4RM9A

Crystal structure of human ezrin in space group c2221
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
586
structure length
368
Chain Sequence
b'MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
molecule tags Peptide binding protein
source organism Homo sapiens
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
total genus 126
structure length 368
sequence length 586
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm9A01
3VUXA 1WX7A 4IWPA 3UGBB 2IO3B 3ZLZA 3ZNZB 2JZZA 4LJOB 1ISNA 3QJZA 1GNUA 2DYOA 1TGZB 3KVFB 1RFAA 3EECA 3VUWA 1XD3B 4FJVB 4AJYB 4DHJB 2L7RA 2DAFA 2GBRA 3L10B 3L54A 3OLMD 3PS6A 2DAJA 3HM6X 3K9OB 2N9EB 2ZEQA 4FHKA 4FA6A 1EF5A 2YLMA 2AWTA 2LXAA 1WZ3A 3PT2B 2NS5A 2CKHB 2LWPA 3ZRFA 2C5LC 5KHQA 3H7SA 1V49A 2MW5A 3QCAA 3T8MA 3ZUNA 3VVWB 2K6QA 2YVCA 3V62A 2DHZA 3NZUA 4GDKA 4MM3A 2I1KA 3PRPB 3ZNHB 3A4RA 5E6NA 4FLHA 1XT9B 2KFKA 4BBNC 4NQKE 1V5OA 2HE7A 2D11A 4G3XB 1Z2MA 1WGRA 3WAMA 3ML9A 4W9GA 4XZ4A 5LXIB 4AP4C 4ANXA 4KIKB 1M94A 2CHWA 3MJWA 5L95C 4GMVA 2CHZA 2KWCA 1WGHA 2BWFA 2G4DB 3DVGY 3PSEB 4GOCA 2KN5A 3QA8A 3H6NA 4P7IA 3VHTC 2AL6A 2MBBB 1YX5B 3ALBA 3TBLD 4AWJA 3MTNB 1GUAB 1WJUA 2D3GA 4JGHB 2DENB 4NJ7A 3DQVA 3N32A 4HDOA 2LVQA 4G0NB 4M8MA 2MBOA 2FIFA 2K8HA 2GBMA 1P1AA 3TJPA 3ZW3A 2OJRA 1RAXA 1E7VA 3L0WB 4K81A 2V3SA 4LCDE 3DVNU 5TR5A 3UIOB 3ZNID 4MGZE 1SIFA 2KC2A 1WJNA 4DHZE 4WJQA 2G45B 5IAAC 2N1WA 3H7PA 3VAWA 3VDZA 4I6LB 1WXMA 2KFJA 2N7EA 1UBIA 1ZW7A 3OJ4B 2PE9A 4ICVA 5JHBA 4FN2A 3W1SC 5BO4B 2K8BA 3ZIMA 1WMHB 4IUMB 2RSUA 4IWOA 3W1SA 1D3ZA 2V1YA 2LXCA 1S1QB 2IYDB 1R4MI 2LUEA 2R2OA 4PYZA 5CHFA 2XBBC 4BFRA 3RZWC 4DDID 2PPHA 1WF9A 2KNBA 2GBNA 4HPLB 4I6NB 2KTRB 1WM2A 2ZNVC 1YIWA 2MP2A 2KOXA 2KC1A 3ECIA 4EZLA 3QHTA 2Z0EB 4LDTB 3RZFA 3VQIA 3AXCA 3A9KA 4JIOU 2FNJB 3VUYA 2DYBA 2Z59B 4BKSA 5J2RA 1CMXB 1AARA 2IY1B 3DVGX 3QQ8B 2L0FA 2ZZPB 4IM3A 4KVGB 5G55A 4FHJA 1WMHA 4NQLB 1S3SG 5AZHA 3R3MA 1VD2A 4DBGA 2WX0A 4HLEA 2N1VA 4KZ0A 2LGDA 4W9IA 2RGFA 3JVZX 3A33B 5EDSA 4PYUA 3DCGA 4OVUA 1BT0A 4F7ZA 1K8RB 1VCBA 1V86A 2N7DA 2MQJA 3H7PB 2C7HA 4IG7B 1HE8A 3TCAA 3A1QA 3CF6E 4TKNA 4HCPB 2DZJA 3KH0A 5CTRC 2KMAA 4KV2A 3B1LX 3DBSA 4KZCA 1WM3A 1WE7A 2FAZA 1WE6A 2XEWA 4MDKE 2NPTB 3VH4B 4FBJB 3DBRI 3UQAA 2M4NA 4BKSD 2M0XA 4IWQA 1FXTB 2IO0B 2JRHA 3PREA 2C60A 4GU2A 2A4ZA 2LRUA 2L05A 4J6IA 4W9EA 1E8YA 2KDBA 2MBEA 1P0RA 2KQ7A 2WYQA 2JVCA 3AU5A 3HK0A 4II2B 3L08A 3UF8A 3Q3JA 5CX3A 1YD8U 3RD2A 3RUIB 4KIKA 1YJ1A 3ZVVA 1KOTA 2JXXA 2KJHB 2OOBB 2KX3A 3MHSD 2ZVOA 3WA0A 2HD5B 3ZDTA 2C9WB 2KZRA 2EKEC 2K39A 2MSED 3JSVA 4ZYNA 2KFKB 2D10A 1OEYJ 3WALA 4FULA 1Q0WB 2RD0A 2BKRB 4ZRJA 1V81A 1GC6A 3VTVA 2JRIB 3WAPA 3SHQA 4W9KA 3RCZA 4W9FA 2ASQA 2IY0B 4KDLB 2CR5A 2O6VA 3PGEA 4HWIB 2MA9B 2L00B 5J18A 2C7NB 2JZ3B 3ONSA 1V80A 3WIMA 3QWZB 2KHWB 2QHOA 2LD9A 2BPSA 1KM7A 3KUZA 3PRMB 4HVBA 4WWNA 1T0YA 3IG3A 3A9JA 5DPWA 1OQYA 4MJSA 3M63B 4MH0E 2MCNB 2KLCA 1I35A 1NI2A 2BGFA 3JW0X 3SDLC 3NY5A 2K25A 2LVOA 3KUCB 4ICUA 4HK2A 2BKFA 3VXWA 3QC8B 4ZRKA 3ZDMC 1ZGUB 2ZCCA 2Y5BB 2KD0A 1WJ6A 5D7GA 3W1YA 4TV3A 2LVPA 2KJRA 2ZPNA 1IPGA 1P9DU 4WWOA 3PHXB 3B08A 4RMAA 5KHOA 5CHVC 2MWSB 3HHMA 3UINB 4AJWA 1F9JA 3VTWA 2FCQA 1E8XA 2NBUA 4WJOA 4GDLB 3V6CB 3S2AA 2CU1A 2D07B 2G3QB 4W9JA 4X57B 3IFWB 3ML8A 3Q3FA 1RRBA 3DPDA 1Q1OA 2N9PC 3NOBA 4GXBA 1L7YA 2XK5A 2KWUB 1WR1A 2RPQA 2ZVNA 3QK0A 3RT3B 4MSMB 4ANUA 1WYWB 3TL5A 4MJSB 2J0JA 2M1MA 3A9JB 2UWQA 2JY6A 5JH5C 4M8NA 1TTNA 5G2NA 4I6PA 1P98A 2N9XA 4NY0A 3DVNV 3LJ3A 1V9JA 2C7MB 1UH6A 4DWFA 2B3AA 4B95A 2K6DB 2PJHA 4K7SA 2PEAA 3AU4A 4K7WA 2O6VB 3PHWB 1MG8A 1XQQA 1WX8A 1YX6B 3TMPB 5L83A 3AULA 4JLCA 3PTFC 1R4NI 2L76A 2NR2A 1J19A 2REXA 4PS8A 4F8CB 4FADA 4HXDA 1LM8B 4TQ1A 3L17A 2W9NA 3RYTA 4DXAB 4M0WB 3X0WA 1WY8A 3JSVB 2K1FA 4IM0A 4FJZA 1E5WA 3L16A 1SE9A 2KX0A 2ZCBA 1LQBA 3PVLA 5D94A 3VTUA 3VFKA 2UYZB 2Z0DB 2IO2B 3KYCD 3R66C 2IBIB 2WWZA 1WGGA 4ANVA 4WJPA 4RM8A 2RR9A 4W9LA 2AL3A 4WJNA 3U30A 3HM3A 4JL9A 4DK5A 3N3KB 1WI0A 3PRZA 4RM9A 2NPTA 3DOWA 4DHJD 2MX2A 3P2BA 2KANA 2LZ6A 3D32A 4W9DA 4EFOA 3APDA 2IO1B 4XX5A 5GMVA 1Z5SB 1WZ0A 3UQBA 1LFDA 2JWZA 1V5TA 4G50A 3A1QB 3QARA 4MGKE 1EO6A 1LXDA 1WR6E 2LJ5A 1L2NA 2BF8B 3APFA 1C1YB 1U4AA 4KDIC 4ANWA 3KUDB 2GMIC 1OEYA 2M8SA 4HPMB 1UBQA 2GOWA 1OTRB 4E3CA 4BKGA 2JPHA 1WGDA 1NDDA 3PLVA 1C3TA 1PQSA 3T9LA 2ZNVB 4ASWC 2DZIA 4BBNF 2A5UA 1J8CA 2KLGA 2LGYA 3QIJA 3ENEA 2KO3A 3KYDD 3L13A 4YL8A 5C23A 4BOSC 4EUTA 2BYFA 1RLFA 1WIAA 2O2VA 3A9KB 3M95A 2AEHA 3NZSA 3PPAA 5D6JB 5J17A 2MRPA 2WDTB 4NAWA 4NAWB 4BKTA 2MP2B 2O2VB 2KTRA 4XC2A 1P3QU 4PS7A 2ZPYA 3GOEA 1IP9A 4MGIE 1SGHA 2KTFA 2FIDA 4FJYA 3M62B 4WWPA 2FCSA 1NBFC 3CMMB 5DPRA 4EZKA 2DYMA 2PE6B 2DZKA 1IYFA 4A20A 4IC7B 3LDZE 2NCNA 3M3JA 1WFYA 5DCNA 3AI5A 2KJ6A 2DZMA 1H8CA 2IZVB 3U7DA 4TQ0A 3ZKJC 3TIXA 3CSFA 4DDGD 3QAQA 4GN1A 5JHAA 1TBEA 4MSQB 3NHEB 2JF5A 1WJ4A 3K9PB 1E7UA 1I42A 2FCMA 1WXVA 2LGXA 4PS3A 5AEKB 2WX1A 5CHWA 4GB9A 4WQOB 4AUQC 2JUOA 3ZRCA 5E6OA 2L0TA 3KW5B 4HDQA 4A3OA 2KK8A 4NNJB 4EKUA 2AYOB 2ZJDA 1H4RA 3DBLI 4KSKC 1GG3A 1E8ZA 5LLIA 3ZTDA 1KJTA 2FCNA 2NVUI 2NBVB 1OGWA 4GGQA 2JT4B 3ZTCA 3JYUA 3DBHI 4G11A 4DHZB 2GBJA 4CO7A 2NBWB 3BY4B 5LXHA 2DX5B 2HJ8A 3APCA 5D2MB 2KXJA 2V4LA 4K7UA 2CS4A 4W9CA 4LJPB 2KQSA 4URKA 3V61A 3SU8X 1WXAA 2KWVB 1J0GA 2EMTA 2LASA 3R7QA 4K1RB 3BINA 2J0MA 2LRWA 1Q5WB 3OJ3A 2L8JA 3OAWA 1UD7A 1A5RA 3ZO5B 4EOYA 3EHVA 5AZGA 4B9KA 4BVUC 3O65B 1Y8RC 5E6PA 4A3PA 3SD5A 4ZRIA 4AOFA 2R2QA 4GDKB 2KDIA 3EFUA 3IHPC 1E90A 3HIZA 3DDCB 2GBKA 4NJ6A 3U8ZA 1QZEA 4HCNB 4TUUA 2O6VD 3N30A 3CSTA 4E71A 2BYVE 1V2YA 4N9F4 4B6WA 3V6EB 2HTHA 4MEMA 5DPTA 2D2QA 1WGYA 4EZJA 2VRRB 2EMSA 2BWES 2J0KA 4GIVA 2G4SA 4OVVA 5FR6A 1X1MA 5IA7A 2L3ZA 3B0AA 1KLVA 2BYEA 4IM2A 3IBEA 3V60A 3VH3B 2KDFB 4MELA 3WANA 3H9DA 1WX9A 2J7QB 3NS8A 3C0RB 3ZNGC 3PV1A 3QX1A 4HJKA 3GZNI 2XK5B 2KKCA 2CHXA 4JQWC 5DPSA 1E8WA 1GC7A 4WAAA 1G6JA 3UIPB 3WAOA 4ZDVA 5C1ZA 2FUHB 4GSWA 2KMCA 2MBQA 1WXSA 2KVRA 4E74A 1GJZA 2KDEB 4GDLA 4MGYE 1ZKHA 4LDTD 2MBHA 3IVFA 4EEWA 1EF1A 2M17A 2MLBA 1WRDB 4II3B 1V6EA 1EUVB 4CYEA 3PLUA 3PZDA 4KSLC 2I1JA 3A4SC 3X23A 2N4FA 1WH3A 1TZ1A 5AZFA 1JRUA 1UELA 3H1UA 4IW0A 4BOZB 3EC8A 3RULA 1UGMA 4F1SA 5HKHA 1YQBA 4NPNA 4W9HA 3R7RA 1UZXB 3I3TB 5JZEB 2K8CA 2LI5A 4CHKA
chains in the Genus database with same CATH superfamily
1YJIA 4RCOA 1GNUA 4YSYB 5AUIA 1RFAA 2L7RA 2FUG1 4PK1A 2N0SB 3PS6A 1EF5A 2LXAA 1L0YB 1TY0A 3QCAA 1LGRA 1PGBA 2DHZA 2J53A 3PRPB 1QLBB 4N58A 4HEA1 4BBNC 4G3XB 2ICIA 4W9GA 4RGOS 1FNUA 5LXIB 5D3DA 4OZBA 1M94A 1N61A 4GOCA 2KN5A 2AL6A 2MBBB 2QCZA 3ALBA 4AWJA 3MTNB 4JGHB 2DENB 2WHIA 2EELA 4M8MA 2V9HA 1M4VA 2OJRA 1RAXA 4K81A 2PKOA 1I4PA 2I2YA 1FRDA 3DVNU 5TR5A 3UIOB 4MGZE 1WJNA 2K22A 2G45B 4WJQA 3VAWA 4LK0M 1GB4A 3AECB 3OJ4B 1L0XB 1IUEA 4RF0A 4A90A 4IWOA 5H8YE 3W1SA 1N60A 3MHZA 2R2OA 2XBBC 3RZWC 5G5HA 3U4EG 4C00A 4REZA 2KOXA 3QHTA 4YXDB 3RZFA 3A9KA 4RGNA 2BQQA 4KGRA 2Z59B 4C4VB 1AARA 3QQ8B 3B2GA 4RGTA 2L0FA 5G55A 3I9V1 1S3SG 3R3MA 4KZ0A 5EE9A 5AUKA 4JWSC 4PYUA 2V3NA 3GP7A 4OVUA 4ZHPA 1BT0A 2N7DA 1V86A 3H7PB 1T6BX 3TCAA 4TKNA 3H8HA 4R3DA 3NG0A 2BBCA 4US9A 2LGSA 3UQAA 4FBJB 3TEYA 3DBRI 3Q8BA 4BKSD 3ZGZA 4GU2A 4W9EA 5BMGA 1R4MB 2JVCA 3HK0A 1AYFA 4II2B 3L08A 5CX3A 1YD8U 3RD2A 3T3OA 3RUIB 3ZVVA 2D3BA 2ZVOA 3WA0A 2HD5B 2MSED 3B9JA 1D5ZC 3WALA 3NVWA 2RD0A 1E0ZA 4L1BA 2ASQA 2KWDA 2IY0B 4HWIB 2MA9B 2CJOA 1OQRA 2DLBA 3ONSA 2KHWB 5IN7A 3PRMB 1T0YA 3IG3A 1EU3A 4GLSC 5FKAC 1NI2A 2BGFA 2V4IB 4ZOHC 3TEZA 3KUCB 1EM7A 1TYGB 3AE5B 1IPGA 5BMIA 2MWSB 3HHMA 1F9JA 3S2AA 2D07B 2JYEA 3ML8A 2CJNA 2DNFA 2INDC 3NOBA 1L7YA 2KWUB 3QK0A 2RPQA 3NVYA 3RNEC 4ANUA 4MSMB 1WYWB 1HTQA 1XLNA 3TL5A 1JWMD 2J0JA 4ITKA 2JY6A 5G2NA 1R7SA 4NY0A 2GRIA 3LJ3A 2B3AA 2WXOA 4B95A 4K7SA 3AU4A 4ZHOA 2O6VB 1WX8A 3MC9A 2WXKA 3V05A 4JLCA 2QMTA 4L23A 1QKZA 4F8CB 2LJIA 4A8XC 3MJ5A 4P1BC 1DOYA 3AE9B 3IT6B 3JSVB 1UNSA 3DHIC 1E5WA 4FJZA 2KX0A 2GLSA 3AV8A 3VFKA 3Q6BA 3WCQA 2WWZA 1WGGA 4WJPA 4RM8A 3HM3A 3PZ8A 4HKZE 3N3KB 1WI0A 2NPTA 2XN9C 4RH6A 1BXTA 4XX5A 1Z5SB 2IPKD 1PGAA 3A1QB 3QARA 4MGKE 3Q2AC 2OJWA 1XEEA 2BF8B 3AE1B 1KLGD 1U4AA 2GMIC 1HZ6A 2M8SA 1WGDA 1NDDA 1C3TA 1RYJA 2DZIA 1I7HA 2A5UA 3Q8EA 3ENEA 5C23A 4EUTA 1RLFA 5D6JB 3M95A 1FXIA 3NZSA 4P16A 1MHXA 2MP2B 4TSSA 2ZPYA 1IP9A 4MGIE 2AQ3B 3AE8B 1MPEA 3KWLA 4B0MA 4WWPA 4NJCA 2PE6B 1IYFA 4A20A 5IOIA 4P1CC 2ZW1A 4P6VF 2DZMA 2IZVB 3U7DA 3FAHA 5JHAA 3QAQA 4GN1A 3C8YA 3NHEB 3K9PB 1E7UA 4N6EB 2FCMA 4PS3A 5CHWA 5E6OA 2IDYA 3IAS1 2WLBA 1UGJA 1H4RA 1GG3A 1KJTA 2FCNA 2NBVB 1OGWA 3ZTCA 5JXVA 4G11A 1TS4A 2NBWB 3AEDB 5LXHA 1GB1A 3APCA 2N7JA 5D2MB 2V4LA 4K7UA 3SU8X 4S0RA 2INCC 2LASA 3R7QA 3W5UB 2J0MA 4M0WA 3OAWA 1A5RA 3ZO5B 4BVUC 3O65B 4A3PA 3SD5A 1AW7A 4LNOA 4MM3B 2KDIA 3EFUA 3ZYYX 1EU4A 4HCNB 3DBHB 1V2YA 2LUMA 3V6EB 4US8A 4AS1A 2W3RA 3N1XC 2BWES 2J0KA 1TT5B 3B0AA 4C7ZA 4YT0B 4IM2A 1MJDA 3V60A 2J7QB 1V8CA 3ZNGC 2KVZA 4JQWC 5DPSA 1YMHE 1G6JA 4WAAA 2IGGA 5C1ZA 3DWGC 2FUHB 1GJZA 2KDEB 3CIRB 2BB6A 1QF6A 4YSXB 2BW2A 2JQRB 1V6EA 3PLUA 4KSLC 2WXGA 1L4ZB 2BYTA 1FCCC 1JRUA 4IW0A 3EC8A 5HKHA 3KQ4A 2K8CA 1ROEA 1VZ6A 1WX7A 3UGBB 4LJOB 3NVZA 4N59A 1XD3B 3TEXA 1WWTA 4AJYB 2DAFA 3L10B 3L54A 4XDCA 2ZEQA 4FHKA 1FNWA 1WZ3A 5HHDG 1D5XC 2C5LC 4OZAA 1V49A 2MW5A 3ZUNA 1PYWD 3PZ7A 1C79A 3ZNHB 5MPOA 1XT9B 1F0ZA 1V5OA 1Z2MA 1WGRA 3ML9A 4XZ4A 1DYQA 2RDHA 3BVGA 3BK2A 5L95C 1FXAA 2CHZA 4JWUC 1WGHA 2BWFA 2G4DB 3VHTC 1YX5B 1WJUA 1AN8A 1ZUD2 4NJ7A 3DQVA 1N5WA 3N32A 2LVQA 4G0NB 2MBOA 2FIFA 3TJPA 3ZW3A 3L0WB 3ZNID 2RPVA 4JX1C 5IAAC 3H7PA 1HXYD 1ACCA 1ZW7A 2OEDA 4FN2A 3W1SC 3E56A 1D3ZA 2V1YA 1R4MI 3AE6B 4PYZA 4WQMA 4C4VA 4BFRA 1KH0A 4DDID 2PPHA 3P4SB 2KNBA 2PVOD 1HQRD 1PDXA 3GE8C 1YQ3B 1MI0A 2Z0EB 4LDTB 3VQIA 3AXCA 4JIOU 2FNJB 1WRIA 2LHDA 1CMXB 4KVGB 1PUTA 4FHJA 1UUPA 4NQLB 4OZCA 4YTMB 4LNIA 5EDSA 4MACA 1E10A 2NTSA 4F7ZA 1K8RB 1VCBA 3BK1A 4KV2A 1ZE3D 5EE0A 1WE6A 3VH4B 2M0XA 2LMCA 1FXTB 1ZXHA 3PREA 2A4ZA 2LRUA 4WAFA 3RMKC 1T0SC 2KQ7A 3AU5A 2JYTA 3P4QB 3GE3C 2K39A 2KZRA 2WXJA 4ZYNA 2KN4A 2D10A 4AQ7A 1OEYJ 1FMAD 2AX5A 1D6EC 1QILA 2BS3B 4USAA 2BKRB 2K5PA 1GC6A 2JRIB 3WAPA 2WXRA 3SHQA 4W9KA 2M56B 2WXIA 1CK1A 4RF1A 1D4BA 3N1YC 3NZ3A 3WIMA 2LD9A 4HVBA 1KM7A 1OQYA 4MJSA 2MCNB 3U7ZA 2KLCA 1I35A 1E9MA 1HEZE 1F52A 3JW0X 3SDLC 2K25A 2LVOA 1JCKB 5IP4D 3QC8B 3ZDMC 1ZP0B 5D7GA 3W1YA 2ZPNA 1P9DU 2UU7A 3PHXB 4WWOA 2INNE 1N63A 3BYTB 5KHOA 3UINB 4AJWA 2FCQA 4WIPA 2NBUA 4WJOA 2G3QB 2KQ4X 1RRBA 3DPDA 3BVZA 4LNKA 2ZVNA 4KKJA 4MJSB 3A9JB 4WWMA 2UWQA 3PO0A 5JH5C 2NMQA 4I6PA 1P98A 2N9XA 2BTEA 2PEAA 3TMPB 2D3CA 2V0GA 1NI3A 1ZDVA 1R4NI 2L83A 2NR2A 1FRRA 1VR9A 1LM8B 4TQ1A 3NJTA 3P4PB 4DXAB 4M0WB 1J7AA 4PT5A 3X0WA 1WY8A 2RDBC 4IM0A 1SE9A 3CWIA 3PVLA 1KF6B 4RGMA 2UYZB 1TZOA 2Z0DB 3R8BA 4MH8A 3RNGC 3R66C 1J7BA 5BYRA 2Y5CA 2I38A 2AL3A 4RFBA 1I4RA 5LNK1 3RI7C 2WQYB 3DOWA 3AH7A 2LZ6A 2XNAC 4W9DA 2IO1B 5GMVA 1LFDA 4G50A 1WR6E 1L2NA 1IGDA 2WDVB 1FIQA 4HPMB 1SE2A 2MJDA 3PLVA 4YWGG 1PQSA 3T9LA 3I63C 1N6ZA 4OHJA 4BBNF 3EFCA 2YEPB 2J52A 2PMVA 3KYDD 3L13A 4RNAA 1FCLA 1XLPA 1F77A 3TSSA 3PPAA 3SFDB 1JWBD 2WXQA 2KTRA 1SJHD 4PS7A 1RM6C 1L5PA 1JWAD 2FCSA 1NBFC 3CMMB 3W2DA 1FD6A 2NCNA 3ZJUA 1TY2A 1JW9D 2KJ6A 3LXFA 4DDGD 4MSQB 2JF5A 1C4CA 1I42A 1R4NB 3P1MA 5AEKB 1QT9A 1FPYA 4K3CA 4AUQC 4IDIA 2JUOA 4A3OA 4EKUA 2JX5A 2AYOB 2PIAA 2ZJDA 1XF5L 2KDMA 3ZTDA 3JYUA 1FFUA 2FE8A 4CO7A 2DX5B 2HJ8A 2KXJA 3AEBB 2CS4A 4W9CA 4O1NA 2KQSA 1QQRA 2GB1A 1WXAA 2KWVB 1J0GA 4IOIE 3TUOA 2LRWA 2MH7A 1YNTE 4EOYA 4A55A 5E6PA 4GDKB 5HFYA 3HIZA 3O13A 4TUUA 2O6VD 1T3QA 4N9F4 4B6WA 2HTHA 1L4DB 1WGYA 5T8IA 3VRBB 4HKQA 1UF0A 5IA7A 2KDFB 4MELA 1JALA 3NRZA 2KAJA 3C0RB 3PV1A 3QX1A 1ZDXA 4HJKA 5EE1A 3W5VB 1E8WA 2MJ3A 2L32A 4ZDVA 1XO3A 2KMCA 3VRAB 1WXSA 4LDTD 4MT5A 3IVFA 1EF1A 2MLBA 4II3B 1I4GA 4CYEA 1K50A 3PZDA 3E9SA 1STEA 3A4SC 1WH3A 1TZ1A 2VH1A 2WP9B 3RULA 4F1SA 2INPE 1QOAA 3R7RA 5JZEB 4CHKA 3VUXA 4IWPA 3ZLZA 1Y56A 3ZNZB 3AN1A 1B9RA 3QJZA 2IGDA 2WDRB 2DYOA 3AE4B 1TGZB 2QDFA 4FJVB 2GBRA 3OLMD 2DAJA 3HM6X 3K9OB 1I4QA 1ZPSA 2N9EB 3L4PA 4NZLB 4FA6A 2M0AA 2YLMA 2AWTA 3AM9A 1TIFA 3PT2B 2K9XA 3N1ZC 2LWPA 5KHQA 3AMZA 4UDUC 1FM0D 3T8MA 3VVWB 2YVCA 3NZUA 4GDKA 3N20C 3A4RA 1NENB 5E6NA 4FLHA 4NQKE 2D11A 3WAMA 4AP4C 4KIKB 1DGJA 2CHWA 4GMVA 3Q8AA 3TBLD 1GUAB 3V3XA 1C77A 3IAM1 4HJGE 4HDOA 2ONQA 2K8HA 2QJLA 1XCQL 2KACA 2BB5A 2N1WA 1WXMA 2N7EA 1UBIA 2JWUA 1ZOYB 3W9CB 3KLSX 5H92C 5JHBA 2LEKA 2RSUA 1NYQA 4NAMA 1S1QB 2IYDB 2LUEA 3UI3A 4OW0A 1VDVA 3EGRA 3IXSA 4HPLB 4I6NB 2KTRB 1WM2A 1NEKB 1YIWA 4EZLA 3ECIA 1KLUD 1CQVA 4XDDA 3VUYA 5J2RA 3DVGX 2ZZPB 1HZ5A 1WMHA 4HLEA 4DBGA 2WX0A 4W9IA 3JVZX 3LB8C 3A33B 3DCGA 1N62A 1YN3A 1JROA 2MEKA 2MQJA 2C7HA 1HE8A 3A1QA 1P7EA 3KH0A 3MC8A 3DBSA 4KZCA 4MDKE 1WE7A 3DWMA 2M4NA 1ENFA 2C60A 2L05A 3I5JC 4J6IA 2KMMA 1E8YA 4ACFA 2KDBA 2MBEA 1P0RA 2WYQA 5FR3A 3UF8A 3Q3JA 1YJ1A 1WYGA 3RPFC 2JXXA 2OOBB 1ZXIA 3EA6A 2C9WB 3JSVA 3Q8FA 1C4PA 2KFKB 4FULA 4ARIA 1V81A 4TMAB 3VTVA 1YOVB 3RCZA 5FK9C 4W9FA 2L00B 1V1PA 5J18A 1FNVA 1F1HA 3ABVB 1V80A 3QWZB 2QHOA 2CU3A 3KUZA 4WWNA 4J3OD 3A9JA 2PVGC 3M63B 4LNFA 3BWUD 1RFKA 3SR6A 1C78A 1TKGA 5G5GA 3NY5A 1SBBB 3VR8B 4HK2A 5BYQA 4DXGA 4ZRKA 4L2YA 3T3NA 2Y5BB 2KD0A 1WJ6A 2LVPA 2KJRA 3B08A 1WXQA 2SEBD 5CHVC 2L52A 3VTWA 1BUIC 1E8XA 3Q3MC 2CU1A 2W54A 4W9JA 3IFWB 3Q3FA 1Q1OA 4FXCA 2N9PC 2B76B 2XK5A 3IT4B 4S17A 4M8NA 1I4XA 1DOXA 3DVNV 1V9JA 1UH6A 2K6DB 2PJHA 4K7WA 3PHWB 1XQQA 1YX6B 3VR9B 3NUHB 3AULA 4CQNA 4M01A 2W82A 3BZDB 5C2TB 1J19A 2REXA 4PS8A 4FADA 2LGIA 2W9NA 3TEWA 4C7YA 2K1FA 3FILB 5D94A 3VTUA 4LTUA 1IGCA 2J42A 2IBIB 5IKCM 1B1ZA 5BYSA 1L6UA 2K0PA 2RR9A 4WJNA 3SEBA 1I4HA 1JWUD 3PRZA 3AE2B 4RM9A 4DHJD 1FO4A 3OWEB 3D32A 3HVZA 2HTME 4EFOA 1WZ0A 1OQQA 3UQBA 3AEAB 1V5TA 1EO6A 1LXDA 1WGKA 3ETRA 3HUIA 2RDGA 3APFA 1NYRA 2ACZB 1L6VA 3KUDB 1OEYA 1UBQA 3RN9C 2W3SA 2V3PA 2JPHA 1C76A 3I57A 1P7FA 1T5XD 4ASWC 3ZQ4A 1J8CA 4KGSA 1SF0A 3QIJA 2RMMA 2KO3A 4YL8A 1WIAA 2O2VA 2WXHA 3DHHC 5J17A 4NAWA 2O2VB 4XC2A 4QAYA 1FFVA 1SGHA 4FJYA 3Q3NC 3EUB2 5DPRA 2DYMA 4IC7B 3BVMA 1WFYA 2R61A 1H8CA 1E6EB 1TKEA 1TBEA 1SXTA 5TSSA 4YTPB 3AE7B 2QILA 2IGHA 1WXVA 2LGXA 3OG5A 5EE3A 3C19A 4GB9A 4WQOB 3ZRCA 2QIEB 4HDQA 1LO5D 3RNAC 3DBLI 4KSKC 1VZ7A 5LLIA 1F2RI 3DBHI 4DHZB 2GBJA 4EE2A 5HI1A 1V97A 4WURA 2EMTA 4K1RB 1XXGA 3EHVA 5AZGA 5GXGB 1TS3A 3RNCC 4AOFA 2R2QA 4D2KA 3IHPC 2VH2A 2GBKA 2BYVE 1VJKA 4MEMA 3ZJVA 5DPTA 2D2QA 4EZJA 2EMSA 1JQ4A 4GIVA 1ET6A 1X1MA 2L3ZA 1JWSD 2JXTA 3AB5A 2BYEA 2KYWA 1XLOA 3VH3B 3WANA 2DWQA 3GZNI 2KKCA 4JPSA 1KTKA 1EWCA 3Q14C 2CHXA 4BZAA 1GC7A 2BT6A 3UIPB 2E3TA 5C3JB 2MBQA 1EWYC 1ET9A 4KGTA 4GDLA 4MGYE 1ZKHA 2MBHA 1EUVB 2G1EA 1WSPA 1A70A 3AEEB 2QEJC 3H1UA 4BOZB 2MJEA 2PTLA 5BMHA 4NPNA 4W9HA 1VRAB 3V61A 2LI5A 1XCTL 2IO3B 2JZZA 3ZJTA 1ISNA 3KVFB 2BVCA 3VUWA 3EECA 4DHJB 2H89B 2OHFA 1V1PB 2NS5A 2CKHB 3ZRFA 3H7SA 1TKYA 1UWXA 3KWVA 4IKGA 4XWWA 2K6QA 3LYYA 3V62A 4MM3A 2W55A 2MHJA 2I1KA 2KFKA 2HE7A 1C9FA 4ANXA 4HROA 3MJWA 2LFIA 1GPXA 3AE3B 2KWCA 3DVGY 3PSEB 3QA8A 3H6NA 4P7IA 2Y5PA 4M02A 2D3GA 1T0QC 2Y3AA 1QOGA 1NVID 1YQ4B 2GBMA 1P1AA 4YTNB 1E7VA 2V3SA 2NTTA 4LCDE 2G9HD 1YN4A 1SIFA 4XE0A 2KC2A 4DHZE 3VDZA 4I6LB 2KFJA 4HPPA 2BS4B 3DBRB 2PE9A 4ICVA 3B2FA 5BO4B 2K8BA 3ZIMA 1WMHB 3NVVA 4IUMB 5D3IB 2QSDA 2LXCA 2SAKA 5CHFA 1QOBA 2WU2B 1WF9A 3FC4A 1PFDA 1SEBD 2GBNA 2ZNVC 3ZXRA 2MP2A 1T0RC 2KC1A 2WXFA 2DYBA 4BKSA 4A6QA 4DQOC 2IY1B 4IM3A 2WU5B 4B0EA 3MFGA 5AZHA 1VD2A 3URYA 1L0VB 1SB3C 2N1VA 2LGDA 2RGFA 3MP9A 4ZYSA 4IG7B 3CF6E 4HCPB 2DZJA 5CTRC 2KMAA 2D5GA 3B1LX 4XWTA 1WM3A 2FAZA 2XEWA 1IBXB 2NPTB 1UWMA 4IWQA 2VZKD 2IO0B 2JRHA 3BIID 2YEPF 3Q3OC 2HDEA 1BMLC 2M19A 2VZKB 2QC8A 4KIKA 1KOTA 5I4DA 2KJHB 4YSZB 2KX3A 3MHSD 1C4AA 3ZDTA 3MC0B 2EKEC 3FKYA 1MFWA 1Q0WB 2BS2B 4WH4A 4ZRJA 1MVKA 2HJ1A 4KDLB 2CR5A 2JSVX 2O6VA 3PGEA 4BAXA 2C7NB 2JZ3B 5E6JA 2WXMA 1OFFA 2BPSA 5DPWA 4MH0E 3GB1A 2WNMA 4ICUA 2BKFA 2WXNA 3Q8CA 3VXWA 2WDQB 1ZGUB 2N9KA 2ZCCA 1GOZA 3RNBC 4TV3A 2K3UA 1XLQA 2J4XA 4RMAA 3P4RB 4Q2JA 3V6CB 4GDLB 4X57B 4KKIA 2N9LA 5IO9A 1K51A 1TS2A 4GXBA 1WR1A 3RT3B 2M1MA 1QOFA 1TTNA 1SJED 4ARCA 3U2SC 2C7MB 3DHGC 4DWFA 2X8XX 1HTOA 1RWSA 1MG8A 4ZRQA 4DXFA 5L83A 3Q69A 2Z8LA 3PTFC 3J9CA 3N9YC 2L76A 1HA5A 4HXDA 3L17A 4XYCA 2ON8A 1VZ8A 3HVDA 4HRSA 3AEGB 3RYTA 3U52E 1SIJA 3P42A 1N5XA 3L16A 2ZCBA 1LQBA 2KT7A 3GS2A 2IO2B 3KYCD 3R2TA 4ANVA 4ZRPA 1CZPA 4W9LA 3U30A 4JL9A 4DK5A 1IBXA 2MX2A 3P2BA 2KANA 3P63A 2WXLA 1D5MC 3SFEB 3APDA 2WS3B 1TS5A 2JWZA 3HRDD 4M00A 2WXPA 2LJ5A 1C1YB 4KDIC 4ANWA 1F2RC 2GOWA 1CJEA 1OTRB 4E3CA 4BKGA 2TSSA 1FEHA 4JE3B 1Q10A 2ZNVB 5HG2A 2KLGA 3GZNB 2LGYA 4LLGM 4BOSC 2BYFA 1KFYB 3A9KB 4XGAB 2AEHA 2MRPA 2WDTB 3BYYB 4NAWB 1V1OA 4BKTA 1P3QU 3GOEA 1SE3A 1SE4A 2KTFA 2FIDA 3M62B 1K53A 4EZKA 2DZKA 2E6XA 3LDZE 3M3JA 5DCNA 1JMLA 2Q5WD 3AI5A 4TQ0A 3ZKJC 3TIXA 3CSFA 1JRPA 1WJ4A 2H88B 2IJ0A 1MG4A 4C56C 2WX1A 2L0TA 3KW5B 2KK8A 4NNJB 1YN5A 1AWDA 1E8ZA 2EKIA 1TJEA 3RNFC 1PGXA 2NVUI 3AEFB 4GGQA 2JT4B 2JU6X 3R2IA 2JZPA 3BY4B 3DBLB 4OVZA 4LJPB 4URKA 2FBWB 3FILA 3BINA 2L1AA 1Q5WB 1ESFA 3OJ3A 1J7CA 2L8JA 2AQ2B 1DOIA 1UD7A 1SSNA 4B9KA 1Y8RC 1GAQB 4ZRIA 1E90A 3DDCB 3U8ZA 4NJ6A 1QZEA 4LNNA 4A9AA 3N30A 3CSTA 4E71A 4K3BA 2VRRB 2G4SA 4OVVA 5FR6A 1VLBA 2AQ1B 1KLVA 2GI9A 3IBEA 4KX6B 4C80A 2WGSA 3H9DA 1YJJA 1WX9A 3NS8A 2LHEA 4H2AA 2XK5B 3NS1A 2D3AA 3WAOA 4GSWA 2PLPA 2KVRA 4E74A 2DBYA 4EEWA 2M17A 3ZXVA 1WRDB 3RFZB 2I1JA 3X23A 2N4FA 1K52A 5AZFA 1UELA 1UGMA 2PW9A 1MHHE 2X38A 1YQBA 2ZW0A 1E7PB 1UZXB 3I3TB 1KRHA
chains in the Genus database with same CATH topology
3VUXA 1WX7A 4IWPA 3UGBB 2IO3B 3ZLZA 3ZNZB 2JZZA 4LJOB 1ISNA 3QJZA 1GNUA 2DYOA 1TGZB 3KVFB 1RFAA 3EECA 3VUWA 1XD3B 4FJVB 4AJYB 4DHJB 2L7RA 2DAFA 2GBRA 3L10B 3L54A 3OLMD 3PS6A 2DAJA 3HM6X 3K9OB 2N9EB 2ZEQA 4FHKA 4FA6A 1EF5A 2YLMA 2AWTA 2LXAA 1WZ3A 3PT2B 2NS5A 2CKHB 2LWPA 3ZRFA 2C5LC 5KHQA 3H7SA 1V49A 2MW5A 3QCAA 3T8MA 3ZUNA 3VVWB 2K6QA 2YVCA 3V62A 2DHZA 3NZUA 4GDKA 4MM3A 2I1KA 3PRPB 3ZNHB 3A4RA 5E6NA 4FLHA 1XT9B 2KFKA 4BBNC 4NQKE 1V5OA 2HE7A 2D11A 4G3XB 1Z2MA 1WGRA 3WAMA 3ML9A 4W9GA 4XZ4A 5LXIB 4AP4C 4ANXA 4KIKB 1M94A 2CHWA 3MJWA 5L95C 4GMVA 2CHZA 2KWCA 1WGHA 2BWFA 2G4DB 3DVGY 3PSEB 4GOCA 2KN5A 3QA8A 3H6NA 4P7IA 3VHTC 2AL6A 2MBBB 1YX5B 3ALBA 3TBLD 4AWJA 3MTNB 1GUAB 1WJUA 2D3GA 4JGHB 2DENB 4NJ7A 3DQVA 3N32A 4HDOA 2LVQA 4G0NB 4M8MA 2MBOA 2FIFA 2K8HA 2GBMA 1P1AA 3TJPA 3ZW3A 2OJRA 1RAXA 1E7VA 3L0WB 4K81A 2V3SA 4LCDE 3DVNU 5TR5A 3UIOB 3ZNID 4MGZE 1SIFA 2KC2A 1WJNA 4DHZE 4WJQA 2G45B 5IAAC 2N1WA 3H7PA 3VAWA 3VDZA 4I6LB 1WXMA 2KFJA 2N7EA 1UBIA 1ZW7A 3OJ4B 2PE9A 4ICVA 5JHBA 4FN2A 3W1SC 5BO4B 2K8BA 3ZIMA 1WMHB 4IUMB 2RSUA 4IWOA 3W1SA 1D3ZA 2V1YA 2LXCA 1S1QB 2IYDB 1R4MI 2LUEA 2R2OA 4PYZA 5CHFA 2XBBC 4BFRA 3RZWC 4DDID 2PPHA 1WF9A 2KNBA 2GBNA 4HPLB 4I6NB 2KTRB 1WM2A 2ZNVC 1YIWA 2MP2A 2KOXA 2KC1A 3ECIA 4EZLA 3QHTA 2Z0EB 4LDTB 3RZFA 3VQIA 3AXCA 3A9KA 4JIOU 2FNJB 3VUYA 2DYBA 2Z59B 4BKSA 5J2RA 1CMXB 1AARA 2IY1B 3DVGX 3QQ8B 2L0FA 2ZZPB 4IM3A 4KVGB 5G55A 4FHJA 1WMHA 4NQLB 1S3SG 5AZHA 3R3MA 1VD2A 4DBGA 2WX0A 4HLEA 2N1VA 4KZ0A 2LGDA 4W9IA 2RGFA 3JVZX 3A33B 5EDSA 4PYUA 3DCGA 4OVUA 1BT0A 4F7ZA 1K8RB 1VCBA 1V86A 2N7DA 2MQJA 3H7PB 2C7HA 4IG7B 1HE8A 3TCAA 3A1QA 3CF6E 4TKNA 4HCPB 2DZJA 3KH0A 5CTRC 2KMAA 4KV2A 3B1LX 3DBSA 4KZCA 1WM3A 1WE7A 2FAZA 1WE6A 2XEWA 4MDKE 2NPTB 3VH4B 4FBJB 3DBRI 3UQAA 2M4NA 4BKSD 2M0XA 4IWQA 1FXTB 2IO0B 2JRHA 3PREA 2C60A 4GU2A 2A4ZA 2LRUA 2L05A 4J6IA 4W9EA 1E8YA 2KDBA 2MBEA 1P0RA 2KQ7A 2WYQA 2JVCA 3AU5A 3HK0A 4II2B 3L08A 3UF8A 3Q3JA 5CX3A 1YD8U 3RD2A 3RUIB 4KIKA 1YJ1A 3ZVVA 1KOTA 2JXXA 2KJHB 2OOBB 2KX3A 3MHSD 2ZVOA 3WA0A 2HD5B 3ZDTA 2C9WB 2KZRA 2EKEC 2K39A 2MSED 3JSVA 4ZYNA 2KFKB 2D10A 1OEYJ 3WALA 4FULA 1Q0WB 2RD0A 2BKRB 4ZRJA 1V81A 1GC6A 3VTVA 2JRIB 3WAPA 3SHQA 4W9KA 3RCZA 4W9FA 2ASQA 2IY0B 4KDLB 2CR5A 2O6VA 3PGEA 4HWIB 2MA9B 2L00B 5J18A 2C7NB 2JZ3B 3ONSA 1V80A 3WIMA 3QWZB 2KHWB 2QHOA 2LD9A 2BPSA 1KM7A 3KUZA 3PRMB 4HVBA 4WWNA 1T0YA 3IG3A 3A9JA 5DPWA 1OQYA 4MJSA 3M63B 4MH0E 2MCNB 2KLCA 1I35A 1NI2A 2BGFA 3JW0X 3SDLC 3NY5A 2K25A 2LVOA 3KUCB 4ICUA 4HK2A 2BKFA 3VXWA 3QC8B 4ZRKA 3ZDMC 1ZGUB 2ZCCA 2Y5BB 2KD0A 1WJ6A 5D7GA 3W1YA 4TV3A 2LVPA 2KJRA 2ZPNA 1IPGA 1P9DU 4WWOA 3PHXB 3B08A 4RMAA 5KHOA 5CHVC 2MWSB 3HHMA 3UINB 4AJWA 1F9JA 3VTWA 2FCQA 1E8XA 2NBUA 4WJOA 4GDLB 3V6CB 3S2AA 2CU1A 2D07B 2G3QB 4W9JA 4X57B 3IFWB 3ML8A 3Q3FA 1RRBA 3DPDA 1Q1OA 2N9PC 3NOBA 4GXBA 1L7YA 2XK5A 2KWUB 1WR1A 2RPQA 2ZVNA 3QK0A 3RT3B 4MSMB 4ANUA 1WYWB 3TL5A 4MJSB 2J0JA 2M1MA 3A9JB 2UWQA 2JY6A 5JH5C 4M8NA 1TTNA 5G2NA 4I6PA 1P98A 2N9XA 4NY0A 3DVNV 3LJ3A 1V9JA 2C7MB 1UH6A 4DWFA 2B3AA 4B95A 2K6DB 2PJHA 4K7SA 2PEAA 3AU4A 4K7WA 2O6VB 3PHWB 1MG8A 1XQQA 1WX8A 1YX6B 3TMPB 5L83A 3AULA 4JLCA 3PTFC 1R4NI 2L76A 2NR2A 1J19A 2REXA 4PS8A 4F8CB 4FADA 4HXDA 1LM8B 4TQ1A 3L17A 2W9NA 3RYTA 4DXAB 4M0WB 3X0WA 1WY8A 3JSVB 2K1FA 4IM0A 4FJZA 1E5WA 3L16A 1SE9A 2KX0A 2ZCBA 1LQBA 3PVLA 5D94A 3VTUA 3VFKA 2UYZB 2Z0DB 2IO2B 3KYCD 3R66C 2IBIB 2WWZA 1WGGA 4ANVA 4WJPA 4RM8A 2RR9A 4W9LA 2AL3A 4WJNA 3U30A 3HM3A 4JL9A 4DK5A 3N3KB 1WI0A 3PRZA 4RM9A 2NPTA 3DOWA 4DHJD 2MX2A 3P2BA 2KANA 2LZ6A 3D32A 4W9DA 4EFOA 3APDA 2IO1B 4XX5A 5GMVA 1Z5SB 1WZ0A 3UQBA 1LFDA 2JWZA 1V5TA 4G50A 3A1QB 3QARA 4MGKE 1EO6A 1LXDA 1WR6E 2LJ5A 1L2NA 2BF8B 3APFA 1C1YB 1U4AA 4KDIC 4ANWA 3KUDB 2GMIC 1OEYA 2M8SA 4HPMB 1UBQA 2GOWA 1OTRB 4E3CA 4BKGA 2JPHA 1WGDA 1NDDA 3PLVA 1C3TA 1PQSA 3T9LA 2ZNVB 4ASWC 2DZIA 4BBNF 2A5UA 1J8CA 2KLGA 2LGYA 3QIJA 3ENEA 2KO3A 3KYDD 3L13A 4YL8A 5C23A 4BOSC 4EUTA 2BYFA 1RLFA 1WIAA 2O2VA 3A9KB 3M95A 2AEHA 3NZSA 3PPAA 5D6JB 5J17A 2MRPA 2WDTB 4NAWA 4NAWB 4BKTA 2MP2B 2O2VB 2KTRA 4XC2A 1P3QU 4PS7A 2ZPYA 3GOEA 1IP9A 4MGIE 1SGHA 2KTFA 2FIDA 4FJYA 3M62B 4WWPA 2FCSA 1NBFC 3CMMB 5DPRA 4EZKA 2DYMA 2PE6B 2DZKA 1IYFA 4A20A 4IC7B 3LDZE 2NCNA 3M3JA 1WFYA 5DCNA 3AI5A 2KJ6A 2DZMA 1H8CA 2IZVB 3U7DA 4TQ0A 3ZKJC 3TIXA 3CSFA 4DDGD 3QAQA 4GN1A 5JHAA 1TBEA 4MSQB 3NHEB 2JF5A 1WJ4A 3K9PB 1E7UA 1I42A 2FCMA 1WXVA 2LGXA 4PS3A 5AEKB 2WX1A 5CHWA 4GB9A 4WQOB 4AUQC 2JUOA 3ZRCA 5E6OA 2L0TA 3KW5B 4HDQA 4A3OA 2KK8A 4NNJB 4EKUA 2AYOB 2ZJDA 1H4RA 3DBLI 4KSKC 1GG3A 1E8ZA 5LLIA 3ZTDA 1KJTA 2FCNA 2NVUI 2NBVB 1OGWA 4GGQA 2JT4B 3ZTCA 3JYUA 3DBHI 4G11A 4DHZB 2GBJA 4CO7A 2NBWB 3BY4B 5LXHA 2DX5B 2HJ8A 3APCA 5D2MB 2KXJA 2V4LA 4K7UA 2CS4A 4W9CA 4LJPB 2KQSA 4URKA 3V61A 3SU8X 1WXAA 2KWVB 1J0GA 2EMTA 2LASA 3R7QA 4K1RB 3BINA 2J0MA 2LRWA 1Q5WB 3OJ3A 2L8JA 3OAWA 1UD7A 1A5RA 3ZO5B 4EOYA 3EHVA 5AZGA 4B9KA 4BVUC 3O65B 1Y8RC 5E6PA 4A3PA 3SD5A 4ZRIA 4AOFA 2R2QA 4GDKB 2KDIA 3EFUA 3IHPC 1E90A 3HIZA 3DDCB 2GBKA 4NJ6A 3U8ZA 1QZEA 4HCNB 4TUUA 2O6VD 3N30A 3CSTA 4E71A 2BYVE 1V2YA 4N9F4 4B6WA 3V6EB 2HTHA 4MEMA 5DPTA 2D2QA 1WGYA 4EZJA 2VRRB 2EMSA 2BWES 2J0KA 4GIVA 2G4SA 4OVVA 5FR6A 1X1MA 5IA7A 2L3ZA 3B0AA 1KLVA 2BYEA 4IM2A 3IBEA 3V60A 3VH3B 2KDFB 4MELA 3WANA 3H9DA 1WX9A 2J7QB 3NS8A 3C0RB 3ZNGC 3PV1A 3QX1A 4HJKA 3GZNI 2XK5B 2KKCA 2CHXA 4JQWC 5DPSA 1E8WA 1GC7A 4WAAA 1G6JA 3UIPB 3WAOA 4ZDVA 5C1ZA 2FUHB 4GSWA 2KMCA 2MBQA 1WXSA 2KVRA 4E74A 1GJZA 2KDEB 4GDLA 4MGYE 1ZKHA 4LDTD 2MBHA 3IVFA 4EEWA 1EF1A 2M17A 2MLBA 1WRDB 4II3B 1V6EA 1EUVB 4CYEA 3PLUA 3PZDA 4KSLC 2I1JA 3A4SC 3X23A 2N4FA 1WH3A 1TZ1A 5AZFA 1JRUA 1UELA 3H1UA 4IW0A 4BOZB 3EC8A 3RULA 1UGMA 4F1SA 5HKHA 1YQBA 4NPNA 4W9HA 3R7RA 1UZXB 3I3TB 5JZEB 2K8CA 2LI5A 4CHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUX A;  1WX7 A;  4IWP A;  3UGB B;  2IO3 B;  3ZLZ A;  3ZNZ B;  2JZZ A;  4LJO B;  1ISN A;  3QJZ A;  1GNU A;  2DYO A;  1TGZ B;  3KVF B;  1RFA A;  3EEC A;  3VUW A;  1XD3 B;  4FJV B;  4AJY B;  4DHJ B;  2L7R A;  2DAF A;  2GBR A;  3L10 B;  3L54 A;  3OLM D;  3PS6 A;  2DAJ A;  3HM6 X;  3K9O B;  2N9E B;  2ZEQ A;  4FHK A;  4FA6 A;  1EF5 A;  2YLM A;  2AWT A;  2LXA A;  1WZ3 A;  3PT2 B;  2NS5 A;  2CKH B;  2LWP A;  3ZRF A;  2C5L C;  5KHQ A;  3H7S A;  1V49 A;  2MW5 A;  3QCA A;  3T8M A;  3ZUN A;  3VVW B;  2K6Q A;  2YVC A;  3V62 A;  2DHZ A;  3NZU A;  4GDK A;  4MM3 A;  2I1K A;  3PRP B;  3ZNH B;  3A4R A;  5E6N A;  4FLH A;  1XT9 B;  2KFK A;  4BBN C;  4NQK E;  1V5O A;  2HE7 A;  2D11 A;  4G3X B;  1Z2M A;  1WGR A;  3WAM A;  3ML9 A;  4W9G A;  4XZ4 A;  5LXI B;  4AP4 C;  4ANX A;  4KIK B;  1M94 A;  2CHW A;  3MJW A;  5L95 C;  4GMV A;  2CHZ A;  2KWC A;  1WGH A;  2BWF A;  2G4D B;  3DVG Y;  3PSE B;  4GOC A;  2KN5 A;  3QA8 A;  3H6N A;  4P7I A;  3VHT C;  2AL6 A;  2MBB B;  1YX5 B;  3ALB A;  3TBL D;  4AWJ A;  3MTN B;  1GUA B;  1WJU A;  2D3G A;  4JGH B;  2DEN B;  4NJ7 A;  3DQV A;  3N32 A;  4HDO A;  2LVQ A;  4G0N B;  4M8M A;  2MBO A;  2FIF A;  2K8H A;  2GBM A;  1P1A A;  3TJP A;  3ZW3 A;  2OJR A;  1RAX A;  1E7V A;  3L0W B;  4K81 A;  2V3S A;  4LCD E;  3DVN U;  5TR5 A;  3UIO B;  3ZNI D;  4MGZ E;  1SIF A;  2KC2 A;  1WJN A;  4DHZ E;  4WJQ A;  2G45 B;  5IAA C;  2N1W A;  3H7P A;  3VAW A;  3VDZ A;  4I6L B;  1WXM A;  2KFJ A;  2N7E A;  1UBI A;  1ZW7 A;  3OJ4 B;  2PE9 A;  4ICV A;  5JHB A;  4FN2 A;  3W1S C;  5BO4 B;  2K8B A;  3ZIM A;  1WMH B;  4IUM B;  2RSU A;  4IWO A;  3W1S A;  1D3Z A;  2V1Y A;  2LXC A;  1S1Q B;  2IYD B;  1R4M I;  2LUE A;  2R2O A;  4PYZ A;  5CHF A;  2XBB C;  4BFR A;  3RZW C;  4DDI D;  2PPH A;  1WF9 A;  2KNB A;  2GBN A;  4HPL B;  4I6N B;  2KTR B;  1WM2 A;  2ZNV C;  1YIW A;  2MP2 A;  2KOX A;  2KC1 A;  3ECI A;  4EZL A;  3QHT A;  2Z0E B;  4LDT B;  3RZF A;  3VQI A;  3AXC A;  3A9K A;  4JIO U;  2FNJ B;  3VUY A;  2DYB A;  2Z59 B;  4BKS A;  5J2R A;  1CMX B;  1AAR A;  2IY1 B;  3DVG X;  3QQ8 B;  2L0F A;  2ZZP B;  4IM3 A;  4KVG B;  5G55 A;  4FHJ A;  1WMH A;  4NQL B;  1S3S G;  5AZH A;  3R3M A;  1VD2 A;  4DBG A;  2WX0 A;  4HLE A;  2N1V A;  4KZ0 A;  2LGD A;  4W9I A;  2RGF A;  3JVZ X;  3A33 B;  5EDS A;  4PYU A;  3DCG A;  4OVU A;  1BT0 A;  4F7Z A;  1K8R B;  1VCB A;  1V86 A;  2N7D A;  2MQJ A;  3H7P B;  2C7H A;  4IG7 B;  1HE8 A;  3TCA A;  3A1Q A;  3CF6 E;  4TKN A;  4HCP B;  2DZJ A;  3KH0 A;  5CTR C;  2KMA A;  4KV2 A;  3B1L X;  3DBS A;  4KZC A;  1WM3 A;  1WE7 A;  2FAZ A;  1WE6 A;  2XEW A;  4MDK E;  2NPT B;  3VH4 B;  4FBJ B;  3DBR I;  3UQA A;  2M4N A;  4BKS D;  2M0X A;  4IWQ A;  1FXT B;  2IO0 B;  2JRH A;  3PRE A;  2C60 A;  4GU2 A;  2A4Z A;  2LRU A;  2L05 A;  4J6I A;  4W9E A;  1E8Y A;  2KDB A;  2MBE A;  1P0R A;  2KQ7 A;  2WYQ A;  2JVC A;  3AU5 A;  3HK0 A;  4II2 B;  3L08 A;  3UF8 A;  3Q3J A;  5CX3 A;  1YD8 U;  3RD2 A;  3RUI B;  4KIK A;  1YJ1 A;  3ZVV A;  1KOT A;  2JXX A;  2KJH B;  2OOB B;  2KX3 A;  3MHS D;  2ZVO A;  3WA0 A;  2HD5 B;  3ZDT A;  2C9W B;  2KZR A;  2EKE C;  2K39 A;  2MSE D;  3JSV A;  4ZYN A;  2KFK B;  2D10 A;  1OEY J;  3WAL A;  4FUL A;  1Q0W B;  2RD0 A;  2BKR B;  4ZRJ A;  1V81 A;  1GC6 A;  3VTV A;  2JRI B;  3WAP A;  3SHQ A;  4W9K A;  3RCZ A;  4W9F A;  2ASQ A;  2IY0 B;  4KDL B;  2CR5 A;  2O6V A;  3PGE A;  4HWI B;  2MA9 B;  2L00 B;  5J18 A;  2C7N B;  2JZ3 B;  3ONS A;  1V80 A;  3WIM A;  3QWZ B;  2KHW B;  2QHO A;  2LD9 A;  2BPS A;  1KM7 A;  3KUZ A;  3PRM B;  4HVB A;  4WWN A;  1T0Y A;  3IG3 A;  3A9J A;  5DPW A;  1OQY A;  4MJS A;  3M63 B;  4MH0 E;  2MCN B;  2KLC A;  1I35 A;  1NI2 A;  2BGF A;  3JW0 X;  3SDL C;  3NY5 A;  2K25 A;  2LVO A;  3KUC B;  4ICU A;  4HK2 A;  2BKF A;  3VXW A;  3QC8 B;  4ZRK A;  3ZDM C;  1ZGU B;  2ZCC A;  2Y5B B;  2KD0 A;  1WJ6 A;  5D7G A;  3W1Y A;  4TV3 A;  2LVP A;  2KJR A;  2ZPN A;  1IPG A;  1P9D U;  4WWO A;  3PHX B;  3B08 A;  4RMA A;  5KHO A;  5CHV C;  2MWS B;  3HHM A;  3UIN B;  4AJW A;  1F9J A;  3VTW A;  2FCQ A;  1E8X A;  2NBU A;  4WJO A;  4GDL B;  3V6C B;  3S2A A;  2CU1 A;  2D07 B;  2G3Q B;  4W9J A;  4X57 B;  3IFW B;  3ML8 A;  3Q3F A;  1RRB A;  3DPD A;  1Q1O A;  2N9P C;  3NOB A;  4GXB A;  1L7Y A;  2XK5 A;  2KWU B;  1WR1 A;  2RPQ A;  2ZVN A;  3QK0 A;  3RT3 B;  4MSM B;  4ANU A;  1WYW B;  3TL5 A;  4MJS B;  2J0J A;  2M1M A;  3A9J B;  2UWQ A;  2JY6 A;  5JH5 C;  4M8N A;  1TTN A;  5G2N A;  4I6P A;  1P98 A;  2N9X A;  4NY0 A;  3DVN V;  3LJ3 A;  1V9J A;  2C7M B;  1UH6 A;  4DWF A;  2B3A A;  4B95 A;  2K6D B;  2PJH A;  4K7S A;  2PEA A;  3AU4 A;  4K7W A;  2O6V B;  3PHW B;  1MG8 A;  1XQQ A;  1WX8 A;  1YX6 B;  3TMP B;  5L83 A;  3AUL A;  4JLC A;  3PTF C;  1R4N I;  2L76 A;  2NR2 A;  1J19 A;  2REX A;  4PS8 A;  4F8C B;  4FAD A;  4HXD A;  1LM8 B;  4TQ1 A;  3L17 A;  2W9N A;  3RYT A;  4DXA B;  4M0W B;  3X0W A;  1WY8 A;  3JSV B;  2K1F A;  4IM0 A;  4FJZ A;  1E5W A;  3L16 A;  1SE9 A;  2KX0 A;  2ZCB A;  1LQB A;  3PVL A;  5D94 A;  3VTU A;  3VFK A;  2UYZ B;  2Z0D B;  2IO2 B;  3KYC D;  3R66 C;  2IBI B;  2WWZ A;  1WGG A;  4ANV A;  4WJP A;  4RM8 A;  2RR9 A;  4W9L A;  2AL3 A;  4WJN A;  3U30 A;  3HM3 A;  4JL9 A;  4DK5 A;  3N3K B;  1WI0 A;  3PRZ A;  4RM9 A;  2NPT A;  3DOW A;  4DHJ D;  2MX2 A;  3P2B A;  2KAN A;  2LZ6 A;  3D32 A;  4W9D A;  4EFO A;  3APD A;  2IO1 B;  4XX5 A;  5GMV A;  1Z5S B;  1WZ0 A;  3UQB A;  1LFD A;  2JWZ A;  1V5T A;  4G50 A;  3A1Q B;  3QAR A;  4MGK E;  1EO6 A;  1LXD A;  1WR6 E;  2LJ5 A;  1L2N A;  2BF8 B;  3APF A;  1C1Y B;  1U4A A;  4KDI C;  4ANW A;  3KUD B;  2GMI C;  1OEY A;  2M8S A;  4HPM B;  1UBQ A;  2GOW A;  1OTR B;  4E3C A;  4BKG A;  2JPH A;  1WGD A;  1NDD A;  3PLV A;  1C3T A;  1PQS A;  3T9L A;  2ZNV B;  4ASW C;  2DZI A;  4BBN F;  2A5U A;  1J8C A;  2KLG A;  2LGY A;  3QIJ A;  3ENE A;  2KO3 A;  3KYD D;  3L13 A;  4YL8 A;  5C23 A;  4BOS C;  4EUT A;  2BYF A;  1RLF A;  1WIA A;  2O2V A;  3A9K B;  3M95 A;  2AEH A;  3NZS A;  3PPA A;  5D6J B;  5J17 A;  2MRP A;  2WDT B;  4NAW A;  4NAW B;  4BKT A;  2MP2 B;  2O2V B;  2KTR A;  4XC2 A;  1P3Q U;  4PS7 A;  2ZPY A;  3GOE A;  1IP9 A;  4MGI E;  1SGH A;  2KTF A;  2FID A;  4FJY A;  3M62 B;  4WWP A;  2FCS A;  1NBF C;  3CMM B;  5DPR A;  4EZK A;  2DYM A;  2PE6 B;  2DZK A;  1IYF A;  4A20 A;  4IC7 B;  3LDZ E;  2NCN A;  3M3J A;  1WFY A;  5DCN A;  3AI5 A;  2KJ6 A;  2DZM A;  1H8C A;  2IZV B;  3U7D A;  4TQ0 A;  3ZKJ C;  3TIX A;  3CSF A;  4DDG D;  3QAQ A;  4GN1 A;  5JHA A;  1TBE A;  4MSQ B;  3NHE B;  2JF5 A;  1WJ4 A;  3K9P B;  1E7U A;  1I42 A;  2FCM A;  1WXV A;  2LGX A;  4PS3 A;  5AEK B;  2WX1 A;  5CHW A;  4GB9 A;  4WQO B;  4AUQ C;  2JUO A;  3ZRC A;  5E6O A;  2L0T A;  3KW5 B;  4HDQ A;  4A3O A;  2KK8 A;  4NNJ B;  4EKU A;  2AYO B;  2ZJD A;  1H4R A;  3DBL I;  4KSK C;  1GG3 A;  1E8Z A;  5LLI A;  3ZTD A;  1KJT A;  2FCN A;  2NVU I;  2NBV B;  1OGW A;  4GGQ A;  2JT4 B;  3ZTC A;  3JYU A;  3DBH I;  4G11 A;  4DHZ B;  2GBJ A;  4CO7 A;  2NBW B;  3BY4 B;  5LXH A;  2DX5 B;  2HJ8 A;  3APC A;  5D2M B;  2KXJ A;  2V4L A;  4K7U A;  2CS4 A;  4W9C A;  4LJP B;  2KQS A;  4URK A;  3V61 A;  3SU8 X;  1WXA A;  2KWV B;  1J0G A;  2EMT A;  2LAS A;  3R7Q A;  4K1R B;  3BIN A;  2J0M A;  2LRW A;  1Q5W B;  3OJ3 A;  2L8J A;  3OAW A;  1UD7 A;  1A5R A;  3ZO5 B;  4EOY A;  3EHV A;  5AZG A;  4B9K A;  4BVU C;  3O65 B;  1Y8R C;  5E6P A;  4A3P A;  3SD5 A;  4ZRI A;  4AOF A;  2R2Q A;  4GDK B;  2KDI A;  3EFU A;  3IHP C;  1E90 A;  3HIZ A;  3DDC B;  2GBK A;  4NJ6 A;  3U8Z A;  1QZE A;  4HCN B;  4TUU A;  2O6V D;  3N30 A;  3CST A;  4E71 A;  2BYV E;  1V2Y A;  4N9F 4;  4B6W A;  3V6E B;  2HTH A;  4MEM A;  5DPT A;  2D2Q A;  1WGY A;  4EZJ A;  2VRR B;  2EMS A;  2BWE S;  2J0K A;  4GIV A;  2G4S A;  4OVV A;  5FR6 A;  1X1M A;  5IA7 A;  2L3Z A;  3B0A A;  1KLV A;  2BYE A;  4IM2 A;  3IBE A;  3V60 A;  3VH3 B;  2KDF B;  4MEL A;  3WAN A;  3H9D A;  1WX9 A;  2J7Q B;  3NS8 A;  3C0R B;  3ZNG C;  3PV1 A;  3QX1 A;  4HJK A;  3GZN I;  2XK5 B;  2KKC A;  2CHX A;  4JQW C;  5DPS A;  1E8W A;  1GC7 A;  4WAA A;  1G6J A;  3UIP B;  3WAO A;  4ZDV A;  5C1Z A;  2FUH B;  4GSW A;  2KMC A;  2MBQ A;  1WXS A;  2KVR A;  4E74 A;  1GJZ A;  2KDE B;  4GDL A;  4MGY E;  1ZKH A;  4LDT D;  2MBH A;  3IVF A;  4EEW A;  1EF1 A;  2M17 A;  2MLB A;  1WRD B;  4II3 B;  1V6E A;  1EUV B;  4CYE A;  3PLU A;  3PZD A;  4KSL C;  2I1J A;  3A4S C;  3X23 A;  2N4F A;  1WH3 A;  1TZ1 A;  5AZF A;  1JRU A;  1UEL A;  3H1U A;  4IW0 A;  4BOZ B;  3EC8 A;  3RUL A;  1UGM A;  4F1S A;  5HKH A;  1YQB A;  4NPN A;  4W9H A;  3R7R A;  1UZX B;  3I3T B;  5JZE B;  2K8C A;  2LI5 A;  4CHK A; 
#chains in the Genus database with same CATH topology
 1YJI A;  4RCO A;  1GNU A;  4YSY B;  5AUI A;  1RFA A;  2L7R A;  2FUG 1;  4PK1 A;  2N0S B;  3PS6 A;  1EF5 A;  2LXA A;  1L0Y B;  1TY0 A;  3QCA A;  1LGR A;  1PGB A;  2DHZ A;  2J53 A;  3PRP B;  1QLB B;  4N58 A;  4HEA 1;  4BBN C;  4G3X B;  2ICI A;  4W9G A;  4RGO S;  1FNU A;  5LXI B;  5D3D A;  4OZB A;  1M94 A;  1N61 A;  4GOC A;  2KN5 A;  2AL6 A;  2MBB B;  2QCZ A;  3ALB A;  4AWJ A;  3MTN B;  4JGH B;  2DEN B;  2WHI A;  2EEL A;  4M8M A;  2V9H A;  1M4V A;  2OJR A;  1RAX A;  4K81 A;  2PKO A;  1I4P A;  2I2Y A;  1FRD A;  3DVN U;  5TR5 A;  3UIO B;  4MGZ E;  1WJN A;  2K22 A;  2G45 B;  4WJQ A;  3VAW A;  4LK0 M;  1GB4 A;  3AEC B;  3OJ4 B;  1L0X B;  1IUE A;  4RF0 A;  4A90 A;  4IWO A;  5H8Y E;  3W1S A;  1N60 A;  3MHZ A;  2R2O A;  2XBB C;  3RZW C;  5G5H A;  3U4E G;  4C00 A;  4REZ A;  2KOX A;  3QHT A;  4YXD B;  3RZF A;  3A9K A;  4RGN A;  2BQQ A;  4KGR A;  2Z59 B;  4C4V B;  1AAR A;  3QQ8 B;  3B2G A;  4RGT A;  2L0F A;  5G55 A;  3I9V 1;  1S3S G;  3R3M A;  4KZ0 A;  5EE9 A;  5AUK A;  4JWS C;  4PYU A;  2V3N A;  3GP7 A;  4OVU A;  4ZHP A;  1BT0 A;  2N7D A;  1V86 A;  3H7P B;  1T6B X;  3TCA A;  4TKN A;  3H8H A;  4R3D A;  3NG0 A;  2BBC A;  4US9 A;  2LGS A;  3UQA A;  4FBJ B;  3TEY A;  3DBR I;  3Q8B A;  4BKS D;  3ZGZ A;  4GU2 A;  4W9E A;  5BMG A;  1R4M B;  2JVC A;  3HK0 A;  1AYF A;  4II2 B;  3L08 A;  5CX3 A;  1YD8 U;  3RD2 A;  3T3O A;  3RUI B;  3ZVV A;  2D3B A;  2ZVO A;  3WA0 A;  2HD5 B;  2MSE D;  3B9J A;  1D5Z C;  3WAL A;  3NVW A;  2RD0 A;  1E0Z A;  4L1B A;  2ASQ A;  2KWD A;  2IY0 B;  4HWI B;  2MA9 B;  2CJO A;  1OQR A;  2DLB A;  3ONS A;  2KHW B;  5IN7 A;  3PRM B;  1T0Y A;  3IG3 A;  1EU3 A;  4GLS C;  5FKA C;  1NI2 A;  2BGF A;  2V4I B;  4ZOH C;  3TEZ A;  3KUC B;  1EM7 A;  1TYG B;  3AE5 B;  1IPG A;  5BMI A;  2MWS B;  3HHM A;  1F9J A;  3S2A A;  2D07 B;  2JYE A;  3ML8 A;  2CJN A;  2DNF A;  2IND C;  3NOB A;  1L7Y A;  2KWU B;  3QK0 A;  2RPQ A;  3NVY A;  3RNE C;  4ANU A;  4MSM B;  1WYW B;  1HTQ A;  1XLN A;  3TL5 A;  1JWM D;  2J0J A;  4ITK A;  2JY6 A;  5G2N A;  1R7S A;  4NY0 A;  2GRI A;  3LJ3 A;  2B3A A;  2WXO A;  4B95 A;  4K7S A;  3AU4 A;  4ZHO A;  2O6V B;  1WX8 A;  3MC9 A;  2WXK A;  3V05 A;  4JLC A;  2QMT A;  4L23 A;  1QKZ A;  4F8C B;  2LJI A;  4A8X C;  3MJ5 A;  4P1B C;  1DOY A;  3AE9 B;  3IT6 B;  3JSV B;  1UNS A;  3DHI C;  1E5W A;  4FJZ A;  2KX0 A;  2GLS A;  3AV8 A;  3VFK A;  3Q6B A;  3WCQ A;  2WWZ A;  1WGG A;  4WJP A;  4RM8 A;  3HM3 A;  3PZ8 A;  4HKZ E;  3N3K B;  1WI0 A;  2NPT A;  2XN9 C;  4RH6 A;  1BXT A;  4XX5 A;  1Z5S B;  2IPK D;  1PGA A;  3A1Q B;  3QAR A;  4MGK E;  3Q2A C;  2OJW A;  1XEE A;  2BF8 B;  3AE1 B;  1KLG D;  1U4A A;  2GMI C;  1HZ6 A;  2M8S A;  1WGD A;  1NDD A;  1C3T A;  1RYJ A;  2DZI A;  1I7H A;  2A5U A;  3Q8E A;  3ENE A;  5C23 A;  4EUT A;  1RLF A;  5D6J B;  3M95 A;  1FXI A;  3NZS A;  4P16 A;  1MHX A;  2MP2 B;  4TSS A;  2ZPY A;  1IP9 A;  4MGI E;  2AQ3 B;  3AE8 B;  1MPE A;  3KWL A;  4B0M A;  4WWP A;  4NJC A;  2PE6 B;  1IYF A;  4A20 A;  5IOI A;  4P1C C;  2ZW1 A;  4P6V F;  2DZM A;  2IZV B;  3U7D A;  3FAH A;  5JHA A;  3QAQ A;  4GN1 A;  3C8Y A;  3NHE B;  3K9P B;  1E7U A;  4N6E B;  2FCM A;  4PS3 A;  5CHW A;  5E6O A;  2IDY A;  3IAS 1;  2WLB A;  1UGJ A;  1H4R A;  1GG3 A;  1KJT A;  2FCN A;  2NBV B;  1OGW A;  3ZTC A;  5JXV A;  4G11 A;  1TS4 A;  2NBW B;  3AED B;  5LXH A;  1GB1 A;  3APC A;  2N7J A;  5D2M B;  2V4L A;  4K7U A;  3SU8 X;  4S0R A;  2INC C;  2LAS A;  3R7Q A;  3W5U B;  2J0M A;  4M0W A;  3OAW A;  1A5R A;  3ZO5 B;  4BVU C;  3O65 B;  4A3P A;  3SD5 A;  1AW7 A;  4LNO A;  4MM3 B;  2KDI A;  3EFU A;  3ZYY X;  1EU4 A;  4HCN B;  3DBH B;  1V2Y A;  2LUM A;  3V6E B;  4US8 A;  4AS1 A;  2W3R A;  3N1X C;  2BWE S;  2J0K A;  1TT5 B;  3B0A A;  4C7Z A;  4YT0 B;  4IM2 A;  1MJD A;  3V60 A;  2J7Q B;  1V8C A;  3ZNG C;  2KVZ A;  4JQW C;  5DPS A;  1YMH E;  1G6J A;  4WAA A;  2IGG A;  5C1Z A;  3DWG C;  2FUH B;  1GJZ A;  2KDE B;  3CIR B;  2BB6 A;  1QF6 A;  4YSX B;  2BW2 A;  2JQR B;  1V6E A;  3PLU A;  4KSL C;  2WXG A;  1L4Z B;  2BYT A;  1FCC C;  1JRU A;  4IW0 A;  3EC8 A;  5HKH A;  3KQ4 A;  2K8C A;  1ROE A;  1VZ6 A;  1WX7 A;  3UGB B;  4LJO B;  3NVZ A;  4N59 A;  1XD3 B;  3TEX A;  1WWT A;  4AJY B;  2DAF A;  3L10 B;  3L54 A;  4XDC A;  2ZEQ A;  4FHK A;  1FNW A;  1WZ3 A;  5HHD G;  1D5X C;  2C5L C;  4OZA A;  1V49 A;  2MW5 A;  3ZUN A;  1PYW D;  3PZ7 A;  1C79 A;  3ZNH B;  5MPO A;  1XT9 B;  1F0Z A;  1V5O A;  1Z2M A;  1WGR A;  3ML9 A;  4XZ4 A;  1DYQ A;  2RDH A;  3BVG A;  3BK2 A;  5L95 C;  1FXA A;  2CHZ A;  4JWU C;  1WGH A;  2BWF A;  2G4D B;  3VHT C;  1YX5 B;  1WJU A;  1AN8 A;  1ZUD 2;  4NJ7 A;  3DQV A;  1N5W A;  3N32 A;  2LVQ A;  4G0N B;  2MBO A;  2FIF A;  3TJP A;  3ZW3 A;  3L0W B;  3ZNI D;  2RPV A;  4JX1 C;  5IAA C;  3H7P A;  1HXY D;  1ACC A;  1ZW7 A;  2OED A;  4FN2 A;  3W1S C;  3E56 A;  1D3Z A;  2V1Y A;  1R4M I;  3AE6 B;  4PYZ A;  4WQM A;  4C4V A;  4BFR A;  1KH0 A;  4DDI D;  2PPH A;  3P4S B;  2KNB A;  2PVO D;  1HQR D;  1PDX A;  3GE8 C;  1YQ3 B;  1MI0 A;  2Z0E B;  4LDT B;  3VQI A;  3AXC A;  4JIO U;  2FNJ B;  1WRI A;  2LHD A;  1CMX B;  4KVG B;  1PUT A;  4FHJ A;  1UUP A;  4NQL B;  4OZC A;  4YTM B;  4LNI A;  5EDS A;  4MAC A;  1E10 A;  2NTS A;  4F7Z A;  1K8R B;  1VCB A;  3BK1 A;  4KV2 A;  1ZE3 D;  5EE0 A;  1WE6 A;  3VH4 B;  2M0X A;  2LMC A;  1FXT B;  1ZXH A;  3PRE A;  2A4Z A;  2LRU A;  4WAF A;  3RMK C;  1T0S C;  2KQ7 A;  3AU5 A;  2JYT A;  3P4Q B;  3GE3 C;  2K39 A;  2KZR A;  2WXJ A;  4ZYN A;  2KN4 A;  2D10 A;  4AQ7 A;  1OEY J;  1FMA D;  2AX5 A;  1D6E C;  1QIL A;  2BS3 B;  4USA A;  2BKR B;  2K5P A;  1GC6 A;  2JRI B;  3WAP A;  2WXR A;  3SHQ A;  4W9K A;  2M56 B;  2WXI A;  1CK1 A;  4RF1 A;  1D4B A;  3N1Y C;  3NZ3 A;  3WIM A;  2LD9 A;  4HVB A;  1KM7 A;  1OQY A;  4MJS A;  2MCN B;  3U7Z A;  2KLC A;  1I35 A;  1E9M A;  1HEZ E;  1F52 A;  3JW0 X;  3SDL C;  2K25 A;  2LVO A;  1JCK B;  5IP4 D;  3QC8 B;  3ZDM C;  1ZP0 B;  5D7G A;  3W1Y A;  2ZPN A;  1P9D U;  2UU7 A;  3PHX B;  4WWO A;  2INN E;  1N63 A;  3BYT B;  5KHO A;  3UIN B;  4AJW A;  2FCQ A;  4WIP A;  2NBU A;  4WJO A;  2G3Q B;  2KQ4 X;  1RRB A;  3DPD A;  3BVZ A;  4LNK A;  2ZVN A;  4KKJ A;  4MJS B;  3A9J B;  4WWM A;  2UWQ A;  3PO0 A;  5JH5 C;  2NMQ A;  4I6P A;  1P98 A;  2N9X A;  2BTE A;  2PEA A;  3TMP B;  2D3C A;  2V0G A;  1NI3 A;  1ZDV A;  1R4N I;  2L83 A;  2NR2 A;  1FRR A;  1VR9 A;  1LM8 B;  4TQ1 A;  3NJT A;  3P4P B;  4DXA B;  4M0W B;  1J7A A;  4PT5 A;  3X0W A;  1WY8 A;  2RDB C;  4IM0 A;  1SE9 A;  3CWI A;  3PVL A;  1KF6 B;  4RGM A;  2UYZ B;  1TZO A;  2Z0D B;  3R8B A;  4MH8 A;  3RNG C;  3R66 C;  1J7B A;  5BYR A;  2Y5C A;  2I38 A;  2AL3 A;  4RFB A;  1I4R A;  5LNK 1;  3RI7 C;  2WQY B;  3DOW A;  3AH7 A;  2LZ6 A;  2XNA C;  4W9D A;  2IO1 B;  5GMV A;  1LFD A;  4G50 A;  1WR6 E;  1L2N A;  1IGD A;  2WDV B;  1FIQ A;  4HPM B;  1SE2 A;  2MJD A;  3PLV A;  4YWG G;  1PQS A;  3T9L A;  3I63 C;  1N6Z A;  4OHJ A;  4BBN F;  3EFC A;  2YEP B;  2J52 A;  2PMV A;  3KYD D;  3L13 A;  4RNA A;  1FCL A;  1XLP A;  1F77 A;  3TSS A;  3PPA A;  3SFD B;  1JWB D;  2WXQ A;  2KTR A;  1SJH D;  4PS7 A;  1RM6 C;  1L5P A;  1JWA D;  2FCS A;  1NBF C;  3CMM B;  3W2D A;  1FD6 A;  2NCN A;  3ZJU A;  1TY2 A;  1JW9 D;  2KJ6 A;  3LXF A;  4DDG D;  4MSQ B;  2JF5 A;  1C4C A;  1I42 A;  1R4N B;  3P1M A;  5AEK B;  1QT9 A;  1FPY A;  4K3C A;  4AUQ C;  4IDI A;  2JUO A;  4A3O A;  4EKU A;  2JX5 A;  2AYO B;  2PIA A;  2ZJD A;  1XF5 L;  2KDM A;  3ZTD A;  3JYU A;  1FFU A;  2FE8 A;  4CO7 A;  2DX5 B;  2HJ8 A;  2KXJ A;  3AEB B;  2CS4 A;  4W9C A;  4O1N A;  2KQS A;  1QQR A;  2GB1 A;  1WXA A;  2KWV B;  1J0G A;  4IOI E;  3TUO A;  2LRW A;  2MH7 A;  1YNT E;  4EOY A;  4A55 A;  5E6P A;  4GDK B;  5HFY A;  3HIZ A;  3O13 A;  4TUU A;  2O6V D;  1T3Q A;  4N9F 4;  4B6W A;  2HTH A;  1L4D B;  1WGY A;  5T8I A;  3VRB B;  4HKQ A;  1UF0 A;  5IA7 A;  2KDF B;  4MEL A;  1JAL A;  3NRZ A;  2KAJ A;  3C0R B;  3PV1 A;  3QX1 A;  1ZDX A;  4HJK A;  5EE1 A;  3W5V B;  1E8W A;  2MJ3 A;  2L32 A;  4ZDV A;  1XO3 A;  2KMC A;  3VRA B;  1WXS A;  4LDT D;  4MT5 A;  3IVF A;  1EF1 A;  2MLB A;  4II3 B;  1I4G A;  4CYE A;  1K50 A;  3PZD A;  3E9S A;  1STE A;  3A4S C;  1WH3 A;  1TZ1 A;  2VH1 A;  2WP9 B;  3RUL A;  4F1S A;  2INP E;  1QOA A;  3R7R A;  5JZE B;  4CHK A;  3VUX A;  4IWP A;  3ZLZ A;  1Y56 A;  3ZNZ B;  3AN1 A;  1B9R A;  3QJZ A;  2IGD A;  2WDR B;  2DYO A;  3AE4 B;  1TGZ B;  2QDF A;  4FJV B;  2GBR A;  3OLM D;  2DAJ A;  3HM6 X;  3K9O B;  1I4Q A;  1ZPS A;  2N9E B;  3L4P A;  4NZL B;  4FA6 A;  2M0A A;  2YLM A;  2AWT A;  3AM9 A;  1TIF A;  3PT2 B;  2K9X A;  3N1Z C;  2LWP A;  5KHQ A;  3AMZ A;  4UDU C;  1FM0 D;  3T8M A;  3VVW B;  2YVC A;  3NZU A;  4GDK A;  3N20 C;  3A4R A;  1NEN B;  5E6N A;  4FLH A;  4NQK E;  2D11 A;  3WAM A;  4AP4 C;  4KIK B;  1DGJ A;  2CHW A;  4GMV A;  3Q8A A;  3TBL D;  1GUA B;  3V3X A;  1C77 A;  3IAM 1;  4HJG E;  4HDO A;  2ONQ A;  2K8H A;  2QJL A;  1XCQ L;  2KAC A;  2BB5 A;  2N1W A;  1WXM A;  2N7E A;  1UBI A;  2JWU A;  1ZOY B;  3W9C B;  3KLS X;  5H92 C;  5JHB A;  2LEK A;  2RSU A;  1NYQ A;  4NAM A;  1S1Q B;  2IYD B;  2LUE A;  3UI3 A;  4OW0 A;  1VDV A;  3EGR A;  3IXS A;  4HPL B;  4I6N B;  2KTR B;  1WM2 A;  1NEK B;  1YIW A;  4EZL A;  3ECI A;  1KLU D;  1CQV A;  4XDD A;  3VUY A;  5J2R A;  3DVG X;  2ZZP B;  1HZ5 A;  1WMH A;  4HLE A;  4DBG A;  2WX0 A;  4W9I A;  3JVZ X;  3LB8 C;  3A33 B;  3DCG A;  1N62 A;  1YN3 A;  1JRO A;  2MEK A;  2MQJ A;  2C7H A;  1HE8 A;  3A1Q A;  1P7E A;  3KH0 A;  3MC8 A;  3DBS A;  4KZC A;  4MDK E;  1WE7 A;  3DWM A;  2M4N A;  1ENF A;  2C60 A;  2L05 A;  3I5J C;  4J6I A;  2KMM A;  1E8Y A;  4ACF A;  2KDB A;  2MBE A;  1P0R A;  2WYQ A;  5FR3 A;  3UF8 A;  3Q3J A;  1YJ1 A;  1WYG A;  3RPF C;  2JXX A;  2OOB B;  1ZXI A;  3EA6 A;  2C9W B;  3JSV A;  3Q8F A;  1C4P A;  2KFK B;  4FUL A;  4ARI A;  1V81 A;  4TMA B;  3VTV A;  1YOV B;  3RCZ A;  5FK9 C;  4W9F A;  2L00 B;  1V1P A;  5J18 A;  1FNV A;  1F1H A;  3ABV B;  1V80 A;  3QWZ B;  2QHO A;  2CU3 A;  3KUZ A;  4WWN A;  4J3O D;  3A9J A;  2PVG C;  3M63 B;  4LNF A;  3BWU D;  1RFK A;  3SR6 A;  1C78 A;  1TKG A;  5G5G A;  3NY5 A;  1SBB B;  3VR8 B;  4HK2 A;  5BYQ A;  4DXG A;  4ZRK A;  4L2Y A;  3T3N A;  2Y5B B;  2KD0 A;  1WJ6 A;  2LVP A;  2KJR A;  3B08 A;  1WXQ A;  2SEB D;  5CHV C;  2L52 A;  3VTW A;  1BUI C;  1E8X A;  3Q3M C;  2CU1 A;  2W54 A;  4W9J A;  3IFW B;  3Q3F A;  1Q1O A;  4FXC A;  2N9P C;  2B76 B;  2XK5 A;  3IT4 B;  4S17 A;  4M8N A;  1I4X A;  1DOX A;  3DVN V;  1V9J A;  1UH6 A;  2K6D B;  2PJH A;  4K7W A;  3PHW B;  1XQQ A;  1YX6 B;  3VR9 B;  3NUH B;  3AUL A;  4CQN A;  4M01 A;  2W82 A;  3BZD B;  5C2T B;  1J19 A;  2REX A;  4PS8 A;  4FAD A;  2LGI A;  2W9N A;  3TEW A;  4C7Y A;  2K1F A;  3FIL B;  5D94 A;  3VTU A;  4LTU A;  1IGC A;  2J42 A;  2IBI B;  5IKC M;  1B1Z A;  5BYS A;  1L6U A;  2K0P A;  2RR9 A;  4WJN A;  3SEB A;  1I4H A;  1JWU D;  3PRZ A;  3AE2 B;  4RM9 A;  4DHJ D;  1FO4 A;  3OWE B;  3D32 A;  3HVZ A;  2HTM E;  4EFO A;  1WZ0 A;  1OQQ A;  3UQB A;  3AEA B;  1V5T A;  1EO6 A;  1LXD A;  1WGK A;  3ETR A;  3HUI A;  2RDG A;  3APF A;  1NYR A;  2ACZ B;  1L6V A;  3KUD B;  1OEY A;  1UBQ A;  3RN9 C;  2W3S A;  2V3P A;  2JPH A;  1C76 A;  3I57 A;  1P7F A;  1T5X D;  4ASW C;  3ZQ4 A;  1J8C A;  4KGS A;  1SF0 A;  3QIJ A;  2RMM A;  2KO3 A;  4YL8 A;  1WIA A;  2O2V A;  2WXH A;  3DHH C;  5J17 A;  4NAW A;  2O2V B;  4XC2 A;  4QAY A;  1FFV A;  1SGH A;  4FJY A;  3Q3N C;  3EUB 2;  5DPR A;  2DYM A;  4IC7 B;  3BVM A;  1WFY A;  2R61 A;  1H8C A;  1E6E B;  1TKE A;  1TBE A;  1SXT A;  5TSS A;  4YTP B;  3AE7 B;  2QIL A;  2IGH A;  1WXV A;  2LGX A;  3OG5 A;  5EE3 A;  3C19 A;  4GB9 A;  4WQO B;  3ZRC A;  2QIE B;  4HDQ A;  1LO5 D;  3RNA C;  3DBL I;  4KSK C;  1VZ7 A;  5LLI A;  1F2R I;  3DBH I;  4DHZ B;  2GBJ A;  4EE2 A;  5HI1 A;  1V97 A;  4WUR A;  2EMT A;  4K1R B;  1XXG A;  3EHV A;  5AZG A;  5GXG B;  1TS3 A;  3RNC C;  4AOF A;  2R2Q A;  4D2K A;  3IHP C;  2VH2 A;  2GBK A;  2BYV E;  1VJK A;  4MEM A;  3ZJV A;  5DPT A;  2D2Q A;  4EZJ A;  2EMS A;  1JQ4 A;  4GIV A;  1ET6 A;  1X1M A;  2L3Z A;  1JWS D;  2JXT A;  3AB5 A;  2BYE A;  2KYW A;  1XLO A;  3VH3 B;  3WAN A;  2DWQ A;  3GZN I;  2KKC A;  4JPS A;  1KTK A;  1EWC A;  3Q14 C;  2CHX A;  4BZA A;  1GC7 A;  2BT6 A;  3UIP B;  2E3T A;  5C3J B;  2MBQ A;  1EWY C;  1ET9 A;  4KGT A;  4GDL A;  4MGY E;  1ZKH A;  2MBH A;  1EUV B;  2G1E A;  1WSP A;  1A70 A;  3AEE B;  2QEJ C;  3H1U A;  4BOZ B;  2MJE A;  2PTL A;  5BMH A;  4NPN A;  4W9H A;  1VRA B;  3V61 A;  2LI5 A;  1XCT L;  2IO3 B;  2JZZ A;  3ZJT A;  1ISN A;  3KVF B;  2BVC A;  3VUW A;  3EEC A;  4DHJ B;  2H89 B;  2OHF A;  1V1P B;  2NS5 A;  2CKH B;  3ZRF A;  3H7S A;  1TKY A;  1UWX A;  3KWV A;  4IKG A;  4XWW A;  2K6Q A;  3LYY A;  3V62 A;  4MM3 A;  2W55 A;  2MHJ A;  2I1K A;  2KFK A;  2HE7 A;  1C9F A;  4ANX A;  4HRO A;  3MJW A;  2LFI A;  1GPX A;  3AE3 B;  2KWC A;  3DVG Y;  3PSE B;  3QA8 A;  3H6N A;  4P7I A;  2Y5P A;  4M02 A;  2D3G A;  1T0Q C;  2Y3A A;  1QOG A;  1NVI D;  1YQ4 B;  2GBM A;  1P1A A;  4YTN B;  1E7V A;  2V3S A;  2NTT A;  4LCD E;  2G9H D;  1YN4 A;  1SIF A;  4XE0 A;  2KC2 A;  4DHZ E;  3VDZ A;  4I6L B;  2KFJ A;  4HPP A;  2BS4 B;  3DBR B;  2PE9 A;  4ICV A;  3B2F A;  5BO4 B;  2K8B A;  3ZIM A;  1WMH B;  3NVV A;  4IUM B;  5D3I B;  2QSD A;  2LXC A;  2SAK A;  5CHF A;  1QOB A;  2WU2 B;  1WF9 A;  3FC4 A;  1PFD A;  1SEB D;  2GBN A;  2ZNV C;  3ZXR A;  2MP2 A;  1T0R C;  2KC1 A;  2WXF A;  2DYB A;  4BKS A;  4A6Q A;  4DQO C;  2IY1 B;  4IM3 A;  2WU5 B;  4B0E A;  3MFG A;  5AZH A;  1VD2 A;  3URY A;  1L0V B;  1SB3 C;  2N1V A;  2LGD A;  2RGF A;  3MP9 A;  4ZYS A;  4IG7 B;  3CF6 E;  4HCP B;  2DZJ A;  5CTR C;  2KMA A;  2D5G A;  3B1L X;  4XWT A;  1WM3 A;  2FAZ A;  2XEW A;  1IBX B;  2NPT B;  1UWM A;  4IWQ A;  2VZK D;  2IO0 B;  2JRH A;  3BII D;  2YEP F;  3Q3O C;  2HDE A;  1BML C;  2M19 A;  2VZK B;  2QC8 A;  4KIK A;  1KOT A;  5I4D A;  2KJH B;  4YSZ B;  2KX3 A;  3MHS D;  1C4A A;  3ZDT A;  3MC0 B;  2EKE C;  3FKY A;  1MFW A;  1Q0W B;  2BS2 B;  4WH4 A;  4ZRJ A;  1MVK A;  2HJ1 A;  4KDL B;  2CR5 A;  2JSV X;  2O6V A;  3PGE A;  4BAX A;  2C7N B;  2JZ3 B;  5E6J A;  2WXM A;  1OFF A;  2BPS A;  5DPW A;  4MH0 E;  3GB1 A;  2WNM A;  4ICU A;  2BKF A;  2WXN A;  3Q8C A;  3VXW A;  2WDQ B;  1ZGU B;  2N9K A;  2ZCC A;  1GOZ A;  3RNB C;  4TV3 A;  2K3U A;  1XLQ A;  2J4X A;  4RMA A;  3P4R B;  4Q2J A;  3V6C B;  4GDL B;  4X57 B;  4KKI A;  2N9L A;  5IO9 A;  1K51 A;  1TS2 A;  4GXB A;  1WR1 A;  3RT3 B;  2M1M A;  1QOF A;  1TTN A;  1SJE D;  4ARC A;  3U2S C;  2C7M B;  3DHG C;  4DWF A;  2X8X X;  1HTO A;  1RWS A;  1MG8 A;  4ZRQ A;  4DXF A;  5L83 A;  3Q69 A;  2Z8L A;  3PTF C;  3J9C A;  3N9Y C;  2L76 A;  1HA5 A;  4HXD A;  3L17 A;  4XYC A;  2ON8 A;  1VZ8 A;  3HVD A;  4HRS A;  3AEG B;  3RYT A;  3U52 E;  1SIJ A;  3P42 A;  1N5X A;  3L16 A;  2ZCB A;  1LQB A;  2KT7 A;  3GS2 A;  2IO2 B;  3KYC D;  3R2T A;  4ANV A;  4ZRP A;  1CZP A;  4W9L A;  3U30 A;  4JL9 A;  4DK5 A;  1IBX A;  2MX2 A;  3P2B A;  2KAN A;  3P63 A;  2WXL A;  1D5M C;  3SFE B;  3APD A;  2WS3 B;  1TS5 A;  2JWZ A;  3HRD D;  4M00 A;  2WXP A;  2LJ5 A;  1C1Y B;  4KDI C;  4ANW A;  1F2R C;  2GOW A;  1CJE A;  1OTR B;  4E3C A;  4BKG A;  2TSS A;  1FEH A;  4JE3 B;  1Q10 A;  2ZNV B;  5HG2 A;  2KLG A;  3GZN B;  2LGY A;  4LLG M;  4BOS C;  2BYF A;  1KFY B;  3A9K B;  4XGA B;  2AEH A;  2MRP A;  2WDT B;  3BYY B;  4NAW B;  1V1O A;  4BKT A;  1P3Q U;  3GOE A;  1SE3 A;  1SE4 A;  2KTF A;  2FID A;  3M62 B;  1K53 A;  4EZK A;  2DZK A;  2E6X A;  3LDZ E;  3M3J A;  5DCN A;  1JML A;  2Q5W D;  3AI5 A;  4TQ0 A;  3ZKJ C;  3TIX A;  3CSF A;  1JRP A;  1WJ4 A;  2H88 B;  2IJ0 A;  1MG4 A;  4C56 C;  2WX1 A;  2L0T A;  3KW5 B;  2KK8 A;  4NNJ B;  1YN5 A;  1AWD A;  1E8Z A;  2EKI A;  1TJE A;  3RNF C;  1PGX A;  2NVU I;  3AEF B;  4GGQ A;  2JT4 B;  2JU6 X;  3R2I A;  2JZP A;  3BY4 B;  3DBL B;  4OVZ A;  4LJP B;  4URK A;  2FBW B;  3FIL A;  3BIN A;  2L1A A;  1Q5W B;  1ESF A;  3OJ3 A;  1J7C A;  2L8J A;  2AQ2 B;  1DOI A;  1UD7 A;  1SSN A;  4B9K A;  1Y8R C;  1GAQ B;  4ZRI A;  1E90 A;  3DDC B;  3U8Z A;  4NJ6 A;  1QZE A;  4LNN A;  4A9A A;  3N30 A;  3CST A;  4E71 A;  4K3B A;  2VRR B;  2G4S A;  4OVV A;  5FR6 A;  1VLB A;  2AQ1 B;  1KLV A;  2GI9 A;  3IBE A;  4KX6 B;  4C80 A;  2WGS A;  3H9D A;  1YJJ A;  1WX9 A;  3NS8 A;  2LHE A;  4H2A A;  2XK5 B;  3NS1 A;  2D3A A;  3WAO A;  4GSW A;  2PLP A;  2KVR A;  4E74 A;  2DBY A;  4EEW A;  2M17 A;  3ZXV A;  1WRD B;  3RFZ B;  2I1J A;  3X23 A;  2N4F A;  1K52 A;  5AZF A;  1UEL A;  1UGM A;  2PW9 A;  1MHH E;  2X38 A;  1YQB A;  2ZW0 A;  1E7P B;  1UZX B;  3I3T B;  1KRH A; 
#chains in the Genus database with same CATH homology
 3VUX A;  1WX7 A;  4IWP A;  3UGB B;  2IO3 B;  3ZLZ A;  3ZNZ B;  2JZZ A;  4LJO B;  1ISN A;  3QJZ A;  1GNU A;  2DYO A;  1TGZ B;  3KVF B;  1RFA A;  3EEC A;  3VUW A;  1XD3 B;  4FJV B;  4AJY B;  4DHJ B;  2L7R A;  2DAF A;  2GBR A;  3L10 B;  3L54 A;  3OLM D;  3PS6 A;  2DAJ A;  3HM6 X;  3K9O B;  2N9E B;  2ZEQ A;  4FHK A;  4FA6 A;  1EF5 A;  2YLM A;  2AWT A;  2LXA A;  1WZ3 A;  3PT2 B;  2NS5 A;  2CKH B;  2LWP A;  3ZRF A;  2C5L C;  5KHQ A;  3H7S A;  1V49 A;  2MW5 A;  3QCA A;  3T8M A;  3ZUN A;  3VVW B;  2K6Q A;  2YVC A;  3V62 A;  2DHZ A;  3NZU A;  4GDK A;  4MM3 A;  2I1K A;  3PRP B;  3ZNH B;  3A4R A;  5E6N A;  4FLH A;  1XT9 B;  2KFK A;  4BBN C;  4NQK E;  1V5O A;  2HE7 A;  2D11 A;  4G3X B;  1Z2M A;  1WGR A;  3WAM A;  3ML9 A;  4W9G A;  4XZ4 A;  5LXI B;  4AP4 C;  4ANX A;  4KIK B;  1M94 A;  2CHW A;  3MJW A;  5L95 C;  4GMV A;  2CHZ A;  2KWC A;  1WGH A;  2BWF A;  2G4D B;  3DVG Y;  3PSE B;  4GOC A;  2KN5 A;  3QA8 A;  3H6N A;  4P7I A;  3VHT C;  2AL6 A;  2MBB B;  1YX5 B;  3ALB A;  3TBL D;  4AWJ A;  3MTN B;  1GUA B;  1WJU A;  2D3G A;  4JGH B;  2DEN B;  4NJ7 A;  3DQV A;  3N32 A;  4HDO A;  2LVQ A;  4G0N B;  4M8M A;  2MBO A;  2FIF A;  2K8H A;  2GBM A;  1P1A A;  3TJP A;  3ZW3 A;  2OJR A;  1RAX A;  1E7V A;  3L0W B;  4K81 A;  2V3S A;  4LCD E;  3DVN U;  5TR5 A;  3UIO B;  3ZNI D;  4MGZ E;  1SIF A;  2KC2 A;  1WJN A;  4DHZ E;  4WJQ A;  2G45 B;  5IAA C;  2N1W A;  3H7P A;  3VAW A;  3VDZ A;  4I6L B;  1WXM A;  2KFJ A;  2N7E A;  1UBI A;  1ZW7 A;  3OJ4 B;  2PE9 A;  4ICV A;  5JHB A;  4FN2 A;  3W1S C;  5BO4 B;  2K8B A;  3ZIM A;  1WMH B;  4IUM B;  2RSU A;  4IWO A;  3W1S A;  1D3Z A;  2V1Y A;  2LXC A;  1S1Q B;  2IYD B;  1R4M I;  2LUE A;  2R2O A;  4PYZ A;  5CHF A;  2XBB C;  4BFR A;  3RZW C;  4DDI D;  2PPH A;  1WF9 A;  2KNB A;  2GBN A;  4HPL B;  4I6N B;  2KTR B;  1WM2 A;  2ZNV C;  1YIW A;  2MP2 A;  2KOX A;  2KC1 A;  3ECI A;  4EZL A;  3QHT A;  2Z0E B;  4LDT B;  3RZF A;  3VQI A;  3AXC A;  3A9K A;  4JIO U;  2FNJ B;  3VUY A;  2DYB A;  2Z59 B;  4BKS A;  5J2R A;  1CMX B;  1AAR A;  2IY1 B;  3DVG X;  3QQ8 B;  2L0F A;  2ZZP B;  4IM3 A;  4KVG B;  5G55 A;  4FHJ A;  1WMH A;  4NQL B;  1S3S G;  5AZH A;  3R3M A;  1VD2 A;  4DBG A;  2WX0 A;  4HLE A;  2N1V A;  4KZ0 A;  2LGD A;  4W9I A;  2RGF A;  3JVZ X;  3A33 B;  5EDS A;  4PYU A;  3DCG A;  4OVU A;  1BT0 A;  4F7Z A;  1K8R B;  1VCB A;  1V86 A;  2N7D A;  2MQJ A;  3H7P B;  2C7H A;  4IG7 B;  1HE8 A;  3TCA A;  3A1Q A;  3CF6 E;  4TKN A;  4HCP B;  2DZJ A;  3KH0 A;  5CTR C;  2KMA A;  4KV2 A;  3B1L X;  3DBS A;  4KZC A;  1WM3 A;  1WE7 A;  2FAZ A;  1WE6 A;  2XEW A;  4MDK E;  2NPT B;  3VH4 B;  4FBJ B;  3DBR I;  3UQA A;  2M4N A;  4BKS D;  2M0X A;  4IWQ A;  1FXT B;  2IO0 B;  2JRH A;  3PRE A;  2C60 A;  4GU2 A;  2A4Z A;  2LRU A;  2L05 A;  4J6I A;  4W9E A;  1E8Y A;  2KDB A;  2MBE A;  1P0R A;  2KQ7 A;  2WYQ A;  2JVC A;  3AU5 A;  3HK0 A;  4II2 B;  3L08 A;  3UF8 A;  3Q3J A;  5CX3 A;  1YD8 U;  3RD2 A;  3RUI B;  4KIK A;  1YJ1 A;  3ZVV A;  1KOT A;  2JXX A;  2KJH B;  2OOB B;  2KX3 A;  3MHS D;  2ZVO A;  3WA0 A;  2HD5 B;  3ZDT A;  2C9W B;  2KZR A;  2EKE C;  2K39 A;  2MSE D;  3JSV A;  4ZYN A;  2KFK B;  2D10 A;  1OEY J;  3WAL A;  4FUL A;  1Q0W B;  2RD0 A;  2BKR B;  4ZRJ A;  1V81 A;  1GC6 A;  3VTV A;  2JRI B;  3WAP A;  3SHQ A;  4W9K A;  3RCZ A;  4W9F A;  2ASQ A;  2IY0 B;  4KDL B;  2CR5 A;  2O6V A;  3PGE A;  4HWI B;  2MA9 B;  2L00 B;  5J18 A;  2C7N B;  2JZ3 B;  3ONS A;  1V80 A;  3WIM A;  3QWZ B;  2KHW B;  2QHO A;  2LD9 A;  2BPS A;  1KM7 A;  3KUZ A;  3PRM B;  4HVB A;  4WWN A;  1T0Y A;  3IG3 A;  3A9J A;  5DPW A;  1OQY A;  4MJS A;  3M63 B;  4MH0 E;  2MCN B;  2KLC A;  1I35 A;  1NI2 A;  2BGF A;  3JW0 X;  3SDL C;  3NY5 A;  2K25 A;  2LVO A;  3KUC B;  4ICU A;  4HK2 A;  2BKF A;  3VXW A;  3QC8 B;  4ZRK A;  3ZDM C;  1ZGU B;  2ZCC A;  2Y5B B;  2KD0 A;  1WJ6 A;  5D7G A;  3W1Y A;  4TV3 A;  2LVP A;  2KJR A;  2ZPN A;  1IPG A;  1P9D U;  4WWO A;  3PHX B;  3B08 A;  4RMA A;  5KHO A;  5CHV C;  2MWS B;  3HHM A;  3UIN B;  4AJW A;  1F9J A;  3VTW A;  2FCQ A;  1E8X A;  2NBU A;  4WJO A;  4GDL B;  3V6C B;  3S2A A;  2CU1 A;  2D07 B;  2G3Q B;  4W9J A;  4X57 B;  3IFW B;  3ML8 A;  3Q3F A;  1RRB A;  3DPD A;  1Q1O A;  2N9P C;  3NOB A;  4GXB A;  1L7Y A;  2XK5 A;  2KWU B;  1WR1 A;  2RPQ A;  2ZVN A;  3QK0 A;  3RT3 B;  4MSM B;  4ANU A;  1WYW B;  3TL5 A;  4MJS B;  2J0J A;  2M1M A;  3A9J B;  2UWQ A;  2JY6 A;  5JH5 C;  4M8N A;  1TTN A;  5G2N A;  4I6P A;  1P98 A;  2N9X A;  4NY0 A;  3DVN V;  3LJ3 A;  1V9J A;  2C7M B;  1UH6 A;  4DWF A;  2B3A A;  4B95 A;  2K6D B;  2PJH A;  4K7S A;  2PEA A;  3AU4 A;  4K7W A;  2O6V B;  3PHW B;  1MG8 A;  1XQQ A;  1WX8 A;  1YX6 B;  3TMP B;  5L83 A;  3AUL A;  4JLC A;  3PTF C;  1R4N I;  2L76 A;  2NR2 A;  1J19 A;  2REX A;  4PS8 A;  4F8C B;  4FAD A;  4HXD A;  1LM8 B;  4TQ1 A;  3L17 A;  2W9N A;  3RYT A;  4DXA B;  4M0W B;  3X0W A;  1WY8 A;  3JSV B;  2K1F A;  4IM0 A;  4FJZ A;  1E5W A;  3L16 A;  1SE9 A;  2KX0 A;  2ZCB A;  1LQB A;  3PVL A;  5D94 A;  3VTU A;  3VFK A;  2UYZ B;  2Z0D B;  2IO2 B;  3KYC D;  3R66 C;  2IBI B;  2WWZ A;  1WGG A;  4ANV A;  4WJP A;  4RM8 A;  2RR9 A;  4W9L A;  2AL3 A;  4WJN A;  3U30 A;  3HM3 A;  4JL9 A;  4DK5 A;  3N3K B;  1WI0 A;  3PRZ A;  4RM9 A;  2NPT A;  3DOW A;  4DHJ D;  2MX2 A;  3P2B A;  2KAN A;  2LZ6 A;  3D32 A;  4W9D A;  4EFO A;  3APD A;  2IO1 B;  4XX5 A;  5GMV A;  1Z5S B;  1WZ0 A;  3UQB A;  1LFD A;  2JWZ A;  1V5T A;  4G50 A;  3A1Q B;  3QAR A;  4MGK E;  1EO6 A;  1LXD A;  1WR6 E;  2LJ5 A;  1L2N A;  2BF8 B;  3APF A;  1C1Y B;  1U4A A;  4KDI C;  4ANW A;  3KUD B;  2GMI C;  1OEY A;  2M8S A;  4HPM B;  1UBQ A;  2GOW A;  1OTR B;  4E3C A;  4BKG A;  2JPH A;  1WGD A;  1NDD A;  3PLV A;  1C3T A;  1PQS A;  3T9L A;  2ZNV B;  4ASW C;  2DZI A;  4BBN F;  2A5U A;  1J8C A;  2KLG A;  2LGY A;  3QIJ A;  3ENE A;  2KO3 A;  3KYD D;  3L13 A;  4YL8 A;  5C23 A;  4BOS C;  4EUT A;  2BYF A;  1RLF A;  1WIA A;  2O2V A;  3A9K B;  3M95 A;  2AEH A;  3NZS A;  3PPA A;  5D6J B;  5J17 A;  2MRP A;  2WDT B;  4NAW A;  4NAW B;  4BKT A;  2MP2 B;  2O2V B;  2KTR A;  4XC2 A;  1P3Q U;  4PS7 A;  2ZPY A;  3GOE A;  1IP9 A;  4MGI E;  1SGH A;  2KTF A;  2FID A;  4FJY A;  3M62 B;  4WWP A;  2FCS A;  1NBF C;  3CMM B;  5DPR A;  4EZK A;  2DYM A;  2PE6 B;  2DZK A;  1IYF A;  4A20 A;  4IC7 B;  3LDZ E;  2NCN A;  3M3J A;  1WFY A;  5DCN A;  3AI5 A;  2KJ6 A;  2DZM A;  1H8C A;  2IZV B;  3U7D A;  4TQ0 A;  3ZKJ C;  3TIX A;  3CSF A;  4DDG D;  3QAQ A;  4GN1 A;  5JHA A;  1TBE A;  4MSQ B;  3NHE B;  2JF5 A;  1WJ4 A;  3K9P B;  1E7U A;  1I42 A;  2FCM A;  1WXV A;  2LGX A;  4PS3 A;  5AEK B;  2WX1 A;  5CHW A;  4GB9 A;  4WQO B;  4AUQ C;  2JUO A;  3ZRC A;  5E6O A;  2L0T A;  3KW5 B;  4HDQ A;  4A3O A;  2KK8 A;  4NNJ B;  4EKU A;  2AYO B;  2ZJD A;  1H4R A;  3DBL I;  4KSK C;  1GG3 A;  1E8Z A;  5LLI A;  3ZTD A;  1KJT A;  2FCN A;  2NVU I;  2NBV B;  1OGW A;  4GGQ A;  2JT4 B;  3ZTC A;  3JYU A;  3DBH I;  4G11 A;  4DHZ B;  2GBJ A;  4CO7 A;  2NBW B;  3BY4 B;  5LXH A;  2DX5 B;  2HJ8 A;  3APC A;  5D2M B;  2KXJ A;  2V4L A;  4K7U A;  2CS4 A;  4W9C A;  4LJP B;  2KQS A;  4URK A;  3V61 A;  3SU8 X;  1WXA A;  2KWV B;  1J0G A;  2EMT A;  2LAS A;  3R7Q A;  4K1R B;  3BIN A;  2J0M A;  2LRW A;  1Q5W B;  3OJ3 A;  2L8J A;  3OAW A;  1UD7 A;  1A5R A;  3ZO5 B;  4EOY A;  3EHV A;  5AZG A;  4B9K A;  4BVU C;  3O65 B;  1Y8R C;  5E6P A;  4A3P A;  3SD5 A;  4ZRI A;  4AOF A;  2R2Q A;  4GDK B;  2KDI A;  3EFU A;  3IHP C;  1E90 A;  3HIZ A;  3DDC B;  2GBK A;  4NJ6 A;  3U8Z A;  1QZE A;  4HCN B;  4TUU A;  2O6V D;  3N30 A;  3CST A;  4E71 A;  2BYV E;  1V2Y A;  4N9F 4;  4B6W A;  3V6E B;  2HTH A;  4MEM A;  5DPT A;  2D2Q A;  1WGY A;  4EZJ A;  2VRR B;  2EMS A;  2BWE S;  2J0K A;  4GIV A;  2G4S A;  4OVV A;  5FR6 A;  1X1M A;  5IA7 A;  2L3Z A;  3B0A A;  1KLV A;  2BYE A;  4IM2 A;  3IBE A;  3V60 A;  3VH3 B;  2KDF B;  4MEL A;  3WAN A;  3H9D A;  1WX9 A;  2J7Q B;  3NS8 A;  3C0R B;  3ZNG C;  3PV1 A;  3QX1 A;  4HJK A;  3GZN I;  2XK5 B;  2KKC A;  2CHX A;  4JQW C;  5DPS A;  1E8W A;  1GC7 A;  4WAA A;  1G6J A;  3UIP B;  3WAO A;  4ZDV A;  5C1Z A;  2FUH B;  4GSW A;  2KMC A;  2MBQ A;  1WXS A;  2KVR A;  4E74 A;  1GJZ A;  2KDE B;  4GDL A;  4MGY E;  1ZKH A;  4LDT D;  2MBH A;  3IVF A;  4EEW A;  1EF1 A;  2M17 A;  2MLB A;  1WRD B;  4II3 B;  1V6E A;  1EUV B;  4CYE A;  3PLU A;  3PZD A;  4KSL C;  2I1J A;  3A4S C;  3X23 A;  2N4F A;  1WH3 A;  1TZ1 A;  5AZF A;  1JRU A;  1UEL A;  3H1U A;  4IW0 A;  4BOZ B;  3EC8 A;  3RUL A;  1UGM A;  4F1S A;  5HKH A;  1YQB A;  4NPN A;  4W9H A;  3R7R A;  1UZX B;  3I3T B;  5JZE B;  2K8C A;  2LI5 A;  4CHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...