4RM9A

Crystal structure of human ezrin in space group c2221
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 126
structure length 368
sequence length 586
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm9A01
4E74A 4W9FA 4IG7B 3EFUA 4K7WA 1GJZA 2WX0A 3W1SC 5CHWA 2K8CA 2NBWB 3MTNB 1WJ4A 2LGXA 2GOWA 2KLGA 4DHZE 1S3SG 3RZWC 2ZNVB 3DCGA 2C9WB 4KSKC 4XC2A 3OJ4B 2FCMA 1LFDA 3IVFA 4WJQA 3VQIA 5FR6A 2KJ6A 2FIDA 3AU4A 2GBNA 4ZYNA 4MGKE 2GBJA 3N3KB 3R7RA 2GMIC 2KWUB 3DBRI 4IWOA 2I1KA 2DENB 4JLCA 2IO1B 2J0MA 4F1SA 1I42A 5AZGA 4IM2A 3ZDMC 2NBUA 1RFAA 3JSVB 4M8MA 1P1AA 2K6DB 4AP4C 3DVGX 2KANA 2MP2A 3QC8B 3EECA 4I6NB 1YQBA 2IY0B 4JL9A 4M0WB 4NNJB 3DQVA 3ONSA 2IO0B 1E90A 3A9JA 1WGGA 3VUXA 2KWVB 4KDIC 3NZUA 2QHOA 1YX6B 4FJVB 1V80A 2G4SA 2MX2A 2W9NA 3VTWA 2LGYA 2V4LA 4TQ0A 2DYMA 3ZDTA 3VFKA 3VUWA 2O6VD 4JIOU 2C7NB 3UQAA 2V3SA 4IUMB 2BGFA 1NI2A 3QCAA 4GDKB 2BYEA 4HWIB 3TJPA 3RD2A 3W1SA 1I35A 3HM6X 4AWJA 3OLMD 4RM8A 3L17A 2BYVE 2DYBA 3N32A 4HPMB 1QZEA 1BT0A 4GN1A 2NS5A 2MBHA 4NY0A 2KNBA 1IP9A 4XZ4A 1RLFA 2CHWA 2MBBB 4MJSA 3K9OB 2RGFA 2KWCA 2N7EA 2BYFA 4G11A 4XX5A 4HPLB 4BFRA 1HE8A 3R7QA 4BOZB 5JZEB 2L0TA 3ZNHB 3AULA 3JSVA 1WJ6A 4NAWB 3RZFA 2ZEQA 1OGWA 2RD0A 4IW0A 3NOBA 2AWTA 2N9XA 4GDLB 1H4RA 1YD8U 4BKGA 4K81A 2FIFA 3ZLZA 2MBQA 2KJRA 1P0RA 4MGZE 3SHQA 2WDTB 4GGQA 2IO3B 1WXSA 2KQSA 4W9KA 5DPTA 3CSFA 3VH3B 4URKA 3A9KB 4GIVA 1OTRB 4W9DA 1C1YB 1E7UA 1V5OA 3ZUNA 3U7DA 3C0RB 2L8JA 5GMVA 2N1WA 3HK0A 2XK5A 4CYEA 4F8CB 2D2QA 3M3JA 4MEMA 4ZRJA 2CHZA 1P98A 2DAJA 2KTRB 3CF6E 2PE9A 2PJHA 3TCAA 2N7DA 5JH5C 5J18A 2AL6A 2M1MA 4WQOB 1WZ3A 3DOWA 4ANXA 1WM3A 1ZW7A 2LVPA 1Q0WB 2ZZPB 4A20A 5HKHA 3EHVA 5D2MB 4BKSA 1R4MI 2KMCA 4CO7A 2JZZA 3PVLA 4GB9A 4WWOA 3ZKJC 3H9DA 1Q5WB 1M94A 3NZSA 2KDFB 2L00B 4WJPA 2NPTB 5KHQA 3WA0A 2KLCA 2LJ5A 3RUIB 4AJWA 1KOTA 1WX9A 2G4DB 2L7RA 3B08A 1J8CA 4W9EA 4NAWA 5AZFA 1YX5B 5L95C 3QJZA 4IWQA 4GDLA 3V62A 4FBJB 4MSMB 3ZTCA 1WX8A 2KX3A 3Q3FA 4I6LB 1EF1A 2LVQA 3WALA 2REXA 2OJRA 4YL8A 2KTFA 3VH4B 4EEWA 1D3ZA 3A33B 3A9KA 1P9DU 1KLVA 2K6QA 3H7PB 2LI5A 4J6IA 4FULA 4CHKA 2EKEC 2DZIA 2MA9B 4OVVA 3PPAA 1E8WA 2NBVB 2KMAA 1V9JA 1WMHA 5CHVC 4LDTD 3KUDB 2KTRA 4A3OA 4B6WA 3T8MA 2J0JA 1Z5SB 3UF8A 2MLBA 4MJSB 2LRUA 4IC7B 3DPDA 5IA7A 3VDZA 5CHFA 2MBOA 3ZTDA 4EFOA 1GNUA 1C3TA 2DX5B 3WIMA 2CS4A 3QX1A 4RM9A 1F9JA 1P3QU 2LUEA 4ZDVA 1EF5A 4FLHA 5DPRA 2J7QB 4ZRIA 2CHXA 3H7SA 2NPTA 3IG3A 1NDDA 3JYUA 3L13A 2YVCA 2DHZA 1UD7A 1Y8RC 4ICVA 2JZ3B 1LM8B 2FUHB 4FA6A 1T0YA 1WH3A 3KH0A 3V6CB 2DZMA 4W9LA 5DPSA 4AUQC 4NQLB 2XK5B 2JRHA 4K7UA 3VTVA 2M8SA 3BINA 3DBHI 4IM3A 2KFKA 4DDID 2Z0DB 3H1UA 1OQYA 3H7PA 3JW0X 1EO6A 4OVUA 2PE6B 1G6JA 2JWZA 3L08A 2MBEA 2M4NA 4EZLA 2N9EB 1Q1OA 2BKRB 2BF8B 3QHTA 4GXBA 1U4AA 2C5LC 2R2OA 2Y5BB 3APFA 1JRUA 4KV2A 4G3XB 3PS6A 4RMAA 1E7VA 3EC8A 4LJPB 2ZVNA 5AEKB 3ZO5B 2G3QB 3UIPB 4WJOA 3VXWA 2O6VB 2R2QA 1YJ1A 2HE7A 3ZRFA 2JT4B 3X23A 1VD2A 1WYWB 3X0WA 3QQ8B 2LGDA 2G45B 3ZW3A 4LCDE 2DYOA 4FJZA 3TIXA 2D07B 4HXDA 2K8HA 4K1RB 2RSUA 2MWSB 4EUTA 2KC1A 2K25A 3PREA 2BKFA 4MSQB 4W9HA 5CTRC 4I6PA 5E6PA 1J0GA 3QARA 3NHEB 3DDCB 1CMXB 3I3TB 3R66C 4FHKA 1S1QB 1UGMA 5J17A 2XBBC 3CSTA 4EOYA 3V60A 2MW5A 4W9JA 1ISNA 1WGYA 1WF9A 1WI0A 2K39A 1WMHB 3VUYA 1GUAB 1E8YA 1E8ZA 2LXAA 3AXCA 3ML9A 3PZDA 1IPGA 2ZJDA 4ZRKA 2HTHA 2LRWA 2DAFA 2IZVB 5EDSA 2CU1A 4ANUA 3M95A 3PRPB 4F7ZA 2IO2B 4N9F4 3ZIMA 3CMMB 3IFWB 3OAWA 3PSEB 3OJ3A 4WWNA 2OOBB 3GOEA 2NCNA 5JHAA 2FCSA 2MCNB 2RPQA 3HHMA 5TR5A 1Z2MA 4K7SA 2LXCA 3PLUA 2FAZA 3V6EB 1E5WA 2PEAA 4TKNA 2ASQA 2KX0A 3PTFC 3L0WB 2FCNA 2LASA 4MM3A 5G2NA 2K8BA 2O6VA 4GSWA 3A4RA 3WAOA 2KHWB 3UIOB 3V61A 1TTNA 4DBGA 4NQKE 3NS8A 4HCPB 2AYOB 1WFYA 4PYUA 3DBLI 3DVNU 3RYTA 2A4ZA 3DBSA 2MRPA 2FNJB 5BO4B 3UGBB 4BKTA 1VCBA 1ZGUB 2L76A 1WR1A 4DHJD 4HCNB 2KC2A 2KFKB 4HK2A 4DK5A 3APCA 1ZKHA 2GBKA 3D32A 4II2B 4IM0A 3RCZA 5D7GA 2JRIB 2WX1A 1SE9A 1GC6A 2GBRA 4JQWC 2PPHA 4W9GA 1WIAA 1KJTA 2IY1B 3QA8A 3SU8X 2BWES 3DVNV 4PS8A 5L83A 2JPHA 1H8CA 4FHJA 2M0XA 2O2VB 4KSLC 3APDA 4KZ0A 1XD3B 3P2BA 1V81A 4EZKA 1V2YA 1WZ0A 3KW5B 4EZJA 1WJNA 5E6NA 2KDBA 2AEHA 3QK0A 2LVOA 4P7IA 2N1VA 1UZXB 3MJWA 2N9PC 3SDLC 2ZNVC 1KM7A 5D94A 3ZRCA 2KK8A 2M17A 3B0AA 3L54A 4PYZA 4E71A 4TQ1A 3S2AA 2EMTA 4LDTB 4G50A 3AU5A 3TL5A 4KDLB 4DDGD 1XT9B 1UBQA 3MHSD 4GU2A 4TUUA 4FJYA 3M62B 4NPNA 5C1ZA 3HM3A 2ZVOA 1LXDA 1SGHA 1TGZB 3WAPA 5C23A 1WE7A 1EUVB 1PQSA 3WANA 4ICUA 3M63B 3IBEA 3AI5A 4PS3A 5J2RA 2DZJA 1UELA 2Z0EB 3KYCD 4BOSC 3A1QB 4NJ6A 3RULA 2RR9A 1V6EA 4MGIE 1WGDA 2KQ7A 4DXAB 1TBEA 1UBIA 1GC7A 2DZKA 2GBMA 4WWPA 3WAMA 2XEWA 2KXJA 4G0NB 3PHXB 3VHTC 1LQBA 1V86A 4FADA 2D11A 4W9CA 3BY4B 2D3GA 2KFJA 2CR5A 5D6JB 4EKUA 3HIZA 2WWZA 4W9IA 2KDEB 3LJ3A 3PGEA 2ZPNA 2O2VA 3H6NA 4BKSD 1XQQA 3SD5A 2FCQA 2MQJA 2HD5B 1IYFA 5DPWA 4GOCA 3R3MA 1TZ1A 4GMVA 2ZCBA 2JF5A 3RT3B 4MDKE 3ZNID 4DWFA 1OEYJ 2LWPA 3Q3JA 3A4SC 4MGYE 4ANVA 2IYDB 2KOXA 3K9PB 2N4FA 2WYQA 1SIFA 3ML8A 1K8RB 2BPSA 2C7HA 3O65B 3T9LA 1YIWA 4MELA 4ASWC 3GZNI 2KKCA 4WJNA 3TBLD 3U30A 1E8XA 2AL3A 3W1YA 3ZNZB 4LJOB 4WAAA 3UQBA 2ZCCA 2LZ6A 2MSED 3IHPC 1NBFC 1R4NI 1WGHA 1J19A 4IWPA 1L7YA 3L16A 4A3PA 2EMSA 3B1LX 4E3CA 2JUOA 5CX3A 1MG8A 1RAXA 4KVGB 3L10B 2JVCA 1RRBA 3UINB 1AARA 2KZRA 3KUZA 1WJUA 4FN2A 3ALBA 5G55A 1WM2A 4B9KA 5AZHA 4PS7A 3A1QA 3ECIA 4ANWA 4KIKB 3ZNGC 2KD0A 1OEYA 3PT2B 2KDIA 1WXVA 2CKHB 3LDZE 4TV3A 3QWZB 2B3AA 4HDOA 1L2NA 2Z59B 2JY6A 3ZVVA 2UWQA 4M8NA 3TMPB 2HJ8A 1WXAA 2KN5A 3PLVA 2JXXA 3QIJA 5IAAC 3PV1A 1WR6E 5KHOA 2C60A 2KVRA 2NVUI 1WRDB 1WGRA 4BBNC 2BWFA 2L0FA 4AOFA 1UH6A 1WX7A 4B95A 1WXMA 1WY8A 2NR2A 5LXHA 2KO3A 4BVUC 5LXIB 2IBIB 4GDKA 2UYZB 3KVFB 2J0KA 3KYDD 3QAQA 4DHZB 2L05A 3DVGY 4X57B 4NJ7A 4JGHB 4MH0E 2ZPYA 4HJKA 1V5TA 5DCNA 4BBNF 3PRMB 1X1MA 4AJYB 2C7MB 2I1JA 5E6OA 2K1FA 3PRZA 5JHBA 2LD9A 3ENEA 2MP2B 3U8ZA 1A5RA 2D10A 2YLMA 3KUCB 2KJHB 1FXTB 4KZCA 3VAWA 1GG3A 3A9JB 5LLIA 2V1YA 1V49A 4HLEA 3NY5A 3N30A 4KIKA 3JVZX 3PHWB 3VVWB 4II3B 2L3ZA 3VTUA 4HDQA 4HVBA 2A5UA 2VRRB 4DHJB 1WE6A
chains in the Genus database with same CATH superfamily
1QF6A 4IG7B 4K7WA 1JMLA 2WX0A 2NTSA 3MTNB 1V8CA 5G5GA 1WJ4A 2LGXA 2GOWA 2KLGA 2ZNVB 2FCMA 3VQIA 1FIQA 2N0SB 5FR6A 2AQ2B 2FIDA 4HRSA 3R7RA 2IJ0A 2KWUB 4JLCA 1I42A 2UU7A 3KLSX 5HFYA 4NNJB 3ONSA 2W54A 3T3OA 2WXGA 1YX6B 2WXKA 4FJVB 5H8YE 3VTWA 2V4LA 5BMHA 3RN9C 2QMTA 4A8XC 4IUMB 3QCAA 1I35A 3RD2A 1I4HA 1YNTE 4AWJA 4RM8A 3NVZA 4XDCA 2PMVA 1ROEA 4IOIE 4N59A 3GE3C 3Q69A 4BOZB 2PIAA 3PO0A 3HVZA 3NOBA 5GXGB 2N9XA 4GDLB 1YD8U 1STEA 4K81A 4OVZA 2HJ1A 3ZLZA 2MBQA 4MGZE 2WXLA 2IO3B 4W9KA 3CSFA 4BZAA 4W9DA 1C1YB 1V5OA 1YN5A 3ZUNA 3HUIA 3C0RB 3U7DA 2N1WA 3LB8C 3J9CA 3CF6E 2PJHA 5JH5C 5BMGA 2M1MA 4WQOB 3NVVA 3DOWA 3RNBC 4M00A 4ANXA 2ZZPB 5MPOA 5D2MB 3AEFB 3H9DA 2E3TA 1M94A 3NZSA 2KDFB 2L00B 4WJPA 3AEDB 5KHQA 4P16A 2FE8A 5AUIA 1WWTA 1KOTA 2Y3AA 4IWQA 4GDLA 4ARIA 3V62A 4MSMB 3ZTCA 3Q3FA 1VRAB 1EF1A 3WALA 4YL8A 2OJRA 1D3ZA 3A33B 3VRAB 1R4NB 2IGGA 2MA9B 1E8WA 1UWMA 4NAMA 1FD6A 5CHVC 3LXFA 1JALA 3HVDA 4Q2JA 1JROA 5EE9A 3T8MA 4MJSB 2LRUA 4IC7B 3VDZA 5CHFA 1MVKA 1GNUA 2DX5B 3QX1A 2DLBA 2WS3B 4UDUC 3RNGC 4ZRIA 1PUTA 2YVCA 3P4QB 1Y8RC 4ICVA 3CIRB 1DOYA 1LM8B 1I7HA 2FUHB 1YQ4B 5DPSA 4AUQC 5T8IA 2JRHA 4K7UA 2M8SA 2NMQA 3DBHI 4IM3A 1FPYA 1C79A 3AMZA 4KGSA 4DXGA 1FCLA 2C5LC 2K3UA 1GAQB 2QC8A 1ZOYB 1GOZA 3X23A 1VD2A 1HTOA 2G45B 1OQQA 4LCDE 4FJZA 1FNWA 3TIXA 1PFDA 4J3OD 2MWSB 4YT0B 4W9HA 1T0RC 5E6PA 1AN8A 1PYWD 1CMXB 1S1QB 3CSTA 1QQRA 2K39A 1WMHB 3VUYA 3DBRB 3AE1B 1GUAB 1E8YA 2LXAA 3AXCA 4ZRKA 2J53A 2LMCA 2IZVB 2YEPB 4F7ZA 2IDYA 2G9HD 3PSEB 2OOBB 3GOEA 2NCNA 1TS4A 4LK0M 4K7SA 3PLUA 3Q14C 3PTFC 3W5UB 3ZW3A 3WAOA 4TMAB 4GSWA 3V61A 1TTNA 4C7YA 4HCPB 2AQ1B 3HRDD 4LNOA 3DBSA 3FILA 5BO4B 4A9AA 3GS2A 1ZGUB 4DHJD 1HTQA 2KFKB 4DK5A 3APCA 2QJLA 1ZKHA 1F52A 3D32A 4II2B 3O13A 4HKZE 3R2IA 3IT4B 2LHEA 1NVID 1SE9A 2GBRA 4W9GA 1J7AA 3MFGA 2IY1B 2W82A 3DHGC 3SU8X 4FHJA 2M0XA 3APDA 3P2BA 1V81A 4EZKA 1NENB 1WZ0A 2AQ3B 2AEHA 2N1VA 3SDLC 3NG0A 4E71A 3S2AA 1D6EC 1WXQA 1XLNA 3U4EG 4DDGD 1XT9B 1UBQA 4TUUA 2JXTA 4FJYA 5E6JA 2ZVOA 1LXDA 5C23A 3WANA 1PQSA 4P6VF 1TIFA 3AE6B 4BOSC 2BW2A 3RULA 1V6EA 4DXAB 1TBEA 4WWPA 2INNE 4RGOS 1V86A 2PW9A 4O1NA 4ZHPA 1QOBA 3LJ3A 1WSPA 2VH2A 1XQQA 3SD5A 2MQJA 2HD5B 3AM9A 4GOCA 2X8XX 3RT3B 4YXDB 5HHDG 2N7JA 3BZDB 3A4SC 2IYDB 1UWXA 2N4FA 3P4RB 3ML8A 3O65B 1L0VB 4DWFA 3U30A 2KKCA 2AL3A 3BYYB 4OW0A 3NVYA 2ZCCA 2LZ6A 3KWVA 1R4NI 1J19A 2LHDA 1QLBB 4C56C 3B1LX 1EWCA 1VDVA 3AV8A 1AARA 3KUZA 1CJEA 4B9KA 2INDC 4PS7A 5AZHA 2QSDA 3MHZA 1XLPA 2LGIA 2XNAC 4HDOA 1L2NA 2Z59B 2OJWA 2UWQA 4M8NA 3TMPB 2KN5A 3P63A 5KHOA 3V05A 1BXTA 1WYGA 5LXHA 4BVUC 4A55A 3P4SB 3KVFB 2W3RA 1JQ4A 2ACZB 4HJKA 3TEYA 2WXFA 2I1JA 3RNCC 2K1FA 1N63A 2LD9A 1L4DB 1FMAD 5LLIA 1V49A 1FM0D 1FXIA 4REZA 4II3B 2CJNA 1EU4A 5BYQA 4C7ZA 4NZLB 4E74A 1TKEA 2KWDA 1ZPSA 1ZXHA 3W1SC 1SB3C 1RYJA 3NUHB 2I2YA 3V3XA 4DHZE 3NS1A 3RZWC 3DCGA 3IAM1 2C9WB 1YJIA 4KSKC 3KQ4A 3OJ4B 4LNKA 4XC2A 4WJQA 1T6BX 5HG2A 3PZ7A 3AU4A 1SXTA 3AE4B 4RGMA 3DBRI 1C9FA 4IWOA 2I1KA 2DENB 2J0MA 3ZDMC 1TY0A 3QC8B 3EECA 1FO4A 2IY0B 1SE4A 1L0XB 2QHOA 2WXOA 1GB1A 1PGAA 3N1YC 4TQ0A 3ZDTA 1FRDA 3KWLA 2C7NB 3UQAA 4ZRQA 1NI2A 1TY2A 2BYEA 3TJPA 3BIID 3TEXA 3L17A 2DYBA 3N32A 4HPMB 2MBHA 4NY0A 2KNBA 1FFUA 4XZ4A 5D3DA 2CHWA 2KWCA 2BYFA 4QAYA 4XX5A 4BFRA 1HE8A 1ACCA 2WLBA 1NYQA 2JZPA 5JZEB 1XF5L 1K51A 3AULA 4YTPB 1WJ6A 4NAWB 4IW0A 3E56A 2JQRB 2FIFA 3Q3NC 2KJRA 1P0RA 3R2TA 1WXSA 1D5XC 5DPTA 1HA5A 1OTRB 2Y5CA 2L8JA 1ZDXA 3HK0A 3M3JA 3ETRA 4MEMA 2CJOA 4US9A 2CHZA 1P98A 1V1OA 1KF6B 2DAJA 2KTRB 1VR9A 3TCAA 5J18A 2OHFA 1ZW7A 5HKHA 1OFFA 3EHVA 3PVLA 4GB9A 3ZKJC 4LNNA 2BBCA 3WA0A 2KLCA 1EU3A 2V3PA 2L7RA 1TJEA 3FKYA 4NAWA 3BYTB 2KAJA 1T0QC 1YX5B 5L95C 3QJZA 4MH8A 4WIPA 4FBJB 4WURA 1UF0A 4I6LB 1KLUD 3H8HA 3VH4B 1KLVA 3MC9A 2LI5A 2G1EA 1M4VA 3KUDB 2KTRA 4YSXB 4B6WA 2MLBA 3DPDA 5IA7A 1FNVA 3CWIA 3RNEC 1N61A 4EFOA 1C3TA 4JPSA 3P42A 4RM9A 2ZW0A 2LUEA 1N5XA 4ZDVA 5DPRA 2CHXA 3JYUA 3IG3A 1UD7A 5AUKA 3AECB 1JCKB 3IT6B 4FA6A 3KH0A 4WWMA 4W9LA 5IN7A 4NQLB 2BVCA 2Z0DB 4OZCA 3RFZB 3H1UA 3GE8C 1G6JA 1C4CA 4EZLA 2N9EB 2BKRB 1U4AA 2R2OA 2Y5BB 4G3XB 3PS6A 3EC8A 4LJPB 1TZOA 5AEKB 1JWAD 4WJOA 2R2QA 1YJ1A 3BWUD 4HPPA 3QQ8B 2LGDA 2DYOA 2D07B 2L83A 4HXDA 2K8HA 4K1RB 2RSUA 2WXPA 2J42A 1D5ZC 3PREA 3NHEB 2EKIA 3DDCB 4KKIA 3AE2B 3N1XC 1NI3A 4USAA 4EOYA 1WI0A 2W55A 2BS3B 1QKZA 2LRWA 3NVWA 1HZ6A 1K53A 4RGNA 5IP4D 3ZIMA 3OAWA 1F1HA 2MCNB 3HHMA 5TR5A 2INPE 1Z2MA 3EA6A 5HI1A 4TKNA 2ASQA 2KX0A 2QILA 3I5JC 2KHWB 3UIOB 1RFKA 2JWUA 3NS8A 1JWSD 3W9CB 2JYEA 1TT5B 4PK1A 2ONQA 2FNJB 3UGBB 2BYTA 2BT6A 1PGXA 1F2RI 1WR1A 4HK2A 5IKCM 2GBKA 3GP7A 5D7GA 5EE1A 3MJ5A 1GC6A 2WNMA 3TEZA 1C76A 2JYTA 2PKOA 4FXCA 2BWES 1HQRD 4PS8A 1H8CA 1C4PA 3I9V1 4KSLC 4KZ0A 1XD3B 1ET6A 1SJED 4EZJA 5E6NA 2KDBA 3QK0A 2LVOA 1E10A 1UZXB 1XCQL 2ZNVC 3B0AA 4PYZA 3RI7C 4LDTB 1EM7A 1VZ7A 3FAHA 5C1ZA 3N20C 3HM3A 3IBEA 3Q8BA 2DZJA 2MH7A 1UELA 3W2DA 3A1QB 2LJIA 4RFBA 1UBIA 2GBMA 1FCCC 1I4GA 1KTKA 1QOFA 4B0MA 1SBBB 2D3GA 2CR5A 1I4RA 2J52A 1NYRA 2ICIA 2ZPNA 3B2FA 3DWMA 2RPVA 3Q3MC 2ZCBA 2JF5A 4MDKE 3VR8B 1OEYJ 2LWPA 2W3SA 4MGYE 3NRZA 3RNAC 2HTME 1SIFA 2BPSA 1K50A 1YIWA 3FILB 4WJNA 1MHHE 3ZNZB 1E8XA 5TSSA 4LJOB 3UQBA 2MSED 1NBFC 2WXMA 3ZXVA 4EE2A 1L7YA 3L16A 1PGBA 2EMSA 1VJKA 2JUOA 5CX3A 1SEBD 3L10B 1R7SA 3I57A 3N1ZC 4FN2A 5EE3A 2KDMA 5G55A 4D2KA 3A1QA 3ECIA 4ANWA 3ZNGC 3ZGZA 2RDHA 1WGKA 2EELA 1L4ZB 2V3NA 3LDZE 3QWZB 1GPXA 2B3AA 2JY6A 2WGSA 3DWGC 1FXAA 1WXAA 5IAAC 1WR6E 4HKQA 2BWFA 2L0FA 4AOFA 1WX7A 4B95A 1J7CA 2J4XA 1TYGB 2Q5WD 2KO3A 3DHHC 2M0AA 4GDKA 3AB5A 5FKAC 3BVMA 4R3DA 4X57B 4MT5A 4MH0E 5DCNA 1V5TA 1AWDA 1X1MA 4AJYB 5E6OA 5JHBA 2MP2B 3BK2A 2RMMA 1FXTB 4S0RA 3A9JB 1XO3A 3JVZX 4ZOHC 5EE0A 2KQ4X 4BAXA 2KVZA 3Q2AC 4K3CA 1JW9D 4W9FA 2DWQA 1UNSA 5CHWA 2K8CA 3EUB2 4C4VB 1XCTL 2RDBC 1S3SG 1QILA 4DXFA 2KJ6A 2SAKA 1B1ZA 5H92C 3AEAB 4ZYNA 4MGKE 2GBJA 3N3KB 1SSNA 1IUEA 3P1MA 2IO1B 4IM2A 4M8MA 3DVGX 2KANA 2MP2A 2XN9C 1MG4A 4I6NB 3IAS1 2IO0B 1E90A 3A9JA 3VUXA 2KWVB 3VR9B 3W5VB 4OZAA 2KMMA 1V80A 2MX2A 1CK1A 4L2YA 2LGYA 1IBXB 3VFKA 1VZ8A 4JIOU 2PVGC 4HWIB 4RNAA 3W1SA 4C4VA 3OLMD 1QZEA 1BT0A 4LLGM 1RLFA 3K9OB 2KT7A 3ZXRA 2MJEA 2N7EA 4YWGG 4G11A 4HPLB 2JSVX 2L0TA 3ZNHB 2ZEQA 3AEBB 4PT5A 2RD0A 4A6QA 2AWTA 4BKGA 1H4RA 3OWEB 3Q6BA 4GLSC 3SHQA 4IKGA 4GGQA 1N5WA 3VH3B 4AQ7A 1GB4A 1I4PA 1IBXA 4S17A 2XK5A 4F8CB 2D2QA 1YQ3B 3BVGA 2ZW1A 2MJ3A 2PE9A 2L1AA 3RPFC 1HZ5A 3R8BA 1WM3A 1FNUA 2DNFA 2LVPA 1Q0WB 4A20A 4BKSA 2JZZA 4WWOA 2BTEA 2NPTB 2LJ5A 4AJWA 3B08A 4W9EA 5AZFA 2QIEB 2IPKD 1P7EA 1WX8A 2KX3A 3GZNB 2KTFA 4EEWA 1P9DU 4CHKA 2EKEC 1IGCA 3N9YC 1V9JA 3MC0B 4LDTD 2WDVB 4A3OA 1Z5SB 3UF8A 4RH6A 3WIMA 2CS4A 4XDDA 3TSSA 2GLSA 1F9JA 4LNIA 1EF5A 4ITKA 3L13A 3H7SA 2NPTA 4YTMB 1NDDA 2H89B 1UUPA 4C80A 1HXYD 2OEDA 3NJTA 4ZHOA 1PDXA 2DZMA 1MHXA 3SR6A 1I4QA 2LGSA 3BINA 4DDID 1FRRA 1OQYA 4OVUA 3L08A 1YOVB 1Q1OA 2BF8B 2Y5PA 4GXBA 1JRUA 4RMAA 1E7VA 4LTUA 1V97A 4A90A 3ZO5B 2G3QB 4L23A 2WXHA 2O6VB 1L6UA 4HROA 1T3QA 1UGJA 5FK9C 3ZJUA 2KACA 3Q8FA 4EUTA 2KC1A 2K25A 1J0GA 2BKFA 4MSQB 1TS5A 1ZXIA 1UGMA 2M19A 5G5HA 5J17A 2XBBC 1Q10A 3V60A 1YJJA 3T3NA 1C78A 1E8ZA 2ZJDA 2HTHA 1SF0A 5EDSA 1KRHA 1C77A 4ARCA 2IO2B 4N9F4 3IFWB 3OJ3A 2RPQA 1CQVA 3AE5B 3V6EB 1E5WA 2PEAA 3U7ZA 2YEPF 1JWMD 2FCNA 2LASA 4MM3A 2O6VA 1SJHD 3TEWA 3DBHB 4PYUA 3RYTA 4JX1C 1E7PB 2MRPA 4BKTA 2L76A 2KC2A 1AW7A 4NJCA 3RCZA 1CZPA 1A70A 1V1PA 2JRIB 3OG5A 4JQWC 1WIAA 1KJTA 2WDRB 3QA8A 5L83A 1I4XA 2O2VB 1B9RA 2GB1A 3AEEB 5C2TB 1WJNA 4P7IA 3MJWA 1MFWA 2BS2B 5D94A 2KK8A 3L54A 4H2AA 2SEBD 2GRIA 4TQ1A 4G50A 2FBWB 3LYYA 5BMIA 4GU2A 2QDFA 1XEEA 3M62B 1SGHA 1TGZB 1WE7A 5IOIA 4ICUA 3M63B 2JU6X 3AI5A 5J2RA 3KYCD 2Z0EB 4NJ6A 1R4MB 1WGDA 2KQ7A 3AH7A 2NTTA 3PHXB 3VHTC 1LQBA 4FADA 4W9CA 1BUIC 3BY4B 2KFJA 2VH1A 5D6JB 2KDEB 3PGEA 2O2VA 4BKSD 2FCQA 1F2RC 5DPWA 4RCOA 3NZ3A 1DOXA 4GMVA 5JXVA 1JWUD 3Q3JA 2KOXA 3K9PB 1MJDA 3GB1A 2PLPA 2WYQA 1ZE3D 4US8A 3GZNI 3TBLD 3W1YA 1WGHA 4IWPA 4N58A 4E3CA 1RAXA 2K0PA 1JRPA 2D3AA 1XXGA 1WJUA 2KZRA 3ALBA 3AE9B 2D5GA 3IXSA 1OEYA 3BK1A 4K3BA 2DBYA 4WH4A 4RF1A 1ET9A 5I4DA 2WXQA 3PLVA 2JXXA 1FEHA 3PV1A 2KVRA 1WRDB 1WGRA 4JWUC 1UH6A 1WY8A 2NR2A 2WXNA 2ON8A 5LXIB 2IBIB 2QEJC 2UYZB 2J0KA 3KYDD 1JWBD 4DHZB 4NJ7A 2LUMA 4BBNF 3PRMB 2C7MB 1ZUD2 2YLMA 3KUCB 1N62A 2KJHB 3SFEB 1TKYA 1FFVA 1RWSA 1YMHE 2WXJA 2L3ZA 3VTUA 2N9KA 4HDQA 1MI0A 5LNK1 2A5UA 3ZQ4A 2MJDA 4KDIC 1WE6A 3EFUA 1GJZA 1DOIA 3MC8A 2NBWB 1LFDA 1N6ZA 3IVFA 3UI3A 1P7FA 2GBNA 2WDQB 2JX5A 2GMIC 4F1SA 5AZGA 2NBUA 1RFAA 2I38A 3JSVB 4RF0A 1E9MA 2D3BA 1P1AA 2K6DB 4AP4C 3Q8CA 2BB5A 1YQBA 4JL9A 4M0WB 3DQVA 4YSZB 1WGGA 1BMLC 3NZUA 1F77A 4KGRA 4B0EA 3DBLB 1D5MC 2G4SA 2W9NA 4ZYSA 2DYMA 2VZKD 3C19A 3VUWA 2O6VD 1ZDVA 2V3SA 4AS1A 2BGFA 2BB6A 1J7BA 4GDKB 1XLQA 3HM6X 2TSSA 3ZJVA 4M01A 2BYVE 4GN1A 2NS5A 3WCQA 1IP9A 1SIJA 1QOGA 2MBBB 4MJSA 1E6EB 2RGFA 3RMKC 1KH0A 4N6EB 3R7QA 1VLBA 3B2GA 2WP9B 3JSVA 3RZFA 1OGWA 1YN4A 4M0WA 4OZBA 3EFCA 2WU5B 2BS4B 2WDTB 4URKA 2KQSA 3A9KB 4GIVA 1E7UA 1L6VA 1LO5D 5GMVA 4CYEA 4ZRJA 4MACA 1F0ZA 3L4PA 2N7DA 2AL6A 4TSSA 1WZ3A 2X38A 4ACFA 1R4MI 2KMCA 4CO7A 1Q5WB 2E6XA 3SEBA 1QOAA 1K52A 1N60A 3Q3OC 3RUIB 1WX9A 2G4DB 1J8CA 2WXRA 1KFYB 1IGDA 2LVQA 2REXA 3A9KA 2K6QA 3B9JA 3H7PB 4J6IA 4FULA 2DZIA 4OVVA 3PPAA 2NBVB 2KMAA 1WMHA 2QCZA 2J0JA 2MBOA 1SE2A 3ZTDA 2Z8LA 1ZP0B 1P3QU 3MP9A 4FLHA 2J7QB 5BYSA 3P4PB 5BYRA 2DHZA 3FC4A 4KX6B 2WU2B 1DYQA 2JZ3B 1T0YA 1WH3A 3V6CB 2XK5B 2K9XA 3VTVA 2L32A 1XLOA 5FR3A 2KFKA 4XWWA 3C8YA 2GI9A 3H7PA 3JW0X 1EO6A 1QT9A 2PE6B 1L0YB 1D4BA 2JWZA 2MBEA 2M4NA 3URYA 2H88B 3QHTA 3AEGB 2KYWA 3APFA 4XYCA 4KV2A 1ESFA 2ZVNA 3UIPB 3VXWA 2AX5A 2HE7A 3ZRFA 1T5XD 3DHIC 2JT4B 1Y56A 1WYWB 3X0WA 1LGRA 3Q8EA 4KKJA 5CTRC 4L1BA 4I6PA 3QARA 3I3TB 4FHKA 3R66C 3AE8B 4ZRPA 1EWYC 2MW5A 4W9JA 1ISNA 1WGYA 1WF9A 3ML9A 3PZDA 1T0SC 1IPGA 3I63C 2RDGA 2DAFA 2CU1A 4ANUA 3M95A 3PRPB 3CMMB 4WWNA 3TUOA 5JHAA 2FCSA 4RGTA 2LXCA 4M02A 2FAZA 3ZYYX 1C4AA 3L0WB 4OHJA 5G2NA 2K8BA 4DBGA 3A4RA 4NQKE 2AYOB 2MHJA 1ENFA 1WFYA 3DBLI 3DVNU 2A4ZA 2WQYB 1AYFA 3AE7B 1DGJA 2WHIA 2V0GA 1VCBA 1L5PA 4HCNB 1MPEA 3BVZA 4IM0A 2PTLA 2WX1A 2PPHA 2K22A 3Q8AA 3DVNV 2JPHA 4WAFA 4YTNB 1V2YA 3KW5B 1E0ZA 1OQRA 3AN1A 2N9PC 1KM7A 4P1CC 1SE3A 2PVOD 5IO9A 3ZRCA 2M17A 2EMTA 3AU5A 4YSYB 1HEZE 2LEKA 4KDLB 3TL5A 2V9HA 3MHSD 4NPNA 1TS3A 3WAPA 2MEKA 4C00A 1EUVB 1TS2A 3RNFC 4HJGE 4PS3A 2L52A 2RR9A 4MGIE 4WQMA 1GC7A 2DZKA 3WAMA 2XEWA 2KXJA 4G0NB 2B76B 2INCC 2D11A 1VZ6A 4EKUA 2BQQA 2WWZA 3HIZA 4W9IA 3H6NA 4P1BC 1NEKB 5C3JB 1IYFA 2VZKB 4MM3B 3R3MA 1TZ1A 3ZNID 4ANVA 4LNFA 2LFIA 1K8RB 2C7HA 3T9LA 4MELA 4DQOC 2HDEA 4ASWC 3ZJTA 1TKGA 4WAAA 3SFDB 3IHPC 4A3PA 3EGRA 1V1PB 4JE3B 3E9SA 1MG8A 4KVGB 2JVCA 3ABVB 1RRBA 3UINB 1RM6C 1WRIA 1WM2A 3U52E 4KIKB 2KD0A 2IGHA 3PT2B 2KDIA 3AE3B 1WXVA 2CKHB 2WXIA 4TV3A 4XWTA 2V4IB 3U2SC 3ZVVA 2HJ8A 3QIJA 2M56B 2C60A 2NVUI 4XE0A 4BBNC 1WXMA 4CQNA 4XGAB 2FUG1 4JWSC 1KLGD 2K5PA 1YN3A 3QAQA 2L05A 3DVGY 4JGHB 2ZPYA 3PRZA 3PZ8A 3ENEA 4IDIA 3U8ZA 2N9LA 2D10A 1A5RA 4KZCA 3VAWA 1GG3A 4HLEA 2V1YA 2CU3A 3NY5A 3N30A 4KIKA 4KGTA 3PHWB 3VVWB 4HEA1 2D3CA 2R61A 2IGDA 4HVBA 2KN4A 5D3IB 3VRBB 2VRRB 4DHJB
chains in the Genus database with same CATH topology
4E74A 4W9FA 4IG7B 3EFUA 4K7WA 1GJZA 2WX0A 3W1SC 5CHWA 2K8CA 2NBWB 3MTNB 1WJ4A 2LGXA 2GOWA 2KLGA 4DHZE 1S3SG 3RZWC 2ZNVB 3DCGA 2C9WB 4KSKC 4XC2A 3OJ4B 2FCMA 1LFDA 3IVFA 4WJQA 3VQIA 5FR6A 2KJ6A 2FIDA 3AU4A 2GBNA 4ZYNA 4MGKE 2GBJA 3N3KB 3R7RA 2GMIC 2KWUB 3DBRI 4IWOA 2I1KA 2DENB 4JLCA 2IO1B 2J0MA 4F1SA 1I42A 5AZGA 4IM2A 3ZDMC 2NBUA 1RFAA 3JSVB 4M8MA 1P1AA 2K6DB 4AP4C 3DVGX 2KANA 2MP2A 3QC8B 3EECA 4I6NB 1YQBA 2IY0B 4JL9A 4M0WB 4NNJB 3DQVA 3ONSA 2IO0B 1E90A 3A9JA 1WGGA 3VUXA 2KWVB 4KDIC 3NZUA 2QHOA 1YX6B 4FJVB 1V80A 2G4SA 2MX2A 2W9NA 3VTWA 2LGYA 2V4LA 4TQ0A 2DYMA 3ZDTA 3VFKA 3VUWA 2O6VD 4JIOU 2C7NB 3UQAA 2V3SA 4IUMB 2BGFA 1NI2A 3QCAA 4GDKB 2BYEA 4HWIB 3TJPA 3RD2A 3W1SA 1I35A 3HM6X 4AWJA 3OLMD 4RM8A 3L17A 2BYVE 2DYBA 3N32A 4HPMB 1QZEA 1BT0A 4GN1A 2NS5A 2MBHA 4NY0A 2KNBA 1IP9A 4XZ4A 1RLFA 2CHWA 2MBBB 4MJSA 3K9OB 2RGFA 2KWCA 2N7EA 2BYFA 4G11A 4XX5A 4HPLB 4BFRA 1HE8A 3R7QA 4BOZB 5JZEB 2L0TA 3ZNHB 3AULA 3JSVA 1WJ6A 4NAWB 3RZFA 2ZEQA 1OGWA 2RD0A 4IW0A 3NOBA 2AWTA 2N9XA 4GDLB 1H4RA 1YD8U 4BKGA 4K81A 2FIFA 3ZLZA 2MBQA 2KJRA 1P0RA 4MGZE 3SHQA 2WDTB 4GGQA 2IO3B 1WXSA 2KQSA 4W9KA 5DPTA 3CSFA 3VH3B 4URKA 3A9KB 4GIVA 1OTRB 4W9DA 1C1YB 1E7UA 1V5OA 3ZUNA 3U7DA 3C0RB 2L8JA 5GMVA 2N1WA 3HK0A 2XK5A 4CYEA 4F8CB 2D2QA 3M3JA 4MEMA 4ZRJA 2CHZA 1P98A 2DAJA 2KTRB 3CF6E 2PE9A 2PJHA 3TCAA 2N7DA 5JH5C 5J18A 2AL6A 2M1MA 4WQOB 1WZ3A 3DOWA 4ANXA 1WM3A 1ZW7A 2LVPA 1Q0WB 2ZZPB 4A20A 5HKHA 3EHVA 5D2MB 4BKSA 1R4MI 2KMCA 4CO7A 2JZZA 3PVLA 4GB9A 4WWOA 3ZKJC 3H9DA 1Q5WB 1M94A 3NZSA 2KDFB 2L00B 4WJPA 2NPTB 5KHQA 3WA0A 2KLCA 2LJ5A 3RUIB 4AJWA 1KOTA 1WX9A 2G4DB 2L7RA 3B08A 1J8CA 4W9EA 4NAWA 5AZFA 1YX5B 5L95C 3QJZA 4IWQA 4GDLA 3V62A 4FBJB 4MSMB 3ZTCA 1WX8A 2KX3A 3Q3FA 4I6LB 1EF1A 2LVQA 3WALA 2REXA 2OJRA 4YL8A 2KTFA 3VH4B 4EEWA 1D3ZA 3A33B 3A9KA 1P9DU 1KLVA 2K6QA 3H7PB 2LI5A 4J6IA 4FULA 4CHKA 2EKEC 2DZIA 2MA9B 4OVVA 3PPAA 1E8WA 2NBVB 2KMAA 1V9JA 1WMHA 5CHVC 4LDTD 3KUDB 2KTRA 4A3OA 4B6WA 3T8MA 2J0JA 1Z5SB 3UF8A 2MLBA 4MJSB 2LRUA 4IC7B 3DPDA 5IA7A 3VDZA 5CHFA 2MBOA 3ZTDA 4EFOA 1GNUA 1C3TA 2DX5B 3WIMA 2CS4A 3QX1A 4RM9A 1F9JA 1P3QU 2LUEA 4ZDVA 1EF5A 4FLHA 5DPRA 2J7QB 4ZRIA 2CHXA 3H7SA 2NPTA 3IG3A 1NDDA 3JYUA 3L13A 2YVCA 2DHZA 1UD7A 1Y8RC 4ICVA 2JZ3B 1LM8B 2FUHB 4FA6A 1T0YA 1WH3A 3KH0A 3V6CB 2DZMA 4W9LA 5DPSA 4AUQC 4NQLB 2XK5B 2JRHA 4K7UA 3VTVA 2M8SA 3BINA 3DBHI 4IM3A 2KFKA 4DDID 2Z0DB 3H1UA 1OQYA 3H7PA 3JW0X 1EO6A 4OVUA 2PE6B 1G6JA 2JWZA 3L08A 2MBEA 2M4NA 4EZLA 2N9EB 1Q1OA 2BKRB 2BF8B 3QHTA 4GXBA 1U4AA 2C5LC 2R2OA 2Y5BB 3APFA 1JRUA 4KV2A 4G3XB 3PS6A 4RMAA 1E7VA 3EC8A 4LJPB 2ZVNA 5AEKB 3ZO5B 2G3QB 3UIPB 4WJOA 3VXWA 2O6VB 2R2QA 1YJ1A 2HE7A 3ZRFA 2JT4B 3X23A 1VD2A 1WYWB 3X0WA 3QQ8B 2LGDA 2G45B 3ZW3A 4LCDE 2DYOA 4FJZA 3TIXA 2D07B 4HXDA 2K8HA 4K1RB 2RSUA 2MWSB 4EUTA 2KC1A 2K25A 3PREA 2BKFA 4MSQB 4W9HA 5CTRC 4I6PA 5E6PA 1J0GA 3QARA 3NHEB 3DDCB 1CMXB 3I3TB 3R66C 4FHKA 1S1QB 1UGMA 5J17A 2XBBC 3CSTA 4EOYA 3V60A 2MW5A 4W9JA 1ISNA 1WGYA 1WF9A 1WI0A 2K39A 1WMHB 3VUYA 1GUAB 1E8YA 1E8ZA 2LXAA 3AXCA 3ML9A 3PZDA 1IPGA 2ZJDA 4ZRKA 2HTHA 2LRWA 2DAFA 2IZVB 5EDSA 2CU1A 4ANUA 3M95A 3PRPB 4F7ZA 2IO2B 4N9F4 3ZIMA 3CMMB 3IFWB 3OAWA 3PSEB 3OJ3A 4WWNA 2OOBB 3GOEA 2NCNA 5JHAA 2FCSA 2MCNB 2RPQA 3HHMA 5TR5A 1Z2MA 4K7SA 2LXCA 3PLUA 2FAZA 3V6EB 1E5WA 2PEAA 4TKNA 2ASQA 2KX0A 3PTFC 3L0WB 2FCNA 2LASA 4MM3A 5G2NA 2K8BA 2O6VA 4GSWA 3A4RA 3WAOA 2KHWB 3UIOB 3V61A 1TTNA 4DBGA 4NQKE 3NS8A 4HCPB 2AYOB 1WFYA 4PYUA 3DBLI 3DVNU 3RYTA 2A4ZA 3DBSA 2MRPA 2FNJB 5BO4B 3UGBB 4BKTA 1VCBA 1ZGUB 2L76A 1WR1A 4DHJD 4HCNB 2KC2A 2KFKB 4HK2A 4DK5A 3APCA 1ZKHA 2GBKA 3D32A 4II2B 4IM0A 3RCZA 5D7GA 2JRIB 2WX1A 1SE9A 1GC6A 2GBRA 4JQWC 2PPHA 4W9GA 1WIAA 1KJTA 2IY1B 3QA8A 3SU8X 2BWES 3DVNV 4PS8A 5L83A 2JPHA 1H8CA 4FHJA 2M0XA 2O2VB 4KSLC 3APDA 4KZ0A 1XD3B 3P2BA 1V81A 4EZKA 1V2YA 1WZ0A 3KW5B 4EZJA 1WJNA 5E6NA 2KDBA 2AEHA 3QK0A 2LVOA 4P7IA 2N1VA 1UZXB 3MJWA 2N9PC 3SDLC 2ZNVC 1KM7A 5D94A 3ZRCA 2KK8A 2M17A 3B0AA 3L54A 4PYZA 4E71A 4TQ1A 3S2AA 2EMTA 4LDTB 4G50A 3AU5A 3TL5A 4KDLB 4DDGD 1XT9B 1UBQA 3MHSD 4GU2A 4TUUA 4FJYA 3M62B 4NPNA 5C1ZA 3HM3A 2ZVOA 1LXDA 1SGHA 1TGZB 3WAPA 5C23A 1WE7A 1EUVB 1PQSA 3WANA 4ICUA 3M63B 3IBEA 3AI5A 4PS3A 5J2RA 2DZJA 1UELA 2Z0EB 3KYCD 4BOSC 3A1QB 4NJ6A 3RULA 2RR9A 1V6EA 4MGIE 1WGDA 2KQ7A 4DXAB 1TBEA 1UBIA 1GC7A 2DZKA 2GBMA 4WWPA 3WAMA 2XEWA 2KXJA 4G0NB 3PHXB 3VHTC 1LQBA 1V86A 4FADA 2D11A 4W9CA 3BY4B 2D3GA 2KFJA 2CR5A 5D6JB 4EKUA 3HIZA 2WWZA 4W9IA 2KDEB 3LJ3A 3PGEA 2ZPNA 2O2VA 3H6NA 4BKSD 1XQQA 3SD5A 2FCQA 2MQJA 2HD5B 1IYFA 5DPWA 4GOCA 3R3MA 1TZ1A 4GMVA 2ZCBA 2JF5A 3RT3B 4MDKE 3ZNID 4DWFA 1OEYJ 2LWPA 3Q3JA 3A4SC 4MGYE 4ANVA 2IYDB 2KOXA 3K9PB 2N4FA 2WYQA 1SIFA 3ML8A 1K8RB 2BPSA 2C7HA 3O65B 3T9LA 1YIWA 4MELA 4ASWC 3GZNI 2KKCA 4WJNA 3TBLD 3U30A 1E8XA 2AL3A 3W1YA 3ZNZB 4LJOB 4WAAA 3UQBA 2ZCCA 2LZ6A 2MSED 3IHPC 1NBFC 1R4NI 1WGHA 1J19A 4IWPA 1L7YA 3L16A 4A3PA 2EMSA 3B1LX 4E3CA 2JUOA 5CX3A 1MG8A 1RAXA 4KVGB 3L10B 2JVCA 1RRBA 3UINB 1AARA 2KZRA 3KUZA 1WJUA 4FN2A 3ALBA 5G55A 1WM2A 4B9KA 5AZHA 4PS7A 3A1QA 3ECIA 4ANWA 4KIKB 3ZNGC 2KD0A 1OEYA 3PT2B 2KDIA 1WXVA 2CKHB 3LDZE 4TV3A 3QWZB 2B3AA 4HDOA 1L2NA 2Z59B 2JY6A 3ZVVA 2UWQA 4M8NA 3TMPB 2HJ8A 1WXAA 2KN5A 3PLVA 2JXXA 3QIJA 5IAAC 3PV1A 1WR6E 5KHOA 2C60A 2KVRA 2NVUI 1WRDB 1WGRA 4BBNC 2BWFA 2L0FA 4AOFA 1UH6A 1WX7A 4B95A 1WXMA 1WY8A 2NR2A 5LXHA 2KO3A 4BVUC 5LXIB 2IBIB 4GDKA 2UYZB 3KVFB 2J0KA 3KYDD 3QAQA 4DHZB 2L05A 3DVGY 4X57B 4NJ7A 4JGHB 4MH0E 2ZPYA 4HJKA 1V5TA 5DCNA 4BBNF 3PRMB 1X1MA 4AJYB 2C7MB 2I1JA 5E6OA 2K1FA 3PRZA 5JHBA 2LD9A 3ENEA 2MP2B 3U8ZA 1A5RA 2D10A 2YLMA 3KUCB 2KJHB 1FXTB 4KZCA 3VAWA 1GG3A 3A9JB 5LLIA 2V1YA 1V49A 4HLEA 3NY5A 3N30A 4KIKA 3JVZX 3PHWB 3VVWB 4II3B 2L3ZA 3VTUA 4HDQA 4HVBA 2A5UA 2VRRB 4DHJB 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E74 A;  4W9F A;  4IG7 B;  3EFU A;  4K7W A;  1GJZ A;  2WX0 A;  3W1S C;  5CHW A;  2K8C A;  2NBW B;  3MTN B;  1WJ4 A;  2LGX A;  2GOW A;  2KLG A;  4DHZ E;  1S3S G;  3RZW C;  2ZNV B;  3DCG A;  2C9W B;  4KSK C;  4XC2 A;  3OJ4 B;  2FCM A;  1LFD A;  3IVF A;  4WJQ A;  3VQI A;  5FR6 A;  2KJ6 A;  2FID A;  3AU4 A;  2GBN A;  4ZYN A;  4MGK E;  2GBJ A;  3N3K B;  3R7R A;  2GMI C;  2KWU B;  3DBR I;  4IWO A;  2I1K A;  2DEN B;  4JLC A;  2IO1 B;  2J0M A;  4F1S A;  1I42 A;  5AZG A;  4IM2 A;  3ZDM C;  2NBU A;  1RFA A;  3JSV B;  4M8M A;  1P1A A;  2K6D B;  4AP4 C;  3DVG X;  2KAN A;  2MP2 A;  3QC8 B;  3EEC A;  4I6N B;  1YQB A;  2IY0 B;  4JL9 A;  4M0W B;  4NNJ B;  3DQV A;  3ONS A;  2IO0 B;  1E90 A;  3A9J A;  1WGG A;  3VUX A;  2KWV B;  4KDI C;  3NZU A;  2QHO A;  1YX6 B;  4FJV B;  1V80 A;  2G4S A;  2MX2 A;  2W9N A;  3VTW A;  2LGY A;  2V4L A;  4TQ0 A;  2DYM A;  3ZDT A;  3VFK A;  3VUW A;  2O6V D;  4JIO U;  2C7N B;  3UQA A;  2V3S A;  4IUM B;  2BGF A;  1NI2 A;  3QCA A;  4GDK B;  2BYE A;  4HWI B;  3TJP A;  3RD2 A;  3W1S A;  1I35 A;  3HM6 X;  4AWJ A;  3OLM D;  4RM8 A;  3L17 A;  2BYV E;  2DYB A;  3N32 A;  4HPM B;  1QZE A;  1BT0 A;  4GN1 A;  2NS5 A;  2MBH A;  4NY0 A;  2KNB A;  1IP9 A;  4XZ4 A;  1RLF A;  2CHW A;  2MBB B;  4MJS A;  3K9O B;  2RGF A;  2KWC A;  2N7E A;  2BYF A;  4G11 A;  4XX5 A;  4HPL B;  4BFR A;  1HE8 A;  3R7Q A;  4BOZ B;  5JZE B;  2L0T A;  3ZNH B;  3AUL A;  3JSV A;  1WJ6 A;  4NAW B;  3RZF A;  2ZEQ A;  1OGW A;  2RD0 A;  4IW0 A;  3NOB A;  2AWT A;  2N9X A;  4GDL B;  1H4R A;  1YD8 U;  4BKG A;  4K81 A;  2FIF A;  3ZLZ A;  2MBQ A;  2KJR A;  1P0R A;  4MGZ E;  3SHQ A;  2WDT B;  4GGQ A;  2IO3 B;  1WXS A;  2KQS A;  4W9K A;  5DPT A;  3CSF A;  3VH3 B;  4URK A;  3A9K B;  4GIV A;  1OTR B;  4W9D A;  1C1Y B;  1E7U A;  1V5O A;  3ZUN A;  3U7D A;  3C0R B;  2L8J A;  5GMV A;  2N1W A;  3HK0 A;  2XK5 A;  4CYE A;  4F8C B;  2D2Q A;  3M3J A;  4MEM A;  4ZRJ A;  2CHZ A;  1P98 A;  2DAJ A;  2KTR B;  3CF6 E;  2PE9 A;  2PJH A;  3TCA A;  2N7D A;  5JH5 C;  5J18 A;  2AL6 A;  2M1M A;  4WQO B;  1WZ3 A;  3DOW A;  4ANX A;  1WM3 A;  1ZW7 A;  2LVP A;  1Q0W B;  2ZZP B;  4A20 A;  5HKH A;  3EHV A;  5D2M B;  4BKS A;  1R4M I;  2KMC A;  4CO7 A;  2JZZ A;  3PVL A;  4GB9 A;  4WWO A;  3ZKJ C;  3H9D A;  1Q5W B;  1M94 A;  3NZS A;  2KDF B;  2L00 B;  4WJP A;  2NPT B;  5KHQ A;  3WA0 A;  2KLC A;  2LJ5 A;  3RUI B;  4AJW A;  1KOT A;  1WX9 A;  2G4D B;  2L7R A;  3B08 A;  1J8C A;  4W9E A;  4NAW A;  5AZF A;  1YX5 B;  5L95 C;  3QJZ A;  4IWQ A;  4GDL A;  3V62 A;  4FBJ B;  4MSM B;  3ZTC A;  1WX8 A;  2KX3 A;  3Q3F A;  4I6L B;  1EF1 A;  2LVQ A;  3WAL A;  2REX A;  2OJR A;  4YL8 A;  2KTF A;  3VH4 B;  4EEW A;  1D3Z A;  3A33 B;  3A9K A;  1P9D U;  1KLV A;  2K6Q A;  3H7P B;  2LI5 A;  4J6I A;  4FUL A;  4CHK A;  2EKE C;  2DZI A;  2MA9 B;  4OVV A;  3PPA A;  1E8W A;  2NBV B;  2KMA A;  1V9J A;  1WMH A;  5CHV C;  4LDT D;  3KUD B;  2KTR A;  4A3O A;  4B6W A;  3T8M A;  2J0J A;  1Z5S B;  3UF8 A;  2MLB A;  4MJS B;  2LRU A;  4IC7 B;  3DPD A;  5IA7 A;  3VDZ A;  5CHF A;  2MBO A;  3ZTD A;  4EFO A;  1GNU A;  1C3T A;  2DX5 B;  3WIM A;  2CS4 A;  3QX1 A;  4RM9 A;  1F9J A;  1P3Q U;  2LUE A;  4ZDV A;  1EF5 A;  4FLH A;  5DPR A;  2J7Q B;  4ZRI A;  2CHX A;  3H7S A;  2NPT A;  3IG3 A;  1NDD A;  3JYU A;  3L13 A;  2YVC A;  2DHZ A;  1UD7 A;  1Y8R C;  4ICV A;  2JZ3 B;  1LM8 B;  2FUH B;  4FA6 A;  1T0Y A;  1WH3 A;  3KH0 A;  3V6C B;  2DZM A;  4W9L A;  5DPS A;  4AUQ C;  4NQL B;  2XK5 B;  2JRH A;  4K7U A;  3VTV A;  2M8S A;  3BIN A;  3DBH I;  4IM3 A;  2KFK A;  4DDI D;  2Z0D B;  3H1U A;  1OQY A;  3H7P A;  3JW0 X;  1EO6 A;  4OVU A;  2PE6 B;  1G6J A;  2JWZ A;  3L08 A;  2MBE A;  2M4N A;  4EZL A;  2N9E B;  1Q1O A;  2BKR B;  2BF8 B;  3QHT A;  4GXB A;  1U4A A;  2C5L C;  2R2O A;  2Y5B B;  3APF A;  1JRU A;  4KV2 A;  4G3X B;  3PS6 A;  4RMA A;  1E7V A;  3EC8 A;  4LJP B;  2ZVN A;  5AEK B;  3ZO5 B;  2G3Q B;  3UIP B;  4WJO A;  3VXW A;  2O6V B;  2R2Q A;  1YJ1 A;  2HE7 A;  3ZRF A;  2JT4 B;  3X23 A;  1VD2 A;  1WYW B;  3X0W A;  3QQ8 B;  2LGD A;  2G45 B;  3ZW3 A;  4LCD E;  2DYO A;  4FJZ A;  3TIX A;  2D07 B;  4HXD A;  2K8H A;  4K1R B;  2RSU A;  2MWS B;  4EUT A;  2KC1 A;  2K25 A;  3PRE A;  2BKF A;  4MSQ B;  4W9H A;  5CTR C;  4I6P A;  5E6P A;  1J0G A;  3QAR A;  3NHE B;  3DDC B;  1CMX B;  3I3T B;  3R66 C;  4FHK A;  1S1Q B;  1UGM A;  5J17 A;  2XBB C;  3CST A;  4EOY A;  3V60 A;  2MW5 A;  4W9J A;  1ISN A;  1WGY A;  1WF9 A;  1WI0 A;  2K39 A;  1WMH B;  3VUY A;  1GUA B;  1E8Y A;  1E8Z A;  2LXA A;  3AXC A;  3ML9 A;  3PZD A;  1IPG A;  2ZJD A;  4ZRK A;  2HTH A;  2LRW A;  2DAF A;  2IZV B;  5EDS A;  2CU1 A;  4ANU A;  3M95 A;  3PRP B;  4F7Z A;  2IO2 B;  4N9F 4;  3ZIM A;  3CMM B;  3IFW B;  3OAW A;  3PSE B;  3OJ3 A;  4WWN A;  2OOB B;  3GOE A;  2NCN A;  5JHA A;  2FCS A;  2MCN B;  2RPQ A;  3HHM A;  5TR5 A;  1Z2M A;  4K7S A;  2LXC A;  3PLU A;  2FAZ A;  3V6E B;  1E5W A;  2PEA A;  4TKN A;  2ASQ A;  2KX0 A;  3PTF C;  3L0W B;  2FCN A;  2LAS A;  4MM3 A;  5G2N A;  2K8B A;  2O6V A;  4GSW A;  3A4R A;  3WAO A;  2KHW B;  3UIO B;  3V61 A;  1TTN A;  4DBG A;  4NQK E;  3NS8 A;  4HCP B;  2AYO B;  1WFY A;  4PYU A;  3DBL I;  3DVN U;  3RYT A;  2A4Z A;  3DBS A;  2MRP A;  2FNJ B;  5BO4 B;  3UGB B;  4BKT A;  1VCB A;  1ZGU B;  2L76 A;  1WR1 A;  4DHJ D;  4HCN B;  2KC2 A;  2KFK B;  4HK2 A;  4DK5 A;  3APC A;  1ZKH A;  2GBK A;  3D32 A;  4II2 B;  4IM0 A;  3RCZ A;  5D7G A;  2JRI B;  2WX1 A;  1SE9 A;  1GC6 A;  2GBR A;  4JQW C;  2PPH A;  4W9G A;  1WIA A;  1KJT A;  2IY1 B;  3QA8 A;  3SU8 X;  2BWE S;  3DVN V;  4PS8 A;  5L83 A;  2JPH A;  1H8C A;  4FHJ A;  2M0X A;  2O2V B;  4KSL C;  3APD A;  4KZ0 A;  1XD3 B;  3P2B A;  1V81 A;  4EZK A;  1V2Y A;  1WZ0 A;  3KW5 B;  4EZJ A;  1WJN A;  5E6N A;  2KDB A;  2AEH A;  3QK0 A;  2LVO A;  4P7I A;  2N1V A;  1UZX B;  3MJW A;  2N9P C;  3SDL C;  2ZNV C;  1KM7 A;  5D94 A;  3ZRC A;  2KK8 A;  2M17 A;  3B0A A;  3L54 A;  4PYZ A;  4E71 A;  4TQ1 A;  3S2A A;  2EMT A;  4LDT B;  4G50 A;  3AU5 A;  3TL5 A;  4KDL B;  4DDG D;  1XT9 B;  1UBQ A;  3MHS D;  4GU2 A;  4TUU A;  4FJY A;  3M62 B;  4NPN A;  5C1Z A;  3HM3 A;  2ZVO A;  1LXD A;  1SGH A;  1TGZ B;  3WAP A;  5C23 A;  1WE7 A;  1EUV B;  1PQS A;  3WAN A;  4ICU A;  3M63 B;  3IBE A;  3AI5 A;  4PS3 A;  5J2R A;  2DZJ A;  1UEL A;  2Z0E B;  3KYC D;  4BOS C;  3A1Q B;  4NJ6 A;  3RUL A;  2RR9 A;  1V6E A;  4MGI E;  1WGD A;  2KQ7 A;  4DXA B;  1TBE A;  1UBI A;  1GC7 A;  2DZK A;  2GBM A;  4WWP A;  3WAM A;  2XEW A;  2KXJ A;  4G0N B;  3PHX B;  3VHT C;  1LQB A;  1V86 A;  4FAD A;  2D11 A;  4W9C A;  3BY4 B;  2D3G A;  2KFJ A;  2CR5 A;  5D6J B;  4EKU A;  3HIZ A;  2WWZ A;  4W9I A;  2KDE B;  3LJ3 A;  3PGE A;  2ZPN A;  2O2V A;  3H6N A;  4BKS D;  1XQQ A;  3SD5 A;  2FCQ A;  2MQJ A;  2HD5 B;  1IYF A;  5DPW A;  4GOC A;  3R3M A;  1TZ1 A;  4GMV A;  2ZCB A;  2JF5 A;  3RT3 B;  4MDK E;  3ZNI D;  4DWF A;  1OEY J;  2LWP A;  3Q3J A;  3A4S C;  4MGY E;  4ANV A;  2IYD B;  2KOX A;  3K9P B;  2N4F A;  2WYQ A;  1SIF A;  3ML8 A;  1K8R B;  2BPS A;  2C7H A;  3O65 B;  3T9L A;  1YIW A;  4MEL A;  4ASW C;  3GZN I;  2KKC A;  4WJN A;  3TBL D;  3U30 A;  1E8X A;  2AL3 A;  3W1Y A;  3ZNZ B;  4LJO B;  4WAA A;  3UQB A;  2ZCC A;  2LZ6 A;  2MSE D;  3IHP C;  1NBF C;  1R4N I;  1WGH A;  1J19 A;  4IWP A;  1L7Y A;  3L16 A;  4A3P A;  2EMS A;  3B1L X;  4E3C A;  2JUO A;  5CX3 A;  1MG8 A;  1RAX A;  4KVG B;  3L10 B;  2JVC A;  1RRB A;  3UIN B;  1AAR A;  2KZR A;  3KUZ A;  1WJU A;  4FN2 A;  3ALB A;  5G55 A;  1WM2 A;  4B9K A;  5AZH A;  4PS7 A;  3A1Q A;  3ECI A;  4ANW A;  4KIK B;  3ZNG C;  2KD0 A;  1OEY A;  3PT2 B;  2KDI A;  1WXV A;  2CKH B;  3LDZ E;  4TV3 A;  3QWZ B;  2B3A A;  4HDO A;  1L2N A;  2Z59 B;  2JY6 A;  3ZVV A;  2UWQ A;  4M8N A;  3TMP B;  2HJ8 A;  1WXA A;  2KN5 A;  3PLV A;  2JXX A;  3QIJ A;  5IAA C;  3PV1 A;  1WR6 E;  5KHO A;  2C60 A;  2KVR A;  2NVU I;  1WRD B;  1WGR A;  4BBN C;  2BWF A;  2L0F A;  4AOF A;  1UH6 A;  1WX7 A;  4B95 A;  1WXM A;  1WY8 A;  2NR2 A;  5LXH A;  2KO3 A;  4BVU C;  5LXI B;  2IBI B;  4GDK A;  2UYZ B;  3KVF B;  2J0K A;  3KYD D;  3QAQ A;  4DHZ B;  2L05 A;  3DVG Y;  4X57 B;  4NJ7 A;  4JGH B;  4MH0 E;  2ZPY A;  4HJK A;  1V5T A;  5DCN A;  4BBN F;  3PRM B;  1X1M A;  4AJY B;  2C7M B;  2I1J A;  5E6O A;  2K1F A;  3PRZ A;  5JHB A;  2LD9 A;  3ENE A;  2MP2 B;  3U8Z A;  1A5R A;  2D10 A;  2YLM A;  3KUC B;  2KJH B;  1FXT B;  4KZC A;  3VAW A;  1GG3 A;  3A9J B;  5LLI A;  2V1Y A;  1V49 A;  4HLE A;  3NY5 A;  3N30 A;  4KIK A;  3JVZ X;  3PHW B;  3VVW B;  4II3 B;  2L3Z A;  3VTU A;  4HDQ A;  4HVB A;  2A5U A;  2VRR B;  4DHJ B;  1WE6 A; 
#chains in the Genus database with same CATH topology
 1QF6 A;  4IG7 B;  4K7W A;  1JML A;  2WX0 A;  2NTS A;  3MTN B;  1V8C A;  5G5G A;  1WJ4 A;  2LGX A;  2GOW A;  2KLG A;  2ZNV B;  2FCM A;  3VQI A;  1FIQ A;  2N0S B;  5FR6 A;  2AQ2 B;  2FID A;  4HRS A;  3R7R A;  2IJ0 A;  2KWU B;  4JLC A;  1I42 A;  2UU7 A;  3KLS X;  5HFY A;  4NNJ B;  3ONS A;  2W54 A;  3T3O A;  2WXG A;  1YX6 B;  2WXK A;  4FJV B;  5H8Y E;  3VTW A;  2V4L A;  5BMH A;  3RN9 C;  2QMT A;  4A8X C;  4IUM B;  3QCA A;  1I35 A;  3RD2 A;  1I4H A;  1YNT E;  4AWJ A;  4RM8 A;  3NVZ A;  4XDC A;  2PMV A;  1ROE A;  4IOI E;  4N59 A;  3GE3 C;  3Q69 A;  4BOZ B;  2PIA A;  3PO0 A;  3HVZ A;  3NOB A;  5GXG B;  2N9X A;  4GDL B;  1YD8 U;  1STE A;  4K81 A;  4OVZ A;  2HJ1 A;  3ZLZ A;  2MBQ A;  4MGZ E;  2WXL A;  2IO3 B;  4W9K A;  3CSF A;  4BZA A;  4W9D A;  1C1Y B;  1V5O A;  1YN5 A;  3ZUN A;  3HUI A;  3C0R B;  3U7D A;  2N1W A;  3LB8 C;  3J9C A;  3CF6 E;  2PJH A;  5JH5 C;  5BMG A;  2M1M A;  4WQO B;  3NVV A;  3DOW A;  3RNB C;  4M00 A;  4ANX A;  2ZZP B;  5MPO A;  5D2M B;  3AEF B;  3H9D A;  2E3T A;  1M94 A;  3NZS A;  2KDF B;  2L00 B;  4WJP A;  3AED B;  5KHQ A;  4P16 A;  2FE8 A;  5AUI A;  1WWT A;  1KOT A;  2Y3A A;  4IWQ A;  4GDL A;  4ARI A;  3V62 A;  4MSM B;  3ZTC A;  3Q3F A;  1VRA B;  1EF1 A;  3WAL A;  4YL8 A;  2OJR A;  1D3Z A;  3A33 B;  3VRA B;  1R4N B;  2IGG A;  2MA9 B;  1E8W A;  1UWM A;  4NAM A;  1FD6 A;  5CHV C;  3LXF A;  1JAL A;  3HVD A;  4Q2J A;  1JRO A;  5EE9 A;  3T8M A;  4MJS B;  2LRU A;  4IC7 B;  3VDZ A;  5CHF A;  1MVK A;  1GNU A;  2DX5 B;  3QX1 A;  2DLB A;  2WS3 B;  4UDU C;  3RNG C;  4ZRI A;  1PUT A;  2YVC A;  3P4Q B;  1Y8R C;  4ICV A;  3CIR B;  1DOY A;  1LM8 B;  1I7H A;  2FUH B;  1YQ4 B;  5DPS A;  4AUQ C;  5T8I A;  2JRH A;  4K7U A;  2M8S A;  2NMQ A;  3DBH I;  4IM3 A;  1FPY A;  1C79 A;  3AMZ A;  4KGS A;  4DXG A;  1FCL A;  2C5L C;  2K3U A;  1GAQ B;  2QC8 A;  1ZOY B;  1GOZ A;  3X23 A;  1VD2 A;  1HTO A;  2G45 B;  1OQQ A;  4LCD E;  4FJZ A;  1FNW A;  3TIX A;  1PFD A;  4J3O D;  2MWS B;  4YT0 B;  4W9H A;  1T0R C;  5E6P A;  1AN8 A;  1PYW D;  1CMX B;  1S1Q B;  3CST A;  1QQR A;  2K39 A;  1WMH B;  3VUY A;  3DBR B;  3AE1 B;  1GUA B;  1E8Y A;  2LXA A;  3AXC A;  4ZRK A;  2J53 A;  2LMC A;  2IZV B;  2YEP B;  4F7Z A;  2IDY A;  2G9H D;  3PSE B;  2OOB B;  3GOE A;  2NCN A;  1TS4 A;  4LK0 M;  4K7S A;  3PLU A;  3Q14 C;  3PTF C;  3W5U B;  3ZW3 A;  3WAO A;  4TMA B;  4GSW A;  3V61 A;  1TTN A;  4C7Y A;  4HCP B;  2AQ1 B;  3HRD D;  4LNO A;  3DBS A;  3FIL A;  5BO4 B;  4A9A A;  3GS2 A;  1ZGU B;  4DHJ D;  1HTQ A;  2KFK B;  4DK5 A;  3APC A;  2QJL A;  1ZKH A;  1F52 A;  3D32 A;  4II2 B;  3O13 A;  4HKZ E;  3R2I A;  3IT4 B;  2LHE A;  1NVI D;  1SE9 A;  2GBR A;  4W9G A;  1J7A A;  3MFG A;  2IY1 B;  2W82 A;  3DHG C;  3SU8 X;  4FHJ A;  2M0X A;  3APD A;  3P2B A;  1V81 A;  4EZK A;  1NEN B;  1WZ0 A;  2AQ3 B;  2AEH A;  2N1V A;  3SDL C;  3NG0 A;  4E71 A;  3S2A A;  1D6E C;  1WXQ A;  1XLN A;  3U4E G;  4DDG D;  1XT9 B;  1UBQ A;  4TUU A;  2JXT A;  4FJY A;  5E6J A;  2ZVO A;  1LXD A;  5C23 A;  3WAN A;  1PQS A;  4P6V F;  1TIF A;  3AE6 B;  4BOS C;  2BW2 A;  3RUL A;  1V6E A;  4DXA B;  1TBE A;  4WWP A;  2INN E;  4RGO S;  1V86 A;  2PW9 A;  4O1N A;  4ZHP A;  1QOB A;  3LJ3 A;  1WSP A;  2VH2 A;  1XQQ A;  3SD5 A;  2MQJ A;  2HD5 B;  3AM9 A;  4GOC A;  2X8X X;  3RT3 B;  4YXD B;  5HHD G;  2N7J A;  3BZD B;  3A4S C;  2IYD B;  1UWX A;  2N4F A;  3P4R B;  3ML8 A;  3O65 B;  1L0V B;  4DWF A;  3U30 A;  2KKC A;  2AL3 A;  3BYY B;  4OW0 A;  3NVY A;  2ZCC A;  2LZ6 A;  3KWV A;  1R4N I;  1J19 A;  2LHD A;  1QLB B;  4C56 C;  3B1L X;  1EWC A;  1VDV A;  3AV8 A;  1AAR A;  3KUZ A;  1CJE A;  4B9K A;  2IND C;  4PS7 A;  5AZH A;  2QSD A;  3MHZ A;  1XLP A;  2LGI A;  2XNA C;  4HDO A;  1L2N A;  2Z59 B;  2OJW A;  2UWQ A;  4M8N A;  3TMP B;  2KN5 A;  3P63 A;  5KHO A;  3V05 A;  1BXT A;  1WYG A;  5LXH A;  4BVU C;  4A55 A;  3P4S B;  3KVF B;  2W3R A;  1JQ4 A;  2ACZ B;  4HJK A;  3TEY A;  2WXF A;  2I1J A;  3RNC C;  2K1F A;  1N63 A;  2LD9 A;  1L4D B;  1FMA D;  5LLI A;  1V49 A;  1FM0 D;  1FXI A;  4REZ A;  4II3 B;  2CJN A;  1EU4 A;  5BYQ A;  4C7Z A;  4NZL B;  4E74 A;  1TKE A;  2KWD A;  1ZPS A;  1ZXH A;  3W1S C;  1SB3 C;  1RYJ A;  3NUH B;  2I2Y A;  3V3X A;  4DHZ E;  3NS1 A;  3RZW C;  3DCG A;  3IAM 1;  2C9W B;  1YJI A;  4KSK C;  3KQ4 A;  3OJ4 B;  4LNK A;  4XC2 A;  4WJQ A;  1T6B X;  5HG2 A;  3PZ7 A;  3AU4 A;  1SXT A;  3AE4 B;  4RGM A;  3DBR I;  1C9F A;  4IWO A;  2I1K A;  2DEN B;  2J0M A;  3ZDM C;  1TY0 A;  3QC8 B;  3EEC A;  1FO4 A;  2IY0 B;  1SE4 A;  1L0X B;  2QHO A;  2WXO A;  1GB1 A;  1PGA A;  3N1Y C;  4TQ0 A;  3ZDT A;  1FRD A;  3KWL A;  2C7N B;  3UQA A;  4ZRQ A;  1NI2 A;  1TY2 A;  2BYE A;  3TJP A;  3BII D;  3TEX A;  3L17 A;  2DYB A;  3N32 A;  4HPM B;  2MBH A;  4NY0 A;  2KNB A;  1FFU A;  4XZ4 A;  5D3D A;  2CHW A;  2KWC A;  2BYF A;  4QAY A;  4XX5 A;  4BFR A;  1HE8 A;  1ACC A;  2WLB A;  1NYQ A;  2JZP A;  5JZE B;  1XF5 L;  1K51 A;  3AUL A;  4YTP B;  1WJ6 A;  4NAW B;  4IW0 A;  3E56 A;  2JQR B;  2FIF A;  3Q3N C;  2KJR A;  1P0R A;  3R2T A;  1WXS A;  1D5X C;  5DPT A;  1HA5 A;  1OTR B;  2Y5C A;  2L8J A;  1ZDX A;  3HK0 A;  3M3J A;  3ETR A;  4MEM A;  2CJO A;  4US9 A;  2CHZ A;  1P98 A;  1V1O A;  1KF6 B;  2DAJ A;  2KTR B;  1VR9 A;  3TCA A;  5J18 A;  2OHF A;  1ZW7 A;  5HKH A;  1OFF A;  3EHV A;  3PVL A;  4GB9 A;  3ZKJ C;  4LNN A;  2BBC A;  3WA0 A;  2KLC A;  1EU3 A;  2V3P A;  2L7R A;  1TJE A;  3FKY A;  4NAW A;  3BYT B;  2KAJ A;  1T0Q C;  1YX5 B;  5L95 C;  3QJZ A;  4MH8 A;  4WIP A;  4FBJ B;  4WUR A;  1UF0 A;  4I6L B;  1KLU D;  3H8H A;  3VH4 B;  1KLV A;  3MC9 A;  2LI5 A;  2G1E A;  1M4V A;  3KUD B;  2KTR A;  4YSX B;  4B6W A;  2MLB A;  3DPD A;  5IA7 A;  1FNV A;  3CWI A;  3RNE C;  1N61 A;  4EFO A;  1C3T A;  4JPS A;  3P42 A;  4RM9 A;  2ZW0 A;  2LUE A;  1N5X A;  4ZDV A;  5DPR A;  2CHX A;  3JYU A;  3IG3 A;  1UD7 A;  5AUK A;  3AEC B;  1JCK B;  3IT6 B;  4FA6 A;  3KH0 A;  4WWM A;  4W9L A;  5IN7 A;  4NQL B;  2BVC A;  2Z0D B;  4OZC A;  3RFZ B;  3H1U A;  3GE8 C;  1G6J A;  1C4C A;  4EZL A;  2N9E B;  2BKR B;  1U4A A;  2R2O A;  2Y5B B;  4G3X B;  3PS6 A;  3EC8 A;  4LJP B;  1TZO A;  5AEK B;  1JWA D;  4WJO A;  2R2Q A;  1YJ1 A;  3BWU D;  4HPP A;  3QQ8 B;  2LGD A;  2DYO A;  2D07 B;  2L83 A;  4HXD A;  2K8H A;  4K1R B;  2RSU A;  2WXP A;  2J42 A;  1D5Z C;  3PRE A;  3NHE B;  2EKI A;  3DDC B;  4KKI A;  3AE2 B;  3N1X C;  1NI3 A;  4USA A;  4EOY A;  1WI0 A;  2W55 A;  2BS3 B;  1QKZ A;  2LRW A;  3NVW A;  1HZ6 A;  1K53 A;  4RGN A;  5IP4 D;  3ZIM A;  3OAW A;  1F1H A;  2MCN B;  3HHM A;  5TR5 A;  2INP E;  1Z2M A;  3EA6 A;  5HI1 A;  4TKN A;  2ASQ A;  2KX0 A;  2QIL A;  3I5J C;  2KHW B;  3UIO B;  1RFK A;  2JWU A;  3NS8 A;  1JWS D;  3W9C B;  2JYE A;  1TT5 B;  4PK1 A;  2ONQ A;  2FNJ B;  3UGB B;  2BYT A;  2BT6 A;  1PGX A;  1F2R I;  1WR1 A;  4HK2 A;  5IKC M;  2GBK A;  3GP7 A;  5D7G A;  5EE1 A;  3MJ5 A;  1GC6 A;  2WNM A;  3TEZ A;  1C76 A;  2JYT A;  2PKO A;  4FXC A;  2BWE S;  1HQR D;  4PS8 A;  1H8C A;  1C4P A;  3I9V 1;  4KSL C;  4KZ0 A;  1XD3 B;  1ET6 A;  1SJE D;  4EZJ A;  5E6N A;  2KDB A;  3QK0 A;  2LVO A;  1E10 A;  1UZX B;  1XCQ L;  2ZNV C;  3B0A A;  4PYZ A;  3RI7 C;  4LDT B;  1EM7 A;  1VZ7 A;  3FAH A;  5C1Z A;  3N20 C;  3HM3 A;  3IBE A;  3Q8B A;  2DZJ A;  2MH7 A;  1UEL A;  3W2D A;  3A1Q B;  2LJI A;  4RFB A;  1UBI A;  2GBM A;  1FCC C;  1I4G A;  1KTK A;  1QOF A;  4B0M A;  1SBB B;  2D3G A;  2CR5 A;  1I4R A;  2J52 A;  1NYR A;  2ICI A;  2ZPN A;  3B2F A;  3DWM A;  2RPV A;  3Q3M C;  2ZCB A;  2JF5 A;  4MDK E;  3VR8 B;  1OEY J;  2LWP A;  2W3S A;  4MGY E;  3NRZ A;  3RNA C;  2HTM E;  1SIF A;  2BPS A;  1K50 A;  1YIW A;  3FIL B;  4WJN A;  1MHH E;  3ZNZ B;  1E8X A;  5TSS A;  4LJO B;  3UQB A;  2MSE D;  1NBF C;  2WXM A;  3ZXV A;  4EE2 A;  1L7Y A;  3L16 A;  1PGB A;  2EMS A;  1VJK A;  2JUO A;  5CX3 A;  1SEB D;  3L10 B;  1R7S A;  3I57 A;  3N1Z C;  4FN2 A;  5EE3 A;  2KDM A;  5G55 A;  4D2K A;  3A1Q A;  3ECI A;  4ANW A;  3ZNG C;  3ZGZ A;  2RDH A;  1WGK A;  2EEL A;  1L4Z B;  2V3N A;  3LDZ E;  3QWZ B;  1GPX A;  2B3A A;  2JY6 A;  2WGS A;  3DWG C;  1FXA A;  1WXA A;  5IAA C;  1WR6 E;  4HKQ A;  2BWF A;  2L0F A;  4AOF A;  1WX7 A;  4B95 A;  1J7C A;  2J4X A;  1TYG B;  2Q5W D;  2KO3 A;  3DHH C;  2M0A A;  4GDK A;  3AB5 A;  5FKA C;  3BVM A;  4R3D A;  4X57 B;  4MT5 A;  4MH0 E;  5DCN A;  1V5T A;  1AWD A;  1X1M A;  4AJY B;  5E6O A;  5JHB A;  2MP2 B;  3BK2 A;  2RMM A;  1FXT B;  4S0R A;  3A9J B;  1XO3 A;  3JVZ X;  4ZOH C;  5EE0 A;  2KQ4 X;  4BAX A;  2KVZ A;  3Q2A C;  4K3C A;  1JW9 D;  4W9F A;  2DWQ A;  1UNS A;  5CHW A;  2K8C A;  3EUB 2;  4C4V B;  1XCT L;  2RDB C;  1S3S G;  1QIL A;  4DXF A;  2KJ6 A;  2SAK A;  1B1Z A;  5H92 C;  3AEA B;  4ZYN A;  4MGK E;  2GBJ A;  3N3K B;  1SSN A;  1IUE A;  3P1M A;  2IO1 B;  4IM2 A;  4M8M A;  3DVG X;  2KAN A;  2MP2 A;  2XN9 C;  1MG4 A;  4I6N B;  3IAS 1;  2IO0 B;  1E90 A;  3A9J A;  3VUX A;  2KWV B;  3VR9 B;  3W5V B;  4OZA A;  2KMM A;  1V80 A;  2MX2 A;  1CK1 A;  4L2Y A;  2LGY A;  1IBX B;  3VFK A;  1VZ8 A;  4JIO U;  2PVG C;  4HWI B;  4RNA A;  3W1S A;  4C4V A;  3OLM D;  1QZE A;  1BT0 A;  4LLG M;  1RLF A;  3K9O B;  2KT7 A;  3ZXR A;  2MJE A;  2N7E A;  4YWG G;  4G11 A;  4HPL B;  2JSV X;  2L0T A;  3ZNH B;  2ZEQ A;  3AEB B;  4PT5 A;  2RD0 A;  4A6Q A;  2AWT A;  4BKG A;  1H4R A;  3OWE B;  3Q6B A;  4GLS C;  3SHQ A;  4IKG A;  4GGQ A;  1N5W A;  3VH3 B;  4AQ7 A;  1GB4 A;  1I4P A;  1IBX A;  4S17 A;  2XK5 A;  4F8C B;  2D2Q A;  1YQ3 B;  3BVG A;  2ZW1 A;  2MJ3 A;  2PE9 A;  2L1A A;  3RPF C;  1HZ5 A;  3R8B A;  1WM3 A;  1FNU A;  2DNF A;  2LVP A;  1Q0W B;  4A20 A;  4BKS A;  2JZZ A;  4WWO A;  2BTE A;  2NPT B;  2LJ5 A;  4AJW A;  3B08 A;  4W9E A;  5AZF A;  2QIE B;  2IPK D;  1P7E A;  1WX8 A;  2KX3 A;  3GZN B;  2KTF A;  4EEW A;  1P9D U;  4CHK A;  2EKE C;  1IGC A;  3N9Y C;  1V9J A;  3MC0 B;  4LDT D;  2WDV B;  4A3O A;  1Z5S B;  3UF8 A;  4RH6 A;  3WIM A;  2CS4 A;  4XDD A;  3TSS A;  2GLS A;  1F9J A;  4LNI A;  1EF5 A;  4ITK A;  3L13 A;  3H7S A;  2NPT A;  4YTM B;  1NDD A;  2H89 B;  1UUP A;  4C80 A;  1HXY D;  2OED A;  3NJT A;  4ZHO A;  1PDX A;  2DZM A;  1MHX A;  3SR6 A;  1I4Q A;  2LGS A;  3BIN A;  4DDI D;  1FRR A;  1OQY A;  4OVU A;  3L08 A;  1YOV B;  1Q1O A;  2BF8 B;  2Y5P A;  4GXB A;  1JRU A;  4RMA A;  1E7V A;  4LTU A;  1V97 A;  4A90 A;  3ZO5 B;  2G3Q B;  4L23 A;  2WXH A;  2O6V B;  1L6U A;  4HRO A;  1T3Q A;  1UGJ A;  5FK9 C;  3ZJU A;  2KAC A;  3Q8F A;  4EUT A;  2KC1 A;  2K25 A;  1J0G A;  2BKF A;  4MSQ B;  1TS5 A;  1ZXI A;  1UGM A;  2M19 A;  5G5H A;  5J17 A;  2XBB C;  1Q10 A;  3V60 A;  1YJJ A;  3T3N A;  1C78 A;  1E8Z A;  2ZJD A;  2HTH A;  1SF0 A;  5EDS A;  1KRH A;  1C77 A;  4ARC A;  2IO2 B;  4N9F 4;  3IFW B;  3OJ3 A;  2RPQ A;  1CQV A;  3AE5 B;  3V6E B;  1E5W A;  2PEA A;  3U7Z A;  2YEP F;  1JWM D;  2FCN A;  2LAS A;  4MM3 A;  2O6V A;  1SJH D;  3TEW A;  3DBH B;  4PYU A;  3RYT A;  4JX1 C;  1E7P B;  2MRP A;  4BKT A;  2L76 A;  2KC2 A;  1AW7 A;  4NJC A;  3RCZ A;  1CZP A;  1A70 A;  1V1P A;  2JRI B;  3OG5 A;  4JQW C;  1WIA A;  1KJT A;  2WDR B;  3QA8 A;  5L83 A;  1I4X A;  2O2V B;  1B9R A;  2GB1 A;  3AEE B;  5C2T B;  1WJN A;  4P7I A;  3MJW A;  1MFW A;  2BS2 B;  5D94 A;  2KK8 A;  3L54 A;  4H2A A;  2SEB D;  2GRI A;  4TQ1 A;  4G50 A;  2FBW B;  3LYY A;  5BMI A;  4GU2 A;  2QDF A;  1XEE A;  3M62 B;  1SGH A;  1TGZ B;  1WE7 A;  5IOI A;  4ICU A;  3M63 B;  2JU6 X;  3AI5 A;  5J2R A;  3KYC D;  2Z0E B;  4NJ6 A;  1R4M B;  1WGD A;  2KQ7 A;  3AH7 A;  2NTT A;  3PHX B;  3VHT C;  1LQB A;  4FAD A;  4W9C A;  1BUI C;  3BY4 B;  2KFJ A;  2VH1 A;  5D6J B;  2KDE B;  3PGE A;  2O2V A;  4BKS D;  2FCQ A;  1F2R C;  5DPW A;  4RCO A;  3NZ3 A;  1DOX A;  4GMV A;  5JXV A;  1JWU D;  3Q3J A;  2KOX A;  3K9P B;  1MJD A;  3GB1 A;  2PLP A;  2WYQ A;  1ZE3 D;  4US8 A;  3GZN I;  3TBL D;  3W1Y A;  1WGH A;  4IWP A;  4N58 A;  4E3C A;  1RAX A;  2K0P A;  1JRP A;  2D3A A;  1XXG A;  1WJU A;  2KZR A;  3ALB A;  3AE9 B;  2D5G A;  3IXS A;  1OEY A;  3BK1 A;  4K3B A;  2DBY A;  4WH4 A;  4RF1 A;  1ET9 A;  5I4D A;  2WXQ A;  3PLV A;  2JXX A;  1FEH A;  3PV1 A;  2KVR A;  1WRD B;  1WGR A;  4JWU C;  1UH6 A;  1WY8 A;  2NR2 A;  2WXN A;  2ON8 A;  5LXI B;  2IBI B;  2QEJ C;  2UYZ B;  2J0K A;  3KYD D;  1JWB D;  4DHZ B;  4NJ7 A;  2LUM A;  4BBN F;  3PRM B;  2C7M B;  1ZUD 2;  2YLM A;  3KUC B;  1N62 A;  2KJH B;  3SFE B;  1TKY A;  1FFV A;  1RWS A;  1YMH E;  2WXJ A;  2L3Z A;  3VTU A;  2N9K A;  4HDQ A;  1MI0 A;  5LNK 1;  2A5U A;  3ZQ4 A;  2MJD A;  4KDI C;  1WE6 A;  3EFU A;  1GJZ A;  1DOI A;  3MC8 A;  2NBW B;  1LFD A;  1N6Z A;  3IVF A;  3UI3 A;  1P7F A;  2GBN A;  2WDQ B;  2JX5 A;  2GMI C;  4F1S A;  5AZG A;  2NBU A;  1RFA A;  2I38 A;  3JSV B;  4RF0 A;  1E9M A;  2D3B A;  1P1A A;  2K6D B;  4AP4 C;  3Q8C A;  2BB5 A;  1YQB A;  4JL9 A;  4M0W B;  3DQV A;  4YSZ B;  1WGG A;  1BML C;  3NZU A;  1F77 A;  4KGR A;  4B0E A;  3DBL B;  1D5M C;  2G4S A;  2W9N A;  4ZYS A;  2DYM A;  2VZK D;  3C19 A;  3VUW A;  2O6V D;  1ZDV A;  2V3S A;  4AS1 A;  2BGF A;  2BB6 A;  1J7B A;  4GDK B;  1XLQ A;  3HM6 X;  2TSS A;  3ZJV A;  4M01 A;  2BYV E;  4GN1 A;  2NS5 A;  3WCQ A;  1IP9 A;  1SIJ A;  1QOG A;  2MBB B;  4MJS A;  1E6E B;  2RGF A;  3RMK C;  1KH0 A;  4N6E B;  3R7Q A;  1VLB A;  3B2G A;  2WP9 B;  3JSV A;  3RZF A;  1OGW A;  1YN4 A;  4M0W A;  4OZB A;  3EFC A;  2WU5 B;  2BS4 B;  2WDT B;  4URK A;  2KQS A;  3A9K B;  4GIV A;  1E7U A;  1L6V A;  1LO5 D;  5GMV A;  4CYE A;  4ZRJ A;  4MAC A;  1F0Z A;  3L4P A;  2N7D A;  2AL6 A;  4TSS A;  1WZ3 A;  2X38 A;  4ACF A;  1R4M I;  2KMC A;  4CO7 A;  1Q5W B;  2E6X A;  3SEB A;  1QOA A;  1K52 A;  1N60 A;  3Q3O C;  3RUI B;  1WX9 A;  2G4D B;  1J8C A;  2WXR A;  1KFY B;  1IGD A;  2LVQ A;  2REX A;  3A9K A;  2K6Q A;  3B9J A;  3H7P B;  4J6I A;  4FUL A;  2DZI A;  4OVV A;  3PPA A;  2NBV B;  2KMA A;  1WMH A;  2QCZ A;  2J0J A;  2MBO A;  1SE2 A;  3ZTD A;  2Z8L A;  1ZP0 B;  1P3Q U;  3MP9 A;  4FLH A;  2J7Q B;  5BYS A;  3P4P B;  5BYR A;  2DHZ A;  3FC4 A;  4KX6 B;  2WU2 B;  1DYQ A;  2JZ3 B;  1T0Y A;  1WH3 A;  3V6C B;  2XK5 B;  2K9X A;  3VTV A;  2L32 A;  1XLO A;  5FR3 A;  2KFK A;  4XWW A;  3C8Y A;  2GI9 A;  3H7P A;  3JW0 X;  1EO6 A;  1QT9 A;  2PE6 B;  1L0Y B;  1D4B A;  2JWZ A;  2MBE A;  2M4N A;  3URY A;  2H88 B;  3QHT A;  3AEG B;  2KYW A;  3APF A;  4XYC A;  4KV2 A;  1ESF A;  2ZVN A;  3UIP B;  3VXW A;  2AX5 A;  2HE7 A;  3ZRF A;  1T5X D;  3DHI C;  2JT4 B;  1Y56 A;  1WYW B;  3X0W A;  1LGR A;  3Q8E A;  4KKJ A;  5CTR C;  4L1B A;  4I6P A;  3QAR A;  3I3T B;  4FHK A;  3R66 C;  3AE8 B;  4ZRP A;  1EWY C;  2MW5 A;  4W9J A;  1ISN A;  1WGY A;  1WF9 A;  3ML9 A;  3PZD A;  1T0S C;  1IPG A;  3I63 C;  2RDG A;  2DAF A;  2CU1 A;  4ANU A;  3M95 A;  3PRP B;  3CMM B;  4WWN A;  3TUO A;  5JHA A;  2FCS A;  4RGT A;  2LXC A;  4M02 A;  2FAZ A;  3ZYY X;  1C4A A;  3L0W B;  4OHJ A;  5G2N A;  2K8B A;  4DBG A;  3A4R A;  4NQK E;  2AYO B;  2MHJ A;  1ENF A;  1WFY A;  3DBL I;  3DVN U;  2A4Z A;  2WQY B;  1AYF A;  3AE7 B;  1DGJ A;  2WHI A;  2V0G A;  1VCB A;  1L5P A;  4HCN B;  1MPE A;  3BVZ A;  4IM0 A;  2PTL A;  2WX1 A;  2PPH A;  2K22 A;  3Q8A A;  3DVN V;  2JPH A;  4WAF A;  4YTN B;  1V2Y A;  3KW5 B;  1E0Z A;  1OQR A;  3AN1 A;  2N9P C;  1KM7 A;  4P1C C;  1SE3 A;  2PVO D;  5IO9 A;  3ZRC A;  2M17 A;  2EMT A;  3AU5 A;  4YSY B;  1HEZ E;  2LEK A;  4KDL B;  3TL5 A;  2V9H A;  3MHS D;  4NPN A;  1TS3 A;  3WAP A;  2MEK A;  4C00 A;  1EUV B;  1TS2 A;  3RNF C;  4HJG E;  4PS3 A;  2L52 A;  2RR9 A;  4MGI E;  4WQM A;  1GC7 A;  2DZK A;  3WAM A;  2XEW A;  2KXJ A;  4G0N B;  2B76 B;  2INC C;  2D11 A;  1VZ6 A;  4EKU A;  2BQQ A;  2WWZ A;  3HIZ A;  4W9I A;  3H6N A;  4P1B C;  1NEK B;  5C3J B;  1IYF A;  2VZK B;  4MM3 B;  3R3M A;  1TZ1 A;  3ZNI D;  4ANV A;  4LNF A;  2LFI A;  1K8R B;  2C7H A;  3T9L A;  4MEL A;  4DQO C;  2HDE A;  4ASW C;  3ZJT A;  1TKG A;  4WAA A;  3SFD B;  3IHP C;  4A3P A;  3EGR A;  1V1P B;  4JE3 B;  3E9S A;  1MG8 A;  4KVG B;  2JVC A;  3ABV B;  1RRB A;  3UIN B;  1RM6 C;  1WRI A;  1WM2 A;  3U52 E;  4KIK B;  2KD0 A;  2IGH A;  3PT2 B;  2KDI A;  3AE3 B;  1WXV A;  2CKH B;  2WXI A;  4TV3 A;  4XWT A;  2V4I B;  3U2S C;  3ZVV A;  2HJ8 A;  3QIJ A;  2M56 B;  2C60 A;  2NVU I;  4XE0 A;  4BBN C;  1WXM A;  4CQN A;  4XGA B;  2FUG 1;  4JWS C;  1KLG D;  2K5P A;  1YN3 A;  3QAQ A;  2L05 A;  3DVG Y;  4JGH B;  2ZPY A;  3PRZ A;  3PZ8 A;  3ENE A;  4IDI A;  3U8Z A;  2N9L A;  2D10 A;  1A5R A;  4KZC A;  3VAW A;  1GG3 A;  4HLE A;  2V1Y A;  2CU3 A;  3NY5 A;  3N30 A;  4KIK A;  4KGT A;  3PHW B;  3VVW B;  4HEA 1;  2D3C A;  2R61 A;  2IGD A;  4HVB A;  2KN4 A;  5D3I B;  3VRB B;  2VRR B;  4DHJ B; 
#chains in the Genus database with same CATH homology
 4E74 A;  4W9F A;  4IG7 B;  3EFU A;  4K7W A;  1GJZ A;  2WX0 A;  3W1S C;  5CHW A;  2K8C A;  2NBW B;  3MTN B;  1WJ4 A;  2LGX A;  2GOW A;  2KLG A;  4DHZ E;  1S3S G;  3RZW C;  2ZNV B;  3DCG A;  2C9W B;  4KSK C;  4XC2 A;  3OJ4 B;  2FCM A;  1LFD A;  3IVF A;  4WJQ A;  3VQI A;  5FR6 A;  2KJ6 A;  2FID A;  3AU4 A;  2GBN A;  4ZYN A;  4MGK E;  2GBJ A;  3N3K B;  3R7R A;  2GMI C;  2KWU B;  3DBR I;  4IWO A;  2I1K A;  2DEN B;  4JLC A;  2IO1 B;  2J0M A;  4F1S A;  1I42 A;  5AZG A;  4IM2 A;  3ZDM C;  2NBU A;  1RFA A;  3JSV B;  4M8M A;  1P1A A;  2K6D B;  4AP4 C;  3DVG X;  2KAN A;  2MP2 A;  3QC8 B;  3EEC A;  4I6N B;  1YQB A;  2IY0 B;  4JL9 A;  4M0W B;  4NNJ B;  3DQV A;  3ONS A;  2IO0 B;  1E90 A;  3A9J A;  1WGG A;  3VUX A;  2KWV B;  4KDI C;  3NZU A;  2QHO A;  1YX6 B;  4FJV B;  1V80 A;  2G4S A;  2MX2 A;  2W9N A;  3VTW A;  2LGY A;  2V4L A;  4TQ0 A;  2DYM A;  3ZDT A;  3VFK A;  3VUW A;  2O6V D;  4JIO U;  2C7N B;  3UQA A;  2V3S A;  4IUM B;  2BGF A;  1NI2 A;  3QCA A;  4GDK B;  2BYE A;  4HWI B;  3TJP A;  3RD2 A;  3W1S A;  1I35 A;  3HM6 X;  4AWJ A;  3OLM D;  4RM8 A;  3L17 A;  2BYV E;  2DYB A;  3N32 A;  4HPM B;  1QZE A;  1BT0 A;  4GN1 A;  2NS5 A;  2MBH A;  4NY0 A;  2KNB A;  1IP9 A;  4XZ4 A;  1RLF A;  2CHW A;  2MBB B;  4MJS A;  3K9O B;  2RGF A;  2KWC A;  2N7E A;  2BYF A;  4G11 A;  4XX5 A;  4HPL B;  4BFR A;  1HE8 A;  3R7Q A;  4BOZ B;  5JZE B;  2L0T A;  3ZNH B;  3AUL A;  3JSV A;  1WJ6 A;  4NAW B;  3RZF A;  2ZEQ A;  1OGW A;  2RD0 A;  4IW0 A;  3NOB A;  2AWT A;  2N9X A;  4GDL B;  1H4R A;  1YD8 U;  4BKG A;  4K81 A;  2FIF A;  3ZLZ A;  2MBQ A;  2KJR A;  1P0R A;  4MGZ E;  3SHQ A;  2WDT B;  4GGQ A;  2IO3 B;  1WXS A;  2KQS A;  4W9K A;  5DPT A;  3CSF A;  3VH3 B;  4URK A;  3A9K B;  4GIV A;  1OTR B;  4W9D A;  1C1Y B;  1E7U A;  1V5O A;  3ZUN A;  3U7D A;  3C0R B;  2L8J A;  5GMV A;  2N1W A;  3HK0 A;  2XK5 A;  4CYE A;  4F8C B;  2D2Q A;  3M3J A;  4MEM A;  4ZRJ A;  2CHZ A;  1P98 A;  2DAJ A;  2KTR B;  3CF6 E;  2PE9 A;  2PJH A;  3TCA A;  2N7D A;  5JH5 C;  5J18 A;  2AL6 A;  2M1M A;  4WQO B;  1WZ3 A;  3DOW A;  4ANX A;  1WM3 A;  1ZW7 A;  2LVP A;  1Q0W B;  2ZZP B;  4A20 A;  5HKH A;  3EHV A;  5D2M B;  4BKS A;  1R4M I;  2KMC A;  4CO7 A;  2JZZ A;  3PVL A;  4GB9 A;  4WWO A;  3ZKJ C;  3H9D A;  1Q5W B;  1M94 A;  3NZS A;  2KDF B;  2L00 B;  4WJP A;  2NPT B;  5KHQ A;  3WA0 A;  2KLC A;  2LJ5 A;  3RUI B;  4AJW A;  1KOT A;  1WX9 A;  2G4D B;  2L7R A;  3B08 A;  1J8C A;  4W9E A;  4NAW A;  5AZF A;  1YX5 B;  5L95 C;  3QJZ A;  4IWQ A;  4GDL A;  3V62 A;  4FBJ B;  4MSM B;  3ZTC A;  1WX8 A;  2KX3 A;  3Q3F A;  4I6L B;  1EF1 A;  2LVQ A;  3WAL A;  2REX A;  2OJR A;  4YL8 A;  2KTF A;  3VH4 B;  4EEW A;  1D3Z A;  3A33 B;  3A9K A;  1P9D U;  1KLV A;  2K6Q A;  3H7P B;  2LI5 A;  4J6I A;  4FUL A;  4CHK A;  2EKE C;  2DZI A;  2MA9 B;  4OVV A;  3PPA A;  1E8W A;  2NBV B;  2KMA A;  1V9J A;  1WMH A;  5CHV C;  4LDT D;  3KUD B;  2KTR A;  4A3O A;  4B6W A;  3T8M A;  2J0J A;  1Z5S B;  3UF8 A;  2MLB A;  4MJS B;  2LRU A;  4IC7 B;  3DPD A;  5IA7 A;  3VDZ A;  5CHF A;  2MBO A;  3ZTD A;  4EFO A;  1GNU A;  1C3T A;  2DX5 B;  3WIM A;  2CS4 A;  3QX1 A;  4RM9 A;  1F9J A;  1P3Q U;  2LUE A;  4ZDV A;  1EF5 A;  4FLH A;  5DPR A;  2J7Q B;  4ZRI A;  2CHX A;  3H7S A;  2NPT A;  3IG3 A;  1NDD A;  3JYU A;  3L13 A;  2YVC A;  2DHZ A;  1UD7 A;  1Y8R C;  4ICV A;  2JZ3 B;  1LM8 B;  2FUH B;  4FA6 A;  1T0Y A;  1WH3 A;  3KH0 A;  3V6C B;  2DZM A;  4W9L A;  5DPS A;  4AUQ C;  4NQL B;  2XK5 B;  2JRH A;  4K7U A;  3VTV A;  2M8S A;  3BIN A;  3DBH I;  4IM3 A;  2KFK A;  4DDI D;  2Z0D B;  3H1U A;  1OQY A;  3H7P A;  3JW0 X;  1EO6 A;  4OVU A;  2PE6 B;  1G6J A;  2JWZ A;  3L08 A;  2MBE A;  2M4N A;  4EZL A;  2N9E B;  1Q1O A;  2BKR B;  2BF8 B;  3QHT A;  4GXB A;  1U4A A;  2C5L C;  2R2O A;  2Y5B B;  3APF A;  1JRU A;  4KV2 A;  4G3X B;  3PS6 A;  4RMA A;  1E7V A;  3EC8 A;  4LJP B;  2ZVN A;  5AEK B;  3ZO5 B;  2G3Q B;  3UIP B;  4WJO A;  3VXW A;  2O6V B;  2R2Q A;  1YJ1 A;  2HE7 A;  3ZRF A;  2JT4 B;  3X23 A;  1VD2 A;  1WYW B;  3X0W A;  3QQ8 B;  2LGD A;  2G45 B;  3ZW3 A;  4LCD E;  2DYO A;  4FJZ A;  3TIX A;  2D07 B;  4HXD A;  2K8H A;  4K1R B;  2RSU A;  2MWS B;  4EUT A;  2KC1 A;  2K25 A;  3PRE A;  2BKF A;  4MSQ B;  4W9H A;  5CTR C;  4I6P A;  5E6P A;  1J0G A;  3QAR A;  3NHE B;  3DDC B;  1CMX B;  3I3T B;  3R66 C;  4FHK A;  1S1Q B;  1UGM A;  5J17 A;  2XBB C;  3CST A;  4EOY A;  3V60 A;  2MW5 A;  4W9J A;  1ISN A;  1WGY A;  1WF9 A;  1WI0 A;  2K39 A;  1WMH B;  3VUY A;  1GUA B;  1E8Y A;  1E8Z A;  2LXA A;  3AXC A;  3ML9 A;  3PZD A;  1IPG A;  2ZJD A;  4ZRK A;  2HTH A;  2LRW A;  2DAF A;  2IZV B;  5EDS A;  2CU1 A;  4ANU A;  3M95 A;  3PRP B;  4F7Z A;  2IO2 B;  4N9F 4;  3ZIM A;  3CMM B;  3IFW B;  3OAW A;  3PSE B;  3OJ3 A;  4WWN A;  2OOB B;  3GOE A;  2NCN A;  5JHA A;  2FCS A;  2MCN B;  2RPQ A;  3HHM A;  5TR5 A;  1Z2M A;  4K7S A;  2LXC A;  3PLU A;  2FAZ A;  3V6E B;  1E5W A;  2PEA A;  4TKN A;  2ASQ A;  2KX0 A;  3PTF C;  3L0W B;  2FCN A;  2LAS A;  4MM3 A;  5G2N A;  2K8B A;  2O6V A;  4GSW A;  3A4R A;  3WAO A;  2KHW B;  3UIO B;  3V61 A;  1TTN A;  4DBG A;  4NQK E;  3NS8 A;  4HCP B;  2AYO B;  1WFY A;  4PYU A;  3DBL I;  3DVN U;  3RYT A;  2A4Z A;  3DBS A;  2MRP A;  2FNJ B;  5BO4 B;  3UGB B;  4BKT A;  1VCB A;  1ZGU B;  2L76 A;  1WR1 A;  4DHJ D;  4HCN B;  2KC2 A;  2KFK B;  4HK2 A;  4DK5 A;  3APC A;  1ZKH A;  2GBK A;  3D32 A;  4II2 B;  4IM0 A;  3RCZ A;  5D7G A;  2JRI B;  2WX1 A;  1SE9 A;  1GC6 A;  2GBR A;  4JQW C;  2PPH A;  4W9G A;  1WIA A;  1KJT A;  2IY1 B;  3QA8 A;  3SU8 X;  2BWE S;  3DVN V;  4PS8 A;  5L83 A;  2JPH A;  1H8C A;  4FHJ A;  2M0X A;  2O2V B;  4KSL C;  3APD A;  4KZ0 A;  1XD3 B;  3P2B A;  1V81 A;  4EZK A;  1V2Y A;  1WZ0 A;  3KW5 B;  4EZJ A;  1WJN A;  5E6N A;  2KDB A;  2AEH A;  3QK0 A;  2LVO A;  4P7I A;  2N1V A;  1UZX B;  3MJW A;  2N9P C;  3SDL C;  2ZNV C;  1KM7 A;  5D94 A;  3ZRC A;  2KK8 A;  2M17 A;  3B0A A;  3L54 A;  4PYZ A;  4E71 A;  4TQ1 A;  3S2A A;  2EMT A;  4LDT B;  4G50 A;  3AU5 A;  3TL5 A;  4KDL B;  4DDG D;  1XT9 B;  1UBQ A;  3MHS D;  4GU2 A;  4TUU A;  4FJY A;  3M62 B;  4NPN A;  5C1Z A;  3HM3 A;  2ZVO A;  1LXD A;  1SGH A;  1TGZ B;  3WAP A;  5C23 A;  1WE7 A;  1EUV B;  1PQS A;  3WAN A;  4ICU A;  3M63 B;  3IBE A;  3AI5 A;  4PS3 A;  5J2R A;  2DZJ A;  1UEL A;  2Z0E B;  3KYC D;  4BOS C;  3A1Q B;  4NJ6 A;  3RUL A;  2RR9 A;  1V6E A;  4MGI E;  1WGD A;  2KQ7 A;  4DXA B;  1TBE A;  1UBI A;  1GC7 A;  2DZK A;  2GBM A;  4WWP A;  3WAM A;  2XEW A;  2KXJ A;  4G0N B;  3PHX B;  3VHT C;  1LQB A;  1V86 A;  4FAD A;  2D11 A;  4W9C A;  3BY4 B;  2D3G A;  2KFJ A;  2CR5 A;  5D6J B;  4EKU A;  3HIZ A;  2WWZ A;  4W9I A;  2KDE B;  3LJ3 A;  3PGE A;  2ZPN A;  2O2V A;  3H6N A;  4BKS D;  1XQQ A;  3SD5 A;  2FCQ A;  2MQJ A;  2HD5 B;  1IYF A;  5DPW A;  4GOC A;  3R3M A;  1TZ1 A;  4GMV A;  2ZCB A;  2JF5 A;  3RT3 B;  4MDK E;  3ZNI D;  4DWF A;  1OEY J;  2LWP A;  3Q3J A;  3A4S C;  4MGY E;  4ANV A;  2IYD B;  2KOX A;  3K9P B;  2N4F A;  2WYQ A;  1SIF A;  3ML8 A;  1K8R B;  2BPS A;  2C7H A;  3O65 B;  3T9L A;  1YIW A;  4MEL A;  4ASW C;  3GZN I;  2KKC A;  4WJN A;  3TBL D;  3U30 A;  1E8X A;  2AL3 A;  3W1Y A;  3ZNZ B;  4LJO B;  4WAA A;  3UQB A;  2ZCC A;  2LZ6 A;  2MSE D;  3IHP C;  1NBF C;  1R4N I;  1WGH A;  1J19 A;  4IWP A;  1L7Y A;  3L16 A;  4A3P A;  2EMS A;  3B1L X;  4E3C A;  2JUO A;  5CX3 A;  1MG8 A;  1RAX A;  4KVG B;  3L10 B;  2JVC A;  1RRB A;  3UIN B;  1AAR A;  2KZR A;  3KUZ A;  1WJU A;  4FN2 A;  3ALB A;  5G55 A;  1WM2 A;  4B9K A;  5AZH A;  4PS7 A;  3A1Q A;  3ECI A;  4ANW A;  4KIK B;  3ZNG C;  2KD0 A;  1OEY A;  3PT2 B;  2KDI A;  1WXV A;  2CKH B;  3LDZ E;  4TV3 A;  3QWZ B;  2B3A A;  4HDO A;  1L2N A;  2Z59 B;  2JY6 A;  3ZVV A;  2UWQ A;  4M8N A;  3TMP B;  2HJ8 A;  1WXA A;  2KN5 A;  3PLV A;  2JXX A;  3QIJ A;  5IAA C;  3PV1 A;  1WR6 E;  5KHO A;  2C60 A;  2KVR A;  2NVU I;  1WRD B;  1WGR A;  4BBN C;  2BWF A;  2L0F A;  4AOF A;  1UH6 A;  1WX7 A;  4B95 A;  1WXM A;  1WY8 A;  2NR2 A;  5LXH A;  2KO3 A;  4BVU C;  5LXI B;  2IBI B;  4GDK A;  2UYZ B;  3KVF B;  2J0K A;  3KYD D;  3QAQ A;  4DHZ B;  2L05 A;  3DVG Y;  4X57 B;  4NJ7 A;  4JGH B;  4MH0 E;  2ZPY A;  4HJK A;  1V5T A;  5DCN A;  4BBN F;  3PRM B;  1X1M A;  4AJY B;  2C7M B;  2I1J A;  5E6O A;  2K1F A;  3PRZ A;  5JHB A;  2LD9 A;  3ENE A;  2MP2 B;  3U8Z A;  1A5R A;  2D10 A;  2YLM A;  3KUC B;  2KJH B;  1FXT B;  4KZC A;  3VAW A;  1GG3 A;  3A9J B;  5LLI A;  2V1Y A;  1V49 A;  4HLE A;  3NY5 A;  3N30 A;  4KIK A;  3JVZ X;  3PHW B;  3VVW B;  4II3 B;  2L3Z A;  3VTU A;  4HDQ A;  4HVB A;  2A5U A;  2VRR B;  4DHJ B;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...