3BYYB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 70
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3byyB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3byyB01
1D5ZC 1T5XD 2QEJC 4Z9CB 1LT5D 4UDUC 5ELDA 1LT4D 3O13A 3DWPA 1PYWD 1JWUD 1B44D 1S5DD 2IJ0A 3BVMA 1CHPD 1STEA 4DXGA 1RF2D 1TY2A 3BVZA 4RHSA 3KLSX 1MD2D 1I4XA 4RHRA 1XTCD 1BCPB 1YN4A 1JCKB 1PTOB 1I4RA 1LT3D 1LLRD 4RGTA 2J4XA 2ICIA 1TS2A 4RH6A 1HQRD 1DYQA 1JR0D 3SEBA 1CK1A 1EFID 1SEBD 1D5MC 1TS4A 5ELBA 1DJRD 4O1NA 3BVGA 1YN3A 2AQ1B 1BCPC 1PTOC 3R2TA 1ET9A 4RGMA 2QILA 5ELCA 1F77A 1FNWA 1I4QA 4RGNA 1JQYD 1EU3A 1ENFA 2XN9C 1D6EC 2R61A 4L63B 1SE3A 1TS3A 1LTID 2RDGA 1TS5A 1S5CD 2NTSA 4BWGB 1BCPF 1RCVD 1PTOF 1TY0A 1SJHD 5FK9C 1HA5A 1RDPD 1S5FD 1L0YB 2AQ3B 1LTRD 1LTTD 1BXTA 1BCPD 4DXFA 1PTOD 1D5XC 1EU4A 2IPKD 1KLGD 2WV6D 4RFBA 2XNAC 5ELFA 1PZKD 2XRQD 2TSSA 1LTGD 1JWMD 1PTOH 1M4VA 4L6TB 1SJED 5TSSA 1EEFD 3BYYB 1HXYD 2O2LD 3CHBD 3EFXD 4ZYSA 3URYA 1S5BD 3R8BA 1LO5D 1L0XB 2AQ2B 1AN8A 1SE4A 3V05A 1S5ED 1G8ZD 1FNVA 1UUPA 1FD7D 1V1PB 3BYTB 1PRTB 1PRTF 3MFGA 1V1PA 1AW7A 1FNUA 2Z8LA 5FKAC 4OHJA 1HTLD 1KTKA 1RD9D 1I4PA 1QILA 2XRSD 1YN5A 5I4DA 4RCOA 1B1ZA 1I4HA 1SBBB 1EWCA 4TSSA 3W2DA 3BZDB 1I4GA 4RGOS 4NZLB 1LTSD 1PRTC 2CHBD 3TSSA 1SXTA 1UNSA 1LTAD 3DWAA 3MC0B 1SE2A 1GOZA 1EEID 1V1OA 3EA6A 1KLUD 2RDHA 5D3DA 4K6LA 1CHQD 3GP7A 1JWSD 5D3IB 1CT1D 1XXGA 2G9HD 1ET6A 1LT6D 3OWEB 1LTBD 1FGBD 5ELEA 1PZJD 4C56C 2NTTA 1CQVA 1PZID 3R2IA 1PRTD 2SEBD 3DWQA 1ESFA
chains in the Genus database with same CATH superfamily
3GQBA 2DAJA 5AJ3L 3MEHA 3KDFA 1LT5D 4MACA 4DR4Q 3HOUG 5EPLA 3P42A 4DR5Q 4MTKA 1NE3A 1VQOA 1K83B 3C2PA 3IG3A 3UE0A 2HDEA 3U4ZA 3A5UA 3FILA 1E1OA 2UU7A 1Y1VH 5C3EH 1E9MA 4HCPB 4C7YA 3KUPA 2CH4W 3GO5A 5IP9G 5L95C 3QHTA 4RMAA 4HJGE 2L4NA 3DUZA 1VD2A 3OMGA 4KIKB 4BXXH 1V81A 3D6CA 2ZM6Q 1WE6A 1J8CA 2BKRB 4LDTD 4JI5L 1CK1A 1E8YA 1N63A 4GDLB 3VA7A 4A3IB 1CKOA 2WWZA 4EVOA 3AFQA 2O2VA 3VDZA 1FPYA 1FNWA 2B2TA 1VMPA 2BE5C 2E2HB 4JW0A 4DHJB 2C7HA 2VNUD 1FD6A 1WJJA 2WB1G 1WX9A 4CQNA 3SXHA 4L1BA 3U9OA 1PYSB 1K8RB 1TS5A 4HEDA 1AE3A 1IZ6A 4IUVA 3H7PB 4LF4L 2LWPA 1STBA 1G91A 2DZIA 1YVCA 4CGYB 3VR2A 2CJNA 2AMCB 2PPHA 4M0WB 2AQ3B 1LTRD 1PQSA 3GS2A 4KHVA 2H5XA 2LVQA 4NNJB 2NVTH 5G5HA 2EYJA 3PGZA 4G0NB 3VYUA 4F87A 4LFCL 1JWMD 4URKA 3UDIA 2F0DA 1YHBA 1A70A 2P5ZX 1SNOA 4CJ1B 3KUDB 3N3KB 3NTIA 3PIP3 1DOYA 3S1QB 2HJ1A 4KVGB 2EXZA 5C4HA 3PO2H 2QSDA 3IXSA 3VTVA 3H0GB 2KWUB 2R92B 3DBRB 3I56A 1N6ZA 3DVNU 3IVFA 3DHHC 4EEWA 1I42A 1B9NA 1RHPA 1PH6A 3VR5A 4FXGC 4PMCA 1OEYA 4PT5A 2WKCA 2BWES 1PRTB 5DM63 4IWQA 3RI7C 4OX9L 4DR6L 1HFGA 2JXTA 2DJFC 1WVLA 3BJUA 3RN9C 3VR9B 2JK8A 2EY6A 1SYEA 4KDIC 4CHTB 2NPTB 4CO7A 1B1ZA 1OFFA 4JI2L 1ZXIA 4TVAB 3HM6X 5GXGB 2K5HA 4N8X1 1NENB 1JB7A 1ZYRD 1TQOA 4LF9L 1LTAD 1XNQQ 1WX8A 3ZJUA 2GB1A 2HTHA 1C4AA 5IYDG 1XMQQ 2V4IB 4NAWA 1JOQA 3LDZE 2BB5A 5FLXc 1E8XA 2WKDA 5HY6A 4ZKCB 3QOJA 3MTSA 5JEAG 1WXQA 2LY7A 4JPBW 5IOCA 1Q1OA 2DLBA 2NVXH 2G4DB 1WFQA 2A68C 2BB6A 4NQLB 4A8XC 3G7LA 1P0RA 2E3TA 1MI0A 4MGYE 3S14H 3F2UA 5DM73 5G55A 3R2IA 3MTNB 1KRHA 5IAAC 1GJXA 4PK1A 5K5PA 4FF2A 2K6QA 2KQ7A 2WU5B 1NMGA 2LUEA 4DPGA 2QHOA 4Z9CB 4R4TA 5ELDA 3P75A 3CMAA 1TKYA 4KZCA 3VR3A 4H2AA 5CHWA 1WGHA 3I4MH 2BYFA 2QC8A 1GD7A 1STAA 5BMGA 3P7JA 3N20C 2C5LC 1STEA 2NN6I 2PE9A 1JRUA 3OLMD 4GKJQ 3P4QB 4GMVA 1H9KA 3EQLC 3F8TA 3MHZA 2D62A 3PV0A 4X65L 4DAYA 1Z7TA 3PUXA 1WGYA 2OJWA 3OSOA 2MBHA 4YSZB 1G6JA 2EE1A 1ASZA 3HOYH 4HCNB 5G3LD 4NY0A 4ACFA 2A8VA 1WYWB 3RZWC 3RNFC 3B6YA 5C4JB 3I8ZA 5BYRA 2N9KA 2I46A 1S40A 2F0EA 4BBSB 4PZ7A 4FN2A 4XQJA 4NQKE 2JWUA 4RGMA 3GDEA 4LAAA 4A3JH 4EX5A 1J5EL 1E6EB 2QA4A 3HVZA 1GB1A 1CM9A 3DEOA 2WINB 4KY5A 4M02A 4A3MH 1WGGA 1PXUA 1UEBA 1WCMB 2E2DC 3ULJA 1WTXA 2K8HA 3I63C 5C3XA 2LGIA 5EGTA 4WIPA 2MBQA 4LF8Q 5DPWA 1P7FA 2NTSA 4DR2Q 1T0RC 2Q8TA 4I7AA 3SK4A 2CHWA 4LNNA 4C3JB 2FAZA 2JJQA 4K2KA 5IGBA 4NXML 3DQVA 3KUZA 4IUUA 1GUNA 3WA0A 2KANA 4DHZB 2AKWB 4TKOB 3DBHI 3ZLZA 1JICA 1UEAB 4F8CB 3C1EA 4DAPA 4QGUA 3HUIA 5C3JB 4WJWA 1C4PA 4HCEA 1PH3A 3O65B 3PLVA 3EBEA 4PMBA 5EKLA 3GTMH 5C0XI 1JROA 1L4DB 4W9CA 2QMTA 1ZEQX 4LK1C 1VQIA 3ICEA 3I5JC 3STBD 2JA8H 2JA6B 1V80A 3A9KA 2ENBA 4FULA 3L0OA 2Y5PA 3JAMi 1J19A 1UUPA 1UWMA 2EMSA 5EE1A 1V1PB 2VY3A 3A54A 2ZJPA 4DV2L 1XNRL 2MW5A 1PRTF 1GUSA 4IUMB 3SE0A 3RLNA 5KHQA 3MC8A 3NTHA 4XDXA 3HKSA 1D1KA 2DYBA 4A3PA 1PH9A 1ISNA 3HKZB 2EJGC 1YHAA 2HCCA 4R8NA 1U4RA 2I5MX 1JJCB 1K73C 4LFBQ 2IGDA 4IW0A 1U4PA 2IGHA 4XTCS 4OIKA 3M4OB 2MBBB 4WRDA 1IBML 1SB3C 4CYEA 5AJ3Q 4XYOA 2RDBC 1LTSD 3N30A 1IHZA 3J7AV 1Z5SB 2MSED 2XWJB 3E9IA 4DV7Q 2BF8B 2RCFA 4DR3L 4GIVA 2DGYA 3GOEA 3IAYA 2NB0A 5C4XG 1A2UA 1EEID 1AWDA 2KHIA 4DHJD 4B3RL 4JBMA 2KBNA 1K50A 3HZXA 4GOPC 2JA5B 1HNXQ 1Q82C 2JWZA 2KFKB 2NWGA 1ACCA 1E5WA 1I6HH 3VXWA 3HOWH 1RYJA 4BVUC 3NJTA 1ET6A 1SR3A 4XQQA 3E0JA 3J9CA 4JK1C 2UXCL 4LNKA 1CQVA 2VQEL 2J7ZA 2N8NA 2SEBD 3OW7A 4PZ6A 3MWYW 2BH8A 4HPPA 4WAFA 5IIFA 5JXVA 4TRDA 3GTKB 2K8CA 1FM0D 4L5TA 3L54A 3AE3B 1FJGL 2BWFA 2K01A 5GQOA 4DNRB 2ZTEA 1EM7A 3BVMA 2VUMH 3L08A 1F2LA 1N61A 2VQFQ 2G3QB 4HEA1 5KGUA 2N78A 3M4YA 2KC1A 4JWUC 4CDDC 3TBLD 2ES2A 1PLFA 1EY9A 3SHLA 3BWUD 4DV6L 2F0WA 2J4XA 4S0RA 2MCNB 2EKIA 4RA8A 2NR2A 1HFNA 4B0EA 2F0VA 4IPDA 4NKLA 5KRUA 2YU9H 2RMMA 2M0XA 4YT0B 3RZOH 3MHSD 1PFDA 4BS9A 5JJKA 4E74A 2B2VC 2EYLA 5E3FA 4ALPA 1BCPC 1CKMA 1AZQA 4HKQA 1H9SB 4GOPA 5EJWA 3TREA 2IX3A 5LNK1 3J80L 1PUTA 2IX0A 2UUAL 4P74A 1IPGA 4PYUA 4MELA 3OMCA 3MJ5A 1WTVA 1TWAB 4MN3A 5CV4A 2C5CA 3PUZA 1TS3A 2IW3A 2ZCBA 1WSPA 1TVXA 1K51A 3S17H 1P8LA 1TWCH 3KYCD 2OTJA 1EWIA 1PTOF 1JE5A 5IGEA 4BBSG 3DHIC 2B2WA 3GTQB 4DK1A 4IOIE 1LUZA 3B9JA 2E2JB 5C44G 2KHSA 4RCNA 3CCSA 3GTGH 2WLBA 2Q2UA 2D10A 1TR5A 5M5WB 4A3BH 2JYEA 3EFCA 4GSWA 4B95A 2WAQG 1Q1BA 2BCOA 2M2LA 5FLXE 2G1EA 3H3VC 5D7GA 3Q8EA 1M4VA 1EIHA 3NS1A 3GV6A 2BA1A 2PZWA 3QAQA 3CQZH 3QIJA 2ZNVB 2MJ3A 2DWQA 3UDXA 5BN4A 4ZRIA 3TP6A 3Q8DA 2KDFB 3C19A 3KWLA 1J7AA 4LNOA 2B2VA 4RWSC 3ZRCA 2JX5A 3JW0X 4FJVB 3VH3B 3W1SC 2M0AA 1WXSA 3RYTA 4BY7H 3L4PA 3P63A 4US9A 4ME3A 1SNQA 5KNBA 1GC6A 2A5HA 4BY1G 1TT2A 4R3DA 1WYDA 3M3JA 3ONAB 3FP9A 3GE3C 1I4PA 4FDBA 3IBEA 4JI0L 1WWTA 1CKNA 4JL9A 3J7AF 3H09A 4IPHA 1L1OA 1B3QA 2IO2B 2PQAA 2G45B 4M01A 5CHFA 2JXXA 3FKIH 5EKIA 3DWGC 1B9RA 4N59A 3Q3OC 3AB5A 1L2FA 3FVQA 3IT6B 2PQEA 2VRRB 2KDMA 3LX0A 3TEXA 3F2CA 4ITKA 1XD3B 1VQJA 3HKZG 1TIFA 1X56A 4R4IA 1I5FA 1QVFA 1KOTA 2KJHB 1I94L 4YL8A 1VQ9A 3KBXA 3MVVA 1IBLL 4B3TQ 3W1YA 4APVA 1NYRA 1H9MA 4V190 5IA7A 4IUPA 3BDLA 3GTLB 3DBHB 5IYBG 2HHHQ 2KJXA 1K52A 3BU2A 3I72A 4J6HA 2K0PA 2M8SA 1B3AA 2DY8A 2GI9A 4R4QA 3HOZH 4DU9A 3O13A 1PGBA 1NSNS 2EDGA 2KJRA 3I4NG 1E7ZA 2JA5G 3CAMA 3OJ4B 4MSQB 4A90A 4LMQD 4YY3Q 1UE6A 2BOSA 4Q0FA 2IGGA 4LF6L 1LT3D 2WHIA 3CSFA 3TMEA 2WQYB 1L2NA 4ZRPA 2F0TA 4QY7A 1ZDVA 5LMNL 4B6WA 3HOVH 2EMTA 4B08A 1QE6A 4HJ8A 2E2IH 2F0FA 1C9FA 4KV6A 3WAPA 1LABA 2UUCL 1DJRD 1LXDA 3BVGA 3NQTA 3VUYA 3D3RA 2WXRA 3V6EB 1ET9A 3BK2A 2MP2B 1TWHH 4J1MA 4NXNL 1K3BC 2V3SA 3A9JB 2F0JA 3OWFA 4WWNA 5MPOA 4N58A 5EDSA 1JQ4A 2OEDA 1WTQA 4H0LC 2QCZA 3QX1A 1FRRA 1SAPA 1S5CD 1N36Q 1FYCA 4GLXA 1H9JA 4B3SL 1UE1A 4U673 4FF3A 4HR7B 3T16A 4ZHOA 1OO9B 1IUEA 4OO1G 4P2CB 3K0XA 4DV2Q 1XNRQ 3R3MA 1HR0L 3PZ8A 2INNE 2O5IC 4RM9A 2R7ZG 2Y0SG 1IP9A 4DR4L 4DUZQ 1YJ9A 2H88B 2B2UC 2RHQB 2Y3AA 4DR5L 1RTOA 2K25A 3I7FA 4DBGA 4EZKA 3V61A 1IYFA 3QB3A 4JI1Q 1EYDA 4OVZA 3PQIA 1JJ2A 2F0IA 1J0GA 1HE8A 1XT9B 4II3B 2K1BA 4WORA 3AMZA 1LO5D 5LHY1 4DR1Q 1J8IA 2B2YC 2LMCB 4C3IH 3KVFB 4EGVA 1DGJA 3LXFA 3BZKA 3MFGA 3BK1A 1DOIA 2ZM6L 1YJNA 3B0AA 1S3OA 2NN6G 1D1IA 4HK2A 2NZOA 1CA5A 1W3SA 3LB8C 4YWKA 5DPSA 2DY7A 4K14A 5C3EB 2WX0A 3B1LX 4B9KA 2PJHA 1IBXB 2UXCQ 2JQRB 1VQ4A 3CMEA 4DV0L 3HFZB 1I4HA 2JA7H 1EWCA 3N32A 4IM2A 3V96A 2CW0D 2MLBA 2DUDA 4K1RB 1M1KC 3X3MA 1ZGUB 1PRTC 4LLGM 5D94A 3GD7A 3AM9A 4FBJB 1FJGQ 2EJFC 3M9BA 5HGQA 1PH5A 3DWAA 4NB3A 1WGRA 3KYDD 5CBEE 2DZMA 3L9AX 3M3YH 2RDHA 4IOCA 2I1JA 4KZ0A 4LDTB 4OZBA 4RMFA 1WMHB 2A1AA 5J39A 2A73B 4GU2A 1UE7A 5ELEA 3H94A 3DVGY 4OW0A 4JOIA 2B2YA 3CC7A 1YX6B 2YVCA 4JX1C 2HD3A 1V9JA 3A5ZB 1X3FA 2B39A 3LJ3A 1M94A 3DWPA 3H8HA 4O42A 4G50A 3EC8A 1F9PA 4ZOHC 2JT4B 3CMMB 3NUHB 1NTGA 2EIFA 3I4LA 2NVTB 1HUMA 3K5OA 2K39A 2MH7A 4N9PA 1WD0A 2NVYH 4CHKA 1X65A 1NAPA 3L10B 5JJZA 5M3FH 3KF6A 4FNFA 4A3GH 3G4SA 4DV4Q 2E6XA 1R9TH 3RFZB 5EQ0A 2Z0SA 4A3DG 5C0XG 3PO2B 2DAFA 4X62Q 1SMYC 2BDOA 5GAHC 1SE9A 3AEGB 4HWIB 3H6NA 1R4QB 5ELBA 2EELA 2PIAA 2NVQH 2AQ1B 2RA4A 3TS0A 4HRSA 3TEWA 1CA6A 2UUBQ 4K3BA 1WI0A 2QDFA 3ONSA 4YCVA 1K0RA 5DLQE 1XNQL 1E3PA 1HEZE 3GZNI 1D6EC 2R61A 1H9RA 4ASWC 1YQ3B 4OVVA 3PIO3 3KYHC 1SYDA 2L11A 4KKIA 2RDGA 2W82A 3D4WA 1JOOA 1VZ6A 1MGSA 5C3WA 4HIMA 3AU7A 1F9SA 5JVG3 3DBRI 3G48A 4XYCA 5KIXA 1PV4A 4LW1A 4XT3B 1BR9A 5JVH3 1YJIA 3AE8B 3N9YC 3V2TA 1V8CA 5GAEC 1PYBA 3UI2A 3RUZA 1B4OA 1KHIA 1BNZA 1VQNA 4JYAQ 1ROEA 3SFEB 1Q46A 2XNAC 2F3WA 1PZKD 4DK6C 5I6YA 2V1YA 4B0MA 3PREA 2SDFA 2YTXA 4R4OA 1F2YA 2OQKA 3UDFA 1YIJA 1VZ8A 3W9CB 2MGSA 3RN2A 4JVZA 3U4VA 1LGRA 2KFJA 3IL8A 5G5GA 3CCUA 2HQEA 4MH0E 4OIJA 3PF4A 3E0EA 2NVXB 2ASQA 2I5LX 4GKJL 1FFUA 3ZVVA 3A4SC 5E4XA 1JB3A 3URYA 3S14B 3B2FA 2N1WA 4K81A 2KDIA 3VUXA 1K3RA 1XYIA 3AE7B 1FO4A 4PNYA 1AN8A 2IHEA 3P20A 5DEHA 2L1AA 3P2BA 4PS3A 2D3CA 4YIJA 4L2YA 4WJOA 3CIRB 2W55A 1VCIA 3NELA 1M90C 1O7ZA 1WTWA 2J0JA 5KYIA 3I4MB 3WAOA 1P98A 3IFTA 1I94Q 4FVMA 3T13A 3A4RA 1JW9D 3UF8A 5H8YE 1RJTA 3F2DA 1EQRA 3J81i 2IT1A 2RGFA 1HJPA 3DM3A 3QG1A 5LMUQ 1S72A 4AJWA 2WXJA 5C6AA 4GNXC 5D6JB 4QIWE 3TRZA 2XIWA 3VYTA 2DN8A 3HOYB 2K9XA 4RGOS 1I4GA 4WJPA 4S17A 2QDLA 3I4OA 4EQOA 4C00A 1OXUA 2ZPYA 1TTNA 4JV5Q 1VRAB 1NVID 4LF8L 2BW2A 4KLKA 3QWNA 4DR2L 1JORA 4IUQA 5LXHA 1SIFA 1O80A 1WTRA 1EY4A 1B9MA 2YV5A 1QCBD 1UAPA 1Y1VG 5E6OA 4K6LA 4A3JB 5ELOA 1RRBA 4MM3A 3PZ7A 1DCZA 1YZ6A 2F0OA 4A3MB 1MKHA 2RR9A 3ETRA 4H44C 3WANA 4KSKC 4DDGD 1G2SA 2LASA 4FP5D 1HHVA 4QMGA 3H1UA 1EF5A 4REZA 3T1YL 2LGXA 2JP1A 4R9WA 3NBHB 3ZO5B 5KEEA 4KD3A 1STNA 4HMIA 4P16A 3QWZB 4IG7B 4LK0M 1QUQA 3KUCB 2D5GA 2GBKA 3WCQA 2HQLA 2XVSA 3R93A 1MD2D 2F3IA 2F4VQ 1Q10A 5FLXL 2O6VB 3H91A 4GNXA 3B2GA 1DOXA 4K7UA 3ZNID 4ILWA 1VCBA 4RGTA 4A3EH 1JWAD 3R66C 1P7EA 2UXDQ 2HDMA 2PNRC 2KCTA 3RLFA 3GTMB 1OXVA 1WTOA 2XWBB 2E8GA 4IJLA 1AH9A 5KNDA 1FXIA 1SIJA 2BVCA 2NS5A 2PW9A 4LFBL 4JI7Q 1EFID 4K6DA 3T3NA 1BUVT 2JA8B 2JXMB 1JALA 2KTRB 3X23A 2AWNA 2JY6A 1OQQA 1EOTA 3K5LA 4C3HG 1IW7D 2PE6B 4DV7L 4RM8A 2JA9A 4ZDVA 2SNSA 1WOCA 4KGSA 2CW0C 1EQVA 2ZEQA 4BKSA 3PO2G 2M1MA 1LTID 3UGBB 4AWJA 1BCPF 4L8JA 4CBVA 1HNXL 5FR6A 4LUVA 3PUYA 2RCNA 2HIVA 1UF0A 4DV1Q 5A35A 1MJEA 3D0FA 1RLFA 1LM8B 4NJ6A 2WIIB 1FVIA 3D6WA 2PPBC 4BBNF 4DNTB 1NR2A 2OJRA 1NI3A 4AUQC 2EJMA 3VQIA 3JAME 2A4ZA 4DV3L 3MHBA 1CZGA 4KKSA 3GTJH 4J15A 3Q8FA 3SDLC 2SOBA 2VH1A 1ZXHA 3DM1A 1QKZA 5FR3A 3JSVB 1EEFD 4DV0Q 3M95A 3HRZC 1I6HB 4IWPA 3HOWB 2O2LD 4X3SA 1EY0A 2VQFL 4A3FG 2L8JA 5JOBA 2MJDA 4AYBG 3PO0A 1BBWA 4A20A 4UP7A 3DXJC 3PO3H 1N5WA 4PV1C 2B63H 3FRPB 2HCIA 5IGGA 3A1QB 2A69D 3EGRA 4AH6A 4YWGG 1JWBD 3A7LA 5J3BA 1T0YA 1V86A 1WM3A 2L76A 2RQXA 3E9HA 2PVGC 2ZNVC 3AXCA 5E6PA 1EIYB 2VUMB 2K14A 4XIGS 2MUYA 3D4DA 2MNAA 3I3TB 3U7ZA 5CC4A 1N34Q 1VQFA 3EECA 4IFDJ 2X8XX 1VR9A 4J8QA 3GZNB 1CJEA 1GHKA 4LNQA 2K7VA 1A5RA 1GB4A 4P7IA 3VR8B 2FMCA 4GZYC 1FCLA 4ID6A 1Y8PB 1SXTA 3RD4A 2YU9B 1MVKA 3AULA 3KWVA 4IFDH 5G3LF 3EN2A 3RZOB 3FHWA 4ZRQA 4POGA 1EY7A 4FF1A 5BN5A 4IWOA 2CHXA 3L13A 1QOHA 4DK5A 3V62A 3IKJA 1C76A 5D2MB 3HOYG 4US8A 4I7ZC 2KA7A 3SK8A 2KNBA 1ZP0B 3C1FA 4HPMB 2IO0B 4ODGA 4BKTA 1KAWA 2GMIC 4II2B 1ILQA 3HOUH 2NYZD 4ME5A 4HIKA 3S17B 1TWCB 4GLAC 1VQKA 4A93G 2QEJC 2DENB 3Q6SA 2C7MB 4DDID 4HJ9A 2IWHA 5CV6A 1QF6A 4A3JG 2JF5A 1KM7A 2R93G 3GTGB 2IHFA 1MI2A 1Q8IA 1T9HA 1TY2A 2NCNA 4A3BB 5IP9H 5EE3A 4IUTA 2W3RA 4TV3A 1Q12A 1HH2P 2G9DA 2H1EA 3EFUA 2JPHA 1IGDA 3W1GA 3RT3B 2INPE 2PCFB 3CQZB 4XDDA 1XO3A 2AWTA 4EKUA 1BO0A 4ZKBB 2K3UA 4KD4A 2L52A 3CRLC 2EYHA 3IAM1 2L15A 2LGYA 4KGRA 1K8OA 1TS4A 5J2RA 1R4NB 3MC9A 2GVAA 1WJ6A 2JRHA 4JI4L 1E24A 4KJNA 2JYOA 4BY7B 2F0UA 2YLMA 1EU3A 4P72A 3UI3A 3AEFB 5M5XH 4X66Q 3J7YW 3NP8A 4XYQA 3NG0A 4IALA 4GDKB 4AQ7A 3PVLA 5BYSA 1XLQA 4QF4A 3PHWB 4WQOB 4OWWB 2AYOB 2JA8G 3ZRFA 4B3TL 5IYCG 5CV7A 1NY4A 4P75A 3JYUA 2K28A 1LTTD 3FKIB 2YEPB 1P9DU 5EBDA 2BS3B 3MXUA 2HHHL 1RWSA 1SGHA 1C77A 1ASYA 4UHVA 1S3SG 5EKKA 3L7ZC 3S1MH 3MXPA 1TZ1A 2KHWB 1KDCA 4ARIA 2I5HA 1JT8A 2GLSA 2OXPA 1SJED 5TSSA 1F2ZA 4DNIA 1N33Q 1EY8A 1C4CA 1RM6C 4K7SA 4GGQA 1YEZA 1YNND 3CHBD 1SNCA 4DKAC 4YY3L 1OGWA 3BZCA 3CCQA 3R8BA 2QEXA 1DOKA 1L0XB 2AQ2B 2ASBA 3M85A 2KXJA 2PKOA 2EPBA 3DDCB 3HOZB 2GRIA 5ELNA 1FD7D 2V4DA 4A3IG 1X6OA 3FMCA 1R4MI 2A6EC 2ZJQA 2LHDA 2O6VD 2EOTA 4EQNA 3HOWG 1V6EA 3ZKJC 2UXBQ 3AEVA 2F0KA 2LFNA 3DHGC 3QCAA 4N6EB 1XTDA 5DPRA 2PNHA 4DQOC 4XT1B 4HJ7A 3Q6BA 1E1TA 1GJZA 5CYUA 3E56A 3T8MA 2Z6BA 2VL6A 2J0MA 2CU3A 4MSMB 2E74C 1HCZA 3AYHB 3CCVA 3K8AA 3T1YQ 3HOVB 3E9SA 1UNSA 2E2IB 1BDOA 2WXMA 2KOXA 1N36L 2VUMG 2ZVOA 1IW7C 2J52A 3OYYA 2K5DA 1EUJA 4S3SA 5JEAH 2V0GA 3P1HA 4F8MA 4MM3B 3EA6A 5HKHA 4DV5L 3MXNA 5E1FA 3I90A 1MG8A 1TWHB 1JWSD 4WJQA 1M8AA 5HHDG 4KKJA 1LT6D 5FJ8G 1GPXA 3BIID 1LTBD 4WURA 4C56C 1PZJD 4IPCA 4P1BC 1PZID 3J81c 3K9OB 4DUZL 1YX5B 3H0GG 1ZKOA 2WB1E 2R92G 5AFWA 1LT4D 4JI1L 4ARCA 1SDFA 3Q8CA 4FYDA 4XQNA 2EZVA 3PRPB 4DR1L 1T3QA 1XF5L 3AB9A 1Y1WH 3KLSX 2XK5B 3CSTA 3Q8BA 1I4XA 1F9RA 3WOEA 3PSIA 5BR8Q 3G71A 5IOIA 4CDEC 3M62B 5FLMG 5T8IA 4HSPA 2CFMA 4K8IA 5IP7H 1XCTL 2J0TD 2GBRA 2L32A 3K9PB 3SU8X 2AL3A 4F88A 2RKSA 2WFWA 1YNTE 2WGSA 4G11A 4MH8A 3PF5A 1JR0D 4OONA 4DF7A 1D5MC 4IOAA 2DYMA 4W9KA 3KDFB 4A3BG 2LVPA 4C3IB 4KDLB 1WR6E 4C4VA 5LXIB 1IGCA 4DV3Q 3PUWA 2ZPNA 2OF1A 1B7YB 2IO3B 4BKGA 1VZ7A 2F0NA 1V49A 1WJNA 2ZZPB 1BUIC 2EYMA 3FILB 1Y8RC 3DVNV 1VQ6A 4C1NI 1WJUA 3FPUB 1EIGA 4HAEA 5M3MH 1GM5A 2WXIA 2R7FA 2F0LA 1KDAA 2JA7B 4W9HA 2I2YA 1UWXA 1ESRA 4W9JA 4KJOA 2QKIC 3D8GA 4KKTA 2YEPF 1KXLA 1E10A 2WV6D 3S24A 1MFWA 1ICWA 1SRUA 2GBJA 4BZAA 2EVBA 4ZK9B 2XRQD 2KECA 4NPSA 3NVVA 1LTGD 2MO0A 1PDQA 2WXGA 2JZ3B 5HI1A 2O2VB 2F03A 1OXXK 3M3YB 4XWTA 4JIOU 1RAXA 3TBIB 1YQ4B 4MDKE 1VLBA 3SVMA 2L55A 1P16A 3J7A5 2FCNA 2X38A 1K8AC 3MXGA 2K5NA 1MJDA 1J7BA 3SHQA 5G2NA 3NUCA 1C48A 4G57A 1E90A 4BBNC 2A6HD 1QVGA 3KLWA 3CCJA 2R2QA 1ZYRC 3KLSA 4HTHA 4MHEA 4POFA 4DV4L 2Z4HA 2KX3A 4MGIE 1GUOA 3I3CA 3NHHA 4QIWB 1JRPA 3FC4A 4D2KA 1Z6HA 4X62L 2ZCCA 2NZ1D 4UPAA 2D07B 4BAXA 1CZWA 3MA2B 3DLLA 1Q7YC 4IDIA 3ZNZB 4WWPA 1WCMG 2N0SB 2L0TA 2UUBL 2NVYB 2RF4A 4ZUIA 3UQBA 5M3FB 3W2DA 3LWEA 1TWGH 3QR8A 5GROA 1HZAA 4A3GB 3TP7A 5J22A 1R9TB 2UWQA 4JPSA 1TXYA 2C60A 3U30A 4X6AH 5C4XH 3H7SA 4C3JG 1QT9A 4UAIA 1WXAA 2ZJDA 2BYEA 3IAS1 4IJHA 5LL6X 2VZKD 1XWEA 2NVQB 5A2QE 2N49A 1J9OA 1UE5A 5D3DA 3S1RH 2KWDA 2WXKA 1FXTB 4HJ5A 5GMVA 4OELB 2G5DA 1ENCA 3HOXH 2LXJA 1BF4A 2E5LQ 2FIDA 2I0QA 2G9HD 4JYAL 2N7EA 5IGDA 4OEMB 1X3QA 3FDTA 1ZDXA 2PEAA 4JBKA 5CTRC 1VF5C 2WXNA 2KDEB 2REXA 5LLIA 4IFDI 4ZQ3A 3K7AH 1KLVA 3NZ3A 1HA6A 2A19A 5BN3A 3NS8A 2JA6G 1JWUD 1B44D 3ENEA 2I38A 4JI4Q 2OOBB 1JOKA 5EE0A 2EXDA 2R7DA 4MNOA 3S2HH 4JWSC 2YYZA 3AEDB 4NAWB 2MO1A 4GN1A 3ND8A 4NMZA 1K8GA 4BA2I 4X3TA 3JAML 1PH8A 3H15A 1K9MC 2LXCA 2WS3B 1SN8A 1R4MB 1STHA 2ICIA 1V8QA 3S9WA 1EOVA 1MSHA 5IT9c 1EL0A 1HQRD 4JI6L 3FEWX 1YD8U 4BFRA 2YTYA 5HGTA 3RNGC 1DYQA 2R6GA 1W2BA 1WH3A 2D2QA 5LMUL 3APFA 1VQBA 3HGBA 2N3SA 1AP0A 4WWOA 5EBCA 3G6EA 3A33B 3PSEB 2QCPX 1AARA 2Z9HA 3R2TA 4HN7A 4YWLA 1ONLA 3E5SA 2EYPA 1IKMA 4Q5VA 1N60A 3W1SA 3NVWA 1OQRA 2PW7A 1SLJA 2BBCA 3NSWA 2ALYB 4JV5L 4A3LG 3ZUNA 1MSGA 4DAYB 1L5PA 1L0WA 4AIMA 2BYTA 4Y7NH 1PDXA 1QNKA 3KF8A 1HNWQ 1ZXTA 1BT0A 5C44H 4MGZE 1VQDA 4UY8C 1W6KA 3ZNHB 1S5FD 2DX5B 1L0YB 2ZXRA 1BXTA 3STBC 3EUB2 1PTOD 1C3TA 1ENAA 1EU4A 2B29A 2ZVNA 4YTNB 4J3OD 5ELFA 1IXRA 3ML8A 3VAWA 4C2MH 4LTUA 1PTOH 1Q8KA 1XLPA 2KMMA 3NEMA 4OZAA 3S15H 1HPCA 4LJOB 1T0SC 4W9LA 5JAVA 2LD9A 2K5WA 3PLUA 3VRBB 1AFPA 1IBKQ 3J81E 4HXDA 4NP5A 2RHSB 1XJVA 2F4VL 3RMHA 3FKYA 3K81C 2CR5A 2QDBA 4OGQC 2CHZA 3TQYA 2WXFA 2GN5A 4FXKC 4BY1H 4QUFA 4K7WA 5J17A 2UXDL 3F1ZA 1ZOYB 3BYTB 4HJAA 4OWXB 2WYQA 2K5QA 4DV5Q 1KRTA 1S1QB 1FNUA 3G6JB 3AEEB 4A3CG 5KYLA 1A3TA 5D14A 4JI7L 3AE6B 1MPEA 1RD9D 3CF5A 2PZUA 1A3UA 1ZKHA 2KN4A 3TL5A 3T53B 4WJ3M 2BQQA 2D3GA 1G6PA 3L0WB 3U4EG 1DOLA 1SBBB 4A3EB 2WXHA 2J0KA 3QOLA 4KSLC 1Z2MA 3P1MA 3ZTDA 4V0BA 5CHVC 5BMHA 2JYTA 5JJLA 3SDZA 4HIOA 2LKVA 2Z6KC 2Q2IA 3NPPA 3A9KB 1O7IA 2F0HA 3MC0B 1GXDC 2PYKA 3MXNB 3GTPH 3Q3MC 4CDFC 2CCZA 3VR4A 1V1OA 4DV1L 1YJ1A 3RUIB 2C9WB 2NVUI 1SYFA 1EUVB 5M3FG 4H7BA 1XXGA 4A3GG 2NMQA 1BKBA 1KRSA 4NW2A 2BA0A 1VJKA 2VB3X 3RD2A 2IBIB 3T1HQ 2MHVA 1IL2A 2K22A 1F9QA 2FCMA 3PIPA 2F0QA 4KTAA 3RZFA 4WAAA 3I4NH 2AEHA 3ZNGC 3PT2B 3RULA 1S5DD 1A8VA 1A63A 4G7HC 1WJ4A 3AU5A 3BG3A 4MEMA 3Q14C 1XX8A 4RHSA 3TZDA 4I65A 1WX7A 4BOZB 1VQLA 1WXVA 1I7HA 3U9SA 2MP1A 4ZLTF 4R1JA 1AE2A 1HQMC 1A0IA 4U68A 3GTJB 2B2UA 3TZUA 4B3MQ 3H7PA 1I50H 4AJYB 3VUWA 2KJ6A 1TS2A 3JAMc 3Q22A 2WAQE 3ULPA 4IPGA 1EF1A 4M0WA 4KV2A 2LJ5A 2KEDA 2C35B 4W9IA 2Z6KA 2INDC 1PFSA 4A6QA 1VQAA 1N34L 1BBXC 1EZ8A 4YCUA 2KEEA 5C5LA 1JC7A 4CDCC 4C4VB 3P4RB 4HVBA 3NQIA 1OXSC 4ZUJA 2B63B 3PO3B 1G6ZA 2L5TA 1HZ5A 2V1CC 3CC4A 2M56B 1OTCA 4K0KQ 3VRAB 4B9XA 3OTOL 1I4QA 4XE0A 2LVOA 1B70B 5H92C 2D0PA 3ZDTA 2AUJD 2XN9C 1NDDA 2JSVX 2V3PA 1Q81C 2WXLA 2AUKA 2AWOA 3OG5A 3ND9A 1D2BA 2D5DA 2DYOA 2BKFA 1PMRA 3QK0A 4GN3B 1TU2B 4OO1H 3RNBC 3HM3A 1HA5A 2PO4A 4KY6A 1OEYJ 4GN4B 2R7ZH 3K7UC 1D5XC 3ERQA 2CVRA 3H6MA 2B8GA 1WFYA 2CS4A 2D3BA 2KDBA 5GADC 3T4AC 3BY4B 2TSSA 1QJOA 2KYWA 3WOFA 3A8KE 4GOPB 2NZHA 1AZPA 3M63B 1SF0A 2NPTA 5E7NA 1TT5B 1I3QH 3OIPA 1RIPA 4W9EA 2D0OA 2MPMA 5IE8A 3HKZE 3VYRA 1K53A 3B08A 1Y8NB 2WU2B 4ZHPA 3NY5A 3HOUB 4DA2A 1F52A 1IYJB 3VHTC 2NBVB 2NN6H 3E3XA 1VQCA 1PVOA 4EQPA 1IYUA 2MQJA 3DCGA 3RR5A 2MHJA 3PPAA 4ANWA 3U50C 1SYGA 2K03A 5CBAE 3A8JE 4L5SA 2KAJA 1CSPA 1Q90A 4NDXA 1WZ0A 3DBLI 1SNDA 3DPDA 5IODA 1YN5A 1F9JA 2EQSA 3A7AB 1WI5A 2RSUA 1KJTA 5IT9E 4XXEA 3VDYA 3TS2A 3HEJA 4O2DA 2R2OA 2C7NB 2K04A 4JLCA 4X66L 1PH2A 3S16H 4CKBA 1WTPA 3CKIB 3TSSA 2KVZA 3VYSA 4DR7Q 1FEHA 3ZGZA 1XPRA 1WZ3A 2IO1B 3RZDH 4XGAB 1KC8C 4ABNA 3UDGA 1GOZA 3AEBB 2OEOA 3Q8AA 1KQSA 1VQEA 1VQ5A 1N5XA 2MBEA 2WB1B 1Q0WB 2BT6A 1L6UA 3OOCA 4IC7B 5M5XB 4OVUA 2F1MA 5I9OA 2QJLA 2LRUA 3AN1A 3BINA 4JI6Q 3TCAA 2NTTA 2ON8A 1CKNB 1NMFA 1WGDA 4PG3A 5J1ZA 1RFKA 3OJ3A 1L1OB 1H95A 1ESFA 4LF5Q 1EFWA 2KC2A 3W5UB 1T5XD 2PQAB 2RDFA 4ZAIA 1N33L 4ICUA 2KACA 1PH4A 1N32Q 4W9DA 2O5JC 3PMFA 3W1BA 1N62A 1AEXA 1F2RI 1R4NI 1CHPD 4DN4M 4DXGA 3BVZA 4LUZA 1YMHE 2PI2E 3NTKA 1GKHA 4RHRA 2ZW1A 2A68D 2Q2HA 3S1MB 4HPLB 3U7DA 5IWAQ 1QZHA 4N9F4 4A3DH 3AE2B 5C0XH 5C3EG 4RKBA 3I73A 4BBRH 2N9XA 3I57A 4RH6A 2Q8IB 2JRIB 2Y0SE 4A3OA 3WALA 2WNMA 2UXBL 1F2MA 3AE9B 3KW5B 1J6QA 2I1KA 3UQAA 2OWOA 1VF7A 4GS3A 4BXXG 4I6PA 3CXCA 3HRDD 3X0WA 2X69A 3GV3A 1VQMA 4EUTA 5JZEB 1C0AA 1GUGA 1ZPSA 1OQYA 1UBQA 5AUKA 1PH7A 3MFYA 1RL2A 1V1QA 2LXKA 4LCDE 3PV1A 3SFDB 2KOLA 4IZ8A 2FUG1 3OPOA 4BWGB 5HG2A 1TY0A 2WACA 4LJPB 1SJHD 1Y69U 1T6BX 1DOMA 2B63G 3S2DH 3KK7A 2PMVA 1HZ6A 1NBFC 3RCZA 4IQZA 2K6AA 3RN5A 4M1UB 3GB1A 1AYFA 1TZOA 3HIZA 3PGEA 3F2BA 1KNAA 1SSOA 1TKGA 3S1NH 2A74C 3ALBA 5A2QL 4L6TB 1QLBB 2L83A 2NBWB 4MJSA 3NRZA 1CUKA 2B3GA 1FR3A 1ZE3D 1XPOA 1FL0A 3AE1B 3MJWA 3K58A 1UD7A 2DNEA 4DK0A 5BR8L 4JQWC 3VFKA 3A55A 3PRZA 1PFBA 4IFDG 1FFVA 3T51B 3V05A 2EKEC 1JMCA 4MIUA 2IL8A 2WP8J 4QJFA 3QA8A 2AHOB 2B2TC 2BDNA 2KENA 2KFKA 2Z59B 5E6NA 1AW7A 2N55A 2R3ZA 2L12A 4JBWA 1QVCA 5E4WC 5I6WA 3J81j 1XMOQ 2PVOD 3CW2C 4QUCA 4LFAQ 1Y1WB 4FHJA 2M9VA 1HR0W 3DEPA 3CPWA 5K36H 4RKLA 5C2TB 2L0CA 4A3KH 3J7ZC 4W9FA 1U4LA 3TJPA 1F1HA 1JJGA 3D31A 3E6ZX 3VTUA 5DNFA 2HJ8A 5BO4B 1CQFA 1U4AA 2ID0A 4Y52H 4QB4A 1EO6A 3KJOA 3T9LA 4USAA 2OQ0A 1HTOA 4RNAA 4NJCA 5HFYA 1SE2A 3NXWA 5IGCA 1E22A 1KL9A 4IUNA 5FO7B 4AQYQ 1NJIC 2MX2A 2HD5B 2N9EB 4XWWA 4KN7C 1ILPA 3LNNA 3OWEB 1EQQA 4PYZA 2SNMA 4K8JA 2GVBA 3Q0AA 2M19A 5KHOA 3WIMA 4DAVA 5M3MB 3HG9A 4DXAB 4KHZA 4DFAA 4O0AA 3TEHB 2IY5B 3C8YA 3UINB 2PI2A 2JSOA 3RNAC 1H9SA 1PYWD 1YJJA 4QCLA 5GAGC 2IJ0A 3OTOQ 2JEBI 2I07B 2N9LA 3I4MG 1RTNA 4RAUC 1E0ZA 4HLEA 5KNCA 1A62A 1YIWA 2ACZB 2CU1A 1EIFA 2FFKB 2JUOA 5JPNC 2M17A 2K4KA 1SFOH 5CX3A 3ZW3A 4G4KA 3DBLB 2CKZB 5JHBA 3J81L 1TWFH 4K5XA 2JZPA 1MJCA 1X55A 2PMZE 1WIAA 5C23A 1V5OA 2HT1A 4EFOA 3C3LA 1YN3A 1WXMA 4C3HH 1J7CA 4GOCA 2BYVE 2KKCA 4X3KA 1G2TA 1LFDA 1Y8OB 2F3VA 1JQYD 5C5MA 4IM3A 3Q3NC 2NBFA 3BDCA 4AP4C 2EY5A 1SE8A 1TYGB 3X3NA 2KWCA 2UU9Q 4L63B 1D4BA 5ISRA 2K8BA 4EZJA 4A3MG 1N8RC 4X57B 3I9V1 3M4PA 1A2TA 1CFMA 3KF6B 4MZ9A 2RSNA 1I35A 2E5LL 4HSVA 3P4PB 1TWGB 3U8ZA 2IX1A 4XDCA 1BCPD 3M7GA 5C4XB 2DHZA 2AL6A 2CWPA 2K75A 3OIQA 3D32A 1B2TA 1UH6A 3K59A 4JE3B 3A56A 2LHEA 4A3FH 3S1RB 2K5PA 4P71A 4EQ5A 2A5UA 3HOXB 1GO3E 4OO1I 2VZKB 2Z4IA 3CRKC 3R7RA 4IO9A 5D65A 2WXPA 1LYLA 5COYA 3SGIA 3CD6A 5L83A 1R4PB 4HJKA 1WYGA 3AECB 3CF6E 1NEKB 3NZUA 4ZRKA 4ANXA 3CC2A 3K7AB 2E75C 1E7PB 2FUHB 2L00B 2W3SA 2DBYA 4M00A 4WWMA 5CGKA 2DNFA 1CI3M 1EWHA 4TKNA 1EYCA 2GA4B 3EROA 1SYCA 5CV9A 1X3PA 1FRDA 2F0GA 3S2HB 1HTLD 1HZCA 3KLRA 3ZJVA 3H3VH 1D3ZA 4X64Q 2ICEC 2RBMA 2FE8A 3U52E 1FXAA 3MP9A 3CWIA 2FXQA 3AU4A 2K33A 4OXPA 1ZUD2 3J80i 4P73A 2N9PC 1YJWA 2FMMA 2V3NA 1EYAA 1Y56A 1A6XA 3ZQ4A 1HNWL 1HNZQ 3U58A 1EYGA 4YTMB 4JBJA 1Y1WG 3AMUA 5F2DA 1LM0A 4GLVB 4YSXB 1WTHA 3VTWA 4B9WA 1K0SA 1XLOA 1CHQD 5I2YA 1E0BA 5D3IB 3FAHA 4TQ0A 3UIOB 5IP7G 4FJZA 3KOJA 4HROA 1QOBA 2KT7A 5DCNA 4YSYB 4A93H 1KH0A 1GAQB 1L4ZB 2BGFA 2J53A 3GE8C 4RF0A 1SROA 4Y7NB 1E2WA 1SNMA 5C44B 1PA6A 2R93H 2V4LA 1IBKL 5JEAJ 4CKCA 2MP2A 4JCVE 3KBGA 2WAQB 3A9JA 5IYDH 2M4NA 2WDTB 3CCEA 3AE5B 2HE7A 3CCRA 1SYBA 3NWSA 1Q1EA 4C2MB 1G291 2LI5A 1C4QA 1JCKB 1PTOB 3I91A 2LXAA 2PLPA 3S15B 1MHHE 1VQHA 3GTOH 2MA9B 5M3MG 3FPPA 4QAYA 4HCSA 2FNJB 2FHTA 3WDNA 4N9TA 1C7YA 4KHPQ 3AQQA 2JE6I 2CKHB 5IY0A 1RODA 1HZBA 4O1NA 4JI3Q 4GKKQ 1V2YA 4ICVA 4AYBE 1MHXA 4BY1B 2JVCA 2FBWB 4HIDA 1JMLA 1TGZB 3UIPB 1QUQB 1L7YA 2EY2A 5AUIA 1B50A 3JVZX 4DK3C 4GNXB 5M5YH 4JC0A 3TN2A 3EJIA 5IYCH 1WGKA 1CMXB 1O7LA 2DZKA 1RCVD 2MBOA 5IT9L 2LMCA 2OCEA 3K80C 4E6IA 4KX6B 4L5QA 2UYZB 1K83H 2LS01 3D4RA 1G51A 4DXFA 1GUWA 4YHHQ 2A69C 4RFBA 3K5NA 3T1HL 2BS4B 1WE7A 3VVWB 5IN7A 4ZYNA 3MZ5A 2VXWA 3VH4B 3GTPB 4LJZC 4MJSB 3RPFC 1C8CA 5EPJA 1IBXA 1NYQA 4G3XB 1S4ZA 1KFYB 3ZXVA 1V97A 1IYVA 4MT5A 3SD5A 4E3CA 2KTFA 4ZYSA 3Q3FA 3CP0A 1P3QU 2K5VA 2L9HA 4MGKE 1EY5A 1IL8A 2KO3A 4A3IH 1V5TA 4A9AA 4B3ML 1DONA 2CH4A 3NE5B 1H4RA 2FCQA 3I4NB 1Y14B 4XZ4A 3A0JA 3PTFC 2J7QB 1EZ6A 4H02A 2E2HH 1PGAA 3AH7A 3SK5A 4LNFA 5FKAC 1WMHA 4KMUC 3HOXG 4BY7G 4J6IA 1SNPA 2ZXOA 4OL7A 4JI5Q 2KVMA 3N1YC 1PFNA 1NR4A 2M00A 4K0KL 3DOWA 2B2WC 1I50B 4TSSA 1X3GA 2IY1B 1NI2A 2B8FA 4R8IA 1H8CA 4NZLB 2KLGA 1YHQA 4HKZE 3RNCC 1SSNA 3PIOA 2F0PA 3QJZA 2H4OA 3IFWB 3Q3JA 3FKIG 1YNJD 5AEKB 5IGFA 2SAKA 4W9GA 1UWVA 3K6OA 3PRMB 1UGMA 5FJ8H 2N7DA 4LF4Q 3N1XC 4DAMA 3NVYA 1VS0A 5JPMC 3TEZA 1CT1D 3S1QH 1XQQA 2KK8A 1PFMA 3H0GH 2XBBC 1FGBD 2R92H 2Q8RE 2KQSA 2N7JA 1PRTD 2VH2A 3ML9A 3DWQA 4LWCA 1Q5WB 1YNXA 4KY7A 2FINB 4A4IA 3VA5A 4UDUC 4LFCQ 1TJEA 4CJ0B 1GUTA 3EHVA 1KABA 3HOZG 4NJ7A 2HUGA 2R7ZB 2BS2B 3KJPA 2Y0SB 2KCMA 5CMDA 4KI0A 2WXOA 2N88A 2BH2A 2NBUA 2O4XA 1N9WA 5FLMH 3PZDA 1A15A 1L1OC 1LLRD 5NUCA 3Q23A 4LUOA 1O78A 3KQ4A 2KVRA 1I3QB 1EWYC 3RMKC 3HHMA 5IP4D 2LFIA 4OX9Q 1FCCC 3PS6A 1CZPA 2X6LA 4DR6Q 1NBWA 1QOFA 3HOVG 2D11A 2OHFA 1UGJA 2KMAA 3APDA 1V9PA 1QQRA 4IKGA 1I6VC 2QILA 2E76C 2WX1A 1PGXA 4JI2Q 2GBNA 4DR7L 3I70A 3HVDA 3NZSA 5CV8A 4LF9Q 1YITA 3NWTA 3LGJA 4GN5A 4MTNA 1YNNC 1TBEA 1SMYD 1UBIA 2RD0A 2MRPA 5FK9C 5FO8B 4CKEA 4GXBA 4TUUA 3SR1A 2KD0A 1C78A 3S16B 1LQBA 2PW5A 3A74A 4LF7L 1QZEA 1FGUA 1K28A 2L3ZA 4BOSC 1LTLA 2Y5CA 4LF5L 3RZDB 3N52A 4RF1A 3EIVA 1STGA 3AFPA 1X54A 2IDYA 3ECIA 3IT4B 1N32L 1U0LA 3L17A 3ITPA 2JEAI 4QQBX 3DWMA 3ZTCA 1WF9A 1BBUA 3BYYB 1P1AA 2QIEB 1U4MA 3EFXD 1UELA 5C4JH 2JU6X 2EY1A 2ATWA 1S5BD 2INCC 4H13C 4BBSH 5IWAL 4ZCKA 4YWMA 3IFDA 4X65Q 2DZJA 1T0QC 2L1BA 2F0SA 3RNUA 1E7UA 1FNVA 1GUAB 3S2AA 2CWAA 3TIXA 4KKUA 1A3VA 3N6RA 4C3IG 3K57A 3M7NA 1WD1A 4C7ZA 1WCMH 3TMPB 1KTKA 1VDZA 1E2ZA 1WRDB 5BYQA 1QILA 2VS1A 2XRSD 1PH1A 4FXCA 5FOBB 1YI2A 5C1ZA 3ZJYC 3ULLA 4A3DB 3JC66 4BA1I 1WR1A 4QL5A 4BBRB 4C3JH 1KIXA 1E7VA 1XLNA 3NBHA 1J5EQ 1OXTA 4K2LA 2JQOA 2JA7G 4PQXA 4P6VF 2FIFA 2HTME 3V3XA 3ZYYX 2PTLA 4WH4A 2BTEA 4LNIA 5T1IA 2O6VA 3I2ZA 1KLUD 5C4ZA 3H3VI 4FJYA 1HTPA 4ULLA 2KQ4X 5IO9A 4IURA 1KD1C 1D8LA 4AS1A 4YXDB 4K5WA 1WY8A 3I55A 2XSCA 3RLOA 5FO9B 4C1NK 1V43A 4NXMQ 3IRBA 1C79A 1QG7A 4F7XA 2ZTDA 2WXQA 1X3EA 2HIXA 5AZFA 2JA6H 4ZRZA 4JI8L 2JN4A 1NNXA 2B3AA 3DMUA 3HP3A 3S2DB 2KTRA 3RNEC 4WJNA 4DUYL 2B76B 3NENA 1GNUA 3J80c 4GLSC 2Z1CA 1RF2D 4YCWA 1FIQA 3CCLA 1RFAA 1XTCD 3CU7A 5DPTA 2KQ3A 2PMZB 3S1NB 4X3UA 1I4RA 3M4OH 3QIAA 1YBYA 4F1SA 2PZTA 2D2CC 2RVLA 4KGTA 3PUVA 4BKSD 2QF7A 4C80A 1DD2A 1E2VA 1U9RA 3L2PA 1XMOL 3SK6A 5IYBH 1QB5D 2OTLA 2AX5A 5H1SE 2DNCA 5M9OA 4LFAL 3KFUA 1OTRB 3V60A 4FADA 2L05A 3SEBA 4KIKA 2ZTCA 4ANVA 1XPUA 3ZXRA 2LZ6A 4GDLA 4EOYA 2LUMA 4A3LH 2RSOA 4OWTB 3QO2A 4FXDA 2RPQA 1GC7A 3H9DA 2JA5H 4XX5A 1EQTA 1IBMQ 3JSVA 1U5KA 2VB2X 2V9HA 4E71A 1SE3A 3M4QA 4FLHA 4P1CC 1MBYA 2C9OA 4JOIC 5E6JA 2LJIA 2WDQB 4DR3Q 1DM0B 1DZ1A 4AQYL 4A3KB 1L0VB 2MJ8A 3ERSX 3GTKH 4ZRJA 1Z47A 1ZW7A 3A1QA 1B53A 5HURA 1RDPD 1D7QA 1MIUA 1QZGA 2Q2TA 1YNJC 4B3RQ 3R7QA 2VW9A 2A6HC 5IKCM 3TEYA 3NBIA 1XCQL 5EPKA 1Y1VB 4KK7A 2HDLA 4YTPB 3NHEB 3SR6A 1Z9FA 2H89B 4WJ4A 2VQEQ 3KH0A 2K1FA 1YQBA 2ZW0A 4JGHB 1PHJA 2NUCA 2D9UA 4NAMA 3WAMA 1GVPA 1R7SA 4DHZE 3R3OA 3K0YA 1DGSA 5AZHA 1MHWC 3NK9A 1SE4A 2KMCA 4ANUA 1WRIA 1G8ZD 1STYA 1FMAD 1Q3LA 3T56B 4FF4A 4EZLA 4A3CH 1YOVB 4DV6Q 4K5VA 1F2RC 2LGSA 4GB9A 4G7ZC 1GHJA 2N4FA 5J18A 2K50A 1TWAH 4OHJA 4FHKA 2LGDA 2FCSA 1QOAA 2Z0DB 1NUCA 2BE5D 3TP8A 5I4DA 4RCOA 4UP9A 2KHJA 3HS0C 3C46A 2XEWA 4M8AA 4L23A 3GTQH 2Y5BB 3BZDB 2K6DB 2LEKA 1CTMA 2E2JH 1WM2A 3HK0A 2UU9L 3DHQA 2CHBD 1SFOB 2G4SA 2MQHA 2UUAQ 3ZIMA 1ML0D 1TWFB 2K52A 3OW2A 2LRWA 4I6LB 5M5WH 3CCMA 4PZ8A 2KLCA 5TR5A 5CV5A 3Q69A 2MWSB 4R4CA 4C3HB 4L5RC 2MJEA 1X9NA 2FJ2A 2XTIA 2CQOA 3GP7A 4UP8A 5DAUA 1Q86C 4BBRG 2L7RA 3PHXB 4IM0A 1KF6B 1QOGA 3Q2AC 4WQMA 4Q2JA 2W9NA 3ABVB 2JZZA 1L6VA 1D5ZC 3BDOA 1VQ8A 1TKWB 3EVQA 4FA6A 4WFN3 4A76A 2GOWA 4G7OC 1BVSA 3VR6A 2K32A 1XMQL 5JJIA 1TIID 3DVGX 1HRJA 2OT2A 4M8NA 4GDKA 1NCVA 1E8ZA 4IN3A 1BCPB 1YN4A 1VQPA 2WDRB 4PMWA 1X1MA 3NOBA 3W5VB 4A3FB 5CR3A 3TUOA 1C9OA 1B8AA 1KAAA 1F0ZA 4DGZA 4AYBB 1UZXB 3K5MA 3N1ZC 1HTQA 2KUMA 3AI5A 4A3EG 1X32A 2QW7A 1VQ7A 3U2SC 4KN4C 1IKLA 4X64L 4FO2A 2WDVB 1SEBD 4LF7Q 1TKEA 2EYOA 3W3AA 4EE2A 2CQAA 4JI0Q 1PTOC 2F0MA 2KN5A 2KX0A 4HDOA 2MFIA 1HZ9A 5ELCA 2ZJRA 1F77A 2DJGC 3QJYA 4RGNA 3QQ8B 4NPNA 5EE9A 1ENFA 5C0XJ 5I2XA 3GTLH 5T1GA 1HNZL 5CORA 3AV8A 3P4SB 1VMCA 3UE1A 3W5OA 3C0RB 5AZGA 2D3AA 3CPFA 1E8WA 2J42A 3ZDMC 4TQ1A 5JH5C 2IPKD 4HMJA 1KLGD 2TMPA 3A8IE 1IBLQ 2N1VA 3Q24A 2LSSA 4TQUS 5EAYA 2CJOA 2YTVA 1EY6A 3AEAB 3TP5A 3MAQA 3V6CB 2IZVB 4AOFA 2Z0EB 3QC8B 3MEFA 5K36G 4TMAB 4N8FA 4A3KG 1HUNA 1BMLC 3OHXC 3ZJTA 3L16A 3LWUA 1BQQT 3ER0A 4I6NB 1HXYD 4A55A 1BOSA 5BMIA 5LL6S 4A93B 2BPSA 4PS8A 3KF8B 1KDBA 1VDVA 1GG3A 2F52A 1S5ED 2MEKA 3PCOB 2EYFA 2KCNA 4LF6Q 2R93B 1K8MA 1LV9A 4KHPL 3J80E 3PO3G 2KWVB 3IHPC 3L3OC 4OZCA 2IY0B 1V1PA 1RKNA 1QNUA 2Z8LA 2ZT9C 5LMNQ 4A75A 4DWFA 5LMNW 4JI3L 5JHAA 2VZAA 4GKKL 1SMXA 1QWYA 4CJ2C 4HDQA 1T5EA 1VQGA 1CSQA 1DXMA 1KNEA 3WWVA 2UUCQ 2IYDB 1ICFB 3GTOB 2RPVA 3APCA 1O7YA 3TDQA 3QARA 1XEEA 3T3OA 4JI8Q 2WP9B 3LYYA 3OAWA 4NXNQ 1JE4A 2Q5WD 3NVZA 4F7ZA 4PS7A 4DUYQ 2F4IA 1II3A 2KCCA 2XK5A 1MG4A 1W6JA 2A6ED 2K05A 2QGQA 2GBMA 2ONQA 3DBSA 3BS1A 2W54A 4B3SQ 3AE4B 4XC2A 1C1YB 5L37A 4YHHL 2ZXPA 4K3CA 2XGTA 2L0FA 4JG2A 4RG1A 1LACA 1HR0Q 5M5YB 2KZRA 5I9PA 2X6GA 4M8MA
chains in the Genus database with same CATH topology
3GQBA 3MEHA 1LT5D 4MACA 5EPLA 3P42A 1K83B 3C2PA 2HDEA 3FILA 1E9MA 3KUPA 3GO5A 4HJGE 2L4NA 3DUZA 3OMGA 3D6CA 1CK1A 1N63A 4GDLB 3VA7A 4A3IB 4EVOA 1FNWA 2B2TA 1VMPA 2BE5C 2E2HB 2VNUD 1FD6A 4CQNA 3SXHA 4L1BA 3U9OA 1TS5A 4HEDA 4IUVA 1STBA 1G91A 4CGYB 3VR2A 2CJNA 2AQ3B 1LTRD 3GS2A 4KHVA 5G5HA 2EYJA 3VYUA 4F87A 1JWMD 2F0DA 1A70A 4CJ1B 1SNOA 3NTIA 3PIP3 1DOYA 3S1QB 2EXZA 5C4HA 2QSDA 3IXSA 3H0GB 2R92B 1B9NA 1RHPA 3VR5A 4FXGC 4PMCA 4PT5A 2WKCA 1PRTB 5DM63 1HFGA 2JXTA 1WVLA 3VR9B 2EY6A 1SYEA 4CHTB 1B1ZA 1OFFA 1ZXIA 5GXGB 1NENB 1ZYRD 1TQOA 1LTAD 3ZJUA 2GB1A 1C4AA 2V4IB 1JOQA 2BB5A 2WKDA 4ZKCB 3QOJA 3MTSA 5JEAG 1WXQA 2LY7A 2DLBA 5IOCA 2JX5A 5EE3A 4A8XC 2BB6A 2A68C 3G7LA 2E3TA 1MI0A 3F2UA 5DM73 3R2IA 1KRHA 1GJXA 5K5PA 4FF2A 2WU5B 4Z9CB 1TKYA 5ELDA 3P75A 3VR3A 4H2AA 1STAA 5BMGA 3P7JA 1STEA 2NN6I 3P4QB 1H9KA 3EQLC 3MHZA 2D62A 3PV0A 4DAYA 1Z7TA 3PUXA 3OSOA 4YSZB 2EE1A 5G3LD 5C4JB 3I8ZA 5BYRA 2N9KA 2I46A 4BBSB 2F0EA 4XQJA 2JWUA 4RGMA 4LAAA 1E6EB 3HVZA 1GB1A 1CM9A 3DEOA 2WINB 4KY5A 1PXUA 2E2DC 1WCMB 1WTXA 5C3XA 2LGIA 5EGTA 4WIPA 1P7FA 2NTSA 2Q8TA 3SK4A 4C3JB 4K2KA 5IGBA 4IUUA 1GUNA 4TKOB 1JICA 1UEAB 3C1EA 4DAPA 3HUIA 5C3JB 4WJWA 1C4PA 4HCEA 4PMBA 5EKLA 5C0XI 1JROA 1L4DB 2QMTA 1ZEQX 4LK1C 2JA6B 2ENBA 2Y5PA 5EE1A 1UUPA 1UWMA 1V1PB 3A54A 1PRTF 1GUSA 3SE0A 3NTHA 4XDXA 1D1KA 3HKZB 2EJGC 2HCCA 4R8NA 1U4RA 2IGDA 1U4PA 2IGHA 4XTCS 4OIKA 3M4OB 4WRDA 1SB3C 4XYOA 1LTSD 1IHZA 3J7AV 2XWJB 3IAYA 2NB0A 1A2UA 1EEID 1AWDA 1K50A 3HZXA 2JA5B 2NWGA 1ACCA 1RYJA 1ET6A 4XQQA 3E0JA 3J9CA 4JK1C 1CQVA 2J7ZA 2SEBD 3OW7A 3MWYW 4WAFA 5IIFA 5JXVA 4TRDA 3GTKB 1FM0D 3AE3B 2K01A 4DNRB 1EM7A 3BVMA 1F2LA 1N61A 4HEA1 5KGUA 3M4YA 4JWUC 1PLFA 1EY9A 3SHLA 3BWUD 2F0WA 2J4XA 2EKIA 4RA8A 4B0EA 1HFNA 2F0VA 4NKLA 5KRUA 2RMMA 4YT0B 1PFDA 4BS9A 2B2VC 2EYLA 5E3FA 1BCPC 1AZQA 4HKQA 1H9SB 5EJWA 2IX3A 5LNK1 3J80L 1PUTA 2IX0A 3OMCA 3MJ5A 1WTVA 1TWAB 4MN3A 5CV4A 2C5CA 3PUZA 1TS3A 2IW3A 1WSPA 1TVXA 1K51A 1PTOF 5IGEA 2B2WA 3GTQB 4DK1A 4IOIE 3B9JA 2E2JB 2KHSA 4RCNA 2WLBA 1TR5A 5M5WB 2JYEA 2G1EA 1Q1BA 2BCOA 2M2LA 5FLXE 5D7GA 3H3VC 3Q8EA 1M4VA 1EIHA 3NS1A 3GV6A 2BA1A 2PZWA 2MJ3A 2DWQA 5BN4A 3TP6A 3KWLA 1J7AA 2B2VA 4RWSC 2M0AA 3L4PA 3P63A 4US9A 1SNQA 5KNBA 2A5HA 1TT2A 4R3DA 3ONAB 1I4PA 1WWTA 3J7AF 3H09A 5EKIA 3DWGC 1B9RA 4N59A 3AB5A 3FVQA 3IT6B 2PQEA 2KDMA 3LX0A 3TEXA 4ITKA 3KBXA 3MVVA 1NYRA 1H9MA 4V190 4IUPA 3BDLA 3GTLB 2KJXA 1K52A 3I72A 4J6HA 2K0PA 1B3AA 2DY8A 2GI9A 4DU9A 3O13A 1PGBA 1NSNS 2EDGA 4A90A 4LMQD 2BOSA 4Q0FA 2IGGA 1LT3D 3TMEA 2WQYB 4ZRPA 2F0TA 1ZDVA 4B08A 1QE6A 2F0FA 1C9FA 4KV6A 1LABA 1DJRD 3BVGA 3NQTA 3D3RA 2WXRA 1ET9A 3BK2A 4J1MA 2F0JA 3OWFA 5MPOA 4N58A 1JQ4A 2OEDA 1WTQA 4H0LC 1FRRA 1SAPA 1S5CD 1FYCA 1H9JA 4U673 4FF3A 4HR7B 3T16A 4ZHOA 1OO9B 1IUEA 4OO1G 4P2CB 3PZ8A 2INNE 2O5IC 2H88B 2Y3AA 2B2UC 1RTOA 3QB3A 1EYDA 4OVZA 2F0IA 2K1BA 4WORA 3AMZA 1LO5D 5LHY1 1J8IA 2B2YC 2LMCB 4EGVA 1DGJA 3LXFA 3MFGA 3BK1A 1DOIA 2NN6G 1D1IA 1CA5A 3LB8C 2DY7A 4K14A 5C3EB 1IBXB 2JQRB 1I4HA 1EWCA 3V96A 2CW0D 4LLGM 3X3MA 1PRTC 3GD7A 3AM9A 2EJFC 3DWAA 5CBEE 3L9AX 2RDHA 4OZBA 5J39A 2A73B 5ELEA 3H94A 4OW0A 2B2YA 4JX1C 2B39A 3DWPA 3H8HA 4O42A 1F9PA 4ZOHC 3NUHB 3I4LA 2NVTB 1HUMA 3K5OA 2MH7A 4N9PA 1WD0A 1NAPA 5JJZA 4FNFA 2E6XA 3RFZB 5EQ0A 5C0XG 3PO2B 1SMYC 2BDOA 3AEGB 1R4QB 5ELBA 2EELA 2PIAA 2AQ1B 2RA4A 4HRSA 3TEWA 1CA6A 1HEZE 1D6EC 2R61A 1H9RA 1YQ3B 3PIO3 4KKIA 1SYDA 2L11A 2RDGA 2W82A 3D4WA 1JOOA 1VZ6A 1MGSA 5C3WA 3AU7A 1F9SA 5JVG3 5KIXA 5JVH3 4XT3B 1BR9A 1YJIA 3AE8B 3N9YC 3V2TA 1V8CA 3UI2A 3RUZA 1B4OA 1BNZA 1ROEA 3SFEB 2XNAC 2F3WA 1PZKD 5I6YA 4B0MA 2SDFA 3W9CB 1F2YA 1VZ8A 2MGSA 5G5GA 3IL8A 2HQEA 4OIJA 2NVXB 1FFUA 5E4XA 1JB3A 3URYA 3S14B 3B2FA 1XYIA 3AE7B 1FO4A 4PNYA 1AN8A 2L1AA 3P20A 5DEHA 4YIJA 4L2YA 3CIRB 2W55A 1VCIA 1O7ZA 1WTWA 5KYIA 3I4MB 3IFTA 4FVMA 3T13A 1JW9D 5H8YE 1RJTA 2IT1A 3QG1A 2WXJA 5C6AA 2XIWA 3VYTA 2DN8A 3HOYB 2K9XA 4RGOS 1I4GA 4EQOA 1OXUA 1VRAB 1NVID 2BW2A 3QWNA 1JORA 4IUQA 1O80A 1WTRA 1EY4A 1B9MA 1QCBD 1UAPA 4K6LA 4A3JB 3PZ7A 1DCZA 2F0OA 4A3MB 3ETRA 4H44C 1G2SA 4FP5D 1HHVA 4QMGA 4REZA 2JP1A 4R9WA 5KEEA 4KD3A 1STNA 4HMIA 4P16A 4LK0M 2D5GA 3WCQA 2XVSA 3R93A 1MD2D 1Q10A 5FLXL 3H91A 3B2GA 1DOXA 4ILWA 4RGTA 1JWAD 1P7EA 2HDMA 2PNRC 3RLFA 3GTMB 1OXVA 1WTOA 2XWBB 2PW9A 5KNDA 1FXIA 1SIJA 1EFID 4K6DA 3T3NA 1BUVT 2JA8B 2JXMB 1JALA 2AWNA 1OQQA 1EOTA 3K5LA 4C3HG 1IW7D 2SNSA 4KGSA 2CW0C 1EQVA 1LTID 1BCPF 4L8JA 4CBVA 3PUYA 5A35A 2WIIB 3D6WA 2PPBC 4DNTB 1NR2A 1NI3A 2EJMA 3VQIA 3JAME 3MHBA 1CZGA 4KKSA 3Q8FA 2SOBA 1ZXHA 3DM1A 1QKZA 5FR3A 1EEFD 3HRZC 1I6HB 3HOWB 2O2LD 4X3SA 1EY0A 2MJDA 5JOBA 3PO0A 3DXJC 1N5WA 4PV1C 3FRPB 2HCIA 5IGGA 4YWGG 2A69D 3EGRA 1JWBD 3A7LA 2PVGC 2RQXA 2VUMB 4XIGS 2MUYA 3D4DA 3U7ZA 5CC4A 4IFDJ 1VR9A 4J8QA 1CJEA 1GHKA 2K7VA 1GB4A 3VR8B 2FMCA 4GZYC 1FCLA 4ID6A 1Y8PB 1SXTA 3RD4A 2YU9B 1MVKA 3KWVA 4IFDH 5G3LF 3RZOB 4ZRQA 1EY7A 4FF1A 5BN5A 1QOHA 3IKJA 1C76A 4US8A 4I7ZC 2KA7A 3SK8A 1ZP0B 3C1FA 4ODGA 1ILQA 2NYZD 4ME5A 3S17B 1TWCB 2QEJC 3Q6SA 2IWHA 5CV6A 1QF6A 3GTGB 1MI2A 1Q8IA 1TY2A 4A3BB 4IUTA 2W3RA 1Q12A 2G9DA 2H1EA 1IGDA 2INPE 2PCFB 3CQZB 4XDDA 1XO3A 1BO0A 4ZKBB 2K3UA 4KD4A 2L52A 3CRLC 2EYHA 3IAM1 4KGRA 1K8OA 1TS4A 4KJNA 2JYOA 4BY7B 2F0UA 1EU3A 3UI3A 3AEFB 3J7YW 3NP8A 4XYQA 4IALA 4GDKB 4AQ7A 5BYSA 1XLQA 4QF4A 5CV7A 2K28A 1LTTD 3FKIB 2YEPB 5EBDA 2BS3B 3MXUA 1RWSA 1C77A 5EKKA 3L7ZC 3MXPA 4ARIA 1KDCA 2OXPA 1SJED 5TSSA 1F2ZA 1C4CA 1EY8A 1RM6C 1YNND 3CHBD 1SNCA 3R8BA 1DOKA 1L0XB 2AQ2B 3M85A 2PKOA 2EPBA 3HOZB 2GRIA 1FD7D 2V4DA 3FMCA 2A6EC 2LHDA 2EOTA 4EQNA 2F0KA 2LFNA 4N6EB 4DQOC 4XT1B 5CYUA 3E56A 2CU3A 2E74C 1HCZA 3HOVB 3E9SA 1UNSA 2E2IB 1BDOA 2WXMA 1IW7C 2J52A 2K5DA 4S3SA 5JEAH 2V0GA 3P1HA 4F8MA 4MM3B 3EA6A 3MXNA 5E1FA 3I90A 1TWHB 1JWSD 1M8AA 5HHDG 4KKJA 1LT6D 1GPXA 3BIID 1LTBD 4WURA 4C56C 1PZJD 1PZID 1ZKOA 5AFWA 1LT4D 4ARCA 1SDFA 3Q8CA 4FYDA 4XQNA 2EZVA 4C7YA 1T3QA 1XF5L 3AB9A 3Q8BA 3KLSX 1I4XA 1F9RA 3WOEA 5T8IA 4HSPA 4K8IA 1XCTL 2J0TD 2L32A 4F88A 2RKSA 1YNTE 4MH8A 1JR0D 4DF7A 1D5MC 2DYMA 4C3IB 1IGCA 3PUWA 2OF1A 1VZ7A 2F0NA 3FILB 1BUIC 2EYMA 4C1NI 3FPUB 1EIGA 4HAEA 2WXIA 2F0LA 1KDAA 2JA7B 2I2YA 1UWXA 1ESRA 4KJOA 2QKIC 3D8GA 4KKTA 2YEPF 1E10A 2WV6D 1ICWA 2EVBA 4ZK9B 2XRQD 2KECA 3NVVA 1LTGD 2WXGA 1PDQA 5HI1A 2F03A 1OXXK 3M3YB 4XWTA 1YQ4B 3TBIB 1VLBA 3SVMA 2L55A 2X38A 3MXGA 1J7BA 3NUCA 1C48A 4G57A 2A6HD 1ZYRC 3KLSA 4HTHA 4MHEA 2Z4HA 1GUOA 3I3CA 3NHHA 4QIWB 1JRPA 3FC4A 4D2KA 1Z6HA 2NZ1D 1CZWA 3MA2B 4IDIA 2N0SB 2NVYB 4ZUIA 5M3FB 3W2DA 3LWEA 4A3GB 3TP7A 5J22A 1R9TB 4C3JG 1QT9A 4UAIA 3IAS1 5LL6X 2VZKD 1XWEA 2NVQB 5A2QE 5D3DA 1J9OA 2WXKA 2KWDA 5HFYA 1ENCA 1BF4A 2G9HD 5IGDA 1X3QA 3FDTA 1ZDXA 1VF5C 2WXNA 4IFDI 4ZQ3A 3NZ3A 1HA6A 5BN3A 1JWUD 1B44D 2I38A 1JOKA 5EE0A 4JWSC 2YYZA 3AEDB 4NAWB 3ND8A 4NMZA 4BA2I 4X3TA 3JAML 2WS3B 1STHA 2ICIA 1V8QA 3S9WA 1EL0A 1MSHA 1HQRD 3FEWX 5HGTA 1DYQA 2R6GA 3HGBA 1AP0A 5EBCA 2QCPX 3R2TA 4HN7A 1ONLA 3E5SA 2EYPA 1IKMA 4Q5VA 1N60A 3W1SA 3NVWA 1OQRA 2PW7A 2BBCA 3NSWA 1MSGA 1L5PA 2BYTA 1PDXA 1QNKA 3KF8A 1ZXTA 1W6KA 1S5FD 1L0YB 2ZXRA 1BXTA 3EUB2 1PTOD 1ENAA 1EU4A 4YTNB 4J3OD 5ELFA 4LTUA 1PTOH 2KMMA 1XLPA 4OZAA 1HPCA 5JAVA 2K5WA 3VRBB 1AFPA 3J81E 4NP5A 3RMHA 2QDBA 4OGQC 2WXFA 4FXKC 4QUFA 1ZOYB 3BYTB 2K5QA 1FNUA 3G6JB 3AEEB 5KYLA 1A3TA 5D14A 3AE6B 1MPEA 1RD9D 2PZUA 1A3UA 2KN4A 3T53B 3U4EG 1DOLA 1SBBB 4A3EB 2WXHA 3QOLA 3P1MA 4V0BA 5BMHA 2JYTA 3SDZA 2LKVA 3NPPA 2F0HA 3MC0B 1GXDC 2PYKA 3VR4A 1V1OA 1SYFA 4H7BA 1XXGA 2NMQA 4NW2A 2BA0A 1VJKA 2VB3X 2MHVA 2K22A 1F9QA 2F0QA 4KTAA 1S5DD 4G7HC 3BG3A 1XX8A 4RHSA 3TZDA 4I65A 1I7HA 3U9SA 2MP1A 4ZLTF 1HQMC 3GTJB 4U68A 2B2UA 3TZUA 1TS2A 3Q22A 4M0WA 2KEDA 4A6QA 1BBXC 1EZ8A 2KEEA 5C5LA 1JC7A 3P4RB 3NQIA 1OXSC 4ZUJA 2B63B 3PO3B 1G6ZA 2L5TA 1HZ5A 2M56B 3VRAB 4B9XA 1I4QA 4XE0A 5H92C 2AUJD 2XN9C 2V3PA 2JSVX 2WXLA 2AUKA 2AWOA 3ND9A 1D2BA 2D5DA 2DYOA 1PMRA 4OO1H 1TU2B 1HA5A 2PO4A 4KY6A 1D5XC 3ERQA 2CVRA 3H6MA 2B8GA 3T4AC 2TSSA 1QJOA 3WOFA 3A8KE 1AZPA 1SF0A 3OIPA 2MPMA 3VYRA 1K53A 1Y8NB 2WU2B 4ZHPA 3HOUB 4DA2A 2NN6H 4EQPA 1IYUA 5CBAE 1SYGA 2K03A 3A8JE 2KAJA 1Q90A 4NDXA 1SNDA 5IODA 1YN5A 3A7AB 5IT9E 4XXEA 3HEJA 2K04A 4CKBA 1WTPA 3CKIB 3TSSA 3ZGZA 3VYSA 1FEHA 4ABNA 1GOZA 3AEBB 2OEOA 3Q8AA 1N5XA 2WB1B 2BT6A 1L6UA 3OOCA 5M5XB 2F1MA 5I9OA 2QJLA 3AN1A 2NTTA 2ON8A 5J1ZA 1RFKA 1ESFA 3W5UB 1T5XD 2RDFA 4ZAIA 2KACA 2O5JC 3PMFA 1N62A 1AEXA 1F2RI 1CHPD 4DN4M 4DXGA 3BVZA 1YMHE 3NTKA 4RHRA 2ZW1A 2A68D 3S1MB 3AE2B 5C0XH 3I57A 4RKBA 3I73A 4RH6A 2Q8IB 2WNMA 1F2MA 3AE9B 1VF7A 3HRDD 2X69A 3GV3A 1GUGA 1ZPSA 5AUKA 3MFYA 3SFDB 2KOLA 4IZ8A 2FUG1 3OPOA 4BWGB 1TY0A 2WACA 1SJHD 1Y69U 1T6BX 1DOMA 3KK7A 2PMVA 1HZ6A 4IQZA 2K6AA 3GB1A 4M1UB 1AYFA 1TZOA 1KNAA 1SSOA 1TKGA 2A74C 5A2QL 4L6TB 1QLBB 2L83A 3NRZA 1FR3A 1ZE3D 3AE1B 3K58A 2DNEA 4DK0A 3A55A 1PFBA 4IFDG 1FFVA 3T51B 3V05A 4MIUA 2IL8A 2WP8J 2B2TC 2BDNA 1AW7A 2N55A 2R3ZA 2L12A 4JBWA 5I6WA 5E4WC 2PVOD 4QUCA 1Y1WB 2M9VA 3DEPA 5K36H 4RKLA 5C2TB 2L0CA 1U4LA 3D31A 3E6ZX 5DNFA 1CQFA 2ID0A 4QB4A 4USAA 4RNAA 4NJCA 1SE2A 3NXWA 5IGCA 4IUNA 5FO7B 4XWWA 4KN7C 1ILPA 3LNNA 3OWEB 2SNMA 4K8JA 3Q0AA 2M19A 4DAVA 5M3MB 3HG9A 4KHZA 4DFAA 3C8YA 2JSOA 1H9SA 1PYWD 1YJJA 4QCLA 2IJ0A 2N9LA 2JEBI 2I07B 1RTNA 4RAUC 1E0ZA 5KNCA 2ACZB 2FFKB 5JPNC 4G4KA 3J81L 4K5XA 2JZPA 3C3LA 1YN3A 1J7CA 4X3KA 1G2TA 1Y8OB 2F3VA 1JQYD 5C5MA 2NBFA 3BDCA 2EY5A 1TYGB 1D4BA 3X3NA 4L63B 5ISRA 3I9V1 1A2TA 1CFMA 2RSNA 4HSVA 3P4PB 1TWGB 2IX1A 4XDCA 1BCPD 3M7GA 5C4XB 3OIQA 1B2TA 3K59A 4JE3B 3A56A 2LHEA 3S1RB 2K5PA 3HOXB 4OO1I 2VZKB 2Z4IA 3CRKC 5D65A 2WXPA 5COYA 1R4PB 1WYGA 3AECB 1NEKB 3K7AB 2E75C 1E7PB 2W3SA 2DBYA 4WWMA 5CGKA 1CI3M 1EWHA 1EYCA 2GA4B 3EROA 1SYCA 5CV9A 1X3PA 1FRDA 2F0GA 3S2HB 1HTLD 3KLRA 3ZJVA 2ICEC 2RBMA 2FE8A 3U52E 1FXAA 3MP9A 3CWIA 2K33A 1ZUD2 2FMMA 2V3NA 1EYAA 1Y56A 1A6XA 3ZQ4A 4YTMB 3AMUA 5F2DA 4YSXB 4B9WA 1XLOA 1CHQD 5I2YA 1E0BA 5D3IB 3FAHA 4TQ0A 4HROA 1QOBA 4YSYB 1KH0A 1GAQB 1L4ZB 2J53A 4RF0A 4Y7NB 1E2WA 1SNMA 5C44B 5JEAJ 4CKCA 3KBGA 2WAQB 3AE5B 1SYBA 3NWSA 1Q1EA 4C2MB 1G291 1C4QA 1JCKB 1PTOB 3I91A 2PLPA 3S15B 1MHHE 3FPPA 4HCSA 2FHTA 3WDNA 4N9TA 2JE6I 1RODA 4O1NA 1MHXA 4BY1B 2FBWB 1JMLA 2EY2A 5AUIA 1B50A 3TN2A 3EJIA 1WGKA 1O7LA 1RCVD 5IT9L 2LMCA 4E6IA 4KX6B 2LS01 3D4RA 4DXFA 1GUWA 2A69C 4RFBA 3K5NA 2BS4B 3MZ5A 2VXWA 3GTPB 4LJZC 3RPFC 1C8CA 5EPJA 1IBXA 1NYQA 1S4ZA 1KFYB 1V97A 1IYVA 4MT5A 4ZYSA 2L9HA 1EY5A 1IL8A 4A9AA 1DONA 3NE5B 3I4NB 1EZ6A 1PGAA 3AH7A 3SK5A 5FKAC 4KMUC 1SNPA 2ZXOA 4OL7A 2KVMA 1PFNA 1NR4A 2M00A 2B2WC 1I50B 4TSSA 2B8FA 4R8IA 4NZLB 4HKZE 1SSNA 2F0PA 2H4OA 1YNJD 5IGFA 2SAKA 3K6OA 3NVYA 5JPMC 3TEZA 1CT1D 1PFMA 1FGBD 2Q8RE 2N7JA 1PRTD 3DWQA 4KY7A 2FINB 1TJEA 3VA5A 4UDUC 4CJ0B 1GUTA 1KABA 2HUGA 2R7ZB 2BS2B 2Y0SB 5CMDA 4KI0A 2WXOA 2N88A 2O4XA 1A15A 1LLRD 5NUCA 3Q23A 1O78A 3KQ4A 1I3QB 1EWYC 2LFIA 1FCCC 1CZPA 2X6LA 1QOFA 2OHFA 1UGJA 1QQRA 4IKGA 1I6VC 2QILA 2E76C 1PGXA 3I70A 3HVDA 5CV8A 3NWTA 1YNNC 1SMYD 5FK9C 5FO8B 4CKEA 3SR1A 1C78A 3S16B 2PW5A 2Y5CA 3RZDB 3N52A 4RF1A 1STGA 2IDYA 3IT4B 3ITPA 2JEAI 3DWMA 3BYYB 2QIEB 1U4MA 3EFXD 2JU6X 2EY1A 1S5BD 4H13C 3IFDA 2L1BA 2F0SA 1FNVA 4KKUA 1A3VA 3N6RA 4C3IG 3K57A 3M7NA 1WD1A 4C7ZA 1KTKA 1VDZA 1E2ZA 5BYQA 1QILA 2XRSD 4FXCA 5FOBB 4A3DB 4BA1I 4BBRB 1XLNA 3NBHA 1OXTA 4K2LA 4PQXA 4P6VF 2HTME 3V3XA 3ZYYX 2PTLA 4WH4A 2BTEA 5T1IA 5C4ZA 1KLUD 1HTPA 4ULLA 2KQ4X 4IURA 4AS1A 4YXDB 4K5WA 2XSCA 5FO9B 4C1NK 1V43A 1C79A 1QG7A 4F7XA 2WXQA 4ZRZA 3DMUA 3HP3A 3S2DB 2B76B 4GLSC 2Z1CA 1RF2D 1FIQA 1XTCD 3CU7A 2KQ3A 2PMZB 3S1NB 4X3UA 1I4RA 3QIAA 2PZTA 2D2CC 2RVLA 4KGTA 3PUVA 4C80A 2QF7A 1DD2A 1E2VA 1U9RA 3SK6A 2AX5A 1QB5D 5HG2A 2DNCA 5M9OA 3SEBA 2LUMA 2RSOA 4FXDA 3QO2A 1EQTA 2VB2X 1SE3A 1MBYA 2C9OA 5E6JA 2LJIA 2WDQB 1DM0B 1DZ1A 4A3KB 1L0VB 2MJ8A 1Z47A 1B53A 5HURA 1RDPD 1YNJC 2A6HC 3TEYA 3NBIA 1XCQL 5EPKA 1Y1VB 4KK7A 2HDLA 4YTPB 3SR6A 2H89B 2ZW0A 2NUCA 2D9UA 4NAMA 1R7SA 3R3OA 3K0YA 3NK9A 1SE4A 1WRIA 1G8ZD 1STYA 1FMAD 1Q3LA 3T56B 4FF4A 4K5VA 1F2RC 4G7ZC 1GHJA 4OHJA 1QOAA 1NUCA 2BE5D 3TP8A 5I4DA 4RCOA 3HS0C 3C46A 4L23A 4M8AA 3BZDB 2LEKA 1CTMA 3DHQA 2CHBD 1SFOB 1ML0D 1TWFB 5CV5A 3Q69A 4C3HB 2MJEA 2FJ2A 3GP7A 5DAUA 1KF6B 1QOGA 4WQMA 4Q2JA 3ABVB 1L6VA 1D5ZC 3BDOA 1TKWB 3EVQA 4WFN3 4G7OC 3VR6A 2K32A 1TIID 1HRJA 2OT2A 1NCVA 4IN3A 1BCPB 1YN4A 2WDRB 4PMWA 3W5VB 4A3FB 5CR3A 3TUOA 1KAAA 1F0ZA 4DGZA 4AYBB 3K5MA 2KUMA 1X32A 3U2SC 4KN4C 1IKLA 4FO2A 2WDVB 1SEBD 1TKEA 2EYOA 3W3AA 4EE2A 2CQAA 1PTOC 2F0MA 5ELCA 1F77A 3QJYA 4RGNA 5EE9A 1ENFA 5C0XJ 5I2XA 5T1GA 5CORA 3AV8A 3P4SB 1VMCA 2J42A 4TQ1A 2IPKD 4HMJA 1KLGD 2TMPA 3A8IE 3Q24A 4TQUS 2CJOA 3AEAB 1EY6A <