3RZFA

Crystal structure of inhibitor of kappab kinase beta (i4122)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
622
structure length
541
Chain Sequence
EMKERLGTGGFGYVLRWIHQDTGEQVAIKQCRQELSPKNRERWCLEIQIMKKLNHPNVVSAREVPDGLQKLAPNDLPLLAMEYCEGGDLRKYLNQFENCCGLKEGPIRTLLSDISSALRYLHENRIIHRDLKPENIVLQPGPQRLIHKIIDLGYAKELDQGELCTEFVGTLQYLAPELLEQKKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHGKVRIVVYDDLTGAVKFSSVLPTPNHLSGILAGKLERWLQCMLMWHQRTDPQNPNVGCFQALDSILSLKLLSVMNMVSGRVHTYPVTENENLQNLKSWLQQDTGIPEEEQELLQASGLALNSAQPLTQYVIDCTVGDLIFLFDNRKISLPAHPESVSIVLQDPKRPLTYTHLRRVWGQIWQTIRALKEDCARLLQGQRTSMVNLLRYNTELSKKKNSMTSEREVQALVDKMMALQTDSVDLQRNPTLDDLEEQARDLYRRLRERPRDQRTPGDSNDMVRLLILAIQSFEKRVILIYDQLSKTVVCKRKALELSPKVKEVMNLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC80376 protein
publication title Crystal structure of inhibitor of KappaB kinase Beta.
pubmed doi rcsb
molecule tags Immune system, signaling protein
total genus 97
structure length 541
sequence length 622
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18397 IKBKB_SDD IQBAL scaffold dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rzfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzfA02
3CP9A 3P08A 4KABA 5KKRC 4I0SA 2WTJA 2R2PA 2KX3A 4O1OA 5DN3A 3V3VA 1OQYA 2BGFA 2XIKA 3VJNA 3W8QA 1WX8A 4QMPA 1WBTA 2OKRA 2VWZA 3GU4A 4UMTA 4RX5A 1WBWA 4JBQA 2RFSA 4EH4A 2CR5A 3A7FA 1NVQA 3A4OX 4G5JA 2XNMA 5C1QB 3NR9A 4JIOU 3DOWA 2C1AA 3ENHA 5TR5A 3MDYA 5CWZA 1KOTA 2KTRA 3VUMA 4BI0A 4J6IA 1U4DA 3EFJA 3EYHA 3ACJA 3L1SA 4JJRA 4DINA 3K9OB 1WYWB 3CS9A 4FV6A 5E8YA 5ICPA 3FZ1A 4EOKA 2OIQA 5CU0A 4JT3A 3VBVA 3K3JA 3VS5A 4E4XA 2QHNA 3NAXA 3APCA 2HK5A 3B8QA 2C6KA 3QZFA 1XHAA 4I5PA 3NOBA 4XC2A 5LMAA 5FTOA 5M55A 1XBAA 1Q41A 4F9AA 2VWWA 4W9LA 4PNKA 4C2VA 2ZNVC 4MH0E 5T6KA 2OZOA 3QHRA 5FTQA 5B2KA 2W1EA 2UVYA 4JQEA 2R3FA 3UBDA 3BCEA 3UIMA 4ACGA 4CV8A 1YWNA 2JLDA 2W4JA 3F3TA 5FXQA 1Q24A 2BVAA 3RK5A 2Z7QA 4R6VA 5DPSA 3UODA 2CGXA 2WQMA 4FHKA 2W4KA 4CCUA 3HGKA 2ITZA 5CX3A 1ISNA 4JOAA 2BDJA 2VX0A 4YJQA 2YAAA 4EWQA 2Y9QA 3R7EA 2C6TA 4D2WA 2MBQA 5JFWA 4L53A 3OTUA 4OTIA 5BMMA 3DAJA 3WZJA 4E4NA 3G0FA 2CMWA 2G01A 2P0CA 5F94A 1PJKA 3Q4UA 3Q9XA 5DPTA 4QP7A 3MA6A 3UOHA 3FI2A 4F9BA 1Y8YA 4LOOA 4MX9A 5EW8A 5JZNA 3BLQA 2XRWA 4ARKA 4WJNA 4BKGA 2WZJA 4UY9A 5HE1A 4XG6A 4ZTLA 3ZLSA 1ZYDA 5AAEA 2KLGA 4WG3A 4NUSA 5A14A 4FTJA 1P1AA 5DEWA 1TZ1A 4DFYA 2WTVA 3VUDA 2VZ6A 2WGJA 2WX1A 3VUHA 2HENA 2VGPA 4C34A 4XNEA 1XKKA 2QI8A 4JAIA 3G6GA 4RQKA 4XP3A 5FEQA 3RJCA 3S00A 4WJQA 1W98A 5L2TA 4CFUA 3FYJX 4OTHA 3MGYA 4YBJA 4YZNA 4BRXA 3QRJA 4AN3A 4F1OA 4YO4A 4E4LA 2KC1A 3CJFA 2LVPA 2YCSA 5DLSA 1Z57A 3VUWA 1Z2MA 4IDVA 5J17A 3ZZEA 1YHSA 4GT5A 4UB7A 5DR9A 3W32A 2MX2A 5TR6A 3BGQA 2QO7A 4CZYB 4ANXA 3WOWA 5F95A 2C6DA 5CAOA 2PZIA 2PSQA 5EOLA 5EYKA 3ORMA 1YHVA 4TV3A 4WWNA 1P3QU 3P9JA 3SXFA 2MCNB 3OCGA 5KMKA 4ANOA 2WAJA 2ZVOA 3A7HA 4M0WB 1UV5A 3GUBA 4YUQA 1YXUA 4XYFA 5AUZA 3PPJA 3SRVB 4E7WA 1IEPA 3F88A 3QD3A 2SRCA 4YPDA 3W1FA 4C4JA 5DMZA 3ZCLA 4QP3A 3S0OA 3G6HA 4BCOA 3GQIA 3KA0A 1PXLA 5IDPA 5M56A 2IY1B 3PIXA 4RC3A 4F99A 2X7GA 3WIGA 3CIKA 3POOA 3BU5A 4W8DA 3U87A 1OITA 4PUZA 4BL1A 5KHXA 5E8TA 3NWWA 2ZAZA 4F7JA 4CO7A 2CKHB 4LV5A 4F0IA 4IEBA 5LWNA 4WNKA 3RUIB 4DHJB 4RJ3A 2GFCA 2R3JA 3DDPA 5IUGA 4A4OA 2D11A 2OJRA 4U6RA 2KZRA 3CE3A 3NW6A 3GGFA 3RAWA 5E8UA 5A46A 5A4QA 4MNEA 3PY0A 4FV0A 2MRPA 5D94A 1H27A 2XCHA 1STCE 2BRNA 3PP1A 2IVUA 2REIA 5ANOA 1Q5WB 3IHPC 1VYWA 4EH8A 3GOPA 2B9HA 2ZV7A 3R22A 5BPYA 3QX1A 3V5TA 2XIYA 4BN1A 4AW5A 2V1YA 1Q4LA 3ZRFA 4XV2A 1V1KA 2C0IA 2HYYA 4I22A 3UG2A 1NI2A 2DYBA 5ANJA 2WOUA 3P78A 2LWPA 3QC8B 3R1YA 3ULIA 2C68A 2XM8A 1YDTE 5CAUA 2PE0A 4YJNA 5FM3A 3A8XA 5DR2A 1XJDA 5CEOA 4LCDE 2WTCA 3ORXA 3AC2A 1WR1A 3PTFC 5J7BA 3NYVA 2GHLA 1OB3A 5J9LA 5K0XA 2JFLA 2KANA 2R3OA 4EK3A 2OF4A 4GK3A 4QP4A 1WE7A 2VO7A 3E8CA 4E20A 3JYUA 4AP4C 4EKUA 3LCTA 1O6KA 5EM7A 1GJZA 3A1QA 3L8VA 4GN1A 4N70A 3DVGY 2QU6A 2EU9A 4L01A 3RHKA 3KXMA 2JEDA 2QHOA 1M7QA 1C1YB 5ACBC 4IDTA 3OS3A 4G6NA 4YLJA 3L0WB 3QQ8B 3ZO2A 5KMIA 2Y6OA 3PLUA 3AULA 4K0YA 4GIHA 3EQRA 3AD6A 3DT1A 3O0GA 3Q32A 4C3PA 5GHVA 4BCKA 4MGZE 2C1BA 2HZ0A 4I6BA 4FZAB 4EZ5A 2R3GA 2B4SB 4RMZA 4MEMA 2V7OA 4HYUA 4IB3A 2XB7A 2BTSA 3MFTA 2G2IA 3LJ1A 4IWOA 3NUXA 4MXAA 3A99A 4LYNA 4QMOA 1WFYA 2JRIB 4PL4A 1FOTA 5IA4A 1WGDA 3OY3A 2J51A 3V5JA 4IVBA 2GFSA 5HG7A 4IE9A 4LV8A 4WNMA 4F64A 4ALWA 2Q0BA 1BL6A 1JSVA 1OL1A 1BLXA 3GCPA 4DEIA 3FQHA 5FDPA 2PMOX 4G1WA 3OT8A 4RBLA 2WX0A 5JZEB 2GOWA 1W84A 4FT9A 2Y7JA 3Q5ZA 3ZS5A 1K3AA 2BYVE 2PK9A 2DYLA 4HPMB 4AGUA 2WDTB 2W5BA 5CANA 3GU8A 4I24A 5H8BA 4C59A 4HVGA 3DBLI 2CN8A 4BGHA 4FIIA 3VHKA 4E73A 3E92A 3BLRA 5HZNA 1HCKA 5J2RA 5HGIA 3FPMA 1A5RA 4MGIE 1VZOA 2B9FA 3EMGA 3RTPA 3ORPA 4YSJA 5IA3A 2LXCA 3KRWA 4PRJA 3WIMA 4AS0A 4EI4A 3R2BA 4OVVA 4HPTE 2D2QA 2WMXA 3OJ3A 5AR3A 5C01A 1HOWA 2I40A 3DKOA 3DVNU 4EOJA 3BV3A 4AZSA 4JXFA 2FSOX 3RCJA 3EQFA 3JSVA 3WF6A 3B08A 5HHWA 2PVKA 4U80A 4FKPA 2WMUA 4BCMA 3GCUA 4HYHA 4Z7GA 4WSYA 3LFBA 3D5VA 4PTCA 1JQHA 3VC4A 3EECA 5CHWA 2XP2A 5ANEA 2ITWA 4WSQA 4KA3A 3ZBFA 5KX8A 3PS6A 1H07A 4O0VA 3U51A 3ANRA 4EEVA 5JSMA 2QOHA 3FV8A 3ZSIA 3QALE 4R3PA 4HCPB 3PXQA 2J7QB 4QQTA 4WOVA 3ZRLA 4G11A 2MBBB 3DB6A 3PZEA 2G2HA 4EOOA 1S3SG 1Q97A 4FIEA 3F3WA 3JY0A 1W0XC 4CT1A 4HNIA 4G17A 3KMWA 3UVPA 2ZDTA 3IDBA 2J5FA 4DFLA 5J9YA 2X6DA 3NLBA 5D1JA 5M44A 3PJ3A 4ZTQA 4R1YA 3ZRKA 2D10A 2LD9A 2YIXA 4E93A 3F5PA 1AD5A 4RIYA 1E8YA 1Q1OA 4WRSA 4J52A 3OUNB 4M84A 3AD4A 4L8MA 5C23A 3DJ7A 2HWOA 3KK8A 4II2B 2YFXA 2ZZPB 3S2AA 3FXWA 1LQBA 5LXIB 4BKJA 4IH8A 2OWBA 4Z7HA 4RWLA 4CTCA 3I5NA 4FJVB 3JY9A 2CLQA 4ZRKA 5AWMA 2F7ZE 2MBEA 5HX8A 2P4IA 2YA9A 5CAQA 4UX9A 4YR8A 2XBBC 3E5AA 3TIXA 4F4PA 3TNPC 2IVTA 3HMPA 3EYGA 2LUEA 4M97A 4F70A 2CKEA 3W2CA 4AQCA 3UOJA 4BOZB 5FDXA 4CQGA 2Y8OA 4IVDA 3RGFA 4IVAA 4H58A 4NKSA 2XCKA 3UE4A 3V8SA 3L17A 5IAAC 4D55A 4NZWB 4MJSA 3W33A 4ALUA 1Z9XA 3DVGX 4QNAA 2MLBA 3LXPA 3KMUA 4U5JA 4AZEA 2PPHA 1I09A 2VWVA 4DK5A 2R3MA 1GNUA 3VVWB 2AYOB 4FV3A 2JZ3B 2O6VB 2XS0A 2IW8A 5AZFA 1M2RA 2FNJB 2CHWA 3LHJA 2PZPA 1OL5A 3D14A 3QK0A 4Q5EA 5FP5A 2C5NA 4IB1A 4KIKB 4QMUA 2PJHA 5AR4A 4ZRIA 4AZWA 2W1FA 4KWPA 3SXRA 4DFXE 3I3TB 4I6NB 3KUZA 3BI6A 1JNKA 5E92A 3UVQA 4O2PA 3ULZA 3FYKX 3A9KA 2VX1A 3HV4A 4EK8A 2GMIC 1OPJA 3L8SA 2VTLA 3D5XA 2C69A 3NS9A 2I6LA 4X3FB 4QTCA 3FUPA 1P2AA 4K11A 4BI2A 3LW0A 3ZOSA 4DH5A 2FAZA 4NFMA 4BCGA 4FTNA 5LWMA 3A4PA 3QTRA 2OI4X 5IDNA 4EK6A 1Q62A 2BILB 2J0JA 3FJQE 3Q4CA 4LRMA 5KMMA 3TMPB 3QRUA 3PIZA 5CI7A 2JUOA 5C1ZA 2JT4B 4NEUA 4GVAA 3G0EA 5EDRA 2G9XA 4BCQA 5J5SA 5AZGA 4BC6A 3V5QA 3NZ0A 3ZDIA 3KKVA 4BYIA 1JBPE 3EKNA 3FL5A 2QU5A 4M0YA 1Y6BA 5M51A 1WMHB 5AP6A 4F9WA 5HD4A 5I9ZA 3SVVA 3QRIA 3VBQA 3PRFA 2PMIA 3D32A 2VRXA 2A1AB 1VYZA 3KVFB 5CSPA 3LLTA 3PREA 2BPMA 3R2YA 3SKCA 2PZRA 5TOZA 3CTQA 2HW6A 2OO8X 2V0DA 5D11A 3ZZWA 4AWIA 4UXQA 4HCUA 4JVGA 3PSDA 4GU9A 2BRGA 1OUYA 3QQFA 5AX3A 2QCSA 2W96B 3IK3A 1BI7A 4MF0A 5HICA 2BF8B 4EH5A 3EHVA 3UMWA 4HVBA 1ERKA 3K54A 4HCVA 3LJ3A 1E1XA 4O38A 3IPHA 4CMTA 4NAWA 4OAUC 3ZRCA 1OMWA 3KRJA 2DYMA 2CCHA 5JHBA 4JBPA 5E6PA 1U54B 3O71A 5D12A 3UIUA 3V8TA 4CD0A 5CEIA 2JKMA 5CT0A 4QO9A 2W5HA 5BVDA 4X57B 5HO8A 2BZJA 2VTSA 3CY2A 3RPYA 3VS0A 3VS4A 3WILA 3QCYA 4FTIA 4BZDA 5D7AA 4RZWA 4EOPA 4BKSA 1OL2A 4LRKA 3CKWA 2R7IA 4O22A 3DBRI 4K1RB 3NCGA 5L6WL 4N9F4 3ZDMC 4USFA 1XH4A 3FZSA 2QNJA 3A7GA 4ASXA 4ZIMA 2NCNA 4WJOA 4KV2A 4H3PA 2HW7A 2QOLA 3WYYA 3UNKA 4C35A 5KBRA 3HRBA 2Y4IC 1LPUA 2MP2B 1PW2A 3RI1A 2NBVB 1K2PA 2B55A 3I4BA 4FT5A 3MJ1A 4IX3A 1MP8A 1TKIA 4AA0A 2WHBA 3C4FA 1PMEA 2GBKA 2D07B 4BTMA 4TKNA 3GI3A 3G9NA 3VAWA 4EFOA 5ANDA 4OTRA 3ZO3A 2KD0A 5CU2A 4GG7A 4MJSB 1KE8A 2H9VA 5L2SA 2GHGA 4OTFA 3UIPB 1H1RA 4PTGA 4BDIA 2ZMDA 4NPNA 5K3YA 4JIKA 2GSFA 2P2IA 4L3JA 4P5ZA 4GMVA 3IW4A 1E5WA 4CFVA 1VCBA 3L9MA 2HAKA 2Y5BB 4WBBB 4GXBA 4I4FA 3EL7A 1QPJA 5I9UA 1WX7A 1LFDA 4DHJD 4X2KA 3KGAA 3O65B 1H00A 1YOLA 2YZAA 3A7IA 3M2WA 1HE8A 3NYNA 4FSUA 4QP8A 2EB3A 5B2MA 5D2MB 4UXLA 3RD2A 4DH1A 1GAGA 3R83A 4DHZB 5IUHA 4MBIA 2PL0A 5DIAA 4MTAA 2KTRB 3HVCA 1P4OA 4QMXA 2VTOA 3KW5B 3BYUA 5A4EA 3SDJA 5BNJA 5EM8A 4FSMA 4G34A 3VS2A 2R3LA 3CGFA 3NYOA 3DPKA 1SNXA 4KBKA 4QMTA 4RJ6A 2KC2A 4C38A 3HLLA 2UZLA 2ZCCA 2PE2A 2IW9A 2YACA 4RFYA 5CSHA 2FUHB 3LFNA 4L3PA 4UMUA 3ENEA 3KEXA 3ZO5B 1WM3A 3F7WA 3MVMA 1V86A 2YEXA 1REKA 3ZXTA 4NW6A 4OBQA 5HLWA 3FMHA 3VTWA 4FX3A 5HVJA 5G6VA 4IJPA 4IAKA 4IB0A 5HE0A 3L9LA 3W18A 2IO6A 2JDRA 4QRCA 4RWIA 4I5HA 4OTQA 1Q0WB 3BQRA 1URCA 3ZSGA 4UWCA 1OKZA 3RYTA 1SNUA 3W1SA 3KYCD 4CFNA 4OTPA 3QX2A 5HBJA 4G3GA 5GJGA 4BKTA 5IISA 1WE6A 4Q2AA 3ZFYA 5GZAA 3F69A 4BCFA 1E90A 4V04A 1WGGA 2Y0AA 3KCFA 4G5PA 4I6HA 2XNNA 3C4CA 1XR1A 4S34A 4BWKA 4C4HA 4E71A 3LZBA 4CMUA 4TL0A 5F1ZA 3DFCB 5FBNC 4YC8A 3UQCA 1YRPA 3VW8A 4YLLA 1YXXA 2BRBA 3KN5A 4BHNA 3OCSA 3KRLA 4QMSA 5AAGA 1UGMA 3EOCA 1CKPA 2A5UA 4EOMA 4IQ6A 2YWPA 4FIGA 2BRHA 3O8PA 4IAYA 4PPBA 4ACDA 4TQ1A 2CGUA 3OCTA 5CYIA 2J0IA 2K6DB 2LXAA 1ZZLA 2CPKE 2YM6A 1YX5B 2C6IA 3NZUA 4AA5A 3QWKA 3UGCA 4GYIA 4CVAA 4XHKB 3L9PA 5TE0A 4DLIA 3K9PB 3OWKA 4QMLA 5IKWA 1UVRA 3PRMB 4W9CA 5ACKA 4UMRA 4QMVA 4C2WA 2M8SA 3ZLZA 2JY6A 1FMKA 3PE1A 2BFXA 4EZ3A 4I94A 2W06A 2CS4A 3ZSHA 4DH7A 2DENB 3P79A 4EEWA 5AAFA 4IM2A 3FL4A 1Z5MA 4NSTA 3TV6A 2IO1B 4XOZA 4C58A 4O96A 1SM2A 1ZYCA 5G2NA 4WT6A 3RM6A 5DRDA 1GY3A 3LQ8A 3OF0A 4FIFA 3L9NA 3IGGA 3TJPA 4BF2A 5LMKA 3Q2MA 2BIKB 3QX4A 3TWJA 4KSQA 3P7CA 1FVTA 1QPDA 4NJ6A 4IC7B 4QOXA 4RMAA 4EZ7A 4RZVA 1XBBA 2JFMA 4JQ8A 4O1PA 2N9PC 5C27A 4RVTA 5GJDA 2FGIA 3H7PA 2VTJA 3WAPA 2UZOA 4TN6A 5AP2A 4ZY4A 2LVQA 3ROCA 3MYGA 4LRJA 1B38A 2WD1A 4IW0A 2XUUA 1S9IA 1XH6A 1MQBA 4GK2A 4CYJA 3CLYA 2X2LA 5E7RA 2RPQA 4WA9A 1GZKA 4U79A 4FKUA 4XBUA 3HV7A 3A4SC 3C4WA 4FHJA 2QKWB 3FI3A 4B9KA 4IADA 2KWVB 4CZTA 3BE2A 2GS2A 1QPCA 4GFGA 5L6OA 3WALA 3KFAA 3MSSA 2WIPA 2W9NA 3DCGA 3UQFA 4IZYA 2XK9A 4FG7A 4PF4A 4E5WA 3CXWA 2W9ZB 4EK5A 3F2NA 1P14A 3MV5A 2C47A 3UO4A 3PVGA 1MRYA 3BQCA 4P2KA 3ZMMA 5CEMA 1YJ1A 4MNEB 4H1MA 2K8BA 3LJ0A 3PWDA 5BVFA 5I9WA 3FMMA 4EC9A 4F6WA 1UELA 2ZB0A 3T8OA 1B6CB 4FL3A 2GNGA 2DQ7X 1T0YA 4MGKE 1AGWA 4F08A 3DBHI 1YXSA 3MB7A 3RMFA 3DQXA 4CKRA 3QD2B 3QHTA 1Y6AA 3WBLA 2KTFA 4M0ZA 2WWZA 3F6XA 2KMCA 3T9TA 4BCPA 4E6QA 4FBXA 4GEOA 4FZDB 3GOEA 2VNYA 2KXJA 2PMLX 4CT2A 4W9EA 4QMMA 2KKCA 1IR3A 4GT3A 4FSQA 4TWPA 2HZIA 2O3PA 1XH7A 2YM4A 3M1SA 4YZ9A 3ITZA 3VIDA 4FKVA 4R8QA 4R7HA 3DNEA 4U7ZA 5TF9A 2R3QA 3ZLYA 2ZPYA 5AEKB 3FLSA 2E9OA 3BINA 2OJGA 1ZYJA 4HJKA 4NFNA 3ZBXA 1YOJA 5A4LA 2PVHA 1Y8RC 3A1QB 4ENYA 1VEBA 3ZTCA 4AWJA 3H10A 2XVDA 2DZMA 2X8IA 4NWMA 3VRYA 3VHTC 3WZUA 1T46A 3UQGA 3WARA 2RG5A 2REXA 2WMBA 4QP6A 4EHGA 3QXOA 1F5QA 4C4FA 1ZRZA 2O64A 3TN8A 4KB8A 1J1BA 4X7QA 3DJ5A 2J4ZA 4U8ZA 3HDNA 2OXXA 4KKEA 5CF6A 1JRUA 4U40A 4ICVA 4XS2A 3FY2A 1ZY5A 1KWPA 1OGUA 3TIYA 4PYZA 2XIZA 5AUWA 3M3JA 4QYFA 1UU7A 2JKQA 4YZMA 3V6EB 1H1PA 2J7TA 4I93A 5D9HA 2X1NA 2BWFA 1W7HA 1X8BA 3PXKA 1REJA 4TNDA 5AP1A 5HI2A 4C0TA 2RSVA 5IU2A 1NBFC 2GBNA 4IM0A 5CU6A 2B3AA 2Z0DB 3A4RA 1XH8A 5EDPA 5J1WA 2XRUA 3MA3A 4ERKA 5M4IA 2WMAA 3LXLA 2GU8A 5JGBA 3I60A 5HESA 4ACMA 1PMVA 2W5AA 2C3IB 2LAVA 4D2VA 2XNEA 3BGZA 4AUAA 4EC8A 2HWPA 2YERA 3QQUA 5IMXA 4PPCA 5AA8A 1BT0A 2KJHB 2ZVAA 3PJ8A 1GZNA 3R30A 4U97A 3RCZA 1U5RA 3DK7A 4RX8A 4UZDA 2GBMA 2KN5A 3ZW3A 3MY1A 2L05A 3UPXA 2ZOQA 5CSVA 2A4LA 2QD9A 4IZ5A 3D4QA 3QTWA 4MD8E 4MBJA 4AAAA 4ANMA 3CY3A 3C5UA 2NVUI 3GCSA 4QPSA 4DH8A 1K8RB 4YNEA 3TZ8A 4D4RA 4OTDA 1SVHA 4U9AA 3HMNA 5GMVA 3NX8A 2XKEA 3NZSA 4MQ2A 3JSVB 1W83A 2RR9A 1F0QA 4U41A 4DDGD 2EXEA 3O17A 4JQWC 4AZVA 3PVWA 3U30A 3QAQA 4EUTA 1WM2A 5DT3A 3KRXA 2VTTA 4LMNA 2ITOA 3KMMA 5ANIA 4FV2A 5K5XA 4BOSC 3BY4B 3FC2A 5BYZA 3HYHA 1WGRA 3QD0A 2M1MA 4BTKA 4KINA 5I9XA 4NU1A 1CKIA 1ZLTA 2P3GX 4BDEA 5BVKA 4JX3A 4B6WA 2JVCA 3PPZA 4CYEA 1JPAA 2PZ5A 2JPHA 4L3LA 3HA6A 5EW9A 5HBEA 4AG8A 3MB6A 2J9MA 3RCDA 2DZKA 2ITXA 2BWES 4ICUA 3IOPA 4FTRA 4WNOA 5TO8A 4DEGA 5JEBA 1AARA 3APFA 3NIZA 4WRGA 5L3AA 1H4LA 2ZV9A 3G9LX 3V6CB 5H2UA 4JI9A 3QCSA 3QLFA 3VNTA 3EHAA 5EYCA 4OT5A 2BKZA 3VRZA 1S1QB 4ZJVA 3KQ7A 4GDLA 4MAOA 1QMZA 4RIYB 4ENXA 4AFEA 2C0TA 4YL8A 2Z2WA 2YISA 3QRKA 5CQUA 3Q60A 4ZSJA 3BHYA 3DBDA 4FG9A 1PXKA 5J18A 1Q8TA 1R0EA 4CQEA 1DM2A 3BBTB 2B54A 5EI2A 3PZDA 1WMKA 1LXDA 4NJ7A 2YIRA 4AE6A 2X8DA 1WAKA 4FV1A 3GC9A 4F1MA 2N9XA 3PGEA 4KSKC 4BDCA 4MSMB 2X4ZA 2XNBA 3KRRA 2MWSB 4OLIA 3TJDA 3A9JA 3AT3A 2OOBB 3CSTA 3LAUA 3PSCA 3M63B 4GFOA 2W1GA 3B0AA 4WG4A 2RSUA 4FA6A 4XRJA 5HQ0A 5CF8A 2UZEA 5LVNA 5IEYA 4IM3A 4G6OA 2CHXA 1FQ1B 1UNLA 3IW8A 4FKQA 4TRLA 3I7CA 2ZCBA 3OLMD 4RVLA 3R7VA 3AMBA 5KHQA 1XD3B 4M68A 3GC7A 4I1ZA 4AU8A 3RK9A 3PVLA 1KSWA 3RT3B 3RVGA 3C4XA 3PUPA 4CXAA 1I42A 5JQ5A 2OIDA 1SVEA 4X6QC 2Y4PA 4JDHA 1VD2A 3U6IA 3BYOA 4IXPA 5AR8A 3O8UA 3QJZA 4FODA 2ZMCA 4MKCA 1DI8A 3RPVA 4ASZA 2RFEA 3QYZA 5LVLA 1BI8A 5A9UA 1PHKA 2W99B 3EN5A 2J50A 3ET7A 3E3PA 4R3CA 2K25A 2M0XA 4C4IA 3A9KB 4EH9A 5L2IA 4KSLC 4IX5A 2NRUA 4DHFA 4LL0A 1Q8UA 3RKBA 3VBTA 3CR0A 4L43A 4QYYA 2KVRA 4QMZA 3D5WA 3R7RA 2KQSA 3V62A 2GS6A 4X2JA 3ZFMA 2JITA 2EVAA 2J90A 2RF9A 3DU8A 1KE6A 2UW5A 3EKKA 3AC5A 4JG6A 3PA5A 5HIBA 4XG9A 4PP9A 3RINA 2YLEA 2IZRA 4EQCA 5HTBA 3EQDA 5AV0A 4AGCA 4WUAA 5KZIA 3UGBB 3GU6A 4NQLB 3FAAA 3O7LB 4RWJA 3TL8A 1EH4A 4RIXA 4FTCA 4YNOA 4AA4A 3WAMA 4FKOA 2LGCA 2F57A 4FT0A 3Q52A 3R6XA 5HU3A 2XK7A 4PL5A 5HKMA 1CTPE 1KV2A 3QTXA 4E6AA 2YVCA 1GNGA 2A19B 3MJWA 1J8CA 4DG2E 3HDMA 1QZEA 4I0TA 4AF3A 1OIYA 3SXSA 1WXAA 2G15A 3C0RB 4G3XB 3W55A 2YCQA 4Z16A 4JG8A 2UZTA 4D5KA 3LFQA 3TL5A 4IAIA 3R7QA 3WE8A 3QWJA 4IFCA 3TIZA 4D9UA 4JDIA 4O0WA 2ERKA 5FLFA 3IGOA 3L8XA 4OBPA 3QIJA 3DPDA 2BAKA 3C9WA 1OZ1A 4C57A 4ZZNA 3KYDD 4NAWB 1V80A 3EFUA 3B2TA 4W9XA 3FE3A 2H96A 2O0UA 3COKA 4FKWA 3HRFA 4QP2A 1WIAA 4L42A 4R1VA 5GNKA 4B99A 2NRYA 2OJJA 1M2QA 3P4KA 4FNZA 2ZPNA 3HX4A 4BDDA 3A7JA 3GFEA 3I7BA 3SLSA 4BDFA 4BBNC 3BEGA 4ZDVA 3AOXA 4K18A 3PRPB 4D28A 4E1ZA 3K3IA 3HZTA 4ZOGA 3RPSA 4JLCA 5E8SA 2FO0A 4AGDA 3BE9A 4IWQA 5A4CA 3AXWA 2QKRA 4FK3A 4RJ4A 4NCTC 4A9YA 5D7GA 4JR7A 4TYJA 3HP2A 3H9OA 3PVBA 4QP1A 4BFMA 1PYXA 4E5BA 3OWLA 2MSED 3NS8A 4JBOA 4FUXA 4YGAA 2C3LA 3RNYA 2I0YA 3FY0A 1ZW7A 3R7GA 3IW6A 4L7SA 2KHWB 2VU3A 2VWIA 1JSUA 4YO6A 2O2VA 3V8WA 1GIHA 4FV8A 4YLKA 4EORA 3DBFA 1UKHA 1TGZB 4EBVA 1R78A 4RFZA 2W7XA 4FGBA 4O21A 5I3RA 4M69A 4C37A 3ORZA 4HVIA 2XYUA 3OHTA 3M62B 1H1QA 3EFWA 4YC3A 1V0PA 2OZAA 3MWUA 1GC6A 2HXQA 3SD5A 3V61A 2WNTA 4K33A 4J96A 4C3FA 4KIOA 5D41A 3CGOA 3SQQA 5IPJA 2BYEA 1RW8A 5DWRA 5L2WA 4CHKA 1SZMA 4XLIA 5EHYA 3EN4A 2FIFA 2AL3A 1R4NI 3FBVA 3QKKA 5H3QA 1PXNA 3UYSA 4AUQC 4UV0A 3F3ZA 4MF1A 5CTRC 2BHEA 3ZKJC 3VVHA 2FSLX 4L7FA 2NBUA 3LCOA 4I23A 2WPAA 1TTNA 1C3TA 4DFZE 5KMLA 4YTCA 3JVSA 5JH6A 4KIPA 3QCAA 3PPKA 4M8MA 3I5ZA 2FYSA 4FC0A 4UWBA 4WG5A 3CMMB 2YM7A 3I6WA 3OOMA 2BIYA 1H08A 1U46A 4GW8A 4JBVA 4MH7A 5CU4A 4FL2A 4ZTRA 3R7YA 3DDQA 1WJNA 2X39A 3HM3A 2N7EA 3WZKA 4WAAA 4TNBA 4ZK5A 3ZTXA 3FKLA 4B8LA 4K6ZA 3FLWA 2QR8A 4Y5HA 2GS7A 4YHTA 2JRHA 1Q3DA 4LL5A 1H25A 4ZZMA 2YN8A 1NXKA 3JUHA 5JQ8A 4GUEA 4JX7A 4A3PA 4U0IA 3AMYA 3UMXA 4E6DA 3JS2A 3T3UA 4ID7A 3FLQA 3BWJA 3R66C 3TNQB 4IBMA 2BTRA 4YTHA 5BUEA 5HLPA 4CNHA 2ZV8A 1GIJA 5IA2A 2GBJA 4YSMA 4FLHA 3ENMA 4FG8A 4ITJA 3KXGA 4FTAA 4A9UA 2C9WB 2IBIB 2K8HA 3TNHA 1XBCA 3PY3A 2XBJA 2Z59B 4MELA 1UD7A 3PZHA 2VO0A 2IZSA 3Q3BA 2JIVA 3LIJA 4I20A 5HD7A 2WO6A 3MFUA 4PMMA 4YTFA 3FLZA 1J1CA 2VTMA 3F9NA 3G33A 3LM0A 3U6JA 4QYEA 3A8WA 4O0TA 4ONAA 4URKA 4LUEA 3TACA 3HEGA 5LJJA 2C60A 1AQ1A 2NPTA 5DI1A 2OXYA 3Q4ZA 5CXHA 5CZHA 4ZTNA 3R8VA 2R3RA 4HZSA 4NM5A 2WELA 4AXAA 3P86A 5HO7A 4GJ3A 2V4LA 3BX5A 3P5KA 5CT7A 4FUYA 4A4LA 4KS7A 4BYJA 3GBZA 3JVRA 1WXSA 4MDKE 4K2RA 5I9YA 4QD6A 4PQNA 3LFEA 4HPUE 4ZY6A 3SOCA 2G1TA 3VS7A 4U45A 1ZOHA 4NM0A 4IMYA 4BDBA 3EWHA 2BR1A 4BI1A 2O2UA 3QKMA 1XT9B 4V05A 5ANKA 3L16A 4LDTB 2R3KA 5JMSA 4DC2A 1WZ3A 3G51A 4L9IA 4FJZA 2YAKA 2QLUA 3BZ3A 3LXKA 4AW0A 5GZ9A 4TW9A 2RG6A 5DOSA 5HE3A 5C8KA 3COIA 4O6LA 2NR2A 4ZY5A 4GK4A 3H7PB 4CKIA 3NUYA 4LM5A 2GQGA 5CNNA 4DGLC 4LI5A 5BMSA 5EOBA 4AJWA 1GJOA 1L3RE 3QF9A 3T3VA 2KJ6A 2KMAA 3CKXA 4PDSA 4AOJA 2LGYA 3ZIMA 2HCKA 3VS6A 1PF8A 5HCYA 2UW7A 3HRCA 5T3QA 5FM2A 4RJ8A 5HIEA 2WTKB 3DXNA 5DBXA 4EYJA 3OW3A 3D2IA 4DG0E 2F2UA 4G16A 1OL6A 3QD4A 2X81A 4EJNA 3FQSA 3SDLC 2UW6A 2UV2A 4WJPA 4I21A 5FBOA 5DPRA 1ZAOA 5HG9A 1DAWA 4ANBA 5ITAA 5JFXA 1YKRA 2FCMA 1WXMA 3N9XA 3TKUA 4EONA 3VH3B 2YCRA 3DGKA 3D2KA 4W4VA 4HVSA 1Z5SB 3ONSA 3DBCA 2CCIA 2A2AA 4BICA 4A3OA 2LGDA 3EQIA 2ZJDA 5HIDA 2X0GA 3FZPA 4Q5HA 5EKOA 1YI4A 2L7RA 3NHEB 2Z7LA 4PS8A 3V60A 2GNIA 3FMJA 4YP8A 3R9DA 4NK9A 1UWHA 5KHWA 2C7NB 4HVDA 3D5UA 2GTMA 2B52A 2HXLA 3E87A 4FSNA 2HE7A 1J91A 1PMNA 3CD8A 3FSFA 3TEIA 3WYXA 4FSWA 4QTBA 1J19A 1YQBA 2R3HA 4F7LA 2JC6A 5CENA 4EHEA 1WCCA 2HZ4A 3ZDUA 5AADA 5KCVA 3UQBA 2B9IA 4FSRA 4UN0C 4B4LA 2L00B 5KO1A 2IZTA 3MBLA 5I5ZA 5AMNA 3GNIB 5DCNA 4W9DA 3TKHA 5L83A 4G31A 4RGJA 3AXCA 4JRNA 3C13A 4GL9A 2YCFA 2ITNA 3AGMA 3DBSA 3EIDA 4A06A 4LJOB 4RM9A 3HM6X 4DFNA 4I4EA 3TT0A 2G45B 1NY3A 1Q3WA 3MPAA 3PJ2A 5DA3A 2E9PA 4FKRA 4NIFA 4D1XA 4R3RA 2W05A 2FSMX 4TXCA 4NM7A 1P4FA 5F20A 3UZTA 4FN2A 3LPBA 4XX9A 4O0UA 5EH0A 4AT3A 4HNFA 4U42A 4BCJA 3DKFA 4BGGA 1UZXB 3QUEA 4WHZA 4KZCA 1Q8YA 4RRVA 3CC6A 2IW6A 4X3FC 5CALA 1WZ0A 4OR5A 4YC6A 2WTDA 2Q0NA 4C4EA 4S33A 3ZLWA 3UOKA 2IZVB 2OGVA 4QT1A 5FQDC 3TZ9A 2ITUA 3ZRMA 3L13A 5D6JB 5EYDA 3AD5A 3PXFA 2L3ZA 1Q8WA 4DEEA 2LRWA 3LE6A 3QKLA 3R01A 3RK7A 2VD5A 3S1HA 3U9NA 5LCJA 5IMEA 1GIIA 4L67A 5FXSA 3GFWA 3HMOA 3ZYAA 5JRQA 3PE2A 3KULA 4BTJA 2XK4A 2P33A 2YJSA 3C0GA 2JKKA 4W4WA 4BHZA 5JKGA 1JKLA 4MYGA 3WF5A 3FLNC 4F1TA 4X2NA 5E6OA 3HL7A 3ODZX 4XLVA 4EQUA 3HHMA 4O0RA 3NPCA 4MQ1A 1DAYA 4W9FA 4GMYA 1OTRB 4GSWA 2M17A 4ZRJA 4HGLA 4KBCA 3R04A 3ZEPA 1LUFA 4NTSA 4HZRA 2YLMA 4W9GA 3X23A 2JAMA 4H3BA 5AUVA 1MQ4A 1LEZA 3EN9A 3LFAA 2DYOA 3FI4A 2QOCA 4KDLB 5ETAA 3QCQA 3IDCA 2LRUA 2VO6A 3DAKA 1YI6A 3AU4A 2XKDA 5E8ZA 3QL8A 2WIHA 5H8EA 3S2PA 4PS7A 3P23A 2XJ0A 3O7LD 1OEYJ 2QOKA 2UVXA 3EQGA 5HU9A 5JFVA 4PYUA 4M14A 5EFQA 4EH3A 3REPA 4PTEA 4MD9E 2FB8A 3EFKA 3R8ZA 4DDID 2BZKB 1V6EA 1PKGA 3AC8A 4UWYA 4A9TA 2WU7A 3AQVA 4JIAA 4JR3A 2OJFE 4E5AX 1TBEA 3OAWA 2RGPA 3OBGA 4F6UA 3NNWA 2AL6A 3AU5A 2P55A 4W9HA 2Z60A 3UC4A 3VF9A 4FSYA 1NDDA 5B0XA 3QUPA 2YLFA 5DGZA 3KXNA 3CTHA 3ZNHB 2JF5A 3BBWA 4GRBA 4KRCA 2A0CX 3MH1A 2WMRA 4TWOA 3IVFA 3DQWA 3OP5A 3I79A 3F82A 4J95A 4NJ3A 1UBQA 2PEAA 4MWIA 4QMQA 1WRDB 2VRRB 4D4YA 3QBNA 1YXTA 3NGAA 4RJ5A 3U6HA 4PX6A 1V2YA 1M17A 5DPVA 2W1DA 4BVUA 2AEHA 2XM9A 3GU7A 3SA0A 4GDLB 4TUUA 4D1ZA 3F5UA 4QMNA 2Z7RA 4YJVA 2K8CA 4BKSD 4LGDA 5HNBA 3BLHA 4FZFB 3CBLA 4DYMA 4GIVA 2HJ8A 3PV1A 2CGVA 4MXZA 3AT4A 4G50A 1OKWA 2O5KA 2XK3A 2V55A 2ERZE 3QTUA 4GYGA 1R0PA 4MXYA 2QR7A 2GTNA 4RPVA 4OT6A 1UU9A 4TKSA 4XG8A 4J8MA 3OW4A 5CZIA 2WKMA 3HA8A 5DT4A 3VBYA 2XZSA 4Y85A 4E8AA 5J87A 5L4QA 2FCNA 3ZUUA 3ODYX 5KMNA 4RFMA 1WBOA 1UBIA 3ALOA 4JL9A 1E8XA 5ANGA 4Q9SA 4LFIA 3UINB 2XIRA 4J1RA 4A9SA 1RAXA 4GIIA 4RG0A 4RIOA 4K7WA 2ZEQA 4JG7A 3POZA 3QC4A 5LCKA 3OEZA 5L8KA 2YIQA 2IVVA 3W10A 4AZFA 3OTVA 2KDIA 2E9VA 5HTIA 1Q5KA 2W4OA 4FEQA 1YX6B 5BVNA 4KKHA 5TKDA 5TT7A 2Z0EB 2H34A 2KDEB 2CHLA 3DS6A 4L52A 4M8TA 2CSNA 3P2BA 3VH4B 3ACKA 5HLNA 3MTNB 3FHIA 4DEDA 1WGHA 3KF7A 4EK4A 2EXCX 5HNGA 4AP7A 5CSWA 5EHOA 4FJYA 3OXZA 3QTZA 4GG5A 3TXOA 4HYIA 2PE6B 3E8EA 3U4UA 4USEA 3FQEA 4ANVA 4AN9A 2GPHA 4HCTA 3KL8A 1UKIA 3RM7A 1YW2A 5CU3A 4F1SA 4K81A 4V0GA 3IS5A 3UIXA 4ANQA 4I6PA 4IG7B 5AP5A 2IO2B 5IF1A 3DK3A 3QGWA 3T8MA 2VN9A 4II3B 4RIXB 2WQEA 1OECA 2FVDA 4TWCA 4F65A 1V0OA 3GC8A 4EH2A 3ROYA 3SOAA 2J6MA 3ZLXA 4FA2A 3OMVA 4QPAA 4NQKE 3KCKA 1OKYA 5CF4A 3THBA 4YBKA 3CPCA 4M3QA 3SAYA 5I4NA 3QWZB 3TUBA 4WO5A 3ORLA 4ANNA 2O63A 3ORIA 3RNIA 4KDIC 2GCDA 2IO0B 4X6RA 2JDOA 4PDPA 4BZOA 4C61A 4GDKA 1CMXB 4JS8A 1OVEA 3ML9A 4GS6A 2MBHA 4K7SA 5HTCA 3Q4TA 5IEXA 4RVKA 3TZ7A 5J5TA 1H0WA 1XQZA 3VQHA 2UW8A 3FLYA 2OICA 4AGWA 4AE9A 2C5VA 2O65A 3FZOA 3R0TA 4IC8A 4MXOA 4DHZE 5AV2A 4AOFA 3D9VA 2IY0B 2VX3A 4FSZA 5AIKA 1R3CA 4ZSGA 1EF1A 4IX6A 1WVYA 2BZIB 2R3PA 4U3YA 3OWPA 3AT2A 2B1PA 1PKDA 4YZDA 5A3XA 3OXIA 4EH7A 3HK0A 2PE1A 2R4BA 3UYTA 2C6OA 4F0GA 1Q8ZA 5AV1A 4QQJA 3M11A 4G3FA 3F5GA 3HIZA 2JBOA 2J0MA 2VNWA 3OWJA 3KK9A 3WZEA 3DDCB 3DVNV 1A9UA 4BVUC 2C5XA 2JDTA 4GUBA 1RLFA 5I3OA 4DXAB 1RJBA 3BYSA 1P9DU 3D7TA 3FZRA 3QA0A 4TT7A 5EW3A 3R71A 3H9DA 5I9VA 4M7IA 2JD5A 2QLQA 1PXOA 4FTOA 3D7ZA 1SIFA 2LJ5A 3VF8A 3QARA 1FGIA 2KFJA 1L7YA 1H8CA 3PJ1A 3V6RA 1YDSE 3F3VA 1KE5A 4GV1A 4L00A 3ZNID 3RZWC 4IANA 3R8LA 3VN9A 3PHXB 2EMTA 3FZTA 2O2VB 1IYFA 2OBJA 3MS9A 3EL8A 2GNJA 5FP6A 4KS8A 2WMQA 3OUKA 1H1SA 3FSKA 3I1AA 4FKIA 4RIWA 4RLKA 4IZAA 5HOAA 4EBWA 3HV6A 4CFWA 3UDBA 1FVRA 2F2CB 4M69B 4ZJJA 4U81A 3EQCA 4QP9A 2GDOA 5EKNA 3ML8A 3NEWA 3CPBA 3TV4A 4K8AA 4XP0A 4IAFA 3ORTA 3QC9A 2OZAB 4O91A 5GJFA 3VULA 4Y95A 5HX6A 2VAGA 3F5XA 3NNUA 2IYDB 3VBWA 3OXTA 1Q61A 2UYZB 3LOKA 1MG8A 4NNJB 3AC4A 4ITHA 3BPRA 2XJ2A 2KQ7A 2PWLA 5FG8A 5L6PA 2O6VD 2PVNA 3IG7A 4IAAA 3HP5A 3BYMA 3HNGA 4MVFA 3C1XA 2OK1A 3VHEA 3RAKA 2NBWB 5IH6A 2XF0A 2R3IA 4PV0A 2MW5A 5EDSA 1O6LA 4RJ7A 3BHTA 3R28A 4W4YA 1TVOA 4I6LB 3OROA 2OH4A 4BDKA 4YJPA 3TTIA 3D0EA 2N1VA 4QMYA 5BUIA 2OG8A 4FULA 4S32A 2WFYA 3LCSA 5J9ZA 1J3HA 1U5QA 2EKEC 4RX7A 5DFPA 1PXJA 3CQUA 3PXRA 2OF2A 2XKFA 4O0XA 3HV3A 3VW6A 2UWQA 3B1LX 4XX5A 4W8EA 3KXHA 4KBAA 1PY5A 1DS5A 2PUUA 5FGKA 4ZXTA 4AT4A 4IJ9A 3FMLA 3MIAA 5CTPA 3IFWB 2WB8A 3NUNA 4IC7A 3V51A 4PP7A 1OEYA 3UNZA 3KY2A 4XZ4A 3O8TA 2XK5A 3JVZX 1FINA 2LGXA 4WKQA 3MTFA 3AC1A 5CVHA 1YDRE 2YDIA 4YJOA 2XK6A 3KXXA 4MXXA 4YZBA 4YHFA 2OIBA 4FI1A 2DAJA 2ITPA 4EQMA 2XA4A 1MRUA 3E7VA 1WJUA 2BUJA 2KULA 3QGYA 4K1BA 2R9SA 3V01A 1ZYLA 5KKRB 1F9JA 2V7AA 1YWRA 4GJ2A 4USDA 1CMKE 4B0GA 5CAPA 2JXXA 2H8HA 5E6NA 5AV3A 5LXHA 3IW7A 3QQJA 2WU6A 4JDJA 2NPTB 5AA9A 4LUDA 4X3JA 4R7IA 5J95A 2EB2A 5M53A 1PXPA 3ZVVA 3DK6A 2UVZA 2W1HA 4F7ZA 2E9NA 2WMSA 2XIXA 4FKGA 3E8DA 3FPQA 4R5SA 3PXZA 1QL6A 4RA5A 4DEHA 3QLGA 4IWPA 4DGNA 1PQSA 2D3GA 2Z7SA 4KRDA 5HKHA 3DY7A 3IW5A 3B2WA 3Q3FA 2FUMA 2VWUA 3ELJA 3R02A 5I0BA 4EZLA 4DEBA 5CF5A 2VTRA 1FXTB 3BIZA 3R7OA 2XJ1A 5HVYA 1M14A 4GCJA 2KO3A 2FCSA 3P1AA 2YITA 4FV9A 2ZJWA 2WQNA 3PWYA 4FKJA 1LM8B 2X9FA 3DAEA 3UOLA 2ZNVB 4O2ZA 3D94A 3VO3A 3DLSA 2GBRA 2XEWA 4V01A 3SV0A 2X6EA 3G5DA 3RWPA 3C4EA 3GC0A 3IDPA 4BDHA 3KVXA 1QCFA 2YIYA 3WF9A 3DCVA 2I1MA 3QQHA 4FIJA 4FR4A 2HTHA 3FWQA 1KE9A 3FKNA 3QCXA 2P2HA 2JDVA 3E64A 3TTJA 2PVMA 5BX0A 4YJRA 5FEDA 3ZONA 1WJ6A 4APPA 4GT4A 2VWXA 1WBSA 4H1JA 4P4CA 4GU6A 4YMJA 3MPMA 3VFKA 4ACHA 2VTNA 4RQVA 2V62A 3HMIA 3PSBA 2YIWA 4PMTA 1Y8GA 4FV7A 4RWKA 3H9RA 2BKRB 2GNFA 5AV4A 3ZO4A 4BWXA 4XBRA 3SC1A 2X2KA 3FMKA 5F9EA 3VUTA 3DTWA 3NUSA 3PXYA 3TV7A 4DTKA 1CKJA 5EI8A 2PE9A 4OTWA 3W2OA 4BBFA 1SVGA 3VBXA 4N4SA 2E2BA 2I1KA 3MIYA 3R3MA 1XH9A 3EJ1A 2CLXA 1ZGUB 2VV9A 4DEAA 1WF9A 5HG5A 2LVOA 3K5VA 5EG3A 1LR4A 3LXNA 5DRBA 4CCBA 4ZAUA 3JW0X 3PSEB 3EQHA 4P90A 5DEYA 2VTHA 3PRZA 4DBGA 2BROA 3EN6A 3MH0A 4XG3A 2VTAA 2C0OA 4QPMA 3ZNZB 4R5YA 1BKXA 3UIOB 4MXCA 5F4NA 3R21A 2UZBA 1JKSA 4TYEA 4UMPA 3BRBA 5L8LA 1KJTA 3RWQA 4APCA 3IECA 4QYHA 4EOSA 1JVPP 1OGWA 3L10B 3WAOA 2PHKA 5IEVA 1R39A 2J0LA 2PVLA 1Y57A 4HLEA 5EK7A 3QAME 3ZHPC 4D0WA 2B7AA 1P98A 4KSPA 5IA0A 4BBNF 4NIFB 5J79A 2HY81 4J98A 2ETKA 2C7MB 2DAFA 1ZWSA 4I6FA 3A61A 4PY1A 2W9FB 4ZLYA 1SYKA 4QQCA 4D0XA 3PT2B 2FH9A 4ANLA 5CVGA 2B9JA 5DR6A 4ZEGA 2JZZA 4ERWA 5E8XA 2ONLC 1IASA 3OEFX 3QXPA 3FDNA 2XEYA 2MQJA 4K77A 1K9AA 1YVJA 2QOIA 4J97A 4C33A 4PS3A 4E74A 4IUMB 2NPQA 2QODA 4MSQB 3IG3A 1V0BA 3QRTA 5BUJA 1A06A 3BEAA 4OVUA 4W9JA 2LASA 3QQGA 5G1XA 2IJMA 3R1NA 4J8NA 4EH6A 3NCZA 4HWIB 3E3BX 4Y83A 4YU2A 4AFJA 3NSZA 3NW7A 4I92A 1SE9A 5D10A 1JKTA 4WD5A 3G2FA 5ETCA 2C6LA 3PRIA 4H3QA 5CEQA 4XV3A 5A6NA 5M4UA 1XWSA 1WY8A 1Q99A 2UW3A 3KULB 5CLPA 3QFVA 4FTMA 5K4IA 1WXVA 4C8BA 3D15A 2C5LC 4F7NA 1OIRA 2AWTA 5KE0A 3U4WA 4KNBA 3R9NA 4CTBA 5AUUA 5JZJA 2K39A 2QVSE 3NW5A 3OC1A 4B9DA 4PMSA 4P7IA 5K4JA 3TCPA 3VTUA 3JXWA 3L08A 2RD0A 3TNWA 1H0VA 1OPKA 2VWYA 3V04A 3DTCA 1FVVA 2VWBA 3IO7A 1V81A 3NY5A 4M12A 4BIEA 2BDFA 2C3JA 4LJPB 3R1QA 4M15A 5IUIA 3U9CA 3ERKA 3NAYA 3RULA 4IB5A 2AYPA 3F2AA 2KFKA 2QO9A 4FVRA 3C0IA 5J8IA 1OIQA 3R7UA 4F63A 3VS3A 3VUXA 1ZARA 1BUHA 4EUUA 1P5EA 3O2MA 4E6CA 1EO6A 1V49A 4O27B 4FADA 4XMOA 4YJTA 2JBPA 4ANSA 3SW4A 4TQ0A 3R1SA 4RT7A 3E63A 4QTAA 1DI9A 2PMNX 2V3SA 5EI6A 4MNFA 4A4XA 2XNGA 5CASA 1H24A 3H1UA 4HK2A 5AR2A 3QTIA 5HCXA 2Z8CA 3DFAA 2BMCA 4EOYA 4BDGA 5EYMA 3U7DA 2I1JA 2O8YA 5ETIA 3UZPA 5LOHA 2C6EA 4IACA 2OFUA 4G0NB 1E8ZA 5J7HA 3EB0A 4EYMA 2K1FA 4FSTA 1UWJA 2OW3A 1E8WA 1JKKA 2AC3A 4FOBA 4KZ0A 4I6QA 4L68A 5AP7A 4ZTSA 1YQJA 3PFQA 3R63A 2EUFB 2QHMA 3UP2A 3WIKA 1W8CA 3PP0A 5AP4A 4BIBA 4FTTA 3FXXA 5C26A 3P0MA 3WANA 4AACA 1W82A 3TNIA 3MN3A 4RLLA 5CEKA 4PMPA 3MVLA 4BCIA 3LVPA 2KJRA 5IZFA 4ZLOA 4W4XA 1SMHA 5KZ0A 5A4TA 5J1VA 4IIRA 3O51A 1U4AA 4G9CA 5KBQA 3EN7A 2X2MA 2YM8A 4D4VA 2X9EA 2ITTA 1ZMWA 4M67A 4C7TA 3N30A 2HZNA 4D2PA 3OCBA 4D2SA 4FZ6A 4I0RA 4FTLA 3QZGA 3A2CA 5FEEA 3SW7A 2WYQA 1WVWA 4CRLA 1M94A 2LI5A 3UVRA 2M4NA 2RL5A 4G6LA 4XP2A 2X8EA 4DAWA 2BZHB 3LJ2A 3W16A 4FKSA 2PVRA 4G2FA 4KD1A 3PY1A 4O0YA 3I81A 4KAOA 4TYIA 1ZXEA 4ZTMA 3R7IA 2ITQA 1M2PA 2UW4A 3BHHA 3UIBA 3DOGA 4F0FA 2WMTA 4I41A 4O0SA 1H01A 3DV3A 4FZ7A 4CMOA 2CU1A 3KF4A 3DJ6A 4LMUA 5CX9A 4F6SA 5BQ0A 5K5NA 2L8JA 4BKYA 3HKOA 3LM5A 2F49A 2WQBA 3ZXZA 3OVVA 4D2TA 4L6QA 4CFMA 4FK6A 2C4GA 3Q5IA 4U44A 3QA8A 2UZNA 4N6ZA 4TYGA 4OTGA 4XCUA 3F61A 2BKFA 5E1EA 4F8CB 2F4JA 4H39A 3QU0A 3Q04A 3DKCA 4C3RA 4DGMA 2WTWA 4D4SA 5CEPA 4BKZA 4E4MA 3QTQA 2ETRA 2YABA 3OY1A 3MW1A 3BWFA 4EL9A 2DZJA 3I0OA 2GNLA 1YI3A 3QQLA 3EZVA 3ZNGC 1WZYA 3K2LA 4MGYE 3WI6A 3MH3A 4TYHA 3W1SC 3WF7A 4RC4A 3F66A 4Y8DA 3ZDTA 1WVXA 2GHMA 4XG7A 4HDOA 3QTSA 1V5TA 4FIHA 5KMJA 1MRVA 4Z55A 3MY5A 3UNJA 4KVGB 1KOBA 1OIUA 4Y5QA 3NNXA 4FNYA 2VUWA 2BYFA 2CJMA 2FA2A 3T9IA 2RGFA 2JAVA 4K7UA 5H9BA 5CXZA 3PYYA 3ALNA 3GCVA 5C8NA 3M95A 5HBHA 1OL7A 4FL1A 3N32A 2AC5A 5AR7A 3H6NA 3AMAA 1TQIA 4BB4A 3S95A 1FPUA 3VQIA 2HY0A 2KWCA 1JAMA 4V0GB 3W2PA 3E8NA 5KMOA 5AP0A 3EC8A 3TUDA 4XEYA 5AR5A 1GG3A 4CZUA 1G3NA 3CQWA 4I5MA 3IQ7A 4YPSA 3KC3A 4BBMA 5LMBA 2OJIA 4UMQA 3F7ZA 4ITIA 1YXVA 2R3NA 3SD0A 3VUGA 4EKKA 5HNIX 2I0HA 3UO5A 3OBJA 5CQWA 4QYGA 3HECA 3BU3A 3AGLA 4MM3A 5KHOA 3RALA 2F7XE 5DT0A 2PZYA 2N7DA 3N3KB 4AX8A 3OJ4B 1WBVA 4FTKA 4PWNA 4PPAA 2J0KA 2HELA 2R2OA 2WMVA 1JSTA 2DWBA 4NH1A 1PMUA 4MHAA 3OOGA 5BVEA 2WOTA 2YM5A 3MH2A 2QOQA 5ETFA 3UJGA 4GDKB 4NT4A 5LMKC 4EKLA 3NIEA 3Q6WA 4HVHA 1PYEA 2KLCA 3DQVA 3ZTDA 2DZIA 1P0RA 1KV1A 3ZUNA 3JPVA 4D2RA 5FWKK 4DWFA 5AP3A 1ZOGA 3FMNA 3E62A 4OW8A 4UYAA 2C6MA 1NA7A 1KE7A 3OZ6A 3VWAA 5C8MA 2ZM4A 1NVSA 4TTHB 5DH3A 5K9IA 3PPAA 2UUEA 3DZOA 4GFMA 3PA4A 4NW5A 3BELA 3LFFA 4XJ0A 5CHFA 3CD3A 3C51A 4TY1A 2G4DB 3LDZE 4IWDA 2WTKC 4J99A 3ORNA 2VO3A 3CF6E 4HCNB 5LXMA 4WIHA 1D3ZA 3AG9A 3DNDA 3WF8A 2J0MB 3C4ZA 2BHHA 3MFRA 4BCNA 4ZZOA 3NUUA 2CDZA 3NDMA 2UZVA 3PVUA 3DKGA 4A9RA 1J0GA 1L2NA 2VTPA 4JNWA 2QQ7A 2IWIA 4OUCA 3MVHA 3VDZA 3RAIA 3D7TB 4HW7A 4GSBA 5AM7A 4RM8A 1QPEA 2I0VA 2G3QB 4TPTA 5M4FA 3VTVA 3IKAA 3O96A 2XYNA 2ZYBA 2Y6MA 1SGHA 3KVWA 4MBLA 4ASDA 4FYOA 3BYVA 4Q9ZA 5JHAA 4JQ7A 5AZHA 2BCJA 3MVJA 5DHJA 4WUNA 4E3CA 2QG5A 2YDKA 4OGRA 4RIWB 4U43A 4WBOA 5CS6A 1GZ8A 4BTFA 3GEQA 2ONLA 4CLIA 3DLZA 2RFNA 4HJOA 2R7BA 5BVOA 4WQOB 5HG8A 4QNYA 2W0JA 3VS1A 4W9WA 4ZJIA 4X0MA 5DVRA 4ACCA 5B7VA 3PJCA 4UEUA 3ZO1A 2H6DA 2ZB1A 2C3KA 3I0QA 4YJSA 1S9JA 2F9GA 4G9RA 4QTEA 3QZIA 4U3ZA 3P7AA 4AZTA 2WEIA 2UW0A 4FICA 1UNGA 5T68A 3PLSA 2IN6A 3RPOA 3SRVA 2L76A 5E90A 5BO4B 5JGAA 4AJYB 3CEKA 1ZY4A 5CVFA 3DA6A 4WWPA 1O6YA 4B95A 3SHEA 3BKBA 1WX9A 4XUFA 2BPSA 5AJQA 5LQFA 1WGYA 2JKOA 2WQOA 5CNOA 2UZDA 4IZ7A 4YZCA 4JDKA 5IA1A 4DGOA 4FYNA 4DBNA 3COMA 4ZLZA 4ZYNA 4HXDA 4N6YA 3ZH8A 4AT5A 3APDA 4ALVA 3GOKA 1LP4A 4NM3A 4BGQA 4F9YA 4NCTA 4FKLA 2NP8A 2PTKA 3H9FA 2NS5A 1RFAA 4LGHA 5AUYA 2Y4IB 1VJYA 2GMXA 3EH9A 3RAHA 1BL7A 3OG7A 4G3CA 4M66A 4MK0A 3BHUA 4XOYA 5KNJA 2ZVNA 1CDKA 2QOOA 4J7BA 3ECIA 5JRSA 4WNPA 4M8NA 2XK5B 3TKIA 4TZRA 4AOIA 3BU6A 2EMSA 4F7SA 5AUTA 4MEDA 3VQUA 3VUIA 4EZJA 4B8MA 4EHZA 3OT3A 3S4QA 3N51A 3VJOA 3A62A 2ITVA 5EDQA 5L8JA 3KXZA 5C03A 3EQBA 1YHWA 4HOKA 4BIDA 2EXMA 2C30A 3KB7A 4GOCA 4W9IA 1UH6A 2WEVA 4LOQA 1ZMUA 4CEGA 4FOCA 3W2SA 5A54A 4AW2A 3DB8A 2DUVA 3JYAA 5L2QA 3PG1A 4FVPA 5AX9A 3W2QA 4IAZA 1BMKA 2BDWA 5E91A 2R0IA 4BDAA 4OAVB 5DG5A 5D7VA 4F9CA 2A4ZA 4WWOA 4QMWA 3R73A 1KLVA 3R8PA 1WI0A 4JAJA 4JGHB 3IBEA 3GZNI 2C7HA 2JGZA 1JWHA 3MI9A 5CAVA 3UQAA 4EZKA 1YOMA 1NVRA 3CCNA 3GT8A 2XKCA 4J71A 4YTIA 3P7BA 4DH3A 4FV4A 3TI1A 1WBPA 1ZKHA 4P7EA 1XH5A 3MHSD 1IP9A 3S3IA 1M52A 2HOGA 3Q96A 4X2GA 4ZTHA 3RHXA 2KDBA 3A9JB 1RDQE 4FVQA 3R8MA 3Q3JA 1ATPE 1MUOA 1RQQA 2K6QA 3KUDB 3E88A 3R9HA 3VAPA 2OXDA 3COHA 4LGGA 1U59A 2XBAA 4H36A 2IO3B 3A60A 3PTGA 5CY3A 4AOTA 4Z3VA 2XEZA 4L44A 4OBOA 4RC2A 2XMYA 3OD6X 4O6EA 2G4SA 1LEWA 4HPLB 3T9LA 3VUYA 4GGQA 3LFSA 4AN2A 2R2QA 3KU2A 1M7NA 2RFDA 3FKOA 3C50A 4ZSAA 1YIWA 4X21A 4D58A 1V9JA 3O23A 2DHZA 1WFCA 4I3ZA 4P5QA 5IA7A 2ZM1A 4RVMA 3KH0A 2W1ZA 4XG2A 4G3EA 3MY0A 2KNBA 3M42A 1JLUE 3H30A 4Y72A 3V5LA 5HVKA 3UTOA 4NTTA 4BZNA 1CM8A 3QYWA 3TG1A 2IZUA 1CSNA 4DITA 2WMWA 1V5OA 2LZ6A 4D1SA 4EHVA 2R64A 2YDJA 3R9OA 4ASWC 2QC6A 3LFDA 1ZZ2A 4S30A 1KM7A 3EZRA 1H28A 1UA2A 4B7TA 2R0UA 5DNRA 2R5TA 4ANWA 1JOWB 3WZDA 5C9CA 4AW1A 5IH5A 2ACXA 3H0ZA 3R8UA 4CKJA 2FCQA 1GUAB 3WA0A 5DE2A 5L95C 4ASEA 1BYGA 3H0YA 4PL3A 3UG1A 1G5SA 2HIWA 4EOQA 1XO2B 3GCQA 5JGDA 2BAQA 2PY3A 5K0KA 3LMGA 5LVPA 2KDFB 3X0WA 2A27A 1H4RA 4S2ZA 3II5A 2KWUB 2OU7A 1IPGA 4FF8A 2PVFA 4ZSEA 4D5HA 3ZEWA 1RRBA 5AUXA 4QQ5A 1OI9A 4X2FA 4HGSA 3ZUVA 3D83A 3TZMA 4Y73A 3FHRA 4FNXA 4RX9A 2KOXA 3BHVA 3ORKA 3QHWA 2NO3A 3RP9A 2BALA 1WH3A 3Q53A 1Y91A 3MJ2A 3QZHA 4BBEA 3UF8A 5FR6A 2JIUA 4YURA 2ZV2A 3E93A 1WR6E 3PHWB 5E8WA 4EWHA 3RZFA 4G3DA 1B39A 3G90X 1WJ4A 2UZWE 1YD8U 5DPWA 3FMDA 1F3MC 4XRLA 5HCZA 4BCHA 3ZUTA 2VTIA 3I6UA 2DX5B 2J2IB 5IG1A 1R1WA 2YJRA 5A6OA 5CHVC 3H3CA 3GP0A 4D9TA 4IX4A 5M57A 2KK8A 3KUCB 2JWZA 3SX9A 3GVUA 4EOIA 4YJUA 1PXIA 3KN6A 4ZS0A 1E9HA 4MWHA 4BDJA 4RA4A 4DLJA 2ZM3A 4FT3A 1UU8A 1E7VA 2QOBA 3EQPA 2I0EA 3HMMA 4HGTA 4ANUA 2QONA 4FT7A 3PA3A 3A33B 4HYSA 4C4GA 3B8RA 2JDSA 3BV2A 3LQ5A 4FKTA 3RBWA 3NRMA 3AI5A 3CSFA 2YHVA 3FXZA 3W2RA 3FC1X 4LQMA 3TJCA 1H26A 4GVJA 3Q9WA 1X1MA 3LFCA 2WXVA 3TCAA 4MD7E 5EM6A 2C5OA 4HDQA 5LLIA 1T45A 4CYIA 3MTLA 4HGEA 3RZBA 5E1SA 1G6JA 1WBNA 3VUKA 2AUHA 2MA9B 3O50A 2PVYA 4ZP5A 1APME 3PIYA 4XV9A 2VGOA 2XNPA 5AM6A 2OJ9A 4DGGA 4L45A 5HO6A 4GU2A 2QOFA 2O6VA 4UYNA 2KFKB 3R00A 1GOLA 2OH0E 4UALA 2RKUA 3SU8X 4KKGA 3GB2A 3W8LA 5FXRA 5JH5C 2ZDUA 1OM1A 2W1CA 2W1IA 3IONA 5JFSA 4FBJB 4LDTD 4F09A 4GH2A 4KIKA 3V5PA 3U8ZA 2IVSA 3E7OA 5JN2A 2N9EB 4KIQA 5LARA 4GB9A 4TWNA 5E8VA 1H8FA 4A20A 3L54A 3HV5A 2CGWA 3LCKA 4NY0A 3Q9YA 3PLVA 4C36A 4UBAA 5CI6A 4E26A 5AIRA 5KUPA 5IH4A 3ZM4A 1OUKA 1ZMVA 4X3FA 4W9KA 4YHJA 2FIDA 1ZOEA 4ZSLA 2JIIA 5CSXA 2ITYA 4II5A 5EHLA 3ANQA 2ETMA 4JRVA 3NYXA 1YWVA 1TQPA 1ZYSA 3SHQA 3CQEA 3ALBA 2VTQA 5BVWA 4J53A 4BFRA 5HEZA 5FD2A 4XH6A 4I5CA 4IFGA 4L46A 3OFMA 4FMQA 3V6SA 3QUDA 3MFSA 1FMOE 1O9UA 3Q6UA 2KX0A 3LCDA 4K9YA 1WMHA 3CJGA 5JT2A 2ASQA 2EWAA 2F7EE 2OSCA 3C0HA 1E7UA 2MBOA 2X7OA 4FTUA 3MPTA 4LOPA 4B6LA 2UW9A 2X4FA 1BX6A 5JK3A 4CRSA 1URWA 4UZHA 2WTIA 2FSTX 2C5YA 2KTYA 4NKAA 3ETAA 5H8GA 4BWPA 3IOKA 3H7SA 4IHPA 2W17A 2N4FA 4PDOA 3GXLA 4RSSA 4CLJA 5G55A 1IA8A 3UC3A 4M13A 5IA5A 3FMEA 2XH5A 4IVCA 4MCVA 2G2FA 5HE2A 3UO6A 4CFFA 4DN5A 4EOLA 3W1YA 2BAJA 1XQQA 1IRKA 1OKVA 1OPLA 3H4JA 3ZU7A 2V22A 3EFLA 3NNVA 3V5WA 2XK8A 3NUPA 3HUCA 5FRIA 3L8PA 3VXWA 4QTDA 4FTQA 1U54A 1PXMA 1H1WA 2CN5A 2J5EA 3BGPA 3GU5A 1E1VA 4FNWA 4NJDA 4XG4A 4Z9LA 3RPRA 2HD5B 2N1WA 3AC3A 2V5QA 4CV9A 2B53A 1FGKA 5HORA 3ZC5A 3DBQA 4S31A 1GC7A 3GENA 5AEPA 2XNOA 3TBLD 1GZOA 5LVMA 1R4MI 4DG3E 4CSVA 4A7CA 5M4CA 2UZUE 5LVOA 3F3UA 4A07A 3U8WA 2CHZA 1UU3A 1I35A 1IG1A 2GNHA 3DZQA 3UP7A 3Q9ZA 5BYYA 3K5UA 1UNHA 2ESMA 3QQKA 4FV5A 4TYHB 2MP2A 5EM5A 1HCLA 2YM3A 5GZ8A 3ZC6A 1KOAA 2BFYA 2OFVA 1TQMA 2QURA 2DS1A 4LG4A 1VR2A 5B2LA 3HUBA 3WE4A 3C7QA 4C02A 1EF5A 1EUVB 2E9UA 3UPZA 2L0FA 4DCEA 2QO2A 3GQLA 1I44A 1RE8A 3PG3A 4Y46A 4CFXA 4C62A 3ZFXA 3DBEA 4N0SA 2RIOA 2X7FA 4PNIA 4XV1A 3TUCA 3CTJA 2BRMA 2L0TA 2PVJA
chains in the Genus database with same CATH superfamily
5KKRC 4O1OA 5DN3A 2BGFA 3W8QA 1WX8A 1WBTA 4RX5A 3GU4A 4UMTA 4JBQA 2PW9A 3A7FA 1NVQA 3A4OX 3DOWA 1KOTA 2KTRA 1WYWB 4FV6A 1D5MC 4JT3A 2QHNA 3APCA 3NOBA 1XBAA 4C2VA 2ZNVC 4CLJA 3UBDA 2R3FA 3UIMA 4ACGA 1YWNA 5DPSA 3HRDD 2YAAA 3OTUA 5BMMA 3G0FA 5F94A 1IGCA 3MA6A 5JZNA 4ARKA 2WZJA 4UY9A 5HE1A 3ZLSA 5AAEA 5DEWA 4C34A 4XNEA 2QI8A 3G6GA 3RJCA 1W98A 4OTHA 4YO4A 2KC1A 4E4LA 4GT5A 4UB7A 5DR9A 3W32A 5TR6A 3BGQA 2PZIA 3SXFA 4ANOA 2WAJA 3A7HA 4M0WB 3GUBA 1YXUA 4XYFA 3PPJA 2LUMA 3GZNB 3F88A 1PYWD 4QP3A 3S0OA 4BCOA 5E6OA 3PIXA 4RC3A 4F99A 3BU5A 2D3CA 5E8TA 4F7JA 4RJ3A 3NW6A 3RAWA 1YN4A 5A4QA 4DQOC 2MRPA 2IVUA 3QX1A 1SXTA 4BN1A 4XV2A 2HYYA 5ANJA 2XM8A 4C00A 4YJNA 3A8XA 5DR2A 1FD6A 5CEOA 5BYSA 1OB3A 5J9LA 2JFLA 2R3OA 4QP4A 3E8CA 1UGJA 2WU5B 3A1QA 2EU9A 1C1YB 4IDTA 4YLJA 3QQ8B 2Y6OA 3EQRA 4MGZE 5GHVA 4BCKA 2R3GA 2DLBA 2V7OA 4IB3A 2XB7A 2BTSA 3NUXA 1FOTA 1WGDA 3OY3A 4LV8A 4WNMA 3W5UB 4DEIA 3GCPA 3FQHA 1K53A 3OT8A 3R2IA 5JZEB 4HPMB 3AE8B 5CANA 2CN8A 3MP9A 4FIIA 3VHKA 4E73A 3E92A 5HZNA 1HCKA 2I2YA 3FPMA 1A5RA 2LXCA 4PRJA 3WIMA 4AS0A 3R2BA 4HPTE 2D2QA 5AR3A 1HOWA 3DVNU 4AZSA 4JXFA 3B08A 5HHWA 4PK1A 3VC4A 4O0VA 4HCPB 4LLGM 3PXQA 2G2HA 4FIEA 3F3WA 1EM7A 2ZDTA 3NLBA 5M44A 3PJ3A 3ZRKA 1AD5A 1ESFA 1E8YA 1Q1OA 4L8MA 1LQBA 5LXIB 4BKJA 1FMAD 4FJVB 4ZRKA 2F7ZE 4YR8A 3E5AA 3HMPA 2LUEA 4F70A 3W2CA 4CQGA 4IVDA 4IVAA 4NKSA 4D55A 2W3SA 3KMUA 1V1PB 4DK5A 2VWVA 2R3MA 2O6VB 4FV3A 1M2RA 2PVOD 5AR4A 4KWPA 3KUZA 5E92A 3UVQA 4O2PA 3FYKX 3FUPA 4BCGA 4FTNA 4EK6A 4LRMA 3TMPB 5CI7A 3G0EA 5J5SA 5AZGA 4IDIA 4BYIA 2QU5A 1Y6BA 5AP6A 1ZXIA 3PREA 3CTQA 2OO8X 3ZZWA 4HCUA 3PSDA 2BRGA 5AX3A 4HVBA 4CMTA 2DYMA 1B1ZA 4JBPA 5CEIA 4USAA 5HO8A 3CY2A 3RPYA 3WILA 4FTIA 3CKWA 2R7IA 4O22A 3DBRI 3FZSA 4ZIMA 2M0AA 2NCNA 4H3PA 2QOLA 5KBRA 1LPUA 3I4BA 1MP8A 4AA0A 2GBKA 3GI3A 2KD0A 5CU2A 2H9VA 5L2SA 3UIPB 2IEWA 3L4PA 4NPNA 4JIKA 4GMVA 3AE6B 1E5WA 2Y5BB 4WBBB 4GXBA 1WX7A 3O65B 1YOLA 4FSUA 1GAGA 5IUHA 2PL0A 1GAQB 2KTRB 5BNJA 4G34A 3VS2A 3CGFA 4KBKA 4RJ6A 3HLLA 2UZLA 2ZCCA 2IW9A 2FUHB 3KEXA 3ZO5B 3F7WA 2YEXA 1REKA 3VTWA 3W18A 2JDRA 4QRCA 4RWIA 1URCA 3ZSGA 3RYTA 3W1SA 3KYCD 5HBJA 1WE6A 5GZAA 1WGGA 3RNCC 1C78A 4E71A 4S34A 4TL0A 3DFCB 3VW8A 1YXXA 3FILA 2A5UA 4EOMA 4TQ1A 2CGUA 2K6DB 1YX5B 3QWKA 1MVKA 3PRMB 2JY6A 1FMKA 2CS4A 3P79A 5AAFA 4IM2A 3TV6A 5G2NA 3RM6A 5DRDA 3OF0A 3TJPA 4KSQA 1FVTA 2N9PC 2FGIA 5AP2A 1S9IA 1XH6A 1MQBA 4CYJA 1GZKA 4U79A 4FKUA 4XBUA 3HV7A 3C4WA 2WIPA 2XK9A 4FG7A 3CXWA 5JXVA 3F2NA 4WURA 3ZMMA 3PVGA 1SB3C 4H1MA 3LJ0A 3PWDA 2DQ7X 4MGKE 2WXKA 1AGWA 1YXSA 3MB7A 3NVWA 3QD2B 2WDRB 3WBLA 4M0ZA 3F6XA 3T9TA 3ZGZA 2KXJA 2PMLX 1XH7A 3RNGC 5TF9A 3FLSA 1ZYJA 3A1QB 1VEBA 3ZTCA 4AWJA 2DZMA 2MEKA 3WARA 2RG5A 2REXA 3Q14C 3T3NA 3HDNA 2OXXA 1ZY5A 1KWPA 3V6EB 2J7TA 4I93A 5D9HA 4TNDA 5IU2A 1NBFC 2Z0DB 2B3AA 4ERKA 5JGBA 4ACMA 4EC8A 2HWPA 2KJHB 3RCZA 2KN5A 4RX8A 2A4LA 2QD9A 4IZ5A 3QTWA 4MBJA 3C5UA 4QPSA 4D4RA 4OTDA 1SVHA 3NX8A 4MQ2A 1W83A 2RR9A 2EXEA 4JQWC 4EUTA 2VTTA 4LMNA 3KMMA 4BOSC 3HYHA 5I9XA 4NU1A 4CYEA 1JPAA 2JPHA 5HBEA 5EW9A 3RCDA 2DZKA 4WNOA 5TO8A 3APFA 2VZKD 2ZV9A 3QCSA 1VR9A 5EYCA 2IJ0A 4AFEA 3DBDA 4FG9A 1FRRA 1WMKA 1LXDA 2YIRA 2X8DA 1TKYA 2X4ZA 2XNBA 2MWSB 3M63B 2WXIA 1FIQA 5LVNA 4G6OA 1FQ1B 4TRLA 3AMBA 5KHQA 1XD3B 4M68A 3GC7A 1KSWA 3RVGA 2OIDA 2Y4PA 5AR8A 1DI8A 1LO5D 2RFEA 2J50A 3E3PA 2K25A 4EH9A 4KSLC 2NRUA 4L43A 3AECB 3R7RA 2KQSA 3EKKA 3A4SC 3PA5A 5HTBA 3UGBB 3GU6A 4ITKA 4JX1C 4YNOA 3Q52A 2A19B 3MJWA 3SXSA 2G15A 3C0RB 4G3XB 2UZTA 4D5KA 1PGAA 3WE8A 5FLFA 4OBPA 2BB5A 3DPDA 4C57A 4W9XA 5GNKA 3RNEC 2OJJA 3HX4A 3SLSA 4BBNC 3BEGA 3AOXA 1HZ6A 3K3IA 3HZTA 5E8SA 1KH0A 4AGDA 4FK3A 4O4BB 1PYXA 4FUXA 2C3LA 2JXTA 3R7GA 3IW6A 4N58A 2KHWB 4YO6A 1TGZB 4C37A 3ORZA 3V61A 1V0PA 3MWUA 5IPJA 5L2WA 1PXNA 4AUQC 4UV0A 2BHEA 3VVHA 3LCOA 4I23A 2WPAA 4FC0A 3AEAB 4UWBA 3CMMB 3OOMA 2Y5PA 3DDQA 4K6ZA 4YHTA 4A3PA 3AMYA 4E6DA 1TJEA 3FLQA 1SIJA 5HLPA 4CNHA 2ZV8A 5IA2A 4FLHA 2IBIB 3VR8B 3PY3A 3AE2B 2XBJA 2JIVA 3FILB 2WO6A 2VTMA 3BWUD 4URKA 3RNBC 2C60A 2NPTA 5DI1A 5CZHA 4ZTNA 4NM5A 2WELA 4AXAA 1QT9A 4C4VA 2G1EA 5CT7A 4MDKE 4FUYA 4A4LA 2G1TA 3G51A 4L9IA 4FJZA 2YAKA 2QLUA 3LXKA 3NUYA 5BMSA 4AJWA 2KMAA 2LGYA 4AOJA 3ZIMA 1PF8A 5HIEA 5DBXA 3D2IA 1OL6A 4EJNA 4WJPA 2UV2A 1ZXHA 1ZAOA 5HG9A 1DAWA 4ANBA 1YJJA 3N9XA 4WAFA 1Z5SB 3DBCA 4BICA 5HIDA 2X0GA 3V60A 1JCKB 5FKAC 2Z7LA 1P7EA 3FMJA 5KHWA 4HVDA 3D5UA 3E87A 4FSNA 3B9JA 2JC6A 1N63A 4FSRA 2L00B 5KO1A 5DCNA 3AXCA 4JRNA 3C13A 2YCFA 3I9V1 4D1XA 4NIFA 4ZHOA 2W05A 5F20A 3BZDB 3UZTA 1UZXB 4RRVA 2IW6A 1WZ0A 4OR5A 2Q0NA 4C4EA 3ZLWA 3C8YA 5FQDC 3ZRMA 3AD5A 1Q8WA 4DEEA 2K5PA 1TS2A 3RK7A 4P6VF 3PE2A 4BTJA 2YJSA 3TEYA 2WXFA 3ODZX 3NPCA 4MQ1A 1JALA 1XEEA 4ZRJA 3R04A 1FNVA 2KYWA 3SD5A 5ETAA 3QCQA 3IDCA 1AN8A 2VO6A 3DAKA 2LRUA 4HKZE 2WIHA 3P23A 2UVXA 5HU9A 5JFVA 4M14A 1MHXA 3REPA 4PTEA 3EFKA 1V6EA 1PKGA 4UWYA 4A9TA 2WU7A 3OAWA 3NNWA 4FSYA 1FM0D 1NDDA 5B0XA 2IDYA 5DGZA 2JF5A 4KRCA 3IVFA 3DQWA 1PGXA 2Q5WD 4QMQA 1V2YA 2W1DA 4TSSA 2JWUA 4TUUA 3F5UA 4QMNA 2Z7RA 4YJVA 4BKSD 3CBLA 3Q3OC 2HJ8A 2XK3A 3QTUA 4RPVA 2ERZE 4TKSA 4OT6A 5DT4A 4Y85A 1E8XA 3QC4A 5LCKA 3OTVA 3Q69A 2LFIA 4FEQA 5BVNA 4KKHA 2KDEB 2MJDA 2CHLA 2JQRB 4L52A 4M8TA 4RCOA 3ACKA 1WGHA 3N20C 4EK4A 5CSWA 3OXZA 4HYIA 4USEA 4AN9A 2GPHA 1YW2A 1TY2A 3UIXA 2VN9A 2WQEA 2FVDA 1V0OA 3NJTA 3THBA 3CPCA 4M3QA 3SAYA 1ET9A 2O63A 3ORIA 4X6RA 4K7SA 5IEXA 2UW8A 1R4NB 4AE9A 4IC8A 4MXOA 5AV2A 2IY0B 4FSZA 3OWPA 2B1PA 4EH7A 4F0GA 2K0PA 3F5GA 2J0MA 3OWJA 4CQNA 2C5XA 1RJBA 5EW3A 3FZRA 4FTOA 5EE9A 2QJLA 3PJ1A 3V6RA 1YDSE 3F3VA 3RZWC 3R8LA 3VN9A 3PHXB 3VRAB 2OBJA 3MS9A 2GNJA 4KS8A 4FKIA 4PT5A 3I1AA 1FVRA 4U81A 3EQCA 3TV4A 4K8AA 4XP0A 4IAFA 5HX6A 4Y95A 3F5XA 3NNUA 2KQ7A 2PWLA 2O6VD 4IAAA 3BYMA 1FNUA 5IH6A 1O6LA 2V9HA 4B0MA 1FNWA 4I6LB 3OROA 4BDKA 4YJPA 2N1VA 3D0EA 5J9ZA 4ZRPA 4W8EA 1NENB 5FGKA 4ZXTA 4AT4A 3IFWB 1OEYA 2XK5A 3JVZX 2LGXA 4WKQA 3MTFA 5CVHA 1YDRE 2XK6A 4MXXA 4YZBA 4FI1A 2DAJA 3E7VA 2BUJA 1ZYLA 1CMKE 4B0GA 2BVCA 3IW7A 3QQJA 2WU6A 4JDJA 2NPTB 5M53A 2UVZA 4F7ZA 3FPQA 4R5SA 4RA5A 4DEHA 4C4VB 2D3GA 3ZQ4A 3Q3FA 2VTRA 2ZJWA 3DAEA 4O2ZA 3D94A 3RWPA 2YIYA 2I1MA 4FIJA 4FR4A 2IGDA 2WQYB 5BX0A 1WJ6A 3TEXA 4GU6A 3MPMA 4ACHA 5TSSA 4FV7A 2JU6X 5F9EA 3VUTA 3NUSA 4RFBA 1I7HA 1SVGA 3VBXA 4A55A 2I1KA 1ZGUB 2CLXA 1P7FA 5DRBA 3EQHA 4RGNA 1I4RA 3EN6A 3DBRB 3ZNZB 4MXCA 2RGFA 3R21A 1JKSA 4TYEA 1OGWA 4APCA 1JVPP 3WAOA 1TZOA 2PHKA 3KWVA 3ZHPC 1P98A 4XWWA 4NIFB 2HY81 1K50A 2C7MB 3PT2B 5CVGA 2B9JA 5DR6A 2JZZA 2WX0A 3QXPA 4J97A 1V0BA 3QRTA 4W9JA 1EU4A 3R1NA 4J8NA 3NCZA 4YU2A 4AFJA 1SE9A 1JKTA 4WD5A 5ETCA 3PRIA 1WY8A 5M4UA 1XWSA 1Q99A 5CLPA 3D15A 3U4WA 5JZJA 1SF0A 5K4JA 3TCPA 3JXWA 3TNWA 1OPKA 2VWYA 3DTCA 3NY5A 4M12A 4BIEA 3NAYA 3F2AA 2QO9A 4FVRA 3C0IA 3VS3A 1ZARA 1BUHA 1P5EA 4O27B 3SW4A 4TQ0A 4YSZB 4MNFA 3QTIA 4BDGA 2I1JA 5LOHA 2TSSA 4EYMA 2K1FA 2OW3A 1E8WA 1JKKA 4ZTSA 4L68A 1YQJA 4Q2JA 3R63A 2QHMA 3MN3A 4N6EB 1UNSA 4IIRA 3AN1A 5KBQA 2YM8A 3N30A 4I0RA 2WYQA 5FEEA 1XO3A 1WVWA 1M94A 4DAWA 2AQ2B 2X8EA 2BZHB 3W16A 4FKSA 2PVRA 3R7IA 2UW4A 2WMTA 1H01A 4LMUA 2F49A 4CFMA 1L4DB 2UZNA 4TYGA 4XCUA 3F61A 5E1EA 2F4JA 3DKCA 4DGMA 5CEPA 2WTWA 4D4SA 4BKZA 4E4MA 2DZJA 4KX6B 3ZNGC 1WZYA 3WI6A 1OFFA 1WVXA 4XG7A 1V5TA 1MRVA 3UNJA 4KVGB 1KOBA 1OIUA 4Y5QA 2VUWA 5H9BA 3ALNA 3GCVA 1E0ZA 2AC5A 5AR7A 3AMAA 4BB4A 5KMOA 3TUDA 4XEYA 1GG3A 4CZUA 4I5MA 5LMBA 2MJ3A 2R3NA 5CQWA 3RALA 2F7XE 2PZYA 3N3KB 4US8A 2YM5A 1GB4A 3UJGA 3NIEA 3ZUNA 3JPVA 4D2RA 4A9AA 1ZOGA 4OW8A 4UYAA 1STEA 4AQ7A 3OZ6A 4TTHB 2HTME 4IWDA 5LXMA 3AG9A 2J0MB 3MFRA 2BHHA 2CDZA 3NDMA 3RAIA 3I57A 4RM8A 2G3QB 5M4FA 3IKAA 4ASDA 3CWIA 3MVJA 2L05A 3GEQA 2R7BA 4QNYA 1QQRA 4W9WA 4ZJIA 2HJ1A 2C3KA 3RNFC 4AZTA 2UW0A 2L76A 1MI0A 5CVFA 3SHEA 5LQFA 2K22A 2JKOA 1KLGD 4YZCA 4ZLZA 4DBNA 4HXDA 3ZH8A 1IBXA 3GOKA 2GMXA 3EH9A 3RAHA 1BL7A 4M66A 4MK0A 2ZVNA 2QOOA 4J7BA 2XK5B 2EMSA 4LTUA 4MEDA 3N51A 1YHWA 2C30A 4W9IA 1UH6A 2WEVA 4LOQA 1F2RI 4CEGA 4FOCA 4AW2A 2DUVA 3PG1A 4IAZA 5E91A 1WI0A 4JGHB 2JGZA 5CAVA 3GT8A 2XKCA 4J71A 3RHXA 1RDQE 4FVQA 1MUOA 5IOIA 2XEZA 3T9LA 3VUYA 3LFSA 3KU2A 1YNTE 1NYRA 3C50A 1YIWA 3O23A 2DHZA 4RVMA 3KH0A 4HJGE 4G3EA 3H30A 3V5LA 4BZNA 3TG1A 1V5OA 4EHVA 3LFDA 1KM7A 1H28A 4AW1A 3BVGA 3R8UA 2FCQA 1GUAB 3UG1A 3TEWA 2A98A 5JGDA 2PY3A 3LMGA 2A27A 1H4RA 4S2ZA 2KWUB 4ZSEA 5AUXA 2INDC 3Q53A 3MJ2A 3Q3NC 2INNE 4C80A 4XRLA 3ZUTA 2VTIA 1R1WA 1M4VA 3H3CA 1L6VA 4D9TA 4IX4A 1PXIA 3P63A 4BDJA 4DLJA 2ZM3A 4FT3A 4ANUA 3PA3A 3FC1X 4LQMA 3TJCA 1H26A 3KLSX 3LFCA 2WXVA 3TCAA 4MD7E 5LLIA 3RZBA 1G6JA 1I4GA 2AUHA 5BMHA 2MA9B 3O50A 2VGOA 2XNPA 4NJCA 5AM6A 5HO6A 3IAM1 4UYNA 1YMHE 2RKUA 2ZDUA 2AX5A 2W1IA 2GB1A 4KIKA 4KGRA 1N5XA 4GB9A 2D5GA 3Q9YA 3PLVA 4C36A 4UBAA 5AIRA 4J3OD 5EHLA 5FD2A 4C7YA 1WMHA 2OSCA 3C0HA 2MBOA 2X7OA 3ZYYX 3MPTA 4LOPA 2UW9A 5JK3A 3H7SA 1Q10A 1IA8A 2G2FA 3VRBB 1XQQA 1OPLA 3H4JA 2V22A 3V5WA 2XK8A 3L8PA 1U54A 2HD5B 2N1WA 2V5QA 5HORA 3ZC5A 3GENA 1GZOA 1R4MI 1WWTA 2JYEA 4CSVA 2UZUE 3U8WA 2CHZA 1UU3A 1I35A 2GNHA 3DZQA 2ESMA 2MP2A 3Q2AC 2LMCA 1VR2A 4C02A 1EF5A 2E9UA 3UPZA 1I44A 3DBEA 4N0SA