3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
b'EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC80376 protein
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
molecule tags Immune system, signaling protein
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
4ZTMA 4Y8DA 3R0TA 4D1ZA 1OM1A 2YM8A 4U42A 4A06A 2ZOQA 2KZRA 2WOUA 4H39A 3QD2B 4R7HA 3PIZA 5AX9A 2YAKA 4EC9A 5IH5A 3KK9A 5LOHA 5F4NA 2VO3A 3ML9A 3NYOA 1PXJA 3CD3A 2Z2WA 4KVGB 3ZLZA 3FXXA 2WKMA 3BWJA 4HK2A 3FLYA 1TBEA 1RW8A 3KGAA 3GU8A 4IC7A 2KDBA 2KXJA 3M63B 4JDJA 4GDLB 4IZAA 4AZTA 3C0GA 2BDJA 3BCEA 5KHXA 2JFLA 3NSZA 4ZLZA 1VYWA 5E1EA 4KS8A 3DFAA 4EOMA 5J1WA 2D3GA 2RFNA 5FXSA 2UZWE 5J95A 3BY4B 4ANXA 4FKVA 3PY3A 3UIUA 4ASZA 3VUMA 2B9FA 3Q53A 1Q8WA 5AJQA 3EFWA 4RIOA 4Z3VA 2J0MB 4BICA 4I6QA 2WTKC 4OTWA 1WJUA 2PZYA 2UZLA 4DHJD 4JQEA 1VD2A 2DAJA 1IP9A 4K9YA 5IDPA 4RC4A 3E8NA 3Q3JA 4OUCA 5CEMA 2V1YA 4OTHA 2QOCA 5CEIA 3PIYA 5TR6A 2XM8A 3W2CA 3FLZA 2J9MA 5GMVA 4WWOA 5EW8A 2X8EA 2YDJA 3A7HA 5DOSA 3OY1A 3NZSA 5AV0A 3AC8A 3DPKA 3KXHA 2V7AA 3VBTA 2CPKE 2J51A 3Q4ZA 2BRMA 5AIRA 4I0RA 4TWPA 2RFEA 3S1HA 1OEYA 2VTOA 3CSFA 2JD5A 2WMQA 3ULIA 5J17A 4AOJA 4EK5A 2BWES 3RPRA 3W55A 3W32A 4NU1A 2JFMA 4USDA 4JX7A 4HVDA 2HWOA 1RE8A 4L46A 1F5QA 2ZMDA 1EO6A 4RJ3A 4AAAA 1TQIA 3ITZA 3S0OA 4GDKA 4IG7B 3ML8A 2KTYA 5BVKA 5KHWA 4X2FA 3MSSA 1C1YB 2CHWA 1X1MA 3D2IA 1P2AA 3PXZA 4AZEA 4AOFA 2F9GA 4KNBA 4FZ7A 4E5AX 3OXTA 2LVPA 4IWQA 2WDTB 4WJPA 4MBLA 3GGFA 2O6VD 5HOAA 5JK3A 5L8JA 2HYYA 3FY2A 4QMOA 2RF9A 5ANKA 1BUHA 4QTBA 1JAMA 2YCQA 1IASA 3AMBA 3IVFA 3DBDA 2BAQA 3QYZA 3APCA 5CAVA 3UGCA 4PS8A 5AP3A 1XO2B 4RC2A 4X2KA 4ACDA 2BILB 3F82A 4G6NA 1ZYSA 4EOQA 4U80A 4FF8A 2ZM4A 3QTXA 4HVIA 5KMKA 3F61A 3R7UA 4EZ7A 1SGHA 5FM2A 4GIIA 2FYSA 2UZTA 2E9OA 4M7IA 3W1FA 4PRJA 3EFLA 5CVHA 5A9UA 5JZJA 3BYSA 3LXLA 4CKRA 4D55A 4D4YA 1E8ZA 4M0WB 2VTRA 3CGFA 3F3ZA 5AV2A 3F3UA 4OR5A 2QOKA 2BCJA 3QA0A 2HAKA 3CJGA 5EYDA 5IPJA 3PA3A 3ZFMA 3UGBB 1H1PA 1PQSA 1CM8A 4O0VA 2HOGA 1YDTE 3NZ0A 5G6VA 3ZSIA 3QX4A 5CU2A 4DK5A 3ZO1A 4YTHA 4HNFA 4AJWA 3I6UA 4GCJA 3KY2A 1IPGA 4IB1A 4J1RA 2ZNVB 4MELA 4C58A 3HECA 3KN5A 4FTTA 2ACXA 2JDOA 3CGOA 2BPSA 3GC8A 4FIHA 2GCDA 3UPZA 4X21A 4FGBA 4MXOA 3R66C 2ZM3A 2IZTA 3DJ6A 2C7MB 3RPOA 2ITPA 3QQUA 2NR2A 3L16A 4CCUA 4DDGD 4URKA 2GTNA 4NJ7A 4EZLA 1ZY4A 4FMQA 1BT0A 2EUFB 3OMVA 3UOHA 3FLNC 3II5A 4FG9A 3QGWA 4O0RA 1YVJA 2GNIA 4FKPA 4Y72A 4BWKA 2BALA 4BDAA 4QOXA 3GU6A 4X3FA 2Y0AA 4FIIA 5AUVA 2LUEA 3WAPA 5DEWA 2O2UA 3U6HA 2XNPA 3FUPA 3QTQA 2FCQA 3ZM4A 1XBAA 5IH4A 4FV8A 3ALOA 4KSLC 3T3VA 1OKYA 3K9PB 2CLQA 4X57B 3E8EA 3AXWA 2XK6A 2D2QA 3AD6A 2VWBA 4TQ1A 3PE1A 4O21A 4QP4A 3RKBA 1XHAA 5LQFA 4BBFA 2XBAA 2NS5A 2GFCA 3U4WA 4FI1A 1U54A 1V0BA 5JN2A 3ZO2A 4OBOA 2UYZB 1RDQE 5AZGA 3DK7A 4DEHA 3ORZA 5IA7A 2W1EA 3LFNA 3F3VA 3BHYA 3BU3A 4MWHA 4QQ5A 5AWMA 4NTSA 2KDIA 3GXLA 3VS5A 1KE7A 5KBRA 3M3JA 3R7GA 4IVBA 3H9OA 3KF4A 4IEBA 3RAHA 3VWAA 2BR1A 2QR8A 4I6HA 3REPA 2PSQA 2MBQA 2YM3A 2ZV7A 4U8ZA 4BDCA 5IG1A 4DH1A 4R3PA 4QMUA 4G9RA 3TNQB 5LMBA 3WARA 2PVNA 3IONA 4TYGA 4W9DA 4IANA 2HY0A 3D15A 1WM3A 4AA5A 2JBPA 2YLEA 2XNEA 3D94A 3KXMA 4I41A 5AP0A 1LM8B 2C30A 2XYNA 2WD1A 3H7PB 2ITNA 1OECA 3NW6A 3PVUA 2IO2B 3TI1A 2ZYBA 3FMJA 3R21A 2R2OA 4FSRA 3QALE 4FNYA 3PG1A 3PFQA 4BBNC 2B3AA 5KMJA 1FGKA 3HDNA 2DX5B 4DH3A 5A6NA 1L2NA 5EDSA 2MLBA 4NAWB 3FI4A 3F7ZA 3CEKA 2HTHA 3A99A 1OI9A 4FG8A 3ZKJC 3D7TB 2XB7A 2GBMA 2XKFA 4IVDA 1R39A 5K4JA 2GMIC 5D9HA 5TOZA 4GT4A 4ALWA 4DXAB 4RIWB 4GFOA 5HEZA 5IKWA 3R9NA 4FA6A 4BIDA 4O0UA 4L01A 3NS9A 3Q9XA 4P90A 5D7VA 4YTCA 4J99A 3ZRFA 4EEWA 1YOLA 5TO8A 4EHZA 2QOQA 4LQMA 4M68A 1IG1A 3A7JA 4QMVA 3OAWA 1QPJA 2GHMA 4GYIA 4O27B 1V9JA 2Z8CA 3CY2A 2OJJA 2XJ1A 2WU6A 2F7EE 1H28A 4J53A 4ZP5A 4J71A 5AP6A 4YJRA 5ANDA 4GFMA 4LGDA 3SQQA 5HTBA 5HICA 5JGDA 3TUCA 4AGCA 2C5XA 4GN1A 3SRVB 4U7ZA 4MGKE 3RCJA 4P5ZA 3ZLXA 4KIQA 4P5QA 4YZDA 3F2NA 5EW3A 3SOCA 4RJ8A 3VIDA 5KMIA 3Q96A 5E8WA 5D2MB 3KU2A 2QHOA 3TTJA 4PDSA 4ANUA 3GOPA 3VRZA 4BFMA 2NPQA 1OB3A 3EQPA 3JY0A 3OBGA 4BKYA 2OF2A 5BX0A 1KE8A 4WUNA 1WY8A 5HKHA 1Q61A 3SKCA 3QAQA 3GVUA 3P86A 1DS5A 4K18A 1M2PA 3FMMA 5JFXA 2YIRA 3NX8A 2UW5A 1OEYJ 5TF9A 4N6YA 5LCJA 3BGQA 3EQHA 5KE0A 4MXYA 3DQVA 4FT0A 5J9ZA 4C2VA 5JEBA 3LZBA 3LXKA 1UBQA 4FTNA 2A5UA 3AXCA 4G0NB 3QZFA 2KTFA 2LGDA 4EHVA 3ZNZB 3R8LA 3PZEA 5AUZA 2WQEA 2X8DA 2ZEQA 2JDVA 2QU6A 4EBWA 3FZ1A 1H8FA 2OZAA 2XJ2A 4L45A 5CQUA 4IXPA 1KE6A 2GS7A 5EH0A 1VEBA 3BYVA 1WJ6A 4HDQA 3GCQA 4QMWA 2HW6A 4RVMA 3VUGA 5C1ZA 4K11A 3S3IA 4BFRA 5FEQA 4DFZE 4ZRKA 3V6EB 1B39A 3TUBA 4BVUC 3HMPA 4QP1A 4TWOA 3G2FA 3D32A 1W83A 2QOLA 3OFMA 3ENHA 3LM5A 4ANLA 3ZO5B 1VZOA 2B1PA 3FKLA 3TZ7A 4FT9A 1TKIA 5AR7A 4S34A 1JKLA 4DBNA 3C0RB 1PW2A 2W5BA 1WE7A 2XK5B 4FV4A 5B2LA 2BVAA 3IO7A 4LMNA 2K1FA 4F4PA 3CXWA 1P4FA 2B7AA 5EI6A 4E74A 1OZ1A 2ITZA 1SVHA 4J98A 4QYFA 4BZNA 3ZLSA 3FMHA 3AU4A 2B52A 4WAAA 2FSOX 5JZEB 4C3FA 4FVPA 4FX3A 1E7VA 4X2GA 2JXXA 4B7TA 3PPAA 5DRDA 4ANNA 4EOJA 3S00A 2VTIA 2XCHA 3D9VA 4MQ2A 4J6IA 2R0UA 1PMEA 4YJOA 3P79A 1WVXA 3KULA 4O38A 5FP6A 4BYJA 4UMRA 5DCNA 4ZTNA 3WIGA 5D12A 2C60A 4YJQA 4YJUA 2GBNA 3TT0A 2F57A 4UWYA 1KWPA 1UU3A 5DR9A 3G90X 4A9TA 4CFXA 3AGMA 4ANWA 4RIXB 3E87A 2X7GA 2R7IA 4HYUA 4I23A 3DA6A 4A9SA 4M8NA 2EB3A 3ZTXA 3TKHA 1XR1A 2B9IA 2XS0A 3BE9A 5EG3A 5LVNA 1KLVA 4H1MA 4MNFA 1WX8A 3EQRA 4FJZA 2J7TA 5HIBA 5LJJA 3D5UA 2VTJA 3EMGA 4MD7E 4CYIA 3M11A 1M2RA 5D1JA 3H7SA 2BFYA 1WXAA 2A0CX 4CFWA 1ZZ2A 2W0JA 5DH3A 3BYUA 3BLQA 4C02A 4B95A 5CU4A 4D4SA 3UIOB 1SZMA 3ZZEA 5HNBA 2DYBA 4WJNA 3OCTA 2XIXA 3DNDA 2N9PC 2ZZPB 4BBEA 4L3JA 4KKGA 4EK3A 4EBVA 2VO6A 4EH8A 3TUDA 3PRPB 3DAEA 1B38A 3A7IA 4F0GA 2IY0B 3LFDA 1JVPP 3QWKA 4HGLA 3ZO4A 4XG6A 3UIMA 1C3TA 3M42A 1M94A 4EZ5A 1XQZA 3Q32A 4NZWB 3VN9A 5CNOA 4ZEGA 2ZPYA 5G1XA 4JR7A 2WMVA 2KVRA 1ZYCA 3V5TA 1ZYJA 2H9VA 5CF6A 4MX9A 3FSFA 4EOPA 1JKKA 1V1KA 4R1VA 4CCBA 3NNWA 4OTDA 1JNKA 1RQQA 1OUKA 3R7VA 3WF5A 2AWTA 2K6DB 4LDTD 3U9CA 3E62A 4FSQA 4C8BA 4RQVA 3E63A 3OTVA 2GHLA 4ZTSA 5C8NA 4TY1A 4BDGA 1A06A 3RHKA 4PTCA 2EMSA 2OGVA 2KNBA 3C51A 5C8MA 4AUAA 5J79A 4O6EA 1ZYDA 4F9YA 5FEEA 5AX3A 1BI8A 3UBDA 4C7TA 2K8BA 3MV5A 3A61A 3MH3A 5K3YA 3K5UA 4GU6A 1P3QU 3ZVVA 3UQBA 3MY5A 1S9JA 2RIOA 5KMOA 3QWZB 3FQEA 3OJ3A 5ETCA 2Z0DB 4DWFA 4HCVA 4XLIA 3W1SC 2PMIA 4FOCA 3GCPA 3LJ1A 4OW8A 4I6FA 2O65A 3V6RA 4DEDA 3Q9YA 4WWNA 2LXAA 4BCPA 3T9TA 3UYTA 1UVRA 3VBVA 4CD0A 2MQJA 3DK6A 4M3QA 4ASWC 2BYEA 4K6ZA 4NM3A 4AQCA 4JRNA 4EJNA 4F09A 2G45B 1E90A 2JDRA 5IEYA 5LCKA 2L3ZA 1J91A 3QXPA 2LAVA 4KDLB 4MGZE 3U7DA 3OEZA 3TCAA 4OVUA 4EKUA 3L08A 3MWUA 2BRBA 4IX4A 2PE6B 5C1QB 4GJ3A 4ZLOA 4F08A 2ZDUA 3OG7A 3BLRA 1LP4A 1QPEA 2HELA 1P4OA 2OZOA 2OKRA 4FT3A 4PDPA 4RWKA 4BHNA 2OICA 3BYOA 4IQ6A 4IM3A 1BKXA 4UWCA 2W1CA 4LI5A 5E8VA 4BI2A 4MJSA 3OF0A 1O6KA 3PXRA 4EKKA 3Q60A 3OWPA 5ANIA 3O8UA 4MEMA 5HD7A 1JPAA 1KV2A 3RAIA 1YDSE 4D9UA 1P98A 3GCVA 4IVCA 4L67A 4FTMA 2VX1A 3IOPA 3KC3A 4H3PA 4XMOA 4N4SA 5ACKA 4PYUA 2YWPA 2GS6A 3UNJA 2C5VA 2UZUE 3W2OA 5FXRA 5JRQA 1WZYA 3ENEA 4CRSA 1ZMUA 5LXIB 5AIKA 5JGAA 4EK4A 2AYOB 1JWHA 2RKUA 2H96A 2R2PA 2VTTA 4L9IA 4U6RA 3WIKA 2OO8X 2H8HA 4HPLB 3I4BA 2N9EB 4FIJA 4RWIA 5CNNA 4NNJB 4KS7A 3PIXA 1PXNA 1UNGA 3ZUUA 1B6CB 4BDJA 4FN2A 4CZTA 2C5YA 5L2TA 5D10A 3OC1A 3FE3A 3VUKA 2MP2B 5LMKA 3O8PA 4V0GA 4JDHA 2C5NA 1UU8A 3IW6A 3LFFA 2JRIB 3DOGA 3QF9A 4C2WA 3UVPA 2Q0BA 2UZEA 3OCGA 5K5XA 3FLWA 2ONLC 3PS6A 4F99A 4I93A 3HZTA 4RX8A 2GQGA 2LRWA 2OFVA 1G5SA 4AP7A 4PF4A 2C0OA 3ORNA 2GBKA 3QX2A 3GBZA 4BDBA 3BHHA 5DPRA 1JKTA 4II3B 2PVLA 4DFYA 4G6LA 1PXIA 5KMLA 3PJ3A 4QP3A 3WYYA 5AUTA 3QJZA 3FI2A 2GSFA 4N6ZA 4NJDA 2WPAA 1YOMA 4PQNA 2RFSA 3TIZA 4EHEA 1Z5SB 3DVGX 2CHLA 2GFSA 3DFCB 3PA4A 5H8BA 3UMXA 5A6OA 4APPA 3PT2B 3TJPA 3C4EA 4WOVA 3VUXA 5IA0A 2DS1A 3ZXZA 3KVXA 3FV8A 4FG7A 4KKHA 3ZTDA 4UV0A 4XG8A 3GT8A 1H00A 4TPTA 1H8CA 4Q5EA 4O96A 5FG8A 4B6WA 3W2RA 3AMAA 1OMWA 2PE9A 4F9AA 3A9KB 3X0WA 3FKOA 4BDFA 5FP5A 3KXZA 2GNHA 4JL9A 4KA3A 4ZJIA 2YM4A 3BQCA 3UJGA 4D2WA 3DCGA 4RMAA 1PF8A 3V3VA 2HJ8A 5HTIA 5C27A 3DDPA 3EN6A 2RPQA 4NY0A 3MTFA 3QTSA 5HU3A 3VH4B 4FTOA 4E71A 4GG7A 4MXXA 5JRSA 5AAGA 3UOJA 4LRMA 3ZH8A 3R1SA 1Q4LA 3P23A 3P5KA 4C36A 2AL3A 2I1MA 3NUYA 3POOA 3ZO3A 1RLFA 2X9EA 2KX0A 4R8QA 5HTCA 4K7WA 2UVZA 3UF8A 4JJRA 4F0IA 2UVXA 4HGTA 4JS8A 3APDA 2XNOA 3VS1A 4FT7A 3OCBA 4GK2A 4GV1A 3U6IA 2UW6A 3KKVA 1WGRA 4D5HA 4W9EA 3IGOA 3NAYA 4HPUE 2R64A 4NQKE 1WRDB 3U51A 4YC6A 3BLHA 3KXXA 4WD5A 3H1UA 2VD5A 3LCTA 2WTWA 3AMYA 5GJDA 5T68A 5L2QA 4KSQA 3RINA 4YZBA 4BCQA 2P3GX 4BIBA 3HKOA 2PPHA 3WALA 4D1XA 1SIFA 3BEGA 4F9CA 4E4XA 5HNGA 2V0DA 4PMTA 2IN6A 5JFVA 3VHTC 3DLSA 1YQJA 2VUWA 3NWWA 4KRCA 4QYEA 3QZGA 4JI9A 3VJNA 5AV4A 2XA4A 5JKGA 2IVUA 2C5OA 1XQQA 4I94A 4M13A 4LV5A 4AGDA 2CHXA 2IO3B 4O2ZA 2QD9A 3EHAA 4AF3A 2LRUA 4CO7A 2F2UA 4IM2A 3EH9A 4WQOB 3QC9A 5AP2A 2LVQA 3JXWA 1E5WA 2I0HA 1CTPE 2JDTA 2GNJA 3NUUA 4PV0A 3QRIA 3SDLC 4IE9A 2XBBC 3JVZX 1KSWA 2Y7JA 4EKLA 3DOWA 3H9DA 5C03A 4E1ZA 2YIQA 2QKRA 3C9WA 3QA8A 4RC3A 4CYEA 2VNYA 5IEXA 3IGGA 2KDEB 2C3LA 3WZJA 4EOYA 4RGJA 3RWQA 2ETRA 5HVKA 3HRBA 3LW0A 4Y83A 4DTKA 3FY0A 4F64A 4F70A 1O6LA 4NIFA 1LFDA 3UIBA 2ZVNA 1WXVA 1PXPA 3QK0A 3UTOA 3AC3A 5CZIA 5J7BA 1YD8U 3QRTA 4NK9A 3ZOSA 3A8XA 3EFKA 3R01A 4DDID 4FHKA 2UZOA 3KVFB 4L42A 3SXRA 3W18A 3ODYX 3I7CA 3JYAA 3NCZA 4JNWA 4TRLA 3IW4A 2O3PA 1W0XC 3PG3A 4AXAA 4ZJJA 2YM5A 3WZKA 4DGGA 4E93A 5D6JB 3FKNA 3DAKA 5IMEA 1OGWA 4W9IA 4FZAB 1OGUA 3MB6A 3ZS5A 4IZ5A 4XJ0A 3UDBA 3F88A 2GS2A 2IVSA 4HCUA 3BZ3A 2ZAZA 3E3PA 3QD3A 3LIJA 3ORIA 2B55A 4GDKB 3VF9A 2HWPA 5CAPA 3NUPA 2UUEA 4QYYA 4MBIA 3UOKA 4BZOA 1H1QA 2OIQA 1AARA 1WJNA 3ETAA 3KW5B 4EUTA 3HRFA 5D41A 4ZTHA 2IW9A 5J7HA 2GBRA 3OT3A 4JG6A 4AT4A 3ORPA 3DKFA 4UMUA 1SYKA 2NBWB 4G34A 4PL5A 4ENYA 5IMXA 4IX5A 2WTIA 3CF6E 3IK3A 4L7FA 4CFNA 4U5JA 3I79A 4NEUA 4Q5HA 4EH9A 3B0AA 3MY0A 4KSPA 3OJ4B 4C35A 4RT7A 4G50A 2Z7QA 4QP9A 4YP8A 4B6LA 5JSMA 3MGYA 4XRJA 4DEGA 4FV9A 3AD5A 3OY3A 5E90A 3VUIA 2GNGA 2GU8A 5EKNA 5HE0A 4DBGA 2OF4A 3TV4A 1Z9XA 2UW0A 4BTFA 3I0QA 4KRDA 4S2ZA 2J0JA 3EL7A 1R4NI 4NW5A 2XIZA 3SVVA 2VTPA 3UQCA 4OTIA 4J95A 4FL3A 2BHHA 4LRKA 1TTNA 4BBNF 1R3CA 2Y5BB 4CHKA 5JH6A 1J1BA 2BKRB 3SOAA 5AUYA 4DC2A 2A19B 1ZZLA 3P78A 4FV1A 4YZ9A 3CBLA 3W2SA 2KFJA 3VQIA 3WI6A 4JR3A 1STCE 4HVHA 3S2AA 1PHKA 1WVWA 3A4OX 2IJMA 2UZBA 3LQ5A 2VWIA 4EQMA 3LM0A 5CF8A 2M4NA 4IW0A 4V04A 4NSTA 2LZ6A 4FT5A 3M2WA 3N51A 4DG2E 5KKRB 4L3LA 1UV5A 4BCIA 5DR2A 5EKOA 4CZYB 2ZVOA 3PRZA 3C4ZA 3E8DA 2G2FA 3COKA 3E7VA 3RHXA 4W8EA 1S3SG 3MFUA 4HWIB 3KEXA 5HBHA 3VS0A 5DVRA 4ALUA 5HX8A 3IFWB 2YN8A 4B9KA 4KINA 3FMEA 3ANRA 1SMHA 4NJ3A 4ONAA 4MK0A 4WNPA 3VTWA 4IC8A 4F6UA 4YZNA 4AZVA 4FTKA 3RALA 5HLPA 4CLIA 3HDMA 4BRXA 4V05A 3BKBA 2R3IA 3RNIA 1LQBA 5DPWA 3EYHA 3GFWA 4RM9A 3AC2A 1TQPA 3QXOA 3LJ2A 4UWBA 2AEHA 3PVGA 4GT3A 4JT3A 3NHEB 4KV2A 4LUDA 3PVBA 2OJ9A 4X3FB 4YJVA 3BV2A 5HE2A 3ZDIA 4EH2A 4ZK5A 4DG3E 3IS5A 3RK9A 1W84A 3OVVA 1O6YA 2HZIA 5EDRA 3VTUA 3COHA 3B1LX 1P14A 3IHPC 1MRUA 4FKGA 5DMZA 3E5AA 4XZ4A 1PXMA 4NCTC 3UQGA 4Y85A 1LUFA 4WA9A 1EUVB 2FSLX 4DHFA 2KK8A 1H0VA 3Q52A 4WSYA 1UH6A 5IH6A 2REIA 3L8PA 4F7JA 2C6IA 3QQFA 4CMUA 3FC1X 4II2B 5IF1A 4K8AA 4LCDE 4UZHA 4AFJA 2YITA 5CAOA 1QCFA 3ACJA 3W8LA 3ENMA 3MH1A 3PP0A 4WUAA 5KMNA 3MA6A 1U54B 3EFUA 2R3JA 3HUBA 3O71A 3QUPA 4DH8A 4CVAA 3F69A 4ZY6A 3E3BX 3SD0A 1YOJA 4U45A 4NPNA 3VTVA 2YISA 4CT1A 5J5TA 3BPRA 4JXFA 3EQGA 2VTLA 4CV9A 2X39A 3FAAA 3F3TA 5B0XA 1FOTA 1H0WA 4AW0A 3FL5A 1Y6AA 2OU7A 4XYFA 4XH6A 4EZKA 1GAGA 3TZ9A 2XRUA 4GUBA 4I4FA 2VWWA 4ZTRA 2PTKA 4HYSA 3HV4A 5HNIX 1E8XA 3KMUA 5IDNA 4JIAA 5EFQA 5I9VA 2CGVA 3R8PA 4AZSA 2RGFA 3APFA 3R2YA 4XUFA 4QTDA 2REXA 2ERKA 4PNKA 5CT0A 4HNIA 3A9JB 3QTIA 1OKVA 2Z7SA 4FTCA 2ZNVC 3HL7A 4G2FA 3Q4CA 2YIXA 4TN6A 3AGLA 2W1GA 2KOXA 1L3RE 3COMA 5CEKA 2KWCA 4O91A 5TT7A 2YLMA 3KUDB 3E93A 2QO2A 3NGAA 1O9UA 2VWXA 3O23A 3PLSA 5DE2A 2X8IA 4O6LA 2KANA 4IMYA 4YL8A 2OH4A 2V22A 1FMOE 3ACKA 4AE9A 5H8GA 5BO4B 3DBFA 2GBJA 1WBWA 4MGYE 2WIPA 4NH1A 4IUMB 1PXKA 3Q4UA 3Q9ZA 5I9XA 2IVTA 2DZKA 4FHJA 3NLBA 1XWSA 4C34A 2KDFB 2ITXA 4CFFA 2VRRB 4C61A 5HLWA 3HV7A 4EK6A 1GZKA 4L44A 3CP9A 1OKZA 4YSMA 3L8XA 5DI1A 4DFLA 4PS3A 1FVVA 5E6NA 2XK9A 1PY5A 2JBOA 4IIRA 4FL2A 2XUUA 2NRUA 3U8WA 3R00A 2W05A 2BRGA 4FULA 2NPTA 5BVDA 2OH0E 4IWDA 3UMWA 3PSEB 1V0OA 4W4VA 4GUEA 3PXYA 4GG5A 5DPVA 3LFQA 4TKSA 3NDMA 5ETAA 4MDKE 2BRNA 3MPAA 4K0YA 2XP2A 5HO7A 1R4MI 1JSTA 3MS9A 3RULA 3ZW3A 5HHWA 2QOHA 3GC9A 4GMVA 3PJCA 5IEVA 3O8TA 4AUQC 2JC6A 3NEWA 4OBQA 2KLCA 2PE2A 4F1OA 3GCSA 5BYYA 4F7LA 2YIYA 3ZEWA 1WIAA 4PP9A 3P7BA 1ZMWA 5F9EA 4L53A 2N1WA 3H10A 4A9RA 4KIPA 3V04A 4S31A 4W9FA 4EONA 4AACA 2YACA 2EKEC 3QKMA 4G3XB 2QNJA 1H26A 1XH9A 2IO0B 3AT3A 4RFMA 2W1DA 5CZHA 3C4CA 2I0YA 2KHWB 4GU2A 4I22A 1ATPE 2WTJA 1JSVA 4L00A 3ZNGC 4WKQA 5E7RA 4NJ6A 3BGPA 3LE6A 4CTCA 5IA2A 2R3QA 5IA1A 5GJGA 3OCSA 3QZIA 2YAAA 3LOKA 2ITOA 1Z57A 3VNTA 3WF8A 5J2RA 5D7GA 5AZHA 3BRBA 2WFYA 2XBJA 3V5QA 4K7UA 3ZRCA 2B9HA 1BL7A 5CU0A 3S95A 4NKSA 2J0MA 4ANMA 1T45A 3PXKA 4YPDA 2JLDA 3L1SA 5GJFA 5J5SA 4FKWA 3F6XA 3LVPA 5LVMA 1MRVA 3L8VA 4QPAA 5IUIA 3W2PA 1JBPE 4W9WA 4YNOA 4CTBA 4RJ5A 3SV0A 3EYGA 4YJSA 1UKHA 2EWAA 5CU3A 3TL8A 1NBFC 1WGGA 3UPXA 4Z7GA 2BAKA 4LG4A 4E3CA 3QC4A 3VVHA 3NNUA 4OTFA 3LQ8A 3BEAA 3ZLYA 5GNKA 4QRCA 3UYSA 3VF8A 5IZFA 4TUUA 1YWRA 2FIDA 1RJBA 1OIRA 2OSCA 2QO9A 4EQUA 4PMPA 5HQ0A 3EC8A 4XBUA 4RWJA 4CLJA 2BUJA 4HOKA 4LGGA 1URWA 4AG8A 5A4CA 3MVJA 2EU9A 3QHTA 4WRSA 5AEKB 3DXNA 3R9DA 2HXQA 2VWVA 3KULB 2KJRA 4MBJA 1F0QA 2FO0A 4MNEB 1YKRA 2PVRA 3WF6A 4PY1A 5CEQA 3WOWA 4BGGA 4EHGA 2W9NA 3RT3B 2C69A 2V55A 2PE0A 3JVSA 2X7OA 4CKJA 4QPMA 3MYGA 1V5TA 5J18A 1OL1A 3QTUA 3CKWA 2EXMA 4XEYA 3VAPA 2OG8A 3V6CB 2Y4PA 2UW3A 2X81A 4R5YA 3EL8A 3PV1A 5CYIA 3K5VA 1MQBA 4IWOA 5L2IA 5L6PA 3SA0A 2LWPA 4GL9A 3SU8X 2FCMA 4U3YA 3DQXA 2XRWA 1OL2A 2CS4A 1A9UA 3BIZA 4R6VA 4R1YA 1KJTA 3UVRA 5L8KA 5DG5A 1MG8A 2C3KA 5HKMA 3C4XA 1M14A 3HX4A 2QR7A 5CHFA 3DAJA 3KB7A 3RPSA 5K0XA 4YJNA 3VUTA 2WQMA 2OXDA 2C4GA 2VWYA 3F7WA 4IX3A 3P08A 3HMOA 3W8QA 3EQBA 3TKIA 2WQNA 3H3CA 4U43A 3MVLA 3EN4A 4TYHA 2Z59B 5AADA 3PE2A 3PHWB 3LJ3A 1DAYA 3POZA 4J7BA 2NP8A 2KTRB 5AP1A 2GTMA 4FLHA 4C33A 4ZRIA 3OEFX 3DKOA 1U46A 3PY0A 3V5WA 2HZ0A 4ZJVA 4RFZA 4IADA 4DGMA 4M12A 2HXLA 3PRFA 3G9LX 1WFYA 3AC1A 4YBJA 1WMKA 3DBRI 1M17A 4IAZA 3SXFA 3DS6A 1WZ3A 3FQSA 1XH8A 2YLFA 4RPVA 1WAKA 3GQIA 4BI0A 2PZIA 4MQ1A 3JSVB 1FGIA 1R0EA 1VJYA 4GFGA 4GU9A 3R04A 4ASDA 2ETMA 4FK3A 4IZYA 5DPSA 5IAAC 4EOLA 2WMXA 1DI8A 3VHKA 2BWFA 2KMCA 3NS8A 3ZC5A 2R5TA 4GSWA 1MRYA 2WMUA 3T3UA 4U0IA 1L7YA 2G2IA 3RZBA 3WYXA 5AR2A 2IO6A 3TTIA 4D5KA 4Q9ZA 4IAYA 4PMMA 3B8QA 4QMXA 5E91A 4OAUC 4I6LB 3H4JA 4DHJB 2HZ4A 4AJYB 3VUDA 2OFUA 5HE3A 3NW5A 4WNMA 1Y8YA 4AFEA 4MYGA 2KLGA 3GEQA 4F65A 4JVGA 4C3PA 2XM9A 4N9F4 2XK4A 4I5HA 4NT4A 5I5ZA 4XV3A 4FNWA 4QO9A 4W9HA 3C4WA 3E88A 2GOWA 4GH2A 4BF2A 5LVOA 2BIYA 3HP5A 3VQUA 3VO3A 1WR6E 2EVAA 2YCRA 4G31A 2IO1B 2CKEA 1W98A 3UZTA 2XEWA 4RRVA 3KCFA 4NM7A 5E8YA 3QCYA 2ZMCA 1H1SA 3P7AA 4FK6A 4O0WA 4GXBA 2WEIA 3QRJA 3QQKA 4KKEA 3KVWA 4IZ7A 5EM8A 4PX6A 4BKGA 4WWPA 5AMNA 2QODA 3ORLA 1YXSA 4LUEA 4TYIA 4QMQA 3AI5A 2IWIA 4FKQA 2C1BA 4N70A 2E9VA 4NTTA 3ORKA 2ZV9A 4YTIA 5IA5A 3CSTA 4BGHA 3EFJA 1P9DU 1LEZA 2PVMA 3V62A 5CHWA 1HOWA 5FBNC 4CZUA 3MIYA 2O6VB 4E6DA 3SHEA 3IPHA 1JOWB 2Z60A 3B8RA 3D0EA 1H27A 5JFWA 1CSNA 2KO3A 4MJSB 3IW5A 3P9JA 3RZFA 4FZDB 2LD9A 3DBQA 3VBWA 4C4EA 4F7SA 2H6DA 3R28A 1V6EA 2YJSA 2R4BA 4MSQB 4XG4A 4KABA 3LPBA 5E8TA 3UNZA 4HVBA 1Y6BA 3ERKA 2KJHB 3FPMA 4QTCA 4EI4A 1UKIA 2YERA 4TW9A 4BCGA 1REJA 5KZIA 2R3GA 4DEBA 3KMMA 4QD6A 5M56A 1H4RA 4JBVA 1MUOA 4M8TA 3PHXB 1PXOA 5LVPA 4EZ3A 4B8LA 4BZDA 3O7LD 4CEGA 2NO3A 4I5CA 1WGDA 4FZ6A 3SHQA 4MXCA 4YC3A 5HBEA 4YLKA 4ASEA 5AA9A 2GPHA 3VS2A 4F7ZA 3T9IA 3TN8A 3C7QA 1P5EA 3UZPA 2X7FA 3ZSGA 3GI3A 4RG0A 2UZVA 1SNUA 2GNLA 3F9NA 3Q3BA 3T8OA 4HYIA 4QP8A 3M62B 2PL0A 3R7QA 4V0GB 5CSHA 3PWDA 1Q5WB 5M4CA 3HA6A 5EI8A 3TKUA 2CN5A 1DI9A 3D7TA 4IAKA 4MD8E 4MHAA 1YXUA 4BGQA 2KQ7A 3NUXA 4FSYA 3TZ8A 2ZJWA 3NY5A 1Y8GA 4QMYA 3A4PA 4P2KA 4WNKA 4H58A 4ANOA 2PWLA 1UD7A 2DZMA 2KWVB 4Y95A 4W9KA 1M7QA 1PMUA 2RG6A 4L8MA 4S33A 4HYHA 4F9BA 4BKTA 1OIQA 3ORTA 3R22A 4KBCA 3RNYA 5FDPA 4MKCA 2C6TA 2XIKA 3DTWA 3VW8A 4CXAA 2Z7LA 5JQ5A 3B2TA 4W9XA 5CWZA 5KMMA 5JT2A 4OVVA 2WU7A 3MFTA 2R3OA 2ITWA 3AOXA 1K2PA 3ODZX 2BRHA 1URCA 5HIDA 1RFAA 1YHVA 2X2KA 4FV5A 3GCUA 1UWJA 3R73A 4KWPA 5EYCA 2X4ZA 3P1AA 3SLSA 4QP2A 3AT4A 3ET7A 3I5NA 4R3CA 5CLPA 4ANBA 4DGLC 3PPKA 3R7IA 3NZUA 3PTFC 3R83A 1WBTA 1FPUA 2QHNA 5I9UA 3GU5A 3UO6A 2EMTA 1GJOA 3HNGA 3LDZE 1OTRB 4HVGA 4A3OA 4QQJA 5L6OA 4IJPA 2VZ6A 4YO4A 3L8SA 2VGPA 1VYZA 2PUUA 5A3XA 4AA0A 5JZNA 4EWQA 5GZ8A 2RFDA 4Z55A 4K1RB 2HK5A 4LRJA 3KRLA 2W9ZB 2JT4B 2R3PA 3UP2A 2DZJA 4AN3A 1W82A 4BDEA 2MCNB 2YDIA 4QQTA 2RL5A 2JAVA 4JDKA 3MY1A 4E20A 2FUMA 2IVVA 4FSUA 2VTHA 5C9CA 2XK3A 1ZY5A 4Y5HA 3ROYA 5CT7A 5IU2A 2IY1B 4F8CB 3UP7A 3ZIMA 3C1XA 4ZSJA 4DH5A 4UYAA 1YI6A 4YO6A 2C3JA 3CPCA 5L3AA 3PZHA 5IUGA 4HPTE 1ZOHA 5EHLA 5T3QA 1APME 3DV3A 4IVAA 5LMAA 4IDTA 4RWLA 3A7GA 3I3TB 5HZNA 3NRMA 3KXGA 4I21A 2FIFA 2K6QA 2XK5A 4PWNA 2BYVE 4OTGA 2HZNA 3PSBA 1XBBA 4TTHB 3UE4A 3ZZWA 3I1AA 4BCHA 4EQCA 2K8HA 5KHOA 5KHQA 3CTHA 4W8DA 2MBHA 3G0EA 4O0SA 3G5DA 5EHOA 1S1QB 2NCNA 2VV9A 4ZTLA 2J6MA 4ITJA 5HORA 3VDZA 5EOLA 4RQKA 4HLEA 4UX9A 2OBJA 1ZGUB 1ERKA 3QRKA 4RIYA 3DJ5A 1OQYA 4BVUA 3V6SA 3AC4A 4AWJA 4YZCA 4F1SA 3HHMA 1TGZB 1Q8TA 2HENA 2JAMA 3F3WA 4UZDA 3VBYA 3TG1A 3OXZA 3WE8A 5I3OA 5GZAA 5K4IA 5E6OA 3W2QA 2BIKB 1GIJA 4IH8A 2YVCA 4AS0A 3VXWA 4BOZB 1OITA 5K5NA 2Z0EB 4EOOA 3GU4A 5H8EA 3ZSHA 5BVFA 3L9MA 4AE6A 3PWYA 1Q1OA 2ETKA 4AWIA 3COIA 3CE3A 5CSWA 3JYUA 1WBVA 2G1TA 1PXLA 4RX9A 4EL9A 5CXZA 3KMWA 3RP9A 5CY3A 4M8MA 2W1FA 2OK1A 2C7HA 2IW8A 3RZWC 3I81A 3QZHA 1KV1A 2P55A 4UN0C 1DAWA 1Q8ZA 3FMLA 2BDFA 2VX0A 3BI6A 3R9HA 3DBLI 5KO1A 2XZSA 5LXHA 5CTRC 1JLUE 3QQGA 2VN9A 4I4EA 2V62A 3CTQA 1WMHB 3ECIA 4U41A 5F94A 4I1ZA 5L4QA 5HLNA 3Q9WA 2QCSA 4EYJA 2XIYA 1OPJA 3KRJA 4IJ9A 4LFIA 5TE0A 4BCFA 5CX3A 5EYMA 4S30A 2JF5A 3MVHA 2L05A 3ZEPA 3PJ8A 5FD2A 3R63A 3A8WA 3FSKA 3R2BA 4KSKC 4FNXA 2MSED 3W16A 4BTMA 4A20A 1OKWA 2YDKA 3ZCLA 2VWUA 2ZV2A 2B9JA 1ZOGA 1XH5A 2FGIA 3ZUNA 2OJGA 1J1CA 3I0OA 4I24A 4GVAA 2JKOA 3A7FA 3CMMB 4LOOA 2VRXA 2LXCA 4G1WA 4S32A 3CLYA 3K3IA 1X8BA 4G5PA 3E92A 5JMSA 5TR5A 1UU7A 2ZVAA 1OUYA 2YA9A 4HZSA 1JRUA 4D2RA 2QQ7A 4KZ0A 1UWHA 3BQRA 4GW8A 3PJ2A 4JRVA 2JKMA 4YLLA 4HPMB 3BV3A 3CTJA 4C4JA 3MTNB 4FVQA 5C23A 2C6LA 3QLGA 3DLZA 4LMUA 2OJRA 3P0MA 4TT7A 3TBLD 4QP7A 3ZRMA 4RZWA 5F95A 4AW2A 2LI5A 4A4XA 4FV0A 2G4SA 1K8RB 4IBMA 3VC4A 3SAYA 4K7SA 1ZRZA 3QKLA 2FB8A 1IRKA 4FSNA 4BDHA 4YR8A 5I4NA 3BBTB 4TYJA 2BFXA 3UO4A 1XH6A 3QLFA 5CASA 1YDRE 4G3EA 3L9PA 4MWIA 4WO5A 5AUUA 1UBIA 3HP2A 4G17A 3VS3A 2R3NA 2XYUA 3QYWA 1XJDA 3SD5A 2CGUA 5CF4A 2A1AB 2LVOA 3QQHA 3V61A 5E1SA 3IQ7A 4QYHA 5ANGA 4CQGA 2NBVB 2FSMX 2XJ0A 5I9YA 3I6WA 1Q41A 3WAMA 2A4LA 4GYGA 5HD4A 4G16A 3OWKA 1J0GA 2VNWA 3EIDA 4P4CA 1Y57A 4U3ZA 1G3NA 4LGHA 5GZ9A 4FTLA 3CPBA 3TZMA 5JFSA 2M0XA 2UW7A 4AT5A 4IC7B 3W1SA 4LL5A 4ZY4A 1CMXB 4YUQA 3O2MA 4YTFA 3FMNA 2ZM1A 5AUWA 4DH7A 4DN5A 3D5WA 3IDCA 5CS6A 1XD3B 5HCXA 3EKNA 2JGZA 4E4LA 1IEPA 1I09A 3EZVA 3FMDA 3ROCA 1K9AA 2IZSA 4FSZA 4XBRA 1H25A 2WYQA 3PPZA 3KRXA 3FXWA 2L0FA 4RJ6A 4XV1A 4BWPA 3IDBA 3ZTCA 1WVYA 2R2QA 1OVEA 4JBPA 4TZRA 1GZNA 3DKCA 3QTZA 4M0ZA 1WM2A 3R1QA 1Q5KA 2P0CA 3CKXA 3OS3A 5J1VA 1Y91A 2F7ZE 4FKSA 1RAXA 2AL6A 4I0SA 3DTCA 1XT9B 2AC3A 2W5HA 2O2VA 3IG3A 2BMCA 2YM6A 3MH2A 1E1VA 5EOBA 5AA8A 4FEQA 3RAWA 4USEA 2MP2A 4JIOU 4A9UA 4AW5A 2WMWA 1NVRA 2C6EA 4FL1A 2OWBA 2X4FA 3H0ZA 3NNVA 2P33A 5A4EA 2YHVA 3FI3A 4CV8A 3GOKA 1PYEA 3LCSA 3RD2A 4BHZA 5AR3A 3O0GA 4LDTB 3UIPB 1I35A 2BZHB 4XLVA 1GUAB 4FV3A 4Y73A 4BCNA 4QTEA 5I9ZA 4IHPA 3D5VA 3EHVA 4DLJA 3QX1A 4HDOA 4M69A 3AC5A 1YX5B 2C47A 4J52A 3OHTA 2Y8OA 3BWFA 2VAGA 3QQJA 4A4OA 4QMSA 3QD0A 3NYNA 2R7BA 4FV7A 3NCGA 3WE4A 2BDWA 3OP5A 1H01A 1H24A 5F1ZA 1KM7A 3NOBA 4ACMA 2OJIA 4ANQA 3AD4A 2I0EA 4EORA 5FTOA 4C4GA 3U87A 5HESA 4U81A 2GHGA 3UNKA 1Q62A 4W4WA 2M17A 2W9FB 4XCUA 4QPSA 5H9BA 5L2SA 1RRBA 4FKIA 2BTSA 4PP7A 2FUHB 4DYMA 2WMRA 5E8UA 2ONLA 4ZSGA 3TJDA 5KKRC 4CRLA 4TXCA 2YZAA 3E64A 2E2BA 5FLFA 2J5EA 3KCKA 2JVCA 2YIWA 2BZKB 1PMNA 2V5QA 3DU8A 3P4KA 5BVWA 2KFKA 3DDCB 1BLXA 4MEDA 2XNMA 1YXVA 3TJCA 3DBSA 3DVGY 5J9LA 4EWHA 4FUXA 2BKZA 2W4OA 4CFMA 3PXQA 4ZRJA 3SXSA 3ZNID 4JOAA 2R0IA 4M97A 3L0WB 4C37A 4TKNA 4O2PA 1FVRA 4ERKA 3H6NA 1BI7A 2WWZA 4DINA 3RYTA 2VX3A 4X3FC 4U44A 1FVTA 3HYHA 1PMVA 2YCSA 1J8CA 4HZRA 4YBKA 3EQFA 3TACA 4H36A 3E8CA 3MTLA 3P7CA 2XCKA 4X6QC 1GC7A 3L13A 3DK3A 5BVNA 3EOCA 4FUYA 4EH7A 4LYNA 3QWJA 3U4UA 3PGEA 1WXSA 1Q24A 4WJOA 4KIKA 3DVNU 4NFMA 2F2CB 3S4QA 5EDPA 4WG3A 5LXMA 3MA3A 4Z16A 1CKIA 2J0KA 1GZ8A 3JVRA 5HX6A 3VUWA 3TWJA 3MBLA 1GZOA 3FYJX 4XOYA 5HO8A 2OIBA 4IACA 4ZLYA 5KCVA 1VCBA 2ESMA 2KMAA 4IX6A 4HVSA 3HV3A 1I44A 3DT1A 3FZPA 4QT1A 5DT3A 3NUSA 4FTRA 1SVGA 4RX7A 4BCKA 5M53A 4HGSA 4KB8A 2R9SA 4BN1A 4AN2A 4KAOA 3LJ0A 3NYVA 4FKUA 3ZU7A 1D3ZA 1WE6A 3EB0A 3QTRA 3CJFA 3VRYA 5AR4A 2JIVA 1NDDA 2L00B 4L52A 2UW4A 3B08A 5LARA 4NQLB 3U30A 1OL6A 4RVKA 4X6RA 3OOMA 3VHEA 5FEDA 4WHZA 3EN9A 5FBOA 3VS7A 4GK4A 4IFGA 3DB8A 4L68A 4EC8A 2RG5A 2HY81 2X1NA 3HV5A 3D5XA 5FRIA 4EYMA 3OOGA 4JQ8A 5DLSA 4D2TA 4K81A 4W4YA 3C13A 5E92A 4FKTA 1MQ4A 4RJ7A 2QONA 3HMIA 4RA5A 2HCKA 3DCVA 3ZC6A 4ZZNA 4UMQA 1YX6B 4C4HA 2WIHA 2O0UA 3RTPA 3TV6A 5K0KA 1WI0A 4QMPA 4DCEA 4EOKA 4PTGA 4NFNA 2DYLA 4EEVA 1Z5MA 3Q2MA 2QKWB 4AGUA 3PA5A 4GGQA 2X0GA 3KK8A 5ANJA 3H30A 4J97A 5HCZA 4BDDA 3EQCA 4I6BA 4UXQA 4AU8A 2Z7RA 1CMKE 5HVJA 4GB9A 1OL7A 2PEAA 5DPTA 4WSQA 3RMFA 4HCNB 2XKDA 2VO7A 4FJYA 4NM0A 5DEYA 1UNHA 1J19A 2N7EA 1TVOA 2VTAA 2XNGA 4D0WA 5FR6A 4BOSC 4WBOA 3MFSA 3JY9A 4U97A 2J5FA 3KRRA 2FNJB 2GDOA 3TV7A 1YI3A 4UB7A 5BYZA 5A4TA 2IZVB 3A1QA 2PK9A 5BPYA 3MJ2A 3OWLA 5EK7A 2QVSE 5J87A 3VVWB 1A5RA 4CKIA 3QKKA 3FL4A 2J0IA 3GB2A 1YRPA 4RBLA 5IUHA 2W1HA 4GMYA 3H9FA 3R02A 4GSBA 4JG7A 3JS2A 3PY1A 1YHSA 3PP1A 4ZSLA 3UC4A 2XEZA 4IB0A 5G55A 3DJ7A 3EWHA 4E7WA 1NVQA 4JAIA 1UGMA 4FJVB 2WTKB 2C1AA 3WILA 3ZXTA 3TNIA 3EECA 4ZAUA 3VAWA 4PUZA 4FKJA 3KUZA 4PTEA 2ASQA 3QL8A 2XK8A 4GOCA 3KL8A 5CI6A 4FOBA 4G6OA 2QI8A 3QRUA 5BMSA 2KULA 2OXXA 4G11A 5EM7A 2YFXA 4E6QA 2KX3A 4TV3A 5ETFA 1FMKA 2DWBA 2CGXA 2PHKA 5HVYA 5BVEA 4DFNA 5BUEA 1Q99A 3EN7A 3NYXA 3OW4A 4A9YA 4K33A 4F1MA 5A4LA 3HV6A 5AR5A 5KBQA 2C68A 5DBXA 3EQDA 3TL5A 2XKCA 3HRCA 5DT0A 4R3RA 4RLLA 2D10A 3C4FA 4QMMA 2D11A 2Y4IC 1U59A 4D9TA 4FKRA 3WF7A 2ITYA 3N30A 3L9NA 1PKDA 1TZ1A 3FLSA 2WNTA 4ID7A 4FSTA 3RK7A 4TYHB 4YSJA 2NVUI 1SE9A 4TL0A 4LJOB 4L6QA 5LVLA 4RLKA 3W1YA 3FZTA 3RAKA 4C62A 3PVLA 3LFAA 3F2AA 4AOTA 3T8MA 2R3HA 4EH6A 3RCZA 4NM5A 3R7OA 1U5QA 4M15A 2XKEA 4LJPB 4PMSA 3VUYA 5AP4A 3QARA 2MBEA 3O17A 5HG9A 4IM0A 3BE2A 4GVJA 2YABA 4XG9A 5I3RA 3A2CA 3GC7A 3FHRA 2IZUA 3NIZA 4DFXE 3RBWA 2WMAA 3FMKA 2X2MA 3LLTA 4YLJA 2CU1A 4XNEA 3THBA 3LFBA 4E6AA 1F9JA 4H3QA 5HO6A 3PTGA 4P7EA 2WOTA 4ZOGA 3PSCA 2WB8A 4MH7A 5HG8A 2FH9A 2Q0NA 2F7XE 2Y4IB 4XG3A 2ITQA 4BCOA 3U6JA 5DN3A 3U8ZA 4L7SA 5AR8A 3BGZA 4AA4A 2GMXA 4G3CA 4GDLA 2J0LA 3L17A 1SVEA 4XP0A 3R8VA 3LCDA 2OZAB 3G51A 2LJ5A 4MGIE 3ZFXA 2CN8A 3ZNHB 3ONSA 5E6PA 5HE1A 1BL6A 4FTJA 2PZRA 2Y9QA 1YWNA 3LCKA 3HEGA 4U40A 3FDNA 3K2LA 5TKDA 4ZXTA 2L0TA 3MPTA 1OIYA 3PVWA 4QMLA 4ITHA 4QP6A 1WJ4A 2J4ZA 3AT2A 3QAME 1NA7A 3QCAA 5G2NA 4ANSA 3ALNA 3QHWA 1HCKA 2FCNA 3GC0A 5CENA 4IAFA 1U5RA 2QO7A 3ZDMC 3FJQE 3QD4A 4KZCA 3X23A 4YJPA 4NUSA 4YGAA 3R8ZA 4WT6A 3ANQA 4J8MA 4EOSA 2MX2A 5ACBC 2C6KA 4OAVB 2OOBB 2PJHA 4DHZE 3IDPA 3OTUA 5CU6A 4OBPA 3BX5A 4FV2A 4X3JA 3NAXA 1YXTA 3UC3A 2X2LA 2G01A 5EM5A 4I0TA 4ACHA 2RSUA 3BYMA 2WTVA 2JIIA 3Q6WA 2LGXA 1NI2A 4BCJA 3IBEA 2LGYA 4M0YA 3C0HA 1TQMA 2W17A 3BHUA 4OT6A 2A27A 2LASA 2C6MA 3OT8A 4AT3A 2ITUA 4HCTA 2W96B 3R1NA 4NCTA 4PL4A 4YNEA 1ISNA 1V80A 3IECA 4F6SA 4AZFA 2UVYA 3CS9A 3MJ1A 3LFCA 4X0MA 4PPAA 1GIHA 3A62A 4JGHB 1AQ1A 3A9JA 2C6DA 5T6KA 3WZDA 1GNUA 2CCIA 3Q04A 1M7NA 3KYDD 4GRBA 1GJZA 2PVKA 2KWUB 1Q3DA 3MDYA 4MSMB 4RFYA 1G6JA 1H4LA 3T9LA 4O22A 2KN5A 2NRYA 2ITVA 2JIUA 4QTAA 3RM6A 5J9YA 2I40A 3OROA 4ITIA 5CXHA 3TNWA 2MWSB 1KOAA 2UV2A 3E7OA 2NBUA 5FM3A 3N9XA 4JAJA 3OD6X 4PL3A 4B9DA 1NY3A 4FODA 3NIEA 5ETIA 4EOIA 5M57A 4PYZA 4ZSAA 4XX9A 4RZVA 3U9NA 4MD9E 3NPCA 1PYXA 3OUNB 4OTQA 1LXDA 2DAFA 4JDIA 4UEUA 1Z2MA 2QU5A 2PZ5A 4DEIA 1P0RA 3GNIB 4WNOA 3EKKA 3UVQA 1EF1A 5GHVA 5L95C 4RSSA 3OZ6A 2VGOA 2BAJA 1WBNA 3D83A 4M67A 1ZYLA 1F3MC 3PYYA 5AP7A 4ZS0A 4RM8A 1XKKA 4EK8A 5FDXA 3N3KB 3AQVA 1UA2A 3CCNA 4WG5A 5LWNA 3QTWA 4M84A 2ZV8A 5EYKA 1HCLA 3C0IA 4D2SA 3SW7A 2KC1A 1ZKHA 4RJ4A 3B2WA 2L8JA 3JW0X 2XVDA 2XF0A 2C5LC 4BDKA 1W8CA 3BHTA 3V51A 1QL6A 4F9WA 2EB2A 5DIAA 3WANA 2ITTA 2ZCBA 3OBJA 3FZRA 4BKSA 1QPDA 1JSUA 4UMPA 3V01A 3ALBA 2XMYA 1YHWA 5HG5A 4FIEA 5JHAA 3MPMA 3FQHA 2X6EA 3ULZA 3VBXA 4B4LA 4XV9A 3P2BA 2VU3A 4FKLA 4GIVA 2SRCA 1CKPA 3SC1A 5A54A 4ZZMA 3W10A 3UOLA 2DUVA 2C0TA 4G3DA 5F20A 4C59A 4Y46A 1P1AA 5L83A 4CSVA 1PKGA 3DVNV 4D28A 5E8ZA 4W9GA 2WTCA 4JQ7A 5KUPA 4GK3A 4LM5A 3WZEA 4DAWA 2E9UA 4FTIA 4XP2A 3MW1A 5L6WL 3ZBFA 4TYEA 1VR2A 4YURA 2R3LA 4YU2A 3V5JA 3CD8A 3MJWA 4FBJB 2CR5A 1V86A 2ERZE 3HA8A 5EHYA 3IW7A 2DYOA 4QQCA 3D2KA 3OUKA 2WMBA 4UY9A 3Q5IA 4QMTA 1WBPA 2R3FA 3M1SA 3K54A 3PREA 4ACCA 2F4JA 1V0PA 3WAOA 3ORXA 5BMMA 5LMKC 5KNJA 3FXZA 1WR1A 4OT5A 1WCCA 2OIDA 4N0SA 4ARKA 3LFSA 2H34A 3DDQA 5CEPA 3Q5ZA 4ANVA 4GEOA 3R7YA 5ANOA 3DB6A 4QNYA 4X2NA 2CKHB 1KE9A 4XG7A 4KBAA 3KA0A 2V7OA 3QHRA 2WXVA 2XNBA 3RI1A 4D4VA 3QC8B 4P7IA 3K9OB 4YHTA 4XV2A 5FGKA 4IB3A 4DG0E 5IA3A 2VO0A 5CAQA 1H1WA 1GY3A 2YEXA 3DNEA 4FTAA 5DA3A 5HI2A 3VW6A 1W7HA 4J96A 4UBAA 3RVGA 3VS6A 3LXPA 3ZMMA 5B2MA 4G9CA 4RIYB 5D11A 3GENA 3TCPA 4DGOA 2PZPA 1T0YA 3PPJA 3QFVA 3GOEA 3LFEA 4MNEA 3MHSD 4II5A 2E9PA 5M44A 5DT4A 1EF5A 2UW9A 5CVGA 2J50A 3UODA 3ZYAA 1WYWB 4FC0A 3A4RA 3BINA 4NAWA 4TWNA 4W9JA 1U4AA 2WTDA 4K2RA 4MXZA 3HK0A 5FWKK 3R30A 4JIKA 3QCQA 3IKAA 4C57A 2PY3A 3HLLA 4PPBA 2K25A 4F63A 4ICVA 4RIWA 4OTPA 3QU0A 1H07A 2N1VA 4E4NA 4A3PA 4XP3A 2JUOA 2FSTX 4M14A 2C3IB 4W4XA 5BQ0A 5IISA 4CT2A 2BZJA 4HCPB 4JBQA 3ZONA 4EUUA 3D7ZA 3KXNA 3ZDTA 2KC2A 3PUPA 5JHBA 4RX5A 2XNNA 4BYIA 2C6OA 2P2IA 4ICUA 2PMLX 4PNIA 3R3MA 3F5PA 5FQDC 3TXOA 4QMZA 4R5SA 1ZW7A 5I0BA 4TQ0A 4I6PA 1ZLTA 3SRVA 1I42A 2KTRA 4BTJA 3VFKA 1FINA 1V49A 1XH7A 2C9WB 3UINB 1ZAOA 2W7XA 4WRGA 3O51A 5CAUA 3OW3A 4ZTQA 4YPSA 3UG1A 3EZRA 2OI4X 2WAJA 4LL0A 4WG4A 2L76A 1WGHA 5ITAA 3VUHA 4DITA 3I7BA 4UXLA 1M52A 3KFAA 3VBQA 2G3QB 5CI7A 3EN5A 3KQ7A 5CF5A 4D0XA 3JSVA 4FR4A 2B53A 3EQIA 4B99A 5FXQA 3QCSA 3RGFA 4EH3A 2R3MA 4U9AA 4BWXA 4CQEA 3CIKA 4IAIA 3BHVA 2O8YA 1R78A 5EDQA 4FNZA 2WMSA 4RVTA 4YMJA 2XIRA 2G4DB 2WX1A 3WA0A 3OXIA 3R1YA 4BI1A 2W4JA 4ZDVA 4E73A 3ORMA 2QOOA 2HD5B 2CMWA 2B4SB 2Y6OA 4BC6A 1Q97A 2GNFA 2OJFE 2F49A 3HVCA 4GJ2A 3TNPC 1M2QA 3ZUTA 4C4IA 3UO5A 2J2IB 3L10B 5C01A 4Q2AA 1LR4A 2V4LA 3QUEA 5EW9A 1YW2A 4ZYNA 5BNJA 2UWQA 2G15A 3L9LA 5I9WA 1WXMA 5CVFA 2RSVA 5E8XA 4I5PA 3UG2A 2C7NB 3AULA 3GZNI 1AGWA 5BUIA 3KF7A 1H1RA 2QLQA 1UZXB 4USFA 2JZ3B 2FVDA 2ZB0A 2X6DA 3QBNA 3SX9A 5H2UA 3D14A 1LPUA 2WZJA 3DZOA 5BVOA 1Q8YA 5ICPA 3PZDA 2VTQA 1J3HA 1KOTA 4D58A 2ZB1A 1V5OA 1NXKA 4WIHA 5HCYA 2EXCX 2E9NA 2W1ZA 1KE5A 4UMTA 3VULA 4RMZA 4MM3A 4BKSD 4JG8A 4HXDA 2WEVA 2VWZA 1DM2A 4F1TA 4ZY5A 2MW5A 3O96A 3WIMA 2WX0A 3VQHA 3FHIA 3R7EA 4BCMA 1WGYA 3C5UA 1V81A 4E6CA 2ZCCA 4UALA 3CR0A 5M55A 3TEIA 4AGWA 2O6VA 1YJ1A 1EH4A 4Z9LA 2Y6MA 4MXAA 4K1BA 3PXFA 4O1OA 3TIYA 5A4QA 3A33B 4AW1A 4D4RA 4FICA 4KD1A 5C26A 2MA9B 4R7IA 1U4DA 3TMPB 5EI2A 2PMOX 4ACGA 4MVFA 3CC6A 1WFCA 3PLUA 3G0FA 4RIXA 2ZJDA 1R1WA 2WHBA 2KKCA 4HJOA 4BL1A 2LGCA 1ZXEA 4Z7HA 2JY6A 4FBXA 3V60A 3KRWA 3HM6X 1PJKA 2PVJA 4UYNA 5CEOA 3R8UA 4L43A 4C3RA 5M4UA 3Q4TA 3BBWA 2G2HA 1ZMVA 4LOQA 4APCA 2BHEA 2DENB 1GIIA 2OW3A 2J90A 3A60A 4MAOA 3DBHI 4NWMA 3NW7A 3V5PA 2JPHA 2IW6A 2XK7A 2P2HA 2R3RA 5K9IA 4MH0E 2JWZA 2VTMA 5DGZA 2O2VB 4H1JA 3PRMB 4NIFB 4XHKB 3PRIA 2JDSA 3LCOA 4G3FA 3DKGA 5L8LA 4RVLA 4AP4C 2HW7A 4ZSEA 5DWRA 1SNXA 2CDZA 1E9HA 4O0YA 1XH4A 3SDJA 3ZFYA 4FKOA 4O0TA 1SM2A 3DBCA 3K3JA 5KZ0A 2CJMA 5CSXA 4YC8A 5BUJA 1UELA 5FTQA 4CNHA 1Y8RC 3O65B 2O5KA 3F5UA 4DLIA 5CSPA 2N4FA 3RCDA 4AN9A 5D7AA 2BROA 3ZRLA 3G33A 4MTAA 1YXXA 3BU6A 2K8CA 4M69B 1GG3A 3O50A 3QQ8B 3CQWA 2DQ7X 3GQLA 2W1IA 4E5WA 4JBOA 3FZOA 4M66A 4XS2A 4YHJA 2WO6A 2BYFA 2MBBB 4ASXA 2JITA 2RGPA 2JEDA 4A7CA 3N32A 3Q3FA 3RUIB 1OPKA 4JLCA 5AUXA 4FADA 4GT5A 2QOIA 3DGKA 4D2PA 3GFEA 1OPLA 4KBKA 2HE7A 4PDOA 1Q0WB 4BB4A 3LHJA 4CMTA 4C0TA 3R6XA 3PJ1A 4BBMA 4G3GA 1Q8UA 3KN6A 2QHMA 4E26A 3HIZA 2QURA 5AV1A 4BIEA 2PMNX 4A4LA 3S2PA 4EH4A 5D94A 3MH0A 5EM6A 3G9NA 3LXNA 2B54A 3MN3A 3RPYA 4CFVA 3LAUA 5ANEA 1QPCA 5HGIA 2KJ6A 3AU5A 3M95A 3AG9A 3RM7A 4BTKA 5CTPA 2UZDA 2IZRA 3R9OA 4B0GA 2KQSA 3MVMA 3QQLA 3RWPA 3VS4A 3H0YA 3ZLWA 4FSMA 3KUCB 4C4FA 2EXEA 2QC6A 3V5LA 1CDKA 4L3PA 4QNAA 3HM3A 2KFKB 4RA4A 1IR3A 4IDVA 2WQOA 4FV6A 5CX9A 3WZUA 5IA4A 4EFOA 2YCFA 4YZMA 4FYOA 4LOPA 3BELA 4GS6A 3FBVA 3DZQA 4XG2A 3UIXA 3QUDA 1Q3WA 2UZNA 5CALA 4BDIA 1NVSA 1CKJA 3VH3B 2WMTA 4XRLA 3NUNA 3LMGA 1OIUA 3F5XA 3FZSA 1FQ1B 3I60A 5CANA 3RK5A 4O0XA 1UNLA 1K3AA 3FPQA 1QMZA 3WBLA 4E5BA 2CSNA 4C38A 1WBOA 4V01A 5AM7A 3ZHPC 1LEWA 3KYCD 1E8WA 1AD5A 1JQHA 1ZOEA 3H9RA 2VTSA 3MB7A 4KIKB 3FC2A 1GNGA 4PPCA 5M4FA 4FZFB 4JX3A 4FIFA 2W99B 4QYGA 1REKA 4NW6A 4TNBA 2QOBA 3G6HA 4OTRA 2UW8A 4G5JA 4NKAA 3ZUVA 2BF8B 4B8MA 2FAZA 2I1JA 4OGRA 2V3SA 2BTRA 5E8SA 4AX8A 3O7LB 2HIWA 3R8MA 2N9XA 5AZFA 2CCHA 3V8WA 2BKFA 2RR9A 2YM7A 2D07B 4DEAA 5AAFA 3HMMA 4XOZA 1UU9A 4ZIMA 3ZRKA 4ERWA 1QZEA 2PVHA 3CQUA 3F66A 3OWJA 2DYMA 1YQBA 4CYJA 3ZBXA 2JRHA 5H3QA 3F5GA 1H08A 5AAEA 5HBJA 5CHVC 3GUBA 2AUHA 2ZDTA 3VJOA 2W5AA 2G9XA 1BYGA 4X7QA 4HGEA 5B7VA 5JGBA 2I1KA 3A4SC 4F7NA 3HMNA 3DPDA 3PLVA 1BX6A 3QIJA 1R0PA 4I6NB 2X9FA 1ZWSA 1WZ0A 4D1SA 4XC2A 2L7RA 1E1XA 5L2WA 2OXYA 2J7QB 4F6WA 5JQ8A 1WX9A 3OLMD 3W33A 3RPVA 3WF9A 2AC5A 3MIAA 2FCSA 4HW7A 4W9CA 5LWMA 4J8NA 1V2YA 5LLIA 1S9IA 2XH5A 3V8TA 4IB5A 3FLQA 4D2VA 3C50A 3Q6UA 4U79A 4EH5A 2DHZA 2PE1A 2K39A 4FTUA 5J8IA 1GC6A 2WQBA 1E7UA 4HJKA 3TIXA 5KX8A 3GP0A 1WX7A 2M8SA 5JH5C 2I0VA 2QG5A 2WGJA 3MI9A 3H7PA 2O64A 4IFCA 4CMOA 1FXTB 2AYPA 2P4IA 4ZZOA 2A2AA 5A14A 5HU9A 4QMNA 1IA8A 2BPMA 2PVYA 2WELA 4FVRA 5AM6A 3RJCA 3D4QA 4DGNA 2FA2A 4Q9SA 4DEEA 3DY7A 1YIWA 4DHZB 4ENXA 3ZDUA 1OL5A 4I20A 4I5MA 3R7RA 3DBEA 4IAAA 4MF1A 5DRBA 3TNHA 5M4IA 3KH0A 4PS7A 4K77A 4LV8A 1WMHA 5DNRA 4TNDA 3NNXA 3V8SA 1HE8A 3R71A 4I92A 5HG7A 2R3KA 4CFUA 3SW4A 1WF9A 1BMKA 3PSDA 3NR9A 4BKJA 3FWQA 2CLXA 4FA2A 1GOLA 2C0IA 3IG7A 2MBOA 2QLUA 1YWVA 3JUHA 3A1QB 4I3ZA 2W4KA 4X2JA 2JKQA 3CQEA 3IOKA 1T46A 4AOIA 3BU5A 3EJ1A 4KDIC 4YJTA 2O63A 4E8AA 3A9KA 1YI4A 1ZARA 3CY3A 3QCXA 2BZIB 4XX5A 4GIHA 4WJQA 4YHFA 4KIOA 4Y5QA 4A07A 2ZPNA 3IW8A 3L54A 2W06A 3ELJA 3G6GA 2QOFA 4ALVA 5CSVA 5CQWA 2XEYA 2IBIB 4FYNA 2KD0A 2RD0A 4FSWA 1E8YA 2CHZA 2YJRA 5DFPA 4O1PA 5B2KA 4IWPA 4W9LA 2MRPA 5AP5A 5DR6A 3DQWA 1MP8A 2IYDB 4MCVA 4OLIA 2JKKA 1JKSA 3GU7A 4FIGA 5A46A 5HIEA 3QGYA 4TWCA 5C8KA 2BGFA 3MFRA 2PVFA 4BKZA 2VTNA 4F0FA 2JZZA 2NPTB 3HGKA 3UQFA 4MF0A 1IYFA 2A4ZA 2M1MA 4FTQA 2I6LA 1WH3A 4AZWA 5AV3A 4JQWC 1KOBA 2N7DA 4EZJA 4WBBB 3JPVA 2CGWA 4H3BA 2DZIA 5M51A 3HUCA 5DHJA 5AEPA 3UQAA 1XBCA 3I5ZA 4E4MA 1WBSA 3FYKX
chains in the Genus database with same CATH superfamily
4Y8DA 4D1ZA 5AX9A 2WS3B 3ML9A 3W5UB 2Z2WA 3FXXA 2Y5CA 4IC7A 1QT9A 2KXJA 3AH7A 3AMZA 3BCEA 2N7JA 5J1WA 3BY4B 2D3GA 2RFNA 3SEBA 1IUEA 3Q53A 4RIOA 4I6QA 2WTKC 4DHJD 4AS1A 4OUCA 3PIYA 3KXHA 2BRMA 2VTOA 3CSFA 2JD5A 5J17A 3RPRA 4HVDA 2JFMA 1EO6A 1TQIA 3N20C 3ML8A 5BVKA 4X2FA 1C1YB 3PXZA 2ON8A 4E5AX 4IWQA 5JK3A 4QMOA 2QIEB 1XLNA 1JAMA 3DBDA 2BAQA 3APCA 4RGTA 1XO2B 4X2KA 2HDEA 3R7UA 1SGHA 5FM2A 4P1BC 2E9OA 5A9UA 3LXLA 4D55A 3F3ZA 5EYDA 3QA0A 3ZFMA 2DLBA 2HOGA 3QX4A 4HNFA 3I6UA 4MELA 3HECA 1UWMA 4BZAA 3R66C 4DDGD 3L16A 4URKA 4EZLA 1ZY4A 2GNIA 2BALA 4QOXA 4X3FA 2XNPA 1QLBB 5IH4A 4FV8A 2INPE 4KSLC 4X57B 3E8EA 2D2QA 2VWBA 5LQFA 1V0BA 4DEHA 3ORZA 5IA7A 4KGSA 3BHYA 2KDIA 5KBRA 3M3JA 3H9OA 3RAHA 3VWAA 2QR8A 2MBQA 2YM3A 4U8ZA 2PVNA 4TYGA 3U2SC 4I41A 1D4BA 3H7PB 1OECA 3NW6A 4FNYA 1FGKA 2DX5B 4DH3A 5A6NA 2MLBA 4NAWB 3ZKJC 3D7TB 2GMIC 2GBMA 5K4JA 4DXAB 4GFOA 3ZRFA 4QMVA 2GHMA 4GYIA 1V9JA 2Z8CA 3A4RA 2WU6A 4J71A 5ANDA 5JGDA 1R4MB 2C5XA 3ZLXA 3F2NA 5EW3A 5E8WA 4ANUA 4BFMA 5HKHA 1DS5A 3AECB 3DQVA 4C2VA 2KTFA 2K3UA 2WQEA 2JDVA 2OZAA 5CQUA 1GB4A 4RVMA 3S3IA 4DFZE 1B39A 3D32A 2QOLA 4ANLA 1VZOA 3FKLA 4FT9A 1TKIA 4S34A 1JKLA 1PW2A 4FV4A 5B2LA 1V8CA 4F4PA 2B7AA 2J42A 1SVHA 4QYFA 3ZLSA 3AU4A 4WAAA 2JXXA 4X2GA 3S00A 3OG5A 2R0UA 4YJOA 3P79A 3KULA 1UU3A 5DR9A 2AQ1B 3DA6A 4A9SA 3ZTXA 1XR1A 2XS0A 1KLVA 4RGOS 3RN9C 2A0CX 1ZZ2A 5CU4A 3ZZEA 2DYBA 1IGCA 1B38A 3DBRB 4N58A 3ZO4A 3QWKA 1C3TA 4EZ5A 3Q3MC 3Q32A 4NZWB 3VN9A 4MX9A 4CCBA 1RQQA 1OUKA 3E62A 4FSQA 2AX5A 4C8BA 4RQVA 2GHLA 4ZTSA 4BDGA 1A06A 4PTCA 2EMSA 5AX3A 5K3YA 3K5UA 2RIOA 4ZOHC 5ETCA 1JQ4A 3GCPA 3LJ1A 4DEDA 2O65A 4WWNA 2LXAA 1UVRA 4XDCA 5LCKA 2LAVA 2BRBA 1QPEA 4PDPA 4RWKA 4BHNA 4IM3A 1BKXA 4MJSA 1O6KA 3PXRA 3O8UA 4KZ0A 3GCVA 4L67A 4EUUA 3IOPA 4BAXA 2YWPA 2C5VA 3W2OA 1WZYA 2RDBC 1TYGB 2RKUA 2R2PA 3WIKA 2OO8X 3ZUUA 1B6CB 4YXDB 3VUKA 4JDHA 2C5NA 1UU8A 2JRIB 3UVPA 3OCGA 2LRWA 4PF4A 2C0OA 1WGKA 4BDBA 4II3B 2PVLA 4DFYA 1QOFA 5AUTA 2GSFA 1YOMA 4PQNA 3TIZA 1Z5SB 1GB1A 3PT2B 3UMXA 3C4EA 3VUXA 5IA0A 2DS1A 4FG7A 3ZTDA 4UV0A 4XG8A 4TPTA 4Q5EA 2MJ3A 2Y5PA 2PE9A 4F9AA 3FKOA 5FP5A 4ZJIA 3UJGA 3DCGA 2HJ1A 2BQQA 5C27A 3DDPA 3QTSA 1ZP0B 4FTOA 4GG7A 4MXXA 5JRSA 3UOJA 4LRMA 3R1SA 4C36A 2I1MA 3POOA 1RLFA 4R8QA 2UVZA 3UF8A 4JJRA 4HGTA 4GK2A 3EFCA 2WTWA 5T68A 4KSQA 5BYSA 4YZBA 3HKOA 4F9CA 2V0DA 3DLSA 3NWWA 4QYEA 2NTSA 2XA4A 5JKGA 4LV5A 2IO3B 2OHFA 4WQOB 5AP2A 3JXWA 1HXYD 1E5WA 1K53A 4PV0A 1TKYA 2V3NA 3H9DA 4CYEA 3C9WA 2VNYA 2C3LA 3HRBA 3FY0A 3UTOA 2K0PA 4L42A 3JYAA 1TY0A 3IW4A 4AXAA 3WZKA 4DGGA 5D6JB 3DAKA 1FEHA 3J9CA 3QD3A 2HWPA 5JXVA 1H1QA 3HRFA 2GBRA 2NBWB 4ENYA 5IMXA 3CF6E 2WXNA 3MY0A 4RT7A 4G50A 4QP9A 4YP8A 3MGYA 3AD5A 3VUIA 5EKNA 4DBGA 3I0QA 4S2ZA 4NW5A 3SVVA 4OTIA 4J95A 4LRKA 1TTNA 1ZZLA 3P78A 3W2SA 4HVHA 2IJMA 3A4OX 3AEGB 4V04A 4NSTA 4CZYB 2G2FA 3E7VA 5DVRA 4ARCA 4MK0A 4B0EA 4AZVA 4CLIA 1LQBA 5DPWA 4RM9A 3AC2A 3QXOA 3LJ2A 3ZDIA 4YSZB 3OVVA 5EDRA 3VTUA 3COHA 3B1LX 1MRUA 4XWWA 4NCTC 2KK8A 4Y85A 1LUFA 1EUVB 4DHFA 1UH6A 2C6IA 3QQFA 3FC1X 4AFJA 3HUBA 3O71A 3QUPA 4DH8A 4CVAA 3SD0A 4NPNA 5J5TA 3BPRA 4CV9A 2X39A 3F3TA 3FL5A 1Y6AA 4EZKA 4XH6A 1GAGA 4ZTRA 4GUBA 5HNIX 2CGVA 3R8PA 4AZSA 2RGFA 1A70A 2REXA 2ERKA 2YIXA 3COMA 5TT7A 3E93A 2QO2A 3PLSA 1HA5A 2GBJA 4NH1A 4FHJA 3NLBA 2KDFB 4CFFA 3HV7A 4EK6A 2XK9A 3R00A 4IWDA 1C79A 3PXYA 4GG5A 3LFQA 4R3DA 1R4MI 3ZW3A 4AUQC 4OBQA 2PE2A 4F7LA 2YIYA 4PP9A 3V04A 4S31A 2EKEC 2IO0B 4RFMA 2W1DA 3C4CA 4I22A 1ATPE 1JSVA 4CTCA 2R3QA 3OCSA 3VNTA 5D7GA 2XBJA 1BL7A 5CU0A 4ANMA 3LVPA 5IUIA 2BB6A 3SV0A 4YJSA 1WGGA 3UPXA 2INNE 3QC4A 4OTFA 4TUUA 5GNKA 3VF8A 2FIDA 1RJBA 1OIRA 4EQUA 3FKYA 4XBUA 2BUJA 5A4CA 3R9DA 2HXQA 4MNEB 4EHGA 3N1YC 2JZPA 3VAPA 2WU5B 2Y4PA 3EL8A 3PV1A 3K5VA 1MQBA 4IWOA 5HKMA 3DHHC 2QR7A 1MG4A 4YTPB 3VUTA 2WQMA 3F7WA 3W8QA 3P08A 3EQBA 5AADA 4KGTA 3LJ3A 1DAYA 4J7BA 2NP8A 5AP1A 3OEFX 1C4PA 4ZJVA 4M12A 2HXLA 2KAJA 4YBJA 1WMKA 3DBRI 2X0QA 2YLFA 1WAKA 3JSVB 4MQ1A 4GU9A 4ASDA 2WMXA 3VHKA 3NS8A 4OAUC 5E91A 4AJYB 4MYGA 1YN5A 4C3PA 2XK4A 4NT4A 5EE9A 4W9HA 2GOWA 5LVOA 2BIYA 3VO3A 1WR6E 2YCRA 1HTOA 5E8YA 4NM7A 4RCOA 4FK6A 2GLSA 4KKEA 5EM8A 4PX6A 4WWPA 2QODA 2PIAA 3ORLA 4LUEA 4TYIA 4QMQA 4N70A 2E9VA 4NTTA 2ZV9A 3CSTA 4BGHA 1LEZA 3V62A 1XLOA 2O6VB 3AM9A 4E6DA 3IPHA 1JOWB 4O4EA 3VBWA 4C4EA 1V6EA 2R4BA 2BYTA 4XG4A 4KABA 4BCGA 5KZIA 2IGGA 1PXOA 3O7LD 4FZ6A 5HBEA 4ASEA 5AA9A 4F7ZA 3C7QA 3UZPA 2X7FA 4BICA 3GI3A 2UZVA 1SNUA 2GNLA 3Q3BA 3T8OA 4HYIA 4QP8A 3BIID 4V0GB 3PWDA 3TKUA 3D7TA 1DI9A 1YXUA 3NUXA 3NY5A 1Y8GA 4P2KA 4H58A 5FDPA 4MKCA 2C6TA 2XIKA 3VW8A 4CXAA 2BRHA 5HIDA 3R73A 4KWPA 3ET7A 4DGLC 1SF0A 4QQJA 4IJPA 1JMLA 3L8SA 4N59A 1VYZA 1ZDXA 2RFDA 4Z55A 4K1RB 4LRJA 3KRLA 2JT4B 4QQTA 2FUMA 2IVVA 5C9CA 4B0MA 5CT7A 2IY1B 4F8CB 3ZIMA 5L3AA 4C4VB 4HPTE 1APME 5LMAA 1RFKA 3KXGA 4I21A 3PSBA 4EQCA 2VV9A 5EOLA 4RQKA 3QRKA 1OQYA 1BUIC 4YZCA 1Q8TA 5K4IA 3W2QA 2YVCA 1STEA 4BOZB 4O4BB 5H8EA 1QKZA 2CJOA 1Q1OA 4AWIA 5CSWA 1PXLA 2C7HA 3RZWC 1KV1A 2P55A 3ZYYX 1EM7A 2BDFA 2VN9A 3ECIA 3Q9WA 2QCSA 2XIYA 1OPJA 5TE0A 2JF5A 1MI0A 3A8WA 3FSKA 2MSED 3W16A 4BTMA 3ZCLA 2B9JA 4I24A 1VLBA 2LXCA 3CLYA 3K3IA 1X8BA 3E92A 1UU7A 2ZVAA 4D2RA 4HPMB 3BK2A 3CTJA 1JWMD 3DLZA 2OJRA 3P0MA 3TBLD 3ZRMA 1M4VA 4AW2A 4A4XA 1AN8A 5I4NA 4BDHA 3BBTB 4G3EA 4MWIA 5AUUA 2R3NA 2XYUA 5CF4A 5E1SA 4QYHA 2FSMX 2XJ0A 4HJGE 4G16A 2WXKA 4LGHA 4AT5A 1CMXB 2ZM1A 5AUWA 3D5WA 5CS6A 3EZVA 3FXWA 2L0FA 3IDBA 1GZNA 3DKCA 3R1QA 1RAXA 5J1VA 3OS3A 2F7ZE 2AL6A 3DTCA 2O2VA 2BMCA 3MH2A 1E1VA 3N9YC 4JIOU 4A9UA 2WMWA 2OWBA 2BS4B 1TS2A 3LCSA 3RD2A 4LDTB 4FV3A 3QX1A 3D5VA 4M69A 3AC5A 3O13A 4PK1A 3OP5A 1H24A 1AWDA 2OJIA 4ANQA 4C4GA 1N63A 4U81A 2L83A 2M17A 2W9FB 4QPSA 4ZSGA 5KKRC 4TXCA 2YZAA 2J5EA 3DU8A 2KFKA 1YXVA 2J4XA 1FCLA 4TKNA 2NTTA 4DINA 2VX3A 4HZRA 1JROA 3EQFA 2AQ3B 3P7CA 5BVNA 3EOCA 4WJOA 2F2CB 5LXMA 3MA3A 5HX6A 3JVRA 3MBLA 5HO8A 4IACA 4RH6A 4ZYSA 2ESMA 3HV3A 3NUSA 2JWUA 4RX7A 5M53A 4HGSA 2R9SA 4AN2A 3LJ0A 2INCC 1D3ZA 3ZU7A 1WE6A 3EB0A 3VRYA 2L00B 4RVKA 4EC8A 2HY81 4EYMA 3OOGA 4JQ8A 4K81A 3AV8A 4DCEA 4EEVA 4AGUA 5ANJA 3H30A 4BDDA 3EQCA 4AU8A 2PEAA 3AE4B 1ZXHA 4NM0A 1J19A 1TVOA 4BOSC 4U97A 2FNJB 3TV7A 1RWSA 2PK9A 5J87A 4CKIA 3H9FA 3JS2A 3DJ7A 1NVQA 4JAIA 1UGMA 3WILA 3EECA 4ZAUA 4PTEA 4GOCA 5EM7A 2YFXA 2CGXA 3HV6A 3EQDA 2Y4IC 4FKRA 2ITYA 1TZ1A 3P42A 4L6QA 5LVLA 4RLKA 3RAKA 4AOTA 4M15A 2XKEA 4LJPB 5AP4A 4ZRQA 3QARA 3O17A 5HG9A 4IM0A 2YABA 3GC7A 3FHRA 3LLTA 4XNEA 5HO6A 3PTGA 2WOTA 2Y4IB 4BCOA 5DN3A 3U8ZA 2GMXA 4G3CA 4HKZE 1QOBA 3G51A 4MGIE 3ZFXA 5D3IB 5HE1A 2PZRA 1HQRD 3K2LA 1V1OA 4QP6A 3ALNA 4IAFA 3FJQE 3QD4A 4YJPA 4NUSA 4LNKA 2MX2A 2C6KA 3OTUA 3NAXA 1YXTA 2WTVA 1NI2A 3IBEA 3C0HA 4NCTA 4PL4A 4F6SA 4AZFA 2UVYA 4JGHB 1GNUA 1M7NA 2KWUB 3MDYA 1G6JA 4O22A 2ITVA 3OROA 5CXHA 2MWSB 2NBUA 5FM3A 3N9XA 4B9DA 4PYZA 5ETIA 1XLPA 4RZVA 3U9NA 1FCCC 1PYXA 3AE1B 1Z2MA 1DOIA 3EKKA 3IT6B 2KQ4X 2BAJA 2QSDA 5AP7A 5FDXA 4M84A 2R2OA 2L8JA 2C5LC 3V51A 1QL6A 4F9WA 2GB1A 2ZCBA 3FZRA 4UMPA 1YHWA 5HG5A 3VBXA 3P2BA 4FKLA 3SC1A 4G3DA 4Y46A 2WTCA 4JQ7A 5KUPA 4DAWA 4TYEA 4YURA 3MJWA 2CR5A 5EHYA 2DYOA 4QQCA 3D2KA 2WMBA 4UY9A 1WBPA 3PREA 4OT5A 2OIDA 4N0SA 4ARKA 3LFSA 5CEPA 4GEOA 5ANOA 4QNYA 3KA0A 4YHTA 4DG0E 4G9CA 4RIYB 1WXQA 2PZPA 3GOEA 4MNEA 5M44A 5DT4A 2UW9A 2J50A 4FC0A 3BINA 2HTME 4C57A 3HLLA 2K25A 4F63A 4RIWA 2PVGC 2C3IB 3ZDTA 2KC2A 3PUPA 2XNNA 2P2IA 4ICUA 2PMLX 3R3MA 5FQDC 3TXOA 5I0BA 1ZLTA 4NZLB 1V49A 1FM0D 2C9WB 1ZAOA 2W7XA 3E56A 2OI4X 4WG4A 2L76A 5ITAA 3I7BA 2J52A 2G3QB 3EN5A 5CF5A 3JSVA 4D0XA 1VZ7A 5AUIA 4FR4A 2B53A 4IAIA 3BHVA 1R78A 4RVTA 2G4DB 3WA0A 3R1YA 2RDGA 3ORMA 2HD5B 2GNFA 3TNPC 4GJ2A 4C4IA 4Q2AA 3QUEA 1YW2A 2UWQA 5I9WA 5E8XA 2JZ3B 3SX9A 5BVOA 5ICPA 3PZDA 2ZB1A 1OQRA 4HXDA 2WEVA 2VWZA 1DM2A 4ZY5A 2MW5A 2WX0A 3FHIA 4BCMA 2O6VA 1EH4A 2Y6MA 4O1OA 1P7FA 3A33B 4AW1A 4FICA 1WFCA 3PLUA 3G0FA 4RIXA 1R1WA 4XX5A 2BHEA 2OW3A 4JE3B 3A60A 2QDFA 2V3PA 1NENB 4MH0E 2JWZA 4H1JA 3PRMB 3PRIA 3LCOA 2HW7A 4ZSEA 1XH4A 3DBCA 1UELA 3K3JA 1Y8RC 5FTQA 4CNHA 3RCDA 4MTAA 1YXXA 2K8CA 3CQWA 2DQ7X 2W1IA 4JBOA 3B9JA 2BYFA 4ASXA 2RGPA 1C78A 2CJNA 4JLCA 4D2PA 3GFEA 4KBKA 1FRDA 1Q0WB 4CMTA 4BBMA 4G3GA 1Q8UA 3KN6A 4E26A 2QURA 4EH4A 4CFVA 3RPYA 3MN3A 3LAUA 3GZNB 5HGIA 3M95A 3AG9A 4BTKA 5CTPA 3R9OA 2KQSA 3RWPA 1MPEA 3H0YA 4C4FA 3V5LA 4FV6A 1QQRA 3WZUA 5IA4A 4LOPA 4GS6A 4XG2A 4BDIA 3LMGA 1RYJA 3WBLA 1QMZA 1LEWA 1AD5A 1JQHA 4KIKB 1GNGA 3VUYA 2UW8A 3ZUVA 2V3SA 4DXFA 4OGRA 2BTRA 3V8WA 2YM7A 4CQNA 1UU9A 4ZIMA 3ZRKA 4ERWA 1J7CA 3F66A 2DYMA 3ZBXA 2JRHA 1H08A 5HBJA 2AUHA 2G9XA 3A4SC 4XC2A 5JQ8A 3RPVA 2AC5A 4HW7A 4J8NA 4S0RA 3V8TA 4IB5A 4D2VA 3C50A 3Q6UA 2WQBA 1FFVA 4HJKA 2M8SA 5JH5C 5H8YE 3MI9A 2O64A 1FXTB 2AYPA 1IA8A 2BPMA 3RJCA 1OL5A 3DBEA 3TNHA 4K77A 3NNXA 4CFUA 1N61A 3NR9A 2KT7A 4HDQA 3A1QB 2QLUA 4I3ZA 4OW0A 4YJTA 3A9KA 1YI4A 3CY3A 4GIHA 4WJQA 4KIOA 2ZPNA 4ZRPA 2QOFA 4ALVA 5CQWA 2XEYA 4FYNA 2YJRA 4O1PA 2MRPA 5AP5A 2IYDB 2JKKA 1JKSA 3MFRA 2VTNA 3HGKA 4FTQA 1WH3A 2N7DA 3JPVA 5AEPA 4E4MA 2X8XX 3R0TA 4H39A 2V0GA 4EC9A 2YAKA 3KK9A 5F4NA 2VO3A 1PXJA 4HK2A 3BWJA 3KGAA