA 2HJ1A 5J18A 2K25A 2WP9B 1C4AA 2ZNVB 2RGFA 4N9F4 3QJZA 2WXQA 2ZPNA 1WJ4A 1SJED 4DHJB 1DOIA 2J7QB 5CHWA 3DBLB 5DPSA 4AJWA 3CWIA 3PREA 2ZW1A 5C1ZA 4MT5A 2LUMA 1WYWB 4NJ7A 2PVGC 1TY0A 3I57A 2G9HD 2LGIA 2WHIA 1HZ5A 2O6VD 2KVRA 4WWMA 3GE3C 3U7DA 1UF0A 4OVZA 4RF1A 3T9LA 4BVUC 4A6QA 1J0GA 1ZW7A 3BINA 4LDTB 2J4XA 4MDKE 4JX1C 2XNAC 3H8HA 4A9AA 1H8CA 1L0XB 2L0TA 3OG5A 3UQAA 3L13A 4EEWA 1WZ3A 2K6QA 2W3RA 2KC2A 1L6VA 1VR9A 2KVZA 2N1VA 5IO9A 4C7YA 3ZYYX 2M56B 2CU3A 1EU4A 3AE8B 2JZ3B 5EDSA 1CK1A 5IP4D 4ASWC 1YNTE 1SE3A 1F9JA 1SIFA 5AUIA 3RNGC 2D10A 4YT0B 4XGAB 3PZ8A 3IT4B 1E8WA 1QOBA 2K39A 4MH0E 2RDHA 2Y5CA 3Q8CA 2VH1A 4N58A 2KN4A 2WLBA 1PFDA 4II2B 1JWUD 3Q8EA 3SR6A 4GIVA 4R3DA 1WX7A 1GTEA 2N1WA 1V97A 1UH6A 1WY8A 1C3TA 2KAJA 3QK0A 5I4DA 2L3ZA 3VRBB 3MJ5A 1MPEA 2INPE 3WAOA 2UU7A 5J2RA 1ET9A 4RM8A 1ZPSA 2W54A 3AE4B 1V1PB 2WXMA 4A8XC 4I6NB 2WU2B 5CX3A 2PPHA 1NI2A 1SF0A 2DZIA 1KFYB 5DPTA 4WH4A 2J42A 4DXFA 1WJNA 2WXFA 3A9KB 1EU3A 1AW7A 3ZLZA 1BMLC 4PT5A 3AE9B 2EKIA 4GU2A 3AEGB 1F2RI 4KIKB 2BW2A 2W55A 4ARIA 3ZUNA 4PS3A 3NS8A 3AXCA 2VH2A 1GB1A 3BWUD 5LLIA 2ON8A 2LJIA 4NAMA 1OQRA 3P2BA 2G1EA 2KANA 1V1OA 1BT0A 3WAPA 4BOZB 4AWJA 3N1XC 2N9LA 1YX5B 1J7CA 3HVZA 4OVVA 1WJ6A 1LM8B 4FLHA 1GTHA 3ZJUA 1FNWA 1FXIA 2IZVB 3AEAB 4LJOB 1C4PA 1WX8A 3HIZA 2SEBD 3AE1B 1FIQA 4A20A 5AUKA 1WXQA 4DHJD 5C23A 1UBIA 1DYQA 1WR6E 4H2AA 3ZDMC 3W1SC 3PHXB 1WE6A 4BAXA 4IC7B 2ONQA 2BWES 4ACFA 3R8BA 2HE7A 4NQLB 4XZ4A 1L5PA 3NVYA 3V05A 3DDCB 1STEA 2KQ7A 1KLUD 1SB3C 3H7SA 3EUB2 4A90A 4EUTA 1N61A 5BMIA 5EE9A 5H92C 3RMKC 4OHJA 3KW5B 3RFZB 3ZTDA 4G50A 3CIRB 3UI3A 1UWXA 2J53A 5E6PA 4HPMB 3JYUA 3IAM1 2IBIB 3CSFA 3T3NA 1ZDVA 3AU5A 1WM3A 5GMVA 3P4SB 3B2FA 3DHIC 2JXTA 3P42A 1TKEA 2JRIB 5D6JB 3Q3JA 4HJGE 1V1PA 1PDXA 5EE1A 4W9CA 3PGEA 3B2GA 2YEPB 3Q8FA 4JE3B 3CMMB 1V86A 3A9KA 3OAWA 1JRUA 2MSED 1TJEA 2AYOB 1XCQL 4OZBA 2MBHA 4AQ7A 3APFA 3SFEB 2WXRA 1SGHA 4KIKA 1S1QB 3UQBA 3N30A 1XD3B 2MW5A 2PE6B 1UWMA 4YTPB 1WH3A 3WCQA 4K7UA 4K3CA 2WYQA 5CHFA 1JW9D 3OJ4B 3RI7C 3RNAC 3GOEA 3IVFA 3IHPC 4ANVA 3MJWA 5JXVA 1SBBB 3AE2B 2Z0EB 3PRZA 4S17A 3TCAA 3ZXRA 2L05A 4LTUA 1E10A 1WE7A 1ZP0B 4IW0A 2K5PA 3I9V1 2L76A 2LVPA 4WIPA 3B08A 3LYYA 1LGRA 2ICIA 3GZNI 4B0EA 4A55A 3AE6B 3URYA 1UNSA 2JPHA 2INDC 3WA0A 4X57B 5BMGA 4KKIA 3ZJTA 4MEMA 3ZNGC 1RLFA 2R2OA 1VZ7A 1WGYA 1RFKA 1ZXHA 1V5TA 1XO3A 1C1YB 2IGDA 4NAWB 1XLNA 3QA8A 2DLBA 5C2TB 1HQRD 1E0ZA 2I2YA 2X38A 1LXDA 1L6UA 4E74A 1YJ1A 1GNUA 3PHWB 1Q0WB 1R4NB 3C0RB 3FC4A 3Q69A 2KJ6A 1ZUD2 4AUQC 2KTFA 4NZLB 4RH6A 3BZDB 1M94A 2NMQA 4NJCA 3ZVVA 3GS2A 2M4NA 1HA5A
chains in the Genus database with same CATH topology
2INNE 1TY2A 3EGRA 2DWQA 5EE3A 2H89B 5TSSA 1D5MC 3BYYB 4EE2A 1C9FA 4HRSA 4C80A 3DWMA 4RGOS 2BB6A 4HROA 1HXYD 2IPKD 2V4IB 2L32A 3BVGA 3W9CB 1KRHA 1I4RA 1D4BA 1B1ZA 4N6EB 4WURA 3BK1A 2LHDA 1D5XC 2WXLA 1QLBB 4RFBA 2JYEA 1GAQB 1VZ8A 2IGGA 1SXTA 4TQ0A 2E3TA 1I4XA 3J9CA 3B9JA 4XDCA 4XE0A 3W2DA 4P6VF 3Q8BA 2KDMA 3AEDB 4ITKA 2WXJA 4YWGG 1QQRA 4AS1A 2MJEA 1PGXA 1NENB 2W3SA 1JWMD 3P4RB 1L4DB 1TS3A 5FK9C 1YN3A 3SFDB 4TMAB 1BXTA 2JWUA 1XLPA 2RDGA 5EE0A 1WGKA 4LK0M 1JWSD 2NTTA 2WP9B 1C4AA 2WDVB 1HZ6A 2N9KA 1L4ZB 2Q5WD 1T6BX 2WXQA 1ROEA 3C8YA 1SJED 3HRDD 4ZYSA 2QILA 1K53A 1DOIA 4ZRQA 1K52A 2N7JA 2PW9A 2M0AA 3CWIA 2ZW1A 1XXGA 4MT5A 2LUMA 1FNVA 2DYMA 4HEA1 1IBXB 3AE3B 1P7FA 2PIAA 4OW0A 1CJEA 2IDYA 2PVGC 1E6EB 1TY0A 2WXNA 3I57A 3KWVA 2G9HD 2LGIA 1TS2A 1HZ5A 1GPXA 2H88B 4WWMA 4IOIE 5BYQA 4REZA 4OVZA 4RF1A 1CQVA 4A6QA 2LEKA 4RNAA 1IGDA 2J4XA 4USAA 2GI9A 5HHDG 1SJHD 4JX1C 2L1AA 2XNAC 4ARCA 3H8HA 1N60A 4A9AA 1L0XB 5BYRA 1FXAA 1I4HA 1JWAD 2W3RA 2YEPF 1D6EC 1L6VA 1NYQA 1VR9A 2RPVA 3GB1A 3NVZA 3AN1A 3ZYYX 4C7YA 3SEBA 3VRAB 1I4GA 1YJIA 2M56B 2I38A 2CU3A 2JYTA 4YSXB 3AE8B 1EU4A 2W82A 2JZPA 2ZW0A 1CK1A 3W5VB 1PYWD 3TSSA 1MI0A 1YNTE 3NUHB 1SE3A 5AUIA 1HEZE 1DGJA 3AE5B 4WAFA 5HI1A 1H7WA 3AECB 2Y3AA 1B9RA 2GRIA 4YT0B 3NVWA 3PZ8A 4YTNB 2ACZB 1RWSA 4OZAA 2Y5PA 3IT4B 4C56C 1TS4A 1AYFA 1QOBA 1VZ6A 3Q8AA 2RDHA 2Y5CA 3Q8CA 1XLOA 3HVDA 4N58A 2KN4A 2AQ3B 2WLBA 1PFDA 2HTME 2VZKB 1ACCA 3RPFC 1JWUD 3Q8EA 3SR6A 2FE8A 4R3DA 3AEFB 1GTEA 1JQ4A 1F0ZA 3FILB 1V97A 4L23A 4O1NA 1PUTA 2KAJA 4KKJA 4M0WA 5I4DA 1JCKB 1VLBA 1BUIC 3VRBB 2WXGA 3MJ5A 2GB1A 1MPEA 2JU6X 3N9YC 2INPE 3BVMA 3ABVB 1ET9A 1NI3A 3AMZA 1SEBD 1VJKA 1ZPSA 2QEJC 2W54A 3AE4B 1V1PB 1KF6B 1D5ZC 2JSVX 4B0MA 1ZOYB 2WXMA 3ZQ4A 1ZDXA 4A8XC 2WU2B 1QOGA 1P7EA 1SSNA 2WXKA 2QIEB 1SF0A 1EWYC 4KGSA 1KFYB 1J7AA 2NTSA 1GT8A 2HDEA 4WH4A 2J42A 4DXFA 2WXFA 1EU3A 1AW7A 3VR8B 2PLPA 1BMLC 4PT5A 2WXPA 3AE9B 5G5HA 2EKIA 3AEGB 1F2RI 2BW2A 3TEWA 1JROA 2W55A 1L0VB 4YSZB 1K50A 4ARIA 1QT9A 3FAHA 1TZOA 2WXIA 2QSDA 4KX6B 3BIID 3P63A 1GB1A 3BWUD 4L1BA 1IBXA 1J7BA 2ON8A 1GB4A 2BYTA 2BT6A 2LJIA 3MC0B 4JWUC 4NAMA 1OQRA 1WSPA 4US8A 2BBCA 2G1EA 2IJ0A 5D3DA 1V1OA 1C4CA 4ZOHC 3U4EG 2B76B 3KLSX 5H8YE 5FR3A 1N62A 2OEDA 5GXGB 1Q10A 2N9LA 1DOYA 1J7CA 3HVZA 3AM9A 4YSYB 2CJOA 3TUOA 1GTHA 3ZJUA 1FNWA 1FXIA 2BS4B 2V3NA 3AEAB 1E9MA 4RGNA 3MHZA 1C4PA 4KGRA 5BYSA 1T3QA 1A70A 4DQOC 3LXFA 1YMHE 1EM7A 2SEBD 1OFFA 1AWDA 3AE1B 1FIQA 4US9A 5AUKA 1MHXA 1WXQA 1IGCA 1RYJA 2D5GA 1OQQA 4Q2JA 3NRZA 1DYQA 2DBYA 2WXOA 4H2AA 2K22A 4TQ1A 1UUPA 1FFUA 4P16A 2WU5B 2K9XA 1XCTL 1SIJA 5MPOA 4WQMA 4HKZE 2KQ4X 2ONQA 2WDRB 2L52A 1VDVA 3R8BA 2JQRB 3HUIA 3IT6B 1RM6C 1ENFA 1L5PA 3NVYA 3V05A 2OHFA 4ZRPA 5BMHA 2K3UA 1FNUA 3DWGC 2CJNA 1CZPA 1STEA 2JX5A 3ZJVA 1FEHA 1KLUD 2XN9C 1SB3C 1PGAA 4GDKB 1N5XA 1FM0D 1MHHE 3EUB2 4A90A 3U2SC 1N61A 3AEBB 1I4QA 4J3OD 3TEYA 1MVKA 1KH0A 1QILA 5BMIA 2PMVA 5EE9A 5H92C 2Z8LA 1NYRA 4XDDA 4MM3B 4OHJA 4RCOA 2LFIA 5FKAC 3RFZB 3P1MA 3MFGA 3CIRB 4GDLB 1UWXA 3UI3A 1JMLA 2J53A 1IUEA 4XWWA 4UDUC 1KLGD 3IAM1 1F2RC 3FILA 4DXGA 3T3NA 3V3XA 1FRRA 3ZGZA 1ZDVA 3T3OA 2V3PA 4OZCA 1ZE3D 2QMTA 4JPSA 3P4SB 3B2FA 2JXTA 5G5GA 2MJ3A 3P42A 1VRAB 1TKEA 1FD6A 2WXHA 4YTMB 3P4PB 1C77A 4ZHPA 3BYTB 3MP9A 4HJGE 1V1PA 1YJJA 1PDXA 3NZ3A 1K51A 3U52E 3OWEB 5EE1A 1SE4A 3B2GA 3NS1A 1JALA 3KQ4A 1QOAA 2YEPB 1T5XD 3Q8FA 4JE3B 4RGMA 2QJLA 2BB5A 4N59A 1FRDA 4YXDB 4D2KA 2VZKD 3LB8C 1TJEA 1XCQL 4OZBA 2SAKA 1PGBA 4AQ7A 1YN5A 3SFEB 2WXRA 1XEEA 2IGHA 5D7GA 3GP7A 2WQYB 4C7ZA 4XWTA 3PO0A 1FO4A 3L4PA 3TEXA 1UWMA 5E6JA 1ZXIA 4YTPB 1YQ3B 3PZ7A 5HG2A 3WCQA 2KWDA 3E9SA 1WWTA 2J52A 1JW9D 1QF6A 1C79A 1Y56A 1YQ4B 2FUG1 1GOZA 3KWLA 1SE2A 1AN8A 1UGJA 5JXVA 4KGTA 1I7HA 1SBBB 3AE2B 2R61A 4HKQA 3NVVA 3CF4A 4LTUA 1QOFA 1E10A 2WS3B 1ZP0B 4RGTA 2AQ1B 2K5PA 3I9V1 1FMAD 1F77A 1KTKA 3AB5A 5D3IB 4CQNA 2BTEA 1XF5L 3U7ZA 4WIPA 4L2YA 3VQIA 2MEKA 3LYYA 2L83A 1TS5A 5LNK1 1M4VA 1NVID 4LLGM 3O13A 1EWCA 2ICIA 4B0EA 1L0YB 4JWSC 1WRIA 2FBWB 1JWBD 1E7PB 3W1SA 4A55A 3AEEB 3AE6B 3URYA 2BS2B 1LO5D 1UNSA 1V8CA 3IAS1 4ZHOA 3AV8A 3E56A 1N5WA 2MJDA 4IKGA 4RF0A 3ETRA 4TSSA 5BMGA 4KKIA 4FXCA 3ZJTA 1I4PA 2KMMA 1C76A 1XLQA 3TEZA 3VR9B 5C3JB 2TSSA 1VZ7A 2E6XA 2EELA 2LHEA 3R2TA 1R7SA 2RMMA 1RFKA 1ZXHA 3P4QB 2K0PA 1XO3A 5T8IA 2MH7A 2DYOA 2IGDA 2AX5A 4NAWB 2M19A 1XLNA 2LMCA 3EA6A 3AE7B 1WYGA 3W5UB 1FFVA 2DLBA 5C2TB 2BS3B 1C78A 5HFYA 1ET6A 4MACA 1TKGA 1HQRD 3BK2A 3BVZA 1DOXA 1ESFA 2I2YA 1E0ZA 2X38A 2PTLA 3R2IA 1L6UA 4GLSC 4IDIA 2WNMA 1H7XA 1FCCC 3AH7A 3FC4A 3Q69A 1QKZA 1ZUD2 1N63A 4MH8A 4NZLB 2PVOD 2AQ2B 1NEKB 2KACA 4RH6A 2WDQB 1JRPA 1TYGB 3BZDB 2NMQA 2PKOA 4NJCA 1YN4A 3GS2A 3IXSA 1TKYA 1FCLA 2V0GA 1HA5A 2N0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS4 B;  1YJI A;  2M56 B;  2CU3 A;  2WQY B;  3AEA B;  4C7Z A;  2DWQ A;  1E9M A;  3PO0 A;  5EE3 A;  2H89 B;  1FO4 A;  4YSX B;  3AE8 B;  3L4P A;  1T3Q A;  1UWM A;  1A70 A;  4HRS A;  4C80 A;  3DWM A;  3LXF A;  3W5V B;  1OFF A;  1AWD A;  1ZXI A;  4HRO A;  3AE1 B;  4YTP B;  1YQ3 B;  1FIQ A;  4US9 A;  5AUK A;  1WXQ A;  1RYJ A;  5AUI A;  1OQQ A;  1DGJ A;  3AE5 B;  3WCQ A;  3NRZ A;  3W9C B;  1KRH A;  2DBY A;  4N6E B;  1H7W A;  2K22 A;  3AEC B;  1WWT A;  1B9R A;  4YT0 B;  3NVW A;  1JW9 D;  1QF6 A;  4YTN B;  1FFU A;  2ACZ B;  2WU5 B;  1RWS A;  1YQ4 B;  2K9X A;  1QLB B;  1SIJ A;  3KWL A;  5MPO A;  1AYF A;  1QOB A;  1GAQ B;  4WQM A;  3W5U B;  2WDR B;  2E3T A;  2Y5C A;  2L52 A;  1XLO A;  3B9J A;  1I7H A;  4N58 A;  4P6V F;  3AE2 B;  1VDV A;  2JQR B;  3HUI A;  1RM6 C;  1PFD A;  3AED B;  1L5P A;  2HTM E;  2WLB A;  3NVV A;  3CF4 A;  3NVY A;  4ITK A;  3RPF C;  4LTU A;  1QOF A;  2MJE A;  2OHF A;  1NEN B;  2WS3 B;  2W3S A;  3AEF B;  1GTE A;  3DWG C;  3SR6 A;  1JQ4 A;  1F0Z A;  1ZP0 B;  1CZP A;  2CJN A;  3P4R B;  2JX5 A;  3SFD B;  2K5P A;  1FMA D;  1V97 A;  1XLP A;  1PUT A;  3AB5 A;  2KAJ A;  5EE0 A;  1SB3 C;  1WGK A;  1N5X A;  1VLB A;  1FM0 D;  3VRB B;  3EUB 2;  2L83 A;  2WP9 B;  2WDV B;  1N61 A;  1NVI D;  3ABV B;  3AEB B;  1NI3 A;  4JWS C;  2Q5W D;  3AMZ A;  5EE9 A;  1WRI A;  2FBW B;  1JWB D;  1ROE A;  5H92 C;  1VJK A;  1NYR A;  3HRD D;  2W54 A;  1E7P B;  3AE4 B;  1KF6 B;  3AE6 B;  3AEE B;  1DOI A;  2BS2 B;  1V8C A;  4ZHO A;  3P1M A;  1ZOY B;  3AV8 A;  3CIR B;  1IUE A;  1N5W A;  2MJD A;  2WU2 B;  1QOG A;  3CWI A;  3ETR A;  1FRR A;  1E10 A;  2QIE B;  4FXC A;  1SF0 A;  1EWY C;  3AE3 B;  2KMM A;  2PIA A;  1CJE A;  1XLQ A;  2PVG C;  1KFY B;  3P4S B;  3VR9 B;  1J7A A;  1E6E B;  5C3J B;  3B2F A;  1GT8 A;  5G5G A;  1GPX A;  2MJ3 A;  2H88 B;  3VR8 B;  4WWM A;  1R7S A;  1TKE A;  1RFK A;  4YTM B;  3P4P B;  4ZHP A;  3P4Q B;  1XO3 A;  2MH7 A;  3AE9 B;  2LEK A;  1YJJ A;  2AX5 A;  1PDX A;  2EKI A;  3AEG B;  1XLN A;  2M19 A;  3AE7 B;  1WYG A;  5G5H A;  1FFV A;  1JRO A;  5C2T B;  1L0V B;  2BS3 B;  4YSZ B;  2W55 A;  4USA A;  1QT9 A;  3B2G A;  3FAH A;  3NS1 A;  4JX1 C;  1JAL A;  1TKG A;  4KX6 B;  1N60 A;  3BII D;  3P63 A;  4A9A A;  1DOX A;  1E0Z A;  1QOA A;  1L6U A;  4IDI A;  1J7B A;  1H7X A;  2N0S B;  2BT6 A;  4JWU C;  2QJL A;  1OQR A;  4US8 A;  1GTH A;  1FXA A;  4N59 A;  2G1E A;  3AH7 A;  5EE1 A;  1FRD A;  4YXD B;  3FC4 A;  1JWA D;  3LB8 C;  4ZOH C;  2B76 B;  1ZUD 2;  1N63 A;  1TJE A;  5H8Y E;  1N62 A;  2PVO D;  1NEK B;  2W3R A;  1L6V A;  1NYQ A;  5GXG B;  1DOY A;  1J7C A;  2WDQ B;  1JRP A;  1TYG B;  3HVZ A;  3NVZ A;  2PKO A;  3AM9 A;  3AN1 A;  4YSY B;  2CJO A;  3ZYY X;  4C7Y A;  1TKY A;  3VRA B;  3SFE B;  1FXI A; 
#chains in the Genus database with same CATH topology
 2IO0 B;  2INN E;  2LVO A;  2DWQ A;  2DAF A;  5TSS A;  3BYY B;  4URK A;  1P9D U;  4HRS A;  1RRB A;  4HRO A;  1HXY D;  3DPD A;  4HPL B;  4K1R B;  3BVG A;  2QC8 A;  4MGY E;  4WJO A;  2KC1 A;  3BK1 A;  2JZZ A;  1VD2 A;  4TQ0 A;  4XE0 A;  3B9J A;  2M0X A;  4P6V F;  3ZKJ C;  3R66 C;  2KDM A;  2OOB B;  4BZA A;  4W9K A;  4YWG G;  3CF6 E;  2DZK A;  1NEN B;  2IY1 B;  2O6V B;  1L4D B;  5FK9 C;  1YN3 A;  2MBO A;  1BXT A;  3N20 C;  1TBE A;  1NDD A;  1MG8 A;  1JWS D;  2B3A A;  2N9K A;  4IUM B;  2Q5W D;  1UZX B;  3C8Y A;  3HRD D;  4ZYS A;  4EFO A;  3R7Q A;  1Q1O A;  3DOW A;  1K53 A;  1J19 A;  2FNJ B;  4ZRQ A;  1K52 A;  1RFA A;  3IBE A;  2C9W B;  3RT3 B;  2M0A A;  4LNN A;  1XXG A;  3BY4 B;  2DYM A;  2JUO A;  4OW0 A;  3JVZ X;  1E6E B;  5L95 C;  5JH5 C;  4WJQ A;  4XX5 A;  5BYQ A;  1Z5S B;  1IGD A;  4NNJ B;  1SJH D;  3ZNZ B;  4WAA A;  2CS4 A;  3L17 A;  1FXA A;  3QWZ B;  1WXM A;  1GUA B;  2J0M A;  3GB1 A;  2MQJ A;  4LNI A;  3SEB A;  1T0R C;  3CST A;  3ECI A;  4NAW A;  3DCG A;  2BWF A;  2L7R A;  2K6D B;  2BQQ A;  2JYT A;  4KVG B;  2JZP A;  5J17 A;  4GN1 A;  1P3Q U;  1DGJ A;  4FHJ A;  4WAF A;  5HI1 A;  1H7W A;  3AEC B;  2Y3A A;  3NVW A;  3DBH B;  4YTN B;  4C56 C;  1VZ6 A;  4HDO A;  3RNB C;  2AQ3 B;  3L10 B;  2VZK B;  1ACC A;  3RPF C;  2FE8 A;  3AEF B;  4J6I A;  1F0Z A;  2KMC A;  4O1N A;  1PUT A;  1BUI C;  1IYF A;  2WXG A;  5TR5 A;  4KDI C;  4EZJ A;  3ABV B;  1FXT B;  1NI3 A;  3AMZ A;  1SEB D;  2RPQ A;  1WGG A;  3AI5 A;  2L0F A;  1ZOY B;  1Y8R C;  1EO6 A;  3NY5 A;  2VRR B;  2O6V A;  3NJT A;  1SSN A;  4WJP A;  5CTR C;  5E6N A;  1TIF A;  2NTS A;  1GT8 A;  5LXH A;  2CHZ A;  2JWZ A;  3JW0 X;  1HTQ A;  3VR8 B;  2Y5B B;  2K8B A;  2D07 B;  4AJY B;  4GB9 A;  2C7N B;  1L0V B;  1K50 A;  1QT9 A;  4XC2 A;  2WXI A;  2AEH A;  3O65 B;  4WWN A;  1YX6 B;  3BII D;  3P63 A;  2BYT A;  2BPS A;  2BT6 A;  3MC0 B;  4JWU C;  2KJH B;  2LJ5 A;  5BO4 B;  5H8Y E;  3RUI B;  1N62 A;  4W9D A;  4ANW A;  5GXG B;  1Q10 A;  4E71 A;  1WMH B;  2V3N A;  1E9M A;  3MHZ A;  2MBE A;  2KK8 A;  1OFF A;  1V5O A;  2D3B A;  1MHX A;  2D5G A;  1OQQ A;  3DBR B;  3NRZ A;  3N3K B;  4TQ1 A;  2LZ6 A;  2XEW A;  4GSW A;  3TBL D;  1R4M B;  5MPO A;  4KSL C;  4HKZ E;  2KQ4 X;  1GJZ A;  2L52 A;  4FN2 A;  2FIF A;  2OHF A;  5G55 A;  1FNU A;  3VHT C;  1CZP A;  4GDK A;  2BVC A;  1N5X A;  3APD A;  3U2S C;  3WAL A;  3TEY A;  2EKE C;  4AP4 C;  5FKA C;  3V61 A;  4P1B C;  5AZF A;  1IUE A;  3N32 A;  4XWW A;  1F2R C;  3V3X A;  4FA6 A;  3T3O A;  1ZE3 D;  2QMT A;  3DVG X;  1UGM A;  3UF8 A;  2BYV E;  5G5G A;  4IWQ A;  1WFY A;  4NY0 A;  4DK5 A;  4YTM B;  5KHO A;  4ZHP A;  4FJV B;  3MP9 A;  3NZ3 A;  1K51 A;  2GBN A;  3A33 B;  1SE4 A;  3NS1 A;  2KTR B;  1T5X D;  4LNO A;  2BB5 A;  2X8X X;  4G11 A;  1V2Y A;  1WJU A;  2VZK D;  1WIA A;  2NS5 A;  2W9N A;  3LDZ E;  4M02 A;  4K7S A;  1XEE A;  2IGH A;  5D7G A;  3GP7 A;  2WQY B;  3PO0 A;  1FO4 A;  2MA9 B;  1SE9 A;  4F7Z A;  5E6J A;  1ZXI A;  4LNK A;  2DX5 B;  4OVU A;  4DHZ B;  4HJK A;  4HCN B;  3PZ7 A;  4C4V B;  2V4L A;  2WDT B;  1LQB A;  2KWD A;  2CKH B;  2J52 A;  1WMH A;  3KWL A;  5L83 A;  1SE2 A;  2G3Q B;  1UGJ A;  3VTU A;  2LGS A;  2R61 A;  4EOY A;  2LAS A;  1V6E A;  2NCN A;  1EF5 A;  1F77 A;  2IO2 B;  3EFU A;  3LJ3 A;  4KZ0 A;  4CQN A;  2BTE A;  1XF5 L;  3VQI A;  2ASQ A;  3A9J B;  4L2Y A;  1NVI D;  1N6Z A;  1EWC A;  3HM3 A;  1WRI A;  3A4R A;  4W9L A;  2Z0D B;  3AEE B;  1LO5 D;  3L16 A;  3AV8 A;  3TL5 A;  4EZK A;  3RZW C;  1N5W A;  2BF8 B;  3ETR A;  4MSM B;  4I6P A;  1GC6 A;  4FXC A;  5LXI B;  1I4P A;  2KMM A;  3Q3F A;  1XLQ A;  3TEZ A;  2WX0 A;  4WJN A;  4MJS A;  4TUU A;  2RMM A;  1EUV B;  3V6E B;  1TT5 B;  3P4Q B;  4ZDV A;  3QAQ A;  2KFJ A;  3UIO B;  3EA6 A;  3AE7 B;  4A3O A;  1FFV A;  2IO3 B;  5HFY A;  1ET6 A;  4MAC A;  4HVB A;  2N7D A;  3OJ3 A;  3BVZ A;  4IM2 A;  3RNC C;  1DOX A;  3ALB A;  2PTL A;  3VXW A;  2PE9 A;  5DCN A;  1E8Z A;  1QKZ A;  1N63 A;  1JRP A;  2M17 A;  1TYG B;  1FCL A;  3IXS A;  3PS6 A;  3VUX A;  3VVW B;  3ZO5 B;  1E90 A;  2H89 B;  4DBG A;  2KTR A;  3V6C B;  1D5M C;  4EE2 A;  1C9F A;  1V80 A;  2DZJ A;  4MGI E;  1WGD A;  2BB6 A;  3L08 A;  5DPW A;  3OLM D;  2V4I B;  3W9C B;  4PS8 A;  4WUR A;  2LHD A;  2ZZP B;  1QLB B;  4RFB A;  2JYE A;  4GXB A;  1VZ8 A;  1SXT A;  1I4X A;  4S0R A;  2WXJ A;  2EMS A;  3EEC A;  2W3S A;  3SDL C;  4C4V A;  4TMA B;  3SU8 X;  2RDG A;  3V60 A;  2CHW A;  1EF1 A;  4CO7 A;  4TV3 A;  4LK0 M;  2WDV B;  1HZ6 A;  1L4Z B;  1T6B X;  2I1J A;  1ROE A;  3HM6 X;  2QIL A;  4EZL A;  5AEK B;  1NBF C;  4FHK A;  3QAR A;  2V3S A;  4HEA 1;  3PLV A;  4I6L B;  3KUC B;  1CJE A;  2IDY A;  5IN7 A;  3A9J A;  2WXN A;  1TS2 A;  4MGK E;  4WQO B;  2H88 B;  5IOI A;  3ML8 A;  2PJH A;  1E8X A;  1J8C A;  4RNA A;  2C5L C;  3C19 A;  4USA A;  2GI9 A;  2OJR A;  2AWT A;  4FUL A;  4ARC A;  4C00 A;  1N60 A;  2L8J A;  3DBL I;  1MJD A;  1OQY A;  3DVG Y;  1D6E C;  1NYQ A;  2RPV A;  2GBM A;  3AN1 A;  3HHM A;  3ZTC A;  3VRA B;  3I3T B;  2ZPY A;  2I38 A;  4YSX B;  2K8H A;  4FJY A;  2UYZ B;  2W82 A;  3W5V B;  1PYW D;  1MI0 A;  3NUH B;  1A5R A;  3M3J A;  1ZGU B;  4M01 A;  1HEZ E;  4DHZ E;  3AE5 B;  1B9R A;  2GRI A;  2C7H A;  2LXC A;  2ACZ B;  1RWS A;  4OZA A;  2LD9 A;  2MWS B;  2DYB A;  3TIX A;  1XLO A;  2N7E A;  3VUW A;  2CU1 A;  1JQ4 A;  1KLV A;  4LNF A;  3FIL B;  4DXA B;  2NBV B;  4KKJ A;  1JCK B;  3X23 A;  2KLC A;  2KXJ A;  1KM7 A;  3BVM A;  2XBB C;  1IP9 A;  2JSV X;  1KF6 B;  1D5Z C;  2FCQ A;  4A3P A;  2N4F A;  4W9I A;  1QOG A;  2WXK A;  5E6O A;  3A1Q B;  4LCD E;  1QZE A;  4F1S A;  4IWO A;  1J7A A;  2HDE A;  2LWP A;  3GE8 C;  4B6W A;  4BKT A;  4AOF A;  3N1Y C;  2PLP A;  2WXP A;  1V49 A;  1K8R B;  1E7V A;  1JRO A;  3PVL A;  2KWC A;  5JZE B;  1GB4 A;  4KV2 A;  1WSP A;  4US8 A;  3NOB A;  4ZOH C;  2B76 B;  3V62 A;  2OED A;  4PS7 A;  3L0W B;  3PZD A;  2FCS A;  4JIO U;  4YSY B;  2CJO A;  3U30 A;  4W9G A;  2BS4 B;  1IPG A;  1E8Y A;  2AL6 A;  2RDB C;  4RGN A;  1LFD A;  3ZRC A;  5BYS A;  1T3Q A;  2KDE B;  1A70 A;  4RM9 A;  4DQO C;  1YMH E;  1EM7 A;  2WX1 A;  2KD0 A;  2KFK B;  4US9 A;  4FJZ A;  4FAD A;  1HE8 A;  3D32 A;  2L00 B;  4Q2J A;  4BKS D;  2DBY A;  1I42 A;  3SHQ A;  1FFU A;  4P16 A;  2WU5 B;  2K9X A;  1XQQ A;  1XCT L;  2GOW A;  5D2M B;  1SIJ A;  4LJP B;  4WQM A;  2KDI A;  2WDR B;  1VDV A;  2JQR B;  2QHO A;  3HUI A;  1RM6 C;  1ENF A;  2KN5 A;  4HXD A;  4ZRP A;  5BMH A;  2K3U A;  2MBQ A;  2CJN A;  2KNB A;  2XN9 C;  3IFW B;  4GDK B;  2D3A A;  1FM0 D;  1MHH E;  2MCN B;  3TJP A;  4KZC A;  3AEB B;  1I4Q A;  1MVK A;  1QIL A;  4MM3 A;  4NQK E;  2Z8L A;  1NYR A;  1RAX A;  2KX0 A;  2KWU B;  2LFI A;  3DHG C;  1L2N A;  4GDL B;  4JGH B;  1ZKH A;  4UDU C;  4DXG A;  3FIL A;  1YIW A;  1FRR A;  2NR2 A;  2Z59 B;  3R7R A;  3H7P B;  3ZIM A;  2JY6 A;  3ZNH B;  2KLG A;  2MJ3 A;  2WXH A;  1I35 A;  1KJT A;  3SD5 A;  1WF9 A;  3APC A;  1YJJ A;  3U52 E;  2I1K A;  3PPA A;  4CYE A;  4MEL A;  3KQ4 A;  3A1Q A;  4RGM A;  4PYU A;  2QJL A;  3N1Z C;  4N59 A;  2GMI C;  4KDL B;  1FRD A;  4YXD B;  3Q2A C;  4D2K A;  4M00 A;  3LB8 C;  2BKF A;  1F1H A;  1AAR A;  3DHH C;  2SAK A;  4IWP A;  3I63 C;  3QIJ A;  4XYC A;  4XWT A;  1Q5W B;  3L54 A;  4JQW C;  2NVU I;  1YQ3 B;  4JL9 A;  3Q14 C;  2D2Q A;  3ZRF A;  2JRH A;  3T8M A;  3E9S A;  3GZN B;  2LGD A;  1Y56 A;  3UIN B;  3M95 A;  1GOZ A;  1WR1 A;  4NJ6 A;  2KFK A;  2JXX A;  2RR9 A;  5D94 A;  3CF4 A;  3H6N A;  1QOF A;  1WM2 A;  1MG4 A;  1FMA D;  2LXA A;  2RSU A;  1KTK A;  5D3I B;  1WI0 A;  2MEK A;  4GGQ A;  1VCB A;  1M4V A;  4LLG M;  2BYE A;  2FBW B;  1JWB D;  3W1S A;  4ICU A;  1V8C A;  3IAS 1;  3S2A A;  2V9H A;  3KH0 A;  2MJD A;  4RF0 A;  4ICV A;  1KOT A;  1T0Q C;  4TSS A;  4HPP A;  1C76 A;  3RD2 A;  1WXV A;  5HKH A;  5C3J B;  1S3S G;  2TSS A;  2EEL A;  2LHE A;  4MSQ B;  3RZF A;  2FCN A;  1R7S A;  2OJW A;  3B0A A;  4M8N A;  4MJS B;  4P7I A;  2MH7 A;  2BGF A;  2AX5 A;  2M19 A;  4GDL A;  3ONS A;  3A4S C;  1OTR B;  2KMA A;  4RMA A;  4GLS C;  4IDI A;  2WNM A;  1H7X A;  3I5J C;  3H7P A;  1FCC C;  1YQB A;  4BFR A;  2DEN B;  4JLC A;  3AH7 A;  3X0W A;  2PVO D;  2AQ2 B;  1NEK B;  3PSE B;  2KAC A;  3EHV A;  2PKO A;  1G6J A;  2V0G A;  3ML9 A;  1TY2 A;  3EGR A;  5EE3 A;  4WWP A;  3KYC D;  2LGX A;  4C80 A;  3DWM A;  3RCZ A;  4RGO S;  2DAJ A;  4HWI B;  2IPK D;  2L32 A;  3ZW3 A;  3PLU A;  1KRH A;  1I4R A;  5JHB A;  3RN9 C;  2N9E B;  4M0W B;  2XK5 B;  1D5X C;  2WXL A;  3K9O B;  3QCA A;  2O2V B;  1R4N I;  1GAQ B;  2IGG A;  1WZ0 A;  3J9C A;  3W2D A;  1V81 A;  2GBK A;  4ITK A;  2HJ8 A;  1GC7 A;  4AS1 A;  3H9D A;  2MX2 A;  1U4A A;  2LUE A;  2KHW B;  3RNE C;  5EE0 A;  1TZ1 A;  2D3C A;  1WGK A;  1WXA A;  2LVQ A;  2NTT A;  4M8M A;  1UBQ A;  4NPN A;  2REX A;  2CHX A;  5IKC M;  2N7J A;  4W9J A;  2PW9 A;  2LRW A;  1P1A A;  2KKC A;  1FNV A;  1IBX B;  3AE3 B;  1P7F A;  2PIA A;  3NG0 A;  2INC C;  3KWV A;  2WWZ A;  4W9E A;  1D3Z A;  1GPX A;  4IOI E;  2KWV B;  4REZ A;  5IAA C;  4B9K A;  1CQV A;  3W1Y A;  4HK2 A;  4ZYN A;  2LEK A;  2A4Z A;  5HHD G;  3IG3 A;  2DNF A;  3Q3M C;  1UEL A;  2L1A A;  3PT2 B;  2N9P C;  2NPT B;  3WAN A;  3AU4 A;  2YLM A;  5BYR A;  5DPR A;  4EKU A;  2QDF A;  1I4H A;  1JWA D;  1E7U A;  4QAY A;  2YEP F;  4BBN C;  2NBU A;  2J0K A;  3NVZ A;  3VFK A;  3KUZ A;  1I4G A;  1P98 A;  1YJI A;  1Z2M A;  2HD5 B;  2PEA A;  3RUL A;  2KOX A;  4ANU A;  2ZW0 A;  3TSS A;  3B1L X;  3U8Z A;  2UWQ A;  4LDT D;  4HLE A;  2KZR A;  2N9X A;  2KDB A;  2DZM A;  2Y5P A;  1L7Y A;  2NBW B;  1TS4 A;  2KX3 A;  4BKG A;  1TGZ B;  1AYF A;  5JHA A;  2FUH B;  3M63 B;  3Q8A A;  2AL3 A;  3HVD A;  2KT7 A;  4PYZ A;  2JVC A;  4CHK A;  2HTM E;  3EFC A;  2EMT A;  2D11 A;  2LRU A;  2M1M A;  3PRM B;  4L23 A;  4K7W A;  4M0W A;  3M62 B;  1VLB A;  2XK5 A;  4MGZ E;  2O2V A;  2GB1 A;  2G4S A;  2JU6 X;  3HK0 A;  3N9Y C;  3PRP B;  2K1F A;  3DBH I;  1VJK A;  3VH3 B;  2QEJ C;  4B0M A;  3VAW A;  3ZQ4 A;  1ZDX A;  2C7M B;  1P7E A;  2ZNV C;  2QIE B;  3UGB B;  1EWY C;  2R2Q A;  1FPY A;  2IO1 B;  2ZJD A;  4KGS A;  5FR6 A;  3AUL A;  3QX1 A;  4P1C C;  3VTV A;  3JSV B;  5G5H A;  3TEW A;  4YSZ B;  3FAH A;  1TZO A;  1PQS A;  4TKN A;  2QSD A;  4KX6 B;  2ZVO A;  4L1B A;  4IM0 A;  1IBX A;  1UD7 A;  1J7B A;  3QQ8 B;  4PK1 A;  2J0J A;  2BBC A;  2IJ0 A;  5D3D A;  1C4C A;  3U4E G;  3KLS X;  4ZRJ A;  5FR3 A;  2D3G A;  4FBJ B;  1DOY A;  2DHZ A;  3AM9 A;  3KYD D;  3TUO A;  2MLB A;  1V9J A;  1OEY A;  4W9H A;  4KGR A;  2NPT A;  3LXF A;  3DVN V;  2KQS A;  2MP2 B;  1AWD A;  1YOV B;  1IGC A;  3VDZ A;  1RYJ A;  1OGW A;  5G2N A;  1XT9 B;  3K9P B;  3QC8 B;  2WXO A;  2K22 A;  1UUP A;  4K3B A;  3MC8 A;  3ZXV A;  3TMP B;  2GLS A;  3VTW A;  4II3 B;  1WX9 A;  3Q6B A;  3IT6 B;  4DWF A;  3DWG C;  1TTN A;  2JX5 A;  2LI5 A;  3ZJV A;  2KO3 A;  1FEH A;  4ANX A;  1PGA A;  2HTH A;  3MHS D;  2GBR A;  3DBR I;  1T0Y A;  4J3O D;  1KH0 A;  2PMV A;  1F52 A;  5AZH A;  1WRD B;  4XDD A;  4MM3 B;  1R4M I;  4RCO A;  3KUD B;  3P1M A;  4IG7 B;  4WWO A;  3MFG A;  1JML A;  1KLG D;  4IM3 A;  2MRP A;  3ZGZ A;  2V3P A;  4OZC A;  3DQV A;  4JPS A;  3H1U A;  3PTF C;  1VRA B;  1OEY J;  1FD6 A;  3P4P B;  1C77 A;  1HTO A;  3BYT B;  2ZEQ A;  4G0N B;  2V1Y A;  3OWE B;  4KSK C;  1JAL A;  4G3X B;  1WGR A;  1QOA A;  3MTN B;  3PV1 A;  3ZNI D;  3VH4 B;  3JSV A;  4DDI D;  1PGB A;  2ZCC A;  1YN5 A;  3NZS A;  4C7Z A;  4BKS A;  2KJR A;  3L4P A;  3NZU A;  5CHV C;  3TEX A;  2C60 A;  3ENE A;  3FKY A;  5HG2 A;  5KHQ A;  3VUY A;  4YL8 A;  4BBN F;  1WWT A;  2BKR B;  1QF6 A;  2BYF A;  4HDQ A;  1C79 A;  3UIP B;  1YQ4 B;  2FUG 1;  4HCP B;  1AN8 A;  2FAZ A;  3Q3N C;  4KGT A;  1I7H A;  2A5U A;  4HKQ A;  2MP2 A;  3NVV A;  2K8C A;  1WXS A;  2WS3 B;  3R3M A;  4RGT A;  2AQ1 B;  2KYW A;  3AB5 A;  2WGS A;  1CMX B;  3U7Z A;  2YVC A;  2L83 A;  1TS5 A;  5LNK 1;  3MC9 A;  2CR5 A;  4GMV A;  1E5W A;  2FID A;  3O13 A;  1L0Y B;  4JWS C;  1E7P B;  3WIM A;  2BS2 B;  1MFW A;  4DDG D;  1ISN A;  4ZHO A;  3E56 A;  4IKG A;  1GG3 A;  3QHT A;  3VR9 B;  2E6X A;  3R2T A;  2K0P A;  5T8I A;  5AZG A;  3RNF C;  2DYO A;  3W5U B;  2LMC A;  3EC8 A;  3Q3O C;  1WYG A;  4W9F A;  1C78 A;  2BS3 B;  2KDF B;  2ZVN A;  1TKG A;  3BK2 A;  1ESF A;  3R2I A;  3DVN U;  2MHJ A;  2QCZ A;  4E3C A;  2M8S A;  1WGH A;  4F8C B;  3RYT A;  4MH8 A;  2G4D B;  1H4R A;  2WDQ B;  2IY0 B;  3ZDT A;  1YN4 A;  1TKY A;  2N0S B;  3WAM A;  2MBB B;  2LGY A;  2GBJ A;  1P0R A;  3NHE B;  1D4B A;  1B1Z A;  4N6E B;  2RD0 A;  3KVF B;  2JT4 B;  2JF5 A;  1X1M A;  2E3T A;  4XDC A;  2G45 B;  3Q8B A;  4ZRK A;  1T0S C;  4K81 A;  3AED B;  5IA7 A;  1QQR A;  2FCM A;  2MJE A;  1PGX A;  1JWM D;  1YD8 U;  3P4R B;  1TS3 A;  4B95 A;  4GOC A;  3SFD B;  4BOS C;  2JWU A;  1XLP A;  2ZCB A;  3DBS A;  2IYD B;  4ZRI A;  2HJ1 A;  5J18 A;  2K25 A;  2WP9 B;  1C4A A;  2ZNV B;  2RGF A;  4N9F 4;  3QJZ A;  2WXQ A;  2ZPN A;  1WJ4 A;  1SJE D;  4DHJ B;  1DOI A;  2J7Q B;  5CHW A;  3DBL B;  5DPS A;  4AJW A;  3CWI A;  3PRE A;  2ZW1 A;  5C1Z A;  4MT5 A;  2LUM A;  1WYW B;  4NJ7 A;  2PVG C;  1TY0 A;  3I57 A;  2G9H D;  2LGI A;  2WHI A;  1HZ5 A;  2O6V D;  2KVR A;  4WWM A;  3GE3 C;  3U7D A;  1UF0 A;  4OVZ A;  4RF1 A;  3T9L A;  4BVU C;  4A6Q A;  1J0G A;  1ZW7 A;  3BIN A;  4LDT B;  2J4X A;  4MDK E;  4JX1 C;  2XNA C;  3H8H A;  4A9A A;  1H8C A;  1L0X B;  2L0T A;  3OG5 A;  3UQA A;  3L13 A;  4EEW A;  1WZ3 A;  2K6Q A;  2W3R A;  2KC2 A;  1L6V A;  1VR9 A;  2KVZ A;  2N1V A;  5IO9 A;  4C7Y A;  3ZYY X;  2M56 B;  2CU3 A;  1EU4 A;  3AE8 B;  2JZ3 B;  5EDS A;  1CK1 A;  5IP4 D;  4ASW C;  1YNT E;  1SE3 A;  1F9J A;  1SIF A;  5AUI A;  3RNG C;  2D10 A;  4YT0 B;  4XGA B;  3PZ8 A;  3IT4 B;  1E8W A;  1QOB A;  2K39 A;  4MH0 E;  2RDH A;  2Y5C A;  3Q8C A;  2VH1 A;  4N58 A;  2KN4 A;  2WLB A;  1PFD A;  4II2 B;  1JWU D;  3Q8E A;  3SR6 A;  4GIV A;  4R3D A;  1WX7 A;  1GTE A;  2N1W A;  1V97 A;  1UH6 A;  1WY8 A;  1C3T A;  2KAJ A;  3QK0 A;  5I4D A;  2L3Z A;  3VRB B;  3MJ5 A;  1MPE A;  2INP E;  3WAO A;  2UU7 A;  5J2R A;  1ET9 A;  4RM8 A;  1ZPS A;  2W54 A;  3AE4 B;  1V1P B;  2WXM A;  4A8X C;  4I6N B;  2WU2 B;  5CX3 A;  2PPH A;  1NI2 A;  1SF0 A;  2DZI A;  1KFY B;  5DPT A;  4WH4 A;  2J42 A;  4DXF A;  1WJN A;  2WXF A;  3A9K B;  1EU3 A;  1AW7 A;  3ZLZ A;  1BML C;  4PT5 A;  3AE9 B;  2EKI A;  4GU2 A;  3AEG B;  1F2R I;  4KIK B;  2BW2 A;  2W55 A;  4ARI A;  3ZUN A;  4PS3 A;  3NS8 A;  3AXC A;  2VH2 A;  1GB1 A;  3BWU D;  5LLI A;  2ON8 A;  2LJI A;  4NAM A;  1OQR A;  3P2B A;  2G1E A;  2KAN A;  1V1O A;  1BT0 A;  3WAP A;  4BOZ B;  4AWJ A;  3N1X C;  2N9L A;  1YX5 B;  1J7C A;  3HVZ A;  4OVV A;  1WJ6 A;  1LM8 B;  4FLH A;  1GTH A;  3ZJU A;  1FNW A;  1FXI A;  2IZV B;  3AEA B;  4LJO B;  1C4P A;  1WX8 A;  3HIZ A;  2SEB D;  3AE1 B;  1FIQ A;  4A20 A;  5AUK A;  1WXQ A;  4DHJ D;  5C23 A;  1UBI A;  1DYQ A;  1WR6 E;  4H2A A;  3ZDM C;  3W1S C;  3PHX B;  1WE6 A;  4BAX A;  4IC7 B;  2ONQ A;  2BWE S;  4ACF A;  3R8B A;  2HE7 A;  4NQL B;  4XZ4 A;  1L5P A;  3NVY A;  3V05 A;  3DDC B;  1STE A;  2KQ7 A;  1KLU D;  1SB3 C;  3H7S A;  3EUB 2;  4A90 A;  4EUT A;  1N61 A;  5BMI A;  5EE9 A;  5H92 C;  3RMK C;  4OHJ A;  3KW5 B;  3RFZ B;  3ZTD A;  4G50 A;  3CIR B;  3UI3 A;  1UWX A;  2J53 A;  5E6P A;  4HPM B;  3JYU A;  3IAM 1;  2IBI B;  3CSF A;  3T3N A;  1ZDV A;  3AU5 A;  1WM3 A;  5GMV A;  3P4S B;  3B2F A;  3DHI C;  2JXT A;  3P42 A;  1TKE A;  2JRI B;  5D6J B;  3Q3J A;  4HJG E;  1V1P A;  1PDX A;  5EE1 A;  4W9C A;  3PGE A;  3B2G A;  2YEP B;  3Q8F A;  4JE3 B;  3CMM B;  1V86 A;  3A9K A;  3OAW A;  1JRU A;  2MSE D;  1TJE A;  2AYO B;  1XCQ L;  4OZB A;  2MBH A;  4AQ7 A;  3APF A;  3SFE B;  2WXR A;  1SGH A;  4KIK A;  1S1Q B;  3UQB A;  3N30 A;  1XD3 B;  2MW5 A;  2PE6 B;  1UWM A;  4YTP B;  1WH3 A;  3WCQ A;  4K7U A;  4K3C A;  2WYQ A;  5CHF A;  1JW9 D;  3OJ4 B;  3RI7 C;  3RNA C;  3GOE A;  3IVF A;  3IHP C;  4ANV A;  3MJW A;  5JXV A;  1SBB B;  3AE2 B;  2Z0E B;  3PRZ A;  4S17 A;  3TCA A;  3ZXR A;  2L05 A;  4LTU A;  1E10 A;  1WE7 A;  1ZP0 B;  4IW0 A;  2K5P A;  3I9V 1;  2L76 A;  2LVP A;  4WIP A;  3B08 A;  3LYY A;  1LGR A;  2ICI A;  3GZN I;  4B0E A;  4A55 A;  3AE6 B;  3URY A;  1UNS A;  2JPH A;  2IND C;  3WA0 A;  4X57 B;  5BMG A;  4KKI A;  3ZJT A;  4MEM A;  3ZNG C;  1RLF A;  2R2O A;  1VZ7 A;  1WGY A;  1RFK A;  1ZXH A;  1V5T A;  1XO3 A;  1C1Y B;  2IGD A;  4NAW B;  1XLN A;  3QA8 A;  2DLB A;  5C2T B;  1HQR D;  1E0Z A;  2I2Y A;  2X38 A;  1LXD A;  1L6U A;  4E74 A;  1YJ1 A;  1GNU A;  3PHW B;  1Q0W B;  1R4N B;  3C0R B;  3FC4 A;  3Q69 A;  2KJ6 A;  1ZUD 2;  4AUQ C;  2KTF A;  4NZL B;  4RH6 A;  3BZD B;  1M94 A;  2NMQ A;  4NJC A;  3ZVV A;  3GS2 A;  2M4N A;  1HA5 A; 
#chains in the Genus database with same CATH homology
 2INN E;  1TY2 A;  3EGR A;  2DWQ A;  5EE3 A;  2H89 B;  5TSS A;  1D5M C;  3BYY B;  4EE2 A;  1C9F A;  4HRS A;  4C80 A;  3DWM A;  4RGO S;  2BB6 A;  4HRO A;  1HXY D;  2IPK D;  2V4I B;  2L32 A;  3BVG A;  3W9C B;  1KRH A;  1I4R A;  1D4B A;  1B1Z A;  4N6E B;  4WUR A;  3BK1 A;  2LHD A;  1D5X C;  2WXL A;  1QLB B;  4RFB A;  2JYE A;  1GAQ B;  1VZ8 A;  2IGG A;  1SXT A;  4TQ0 A;  2E3T A;  1I4X A;  3J9C A;  3B9J A;  4XDC A;  4XE0 A;  3W2D A;  4P6V F;  3Q8B A;  2KDM A;  3AED B;  4ITK A;  2WXJ A;  4YWG G;  1QQR A;  4AS1 A;  2MJE A;  1PGX A;  1NEN B;  2W3S A;  1JWM D;  3P4R B;  1L4D B;  1TS3 A;  5FK9 C;  1YN3 A;  3SFD B;  4TMA B;  1BXT A;  2JWU A;  1XLP A;  2RDG A;  5EE0 A;  1WGK A;  4LK0 M;  1JWS D;  2NTT A;  2WP9 B;  1C4A A;  2WDV B;  1HZ6 A;  2N9K A;  1L4Z B;  2Q5W D;  1T6B X;  2WXQ A;  1ROE A;  3C8Y A;  1SJE D;  3HRD D;  4ZYS A;  2QIL A;  1K53 A;  1DOI A;  4ZRQ A;  1K52 A;  2N7J A;  2PW9 A;  2M0A A;  3CWI A;  2ZW1 A;  1XXG A;  4MT5 A;  2LUM A;  1FNV A;  2DYM A;  4HEA 1;  1IBX B;  3AE3 B;  1P7F A;  2PIA A;  4OW0 A;  1CJE A;  2IDY A;  2PVG C;  1E6E B;  1TY0 A;  2WXN A;  3I57 A;  3KWV A;  2G9H D;  2LGI A;  1TS2 A;  1HZ5 A;  1GPX A;  2H88 B;  4WWM A;  4IOI E;  5BYQ A;  4REZ A;  4OVZ A;  4RF1 A;  1CQV A;  4A6Q A;  2LEK A;  4RNA A;  1IGD A;  2J4X A;  4USA A;  2GI9 A;  5HHD G;  1SJH D;  4JX1 C;  2L1A A;  2XNA C;  4ARC A;  3H8H A;  1N60 A;  4A9A A;  1L0X B;  5BYR A;  1FXA A;  1I4H A;  1JWA D;  2W3R A;  2YEP F;  1D6E C;  1L6V A;  1NYQ A;  1VR9 A;  2RPV A;  3GB1 A;  3NVZ A;  3AN1 A;  3ZYY X;  4C7Y A;  3SEB A;  3VRA B;  1I4G A;  1YJI A;  2M56 B;  2I38 A;  2CU3 A;  2JYT A;  4YSX B;  3AE8 B;  1EU4 A;  2W82 A;  2JZP A;  2ZW0 A;  1CK1 A;  3W5V B;  1PYW D;  3TSS A;  1MI0 A;  1YNT E;  3NUH B;  1SE3 A;  5AUI A;  1HEZ E;  1DGJ A;  3AE5 B;  4WAF A;  5HI1 A;  1H7W A;  3AEC B;  2Y3A A;  1B9R A;  2GRI A;  4YT0 B;  3NVW A;  3PZ8 A;  4YTN B;  2ACZ B;  1RWS A;  4OZA A;  2Y5P A;  3IT4 B;  4C56 C;  1TS4 A;  1AYF A;  1QOB A;  1VZ6 A;  3Q8A A;  2RDH A;  2Y5C A;  3Q8C A;  1XLO A;  3HVD A;  4N58 A;  2KN4 A;  2AQ3 B;  2WLB A;  1PFD A;  2HTM E;  2VZK B;  1ACC A;  3RPF C;  1JWU D;  3Q8E A;  3SR6 A;  2FE8 A;  4R3D A;  3AEF B;  1GTE A;  1JQ4 A;  1F0Z A;  3FIL B;  1V97 A;  4L23 A;  4O1N A;  1PUT A;  2KAJ A;  4KKJ A;  4M0W A;  5I4D A;  1JCK B;  1VLB A;  1BUI C;  3VRB B;  2WXG A;  3MJ5 A;  2GB1 A;  1MPE A;  2JU6 X;  3N9Y C;  2INP E;  3BVM A;  3ABV B;  1ET9 A;  1NI3 A;  3AMZ A;  1SEB D;  1VJK A;  1ZPS A;  2QEJ C;  2W54 A;  3AE4 B;  1V1P B;  1KF6 B;  1D5Z C;  2JSV X;  4B0M A;  1ZOY B;  2WXM A;  3ZQ4 A;  1ZDX A;  4A8X C;  2WU2 B;  1QOG A;  1P7E A;  1SSN A;  2WXK A;  2QIE B;  1SF0 A;  1EWY C;  4KGS A;  1KFY B;  1J7A A;  2NTS A;  1GT8 A;  2HDE A;  4WH4 A;  2J42 A;  4DXF A;  2WXF A;  1EU3 A;  1AW7 A;  3VR8 B;  2PLP A;  1BML C;  4PT5 A;  2WXP A;  3AE9 B;  5G5H A;  2EKI A;  3AEG B;  1F2R I;  2BW2 A;  3TEW A;  1JRO A;  2W55 A;  1L0V B;  4YSZ B;  1K50 A;  4ARI A;  1QT9 A;  3FAH A;  1TZO A;  2WXI A;  2QSD A;  4KX6 B;  3BII D;  3P63 A;  1GB1 A;  3BWU D;  4L1B A;  1IBX A;  1J7B A;  2ON8 A;  1GB4 A;  2BYT A;  2BT6 A;  2LJI A;  3MC0 B;  4JWU C;  4NAM A;  1OQR A;  1WSP A;  4US8 A;  2BBC A;  2G1E A;  2IJ0 A;  5D3D A;  1V1O A;  1C4C A;  4ZOH C;  3U4E G;  2B76 B;  3KLS X;  5H8Y E;  5FR3 A;  1N62 A;  2OED A;  5GXG B;  1Q10 A;  2N9L A;  1DOY A;  1J7C A;  3HVZ A;  3AM9 A;  4YSY B;  2CJO A;  3TUO A;  1GTH A;  3ZJU A;  1FNW A;  1FXI A;  2BS4 B;  2V3N A;  3AEA B;  1E9M A;  4RGN A;  3MHZ A;  1C4P A;  4KGR A;  5BYS A;  1T3Q A;  1A70 A;  4DQO C;  3LXF A;  1YMH E;  1EM7 A;  2SEB D;  1OFF A;  1AWD A;  3AE1 B;  1FIQ A;  4US9 A;  5AUK A;  1MHX A;  1WXQ A;  1IGC A;  1RYJ A;  2D5G A;  1OQQ A;  4Q2J A;  3NRZ A;  1DYQ A;  2DBY A;  2WXO A;  4H2A A;  2K22 A;  4TQ1 A;  1UUP A;  1FFU A;  4P16 A;  2WU5 B;  2K9X A;  1XCT L;  1SIJ A;  5MPO A;  4WQM A;  4HKZ E;  2KQ4 X;  2ONQ A;  2WDR B;  2L52 A;  1VDV A;  3R8B A;  2JQR B;  3HUI A;  3IT6 B;  1RM6 C;  1ENF A;  1L5P A;  3NVY A;  3V05 A;  2OHF A;  4ZRP A;  5BMH A;  2K3U A;  1FNU A;  3DWG C;  2CJN A;  1CZP A;  1STE A;  2JX5 A;  3ZJV A;  1FEH A;  1KLU D;  2XN9 C;  1SB3 C;  1PGA A;  4GDK B;  1N5X A;  1FM0 D;  1MHH E;  3EUB 2;  4A90 A;  3U2S C;  1N61 A;  3AEB B;  1I4Q A;  4J3O D;  3TEY A;  1MVK A;  1KH0 A;  1QIL A;  5BMI A;  2PMV A;  5EE9 A;  5H92 C;  2Z8L A;  1NYR A;  4XDD A;  4MM3 B;  4OHJ A;  4RCO A;  2LFI A;  5FKA C;  3RFZ B;  3P1M A;  3MFG A;  3CIR B;  4GDL B;  1UWX A;  3UI3 A;  1JML A;  2J53 A;  1IUE A;  4XWW A;  4UDU C;  1KLG D;  3IAM 1;  1F2R C;  3FIL A;  4DXG A;  3T3N A;  3V3X A;  1FRR A;  3ZGZ A;  1ZDV A;  3T3O A;  2V3P A;  4OZC A;  1ZE3 D;  2QMT A;  4JPS A;  3P4S B;  3B2F A;  2JXT A;  5G5G A;  2MJ3 A;  3P42 A;  1VRA B;  1TKE A;  1FD6 A;  2WXH A;  4YTM B;  3P4P B;  1C77 A;  4ZHP A;  3BYT B;  3MP9 A;  4HJG E;  1V1P A;  1YJJ A;  1PDX A;  3NZ3 A;  1K51 A;  3U52 E;  3OWE B;  5EE1 A;  1SE4 A;  3B2G A;  3NS1 A;  1JAL A;  3KQ4 A;  1QOA A;  2YEP B;  1T5X D;  3Q8F A;  4JE3 B;  4RGM A;  2QJL A;  2BB5 A;  4N59 A;  1FRD A;  4YXD B;  4D2K A;  2VZK D;  3LB8 C;  1TJE A;  1XCQ L;  4OZB A;  2SAK A;  1PGB A;  4AQ7 A;  1YN5 A;  3SFE B;  2WXR A;  1XEE A;  2IGH A;  5D7G A;  3GP7 A;  2WQY B;  4C7Z A;  4XWT A;  3PO0 A;  1FO4 A;  3L4P A;  3TEX A;  1UWM A;  5E6J A;  1ZXI A;  4YTP B;  1YQ3 B;  3PZ7 A;  5HG2 A;  3WCQ A;  2KWD A;  3E9S A;  1WWT A;  2J52 A;  1JW9 D;  1QF6 A;  1C79 A;  1Y56 A;  1YQ4 B;  2FUG 1;  1GOZ A;  3KWL A;  1SE2 A;  1AN8 A;  1UGJ A;  5JXV A;  4KGT A;  1I7H A;  1SBB B;  3AE2 B;  2R61 A;  4HKQ A;  3NVV A;  3CF4 A;  4LTU A;  1QOF A;  1E10 A;  2WS3 B;  1ZP0 B;  4RGT A;  2AQ1 B;  2K5P A;  3I9V 1;  1FMA D;  1F77 A;  1KTK A;  3AB5 A;  5D3I B;  4CQN A;  2BTE A;  1XF5 L;  3U7Z A;  4WIP A;  4L2Y A;  3VQI A;  2MEK A;  3LYY A;  2L83 A;  1TS5 A;  5LNK 1;  1M4V A;  1NVI D;  4LLG M;  3O13 A;  1EWC A;  2ICI A;  4B0E A;  1L0Y B;  4JWS C;  1WRI A;  2FBW B;  1JWB D;  1E7P B;  3W1S A;  4A55 A;  3AEE B;  3AE6 B;  3URY A;  2BS2 B;  1LO5 D;  1UNS A;  1V8C A;  3IAS 1;  4ZHO A;  3AV8 A;  3E56 A;  1N5W A;  2MJD A;  4IKG A;  4RF0 A;  3ETR A;  4TSS A;  5BMG A;  4KKI A;  4FXC A;  3ZJT A;  1I4P A;  2KMM A;  1C76 A;  1XLQ A;  3TEZ A;  3VR9 B;  5C3J B;  2TSS A;  1VZ7 A;  2E6X A;  2EEL A;  2LHE A;  3R2T A;  1R7S A;  2RMM A;  1RFK A;  1ZXH A;  3P4Q B;  2K0P A;  1XO3 A;  5T8I A;  2MH7 A;  2DYO A;  2IGD A;  2AX5 A;  4NAW B;  2M19 A;  1XLN A;  2LMC A;  3EA6 A;  3AE7 B;  1WYG A;  3W5U B;  1FFV A;  2DLB A;  5C2T B;  2BS3 B;  1C78 A;  5HFY A;  1ET6 A;  4MAC A;  1TKG A;  1HQR D;  3BK2 A;  3BVZ A;  1DOX A;  1ESF A;  2I2Y A;  1E0Z A;  2X38 A;  2PTL A;  3R2I A;  1L6U A;  4GLS C;  4IDI A;  2WNM A;  1H7X A;  1FCC C;  3AH7 A;  3FC4 A;  3Q69 A;  1QKZ A;  1ZUD 2;  1N63 A;  4MH8 A;  4NZL B;  2PVO D;  2AQ2 B;  1NEK B;  2KAC A;  4RH6 A;  2WDQ B;  1JRP A;  1TYG B;  3BZD B;  2NMQ A;  2PKO A;  4NJC A;  1YN4 A;  3GS2 A;  3IXS A;  1TKY A;  1FCL A;  2V0G A;  1HA5 A;  2N0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...