3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC80376 protein
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
molecule tags Immune system, signaling protein
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
4W9JA 3OROA 4RGJA 1K3AA 1Y57A 2QKWB 3ZTXA 3L9LA 4J7BA 3V5WA 2C60A 2IYDB 4XOYA 2ZV2A 2J50A 4FIFA 1XBBA 1H8FA 3HDNA 2WU6A 4QMVA 3ULZA 5I9XA 5JQ5A 2DYOA 1H4LA 5CALA 3AQVA 2EB3A 3NCGA 4O2ZA 1PXMA 3S3IA 3JS2A 4XG4A 5J7HA 4II3B 2ERZE 3R7YA 2R3QA 3C1XA 1P14A 3H3CA 5AR2A 4AOIA 4K0YA 2DHZA 4HGSA 3L0WB 5DPSA 3P23A 3TWJA 1Y6AA 4CMUA 3H9FA 4JQ8A 2BHEA 4HPUE 3LHJA 4DGMA 5A9UA 1J19A 3W1YA 3DNDA 4E6DA 3KRJA 2C6LA 3NNVA 4JBPA 2JRHA 2NRYA 4Y46A 3RMFA 2C3KA 4OUCA 1OEYJ 4XRJA 4HJKA 5DPWA 5AADA 1ZOHA 3AMBA 4D1XA 4C35A 3EFLA 4QPAA 4JQWC 2J0IA 3SD0A 3HEGA 4K7SA 3F3ZA 3W55A 1JKKA 4L67A 2WTWA 4J95A 4YC8A 4OTGA 4PTEA 2HAKA 3UP7A 4AOTA 5TO8A 3QWJA 3U87A 4KRCA 3W16A 2HTHA 3D14A 3FXXA 3EL7A 4TXCA 4KDIC 4X3JA 1YXVA 3QRUA 4RJ8A 3T9IA 5LVNA 3LFEA 3IGOA 4X6RA 4AA5A 3DLZA 3SHQA 3PE1A 4NIFA 4TWNA 1LEZA 2BRBA 1XWSA 3OOGA 3D5WA 3DBDA 4RQKA 4BKSD 4EOMA 3H0ZA 4DFLA 3AMAA 1Z2MA 4WWOA 4YJPA 3ZLSA 3QD2B 2GU8A 4DTKA 3MVMA 3EWHA 4MF0A 4FYNA 3NAYA 4O0UA 3FPQA 2KX3A 2J5EA 2XK8A 2QOHA 3MJWA 4QMPA 4ZTRA 2KLCA 3FZ1A 3FXZA 3AMYA 1SM2A 1OPLA 5HG5A 4FL2A 4B7TA 4MGKE 2RGPA 3DVGY 3PVGA 3F66A 3MDYA 4N70A 4A9SA 3OG7A 3HMPA 2VTNA 4M66A 3APDA 4P7IA 2BCJA 2QVSE 3TZ8A 3U9NA 3DBRI 5A6OA 3ROYA 3BGPA 5LCJA 2EWAA 4FSYA 3UIBA 5G2NA 3S1HA 4AWIA 3Q5ZA 3VS2A 4W9KA 3E62A 4JR7A 2QOQA 4FV5A 5HGIA 5IH4A 2LD9A 4PDOA 3UTOA 1W98A 3ZLYA 3VTWA 1Q5KA 3Q3BA 4K33A 1JKTA 5JMSA 2P2HA 3C0GA 1U5QA 1OUKA 2EVAA 5J8IA 2KJRA 2LWPA 3A33B 1B39A 3ZUTA 4UB7A 2W7XA 2R7IA 5ANIA 2CGWA 2RG5A 4FVRA 4GK2A 1WM3A 4DHZB 3PPZA 4UXQA 4EC8A 3P2BA 1J8CA 5FWKK 4L46A 5CENA 3A8WA 3VUMA 2KKCA 2R3HA 4KBKA 3QZIA 2DYBA 3NZUA 5AA9A 4EORA 4FNWA 4QQCA 4BBEA 1WM2A 3QTWA 4DCEA 3MIYA 4O0WA 1AD5A 4X3FA 5HNGA 3FKLA 4KIOA 5ANEA 4A9UA 4W8DA 4ZSAA 5HVKA 1H8CA 4A7CA 4R1YA 4W9HA 3MPAA 4NFMA 1XR1A 2IW6A 3UINB 4B6WA 3OLMD 4KKHA 2ZYBA 2O5KA 3TV4A 3EN7A 1CTPE 5TOZA 3PSBA 3AC1A 3MIAA 1JKLA 3CCNA 4DGGA 3DPDA 2IY0B 4ITIA 3A7IA 1XBAA 3BWFA 3I7BA 2NR2A 3KUZA 2UUEA 4D9UA 5CF4A 2QU5A 1YD8U 3QX1A 3AC2A 2VNYA 1UU9A 3TJDA 1AQ1A 2W1ZA 4KRDA 4NIFB 4FZ6A 1VJYA 3IOPA 3GOKA 4DGNA 3GU6A 4TNBA 1WBPA 3KXXA 3I4BA 4X2NA 4B8LA 5JFWA 1JVPP 1CDKA 4L9IA 3E8CA 4TYHA 2XK7A 1SVHA 1R0PA 1MP8A 2ZAZA 3CXWA 2C6IA 2XJ0A 3Q53A 4FSRA 4H1MA 4I6BA 3RBWA 2IN6A 2CDZA 4BKGA 2FCQA 1E1XA 3PXRA 2WPAA 3W8QA 1FVVA 4KKGA 3I60A 3UYSA 4RIYA 4HYHA 4BKYA 2WX1A 4GIVA 3ZMMA 3TKUA 3UJGA 3I1AA 3VUGA 3W18A 2AC5A 3BYUA 3L10B 4BDGA 4XRLA 2M0XA 2OZAA 4UV0A 4EUUA 3GNIB 1I09A 4IXPA 3ZRKA 4BCPA 1U5RA 4LI5A 4IDVA 1YXXA 5F4NA 4DEGA 3HV3A 1RJBA 5KO1A 1UD7A 1YX5B 4CVAA 1W84A 3TXOA 3DPKA 3ZEWA 2FUHB 4JL9A 2UZLA 1YVJA 4IEBA 4ITHA 2BDFA 4XBRA 3BCEA 2BHHA 5CHFA 2GS2A 4NWMA 3MH2A 4WG5A 2YFXA 2HWOA 4U40A 4YZMA 4RZWA 3KK9A 4IX4A 4EEVA 5HZNA 1WGGA 2DAFA 3OXZA 5DPRA 2XS0A 2NO3A 4MM3A 4E73A 5KKRC 4YSJA 5D94A 4HW7A 2DAJA 3K9PB 1NXKA 2XM8A 3OCTA 4I5CA 3FMEA 1RLFA 4HCVA 5CSVA 1Q8UA 4WG4A 1WRDB 2V4LA 4UMPA 4ASEA 3SXFA 2IVVA 3ZO5B 3POOA 2WXVA 3VS0A 3JPVA 3F88A 1NVRA 4X3FB 2H8HA 4A06A 4YU2A 3RI1A 1UNLA 3B0AA 4BCHA 4H1JA 4BDDA 4BWPA 1ZGUB 1ZYCA 4Z7HA 4C4EA 5LXIB 3THBA 3R1QA 2QO9A 4QMMA 1FMKA 2WEIA 1XJDA 3EQPA 3UIMA 3ZDUA 4NK9A 2XYUA 4ZLOA 4F65A 3PRMB 2X0GA 4WRSA 5DNRA 2RSUA 3DNEA 2ZCBA 3R0TA 4RWIA 5CZHA 4KNBA 2OW3A 2XKDA 4G31A 1U4DA 4A9RA 2KTRA 2XVDA 5LMAA 5KCVA 3DGKA 3PWDA 4I0SA 1H25A 1KV2A 4TYHB 4YC3A 1T0YA 3DJ6A 3ET7A 4E20A 1XH7A 4PRJA 3UODA 4BIDA 2H6DA 2GOWA 3KVXA 3KYCD 4LJOB 4M8NA 4JXFA 5HHWA 5GZ9A 3TBLD 4RIYB 3E87A 4ACMA 4WBOA 4WSYA 4ZAUA 3NS8A 2VRXA 3PP1A 2C5OA 3QFVA 3PSEB 2B9IA 4YMJA 3QD3A 4KIKA 5HLWA 2OZAB 3FMDA 4EL9A 3EZVA 4W8EA 5E8XA 1GZ8A 4EQMA 2YDKA 4GVJA 3ZNID 4L53A 3VUWA 4GJ3A 1KV1A 2LVPA 3KA0A 3VO3A 2Y9QA 4QMTA 4M97A 3MA6A 4IWOA 1GNGA 4E93A 2X7GA 4BCNA 3MH1A 1Q1OA 2XBBC 2Y5BB 3FI2A 3LXNA 2P33A 3I7CA 4Q9ZA 4E71A 3CJGA 3QCXA 4C4IA 3DTCA 3O8PA 3FXWA 3V51A 3QK0A 3CPCA 3G9NA 2WOUA 1WX9A 2MLBA 1Q3WA 3QTXA 4BYJA 5DPVA 2A19B 3HA8A 5AV1A 3R9NA 2IO1B 1PF8A 3NUUA 4YJSA 3NY5A 1BMKA 3FQHA 3KRXA 3AD6A 3KULA 4QMUA 1F9JA 3OP5A 4IB3A 2JITA 3DKOA 4XS2A 5B0XA 4BZNA 4M7IA 3DAJA 4HVIA 3NLBA 4FOBA 2KJ6A 2EB2A 2V1YA 4HDOA 5I0BA 2C0IA 2KTYA 4K81A 3SAYA 2BFXA 2R3KA 4G3DA 2XCHA 2D3GA 3ERKA 4LRKA 2H9VA 4D2RA 2C3IB 1QPJA 3TKIA 4FKOA 2BVAA 4FK3A 4G3GA 3ZO2A 4BKSA 3EQFA 4FKLA 4GRBA 1WCCA 4QP8A 4WRGA 3VUXA 4Q5EA 4U44A 2M1MA 1U54A 1FMOE 5C27A 5HNIX 2J0LA 4YJTA 3E5AA 3MGYA 3Q9ZA 2WMVA 3RVGA 1FXTB 2PMNX 2YLFA 1XO2B 2PZRA 3A7JA 3RKBA 4HYSA 2KTRB 2W1EA 3QKLA 4G16A 4A3PA 3VHTC 2ITZA 4PP9A 3AD5A 4X57B 3QQJA 4I41A 3VIDA 5IMXA 2DENB 2R2PA 3O51A 3COMA 4D4VA 4I5PA 1WVXA 4CRLA 3H9OA 4NH1A 3BY4B 5CT0A 4C4HA 2ONLA 2IZSA 2DZJA 1NBFC 2UW4A 5EYKA 3W2PA 1H00A 1OKZA 4U97A 4EH7A 5IA1A 3KVWA 1O6KA 2OO8X 3U8WA 3WZKA 3M42A 5DR6A 2W99B 4BZOA 4KIKB 3DCGA 3V3VA 2HJ8A 3R9DA 4EONA 2YACA 1WZ0A 2CHXA 4GDLA 2W1IA 3OZ6A 4DEEA 4G6OA 2CN8A 3FC2A 2XIYA 4FODA 3H10A 3OXTA 5EI6A 4LJPB 3SXSA 4MBLA 4R1VA 1BL7A 4U6RA 3VS3A 2WFYA 4WD5A 3QA0A 3W33A 4F7SA 3UGBB 5HTBA 3DVNU 3SDJA 5JFVA 2C4GA 3TIYA 1J91A 1P4OA 2WMTA 5K9IA 3I5ZA 2ITTA 3B8QA 3OS3A 1J1BA 4FKTA 3QLFA 4DLJA 4ANXA 2GS6A 3EMGA 3M1SA 4LUEA 4FT9A 2Y6OA 3ECIA 2HIWA 4JIKA 4AOJA 4YURA 3HV4A 4BCMA 4A9YA 4O0YA 5ETAA 2UW7A 2JBPA 5ANDA 5FXRA 2G4DB 3ZRMA 3KULB 3CSFA 5K5NA 4EFOA 1SVGA 4MQ2A 4FT5A 4I21A 2YDIA 3KMUA 4UWYA 3ZLXA 1UBQA 4DYMA 2Q0BA 1V6EA 2W1CA 4XP3A 2KDFB 3RP9A 5AUVA 3OT3A 3VBTA 3TMPB 3X23A 3LCTA 5KMIA 2OH0E 2E9PA 4FZDB 5FGKA 1Q0WB 5AEKB 3WALA 1YWVA 2JIUA 1W82A 3RHKA 5IG1A 2J0MA 4M84A 5F20A 3RZFA 3MTNB 3NHEB 3C51A 3R2BA 4E3CA 3RM6A 2BR1A 4FKIA 4MXXA 3IDBA 4P5QA 3TNHA 4F0GA 4GU2A 1PW2A 3ZUVA 2Z60A 3Q60A 4FX3A 1NY3A 1U54B 2C1AA 2I0HA 3PA5A 4UZHA 4E74A 4BF2A 1LUFA 2CU1A 5GNKA 3CEKA 4FSTA 4F63A 4OBQA 2YIQA 2GFCA 2PVNA 2E2BA 2Z7RA 3LFCA 3QRKA 4CFMA 2YM7A 3R83A 5L6OA 3LJ2A 4L52A 3VS7A 2NPQA 4JVGA 2C3LA 3EB0A 1P4FA 1UNHA 3EKNA 3FPMA 3O96A 1G6JA 2VX0A 4XJ0A 3FZSA 5BVWA 4PNKA 2KDEB 2KQSA 4I6NB 4QYHA 2JIVA 2OIBA 3FZPA 2REIA 3PJ2A 3VQHA 4PQNA 1E1VA 2N1WA 3ULIA 1WBTA 1OIRA 3AT2A 4FK6A 4I6FA 5DN3A 5I3RA 4GDLB 4ZXTA 3VQUA 2W1FA 3LFBA 4D58A 4IANA 4E26A 4FLHA 2IWIA 5DEWA 1GAGA 4MNFA 2JDOA 4P90A 1PXNA 5FRIA 5H8EA 3T3VA 1TBEA 2FH9A 5CSHA 4QMXA 2UW6A 3RTPA 3VUYA 3BQCA 1R0EA 4QMOA 3PLVA 1J0GA 3HMOA 1G3NA 3UF8A 3RK9A 1WGHA 3QCAA 4NKSA 2QKRA 3OWLA 4ZJIA 3FLZA 2R4BA 2FGIA 4ICVA 3SKCA 3A4SC 3GT8A 2JDRA 4FKVA 3RT3B 1C1YB 4ZTSA 2KOXA 4I20A 3LIJA 4GL9A 4LFIA 4NM0A 5ETFA 4U80A 3ZRLA 4BDFA 5IA0A 5C03A 3UZTA 2M17A 2W4OA 3KW5B 5HIBA 2V5QA 2VTRA 4PMSA 2EUFB 5HBHA 4EQUA 1KE9A 3FKOA 4C62A 2V7OA 3E92A 1YDSE 4MXCA 3SXRA 2Y4PA 4AE9A 4Z55A 4GT3A 3V6CB 4FNXA 2HELA 2JEDA 5C26A 4ZTQA 3TCAA 4HNIA 3BI6A 5BPYA 3A9JA 2OH4A 4V0GA 2J0MB 2PHKA 2PE9A 2C6EA 4V05A 3UVPA 3ZO3A 5FEDA 5LVPA 4YZBA 2KFKA 3NGAA 5CWZA 2CMWA 3GVUA 2UV2A 3SLSA 3TJCA 3ZZEA 2KMAA 3SA0A 3VDZA 5CAOA 4NPNA 4UY9A 5IEYA 3PG3A 2PE0A 3PUPA 4GV1A 3A7HA 3ZXZA 3IO7A 4LYNA 1V2YA 4JDHA 5AZFA 2FCMA 4CKJA 3ZC5A 2AL3A 1ZOEA 3PY1A 4L68A 4NCTA 3ZTDA 4FSUA 3SOCA 2GNFA 2PZIA 4AA4A 2RL5A 1M14A 3PIYA 4NFNA 1EF1A 2C5NA 3UIXA 3LJ3A 4QOXA 4AN9A 5CU3A 2XA4A 4RJ7A 4BRXA 4DXAB 4PWNA 1XH6A 4KKEA 3HRFA 4MWHA 4QYGA 4UZDA 3CLYA 4IMYA 2UW3A 3RWQA 5HTIA 4DDID 2VZ6A 2YIXA 3I6UA 4EH5A 4C3FA 5EM5A 3BBWA 4CMOA 5DHJA 3RCJA 3C4CA 3QZHA 4J8NA 3HV7A 3JW0X 2IO0B 1ZARA 2UZOA 4FTTA 3T8OA 5M51A 5HG8A 4MXZA 2YM8A 1WAKA 2B9HA 2WQEA 1H26A 2ZJWA 4YC6A 4ACHA 5FBOA 4EK3A 1OPJA 4L3LA 3VUHA 3UQFA 3NZSA 4Z9LA 2OOBB 2QONA 3PWYA 2R3LA 1SNUA 4AW2A 3S2AA 4U41A 5DVRA 3DQXA 2KXJA 4R3RA 3QQLA 3U6HA 3U51A 4E4XA 4EWHA 4DH3A 4Y72A 3LVPA 5DBXA 2LXCA 3QTRA 5HIEA 4W4WA 4LRJA 3RPRA 1FOTA 2OXYA 5CSWA 2V7AA 2VWIA 5H2UA 1W7HA 3FBVA 2YJRA 3EFUA 2ZOQA 3P08A 3IONA 3VW6A 3PIXA 3T8MA 1KE5A 5HX6A 1TTNA 3ODYX 4XG2A 4XP2A 3DZQA 1RFAA 2X39A 3ZXTA 3CE3A 5JH5C 3PVLA 4GCJA 5TR6A 3V5TA 4MAOA 2W5BA 2WKMA 3C4XA 3OW3A 4FV7A 4TQ1A 2ZEQA 4QP3A 4A3OA 2G9XA 1WYWB 2MQJA 4P7EA 2ZPNA 4NY0A 2WX0A 5J5SA 3A9JB 2X7OA 3QX2A 4P5ZA 4V0GB 2K6QA 2VTIA 4JDIA 3W1FA 2P2IA 4L45A 4BWXA 5A4EA 1LFDA 4HLEA 3JUHA 1TGZB 3BRBA 3O50A 4BDKA 2KFKB 5HORA 4PS8A 4GEOA 5DLSA 5JGBA 2JDSA 4RMAA 3V5QA 2L0FA 1PKDA 2OIQA 4UWCA 4EHVA 4I6PA 5CLPA 2ZVAA 4IAFA 1FPUA 3TL8A 4FV8A 4ZLYA 4EOSA 3BYOA 4RX9A 1WFYA 1CMXB 2HXQA 4F9CA 5IZFA 1Q8TA 2R9SA 2FSTX 2JZZA 1OIQA 2VTSA 2WTCA 4A4XA 5JQ8A 4C58A 3R1SA 2YN8A 4JT3A 2ZCCA 4IHPA 3UMWA 4C02A 5J79A 3G6HA 3KQ7A 4BGQA 3D2KA 4KSQA 3VJNA 3DDCB 1PKGA 3SQQA 2XNMA 3V6SA 3V5PA 3WIKA 4YO4A 2KTFA 4AFEA 3K3JA 4CFUA 4ARKA 4BVUC 4KBAA 2OJGA 2B3AA 3QARA 2ITNA 2YEXA 3DKCA 3WZJA 2FSLX 3G5DA 4UMQA 4ZZMA 5HO7A 5IISA 1ZYSA 5C1QB 3K9OB 2KWCA 5L8LA 3DQVA 1ZYDA 4AP4C 4DK5A 5HU3A 4M68A 2PVRA 4ANWA 4ZSEA 3AU5A 5FR6A 4GB9A 1GZKA 3P86A 3QRJA 4IB0A 2JPHA 4J1RA 4DGLC 3NZ0A 2BRMA 1WJ6A 4FV2A 4RSSA 1Z5MA 1STCE 2ITPA 3AG9A 4YP8A 1E8WA 5BO4B 3UYTA 4JNWA 4XV3A 3A8XA 4H3BA 3QIJA 3KXZA 1JWHA 5DT4A 5GJFA 5DT0A 4PX6A 1JPAA 5EH0A 5I9VA 4ZJJA 3UIUA 3MPTA 3QYWA 3SHEA 4ANQA 4MD9E 4EZKA 4DEIA 3FL4A 1U4AA 4DEBA 1BYGA 3DZOA 4FKUA 4G3CA 4FZ7A 2YERA 3K54A 4D5KA 2IZRA 1Q97A 2EXEA 2PSQA 5HLNA 1UH6A 4G1WA 2AWTA 2VGOA 3KGAA 3JY9A 3FSFA 5CEQA 3FLQA 2QQ7A 3R71A 4BHZA 3CSTA 3QBNA 2OK1A 5AX9A 4CEGA 5E8YA 5CY3A 3VF9A 3QQUA 3EFJA 3DBEA 3TNPC 3QTSA 4AA0A 3UIPB 4CZUA 4NW6A 3QU0A 4Y73A 4ERWA 4GH2A 2V0DA 5F94A 2N9XA 3D4QA 4FUXA 5DA3A 4C3RA 4CSVA 4OTIA 4AUQC 2BAQA 3EQIA 1NVQA 2RSVA 4M67A 5K3YA 4AT5A 3QC4A 5J5TA 2CHZA 4KSKC 3AC4A 3LFQA 1PXPA 4ANBA 4RBLA 5L2WA 3R1YA 4X6QC 3Q3FA 3V60A 2OJJA 3MB7A 2QLQA 4F9AA 5HTCA 4RG0A 2XK5A 4FADA 2KO3A 2YJSA 3BPRA 4EHEA 2W9FB 3FMHA 4HNFA 2A1AB 2PMIA 3B2WA 3FV8A 3H0YA 2QC6A 3HUBA 4KABA 4PTCA 5E7RA 4CLJA 1J1CA 4IM2A 2JFLA 3A2CA 4YNOA 1IP9A 4ASWC 2BGFA 3FUPA 3KCKA 3VW8A 2VTMA 5D7AA 2XB7A 5FBNC 4BBMA 5DPTA 2WMQA 3A99A 5HCZA 2RGFA 5HU9A 1JQHA 2W5HA 3HGKA 4FTAA 5HE2A 2C1BA 3AOXA 4USDA 5DRDA 5BUIA 3FY0A 3QGYA 5HO8A 4DFZE 2N7EA 3DBHI 2DYLA 3C50A 2B9JA 4O6EA 2MBHA 4G6NA 1GZNA 3QCQA 4EOJA 5DOSA 4F1MA 4C4FA 2BZKB 3ZDTA 3MJ2A 1X8BA 3H30A 3RM7A 2GNIA 3PSDA 4I4EA 4OT5A 1R1WA 3DAKA 2JC6A 3RAKA 1ISNA 1TZ1A 1OKVA 1ZXEA 5CEOA 2V55A 4LL0A 2F57A 4XG6A 3SX9A 2KX0A 2ZJDA 4LGGA 3FI4A 1YXUA 5DR9A 3RNIA 3UC3A 4RWJA 2WO6A 4DC2A 4QMQA 1BI8A 3F2NA 4JLCA 1H4RA 3EQDA 1HE8A 2BWES 2WQOA 2JZ3B 3HLLA 4EKKA 4O22A 4MGIE 1T45A 5AUWA 1OL1A 4C59A 1OTRB 3AT4A 2A4LA 3D2IA 3K5UA 3QQKA 4AP7A 5KUPA 3JYUA 1OL6A 2VO0A 3EQCA 4HJOA 1CSNA 4UYAA 3UMXA 3CF6E 2OGVA 5CI6A 4A07A 3Q9XA 4BCJA 3P7BA 2H34A 2OXXA 4GT4A 4YNEA 3S95A 4PY1A 3GENA 4BGGA 2KVRA 2VTTA 4FBJB 3ZTCA 3VUDA 3L9PA 4LV5A 5JRSA 4PS3A 3TACA 4O2PA 3AU4A 3HZTA 3E7OA 3KK8A 2OI4X 3PIZA 4QTBA 4AF3A 4HCNB 4PV0A 5GZ8A 2X2KA 4YBJA 5BVEA 4TZRA 4J98A 2BDWA 1I44A 3UZPA 4A9TA 4R8QA 5FXSA 4WOVA 2XK5B 2W17A 4YJRA 1RAXA 3KRRA 4J97A 5BVOA 4ANUA 3HM3A 1PXJA 4FTNA 2QURA 3BU5A 2VTOA 5KE0A 4IAYA 2VTLA 2CLQA 3Q4UA 5EDRA 3FWQA 4L3JA 5JGDA 5JN2A 3HMMA 2P55A 3QQGA 4FV9A 4RX8A 4F0IA 4XEYA 4O0RA 3I5NA 2BWFA 3EECA 4V04A 4W4VA 2EU9A 1UU7A 2VN9A 1O6LA 2C6KA 1JOWB 1ERKA 4MH7A 3T9TA 4KV2A 3Q3JA 2X4ZA 3ORKA 5EDPA 5BUEA 2HY81 2R64A 3HV5A 3M2WA 2JAVA 4U42A 2BIKB 4C4JA 4NM5A 3TCPA 5J9YA 3UNKA 1UVRA 2REXA 2XIKA 3A62A 3CC6A 4FBXA 1OVEA 4FIHA 4YJOA 4AZWA 5A4QA 2UWQA 3GOPA 2XK9A 3IK3A 4GYIA 3CY2A 4U8ZA 4BCGA 1Q4LA 4C3PA 3N30A 4DDGD 4B9DA 3PLUA 3VULA 4DAWA 2JKMA 3LQ5A 2NBVB 2XKFA 4BL1A 3KVFB 1XH9A 5J9ZA 4EKUA 3FQSA 4CV8A 3E8EA 4ANMA 4F99A 4BTJA 4FI1A 1GJZA 1Q99A 4R7IA 3RJCA 4AN2A 1SMHA 5AZGA 4JG6A 4EK6A 5CAUA 4DHJB 4G11A 3PE2A 5AM7A 2W9NA 4GFMA 2KC1A 4Q9SA 5B2MA 4GFOA 1T46A 3L9MA 3PXQA 5IH6A 2OKRA 4XH6A 3NUNA 5B7VA 5CX9A 3V61A 4IWQA 4BFRA 3ZW3A 4FTKA 2FYSA 2O64A 2YWPA 3UQCA 1OMWA 2OJFE 2ZM4A 4EH2A 3OJ3A 4FR4A 4PTGA 4AE6A 1YHVA 2QR8A 3PRIA 5T6KA 5M44A 4WWPA 5K4IA 4AN3A 4JS8A 4WNPA 2HD5B 4DN5A 1OEYA 2IVSA 2GHMA 3ALOA 3RPVA 2XNPA 3BE2A 3LJ0A 3NOBA 2XNNA 2LVOA 1M7NA 4MKCA 3R7VA 4GVAA 3IKAA 1WXSA 5LXHA 2I1MA 3Q2MA 4H39A 4KIPA 4YBKA 2G15A 2G3QB 4LUDA 2N4FA 1Q41A 2OIDA 3M3JA 4ICUA 1BKXA 3RAHA 4RLLA 3NUSA 3OBGA 2PMLX 3B8RA 3U4UA 4RLKA 4BI1A 4BBNC 3RK7A 4GU9A 4IDTA 2ITXA 2FAZA 4WIHA 3KMMA 4GU6A 4ZLZA 4IC8A 5AV0A 3U4WA 2O2VA 3NEWA 5IKWA 4FTOA 4IVAA 2I40A 3NCZA 4OW8A 4C33A 4GG7A 1WBWA 1GIHA 4L42A 4RJ3A 4NQLB 3SD5A 3CQWA 3GCUA 4X7QA 4O96A 3FSKA 4EOOA 4CTBA 4PMPA 5AAGA 3IW5A 1O9UA 5CI7A 5CT7A 4FV4A 1OIUA 3BYSA 2IVUA 3H1UA 1XQZA 1NDDA 4MQ1A 3KF4A 2G45B 3VAWA 2ZDTA 2BZIB 4AS0A 3P1AA 4F08A 5I9ZA 1S1QB 4APPA 1WI0A 1FVTA 3PG1A 4BIEA 3Q9YA 2PE2A 3R22A 3UDBA 1UKHA 4XUFA 5J1VA 4WBBB 1YI4A 2FB8A 4JI9A 3S00A 4M15A 4CXAA 4AGWA 4BICA 4NAWA 2CGUA 1WGYA 1H1PA 3NW5A 2KHWB 2L0TA 3OAWA 4R5YA 4CTCA 3R8LA 3BV3A 3M11A 5ANKA 3MPMA 2UVZA 5BMSA 4PS7A 4MGZE 4QRCA 1AARA 1C3TA 5EDQA 4HCPB 2JKKA 1TQIA 5HNBA 1QL6A 3DK7A 2A2AA 3BLRA 3HP5A 3NW7A 3O23A 4H3PA 5KMKA 1V86A 5AUUA 4K77A 3TV7A 4PMTA 3OF0A 4MD8E 2ZB0A 3NUXA 1B38A 4DFNA 5AEPA 3T9LA 2W96B 4RVKA 1OQYA 3ZO1A 3H7PA 3VN9A 1FGIA 4BDEA 5KKRB 3L13A 4XYFA 4Y8DA 4ALUA 3SW7A 2MW5A 5CHVC 4FA2A 4OTDA 5KMLA 4JX3A 1TQPA 5EHOA 4UMUA 2VWWA 1EO6A 3FLYA 5EK7A 4IW0A 4M69A 2JFMA 3QYZA 4OBOA 3QHTA 4MEDA 5AP0A 3L8XA 5CTPA 5AUTA 4JJRA 3RZBA 4X21A 4GSWA 4LMNA 1OM1A 1PQSA 3ZBFA 1WGDA 2VX3A 4I1ZA 5HCYA 1Z5SB 2XCKA 4NW5A 2LUEA 3M95A 4XG7A 3R3MA 4G9RA 1M2QA 3HRBA 4HYUA 3IDCA 2VO7A 2KDBA 5L83A 5H3QA 5GHVA 3RPOA 4DH1A 1ZRZA 4NJDA 1H1RA 3SDLC 2O2VB 4TTHB 4ZY6A 4D0WA 4AWJA 3B08A 3MFRA 4A4LA 3PTFC 5CVGA 2GPHA 4USEA 3EQRA 4PYUA 1MQBA 4ZEGA 1Q8WA 3LXKA 3DKGA 3MY5A 4CZYB 3QZFA 4L43A 5CEIA 3PRPB 5IMEA 4WG3A 4KS7A 1LPUA 2OSCA 3HKOA 4NKAA 4WHZA 2YM5A 5KBQA 2F7EE 5HOAA 3ZCLA 2G01A 3IW6A 4E5AX 4ERKA 4J99A 4RVMA 4NZWB 4FL1A 3EFKA 3ENHA 5C01A 4HGTA 4F9WA 4IX6A 2ZV7A 1E7UA 2WMRA 3W1SC 4BKZA 1IYFA 2DS1A 1BT0A 3A7GA 5HO6A 1YX6B 3OD6X 2F49A 3F69A 4I6HA 4K2RA 5ACBC 3UQGA 4LMUA 4C38A 5J9LA 3MHSD 1H24A 3C4FA 4NAWB 5IAAC 3V6EB 5EI2A 3U7DA 1E8YA 2F7ZE 2BILB 2N1VA 4YHTA 3ZSHA 4IE9A 4UWBA 2IO2B 4ENYA 4XNEA 5D7GA 3C4WA 4FTLA 2LXAA 1MUOA 3ZKJC 3OEFX 2AC3A 3BYMA 3D15A 3JXWA 3ML8A 3NAXA 3R28A 1IG1A 4KD1A 3R7RA 3NNUA 3PJ3A 2B54A 4AG8A 3E63A 3I0QA 3GGFA 3KF7A 3GCQA 4Q5HA 1EH4A 2DZMA 1IRKA 2O2UA 2X8IA 3H7PB 1W0XC 4WJOA 3D7ZA 4GDKA 4EOYA 3TUBA 4FN2A 2CGXA 2X4FA 2KD0A 1WX8A 2XYNA 5CU6A 4FEQA 4E5WA 1MQ4A 3QC8B 5K4JA 4M69B 4HGLA 4MNEA 3H9RA 5CNOA 3ZRFA 5KHWA 1SVEA 3LQ8A 2KMCA 3ROCA 4WUNA 3GQLA 5JZEB 5AV4A 5E91A 1ZKHA 5GMVA 2UZTA 4WNKA 3DY7A 4FT7A 2FCNA 2KWVB 1H1WA 1UNGA 5C8KA 3VS4A 3U30A 3W2CA 3Q4CA 4BKTA 4LDTB 5IUGA 4FA6A 2XRWA 2XIRA 4KA3A 5AR4A 4MXOA 4IZAA 2CPKE 4TQ0A 1KE7A 2WNTA 4PYZA 4HVHA 5H8GA 2GBKA 4YTCA 4FT3A 3EQGA 2PK9A 4BBNF 1S3SG 2KC2A 1RDQE 4FTIA 3QRTA 2HOGA 3E3PA 3MY0A 2OFVA 3UPXA 3VH3B 2LGXA 3BLQA 4FJYA 4ZDVA 3TUCA 3RZWC 2EKEC 4IBMA 3UE4A 5AV3A 4X2FA 4RFZA 4QYEA 4MSQB 4G34A 1DS5A 1UV5A 4W9XA 1QZEA 3BHHA 2OJ9A 2CJMA 3MSSA 4OTWA 3LPBA 4X0MA 5ANGA 5HD4A 4OAVB 5BYZA 3DFCB 5A14A 2HY0A 4WNOA 4RIXA 3CD8A 2IZVB 5E8SA 4C8BA 4I6QA 5BNJA 2OF4A 5LJJA 3ZNHB 1YWRA 3EN6A 1YQJA 3CTQA 1VR2A 1UA2A 4FV6A 4YJVA 2X8EA 3RCDA 4FVQA 1KOBA 3NIZA 3Q6WA 3CQUA 2X1NA 3GCPA 2C6MA 3JY0A 4KAOA 4QQJA 4O1OA 4ZS0A 5AR5A 3TNIA 4CQGA 2H96A 4EYMA 4BDBA 4FF8A 2M4NA 3LJ1A 2LJ5A 3RPYA 4PDSA 3SRVA 4EOPA 4HK2A 2N9PC 5IUIA 1JLUE 4O91A 4AACA 4RZVA 3COIA 5FQDC 4KB8A 3R2YA 4NTTA 5AP3A 4AU8A 4BKJA 5C8NA 4ANNA 1A5RA 2XM9A 4O38A 3F3WA 2VWXA 3AT3A 5DH3A 3KC3A 2WTKB 2O3PA 5H9BA 1QMZA 3HNGA 1KJTA 2LRUA 2BAJA 3MN3A 2XH5A 4IX3A 4AW5A 4YTFA 4GDKB 3BHVA 3WANA 2GNJA 4IG7B 3PPKA 4E7WA 3F7WA 2O63A 4W9FA 2GNLA 1GZOA 4ZK5A 1QPCA 1ZMUA 4W9GA 5JHAA 3VHEA 3C0IA 5EYDA 4IAIA 4CLIA 5A4CA 2WTKC 2YIWA 3FLNC 4MNEB 4RC4A 3ZU7A 3C13A 4JBVA 5D9HA 4BCIA 2MA9B 2K39A 2FVDA 3CPBA 2WWZA 4JBOA 4JBQA 2K8BA 2A0CX 2JIIA 2OJIA 2XEZA 4J6IA 4IAKA 2W06A 4Y95A 1YOLA 1ZY5A 4U9AA 4TNDA 3HYHA 3ZH8A 5M4FA 3KH0A 4KZ0A 3GB2A 3LFNA 3MI9A 4FKRA 4CYJA 1FINA 5CSPA 4E6QA 3RAIA 1ZZ2A 2WU7A 4HVSA 1V49A 2ITUA 2W9ZB 3M62B 3L1SA 2PZYA 4QNAA 1YDTE 4C37A 4OLIA 3TNWA 4FHKA 3O8TA 2BRNA 4RFYA 4JDJA 3S2PA 3R6XA 3ZONA 3UOJA 3RD2A 4EEWA 2JWZA 2Y4IC 4W4YA 3BU6A 5FTOA 3CGFA 3R04A 3HIZA 3GC7A 2N7DA 2AYOB 2NBWB 2J2IB 4OAUC 3GOEA 4U3ZA 4DEAA 3RUIB 4AT3A 3EOCA 3EH9A 1H08A 2P4IA 2XBJA 3D0EA 3DVNV 4FYOA 1MRVA 5FEQA 3LFAA 4DBNA 5FP5A 4HWIB 1DM2A 1WE7A 3KXMA 4RIXB 1YHWA 4ACGA 2OG8A 4FKPA 3RAWA 4WUAA 2XZSA 3NYNA 2IW9A 2MBEA 5HE1A 2Z7LA 1OUYA 4D2WA 2WB8A 3FMNA 4JDKA 4XZ4A 2HYYA 2PWLA 3R01A 1SIFA 1M94A 2CCIA 3MVJA 4G0NB 5G55A 4HCTA 4BDCA 4B4LA 3GC8A 4DITA 3C4ZA 3SRVB 3ORXA 2IJMA 5BYYA 3DLSA 3C7QA 2XNOA 3PHXB 4KS8A 4U7ZA 2JKOA 4GGQA 1GIIA 5HQ0A 2D11A 2MSED 1REJA 4FOCA 4FTJA 2L05A 3NYXA 4ANLA 4FIGA 2ITOA 2KDIA 4MXAA 3R73A 3BE9A 2DQ7X 5EW3A 3IOKA 3UO6A 3V8WA 1KSWA 1ZMVA 3OOMA 5CEKA 2MRPA 4K9YA 5L2IA 5CQWA 4LCDE 3JVRA 4FMQA 3UP2A 1JSUA 1SNXA 4FC0A 2KWUB 1WBVA 2RFNA 2WQNA 3NIEA 4E5BA 2C9WB 3JSVA 3UNZA 4ZRKA 5AWMA 3UIOB 3FQEA 4MBIA 3LXLA 4G6LA 4CD0A 5LMKC 2DYMA 4YLJA 3DOWA 1LM8B 4QTDA 2C68A 4U81A 5I9YA 3WZEA 4ITJA 3PRZA 3PYYA 3LCOA 3WF9A 1F3MC 5CXHA 3DJ7A 4II5A 3COKA 4QNYA 4FVPA 3KRWA 4XBUA 3TKHA 5CX3A 3KL8A 3BWJA 3DTWA 4J53A 3MH3A 3KMWA 4P4CA 3UO4A 5HX8A 1V5TA 2CS4A 4GN1A 2LI5A 1V5OA 4FZFB 3WYYA 1E8ZA 4EH8A 2WIHA 3FMJA 4TRLA 5HCXA 2AYPA 5EDSA 4XX5A 4U3YA 2YABA 2G2HA 4JIAA 2FSOX 4O1PA 4GK3A 3KY2A 4S31A 5L6WL 4DHJD 4GIIA 4TV3A 3NS9A 3ACJA 4LL5A 4MTAA 3PJ1A 3BGQA 4NJ7A 5DCNA 5EW9A 4EHZA 4JR3A 2C0TA 3ZLZA 2GMXA 5HVJA 2HZIA 3OUNB 5BVKA 4O0VA 3OUKA 5HBEA 4EH4A 3PXKA 3V5LA 2XIXA 4F8CB 4I22A 3C0HA 3OCBA 4F7NA 3CTHA 5IEXA 3GCSA 4W9IA 2NS5A 1VZOA 5JEBA 3HRCA 3ZFXA 4BVUA 5J95A 1WE6A 4ZOGA 2G2FA 5CXZA 4DH8A 2UZEA 5L6PA 1WGRA 4XV1A 5ETIA 2AL6A 2F4JA 4MCVA 4QQ5A 5HBJA 3TUDA 1VCBA 4OVUA 2GSFA 1PMUA 2HENA 4EOLA 3F5PA 2DZIA 3DFAA 2MX2A 3IS5A 2W05A 3PVBA 2UZBA 5M4UA 2GS7A 2XRUA 1A9UA 3C5UA 4KBCA 2Z0EB 4QP7A 4ALVA 3ACKA 2JAMA 4FSZA 4NJ6A 5J2RA 2J51A 4JG7A 4DH7A 4IZYA 1KOAA 3KXGA 2PMOX 3QX4A 2Z0DB 2X6EA 3H6NA 4TYEA 4U79A 4DINA 4FTQA 3L54A 2LVQA 2P0CA 3RINA 4R6VA 4MGYE 1Q61A 5AP7A 3DB8A 2Z8CA 4QTEA 3V8SA 3UO5A 3PY0A 4UXLA 5HE3A 4I4FA 4EH3A 3JSVB 4A20A 1L2NA 3FAAA 2DUVA 4E4LA 4RIOA 4XV9A 3MWUA 4JQ7A 3OCGA 3ORLA 4FKGA 3ZC6A 1OITA 2KZRA 4NM3A 2IY1B 3APCA 3PJ8A 4G3XB 3FZTA 3BGZA 1YJ1A 4IH8A 4F6WA 4C0TA 3NPCA 4GFGA 3ZVVA 4ANSA 3BQRA 2PVYA 3PJCA 2XK4A 4CKRA 4ZRIA 1RRBA 1WXVA 2ITVA 1GG3A 4FGBA 2QODA 1P1AA 2IVTA 4M0ZA 1A06A 2R3MA 1XH8A 3TT0A 4YSMA 4BN1A 4M12A 3PS6A 2VNWA 2WMWA 4UMTA 4DHZE 3EZRA 2HW7A 3DCVA 3ZDMC 3GCVA 3TEIA 2QU6A 3TV6A 2B7AA 3BHUA 4KWPA 2PE6B 3PHWB 5AAFA 2BYVE 4ZRJA 4G5JA 3GUBA 1WXMA 3ZDIA 4FIJA 1BUHA 4ZTMA 2BALA 3KUCB 1J3HA 1PYXA 4RWLA 3OJ4B 4PP7A 3NDMA 2GBRA 4ACDA 2BROA 4J52A 5DE2A 3Q52A 3O7LB 2VTHA 3MBLA 2YVCA 1M7QA 5E8ZA 4NUSA 5M4IA 3NUYA 3ZUUA 2ZZPB 4PL3A 5HIDA 3CD3A 3ALBA 4GG5A 1QCFA 3BHTA 5A6NA 3IW4A 3GP0A 4E6AA 1ATPE 3KB7A 1EUVB 2QOOA 4H3QA 3QC9A 5ANJA 3GU4A 1P5EA 3KN6A 5JZNA 4LOQA 3D7TA 4M0YA 3IBEA 1ZWSA 1R4MI 2NCNA 2K6DB 3OXIA 4CFVA 4CV9A 3LW0A 2I0VA 4HZSA 1B6CB 5H8BA 3DV3A 2IO6A 4QP1A 4RA5A 4BGHA 5JT2A 3H7SA 4FKSA 4RWKA 4QT1A 5I3OA 5KX8A 1SGHA 1DI9A 3GC0A 3R7GA 2R3FA 4I24A 2ESMA 4PMMA 3P4KA 4RPVA 4RRVA 5HESA 3W10A 3QF9A 3KYDD 5CZIA 1WBNA 2Y0AA 2EXMA 4V01A 5TE0A 5JHBA 5DMZA 3DAEA 1Y6BA 3WYXA 4QYFA 4IJPA 4R7HA 3CR0A 2PZ5A 3WF8A 4ZSLA 4UX9A 2R3NA 2PL0A 3HUCA 4HVGA 5KMOA 1P3QU 1JAMA 1XT9B 1PXOA 2L7RA 3KKVA 3VUTA 2GNHA 5EFQA 1K8RB 3R1NA 5T68A 2WMUA 3EIDA 4I94A 2CKEA 3D94A 2CLXA 1WJNA 3VVWB 4X2GA 4OVVA 4WKQA 4YTIA 2B53A 2LGDA 3LCKA 3FMKA 4M8TA 2NP8A 2XKCA 4LDTD 3WAPA 4W9CA 5IA7A 4FHJA 4LOOA 2J9MA 2ZM3A 1PYEA 5J87A 4YPDA 5LVMA 1DAYA 3VAPA 4MEMA 3ORZA 4AZFA 3I79A 3QZGA 2CKHB 5GZAA 5M53A 4FICA 1OL5A 2JT4B 5F95A 5EM8A 5AM6A 4EOQA 2B55A 3CTJA 1XH5A 1M2RA 5HI2A 5KZ0A 3RHXA 5L2TA 2C6TA 2C5XA 2WTIA 2WZJA 2E9VA 3TTJA 4ZTLA 4QMSA 3DBSA 4S32A 3EFWA 1M17A 1GJOA 2QHNA 3PP0A 4EK5A 3CKWA 3GFWA 5KMMA 4D5HA 1GY3A 5E1EA 3L8PA 3ETAA 3QXPA 1Y91A 4D1ZA 4G3FA 4TT7A 3UC4A 3DBLI 3FZRA 4ZYNA 3G9LX 2ITYA 4KIQA 1NVSA 4H58A 4Z7GA 3I0OA 3VH4B 4K7UA 2C7HA 3PVWA 3CY3A 5KZIA 3BEGA 5CTRC 1UZXB 3HDMA 3PRFA 1OGWA 3HHMA 1ZYLA 5AAEA 2CCHA 4C7TA 3FMMA 3QTUA 4L8MA 5BVNA 2JY6A 3C4EA 1XKKA 2GHLA 3D7TB 2W0JA 3LMGA 4N0SA 5L8JA 1ZAOA 2GMIC 3DXNA 5D6JB 2Z2WA 4FL3A 4B6LA 5HVYA 4CRSA 4I3ZA 2C5LC 1WBOA 5DEYA 3NNXA 4RJ4A 3TI1A 2JLDA 1XBCA 3R9OA 4F1TA 4GMVA 1H07A 2W1DA 1Y8GA 3W32A 3BIZA 3ZFYA 5IH5A 4IVDA 4WJNA 2GTNA 4B8MA 2YM4A 4MSMB 4M3QA 3EYGA 4JAIA 2PVKA 3GC9A 4NTSA 4CKIA 5A4TA 5CF8A 3NR9A 5IU2A 5LOHA 1GC7A 4RIWA 1OB3A 2VWZA 4N6ZA 2QI8A 2ITQA 2OWBA 2AUHA 3FY2A 5IA4A 5I9WA 4RJ5A 1VD2A 3VTVA 1WF9A 2J0KA 2R2QA 2RFDA 3F61A 4II2B 4W9WA 5FLFA 3NRMA 3I3TB 4I6LB 3NYVA 4I93A 2R2OA 3DB6A 5AR7A 3NW6A 3PZEA 2XMYA 3FHRA 1JKSA 4I0RA 1DAWA 3R8PA 4AZVA 4JRNA 4ACCA 1WX7A 4HVBA 3D32A 3LDZE 3VWAA 3O17A 3PPJA 4XP0A 2RPQA 5AR8A 2BYFA 2ZNVC 3EYHA 3QXOA 2XUUA 4OT6A 4JIOU 2VTJA 4CZTA 2C5YA 4IVCA 4M8MA 1H0WA 4O6LA 2V62A 3G2FA 4K8AA 3QWKA 3ENMA 2O8YA 3UVQA 4CYEA 2A27A 3S0OA 4DG0E 1YXTA 3NWWA 3R21A 4U0IA 2WD1A 5E90A 1IR3A 4O21A 4YZCA 2XBAA 3MFTA 5E8TA 2PPHA 3QALE 4IM0A 4GW8A 2WTJA 3UOHA 3R8ZA 4APCA 2BPSA 3QAME 1QPDA 3F5UA 2BRHA 1BX6A 3IFWB 3L16A 5FDXA 4LV8A 4AFJA 1TQMA 3ORNA 1XHAA 4GOCA 4OR5A 5D12A 3X0WA 4Y83A 2QR7A 4D4RA 5DWRA 5CVHA 4AX8A 1U59A 4E4MA 3DDQA 4YZNA 3ZZWA 4QO9A 2D07B 2HE7A 3QA8A 4IJ9A 4K6ZA 2XEYA 3SC1A 3R8MA 4RX7A 3TJPA 1YOJA 5KHQA 4EOIA 3P5KA 3CQEA 3FC1X 2YCFA 4RVLA 1GIJA 2WEVA 3G90X 4YJQA 4E6CA 4F1OA 4AUAA 2KLGA 2PJHA 1YWNA 3BEAA 3PA4A 5EM7A 2CGVA 3ANQA 3D5XA 2IO3B 3ELJA 5JH6A 1FGKA 1W83A 4YLLA 4J71A 5IEVA 2KFJA 2J0JA 3OW4A 4XCUA 4HDQA 4N9F4 2L3ZA 3BU3A 4GIHA 4WNMA 4G5PA 2YCSA 5CS6A 4BDAA 4E1ZA 1E90A 2W1HA 5ETCA 1Q62A 3F3UA 1WFCA 4UALA 2NBUA 1YIWA 4RIWB 4CFFA 1R4NI 2C7MB 3MH0A 3ORPA 3W2OA 3SU8X 3WILA 4OTPA 5LVLA 3RULA 3KXHA 1QPEA 3Q4ZA 5A54A 4XLVA 3O0GA 2LGYA 2BKZA 5JZJA 1ZOGA 1F0QA 4CFWA 4L44A 4ZSJA 2IW8A 4NU1A 5AUXA 4FTRA 4B0GA 4UMRA 1IPGA 2BUJA 2KK8A 1WVYA 5E6OA 4FIIA 3DA6A 2PVHA 2QO2A 5DI1A 1O6YA 2RKUA 2UZVA 4FKWA 1V80A 1YW2A 1WZ3A 1MG8A 3P79A 3ZIMA 5KMJA 4BIBA 2WMBA 3GQIA 2R7BA 4WJQA 3ZSIA 2GTMA 4M14A 1WJ4A 2RD0A 3MV5A 1ZZLA 4I5MA 2OJRA 1BI7A 4AGDA 5LLIA 1HOWA 1IEPA 4QMLA 1JRUA 1L7YA 3IG3A 3O71A 3QQ8B 1TVOA 3NSZA 4LG4A 4O0XA 1RW8A 5EM6A 2BTRA 3ANRA 2BKFA 4AQCA 3FZOA 3IECA 4ZTNA 3L08A 2OICA 2PVFA 5HG7A 5CF5A 5JK3A 4S30A 1UBIA 4W9DA 5AJQA 3VBQA 2IZTA 2BFYA 3OT8A 3KRLA 4FKJA 4KSPA 5TT7A 3L8SA 4BDIA 2J7QB 1M2PA 3D83A 3AI5A 4FJVB 3RCZA 2DX5B 1PY5A 3FLWA 2J4ZA 4EHGA 3REPA 2VRRB 2Z7QA 4HXDA 2BRGA 4IAZA 5E8UA 1YI3A 4MHAA 3QRIA 5J17A 1V0BA 3CS9A 4EC9A 3V5JA 2Z59B 5CQUA 4Z16A 5D10A 3O65B 4WA9A 3U6JA 4FJZA 4C57A 5TR5A 3MY1A 5L2QA 5D2MB 1WXAA 3N3KB 3IGGA 1Q24A 2VWVA 4S34A 2FUMA 2GHGA 3U6IA 5BUJA 3W1SA 3WAOA 3G51A 3PTGA 4DWFA 1YOMA 4FG7A 2NPTA 3UG2A 4LQMA 4PDPA 4XV2A 3BHYA 4M0WB 2ZDUA 3AC5A 3WA0A 1WR1A 2E9OA 2R0UA 5EI8A 4EBWA 2X9EA 3FHIA 4OGRA 5DR2A 4O27B 4TYGA 5I4NA 4GUBA 3TZ7A 4MX9A 4BTFA 3V8TA 2VTPA 4W9LA 1PXKA 3HP2A 2RG6A 3PZHA 2NVUI 3CGOA 3TN8A 1KOTA 1KE8A 3NX8A 4ZTHA 2PEAA 3ZNGC 5D1JA 2XNEA 1UU8A 2V3SA 3IW7A 3DT1A 3A7FA 3JYAA 4RC3A 4G2FA 2VU3A 2UW9A 4TKNA 4QMZA 4YO6A 4GJ2A 3ZUNA 4R3PA 2FO0A 3MA3A 3QUEA 3HK0A 1OECA 5L95C 2FNJB 2C5VA 4IQ6A 3F2AA 3HM6X 2YAAA 4LM5A 4ANVA 3RNYA 2XJ2A 3PXYA 5FG8A 1SE9A 4GMYA 2YISA 3DBCA 5CHWA 3TTIA 4AJYB 1XH4A 4XX9A 3ZSGA 4A4OA 5HKHA 2GDOA 4TWOA 4D0XA 3OTUA 4UEUA 4WT6A 3KUDB 2ETMA 1Y8YA 2J5FA 2XP2A 4W4XA 1P9DU 3O2MA 3PT2B 4RM8A 3DK3A 5DIAA 4EH6A 4QQTA 4FTCA 3BKBA 4F70A 3DJ5A 2YHVA 1JSTA 2X81A 3EJ1A 4PPAA 5AIKA 4F6UA 4F1SA 3VBXA 3MTLA 3PXFA 2O65A 5LWNA 1Z9XA 2VO3A 1RE8A 1OL7A 3EL8A 3A61A 3F6XA 3TL5A 3WAMA 4YHJA 2O0UA 4H36A 4YTHA 4Y5HA 4K7WA 2OF2A 2MBQA 3F82A 4WQOB 3OY3A 1AGWA 3QHWA 5IDNA 4EK4A 3RYTA 4NQKE 3F7ZA 5AP6A 4BTMA 4XG3A 4JGHB 2ETKA 4CFXA 3V62A 3PZDA 4N4SA 4QTCA 2AEHA 3D5UA 4D2PA 2ASQA 3QJZA 1UELA 4PUZA 1WMKA 4EH9A 3G0EA 4IUMB 4L3PA 3L8VA 4B95A 2SRCA 1UKIA 2BZJA 2GBMA 2NPTB 1G5SA 2O6VA 5BVFA 4RVTA 2F2CB 2B9FA 3QQFA 4F7LA 3SV0A 4FV1A 2Q0NA 3VHKA 3AGLA 3VVHA 4S2ZA 4ZIMA 5KNJA 2X6DA 3B1LX 3MFSA 2XF0A 2R5TA 4PL4A 3LCSA 3Q5IA 1IASA 4XMOA 1WR6E 1V9JA 1Q5WB 2K1FA 4ZP5A 4C34A 3MJ1A 3H9DA 1JNKA 2UW5A 2B4SB 2VWYA 2YDJA 4LOPA 4OTHA 5GJGA 3KU2A 5B2KA 2MBBB 3POZA 3ZOSA 3LCDA 3WI6A 2ZVOA 4L01A 3IHPC 3QKKA 3APFA 3HVCA 2W5AA 2I1JA 3PXZA 5FTQA 5LARA 4BDHA 2WMSA 2C0OA 3LFFA 2OU7A 3O7LD 4IZ5A 3A9KA 2XIZA 3HA6A 4EYJA 3QQHA 5C1ZA 2CSNA 1CMKE 2X2MA 4QYYA 3ZRCA 1PXIA 3F3VA 4D4YA 2RFSA 5L3AA 4YJUA 5M56A 4GYGA 4QP9A 3CJFA 4GUEA 4WWNA 1ZW7A 4X3FC 3FLSA 2LAVA 1UWHA 5CYIA 3EKKA 5EOLA 5A3XA 3VUIA 4BTKA 5KMNA 2XJ1A 3FL5A 3DU8A 4GT5A 1E7VA 4FIEA 4IAAA 2YCRA 4EOKA 4S33A 4EI4A 3G6GA 4F7JA 4TYIA 4NEUA 3TNQB 3PPAA 4L6QA 4YJNA 3ZLWA 2BKRB 4USFA 1I42A 4D1SA 2NRUA 1WIAA 2FCSA 3Q9WA 4QPSA 4PPBA 4KINA 3V01A 2C6DA 3GU5A 5CAQA 1LP4A 2RR9A 1TKIA 3A1QA 2C30A 2I6LA 3BZ3A 3GI3A 3VRZA 4DG3E 2CHLA 2R3JA 5KHXA 4NNJB 3R02A 2QOFA 1K9AA 4I0TA 2K25A 3KN5A 3W2QA 4C36A 2I1KA 3PSCA 1REKA 3TIZA 5KHOA 4WAAA 1Z57A 1H1SA 2E9UA 3P0MA 3R30A 5FD2A 1PMNA 2O6VB 5IA3A 1GNUA 1JBPE 2R0IA 4MK0A 1R39A 3W8LA 3F5XA 3RK5A 3H4JA 2CN5A 5LQFA 4BC6A 1Q8YA 4MBJA 2EMSA 4JOAA 5J7BA 3OMVA 4DEHA 3UG1A 5AP1A 2ACXA 4IVBA 2R3IA 1X1MA 3LE6A 2ZMCA 4L7FA 5D11A 4EZJA 3QKMA 2YLMA 3A4OX 2WOTA 3QUDA 2V22A 4BB4A 2VGPA 3KEXA 3GZNI 3R7UA 4BOSC 3MB6A 3QL8A 3MFUA 2X2LA 2QOLA 4DFXE 3K5VA 3HECA 1FQ1B 5FDPA 4AW0A 4F9BA 2L8JA 3WIMA 3PFQA 4TYJA 5L8KA 4EUTA 3A9KB 2JBOA 3AD4A 4IIRA 4IX5A 3VQIA 1S9JA 2UYZB 3DOGA 3KFAA 4GS6A 5E92A 2YAKA 1MRUA 4Y5QA 2OXDA 2RF9A 3VBVA 3WBLA 4F4PA 2WIPA 3EHAA 5E6NA 3ZNZB 3KXNA 3PY3A 5L4QA 3RPSA 4MF1A 5J18A 4BCQA 1XQQA 2HWPA 5I5ZA 2ERKA 1YHSA 3U9CA 4MXYA 5BQ0A 2K8CA 3QLGA 5CEPA 4I5HA 1L3RE 3R63A 4LGHA 3NYOA 4IADA 1WBSA 2YITA 5M55A 5LMKA 3ODZX 2CR5A 5C9CA 4PPCA 3T3UA 2MP2A 2MWSB 4Z3VA 4HVDA 4J96A 2HCKA 1E5WA 2ZM1A 3M63B 3QCSA 3OC1A 3JVSA 4ZSGA 1OIYA 1YQBA 4ANOA 2OZOA 4URKA 1P98A 5E8WA 3UQBA 4ZZNA 3L9NA 2JVCA 3EQBA 4CCBA 3DDPA 3A1QB 3AULA 4RT7A 2F9GA 2Y4IB 3WZDA 2WTDA 1ZY4A 3HX4A 4F09A 3SVVA 4CQEA 4AT4A 5FM2A 4Y85A 2WQBA 1OI9A 1RQQA 5JKGA 1KM7A 3AXWA 3F5GA 1KLVA 1V0OA 5I9UA 4YZDA 2J6MA 2J90A 2MBOA 4EBVA 4UYNA 1YKRA 2ZB1A 2JUOA 4YPSA 2IBIB 1NA7A 4EZ7A 4OTRA 1V81A 3QD4A 4D2VA 4TPTA 5ITAA 2VD5A 3LM0A 3IPHA 3W2RA 5M57A 3L17A 1BL6A 3VRYA 3VXWA 2JF5A 5HD7A 3DVGX 3OCSA 2HXLA 3QD0A 5DRBA 4IC7A 3VNTA 2JXXA 2WQMA 3LFDA 1SZMA 3GFEA 3UGCA 3ZBXA 3N32A 3LLTA 3UVRA 3UPZA 4LRMA 4P2KA 3WE8A 4ENXA 3R8VA 4G50A 2LGCA 4QP2A 1V0PA 4BI0A 3ORIA 3WE4A 2WYQA 5LXMA 3VFKA 5AR3A 5F1ZA 4KDLB 4EZ3A 3OHTA 3LM5A 4MD7E 1VYWA 3VBYA 4NT4A 3DKFA 3OFMA 3P7AA 5AA8A 2D10A 1APME 2JRIB 4R5SA 2VWBA 2FSMX 2WELA 3CIKA 3EN4A 3PLSA 3OEZA 5FEEA 2WAJA 5IPJA 3HMNA 4NM7A 2XK6A 1UWJA 2XNGA 2WMAA 4KVGB 1YXSA 5LCKA 2BPMA 5CAPA 2QOIA 3R9HA 5CU4A 2PVMA 2VTQA 5EHYA 4C2VA 4YUQA 5KBRA 3R66C 3R7IA 1OL2A 2UZUE 3UOKA 2MP2B 1MRYA 2QD9A 1KE6A 2VAGA 4E4NA 5HKMA 2GBNA 4DFYA 2ZPYA 4FSQA 4AGCA 2C6OA 5FP6A 3FI3A 4CCUA 3GEQA 3WARA 4K11A 2FA2A 1IA8A 4X2KA 4O0SA 2F2UA 3OTVA 3ZFMA 4TW9A 4FULA 5CAVA 2KN5A 4ZJVA 4FNYA 3C0RB 1OGUA 3BBTB 3F3TA 3V6RA 3GU8A 4FZAB 3WF5A 4BFMA 3EN5A 4QD6A 5G1XA 2YCQA 3KCFA 4FTMA 3G33A 4RFMA 4TWCA 2EMTA 4AJWA 4IWDA 4IB5A 4BDJA 4QMWA 5B2LA 4HPLB 5T3QA 4E8AA 2ONLC 2FIFA 4MDKE 2QOCA 4CMTA 4ZZOA 5LVOA 3SOAA 5AZHA 3QTIA 4AGUA 1UGMA 3LXPA 4FNZA 4MWIA 3UBDA 3FYKX 3CBLA 4IACA 4AZEA 1LXDA 2OBJA 5EOBA 3ORTA 3WOWA 4DEDA 4EJNA 1GUAB 4WSQA 3Q6UA 3HL7A 5HICA 3BLHA 1PMVA 3CKXA 3DS6A 5CNNA 1ZLTA 4QPMA 3GXLA 5CVFA 2G2IA 4O0TA 4ZY5A 4IC7B 2BMCA 2VWUA 4D4SA 5CASA 1U46A 4DBGA 2PE1A 2B52A 2YIYA 2GNGA 3VS6A 3A60A 3NUPA 5JFXA 4CO7A 4TUUA 2W4JA 4D2TA 5HEZA 5EYCA 3JVZX 3QHRA 5EYMA 2WMXA 3IW8A 4AAAA 3MW1A 3ALNA 3MVLA 4JRVA 2QOBA 1CKIA 3LOKA 3UQAA 4XG8A 2QHOA 3HMIA 1H01A 4JQEA 1URCA 4XC2A 2GFSA 2PVLA 2QLUA 2KANA 2L00B 1FVRA 2W1GA 4DH5A 1CM8A 4I92A 1WMHA 4FKQA 3VS5A 3OBJA 1WH3A 2MCNB 3EHVA 4CT1A 1KWPA 3I6WA 4NJ3A 5AV2A 2HW6A 2ZMDA 5E1SA 2BF8B 3BINA 3FKNA 3PVUA 3ORMA 3AC8A 1LQBA 1URWA 3PV1A 4C2WA 4TWPA 2C7NB 4CFNA 1H28A 3WZUA 2ZV9A 4PL5A 1P0RA 2PZPA 3N9XA 3Q96A 4BI2A 3PA3A 4TKSA 4QP6A 2UVYA 4RM9A 2CHWA 4G17A 1PHKA 3O8UA 4MH0E 4LGDA 1VEBA 1XD3B 4HOKA 3ZO4A 3S4QA 5JFSA 4MVFA 2LZ6A 2XKEA 2B1PA 2X9FA 4AXAA 5TF9A 1H0VA 1E9HA 1V1KA 2BIYA 4QP4A 2YZAA 4D28A 5L2SA 3OWKA 2A4ZA 3P9JA 4IFGA 1OPKA 5M4CA 4XHKB 3PGEA 5A46A 3ONSA 2HZNA 4NSTA 2PUUA 1S9IA 4U5JA 2WGJA 2PTKA 1YDRE 4BHNA 3IVFA 2ITWA 4JX7A 1ZMWA 2KQ7A 2GCDA 5JGAA 2UZWE 3BX5A 3OY1A 2LASA 3V04A 4AOFA 5DFPA 3DK6A 4UN0C 2QO7A 3MTFA 1M52A 4AW1A 4L00A 2YIRA 2HK5A 3A4PA 2HZ0A 4QTAA 1R78A 3G0FA 3HV6A 4OTFA 4OBPA 4Q2AA 5ANOA 4GXBA 4FTUA 1PXLA 4FV0A 3QUPA 3WIGA 1W8CA 3R8UA 5CSXA 5TKDA 3EN9A 2HZ4A 2QCSA 4JAJA 2E9NA 4DHFA 3AXCA 5F9EA 2KNBA 2M8SA 5AP2A 2BYEA 2YLEA 4D2SA 3IG7A 1ZYJA 1WJUA 4MYGA 4B9KA 2UW8A 3ZM4A 4CT2A 3E8NA 4CHKA 2QG5A 3R7OA 2C47A 3ITZA 2D2QA 1P2AA 1LEWA 2LRWA 3E88A 4BCOA 3EQHA 5C23A 5IUHA 2PVJA 1WMHB 3OWPA 3MYGA 3VF8A 2W4KA 2BAKA 2BDJA 4HCUA 2VUWA 2R3OA 3IQ7A 3AC3A 4JG8A 1WZYA 2KULA 2ZVNA 3IDPA 3BV2A 4I23A 5AP5A 1CKJA 5K0KA 2KJHB 2QHMA 3DQWA 3VS1A 3LFSA 3GBZA 2L76A 3MVHA 2R3RA 3DBFA 4U43A 4YZ9A 2JGZA 4XLIA 1JSVA 5AUZA 4AZTA 3PREA 4HPMB 3U8ZA 4G3EA 1UU3A 2RFEA 5EG3A 2K8HA 4DLIA 4RQVA 4QMYA 3FMLA 2P3GX 2XNBA 4NCTC 4G9CA 3UOLA 3QAQA 5AUYA 3FE3A 5HLPA 4D55A 5CU0A 3ZEPA 5DT3A 1E8XA 3RWPA 4BZDA 2JDTA 3SW4A 5D41A 5BVDA 2EXCX 1Q3DA 4FV3A 5G6VA 5GJDA 4BBFA 1GC6A 1D3ZA 2Z7SA 2YM6A 3D5VA 4R3CA 4YLKA 4BYIA 3EC8A 2XK3A 1Y8RC 4MELA 4WJPA 1HCKA 2ETRA 2R3PA 5C8MA 2A5UA 3CMMB 4B99A 3Q04A 3K2LA 3B2TA 3N51A 1GOLA 1NI2A 4FUYA 4ALWA 2C3JA 4GSBA 3QCYA 3ENEA 1F5QA 2OFUA 2F7XE 3TZMA 5EKNA 2GBJA 3AGMA 4ASDA 3MS9A 2XEWA 4HZRA 4PNIA 1H1QA 3Q4TA 3OVVA 3VTUA 4XOZA 3VBWA 4TN6A 5E8VA 4M13A 3VUKA 3W2SA 2WHBA 3P7CA 4MJSA 3E93A 4J8MA 2IZUA 4FSNA 4WO5A 3QGWA 3ML9A 5LMBA 5CANA 1OKWA 4IB1A 3C9WA 5AMNA 3LAUA 2UZNA 2G4SA 2FIDA 5J1WA 1H27A 3FJQE 1LR4A 4KSLC 5CF6A 5JRQA 2DWBA 4YR8A 4BCKA 4F7ZA 5IA2A 5AIRA 5IDPA 4K1RB 4F9YA 2VO6A 4TY1A 2VTAA 4FSMA 5BMMA 2J7TA 3WF7A 4ZY4A 2PY3A 3F9NA 5DG5A 3VC4A 5HE0A 2RIOA 3GU7A 5EKOA 4F0FA 2C69A 2JKQA 4XG9A 4L7SA 4C4GA 5IF1A 4EWQA 2I0EA 4EKLA 4RJ6A 5AX3A 1YRPA 2G1TA 2QNJA 2Y7JA 3LZBA 3RALA 2O6VD 4CNHA 1OZ1A 4HYIA 5LWMA 2UZDA 3OWJA 4BWKA 4OTQA 3ZS5A 2ZNVB 4EZLA 2GQGA 4K18A 1CKPA 5FXQA 1OKYA 3NNWA 3BELA 3D9VA 1YI6A 4ID7A 3FYJX 1PJKA 4YGAA 5FM3A 3WF6A 4ASZA 2X8DA 3FDNA 3QWZB 1PMEA 2VV9A 4AZSA 2UW0A 3K3IA 3R7EA 2YA9A 5EHLA 1Q8ZA 5E6PA 2WTVA 3E3BX 5DGZA 3E64A 5ICPA 4RX5A 1WVWA 5CEMA 4FSWA 3BYVA 1I35A 2WDTB 2I0YA 4HPTE 2UVXA 4DGOA 1R3CA 2QOKA 4YL8A 2VX1A 4F64A 4IFCA 3II5A 4N6YA 2BTSA 4FT0A 3I81A 3VJOA 3R7QA 2ZV8A 3E8DA 4RC2A 1DI8A 5A4LA 4EK8A 3QTZA 3ZHPC 4DG2E 1BLXA 3CP9A 3DBQA 5HG9A 2JDVA 1EF5A 4IWPA 4BOZB 3RGFA 4MJSB 5K5XA 4U45A 2R3GA 4IZ7A 5CU2A 4IM3A 4YHFA 4W9EA 4EZ5A 3TIXA 3TG1A 2N9EB 4BCFA 5IA5A 4ASXA 1WY8A 4D9TA 4PF4A 5JSMA 4K1BA 2DZKA 4GK4A 4HGEA 2Y8OA 2BZHB 5AP4A 3TZ9A 3UNJA 4TL0A 4RMZA 5BX0A 3R00A 2X7FA 3E7VA 5ACKA 4EQCA 4X2JA 1SYKA 1VYZA 2JD5A 4QMNA 4KZCA 2YM3A 4FG8A 1K2PA 4RA4A 3Q32A 5EW8A 3ZYAA 3P78A 4F6SA 1HCLA 5K0XA 4ONAA 4C61A 4CYIA 3QTQA 3A4RA 5D7VA 2Y6MA 3COHA 4FG9A 4UBAA
chains in the Genus database with same CATH superfamily
4W9JA 3ZTXA 4PT5A 2ZV2A 3HDNA 2WU6A 5I9XA 1H4LA 2Y3AA 2EB3A 3NCGA 4O2ZA 1PXMA 4II3B 1P14A 3L0WB 1Y6AA 4JQ8A 1KH0A 4HPUE 3W1YA 3KRJA 4JBPA 2VH2A 3RMFA 2C3KA 4HJKA 4XRJA 1K52A 5DPWA 3AMBA 3EFLA 3SD0A 4K7SA 2WTWA 3GB1A 2HAKA 4KRCA 3AB5A 1N5WA 4KDIC 4O4DA 5LVNA 3LFEA 3IGOA 4X6RA 4KKJA 3DLZA 1KFYB 4LLGM 3SHQA 4BKSD 3AMAA 3QD2B 4ZTRA 3FZ1A 2BYTA 2QVSE 3U9NA 3BGPA 2EWAA 4FSYA 3UIBA 5G2NA 3Q5ZA 3ALBA 2QOQA 2LD9A 1W98A 1Q5KA 2P2HA 3C0GA 2LWPA 2R7IA 2CGWA 1J8CA 5FWKK 4L46A 3VUMA 3NZUA 3MIYA 4O0WA 4X3FA 3FKLA 4KIOA 2IW6A 3UINB 3TV4A 4USEA 4DHZB 4DGGA 1F77A 4ITIA 2NR2A 3KUZA 4D9UA 1YD8U 1UU9A 1VJYA 3IT4B 4DGNA 3I4BA 4L9IA 3E8CA 4TYHA 2ZAZA 1R0PA 4H1JA 4FSRA 1XO3A 2WX1A 2AC5A 1C4AA 3L10B 2OZAA 4EUUA 4IXPA 4IDVA 1YXXA 5F4NA 1PFDA 1RJBA 1W84A 4JL9A 4IEBA 3BCEA 2GS2A 4WG5A 4U40A 4RZWA 4E73A 1FEHA 4I5CA 4WG4A 3SXFA 3ZO5B 3POOA 2WXVA 1NVRA 3RI1A 1UNLA 3B0AA 1ZGUB 1ZYCA 4C4EA 3THBA 3UIMA 1FMKA 4YT0B 4ZLOA 2WQYB 3PRMB 2XKDA 3DGKA 3PWDA 4I0SA 1T0YA 3DJ6A 3ET7A 3M95A 3KYCD 4JXFA 3TBLD 4RIYB 2KMMA 3NVWA 4W8EA 5E8XA 2YDKA 4GVJA 4L53A 2LVPA 1MJDA 4QMTA 3MA6A 2X7GA 3MH1A 2Y5BB 2P33A 3FXWA 5T8IA 3V51A 2WOUA 1SB3C 4MM3B 2IO1B 3NUUA 4YJSA 3OP5A 4IB3A 4XS2A 4HVIA 3NLBA 2EB2A 4HDOA 2R3KA 4G3DA 3ERKA 4LRKA 1L0XB 4U44A 2M1MA 1FMOE 3MGYA 2PZRA 4G16A 2ITZA 4PP9A 2SAKA 4X57B 3VIDA 4CRLA 4NH1A 5CT0A 1NBFC 2UW4A 3W2PA 3L4PA 1OKZA 4U97A 2W99B 3DCGA 2HJ8A 3R9DA 4EONA 2YACA 1WZ0A 2CN8A 2XIYA 4FODA 3H10A 4LJPB 3UGBB 3I5ZA 3OS3A 4FKTA 3M1SA 4LUEA 3HV4A 5FXRA 3ZRMA 1SVGA 4MQ2A 4FT5A 4I21A 1V6EA 2W1CA 2KDFB 5FGKA 3RHKA 3MTNB 3RZFA 4YTPB 3C51A 4FKIA 3IDBA 3TNHA 4LTUA 3Q60A 4OBQA 2E2BA 2Z7RA 4L52A 2C3LA 1G6JA 4PNKA 4I6NB 4QYHA 1C4CA 3VQHA 4PQNA 3ULIA 1WBTA 3AT2A 1C4PA 3VQUA 2W1FA 3TEYA 3LFBA 4IANA 5H8EA 2JDOA 3T3VA 1R0EA 1J0GA 3HMOA 1G3NA 2FGIA 2KOXA 3LIJA 4GL9A 3UZTA 2M17A 2VTRA 2V7OA 4Z55A 3SXRA 2Y4PA 4HNIA 3A9JA 2OH4A 4V0GA 2J0MB 5CWZA 2CMWA 1I4XA 2UV2A 3TJCA 4NPNA 3PG3A 5AZFA 2AL3A 3U52E 4L68A 4NCTA 4FSUA 1M14A 4MWHA 3CLYA 5DHJA 3JW0X 1ZARA 4MXZA 2YM8A 1WAKA 2WQEA 4EZKA 2ZJWA 3UQFA 4N58A 2OOBB 2QONA 3PWYA 4R3RA 3U6HA 4Y72A 2LXCA 3Q3MC 2YJRA 3P08A 3PIXA 5HX6A 4XG2A 5TR6A 2W5BA 3OW3A 4TQ1A 2MQJA 4P7EA 2WX0A 5J5SA 2X7OA 3QX2A 4P5ZA 4JDIA 3W1FA 2P2IA 4BWXA 2KFKB 3BRBA 4PS8A 5DLSA 1FPYA 4EHVA 3TL8A 4ZLYA 2HXQA 4F9CA 2WTCA 4C58A 4JT3A 4IHPA 5J79A 3VJNA 4KSQA 1PKGA 3K3JA 4KBAA 3FILB 2B3AA 4K3BA 2LJIA 1DOYA 2FSLX 4UMQA 5HO7A 5L8LA 1ZYDA 4M68A 3QRJA 4DGLC 1WJ6A 4FV2A 4WIPA 4YP8A 4XV3A 3A8XA 3KXZA 5I9VA 3UIUA 3QYWA 4MD9E 3FL4A 1U4AA 1BYGA 1Q97A 2QQ7A 5AX9A 2GRIA 5CY3A 3VF9A 3BVZA 3TNPC 1SBBB 3QU0A 4CSVA 4C3RA 4KSKC 3LFQA 3MB7A 4FADA 3BPRA 1BUIC 5FR3A 4PTCA 4KABA 4CLJA 4IM2A 1D5MC 3VW8A 3A99A 5HU9A 3HGKA 4FTAA 2C1BA 4USDA 3QGYA 4EOJA 4QAYA 2GNIA 2I2YA 1TZ1A 2V55A 3FI4A 1YXUA 5DR9A 3RNIA 4L2YA 4RWJA 4G11A 1BI8A 3HLLA 5AUWA 1OTRB 4AP7A 5KUPA 1OL6A 1DYQA 3H8HA 3S95A 4LV5A 3TACA 4AF3A 4PV0A 4TZRA 4J98A 3UZPA 4WOVA 2XK5B 1RAXA 5BVOA 2QURA 5KE0A 3FWQA 4XEYA 2BWFA 3W2DA 1JOWB 3Q3JA 2X4ZA 3M2WA 4C4JA 2REXA 3CC6A 4FBXA 4FIHA 4YJOA 2UWQA 4C7YA 1Q4LA 4C56C 2DNFA 4B9DA 2NBVB 4EKUA 4BTJA 1GJZA 4R7IA 5AZGA 4DHJB 1ROEA 4IWQA 2YWPA 2O64A 2QSDA 4AN3A 1OEYA 3ALOA 3BE2A 4H39A 4YBKA 2G15A 4DXFA 1BKXA 3U4UA 2PMLX 3B8RA 2INPE 2N7JA 2D5GA 3KMMA 3CQWA 3FSKA 4CTBA 4PMPA 3IW5A 3BYSA 4MQ1A 2BZIB 3P1AA 1WI0A 2GI9A 2PE2A 3R22A 4WBBB 1YI4A 2FB8A 3S00A 4CXAA 2CGUA 2L0TA 3OAWA 4R5YA 3BV3A 4GLSC 4QRCA 3BLRA 1V86A 5AUUA 4K77A 3TV7A 4DFNA 1B38A 5KKRB 4ALUA 3SW7A 2MW5A 4OTDA 1TQPA 2VWWA 2JFMA 3QYZA 4JJRA 2VX3A 2XCKA 4XG7A 2KDBA 4DH1A 1H1RA 2LHDA 5CVGA 3EQRA 4PYUA 4XGAB 4ZEGA 1Q8WA 5CEIA 3PRPB 1LPUA 5KBQA 2G01A 4FL1A 5C01A 4JWUC 4IX6A 2BBCA 2WMRA 3W1SC 1IYFA 1BT0A 3A7GA 3UQGA 4NAWB 1H24A 2F7ZE 3ZSHA 4IE9A 2INDC 3C4WA 3OEFX 2AC3A 4AG8A 3KF7A 2O2UA 3H7PB 1W0XC 1JRPA 2CGXA 3QC8B 4HGLA 3ZRFA 3H9RA 5JZEB 3DY7A 5C8KA 3Q4CA 5IUGA 3N1ZC 4TQ0A 1KE7A 4FT3A 4BBNF 3VH3B 3RZWC 5AV3A 4G34A 1DS5A 1UV5A 2OJ9A 4OTWA 4X0MA 3LPBA 4OAVB 2IZVB 1WSPA 3EN6A 1YQJA 3CTQA 1VR2A 1KOBA 3CQUA 4KAOA 2C6MA 4O1OA 4FF8A 2N9PC 5FQDC 4KB8A 4NTTA 1T0QC 1R7SA 1QMZA 1KJTA 2XH5A 1QPCA 4IAIA 2MA9B 2K39A 2FVDA 2WWZA 4JBQA 2A0CX 2XEZA 4J6IA 1YOLA 1ZY5A 3HYHA 4OZBA 3GB2A 4E6QA 4HVSA 2ITUA 4C37A 2BRNA 4RFYA 3R6XA 4W4YA 3HIZA 2N7DA 2NBWB 2J2IB 4U3ZA 4DEAA 2P4IA 3DVNV 4DBNA 3BYTB 1WE7A 3W9CB 4XZ4A 1OUYA 2HYYA 2PWLA 4G0NB 4BDCA 2IJMA 5BYYA 3DLSA 5HQ0A 1REJA 4FOCA 4ANLA 4MXAA 2DQ7X 5CEKA 1KSWA 3OOMA 3JVRA 1JSUA 2KWUB 2RFNA 3UNZA 3FQEA 3LXLA 3FC4A 1LM8B 3PRZA 3WF9A 2W55A 2VZKB 5CXHA 3COKA 4XBUA 4J53A 4GN1A 2CS4A 2LI5A 4XX5A 4U3YA 2FSOX 4DHJD 3KY2A 4MTAA 3PJ1A 2GMXA 2ZW0A 4F7NA 3CTHA 3GCSA 4W9IA 2ON8A 4NZLB 1VZOA 3HRCA 4ZOGA 2G2FA 5L6PA 4XV1A 2F4JA 1PMUA 4EOLA 3F5PA 2MX2A 5M4UA 3C5UA 4QP7A 4DH7A 1TY2A 3KXGA 1K50A 2X6EA 1P7EA 4MGYE 4QTEA 3PY0A 4PK1A 1YN5A 4XV9A 3MWUA 3ORLA 1OITA 3APCA 3FZTA 4F6WA 4C0TA 3BQRA 2XK4A 1WXVA 1P1AA 3TT0A 4M12A 2WMWA 1MPEA 2HW7A 3DCVA 2PE6B 1R4NB 4P6VF 4ZTMA 1PYXA 3OJ4B 2GBRA 4J52A 3MBLA 4NUSA 3ZUUA 5HIDA 5A6NA 1N60A 3U7ZA 3GU4A 1P5EA 3KN6A 4M0YA 3D7TA 3IBEA 1ZWSA 3VR8B 2NCNA 4CV9A 3H7SA 5H8BA 2IO6A 5JT2A 4FKSA 4RWKA 5I3OA 3W10A 4PMMA 3P4KA 5C2TB 3KYDD 2Y0AA 5DMZA 3DAEA 3WYXA 3CR0A 4UX9A 3KKVA 1K8RB 3R1NA 3UI3A 1WJNA 3LCKA 5IA7A 1HTOA 1OQQA 5LVMA 1DAYA 3VAPA 5F95A 5AM6A 3CTJA 2WZJA 2E9VA 3TTJA 4TT7A 2INCC 3FZRA 3AV8A 1UZXB 3PRFA 3HHMA 1ZYLA 3FMMA 4L8MA 2JY6A 1XKKA 2GMIC 4FL3A 4B6LA 5HVYA 3TI1A 1Y8GA 1C78A 4IVDA 4WJNA 5IP4D 4A8XC 2YM4A 4MSMB 4NTSA 2PVKA 5CF8A 2MJEA 1D5ZC 4RIWA 4N6ZA 1E7PB 1VD2A 2QI8A 2Y5PA 2R2OA 1JKSA 1DAWA 4JRNA 3VWAA 4XP0A 3EYHA 2C5YA 4IVCA 4M8MA 3UVQA 4DG0E 1YXTA 5E90A 4HROA 1QOGA 3QALE 4GW8A 3R8ZA 3QAME 3ORNA 4OR5A 5D12A 1U59A 2D07B 4IJ9A 3SC1A 1YOJA 4O4FA 2DWQA 3FC1X 4RGMA 1GIJA 2WEVA 4E6CA 2HDEA 2CGVA 5JH6A 3Q8CA 4XCUA 3P4RB 4HDQA 3BU3A 4BDAA 4E1ZA 2W1HA 2AQ1B 2NBUA 2EKIA 3W2OA 1QPEA 3O0GA 3E9SA 4ZSJA 2IW8A 4B0GA 3DA6A 2QO2A 2RKUA 2UZVA 1V80A 4HRSA 3GQIA 2R7BA 3ZSIA 4ZOHC 2RD0A 3IG3A 3O71A 4O0XA 4LG4A 5EM6A 3FZOA 3L08A 3GZNB 5HG7A 4W9DA 3OT8A 4BDIA 3Q8EA 1L5PA 2BRGA 4IAZA 5E8UA 1YI3A 3QRIA 3V5JA 5CQUA 4WA9A 1WXAA 4S34A 3U6IA 2VZKD 3UG2A 4PDPA 3BHYA 3AC5A 2WXIA 4OGRA 4BTFA 2VTPA 3PZHA 3NX8A 4ZTHA 2PEAA 3ZNGC 3IW7A 2WP9B 3VR9B 3ZUNA 4YSZB 4R3PA 2FNJB 4IQ6A 3RNYA 1FCLA 3PXYA 2YISA 1XH4A 4D0XA 2ETMA 2V0GA 5DIAA 4FTCA 3ZGZA 4F70A 2YHVA 3EJ1A 1VZ8A 1RE8A 3EL8A 3TL5A 2O0UA 4YTHA 3OY3A 1AGWA 3QHWA 4EK4A 4NQKE 4JGHB 3NUHB 4CFXA 4QTCA 1UELA 4EH9A 4IUMB 4L3PA 3L8VA 4B95A 2SRCA 2GBMA 1G5SA 5BVFA 4RVTA 4FV1A 3VHKA 3AGLA 2XF0A 2R5TA 3LCSA 5GJGA 3IHPC 2I1JA 5LARA 2WMSA 2C0OA 3A9KA 2OU7A 2XIZA 1I4GA 4EYJA 4AS1A 2X2MA 4QYYA 2WXFA 1PXIA 2WXPA 5M56A 3CJFA 2LAVA 1TT5B 2V9HA 4BTKA 4FIEA 4F7JA 1N6ZA 4TYIA 4NEUA 4TSSA 4L6QA 4YJNA 2NRUA 2L83A 2C6DA 3A1QA 3GI3A 5KHXA 4I0TA 3KN5A 4C36A 3FKYA 2I1KA 3TIZA 3AE6B 1H1SA 2O6VB 2R0IA 3W8LA 1R39A 3F5XA 3H4JA 2CN5A 1Q10A 2UU7A 1HZ5A 3QKMA 2YLMA 1EU3A 2VGPA 5JXVA 3KEXA 2X2LA 3K5VA 3HECA 3PFQA 5L8KA 4EUTA 2JBOA 3DOGA 3VBVA 1MRUA 2OXDA 2RF9A 3WBLA 4MF1A 1XQQA 4PS3A 3QLGA 4I5HA 3RMKC 5M55A 1WBSA 4M0WB 2MP2A 4HVDA 4J96A 1E5WA 4OZCA 3JVSA 4ZSGA 2JVCA 3HX4A 4CQEA 4Y85A 2BT6A 4US9A 1V0OA 1QKZA 2J90A 3IAS1 2JUOA 5E6JA 3GS2A 5ITAA 4TPTA 1BL6A 1SZMA 3N32A 3WE8A 4ENXA 5AR3A 3OHTA 4MD7E 3OFMA 3P7AA 5AA8A 4R5SA 2FSMX 3PLSA 5FEEA 2BPMA 3R7IA 4USAA 2UZUE 2QD9A 2GBNA 5HKMA 4FSQA 2C6OA 4CCUA 4K11A 2FA2A 2F2UA 3OTVA 4FULA 5CAVA 3C0RB 3BBTB 3F3TA 3WF5A 2YCQA 2EMTA 3G33A 2G1EA 4AJWA 2RDBC 1XCTL 3QTIA 3FYKX 4AZEA 1LXDA 2OBJA 3WOWA 1GUAB 4DEDA 5HICA 1PMVA 3GXLA 3DWMA 2BMCA 2VWUA 2PE1A 2TSSA 3VS6A 3A60A 2Z8LA 4TUUA 5HEZA 5EYCA 3QHRA 5EYMA 3IW8A 2QOBA 3LOKA 1MVKA 2QLUA 1FVRA 1WMHA 4CT1A 5AUIA 1KWPA 3ORMA 1JWMD 4TWPA 3WZUA 4BI2A 3O8UA 4HOKA 3ZO4A 5JFSA 2BIYA 1E9HA 4QP4A 2YZAA 2HZNA 4NSTA 1S9IA 1WYGA 2PTKA 4NAMA 4BHNA 3IVFA 2KQ7A 1ZMWA 2LASA 3DK6A 4AW1A 2IJ0A 3A4PA 2HZ0A 3G0FA 4OBPA 1PXLA 3I63C 3WIGA 5TKDA 2HZ4A 1VRAB 5F9EA 5AP2A 2BYEA 4D2SA 1ZYJA 1N62A 2PW9A 3E88A 3EQHA 1V1OA 3OWPA 2BAKA 2VUWA 2WXOA 5K0KA 4TMAB 3GBZA 4YZ9A 4XLIA 4HPMB 4G3EA 2K8HA 4RQVA 2XNBA 5HLPA 1W2FA 4D55A 3DBRB 3ZEPA 1E8XA 3SW4A 1WXQA 1Q3DA 5G6VA 1KF6B 4WAFA 1D3ZA 3BK1A 4MELA 2R3PA 5C8MA 2A5UA 3SR6A 1NI2A 1GOLA 5EKNA 2OFUA 3AGMA 2PTLA 4TN6A 4M13A 2WHBA 2IZUA 5LMBA 4IB1A 4C7ZA 5J1WA 3FJQE 4KSLC 1L0YB 4YR8A 4F7ZA 4K1RB 2VTAA 4LNKA 5DG5A 4F0FA 4L7SA 5IF1A 4EWQA 1YRPA 2G1TA 3LZBA 2O6VD 1OZ1A 3ZS5A 2GQGA 1ZXIA 1SIJA 4YGAA 2X8DA 2Q5WD 4AZSA 2UW0A 3K3IA 3R7EA 5E6PA 2WDTB 4DGOA 4FT0A 3I81A 3HRDD 5K5XA 2LFIA 4IM3A 3TG1A 5IA5A 4D9TA 4PF4A 5BYQA 4QMNA 3ZYAA 4F6SA 2JWUA 3OROA 4RGJA 1K3AA 3V5WA 4XOYA 2J50A 4QMVA 3AQVA 3R7YA 2R3QA 4EOYA 4K0YA 3AE7B 2K9XA 1TS5A 2BHEA 4DGMA 4E6DA 4A9AA 2J0IA 4OTGA 4PTEA 3UP7A 4AOTA 3W16A 3FXXA 4TXCA 3EL7A 4X3JA 2BRBA 3D5WA 3DBDA 1Z2MA 4WWOA 3NVZA 3NAYA 1XEEA 3FPQA 2XK8A 3MJWA 4QMPA 3FXZA 1OPLA 4MGKE 4FL2A 3MDYA 4N70A 2J53A 3OG7A 4M66A 3TZ8A 3GE8C 3E62A 4JR7A 3ZLYA 3Q3BA 2WXMA 2EVAA 1B39A 1SJHD 1WM3A 5ANIA 4FVRA 4GK2A 5IO9A 2KACA 3P2BA 5CENA 1KTKA 4KBKA 3QZIA