3BYYB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
total genus 70
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3byyB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3byyB01
1RDPD 1BXTA 1DJRD 1AW7A 1JWSD 4RHSA 1PTOD 1EEID 1PZID 5D3DA 2RDHA 5TSSA 1V1PA 2XN9C 1D5MC 1CK1A 1LT4D 1HA5A 1JCKB 1RF2D 3DWPA 3EA6A 4C56C 1LT6D 1I4QA 5FK9C 1FNVA 1TS4A 1TY0A 4L63B 1EFID 1F77A 1ET9A 2AQ1B 5ELFA 1V1OA 1LTRD 3OWEB 1I4RA 1BCPC 4RGNA 1PZKD 1LTAD 1SJED 3GP7A 1I4XA 1I4PA 3BVGA 4RH6A 1ET6A 1FNUA 1XTCD 3W2DA 1LTBD 1LT3D 4O1NA 1HTLD 1PTOH 4RCOA 1SJHD 5ELEA 1EWCA 1DYQA 1LLRD 1RCVD 3R8BA 1EEFD 2WV6D 2CHBD 1LTGD 2XNAC 1JWUD 1FD7D 3BZDB 3TSSA 4RFBA 1D6EC 1EU3A 1QILA 1BCPF 1UUPA 1BCPB 1I4HA 2XRQD 1YN4A 2NTTA 1D5ZC 2O2LD 3BYYB 5ELCA 3DWQA 1FNWA 1KTKA 2AQ2B 3V05A 1SEBD 1G8ZD 1L0XB 1SE2A 1BCPD 3MC0B 1LTSD 1V1PB 4RGTA 1SE3A 1JR0D 1I4GA 1JQYD 1STEA 1LT5D 1SXTA 3O13A 2RDGA 1CHPD 3R2TA 5ELDA 4ZYSA 1CT1D 1LO5D 1CQVA 1JWMD 1S5BD 1L0YB 2AQ3B 1PZJD 1LTTD 2R61A 5I4DA 3BVMA 1T5XD 2G9HD 2NTSA 2TSSA 4RGOS 1PRTC 2Z8LA 2XRSD 1MD2D 1AN8A 1CHQD 5FKAC 5ELBA 1B1ZA 4RHRA 5D3IB 4K6LA 1TS5A 1YN3A 2QEJC 1LTID 1ESFA 4DXFA 4NZLB 2QILA 3BVZA 4L6TB 1SE4A 1KLUD 1TS2A 1PYWD 4BWGB 1EU4A 1S5DD 2IJ0A 1KLGD 3EFXD 1PTOC 1UNSA 3R2IA 1D5XC 1PRTF 1PRTB 2ICIA 4RGMA 1TY2A 4UDUC 1B44D 1S5CD 1RD9D 1PRTD 2IPKD 3CHBD 3MFGA 1HQRD 2SEBD 1HXYD 1SBBB 1GOZA 2J4XA 3SEBA 1M4VA 3KLSX 1ENFA 3DWAA 1YN5A 3BYTB 1TS3A 4TSSA 1XXGA 4Z9CB 1PTOF 1S5ED 1PTOB 1S5FD 4DXGA 1FGBD 4OHJA 3URYA
chains in the Genus database with same CATH superfamily
3RZDH 2VY3A 1MI0A 1G6JA 4KY7A 1YNJC 3VYRA 3RZOB 3CMAA 2R93G 4NZLB 3DWPA 2NVXH 2ATWA 1WCMB 3GTQH 2WXGA 4OELB 2JSOA 4FHJA 1RFKA 4JW0A 4XC2A 3MHZA 3P4RB 3HVZA 2KCNA 3ZTDA 1E7ZA 3OOCA 4TKNA 2I0QA 4IG7B 1R4PB 4EQNA 4ARIA 1K0SA 1EY7A 3T13A 5C0XI 2SNSA 2JA8G 2KKCA 2OOBB 2B2WC 3IT6B 3ZKJC 2BGFA 4B0EA 3TP5A 4IM3A 5GROA 3BZCA 2Q5WD 3AE7B 2XNAC 2HJ1A 3PGZA 4KGSA 4JPSA 3RNUA 1OFFA 5CMDA 4RFBA 2KVRA 1EIGA 1VCIA 1L2FA 3A55A 2PIAA 3I9V1 3GTGH 4N9F4 1D1KA 2D9UA 4H44C 5HGQA 1K8GA 2JWZA 3V96A 1X3QA 4GDKA 3ZW3A 2B3AA 1V8CA 2EYPA 2QJLA 1ICWA 3HGBA 2HD5B 4YWGG 3PIO3 1UE7A 3PO2H 3VFKA 2F0EA 5GAHC 4JI8L 5C3JB 2B76B 2G4SA 4C00A 4LF5L 3PLVA 5LL6S 3GV6A 2CU1A 2ALYB 3CSFA 3OIQA 4GNXC 1SIFA 2EYFA 3KJPA 1WWTA 4IWQA 4J15A 5JH5C 4K3BA 5DLQE 3A56A 5D3IB 1YOVB 2MJ3A 2GVAA 1D3ZA 5FR6A 4P73A 5C4ZA 1PH4A 4B6WA 1PFBA 3DBLB 2RSOA 1FXTB 4KKUA 1OXUA 4RCNA 1ESFA 3R93A 3KLSA 3ND9A 3I91A 4X6AH 4IWOA 4NAMA 1RIPA 1I42A 1P9DU 1RM6C 4X66L 5DAUA 1UWVA 3R2IA 1HZ6A 1TT5B 2B2VC 2XIWA 3Q22A 1AWDA 2UWQA 2ICIA 3TBIB 4BOZB 2PVGC 2HDMA 3HK0A 2B2TC 4APVA 4PK1A 1AFPA 4MGZE 2I2YA 3DLLA 3CCEA 3UIOB 3LDZE 1GB4A 2BDNA 2D62A 2IZVB 2PPBC 1JRUA 2BF8B 3TIXA 3E0EA 2KVZA 3LWUA 4IALA 1VQKA 1I3QB 3DM3A 1WTOA 1WJUA 4M0WB 1TS3A 3CD6A 1NSNS 4FN2A 1ZYRC 3NENA 4HJ9A 1C77A 3KJOA 1J19A 4C3IB 2MQJA 1CZWA 1ILQA 1QB5D 3S17H 3PREA 2UU9L 2UXBQ 4AIMA 5FLXL 2AWNA 4IOIE 3KDFA 3EA6A 4RMFA 2K5QA 2HCIA 1YJ1A 3U4ZA 2DAFA 3DVGX 3NPPA 3KUCB 2M00A 3N1XC 4MN3A 3CKIB 1TS4A 2B63B 1FIQA 4PYUA 2KJHB 1HA6A 1QNUA 1R4MI 2KLGA 2W82A 5G3LF 1A6XA 1ZP0B 2MJEA 1V1OA 1DXMA 3D8GA 3VH3B 2CKHB 2F0LA 3C2PA 3T3OA 1NE3A 1TKWB 2IHFA 3EIVA 1JT8A 5AUKA 4HR7B 4B9WA 2K28A 2INCC 5JHBA 1AYFA 2WAQG 2K5WA 1JB3A 1VQDA 4RCOA 1OEYA 1I50B 2PVOD 1F1HA 3DMUA 1TKYA 3K5LA 3BZDB 3MVVA 4HJAA 4FYDA 5E6NA 3RUIB 4HLEA 3QHTA 4XWTA 1NY4A 3VVWB 4DGZA 3F1ZA 4KLKA 5G5GA 4YL8A 2E8GA 3S9WA 2WXPA 1DGJA 3U8ZA 2A69C 1KRSA 4QAYA 1HHVA 3DWQA 4JX1C 3M63B 4R4CA 3Q3OC 1KDAA 3MXUA 5JVG3 4DV3Q 1VQEA 1XNRL 1L0VB 5K36H 4HEDA 5EAYA 3MC9A 4GDLB 1SE3A 1I4GA 4NP5A 3I55A 3WANA 1Z7TA 4MT5A 1K83H 3W5OA 3SHQA 3OTOQ 2WINB 1JJ2A 3DBSA 1WTPA 5LMUL 2C5CA 2R2OA 1E2VA 1L0YB 3GO5A 1PZJD 1HR0L 2AEHA 1MIUA 4HN7A 3BVMA 4M0WA 4P2CB 2VRRB 2VH1A 3HOUH 4A3GH 1WCMG 3UDIA 2MHJA 4OO1G 1CHQD 2EMTA 2PLPA 1HNXQ 3DCGA 4DPGA 1Q7YC 2WKDA 4AQ7A 4N9TA 5CHFA 1WMHB 4X3TA 3C19A 3S1RB 5AJ3L 4RWSC 1IW7C 1X55A 1K9MC 2VS1A 4JI0Q 1L1OB 3ZQ4A 2EY5A 2ZPNA 2VNUD 2H89B 1H95A 2NN6H 1QWYA 1KXLA 1C4PA 2HQEA 2WU5B 2ENBA 2BS2B 4NPSA 3MC8A 3EFXD 3RULA 1Q3LA 3QIAA 4W9DA 4WJ4A 5J17A 4TQUS 3U58A 3HZXA 1D5XC 2BW2A 3AMUA 3OG5A 4M8MA 4Q2JA 1NR4A 1L4DB 2UUAQ 4JI7L 1TZ1A 3HM3A 3M4YA 1UE1A 3OMCA 2VH2A 4GN1A 4GMVA 3ZO5B 1IBXB 3L08A 1SR3A 5LXHA 1JB7A 1RD9D 4CKEA 2ES2A 1MGSA 1NBWA 2HD3A 2Q8IB 5IGDA 1K50A 3AXCA 1AP0A 2BQQA 4DUYL 2JA6H 2BA1A 1ZOYB 5DPSA 5C3WA 3WOEA 4LNOA 3DWAA 1Q81C 2LFIA 3NZSA 3TUOA 2WYQA 1U4MA 4MTNA 3VDYA 2E6XA 2PW9A 5COYA 4C1NI 3HOVG 3PRMB 3CCLA 4BKGA 3FVQA 3OW7A 3NWTA 1W3SA 3SDLC 4DV4L 1V86A 4CJ1B 1E8YA 1W2BA 2RF4A 4DHZE 4M01A 4G0NB 4YTPB 2C7MB 1EEID 1QCBD 2RPQA 1L6VA 4A8XC 4LNQA 1HEZE 4KZCA 4GDLA 4C56C 4KSLC 1FCLA 3ZXRA 2VQFQ 5IA7A 1CSQA 5LMNW 1G291 4XQQA 3X23A 1GPXA 4ZUJA 2DBYA 1N32Q 2MW5A 3HHMA 2GVBA 1XWEA 2D10A 4LNNA 4KY6A 2K14A 3NUHB 4ICVA 4X65Q 3VR8B 1EYGA 4U673 4F8CB 1I4XA 2ASQA 3A4SC 3HOWH 1DOIA 2NWGA 3VYUA 2R7DA 4DV1L 3UI2A 3I4NH 2BA0A 1WGYA 4LW1A 1N8RC 3DHGC 4O1NA 1HTLD 3FEWX 1SJHD 2JJQA 4A76A 2F4VQ 3TS2A 4IJLA 1A63A 2ONQA 3KW5B 2K03A 1HCZA 1WMHA 3MA2B 3MAQA 4B9XA 4RM9A 2YU9B 4A93G 3L13A 4BA1I 2H4OA 2JZZA 1T9HA 2GB1A 1ICFB 5C4XG 3RNBC 3VTWA 3GV3A 3A8JE 4TQ0A 2QC8A 3V05A 2CS4A 1U4RA 1L0XB 4FLHA 4R4TA 1WFQA 4REZA 4YHHL 1V1PB 3F2DA 2L4NA 1TKGA 2FFKB 2JZ3B 3NZ3A 1BOSA 4A3LH 1J7BA 1EZ8A 4BBSH 1SXTA 1IYUA 1FEHA 2H1EA 3D32A 1QQRA 5E3FA 5JVH3 3AEVA 3BK1A 2JRHA 3UGBB 2L32A 2NPTB 2DY7A 2KX0A 1YBYA 2G9HD 1T0SC 1PRTC 2WFWA 3TP8A 3S16H 3AM9A 4DR6Q 2AWTA 2JUOA 3PO3B 2JU6X 1EO6A 3I57A 3U7ZA 5LL6X 4LK1C 1V81A 2WX1A 3LB8C 1EOTA 2WGSA 2XVSA 2EKEC 4GB9A 3NHHA 3BG3A 2ZXPA 3PZ8A 1SNPA 4CKBA 2JXXA 2OQ0A 2BT6A 3EROA 2B2TA 3MTSA 4BKTA 4B3ML 1T0RC 3ZVVA 1PA6A 3K0YA 1VQJA 4DK0A 3JAMc 4FF3A 1XLPA 3AN1A 1PFNA 4ME5A 2GBKA 4A3EG 3W5UB 1B7YB 1ZDXA 1W6KA 4MJSB 5IP7H 4HK2A 3AEEB 1CSPA 3PUWA 4GN5A 4IDIA 1JE5A 2WXIA 2BS3B 2CFMA 1GUOA 4K14A 1Y56A 2A4ZA 4H7BA 2K5NA 3HOXH 2JE6I 1XMOL 4JC0A 2J52A 3NTIA 3D31A 3B2GA 3Q8AA 3CHBD 2JWUA 1Y69U 2A6HD 1PDQA 4ACFA 4IJHA 2IO1B 2JK8A 4M8AA 3VHTC 4KV2A 3PO0A 1NR2A 3RD2A 3MJ5A 3J80L 3ML8A 3N1ZC 1FMAD 3FAHA 2R3ZA 4G7OC 2V1CC 1GJXA 1WGHA 1YX5B 1S5ED 3D4DA 4GZYC 2IX1A 1MI2A 4NW2A 4JPBW 2AYOB 1LM8B 3BK2A 3NVZA 1HTPA 3ULPA 1RFAA 2K04A 2FIDA 1V1PA 3H0GG 1M94A 2QF7A 3T16A 2Z4HA 5IGCA 1WR6E 3Q6BA 4JI1L 1Y1WH 3C8YA 4II3B 3Q6SA 1EFID 4JBJA 3QARA 1X56A 4EFOA 5BR8Q 2OTJA 4JBWA 4BY1G 2NPTA 1FM0D 1I3QH 2JEAI 3VQIA 4K2KA 2LJ5A 1CZGA 2MSED 4IUTA 3RLFA 1CKMA 3DWGC 1PH7A 4PT5A 2C5LC 4ZRKA 1WJNA 1V97A 1NAPA 3L0WB 4G50A 4GLSC 3AH7A 3L54A 2LVPA 1M90C 4JI4L 1EU3A 1Q8IA 1SMXA 2OHFA 3GTGB 4FA6A 3B6YA 4B3TQ 3TQYA 2MJDA 3K5MA 2K75A 2JYEA 4RNAA 4MJSA 5EE0A 4X3KA 2KMMA 2NVQB 1VS0A 3DEPA 2YTXA 1QJOA 1TJEA 1HZCA 5H1SE 2KXJA 5EKKA 1WTQA 2KANA 3L0OA 2NB0A 4PMCA 3PO2B 2DYMA 4KY5A 4XYOA 4XQNA 1STYA 2NVUI 1K8OA 2KO3A 4ZYNA 1EOVA 2NN6I 2KQ4X 3AFQA 1LYLA 5M3FG 4HJKA 2EE1A 2M17A 1QG7A 4DV2L 4A3JB 3AB9A 4LDTD 1D8LA 1KC8C 4GKKQ 4DXAB 1SSOA 4CDFC 1WM2A 3TP7A 4IPDA 2LI5A 3RFZB 4DK1A 1MSGA 4GN4B 4OGQC 4F88A 5BYRA 4R9WA 3EUB2 2WQYB 2RCNA 4OVUA 2JX5A 4JYAL 4UPAA 2E2IH 3V60A 3ERQA 5C0XH 4CKCA 2QEJC 1F0ZA 1TIFA 3Q3JA 1WYDA 2ZNVB 2H5XA 3ONSA 4KGTA 4NPNA 1Q46A 1BUVT 1FRRA 4DV6L 1VF7A 1WD0A 3P4SB 1IYVA 1HQMC 1VDVA 1FPYA 2PJHA 4HPPA 1EY4A 2E5LQ 2HDEA 1M1KC 1PRTB 2B2YC 4WAAA 5FO8B 3T1YL 3AB5A 5C5LA 2DJGC 4B3SL 5HI1A 4BKSA 3GTKH 2A1AA 5JPNC 1L0WA 4UP8A 1TVXA 3HKZG 4K6DA 1LABA 4C3HG 4JV5Q 1HXYD 5I2XA 4JQWC 1MBYA 2IL8A 2UUCQ 3AE8B 3S1RH 2KWVB 2N9KA 3SFEB 2VZKD 4HCPB 1STNA 2R92H 4HCSA 1PGXA 4WJPA 3D6WA 4WJQA 1D4BA 4US9A 4B95A 4LNIA 2Z0EB 3W1BA 4BBRH 4A3DH 1TKEA 3S17B 3Q8EA 2BTEA 1IL2A 4DR4L 1FD6A 1SNQA 4ZDVA 3VA5A 4XIGS 3V62A 3F8TA 1HUNA 4LFBQ 1J0GA 1D5MC 1IBLQ 4NB3A 1A2UA 1N36L 2Y0SG 2MFIA 3WAPA 3MHSD 5L37A 2EXDA 2KDMA 5LLIA 2F3IA 4WQOB 3NSWA 3ZRCA 1IYJB 1F9QA 1ML0D 4KZ0A 1PZKD 1AZQA 3KLRA 3ZUNA 4E71A 3TEYA 5CV8A 3RUZA 1H4RA 2WXKA 2DJFC 1SFOH 1IYFA 3NE5B 2KD0A 1ET6A 3AEFB 3Q14C 1YITA 2D0PA 1DOLA 1UD7A 4LFCQ 1XD3B 1K53A 3VUYA 1KDBA 2EIFA 1XT9B 5FLMH 2NMQA 3HVDA 4G4KA 4IUNA 1LTLA 2HIXA 1PFMA 2NVYB 2N8NA 2X69A 4YY3L 2M56B 4A4IA 4J3OD 3PT2B 1D6EC 3T1HQ 3VYTA 3Q8CA 1C4CA 1A70A 5J18A 4GLAC 5LHY1 4WRDA 1TZOA 1UH6A 2M19A 2K8BA 4NJ6A 3FP9A 2BDOA 1JJCB 3MC0B 2LS01 1F9PA 3ICEA 3L3OC 4RGTA 3HIZA 3JYUA 3RNFC 2F3VA 5HGTA 2OEDA 1MSHA 4I7AA 1N34Q 1ISNA 3NZUA 1CHPD 1T3QA 2DNFA 4NJCA 1Y1VG 1HZ5A 4LJZC 2AQ3B 1DGSA 2KVMA 2N78A 3Q2AC 2MO0A 3NELA 2WB1E 1V5OA 2B39A 2ZVNA 4AS1A 3HOUB 1STGA 1A62A 4DV5Q 3CXCA 1V5TA 1FR3A 4HSVA 4A3FB 4JI2L 1F2LA 1TT2A 3ENEA 3GTOH 3SR1A 4ZLTF 1OEYJ 2IT1A 1V43A 2JA7H 1LGRA 2JPHA 2N7DA 3N1YC 3MTNB 1LTID 1L2NA 3I63C 3WALA 2UYZB 3HRZC 1RODA 1QLBB 4CDEC 1TTNA 3E3XA 3DBHI 2G45B 2IX3A 4DR5Q 2BYTA 5E6JA 2V3SA 2L1AA 1J7CA 5K5PA 1R7SA 1C4QA 3EHVA 3UF8A 4Q0FA 1I94L 3HKSA 5EKIA 2MO1A 4HJGE 3U7DA 4L8JA 4GLXA 3VTUA 4HMIA 1KOTA 2GA4B 1DOMA 5CV7A 1VQIA 1GOZA 5FLXE 2JA6B 1DOXA 2IWHA 3GTLB 3T53B 4DR2Q 1YHQA 3N3KB 3NTKA 3CPFA 3NWSA 4JI3Q 4LF7L 2LMCB 2KN5A 2Q2HA 3PO2G 1HTQA 1EM7A 1BR9A 2E74C 1X1MA 1GO3E 1ESRA 2WXLA 2NBUA 2IBIB 5KHOA 1NYQA 3URYA 1S40A 4KJNA 4NDXA 3T4AC 1YJJA 1HNWQ 2MHVA 3LNNA 4K8IA 4XTCS 5IGGA 1SMYD 5JZEB 5IGFA 4IFDI 2DLBA 3K0XA 1S1QB 3HUIA 4YSZB 3SK5A 4ZAIA 1F9JA 1JOQA 1WX8A 3O65B 5HHDG 1FRDA 4PS7A 4E74A 4LF8Q 4BOSC 1DOKA 1XNQQ 3IHPC 2Q2TA 3RN2A 2BYEA 1KNAA 5HURA 2AL6A 4YSYB 4EE2A 3ONAB 1XPOA 2OTLA 3HOYH 1E0ZA 5G3LD 3HOWB 1JROA 3I4NB 2NS5A 4KN4C 2JZPA 2WDVB 3R7RA 5D7GA 3QX1A 3Q3MC 3KLWA 4W9KA 4FULA 1IHZA 1RCVD 2VB3X 1EWIA 2WV6D 4S0RA 4IPHA 1N61A 3V2TA 1K52A 1KABA 2RSNA 4TMAB 2XK5B 2UXCQ 1I5FA 3TSSA 4S17A 1U4PA 3S2HB 1G2TA 4DN4M 3P7JA 1UBQA 5AZGA 4D2KA 2EDGA 2M1MA 1EQRA 2C9OA 2NTTA 1QUQB 2LXKA 2JQRB 2E3TA 3IAS1 4WWMA 4KMUC 4YSXB 2MGSA 1C48A 5GAEC 4OX9Q 3VR5A 2L05A 2EY1A 2PE9A 2SAKA 3IKJA 1VQ5A 4URKA 4BBSB 4ANWA 4IUPA 4DF7A 2F0UA 1NI3A 4QUCA 3I4MH 1CUKA 3ABVB 1G91A 3D4RA 3A74A 5EJWA 1WYGA 1G2SA 1LTTD 4MIUA 1U5KA 3H6MA 4GXBA 1O80A 4IM0A 5CYUA 4ZRJA 4EX5A 1XMQL 2RA4A 3JVZX 3RMHA 2F0SA 2LMCA 4A9AA 2RQXA 3S16B 1WR1A 4DAPA 2LFNA 5LMNQ 2KCCA 5ELBA 1ZGUB 3SE0A 2CQAA 1F2MA 1YX6B 4XE0A 2QHOA 2NVQH 3S1NH 2WXMA 4LTUA 1FL0A 1BKBA 3KDFB 3PRZA 3GD7A 3AQQA 3E6ZX 3K8AA 2XWBB 2AWOA 4QJFA 1EUJA 3E9IA 5CC4A 2EVBA 2K1BA 1EU4A 3ZIMA 4DV7Q 3R66C 4CHTB 2N9XA 4LJOB 1HJPA 1PRTF 3C0RB 3U30A 3VUWA 4LNKA 2WKCA 1TWGB 3HOXB 4XQJA 5CV4A 4O42A 4A3JH 4R3DA 4ZHOA 1B9RA 1ZPSA 2K1FA 2ICEC 5JJZA 1K0RA 4MM3A 3T56B 2R7ZG 3MFGA 2KA7A 4FXGC 1PFDA 2RBMA 4Y7NH 2I46A 2XEWA 2A8VA 1LQBA 5EPLA 2OT2A 5J39A 4C1NK 2XK5A 2VUMH 1QOGA 1GKHA 4R4OA 3P20A 3C1EA 4MZ9A 1XLNA 5CX3A 1J7AA 1JORA 1ENAA 4TSSA 2JY6A 2AX5A 3DBHB 2JEBI 4Z9CB 1IZ6A 1FGBD 1EZ6A 4NMZA 2IO0B 2UXBL 1QUQA 1XLQA 1V80A 3F2CA 1JICA 3DWMA 1CJEA 3VR2A 5IOCA 5D3DA 1GG3A 2RDHA 5TSSA 4JWUC 4ANXA 4DHZB 1LT4D 4F7XA 1BO0A 2FNJB 4LFAQ 4USAA 1Y1WB 1SIJA 4GS3A 3VYSA 4A3GG 3IAM1 1D7QA 1B4OA 4B3RL 1P7FA 3AU5A 5FO7B 1EQVA 5CHVC 4RGNA 3S15H 4TRDA 1HZ9A 2EYMA 2E2HH 4GOPC 3GOEA 4DNTB 4W9JA 4R4QA 2N7EA 3M4OH 1X9NA 2D07B 3EFCA 3NJTA 3J7YW 5EPKA 2FAZA 4KKSA 2NN6G 3G71A 1RTNA 1KIXA 2I1JA 2R93H 2O6VB 3J7AF 2ZT9C 2INDC 1IGCA 1VMPA 2FMCA 1E6EB 3WOFA 2QCPX 2QA4A 1VQCA 1YJIA 2WHIA 1X3GA 4CDCC 2IY0B 5GXGB 1I4HA 2E76C 4KHVA 3PV0A 1YN4A 3GTMH 4ITKA 5JHAA 3HRDD 1YNXA 4FXDA 2O2LD 1D5ZC 2PW5A 1ZUD2 1TGZB 5ELCA 3ZNID 1FNWA 2WIIB 3Q8BA 4NNJB 2KN4A 4JL9A 1NENB 3NS1A 4DV3L 2J0KA 2JA6G 3PF4A 2RGFA 2V3NA 3BWUD 5JXVA 1UELA 2B8FA 3LXFA 3O13A 2RDGA 3R2TA 3OTOL 1IBML 2WXRA 4LJPB 3S1QH 4FO2A 2ZJRA 4BZAA 2LZ6A 1Q0WB 3EGRA 3H09A 3TS0A 1QOFA 2ASBA 4ZKBB 1GD7A 2J0TD 2ZW0A 3GTJH 3G6EA 2NVYH 4ZHPA 2CH4A 3NOBA 5A35A 3R7QA 1TBEA 4HVBA 1A5RA 4DAVA 4ZQ3A 4MDKE 5D2MB 3KBXA 2ZM6L 4KI0A 3K81C 2IGGA 3H3VI 4EZLA 5FJ8H 1KRTA 1VQ9A 3H3VC 2I38A 5ELNA 1TS5A 1K3BC 3I90A 1GUTA 1VQ7A 2PMZB 2Z1CA 2E2IB 4JI0L 5CV5A 5BN5A 2W55A 3BINA 4BVUC 1K8MA 3KYDD 1WE6A 2WS3B 3IBEA 3CC4A 1G51A 1VF5C 3U9SA 5DCNA 4NY0A 1GUWA 2K5PA 2LXCA 3J80E 3D4WA 4YWKA 3N32A 3ER0A 2KFKB 4YCUA 1WGDA 5AFWA 2LJIA 4BBNC 2ZJDA 3GTKB 2O2VB 3KFUA 2K3UA 4AJYB 4RKLA 4HJ8A 4KK7A 1L5PA 1WY8A 4ANUA 4LMQD 3I70A 3H1UA 4DNRB 4A3FH 2O6VA 3QG1A 5GADC 4A3CH 1S72A 1R4NI 4TKOB 1PH2A 3PSIA 3BYTB 5JEAH 1YD8U 4IO9A 1WJ4A 3AE9B 1PH1A 3OIPA 2N55A 2R92B 1RAXA 1XXGA 4JWSC 3VDZA 1P8LA 3M9BA 4OHJA 1NI2A 4N9PA 1YZ6A 2FHTA 1V1QA 1W6JA 3U9OA 4BBRB 3UIPB 4A3DB 1BXTA 5C3EH 4GNXB 2OF1A 1PH6A 3TBLD 1CMXB 2IDYA 4F8MA 5M5XH 1QVFA 1Q1OA 1JCKB 2BE5D 2VQFL 3SK6A 4R4IA 2FUG1 3X0WA 2NZ1D 3M7GA 5IOIA 1OXSC 2K5VA 2K50A 1RWSA 2KCTA 1N32L 1KQSA 5ELFA 2YTVA 1LTRD 1TU2B 4KTAA 4DNIA 1WXAA 1BCPC 3B0AA 4X65L 2Z59B 1ROEA 2KJ6A 1UGJA 2L55A 4OVVA 3GTLH 4H13C 1PXUA 1SFOB 1HRJA 2K6QA 1FNUA 3UDXA 1GXDC 2KECA 2Z6KC 1KL9A 2Q2UA 4XX5A 2LHEA 5EBDA 3CCSA 4JI5Q 4Q5VA 5DPRA 1IL8A 2PQAB 3DXJC 2F4VL 2OXPA 5LXIB 2A68D 2QW7A 1C9FA 5EGTA 4DUZQ 1EEFD 2ZTEA 3NG0A 4X64Q 3SGIA 2VQEQ 1HE8A 2DAJA 1G6ZA 1ASYA 2B2WA 3NEMA 1YNJD 5AZHA 1QOHA 2F0JA 4ZRQA 4MH8A 3S2DH 3BDCA 4JVZA 4C3JH 2WP8J 1YNND 3FMCA 4KHPQ 2LSSA 1WIAA 3IRBA 1E3PA 4GOPB 3ITPA 1PVOA 1VQNA 1MG4A 1C3TA 3PIPA 5AJ3Q 1G8ZD 1XCQL 3J80i 3A54A 4YTNB 3TCAA 1J8IA 2KFKA 1IXRA 4A3MB 2HDLA 3VXWA 2XBBC 2K4KA 2O2VA 4P75A 1E7UA 5HG2A 4QF4A 3DVGY 3SU8X 4NXMQ 3V6CB 4N59A 4X3UA 3A4RA 5H92C 2B8GA 5NUCA 2UUBQ 5M3MB 5JJKA 2GRIA 3UINB 2K9XA 4DV0Q 2GBMA 3GTPH 1X3FA 2IX0A 4EGVA 1T5XD 5AZFA 3KF6B 1A15A 3Q3NC 3KQ4A 4DR6L 3S2HH 1R4MB 2XRSD 3BDOA 3K7UC 2L52A 2D2CC 4HIMA 1Y1WG 2MH7A 4LWCA 2JSVX 1UGMA 4XT3B 3D0FA 5I6WA 1JALA 4DUYQ 4GNXA 2NBWB 3GTOB 1PV4A 3M95A 3I7FA 4DDID 3A7LA 2QCZA 4ICUA 3J81E 4J8QA 2HHHL 2JA7B 1C9OA 2KDFB 4EZJA 2M8SA 1S4ZA 1TIID 4C2MB 2I07B 2WDRB 2PW7A 3ERSX 2MA9B 2B3GA 2ZEQA 4BY7B 3JC66 2LRUA 1WI5A 2NUCA 4C3IG 4IOCA 1O7LA 4HEA1 4FF2A 1KLVA 1T5EA 3CCQA 1PTOC 1YIJA 1ASZA 2RPVA 4X3SA 2ZTDA 1EQTA 1E2WA 3N52A 5IP9G 1HH2P 2OJRA 2PQAA 3BIID 4RF1A 3ZGZA 1HQRD 4WJNA 1Q12A 1JWAD 4OZBA 1OQRA 2B2VA 3CCVA 2B63G 4PV1C 2PMZE 2E2JH 5GAGC 3TZUA 4LF4L 1UWXA 4QIWB 1MFWA 4IW0A 5HY6A 3GQBA 1QZEA 4K7SA 4I6PA 4W9CA 4AYBB 4LUVA 1WXSA 1H8CA 3M3YH 2LWPA 4GOPA 2J7QB 2INPE 2KDEB 5IAAC 3ZNGC 1GB1A 4RHSA 1HFGA 5IO9A 1J6QA 1EY9A 4EQ5A 4K7WA 1PZID 3FDTA 1TWGH 3CIRB 5FK9C 1E10A 3H9DA 4Y52H 1GAQB 2AKWB 4BXXH 1R4NB 2CJNA 2B2UC 3HEJA 2RR9A 3L4PA 3HOYB 3HOVH 3CCRA 1IUEA 4J6IA 4RH6A 3KF6A 3W2DA 2IO2B 5C0XG 2LGYA 4K0KQ 1STHA 1PQSA 3TEXA 1Z9FA 5IGBA 4OIKA 5CBAE 1ZW7A 2BYFA 1Y14B 3QA8A 1EWCA 2EYLA 1WTHA 2BH8A 4QB4A 3MZ5A 5E1FA 1SSNA 4YXDB 4S3SA 4I6NB 2V0GA 4MHEA 4FJVB 4F7ZA 3J81i 2NBVB 4KHZA 3AMZA 2EYOA 2FUHB 4DAYB 4B3TL 4ZRIA 1BCPB 1EIFA 3IXSA 3PHWB 2F0NA 4BA2I 1R9TH 3GB1A 4IUUA 5C44B 1V6EA 4AH6A 4DK5A 3NQIA 4DR3Q 2EY2A 1Y8RC 3PCOB 5E7NA 1E22A 5IYDH 2SOBA 2KAJA 3MJWA 1YMHE 3U52E 2NVTH 1BDOA 1JR0D 1TWAH 4A3PA 4V0BA 2N49A 4BS9A 1JW9D 3SFDB 3VRAB 4YCVA 3FC4A 4POGA 5I9OA 4ULLA 2KJRA 3I4MB 4LLGM 2F1MA 3A9KB 4TV3A 3QOJA 1PLFA 1QZHA 2KCMA 2E2DC 2J53A 4K5WA 4BBRG 3PZ7A 2EZVA 3E5SA 4A3KH 4IFDH 1TQOA 2RHSB 2VB2X 3EJIA 1PFSA 1XMOQ 1FJGL 3K6OA 1GUGA 3DQVA 4GKKL 4K8JA 5C4XH 2WB1B 3N20C 4N6EB 4WAFA 3OWFA 2JRIB 2GN5A 4HROA 3EN2A 3W5VB 1E0BA 2I5MX 2YV5A 5KYIA 4OXPA 1XYIA 3NVWA 4KJOA 3S1NB 2DYOA 2K7VA 3AYHB 2KHJA 5CORA 1XX8A 1GUNA 2A74C 3STBD 2W3RA 2Z0DB 4KIKB 4DXFA 3IT4B 2GOWA 4EOYA 1LM0A 2BOSA 4DHJB 1J8CA 4L6TB 5BN4A 2KNBA 3FKIH 2OQKA 3KYCD 2L12A 2E5LL 2C7NB 2KLCA 4B08A 3BU2A 5FLMG 1VQ6A 1SE9A 4RA8A 4MGKE 2CVRA 1F2ZA 3SR6A 2ID0A 2OWOA 5L95C 4F87A 1IBKQ 1WSPA 1H9KA 2PEAA 1SYEA 3H6NA 1D1IA 4P72A 4JI1Q 1RJTA 3MEHA 3UE0A 1S5CD 4X62Q 3UI3A 1X3EA 4CYEA 1LACA 4JV5L 3A0JA 3AE1B 2FCSA 1SYDA 4WWOA 3VTVA 2A6ED 5J3BA 2EJGC 4Y7NB 2ZJPA 2UUCL 2FE8A 3NUCA 5C5MA 3SEBA 4AUQC 1EF1A 4A6QA 2VUMB 2SNMA 3RNAC 4NJ7A 3NXWA 4DFAA 4CJ2C 2KC1A 4A3EH 4DAYA 3H91A 2WU2B 5IYBH 5IODA 1B2TA 1PTOB 3AI5A 2L76A 3QWZB 4HMJA 5A2QL 1MG8A 1WFYA 1YIWA 2PPHA 2G3QB 2C9WB 1AW7A 1MJCA 2N9LA 3QB3A 3WWVA 4G57A 1HR0W 3HKZE 2PZTA 4LFBL 2MBQA 2XN9C 1YJNA 1RF2D 2AUKA 4HJ5A 2HQLA 5IE8A 3J81L 2VW9A 1I4QA 1HNZL 1C1YB 5BYSA 4LF6L 1WXVA 5TR5A 4L63B 4J1MA 3NS8A 2UXDQ 5FR3A 1IKLA 2HT1A 3A9KA 2EXZA 4LNFA 5E6PA 1UF0A 2RDFA 5J22A 5CBEE 3S15B 2WXOA 1LTAD 1WRDB 2E2HB 4QIWE 2YEPB 2KOXA 1XTCD 2XWJB 4X57B 3NQTA 4LFCL 2L0FA 3M4OB 1NEKB 3PLUA 3SD5A 3NTHA 4AYBE 1A8VA 1SNDA 2GBJA 3RZFA 3L7ZC 1M8AA 4BKSD 2V9HA 3H0GH 2R93B 1TXYA 1AH9A 4JIOU 3KBGA 3V3XA 3TZDA 2LVOA 3OMGA 5MPOA 1CFMA 4KIKA 2DWQA 5C3XA 3P42A 3T1HL 4H0LC 1VD2A 2DZJA 1PH3A 2F0FA 3Q8FA 5I6YA 4BY1H 3GTMB 1XQQA 5E6OA 5FLXc 3PO3G 4AQYQ 3VR9B 1GNUA 2ZJQA 1QF6A 4ME3A 2JA8B 4C4VB 1LTSD 2JXMB 4I7ZC 2F0PA 5I9PA 4DR1Q 3CAMA 1UBIA 4G11A 1NJIC 3D6CA 3I3CA 2MBEA 5KEEA 1N34L 4KDIC 2LASA 3PTFC 2ON8A 3PS6A 4NQKE 1SB3C 3DEOA 2JA5H 3S1QB 1WD1A 2WACA 3DVNU 3A8KE 2ZPYA 5BMHA 5IIFA 1IKMA 4L2YA 4ABNA 1HUMA 3J81j 3L16A 1MHHE 3GTJB 3L17A 4OZAA 1Z47A 2I1KA 3ETRA 4P74A 2CCZA 3K7AH 4LUOA 3TEHB 1N60A 2O5IC 4NXNQ 1AN8A 4OO1I 4DV5L 3OJ4B 3RMKC 1KAAA 1X32A 2K32A 2LY7A 1EY6A 4RHRA 2INNE 5C1ZA 3DHIC 3RLOA 4PS3A 4MTKA 3QQ8B 3AEDB 2F0KA 3DPDA 1STAA 4A3MH 4R1JA 4CJ0B 4A90A 3HOYG 1GC7A 1UE5A 1CI3M 4KV6A 5FOBB 2JT4B 4UP9A 5M3FH 2LD9A 4RF0A 2K33A 1ZKOA 4DR5L 3ND8A 4N8X1 3HG9A 3MXNB 5M3MH 4HCNB 2K05A 3OPOA 3J7ZC 2RMMA 3WA0A 1YHAA 1H9RA 1ZXTA 4KDLB 4EUTA 2BKRB 2K5HA 4PZ7A 4XDCA 1VQAA 1J5EQ 1N33L 1ONLA 4EQOA 1EIHA 1PRTD 3PSEB 1SLJA 3MP9A 3K9PB 5IT9E 3IFWB 4GOCA 4OL7A 4PMBA 4A75A 1C78A 1VCBA 2LHDA 3AE5B 3AU4A 1HZAA 1YN5A 2M2LA 4JI3L 2FCNA 5IGEA 3NK9A 1H9SB 4C2MH 1PGAA 2F52A 3U2SC 1S5FD 2B2UA 5BO4B 4BY7H 3EC8A 1TWFB 5HFYA 1HNWL 2LKVA 1DZ1A 5D65A 5C3EB 1JWSD 1TYGB 4BBNF 2WXJA 3S1MB 2N88A 3J7A5 4C4VA 2KENA 5M5XB 3GS2A 1EYDA 1K8AC 1LT6D 3H3VH 2M4NA 4FHKA 4YCWA 1N6ZA 2WX0A 1TY0A 4LF8L 3X3NA 5IWAQ 3CCMA 2RCFA 1YJWA 1XNQL 4A3BH 3OWEB 2LGXA 2MBBB 1JRPA 2WXHA 4HDOA 1GHJA 4HIOA 4LF9Q 2L11A 1N63A 5JPMC 2B29A 1SF0A 4DDGD 1UE6A 3G6JB 2MJ8A 3AECB 2CU3A 3V61A 1LTBD 1LT3D 4LAAA 1V49A 3RLNA 5IYCH 3PIP3 5JJIA 5M5WH 2LUEA 1V2YA 3DHHC 1SGHA 4OIJA 2ZCCA 1LLRD 3QCAA 4JE3B 2KWUB 5C6AA 1O7ZA 5J2RA 4K3CA 2UXCL 2KZRA 1OGWA 3CRLC 1B50A 1WRIA 3RD4A 1QILA 2OEOA 3DM1A 1ZDVA 3C3LA 4A3JG 1WTWA 3S2DB 1P0RA 1RL2A 1VZ7A 1BCPF 4C3JB 3JAML 1ZXIA 1IPGA 4JG2A 3BYYB 5ISRA 3IL8A 3MXNA 4GKJQ 5EKLA 1SEBD 4OX9L 1DOYA 4E3CA 1E5WA 2DZKA 2CWPA 5D14A 3RNCC 4L1BA 2WAQB 3I4LA 1LV9A 3OJ3A 4MSQB 1VZ6A 2LUMA 1WZ0A 5G2NA 2F0DA 4MM3B 1MJDA 1LO5D 2VXWA 4A55A 1A0IA 4XT1B 1CKOA 2GMIC 5G55A 2KFJA 2L3ZA 3N6RA 2L8JA 4PYZA 2BE5C 1N5XA 2VL6A 4XXEA 1WGRA 3GTPB 5BN3A 2PNHA 3ZNZB 4RGOS 1WJJA 2NTSA 1YQ3B 4WQMA 3N30A 1H9SA 1I94Q 1WJ6A 3OW2A 1MD2D 4FJZA 5LMNL 4K81A 2DHZA 4KKTA 1TWHH 2F0HA 4PG3A 1B1ZA 3A8IE 2KACA 3M4QA 3P63A 5C44H 2R2QA 1V9PA 3KVFB 1GM5A 3NRZA 4JBKA 4IOAA 4HIKA 3R3MA 4ZOHC 4K2LA 4DR7Q 2UU7A 4WJWA 4A3IH 1DD2A 3FHWA 4LF7Q 2X8XX 1NNXA 2QILA 4R8IA 1DONA 2A68C 2CWAA 2D0OA 1C79A 3PVLA 5DM63 1KLUD 5C0XJ 1T6BX 2PMVA 4JI6Q 3P75A 3ZJYC 3Q23A 2JP1A 4DV7L 1S5DD 2IJ0A 3MEFA 2KMAA 4II2B 4KX6B 1YQBA 3UQAA 4G7ZC 1HFNA 4B0MA 3T3NA 2CH4W 3BY4B 4UDUC 4JOIC 1WTVA 2WDQB 1YNNC 1AZPA 3S14H 2K6AA 1B44D 3IAYA 5DPTA 3T51B 4M1UB 4A3OA 1S3SG 2W9NA 1RYJA 4IC7B 1QVCA 2B2YA 3TEWA 3QJYA 3PUYA 1B8AA 2DN8A 2J4XA 4QCLA 4P6VF 4KD4A 2MBOA 3RT3B 2E2JB 3C1FA 3CPWA 1FXAA 4R8NA 1JE4A 1XPRA 4FF1A 4F1SA 4W9EA 3CCJA 3WAMA 1PTOF 1C7YA 5KNDA 1OTCA 2L5TA 2EPBA 1WX9A 3M3YB 1MKHA 3IG3A 1RDPD 3Q8DA 4RM8A 3RYTA 2XGTA 2V3PA 2QDLA 2CHZA 2F0VA 4LFAL 1BT0A 2KDIA 4DQOC 4EZKA 1JC7A 1T0YA 2FIFA 1CZPA 2EJFC 5JAVA 2WXNA 4FBJB 3MFYA 1ET9A 2PI2E 2F0QA 3CF5A 5FJ8G 5DEHA 3SHLA 3OAWA 5C4JH 4ZRZA 3IFTA 4ID6A 4XZ4A 2L1BA 1QVGA 2YEPF 3HOVB 2JYOA 2KUMA 1KAWA 4JBMA 3PUZA 2O5JC 5AUIA 2BBCA 1A3VA 1L1OC 4MELA 2KEDA 5K36G 1PTOH 5ELEA 4UAIA 1YJ9A 1SDFA 1DYQA 2BB6A 2OJWA 5IN7A 3ULLA 3UDGA 1KHIA 5IT9L 2CHBD 3AU7A 3J80c 2BWFA 1O78A 5EE9A 1VQMA 3TMEA 4WJ3M 1LXDA 1SNMA 3ZLZA 1B9NA 3AE2B 4L5TA 1XMQQ 4NAWB 1A3TA 3B9JA 2DNEA 4K5VA 5CTRC 4RMAA 4ARCA 1UUPA 3P4PB 1LUZA 5M5YH 3G4SA 4I6LB 3MWYW 1QNKA 3HOUG 1R9TB 4IM2A 5AEKB 1N62A 1SYCA 3HOZH 3PUVA 4A3FG 4WJOA 2IGHA 5BMGA 3V6EB 1Q1EA 4A3CG 2Q8TA 1GC6A 2NVTB 1TWAB 5JEAG 1NBFC 1E2ZA 3ZRFA 4JI8Q 4FVMA 1I6HB 3NHEB 1KH0A 4LF5Q 1Q5WB 1YNTE 2WLBA 2WXQA 4KKIA 4RKBA 3KK7A 1NMFA 1VMCA 4A93B 1OQYA 2AL3A 3DBRI 3PGEA 1L6UA 2D2QA 4DAMA 2F3WA 1XLOA 5C3EG 4A3KB 3G48A 5IKCM 1J9OA 1WXMA 3U4VA 5GQOA 2Z9HA 4LK0M 4GN3B 1KDCA 1SROA 2JQOA 4HCEA 4ZUIA 5C4XB 3PHXB 2A6HC 1SNCA 3PQIA 2EY6A 2L83A 1SYGA 1B53A 2PZWA 4J6HA 5T1GA 1GVPA 1FFUA 1STBA 2JA8H 2N9PC 3JSVB 4LCDE 2WAQE 1WI0A 3UQBA 3FPPA 1VQFA 5CV6A 4KSKC 5GMVA 4IURA 2CKZB 3FKYA 5EDSA 2I5HA 3DOWA 3I3TB 3FKIB 5LNK1 2MRPA 2CW0D 2FXQA 1Q82C 4P7IA 4X66Q 4FNFA 1PHJA 1XF5L 4JLCA 3H8HA 1TR5A 5EE1A 1JOKA 1K3RA 1JOOA 2HUGA 1PGBA 4AJWA 2YYZA 1KF6B 2PE6B 3ECIA 2KBNA 4PS8A 4G3XB 4WORA 4PMWA 1SN8A 3AV8A 1HNXL 3RR5A 4IPCA 4UHVA 4C3JG 4B3RQ 3B08A 5CV9A 2M9VA 3LX0A 1UEAB 1BQQT 4DK3C 4KN7C 1AE2A 1Q90A 3NBHB 4GIVA 2WNMA 2J0JA 2IHEA 2ZW1A 3DVNV 4P1CC 3CQZH 4HJ7A 5C2TB 1WTRA 4NAWA 1X6OA 4PZ8A 4TVAB 4E6IA 3C46A 1K51A 3I56A 4A3EB 3HOWG 3J7AV 3I4NG 1FGUA 3MHBA 2BVCA 2FBWB 4CQNA 4OWTB 3TP6A 3UDFA 3CRKC 2BS4B 5E4XA 4L5RC 2UU9Q 1CA6A 2CJOA 3NBIA 2X6GA 2JYTA 3ZJVA 2CR5A 2UUAL 1CK1A 2R7ZH 2DY8A 1AE3A 3HS0C 2LVQA 1BVSA 2QGQA 2PNRC 3WDNA 1F77A 3E9SA 1EFWA 2RDBC 1YQ4B 3STBC 2QSDA 1P98A 2VZAA 3E56A 2KQ3A 3J81c 3CU7A 5KNCA 2EMSA 3HM6X 4CHKA 4CBVA 4IUQA 2M0AA 2K52A 4JI5L 1VZ8A 4HTHA 3TEZA 1U9RA 1XTDA 1VQOA 4WH4A 1IBMQ 1ENCA 3WAOA 4A3LG 5C4HA 2KHIA 4DUZL 1TWFH 4BBSG 3R8BA 4X64L 1MVKA 2VQEL 3H0GB 3ZJTA 2K8CA 2D11A 4AWJA 2YLMA 3S1MH 2F03A 3JSVA 3ALBA 1VQ8A 2O6VD 4ILWA 2ZM6Q 4UP7A 4KHPL 2A6EC 2XTIA 3S24A 1N5WA 5H8YE 3ZXVA 2A73B 1WGGA 4XYCA 3AEGB 4BY1B 1PH9A 2W3SA 1N9WA 1KTKA 4NKLA 1E24A 1I35A 4MSMB 1GUSA 1WX7A 3SVMA 4PZ6A 2V4IB 3RI7C 1XJVA 4W9LA 3R3OA 1XNRQ 1B3AA 1MPEA 2WXFA 5EPJA 2ZXRA 3PUXA 4NXML 2BB5A 3RCZA 4ZYSA 3AE3B 2UUBL 3K58A 2JA5B 1WYWB 3CF6E 4DV0L 1CQVA 5LMUQ 4AP4C 5CHWA 1S5BD 2KQ7A 3NBHA 1EF5A 1E8ZA 2KC2A 4IKGA 5IP7G 1HR0Q 1P16A 2L9HA 3A9JB 2AMCB 1R4QB 2TSSA 4O0AA 3K7AB 5ELOA 4FXKC 2WDTB 3HOXG 3OSOA 1VJKA 4POFA 2EJMA 4HIDA 3RNGC 1ZXHA 4BXXG 4XYQA 4JOIA 1FYCA 3QC8B 3BZKA 3IFDA 2BKFA 1GUAB 4N58A 4L23A 1EY5A 1WTXA 1FVIA 3P4QB 3K5OA 3BVZA 3AEBB 1TS2A 1PYWD 5KGUA 3DBRB 5M3FB 1AARA 1Y8OB 2Z0SA 1GHKA 3QJZA 1KLGD 1K73C 1KM7A 2MWSB 1H9JA 1Q1BA 5EQ0A 1DM0B 1VDZA 2N9EB 1WF9A 1O7YA 4RGMA 3GDEA 5T1IA 2Y5CA 4JI7Q 1VQLA 1ZKHA 5EBCA 4YT0B 1V9JA 3F2UA 2J42A 1O7IA 5A2QE 1H9MA 3S2AA 2DENB 2SEBD 2K5DA 4TQ1A 4M02A 2HE7A 1UWMA 3K57A 1D2BA 2K6DB 5IP4D 2G5DA 4QMGA 5J1ZA 2F0GA 1OXTA 3Q0AA 3P2BA 3T8MA 5IYDG 2C60A 1IP9A 2FJ2A 2BYVE 1I6VC 3CWIA 4FP5D 4DV4Q 3ZNHB 1DJRD 2IY1B 3I73A 1WVLA 3E0JA 3RZOH 5L83A 1L1OA 1E9MA 4HSPA 1WCMH 4OEMB 2MNAA 4A3KG 3HKZB 4IFDG 4OO1H 5T8IA 2MUYA 1V8QA 4HXDA 2DZMA 4C3HB 1FNVA 4MGYE 1L4ZB 5CGKA 3A5ZB 3ZYYX 1B9MA 4A3BB 2NYZD 1QOBA 1I4RA 1EL0A 2K25A 2D3BA 2HTME 3G7LA 1WE7A 1SNOA 1ZEQX 2QDFA 3BVGA 2KJXA 3A7AB 3A9JA 4K0KL 3B1LX 3PRPB 4DV1Q 1IBXA 2V4DA 5KRUA 3QO2A 2Q2IA 2D3AA 1QZGA 2ZNVC 5M5WB 2KHWB 1VLBA 3HFZB 3VR4A 1KNEA 3FKIG 5KHQA 4CDDC 1LTGD 1VQHA 2FINB 1F2RI 1F2RC 1JWUD 1FD7D 2Y0SB 3AE6B 4C7YA 4MACA 3A5UA 4QGUA 1YHBA 2N1WA 3NP8A 4KD3A 2F0OA 3OYYA 3GE8C 2K8HA 1I7HA 4CGYB 4H2AA 4FJYA 1F2YA 2XRQD 4OWWB 3LJ3A 1EQQA 3AE4B 1EIYB 4MNOA 2IGDA 3RZWC 1NUCA 2ZTCA 5BR8L 4DR3L 2QMTA 1WM3A 1SE2A 4M8NA 4PQXA 3SXHA 2HHHQ 4P71A 4WWNA 1TWCB 3W9CB 4YHHQ 4UY8C 1XO3A 3KWLA 2JA9A 3VRBB 1JQYD 3KUPA 3ZDMC 5BMIA 1STEA 5F2DA 1ZYRD 1PYSB 2TMPA 5IYBG 4LDTB 3EECA 1SAPA 3U50C 2ZZPB 4QY7A 1JWMD 1ZE3D 1CQFA 1QOAA 1ACCA 5I4DA 3EVQA 2ZXOA 2Z8LA 1IGDA 3VAWA 3PIOA 2MBHA 1ILPA 1TWHB 4C80A 2WP9B 2AUJD 1JJGA 2K01A 1P3QU 2EELA 4ZKCB 4XDXA 4LF4Q 3DDCB 4A3IB 5HKHA 2K22A 4B3MQ 5E4WC 3DUZA 2JVCA 3QIJA 1NDDA 1PMRA 3GZNI 1E7VA 1K28A 1DCZA 1Y1VB 1I6HH 2R92G 4DWFA 1OQQA 2G1EA 3RZDB 5G5HA 4A93H 4HKQA 1SMYC 2KTRB 2PYKA 4A3DG 2LEKA 1IBKL 1TY2A 2NVXB 3VA7A 3GTQB 4X62L 3W1SC 2PKOA 2KOLA 5FO9B 3M85A 3S14B 3K80C 4QQBX 5DPWA 2IPKD 2NBFA 4A20A 1EWHA 3FILB 3Q69A 4XGAB 1OXXK 2VZKB 2PTLA 4GU2A 2RSUA 1M4VA 2A69D 4DBGA 3CMEA 3EQLC 5KIXA 2BWES 1YI2A 2P5ZX 2KHSA 2HTHA 4QL5A 3RNEC 1F9SA 4C3IH 2Y3AA 2ZVOA 2EKIA 2KTFA 5JEAJ 1VQPA 1PUTA 3L10B 4OONA 3DHQA 2PZUA 3B2FA 2MLBA 3QK0A 1UZXB 2JA5G 1EYAA 5IP9H 2O4XA 1BMLC 1C4AA 1Z2MA 3I5JC 3VUXA 4JCVE 1GJZA 1SRUA 2MCNB 5C23A 1C0AA 2KYWA 3LYYA 1UAPA 2FCQA 2B63H 5BYQA 3KH0A 2UXDL 2G4DB 4W9IA 2AQ1B 1FO4A 2MQHA 4IQZA 1CA5A 3J9CA 4W9FA 2NZOA 3VR3A 1JMLA 1E8XA 3IVFA 2MPMA 5C4JB 2F0IA 1SJED 4DA2A 2QEXA 1FXIA 1Q10A 4WIPA 3TL5A 2KK8A 3APFA 1IW7D 3CP0A 3AFPA 3CW2C 2ACZB 4K1RB 3WCQA 4A3MG 3JAME 5I2YA 2F0TA 2WWZA 2LXJA 3RPFC 4C7ZA 1U4AA 1I50H 2QIEB 4H02A 3SDZA 3CMMB 3CSTA 4JGHB 3KF8B 1PH8A 4FADA 3ZTCA 5CR3A 2LXAA 1FFVA 2N4FA 4O2DA 2Z6KA 1FJGQ 5M3MG 2J0MA 4K7UA 1IBLL 4IUVA 2NR2A 3CCUA 2DGYA 4JI4Q 2XSCA 1EYCA 1Y8NB 3KUDB 1EY8A 3OHXC 2KWCA 2N1VA 3PPAA 4OZCA 3QAQA 4OVZA 5M5YB 5IT9c 4FDBA 4ZRPA 1NMGA 4AQYL 4LUZA 2BPSA 1NYRA 2N7JA 2N3SA 2A19A 5JOBA 1BCPD 1BBXC 3L9AX 3HOZB 4DR1L 2KTRA 4OW0A 3RN9C 2Y5BB 3TJPA 1VRAB 3L2PA 2RHQB 3N9YC 4U68A 2K0PA 2JA7G 3H7SA 3FILA 3M7NA 1QE6A 2NZHA 5DNFA 1SYFA 4B9KA 4CO7A 4AOFA 3CC2A 1RHPA 2KDBA 2BCOA 4BY7G 5JJLA 1G6PA 2Y0SE 2RKSA 2BH2A 2R61A 3W3AA 2QDBA 2EYJA 4DV2Q 2L0TA 4DKAC 2KWDA 4NXNL 1CKNB 2Y5PA 4DK6C 4HDQA 1F9RA 2CQOA 1Q8KA 4WFN3 4DU9A 3GE3C 2GBNA 3I72A 4K6LA 5D94A 2F0MA 1WGKA 4HPLB 4A3BG 3QWNA 2RVLA 1VQGA 4JYAQ 2KQSA 3HP3A 2V1YA 1C76A 3AEAB 1X65A 2AHOB 3K9OB 2MP1A 1U0LA 1OXVA 2C7HA 3Q24A 2X6LA 2PQEA 1SE4A 3LGJA 4TUUA 3FPUB 1KD1C 3QOLA 1BUIC 1RTOA 5IYCG 4BWGB 4DV6Q 2PO4A 2IO3B 4AYBG 2J7ZA 2A5UA 2KMCA 2L0CA 2KEEA 2REXA 4HPMB 4DHJD 1BBUA 3P1HA 3APDA 1J5EL 4N8FA 3T1YQ 1KRHA 3EFUA 1HNZQ 2IY5B 2IYDB 4B3SQ 1B70B 2L7RA 2A5HA 4LF6Q 3TRZA 2Q8RE 3JAMi 1XCTL 4EEWA 2GLSA 3UE1A 3RN5A 2YTYA 2I5LX 1VQ4A 1SBBB 3PMFA 1KJTA 4ASWC 1A2TA 1CTMA 3KF8A 2LGSA 2MP2B 3K59A 1F52A 3KLSX 3VH4B 1X3PA 3BS1A 1PH5A 3CQZB 1PDXA 3GZNB 3KUZA 2EQSA 1B3QA 2HIVA 1U4LA 3M62B 1OTRB 4WURA 4EKUA 1Y8PB 3ULJA 4L5SA 4EQPA 1T0QC 2MEKA 3SK8A 1QKZA 2LGIA 4P1BC 1YVCA 1PTOD 4JK1C 5M9OA 4DR4Q 1EWYC 2LGDA 1EY0A 2OCEA 1XPUA 4ANVA 3FRPB 1K8RB 1HA5A 2DYBA 2K39A 2R7ZB 4BAXA 4G7HC 2IW3A 1N36Q 2H88B 1AEXA 2CHXA 4IN3A 5IWAL 3K5NA 4IZ8A 1II3A 3PF5A 3M3JA 4W9HA 2DX5B 2Z6BA 3MXGA 2PCFB 3T9LA 1BNZA 1VR9A 3MXPA 1RRBA 4LF9L 1P1AA 2DNCA 4I65A 3A1QB 4YWLA 1MJEA 4GLVB 3KWVA 4M00A 4US8A 4ZCKA 2DZIA 3GP7A 3I2ZA 4DR2L 1FCCC 1I4PA 5C44G 1JMCA 3H7PB 4GGQA 4YTMB 5KYLA 1Z6HA 3ZDTA 1E7PB 4NQLB 2EOTA 1CKNA 4A3IG 2V4LA 1K83B 2CW0C 4RAUC 4ZK9B 1EUVB 1BF4A 4HWIB 1S3OA 3ZJUA 3I4MG 2JN4A 1KFYB 2YU9H 3SK4A 4YY3Q 2GI9A 3VR6A 4A3GB 4FXCA 1LFDA 3F2BA 2FCMA 4C3HH 1VQBA 1QT9A 1WZ3A 1UEBA 4MEMA 1Q86C 1C8CA 3AULA 4P16A 3I8ZA 3TDQA 4WWPA 2WB1G 1L7YA 4HKZE 4GKJL 2GBRA 1E1TA 2ZCBA 2AQ2B 2R6GA 1XEEA 3W1YA 4YIJA 4YWMA 2W54A 1NVID 2D5DA 3W1GA 1JWBD 3A33B 3DBLI 4KKJA 2X38A 3WIMA 1WH3A 3M4PA 1LT5D 2R7FA 5ELDA 1CT1D 5KNBA 2M0XA 1RKNA 1E90A 2MP2A 4RG1A 4IWPA 2JXTA 3D3RA 1SE8A 4XWWA 2YVCA 2D3GA 1NCVA 3E9HA 3KOJA 1N33Q 3NY5A 4IFDJ 3PO3H 1YEZA 3CC7A 2N0SB 1RLFA 5FKAC 4W9GA 4ALPA 4KGRA 1JQ4A 3P1MA 1BBWA 2L15A 1MHWC 4JI2Q 4EVOA 2G9DA 1WOCA 1A3UA 4ODGA 4V190 1HPCA 2L00B 2MX2A 3KYHC 2FMMA 4DR7L 1YN3A 4XDDA 3W1SA 2DUDA 2KT7A 1TWCH 3BJUA 1SYBA 2CHWA 2VUMG 3EBEA 2NCNA 4JI6L 3NVVA 4L5QA 4IPGA 1MHXA 1P7EA 1WXQA 2JF5A 3PZDA 3Q3FA 2SDFA 4GDKB 1NTGA 1X54A 2PI2A 5IY0A 1UNSA 2D3CA 2F0WA 3QR8A 3A1QA 3X3MA 4BFRA 3H15A 5DM73 3H7PA 4GSWA 5D6JB 3BDLA 3LWEA 2LRWA 2HCCA 2QKIC 1CM9A 3PV1A 4HAEA 3TMPB 2HJ8A 2Z4IA 2EYHA 1E1OA 4OWXB 3TN2A 3NVYA 3H94A 4QUFA 1HTOA 2C35B 1E8WA 3JW0X 3ML9A 4HRSA 3APCA 1ENFA 4KVGB 4MH0E 1PYBA 1HZBA 3HOZG 4PNYA 2RD0A 2D5GA 3I4OA 4FF4A 3U4EG 1OO9B 2F4IA 4MGIE 2KX3A 3TREA 4DXGA 5EE3A 1Z5SB 1Y1VH 2E75C 3OLMD 4IUMB 4K5XA
chains in the Genus database with same CATH topology
1MI0A 4KY7A 1YNJC 3VYRA 3RZOB 4NZLB 3DWPA 1WCMB 2WXGA 2JSOA 1RFKA 3MHZA 3P4RB 3HVZA 2KCNA 3OOCA 1R4PB 4EQNA 4ARIA 1EY7A 3T13A 5C0XI 2SNSA 2B2WC 3IT6B 4B0EA 3TP5A 2Q5WD 3AE7B 2XNAC 4KGSA 4JPSA 1OFFA 5CMDA 4RFBA 1EIGA 1VCIA 3A55A 2PIAA 3I9V1 1D1KA 2D9UA 4H44C 3V96A 1X3QA 2QJLA 1V8CA 2EYPA 1ICWA 3HGBA 4YWGG 3PIO3 2F0EA 5C3JB 2B76B 5LL6S 3GV6A 3OIQA 2EYFA 1WWTA 3A56A 5D3IB 2MJ3A 5C4ZA 1PFBA 2RSOA 4KKUA 1OXUA 4RCNA 1ESFA 3R93A 3KLSA 3ND9A 3I91A 4NAMA 1RM6C 5DAUA 3R2IA 1HZ6A 2B2VC 2XIWA 3Q22A 1AWDA 2ICIA 3TBIB 2PVGC 2HDMA 2B2TC 1AFPA 2I2YA 1GB4A 2BDNA 2D62A 2PPBC 3LWUA 4IALA 1I3QB 1WTOA 1TS3A 1NSNS 1ZYRC 1C77A 4C3IB 1CZWA 1ILQA 1QB5D 5FLXL 2AWNA 4IOIE 3EA6A 2K5QA 2HCIA 4OZCA 3NPPA 2M00A 4MN3A 3CKIB 1TS4A 2B63B 1FIQA 1HA6A 1QNUA 2W82A 5G3LF 1A6XA 1ZP0B 2MJEA 1V1OA 1DXMA 3D8GA 2F0LA 3C2PA 3T3OA 1TKWB 5AUKA 4HR7B 4B9WA 2K28A 1AYFA 2K5WA 1JB3A 4RCOA 1I50B 2PVOD 3DMUA 1TKYA 3K5LA 3BZDB 3MVVA 4FYDA 4XWTA 4DGZA 5G5GA 3S9WA 2WXPA 1DGJA 2A69C 1HHVA 3DWQA 4JX1C 1KDAA 3MXUA 5JVG3 1L0VB 5K36H 4HEDA 4GDLB 1SE3A 1I4GA 4NP5A 1Z7TA 4MT5A 2WINB 1WTPA 2C5CA 1E2VA 1L0YB 3GO5A 1PZJD 4HN7A 3BVMA 4M0WA 4P2CB 4OO1G 1CHQD 2PLPA 2WKDA 4AQ7A 4N9TA 4X3TA 3S1RB 4RWSC 1IW7C 3ZQ4A 2EY5A 2VNUD 2H89B 2NN6H 1QWYA 1C4PA 2HQEA 2WU5B 2ENBA 2BS2B 3EFXD 1Q3LA 3QIAA 4TQUS 3HZXA 1D5XC 2BW2A 3AMUA 4Q2JA 1NR4A 1L4DB 3M4YA 3OMCA 1IBXB 1RD9D 4CKEA 1MGSA 5IGDA 2Q8IB 1K50A 1AP0A 1ZOYB 2BA1A 5C3WA 3WOEA 3DWAA 2LFIA 3TUOA 1U4MA 2E6XA 2PW9A 5COYA 4C1NI 3FVQA 3OW7A 3NWTA 4CJ1B 4YTPB 1EEID 1QCBD 1L6VA 4A8XC 1HEZE 4C56C 1FCLA 1G291 4XQQA 1GPXA 4ZUJA 2DBYA 1XWEA 4KY6A 3NUHB 4U673 1I4XA 1DOIA 2NWGA 3VYUA 3UI2A 2BA0A 4O1NA 1HTLD 3FEWX 1SJHD 2ONQA 2K03A 1HCZA 3MA2B 3MAQA 4B9XA 2YU9B 4BA1I 2H4OA 2GB1A 3GV3A 3A8JE 4TQ0A 3V05A 1U4RA 1L0XB 4REZA 1V1PB 1TKGA 2L4NA 2FFKB 3NZ3A 1BOSA 1J7BA 1EZ8A 1SXTA 1IYUA 1FEHA 2H1EA 1QQRA 5E3FA 5JVH3 3BK1A 2L32A 2DY7A 2G9HD 1PRTC 3TP8A 3AM9A 3PO3B 2JU6X 3U7ZA 3I57A 5LL6X 4LK1C 3LB8C 1EOTA 2XVSA 3NHHA 3BG3A 2ZXPA 3PZ8A 1SNPA 4CKBA 2BT6A 3EROA 2B2TA 3MTSA 3K0YA 1XLPA 4DK0A 4FF3A 3AN1A 1PFNA 4ME5A 3W5UB 1ZDXA 1W6KA 3AEEB 3PUWA 4IDIA 2WXIA 2BS3B 1Y56A 1GUOA 4K14A 4H7BA 2JE6I 2J52A 3NTIA 3D31A 3B2GA 3Q8AA 3CHBD 2JWUA 1Y69U 2A6HD 1PDQA 4M8AA 3PO0A 1NR2A 3MJ5A 3J80L 1FMAD 3FAHA 2R3ZA 4G7OC 1GJXA 1S5ED 3D4DA 4GZYC 2IX1A 1MI2A 4NW2A 3BK2A 3NVZA 1HTPA 2K04A 1V1PA 2QF7A 3T16A 2Z4HA 5IGCA 3C8YA 3Q6SA 1EFID 4JBWA 1FM0D 2JEAI 3VQIA 4K2KA 1CZGA 4IUTA 3RLFA 3DWGC 4PT5A 1V97A 1NAPA 4GLSC 3AH7A 1EU3A 1Q8IA 2OHFA 3GTGB 2MJDA 3K5MA 2JYEA 4RNAA 5EE0A 4X3KA 2KMMA 2NVQB 3DEPA 1QJOA 1TJEA 5EKKA 1WTQA 2NB0A 4PMCA 3PO2B 2DYMA 4KY5A 4XYOA 4XQNA 1STYA 1K8OA 2NN6I 2KQ4X 2EE1A 1QG7A 4A3JB 3AB9A 1SSOA 3TP7A 3RFZB 4DK1A 1MSGA 4OGQC 4F88A 5BYRA 4R9WA 3EUB2 2WQYB 2JX5A 3ERQA 5C0XH 4CKCA 2QEJC 1F0ZA 4KGTA 1BUVT 1FRRA 1WD0A 1VF7A 3P4SB 1IYVA 1HQMC 1VDVA 1EY4A 2HDEA 1PRTB 2B2YC 5FO8B 3AB5A 5C5LA 5HI1A 5JPNC 1TVXA 4K6DA 1LABA 4C3HG 1HXYD 5I2XA 1MBYA 2IL8A 3AE8B 2N9KA 3SFEB 2VZKD 1STNA 4HCSA 1PGXA 3D6WA 1D4BA 4US9A 1TKEA 3S17B 3Q8EA 2BTEA 1FD6A 1SNQA 3VA5A 4XIGS 1HUNA 1D5MC 1A2UA 2KDMA 3NSWA 1F9QA 1ML0D 1PZKD 1AZQA 3KLRA 3TEYA 5CV8A 3RUZA 2WXKA 3NE5B 1ET6A 3AEFB 1DOLA 1K53A 1KDBA 2NMQA 3HVDA 4G4KA 4IUNA 1PFMA 2NVYB 2X69A 2M56B 4J3OD 1D6EC 3VYTA 3Q8CA 1C4CA 1A70A 5LHY1 4WRDA 1TZOA 2M19A 2BDOA 3MC0B 2LS01 1F9PA 3L3OC 4RGTA 2F3VA 5HGTA 2OEDA 1MSHA 1CHPD 1T3QA 4NJCA 1HZ5A 4LJZC 2AQ3B 2KVMA 2B39A 4AS1A 3HOUB 1STGA 1FR3A 4HSVA 4A3FB 1F2LA 1TT2A 3SR1A 4ZLTF 2IT1A 1V43A 1LTID 3HRZC 1RODA 1QLBB 2IX3A 2BYTA 5E6JA 2L1AA 1J7CA 5K5PA 1R7SA 1C4QA 4Q0FA 5EKIA 4HJGE 4L8JA 4HMIA 2GA4B 1DOMA 5CV7A 1GOZA 5FLXE 2JA6B 1DOXA 2IWHA 3GTLB 3T53B 3NTKA 3NWSA 2LMCB 1EM7A 1BR9A 2E74C 1ESRA 2WXLA 1NYQA 3URYA 4KJNA 4NDXA 3T4AC 1YJJA 2MHVA 3LNNA 4K8IA 4XTCS 5IGGA 1SMYD 5IGFA 4IFDI 2DLBA 3HUIA 4YSZB 3SK5A 4ZAIA 1JOQA 5HHDG 1FRDA 1DOKA 1KNAA 5HURA 4YSYB 4EE2A 3ONAB 1E0ZA 5G3LD 3HOWB 1JROA 3I4NB 2WDVB 4KN4C 2JZPA 5D7GA 1IHZA 1RCVD 2VB3X 2WV6D 1N61A 3V2TA 1K52A 1KABA 2RSNA 4TMAB 3TSSA 1U4PA 3S2HB 1G2TA 4DN4M 3P7JA 4D2KA 2EDGA 2C9OA 2NTTA 2JQRB 2E3TA 3IAS1 4WWMA 4KMUC 4YSXB 2MGSA 1C48A 3VR5A 2EY1A 2SAKA 3IKJA 4BBSB 4IUPA 4DF7A 2F0UA 1NI3A 4QUCA 3ABVB 1G91A 3D4RA 5EJWA 1WYGA 1G2SA 1LTTD 4MIUA 3H6MA 1O80A 5CYUA 4A9AA 2RA4A 3RMHA 2F0SA 2LMCA 2RQXA 3S16B 4DAPA 2LFNA 2KCCA 5ELBA 3SE0A 2CQAA 1F2MA 4XE0A 2WXMA 4LTUA 3GD7A 3E6ZX 2XWBB 2AWOA 5CC4A 2EVBA 2K1BA 1EU4A 4CHTB 1PRTF 2WKCA 1TWGB 3HOXB 4XQJA 5CV4A 4O42A 4R3DA 4ZHOA 1B9RA 1ZPSA 2ICEC 5JJZA 3T56B 3MFGA 2KA7A 4FXGC 1PFDA 2RBMA 2I46A 5EPLA 2OT2A 5J39A 4C1NK 1QOGA 3P20A 3C1EA 1XLNA 1J7AA 1JORA 1ENAA 4TSSA 2AX5A 2JEBI 4Z9CB 1FGBD 1EZ6A 4NMZA 1XLQA 1JICA 3DWMA 1CJEA 3VR2A 5IOCA 5D3DA 2RDHA 5TSSA 4JWUC 1LT4D 4F7XA 1BO0A 4USAA 1Y1WB 1SIJA 3VYSA 3IAM1 1B4OA 1P7FA 5FO7B 1EQVA 4RGNA 4TRDA 2EYMA 4DNTB 3J7YW 5EPKA 4KKSA 2NN6G 1RTNA 3J7AF 2ZT9C 1IGCA 1VMPA 2FMCA 1E6EB 3WOFA 2QCPX 1YJIA 5GXGB 1I4HA 2E76C 4KHVA 3PV0A 1YN4A 4ITKA 3HRDD 4FXDA 2O2LD 1D5ZC 2PW5A 1ZUD2 5ELCA 1FNWA 2WIIB 3Q8BA 2KN4A 1NENB 3NS1A 2V3NA 3BWUD 5JXVA 2B8FA 3LXFA 3O13A 2RDGA 3R2TA 2WXRA 4FO2A 3EGRA 3H09A 1QOFA 4ZKBB 2J0TD 2ZW0A 4ZHPA 5A35A 4DAVA 4ZQ3A 3KBXA 4KI0A 2IGGA 3H3VC 2I38A 1TS5A 3I90A 1GUTA 2PMZB 2Z1CA 2E2IB 2W55A 5CV5A 5BN5A 1K8MA 2WS3B 1VF5C 3U9SA 1GUWA 2K5PA 3J80E 3D4WA 5AFWA 2LJIA 3GTKB 2K3UA 4RKLA 4KK7A 1L5PA 4LMQD 3I70A 4DNRB 3QG1A 4TKOB 5JEAH 3BYTB 3AE9B 3OIPA 2N55A 2R92B 1XXGA 4JWSC 4OHJA 4N9PA 2FHTA 3U9OA 1W6JA 4BBRB 4A3DB 1BXTA 2OF1A 2IDYA 4F8MA 1JCKB 2BE5D 3SK6A 2FUG1 2NZ1D 3M7GA 1OXSC 1RWSA 5ELFA 1LTRD 1TU2B 4KTAA 1BCPC 1ROEA 1UGJA 2L55A 4H13C 1PXUA 1SFOB 1HRJA 1FNUA 1GXDC 2KECA 2LHEA 5EBDA 4Q5VA 1IL8A 3DXJC 2OXPA 2A68D 1C9FA 5EGTA 1EEFD 1G6ZA 2B2WA 1YNJD 1QOHA 2F0JA 4ZRQA 4MH8A 3BDCA 2WP8J 1YNND 3FMCA 3ITPA 1XCQL 1G8ZD 4YTNB 3A54A 1J8IA 4A3MB 2HDLA 5HG2A 4QF4A 4N59A 4X3UA 5H92C 2B8GA 5NUCA 5M3MB 2GRIA 2K9XA 2IX0A 4EGVA 1T5XD 1A15A 3KQ4A 2L52A 2XRSD 3BDOA 2D2CC 2MH7A 2JSVX 4XT3B 5I6WA 1JALA 3GTOB 3A7LA 3J81E 4J8QA 2JA7B 1S4ZA 1TIID 4C2MB 2I07B 2WDRB 2PW7A 4ZRPA 4BY7B 2NUCA 4C3IG 1O7LA 4HEA1 4FF2A 1T5EA 1PTOC 2RPVA 4X3SA 1EQTA 1E2WA 3N52A 3BIID 4RF1A 1HQRD 1Q12A 1JWAD 4OZBA 1OQRA 2B2VA 4PV1C 3TZUA 1UWXA 4QIWB 3GQBA 4AYBB 2INPE 1GB1A 4RHSA 1HFGA 1EY9A 1PZID 3FDTA 3CIRB 5FK9C 1E10A 1GAQB 2CJNA 2B2UC 3HEJA 3L4PA 3HOYB 1IUEA 4RH6A 3W2DA 5C0XG 3TEXA 1STHA 5IGBA 4OIKA 5CBAE 1EWCA 2EYLA 4QB4A 3MZ5A 5E1FA 1SSNA 4S3SA 2V0GA 4MHEA 4KHZA 3AMZA 2EYOA 1BCPB 3IXSA 2F0NA 4BA2I 3GB1A 4IUUA 5C44B 3NQIA 2EY2A 2SOBA 2KAJA 3U52E 1YMHE 1BDOA 1JR0D 4V0BA 4BS9A 3SFDB 1JW9D 3VRAB 3FC4A 5I9OA 4ULLA 4LLGM 3I4MB 2F1MA 4YXDB 3QOJA 1PLFA 2J53A 2E2DC 3PZ7A 4K5WA 2EZVA 3E5SA 4IFDH 1TQOA 3EJIA 2VB2X 3K6OA 1GUGA 4K8JA 2WB1B 4N6EB 4WAFA 3OWFA 4HROA 3W5VB 1E0BA 5KYIA 1XYIA 3NVWA 4KJOA 3S1NB 2DYOA 2K7VA 5CORA 1XX8A 1GUNA 2A74C 2W3RA 4DXFA 3IT4B 2BOSA 4L6TB 5BN4A 2L12A 4B08A 4RA8A 2CVRA 1F2ZA 3SR6A 2ID0A 4F87A 1WSPA 1H9KA 1SYEA 1D1IA 1RJTA 3MEHA 1S5CD 3UI3A 1LACA 3AE1B 1SYDA 2A6ED 2EJGC 4Y7NB 2FE8A 3NUCA 5C5MA 3SEBA 4A6QA 2VUMB 2SNMA 3NXWA 4DFAA 4CJ2C 4DAYA 3H91A 2WU2B 5IODA 1B2TA 1PTOB 4HMJA 5A2QL 1AW7A 2N9LA 3QB3A 4G57A 2PZTA 2XN9C 1RF2D 2AUKA 3J81L 5BYSA 1I4QA 4L63B 4J1MA 5FR3A 1IKLA 2EXZA 2RDFA 5J22A 5CBEE 3S15B 2WXOA 1LTAD 2E2HB 2YEPB 1XTCD 2XWJB 3NQTA 3M4OB 1NEKB 3NTHA 1SNDA 3L7ZC 1M8AA 2R93B 3KBGA 3V3XA 3TZDA 5MPOA 3OMGA 1CFMA 2DWQA 5C3XA 3P42A 4H0LC 2F0FA 3Q8FA 5I6YA 3GTMB 3VR9B 1QF6A 2JA8B 1LTSD 2JXMB 4I7ZC 2F0PA 5I9PA 3D6CA 3I3CA 5KEEA 2ON8A 1SB3C 3DEOA 3S1QB 5BMHA 1WD1A 2WACA 3A8KE 5IIFA 1IKMA 4L2YA 4ABNA 1HUMA 4OZAA 1MHHE 3GTJB 1Z47A 3ETRA 1N60A 2O5IC 1AN8A 4OO1I 1KAAA 1X32A 2K32A 2LY7A 1EY6A 4RHRA 2INNE 3AEDB 2F0KA 1STAA 4CJ0B 4A90A 1CI3M 4KV6A 5FOBB 4RF0A 2K33A 1ZKOA 3ND8A 3HG9A 2K05A 3OPOA 2RMMA 1ZXTA 1H9RA 4XDCA 1ONLA 4EQOA 1EIHA 1PRTD 3MP9A 5IT9E 4OL7A 4PMBA 1C78A 2LHDA 3AE5B 1YN5A 2M2LA 5IGEA 3NK9A 1H9SB 1PGAA 3U2SC 1S5FD 2B2UA 1TWFB 5HFYA 2LKVA 1DZ1A 5D65A 5C3EB 1JWSD 1TYGB 2WXJA 3S1MB 2N88A 5M5XB 3GS2A 1EYDA 1LT6D 1TY0A 3X3NA 3OWEB 2WXHA 1JRPA 1GHJA 2L11A 1N63A 5JPMC 1SF0A 3G6JB 2MJ8A 3AECB 2CU3A 1LTBD 1LT3D 4LAAA 3PIP3 4OIJA 1LLRD 4JE3B 5C6AA 1O7ZA 3CRLC 1B50A 1WRIA 3RD4A 1QILA 2OEOA 3DM1A 1ZDVA 3C3LA 1WTWA 3S2DB 1VZ7A 1BCPF 4C3JB 3JAML 1ZXIA 3BYYB 5ISRA 3IL8A 3MXNA 5EKLA 1SEBD 1DOYA 5D14A 4L1BA 2WAQB 3I4LA 1LV9A 1VZ6A 2LUMA 2F0DA 4MM3B 1LO5D 2VXWA 4A55A 4XT1B 3N6RA 2BE5C 1N5XA 4XXEA 3GTPB 5BN3A 4RGOS 2NTSA 1YQ3B 4WQMA 1H9SA 1MD2D 4KKTA 2F0HA 2KACA 1B1ZA 3A8IE 3P63A 3NRZA 4ZOHC 4K2LA 4WJWA 1DD2A 1DONA 2QILA 4R8IA 2A68C 1C79A 5DM63 1KLUD 5C0XJ 1T6BX 2PMVA 3P75A 3Q23A 2JP1A 1S5DD 2IJ0A 4KX6B 4G7ZC 1HFNA 4B0MA 3T3NA 4UDUC 1WTVA 2WDQB 1YNNC 1AZPA 2K6AA 1B44D 3IAYA 3T51B 4M1UB 1RYJA 2B2YA 3TEWA 3QJYA 3PUYA 2DN8A 2J4XA 4QCLA 4P6VF 4KD4A 2E2JB 3C1FA 1FXAA 4R8NA 1JE4A 4FF1A 1PTOF 5KNDA 2L5TA 2EPBA 3M3YB 1RDPD 2V3PA 2F0VA 4DQOC 1JC7A 1CZPA 2EJFC 5JAVA 2WXNA 3MFYA 1ET9A 2F0QA 5DEHA 3SHLA 4ZRZA 3IFTA 4ID6A 2L1BA 2YEPF 3HOVB 2JYOA 2KUMA 3PUZA 2O5JC 5AUIA 2BBCA 1A3VA 2KEDA 5K36G 1PTOH 5ELEA 4UAIA 1SDFA 1DYQA 2BB6A 5IT9L 2CHBD 3AU7A 1O78A 5EE9A 3TMEA 1SNMA 1B9NA 3AE2B 4NAWB 1A3TA 3B9JA 2DNEA 4K5VA 4ARCA 1UUPA 3P4PB 3MWYW 1QNKA 1R9TB 1N62A 1SYCA 3PUVA 5BMGA 2IGHA 1Q1EA 2Q8TA 2NVTB 1TWAB 5JEAG 1E2ZA 4FVMA 1I6HB 1KH0A 1YNTE 2WLBA 2WXQA 4KKIA 4RKBA 3KK7A 1VMCA 4A93B 1L6UA 1XLOA 2F3WA 4A3KB 1J9OA 4LK0M 4ZUIA 1KDCA 4HCEA 5C4XB 2A6HC 1SNCA 2EY6A 2L83A 1SYGA 1B53A 2PZWA 4J6HA 5T1GA 1FFUA 1STBA 3FPPA 5CV6A 4IURA 3FKIB 5LNK1 2CW0D 3VR8B 5EE1A 4FNFA 1XF5L 3H8HA 1TR5A 1JOKA 1JOOA 2HUGA 1PGBA 2YYZA 1KF6B 4WORA 4PMWA 3AV8A 4C3JG 5CV9A 2M9VA 3LX0A 1UEAB 1BQQT 4KN7C 1Q90A 2WNMA 2ZW1A 5C2TB 1WTRA 3C46A 4E6IA 1K51A 4A3EB 3J7AV 2FBWB 3MHBA 4CQNA 3TP6A 3CRKC 2BS4B 5E4XA 1CA6A 2CJOA 3NBIA 2X6GA 2JYTA 3ZJVA 1CK1A 2DY8A 3HS0C 2PNRC 3WDNA 1F77A 3E9SA 1YQ4B 2QSDA 3E56A 2KQ3A 3CU7A 5KNCA 4CBVA 4IUQA 2M0AA 1VZ8A 4HTHA 3TEZA 1U9RA 4WH4A 1ENCA 5C4HA 3R8BA 1MVKA 3H0GB 3ZJTA 2F03A 4ILWA 2A6EC 1N5WA 5H8YE 2A73B 3AEGB 4BY1B 2W3SA 4NKLA 1KTKA 1GUSA 3SVMA 2V4IB 3R3OA 1B3AA 1MPEA 2WXFA 5EPJA 2ZXRA 3PUXA 2BB5A 4ZYSA 3AE3B 3K58A 2JA5B 1CQVA 1S5BD 3NBHA 4IKGA 2L9HA 2TSSA 1R4QB 3K7AB 4FXKC 3OSOA 1VJKA 2EJMA 1ZXHA 4XYQA 1FYCA 3IFDA 4N58A 4L23A 1EY5A 1WTXA 3P4QB 3K5OA 3BVZA 3AEBB 1TS2A 1PYWD 5KGUA 5M3FB 1Y8OB 1GHKA 1KLGD 1H9JA 1Q1BA 5EQ0A 1DM0B 1VDZA 1O7YA 4RGMA 5T1IA 2Y5CA 5EBCA 4YT0B 3F2UA 2J42A 5A2QE 1H9MA 2SEBD 2K5DA 4TQ1A 1UWMA 3K57A 1D2BA 4QMGA 5J1ZA 2F0GA 1OXTA 3Q0AA 2FJ2A 1I6VC 3CWIA 4FP5D 1DJRD 3I73A 1WVLA 3E0JA 1E9MA 4HSPA 4IFDG 3HKZB 4OO1H 5T8IA 2MUYA 1V8QA 4C3HB 1FNVA 1L4ZB 5CGKA 3ZYYX 1B9MA 4A3BB 2NYZD 1QOBA 1I4RA 1EL0A 2HTME 3G7LA 1SNOA 1ZEQX 1IBXA 3BVGA 2KJXA 3A7AB 2V4DA 5KRUA 3QO2A 5M5WB 1VLBA 3VR4A 1KNEA 1LTGD 1F2RI 2FINB 4C7YA 1F2RC 1JWUD 1FD7D 2Y0SB 3AE6B 4MACA 3NP8A 4KD3A 2F0OA 1I7HA 4CGYB 4H2AA 1F2YA 2XRQD 3AE4B 2IGDA 1NUCA 2QMTA 1SE2A 4PQXA 3SXHA 3W9CB 1TWCB 1XO3A 3KWLA 3VRBB 1JQYD 3KUPA 5BMIA 1STEA 5F2DA 1ZYRD 2TMPA 1SAPA 1JWMD 1ZE3D 1CQFA 1QOAA 1ACCA 5I4DA 3EVQA 2ZXOA 2Z8LA 1IGDA 1ILPA 1TWHB 4C80A 2WP9B 2AUJD 2K01A 2EELA 4ZKCB 4XDXA 4A3IB 2K22A 5E4WC 3DUZA 1PMRA 1DCZA 1Y1VB 1OQQA 2G1EA 3RZDB 5G5HA 4HKQA 1SMYC 2PYKA 2LEKA 2NVXB 1TY2A 3VA7A 3GTQB 2PKOA 2KOLA 5FO9B 3M85A 3S14B 2IPKD 2NBFA 1EWHA 3FILB 3Q69A 1OXXK 2VZKB 2PTLA 1M4VA 2A69D 3EQLC 5KIXA 2KHSA 1F9SA 2Y3AA 2EKIA 5JEAJ 1PUTA 3DHQA 2PZUA 3B2FA 1EYAA 1BMLC 2O4XA 1C4AA 3LYYA 1UAPA 5BYQA 2AQ1B 1FO4A 4IQZA 1CA5A 3J9CA 3VR3A 1JMLA 2MPMA 5C4JB 2F0IA 1SJED 4DA2A 1FXIA 1Q10A 4WIPA 3WCQA 3ZGZA 1IW7D 2ACZB 3JAME 5I2YA 2F0TA 4C7ZA 3RPFC 2QIEB 3SDZA 5CR3A 1FFVA 4IUVA 2XSCA 1EYCA 1Y8NB 1EY8A 3OHXC 4OVZA 5M5YB 1NYRA 2N7JA 4OW0A 5JOBA 1BBXC 1BCPD 3HOZB 3L9AX 1VRAB 3N9YC 4U68A 2K0PA 3FILA 3M7NA 1QE6A 5DNFA 1SYFA 1RHPA 2BCOA 2RKSA 2R61A 3W3AA 2QDBA 2EYJA 2KWDA 2Y5PA 1F9RA 4WFN3 4DU9A 3I72A 4K6LA 2F0MA 1WGKA 3QWNA 2RVLA 3HP3A 1C76A 3AEAB 2MP1A 1OXVA 3Q24A 2X6LA 2PQEA 1SE4A 3FPUB 3QOLA 1BUIC 1RTOA 4BWGB 2PO4A 2J7ZA 2L0CA 2KEEA 3P1HA 1KRHA 2A5HA 2Q8RE 1XCTL 1SBBB 3PMFA 1A2TA 1CTMA 3KF8A 3K59A 3KLSX 1X3PA 3BS1A 3CQZB 1PDXA 1U4LA 4WURA 1Y8PB 4EQPA 2MEKA 3SK8A 1QKZA 2LGIA 1PTOD 4JK1C 5M9OA 1EWYC 1EY0A 3FRPB 1HA5A 2R7ZB 4G7HC 2IW3A 2H88B 1AEXA 4IN3A 3K5NA 4IZ8A 1II3A 3MXGA 2PCFB 1BNZA 1VR9A 3MXPA 2DNCA 4I65A 3KWVA 4US8A 3GP7A 1FCCC 1I4PA 4YTMB 5KYLA 1Z6HA 1E7PB 2EOTA 1K83B 2CW0C 4RAUC 4ZK9B 1BF4A 3ZJUA 1KFYB 3SK4A 2GI9A 3VR6A 4A3GB 4FXCA 1QT9A 1C8CA 4P16A 3I8ZA 3TDQA 4HKZE 2AQ2B 2R6GA 1XEEA 4YIJA 2W54A