4RM9A

Crystal structure of human ezrin in space group c2221
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 126
structure length 368
sequence length 586
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm9A01
4AJWA 2GBNA 2JWZA 4W9JA 4ZRIA 1U4AA 2M17A 2ZCCA 4EOYA 5AZFA 3PRPB 3TCAA 2LVQA 2KJHB 2L8JA 2LD9A 3U8ZA 3DDCB 3AU5A 3QC8B 2NVUI 4MGZE 4I6PA 1WF9A 2NBWB 4BKSA 2K8CA 2K8HA 4IM0A 5CTRC 2JT4B 4BKSD 4E74A 4FHJA 4ANWA 4LJPB 1E90A 3PLVA 2IO1B 4W9DA 1SIFA 2HE7A 3M95A 4JL9A 1P3QU 4DHJD 3RULA 1P1AA 4IM2A 1RFAA 4HVBA 1I42A 2XK5A 1E8WA 3EECA 2CR5A 4X57B 3JSVA 1Z5SB 3VFKA 3KUCB 2DYOA 1WI0A 4JIOU 2LRUA 2NPTA 2PE9A 5DPWA 1LM8B 4PS8A 1P9DU 3APFA 5LLIA 4B9KA 3S2AA 2M1MA 1RAXA 3ZUNA 3PHXB 1MG8A 1UH6A 4LDTD 4BOZB 2FCNA 3PRZA 4XC2A 2KFKA 4JGHB 2L00B 2KZRA 2KANA 3NHEB 3K9OB 2M4NA 3B1LX 4NAWA 4ZRJA 2FCSA 2AL6A 3Q3FA 3RYTA 2BYVE 2HTHA 3UGBB 5JH5C 4MSMB 1C3TA 2NBVB 3APCA 2A4ZA 3HM6X 2PE6B 2UWQA 3APDA 5LXIB 3DOWA 2O2VB 1S3SG 4BVUC 2RR9A 5LXHA 2KO3A 3AU4A 3DQVA 4WJPA 2C9WB 5C23A 2KC2A 2LXCA 2N1VA 2B3AA 2RGFA 4W9GA 3EFUA 3B08A 3IG3A 4FJYA 2ZCBA 1RRBA 1WY8A 1YIWA 5J17A 4GOCA 4AP4C 4DBGA 4OVUA 2N9PC 4HWIB 3CSFA 1ZKHA 4F7ZA 2O6VA 3UF8A 3DCGA 2LJ5A 3KW5B 3L13A 3ZKJC 2KX0A 2KQSA 1G6JA 2DHZA 3L10B 4AOFA 1J8CA 4GDLB 3KUZA 4DK5A 2ZZPB 4KDLB 1SGHA 3HM3A 3VDZA 1IP9A 1Q1OA 2FAZA 2IZVB 1OGWA 2L0TA 4PS7A 3ECIA 2A5UA 3KH0A 2KWVB 2ZPNA 4XX5A 1C1YB 4WJOA 4II3B 3H6NA 2D10A 4IWQA 4RM9A 1V86A 5FR6A 1WR6E 4PYUA 1WJ6A 2OOBB 1EO6A 2WX1A 3SU8X 2NS5A 4EZJA 1EUVB 2KQ7A 5D6JB 1WE6A 1VCBA 3NZSA 2DAJA 3IVFA 4DXAB 2BWES 4HPLB 3SHQA 2GBMA 5L95C 2N4FA 1OEYA 2KMAA 2LRWA 2BKRB 2MBBB 3ML8A 1P98A 3PGEA 4MM3A 1H4RA 1KOTA 2V1YA 4F8CB 2J0MA 2BYFA 4IW0A 3TBLD 1J19A 3ENEA 2CHWA 5CX3A 3L08A 1WGGA 1AARA 4YL8A 4KIKA 3RCZA 3T8MA 3A1QB 3EC8A 4P7IA 1WYWB 4XZ4A 5DCNA 4F1SA 3UINB 2MA9B 4KSLC 2ASQA 3ZLZA 3WAPA 4B6WA 2MBEA 3K9PB 2KN5A 2IY0B 4IWOA 3O65B 4NQLB 5CHFA 4ICUA 2C7NB 1GC6A 5C1ZA 4K7WA 4K7UA 3RZFA 2DYMA 2KC1A 4K81A 2EMSA 4ANUA 3A4SC 2G3QB 1UBIA 4GDKA 1WFYA 1WMHA 3A9KA 4NPNA 1BT0A 3C0RB 2BGFA 2FIDA 4IC7B 1UELA 1R4MI 3PHWB 3NY5A 5CHWA 3VTUA 2KX3A 3QX1A 5G2NA 1A5RA 3PT2B 3VTVA 4MJSB 1XD3B 3QHTA 4LCDE 4BFRA 3W1SA 4EZKA 3WAOA 3A4RA 1ISNA 1WGRA 2LXAA 3VAWA 4CHKA 3AXCA 5AZHA 5JHBA 1E8ZA 3W1YA 2G4DB 1WX8A 2KDEB 2MBQA 5HKHA 1Z2MA 5TR5A 4TV3A 2LZ6A 1TTNA 2CU1A 2PEAA 1UBQA 3HK0A 3QCAA 1J0GA 3NOBA 1L7YA 3N30A 3LJ3A 2MW5A 4G11A 4GXBA 2JY6A 4EFOA 3VXWA 3ZTDA 2LVOA 4FJZA 2KKCA 2RSUA 2RD0A 1WX7A 2DZKA 1WIAA 2KTRB 1E8XA 3VQIA 2JZZA 4MEMA 1EF1A 1E5WA 3DVNV 3A9JB 4HXDA 2KMCA 3RT3B 3V6CB 3JVZX 2ZEQA 3DBSA 4MGYE 3WIMA 4MGIE 2K8BA 2K39A 2BYEA 3R3MA 2LUEA 3UIOB 4W9LA 1V80A 3VVWB 2K1FA 4M0WB 1E7UA 3VTWA 4J6IA 4CYEA 3H7SA 1H8CA 2LI5A 1Q0WB 1EF5A 3NS8A 4JLCA 2V4LA 3QARA 4IM3A 2C7HA 2MP2B 1WM2A 1WM3A 2VRRB 4AJYB 2M8SA 3AULA 4NY0A 3ZVVA 2JZ3B 2L0FA 2ZPYA 4FA6A 3OAWA 3I3TB 4MH0E 3SD5A 2M0XA 3R66C 2JXXA 3EHVA 4B95A 2KOXA 2LGYA 2FIFA 4MSQB 3WALA 1WGHA 4WJNA 2PJHA 3WA0A 2NR2A 2AL3A 1R4NI 5J18A 1YQBA 2D2QA 3PTFC 5AZGA 5AEKB 3V6EB 4NQKE 3ZRCA 2K6DB 3VUXA 4KV2A 4EUTA 3GZNI 4BKTA 1E7VA 2R2QA 1VD2A 2Z0DB 4M8MA 4HJKA 4JQWC 2ZJDA 1WRDB 2WWZA 5KHOA 4ANXA 2DZIA 4I6LB 4K7SA 2KWCA 2BF8B 1NBFC 3OJ3A 4A20A 2GMIC 2Z59B 4DDID 2GBKA 3ALBA 2MQJA 3BINA 2IO0B 1OEYJ 1LFDA 2JUOA 1CMXB 1V6EA 2JRHA 2KJRA 2KTFA 3H7PB 1IPGA 1GC7A 2UYZB 3OJ4B 3QA8A 2DAFA 3KUDB 4GSWA 4NNJB 3L17A 4KZ0A 4BBNF 1IYFA 1TBEA 2C5LC 4W9EA 2D07B 2HJ8A 1TZ1A 2KVRA 4FULA 1HE8A 3IBEA 2XBBC 3R7RA 4G50A 3X23A 5EDSA 1X1MA 2OJRA 4WWPA 5L83A 4LJOB 3U7DA 3RUIB 3GOEA 2LGXA 2FNJB 1WXAA 2GOWA 2DYBA 2G4SA 1ZW7A 3VH4B 2MRPA 2K25A 3CMMB 3D32A 3M3JA 2FUHB 2N7EA 2O2VA 2NBUA 2ZNVB 2J0JA 4E3CA 3DBHI 4OVVA 1JRUA 2XK5B 4NJ7A 1D3ZA 3ML9A 4PS3A 2Z0EB 4EZLA 3V60A 2DZJA 2C60A 4IWPA 4ANVA 1SE9A 2NPTB 2ZNVC 3RZWC 3MTNB 1V5OA 2J0KA 2MBOA 4LDTB 2KDIA 3ZRFA 4ICVA 4BOSC 1P0RA 3PLUA 2KFKB 1WJUA 3KYCD 1WGDA 2NCNA 2MSED 1KM7A 4GDLA 4NAWB 1LXDA 1YX5B 4WAAA 3L0WB 2WDTB 1QZEA 4DWFA 2DX5B 3ZDMC 2KWUB 4IUMB 2HD5B 4BKGA 4GN1A 4MDKE 4N9F4 1XQQA 1V49A 4TQ1A 5D94A 4K1RB 3X0WA 4AUQC 2MLBA 2AEHA 3UIPB 1YJ1A 1WZ3A 4GMVA 5CHVC 1LQBA 3ZIMA 2YVCA 5E6OA 3WANA 1V2YA 2CKHB 4MELA 4FHKA 5GMVA 3TIXA 4KZCA 3ZTCA 3TJPA 4G0NB 3QWZB 4WQOB 2EMTA 3U30A 2BKFA 4HPMB 3ZNZB 2LVPA 1UD7A 1K8RB 1UZXB 2IYDB 4I6NB 2GBJA 3PSEB 2PPHA 2O6VB 5G55A 2JF5A 1NDDA 2KXJA 3L54A 2XEWA 5BO4B 3ZNGC 1GJZA 4RMAA 1E8YA 3ZW3A 1T0YA 1GNUA 1XT9B 3V62A 1WR1A 2YLMA 3DVGX 3IFWB 2AWTA 4HLEA 4AWJA 4EEWA 1V5TA 2FCQA 3PS6A 2I1JA 5DPTA 4DHZB 3A1QA 1KJTA 3WAMA 1OQYA 2WX0A 3DBRI 4HK2A 4FN2A 4GGQA 4HCPB 3ZNHB 3IHPC 4DHZE 1WXVA 3QIJA 4W9KA 4GU2A 4II2B 1WJ4A 3DPDA 2KLCA 3PZDA 1OTRB 3VUWA 2CHZA 4HCNB 2LASA 2REXA 3M62B 4A3PA 2BWFA 2N1WA 2LWPA 3VHTC 3HIZA 3HHMA 2K6QA 4HDQA 3QJZA 3ZDTA 1S1QB 3ONSA 2J7QB 5KHQA 2KLGA 4HDOA 2IO2B 2N7DA 2JVCA 4KDIC 1I35A 5DPRA 3V61A 4KVGB 5IAAC 2KJ6A 4MJSA 4TUUA 3VH3B 4ZRKA 3CF6E 4KIKB 3H9DA 2BPSA 3BY4B 1L2NA 3UQBA 1GG3A 1Q5WB 2I1KA 2KK8A 4MGKE 4G3XB 4A3OA 2IBIB 2LGDA 2DENB 2N9XA 2JPHA 2C7MB 2EKEC 1YD8U 2KDFB 3MHSD 2MBHA 2L3ZA 4GDKB 3A9KB 1WMHB 3ZO5B 4WWNA 4FJVB 2O6VD 3N3KB 1KLVA 2KFJA 3OLMD 4NJ6A 2KTRA 3PRMB 1TGZB 3A9JA 1YX6B 2KHWB 1WX9A 3CSTA 3QQ8B 2CS4A 3LDZE 2KNBA 3SDLC 2KD0A 2MWSB 3UQAA 2IY1B 4URKA 4FLHA 2KDBA 3DBLI 5D2MB 3P2BA 4TQ0A 3N32A 5JHAA 1NI2A 1WXSA 2L7RA 4ZYNA 3T9LA 2CHXA 4FBJB 3QAQA 3W1SC 3TL5A 2MP2A 3H1UA 1GUAB 2W9NA 1WXMA 4DHJB 3M63B 4W9IA 3B0AA 2MX2A 4GIVA 3PV1A 4TKNA 3VUYA 4ASWC 2D11A 2QHOA 4RM8A 3ZNID 2DZMA 3JSVB 3RD2A 2D3GA 4PYZA 3TMPB 2GBRA 4W9FA 3KYDD 4WJQA 3DVGY 3A33B 3JYUA 4E71A 2FCMA 3PVLA 4EKUA 5D7GA 1WE7A 1WJNA 4W9CA 4CO7A 4IG7B 1ZGUB 1PQSA 2R2OA 2Y5BB 2ZVNA 3DVNU 3JW0X 3MJWA 3Q3JA 2V3SA 4FADA 2JRIB 2WYQA 5JZEB 5E6NA 2AYOB 3QK0A 1WH3A 1V9JA 3NZUA 1RLFA 1UGMA 2G45B 3PPAA 1M94A 4KSKC 2MCNB 1F9JA 1WGYA 2N9EB 4W9HA 4WWOA 3KVFB 5J2RA 4GB9A 4DDGD 1WZ0A 3R7QA 4M8NA 5IA7A 3H7PA 1Y8RC 2L05A 4BBNC 1FXTB 2IO3B 2RPQA 2ZVOA 3PREA 3L16A 2L76A 5DPSA 5E6PA 3AI5A 1V81A 4ZDVA
chains in the Genus database with same CATH superfamily
2JWZA 1SE3A 3TCAA 2LVQA 2L8JA 3TEYA 3SEBA 2BS2B 4I6PA 1L0VB 1F2RC 2KACA 2K8CA 2K8HA 5CTRC 4LJPB 1E90A 2IO1B 1SIFA 2CU3A 1SE4A 3ZXVA 3RULA 1RFAA 2WXNA 2CR5A 4KGSA 4X57B 3JSVA 3KUCB 2DYOA 1WI0A 5DPWA 2PE9A 3V05A 3S2AA 4BOZB 1UH6A 4LDTD 2FCNA 2WQYB 1T3QA 3NHEB 3K9OB 5BMIA 2AL6A 1QKZA 2M56B 2JSVX 4OZCA 3RNEC 1T5XD 5LXHA 2KO3A 1XCQL 4WJPA 2DWQA 2RGFA 2PVOD 3IG3A 1WY8A 4GOCA 4DBGA 2WXOA 1XLNA 2KYWA 1KF6B 2PW9A 4F7ZA 2QDFA 4L2YA 3UF8A 3DCGA 3W9CB 1L6UA 2KQSA 1G6JA 2RPVA 4GLSC 3Q8AA 1SGHA 3VDZA 4ACFA 1IP9A 3R8BA 3MC8A 4PS7A 3DBRB 2A5UA 4XX5A 1C1YB 3DWMA 2V0GA 3WCQA 2D10A 1IGCA 1TS3A 1EO6A 1T0QC 2KQ7A 5D6JB 3NZSA 4KGRA 1YQ4B 5EE0A 2GBMA 5L95C 3Q2AC 2WU2B 3T3OA 3ML8A 1PFDA 3RNGC 2WXIA 2J0MA 1J19A 1FNVA 5CX3A 1TS4A 1B9RA 1AARA 4ZRPA 4KIKA 1PGAA 3EC8A 4AQ7A 2KN5A 4NQLB 1SSNA 5C1ZA 4K7UA 2N9LA 2DYMA 2X8XX 2EMSA 4ANUA 4PT5A 3ETRA 1BT0A 5HHDG 1UELA 2KX3A 3VTVA 4EZKA 3VAWA 2HJ1A 2V3PA 2KDEB 5HKHA 3W2DA 5D3IB 5TR5A 2YEPF 4AS1A 1OQRA 1ET9A 3N30A 3LJ3A 1D5MC 1XXGA 4EFOA 5G5GA 3ZTDA 1WX7A 5BMGA 1WIAA 4MEMA 4HXDA 3A9JB 1N5WA 2BQQA 2ZEQA 3DBSA 4MGIE 5H8YE 3R3MA 2K39A 2BYEA 4WQMA 2AQ3B 3UIOB 3VVWB 1V80A 3IXSA 4J6IA 1FMAD 3NS8A 1Q0WB 1F0ZA 5IP4D 2C7HA 1WM2A 4JWUC 3AEBB 3AULA 3ZVVA 1YQ3B 4RGOS 4MH0E 3SD5A 4HJGE 1ACCA 3R66C 3EHVA 3AEDB 3DHHC 2LGYA 5H92C 3N20C 1N5XA 3WA0A 2NR2A 3N1ZC 1SJED 1R4NI 3PTFC 4OHJA 5AZGA 3AB5A 4BKTA 4LNKA 2R2QA 4ANXA 3DHIC 1KH0A 4I6LB 2GLSA 3OJ3A 2LHEA 1NVID 3BINA 4S17A 1WYGA 4A9AA 3H7PB 1GC7A 3OJ4B 2SAKA 3KUDB 2PTLA 4BBNF 1IYFA 1TBEA 3BYTB 1HE8A 2GB1A 2OJRA 4WWPA 5L83A 3U7DA 1J7AA 2LGXA 1OQQA 2MRPA 3P4RB 4DXGA 2NBUA 2KDMA 1IBXB 3SR6A 2H88B 2C60A 3MTNB 3GE8C 3Q3MC 4BOSC 1P0RA 4YXDB 2KFKB 2MH7A 2MSED 4DXFA 3DHGC 4GDLA 4NAWB 1YX5B 3L0WB 3BZDB 1QZEA 2HD5B 4N9F4 1V49A 4TQ1A 5D94A 2PIAA 1YJ1A 3ZIMA 3WANA 1V2YA 2CKHB 3HUIA 4KZCA 3ZTCA 1C4CA 1ZOYB 3U30A 3KLSX 2BKFA 4HPMB 2LHDA 3ZNZB 1HTQA 1UZXB 1MPEA 3TEXA 1P7EA 3ZW3A 1XT9B 4USAA 3KQ4A 4HLEA 5BYQA 2I2YA 4DHZB 3WAMA 1OQYA 3DBRI 2WXFA 3AM9A 4FN2A 4GGQA 4HK2A 1D4BA 4YT0B 4C80A 3IHPC 1WXVA 4GU2A 2L52A 1FFVA 3PZ7A 2REXA 3I57A 2BWFA 1DYQA 3HHMA 5TSSA 4HDQA 1GPXA 2EKIA 3BIID 1STEA 2J7QB 1I35A 1ZDXA 1SE2A 4MJSA 4TUUA 2MJ3A 3BY4B 2I1KA 1Q5WB 2AX5A 1QT9A 1MVKA 2JPHA 2EKEC 1YD8U 3E9SA 1BUIC 2L3ZA 1JROA 3W5UB 3A9KB 1WMHB 1ET6A 2D5GA 3N3KB 1TKGA 3OLMD 2J52A 1QOAA 3Q8CA 3CSTA 2KNBA 2IY1B 3B9JA 4URKA 4FLHA 5D2MB 2WNMA 4EE2A 3CWIA 1VZ7A 2L7RA 1UWMA 1SJHD 2MP2A 2INPE 4S0RA 1CJEA 1F77A 4WAFA 4W9IA 1PYWD 2MX2A 4OZBA 1FRRA 4ASWC 2GBRA 5MPOA 4EKUA 5D7GA 3AEGB 4IG7B 3MJWA 3DVNU 2WYQA 5JZEB 1K53A 1HEZE 4N6EB 4K3BA 3ZYYX 2KVZA 5J2RA 4JPSA 2XNAC 2BS3B 4M8NA 1RFKA 1Y8RC 1FXTB 2L76A 2K3UA 3AI5A 2ZCCA 3PRPB 2KJHB 2LD9A 1EWCA 3AU5A 4ARIA 4MGZE 4BKSA 2W55A 4US9A 1C78A 4FHJA 2BW2A 4WH4A 4JL9A 1P3QU 2W82A 3HVDA 1C77A 1P1AA 4HVBA 1CQVA 1E8WA 1I7HA 1LGRA 2PLPA 4JIOU 2NTTA 2IDYA 1P9DU 3APFA 4H2AA 5LLIA 4B9KA 2M1MA 1RAXA 1DOIA 3ZUNA 4ZOHC 1PUTA 1E9MA 2KZRA 2KANA 5JXVA 2J53A 3AEEB 3Q3FA 2BYVE 1C3TA 5EE1A 1YJJA 4MSMB 2NBVB 3RNBC 3APCA 2A4ZA 2JYEA 4KKJA 3APDA 1QLBB 4HKQA 4BVUC 2RR9A 3AU4A 3DQVA 4XDCA 2C9WB 1KTKA 2LXCA 5FR3A 2N9PC 2HTME 4HWIB 3VRBB 1ZKHA 2O6VA 1L0XB 2LJ5A 1HZ5A 3ZKJC 2M19A 3L10B 1J8CA 3KUZA 1NENB 4KDLB 2IZVB 4KKIA 2WDQB 1EU3A 3AEAB 1FNUA 2ZPNA 4WJOA 3FILA 2D3AA 2WHIA 1V1OA 2KT7A 4IWQA 2INNE 5FR6A 1CZPA 4PYUA 1WJ6A 2WX1A 3SU8X 2E6XA 1WE6A 1VCBA 4DXAB 4HPLB 2N4FA 1EWYC 1EU4A 1H4RA 1KOTA 1DGJA 4IW0A 1F52A 2N9KA 4L23A 1V1PA 1RWSA 3L08A 2MEKA 4A6QA 3RCZA 2WXGA 5DCNA 1WYWB 2MA9B 4B6WA 2ASQA 3WAPA 1V8CA 4WIPA 4IWOA 3O65B 4ICUA 1GC6A 4K7WA 2KC1A 3H8HA 2G3QB 2WP9B 5IKCM 2M0AA 4LK0M 2LGSA 4NPNA 3C0RB 2BGFA 4IC7B 1IGDA 2HDEA 1FIQA 1XLOA 3FAHA 4LCDE 4BFRA 3W1SA 2V3NA 4OZAA 3WAOA 3A4RA 3RNAC 4TSSA 2LXAA 4CHKA 5JHBA 1E8ZA 3P4SB 3W1YA 3FC4A 3RMKC 3LB8C 1C76A 1TTNA 1VZ8A 1UBQA 1FEHA 1ZXHA 2Y5CA 1C4PA 2G1EA 1GB4A 2JY6A 4FJZA 2RD0A 2DZKA 4ZHOA 1E8XA 3MP9A 1TYGB 2PVGC 2KMCA 1TT5B 1HTOA 2K8BA 3P4QB 2LUEA 4W9LA 3VTWA 3Q8FA 4CYEA 2KN4A 2M8SA 3TUOA 3HRDD 2ACZB 2ZPYA 3BVGA 2M0XA 1YNTE 4RH6A 2JXXA 2KOXA 3WALA 1LO5D 4WJNA 1FPYA 1N63A 2GI9A 3ZRCA 2K6DB 3AE9B 3VUXA 4KV2A 4M01A 1QF6A 2WWZA 2QEJC 5KHOA 2DZIA 1JWBD 4HRSA 2IGGA 3AN1A 1NBFC 1NEKB 1UF0A 4A20A 2Z59B 5EE9A 3V3XA 2JUOA 1OEYJ 1IPGA 2UYZB 3N1XC 3AE4B 1I4PA 3AEFB 1HXYD 3AE2B 2QCZA 1VDVA 3L17A 4W9EA 3IT4B 3IBEA 2XBBC 5EDSA 1SF0A 1XF5L 2FNJB 1QQRA 3NJTA 1NI3A 2VH2A 4P6VF 1XLPA 3BVZA 2O2VA 3HVZA 2FE8A 4OVVA 1D3ZA 3ML9A 1MJDA 3V60A 4IWPA 3RZWC 1VR9A 3GE3C 2KDIA 3ZRFA 2VH1A 3PLUA 1WJUA 1WGDA 2NCNA 1LXDA 1D5XC 2VZKD 2DX5B 2KWUB 4GN1A 1EM7A 3X0WA 1SIJA 2JU6X 5D3DA 3Q3OC 1SXTA 4M00A 2I38A 3TIXA 1UD7A 2IYDB 5HI1A 3DWGC 2D3CA 2KXJA 3L54A 1VRAB 4XDDA 2G9HD 1T0YA 3EFCA 1GNUA 3V62A 3DVGX 3IFWB 4AWJA 3PS6A 1N6ZA 2I1JA 5DPTA 3A1QA 1KJTA 3AE6B 4HCPB 3ZNHB 1YOVB 2QMTA 3QIJA 4W9KA 4HROA 4II2B 2KLCA 1JMLA 3PZDA 2CHZA 1F1HA 2LASA 2N1WA 3VHTC 1MG4A 3HIZA 2IGDA 2K6QA 2DNFA 3RNCC 3ZDTA 1S1QB 3ONSA 2QSDA 2N7DA 4KDIC 2KJ6A 5IOIA 1JALA 3CF6E 4KIKB 2BPSA 1FXAA 1GG3A 2KK8A 4MGKE 3N9YC 4A3OA 3EGRA 1FXIA 3MHSD 2JQRB 4Q2JA 4FJVB 2O6VD 3W5VB 1E6EB 2IJ0A 2KTRA 3BYYB 2KWDA 1WX9A 2CS4A 3LDZE 3SDLC 2MWSB 2OHFA 2BYTA 2WDVB 4WWMA 3OWEB 2NMQA 3B2FA 3P2BA 1NI2A 4M0WA 3QAQA 3SFDB 3TL5A 3H1UA 1I4QA 2W9NA 1XLQA 3M63B 3B0AA 3URYA 3NVVA 3Q8BA 1ENFA 1YN4A 2D3GA 1SB3C 3DVGY 3L4PA 2FCMA 4CO7A 2ZW0A 1ZGUB 2RDHA 2ZVNA 1XO3A 3JW0X 1L4DB 1WGKA 4FADA 2JRIB 5E6NA 2AYOB 1N60A 3NZUA 1V9JA 3QK0A 2DBYA 4RF1A 3GZNB 1JCKB 4BAXA 2MCNB 2N9EB 1WGYA 1AW7A 3AMZA 3O13A 1FNWA 5AUKA 1WZ0A 2W3SA 4BBNC 4XGAB 1M4VA 5DPSA 1UUPA 4ZDVA 3LXFA 2GBNA 3MC0B 4ZRIA 4EOYA 1QOFA 2M17A 5AZFA 3EA6A 4A90A 1VLBA 2K5PA 3R2TA 2NBWB 2TSSA 4IOIE 4IM0A 2FUG1 2W3RA 3PLVA 4W9DA 4DHJD 4IM2A 3DBHB 2PKOA 2XK5A 3BK2A 1Z5SB 2LRUA 2NPTA 1R7SA 1T0SC 3PHXB 1MG8A 1XCTL 3PRZA 4XC2A 3KWLA 4NAMA 4UDUC 4ZYSA 3B1LX 1TY0A 4ZRJA 2HTHA 2WXQA 2YEPB 3UGBB 5JH5C 1KRHA 3HM6X 2UWQA 5LXIB 3DOWA 4NJCA 1S3SG 2MHJA 1ZP0B 1ZE3D 2N1VA 2B3AA 4W9GA 3BVMA 3TSSA 3EFUA 2J42A 5J17A 2LMCA 2ZCBA 1YIWA 4AP4C 4C4VA 3ZJVA 1TS5A 4TMAB 1JWAD 3P1MA 3KW5B 3L13A 2KX0A 2DHZA 1AWDA 3Q3NC 4GDLB 3TEZA 4C00A 4DQOC 4DK5A 2RDGA 2ZZPB 3ZJTA 3I5JC 4HPPA 3HM3A 2JZPA 1OGWA 2L0TA 1DOXA 2KWVB 3AE8B 3MC9A 4II3B 3H6NA 4RM9A 3GP7A 1WR6E 2OOBB 2NS5A 4EZJA 1EUVB 1PGXA 2DAJA 3AE7B 1OEYA 2LRWA 2MBBB 1C79A 4RGNA 1P98A 3PGEA 4MM3A 2V1YA 4F8CB 5IO9A 3ENEA 2W54A 4P1CC 1B1ZA 1WGGA 1HZ6A 3T8MA 4P7IA 1ZDVA 4KSLC 3ZLZA 3I63C 2MBEA 2IY0B 5CHFA 2BB6A 4R3DA 3ABVB 3C8YA 2KQ4X 1UBIA 4GDKA 1GOZA 1WFYA 2FIDA 3IAM1 1R4MI 2K0PA 2BT6A 3QX1A 1FO4A 3PT2B 4MJSB 3QHTA 1WGRA 3U4EG 2OJWA 3PO0A 1Z2MA 4MH8A 3QCAA 3HK0A 1YN5A 1L7YA 4G11A 4GXBA 2KKCA 2RSUA 1SEBD 1MFWA 2CJOA 4LLGM 1E5WA 3V6CB 3RT3B 3JVZX 1CK1A 2BS4B 1E7UA 1H8CA 2LI5A 4MT5A 2QC8A 2V4LA 3QARA 4IM3A 2MP2B 1ZPSA 2QIEB 1WM3A 1KLUD 4AJYB 1WRIA 4NY0A 2L0FA 2K9XA 3I3TB 1FM0D 2WU5B 4B95A 2FIFA 4MSQB 2PJHA 2AL3A 2VZKB 1YQBA 2JYTA 1QOBA 4ITKA 3V6EB 4NQKE 3Q8EA 4YTPB 3ZGZA 3Q14C 4EUTA 3GZNI 1E7VA 2FBWB 1VD2A 4HJKA 3VRAB 2KWCA 2GMIC 4US8A 4DDID 2IO0B 1LFDA 1CMXB 3QA8A 4L1BA 4GSWA 1N62A 1Y56A 4NNJB 2K22A 3U52E 1T6BX 1TJEA 2HJ8A 5EE3A 3EUB2 1NYRA 4C7YA 2EELA 2GOWA 2GRIA 2LGIA 2DYBA 2CJNA 3CMMB 3D32A 2FUHB 1K51A 4JE3B 2WXJA 2ZNVB 3BK1A 3DBHI 1JRUA 2Z0EB 2JWUA 4ANVA 2BVCA 1A70A 2MBOA 3KWVA 2XN9C 1KLGD 3KYCD 1KM7A 2WDTB 2NTSA 2WXRA 4IUMB 4JWSC 4LNIA 4MDKE 2IPKD 1XQQA 2JX5A 2MLBA 2AEHA 3NS1A 1WZ3A 4GMVA 5CHVC 4LNOA 3NG0A 4MELA 4FHKA 3P4PB 3TJPA 4G0NB 3T3NA 4WQOB 2EMTA 2RDBC 2LVPA 1TZOA 1WWTA 4D2KA 4I6NB 1MI0A 2GBJA 2O6VB 2X38A 3ZNGC 4RMAA 1E8YA 4CQNA 1I4RA 1WR1A 2YLMA 2AWTA 1V5TA 2FCQA 4K3CA 3RN9C 2WX0A 3FILB 4HKZE 4DHZE 3UI3A 2MJDA 3AECB 2WXKA 5C3JB 1WJ4A 4B0EA 1TY2A 3NVZA 3M62B 1JRPA 2LWPA 1QILA 1QOGA 2N7JA 1YN3A 3QJZA 2KLGA 2IO2B 2JVCA 3NVYA 3TEWA 1V1PB 5DPRA 3V61A 5IAAC 4YSZB 3VH3B 4ZRKA 4XWWA 3H9DA 3UQBA 1FRDA 4B0MA 3SFEB 2DENB 2N9XA 2C7MB 1TIFA 2BTEA 2ONQA 3ZO5B 1NYQA 4WWNA 1KLVA 3J9CA 4NJ6A 3PRMB 2LEKA 3A9JA 1YX6B 3QQ8B 4N58A 2LUMA 1RM6C 1K52A 4ZYNA 2WXHA 4FBJB 1GUAB 2SEBD 4HEA1 1JWSD 4DHJB 2L1AA 3PV1A 4TKNA 3VUYA 1ESFA 4MACA 2D11A 2H89B 2QHOA 3ZNID 2DZMA 3JSVB 4NZLB 4PYZA 5FKAC 3TMPB 4W9FA 3KYDD 1WSPA 3A33B 1JQ4A 4E71A 1V97A 3PZ8A 2ICIA 4W9CA 5HFYA 1PGBA 2MJEA 2V3SA 2WS3B 2Y5PA 1IUEA 1RLFA 4YTMB 2G45B 3ZJUA 1M94A 1KFYB 4W9HA 1TKEA 1E10A 1JW9D 4WWOA 3KVFB 5FK9C 3IAS1 4J3OD 2Q5WD 4GB9A 4BZAA 3R7QA 3H7PA 1D6EC 1FD6A 1HA5A 1OFFA 2IO3B 2ZVOA 4YTNB 3PREA 3L16A 4RGTA 5E6PA 2R61A 4AJWA 4W9JA 1U4AA 4RCOA 1FCCC 3U8ZA 3DDCB 2UU7A 3QC8B 2NVUI 1WF9A 1BMLC 2JT4B 4BKSD 4E74A 4ANWA 2HE7A 3M95A 1WXQA 5BYSA 1IBXA 1I42A 1JWMD 3EECA 1UNSA 1FFUA 3VFKA 1LM8B 4PS8A 3ZQ4A 1I4HA 1N61A 3E56A 2KFKA 2KAJA 4JGHB 4FXCA 2L00B 4IDIA 1R4MB 3RFZB 4NAWA 2M4NA 2FCSA 3RYTA 1JWUD 2PE6B 2O2VB 5C2TB 5C23A 2KC2A 3VR8B 3B08A 4FJYA 1RRBA 2E3TA 3GB1A 2AQ1B 4LNFA 4OVUA 3CSFA 3AE1B 2BB5A 4AOFA 1VJKA 1Q1OA 2FAZA 3ECIA 3KH0A 3MFGA 3AE3B 1V86A 2INCC 2WXPA 2L32A 3IVFA 2BWES 3SHQA 1Q10A 2KMAA 2BKRB 4IKGA 4RF0A 2BYFA 3TBLD 2CHWA 2PMVA 1DOYA 1D5ZC 1YJIA 4YL8A 4YWGG 3A1QB 4XZ4A 4F1SA 2KMMA 3UINB 4O1NA 4JX1C 4REZA 3K9PB 2C7NB 1P7FA 3RZFA 4K81A 4C56C 3A4SC 4ZRQA 3A9KA 1WMHA 3RNFC 3VTUA 5CHWA 3PHWB 3NY5A 5G2NA 1J7BA 1A5RA 3AE5B 3AH7A 2B76B 1XD3B 1E7PB 1ISNA 3DBLB 3AXCA 5AZHA 3B2GA 3OG5A 2G4DB 2V4IB 1WX8A 2MBQA 3CIRB 2BBCA 1UWXA 4TV3A 2LZ6A 2CU1A 2PEAA 1J0GA 3NOBA 2MW5A 3VXWA 2LVOA 4WURA 2KTRB 3VQIA 2JZZA 1EF1A 3DVNV 2RMMA 4P1BC 3RPFC 4MGYE 3WIMA 1T0RC 3FKYA 2K1FA 4M0WB 1C9FA 3H7SA 1EF5A 4JLCA 4C7ZA 3NUHB 2VRRB 1I4GA 3NVWA 2JZ3B 4FA6A 3OAWA 1E0ZA 3MJ5A 4XYCA 1WGHA 4P16A 1L0YB 2QILA 5J18A 2D2QA 1J7CA 5AEKB 1PDXA 2ZW1A 1TS2A 2Z0DB 4M8MA 2OEDA 1GAQB 4JQWC 2V9HA 1TKYA 2ZJDA 1WRDB 1VZ6A 4K7SA 1RYJA 1K50A 2BF8B 2GBKA 3ALBA 2MQJA 2KJRA 1V6EA 2JRHA 2KTFA 3PSEB 4ARCA 2DAFA 3LYYA 1HQRD 3N1YC 4KZ0A 2C5LC 2D07B 4RNAA 1TZ1A 2KVRA 4FULA 1F2RI 4YSYB 4G50A 3R7RA 3X23A 1X1MA 4LJOB 3RUIB 3GOEA 1WXAA 2L83A 2G4SA 1L5PA 1ZW7A 3VH4B 2J4XA 2K25A 3M3JA 2LFIA 2N7EA 2J0JA 4E3CA 2XK5B 4NJ7A 4PS3A 4EZLA 2LJIA 2DZJA 1SE9A 2NPTB 2ZNVC 1UGJA 1V5OA 2J0KA 4LDTB 1BXTA 4ICVA 1C4AA 1MHHE 2D3BA 4WAAA 2WXMA 4DWFA 3ZDMC 4BKGA 4YSXB 1AYFA 4AUQC 3BWUD 4K1RB 5I4DA 3MHZA 3UIPB 1LQBA 2YVCA 5E6OA 2DLBA 5GMVA 3QWZB 4N59A 1L6VA 4C4VB 4RGMA 1K8RB 4M02A 2WGSA 2PPHA 5G55A 3GS2A 2JF5A 4LNNA 1NDDA 4RFBA 5BO4B 2XEWA 3I9V1 1GJZA 2INDC 4EEWA 5AUIA 1FCLA 2QJLA 2JXTA 1YMHE 2WDRB 3C19A 3DPDA 3VUWA 1OTRB 1ZUD2 4HCNB 4KGTA 4A3PA 1SBBB 3P42A 1MHXA 4MM3B 5KHQA 4HDOA 4KVGB 3NZ3A 4A8XC 1L2NA 3ZXRA 3VR9B 4G3XB 1ROEA 2IBIB 2LGDA 2KDFB 3IT6B 2MBHA 4GDKB 3NRZA 2Z8LA 2KFJA 5E6JA 1TGZB 4QAYA 2KHWB 4A55A 2KD0A 3UQAA 2IGHA 1ZXIA 5BYRA 2KDBA 4OW0A 3DBLI 5JHAA 3RI7C 3N32A 4TQ0A 5HG2A 1WXSA 3T9LA 2CHXA 3W1SC 2Y3AA 3R2IA 5IN7A 1WXMA 4PK1A 3AV8A 4GIVA 4XE0A 4ZHPA 4KX6B 4RM8A 1AN8A 3RD2A 3U2SC 4WJQA 3JYUA 4OVZA 1GB1A 3PVLA 5T8IA 5BMHA 1WE7A 1WJNA 2N0SB 1PQSA 3Q3JA 1R4NB 2R2OA 2Y5BB 1L4ZB 3P63A 3U7ZA 1WH3A 1UGMA 2WXLA 3PPAA 4KSKC 5GXGB 2WLBA 3Q6BA 2ON8A 1F9JA 1I4XA 4DDGD 5G5HA 5IA7A 4XWTA 2L05A 4LTUA 3Q69A 1XEEA 5LNK1 2AQ2B 2RPQA 1V81A
chains in the Genus database with same CATH topology
4AJWA 2GBNA 2JWZA 4W9JA 4ZRIA 1U4AA 2M17A 2ZCCA 4EOYA 5AZFA 3PRPB 3TCAA 2LVQA 2KJHB 2L8JA 2LD9A 3U8ZA 3DDCB 3AU5A 3QC8B 2NVUI 4MGZE 4I6PA 1WF9A 2NBWB 4BKSA 2K8CA 2K8HA 4IM0A 5CTRC 2JT4B 4BKSD 4E74A 4FHJA 4ANWA 4LJPB 1E90A 3PLVA 2IO1B 4W9DA 1SIFA 2HE7A 3M95A 4JL9A 1P3QU 4DHJD 3RULA 1P1AA 4IM2A 1RFAA 4HVBA 1I42A 2XK5A 1E8WA 3EECA 2CR5A 4X57B 3JSVA 1Z5SB 3VFKA 3KUCB 2DYOA 1WI0A 4JIOU 2LRUA 2NPTA 2PE9A 5DPWA 1LM8B 4PS8A 1P9DU 3APFA 5LLIA 4B9KA 3S2AA 2M1MA 1RAXA 3ZUNA 3PHXB 1MG8A 1UH6A 4LDTD 4BOZB 2FCNA 3PRZA 4XC2A 2KFKA 4JGHB 2L00B 2KZRA 2KANA 3NHEB 3K9OB 2M4NA 3B1LX 4NAWA 4ZRJA 2FCSA 2AL6A 3Q3FA 3RYTA 2BYVE 2HTHA 3UGBB 5JH5C 4MSMB 1C3TA 2NBVB 3APCA 2A4ZA 3HM6X 2PE6B 2UWQA 3APDA 5LXIB 3DOWA 2O2VB 1S3SG 4BVUC 2RR9A 5LXHA 2KO3A 3AU4A 3DQVA 4WJPA 2C9WB 5C23A 2KC2A 2LXCA 2N1VA 2B3AA 2RGFA 4W9GA 3EFUA 3B08A 3IG3A 4FJYA 2ZCBA 1RRBA 1WY8A 1YIWA 5J17A 4GOCA 4AP4C 4DBGA 4OVUA 2N9PC 4HWIB 3CSFA 1ZKHA 4F7ZA 2O6VA 3UF8A 3DCGA 2LJ5A 3KW5B 3L13A 3ZKJC 2KX0A 2KQSA 1G6JA 2DHZA 3L10B 4AOFA 1J8CA 4GDLB 3KUZA 4DK5A 2ZZPB 4KDLB 1SGHA 3HM3A 3VDZA 1IP9A 1Q1OA 2FAZA 2IZVB 1OGWA 2L0TA 4PS7A 3ECIA 2A5UA 3KH0A 2KWVB 2ZPNA 4XX5A 1C1YB 4WJOA 4II3B 3H6NA 2D10A 4IWQA 4RM9A 1V86A 5FR6A 1WR6E 4PYUA 1WJ6A 2OOBB 1EO6A 2WX1A 3SU8X 2NS5A 4EZJA 1EUVB 2KQ7A 5D6JB 1WE6A 1VCBA 3NZSA 2DAJA 3IVFA 4DXAB 2BWES 4HPLB 3SHQA 2GBMA 5L95C 2N4FA 1OEYA 2KMAA 2LRWA 2BKRB 2MBBB 3ML8A 1P98A 3PGEA 4MM3A 1H4RA 1KOTA 2V1YA 4F8CB 2J0MA 2BYFA 4IW0A 3TBLD 1J19A 3ENEA 2CHWA 5CX3A 3L08A 1WGGA 1AARA 4YL8A 4KIKA 3RCZA 3T8MA 3A1QB 3EC8A 4P7IA 1WYWB 4XZ4A 5DCNA 4F1SA 3UINB 2MA9B 4KSLC 2ASQA 3ZLZA 3WAPA 4B6WA 2MBEA 3K9PB 2KN5A 2IY0B 4IWOA 3O65B 4NQLB 5CHFA 4ICUA 2C7NB 1GC6A 5C1ZA 4K7WA 4K7UA 3RZFA 2DYMA 2KC1A 4K81A 2EMSA 4ANUA 3A4SC 2G3QB 1UBIA 4GDKA 1WFYA 1WMHA 3A9KA 4NPNA 1BT0A 3C0RB 2BGFA 2FIDA 4IC7B 1UELA 1R4MI 3PHWB 3NY5A 5CHWA 3VTUA 2KX3A 3QX1A 5G2NA 1A5RA 3PT2B 3VTVA 4MJSB 1XD3B 3QHTA 4LCDE 4BFRA 3W1SA 4EZKA 3WAOA 3A4RA 1ISNA 1WGRA 2LXAA 3VAWA 4CHKA 3AXCA 5AZHA 5JHBA 1E8ZA 3W1YA 2G4DB 1WX8A 2KDEB 2MBQA 5HKHA 1Z2MA 5TR5A 4TV3A 2LZ6A 1TTNA 2CU1A 2PEAA 1UBQA 3HK0A 3QCAA 1J0GA 3NOBA 1L7YA 3N30A 3LJ3A 2MW5A 4G11A 4GXBA 2JY6A 4EFOA 3VXWA 3ZTDA 2LVOA 4FJZA 2KKCA 2RSUA 2RD0A 1WX7A 2DZKA 1WIAA 2KTRB 1E8XA 3VQIA 2JZZA 4MEMA 1EF1A 1E5WA 3DVNV 3A9JB 4HXDA 2KMCA 3RT3B 3V6CB 3JVZX 2ZEQA 3DBSA 4MGYE 3WIMA 4MGIE 2K8BA 2K39A 2BYEA 3R3MA 2LUEA 3UIOB 4W9LA 1V80A 3VVWB 2K1FA 4M0WB 1E7UA 3VTWA 4J6IA 4CYEA 3H7SA 1H8CA 2LI5A 1Q0WB 1EF5A 3NS8A 4JLCA 2V4LA 3QARA 4IM3A 2C7HA 2MP2B 1WM2A 1WM3A 2VRRB 4AJYB 2M8SA 3AULA 4NY0A 3ZVVA 2JZ3B 2L0FA 2ZPYA 4FA6A 3OAWA 3I3TB 4MH0E 3SD5A 2M0XA 3R66C 2JXXA 3EHVA 4B95A 2KOXA 2LGYA 2FIFA 4MSQB 3WALA 1WGHA 4WJNA 2PJHA 3WA0A 2NR2A 2AL3A 1R4NI 5J18A 1YQBA 2D2QA 3PTFC 5AZGA 5AEKB 3V6EB 4NQKE 3ZRCA 2K6DB 3VUXA 4KV2A 4EUTA 3GZNI 4BKTA 1E7VA 2R2QA 1VD2A 2Z0DB 4M8MA 4HJKA 4JQWC 2ZJDA 1WRDB 2WWZA 5KHOA 4ANXA 2DZIA 4I6LB 4K7SA 2KWCA 2BF8B 1NBFC 3OJ3A 4A20A 2GMIC 2Z59B 4DDID 2GBKA 3ALBA 2MQJA 3BINA 2IO0B 1OEYJ 1LFDA 2JUOA 1CMXB 1V6EA 2JRHA 2KJRA 2KTFA 3H7PB 1IPGA 1GC7A 2UYZB 3OJ4B 3QA8A 2DAFA 3KUDB 4GSWA 4NNJB 3L17A 4KZ0A 4BBNF 1IYFA 1TBEA 2C5LC 4W9EA 2D07B 2HJ8A 1TZ1A 2KVRA 4FULA 1HE8A 3IBEA 2XBBC 3R7RA 4G50A 3X23A 5EDSA 1X1MA 2OJRA 4WWPA 5L83A 4LJOB 3U7DA 3RUIB 3GOEA 2LGXA 2FNJB 1WXAA 2GOWA 2DYBA 2G4SA 1ZW7A 3VH4B 2MRPA 2K25A 3CMMB 3D32A 3M3JA 2FUHB 2N7EA 2O2VA 2NBUA 2ZNVB 2J0JA 4E3CA 3DBHI 4OVVA 1JRUA 2XK5B 4NJ7A 1D3ZA 3ML9A 4PS3A 2Z0EB 4EZLA 3V60A 2DZJA 2C60A 4IWPA 4ANVA 1SE9A 2NPTB 2ZNVC 3RZWC 3MTNB 1V5OA 2J0KA 2MBOA 4LDTB 2KDIA 3ZRFA 4ICVA 4BOSC 1P0RA 3PLUA 2KFKB 1WJUA 3KYCD 1WGDA 2NCNA 2MSED 1KM7A 4GDLA 4NAWB 1LXDA 1YX5B 4WAAA 3L0WB 2WDTB 1QZEA 4DWFA 2DX5B 3ZDMC 2KWUB 4IUMB 2HD5B 4BKGA 4GN1A 4MDKE 4N9F4 1XQQA 1V49A 4TQ1A 5D94A 4K1RB 3X0WA 4AUQC 2MLBA 2AEHA 3UIPB 1YJ1A 1WZ3A 4GMVA 5CHVC 1LQBA 3ZIMA 2YVCA 5E6OA 3WANA 1V2YA 2CKHB 4MELA 4FHKA 5GMVA 3TIXA 4KZCA 3ZTCA 3TJPA 4G0NB 3QWZB 4WQOB 2EMTA 3U30A 2BKFA 4HPMB 3ZNZB 2LVPA 1UD7A 1K8RB 1UZXB 2IYDB 4I6NB 2GBJA 3PSEB 2PPHA 2O6VB 5G55A 2JF5A 1NDDA 2KXJA 3L54A 2XEWA 5BO4B 3ZNGC 1GJZA 4RMAA 1E8YA 3ZW3A 1T0YA 1GNUA 1XT9B 3V62A 1WR1A 2YLMA 3DVGX 3IFWB 2AWTA 4HLEA 4AWJA 4EEWA 1V5TA 2FCQA 3PS6A 2I1JA 5DPTA 4DHZB 3A1QA 1KJTA 3WAMA 1OQYA 2WX0A 3DBRI 4HK2A 4FN2A 4GGQA 4HCPB 3ZNHB 3IHPC 4DHZE 1WXVA 3QIJA 4W9KA 4GU2A 4II2B 1WJ4A 3DPDA 2KLCA 3PZDA 1OTRB 3VUWA 2CHZA 4HCNB 2LASA 2REXA 3M62B 4A3PA 2BWFA 2N1WA 2LWPA 3VHTC 3HIZA 3HHMA 2K6QA 4HDQA 3QJZA 3ZDTA 1S1QB 3ONSA 2J7QB 5KHQA 2KLGA 4HDOA 2IO2B 2N7DA 2JVCA 4KDIC 1I35A 5DPRA 3V61A 4KVGB 5IAAC 2KJ6A 4MJSA 4TUUA 3VH3B 4ZRKA 3CF6E 4KIKB 3H9DA 2BPSA 3BY4B 1L2NA 3UQBA 1GG3A 1Q5WB 2I1KA 2KK8A 4MGKE 4G3XB 4A3OA 2IBIB 2LGDA 2DENB 2N9XA 2JPHA 2C7MB 2EKEC 1YD8U 2KDFB 3MHSD 2MBHA 2L3ZA 4GDKB 3A9KB 1WMHB 3ZO5B 4WWNA 4FJVB 2O6VD 3N3KB 1KLVA 2KFJA 3OLMD 4NJ6A 2KTRA 3PRMB 1TGZB 3A9JA 1YX6B 2KHWB 1WX9A 3CSTA 3QQ8B 2CS4A 3LDZE 2KNBA 3SDLC 2KD0A 2MWSB 3UQAA 2IY1B 4URKA 4FLHA 2KDBA 3DBLI 5D2MB 3P2BA 4TQ0A 3N32A 5JHAA 1NI2A 1WXSA 2L7RA 4ZYNA 3T9LA 2CHXA 4FBJB 3QAQA 3W1SC 3TL5A 2MP2A 3H1UA 1GUAB 2W9NA 1WXMA 4DHJB 3M63B 4W9IA 3B0AA 2MX2A 4GIVA 3PV1A 4TKNA 3VUYA 4ASWC 2D11A 2QHOA 4RM8A 3ZNID 2DZMA 3JSVB 3RD2A 2D3GA 4PYZA 3TMPB 2GBRA 4W9FA 3KYDD 4WJQA 3DVGY 3A33B 3JYUA 4E71A 2FCMA 3PVLA 4EKUA 5D7GA 1WE7A 1WJNA 4W9CA 4CO7A 4IG7B 1ZGUB 1PQSA 2R2OA 2Y5BB 2ZVNA 3DVNU 3JW0X 3MJWA 3Q3JA 2V3SA 4FADA 2JRIB 2WYQA 5JZEB 5E6NA 2AYOB 3QK0A 1WH3A 1V9JA 3NZUA 1RLFA 1UGMA 2G45B 3PPAA 1M94A 4KSKC 2MCNB 1F9JA 1WGYA 2N9EB 4W9HA 4WWOA 3KVFB 5J2RA 4GB9A 4DDGD 1WZ0A 3R7QA 4M8NA 5IA7A 3H7PA 1Y8RC 2L05A 4BBNC 1FXTB 2IO3B 2RPQA 2ZVOA 3PREA 3L16A 2L76A 5DPSA 5E6PA 3AI5A 1V81A 4ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJW A;  2GBN A;  2JWZ A;  4W9J A;  4ZRI A;  1U4A A;  2M17 A;  2ZCC A;  4EOY A;  5AZF A;  3PRP B;  3TCA A;  2LVQ A;  2KJH B;  2L8J A;  2LD9 A;  3U8Z A;  3DDC B;  3AU5 A;  3QC8 B;  2NVU I;  4MGZ E;  4I6P A;  1WF9 A;  2NBW B;  4BKS A;  2K8C A;  2K8H A;  4IM0 A;  5CTR C;  2JT4 B;  4BKS D;  4E74 A;  4FHJ A;  4ANW A;  4LJP B;  1E90 A;  3PLV A;  2IO1 B;  4W9D A;  1SIF A;  2HE7 A;  3M95 A;  4JL9 A;  1P3Q U;  4DHJ D;  3RUL A;  1P1A A;  4IM2 A;  1RFA A;  4HVB A;  1I42 A;  2XK5 A;  1E8W A;  3EEC A;  2CR5 A;  4X57 B;  3JSV A;  1Z5S B;  3VFK A;  3KUC B;  2DYO A;  1WI0 A;  4JIO U;  2LRU A;  2NPT A;  2PE9 A;  5DPW A;  1LM8 B;  4PS8 A;  1P9D U;  3APF A;  5LLI A;  4B9K A;  3S2A A;  2M1M A;  1RAX A;  3ZUN A;  3PHX B;  1MG8 A;  1UH6 A;  4LDT D;  4BOZ B;  2FCN A;  3PRZ A;  4XC2 A;  2KFK A;  4JGH B;  2L00 B;  2KZR A;  2KAN A;  3NHE B;  3K9O B;  2M4N A;  3B1L X;  4NAW A;  4ZRJ A;  2FCS A;  2AL6 A;  3Q3F A;  3RYT A;  2BYV E;  2HTH A;  3UGB B;  5JH5 C;  4MSM B;  1C3T A;  2NBV B;  3APC A;  2A4Z A;  3HM6 X;  2PE6 B;  2UWQ A;  3APD A;  5LXI B;  3DOW A;  2O2V B;  1S3S G;  4BVU C;  2RR9 A;  5LXH A;  2KO3 A;  3AU4 A;  3DQV A;  4WJP A;  2C9W B;  5C23 A;  2KC2 A;  2LXC A;  2N1V A;  2B3A A;  2RGF A;  4W9G A;  3EFU A;  3B08 A;  3IG3 A;  4FJY A;  2ZCB A;  1RRB A;  1WY8 A;  1YIW A;  5J17 A;  4GOC A;  4AP4 C;  4DBG A;  4OVU A;  2N9P C;  4HWI B;  3CSF A;  1ZKH A;  4F7Z A;  2O6V A;  3UF8 A;  3DCG A;  2LJ5 A;  3KW5 B;  3L13 A;  3ZKJ C;  2KX0 A;  2KQS A;  1G6J A;  2DHZ A;  3L10 B;  4AOF A;  1J8C A;  4GDL B;  3KUZ A;  4DK5 A;  2ZZP B;  4KDL B;  1SGH A;  3HM3 A;  3VDZ A;  1IP9 A;  1Q1O A;  2FAZ A;  2IZV B;  1OGW A;  2L0T A;  4PS7 A;  3ECI A;  2A5U A;  3KH0 A;  2KWV B;  2ZPN A;  4XX5 A;  1C1Y B;  4WJO A;  4II3 B;  3H6N A;  2D10 A;  4IWQ A;  4RM9 A;  1V86 A;  5FR6 A;  1WR6 E;  4PYU A;  1WJ6 A;  2OOB B;  1EO6 A;  2WX1 A;  3SU8 X;  2NS5 A;  4EZJ A;  1EUV B;  2KQ7 A;  5D6J B;  1WE6 A;  1VCB A;  3NZS A;  2DAJ A;  3IVF A;  4DXA B;  2BWE S;  4HPL B;  3SHQ A;  2GBM A;  5L95 C;  2N4F A;  1OEY A;  2KMA A;  2LRW A;  2BKR B;  2MBB B;  3ML8 A;  1P98 A;  3PGE A;  4MM3 A;  1H4R A;  1KOT A;  2V1Y A;  4F8C B;  2J0M A;  2BYF A;  4IW0 A;  3TBL D;  1J19 A;  3ENE A;  2CHW A;  5CX3 A;  3L08 A;  1WGG A;  1AAR A;  4YL8 A;  4KIK A;  3RCZ A;  3T8M A;  3A1Q B;  3EC8 A;  4P7I A;  1WYW B;  4XZ4 A;  5DCN A;  4F1S A;  3UIN B;  2MA9 B;  4KSL C;  2ASQ A;  3ZLZ A;  3WAP A;  4B6W A;  2MBE A;  3K9P B;  2KN5 A;  2IY0 B;  4IWO A;  3O65 B;  4NQL B;  5CHF A;  4ICU A;  2C7N B;  1GC6 A;  5C1Z A;  4K7W A;  4K7U A;  3RZF A;  2DYM A;  2KC1 A;  4K81 A;  2EMS A;  4ANU A;  3A4S C;  2G3Q B;  1UBI A;  4GDK A;  1WFY A;  1WMH A;  3A9K A;  4NPN A;  1BT0 A;  3C0R B;  2BGF A;  2FID A;  4IC7 B;  1UEL A;  1R4M I;  3PHW B;  3NY5 A;  5CHW A;  3VTU A;  2KX3 A;  3QX1 A;  5G2N A;  1A5R A;  3PT2 B;  3VTV A;  4MJS B;  1XD3 B;  3QHT A;  4LCD E;  4BFR A;  3W1S A;  4EZK A;  3WAO A;  3A4R A;  1ISN A;  1WGR A;  2LXA A;  3VAW A;  4CHK A;  3AXC A;  5AZH A;  5JHB A;  1E8Z A;  3W1Y A;  2G4D B;  1WX8 A;  2KDE B;  2MBQ A;  5HKH A;  1Z2M A;  5TR5 A;  4TV3 A;  2LZ6 A;  1TTN A;  2CU1 A;  2PEA A;  1UBQ A;  3HK0 A;  3QCA A;  1J0G A;  3NOB A;  1L7Y A;  3N30 A;  3LJ3 A;  2MW5 A;  4G11 A;  4GXB A;  2JY6 A;  4EFO A;  3VXW A;  3ZTD A;  2LVO A;  4FJZ A;  2KKC A;  2RSU A;  2RD0 A;  1WX7 A;  2DZK A;  1WIA A;  2KTR B;  1E8X A;  3VQI A;  2JZZ A;  4MEM A;  1EF1 A;  1E5W A;  3DVN V;  3A9J B;  4HXD A;  2KMC A;  3RT3 B;  3V6C B;  3JVZ X;  2ZEQ A;  3DBS A;  4MGY E;  3WIM A;  4MGI E;  2K8B A;  2K39 A;  2BYE A;  3R3M A;  2LUE A;  3UIO B;  4W9L A;  1V80 A;  3VVW B;  2K1F A;  4M0W B;  1E7U A;  3VTW A;  4J6I A;  4CYE A;  3H7S A;  1H8C A;  2LI5 A;  1Q0W B;  1EF5 A;  3NS8 A;  4JLC A;  2V4L A;  3QAR A;  4IM3 A;  2C7H A;  2MP2 B;  1WM2 A;  1WM3 A;  2VRR B;  4AJY B;  2M8S A;  3AUL A;  4NY0 A;  3ZVV A;  2JZ3 B;  2L0F A;  2ZPY A;  4FA6 A;  3OAW A;  3I3T B;  4MH0 E;  3SD5 A;  2M0X A;  3R66 C;  2JXX A;  3EHV A;  4B95 A;  2KOX A;  2LGY A;  2FIF A;  4MSQ B;  3WAL A;  1WGH A;  4WJN A;  2PJH A;  3WA0 A;  2NR2 A;  2AL3 A;  1R4N I;  5J18 A;  1YQB A;  2D2Q A;  3PTF C;  5AZG A;  5AEK B;  3V6E B;  4NQK E;  3ZRC A;  2K6D B;  3VUX A;  4KV2 A;  4EUT A;  3GZN I;  4BKT A;  1E7V A;  2R2Q A;  1VD2 A;  2Z0D B;  4M8M A;  4HJK A;  4JQW C;  2ZJD A;  1WRD B;  2WWZ A;  5KHO A;  4ANX A;  2DZI A;  4I6L B;  4K7S A;  2KWC A;  2BF8 B;  1NBF C;  3OJ3 A;  4A20 A;  2GMI C;  2Z59 B;  4DDI D;  2GBK A;  3ALB A;  2MQJ A;  3BIN A;  2IO0 B;  1OEY J;  1LFD A;  2JUO A;  1CMX B;  1V6E A;  2JRH A;  2KJR A;  2KTF A;  3H7P B;  1IPG A;  1GC7 A;  2UYZ B;  3OJ4 B;  3QA8 A;  2DAF A;  3KUD B;  4GSW A;  4NNJ B;  3L17 A;  4KZ0 A;  4BBN F;  1IYF A;  1TBE A;  2C5L C;  4W9E A;  2D07 B;  2HJ8 A;  1TZ1 A;  2KVR A;  4FUL A;  1HE8 A;  3IBE A;  2XBB C;  3R7R A;  4G50 A;  3X23 A;  5EDS A;  1X1M A;  2OJR A;  4WWP A;  5L83 A;  4LJO B;  3U7D A;  3RUI B;  3GOE A;  2LGX A;  2FNJ B;  1WXA A;  2GOW A;  2DYB A;  2G4S A;  1ZW7 A;  3VH4 B;  2MRP A;  2K25 A;  3CMM B;  3D32 A;  3M3J A;  2FUH B;  2N7E A;  2O2V A;  2NBU A;  2ZNV B;  2J0J A;  4E3C A;  3DBH I;  4OVV A;  1JRU A;  2XK5 B;  4NJ7 A;  1D3Z A;  3ML9 A;  4PS3 A;  2Z0E B;  4EZL A;  3V60 A;  2DZJ A;  2C60 A;  4IWP A;  4ANV A;  1SE9 A;  2NPT B;  2ZNV C;  3RZW C;  3MTN B;  1V5O A;  2J0K A;  2MBO A;  4LDT B;  2KDI A;  3ZRF A;  4ICV A;  4BOS C;  1P0R A;  3PLU A;  2KFK B;  1WJU A;  3KYC D;  1WGD A;  2NCN A;  2MSE D;  1KM7 A;  4GDL A;  4NAW B;  1LXD A;  1YX5 B;  4WAA A;  3L0W B;  2WDT B;  1QZE A;  4DWF A;  2DX5 B;  3ZDM C;  2KWU B;  4IUM B;  2HD5 B;  4BKG A;  4GN1 A;  4MDK E;  4N9F 4;  1XQQ A;  1V49 A;  4TQ1 A;  5D94 A;  4K1R B;  3X0W A;  4AUQ C;  2MLB A;  2AEH A;  3UIP B;  1YJ1 A;  1WZ3 A;  4GMV A;  5CHV C;  1LQB A;  3ZIM A;  2YVC A;  5E6O A;  3WAN A;  1V2Y A;  2CKH B;  4MEL A;  4FHK A;  5GMV A;  3TIX A;  4KZC A;  3ZTC A;  3TJP A;  4G0N B;  3QWZ B;  4WQO B;  2EMT A;  3U30 A;  2BKF A;  4HPM B;  3ZNZ B;  2LVP A;  1UD7 A;  1K8R B;  1UZX B;  2IYD B;  4I6N B;  2GBJ A;  3PSE B;  2PPH A;  2O6V B;  5G55 A;  2JF5 A;  1NDD A;  2KXJ A;  3L54 A;  2XEW A;  5BO4 B;  3ZNG C;  1GJZ A;  4RMA A;  1E8Y A;  3ZW3 A;  1T0Y A;  1GNU A;  1XT9 B;  3V62 A;  1WR1 A;  2YLM A;  3DVG X;  3IFW B;  2AWT A;  4HLE A;  4AWJ A;  4EEW A;  1V5T A;  2FCQ A;  3PS6 A;  2I1J A;  5DPT A;  4DHZ B;  3A1Q A;  1KJT A;  3WAM A;  1OQY A;  2WX0 A;  3DBR I;  4HK2 A;  4FN2 A;  4GGQ A;  4HCP B;  3ZNH B;  3IHP C;  4DHZ E;  1WXV A;  3QIJ A;  4W9K A;  4GU2 A;  4II2 B;  1WJ4 A;  3DPD A;  2KLC A;  3PZD A;  1OTR B;  3VUW A;  2CHZ A;  4HCN B;  2LAS A;  2REX A;  3M62 B;  4A3P A;  2BWF A;  2N1W A;  2LWP A;  3VHT C;  3HIZ A;  3HHM A;  2K6Q A;  4HDQ A;  3QJZ A;  3ZDT A;  1S1Q B;  3ONS A;  2J7Q B;  5KHQ A;  2KLG A;  4HDO A;  2IO2 B;  2N7D A;  2JVC A;  4KDI C;  1I35 A;  5DPR A;  3V61 A;  4KVG B;  5IAA C;  2KJ6 A;  4MJS A;  4TUU A;  3VH3 B;  4ZRK A;  3CF6 E;  4KIK B;  3H9D A;  2BPS A;  3BY4 B;  1L2N A;  3UQB A;  1GG3 A;  1Q5W B;  2I1K A;  2KK8 A;  4MGK E;  4G3X B;  4A3O A;  2IBI B;  2LGD A;  2DEN B;  2N9X A;  2JPH A;  2C7M B;  2EKE C;  1YD8 U;  2KDF B;  3MHS D;  2MBH A;  2L3Z A;  4GDK B;  3A9K B;  1WMH B;  3ZO5 B;  4WWN A;  4FJV B;  2O6V D;  3N3K B;  1KLV A;  2KFJ A;  3OLM D;  4NJ6 A;  2KTR A;  3PRM B;  1TGZ B;  3A9J A;  1YX6 B;  2KHW B;  1WX9 A;  3CST A;  3QQ8 B;  2CS4 A;  3LDZ E;  2KNB A;  3SDL C;  2KD0 A;  2MWS B;  3UQA A;  2IY1 B;  4URK A;  4FLH A;  2KDB A;  3DBL I;  5D2M B;  3P2B A;  4TQ0 A;  3N32 A;  5JHA A;  1NI2 A;  1WXS A;  2L7R A;  4ZYN A;  3T9L A;  2CHX A;  4FBJ B;  3QAQ A;  3W1S C;  3TL5 A;  2MP2 A;  3H1U A;  1GUA B;  2W9N A;  1WXM A;  4DHJ B;  3M63 B;  4W9I A;  3B0A A;  2MX2 A;  4GIV A;  3PV1 A;  4TKN A;  3VUY A;  4ASW C;  2D11 A;  2QHO A;  4RM8 A;  3ZNI D;  2DZM A;  3JSV B;  3RD2 A;  2D3G A;  4PYZ A;  3TMP B;  2GBR A;  4W9F A;  3KYD D;  4WJQ A;  3DVG Y;  3A33 B;  3JYU A;  4E71 A;  2FCM A;  3PVL A;  4EKU A;  5D7G A;  1WE7 A;  1WJN A;  4W9C A;  4CO7 A;  4IG7 B;  1ZGU B;  1PQS A;  2R2O A;  2Y5B B;  2ZVN A;  3DVN U;  3JW0 X;  3MJW A;  3Q3J A;  2V3S A;  4FAD A;  2JRI B;  2WYQ A;  5JZE B;  5E6N A;  2AYO B;  3QK0 A;  1WH3 A;  1V9J A;  3NZU A;  1RLF A;  1UGM A;  2G45 B;  3PPA A;  1M94 A;  4KSK C;  2MCN B;  1F9J A;  1WGY A;  2N9E B;  4W9H A;  4WWO A;  3KVF B;  5J2R A;  4GB9 A;  4DDG D;  1WZ0 A;  3R7Q A;  4M8N A;  5IA7 A;  3H7P A;  1Y8R C;  2L05 A;  4BBN C;  1FXT B;  2IO3 B;  2RPQ A;  2ZVO A;  3PRE A;  3L16 A;  2L76 A;  5DPS A;  5E6P A;  3AI5 A;  1V81 A;  4ZDV A; 
#chains in the Genus database with same CATH topology
 2JWZ A;  1SE3 A;  3TCA A;  2LVQ A;  2L8J A;  3TEY A;  3SEB A;  2BS2 B;  4I6P A;  1L0V B;  1F2R C;  2KAC A;  2K8C A;  2K8H A;  5CTR C;  4LJP B;  1E90 A;  2IO1 B;  1SIF A;  2CU3 A;  1SE4 A;  3ZXV A;  3RUL A;  1RFA A;  2WXN A;  2CR5 A;  4KGS A;  4X57 B;  3JSV A;  3KUC B;  2DYO A;  1WI0 A;  5DPW A;  2PE9 A;  3V05 A;  3S2A A;  4BOZ B;  1UH6 A;  4LDT D;  2FCN A;  2WQY B;  1T3Q A;  3NHE B;  3K9O B;  5BMI A;  2AL6 A;  1QKZ A;  2M56 B;  2JSV X;  4OZC A;  3RNE C;  1T5X D;  5LXH A;  2KO3 A;  1XCQ L;  4WJP A;  2DWQ A;  2RGF A;  2PVO D;  3IG3 A;  1WY8 A;  4GOC A;  4DBG A;  2WXO A;  1XLN A;  2KYW A;  1KF6 B;  2PW9 A;  4F7Z A;  2QDF A;  4L2Y A;  3UF8 A;  3DCG A;  3W9C B;  1L6U A;  2KQS A;  1G6J A;  2RPV A;  4GLS C;  3Q8A A;  1SGH A;  3VDZ A;  4ACF A;  1IP9 A;  3R8B A;  3MC8 A;  4PS7 A;  3DBR B;  2A5U A;  4XX5 A;  1C1Y B;  3DWM A;  2V0G A;  3WCQ A;  2D10 A;  1IGC A;  1TS3 A;  1EO6 A;  1T0Q C;  2KQ7 A;  5D6J B;  3NZS A;  4KGR A;  1YQ4 B;  5EE0 A;  2GBM A;  5L95 C;  3Q2A C;  2WU2 B;  3T3O A;  3ML8 A;  1PFD A;  3RNG C;  2WXI A;  2J0M A;  1J19 A;  1FNV A;  5CX3 A;  1TS4 A;  1B9R A;  1AAR A;  4ZRP A;  4KIK A;  1PGA A;  3EC8 A;  4AQ7 A;  2KN5 A;  4NQL B;  1SSN A;  5C1Z A;  4K7U A;  2N9L A;  2DYM A;  2X8X X;  2EMS A;  4ANU A;  4PT5 A;  3ETR A;  1BT0 A;  5HHD G;  1UEL A;  2KX3 A;  3VTV A;  4EZK A;  3VAW A;  2HJ1 A;  2V3P A;  2KDE B;  5HKH A;  3W2D A;  5D3I B;  5TR5 A;  2YEP F;  4AS1 A;  1OQR A;  1ET9 A;  3N30 A;  3LJ3 A;  1D5M C;  1XXG A;  4EFO A;  5G5G A;  3ZTD A;  1WX7 A;  5BMG A;  1WIA A;  4MEM A;  4HXD A;  3A9J B;  1N5W A;  2BQQ A;  2ZEQ A;  3DBS A;  4MGI E;  5H8Y E;  3R3M A;  2K39 A;  2BYE A;  4WQM A;  2AQ3 B;  3UIO B;  3VVW B;  1V80 A;  3IXS A;  4J6I A;  1FMA D;  3NS8 A;  1Q0W B;  1F0Z A;  5IP4 D;  2C7H A;  1WM2 A;  4JWU C;  3AEB B;  3AUL A;  3ZVV A;  1YQ3 B;  4RGO S;  4MH0 E;  3SD5 A;  4HJG E;  1ACC A;  3R66 C;  3EHV A;  3AED B;  3DHH C;  2LGY A;  5H92 C;  3N20 C;  1N5X A;  3WA0 A;  2NR2 A;  3N1Z C;  1SJE D;  1R4N I;  3PTF C;  4OHJ A;  5AZG A;  3AB5 A;  4BKT A;  4LNK A;  2R2Q A;  4ANX A;  3DHI C;  1KH0 A;  4I6L B;  2GLS A;  3OJ3 A;  2LHE A;  1NVI D;  3BIN A;  4S17 A;  1WYG A;  4A9A A;  3H7P B;  1GC7 A;  3OJ4 B;  2SAK A;  3KUD B;  2PTL A;  4BBN F;  1IYF A;  1TBE A;  3BYT B;  1HE8 A;  2GB1 A;  2OJR A;  4WWP A;  5L83 A;  3U7D A;  1J7A A;  2LGX A;  1OQQ A;  2MRP A;  3P4R B;  4DXG A;  2NBU A;  2KDM A;  1IBX B;  3SR6 A;  2H88 B;  2C60 A;  3MTN B;  3GE8 C;  3Q3M C;  4BOS C;  1P0R A;  4YXD B;  2KFK B;  2MH7 A;  2MSE D;  4DXF A;  3DHG C;  4GDL A;  4NAW B;  1YX5 B;  3L0W B;  3BZD B;  1QZE A;  2HD5 B;  4N9F 4;  1V49 A;  4TQ1 A;  5D94 A;  2PIA A;  1YJ1 A;  3ZIM A;  3WAN A;  1V2Y A;  2CKH B;  3HUI A;  4KZC A;  3ZTC A;  1C4C A;  1ZOY B;  3U30 A;  3KLS X;  2BKF A;  4HPM B;  2LHD A;  3ZNZ B;  1HTQ A;  1UZX B;  1MPE A;  3TEX A;  1P7E A;  3ZW3 A;  1XT9 B;  4USA A;  3KQ4 A;  4HLE A;  5BYQ A;  2I2Y A;  4DHZ B;  3WAM A;  1OQY A;  3DBR I;  2WXF A;  3AM9 A;  4FN2 A;  4GGQ A;  4HK2 A;  1D4B A;  4YT0 B;  4C80 A;  3IHP C;  1WXV A;  4GU2 A;  2L52 A;  1FFV A;  3PZ7 A;  2REX A;  3I57 A;  2BWF A;  1DYQ A;  3HHM A;  5TSS A;  4HDQ A;  1GPX A;  2EKI A;  3BII D;  1STE A;  2J7Q B;  1I35 A;  1ZDX A;  1SE2 A;  4MJS A;  4TUU A;  2MJ3 A;  3BY4 B;  2I1K A;  1Q5W B;  2AX5 A;  1QT9 A;  1MVK A;  2JPH A;  2EKE C;  1YD8 U;  3E9S A;  1BUI C;  2L3Z A;  1JRO A;  3W5U B;  3A9K B;  1WMH B;  1ET6 A;  2D5G A;  3N3K B;  1TKG A;  3OLM D;  2J52 A;  1QOA A;  3Q8C A;  3CST A;  2KNB A;  2IY1 B;  3B9J A;  4URK A;  4FLH A;  5D2M B;  2WNM A;  4EE2 A;  3CWI A;  1VZ7 A;  2L7R A;  1UWM A;  1SJH D;  2MP2 A;  2INP E;  4S0R A;  1CJE A;  1F77 A;  4WAF A;  4W9I A;  1PYW D;  2MX2 A;  4OZB A;  1FRR A;  4ASW C;  2GBR A;  5MPO A;  4EKU A;  5D7G A;  3AEG B;  4IG7 B;  3MJW A;  3DVN U;  2WYQ A;  5JZE B;  1K53 A;  1HEZ E;  4N6E B;  4K3B A;  3ZYY X;  2KVZ A;  5J2R A;  4JPS A;  2XNA C;  2BS3 B;  4M8N A;  1RFK A;  1Y8R C;  1FXT B;  2L76 A;  2K3U A;  3AI5 A;  2ZCC A;  3PRP B;  2KJH B;  2LD9 A;  1EWC A;  3AU5 A;  4ARI A;  4MGZ E;  4BKS A;  2W55 A;  4US9 A;  1C78 A;  4FHJ A;  2BW2 A;  4WH4 A;  4JL9 A;  1P3Q U;  2W82 A;  3HVD A;  1C77 A;  1P1A A;  4HVB A;  1CQV A;  1E8W A;  1I7H A;  1LGR A;  2PLP A;  4JIO U;  2NTT A;  2IDY A;  1P9D U;  3APF A;  4H2A A;  5LLI A;  4B9K A;  2M1M A;  1RAX A;  1DOI A;  3ZUN A;  4ZOH C;  1PUT A;  1E9M A;  2KZR A;  2KAN A;  5JXV A;  2J53 A;  3AEE B;  3Q3F A;  2BYV E;  1C3T A;  5EE1 A;  1YJJ A;  4MSM B;  2NBV B;  3RNB C;  3APC A;  2A4Z A;  2JYE A;  4KKJ A;  3APD A;  1QLB B;  4HKQ A;  4BVU C;  2RR9 A;  3AU4 A;  3DQV A;  4XDC A;  2C9W B;  1KTK A;  2LXC A;  5FR3 A;  2N9P C;  2HTM E;  4HWI B;  3VRB B;  1ZKH A;  2O6V A;  1L0X B;  2LJ5 A;  1HZ5 A;  3ZKJ C;  2M19 A;  3L10 B;  1J8C A;  3KUZ A;  1NEN B;  4KDL B;  2IZV B;  4KKI A;  2WDQ B;  1EU3 A;  3AEA B;  1FNU A;  2ZPN A;  4WJO A;  3FIL A;  2D3A A;  2WHI A;  1V1O A;  2KT7 A;  4IWQ A;  2INN E;  5FR6 A;  1CZP A;  4PYU A;  1WJ6 A;  2WX1 A;  3SU8 X;  2E6X A;  1WE6 A;  1VCB A;  4DXA B;  4HPL B;  2N4F A;  1EWY C;  1EU4 A;  1H4R A;  1KOT A;  1DGJ A;  4IW0 A;  1F52 A;  2N9K A;  4L23 A;  1V1P A;  1RWS A;  3L08 A;  2MEK A;  4A6Q A;  3RCZ A;  2WXG A;  5DCN A;  1WYW B;  2MA9 B;  4B6W A;  2ASQ A;  3WAP A;  1V8C A;  4WIP A;  4IWO A;  3O65 B;  4ICU A;  1GC6 A;  4K7W A;  2KC1 A;  3H8H A;  2G3Q B;  2WP9 B;  5IKC M;  2M0A A;  4LK0 M;  2LGS A;  4NPN A;  3C0R B;  2BGF A;  4IC7 B;  1IGD A;  2HDE A;  1FIQ A;  1XLO A;  3FAH A;  4LCD E;  4BFR A;  3W1S A;  2V3N A;  4OZA A;  3WAO A;  3A4R A;  3RNA C;  4TSS A;  2LXA A;  4CHK A;  5JHB A;  1E8Z A;  3P4S B;  3W1Y A;  3FC4 A;  3RMK C;  3LB8 C;  1C76 A;  1TTN A;  1VZ8 A;  1UBQ A;  1FEH A;  1ZXH A;  2Y5C A;  1C4P A;  2G1E A;  1GB4 A;  2JY6 A;  4FJZ A;  2RD0 A;  2DZK A;  4ZHO A;  1E8X A;  3MP9 A;  1TYG B;  2PVG C;  2KMC A;  1TT5 B;  1HTO A;  2K8B A;  3P4Q B;  2LUE A;  4W9L A;  3VTW A;  3Q8F A;  4CYE A;  2KN4 A;  2M8S A;  3TUO A;  3HRD D;  2ACZ B;  2ZPY A;  3BVG A;  2M0X A;  1YNT E;  4RH6 A;  2JXX A;  2KOX A;  3WAL A;  1LO5 D;  4WJN A;  1FPY A;  1N63 A;  2GI9 A;  3ZRC A;  2K6D B;  3AE9 B;  3VUX A;  4KV2 A;  4M01 A;  1QF6 A;  2WWZ A;  2QEJ C;  5KHO A;  2DZI A;  1JWB D;  4HRS A;  2IGG A;  3AN1 A;  1NBF C;  1NEK B;  1UF0 A;  4A20 A;  2Z59 B;  5EE9 A;  3V3X A;  2JUO A;  1OEY J;  1IPG A;  2UYZ B;  3N1X C;  3AE4 B;  1I4P A;  3AEF B;  1HXY D;  3AE2 B;  2QCZ A;  1VDV A;  3L17 A;  4W9E A;  3IT4 B;  3IBE A;  2XBB C;  5EDS A;  1SF0 A;  1XF5 L;  2FNJ B;  1QQR A;  3NJT A;  1NI3 A;  2VH2 A;  4P6V F;  1XLP A;  3BVZ A;  2O2V A;  3HVZ A;  2FE8 A;  4OVV A;  1D3Z A;  3ML9 A;  1MJD A;  3V60 A;  4IWP A;  3RZW C;  1VR9 A;  3GE3 C;  2KDI A;  3ZRF A;  2VH1 A;  3PLU A;  1WJU A;  1WGD A;  2NCN A;  1LXD A;  1D5X C;  2VZK D;  2DX5 B;  2KWU B;  4GN1 A;  1EM7 A;  3X0W A;  1SIJ A;  2JU6 X;  5D3D A;  3Q3O C;  1SXT A;  4M00 A;  2I38 A;  3TIX A;  1UD7 A;  2IYD B;  5HI1 A;  3DWG C;  2D3C A;  2KXJ A;  3L54 A;  1VRA B;  4XDD A;  2G9H D;  1T0Y A;  3EFC A;  1GNU A;  3V62 A;  3DVG X;  3IFW B;  4AWJ A;  3PS6 A;  1N6Z A;  2I1J A;  5DPT A;  3A1Q A;  1KJT A;  3AE6 B;  4HCP B;  3ZNH B;  1YOV B;  2QMT A;  3QIJ A;  4W9K A;  4HRO A;  4II2 B;  2KLC A;  1JML A;  3PZD A;  2CHZ A;  1F1H A;  2LAS A;  2N1W A;  3VHT C;  1MG4 A;  3HIZ A;  2IGD A;  2K6Q A;  2DNF A;  3RNC C;  3ZDT A;  1S1Q B;  3ONS A;  2QSD A;  2N7D A;  4KDI C;  2KJ6 A;  5IOI A;  1JAL A;  3CF6 E;  4KIK B;  2BPS A;  1FXA A;  1GG3 A;  2KK8 A;  4MGK E;  3N9Y C;  4A3O A;  3EGR A;  1FXI A;  3MHS D;  2JQR B;  4Q2J A;  4FJV B;  2O6V D;  3W5V B;  1E6E B;  2IJ0 A;  2KTR A;  3BYY B;  2KWD A;  1WX9 A;  2CS4 A;  3LDZ E;  3SDL C;  2MWS B;  2OHF A;  2BYT A;  2WDV B;  4WWM A;  3OWE B;  2NMQ A;  3B2F A;  3P2B A;  1NI2 A;  4M0W A;  3QAQ A;  3SFD B;  3TL5 A;  3H1U A;  1I4Q A;  2W9N A;  1XLQ A;  3M63 B;  3B0A A;  3URY A;  3NVV A;  3Q8B A;  1ENF A;  1YN4 A;  2D3G A;  1SB3 C;  3DVG Y;  3L4P A;  2FCM A;  4CO7 A;  2ZW0 A;  1ZGU B;  2RDH A;  2ZVN A;  1XO3 A;  3JW0 X;  1L4D B;  1WGK A;  4FAD A;  2JRI B;  5E6N A;  2AYO B;  1N60 A;  3NZU A;  1V9J A;  3QK0 A;  2DBY A;  4RF1 A;  3GZN B;  1JCK B;  4BAX A;  2MCN B;  2N9E B;  1WGY A;  1AW7 A;  3AMZ A;  3O13 A;  1FNW A;  5AUK A;  1WZ0 A;  2W3S A;  4BBN C;  4XGA B;  1M4V A;  5DPS A;  1UUP A;  4ZDV A;  3LXF A;  2GBN A;  3MC0 B;  4ZRI A;  4EOY A;  1QOF A;  2M17 A;  5AZF A;  3EA6 A;  4A90 A;  1VLB A;  2K5P A;  3R2T A;  2NBW B;  2TSS A;  4IOI E;  4IM0 A;  2FUG 1;  2W3R A;  3PLV A;  4W9D A;  4DHJ D;  4IM2 A;  3DBH B;  2PKO A;  2XK5 A;  3BK2 A;  1Z5S B;  2LRU A;  2NPT A;  1R7S A;  1T0S C;  3PHX B;  1MG8 A;  1XCT L;  3PRZ A;  4XC2 A;  3KWL A;  4NAM A;  4UDU C;  4ZYS A;  3B1L X;  1TY0 A;  4ZRJ A;  2HTH A;  2WXQ A;  2YEP B;  3UGB B;  5JH5 C;  1KRH A;  3HM6 X;  2UWQ A;  5LXI B;  3DOW A;  4NJC A;  1S3S G;  2MHJ A;  1ZP0 B;  1ZE3 D;  2N1V A;  2B3A A;  4W9G A;  3BVM A;  3TSS A;  3EFU A;  2J42 A;  5J17 A;  2LMC A;  2ZCB A;  1YIW A;  4AP4 C;  4C4V A;  3ZJV A;  1TS5 A;  4TMA B;  1JWA D;  3P1M A;  3KW5 B;  3L13 A;  2KX0 A;  2DHZ A;  1AWD A;  3Q3N C;  4GDL B;  3TEZ A;  4C00 A;  4DQO C;  4DK5 A;  2RDG A;  2ZZP B;  3ZJT A;  3I5J C;  4HPP A;  3HM3 A;  2JZP A;  1OGW A;  2L0T A;  1DOX A;  2KWV B;  3AE8 B;  3MC9 A;  4II3 B;  3H6N A;  4RM9 A;  3GP7 A;  1WR6 E;  2OOB B;  2NS5 A;  4EZJ A;  1EUV B;  1PGX A;  2DAJ A;  3AE7 B;  1OEY A;  2LRW A;  2MBB B;  1C79 A;  4RGN A;  1P98 A;  3PGE A;  4MM3 A;  2V1Y A;  4F8C B;  5IO9 A;  3ENE A;  2W54 A;  4P1C C;  1B1Z A;  1WGG A;  1HZ6 A;  3T8M A;  4P7I A;  1ZDV A;  4KSL C;  3ZLZ A;  3I63 C;  2MBE A;  2IY0 B;  5CHF A;  2BB6 A;  4R3D A;  3ABV B;  3C8Y A;  2KQ4 X;  1UBI A;  4GDK A;  1GOZ A;  1WFY A;  2FID A;  3IAM 1;  1R4M I;  2K0P A;  2BT6 A;  3QX1 A;  1FO4 A;  3PT2 B;  4MJS B;  3QHT A;  1WGR A;  3U4E G;  2OJW A;  3PO0 A;  1Z2M A;  4MH8 A;  3QCA A;  3HK0 A;  1YN5 A;  1L7Y A;  4G11 A;  4GXB A;  2KKC A;  2RSU A;  1SEB D;  1MFW A;  2CJO A;  4LLG M;  1E5W A;  3V6C B;  3RT3 B;  3JVZ X;  1CK1 A;  2BS4 B;  1E7U A;  1H8C A;  2LI5 A;  4MT5 A;  2QC8 A;  2V4L A;  3QAR A;  4IM3 A;  2MP2 B;  1ZPS A;  2QIE B;  1WM3 A;  1KLU D;  4AJY B;  1WRI A;  4NY0 A;  2L0F A;  2K9X A;  3I3T B;  1FM0 D;  2WU5 B;  4B95 A;  2FIF A;  4MSQ B;  2PJH A;  2AL3 A;  2VZK B;  1YQB A;  2JYT A;  1QOB A;  4ITK A;  3V6E B;  4NQK E;  3Q8E A;  4YTP B;  3ZGZ A;  3Q14 C;  4EUT A;  3GZN I;  1E7V A;  2FBW B;  1VD2 A;  4HJK A;  3VRA B;  2KWC A;  2GMI C;  4US8 A;  4DDI D;  2IO0 B;  1LFD A;  1CMX B;  3QA8 A;  4L1B A;  4GSW A;  1N62 A;  1Y56 A;  4NNJ B;  2K22 A;  3U52 E;  1T6B X;  1TJE A;  2HJ8 A;  5EE3 A;  3EUB 2;  1NYR A;  4C7Y A;  2EEL A;  2GOW A;  2GRI A;  2LGI A;  2DYB A;  2CJN A;  3CMM B;  3D32 A;  2FUH B;  1K51 A;  4JE3 B;  2WXJ A;  2ZNV B;  3BK1 A;  3DBH I;  1JRU A;  2Z0E B;  2JWU A;  4ANV A;  2BVC A;  1A70 A;  2MBO A;  3KWV A;  2XN9 C;  1KLG D;  3KYC D;  1KM7 A;  2WDT B;  2NTS A;  2WXR A;  4IUM B;  4JWS C;  4LNI A;  4MDK E;  2IPK D;  1XQQ A;  2JX5 A;  2MLB A;  2AEH A;  3NS1 A;  1WZ3 A;  4GMV A;  5CHV C;  4LNO A;  3NG0 A;  4MEL A;  4FHK A;  3P4P B;  3TJP A;  4G0N B;  3T3N A;  4WQO B;  2EMT A;  2RDB C;  2LVP A;  1TZO A;  1WWT A;  4D2K A;  4I6N B;  1MI0 A;  2GBJ A;  2O6V B;  2X38 A;  3ZNG C;  4RMA A;  1E8Y A;  4CQN A;  1I4R A;  1WR1 A;  2YLM A;  2AWT A;  1V5T A;  2FCQ A;  4K3C A;  3RN9 C;  2WX0 A;  3FIL B;  4HKZ E;  4DHZ E;  3UI3 A;  2MJD A;  3AEC B;  2WXK A;  5C3J B;  1WJ4 A;  4B0E A;  1TY2 A;  3NVZ A;  3M62 B;  1JRP A;  2LWP A;  1QIL A;  1QOG A;  2N7J A;  1YN3 A;  3QJZ A;  2KLG A;  2IO2 B;  2JVC A;  3NVY A;  3TEW A;  1V1P B;  5DPR A;  3V61 A;  5IAA C;  4YSZ B;  3VH3 B;  4ZRK A;  4XWW A;  3H9D A;  3UQB A;  1FRD A;  4B0M A;  3SFE B;  2DEN B;  2N9X A;  2C7M B;  1TIF A;  2BTE A;  2ONQ A;  3ZO5 B;  1NYQ A;  4WWN A;  1KLV A;  3J9C A;  4NJ6 A;  3PRM B;  2LEK A;  3A9J A;  1YX6 B;  3QQ8 B;  4N58 A;  2LUM A;  1RM6 C;  1K52 A;  4ZYN A;  2WXH A;  4FBJ B;  1GUA B;  2SEB D;  4HEA 1;  1JWS D;  4DHJ B;  2L1A A;  3PV1 A;  4TKN A;  3VUY A;  1ESF A;  4MAC A;  2D11 A;  2H89 B;  2QHO A;  3ZNI D;  2DZM A;  3JSV B;  4NZL B;  4PYZ A;  5FKA C;  3TMP B;  4W9F A;  3KYD D;  1WSP A;  3A33 B;  1JQ4 A;  4E71 A;  1V97 A;  3PZ8 A;  2ICI A;  4W9C A;  5HFY A;  1PGB A;  2MJE A;  2V3S A;  2WS3 B;  2Y5P A;  1IUE A;  1RLF A;  4YTM B;  2G45 B;  3ZJU A;  1M94 A;  1KFY B;  4W9H A;  1TKE A;  1E10 A;  1JW9 D;  4WWO A;  3KVF B;  5FK9 C;  3IAS 1;  4J3O D;  2Q5W D;  4GB9 A;  4BZA A;  3R7Q A;  3H7P A;  1D6E C;  1FD6 A;  1HA5 A;  1OFF A;  2IO3 B;  2ZVO A;  4YTN B;  3PRE A;  3L16 A;  4RGT A;  5E6P A;  2R61 A;  4AJW A;  4W9J A;  1U4A A;  4RCO A;  1FCC C;  3U8Z A;  3DDC B;  2UU7 A;  3QC8 B;  2NVU I;  1WF9 A;  1BML C;  2JT4 B;  4BKS D;  4E74 A;  4ANW A;  2HE7 A;  3M95 A;  1WXQ A;  5BYS A;  1IBX A;  1I42 A;  1JWM D;  3EEC A;  1UNS A;  1FFU A;  3VFK A;  1LM8 B;  4PS8 A;  3ZQ4 A;  1I4H A;  1N61 A;  3E56 A;  2KFK A;  2KAJ A;  4JGH B;  4FXC A;  2L00 B;  4IDI A;  1R4M B;  3RFZ B;  4NAW A;  2M4N A;  2FCS A;  3RYT A;  1JWU D;  2PE6 B;  2O2V B;  5C2T B;  5C23 A;  2KC2 A;  3VR8 B;  3B08 A;  4FJY A;  1RRB A;  2E3T A;  3GB1 A;  2AQ1 B;  4LNF A;  4OVU A;  3CSF A;  3AE1 B;  2BB5 A;  4AOF A;  1VJK A;  1Q1O A;  2FAZ A;  3ECI A;  3KH0 A;  3MFG A;  3AE3 B;  1V86 A;  2INC C;  2WXP A;  2L32 A;  3IVF A;  2BWE S;  3SHQ A;  1Q10 A;  2KMA A;  2BKR B;  4IKG A;  4RF0 A;  2BYF A;  3TBL D;  2CHW A;  2PMV A;  1DOY A;  1D5Z C;  1YJI A;  4YL8 A;  4YWG G;  3A1Q B;  4XZ4 A;  4F1S A;  2KMM A;  3UIN B;  4O1N A;  4JX1 C;  4REZ A;  3K9P B;  2C7N B;  1P7F A;  3RZF A;  4K81 A;  4C56 C;  3A4S C;  4ZRQ A;  3A9K A;  1WMH A;  3RNF C;  3VTU A;  5CHW A;  3PHW B;  3NY5 A;  5G2N A;  1J7B A;  1A5R A;  3AE5 B;  3AH7 A;  2B76 B;  1XD3 B;  1E7P B;  1ISN A;  3DBL B;  3AXC A;  5AZH A;  3B2G A;  3OG5 A;  2G4D B;  2V4I B;  1WX8 A;  2MBQ A;  3CIR B;  2BBC A;  1UWX A;  4TV3 A;  2LZ6 A;  2CU1 A;  2PEA A;  1J0G A;  3NOB A;  2MW5 A;  3VXW A;  2LVO A;  4WUR A;  2KTR B;  3VQI A;  2JZZ A;  1EF1 A;  3DVN V;  2RMM A;  4P1B C;  3RPF C;  4MGY E;  3WIM A;  1T0R C;  3FKY A;  2K1F A;  4M0W B;  1C9F A;  3H7S A;  1EF5 A;  4JLC A;  4C7Z A;  3NUH B;  2VRR B;  1I4G A;  3NVW A;  2JZ3 B;  4FA6 A;  3OAW A;  1E0Z A;  3MJ5 A;  4XYC A;  1WGH A;  4P16 A;  1L0Y B;  2QIL A;  5J18 A;  2D2Q A;  1J7C A;  5AEK B;  1PDX A;  2ZW1 A;  1TS2 A;  2Z0D B;  4M8M A;  2OED A;  1GAQ B;  4JQW C;  2V9H A;  1TKY A;  2ZJD A;  1WRD B;  1VZ6 A;  4K7S A;  1RYJ A;  1K50 A;  2BF8 B;  2GBK A;  3ALB A;  2MQJ A;  2KJR A;  1V6E A;  2JRH A;  2KTF A;  3PSE B;  4ARC A;  2DAF A;  3LYY A;  1HQR D;  3N1Y C;  4KZ0 A;  2C5L C;  2D07 B;  4RNA A;  1TZ1 A;  2KVR A;  4FUL A;  1F2R I;  4YSY B;  4G50 A;  3R7R A;  3X23 A;  1X1M A;  4LJO B;  3RUI B;  3GOE A;  1WXA A;  2L83 A;  2G4S A;  1L5P A;  1ZW7 A;  3VH4 B;  2J4X A;  2K25 A;  3M3J A;  2LFI A;  2N7E A;  2J0J A;  4E3C A;  2XK5 B;  4NJ7 A;  4PS3 A;  4EZL A;  2LJI A;  2DZJ A;  1SE9 A;  2NPT B;  2ZNV C;  1UGJ A;  1V5O A;  2J0K A;  4LDT B;  1BXT A;  4ICV A;  1C4A A;  1MHH E;  2D3B A;  4WAA A;  2WXM A;  4DWF A;  3ZDM C;  4BKG A;  4YSX B;  1AYF A;  4AUQ C;  3BWU D;  4K1R B;  5I4D A;  3MHZ A;  3UIP B;  1LQB A;  2YVC A;  5E6O A;  2DLB A;  5GMV A;  3QWZ B;  4N59 A;  1L6V A;  4C4V B;  4RGM A;  1K8R B;  4M02 A;  2WGS A;  2PPH A;  5G55 A;  3GS2 A;  2JF5 A;  4LNN A;  1NDD A;  4RFB A;  5BO4 B;  2XEW A;  3I9V 1;  1GJZ A;  2IND C;  4EEW A;  5AUI A;  1FCL A;  2QJL A;  2JXT A;  1YMH E;  2WDR B;  3C19 A;  3DPD A;  3VUW A;  1OTR B;  1ZUD 2;  4HCN B;  4KGT A;  4A3P A;  1SBB B;  3P42 A;  1MHX A;  4MM3 B;  5KHQ A;  4HDO A;  4KVG B;  3NZ3 A;  4A8X C;  1L2N A;  3ZXR A;  3VR9 B;  4G3X B;  1ROE A;  2IBI B;  2LGD A;  2KDF B;  3IT6 B;  2MBH A;  4GDK B;  3NRZ A;  2Z8L A;  2KFJ A;  5E6J A;  1TGZ B;  4QAY A;  2KHW B;  4A55 A;  2KD0 A;  3UQA A;  2IGH A;  1ZXI A;  5BYR A;  2KDB A;  4OW0 A;  3DBL I;  5JHA A;  3RI7 C;  3N32 A;  4TQ0 A;  5HG2 A;  1WXS A;  3T9L A;  2CHX A;  3W1S C;  2Y3A A;  3R2I A;  5IN7 A;  1WXM A;  4PK1 A;  3AV8 A;  4GIV A;  4XE0 A;  4ZHP A;  4KX6 B;  4RM8 A;  1AN8 A;  3RD2 A;  3U2S C;  4WJQ A;  3JYU A;  4OVZ A;  1GB1 A;  3PVL A;  5T8I A;  5BMH A;  1WE7 A;  1WJN A;  2N0S B;  1PQS A;  3Q3J A;  1R4N B;  2R2O A;  2Y5B B;  1L4Z B;  3P63 A;  3U7Z A;  1WH3 A;  1UGM A;  2WXL A;  3PPA A;  4KSK C;  5GXG B;  2WLB A;  3Q6B A;  2ON8 A;  1F9J A;  1I4X A;  4DDG D;  5G5H A;  5IA7 A;  4XWT A;  2L05 A;  4LTU A;  3Q69 A;  1XEE A;  5LNK 1;  2AQ2 B;  2RPQ A;  1V81 A; 
#chains in the Genus database with same CATH homology
 4AJW A;  2GBN A;  2JWZ A;  4W9J A;  4ZRI A;  1U4A A;  2M17 A;  2ZCC A;  4EOY A;  5AZF A;  3PRP B;  3TCA A;  2LVQ A;  2KJH B;  2L8J A;  2LD9 A;  3U8Z A;  3DDC B;  3AU5 A;  3QC8 B;  2NVU I;  4MGZ E;  4I6P A;  1WF9 A;  2NBW B;  4BKS A;  2K8C A;  2K8H A;  4IM0 A;  5CTR C;  2JT4 B;  4BKS D;  4E74 A;  4FHJ A;  4ANW A;  4LJP B;  1E90 A;  3PLV A;  2IO1 B;  4W9D A;  1SIF A;  2HE7 A;  3M95 A;  4JL9 A;  1P3Q U;  4DHJ D;  3RUL A;  1P1A A;  4IM2 A;  1RFA A;  4HVB A;  1I42 A;  2XK5 A;  1E8W A;  3EEC A;  2CR5 A;  4X57 B;  3JSV A;  1Z5S B;  3VFK A;  3KUC B;  2DYO A;  1WI0 A;  4JIO U;  2LRU A;  2NPT A;  2PE9 A;  5DPW A;  1LM8 B;  4PS8 A;  1P9D U;  3APF A;  5LLI A;  4B9K A;  3S2A A;  2M1M A;  1RAX A;  3ZUN A;  3PHX B;  1MG8 A;  1UH6 A;  4LDT D;  4BOZ B;  2FCN A;  3PRZ A;  4XC2 A;  2KFK A;  4JGH B;  2L00 B;  2KZR A;  2KAN A;  3NHE B;  3K9O B;  2M4N A;  3B1L X;  4NAW A;  4ZRJ A;  2FCS A;  2AL6 A;  3Q3F A;  3RYT A;  2BYV E;  2HTH A;  3UGB B;  5JH5 C;  4MSM B;  1C3T A;  2NBV B;  3APC A;  2A4Z A;  3HM6 X;  2PE6 B;  2UWQ A;  3APD A;  5LXI B;  3DOW A;  2O2V B;  1S3S G;  4BVU C;  2RR9 A;  5LXH A;  2KO3 A;  3AU4 A;  3DQV A;  4WJP A;  2C9W B;  5C23 A;  2KC2 A;  2LXC A;  2N1V A;  2B3A A;  2RGF A;  4W9G A;  3EFU A;  3B08 A;  3IG3 A;  4FJY A;  2ZCB A;  1RRB A;  1WY8 A;  1YIW A;  5J17 A;  4GOC A;  4AP4 C;  4DBG A;  4OVU A;  2N9P C;  4HWI B;  3CSF A;  1ZKH A;  4F7Z A;  2O6V A;  3UF8 A;  3DCG A;  2LJ5 A;  3KW5 B;  3L13 A;  3ZKJ C;  2KX0 A;  2KQS A;  1G6J A;  2DHZ A;  3L10 B;  4AOF A;  1J8C A;  4GDL B;  3KUZ A;  4DK5 A;  2ZZP B;  4KDL B;  1SGH A;  3HM3 A;  3VDZ A;  1IP9 A;  1Q1O A;  2FAZ A;  2IZV B;  1OGW A;  2L0T A;  4PS7 A;  3ECI A;  2A5U A;  3KH0 A;  2KWV B;  2ZPN A;  4XX5 A;  1C1Y B;  4WJO A;  4II3 B;  3H6N A;  2D10 A;  4IWQ A;  4RM9 A;  1V86 A;  5FR6 A;  1WR6 E;  4PYU A;  1WJ6 A;  2OOB B;  1EO6 A;  2WX1 A;  3SU8 X;  2NS5 A;  4EZJ A;  1EUV B;  2KQ7 A;  5D6J B;  1WE6 A;  1VCB A;  3NZS A;  2DAJ A;  3IVF A;  4DXA B;  2BWE S;  4HPL B;  3SHQ A;  2GBM A;  5L95 C;  2N4F A;  1OEY A;  2KMA A;  2LRW A;  2BKR B;  2MBB B;  3ML8 A;  1P98 A;  3PGE A;  4MM3 A;  1H4R A;  1KOT A;  2V1Y A;  4F8C B;  2J0M A;  2BYF A;  4IW0 A;  3TBL D;  1J19 A;  3ENE A;  2CHW A;  5CX3 A;  3L08 A;  1WGG A;  1AAR A;  4YL8 A;  4KIK A;  3RCZ A;  3T8M A;  3A1Q B;  3EC8 A;  4P7I A;  1WYW B;  4XZ4 A;  5DCN A;  4F1S A;  3UIN B;  2MA9 B;  4KSL C;  2ASQ A;  3ZLZ A;  3WAP A;  4B6W A;  2MBE A;  3K9P B;  2KN5 A;  2IY0 B;  4IWO A;  3O65 B;  4NQL B;  5CHF A;  4ICU A;  2C7N B;  1GC6 A;  5C1Z A;  4K7W A;  4K7U A;  3RZF A;  2DYM A;  2KC1 A;  4K81 A;  2EMS A;  4ANU A;  3A4S C;  2G3Q B;  1UBI A;  4GDK A;  1WFY A;  1WMH A;  3A9K A;  4NPN A;  1BT0 A;  3C0R B;  2BGF A;  2FID A;  4IC7 B;  1UEL A;  1R4M I;  3PHW B;  3NY5 A;  5CHW A;  3VTU A;  2KX3 A;  3QX1 A;  5G2N A;  1A5R A;  3PT2 B;  3VTV A;  4MJS B;  1XD3 B;  3QHT A;  4LCD E;  4BFR A;  3W1S A;  4EZK A;  3WAO A;  3A4R A;  1ISN A;  1WGR A;  2LXA A;  3VAW A;  4CHK A;  3AXC A;  5AZH A;  5JHB A;  1E8Z A;  3W1Y A;  2G4D B;  1WX8 A;  2KDE B;  2MBQ A;  5HKH A;  1Z2M A;  5TR5 A;  4TV3 A;  2LZ6 A;  1TTN A;  2CU1 A;  2PEA A;  1UBQ A;  3HK0 A;  3QCA A;  1J0G A;  3NOB A;  1L7Y A;  3N30 A;  3LJ3 A;  2MW5 A;  4G11 A;  4GXB A;  2JY6 A;  4EFO A;  3VXW A;  3ZTD A;  2LVO A;  4FJZ A;  2KKC A;  2RSU A;  2RD0 A;  1WX7 A;  2DZK A;  1WIA A;  2KTR B;  1E8X A;  3VQI A;  2JZZ A;  4MEM A;  1EF1 A;  1E5W A;  3DVN V;  3A9J B;  4HXD A;  2KMC A;  3RT3 B;  3V6C B;  3JVZ X;  2ZEQ A;  3DBS A;  4MGY E;  3WIM A;  4MGI E;  2K8B A;  2K39 A;  2BYE A;  3R3M A;  2LUE A;  3UIO B;  4W9L A;  1V80 A;  3VVW B;  2K1F A;  4M0W B;  1E7U A;  3VTW A;  4J6I A;  4CYE A;  3H7S A;  1H8C A;  2LI5 A;  1Q0W B;  1EF5 A;  3NS8 A;  4JLC A;  2V4L A;  3QAR A;  4IM3 A;  2C7H A;  2MP2 B;  1WM2 A;  1WM3 A;  2VRR B;  4AJY B;  2M8S A;  3AUL A;  4NY0 A;  3ZVV A;  2JZ3 B;  2L0F A;  2ZPY A;  4FA6 A;  3OAW A;  3I3T B;  4MH0 E;  3SD5 A;  2M0X A;  3R66 C;  2JXX A;  3EHV A;  4B95 A;  2KOX A;  2LGY A;  2FIF A;  4MSQ B;  3WAL A;  1WGH A;  4WJN A;  2PJH A;  3WA0 A;  2NR2 A;  2AL3 A;  1R4N I;  5J18 A;  1YQB A;  2D2Q A;  3PTF C;  5AZG A;  5AEK B;  3V6E B;  4NQK E;  3ZRC A;  2K6D B;  3VUX A;  4KV2 A;  4EUT A;  3GZN I;  4BKT A;  1E7V A;  2R2Q A;  1VD2 A;  2Z0D B;  4M8M A;  4HJK A;  4JQW C;  2ZJD A;  1WRD B;  2WWZ A;  5KHO A;  4ANX A;  2DZI A;  4I6L B;  4K7S A;  2KWC A;  2BF8 B;  1NBF C;  3OJ3 A;  4A20 A;  2GMI C;  2Z59 B;  4DDI D;  2GBK A;  3ALB A;  2MQJ A;  3BIN A;  2IO0 B;  1OEY J;  1LFD A;  2JUO A;  1CMX B;  1V6E A;  2JRH A;  2KJR A;  2KTF A;  3H7P B;  1IPG A;  1GC7 A;  2UYZ B;  3OJ4 B;  3QA8 A;  2DAF A;  3KUD B;  4GSW A;  4NNJ B;  3L17 A;  4KZ0 A;  4BBN F;  1IYF A;  1TBE A;  2C5L C;  4W9E A;  2D07 B;  2HJ8 A;  1TZ1 A;  2KVR A;  4FUL A;  1HE8 A;  3IBE A;  2XBB C;  3R7R A;  4G50 A;  3X23 A;  5EDS A;  1X1M A;  2OJR A;  4WWP A;  5L83 A;  4LJO B;  3U7D A;  3RUI B;  3GOE A;  2LGX A;  2FNJ B;  1WXA A;  2GOW A;  2DYB A;  2G4S A;  1ZW7 A;  3VH4 B;  2MRP A;  2K25 A;  3CMM B;  3D32 A;  3M3J A;  2FUH B;  2N7E A;  2O2V A;  2NBU A;  2ZNV B;  2J0J A;  4E3C A;  3DBH I;  4OVV A;  1JRU A;  2XK5 B;  4NJ7 A;  1D3Z A;  3ML9 A;  4PS3 A;  2Z0E B;  4EZL A;  3V60 A;  2DZJ A;  2C60 A;  4IWP A;  4ANV A;  1SE9 A;  2NPT B;  2ZNV C;  3RZW C;  3MTN B;  1V5O A;  2J0K A;  2MBO A;  4LDT B;  2KDI A;  3ZRF A;  4ICV A;  4BOS C;  1P0R A;  3PLU A;  2KFK B;  1WJU A;  3KYC D;  1WGD A;  2NCN A;  2MSE D;  1KM7 A;  4GDL A;  4NAW B;  1LXD A;  1YX5 B;  4WAA A;  3L0W B;  2WDT B;  1QZE A;  4DWF A;  2DX5 B;  3ZDM C;  2KWU B;  4IUM B;  2HD5 B;  4BKG A;  4GN1 A;  4MDK E;  4N9F 4;  1XQQ A;  1V49 A;  4TQ1 A;  5D94 A;  4K1R B;  3X0W A;  4AUQ C;  2MLB A;  2AEH A;  3UIP B;  1YJ1 A;  1WZ3 A;  4GMV A;  5CHV C;  1LQB A;  3ZIM A;  2YVC A;  5E6O A;  3WAN A;  1V2Y A;  2CKH B;  4MEL A;  4FHK A;  5GMV A;  3TIX A;  4KZC A;  3ZTC A;  3TJP A;  4G0N B;  3QWZ B;  4WQO B;  2EMT A;  3U30 A;  2BKF A;  4HPM B;  3ZNZ B;  2LVP A;  1UD7 A;  1K8R B;  1UZX B;  2IYD B;  4I6N B;  2GBJ A;  3PSE B;  2PPH A;  2O6V B;  5G55 A;  2JF5 A;  1NDD A;  2KXJ A;  3L54 A;  2XEW A;  5BO4 B;  3ZNG C;  1GJZ A;  4RMA A;  1E8Y A;  3ZW3 A;  1T0Y A;  1GNU A;  1XT9 B;  3V62 A;  1WR1 A;  2YLM A;  3DVG X;  3IFW B;  2AWT A;  4HLE A;  4AWJ A;  4EEW A;  1V5T A;  2FCQ A;  3PS6 A;  2I1J A;  5DPT A;  4DHZ B;  3A1Q A;  1KJT A;  3WAM A;  1OQY A;  2WX0 A;  3DBR I;  4HK2 A;  4FN2 A;  4GGQ A;  4HCP B;  3ZNH B;  3IHP C;  4DHZ E;  1WXV A;  3QIJ A;  4W9K A;  4GU2 A;  4II2 B;  1WJ4 A;  3DPD A;  2KLC A;  3PZD A;  1OTR B;  3VUW A;  2CHZ A;  4HCN B;  2LAS A;  2REX A;  3M62 B;  4A3P A;  2BWF A;  2N1W A;  2LWP A;  3VHT C;  3HIZ A;  3HHM A;  2K6Q A;  4HDQ A;  3QJZ A;  3ZDT A;  1S1Q B;  3ONS A;  2J7Q B;  5KHQ A;  2KLG A;  4HDO A;  2IO2 B;  2N7D A;  2JVC A;  4KDI C;  1I35 A;  5DPR A;  3V61 A;  4KVG B;  5IAA C;  2KJ6 A;  4MJS A;  4TUU A;  3VH3 B;  4ZRK A;  3CF6 E;  4KIK B;  3H9D A;  2BPS A;  3BY4 B;  1L2N A;  3UQB A;  1GG3 A;  1Q5W B;  2I1K A;  2KK8 A;  4MGK E;  4G3X B;  4A3O A;  2IBI B;  2LGD A;  2DEN B;  2N9X A;  2JPH A;  2C7M B;  2EKE C;  1YD8 U;  2KDF B;  3MHS D;  2MBH A;  2L3Z A;  4GDK B;  3A9K B;  1WMH B;  3ZO5 B;  4WWN A;  4FJV B;  2O6V D;  3N3K B;  1KLV A;  2KFJ A;  3OLM D;  4NJ6 A;  2KTR A;  3PRM B;  1TGZ B;  3A9J A;  1YX6 B;  2KHW B;  1WX9 A;  3CST A;  3QQ8 B;  2CS4 A;  3LDZ E;  2KNB A;  3SDL C;  2KD0 A;  2MWS B;  3UQA A;  2IY1 B;  4URK A;  4FLH A;  2KDB A;  3DBL I;  5D2M B;  3P2B A;  4TQ0 A;  3N32 A;  5JHA A;  1NI2 A;  1WXS A;  2L7R A;  4ZYN A;  3T9L A;  2CHX A;  4FBJ B;  3QAQ A;  3W1S C;  3TL5 A;  2MP2 A;  3H1U A;  1GUA B;  2W9N A;  1WXM A;  4DHJ B;  3M63 B;  4W9I A;  3B0A A;  2MX2 A;  4GIV A;  3PV1 A;  4TKN A;  3VUY A;  4ASW C;  2D11 A;  2QHO A;  4RM8 A;  3ZNI D;  2DZM A;  3JSV B;  3RD2 A;  2D3G A;  4PYZ A;  3TMP B;  2GBR A;  4W9F A;  3KYD D;  4WJQ A;  3DVG Y;  3A33 B;  3JYU A;  4E71 A;  2FCM A;  3PVL A;  4EKU A;  5D7G A;  1WE7 A;  1WJN A;  4W9C A;  4CO7 A;  4IG7 B;  1ZGU B;  1PQS A;  2R2O A;  2Y5B B;  2ZVN A;  3DVN U;  3JW0 X;  3MJW A;  3Q3J A;  2V3S A;  4FAD A;  2JRI B;  2WYQ A;  5JZE B;  5E6N A;  2AYO B;  3QK0 A;  1WH3 A;  1V9J A;  3NZU A;  1RLF A;  1UGM A;  2G45 B;  3PPA A;  1M94 A;  4KSK C;  2MCN B;  1F9J A;  1WGY A;  2N9E B;  4W9H A;  4WWO A;  3KVF B;  5J2R A;  4GB9 A;  4DDG D;  1WZ0 A;  3R7Q A;  4M8N A;  5IA7 A;  3H7P A;  1Y8R C;  2L05 A;  4BBN C;  1FXT B;  2IO3 B;  2RPQ A;  2ZVO A;  3PRE A;  3L16 A;  2L76 A;  5DPS A;  5E6P A;  3AI5 A;  1V81 A;  4ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...