3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, signaling protein
molecule keywords MGC80376 protein
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
4NM5A 2VTMA 2ZB0A 3C0GA 2BYEA 3RINA 1YI6A 4NAWA 3G5DA 2ZNVC 1CKPA 1YI3A 4N4SA 4N6ZA 3VNTA 3OUKA 2WPAA 3EH9A 2ZPYA 3R2BA 4ZSLA 1JSTA 2WMXA 3F7WA 3VJOA 3COIA 4BDFA 4FVPA 2WTCA 4IMYA 1YXSA 4BI0A 1UKHA 4ALWA 3BLRA 3H9FA 2GNJA 1PMUA 3C7QA 2XKEA 5DEWA 4MHAA 2GBKA 1GOLA 2JZ3B 3LCTA 2LXCA 4KVGB 4P7IA 3FLSA 3QQKA 5G1XA 4K33A 2HTHA 3PWDA 5LOHA 5HCXA 4M97A 1DAWA 3NDMA 2GQGA 2P33A 2VWBA 1WJ6A 4D4SA 5G55A 4QQ5A 4BL1A 5CVHA 2HW7A 4RGJA 4BTMA 3TV4A 3ZNZB 5DI1A 5E90A 4B0GA 2JIVA 4HGLA 2X8EA 3GC9A 3F3UA 5DNRA 4A9UA 4FT5A 2WQBA 4YTHA 2M8SA 4F8CB 3TZMA 2KHWB 4TKSA 2R2QA 1CKIA 2ERKA 3A8XA 4FYOA 4GU9A 3E3PA 4R7HA 4U40A 3ZO2A 5HTCA 1XH4A 5M56A 3B08A 3QK0A 2Y6OA 2X1NA 3BBTB 1Q24A 3DFAA 4W4WA 5I3RA 3CD8A 4E6AA 5AP3A 3LQ8A 2YA9A 3ORMA 3WIGA 1J1CA 2FO0A 2C3KA 4OTHA 1AQ1A 3Q5ZA 5LARA 3TNPC 4H39A 4BCKA 4I6PA 4RM9A 1H28A 4EUUA 5HG9A 2KD0A 5HLNA 1YHVA 4NTSA 5IDPA 5K5XA 5EDSA 1UZXB 4W9HA 4MGZE 1L2NA 1ZKHA 4WKQA 2DENB 3ZMMA 3KGAA 2PVJA 3UINB 4E71A 4ZTLA 2VTTA 4A9RA 5M53A 1XT9B 2FSMX 4GT5A 4E4XA 4O1OA 5LCJA 4QPMA 3R7EA 1WX8A 2YDIA 3LXLA 4ZRKA 2HZ4A 4ICVA 3CCNA 1JKLA 5E8ZA 3V8SA 2LWPA 4L7SA 2JLDA 3GFWA 3FE3A 4IUMB 3WANA 3NZSA 3NUPA 1RJBA 3UJGA 4JDIA 2KFJA 2H9VA 1VZOA 2NO3A 3FLWA 3PTGA 5H3QA 2CCHA 3OT8A 5HO6A 3ANRA 1WVXA 4TWPA 5K0XA 4GDKB 5AZGA 2EWAA 2XK9A 4FR4A 3ZRKA 5L3AA 4FTAA 1YQBA 4YJTA 2C3IB 3OP5A 5DVRA 2L0FA 4F0FA 2VWWA 3PVWA 4PTCA 3AXWA 5TT7A 2XBJA 4Z9LA 4F7SA 3CC6A 4ZS0A 4YMJA 1O9UA 2C6EA 3FL5A 2BGFA 3OOMA 4WRGA 4PPCA 3DBFA 5TO8A 4FJYA 3ITZA 3QCXA 3V62A 1JKSA 1WVWA 4CFNA 4BDEA 2WQMA 2YERA 5EW8A 3NUSA 4X3FA 2BWES 4TY1A 3Q9ZA 4RBLA 4R5YA 1WM2A 3H6NA 2ITTA 3UTOA 3ZC6A 3C1XA 5DWRA 2VO0A 3Q9YA 2R3PA 3V5WA 3E7VA 3RUIB 1JKTA 3KEXA 4ERKA 4EBVA 4HGEA 3U9CA 2ONLC 3COHA 4YPDA 2OH0E 3UO4A 4FV4A 3DBHI 3EFJA 2JAVA 3LCOA 3ZUUA 4M3QA 4IX6A 5FEEA 2UWQA 2R3IA 3PVLA 2O2VA 5IH4A 1VEBA 3DBEA 2ACXA 5I9UA 3KVFB 1W8CA 4CFVA 1SVHA 3LIJA 4EWHA 4HOKA 4UMUA 5BVKA 3W1SA 2X2KA 4FT0A 2XRWA 3CMMB 3QXOA 1Q3WA 4TYGA 4I6FA 2C6LA 4L01A 4MH0E 2LGYA 4D1XA 3REPA 4G1WA 3Q4ZA 3E5AA 3AI5A 2ITOA 4JRNA 5EDPA 4KNBA 3JSVA 1W98A 3PA5A 4QMOA 4FL1A 3R9OA 5EHLA 4EZ7A 2BZJA 4L43A 2BZHB 3G33A 2L76A 4YU2A 3NNUA 4MK0A 3O8UA 4HGTA 5JT2A 4KWPA 1WJNA 4HDQA 3CKWA 2M17A 4I21A 3N30A 3QYWA 3BYMA 3TKIA 4EH7A 4MDKE 3Q5IA 3R22A 1H24A 3TNHA 4EKKA 4A9TA 1I09A 1OUYA 5EK7A 1LXDA 3EFLA 2BILB 4JG7A 5DPRA 2BALA 4A4LA 4USEA 2RGFA 2JDRA 4XP2A 2F49A 3F88A 3IG3A 3IFWB 4J6IA 3ORNA 4RQKA 4ZXTA 4GOCA 3GT8A 4EKLA 5AV2A 5HTBA 3OWJA 2P2IA 2C3JA 2NP8A 4X7QA 5C8NA 1RAXA 4EZLA 2OXDA 4FKVA 3QTRA 2QKRA 4I22A 1Q8UA 4D0XA 2ITVA 4A4XA 5AUUA 2KKCA 3MVMA 4IWPA 4ZSEA 2VRRB 2CKEA 2WIHA 4CFUA 2N7DA 4BRXA 3PE1A 3M11A 4B8LA 1XO2B 2B53A 2J50A 3BHVA 3I60A 5H2UA 1IEPA 1XQZA 5L2QA 1V9JA 3AD4A 1EF5A 1WCCA 4LV8A 4FADA 4EORA 1QCFA 2QQ7A 4L42A 3I0OA 4AZFA 5I9WA 2L7RA 1OPJA 4A3PA 4P5ZA 1OIRA 2CHZA 4AOIA 2CGUA 3FJQE 2KVRA 4M69B 2P4IA 5E8UA 5GMVA 3F6XA 4PL4A 2PZRA 3LFDA 2RFDA 2VTAA 2ESMA 4LYNA 4IC7A 4XYFA 5T3QA 4W9IA 3OWPA 4ZY5A 5E8YA 1OVEA 4NM7A 4YZMA 3BKBA 4PS7A 3GOKA 3KXGA 3FZRA 2XNEA 3VUIA 3QKMA 3HA6A 4C57A 2NCNA 4NWMA 5LVLA 3QCSA 2KX3A 3NPCA 3BYSA 2GNGA 2C9WB 3QX4A 2BKZA 1V0BA 1HE8A 2OZOA 4FVQA 2G4SA 3OS3A 5HX8A 5KX8A 4KV2A 3TTJA 1WJUA 3I6WA 4BYJA 4G16A 4AU8A 4CRSA 4AN9A 2AC5A 2XBAA 5CEPA 2XIXA 2AL3A 3OD6X 4FL2A 1U46A 2UW7A 1L3RE 4DLJA 4CFWA 4M0YA 2F2UA 2WFYA 2F2CB 4RC2A 4DEGA 3IDCA 4G34A 2EXEA 4JAIA 4QMVA 4QMWA 3RPVA 4ARKA 5AX9A 4FTJA 4RJ3A 2KOXA 4FZDB 2Z7SA 4BIEA 3U87A 3EHAA 4V05A 4F9AA 1WR1A 5AUZA 2C5LC 4FV1A 3TXOA 4EOSA 3QZHA 2OJRA 4KIKB 4FK6A 4D2RA 2JKQA 1JSVA 2J90A 4G6OA 5JRSA 2BRHA 3FI2A 4APCA 3RTPA 2A5UA 3B1LX 3GZNI 5I0BA 4XUFA 2WEVA 3P78A 1Z5SB 3QHTA 2BAQA 5FLFA 4BFRA 2QCSA 1WBOA 3PG1A 5CSXA 4CD0A 3CPBA 3ORKA 3G6GA 3TG1A 3SC1A 4IBMA 1VYZA 4R5SA 2LASA 2P3GX 4E1ZA 2WMUA 2WQEA 2GTMA 2IVSA 1YXTA 2J4ZA 3K54A 5I9YA 1XKKA 1E1VA 3MIYA 3UVQA 2NPTB 2FH9A 3GU6A 1M7NA 4L44A 1R3CA 4GEOA 3W1FA 3ZHPC 5IF1A 3FLYA 3IOKA 1GIIA 4RJ7A 4UMTA 5HE1A 4DBNA 3R0TA 3PT2B 3UODA 3HV6A 4DFXE 5IDNA 4YJRA 3WALA 4FKLA 5K5NA 5C03A 3NUXA 3BBWA 3D7TB 3VTUA 2MW5A 4F7ZA 2LVQA 1WX9A 4IM3A 1PYEA 4AZVA 2N9EB 3VAWA 3Q3BA 4WD5A 4YJSA 5L8JA 1QZEA 3E8EA 1YD8U 2KJRA 4FHJA 3R7YA 4NAWB 4NKSA 3MH0A 4I23A 2PWLA 4IZAA 4E26A 2ZCCA 5CHFA 5CX3A 2CLXA 4M13A 5AUXA 3ZZEA 1LR4A 2HY0A 3L8XA 5CAQA 2ZVAA 3H30A 3KA0A 3KN5A 3QGYA 4Q9SA 4AA4A 3UQCA 3PZEA 4FMQA 4OAUC 2QO2A 1ZRZA 2VWXA 1H00A 2XZSA 3GC7A 2D07B 1PXPA 5CVFA 3R3MA 4AGCA 1P3QU 4WSQA 3P86A 2HWPA 5HIDA 1TQMA 1B38A 4C4JA 2PE1A 3HZTA 3U4UA 3PREA 3KRRA 3G2FA 3QWJA 4GK2A 4OBOA 4FKQA 4OTWA 3GUBA 4A9YA 3RAKA 3CBLA 2ZZPB 4RWLA 4G3GA 3BE2A 5F94A 4ZRIA 1GZKA 4D4YA 4Z3VA 4L9IA 4RC3A 1SGHA 1OIQA 4O0SA 5DE2A 3VHKA 3W33A 4BDKA 4DGMA 5CI7A 1O6LA 1E8ZA 3TL5A 4LM5A 4BZOA 1IPGA 2UYZB 4ZIMA 4KBAA 3JXWA 4C8BA 4K1BA 2H34A 3ULZA 3S0OA 4MEMA 3APCA 1F3MC 3FMDA 3QZIA 5ETCA 5LVPA 4WHZA 4XP3A 4YHJA 2O0UA 3O8PA 2OICA 2JFLA 3F5PA 4M12A 1EUVB 1ZGUB 2N7EA 3FZ1A 4S34A 3APFA 5LXMA 4EI4A 4P7EA 1YHWA 4K11A 4GMYA 1Q61A 2WHBA 3IG7A 2YCRA 3DXNA 3RAHA 4CTBA 3H7SA 3DBQA 4XOYA 2WEIA 4L46A 4WG5A 4A07A 4A7CA 1R4NI 5DPWA 1IYFA 5IKWA 3DDPA 4FKJA 3I7CA 4BGHA 2OJGA 4ZLOA 2XNBA 4E20A 4KS8A 1HCLA 3OCBA 4RX9A 1Q41A 4KDIC 1S3SG 4TXCA 4CT2A 3AC8A 3PE2A 4EC9A 1M14A 3KCKA 4MNFA 2ZDTA 3UBDA 2CKHB 4ZEGA 1Q5KA 4U42A 4TN6A 3TZ9A 1OMWA 4AP7A 1OZ1A 4IANA 3FY2A 4MD8E 4HVSA 5AEPA 4QQCA 2RSVA 5AWMA 3OXZA 4YHTA 3TL8A 1OB3A 3UPZA 2Y6MA 5CVGA 3L10B 4WJPA 3BV2A 3DZQA 3BU6A 4OBQA 4LDTB 5C27A 5CT7A 1T46A 4OBPA 4EYMA 4MH7A 2G9XA 4FTMA 1P14A 3G90X 3TIXA 2UW3A 4ONAA 5L6WL 4K6ZA 4DGLC 3DJ7A 1GC6A 3WF5A 2ZV8A 1KE6A 5CLPA 3DPDA 4BI2A 3RT3B 4X3FB 3P2BA 4HGSA 5DG5A 4YC8A 4ITIA 4G5JA 5J8IA 4GGQA 5LVNA 2XUUA 4QMLA 5KE0A 4C3PA 1GY3A 4C02A 2Z59B 3OCTA 2JIUA 2UV2A 3ZUVA 4FUYA 5CXHA 3BHTA 3KMMA 4LL5A 4BDBA 3OJ3A 1QPJA 3GEQA 1PXMA 4FSZA 5DT4A 4BF2A 2H96A 2XKCA 5IU2A 4BHZA 4FLHA 5H8BA 4BCQA 2NVUI 2XK6A 4NNJB 4AS0A 2XIKA 4AN3A 2VWUA 1F0QA 3B2WA 4G2FA 2ZV9A 3PYYA 3Q3FA 5TR5A 1GNUA 2GFCA 2QKWB 2ZV2A 3FAAA 3RZBA 4D5HA 1UU8A 3WARA 4CYIA 1P1AA 2OJIA 4AW5A 3OG7A 4YC6A 1XH8A 3OXTA 2OG8A 2WQNA 3ZZWA 3JSVB 2MLBA 5T68A 1PXNA 3FMEA 4I3ZA 1V81A 3S2AA 4ZTHA 3EECA 2GFSA 3W2RA 2REIA 4JQ7A 3SA0A 4IACA 4GCJA 4X6RA 2XNMA 4CV9A 2EMSA 3PJ8A 4J97A 4QMNA 1PXKA 2PPHA 2PVMA 2WTJA 2FIDA 4HVIA 4QMUA 3DLZA 2XK3A 3R1QA 1WGHA 4UWCA 3EWHA 3RPYA 3UP2A 3EQRA 1LEZA 3LJ0A 4IDTA 3IQ7A 2EXCX 2JFMA 2X6EA 4OAVB 5D6JB 3FMMA 3HV7A 5D9HA 4CCUA 4JQ8A 2V4LA 2Y0AA 3UIOB 1OITA 4FV6A 5KCVA 5HVJA 2PMOX 4C36A 1R0EA 3C4FA 3JS2A 4G9RA 4AA0A 3T9LA 2C7HA 2EMTA 3Q04A 2L00B 4KSLC 5ANJA 4PP7A 3AC5A 3QQJA 3ZDIA 1PKDA 3FLZA 4UBAA 4U81A 3ERKA 3MPAA 2LAVA 2VTOA 5FGKA 5JQ8A 3UO5A 4LCDE 3D5WA 3NRMA 4M84A 4XJ0A 4EK5A 2QOHA 3NCGA 4QMYA 4GN1A 1FPUA 2B55A 2QU5A 3EKKA 4YP8A 3IW8A 5TF9A 5HKHA 3P1AA 3ZO3A 3QCYA 4HLEA 1UV5A 3GQLA 4EZ3A 4AF3A 5CF5A 1G6JA 5LQFA 4AT3A 1WXSA 4QYFA 3IONA 3KULB 1WZYA 2ZMDA 2UZOA 3VO3A 2XVDA 3CKXA 3N32A 3R7GA 4XRLA 1JNKA 4XS2A 4EH4A 3A4PA 4YJQA 3VQHA 5BYYA 4IC7B 1ZWSA 3DKCA 5HCZA 2Y8OA 3IECA 3VRZA 1HCKA 1WBSA 2RIOA 4ENXA 3DVNV 3OLMD 3BHYA 4FV2A 3V6EB 4EOMA 4G50A 2X4ZA 3QGWA 1WRDB 2QC6A 3A7FA 4Y95A 2B1PA 2H6DA 4TWCA 3A9KB 4V0GB 5CU0A 4W4XA 3MB7A 1YXUA 1YDRE 2Y5BB 2J0MA 3QIJA 1ZOHA 3G9NA 3R1SA 1R4MI 4BZNA 4F0GA 4XNEA 5IUHA 5L8KA 3OEZA 3U6HA 1MUOA 4X3FC 3MA6A 5CAUA 2BYFA 5HLPA 1PMVA 4FSWA 4JIAA 2ZOQA 5D10A 3BGQA 5L6PA 4FTTA 4WOVA 3OBGA 4JBVA 1OKYA 4JRVA 3VUDA 5IEXA 4JDHA 3L08A 2V0DA 5HHWA 2KN5A 4RZWA 4JQWC 3KXHA 2ITXA 3CE3A 3PXZA 4PPBA 5HZNA 2B9HA 3C9WA 1F5QA 2XIZA 3PRFA 3PIYA 3DNDA 4J98A 5LVOA 2UW5A 3DAJA 3PA3A 2QOQA 3FMLA 4DH7A 3UNJA 4C33A 4Z7GA 1AGWA 3D94A 4QYHA 3VBVA 3C4ZA 3OTUA 3ENMA 4CKJA 4KSKC 2BDJA 3VQUA 3BY4B 4KIPA 4ACGA 1YHSA 2MBBB 5EW3A 4B9DA 3ZRFA 2N1VA 2VD5A 1WMHA 3NYXA 3WZJA 2BIKB 3LHJA 4FTKA 3MY0A 3UVRA 4DC2A 5EKNA 2NBUA 2OF4A 3D2KA 5A14A 4BGGA 1TQIA 3EL8A 3PWYA 4ZOGA 2GNLA 2J0LA 2WTWA 1WE7A 5CZIA 4FG8A 4MGIE 2W06A 5DBXA 5CU2A 3V5LA 4RA4A 4DEEA 2O6VB 4G3EA 2OO8X 1BX6A 4BDDA 5BVFA 2OJFE 3QKKA 4QP2A 5HBEA 4AE9A 5CENA 5LCKA 4H1MA 2C5XA 4WJOA 3QZGA 3FY0A 3GC0A 5L2SA 4TYHA 3WAOA 2W9ZB 3BPRA 4EYJA 3R7QA 5HO7A 4I4FA 3O17A 5M4CA 3O51A 4I5HA 4M8NA 4L52A 4L3JA 3BWJA 4D2SA 1JSUA 1APME 4TNBA 4ZJJA 4YSJA 2XYNA 4FIIA 3V5TA 5EKOA 4JVGA 1P2AA 5JZEB 1SVGA 2YHVA 2CDZA 4BCFA 4R1YA 4ANQA 5AIKA 1M2PA 2E9PA 2J2IB 4YTIA 5FDPA 2FIFA 3UMXA 2GBMA 2KWCA 3OZ6A 2MP2B 3KYDD 4RIWA 5D12A 3KK9A 2R0UA 4R6VA 3BIZA 4BDJA 5LWMA 1OL7A 3KF7A 4YJOA 4XG7A 4BFMA 2B9JA 3QCAA 3NW5A 2X2MA 3NYOA 4QQJA 4EOOA 5HTIA 2GBRA 3LLTA 3QALE 3PRIA 4FGBA 2BTRA 3BI6A 2J0JA 4BBEA 1OL6A 5KHWA 1WR6E 2QHMA 2KDBA 3RCZA 1A5RA 4ZLYA 3PY0A 2JWZA 3VHEA 3QUDA 4YLLA 4GVAA 4ASZA 4F0IA 3EHVA 1GZNA 4NQLB 4NY0A 2IO0B 3JVRA 5CY3A 1K9AA 3ZNHB 3IW5A 5JHAA 1I35A 4BCJA 3WYYA 4YR8A 4TQ0A 1REJA 4O96A 2ZYBA 4LGHA 4FEQA 4K18A 2XM8A 3EQFA 3FMHA 4MQ1A 2JY6A 4G3FA 3VH4B 2R2OA 4DH5A 4EL9A 1ZAOA 1OQYA 3P7BA 3C0HA 3BZ3A 3BRBA 3C50A 2FCSA 4AX8A 4IVCA 3EQGA 1OL1A 4QMPA 5H8EA 2PVYA 2PVHA 3DNEA 4JDKA 5L6OA 5LMKC 3N9XA 3OWLA 5IMEA 5DGZA 2IN6A 3QTIA 4IB1A 1H07A 3MH3A 3DCGA 3MH2A 5L95C 3EKNA 4IC8A 3LFAA 2JEDA 4CLIA 5HNIX 5DMZA 1YOLA 5EFQA 1YIWA 4IAAA 5CHVC 2DYMA 2W96B 3LJ1A 3FYJX 4QP7A 4U45A 3HP5A 5EOLA 1BLXA 4X2NA 2YM5A 3R83A 4IWOA 1H4LA 3NAYA 3SHQA 1YDTE 5KZIA 4ACMA 4IZYA 4MEDA 4AGUA 3R9HA 2YITA 5D2MB 4IB5A 2LUEA 2OW3A 3JY9A 2D3GA 1OKVA 5IA5A 5CAOA 3EQBA 1AARA 2KXJA 2FSOX 4ASWC 4RIYA 1BMKA 5I9XA 3HRBA 3PY3A 4XV9A 2EB2A 4AE6A 4XX9A 3PZDA 3ZLWA 3ZRMA 3WI6A 4DAWA 4ZYNA 2PE6B 3Q4CA 2ZJWA 2ETKA 3IDPA 4UWYA 4I4EA 2WZJA 3RALA 3ROYA 2YIRA 3NNXA 4QO9A 3DQVA 2WXVA 4J95A 4BDCA 4FT9A 5I9VA 3KUZA 2XJ0A 4FV7A 4RIXB 4ZTQA 2YABA 1ZOEA 5EDQA 4AOJA 2CR5A 4I0SA 4YZDA 5HE3A 4FODA 2VX1A 3CTJA 4JG6A 5DT0A 5I4NA 1M52A 3PJCA 2GOWA 3PXKA 4PV0A 4RX8A 4MD9E 4FA2A 3CJFA 2ETRA 4DG0E 2AWTA 2D10A 3LAUA 4IHPA 5EYKA 3NGAA 5AV4A 4R3PA 4G11A 3LFFA 2W1GA 2J6MA 4GG7A 4MGYE 1I44A 3Q60A 2GNFA 2YLFA 5TOZA 5AR8A 3TJCA 2J5EA 3W8QA 5KO1A 4LG4A 4UB7A 3HKOA 5IEVA 5KMKA 2D2QA 1YVJA 3UZPA 4RMAA 4BWPA 3K9OB 4NCTA 4E6CA 4BICA 4U79A 2G2FA 4NZWB 4WAAA 5M4UA 4AJWA 3SW7A 1MQBA 4C4FA 4YJVA 3RNYA 4YZ9A 5DA3A 5ANOA 5ICPA 5IH6A 2JRIB 3BX5A 3R28A 5E1EA 3SXRA 4I5MA 3BGZA 3QQ8B 3U8WA 4F6SA 3QLGA 3L16A 4BOZB 1OL2A 4F6UA 5AP4A 3GGFA 5EW9A 2F7ZE 3X23A 4MXZA 2RKUA 1RQQA 2XRUA 3LXNA 1ZYCA 4FTRA 5DHJA 1U4AA 4MWHA 2RF9A 2R3OA 2KDIA 3KC3A 5AP0A 3V8WA 1SZMA 3A7JA 2PVNA 1PXLA 3VBYA 2X8IA 1Y6BA 3PXYA 2YCQA 5JGBA 3QBNA 4KIOA 2CJMA 2WMSA 4HK2A 4MGKE 5FBNC 5LXHA 2BZIB 3VUMA 3F3TA 3VUKA 3ZSHA 5L2TA 4LDTD 2IO6A 2QO7A 2ZV7A 3SRVB 2D11A 1FXTB 1JLUE 1XQQA 4O0UA 3KUDB 4FKWA 3VQIA 3TACA 3O8TA 4QYYA 3L8SA 3QZFA 5IA3A 3DK6A 3F69A 3P7AA 4TZRA 5AX3A 4BYIA 2ETMA 1OIYA 2BMCA 4HCUA 3A9JA 3VHTC 4ANMA 2CU1A 1A06A 3IOPA 3QQGA 3ZFXA 1UNLA 1WGYA 1E8YA 2UZLA 3POZA 4Y83A 4NW6A 3B2TA 4GIIA 4ZK5A 3JVSA 4WWNA 4Q2AA 5E8WA 4E5WA 2CS4A 2I0EA 3FQSA 2W9NA 5JGAA 2KWVB 2KMCA 3QC9A 3LDZE 3ZTDA 1QL6A 3DZOA 3QA0A 4FICA 2FUHB 3ZNID 4OTQA 4UWBA 4MJSB 1H08A 3L8VA 5HKMA 4IX3A 2HJ8A 4ZTMA 1SIFA 3KCFA 3DK7A 5A46A 2HZNA 1Q8ZA 5ITAA 3DV3A 5D94A 2JD5A 4I92A 2V1YA 4EOIA 1FVTA 4DFZE 2OIBA 3UQFA 2AEHA 4CKIA 5C01A 2BKFA 2K39A 4YC3A 2J0MB 3WE8A 1FGIA 4FJZA 4EZKA 3W1YA 4WRSA 5DT3A 1WBNA 2W5HA 3MFRA 5ETFA 3BE9A 5HIEA 3SOCA 4WG3A 2RG5A 4KSQA 4EH6A 1PMEA 2FB8A 2Z7RA 5JRQA 4R1VA 2R64A 3HL7A 1R0PA 4E6QA 2C47A 2YIQA 3SOAA 2DZIA 4BI1A 5GZ9A 3EYHA 4B7TA 5B7VA 3E64A 5D7VA 4D0WA 4BKSD 3UGBB 3LE6A 2I0HA 4O6EA 3R9DA 3V60A 2OFUA 2GHMA 4DG3E 4GT3A 5CSPA 3AMAA 3RPOA 3VAPA 2UW8A 3C4XA 4ANLA 4LOQA 3OT3A 3EC8A 2GNHA 1YW2A 2XIRA 3QRKA 3KYCD 3UIUA 2WMQA 2XJ1A 1PYXA 1WBWA 5DIAA 2PVFA 3AG9A 4KKGA 4RVKA 1Y8YA 2HAKA 2C69A 3I79A 3WOWA 5DH3A 2AUHA 2E9UA 3A60A 2HW6A 3QRTA 4FKSA 4IAIA 4QMXA 4AAAA 4HXDA 4CZTA 4MAOA 2BDFA 3RD2A 4XV2A 2A27A 1WMKA 1CM8A 2CHLA 4TKNA 2JITA 4EQUA 3ORXA 3QTQA 2PK9A 1JBPE 4TYHB 1RE8A 4C7TA 5E8VA 4BBNF 2DAJA 4PL5A 2Y9QA 4IVBA 3VWAA 4ANNA 3O0GA 3HVCA 3QQHA 4WBOA 3ZDTA 5HGIA 3QC4A 1W7HA 4IDVA 2L8JA 1QPCA 3RWPA 4MSQB 1ATPE 2YDKA 4D4VA 4DYMA 3T9IA 4XG3A 3SDLC 1H1QA 4TRLA 3TNWA 4IM0A 4ASXA 5L8LA 1J8CA 3PRMB 1WIAA 1BI7A 4M66A 5L4QA 3ZEPA 5ACBC 1WE6A 3KU2A 3NUNA 5KZ0A 5AR7A 3FXWA 3I5ZA 2YCSA 2FCNA 3O7LB 3GQIA 2SRCA 3PVBA 4FVRA 3A4OX 4R3CA 4UY9A 5ANGA 5AMNA 4H3QA 3FKOA 2QHOA 4IG7B 3KW5B 3LOKA 4GFMA 4E93A 2IVVA 2XCKA 2IYDB 2XNOA 4UMRA 4FL3A 1DS5A 2QO9A 1J3HA 3A7GA 3UNZA 4ACCA 4E8AA 4TYIA 1YWNA 4YNEA 5M44A 3GXLA 3E62A 3R63A 5DPTA 4ALUA 2X8DA 4ZZOA 1JVPP 2B52A 1G3NA 4IX4A 4XBRA 5M55A 4S31A 1P4FA 4Y5HA 4F65A 3UF8A 1DI8A 5KHQA 1UBQA 3TI1A 2O6VD 2HCKA 4DGGA 4Y73A 2ZEQA 4CQEA 4JS8A 4NQKE 2A4LA 1K8RB 3ZBXA 2IVUA 3TZ7A 2BFXA 2X7OA 3R8PA 3WF7A 2XK8A 2P0CA 2B9IA 5FTOA 3UO6A 4TUUA 2YJSA 1PMNA 4FNWA 5CS6A 5CF6A 3GCUA 4J71A 3N3KB 4G17A 5EM7A 3WF6A 3RJCA 4CHKA 4II2B 2GMXA 5LJJA 2VUWA 3ANQA 4EQCA 1MRUA 3NNWA 3P7CA 3WZDA 2AYOB 5AP2A 1FINA 2G2HA 1PQSA 2V7AA 5HD7A 5DOSA 2JGZA 2HZIA 4P2KA 2YDJA 2XKDA 4FF8A 1OL5A 4C3RA 4DINA 2C1BA 3HDNA 4FJVB 4RIYB 3QUPA 2WDTB 4DN5A 1GG3A 2LRWA 4A20A 4FSRA 3FZOA 4MBJA 1Q99A 3KQ7A 2UVXA 1O6KA 3CY2A 3UIXA 4BTJA 2LZ6A 2BRMA 2YVCA 4C59A 3VXWA 2VTSA 3UOJA 5BUIA 2HK5A 2GS7A 4MXXA 3R8VA 4OVUA 4D1ZA 3WIKA 4GYIA 3WF9A 3U6IA 2MX2A 3ZM4A 4DXAB 2K8HA 2XA4A 5J7HA 2LJ5A 3ORIA 3CIKA 3FV8A 4JBOA 1WBPA 4BGQA 2W99B 4HVGA 3NW7A 3UGCA 4JOAA 4NT4A 2W1ZA 3FSKA 5EH0A 4D4RA 1UU9A 5A54A 2W4JA 3ETAA 2K25A 3R1YA 2I1JA 2XP2A 1XH5A 3ZU7A 4D2TA 3L9NA 3C5UA 4OW8A 4Q5HA 2PZIA 5K0KA 4BDHA 1WF9A 4BBNC 3W32A 2V22A 3L13A 1REKA 4X2GA 4NKAA 1KSWA 5A4QA 4RZVA 5IH5A 2L3ZA 2RFEA 1PF8A 1VD2A 1W84A 2E2BA 2PE0A 3DJ5A 3I7BA 4GS6A 4FSYA 2OJ9A 4MTAA 3HP2A 3ZH8A 5E8XA 3K9PB 3NZ0A 4GSBA 4GW8A 2BR1A 2X81A 3MV5A 3P0MA 4RJ5A 2EU9A 4F6WA 3I4BA 4DEDA 2J7QB 3DFCB 2BTSA 4AOTA 2O64A 2OZAA 3MJ1A 2LGDA 3O65B 4YNOA 5FXRA 3F82A 2NS5A 1U54A 4FNXA 4EJNA 2ZVNA 4LJOB 3DB6A 1WY8A 3T8MA 4GK4A 2M0XA 4AW0A 3C0IA 3F5UA 3U8ZA 4F63A 1O6YA 2DWBA 4O0RA 5D11A 4MKCA 3OHTA 1WFYA 1V86A 2KWUB 2ZCBA 4PDSA 3ODZX 4WBBB 3EN6A 3D32A 2FSLX 4EZ5A 1ZYDA 4P4CA 3WF8A 2J9MA 4GIVA 4RMZA 2CHWA 4GIHA 2X7GA 4CYJA 1PJKA 3AU4A 4TV3A 3TJDA 4F64A 2HXLA 4M68A 2BROA 5AM7A 3H3CA 3W10A 1V6EA 3DBRI 2OKRA 4LV5A 4BWXA 5KHXA 4FKRA 4IAKA 4MF0A 2UZVA 2RFSA 4FTLA 2OXYA 3CP9A 2WMVA 5ETAA 5LWNA 2KJHB 4RM8A 3ZLZA 3V6SA 2QOLA 3APDA 2W1DA 1VCBA 3GU4A 1RDQE 2PE2A 3MPTA 4GG5A 1B39A 3AT2A 3TIYA 1SYKA 3PSDA 2KK8A 4QRCA 4JX3A 5CNNA 3F61A 3PPJA 3F3ZA 5FM3A 3DAKA 2IY0B 3NYNA 3R73A 4OLIA 3SW4A 1PY5A 5C9CA 4MYGA 5HD4A 1E8XA 1S9JA 2O63A 3R9NA 4QP9A 3H0YA 4L3LA 2NPQA 3FI4A 4KBCA 4F7LA 5J9YA 2K6QA 2W5AA 4CFFA 4WQOB 3UQBA 3HGKA 4NM3A 5HLWA 1TKIA 1R39A 4HDOA 3UIBA 5EG3A 1ZXEA 1NXKA 2EKEC 2MSED 2YN8A 4O0XA 3C4EA 3Q6UA 4B95A 3BQCA 3EN4A 3H1UA 5EYDA 4XBUA 3QQUA 3W2PA 5J1VA 1ZMUA 3PIXA 2VNWA 3MVHA 3QWKA 1YXXA 1M2QA 1KV2A 3GOEA 3ZLXA 4DEHA 4X6QC 2G45B 2MQJA 2PSQA 4K2RA 4CXAA 2WQOA 1M94A 5IA4A 3FLNC 4U41A 2C7NB 4QMZA 2UZTA 4QMSA 4GFGA 4OUCA 4YURA 1E7VA 2ITZA 3H10A 2CN5A 2OOBB 4ACDA 4FC0A 5IUGA 3VVWB 1TVOA 2XYUA 4XV3A 3TNQB 4WNPA 4S32A 2VO7A 2IZSA 2OIQA 3GI3A 3EQHA 4I6HA 1WH3A 1OEYJ 1WXVA 4II5A 4JBPA 4W8DA 4DFYA 1LQBA 3COMA 4RVTA 3VIDA 4BCMA 3RZFA 4CFMA 2I6LA 1UWJA 5FG8A 2R2PA 1RRBA 2XJ2A 1WGRA 4UXLA 3ZUTA 2DS1A 3P4KA 4NFNA 4AFJA 4QTBA 4AXAA 4EOKA 2C68A 2YM3A 4ZSAA 3M63B 1UNHA 3JY0A 3PZHA 2X39A 3R7IA 2BPMA 4BHNA 2BYVE 3EB0A 4E6DA 3PJ2A 2IW6A 3FC2A 3PVGA 4C38A 4DH8A 4WWPA 4U43A 2W1FA 1YOJA 3HM3A 1H25A 1RLFA 1NY3A 3QA8A 3CJGA 4ZRJA 3AC2A 3FC1X 3K2LA 2CLQA 4UXQA 5CEOA 4NFMA 4FTOA 3RKBA 2KDEB 5T6KA 2GBJA 1SVEA 2C0IA 3V61A 1GAGA 5FXSA 1Q4LA 4U80A 4D2PA 5LMAA 3AT3A 3TCPA 3HIZA 4K81A 3A4RA 1GZ8A 4RFYA 5HVKA 3B8RA 1W0XC 2C5OA 4LMNA 1C3TA 2BRBA 2YISA 3C0RB 2LGCA 1CSNA 4IVDA 4RWIA 5E1SA 2X4FA 3FDNA 3R04A 3A1QA 4HPTE 4FBJB 3RPSA 5HQ0A 4PS3A 5DCNA 2R7IA 5C23A 1VJYA 2XF0A 4N9F4 5DPSA 2ZPNA 3AC3A 3DTCA 4URKA 2O2VB 4M67A 1WYWB 4EH8A 4EOLA 2Z2WA 3CQEA 1PKGA 3TUDA 2WOUA 1YX5B 2JKMA 3R2YA 2IJMA 4BIDA 3ORLA 4WJQA 1ZY5A 4MNEA 1XH6A 3COKA 2BPSA 3MJWA 4YGAA 4G3XB 3TKHA 1URCA 5EYCA 3LCKA 3CD3A 1E8WA 5ANEA 3WYXA 4FV8A 2VWIA 5TKDA 4TWNA 4F09A 2WMBA 1YRPA 2B7AA 4IFCA 3ZDUA 5AV0A 2XIYA 4D2WA 3SXFA 4QT1A 3C4CA 4JDJA 1V5OA 4DITA 4F9BA 5CEMA 3TV7A 2IZTA 3HLLA 3PA4A 3HNGA 3R66C 2OF2A 3KRWA 1U5RA 4DCEA 2UW4A 2YFXA 1XBAA 4GJ3A 4G3CA 3R1NA 1FMKA 2MBQA 2ZB1A 3LJ3A 3HUBA 4CO7A 2BZKB 1F9JA 4F1MA 3NYVA 3CLYA 4J7BA 4IW0A 4QP8A 2J51A 4PTGA 1PXOA 4M8TA 3ZO1A 3OEFX 4CCBA 3ODYX 5JH5C 2ZJDA 3RPRA 2XBBC 3WE4A 3K3IA 5KBQA 4AZTA 3R01A 4I20A 4A06A 1K2PA 5G6VA 3W2OA 3BEGA 1KOTA 2VX0A 3FWQA 4DEBA 2N4FA 3ACKA 2MRPA 3JW0X 4ZTNA 2F9GA 2WU7A 2VWYA 4FV5A 3P08A 4L00A 4BKYA 1WXAA 3H9DA 4HCNB 4KB8A 4EHEA 2ERZE 2R7BA 3KXMA 4XOZA 2X9FA 3ZFMA 4YTFA 1XD3B 4FI1A 5HNBA 3I6UA 3UZTA 2KC2A 3VVHA 5E6NA 3ALBA 5JQ5A 5J7BA 4XG2A 3HK0A 1OPLA 3NUYA 3QXPA 4MVFA 4RJ6A 3ORTA 4K7WA 1UD7A 3CXWA 4FTIA 4R7IA 3FQEA 2Z0EB 1SE9A 4FSTA 2OI4X 5K3YA 4KIQA 1GJZA 2R3LA 2LGXA 2Z60A 5AIRA 4Z7HA 4FIEA 2QU6A 4M7IA 3VS1A 4ZTSA 4LQMA 4PS8A 2HIWA 4LL0A 3OUNB 4DHZE 4R3RA 3HEGA 3AD6A 4FV9A 4HYHA 4MXOA 5TR6A 4DEAA 5BVOA 1UELA 2G3QB 2CSNA 5GJGA 3T3VA 5A6NA 4CZYB 3ML8A 2KMAA 1S9IA 2VTIA 2UVYA 3S2PA 3UOKA 4NSTA 5HX6A 5JFVA 1GIJA 3PV1A 4NPNA 2C6TA 2N9XA 4FKOA 4YHFA 5FD2A 2MCNB 2YIXA 2UUEA 4XG6A 3ZBFA 1P4OA 3MJ2A 5AUVA 3PG3A 5HVYA 3VRYA 5I5ZA 3BLQA 3LVPA 1LP4A 3E7OA 3ENHA 2A1AB 4FNZA 3IO7A 4FUXA 4ANOA 4AT5A 3R6XA 2C5VA 4IVAA 2ONLA 5CEQA 4WA9A 1X8BA 3W1SC 1U54B 3VH3B 1KE5A 2C6OA 3W18A 2PY3A 2W9FB 2WMTA 2DX5B 5C26A 4BTFA 5JK3A 3NLBA 4GJ2A 3F66A 3R30A 5J5TA 2C60A 3AU5A 3DPKA 3RULA 5AP7A 4HYUA 4KAOA 4JJRA 3ZKJC 2QOFA 1H26A 3OF0A 5FBOA 1RW8A 3RP9A 4O21A 3O50A 4B8MA 2MBOA 3BU5A 3N51A 3VBXA 5J18A 2PUUA 4TNDA 1XBBA 2VNYA 3EZVA 5CQUA 4FA6A 2XH5A 1WGGA 5FRIA 2X9EA 4K9YA 3ORPA 3P23A 4OTDA 5E7RA 5EYMA 3ZSIA 4A3OA 4DLIA 4HWIB 5AZFA 3FMJA 4F70A 4WG4A 4DBGA 1IRKA 4AFEA 2J7TA 4NJ6A 3UOHA 3BHHA 2KFKA 3KXZA 3R71A 1PXIA 1GJOA 4PY1A 1EF1A 2VU3A 4LOPA 3V3VA 3W55A 3PPKA 4BN1A 3GP0A 2N9PC 3V01A 4MM3A 4L8MA 2L0TA 4ALVA 4FSQA 3IKAA 4OTFA 1M17A 5AR2A 5A6OA 4GFOA 3L54A 4DK5A 3LXPA 3II5A 4EUTA 2LRUA 4IJPA 3LQ5A 1ISNA 3KRLA 5AV3A 3I5NA 2DZMA 5HE0A 1TGZB 1LEWA 5IZFA 3U4WA 3QQLA 4AZEA 4IAFA 3R02A 1OM1A 3EN9A 2HXQA 2VTJA 5HICA 3RGFA 3ZLYA 5M51A 3M95A 1ZYSA 4KBKA 3AC1A 4AUAA 4F1OA 4RWJA 4USFA 5D1JA 1XWSA 2GS2A 3VF9A 3NW6A 5AA8A 2NBVB 3A62A 2QOCA 5E91A 2W1HA 2W17A 4BIBA 4ZP5A 2R3QA 5BVDA 5TE0A 2GBNA 4FSNA 4AWIA 4GDKA 5HE2A 1P5EA 3PVUA 4O38A 1NI2A 1YX6B 4L67A 4WWOA 3QJZA 5KMLA 5ACKA 3KRXA 4RC4A 3ZXZA 5HG8A 1ZLTA 4QTDA 3S3IA 2BWFA 3ZSGA 4P90A 2BAKA 3UC4A 3VS6A 3DKFA 3QL8A 3MS9A 2PHKA 1Y57A 3DKOA 4X0MA 4XEYA 5AP1A 3RCJA 1EO6A 3AXCA 4D28A 5CHWA 4X2JA 4XLIA 4C0TA 3Q4TA 1UVRA 2RL5A 1IR3A 1S1QB 4H58A 4KZ0A 4IM2A 2KLCA 3QTWA 3A2CA 2UZDA 3HECA 2Y4IB 3HDMA 4DH1A 1NDDA 1XH9A 4CV8A 5IA2A 2R3KA 2C30A 5D41A 3UG1A 4AGWA 3DGKA 2UZWE 1TQPA 5B2MA 3MVLA 4LUEA 1FOTA 4R8QA 5IG1A 1J19A 3BLHA 5CI6A 4XG4A 1H1PA 2UZNA 2C0TA 3GVUA 1XBCA 4Y85A 3TNIA 3TWJA 4C37A 4CT1A 1YJ1A 5EM6A 3ZLSA 2WWZA 1ZYLA 5HG5A 5C8MA 3U30A 4RX5A 1Q62A 3S1HA 3BHUA 2Z7QA 3ENEA 4DG2E 2FA2A 4J96A 5JMSA 3SV0A 4QNYA 3ZVVA 2PEAA 1OGWA 2BCJA 3H9RA 2OSCA 3KXNA 1H4RA 3AGMA 3Q6WA 4EEVA 3VTVA 2C1AA 2V55A 5FWKK 1Q8TA 3VF8A 5AUYA 2QHNA 4FK3A 4JBQA 1H1RA 2QOIA 2VTQA 4MWIA 4RX7A 5ETIA 1FQ1B 5F20A 2B54A 4A9SA 4UV0A 5EM8A 1CMXB 2Y4PA 3ZRLA 4U7ZA 2KTRA 5CTRC 4YPSA 1IA8A 2QONA 3PY1A 3IS5A 4WNMA 1LFDA 3F3WA 4HVBA 1JOWB 4EK6A 4RG0A 2DYLA 2QG5A 3BYOA 1FGKA 3A7HA 2G4DB 3CSFA 1MRVA 2EXMA 3FLQA 5HEZA 4ITHA 1SM2A 2R3HA 2GDOA 4YUQA 3FSFA 4IAZA 1QMZA 2V62A 1STCE 4RFZA 2XEWA 3KL8A 1NVQA 2ITUA 4M14A 4X2FA 2MA9B 2I40A 5B0XA 2C6DA 1NVSA 3B0AA 4QPSA 4I1ZA 2WMWA 4J1RA 3FKLA 4C4EA 2VV9A 3A1QB 2Z7LA 3PUPA 3AC4A 4W9LA 2JDVA 4AN2A 3MIAA 2MBHA 3SVVA 4RVMA 4U0IA 3HHMA 3G51A 2FVDA 5A3XA 4MX9A 2CGXA 3MTLA 2CCIA 4KABA 3GNIB 4EOPA 2YAKA 4AJYB 2B9FA 3MY5A 3CTHA 2BFYA 4F1SA 4DDID 1IASA 2K6DB 4GH2A 2WTDA 2A19B 4CYEA 4QD6A 4I0TA 3RVGA 5HG7A 2JXXA 2MBEA 4OTGA 3HYHA 5E92A 1J91A 3PPZA 1Z2MA 3ALNA 4P5QA 3UDBA 3UE4A 3PP1A 5IUIA 4D1SA 3QX2A 1IG1A 3SQQA 3TMPB 1WX7A 2JVCA 3DQXA 4O6LA 4BDAA 4EH5A 3ULIA 3U6JA 2XNNA 1BL7A 2BHHA 3PSBA 2J0KA 3UOLA 3TUCA 2Y4IC 3ECIA 5BVWA 5AP5A 4EHGA 3QAQA 3HMOA 1E5WA 4PYZA 4GVJA 4PL3A 4I6QA 3W16A 2JUOA 3U9NA 4IE9A 5HI2A 5AJQA 4JIOU 3TIZA 4O1PA 4D58A 1UWHA 4IAYA 2RFNA 3ONSA 3TKUA 4X2KA 4D2VA 2HZ0A 3RNIA 5LLIA 4YJNA 3IBEA 3U7DA 1JKKA 4FYNA 3TBLD 2XNPA 5EM5A 3GCQA 3V5JA 1JQHA 3K5UA 4G6NA 5D7GA 5FP6A 4ZZNA 3F9NA 1G5SA 2PVKA 4QOXA 1R1WA 4FIJA 1R78A 3FPQA 5F9EA 5KBRA 2PE9A 2VO3A 1CDKA 3RAWA 4IADA 2ITYA 3MBLA 4GXBA 2YWPA 1DAYA 4RA5A 4XHKB 4CTCA 5F4NA 3I0QA 2K8CA 2WNTA 1M2RA 4ZDVA 4KSPA 4FZ7A 5CZHA 3C13A 5DRBA 5KUPA 2R4BA 2ZMCA 4AWJA 2NPTA 2XB7A 4O0WA 3A61A 4ZJIA 2E9OA 4U9AA 4AGDA 4QMQA 4ANVA 2DQ7X 3KN6A 1IP9A 2ZM1A 3GC8A 2G1TA 4ZSJA 3SAYA 2DHZA 4JR3A 4BCHA 4FOCA 4RSSA 4W9CA 4II3B 2XS0A 2JBPA 2OH4A 4I0RA 4W4YA 3VUGA 5J9LA 3H9OA 4TTHB 4PNKA 5A9UA 1KM7A 2N1WA 3RK9A 5EHOA 3ORZA 5A4LA 3VUXA 2YZAA 4FTQA 3ZUNA 4HW7A 2LD9A 4PQNA 1L7YA 4HVHA 2PVLA 2WIPA 4HNIA 4D5KA 5IA1A 1UKIA 2Z0DB 4OVVA 2BRNA 2W1CA 3F2AA 2VX3A 4XMOA 3PFQA 1KOBA 2O8YA 5K4JA 3LM0A 2PMLX 2IWIA 4BBMA 3DAEA 4YZBA 2F7EE 5A4TA 2WOTA 3QU0A 4YJPA 3ZW3A 4AG8A 4W9JA 3M1SA 1H01A 2F7XE 2XEYA 4L6QA 4IFGA 2JDTA 5KKRB 5J17A 2NRUA 2L05A 5JHBA 1XH7A 4NM0A 4ASDA 2DYOA 5BPYA 2HELA 3EN7A 4CQGA 5BUEA 4JLCA 4MXCA 2QR7A 2GU8A 3BGPA 5CSVA 1KE8A 2WTIA 2A4ZA 5KMNA 3OTVA 1WMHB 4UZHA 1KE9A 2ZM3A 3MFUA 3VS4A 3LFBA 3QHWA 2IW9A 4I5CA 3NY5A 4U3ZA 2VAGA 3QUEA 2XCHA 1W83A 5CX9A 3PSCA 5EHYA 5FEQA 3SHEA 3VS2A 3DB8A 4ANSA 5L2WA 2FSTX 3MSSA 5JGDA 4PMPA 3R7OA 2QLUA 3OOGA 3F2NA 4AZWA 3TN8A 3DVGX 3G9LX 3PJ1A 4DH3A 4XRJA 4B4LA 5IISA 5JFXA 3UIMA 1GIHA 2R3FA 2NRYA 2OFVA 2K1FA 2WMAA 3NIZA 5E8TA 4LRJA 2KFKB 2JRHA 5BO4B 1YWVA 2R5TA 3HV4A 3KKVA 4ID7A 3QTUA 4F9WA 1H0WA 4IIRA 3MTNB 4DHJB 2EB3A 4H1JA 2PJHA 3IGOA 3W2QA 1XJDA 3BCEA 5JZNA 2I0YA 2VWVA 3NUUA 3CF6E 3TV6A 4NK9A 5HESA 3WA0A 2CPKE 4I6LB 4RIWB 4LI5A 5CAVA 3UNKA 1TZ1A 1WFCA 1PW2A 2YIWA 3JYUA 4PDPA 4EK3A 1K3AA 4TYEA 2IBIB 1WJ4A 2HY81 2UW9A 5D7AA 5GHVA 4C35A 2Z8CA 1Z57A 1Z9XA 4ACHA 1W82A 4K77A 4U5JA 4RWKA 3NS8A 1DI9A 1P98A 1WXMA 4YO4A 3W8LA 4YL8A 3ZNGC 4I5PA 4LOOA 4RPVA 2PTKA 3IHPC 1JWHA 1U59A 4GK3A 4MQ2A 2WTKB 3QHRA 3KB7A 4WT6A 4TPTA 2QURA 4LRKA 2WGJA 1Q5WB 3QCQA 5EOBA 3VBWA 1NBFC 3WAPA 1XR1A 3NAXA 2H8HA 4N70A 2C5YA 2O2UA 5E8SA 2WU6A 5AUTA 3DOWA 2GPHA 4C58A 3EJ1A 2KANA 3BELA 5CAPA 3IVFA 4FTNA 2O5KA 4MF1A 3PLVA 5AAGA 1CMKE 3E87A 1I42A 4PTEA 3HRFA 1Y6AA 2PL0A 4NIFA 4M15A 2VTLA 2XEZA 3HMPA 3MW1A 2NBWB 3OY3A 4UYNA 3BWFA 4BCOA 5CXZA 2LVOA 2PZPA 3MPMA 4XV1A 3R8MA 5LVMA 4K7UA 5JSMA 5KKRC 5FXQA 4RIOA 4UEUA 1Z5MA 4OR5A 3PXRA 4NW5A 5GNKA 4ZJVA 3VW6A 5JFSA 4O2PA 4RVLA 3PXQA 5DPVA 2I1KA 4PMSA 3L0WB 4AT4A 4QPAA 3HUCA 2ZVOA 3FPMA 2EUFB 4E4NA 3ZOSA 1ZMWA 3KXXA 3NNVA 3M3JA 4EBWA 4H3PA 2DUVA 4DEIA 5BQ0A 4UX9A 4FT7A 2ITNA 3EMGA 1OTRB 2W4OA 3L1SA 1AD5A 3LFCA 1U5QA 3R8LA 5BVEA 4ENYA 3DTWA 3PHXB 3HRCA 4TT7A 4L3PA 3RM6A 2KTRB 3NOBA 5KMMA 5BX0A 1FVRA 3GCVA 3D7ZA 4GRBA 4M0WB 1Q8WA 4PRJA 4BCIA 1UU3A 3CY3A 2KTYA 4NTTA 4EHZA 3QARA 3OY1A 1CTPE 3VUYA 4Q5EA 3AMBA 4F99A 4RQVA 4BKZA 2KNBA 2FUMA 2NR2A 1BUHA 2VWZA 3UC3A 4FN2A 2E9NA 2JZZA 3K5VA 3TUBA 4ICUA 4N6YA 4RJ4A 4W9XA 5BMMA 2R9SA 4JX7A 4B99A 5JEBA 4W9FA 4BKSA 3T8OA 3DU8A 4ZLZA 3QFVA 2JF5A 4PMTA 3IW6A 4ASEA 3AGLA 3H7PA 3R8UA 4GDLA 2OU7A 3RBWA 1GC7A 4F7NA 2RD0A 4FKUA 4JQEA 2WAJA 4ANBA 4WIHA 4J53A 2R3RA 4CVAA 1LPUA 4DGOA 3OWKA 4FULA 1M7QA 4QTCA 2R3MA 4MCVA 4MXYA 2OBJA 3MB6A 4D9UA 1EH4A 4C3FA 5ANDA 2BIYA 4GU6A 1V5TA 3KULA 2DZJA 3R7RA 3LZBA 5BYZA 2KLGA 4KZCA 2WTKC 4IQ6A 2IO2B 2OGVA 3WIMA 3LM5A 4TYJA 4AZSA 3X0WA 5KHOA 3IGGA 2R3NA 2BHEA 3TTIA 5L2IA 2XNGA 3GCSA 2VTPA 3ZYAA 5K9IA 4ERWA 4FOBA 3AOXA 4V0GA 3LW0A 3FHIA 4HYSA 3SKCA 4FKIA 5H8GA 3PLUA 1WBVA 2G2IA 3FZTA 4O27B 4S33A 3UQAA 2M4NA 3K3JA 4Y8DA 4EEWA 3PIZA 3DS6A 4CRLA 5AA9A 2JAMA 2OIDA 2YACA 3D5VA 4EC8A 3LFSA 3RMFA 1GUAB 3V8TA 4EOJA 3ZS5A 2C6MA 5LMKA 3OFMA 4PDOA 2AYPA 4MBLA 2BVAA 3UYSA 4CZUA 2ZAZA 4FG9A 4F1TA 2DZKA 3TCAA 3TJPA 4U97A 4J52A 1YWRA 2Q0BA 4WUNA 3TZ8A 2UVZA 3JUHA 3KVXA 3GOPA 3HA8A 3A9JB 5JH6A 2JC6A 3PRPB 3FQHA 5J79A 4W9KA 1UU7A 1ERKA 3LCDA 4YO6A 3A4SC 5IAAC 1ZZLA 4PWNA 3OC1A 2IO1B 5DEYA 1OKZA 3QRUA 1OGUA 4W8EA 2K8BA 2V7OA 1ZMVA 5CF8A 3HM6X 3PGEA 3E88A 2FAZA 1UA2A 2ASQA 4KS7A 3Q32A 3GU7A 4IB0A 3M42A 4BVUA 4EWQA 2KJ6A 4GB9A 3RI1A 4UMPA 4X3JA 3VS7A 5EI6A 3OBJA 2C0OA 2XK7A 5EI8A 3UVPA 2VGOA 5JFWA 4BKGA 2IZVB 5GJDA 3ZEWA 2FNJB 3FL4A 2O6VA 3ZO5B 3ELJA 1ZY4A 3NIEA 4FIHA 3ZIMA 4L45A 3AT4A 2XK5A 4WJNA 3HV3A 3BYVA 3HMNA 4GYGA 5EI2A 2P55A 1WM3A 3P9JA 4ANUA 4DDGD 1OECA 1CKJA 3LPBA 4CSVA 2VN9A 1X1MA 4IZ7A 2YLMA 3AULA 1E7UA 2JT4B 1OEYA 5J87A 2RR9A 4MXAA 4YLKA 3NCZA 2X7FA 4F9YA 1TBEA 1BL6A 2W0JA 3DKGA 2UW0A 3I1AA 4LGGA 3QD0A 3RK7A 1P0RA 3F7ZA 4G0NB 4KA3A 4M8MA 4YZCA 2QVSE 3H4JA 4ANWA 5CEIA 3ML9A 5HU9A 2XMYA 4UYAA 1Q3DA 4EH2A 2MP2A 3JYAA 5AR4A 1MP8A 4NCTC 1YOMA 5I9ZA 1ZW7A 5GZAA 3HV5A 2B3AA 3ZDMC 3IW4A 4IX5A 3BYUA 4IWQA 3QAME 5HBJA 2CMWA 1UH6A 2WD1A 2X0GA 2W05A 1PXJA 3FYKX 1LUFA 3O96A 3QTSA 4J8NA 4ZTRA 4HPUE 4FKGA 3C51A 4D9TA 5IPJA 3PS6A 4DWFA 1QPEA 3ROCA 5M4IA 4V01A 4FTCA 4QP3A 4E5BA 1KOAA 4G3DA 4U44A 3VS3A 3U51A 1WI0A 2V3SA 4Q9ZA 3WAMA 3WZEA 4FIFA 3RK5A 4BCNA 4IWDA 5FM2A 3G6HA 5JKGA 3W2SA 4KINA 3QD3A 1B6CB 5AAFA 4QTEA 5CU4A 4OT6A 5HO8A 4C34A 1V80A 3VFKA 3D0EA 3V04A 1UGMA 1MQ4A 4Y5QA 4D55A 1WGDA 3PLSA 2IZRA 2IZUA 4Y72A 4XC2A 4YBKA 4CLJA 3WBLA 4FKTA 5L83A 3KVWA 1YI4A 1NVRA 4MD7E 2W4KA 3ZONA 4JI9A 4CEGA 4TL0A 3E63A 4WUAA 4CFXA 3DDQA 4OTIA 4AW1A 2RGPA 3DK3A 3PRZA 2JKKA 2RPQA 3LCSA 3FKNA 4S2ZA 3RYTA 4YZNA 3ZRCA 1Y8GA 1OIUA 5BUJA 1XHAA 4F9CA 5AM6A 2JDSA 3DQWA 3ZTCA 3FXZA 4DHZB 3EFWA 3LFEA 3P79A 3ZC5A 3D83A 2W5BA 3MI9A 4EOYA 3VDZA 2ZM4A 2QR8A 3Q3JA 4BOSC 1YDSE 5I3OA 1Q8YA 3UP7A 1QPDA 5CQWA 4AOFA 4HCVA 3NR9A 4QMMA 2O3PA 4LGDA 4XG8A 1ZYJA 4NJ7A 5IA0A 3Q53A 5C8KA 5DR9A 4EFOA 1FMOE 4DHFA 5CASA 1Q97A 2Q0NA 3QYZA 5AAEA 2OK1A 2RG6A 4EH3A 3DVGY 3MN3A 4BB4A 4N0SA 4ITJA 3D5UA 4O0YA 4RIXA 4YBJA 4AA5A 4C62A 5JZJA 3DBLI 4MSMB 4E74A 4MBIA 1Y91A 4IXPA 4Z55A 2JDOA 3AD5A 3LFNA 3PXFA 4FV0A 4M0ZA 4YSMA 4G9CA 2HD5B 2PMNX 2HYYA 3E3BX 4U6RA 4HNFA 3CEKA 3L9PA 2W1EA 5AADA 3BV3A 3GCPA 4PF4A 2V5QA 2PZYA 3QRJA 3DBSA 4LUDA 4UALA 3PPAA 3PTFC 1C1YB 4FKPA 4Z16A 3VUWA 2KQSA 1H8FA 3QD4A 5AP6A 4NIFB 3D9VA 4BZDA 4FHKA 4FTUA 2UZBA 3DCVA 4IB3A 4FX3A 1ZARA 2BDWA 2HE7A 3DLSA 3KFAA 4JL9A 3QWZB 3MTFA 4G6LA 4FSMA 3CTQA 5KNJA 1HOWA 3EL7A 1KE7A 3P5KA 5FQDC 4DHJD 4I41A 3ZFYA 1KWPA 3L9LA 5G2NA 5J9ZA 2GSFA 4PX6A 4NH1A 3IK3A 4G5PA 4E73A 5H9BA 4J8MA 5KMOA 2KX0A 2RSUA 5BMSA 5HIBA 4E5AX 2CGWA 4C2WA 3SDJA 2AL6A 4JAJA 3OCSA 4GUEA 4HZSA 4QQTA 2F4JA 4DFNA 1VYWA 4ZAUA 2KQ7A 3AQVA 4HVDA 3MFTA 3LXKA 4GT4A 4AACA 3O7LD 3MVJA 3LMGA 4YJUA 1T0YA 4X21A 3OCGA 4QP4A 3ACJA 5FTQA 4RLKA 1PHKA 3HMIA 5A4EA 4IEBA 3KH0A 3UIPB 4U8ZA 1RFAA 1V1KA 5EDRA 3EQDA 4HPMB 2GTNA 5B2LA 3M62B 1WVYA 3WZKA 1J0GA 4TW9A 5GZ8A 3WZUA 3SRVA 5CWZA 2QOKA 2X2LA 4QNAA 4RT7A 2ITWA 4I94A 3LFQA 2MWSB 4RFMA 3T3UA 3V6RA 3KK8A 4YLJA 4C4GA 2C3LA 2GNIA 3OMVA 2OJJA 1MRYA 3H7PB 1BYGA 2BAJA 3CQUA 4USDA 2JPHA 4GDLB 1BKXA 3E92A 3NWWA 4V04A 4XCUA 3A8WA 5HCYA 2EVAA 3S95A 3SLSA 4F4PA 4EKUA 3SXSA 4QP6A 3QTXA 5CF4A 1GZOA 2PMIA 3DJ6A 4Y46A 3NZUA 3MGYA 3QX1A 2ITPA 4QYEA 4XZ4A 3Q96A 1V49A 1UBIA 3MHSD 3CS9A 5CSHA 2CN8A 5HBHA 2REXA 4RLLA 4FZ6A 4KRDA 4I6NB 4E4LA 3UG2A 3L8PA 2WX1A 4W9WA 3VN9A 5CU6A 3DOGA 4GV1A 4L68A 2YAAA 2YJRA 3F5GA 3G0FA 4MJSA 1H0VA 3EQCA 4BCPA 1YQJA 5M57A 2LXAA 2FGIA 4PYUA 2A0CX 2OZAB 4XH6A 2E9VA 3BEAA 1KLVA 2C7MB 4ZY4A 2QOOA 2WO6A 5BNJA 4FZAB 3GU8A 3R21A 4K8AA 3OROA 5B2KA 5BVNA 5IMXA 1JRUA 2Y7JA 5FP5A 3VS5A 5HOAA 1V0PA 4BKJA 2LI5A 2KO3A 4C61A 3E8CA 4O0TA 5KMJA 5CNOA 2IY1B 2R0IA 3FMKA 3OW3A 3RWQA 4DTKA 4GU2A 3JVZX 4W4VA 2HOGA 1KJTA 2DAFA 3EIDA 4XX5A 1JAMA 3EOCA 5C1QB 3UQGA 1TTNA 4CNHA 5IEYA 2C4GA 3TEIA 4EH9A 2W7XA 4BTKA 4EK8A 4LRMA 1NA7A 3MWUA 3A7IA 4IZ5A 4WNOA 3MDYA 4I93A 2X6DA 3GU5A 2B4SB 3RHKA 3H0ZA 5AR5A 2VTRA 5DR6A 5GJFA 4A4OA 4E4MA 2PVRA 2WMRA 3A9KA 3O23A 5KMIA 3EFUA 4WO5A 3SX9A 2VRXA 3FXXA 2YM8A 4CMUA 3F3VA 2ITQA 4HCTA 3FZPA 2J0IA 3O2MA 4RJ8A 4JT3A 5DRDA 3S00A 4H36A 1E90A 3OAWA 4O0VA 2CHXA 3R7UA 3TT0A 1T45A 4FNYA 5J2RA 2QNJA 4PPAA 4MELA 2P2HA 4XP0A 1V0OA 3QRIA 4W9EA 2BF8B 4NU1A 4B6WA 2FCMA 4XG9A 4KDLB 3PSEB 4I24A 2XK5B 4HJKA 4GMVA 3PP0A 2ZDUA 4BCGA 4KRCA 3GFEA 3DY7A 2BKRB 4B9KA 3S4QA 3D14A 3A99A 3VJNA 4UZDA 3SD5A 2IW8A 5M4FA 2GHLA 4WSYA 1H1WA 4BKTA 3M2WA 3CR0A 4L53A 3FHRA 3EQIA 3I81A 4NJDA 5AUWA 4EQMA 3JPVA 2GS6A 2I1MA 1FVVA 2HENA 4U3YA 5LMBA 5E6PA 3R00A 4HYIA 3RM7A 1URWA 5C1ZA 3BU3A 3V6CB 1E1XA 2XM9A 1OPKA 4FSUA 4HPLB 1OI9A 4GL9A 5CANA 2YLEA 3GBZA 4QP1A 3KUCB 4AP4C 3ZTXA 5FR6A 2HWOA 3KY2A 4JR7A 3KMWA 3IDBA 4W9DA 5K4IA 3UMWA 1MG8A 4HJOA 3OJ4B 3CGFA 3ET7A 5J1WA 4ANXA 5A4CA 3D4QA 3OXIA 2KZRA 3L17A 2YIYA 4WNKA 4H3BA 3FZSA 5F1ZA 4EOQA 2UW6A 3E8NA 2YCFA 3NX8A 2KULA 2QI8A 3V5QA 4C4IA 3OW4A 2KDFB 3V51A 2WB8A 4OT5A 1BT0A 4KKHA 3HX4A 4OTRA 1H1SA 3AMYA 4BC6A 1OKWA 3D5XA 3G0EA 2VTHA 3MFSA 2YM6A 3UYTA 2UZUE 1SMHA 4GUBA 4F7JA 1LM8B 1Q0WB 1ZOGA 2KC1A 5FDXA 1SNXA 3R7VA 2WX0A 2CGVA 3A33B 3RCDA 3WILA 5JN2A 2G01A 3KRJA 3UPXA 2BRGA 1YXVA 5DFPA 4APPA 3Q9XA 4QYGA 4K0YA 5CSWA 4LMUA 3DA6A 4KD1A 4FG7A 3ZXTA 2M1MA 2FCQA 1WZ0A 3SU8X 3IW7A 3EFKA 3DVNU 2VZ6A 3VW8A 3CSTA 4FIGA 2JBOA 1E9HA 4BWKA 2YM4A 2KTFA 4I6BA 3B8QA 3DDCB 4GSWA 5HNGA 4BDGA 3FI3A 4AUQC 4JXFA 4HCPB 2FYSA 5CT0A 5CEKA 1UNGA 3QD2B 4NUSA 4NJ3A 2QLQA 2BUJA 3THBA 3CQWA 1JPAA 5DLSA 3F5XA 1Q1OA 5AZHA 2C6IA 4NEUA 4BVUC 3DT1A 4ZY6A 3CGOA 4O91A 4OGRA 3KF4A 4XLVA 3MA3A 1A9UA 5HORA 1P9DU 2ZNVB 3QTZA 3VUHA 1H8CA 2O65A 3FUPA 2LVPA 3Q52A 3QLFA 1WBTA 5IA7A 3VC4A 4UN0C 2QOBA 3C4WA 1H27A 3DBCA 3EN5A 3EZRA 5HU3A 3VTWA 4LJPB 4EZJA 4PNIA 3QF9A 4IJ9A 1VR2A 4PP9A 5DN3A 2JKOA 3VBTA 4EK4A 3D2IA 3QQFA 5F95A 3V5PA 4BDIA 4CMOA 2R3GA 5ANKA 3Q9WA 4DFLA 3EQPA 4E3CA 4AW2A 4EONA 2GHGA 3RZWC 5AR3A 4C4HA 2J5FA 4MNEB 5AEKB 1GNGA 3Q4UA 4M69A 3L9MA 3RHXA 4CKRA 4JIKA 4FBXA 5E6OA 3RAIA 2GCDA 2A2AA 2VTNA 3ZCLA 4JG8A 2IO3B 4PMMA 1BI8A 4C2VA 3E93A 3T9TA 4FZFB 3NS9A 2IVTA 4O22A 2C5NA 4RRVA 4UMQA 5CALA 3I3TB 1WAKA 5FEDA 4AQCA 4JGHB 2XK4A 1ZZ2A 3MYGA 2QODA 3D15A 3MY1A 4TWOA 4E7WA 2OXXA 3SD0A 2WYQA 2VO6A 4J99A 4B6LA 1J1BA 3VS0A 2XKFA 3QKLA 4PUZA 2QD9A 4CMTA 5LXIB 4S30A 2UZEA 5CTPA 3E8DA 5CYIA 3KMUA 1OUKA 2YEXA 2YM7A 4TQ1A 4FT3A 3LJ2A 4HZRA 5J5SA 4X57B 4QMTA 1WZ3A 3Q2MA 5J95A 4W9GA 4O2ZA 3BQRA 3VUTA 4KIKA 3IPHA 3PJ3A 3QC8B 4EHVA 2WTVA 2VGPA 3CPCA 5CU3A 4ZSGA 1V2YA 3BINA 4FV3A 1KV1A 3ZO4A 1DM2A 4L7FA 3HMMA 3W2CA 2F57A 2PZ5A 3GENA 5ANIA 4DGNA 1Y8RC 3NHEB 1SNUA 2W1IA 3O71A 3ALOA 4G31A 4IH8A 4F08A 5DR2A 3R8ZA 3FMNA 4K1RB 3NEWA 4OTPA 4BBFA 4ZZMA 2JIIA 3DBDA 1U4DA 2G15A 2C6KA 3MH1A 2OWBA 3POOA 3GB2A 3NSZA 2I0VA 2WKMA 4QTAA 4YTCA 4KKEA 4LFIA 3VBQA 2WELA 3VULA 3EYGA 3OVVA 2DYBA 4JNWA 1D3ZA 1YKRA 2GMIC 3D7TA 4K7SA 5AV1A 2R3JA 3FBVA 2AC3A 3PHWB
chains in the Genus database with same CATH superfamily
2BYEA 3RINA 1P7FA 1CKPA 1YI3A 4N4SA 4N6ZA 3F7WA 4FVPA 4IMYA 4BI0A 1UKHA 4MHAA 2FE8A 2JZ3B 2LXCA 1A70A 3FLSA 1TS5A 2HTHA 3PWDA 1DAWA 3NDMA 4D4SA 4QQ5A 4BL1A 4BTMA 5DI1A 5E90A 4DXFA 4B0GA 2M8SA 4TKSA 2ERKA 4GU9A 4R7HA 1NDDA 4PK1A 5M56A 1XH4A 3QK0A 3WIGA 4ASEA 4H39A 4MM3B 1YHVA 4MGZE 2DENB 1TZOA 1VZ7A 5GXGB 4A9RA 1JALA 2FSMX 4GT5A 4O1OA 5LCJA 3R7EA 2YDIA 3LXLA 4ICVA 3IAS1 3FE3A 4IUMB 1RJBA 4JDIA 5H3QA 2CCHA 1WVXA 1CJEA 2EWAA 1CK1A 5L3AA 4YJTA 2C3IB 3PVWA 4PTCA 2XBJA 4ZS0A 1O9UA 2C6EA 4WRGA 4FJYA 3QCXA 4CFNA 1WXQA 4BDEA 3NUSA 3Q9ZA 3H6NA 2ITTA 3UTOA 3C1XA 4WIPA 4USAA 4EBVA 1WSPA 3COHA 4M3QA 5FEEA 2R3IA 1W8CA 1SVHA 4HOKA 5BVKA 3QXOA 3REPA 3Q4ZA 5EDPA 3VHTC 4QMOA 3R9OA 2L76A 4KWPA 3CKWA 4I21A 4EH7A 3TKIA 4MDKE 3TNHA 4A9TA 1I09A 1OUYA 4JG7A 4USEA 4J6IA 4ZXTA 4M02A 4GOCA 3GT8A 2P2IA 4X7QA 1RAXA 5C8NA 4EZLA 4I22A 5AUUA 3MVMA 1FRDA 2WIHA 3RFZB 2N7DA 2B53A 3I60A 3KLSX 1IEPA 1WCCA 2WXKA 2QQ7A 2L7RA 4A3PA 2CHZA 4AOIA 2KVRA 3FJQE 2P4IA 4W9IA 2ESMA 4IC7A 3OWPA 3KXGA 3FZRA 3VUIA 3QKMA 3HA6A 5LVLA 3BYSA 1V0BA 4KV2A 1WJUA 4AU8A 2XBAA 5CEPA 4FL2A 2PLPA 4M0YA 5AUZA 2GI9A 3NS1A 2JKQA 2A5UA 4APCA 4XUFA 1Z5SB 3QHTA 4BFRA 1MG4A 1WGKA 3MFGA 2LASA 2IVSA 2NPTB 3GU6A 4GEOA 3FLYA 3IOKA 4RJ7A 4DBNA 3HV6A 4DFXE 5IDNA 5K5NA 4YT0B 4AZVA 4WD5A 4YJSA 5L8JA 4NKSA 5CHFA 2C7MB 1FFUA 2HY0A 2ZVAA 3H30A 3KA0A 3KN5A 3QGYA 3UQCA 3PZEA 4FMQA 1ZRZA 2VWXA 1H00A 5CVFA 4AGCA 4WSQA 4C4JA 2MJEA 5BMHA 3CBLA 4RWLA 3BE2A 5F94A 3BIID 4L9IA 1SGHA 3TL5A 3VHKA 4BDKA 4DGMA 1O6LA 1IPGA 2UYZB 1NYRA 4C8BA 4MEMA 3APCA 5IO9A 4GLSC 3NZ3A 5LVPA 4WHZA 2JFLA 2IJ0A 4P7EA 3IG7A 3H7SA 4A07A 4FKJA 4BGHA 2OJGA 4E20A 1Q41A 1S3SG 3AC8A 4EC9A 4C80A 4TN6A 3T3OA 4WH4A 1OZ1A 3FY2A 4HVSA 5AEPA 5AWMA 2RSVA 3OXZA 4YHTA 4WJPA 5CT7A 2G9XA 4ONAA 5L6WL 3DPDA 2ZV8A 3RT3B 3P2BA 4HGSA 5DG5A 4YC8A 4ITIA 4G5JA 4GGQA 1ZPSA 3OCTA 1F52A 5CXHA 3KMMA 4LL5A 1QPJA 5IU2A 2H96A 5H8BA 3B2WA 3PYYA 3Q3FA 3MC8A 1GNUA 3ZXVA 3RZBA 4CYIA 3WARA 4AW5A 3OG7A 3DWMA 1PXNA 4I3ZA 3NVVA 4GCJA 4CV9A 2XNMA 1FEHA 3PJ8A 1YN5A 2FIDA 4HVIA 4QMUA 4UWCA 3EWHA 3EQRA 3LJ0A 4IDTA 4OAVB 4CCUA 3HV7A 5D9HA 4FV6A 1R0EA 4G9RA 2C7HA 2EMTA 2L00B 1LO5D 3QQJA 3BWUD 1PKDA 3ERKA 3MPAA 5JQ8A 4GN1A 3IW8A 5TF9A 3GQLA 1G6JA 4AT3A 4QYFA 3KULB 1WZYA 2XVDA 3CKXA 3N32A 2TSSA 4IC7B 4FA6A 3VRZA 1WBSA 4FV2A 2W54A 2H6DA 4TWCA 4YL8A 1YDRE 3G9NA 3U6HA 3MA6A 5D10A 4JBVA 1OKYA 4JDHA 2V0DA 2KN5A 4RZWA 4JQWC 2ITXA 3CE3A 3PXZA 4PPBA 5HZNA 2WDRB 3PA3A 3D94A 3IT6B 3OTUA 4CKJA 3BY4B 1WMHA 3WZJA 2BIKB 2NBUA 4BGGA 3EL8A 2WTWA 3UIOB 4RA4A 4G3EA 3HVZA 3QKKA 4WJOA 3QZGA 4TYHA 2W9ZB 4I4FA 3O17A 4M8NA 4D2SA 4ZJJA 1APME 4YSZB 5BYQA 4BCFA 4ANQA 1M2PA 1IBXA 2FIFA 2MP2B 2JU6X 2QEJC 2R0UA 4R6VA 3BIZA 4BDJA 5LWMA 1OL7A 3KF7A 4BFMA 3SEBA 2GBRA 5MPOA 5KHWA 1FNWA 4ASZA 4F0IA 1I35A 4NY0A 3JVRA 3IW5A 1REJA 4FEQA 4K18A 2JY6A 3BRBA 4QMPA 4KZ0A 2IN6A 3QTIA 4IB1A 3MH3A 3EKNA 4IC8A 3LFAA 4IAAA 3LJ1A 3HP5A 1BLXA 4X2NA 3RNEC 3R83A 4IWOA 1H4LA 3NAYA 3SHQA 5KZIA 4ACMA 5G5HA 4MEDA 2YITA 2LUEA 2FSOX 3FILA 2KAJA 4JPSA 3PY3A 4AE6A 4XX9A 3ZLWA 3ZRMA 3WI6A 2PE6B 4UWYA 3RALA 3NNXA 4QO9A 3DQVA 5I9VA 4FT9A 4FODA 2LFIA 3R2TA 3PJCA 2ETRA 2D10A 4IHPA 2J6MA 2YLFA 3H8HA 5KO1A 2D2QA 4BICA 4NZWB 4C4VA 4WAAA 1MQBA 4YJVA 5ANOA 2JRIB 3BX5A 3SXRA 1R4MB 4I5MA 3TSSA 4F6SA 4F6UA 5AP4A 3X23A 4MXZA 2R3OA 2AQ2B 1SZMA 3PXYA 5JGBA 5LXHA 3SRVB 3KUDB 4UDUC 4O0UA 4QYYA 2X0PA 3L8SA 5IA3A 3DK6A 3KWLA 3P7AA 4HCUA 2UZLA 2CS4A 5JGAA 1QL6A 1PUTA 3QA0A 4FICA 4UWBA 5HKMA 4ZTMA 5D94A 4I92A 3UQFA 5C01A 1FXAA 4EZKA 2WXNA 5DT3A 1WBNA 3MFRA 5T8IA 5HIEA 2BS2B 4WG3A 2RG5A 4REZA 5JRQA 2WGSA 4R1VA 2R64A 2G9HD 1R0PA 3SOAA 2DZIA 4O4DA 5D7VA 4D0WA 4BKSD 4RGOS 3R9DA 3AMAA 3RPOA 4LOQA 3KYCD 3TEYA 2HAKA 2C69A 2AUHA 3A60A 4QMXA 4AAAA 4MAOA 1WMKA 3U2SC 4EQUA 3ORXA 4TYHB 1JBPE 5E8VA 2DAJA 2Y9QA 4IVBA 3VWAA 4ANNA 2L8JA 1ZDXA 4ASXA 3TNWA 5L8LA 5L4QA 3ZEPA 5ACBC 3KU2A 3I5ZA 2FCNA 2SRCA 4UY9A 3LOKA 4GFMA 4E93A 1TYGB 2IYDB 2XNOA 2QO9A 4TYIA 4YNEA 1YN4A 5M55A 4S31A 1DI8A 3TI1A 4DGGA 4Y73A 4JS8A 2A4LA 3WF7A 2FBWB 2VZKD 4TUUA 1PMNA 4CHKA 4II2B 5LJJA 2VUWA 1N62A 3NUHB 2G2HA 4P2KA 2I38A 1OL5A 4C3RA 2C1BA 3HDNA 3Q3MC 4A20A 1NENB 1O6KA 4BTJA 2LZ6A 2YVCA 2PW9A 2HK5A 2GS7A 4D1ZA 3WIKA 5J7HA 1GPXA 2W99B 5A54A 3R1YA 2XP2A 1XH5A 4Q5HA 5K0KA 2PZIA 3W32A 4X2GA 2RFEA 1PF8A 2E2BA 3I7BA 4GS6A 2BR1A 2X81A 3P0MA 2J7QB 2EU9A 3I4BA 3DFCB 4AOTA 2LGDA 2O64A 3O65B 3F82A 4FNXA 4EJNA 1GOZA 3T8MA 2M0XA 4P1CC 2WXIA 3U8ZA 1O6YA 2DWBA 2KWUB 4PDSA 4EZ5A 4CYJA 2X7GA 5AM7A 1N5XA 4BWXA 5KHXA 4IAKA 3CP9A 3ZLZA 1TY0A 3APDA 4M01A 3DAKA 3AE7B 3SW4A 1I4XA 3R9NA 4QP9A 3FI4A 4KBCA 5J9YA 2K6QA 4HDOA 1NXKA 4B95A 3Q6UA 3H1UA 5EYDA 4XBUA 3PIXA 1YXXA 3GOEA 4X6QC 4K2RA 5IA4A 3FLNC 2UZTA 4YURA 3H10A 3AEEB 4FC0A 3VVWB 3I5JC 1TVOA 2XYUA 2OIQA 1WH3A 4RNAA 2NTSA 4II5A 1LQBA 4RVTA 3VIDA 4BCMA 2I6LA 5EE3A 4AFJA 4QTBA 1UNHA 2J52A 3MC9A 3R7IA 1LGRA 4WWPA 3PVGA 4U43A 4LNIA 1H25A 3AC2A 4RGTA 3FC1X 2WQYB 2KDEB 5T6KA 1SVEA 5LMAA 1GZ8A 3B8RA 3R04A 2EELA 4HPTE 5HQ0A 5DCNA 4N9F4 3DTCA 2O2VB 4EH8A 1PKGA 3R2YA 4BIDA 1VRAB 1ZY5A 4G3XB 4YGAA 5EYCA 3CD3A 5ANEA 4FV8A 5TKDA 4F09A 2WMBA 1YRPA 2B7AA 4IFCA 3ZDUA 5AV0A 3SXFA 4QT1A 1FM0D 1XCTL 1F77A 3TV7A 5E6JA 3HLLA 1FCCC 3R66C 1KTKA 4G3CA 1FMKA 3LJ3A 4CO7A 1F9JA 4PTGA 3WE4A 3K3IA 3AEFB 3R01A 4I20A 2VX0A 4DEBA 2WXPA 3NVWA 1WXAA 4L00A 4KB8A 3KXMA 3ZFMA 4YTFA 1XD3B 1TT5B 5E6NA 4XG2A 3HK0A 4RJ6A 3ORTA 4K7WA 3FQEA 2Z0EB 4B0MA 2LGXA 2QU6A 4M7IA 4PT5A 5TR6A 4HYHA 4DEAA 4W9LA 5A6NA 4FKOA 5FD2A 4YTNB 2UUEA 3MJ2A 5HVYA 3BLQA 3LVPA 4FNZA 2IPKD 2QIEB 4ANOA 3R6XA 2W9FB 2DX5B 5C26A 3TEXA 1FCLA 4KAOA 3ZKJC 2QOFA 3OF0A 3BU5A 2XH5A 2X9EA 3P23A 5AZFA 4HWIB 3FMJA 1IRKA 3UOHA 4L8MA 4OTFA 1M17A 2LRUA 4L2YA 3I5NA 2DZMA 1TGZB 1I4RA 1LEWA 3QQLA 1IGDA 3R02A 3M95A 1ZYSA 3AC1A 4AUAA 4F1OA 4RWJA 4USFA 1XWSA 2GS2A 3VF9A 5AA8A 3A62A 5E91A 1P5EA 4O38A 5ACKA 4RC4A 5HG8A 3UC4A 3VS6A 3DKFA 5CHWA 4X0MA 4D28A 4X2JA 1S1QB 2ICIA 2Y4IB 4IOIE 3HDMA 5IA2A 2R3KA 2QDFA 1TQPA 1YJ1A 2WWZA 5C8MA 4KGSA 4RF0A 4EE2A 2FA2A 4J96A 3ZVVA 3KXNA 4JX1C 5FWKK 1FQ1B 2B54A 4A9SA 5CTRC 1IA8A 2QONA 3IS5A 4HVBA 4RG0A 2DYLA 3A7HA 1MRVA 4YUQA 3FSFA 4IAZA 2XEWA 2V62A 4RFZA 3KL8A 1NVQA 2ITUA 4I1ZA 3SVVA 5A3XA 2CGXA 3MTLA 4DDID 2MBEA 5HG2A 2YEPB 1J91A 4M00A 3QX2A 1IG1A 3ECIA 2Y4IC 5BVWA 4PYZA 4GVJA 4PL3A 4I6QA 3W16A 5HI2A 4O1PA 4IAYA 4D2VA 3RNIA 3IBEA 3U7DA 1JKKA 1TKGA 3F9NA 5KBRA 5HHDG 3RAWA 3MBLA 2YWPA 4CTCA 5F4NA 4KSPA 4FZ7A 5CZHA 5DRBA 5KUPA 2XB7A 2DQ7X 3KN6A 2DHZA 2XS0A 2OH4A 4W4YA 1KM7A 3H9OA 4TTHB 3ORZA 3ZUNA 4HW7A 1L7YA 3ZJUA 3F2AA 4XMOA 5K4JA 4YJPA 3SR6A 2F7XE 4L6QA 1XO3A 5J17A 1E7PB 4NM0A 5CSVA 3AN1A 3OTVA 2ZM3A 2IW9A 4U3ZA 5EHYA 5FEQA 3SHEA 1K53A 3DB8A 4AZWA 3DVGX 3G9LX 4DH3A 2NRYA 2OFVA 2WMAA 4LRJA 1YWVA 4IIRA 3MTNB 2EB3A 4H1JA 1XJDA 3BCEA 2I0YA 1EWYC 5HESA 4RIWB 4LI5A 1TZ1A 1WFCA 2HY81 2Z8CA 1W82A 4K77A 4RWKA 1P98A 1WXMA 4YO4A 3ZNGC 1N61A 4I5PA 3QHRA 5EOBA 2GLSA 3WAPA 1XR1A 3DOWA 4N70A 5AUTA 2KANA 4FTNA 2O5KA 3PLVA 4M15A 1N60A 2XEZA 3MW1A 3BWFA 4XE0A 4K7UA 4XV1A 4US8A 5FXQA 4NW5A 4O2PA 4RVLA 3L0WB 4OW0A 2ZVOA 4E4NA 3DWGC 3KXXA 3NNVA 4LNFA 2DUVA 4UX9A 1U5QA 3R8LA 3AE9B 3HRCA 1FVRA 1C79A 4NTTA 2KTYA 3B9JA 2KNBA 2FUMA 2NR2A 3K5VA 3TUBA 4N6YA 2R9SA 4JX7A 4B99A 3DU8A 3H7PA 4PMTA 4NJCA 2WAJA 4CVAA 4FULA 4QTCA 4C3FA 2DZJA 3LZBA 2L83A 2IO2B 3R2IA 4OZBA 3IGGA 5K9IA 4ERWA 4FOBA 3LW0A 3FHIA 4O27B 2M4NA 5AA9A 4EOJA 3ZS5A 5LMKA 4MBLA 3TJPA 3TCAA 4U97A 3HA8A 3A9JB 5JH6A 3FQHA 4W9KA 1ZZLA 4PWNA 1OKZA 3QRUA 2V7OA 3HM6X 3PGEA 1UA2A 4GB9A 2O6VA 2FNJB 3FL4A 1L4ZB 3NIEA 4L45A 3AT4A 1VDVA 3HMNA 4ANUA 4DDGD 1CKJA 2RR9A 3NCZA 1TBEA 3DKGA 3QD0A 3RK7A 4KA3A 3ML9A 2XMYA 4EH2A 5AR4A 2IEWA 3IW4A 4IX5A 1Q10A 4IWQA 2WD1A 2X0GA 3K9OB 4D9TA 3PS6A 1N5WA 3ROCA 3EGRA 5M4IA 2INCC 4FTCA 4G3DA 4Q9ZA 2L1AA 3WAMA 3WZEA 4ARIA 5FM2A 3G6HA 3W2SA 4OT6A 1D5ZC 3D0EA 2FUG1 3DBHB 4Y5QA 1WGDA 2IZRA 2IZUA 3WBLA 4FKTA 4JI9A 4CEGA 4TL0A 4CFXA 4OTIA 4AW1A 4S2ZA 3RYTA 3Q69A 1OIUA 5AM6A 3FXZA 4DHZB 3ZC5A 3D83A 1Q8YA 4LGDA 4NJ7A 5C8KA 1FMOE 1Q97A 2OK1A 2RG6A 3D5UA 3DBLI 4E74A 2VH2A 2JDOA 3AD5A 4FV0A 2HD5B 4U6RA 5AADA 2V5QA 1E0ZA 1C4CA 4FKPA 3VUWA 1JQ4A 4FX3A 1KF6B 4N6EB 4G5PA 4E73A 5H9BA 5KMOA 5BMSA 3OCSA 2F4JA 4HVDA 3MFTA 3O7LD 3ACJA 3KH0A 4U8ZA 3EQDA 3WZKA 1VZ8A 4KGTA 3KK8A 4YLJA 4C4GA 3H7PB 4URKA 2OJJA 2JPHA 4V04A 3E92A 5HCYA 3S95A 3SLSA 1PGBA 3QTXA 3NZUA 3QX1A 3MGYA 3MHSD 3UI3A 3CS9A 5HBHA 4FZ6A 2WX1A 4L68A 2YAAA 3G0FA 2A0CX 1KLVA 5BNJA 2QOOA 1J7BA 3R21A 4K8AA 5B2KA 2W82A 5IMXA 5FP5A 1V0PA 3OW3A 3RWQA 1MVKA 4GU2A 4XX5A 1JAMA 1TTNA 5IEYA 4EH9A 4EK8A 1NA7A 3A7IA 2I2YA 2X6DA 3GU5A 3RHKA 2PVRA 2WMRA 2QMTA 3SX9A 2H88B 2ITQA 1HTOA 5DRDA 3S00A 4H36A 2CHXA 2QNJA 4MELA 4W9EA 4KDLB 4I24A 3GFEA 3DY7A 2BKRB 3VJNA 5M4FA 2GHLA 4WSYA 3M2WA 3EQIA 3I81A 2HENA 4U3YA 5C1ZA 1URWA 2XM9A 1OI9A 3IDBA 4W9DA 5K4IA 1MG8A 3ET7A 2RPVA 4ANXA 2KZRA 2YIYA 4WNKA 4H3BA 3FZSA 4C4IA 2KULA 3OW4A 3V51A 4OT5A 1H1SA 3D5XA 4F7JA 2YM6A 2KC1A 2UZUE 4GUBA 1LM8B 2WX0A 3A33B 1ZOGA 5FDXA 3R7VA 3KRJA 2BRGA 4APPA 1YMHE 4QYGA 4K0YA 1FIQA 3IW7A 3EFKA 2VZ6A 3CSTA<