3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
molecule tags Immune system, signaling protein
molecule keywords MGC80376 protein
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
4YBKA 5L8JA 2IYDB 2JY6A 1P4OA 4DTKA 3FQHA 2WFYA 4EZKA 2UVYA 3NAYA 3QRIA 4IZYA 4XJ0A 4JRNA 5ANGA 3WZEA 4F9WA 5BYYA 3A1QA 3E8NA 4UBAA 2BPMA 4FV5A 4E8AA 1IYFA 4RC3A 1Q4LA 4ZZOA 4YJQA 4I6QA 4BTKA 4BGGA 3E87A 3MIAA 2QLQA 4GIHA 4C62A 4OGRA 1SVHA 1GIIA 5IEYA 4IMYA 2KX0A 3O17A 4FKOA 4FOCA 4Y73A 4FSUA 4ASXA 3TUDA 4K9YA 4UMTA 5KZIA 2RSUA 3FMJA 3G6GA 4U5JA 1NI2A 3QJZA 2W0JA 5LVMA 4D2WA 5DWRA 3THBA 3NLBA 4FSYA 5LOHA 3MIYA 2EMSA 4LYNA 2FSOX 1OVEA 2I40A 3AXCA 5CY3A 1C3TA 1ZLTA 4LGHA 1KJTA 3DQVA 4MSQB 1O9UA 2E9NA 2KJRA 4CQEA 2MCNB 3A4OX 3FL5A 1Q8ZA 5KE0A 1XH5A 1H1PA 2Y6MA 1L2NA 4FZ6A 3NGAA 5T68A 1VEBA 4S32A 3PUPA 4CZTA 4YTFA 4II2B 2XS0A 2QOFA 2ZPYA 5IDPA 1CMXB 3SW7A 3GCSA 3BCEA 4J96A 3TZ8A 3Q53A 3ORNA 3R1QA 1BT0A 4GK3A 1OM1A 4IM0A 2EXEA 4GT3A 1DAWA 3CQEA 2FCNA 4JG6A 3C0RB 3TJDA 4TNBA 2EB3A 5LMBA 3IQ7A 5I3OA 3QLFA 2HELA 4FICA 2VTOA 4BDIA 1OEYA 1H0WA 3ZBXA 4LMNA 4EBVA 2O6VB 4TV3A 4DAWA 5AP6A 1HOWA 5AP4A 5AUZA 1UH6A 5CVHA 5L83A 4AW0A 1KE8A 1P3QU 3A33B 3EFWA 4W9GA 4XS2A 3R63A 1S1QB 2J9MA 4FV9A 4H1MA 2YN8A 3B1LX 4IHPA 2ITOA 2RFDA 1E1XA 3F5GA 1OGWA 2UV2A 4ZYNA 1SYKA 2XEZA 3VTUA 4D2RA 4UX9A 2QQ7A 2FB8A 3W2SA 3P0MA 2BAKA 3AC1A 3G9LX 2KN5A 3JPVA 3RD2A 2KWCA 2Y4IB 1IA8A 2XEWA 4FK3A 3UC3A 4LQMA 1XKKA 4X6QC 2W1CA 4DLJA 2WYQA 4YO6A 5DRBA 5J2RA 2OH0E 3IDCA 2O64A 2HIWA 2XIXA 4GL9A 4JBPA 4RA4A 2QHOA 1WZ0A 2Z60A 3MTFA 4GMVA 1L3RE 5JEBA 4IX3A 3MBLA 2QO7A 5A6OA 4O6LA 3WBLA 3QWKA 2G2HA 4FKSA 4I6FA 4XV9A 2PVLA 3BEGA 5TKDA 2CS4A 2GBJA 2IO0B 2LVPA 3TKIA 1A5RA 2QURA 2IY0B 3FXWA 4AT5A 2JVCA 4BBNF 3HMNA 3QAME 5L6WL 1PW2A 4BOZB 4DK5A 1GZOA 4D1XA 3QQLA 2EWAA 4RC4A 4MH7A 4XNEA 4EQUA 2IZVB 5CNNA 3KCKA 4OTDA 4TN6A 4FTTA 4HPUE 3SQQA 4F0GA 4AUQC 4RJ4A 3R9HA 2UZWE 3PVGA 3OHTA 2C30A 2FSTX 3KF7A 4BI0A 3L16A 4ZY6A 2VO3A 3TCAA 3W16A 4OVUA 2VTLA 4FIHA 1YI4A 3OUKA 4KBAA 2K6DB 1OI9A 4RZWA 1YKRA 2YFXA 4R7HA 4AACA 4ZJVA 5JHAA 4GU6A 5KMLA 4FN2A 3CP9A 2QD9A 3KC3A 5LMKC 2YIYA 3ZFMA 3UZPA 1RFAA 2GBMA 2KDEB 2YJRA 3EKNA 4J95A 4UB7A 4MEMA 4BDFA 4F7SA 4Y8DA 2GNGA 3LAUA 4UYAA 1XBAA 3FXXA 2OJRA 1XWSA 4YJUA 2W06A 2YM5A 2R3MA 2EXMA 5D10A 2I0EA 3F3ZA 3DJ7A 5D94A 3CY3A 3T9IA 3P08A 1H1WA 4YBJA 2DHZA 3OFMA 3QTSA 3KMMA 3LFAA 4H36A 1ZMWA 4EOYA 2OK1A 1H1RA 1WYWB 5IPJA 3K3JA 4O2PA 5FBOA 4QMNA 2JZ3B 1I44A 4WBBB 4ASZA 3DGKA 3DK6A 5IA1A 3PRMB 4Y5HA 4N6ZA 1Y6BA 3OWPA 4R7IA 1FMOE 5LCJA 1V81A 1OIQA 4IX4A 4ZTLA 3FUPA 1K8RB 4E26A 3QQHA 5AZGA 3VQIA 1KSWA 5AR7A 4MWHA 4JDKA 5E1EA 3I0OA 3MW1A 3GU6A 3I6UA 5C8NA 4II3B 3OCSA 3C13A 5AAFA 3GVUA 4G6OA 4I5HA 3AT2A 2XEYA 4LRMA 4R1YA 2ERZE 2VWWA 4CEGA 5HHWA 3BLRA 4R5YA 5CEIA 3HECA 2UZTA 3HA8A 3P79A 4W4YA 4DITA 4F6WA 5GZ8A 3EECA 5IH4A 2W9FB 5K3YA 4LI5A 2QOLA 4CMTA 2E9VA 4D1ZA 2ZZPB 3HK0A 2BCJA 3A2CA 3V8TA 5IISA 4DHZE 5D7VA 5A54A 4PTEA 1BUHA 1P14A 4HYUA 4ZY4A 1KE6A 3TV7A 5AEPA 2QOKA 2O6VD 3QC9A 3LXNA 2CPKE 4FL1A 2OKRA 4L42A 2R3OA 5G2NA 3PVLA 4F09A 3CR0A 4FYOA 2O65A 3SHEA 1ZAOA 5LMAA 5A14A 5EKOA 3U7DA 2BKRB 5EM8A 5CTRC 4F9YA 2XBJA 3N32A 3KXHA 2FO0A 3PT2B 5HNIX 3ELJA 4EHGA 4EOQA 2IO3B 4XOZA 2OXDA 2XJ2A 4HCPB 4ANXA 2X7GA 4CQGA 1Q8TA 5DLSA 4IVAA 5CX9A 4J1RA 3E8DA 1OIYA 2OZAA 3QQFA 4BCJA 2K1FA 3SDJA 2LI5A 2JGZA 2DZKA 3PIXA 2LUEA 3A62A 4YSJA 2XK6A 4ICUA 3VHKA 2BHEA 1KE7A 2W1IA 2XYNA 3HYHA 3ZUVA 2K25A 4WJNA 3ORMA 3OTVA 3NYNA 4FT7A 4PL5A 3VBXA 3PZEA 1MG8A 1CDKA 1WZYA 3COKA 4FV7A 4CFWA 3CPCA 4HWIB 3CQUA 3VS0A 1GAGA 1EH4A 4FC0A 2P55A 3BQRA 4JOAA 4YJVA 3R8ZA 1E7UA 2ZEQA 3WANA 3DAKA 4J99A 1XQZA 3OXIA 3F88A 4RIWB 3UQAA 3ZNHB 3BLQA 4RM9A 4FV1A 2C3KA 1LP4A 1J1CA 3PZHA 2Y4PA 1P4FA 4IADA 3PY1A 4ZTRA 5TOZA 2MP2A 4GUEA 1ZYLA 3QHWA 3R71A 2C47A 3TNHA 3UC4A 2HOGA 3JUHA 2ZYBA 2GHGA 2P33A 2XZSA 4AT4A 1WJ4A 3SDLC 3AC3A 5HE1A 4JI9A 2PZRA 2VRXA 4KSPA 5AV2A 5HESA 2B55A 5KMOA 1UD7A 2WDTB 4Q5EA 4URKA 4C7TA 3Q6UA 5C1ZA 4CRLA 4JS8A 3U6HA 5EYMA 3RHKA 3AI5A 2ITPA 2ZM4A 4X7QA 2YDIA 2VTJA 4YZMA 2YDJA 3KL8A 4K7SA 2R5TA 4XG3A 3T8MA 4UXQA 4UYNA 3GCPA 4U44A 1WGDA 2FUHB 3HX4A 4L46A 3HMIA 2XKCA 3POOA 3OMVA 4L3JA 1WGHA 3PY3A 4M69B 1QMZA 1VR2A 3R7EA 2PE9A 2C5YA 3RZWC 2W17A 3JSVB 5HLWA 2C1BA 4IFCA 2BVAA 2C5NA 4F4PA 5KUPA 2R2OA 4F08A 3UNKA 3KUCB 5HTBA 4HJKA 3S2AA 4EZLA 3CGOA 2ZM3A 5HX6A 5LVNA 3VUDA 2WMQA 4GK2A 4QP3A 2BYEA 2W9NA 4CNHA 4A9UA 3FAAA 2C6KA 2JDSA 3QWJA 3WAOA 4FGBA 3IOKA 4J98A 4AZEA 2CHZA 1PKGA 2ZNVC 4I5PA 1PXPA 5AR8A 3UVPA 3MTNB 3PJ1A 2OU7A 4I20A 2JBOA 4MEDA 3TZ7A 4G3CA 4HW7A 3A9JA 4NM3A 2PJHA 2EU9A 3GENA 5CWZA 4QYHA 1LXDA 2CHXA 3DOWA 5DFPA 3Q2MA 3B8QA 5IA5A 4RX7A 3FI3A 1H28A 4JX7A 4E5WA 1ZXEA 5IA3A 2VTMA 3AOXA 3PXYA 1WXAA 3H9DA 4LM5A 5ANIA 5C9CA 4ZLOA 3VC4A 3KRWA 3NZUA 2BRBA 5HIBA 3F7WA 3DBEA 3WOWA 2MX2A 4AP4C 4Y95A 4QMXA 2XF0A 5AX3A 4E6AA 3G51A 2J2IB 4HVSA 2HTHA 4MJSB 1PJKA 2ZOQA 2HZ4A 1IPGA 4IJPA 2BZJA 1WAKA 3BGQA 4MSMB 4OTFA 2FAZA 4MWIA 4G16A 4XYFA 5AUUA 5C23A 3WZKA 2OJIA 2XA4A 4KIKA 4A06A 1HE8A 3FJQE 1XQQA 2NPTB 1IP9A 2H8HA 3TUCA 4D4SA 3DBSA 5HOAA 3N30A 4WWPA 2RFNA 3LE6A 3R9DA 3VHTC 4RQKA 4Q5HA 4FKGA 4L3LA 1QZEA 1PF8A 4YSMA 4M69A 2DZMA 4F8CB 1WIAA 1WRDB 4QQCA 1GC6A 4G3FA 1WMHA 1M14A 4MNFA 4H3BA 3LHJA 4XMOA 3FZRA 1ZW7A 1S9IA 5JKGA 4BFMA 2JKKA 2C5LC 4YJPA 3QTRA 5D9HA 3AXWA 2BZKB 3E63A 4IAIA 4C34A 3R9OA 4EK6A 3EZRA 3TIYA 3HRFA 4RWLA 3RAWA 1J0GA 3RWPA 3ORXA 5HU3A 4NPNA 1PYEA 2GHLA 4TYJA 5EDRA 1WVYA 3VQUA 5BVOA 3V04A 3TTIA 3RK9A 3PVUA 4S34A 3U30A 4WJQA 3FLWA 1Z2MA 3IW6A 1PXMA 5J87A 3LZBA 2ZV2A 5AV4A 2L76A 4J52A 1Q24A 3C5UA 1P5EA 2R64A 2DUVA 4BC6A 4BDBA 2OJJA 2IVSA 2KOXA 3L13A 2UVXA 2OOBB 2LGXA 3KN5A 2O3PA 2X6DA 4RMAA 3R8LA 3ZLSA 5DH3A 2XRUA 4L44A 2ONLA 3IW8A 3QD3A 3L08A 1OZ1A 3HMMA 4FT9A 2OG8A 4O0RA 3QD4A 3Q5ZA 2BRMA 4JAJA 3GEQA 3R28A 3PGEA 2LVQA 3K2LA 2BRHA 2EB2A 5AR3A 4U42A 2XJ1A 4ZTHA 3RK5A 3VW8A 2WKMA 1Q97A 4QO9A 2FCMA 1ZMVA 5CSHA 4USFA 5BVFA 2ITTA 3GC9A 4NW6A 5CAUA 4KRCA 4A3PA 4U3ZA 4BBNC 1LR4A 2HYYA 1W8CA 2WZJA 4IB5A 4W8EA 4W8DA 4WNMA 3W33A 1LQBA 4FV3A 4JBVA 2JWZA 1ZKHA 4MGKE 3UGBB 2QR7A 2UZLA 4FK6A 2WU6A 4D0WA 4RRVA 4ZIMA 3FMDA 1NA7A 3VVWB 4XOYA 4JLCA 3MTLA 4EUUA 3DV3A 3R2YA 4FT5A 5KO1A 1E7VA 4AOTA 1FMKA 4HVHA 5HZNA 2V5QA 3VULA 1WR6E 3DBFA 3UJGA 4JIOU 2J0LA 4RFZA 4BWKA 2F7ZE 3E5AA 3UOHA 4CFUA 2YCFA 2DYLA 3DBRI 3QHTA 1NVRA 5HE2A 3FY2A 2VX0A 2R7IA 4F1TA 5AR4A 2C5OA 1Y8GA 2YABA 4EJNA 4K77A 4ZLZA 4BDKA 2F2UA 3PPJA 1ZWSA 4YTIA 4I21A 4DBNA 1O6YA 3GU8A 4BVUA 4MGYE 3IFWB 3C4WA 5J95A 4QTAA 4F9AA 2ETRA 2BKZA 2CKHB 2WOUA 1R4MI 3MB6A 3MFUA 1OECA 3M63B 3TBLD 1WMKA 4AGUA 4YZ9A 5EW3A 3NW7A 5FBNC 3L54A 1P2AA 4NUSA 3UMWA 4ANUA 3R01A 3WF7A 2ITUA 3KXZA 4BRXA 3ORLA 4PF4A 2JC6A 2UZDA 1OITA 3AGLA 5DPTA 3B2TA 1OIRA 2YISA 3D7TB 2WQMA 3GBZA 3QBNA 1R3CA 1PMVA 3JS2A 5CEKA 1TQIA 5EI8A 3TN8A 3EN5A 4MJSA 3OWJA 4IAZA 2G4DB 3QF9A 5AX9A 2BTRA 3RI1A 4O1PA 5D6JB 2IJMA 4J7BA 4RIWA 3DPKA 5JK3A 4HGSA 2D11A 4BDHA 3D94A 3Q96A 4FHKA 4TNDA 3F3VA 3WIKA 5IUGA 4KWPA 4BOSC 3AU4A 2GTMA 5CNOA 5EM7A 3U9NA 5HE3A 1GZ8A 3RPSA 3BBWA 3ZONA 4BBEA 5JSMA 3IDBA 4FHJA 2IZTA 2V7AA 4ZEGA 2W1EA 4M67A 4C36A 3S1HA 4FIIA 1OMWA 2ZM1A 1LEZA 5AUWA 4O38A 4RSSA 1D3ZA 2C3IB 5HIEA 4IWQA 4LRJA 4IC7A 3GC7A 4L43A 5AP3A 3UTOA 4FTJA 4RZVA 5DT4A 4RIYB 3U4UA 2KTRA 5CT0A 3ZEPA 3JYAA 2PZPA 4FTQA 3EQRA 3PJ2A 3ZSHA 1UNLA 3LQ5A 3KCFA 1YVJA 3ENHA 3LCKA 1WM3A 4ANSA 5CXHA 1V6EA 5A4QA 3UVQA 2NBUA 4IB1A 3BHYA 4IFGA 4R3RA 4EWQA 3LJ2A 4EHEA 3VH4B 4RIXA 4N4SA 3U6IA 5DT0A 4AN2A 4E6DA 5JRQA 4NAWB 3QQ8B 4EL9A 4KKHA 3S2PA 4E6QA 2FIFA 4E4NA 4F65A 3NCZA 3TMPB 3FSFA 1YDSE 3R2BA 3PIYA 2X81A 5JH5C 5EFQA 3A9KA 3AD5A 4KABA 1WBNA 5M4FA 4KVGB 4L9IA 1AQ1A 3DK7A 1WBTA 5HD7A 2PMLX 3W1SA 2YAAA 3OEZA 4X57B 3N9XA 4G5PA 5AP2A 2BAQA 2VTIA 3NZ0A 3POZA 2K6QA 3RNYA 4FSZA 5IAAC 3O7LB 4C59A 2J0MB 2N1VA 3KH0A 1OUYA 5K4JA 4HPTE 4BCOA 4LMUA 3EC8A 2RG5A 5F1ZA 3NUSA 4V05A 3UIXA 4DEEA 4HCVA 4KZ0A 1S3SG 5KHQA 4FA2A 3FWQA 2R3QA 3ZFYA 5CSWA 3EQPA 1DS5A 2KKCA 4IDTA 5CAVA 3FKLA 3V5WA 1WX9A 2GFCA 2GFSA 2WMXA 3WAPA 3TNPC 2LGYA 3L0WB 4FYNA 2LASA 4WT6A 3WIMA 2J90A 3NSZA 1F5QA 1ZOGA 4X3FC 3U9CA 3UIUA 3VUWA 1J19A 5DE2A 4BKSD 3SD0A 4ANNA 3WYXA 3MH1A 4OUCA 4EYJA 3BRBA 4OBQA 3JW0X 1P1AA 2FA2A 4DGOA 4WKQA 3KYCD 3OWLA 4FV2A 5KX8A 5H9BA 4A7CA 4EOPA 3OD6X 4XG8A 2ZV7A 4CYIA 2VNWA 2WTKB 3IW4A 3ODZX 4DH1A 4FTUA 4K2RA 2OH4A 5B2KA 5J17A 2RL5A 4F7ZA 4FEQA 3LW0A 1WZ3A 5JGBA 2PEAA 3BX5A 4ANLA 2J50A 2RF9A 2QODA 4PPAA 3ZDUA 4EKKA 5K0XA 5M57A 2PVHA 1ZYSA 3W1FA 4CCBA 2O2VA 1PXIA 4I41A 4L68A 3PA3A 3PXKA 4R3PA 1YHVA 3HDNA 3APDA 3V01A 3AGMA 2GBRA 3MYGA 4V0GB 2HD5B 4BKSA 2NPQA 5KKRC 4G6NA 5DEWA 4EZJA 1MRYA 2YM6A 4WBOA 1TTNA 4KZCA 5DPWA 1GIJA 1PXNA 2ZAZA 5A6NA 3KUZA 3TEIA 4BKYA 5J9LA 5F9EA 4PY1A 3UIBA 4ASEA 2OBJA 2UZUE 2BYFA 4AW5A 4ANVA 3NCGA 5CQWA 4P5ZA 3AQVA 3BU5A 1U59A 4IAKA 1V1KA 3FXZA 3MPTA 1W98A 3BWFA 5HBJA 2Z2WA 2C1AA 4XP3A 4CMOA 5L6PA 4LGGA 1E5WA 2M4NA 3GQIA 2PVJA 3LFEA 1WGYA 3ZNGC 4HXDA 4E73A 4DG2E 4NFNA 2V0DA 5BUJA 1NDDA 1YOLA 4FZFB 4JIAA 3QCSA 2P2HA 4M0ZA 4OTPA 4U40A 4WG5A 1Q5WB 5AZFA 5J18A 1M2QA 1AD5A 1UNHA 3GUBA 3G0EA 4F70A 4ZRKA 3L9PA 2VU3A 2GPHA 2E9UA 1Q62A 2QOCA 4PDPA 5C1QB 5HO7A 2KTRB 3BINA 3DVGY 2OZOA 1LM8B 3TL5A 3PLSA 5IEVA 5E1SA 3UNZA 2UW3A 4AX8A 1YX5B 2X8DA 4I6HA 4QMSA 5ANDA 4I5CA 4ZSLA 2PE2A 2YITA 2JD5A 3ZO2A 4RJ8A 3ZOSA 3RAKA 1F0QA 3EQDA 4I6LB 3HV3A 4D4VA 3FZTA 3M3JA 4Q9ZA 4C2VA 3FKOA 4K11A 4O91A 4QP1A 2BGFA 2D3GA 1WXVA 5DR9A 3KEXA 3REPA 2R3KA 2X8EA 4HZRA 2FVDA 2SRCA 4FNXA 3UNJA 4CMUA 5J9ZA 1YWVA 4WRGA 3UQFA 4XX5A 4JDJA 4YR8A 5JHBA 3IGOA 2ZJWA 3C4FA 1GJZA 2WEVA 3B2WA 3D15A 1QPDA 3L8SA 3ZH8A 4NFMA 4TWNA 3QKLA 4IZ7A 4B95A 4MXCA 1YXVA 3KN6A 3ZS5A 4BKTA 1DM2A 4QMUA 2YLEA 1JQHA 4D55A 4FKIA 4ERKA 4B9DA 1GJOA 4YTCA 5DA3A 3ZUUA 4FX3A 3R7OA 4BDCA 3GC0A 3BY4B 2X2KA 4WG4A 5KBQA 5GZAA 2D2QA 4H3PA 2VTQA 4RG0A 4E5BA 2YM3A 4G9RA 2BFYA 4GCJA 2O5KA 2AC3A 1BL6A 3Q4UA 3CPBA 5DOSA 4EKUA 3TZMA 4C4EA 1H01A 2GNHA 2ACXA 3PJ8A 3DK3A 2DAJA 1VZOA 2OWBA 3SXRA 2R2QA 4LUDA 4YZCA 4FBXA 2VTHA 3QX4A 5CS6A 2J6MA 3KRRA 4JX3A 4GFMA 4ANOA 2YACA 3HNGA 2UW9A 4DGMA 4JXFA 3MVHA 5F20A 4AN3A 2FCSA 3PSEB 3VW6A 1JBPE 2C6OA 3BE2A 3O50A 1WJNA 2XVDA 3BPRA 3G33A 2A2AA 4HYSA 4KD1A 5EK7A 3ZXZA 2H34A 5DRDA 4C4FA 3R7UA 4Y83A 5HKHA 4LOPA 5CAOA 3DCVA 4ZJIA 4CT2A 4ACMA 5AA9A 2KLCA 4GYIA 3FL4A 4A07A 5CHWA 4C3PA 1UU9A 3BYSA 4DC2A 3R8PA 3HDMA 2BPSA 3R66C 4D58A 5F95A 4WJOA 2C6MA 4I0RA 3APCA 4PP9A 2K8CA 4FMQA 5C26A 3TNIA 2XIRA 3NZSA 3FI4A 2ITWA 4BTFA 4AGDA 2WOTA 3MJ2A 4S31A 2VWUA 3II5A 4ZAUA 4GVAA 4FT0A 2M1MA 2BRGA 1XJDA 2GQGA 3A4SC 3GFEA 3EN4A 5M4UA 5EHOA 2ZDUA 1O6KA 3B08A 5FP5A 1YW2A 4NJ6A 3VS3A 5DPVA 5FDPA 4W9FA 1ISNA 1OIUA 4PRJA 3EL7A 4R8QA 3BHUA 3D7TA 4RWKA 3VAPA 4AFJA 5JQ5A 4EEVA 3A4RA 3JSVA 3TCPA 4U6RA 2C7MB 1JLUE 5LCKA 2A4ZA 3TUBA 2ZPNA 4CKRA 2D07B 3PREA 4AG8A 1GZNA 4FKJA 3DLZA 3S95A 1EF1A 2LXAA 3LM0A 4B0GA 5CASA 2KWVB 4HGLA 3LCTA 3AG9A 5HCZA 2BMCA 5LXHA 3Q6WA 3CE3A 3EQHA 1NXKA 4N6YA 3FZPA 3KYDD 2HENA 4TWOA 5CZHA 2KJ6A 4UEUA 2MSED 3WF8A 5E6PA 4DFLA 3HUBA 3O71A 2L00B 4G31A 2C5XA 5D1JA 4RWIA 3UGCA 3NIZA 2CGXA 4BCGA 4TT7A 5BUIA 3CTQA 4NWMA 5LQFA 2VN9A 3EH9A 1ZZLA 4UMPA 1QPEA 4AU8A 2Z7SA 4O0SA 4C2WA 4QP9A 1CSNA 3LMGA 4EOIA 5AV3A 4WAAA 3GOPA 2JEDA 4N0SA 5E8XA 3VUTA 2R3GA 2JDRA 2R0UA 4E3CA 3PRIA 2R4BA 4DGNA 4G50A 2VTSA 2V62A 3CJGA 3NW6A 4TYEA 4G11A 1Y91A 2QOOA 3LPBA 2IVUA 1HCKA 3R0TA 3LFQA 3ZLZA 3RYTA 2Y0AA 3E88A 2WNTA 4FIFA 4BCKA 4XZ4A 1KOTA 3IKAA 4QTCA 4YLKA 1DAYA 2R3HA 2B7AA 3ZC6A 1V5OA 3HIZA 4LFIA 2WEIA 4NT4A 3R7YA 1WY8A 3AMYA 5CHFA 3JYUA 3PE2A 5FEQA 5ACKA 5IA2A 1YI3A 3F66A 2HZIA 3RMFA 3KXNA 4AWIA 1FVTA 4BKZA 2MP2B 3LFSA 3D83A 1W7HA 1APME 3C4EA 3CLYA 1OL6A 4GDKB 3QGYA 4L45A 4KSQA 2R3FA 5GZ9A 3QZHA 4EOMA 3DDPA 3DU8A 4MXAA 2BRNA 2C3JA 4U7ZA 4FULA 4NEUA 3ZTDA 4FNZA 4D5KA 3UF8A 3FLNC 5JRSA 2Y7JA 4PDOA 3KXXA 1WH3A 4ASWC 4DG0E 3CKXA 2J0MA 3RPVA 4KDIC 4YZNA 4Z3VA 1PXJA 1PKDA 2XK3A 1JSVA 4XG9A 2WMRA 4ZSAA 1TZ1A 5GJFA 4BCFA 2NR2A 5J8IA 2GOWA 2J7QB 3F61A 1PMUA 3SHQA 5ANEA 5IA7A 4UMUA 3MWUA 3KRJA 1R0EA 1REKA 4IDVA 4BCMA 3BHTA 5J79A 2Z0EB 2ZNVB 5TO8A 3ALBA 4ZRJA 3FZ1A 3MI9A 3HUCA 3FYKX 2LRUA 4D2SA 3CKWA 4CYEA 3ACKA 4C57A 3PSBA 4O2ZA 4ALVA 2WX0A 4IXPA 4L67A 3OP5A 4AFEA 5IEXA 3BGZA 5FDXA 5I9XA 4R5SA 3NRMA 3VWAA 3ZC5A 2X2LA 3F2AA 4DXAB 2X7FA 4U3YA 5AIRA 3H0ZA 2R3PA 4MAOA 3OCTA 5DI1A 1WMHB 2PSQA 4J8NA 3MVLA 4AOIA 3O8UA 2BZHB 3KULA 3AT4A 3GXLA 3LXLA 4GIIA 2OFUA 4M3QA 5CXZA 5LVPA 4JRVA 3GCVA 3VIDA 2JZZA 4C02A 1XH9A 4TWCA 5E8WA 3FQSA 4KIOA 3DFCB 3IO7A 3P4KA 4ERWA 3ZRFA 3TNQB 5LWMA 3HMPA 3P23A 2H9VA 3SXSA 4EOJA 2KHWB 2L3ZA 3F7ZA 3DDCB 4JL9A 4GDKA 3BYOA 4MM3A 5LXMA 2NRYA 2BFXA 2PY3A 4KAOA 2C4GA 3F2NA 2JDOA 2B9FA 3KRXA 4M14A 3RJCA 2WGJA 2OJGA 2QONA 4BI1A 5FTOA 2MLBA 4W9IA 4E71A 1VYZA 2X7OA 1ZRZA 2HY81 2OIBA 1W84A 4NU1A 2KDFB 3P2BA 1PMEA 3QRKA 2HXQA 4JIKA 4NJDA 4NCTA 2JDTA 1BLXA 5EW9A 4EK4A 5K4IA 2X1NA 4JG8A 2QO9A 4G3DA 3MPMA 4XG7A 3PHWB 3C0GA 4DWFA 2V55A 4QMVA 2JKMA 5DHJA 4RVKA 3VS7A 4DEDA 3F6XA 2WB8A 3RPYA 2C3LA 4RIOA 3ZLYA 5CEPA 3HV4A 3DY7A 4YHTA 4YURA 2DX5B 4IX5A 3F69A 3PRPB 4WWNA 1K2PA 2XM8A 3QALE 4PP7A 4KS7A 2W5BA 3L8VA 4E4MA 5HCYA 1XO2B 3ALNA 3TG1A 3KY2A 1TKIA 3ZDIA 1F3MC 3M2WA 4WIHA 5IMEA 1BL7A 1QCFA 2QI8A 4L7SA 1URWA 2QOQA 5CQUA 4AE6A 4RX9A 3L1SA 5JZEB 3BYVA 5AUTA 1XD3B 2K8BA 5HCXA 2ASQA 3SRVB 4YNEA 3GGFA 2IN6A 3L9NA 5ANJA 4DN5A 4MH0E 1ZYCA 2RR9A 4IB0A 5BVKA 4QP7A 2YVCA 3OT8A 2PVFA 2JDVA 1FGKA 3KVXA 3Q04A 5BQ0A 4JGHB 4ACDA 5I9WA 2XNBA 1OKYA 1Y6AA 4Z9LA 3UO6A 1U54A 3TTJA 4FSNA 3GZNI 4NY0A 4QTBA 4IZ5A 2UW5A 4EH2A 2L0TA 2NS5A 3WI6A 3QLGA 4D9TA 4ALWA 2KFKA 1Z57A 4X21A 2J5EA 4II5A 4BICA 1OL2A 4HCTA 4GUBA 1UELA 2B4SB 3EFJA 2J7TA 4KINA 3H7SA 4MHAA 3MA6A 2Z7LA 2Y8OA 4P4CA 4AS0A 5HTIA 5KCVA 1VCBA 3QD0A 3DTWA 2VO0A 1FGIA 4FG7A 1UU7A 3FLZA 4GGQA 4RBLA 3VUHA 4DFZE 5LVOA 3PVBA 2JIUA 2PZIA 1RRBA 3PV1A 3FMEA 1OL1A 4FT3A 4IH8A 3VUXA 3DB6A 3RBWA 3ORPA 3QK0A 4FUXA 5ACBC 5J5TA 2PMNX 2HWOA 4YO4A 5TF9A 1LUFA 1Q41A 3DNEA 1KM7A 4S2ZA 2YCRA 1YOJA 2J0IA 4QPAA 5DR6A 4A4LA 3I60A 3DQWA 1W0XC 3K5UA 2OSCA 4GXBA 4G1WA 5BVNA 5JT2A 1JWHA 3TJCA 4GSWA 5J5SA 1GNUA 2WMVA 2VWIA 3SLSA 2NO3A 3H0YA 3DT1A 2BR1A 3VDZA 3CGFA 2ETMA 3IOPA 4IW0A 2YEXA 4YC8A 2HW6A 2QO2A 4IWPA 3QQJA 2REXA 5M53A 3VUKA 1E8XA 3FLYA 2R3LA 1YWNA 4ZK5A 2FIDA 3FZOA 2LXCA 2CLXA 3B8RA 3E7OA 2YLFA 3DNDA 4EZ3A 3LCDA 4H3QA 1Q0WB 4FZAB 4M84A 3LVPA 5G1XA 2BZIB 5HG7A 4AW1A 3R7QA 1OPJA 3O8TA 1JKKA 4CZUA 4KIPA 1E90A 4GB9A 4FNWA 2I1KA 5K0KA 3KXGA 4JAIA 3U51A 1UKHA 3LCSA 3LFCA 3JY9A 4ZJJA 5DCNA 3UINB 4I24A 3C50A 2IZRA 4QQJA 5E90A 3S4QA 4CLIA 3E3BX 5AM7A 1H00A 2YCSA 1AGWA 3DA6A 3JVSA 4PS8A 3FY0A 2XUUA 3IG7A 4JJRA 5HNBA 2WQOA 1L7YA 4MXYA 4TYHB 1HCLA 4NK9A 4QQTA 4MD8E 3R8MA 2F4JA 4DYMA 5L95C 3C4CA 3G0FA 3PXZA 2KO3A 3ZBFA 2RIOA 3PG1A 1BYGA 4BGHA 5JFSA 4D0XA 4F0IA 2IY1B 2VZ6A 4V0GA 3MVJA 3AD6A 5J7BA 1MRUA 4L8MA 5TR5A 4O6EA 4UWBA 4BHNA 4KDLB 2Z7QA 4NJ3A 5HU9A 4IANA 5AA8A 1TVOA 2JKOA 4RPVA 2Z8CA 5L2IA 3DBLI 2XIZA 1YRPA 1MP8A 2MQJA 4BFRA 5KMIA 3NUNA 3ZNID 3OJ3A 3HHMA 3PRFA 4JQEA 3DS6A 4XP0A 5EHYA 4FTCA 5CANA 3QA8A 4P7EA 2OGVA 2WWZA 4YMJA 3ANQA 5EYKA 4N9F4 3KGAA 4PTGA 3ZDMC 4FTKA 4M97A 2EUFB 3NPCA 3Q5IA 5CU2A 5E8TA 4QMQA 1WCCA 3EIDA 4IWDA 2AC5A 5CZIA 3GU4A 1KLVA 4D2PA 2MBQA 2QG5A 4ANBA 4OT6A 2JAVA 4LV8A 4RC2A 3R7IA 4ZTMA 2L05A 4IZAA 2GMIC 3PZDA 3IBEA 4K8AA 2XH5A 2YM8A 3OG7A 1OKZA 4I22A 4W9XA 4Y72A 3COIA 5HBHA 2RFSA 4EZ7A 2AWTA 4DDGD 1PXOA 3R22A 1YHSA 4HPMB 1DI8A 4F7NA 3CTHA 5FTQA 3PLVA 5BVEA 1V49A 4CHKA 3UPXA 2C5VA 5JQ8A 3KU2A 4NTSA 3RAIA 2ZVOA 4PPBA 1SNXA 5TT7A 2OJFE 2OIQA 2CHLA 3EQIA 1OGUA 3OWKA 3ZEWA 2BF8B 1H25A 2N9PC 3DVGX 3CY2A 3P1AA 4ITIA 2KTFA 4TYGA 1P98A 3QC4A 4A4OA 2ZB1A 2Y5BB 4FJVB 4PS3A 1H8CA 3OW4A 4IC8A 3A61A 2BWFA 3MSSA 2X9EA 3V5LA 4HVBA 3GCUA 3FE3A 4I6NB 3BV3A 4D1SA 1H27A 2OXXA 4O21A 1ATPE 2B52A 2Q0BA 4I94A 4LV5A 4DFXE 4H58A 4F63A 2JIVA 4PMTA 3VH3B 3C4ZA 2WTCA 5DPRA 4XRJA 4YP8A 2WHBA 5BYZA 2CKEA 1TQPA 3CXWA 1R78A 3V62A 4FG9A 5LWNA 4M66A 1UGMA 4QTDA 3KF4A 1E9HA 2OW3A 3DLSA 1RLFA 3VS1A 2UYZB 4AWJA 5KHOA 2YM4A 3T8OA 1JRUA 4YHFA 3ANRA 3NIEA 4BL1A 2OF2A 3QGWA 4MNEB 2JRIB 2RFEA 2KWUB 3VAWA 2B9JA 3EQFA 3OOMA 1CM8A 2C9WB 1BI8A 4HVGA 1M52A 2IBIB 1ZARA 2O0UA 3QXPA 4F99A 2WTDA 3R8VA 4RFMA 3ORKA 4FIJA 3ZLXA 5IG1A 4GU2A 2WTKC 4P2KA 4FV4A 3A7GA 2DYOA 5HQ0A 1OPLA 3DBDA 4QMLA 3GC8A 3CJFA 4H39A 4W9CA 2C69A 4FF8A 3CBLA 1P9DU 4JQ8A 2N9XA 4YLJA 3UVRA 2RSVA 4BTJA 2HK5A 4I4FA 4ENXA 2JFMA 3VBYA 5B2MA 2KLGA 2JFLA 2FSMX 2OI4X 3FMHA 3IK3A 3MA3A 5FXQA 5HNGA 5KKRB 2VRRB 3VVHA 2A0CX 4X6RA 4XRLA 1ZMUA 5KNJA 4BB4A 5L2TA 1Q8WA 3I5ZA 3ENEA 4QQ5A 2VO6A 1ZYJA 5CEMA 4YZDA 2JBPA 3C7QA 3LOKA 2R3RA 4CV8A 3PTFC 5FWKK 2YM7A 3D5WA 3KFAA 3R21A 5GJGA 2PVKA 1OL5A 2FH9A 3H9OA 3VUMA 4A4XA 4GIVA 5AZHA 3R7GA 1V9JA 2GBKA 5ETFA 2M8SA 2UW7A 3KKVA 3G90X 4CKIA 2XCHA 3DQXA 4OTHA 1IG1A 4HVIA 1Q1OA 3UBDA 4WG3A 5D41A 2K8HA 1URCA 2CGUA 1K3AA 3UYSA 1XBCA 3BIZA 4EYMA 3GT8A 3RM7A 4U0IA 2Y6OA 2XYUA 5HBEA 4C58A 2DZIA 3ZO1A 3VF9A 3K5VA 3E8CA 4TL0A 3QZFA 3ZUTA 5IZFA 3T3VA 1GY3A 4DH3A 3LXKA 2F7XE 4W9EA 4O22A 5CEOA 4BCHA 3E3PA 1GG3A 1CTPE 3ZTCA 1BX6A 1MRVA 1RW8A 2ITYA 2XK7A 3EN9A 4UY9A 3W8LA 4MXZA 2PHKA 2YCQA 4AOJA 3P5KA 3MJ1A 2VX1A 2VWBA 3ITZA 3VO3A 3W1SC 4BCQA 4OAUC 1DI9A 3NUUA 3BKBA 3FZSA 4M0YA 3COMA 5E8ZA 3TIZA 4GJ3A 1QPJA 4AQCA 2MBOA 4GG7A 2OXYA 4CRSA 2VWVA 1H4LA 4ALUA 4AGCA 1I35A 3MH0A 4RMZA 5GHVA 3SOCA 3AD4A 1YXTA 2P2IA 3Q4TA 4BN1A 5ITAA 2DYMA 4F0FA 3OEFX 4I0TA 4G17A 3WILA 2YA9A 3S0OA 4LDTB 3GP0A 3DTCA 4FTLA 4FKQA 2QC6A 3FDNA 3FKNA 2AEHA 5HGIA 4JQWC 3ZRKA 5CSPA 2VGPA 4MBIA 1XHAA 3C1XA 5HX8A 2D10A 4MD9E 3Q9ZA 4M8NA 5T3QA 4IVDA 4EH3A 4CZYB 1GOLA 2VWZA 4ZLYA 4MKCA 4A20A 3QIJA 3CQWA 5CU3A 2HZ0A 2C6LA 3EZVA 1H1SA 3QTUA 1IASA 2VTAA 4WUAA 4DGLC 4OW8A 1PY5A 2XK9A 1UBQA 2W4KA 4HZSA 5HLNA 2XNGA 3D9VA 3ZO4A 5CHVC 3QUPA 4QMZA 3FHIA 1FPUA 4XV3A 2PVYA 3DZQA 2C7HA 3QAQA 1WJUA 2A4LA 3WZDA 2KTYA 2WIPA 3Q9WA 4I6BA 1KV2A 4ZXTA 3ZCLA 4EH6A 3DVNV 2G2FA 2XNPA 4IAYA 3RNIA 3CMMB 2KX3A 2QU5A 5AR2A 3NUXA 2AL3A 1WXMA 4TZRA 3CF6E 4OLIA 2IO2B 4LCDE 2NBWB 3WA0A 2F49A 3LXPA 2P0CA 2W7XA 1PMNA 2B53A 3X0WA 2CMWA 3PIZA 2G9XA 1JNKA 5GMVA 5CLPA 2CR5A 2W05A 1H08A 3ZRCA 3NUPA 2XRWA 4JNWA 2LRWA 5FR6A 3LDZE 3MY0A 4MGZE 1Z5MA 3Q9YA 5H2UA 4DGGA 2VUWA 3WF5A 2MBBB 2ZB0A 3G9NA 5EDQA 5CAQA 2B9HA 2Y4IC 3BEAA 3EHAA 3LJ1A 4YC3A 5I5ZA 1ZYDA 4JBQA 5D7GA 3OT3A 1I09A 3ROYA 4JT3A 3GFWA 3TACA 3OBJA 4LOQA 2C6TA 3QQKA 2JUOA 3ZIMA 3S3IA 4CKJA 1PQSA 3FPQA 2C6EA 1UZXB 4WHZA 2XNNA 4W4WA 5CU6A 5HI2A 2WPAA 2BIYA 5IMXA 1SVGA 2QOIA 4FSMA 5T6KA 2W5AA 3SXFA 2QNJA 5AADA 3PTGA 4UALA 5G6VA 2WXVA 4GV1A 4WNPA 1Q8YA 3HV6A 2IO6A 3IW7A 1SM2A 3ORIA 3MGYA 3VJNA 5I9VA 1OEYJ 1T45A 4LJPB 3I6WA 4CFFA 2O2UA 4FL3A 2QOBA 4NJ7A 2UW8A 3BHVA 3RM6A 4EONA 5HO6A 4CSVA 4PX6A 4EQCA 2OIDA 3EFKA 4CYJA 2VD5A 1WJ6A 3ET7A 4DEGA 3D5XA 2J0KA 5LMKA 1YXUA 4HGTA 5K5XA 1JOWB 2HXLA 1X8BA 4FTNA 3PPZA 4QP4A 3QKMA 2OJ9A 4FKRA 5F4NA 4A9TA 1CKIA 2KVRA 4RX5A 1VYWA 5L6OA 2UZOA 1E8WA 1Z5SB 3ML9A 3I7CA 3ZHPC 4NNJB 3QTZA 3OW3A 2WTIA 2YERA 3D5VA 3NY5A 2KJHB 5AP0A 5FP6A 3H10A 3UODA 4ZOGA 3TWJA 2JAMA 2VX3A 3UO4A 1SE9A 1LFDA 3G2FA 5AP7A 2BYVE 2R3JA 3F82A 4C0TA 4MQ2A 4F1MA 4LDTD 5EM6A 2IWIA 3O65B 3VHEA 4F1SA 2R3IA 5I9UA 4A9YA 4DLIA 4K1BA 3EN7A 3PLUA 4LGDA 2QU6A 4FTIA 2LZ6A 3DCGA 1OTRB 5HVKA 4PYZA 1XH4A 4O0UA 4O27B 4PWNA 4QD6A 3R8UA 3BQCA 1WX7A 4EWHA 3FQEA 3CTJA 3E64A 4OBPA 4KKEA 5TE0A 3FHRA 3KK9A 1WBWA 4IQ6A 4CO7A 3EYHA 2E2BA 3SX9A 3WZUA 2RGPA 2PE6B 1YXXA 4AW2A 4I5MA 5M4CA 5AEKB 4YZBA 4EORA 4EH4A 1SGHA 2PPHA 2CSNA 3BU3A 3NX8A 3E7VA 4FSRA 4DH7A 5DR2A 1E8ZA 2FYSA 4WD5A 5HG5A 3ZTXA 3KW5B 4IE9A 3FI2A 5AR5A 3ZSGA 4QMPA 4K1RB 3TNWA 1YOMA 4ENYA 3CSFA 4GG5A 1YI6A 4D4YA 2W4OA 4PUZA 1U5QA 2REIA 3E93A 4KS8A 4U8ZA 2WMBA 2KZRA 2RKUA 4NSTA 3OY1A 4I92A 4RVTA 3RAHA 3UDBA 3VBQA 4EC9A 2WELA 2NPTA 2O6VA 3KVFB 2BTSA 1NVSA 4B7TA 1B6CB 2WO6A 3GU7A 3QQUA 4IX6A 4LL0A 3BLHA 3RCDA 1U5RA 3TV6A 5ICPA 2UW4A 4P5QA 3Q32A 2GNFA 3TZ9A 4EQMA 2IZUA 2CHWA 3UOLA 2WTWA 3ORTA 4PMMA 5A4LA 2GDOA 4QYGA 3I7BA 4AOFA 4QNYA 1MUOA 4KSKC 2BHHA 3R1NA 4DCEA 1VD2A 4U80A 4EH8A 5M44A 2QHMA 2WTVA 3GOEA 3A9JB 4C4JA 2YIXA 4BDAA 4EK5A 2KQSA 4E74A 5JFWA 5L2WA 3A7FA 2V1YA 2Q0NA 1G5SA 4GN1A 3V5TA 5M56A 4HOKA 4GDLB 3P7CA 1H8FA 3D5UA 4GK4A 1XBBA 1WM2A 3FMMA 5AM6A 1WBOA 4QP2A 3OXZA 4NM0A 4PNIA 2ZCBA 3KVWA 2PVRA 3EL8A 1PXLA 2VNYA 2YZAA 5I9YA 2W4JA 5CYIA 3C9WA 5AUYA 4HK2A 2ETKA 3ZYAA 3RUIB 2W9ZB 2GS7A 4BTMA 1MQBA 4ANWA 4PL4A 3NS9A 2P4IA 4AAAA 1WBSA 3F5UA 4CV9A 5KMJA 5J1VA 4MELA 3R7RA 4GH2A 4K0YA 2XK5B 2ZJDA 3EHVA 3A8XA 4K6ZA 5IU2A 4B6WA 3MS9A 3SD5A 3N51A 2CCIA 4RJ6A 2JRHA 3BE9A 3Q3BA 4GFGA 2WQBA 5BMMA 4AN9A 2AUHA 3MH2A 4YJOA 1PHKA 2R2PA 5E92A 3HZTA 1SIFA 3D32A 4XHKB 3AT3A 2GNJA 5AWMA 3I81A 4U79A 2ZV8A 3SU8X 1YWRA 3MB7A 4IAAA 4GMYA 5ETCA 5LARA 3NUYA 4ITJA 1WFYA 2B3AA 3MDYA 4MD7E 4WSQA 2G01A 2PMIA 4ASDA 1V5TA 5EOBA 1BKXA 5DNRA 3Q60A 4W9DA 2XCKA 1IR3A 3D7ZA 4IM2A 4O0XA 5M4IA 1JKTA 3RULA 3VUYA 4E6CA 2CLQA 1EF5A 3BBTB 2IZSA 4OTIA 2UWQA 4JDIA 1WXSA 4AP7A 5IH5A 2VV9A 4GS6A 4XC2A 3OTUA 3AULA 3MFSA 4UZDA 3PXQA 3WAMA 2RD0A 5A46A 4LUEA 4WO5A 3RVGA 3O51A 3ULZA 5D7AA 2HCKA 4S30A 3V6SA 1JAMA 2W1FA 3QCYA 1V80A 3EFUA 4OVVA 4EOSA 3ML8A 3ZRMA 3EWHA 3C0HA 5H3QA 4BCNA 4O0TA 3PA4A 4GEOA 4MGIE 4G3XB 3VQHA 1FINA 2HWPA 3VS6A 4E7WA 3BU6A 2JPHA 4PS7A 2G1TA 1JKSA 3I0QA 2P3GX 2X39A 1QL6A 1CMKE 3L8PA 4GU9A 4BIBA 2Z59B 2GHMA 2PE1A 3SOAA 3OF0A 4TWPA 2R3NA 4M12A 3BGPA 4ZP5A 2VWXA 4AXAA 5IH6A 3R00A 5M51A 3X23A 3W8QA 5HICA 4XH6A 4Q2AA 1FVVA 3BV2A 1GNGA 2I0HA 4MK0A 3CS9A 2K39A 4GRBA 2XNOA 3H9RA 4YGAA 3FMLA 1SMHA 2EVAA 3I4BA 4EHVA 4UMQA 1J91A 4EZ5A 4BKGA 5EW8A 4YLLA 2WTJA 4FVQA 4Y46A 3A7IA 5FG8A 3H7PA 1YQBA 4QTEA 5DT3A 2CGVA 4TKSA 3NYOA 5LLIA 5CSVA 4APPA 4NIFA 2MA9B 5IUIA 1UV5A 2C60A 3BZ3A 5EH0A 2O8YA 3L9LA 1NY3A 4DEAA 4PPCA 2CJMA 3OCBA 3ROCA 4NAWA 4FADA 4RX8A 4USEA 4MXOA 3A60A 3HV5A 1SZMA 3P7AA 4TYHA 4AA0A 3DKOA 1X1MA 3FPMA 3IDPA 3VBVA 2IVTA 1EO6A 3SKCA 5BPYA 1J8CA 3E8EA 3V60A 1RDQE 5LJJA 3HRBA 2VTTA 4X2KA 4A9SA 3G5DA 3RP9A 2IW6A 3UQCA 3ZNZB 2PE0A 3ZFXA 1YQJA 4ZS0A 5F94A 2NP8A 5EDSA 2WD1A 1E1VA 2YHVA 4C33A 4B8MA 4J71A 2X4FA 2UW0A 3MN3A 5AV1A 5BVWA 4IIRA 4XV1A 4EOOA 2A5UA 4J53A 1SVEA 3W2RA 3PWYA 4X0MA 2LWPA 4IUMB 3I3TB 1U54B 2C0IA 5CF5A 2BWES 4X2NA 2Z7RA 4CTCA 3NYVA 5K9IA 2KULA 4QPMA 4YPSA 3MJWA 3F3UA 3W10A 4BKJA 4QPSA 4BBMA 1WE7A 4JQ7A 2IVVA 2G4SA 4V04A 2C6IA 4ZSGA 5D11A 3QTIA 3VS4A 2YJSA 5IDNA 4BGQA 4XG4A 4XEYA 4GYGA 5BX0A 2BROA 3WF9A 1KV1A 1RAXA 2NBVB 2Z0DB 1S9JA 3RT3B 3UQBA 4QP6A 5CF8A 5B0XA 4UN0C 1U4AA 2MW5A 4IB3A 1BMKA 5CU4A 4W4VA 5D12A 3AMBA 3WZJA 3RGFA 2RPQA 3U87A 2KFJA 4BZOA 4M8TA 5ANOA 4JDHA 2QR8A 5A9UA 2CN5A 2ITQA 1FVRA 3UOJA 3HKOA 3K54A 3NWWA 3F5XA 5CTPA 2HZNA 4M13A 2GS2A 4O0WA 2PMOX 2JXXA 1WI0A 5I0BA 2GMXA 4QMYA 4QP8A 5KMNA 5EDPA 2C0TA 3P86A 1JKLA 2O63A 4PYUA 4I0SA 3LCOA 3HVCA 3HM3A 2BILB 2WMSA 4YPDA 3H6NA 1NVQA 3GCQA 3QD2B 4X3JA 4A3OA 3IS5A 4OTRA 3GNIB 4PDSA 2MWSB 4DHJD 1M2RA 2ONLC 3R30A 4OTGA 4W9LA 1OQYA 4TYIA 4QMTA 3L8XA 5HORA 4IACA 4FLHA 3NEWA 4TQ0A 1CKJA 4APCA 4FG8A 5CVFA 5EG3A 4HYHA 2ITNA 2X0GA 3HGKA 3EQBA 5B2LA 2ZV9A 4DFNA 5K5NA 3VF8A 3MY5A 1WE6A 2W99B 1A9UA 5CVGA 1VJYA 3EQGA 5FEEA 1V2YA 2W96B 4L01A 1FOTA 2W5HA 3OOGA 2I1MA 3CEKA 3ZXTA 5JZNA 3UIMA 4OAVB 3V61A 4XV2A 2R7BA 2L8JA 4MYGA 3ETAA 5H8GA 4LRKA 4U9AA 2DYBA 1W83A 4FTRA 3NR9A 4O96A 4I6PA 1WBVA 3KRLA 3M11A 1YDRE 3FC2A 3ZU7A 4RIYA 2LD9A 4NM5A 3PA5A 2H96A 2E9PA 3R7VA 4ACCA 4FJZA 4J97A 1ZZ2A 4RLLA 1UWHA 4FTOA 4HNFA 5AP5A 5A3XA 3PP1A 4BBFA 1Q3DA 4W4XA 3L10B 2BDFA 5H8EA 3ZVVA 2UUEA 4UXLA 1H0VA 3CSTA 4HDQA 2G2IA 2JITA 5CSXA 3V8WA 2W1DA 4F1OA 1Y8RC 4CTBA 4HJOA 3ONSA 2WU7A 3D2IA 5E6OA 3EKKA 3EYGA 4IJ9A 5DEYA 4FKTA 5FGKA 3TXOA 1LPUA 4D4RA 3GOKA 1MQ4A 2BDJA 4JR3A 3ALOA 5EI6A 4BIEA 4IG7B 4TUUA 5HO8A 2MRPA 4R1VA 4WSYA 2MBEA 5L3AA 5IUHA 5HE0A 3VS5A 1J1BA 5EYDA 3UMXA 4HPLB 4FA6A 1T46A 4MTAA 4TTHB 1ZOEA 3EOCA 3UP2A 4EC8A 5AV0A 2V3SA 3JY0A 4D28A 3NAXA 3LIJA 3R04A 3KK8A 3PXRA 3S00A 5HLPA 3PXFA 4TXCA 4KB8A 4PQNA 1UVRA 4F9CA 4BYJA 3KMUA 5EKNA 4YJNA 4C35A 5AMNA 1E8YA 4DBGA 3LFBA 3ODYX 4CLJA 4ID7A 4KV2A 4EK3A 4R3CA 3TT0A 3OROA 3Q3FA 2LVOA 3R6XA 3AC2A 4MVFA 4BIDA 2EMTA 4OR5A 3DBQA 4ZRIA 4IBMA 2KK8A 2LAVA 2BDWA 2WQEA 4AZFA 4Z16A 4LJOB 2KMCA 3K3IA 5E8SA 2NVUI 3M1SA 3F5PA 3OBGA 3DZOA 3V8SA 2L7RA 5A4CA 1UU8A 3CD8A 2XIYA 3BHHA 3MFTA 3D2KA 4P90A 4GVJA 2JIIA 3H3CA 4RA5A 3ZZWA 2KMAA 2WIHA 1R39A 1A06A 2EXCX 4BYIA 3M62B 3MY1A 3PVWA 2RG6A 4AGWA 5EYCA 4FR4A 3RALA 1KOAA 2ZMCA 4BF2A 4OT5A 1V0BA 4UMRA 2KANA 4NQKE 4MBLA 1XT9B 3W2QA 5BNJA 4G3EA 3V5QA 4Z7HA 4XP2A 5KBRA 4IEBA 4QYFA 1H24A 4DHJB 4HYIA 3QCQA 4KNBA 2I1JA 2QKWB 4YHJA 3VN9A 1V0OA 2UW6A 3TKUA 1KE9A 2IO1B 4DHZB 3ERKA 4DH8A 2YIRA 5FM2A 3B0AA 2NCNA 1R0PA 3GI3A 2XK8A 3AU5A 3RZFA 4AA5A 4B6LA 1GC7A 1YXSA 2BKFA 3PSCA 2ZMDA 5HKMA 3U4WA 4BDJA 4EBWA 3U6JA 1AARA 2G45B 4E93A 1K9AA 4X2FA 4L3PA 4M8MA 4RM8A 3WALA 3BELA 3A7HA 4XCUA 5CF6A 4FJYA 4UV0A 2DS1A 1JVPP 3PJ3A 3O2MA 3PFQA 4NKAA 3H4JA 4D2TA 4HCUA 3DXNA 2GCDA 1H4RA 3LLTA 3OZ6A 2A27A 2BUJA 1BI7A 3A4PA 3O7LD 3VUIA 4BHZA 3PYYA 2A1AB 4GT5A 4JBOA 5IA4A 3MHSD 2KDIA 3ZM4A 5I9ZA 2OZAB 5CT7A 2XNMA 3COHA 4JR7A 4FKVA 4RVMA 3KXMA 4E5AX 2OICA 4ZSJA 2QCSA 4LOOA 4F7LA 3RCZA 4KBKA 5CF4A 5BO4B 2VO7A 1M7QA 3FC1X 3QRJA 5DBXA 1YJ1A 3ACJA 2DQ7X 3RCJA 3E92A 1UWJA 2E9OA 4CT1A 3T9LA 1WBPA 4G9CA 4FKWA 4IWOA 4G2FA 3VJOA 3RPRA 4DG3E 2VTNA 4EH9A 5FEDA 2N1WA 3DOGA 1IRKA 3IW5A 1PXKA 5CI7A 3A99A 1OPKA 5FRIA 1NBFC 3VS2A 2L0FA 1KE5A 3UG1A 4FIEA 5L2QA 4CXAA 1JSTA 5E8YA 3KULB 3IECA 3LFNA 3QL8A 1FXTB 4MF0A 4U97A 5L8LA 4I93A 4I3ZA 2HW7A 3CCNA 2FGIA 3A9KB 4TQ1A 2WMTA 3ZLWA 4WUNA 1ZOHA 1PYXA 2A19B 4L00A 5C8KA 3HP5A 4QRCA 5BUEA 4EK8A 1H26A 2HAKA 4PL3A 5I3RA 2XIKA 5E7RA 4YL8A 4FV8A 4EFOA 3OCGA 1G6JA 2CCHA 3R1SA 3H7PB 3ZDTA 3A1QB 4DDID 2B54A 3WF6A 2M0XA 2I0YA 4RJ7A 2FCQA 2WMAA 2LJ5A 3VUGA 5CENA 2XBBC 3QA0A 3QU0A 3DBHI 2WQNA 3DBCA 4BDEA 4IC7B 3GQLA 3KB7A 3IGGA 4ZY5A 5EI2A 4L53A 3QTQA 4I4EA 3LFFA 4ZSEA 3RHXA 4AZTA 3ZO5B 5H8BA 4NKSA 1Z9XA 4KIKB 3T9TA 3M95A 4B8LA 4DHFA 3PE1A 1EUVB 2PZYA 2DAFA 2XP2A 5KHXA 4XG2A 3VXWA 3NS8A 2B1PA 2I6LA 4W9JA 4RWJA 2N4FA 2IW8A 3UQGA 2MBHA 4D5HA 3VBWA 3LM5A 5TR6A 4FSQA 2ITVA 1C1YB 3OJ4B 5AAGA 4PMPA 3QC8B 1Q8UA 4B9KA 1Q5KA 4XBRA 5AJQA 3OUNB 3FSKA 2BAJA 5EM5A 5AAEA 3OLMD 3W2CA 4EI4A 3D4QA 4E20A 4WWOA 3OY3A 3PS6A 3C4XA 5KMMA 2UVZA 3C0IA 4FODA 4RGJA 2HE7A 3HV7A 3V5PA 1STCE 1KOBA 2GNLA 3FBVA 1OUKA 3UO5A 4NW5A 4YNOA 2GS6A 5FD2A 4W9HA 2WMUA 3PG3A 2KNBA 4F7JA 3QX2A 3R83A 4FZ7A 2N7DA 2ZVNA 4QOXA 4FL2A 4EH5A 3BYMA 3QUDA 5G55A 4WRSA 5DIAA 2OO8X 4FKLA 5DN3A 2GBNA 3BWJA 4GJ2A 3UE4A 3VRYA 5E8UA 4CFNA 4HNIA 4XLVA 3V6RA 3TL8A 3ZO3A 1ZY5A 1Q3WA 4PTCA 2VTPA 5C01A 5A4TA 1XR1A 4F6UA 2FNJB 2C7NB 3K9PB 1IEPA 3PPAA 3FMKA 4XLIA 3TV4A 3NOBA 2F9GA 1B39A 4ZDVA 3FMNA 5FQDC 5LXIB 4FOBA 3NNUA 3O0GA 4DFYA 5I4NA 3CD3A 5HG9A 3A8WA 4AUAA 2YIQA 4PV0A 3H30A 5KZ0A 3DVNU 1R1WA 5EHLA 2QLUA 4IVCA 4B99A 2O2VB 4MQ1A 4YJRA 3QTWA 1H07A 3TJPA 2J51A 4QYEA 4BZDA 4NIFB 2JLDA 3GU5A 5CX3A 4GFOA 3PSDA 5BMSA 2VWYA 5HTCA 4LL5A 4M7IA 4BWXA 2I0VA 2H6DA 2AL6A 4GDLA 4D2VA 5JFXA 3KA0A 4TY1A 3UP7A 2PWLA 5J7HA 2ITXA 2PVMA 2ZDTA 4CFXA 4O0YA 2UZBA 3IVFA 4QYYA 3ZZEA 4AE9A 4JG7A 4YJSA 2CDZA 1UA2A 5FLFA 4C37A 4EH7A 2KDBA 3H9FA 2JT4B 4BI2A 1YDTE 1ZGUB 3HLLA 3R73A 3R1YA 5BVDA 3FYJX 3N3KB 4E1ZA 4C4IA 1RQQA 4EUTA 2PZ5A 1WX8A 1CKPA 2CGWA 3V3VA 3LFDA 4U43A 3UOKA 3PHXB 4GOCA 2KFKB 3ZMMA 5D2MB 2XK4A 5GJDA 3NDMA 3P78A 3HRCA 4IM3A 1OKVA 3QUEA 4RJ5A 4FNYA 1SNUA 4YUQA 3UG2A 5IA0A 3ECIA 4EKLA 3OAWA 3RK7A 3EMGA 4F64A 4RT7A 4KRDA 3SA0A 3I5NA 4ONAA 4ANQA 4OBOA 4YU2A 2CU1A 4I1ZA 4DEHA 3NNWA 3AC8A 4ZTQA 1OL7A 5C27A 3MV5A 2WX1A 1WF9A 1YX6B 1R4NI 3U8WA 2Y9QA 3LJ0A 4DEBA 2AYOB 1W82A 2X9FA 2XNEA 3OC1A 2FUMA 3QWZB 4Y5QA 4WJPA 4DINA 3HM6X 3OS3A 5KHWA 4MBJA 4CCUA 3L17A 4L7FA 2XKFA 4FBJB 5GNKA 4IAFA 4G5JA 4U41A 4AF3A 4BVUC 3ULIA 2W1ZA 3I1AA 1P0RA 1T0YA 3D14A 5L2SA 2VGOA 4CVAA 3R02A 4K81A 3D0EA 4MXXA 4WQOB 3WE8A 2PUUA 2ITZA 2J0JA 5ETIA 2LGCA 2XBAA 3SAYA 4V01A 4FI1A 3NW5A 4J8MA 5JMSA 1J3HA 4QMOA 5DGZA 2C6DA 5IKWA 3HP2A 1UBIA 3VTVA 3PPKA 3H1UA 4X3FB 3V5JA 3EQCA 4BCIA 4PMSA 3T3UA 4PNKA 4HDOA 4CFMA 4GW8A 3QHRA 1TBEA 4FIGA 4NH1A 2YDKA 4OTQA 3AC4A 4WA9A 2ZCCA 1UNGA 5IF1A 1RJBA 5DPSA 2JKQA 2UZEA 1GZKA 4TRLA 2DZJA 3VTWA 4LG4A 4MF1A 5CALA 4B4LA 3WYYA 3ZSIA 4F6SA 4Z7GA 4C61A 2NRUA 3NNVA 3QZGA 2EKEC 1GIHA 4AJWA 3F9NA 1V0PA 1RE8A 4FTMA 1FQ1B 4AZVA 3U8ZA 4DH5A 3KMWA 2X2MA 4U81A 4H1JA 4QMWA 4QMMA 4USDA 3VNTA 3W2OA 1WR1A 3Q3JA 4C4GA 2J5FA 3QX1A 3DFAA 3WE4A 3Q4CA 5AP1A 4NM7A 5CI6A 4AT3A 4AZWA 2GNIA 4TPTA 2R9SA 3QZIA 4EOKA 2XKEA 1OKWA 3TIXA 2J4ZA 5JN2A 3V51A 1F9JA 3O8PA 4AJYB 2V4LA 3PP0A 1YHWA 4WOVA 2QVSE 4FVPA 3TI1A 5ETAA 4E4LA 3V6CB 2W1HA 4UZHA 3I79A 1H1QA 3QRUA 4CFVA 4K18A 4ZTSA 1U46A 3L9MA 4C8BA 1TQMA 4C38A 3JVRA 4RIXB 5AUVA 3KQ7A 4X3FA 3HA6A 4YJTA 1M17A 5M55A 5A4EA 5HVJA 3AC5A 2X6EA 3C51A 3QCXA 4FSTA 3FLQA 5FM3A 4ACHA 3MPAA 2M17A 2B9IA 4M68A 4ZZMA 2UZNA 2OFVA 1G3NA 3KUDB 3O23A 2VTRA 4RLKA 1LEWA 2G15A 3G6HA 4GSBA 1YIWA 3HEGA 3HL7A 3FV8A 1JPAA 2QOHA 3UYTA 4I23A 3K9OB 4DEIA 1WFCA 3W18A 3MFRA 3ORZA 4XG6A 4R6VA 4A9RA 2QHNA 4WNKA 2N7EA 3UIPB 3BYUA 4O1OA 2DENB 3DJ6A 3R9NA 3BI6A 4HVDA 5E6NA 2F57A 3DKFA 3QFVA 4KSLC 1XH6A 4TW9A 4FVRA 2XM9A 3RINA 4L6QA 3JVZX 2X4ZA 2C0OA 4KA3A 1M94A 4Q9SA 2KC1A 4FV6A 5JGAA 5AIKA 4RJ3A 4YTHA 1I42A 1OB3A 4ZTNA 2BALA 3UZTA 2YAKA 3PWDA 3PRZA 5EOLA 4QT1A 3APFA 3FLSA 3EB0A 3Q9XA 4G6LA 2RGFA 3Q52A 5JZJA 5JGDA 5HVYA 3WARA 5HD4A 2KD0A 3QRTA 4N70A 4ZZNA 4GT4A 5L8KA 3CC6A 2JF5A 3ZW3A 4K7UA 4M0WB 2KC2A 3NYXA 2AYPA 3QKKA 1GUAB 2N9EB 3QCAA 4X2JA 3EJ1A 4JVGA 5HG8A 1B38A 4J6IA 4L52A 5JH6A 3W55A 3VFKA 3RWQA 2V22A 3VRZA 3QARA 5J1WA 3W2PA 5CU0A 5AUXA 1UKIA 2UZVA 3M42A 3GB2A 3ZKJC 5ANKA 3QYWA 3A7JA 4ITHA 4RVLA 3P7BA 5DVRA 3RZBA 3OVVA 1UU3A 2HJ8A 4Y85A 4MCVA 3W1YA 4P7IA 1Y8YA 1QPCA 2F2CB 3MVMA 4FTAA 4HLEA 4ANMA 3DAJA 1REJA 2XMYA 3LJ3A 5E91A 4ICVA 5J9YA 4C3FA 4KBCA 2V7OA 2DWBA 3DB8A 4KIQA 4G34A 2GTNA 4Z55A 4XUFA 4FUYA 3DKCA 5FXSA 4UWCA 1ZY4A 4BCPA 5DG5A 5HIDA 2W1GA 4FKUA 4ACGA 4C3RA 3AMAA 4MDKE 5L4QA 2YIWA 3QQGA 4XBUA 3PY0A 3UPZA 4F9BA 3NHEB 5KMKA 1WGRA 5CAPA 4EOLA 5B7VA 3DAEA 2XK5A 5DMZA 3IG3A 3P9JA 5C03A 3JXWA 2G3QB 1V86A 3F3WA 1M2PA 4AA4A 1WGGA 3IPHA 2LGDA 1Q99A 2WMWA 3R3MA 3Q4ZA 3PJCA 4AZSA 4S33A 3NNXA 4E4XA 1Y57A 2IW9A 3SRVA 3ZUNA 2XKDA 5LVLA 3W32A 4G3GA 2KXJA 4W9KA 4K7WA 1WVXA 3O96A 2X8IA 2XJ0A 5C8MA 1XH8A 5JFVA 4XX9A 4K33A 4ARKA 3QYZA 4O0VA 3RPOA 3HMOA 4TKNA 4OTWA 3DJ5A 4NZWB 4FKPA 3V6EB 3TKHA 1U4DA 2QKRA 3EN6A 5CEQA 3RKBA 1ERKA 1O6LA 2YWPA 4CD0A 4BDDA 3SVVA 3LQ8A 2PL0A 2R0IA 3DKGA 4YC6A 4BWPA 2PK9A 2VAGA 1YD8U 2GU8A 1JSUA 1Q61A 2ERKA 2KQ7A 3IHPC 2HY0A 4FV0A 3SV0A 4EHZA 3DDQA 3EFLA 4RQVA 2GSFA 3ZRLA 3UIOB 2BIKB 2XB7A 1TGZB 4KKGA 3QTXA 3SC1A 3CIKA 4D9UA 5E8VA 4FSWA 2ZVAA 4IVBA 4U45A 3OXTA 3VBTA 1KWPA 5HEZA 4BZNA 4HGEA 4W9WA 2PVNA 3MH3A 2F7EE 4UWYA 4FZDB 4RFYA 3QXOA 3WIGA 4MX9A 5FXRA 4QNAA 1M7NA 2C68A 1XH7A 4C4HA 2WAJA 4M15A 3RTPA 4EEWA 3ENMA 4NQLB 1WVWA 4G0NB 3IONA 3E62A 2YLMA 4NCTC 4WNOA 2CN8A 4X2GA 4HCNB 2FSLX 2PTKA 2ESMA 4NTTA 3SW4A 3F3TA 4MNEA 3DPDA 2OF4A 4BDGA
chains in the Genus database with same CATH superfamily
1YN4A 3RNCC 4E8AA 4RC3A 4ZZOA 4YJQA 4I6QA 4BGGA 1NYQA 1GIIA 3AEDB 2KX0A 4Y73A 4ASXA 3FMJA 1NI2A 5LVMA 3THBA 2BB5A 3MIYA 2EMSA 1OVEA 2I40A 4LGHA 1KJTA 1O9UA 3A4OX 1Q8ZA 4S32A 2XS0A 1CMXB 1WGKA 4J96A 3Q53A 4IM0A 3AN1A 4TNBA 2EB3A 5LMBA 5I3OA 3QLFA 4BDIA 1H0WA 4TV3A 1HOWA 5AP4A 1UH6A 1KE8A 3A33B 4H1MA 3B1LX 2RFDA 4ZYNA 2BAKA 3AC1A 3G9LX 1K53A 1V97A 1IA8A 4DLJA 5J2RA 1XKKA 2W1CA 2OH0E 2E3TA 2QHOA 1WZ0A 2Z60A 4GMVA 1L3RE 5JEBA 2WU2B 2QO7A 4O6LA 4FKSA 4I6FA 4XV9A 2I38A 2IO0B 2CS4A 2QURA 3HMNA 5L6WL 3C19A 2IZVB 3ALBA 5CNNA 2UZWE 3PVGA 4ZY6A 2VO3A 3TCAA 3W16A 2VTLA 3LB8C 4AACA 1D5ZC 4FN2A 2YIYA 2GBMA 4J95A 3LAUA 4UYAA 2YM5A 2EXMA 5D94A 2I0EA 3F3ZA 3AEEB 3T9IA 1H1WA 3OFMA 2OK1A 1WYWB 3K3JA 2JZ3B 4WBBB 5IA1A 1FMOE 1IBXB 3FUPA 5C8NA 3C13A 1BXTA 5CEIA 2UZTA 3P79A 4F6WA 5GZ8A 1N60A 5K3YA 2ZZPB 2E9VA 3A2CA 5D7VA 5A54A 1BUHA 3MC0B 2CPKE 4L42A 3PVLA 4F09A 5A14A 5LMAA 3U7DA 3PT2B 4EOQA 4HCPB 4XOZA 2OXDA 5DLSA 3E8DA 1OIYA 3QQFA 3A62A 4ICUA 3VHKA 1KE7A 2W1IA 4WJNA 3NYNA 4FT7A 4PL5A 1CDKA 3CPCA 3WANA 2ZEQA 4J99A 4ZTRA 2MP2A 4GUEA 3JUHA 2GHGA 2XZSA 5HE1A 4JI9A 4KSPA 2WDTB 2B55A 4JS8A 5EYMA 3AI5A 2ITPA 2ZM4A 2N7JA 2J53A 2YDJA 4K7SA 3T8MA 2X8XX 2XKCA 3PY3A 1QMZA 2C1BA 4IFCA 2BVAA 2R2OA 3UNKA 3S2AA 2ZM3A 2WX1A 2LEKA 3FAAA 4RNAA 3WAOA 4O4DA 1C4AA 2CHZA 3UVPA 2SAKA 2OU7A 4I20A 3A9JA 4NM3A 2PJHA 5CWZA 4QYHA 5DFPA 3B8QA 3AE6B 5C9CA 1SE2A 5HIBA 2MX2A 2J2IB 4HVSA 2WXHA 3IT4B 4OTFA 5AUUA 5C23A 2OJIA 1HE8A 2NPTB 4NZLB 4YTNB 2RFNA 2M0AA 3LE6A 3R9DA 4RQKA 4FKGA 1PF8A 1WIAA 1WRDB 3LHJA 2C5LC 4YJPA 3QTRA 3AXWA 2BZKB 3E63A 4C34A 3EZRA 1J0GA 3RWPA 3VQUA 5BVOA 3TTIA 3RK9A 1EU3A 1Z2MA 1Q24A 1P5EA 2LGXA 2X6DA 4RMAA 2ONLA 3QD3A 2OG8A 3QD4A 4JAJA 3GEQA 3R28A 3K2LA 5CSHA 4A3PA 4U3ZA 4BBNC 2HYYA 2LVQA 1LQBA 1ZKHA 2QR7A 4ZIMA 1NA7A 2PMVA 1FMKA 1FXIA 3UJGA 3E5AA 4CFUA 2YCFA 3DBRI 3QHTA 1NVRA 3FY2A 2C5OA 1Y8GA 4EJNA 4K77A 4DBNA 2ETRA 3MFUA 3M63B 1P2AA 3R01A 3KXZA 4PF4A 1OITA 5DPTA 3QBNA 3TN8A 5IO9A 2BTRA 5D6JB 3ZGZA 3DPKA 3D94A 3Q96A 4BOSC 4TNDA 3WIKA 5EM7A 4BBEA 3ZONA 1GZ8A 4WIPA 2W1EA 3S1HA 4FIIA 1OMWA 4RSSA 2C3IB 3U4UA 3EQRA 3ZSHA 5CXHA 3VH4B 4EL9A 4E6QA 3AD5A 1WBNA 5M4FA 4KVGB 2PMLX 2YAAA 4G5PA 2BAQA 4C59A 2J0MB 2N1VA 3KH0A 1OUYA 4HPTE 4LMUA 5F1ZA 3NUSA 4V05A 1E7PB 2R3QA 2KKCA 3WAPA 2LASA 2J90A 3NSZA 3UIUA 4J3OD 4ANNA 3WYXA 4EYJA 4L2YA 1P1AA 4DGOA 3OWLA 5KX8A 4A7CA 2ZV7A 2OH4A 5B2KA 5JGBA 2J50A 4EKKA 5M57A 3W1FA 1ZYSA 4CCBA 1PXIA 1YHVA 3HDNA 3APDA 4V0GB 2HD5B 2NPQA 3IT6B 5DEWA 2YM6A 4WBOA 3TEIA 2VZKB 5F9EA 4PY1A 4ASEA 4AW5A 1HA5A 3NCGA 3ABVB 2HTME 1U59A 3MPTA 4EE2A 4LGGA 1NDDA 3PRZA 4FZFB 4OTPA 4JIAA 3QCSA 4WG5A 1Q5WB 5J18A 1UNHA 3G0EA 5HO7A 3BINA 4XWWA 5E1SA 2WS3B 5ANDA 2PE2A 3NVYA 3ZO2A 4K11A 5DR9A 2R3KA 4HZRA 2FVDA 2SRCA 3UNJA 3IAS1 4WRGA 3OWEB 4XX5A 3IGOA 1GJZA 3B2WA 3D15A 1YXVA 1JWAD 4D55A 4FKIA 3BY4B 2VTQA 4E5BA 2BFYA 4GCJA 1MFWA 3TZMA 1H01A 2GNHA 2ACXA 1B1ZA 1FM0D 1ZPSA 2J6MA 4GFMA 4ANOA 3BE2A 3BPRA 3ZXZA 2A2AA 5DRDA 3R7UA 4Y83A 2WLBA 5HKHA 4CT2A 2KLCA 2GRIA 3BYSA 2BPSA 4OZBA 4D58A 4FMQA 3FI4A 4BTFA 3HUIA 2VWUA 3II5A 4FT0A 1XJDA 1E0ZA 5M4UA 2ZW1A 3VS3A 2KACA 4PT5A 4PRJA 3VAPA 2C7MB 3PREA 5CASA 3AG9A 4JPSA 2BMCA 5LXHA 3Q6WA 4N6YA 1NXKA 1MI0A 3FZPA 3KYDD 4UEUA 3WF8A 4DFLA 3O71A 4G31A 2C5XA 5D1JA 4BCGA 4C2WA 1CSNA 4WAAA 4G50A 1OFFA 2QOOA 3R0TA 3RYTA 4XZ4A 2R3HA 1V5OA 3HIZA 2AQXA 1WY8A 3AMYA 5CHFA 3JYUA 3PE2A 3F66A 1FVTA 2MP2B 3LFSA 1APME 4GDKB 2X0QA 3DDPA 2Q5WD 4U7ZA 4FULA 5JRSA 2J0MA 1PKDA 1JSVA 3BYTB 1K50A 5GJFA 2J7QB 1JWMD 3MWUA 4BCMA 4HROA 4ZRJA 4D2SA 2WX0A 4L67A 4AFEA 5IEXA 3BGZA 2X2LA 4DXAB 4NNJB 4MAOA 3MVLA 4M3QA 5LVPA 2LFIA 4C02A 3DFCB 3TNQB 3P23A 2H9VA 3SXSA 3F7ZA 2NRYA 2B9FA 4M14A 2WGJA 4BI1A 5FTOA 1PMEA 4NJDA 1FMAD 2X1NA 3PHWB 1PGBA 3C0GA 4DEDA 4RVKA 4RIOA 3DY7A 3T3NA 2IGHA 1UGJA 4PP7A 4E4MA 3L8VA 1XO2B 5IMEA 1TKIA 1F3MC 4L7SA 5CQUA 1URWA 3Q8AA 1XD3B 2K8BA 5C2TB 4YNEA 4DN5A 4REZA 3L9NA 2RR9A 2XNBA 1JALA 4Z9LA 3TTJA 2PVOD 3WI6A 3QLGA 3KQ4A 4BICA 3H7SA 3MA6A 1FGIA 4XGAB 4FG7A 3FLZA 2TSSA 4DFZE 3VUHA 4GGQA 3PVBA 3PV1A 4IH8A 3DB6A 3ORPA 4FUXA 1LUFA 1KM7A 4K3BA 2J0IA 2OSCA 4GXBA 4G1WA 5JT2A 3TJCA 2VWIA 3DT1A 2ETMA 4YC8A 3QQJA 4ZK5A 3DNDA 1HZ6A 3LCDA 4H3QA 4M84A 3O8TA 1JKKA 4B0MA 4PS8A 2WQOA 4TYHB 2F4JA 3PXZA 5J7BA 4O6EA 2BT6A 4KDLB 2Z7QA 5AA8A 1FNVA 1TVOA 5L2IA 2XIZA 3HHMA 3PRFA 4JQEA 2SEBD 4P7EA 1I4PA 2OGVA 4YMJA 4FTKA 2EUFB 5CU2A 3EIDA 5CZIA 3PZDA 2J52A 2V3PA 2YM8A 3COIA 1PXOA 1YHSA 4HPMB 1DI8A 3CTHA 5FTQA 3PLVA 5BVEA 1V49A 3KU2A 4NTSA 3RAIA 2ZVOA 5TT7A 2OJFE 2OIQA 2KTFA 1P98A 4R3DA 4FJVB 4ZOHC 3OW4A 3V5LA 3GCUA 4I6NB 4L1BA 4I94A 4DFXE 5FR3A 2K3UA 2WHBA 3CIRB 5LWNA 1EWCA 1E9HA 2OW3A 5KHOA 3AE4B 1JRUA 3NIEA 4BL1A 3QGWA 2JRIB 2KWUB 3ETRA 1CM8A 4KX6B 1ZARA 3R8VA 2BS2B 3A7GA 5HQ0A 1OPLA 1T0QC 3CJFA 4H39A 2C69A 4YLJA 1TKGA 1W2DA 2ONQA 2JFLA 5HNGA 5KKRB 3IK3A 2VRRB 4X6RA 5L2TA 3N1XC 3LOKA 2R3RA 4CV8A 3PTFC 1T0SC 2YM7A 3KFAA 2PVKA 1OL5A 4A4XA 4GIVA 1V9JA 5ETFA 2M8SA 2UW7A 4CKIA 1IG1A 2K8HA 4EYMA 4U0IA 5HBEA 4C7ZA 3ZUTA 5IZFA 4DH3A 1C9FA 3E3PA 3ZTCA 3EN9A 3W8LA 4MXZA 3MJ1A 2VX1A 3VO3A 1I4GA 3COMA 5E8ZA 4AQCA 2OXYA 4CRSA 4ALUA 2P2IA 3Q4TA 1WYGA 4ZRPA 1V1OA 4LDTB 3GP0A 2AEHA 3ZRKA 2VGPA 1XHAA 4ZHOA 5CU3A 3EZVA 1H1SA 2NMQA 1IASA 4DGLC 1PY5A 3MJ5A 2XNGA 3D9VA 5CHVC 3QUPA 4QMZA 3FHIA 2PVYA 4BZAA 2YEPB 4I6BA 3DVNV 2XNPA 4IAYA 3CMMB 5AR2A 4TZRA 3BZDB 4LCDE 2P0CA 1PMNA 5CLPA 3ZRCA 3NUPA 2LRWA 3N1ZC 4HJGE 4DGGA 3G9NA 5EDQA 2B9HA 2Y4IC 3EHAA 4YC3A 1ZYDA 5D7GA 4WQMA 3TACA 4LOQA 2C6TA 3ZIMA 3S3IA 1UZXB 2Y3AA 5CU6A 5HI2A 4ITKA 5IMXA 3SXFA 2QNJA 5AADA 3PTGA 5G6VA 2WXVA 4GN1A 3IW7A 3I6WA 4FL3A 2WXGA 5HO6A 3ET7A 4A9AA 3PPZA 5F4NA 4FKRA 4A9TA 5L6OA 2YERA 3D5VA 1SE9A 1LFDA 4LNOA 4LDTD 2R3IA 5I9UA 4A9YA 4DLIA 3HVZA 2QU6A 4FTIA 3DCGA 4O27B 3BQCA 1V8CA 3FQEA 4CO7A 3FHRA 1WBWA 4IQ6A 3WZUA 2RGPA 4EORA 2PPHA 1R4MB 2FYSA 4WD5A 5AR5A 3TNWA 4GG5A 3E93A 4NSTA 2O6VA 3KVFB 4B7TA 3GU7A 3SR6A 3TZ9A 3UOLA 4AOFA 1MUOA 2WTVA 4A8XC 3A9JB 2YIXA 5L2WA 1G5SA 3V5TA 5M56A 5D3IB 3P7CA 5AM6A 1HTQA 4NM0A 2PVRA 2JXTA 5CYIA 5AUYA 2ETKA 3ZYAA 3F5UA 5J1VA 4MELA 1RM6C 3EHVA 5IU2A 4RJ6A 2IGGA 4YJOA 4XHKB 3AT3A 2GNJA 4U79A 4IAAA 4GMYA 5ETCA 3NUYA 4ITJA 3MDYA 4WSQA 2G01A 1BKXA 3Q60A 5M4IA 3VUYA 3BBTB 2IZSA 5IH5A 4GS6A 4XC2A 3NS1A 2E6XA 3I63C 2RD0A 3EA6A 3O51A 5D7AA 2HCKA 2W1FA 2KT7A 3ZRMA 3C0HA 5H3QA 3DWGC 4MGIE 4PS7A 2X39A 4BIBA 2Z59B 2GHMA 4M12A 4AXAA 5IH6A 3R00A 5M51A 3W8QA 1FVVA 4MK0A 4GRBA 2XNOA 1SMHA 3I4BA 5EW8A 5FG8A 3H7PA 2CGVA 4TKSA 2WHIA 3BZ3A 4PPCA 2CJMA 1SZMA 3DKOA 3IDPA 3RN9C 5BPYA 1J8CA 5LJJA 3RNBC 3G5DA 3RP9A 2IW6A 3ZFXA 5F94A 2NP8A 4J71A 3PWYA 4X0MA 4IUMB 1U54B 2Z7RA 4YPSA 3MJWA 3U7ZA 2IVVA 2G4SA 4V04A 5D11A 4BGQA 1RAXA 2NBVB 4RGNA 3RT3B 5B0XA 4BZOA 4M8TA 1JMLA 3HKOA 4M13A 2GS2A 2JXXA 1WI0A 3AE7B 2C0TA 1JKLA 4PYUA 4I0SA 3LCOA 1AW7A 2BILB 2WMSA 4YPDA 1NVQA 4X3JA 2JYTA 3R30A 4TYIA 3L8XA 3NEWA 4FG8A 3EQBA 1WE6A 2W99B 3EQGA 5FEEA 3BYYB 3ZXTA 5JZNA 3V61A 1QLBB 2L8JA 3ETAA 4LRKA 2LD9A 4NM5A 3R7VA 2H96A 4J97A 1UWHA 4HNFA 1C79A 3PP1A 4W4XA 3L10B 2UUEA 4UXLA 4XWTA 3V8WA 4CTBA 2WDRB 5DEYA 4FKTA 1MQ4A 3AECB 3KWLA 2MBEA 5L3AA 3VS5A 5EYDA 3UMXA 1ZOEA 3UP2A 2WXPA 3DHHC 1J7AA 3S00A 3KMUA 4DBGA 4C35A 5AMNA 1E8YA 4KV2A 5HHDG 2LVOA 4MVFA 2EMTA 4BIDA 2NVUI 3OBGA 1FCCC 3UC3A 1UU8A 4RA5A 4GVJA 2JIIA 2KMAA 1A06A 3W2QA 3V5QA 5KBRA 4IEBA 2I1JA 2IO1B 2YIRA 3GI3A 3RZFA 1PGXA 1GC7A 3MTNB 2MRPA 2G45B 3U6JA 4EBWA 1K9AA 3AEBB 3A7HA 2Z8LA 4FJYA 1JVPP 3PFQA 3H4JA 4HCUA 4BHZA 3VUIA 2BUJA 4P16A 1BI7A 3A4PA 3PYYA 4GT5A 3ZM4A 5CT7A 2XNMA 4RVMA 4FKVA 2OICA 3NVZA 4LOOA 4F7LA 4KBKA 1SEBD 3QRJA 1UWJA 3T9LA 4G9CA 4EH9A 3VJOA 4G2FA 1OPKA 2L0FA 4FIEA 5L2QA 4CXAA 1IGDA 3QL8A 4MF0A 5L8LA 3A9KB 2FGIA 3U2SC 3HP5A 5I3RA 1FO4A 1H26A 2XIKA 4FV8A 3H7PB 2I0YA 2FCQA 2WMAA 3QU0A 4IKGA 1CK1A 2ICIA 4I4EA 4ZSEA 4KIKB 3M95A 4B8LA 2PZYA 4XG2A 3NS8A 2MBHA 4D5HA 1C1YB 3OJ4B 5AAGA 2PIAA 5AJQA 3FSKA 5EM5A 3OLMD 3W2CA 3D4QA 5KMMA 1KOBA 2GNLA 3FBVA 1STEA 4W9HA 2GS6A 5G5GA 3R83A 2LHEA 2ZVNA 4EH5A 4WRSA 2IDYA 4CFNA 2BB6A 4XLVA 1VR9A 2EKIA 5A4TA 2FNJB 3FMNA 3R2TA 4FOBA 5I4NA 5KZ0A 5EHLA 4B99A 1F1HA 4YJRA 3QTWA 1H07A 4QYEA 2JLDA 5CX3A 4GFOA 1UNSA 4M7IA 4DXFA 2AL6A 2H6DA 4GDLA 3UP7A 2PWLA 3IVFA 4AE9A 4C37A 1UA2A 5FLFA 1YDTE 3HLLA 3R73A 3R1YA 3FYJX 3ZMMA 2XK4A 5GJDA 4IM3A 3W2DA 4FNYA 5IA0A 4EKLA 3RK7A 3EMGA 4F64A 4RT7A 4KRDA 3I5NA 4ANQA 4OBOA 4DEHA 1D5MC 4ZTQA 4WH4A 1R4NI 2Y9QA 1W82A 3L17A 4L7FA 4BVUC 1P0RA 3I1AA 1T0YA 4CVAA 4MXXA 4WQOB 3EGRA 4FI1A 4QMOA 1JQ4A 4X3FB 1RFKA 4QAYA 4CFMA 1TBEA 4OTQA 5IF1A 1RJBA 2JKQA 4TRLA 4C61A 3F9NA 1FQ1B 4DH5A 3UQBA 4C4GA 4YSXB 4NM7A 4AT3A 4TPTA 2XKEA 3O8PA 3TI1A 4FVPA 3V6CB 4K18A 4X3FA 1M17A 5A4EA 2WNMA 5HG2A 3MPAA 4ZZMA 2OFVA 3KUDB 3O23A 2VTRA 3G6HA 4GSBA 2L83A 3HEGA 4US9A 4I23A 1WFCA 3MFRA 4O1OA 2DENB 4HVDA 2XM9A 4L6QA 1M94A 4RJ3A 1I42A 1IYFA 2YAKA 3APFA 3Q9XA 4G6LA 3NZ3A 5HD4A 2N9EB 1GUAB 4X2JA 3EJ1A 5JH6A 2V22A 2UZVA 3GB2A 5DVRA 3RZBA 2EELA 3P7BA 2HJ8A 4Y85A 2F2CB 3MVMA 4ICVA 1REJA 3LJ3A 4C3FA 4KBCA 4FUYA 3DKCA 3AE1B 1WGRA 5CAPA 2XK5A 5DMZA 4AA4A 1M2PA