3BYYB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 70
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3byyB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3byyB01
5ELFA 1TY0A 5FK9C 1EEFD 1I4GA 2QILA 4RGOS 1L0YB 1PRTC 2R61A 1L0XB 2Z8LA 1BCPC 1LT3D 3BZDB 1I4RA 1B1ZA 4UDUC 2XRSD 3DWAA 3EFXD 2ICIA 2AQ2B 1JWSD 1JQYD 2O2LD 4C56C 1S5FD 3URYA 1LTSD 3KLSX 3R2IA 1HQRD 1PYWD 2XN9C 1TS3A 1RCVD 2AQ3B 1PTOB 1LTRD 1LTTD 1PRTF 1I4PA 1LTGD 1KTKA 1ET6A 5TSSA 4L63B 1I4HA 1LT6D 4RH6A 1AN8A 1UNSA 1V1OA 5FKAC 1HTLD 4OHJA 2NTSA 1BXTA 2QEJC 3BYYB 1CHQD 3BVMA 1DYQA 1D6EC 1EU4A 1LT5D 1FGBD 1G8ZD 1CHPD 1TS4A 2SEBD 1PTOC 4RCOA 1DJRD 1D5XC 1LTID 1JWMD 1STEA 1XXGA 3EA6A 3MC0B 4Z9CB 3BYTB 3MFGA 4RFBA 1T5XD 2NTTA 1UUPA 3R8BA 1JWUD 1PTOH 2J4XA 5D3IB 1EWCA 1HA5A 1S5DD 1JCKB 1TS5A 1V1PA 1XTCD 3GP7A 1RD9D 5I4DA 4BWGB 4O1NA 2TSSA 3V05A 3TSSA 1SJED 1ET9A 4DXFA 4RGMA 1FNVA 1SE3A 1YN3A 4RHRA 3OWEB 5ELDA 1PRTD 4RGTA 1KLGD 1M4VA 1EFID 3W2DA 1PTOF 4RHSA 1BCPD 4L6TB 1I4QA 1YN4A 1D5ZC 1LLRD 2XRQD 1SBBB 1PZID 2IJ0A 1PZKD 1SXTA 1KLUD 1CK1A 1BCPB 2RDGA 1MD2D 1PTOD 1QILA 3O13A 1S5BD 4RGNA 1I4XA 4TSSA 5D3DA 1FNUA 1SE2A 1PZJD 1RDPD 1SEBD 3DWPA 1HXYD 3DWQA 1FNWA 1TS2A 1EU3A 3R2TA 3CHBD 1RF2D 1S5ED 1B44D 2XNAC 3BVGA 2G9HD 1JR0D 1LT4D 1PRTB 1S5CD 3SEBA 1YN5A 2RDHA 4NZLB 5ELBA 1AW7A 3BVZA 1D5MC 1CT1D 1SE4A 1ENFA 1SJHD 1F77A 4ZYSA 1CQVA 1BCPF 1EEID 1FD7D 1GOZA 1LO5D 1LTAD 4K6LA 1V1PB 5ELCA 4DXGA 2AQ1B 2CHBD 1LTBD 1ESFA 2IPKD 5ELEA 2WV6D 1TY2A
chains in the Genus database with same CATH superfamily
2A6EC 1HFNA 2WXMA 2LRUA 3GS2A 3NG0A 4DAYA 4PYZA 5BMIA 3T9LA 3KUZA 4DR5Q 3TEZA 3BZDB 2E76C 2D5GA 1YJ9A 2RSUA 2ZPNA 2HUGA 5JEAG 4M8NA 3HKZE 1HZ5A 1JICA 2D0PA 2ICIA 3P63A 3S1RH 5FR6A 1XMQQ 1XF5L 3DCGA 1JE5A 4P1BC 3NWSA 2F4VQ 2LHDA 1B8AA 5IYDG 1YJNA 3DBHI 1BMLC 3KUCB 1EY9A 1MHWC 5IYBG 5IYCG 4Y7NH 1YI2A 3MC8A 1EWYC 3Q3OC 2W55A 3HOXB 3ND8A 3A5UA 1MFWA 2BS3B 4X65Q 4OHJA 1E9MA 4OO1G 3K9OB 2H5XA 4TQUS 3CCUA 1ZDVA 1SR3A 3A7AB 1MSGA 3AE9B 4DR3L 1DYQA 1WI0A 3FP9A 2BYTA 4UPAA 4IPGA 5F2DA 1ZPSA 3PF4A 1CHPD 1J9OA 2A74C 4NQKE 1LTID 4DK5A 4IM0A 3V61A 4I6LB 3WCQA 4B0EA 3R8BA 4L5SA 1SNMA 2PZWA 2MW5A 3LYYA 3T1YQ 4EUTA 5I4DA 2Y5BB 1KD1C 2ACZB 4B9WA 3MJWA 4JBKA 2EIFA 5IY0A 4PNYA 3RFZB 3Q8BA 4Q2JA 2VH2A 2IX3A 1G91A 2R3ZA 4ME5A 5IYCH 5IE8A 2HHHQ 3U52E 2I07B 3W1SC 1G291 1BR9A 1O7ZA 4EOYA 3VYRA 4RGTA 2MFIA 2XEWA 1H9SA 3PPAA 1EFID 3KYHC 2GBJA 2WDRB 3VR4A 2R2OA 2JZ3B 2N1VA 2F0KA 3AEEB 2VQFQ 3D4RA 2LGSA 3I4OA 4CKBA 2WHIA 2WQYB 4JWSC 1CSPA 1SXTA 3CQZH 2Y0SE 3OSOA 4A3JG 1KRSA 3LWEA 2W82A 1JJGA 1O80A 4TKNA 1N5XA 1RKNA 2VB2X 1VDVA 1HNZQ 5I9OA 2OCEA 3RYTA 4FN2A 2LRWA 1GM5A 3DHQA 4LF5Q 1FNWA 2OF1A 3MXNB 3RUZA 1PVOA 2N7DA 2KDEB 4W9KA 2DN8A 1X3QA 2KDMA 2E5LQ 1RF2D 5EPKA 3PF5A 4R4CA 2B39A 4OX9L 3UF8A 2DLBA 2RDHA 3EJIA 5ELBA 2K0PA 4LJPB 2JA7B 4KV2A 4ZQ3A 2DJFC 5CBAE 1IYVA 3NS1A 2N49A 4JOIC 1LTAD 3E9HA 4EX5A 1B3AA 4WWOA 1EO6A 3N32A 3DPDA 3HM3A 5FLXE 1AE3A 4Q0FA 3MHSD 1TQOA 2FCSA 1P7EA 3TL5A 2JA6B 3E6ZX 4US8A 4A76A 1JALA 4FADA 4YT0B 3PO0A 3RLFA 1LT3D 2C7NB 2LUEA 2R7FA 2O5JC 4RKLA 4FF1A 4XDCA 1UWMA 4LW1A 4DV4L 4NQLB 1F9SA 2AWNA 4K7UA 3NS8A 1NJIC 3Q24A 1L5PA 3K7AB 2JXMB 2KBNA 1XPUA 2B76B 3H6MA 3S2DH 3V3XA 2E2JB 3PQIA 3H15A 1J19A 3BZCA 4NXMQ 5IP7H 1FFUA 3KVFB 5A2QL 1WGKA 4AJYB 5L37A 2L1BA 4GOPC 4KGRA 2FE8A 1F52A 4L5RC 2N9XA 4RH6A 2R92H 1AN8A 3WAPA 2X6GA 2NZHA 1PGAA 4CO7A 1X55A 2KHJA 1HTLD 1F2MA 1P7FA 1KXLA 1BXTA 5IGEA 4HJ9A 1JORA 2C5LC 1H4RA 1SIFA 2DYBA 1E5WA 1VQEA 1FXAA 3BWUD 3NK9A 4CKEA 3PV1A 2JX5A 4A55A 2SNMA 2SEBD 4LFCQ 2J0MA 3RNAC 4TMAB 1DJRD 2CU1A 1NYQA 3STBC 3F8TA 4QAYA 1PDQA 3D6WA 2GLSA 4MT5A 4C3HB 2R93B 3S2HH 2KLGA 3SVMA 5D6JB 1L1OC 1EIFA 2E6XA 2EXZA 4LNKA 3H8HA 3FRPB 2JEBI 1STBA 2DZMA 2DY8A 4CDEC 2I1KA 1RIPA 5M5YB 4KN7C 3J81E 3CIRB 4GOPA 2HCCA 2FHTA 1PH1A 4OVZA 4JCVE 1XPOA 3PUZA 4W9FA 2JSVX 2K5DA 3J7A5 1DOYA 3W2DA 3FMCA 4RHSA 4HLEA 3KYDD 2JA5G 1LLRD 2NBUA 2XRQD 2KXJA 2K33A 1SBBB 4JOIA 4B3RL 4GLSC 2V4IB 2BKFA 2DNFA 1QG7A 3OIQA 1TTNA 3M63B 3RNBC 4TQ0A 1G6JA 3AM9A 2X6LA 1WJUA 1Q46A 4MGKE 1PTOD 3OOCA 4PG3A 4PZ6A 4AOFA 3AV8A 4IPDA 1PYBA 1SEBD 3SHQA 4OXPA 2RVLA 2G45B 1I35A 1VQOA 2IHFA 5CYUA 2QHOA 2JA7G 4WH4A 5CR3A 1C3TA 3LGJA 1V80A 2NB0A 1UE5A 3TP8A 1R4NI 3H7PB 1YN5A 3AMZA 2IO3B 3CRKC 4FXGC 1GHJA 2KECA 2FCQA 4OZCA 3BVZA 4PQXA 3V6CB 4N9PA 2RQXA 2L3ZA 2K04A 2QIEB 4HPPA 1D7QA 4P1CC 1AZQA 2Z0EB 2QDBA 1F9RA 2VB3X 3L0OA 4QMGA 5CV8A 1LTBD 1VQPA 1YX6B 4JI2Q 2Q8RE 3NXWA 3KK7A 3DMUA 4JV5Q 1SSNA 2BWES 2IGHA 1GKHA 4JYAQ 5FLMG 2BKRB 2FCNA 3DVGX 2KK8A 3EECA 4P71A 2AUJD 3FVQA 2UUAQ 1J7BA 5KEEA 2INCC 4JI6Q 3FC4A 3R7RA 2WP8J 1E8WA 1IBML 4NXNQ 1FR3A 1ASZA 1WFYA 4HDOA 2QJLA 1A70A 2HIVA 2O2LD 1STGA 3U2SC 4EZKA 3AECB 3D0FA 3QOLA 1H95A 2V9HA 3M95A 3C1EA 4BAXA 4BY7B 5IP4D 2FXQA 2KVMA 4NAWA 1PA6A 2F03A 2F0UA 2K5QA 2GVBA 4K0KL 5KIXA 2WX0A 2RSOA 2B2WA 2ZM6Q 1NMGA 3AFPA 4KY5A 2HDMA 1M1KC 3VUXA 3K81C 2D0OA 2Z0DB 2EJMA 2LWPA 5BMGA 3ZGZA 4IJLA 2D07B 3MAQA 4MN3A 3NELA 2ZW1A 3ZJUA 1X65A 4HCEA 1S3SG 3I3TB 1FCLA 2QF7A 1WJJA 3P1HA 2E2IB 4DV2L 1IXRA 1U0LA 4LK1C 2ICEC 1UBQA 1JC7A 1VQMA 1X32A 4M00A 5COYA 4DAYB 3NVYA 1PTOC 2NVXH 4N58A 1WX9A 1JWMD 4I6PA 3OG5A 3QIAA 2WXFA 3IAM1 1E90A 2UUCQ 2NTTA 2Z59B 3H0GG 3F2CA 3BU2A 3TCAA 2K8HA 2MUYA 5IOIA 4A3PA 1HA5A 4NJ6A 4KGTA 1HNWL 4BWGB 4S3SA 1GVPA 3V05A 3KYCD 3TSSA 2L12A 1K8RB 4C3JB 3PIO3 3PZDA 1SIJA 3PGEA 3PZ7A 2UXCQ 2KC2A 3V96A 4LLGM 2K6AA 5G5GA 4R9WA 3L10B 3R66C 2O4XA 3NTKA 1Y1VB 3NY5A 3ZJVA 4A3IH 3HOVG 2EKEC 3AE6B 3MP9A 4A9AA 5L83A 3G48A 3APFA 2ONQA 2AUKA 4OGQC 2L4NA 2ZJPA 4MM3A 1M8AA 3BS1A 4HPMB 4YWMA 4YIJA 3S14H 4CDCC 1CK1A 3VTWA 5HKHA 1YIWA 2N0SB 3HOZB 3SXHA 2R7ZB 3J7AF 4JI5Q 1KRHA 4DXAB 1WZ3A 1SNQA 2E74C 4K5XA 2DJGC 4YTNB 2N7EA 1TS2A 5GAEC 4IDIA 3VRAB 3CKIB 4X3UA 4HXDA 2OTLA 1KJTA 3P20A 3QO2A 4X64Q 1UD7A 4P74A 1QOBA 4IOAA 4NZLB 1E2WA 4TKOB 1VDZA 4GN3B 4L1BA 1ZP0B 3ZYYX 1NSNS 4OEMB 3L08A 2ZCCA 4DR6Q 2N9EB 3NVVA 4DBGA 3AULA 3C0RB 4XT1B 2J52A 1MG8A 5BYSA 1VD2A 4C3IB 2UXDQ 2C35B 1VQJA 1V1PB 3IAS1 2J7QB 2CHBD 5IYBH 2I0QA 2WDTB 4M0WA 2FMMA 4B6WA 2CJOA 4W9EA 2DZJA 4DV5Q 2LJ5A 4RGOS 1L0YB 4UP7A 3NE5B 1CZWA 2M0XA 4RAUC 4E6IA 5IIFA 1B9NA 3RZFA 4NW2A 3IFDA 4LAAA 3VFKA 1HRJA 4WJNA 4K3BA 4F1SA 1B1ZA 2KCTA 3AU7A 2KTFA 2ZXOA 2LS01 1E22A 3H91A 1RLFA 2NUCA 2JA5B 1Q8KA 2XWJB 2DX5B 2D3GA 1A3VA 4YY3L 2KJRA 2VXWA 4GIVA 4HKQA 1RCVD 2QW7A 4IJHA 1R4NB 1JOKA 1DONA 3M4PA 2BYFA 3E9IA 4OWTB 1CMXB 2V1CC 1Z9FA 4A6QA 2QDFA 2HT1A 2L0TA 3ERSX 2JWUA 5M3MH 1LM0A 2M19A 2ZW0A 1YOVB 2EYMA 1CKOA 2ZJQA 1SSOA 3K5OA 3HOYH 4IUQA 2G5DA 2R2QA 4D2KA 3A1QB 3DBRI 4KLKA 1EY7A 3HOXG 2MBBB 3RZDB 4K3CA 1QNKA 1BQQT 1EU4A 2XSCA 1FGBD 4PYUA 2KHIA 3T13A 2NYZD 2F0OA 4XYOA 1D5XC 1U4MA 1HPCA 1XXGA 1EF1A 4KIKB 4YSYB 1QCBD 3JAME 3UQAA 1VF7A 3P75A 3MFGA 4U673 3TS0A 1K53A 3L4PA 2L15A 2Z1CA 1BNZA 2JZZA 1WOCA 1TS5A 4B3TQ 2J0JA 5C3EH 3DDCB 3ZRCA 4DUYL 1RD9D 4H02A 4GNXB 3HRDD 2C7HA 1HNXQ 4LF6L 2IX0A 5BN5A 3HOVB 3J7ZC 1I6HH 1YN3A 1FNVA 2KDBA 3UDXA 3GTLH 5JXVA 3OWEB 4ZOHC 1X3EA 2WKCA 1FJGL 1H9RA 4DR7Q 1GC7A 4HR7B 4B9XA 4YCVA 1JOOA 4X57B 4V0BA 1DGSA 1F2YA 3HOWB 1L1OB 4K7WA 1V1QA 3SK5A 1QOGA 3PHXB 3VR8B 3S24A 1PZKD 2OWOA 2FNJB 3CCQA 2UUBQ 3RZWC 2Z9HA 4HDQA 1HTOA 4JVZA 4BKGA 2LY7A 4DR3Q 4K1RB 5BYRA 3UQBA 3KBGA 5EE9A 3NTIA 1TWCH 1PZJD 4HJ7A 2KDFB 3VAWA 3N6RA 1KOTA 1L1OA 2JA6H 1VQNA 2LKVA 1YEZA 2K4KA 1WGDA 1SYBA 4ICUA 3AQQA 4DUYQ 1JB7A 1PV4A 1IBKQ 4MH8A 3CHBD 1PH6A 1WSPA 1OTRB 2BE5D 1I7HA 3ZNID 3H3VI 4IUMB 4ARCA 3LXFA 5IO9A 1BUVT 4DR2L 1T0SC 4GN4B 3BG3A 3T8MA 4UHVA 3PS6A 1EY5A 5ELOA 4REZA 1SNCA 3W1BA 4CBVA 2AL3A 2WXPA 4ZYSA 1GOZA 4A3KG 1Q81C 2O6VA 4KY7A 1OQQA 3ETRA 1I42A 1EOVA 2K5WA 3S17H 3K8AA 3UGBB 3RT3B 2UU9Q 1QVGA 3CC4A 2K1BA 3DBLI 2PW5A 2L9HA 2HD5B 4OW0A 2R92B 4RMAA 5AUIA 3GTMB 1HNWQ 2C7MB 4J15A 2B63B 4C3JG 2PZTA 3NQTA 1HZ6A 3TZDA 5TR5A 2UUCL 3GTPH 1CTMA 4HSPA 4YHHL 2WACA 4AIMA 1E2ZA 2WXNA 3FKIH 4X3TA 2KNBA 2PLPA 3AB5A 3KJPA 5C0XJ 3WAOA 5EBCA 1B70B 3K5LA 5CBEE 2W9NA 1TBEA 3I91A 3VXWA 5JOBA 3U4EG 2F0PA 2LEKA 3EQLC 1PTOB 2MGSA 1G6PA 2GMIC 3L0WB 2R7ZG 3MZ5A 1ET6A 4IM2A 5H1SE 4A3KH 2K7VA 4L63B 4QF4A 3GTKH 2WX1A 4DK0A 2KTRA 4DV3L 2J42A 3EIVA 4J6IA 3PHWB 4XDXA 2XK5B 3BINA 1N62A 1Y1WH 3PIP3 3AEVA 3Q3FA 2IHEA 4GDKA 4C4VA 4AQ7A 1SMXA 4HEDA 3AEGB 4QQBX 2MJ3A 1FGUA 1D6EC 4C3JH 4NY0A 4YWLA 4PS7A 4A3CH 4XX5A 4A3EB 2JE6I 4R1JA 3M85A 2VW9A 4IFDJ 3S1NH 2Q2UA 1FVIA 1UUPA 2F0DA 3QARA 1Q1EA 3VR2A 2LFIA 1T9HA 2E2IH 3HEJA 1PH7A 4RF1A 2LJIA 1VQKA 4MDKE 2PKOA 3KUPA 4Y52H 1A5RA 4LF7Q 4DK3C 1XEEA 1K3RA 1GJXA 2J0KA 5C3JB 3DEPA 3SE0A 5A35A 4NAWB 3I72A 1CI3M 2MSED 2JZPA 4JI5L 3WOFA 4IG7B 3GE3C 4GKJL 4WIPA 3C19A 4K0KQ 5CV4A 5BN4A 3NOBA 2CVRA 3KOJA 2A1AA 5C0XH 2YLMA 5IAAC 4HIOA 1TKEA 2OHFA 2FUG1 3E0JA 3OTOQ 3VRBB 2MJDA 1GUNA 1QOAA 3B6YA 2DNCA 1U4AA 2KN4A 4P7IA 2RKSA 3J9CA 4MM3B 1MD2D 4WAAA 4DHJB 2LGDA 4RGNA 4J3OD 4O0AA 2SDFA 1HE8A 4JQWC 3W5VB 4HROA 2F0WA 4HVBA 3JAMc 2H1EA 2HCIA 4KI0A 4BBRB 1R9TB 2C5CA 1N33Q 4MELA 1LTLA 3JAMi 1EY4A 5FO8B 1ZW7A 4UY8C 4M02A 5DPRA 2JXXA 2NCNA 3EFUA 4K2KA 3CC7A 3CCSA 1OEYA 5HG2A 2F0EA 3NWTA 2H4OA 3BVGA 3M4YA 5IKCM 3NHHA 5IODA 3J81c 4EQ5A 2CFMA 3T16A 4ACFA 1X1MA 4RWSC 1SYDA 1XMOL 1J8CA 5T8IA 2LXKA 1N63A 4WQMA 1LO5D 4YCWA 1IHZA 1E1OA 4HJ8A 1K8GA 2ZVNA 5C0XG 4ABNA 2L8JA 2YTVA 4GKKL 3NRZA 1EY0A 2AQ1B 4BXXH 2GI9A 4AQYQ 2FJ2A 2GBNA 3AN1A 2WV6D 2VQEQ 3I73A 4KK7A 4ZRKA 2HE7A 3QC8B 4JWUC 3QG1A 4AYBG 1V2YA 1Z6HA 4XDDA 4AQYL 3P4SB 1TWFB 4TQ1A 3BZKA 1L0WA 2KHWB 4YXDB 4A3MG 2P5ZX 5FO7B 1V86A 3FILB 3NVZA 1H9SB 3GTJH 4QUFA 3U30A 4YWGG 2NS5A 2B3GA 3SK6A 3TUOA 2EY5A 2F0IA 2KT7A 1T5EA 2QCZA 3LNNA 1SYGA 2OXPA 1X3PA 1JWSD 2ZPYA 4A3DH 1JWBD 3AEFB 4MZ9A 2BGFA 2L1AA 3S17B 1IW7D 1NENB 5C2TB 4EFOA 1XQQA 3BDCA 4LUOA 1GNUA 2CQOA 2MP1A 2IX1A 3AMUA 3RNEC 3NP8A 4K6DA 1ZE3D 2MO1A 4BY7G 3CPFA 1JMCA 3GTMH 3FHWA 3GE8C 2MPMA 1YVCA 1C7YA 1Y56A 1EFWA 3AE3B 4AS1A 5C3EB 2F0JA 4K8IA 3BYYB 5JEAH 3CC2A 5C44H 4ASWC 2ENBA 4A90A 4XWWA 5E6NA 3NENA 4B95A 1L0VB 1WTXA 3AE1B 4ANWA 3OW7A 4S0RA 1I6HB 1VZ8A 2F4VL 2XK5A 1GAQB 4OZAA 2ZTEA 3M4QA 3AYHB 1B2TA 1L7YA 3RR5A 3PLUA 2D2CC 3ULLA 1T5XD 4M8AA 5EPLA 4DV6Q 1FFVA 1O78A 3SR6A 1ZXHA 4KTAA 2IO1B 4A3DG 2B2UA 5HY6A 4XXEA 1IBLL 1IGCA 2WXOA 4NP5A 2ZNVB 3KDFA 1TKWB 3T1HQ 2MJEA 4LDTD 1WJ6A 5FJ8H 3ZLZA 5ELDA 5E6OA 5M3FH 1ZDXA 1X3GA 2PZUA 1PTOF 2UUBL 1E7PB 1WYDA 2G4SA 1IYJB 2CW0D 1YNNC 4DK1A 1WVLA 1QOFA 4JLCA 2E75C 3RLOA 3VYTA 5C44G 2LASA 2WXKA 4BY1H 3A9KB 1K51A 4IQZA 4NKLA 2AX5A 3GTGH 2PI2A 1QILA 1YQ3B 4KHVA 2K9XA 4A3BG 2ZEQA 3ONAB 1UE1A 1OQRA 1WRIA 2Q2IA 1V6EA 4LF5L 2A69D 1HXYD 1ZOYB 2EJFC 1GUGA 2M2LA 5D2MB 4IWQA 3A74A 5BN3A 5KYIA 1VQ5A 1WI5A 3DM3A 1YJIA 4ALPA 4DNIA 4LF8L 2LHEA 2RHSB 3AE7B 4MJSB 1IBLQ 4OIKA 3FPUB 1PGXA 4MACA 5BYQA 4ARIA 2KVZA 2M0AA 2JYEA 3DLLA 1WJNA 3BY4B 3Q8CA 4DR1L 3B0AA 3HHMA 1GUAB 4A3JH 1VQ8A 4LUVA 1DCZA 3GTQB 3A9JB 1II3A 5M5WB 2NBVB 4A3EG 2OEDA 5GMVA 2ATWA 1HCZA 1L2NA 5AJ3L 3QA8A 3F2BA 3QWZB 3TEWA 1SYCA 4A3MB 2L32A 1C76A 4X62Q 5ELFA 1LQBA 3OWFA 2KMMA 1VQ9A 2NBWB 3HKZG 3N30A 4R4IA 3KH0A 2F0LA 4GOPB 2D2QA 1R7SA 1DZ1A 4A3FH 5M3MG 1EZ8A 1SDFA 3A0JA 1SNPA 3VUWA 1C77A 1IP9A 4CDDC 3A56A 3EFXD 1QZHA 1QE6A 1RL2A 3ND9A 4LNIA 2L11A 2J0TD 1J0GA 2PO4A 3G6EA 1QUQA 5DEHA 4N8FA 3URYA 4P6VF 3SD5A 1YNXA 3G6JB 3R2IA 1VRAB 3P7JA 1UAPA 1PMRA 2VQFL 4FJYA 2CS4A 1BOSA 2LXJA 1GJZA 1MGSA 1TS3A 1VQIA 4AP4C 3CAMA 3R93A 2O6VB 4K81A 2DHZA 4KY6A 2F3VA 5IWAL 3VHTC 4FP5D 5C3EG 1OQYA 3VH4B 2INNE 3ZJTA 5E3FA 4Q5VA 2F0SA 1XLPA 1OXUA 2BYVE 3IG3A 4G4KA 1SFOH 2UXDL 3UI3A 4BBNF 2HQEA 2HTHA 3F2DA 3PRZA 1XMQL 5IGCA 4NXNL 3GDEA 1STEA 2PPHA 3HVZA 3GTKB 5M9OA 2BB5A 2V3NA 1CA6A 5H92C 5C23A 2K3UA 4DV7L 1X3FA 2ZTCA 3UI2A 2CW0C 1PUTA 1ZKOA 5LXHA 1K0RA 1MHXA 1A8VA 4H13C 2ASQA 5CHFA 1JJ2A 2JA8B 3RLNA 2D5DA 3OHXC 5CTRC 2JA6G 4X3KA 1CM9A 4F8CB 1WXMA 4F8MA 3QK0A 2V4LA 3RN2A 3DWGC 4G7HC 3EC8A 1ROEA 3HP3A 5C44B 4ZK9B 1WD1A 1OXXK 2QSDA 2WGSA 2VS1A 4HAEA 1YNTE 1TWAH 4L6TB 3CCVA 2KJ6A 4ZKBB 1BKBA 4PV1C 2CKHB 4K14A 1C79A 1PFNA 2IJ0A 2JN4A 1SLJA 1NUCA 3MEFA 3KLSA 4LNFA 3NUHB 3X23A 3N9YC 4FO2A 1FRDA 3O13A 4QY7A 3WIMA 1A63A 3PUXA 5E1FA 3M7NA 4EZLA 3HOWG 4OX9Q 1R4MB 3NZUA 2C60A 3F1ZA 3FDTA 3NBHB 4MNOA 5AFWA 2WU2B 2BE5C 5EKKA 3H9DA 3OLMD 5I2YA 4DN4M 5KNBA 5G3LD 4WWNA 3KWLA 4JI8Q 1EIYB 4R8IA 4YSZB 2X69A 3U4VA 1STYA 1RTNA 3PGZA 2H88B 3ZRFA 4WURA 1S3OA 3GTPB 2WIIB 2VL6A 4LJOB 5CV7A 3TREA 3ICEA 3LJ3A 1UEAB 3Q8DA 1D1IA 1T0RC 2JQOA 4P2CB 3CMEA 3W5UB 3K5NA 1BVSA 2ZJRA 1YNND 1OXSC 3NEMA 2NMQA 1TIFA 4K7SA 2M17A 2MWSB 4J6HA 3RN9C 1IBXB 1WTWA 2LZ6A 4TRDA 1WM2A 2O2VB 4F88A 1TY0A 3APDA 2DYOA 1CFMA 2QILA 4J8QA 3J81i 2JA7H 2K6QA 4BKTA 2IY5B 3NHEB 3UE1A 3GO5A 1WZ0A 4JX1C 3NTHA 1C78A 4AYBE 2YVCA 3WOEA 2XRSD 3GV6A 4G0NB 3BK1A 1QQRA 4MEMA 4NMZA 2WP9B 4B3ML 3Q23A 1J8IA 2EYFA 2EKIA 2NPTB 1F0ZA 5KRUA 1DOMA 3I55A 1HEZE 1BBWA 3M3JA 3AU4A 1ONLA 1WJ4A 4N9F4 1E7VA 4FYDA 1F2RC 3EFCA 2XIWA 1I4PA 1UWVA 5FLMH 4A3BB 4EQOA 3R3MA 3TEXA 1PFSA 1I4HA 2EMSA 2ON8A 1GUWA 4JYAL 2K05A 3DXJC 3KLRA 2BW2A 2PE6B 1FM0D 3B2FA 1Q3LA 1CKNB 3T1YL 4CJ0B 3CCRA 3MWYW 1P16A 1IYUA 2RPQA 4IM3A 1C48A 1X54A 5I2XA 4GS3A 4TVAB 5DCNA 1EYCA 3RNGC 2A8VA 2LMCA 3OMCA 2Y3AA 5AUKA 1E24A 1S72A 2F0HA 1N32L 1GB4A 1BBUA 1H9KA 3U7DA 4DKAC 3Q14C 3HIZA 2JA8G 2I38A 2LI5A 1JWUD 5JJZA 5JJKA 2BOSA 3BJUA 2YU9H 1N36Q 1QLBB 4W9GA 1VQDA 4PK1A 3CCJA 3VUYA 2CQAA 2Q5WD 3GD7A 1LXDA 2PE9A 3S15B 4DXFA 3EN2A 5J39A 4V190 3GTGB 3J80i 4HIMA 4HJ5A 1M90C 1MJDA 1KABA 3X3NA 1N61A 2INPE 2V3SA 1IUEA 2MBQA 3KF6B 4FHJA 2IT1A 3MHBA 2BB6A 4M1UB 3TP5A 1SB3C 1FXIA 4JC0A 2FIDA 4YL8A 5EE3A 2K6DB 4W9JA 4AWJA 4BA1I 4EGVA 2L5TA 2DUDA 2PQAB 1YMHE 1PZID 2JA9A 4A93H 1Q82C 1WYWB 2KD0A 1F9JA 3E9SA 4GLVB 4A3GH 2LGXA 1J5EL 2G3QB 3H94A 5HFYA 4RG1A 1L2FA 4JI4Q 1TWGH 5E6JA 3SHLA 1TWHH 4X65L 1ZEQX 2V0GA 4BBSB 1G2SA 1I50B 1RDPD 4LMQD 4JI8L 1I94Q 1J7AA 2V3PA 5HURA 3DVNU 2ZTDA 3AH7A 2N88A 4LFBL 3G71A 1DM0B 5AZGA 4DAVA 2GBKA 4PMBA 1R4MI 1CZGA 4BBRG 2AKWB 3A1QA 2VQEL 1W6KA 1Y1VH 2XNAC 4A3MH 1IKMA 4NDXA 1DD2A 2N7JA 4EZJA 1KF6B 1ENAA 2R6GA 5C4JB 2IGGA 2DAJA 3ERQA 4RM8A 2A4ZA 2KJHB 4A3FB 3HS0C 1WE7A 1SJHD 3CF6E 4M8MA 3TP7A 3N1XC 1EEID 5I6YA 4G11A 2ZVOA 3LWUA 1WTOA 1UEBA 1KH0A 4MH0E 3MC9A 3WWVA 2NZOA 2YYZA 5BR8L 3ML8A 1NBFC 4AUQC 3SFDB 4AH6A 1WTVA 4XE0A 1WMHA 2MBEA 4NJ7A 5CHWA 5ELNA 3ZKJC 2KJXA 2X8XX 2LUMA 4BY7H 4KV6A 2BVCA 1VQ6A 1SGHA 1U4RA 5KHQA 4EVOA 2PYKA 4X62L 5M5WH 4DV7Q 3TBLD 4HEA1 2L0CA 4AYBB 4H7BA 3PREA 1N36L 1SYEA 1UF0A 1K50A 1ZGUB 2FCMA 2I5MX 4X6AH 1QT9A 2PQEA 2SOBA 2WXIA 1ICFB 2KQ4X 4PZ8A 1WMHB 3NPPA 1LYLA 3S9WA 2K14A 2FIFA 1SFOB 2HDEA 1LTSD 1GB1A 4WJWA 3ABVB 1ISNA 3IT4B 2KAJA 1PYWD 1ACCA 4OZBA 1I6VC 3J81j 5DLQE 1H9JA 5IOCA 3X0WA 2I5LX 2J7ZA 2JRIB 4IALA 1KL9A 3E5SA 5KGUA 5FLXc 2KQ3A 2NPTA 4KSLC 3DHHC 2M56B 1ZKHA 2CH4W 3ENEA 2EYOA 3ZJYC 3AXCA 1XNQQ 5EKLA 4KZ0A 1KDAA 1PFMA 4JI4L 3KJOA 2K01A 1LGRA 5FLXL 4JPBW 2RHQB 4DHJD 2K8CA 1PXUA 1ESRA 3P1MA 2B2UC 4B3RQ 4XGAB 1WY8A 5GAGC 4HIDA 1TYGB 3S1QH 2JYTA 1CQFA 2MA9B 3U4ZA 4JPSA 1GUOA 1WYGA 4GZYC 1NCVA 2M1MA 1TWAB 4MHEA 4DR5L 1XTCD 5FO9B 4OIJA 2KC1A 1K52A 1EQRA 2NWGA 1VLBA 1KLVA 4C3IG 1FJGQ 1PQSA 5IYDH 1E3PA 3AEBB 2L76A 2K75A 1PHJA 4GOCA 2VH1A 4WWMA 1PRTD 3HOYB 2MJ8A 2Y5CA 1BT0A 3VR3A 1OFFA 1M4VA 3D8GA 4ULLA 2NVQB 1XT9B 3ULJA 4OWXB 2GOWA 4ITKA 2UXBQ 4PMWA 3SK8A 4KD3A 1B9RA 3PMFA 4BBSG 4M0WB 3MFYA 2PPBC 5H8YE 5D7GA 1GPXA 5I9PA 1WD0A 4IWPA 3MXGA 1WGRA 3ML9A 2B2YA 5J1ZA 2YTXA 5CV9A 5KYLA 1JOQA 1BO0A 4C80A 1CSQA 2JP1A 3DM1A 3TZUA 4LCDE 3DWPA 1TZ1A 5C4HA 4A3IB 5EE1A 2MLBA 1KNAA 2Q2TA 1PDXA 1HJPA 1S1QB 2PVGC 4JK1C 3J80E 1FEHA 4NNJB 2D11A 2WS3B 1M94A 4KDLB 1WM3A 3GOEA 1XX8A 3JYUA 3J7YW 4A3FG 1B44D 4BFRA 3PZ8A 5IP7G 3TEHB 4LF4L 3I5JC 4FJVB 1XMOQ 4OWWB 3RN5A 5CHVC 4A93B 4N6EB 1O7LA 1CT1D 4FF3A 1F2LA 2JF5A 5K5PA 4RCNA 1YJJA 2AWTA 4H0LC 1YIJA 2N3SA 1PH9A 1Q1OA 2IO2B 5E6PA 1FD7D 1V9PA 3F2UA 5JVG3 1RJTA 3UDGA 3W1YA 1RTOA 4EQPA 3L16A 4BBSH 4DUZQ 3Q6BA 3ZVVA 3ZDTA 1WTQA 2GB1A 4FXCA 5D94A 2EYPA 2MHVA 1I4GA 2PMZE 2LXAA 1KQSA 2BS4B 2PW7A 3RNCC 4WWPA 4LF7L 1K8MA 1XO3A 2ZM6L 3L54A 2KFKB 4QJFA 4DV1L 3T51B 5M5XB 3C3LA 3CD6A 1GC6A 3Q6SA 3APCA 3HKZB 1X56A 3CCLA 2B3AA 3RD4A 5C4JH 4GNXC 3MHZA 1CKMA 2ZT9C 2KUMA 5M3MB 4JL9A 2XGTA 1RM6C 2QGQA 4RM9A 3RULA 2NVXB 2VUMH 3RZOH 1YD8U 5EAYA 3A9KA 3A9JA 5IP9G 3MJ5A 3SDZA 1B7YB 2XN9C 3PO2G 4IZ8A 1H8CA 2RF4A 4ANUA 1LTRD 1PRTF 1KDBA 1EYAA 4HCNB 1TIID 1D2BA 5TSSA 1A3TA 3T53B 2A73B 2EE1A 2N4FA 1TXYA 2NVUI 4QGUA 5EPJA 2DAFA 3AI5A 4X3SA 2B2TC 1C9OA 3KWVA 5E4WC 2WDQB 5J17A 2NTSA 2IW3A 4RNAA 2HIXA 1N33L 1C0AA 4JI0L 5IGDA 2KWUB 3FKIB 3VR5A 3QAQA 5CGKA 1KRTA 3ZTDA 3L7ZC 3PTFC 4NJCA 3S1MB 2R7DA 4FULA 4RCOA 2KACA 3EVQA 5C0XI 3GTLB 2RA4A 1V81A 3AEDB 5DPSA 3WALA 1V8CA 1T0YA 5JH5C 3AU5A 4ZDVA 4GNXA 3VVWB 2ZXRA 3IAYA 4LNNA 4R3DA 4BKSA 1EWCA 5LL6X 1K8AC 2R7ZH 5JHBA 4MGIE 1WR6E 3ZW3A 3HOWH 3N1YC 4DV3Q 3U8ZA 2GBMA 3H7SA 3UDIA 4FA6A 5IA7A 1HZCA 3PO2H 3NQIA 1Y1WG 1ET9A 1I94L 2CHXA 4RHRA 3M9BA 1YZ6A 4CDFC 1EUVB 2RMMA 1YHQA 1MHHE 1K9MC 1MKHA 2M00A 2N9LA 2TMPA 3HRZC 3N52A 1STNA 4R4TA 4YTPB 1I50H 2K5PA 1J5EQ 2F0VA 1I4QA 3C46A 3ZO5B 1D5ZC 5GROA 4PMCA 5J2RA 1WXSA 1JB3A 2E2HB 4POGA 3I90A 5EGTA 5I6WA 3S1QB 5C4XB 1VJKA 5IT9c 3S15H 2EYHA 4OL7A 1MSHA 3L2PA 3FKYA 3BDOA 2Z0SA 5D65A 4TSSA 1HZAA 2ZZPB 1FNUA 2LFNA 1UH6A 3E3XA 1F9PA 3Q22A 3ZNGC 1B53A 5GADC 5AZHA 3S2AA 2JUOA 2F0GA 1RRBA 3K59A 4HJGE 2PNHA 4KKTA 4JI1L 2CCZA 4A3GB 3H09A 3TRZA 3P4RB 5A2QE 1K3BC 4KKIA 3PO3B 2NR2A 2EYLA 2RR9A 2K5VA 3ULPA 2L83A 3A4RA 4XQQA 4IKGA 4DR6L 1VCBA 1RHPA 4K8JA 5LXIB 1J6QA 3CSTA 2Z6KC 4QB4A 2CWAA 3VDZA 3QOJA 1MI2A 3V6EB 4BA2I 2L7RA 1RAXA 4JI3L 1WE6A 1Y14B 3ONSA 2GA4B 1AE2A 4QUCA 1JQ4A 4B3SQ 2B2VC 4URKA 3ZNZB 1QOHA 4L5TA 2LSSA 5FK9C 2ES2A 2PMZB 4IWOA 4OVUA 3W1SA 1NI2A 5LMNW 4LF9L 1L0XB 2Y5PA 1ZYRD 5JHAA 3H1UA 1HNXL 4LF6Q 3T1HL 4EE2A 1VQHA 2HTME 1IZ6A 3HGBA 1IYFA 1E6EB 1KAAA 3A7LA 1IL2A 2VZKD 4B3MQ 3H0GH 1XLOA 2Z4IA 4ZRPA 3IL8A 1UE7A 1VQBA 5E4XA 2AHOB 3DHGC 2IWHA 3T56B 2XVSA 1F9QA 2KX3A 1HQRD 5J18A 2MHJA 2A69C 1EQTA 4IUUA 4G3XB 1WR1A 1KTKA 4HSVA 1AP0A 3NBHA 4YCUA 3QJZA 1AARA 2L0FA 2EY2A 3L13A 1WCMB 1WX7A 3OYYA 5FKAC 4A3IG 3HOVH 1TKGA 1W3SA 2QKIC 3EGRA 1QNUA 2MBOA 3Q3MC 5M5XH 3KUDB 4MJSA 2A5UA 3QIJA 2PW9A 2Z6BA 1W2BA 2IL8A 1CUKA 2HDLA 1YQBA 3CMMB 4TUUA 1N9WA 2IZVB 4HK2A 3W9CB 4WFN3 4IUNA 1LACA 1MJCA 5IGBA 2E2JH 3UDFA 3FPPA 1NDDA 4A93G 2DBYA 1SN8A 4L23A 1JROA 1K73C 1SMYD 2JVCA 5BO4B 1TWHB 4ZAIA 5IGGA 1EQVA 2Q8TA 4FF4A 4HTHA 2BQQA 2PIAA 1ZYRC 3EHVA 2N55A 4RGMA 4IUVA 4KKUA 4W9LA 1ML0D 4K2LA 4YY3Q 3RPFC 5ISRA 1BCPD 4S17A 1YN4A 4IFDI 2KWVB 3S1MH 4ICVA 1WIAA 3SDLC 4DQOC 5D14A 3OIPA 3AE2B 4ZRQA 2DNEA 3A8IE 2MP2A 2DYMA 1C1YB 4GDLA 4J1MA 4USAA 5CC4A 1SROA 3NJTA 5EE0A 3V60A 3NBIA 4JBMA 4X66L 3RCZA 4DPGA 5HGTA 1AYFA 2Q8IB 1XLNA 2KQ7A 2OJWA 1SE2A 3K7UC 3M7GA 4A75A 1N6ZA 2Y0SG 3VDYA 2OQKA 5JAVA 1Y8RC 3DVGY 4PS8A 3WANA 3Q8AA 1QF6A 3JAML 1A62A 1A15A 3CQZB 2F52A 2WXQA 2VZKB 4DNRB 3DQVA 3KF6A 4P75A 4OELB 1FD6A 1S5CD 3SEBA 3STBD 1FPYA 1PH5A 1AW7A 2L00B 2LMCB 1BDOA 1D5MC 1ILQA 2CWPA 4BS9A 4BY1G 3ZQ4A 5LMNL 3OTOL 1FO4A 4K5VA 1UELA 1ZXTA 2EVBA 4DR4L 1YNJC 2K52A 1CQVA 4IOIE 2EY1A 3CRLC 2M8SA 5C1ZA 1ASYA 2A68D 1HZ9A 1FL0A 2VZAA 1HHVA 2IPKD 1LABA 4IC7B 4ILWA 4FF2A 2MQJA 2WINB 3M62B 4CKCA 4A3DB 3OPOA 1SF0A 2GBRA 3RZOB 1E8XA 3HOXH 4II3B 1H9MA 2NN6H 5JJLA 4DK6C 1E8YA 4FBJB 4DV5L 3MVVA 1Y1WB 4B3TL 3MXNA 3I7FA 4X66Q 1EUJA 1QZGA 2BA0A 3H3VH 4IFDG 3GV3A 4XYCA 2INDC 3P42A 4OO1H 2EYJA 3HFZB 3HZXA 4UDUC 1HR0Q 1IPGA 3JSVA 2A68C 3HOUB 3U9SA 1QWYA 3MXUA 3QB3A 1WF9A 2EDGA 3KLSX 2F1MA 4RMFA 1WXAA 2MRPA 3AB9A 3S1NB 1Q10A 1OO9B 1TWFH 5C4XG 1WCMG 4P16A 2AQ3B 2V1YA 2I5HA 4YWKA 4I6NB 2REXA 3JSVB 2DGYA 4X64L 3HVDA 3P4PB 3IFTA 1A0IA 4WORA 3SK4A 3IVFA 1WTPA 5HHDG 1D4BA 3QR8A 3H3VC 3K7AH 3N1ZC 5LMUL 3M3YB 3SU8X 2YV5A 1LM8B 2VUMB 3X3MA 2A5HA 4DNTB 2KVRA 4A3OA 3PLVA 3NZSA 1CHQD 3M4OH 4IW0A 1WGYA 1I3QB 1KC8C 5CX3A 3QWNA 4IFDH 4EKUA 4JI7Q 4KSKC 4US9A 2F0NA 4Z9CB 5T1IA 1R4QB 1E7UA 4KN4C 4JI7L 1QKZA 5AEKB 4ZRIA 4RFBA 2GN5A 1IBMQ 2N9PC 3L17A 5D3IB 3IBEA 4C00A 4LWCA 3GP7A 2JK8A 1OEYJ 2SNSA 2I1JA 4XZ4A 2O2VA 1V8QA 5C4XH 1WCMH 4MGZE 5GAHC 3QJYA 1AWDA 4FDBA 1SE3A 4R4OA 4B0MA 1C9FA 4I65A 2OQ0A 1PGBA 4DHZE 2SAKA 3B08A 3RUIB 1ENCA 3DOWA 3EBEA 3OMGA 2WAQG 4A20A 2JWZA 3K0XA 1HUMA 3HOYG 4W9HA 1AZPA 1VZ7A 1GO3E 3I4LA 2PVOD 4FJZA 2Y0SB 4JE3B 4CYEA 3ECIA 1JMLA 4LJZC 2RD0A 3QX1A 3VYUA 4ZRZA 3R3OA 3OAWA 2FBWB 1YHAA 3Q3NC 3AFQA 5M3FB 1P3QU 2NBFA 1LV9A 1JRPA 4IOCA 4KIKA 4G57A 3CSFA 1Q12A 3D3RA 5G55A 2MEKA 2MCNB 4BY1B 1ICWA 1C4CA 1QVCA 1HUNA 2MBHA 4DAMA 2E3TA 5K36G 1JR0D 1LT4D 1Q8IA 3D31A 2LVPA 1U4PA 3PUVA 1PH4A 4OO1I 4WAFA 3RI7C 3S16B 1Z7TA 3JW0X 4DDID 4N9TA 3VR6A 1UGJA 3U58A 4A8XC 2BDNA 4BZAA 1YBYA 4C3HG 1N8RC 1PH8A 3K5MA 3S14B 1E10A 2BWFA 2K25A 2F3IA 1KNEA 4WJOA 1MJEA 2DWQA 3LB8C 3A4SC 4ANVA 2CU3A 5ELCA 2H89B 5LHY1 1ESFA 1UZXB 3CU7A 1XCTL 1EWHA 2IBIB 2K1FA 2KQSA 1MBYA 3HG9A 3VYSA 2KA7A 4DWFA 1EEFD 1KIXA 1UGMA 3KLWA 2DZIA 3B1LX 3PRMB 1PRTC 1CKNA 1N60A 1CZPA 3I56A 3HOUG 1P98A 3KF8A 1STHA 3DHIC 4FLHA 1NE3A 2KWDA 5G2NA 1G2TA 5C4ZA 3CXCA 2NZ1D 3TDQA 2AQ2B 2DY7A 1VZ6A 4DR1Q 1EOTA 2A6ED 3KDFB 2F0QA 3NSWA 5K36H 2XWBB 5NUCA 1DOIA 1V5OA 4P73A 4QIWE 2WKDA 2CHWA 1XNRQ 4GDKB 5C5LA 4DV2Q 4GN1A 1NEKB 1JE4A 4HWIB 4BKSD 2WYQA 1IBKL 1U4LA 1A3UA 1KFYB 1LTTD 1LTGD 3H6NA 2WXRA 2QA4A 1WFQA 3CF5A 3PO2B 5M5YH 3I4NG 5JPNC 3GQBA 1A2TA 2JJQA 1A2UA 1SNOA 4HJKA 1STAA 2WXLA 4M01A 4DUZL 3IRBA 3L3OC 4G7ZC 1O7IA 3BVMA 2BF8B 1L4ZB 2J53A 2KFKA 2PQAA 4HMIA 1Q0WB 2B2WC 2W54A 3HOUH 2WXGA 2JA5H 1SE9A 2KN5A 5C6AA 4JBJA 4I7AA 1NI3A 3I9V1 3LDZE 1GUTA 1HA6A 3NZ3A 3RNUA 4DV4Q 4IPHA 1JCKB 4RKBA 1V9JA 2RPVA 1VQ7A 4O1NA 4HMJA 1Y8NB 2TSSA 3J80L 1U5KA 1VQLA 4GGQA 5JJIA 4WJ4A 3R7QA 4F87A 4E74A 3HKSA 4KX6B 1QB5D 1VR9A 1N34L 4PS3A 5JVH3 2LGIA 4KHZA 1CJEA 1R4PB 3OJ3A 3A8JE 1HH2P 4HCPB 3RZDH 2RBMA 3PO3H 2FINB 4IPCA 3RMHA 1P8LA 4DAPA 4XWTA 3I4NH 4C1NK 1DOLA 4ZYNA 5E7NA 4A3LH 1NMFA 3DUZA 1Z47A 2N78A 4B08A 3K57A 4BXXG 2UU7A 1HR0L 3ZXVA 4TV3A 4ZUIA 4IO9A 2RDGA 3E56A 4OONA 2JY6A 1S5BD 4ODGA 4XQJA 1I4XA 4E71A 3I4MH 4XTCS 4XIGS 2MP2B 5D3DA 1GXDC 4KKSA 3TBIB 4DU9A 4H44C 3B9JA 4BBNC 2VNUD 3D32A 3HK0A 3MXPA 1X9NA 1QVFA 3A8KE 3BK2A 2PI2E 4F7XA 1XLQA 1HNZL 1S5ED 5BR8Q 1SRUA 3ZIMA 1J7CA 4O42A 4C2MB 4DR4Q 1UE6A 4KHPQ 2ZJDA 5GQOA 4KGSA 3C1FA 5GXGB 3ZUNA 1V49A 1WTRA 1EL0A 4A3GG 1SE4A 2OTJA 3PSEB 1EYDA 5EKIA 3GTOB 2K5NA 1MI0A 2MNAA 4UAIA 1GHKA 4I7ZC 2RCFA 4DXGA 2YEPB 5IT9E 1TWCB 4GLAC 2BA1A 2QEJC 3E0EA 2RGFA 5ELEA 4ANXA 2BDOA 1TY2A 2HD3A 2Z4HA 3MEHA 1Z5SB 3DBSA 2F0FA 4XYQA 1UWXA 2K50A 3PCOB 1PLFA 2NVTH 3I4MG 3SFEB 1IL8A 1TT2A 4ZCKA 3ZXRA 4UP8A 2BCOA 4DV0Q 1P9DU 1BCPC 1Y1VG 3K0YA 3CPWA 2N1WA 3JVZX 3UIOB 1AFPA 1FMAD 3GZNI 2E8GA 1TU2B 3VH3B 5LMNQ 1B3QA 1Y69U 3TJPA 4LFCL 3W5OA 3IXSA 4IUPA 4FXKC 5EDSA 3RMKC 3WAMA 3A55A 4C56C 3PT2B 3FEWX 2KCMA 4KHPL 4LFAQ 3KF8B 2WNMA 3FILA 1DOKA 4QIWB 4KKJA 2F3WA 3M4OB 4CQNA 2WB1E 3OJ4B 5FJ8G 2RCNA 3TQYA 5LMUQ 1SMYC 1L6UA 2EELA 2KHSA 4JGHB 1XNQL 1ZXIA 5M3FG 1G6ZA 1YITA 2OT2A 4CJ1B 5KNDA 2PEAA 3CWIA 4HPLB 3W1GA 5EJWA 1VQ4A 5CMDA 2LD9A 2FMCA 2YU9B 1Z2MA 2F0MA 4PZ7A 2OJRA 3TP6A 2JEAI 2JXTA 4IUTA 4AJWA 3L9AX 1Q1BA 1SYFA 3DBRB 4ZHPA 5AJ3Q 3W3AA 3NVWA 1Q90A 2HJ8A 4L5QA 3VR9B 3K6OA 2KTRB 4LNOA 4A3BH 1TS4A 4FHKA 2AWOA 2CKZB 1EQQA 2N8NA 3Q3JA 2BPSA 1Q7YC 1D3ZA 3V62A 3V2TA 1O7YA 1C4QA 4OVVA 2CR5A 1PTOH 2J4XA 4JI1Q 4GXBA 4JI6L 4HCSA 5C5MA 1VQCA 3Q2AC 1E7ZA 2GVAA 5DNFA 3IFWB 4CHKA 2D62A 3I63C 2UUAL 4II2B 2X38A 1E1TA 1SJED 3PV0A 1EZ6A 3TMEA 1E2VA 4KJNA 5DM63 1HR0W 2KKCA 2M4NA 1KLGD 1VMPA 4IURA 4JI2L 4JV5L 2LGYA 2PMVA 4KVGB 1XCQL 1LFDA 2A6HD 4CGYB 4HRSA 4PT5A 2L05A 4H2AA 2LVQA 3UE0A 1WGHA 1T6BX 1RFKA 2NVYH 3EROA 1BCPB 1K83B 2RSNA 2WAQE 4DR7L 2HQLA 2QDLA 4L8JA 1QZEA 4C3IH 1XTDA 3G7LA 3VTVA 4GB9A 2PCFB 3S16H 2AL6A 1OXTA 2A19A 2K5HA 4NB3A 5IGFA 2MH7A 1WWTA 1OXVA 1FRRA 1EU3A 3LX0A 3PIOA 1LUZA 5LLIA 1F2ZA 3R2TA 2NN6G 4P72A 5DPWA 1Y8OB 1EYGA 2W3SA 5IWAQ 1V5TA 4XC2A 1TWGB 2JT4B 2MX2A 4E3CA 1IKLA 4YTMB 2ZNVC 1IBXA 4G7OC 4FNFA 3DVNV 2OEOA 4ID6A 2UXBL 1WGGA 2JPHA 4WQOB 1MPEA 1VCIA 1BUIC 1EF5A 1ENFA 4U68A 2VY3A 2QEXA 4W9IA 1RODA 4YHHQ 1L6VA 4BOSC 4K6LA 3ZDMC 3D4DA 1KM7A 4NAMA 3I4MB 3SGIA 1BF4A 2UXCL 2DENB 5KNCA 1DOXA 3U9OA 4LF9Q 2C9WB 1YQ4B 3P2BA 3DBLB 2FUHB 3WA0A 4FVMA 1X6OA 2EJGC 1QUQB 1EIHA 5FR3A 3J7AV 2Z8LA 1FYCA 3A54A 3M3YH 1WXVA 2FFKB 4K5WA 4C1NI 3CCEA 4GMVA 4WJQA 2IGDA 3TIXA 1SAPA 4ME3A 1NR2A 4UP9A 4NXML 2G4DB 5G5HA 3A33B 2B2VA 4KD4A 1I3QH 3I57A 5AZFA 3A5ZB 1VQGA 4LFAL 1JQYD 1PYSB 1S5FD 3VA7A 2KENA 1WH3A 2B8GA 3GZNB 5FOBB 2MQHA 5CV5A 2KCNA 3P4QB 4YSXB 2B63H 4NPSA 4QCLA 2BS2B 2WB1B 5JPMC 4LK0M 5IT9L 1AEXA 2KYWA 4A3EH 3AE4B 3DWMA 1WTHA 4KZCA 2NN6I 2OOBB 4WJPA 2MO0A 4DV0L 1BBXC 3S1RB 1EM7A 1HZBA 1UNSA 1V1OA 2HHHL 1ZUD2 2EZVA 3VQIA 3K58A 1S40A 1JWAD 3ITPA 5CV6A 5BMHA 1NNXA 3KFUA 4MSQB 4C4VB 5JEAJ 4Y7NB 3BDLA 2E2DC 2O5IC 4MTKA 1HTPA 1LT5D 1G8ZD 3MA2B 1PFDA 2K28A 2VUMG 3D4WA 2Z6KA 4MIUA 4A3KB 3S2DB 1TT5B 1YJ1A 4NPNA 5IP9H 1EY8A 1HQMC 4XT3B 2F4IA 4BVUC 4JBWA 2YTYA 1NR4A 1B4OA 2NVQH 2E5LL 4WJ3M 1JW9D 1KHIA 2N9KA 4KDIC 4RF0A 1S5DD 1V1PA 3NUCA 1Q86C 2M9VA 5DAUA 2XTIA 2R92G 3QCAA 4C7ZA 1CA5A 2FAZA 3N20C 2RDFA 2B63G 1EY6A 1B9MA 1T0QC 3ALBA 4B3SL 1KAWA 1GUSA 2IO0B 4JIOU 3I70A 4JI3Q 1JRUA 3EUB2 3QHTA 5J22A 4C7YA 4DHZB 2AMCB 1TR5A 1XWEA 1FIQA 4W9DA 4ZHOA 1HFGA 2QCPX 4N8X1 4GN5A 1K8OA 3KW5B 2QMTA 3I8ZA 2KMCA 1GG3A 3CW2C 4DV6L 1C4AA 4EEWA 1VQFA 2BH8A 2I2YA 3TN2A 1FCCC 4GU2A 1V43A 1TKYA 1IW7C 4B9KA 1TGZB 1F2RI 3VA5A 2WDVB 4C3HH 2WAQB 1C8CA 2IY0B 1V97A 5EQ0A 5LL6S 4LF4Q 1VF5C 5HGQA 3Q8FA 1NYRA 2WXHA 1D1KA 1F1HA 4GKJQ 2JSOA 2O6VD 4LFBQ 3ZNHB 3FAHA 2EPBA 3DWQA 3J81L 5HI1A 1N34Q 1D8LA 2CJNA 2WWZA 3GTOH 1A6XA 1WX8A 3MTNB 2D3AA 1WRDB 2ZXPA 3Q0AA 3UIPB 3AEAB 4LDTB 2D3CA 2B2TA 2KX0A 2ASBA 1ILPA 4DFAA 2EY6A 1RWSA 1R9TH 4QL5A 2NVTB 2UWQA 2D10A 3FKIG 1P1AA 1VMCA 2CH4A 2L55A 3IHPC 2NVYB 1F77A 3DEOA 3GTJB 4DV1Q 2G1EA 1YHBA 1MG4A 2A6HC 4HKZE 2I46A 2V4DA 3PUYA 3C8YA 2JQRB 4C2MH 2JU6X 3U50C 4POFA 1B50A 2KANA 4EQNA 4KMUC 3IT6B 2R61A 1NAPA 2PJHA 2L52A 4R8NA 4GSWA 1NVID 2BT6A 4MSMB 3RD2A 1VS0A 2DZKA 5IN7A 4LNQA 4IN3A 2KZRA 1I4RA 5DM73 2WFWA 2EOTA 2W3RA 3VTUA 3U7ZA 4GLXA 4GKKQ 3DWAA 3K80C 1T3QA 2AEHA 3JC66 3WDNA 2KDIA 2K03A 2WLBA 1XD3B 1RYJA 3DBHB 3KQ4A 4N59A 1SNDA 4MGYE 2ZCBA 3TEYA 3PUWA 3GTQH 2ID0A 1XJVA 4A3CG 2CHZA 4JI0Q 4JW0A 2B8FA 1TJEA 2BTEA 4CJ2C 2EQSA 3HM6X 1TZOA 4JG2A 4APVA 4CHTB 5MPOA 3PIPA 4A4IA 3HUIA 1LT6D 2VRRB 5LNK1 5JZEB 4DGZA 3K9PB 4G50A 2RDBC 3KBXA 5EBDA 5G3LF 1E8ZA 1G51A 5DPTA 3S2HB 1JT8A 3T3OA 3PVLA 2F0TA 1PH2A 2LXCA 3QQ8B 4KJOA 4RA8A 4ZKCB 1NY4A 2YEPF 2UU9L 3MTSA 2G9DA 1PFBA 1K28A 2D9UA 2KEDA 2PTLA 4BOZB 1MIUA 5C3WA 4LUZA 2K32A 3PO3G 3H0GB 3I4NB 1WXQA 1AH9A 3AE8B 3TS2A 2EXDA 1SE8A 1RFAA 4DDGD 3MC0B 1EIGA 3EA6A 2XBBC 4XQNA 4A3LG 3BYTB 4GDLB 1N32Q 1DXMA 4LTUA 2UYZB 2KWCA 4DR2Q 2IYDB 3J80c 4FXDA 3OW2A 2KCCA 2QC8A 4WRDA 3CP0A 2C9OA 4ZUJA 4BBRH 3I2ZA 4DA2A 2KOXA 3AE5B 1KDCA 1Y8PB 3C2PA 1QJOA 5KHOA 4F7ZA 1GD7A 1K83H 2BBCA 1C4PA 1L4DB 5L95C 4HN7A 3TMPB 1VQAA 5J3BA 5CORA 1K0SA 2PNRC 4O2DA 3IKJA 4L2YA 2R93H 1W6JA 1FXTB 1U9RA 2KMAA 2D3BA 2JYOA 2B29A 2B2YC 1OGWA 2HJ1A 2K39A 3HOZG 2KEEA 1PH3A 1P0RA 1JJCB 3BIID 1NBWA 4ZRJA 1I5FA 1EWIA 2BH2A 1KLUD 1UBIA 3T3NA 3GB1A 4MTNA 1XPRA 1E0BA 1HTQA 3Q8EA 4DF7A 2KOLA 1NTGA 2ALYB 1YJWA 2WB1G 3O65B 4A3JB 2JA8H 5T1GA 2WU5B 2KFJA 4HIKA 3Q69A 1OTCA 2E2HH 1YX5B 2IDYA 2AYOB 3PRPB 1XYIA 3D6CA 1MVKA 2K8BA 3H7PA 2EMTA 2WXJA 1YNJD 3B2GA 2G9HD 3T4AC 3N3KB 2KLCA 1PRTB 2Q2HA 1S4ZA 4ZLTF 3CCMA 1N5WA 3SR1A 2BYEA 1Q5WB 3G4SA 2KO3A 1XNRL 1E0ZA 2GRIA 3ER0A 4R4QA 2LVOA 2R93G 2JRHA 1BCPF 4W9CA 3UINB 5C3XA 3HOZH 3RNFC 4LF8Q 1TVXA 2IY1B 3CMAA 4HJAA 3I3CA 3PSIA 2K22A 1DGJA 3ZTCA 1IGDA
chains in the Genus database with same CATH topology
2A6EC 1HFNA 2WXMA 3GS2A 4DAYA 5BMIA 3TEZA 3BZDB 2E76C 2D5GA 2HUGA 5JEAG 1HZ5A 1JICA 2ICIA 3P63A 1XF5L 3NWSA 2LHDA 1BMLC 1EY9A 1EWYC 2W55A 3HOXB 3ND8A 2BS3B 4OHJA 1E9MA 4OO1G 4TQUS 1ZDVA 3A7AB 1MSGA 3AE9B 1DYQA 2BYTA 5F2DA 1ZPSA 1CHPD 1J9OA 2A74C 1LTID 3WCQA 4B0EA 3R8BA 3LYYA 1SNMA 2PZWA 5I4DA 2ACZB 4B9WA 4PNYA 3RFZB 4Q2JA 2IX3A 1G91A 2R3ZA 4ME5A 3U52E 2I07B 1G291 1BR9A 1O7ZA 3VYRA 4RGTA 1H9SA 1EFID 2WDRB 3VR4A 3AEEB 2F0KA 3D4RA 4CKBA 2WQYB 4JWSC 1SXTA 3OSOA 3LWEA 2W82A 1O80A 1N5XA 1RKNA 2VB2X 1VDVA 5I9OA 3DHQA 1FNWA 2OF1A 3RUZA 2DN8A 1X3QA 2KDMA 1RF2D 5EPKA 2B39A 2RDHA 3EJIA 5ELBA 2K0PA 2JA7B 4ZQ3A 5CBAE 1IYVA 3NS1A 1LTAD 1B3AA 5FLXE 4Q0FA 1TQOA 1P7EA 2JA6B 3E6ZX 4US8A 1JALA 4YT0B 3PO0A 3RLFA 1LT3D 2O5JC 4RKLA 4FF1A 4XDCA 1UWMA 1F9SA 2AWNA 3Q24A 1L5PA 3K7AB 2JXMB 2B76B 3H6MA 3V3XA 2E2JB 1FFUA 5A2QL 1WGKA 2L1BA 4KGRA 2FE8A 4RH6A 1AN8A 2X6GA 1PGAA 1P7FA 1HTLD 1F2MA 1BXTA 5IGEA 1JORA 1FXAA 3BWUD 3NK9A 4CKEA 2JX5A 4A55A 2SNMA 2SEBD 4TMAB 1DJRD 1NYQA 1PDQA 3D6WA 4MT5A 4C3HB 2R93B 3SVMA 2E6XA 2EXZA 3H8HA 3FRPB 2JEBI 1STBA 2DY8A 5M5YB 4KN7C 3J81E 3CIRB 2HCCA 2FHTA 4OVZA 3PUZA 2JSVX 2K5DA 1DOYA 3W2DA 3FMCA 4RHSA 1LLRD 2XRQD 2K33A 1SBBB 4GLSC 2V4IB 1QG7A 3OIQA 4TQ0A 3AM9A 2X6LA 1PTOD 3OOCA 3AV8A 1SEBD 2RVLA 5CYUA 4WH4A 5CR3A 2NB0A 3TP8A 1YN5A 3AMZA 3CRKC 4FXGC 1GHJA 2KECA 4OZCA 3BVZA 4PQXA 4N9PA 2RQXA 2K04A 2QIEB 1AZQA 2QDBA 1F9RA 2VB3X 4QMGA 5CV8A 1LTBD 3Q8BA 2Q8RE 3NXWA 3KK7A 3DMUA 1SSNA 2IGHA 2AUJD 3FVQA 1J7BA 5KEEA 3FC4A 2WP8J 1FR3A 2QJLA 1A70A 2O2LD 1STGA 3U2SC 3AECB 3QOLA 3C1EA 4BY7B 2KVMA 2F03A 2F0UA 2K5QA 5KIXA 2RSOA 2B2WA 4KY5A 2HDMA 2EJMA 5BMGA 3ZGZA 3ZJUA 3MAQA 4MN3A 2ZW1A 1FCLA 4HCEA 2QF7A 3P1HA 2E2IB 4LK1C 2ICEC 1JC7A 1X32A 5COYA 3NVYA 1PTOC 4N58A 1JWMD 3QIAA 2WXFA 3IAM1 2NTTA 2MUYA 1HA5A 4KGTA 4BWGB 4S3SA 3V05A 3TSSA 2L12A 4C3JB 3PIO3 1SIJA 3PZ7A 4LLGM 5G5GA 3V96A 2K6AA 4R9WA 2O4XA 3NTKA 1Y1VB 3ZJVA 3AE6B 3MP9A 4A9AA 2ONQA 2AUKA 4OGQC 2L4NA 1M8AA 3BS1A 4YIJA 1CK1A 2N0SB 3HOZB 3SXHA 2R7ZB 3J7AF 1KRHA 1SNQA 2E74C 4K5XA 4YTNB 1TS2A 4IDIA 3VRAB 3CKIB 4X3UA 3P20A 3QO2A 1QOBA 4NZLB 1E2WA 4TKOB 1VDZA 4L1BA 1ZP0B 3ZYYX 1NSNS 3NVVA 5BYSA 4XT1B 2J52A 4C3IB 1V1PB 3IAS1 2CHBD 4M0WA 2FMMA 2CJOA 4RGOS 1L0YB 3NE5B 1CZWA 4RAUC 4E6IA 5IIFA 1B9NA 4LAAA 3IFDA 4NW2A 1HRJA 1B1ZA 3AU7A 2ZXOA 2LS01 3H91A 2NUCA 2JA5B 2XWJB 1A3VA 2VXWA 4HKQA 1RCVD 1JOKA 1DONA 4A6QA 2JWUA 2M19A 2ZW0A 2EYMA 1SSOA 3K5OA 4D2KA 4IUQA 1EY7A 3RZDB 1QNKA 1BQQT 1EU4A 2XSCA 1FGBD 3T13A 2NYZD 4XYOA 2F0OA 1D5XC 1U4MA 1HPCA 1XXGA 4YSYB 1QCBD 3JAME 1VF7A 3P75A 3MFGA 4U673 1K53A 3L4PA 2Z1CA 1BNZA 1TS5A 1RD9D 3HRDD 2IX0A 5BN5A 3HOVB 1YN3A 1FNVA 5JXVA 3OWEB 4ZOHC 2WKCA 1H9RA 4HR7B 4B9XA 1JOOA 4V0BA 1F2YA 3HOWB 3SK5A 1QOGA 3VR8B 1PZKD 2LY7A 5BYRA 3KBGA 5EE9A 3NTIA 1PZJD 3N6RA 2LKVA 1SYBA 4MH8A 3CHBD 1WSPA 2BE5D 1I7HA 4ARCA 3LXFA 1BUVT 3BG3A 1EY5A 4REZA 1SNCA 4CBVA 2WXPA 4ZYSA 1GOZA 4KY7A 1OQQA 3ETRA 2K5WA 2K1BA 2PW5A 2L9HA 4OW0A 2R92B 5AUIA 3GTMB 2B63B 4C3JG 2PZTA 3NQTA 1HZ6A 3TZDA 1CTMA 4HSPA 2WACA 1E2ZA 2WXNA 4X3TA 2PLPA 3AB5A 5C0XJ 5EBCA 3K5LA 5CBEE 3I91A 5JOBA 3U4EG 2F0PA 2LEKA 3EQLC 1PTOB 2MGSA 3MZ5A 1ET6A 2K7VA 4L63B 4QF4A 4DK0A 2J42A 4XDXA 1N62A 3PIP3 4AQ7A 4HEDA 3AEGB 2MJ3A 1D6EC 4A3EB 2JE6I 3M85A 4IFDJ 1UUPA 2F0DA 1Q1EA 3VR2A 2LFIA 3HEJA 4RF1A 2LJIA 2PKOA 3KUPA 1XEEA 1GJXA 5C3JB 3DEPA 3SE0A 5A35A 4NAWB 3I72A 1CI3M 2JZPA 3WOFA 4WIPA 5CV4A 5BN4A 2CVRA 5C0XH 1TKEA 2OHFA 2FUG1 3E0JA 3VRBB 2MJDA 1GUNA 1QOAA 2DNCA 2KN4A 2RKSA 3J9CA 4MM3B 1MD2D 4J3OD 4RGNA 2SDFA 3W5VB 4HROA 2F0WA 2H1EA 2HCIA 4KI0A 4BBRB 1R9TB 2C5CA 1EY4A 5FO8B 4K2KA 5HG2A 2F0EA 3NWTA 2H4OA 3BVGA 3M4YA 3NHHA 5IODA 3T16A 4RWSC 1SYDA 5T8IA 1N63A 4WQMA 1LO5D 1IHZA 5C0XG 4ABNA 3NRZA 1EY0A 2AQ1B 2GI9A 3AN1A 2FJ2A 2WV6D 3I73A 4KK7A 4JWUC 3QG1A 1Z6HA 4XDDA 3P4SB 1TWFB 4TQ1A 4YXDB 5FO7B 3FILB 3NVZA 1H9SB 4QUFA 4YWGG 3SK6A 3TUOA 2EY5A 2F0IA 1T5EA 3LNNA 1SYGA 2OXPA 1X3PA 1JWSD 1JWBD 3AEFB 2L1AA 3S17B 1IW7D 1NENB 5C2TB 3BDCA 2MP1A 2IX1A 3AMUA 3NP8A 4K6DA 1ZE3D 2MPMA 1Y56A 3AE3B 4AS1A 5C3EB 2F0JA 4K8IA 3BYYB 5JEAH 4XWWA 2ENBA 4A90A 1L0VB 1WTXA 3AE1B 3OW7A 1I6HB 1VZ8A 1GAQB 4OZAA 1B2TA 2D2CC 1T5XD 4M8AA 5EPLA 1FFVA 1O78A 3SR6A 1ZXHA 4KTAA 2B2UA 4XXEA 2WXOA 1IGCA 4NP5A 1TKWB 2MJEA 5ELDA 1ZDXA 2PZUA 1PTOF 1E7PB 4DK1A 2CW0D 1YNNC 1QOFA 1WVLA 2E75C 3VYTA 2WXKA 1K51A 4IQZA 4NKLA 2AX5A 1QILA 1YQ3B 4KHVA 2K9XA 3ONAB 1OQRA 1WRIA 2A69D 1HXYD 1ZOYB 2EJFC 1GUGA 2M2LA 5BN3A 5KYIA 1YJIA 2LHEA 3AE7B 4OIKA 3FPUB 1PGXA 4MACA 5BYQA 4ARIA 2M0AA 2JYEA 3Q8CA 1DCZA 3GTQB 1II3A 5M5WB 2OEDA 1HCZA 3TEWA 1SYCA 4A3MB 2L32A 1C76A 5ELFA 2KMMA 3OWFA 2F0LA 1R7SA 1DZ1A 1EZ8A 1SDFA 1SNPA 1C77A 3A56A 3EFXD 1QE6A 3ND9A 2L11A 2J0TD 2PO4A 5DEHA 4P6VF 3URYA 3G6JB 3R2IA 1VRAB 1UAPA 3P7JA 1PMRA 1BOSA 1MGSA 1TS3A 3R93A 4KY6A 2F3VA 4FP5D 2INNE 3ZJTA 5E3FA 4Q5VA 2F0SA 1XLPA 1OXUA 4G4KA 3UI3A 2HQEA 5IGCA 1STEA 3HVZA 3GTKB 5M9OA 2BB5A 2V3NA 1CA6A 5H92C 2K3UA 3UI2A 2CW0C 1PUTA 1ZKOA 1MHXA 4H13C 2JA8B 2D5DA 3OHXC 4X3KA 1CM9A 4F8MA 3DWGC 4G7HC 1ROEA 3HP3A 5C44B 4ZK9B 1WD1A 1OXXK 2QSDA 4HAEA 1YNTE 4L6TB 4ZKBB 4PV1C 4K14A 1C79A 1PFNA 2IJ0A 1NUCA 3KLSA 3NUHB 3N9YC 4FO2A 1FRDA 3O13A 3PUXA 5E1FA 3M7NA 3FDTA 5AFWA 2WU2B 2BE5C 5EKKA 5I2YA 4DN4M 5KNBA 5G3LD 3KWLA 4R8IA 4YSZB 2X69A 1STYA 1RTNA 2H88B 4WURA 3GTPB 2WIIB 5CV7A 1UEAB 1D1IA 4P2CB 3W5UB 3K5NA 1YNND 1OXSC 2NMQA 4J6HA 1IBXB 1WTWA 4TRDA 4F88A 1TY0A 2DYOA 1CFMA 2QILA 4J8QA 3GO5A 4JX1C 3NTHA 1C78A 3WOEA 2XRSD 3GV6A 3BK1A 1QQRA 4NMZA 2WP9B 1J8IA 3Q23A 2EYFA 2EKIA 1F0ZA 5KRUA 1DOMA 1HEZE 1ONLA 4FYDA 1F2RC 2XIWA 1I4PA 4A3BB 4EQOA 3TEXA 1I4HA 2ON8A 1GUWA 2K05A 3DXJC 3KLRA 2BW2A 1FM0D 3B2FA 1Q3LA 4CJ0B 3MWYW 1IYUA 1C48A 5I2XA 1EYCA 2LMCA 5AUKA 3OMCA 2Y3AA 2F0HA 1GB4A 1H9KA 2I38A 1JWUD 5JJZA 2BOSA 1QLBB 2CQAA 2Q5WD 3GD7A 3S15B 4DXFA 5J39A 4V190 3GTGB 2INPE 1KABA 3X3NA 1N61A 1IUEA 2IT1A 3MHBA 2BB6A 4M1UB 3TP5A 1SB3C 1FXIA 5EE3A 4BA1I 4EGVA 2L5TA 1YMHE 1PZID 3E9SA 3H94A 5HFYA 5E6JA 3SHLA 1ZEQX 2V0GA 4BBSB 1G2SA 1I50B 1RDPD 4LMQD 2V3PA 1J7AA 5HURA 3AH7A 2N88A 1DM0B 4DAVA 4PMBA 1CZGA 1W6KA 2XNAC 1IKMA 1DD2A 4NDXA 2N7JA 1KF6B 1ENAA 2R6GA 5C4JB 2IGGA 3ERQA 4A3FB 3HS0C 1SJHD 3TP7A 1EEID 5I6YA 3LWUA 1WTOA 1KH0A 2YYZA 3SFDB 1WTVA 4XE0A 2KJXA 2LUMA 4KV6A 1U4RA 4EVOA 2PYKA 4HEA1 2L0CA 4AYBB 4H7BA 1SYEA 1K50A 1QT9A 2PQEA 2SOBA 2WXIA 2KQ4X 3NPPA 3S9WA 1SFOB 2HDEA 1LTSD 1GB1A 4WJWA 3ABVB 3IT4B 2KAJA 1PYWD 1ACCA 4OZBA 1I6VC 1H9JA 5IOCA 2J7ZA 4IALA 3E5SA 5KGUA 2KQ3A 2M56B 2EYOA 5EKLA 1KDAA 1PFMA 2K01A 5FLXL 1PXUA 1ESRA 3P1MA 2B2UC 1TYGB 4JPSA 2JYTA 1CQFA 1GUOA 1WYGA 4GZYC 1NCVA 1TWAB 4MHEA 1XTCD 5FO9B 4OIJA 1K52A 2NWGA 1VLBA 4C3IG 3AEBB 4WWMA 1PRTD 3HOYB 2MJ8A 2Y5CA 3VR3A 1OFFA 1M4VA 3D8GA 4ULLA 2NVQB 4ITKA 4PMWA 3SK8A 4KD3A 1B9RA 3PMFA 3MFYA 2PPBC 5H8YE 5D7GA 1GPXA 5I9PA 1WD0A 3MXGA 2B2YA 5J1ZA 1JOQA 5CV9A 5KYLA 1BO0A 4C80A 2JP1A 3DM1A 3TZUA 3DWPA 5C4HA 4A3IB 5EE1A 1KNAA 1PDXA 2PVGC 4JK1C 3J80E 1FEHA 2WS3B 1XX8A 3J7YW 1B44D 3PZ8A 4A93B 4N6EB 1O7LA 1CT1D 4FF3A 1F2LA 5K5PA 4RCNA 1YJJA 4H0LC 1FD7D 3F2UA 5JVG3 1RJTA 1RTOA 4EQPA 1WTQA 2GB1A 4FXCA 2EYPA 2MHVA 1I4GA 2BS4B 2PW7A 1K8MA 1XO3A 5M5XB 3C3LA 3T51B 3Q6SA 3HKZB 3RD4A 3MHZA 2ZT9C 2KUMA 5M3MB 1RM6C 2NVXB 3MJ5A 3SDZA 2XN9C 4IZ8A 1LTRD 1PRTF 1KDBA 1EYAA 1TIID 1D2BA 5TSSA 1A3TA 3T53B 2A73B 2EE1A 5EPJA 4X3SA 2B2TC 3KWVA 5E4WC 2WDQB 2NTSA 2IW3A 4RNAA 5IGDA 3FKIB 3VR5A 5CGKA 3L7ZC 4NJCA 3S1MB 4RCOA 2KACA 3EVQA 5C0XI 3GTLB 2RA4A 3AEDB 1V8CA 2ZXRA 3IAYA 4R3DA 1EWCA 5LL6X 3NQIA 1ET9A 4RHRA 2RMMA 1MHHE 2N9LA 2M00A 2TMPA 3HRZC 3N52A 1STNA 4YTPB 2K5PA 2F0VA 1I4QA 3C46A 1D5ZC 4PMCA 1JB3A 2E2HB 3I90A 5EGTA 5I6WA 3S1QB 5C4XB 1VJKA 2EYHA 4OL7A 1MSHA 3BDOA 5D65A 4TSSA 1FNUA 2LFNA 1F9PA 3Q22A 1B53A 2F0GA 3K59A 4HJGE 4KKTA 3P4RB 4A3GB 3H09A 5A2QE 4KKIA 3PO3B 2EYLA 2L83A 4XQQA 4IKGA 1RHPA 4K8JA 4QB4A 3QOJA 1MI2A 4BA2I 2GA4B 4QUCA 1JQ4A 2B2VC 1QOHA 5FK9C 2PMZB 3W1SA 1L0XB 2Y5PA 1ZYRD 4EE2A 2HTME 3HGBA 1E6EB 1KAAA 3A7LA 2VZKD 1XLOA 2Z4IA 4ZRPA 3IL8A 5E4XA 2IWHA 3T56B 2XVSA 1F9QA 1HQRD 2A69C 1EQTA 4IUUA 1KTKA 4HSVA 1AP0A 3NBHA 2EY2A 1WCMB 5FKAC 1TKGA 2QKIC 3EGRA 1QNUA 2PW9A 2IL8A 2HDLA 3W9CB 4WFN3 4IUNA 1LACA 5IGBA 3FPPA 2DBYA 4L23A 1JROA 1SMYD 1TWHB 4ZAIA 5IGGA 1EQVA 2Q8TA 4FF4A 4HTHA 2PIAA 1ZYRC 2N55A 4RGMA 4IUVA 4KKUA 1ML0D 4K2LA 3RPFC 5ISRA 1BCPD 1YN4A 4IFDI 4DQOC 5D14A 3OIPA 3AE2B 4ZRQA 2DNEA 3A8IE 4USAA 2DYMA 4J1MA 5CC4A 5EE0A 3NBIA 5HGTA 1AYFA 1XLNA 2Q8IB 1SE2A 3M7GA 5JAVA 3Q8AA 1QF6A 3JAML 1A15A 3CQZB 2WXQA 2VZKB 4DNRB 1FD6A 1S5CD 3SEBA 1AW7A 2LMCB 1BDOA 1D5MC 1ILQA 4BS9A 3ZQ4A 1FO4A 4K5VA 1ZXTA 2EVBA 1YNJC 1CQVA 4IOIE 2EY1A 3CRLC 2A68D 1HHVA 2IPKD 1LABA 4ILWA 4FF2A 2WINB 4CKCA 4A3DB 3OPOA 1SF0A 3RZOB 1H9MA 2NN6H 3MVVA 1Y1WB 3MXNA 4IFDG 2BA0A 3GV3A 3P42A 4OO1H 2EYJA 3HZXA 4UDUC 2A68C 3HOUB 3U9SA 1QWYA 3MXUA 3QB3A 2EDGA 3KLSX 2F1MA 3AB9A 3S1NB 1Q10A 1OO9B 4P16A 2AQ3B 3HVDA 3P4PB 3IFTA 4WORA 3SK4A 5HHDG 1WTPA 1D4BA 3H3VC 3M3YB 2VUMB 3X3MA 2A5HA 4DNTB 1CHQD 1I3QB 3QWNA 4IFDH 4US9A 2F0NA 4Z9CB 5T1IA 1R4QB 4KN4C 1QKZA 4RFBA 5D3IB 3GP7A 2SNSA 1V8QA 1AWDA 3QJYA 1SE3A 4B0MA 1C9FA 4I65A 1PGBA 2SAKA 1ENCA 3OMGA 1HUMA 1AZPA 1VZ7A 3I4LA 2PVOD 4JE3B 2Y0SB 1JMLA 4LJZC 3VYUA 4ZRZA 3R3OA 2FBWB 5M3FB 2NBFA 1LV9A 1JRPA 4G57A 1Q12A 3D3RA 2MEKA 4BY1B 1ICWA 1C4CA 1HUNA 2E3TA 5K36G 1JR0D 1LT4D 1Q8IA 3D31A 1U4PA 3PUVA 4OO1I 4WAFA 3S16B 1Z7TA 4N9TA 3VR6A 1UGJA 4A8XC 2BDNA 4C3HG 3S14B 3K5MA 1E10A 1KNEA 2DWQA 3LB8C 2CU3A 5ELCA 2H89B 5LHY1 1ESFA 3CU7A 1XCTL 1EWHA 1MBYA 3HG9A 3VYSA 2KA7A 1EEFD 1PRTC 1N60A 1CZPA 3KF8A 1STHA 2KWDA 1G2TA 5C4ZA 2NZ1D 3TDQA 2AQ2B 2DY7A 1VZ6A 1EOTA 2A6ED 5K36H 2F0QA 3NSWA 2XWBB 5NUCA 1DOIA 2WKDA 4GDKB 5C5LA 1NEKB 1JE4A 1U4LA 1A3UA 1KFYB 1LTTD 1LTGD 2WXRA 3PO2B 5JPNC 3GQBA 1A2TA 1A2UA 1SNOA 1STAA 2WXLA 3L3OC 4G7ZC 3BVMA 1L4ZB 2J53A 4HMIA 2B2WC 2W54A 2WXGA 5C6AA 1NI3A 3I9V1 1GUTA 1HA6A 3NZ3A 1JCKB 4RKBA 2RPVA 4KGSA 4O1NA 4HMJA 1Y8NB 2TSSA 3J80L 4F87A 4KX6B 1QB5D 1VR9A 5JVH3 2LGIA 4KHZA 1CJEA 1R4PB 3A8JE 2RBMA 4XWTA 2FINB 3RMHA 4DAPA 4C1NK 1DOLA 3DUZA 1Z47A 4B08A 3K57A 4ZUIA 2RDGA 3E56A 1S5BD 4ODGA 4XQJA 1I4XA 4XTCS 4XIGS 5D3DA 1GXDC 4KKSA 3TBIB 4DU9A 4H44C 3B9JA 2VNUD 3MXPA 3A8KE 3BK2A 4F7XA 1XLQA 1S5ED 1J7CA 4O42A 4C2MB 3C1FA 5GXGB 1WTRA 1EL0A 1SE4A 1EYDA 5EKIA 3GTOB 1MI0A 4UAIA 1GHKA 4I7ZC 2YEPB 4DXGA 5IT9E 1TWCB 2BA1A 2QEJC 5ELEA 2BDOA 1TY2A 2Z4HA 3MEHA 2F0FA 4XYQA 1UWXA 1PLFA 3SFEB 1IL8A 1TT2A 2BCOA 1BCPC 3K0YA 1AFPA 1FMAD 1TU2B 1Y69U 3IXSA 4IUPA 4FXKC 3A55A 4C56C 3FEWX 2WNMA 3FILA 1DOKA 4QIWB 4KKJA 2F3WA 3M4OB 4CQNA 1SMYC 1L6UA 2EELA 2KHSA 1ZXIA 1G6ZA 2OT2A 4CJ1B 5KNDA 3CWIA 5EJWA 5CMDA 2FMCA 2YU9B 2F0MA 3TP6A 2JEAI 2JXTA 4IUTA 3L9AX 1Q1BA 1SYFA 4ZHPA 3W3AA 3NVWA 1Q90A 3VR9B 3K6OA 1TS4A 2AWOA 3V2TA 1O7YA 1C4QA 1PTOH 2J4XA 4HCSA 5C5MA 5DNFA 2D62A 2X38A 1SJED 3PV0A 1EZ6A 3TMEA 1E2VA 4KJNA 5DM63 1KLGD 1VMPA 4IURA 2PMVA 1XCQL 2A6HD 4CGYB 4HRSA 4PT5A 4H2AA 1T6BX 1RFKA 1BCPB 1K83B 2RSNA 3EROA 4L8JA 3G7LA 2PCFB 1OXTA 5IGFA 2MH7A 1WWTA 1OXVA 1FRRA 1EU3A 3LX0A 1F2ZA 3R2TA 2NN6G 1Y8OB 2W3SA 1TWGB 1IKLA 4YTMB 1IBXA 4G7OC 4FNFA 2OEOA 4ID6A 1MPEA 1VCIA 1BUIC 1ENFA 4U68A 1RODA 1L6VA 4K6LA 3D4DA 4NAMA 3I4MB 1BF4A 5KNCA 1DOXA 3U9OA 1YQ4B 4FVMA 2EJGC 1EIHA 5FR3A 3J7AV 2Z8LA 1FYCA 3A54A 2FFKB 4K5WA 4C1NI 2IGDA 1SAPA 1NR2A 5G5HA 3I57A 2B2VA 4KD4A 1JQYD 1S5FD 3VA7A 2B8GA 5FOBB 5CV5A 2KCNA 3P4QB 4YSXB 4QCLA 2BS2B 2WB1B 5JPMC 4LK0M 5IT9L 1AEXA 3AE4B 3DWMA 2NN6I 1BBXC 3S1RB 1EM7A 1UNSA 1V1OA 1ZUD2 2EZVA 3VQIA 3K58A 1JWAD 3ITPA 5CV6A 5BMHA 5JEAJ 4Y7NB 3BDLA 2E2DC 2O5IC 2DLBA 1HTPA 1LT5D 1G8ZD 3MA2B 1PFDA 2K28A 3S2DB 3D4WA 4MIUA 4A3KB 1EY8A 1HQMC 4XT3B 2F4IA 4JBWA 1NR4A 1B4OA 1JW9D 2N9KA 4RF0A 1S5DD 1V1PA 3NUCA 2M9VA 5DAUA 4C7ZA 1CA5A 2RDFA 1EY6A 1B9MA 1GUSA 3I70A 3EUB2 4C7YA 5J22A 1TR5A 1XWEA 1FIQA 4ZHOA 1HFGA 2QCPX 1K8OA 2QMTA 3I8ZA 2I2YA 1C4AA 3TN2A 1FCCC 1V43A 1TKYA 1IW7C 1F2RI 3VA5A 2WDVB 1C8CA 2WAQB 1V97A 5EQ0A 5LL6S 1VF5C 3Q8FA 1NYRA 2WXHA 1D1KA 2JSOA 3FAHA 2EPBA 3DWQA 3J81L 5HI1A 2CJNA 1A6XA 2ZXPA 3Q0AA 3AEAB 2B2TA 1ILPA 4DFAA 2EY6A 1RWSA 2NVTB 1VMCA 2L55A 2NVYB 1F77A 3DEOA 3GTJB 2G1EA 2A6HC 4HKZE 2I46A 2V4DA 3PUYA 3C8YA 2JQRB 2JU6X 1B50A 4EQNA 4KMUC 3IT6B 2R61A 1NAPA 2L52A 4R8NA 1NVID 2BT6A 4IN3A 1I4RA 5DM73 2EOTA 2W3RA 3U7ZA 2WLBA 3DWAA 1T3QA 3WDNA 2K03A 3KQ4A 1RYJA 4N59A 3TEYA 1SNDA 3PUWA 2ID0A 2B8FA 1TJEA 2BTEA 4CJ2C 1TZOA 5MPOA 4CHTB 3HUIA 1LT6D 5LNK1 4DGZA 3KBXA 5EBDA 5G3LF 3T3OA 3S2HB 2F0TA 4KJOA 4RA8A 4ZKCB 2YEPF 2G9DA 1PFBA 3MTSA 2D9UA 2PTLA 2KEDA 5C3WA 2K32A 1WXQA 3H0GB 3I4NB 3AE8B 3MC0B 1EIGA