3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
molecule tags Immune system, signaling protein
molecule keywords MGC80376 protein
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
2QVSE 3F5PA 1WBWA 4P5QA 4G9RA 4GH2A 3HM6X 4C3PA 4FKIA 2HW7A 3MBLA 4RC4A 2FCQA 2P33A 4L52A 4HZSA 3F3VA 4OGRA 3PIYA 5HZNA 2C5LC 3FL4A 3BHHA 4D2VA 2VUWA 3QTRA 5AR4A 2YDJA 3QX2A 3RNIA 3E87A 4A9UA 4ALVA 4EHGA 2Z8CA 5DN3A 2VO0A 5EYMA 4D2TA 3PHXB 2V7AA 4TYJA 4ZLZA 1WI0A 3VBVA 4X0MA 2JKMA 1WXMA 4ZZOA 2J7TA 4F6WA 5M4UA 1V5TA 5L95C 4UZHA 3TKIA 3UIPB 5AA8A 4EYMA 3H4JA 4EHZA 2OF2A 4D0WA 2VO6A 5L2QA 2J7QB 2XK5A 4W9HA 3EIDA 4OT5A 2VU3A 4R7IA 3QYWA 3ZZWA 4BCMA 3DCVA 3HVCA 2C1BA 5HX8A 2NPTB 4EEWA 4U43A 5IDNA 2X9FA 2QCSA 3RULA 3TT0A 3BGZA 5KZ0A 3KXZA 2QU5A 3FDNA 3ORLA 2GBRA 3PLVA 2L7RA 2KTRB 1TQPA 4RRVA 3GU8A 1OKWA 4FKVA 4FTOA 4AN3A 3VHTC 2XK4A 4NIFB 3DKCA 5J9YA 4ZSEA 2XKDA 5CU4A 4BWKA 4CCUA 1E7VA 3KU2A 3P0MA 4FV0A 3OOGA 4GJ2A 3DAJA 4I41A 2KDBA 4G1WA 3L08A 4ZTHA 1V1KA 4IAFA 3QC4A 4AOIA 2IY0B 2G45B 1LR4A 3K9OB 3I3TB 3QUEA 2GNHA 2EVAA 2CGUA 3QFVA 3F7ZA 3GCQA 4B99A 4F0GA 1I42A 4WNMA 4F70A 4NFMA 4ALWA 1GIIA 3RPRA 3QTWA 2AYPA 2BHEA 2XK7A 4AW5A 4O0WA 3OEFX 3ZUUA 3FE3A 3NLBA 5HTCA 4KIKB 3NEWA 3QKKA 5LMBA 4DAWA 2HELA 1H00A 4J1RA 4QP6A 4B9DA 2WXVA 2OZOA 5DH3A 5AV4A 3DBLI 3NUUA 2YLEA 3RMFA 4XG7A 4ZY4A 4EQCA 3VW8A 5D11A 3QD2B 4NUSA 4XLVA 5HTIA 3DJ7A 2R3FA 3LQ8A 5F9EA 3LAUA 2BZIB 4D5KA 3TJPA 4FT0A 4BCFA 3ZO5B 4FSRA 2ZJWA 3F9NA 1WM2A 2N7DA 3WAMA 3KUZA 4PDSA 4U9AA 3ZC5A 2O2UA 3MGYA 5CYIA 4IMYA 2XKCA 3MA3A 4WOVA 4TYIA 2FAZA 4QPAA 3FMLA 2DZIA 3R8UA 3Q9YA 3OWJA 4JXFA 3R7OA 4ZSAA 5E6NA 3WANA 2CGXA 4CZTA 4IVCA 2HE7A 2XK3A 3ACJA 4I0TA 5EW8A 4YMJA 2MX2A 3FI4A 2QD9A 4BZOA 4MDKE 1KM7A 3ECIA 4G3CA 3PXFA 4GIHA 4MTAA 5AP1A 1R3CA 2GU8A 4O0XA 2IVUA 3NW6A 3L8SA 3PY3A 4PQNA 4FC0A 1PKDA 3UO5A 3QZFA 4BC6A 1Q3WA 2UW3A 3VUYA 3QZIA 4LM5A 4KAOA 5ANOA 3SC1A 1OL1A 3MY1A 1XBAA 4R1YA 2ZV9A 3RI1A 4DH5A 2CGWA 2X9EA 5AUTA 2RL5A 4O0UA 3TUCA 1NVQA 2J4ZA 1H1PA 1PXNA 3FMMA 4FX3A 5FEDA 3RJCA 2D07B 2NCNA 3NCZA 2XB7A 4IC7B 3LDZE 3DJ5A 5IAAC 2D2QA 3LFAA 3TJCA 4OAUC 2DAJA 3EFJA 2FCMA 4S31A 3OP5A 3P86A 3TIZA 1Q5KA 4PS7A 5CT0A 3HP5A 3EJ1A 4PS3A 4NPNA 4FA2A 4AT5A 2PVFA 2QLUA 4OVVA 4U42A 4IWQA 4RVKA 5DEWA 3QRKA 4ANQA 1UA2A 1YW2A 4IH8A 3ZBFA 3WYXA 1WMKA 3HK0A 4GU2A 3F3TA 3IDBA 2XKEA 3R00A 5G55A 4UMPA 4ZSGA 3O51A 2IW9A 3W2QA 4F09A 1QZEA 2H9VA 4IZYA 2F7ZE 4BDHA 4E71A 4BCNA 3L9MA 2ZVNA 2IW8A 2G15A 4RSSA 5FGKA 5LXMA 3R7EA 4KZCA 2HTHA 1K3AA 2GDOA 3DS6A 3KULB 1YOMA 4MNFA 3TXOA 3FYKX 4QP3A 2C5OA 5AUZA 2O2VB 2ACXA 1IA8A 5AV3A 2BYVE 3RT3B 2V55A 3OY1A 3IW8A 4L6QA 4RJ7A 3BGQA 3ZLXA 2N1WA 3ORKA 4K7UA 4LGDA 2FCNA 2F4JA 3WF6A 4N0SA 5AUUA 4X2KA 3FY2A 5HU3A 3W8QA 3ZVVA 2Z7LA 3MH2A 3VW6A 2A4ZA 3IK3A 5KCVA 4RWJA 3FSFA 3EFKA 4FT3A 4G9CA 2HCKA 4WSQA 4B6WA 2IZTA 4FT5A 3D15A 3KMMA 2W1ZA 3LMGA 3OCSA 2HZNA 2BDWA 5CXHA 1K9AA 3QQJA 3QU0A 2BALA 3A7JA 2DYOA 3OBGA 4IWPA 2GBKA 4RC2A 4C4JA 1CMKE 4GS6A 4OTWA 2G9XA 3TEIA 4FG9A 4BCGA 2GMIC 3MV5A 5CU6A 2B52A 4HVSA 3NW5A 4NSTA 3R8LA 3VO3A 1CKIA 5HNBA 3RAHA 4K81A 1KE8A 4WRGA 1W82A 3EQRA 3EHAA 1OPLA 1OB3A 1KWPA 3FKOA 3NS8A 5K0KA 4ZTRA 2WTJA 3FQEA 5A9UA 5AM6A 5LOHA 3L17A 3C50A 4G6NA 1M14A 4FSMA 5DPRA 4EH7A 4XH6A 2HD5B 3PV1A 3RNYA 2L8JA 1WF9A 5ACBC 5L6OA 4QMOA 4EK4A 5EKNA 2BPSA 3RP9A 5EYCA 5KNJA 2WD1A 2LUEA 3JW0X 1PF8A 1HOWA 4IVDA 2DS1A 4EOSA 3BYUA 4G6LA 4IB0A 2VV9A 2EXCX 3FV8A 3BKBA 4FVRA 1EF5A 4Y95A 3E88A 4F64A 3FMEA 2GTNA 3V6SA 2I1MA 3FHIA 4X7QA 3V01A 3PSDA 3PYYA 4JOAA 4NJDA 4JDIA 2XZSA 2CLXA 3LLTA 1JOWB 2CDZA 2ZV7A 3V5QA 3TBLD 2QOQA 2IVVA 4DN5A 4YU2A 5DR6A 1E8ZA 2LASA 2JUOA 3ZUTA 2KTRA 3E7VA 3WIGA 4Y85A 1T0YA 3LFCA 4K9YA 4CEGA 1WRDB 3DBRI 3N32A 1CDKA 3KCFA 3QX1A 4W4YA 1Y8GA 3EFLA 2Y7JA 3Q60A 3KXHA 3L9LA 3B1LX 3R1NA 4ANBA 1GG3A 1OIUA 1J0GA 4DGMA 2RFDA 3WE8A 4AZSA 2VTRA 3SHEA 2BF8B 3FUPA 4YZCA 3WALA 3P9JA 2JKOA 3I1AA 5AP7A 4D28A 2A4LA 5KUPA 2JKQA 1B6CB 3EQGA 4ID7A 5B0XA 4I4FA 1TQIA 2UW4A 2WTKC 4ENYA 1CSNA 3WZJA 4CVAA 4QP7A 5A4LA 4M66A 3TNPC 2FUMA 4F7JA 3ZXZA 3VVWB 3SA0A 4HK2A 2XYUA 2JRIB 1TQMA 2X8EA 5CF5A 3MJWA 4OBQA 2YCQA 2VTOA 5C26A 4FSQA 2KX0A 3OLMD 4YJTA 3KRRA 4BRXA 4X21A 4L3JA 4EYJA 5I4NA 2KDEB 3CSFA 1Q41A 3RPYA 4ANOA 2X7OA 1K8RB 1UKHA 1YRPA 2KN5A 3RAKA 3HYHA 4BCJA 4FHKA 2KLGA 5IUIA 4FLHA 2HWOA 4IJPA 4ERKA 3R2BA 5EM6A 3UVQA 4BBEA 3CR0A 4ZLYA 4ZTMA 1OEYJ 4CRLA 1V81A 4DWFA 4HCPB 4K7SA 3VTWA 4QTBA 5AR7A 4O6EA 3UP7A 5K5NA 4AWJA 4GVJA 4RLLA 4H36A 5IZFA 3AC3A 3LIJA 4K8AA 5FM3A 5C8KA 3IONA 4AJWA 5DNRA 4W9KA 5I9YA 4O27B 5IMEA 4ZLOA 2Y8OA 4HZRA 1UU8A 1OVEA 4E5AX 2ITUA 4ITJA 2YLFA 2H6DA 3M11A 4EORA 3AC5A 2GBJA 5EM7A 3SQQA 4TYEA 3TV6A 4WJNA 4KA3A 4AFJA 4N6ZA 3NNWA 1R0EA 4YNEA 3ZBXA 2ZV8A 4EOOA 2PVRA 4KBCA 3TWJA 2E9VA 3H6NA 2UV2A 3QQHA 2WIHA 3DFAA 3QCSA 4HJOA 3PRFA 4BYJA 5DRDA 4F1OA 2ZMDA 1UNLA 4LMNA 3ZRCA 3HL7A 3PIXA 1GIHA 3HMIA 2R2PA 1H1QA 4WO5A 3TNIA 3UGBB 2B1PA 3O96A 1A9UA 5IA4A 3RPSA 3O23A 1EF1A 3AMAA 3HRFA 5A6NA 2WO6A 2XNBA 4TKNA 4XV9A 4USEA 5JFWA 3EECA 2C7MB 3C1XA 1V0PA 1Y8YA 4RMAA 2ITVA 4JAIA 4U3ZA 5DCNA 3CGOA 3BWFA 2VTJA 3RZBA 4WT6A 2YIQA 2LXAA 2SRCA 3SU8X 5IH5A 3DVGY 2ERKA 3FZPA 5FXRA 1Q0WB 4RT7A 4II3B 3A9JB 3EYHA 4JVGA 4QP4A 3P78A 3DB6A 5HIBA 3W18A 2Z7SA 4DEAA 4ASEA 2A27A 5HD4A 5LVPA 5M4IA 2KXJA 3ZTCA 1H8CA 1WM3A 1WGRA 3M62B 2ITWA 2UVXA 5KMMA 3R6XA 3CY2A 1S9IA 2UW6A 1VYZA 4HNIA 5HO6A 4W9CA 3CQEA 3ZDMC 4DDGD 5DR2A 5IA2A 4IDTA 4BCPA 3R9DA 5KKRB 1PJKA 3G6HA 4MXZA 1FMOE 4DHJD 4URKA 2IYDB 4ANVA 4NTSA 1H25A 2ONLA 3OCTA 4TPTA 2CKHB 3L13A 3SD5A 4YL8A 3LFEA 3OEZA 1FGIA 4ASXA 2V1YA 3V5JA 2M17A 2JDSA 5CHVC 3L16A 5BVEA 2OH4A 2EXMA 2FO0A 3RM6A 4EK3A 4L00A 2OBJA 1R4NI 4RX7A 3RCDA 2O65A 3SX9A 2C60A 2XP2A 4TYHA 4W9XA 4FNYA 2B54A 2BROA 4XUFA 3CCNA 4L42A 4ANSA 1Y8RC 1YOLA 2L0TA 3MY0A 1GNGA 1REKA 5E91A 4ALUA 1Q61A 2OFVA 2PEAA 4ZK5A 1XBBA 4Y8DA 3B0AA 1H26A 2X39A 3ZNZB 3KN6A 4IIRA 5E8VA 5E92A 4O1PA 4WIHA 4EI4A 1UVRA 1Q5WB 2VWYA 3OY3A 4E6CA 4GEOA 2DAFA 4FIIA 2CMWA 3NUYA 2XEYA 3BQCA 1VCBA 4W8EA 5FP5A 3UNKA 2UYZB 1GNUA 4HCNB 4UXLA 4FKGA 4IADA 5M56A 3OXZA 3KVWA 3VQHA 5GNKA 2RFNA 3LZBA 2IWIA 4HVGA 3VN9A 5IKWA 1OM1A 4IC8A 3Q04A 4FL1A 4JLCA 1WCCA 3L8VA 4IAKA 3W2PA 3ZRKA 4QYEA 2AC3A 1ZWSA 5KMOA 3F3WA 4D55A 2WQNA 3A99A 5FTQA 1AQ1A 4JT3A 4CFMA 3HEGA 4IXPA 3R73A 4G5PA 3BHTA 4I94A 4IX6A 3ZO1A 4EK8A 4QOXA 4HVDA 1GUAB 2X2MA 3LFFA 1YKRA 4FKLA 4QT1A 3SD0A 2IO2B 2WMTA 5A54A 1WR6E 4ZP5A 2MBOA 3ZW3A 3QQLA 3ZDIA 3ZEWA 4FSNA 3NAYA 5HESA 4LRKA 4BDAA 3EQIA 4BL1A 4AE9A 5AP2A 2LAVA 1NDDA 3A61A 4AU8A 4Y72A 4A9YA 2QO2A 4UXQA 4O0RA 4CYJA 4N4SA 3B2WA 1V2YA 4G34A 5B2MA 5A6OA 2BKZA 4AX8A 3PPZA 4KKHA 3VHEA 3BY4B 1P98A 2Q0NA 4BDKA 4O2PA 3DQVA 4GT5A 3QTSA 4YTIA 3G5DA 2VWXA 5FXQA 4NW5A 2C6KA 3U87A 2JRHA 4FULA 5I3RA 4MWIA 2YM7A 3OMVA 4ITIA 3H1UA 3F2NA 4M3QA 3LXKA 3QTZA 1UGMA 3S3IA 3ANRA 5G1XA 4V0GB 4CKJA 5CZIA 3VBXA 1FMKA 3AD4A 4FSZA 5H3QA 2ITXA 2QKWB 3RTPA 4C4HA 3H9DA 3VFKA 4X6QC 2F2CB 2GS2A 2PVYA 2R3GA 2XIZA 3HV3A 4UY9A 4AS0A 4AG8A 5JSMA 2WQBA 3L10B 1NA7A 1V80A 5I9VA 2JAVA 2WU6A 3H0YA 3OW4A 4J71A 1FINA 3FYJX 5DT0A 5J7BA 2MBBB 3KCKA 4I5HA 4FV4A 5DPVA 3SW4A 4ASWC 2WTVA 3F3ZA 1WVWA 1BKXA 4ANNA 2C0TA 2EB3A 5TR5A 2PMLX 3BRBA 3MJ2A 3UJGA 2G4SA 2J9MA 4QTEA 1MQBA 1WFCA 3P7CA 4BDIA 1ZGUB 3UNJA 1PXLA 1KE7A 2BPMA 3VS0A 1IASA 4C4GA 4NQKE 3ENMA 5KMIA 4JDHA 2YEXA 3PFQA 5CSPA 2L76A 2BYEA 5AWMA 2MCNB 4F9CA 4A3OA 4QTDA 3NGAA 1AGWA 2DZJA 4A4LA 3Q53A 2BAQA 2KDIA 4PS8A 1WBVA 3ZRMA 4FI1A 4F1SA 2C6TA 2E2BA 3KF4A 4GN1A 2I40A 2UW0A 4PV0A 1UBQA 2MP2B 3RD2A 2WDTB 4DXAB 2LWPA 4FTJA 4IW0A 3Q9ZA 2VD5A 4C34A 3D14A 2FYSA 3BYMA 1O6LA 1OMWA 4YBJA 1IEPA 4JGHB 4BVUC 3FAAA 5DOSA 4ZXTA 3ZSHA 3GXLA 3NZUA 1G6JA 3LCDA 1YD8U 3KVFB 1U54B 3T9TA 5L2IA 3SRVB 1PW2A 2C69A 2XBBC 2YM4A 3FMKA 3GBZA 3O7LD 3KYCD 4C4FA 2R0UA 3V60A 2FNJB 3UQBA 1P9DU 5B2LA 3R8MA 4L45A 4PP9A 1WX8A 3ONSA 1UWJA 4G17A 5F1ZA 2A2AA 3OWKA 1XQZA 1PYEA 2X81A 4C02A 1UKIA 4LV8A 2JKKA 4LGGA 3WZEA 4TKSA 4DGOA 4MBIA 2ZYBA 1AD5A 2CSNA 1P4OA 4X2FA 4ZJJA 5CX3A 1U59A 3I81A 1H0VA 1ZMVA 4EZJA 3GC0A 1P1AA 4F9BA 2PVLA 2R2QA 1FVTA 5CAQA 3VF8A 2FH9A 3E92A 3C4ZA 5I3OA 1IR3A 5DIAA 1Z57A 4PPBA 3O8TA 2G2HA 3R7VA 4MELA 2KWVB 1ATPE 5CQWA 3GEQA 3M1SA 3R83A 4BOSC 1YDTE 2BRNA 2PVKA 1REJA 3GUBA 3IW7A 4Y46A 5K3YA 5TOZA 5JGBA 5E8ZA 3CLYA 4GK4A 5C23A 5LVLA 4CV9A 4E73A 4MNEB 3VUMA 5ETAA 4DFXE 3OAWA 3S2AA 4AWIA 4I6HA 2XBAA 1H01A 1WZYA 3NYXA 2JDTA 2BMCA 4I6PA 4BDEA 3RHKA 2C3LA 2PUUA 1E90A 4JBQA 1EO6A 1GC7A 4AA4A 5DVRA 4XV1A 4FNWA 3CTJA 2JT4B 2BFXA 4RIXB 2UUEA 4B7TA 4R5YA 3MPAA 5JFXA 4FZAB 3DOGA 1ZOGA 4I4EA 4GRBA 1PXIA 2VX1A 3QA0A 1VYWA 4D2PA 4H1JA 3V8WA 1R1WA 4I22A 3F61A 3ZDUA 1WE6A 2X0GA 4YHJA 5LJJA 2CPKE 3OVVA 3MS9A 4FKSA 4A7CA 3R1QA 5AJQA 5AV2A 1UWHA 3HNGA 4UWCA 2RIOA 2MW5A 5JEBA 4PX6A 2ERZE 5JH5C 3IDCA 4MM3A 4U44A 4OTHA 1VR2A 3E93A 3NYNA 4FTTA 4QTCA 5HEZA 5IH4A 1U4AA 4BKGA 4L01A 4JR7A 4U81A 3GNIB 4QQJA 2OFUA 1OQYA 3DU8A 3VUXA 4I5CA 4WJQA 1SNXA 1V0BA 4XOYA 3I6UA 2ESMA 3FLYA 1M7QA 3GZNI 5EI2A 1WBSA 1XH9A 3BCEA 4XBUA 4M13A 2VTQA 1ZMWA 4J8MA 4PYZA 4BCQA 2YA9A 2QC6A 5D41A 4DEEA 2AL6A 2WMBA 3C51A 4LDTB 1FVVA 2QOBA 2VTNA 1EH4A 2Y4IC 3BLRA 2I0EA 4BKYA 5LWNA 1WIAA 3FMHA 3GCSA 4RA4A 4DDID 3QUDA 3A9KA 4PYUA 2C6DA 4R7HA 4ZS0A 3REPA 4EH4A 3VAWA 3R8ZA 3RWPA 3R01A 1FPUA 2EU9A 1XWSA 2R3JA 4IC7A 4J95A 3U9NA 2FA2A 2QONA 2XRUA 3ZLWA 5FEQA 2RR9A 2C30A 2ZNVC 4GDKA 1OL5A 2YACA 4RX9A 5J8IA 3NNVA 1Q99A 1YDRE 2ZV2A 5M51A 2V3SA 4BKSA 5K5XA 1JLUE 2BAKA 5FDXA 4Q9ZA 2A0CX 3EC8A 1BI8A 3F82A 4FMQA 5FXSA 4A9TA 4BCIA 3NS9A 5EDSA 2O8YA 2C6IA 4HCUA 3OG7A 4YC6A 1YHWA 5CSXA 1E7UA 2ZVOA 2WHBA 5DPTA 3NNUA 4CNHA 3A1QA 3MVJA 3OUNB 2QOHA 2JFMA 3AD5A 3LCKA 1Z5MA 4MHAA 4MK0A 3ZHPC 5HIEA 3QARA 5H2UA 2A1AB 1DI8A 2QOOA 4APCA 5CHFA 3JPVA 4FV3A 4PDOA 5J9ZA 5DPWA 4FGBA 2YCSA 1M2PA 4FTCA 4DTKA 3ALOA 2REXA 4JQWC 3TIXA 4BGGA 3GC8A 1JNKA 3IGGA 4HYHA 3QD3A 3IBEA 2PMIA 3N51A 2CCIA 3G6GA 4OTRA 1QMZA 4F99A 4IANA 3TNQB 4E7WA 5C8NA 4MXYA 5ICPA 3QL8A 4FYNA 3N30A 3R9NA 3HA8A 4DBNA 2E9UA 2HXQA 4ZTQA 5AP0A 3EFUA 3FZTA 4ACGA 4F6UA 5CU0A 4IE9A 3EH9A 4XG3A 5LXIB 4L43A 3EB0A 5BO4B 3R2YA 1DS5A 3C9WA 4CKRA 4ENXA 3BELA 2R3IA 4PMPA 4BKJA 3Q4UA 1O9UA 4GK2A 1TVOA 3CC6A 3OXIA 1PMEA 2G1TA 4MCVA 2VWIA 4FZDB 2QR7A 1JPAA 4GU6A 4LFIA 5E90A 2HZIA 3SXFA 2OOBB 2OJFE 1XO2B 4RIYA 2X4FA 2NR2A 4H1MA 4EHVA 3UMWA 3ORPA 5AEPA 4DEIA 4EZ5A 2LJ5A 2F2UA 3PXKA 2PL0A 5IA5A 3OWPA 4KS8A 4F0FA 1YI6A 5KMNA 3AXWA 4FKPA 4UMUA 4IEBA 3WE4A 5IEYA 3NR9A 2R3LA 5JGDA 4RZWA 3OUKA 4FV8A 4RVTA 4F65A 2KZRA 2J0KA 2I0HA 4FTMA 5AX3A 5LARA 5IDPA 5D1JA 4Z16A 4FZFB 4F6SA 3PP1A 4QYGA 3OT3A 3TV7A 1OPJA 3PJCA 4WD5A 4M8MA 3VQIA 2Y0AA 2Z7RA 3DK3A 4BTKA 4EKKA 2BKRB 4A3PA 3MPMA 1TKIA 4FTLA 4IAIA 2CHLA 2PZYA 4WWPA 4B95A 3GOPA 4MH0E 3GT8A 3ZO3A 1JSVA 3Q3BA 5ACKA 3FHRA 4TWCA 4YBKA 1BYGA 3BYOA 4E4XA 4CCBA 2XJ2A 3NWWA 3I79A 2FSTX 5JK3A 3PREA 2OJGA 3NCGA 3QD4A 4KBAA 4YC3A 4Q9SA 3PPJA 3EQPA 4RQKA 4BIBA 2C3IB 3FZOA 4A9RA 4EK5A 2HW6A 2CHXA 4GDKB 4C8BA 3HMPA 2LGYA 1JKSA 3ODZX 4C3RA 1AARA 3PGEA 4F7ZA 1WGGA 1J91A 4S2ZA 5HLWA 5J7HA 4JG8A 3CTQA 4A4OA 2VTSA 2UW9A 2IO0B 4ZYNA 2X6EA 4W4XA 3I7BA 5IA7A 4GB9A 2PY3A 2YIRA 3H3CA 3IPHA 1Q97A 4KB8A 4NJ3A 5DG5A 4B0GA 4YZDA 1OIRA 4YTFA 1OL7A 3KXXA 3TTJA 1WGHA 4F1MA 5F94A 3HX4A 1H1SA 4P7IA 4DGGA 3GCVA 4I6LB 3CJFA 3DNEA 3Q5IA 3MHSD 2VWUA 4WKQA 1HCLA 3R22A 4GFGA 5G6VA 4TQ1A 2DYBA 3UVRA 3ETAA 3RCJA 3ZS5A 4X3FA 4MF1A 4PP7A 1F5QA 3GOKA 4BFRA 3R7QA 4XRJA 3PJ8A 5DFPA 5EK7A 4FSWA 5CAPA 1V86A 4D4YA 5CX9A 2KO3A 2DX5B 2JPHA 4BKSD 5HG8A 3D0EA 3PE1A 4QYYA 4JL9A 3JS2A 4AW2A 1YDSE 3EQFA 1YIWA 2YWPA 3UDBA 3QKMA 3EN7A 3BX5A 3DZOA 3K3JA 5L6WL 2PE6B 2XBJA 2Y9QA 4GIIA 4IFCA 5BVFA 1YWRA 2V7OA 2VTTA 3BE2A 3FWQA 4E5WA 2NPQA 2LI5A 1KOBA 3ERKA 3PSBA 2QO9A 4YC8A 1M17A 5AP3A 1OIYA 3CQWA 4UEUA 3THBA 5HX6A 4KWPA 1WJUA 2ZCCA 1CTPE 2Z2WA 5C1ZA 4XOZA 5GJDA 3DKFA 4AACA 4Z3VA 3AD6A 1PYXA 3FLZA 5CANA 3QQUA 3IW4A 1LP4A 3VS4A 5DRBA 3FQHA 3A8WA 3BINA 3QC8B 3Q2MA 3V5WA 2YZAA 4CYEA 4NNJB 4QMTA 4TV3A 3DLZA 3Q32A 5BUIA 4GCJA 3NIEA 4M67A 4M0YA 3R9OA 4QQCA 2EB2A 4MXOA 2QU6A 4W9WA 3VUDA 4OT6A 3APCA 4JQEA 4AZFA 2K8BA 3BBWA 2W1DA 3NRMA 4FUYA 3G9NA 4O22A 4Y5QA 3RK9A 3ZO2A 2O6VB 3PPAA 1ZYCA 4LMUA 4KABA 2EWAA 1ISNA 1XT9B 5JZNA 3DPDA 5I9UA 4B8LA 2JIIA 1FQ1B 3OOMA 4RLKA 4DLIA 3D5XA 4IX5A 3PSEB 4ZSJA 4CZYB 4E5BA 3MWUA 2ETKA 4V04A 3Q9WA 3DBSA 3NY5A 3PXRA 4BOZB 4EZ7A 4E6AA 2YITA 3Q96A 3UO4A 4EC9A 5JH6A 2V22A 2IO1B 3IFWB 5KHOA 4EFOA 4BDDA 1GZNA 2JDRA 2W05A 2GTMA 2J2IB 4FTQA 5AUWA 3ZRLA 4D1ZA 2O3PA 4EEVA 5AIRA 3GQLA 4JNWA 5FP6A 2DHZA 1LPUA 4HCTA 4LRJA 4RWIA 3DZQA 2GHMA 2BDFA 3R7UA 4IAZA 3DBCA 4NWMA 4OTDA 3EKNA 4XV3A 4QMZA 2ZM3A 3EKKA 4F9YA 3TZ8A 2WX1A 4WBOA 4II5A 4G6OA 4BTJA 5J1VA 3UQAA 3RHXA 4QYFA 3DNDA 2YM3A 2WAJA 2J5FA 2WGJA 3OTVA 3BE9A 1H07A 3KXNA 5CEPA 3FXWA 3AC4A 3BEGA 4ANXA 3FZ1A 5LVMA 5JZEB 4AW0A 3U6JA 4LV5A 3QCAA 4ANWA 2Y4IB 4R3CA 5EHOA 4RIOA 5FBNC 2BZKB 4CMOA 3QTUA 1CKPA 4JBVA 1YX6B 3A2CA 3IOKA 1L2NA 2J6MA 4J52A 4YZMA 1U46A 5EOBA 4BKZA 2WWZA 3DTWA 5M4CA 2K8CA 1OIQA 3FJQE 1R39A 4IM0A 4U79A 2YABA 3GENA 4JQ7A 4MD9E 3VWAA 1TTNA 3Q52A 5AR8A 4S32A 1Q24A 3A8XA 5HKMA 1CMXB 1ZW7A 4BBFA 1KE6A 4LG4A 3VC4A 2XIYA 4XG9A 4CT2A 4YJVA 5ANJA 2XM8A 4RFMA 3HIZA 4FV7A 2IVSA 1WYWB 1XH8A 2BILB 3NIZA 4NAWA 5KBQA 2BWFA 2AEHA 2LGDA 1NXKA 4PY1A 3Q5ZA 2PVMA 3JVZX 4KVGB 5HE2A 3COKA 4B8MA 1XKKA 3FBVA 4O0YA 4YURA 1Y6BA 4RG0A 4KSQA 2VTPA 5CTRC 3L8XA 2JDOA 3QGWA 3MI9A 3VS6A 4FKWA 4GJ3A 4YLJA 4MAOA 4RVLA 4U40A 2ITQA 4LI5A 2FCSA 5HBJA 5C03A 1APME 3CMMB 3D4QA 2R3MA 2O6VA 5ITAA 5EDPA 4GDLA 4QP9A 3ORNA 2XNNA 4I21A 3EN4A 3PLUA 5AIKA 3HRBA 3DVNU 2R3RA 5HG7A 4DHZE 1P2AA 4X2JA 1IRKA 4FKRA 3AT2A 2B53A 2HENA 5AUXA 2W1CA 2DUVA 2XIKA 3L1SA 2NO3A 3R71A 5EYDA 3ZMMA 4AUAA 4ZRIA 5CAUA 3Q9XA 1MRVA 2MSED 4UYNA 3M95A 3RINA 3JY0A 3TKUA 2UZBA 4JG7A 3MW1A 1OL2A 4YJNA 3FC1X 3QKLA 2W1HA 2VGOA 1STCE 1W0XC 2WTDA 2X7FA 3HLLA 4E4LA 2OK1A 4XEYA 3S1HA 3ENEA 3R3MA 2XNOA 3H9RA 4DC2A 4OLIA 2MWSB 4FV2A 2BKFA 2C5YA 1I09A 3MN3A 4IAAA 3RZFA 5CVFA 4RFZA 1ZLTA 2XIRA 3MSSA 3NUSA 3WZDA 2HIWA 5A4EA 4HYSA 5CQUA 4FKTA 3L9PA 5HO7A 3FL5A 2VRRB 4LCDE 4KNBA 3ZDTA 3T3UA 2GPHA 4M7IA 2O6VD 2YERA 4DEDA 3UQFA 1XH4A 4ZTNA 4WA9A 5IMXA 3AI5A 3PHWB 1H0WA 4WG3A 4YHFA 3SVVA 2XJ1A 2A5UA 4MGKE 3A60A 4M97A 3C5UA 4O96A 1OECA 4ARKA 5IISA 3LJ0A 3KH0A 2WELA 3UZTA 4UMRA 4RIXA 4NK9A 3W16A 5BNJA 2DWBA 4PMSA 1NBFC 3PWYA 1IPGA 4UALA 3OW3A 3R0TA 4IB1A 3TZ7A 4E6DA 4KRDA 4EUUA 2QI8A 3EYGA 5DEYA 3PVWA 2C0IA 4F1TA 2FIFA 1PXOA 3G90X 2CCHA 4PWNA 5A4QA 3LCSA 3MDYA 4O0TA 4R6VA 4WAAA 2ETRA 4DG2E 2ZPNA 5H8EA 5BUJA 3PZHA 2PE0A 3FI3A 4U97A 3ELJA 1WJ6A 3HM3A 3QAQA 3UF8A 3ZUVA 3FC2A 4I0RA 3L54A 2ITOA 5TF9A 5IA1A 1RJBA 4L7FA 5GHVA 2XNGA 3PRIA 4XP2A 5GZAA 5LWMA 4RMZA 4YP8A 4YJUA 1WBNA 4BTFA 1WJNA 1EUVB 1P14A 1WXSA 2LZ6A 4TYGA 1ZOEA 3K54A 4CQEA 3GC7A 4DG3E 2J0JA 3PY1A 4CMTA 3VS3A 3ZKJC 4FIHA 2WQMA 5BYZA 5T6KA 2BIYA 1VD2A 4DCEA 4ERWA 4CD0A 2M8SA 3FMJA 4HVBA 3EHVA 2UVYA 3E8CA 2JFLA 3O17A 3DV3A 4YO6A 3QRJA 3TCAA 2KX3A 2RD0A 4W8DA 5CI6A 5JKGA 1WX7A 3AC8A 2RF9A 3CGFA 4L9IA 4GDLB 3DVNV 2LGCA 4RJ8A 4EKUA 3S2PA 5D7AA 1Q62A 4D5HA 1LUFA 5HNIX 2WYQA 3RUIB 2J0IA 3MFRA 3EZRA 3OZ6A 3WILA 3IGOA 4F4PA 2OJIA 3AU5A 3E8EA 3COMA 4MKCA 2LVQA 2OH0E 3ZSIA 2ONLC 3FLWA 4F7NA 3LJ1A 5AP5A 1E5WA 4ZRKA 4D4SA 1WGYA 2W99B 3WOWA 4Q5EA 3APDA 4N9F4 1YWVA 4PPAA 5FWKK 2LGXA 4DBGA 4BDFA 4FYOA 1QL6A 4O38A 2C0OA 2NBWB 4PTEA 4YZ9A 4XRLA 2Z59B 3MTNB 4H3BA 3F7WA 3VBYA 4S33A 3VRZA 5KMJA 2DYMA 2JBOA 4QTAA 2QOLA 3R9HA 4J8NA 4BDCA 4AGUA 4M12A 4IWOA 3E3BX 3GB2A 4FTKA 1ZYSA 1UNHA 3CD8A 3VQUA 5I9WA 3DKGA 4NTTA 3L9NA 1LEZA 2J0MB 3BYVA 4NZWB 4WHZA 5DT4A 3EN9A 1VZOA 4F7SA 2KK8A 4W9JA 2B9IA 5F95A 1DAYA 1B38A 3AQVA 2CS4A 3MA6A 2W4KA 4S34A 3QQFA 4IWDA 3ZLSA 1XH6A 4D58A 4F0IA 2JBPA 4FT7A 4LGHA 4OTGA 4P4CA 5DT3A 4C7TA 4MXAA 3E8DA 3QLGA 4FV6A 3C0GA 4UBAA 3B08A 4LDTD 2QHNA 4APPA 3PXZA 4AQCA 4WBBB 5M57A 4EUTA 5KZIA 3SHQA 4DFLA 4F08A 5KX8A 4FTNA 3DOWA 4EZLA 3UE4A 4WG4A 1SIFA 3NDMA 4EQUA 5HNGA 3VBTA 2UZNA 2QNJA 4QRCA 1ZYDA 3BHYA 4AP7A 3SDLC 2O5KA 1W7HA 3WZUA 3D32A 2J50A 4HGTA 3VJNA 4HXDA 3P7AA 2NRUA 3LCTA 3LPBA 1RRBA 4AGDA 4MQ1A 3AOXA 3MTLA 4BDJA 5AAGA 4G3DA 5J95A 3R7IA 3PVGA 2XK9A 3VTVA 4GL9A 4MGYE 3DVGX 2WU7A 4NM3A 2DYLA 3WF5A 3D83A 1OUKA 3IW6A 4YJSA 1UELA 2OZAB 2JVCA 3F3UA 4EH9A 2C3JA 2H34A 3DXNA 3UYTA 3CP9A 3EWHA 4O2ZA 2ZOQA 2KTFA 5J5TA 4MH7A 4X3JA 4KV2A 4CLIA 3FKNA 4C4IA 5JN2A 4AJYB 3D7TA 3JYUA 3GI3A 3KMUA 4WG5A 4CYIA 4AT4A 5HVYA 3MYGA 2W96B 2KC2A 4GW8A 5EI8A 4EWHA 2CHWA 3TMPB 5LMAA 2FIDA 4WQOB 2NRYA 3QIJA 1JQHA 5EG3A 3FI2A 3VS2A 5LCKA 2JIUA 3QWJA 3UQGA 4C37A 4YJRA 5JFSA 4HPMB 4FR4A 4YO4A 4IB3A 3U9CA 4ACCA 4BN1A 4RWLA 3BBTB 1WMHA 2RFSA 2BRMA 3W32A 2GNLA 2YM5A 5CENA 3PLSA 3WZKA 2RGPA 2VX0A 3OC1A 3UZPA 3ZCLA 4DINA 1Z2MA 4H58A 4EOLA 2C1AA 3DCGA 1ZY5A 2MRPA 4AZVA 4X3FC 2J5EA 2OXXA 3EQBA 4M15A 4AZWA 4KSKC 3DLSA 2UZEA 5HLPA 4XP0A 4D9UA 2OJJA 2XJ0A 3V61A 2FGIA 4U6RA 4GT4A 5K4IA 3AC1A 3LQ5A 3OROA 5BVWA 1ZOHA 5HU9A 5CHWA 2XCKA 3ML9A 1YX5B 2OXDA 4LUEA 4OW8A 5CSWA 2GSFA 1WGDA 2WX0A 4MGZE 5AP4A 5J18A 2WMXA 4FSTA 4G16A 4L3PA 1SM2A 4K2RA 4O1OA 2BUJA 3ODYX 4BCOA 3V62A 4GMYA 4HVHA 3JY9A 3C13A 2JAMA 3FPMA 4UMTA 4FG7A 1WXAA 2A19B 2OJ9A 4Y83A 2BZJA 4L53A 3W2OA 3SXRA 1ZY4A 3UIUA 4ONAA 4WNKA 4D1XA 4M8NA 1F3MC 1UU9A 2HAKA 1KOAA 4HGSA 4IZ7A 4HDOA 4XZ4A 2YHVA 2C6EA 2WMAA 2P2IA 3UINB 4XMOA 2YIWA 4FIJA 5I5ZA 1V6EA 3V6CB 3MFUA 2FUHB 4C33A 2WTKB 3TJDA 3RYTA 2UW7A 3AC2A 2C3KA 1BL6A 3BYSA 3AXCA 5AEKB 3JXWA 3I0OA 3DBFA 4ZOGA 4RVMA 4FA6A 5CALA 2HZ0A 2YAKA 3KN5A 4L46A 4YPSA 5E1SA 4JJRA 3SXSA 3VUKA 4RIWB 2L0FA 2IBIB 4FADA 5BVNA 5JQ5A 5KMKA 4MXXA 1BMKA 1QCFA 2GNIA 2ITTA 1OKVA 2WMRA 4CT1A 3A62A 5DMZA 2KLCA 4FN2A 1JKLA 2E9PA 4PTCA 3T9LA 2E9NA 4XNEA 4AN9A 3II5A 4OBOA 3TKHA 5C27A 5EKOA 3WARA 4C0TA 5IA0A 3VJOA 3W8LA 3U6HA 2JY6A 4MX9A 4QNYA 4TXCA 4JI9A 3FXXA 2BTSA 1E1XA 1VJYA 3TUBA 2QOIA 3M63B 3HMOA 1CM8A 5AR5A 4RM8A 3COIA 1JSTA 4HPTE 1U5QA 5BVDA 4DK5A 3DKOA 4MEDA 3R28A 4NW6A 3C7QA 5E1EA 5C8MA 3VF9A 2RGFA 4JIKA 2L3ZA 4FSYA 3QBNA 2CN8A 3GGFA 4ASZA 3E5AA 4W9EA 4WNOA 1LQBA 4I24A 4KKGA 1OUYA 3F66A 3P5KA 2RPQA 3FSKA 4JBOA 3U4WA 4FNXA 4U7ZA 5HGIA 4ZZNA 3I5NA 3TL5A 3PA3A 3RKBA 2OG8A 3V8SA 4C2VA 3LXPA 2UW5A 2YJSA 1GC6A 3S0OA 4KS7A 1ZKHA 3VTUA 3PWDA 5H8GA 3QZHA 5CNNA 3OFMA 3R21A 1Q8UA 2P0CA 3EQHA 4HNFA 3E8NA 2BIKB 2PTKA 5AZFA 3KKVA 3RBWA 4DYMA 4XC2A 4A20A 3OXTA 4UZDA 3G9LX 5HIDA 2QQ7A 1YI3A 2JDVA 3O8PA 4RJ6A 4E20A 4NCTA 1GZKA 2BWES 4FKUA 4NM5A 2HWPA 4L8MA 2P4IA 5AMNA 4ZTSA 2KNBA 4BGQA 5CVHA 2QHMA 4Z7GA 1URCA 3LOKA 4LL0A 2RSUA 4C2WA 5HCYA 5CVGA 3ZLYA 4JR3A 1C3TA 1Y57A 4C58A 4BTMA 3R7GA 3GFEA 2WNTA 4KIKA 5D12A 4BHZA 3H7SA 3RCZA 1KLVA 4FTIA 3CPBA 3DBQA 3ORMA 3PZEA 3Q6WA 4GUBA 4QMWA 4OR5A 4RWKA 2Z0EB 4RFYA 4QMMA 2LRWA 2JLDA 4X57B 3POOA 4FTAA 5CEQA 2XNMA 3PJ2A 4B4LA 2VWBA 5FM2A 3UC3A 4GSWA 4B6LA 3C0IA 5T3QA 2GNFA 2WOUA 2ZB0A 4Z7HA 2VTHA 4IVBA 5JGAA 2BHHA 1R4MI 2EMSA 3TZMA 1J1BA 5CAVA 3UTOA 4AT3A 3VUTA 4DHZB 4G5JA 3CBLA 4LYNA 3ULZA 3UOHA 5HICA 4W9FA 3R63A 4NCTC 3ZH8A 3DQWA 4M84A 3UIBA 3R04A 2V0DA 3GU4A 3GVUA 5L3AA 1W84A 2GNGA 2VTLA 3MIAA 3ORXA 2N9XA 5LQFA 2M1MA 1YXVA 4G3GA 4RA5A 4LQMA 1C1YB 2MBEA 5D94A 2C6LA 4XLIA 3VUIA 5HVKA 3NHEB 5KHQA 4I3ZA 1Q3DA 2ETMA 4IZAA 4CXAA 3DDQA 3HMMA 4IM2A 1URWA 4TWPA 2QOCA 5CASA 3QCYA 4O0SA 2PE2A 2Z0DB 4G0NB 3QQGA 3K2LA 3VH3B 2X6DA 4JIAA 2EMTA 3OWLA 4DEHA 1JKTA 4I23A 2UZTA 4OTPA 4AAAA 2WTCA 4RJ5A 5ANKA 2NBVB 2UZLA 4NIFA 5KE0A 3BLQA 4RZVA 4W9DA 4GV1A 2XH5A 3ZNGC 3C4WA 1RAXA 4MGIE 2YDKA 1SMHA 2B7AA 2CLQA 3VBWA 2PPHA 5BMMA 4UX9A 5D7VA 3ZNID 4XYFA 3UPZA 4G11A 3WIMA 4HOKA 4ASDA 3PJ1A 4K7WA 2JXXA 5J79A 2WTWA 3I6WA 5HBEA 4KINA 3ROCA 4CSVA 5C1QB 2YDIA 4C57A 2CHZA 4H3QA 1QPDA 3DAEA 4G3XB 3W10A 4X6RA 1H1RA 3O50A 4RPVA 3S95A 3NYVA 4B9KA 4PMTA 1MRYA 3QZGA 2R7BA 3DJ6A 5HE3A 3AULA 2Y6MA 2XEZA 3QUPA 3DGKA 4AZEA 2UW8A 3JSVA 2XCHA 5KO1A 4DH1A 2EXEA 3EOCA 3QTXA 3QWZB 2XA4A 3LCOA 1OI9A 2R4BA 2OWBA 4E4NA 2QR8A 4DEGA 4FJZA 2VTAA 1M2RA 3FQSA 4BFMA 5IA3A 5JRSA 2IZSA 4F8CB 4XG8A 1VEBA 2KULA 3C4EA 5CS6A 3ACKA 4BGHA 3WYYA 3AGMA 4U3YA 2B9JA 4EOQA 4BI2A 3KRWA 3LFDA 3Q4ZA 1UNGA 4J6IA 3VRYA 5AR3A 2F57A 4DH7A 4MVFA 3ANQA 3DDPA 4E26A 4GIVA 4C3FA 4M14A 3TTIA 2XNEA 2QHOA 4KIPA 2OGVA 4MD8E 2C5NA 5AUVA 1J3HA 4MBJA 4QP8A 3W2SA 3C4FA 2LVOA 5FD2A 1PKGA 2PVHA 1J8CA 4QD6A 3TACA 3ZLZA 4BI0A 4UV0A 1Q8TA 5E8SA 5J9LA 4EKLA 5I0BA 4IACA 2RFEA 4CKIA 3A7FA 4PDPA 4AGWA 4D2WA 3KUDB 3MH0A 2VNYA 4I20A 3VULA 2PMNX 2QODA 5DI1A 2M0XA 1NY3A 4M69A 2XKFA 5CEIA 4C36A 4J99A 2JITA 2K8HA 1YXXA 5G2NA 5HG9A 3K5UA 4FT9A 4JX7A 4ACHA 5HORA 1UU3A 2WEVA 3MH3A 3ENHA 4F9AA 3ZTDA 2JZZA 4ZY6A 4TUUA 5EM8A 3ZNHB 1QPJA 2XK8A 4PRJA 4RX8A 3VDZA 3A33B 3CPCA 3SRVA 2G4DB 3LFSA 4C35A 2WOTA 2BRBA 1MG8A 5EHLA 4OAVB 3G51A 5LXHA 2AYOB 2L00B 4UN0C 3LFBA 1WY8A 4HDQA 1L3RE 1MQ4A 3H7PB 5LMKC 4D2SA 3CKWA 3MVMA 4W4VA 3PTGA 4RIWA 5BX0A 2X2LA 5ANGA 2ZM1A 4CFVA 2NS5A 5L83A 3BWJA 1PXMA 3OCGA 4O0VA 3BV2A 4XP3A 3LW0A 4DGNA 5C9CA 3B8QA 2KWCA 4GFMA 5KBRA 4JIOU 2PZ5A 5LCJA 2O63A 4YZBA 1WBOA 3NUNA 4QMLA 4AOFA 3IG7A 1MUOA 2G2FA 2RG6A 5ANDA 2C47A 2VTMA 1S1QB 2W5HA 3IQ7A 4AF3A 3VBQA 3MVLA 5T68A 2X1NA 2R64A 2P55A 4KSLC 3DT1A 4FODA 3SW7A 2K6DB 2PK9A 3MB7A 3NOBA 1Q8ZA 3D2KA 4IDVA 2R3HA 2Y6OA 4H3PA 4TWNA 1KJTA 2GBMA 2VTIA 3C4XA 2YISA 4AFEA 2ZEQA 5JQ8A 3HGKA 3TZ9A 3R1SA 4O6LA 3PG1A 3KW5B 3KK8A 4W9LA 5ETCA 4EL9A 2LVPA 2IVTA 5DLSA 4ZTLA 1WVYA 4KDIC 4IJ9A 4ZJIA 2R0IA 2YIYA 3UVPA 1U4DA 2F9GA 4ACMA 2C5XA 4LL5A 4UWBA 4CHKA 2BVAA 4C38A 2O2VA 3PRPB 3O2MA 1OPKA 4CFNA 4E74A 3K3IA 4HYIA 3C4CA 4GUEA 3UG1A 4FBXA 3DAKA 2JEDA 2CGVA 3A4SC 3KRLA 3QHTA 3FZRA 4ZRJA 4QMNA 4YUQA 3MH1A 3W1SC 4GXBA 4CZUA 3ZYAA 4M0WB 2VO3A 2W5AA 4IX4A 3MTFA 5BVKA 3IG3A 4PL4A 2FSLX 2YM6A 4Q5HA 1H8FA 4BWXA 4K1RB 4LRMA 1CKJA 4USFA 3CTHA 2ZVAA 4EJNA 4YJQA 3DK6A 3QCQA 4D9TA 4WNPA 3CSTA 2HK5A 4KD1A 4PPCA 4USDA 5HD7A 4OTFA 4X2NA 5M55A 1WH3A 1WAKA 1H24A 3PJ3A 1XQQA 5F4NA 2WMVA 4J97A 3L8PA 2AUHA 4BZDA 2KDFB 4FV1A 3WF8A 3S4QA 5E8TA 4D0XA 1YQJA 5AX9A 3FXZA 5A3XA 4BIDA 3W55A 4RJ3A 3UPXA 1P3QU 1JWHA 5KKRC 3ZFMA 4IX3A 2IZRA 5J17A 1B39A 3QGYA 2FSMX 3U4UA 3CEKA 5TT7A 3LE6A 4FG8A 3VUHA 2WIPA 2DZKA 2MLBA 3OJ4B 3C0HA 4KRCA 1LXDA 3KK9A 1XR1A 3H10A 2KJ6A 1ZAOA 4MF0A 3AGLA 4AA5A 3JSVB 2YCFA 3ZOSA 1BX6A 4FSUA 4GG5A 4P7EA 1T46A 5A4TA 5CF6A 3I4BA 1SVGA 2KD0A 3KULA 1KSWA 3MFSA 4H39A 4BF2A 2K1FA 5IU2A 3H0ZA 4FK6A 3G0FA 3H9FA 1QPEA 4QMPA 4XCUA 1V9JA 2K25A 5I9ZA 3F88A 3LJ2A 3QF9A 3WA0A 4MYGA 4ZSLA 3TUDA 3LXNA 2R3NA 3PG3A 3U7DA 3SOAA 1WVXA 3OS3A 4QMXA 2QURA 2X8DA 4PUZA 2G01A 1FXTB 4KBKA 3GC9A 3BPRA 1OL6A 5CEMA 2ZAZA 3EL7A 5HLNA 2AWTA 2BGFA 2LD9A 3PVLA 3IOPA 2R5TA 1Z9XA 4BVUA 3T9IA 3MJ1A 4E93A 1YJ1A 4WJOA 2L05A 1HE8A 1Q1OA 2BRGA 3CS9A 2EKEC 3WF7A 2J0MA 3OJ3A 4NAWB 2WB8A 4M69B 5FLFA 3UP2A 4CTBA 4D4RA 4IG7B 3QTIA 1OKYA 2ZPYA 2BTRA 2KTYA 2OI4X 4IB5A 4IZ5A 4JDJA 1SVEA 1YHSA 3Q3JA 3UIMA 3AU4A 4LJOB 3JVRA 3W1YA 2VRXA 5J87A 4TNDA 3T3VA 4FJVB 5GZ8A 4FF8A 4W4WA 1LM8B 3NNXA 2I0YA 2JIVA 4NKSA 4O91A 4QO9A 2PE9A 3P2BA 4G3FA 3FZSA 2E9OA 5B7VA 3PZDA 1Y6AA 4YGAA 3N3KB 5HKHA 3HECA 1RDQE 4TTHB 2GFCA 4AW1A 4CFFA 3U8WA 2PZIA 1S9JA 3CD3A 3KY2A 4FJYA 4Q2AA 5IEXA 1SVHA 4RJ4A 2OW3A 5D9HA 4BBMA 2KJRA 5K0XA 1BL7A 1O6YA 1Z5SB 4I0SA 1U54A 2GBNA 3PA5A 5E8UA 2IZVB 5AM7A 2X8IA 2QO7A 3FLSA 3KRXA 2ZZPB 3ZXTA 4NJ6A 1OKZA 4N6YA 3TNWA 2XK5B 3ROYA 4R1VA 3V8TA 4NH1A 5K4JA 2GHGA 2W1FA 3ORZA 3GQIA 1H4LA 5BYYA 3A4RA 3D7TB 5EHYA 5JHAA 3HMNA 1XBCA 2CR5A 3PVBA 1J19A 4R8QA 3Q6UA 1WE7A 4TZRA 4EOPA 3QD0A 1GJOA 2WMQA 2WMSA 2XF0A 2ZDUA 4LOQA 4MNEA 3V5LA 3LHJA 2C9WB 2D11A 4KZ0A 4J53A 2V62A 1H28A 2B4SB 1E9HA 2Q0BA 4G3EA 4NEUA 3VS5A 1PMNA 5DBXA 2KVRA 2JC6A 4JRVA 4QPSA 3V3VA 3VVHA 2J0LA 1H4RA 2X4ZA 2R3PA 2C7HA 3O8UA 3R7RA 3M2WA 5AADA 4YPDA 3ZEPA 3QLFA 3R8PA 2UZUE 5AA9A 5FDPA 3AT4A 2WKMA 4FV9A 1ZYLA 3G33A 1OITA 4L7SA 3A4PA 5CZHA 1P4FA 4C59A 3QK0A 3UYSA 3KQ7A 3D9VA 1GZ8A 2WQOA 3Q4TA 4DEBA 1UD7A 2KKCA 3BV3A 1LEWA 3R30A 4U41A 5A14A 2JWZA 2K6QA 3OBJA 3R1YA 1SE9A 3ZFYA 1P0RA 2W5BA 3QRTA 4E4MA 1A06A 1V49A 1TBEA 4BYIA 5ETIA 5HO8A 3KYDD 3ZUNA 4BWPA 5DR9A 3KUCB 3H30A 5K9IA 3W1SA 3UOJA 1DI9A 4K1BA 1TZ1A 2W4JA 2PMOX 4AN2A 1XHAA 3KMWA 3T8MA 5TKDA 3ALBA 3E64A 1JSUA 3SDJA 3HV7A 2UZOA 4HCVA 5IEVA 1IYFA 1WBTA 1O6KA 4UB7A 4G31A 4XJ0A 4FKJA 3P4KA 3QRUA 2QOKA 1LFDA 4AP4C 3K9PB 4GYIA 4KKEA 2ITPA 3KGAA 4IVAA 4TY1A 1OGUA 2R7IA 4TT7A 4AOJA 2DENB 4IHPA 5FR6A 3VXWA 3E3PA 2QG5A 1IG1A 4O21A 4PF4A 3KEXA 4PNKA 1WXVA 4E8AA 4OUCA 2KWUB 4FIGA 2W0JA 5E7RA 5I9XA 4WSYA 2W9ZB 3MY5A 4UYAA 4AA0A 4ZAUA 1NVRA 5CI7A 3MIYA 2UWQA 3OTUA 3DFCB 5L6PA 2YM8A 1WJ4A 5ANEA 5CXZA 2AC5A 4DGLC 3ITZA 1WBPA 4I92A 4PNIA 4XG4A 5BVOA 1Q4LA 4FL3A 3BEAA 3F5GA 4EZ3A 3POZA 2JF5A 3IO7A 3IKAA 3QXPA 2IN6A 2OU7A 2ITZA 4IQ6A 3TCPA 4EQMA 2WEIA 3DY7A 4L3LA 5A4CA 5JFVA 5JMSA 3RPOA 1UU7A 1F9JA 2BFYA 4GYGA 2OXYA 2JZ3B 4FBJB 4FKQA 3BI6A 2V4LA 3PT2B 5AV1A 3ZONA 3G2FA 2VO7A 3HKOA 4X2GA 3GOEA 2VNWA 2XM9A 5GJFA 4EHEA 4ZZMA 2ZCBA 4FOCA 3V04A 2K39A 2FVDA 5DPSA 1I44A 2ZDTA 3OF0A 4E3CA 4KIOA 4D1SA 4G50A 4FKOA 1KV2A 3BU5A 1ZRZA 1RE8A 4KDLB 5AR2A 2PE1A 4JBPA 5L8JA 1E1VA 5F20A 4ZY5A 4CLJA 4BB4A 4MEMA 3DBEA 4P5ZA 5C01A 1BI7A 4K18A 4ITHA 4DHFA 2NVUI 2VWVA 4L67A 4II2B 4XX5A 4J96A 2BAJA 4XX9A 3RALA 4EK6A 2WZJA 5IF1A 3E63A 3I5ZA 2W1EA 4A4XA 3UNZA 4BZNA 4EH6A 3KC3A 4MQ2A 5EYKA 1M94A 2G3QB 4R3RA 1PMUA 4K77A 3V6RA 1NI2A 3P1AA 3LVPA 3MVHA 3PA4A 3TNHA 3APFA 1OZ1A 1KE9A 1M7NA 2PZPA 4YJOA 2WMUA 2KMCA 3F2AA 3KL8A 1PMVA 3PUPA 3IHPC 3HHMA 3BHUA 3Q3FA 4JAJA 1KE5A 3F69A 4NU1A 2BYFA 5HVJA 4BIEA 5AZGA 1JAMA 2WFYA 1ZMUA 2X2KA 3QX4A 4V05A 1TGZB 2XEWA 4A07A 4AE6A 4F63A 3ALNA 5HBHA 1V0OA 2HY0A 4FUXA 2RKUA 5DGZA 3VUGA 3PPKA 4BICA 1GZOA 4P90A 3V5TA 5B2KA 5CU2A 3P08A 2OSCA 4I5MA 4NT4A 5HE1A 2KFKA 4JS8A 5JRQA 4C4EA 2MBHA 3GU5A 4QYHA 3LM5A 3C0RB 5TE0A 4MSMB 4ANUA 2W4OA 3MB6A 4L68A 1I35A 1WMHB 4S30A 2B9FA 5BMSA 2QLQA 3IW5A 2XS0A 4HGLA 3JUHA 1BUHA 2B9HA 3N9XA 3RM7A 3R66C 3MPTA 2OICA 2REIA 3RVGA 4MSQB 2IY1B 1JKKA 3D7ZA 4RIYB 5M53A 3TN8A 4EZKA 4FIFA 3QJZA 5BPYA 4DH3A 3NSZA 5GZ9A 5HQ0A 4BDGA 4J98A 4WRSA 3GU7A 3QYZA 4AXAA 4DFNA 4PTGA 4NM7A 5CY3A 2J90A 4W9GA 5ETFA 1YXSA 3WIKA 5D6JB 2PVJA 3HZTA 3V51A 3KB7A 1GJZA 4K6ZA 4LOPA 4TRLA 5EDQA 3O71A 3HP2A 4A06A 4J7BA 3VS1A 2OF4A 4EOYA 3HDMA 3KRJA 3SLSA 4GMVA 4MXCA 4YJPA 4EH8A 3KXGA 4FHJA 2Y4PA 4I1ZA 5EDRA 1M2QA 1IP9A 3HA6A 1DM2A 1E8XA 2C5VA 2M4NA 1R78A 4C61A 1SYKA 2ZMCA 2ZNVB 2NP8A 2R2OA 2BR1A 4EH3A 4R5SA 1PXKA 2ITNA 2XIXA 2DQ7X 3X0WA 2R9SA 5CWZA 3I0QA 2MA9B 3QCXA 1FOTA 4XG2A 3U51A 3DBDA 3W2RA 2BRHA 3W33A 2CKEA 2IO6A 3WAOA 5AAFA 4I5PA 5CU3A 3UOKA 4CV8A 3R8VA 3F6XA 2HJ8A 1SNUA 2IO3B 3U30A 2BDJA 2XYNA 5HG5A 2F49A 3RPVA 1WZ0A 1MP8A 3KF7A 1NVSA 4OTIA 3ZFXA 5AZHA 2GS7A 2VGPA 5EFQA 4AUQC 3EN5A 5DE2A 4HYUA 2RSVA 2NPTA 4QMUA 2I1JA 1FVRA 2PHKA 2R3QA 4MJSA 5TO8A 5HHWA 3SV0A 3NPCA 3B8RA 5J1WA 4WJPA 2UZVA 4ANMA 3BGPA 4BHNA 4FV5A 2ITYA 4GFOA 4ANLA 2W9NA 3O0GA 1RFAA 3NW7A 5DWRA 5E8WA 3KXMA 1YI4A 3PXYA 4FICA 5FEEA 4D2RA 4QMQA 2D3GA 1D3ZA 2IZUA 4FIEA 4GG7A 3QWKA 4JQ8A 3EL8A 4U80A 3UG2A 5AAEA 3CE3A 2JGZA 2N9EB 4FNZA 4FL2A 3LJ3A 4Y73A 3EQCA 4K11A 5L4QA 4YNOA 3GCUA 1WFYA 4XHKB 3FKLA 3MFTA 1PXJA 4IAYA 4K33A 4YLKA 4E6QA 1JRUA 4HLEA 2VX3A 3NZSA 1H1WA 5AV0A 3EQDA 1KOTA 2NBUA 4BKTA 2WTIA 4HWIB 3QHRA 3ORIA 3NUPA 2KHWB 3A7IA 3BLHA 3GU6A 2O64A 3F5UA 1Y91A 1GOLA 3QA8A 4U8ZA 5L2TA 5JT2A 4R3PA 2XK6A 3B2TA 3EN6A 3RAWA 3UQCA 3ZZEA 3A1QB 4JX3A 3ML8A 4FOBA 3DPKA 4M68A 1BLXA 1GY3A 4EOMA 4RM9A 3NAXA 2Z7QA 5EOLA 4ZEGA 4HPUE 3PIZA 3BQRA 1UH6A 4G2FA 4EH5A 3DK7A 2F7XE 4ZIMA 3KVXA 3HRCA 1E8WA 2CU1A 2C4GA 3SOCA 3TG1A 3BU6A 4YZNA 1XH5A 5A46A 1SZMA 3UIOB 4TWOA 3UMXA 5M4FA 4EBVA 2KQ7A 4U0IA 4GGQA 3VH4B 2AL3A 1DAWA 4FTUA 2N4FA 1ZXEA 2HXLA 3A4OX 2DZMA 3HDNA 1HCKA 3QQKA 4DH8A 3CY3A 2R3OA 2X7GA 4YR8A 4BBNC 3VNTA 3SKCA 5D2MB 1ZARA 3OHTA 3H7PA 3BZ3A 1PY5A 4Z55A 1RLFA 2XVDA 3U6IA 2KOXA 5L8KA 3TL8A 3KA0A 5KHWA 3HUBA 4I6QA 5DA3A 5FBOA 4BDBA 1X1MA 4EOIA 2B3AA 2VAGA 4JDKA 3BIZA 1U5RA 1XJDA 3VHKA 1L7YA 1WR1A 1X8BA 4QMSA 4QPMA 1OTRB 1OGWA 2YJRA 4HGEA 1K2PA 5GMVA 2LRUA 3LFNA 4ZJVA 2C68A 4F9WA 5CTPA 5IUGA 4NY0A 5LVNA 4Z9LA 2KFKB 4XBRA 5KMLA 4I6NB 5HI2A 2HOGA 3GFWA 3WBLA 5IH6A 2N7EA 4MJSB 5IPJA 4E1ZA 2I1KA 3Q4CA 4OBPA 3ZM4A 1UZXB 4GSBA 3A7HA 3ZTXA 4ICUA 3R02A 4NQLB 4TN6A 3FMDA 3CKXA 3GCPA 4V01A 5EI6A 2MP2A 3KFAA 1S3SG 2MBQA 2N1VA 3CJGA 1BT0A 3EZVA 2ZB1A 3FMNA 2GFSA 3F5XA 2W1IA 2WPAA 3RWQA 3I60A 4L44A 3RK5A 2YVCA 1ZZLA 3P79A 4PMMA 1A5RA 2YLMA 1RW8A 2IJMA 3M42A 4WUNA 4CMUA 3O65B 4QNAA 2RG5A 3ZC6A 4JG6A 1G3NA 1KV1A 4HJKA 3COHA 3IVFA 4DFZE 3UGCA 4U45A 3IS5A 4QMVA 4K0YA 5ANIA 3LM0A 4OVUA 2WQEA 3V5PA 2XUUA 1W8CA 2BZHB 4QQTA 2KMAA 3X23A 4M8TA 4N70A 4UWYA 3PVUA 2JD5A 4X3FB 3PRMB 1W98A 4XS2A 3GP0A 4W9IA 2HY81 3DB8A 2I0VA 2OZAA 5GJGA 3V6EB 2HYYA 3VS7A 5BQ0A 3G0EA 3A9KB 2R3KA 5LMKA 4QMYA 3ORTA 5EH0A 1YVJA 2C6OA 3DQXA 1H27A 2WMWA 4UMQA 3WI6A 3TV4A 4DFYA 3NX8A 4MWHA 5DHJA 3R7YA 3P23A 5CEKA 3D94A 2QOFA 2Y5BB 1V5OA 4LJPB 4ZDVA 4MBLA 4PL5A 2VWWA 2W06A 2O0UA 3RK7A 4EH2A 5E8XA 3JYAA 3T8OA 3BHVA 3UBDA 2OJRA 2KFJA 1M52A 3D5UA 2ASQA 3QC9A 1OEYA 5EW3A 1Q8YA 4NJ7A 3OT8A 2YN8A 5JHBA 3JVSA 3PRZA 3VUWA 2UZWE 3CXWA 3PP0A 5D7GA 4I93A 2YCRA 3D5VA 4WWNA 2GNJA 2F7EE 3DTCA 3A9JA 3D5WA 5L8LA 1Q8WA 5CLPA 2KJHB 2YAAA 1E8YA 3VIDA 3QTQA 2H96A 2OIQA 4DLJA 5CAOA 2KANA 5CT7A 2GS6A 2IW6A 2OIDA 4LOOA 4CFXA 1MRUA 5AP6A 4F7LA 5IUHA 1PQSA 2C7NB 3IECA 5JZJA 1J1CA 5LLIA 4YSMA 2GHLA 1JVPP 3FY0A 4OTQA 5J2RA 2VWZA 3CIKA 2H8HA 4U5JA 4CFWA 4HPLB 5FRIA 3ULIA 4IUMB 3P7BA 3FLNC 4RGJA 5L2WA 3E62A 4MD7E 5HE0A 4FVQA 4YTCA 3CQUA 3HV4A 1FGKA 1YXTA 4IM3A 2QKRA 3QRIA 3BU3A 3IDPA 5TR6A 4BBNF 2PWLA 3ET7A 2ZM4A 1XH7A 4I6BA 4EWQA 4CO7A 3VAPA 5J5SA 5HOAA 4ACDA 5AUYA 2FSOX 4TL0A 5HCXA 3L0WB 5FG8A 4GOCA 2VN9A 1R0PA 3TIYA 4Y5HA 2GCDA 2GQGA 4QP1A 4AGCA 5CNOA 2HZ4A 3QALE 3UO6A 2W17A 4CFUA 2N9PC 2UZDA 1H08A 3RAIA 3SAYA 3I7CA 3E7OA 3QHWA 3H9OA 4GVAA 5KHXA 3PY0A 3NYOA 1P5EA 1SGHA 5CF8A 5E6OA 2XNPA 5EM5A 1G5SA 4C62A 3QAME 4ICVA 4HW7A 4EOJA 3DDCB 4BCHA 4BCKA 3ZRFA 3HUCA 4V0GA 2GOWA 3UC4A 1RQQA 2OKRA 1JBPE 2PJHA 4RBLA 2W1GA 4QQ5A 4EOKA 3PE2A 3HV6A 4BI1A 3S00A 3WAPA 3CF6E 4FVPA 1ZZ2A 2LXCA 3LXLA 4DHJB 5H9BA 4GT3A 1F0QA 2B55A 2W9FB 3AT3A 4IFGA 4KIQA 2BCJA 4NM0A 2OO8X 2XRWA 4RQVA 4EC8A 5CF4A 3QQ8B 4CRSA 5E6PA 3NZ0A 4LUDA 4YTHA 3FPQA 3ZU7A 5LVOA 3AMBA 2KC1A 1QPCA 1W83A 4DITA 5M44A 4EBWA 3U8ZA 5D10A 3W1FA 1PXPA 3PSCA 4P2KA 4DG0E 2CJMA 3RZWC 4FZ6A 4WUAA 4A9SA 2ZJDA 4FEQA 4GK3A 4NFNA 2P2HA 4QP2A 4EONA 3UOLA 1PHKA 2KQSA 4FZ7A 1YHVA 5H8BA 5L2SA 4CTCA 1ZYJA 3NUXA 2FB8A 2I6LA 5HTBA 4YHTA 5CSHA 3LFQA 2EUFB 4YSJA 2OIBA 5CEOA 4I6FA 3ZIMA 1UBIA 2PVNA 3OCBA 5EW9A 1GIJA 3RGFA 1UV5A 3TI1A 3ZSGA 4FTRA 4PL3A 3K5VA 4JRNA 5FQDC 5HCZA 2G2IA 4TYHB 2P3GX 2MQJA 3EMGA 2XMYA 2J51A 2GMXA 2VZ6A 2YIXA 3AMYA 4TW9A 4RC3A 5CSVA 4HVIA 1WZ3A 3O7LB 2D10A 3PS6A 5FTOA 3A7GA 3PXQA 4IBMA 4WWOA 4TQ0A 2UVZA 2PZRA 3D2IA 4XG6A 3QXOA 1YXUA 4GU9A 4CQGA 1XD3B 4D4VA 4YLLA 2C6MA 3UIXA 4FK3A 3HV5A 4NKAA 5E8YA 3AG9A 1YOJA 2V5QA 1T45A 3ZO4A 4KSPA 1WX9A 2CN5A 3OD6X 4RX5A 5BUEA 4M0ZA 1YWNA 3DA6A 4AOTA 1GAGA 4AZTA 5IG1A 2YFXA 3W2CA 3FLQA 4TNBA 4XV2A 1ERKA 3WF9A 1YQBA 3M3JA 3PTFC 3EFWA 2PSQA 3DBHI 2W7XA 2Z60A 3UODA
chains in the Genus database with same CATH superfamily
3MBLA 2FCQA 3F3VA 2VUWA 3QTRA 5AR4A 2YDJA 4IKGA 3E87A 2VO0A 2V7AA 3URYA 3RNAC 4ZZOA 5L95C 4UZHA 3TKIA 4OT5A 4R7IA 2C1BA 5IDNA 2QCSA 3TT0A 2BT6A 2QU5A 2L7RA 4RRVA 3GU8A 3DKCA 3OOGA 4AOIA 3QC4A 1LR4A 3K9OB 3GCQA 4B99A 1I42A 1SE4A 4AW5A 1H00A 3DBLI 4XG7A 3VW8A 3QD2B 3LQ8A 3TJPA 4D5KA 4FT0A 4BCFA 4FSRA 4PDSA 4IMYA 2XKCA 3DHGC 5E6NA 4CZTA 2MX2A 3FI4A 2QD9A 5AP1A 3PY3A 3IT6B 3UO5A 1Q3WA 1XBAA 2CGWA 5AUTA 1NVQA 2J4ZA 2D07B 3NCZA 4IC7B 3LDZE 3DJ5A 2FCMA 3NVZA 5CT0A 1XLNA 4PS3A 4FA2A 4IWQA 3IDBA 4ZSGA 2IW9A 1JALA 2F7ZE 4E71A 2G15A 2HTHA 2O2VB 1IA8A 2BYVE 3OY1A 3IW8A 4L6QA 3ORKA 3WF6A 2J4XA 5HU3A 3W8QA 3VW6A 3IK3A 4RWJA 4FT3A 4G9CA 4B6WA 3KMMA 2HZNA 1K9AA 2DYOA 3OBGA 4IWPA 2GBKA 2V3PA 2G9XA 4BCGA 4P1BC 2B52A 2K0PA 4NSTA 3R8LA 4K81A 3EQRA 3NS8A 5K0KA 5A9UA 3FQEA 1M14A 5DPRA 4EH7A 4XH6A 2HD5B 5L6OA 4QMOA 5KNJA 3AV8A 2VV9A 3FV8A 2GTNA 2I1MA 3V01A 3PSDA 4NJDA 2ZV7A 2IVVA 1E8ZA 1TS4A 1QOBA 3N32A 1Y8GA 3EFLA 2Y7JA 2RFDA 3WE8A 4AZSA 2BF8B 3P9JA 2JKOA 5AP7A 5B0XA 1TQIA 1CSNA 3WZJA 3SA0A 2XYUA 2JRIB 4X21A 5I4NA 3CSFA 1Q41A 1UKHA 1YRPA 4BCJA 2HWOA 3UVQA 1OEYJ 5BMGA 1V81A 5AR7A 3UP7A 3AC3A 3LIJA 5IMEA 3AC5A 3SQQA 4KA3A 4KBCA 3H6NA 3TWJA 2UV2A 3QQHA 2KT7A 4BYJA 5DRDA 3ZRCA 2ZMDA 1UNLA 3HL7A 3PIXA 4WO5A 1H1QA 1A9UA 2XNBA 4TKNA 4USEA 5JFWA 1Y8YA 4U3ZA 1RM6C 2VTJA 3RZBA 5JXVA 3SU8X 3A9JB 5HIBA 3DB6A 3W18A 2Z7SA 5HD4A 5LVPA 1WGRA 3M62B 2ITWA 2UVXA 3CY2A 4BCPA 4URKA 2IYDB 4ANVA 1WXQA 1H25A 3OCTA 3LFEA 3V5JA 5CHVC 5BVEA 2FO0A 4L00A 3AE6B 1R4NI 2C60A 2LGSA 2XP2A 4XUFA 1YOLA 1REKA 2OFVA 4Y8DA 3B0AA 1H26A 5E8VA 3CWIA 4O1PA 4WIHA 1Q5WB 2VWYA 4GEOA 4FIIA 4HCNB 4HVGA 1OM1A 3Q04A 4FL1A 4IAKA 4QYEA 3F3WA 1J7BA 5FTQA 3HEGA 3ZO1A 4IX6A 4QOXA 1GUAB 3LFFA 1YKRA 4KGRA 2WMTA 4ZP5A 4LRKA 4AE9A 4Y72A 4CYJA 4G34A 5A6OA 2VH1A 3AB5A 4O2PA 4GT5A 3OMVA 1UGMA 5G1XA 4CKJA 5CZIA 1L4DB 2RMMA 2ITXA 4C4HA 3H9DA 2PVYA 2R3GA 4AG8A 2JAVA 4J71A 5DT0A 4ASWC 3MJ2A 1WFCA 4BDIA 4REZA 3UNJA 2IGGA 1IASA 5CSPA 5AWMA 4A3OA 4FI1A 2E2BA 3KF4A 4GN1A 1UBQA 4DXAB 4IW0A 3Q9ZA 4C34A 4JGHB 1OMWA 4YBJA 1N60A 4ZXTA 1YD8U 1PW2A 1YQ3B 3O7LD 2R0UA 3R8MA 1XQZA 3AM9A 4C02A 2CSNA 4X2FA 5CX3A 1P1AA 4F9BA 2PVLA 1FVTA 2FH9A 3C4ZA 1ATPE 3R83A 3M1SA 5ETAA 4DFXE 4I6HA 2XBAA 2PUUA 4JBQA 5DVRA 4FNWA 1HA5A 4RIXB 5JFXA 4FZAB 1AW7A 3QA0A 4D2PA 1YN5A 3W2DA 4UWCA 4PX6A 3ZXRA 3E93A 5HEZA 4BKGA 1OQYA 2OFUA 1PUTA 1W2DA 3VUXA 1V0BA 2ESMA 1WBSA 3HVDA 4PYZA 5D41A 4BKYA 2QOBA 2VTNA 1EH4A 2Y4IC 4DDID 4R7HA 4IC7A 2R3JA 3ZLWA 5FEQA 1OL5A 3B2GA 2V3SA 1JLUE 4Q9ZA 1YHWA 3LCKA 3ZHPC 5J9ZA 2YCSA 1M2PA 3IGGA 4HYHA 4OTRA 5C8NA 4FYNA 3HA8A 4DBNA 3EFUA 4F6UA 5LXIB 5CU0A 3R2YA 4CKRA 4ENXA 1V1OA 4PMPA 1PMEA 2G1TA 5E90A 1JPAA 2HZIA 2NR2A 2LJ5A 5IA5A 1YI6A 4FKPA 4IEBA 3WE4A 5JGDA 2KZRA 2J0KA 2I0HA 5LARA 5D1JA 4Z16A 4F6SA 3SFDB 4WD5A 4BTKA 2CHLA 2PZYA 4MH0E 2G9HD 3BYOA 2XJ2A 2FSTX 4BIBA 4KBAA 4DHZB 4Q9SA 3PPJA 2CHXA 3FZOA 4A9RA 4GDKB 3HMPA 2LGYA 1JKSA 4C3RA 1WGGA 2VTSA 2UW9A 2IO0B 5IA7A 4NJ3A 1C4CA 4B0GA 3KXXA 4DGGA 3R22A 2DYBA 3R2TA 3UVRA 3ETAA 4BFRA 5DFPA 5EK7A 2HTME 4BKSD 5HG8A 3AE5B 4JL9A 3JS2A 1FO4A 2YWPA 3QKMA 3DZOA 5BVFA 2VTTA 3BE2A 1KOBA 3PSBA 2QO9A 4YC8A 2EKIA 2D3CA 1OIYA 1WJUA 4XOZA 3AD6A 3VS4A 5DRBA 3FQHA 3A8WA 3QC8B 4NNJB 3DLZA 2W55A 3NIEA 4JQEA 4AZFA 2K8BA 2O6VB 3PPAA 1ZYCA 4KABA 1XT9B 5JZNA 5I9UA 4B8LA 1FQ1B 4IX5A 4V04A 3DBSA 4BOZB 3IFWB 3UO4A 4EC9A 5JH6A 2IO1B 2JDRA 2W05A 4LTUA 4JNWA 3ML9A 3DZQA 4NWMA 3EKNA 2ZM3A 3EKKA 4F9YA 5J1VA 4G6OA 1MFWA 3OTVA 3BE9A 5CEPA 2BZKB 1CKPA 1YX6B 1L2NA 2J6MA 1L5PA 1R39A 4MD9E 4S32A 1Q24A 5HKMA 4LG4A 4CT2A 3VC4A 4YJVA 3HIZA 4FV7A 4PY1A 2PVMA 3JVZX 5HE2A 4B8MA 1XKKA 4O0YA 4RVLA 5C03A 1APME 2O6VA 4GDLA 4I21A 5AIKA 5HG7A 4X2JA 1IRKA 1OFFA 5HKHA 5HX6A 4ZRIA 2DUVA 4UYNA 3SR6A 3TKUA 4E4LA 3S1HA 2OK1A 3ENEA 3H9RA 2MWSB 2BKFA 1ZLTA 3WZDA 5HO7A 3FL5A 2VRRB 4KNBA 3T3UA 2O6VD 4M7IA 2MJ3A 4DEDA 3UQFA 1XH4A 2L83A 4WA9A 5IMXA 1H0WA 4WG3A 2A5UA 3A60A 4O96A 2PKOA 4ARKA 3KH0A 2WELA 4UMRA 1NBFC 3R0TA 3TZ7A 2WXMA 3EYGA 5DEYA 1PXOA 3BZDB 2ETRA 3FI3A 4U97A 3UF8A 3FC2A 2JYTA 2ITOA 1RJBA 5GHVA 2YVCA 1WJNA 3K54A 4CQEA 2J0JA 3VS3A 1FEHA 5T6KA 2BIYA 4CD0A 2M8SA 5EE3A 3EHVA 2JFLA 3QRJA 2KX3A 4W8DA 1WX7A 3DVNV 4RJ8A 3S2PA 5D7AA 3RUIB 2WYQA 2V9HA 2AQXA 3I57A 4P16A 3E8EA 3COMA 4MKCA 2LVQA 2OH0E 2ONLC 1E5WA 4ZRKA 2ACZB 4DBGA 2NBWB 2J52A 3MTNB 5KMJA 2BVCA 3R9HA 4AGUA 4M12A 1LEZA 5DT4A 4F7SA 4XE0A 3EN9A 1DAYA 3AQVA 3MA6A 2W4KA 4D58A 4IWDA 2AQ3B 4UBAA 3B08A 4APPA 4AQCA 1K52A 4F08A 1SIFA 5HNGA 3VBTA 2O5KA 2J50A 3VJNA 3P7AA 3LPBA 1FXAA 4MQ1A 3AOXA 4BDJA 5J95A 2XK9A 4NM3A 2DYLA 3F3UA 3DXNA 3J9CA 2KTFA 5J5TA 4MH7A 3CIRB 3FKNA 3JYUA 2QJLA 3RNEC 4CYIA 4AT4A 2KC2A 3TMPB 4WQOB 3FI2A 1JROA 3GS2A 2QIEB 4ACCA 4RWLA 2RFSA 2GNLA 4WQMA 2RGPA 4DINA 1K50A 2NTTA 4X3FC 2M56B 4KSKC 3DLSA 5HLPA 4GT4A 2FUG1 3LQ5A 5CHWA 3SFEB 5IN7A 1VR9A 2OXDA 4LUEA 5AP4A 4G16A 4L3PA 1SM2A 3ODYX 2X0PA 4HVHA 2A19B 4L53A 4M8NA 4D1XA 4HGSA 4HDOA 4XZ4A 3V6CB 5I5ZA 3BYSA 3JXWA 4L46A 5E1SA 4JJRA 3SXSA 1BMKA 2WMRA 2LMCA 2E9NA 1F52A 5EDSA 5EKOA 2JY6A 4TXCA 1E1XA 1VJYA 5EE1A 3TUBA 2QOIA 5AR5A 3COIA 4HPTE 4DK5A 4NW6A 2RGFA 4JIKA 4ASZA 4W9EA 3E5AA 4I24A 3F66A 2PVGC 4ZZNA 3I5NA 2UW5A 2YJSA 3ZGZA 5CNNA 1Q8UA 1YI3A 4RJ6A 4E20A 4NCTA 1GZKA 4ZTSA 4L8MA 2P4IA 4BGQA 5HHDG 1URCA 4JR3A 4KIKA 2WNTA 3RCZA 1KLVA 3CPBA 4QMWA 1FFUA 2LRWA 2JLDA 4GSWA 1IGCA 3C0IA 4Z7HA 1R4MI 2BHHA 4KGTA 4AT3A 5HICA 3DQWA 4M84A 3GVUA 4FXCA 1W84A 5LQFA 1FPYA 4G3GA 4RA5A 4XLIA 2ETMA 4G0NB 5CASA 3QCYA 4O0SA 2Z0DB 2X6DA 2NMQA 5FK9C 4DEHA 2UZTA 2NBVB 5KE0A 3BLQA 3ZNGC 1RAXA 5BMMA 4G11A 4HOKA 4ASDA 2YDIA 4X6RA 3S95A 4PMTA 4AZEA 4OZAA 2UW8A 4RFBA 2XA4A 2VTAA 5JRSA 1VEBA 5CS6A 3WYYA 4U3YA 4EOQA 2H89B 4J6IA 3AE7B 4GIVA 4C3FA 4M14A 4HJGE 2OGVA 1J3HA 1FIQA 4BI0A 5E8SA 5J9LA 5I0BA 4D2WA 3A7FA 3KUDB 3MH0A 2VNYA 4C4VB 4C36A 5HG9A 4JX7A 2WEVA 3ENHA 3ZTDA 1QPJA 4PRJA 3VDZA 1KH0A 3SRVA 1ZDXA 3G51A 2L00B 4UN0C 1L3RE 1MQ4A 3PTGA 2NS5A 5ANGA 2ZM1A 4CFVA 1C79A 3BWJA 3OCGA 4XP3A 3LW0A 4GFMA 4RGOS 4JIOU 2O63A 3NUNA 1N61A 2G2FA 1S1QB 3IQ7A 3VBQA 3MVLA 5T68A 4FODA 2PK9A 2J53A 3NOBA 4IDVA 2GBMA 2KDMA 3R1SA 2MJEA 4W9LA 4ZJIA 4ACMA 4UWBA 3O2MA 3UG1A 2CGVA 3KRLA 1WSPA 3MTFA 4LRMA 4KD1A 5M55A 1WH3A 1XQQA 5F4NA 5E8TA 5BMIA 1YQJA 3FXZA 4RJ3A 3UPXA 4IX3A 2IZRA 5J17A 3CEKA 5TT7A 3VUHA 2K5PA 1SEBD 1ZAOA 3AGLA 2YCFA 1BX6A 4FSUA 5A4TA 1T46A 4FK6A 4QMPA 3F88A 3QF9A 4ZSLA 1OL6A 2ZAZA 3MJ1A 2EKEC 4CTBA 4IZ5A 4JDJA 4LJOB 3Q3JA 4FJVB 3ZJTA 1WWTA 5GZ8A 2I0YA 2JIVA 4O91A 5B7VA 3RI7C 3U8WA 1S9JA 1WYGA 5K0XA 1O6YA 4MT5A 1UWXA 3KRXA 4NJ6A 2XK5B 4C7YA 3A4RA 3D7TB 3HMNA 1J19A 3Q6UA 1WE7A 3QD0A 4MNEA 4KZ0A 2V62A 1H28A 2Q0BA 1L6VA 3VS5A 2J0LA 1H4RA 2X4ZA 2R3PA 3R7RA 3O8UA 5AADA 3DBRB 5FDPA 2WKMA 1OITA 5CZHA 1GZ8A 2KKCA 3BV3A 1SE9A 4E4MA 1T0SC 5DR9A 1DYQA 3H30A 5K9IA 3T8MA 3KMWA 2W82A 5TKDA 1JW9D 4HCVA 5IEVA 1O6KA 4M02A 4FKJA 1NYQA 4AP4C 1NVID 4TY1A 4IVAA 4AOJA 4TT7A 3VXWA 4UYAA 4AA0A 1NVRA 3MIYA 4L1BA 5L6PA 4FL3A 3F5GA 4EZ3A 2JF5A 2IN6A 3TCPA 5A4CA 5JFVA 3QQ8B 2BFYA 4FKQA 3P4PB 3BI6A 3GOEA 2XM9A 5GJFA 4ZZMA 2FVDA 2ZDTA 3BIID 4G50A 1KV2A 1RE8A 5F20A 3DBEA 4YXDB 4K18A 4DHFA 2NVUI 4XX5A 2VWVA 4XX9A 4EK6A 4A4XA 4EH6A 1M94A 3P1AA 3TNHA 3APFA 2BS2B 1M7NA 4YJOA 2PZPA 2B76B 2KMCA 3NVWA 1PYWD 1PMVA 3IHPC 1KE5A 3Q3OC 1JAMA 2LJIA 4F63A 4FUXA 5B2KA 4WURA 5CU2A 4I5MA 3GU5A 3LM5A 1QOFA 2W4OA 1I35A 1WMHB 4S30A 2XS0A 3N9XA 2OICA 2IY1B 4FIFA 4DH3A 4HRSA 2J90A 3WIKA 2XNAC 1GJZA 4TRLA 5EDQA 3O71A 4EOYA 3HDMA 3KRJA 4YJPA 4EH8A 3KXGA 5EDRA 3BYTB 1MHHE 2R2OA 4R5SA 1PXKA 2XIXA 5CWZA 3QCXA 3DBDA 3W33A 3WAOA 2IO6A 5AAFA 1GB1A 2IO3B 5HG5A 2F49A 3ZFXA 5AZHA 1HZ6A 3AEFB 5DE2A 2RSVA 2I1JA 4MJSA 3ABVB 2KAJA 4WJPA 4ANLA 2D3GA 1D3ZA 4GG7A 4YSXB 3UG2A 2H88B 1WFYA 2Y3AA 4YLKA 4IAYA 4E6QA 4HLEA 4BKTA 4HWIB 3GU6A 4JX1C 2GB1A 1GOLA 4R3PA 2XK6A 2JQRB 3A1QB 3ML8A 1GY3A 1XXGA 3BQRA 4G2FA 4US9A 2CU1A 4L2YA 2C4GA 4O4BB 1DAWA 2N4FA 2DZMA 3HDNA 4DH8A 3CY3A 4BBNC 3SKCA 4Z55A 3U6IA 5DA3A 3VHKA 4HGEA 1K2PA 1BUIC 2C68A 4F9WA 4Z9LA 1XEEA 3GFWA 2N7EA 4MJSB 5IPJA 4E1ZA 2I1KA 3Q4CA 4OBPA 3FMDA 2MP2A 2MBQA 2GFSA 3N1XC 4S0RA 3M42A 3RNGC 1G3NA 1KV1A 3AECB 5AUIA 4DFZE 4U45A 4QMVA 5ANIA 3LM0A 5IO9A 3X23A 4M8TA 2JD5A 4X3FB 3PRMB 1W98A 3RNBC 4XS2A 2HY81 3DB8A 2I0VA 3G0EA 5LMKA 1YVJA 2WMWA 3P23A 2KMMA 2QOFA 2Y5BB 4LJPB 2VWWA 5E8XA 3UBDA 3OT8A 4KKIA 2D5GA 3D5VA 2GNJA 3W9CB 2KJHB 5CLPA 1MRUA 5AP6A 2C7NB 5LLIA 1JVPP 5J2RA 2VWZA 2H8HA 4HPLB 3EA6A 4RGJA 3IDPA 5TR6A 2ZM4A 1XH7A 2FSOX 5HCXA 4GOCA 2VN9A 3TIYA 3UO6A 2W17A 1UNSA 3H9OA 5KHXA 3NYOA 1K53A 5E6OA 4ICVA 1G5SA 4C62A 4BCHA 2PJHA 4RBLA 3WAPA 2LXCA 1RRBA 1F0QA 2B55A 4IFGA 4KIQA 4YTHA 2KC1A 1QPCA 3W1FA 4DXGA 3RZWC 4C4VA 4WUAA 4NFNA 4ZRPA 1W2CA 1PHKA 5L2SA 3P4RB 4C7ZA 1QF6A 1ZYJA 4YHTA 3LFQA 2ZW0A 5CEOA 3ZSGA 3TI1A 3EMGA 2GMXA 3KWVA 5CSVA 4TQ0A 2UVZA 2PZRA 3D2IA 4XG6A 1YXUA 1XD3B 4YLLA 3UIXA 4NKAA 3AG9A 1YOJA 2KVZA 3ZO4A 1WX9A 1YWNA 3DA6A 4AOTA 1GAGA 4XV2A 3PTFC 2W7XA 3UODA 4GH2A 2HW7A 3PIYA 4LNIA 3RNIA 4A9UA 4C00A 5EYMA 4ZLZA 3VBVA 4F6WA 5AA8A 3H4JA 4EHZA 2J7QB 2VO6A 1UF0A 3QYWA 3ZZWA 3DCVA 5HX8A