4RM9A

Crystal structure of human ezrin in space group c2221
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 368
sequence length 586
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm9A01
3PS6A 2L7RA 1RLFA 2O6VD 3IHPC 2CR5A 2DZKA 2C5LC 4II2B 3A1QA 2KDBA 3KYCD 2BYVE 2K8HA 3N3KB 4JQWC 4TQ0A 4FADA 2ZPYA 2NBUA 4EFOA 2REXA 1TBEA 1WZ3A 2K6DB 2Z59B 4A3PA 4IUMB 1WF9A 2K6QA 2V3SA 2R2OA 2GOWA 4J6IA 2GBKA 5G2NA 3ZDTA 1P3QU 2JRHA 3OJ4B 4OVVA 3VTVA 2BWES 2N9PC 4NPNA 4E71A 3PGEA 1M94A 2NBVB 3IVFA 4XX5A 3QARA 3L54A 3QC8B 1WJUA 3ZKJC 3EHVA 3DBSA 4DHJB 4BVUC 4HDOA 3V6CB 2KFJA 2R2QA 4BKSA 5J17A 5CTRC 1WXVA 4EZKA 1FXTB 4KIKB 2DYMA 4DDGD 2V1YA 2LASA 2PJHA 2DAFA 2NPTB 2KDFB 5L95C 1UGMA 2KQ7A 4GGQA 4ANXA 4GXBA 3Q3JA 1HE8A 3MHSD 1LM8B 3P2BA 4LCDE 2CHXA 3RZWC 2KN5A 3DVGY 3KW5B 1E7UA 2V4LA 1Q0WB 4A20A 3ECIA 2AWTA 3VUWA 2NPTA 4PYUA 2AL3A 2CKHB 2L00B 4IM2A 2K39A 3IBEA 4IM3A 3PV1A 2JZZA 2BGFA 3ML8A 5E6PA 3VH3B 3GOEA 1WJNA 3HK0A 3ZTDA 2IO2B 3BY4B 3ZNGC 3HHMA 5E6OA 2MBHA 2N1VA 4I6PA 3AI5A 2ZNVB 2KMCA 3QWZB 1J8CA 2N9EB 2K1FA 2BYFA 4WWPA 4ZRIA 1XT9B 3WA0A 1GJZA 1P1AA 3WAMA 4CYEA 4DHZE 4DWFA 5JH5C 2NR2A 3SHQA 3VTUA 1G6JA 2MQJA 1U4AA 4WJNA 3DVGX 2EKEC 2DYOA 3ZRCA 1I35A 1WXMA 3H7SA 3L16A 4MH0E 1L7YA 4B6WA 5JHAA 2PPHA 2MWSB 2OOBB 2KTRB 3A9JA 3JVZX 3OAWA 4M8MA 3B08A 3KYDD 3M3JA 2IZVB 2YVCA 1XD3B 3PLUA 2NCNA 5BO4B 1BT0A 4KV2A 3VHTC 3RZFA 1KM7A 3SDLC 2EMSA 3RT3B 3AXCA 5CHFA 5LXIB 2KJRA 4EKUA 1H8CA 1WGRA 1SIFA 4ZYNA 1Q5WB 2D3GA 2WWZA 3PVLA 3N30A 2K8CA 4FULA 1UZXB 1WR6E 4KZCA 4F7ZA 3L17A 2C7HA 2EMTA 3ZVVA 4W9HA 1RFAA 4HCNB 1Z2MA 4F1SA 2FUHB 4FJVB 1LFDA 3EC8A 5D94A 1V9JA 2M17A 4G0NB 2FNJB 2CS4A 5LLIA 3U8ZA 1OQYA 2LGYA 2MBEA 3MJWA 4KZ0A 5J2RA 5HKHA 2RPQA 2JZ3B 1T0YA 2IY1B 3ZTCA 4IC7B 3N32A 2FCNA 2XK5A 3QIJA 4HWIB 3ZNID 3L10B 4JLCA 2AYOB 4AJWA 3H7PB 4N9F4 2KNBA 3R3MA 3L08A 1WIAA 2WDTB 5KHQA 3R66C 4URKA 2ZCCA 1X1MA 3I3TB 4ANVA 3W1SA 1V2YA 1E5WA 4MGIE 1YJ1A 3EECA 3QJZA 3H7PA 1UD7A 3TBLD 1IPGA 3AU4A 5IAAC 4W9FA 1JRUA 2PE6B 2ZZPB 5CHWA 4ZDVA 2KK8A 3LDZE 1SGHA 3H6NA 4NJ6A 1J0GA 1P9DU 2Y5BB 1YQBA 2KZRA 3C0RB 2KFKB 2CHWA 4II3B 3KH0A 3DCGA 1Z5SB 1WXSA 1E8YA 4NY0A 1GC6A 4HDQA 2LVQA 2UWQA 5C1ZA 2G45B 4MSMB 3S2AA 5JHBA 2RD0A 3ONSA 3ZIMA 5DPSA 1IP9A 4BBNF 3A4SC 1WXAA 2PE9A 2HTHA 4K1RB 3RULA 2BKFA 3QK0A 4IW0A 2I1JA 5C23A 4HCPB 3UIOB 2KVRA 2G4DB 3QQ8B 4HVBA 2MBOA 5JZEB 2CHZA 4KSLC 3D32A 2KO3A 3VH4B 3PREA 2D2QA 2O6VB 1K8RB 4DBGA 2LWPA 2MCNB 1E8ZA 1WX7A 4BKSD 2JWZA 2MP2B 2GBNA 4IWQA 3VUYA 4K81A 2ZCBA 2L05A 4XZ4A 1I42A 4PS8A 2O6VA 3B1LX 3VTWA 3LJ3A 2OJRA 3IG3A 1V80A 3WALA 2IO3B 5GMVA 5DPRA 2LI5A 4ANUA 4M0WB 2JT4B 2KDEB 3CSFA 1L2NA 4KIKA 2KOXA 3APDA 3QA8A 4JGHB 3PSEB 4MJSB 4W9JA 1KJTA 3A9KB 4G50A 4X57B 4WWOA 4GIVA 2BWFA 3TIXA 3NZUA 2O2VB 4W9EA 1S1QB 2NS5A 2GMIC 4CHKA 2L0TA 4WJPA 2ZVNA 3CMMB 4MJSA 3R7RA 3EFUA 2IO1B 1UELA 4NQKE 3ZO5B 1P0RA 1OEYA 3W1YA 4EOYA 2KTFA 2KX3A 5DPTA 4AOFA 2W9NA 3X0WA 4P7IA 3CSTA 4BOSC 2JY6A 1ZW7A 1V5TA 1LXDA 4HPLB 4MGKE 4HPMB 2KD0A 4DHZB 4WWNA 1WE6A 3VDZA 2L3ZA 3B0AA 1V86A 4NQLB 3ZNHB 3NHEB 1YIWA 1R4NI 2B3AA 2J0KA 3UQBA 1GC7A 3KVFB 4GDLB 5TR5A 4ANWA 2DHZA 2K8BA 1WI0A 4OVUA 4TV3A 5KHOA 4RM8A 2UYZB 2BF8B 2AL6A 3WANA 2G4SA 4A3OA 2IY0B 3UQAA 2N7EA 4W9DA 5G55A 2KTRA 4W9CA 4EZJA 4GDKB 4NAWB 5EDSA 4MELA 4TQ1A 2DX5B 2Z0DB 3VVWB 1YX6B 4WAAA 1YD8U 2HJ8A 2KJHB 1WM2A 3PTFC 2LRUA 4I6LB 1WFYA 3QHTA 4F8CB 2FIFA 3ZLZA 3PHXB 3NOBA 4GSWA 4ICUA 3AULA 2LGXA 1KLVA 3DDCB 4WJQA 4HXDA 1WZ0A 2KC2A 3T8MA 5CX3A 3L13A 4W9LA 3PZDA 3SD5A 2NBWB 2ZVOA 4BOZB 3AU5A 4LDTD 1EO6A 5J18A 1VD2A 3OJ3A 1J19A 3H9DA 4GOCA 1UBIA 3V62A 2BPSA 2KXJA 2M8SA 4M8NA 2BYEA 1UBQA 2FAZA 4GN1A 4AUQC 1E90A 4KSKC 2LZ6A 2A5UA 2I1KA 3NZSA 4FN2A 4JIOU 1LQBA 3JYUA 5D2MB 3ENEA 2BKRB 5D6JB 2ZPNA 1WR1A 3VUXA 4PS7A 2MLBA 2D07B 5AZGA 3ZRFA 5L83A 2J0JA 4XC2A 2MSED 3QAQA 1PQSA 3MTNB 2JF5A 4EEWA 4MGYE 1ISNA 2LUEA 1UH6A 2CU1A 2KMAA 2KWUB 2L0FA 1RRBA 2XBBC 2A4ZA 1MG8A 3V60A 2JXXA 2KFKA 3SU8X 5E6NA 2DZMA 2KJ6A 4PS3A 2GBRA 2JVCA 2N4FA 1WYWB 2PEAA 4FJYA 1OEYJ 2LVOA 4KDIC 4LJPB 2MX2A 2KC1A 1TZ1A 2NVUI 3JW0X 3NS8A 1ZKHA 1WMHB 2JUOA 1E8WA 1SE9A 1WJ4A 4K7WA 4FLHA 4B9KA 1AARA 3DBLI 3PT2B 3TJPA 4ICVA 4IG7B 1P98A 2KLCA 1WMHA 4FBJB 4W9IA 5LXHA 1QZEA 1WE7A 4DHJD 3CF6E 2DAJA 4DXAB 2GBJA 4EUTA 2MP2A 2QHOA 1NBFC 2KDIA 3VXWA 4MM3A 4G3XB 1XQQA 2FCQA 2KWCA 1C1YB 1ZGUB 2FCMA 3M62B 4ZRJA 2M0XA 4BBNC 2L76A 1V49A 5D7GA 2C60A 4DDID 3ML9A 3QCAA 4BKGA 2ZEQA 2FCSA 3KUZA 2AEHA 1WGDA 2KANA 1E7VA 2LVPA 1EF5A 3RUIB 2IBIB 2D10A 4HLEA 1Y8RC 3M95A 3Q3FA 3JSVB 3K9OB 1OTRB 4K7SA 3WIMA 1YX5B 3W1SC 1R4MI 3A9KA 3HM6X 3A4RA 4GU2A 5DPWA 3PPAA 1E8XA 4PYZA 1NI2A 2O2VA 3X23A 4CO7A 3U30A 1OGWA 3HM3A 3DBRI 4FA6A 3JSVA 2C9WB 3ZDMC 3VAWA 2G3QB 2ASQA 3H1UA 2N9XA 5AZFA 3DVNU 3M63B 3ALBA 4HK2A 5AEKB 3TL5A 2RGFA 3A33B 4NJ7A 4E74A 2DYBA 4LJOB 2WX1A 3RYTA 4GMVA 2XEWA 1WM3A 4E3CA 4HJKA 2LD9A 1WJ6A 2DZJA 3PLVA 5AZHA 3UF8A 2LXAA 3DVNV 1EF1A 4FHKA 3T9LA 3ZW3A 4BKTA 1RAXA 4GDLA 4IM0A 4BFRA 3PRZA 3A9JB 3R7QA 2KWVB 4ZRKA 5DCNA 2RSUA 4TUUA 4W9KA 2WX0A 2J0MA 3U7DA 4FJZA 2MA9B 4G11A 5IA7A 3BINA 3ZUNA 3DOWA 1WX9A 4IWPA 2DENB 3PHWB 1WY8A 2LRWA 4RMAA 4GDKA 4YL8A 4NAWA 4NNJB 2KX0A 5CHVC 2MBQA 3TMPB 2MRPA 2ZJDA 1V5OA 1TGZB 2D11A 3WAOA 3DBHI 1WRDB 2C7MB 1WX8A 1TTNA 2LJ5A 2KQSA 1NDDA 5FR6A 1WGHA 4WJOA 3K9PB 4TKNA 3KUDB 4KDLB 3L0WB 3V6EB 2JRIB 4MEMA 3QX1A 4W9GA 1S3SG 1WGGA 3NY5A 1IYFA 3VFKA 1WGYA 3KUCB 2FIDA 3RCZA 3HIZA 3GZNI 3UGBB 4JL9A 1GUAB 3ZNZB 2LGDA 1Q1OA 2DZIA 2KHWB 2MBBB 1H4RA 2XK5B 4KVGB 3DQVA 4IWOA 3WAPA 3UINB 2LXCA 2Z0EB 2HE7A 4LDTB 4AP4C 4EZLA 2WYQA 1A5RA 4WQOB 2M4NA 2C7NB 2MW5A 1GG3A 1V6EA 1WH3A 1V81A 2YLMA 4AWJA 4FHJA 4MDKE 3UIPB 2KKCA 1CMXB 2K25A 3VQIA 4DK5A 2JPHA 3V61A 4MGZE 3O65B 2N7DA 2M1MA 2J7QB 2ZNVC 3OLMD 2VRRB 2HD5B 2IYDB 3PRPB 2RR9A 1GNUA 3APCA 3PRMB 2KLGA 4AJYB 3TCAA 4MSQB 4ASWC 3RD2A 2GBMA 2IO0B 3DPDA 4RM9A 2N1WA 1C3TA 1EUVB 3IFWB 3A1QB 1VCBA 2L8JA 4I6NB 4K7UA 3APFA 1D3ZA 4B95A 1KOTA 4GB9A 1F9JA
chains in the Genus database with same CATH superfamily
3FILA 1RLFA 1FXIA 2C5LC 1QOAA 5BMGA 3DHGC 4JQWC 2ZPYA 2N7JA 1DYQA 1V1PA 3AE8B 1XCQL 3KLSX 2V3SA 3OJ4B 4OVVA 2N9PC 3PGEA 3IVFA 3QARA 3L54A 3TEYA 1J7CA 3V6CB 1HTQA 4BKSA 2BS3B 5CTRC 2V1YA 2KDFB 4ACFA 2RDGA 4ANXA 3RI7C 1LM8B 2MEKA 4C56C 1Q0WB 4A20A 4XWTA 2AWTA 2D5GA 3VUWA 2NPTA 2J42A 2K39A 1NEKB 2WGSA 2YEPB 2H88B 1CJEA 2N1VA 1WGKA 2N9EB 2BYFA 1GJZA 4JWUC 5HHDG 3DVGX 1QKZA 3L16A 1L7YA 3OAWA 2FUG1 4N6EB 5D3IB 1XF5L 3KYDD 2IZVB 1XD3B 1BT0A 4KV2A 3VHTC 1HQRD 2EMSA 5C3JB 2W82A 2WWZA 4F7ZA 1WR6E 5T8IA 3ZVVA 4HKZE 4F1SA 4ARIA 3EC8A 2M17A 2FNJB 2CS4A 2MBEA 3VRAB 3N32A 2XK5A 3ZNID 1T0QC 4JLCA 5BYQA 1FD6A 1WIAA 1UF0A 1X1MA 2N0SB 3H7PA 2QMTA 1UD7A 5FKAC 1FRDA 5CHWA 2Y3AA 1SGHA 1IGCA 2Q5WD 3FKYA 3DCGA 1WXSA 3P4RB 1TS3A 4KGTA 2G45B 1I4PA 1HXYD 5IP4D 3A4SC 2HTHA 4K1RB 3RULA 3UIOB 2INNE 2KYWA 4LNNA 2KO3A 3PREA 2K9XA 2JZPA 2HDEA 4XE0A 4BKSD 2HJ1A 3VUYA 4K81A 2L52A 2O6VA 4OHJA 3B1LX 3LJ3A 1IBXA 1XLOA 4P1BC 2IO3B 2AQ2B 2LI5A 3DHIC 2DBYA 2KOXA 4JGHB 1FRRA 2NTTA 4GIVA 2BWFA 2AQ3B 2VH2A 1ACCA 2WXPA 3ZJVA 2NS5A 1PGBA 4CHKA 3TSSA 1DOIA 4WJPA 3CMMB 3EFUA 4NQKE 3ZO5B 1P0RA 4EOYA 2E6XA 4P7IA 4BOSC 2JY6A 1ZW7A 2G9HD 4B0EA 1LXDA 4HPLB 4MGKE 4HPMB 4DHZB 4XWWA 1WE6A 1N5WA 2L3ZA 4IOIE 4NQLB 3ZNHB 3BK2A 4KKJA 1PDXA 2IGDA 3UQBA 3KVFB 4GDLB 2K8BA 4OVUA 3ZJTA 5KHOA 4RM8A 2LHDA 3U52E 1TJEA 2AL6A 3R2IA 1RM6C 2N7EA 5G55A 4L1BA 3VRBB 4YTNB 4RF0A 4BAXA 2Z0DB 1VDVA 4JX1C 3PTFC 1OFFA 1WFYA 4F8CB 3ZLZA 1E10A 3Q2AC 4ICUA 1KFYB 1KLVA 1TKEA 2BB5A 1UGJA 5CX3A 4AQ7A 1KTKA 3PZDA 3IAS1 3SD5A 3C8YA 3MC9A 1EO6A 1KLUD 1VD2A 1FMAD 2KXJA 2M8SA 4M8NA 1UBQA 2FAZA 4GN1A 4AUQC 4NAMA 5E6JA 3ENEA 2VZKD 2GI9A 3VUXA 2MLBA 5L83A 2J53A 1T6BX 2V3PA 3AECB 3RNBC 1PQSA 3ZYYX 4MGYE 2KWUB 2L0FA 2XBBC 5EE9A 2JXXA 2KFKA 2DZMA 2INDC 2JVCA 3FILB 4FJYA 4US8A 2NVUI 1ZKHA 1E8WA 1SE9A 4FXCA 1V1PB 1HTOA 4W9IA 1QZEA 4PT5A 4DXAB 2K22A 2GBJA 1M4VA 2KDIA 4RCOA 4MM3A 4G3XB 2FCQA 3TEXA 1C1YB 1ZGUB 3BYYB 3IT6B 1UWXA 3AE7B 4HKQA 3KUZA 3FC4A 1MG4A 4YSXB 4L2YA 2D10A 4C4VB 3Q3FA 2FE8A 3A9KA 3HM6X 3X23A 4CO7A 5EE3A 3U30A 1L0YB 3HM3A 3JSVA 2G3QB 3H1UA 1RWSA 3BVMA 4Q2JA 1ZDXA 5C2TB 4GMVA 1L4ZB 2JU6X 2LD9A 1WJ6A 4BKTA 3DVNV 2WDVB 3T9LA 1NI3A 2JSVX 3R7QA 2KWVB 4ZRKA 4TUUA 2QDFA 1ENFA 2DENB 2AQ1B 4GDKA 4NAWA 4NNJB 2W3RA 2YEPF 4KGRA 2TSSA 1WRDB 3E56A 4ZHPA 1WX8A 1GPXA 4US9A 3ETRA 4M01A 3K9PB 2WXKA 4MEMA 1N62A 3QX1A 3NY5A 3UGBB 2XK5B 2KHWB 2WXJA 3AMZA 4EZLA 2WU5B 1HZ6A 2LMCA 1WH3A 4AWJA 1FO4A 1CQVA 3VQIA 3P4PB 3V61A 2N7DA 2M1MA 2VZKB 2ONQA 5AUIA 2WQYB 1GNUA 2KLGA 4MSQB 2GBMA 1VCBA 1D3ZA 4HPPA 4GB9A 1F9JA 1FNWA 4R3DA 2CR5A 2DZKA 3A1QA 3N3KB 4FADA 1TBEA 4CQNA 1WZ3A 3DWGC 2WXMA 2Z8LA 3DWMA 3P4SB 4TSSA 4J6IA 2GBKA 3ZDTA 3MC0B 4RGMA 1JWUD 2KN4A 1IBXB 4E71A 1M94A 2NBVB 1MJDA 4REZA 4JPSA 1WJUA 4DQOC 3DBSA 4BVUC 1C4CA 2XNAC 2R2QA 1FXTB 2DYMA 4DDGD 1UGMA 1MPEA 4GGQA 3MHSD 4AS1A 4UDUC 2KN5A 2RDBC 2QCZA 2AL3A 2CKHB 4IM2A 1V1OA 3W9CB 3UI3A 1D6EC 5E6PA 4WWMA 1NYRA 1WJNA 3HK0A 4J3OD 2QSDA 3AI5A 1J8CA 3QWZB 3VTUA 2DYOA 3DBRB 1WXMA 3P42A 2OOBB 3JVZX 3BIID 1YQ4B 1KM7A 4RGNA 3U4EG 1SEBD 1L0VB 5CHFA 2KJRA 1C9FA 3Q8FA 4ZHOA 4KZCA 1L6VA 4RH6A 3ZXRA 4W9HA 1RFAA 4HCNB 1Z2MA 2PVOD 5LLIA 4DXGA 4KZ0A 5HKHA 1XLPA 2RPQA 3EA6A 2QIEB 3ZTCA 3QIJA 3DBHB 3EGRA 4DXFA 4N9F4 1JWBD 1T3QA 1P7EA 2WDTB 5HI1A 5KHQA 3R66C 4HEA1 3AEDB 3EECA 4OZCA 1IPGA 2V4IB 4W9FA 3TEWA 2PE6B 2ZZPB 1J0GA 3H6NA 1F0ZA 1LGRA 1YQBA 2KZRA 2KFKB 2CHWA 4II3B 2QJLA 1Z5SB 3RNEC 1L4DB 2LVQA 2UWQA 1UUPA 4MSMB 2RD0A 3ONSA 1IP9A 4BBNF 1WXAA 1NENB 1I4XA 2EKIA 3QK0A 2KVRA 2MBOA 2CHZA 4KSLC 1YMHE 5IKCM 3OG5A 2J4XA 2MCNB 1E8ZA 1WX7A 4C7ZA 4MM3B 1I4RA 4P6VF 2L05A 3VTWA 1FM0D 1YNTE 2JT4B 1WWTA 2KDEB 1L2NA 3HVDA 2MJ3A 4MJSB 3RMKC 3A9KB 4G50A 4WWOA 3TIXA 4W9EA 4S17A 2BT6A 2WU2B 2GMIC 3U7ZA 2L0TA 4WAFA 2ZVNA 2KDMA 1SB3C 2RPVA 3RN9C 2KTFA 2KX3A 5DPTA 2CJOA 4K3CA 2DNFA 2WXFA 4YXDB 2KD0A 4YT0B 4WWNA 3B0AA 1MI0A 5BMHA 5TR5A 3TEZA 4TV3A 1ZDVA 2BF8B 2IY0B 3UQAA 1F52A 4GDKB 4NAWB 4MELA 2PTLA 2DX5B 4WAAA 1YD8U 2KJHB 3MHZA 3QHTA 2FIFA 4GSWA 1K50A 2W55A 3AULA 3Q8AA 4WJQA 3I9V1 3NG0A 3EFCA 4LDTD 1TYGB 1TS5A 4GOCA 3OJ3A 1J19A 3H9DA 1UBIA 1F77A 2BYEA 3NZSA 4FN2A 1D5ZC 2L32A 3QAQA 3MTNB 2JF5A 1ISNA 2LUEA 1UH6A 2CU1A 2KMAA 2A4ZA 1MHXA 1MG8A 1K53A 3SU8X 3DHHC 5E6NA 1SE4A 2KJ6A 3AE2B 2UU7A 2GBRA 2N4FA 2PEAA 3Q8BA 1OEYJ 3RNCC 4LJPB 2MX2A 4HJGE 1WJ4A 4K7WA 4FLHA 2LHEA 1AARA 3DBLI 3PT2B 4ICVA 2D3AA 1P98A 3NUHB 1WMHA 3AE4B 4FBJB 3HUIA 4EUTA 2MP2A 3M62B 1XCTL 1VRAB 4BBNC 3SFDB 3KQ4A 3MP9A 2C60A 4DDID 3QCAA 4M0WA 2KANA 2IBIB 1EWYC 5H92C 3M95A 2WXLA 4HLEA 1FPYA 3K9OB 3NJTA 1JW9D 1ZUD2 1E8XA 1XXGA 2O2VA 3Q8EA 4PYZA 1XLQA 3DBRI 3ZDMC 2WXIA 3VAWA 1L5PA 3AN1A 3DVNU 3M63B 3ALBA 4HK2A 2X8XX 1F1HA 3TL5A 3A33B 2BQQA 3NVVA 4NJ7A 2DYBA 3LYYA 2XEWA 3TUOA 4E3CA 4HJKA 2QEJC 3ZW3A 1RAXA 1HZ5A 1T0RC 3GE3C 1N61A 3PRZA 5I4DA 1JCKB 4M00A 2MA9B 1HEZE 5IA7A 3PZ7A 3V3XA 1WY8A 2LRWA 4YL8A 5CHVC 4QAYA 3MFGA 2MRPA 1V5OA 1TY0A 2ZW0A 1TS4A 2BB6A 3DBHI 2LJ5A 2KQSA 1QT9A 5FR6A 2BYTA 2WXOA 3V6EB 4W9GA 4YTPB 3VFKA 1R7SA 3RCZA 3GZNI 2BS4B 2KMMA 1XLNA 3ZNZB 2LGDA 1GB1A 2MBBB 1H4RA 1VJKA 4LDTB 4AP4C 3CIRB 2WYQA 4LK0M 2M4NA 2H89B 1E9MA 3PZ8A 2PVGC 3GS2A 1CMXB 2HD5B 1JROA 2WLBA 2N1WA 1JWAD 4I6NB 4B95A 1QOFA 2N9KA 3PS6A 2L7RA 2O6VD 2QILA 3KYCD 1L0XB 2BYVE 2LEKA 4A6QA 1WRIA 2REXA 4KKIA 2PLPA 2K6DB 2Z59B 2WDRB 2LJIA 1AYFA 2EELA 4A3PA 4IUMB 2Y5CA 2K6QA 3BYTB 2R2OA 2GOWA 5G2NA 1P3QU 4S0RA 3NVWA 4NPNA 2B76B 4N58A 3B2GA 1T0SC 2KFJA 5J17A 1KF6B 4YSZB 5IN7A 1WXVA 4EZKA 1WXQA 2LASA 1KLGD 2PJHA 1B9RA 2NPTB 5G5GA 4KGSA 5L95C 4TMAB 3Q3JA 1SF0A 4C7YA 2JXTA 3RZWC 1ZP0B 2CHXA 1NYQA 3KW5B 2JYTA 3ECIA 3J9CA 2L00B 2JZZA 3BVZA 3GOEA 3ZTDA 2IO2B 3BY4B 3ZNGC 3HHMA 5E6OA 2MBHA 4I6PA 2KMCA 4WWPA 1XT9B 3WA0A 3WAMA 4CYEA 1IGDA 1ZE3D 4DWFA 5JH5C 5MPOA 1G6JA 2MQJA 3N1YC 1U4AA 4WJNA 2EKEC 3ZRCA 3T3OA 4MH0E 4B6WA 4XDCA 2PMVA 1C4PA 2YVCA 2NCNA 3ZGZA 3RT3B 3AXCA 5LXIB 4EKUA 1H8CA 1SIFA 3AE5B 4LNOA 1JWSD 2KACA 3L17A 2C7HA 2BS2B 1GAQB 2EMTA 4IDIA 4FJVB 1LFDA 1V9JA 5BYRA 1OQYA 3MJWA 5J2RA 2JZ3B 1T0YA 2IY1B 2BW2A 4IC7B 2FCNA 2W54A 1ZPSA 4RNAA 3L10B 1PGXA 2AYOB 4AJWA 3H7PB 3Q3MC 3L08A 2ZCCA 3I3TB 1CK1A 3W1SA 1V2YA 1E5WA 4MGIE 3QJZA 3TBLD 3BZDB 3AU4A 4WQMA 4ZDVA 1MVKA 4NJ6A 2CU3A 1P9DU 1SE2A 2Y5BB 3C19A 3KH0A 1ZXIA 2JWUA 4BZAA 3N1XC 5C1ZA 1C79A 3Q3OC 3ZIMA 5DPSA 4OZAA 2OJWA 3B2FA 2I1JA 4IW0A 4HCPB 5C23A 4MACA 2G4DB 3QQ8B 4HVBA 3MC8A 3AV8A 3VH4B 2BBCA 2D2QA 2O6VB 2LWPA 1DGJA 2D3CA 2Y5PA 2JWZA 2MP2B 2XN9C 5EE1A 2GBNA 4IWQA 2CJNA 2IDYA 4XZ4A 1I42A 4PS8A 1ET9A 3DBLB 2OJRA 3IG3A 1V80A 3WALA 5GMVA 2GB1A 5DPRA 4XDDA 4M0WB 3FAHA 3CSFA 3BVGA 2LGIA 3APDA 4KIKA 3CWIA 2M19A 3N9YC 2JYEA 3NZUA 1FFUA 2O2VB 4RGOS 1S1QB 1QF6A 3R7RA 3O13A 1K51A 2WS3B 3CSTA 2IJ0A 1V5TA 4XGAB 3VDZA 1V86A 1YIWA 3GE8C 2J0KA 1GC7A 1D5MC 2DHZA 2AX5A 1WI0A 2HTME 3NVZA 2G4SA 4A3OA 2D3BA 5FK9C 2KTRA 4W9CA 3KWLA 3AEAB 1Q10A 5EDSA 3VVWB 1JQ4A 1YX6B 1BUIC 2HJ8A 1VZ8A 2PKOA 1WM2A 2LRUA 4I6LB 3BWUD 2LFIA 3NOBA 3WCQA 3URYA 1AWDA 2LGXA 3P1MA 4A55A 1I4HA 2K0PA 4HXDA 1WZ0A 2KC2A 3T8MA 1YQ3B 4W9LA 2NBWB 3AU5A 3V62A 1VZ6A 1E90A 1AN8A 2LZ6A 2I1KA 3V05A 1WSPA 4YWGG 1LQBA 3JYUA 5D2MB 2WXGA 2BKRB 2ZPNA 1WR1A 1ET6A 3GZNB 2NMQA 2J0JA 2MSED 4ZYSA 4EEWA 3RPFC 1V8CA 3NS1A 4O1NA 3ZXVA 3AE3B 1RYJA 3HVZA 4OVZA 4PS3A 1WYWB 3P63A 4LLGM 1TZ1A 3NS8A 1SJED 1N60A 1T5XD 2SEBD 3VR8B 1UWMA 2KLCA 2BVCA 2G1EA 1WE7A 4DHJD 2DAJA 2QHOA 1NBFC 2OHFA 3VXWA 2KWCA 4ZRJA 1JMLA 2FCMA 1MHHE 4WIPA 2E3TA 1CZPA 2N9LA 2FCSA 1EU3A 1WGDA 2NTSA 3GB1A 3EUB2 3JSVB 4K7SA 4EE2A 4WH4A 1YX5B 3W1SC 5DPWA 4GU2A 3PPAA 3BK1A 1NI2A 1N6ZA 3SFEB 4C4VA 2ICIA 4FA6A 3NVYA 4LTUA 5AZFA 3N1ZC 5AEKB 3B9JA 1SXTA 2WX1A 1F2RI 3UF8A 4JE3B 5AZHA 1IUEA 3Q69A 2SAKA 3HRDD 4W9KA 2RMMA 3BINA 3ZUNA 1WX9A 1D5XC 3PHWB 4RMAA 2MBQA 3TMPB 3P4QB 4HRSA 1FXAA 1KRHA 1R4NB 1OQQA 1TGZB 3WAOA 4NZLB 1VR9A 1NDDA 2DWQA 4RF1A 1WGHA 1QLBB 4WJOA 1ESFA 3RFZB 4KDLB 2JRIB 1IYFA 2FIDA 4C80A 1YJIA 1GUAB 4P1CC 1J7AA 1ZXHA 4KVGB 4L23A 1VLBA 4IWOA 4OZBA 1B1ZA 3UINB 2LXCA 2Z0EB 1A5RA 4WQOB 1XEEA 1GG3A 1E6EB 1V6EA 1V81A 2PIAA 2YLMA 4FHJA 1TT5B 2K25A 3VR9B 2MHJA 2JPHA 4MGZE 3O65B 2ZNVC 3PRPB 1C76A 3APCA 3PRMB 1DOYA 3AE6B 4ASWC 1YOVB 3DPDA 4RM9A 1EUVB 2MH7A 3A1QB 2L8JA 1L6UA 4K7UA 1KOTA 4PK1A 1SSNA 1KH0A 1PYWD 3IHPC 4II2B 4C00A 2J52A 2KDBA 3R2TA 2K8HA 4TQ0A 2NBUA 4EFOA 5IOIA 2KVZA 1AW7A 2KT7A 4ZRQA 3N20C 1WF9A 2M0AA 4ZOHC 2JRHA 3VTVA 2L1AA 2BWES 4M02A 3E9SA 4XX5A 2KWDA 1SJHD 1FFVA 3QC8B 3ZKJC 1D4BA 2V3NA 1QQRA 3EHVA 4DHJB 2IGGA 2ACZB 4HDOA 1YN3A 4KIKB 3ZQ4A 2DAFA 2KQ7A 4GXBA 1HE8A 3P2BA 4LCDE 3DVGY 1E7UA 2V4LA 5H8YE 1SE3A 4PYUA 3IBEA 1TIFA 3PV1A 4IM3A 1J7BA 4A90A 2BGFA 3ML8A 1YN5A 1FEHA 2OEDA 2V0GA 3AM9A 3VH3B 2ZNVB 2K1FA 4JWSC 4ZRIA 1R4MB 1P1AA 4DHZE 1PUTA 2NR2A 3SHQA 1SIJA 3IXSA 1I35A 3H7SA 5JHAA 2PPHA 2MWSB 1PFDA 2KTRB 3A9JA 4M8MA 3B08A 3IAM1 3M3JA 2X38A 3PLUA 4MT5A 5BO4B 3RZFA 5AUKA 3AEFB 4RGTA 1JRPA 3SDLC 2FBWB 1MFWA 1FCCC 1VZ7A 3AH7A 1WGRA 4ZYNA 1Q5WB 3I5JC 2D3GA 3LXFA 3RNFC 3I57A 3PVLA 2RDHA 3N30A 2K8CA 4FULA 1UZXB 3SEBA 2FUHB 1GOZA 5D94A 4G0NB 3U8ZA 2LGYA 3NZ3A 4YSYB 1YJJA 4HWIB 3MJ5A 4KX6B 2KNBA 3R3MA 4URKA 4ANVA 3W5UB 2PW9A 1YJ1A 2V9HA 5IO9A 5IAAC 1JRUA 3GP7A 2KK8A 3LDZE 1QOBA 1QOGA 3C0RB 1LO5D 4USAA 1E8YA 4NY0A 1EWCA 1GC6A 2WHIA 4HDQA 4B0MA 3S2AA 5JHBA 1F2RC 4WURA 2PE9A 2BKFA 4ARCA 2LUMA 4NJCA 5JZEB 5D3DA 3D32A 2I2YA 1TKYA 2IPKD 1K8RB 1JALA 3PO0A 4DBGA 4IKGA 3AEGB 2ZCBA 3NRZA 1I4QA 5HG2A 3RNAC 3OWEB 1A70A 4ANUA 2MJEA 3QA8A 3PSEB 4W9JA 1KJTA 4N59A 4X57B 4H2AA 4MJSA 4ZRPA 5BYSA 2M56B 2WXQA 1E7PB 3RNGC 2IO1B 1UELA 3W1YA 1OEYA 1P7FA 3IT4B 3ABVB 4AOFA 2W9NA 3X0WA 3KWVA 2VH1A 1OQRA 1FIQA 1EM7A 3LB8C 4D2KA 2K5PA 1FNVA 3NHEB 1R4NI 2B3AA 4ANWA 2INPE 2UYZB 3WANA 4W9DA 4EZJA 1FCLA 1JWMD 4LNIA 4TQ1A 2WXRA 1HA5A 2WXHA 2INCC 2ON8A 1C4AA 1STEA 1BXTA 3PHXB 4P16A 1TZOA 1I4GA 2DLBA 4A8XC 3DDCB 1YN4A 1PGAA 3L13A 3L4PA 5HFYA 2ZVOA 4BOZB 5J18A 4GLSC 2BPSA 3SR6A 4KSKC 2A5UA 4JIOU 5D6JB 4PS7A 2D07B 5AZGA 3ZRFA 4XC2A 5FR3A 3H8HA 4RFBA 5LNK1 4ITKA 4HROA 1RRBA 3V60A 3W2DA 4K3BA 1EU4A 2KQ4X 2LVOA 4A9AA 4YTMB 4KDIC 4LNKA 2KC1A 3JW0X 4XYCA 3AEEB 1WMHB 2JUOA 3I63C 5JXVA 1UNSA 2W3SA 4B9KA 1TY2A 3TJPA 4IG7B 5LXHA 3CF6E 1ROEA 2WP9B 2JX5A 3U2SC 1XQQA 1I7HA 1ZOYB 2M0XA 3Q6BA 2L76A 1V49A 1N63A 5D7GA 2WNMA 3ML9A 3Q14C 4BKGA 2ZEQA 2AEHA 2LVPA 4MH8A 1E7VA 3AE9B 1EF5A 3RUIB 1Y8RC 2WDQB 2I38A 5EE0A 3WIMA 1OTRB 1K52A 2GLSA 1R4MI 2ZW1A 3A4RA 1QILA 2QC8A 1OGWA 1RFKA 2C9WB 2ASQA 1BMLC 2N9XA 3R8BA 1TKGA 4OW0A 2MJDA 2RGFA 3Q8CA 4E74A 1Y56A 4LJOB 1TS2A 3RYTA 1FNUA 1WM3A 3T3NA 2IGHA 5BMIA 1C78A 1NVID 2DZJA 3PLVA 2LXAA 1EF1A 4FHKA 4GDLA 4IM0A 4BFRA 3A9JB 5DCNA 2RSUA 2WX0A 2J0MA 3U7DA 4FJZA 4G11A 3DOWA 4IWPA 2JQRB 2KX0A 1N5XA 2ZJDA 1WYGA 2D11A 2C7MB 2BTEA 1TTNA 1SBBB 2K3UA 4TKNA 3KUDB 3L0WB 2L83A 1S3SG 1WGGA 1WGYA 3KUCB 3HIZA 4JL9A 1Q1OA 2DZIA 3DQVA 3AE1B 1GB4A 2WXNA 3WAPA 3Q3NC 2HE7A 1E0ZA 2KAJA 2C7NB 2MW5A 1V97A 4MDKE 3UIPB 2KKCA 4DK5A 3ZJUA 1DOXA 2J7QB 3OLMD 5G5HA 2LGSA 2VRRB 4LNFA 5TSSA 3W5VB 2IYDB 2GRIA 2R61A 2RR9A 3AB5A 4AJYB 1C77A 3TCAA 3RD2A 2IO0B 1C3TA 5GXGB 1XO3A 3IFWB 3AEBB 3APFA
chains in the Genus database with same CATH topology
3PS6A 2L7RA 1RLFA 2O6VD 3IHPC 2CR5A 2DZKA 2C5LC 4II2B 3A1QA 2KDBA 3KYCD 2BYVE 2K8HA 3N3KB 4JQWC 4TQ0A 4FADA 2ZPYA 2NBUA 4EFOA 2REXA 1TBEA 1WZ3A 2K6DB 2Z59B 4A3PA 4IUMB 1WF9A 2K6QA 2V3SA 2R2OA 2GOWA 4J6IA 2GBKA 5G2NA 3ZDTA 1P3QU 2JRHA 3OJ4B 4OVVA 3VTVA 2BWES 2N9PC 4NPNA 4E71A 3PGEA 1M94A 2NBVB 3IVFA 4XX5A 3QARA 3L54A 3QC8B 1WJUA 3ZKJC 3EHVA 3DBSA 4DHJB 4BVUC 4HDOA 3V6CB 2KFJA 2R2QA 4BKSA 5J17A 5CTRC 1WXVA 4EZKA 1FXTB 4KIKB 2DYMA 4DDGD 2V1YA 2LASA 2PJHA 2DAFA 2NPTB 2KDFB 5L95C 1UGMA 2KQ7A 4GGQA 4ANXA 4GXBA 3Q3JA 1HE8A 3MHSD 1LM8B 3P2BA 4LCDE 2CHXA 3RZWC 2KN5A 3DVGY 3KW5B 1E7UA 2V4LA 1Q0WB 4A20A 3ECIA 2AWTA 3VUWA 2NPTA 4PYUA 2AL3A 2CKHB 2L00B 4IM2A 2K39A 3IBEA 4IM3A 3PV1A 2JZZA 2BGFA 3ML8A 5E6PA 3VH3B 3GOEA 1WJNA 3HK0A 3ZTDA 2IO2B 3BY4B 3ZNGC 3HHMA 5E6OA 2MBHA 2N1VA 4I6PA 3AI5A 2ZNVB 2KMCA 3QWZB 1J8CA 2N9EB 2K1FA 2BYFA 4WWPA 4ZRIA 1XT9B 3WA0A 1GJZA 1P1AA 3WAMA 4CYEA 4DHZE 4DWFA 5JH5C 2NR2A 3SHQA 3VTUA 1G6JA 2MQJA 1U4AA 4WJNA 3DVGX 2EKEC 2DYOA 3ZRCA 1I35A 1WXMA 3H7SA 3L16A 4MH0E 1L7YA 4B6WA 5JHAA 2PPHA 2MWSB 2OOBB 2KTRB 3A9JA 3JVZX 3OAWA 4M8MA 3B08A 3KYDD 3M3JA 2IZVB 2YVCA 1XD3B 3PLUA 2NCNA 5BO4B 1BT0A 4KV2A 3VHTC 3RZFA 1KM7A 3SDLC 2EMSA 3RT3B 3AXCA 5CHFA 5LXIB 2KJRA 4EKUA 1H8CA 1WGRA 1SIFA 4ZYNA 1Q5WB 2D3GA 2WWZA 3PVLA 3N30A 2K8CA 4FULA 1UZXB 1WR6E 4KZCA 4F7ZA 3L17A 2C7HA 2EMTA 3ZVVA 4W9HA 1RFAA 4HCNB 1Z2MA 4F1SA 2FUHB 4FJVB 1LFDA 3EC8A 5D94A 1V9JA 2M17A 4G0NB 2FNJB 2CS4A 5LLIA 3U8ZA 1OQYA 2LGYA 2MBEA 3MJWA 4KZ0A 5J2RA 5HKHA 2RPQA 2JZ3B 1T0YA 2IY1B 3ZTCA 4IC7B 3N32A 2FCNA 2XK5A 3QIJA 4HWIB 3ZNID 3L10B 4JLCA 2AYOB 4AJWA 3H7PB 4N9F4 2KNBA 3R3MA 3L08A 1WIAA 2WDTB 5KHQA 3R66C 4URKA 2ZCCA 1X1MA 3I3TB 4ANVA 3W1SA 1V2YA 1E5WA 4MGIE 1YJ1A 3EECA 3QJZA 3H7PA 1UD7A 3TBLD 1IPGA 3AU4A 5IAAC 4W9FA 1JRUA 2PE6B 2ZZPB 5CHWA 4ZDVA 2KK8A 3LDZE 1SGHA 3H6NA 4NJ6A 1J0GA 1P9DU 2Y5BB 1YQBA 2KZRA 3C0RB 2KFKB 2CHWA 4II3B 3KH0A 3DCGA 1Z5SB 1WXSA 1E8YA 4NY0A 1GC6A 4HDQA 2LVQA 2UWQA 5C1ZA 2G45B 4MSMB 3S2AA 5JHBA 2RD0A 3ONSA 3ZIMA 5DPSA 1IP9A 4BBNF 3A4SC 1WXAA 2PE9A 2HTHA 4K1RB 3RULA 2BKFA 3QK0A 4IW0A 2I1JA 5C23A 4HCPB 3UIOB 2KVRA 2G4DB 3QQ8B 4HVBA 2MBOA 5JZEB 2CHZA 4KSLC 3D32A 2KO3A 3VH4B 3PREA 2D2QA 2O6VB 1K8RB 4DBGA 2LWPA 2MCNB 1E8ZA 1WX7A 4BKSD 2JWZA 2MP2B 2GBNA 4IWQA 3VUYA 4K81A 2ZCBA 2L05A 4XZ4A 1I42A 4PS8A 2O6VA 3B1LX 3VTWA 3LJ3A 2OJRA 3IG3A 1V80A 3WALA 2IO3B 5GMVA 5DPRA 2LI5A 4ANUA 4M0WB 2JT4B 2KDEB 3CSFA 1L2NA 4KIKA 2KOXA 3APDA 3QA8A 4JGHB 3PSEB 4MJSB 4W9JA 1KJTA 3A9KB 4G50A 4X57B 4WWOA 4GIVA 2BWFA 3TIXA 3NZUA 2O2VB 4W9EA 1S1QB 2NS5A 2GMIC 4CHKA 2L0TA 4WJPA 2ZVNA 3CMMB 4MJSA 3R7RA 3EFUA 2IO1B 1UELA 4NQKE 3ZO5B 1P0RA 1OEYA 3W1YA 4EOYA 2KTFA 2KX3A 5DPTA 4AOFA 2W9NA 3X0WA 4P7IA 3CSTA 4BOSC 2JY6A 1ZW7A 1V5TA 1LXDA 4HPLB 4MGKE 4HPMB 2KD0A 4DHZB 4WWNA 1WE6A 3VDZA 2L3ZA 3B0AA 1V86A 4NQLB 3ZNHB 3NHEB 1YIWA 1R4NI 2B3AA 2J0KA 3UQBA 1GC7A 3KVFB 4GDLB 5TR5A 4ANWA 2DHZA 2K8BA 1WI0A 4OVUA 4TV3A 5KHOA 4RM8A 2UYZB 2BF8B 2AL6A 3WANA 2G4SA 4A3OA 2IY0B 3UQAA 2N7EA 4W9DA 5G55A 2KTRA 4W9CA 4EZJA 4GDKB 4NAWB 5EDSA 4MELA 4TQ1A 2DX5B 2Z0DB 3VVWB 1YX6B 4WAAA 1YD8U 2HJ8A 2KJHB 1WM2A 3PTFC 2LRUA 4I6LB 1WFYA 3QHTA 4F8CB 2FIFA 3ZLZA 3PHXB 3NOBA 4GSWA 4ICUA 3AULA 2LGXA 1KLVA 3DDCB 4WJQA 4HXDA 1WZ0A 2KC2A 3T8MA 5CX3A 3L13A 4W9LA 3PZDA 3SD5A 2NBWB 2ZVOA 4BOZB 3AU5A 4LDTD 1EO6A 5J18A 1VD2A 3OJ3A 1J19A 3H9DA 4GOCA 1UBIA 3V62A 2BPSA 2KXJA 2M8SA 4M8NA 2BYEA 1UBQA 2FAZA 4GN1A 4AUQC 1E90A 4KSKC 2LZ6A 2A5UA 2I1KA 3NZSA 4FN2A 4JIOU 1LQBA 3JYUA 5D2MB 3ENEA 2BKRB 5D6JB 2ZPNA 1WR1A 3VUXA 4PS7A 2MLBA 2D07B 5AZGA 3ZRFA 5L83A 2J0JA 4XC2A 2MSED 3QAQA 1PQSA 3MTNB 2JF5A 4EEWA 4MGYE 1ISNA 2LUEA 1UH6A 2CU1A 2KMAA 2KWUB 2L0FA 1RRBA 2XBBC 2A4ZA 1MG8A 3V60A 2JXXA 2KFKA 3SU8X 5E6NA 2DZMA 2KJ6A 4PS3A 2GBRA 2JVCA 2N4FA 1WYWB 2PEAA 4FJYA 1OEYJ 2LVOA 4KDIC 4LJPB 2MX2A 2KC1A 1TZ1A 2NVUI 3JW0X 3NS8A 1ZKHA 1WMHB 2JUOA 1E8WA 1SE9A 1WJ4A 4K7WA 4FLHA 4B9KA 1AARA 3DBLI 3PT2B 3TJPA 4ICVA 4IG7B 1P98A 2KLCA 1WMHA 4FBJB 4W9IA 5LXHA 1QZEA 1WE7A 4DHJD 3CF6E 2DAJA 4DXAB 2GBJA 4EUTA 2MP2A 2QHOA 1NBFC 2KDIA 3VXWA 4MM3A 4G3XB 1XQQA 2FCQA 2KWCA 1C1YB 1ZGUB 2FCMA 3M62B 4ZRJA 2M0XA 4BBNC 2L76A 1V49A 5D7GA 2C60A 4DDID 3ML9A 3QCAA 4BKGA 2ZEQA 2FCSA 3KUZA 2AEHA 1WGDA 2KANA 1E7VA 2LVPA 1EF5A 3RUIB 2IBIB 2D10A 4HLEA 1Y8RC 3M95A 3Q3FA 3JSVB 3K9OB 1OTRB 4K7SA 3WIMA 1YX5B 3W1SC 1R4MI 3A9KA 3HM6X 3A4RA 4GU2A 5DPWA 3PPAA 1E8XA 4PYZA 1NI2A 2O2VA 3X23A 4CO7A 3U30A 1OGWA 3HM3A 3DBRI 4FA6A 3JSVA 2C9WB 3ZDMC 3VAWA 2G3QB 2ASQA 3H1UA 2N9XA 5AZFA 3DVNU 3M63B 3ALBA 4HK2A 5AEKB 3TL5A 2RGFA 3A33B 4NJ7A 4E74A 2DYBA 4LJOB 2WX1A 3RYTA 4GMVA 2XEWA 1WM3A 4E3CA 4HJKA 2LD9A 1WJ6A 2DZJA 3PLVA 5AZHA 3UF8A 2LXAA 3DVNV 1EF1A 4FHKA 3T9LA 3ZW3A 4BKTA 1RAXA 4GDLA 4IM0A 4BFRA 3PRZA 3A9JB 3R7QA 2KWVB 4ZRKA 5DCNA 2RSUA 4TUUA 4W9KA 2WX0A 2J0MA 3U7DA 4FJZA 2MA9B 4G11A 5IA7A 3BINA 3ZUNA 3DOWA 1WX9A 4IWPA 2DENB 3PHWB 1WY8A 2LRWA 4RMAA 4GDKA 4YL8A 4NAWA 4NNJB 2KX0A 5CHVC 2MBQA 3TMPB 2MRPA 2ZJDA 1V5OA 1TGZB 2D11A 3WAOA 3DBHI 1WRDB 2C7MB 1WX8A 1TTNA 2LJ5A 2KQSA 1NDDA 5FR6A 1WGHA 4WJOA 3K9PB 4TKNA 3KUDB 4KDLB 3L0WB 3V6EB 2JRIB 4MEMA 3QX1A 4W9GA 1S3SG 1WGGA 3NY5A 1IYFA 3VFKA 1WGYA 3KUCB 2FIDA 3RCZA 3HIZA 3GZNI 3UGBB 4JL9A 1GUAB 3ZNZB 2LGDA 1Q1OA 2DZIA 2KHWB 2MBBB 1H4RA 2XK5B 4KVGB 3DQVA 4IWOA 3WAPA 3UINB 2LXCA 2Z0EB 2HE7A 4LDTB 4AP4C 4EZLA 2WYQA 1A5RA 4WQOB 2M4NA 2C7NB 2MW5A 1GG3A 1V6EA 1WH3A 1V81A 2YLMA 4AWJA 4FHJA 4MDKE 3UIPB 2KKCA 1CMXB 2K25A 3VQIA 4DK5A 2JPHA 3V61A 4MGZE 3O65B 2N7DA 2M1MA 2J7QB 2ZNVC 3OLMD 2VRRB 2HD5B 2IYDB 3PRPB 2RR9A 1GNUA 3APCA 3PRMB 2KLGA 4AJYB 3TCAA 4MSQB 4ASWC 3RD2A 2GBMA 2IO0B 3DPDA 4RM9A 2N1WA 1C3TA 1EUVB 3IFWB 3A1QB 1VCBA 2L8JA 4I6NB 4K7UA 3APFA 1D3ZA 4B95A 1KOTA 4GB9A 1F9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS6 A;  2L7R A;  1RLF A;  2O6V D;  3IHP C;  2CR5 A;  2DZK A;  2C5L C;  4II2 B;  3A1Q A;  2KDB A;  3KYC D;  2BYV E;  2K8H A;  3N3K B;  4JQW C;  4TQ0 A;  4FAD A;  2ZPY A;  2NBU A;  4EFO A;  2REX A;  1TBE A;  1WZ3 A;  2K6D B;  2Z59 B;  4A3P A;  4IUM B;  1WF9 A;  2K6Q A;  2V3S A;  2R2O A;  2GOW A;  4J6I A;  2GBK A;  5G2N A;  3ZDT A;  1P3Q U;  2JRH A;  3OJ4 B;  4OVV A;  3VTV A;  2BWE S;  2N9P C;  4NPN A;  4E71 A;  3PGE A;  1M94 A;  2NBV B;  3IVF A;  4XX5 A;  3QAR A;  3L54 A;  3QC8 B;  1WJU A;  3ZKJ C;  3EHV A;  3DBS A;  4DHJ B;  4BVU C;  4HDO A;  3V6C B;  2KFJ A;  2R2Q A;  4BKS A;  5J17 A;  5CTR C;  1WXV A;  4EZK A;  1FXT B;  4KIK B;  2DYM A;  4DDG D;  2V1Y A;  2LAS A;  2PJH A;  2DAF A;  2NPT B;  2KDF B;  5L95 C;  1UGM A;  2KQ7 A;  4GGQ A;  4ANX A;  4GXB A;  3Q3J A;  1HE8 A;  3MHS D;  1LM8 B;  3P2B A;  4LCD E;  2CHX A;  3RZW C;  2KN5 A;  3DVG Y;  3KW5 B;  1E7U A;  2V4L A;  1Q0W B;  4A20 A;  3ECI A;  2AWT A;  3VUW A;  2NPT A;  4PYU A;  2AL3 A;  2CKH B;  2L00 B;  4IM2 A;  2K39 A;  3IBE A;  4IM3 A;  3PV1 A;  2JZZ A;  2BGF A;  3ML8 A;  5E6P A;  3VH3 B;  3GOE A;  1WJN A;  3HK0 A;  3ZTD A;  2IO2 B;  3BY4 B;  3ZNG C;  3HHM A;  5E6O A;  2MBH A;  2N1V A;  4I6P A;  3AI5 A;  2ZNV B;  2KMC A;  3QWZ B;  1J8C A;  2N9E B;  2K1F A;  2BYF A;  4WWP A;  4ZRI A;  1XT9 B;  3WA0 A;  1GJZ A;  1P1A A;  3WAM A;  4CYE A;  4DHZ E;  4DWF A;  5JH5 C;  2NR2 A;  3SHQ A;  3VTU A;  1G6J A;  2MQJ A;  1U4A A;  4WJN A;  3DVG X;  2EKE C;  2DYO A;  3ZRC A;  1I35 A;  1WXM A;  3H7S A;  3L16 A;  4MH0 E;  1L7Y A;  4B6W A;  5JHA A;  2PPH A;  2MWS B;  2OOB B;  2KTR B;  3A9J A;  3JVZ X;  3OAW A;  4M8M A;  3B08 A;  3KYD D;  3M3J A;  2IZV B;  2YVC A;  1XD3 B;  3PLU A;  2NCN A;  5BO4 B;  1BT0 A;  4KV2 A;  3VHT C;  3RZF A;  1KM7 A;  3SDL C;  2EMS A;  3RT3 B;  3AXC A;  5CHF A;  5LXI B;  2KJR A;  4EKU A;  1H8C A;  1WGR A;  1SIF A;  4ZYN A;  1Q5W B;  2D3G A;  2WWZ A;  3PVL A;  3N30 A;  2K8C A;  4FUL A;  1UZX B;  1WR6 E;  4KZC A;  4F7Z A;  3L17 A;  2C7H A;  2EMT A;  3ZVV A;  4W9H A;  1RFA A;  4HCN B;  1Z2M A;  4F1S A;  2FUH B;  4FJV B;  1LFD A;  3EC8 A;  5D94 A;  1V9J A;  2M17 A;  4G0N B;  2FNJ B;  2CS4 A;  5LLI A;  3U8Z A;  1OQY A;  2LGY A;  2MBE A;  3MJW A;  4KZ0 A;  5J2R A;  5HKH A;  2RPQ A;  2JZ3 B;  1T0Y A;  2IY1 B;  3ZTC A;  4IC7 B;  3N32 A;  2FCN A;  2XK5 A;  3QIJ A;  4HWI B;  3ZNI D;  3L10 B;  4JLC A;  2AYO B;  4AJW A;  3H7P B;  4N9F 4;  2KNB A;  3R3M A;  3L08 A;  1WIA A;  2WDT B;  5KHQ A;  3R66 C;  4URK A;  2ZCC A;  1X1M A;  3I3T B;  4ANV A;  3W1S A;  1V2Y A;  1E5W A;  4MGI E;  1YJ1 A;  3EEC A;  3QJZ A;  3H7P A;  1UD7 A;  3TBL D;  1IPG A;  3AU4 A;  5IAA C;  4W9F A;  1JRU A;  2PE6 B;  2ZZP B;  5CHW A;  4ZDV A;  2KK8 A;  3LDZ E;  1SGH A;  3H6N A;  4NJ6 A;  1J0G A;  1P9D U;  2Y5B B;  1YQB A;  2KZR A;  3C0R B;  2KFK B;  2CHW A;  4II3 B;  3KH0 A;  3DCG A;  1Z5S B;  1WXS A;  1E8Y A;  4NY0 A;  1GC6 A;  4HDQ A;  2LVQ A;  2UWQ A;  5C1Z A;  2G45 B;  4MSM B;  3S2A A;  5JHB A;  2RD0 A;  3ONS A;  3ZIM A;  5DPS A;  1IP9 A;  4BBN F;  3A4S C;  1WXA A;  2PE9 A;  2HTH A;  4K1R B;  3RUL A;  2BKF A;  3QK0 A;  4IW0 A;  2I1J A;  5C23 A;  4HCP B;  3UIO B;  2KVR A;  2G4D B;  3QQ8 B;  4HVB A;  2MBO A;  5JZE B;  2CHZ A;  4KSL C;  3D32 A;  2KO3 A;  3VH4 B;  3PRE A;  2D2Q A;  2O6V B;  1K8R B;  4DBG A;  2LWP A;  2MCN B;  1E8Z A;  1WX7 A;  4BKS D;  2JWZ A;  2MP2 B;  2GBN A;  4IWQ A;  3VUY A;  4K81 A;  2ZCB A;  2L05 A;  4XZ4 A;  1I42 A;  4PS8 A;  2O6V A;  3B1L X;  3VTW A;  3LJ3 A;  2OJR A;  3IG3 A;  1V80 A;  3WAL A;  2IO3 B;  5GMV A;  5DPR A;  2LI5 A;  4ANU A;  4M0W B;  2JT4 B;  2KDE B;  3CSF A;  1L2N A;  4KIK A;  2KOX A;  3APD A;  3QA8 A;  4JGH B;  3PSE B;  4MJS B;  4W9J A;  1KJT A;  3A9K B;  4G50 A;  4X57 B;  4WWO A;  4GIV A;  2BWF A;  3TIX A;  3NZU A;  2O2V B;  4W9E A;  1S1Q B;  2NS5 A;  2GMI C;  4CHK A;  2L0T A;  4WJP A;  2ZVN A;  3CMM B;  4MJS A;  3R7R A;  3EFU A;  2IO1 B;  1UEL A;  4NQK E;  3ZO5 B;  1P0R A;  1OEY A;  3W1Y A;  4EOY A;  2KTF A;  2KX3 A;  5DPT A;  4AOF A;  2W9N A;  3X0W A;  4P7I A;  3CST A;  4BOS C;  2JY6 A;  1ZW7 A;  1V5T A;  1LXD A;  4HPL B;  4MGK E;  4HPM B;  2KD0 A;  4DHZ B;  4WWN A;  1WE6 A;  3VDZ A;  2L3Z A;  3B0A A;  1V86 A;  4NQL B;  3ZNH B;  3NHE B;  1YIW A;  1R4N I;  2B3A A;  2J0K A;  3UQB A;  1GC7 A;  3KVF B;  4GDL B;  5TR5 A;  4ANW A;  2DHZ A;  2K8B A;  1WI0 A;  4OVU A;  4TV3 A;  5KHO A;  4RM8 A;  2UYZ B;  2BF8 B;  2AL6 A;  3WAN A;  2G4S A;  4A3O A;  2IY0 B;  3UQA A;  2N7E A;  4W9D A;  5G55 A;  2KTR A;  4W9C A;  4EZJ A;  4GDK B;  4NAW B;  5EDS A;  4MEL A;  4TQ1 A;  2DX5 B;  2Z0D B;  3VVW B;  1YX6 B;  4WAA A;  1YD8 U;  2HJ8 A;  2KJH B;  1WM2 A;  3PTF C;  2LRU A;  4I6L B;  1WFY A;  3QHT A;  4F8C B;  2FIF A;  3ZLZ A;  3PHX B;  3NOB A;  4GSW A;  4ICU A;  3AUL A;  2LGX A;  1KLV A;  3DDC B;  4WJQ A;  4HXD A;  1WZ0 A;  2KC2 A;  3T8M A;  5CX3 A;  3L13 A;  4W9L A;  3PZD A;  3SD5 A;  2NBW B;  2ZVO A;  4BOZ B;  3AU5 A;  4LDT D;  1EO6 A;  5J18 A;  1VD2 A;  3OJ3 A;  1J19 A;  3H9D A;  4GOC A;  1UBI A;  3V62 A;  2BPS A;  2KXJ A;  2M8S A;  4M8N A;  2BYE A;  1UBQ A;  2FAZ A;  4GN1 A;  4AUQ C;  1E90 A;  4KSK C;  2LZ6 A;  2A5U A;  2I1K A;  3NZS A;  4FN2 A;  4JIO U;  1LQB A;  3JYU A;  5D2M B;  3ENE A;  2BKR B;  5D6J B;  2ZPN A;  1WR1 A;  3VUX A;  4PS7 A;  2MLB A;  2D07 B;  5AZG A;  3ZRF A;  5L83 A;  2J0J A;  4XC2 A;  2MSE D;  3QAQ A;  1PQS A;  3MTN B;  2JF5 A;  4EEW A;  4MGY E;  1ISN A;  2LUE A;  1UH6 A;  2CU1 A;  2KMA A;  2KWU B;  2L0F A;  1RRB A;  2XBB C;  2A4Z A;  1MG8 A;  3V60 A;  2JXX A;  2KFK A;  3SU8 X;  5E6N A;  2DZM A;  2KJ6 A;  4PS3 A;  2GBR A;  2JVC A;  2N4F A;  1WYW B;  2PEA A;  4FJY A;  1OEY J;  2LVO A;  4KDI C;  4LJP B;  2MX2 A;  2KC1 A;  1TZ1 A;  2NVU I;  3JW0 X;  3NS8 A;  1ZKH A;  1WMH B;  2JUO A;  1E8W A;  1SE9 A;  1WJ4 A;  4K7W A;  4FLH A;  4B9K A;  1AAR A;  3DBL I;  3PT2 B;  3TJP A;  4ICV A;  4IG7 B;  1P98 A;  2KLC A;  1WMH A;  4FBJ B;  4W9I A;  5LXH A;  1QZE A;  1WE7 A;  4DHJ D;  3CF6 E;  2DAJ A;  4DXA B;  2GBJ A;  4EUT A;  2MP2 A;  2QHO A;  1NBF C;  2KDI A;  3VXW A;  4MM3 A;  4G3X B;  1XQQ A;  2FCQ A;  2KWC A;  1C1Y B;  1ZGU B;  2FCM A;  3M62 B;  4ZRJ A;  2M0X A;  4BBN C;  2L76 A;  1V49 A;  5D7G A;  2C60 A;  4DDI D;  3ML9 A;  3QCA A;  4BKG A;  2ZEQ A;  2FCS A;  3KUZ A;  2AEH A;  1WGD A;  2KAN A;  1E7V A;  2LVP A;  1EF5 A;  3RUI B;  2IBI B;  2D10 A;  4HLE A;  1Y8R C;  3M95 A;  3Q3F A;  3JSV B;  3K9O B;  1OTR B;  4K7S A;  3WIM A;  1YX5 B;  3W1S C;  1R4M I;  3A9K A;  3HM6 X;  3A4R A;  4GU2 A;  5DPW A;  3PPA A;  1E8X A;  4PYZ A;  1NI2 A;  2O2V A;  3X23 A;  4CO7 A;  3U30 A;  1OGW A;  3HM3 A;  3DBR I;  4FA6 A;  3JSV A;  2C9W B;  3ZDM C;  3VAW A;  2G3Q B;  2ASQ A;  3H1U A;  2N9X A;  5AZF A;  3DVN U;  3M63 B;  3ALB A;  4HK2 A;  5AEK B;  3TL5 A;  2RGF A;  3A33 B;  4NJ7 A;  4E74 A;  2DYB A;  4LJO B;  2WX1 A;  3RYT A;  4GMV A;  2XEW A;  1WM3 A;  4E3C A;  4HJK A;  2LD9 A;  1WJ6 A;  2DZJ A;  3PLV A;  5AZH A;  3UF8 A;  2LXA A;  3DVN V;  1EF1 A;  4FHK A;  3T9L A;  3ZW3 A;  4BKT A;  1RAX A;  4GDL A;  4IM0 A;  4BFR A;  3PRZ A;  3A9J B;  3R7Q A;  2KWV B;  4ZRK A;  5DCN A;  2RSU A;  4TUU A;  4W9K A;  2WX0 A;  2J0M A;  3U7D A;  4FJZ A;  2MA9 B;  4G11 A;  5IA7 A;  3BIN A;  3ZUN A;  3DOW A;  1WX9 A;  4IWP A;  2DEN B;  3PHW B;  1WY8 A;  2LRW A;  4RMA A;  4GDK A;  4YL8 A;  4NAW A;  4NNJ B;  2KX0 A;  5CHV C;  2MBQ A;  3TMP B;  2MRP A;  2ZJD A;  1V5O A;  1TGZ B;  2D11 A;  3WAO A;  3DBH I;  1WRD B;  2C7M B;  1WX8 A;  1TTN A;  2LJ5 A;  2KQS A;  1NDD A;  5FR6 A;  1WGH A;  4WJO A;  3K9P B;  4TKN A;  3KUD B;  4KDL B;  3L0W B;  3V6E B;  2JRI B;  4MEM A;  3QX1 A;  4W9G A;  1S3S G;  1WGG A;  3NY5 A;  1IYF A;  3VFK A;  1WGY A;  3KUC B;  2FID A;  3RCZ A;  3HIZ A;  3GZN I;  3UGB B;  4JL9 A;  1GUA B;  3ZNZ B;  2LGD A;  1Q1O A;  2DZI A;  2KHW B;  2MBB B;  1H4R A;  2XK5 B;  4KVG B;  3DQV A;  4IWO A;  3WAP A;  3UIN B;  2LXC A;  2Z0E B;  2HE7 A;  4LDT B;  4AP4 C;  4EZL A;  2WYQ A;  1A5R A;  4WQO B;  2M4N A;  2C7N B;  2MW5 A;  1GG3 A;  1V6E A;  1WH3 A;  1V81 A;  2YLM A;  4AWJ A;  4FHJ A;  4MDK E;  3UIP B;  2KKC A;  1CMX B;  2K25 A;  3VQI A;  4DK5 A;  2JPH A;  3V61 A;  4MGZ E;  3O65 B;  2N7D A;  2M1M A;  2J7Q B;  2ZNV C;  3OLM D;  2VRR B;  2HD5 B;  2IYD B;  3PRP B;  2RR9 A;  1GNU A;  3APC A;  3PRM B;  2KLG A;  4AJY B;  3TCA A;  4MSQ B;  4ASW C;  3RD2 A;  2GBM A;  2IO0 B;  3DPD A;  4RM9 A;  2N1W A;  1C3T A;  1EUV B;  3IFW B;  3A1Q B;  1VCB A;  2L8J A;  4I6N B;  4K7U A;  3APF A;  1D3Z A;  4B95 A;  1KOT A;  4GB9 A;  1F9J A; 
#chains in the Genus database with same CATH topology
 3FIL A;  1RLF A;  1FXI A;  2C5L C;  1QOA A;  5BMG A;  3DHG C;  4JQW C;  2ZPY A;  2N7J A;  1DYQ A;  1V1P A;  3AE8 B;  1XCQ L;  3KLS X;  2V3S A;  3OJ4 B;  4OVV A;  2N9P C;  3PGE A;  3IVF A;  3QAR A;  3L54 A;  3TEY A;  1J7C A;  3V6C B;  1HTQ A;  4BKS A;  2BS3 B;  5CTR C;  2V1Y A;  2KDF B;  4ACF A;  2RDG A;  4ANX A;  3RI7 C;  1LM8 B;  2MEK A;  4C56 C;  1Q0W B;  4A20 A;  4XWT A;  2AWT A;  2D5G A;  3VUW A;  2NPT A;  2J42 A;  2K39 A;  1NEK B;  2WGS A;  2YEP B;  2H88 B;  1CJE A;  2N1V A;  1WGK A;  2N9E B;  2BYF A;  1GJZ A;  4JWU C;  5HHD G;  3DVG X;  1QKZ A;  3L16 A;  1L7Y A;  3OAW A;  2FUG 1;  4N6E B;  5D3I B;  1XF5 L;  3KYD D;  2IZV B;  1XD3 B;  1BT0 A;  4KV2 A;  3VHT C;  1HQR D;  2EMS A;  5C3J B;  2W82 A;  2WWZ A;  4F7Z A;  1WR6 E;  5T8I A;  3ZVV A;  4HKZ E;  4F1S A;  4ARI A;  3EC8 A;  2M17 A;  2FNJ B;  2CS4 A;  2MBE A;  3VRA B;  3N32 A;  2XK5 A;  3ZNI D;  1T0Q C;  4JLC A;  5BYQ A;  1FD6 A;  1WIA A;  1UF0 A;  1X1M A;  2N0S B;  3H7P A;  2QMT A;  1UD7 A;  5FKA C;  1FRD A;  5CHW A;  2Y3A A;  1SGH A;  1IGC A;  2Q5W D;  3FKY A;  3DCG A;  1WXS A;  3P4R B;  1TS3 A;  4KGT A;  2G45 B;  1I4P A;  1HXY D;  5IP4 D;  3A4S C;  2HTH A;  4K1R B;  3RUL A;  3UIO B;  2INN E;  2KYW A;  4LNN A;  2KO3 A;  3PRE A;  2K9X A;  2JZP A;  2HDE A;  4XE0 A;  4BKS D;  2HJ1 A;  3VUY A;  4K81 A;  2L52 A;  2O6V A;  4OHJ A;  3B1L X;  3LJ3 A;  1IBX A;  1XLO A;  4P1B C;  2IO3 B;  2AQ2 B;  2LI5 A;  3DHI C;  2DBY A;  2KOX A;  4JGH B;  1FRR A;  2NTT A;  4GIV A;  2BWF A;  2AQ3 B;  2VH2 A;  1ACC A;  2WXP A;  3ZJV A;  2NS5 A;  1PGB A;  4CHK A;  3TSS A;  1DOI A;  4WJP A;  3CMM B;  3EFU A;  4NQK E;  3ZO5 B;  1P0R A;  4EOY A;  2E6X A;  4P7I A;  4BOS C;  2JY6 A;  1ZW7 A;  2G9H D;  4B0E A;  1LXD A;  4HPL B;  4MGK E;  4HPM B;  4DHZ B;  4XWW A;  1WE6 A;  1N5W A;  2L3Z A;  4IOI E;  4NQL B;  3ZNH B;  3BK2 A;  4KKJ A;  1PDX A;  2IGD A;  3UQB A;  3KVF B;  4GDL B;  2K8B A;  4OVU A;  3ZJT A;  5KHO A;  4RM8 A;  2LHD A;  3U52 E;  1TJE A;  2AL6 A;  3R2I A;  1RM6 C;  2N7E A;  5G55 A;  4L1B A;  3VRB B;  4YTN B;  4RF0 A;  4BAX A;  2Z0D B;  1VDV A;  4JX1 C;  3PTF C;  1OFF A;  1WFY A;  4F8C B;  3ZLZ A;  1E10 A;  3Q2A C;  4ICU A;  1KFY B;  1KLV A;  1TKE A;  2BB5 A;  1UGJ A;  5CX3 A;  4AQ7 A;  1KTK A;  3PZD A;  3IAS 1;  3SD5 A;  3C8Y A;  3MC9 A;  1EO6 A;  1KLU D;  1VD2 A;  1FMA D;  2KXJ A;  2M8S A;  4M8N A;  1UBQ A;  2FAZ A;  4GN1 A;  4AUQ C;  4NAM A;  5E6J A;  3ENE A;  2VZK D;  2GI9 A;  3VUX A;  2MLB A;  5L83 A;  2J53 A;  1T6B X;  2V3P A;  3AEC B;  3RNB C;  1PQS A;  3ZYY X;  4MGY E;  2KWU B;  2L0F A;  2XBB C;  5EE9 A;  2JXX A;  2KFK A;  2DZM A;  2IND C;  2JVC A;  3FIL B;  4FJY A;  4US8 A;  2NVU I;  1ZKH A;  1E8W A;  1SE9 A;  4FXC A;  1V1P B;  1HTO A;  4W9I A;  1QZE A;  4PT5 A;  4DXA B;  2K22 A;  2GBJ A;  1M4V A;  2KDI A;  4RCO A;  4MM3 A;  4G3X B;  2FCQ A;  3TEX A;  1C1Y B;  1ZGU B;  3BYY B;  3IT6 B;  1UWX A;  3AE7 B;  4HKQ A;  3KUZ A;  3FC4 A;  1MG4 A;  4YSX B;  4L2Y A;  2D10 A;  4C4V B;  3Q3F A;  2FE8 A;  3A9K A;  3HM6 X;  3X23 A;  4CO7 A;  5EE3 A;  3U30 A;  1L0Y B;  3HM3 A;  3JSV A;  2G3Q B;  3H1U A;  1RWS A;  3BVM A;  4Q2J A;  1ZDX A;  5C2T B;  4GMV A;  1L4Z B;  2JU6 X;  2LD9 A;  1WJ6 A;  4BKT A;  3DVN V;  2WDV B;  3T9L A;  1NI3 A;  2JSV X;  3R7Q A;  2KWV B;  4ZRK A;  4TUU A;  2QDF A;  1ENF A;  2DEN B;  2AQ1 B;  4GDK A;  4NAW A;  4NNJ B;  2W3R A;  2YEP F;  4KGR A;  2TSS A;  1WRD B;  3E56 A;  4ZHP A;  1WX8 A;  1GPX A;  4US9 A;  3ETR A;  4M01 A;  3K9P B;  2WXK A;  4MEM A;  1N62 A;  3QX1 A;  3NY5 A;  3UGB B;  2XK5 B;  2KHW B;  2WXJ A;  3AMZ A;  4EZL A;  2WU5 B;  1HZ6 A;  2LMC A;  1WH3 A;  4AWJ A;  1FO4 A;  1CQV A;  3VQI A;  3P4P B;  3V61 A;  2N7D A;  2M1M A;  2VZK B;  2ONQ A;  5AUI A;  2WQY B;  1GNU A;  2KLG A;  4MSQ B;  2GBM A;  1VCB A;  1D3Z A;  4HPP A;  4GB9 A;  1F9J A;  1FNW A;  4R3D A;  2CR5 A;  2DZK A;  3A1Q A;  3N3K B;  4FAD A;  1TBE A;  4CQN A;  1WZ3 A;  3DWG C;  2WXM A;  2Z8L A;  3DWM A;  3P4S B;  4TSS A;  4J6I A;  2GBK A;  3ZDT A;  3MC0 B;  4RGM A;  1JWU D;  2KN4 A;  1IBX B;  4E71 A;  1M94 A;  2NBV B;  1MJD A;  4REZ A;  4JPS A;  1WJU A;  4DQO C;  3DBS A;  4BVU C;  1C4C A;  2XNA C;  2R2Q A;  1FXT B;  2DYM A;  4DDG D;  1UGM A;  1MPE A;  4GGQ A;  3MHS D;  4AS1 A;  4UDU C;  2KN5 A;  2RDB C;  2QCZ A;  2AL3 A;  2CKH B;  4IM2 A;  1V1O A;  3W9C B;  3UI3 A;  1D6E C;  5E6P A;  4WWM A;  1NYR A;  1WJN A;  3HK0 A;  4J3O D;  2QSD A;  3AI5 A;  1J8C A;  3QWZ B;  3VTU A;  2DYO A;  3DBR B;  1WXM A;  3P42 A;  2OOB B;  3JVZ X;  3BII D;  1YQ4 B;  1KM7 A;  4RGN A;  3U4E G;  1SEB D;  1L0V B;  5CHF A;  2KJR A;  1C9F A;  3Q8F A;  4ZHO A;  4KZC A;  1L6V A;  4RH6 A;  3ZXR A;  4W9H A;  1RFA A;  4HCN B;  1Z2M A;  2PVO D;  5LLI A;  4DXG A;  4KZ0 A;  5HKH A;  1XLP A;  2RPQ A;  3EA6 A;  2QIE B;  3ZTC A;  3QIJ A;  3DBH B;  3EGR A;  4DXF A;  4N9F 4;  1JWB D;  1T3Q A;  1P7E A;  2WDT B;  5HI1 A;  5KHQ A;  3R66 C;  4HEA 1;  3AED B;  3EEC A;  4OZC A;  1IPG A;  2V4I B;  4W9F A;  3TEW A;  2PE6 B;  2ZZP B;  1J0G A;  3H6N A;  1F0Z A;  1LGR A;  1YQB A;  2KZR A;  2KFK B;  2CHW A;  4II3 B;  2QJL A;  1Z5S B;  3RNE C;  1L4D B;  2LVQ A;  2UWQ A;  1UUP A;  4MSM B;  2RD0 A;  3ONS A;  1IP9 A;  4BBN F;  1WXA A;  1NEN B;  1I4X A;  2EKI A;  3QK0 A;  2KVR A;  2MBO A;  2CHZ A;  4KSL C;  1YMH E;  5IKC M;  3OG5 A;  2J4X A;  2MCN B;  1E8Z A;  1WX7 A;  4C7Z A;  4MM3 B;  1I4R A;  4P6V F;  2L05 A;  3VTW A;  1FM0 D;  1YNT E;  2JT4 B;  1WWT A;  2KDE B;  1L2N A;  3HVD A;  2MJ3 A;  4MJS B;  3RMK C;  3A9K B;  4G50 A;  4WWO A;  3TIX A;  4W9E A;  4S17 A;  2BT6 A;  2WU2 B;  2GMI C;  3U7Z A;  2L0T A;  4WAF A;  2ZVN A;  2KDM A;  1SB3 C;  2RPV A;  3RN9 C;  2KTF A;  2KX3 A;  5DPT A;  2CJO A;  4K3C A;  2DNF A;  2WXF A;  4YXD B;  2KD0 A;  4YT0 B;  4WWN A;  3B0A A;  1MI0 A;  5BMH A;  5TR5 A;  3TEZ A;  4TV3 A;  1ZDV A;  2BF8 B;  2IY0 B;  3UQA A;  1F52 A;  4GDK B;  4NAW B;  4MEL A;  2PTL A;  2DX5 B;  4WAA A;  1YD8 U;  2KJH B;  3MHZ A;  3QHT A;  2FIF A;  4GSW A;  1K50 A;  2W55 A;  3AUL A;  3Q8A A;  4WJQ A;  3I9V 1;  3NG0 A;  3EFC A;  4LDT D;  1TYG B;  1TS5 A;  4GOC A;  3OJ3 A;  1J19 A;  3H9D A;  1UBI A;  1F77 A;  2BYE A;  3NZS A;  4FN2 A;  1D5Z C;  2L32 A;  3QAQ A;  3MTN B;  2JF5 A;  1ISN A;  2LUE A;  1UH6 A;  2CU1 A;  2KMA A;  2A4Z A;  1MHX A;  1MG8 A;  1K53 A;  3SU8 X;  3DHH C;  5E6N A;  1SE4 A;  2KJ6 A;  3AE2 B;  2UU7 A;  2GBR A;  2N4F A;  2PEA A;  3Q8B A;  1OEY J;  3RNC C;  4LJP B;  2MX2 A;  4HJG E;  1WJ4 A;  4K7W A;  4FLH A;  2LHE A;  1AAR A;  3DBL I;  3PT2 B;  4ICV A;  2D3A A;  1P98 A;  3NUH B;  1WMH A;  3AE4 B;  4FBJ B;  3HUI A;  4EUT A;  2MP2 A;  3M62 B;  1XCT L;  1VRA B;  4BBN C;  3SFD B;  3KQ4 A;  3MP9 A;  2C60 A;  4DDI D;  3QCA A;  4M0W A;  2KAN A;  2IBI B;  1EWY C;  5H92 C;  3M95 A;  2WXL A;  4HLE A;  1FPY A;  3K9O B;  3NJT A;  1JW9 D;  1ZUD 2;  1E8X A;  1XXG A;  2O2V A;  3Q8E A;  4PYZ A;  1XLQ A;  3DBR I;  3ZDM C;  2WXI A;  3VAW A;  1L5P A;  3AN1 A;  3DVN U;  3M63 B;  3ALB A;  4HK2 A;  2X8X X;  1F1H A;  3TL5 A;  3A33 B;  2BQQ A;  3NVV A;  4NJ7 A;  2DYB A;  3LYY A;  2XEW A;  3TUO A;  4E3C A;  4HJK A;  2QEJ C;  3ZW3 A;  1RAX A;  1HZ5 A;  1T0R C;  3GE3 C;  1N61 A;  3PRZ A;  5I4D A;  1JCK B;  4M00 A;  2MA9 B;  1HEZ E;  5IA7 A;  3PZ7 A;  3V3X A;  1WY8 A;  2LRW A;  4YL8 A;  5CHV C;  4QAY A;  3MFG A;  2MRP A;  1V5O A;  1TY0 A;  2ZW0 A;  1TS4 A;  2BB6 A;  3DBH I;  2LJ5 A;  2KQS A;  1QT9 A;  5FR6 A;  2BYT A;  2WXO A;  3V6E B;  4W9G A;  4YTP B;  3VFK A;  1R7S A;  3RCZ A;  3GZN I;  2BS4 B;  2KMM A;  1XLN A;  3ZNZ B;  2LGD A;  1GB1 A;  2MBB B;  1H4R A;  1VJK A;  4LDT B;  4AP4 C;  3CIR B;  2WYQ A;  4LK0 M;  2M4N A;  2H89 B;  1E9M A;  3PZ8 A;  2PVG C;  3GS2 A;  1CMX B;  2HD5 B;  1JRO A;  2WLB A;  2N1W A;  1JWA D;  4I6N B;  4B95 A;  1QOF A;  2N9K A;  3PS6 A;  2L7R A;  2O6V D;  2QIL A;  3KYC D;  1L0X B;  2BYV E;  2LEK A;  4A6Q A;  1WRI A;  2REX A;  4KKI A;  2PLP A;  2K6D B;  2Z59 B;  2WDR B;  2LJI A;  1AYF A;  2EEL A;  4A3P A;  4IUM B;  2Y5C A;  2K6Q A;  3BYT B;  2R2O A;  2GOW A;  5G2N A;  1P3Q U;  4S0R A;  3NVW A;  4NPN A;  2B76 B;  4N58 A;  3B2G A;  1T0S C;  2KFJ A;  5J17 A;  1KF6 B;  4YSZ B;  5IN7 A;  1WXV A;  4EZK A;  1WXQ A;  2LAS A;  1KLG D;  2PJH A;  1B9R A;  2NPT B;  5G5G A;  4KGS A;  5L95 C;  4TMA B;  3Q3J A;  1SF0 A;  4C7Y A;  2JXT A;  3RZW C;  1ZP0 B;  2CHX A;  1NYQ A;  3KW5 B;  2JYT A;  3ECI A;  3J9C A;  2L00 B;  2JZZ A;  3BVZ A;  3GOE A;  3ZTD A;  2IO2 B;  3BY4 B;  3ZNG C;  3HHM A;  5E6O A;  2MBH A;  4I6P A;  2KMC A;  4WWP A;  1XT9 B;  3WA0 A;  3WAM A;  4CYE A;  1IGD A;  1ZE3 D;  4DWF A;  5JH5 C;  5MPO A;  1G6J A;  2MQJ A;  3N1Y C;  1U4A A;  4WJN A;  2EKE C;  3ZRC A;  3T3O A;  4MH0 E;  4B6W A;  4XDC A;  2PMV A;  1C4P A;  2YVC A;  2NCN A;  3ZGZ A;  3RT3 B;  3AXC A;  5LXI B;  4EKU A;  1H8C A;  1SIF A;  3AE5 B;  4LNO A;  1JWS D;  2KAC A;  3L17 A;  2C7H A;  2BS2 B;  1GAQ B;  2EMT A;  4IDI A;  4FJV B;  1LFD A;  1V9J A;  5BYR A;  1OQY A;  3MJW A;  5J2R A;  2JZ3 B;  1T0Y A;  2IY1 B;  2BW2 A;  4IC7 B;  2FCN A;  2W54 A;  1ZPS A;  4RNA A;  3L10 B;  1PGX A;  2AYO B;  4AJW A;  3H7P B;  3Q3M C;  3L08 A;  2ZCC A;  3I3T B;  1CK1 A;  3W1S A;  1V2Y A;  1E5W A;  4MGI E;  3QJZ A;  3TBL D;  3BZD B;  3AU4 A;  4WQM A;  4ZDV A;  1MVK A;  4NJ6 A;  2CU3 A;  1P9D U;  1SE2 A;  2Y5B B;  3C19 A;  3KH0 A;  1ZXI A;  2JWU A;  4BZA A;  3N1X C;  5C1Z A;  1C79 A;  3Q3O C;  3ZIM A;  5DPS A;  4OZA A;  2OJW A;  3B2F A;  2I1J A;  4IW0 A;  4HCP B;  5C23 A;  4MAC A;  2G4D B;  3QQ8 B;  4HVB A;  3MC8 A;  3AV8 A;  3VH4 B;  2BBC A;  2D2Q A;  2O6V B;  2LWP A;  1DGJ A;  2D3C A;  2Y5P A;  2JWZ A;  2MP2 B;  2XN9 C;  5EE1 A;  2GBN A;  4IWQ A;  2CJN A;  2IDY A;  4XZ4 A;  1I42 A;  4PS8 A;  1ET9 A;  3DBL B;  2OJR A;  3IG3 A;  1V80 A;  3WAL A;  5GMV A;  2GB1 A;  5DPR A;  4XDD A;  4M0W B;  3FAH A;  3CSF A;  3BVG A;  2LGI A;  3APD A;  4KIK A;  3CWI A;  2M19 A;  3N9Y C;  2JYE A;  3NZU A;  1FFU A;  2O2V B;  4RGO S;  1S1Q B;  1QF6 A;  3R7R A;  3O13 A;  1K51 A;  2WS3 B;  3CST A;  2IJ0 A;  1V5T A;  4XGA B;  3VDZ A;  1V86 A;  1YIW A;  3GE8 C;  2J0K A;  1GC7 A;  1D5M C;  2DHZ A;  2AX5 A;  1WI0 A;  2HTM E;  3NVZ A;  2G4S A;  4A3O A;  2D3B A;  5FK9 C;  2KTR A;  4W9C A;  3KWL A;  3AEA B;  1Q10 A;  5EDS A;  3VVW B;  1JQ4 A;  1YX6 B;  1BUI C;  2HJ8 A;  1VZ8 A;  2PKO A;  1WM2 A;  2LRU A;  4I6L B;  3BWU D;  2LFI A;  3NOB A;  3WCQ A;  3URY A;  1AWD A;  2LGX A;  3P1M A;  4A55 A;  1I4H A;  2K0P A;  4HXD A;  1WZ0 A;  2KC2 A;  3T8M A;  1YQ3 B;  4W9L A;  2NBW B;  3AU5 A;  3V62 A;  1VZ6 A;  1E90 A;  1AN8 A;  2LZ6 A;  2I1K A;  3V05 A;  1WSP A;  4YWG G;  1LQB A;  3JYU A;  5D2M B;  2WXG A;  2BKR B;  2ZPN A;  1WR1 A;  1ET6 A;  3GZN B;  2NMQ A;  2J0J A;  2MSE D;  4ZYS A;  4EEW A;  3RPF C;  1V8C A;  3NS1 A;  4O1N A;  3ZXV A;  3AE3 B;  1RYJ A;  3HVZ A;  4OVZ A;  4PS3 A;  1WYW B;  3P63 A;  4LLG M;  1TZ1 A;  3NS8 A;  1SJE D;  1N60 A;  1T5X D;  2SEB D;  3VR8 B;  1UWM A;  2KLC A;  2BVC A;  2G1E A;  1WE7 A;  4DHJ D;  2DAJ A;  2QHO A;  1NBF C;  2OHF A;  3VXW A;  2KWC A;  4ZRJ A;  1JML A;  2FCM A;  1MHH E;  4WIP A;  2E3T A;  1CZP A;  2N9L A;  2FCS A;  1EU3 A;  1WGD A;  2NTS A;  3GB1 A;  3EUB 2;  3JSV B;  4K7S A;  4EE2 A;  4WH4 A;  1YX5 B;  3W1S C;  5DPW A;  4GU2 A;  3PPA A;  3BK1 A;  1NI2 A;  1N6Z A;  3SFE B;  4C4V A;  2ICI A;  4FA6 A;  3NVY A;  4LTU A;  5AZF A;  3N1Z C;  5AEK B;  3B9J A;  1SXT A;  2WX1 A;  1F2R I;  3UF8 A;  4JE3 B;  5AZH A;  1IUE A;  3Q69 A;  2SAK A;  3HRD D;  4W9K A;  2RMM A;  3BIN A;  3ZUN A;  1WX9 A;  1D5X C;  3PHW B;  4RMA A;  2MBQ A;  3TMP B;  3P4Q B;  4HRS A;  1FXA A;  1KRH A;  1R4N B;  1OQQ A;  1TGZ B;  3WAO A;  4NZL B;  1VR9 A;  1NDD A;  2DWQ A;  4RF1 A;  1WGH A;  1QLB B;  4WJO A;  1ESF A;  3RFZ B;  4KDL B;  2JRI B;  1IYF A;  2FID A;  4C80 A;  1YJI A;  1GUA B;  4P1C C;  1J7A A;  1ZXH A;  4KVG B;  4L23 A;  1VLB A;  4IWO A;  4OZB A;  1B1Z A;  3UIN B;  2LXC A;  2Z0E B;  1A5R A;  4WQO B;  1XEE A;  1GG3 A;  1E6E B;  1V6E A;  1V81 A;  2PIA A;  2YLM A;  4FHJ A;  1TT5 B;  2K25 A;  3VR9 B;  2MHJ A;  2JPH A;  4MGZ E;  3O65 B;  2ZNV C;  3PRP B;  1C76 A;  3APC A;  3PRM B;  1DOY A;  3AE6 B;  4ASW C;  1YOV B;  3DPD A;  4RM9 A;  1EUV B;  2MH7 A;  3A1Q B;  2L8J A;  1L6U A;  4K7U A;  1KOT A;  4PK1 A;  1SSN A;  1KH0 A;  1PYW D;  3IHP C;  4II2 B;  4C00 A;  2J52 A;  2KDB A;  3R2T A;  2K8H A;  4TQ0 A;  2NBU A;  4EFO A;  5IOI A;  2KVZ A;  1AW7 A;  2KT7 A;  4ZRQ A;  3N20 C;  1WF9 A;  2M0A A;  4ZOH C;  2JRH A;  3VTV A;  2L1A A;  2BWE S;  4M02 A;  3E9S A;  4XX5 A;  2KWD A;  1SJH D;  1FFV A;  3QC8 B;  3ZKJ C;  1D4B A;  2V3N A;  1QQR A;  3EHV A;  4DHJ B;  2IGG A;  2ACZ B;  4HDO A;  1YN3 A;  4KIK B;  3ZQ4 A;  2DAF A;  2KQ7 A;  4GXB A;  1HE8 A;  3P2B A;  4LCD E;  3DVG Y;  1E7U A;  2V4L A;  5H8Y E;  1SE3 A;  4PYU A;  3IBE A;  1TIF A;  3PV1 A;  4IM3 A;  1J7B A;  4A90 A;  2BGF A;  3ML8 A;  1YN5 A;  1FEH A;  2OED A;  2V0G A;  3AM9 A;  3VH3 B;  2ZNV B;  2K1F A;  4JWS C;  4ZRI A;  1R4M B;  1P1A A;  4DHZ E;  1PUT A;  2NR2 A;  3SHQ A;  1SIJ A;  3IXS A;  1I35 A;  3H7S A;  5JHA A;  2PPH A;  2MWS B;  1PFD A;  2KTR B;  3A9J A;  4M8M A;  3B08 A;  3IAM 1;  3M3J A;  2X38 A;  3PLU A;  4MT5 A;  5BO4 B;  3RZF A;  5AUK A;  3AEF B;  4RGT A;  1JRP A;  3SDL C;  2FBW B;  1MFW A;  1FCC C;  1VZ7 A;  3AH7 A;  1WGR A;  4ZYN A;  1Q5W B;  3I5J C;  2D3G A;  3LXF A;  3RNF C;  3I57 A;  3PVL A;  2RDH A;  3N30 A;  2K8C A;  4FUL A;  1UZX B;  3SEB A;  2FUH B;  1GOZ A;  5D94 A;  4G0N B;  3U8Z A;  2LGY A;  3NZ3 A;  4YSY B;  1YJJ A;  4HWI B;  3MJ5 A;  4KX6 B;  2KNB A;  3R3M A;  4URK A;  4ANV A;  3W5U B;  2PW9 A;  1YJ1 A;  2V9H A;  5IO9 A;  5IAA C;  1JRU A;  3GP7 A;  2KK8 A;  3LDZ E;  1QOB A;  1QOG A;  3C0R B;  1LO5 D;  4USA A;  1E8Y A;  4NY0 A;  1EWC A;  1GC6 A;  2WHI A;  4HDQ A;  4B0M A;  3S2A A;  5JHB A;  1F2R C;  4WUR A;  2PE9 A;  2BKF A;  4ARC A;  2LUM A;  4NJC A;  5JZE B;  5D3D A;  3D32 A;  2I2Y A;  1TKY A;  2IPK D;  1K8R B;  1JAL A;  3PO0 A;  4DBG A;  4IKG A;  3AEG B;  2ZCB A;  3NRZ A;  1I4Q A;  5HG2 A;  3RNA C;  3OWE B;  1A70 A;  4ANU A;  2MJE A;  3QA8 A;  3PSE B;  4W9J A;  1KJT A;  4N59 A;  4X57 B;  4H2A A;  4MJS A;  4ZRP A;  5BYS A;  2M56 B;  2WXQ A;  1E7P B;  3RNG C;  2IO1 B;  1UEL A;  3W1Y A;  1OEY A;  1P7F A;  3IT4 B;  3ABV B;  4AOF A;  2W9N A;  3X0W A;  3KWV A;  2VH1 A;  1OQR A;  1FIQ A;  1EM7 A;  3LB8 C;  4D2K A;  2K5P A;  1FNV A;  3NHE B;  1R4N I;  2B3A A;  4ANW A;  2INP E;  2UYZ B;  3WAN A;  4W9D A;  4EZJ A;  1FCL A;  1JWM D;  4LNI A;  4TQ1 A;  2WXR A;  1HA5 A;  2WXH A;  2INC C;  2ON8 A;  1C4A A;  1STE A;  1BXT A;  3PHX B;  4P16 A;  1TZO A;  1I4G A;  2DLB A;  4A8X C;  3DDC B;  1YN4 A;  1PGA A;  3L13 A;  3L4P A;  5HFY A;  2ZVO A;  4BOZ B;  5J18 A;  4GLS C;  2BPS A;  3SR6 A;  4KSK C;  2A5U A;  4JIO U;  5D6J B;  4PS7 A;  2D07 B;  5AZG A;  3ZRF A;  4XC2 A;  5FR3 A;  3H8H A;  4RFB A;  5LNK 1;  4ITK A;  4HRO A;  1RRB A;  3V60 A;  3W2D A;  4K3B A;  1EU4 A;  2KQ4 X;  2LVO A;  4A9A A;  4YTM B;  4KDI C;  4LNK A;  2KC1 A;  3JW0 X;  4XYC A;  3AEE B;  1WMH B;  2JUO A;  3I63 C;  5JXV A;  1UNS A;  2W3S A;  4B9K A;  1TY2 A;  3TJP A;  4IG7 B;  5LXH A;  3CF6 E;  1ROE A;  2WP9 B;  2JX5 A;  3U2S C;  1XQQ A;  1I7H A;  1ZOY B;  2M0X A;  3Q6B A;  2L76 A;  1V49 A;  1N63 A;  5D7G A;  2WNM A;  3ML9 A;  3Q14 C;  4BKG A;  2ZEQ A;  2AEH A;  2LVP A;  4MH8 A;  1E7V A;  3AE9 B;  1EF5 A;  3RUI B;  1Y8R C;  2WDQ B;  2I38 A;  5EE0 A;  3WIM A;  1OTR B;  1K52 A;  2GLS A;  1R4M I;  2ZW1 A;  3A4R A;  1QIL A;  2QC8 A;  1OGW A;  1RFK A;  2C9W B;  2ASQ A;  1BML C;  2N9X A;  3R8B A;  1TKG A;  4OW0 A;  2MJD A;  2RGF A;  3Q8C A;  4E74 A;  1Y56 A;  4LJO B;  1TS2 A;  3RYT A;  1FNU A;  1WM3 A;  3T3N A;  2IGH A;  5BMI A;  1C78 A;  1NVI D;  2DZJ A;  3PLV A;  2LXA A;  1EF1 A;  4FHK A;  4GDL A;  4IM0 A;  4BFR A;  3A9J B;  5DCN A;  2RSU A;  2WX0 A;  2J0M A;  3U7D A;  4FJZ A;  4G11 A;  3DOW A;  4IWP A;  2JQR B;  2KX0 A;  1N5X A;  2ZJD A;  1WYG A;  2D11 A;  2C7M B;  2BTE A;  1TTN A;  1SBB B;  2K3U A;  4TKN A;  3KUD B;  3L0W B;  2L83 A;  1S3S G;  1WGG A;  1WGY A;  3KUC B;  3HIZ A;  4JL9 A;  1Q1O A;  2DZI A;  3DQV A;  3AE1 B;  1GB4 A;  2WXN A;  3WAP A;  3Q3N C;  2HE7 A;  1E0Z A;  2KAJ A;  2C7N B;  2MW5 A;  1V97 A;  4MDK E;  3UIP B;  2KKC A;  4DK5 A;  3ZJU A;  1DOX A;  2J7Q B;  3OLM D;  5G5H A;  2LGS A;  2VRR B;  4LNF A;  5TSS A;  3W5V B;  2IYD B;  2GRI A;  2R61 A;  2RR9 A;  3AB5 A;  4AJY B;  1C77 A;  3TCA A;  3RD2 A;  2IO0 B;  1C3T A;  5GXG B;  1XO3 A;  3IFW B;  3AEB B;  3APF A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  2L7R A;  1RLF A;  2O6V D;  3IHP C;  2CR5 A;  2DZK A;  2C5L C;  4II2 B;  3A1Q A;  2KDB A;  3KYC D;  2BYV E;  2K8H A;  3N3K B;  4JQW C;  4TQ0 A;  4FAD A;  2ZPY A;  2NBU A;  4EFO A;  2REX A;  1TBE A;  1WZ3 A;  2K6D B;  2Z59 B;  4A3P A;  4IUM B;  1WF9 A;  2K6Q A;  2V3S A;  2R2O A;  2GOW A;  4J6I A;  2GBK A;  5G2N A;  3ZDT A;  1P3Q U;  2JRH A;  3OJ4 B;  4OVV A;  3VTV A;  2BWE S;  2N9P C;  4NPN A;  4E71 A;  3PGE A;  1M94 A;  2NBV B;  3IVF A;  4XX5 A;  3QAR A;  3L54 A;  3QC8 B;  1WJU A;  3ZKJ C;  3EHV A;  3DBS A;  4DHJ B;  4BVU C;  4HDO A;  3V6C B;  2KFJ A;  2R2Q A;  4BKS A;  5J17 A;  5CTR C;  1WXV A;  4EZK A;  1FXT B;  4KIK B;  2DYM A;  4DDG D;  2V1Y A;  2LAS A;  2PJH A;  2DAF A;  2NPT B;  2KDF B;  5L95 C;  1UGM A;  2KQ7 A;  4GGQ A;  4ANX A;  4GXB A;  3Q3J A;  1HE8 A;  3MHS D;  1LM8 B;  3P2B A;  4LCD E;  2CHX A;  3RZW C;  2KN5 A;  3DVG Y;  3KW5 B;  1E7U A;  2V4L A;  1Q0W B;  4A20 A;  3ECI A;  2AWT A;  3VUW A;  2NPT A;  4PYU A;  2AL3 A;  2CKH B;  2L00 B;  4IM2 A;  2K39 A;  3IBE A;  4IM3 A;  3PV1 A;  2JZZ A;  2BGF A;  3ML8 A;  5E6P A;  3VH3 B;  3GOE A;  1WJN A;  3HK0 A;  3ZTD A;  2IO2 B;  3BY4 B;  3ZNG C;  3HHM A;  5E6O A;  2MBH A;  2N1V A;  4I6P A;  3AI5 A;  2ZNV B;  2KMC A;  3QWZ B;  1J8C A;  2N9E B;  2K1F A;  2BYF A;  4WWP A;  4ZRI A;  1XT9 B;  3WA0 A;  1GJZ A;  1P1A A;  3WAM A;  4CYE A;  4DHZ E;  4DWF A;  5JH5 C;  2NR2 A;  3SHQ A;  3VTU A;  1G6J A;  2MQJ A;  1U4A A;  4WJN A;  3DVG X;  2EKE C;  2DYO A;  3ZRC A;  1I35 A;  1WXM A;  3H7S A;  3L16 A;  4MH0 E;  1L7Y A;  4B6W A;  5JHA A;  2PPH A;  2MWS B;  2OOB B;  2KTR B;  3A9J A;  3JVZ X;  3OAW A;  4M8M A;  3B08 A;  3KYD D;  3M3J A;  2IZV B;  2YVC A;  1XD3 B;  3PLU A;  2NCN A;  5BO4 B;  1BT0 A;  4KV2 A;  3VHT C;  3RZF A;  1KM7 A;  3SDL C;  2EMS A;  3RT3 B;  3AXC A;  5CHF A;  5LXI B;  2KJR A;  4EKU A;  1H8C A;  1WGR A;  1SIF A;  4ZYN A;  1Q5W B;  2D3G A;  2WWZ A;  3PVL A;  3N30 A;  2K8C A;  4FUL A;  1UZX B;  1WR6 E;  4KZC A;  4F7Z A;  3L17 A;  2C7H A;  2EMT A;  3ZVV A;  4W9H A;  1RFA A;  4HCN B;  1Z2M A;  4F1S A;  2FUH B;  4FJV B;  1LFD A;  3EC8 A;  5D94 A;  1V9J A;  2M17 A;  4G0N B;  2FNJ B;  2CS4 A;  5LLI A;  3U8Z A;  1OQY A;  2LGY A;  2MBE A;  3MJW A;  4KZ0 A;  5J2R A;  5HKH A;  2RPQ A;  2JZ3 B;  1T0Y A;  2IY1 B;  3ZTC A;  4IC7 B;  3N32 A;  2FCN A;  2XK5 A;  3QIJ A;  4HWI B;  3ZNI D;  3L10 B;  4JLC A;  2AYO B;  4AJW A;  3H7P B;  4N9F 4;  2KNB A;  3R3M A;  3L08 A;  1WIA A;  2WDT B;  5KHQ A;  3R66 C;  4URK A;  2ZCC A;  1X1M A;  3I3T B;  4ANV A;  3W1S A;  1V2Y A;  1E5W A;  4MGI E;  1YJ1 A;  3EEC A;  3QJZ A;  3H7P A;  1UD7 A;  3TBL D;  1IPG A;  3AU4 A;  5IAA C;  4W9F A;  1JRU A;  2PE6 B;  2ZZP B;  5CHW A;  4ZDV A;  2KK8 A;  3LDZ E;  1SGH A;  3H6N A;  4NJ6 A;  1J0G A;  1P9D U;  2Y5B B;  1YQB A;  2KZR A;  3C0R B;  2KFK B;  2CHW A;  4II3 B;  3KH0 A;  3DCG A;  1Z5S B;  1WXS A;  1E8Y A;  4NY0 A;  1GC6 A;  4HDQ A;  2LVQ A;  2UWQ A;  5C1Z A;  2G45 B;  4MSM B;  3S2A A;  5JHB A;  2RD0 A;  3ONS A;  3ZIM A;  5DPS A;  1IP9 A;  4BBN F;  3A4S C;  1WXA A;  2PE9 A;  2HTH A;  4K1R B;  3RUL A;  2BKF A;  3QK0 A;  4IW0 A;  2I1J A;  5C23 A;  4HCP B;  3UIO B;  2KVR A;  2G4D B;  3QQ8 B;  4HVB A;  2MBO A;  5JZE B;  2CHZ A;  4KSL C;  3D32 A;  2KO3 A;  3VH4 B;  3PRE A;  2D2Q A;  2O6V B;  1K8R B;  4DBG A;  2LWP A;  2MCN B;  1E8Z A;  1WX7 A;  4BKS D;  2JWZ A;  2MP2 B;  2GBN A;  4IWQ A;  3VUY A;  4K81 A;  2ZCB A;  2L05 A;  4XZ4 A;  1I42 A;  4PS8 A;  2O6V A;  3B1L X;  3VTW A;  3LJ3 A;  2OJR A;  3IG3 A;  1V80 A;  3WAL A;  2IO3 B;  5GMV A;  5DPR A;  2LI5 A;  4ANU A;  4M0W B;  2JT4 B;  2KDE B;  3CSF A;  1L2N A;  4KIK A;  2KOX A;  3APD A;  3QA8 A;  4JGH B;  3PSE B;  4MJS B;  4W9J A;  1KJT A;  3A9K B;  4G50 A;  4X57 B;  4WWO A;  4GIV A;  2BWF A;  3TIX A;  3NZU A;  2O2V B;  4W9E A;  1S1Q B;  2NS5 A;  2GMI C;  4CHK A;  2L0T A;  4WJP A;  2ZVN A;  3CMM B;  4MJS A;  3R7R A;  3EFU A;  2IO1 B;  1UEL A;  4NQK E;  3ZO5 B;  1P0R A;  1OEY A;  3W1Y A;  4EOY A;  2KTF A;  2KX3 A;  5DPT A;  4AOF A;  2W9N A;  3X0W A;  4P7I A;  3CST A;  4BOS C;  2JY6 A;  1ZW7 A;  1V5T A;  1LXD A;  4HPL B;  4MGK E;  4HPM B;  2KD0 A;  4DHZ B;  4WWN A;  1WE6 A;  3VDZ A;  2L3Z A;  3B0A A;  1V86 A;  4NQL B;  3ZNH B;  3NHE B;  1YIW A;  1R4N I;  2B3A A;  2J0K A;  3UQB A;  1GC7 A;  3KVF B;  4GDL B;  5TR5 A;  4ANW A;  2DHZ A;  2K8B A;  1WI0 A;  4OVU A;  4TV3 A;  5KHO A;  4RM8 A;  2UYZ B;  2BF8 B;  2AL6 A;  3WAN A;  2G4S A;  4A3O A;  2IY0 B;  3UQA A;  2N7E A;  4W9D A;  5G55 A;  2KTR A;  4W9C A;  4EZJ A;  4GDK B;  4NAW B;  5EDS A;  4MEL A;  4TQ1 A;  2DX5 B;  2Z0D B;  3VVW B;  1YX6 B;  4WAA A;  1YD8 U;  2HJ8 A;  2KJH B;  1WM2 A;  3PTF C;  2LRU A;  4I6L B;  1WFY A;  3QHT A;  4F8C B;  2FIF A;  3ZLZ A;  3PHX B;  3NOB A;  4GSW A;  4ICU A;  3AUL A;  2LGX A;  1KLV A;  3DDC B;  4WJQ A;  4HXD A;  1WZ0 A;  2KC2 A;  3T8M A;  5CX3 A;  3L13 A;  4W9L A;  3PZD A;  3SD5 A;  2NBW B;  2ZVO A;  4BOZ B;  3AU5 A;  4LDT D;  1EO6 A;  5J18 A;  1VD2 A;  3OJ3 A;  1J19 A;  3H9D A;  4GOC A;  1UBI A;  3V62 A;  2BPS A;  2KXJ A;  2M8S A;  4M8N A;  2BYE A;  1UBQ A;  2FAZ A;  4GN1 A;  4AUQ C;  1E90 A;  4KSK C;  2LZ6 A;  2A5U A;  2I1K A;  3NZS A;  4FN2 A;  4JIO U;  1LQB A;  3JYU A;  5D2M B;  3ENE A;  2BKR B;  5D6J B;  2ZPN A;  1WR1 A;  3VUX A;  4PS7 A;  2MLB A;  2D07 B;  5AZG A;  3ZRF A;  5L83 A;  2J0J A;  4XC2 A;  2MSE D;  3QAQ A;  1PQS A;  3MTN B;  2JF5 A;  4EEW A;  4MGY E;  1ISN A;  2LUE A;  1UH6 A;  2CU1 A;  2KMA A;  2KWU B;  2L0F A;  1RRB A;  2XBB C;  2A4Z A;  1MG8 A;  3V60 A;  2JXX A;  2KFK A;  3SU8 X;  5E6N A;  2DZM A;  2KJ6 A;  4PS3 A;  2GBR A;  2JVC A;  2N4F A;  1WYW B;  2PEA A;  4FJY A;  1OEY J;  2LVO A;  4KDI C;  4LJP B;  2MX2 A;  2KC1 A;  1TZ1 A;  2NVU I;  3JW0 X;  3NS8 A;  1ZKH A;  1WMH B;  2JUO A;  1E8W A;  1SE9 A;  1WJ4 A;  4K7W A;  4FLH A;  4B9K A;  1AAR A;  3DBL I;  3PT2 B;  3TJP A;  4ICV A;  4IG7 B;  1P98 A;  2KLC A;  1WMH A;  4FBJ B;  4W9I A;  5LXH A;  1QZE A;  1WE7 A;  4DHJ D;  3CF6 E;  2DAJ A;  4DXA B;  2GBJ A;  4EUT A;  2MP2 A;  2QHO A;  1NBF C;  2KDI A;  3VXW A;  4MM3 A;  4G3X B;  1XQQ A;  2FCQ A;  2KWC A;  1C1Y B;  1ZGU B;  2FCM A;  3M62 B;  4ZRJ A;  2M0X A;  4BBN C;  2L76 A;  1V49 A;  5D7G A;  2C60 A;  4DDI D;  3ML9 A;  3QCA A;  4BKG A;  2ZEQ A;  2FCS A;  3KUZ A;  2AEH A;  1WGD A;  2KAN A;  1E7V A;  2LVP A;  1EF5 A;  3RUI B;  2IBI B;  2D10 A;  4HLE A;  1Y8R C;  3M95 A;  3Q3F A;  3JSV B;  3K9O B;  1OTR B;  4K7S A;  3WIM A;  1YX5 B;  3W1S C;  1R4M I;  3A9K A;  3HM6 X;  3A4R A;  4GU2 A;  5DPW A;  3PPA A;  1E8X A;  4PYZ A;  1NI2 A;  2O2V A;  3X23 A;  4CO7 A;  3U30 A;  1OGW A;  3HM3 A;  3DBR I;  4FA6 A;  3JSV A;  2C9W B;  3ZDM C;  3VAW A;  2G3Q B;  2ASQ A;  3H1U A;  2N9X A;  5AZF A;  3DVN U;  3M63 B;  3ALB A;  4HK2 A;  5AEK B;  3TL5 A;  2RGF A;  3A33 B;  4NJ7 A;  4E74 A;  2DYB A;  4LJO B;  2WX1 A;  3RYT A;  4GMV A;  2XEW A;  1WM3 A;  4E3C A;  4HJK A;  2LD9 A;  1WJ6 A;  2DZJ A;  3PLV A;  5AZH A;  3UF8 A;  2LXA A;  3DVN V;  1EF1 A;  4FHK A;  3T9L A;  3ZW3 A;  4BKT A;  1RAX A;  4GDL A;  4IM0 A;  4BFR A;  3PRZ A;  3A9J B;  3R7Q A;  2KWV B;  4ZRK A;  5DCN A;  2RSU A;  4TUU A;  4W9K A;  2WX0 A;  2J0M A;  3U7D A;  4FJZ A;  2MA9 B;  4G11 A;  5IA7 A;  3BIN A;  3ZUN A;  3DOW A;  1WX9 A;  4IWP A;  2DEN B;  3PHW B;  1WY8 A;  2LRW A;  4RMA A;  4GDK A;  4YL8 A;  4NAW A;  4NNJ B;  2KX0 A;  5CHV C;  2MBQ A;  3TMP B;  2MRP A;  2ZJD A;  1V5O A;  1TGZ B;  2D11 A;  3WAO A;  3DBH I;  1WRD B;  2C7M B;  1WX8 A;  1TTN A;  2LJ5 A;  2KQS A;  1NDD A;  5FR6 A;  1WGH A;  4WJO A;  3K9P B;  4TKN A;  3KUD B;  4KDL B;  3L0W B;  3V6E B;  2JRI B;  4MEM A;  3QX1 A;  4W9G A;  1S3S G;  1WGG A;  3NY5 A;  1IYF A;  3VFK A;  1WGY A;  3KUC B;  2FID A;  3RCZ A;  3HIZ A;  3GZN I;  3UGB B;  4JL9 A;  1GUA B;  3ZNZ B;  2LGD A;  1Q1O A;  2DZI A;  2KHW B;  2MBB B;  1H4R A;  2XK5 B;  4KVG B;  3DQV A;  4IWO A;  3WAP A;  3UIN B;  2LXC A;  2Z0E B;  2HE7 A;  4LDT B;  4AP4 C;  4EZL A;  2WYQ A;  1A5R A;  4WQO B;  2M4N A;  2C7N B;  2MW5 A;  1GG3 A;  1V6E A;  1WH3 A;  1V81 A;  2YLM A;  4AWJ A;  4FHJ A;  4MDK E;  3UIP B;  2KKC A;  1CMX B;  2K25 A;  3VQI A;  4DK5 A;  2JPH A;  3V61 A;  4MGZ E;  3O65 B;  2N7D A;  2M1M A;  2J7Q B;  2ZNV C;  3OLM D;  2VRR B;  2HD5 B;  2IYD B;  3PRP B;  2RR9 A;  1GNU A;  3APC A;  3PRM B;  2KLG A;  4AJY B;  3TCA A;  4MSQ B;  4ASW C;  3RD2 A;  2GBM A;  2IO0 B;  3DPD A;  4RM9 A;  2N1W A;  1C3T A;  1EUV B;  3IFW B;  3A1Q B;  1VCB A;  2L8J A;  4I6N B;  4K7U A;  3APF A;  1D3Z A;  4B95 A;  1KOT A;  4GB9 A;  1F9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...