4YSZB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yszB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yszB01
3FAHA 4US9A 4YSZB 1QT9A 3AV8A 5EE1A 1E0ZA 3NS1A 3AN1A 1RYJA 2W3SA 3FC4A 4HROA 1PFDA 1YJIA 2CJOA 5MPOA 3AE4B 5C2TB 1EWYC 1KF6B 1ZOYB 1FRDA 2DBYA 2WU5B 2BS4B 1SIJA 1JALA 1RFKA 1OQQA 3HVZA 3DWGC 1L6VA 2KAJA 1NEKB 1FIQA 2LEKA 4P6VF 3BIID 2K22A 2HTME 1SB3C 1J7AA 2BS2B 1FFUA 4YXDB 2PIAA 3NRZA 3NVZA 4ITKA 1J7BA 1IUEA 3AH7A 3DWMA 4JWUC 5H8YE 4C80A 3AB5A 4N6EB 3P4RB 1YQ3B 2PVOD 2WDQB 1CJEA 5G5HA 3RPFC 1L5PA 1ZUD2 3AEGB 3AEAB 1SF0A 2N0SB 4FXCA 1V8CA 3VRAB 1FO4A 2AX5A 1E6EB 3AEDB 2W3RA 2ACZB 3AE5B 1OFFA 3W5VB 2CJNA 1JRPA 1TKEA 1QLBB 1WRIA 1JROA 1TJEA 4A9AA 2B76B 1OQRA 1QOAA 4C7YA 3VR8B 4N59A 2MJDA 3AM9A 3WCQA 1N60A 1NENB 2H89B 3B9JA 1N62A 2JQRB 1DOXA 2L83A 1FXAA 3B2FA 3AE9B 2DWQA 1T3QA 2M56B 3AE1B 1B9RA 1N63A 4YSXB 1PDXA 1CZPA 1VDVA 3NVVA 3P63A 3AECB 3KWLA 5G5GA 1DOYA 4JWSC 2BS3B 1E10A 3ZYYX 2CU3A 1H7XA 1XLQA 3AMZA 3NVWA 1XLPA 4WWMA 4HRSA 1TKYA 1GTEA 3B2GA 2Y5CA 3HRDD 1ZP0B 2WQYB 1WXQA 3AE2B 1JWAD 1XLNA 3W9CB 3SFEB 3SR6A 4ZHOA 1F0ZA 2PKOA 2WU2B 3AEBB 1AWDA 1QOBA 1VJKA 4N58A 4YSYB 1N61A 1YJJA 1JWBD 3NVYA 3W5UB 3L4PA 2QIEB 1AYFA 1DGJA 1FMAD 1UWMA 4JX1C 5EE3A 4US8A 3AEEB 1NYRA 1WWTA 3HUIA 2BT6A 5AUIA 5AUKA 4WQMA 4IDIA 2QJLA 1QOGA 1GPXA 3AE7B 2W55A 1N5WA 2W54A 1KRHA 2WDVB 2K9XA 2M19A 1PUTA 4KX6B 2MH7A 3P4SB 3ABVB 3AE6B 3SFDB 1JW9D 2Q5WD 5EE9A 1FRRA 1VLBA 1ZXIA 4YT0B 1L6UA 4YTPB 2MJEA 2WP9B 1V97A 3P4QB 1NVID 1FFVA 1RM6C 1E9MA 2JX5A 1N5XA 1J7CA 1I7HA 2EKIA 2KMMA 1L0VB 1WGKA 2G1EA 1R7SA 2E3TA 2OHFA 4USAA 2K5PA 3VRBB 1DOIA 1NYQA 2FBWB 1YQ4B 4YTMB 2WS3B 2PVGC 1XLOA 1GT8A 1KFYB 4ZHPA 5EE0A 1RWSA 1JQ4A 1GAQB 3CIRB 1FM0D 3ETRA 3P1MA 1QF6A 3LXFA 5C3JB 1QOFA 1ROEA 1XO3A 1E7PB 2WDRB 3CF4A 1WYGA 4ZOHC 3AE8B 1FXIA 3CWIA 1TKGA 4LTUA 5GXGB 5H92C 1GTHA 1H7WA 3AEFB 2MJ3A 3EUB2 3LB8C 4C7ZA 2WLBA 3AE3B 3PO0A 1A70A 1TYGB 2H88B 1NI3A 4YTNB 3VR9B 3P4PB 2L52A
chains in the Genus database with same CATH superfamily
1KM7A 4YWGG 1PFDA 4M0WB 4PYZA 3A33B 1R4NB 2ZW0A 2RSUA 2BS4B 3NS8A 1JALA 3MC9A 3P42A 4PT5A 5IO9A 1L6VA 1YD8U 1P7FA 2V4LA 3OWEB 5D3DA 2KZRA 3EGRA 1WGHA 4GMVA 3ZTDA 2PVOD 1NI2A 4LNOA 1FO4A 2WXJA 3KUZA 4DHZB 4WJQA 4EZKA 2B76B 4C7YA 2KFKA 2KJRA 3DBHI 4EOYA 4TV3A 2G9HD 1N62A 3WANA 3MJWA 3L13A 1C78A 4AWJA 3HRDD 1WXQA 4A6QA 1HZ5A 1K53A 3AU5A 4A8XC 4F8CB 2K3UA 4W9HA 1OQYA 1WGYA 2N9KA 1UGMA 2C5LC 2N1VA 2WXLA 1HTOA 2KTFA 4NJ7A 1WE6A 4WJNA 4CO7A 5EE9A 1FRRA 4LDTD 3PTFC 2O2VA 3ZTCA 4W9EA 4EEWA 4DDGD 4MDKE 3DBHB 2FAZA 1N5XA 2VH1A 3PREA 5BMHA 4CYEA 3ZLZA 5IKCM 4GGQA 4K3CA 2FNJB 2ASQA 1FM0D 1TS3A 3R2IA 1QF6A 2NMQA 1Q5WB 3ZJVA 1EU3A 5DPSA 5TR5A 2Y3AA 4EE2A 4FA6A 4J3OD 1WMHA 3EA6A 4LNIA 5EE1A 2LMCA 2B3AA 1Q1OA 1RYJA 4ANWA 4HROA 1ZPSA 2ZPYA 2LI5A 4IW0A 4KKJA 4P6VF 3BIID 2KVZA 2BWFA 3L0WB 1SB3C 3RD2A 4LLGM 3T3NA 4H2AA 4JWUC 2ZPNA 2GBMA 4P7IA 2ZCCA 2LXCA 4FXCA 2V9HA 2I38A 1P3QU 4LNNA 3IG3A 2RMMA 1F9JA 2IDYA 3R7QA 2JYTA 1AARA 1OQRA 4KDIC 3B9JA 4PS7A 2JQRB 2L83A 3KH0A 1HZ6A 1VR9A 2EMTA 3Q3FA 2KFKB 1ZDXA 1J8CA 1MHHE 4K7SA 3K9OB 2WQYB 3BK1A 3NZSA 2WXPA 2WXIA 3ZJUA 2RD0A 3W5UB 1LQBA 2UU7A 2LHEA 2NTSA 1T0QC 3BVMA 4A55A 1E7UA 2BKRB 1UZXB 2BT6A 5AUIA 4BKTA 2O6VA 4IWOA 1QOGA 2FUG1 4GIVA 2MH7A 2KWCA 3MHZA 2KQSA 3SFDB 3H9DA 2HJ1A 4GDKA 2MJEA 1C3TA 3Q8CA 1F2RC 2V3PA 1V5TA 2KDMA 4FHKA 2O2VB 2RR9A 1GT8A 2WXQA 3APDA 4K3BA 3ZRCA 4MACA 3ZNZB 1FXIA 2X38A 5JZEB 3MC8A 2FCNA 1SIFA 2DYBA 3FKYA 1GOZA 1TYGB 3N20C 3V60A 3GOEA 1YJIA 2AYOB 2NBVB 3Q8AA 1C76A 1C4AA 1OQQA 4AJYB 2KAJA 3I5JC 3ONSA 2WWZA 1SGHA 3DPDA 4C80A 1BXTA 4K7UA 1WI0A 1D6EC 1V2YA 3I63C 3BY4B 2MW5A 3W5VB 3UIOB 3C0RB 2JF5A 4HDQA 1H4RA 4RMAA 4NNJB 2IO0B 1T0SC 3H6NA 2LGYA 5FK9C 2ZJDA 5BYQA 2AL6A 1B9RA 1CZPA 5IN7A 2ZEQA 3V3XA 3X0WA 3A1QA 2BPSA 3IVFA 2IPKD 1TS5A 4FBJB 2LGIA 1D5MC 1UD7A 3SR6A 5JH5C 4AJWA 4W9FA 4D2KA 2JZZA 3DVNV 3OG5A 1WY8A 5AUKA 3VQIA 3AE7B 2PLPA 4GSWA 3ABVB 3U7DA 4A90A 2DENB 1JW9D 1MVKA 2A5UA 4HJKA 2O6VB 2R2QA 2JVCA 4QAYA 2Z0DB 3H7PB 5AZFA 2KMMA 3HVDA 4I6LB 4GDKB 2KD0A 2L7RA 2QSDA 3CIRB 2AWTA 2PEAA 3VUXA 4EFOA 3ML8A 2C9WB 2PE9A 2J0JA 3C19A 3CWIA 3H8HA 3PO0A 1NI3A 4DQOC 1ZXHA 4GDLB 3PLUA 3ZVVA 1EWYC 2DBYA 1FRDA 1AN8A 1UWXA 3VVWB 2D2QA 3NJTA 3RZWC 3HVZA 3DWGC 1U4AA 2BVCA 4M8NA 3RNBC 2LGSA 1JRUA 4N6EB 3HM6X 1CJEA 3TSSA 1C4PA 3RCZA 4MJSA 1P0RA 4LCDE 4BOZB 1WF9A 1ZE3D 5CX3A 2NPTB 1WJNA 4KGTA 4N59A 1I4HA 1HEZE 3SHQA 5JHBA 2DYMA 1FNWA 1C77A 1VDVA 3U8ZA 2VH2A 4TSSA 4HDOA 4TMAB 5LXHA 1BT0A 1RFAA 3GB1A 1HE8A 1TGZB 1K51A 2PPHA 3C8YA 3A9JA 3L4PA 3M95A 4MELA 1I4QA 3A1QB 4JE3B 3ZNGC 1L4ZB 2VZKB 3R3MA 3QK0A 1QQRA 4OW0A 3MFGA 4ZRQA 3AE6B 2DX5B 2Q5WD 1TT5B 4G11A 1E8WA 1V49A 1V80A 2TSSA 1P9DU 2E3TA 5E6OA 3UINB 2CHXA 1EF1A 1TBEA 5G2NA 1HXYD 3DVNU 5JHAA 1XO3A 2J42A 3KVFB 1GTHA 1C4CA 1SJED 4IM0A 2RDGA 1A70A 4JL9A 3FAHA 2INNE 2D11A 4ACFA 4JQWC 4K1RB 1ZOYB 3I9V1 5HKHA 1XT9B 4HPMB 2N9XA 3VTWA 3GE3C 2K22A 4YXDB 3DHGC 2WXOA 3BINA 2RPVA 3Q8BA 2HDEA 3P4RB 3Q6BA 4C56C 3HHMA 2G3QB 4DHJD 4I6NB 3Q8FA 2LJ5A 1WSPA 2ICIA 4G50A 1R4MI 4LDTB 2K39A 3VR8B 1NENB 4F1SA 1BUIC 2HJ8A 2XEWA 4DXFA 5G5GA 1T0RC 2GLSA 4DBGA 5CHFA 4HXDA 1A5RA 1ENFA 1J19A 3AE2B 3L10B 2RDHA 2W9NA 1AW7A 2L05A 1FMAD 4HK2A 1GPXA 3RYTA 3L17A 2YVCA 1HQRD 3NHEB 1WR1A 1YOVB 1L6UA 1R4MB 2C7NB 3VTVA 1V6EA 2GBNA 4RGTA 3W1SA 3E9SA 3BZDB 1GB4A 1T6BX 4WWNA 4WAFA 3UGBB 4LNKA 3RMKC 3NOBA 4BVUC 1Q10A 4A3OA 4BKSD 3ALBA 4FULA 3ZQ4A 4MT5A 1H7WA 3QAQA 3LB8C 3VH3B 1ZDVA 1VZ6A 3RNEC 1WZ0A 4IUMB 2YEPF 4IOIE 1QT9A 1E0ZA 4G0NB 2D3AA 1JCKB 4RH6A 1PYWD 4BZAA 4O1NA 3U30A 4XWWA 3TMPB 3OJ3A 2WNMA 4W9IA 1XCTL 1YQ3B 1ET9A 2VZKD 3CSFA 5JXVA 1I4PA 2KLCA 4P1BC 2ZCBA 1XF5L 1NDDA 1OFFA 3R66C 1BMLC 4W9GA 3FILA 2EMSA 4B6WA 1D4BA 5LNK1 1N60A 2KQ4X 2FIFA 2DZIA 1E5WA 5BYRA 4GU2A 3T3OA 3W1YA 1TZOA 2KDFB 3ZYYX 2IY0B 3H1UA 1JWAD 4E71A 4DHZE 1VJKA 2J0KA 4TQ1A 1YJJA 1WM2A 4KZ0A 1L0XB 1LGRA 3A4RA 4KZCA 1D5ZC 1UBQA 3VAWA 2M19A 2FE8A 2KLGA 2XK5A 2NR2A 3JSVA 3KW5B 3AULA 4IWQA 3DBRI 4FN2A 1YN4A 2G1EA 3Q8EA 5BO4B 3TL5A 3IHPC 4DXAB 4ZHPA 1TS4A 3KLSX 4BAXA 3EC8A 3I57A 2NBWB 3URYA 2WHIA 2NBUA 4L2YA 4BOSC 4ZYSA 4US9A 4WIPA 4TQ0A 1V1PA 2WU5B 3PZ8A 1WGGA 4KIKA 3IXSA 1J7BA 2ONQA 2N7JA 3DWMA 2QCZA 1C79A 4MGIE 2KVRA 2X8XX 3N32A 3ZNID 1ZUD2 3PZ7A 2NS5A 3R8BA 2KC1A 4NPNA 1IGDA 1UF0A 1UBIA 2GOWA 4NZLB 3EFUA 4OZBA 1WJUA 3A4SC 1JWUD 3OJ4B 3FILB 3ECIA 2DHZA 1E10A 2A4ZA 2AQ2B 3B2GA 2Y5CA 2LGDA 3W9CB 2REXA 1VCBA 2PKOA 4RM8A 1AWDA 3TUOA 1N6ZA 4XWTA 3APCA 3V05A 1AYFA 1DGJA 4HCNB 2N7DA 3Q3NC 1L4DB 3NZ3A 1JWMD 2WXMA 3BK2A 2LVQA 1PUTA 3NG0A 4XC2A 3ZDMC 2V3NA 5J2RA 2BYTA 3RULA 1IPGA 1RM6C 2V3SA 3R7RA 3CMMB 2MX2A 2XK5B 2K8CA 3W2DA 1ZKHA 3JSVB 3VRBB 3QJZA 2LUMA 4LJPB 4RF1A 1MFWA 3AU4A 4MGZE 3UF8A 4BKGA 1E7PB 5LXIB 2MP2A 3H7PA 3TEXA 1YN5A 2IGHA 5L95C 1GUAB 2H88B 3P4PB 1I4GA 3Q3MC 4KDLB 1IYFA 2DZMA 3TEWA 2WXHA 3PPAA 2MRPA 2FUHB 4RGOS 2MSED 5D94A 2KDBA 1WXAA 4GOCA 2JXXA 4NQLB 1IP9A 2HTME 2KWUB 2BS2B 3BYYB 3VUYA 5J17A 2DYOA 4IKGA 1V1PB 3RT3B 1SSNA 3AB5A 1ESFA 4REZA 1FNUA 4GDLA 1FXTB 4L23A 3RPFC 3Q2AC 3AEAB 3WIMA 1QZEA 1KH0A 1SXTA 4JGHB 1FCLA 4KIKB 3AEDB 3K9PB 3QHTA 3TIXA 3O13A 4M02A 3ZDTA 2IO3B 5E6PA 4A9AA 2ZW1A 2IBIB 3WCQA 2ZNVB 5DCNA 2BYFA 2N9EB 1PQSA 1DYQA 3NVVA 1ISNA 3NY5A 2CU3A 2JRIB 1XLQA 3Q14C 3E56A 3WAOA 4BBNC 2NPTA 4WQOB 2LASA 1L2NA 2HE7A 3QX1A 1UWMA 3RNCC 5BYSA 1LXDA 3CF6E 3MC0B 4IDIA 3RI7C 1XQQA 2ZZPB 1TS2A 2K9XA 4N9F4 4AUQC 1TY0A 2GBKA 4CQNA 2I2YA 2JXTA 2FCMA 3UI3A 1FFVA 2KJ6A 4A20A 4HJGE 1WGKA 2FCQA 3PT2B 1MG4A 4C4VA 4GN1A 1DOIA 1NYQA 1PGAA 2WS3B 3V6CB 2RDBC 1XLOA 5T8IA 1KFYB 4AOFA 5EE0A 5HI1A 2LWPA 1ROEA 4DHJB 4GLSC 1EWCA 4HPLB 3TCAA 4EZLA 3Q69A 2D5GA 4C7ZA 4AQ7A 2GI9A 5HFYA 4S0RA 1PGBA 1S1QB 2WXNA 4DDID 3AV8A 2MP2B 5GMVA 5D2MB 2WDTB 4WWPA 2JY6A 1WJ6A 1SIJA 1RFKA 3DQVA 2KDIA 5G55A 4GB9A 2XNAC 3IBEA 2LFIA 4W9JA 4ITKA 1UGJA 2MEKA 4TKNA 2CKHB 2M0AA 1IBXA 2AQ3B 4XDCA 1K50A 3DHHC 1TKEA 1CK1A 3OLMD 2N9PC 3EFCA 2L1AA 2BQQA 5AEKB 2MJDA 3TEYA 1WGRA 3AE1B 1N63A 2I1JA 3AECB 1XLPA 4RGMA 1TKYA 2Z59B 3SFEB 3U7ZA 1F0ZA 2KYWA 4N58A 3PS6A 1F1HA 1KOTA 2IGDA 4R3DA 3DHIC 4KX6B 2N1WA 3S2AA 3QC8B 2JYEA 1ZXIA 1VLBA 3HIZA 3IT6B 4FADA 2WP9B 1V97A 2MCNB 4OZCA 3V6EB 1VD2A 1XXGA 3L54A 1SE9A 1G6JA 2JT4B 2PVGC 1EO6A 2INPE 1OGWA 1WX8A 1CQVA 2M8SA 4C00A 3P1MA 3LXFA 1HTQA 2PJHA 4C4VB 4OVZA 2KO3A 2KMCA 2M0XA 1KLGD 2V4IB 5H92C 1KLUD 5IA7A 1HA5A 3DOWA 3VTUA 4ARIA 4ASWC 4NJ6A 1F52A 3RNGC 5KHOA 4FHJA 5CHVC 2OOBB 2JSVX 3U52E 5C2TB 1MPEA 1KJTA 1ET6A 2KKCA 4MH0E 4IM3A 1J7AA 2PIAA 4IC7B 1IUEA 3AH7A 1WJ4A 2IJ0A 1OEYA 5G5HA 2EELA 1V8CA 1E6EB 3AE5B 1I42A 1JRPA 4HKQA 2PE6B 1WX7A 4DXGA 3JW0X 4KSLC 1IBXB 1DOXA 2DWQA 4L1BA 5L83A 4TUUA 3KUCB 3IT4B 1STEA 4YSXB 3PHWB 4WWMA 3AMZA 1TZ1A 5IAAC 4NQKE 3PRPB 4PK1A 4OHJA 2N9LA 4HEA1 4ICUA 4RNAA 4KGSA 5KHQA 4K7WA 3P2BA 3SU8X 3P4SB 4YTPB 1K52A 2LZ6A 2QMTA 3JVZX 4IM2A 4FJZA 1WZ3A 1L0VB 2KX3A 2YEPB 1WH3A 1Z2MA 3ZXVA 1T0YA 3T9LA 3MTNB 3ZUNA 1ZW7A 5FR6A 1GC6A 1TY2A 2WDRB 1ZGUB 4ZOHC 5C23A 4FJYA 1TKGA 5GXGB 1C9FA 3D32A 1GG3A 1RRBA 4ZRJA 2D07B 2WXKA 1YJ1A 3AXCA 3ENEA 2L52A 4E3CA 2IO1B 3AN1A 3FC4A 3AE4B 2GMIC 4MSMB 1JWSD 3ZKJC 1NEKB 5I4DA 2L00B 4MGKE 4WURA 4CHKA 4OZAA 1WE7A 1L5PA 4EKUA 4FLHA 2L0TA 4ANVA 4ZRPA 1F77A 4W9DA 3DVGY 1QLBB 1TJEA 2KWVB 5FKAC 3UQAA 3RNAC 2H89B 4JLCA 1C1YB 2FCSA 1WIAA 2FIDA 2Z8LA 4K81A 2J4XA 2HTHA 1QOBA 2L76A 2MBQA 4HKZE 4M8MA 1EF5A 1SJHD 2IO2B 3N1ZC 3AEEB 3HUIA 2KC2A 2LHDA 2M17A 1N5WA 2KANA 3J9CA 3V62A 2BF8B 1H8CA 1TIFA 1V5OA 3U4EG 1J7CA 1I7HA 2EKIA 3VDZA 2BWES 2K5PA 1MJDA 2FBWB 3UIPB 2J52A 2K6QA 2BBCA 1YIWA 3ETRA 5C3JB 1QOFA 3I3TB 3QIJA 5E6JA 2NVUI 3KUDB 2MJ3A 4FJVB 3B1LX 1F2RI 2MWSB 1CMXB 1I35A 3V61A 2V1YA 3TBLD 3BYTB 2LJIA 4G3XB 4W9CA 2W3SA 4XX5A 2CJOA 5MPOA 4B0MA 3KYCD 2J53A 1FIQA 4KV2A 5LLIA 5H8YE 2E6XA 1E8XA 4WJOA 2KXJA 4MH8A 1SE4A 4MSQB 3Q3JA 3AEGB 4KVGB 2M4NA 4NAMA 2KMAA 2QEJC 3GZNI 2PTLA 2Y5BB 3O65B 4W9KA 3TJPA 4EZJA 4MEMA 1WGDA 1WRDB 2MA9B 1WYWB 2G45B 4EUTA 3B2FA 3AE9B 2G4DB 2MBBB 3DBRB 2K0PA 1MG8A 4JWSC 4RGNA 3GP7A 1MI0A 4ZHOA 1FPYA 3BVGA 3PRMB 1V1OA 1EM7A 2WU2B 4YSYB 3M63B 4URKA 3KQ4A 1JWBD 2ZVOA 4JX1C 2QILA 3B08A 4XGAB 3DCGA 2JU6X 2W54A 5DPRA 2CHZA 1YN3A 3GZNB 1FNVA 1YQBA 2IY1B 1YMHE 2M1MA 3ZJTA 3TEZA 2KWDA 3B0AA 2AL3A 1R7SA 2JWZA 5TSSA 3WAPA 3MP9A 3KYDD 3ZIMA 2RPQA 2L0FA 2XBBC 2JPHA 4HVBA 3ZRFA 1WYGA 2LGXA 4ARCA 1FD6A 5HHDG 1Q0WB 4E74A 4W9LA 3EUB2 1RAXA 2IYDB 2ZVNA 2BB5A 3SDLC 1YNTE 3MJ5A 4I6PA 4HCPB 2BW2A 2MHJA 1EU4A 2MQJA 4P16A 5FR3A 1P1AA 3PLVA 1WXSA 3QQ8B 2D10A 3WAMA 3LDZE 3W1SC 3ZXRA 2W3RA 2ACZB 1QKZA 3HM3A 1M94A 2BB6A 1WXVA 3M3JA 2DAFA 1VZ8A 4BBNF 3T8MA 1FXAA 3NZUA 3ZNHB 2W82A 2BS3B 5BMIA 2CU1A 1H7XA 2KFJA 2RGFA 3VUWA 1N61A 2YLMA 3NVYA 4ICVA 4NJCA 2PMVA 2LUEA 3AI5A 3U2SC 1QILA 1SEBD 2QJLA 2W55A 1JMLA 4XYCA 2WXRA 3WA0A 3Q3OC 4YT0B 2LD9A 4BKSA 3P4QB 3BWUD 1P98A 2JX5A 1E9MA 2KHWB 4HWIB 2MLBA 1VRAB 4XZ4A 4KKIA 1FEHA 4PYUA 3RFZB 1YQ4B 4YTMB 1WMHB 2KN5A 2GBJA 1LO5D 3CF4A 4M00A 5AZGA 1J0GA 1XD3B 3OAWA 1UH6A 5CHWA 1KTKA 4YTNB 4YSZB 1GC7A 3QARA 4MM3A 4GXBA 5J18A 2UYZB 2C60A 1UUPA 1KF6B 2JWUA 2KDEB 2WX0A 1V9JA 2KQ7A 2KOXA 3PGEA 3RUIB 2LEKA 2CR5A 3HK0A 1FFUA 5HG2A 1NBFC 2CHWA 2BYEA 3ZW3A 1WXMA 3GS2A 3UQBA 1OTRB 3VRAB 1UELA 4AP4C 4Q2JA 2KTRA 2CJNA 3DBSA 5D6JB 2INCC 4PS3A 3SD5A 4PS8A 2DAJA 2WGSA 3EHVA 3L16A 1K8RB 3PVLA 3QCAA 3KWLA 2GRIA 4NAWA 2BGFA 5AZHA 2QHOA 4LJOB 3N30A 2N4FA 4HLEA 2BTEA 3N1YC 2PW9A 1WM3A 2LRWA 2G4SA 2QIEB 2IZVB 4US8A 1IGCA 4B95A 2C7MB 4WQMA 2DNFA 2BKFA 3ZO5B 1KRHA 3ZGZA 1X1MA 2K6DB 2LRUA 3DVGX 4LNFA 4B9KA 2QDFA 4ZYNA 1E8ZA 4ANUA 2Y5PA 2ZNVC 3VHTC 1XCQL 2L32A 2J0MA 1L0YB 5EDSA 1GB1A 3KWVA 4WWOA 4USAA 1OEYJ 2K25A 4X57B 4LK0M 1JQ4A 1GAQB 4HPPA 4WJPA 3IAM1 4IG7B 4XE0A 4RF0A 5E6NA 2V0GA 1I4RA 1SBBB 2IGGA 1V81A 3LYYA 2UWQA 2WLBA 2WYQA 1KLVA 1DOYA 3NS1A 5C1ZA 1WR6E 3RN9C 5D3IB 1YX6B 2INDC 4M01A 4P1CC 4UDUC 3N1XC 4MM3B 2EKEC 1L7YA 3NVZA 4JIOU 3SEBA 1FCCC 2DLBA 3LJ3A 2DZJA 1WX9A 2WDQB 2JZPA 2N0SB 1Z5SB 1Y56A 2AX5A 1P7EA 2LVPA 2XN9C 2QC8A 4MGYE 1GNUA 3A9KA 2R61A 1Y8RC 3DDCB 3N3KB 1QOAA 3L08A 2DZKA 2BYVE 1PGXA 3DBLI 4B0EA 2KTRB 1T3QA 3VH4B 2OEDA 2D3CA 1PDXA 2AEHA 3P63A 5DPTA 4ZRIA 2JUOA 1SE2A 3NVWA 3PSEB 4KSKC 1XLNA 2KK8A 3MHSD 2SEBD 4NAWB 2NTTA 3IAS1 2C7HA 5EE3A 1NYRA 2WXGA 1WWTA 1E8YA 2KN4A 2L8JA 4OVUA 2WDVB 1RLFA 3EECA 5CTRC 2N7EA 1GJZA 1B1ZA 2K8BA 2K8HA 2LXAA 5BMGA 4ANXA 2KT7A 4II3B 2OJRA 3DBLB 2AQ1B 2D3GA 1MHXA 1ACCA 2KX0A 2Z0EB 4XDDA 3AE8B 1EUVB 1TTNA 4LTUA 1T5XD 2D3BA 4M0WA 1YX5B 3GE8C 4DK5A 2ON8A 3N9YC 4J6IA 2GBRA 1D5XC 2O6VD 3QWZB 4ZDVA 5IP4D 4MJSB 1LM8B 4YL8A 3NRZA 3VXWA 2WX1A 1WFYA 3PZDA 4WH4A 4BFRA 1SF0A 4RM9A 2J7QB 1D3ZA 3PRZA 3ML9A 1WRIA 1JROA 4RCOA 4DWFA 3H7SA 3AM9A 2CS4A 1SE3A 3WALA 3X23A 3A9JB 3NUHB 3A9KB 1M4VA 2M56B 2K1FA 2JZ3B 3R2TA 2I1KA 2OJWA 4OVVA 4HRSA 1GTEA 3VFKA 1ZP0B 2R2OA 4ZRKA 4NY0A 3AEBB 5IOIA 3JYUA 1E7VA 2MBOA 4RFBA 4IWPA 2SAKA 4JPSA 1LFDA 2GB1A 4AS1A 3PV1A 1I4XA 1R4NI 2JRHA 2MBHA 1XEEA 2VRRB 2KNBA 3M62B 2HD5B 5DPWA 1NVID 1V86A 4F7ZA 2NCNA 2LVOA 2L3ZA 2OHFA 3IFWB 3BVZA 4WAAA 1RWSA 1S3SG 3QA8A 1E90A 2KJHB 4A3PA 3APFA 4II2B 3CSTA 4S17A 4KGRA 3PHXB 3RNFC 1VZ7A 2KACA 1UNSA 5D7GA 3AEFB 2WXFA 3AE3B 3RZFA 2MBEA 3VR9B
chains in the Genus database with same CATH topology
2WXNA 2INNE 3FAHA 3MJ5A 3AV8A 4YWGG 1PFDA 1ZOYB 3I9V1 2BW2A 2ZW0A 1EU4A 2BS4B 1SIJA 1JALA 1RFKA 3P42A 4PT5A 1L6VA 1P7FA 2XNAC 3OWEB 2K22A 4P16A 5D3DA 2LFIA 3EGRA 5FR3A 4ITKA 4YXDB 2WXOA 1UGJA 2MEKA 2RPVA 3Q8BA 2HDEA 3P4RB 2PVOD 4C56C 2M0AA 1FO4A 2WXJA 1IBXA 2AQ3B 3Q8FA 4XDCA 2W3RA 2ACZB 1K50A 1TKEA 1CK1A 1WSPA 2ICIA 1QKZA 2BB6A 2L1AA 2B76B 4C7YA 3VR8B 2MJDA 1NENB 1VZ8A 3TEYA 2G9HD 1N62A 1FXAA 3AE1B 1BUIC 1N63A 4DXFA 3AECB 1C78A 5G5GA 2W82A 2BS3B 5BMIA 1H7XA 1XLPA 4RGMA 1TKYA 3HRDD 1ENFA 1WXQA 4A6QA 3AE2B 3SFEB 1HZ5A 1K53A 3U7ZA 1F0ZA 2RDHA 4N58A 1N61A 3NVYA 1AW7A 4A8XC 2K3UA 1FMAD 4NJCA 2IGDA 4R3DA 2PMVA 2N9KA 3U2SC 1QILA 1SEBD 2QJLA 1GPXA 2WXLA 2W55A 1JMLA 4KX6B 1HQRD 2WXRA 2JYEA 5EE9A 1FRRA 1VLBA 1ZXIA 4YT0B 1L6UA 3IT6B 2WP9B 1V97A 3P4QB 3BWUD 2JX5A 1E9MA 1N5XA 4OZCA 1VRAB 1XXGA 4RGTA 4KKIA 1FEHA 3W1SA 3E9SA 5BMHA 3RFZB 1YQ4B 3BZDB 4YTMB 1T6BX 4WAFA 1GB4A 2PVGC 2INPE 1CQVA 1FM0D 1TS3A 3P1MA 3R2IA 1QF6A 3LXFA 2NMQA 1LO5D 3ZJVA 1EU3A 3CF4A 1Q10A 4OVZA 2Y3AA 4EE2A 1KLGD 2V4IB 4MT5A 5H92C 1H7WA 3ZQ4A 3LB8C 1HA5A 1ZDVA 1VZ6A 4J3OD 4ARIA 1KTKA 3EA6A 4YTNB 2YEPF 4IOIE 4YSZB 1QT9A 1E0ZA 5EE1A 2LMCA 1RYJA 2JSVX 4HROA 1JCKB 1UUPA 3U52E 5C2TB 4RH6A 1KF6B 1ZPSA 1MPEA 1PYWD 2JWUA 1ET6A 4KKJA 4O1NA 2LEKA 4P6VF 3BIID 4XWWA 1SB3C 1J7AA 1FFUA 4LLGM 2PIAA 5HG2A 3T3NA 4H2AA 1IUEA 3AH7A 4JWUC 2WNMA 1XCTL 2IJ0A 3GS2A 1YQ3B 5G5HA 1ET9A 2VZKD 5JXVA 4FXCA 1I4PA 2EELA 1V8CA 3VRAB 1E6EB 2I38A 1XF5L 4Q2JA 3AE5B 1OFFA 2RMMA 2CJNA 2IDYA 1BMLC 1JRPA 4HKQA 2JYTA 3FILA 1D4BA 1OQRA 4DXGA 5LNK1 1N60A 3B9JA 1IBXB 2KQ4X 2JQRB 1DOXA 2L83A 2DWQA 4L1BA 1HZ6A 1VR9A 3IT4B 1STEA 5BYRA 4YSXB 3T3OA 2GRIA 3KWLA 1TZOA 3ZYYX 4WWMA 3AMZA 1ZDXA 1MHHE 2WQYB 1JWAD 3BK1A 2BTEA 4OHJA 2WXPA 1VJKA 2PW9A 2WXIA 4TQ1A 1YJJA 3ZJUA 2N9LA 4HEA1 3W5UB 2QIEB 2LHEA 2NTSA 3BVMA 4A55A 1L0XB 4US8A 1IGCA 4RNAA 4KGSA 2BT6A 5AUIA 4WQMA 1QOGA 2FUG1 1D5ZC 1KRHA 2M19A 3ZGZA 2MH7A 2FE8A 3P4SB 3MHZA 3SFDB 4YTPB 2MJEA 2Y5PA 3Q8CA 1F2RC 1K52A 2QMTA 1XCQL 2L32A 1L0YB 1YN4A 2V3PA 1GB1A 1L0VB 2G1EA 3Q8EA 3KWVA 2YEPB 2KDMA 4USAA 4LK0M 1JQ4A 1GT8A 4ZHPA 2WXQA 1GAQB 1TS4A 4MACA 3IAM1 1TY2A 2WDRB 4XE0A 4RF0A 4ZOHC 2V0GA 3KLSX 1FXIA 1I4RA 1SBBB 2X38A 3I57A 1TKGA 2IGGA 5GXGB 1C9FA 3URYA 3LYYA 2WLBA 2WXKA 4L2YA 4ZYSA 1GOZA 1TYGB 1DOYA 2L52A 4US9A 3NS1A 3AN1A 3FC4A 4WIPA 1YJIA 5D3IB 3AE4B 4UDUC 4TQ0A 1V1PA 3Q8AA 2WU5B 1C76A 1C4AA 1OQQA 1JWSD 2KAJA 1NEKB 5I4DA 3PZ8A 4MM3B 3NVZA 3SEBA 1FCCC 3IXSA 1J7BA 2ONQA 2N7JA 2DLBA 3DWMA 4WURA 4C80A 1BXTA 1C79A 4OZAA 2WDQB 1D6EC 1L5PA 1ZUD2 3PZ7A 2JZPA 2N0SB 1Y56A 2AX5A 1P7EA 3R8BA 2XN9C 4ZRPA 3W5VB 1F77A 2R61A 1QLBB 1TJEA 1IGDA 1QOAA 5FKAC 4NZLB 1PGXA 2H89B 4OZBA 5FK9C 5BYQA 4B0EA 1T3QA 1JWUD 1B9RA 2OEDA 3P63A 1PDXA 1CZPA 3FILB 1E10A 2Z8LA 1SE2A 3NVWA 3V3XA 2AQ2B 3B2GA 2Y5CA 2IPKD 1TS5A 2J4XA 1XLNA 3W9CB 2LGIA 1D5MC 3SR6A 2PKOA 1AWDA 1QOBA 4HKZE 3TUOA 2SEBD 4NAWB 4XWTA 2NTTA 1SJHD 3V05A 1AYFA 1DGJA 3IAS1 4D2KA 5EE3A 3AEEB 1L4DB 1NYRA 2WXGA 3NZ3A 1JWMD 1WWTA 2KN4A 3HUIA 2WXMA 5AUKA 3VQIA 2LHDA 3AE7B 3BK2A 2PLPA 1N5WA 2WDVB 1PUTA 3ABVB 4A90A 1JW9D 1MVKA 1B1ZA 3J9CA 2V3NA 5BMGA 2BYTA 1RM6C 3U4EG 1J7CA 1I7HA 2EKIA 2AQ1B 2KMMA 3HVDA 3W2DA 1MHXA 4GDKB 2K5PA 3VRBB 2FBWB 2LUMA 1ACCA 2J52A 4RF1A 2QSDA 2BBCA 3CIRB 3ETRA 5C3JB 1QOFA 1E7PB 4XDDA 5E6JA 3AE8B 3CWIA 3TEXA 3H8HA 4LTUA 1T5XD 2MJ3A 1YN5A 4M0WA 2IGHA 3PO0A 1F2RI 2H88B 1NI3A 4DQOC 3P4PB 2ON8A 3N9YC 1I4GA 3BYTB 2LJIA 2W3SA 1ZXHA 3TEWA 2CJOA 4GDLB 5MPOA 1EWYC 2DBYA 1D5XC 1FRDA 1AN8A 1UWXA 2WXHA 4B0MA 4RGOS 3HVZA 2J53A 3DWGC 1FIQA 2HTME 2BS2B 3BYYB 3NRZA 2DYOA 5H8YE 4IKGA 1V1PB 2E6XA 1SSNA 3AB5A 1ESFA 4REZA 1FNUA 4N6EB 4MH8A 4L23A 1SE4A 1CJEA 3TSSA 3RPFC 4WH4A 1C4PA 3AEGB 3AEAB 1SF0A 1KH0A 1SXTA 1FCLA 4NAMA 3AEDB 2QEJC 2PTLA 3O13A 1WRIA 1JROA 1ZE3D 4A9AA 4RCOA 2ZW1A 4KGTA 4N59A 1I4HA 3AM9A 1HEZE 3WCQA 1SE3A 3B2FA 3AE9B 1DYQA 3NUHB 1M4VA 2M56B 2DYMA 1FNWA 1C77A 1VDVA 3NVVA 2K0PA 3R2TA 4TSSA 4JWSC 2CU3A 4TMAB 1XLQA 4RGNA 4HRSA 3E56A 1GTEA 3GP7A 1ZP0B 1MI0A 3GB1A 4ZHOA 3BVGA 1V1OA 1EM7A 2WU2B 3AEBB 4YSYB 1K51A 3KQ4A 1JWBD 3C8YA 4RFBA 3L4PA 1I4QA 1UWMA 4JE3B 4JX1C 2QILA 1L4ZB 2VZKB 5BYSA 2SAKA 4JPSA 3MC0B 4IDIA 1QQRA 2GB1A 2JU6X 2W54A 4OW0A 1TS2A 2K9XA 4AS1A 1TY0A 1YN3A 1I4XA 3MFGA 3AE6B 4ZRQA 4CQNA 2Q5WD 1FNVA 2I2YA 1XEEA 1YMHE 2JXTA 3UI3A 1NVID 1FFVA 3ZJTA 3TEZA 2KWDA 4HJGE 1WGKA 2TSSA 1R7SA 2E3TA 2OHFA 5TSSA 1DOIA 1NYQA 1PGAA 3BVZA 2WS3B 3MP9A 1XLOA 1HXYD 1KFYB 5T8IA 5EE0A 1RWSA 5HI1A 1ROEA 4GLSC 1XO3A 1WYGA 2J42A 4ARCA 1EWCA 1FD6A 4KGRA 1VZ7A 5HHDG 2KACA 1UNSA 3Q69A 5D7GA 1GTHA 1C4CA 2D5GA 3AEFB 1SJED 2WXFA 3EUB2 2RDGA 4C7ZA 4AQ7A 3AE3B 2GI9A 5HFYA 1A70A 2BB5A 1PGBA 1KLUD 3VR9B 1YNTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAH A;  4US9 A;  4YSZ B;  1QT9 A;  3AV8 A;  5EE1 A;  1E0Z A;  3NS1 A;  3AN1 A;  1RYJ A;  2W3S A;  3FC4 A;  4HRO A;  1PFD A;  1YJI A;  2CJO A;  5MPO A;  3AE4 B;  5C2T B;  1EWY C;  1KF6 B;  1ZOY B;  1FRD A;  2DBY A;  2WU5 B;  2BS4 B;  1SIJ A;  1JAL A;  1RFK A;  1OQQ A;  3HVZ A;  3DWG C;  1L6V A;  2KAJ A;  1NEK B;  1FIQ A;  2LEK A;  4P6V F;  3BII D;  2K22 A;  2HTM E;  1SB3 C;  1J7A A;  2BS2 B;  1FFU A;  4YXD B;  2PIA A;  3NRZ A;  3NVZ A;  4ITK A;  1J7B A;  1IUE A;  3AH7 A;  3DWM A;  4JWU C;  5H8Y E;  4C80 A;  3AB5 A;  4N6E B;  3P4R B;  1YQ3 B;  2PVO D;  2WDQ B;  1CJE A;  5G5H A;  3RPF C;  1L5P A;  1ZUD 2;  3AEG B;  3AEA B;  1SF0 A;  2N0S B;  4FXC A;  1V8C A;  3VRA B;  1FO4 A;  2AX5 A;  1E6E B;  3AED B;  2W3R A;  2ACZ B;  3AE5 B;  1OFF A;  3W5V B;  2CJN A;  1JRP A;  1TKE A;  1QLB B;  1WRI A;  1JRO A;  1TJE A;  4A9A A;  2B76 B;  1OQR A;  1QOA A;  4C7Y A;  3VR8 B;  4N59 A;  2MJD A;  3AM9 A;  3WCQ A;  1N60 A;  1NEN B;  2H89 B;  3B9J A;  1N62 A;  2JQR B;  1DOX A;  2L83 A;  1FXA A;  3B2F A;  3AE9 B;  2DWQ A;  1T3Q A;  2M56 B;  3AE1 B;  1B9R A;  1N63 A;  4YSX B;  1PDX A;  1CZP A;  1VDV A;  3NVV A;  3P63 A;  3AEC B;  3KWL A;  5G5G A;  1DOY A;  4JWS C;  2BS3 B;  1E10 A;  3ZYY X;  2CU3 A;  1H7X A;  1XLQ A;  3AMZ A;  3NVW A;  1XLP A;  4WWM A;  4HRS A;  1TKY A;  1GTE A;  3B2G A;  2Y5C A;  3HRD D;  1ZP0 B;  2WQY B;  1WXQ A;  3AE2 B;  1JWA D;  1XLN A;  3W9C B;  3SFE B;  3SR6 A;  4ZHO A;  1F0Z A;  2PKO A;  2WU2 B;  3AEB B;  1AWD A;  1QOB A;  1VJK A;  4N58 A;  4YSY B;  1N61 A;  1YJJ A;  1JWB D;  3NVY A;  3W5U B;  3L4P A;  2QIE B;  1AYF A;  1DGJ A;  1FMA D;  1UWM A;  4JX1 C;  5EE3 A;  4US8 A;  3AEE B;  1NYR A;  1WWT A;  3HUI A;  2BT6 A;  5AUI A;  5AUK A;  4WQM A;  4IDI A;  2QJL A;  1QOG A;  1GPX A;  3AE7 B;  2W55 A;  1N5W A;  2W54 A;  1KRH A;  2WDV B;  2K9X A;  2M19 A;  1PUT A;  4KX6 B;  2MH7 A;  3P4S B;  3ABV B;  3AE6 B;  3SFD B;  1JW9 D;  2Q5W D;  5EE9 A;  1FRR A;  1VLB A;  1ZXI A;  4YT0 B;  1L6U A;  4YTP B;  2MJE A;  2WP9 B;  1V97 A;  3P4Q B;  1NVI D;  1FFV A;  1RM6 C;  1E9M A;  2JX5 A;  1N5X A;  1J7C A;  1I7H A;  2EKI A;  2KMM A;  1L0V B;  1WGK A;  2G1E A;  1R7S A;  2E3T A;  2OHF A;  4USA A;  2K5P A;  3VRB B;  1DOI A;  1NYQ A;  2FBW B;  1YQ4 B;  4YTM B;  2WS3 B;  2PVG C;  1XLO A;  1GT8 A;  1KFY B;  4ZHP A;  5EE0 A;  1RWS A;  1JQ4 A;  1GAQ B;  3CIR B;  1FM0 D;  3ETR A;  3P1M A;  1QF6 A;  3LXF A;  5C3J B;  1QOF A;  1ROE A;  1XO3 A;  1E7P B;  2WDR B;  3CF4 A;  1WYG A;  4ZOH C;  3AE8 B;  1FXI A;  3CWI A;  1TKG A;  4LTU A;  5GXG B;  5H92 C;  1GTH A;  1H7W A;  3AEF B;  2MJ3 A;  3EUB 2;  3LB8 C;  4C7Z A;  2WLB A;  3AE3 B;  3PO0 A;  1A70 A;  1TYG B;  2H88 B;  1NI3 A;  4YTN B;  3VR9 B;  3P4P B;  2L52 A; 
#chains in the Genus database with same CATH topology
 1KM7 A;  4YWG G;  1PFD A;  4M0W B;  4PYZ A;  3A33 B;  1R4N B;  2ZW0 A;  2RSU A;  2BS4 B;  3NS8 A;  1JAL A;  3MC9 A;  3P42 A;  4PT5 A;  5IO9 A;  1L6V A;  1YD8 U;  1P7F A;  2V4L A;  3OWE B;  5D3D A;  2KZR A;  3EGR A;  1WGH A;  4GMV A;  3ZTD A;  2PVO D;  1NI2 A;  4LNO A;  1FO4 A;  2WXJ A;  3KUZ A;  4DHZ B;  4WJQ A;  4EZK A;  2B76 B;  4C7Y A;  2KFK A;  2KJR A;  3DBH I;  4EOY A;  4TV3 A;  2G9H D;  1N62 A;  3WAN A;  3MJW A;  3L13 A;  1C78 A;  4AWJ A;  3HRD D;  1WXQ A;  4A6Q A;  1HZ5 A;  1K53 A;  3AU5 A;  4A8X C;  4F8C B;  2K3U A;  4W9H A;  1OQY A;  1WGY A;  2N9K A;  1UGM A;  2C5L C;  2N1V A;  2WXL A;  1HTO A;  2KTF A;  4NJ7 A;  1WE6 A;  4WJN A;  4CO7 A;  5EE9 A;  1FRR A;  4LDT D;  3PTF C;  2O2V A;  3ZTC A;  4W9E A;  4EEW A;  4DDG D;  4MDK E;  3DBH B;  2FAZ A;  1N5X A;  2VH1 A;  3PRE A;  5BMH A;  4CYE A;  3ZLZ A;  5IKC M;  4GGQ A;  4K3C A;  2FNJ B;  2ASQ A;  1FM0 D;  1TS3 A;  3R2I A;  1QF6 A;  2NMQ A;  1Q5W B;  3ZJV A;  1EU3 A;  5DPS A;  5TR5 A;  2Y3A A;  4EE2 A;  4FA6 A;  4J3O D;  1WMH A;  3EA6 A;  4LNI A;  5EE1 A;  2LMC A;  2B3A A;  1Q1O A;  1RYJ A;  4ANW A;  4HRO A;  1ZPS A;  2ZPY A;  2LI5 A;  4IW0 A;  4KKJ A;  4P6V F;  3BII D;  2KVZ A;  2BWF A;  3L0W B;  1SB3 C;  3RD2 A;  4LLG M;  3T3N A;  4H2A A;  4JWU C;  2ZPN A;  2GBM A;  4P7I A;  2ZCC A;  2LXC A;  4FXC A;  2V9H A;  2I38 A;  1P3Q U;  4LNN A;  3IG3 A;  2RMM A;  1F9J A;  2IDY A;  3R7Q A;  2JYT A;  1AAR A;  1OQR A;  4KDI C;  3B9J A;  4PS7 A;  2JQR B;  2L83 A;  3KH0 A;  1HZ6 A;  1VR9 A;  2EMT A;  3Q3F A;  2KFK B;  1ZDX A;  1J8C A;  1MHH E;  4K7S A;  3K9O B;  2WQY B;  3BK1 A;  3NZS A;  2WXP A;  2WXI A;  3ZJU A;  2RD0 A;  3W5U B;  1LQB A;  2UU7 A;  2LHE A;  2NTS A;  1T0Q C;  3BVM A;  4A55 A;  1E7U A;  2BKR B;  1UZX B;  2BT6 A;  5AUI A;  4BKT A;  2O6V A;  4IWO A;  1QOG A;  2FUG 1;  4GIV A;  2MH7 A;  2KWC A;  3MHZ A;  2KQS A;  3SFD B;  3H9D A;  2HJ1 A;  4GDK A;  2MJE A;  1C3T A;  3Q8C A;  1F2R C;  2V3P A;  1V5T A;  2KDM A;  4FHK A;  2O2V B;  2RR9 A;  1GT8 A;  2WXQ A;  3APD A;  4K3B A;  3ZRC A;  4MAC A;  3ZNZ B;  1FXI A;  2X38 A;  5JZE B;  3MC8 A;  2FCN A;  1SIF A;  2DYB A;  3FKY A;  1GOZ A;  1TYG B;  3N20 C;  3V60 A;  3GOE A;  1YJI A;  2AYO B;  2NBV B;  3Q8A A;  1C76 A;  1C4A A;  1OQQ A;  4AJY B;  2KAJ A;  3I5J C;  3ONS A;  2WWZ A;  1SGH A;  3DPD A;  4C80 A;  1BXT A;  4K7U A;  1WI0 A;  1D6E C;  1V2Y A;  3I63 C;  3BY4 B;  2MW5 A;  3W5V B;  3UIO B;  3C0R B;  2JF5 A;  4HDQ A;  1H4R A;  4RMA A;  4NNJ B;  2IO0 B;  1T0S C;  3H6N A;  2LGY A;  5FK9 C;  2ZJD A;  5BYQ A;  2AL6 A;  1B9R A;  1CZP A;  5IN7 A;  2ZEQ A;  3V3X A;  3X0W A;  3A1Q A;  2BPS A;  3IVF A;  2IPK D;  1TS5 A;  4FBJ B;  2LGI A;  1D5M C;  1UD7 A;  3SR6 A;  5JH5 C;  4AJW A;  4W9F A;  4D2K A;  2JZZ A;  3DVN V;  3OG5 A;  1WY8 A;  5AUK A;  3VQI A;  3AE7 B;  2PLP A;  4GSW A;  3ABV B;  3U7D A;  4A90 A;  2DEN B;  1JW9 D;  1MVK A;  2A5U A;  4HJK A;  2O6V B;  2R2Q A;  2JVC A;  4QAY A;  2Z0D B;  3H7P B;  5AZF A;  2KMM A;  3HVD A;  4I6L B;  4GDK B;  2KD0 A;  2L7R A;  2QSD A;  3CIR B;  2AWT A;  2PEA A;  3VUX A;  4EFO A;  3ML8 A;  2C9W B;  2PE9 A;  2J0J A;  3C19 A;  3CWI A;  3H8H A;  3PO0 A;  1NI3 A;  4DQO C;  1ZXH A;  4GDL B;  3PLU A;  3ZVV A;  1EWY C;  2DBY A;  1FRD A;  1AN8 A;  1UWX A;  3VVW B;  2D2Q A;  3NJT A;  3RZW C;  3HVZ A;  3DWG C;  1U4A A;  2BVC A;  4M8N A;  3RNB C;  2LGS A;  1JRU A;  4N6E B;  3HM6 X;  1CJE A;  3TSS A;  1C4P A;  3RCZ A;  4MJS A;  1P0R A;  4LCD E;  4BOZ B;  1WF9 A;  1ZE3 D;  5CX3 A;  2NPT B;  1WJN A;  4KGT A;  4N59 A;  1I4H A;  1HEZ E;  3SHQ A;  5JHB A;  2DYM A;  1FNW A;  1C77 A;  1VDV A;  3U8Z A;  2VH2 A;  4TSS A;  4HDO A;  4TMA B;  5LXH A;  1BT0 A;  1RFA A;  3GB1 A;  1HE8 A;  1TGZ B;  1K51 A;  2PPH A;  3C8Y A;  3A9J A;  3L4P A;  3M95 A;  4MEL A;  1I4Q A;  3A1Q B;  4JE3 B;  3ZNG C;  1L4Z B;  2VZK B;  3R3M A;  3QK0 A;  1QQR A;  4OW0 A;  3MFG A;  4ZRQ A;  3AE6 B;  2DX5 B;  2Q5W D;  1TT5 B;  4G11 A;  1E8W A;  1V49 A;  1V80 A;  2TSS A;  1P9D U;  2E3T A;  5E6O A;  3UIN B;  2CHX A;  1EF1 A;  1TBE A;  5G2N A;  1HXY D;  3DVN U;  5JHA A;  1XO3 A;  2J42 A;  3KVF B;  1GTH A;  1C4C A;  1SJE D;  4IM0 A;  2RDG A;  1A70 A;  4JL9 A;  3FAH A;  2INN E;  2D11 A;  4ACF A;  4JQW C;  4K1R B;  1ZOY B;  3I9V 1;  5HKH A;  1XT9 B;  4HPM B;  2N9X A;  3VTW A;  3GE3 C;  2K22 A;  4YXD B;  3DHG C;  2WXO A;  3BIN A;  2RPV A;  3Q8B A;  2HDE A;  3P4R B;  3Q6B A;  4C56 C;  3HHM A;  2G3Q B;  4DHJ D;  4I6N B;  3Q8F A;  2LJ5 A;  1WSP A;  2ICI A;  4G50 A;  1R4M I;  4LDT B;  2K39 A;  3VR8 B;  1NEN B;  4F1S A;  1BUI C;  2HJ8 A;  2XEW A;  4DXF A;  5G5G A;  1T0R C;  2GLS A;  4DBG A;  5CHF A;  4HXD A;  1A5R A;  1ENF A;  1J19 A;  3AE2 B;  3L10 B;  2RDH A;  2W9N A;  1AW7 A;  2L05 A;  1FMA D;  4HK2 A;  1GPX A;  3RYT A;  3L17 A;  2YVC A;  1HQR D;  3NHE B;  1WR1 A;  1YOV B;  1L6U A;  1R4M B;  2C7N B;  3VTV A;  1V6E A;  2GBN A;  4RGT A;  3W1S A;  3E9S A;  3BZD B;  1GB4 A;  1T6B X;  4WWN A;  4WAF A;  3UGB B;  4LNK A;  3RMK C;  3NOB A;  4BVU C;  1Q10 A;  4A3O A;  4BKS D;  3ALB A;  4FUL A;  3ZQ4 A;  4MT5 A;  1H7W A;  3QAQ A;  3LB8 C;  3VH3 B;  1ZDV A;  1VZ6 A;  3RNE C;  1WZ0 A;  4IUM B;  2YEP F;  4IOI E;  1QT9 A;  1E0Z A;  4G0N B;  2D3A A;  1JCK B;  4RH6 A;  1PYW D;  4BZA A;  4O1N A;  3U30 A;  4XWW A;  3TMP B;  3OJ3 A;  2WNM A;  4W9I A;  1XCT L;  1YQ3 B;  1ET9 A;  2VZK D;  3CSF A;  5JXV A;  1I4P A;  2KLC A;  4P1B C;  2ZCB A;  1XF5 L;  1NDD A;  1OFF A;  3R66 C;  1BML C;  4W9G A;  3FIL A;  2EMS A;  4B6W A;  1D4B A;  5LNK 1;  1N60 A;  2KQ4 X;  2FIF A;  2DZI A;  1E5W A;  5BYR A;  4GU2 A;  3T3O A;  3W1Y A;  1TZO A;  2KDF B;  3ZYY X;  2IY0 B;  3H1U A;  1JWA D;  4E71 A;  4DHZ E;  1VJK A;  2J0K A;  4TQ1 A;  1YJJ A;  1WM2 A;  4KZ0 A;  1L0X B;  1LGR A;  3A4R A;  4KZC A;  1D5Z C;  1UBQ A;  3VAW A;  2M19 A;  2FE8 A;  2KLG A;  2XK5 A;  2NR2 A;  3JSV A;  3KW5 B;  3AUL A;  4IWQ A;  3DBR I;  4FN2 A;  1YN4 A;  2G1E A;  3Q8E A;  5BO4 B;  3TL5 A;  3IHP C;  4DXA B;  4ZHP A;  1TS4 A;  3KLS X;  4BAX A;  3EC8 A;  3I57 A;  2NBW B;  3URY A;  2WHI A;  2NBU A;  4L2Y A;  4BOS C;  4ZYS A;  4US9 A;  4WIP A;  4TQ0 A;  1V1P A;  2WU5 B;  3PZ8 A;  1WGG A;  4KIK A;  3IXS A;  1J7B A;  2ONQ A;  2N7J A;  3DWM A;  2QCZ A;  1C79 A;  4MGI E;  2KVR A;  2X8X X;  3N32 A;  3ZNI D;  1ZUD 2;  3PZ7 A;  2NS5 A;  3R8B A;  2KC1 A;  4NPN A;  1IGD A;  1UF0 A;  1UBI A;  2GOW A;  4NZL B;  3EFU A;  4OZB A;  1WJU A;  3A4S C;  1JWU D;  3OJ4 B;  3FIL B;  3ECI A;  2DHZ A;  1E10 A;  2A4Z A;  2AQ2 B;  3B2G A;  2Y5C A;  2LGD A;  3W9C B;  2REX A;  1VCB A;  2PKO A;  4RM8 A;  1AWD A;  3TUO A;  1N6Z A;  4XWT A;  3APC A;  3V05 A;  1AYF A;  1DGJ A;  4HCN B;  2N7D A;  3Q3N C;  1L4D B;  3NZ3 A;  1JWM D;  2WXM A;  3BK2 A;  2LVQ A;  1PUT A;  3NG0 A;  4XC2 A;  3ZDM C;  2V3N A;  5J2R A;  2BYT A;  3RUL A;  1IPG A;  1RM6 C;  2V3S A;  3R7R A;  3CMM B;  2MX2 A;  2XK5 B;  2K8C A;  3W2D A;  1ZKH A;  3JSV B;  3VRB B;  3QJZ A;  2LUM A;  4LJP B;  4RF1 A;  1MFW A;  3AU4 A;  4MGZ E;  3UF8 A;  4BKG A;  1E7P B;  5LXI B;  2MP2 A;  3H7P A;  3TEX A;  1YN5 A;  2IGH A;  5L95 C;  1GUA B;  2H88 B;  3P4P B;  1I4G A;  3Q3M C;  4KDL B;  1IYF A;  2DZM A;  3TEW A;  2WXH A;  3PPA A;  2MRP A;  2FUH B;  4RGO S;  2MSE D;  5D94 A;  2KDB A;  1WXA A;  4GOC A;  2JXX A;  4NQL B;  1IP9 A;  2HTM E;  2KWU B;  2BS2 B;  3BYY B;  3VUY A;  5J17 A;  2DYO A;  4IKG A;  1V1P B;  3RT3 B;  1SSN A;  3AB5 A;  1ESF A;  4REZ A;  1FNU A;  4GDL A;  1FXT B;  4L23 A;  3RPF C;  3Q2A C;  3AEA B;  3WIM A;  1QZE A;  1KH0 A;  1SXT A;  4JGH B;  1FCL A;  4KIK B;  3AED B;  3K9P B;  3QHT A;  3TIX A;  3O13 A;  4M02 A;  3ZDT A;  2IO3 B;  5E6P A;  4A9A A;  2ZW1 A;  2IBI B;  3WCQ A;  2ZNV B;  5DCN A;  2BYF A;  2N9E B;  1PQS A;  1DYQ A;  3NVV A;  1ISN A;  3NY5 A;  2CU3 A;  2JRI B;  1XLQ A;  3Q14 C;  3E56 A;  3WAO A;  4BBN C;  2NPT A;  4WQO B;  2LAS A;  1L2N A;  2HE7 A;  3QX1 A;  1UWM A;  3RNC C;  5BYS A;  1LXD A;  3CF6 E;  3MC0 B;  4IDI A;  3RI7 C;  1XQQ A;  2ZZP B;  1TS2 A;  2K9X A;  4N9F 4;  4AUQ C;  1TY0 A;  2GBK A;  4CQN A;  2I2Y A;  2JXT A;  2FCM A;  3UI3 A;  1FFV A;  2KJ6 A;  4A20 A;  4HJG E;  1WGK A;  2FCQ A;  3PT2 B;  1MG4 A;  4C4V A;  4GN1 A;  1DOI A;  1NYQ A;  1PGA A;  2WS3 B;  3V6C B;  2RDB C;  1XLO A;  5T8I A;  1KFY B;  4AOF A;  5EE0 A;  5HI1 A;  2LWP A;  1ROE A;  4DHJ B;  4GLS C;  1EWC A;  4HPL B;  3TCA A;  4EZL A;  3Q69 A;  2D5G A;  4C7Z A;  4AQ7 A;  2GI9 A;  5HFY A;  4S0R A;  1PGB A;  1S1Q B;  2WXN A;  4DDI D;  3AV8 A;  2MP2 B;  5GMV A;  5D2M B;  2WDT B;  4WWP A;  2JY6 A;  1WJ6 A;  1SIJ A;  1RFK A;  3DQV A;  2KDI A;  5G55 A;  4GB9 A;  2XNA C;  3IBE A;  2LFI A;  4W9J A;  4ITK A;  1UGJ A;  2MEK A;  4TKN A;  2CKH B;  2M0A A;  1IBX A;  2AQ3 B;  4XDC A;  1K50 A;  3DHH C;  1TKE A;  1CK1 A;  3OLM D;  2N9P C;  3EFC A;  2L1A A;  2BQQ A;  5AEK B;  2MJD A;  3TEY A;  1WGR A;  3AE1 B;  1N63 A;  2I1J A;  3AEC B;  1XLP A;  4RGM A;  1TKY A;  2Z59 B;  3SFE B;  3U7Z A;  1F0Z A;  2KYW A;  4N58 A;  3PS6 A;  1F1H A;  1KOT A;  2IGD A;  4R3D A;  3DHI C;  4KX6 B;  2N1W A;  3S2A A;  3QC8 B;  2JYE A;  1ZXI A;  1VLB A;  3HIZ A;  3IT6 B;  4FAD A;  2WP9 B;  1V97 A;  2MCN B;  4OZC A;  3V6E B;  1VD2 A;  1XXG A;  3L54 A;  1SE9 A;  1G6J A;  2JT4 B;  2PVG C;  1EO6 A;  2INP E;  1OGW A;  1WX8 A;  1CQV A;  2M8S A;  4C00 A;  3P1M A;  3LXF A;  1HTQ A;  2PJH A;  4C4V B;  4OVZ A;  2KO3 A;  2KMC A;  2M0X A;  1KLG D;  2V4I B;  5H92 C;  1KLU D;  5IA7 A;  1HA5 A;  3DOW A;  3VTU A;  4ARI A;  4ASW C;  4NJ6 A;  1F52 A;  3RNG C;  5KHO A;  4FHJ A;  5CHV C;  2OOB B;  2JSV X;  3U52 E;  5C2T B;  1MPE A;  1KJT A;  1ET6 A;  2KKC A;  4MH0 E;  4IM3 A;  1J7A A;  2PIA A;  4IC7 B;  1IUE A;  3AH7 A;  1WJ4 A;  2IJ0 A;  1OEY A;  5G5H A;  2EEL A;  1V8C A;  1E6E B;  3AE5 B;  1I42 A;  1JRP A;  4HKQ A;  2PE6 B;  1WX7 A;  4DXG A;  3JW0 X;  4KSL C;  1IBX B;  1DOX A;  2DWQ A;  4L1B A;  5L83 A;  4TUU A;  3KUC B;  3IT4 B;  1STE A;  4YSX B;  3PHW B;  4WWM A;  3AMZ A;  1TZ1 A;  5IAA C;  4NQK E;  3PRP B;  4PK1 A;  4OHJ A;  2N9L A;  4HEA 1;  4ICU A;  4RNA A;  4KGS A;  5KHQ A;  4K7W A;  3P2B A;  3SU8 X;  3P4S B;  4YTP B;  1K52 A;  2LZ6 A;  2QMT A;  3JVZ X;  4IM2 A;  4FJZ A;  1WZ3 A;  1L0V B;  2KX3 A;  2YEP B;  1WH3 A;  1Z2M A;  3ZXV A;  1T0Y A;  3T9L A;  3MTN B;  3ZUN A;  1ZW7 A;  5FR6 A;  1GC6 A;  1TY2 A;  2WDR B;  1ZGU B;  4ZOH C;  5C23 A;  4FJY A;  1TKG A;  5GXG B;  1C9F A;  3D32 A;  1GG3 A;  1RRB A;  4ZRJ A;  2D07 B;  2WXK A;  1YJ1 A;  3AXC A;  3ENE A;  2L52 A;  4E3C A;  2IO1 B;  3AN1 A;  3FC4 A;  3AE4 B;  2GMI C;  4MSM B;  1JWS D;  3ZKJ C;  1NEK B;  5I4D A;  2L00 B;  4MGK E;  4WUR A;  4CHK A;  4OZA A;  1WE7 A;  1L5P A;  4EKU A;  4FLH A;  2L0T A;  4ANV A;  4ZRP A;  1F77 A;  4W9D A;  3DVG Y;  1QLB B;  1TJE A;  2KWV B;  5FKA C;  3UQA A;  3RNA C;  2H89 B;  4JLC A;  1C1Y B;  2FCS A;  1WIA A;  2FID A;  2Z8L A;  4K81 A;  2J4X A;  2HTH A;  1QOB A;  2L76 A;  2MBQ A;  4HKZ E;  4M8M A;  1EF5 A;  1SJH D;  2IO2 B;  3N1Z C;  3AEE B;  3HUI A;  2KC2 A;  2LHD A;  2M17 A;  1N5W A;  2KAN A;  3J9C A;  3V62 A;  2BF8 B;  1H8C A;  1TIF A;  1V5O A;  3U4E G;  1J7C A;  1I7H A;  2EKI A;  3VDZ A;  2BWE S;  2K5P A;  1MJD A;  2FBW B;  3UIP B;  2J52 A;  2K6Q A;  2BBC A;  1YIW A;  3ETR A;  5C3J B;  1QOF A;  3I3T B;  3QIJ A;  5E6J A;  2NVU I;  3KUD B;  2MJ3 A;  4FJV B;  3B1L X;  1F2R I;  2MWS B;  1CMX B;  1I35 A;  3V61 A;  2V1Y A;  3TBL D;  3BYT B;  2LJI A;  4G3X B;  4W9C A;  2W3S A;  4XX5 A;  2CJO A;  5MPO A;  4B0M A;  3KYC D;  2J53 A;  1FIQ A;  4KV2 A;  5LLI A;  5H8Y E;  2E6X A;  1E8X A;  4WJO A;  2KXJ A;  4MH8 A;  1SE4 A;  4MSQ B;  3Q3J A;  3AEG B;  4KVG B;  2M4N A;  4NAM A;  2KMA A;  2QEJ C;  3GZN I;  2PTL A;  2Y5B B;  3O65 B;  4W9K A;  3TJP A;  4EZJ A;  4MEM A;  1WGD A;  1WRD B;  2MA9 B;  1WYW B;  2G45 B;  4EUT A;  3B2F A;  3AE9 B;  2G4D B;  2MBB B;  3DBR B;  2K0P A;  1MG8 A;  4JWS C;  4RGN A;  3GP7 A;  1MI0 A;  4ZHO A;  1FPY A;  3BVG A;  3PRM B;  1V1O A;  1EM7 A;  2WU2 B;  4YSY B;  3M63 B;  4URK A;  3KQ4 A;  1JWB D;  2ZVO A;  4JX1 C;  2QIL A;  3B08 A;  4XGA B;  3DCG A;  2JU6 X;  2W54 A;  5DPR A;  2CHZ A;  1YN3 A;  3GZN B;  1FNV A;  1YQB A;  2IY1 B;  1YMH E;  2M1M A;  3ZJT A;  3TEZ A;  2KWD A;  3B0A A;  2AL3 A;  1R7S A;  2JWZ A;  5TSS A;  3WAP A;  3MP9 A;  3KYD D;  3ZIM A;  2RPQ A;  2L0F A;  2XBB C;  2JPH A;  4HVB A;  3ZRF A;  1WYG A;  2LGX A;  4ARC A;  1FD6 A;  5HHD G;  1Q0W B;  4E74 A;  4W9L A;  3EUB 2;  1RAX A;  2IYD B;  2ZVN A;  2BB5 A;  3SDL C;  1YNT E;  3MJ5 A;  4I6P A;  4HCP B;  2BW2 A;  2MHJ A;  1EU4 A;  2MQJ A;  4P16 A;  5FR3 A;  1P1A A;  3PLV A;  1WXS A;  3QQ8 B;  2D10 A;  3WAM A;  3LDZ E;  3W1S C;  3ZXR A;  2W3R A;  2ACZ B;  1QKZ A;  3HM3 A;  1M94 A;  2BB6 A;  1WXV A;  3M3J A;  2DAF A;  1VZ8 A;  4BBN F;  3T8M A;  1FXA A;  3NZU A;  3ZNH B;  2W82 A;  2BS3 B;  5BMI A;  2CU1 A;  1H7X A;  2KFJ A;  2RGF A;  3VUW A;  1N61 A;  2YLM A;  3NVY A;  4ICV A;  4NJC A;  2PMV A;  2LUE A;  3AI5 A;  3U2S C;  1QIL A;  1SEB D;  2QJL A;  2W55 A;  1JML A;  4XYC A;  2WXR A;  3WA0 A;  3Q3O C;  4YT0 B;  2LD9 A;  4BKS A;  3P4Q B;  3BWU D;  1P98 A;  2JX5 A;  1E9M A;  2KHW B;  4HWI B;  2MLB A;  1VRA B;  4XZ4 A;  4KKI A;  1FEH A;  4PYU A;  3RFZ B;  1YQ4 B;  4YTM B;  1WMH B;  2KN5 A;  2GBJ A;  1LO5 D;  3CF4 A;  4M00 A;  5AZG A;  1J0G A;  1XD3 B;  3OAW A;  1UH6 A;  5CHW A;  1KTK A;  4YTN B;  4YSZ B;  1GC7 A;  3QAR A;  4MM3 A;  4GXB A;  5J18 A;  2UYZ B;  2C60 A;  1UUP A;  1KF6 B;  2JWU A;  2KDE B;  2WX0 A;  1V9J A;  2KQ7 A;  2KOX A;  3PGE A;  3RUI B;  2LEK A;  2CR5 A;  3HK0 A;  1FFU A;  5HG2 A;  1NBF C;  2CHW A;  2BYE A;  3ZW3 A;  1WXM A;  3GS2 A;  3UQB A;  1OTR B;  3VRA B;  1UEL A;  4AP4 C;  4Q2J A;  2KTR A;  2CJN A;  3DBS A;  5D6J B;  2INC C;  4PS3 A;  3SD5 A;  4PS8 A;  2DAJ A;  2WGS A;  3EHV A;  3L16 A;  1K8R B;  3PVL A;  3QCA A;  3KWL A;  2GRI A;  4NAW A;  2BGF A;  5AZH A;  2QHO A;  4LJO B;  3N30 A;  2N4F A;  4HLE A;  2BTE A;  3N1Y C;  2PW9 A;  1WM3 A;  2LRW A;  2G4S A;  2QIE B;  2IZV B;  4US8 A;  1IGC A;  4B95 A;  2C7M B;  4WQM A;  2DNF A;  2BKF A;  3ZO5 B;  1KRH A;  3ZGZ A;  1X1M A;  2K6D B;  2LRU A;  3DVG X;  4LNF A;  4B9K A;  2QDF A;  4ZYN A;  1E8Z A;  4ANU A;  2Y5P A;  2ZNV C;  3VHT C;  1XCQ L;  2L32 A;  2J0M A;  1L0Y B;  5EDS A;  1GB1 A;  3KWV A;  4WWO A;  4USA A;  1OEY J;  2K25 A;  4X57 B;  4LK0 M;  1JQ4 A;  1GAQ B;  4HPP A;  4WJP A;  3IAM 1;  4IG7 B;  4XE0 A;  4RF0 A;  5E6N A;  2V0G A;  1I4R A;  1SBB B;  2IGG A;  1V81 A;  3LYY A;  2UWQ A;  2WLB A;  2WYQ A;  1KLV A;  1DOY A;  3NS1 A;  5C1Z A;  1WR6 E;  3RN9 C;  5D3I B;  1YX6 B;  2IND C;  4M01 A;  4P1C C;  4UDU C;  3N1X C;  4MM3 B;  2EKE C;  1L7Y A;  3NVZ A;  4JIO U;  3SEB A;  1FCC C;  2DLB A;  3LJ3 A;  2DZJ A;  1WX9 A;  2WDQ B;  2JZP A;  2N0S B;  1Z5S B;  1Y56 A;  2AX5 A;  1P7E A;  2LVP A;  2XN9 C;  2QC8 A;  4MGY E;  1GNU A;  3A9K A;  2R61 A;  1Y8R C;  3DDC B;  3N3K B;  1QOA A;  3L08 A;  2DZK A;  2BYV E;  1PGX A;  3DBL I;  4B0E A;  2KTR B;  1T3Q A;  3VH4 B;  2OED A;  2D3C A;  1PDX A;  2AEH A;  3P63 A;  5DPT A;  4ZRI A;  2JUO A;  1SE2 A;  3NVW A;  3PSE B;  4KSK C;  1XLN A;  2KK8 A;  3MHS D;  2SEB D;  4NAW B;  2NTT A;  3IAS 1;  2C7H A;  5EE3 A;  1NYR A;  2WXG A;  1WWT A;  1E8Y A;  2KN4 A;  2L8J A;  4OVU A;  2WDV B;  1RLF A;  3EEC A;  5CTR C;  2N7E A;  1GJZ A;  1B1Z A;  2K8B A;  2K8H A;  2LXA A;  5BMG A;  4ANX A;  2KT7 A;  4II3 B;  2OJR A;  3DBL B;  2AQ1 B;  2D3G A;  1MHX A;  1ACC A;  2KX0 A;  2Z0E B;  4XDD A;  3AE8 B;  1EUV B;  1TTN A;  4LTU A;  1T5X D;  2D3B A;  4M0W A;  1YX5 B;  3GE8 C;  4DK5 A;  2ON8 A;  3N9Y C;  4J6I A;  2GBR A;  1D5X C;  2O6V D;  3QWZ B;  4ZDV A;  5IP4 D;  4MJS B;  1LM8 B;  4YL8 A;  3NRZ A;  3VXW A;  2WX1 A;  1WFY A;  3PZD A;  4WH4 A;  4BFR A;  1SF0 A;  4RM9 A;  2J7Q B;  1D3Z A;  3PRZ A;  3ML9 A;  1WRI A;  1JRO A;  4RCO A;  4DWF A;  3H7S A;  3AM9 A;  2CS4 A;  1SE3 A;  3WAL A;  3X23 A;  3A9J B;  3NUH B;  3A9K B;  1M4V A;  2M56 B;  2K1F A;  2JZ3 B;  3R2T A;  2I1K A;  2OJW A;  4OVV A;  4HRS A;  1GTE A;  3VFK A;  1ZP0 B;  2R2O A;  4ZRK A;  4NY0 A;  3AEB B;  5IOI A;  3JYU A;  1E7V A;  2MBO A;  4RFB A;  4IWP A;  2SAK A;  4JPS A;  1LFD A;  2GB1 A;  4AS1 A;  3PV1 A;  1I4X A;  1R4N I;  2JRH A;  2MBH A;  1XEE A;  2VRR B;  2KNB A;  3M62 B;  2HD5 B;  5DPW A;  1NVI D;  1V86 A;  4F7Z A;  2NCN A;  2LVO A;  2L3Z A;  2OHF A;  3IFW B;  3BVZ A;  4WAA A;  1RWS A;  1S3S G;  3QA8 A;  1E90 A;  2KJH B;  4A3P A;  3APF A;  4II2 B;  3CST A;  4S17 A;  4KGR A;  3PHX B;  3RNF C;  1VZ7 A;  2KAC A;  1UNS A;  5D7G A;  3AEF B;  2WXF A;  3AE3 B;  3RZF A;  2MBE A;  3VR9 B; 
#chains in the Genus database with same CATH homology
 2WXN A;  2INN E;  3FAH A;  3MJ5 A;  3AV8 A;  4YWG G;  1PFD A;  1ZOY B;  3I9V 1;  2BW2 A;  2ZW0 A;  1EU4 A;  2BS4 B;  1SIJ A;  1JAL A;  1RFK A;  3P42 A;  4PT5 A;  1L6V A;  1P7F A;  2XNA C;  3OWE B;  2K22 A;  4P16 A;  5D3D A;  2LFI A;  3EGR A;  5FR3 A;  4ITK A;  4YXD B;  2WXO A;  1UGJ A;  2MEK A;  2RPV A;  3Q8B A;  2HDE A;  3P4R B;  2PVO D;  4C56 C;  2M0A A;  1FO4 A;  2WXJ A;  1IBX A;  2AQ3 B;  3Q8F A;  4XDC A;  2W3R A;  2ACZ B;  1K50 A;  1TKE A;  1CK1 A;  1WSP A;  2ICI A;  1QKZ A;  2BB6 A;  2L1A A;  2B76 B;  4C7Y A;  3VR8 B;  2MJD A;  1NEN B;  1VZ8 A;  3TEY A;  2G9H D;  1N62 A;  1FXA A;  3AE1 B;  1BUI C;  1N63 A;  4DXF A;  3AEC B;  1C78 A;  5G5G A;  2W82 A;  2BS3 B;  5BMI A;  1H7X A;  1XLP A;  4RGM A;  1TKY A;  3HRD D;  1ENF A;  1WXQ A;  4A6Q A;  3AE2 B;  3SFE B;  1HZ5 A;  1K53 A;  3U7Z A;  1F0Z A;  2RDH A;  4N58 A;  1N61 A;  3NVY A;  1AW7 A;  4A8X C;  2K3U A;  1FMA D;  4NJC A;  2IGD A;  4R3D A;  2PMV A;  2N9K A;  3U2S C;  1QIL A;  1SEB D;  2QJL A;  1GPX A;  2WXL A;  2W55 A;  1JML A;  4KX6 B;  1HQR D;  2WXR A;  2JYE A;  5EE9 A;  1FRR A;  1VLB A;  1ZXI A;  4YT0 B;  1L6U A;  3IT6 B;  2WP9 B;  1V97 A;  3P4Q B;  3BWU D;  2JX5 A;  1E9M A;  1N5X A;  4OZC A;  1VRA B;  1XXG A;  4RGT A;  4KKI A;  1FEH A;  3W1S A;  3E9S A;  5BMH A;  3RFZ B;  1YQ4 B;  3BZD B;  4YTM B;  1T6B X;  4WAF A;  1GB4 A;  2PVG C;  2INP E;  1CQV A;  1FM0 D;  1TS3 A;  3P1M A;  3R2I A;  1QF6 A;  3LXF A;  2NMQ A;  1LO5 D;  3ZJV A;  1EU3 A;  3CF4 A;  1Q10 A;  4OVZ A;  2Y3A A;  4EE2 A;  1KLG D;  2V4I B;  4MT5 A;  5H92 C;  1H7W A;  3ZQ4 A;  3LB8 C;  1HA5 A;  1ZDV A;  1VZ6 A;  4J3O D;  4ARI A;  1KTK A;  3EA6 A;  4YTN B;  2YEP F;  4IOI E;  4YSZ B;  1QT9 A;  1E0Z A;  5EE1 A;  2LMC A;  1RYJ A;  2JSV X;  4HRO A;  1JCK B;  1UUP A;  3U52 E;  5C2T B;  4RH6 A;  1KF6 B;  1ZPS A;  1MPE A;  1PYW D;  2JWU A;  1ET6 A;  4KKJ A;  4O1N A;  2LEK A;  4P6V F;  3BII D;  4XWW A;  1SB3 C;  1J7A A;  1FFU A;  4LLG M;  2PIA A;  5HG2 A;  3T3N A;  4H2A A;  1IUE A;  3AH7 A;  4JWU C;  2WNM A;  1XCT L;  2IJ0 A;  3GS2 A;  1YQ3 B;  5G5H A;  1ET9 A;  2VZK D;  5JXV A;  4FXC A;  1I4P A;  2EEL A;  1V8C A;  3VRA B;  1E6E B;  2I38 A;  1XF5 L;  4Q2J A;  3AE5 B;  1OFF A;  2RMM A;  2CJN A;  2IDY A;  1BML C;  1JRP A;  4HKQ A;  2JYT A;  3FIL A;  1D4B A;  1OQR A;  4DXG A;  5LNK 1;  1N60 A;  3B9J A;  1IBX B;  2KQ4 X;  2JQR B;  1DOX A;  2L83 A;  2DWQ A;  4L1B A;  1HZ6 A;  1VR9 A;  3IT4 B;  1STE A;  5BYR A;  4YSX B;  3T3O A;  2GRI A;  3KWL A;  1TZO A;  3ZYY X;  4WWM A;  3AMZ A;  1ZDX A;  1MHH E;  2WQY B;  1JWA D;  3BK1 A;  2BTE A;  4OHJ A;  2WXP A;  1VJK A;  2PW9 A;  2WXI A;  4TQ1 A;  1YJJ A;  3ZJU A;  2N9L A;  4HEA 1;  3W5U B;  2QIE B;  2LHE A;  2NTS A;  3BVM A;  4A55 A;  1L0X B;  4US8 A;  1IGC A;  4RNA A;  4KGS A;  2BT6 A;  5AUI A;  4WQM A;  1QOG A;  2FUG 1;  1D5Z C;  1KRH A;  2M19 A;  3ZGZ A;  2MH7 A;  2FE8 A;  3P4S B;  3MHZ A;  3SFD B;  4YTP B;  2MJE A;  2Y5P A;  3Q8C A;  1F2R C;  1K52 A;  2QMT A;  1XCQ L;  2L32 A;  1L0Y B;  1YN4 A;  2V3P A;  1GB1 A;  1L0V B;  2G1E A;  3Q8E A;  3KWV A;  2YEP B;  2KDM A;  4USA A;  4LK0 M;  1JQ4 A;  1GT8 A;  4ZHP A;  2WXQ A;  1GAQ B;  1TS4 A;  4MAC A;  3IAM 1;  1TY2 A;  2WDR B;  4XE0 A;  4RF0 A;  4ZOH C;  2V0G A;  3KLS X;  1FXI A;  1I4R A;  1SBB B;  2X38 A;  3I57 A;  1TKG A;  2IGG A;  5GXG B;  1C9F A;  3URY A;  3LYY A;  2WLB A;  2WXK A;  4L2Y A;  4ZYS A;  1GOZ A;  1TYG B;  1DOY A;  2L52 A;  4US9 A;  3NS1 A;  3AN1 A;  3FC4 A;  4WIP A;  1YJI A;  5D3I B;  3AE4 B;  4UDU C;  4TQ0 A;  1V1P A;  3Q8A A;  2WU5 B;  1C76 A;  1C4A A;  1OQQ A;  1JWS D;  2KAJ A;  1NEK B;  5I4D A;  3PZ8 A;  4MM3 B;  3NVZ A;  3SEB A;  1FCC C;  3IXS A;  1J7B A;  2ONQ A;  2N7J A;  2DLB A;  3DWM A;  4WUR A;  4C80 A;  1BXT A;  1C79 A;  4OZA A;  2WDQ B;  1D6E C;  1L5P A;  1ZUD 2;  3PZ7 A;  2JZP A;  2N0S B;  1Y56 A;  2AX5 A;  1P7E A;  3R8B A;  2XN9 C;  4ZRP A;  3W5V B;  1F77 A;  2R61 A;  1QLB B;  1TJE A;  1IGD A;  1QOA A;  5FKA C;  4NZL B;  1PGX A;  2H89 B;  4OZB A;  5FK9 C;  5BYQ A;  4B0E A;  1T3Q A;  1JWU D;  1B9R A;  2OED A;  3P63 A;  1PDX A;  1CZP A;  3FIL B;  1E10 A;  2Z8L A;  1SE2 A;  3NVW A;  3V3X A;  2AQ2 B;  3B2G A;  2Y5C A;  2IPK D;  1TS5 A;  2J4X A;  1XLN A;  3W9C B;  2LGI A;  1D5M C;  3SR6 A;  2PKO A;  1AWD A;  1QOB A;  4HKZ E;  3TUO A;  2SEB D;  4NAW B;  4XWT A;  2NTT A;  1SJH D;  3V05 A;  1AYF A;  1DGJ A;  3IAS 1;  4D2K A;  5EE3 A;  3AEE B;  1L4D B;  1NYR A;  2WXG A;  3NZ3 A;  1JWM D;  1WWT A;  2KN4 A;  3HUI A;  2WXM A;  5AUK A;  3VQI A;  2LHD A;  3AE7 B;  3BK2 A;  2PLP A;  1N5W A;  2WDV B;  1PUT A;  3ABV B;  4A90 A;  1JW9 D;  1MVK A;  1B1Z A;  3J9C A;  2V3N A;  5BMG A;  2BYT A;  1RM6 C;  3U4E G;  1J7C A;  1I7H A;  2EKI A;  2AQ1 B;  2KMM A;  3HVD A;  3W2D A;  1MHX A;  4GDK B;  2K5P A;  3VRB B;  2FBW B;  2LUM A;  1ACC A;  2J52 A;  4RF1 A;  2QSD A;  2BBC A;  3CIR B;  3ETR A;  5C3J B;  1QOF A;  1E7P B;  4XDD A;  5E6J A;  3AE8 B;  3CWI A;  3TEX A;  3H8H A;  4LTU A;  1T5X D;  2MJ3 A;  1YN5 A;  4M0W A;  2IGH A;  3PO0 A;  1F2R I;  2H88 B;  1NI3 A;  4DQO C;  3P4P B;  2ON8 A;  3N9Y C;  1I4G A;  3BYT B;  2LJI A;  2W3S A;  1ZXH A;  3TEW A;  2CJO A;  4GDL B;  5MPO A;  1EWY C;  2DBY A;  1D5X C;  1FRD A;  1AN8 A;  1UWX A;  2WXH A;  4B0M A;  4RGO S;  3HVZ A;  2J53 A;  3DWG C;  1FIQ A;  2HTM E;  2BS2 B;  3BYY B;  3NRZ A;  2DYO A;  5H8Y E;  4IKG A;  1V1P B;  2E6X A;  1SSN A;  3AB5 A;  1ESF A;  4REZ A;  1FNU A;  4N6E B;  4MH8 A;  4L23 A;  1SE4 A;  1CJE A;  3TSS A;  3RPF C;  4WH4 A;  1C4P A;  3AEG B;  3AEA B;  1SF0 A;  1KH0 A;  1SXT A;  1FCL A;  4NAM A;  3AED B;  2QEJ C;  2PTL A;  3O13 A;  1WRI A;  1JRO A;  1ZE3 D;  4A9A A;  4RCO A;  2ZW1 A;  4KGT A;  4N59 A;  1I4H A;  3AM9 A;  1HEZ E;  3WCQ A;  1SE3 A;  3B2F A;  3AE9 B;  1DYQ A;  3NUH B;  1M4V A;  2M56 B;  2DYM A;  1FNW A;  1C77 A;  1VDV A;  3NVV A;  2K0P A;  3R2T A;  4TSS A;  4JWS C;  2CU3 A;  4TMA B;  1XLQ A;  4RGN A;  4HRS A;  3E56 A;  1GTE A;  3GP7 A;  1ZP0 B;  1MI0 A;  3GB1 A;  4ZHO A;  3BVG A;  1V1O A;  1EM7 A;  2WU2 B;  3AEB B;  4YSY B;  1K51 A;  3KQ4 A;  1JWB D;  3C8Y A;  4RFB A;  3L4P A;  1I4Q A;  1UWM A;  4JE3 B;  4JX1 C;  2QIL A;  1L4Z B;  2VZK B;  5BYS A;  2SAK A;  4JPS A;  3MC0 B;  4IDI A;  1QQR A;  2GB1 A;  2JU6 X;  2W54 A;  4OW0 A;  1TS2 A;  2K9X A;  4AS1 A;  1TY0 A;  1YN3 A;  1I4X A;  3MFG A;  3AE6 B;  4ZRQ A;  4CQN A;  2Q5W D;  1FNV A;  2I2Y A;  1XEE A;  1YMH E;  2JXT A;  3UI3 A;  1NVI D;  1FFV A;  3ZJT A;  3TEZ A;  2KWD A;  4HJG E;  1WGK A;  2TSS A;  1R7S A;  2E3T A;  2OHF A;  5TSS A;  1DOI A;  1NYQ A;  1PGA A;  3BVZ A;  2WS3 B;  3MP9 A;  1XLO A;  1HXY D;  1KFY B;  5T8I A;  5EE0 A;  1RWS A;  5HI1 A;  1ROE A;  4GLS C;  1XO3 A;  1WYG A;  2J42 A;  4ARC A;  1EWC A;  1FD6 A;  4KGR A;  1VZ7 A;  5HHD G;  2KAC A;  1UNS A;  3Q69 A;  5D7G A;  1GTH A;  1C4C A;  2D5G A;  3AEF B;  1SJE D;  2WXF A;  3EUB 2;  2RDG A;  4C7Z A;  4AQ7 A;  3AE3 B;  2GI9 A;  5HFY A;  1A70 A;  2BB5 A;  1PGB A;  1KLU D;  3VR9 B;  1YNT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...