4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
2DHZA 2KDIA 4MSQB 5CHVC 4N9F4 3JYUA 3ML9A 4MGIE 4W9HA 2KOXA 4MJSB 1XQQA 2LGDA 3APFA 2HE7A 3ZIMA 1WMHB 4F1SA 5IAAC 2IO3B 4IWQA 3IVFA 4GMVA 2KZRA 5BO4B 3KUZA 4GU2A 3ZKJC 1T0YA 2Z59B 3R66C 2WX0A 2C5LC 2DX5B 3X23A 2KMAA 1GC7A 1WYWB 1FXTB 4CYEA 1L7YA 5J17A 3PSEB 2ZPYA 2KC1A 4I6PA 4DHJB 2N7DA 4CHKA 1WI0A 3V62A 3JW0X 4IM3A 3DVNV 4KSLC 2LUEA 4GIVA 1SIFA 4BOSC 2KJHB 2MA9B 4RM8A 3IFWB 1WX7A 4FJVB 4GB9A 5L95C 1WM2A 1V81A 2KK8A 3KYCD 2FIDA 1H8CA 2WDTB 1E5WA 4E74A 3QIJA 4W9JA 3UIOB 2ZVNA 3N3KB 5KHOA 1IYFA 2DYOA 4WJNA 3UQBA 5AZGA 2OJRA 1G6JA 2G45B 3ZO5B 4EZLA 3PS6A 4KVGB 3A9JB 3NOBA 2N9EB 2KFKA 4ANVA 2JVCA 4RM9A 3W1SA 2J7QB 2L76A 1E7UA 1KJTA 4URKA 4W9EA 1WE7A 2G3QB 5CHWA 3UF8A 4AJYB 3DPDA 3ALBA 4FN2A 5TR5A 3OJ4B 1UD7A 2Z0DB 4G3XB 4TUUA 3VH3B 2NR2A 1ISNA 1GJZA 2MW5A 1EUVB 4GGQA 4MDKE 3ONSA 3RUIB 3V60A 2MBQA 3VUYA 5AEKB 2EMTA 4FJYA 2LJ5A 4W9GA 2GBJA 3VVWB 5D6JB 4AP4C 2O2VB 4FJZA 1OTRB 2RR9A 3VTWA 1HE8A 4K7WA 4BVUC 3DBLI 2KQ7A 4KDLB 3A33B 4RMAA 3HK0A 3QC8B 3U30A 2IZVB 5CX3A 2JRIB 2L7RA 4PS8A 5GMVA 2MX2A 3WA0A 1JRUA 1WJUA 4MELA 4MH0E 3WALA 4W9FA 4XZ4A 4ANUA 2KTFA 1NDDA 2BPSA 3T8MA 3R7QA 1P9DU 3MTNB 4ZDVA 4G50A 4FA6A 1P3QU 2KTRA 2NBVB 3PVLA 5JZEB 1L2NA 1UH6A 3TL5A 3L13A 2KJRA 2Y5BB 4P7IA 1LFDA 3HM3A 4JL9A 4IWPA 4NPNA 4MGZE 4DBGA 1J8CA 3L0WB 2NBWB 3MHSD 1E8XA 1WZ3A 1WGYA 3RD2A 3M63B 3VQIA 1WGRA 3AI5A 3D32A 5LXHA 3PHXB 3TBLD 1RAXA 4II2B 5AZHA 3A9KA 3ZRFA 4E71A 2JZ3B 2K8CA 1E8WA 1YIWA 3DVGX 4I6LB 2C7MB 4WWNA 2N4FA 2MBEA 2BYVE 3H9DA 4NJ7A 1RRBA 2I1KA 2NPTA 2DYMA 1VCBA 1GC6A 3VTUA 5J18A 1V6EA 1EF1A 1P1AA 2CHZA 2V3SA 4FHKA 4ICUA 4BBNF 5LXIB 2YVCA 1C3TA 2RD0A 4WJOA 4HCPB 4TV3A 2C60A 4KZ0A 4BKTA 2LVPA 1XT9B 2KFKB 1D3ZA 4ICVA 2KN5A 2KKCA 2KMCA 2RGFA 3PHWB 4HCNB 1K8RB 3L10B 3PREA 2XK5A 1Y8RC 5D2MB 3U7DA 3ZNID 2IO1B 2N7EA 4NJ6A 3A1QA 5EDSA 4YL8A 2IYDB 2GOWA 2O6VA 2DAJA 1C1YB 2DAFA 2KANA 3ZTDA 4EUTA 5JHBA 4OVUA 3K9PB 2J0JA 2MSED 2KQSA 1I35A 2DZIA 3RZWC 2KJ6A 1WM3A 2DZMA 3WANA 5KHQA 4W9DA 4E3CA 4EKUA 5G55A 1Z5SB 3ZNGC 1TTNA 2CKHB 2JT4B 2FCNA 3NY5A 2OOBB 3RYTA 3ZUNA 5C1ZA 3WAOA 3ZVVA 2JXXA 1E90A 2EKEC 4HXDA 4OVVA 3Q3JA 2ZNVC 1WXSA 2LD9A 2NVUI 2FCSA 3L16A 3V6EB 2GBNA 1WX9A 1WGHA 4LDTD 3CSTA 4BBNC 4EZKA 4A3PA 4NQKE 4DDGD 4WJPA 3TMPB 3WAPA 3VDZA 4GDLA 2N9XA 4JGHB 3KYDD 4EZJA 3DVGY 1S3SG 3H6NA 3APCA 1BT0A 1Q1OA 2O6VD 2AL6A 2KTRB 3NZUA 2UYZB 4JQWC 5G2NA 1EF5A 4KIKA 1Q5WB 2MLBA 3GZNI 4EEWA 4XC2A 3VUWA 3DDCB 4II3B 2MWSB 4W9IA 4EOYA 2N1WA 1OQYA 2L8JA 2D07B 3RULA 2D11A 4ANWA 3NHEB 2JUOA 3A9KB 2L0TA 2D2QA 4JLCA 1TBEA 2K39A 3SD5A 4WAAA 2AL3A 2NPTB 2WWZA 3N30A 3TJPA 2JPHA 1AARA 3RT3B 2CU1A 3QA8A 4PYUA 4K1RB 3VTVA 2EMSA 3LJ3A 2NCNA 1WGGA 2BKRB 3JSVA 1QZEA 1ZKHA 2BGFA 2WX1A 3RZFA 2M8SA 3H7PB 2MBBB 3KUDB 4LDTB 4DHZB 2LZ6A 1J0GA 4NNJB 2KO3A 4PS7A 3ZTCA 2AYOB 1WR6E 2K8BA 2XK5B 2YLMA 3PRZA 2K6DB 4X57B 2ZPNA 3PLVA 4ASWC 2ZCBA 2A5UA 2FCQA 3A1QB 1GNUA 4XX5A 1H4RA 2O6VB 2G4DB 2WYQA 3AU4A 2D3GA 3ZRCA 1WGDA 3ZW3A 4MEMA 4NAWA 2J0MA 1E7VA 2KD0A 1UBQA 3R3MA 2ZEQA 2ZCCA 1TGZB 2BWFA 1V2YA 1WIAA 1P0RA 3A4RA 3T9LA 2MP2A 4WQOB 2BF8B 1VD2A 4GSWA 5AZFA 2KDEB 1V49A 3NZSA 1YX5B 3VAWA 3DBRI 2KHWB 3EECA 2BWES 3ZNZB 4MSMB 2JF5A 3UGBB 3PZDA 2IY0B 2BKFA 2M17A 4HPMB 4K81A 3ZDTA 2ZZPB 3V6CB 2RPQA 3HIZA 4IUMB 4WWOA 3ZDMC 3AXCA 4GDLB 2KDFB 1WJ4A 2LVQA 2LVOA 3V61A 3OLMD 1I42A 2FCMA 2MQJA 4GN1A 2GBKA 3RCZA 4DHZE 4LJPB 2D10A 2FNJB 4KIKB 4LJOB 1J19A 1WX8A 1R4NI 1EO6A 2M0XA 4M8MA 2PPHA 2LRUA 1IPGA 3KUCB 1WFYA 2G4SA 2KC2A 5DCNA 1Q0WB 4A3OA 3EHVA 4KSKC 3H7PA 1WE6A 3WAMA 4B6WA 3ECIA 3SU8X 2FUHB 3QAQA 5E6PA 2KXJA 4HJKA 2L00B 4NQLB 2LGYA 2R2OA 5L83A 2K25A 4TKNA 1PQSA 2HJ8A 1LM8B 1WJ6A 4B95A 4FADA 5IA7A 2CHXA 3JSVB 3CF6E 2CR5A 1CMXB 3SDLC 2W9NA 1WRDB 3L54A 1R4MI 2JRHA 4BKSA 2FAZA 3QK0A 2L3ZA 2A4ZA 2BYFA 4WJQA 2KX0A 1V9JA 3B08A 5DPTA 4B9KA 1NBFC 1X1MA 4IM0A 3PV1A 4DXAB 2Z0EB 2C7NB 4W9LA 1M94A 4M8NA 3ZLZA 1A5RA 3PRPB 1ZGUB 1WF9A 3PGEA 2ZNVB 3W1YA 1U4AA 2KWUB 3X0WA 2K1FA 2N9PC 4W9KA 1V5OA 4K7UA 3TIXA 2M1MA 2HD5B 2CHWA 4NAWB 1SE9A 4AJWA 4HPLB 1Z2MA 3M62B 4PS3A 3APDA 3I3TB 4GDKA 3S2AA 3HM6X 4I6NB 2LGXA 4MGYE 2QHOA 3SHQA 3OJ3A 2MP2B 3ZNHB 1S1QB 1WR1A 3N32A 4HK2A 4K7SA 2ZVOA 5CTRC 4A20A 5J2RA 4ZYNA 2CS4A 3K9OB 5C23A 2AWTA 3KVFB 3VFKA 1GG3A 3VHTC 1UELA 1WJNA 3AU5A 2LI5A 5FR6A 4BKSD 1UGMA 4WWPA 1YQBA 2DZJA 3P2BA 4IW0A 2KVRA 4FHJA 4ANXA 1IP9A 1E8YA 2MRPA 3QQ8B 4KV2A 3QX1A 1LXDA 2DZKA 4IWOA 4HDQA 4W9CA 3IHPC 2GMIC 4F7ZA 2J0KA 4IM2A 2NBUA 3QJZA 2R2QA 2JWZA 3ENEA 4AWJA 4PYZA 1NI2A 2DENB 4HWIB 2NS5A 3O65B 2B3AA 2PEAA 1V5TA 3CMMB 2IO2B 3AULA 3H7SA 4DWFA 4BOZB 2FIFA 4CO7A 4MGKE 5JHAA 2C9WB 2REXA 4M0WB 1WXVA 2XBBC 4HLEA 1GUAB 4J6IA 5DPWA 3Q3FA 3TCAA 2KDBA 3EFUA 2PJHA 2N1VA 1LQBA 4KDIC 4G0NB 1XD3B 3MJWA 4JIOU 2HTHA 2KX3A 2JY6A 4F8CB 5CHFA 1WH3A 3UQAA 2MCNB 1SGHA 3B1LX 1YX6B 3PLUA 4MJSA 1OGWA 1KOTA 2ZJDA 2XEWA 3QCAA 2V1YA 2MBOA 3JVZX 3U8ZA 3H1UA 3VXWA 4BFRA 4EFOA 1MG8A 1WMHA 2LWPA 1E8ZA 3BY4B 1TZ1A 3L08A 2DYBA 1YD8U 2GBRA 2KWVB 4GOCA 2KWCA 2GBMA 3IG3A 3LDZE 4KZCA 3DBHI 5DPSA 5HKHA 4ZRKA 2JZZA 5E6NA 3R7RA 4GDKB 4HVBA 1UBIA 2L05A 4LCDE 3QWZB 1KLVA 5E6OA 3BINA 3VH4B 4DK5A 3UINB 1RLFA 4BKGA 1WY8A 2KLGA 3GOEA 2L0FA 2V4LA 2ASQA 2IY1B 1V86A 1OEYA 3EC8A 2UWQA 1WXMA 3QARA 5LLIA 4TQ0A 1ZW7A 2MBHA 3UIPB 4ZRJA 3HHMA 3DOWA 4DDID 1WZ0A 4MM3A 2M4NA 2I1JA 2LXCA 3KW5B 4NY0A 3A9JA 1OEYJ 4FBJB 2VRRB 3PPAA 3PRMB 3C0RB 1KM7A 3M3JA 5JH5C 2LRWA 3PT2B 2IBIB 3B0AA 2C7HA 1WXAA 3KH0A 4AOFA 2KNBA 2BYEA 2PE9A 4GXBA 3A4SC 3QHTA 3IBEA 5D7GA 3OAWA 5DPRA 4DHJD 4FULA 1UZXB 1YJ1A 2IO0B 2KFJA 3WIMA 2KLCA 1V80A 4ZRIA 2LASA 3DCGA 3DVNU 4HDOA 5D94A 3M95A 4TQ1A 3DQVA 4FLHA 1F9JA 2AEHA 4IC7B 2O2VA 4IG7B 3ML8A 3L17A 2RSUA 3CSFA 1RFAA 2K6QA 2LXAA 3W1SC 3VUXA 1P98A 3NS8A 2K8HA 4G11A 4AUQC 2PE6B 3PTFC 3DBSA
chains in the Genus database with same CATH superfamily
2KDIA 4MSQB 1HXYD 2QIEB 4MJSB 3BYYB 2LGDA 3ZIMA 1TY0A 4IWQA 5T8IA 1HTQA 3R66C 2WXKA 3TUOA 2ZPYA 4DHJB 2N7DA 4IM3A 3DVNV 4BOSC 2KJHB 1FMAD 1WX7A 2WXPA 3FC4A 1T0SC 1WM2A 4PK1A 1L0YB 3LYYA 2ZVNA 2DYOA 4WJNA 4XWTA 4EZLA 2SAKA 4KVGB 3U2SC 4RM9A 3AB5A 1VLBA 1E7UA 1WE7A 4FN2A 3OJ4B 2Z0DB 4G3XB 2BVCA 1GJZA 3ONSA 3RUIB 3V60A 1KFYB 2EMTA 4XE0A 2E6XA 2LJ5A 4W9GA 1PFDA 1I4PA 1JRPA 1MPEA 2RR9A 1HE8A 1I4HA 4K7WA 4OZAA 2M56B 4KDLB 2RMMA 2HTME 1FXIA 2QILA 3U30A 2CJNA 2GB1A 2RDGA 1FIQA 1KRHA 5GMVA 3AE9B 2MX2A 1VRAB 3WA0A 3GS2A 4XWWA 3AEGB 1MHXA 1NDDA 2MH7A 3T8MA 2WU2B 1YQ3B 2KTRA 4AS1A 1N63A 1OFFA 4NPNA 1CK1A 1WGYA 5LXHA 3M63B 1WGRA 3AI5A 1WRIA 3D32A 1J7AA 1RAXA 1HA5A 1QOGA 1CJEA 1I7HA 2K8CA 1T0QC 3HVZA 1RRBA 2N9KA 1FCLA 2DYMA 1ZUD2 2KACA 1EF1A 5LXIB 2RD0A 4WJOA 4HCPB 4C4VB 2WXGA 4BKTA 2LVPA 2KFKB 3PHWB 2KMCA 4HCNB 2IO1B 3A1QA 2AX5A 2GOWA 2O6VA 1C1YB 2DAFA 3FAHA 1ROEA 3K9PB 2WDRB 2MSED 2KQSA 2KJ6A 1WM3A 3ZJTA 1MVKA 5C1ZA 3WAOA 3ZVVA 4HEA1 4HXDA 2L1AA 1QOFA 3I5JC 3VRAB 4HKQA 1TY2A 2ZNVC 2NVUI 2LD9A 2WXRA 4XDCA 1WX9A 3CSTA 4BBNC 3TEZA 4DDGD 4WJPA 3PZ8A 3WAPA 1UNSA 3AE5B 1S3SG 5IN7A 2K22A 4P16A 4KIKA 1Q5WB 2MLBA 3Q2AC 3DDCB 1FFUA 2MWSB 2D07B 2EKIA 3DWMA 2L0TA 1TBEA 2K39A 1L5PA 2BS3B 3N30A 1LO5D 2CU1A 2EMSA 1XXGA 1K52A 3JSVA 1QZEA 3RZFA 3Q3OC 2H89B 2QC8A 3KUDB 2G1EA 2LZ6A 3LXFA 1J0GA 1SE2A 1WR6E 2YLMA 2G9HD 2ZCBA 3R2IA 1STEA 2FCQA 1DGJA 1H4RA 2J4XA 2D3GA 3ZRCA 3ZW3A 4ZRPA 1E7VA 4WIPA 2ZCCA 1TGZB 1WIAA 4WQOB 1VD2A 4GSWA 5AZFA 3NZSA 1JQ4A 2WDVB 3VAWA 3EECA 2BWES 3ZNZB 4MSMB 3UGBB 1DYQA 2BKFA 2HDEA 3ZDTA 2ZZPB 3V6CB 4ZHPA 4HPPA 4GDLB 1WJ4A 4WH4A 4GN1A 4DHZE 2FNJB 4RCOA 1BUIC 1EWYC 1R4NI 3IT6B 3N1YC 3GP7A 4S17A 2LRUA 1WFYA 5MPOA 3HVDA 2DBYA 1FCCC 4KSKC 4B6WA 1WE6A 1DOXA 2KXJA 4YSXB 5L83A 3WCQA 2GLSA 2CR5A 3SDLC 2WXLA 3MC8A 1SE4A 4LNFA 1JWAD 2A4ZA 4WJQA 1V1OA 3B08A 4B9KA 4IM0A 3PV1A 3ZLZA 1XEEA 1JWSD 5G5HA 3IXSA 3X0WA 3U7ZA 3UI3A 4NAWB 1SE9A 5IO9A 1LGRA 2JXTA 4PS3A 4WAFA 2YEPF 4JWSC 4RF1A 3I3TB 3S2AA 3HM6X 2GRIA 2MP2B 3ZNHB 2WU5B 5CTRC 4IKGA 3FILA 2CS4A 4USAA 4ZYNA 5C23A 1NYQA 3KVFB 3E56A 1WJNA 4JX1C 3RMKC 1YQBA 2N0SB 2OJWA 2WQYB 3P2BA 2MRPA 4KV2A 3KLSX 1T3QA 1L0VB 3AH7A 4TSSA 4PYZA 2X8XX 2PEAA 2JSVX 4REZA 3RNFC 2FIFA 2WXOA 4MGKE 4TMAB 5JHAA 2BS2B 4MM3B 1E6EB 1TYGB 3P4QB 4J6IA 5DPWA 2KDBA 4G0NB 1YJJA 3MJWA 2HTHA 1C9FA 2KX3A 3TEYA 4F8CB 1WH3A 2MEKA 1SGHA 1OGWA 4MH8A 1YNTE 2MBOA 4BFRA 1YN4A 3W5UB 2AQ1B 2KWVB 3LDZE 1SEBD 3R8BA 4M02A 3DBHI 5HKHA 2EELA 2J53A 4HVBA 4LCDE 1P7EA 2M19A 1KLVA 1BXTA 3BINA 2D5GA 1OQRA 3Q6BA 1OEYA 1EU4A 3EC8A 3Q8FA 2R61A 1C77A 4ZRJA 2OHFA 3DOWA 4DDID 1WZ0A 4MM3A 2M4NA 2LXCA 3A9JA 3PPAA 3PRMB 5JH5C 2IBIB 3B0AA 3KH0A 4AOFA 1I4XA 2PE9A 3A4SC 1ET9A 2INCC 2WLBA 2KLCA 4ZRIA 2QSDA 5D94A 4LNOA 1JALA 4FLHA 1QLBB 4IC7B 2O2VA 3CWIA 2K6QA 2LXAA 4XGAB 4G11A 5E6JA 2VH1A 3U52E 2DHZA 4FXCA 3ZYYX 3H8HA 2INDC 4LNKA 1XQQA 2JYEA 5BO4B 3HRDD 2V0GA 3KUZA 3AE7B 3VR9B 4K3CA 2C5LC 3X23A 4CYEA 1TIFA 4I6PA 4CHKA 3V62A 4GIVA 2FE8A 1HZ5A 1QOAA 3IFWB 4FJVB 4NJCA 4YTNB 1ZPSA 1V81A 1E5WA 4E74A 3QIJA 4W9JA 3UIOB 5KHOA 2YEPB 4UDUC 2OJRA 4A6QA 4QAYA 3NOBA 2N9EB 2ACZB 4ANVA 2BBCA 1N6ZA 2J7QB 4URKA 4IOIE 3UF8A 3ZJVA 3ALBA 3BVGA 1ISNA 3BWUD 4US9A 2H88B 1IBXB 2L52A 2GBJA 1EU3A 5D6JB 2K0PA 1M4VA 4FJZA 1OTRB 1QQRA 4RMAA 3HK0A 2LHEA 1QILA 1FO4A 4J3OD 4MELA 1K50A 4RH6A 3TEWA 4W9FA 2NTTA 1NYRA 4ACFA 1MHHE 4ANUA 4EE2A 3R7QA 3MTNB 1UWMA 2NBVB 3AN1A 2INNE 2KJRA 1LFDA 3DWGC 4MGZE 4DBGA 3RD2A 1XCQL 2KMMA 3PHXB 2Y5PA 2PMVA 5AZHA 4MACA 3A9KA 3ZRFA 4E71A 1E8WA 1QF6A 1GPXA 2C7MB 4WWNA 2MBEA 3H9DA 4ZOHC 2I1KA 1VCBA 2CHZA 1PGAA 2IJ0A 4FHKA 4ICUA 1C3TA 4TV3A 1YMHE 1JMLA 1XT9B 2KN5A 1K8RB 3L10B 3U7DA 3ZNID 2N7EA 3HUIA 5HFYA 4HKZE 4YL8A 1WSPA 2KANA 5C3JB 4EUTA 1ESFA 1I4RA 4W9DA 1RWSA 1B1ZA 1TT5B 3V6EB 2KT7A 1FNVA 1WGHA 2N9XA 4JGHB 1JW9D 4EZJA 3DVGY 3H6NA 2O6VD 5G2NA 2AL6A 2KTRB 4JQWC 2K9XA 4GLSC 3GZNI 3VUWA 1A70A 1OQYA 2L8JA 3RULA 4HROA 2D11A 4ANWA 2JUOA 1J7CA 1JWBD 1YQ4B 1VDVA 2WWZA 1AARA 4US8A 4PYUA 1L4ZB 2N7JA 2NCNA 2BKRB 1SXTA 1ZKHA 2W3RA 4DHZB 3PRZA 2K8BA 4ASWC 5D3IB 3KWVA 4BZAA 3DHIC 2A5UA 3A1QB 2TSSA 2ONQA 2O6VB 1TS2A 2G4DB 2LJIA 2WYQA 3RNGC 1GB4A 1C4CA 1VZ8A 2BWFA 1V2YA 3Q8AA 1JCKB 2BF8B 3DBRB 4KKIA 5HI1A 3B9JA 1WYGA 4K81A 2KAJA 2RPQA 4WWOA 3AXCA 3AEFB 2LVQA 2UU7A 2LVOA 2JYTA 1I42A 2FCMA 2MQJA 1RYJA 3EUB2 1HTOA 2D10A 4KIKB 4LJOB 4MT5A 3AEDB 4M8MA 3Q69A 1IPGA 1ZDXA 5DCNA 2G4SA 1Q0WB 4A3OA 2I38A 3QAQA 1F2RI 4HJKA 4H2AA 1Y56A 4RGMA 1LM8B 2CHXA 3JSVB 2W9NA 4BKSA 3ETRA 2KX0A 1NBFC 4W9LA 2C7NB 1BMLC 3AE8B 4C7YA 1TS5A 2KWUB 2JX5A 1V5OA 3TIXA 2HD5B 1C79A 1AWDA 4AJWA 1E7PB 4HPLB 4OW0A 1EM7A 2LGXA 5BMIA 4MGYE 3SHQA 3AEAB 3N32A 4A20A 3GZNB 4HK2A 4K7SA 1WGKA 2PKOA 3K9OB 2AWTA 3VFKA 3VHTC 5EE0A 3NVWA 2LGSA 3AU5A 2CU3A 4ARIA 4M00A 4ZHOA 4IW0A 4ANXA 1VZ6A 4W9CA 3QX1A 2DZKA 3IHPC 1FRRA 2GMIC 4F7ZA 2J0KA 3QJZA 1UUPA 3EA6A 1NI3A 1NI2A 2DENB 2B3AA 1V5TA 2IO2B 1ACCA 1D5XC 4CO7A 2C9WB 2WGSA 1WXVA 4HLEA 1GUAB 3RPFC 1CZPA 1WWTA 3SR6A 2BYTA 1JWMD 2IGDA 2PJHA 1T0RC 1KF6B 2KDMA 3AMZA 3N20C 3ZQ4A 3RNCC 1QOBA 4YTPB 5CHFA 2MCNB 1UWXA 1ZDVA 4LNIA 3PLUA 3Q3NC 3Q14C 3JVZX 3H1UA 4EFOA 1MG8A 1WMHA 2FBWB 3BIID 2WXQA 2GBMA 3IG3A 4KZCA 2PTLA 4N6EB 3NS1A 5DPSA 5JXVA 5E6NA 3R7RA 1C78A 2L05A 3RNAC 2J42A 3IT4B 3FILB 3UINB 4BKGA 1WY8A 2KLGA 3GOEA 3P4RB 2L0FA 1FNUA 2WP9B 1D5MC 2LFIA 2WXJA 3BK1A 2XN9C 5LLIA 2X38A 2MBHA 3UIPB 3HHMA 2I1JA 4NY0A 1PGXA 2VRRB 3C0RB 1KM7A 3M3JA 1V1PA 4GXBA 4L23A 1D5ZC 1YN3A 5HHDG 5DPRA 2IO0B 2KFJA 1V80A 4HDOA 4OVZA 1XLOA 3ML8A 2RSUA 3W1SC 5EE1A 3NS8A 1UGJA 2W54A 3PTFC 2BB6A 2BQQA 1ENFA 4C80A 2WS3B 4N9F4 3JYUA 3ML9A 4MGIE 2AQ3B 2QDFA 2W82A 2HE7A 2JU6X 4LNNA 3IVFA 4GMVA 2KZRA 4C56C 4A9AA 2DNFA 1QT9A 4GU2A 3ZKJC 2KMAA 5J17A 1IGCA 1L7YA 3AE3B 3PSEB 3P1MA 2E3TA 1WI0A 2Y5CA 4KSLC 1TS4A 2JQRB 4JWUC 3AV8A 4RM8A 4RFBA 4YT0B 2ICIA 3ABVB 4YSYB 3KYCD 2WDTB 1IYFA 3UQBA 3W2DA 2G45B 3MC0B 3PS6A 3O13A 3A9JB 3ZJUA 4RGOS 1KJTA 5BMGA 2G3QB 5CHWA 3DPDA 5TR5A 1UD7A 4TUUA 4GGQA 3P4SB 2MBQA 1EWCA 3VUYA 4KGTA 5H92C 3DBLB 3VVWB 2O2VB 5G5GA 4LK0M 3VTWA 1FEHA 1F0ZA 2KQ7A 2HJ1A 1C76A 3A33B 3QC8B 5CX3A 2JRIB 2L7RA 4PS8A 1WJUA 4BAXA 4MH0E 1T6BX 4XZ4A 2LUMA 1MFWA 2WNMA 2BPSA 4ZDVA 4FA6A 1P3QU 3PVLA 4N59A 1L2NA 4XYCA 1B9RA 1GB1A 3L13A 1SIJA 4LLGM 4P7IA 5H8YE 4JL9A 1J8CA 3VQIA 1E8XA 1WZ3A 3TEXA 3TBLD 4II2B 1PDXA 4RF0A 3DVGX 2QJLA 2BYVE 2NPTA 2QCZA 4O1NA 3VTUA 1V6EA 4L2YA 1P1AA 3I63C 4P1BC 4BBNF 1AN8A 4KZ0A 1D3ZA 3BK2A 4ARCA 2XK5A 4NJ6A 2IYDB 2DAJA 3ZTDA 5JHBA 2J0JA 3T3OA 2DZMA 4A90A 4E3CA 3VR8B 5G55A 4EKUA 1NVID 3ZNGC 1N5XA 2FCNA 3RYTA 3N1ZC 2K5PA 2NTSA 1PUTA 3MJ5A 2LMCA 3MP9A 5IP4D 4OVVA 1WXSA 3L16A 3NUHB 2GBNA 4LDTD 1L4DB 4A3PA 4NQKE 5AUKA 3TMPB 3VDZA 2KN4A 3Q8CA 3KYDD 3APCA 1BT0A 3NZUA 2UYZB 3AE2B 1EF5A 4EEWA 3BZDB 4ZYSA 4EOYA 2N1WA 1J7BA 2WXHA 2VZKD 3NHEB 3A9KB 2D2QA 3GE8C 2BW2A 4WAAA 2JPHA 1KTKA 4WWMA 3RT3B 3QA8A 2SEBD 2WHIA 1XF5L 4KKJA 1WGGA 3PZ7A 4LDTB 4NNJB 4PS7A 3ZTCA 2ON8A 1MI0A 5IKCM 3AU4A 1WGDA 1YJIA 2PIAA 2J0MA 3IAM1 3R3MA 1N61A 1D4BA 2ZEQA 1SBBB 3R2TA 3A4RA 3SFDB 3EGRA 2VZKB 1V8CA 4ITKA 1V49A 3DBRI 2KHWB 2RDBC 2BB5A 3NZ3A 2JF5A 3V05A 2IY0B 4IUMB 1ET6A 3ZDMC 2KDFB 4HJGE 3V61A 4B0MA 1C4AA 3RCZA 1J19A 2LEKA 2IGHA 3KUCB 3Q8BA 3B2FA 4DXGA 3B2GA 3T3NA 3WAMA 4JE3B 2QMTA 4M0WA 2FUHB 2DWQA 3C8YA 2RDHA 4NQLB 2LGYA 1XLQA 2K25A 4YTMB 4TKNA 1PQSA 1R4MB 2HJ8A 3VRBB 1WJ6A 2FUG1 3RNEC 4FADA 5IA7A 3CF6E 1CMXB 2FAZA 3QK0A 1L0XB 2BYFA 5DPTA 1V9JA 2WXMA 1X1MA 2WXNA 4KGRA 5EE3A 1A5RA 1ZGUB 1WF9A 2ZNVB 3W1YA 1U4AA 3Q3MC 2K1FA 2N9PC 4W9KA 4K7UA 3TSSA 1PGBA 1R7SA 1K51A 1Z2MA 3M62B 3NVZA 4OZCA 4GDKA 4I6NB 2QHOA 3OJ3A 1S1QB 1JROA 1WR1A 3BVMA 2LHDA 3AE1B 5FR6A 4BKSD 1UGMA 3AEBB 4WWPA 4KX6B 1E8YA 3QQ8B 2V3PA 4IWOA 4HDQA 1ZP0B 3ZGZA 3NG0A 2R2QA 1E10A 2JWZA 1AW7A 4PT5A 1C4PA 4AWJA 4HWIB 3SEBA 2NS5A 3AULA 3H7SA 4R3DA 3C19A 4DWFA 1YOVB 2REXA 2XBBC 1I4QA 2ZW0A 2RPVA 1VZ7A 1OQQA 3Q3FA 3N1XC 3TCAA 3W5VB 3EFUA 4RGTA 1XD3B 4DXFA 1VJKA 2JY6A 1I4GA 1MG4A 4RNAA 3BYTB 2MHJA 1YX6B 3GB1A 4MJSA 1KOTA 4JPSA 1YN5A 2XEWA 3QCAA 2V1YA 3U8ZA 3VXWA 1HQRD 1E8ZA 3BY4B 4XDDA 1YD8U 1DOIA 4ZRKA 2JZZA 1UBIA 1FNWA 2V4LA 2D3BA 2ASQA 2IY1B 2KVZA 3URYA 1RFKA 1WXMA 1TKYA 3QARA 1FD6A 4TQ0A 1TZOA 4P6VF 2LRWA 2C7HA 1WXAA 4S0RA 2KNBA 3QHTA 3IBEA 2XNAC 3OAWA 4OZBA 4D2KA 4FULA 1UZXB 2LASA 3DCGA 2M0AA 4TQ1A 1F9JA 4IG7B 5D3DA 5BMHA 3L17A 3DBSA 1RFAA 3VUXA 3EFCA 2K8HA 4AUQC 2Z8LA 3FKYA 5CHVC 1F1HA 4W9HA 2V4IB 2KOXA 4P1CC 3APFA 1WMHB 4F1SA 5IAAC 2IO3B 3PO0A 1T0YA 2Z59B 2WX0A 2DX5B 1GC7A 1WYWB 1FXTB 1N62A 3NRZA 2INPE 2KC1A 5LNK1 2BTEA 3JW0X 4N58A 2V3NA 1TS3A 2LUEA 1SIFA 2MA9B 2B76B 1TJEA 4YWGG 4GB9A 5L95C 2KK8A 2FIDA 1H8CA 1P7FA 2L32A 2VH2A 3N3KB 2IPKD 5AZGA 2BT6A 5FR3A 1G6JA 3ZO5B 4C4VA 3GE3C 5AUIA 2KFKA 2JVCA 2D3CA 1V1PB 2QEJC 3W1SA 2L76A 4W9EA 4AJYB 2JWUA 3VH3B 1ZE3D 2NR2A 2MW5A 1EUVB 4MDKE 4Q2JA 5AEKB 1E0ZA 1KLGD 3I9V1 4FJYA 4AP4C 4BVUC 3DBLI 2L83A 2PVOD 4L1BA 1D6EC 4KGSA 1L6UA 1K53A 3NJTA 2IZVB 3MC9A 5BYSA 3BVZA 1JRUA 3WALA 2PW9A 5BYRA 1IUEA 4AQ7A 2KTFA 1P9DU 1JWUD 3KQ4A 4G50A 2Y3AA 5JZEB 1UH6A 3TL5A 3P4PB 2Y5BB 3HM3A 4IWPA 1ZXIA 3RN9C 3L0WB 2NBWB 3MHSD 3DHHC 1FRDA 1XO3A 3DHGC 2WXFA 3Q8EA 4NAMA 2JZ3B 1YIWA 4I6LB 2N4FA 2DLBA 3AM9A 4NJ7A 1GC6A 5J18A 5IOIA 2V3SA 1KH0A 4YSZB 1FXAA 3KWLA 1KLUD 2YVCA 2C60A 1SE3A 1T5XD 5FK9C 4ICVA 2KKCA 2RGFA 2GI9A 3PREA 1DOYA 1Y8RC 3P42A 5D2MB 5EDSA 2WDQB 2KQ4X 4A55A 4OVUA 1FFVA 1I35A 2JZPA 2DZIA 3RZWC 2BS4B 3WANA 5KHQA 3SFEB 1VR9A 1Z5SB 1TTNA 2CKHB 1QKZA 2JT4B 3NY5A 2OOBB 3ZUNA 4YXDB 2JXXA 1E90A 2EKEC 3P63A 4C00A 2KWDA 2N9LA 3Q3JA 2FCSA 3J9CA 2KYWA 3IAS1 5GXGB 4GDLA 1Q1OA 1XLPA 3NVVA 4XC2A 1HEZE 4II3B 1F77A 4W9IA 1ZOYB 4JLCA 1SJED 3I57A 3SD5A 4M01A 2AL3A 2NPTB 3TJPA 3AEEB 4K1RB 3OG5A 3VTVA 3LJ3A 2BGFA 2WX1A 3L4PA 2M8SA 3H7PB 2MBBB 5HG2A 4CQNA 2ZW1A 2KO3A 2AYOB 2XK5B 4X57B 2K6DB 2ZPNA 4C7ZA 1GNUA 4XX5A 4MEMA 4NAWA 2KD0A 1UBQA 2PLPA 1N60A 3AE6B 4WQMA 1Q10A 1P0RA 5BYQA 3T9LA 1GOZA 1XCTL 2MP2A 2KDEB 1PYWD 3LB8C 3W9CB 1F52A 2IGGA 1YX5B 2PVGC 1NENB 3PZDA 4HPMB 2M17A 2IDYA 3HIZA 3V3XA 1SF0A 2W3SA 3OLMD 1R4NB 4LTUA 2GBKA 3ZXRA 4LJPB 1WX8A 1EO6A 2M0XA 2MJEA 2PPHA 1TKGA 3U4EG 2KC2A 3EHVA 1F2RC 3H7PA 3ECIA 2MJDA 3SU8X 5E6PA 2V9HA 2L00B 2R2OA 3E9SA 1RM6C 2LGIA 1V97A 3ZXVA 2I2YA 4B95A 1N5WA 1WRDB 3L54A 3AE4B 1R4MI 2JRHA 2L3ZA 4EZKA 4DXAB 2Z0EB 1M94A 4M8NA 3PRPB 2J52A 4DQOC 3PGEA 2M1MA 3OWEB 2CHWA 2MJ3A 3APDA 1SSNA 5J2RA 2ZVOA 1GG3A 1UELA 2LI5A 2Q5WD 2DZJA 1IP9A 2KVRA 4FHJA 1L6VA 1LXDA 2WXIA 1GAQB 4IM2A 2NBUA 5FKAC 2D3AA 3ENEA 1XLNA 3O65B 3CMMB 3RNBC 4A8XC 4BOZB 1SB3C 4M0WB 5TSSA 1IGDA 3CIRB 2N1VA 1LQBA 4KDIC 1NEKB 4HRSA 3MFGA 4K3BA 5EE9A 4JIOU 4OHJA 2K3UA 3UQAA 1WXQA 4IDIA 3B1LX 1E9MA 3AECB 2OEDA 2ZJDA 2LWPA 4RGNA 4ZRQA 1MJDA 3DBHB 1TZ1A 3L08A 3N9YC 2DYBA 2GBRA 4GOCA 1CQVA 2KWCA 4GDKB 2AQ2B 3QWZB 1UF0A 4NZLB 4WURA 5E6OA 3VH4B 4DK5A 1FM0D 1RLFA 3NVYA 1V86A 2UWQA 1ZW7A 5C2TB 1TKEA 4FBJB 3KW5B 3RI7C 1OEYJ 3PT2B 2BYEA 2CJOA 5D7GA 1AYFA 1FPYA 1SJHD 3MHZA 4DHJD 1ZXHA 5I4DA 1YJ1A 3WIMA 1IBXA 3RFZB 3DVNU 3M95A 2NMQA 3DQVA 2AEHA 2W55A 1HZ6A 3CSFA 1P98A 2PE6B 4B0EA 3PLVA
chains in the Genus database with same CATH topology
2DHZA 2KDIA 4MSQB 5CHVC 4N9F4 3JYUA 3ML9A 4MGIE 4W9HA 2KOXA 4MJSB 1XQQA 2LGDA 3APFA 2HE7A 3ZIMA 1WMHB 4F1SA 5IAAC 2IO3B 4IWQA 3IVFA 4GMVA 2KZRA 5BO4B 3KUZA 4GU2A 3ZKJC 1T0YA 2Z59B 3R66C 2WX0A 2C5LC 2DX5B 3X23A 2KMAA 1GC7A 1WYWB 1FXTB 4CYEA 1L7YA 5J17A 3PSEB 2ZPYA 2KC1A 4I6PA 4DHJB 2N7DA 4CHKA 1WI0A 3V62A 3JW0X 4IM3A 3DVNV 4KSLC 2LUEA 4GIVA 1SIFA 4BOSC 2KJHB 2MA9B 4RM8A 3IFWB 1WX7A 4FJVB 4GB9A 5L95C 1WM2A 1V81A 2KK8A 3KYCD 2FIDA 1H8CA 2WDTB 1E5WA 4E74A 3QIJA 4W9JA 3UIOB 2ZVNA 3N3KB 5KHOA 1IYFA 2DYOA 4WJNA 3UQBA 5AZGA 2OJRA 1G6JA 2G45B 3ZO5B 4EZLA 3PS6A 4KVGB 3A9JB 3NOBA 2N9EB 2KFKA 4ANVA 2JVCA 4RM9A 3W1SA 2J7QB 2L76A 1E7UA 1KJTA 4URKA 4W9EA 1WE7A 2G3QB 5CHWA 3UF8A 4AJYB 3DPDA 3ALBA 4FN2A 5TR5A 3OJ4B 1UD7A 2Z0DB 4G3XB 4TUUA 3VH3B 2NR2A 1ISNA 1GJZA 2MW5A 1EUVB 4GGQA 4MDKE 3ONSA 3RUIB 3V60A 2MBQA 3VUYA 5AEKB 2EMTA 4FJYA 2LJ5A 4W9GA 2GBJA 3VVWB 5D6JB 4AP4C 2O2VB 4FJZA 1OTRB 2RR9A 3VTWA 1HE8A 4K7WA 4BVUC 3DBLI 2KQ7A 4KDLB 3A33B 4RMAA 3HK0A 3QC8B 3U30A 2IZVB 5CX3A 2JRIB 2L7RA 4PS8A 5GMVA 2MX2A 3WA0A 1JRUA 1WJUA 4MELA 4MH0E 3WALA 4W9FA 4XZ4A 4ANUA 2KTFA 1NDDA 2BPSA 3T8MA 3R7QA 1P9DU 3MTNB 4ZDVA 4G50A 4FA6A 1P3QU 2KTRA 2NBVB 3PVLA 5JZEB 1L2NA 1UH6A 3TL5A 3L13A 2KJRA 2Y5BB 4P7IA 1LFDA 3HM3A 4JL9A 4IWPA 4NPNA 4MGZE 4DBGA 1J8CA 3L0WB 2NBWB 3MHSD 1E8XA 1WZ3A 1WGYA 3RD2A 3M63B 3VQIA 1WGRA 3AI5A 3D32A 5LXHA 3PHXB 3TBLD 1RAXA 4II2B 5AZHA 3A9KA 3ZRFA 4E71A 2JZ3B 2K8CA 1E8WA 1YIWA 3DVGX 4I6LB 2C7MB 4WWNA 2N4FA 2MBEA 2BYVE 3H9DA 4NJ7A 1RRBA 2I1KA 2NPTA 2DYMA 1VCBA 1GC6A 3VTUA 5J18A 1V6EA 1EF1A 1P1AA 2CHZA 2V3SA 4FHKA 4ICUA 4BBNF 5LXIB 2YVCA 1C3TA 2RD0A 4WJOA 4HCPB 4TV3A 2C60A 4KZ0A 4BKTA 2LVPA 1XT9B 2KFKB 1D3ZA 4ICVA 2KN5A 2KKCA 2KMCA 2RGFA 3PHWB 4HCNB 1K8RB 3L10B 3PREA 2XK5A 1Y8RC 5D2MB 3U7DA 3ZNID 2IO1B 2N7EA 4NJ6A 3A1QA 5EDSA 4YL8A 2IYDB 2GOWA 2O6VA 2DAJA 1C1YB 2DAFA 2KANA 3ZTDA 4EUTA 5JHBA 4OVUA 3K9PB 2J0JA 2MSED 2KQSA 1I35A 2DZIA 3RZWC 2KJ6A 1WM3A 2DZMA 3WANA 5KHQA 4W9DA 4E3CA 4EKUA 5G55A 1Z5SB 3ZNGC 1TTNA 2CKHB 2JT4B 2FCNA 3NY5A 2OOBB 3RYTA 3ZUNA 5C1ZA 3WAOA 3ZVVA 2JXXA 1E90A 2EKEC 4HXDA 4OVVA 3Q3JA 2ZNVC 1WXSA 2LD9A 2NVUI 2FCSA 3L16A 3V6EB 2GBNA 1WX9A 1WGHA 4LDTD 3CSTA 4BBNC 4EZKA 4A3PA 4NQKE 4DDGD 4WJPA 3TMPB 3WAPA 3VDZA 4GDLA 2N9XA 4JGHB 3KYDD 4EZJA 3DVGY 1S3SG 3H6NA 3APCA 1BT0A 1Q1OA 2O6VD 2AL6A 2KTRB 3NZUA 2UYZB 4JQWC 5G2NA 1EF5A 4KIKA 1Q5WB 2MLBA 3GZNI 4EEWA 4XC2A 3VUWA 3DDCB 4II3B 2MWSB 4W9IA 4EOYA 2N1WA 1OQYA 2L8JA 2D07B 3RULA 2D11A 4ANWA 3NHEB 2JUOA 3A9KB 2L0TA 2D2QA 4JLCA 1TBEA 2K39A 3SD5A 4WAAA 2AL3A 2NPTB 2WWZA 3N30A 3TJPA 2JPHA 1AARA 3RT3B 2CU1A 3QA8A 4PYUA 4K1RB 3VTVA 2EMSA 3LJ3A 2NCNA 1WGGA 2BKRB 3JSVA 1QZEA 1ZKHA 2BGFA 2WX1A 3RZFA 2M8SA 3H7PB 2MBBB 3KUDB 4LDTB 4DHZB 2LZ6A 1J0GA 4NNJB 2KO3A 4PS7A 3ZTCA 2AYOB 1WR6E 2K8BA 2XK5B 2YLMA 3PRZA 2K6DB 4X57B 2ZPNA 3PLVA 4ASWC 2ZCBA 2A5UA 2FCQA 3A1QB 1GNUA 4XX5A 1H4RA 2O6VB 2G4DB 2WYQA 3AU4A 2D3GA 3ZRCA 1WGDA 3ZW3A 4MEMA 4NAWA 2J0MA 1E7VA 2KD0A 1UBQA 3R3MA 2ZEQA 2ZCCA 1TGZB 2BWFA 1V2YA 1WIAA 1P0RA 3A4RA 3T9LA 2MP2A 4WQOB 2BF8B 1VD2A 4GSWA 5AZFA 2KDEB 1V49A 3NZSA 1YX5B 3VAWA 3DBRI 2KHWB 3EECA 2BWES 3ZNZB 4MSMB 2JF5A 3UGBB 3PZDA 2IY0B 2BKFA 2M17A 4HPMB 4K81A 3ZDTA 2ZZPB 3V6CB 2RPQA 3HIZA 4IUMB 4WWOA 3ZDMC 3AXCA 4GDLB 2KDFB 1WJ4A 2LVQA 2LVOA 3V61A 3OLMD 1I42A 2FCMA 2MQJA 4GN1A 2GBKA 3RCZA 4DHZE 4LJPB 2D10A 2FNJB 4KIKB 4LJOB 1J19A 1WX8A 1R4NI 1EO6A 2M0XA 4M8MA 2PPHA 2LRUA 1IPGA 3KUCB 1WFYA 2G4SA 2KC2A 5DCNA 1Q0WB 4A3OA 3EHVA 4KSKC 3H7PA 1WE6A 3WAMA 4B6WA 3ECIA 3SU8X 2FUHB 3QAQA 5E6PA 2KXJA 4HJKA 2L00B 4NQLB 2LGYA 2R2OA 5L83A 2K25A 4TKNA 1PQSA 2HJ8A 1LM8B 1WJ6A 4B95A 4FADA 5IA7A 2CHXA 3JSVB 3CF6E 2CR5A 1CMXB 3SDLC 2W9NA 1WRDB 3L54A 1R4MI 2JRHA 4BKSA 2FAZA 3QK0A 2L3ZA 2A4ZA 2BYFA 4WJQA 2KX0A 1V9JA 3B08A 5DPTA 4B9KA 1NBFC 1X1MA 4IM0A 3PV1A 4DXAB 2Z0EB 2C7NB 4W9LA 1M94A 4M8NA 3ZLZA 1A5RA 3PRPB 1ZGUB 1WF9A 3PGEA 2ZNVB 3W1YA 1U4AA 2KWUB 3X0WA 2K1FA 2N9PC 4W9KA 1V5OA 4K7UA 3TIXA 2M1MA 2HD5B 2CHWA 4NAWB 1SE9A 4AJWA 4HPLB 1Z2MA 3M62B 4PS3A 3APDA 3I3TB 4GDKA 3S2AA 3HM6X 4I6NB 2LGXA 4MGYE 2QHOA 3SHQA 3OJ3A 2MP2B 3ZNHB 1S1QB 1WR1A 3N32A 4HK2A 4K7SA 2ZVOA 5CTRC 4A20A 5J2RA 4ZYNA 2CS4A 3K9OB 5C23A 2AWTA 3KVFB 3VFKA 1GG3A 3VHTC 1UELA 1WJNA 3AU5A 2LI5A 5FR6A 4BKSD 1UGMA 4WWPA 1YQBA 2DZJA 3P2BA 4IW0A 2KVRA 4FHJA 4ANXA 1IP9A 1E8YA 2MRPA 3QQ8B 4KV2A 3QX1A 1LXDA 2DZKA 4IWOA 4HDQA 4W9CA 3IHPC 2GMIC 4F7ZA 2J0KA 4IM2A 2NBUA 3QJZA 2R2QA 2JWZA 3ENEA 4AWJA 4PYZA 1NI2A 2DENB 4HWIB 2NS5A 3O65B 2B3AA 2PEAA 1V5TA 3CMMB 2IO2B 3AULA 3H7SA 4DWFA 4BOZB 2FIFA 4CO7A 4MGKE 5JHAA 2C9WB 2REXA 4M0WB 1WXVA 2XBBC 4HLEA 1GUAB 4J6IA 5DPWA 3Q3FA 3TCAA 2KDBA 3EFUA 2PJHA 2N1VA 1LQBA 4KDIC 4G0NB 1XD3B 3MJWA 4JIOU 2HTHA 2KX3A 2JY6A 4F8CB 5CHFA 1WH3A 3UQAA 2MCNB 1SGHA 3B1LX 1YX6B 3PLUA 4MJSA 1OGWA 1KOTA 2ZJDA 2XEWA 3QCAA 2V1YA 2MBOA 3JVZX 3U8ZA 3H1UA 3VXWA 4BFRA 4EFOA 1MG8A 1WMHA 2LWPA 1E8ZA 3BY4B 1TZ1A 3L08A 2DYBA 1YD8U 2GBRA 2KWVB 4GOCA 2KWCA 2GBMA 3IG3A 3LDZE 4KZCA 3DBHI 5DPSA 5HKHA 4ZRKA 2JZZA 5E6NA 3R7RA 4GDKB 4HVBA 1UBIA 2L05A 4LCDE 3QWZB 1KLVA 5E6OA 3BINA 3VH4B 4DK5A 3UINB 1RLFA 4BKGA 1WY8A 2KLGA 3GOEA 2L0FA 2V4LA 2ASQA 2IY1B 1V86A 1OEYA 3EC8A 2UWQA 1WXMA 3QARA 5LLIA 4TQ0A 1ZW7A 2MBHA 3UIPB 4ZRJA 3HHMA 3DOWA 4DDID 1WZ0A 4MM3A 2M4NA 2I1JA 2LXCA 3KW5B 4NY0A 3A9JA 1OEYJ 4FBJB 2VRRB 3PPAA 3PRMB 3C0RB 1KM7A 3M3JA 5JH5C 2LRWA 3PT2B 2IBIB 3B0AA 2C7HA 1WXAA 3KH0A 4AOFA 2KNBA 2BYEA 2PE9A 4GXBA 3A4SC 3QHTA 3IBEA 5D7GA 3OAWA 5DPRA 4DHJD 4FULA 1UZXB 1YJ1A 2IO0B 2KFJA 3WIMA 2KLCA 1V80A 4ZRIA 2LASA 3DCGA 3DVNU 4HDOA 5D94A 3M95A 4TQ1A 3DQVA 4FLHA 1F9JA 2AEHA 4IC7B 2O2VA 4IG7B 3ML8A 3L17A 2RSUA 3CSFA 1RFAA 2K6QA 2LXAA 3W1SC 3VUXA 1P98A 3NS8A 2K8HA 4G11A 4AUQC 2PE6B 3PTFC 3DBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHZ A;  2KDI A;  4MSQ B;  5CHV C;  4N9F 4;  3JYU A;  3ML9 A;  4MGI E;  4W9H A;  2KOX A;  4MJS B;  1XQQ A;  2LGD A;  3APF A;  2HE7 A;  3ZIM A;  1WMH B;  4F1S A;  5IAA C;  2IO3 B;  4IWQ A;  3IVF A;  4GMV A;  2KZR A;  5BO4 B;  3KUZ A;  4GU2 A;  3ZKJ C;  1T0Y A;  2Z59 B;  3R66 C;  2WX0 A;  2C5L C;  2DX5 B;  3X23 A;  2KMA A;  1GC7 A;  1WYW B;  1FXT B;  4CYE A;  1L7Y A;  5J17 A;  3PSE B;  2ZPY A;  2KC1 A;  4I6P A;  4DHJ B;  2N7D A;  4CHK A;  1WI0 A;  3V62 A;  3JW0 X;  4IM3 A;  3DVN V;  4KSL C;  2LUE A;  4GIV A;  1SIF A;  4BOS C;  2KJH B;  2MA9 B;  4RM8 A;  3IFW B;  1WX7 A;  4FJV B;  4GB9 A;  5L95 C;  1WM2 A;  1V81 A;  2KK8 A;  3KYC D;  2FID A;  1H8C A;  2WDT B;  1E5W A;  4E74 A;  3QIJ A;  4W9J A;  3UIO B;  2ZVN A;  3N3K B;  5KHO A;  1IYF A;  2DYO A;  4WJN A;  3UQB A;  5AZG A;  2OJR A;  1G6J A;  2G45 B;  3ZO5 B;  4EZL A;  3PS6 A;  4KVG B;  3A9J B;  3NOB A;  2N9E B;  2KFK A;  4ANV A;  2JVC A;  4RM9 A;  3W1S A;  2J7Q B;  2L76 A;  1E7U A;  1KJT A;  4URK A;  4W9E A;  1WE7 A;  2G3Q B;  5CHW A;  3UF8 A;  4AJY B;  3DPD A;  3ALB A;  4FN2 A;  5TR5 A;  3OJ4 B;  1UD7 A;  2Z0D B;  4G3X B;  4TUU A;  3VH3 B;  2NR2 A;  1ISN A;  1GJZ A;  2MW5 A;  1EUV B;  4GGQ A;  4MDK E;  3ONS A;  3RUI B;  3V60 A;  2MBQ A;  3VUY A;  5AEK B;  2EMT A;  4FJY A;  2LJ5 A;  4W9G A;  2GBJ A;  3VVW B;  5D6J B;  4AP4 C;  2O2V B;  4FJZ A;  1OTR B;  2RR9 A;  3VTW A;  1HE8 A;  4K7W A;  4BVU C;  3DBL I;  2KQ7 A;  4KDL B;  3A33 B;  4RMA A;  3HK0 A;  3QC8 B;  3U30 A;  2IZV B;  5CX3 A;  2JRI B;  2L7R A;  4PS8 A;  5GMV A;  2MX2 A;  3WA0 A;  1JRU A;  1WJU A;  4MEL A;  4MH0 E;  3WAL A;  4W9F A;  4XZ4 A;  4ANU A;  2KTF A;  1NDD A;  2BPS A;  3T8M A;  3R7Q A;  1P9D U;  3MTN B;  4ZDV A;  4G50 A;  4FA6 A;  1P3Q U;  2KTR A;  2NBV B;  3PVL A;  5JZE B;  1L2N A;  1UH6 A;  3TL5 A;  3L13 A;  2KJR A;  2Y5B B;  4P7I A;  1LFD A;  3HM3 A;  4JL9 A;  4IWP A;  4NPN A;  4MGZ E;  4DBG A;  1J8C A;  3L0W B;  2NBW B;  3MHS D;  1E8X A;  1WZ3 A;  1WGY A;  3RD2 A;  3M63 B;  3VQI A;  1WGR A;  3AI5 A;  3D32 A;  5LXH A;  3PHX B;  3TBL D;  1RAX A;  4II2 B;  5AZH A;  3A9K A;  3ZRF A;  4E71 A;  2JZ3 B;  2K8C A;  1E8W A;  1YIW A;  3DVG X;  4I6L B;  2C7M B;  4WWN A;  2N4F A;  2MBE A;  2BYV E;  3H9D A;  4NJ7 A;  1RRB A;  2I1K A;  2NPT A;  2DYM A;  1VCB A;  1GC6 A;  3VTU A;  5J18 A;  1V6E A;  1EF1 A;  1P1A A;  2CHZ A;  2V3S A;  4FHK A;  4ICU A;  4BBN F;  5LXI B;  2YVC A;  1C3T A;  2RD0 A;  4WJO A;  4HCP B;  4TV3 A;  2C60 A;  4KZ0 A;  4BKT A;  2LVP A;  1XT9 B;  2KFK B;  1D3Z A;  4ICV A;  2KN5 A;  2KKC A;  2KMC A;  2RGF A;  3PHW B;  4HCN B;  1K8R B;  3L10 B;  3PRE A;  2XK5 A;  1Y8R C;  5D2M B;  3U7D A;  3ZNI D;  2IO1 B;  2N7E A;  4NJ6 A;  3A1Q A;  5EDS A;  4YL8 A;  2IYD B;  2GOW A;  2O6V A;  2DAJ A;  1C1Y B;  2DAF A;  2KAN A;  3ZTD A;  4EUT A;  5JHB A;  4OVU A;  3K9P B;  2J0J A;  2MSE D;  2KQS A;  1I35 A;  2DZI A;  3RZW C;  2KJ6 A;  1WM3 A;  2DZM A;  3WAN A;  5KHQ A;  4W9D A;  4E3C A;  4EKU A;  5G55 A;  1Z5S B;  3ZNG C;  1TTN A;  2CKH B;  2JT4 B;  2FCN A;  3NY5 A;  2OOB B;  3RYT A;  3ZUN A;  5C1Z A;  3WAO A;  3ZVV A;  2JXX A;  1E90 A;  2EKE C;  4HXD A;  4OVV A;  3Q3J A;  2ZNV C;  1WXS A;  2LD9 A;  2NVU I;  2FCS A;  3L16 A;  3V6E B;  2GBN A;  1WX9 A;  1WGH A;  4LDT D;  3CST A;  4BBN C;  4EZK A;  4A3P A;  4NQK E;  4DDG D;  4WJP A;  3TMP B;  3WAP A;  3VDZ A;  4GDL A;  2N9X A;  4JGH B;  3KYD D;  4EZJ A;  3DVG Y;  1S3S G;  3H6N A;  3APC A;  1BT0 A;  1Q1O A;  2O6V D;  2AL6 A;  2KTR B;  3NZU A;  2UYZ B;  4JQW C;  5G2N A;  1EF5 A;  4KIK A;  1Q5W B;  2MLB A;  3GZN I;  4EEW A;  4XC2 A;  3VUW A;  3DDC B;  4II3 B;  2MWS B;  4W9I A;  4EOY A;  2N1W A;  1OQY A;  2L8J A;  2D07 B;  3RUL A;  2D11 A;  4ANW A;  3NHE B;  2JUO A;  3A9K B;  2L0T A;  2D2Q A;  4JLC A;  1TBE A;  2K39 A;  3SD5 A;  4WAA A;  2AL3 A;  2NPT B;  2WWZ A;  3N30 A;  3TJP A;  2JPH A;  1AAR A;  3RT3 B;  2CU1 A;  3QA8 A;  4PYU A;  4K1R B;  3VTV A;  2EMS A;  3LJ3 A;  2NCN A;  1WGG A;  2BKR B;  3JSV A;  1QZE A;  1ZKH A;  2BGF A;  2WX1 A;  3RZF A;  2M8S A;  3H7P B;  2MBB B;  3KUD B;  4LDT B;  4DHZ B;  2LZ6 A;  1J0G A;  4NNJ B;  2KO3 A;  4PS7 A;  3ZTC A;  2AYO B;  1WR6 E;  2K8B A;  2XK5 B;  2YLM A;  3PRZ A;  2K6D B;  4X57 B;  2ZPN A;  3PLV A;  4ASW C;  2ZCB A;  2A5U A;  2FCQ A;  3A1Q B;  1GNU A;  4XX5 A;  1H4R A;  2O6V B;  2G4D B;  2WYQ A;  3AU4 A;  2D3G A;  3ZRC A;  1WGD A;  3ZW3 A;  4MEM A;  4NAW A;  2J0M A;  1E7V A;  2KD0 A;  1UBQ A;  3R3M A;  2ZEQ A;  2ZCC A;  1TGZ B;  2BWF A;  1V2Y A;  1WIA A;  1P0R A;  3A4R A;  3T9L A;  2MP2 A;  4WQO B;  2BF8 B;  1VD2 A;  4GSW A;  5AZF A;  2KDE B;  1V49 A;  3NZS A;  1YX5 B;  3VAW A;  3DBR I;  2KHW B;  3EEC A;  2BWE S;  3ZNZ B;  4MSM B;  2JF5 A;  3UGB B;  3PZD A;  2IY0 B;  2BKF A;  2M17 A;  4HPM B;  4K81 A;  3ZDT A;  2ZZP B;  3V6C B;  2RPQ A;  3HIZ A;  4IUM B;  4WWO A;  3ZDM C;  3AXC A;  4GDL B;  2KDF B;  1WJ4 A;  2LVQ A;  2LVO A;  3V61 A;  3OLM D;  1I42 A;  2FCM A;  2MQJ A;  4GN1 A;  2GBK A;  3RCZ A;  4DHZ E;  4LJP B;  2D10 A;  2FNJ B;  4KIK B;  4LJO B;  1J19 A;  1WX8 A;  1R4N I;  1EO6 A;  2M0X A;  4M8M A;  2PPH A;  2LRU A;  1IPG A;  3KUC B;  1WFY A;  2G4S A;  2KC2 A;  5DCN A;  1Q0W B;  4A3O A;  3EHV A;  4KSK C;  3H7P A;  1WE6 A;  3WAM A;  4B6W A;  3ECI A;  3SU8 X;  2FUH B;  3QAQ A;  5E6P A;  2KXJ A;  4HJK A;  2L00 B;  4NQL B;  2LGY A;  2R2O A;  5L83 A;  2K25 A;  4TKN A;  1PQS A;  2HJ8 A;  1LM8 B;  1WJ6 A;  4B95 A;  4FAD A;  5IA7 A;  2CHX A;  3JSV B;  3CF6 E;  2CR5 A;  1CMX B;  3SDL C;  2W9N A;  1WRD B;  3L54 A;  1R4M I;  2JRH A;  4BKS A;  2FAZ A;  3QK0 A;  2L3Z A;  2A4Z A;  2BYF A;  4WJQ A;  2KX0 A;  1V9J A;  3B08 A;  5DPT A;  4B9K A;  1NBF C;  1X1M A;  4IM0 A;  3PV1 A;  4DXA B;  2Z0E B;  2C7N B;  4W9L A;  1M94 A;  4M8N A;  3ZLZ A;  1A5R A;  3PRP B;  1ZGU B;  1WF9 A;  3PGE A;  2ZNV B;  3W1Y A;  1U4A A;  2KWU B;  3X0W A;  2K1F A;  2N9P C;  4W9K A;  1V5O A;  4K7U A;  3TIX A;  2M1M A;  2HD5 B;  2CHW A;  4NAW B;  1SE9 A;  4AJW A;  4HPL B;  1Z2M A;  3M62 B;  4PS3 A;  3APD A;  3I3T B;  4GDK A;  3S2A A;  3HM6 X;  4I6N B;  2LGX A;  4MGY E;  2QHO A;  3SHQ A;  3OJ3 A;  2MP2 B;  3ZNH B;  1S1Q B;  1WR1 A;  3N32 A;  4HK2 A;  4K7S A;  2ZVO A;  5CTR C;  4A20 A;  5J2R A;  4ZYN A;  2CS4 A;  3K9O B;  5C23 A;  2AWT A;  3KVF B;  3VFK A;  1GG3 A;  3VHT C;  1UEL A;  1WJN A;  3AU5 A;  2LI5 A;  5FR6 A;  4BKS D;  1UGM A;  4WWP A;  1YQB A;  2DZJ A;  3P2B A;  4IW0 A;  2KVR A;  4FHJ A;  4ANX A;  1IP9 A;  1E8Y A;  2MRP A;  3QQ8 B;  4KV2 A;  3QX1 A;  1LXD A;  2DZK A;  4IWO A;  4HDQ A;  4W9C A;  3IHP C;  2GMI C;  4F7Z A;  2J0K A;  4IM2 A;  2NBU A;  3QJZ A;  2R2Q A;  2JWZ A;  3ENE A;  4AWJ A;  4PYZ A;  1NI2 A;  2DEN B;  4HWI B;  2NS5 A;  3O65 B;  2B3A A;  2PEA A;  1V5T A;  3CMM B;  2IO2 B;  3AUL A;  3H7S A;  4DWF A;  4BOZ B;  2FIF A;  4CO7 A;  4MGK E;  5JHA A;  2C9W B;  2REX A;  4M0W B;  1WXV A;  2XBB C;  4HLE A;  1GUA B;  4J6I A;  5DPW A;  3Q3F A;  3TCA A;  2KDB A;  3EFU A;  2PJH A;  2N1V A;  1LQB A;  4KDI C;  4G0N B;  1XD3 B;  3MJW A;  4JIO U;  2HTH A;  2KX3 A;  2JY6 A;  4F8C B;  5CHF A;  1WH3 A;  3UQA A;  2MCN B;  1SGH A;  3B1L X;  1YX6 B;  3PLU A;  4MJS A;  1OGW A;  1KOT A;  2ZJD A;  2XEW A;  3QCA A;  2V1Y A;  2MBO A;  3JVZ X;  3U8Z A;  3H1U A;  3VXW A;  4BFR A;  4EFO A;  1MG8 A;  1WMH A;  2LWP A;  1E8Z A;  3BY4 B;  1TZ1 A;  3L08 A;  2DYB A;  1YD8 U;  2GBR A;  2KWV B;  4GOC A;  2KWC A;  2GBM A;  3IG3 A;  3LDZ E;  4KZC A;  3DBH I;  5DPS A;  5HKH A;  4ZRK A;  2JZZ A;  5E6N A;  3R7R A;  4GDK B;  4HVB A;  1UBI A;  2L05 A;  4LCD E;  3QWZ B;  1KLV A;  5E6O A;  3BIN A;  3VH4 B;  4DK5 A;  3UIN B;  1RLF A;  4BKG A;  1WY8 A;  2KLG A;  3GOE A;  2L0F A;  2V4L A;  2ASQ A;  2IY1 B;  1V86 A;  1OEY A;  3EC8 A;  2UWQ A;  1WXM A;  3QAR A;  5LLI A;  4TQ0 A;  1ZW7 A;  2MBH A;  3UIP B;  4ZRJ A;  3HHM A;  3DOW A;  4DDI D;  1WZ0 A;  4MM3 A;  2M4N A;  2I1J A;  2LXC A;  3KW5 B;  4NY0 A;  3A9J A;  1OEY J;  4FBJ B;  2VRR B;  3PPA A;  3PRM B;  3C0R B;  1KM7 A;  3M3J A;  5JH5 C;  2LRW A;  3PT2 B;  2IBI B;  3B0A A;  2C7H A;  1WXA A;  3KH0 A;  4AOF A;  2KNB A;  2BYE A;  2PE9 A;  4GXB A;  3A4S C;  3QHT A;  3IBE A;  5D7G A;  3OAW A;  5DPR A;  4DHJ D;  4FUL A;  1UZX B;  1YJ1 A;  2IO0 B;  2KFJ A;  3WIM A;  2KLC A;  1V80 A;  4ZRI A;  2LAS A;  3DCG A;  3DVN U;  4HDO A;  5D94 A;  3M95 A;  4TQ1 A;  3DQV A;  4FLH A;  1F9J A;  2AEH A;  4IC7 B;  2O2V A;  4IG7 B;  3ML8 A;  3L17 A;  2RSU A;  3CSF A;  1RFA A;  2K6Q A;  2LXA A;  3W1S C;  3VUX A;  1P98 A;  3NS8 A;  2K8H A;  4G11 A;  4AUQ C;  2PE6 B;  3PTF C;  3DBS A; 
#chains in the Genus database with same CATH topology
 2KDI A;  4MSQ B;  1HXY D;  2QIE B;  4MJS B;  3BYY B;  2LGD A;  3ZIM A;  1TY0 A;  4IWQ A;  5T8I A;  1HTQ A;  3R66 C;  2WXK A;  3TUO A;  2ZPY A;  4DHJ B;  2N7D A;  4IM3 A;  3DVN V;  4BOS C;  2KJH B;  1FMA D;  1WX7 A;  2WXP A;  3FC4 A;  1T0S C;  1WM2 A;  4PK1 A;  1L0Y B;  3LYY A;  2ZVN A;  2DYO A;  4WJN A;  4XWT A;  4EZL A;  2SAK A;  4KVG B;  3U2S C;  4RM9 A;  3AB5 A;  1VLB A;  1E7U A;  1WE7 A;  4FN2 A;  3OJ4 B;  2Z0D B;  4G3X B;  2BVC A;  1GJZ A;  3ONS A;  3RUI B;  3V60 A;  1KFY B;  2EMT A;  4XE0 A;  2E6X A;  2LJ5 A;  4W9G A;  1PFD A;  1I4P A;  1JRP A;  1MPE A;  2RR9 A;  1HE8 A;  1I4H A;  4K7W A;  4OZA A;  2M56 B;  4KDL B;  2RMM A;  2HTM E;  1FXI A;  2QIL A;  3U30 A;  2CJN A;  2GB1 A;  2RDG A;  1FIQ A;  1KRH A;  5GMV A;  3AE9 B;  2MX2 A;  1VRA B;  3WA0 A;  3GS2 A;  4XWW A;  3AEG B;  1MHX A;  1NDD A;  2MH7 A;  3T8M A;  2WU2 B;  1YQ3 B;  2KTR A;  4AS1 A;  1N63 A;  1OFF A;  4NPN A;  1CK1 A;  1WGY A;  5LXH A;  3M63 B;  1WGR A;  3AI5 A;  1WRI A;  3D32 A;  1J7A A;  1RAX A;  1HA5 A;  1QOG A;  1CJE A;  1I7H A;  2K8C A;  1T0Q C;  3HVZ A;  1RRB A;  2N9K A;  1FCL A;  2DYM A;  1ZUD 2;  2KAC A;  1EF1 A;  5LXI B;  2RD0 A;  4WJO A;  4HCP B;  4C4V B;  2WXG A;  4BKT A;  2LVP A;  2KFK B;  3PHW B;  2KMC A;  4HCN B;  2IO1 B;  3A1Q A;  2AX5 A;  2GOW A;  2O6V A;  1C1Y B;  2DAF A;  3FAH A;  1ROE A;  3K9P B;  2WDR B;  2MSE D;  2KQS A;  2KJ6 A;  1WM3 A;  3ZJT A;  1MVK A;  5C1Z A;  3WAO A;  3ZVV A;  4HEA 1;  4HXD A;  2L1A A;  1QOF A;  3I5J C;  3VRA B;  4HKQ A;  1TY2 A;  2ZNV C;  2NVU I;  2LD9 A;  2WXR A;  4XDC A;  1WX9 A;  3CST A;  4BBN C;  3TEZ A;  4DDG D;  4WJP A;  3PZ8 A;  3WAP A;  1UNS A;  3AE5 B;  1S3S G;  5IN7 A;  2K22 A;  4P16 A;  4KIK A;  1Q5W B;  2MLB A;  3Q2A C;  3DDC B;  1FFU A;  2MWS B;  2D07 B;  2EKI A;  3DWM A;  2L0T A;  1TBE A;  2K39 A;  1L5P A;  2BS3 B;  3N30 A;  1LO5 D;  2CU1 A;  2EMS A;  1XXG A;  1K52 A;  3JSV A;  1QZE A;  3RZF A;  3Q3O C;  2H89 B;  2QC8 A;  3KUD B;  2G1E A;  2LZ6 A;  3LXF A;  1J0G A;  1SE2 A;  1WR6 E;  2YLM A;  2G9H D;  2ZCB A;  3R2I A;  1STE A;  2FCQ A;  1DGJ A;  1H4R A;  2J4X A;  2D3G A;  3ZRC A;  3ZW3 A;  4ZRP A;  1E7V A;  4WIP A;  2ZCC A;  1TGZ B;  1WIA A;  4WQO B;  1VD2 A;  4GSW A;  5AZF A;  3NZS A;  1JQ4 A;  2WDV B;  3VAW A;  3EEC A;  2BWE S;  3ZNZ B;  4MSM B;  3UGB B;  1DYQ A;  2BKF A;  2HDE A;  3ZDT A;  2ZZP B;  3V6C B;  4ZHP A;  4HPP A;  4GDL B;  1WJ4 A;  4WH4 A;  4GN1 A;  4DHZ E;  2FNJ B;  4RCO A;  1BUI C;  1EWY C;  1R4N I;  3IT6 B;  3N1Y C;  3GP7 A;  4S17 A;  2LRU A;  1WFY A;  5MPO A;  3HVD A;  2DBY A;  1FCC C;  4KSK C;  4B6W A;  1WE6 A;  1DOX A;  2KXJ A;  4YSX B;  5L83 A;  3WCQ A;  2GLS A;  2CR5 A;  3SDL C;  2WXL A;  3MC8 A;  1SE4 A;  4LNF A;  1JWA D;  2A4Z A;  4WJQ A;  1V1O A;  3B08 A;  4B9K A;  4IM0 A;  3PV1 A;  3ZLZ A;  1XEE A;  1JWS D;  5G5H A;  3IXS A;  3X0W A;  3U7Z A;  3UI3 A;  4NAW B;  1SE9 A;  5IO9 A;  1LGR A;  2JXT A;  4PS3 A;  4WAF A;  2YEP F;  4JWS C;  4RF1 A;  3I3T B;  3S2A A;  3HM6 X;  2GRI A;  2MP2 B;  3ZNH B;  2WU5 B;  5CTR C;  4IKG A;  3FIL A;  2CS4 A;  4USA A;  4ZYN A;  5C23 A;  1NYQ A;  3KVF B;  3E56 A;  1WJN A;  4JX1 C;  3RMK C;  1YQB A;  2N0S B;  2OJW A;  2WQY B;  3P2B A;  2MRP A;  4KV2 A;  3KLS X;  1T3Q A;  1L0V B;  3AH7 A;  4TSS A;  4PYZ A;  2X8X X;  2PEA A;  2JSV X;  4REZ A;  3RNF C;  2FIF A;  2WXO A;  4MGK E;  4TMA B;  5JHA A;  2BS2 B;  4MM3 B;  1E6E B;  1TYG B;  3P4Q B;  4J6I A;  5DPW A;  2KDB A;  4G0N B;  1YJJ A;  3MJW A;  2HTH A;  1C9F A;  2KX3 A;  3TEY A;  4F8C B;  1WH3 A;  2MEK A;  1SGH A;  1OGW A;  4MH8 A;  1YNT E;  2MBO A;  4BFR A;  1YN4 A;  3W5U B;  2AQ1 B;  2KWV B;  3LDZ E;  1SEB D;  3R8B A;  4M02 A;  3DBH I;  5HKH A;  2EEL A;  2J53 A;  4HVB A;  4LCD E;  1P7E A;  2M19 A;  1KLV A;  1BXT A;  3BIN A;  2D5G A;  1OQR A;  3Q6B A;  1OEY A;  1EU4 A;  3EC8 A;  3Q8F A;  2R61 A;  1C77 A;  4ZRJ A;  2OHF A;  3DOW A;  4DDI D;  1WZ0 A;  4MM3 A;  2M4N A;  2LXC A;  3A9J A;  3PPA A;  3PRM B;  5JH5 C;  2IBI B;  3B0A A;  3KH0 A;  4AOF A;  1I4X A;  2PE9 A;  3A4S C;  1ET9 A;  2INC C;  2WLB A;  2KLC A;  4ZRI A;  2QSD A;  5D94 A;  4LNO A;  1JAL A;  4FLH A;  1QLB B;  4IC7 B;  2O2V A;  3CWI A;  2K6Q A;  2LXA A;  4XGA B;  4G11 A;  5E6J A;  2VH1 A;  3U52 E;  2DHZ A;  4FXC A;  3ZYY X;  3H8H A;  2IND C;  4LNK A;  1XQQ A;  2JYE A;  5BO4 B;  3HRD D;  2V0G A;  3KUZ A;  3AE7 B;  3VR9 B;  4K3C A;  2C5L C;  3X23 A;  4CYE A;  1TIF A;  4I6P A;  4CHK A;  3V62 A;  4GIV A;  2FE8 A;  1HZ5 A;  1QOA A;  3IFW B;  4FJV B;  4NJC A;  4YTN B;  1ZPS A;  1V81 A;  1E5W A;  4E74 A;  3QIJ A;  4W9J A;  3UIO B;  5KHO A;  2YEP B;  4UDU C;  2OJR A;  4A6Q A;  4QAY A;  3NOB A;  2N9E B;  2ACZ B;  4ANV A;  2BBC A;  1N6Z A;  2J7Q B;  4URK A;  4IOI E;  3UF8 A;  3ZJV A;  3ALB A;  3BVG A;  1ISN A;  3BWU D;  4US9 A;  2H88 B;  1IBX B;  2L52 A;  2GBJ A;  1EU3 A;  5D6J B;  2K0P A;  1M4V A;  4FJZ A;  1OTR B;  1QQR A;  4RMA A;  3HK0 A;  2LHE A;  1QIL A;  1FO4 A;  4J3O D;  4MEL A;  1K50 A;  4RH6 A;  3TEW A;  4W9F A;  2NTT A;  1NYR A;  4ACF A;  1MHH E;  4ANU A;  4EE2 A;  3R7Q A;  3MTN B;  1UWM A;  2NBV B;  3AN1 A;  2INN E;  2KJR A;  1LFD A;  3DWG C;  4MGZ E;  4DBG A;  3RD2 A;  1XCQ L;  2KMM A;  3PHX B;  2Y5P A;  2PMV A;  5AZH A;  4MAC A;  3A9K A;  3ZRF A;  4E71 A;  1E8W A;  1QF6 A;  1GPX A;  2C7M B;  4WWN A;  2MBE A;  3H9D A;  4ZOH C;  2I1K A;  1VCB A;  2CHZ A;  1PGA A;  2IJ0 A;  4FHK A;  4ICU A;  1C3T A;  4TV3 A;  1YMH E;  1JML A;  1XT9 B;  2KN5 A;  1K8R B;  3L10 B;  3U7D A;  3ZNI D;  2N7E A;  3HUI A;  5HFY A;  4HKZ E;  4YL8 A;  1WSP A;  2KAN A;  5C3J B;  4EUT A;  1ESF A;  1I4R A;  4W9D A;  1RWS A;  1B1Z A;  1TT5 B;  3V6E B;  2KT7 A;  1FNV A;  1WGH A;  2N9X A;  4JGH B;  1JW9 D;  4EZJ A;  3DVG Y;  3H6N A;  2O6V D;  5G2N A;  2AL6 A;  2KTR B;  4JQW C;  2K9X A;  4GLS C;  3GZN I;  3VUW A;  1A70 A;  1OQY A;  2L8J A;  3RUL A;  4HRO A;  2D11 A;  4ANW A;  2JUO A;  1J7C A;  1JWB D;  1YQ4 B;  1VDV A;  2WWZ A;  1AAR A;  4US8 A;  4PYU A;  1L4Z B;  2N7J A;  2NCN A;  2BKR B;  1SXT A;  1ZKH A;  2W3R A;  4DHZ B;  3PRZ A;  2K8B A;  4ASW C;  5D3I B;  3KWV A;  4BZA A;  3DHI C;  2A5U A;  3A1Q B;  2TSS A;  2ONQ A;  2O6V B;  1TS2 A;  2G4D B;  2LJI A;  2WYQ A;  3RNG C;  1GB4 A;  1C4C A;  1VZ8 A;  2BWF A;  1V2Y A;  3Q8A A;  1JCK B;  2BF8 B;  3DBR B;  4KKI A;  5HI1 A;  3B9J A;  1WYG A;  4K81 A;  2KAJ A;  2RPQ A;  4WWO A;  3AXC A;  3AEF B;  2LVQ A;  2UU7 A;  2LVO A;  2JYT A;  1I42 A;  2FCM A;  2MQJ A;  1RYJ A;  3EUB 2;  1HTO A;  2D10 A;  4KIK B;  4LJO B;  4MT5 A;  3AED B;  4M8M A;  3Q69 A;  1IPG A;  1ZDX A;  5DCN A;  2G4S A;  1Q0W B;  4A3O A;  2I38 A;  3QAQ A;  1F2R I;  4HJK A;  4H2A A;  1Y56 A;  4RGM A;  1LM8 B;  2CHX A;  3JSV B;  2W9N A;  4BKS A;  3ETR A;  2KX0 A;  1NBF C;  4W9L A;  2C7N B;  1BML C;  3AE8 B;  4C7Y A;  1TS5 A;  2KWU B;  2JX5 A;  1V5O A;  3TIX A;  2HD5 B;  1C79 A;  1AWD A;  4AJW A;  1E7P B;  4HPL B;  4OW0 A;  1EM7 A;  2LGX A;  5BMI A;  4MGY E;  3SHQ A;  3AEA B;  3N32 A;  4A20 A;  3GZN B;  4HK2 A;  4K7S A;  1WGK A;  2PKO A;  3K9O B;  2AWT A;  3VFK A;  3VHT C;  5EE0 A;  3NVW A;  2LGS A;  3AU5 A;  2CU3 A;  4ARI A;  4M00 A;  4ZHO A;  4IW0 A;  4ANX A;  1VZ6 A;  4W9C A;  3QX1 A;  2DZK A;  3IHP C;  1FRR A;  2GMI C;  4F7Z A;  2J0K A;  3QJZ A;  1UUP A;  3EA6 A;  1NI3 A;  1NI2 A;  2DEN B;  2B3A A;  1V5T A;  2IO2 B;  1ACC A;  1D5X C;  4CO7 A;  2C9W B;  2WGS A;  1WXV A;  4HLE A;  1GUA B;  3RPF C;  1CZP A;  1WWT A;  3SR6 A;  2BYT A;  1JWM D;  2IGD A;  2PJH A;  1T0R C;  1KF6 B;  2KDM A;  3AMZ A;  3N20 C;  3ZQ4 A;  3RNC C;  1QOB A;  4YTP B;  5CHF A;  2MCN B;  1UWX A;  1ZDV A;  4LNI A;  3PLU A;  3Q3N C;  3Q14 C;  3JVZ X;  3H1U A;  4EFO A;  1MG8 A;  1WMH A;  2FBW B;  3BII D;  2WXQ A;  2GBM A;  3IG3 A;  4KZC A;  2PTL A;  4N6E B;  3NS1 A;  5DPS A;  5JXV A;  5E6N A;  3R7R A;  1C78 A;  2L05 A;  3RNA C;  2J42 A;  3IT4 B;  3FIL B;  3UIN B;  4BKG A;  1WY8 A;  2KLG A;  3GOE A;  3P4R B;  2L0F A;  1FNU A;  2WP9 B;  1D5M C;  2LFI A;  2WXJ A;  3BK1 A;  2XN9 C;  5LLI A;  2X38 A;  2MBH A;  3UIP B;  3HHM A;  2I1J A;  4NY0 A;  1PGX A;  2VRR B;  3C0R B;  1KM7 A;  3M3J A;  1V1P A;  4GXB A;  4L23 A;  1D5Z C;  1YN3 A;  5HHD G;  5DPR A;  2IO0 B;  2KFJ A;  1V80 A;  4HDO A;  4OVZ A;  1XLO A;  3ML8 A;  2RSU A;  3W1S C;  5EE1 A;  3NS8 A;  1UGJ A;  2W54 A;  3PTF C;  2BB6 A;  2BQQ A;  1ENF A;  4C80 A;  2WS3 B;  4N9F 4;  3JYU A;  3ML9 A;  4MGI E;  2AQ3 B;  2QDF A;  2W82 A;  2HE7 A;  2JU6 X;  4LNN A;  3IVF A;  4GMV A;  2KZR A;  4C56 C;  4A9A A;  2DNF A;  1QT9 A;  4GU2 A;  3ZKJ C;  2KMA A;  5J17 A;  1IGC A;  1L7Y A;  3AE3 B;  3PSE B;  3P1M A;  2E3T A;  1WI0 A;  2Y5C A;  4KSL C;  1TS4 A;  2JQR B;  4JWU C;  3AV8 A;  4RM8 A;  4RFB A;  4YT0 B;  2ICI A;  3ABV B;  4YSY B;  3KYC D;  2WDT B;  1IYF A;  3UQB A;  3W2D A;  2G45 B;  3MC0 B;  3PS6 A;  3O13 A;  3A9J B;  3ZJU A;  4RGO S;  1KJT A;  5BMG A;  2G3Q B;  5CHW A;  3DPD A;  5TR5 A;  1UD7 A;  4TUU A;  4GGQ A;  3P4S B;  2MBQ A;  1EWC A;  3VUY A;  4KGT A;  5H92 C;  3DBL B;  3VVW B;  2O2V B;  5G5G A;  4LK0 M;  3VTW A;  1FEH A;  1F0Z A;  2KQ7 A;  2HJ1 A;  1C76 A;  3A33 B;  3QC8 B;  5CX3 A;  2JRI B;  2L7R A;  4PS8 A;  1WJU A;  4BAX A;  4MH0 E;  1T6B X;  4XZ4 A;  2LUM A;  1MFW A;  2WNM A;  2BPS A;  4ZDV A;  4FA6 A;  1P3Q U;  3PVL A;  4N59 A;  1L2N A;  4XYC A;  1B9R A;  1GB1 A;  3L13 A;  1SIJ A;  4LLG M;  4P7I A;  5H8Y E;  4JL9 A;  1J8C A;  3VQI A;  1E8X A;  1WZ3 A;  3TEX A;  3TBL D;  4II2 B;  1PDX A;  4RF0 A;  3DVG X;  2QJL A;  2BYV E;  2NPT A;  2QCZ A;  4O1N A;  3VTU A;  1V6E A;  4L2Y A;  1P1A A;  3I63 C;  4P1B C;  4BBN F;  1AN8 A;  4KZ0 A;  1D3Z A;  3BK2 A;  4ARC A;  2XK5 A;  4NJ6 A;  2IYD B;  2DAJ A;  3ZTD A;  5JHB A;  2J0J A;  3T3O A;  2DZM A;  4A90 A;  4E3C A;  3VR8 B;  5G55 A;  4EKU A;  1NVI D;  3ZNG C;  1N5X A;  2FCN A;  3RYT A;  3N1Z C;  2K5P A;  2NTS A;  1PUT A;  3MJ5 A;  2LMC A;  3MP9 A;  5IP4 D;  4OVV A;  1WXS A;  3L16 A;  3NUH B;  2GBN A;  4LDT D;  1L4D B;  4A3P A;  4NQK E;  5AUK A;  3TMP B;  3VDZ A;  2KN4 A;  3Q8C A;  3KYD D;  3APC A;  1BT0 A;  3NZU A;  2UYZ B;  3AE2 B;  1EF5 A;  4EEW A;  3BZD B;  4ZYS A;  4EOY A;  2N1W A;  1J7B A;  2WXH A;  2VZK D;  3NHE B;  3A9K B;  2D2Q A;  3GE8 C;  2BW2 A;  4WAA A;  2JPH A;  1KTK A;  4WWM A;  3RT3 B;  3QA8 A;  2SEB D;  2WHI A;  1XF5 L;  4KKJ A;  1WGG A;  3PZ7 A;  4LDT B;  4NNJ B;  4PS7 A;  3ZTC A;  2ON8 A;  1MI0 A;  5IKC M;  3AU4 A;  1WGD A;  1YJI A;  2PIA A;  2J0M A;  3IAM 1;  3R3M A;  1N61 A;  1D4B A;  2ZEQ A;  1SBB B;  3R2T A;  3A4R A;  3SFD B;  3EGR A;  2VZK B;  1V8C A;  4ITK A;  1V49 A;  3DBR I;  2KHW B;  2RDB C;  2BB5 A;  3NZ3 A;  2JF5 A;  3V05 A;  2IY0 B;  4IUM B;  1ET6 A;  3ZDM C;  2KDF B;  4HJG E;  3V61 A;  4B0M A;  1C4A A;  3RCZ A;  1J19 A;  2LEK A;  2IGH A;  3KUC B;  3Q8B A;  3B2F A;  4DXG A;  3B2G A;  3T3N A;  3WAM A;  4JE3 B;  2QMT A;  4M0W A;  2FUH B;  2DWQ A;  3C8Y A;  2RDH A;  4NQL B;  2LGY A;  1XLQ A;  2K25 A;  4YTM B;  4TKN A;  1PQS A;  1R4M B;  2HJ8 A;  3VRB B;  1WJ6 A;  2FUG 1;  3RNE C;  4FAD A;  5IA7 A;  3CF6 E;  1CMX B;  2FAZ A;  3QK0 A;  1L0X B;  2BYF A;  5DPT A;  1V9J A;  2WXM A;  1X1M A;  2WXN A;  4KGR A;  5EE3 A;  1A5R A;  1ZGU B;  1WF9 A;  2ZNV B;  3W1Y A;  1U4A A;  3Q3M C;  2K1F A;  2N9P C;  4W9K A;  4K7U A;  3TSS A;  1PGB A;  1R7S A;  1K51 A;  1Z2M A;  3M62 B;  3NVZ A;  4OZC A;  4GDK A;  4I6N B;  2QHO A;  3OJ3 A;  1S1Q B;  1JRO A;  1WR1 A;  3BVM A;  2LHD A;  3AE1 B;  5FR6 A;  4BKS D;  1UGM A;  3AEB B;  4WWP A;  4KX6 B;  1E8Y A;  3QQ8 B;  2V3P A;  4IWO A;  4HDQ A;  1ZP0 B;  3ZGZ A;  3NG0 A;  2R2Q A;  1E10 A;  2JWZ A;  1AW7 A;  4PT5 A;  1C4P A;  4AWJ A;  4HWI B;  3SEB A;  2NS5 A;  3AUL A;  3H7S A;  4R3D A;  3C19 A;  4DWF A;  1YOV B;  2REX A;  2XBB C;  1I4Q A;  2ZW0 A;  2RPV A;  1VZ7 A;  1OQQ A;  3Q3F A;  3N1X C;  3TCA A;  3W5V B;  3EFU A;  4RGT A;  1XD3 B;  4DXF A;  1VJK A;  2JY6 A;  1I4G A;  1MG4 A;  4RNA A;  3BYT B;  2MHJ A;  1YX6 B;  3GB1 A;  4MJS A;  1KOT A;  4JPS A;  1YN5 A;  2XEW A;  3QCA A;  2V1Y A;  3U8Z A;  3VXW A;  1HQR D;  1E8Z A;  3BY4 B;  4XDD A;  1YD8 U;  1DOI A;  4ZRK A;  2JZZ A;  1UBI A;  1FNW A;  2V4L A;  2D3B A;  2ASQ A;  2IY1 B;  2KVZ A;  3URY A;  1RFK A;  1WXM A;  1TKY A;  3QAR A;  1FD6 A;  4TQ0 A;  1TZO A;  4P6V F;  2LRW A;  2C7H A;  1WXA A;  4S0R A;  2KNB A;  3QHT A;  3IBE A;  2XNA C;  3OAW A;  4OZB A;  4D2K A;  4FUL A;  1UZX B;  2LAS A;  3DCG A;  2M0A A;  4TQ1 A;  1F9J A;  4IG7 B;  5D3D A;  5BMH A;  3L17 A;  3DBS A;  1RFA A;  3VUX A;  3EFC A;  2K8H A;  4AUQ C;  2Z8L A;  3FKY A;  5CHV C;  1F1H A;  4W9H A;  2V4I B;  2KOX A;  4P1C C;  3APF A;  1WMH B;  4F1S A;  5IAA C;  2IO3 B;  3PO0 A;  1T0Y A;  2Z59 B;  2WX0 A;  2DX5 B;  1GC7 A;  1WYW B;  1FXT B;  1N62 A;  3NRZ A;  2INP E;  2KC1 A;  5LNK 1;  2BTE A;  3JW0 X;  4N58 A;  2V3N A;  1TS3 A;  2LUE A;  1SIF A;  2MA9 B;  2B76 B;  1TJE A;  4YWG G;  4GB9 A;  5L95 C;  2KK8 A;  2FID A;  1H8C A;  1P7F A;  2L32 A;  2VH2 A;  3N3K B;  2IPK D;  5AZG A;  2BT6 A;  5FR3 A;  1G6J A;  3ZO5 B;  4C4V A;  3GE3 C;  5AUI A;  2KFK A;  2JVC A;  2D3C A;  1V1P B;  2QEJ C;  3W1S A;  2L76 A;  4W9E A;  4AJY B;  2JWU A;  3VH3 B;  1ZE3 D;  2NR2 A;  2MW5 A;  1EUV B;  4MDK E;  4Q2J A;  5AEK B;  1E0Z A;  1KLG D;  3I9V 1;  4FJY A;  4AP4 C;  4BVU C;  3DBL I;  2L83 A;  2PVO D;  4L1B A;  1D6E C;  4KGS A;  1L6U A;  1K53 A;  3NJT A;  2IZV B;  3MC9 A;  5BYS A;  3BVZ A;  1JRU A;  3WAL A;  2PW9 A;  5BYR A;  1IUE A;  4AQ7 A;  2KTF A;  1P9D U;  1JWU D;  3KQ4 A;  4G50 A;  2Y3A A;  5JZE B;  1UH6 A;  3TL5 A;  3P4P B;  2Y5B B;  3HM3 A;  4IWP A;  1ZXI A;  3RN9 C;  3L0W B;  2NBW B;  3MHS D;  3DHH C;  1FRD A;  1XO3 A;  3DHG C;  2WXF A;  3Q8E A;  4NAM A;  2JZ3 B;  1YIW A;  4I6L B;  2N4F A;  2DLB A;  3AM9 A;  4NJ7 A;  1GC6 A;  5J18 A;  5IOI A;  2V3S A;  1KH0 A;  4YSZ B;  1FXA A;  3KWL A;  1KLU D;  2YVC A;  2C60 A;  1SE3 A;  1T5X D;  5FK9 C;  4ICV A;  2KKC A;  2RGF A;  2GI9 A;  3PRE A;  1DOY A;  1Y8R C;  3P42 A;  5D2M B;  5EDS A;  2WDQ B;  2KQ4 X;  4A55 A;  4OVU A;  1FFV A;  1I35 A;  2JZP A;  2DZI A;  3RZW C;  2BS4 B;  3WAN A;  5KHQ A;  3SFE B;  1VR9 A;  1Z5S B;  1TTN A;  2CKH B;  1QKZ A;  2JT4 B;  3NY5 A;  2OOB B;  3ZUN A;  4YXD B;  2JXX A;  1E90 A;  2EKE C;  3P63 A;  4C00 A;  2KWD A;  2N9L A;  3Q3J A;  2FCS A;  3J9C A;  2KYW A;  3IAS 1;  5GXG B;  4GDL A;  1Q1O A;  1XLP A;  3NVV A;  4XC2 A;  1HEZ E;  4II3 B;  1F77 A;  4W9I A;  1ZOY B;  4JLC A;  1SJE D;  3I57 A;  3SD5 A;  4M01 A;  2AL3 A;  2NPT B;  3TJP A;  3AEE B;  4K1R B;  3OG5 A;  3VTV A;  3LJ3 A;  2BGF A;  2WX1 A;  3L4P A;  2M8S A;  3H7P B;  2MBB B;  5HG2 A;  4CQN A;  2ZW1 A;  2KO3 A;  2AYO B;  2XK5 B;  4X57 B;  2K6D B;  2ZPN A;  4C7Z A;  1GNU A;  4XX5 A;  4MEM A;  4NAW A;  2KD0 A;  1UBQ A;  2PLP A;  1N60 A;  3AE6 B;  4WQM A;  1Q10 A;  1P0R A;  5BYQ A;  3T9L A;  1GOZ A;  1XCT L;  2MP2 A;  2KDE B;  1PYW D;  3LB8 C;  3W9C B;  1F52 A;  2IGG A;  1YX5 B;  2PVG C;  1NEN B;  3PZD A;  4HPM B;  2M17 A;  2IDY A;  3HIZ A;  3V3X A;  1SF0 A;  2W3S A;  3OLM D;  1R4N B;  4LTU A;  2GBK A;  3ZXR A;  4LJP B;  1WX8 A;  1EO6 A;  2M0X A;  2MJE A;  2PPH A;  1TKG A;  3U4E G;  2KC2 A;  3EHV A;  1F2R C;  3H7P A;  3ECI A;  2MJD A;  3SU8 X;  5E6P A;  2V9H A;  2L00 B;  2R2O A;  3E9S A;  1RM6 C;  2LGI A;  1V97 A;  3ZXV A;  2I2Y A;  4B95 A;  1N5W A;  1WRD B;  3L54 A;  3AE4 B;  1R4M I;  2JRH A;  2L3Z A;  4EZK A;  4DXA B;  2Z0E B;  1M94 A;  4M8N A;  3PRP B;  2J52 A;  4DQO C;  3PGE A;  2M1M A;  3OWE B;  2CHW A;  2MJ3 A;  3APD A;  1SSN A;  5J2R A;  2ZVO A;  1GG3 A;  1UEL A;  2LI5 A;  2Q5W D;  2DZJ A;  1IP9 A;  2KVR A;  4FHJ A;  1L6V A;  1LXD A;  2WXI A;  1GAQ B;  4IM2 A;  2NBU A;  5FKA C;  2D3A A;  3ENE A;  1XLN A;  3O65 B;  3CMM B;  3RNB C;  4A8X C;  4BOZ B;  1SB3 C;  4M0W B;  5TSS A;  1IGD A;  3CIR B;  2N1V A;  1LQB A;  4KDI C;  1NEK B;  4HRS A;  3MFG A;  4K3B A;  5EE9 A;  4JIO U;  4OHJ A;  2K3U A;  3UQA A;  1WXQ A;  4IDI A;  3B1L X;  1E9M A;  3AEC B;  2OED A;  2ZJD A;  2LWP A;  4RGN A;  4ZRQ A;  1MJD A;  3DBH B;  1TZ1 A;  3L08 A;  3N9Y C;  2DYB A;  2GBR A;  4GOC A;  1CQV A;  2KWC A;  4GDK B;  2AQ2 B;  3QWZ B;  1UF0 A;  4NZL B;  4WUR A;  5E6O A;  3VH4 B;  4DK5 A;  1FM0 D;  1RLF A;  3NVY A;  1V86 A;  2UWQ A;  1ZW7 A;  5C2T B;  1TKE A;  4FBJ B;  3KW5 B;  3RI7 C;  1OEY J;  3PT2 B;  2BYE A;  2CJO A;  5D7G A;  1AYF A;  1FPY A;  1SJH D;  3MHZ A;  4DHJ D;  1ZXH A;  5I4D A;  1YJ1 A;  3WIM A;  1IBX A;  3RFZ B;  3DVN U;  3M95 A;  2NMQ A;  3DQV A;  2AEH A;  2W55 A;  1HZ6 A;  3CSF A;  1P98 A;  2PE6 B;  4B0E A;  3PLV A; 
#chains in the Genus database with same CATH homology
 2DHZ A;  2KDI A;  4MSQ B;  5CHV C;  4N9F 4;  3JYU A;  3ML9 A;  4MGI E;  4W9H A;  2KOX A;  4MJS B;  1XQQ A;  2LGD A;  3APF A;  2HE7 A;  3ZIM A;  1WMH B;  4F1S A;  5IAA C;  2IO3 B;  4IWQ A;  3IVF A;  4GMV A;  2KZR A;  5BO4 B;  3KUZ A;  4GU2 A;  3ZKJ C;  1T0Y A;  2Z59 B;  3R66 C;  2WX0 A;  2C5L C;  2DX5 B;  3X23 A;  2KMA A;  1GC7 A;  1WYW B;  1FXT B;  4CYE A;  1L7Y A;  5J17 A;  3PSE B;  2ZPY A;  2KC1 A;  4I6P A;  4DHJ B;  2N7D A;  4CHK A;  1WI0 A;  3V62 A;  3JW0 X;  4IM3 A;  3DVN V;  4KSL C;  2LUE A;  4GIV A;  1SIF A;  4BOS C;  2KJH B;  2MA9 B;  4RM8 A;  3IFW B;  1WX7 A;  4FJV B;  4GB9 A;  5L95 C;  1WM2 A;  1V81 A;  2KK8 A;  3KYC D;  2FID A;  1H8C A;  2WDT B;  1E5W A;  4E74 A;  3QIJ A;  4W9J A;  3UIO B;  2ZVN A;  3N3K B;  5KHO A;  1IYF A;  2DYO A;  4WJN A;  3UQB A;  5AZG A;  2OJR A;  1G6J A;  2G45 B;  3ZO5 B;  4EZL A;  3PS6 A;  4KVG B;  3A9J B;  3NOB A;  2N9E B;  2KFK A;  4ANV A;  2JVC A;  4RM9 A;  3W1S A;  2J7Q B;  2L76 A;  1E7U A;  1KJT A;  4URK A;  4W9E A;  1WE7 A;  2G3Q B;  5CHW A;  3UF8 A;  4AJY B;  3DPD A;  3ALB A;  4FN2 A;  5TR5 A;  3OJ4 B;  1UD7 A;  2Z0D B;  4G3X B;  4TUU A;  3VH3 B;  2NR2 A;  1ISN A;  1GJZ A;  2MW5 A;  1EUV B;  4GGQ A;  4MDK E;  3ONS A;  3RUI B;  3V60 A;  2MBQ A;  3VUY A;  5AEK B;  2EMT A;  4FJY A;  2LJ5 A;  4W9G A;  2GBJ A;  3VVW B;  5D6J B;  4AP4 C;  2O2V B;  4FJZ A;  1OTR B;  2RR9 A;  3VTW A;  1HE8 A;  4K7W A;  4BVU C;  3DBL I;  2KQ7 A;  4KDL B;  3A33 B;  4RMA A;  3HK0 A;  3QC8 B;  3U30 A;  2IZV B;  5CX3 A;  2JRI B;  2L7R A;  4PS8 A;  5GMV A;  2MX2 A;  3WA0 A;  1JRU A;  1WJU A;  4MEL A;  4MH0 E;  3WAL A;  4W9F A;  4XZ4 A;  4ANU A;  2KTF A;  1NDD A;  2BPS A;  3T8M A;  3R7Q A;  1P9D U;  3MTN B;  4ZDV A;  4G50 A;  4FA6 A;  1P3Q U;  2KTR A;  2NBV B;  3PVL A;  5JZE B;  1L2N A;  1UH6 A;  3TL5 A;  3L13 A;  2KJR A;  2Y5B B;  4P7I A;  1LFD A;  3HM3 A;  4JL9 A;  4IWP A;  4NPN A;  4MGZ E;  4DBG A;  1J8C A;  3L0W B;  2NBW B;  3MHS D;  1E8X A;  1WZ3 A;  1WGY A;  3RD2 A;  3M63 B;  3VQI A;  1WGR A;  3AI5 A;  3D32 A;  5LXH A;  3PHX B;  3TBL D;  1RAX A;  4II2 B;  5AZH A;  3A9K A;  3ZRF A;  4E71 A;  2JZ3 B;  2K8C A;  1E8W A;  1YIW A;  3DVG X;  4I6L B;  2C7M B;  4WWN A;  2N4F A;  2MBE A;  2BYV E;  3H9D A;  4NJ7 A;  1RRB A;  2I1K A;  2NPT A;  2DYM A;  1VCB A;  1GC6 A;  3VTU A;  5J18 A;  1V6E A;  1EF1 A;  1P1A A;  2CHZ A;  2V3S A;  4FHK A;  4ICU A;  4BBN F;  5LXI B;  2YVC A;  1C3T A;  2RD0 A;  4WJO A;  4HCP B;  4TV3 A;  2C60 A;  4KZ0 A;  4BKT A;  2LVP A;  1XT9 B;  2KFK B;  1D3Z A;  4ICV A;  2KN5 A;  2KKC A;  2KMC A;  2RGF A;  3PHW B;  4HCN B;  1K8R B;  3L10 B;  3PRE A;  2XK5 A;  1Y8R C;  5D2M B;  3U7D A;  3ZNI D;  2IO1 B;  2N7E A;  4NJ6 A;  3A1Q A;  5EDS A;  4YL8 A;  2IYD B;  2GOW A;  2O6V A;  2DAJ A;  1C1Y B;  2DAF A;  2KAN A;  3ZTD A;  4EUT A;  5JHB A;  4OVU A;  3K9P B;  2J0J A;  2MSE D;  2KQS A;  1I35 A;  2DZI A;  3RZW C;  2KJ6 A;  1WM3 A;  2DZM A;  3WAN A;  5KHQ A;  4W9D A;  4E3C A;  4EKU A;  5G55 A;  1Z5S B;  3ZNG C;  1TTN A;  2CKH B;  2JT4 B;  2FCN A;  3NY5 A;  2OOB B;  3RYT A;  3ZUN A;  5C1Z A;  3WAO A;  3ZVV A;  2JXX A;  1E90 A;  2EKE C;  4HXD A;  4OVV A;  3Q3J A;  2ZNV C;  1WXS A;  2LD9 A;  2NVU I;  2FCS A;  3L16 A;  3V6E B;  2GBN A;  1WX9 A;  1WGH A;  4LDT D;  3CST A;  4BBN C;  4EZK A;  4A3P A;  4NQK E;  4DDG D;  4WJP A;  3TMP B;  3WAP A;  3VDZ A;  4GDL A;  2N9X A;  4JGH B;  3KYD D;  4EZJ A;  3DVG Y;  1S3S G;  3H6N A;  3APC A;  1BT0 A;  1Q1O A;  2O6V D;  2AL6 A;  2KTR B;  3NZU A;  2UYZ B;  4JQW C;  5G2N A;  1EF5 A;  4KIK A;  1Q5W B;  2MLB A;  3GZN I;  4EEW A;  4XC2 A;  3VUW A;  3DDC B;  4II3 B;  2MWS B;  4W9I A;  4EOY A;  2N1W A;  1OQY A;  2L8J A;  2D07 B;  3RUL A;  2D11 A;  4ANW A;  3NHE B;  2JUO A;  3A9K B;  2L0T A;  2D2Q A;  4JLC A;  1TBE A;  2K39 A;  3SD5 A;  4WAA A;  2AL3 A;  2NPT B;  2WWZ A;  3N30 A;  3TJP A;  2JPH A;  1AAR A;  3RT3 B;  2CU1 A;  3QA8 A;  4PYU A;  4K1R B;  3VTV A;  2EMS A;  3LJ3 A;  2NCN A;  1WGG A;  2BKR B;  3JSV A;  1QZE A;  1ZKH A;  2BGF A;  2WX1 A;  3RZF A;  2M8S A;  3H7P B;  2MBB B;  3KUD B;  4LDT B;  4DHZ B;  2LZ6 A;  1J0G A;  4NNJ B;  2KO3 A;  4PS7 A;  3ZTC A;  2AYO B;  1WR6 E;  2K8B A;  2XK5 B;  2YLM A;  3PRZ A;  2K6D B;  4X57 B;  2ZPN A;  3PLV A;  4ASW C;  2ZCB A;  2A5U A;  2FCQ A;  3A1Q B;  1GNU A;  4XX5 A;  1H4R A;  2O6V B;  2G4D B;  2WYQ A;  3AU4 A;  2D3G A;  3ZRC A;  1WGD A;  3ZW3 A;  4MEM A;  4NAW A;  2J0M A;  1E7V A;  2KD0 A;  1UBQ A;  3R3M A;  2ZEQ A;  2ZCC A;  1TGZ B;  2BWF A;  1V2Y A;  1WIA A;  1P0R A;  3A4R A;  3T9L A;  2MP2 A;  4WQO B;  2BF8 B;  1VD2 A;  4GSW A;  5AZF A;  2KDE B;  1V49 A;  3NZS A;  1YX5 B;  3VAW A;  3DBR I;  2KHW B;  3EEC A;  2BWE S;  3ZNZ B;  4MSM B;  2JF5 A;  3UGB B;  3PZD A;  2IY0 B;  2BKF A;  2M17 A;  4HPM B;  4K81 A;  3ZDT A;  2ZZP B;  3V6C B;  2RPQ A;  3HIZ A;  4IUM B;  4WWO A;  3ZDM C;  3AXC A;  4GDL B;  2KDF B;  1WJ4 A;  2LVQ A;  2LVO A;  3V61 A;  3OLM D;  1I42 A;  2FCM A;  2MQJ A;  4GN1 A;  2GBK A;  3RCZ A;  4DHZ E;  4LJP B;  2D10 A;  2FNJ B;  4KIK B;  4LJO B;  1J19 A;  1WX8 A;  1R4N I;  1EO6 A;  2M0X A;  4M8M A;  2PPH A;  2LRU A;  1IPG A;  3KUC B;  1WFY A;  2G4S A;  2KC2 A;  5DCN A;  1Q0W B;  4A3O A;  3EHV A;  4KSK C;  3H7P A;  1WE6 A;  3WAM A;  4B6W A;  3ECI A;  3SU8 X;  2FUH B;  3QAQ A;  5E6P A;  2KXJ A;  4HJK A;  2L00 B;  4NQL B;  2LGY A;  2R2O A;  5L83 A;  2K25 A;  4TKN A;  1PQS A;  2HJ8 A;  1LM8 B;  1WJ6 A;  4B95 A;  4FAD A;  5IA7 A;  2CHX A;  3JSV B;  3CF6 E;  2CR5 A;  1CMX B;  3SDL C;  2W9N A;  1WRD B;  3L54 A;  1R4M I;  2JRH A;  4BKS A;  2FAZ A;  3QK0 A;  2L3Z A;  2A4Z A;  2BYF A;  4WJQ A;  2KX0 A;  1V9J A;  3B08 A;  5DPT A;  4B9K A;  1NBF C;  1X1M A;  4IM0 A;  3PV1 A;  4DXA B;  2Z0E B;  2C7N B;  4W9L A;  1M94 A;  4M8N A;  3ZLZ A;  1A5R A;  3PRP B;  1ZGU B;  1WF9 A;  3PGE A;  2ZNV B;  3W1Y A;  1U4A A;  2KWU B;  3X0W A;  2K1F A;  2N9P C;  4W9K A;  1V5O A;  4K7U A;  3TIX A;  2M1M A;  2HD5 B;  2CHW A;  4NAW B;  1SE9 A;  4AJW A;  4HPL B;  1Z2M A;  3M62 B;  4PS3 A;  3APD A;  3I3T B;  4GDK A;  3S2A A;  3HM6 X;  4I6N B;  2LGX A;  4MGY E;  2QHO A;  3SHQ A;  3OJ3 A;  2MP2 B;  3ZNH B;  1S1Q B;  1WR1 A;  3N32 A;  4HK2 A;  4K7S A;  2ZVO A;  5CTR C;  4A20 A;  5J2R A;  4ZYN A;  2CS4 A;  3K9O B;  5C23 A;  2AWT A;  3KVF B;  3VFK A;  1GG3 A;  3VHT C;  1UEL A;  1WJN A;  3AU5 A;  2LI5 A;  5FR6 A;  4BKS D;  1UGM A;  4WWP A;  1YQB A;  2DZJ A;  3P2B A;  4IW0 A;  2KVR A;  4FHJ A;  4ANX A;  1IP9 A;  1E8Y A;  2MRP A;  3QQ8 B;  4KV2 A;  3QX1 A;  1LXD A;  2DZK A;  4IWO A;  4HDQ A;  4W9C A;  3IHP C;  2GMI C;  4F7Z A;  2J0K A;  4IM2 A;  2NBU A;  3QJZ A;  2R2Q A;  2JWZ A;  3ENE A;  4AWJ A;  4PYZ A;  1NI2 A;  2DEN B;  4HWI B;  2NS5 A;  3O65 B;  2B3A A;  2PEA A;  1V5T A;  3CMM B;  2IO2 B;  3AUL A;  3H7S A;  4DWF A;  4BOZ B;  2FIF A;  4CO7 A;  4MGK E;  5JHA A;  2C9W B;  2REX A;  4M0W B;  1WXV A;  2XBB C;  4HLE A;  1GUA B;  4J6I A;  5DPW A;  3Q3F A;  3TCA A;  2KDB A;  3EFU A;  2PJH A;  2N1V A;  1LQB A;  4KDI C;  4G0N B;  1XD3 B;  3MJW A;  4JIO U;  2HTH A;  2KX3 A;  2JY6 A;  4F8C B;  5CHF A;  1WH3 A;  3UQA A;  2MCN B;  1SGH A;  3B1L X;  1YX6 B;  3PLU A;  4MJS A;  1OGW A;  1KOT A;  2ZJD A;  2XEW A;  3QCA A;  2V1Y A;  2MBO A;  3JVZ X;  3U8Z A;  3H1U A;  3VXW A;  4BFR A;  4EFO A;  1MG8 A;  1WMH A;  2LWP A;  1E8Z A;  3BY4 B;  1TZ1 A;  3L08 A;  2DYB A;  1YD8 U;  2GBR A;  2KWV B;  4GOC A;  2KWC A;  2GBM A;  3IG3 A;  3LDZ E;  4KZC A;  3DBH I;  5DPS A;  5HKH A;  4ZRK A;  2JZZ A;  5E6N A;  3R7R A;  4GDK B;  4HVB A;  1UBI A;  2L05 A;  4LCD E;  3QWZ B;  1KLV A;  5E6O A;  3BIN A;  3VH4 B;  4DK5 A;  3UIN B;  1RLF A;  4BKG A;  1WY8 A;  2KLG A;  3GOE A;  2L0F A;  2V4L A;  2ASQ A;  2IY1 B;  1V86 A;  1OEY A;  3EC8 A;  2UWQ A;  1WXM A;  3QAR A;  5LLI A;  4TQ0 A;  1ZW7 A;  2MBH A;  3UIP B;  4ZRJ A;  3HHM A;  3DOW A;  4DDI D;  1WZ0 A;  4MM3 A;  2M4N A;  2I1J A;  2LXC A;  3KW5 B;  4NY0 A;  3A9J A;  1OEY J;  4FBJ B;  2VRR B;  3PPA A;  3PRM B;  3C0R B;  1KM7 A;  3M3J A;  5JH5 C;  2LRW A;  3PT2 B;  2IBI B;  3B0A A;  2C7H A;  1WXA A;  3KH0 A;  4AOF A;  2KNB A;  2BYE A;  2PE9 A;  4GXB A;  3A4S C;  3QHT A;  3IBE A;  5D7G A;  3OAW A;  5DPR A;  4DHJ D;  4FUL A;  1UZX B;  1YJ1 A;  2IO0 B;  2KFJ A;  3WIM A;  2KLC A;  1V80 A;  4ZRI A;  2LAS A;  3DCG A;  3DVN U;  4HDO A;  5D94 A;  3M95 A;  4TQ1 A;  3DQV A;  4FLH A;  1F9J A;  2AEH A;  4IC7 B;  2O2V A;  4IG7 B;  3ML8 A;  3L17 A;  2RSU A;  3CSF A;  1RFA A;  2K6Q A;  2LXA A;  3W1S C;  3VUX A;  1P98 A;  3NS8 A;  2K8H A;  4G11 A;  4AUQ C;  2PE6 B;  3PTF C;  3DBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...