4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
1P98A 3VTUA 2MSED 2QHOA 2LZ6A 1XQQA 1WM3A 1F9JA 2G4SA 1G6JA 3APCA 5DCNA 4OVVA 3ZRCA 1R4NI 4EFOA 4BKSA 2AL3A 1K8RB 4LDTB 3K9OB 1XT9B 1RLFA 2FIDA 4W9DA 1OQYA 2JPHA 2KO3A 1WX9A 3PGEA 5LXHA 2L76A 4BKTA 4MELA 4HDOA 4K7SA 1NI2A 1V6EA 3NHEB 2J7QB 1P0RA 2JZZA 2R2QA 2LRUA 1ZGUB 4NY0A 3RYTA 1GNUA 4GIVA 4ZDVA 2JT4B 1LQBA 3VAWA 3DPDA 3CF6E 5L95C 3W1SA 3JW0X 4AJYB 1IPGA 1T0YA 3KUZA 4IW0A 2JF5A 3JYUA 2J0KA 3WANA 3ZKJC 5AZFA 2L0TA 4ZYNA 1OEYA 3S2AA 3MTNB 3N32A 2KMAA 1LXDA 2MBEA 4GGQA 3SU8X 3CMMB 2EMSA 4WQOB 3U8ZA 5TR5A 4HVBA 1EF1A 2KXJA 2LVPA 3M63B 4NQLB 2ZPNA 4GDLB 3V62A 4ANUA 4K7UA 1YX6B 1D3ZA 2IY1B 4DHZE 1V9JA 4WJQA 2N9EB 3VHTC 2IBIB 3M95A 3ZNHB 4XX5A 3PV1A 2GMIC 2LJ5A 4E71A 4HLEA 4GU2A 2G45B 2L0FA 3HK0A 4DK5A 1HE8A 1OGWA 2G4DB 1SE9A 4G50A 3VTWA 1ZW7A 4FHKA 3RT3B 2RSUA 3O65B 4IWQA 3VVWB 3W1YA 5IA7A 3JSVB 3TIXA 4FULA 5DPRA 1WXSA 4GMVA 3DDCB 4FJVB 5JHAA 1V86A 1WR1A 4ANWA 4MJSB 2M4NA 3OLMD 3WAMA 4WJNA 1L7YA 4MGZE 1GG3A 2LGDA 5DPSA 2DZMA 2CHXA 3JSVA 3OJ3A 4KZCA 1V2YA 1V5OA 2NVUI 3ZLZA 5DPWA 2LGYA 2MBHA 2V1YA 3TJPA 3CSFA 1OTRB 3RZWC 4XZ4A 2LXCA 3EFUA 2N7EA 1V81A 4EZJA 3DQVA 2BF8B 3PHWB 1UBIA 3ZTCA 3QQ8B 2NPTA 2CKHB 4G0NB 2KJRA 4DXAB 3IBEA 1KOTA 3NS8A 4J6IA 4HPLB 2KLGA 4JGHB 4TUUA 1RFAA 4MEMA 3DBSA 3ZVVA 2IY0B 2ZJDA 4BBNF 3PHXB 2O6VA 3A4RA 4GSWA 2NPTB 5D7GA 3R3MA 3IG3A 2RGFA 1Z2MA 2BWFA 2PEAA 2M1MA 2LI5A 2RPQA 3HHMA 2KWVB 1C3TA 4WAAA 3H7PB 3RCZA 4WWNA 4FADA 2N7DA 2YLMA 2WDTB 3ENEA 2FCNA 4ANVA 4JLCA 2K39A 3ZNZB 2LWPA 3JVZX 3PZDA 2AL6A 3A33B 2KZRA 4G3XB 1A5RA 3QK0A 4FN2A 3DBRI 3LJ3A 3UQAA 4HCPB 2L00B 3R7RA 2PPHA 3ZIMA 2K6DB 2CR5A 2KX0A 3UINB 2K8HA 3EC8A 3PSEB 5CHWA 1YD8U 2HE7A 4CHKA 2ZCBA 1ZKHA 1GUAB 1Y8RC 2HTHA 1FXTB 3B08A 2JRIB 1EO6A 3NZSA 4WWOA 2MBQA 3PVLA 5D6JB 1NBFC 2RD0A 4ZRKA 3ZDTA 4MJSA 4BOSC 2DHZA 1Q1OA 2ZNVB 3PRMB 4GOCA 3ZO5B 2LUEA 4PS7A 4I6PA 3OJ4B 3KW5B 3QJZA 1AARA 3P2BA 4MGKE 4EZKA 4MSQB 4KDIC 3UIOB 3X23A 3V61A 4WWPA 2DYBA 1UBQA 1WX8A 3VQIA 4DHJB 4NPNA 2KDBA 4W9EA 4FHJA 1V5TA 3PLVA 5DPTA 3TCAA 1YQBA 2BKFA 2ZZPB 3KUDB 3ML9A 3U7DA 4CYEA 4IUMB 4X57B 2ASQA 2MP2B 1I42A 4KVGB 4K1RB 1KM7A 4ICVA 5KHOA 5KHQA 2AEHA 4GDLA 3PREA 2BKRB 4WJOA 2L8JA 3AXCA 2L05A 1UD7A 1IP9A 2AWTA 2DAJA 3L13A 3QWZB 1E7UA 3QAQA 4KZ0A 4DDGD 1TGZB 3ECIA 4M0WB 3Q3JA 3PT2B 1IYFA 2R2OA 2BPSA 1J0GA 4DHZB 3V6CB 3HM3A 4E3CA 1YJ1A 1CMXB 1EUVB 5JZEB 4B9KA 2JXXA 4II3B 3ML8A 3DVGX 5E6OA 2M8SA 1S3SG 5E6NA 1WMHA 3B0AA 2M17A 2N4FA 2IZVB 4MM3A 2K1FA 2IO3B 2FAZA 2DYMA 2C7NB 4EOYA 3NZUA 4HCNB 3LDZE 4TV3A 2ZVNA 4B6WA 3T8MA 1WMHB 2XK5B 2LASA 3ZTDA 4IM0A 3A9JB 1RRBA 4KIKA 2VRRB 2Y5BB 4I6NB 3WIMA 1XD3B 3NY5A 4NNJB 3A9KB 2JRHA 4K81A 4NJ6A 3WALA 3IHPC 5D94A 2DZKA 3VH4B 3L0WB 4G11A 3A1QA 2GBRA 4HXDA 4HWIB 4NAWB 2ZVOA 2MLBA 2KJ6A 2REXA 4A20A 3ZW3A 3T9LA 5CHVC 3VUYA 4LJOB 2XK5A 1UGMA 1WYWB 2C5LC 4EEWA 1J8CA 4KIKB 1WE7A 1YIWA 2WX1A 2Z59B 1YX5B 2MA9B 5EDSA 3APFA 4EKUA 1P9DU 1WXMA 4A3OA 2DYOA 4NQKE 2JZ3B 5JHBA 2D2QA 3WAPA 2N9PC 2K8BA 2JUOA 4ZRJA 2CHWA 4IWOA 4LCDE 2CU1A 3ZNGC 3M3JA 2PJHA 2DAFA 2FCSA 1WGHA 4DDID 2OOBB 1WF9A 2KHWB 3MHSD 4YL8A 2BGFA 2Z0DB 3N3KB 2ZPYA 2IO0B 1TTNA 1WJUA 2D11A 2KANA 3A1QB 4W9GA 1LFDA 1VCBA 1P3QU 4OVUA 3IFWB 2FCMA 4TQ1A 3QIJA 3RUIB 1WY8A 3UGBB 1Q0WB 4AOFA 1E90A 2WYQA 2LVQA 5AZGA 3D32A 4MDKE 3PS6A 3UF8A 4PYUA 1MG8A 2D10A 3AULA 1WE6A 4MSMB 3PRPB 2KC2A 2KC1A 2LGXA 5LLIA 2HD5B 2K6QA 3A4SC 2KOXA 1UZXB 1SIFA 1WXAA 3DVNV 2D07B 2NBUA 1E8WA 2MP2A 2NCNA 3RD2A 4EUTA 5CHFA 3TL5A 4KV2A 4KSLC 2KD0A 1WJ6A 1WM2A 3DVNU 4I6LB 4LDTD 2RR9A 4KSKC 3R66C 4W9LA 1E8YA 1WH3A 1V80A 2M0XA 3KVFB 3QCAA 3SDLC 3HM6X 4EZLA 4BOZB 2PE6B 2I1JA 3N30A 3PPAA 4GB9A 2AYOB 5FR6A 1WFYA 2O2VB 1WX7A 3DCGA 5G55A 2GBJA 2L3ZA 1OEYJ 3UQBA 1S1QB 1M94A 2C60A 5LXIB 2I1KA 3L10B 1GJZA 4PS8A 3SD5A 2LD9A 3PTFC 4W9JA 2NBWB 3QC8B 2CHZA 3PRZA 1E5WA 2C9WB 4JQWC 5L83A 4B95A 2NS5A 3H7PA 4BFRA 1I35A 1WR6E 4BKSD 3AU5A 4BBNC 2C7HA 2K25A 3A9JA 4RMAA 4W9FA 3ZDMC 2EKEC 4AP4C 2KX3A 2MX2A 4IWPA 1UELA 3QHTA 4W9CA 1L2NA 4GDKA 2IO2B 2ZNVC 2KJHB 2D3GA 2A4ZA 1GC7A 2UYZB 4II2B 3SHQA 4FA6A 3ZUNA 4N9F4 3DOWA 4BVUC 4IC7B 1WZ0A 4W9HA 3PLUA 4W9IA 2N9XA 3L17A 2DZJA 2WX0A 3H6NA 2GBNA 2BYFA 2GOWA 2MBBB 3B1LX 4A3PA 2DENB 4HK2A 5IAAC 4F7ZA 2KNBA 3H9DA 1U4AA 3QA8A 5D2MB 5J2RA 3V6EB 2GBMA 1WGDA 4FJZA 4MH0E 4TKNA 4FJYA 3GOEA 1WGRA 4XC2A 5J18A 4GN1A 4ZRIA 3I3TB 2O6VD 4KDLB 2W9NA 4DBGA 2C7MB 4F8CB 1GC6A 2KK8A 3IVFA 4HPMB 5AEKB 2UWQA 4AJWA 1TBEA 2YVCA 2MQJA 2JVCA 2MBOA 2XBBC 3M62B 5E6PA 3Q3FA 3KUCB 2JY6A 2K8CA 3GZNI 5CX3A 3ZRFA 2KVRA 4RM8A 4BKGA 3VDZA 3KYCD 2EMTA 4W9KA 5HKHA 3ALBA 1X1MA 2KWUB 4HDQA 4PS3A 2LXAA 1JRUA 4IM3A 5C23A 2PE9A 3H1UA 2MWSB 1QZEA 2MRPA 3VXWA 4URKA 1KLVA 3VTVA 3L16A 1WJNA 1VD2A 3WA0A 1PQSA 4NJ7A 1WZ3A 1C1YB 2N1WA 2XEWA 3EHVA 2FIFA 3K9PB 3KH0A 4M8NA 4NAWA 5G2NA 2KN5A 3DBHI 3QX1A 1V49A 4HJKA 3RULA 2CS4A 4CO7A 4E74A 3X0WA 4JIOU 3VFKA 3NOBA 2KWCA 2FUHB 3U30A 2L7RA 2KLCA 3R7QA 3EECA 3V60A 1UH6A 2KDEB 4GDKB 4K7WA 1TZ1A 4WJPA 2A5UA 3TBLD 2KTFA 2OJRA 2KFKB 3VUWA 3APDA 2KQSA 2LRWA 5BO4B 5AZHA 2ZEQA 3CSTA 4M8MA 4LJPB 3C0RB 1WGGA 3HIZA 1E8ZA 2BYVE 2DZIA 2ZCCA 3ZNID 2NR2A 2MCNB 2Z0EB 2KQ7A 1H8CA 3L54A 3AI5A 2JWZA 2BWES 5J17A 1E8XA 3BINA 1WGYA 1Q5WB 2O6VB 3VH3B 2V3SA 2V4LA 4F1SA 3BY4B 3H7SA 1BT0A 2KFKA 4ICUA 5CTRC 1KJTA 1WIAA 3ONSA 2KDFB 3WAOA 5GMVA 1R4MI 4ANXA 4DHJD 4AWJA 2O2VA 3UIPB 2DX5B 4FBJB 3W1SC 2KKCA 2LVOA 4FLHA 2HJ8A 3DVGY 2KTRB 1EF5A 2J0MA 1ISNA 1WRDB 2KFJA 3KYDD 4JL9A 4MGIE 3A9KA 3OAWA 2N1VA 1SGHA 4TQ0A 2FCQA 4ASWC 1LM8B 3DBLI 4MGYE 5C1ZA 1E7VA 4GXBA 2IO1B 2WWZA 2NBVB 3AU4A 4PYZA 2G3QB 4IG7B 3QARA 1WI0A 2KTRA 4P7IA 3TMPB 1WXVA 1H4RA 2BYEA 4DWFA 1P1AA 3MJWA 2FNJB 2IYDB 1RAXA 1WJ4A 2KMCA 1J19A 1Z5SB 2GBKA 2KDIA 3L08A 3RZFA 4RM9A 5JH5C 1NDDA 3VUXA 4AUQC 2B3AA 2J0JA 2MW5A 4IM2A
chains in the Genus database with same CATH superfamily
3BVMA 3C19A 3Q8AA 2JZPA 1JRPA 4JX1C 4LTUA 4IKGA 2AL3A 4TMAB 3KWVA 3LXFA 2V3PA 3GB1A 2QJLA 1RLFA 2FIDA 4W9DA 5G5HA 2ACZB 3PGEA 1L4DB 4MELA 1NI2A 1V6EA 1YOVB 3NHEB 5D3IB 4KKJA 2LRUA 1D5MC 1ZGUB 5BMGA 1E9MA 3IXSA 1R4NB 1N63A 2PVGC 5L95C 1FD6A 4AJYB 1T0YA 3JYUA 3WANA 4IOIE 3S2AA 3RNAC 3MTNB 3AMZA 1WRIA 4XWTA 3SU8X 4L1BA 3CMMB 2EMSA 4US8A 1BMLC 1D5ZC 3IT6B 3U8ZA 2LVPA 1NENB 1JWSD 3V62A 4RF0A 3EGRA 2LJ5A 1C4PA 3GE8C 4DK5A 1HE8A 1OGWA 1SE9A 4R3DA 2BBCA 2L1AA 5TSSA 4GMVA 3DDCB 4FJVB 3MFGA 2JYTA 2M4NA 4N58A 4OZAA 3WAMA 1FMAD 1SE4A 4XDCA 5DPSA 3EA6A 3JSVA 3OJ3A 2SEBD 2WP9B 1C9FA 2V1YA 3BK2A 3CSFA 4YSYB 3ZTCA 2NPTA 2CKHB 3ZQ4A 1I4XA 4HPLB 4TUUA 2LHEA 3W9CB 2IY0B 4JE3B 4BBNF 1SE3A 4GSWA 3R3MA 3IG3A 2PEAA 1C3TA 4WWNA 2Y5CA 1QT9A 2WDTB 1N5WA 3DBRI 4HCPB 4OVZA 2KX0A 2WXLA 3PSEB 5CHWA 2G9HD 1XLOA 4A8XC 2ZCBA 4CHKA 1Y8RC 4DHJD 1FXTB 5D6JB 1KF6B 2MBQA 4EE2A 3PRMB 3EFCA 3ZO5B 4PS7A 4I6PA 1F1HA 3KW5B 4MGKE 1SIJA 4WWPA 1WX8A 1HXYD 4NPNA 4W9EA 4FHJA 3PLVA 2BKFA 1TKEA 4IUMB 4X57B 2ASQA 2LEKA 5EE9A 4KVGB 2LGIA 3Q8FA 1LGRA 1MFWA 3V05A 2BKRB 1UD7A 2DAJA 5HG2A 3QWZB 3SEBA 1E7UA 4KZ0A 3AV8A 3NVVA 1MI0A 1CZPA 1J0GA 3V6CB 3HM3A 3FILB 1CMXB 1EUVB 4II3B 2M8SA 5E6NA 1WMHA 2K1FA 2WXPA 2FAZA 2DBYA 5H92C 3DHHC 2R61A 3Q6BA 4C7YA 2BS3B 3ZTDA 3A9JB 1RWSA 4I6NB 3WIMA 3A9KB 2JRHA 3WALA 1FM0D 2DZKA 3VH4B 3L0WB 4G11A 4NAWB 1QF6A 2JYEA 2REXA 4EEWA 2QSDA 1J8CA 1YIWA 1TJEA 1YX5B 2MA9B 5EDSA 3B2FA 1N6ZA 1J7AA 2DYOA 4NQKE 2D2QA 1OFFA 2CHWA 4C4VA 2B76B 3M3JA 2FCSA 1WF9A 3MHSD 3KQ4A 4HROA 3N3KB 2ZPYA 3E56A 1WJUA 1N61A 1T0QC 1E7PB 3BYYB 2FCMA 3QIJA 1C77A 1V1PB 1WY8A 3UGBB 1E90A 2LVQA 3GE3C 1WWTA 3I9V1 4MSMB 2K0PA 1VR9A 3AE2B 1M4VA 2KOXA 2PKOA 1WXAA 2ONQA 2WXGA 1MHHE 1UF0A 2RR9A 3DBHB 1WH3A 2VH2A 3SDLC 2WXJA 4ZRQA 4GB9A 2GLSA 1WFYA 1WX7A 1ZXHA 3VR8B 1OEYJ 5LXIB 1GJZA 1IUEA 3AECB 4PS8A 3PTFC 2Y5PA 5H8YE 3PRZA 1E5WA 2C9WB 5L83A 1TY0A 4YXDB 1ZOYB 2CJOA 2C7HA 1JW9D 4YSXB 3HVZA 2EKEC 2MX2A 1UELA 3QHTA 3GZNB 1GB1A 2A4ZA 4FA6A 3ZUNA 4N9F4 1R7SA 4OZCA 3TSSA 4BVUC 4IC7B 1WZ0A 1TKGA 2WX0A 2GBNA 3AE1B 4RGTA 4A3PA 2DENB 2KN4A 2BT6A 1U4AA 3QA8A 2HDEA 3OG5A 2VZKB 2ZW1A 3AE4B 3AEFB 4NJCA 4YTMB 5IOIA 4XC2A 3I3TB 4RH6A 2K9XA 2W9NA 4F8CB 3AB5A 5AEKB 3IVFA 1TBEA 2MQJA 3M62B 4A6QA 3TEYA 3Q3FA 4BZAA 4RM8A 4BKGA 3VDZA 4W9KA 1X1MA 1WYGA 2YEPF 4HDQA 4AS1A 1ZP0B 1PQSA 3H8HA 2XEWA 2FIFA 5G2NA 3QX1A 3RULA 1V49A 4CO7A 1I4GA 3KLSX 2KWCA 2FUHB 2RPVA 2GRIA 3U30A 2KLCA 1UH6A 4ZHOA 4ACFA 3R8BA 2W55A 1PGAA 2KFKB 4WURA 5BO4B 2ZEQA 3CSTA 4M8MA 1WGGA 1E8ZA 3ZNID 3AEBB 1ZDXA 1YJIA 2JWZA 1XCTL 3BINA 2WS3B 3H7SA 5CTRC 1KJTA 5GMVA 3N1XC 2INPE 3UIPB 2WHIA 5HI1A 3DVGY 2HTME 2CJNA 2J0MA 4JL9A 1WRDB 4MGIE 3NS1A 3A9KA 3OAWA 3W5UB 4ASWC 3DBLI 5FR3A 5C1ZA 1E7VA 1T0SC 1FRRA 2KACA 3AU4A 5EE3A 2KTRA 1FCCC 2WXHA 1KRHA 2IYDB 1D4BA 2E3TA 1WJ4A 1FXIA 2KDIA 3B2GA 3CIRB 2K5PA 1NDDA 3VUXA 2WXRA 2B3AA 1P98A 1QQRA 3L4PA 2MSED 1AN8A 1XQQA 2LZ6A 1F9JA 1V8CA 1NI3A 1G6JA 5DCNA 3ZRCA 1R4NI 4EFOA 4LDTB 4WAFA 3K9OB 1T6BX 3DHGC 5LXHA 2L76A 4HDOA 4K7SA 2J7QB 3NVZA 1I4RA 4NY0A 4KX6B 3AE9B 3VAWA 4ITKA 1JWAD 3KUZA 4PT5A 3SR6A 2J0KA 4ZYNA 5BMIA 1CK1A 3N32A 1LXDA 1TIFA 5TR5A 3PZ8A 3M63B 1NYRA 3ZGZA 1YX6B 2X38A 3AE8B 2GMIC 4E71A 4HLEA 2Z8LA 4GU2A 1UWXA 3P4RB 1XXGA 3HUIA 3RT3B 3O65B 2BB6A 1TS3A 5IA7A 3TIXA 1V86A 4ANWA 1MJDA 3NVWA 1TYGB 4WJNA 1VJKA 4MGZE 1SXTA 5BMHA 4KZCA 1ACCA 1KLUD 1V5OA 2NVUI 2I38A 3TJPA 4HKQA 3RZWC 1UBIA 3LB8C 3NUHB 4DXAB 3IBEA 1KOTA 3DBSA 2WXKA 3ZVVA 3W2DA 3Q8CA 3T3OA 3PHXB 2BVCA 1YN5A 2IGDA 5AUKA 1Z2MA 4P6VF 2M1MA 3HHMA 4WAAA 1C78A 1T0RC 2YLMA 4JLCA 2K39A 4K3CA 3I63C 2LWPA 3JVZX 2BS2B 4FN2A 4A55A 3UQAA 1SE2A 3J9CA 1FNVA 3UINB 2K8HA 2HE7A 1TT5B 1V1PA 1ZKHA 2HTHA 3PVLA 3Q3NC 3ZDTA 2RD0A 1KTKA 4YTNB 2DHZA 4GOCA 2E6XA 3QJZA 1E10A 4MSQB 3VQIA 2KDBA 2IDYA 5DPTA 2ZZPB 3ML9A 3U7DA 4CYEA 1VZ8A 3ETRA 5KHQA 1C4CA 1EWYC 3PREA 3Q14C 2L8JA 2L05A 2D3BA 2W54A 2AWTA 1L6VA 2AQ1B 3L13A 2N9LA 3QAQA 2BPSA 1SBBB 1TS2A 2TSSA 3N9YC 4N59A 3ML8A 3DVGX 5E6OA 1BUIC 1S3SG 4CQNA 1N5XA 1RYJA 1F0ZA 4LLGM 1JROA 2UU7A 4TV3A 2G1EA 4B6WA 1WSPA 1XD3B 2IGHA 4K81A 2NTTA 1T5XD 5D94A 3A1QA 2GBRA 4HWIB 3T3NA 2ZVOA 2MLBA 4A20A 1ESFA 3T9LA 3NVYA 3VUYA 4LJOB 2XK5A 1UGMA 2C5LC 4KIKB 2Z59B 4EKUA 4A3OA 2JZ3B 2N9PC 2K8BA 2JUOA 1AYFA 1P7FA 4LK0M 1OQRA 2CU1A 3SFEB 4L23A 2DAFA 1WGHA 2OOBB 2WQYB 2BGFA 4NZLB 5D3DA 3RNEC 3TEXA 1OQQA 2D11A 3ZXRA 4W9GA 1VCBA 3IFWB 1N62A 4TQ1A 5IO9A 2J52A 3RUIB 2QEJC 1Q0WB 2WYQA 4LNIA 5AZGA 4WWMA 2IJ0A 2D10A 3AULA 3RNGC 4KGRA 2KC2A 2FUG1 2IPKD 1UZXB 1D6EC 1MVKA 2D07B 4EUTA 2NCNA 4ZRPA 5CHFA 3IAS1 2WXFA 1WJ6A 4WQMA 1WM2A 3P63A 4C80A 3IT4B 3P42A 4KSKC 3R66C 4W9LA 1JQ4A 1ZDVA 2M0XA 3KVFB 2H88B 4BOZB 5IN7A 3DBLB 5FR6A 5G55A 2L3ZA 1F52A 1L0XB 2XNAC 3L10B 2CHZA 2ICIA 4B95A 5C2TB 2PTLA 2KT7A 3NRZA 4NAMA 2WXOA 1KLGD 3BVGA 2D3GA 3SHQA 1F2RI 1TS5A 4ARIA 4W9HA 2N9XA 1PDXA 2DZJA 2GOWA 2PW9A 1YN4A 3HRDD 2MJ3A 3H9DA 1IGCA 1I7HA 4TKNA 3AEEB 4FJYA 2KDMA 1I4HA 2KQ4X 2N0SB 4DBGA 1GC6A 2UWQA 4AJWA 2JVCA 2MBOA 2XBBC 1C79A 2HJ1A 3AE5B 5CX3A 3ZRFA 2RDHA 2MJDA 3ALBA 4PS3A 1DOXA 1EM7A 1JRUA 4YWGG 2PE9A 2MWSB 4URKA 3W5VB 3L16A 1WJNA 1VD2A 4NJ7A 4B0EA 1XCQL 2N1WA 4NAWA 1K51A 3DBHI 5BYRA 3GP7A 2J53A 3X0WA 2QIEB 3DBRB 2WU5B 3BIID 4K7WA 3NZ3A 2KTFA 2EKIA 3VUWA 2KQSA 2LRWA 2ON8A 2DLBA 1YJJA 4MT5A 3HIZA 2DZIA 2NR2A 2MCNB 5HFYA 1K53A 1QOAA 2BWES 2RMMA 1WGYA 2I2YA 2O6VB 3VH3B 1JWMD 3BY4B 1BT0A 4DQOC 2KDFB 3UI3A 2M56B 4IDIA 2O2VA 4FBJB 2AQ3B 1J7BA 2KVZA 4KGSA 1R4MB 4MACA 1QILA 3I57A 2N1VA 4GLSC 2FCQA 1PGXA 4YT0B 4C56C 2K22A 2IO1B 2KWDA 4PYZA 4IG7B 1WI0A 1L5PA 4MM3B 4M0WA 1EU3A 2BYEA 4DWFA 2WLBA 4L2YA 3IAM1 1HA5A 5JH5C 5IKCM 4O1NA 3N1ZC 3Q3OC 4BKSD 3ZJTA 2G4SA 1WM3A 1HEZE 4OVVA 1ZE3D 4BKSA 1XT9B 1OQYA 2JPHA 2KO3A 1WX9A 5MPOA 4BKTA 1D5XC 4PK1A 2R2QA 2MEKA 3RYTA 3DPDA 3W1SA 3JW0X 4IW0A 2JF5A 5AZFA 2L0TA 1OEYA 1KFYB 5GXGB 2YEPB 2KMAA 1C4AA 1Q10A 1HZ6A 4WQOB 4HVBA 2KXJA 4NQLB 2ZPNA 3FKYA 4K7UA 1D3ZA 5FK9C 2IY1B 4DHZE 4WJQA 3ZNHB 3PV1A 2QILA 2G45B 2L0FA 3HK0A 4G50A 4FHKA 3W1YA 3JSVB 4FULA 1WXSA 2RDGA 5JHAA 4Q2JA 1L7YA 1GG3A 3BWUD 2JQRB 3BZDB 1TY2A 1E0ZA 3AE6B 5DPWA 3ZLZA 4OZBA 1ROEA 1L4ZB 1OTRB 1K50A 4XZ4A 3EFUA 1GAQB 3RNFC 4EZJA 2BF8B 3PHWB 3NS8A 2KLGA 4JGHB 1RFAA 4K3BA 2PIAA 3A4RA 5D7GA 2NPTB 2RGFA 2RPQA 2BWFA 2LI5A 2KWVB 3H7PB 3RCZA 4FADA 2N7DA 2FCNA 4ANVA 1FNWA 1JCKB 1SSNA 3PZDA 2LHDA 3CWIA 2AL6A 3A33B 2KZRA 4G3XB 1A5RA 3QK0A 3TUOA 3LJ3A 4XWWA 1CQVA 1V97A 2PPHA 3ZIMA 2K6DB 2CR5A 3U4EG 3PZ7A 1EO6A 3TEZA 2BS4B 5JXVA 4RNAA 1MHXA 5EE0A 2ZNVB 2DWQA 1ZUD2 2LUEA 3OJ4B 3BK1A 4KDIC 3V61A 1ZXIA 2DYBA 1UBQA 4DHJB 5BYSA 1FFUA 1V5TA 3TCAA 1VZ6A 2WXIA 2LMCA 1I42A 2N9KA 4K1RB 1AWDA 5KHOA 4GDLA 4WJOA 3AXCA 3P1MA 1IP9A 1TGZB 3Q3JA 3PT2B 1IYFA 2R2OA 2Y3AA 4DHZB 3BVZA 4RFBA 1XEEA 4TSSA 3B0AA 4YTPB 2M17A 2N4FA 2IZVB 4MM3A 2IO3B 4N6EB 2DYMA 1UNSA 2BTEA 3NZUA 4HCNB 3LDZE 1L0YB 3T8MA 1WMHB 2LASA 3AH7A 4IM0A 2Y5BB 2L52A 4NNJB 5AUIA 3AE3B 1I4QA 1UGJA 3IHPC 1A70A 2M19A 1SF0A 4RF1A 2KJ6A 4LNKA 1HTOA 1QKZA 1WYWB 2WXQA 4D2KA 2KYWA 3APFA 1P9DU 1WXMA 5JHBA 1YQ4B 3WAPA 4ZRJA 2MHJA 4IWOA 1PGBA 3ZNGC 4DDID 3V3XA 2KHWB 4YL8A 2FBWB 1ET9A 4JWSC 3A1QB 2MH7A 1P3QU 2D5GA 3MHZA 4C4VB 1ENFA 1Y56A 4AOFA 4ZOHC 4JWUC 1LO5D 3D32A 3PS6A 3N1YC 2PVOD 4PYUA 1WE6A 5LNK1 1FCLA 2KC1A 5LLIA 3A4SC 2K6QA 1JWUD 3DVNV 1SIFA 1SEBD 2W3RA 2NBUA 2MP2A 3TL5A 4KV2A 4KSLC 2KD0A 2KMMA 4WH4A 3RI7C 3ABVB 2DNFA 4I6LB 1B9RA 1HZ5A 3E9SA 1E8YA 4A9AA 3HM6X 2PE6B 3PPAA 2IGGA 2O2VB 1RM6C 3DWMA 1S1QB 2JX5A 2I1KA 3U52E 4DXFA 2NBWB 3QC8B 4JQWC 2NS5A 1WR6E 4S17A 3AU5A 2K25A 4RMAA 2OJWA 3URYA 1MG4A 3SFDB 3ZDMC 3VR9B 1UWMA 4IWPA 1DGJA 2NMQA 4W9CA 1L2NA 1I4PA 4GDKA 2IO2B 1GC7A 2UYZB 4II2B 3NG0A 3DOWA 4C00A 3L17A 1VLBA 1TS4A 2QDFA 3ZJUA 3HVDA 5IAAC 3EUB2 3RFZB 5D2MB 4ARCA 1STEA 1WGDA 1NYQA 1JALA 1WGRA 4GN1A 4ZRIA 2O6VD 4KDLB 2C7MB 2NTSA 2KK8A 4HPMB 1XF5L 3AEGB 3N20C 2CU3A 3FC4A 3KUCB 2K8CA 2QC8A 2KVRA 3RMKC 3KYCD 5HKHA 2LXAA 5C23A 1FO4A 1QZEA 3VTVA 1WZ3A 3TEWA 3K9PB 4M8NA 2KN5A 2CS4A 4LNOA 2WGSA 3VFKA 3NOBA 5FKAC 2LFIA 2L7RA 3R7QA 3EECA 4GDKB 2WXNA 4QAYA 3MC8A 4AQ7A 2H89B 4RGOS 5AZHA 2FE8A 3BYTB 2KQ7A 1F2RC 2V4IB 1Q5WB 2V0GA 4LNFA 4ICUA 2KFKA 1WIAA 3ONSA 3WAOA 1R4MI 4ANXA 5C3JB 4USAA 2INNE 4AWJA 4M00A 2DX5B 4FLHA 2KKCA 2WDVB 2KTRB 2KFJA 2LJIA 3KYDD 1YQ3B 4FXCA 4TQ0A 3U2SC 4MGYE 4GXBA 2MJEA 2WWZA 2NBVB 1TKYA 3QARA 3AEAB 1SJED 1IBXB 2GB1A 1P1AA 2L32A 2FNJB 3MJWA 2WXMA 1RAXA 4REZA 2KMCA 4B0MA 3MP9A 2GBKA 3L08A 3RZFA 3C8YA 4RGNA 1T3QA 1YMHE 2D3AA 2J0JA 2J42A 4IM2A 3U7ZA 3VTUA 2QHOA 4P1BC 3Q2AC 3Q69A 3APCA 1PUTA 1FFVA 1K8RB 1GPXA 2EELA 1ZPSA 2WDRB 1P0RA 1TZOA 2JZZA 2V9HA 1GNUA 4GIVA 1NEKB 2GI9A 4ZDVA 2JT4B 1LQBA 3CF6E 3P4SB 1IPGA 2QCZA 3ZKJC 4P16A 1FRDA 2MBEA 4GGQA 4XE0A 3MC0B 2JWUA 2JXTA 1EF1A 4GDLB 4ANUA 3B9JA 1V9JA 2N9EB 3VHTC 2IBIB 3M95A 2ZW0A 4XX5A 1XLNA 2G4DB 3VTWA 1ZW7A 4KKIA 2WNMA 2RSUA 1SJHD 3RNBC 4IWQA 3VVWB 3MC9A 1VRAB 5DPRA 1QOGA 1WR1A 2INCC 3Q8BA 4MJSB 3OLMD 3AN1A 3ZXVA 2OEDA 2WU2B 2LGDA 2OHFA 2DZMA 2CHXA 1EWCA 1V2YA 3P4QB 2LUMA 1MPEA 2LGYA 2MBHA 4H2AA 2LXCA 2N7EA 1V81A 5IP4D 3DQVA 2AX5A 3QQ8B 4G0NB 2KJRA 4J6IA 4MEMA 4JPSA 1JMLA 2ZJDA 1VDVA 2O6VA 2J4XA 2W82A 1L6UA 1VZ7A 3ENEA 5E6JA 2X8XX 3ZNZB 2PLPA 2JSVX 2INDC 2L00B 3R7RA 3EC8A 1YD8U 4KGTA 1GUAB 4WWOA 3B08A 1QOBA 2JRIB 3NZSA 1NBFC 1V1OA 4ZRKA 4BOSC 4MJSA 1Q1OA 5T8IA 4HJGE 1XLPA 3FILA 1JWBD 1AARA 3P2BA 2JU6X 4EZKA 5I4DA 3UIOB 3X23A 1RFKA 5G5GA 1KH0A 2BB5A 3R2IA 1YQBA 1HTQA 3KUDB 2MP2B 2XN9C 4A90A 1KM7A 4ICVA 1NVID 2AEHA 3RPFC 4BAXA 1WGKA 4DDGD 3ECIA 4M0WB 1YNTE 3R2TA 1PFDA 4E3CA 3O13A 1YJ1A 5JZEB 4B9KA 2JXXA 2L83A 4XYCA 3ZYYX 1C76A 1BXTA 2C7NB 4EOYA 1E6EB 1YN3A 4XGAB 1GB4A 2ZVNA 2XK5B 1DOYA 1RRBA 4KIKA 2VRRB 3NY5A 4HEA1 4NJ6A 1FEHA 3VRBB 4HXDA 4OW0A 3ZW3A 5CHVC 3GS2A 1WE7A 2WX1A 2M0AA 4M02A 1L0VB 1PYWD 4HRSA 1SB3C 3Q8EA 4LCDE 2RDBC 2PJHA 1FNUA 1FPYA 3DHIC 2Z0DB 2V3NA 4WIPA 2IO0B 1TTNA 2KANA 2WDQB 1LFDA 4ZHPA 4OVUA 2D3CA 1IGDA 4S0RA 1N60A 4MDKE 3UF8A 1CJEA 1MG8A 4HKZE 3OWEB 3PRPB 2LGXA 2HD5B 5EE1A 4RGMA 4P1CC 1E8WA 3RD2A 1K52A 4LDTD 1V80A 1AW7A 3QCAA 4EZLA 2I1JA 3N30A 4HPPA 2BW2A 2AYOB 3DCGA 2GBJA 3UQBA 1M94A 1P7EA 2C60A 3P4PB 4M01A 3SD5A 2LD9A 4W9JA 3DWGC 3I5JC 1EU4A 2W3SA 1B1ZA 2QMTA 3H7PA 4BFRA 1I35A 2AQ2B 4BBNC 3A9JA 1XLQA 4W9FA 3LYYA 3MJ5A 4AP4C 2KX3A 3NJTA 3RN9C 3ZJVA 2ZNVC 2KJHB 4C7ZA 4OHJA 4LNNA 1QLBB 4J3OD 1IBXA 4W9IA 3PLUA 3H6NA 2BYFA 2MBBB 2Q5WD 3B1LX 1XO3A 4HK2A 4F7ZA 2KNBA 4ZYSA 1GOZA 3FAHA 3VRAB 5J2RA 2BQQA 2GBMA 2PMVA 4MH0E 4FJZA 3V6EB 4DXGA 3GOEA 5J18A 3KWLA 3AM9A 2YVCA 3Q3MC 5E6PA 1DOIA 1F77A 2JY6A 3AEDB 3GZNI 2K3UA 2EMTA 2KWUB 1UUPA 3PO0A 4IM3A 3H1UA 3VXWA 2MRPA 1KLVA 3WA0A 1C1YB 2BYTA 3EHVA 3KH0A 4E74A 4HJKA 4UDUC 4MH8A 4JIOU 4YSZB 5HHDG 3V60A 2LGSA 2KDEB 1TZ1A 4WJPA 2A5UA 3TBLD 2OJRA 3APDA 4RCOA 4LJPB 3C0RB 2BYVE 3AE7B 2ZCCA 2Z0EB 1H8CA 3L54A 3AI5A 5J17A 1E8XA 2V3SA 2V4LA 4F1SA 1QOFA 1FXAA 3RNCC 3WCQA 3W1SC 2LVOA 2KAJA 2HJ8A 1EF5A 1ISNA 5BYQA 1SGHA 1LM8B 2VZKD 1J7CA 2SAKA 2VH1A 1ET6A 4US9A 2G3QB 1WXQA 4P7IA 1FIQA 3TMPB 4XDDA 2N7JA 1WXVA 1H4RA 1DYQA 1J19A 1Z5SB 4RM9A 1HQRD 4AUQC 3DVNU 2MW5A
chains in the Genus database with same CATH topology
1P98A 3VTUA 2MSED 2QHOA 2LZ6A 1XQQA 1WM3A 1F9JA 2G4SA 1G6JA 3APCA 5DCNA 4OVVA 3ZRCA 1R4NI 4EFOA 4BKSA 2AL3A 1K8RB 4LDTB 3K9OB 1XT9B 1RLFA 2FIDA 4W9DA 1OQYA 2JPHA 2KO3A 1WX9A 3PGEA 5LXHA 2L76A 4BKTA 4MELA 4HDOA 4K7SA 1NI2A 1V6EA 3NHEB 2J7QB 1P0RA 2JZZA 2R2QA 2LRUA 1ZGUB 4NY0A 3RYTA 1GNUA 4GIVA 4ZDVA 2JT4B 1LQBA 3VAWA 3DPDA 3CF6E 5L95C 3W1SA 3JW0X 4AJYB 1IPGA 1T0YA 3KUZA 4IW0A 2JF5A 3JYUA 2J0KA 3WANA 3ZKJC 5AZFA 2L0TA 4ZYNA 1OEYA 3S2AA 3MTNB 3N32A 2KMAA 1LXDA 2MBEA 4GGQA 3SU8X 3CMMB 2EMSA 4WQOB 3U8ZA 5TR5A 4HVBA 1EF1A 2KXJA 2LVPA 3M63B 4NQLB 2ZPNA 4GDLB 3V62A 4ANUA 4K7UA 1YX6B 1D3ZA 2IY1B 4DHZE 1V9JA 4WJQA 2N9EB 3VHTC 2IBIB 3M95A 3ZNHB 4XX5A 3PV1A 2GMIC 2LJ5A 4E71A 4HLEA 4GU2A 2G45B 2L0FA 3HK0A 4DK5A 1HE8A 1OGWA 2G4DB 1SE9A 4G50A 3VTWA 1ZW7A 4FHKA 3RT3B 2RSUA 3O65B 4IWQA 3VVWB 3W1YA 5IA7A 3JSVB 3TIXA 4FULA 5DPRA 1WXSA 4GMVA 3DDCB 4FJVB 5JHAA 1V86A 1WR1A 4ANWA 4MJSB 2M4NA 3OLMD 3WAMA 4WJNA 1L7YA 4MGZE 1GG3A 2LGDA 5DPSA 2DZMA 2CHXA 3JSVA 3OJ3A 4KZCA 1V2YA 1V5OA 2NVUI 3ZLZA 5DPWA 2LGYA 2MBHA 2V1YA 3TJPA 3CSFA 1OTRB 3RZWC 4XZ4A 2LXCA 3EFUA 2N7EA 1V81A 4EZJA 3DQVA 2BF8B 3PHWB 1UBIA 3ZTCA 3QQ8B 2NPTA 2CKHB 4G0NB 2KJRA 4DXAB 3IBEA 1KOTA 3NS8A 4J6IA 4HPLB 2KLGA 4JGHB 4TUUA 1RFAA 4MEMA 3DBSA 3ZVVA 2IY0B 2ZJDA 4BBNF 3PHXB 2O6VA 3A4RA 4GSWA 2NPTB 5D7GA 3R3MA 3IG3A 2RGFA 1Z2MA 2BWFA 2PEAA 2M1MA 2LI5A 2RPQA 3HHMA 2KWVB 1C3TA 4WAAA 3H7PB 3RCZA 4WWNA 4FADA 2N7DA 2YLMA 2WDTB 3ENEA 2FCNA 4ANVA 4JLCA 2K39A 3ZNZB 2LWPA 3JVZX 3PZDA 2AL6A 3A33B 2KZRA 4G3XB 1A5RA 3QK0A 4FN2A 3DBRI 3LJ3A 3UQAA 4HCPB 2L00B 3R7RA 2PPHA 3ZIMA 2K6DB 2CR5A 2KX0A 3UINB 2K8HA 3EC8A 3PSEB 5CHWA 1YD8U 2HE7A 4CHKA 2ZCBA 1ZKHA 1GUAB 1Y8RC 2HTHA 1FXTB 3B08A 2JRIB 1EO6A 3NZSA 4WWOA 2MBQA 3PVLA 5D6JB 1NBFC 2RD0A 4ZRKA 3ZDTA 4MJSA 4BOSC 2DHZA 1Q1OA 2ZNVB 3PRMB 4GOCA 3ZO5B 2LUEA 4PS7A 4I6PA 3OJ4B 3KW5B 3QJZA 1AARA 3P2BA 4MGKE 4EZKA 4MSQB 4KDIC 3UIOB 3X23A 3V61A 4WWPA 2DYBA 1UBQA 1WX8A 3VQIA 4DHJB 4NPNA 2KDBA 4W9EA 4FHJA 1V5TA 3PLVA 5DPTA 3TCAA 1YQBA 2BKFA 2ZZPB 3KUDB 3ML9A 3U7DA 4CYEA 4IUMB 4X57B 2ASQA 2MP2B 1I42A 4KVGB 4K1RB 1KM7A 4ICVA 5KHOA 5KHQA 2AEHA 4GDLA 3PREA 2BKRB 4WJOA 2L8JA 3AXCA 2L05A 1UD7A 1IP9A 2AWTA 2DAJA 3L13A 3QWZB 1E7UA 3QAQA 4KZ0A 4DDGD 1TGZB 3ECIA 4M0WB 3Q3JA 3PT2B 1IYFA 2R2OA 2BPSA 1J0GA 4DHZB 3V6CB 3HM3A 4E3CA 1YJ1A 1CMXB 1EUVB 5JZEB 4B9KA 2JXXA 4II3B 3ML8A 3DVGX 5E6OA 2M8SA 1S3SG 5E6NA 1WMHA 3B0AA 2M17A 2N4FA 2IZVB 4MM3A 2K1FA 2IO3B 2FAZA 2DYMA 2C7NB 4EOYA 3NZUA 4HCNB 3LDZE 4TV3A 2ZVNA 4B6WA 3T8MA 1WMHB 2XK5B 2LASA 3ZTDA 4IM0A 3A9JB 1RRBA 4KIKA 2VRRB 2Y5BB 4I6NB 3WIMA 1XD3B 3NY5A 4NNJB 3A9KB 2JRHA 4K81A 4NJ6A 3WALA 3IHPC 5D94A 2DZKA 3VH4B 3L0WB 4G11A 3A1QA 2GBRA 4HXDA 4HWIB 4NAWB 2ZVOA 2MLBA 2KJ6A 2REXA 4A20A 3ZW3A 3T9LA 5CHVC 3VUYA 4LJOB 2XK5A 1UGMA 1WYWB 2C5LC 4EEWA 1J8CA 4KIKB 1WE7A 1YIWA 2WX1A 2Z59B 1YX5B 2MA9B 5EDSA 3APFA 4EKUA 1P9DU 1WXMA 4A3OA 2DYOA 4NQKE 2JZ3B 5JHBA 2D2QA 3WAPA 2N9PC 2K8BA 2JUOA 4ZRJA 2CHWA 4IWOA 4LCDE 2CU1A 3ZNGC 3M3JA 2PJHA 2DAFA 2FCSA 1WGHA 4DDID 2OOBB 1WF9A 2KHWB 3MHSD 4YL8A 2BGFA 2Z0DB 3N3KB 2ZPYA 2IO0B 1TTNA 1WJUA 2D11A 2KANA 3A1QB 4W9GA 1LFDA 1VCBA 1P3QU 4OVUA 3IFWB 2FCMA 4TQ1A 3QIJA 3RUIB 1WY8A 3UGBB 1Q0WB 4AOFA 1E90A 2WYQA 2LVQA 5AZGA 3D32A 4MDKE 3PS6A 3UF8A 4PYUA 1MG8A 2D10A 3AULA 1WE6A 4MSMB 3PRPB 2KC2A 2KC1A 2LGXA 5LLIA 2HD5B 2K6QA 3A4SC 2KOXA 1UZXB 1SIFA 1WXAA 3DVNV 2D07B 2NBUA 1E8WA 2MP2A 2NCNA 3RD2A 4EUTA 5CHFA 3TL5A 4KV2A 4KSLC 2KD0A 1WJ6A 1WM2A 3DVNU 4I6LB 4LDTD 2RR9A 4KSKC 3R66C 4W9LA 1E8YA 1WH3A 1V80A 2M0XA 3KVFB 3QCAA 3SDLC 3HM6X 4EZLA 4BOZB 2PE6B 2I1JA 3N30A 3PPAA 4GB9A 2AYOB 5FR6A 1WFYA 2O2VB 1WX7A 3DCGA 5G55A 2GBJA 2L3ZA 1OEYJ 3UQBA 1S1QB 1M94A 2C60A 5LXIB 2I1KA 3L10B 1GJZA 4PS8A 3SD5A 2LD9A 3PTFC 4W9JA 2NBWB 3QC8B 2CHZA 3PRZA 1E5WA 2C9WB 4JQWC 5L83A 4B95A 2NS5A 3H7PA 4BFRA 1I35A 1WR6E 4BKSD 3AU5A 4BBNC 2C7HA 2K25A 3A9JA 4RMAA 4W9FA 3ZDMC 2EKEC 4AP4C 2KX3A 2MX2A 4IWPA 1UELA 3QHTA 4W9CA 1L2NA 4GDKA 2IO2B 2ZNVC 2KJHB 2D3GA 2A4ZA 1GC7A 2UYZB 4II2B 3SHQA 4FA6A 3ZUNA 4N9F4 3DOWA 4BVUC 4IC7B 1WZ0A 4W9HA 3PLUA 4W9IA 2N9XA 3L17A 2DZJA 2WX0A 3H6NA 2GBNA 2BYFA 2GOWA 2MBBB 3B1LX 4A3PA 2DENB 4HK2A 5IAAC 4F7ZA 2KNBA 3H9DA 1U4AA 3QA8A 5D2MB 5J2RA 3V6EB 2GBMA 1WGDA 4FJZA 4MH0E 4TKNA 4FJYA 3GOEA 1WGRA 4XC2A 5J18A 4GN1A 4ZRIA 3I3TB 2O6VD 4KDLB 2W9NA 4DBGA 2C7MB 4F8CB 1GC6A 2KK8A 3IVFA 4HPMB 5AEKB 2UWQA 4AJWA 1TBEA 2YVCA 2MQJA 2JVCA 2MBOA 2XBBC 3M62B 5E6PA 3Q3FA 3KUCB 2JY6A 2K8CA 3GZNI 5CX3A 3ZRFA 2KVRA 4RM8A 4BKGA 3VDZA 3KYCD 2EMTA 4W9KA 5HKHA 3ALBA 1X1MA 2KWUB 4HDQA 4PS3A 2LXAA 1JRUA 4IM3A 5C23A 2PE9A 3H1UA 2MWSB 1QZEA 2MRPA 3VXWA 4URKA 1KLVA 3VTVA 3L16A 1WJNA 1VD2A 3WA0A 1PQSA 4NJ7A 1WZ3A 1C1YB 2N1WA 2XEWA 3EHVA 2FIFA 3K9PB 3KH0A 4M8NA 4NAWA 5G2NA 2KN5A 3DBHI 3QX1A 1V49A 4HJKA 3RULA 2CS4A 4CO7A 4E74A 3X0WA 4JIOU 3VFKA 3NOBA 2KWCA 2FUHB 3U30A 2L7RA 2KLCA 3R7QA 3EECA 3V60A 1UH6A 2KDEB 4GDKB 4K7WA 1TZ1A 4WJPA 2A5UA 3TBLD 2KTFA 2OJRA 2KFKB 3VUWA 3APDA 2KQSA 2LRWA 5BO4B 5AZHA 2ZEQA 3CSTA 4M8MA 4LJPB 3C0RB 1WGGA 3HIZA 1E8ZA 2BYVE 2DZIA 2ZCCA 3ZNID 2NR2A 2MCNB 2Z0EB 2KQ7A 1H8CA 3L54A 3AI5A 2JWZA 2BWES 5J17A 1E8XA 3BINA 1WGYA 1Q5WB 2O6VB 3VH3B 2V3SA 2V4LA 4F1SA 3BY4B 3H7SA 1BT0A 2KFKA 4ICUA 5CTRC 1KJTA 1WIAA 3ONSA 2KDFB 3WAOA 5GMVA 1R4MI 4ANXA 4DHJD 4AWJA 2O2VA 3UIPB 2DX5B 4FBJB 3W1SC 2KKCA 2LVOA 4FLHA 2HJ8A 3DVGY 2KTRB 1EF5A 2J0MA 1ISNA 1WRDB 2KFJA 3KYDD 4JL9A 4MGIE 3A9KA 3OAWA 2N1VA 1SGHA 4TQ0A 2FCQA 4ASWC 1LM8B 3DBLI 4MGYE 5C1ZA 1E7VA 4GXBA 2IO1B 2WWZA 2NBVB 3AU4A 4PYZA 2G3QB 4IG7B 3QARA 1WI0A 2KTRA 4P7IA 3TMPB 1WXVA 1H4RA 2BYEA 4DWFA 1P1AA 3MJWA 2FNJB 2IYDB 1RAXA 1WJ4A 2KMCA 1J19A 1Z5SB 2GBKA 2KDIA 3L08A 3RZFA 4RM9A 5JH5C 1NDDA 3VUXA 4AUQC 2B3AA 2J0JA 2MW5A 4IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P98 A;  3VTU A;  2MSE D;  2QHO A;  2LZ6 A;  1XQQ A;  1WM3 A;  1F9J A;  2G4S A;  1G6J A;  3APC A;  5DCN A;  4OVV A;  3ZRC A;  1R4N I;  4EFO A;  4BKS A;  2AL3 A;  1K8R B;  4LDT B;  3K9O B;  1XT9 B;  1RLF A;  2FID A;  4W9D A;  1OQY A;  2JPH A;  2KO3 A;  1WX9 A;  3PGE A;  5LXH A;  2L76 A;  4BKT A;  4MEL A;  4HDO A;  4K7S A;  1NI2 A;  1V6E A;  3NHE B;  2J7Q B;  1P0R A;  2JZZ A;  2R2Q A;  2LRU A;  1ZGU B;  4NY0 A;  3RYT A;  1GNU A;  4GIV A;  4ZDV A;  2JT4 B;  1LQB A;  3VAW A;  3DPD A;  3CF6 E;  5L95 C;  3W1S A;  3JW0 X;  4AJY B;  1IPG A;  1T0Y A;  3KUZ A;  4IW0 A;  2JF5 A;  3JYU A;  2J0K A;  3WAN A;  3ZKJ C;  5AZF A;  2L0T A;  4ZYN A;  1OEY A;  3S2A A;  3MTN B;  3N32 A;  2KMA A;  1LXD A;  2MBE A;  4GGQ A;  3SU8 X;  3CMM B;  2EMS A;  4WQO B;  3U8Z A;  5TR5 A;  4HVB A;  1EF1 A;  2KXJ A;  2LVP A;  3M63 B;  4NQL B;  2ZPN A;  4GDL B;  3V62 A;  4ANU A;  4K7U A;  1YX6 B;  1D3Z A;  2IY1 B;  4DHZ E;  1V9J A;  4WJQ A;  2N9E B;  3VHT C;  2IBI B;  3M95 A;  3ZNH B;  4XX5 A;  3PV1 A;  2GMI C;  2LJ5 A;  4E71 A;  4HLE A;  4GU2 A;  2G45 B;  2L0F A;  3HK0 A;  4DK5 A;  1HE8 A;  1OGW A;  2G4D B;  1SE9 A;  4G50 A;  3VTW A;  1ZW7 A;  4FHK A;  3RT3 B;  2RSU A;  3O65 B;  4IWQ A;  3VVW B;  3W1Y A;  5IA7 A;  3JSV B;  3TIX A;  4FUL A;  5DPR A;  1WXS A;  4GMV A;  3DDC B;  4FJV B;  5JHA A;  1V86 A;  1WR1 A;  4ANW A;  4MJS B;  2M4N A;  3OLM D;  3WAM A;  4WJN A;  1L7Y A;  4MGZ E;  1GG3 A;  2LGD A;  5DPS A;  2DZM A;  2CHX A;  3JSV A;  3OJ3 A;  4KZC A;  1V2Y A;  1V5O A;  2NVU I;  3ZLZ A;  5DPW A;  2LGY A;  2MBH A;  2V1Y A;  3TJP A;  3CSF A;  1OTR B;  3RZW C;  4XZ4 A;  2LXC A;  3EFU A;  2N7E A;  1V81 A;  4EZJ A;  3DQV A;  2BF8 B;  3PHW B;  1UBI A;  3ZTC A;  3QQ8 B;  2NPT A;  2CKH B;  4G0N B;  2KJR A;  4DXA B;  3IBE A;  1KOT A;  3NS8 A;  4J6I A;  4HPL B;  2KLG A;  4JGH B;  4TUU A;  1RFA A;  4MEM A;  3DBS A;  3ZVV A;  2IY0 B;  2ZJD A;  4BBN F;  3PHX B;  2O6V A;  3A4R A;  4GSW A;  2NPT B;  5D7G A;  3R3M A;  3IG3 A;  2RGF A;  1Z2M A;  2BWF A;  2PEA A;  2M1M A;  2LI5 A;  2RPQ A;  3HHM A;  2KWV B;  1C3T A;  4WAA A;  3H7P B;  3RCZ A;  4WWN A;  4FAD A;  2N7D A;  2YLM A;  2WDT B;  3ENE A;  2FCN A;  4ANV A;  4JLC A;  2K39 A;  3ZNZ B;  2LWP A;  3JVZ X;  3PZD A;  2AL6 A;  3A33 B;  2KZR A;  4G3X B;  1A5R A;  3QK0 A;  4FN2 A;  3DBR I;  3LJ3 A;  3UQA A;  4HCP B;  2L00 B;  3R7R A;  2PPH A;  3ZIM A;  2K6D B;  2CR5 A;  2KX0 A;  3UIN B;  2K8H A;  3EC8 A;  3PSE B;  5CHW A;  1YD8 U;  2HE7 A;  4CHK A;  2ZCB A;  1ZKH A;  1GUA B;  1Y8R C;  2HTH A;  1FXT B;  3B08 A;  2JRI B;  1EO6 A;  3NZS A;  4WWO A;  2MBQ A;  3PVL A;  5D6J B;  1NBF C;  2RD0 A;  4ZRK A;  3ZDT A;  4MJS A;  4BOS C;  2DHZ A;  1Q1O A;  2ZNV B;  3PRM B;  4GOC A;  3ZO5 B;  2LUE A;  4PS7 A;  4I6P A;  3OJ4 B;  3KW5 B;  3QJZ A;  1AAR A;  3P2B A;  4MGK E;  4EZK A;  4MSQ B;  4KDI C;  3UIO B;  3X23 A;  3V61 A;  4WWP A;  2DYB A;  1UBQ A;  1WX8 A;  3VQI A;  4DHJ B;  4NPN A;  2KDB A;  4W9E A;  4FHJ A;  1V5T A;  3PLV A;  5DPT A;  3TCA A;  1YQB A;  2BKF A;  2ZZP B;  3KUD B;  3ML9 A;  3U7D A;  4CYE A;  4IUM B;  4X57 B;  2ASQ A;  2MP2 B;  1I42 A;  4KVG B;  4K1R B;  1KM7 A;  4ICV A;  5KHO A;  5KHQ A;  2AEH A;  4GDL A;  3PRE A;  2BKR B;  4WJO A;  2L8J A;  3AXC A;  2L05 A;  1UD7 A;  1IP9 A;  2AWT A;  2DAJ A;  3L13 A;  3QWZ B;  1E7U A;  3QAQ A;  4KZ0 A;  4DDG D;  1TGZ B;  3ECI A;  4M0W B;  3Q3J A;  3PT2 B;  1IYF A;  2R2O A;  2BPS A;  1J0G A;  4DHZ B;  3V6C B;  3HM3 A;  4E3C A;  1YJ1 A;  1CMX B;  1EUV B;  5JZE B;  4B9K A;  2JXX A;  4II3 B;  3ML8 A;  3DVG X;  5E6O A;  2M8S A;  1S3S G;  5E6N A;  1WMH A;  3B0A A;  2M17 A;  2N4F A;  2IZV B;  4MM3 A;  2K1F A;  2IO3 B;  2FAZ A;  2DYM A;  2C7N B;  4EOY A;  3NZU A;  4HCN B;  3LDZ E;  4TV3 A;  2ZVN A;  4B6W A;  3T8M A;  1WMH B;  2XK5 B;  2LAS A;  3ZTD A;  4IM0 A;  3A9J B;  1RRB A;  4KIK A;  2VRR B;  2Y5B B;  4I6N B;  3WIM A;  1XD3 B;  3NY5 A;  4NNJ B;  3A9K B;  2JRH A;  4K81 A;  4NJ6 A;  3WAL A;  3IHP C;  5D94 A;  2DZK A;  3VH4 B;  3L0W B;  4G11 A;  3A1Q A;  2GBR A;  4HXD A;  4HWI B;  4NAW B;  2ZVO A;  2MLB A;  2KJ6 A;  2REX A;  4A20 A;  3ZW3 A;  3T9L A;  5CHV C;  3VUY A;  4LJO B;  2XK5 A;  1UGM A;  1WYW B;  2C5L C;  4EEW A;  1J8C A;  4KIK B;  1WE7 A;  1YIW A;  2WX1 A;  2Z59 B;  1YX5 B;  2MA9 B;  5EDS A;  3APF A;  4EKU A;  1P9D U;  1WXM A;  4A3O A;  2DYO A;  4NQK E;  2JZ3 B;  5JHB A;  2D2Q A;  3WAP A;  2N9P C;  2K8B A;  2JUO A;  4ZRJ A;  2CHW A;  4IWO A;  4LCD E;  2CU1 A;  3ZNG C;  3M3J A;  2PJH A;  2DAF A;  2FCS A;  1WGH A;  4DDI D;  2OOB B;  1WF9 A;  2KHW B;  3MHS D;  4YL8 A;  2BGF A;  2Z0D B;  3N3K B;  2ZPY A;  2IO0 B;  1TTN A;  1WJU A;  2D11 A;  2KAN A;  3A1Q B;  4W9G A;  1LFD A;  1VCB A;  1P3Q U;  4OVU A;  3IFW B;  2FCM A;  4TQ1 A;  3QIJ A;  3RUI B;  1WY8 A;  3UGB B;  1Q0W B;  4AOF A;  1E90 A;  2WYQ A;  2LVQ A;  5AZG A;  3D32 A;  4MDK E;  3PS6 A;  3UF8 A;  4PYU A;  1MG8 A;  2D10 A;  3AUL A;  1WE6 A;  4MSM B;  3PRP B;  2KC2 A;  2KC1 A;  2LGX A;  5LLI A;  2HD5 B;  2K6Q A;  3A4S C;  2KOX A;  1UZX B;  1SIF A;  1WXA A;  3DVN V;  2D07 B;  2NBU A;  1E8W A;  2MP2 A;  2NCN A;  3RD2 A;  4EUT A;  5CHF A;  3TL5 A;  4KV2 A;  4KSL C;  2KD0 A;  1WJ6 A;  1WM2 A;  3DVN U;  4I6L B;  4LDT D;  2RR9 A;  4KSK C;  3R66 C;  4W9L A;  1E8Y A;  1WH3 A;  1V80 A;  2M0X A;  3KVF B;  3QCA A;  3SDL C;  3HM6 X;  4EZL A;  4BOZ B;  2PE6 B;  2I1J A;  3N30 A;  3PPA A;  4GB9 A;  2AYO B;  5FR6 A;  1WFY A;  2O2V B;  1WX7 A;  3DCG A;  5G55 A;  2GBJ A;  2L3Z A;  1OEY J;  3UQB A;  1S1Q B;  1M94 A;  2C60 A;  5LXI B;  2I1K A;  3L10 B;  1GJZ A;  4PS8 A;  3SD5 A;  2LD9 A;  3PTF C;  4W9J A;  2NBW B;  3QC8 B;  2CHZ A;  3PRZ A;  1E5W A;  2C9W B;  4JQW C;  5L83 A;  4B95 A;  2NS5 A;  3H7P A;  4BFR A;  1I35 A;  1WR6 E;  4BKS D;  3AU5 A;  4BBN C;  2C7H A;  2K25 A;  3A9J A;  4RMA A;  4W9F A;  3ZDM C;  2EKE C;  4AP4 C;  2KX3 A;  2MX2 A;  4IWP A;  1UEL A;  3QHT A;  4W9C A;  1L2N A;  4GDK A;  2IO2 B;  2ZNV C;  2KJH B;  2D3G A;  2A4Z A;  1GC7 A;  2UYZ B;  4II2 B;  3SHQ A;  4FA6 A;  3ZUN A;  4N9F 4;  3DOW A;  4BVU C;  4IC7 B;  1WZ0 A;  4W9H A;  3PLU A;  4W9I A;  2N9X A;  3L17 A;  2DZJ A;  2WX0 A;  3H6N A;  2GBN A;  2BYF A;  2GOW A;  2MBB B;  3B1L X;  4A3P A;  2DEN B;  4HK2 A;  5IAA C;  4F7Z A;  2KNB A;  3H9D A;  1U4A A;  3QA8 A;  5D2M B;  5J2R A;  3V6E B;  2GBM A;  1WGD A;  4FJZ A;  4MH0 E;  4TKN A;  4FJY A;  3GOE A;  1WGR A;  4XC2 A;  5J18 A;  4GN1 A;  4ZRI A;  3I3T B;  2O6V D;  4KDL B;  2W9N A;  4DBG A;  2C7M B;  4F8C B;  1GC6 A;  2KK8 A;  3IVF A;  4HPM B;  5AEK B;  2UWQ A;  4AJW A;  1TBE A;  2YVC A;  2MQJ A;  2JVC A;  2MBO A;  2XBB C;  3M62 B;  5E6P A;  3Q3F A;  3KUC B;  2JY6 A;  2K8C A;  3GZN I;  5CX3 A;  3ZRF A;  2KVR A;  4RM8 A;  4BKG A;  3VDZ A;  3KYC D;  2EMT A;  4W9K A;  5HKH A;  3ALB A;  1X1M A;  2KWU B;  4HDQ A;  4PS3 A;  2LXA A;  1JRU A;  4IM3 A;  5C23 A;  2PE9 A;  3H1U A;  2MWS B;  1QZE A;  2MRP A;  3VXW A;  4URK A;  1KLV A;  3VTV A;  3L16 A;  1WJN A;  1VD2 A;  3WA0 A;  1PQS A;  4NJ7 A;  1WZ3 A;  1C1Y B;  2N1W A;  2XEW A;  3EHV A;  2FIF A;  3K9P B;  3KH0 A;  4M8N A;  4NAW A;  5G2N A;  2KN5 A;  3DBH I;  3QX1 A;  1V49 A;  4HJK A;  3RUL A;  2CS4 A;  4CO7 A;  4E74 A;  3X0W A;  4JIO U;  3VFK A;  3NOB A;  2KWC A;  2FUH B;  3U30 A;  2L7R A;  2KLC A;  3R7Q A;  3EEC A;  3V60 A;  1UH6 A;  2KDE B;  4GDK B;  4K7W A;  1TZ1 A;  4WJP A;  2A5U A;  3TBL D;  2KTF A;  2OJR A;  2KFK B;  3VUW A;  3APD A;  2KQS A;  2LRW A;  5BO4 B;  5AZH A;  2ZEQ A;  3CST A;  4M8M A;  4LJP B;  3C0R B;  1WGG A;  3HIZ A;  1E8Z A;  2BYV E;  2DZI A;  2ZCC A;  3ZNI D;  2NR2 A;  2MCN B;  2Z0E B;  2KQ7 A;  1H8C A;  3L54 A;  3AI5 A;  2JWZ A;  2BWE S;  5J17 A;  1E8X A;  3BIN A;  1WGY A;  1Q5W B;  2O6V B;  3VH3 B;  2V3S A;  2V4L A;  4F1S A;  3BY4 B;  3H7S A;  1BT0 A;  2KFK A;  4ICU A;  5CTR C;  1KJT A;  1WIA A;  3ONS A;  2KDF B;  3WAO A;  5GMV A;  1R4M I;  4ANX A;  4DHJ D;  4AWJ A;  2O2V A;  3UIP B;  2DX5 B;  4FBJ B;  3W1S C;  2KKC A;  2LVO A;  4FLH A;  2HJ8 A;  3DVG Y;  2KTR B;  1EF5 A;  2J0M A;  1ISN A;  1WRD B;  2KFJ A;  3KYD D;  4JL9 A;  4MGI E;  3A9K A;  3OAW A;  2N1V A;  1SGH A;  4TQ0 A;  2FCQ A;  4ASW C;  1LM8 B;  3DBL I;  4MGY E;  5C1Z A;  1E7V A;  4GXB A;  2IO1 B;  2WWZ A;  2NBV B;  3AU4 A;  4PYZ A;  2G3Q B;  4IG7 B;  3QAR A;  1WI0 A;  2KTR A;  4P7I A;  3TMP B;  1WXV A;  1H4R A;  2BYE A;  4DWF A;  1P1A A;  3MJW A;  2FNJ B;  2IYD B;  1RAX A;  1WJ4 A;  2KMC A;  1J19 A;  1Z5S B;  2GBK A;  2KDI A;  3L08 A;  3RZF A;  4RM9 A;  5JH5 C;  1NDD A;  3VUX A;  4AUQ C;  2B3A A;  2J0J A;  2MW5 A;  4IM2 A; 
#chains in the Genus database with same CATH topology
 3BVM A;  3C19 A;  3Q8A A;  2JZP A;  1JRP A;  4JX1 C;  4LTU A;  4IKG A;  2AL3 A;  4TMA B;  3KWV A;  3LXF A;  2V3P A;  3GB1 A;  2QJL A;  1RLF A;  2FID A;  4W9D A;  5G5H A;  2ACZ B;  3PGE A;  1L4D B;  4MEL A;  1NI2 A;  1V6E A;  1YOV B;  3NHE B;  5D3I B;  4KKJ A;  2LRU A;  1D5M C;  1ZGU B;  5BMG A;  1E9M A;  3IXS A;  1R4N B;  1N63 A;  2PVG C;  5L95 C;  1FD6 A;  4AJY B;  1T0Y A;  3JYU A;  3WAN A;  4IOI E;  3S2A A;  3RNA C;  3MTN B;  3AMZ A;  1WRI A;  4XWT A;  3SU8 X;  4L1B A;  3CMM B;  2EMS A;  4US8 A;  1BML C;  1D5Z C;  3IT6 B;  3U8Z A;  2LVP A;  1NEN B;  1JWS D;  3V62 A;  4RF0 A;  3EGR A;  2LJ5 A;  1C4P A;  3GE8 C;  4DK5 A;  1HE8 A;  1OGW A;  1SE9 A;  4R3D A;  2BBC A;  2L1A A;  5TSS A;  4GMV A;  3DDC B;  4FJV B;  3MFG A;  2JYT A;  2M4N A;  4N58 A;  4OZA A;  3WAM A;  1FMA D;  1SE4 A;  4XDC A;  5DPS A;  3EA6 A;  3JSV A;  3OJ3 A;  2SEB D;  2WP9 B;  1C9F A;  2V1Y A;  3BK2 A;  3CSF A;  4YSY B;  3ZTC A;  2NPT A;  2CKH B;  3ZQ4 A;  1I4X A;  4HPL B;  4TUU A;  2LHE A;  3W9C B;  2IY0 B;  4JE3 B;  4BBN F;  1SE3 A;  4GSW A;  3R3M A;  3IG3 A;  2PEA A;  1C3T A;  4WWN A;  2Y5C A;  1QT9 A;  2WDT B;  1N5W A;  3DBR I;  4HCP B;  4OVZ A;  2KX0 A;  2WXL A;  3PSE B;  5CHW A;  2G9H D;  1XLO A;  4A8X C;  2ZCB A;  4CHK A;  1Y8R C;  4DHJ D;  1FXT B;  5D6J B;  1KF6 B;  2MBQ A;  4EE2 A;  3PRM B;  3EFC A;  3ZO5 B;  4PS7 A;  4I6P A;  1F1H A;  3KW5 B;  4MGK E;  1SIJ A;  4WWP A;  1WX8 A;  1HXY D;  4NPN A;  4W9E A;  4FHJ A;  3PLV A;  2BKF A;  1TKE A;  4IUM B;  4X57 B;  2ASQ A;  2LEK A;  5EE9 A;  4KVG B;  2LGI A;  3Q8F A;  1LGR A;  1MFW A;  3V05 A;  2BKR B;  1UD7 A;  2DAJ A;  5HG2 A;  3QWZ B;  3SEB A;  1E7U A;  4KZ0 A;  3AV8 A;  3NVV A;  1MI0 A;  1CZP A;  1J0G A;  3V6C B;  3HM3 A;  3FIL B;  1CMX B;  1EUV B;  4II3 B;  2M8S A;  5E6N A;  1WMH A;  2K1F A;  2WXP A;  2FAZ A;  2DBY A;  5H92 C;  3DHH C;  2R61 A;  3Q6B A;  4C7Y A;  2BS3 B;  3ZTD A;  3A9J B;  1RWS A;  4I6N B;  3WIM A;  3A9K B;  2JRH A;  3WAL A;  1FM0 D;  2DZK A;  3VH4 B;  3L0W B;  4G11 A;  4NAW B;  1QF6 A;  2JYE A;  2REX A;  4EEW A;  2QSD A;  1J8C A;  1YIW A;  1TJE A;  1YX5 B;  2MA9 B;  5EDS A;  3B2F A;  1N6Z A;  1J7A A;  2DYO A;  4NQK E;  2D2Q A;  1OFF A;  2CHW A;  4C4V A;  2B76 B;  3M3J A;  2FCS A;  1WF9 A;  3MHS D;  3KQ4 A;  4HRO A;  3N3K B;  2ZPY A;  3E56 A;  1WJU A;  1N61 A;  1T0Q C;  1E7P B;  3BYY B;  2FCM A;  3QIJ A;  1C77 A;  1V1P B;  1WY8 A;  3UGB B;  1E90 A;  2LVQ A;  3GE3 C;  1WWT A;  3I9V 1;  4MSM B;  2K0P A;  1VR9 A;  3AE2 B;  1M4V A;  2KOX A;  2PKO A;  1WXA A;  2ONQ A;  2WXG A;  1MHH E;  1UF0 A;  2RR9 A;  3DBH B;  1WH3 A;  2VH2 A;  3SDL C;  2WXJ A;  4ZRQ A;  4GB9 A;  2GLS A;  1WFY A;  1WX7 A;  1ZXH A;  3VR8 B;  1OEY J;  5LXI B;  1GJZ A;  1IUE A;  3AEC B;  4PS8 A;  3PTF C;  2Y5P A;  5H8Y E;  3PRZ A;  1E5W A;  2C9W B;  5L83 A;  1TY0 A;  4YXD B;  1ZOY B;  2CJO A;  2C7H A;  1JW9 D;  4YSX B;  3HVZ A;  2EKE C;  2MX2 A;  1UEL A;  3QHT A;  3GZN B;  1GB1 A;  2A4Z A;  4FA6 A;  3ZUN A;  4N9F 4;  1R7S A;  4OZC A;  3TSS A;  4BVU C;  4IC7 B;  1WZ0 A;  1TKG A;  2WX0 A;  2GBN A;  3AE1 B;  4RGT A;  4A3P A;  2DEN B;  2KN4 A;  2BT6 A;  1U4A A;  3QA8 A;  2HDE A;  3OG5 A;  2VZK B;  2ZW1 A;  3AE4 B;  3AEF B;  4NJC A;  4YTM B;  5IOI A;  4XC2 A;  3I3T B;  4RH6 A;  2K9X A;  2W9N A;  4F8C B;  3AB5 A;  5AEK B;  3IVF A;  1TBE A;  2MQJ A;  3M62 B;  4A6Q A;  3TEY A;  3Q3F A;  4BZA A;  4RM8 A;  4BKG A;  3VDZ A;  4W9K A;  1X1M A;  1WYG A;  2YEP F;  4HDQ A;  4AS1 A;  1ZP0 B;  1PQS A;  3H8H A;  2XEW A;  2FIF A;  5G2N A;  3QX1 A;  3RUL A;  1V49 A;  4CO7 A;  1I4G A;  3KLS X;  2KWC A;  2FUH B;  2RPV A;  2GRI A;  3U30 A;  2KLC A;  1UH6 A;  4ZHO A;  4ACF A;  3R8B A;  2W55 A;  1PGA A;  2KFK B;  4WUR A;  5BO4 B;  2ZEQ A;  3CST A;  4M8M A;  1WGG A;  1E8Z A;  3ZNI D;  3AEB B;  1ZDX A;  1YJI A;  2JWZ A;  1XCT L;  3BIN A;  2WS3 B;  3H7S A;  5CTR C;  1KJT A;  5GMV A;  3N1X C;  2INP E;  3UIP B;  2WHI A;  5HI1 A;  3DVG Y;  2HTM E;  2CJN A;  2J0M A;  4JL9 A;  1WRD B;  4MGI E;  3NS1 A;  3A9K A;  3OAW A;  3W5U B;  4ASW C;  3DBL I;  5FR3 A;  5C1Z A;  1E7V A;  1T0S C;  1FRR A;  2KAC A;  3AU4 A;  5EE3 A;  2KTR A;  1FCC C;  2WXH A;  1KRH A;  2IYD B;  1D4B A;  2E3T A;  1WJ4 A;  1FXI A;  2KDI A;  3B2G A;  3CIR B;  2K5P A;  1NDD A;  3VUX A;  2WXR A;  2B3A A;  1P98 A;  1QQR A;  3L4P A;  2MSE D;  1AN8 A;  1XQQ A;  2LZ6 A;  1F9J A;  1V8C A;  1NI3 A;  1G6J A;  5DCN A;  3ZRC A;  1R4N I;  4EFO A;  4LDT B;  4WAF A;  3K9O B;  1T6B X;  3DHG C;  5LXH A;  2L76 A;  4HDO A;  4K7S A;  2J7Q B;  3NVZ A;  1I4R A;  4NY0 A;  4KX6 B;  3AE9 B;  3VAW A;  4ITK A;  1JWA D;  3KUZ A;  4PT5 A;  3SR6 A;  2J0K A;  4ZYN A;  5BMI A;  1CK1 A;  3N32 A;  1LXD A;  1TIF A;  5TR5 A;  3PZ8 A;  3M63 B;  1NYR A;  3ZGZ A;  1YX6 B;  2X38 A;  3AE8 B;  2GMI C;  4E71 A;  4HLE A;  2Z8L A;  4GU2 A;  1UWX A;  3P4R B;  1XXG A;  3HUI A;  3RT3 B;  3O65 B;  2BB6 A;  1TS3 A;  5IA7 A;  3TIX A;  1V86 A;  4ANW A;  1MJD A;  3NVW A;  1TYG B;  4WJN A;  1VJK A;  4MGZ E;  1SXT A;  5BMH A;  4KZC A;  1ACC A;  1KLU D;  1V5O A;  2NVU I;  2I38 A;  3TJP A;  4HKQ A;  3RZW C;  1UBI A;  3LB8 C;  3NUH B;  4DXA B;  3IBE A;  1KOT A;  3DBS A;  2WXK A;  3ZVV A;  3W2D A;  3Q8C A;  3T3O A;  3PHX B;  2BVC A;  1YN5 A;  2IGD A;  5AUK A;  1Z2M A;  4P6V F;  2M1M A;  3HHM A;  4WAA A;  1C78 A;  1T0R C;  2YLM A;  4JLC A;  2K39 A;  4K3C A;  3I63 C;  2LWP A;  3JVZ X;  2BS2 B;  4FN2 A;  4A55 A;  3UQA A;  1SE2 A;  3J9C A;  1FNV A;  3UIN B;  2K8H A;  2HE7 A;  1TT5 B;  1V1P A;  1ZKH A;  2HTH A;  3PVL A;  3Q3N C;  3ZDT A;  2RD0 A;  1KTK A;  4YTN B;  2DHZ A;  4GOC A;  2E6X A;  3QJZ A;  1E10 A;  4MSQ B;  3VQI A;  2KDB A;  2IDY A;  5DPT A;  2ZZP B;  3ML9 A;  3U7D A;  4CYE A;  1VZ8 A;  3ETR A;  5KHQ A;  1C4C A;  1EWY C;  3PRE A;  3Q14 C;  2L8J A;  2L05 A;  2D3B A;  2W54 A;  2AWT A;  1L6V A;  2AQ1 B;  3L13 A;  2N9L A;  3QAQ A;  2BPS A;  1SBB B;  1TS2 A;  2TSS A;  3N9Y C;  4N59 A;  3ML8 A;  3DVG X;  5E6O A;  1BUI C;  1S3S G;  4CQN A;  1N5X A;  1RYJ A;  1F0Z A;  4LLG M;  1JRO A;  2UU7 A;  4TV3 A;  2G1E A;  4B6W A;  1WSP A;  1XD3 B;  2IGH A;  4K81 A;  2NTT A;  1T5X D;  5D94 A;  3A1Q A;  2GBR A;  4HWI B;  3T3N A;  2ZVO A;  2MLB A;  4A20 A;  1ESF A;  3T9L A;  3NVY A;  3VUY A;  4LJO B;  2XK5 A;  1UGM A;  2C5L C;  4KIK B;  2Z59 B;  4EKU A;  4A3O A;  2JZ3 B;  2N9P C;  2K8B A;  2JUO A;  1AYF A;  1P7F A;  4LK0 M;  1OQR A;  2CU1 A;  3SFE B;  4L23 A;  2DAF A;  1WGH A;  2OOB B;  2WQY B;  2BGF A;  4NZL B;  5D3D A;  3RNE C;  3TEX A;  1OQQ A;  2D11 A;  3ZXR A;  4W9G A;  1VCB A;  3IFW B;  1N62 A;  4TQ1 A;  5IO9 A;  2J52 A;  3RUI B;  2QEJ C;  1Q0W B;  2WYQ A;  4LNI A;  5AZG A;  4WWM A;  2IJ0 A;  2D10 A;  3AUL A;  3RNG C;  4KGR A;  2KC2 A;  2FUG 1;  2IPK D;  1UZX B;  1D6E C;  1MVK A;  2D07 B;  4EUT A;  2NCN A;  4ZRP A;  5CHF A;  3IAS 1;  2WXF A;  1WJ6 A;  4WQM A;  1WM2 A;  3P63 A;  4C80 A;  3IT4 B;  3P42 A;  4KSK C;  3R66 C;  4W9L A;  1JQ4 A;  1ZDV A;  2M0X A;  3KVF B;  2H88 B;  4BOZ B;  5IN7 A;  3DBL B;  5FR6 A;  5G55 A;  2L3Z A;  1F52 A;  1L0X B;  2XNA C;  3L10 B;  2CHZ A;  2ICI A;  4B95 A;  5C2T B;  2PTL A;  2KT7 A;  3NRZ A;  4NAM A;  2WXO A;  1KLG D;  3BVG A;  2D3G A;  3SHQ A;  1F2R I;  1TS5 A;  4ARI A;  4W9H A;  2N9X A;  1PDX A;  2DZJ A;  2GOW A;  2PW9 A;  1YN4 A;  3HRD D;  2MJ3 A;  3H9D A;  1IGC A;  1I7H A;  4TKN A;  3AEE B;  4FJY A;  2KDM A;  1I4H A;  2KQ4 X;  2N0S B;  4DBG A;  1GC6 A;  2UWQ A;  4AJW A;  2JVC A;  2MBO A;  2XBB C;  1C79 A;  2HJ1 A;  3AE5 B;  5CX3 A;  3ZRF A;  2RDH A;  2MJD A;  3ALB A;  4PS3 A;  1DOX A;  1EM7 A;  1JRU A;  4YWG G;  2PE9 A;  2MWS B;  4URK A;  3W5V B;  3L16 A;  1WJN A;  1VD2 A;  4NJ7 A;  4B0E A;  1XCQ L;  2N1W A;  4NAW A;  1K51 A;  3DBH I;  5BYR A;  3GP7 A;  2J53 A;  3X0W A;  2QIE B;  3DBR B;  2WU5 B;  3BII D;  4K7W A;  3NZ3 A;  2KTF A;  2EKI A;  3VUW A;  2KQS A;  2LRW A;  2ON8 A;  2DLB A;  1YJJ A;  4MT5 A;  3HIZ A;  2DZI A;  2NR2 A;  2MCN B;  5HFY A;  1K53 A;  1QOA A;  2BWE S;  2RMM A;  1WGY A;  2I2Y A;  2O6V B;  3VH3 B;  1JWM D;  3BY4 B;  1BT0 A;  4DQO C;  2KDF B;  3UI3 A;  2M56 B;  4IDI A;  2O2V A;  4FBJ B;  2AQ3 B;  1J7B A;  2KVZ A;  4KGS A;  1R4M B;  4MAC A;  1QIL A;  3I57 A;  2N1V A;  4GLS C;  2FCQ A;  1PGX A;  4YT0 B;  4C56 C;  2K22 A;  2IO1 B;  2KWD A;  4PYZ A;  4IG7 B;  1WI0 A;  1L5P A;  4MM3 B;  4M0W A;  1EU3 A;  2BYE A;  4DWF A;  2WLB A;  4L2Y A;  3IAM 1;  1HA5 A;  5JH5 C;  5IKC M;  4O1N A;  3N1Z C;  3Q3O C;  4BKS D;  3ZJT A;  2G4S A;  1WM3 A;  1HEZ E;  4OVV A;  1ZE3 D;  4BKS A;  1XT9 B;  1OQY A;  2JPH A;  2KO3 A;  1WX9 A;  5MPO A;  4BKT A;  1D5X C;  4PK1 A;  2R2Q A;  2MEK A;  3RYT A;  3DPD A;  3W1S A;  3JW0 X;  4IW0 A;  2JF5 A;  5AZF A;  2L0T A;  1OEY A;  1KFY B;  5GXG B;  2YEP B;  2KMA A;  1C4A A;  1Q10 A;  1HZ6 A;  4WQO B;  4HVB A;  2KXJ A;  4NQL B;  2ZPN A;  3FKY A;  4K7U A;  1D3Z A;  5FK9 C;  2IY1 B;  4DHZ E;  4WJQ A;  3ZNH B;  3PV1 A;  2QIL A;  2G45 B;  2L0F A;  3HK0 A;  4G50 A;  4FHK A;  3W1Y A;  3JSV B;  4FUL A;  1WXS A;  2RDG A;  5JHA A;  4Q2J A;  1L7Y A;  1GG3 A;  3BWU D;  2JQR B;  3BZD B;  1TY2 A;  1E0Z A;  3AE6 B;  5DPW A;  3ZLZ A;  4OZB A;  1ROE A;  1L4Z B;  1OTR B;  1K50 A;  4XZ4 A;  3EFU A;  1GAQ B;  3RNF C;  4EZJ A;  2BF8 B;  3PHW B;  3NS8 A;  2KLG A;  4JGH B;  1RFA A;  4K3B A;  2PIA A;  3A4R A;  5D7G A;  2NPT B;  2RGF A;  2RPQ A;  2BWF A;  2LI5 A;  2KWV B;  3H7P B;  3RCZ A;  4FAD A;  2N7D A;  2FCN A;  4ANV A;  1FNW A;  1JCK B;  1SSN A;  3PZD A;  2LHD A;  3CWI A;  2AL6 A;  3A33 B;  2KZR A;  4G3X B;  1A5R A;  3QK0 A;  3TUO A;  3LJ3 A;  4XWW A;  1CQV A;  1V97 A;  2PPH A;  3ZIM A;  2K6D B;  2CR5 A;  3U4E G;  3PZ7 A;  1EO6 A;  3TEZ A;  2BS4 B;  5JXV A;  4RNA A;  1MHX A;  5EE0 A;  2ZNV B;  2DWQ A;  1ZUD 2;  2LUE A;  3OJ4 B;  3BK1 A;  4KDI C;  3V61 A;  1ZXI A;  2DYB A;  1UBQ A;  4DHJ B;  5BYS A;  1FFU A;  1V5T A;  3TCA A;  1VZ6 A;  2WXI A;  2LMC A;  1I42 A;  2N9K A;  4K1R B;  1AWD A;  5KHO A;  4GDL A;  4WJO A;  3AXC A;  3P1M A;  1IP9 A;  1TGZ B;  3Q3J A;  3PT2 B;  1IYF A;  2R2O A;  2Y3A A;  4DHZ B;  3BVZ A;  4RFB A;  1XEE A;  4TSS A;  3B0A A;  4YTP B;  2M17 A;  2N4F A;  2IZV B;  4MM3 A;  2IO3 B;  4N6E B;  2DYM A;  1UNS A;  2BTE A;  3NZU A;  4HCN B;  3LDZ E;  1L0Y B;  3T8M A;  1WMH B;  2LAS A;  3AH7 A;  4IM0 A;  2Y5B B;  2L52 A;  4NNJ B;  5AUI A;  3AE3 B;  1I4Q A;  1UGJ A;  3IHP C;  1A70 A;  2M19 A;  1SF0 A;  4RF1 A;  2KJ6 A;  4LNK A;  1HTO A;  1QKZ A;  1WYW B;  2WXQ A;  4D2K A;  2KYW A;  3APF A;  1P9D U;  1WXM A;  5JHB A;  1YQ4 B;  3WAP A;  4ZRJ A;  2MHJ A;  4IWO A;  1PGB A;  3ZNG C;  4DDI D;  3V3X A;  2KHW B;  4YL8 A;  2FBW B;  1ET9 A;  4JWS C;  3A1Q B;  2MH7 A;  1P3Q U;  2D5G A;  3MHZ A;  4C4V B;  1ENF A;  1Y56 A;  4AOF A;  4ZOH C;  4JWU C;  1LO5 D;  3D32 A;  3PS6 A;  3N1Y C;  2PVO D;  4PYU A;  1WE6 A;  5LNK 1;  1FCL A;  2KC1 A;  5LLI A;  3A4S C;  2K6Q A;  1JWU D;  3DVN V;  1SIF A;  1SEB D;  2W3R A;  2NBU A;  2MP2 A;  3TL5 A;  4KV2 A;  4KSL C;  2KD0 A;  2KMM A;  4WH4 A;  3RI7 C;  3ABV B;  2DNF A;  4I6L B;  1B9R A;  1HZ5 A;  3E9S A;  1E8Y A;  4A9A A;  3HM6 X;  2PE6 B;  3PPA A;  2IGG A;  2O2V B;  1RM6 C;  3DWM A;  1S1Q B;  2JX5 A;  2I1K A;  3U52 E;  4DXF A;  2NBW B;  3QC8 B;  4JQW C;  2NS5 A;  1WR6 E;  4S17 A;  3AU5 A;  2K25 A;  4RMA A;  2OJW A;  3URY A;  1MG4 A;  3SFD B;  3ZDM C;  3VR9 B;  1UWM A;  4IWP A;  1DGJ A;  2NMQ A;  4W9C A;  1L2N A;  1I4P A;  4GDK A;  2IO2 B;  1GC7 A;  2UYZ B;  4II2 B;  3NG0 A;  3DOW A;  4C00 A;  3L17 A;  1VLB A;  1TS4 A;  2QDF A;  3ZJU A;  3HVD A;  5IAA C;  3EUB 2;  3RFZ B;  5D2M B;  4ARC A;  1STE A;  1WGD A;  1NYQ A;  1JAL A;  1WGR A;  4GN1 A;  4ZRI A;  2O6V D;  4KDL B;  2C7M B;  2NTS A;  2KK8 A;  4HPM B;  1XF5 L;  3AEG B;  3N20 C;  2CU3 A;  3FC4 A;  3KUC B;  2K8C A;  2QC8 A;  2KVR A;  3RMK C;  3KYC D;  5HKH A;  2LXA A;  5C23 A;  1FO4 A;  1QZE A;  3VTV A;  1WZ3 A;  3TEW A;  3K9P B;  4M8N A;  2KN5 A;  2CS4 A;  4LNO A;  2WGS A;  3VFK A;  3NOB A;  5FKA C;  2LFI A;  2L7R A;  3R7Q A;  3EEC A;  4GDK B;  2WXN A;  4QAY A;  3MC8 A;  4AQ7 A;  2H89 B;  4RGO S;  5AZH A;  2FE8 A;  3BYT B;  2KQ7 A;  1F2R C;  2V4I B;  1Q5W B;  2V0G A;  4LNF A;  4ICU A;  2KFK A;  1WIA A;  3ONS A;  3WAO A;  1R4M I;  4ANX A;  5C3J B;  4USA A;  2INN E;  4AWJ A;  4M00 A;  2DX5 B;  4FLH A;  2KKC A;  2WDV B;  2KTR B;  2KFJ A;  2LJI A;  3KYD D;  1YQ3 B;  4FXC A;  4TQ0 A;  3U2S C;  4MGY E;  4GXB A;  2MJE A;  2WWZ A;  2NBV B;  1TKY A;  3QAR A;  3AEA B;  1SJE D;  1IBX B;  2GB1 A;  1P1A A;  2L32 A;  2FNJ B;  3MJW A;  2WXM A;  1RAX A;  4REZ A;  2KMC A;  4B0M A;  3MP9 A;  2GBK A;  3L08 A;  3RZF A;  3C8Y A;  4RGN A;  1T3Q A;  1YMH E;  2D3A A;  2J0J A;  2J42 A;  4IM2 A;  3U7Z A;  3VTU A;  2QHO A;  4P1B C;  3Q2A C;  3Q69 A;  3APC A;  1PUT A;  1FFV A;  1K8R B;  1GPX A;  2EEL A;  1ZPS A;  2WDR B;  1P0R A;  1TZO A;  2JZZ A;  2V9H A;  1GNU A;  4GIV A;  1NEK B;  2GI9 A;  4ZDV A;  2JT4 B;  1LQB A;  3CF6 E;  3P4S B;  1IPG A;  2QCZ A;  3ZKJ C;  4P16 A;  1FRD A;  2MBE A;  4GGQ A;  4XE0 A;  3MC0 B;  2JWU A;  2JXT A;  1EF1 A;  4GDL B;  4ANU A;  3B9J A;  1V9J A;  2N9E B;  3VHT C;  2IBI B;  3M95 A;  2ZW0 A;  4XX5 A;  1XLN A;  2G4D B;  3VTW A;  1ZW7 A;  4KKI A;  2WNM A;  2RSU A;  1SJH D;  3RNB C;  4IWQ A;  3VVW B;  3MC9 A;  1VRA B;  5DPR A;  1QOG A;  1WR1 A;  2INC C;  3Q8B A;  4MJS B;  3OLM D;  3AN1 A;  3ZXV A;  2OED A;  2WU2 B;  2LGD A;  2OHF A;  2DZM A;  2CHX A;  1EWC A;  1V2Y A;  3P4Q B;  2LUM A;  1MPE A;  2LGY A;  2MBH A;  4H2A A;  2LXC A;  2N7E A;  1V81 A;  5IP4 D;  3DQV A;  2AX5 A;  3QQ8 B;  4G0N B;  2KJR A;  4J6I A;  4MEM A;  4JPS A;  1JML A;  2ZJD A;  1VDV A;  2O6V A;  2J4X A;  2W82 A;  1L6U A;  1VZ7 A;  3ENE A;  5E6J A;  2X8X X;  3ZNZ B;  2PLP A;  2JSV X;  2IND C;  2L00 B;  3R7R A;  3EC8 A;  1YD8 U;  4KGT A;  1GUA B;  4WWO A;  3B08 A;  1QOB A;  2JRI B;  3NZS A;  1NBF C;  1V1O A;  4ZRK A;  4BOS C;  4MJS A;  1Q1O A;  5T8I A;  4HJG E;  1XLP A;  3FIL A;  1JWB D;  1AAR A;  3P2B A;  2JU6 X;  4EZK A;  5I4D A;  3UIO B;  3X23 A;  1RFK A;  5G5G A;  1KH0 A;  2BB5 A;  3R2I A;  1YQB A;  1HTQ A;  3KUD B;  2MP2 B;  2XN9 C;  4A90 A;  1KM7 A;  4ICV A;  1NVI D;  2AEH A;  3RPF C;  4BAX A;  1WGK A;  4DDG D;  3ECI A;  4M0W B;  1YNT E;  3R2T A;  1PFD A;  4E3C A;  3O13 A;  1YJ1 A;  5JZE B;  4B9K A;  2JXX A;  2L83 A;  4XYC A;  3ZYY X;  1C76 A;  1BXT A;  2C7N B;  4EOY A;  1E6E B;  1YN3 A;  4XGA B;  1GB4 A;  2ZVN A;  2XK5 B;  1DOY A;  1RRB A;  4KIK A;  2VRR B;  3NY5 A;  4HEA 1;  4NJ6 A;  1FEH A;  3VRB B;  4HXD A;  4OW0 A;  3ZW3 A;  5CHV C;  3GS2 A;  1WE7 A;  2WX1 A;  2M0A A;  4M02 A;  1L0V B;  1PYW D;  4HRS A;  1SB3 C;  3Q8E A;  4LCD E;  2RDB C;  2PJH A;  1FNU A;  1FPY A;  3DHI C;  2Z0D B;  2V3N A;  4WIP A;  2IO0 B;  1TTN A;  2KAN A;  2WDQ B;  1LFD A;  4ZHP A;  4OVU A;  2D3C A;  1IGD A;  4S0R A;  1N60 A;  4MDK E;  3UF8 A;  1CJE A;  1MG8 A;  4HKZ E;  3OWE B;  3PRP B;  2LGX A;  2HD5 B;  5EE1 A;  4RGM A;  4P1C C;  1E8W A;  3RD2 A;  1K52 A;  4LDT D;  1V80 A;  1AW7 A;  3QCA A;  4EZL A;  2I1J A;  3N30 A;  4HPP A;  2BW2 A;  2AYO B;  3DCG A;  2GBJ A;  3UQB A;  1M94 A;  1P7E A;  2C60 A;  3P4P B;  4M01 A;  3SD5 A;  2LD9 A;  4W9J A;  3DWG C;  3I5J C;  1EU4 A;  2W3S A;  1B1Z A;  2QMT A;  3H7P A;  4BFR A;  1I35 A;  2AQ2 B;  4BBN C;  3A9J A;  1XLQ A;  4W9F A;  3LYY A;  3MJ5 A;  4AP4 C;  2KX3 A;  3NJT A;  3RN9 C;  3ZJV A;  2ZNV C;  2KJH B;  4C7Z A;  4OHJ A;  4LNN A;  1QLB B;  4J3O D;  1IBX A;  4W9I A;  3PLU A;  3H6N A;  2BYF A;  2MBB B;  2Q5W D;  3B1L X;  1XO3 A;  4HK2 A;  4F7Z A;  2KNB A;  4ZYS A;  1GOZ A;  3FAH A;  3VRA B;  5J2R A;  2BQQ A;  2GBM A;  2PMV A;  4MH0 E;  4FJZ A;  3V6E B;  4DXG A;  3GOE A;  5J18 A;  3KWL A;  3AM9 A;  2YVC A;  3Q3M C;  5E6P A;  1DOI A;  1F77 A;  2JY6 A;  3AED B;  3GZN I;  2K3U A;  2EMT A;  2KWU B;  1UUP A;  3PO0 A;  4IM3 A;  3H1U A;  3VXW A;  2MRP A;  1KLV A;  3WA0 A;  1C1Y B;  2BYT A;  3EHV A;  3KH0 A;  4E74 A;  4HJK A;  4UDU C;  4MH8 A;  4JIO U;  4YSZ B;  5HHD G;  3V60 A;  2LGS A;  2KDE B;  1TZ1 A;  4WJP A;  2A5U A;  3TBL D;  2OJR A;  3APD A;  4RCO A;  4LJP B;  3C0R B;  2BYV E;  3AE7 B;  2ZCC A;  2Z0E B;  1H8C A;  3L54 A;  3AI5 A;  5J17 A;  1E8X A;  2V3S A;  2V4L A;  4F1S A;  1QOF A;  1FXA A;  3RNC C;  3WCQ A;  3W1S C;  2LVO A;  2KAJ A;  2HJ8 A;  1EF5 A;  1ISN A;  5BYQ A;  1SGH A;  1LM8 B;  2VZK D;  1J7C A;  2SAK A;  2VH1 A;  1ET6 A;  4US9 A;  2G3Q B;  1WXQ A;  4P7I A;  1FIQ A;  3TMP B;  4XDD A;  2N7J A;  1WXV A;  1H4R A;  1DYQ A;  1J19 A;  1Z5S B;  4RM9 A;  1HQR D;  4AUQ C;  3DVN U;  2MW5 A; 
#chains in the Genus database with same CATH homology
 1P98 A;  3VTU A;  2MSE D;  2QHO A;  2LZ6 A;  1XQQ A;  1WM3 A;  1F9J A;  2G4S A;  1G6J A;  3APC A;  5DCN A;  4OVV A;  3ZRC A;  1R4N I;  4EFO A;  4BKS A;  2AL3 A;  1K8R B;  4LDT B;  3K9O B;  1XT9 B;  1RLF A;  2FID A;  4W9D A;  1OQY A;  2JPH A;  2KO3 A;  1WX9 A;  3PGE A;  5LXH A;  2L76 A;  4BKT A;  4MEL A;  4HDO A;  4K7S A;  1NI2 A;  1V6E A;  3NHE B;  2J7Q B;  1P0R A;  2JZZ A;  2R2Q A;  2LRU A;  1ZGU B;  4NY0 A;  3RYT A;  1GNU A;  4GIV A;  4ZDV A;  2JT4 B;  1LQB A;  3VAW A;  3DPD A;  3CF6 E;  5L95 C;  3W1S A;  3JW0 X;  4AJY B;  1IPG A;  1T0Y A;  3KUZ A;  4IW0 A;  2JF5 A;  3JYU A;  2J0K A;  3WAN A;  3ZKJ C;  5AZF A;  2L0T A;  4ZYN A;  1OEY A;  3S2A A;  3MTN B;  3N32 A;  2KMA A;  1LXD A;  2MBE A;  4GGQ A;  3SU8 X;  3CMM B;  2EMS A;  4WQO B;  3U8Z A;  5TR5 A;  4HVB A;  1EF1 A;  2KXJ A;  2LVP A;  3M63 B;  4NQL B;  2ZPN A;  4GDL B;  3V62 A;  4ANU A;  4K7U A;  1YX6 B;  1D3Z A;  2IY1 B;  4DHZ E;  1V9J A;  4WJQ A;  2N9E B;  3VHT C;  2IBI B;  3M95 A;  3ZNH B;  4XX5 A;  3PV1 A;  2GMI C;  2LJ5 A;  4E71 A;  4HLE A;  4GU2 A;  2G45 B;  2L0F A;  3HK0 A;  4DK5 A;  1HE8 A;  1OGW A;  2G4D B;  1SE9 A;  4G50 A;  3VTW A;  1ZW7 A;  4FHK A;  3RT3 B;  2RSU A;  3O65 B;  4IWQ A;  3VVW B;  3W1Y A;  5IA7 A;  3JSV B;  3TIX A;  4FUL A;  5DPR A;  1WXS A;  4GMV A;  3DDC B;  4FJV B;  5JHA A;  1V86 A;  1WR1 A;  4ANW A;  4MJS B;  2M4N A;  3OLM D;  3WAM A;  4WJN A;  1L7Y A;  4MGZ E;  1GG3 A;  2LGD A;  5DPS A;  2DZM A;  2CHX A;  3JSV A;  3OJ3 A;  4KZC A;  1V2Y A;  1V5O A;  2NVU I;  3ZLZ A;  5DPW A;  2LGY A;  2MBH A;  2V1Y A;  3TJP A;  3CSF A;  1OTR B;  3RZW C;  4XZ4 A;  2LXC A;  3EFU A;  2N7E A;  1V81 A;  4EZJ A;  3DQV A;  2BF8 B;  3PHW B;  1UBI A;  3ZTC A;  3QQ8 B;  2NPT A;  2CKH B;  4G0N B;  2KJR A;  4DXA B;  3IBE A;  1KOT A;  3NS8 A;  4J6I A;  4HPL B;  2KLG A;  4JGH B;  4TUU A;  1RFA A;  4MEM A;  3DBS A;  3ZVV A;  2IY0 B;  2ZJD A;  4BBN F;  3PHX B;  2O6V A;  3A4R A;  4GSW A;  2NPT B;  5D7G A;  3R3M A;  3IG3 A;  2RGF A;  1Z2M A;  2BWF A;  2PEA A;  2M1M A;  2LI5 A;  2RPQ A;  3HHM A;  2KWV B;  1C3T A;  4WAA A;  3H7P B;  3RCZ A;  4WWN A;  4FAD A;  2N7D A;  2YLM A;  2WDT B;  3ENE A;  2FCN A;  4ANV A;  4JLC A;  2K39 A;  3ZNZ B;  2LWP A;  3JVZ X;  3PZD A;  2AL6 A;  3A33 B;  2KZR A;  4G3X B;  1A5R A;  3QK0 A;  4FN2 A;  3DBR I;  3LJ3 A;  3UQA A;  4HCP B;  2L00 B;  3R7R A;  2PPH A;  3ZIM A;  2K6D B;  2CR5 A;  2KX0 A;  3UIN B;  2K8H A;  3EC8 A;  3PSE B;  5CHW A;  1YD8 U;  2HE7 A;  4CHK A;  2ZCB A;  1ZKH A;  1GUA B;  1Y8R C;  2HTH A;  1FXT B;  3B08 A;  2JRI B;  1EO6 A;  3NZS A;  4WWO A;  2MBQ A;  3PVL A;  5D6J B;  1NBF C;  2RD0 A;  4ZRK A;  3ZDT A;  4MJS A;  4BOS C;  2DHZ A;  1Q1O A;  2ZNV B;  3PRM B;  4GOC A;  3ZO5 B;  2LUE A;  4PS7 A;  4I6P A;  3OJ4 B;  3KW5 B;  3QJZ A;  1AAR A;  3P2B A;  4MGK E;  4EZK A;  4MSQ B;  4KDI C;  3UIO B;  3X23 A;  3V61 A;  4WWP A;  2DYB A;  1UBQ A;  1WX8 A;  3VQI A;  4DHJ B;  4NPN A;  2KDB A;  4W9E A;  4FHJ A;  1V5T A;  3PLV A;  5DPT A;  3TCA A;  1YQB A;  2BKF A;  2ZZP B;  3KUD B;  3ML9 A;  3U7D A;  4CYE A;  4IUM B;  4X57 B;  2ASQ A;  2MP2 B;  1I42 A;  4KVG B;  4K1R B;  1KM7 A;  4ICV A;  5KHO A;  5KHQ A;  2AEH A;  4GDL A;  3PRE A;  2BKR B;  4WJO A;  2L8J A;  3AXC A;  2L05 A;  1UD7 A;  1IP9 A;  2AWT A;  2DAJ A;  3L13 A;  3QWZ B;  1E7U A;  3QAQ A;  4KZ0 A;  4DDG D;  1TGZ B;  3ECI A;  4M0W B;  3Q3J A;  3PT2 B;  1IYF A;  2R2O A;  2BPS A;  1J0G A;  4DHZ B;  3V6C B;  3HM3 A;  4E3C A;  1YJ1 A;  1CMX B;  1EUV B;  5JZE B;  4B9K A;  2JXX A;  4II3 B;  3ML8 A;  3DVG X;  5E6O A;  2M8S A;  1S3S G;  5E6N A;  1WMH A;  3B0A A;  2M17 A;  2N4F A;  2IZV B;  4MM3 A;  2K1F A;  2IO3 B;  2FAZ A;  2DYM A;  2C7N B;  4EOY A;  3NZU A;  4HCN B;  3LDZ E;  4TV3 A;  2ZVN A;  4B6W A;  3T8M A;  1WMH B;  2XK5 B;  2LAS A;  3ZTD A;  4IM0 A;  3A9J B;  1RRB A;  4KIK A;  2VRR B;  2Y5B B;  4I6N B;  3WIM A;  1XD3 B;  3NY5 A;  4NNJ B;  3A9K B;  2JRH A;  4K81 A;  4NJ6 A;  3WAL A;  3IHP C;  5D94 A;  2DZK A;  3VH4 B;  3L0W B;  4G11 A;  3A1Q A;  2GBR A;  4HXD A;  4HWI B;  4NAW B;  2ZVO A;  2MLB A;  2KJ6 A;  2REX A;  4A20 A;  3ZW3 A;  3T9L A;  5CHV C;  3VUY A;  4LJO B;  2XK5 A;  1UGM A;  1WYW B;  2C5L C;  4EEW A;  1J8C A;  4KIK B;  1WE7 A;  1YIW A;  2WX1 A;  2Z59 B;  1YX5 B;  2MA9 B;  5EDS A;  3APF A;  4EKU A;  1P9D U;  1WXM A;  4A3O A;  2DYO A;  4NQK E;  2JZ3 B;  5JHB A;  2D2Q A;  3WAP A;  2N9P C;  2K8B A;  2JUO A;  4ZRJ A;  2CHW A;  4IWO A;  4LCD E;  2CU1 A;  3ZNG C;  3M3J A;  2PJH A;  2DAF A;  2FCS A;  1WGH A;  4DDI D;  2OOB B;  1WF9 A;  2KHW B;  3MHS D;  4YL8 A;  2BGF A;  2Z0D B;  3N3K B;  2ZPY A;  2IO0 B;  1TTN A;  1WJU A;  2D11 A;  2KAN A;  3A1Q B;  4W9G A;  1LFD A;  1VCB A;  1P3Q U;  4OVU A;  3IFW B;  2FCM A;  4TQ1 A;  3QIJ A;  3RUI B;  1WY8 A;  3UGB B;  1Q0W B;  4AOF A;  1E90 A;  2WYQ A;  2LVQ A;  5AZG A;  3D32 A;  4MDK E;  3PS6 A;  3UF8 A;  4PYU A;  1MG8 A;  2D10 A;  3AUL A;  1WE6 A;  4MSM B;  3PRP B;  2KC2 A;  2KC1 A;  2LGX A;  5LLI A;  2HD5 B;  2K6Q A;  3A4S C;  2KOX A;  1UZX B;  1SIF A;  1WXA A;  3DVN V;  2D07 B;  2NBU A;  1E8W A;  2MP2 A;  2NCN A;  3RD2 A;  4EUT A;  5CHF A;  3TL5 A;  4KV2 A;  4KSL C;  2KD0 A;  1WJ6 A;  1WM2 A;  3DVN U;  4I6L B;  4LDT D;  2RR9 A;  4KSK C;  3R66 C;  4W9L A;  1E8Y A;  1WH3 A;  1V80 A;  2M0X A;  3KVF B;  3QCA A;  3SDL C;  3HM6 X;  4EZL A;  4BOZ B;  2PE6 B;  2I1J A;  3N30 A;  3PPA A;  4GB9 A;  2AYO B;  5FR6 A;  1WFY A;  2O2V B;  1WX7 A;  3DCG A;  5G55 A;  2GBJ A;  2L3Z A;  1OEY J;  3UQB A;  1S1Q B;  1M94 A;  2C60 A;  5LXI B;  2I1K A;  3L10 B;  1GJZ A;  4PS8 A;  3SD5 A;  2LD9 A;  3PTF C;  4W9J A;  2NBW B;  3QC8 B;  2CHZ A;  3PRZ A;  1E5W A;  2C9W B;  4JQW C;  5L83 A;  4B95 A;  2NS5 A;  3H7P A;  4BFR A;  1I35 A;  1WR6 E;  4BKS D;  3AU5 A;  4BBN C;  2C7H A;  2K25 A;  3A9J A;  4RMA A;  4W9F A;  3ZDM C;  2EKE C;  4AP4 C;  2KX3 A;  2MX2 A;  4IWP A;  1UEL A;  3QHT A;  4W9C A;  1L2N A;  4GDK A;  2IO2 B;  2ZNV C;  2KJH B;  2D3G A;  2A4Z A;  1GC7 A;  2UYZ B;  4II2 B;  3SHQ A;  4FA6 A;  3ZUN A;  4N9F 4;  3DOW A;  4BVU C;  4IC7 B;  1WZ0 A;  4W9H A;  3PLU A;  4W9I A;  2N9X A;  3L17 A;  2DZJ A;  2WX0 A;  3H6N A;  2GBN A;  2BYF A;  2GOW A;  2MBB B;  3B1L X;  4A3P A;  2DEN B;  4HK2 A;  5IAA C;  4F7Z A;  2KNB A;  3H9D A;  1U4A A;  3QA8 A;  5D2M B;  5J2R A;  3V6E B;  2GBM A;  1WGD A;  4FJZ A;  4MH0 E;  4TKN A;  4FJY A;  3GOE A;  1WGR A;  4XC2 A;  5J18 A;  4GN1 A;  4ZRI A;  3I3T B;  2O6V D;  4KDL B;  2W9N A;  4DBG A;  2C7M B;  4F8C B;  1GC6 A;  2KK8 A;  3IVF A;  4HPM B;  5AEK B;  2UWQ A;  4AJW A;  1TBE A;  2YVC A;  2MQJ A;  2JVC A;  2MBO A;  2XBB C;  3M62 B;  5E6P A;  3Q3F A;  3KUC B;  2JY6 A;  2K8C A;  3GZN I;  5CX3 A;  3ZRF A;  2KVR A;  4RM8 A;  4BKG A;  3VDZ A;  3KYC D;  2EMT A;  4W9K A;  5HKH A;  3ALB A;  1X1M A;  2KWU B;  4HDQ A;  4PS3 A;  2LXA A;  1JRU A;  4IM3 A;  5C23 A;  2PE9 A;  3H1U A;  2MWS B;  1QZE A;  2MRP A;  3VXW A;  4URK A;  1KLV A;  3VTV A;  3L16 A;  1WJN A;  1VD2 A;  3WA0 A;  1PQS A;  4NJ7 A;  1WZ3 A;  1C1Y B;  2N1W A;  2XEW A;  3EHV A;  2FIF A;  3K9P B;  3KH0 A;  4M8N A;  4NAW A;  5G2N A;  2KN5 A;  3DBH I;  3QX1 A;  1V49 A;  4HJK A;  3RUL A;  2CS4 A;  4CO7 A;  4E74 A;  3X0W A;  4JIO U;  3VFK A;  3NOB A;  2KWC A;  2FUH B;  3U30 A;  2L7R A;  2KLC A;  3R7Q A;  3EEC A;  3V60 A;  1UH6 A;  2KDE B;  4GDK B;  4K7W A;  1TZ1 A;  4WJP A;  2A5U A;  3TBL D;  2KTF A;  2OJR A;  2KFK B;  3VUW A;  3APD A;  2KQS A;  2LRW A;  5BO4 B;  5AZH A;  2ZEQ A;  3CST A;  4M8M A;  4LJP B;  3C0R B;  1WGG A;  3HIZ A;  1E8Z A;  2BYV E;  2DZI A;  2ZCC A;  3ZNI D;  2NR2 A;  2MCN B;  2Z0E B;  2KQ7 A;  1H8C A;  3L54 A;  3AI5 A;  2JWZ A;  2BWE S;  5J17 A;  1E8X A;  3BIN A;  1WGY A;  1Q5W B;  2O6V B;  3VH3 B;  2V3S A;  2V4L A;  4F1S A;  3BY4 B;  3H7S A;  1BT0 A;  2KFK A;  4ICU A;  5CTR C;  1KJT A;  1WIA A;  3ONS A;  2KDF B;  3WAO A;  5GMV A;  1R4M I;  4ANX A;  4DHJ D;  4AWJ A;  2O2V A;  3UIP B;  2DX5 B;  4FBJ B;  3W1S C;  2KKC A;  2LVO A;  4FLH A;  2HJ8 A;  3DVG Y;  2KTR B;  1EF5 A;  2J0M A;  1ISN A;  1WRD B;  2KFJ A;  3KYD D;  4JL9 A;  4MGI E;  3A9K A;  3OAW A;  2N1V A;  1SGH A;  4TQ0 A;  2FCQ A;  4ASW C;  1LM8 B;  3DBL I;  4MGY E;  5C1Z A;  1E7V A;  4GXB A;  2IO1 B;  2WWZ A;  2NBV B;  3AU4 A;  4PYZ A;  2G3Q B;  4IG7 B;  3QAR A;  1WI0 A;  2KTR A;  4P7I A;  3TMP B;  1WXV A;  1H4R A;  2BYE A;  4DWF A;  1P1A A;  3MJW A;  2FNJ B;  2IYD B;  1RAX A;  1WJ4 A;  2KMC A;  1J19 A;  1Z5S B;  2GBK A;  2KDI A;  3L08 A;  3RZF A;  4RM9 A;  5JH5 C;  1NDD A;  3VUX A;  4AUQ C;  2B3A A;  2J0J A;  2MW5 A;  4IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...