4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
3RD2A 5IAAC 4DK5A 1C1YB 3VTUA 1LFDA 3QQ8B 2G3QB 2FCSA 2KQ7A 3TBLD 2R2QA 5DPWA 4AOFA 2K8CA 2KDEB 3DDCB 4DDID 4EEWA 5JHAA 2DAFA 2N7DA 3TMPB 2JF5A 1OEYJ 2NR2A 2JZ3B 4ANUA 4FHKA 4PYUA 2KMAA 4GB9A 4MGZE 2DYMA 3H7PB 2KOXA 4N9F4 4NQKE 1V49A 1WFYA 4ZRJA 2KDBA 3ZNHB 3IVFA 1VD2A 3KUCB 1V80A 2KTFA 1Q5WB 3PS6A 3ZDTA 5DPTA 4W9GA 2KHWB 2KMCA 2UWQA 3L17A 4WJOA 4ZRKA 1QZEA 4KV2A 1TZ1A 2BKRB 2MBOA 5J18A 2L05A 4W9FA 1FXTB 4FLHA 2ZZPB 2Z0DB 3JSVB 4AJWA 3ZRCA 3A1QB 4JIOU 3MJWA 1L2NA 1X1MA 2WX1A 2MX2A 4PS3A 4RMAA 3WAMA 1J19A 1UBQA 2NBUA 3PGEA 1TBEA 3QC8B 4EKUA 1UZXB 4E71A 3PRZA 3T9LA 3DVGY 1IPGA 1SE9A 1WXVA 2K8HA 2Z0EB 4FULA 4TQ1A 3A9JA 3QWZB 3V6CB 3W1SA 4TKNA 2HJ8A 2ZJDA 3APDA 2ZPYA 1I42A 1LM8B 2DYBA 1E8YA 2NBVB 2ZNVB 3R66C 3WAPA 2MBQA 4G50A 5CHFA 4W9CA 3B1LX 2IO1B 2EMTA 4IM0A 2ZVOA 3SU8X 2ZNVC 3VAWA 4KDIC 4MH0E 4F1SA 1NI2A 2AYOB 1J0GA 2GOWA 2O6VA 3DVNU 2ZCBA 2LUEA 4ANVA 1UH6A 4BKTA 3RZFA 4JQWC 3V6EB 4HWIB 2DZKA 2CR5A 5CTRC 4TUUA 1E8XA 4FBJB 3M63B 5LLIA 2DHZA 4NQLB 3B08A 1WJNA 4GDLA 4MJSB 3U7DA 4GU2A 4A3OA 2M17A 4ANWA 4WWOA 3QARA 3PV1A 3HM6X 3UQBA 1WZ0A 4PS8A 2CHWA 3QAQA 2N9EB 1RFAA 2N9XA 2KWUB 2FUHB 3VHTC 2KO3A 1YQBA 2KQSA 3KH0A 4K7WA 4EZKA 4URKA 4IM2A 2FAZA 4AJYB 5FR6A 3L16A 4HDOA 2AL3A 2MA9B 2O2VA 3UIOB 4DWFA 4K1RB 4EFOA 1WGGA 3BINA 1V5TA 3PPAA 1E7UA 2CHZA 2LVQA 3SHQA 3B0AA 1WYWB 4HVBA 2IY1B 2KK8A 3A4RA 3ECIA 3H1UA 4W9HA 3W1SC 4DHJD 3VFKA 4K7UA 1UELA 3A9KB 2BYFA 4NJ6A 4NNJB 4FJVB 2PE6B 1C3TA 3EFUA 4II3B 4K81A 3VH4B 4G3XB 3A1QA 4XZ4A 1GC7A 3P2BA 4MGIE 3HHMA 2DAJA 3RT3B 1WM3A 3EECA 2LRUA 2BYVE 2RPQA 3AULA 1YD8U 4RM9A 2EKEC 1S3SG 1YIWA 4ASWC 2D2QA 2W9NA 3CSTA 2V1YA 3A4SC 1Z5SB 1WGYA 1Z2MA 2UYZB 4G0NB 3X0WA 3M62B 2L3ZA 2N1WA 3K9OB 4BBNF 4BKSA 3TJPA 2IY0B 1WH3A 3DBHI 2MP2A 2QHOA 2FNJB 1SGHA 2KN5A 3PZDA 4IM3A 4KZCA 5E6PA 4ZRIA 4IW0A 2HD5B 4MGKE 1RLFA 4FJZA 1P0RA 2Z59B 5G55A 3JYUA 3VTWA 3X23A 1PQSA 1EUVB 1H4RA 3IFWB 4NY0A 1E7VA 2JXXA 1WMHA 3IBEA 4HJKA 1WMHB 1WF9A 2D07B 2NPTA 2RR9A 4GGQA 5G2NA 1K8RB 3LJ3A 3JSVA 2V3SA 5J17A 3QA8A 4HCPB 4DHZB 2D3GA 1G6JA 3ML9A 4TV3A 2OOBB 1ZKHA 2I1KA 1WR1A 3H7SA 5AEKB 1AARA 4HDQA 4I6PA 4LJPB 3R7QA 5L83A 4EZLA 1KLVA 4OVUA 2KWVB 2K6QA 2KD0A 1ISNA 3PLVA 4DXAB 3HK0A 3ZTCA 4XC2A 2AL6A 2MSED 1YX6B 3DBLI 2BF8B 1V86A 2MBBB 2KDFB 1UD7A 2FCMA 4B9KA 2KDIA 2MP2B 3PVLA 2L0TA 5LXHA 3ZW3A 3KUZA 1R4NI 2KVRA 3APFA 3UQAA 2B3AA 5C23A 5CHVC 1NBFC 2ZEQA 1T0YA 1NDDA 4BKGA 2DZJA 2CS4A 2MBHA 4BOSC 1WXMA 1E8ZA 3PHXB 4B6WA 5J2RA 3KUDB 4W9EA 1RAXA 5DCNA 2IYDB 3VVWB 2KKCA 3ZNGC 3ZUNA 5LXIB 4ICUA 4JLCA 2JRIB 1A5RA 2KLCA 2M4NA 2L8JA 4ZDVA 3SD5A 2IO0B 3JW0X 3CF6E 3ONSA 5AZGA 2GBRA 4M8NA 4LDTB 3CMMB 3VUXA 3DPDA 4DDGD 3WA0A 3O65B 3A33B 1S1QB 3KYDD 3AU5A 4IWQA 2RD0A 4AWJA 4NAWB 5JZEB 3RZWC 1WGRA 1WJ4A 4M8MA 3ZNID 1OQYA 2LGYA 4P7IA 2LI5A 5D7GA 3WANA 2R2OA 5JH5C 4J6IA 3DVNV 3L13A 4KIKB 3LDZE 3IG3A 1V5OA 3QJZA 4NPNA 3R7RA 3GOEA 2M1MA 1YX5B 3ZNZB 3VUYA 2KC2A 4GOCA 3HM3A 3QHTA 4E3CA 1KM7A 2RGFA 2CU1A 3ALBA 1WR6E 2GBMA 5CX3A 3W1YA 2LGDA 4PS7A 3RULA 2JVCA 3T8MA 2KLGA 3SDLC 2MCNB 3VH3B 2BGFA 3QCAA 4BBNC 2KXJA 2M0XA 3TCAA 2AWTA 3MTNB 4W9DA 3S2AA 4WWNA 2DX5B 1D3ZA 1WRDB 3QX1A 5EDSA 1H8CA 1WJUA 1Y8RC 2K1FA 3WAOA 5KHQA 2N7EA 1GC6A 5JHBA 2FIDA 1LXDA 3JVZX 2JY6A 2KANA 1J8CA 2K39A 2MLBA 3A9KA 2BWES 2BYEA 3VQIA 3ZLZA 1OTRB 2L0FA 1EF1A 2N1VA 4LDTD 3PLUA 1UBIA 2GBKA 3VDZA 3N32A 4ICVA 1E90A 2MQJA 2JWZA 3PHWB 2PE9A 3MHSD 4IWOA 2N9PC 2NBWB 1EF5A 2LD9A 2MRPA 2OJRA 4DHJB 3L0WB 3OJ4B 4WWPA 4AP4C 3DBSA 1WZ3A 2J0MA 3A9JB 5D2MB 1E5WA 4MDKE 4WJNA 2LGXA 4BFRA 1TGZB 3ZDMC 4W9KA 1VCBA 3RYTA 1WX9A 2ZPNA 2LWPA 5AZHA 5BO4B 4FHJA 4NJ7A 1WXAA 4CO7A 3APCA 5CHWA 2KTRA 1V81A 4X57B 3KW5B 3V62A 1BT0A 2FCQA 2MBEA 2A4ZA 3H9DA 4K7SA 3ZKJC 3QIJA 4KSKC 2C7MB 5L95C 3CSFA 4MSQB 2M8SA 4BKSD 2DENB 4MGYE 5DPSA 3D32A 2ZVNA 4JL9A 2AEHA 2K6DB 1WXSA 2G45B 4HK2A 3RUIB 4CYEA 4KDLB 2FIFA 3DOWA 3K9PB 3VXWA 2JT4B 1OEYA 5E6NA 1WE6A 2KFKB 2XBBC 2ZCCA 2GBNA 1GUAB 1WX7A 3L10B 4MELA 5IA7A 3HIZA 3NZSA 3V61A 3RCZA 2KNBA 2C60A 3Q3JA 4GMVA 1E8WA 2LRWA 4II2B 3DVGX 4GSWA 3NOBA 3TIXA 3U30A 1WY8A 2KJHB 2NPTB 3DCGA 4W9JA 4W9LA 2KZRA 1ZGUB 2MW5A 4FN2A 4I6NB 1EO6A 1GNUA 1WI0A 2GMIC 5C1ZA 4BOZB 3L54A 3M3JA 1WJ6A 4DHZE 4G11A 1P3QU 2KWCA 5D6JB 5GMVA 3OLMD 2L76A 4W9IA 5KHOA 2CHXA 3AXCA 3H7PA 2KX0A 4YL8A 1V6EA 4OVVA 1HE8A 3UINB 3GZNI 5TR5A 3PREA 4GDKB 2BPSA 4KVGB 2LASA 4NAWA 2O6VB 4IC7B 1U4AA 4JGHB 4BVUC 4DBGA 2KJRA 3UGBB 1Q1OA 4HPMB 4GIVA 2N4FA 1IP9A 3M95A 4B95A 2K8BA 2DYOA 2KFKA 2KTRB 3QK0A 4GN1A 2G4DB 5DPRA 2J0KA 3C0RB 1RRBA 2LXAA 4I6LB 1F9JA 2LJ5A 2Y5BB 1V9JA 3KVFB 4GDKA 4HCNB 3ZTDA 3WALA 4XX5A 2L7RA 4MSMB 2JUOA 1R4MI 2LZ6A 1V2YA 4MM3A 2KC1A 1M94A 2ASQA 4TQ0A 1ZW7A 2GBJA 1GG3A 3WIMA 2BKFA 1KOTA 2IBIB 2V4LA 4LCDE 4LJOB 3NY5A 3PRPB 1MG8A 2O6VD 3ML8A 1XD3B 2KX3A 4HPLB 1P98A 1KJTA 2G4SA 3VUWA 1JRUA 3I3TB 2DZMA 2C7HA 2XK5A 3ZVVA 4EUTA 4EZJA 1LQBA 2KFJA 3OAWA 5D94A 3AU4A 4CHKA 2YVCA 4HXDA 4MEMA 4M0WB 1XT9B 3PSEB 2D11A 3ENEA 3H6NA 2YLMA 2WDTB 2L00B 1CMXB 2KJ6A 3R3MA 2C5LC 2REXA 2XEWA 2LVPA 4EOYA 1WX8A 4IUMB 2J7QB 4F7ZA 2JZZA 2VRRB 3DQVA 3EHVA 5E6OA 1TTNA 4MJSA 1I35A 3U8ZA 2K25A 1P9DU 2PEAA 3V60A 3ZRFA 3UF8A 2LXCA 2JPHA 2NVUI 4FJYA 4WJPA 3PT2B 2JRHA 1Q0WB 4KSLC 3NHEB 3ZO5B 1GJZA 4AUQC 3OJ3A 3VTVA 1OGWA 2IO3B 4A20A 2LVOA 2HE7A 3NS8A 2WYQA 2IO2B 3TL5A 2FCNA 1WIAA 1WM2A 3BY4B 3EC8A 3N3KB 4GDLB 2J0JA 3DBRI 4PYZA 2EMSA 4HLEA 3NZUA 1WGHA 2O2VB 4WJQA 2PPHA 3N30A 5AZFA 2NS5A 4WQOB 1WE7A 2D10A 2HTHA 4WAAA 2XK5B 2PJHA 1WGDA 2WWZA 3KYCD 2RSUA 4KIKA 4ANXA 4FADA 1YJ1A 2IZVB 4E74A 3PRMB 2A5UA 2NCNA 1SIFA 4IG7B 3PTFC 3IHPC 1L7YA 3UIPB 4ZYNA 3ZIMA 2MWSB 2C7NB 5HKHA 4GXBA 3Q3FA 4RM8A 1IYFA 4A3PA 2C9WB 1P1AA 2BWFA 2CKHB 1UGMA 1XQQA 2I1JA 4FA6A 3L08A 4KZ0A 3AI5A 2WX0A 2DZIA 4IWPA 4F8CB
chains in the Genus database with same CATH superfamily
3AEBB 3RD2A 1LGRA 4JX1C 5DPWA 2E3TA 2VH1A 5JHAA 2DLBA 2NR2A 2JZ3B 3AEEB 1FNWA 4MGZE 2DYMA 2KOXA 4ZRJA 1SSNA 1I4HA 2RDBC 2KDBA 3MFGA 3BYYB 3IVFA 3KUCB 2V9HA 1JRPA 2BKRB 3KQ4A 4W9FA 2RPVA 4AJWA 3A1QB 4JIOU 3MJWA 1L2NA 2IDYA 1X1MA 1ZDXA 2MX2A 2B76B 2NBUA 2QSDA 1UZXB 4E71A 3T9LA 1WWTA 1SE9A 3MJ5A 4FULA 4KKJA 4TQ1A 3A9JA 4C7YA 2WXJA 3V6CB 1BXTA 5G5GA 2HJ8A 3AN1A 2QMTA 2DYBA 2NBVB 2MBQA 1YMHE 4G50A 3SU8X 2ZNVC 3VAWA 4KDIC 3FAHA 2GOWA 2O6VA 2DWQA 2WXQA 3V6EB 5CTRC 2J53A 4XWWA 2DHZA 4NQLB 3U7DA 1D5ZC 3N9YC 4GDLA 3AEFB 2JWUA 4RCOA 5H8YE 2PLPA 4NJCA 3P4PB 4PS8A 1V8CA 1RFAA 1VLBA 3KH0A 1TKEA 1YQ4B 4ACFA 3L16A 1VZ7A 2AL3A 4EFOA 5EE9A 1WGGA 1YN3A 1KRHA 2KDMA 1QOAA 3AE7B 1E7UA 3SHQA 4O1NA 2JXTA 2IY1B 3DWMA 2LFIA 1UELA 2BYFA 4FJVB 1C3TA 1N5WA 3VH4B 1SF0A 3AEDB 2DAJA 3RT3B 2LRUA 5D3IB 4NAMA 1S3SG 4ASWC 3A4SC 1Z5SB 3X0WA 1FMAD 4BKSA 2AQ1B 2MP2A 2KN5A 4MGKE 4FJZA 4CO7A 5G55A 3VTWA 1E7VA 3GP7A 3Q8CA 2H89B 3LJ3A 2OEDA 4MH8A 2V3SA 4LNKA 3VRBB 2RMMA 1G6JA 1IGDA 3FILA 1ZKHA 1PFDA 2V0GA 3R7QA 5MPOA 2KWVB 2K6QA 1ISNA 1TJEA 4DXAB 5LNK1 3ZTCA 4XC2A 2AL6A 1CQVA 1HA5A 1T6BX 1UD7A 4B9KA 3ZW3A 1R4NI 5CHVC 1NDDA 4BOSC 4B6WA 3N1XC 2M4NA 2L8JA 2DBYA 2GBRA 4M8NA 1VDVA 4LDTB 1ZOYB 2QJLA 2OHFA 3A33B 1S1QB 3KYDD 4IWQA 4NAWB 1OQYA 2LGYA 1UNSA 2JX5A 5D7GA 1D5MC 1N63A 3N20C 5TSSA 1TKYA 4KIKB 4IDIA 2PMVA 1T3QA 1V5OA 3NG0A 4A55A 3ZNZB 2BS2B 1DOXA 4GOCA 4RGMA 3AECB 4REZA 2K9XA 4PS7A 2SEBD 3LXFA 4HROA 3MP9A 2WXRA 1SE4A 2PKOA 2JQRB 4XDCA 3TCAA 3PZ7A 3B2GA 5EDSA 1WJUA 1Y8RC 2K1FA 5KHQA 1N60A 1T5XD 2JY6A 2KANA 2ZW0A 2BWES 3ZLZA 2N1VA 1EF1A 3PLUA 3VDZA 2PE9A 3MHZA 1CZPA 3RNBC 4DHJB 3ZYYX 2OJWA 4WIPA 4AP4C 3DBSA 1QT9A 4YXDB 2LGXA 1FIQA 3Q3MC 1WYGA 3Q8BA 5BO4B 1UWXA 3AE2B 3BK2A 2LUMA 1P7EA 4NJ7A 2Q5WD 3V62A 1BT0A 1MI0A 3BVGA 4MSQB 3WCQA 3RNGC 2ZVNA 4NZLB 2K6DB 1WXSA 4KDLB 1D6EC 2JT4B 5D3DA 1OEYA 3UI3A 3Q14C 4MELA 4M02A 2WXGA 3RCZA 4A8XC 4LNIA 3DVGX 2V4IB 4W9JA 4C80A 2MW5A 1WI0A 5C1ZA 3DWGC 2HDEA 2WDVB 3GS2A 4S0RA 4G11A 3NVYA 3AE5B 1P3QU 5D6JB 1SXTA 3AXCA 4YL8A 4OVVA 1E7PB 1TZOA 3B2FA 4KVGB 4IC7B 4BVUC 4DBGA 2GB1A 2QCZA 4MM3B 3C8YA 1TS4A 1C78A 2KFKA 2BS4B 1RRBA 2LXAA 4I6LB 2LJ5A 2JUOA 3W5UB 5AUIA 2KC1A 3BIID 4RNAA 2BKFA 2IBIB 2AX5A 3PRPB 3ML8A 2KWDA 4HPLB 1KJTA 3SEBA 1VZ8A 2R61A 2XK5A 4EUTA 4N59A 1JWAD 1LQBA 2KFJA 3OAWA 1QOFA 4M0WA 4M01A 3RN9C 1B1ZA 2L00B 2KJ6A 3R3MA 2GRIA 4UDUC 1FNUA 1WX8A 1MPEA 1FD6A 1OQQA 4IUMB 5T8IA 2J7QB 3DQVA 1I35A 2N0SB 4JPSA 1TTNA 4MJSA 3U8ZA 1VZ6A 3UF8A 2NVUI 2JPHA 2W54A 4KSLC 1GJZA 4AUQC 3VTVA 2WYQA 1WIAA 2WQYB 1WGHA 2O2VB 2INNE 4XWTA 2ICIA 1IUEA 2XK5B 3AM9A 3KYCD 2RSUA 3P4RB 1RFKA 4BAXA 4IG7B 3IHPC 4ZYNA 2C7NB 3EA6A 3Q3FA 1XLNA 4RM8A 1GAQB 4YSXB 4ITKA 2BWFA 2BQQA 2BYTA 1ZXIA 1UGMA 1XQQA 3RNFC 2DZIA 1KH0A 5IAAC 2IGHA 2G3QB 2FCSA 4EEWA 2J42A 5FKAC 1OEYJ 2J4XA 4ANUA 1J7AA 4FHKA 1HEZE 3HVZA 3DHHC 4N9F4 3ZNHB 1KLUD 1V80A 3ZDTA 5DPTA 1FO4A 1CK1A 1KFYB 4YTNB 2MBOA 3Q69A 4A90A 3MC8A 2L05A 1HTQA 4FLHA 2EKIA 3JSVB 3U52E 3ZRCA 4PS3A 4EKUA 1E6EB 3P1MA 3PRZA 1OFFA 3DVGY 3NZ3A 1NENB 2Z0EB 1TS2A 3Q8FA 4ZRQA 4TKNA 4OZBA 1I42A 1LM8B 1N5XA 4H2AA 1E8YA 3WAPA 1C4CA 2JZPA 4C56C 2BBCA 2L83A 1HZ6A 4L1BA 3Q6BA 1NI2A 3DVNU 2GI9A 4L2YA 1FPYA 2K5PA 1UH6A 2G9HD 4HWIB 2CR5A 1MVKA 1TY0A 2JSVX 2X8XX 4XE0A 3FKYA 4GU2A 2M17A 5AUKA 3HM6X 1WZ0A 2N9XA 3VHTC 1SIJA 2KQSA 3CWIA 2LHDA 5FR6A 2JU6X 1XCQL 4XYCA 2MA9B 5GXGB 5JXVA 3NVWA 4LLGM 3PPAA 3BK1A 2LVQA 1YNTE 3B0AA 1WYWB 4HVBA 4PT5A 4DHJD 2WHIA 1C4PA 1WRIA 4NNJB 4NJ6A 2PE6B 1UWMA 1F2RI 4XZ4A 3HHMA 1WM3A 1WSPA 2D2QA 2W9NA 5BMIA 4P1CC 3TEWA 4B0MA 2L3ZA 4S17A 2N1WA 1XEEA 3TJPA 3Q3OC 1ENFA 3DBHI 1FEHA 2FNJB 4KZCA 5E6PA 1RLFA 1P0RA 1PQSA 1H4RA 4NY0A 2QC8A 2QDFA 1ROEA 1WMHA 3IBEA 1WF9A 2NPTA 1MFWA 5BMHA 5J17A 4HCPB 1TS3A 2D3GA 2Z8LA 3ML9A 3NJTA 3URYA 3V3XA 3RPFC 1TS5A 1AARA 1PYWD 3NVZA 4OVUA 3HVDA 2K0PA 3HK0A 2MSED 2D3CA 1F52A 1V86A 2MBBB 1ET9A 1AW7A 4ZHOA 1TKGA 4K3BA 2I2YA 5LXHA 1STEA 5C23A 3IT4B 1NBFC 2KACA 1T0YA 2WXMA 4BKGA 2DZJA 1TY2A 1WXMA 4JWUC 3KUDB 5DCNA 3VVWB 2KKCA 5LXIB 1V1PB 4JLCA 1MJDA 2MJ3A 3TEZA 4RH6A 3ONSA 5BYQA 3DPDA 4DDGD 3O65B 1NYRA 3KWVA 1WJ4A 2W3RA 1N6ZA 2LI5A 3AE3B 4DXFA 3L13A 3AEGB 3GOEA 1YX5B 2N9LA 3VUYA 2KC2A 1VRAB 3IXSA 2RGFA 2CU1A 1WR6E 5G5HA 3W1YA 2JVCA 5EE3A 4ZHPA 2KLGA 3SDLC 2MCNB 3VH3B 2BGFA 3QCAA 4BBNC 1GOZA 2KXJA 2M0XA 3GB1A 4MT5A 3S2AA 5I4DA 1D3ZA 1WRDB 1XLQA 3QX1A 3W2DA 1H8CA 4PK1A 2W3SA 3T3NA 3WAOA 1QQRA 1RYJA 4P6VF 3JVZX 2K39A 1OTRB 2L0FA 4OZAA 1UBIA 1E90A 3PHWB 1R4NB 3MHSD 4IWOA 2N9PC 2NBWB 2L32A 1HQRD 1KF6B 2MRPA 4YT0B 3L0WB 4WWPA 3TUOA 2AQ3B 1MG4A 1WZ3A 2J0MA 1R7SA 4WJNA 4BFRA 3ZDMC 1DOIA 1VCBA 1WX9A 2LWPA 2W82A 3W5VB 3DHIC 4FHJA 2Y5PA 5CHWA 1JCKB 1UGJA 1AWDA 2MBEA 4F1SA 3QIJA 2XN9C 2WGSA 3CSFA 4LNNA 2DENB 4MGYE 3D32A 4JL9A 2AEHA 4CYEA 2G45B 1SE3A 1SEBD 3VXWA 2FIFA 2XBBC 2GBNA 2G1EA 3L10B 4YTPB 4P16A 4GSWA 1YN5A 2IGGA 2NPTB 4I6NB 2LHEA 1EO6A 1XO3A 2GMIC 4BOZB 3M3JA 2KWCA 5GMVA 1PDXA 3BYTB 2KX0A 3UINB 3GZNI 3PREA 4GDKB 2BPSA 4AQ7A 1Y56A 4NAWA 1I7HA 3AV8A 2KJRA 1ESFA 4HPMB 4GIVA 3M95A 5EE0A 4B95A 1UUPA 2WXFA 2DYOA 3QK0A 2J0KA 1T0RC 2HTME 3VR8B 3WALA 4OZCA 2BS3B 1FCCC 2LZ6A 4MM3A 3HRDD 4TQ0A 1ZW7A 2INCC 2GBJA 1GG3A 1YQ3B 3WIMA 1VR9A 3NY5A 1DGJA 1XD3B 4HJGE 1P98A 1JRUA 2WXPA 2DZMA 2C7HA 3ZVVA 2YVCA 3EFCA 4HXDA 4CQNA 4MEMA 4M0WB 1QILA 3PSEB 3I5JC 2D11A 1JWMD 3ETRA 3ENEA 4OHJA 3DBHB 2WDTB 1CMXB 3VR9B 4FXCA 2XEWA 3CIRB 2JZZA 2VRRB 1RM6C 2PEAA 4QAYA 4FJYA 2DNFA 2JRHA 4WAFA 2IO3B 2HE7A 3NS8A 3TL5A 2FCNA 4HLEA 3NZUA 1E9MA 3AE9B 2SAKA 2RDGA 4WQOB 1WE7A 4WAAA 1C4AA 2WWZA 4KIKA 1YJ1A 2IZVB 3UIPB 1JQ4A 3ZIMA 2MWSB 5HKHA 2PIAA 1IYFA 4A3PA 2C9WB 1P1AA 5IN7A 2CKHB 3DBRB 4FA6A 3L08A 2KN4A 2WX0A 4RGOS 3VTUA 1DOYA 1PGXA 1LFDA 3QQ8B 4LNOA 1N61A 2KQ7A 3TBLD 2R2QA 4AOFA 2K8CA 2M0AA 3DDCB 3P4QB 4DDID 1C79A 3TMPB 4HRSA 2MJDA 4L23A 3E9SA 3RNEC 1I4QA 2KHWB 2KMCA 2LGIA 3N1ZC 1TYGB 4A9AA 4WJOA 4KV2A 1TZ1A 2MJEA 1YJJA 2HJ1A 1HTOA 2WX1A 4RMAA 3WAMA 1J19A 1UBQA 2GLSA 1I4RA 3QWZB 5C3JB 2BB5A 2ZPYA 1L6VA 3IT6B 2WS3B 3R66C 3I57A 4W9CA 1V97A 2EMTA 1XF5L 2ZVOA 3L4PA 4YSYB 5IO9A 1IGCA 2MEKA 2ZCBA 2K22A 4ANVA 3RZFA 1E10A 2DZKA 2L52A 2N9KA 4TUUA 1E8XA 4FBJB 5LLIA 1SJHD 3B08A 1WJNA 4MJSB 4US9A 4A3OA 3GE8C 1FM0D 4ANWA 1ZDVA 4WWOA 3QARA 3UQBA 3ZJUA 2KO3A 1HXYD 4IM2A 2FAZA 4HDOA 1RWSA 4K1RB 3ECIA 3H1UA 4W9HA 1PGBA 3SR6A 3VFKA 3EFUA 4II3B 4G3XB 1I4PA 3SFDB 1GC7A 3P2BA 4MGIE 3RMKC 3PO0A 4OVZA 3AULA 1YD8U 3EGRA 4RM9A 2EKEC 3V05A 2V1YA 1WGYA 2UYZB 4G0NB 3LYYA 3U4EG 2IY0B 3AB5A 1WH3A 4KKIA 1NVID 2QHOA 1FFVA 3DHGC 1SGHA 1KTKA 4IM3A 4ZRIA 2Z59B 3IFWB 1EUVB 2VZKB 4YSZB 2JXXA 4HJKA 1WMHB 2RR9A 5G2NA 4GGQA 1K8RB 2JYEA 3R2IA 1ZXHA 2ZW1A 2D5GA 2OOBB 2I1KA 3OG5A 1WR1A 3H7SA 5AEKB 2KQ4X 4Q2JA 4HDQA 4KGRA 4I6PA 4LJPB 5L83A 2KD0A 4ARIA 1YX6B 3DBLI 2BF8B 2WP9B 3R2TA 2KDFB 2FCMA 2KDIA 2MP2B 1NYQA 3APFA 4JE3B 5IKCM 3FC4A 1SE2A 5H92C 2CS4A 3BWUD 3RFZB 2M19A 1E8ZA 1RAXA 2IYDB 4ICUA 3GZNB 4WURA 2X38A 2KLCA 4MACA 4LNFA 2IO0B 3JW0X 4TMAB 2KMMA 3CF6E 3KLSX 5AZGA 3CMMB 3WA0A 3AU5A 2RD0A 5JZEB 3RZWC 4M8MA 3ZNID 3AE6B 4C4VA 3WANA 5JH5C 4J6IA 3DVNV 4KX6B 2ACZB 3LDZE 3FILB 2M1MA 3Q2AC 4E3CA 3R8BA 5CX3A 2LGDA 1EWYC 3T8MA 1NI3A 1ET6A 5FR3A 2AWTA 3MTNB 3O13A 4W9DA 1XLPA 2N7EA 2YEPF 1GC6A 2FIDA 3ZQ4A 2MLBA 3A9KA 1FRDA 3T3OA 2GBKA 3IAS1 3N32A 5FK9C 2LD9A 1R4MB 1L6UA 2OJRA 1FCLA 1ZP0B 3OJ4B 1F2RC 4RF1A 3A9JB 4MDKE 1TGZB 2L1AA 2ZPNA 3APCA 1SJED 2KTRA 4USAA 3BVMA 3KW5B 1F1HA 5L95C 2A4ZA 2C7MB 2WDQB 1P7FA 2LJIA 4BKSD 4C4VB 4KGTA 4HK2A 3K9PB 5E6NA 1WE6A 2KFKB 1WX7A 5IA7A 3HIZA 3NZSA 2KNBA 1I4GA 2J52A 2C60A 3Q3JA 1FNVA 2LRWA 4II2B 3TEYA 3NOBA 3U30A 1WY8A 2KZRA 1WJ6A 4DHZE 1QKZA 5BYRA 4W9IA 3Q3NC 3H7PA 1CJEA 5TR5A 1DYQA 2O6VB 1U4AA 4JGHB 3ZJTA 3UGBB 1IP9A 3TSSA 4N58A 3P4SB 3ZJVA 3EUB2 4HPPA 4GDKA 3ZTDA 4JWSC 4XX5A 4MSMB 1V2YA 3ZXVA 3IAM1 2BB6A 1M94A 2H88B 2ASQA 1HZ5A 2LMCA 1KOTA 2V4LA 1V1PA 2ON8A 1MG8A 1FXAA 3VUWA 3I3TB 3I63C 4EZJA 2CJNA 2WDRB 2E6XA 4CHKA 4HKZE 1XT9B 3H6NA 1EU4A 2YLMA 2NTTA 3B9JA 3ZXRA 2UU7A 3RNAC 3EHVA 1F0ZA 3V60A 3ZRFA 2LXCA 4WJPA 1Q0WB 3NHEB 2WXOA 3HUIA 4A20A 1OGWA 2LVOA 1C77A 2IO2B 2JYTA 1GB1A 4PYZA 2EMSA 1SBBB 4RF0A 4WJQA 4ZRPA 3N30A 2NS5A 2HTHA 4ANXA 1WGDA 4FADA 1JWSD 5IOIA 2VH2A 4E74A 3PRMB 2NCNA 1SIFA 1L7YA 2WXHA 4GXBA 4RGNA 3ABVB 3BVZA 4KZ0A 4IWPA 4DK5A 1C1YB 1PUTA 2AQ2B 3TEXA 1L0XB 3MC0B 1K52A 2KDEB 4KGSA 2FUG1 2DAFA 2N7DA 2JF5A 2WNMA 1NEKB 4PYUA 2KMAA 4GB9A 3H7PB 4NQKE 1V49A 1WFYA 3PS6A 1VD2A 2KTFA 1Q5WB 4W9GA 2UWQA 1QOGA 3L17A 4ZRKA 1QZEA 1GB4A 4C00A 4C7ZA 5J18A 1FXTB 1AN8A 2ZZPB 2Z0DB 2NMQA 3PGEA 2MHJA 1TBEA 3QC8B 3W9CB 1IPGA 1WXVA 2INDC 2K8HA 1TIFA 3W1SA 2ZJDA 3APDA 1FRRA 2WXLA 2ZNVB 5CHFA 3Q8AA 3B1LX 2IO1B 4IM0A 4MH0E 2AYOB 1J0GA 2QILA 2BW2A 2Y3AA 3Q8EA 2LUEA 4EE2A 1XLOA 1PGAA 3U2SC 4BKTA 4JQWC 3M63B 2IPKD 1L0YB 4LK0M 3U7ZA 3PV1A 1EWCA 2CHWA 3QAQA 2INPE 2N9EB 2FE8A 2FUHB 2KWUB 4K7WA 1YQBA 4URKA 3DBLB 4EZKA 2YEPB 2VZKD 4A6QA 4AJYB 1OQRA 2EELA 2O2VA 3UIOB 4DWFA 3BINA 2RDHA 1V5TA 4B0EA 2CHZA 2KK8A 3A4RA 3H8HA 3W1SC 2KYWA 4K7UA 3A9KB 4K81A 1MHXA 5HI1A 3A1QA 3P63A 1SB3C 1C76A 3EECA 2WXNA 2BYVE 2RPQA 2PVOD 1FFUA 1V1OA 1VJKA 1YIWA 4ZOHC 2QEJC 3CSTA 1T0QC 1Z2MA 5HFYA 3M62B 3NRZA 3K9OB 4BBNF 2LGSA 4N6EB 1JWUD 2FBWB 4HKQA 1UF0A 3PZDA 4IOIE 3VRAB 1EU3A 1EM7A 4IW0A 2HD5B 3JYUA 3X23A 2WXIA 1J7CA 2D07B 1B9RA 1GPXA 3NS1A 3JSVA 3QA8A 3NVVA 4DHZB 4TV3A 1L4DB 4EZLA 2WU5B 1KLVA 3PZ8A 1K51A 3AE1B 2K3UA 3PLVA 2V3PA 3AMZA 2MH7A 2CU3A 2ONQA 3PVLA 2L0TA 1WGKA 3KUZA 2KVRA 3UQAA 2B3AA 2KT7A 4M00A 2ZEQA 2WU2B 1JMLA 2MBHA 4R3DA 1JWBD 1M4VA 3PHXB 4RGTA 3AEAB 5J2RA 4W9EA 3ZNGC 1C9FA 1YOVB 3ZUNA 1BMLC 2JRIB 1A5RA 5EE1A 4ZDVA 3SD5A 4LTUA 4IKGA 2W55A 3KWLA 3VUXA 1L5PA 2V3NA 4TSSA 3RNCC 4AWJA 1WGRA 1QLBB 3RI7C 4P7IA 2R2OA 3IG3A 3QJZA 4XDDA 4NPNA 3R7RA 3I9V1 3HM3A 4YWGG 3QHTA 3MC9A 1KM7A 3NUHB 3ALBA 3AE4B 2GBMA 3OWEB 5E6JA 3RULA 1IBXA 2D3AA 3J9CA 4GLSC 3AE8B 1AYFA 4WWNA 2DX5B 1BUIC 1I4XA 2NTSA 1QOBA 1FXIA 5JHBA 2LEKA 1LXDA 2Y5CA 1J8CA 2BYEA 1K53A 3VQIA 2PW9A 4LDTD 1YJIA 4ICVA 2MQJA 2JWZA 1ZUD2 1EF5A 1T0SC 2CJOA 3GE3C 2N7JA 1XCTL 5D2MB 4BZAA 1E5WA 4HEA1 1QF6A 4W9KA 3RYTA 1Q10A 5AZHA 4ZYSA 2IJ0A 3C19A 1WXAA 1V81A 4X57B 2FCQA 3H9DA 4K7SA 3ZKJC 4KSKC 2IGDA 1IBXB 1A70A 2KAJA 1XXGA 2M8SA 2M56B 5DPSA 3ZGZA 3RUIB 3DOWA 1ACCA 2ZCCA 5BMGA 1GUAB 2PVGC 1JALA 3V61A 2WXKA 4D2KA 1KLGD 4GMVA 1E8WA 2BVCA 3SFEB 3TIXA 2KJHB 3DCGA 4W9LA 1ZGUB 4FN2A 1GNUA 2BT6A 3L54A 4RFBA 2TSSA 2WLBA 2BTEA 1ZPSA 4ARCA 4XGAB 3OLMD 2L76A 5KHOA 2CHXA 1V6EA 1JROA 1HE8A 5BYSA 1F77A 2LASA 4OW0A 4K3CA 1Q1OA 2N4FA 1E0ZA 2K8BA 4P1BC 4GN1A 2KTRB 5DPRA 2G4DB 4WH4A 3C0RB 1F9JA 2QIEB 2Y5BB 1V9JA 3KVFB 4HCNB 2L7RA 4US8A 1R4MI 4J3OD 3P42A 3E56A 3LB8C 4LCDE 4LJOB 1L0VB 2O6VD 2KX3A 5HHDG 2G4SA 1JW9D 1ZE3D 1LO5D 5D94A 3AU4A 3N1YC 1WXQA 3BZDB 5IP4D 2C5LC 2REXA 2LVPA 2D3BA 4EOYA 4F7ZA 5E6OA 4WQMA 4YTMB 2K25A 2PTLA 1P9DU 5C2TB 4DQOC 3PT2B 1N62A 3ZO5B 1L4ZB 3AH7A 3OJ3A 1D5XC 1WM2A 3BY4B 3EC8A 3N3KB 4GDLB 2J0JA 3DBRI 2PPHA 5AZFA 2D10A 2PJHA 2I38A 2XNAC 2A5UA 1J7BA 1MHHE 3PTFC 5HG2A 1TT5B 4AS1A 1K50A 1YN4A 2KVZA 4DXGA 1D4BA 4WWMA 2I1JA 3AI5A 4F8CB
chains in the Genus database with same CATH topology
3RD2A 5IAAC 4DK5A 1C1YB 3VTUA 1LFDA 3QQ8B 2G3QB 2FCSA 2KQ7A 3TBLD 2R2QA 5DPWA 4AOFA 2K8CA 2KDEB 3DDCB 4DDID 4EEWA 5JHAA 2DAFA 2N7DA 3TMPB 2JF5A 1OEYJ 2NR2A 2JZ3B 4ANUA 4FHKA 4PYUA 2KMAA 4GB9A 4MGZE 2DYMA 3H7PB 2KOXA 4N9F4 4NQKE 1V49A 1WFYA 4ZRJA 2KDBA 3ZNHB 3IVFA 1VD2A 3KUCB 1V80A 2KTFA 1Q5WB 3PS6A 3ZDTA 5DPTA 4W9GA 2KHWB 2KMCA 2UWQA 3L17A 4WJOA 4ZRKA 1QZEA 4KV2A 1TZ1A 2BKRB 2MBOA 5J18A 2L05A 4W9FA 1FXTB 4FLHA 2ZZPB 2Z0DB 3JSVB 4AJWA 3ZRCA 3A1QB 4JIOU 3MJWA 1L2NA 1X1MA 2WX1A 2MX2A 4PS3A 4RMAA 3WAMA 1J19A 1UBQA 2NBUA 3PGEA 1TBEA 3QC8B 4EKUA 1UZXB 4E71A 3PRZA 3T9LA 3DVGY 1IPGA 1SE9A 1WXVA 2K8HA 2Z0EB 4FULA 4TQ1A 3A9JA 3QWZB 3V6CB 3W1SA 4TKNA 2HJ8A 2ZJDA 3APDA 2ZPYA 1I42A 1LM8B 2DYBA 1E8YA 2NBVB 2ZNVB 3R66C 3WAPA 2MBQA 4G50A 5CHFA 4W9CA 3B1LX 2IO1B 2EMTA 4IM0A 2ZVOA 3SU8X 2ZNVC 3VAWA 4KDIC 4MH0E 4F1SA 1NI2A 2AYOB 1J0GA 2GOWA 2O6VA 3DVNU 2ZCBA 2LUEA 4ANVA 1UH6A 4BKTA 3RZFA 4JQWC 3V6EB 4HWIB 2DZKA 2CR5A 5CTRC 4TUUA 1E8XA 4FBJB 3M63B 5LLIA 2DHZA 4NQLB 3B08A 1WJNA 4GDLA 4MJSB 3U7DA 4GU2A 4A3OA 2M17A 4ANWA 4WWOA 3QARA 3PV1A 3HM6X 3UQBA 1WZ0A 4PS8A 2CHWA 3QAQA 2N9EB 1RFAA 2N9XA 2KWUB 2FUHB 3VHTC 2KO3A 1YQBA 2KQSA 3KH0A 4K7WA 4EZKA 4URKA 4IM2A 2FAZA 4AJYB 5FR6A 3L16A 4HDOA 2AL3A 2MA9B 2O2VA 3UIOB 4DWFA 4K1RB 4EFOA 1WGGA 3BINA 1V5TA 3PPAA 1E7UA 2CHZA 2LVQA 3SHQA 3B0AA 1WYWB 4HVBA 2IY1B 2KK8A 3A4RA 3ECIA 3H1UA 4W9HA 3W1SC 4DHJD 3VFKA 4K7UA 1UELA 3A9KB 2BYFA 4NJ6A 4NNJB 4FJVB 2PE6B 1C3TA 3EFUA 4II3B 4K81A 3VH4B 4G3XB 3A1QA 4XZ4A 1GC7A 3P2BA 4MGIE 3HHMA 2DAJA 3RT3B 1WM3A 3EECA 2LRUA 2BYVE 2RPQA 3AULA 1YD8U 4RM9A 2EKEC 1S3SG 1YIWA 4ASWC 2D2QA 2W9NA 3CSTA 2V1YA 3A4SC 1Z5SB 1WGYA 1Z2MA 2UYZB 4G0NB 3X0WA 3M62B 2L3ZA 2N1WA 3K9OB 4BBNF 4BKSA 3TJPA 2IY0B 1WH3A 3DBHI 2MP2A 2QHOA 2FNJB 1SGHA 2KN5A 3PZDA 4IM3A 4KZCA 5E6PA 4ZRIA 4IW0A 2HD5B 4MGKE 1RLFA 4FJZA 1P0RA 2Z59B 5G55A 3JYUA 3VTWA 3X23A 1PQSA 1EUVB 1H4RA 3IFWB 4NY0A 1E7VA 2JXXA 1WMHA 3IBEA 4HJKA 1WMHB 1WF9A 2D07B 2NPTA 2RR9A 4GGQA 5G2NA 1K8RB 3LJ3A 3JSVA 2V3SA 5J17A 3QA8A 4HCPB 4DHZB 2D3GA 1G6JA 3ML9A 4TV3A 2OOBB 1ZKHA 2I1KA 1WR1A 3H7SA 5AEKB 1AARA 4HDQA 4I6PA 4LJPB 3R7QA 5L83A 4EZLA 1KLVA 4OVUA 2KWVB 2K6QA 2KD0A 1ISNA 3PLVA 4DXAB 3HK0A 3ZTCA 4XC2A 2AL6A 2MSED 1YX6B 3DBLI 2BF8B 1V86A 2MBBB 2KDFB 1UD7A 2FCMA 4B9KA 2KDIA 2MP2B 3PVLA 2L0TA 5LXHA 3ZW3A 3KUZA 1R4NI 2KVRA 3APFA 3UQAA 2B3AA 5C23A 5CHVC 1NBFC 2ZEQA 1T0YA 1NDDA 4BKGA 2DZJA 2CS4A 2MBHA 4BOSC 1WXMA 1E8ZA 3PHXB 4B6WA 5J2RA 3KUDB 4W9EA 1RAXA 5DCNA 2IYDB 3VVWB 2KKCA 3ZNGC 3ZUNA 5LXIB 4ICUA 4JLCA 2JRIB 1A5RA 2KLCA 2M4NA 2L8JA 4ZDVA 3SD5A 2IO0B 3JW0X 3CF6E 3ONSA 5AZGA 2GBRA 4M8NA 4LDTB 3CMMB 3VUXA 3DPDA 4DDGD 3WA0A 3O65B 3A33B 1S1QB 3KYDD 3AU5A 4IWQA 2RD0A 4AWJA 4NAWB 5JZEB 3RZWC 1WGRA 1WJ4A 4M8MA 3ZNID 1OQYA 2LGYA 4P7IA 2LI5A 5D7GA 3WANA 2R2OA 5JH5C 4J6IA 3DVNV 3L13A 4KIKB 3LDZE 3IG3A 1V5OA 3QJZA 4NPNA 3R7RA 3GOEA 2M1MA 1YX5B 3ZNZB 3VUYA 2KC2A 4GOCA 3HM3A 3QHTA 4E3CA 1KM7A 2RGFA 2CU1A 3ALBA 1WR6E 2GBMA 5CX3A 3W1YA 2LGDA 4PS7A 3RULA 2JVCA 3T8MA 2KLGA 3SDLC 2MCNB 3VH3B 2BGFA 3QCAA 4BBNC 2KXJA 2M0XA 3TCAA 2AWTA 3MTNB 4W9DA 3S2AA 4WWNA 2DX5B 1D3ZA 1WRDB 3QX1A 5EDSA 1H8CA 1WJUA 1Y8RC 2K1FA 3WAOA 5KHQA 2N7EA 1GC6A 5JHBA 2FIDA 1LXDA 3JVZX 2JY6A 2KANA 1J8CA 2K39A 2MLBA 3A9KA 2BWES 2BYEA 3VQIA 3ZLZA 1OTRB 2L0FA 1EF1A 2N1VA 4LDTD 3PLUA 1UBIA 2GBKA 3VDZA 3N32A 4ICVA 1E90A 2MQJA 2JWZA 3PHWB 2PE9A 3MHSD 4IWOA 2N9PC 2NBWB 1EF5A 2LD9A 2MRPA 2OJRA 4DHJB 3L0WB 3OJ4B 4WWPA 4AP4C 3DBSA 1WZ3A 2J0MA 3A9JB 5D2MB 1E5WA 4MDKE 4WJNA 2LGXA 4BFRA 1TGZB 3ZDMC 4W9KA 1VCBA 3RYTA 1WX9A 2ZPNA 2LWPA 5AZHA 5BO4B 4FHJA 4NJ7A 1WXAA 4CO7A 3APCA 5CHWA 2KTRA 1V81A 4X57B 3KW5B 3V62A 1BT0A 2FCQA 2MBEA 2A4ZA 3H9DA 4K7SA 3ZKJC 3QIJA 4KSKC 2C7MB 5L95C 3CSFA 4MSQB 2M8SA 4BKSD 2DENB 4MGYE 5DPSA 3D32A 2ZVNA 4JL9A 2AEHA 2K6DB 1WXSA 2G45B 4HK2A 3RUIB 4CYEA 4KDLB 2FIFA 3DOWA 3K9PB 3VXWA 2JT4B 1OEYA 5E6NA 1WE6A 2KFKB 2XBBC 2ZCCA 2GBNA 1GUAB 1WX7A 3L10B 4MELA 5IA7A 3HIZA 3NZSA 3V61A 3RCZA 2KNBA 2C60A 3Q3JA 4GMVA 1E8WA 2LRWA 4II2B 3DVGX 4GSWA 3NOBA 3TIXA 3U30A 1WY8A 2KJHB 2NPTB 3DCGA 4W9JA 4W9LA 2KZRA 1ZGUB 2MW5A 4FN2A 4I6NB 1EO6A 1GNUA 1WI0A 2GMIC 5C1ZA 4BOZB 3L54A 3M3JA 1WJ6A 4DHZE 4G11A 1P3QU 2KWCA 5D6JB 5GMVA 3OLMD 2L76A 4W9IA 5KHOA 2CHXA 3AXCA 3H7PA 2KX0A 4YL8A 1V6EA 4OVVA 1HE8A 3UINB 3GZNI 5TR5A 3PREA 4GDKB 2BPSA 4KVGB 2LASA 4NAWA 2O6VB 4IC7B 1U4AA 4JGHB 4BVUC 4DBGA 2KJRA 3UGBB 1Q1OA 4HPMB 4GIVA 2N4FA 1IP9A 3M95A 4B95A 2K8BA 2DYOA 2KFKA 2KTRB 3QK0A 4GN1A 2G4DB 5DPRA 2J0KA 3C0RB 1RRBA 2LXAA 4I6LB 1F9JA 2LJ5A 2Y5BB 1V9JA 3KVFB 4GDKA 4HCNB 3ZTDA 3WALA 4XX5A 2L7RA 4MSMB 2JUOA 1R4MI 2LZ6A 1V2YA 4MM3A 2KC1A 1M94A 2ASQA 4TQ0A 1ZW7A 2GBJA 1GG3A 3WIMA 2BKFA 1KOTA 2IBIB 2V4LA 4LCDE 4LJOB 3NY5A 3PRPB 1MG8A 2O6VD 3ML8A 1XD3B 2KX3A 4HPLB 1P98A 1KJTA 2G4SA 3VUWA 1JRUA 3I3TB 2DZMA 2C7HA 2XK5A 3ZVVA 4EUTA 4EZJA 1LQBA 2KFJA 3OAWA 5D94A 3AU4A 4CHKA 2YVCA 4HXDA 4MEMA 4M0WB 1XT9B 3PSEB 2D11A 3ENEA 3H6NA 2YLMA 2WDTB 2L00B 1CMXB 2KJ6A 3R3MA 2C5LC 2REXA 2XEWA 2LVPA 4EOYA 1WX8A 4IUMB 2J7QB 4F7ZA 2JZZA 2VRRB 3DQVA 3EHVA 5E6OA 1TTNA 4MJSA 1I35A 3U8ZA 2K25A 1P9DU 2PEAA 3V60A 3ZRFA 3UF8A 2LXCA 2JPHA 2NVUI 4FJYA 4WJPA 3PT2B 2JRHA 1Q0WB 4KSLC 3NHEB 3ZO5B 1GJZA 4AUQC 3OJ3A 3VTVA 1OGWA 2IO3B 4A20A 2LVOA 2HE7A 3NS8A 2WYQA 2IO2B 3TL5A 2FCNA 1WIAA 1WM2A 3BY4B 3EC8A 3N3KB 4GDLB 2J0JA 3DBRI 4PYZA 2EMSA 4HLEA 3NZUA 1WGHA 2O2VB 4WJQA 2PPHA 3N30A 5AZFA 2NS5A 4WQOB 1WE7A 2D10A 2HTHA 4WAAA 2XK5B 2PJHA 1WGDA 2WWZA 3KYCD 2RSUA 4KIKA 4ANXA 4FADA 1YJ1A 2IZVB 4E74A 3PRMB 2A5UA 2NCNA 1SIFA 4IG7B 3PTFC 3IHPC 1L7YA 3UIPB 4ZYNA 3ZIMA 2MWSB 2C7NB 5HKHA 4GXBA 3Q3FA 4RM8A 1IYFA 4A3PA 2C9WB 1P1AA 2BWFA 2CKHB 1UGMA 1XQQA 2I1JA 4FA6A 3L08A 4KZ0A 3AI5A 2WX0A 2DZIA 4IWPA 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD2 A;  5IAA C;  4DK5 A;  1C1Y B;  3VTU A;  1LFD A;  3QQ8 B;  2G3Q B;  2FCS A;  2KQ7 A;  3TBL D;  2R2Q A;  5DPW A;  4AOF A;  2K8C A;  2KDE B;  3DDC B;  4DDI D;  4EEW A;  5JHA A;  2DAF A;  2N7D A;  3TMP B;  2JF5 A;  1OEY J;  2NR2 A;  2JZ3 B;  4ANU A;  4FHK A;  4PYU A;  2KMA A;  4GB9 A;  4MGZ E;  2DYM A;  3H7P B;  2KOX A;  4N9F 4;  4NQK E;  1V49 A;  1WFY A;  4ZRJ A;  2KDB A;  3ZNH B;  3IVF A;  1VD2 A;  3KUC B;  1V80 A;  2KTF A;  1Q5W B;  3PS6 A;  3ZDT A;  5DPT A;  4W9G A;  2KHW B;  2KMC A;  2UWQ A;  3L17 A;  4WJO A;  4ZRK A;  1QZE A;  4KV2 A;  1TZ1 A;  2BKR B;  2MBO A;  5J18 A;  2L05 A;  4W9F A;  1FXT B;  4FLH A;  2ZZP B;  2Z0D B;  3JSV B;  4AJW A;  3ZRC A;  3A1Q B;  4JIO U;  3MJW A;  1L2N A;  1X1M A;  2WX1 A;  2MX2 A;  4PS3 A;  4RMA A;  3WAM A;  1J19 A;  1UBQ A;  2NBU A;  3PGE A;  1TBE A;  3QC8 B;  4EKU A;  1UZX B;  4E71 A;  3PRZ A;  3T9L A;  3DVG Y;  1IPG A;  1SE9 A;  1WXV A;  2K8H A;  2Z0E B;  4FUL A;  4TQ1 A;  3A9J A;  3QWZ B;  3V6C B;  3W1S A;  4TKN A;  2HJ8 A;  2ZJD A;  3APD A;  2ZPY A;  1I42 A;  1LM8 B;  2DYB A;  1E8Y A;  2NBV B;  2ZNV B;  3R66 C;  3WAP A;  2MBQ A;  4G50 A;  5CHF A;  4W9C A;  3B1L X;  2IO1 B;  2EMT A;  4IM0 A;  2ZVO A;  3SU8 X;  2ZNV C;  3VAW A;  4KDI C;  4MH0 E;  4F1S A;  1NI2 A;  2AYO B;  1J0G A;  2GOW A;  2O6V A;  3DVN U;  2ZCB A;  2LUE A;  4ANV A;  1UH6 A;  4BKT A;  3RZF A;  4JQW C;  3V6E B;  4HWI B;  2DZK A;  2CR5 A;  5CTR C;  4TUU A;  1E8X A;  4FBJ B;  3M63 B;  5LLI A;  2DHZ A;  4NQL B;  3B08 A;  1WJN A;  4GDL A;  4MJS B;  3U7D A;  4GU2 A;  4A3O A;  2M17 A;  4ANW A;  4WWO A;  3QAR A;  3PV1 A;  3HM6 X;  3UQB A;  1WZ0 A;  4PS8 A;  2CHW A;  3QAQ A;  2N9E B;  1RFA A;  2N9X A;  2KWU B;  2FUH B;  3VHT C;  2KO3 A;  1YQB A;  2KQS A;  3KH0 A;  4K7W A;  4EZK A;  4URK A;  4IM2 A;  2FAZ A;  4AJY B;  5FR6 A;  3L16 A;  4HDO A;  2AL3 A;  2MA9 B;  2O2V A;  3UIO B;  4DWF A;  4K1R B;  4EFO A;  1WGG A;  3BIN A;  1V5T A;  3PPA A;  1E7U A;  2CHZ A;  2LVQ A;  3SHQ A;  3B0A A;  1WYW B;  4HVB A;  2IY1 B;  2KK8 A;  3A4R A;  3ECI A;  3H1U A;  4W9H A;  3W1S C;  4DHJ D;  3VFK A;  4K7U A;  1UEL A;  3A9K B;  2BYF A;  4NJ6 A;  4NNJ B;  4FJV B;  2PE6 B;  1C3T A;  3EFU A;  4II3 B;  4K81 A;  3VH4 B;  4G3X B;  3A1Q A;  4XZ4 A;  1GC7 A;  3P2B A;  4MGI E;  3HHM A;  2DAJ A;  3RT3 B;  1WM3 A;  3EEC A;  2LRU A;  2BYV E;  2RPQ A;  3AUL A;  1YD8 U;  4RM9 A;  2EKE C;  1S3S G;  1YIW A;  4ASW C;  2D2Q A;  2W9N A;  3CST A;  2V1Y A;  3A4S C;  1Z5S B;  1WGY A;  1Z2M A;  2UYZ B;  4G0N B;  3X0W A;  3M62 B;  2L3Z A;  2N1W A;  3K9O B;  4BBN F;  4BKS A;  3TJP A;  2IY0 B;  1WH3 A;  3DBH I;  2MP2 A;  2QHO A;  2FNJ B;  1SGH A;  2KN5 A;  3PZD A;  4IM3 A;  4KZC A;  5E6P A;  4ZRI A;  4IW0 A;  2HD5 B;  4MGK E;  1RLF A;  4FJZ A;  1P0R A;  2Z59 B;  5G55 A;  3JYU A;  3VTW A;  3X23 A;  1PQS A;  1EUV B;  1H4R A;  3IFW B;  4NY0 A;  1E7V A;  2JXX A;  1WMH A;  3IBE A;  4HJK A;  1WMH B;  1WF9 A;  2D07 B;  2NPT A;  2RR9 A;  4GGQ A;  5G2N A;  1K8R B;  3LJ3 A;  3JSV A;  2V3S A;  5J17 A;  3QA8 A;  4HCP B;  4DHZ B;  2D3G A;  1G6J A;  3ML9 A;  4TV3 A;  2OOB B;  1ZKH A;  2I1K A;  1WR1 A;  3H7S A;  5AEK B;  1AAR A;  4HDQ A;  4I6P A;  4LJP B;  3R7Q A;  5L83 A;  4EZL A;  1KLV A;  4OVU A;  2KWV B;  2K6Q A;  2KD0 A;  1ISN A;  3PLV A;  4DXA B;  3HK0 A;  3ZTC A;  4XC2 A;  2AL6 A;  2MSE D;  1YX6 B;  3DBL I;  2BF8 B;  1V86 A;  2MBB B;  2KDF B;  1UD7 A;  2FCM A;  4B9K A;  2KDI A;  2MP2 B;  3PVL A;  2L0T A;  5LXH A;  3ZW3 A;  3KUZ A;  1R4N I;  2KVR A;  3APF A;  3UQA A;  2B3A A;  5C23 A;  5CHV C;  1NBF C;  2ZEQ A;  1T0Y A;  1NDD A;  4BKG A;  2DZJ A;  2CS4 A;  2MBH A;  4BOS C;  1WXM A;  1E8Z A;  3PHX B;  4B6W A;  5J2R A;  3KUD B;  4W9E A;  1RAX A;  5DCN A;  2IYD B;  3VVW B;  2KKC A;  3ZNG C;  3ZUN A;  5LXI B;  4ICU A;  4JLC A;  2JRI B;  1A5R A;  2KLC A;  2M4N A;  2L8J A;  4ZDV A;  3SD5 A;  2IO0 B;  3JW0 X;  3CF6 E;  3ONS A;  5AZG A;  2GBR A;  4M8N A;  4LDT B;  3CMM B;  3VUX A;  3DPD A;  4DDG D;  3WA0 A;  3O65 B;  3A33 B;  1S1Q B;  3KYD D;  3AU5 A;  4IWQ A;  2RD0 A;  4AWJ A;  4NAW B;  5JZE B;  3RZW C;  1WGR A;  1WJ4 A;  4M8M A;  3ZNI D;  1OQY A;  2LGY A;  4P7I A;  2LI5 A;  5D7G A;  3WAN A;  2R2O A;  5JH5 C;  4J6I A;  3DVN V;  3L13 A;  4KIK B;  3LDZ E;  3IG3 A;  1V5O A;  3QJZ A;  4NPN A;  3R7R A;  3GOE A;  2M1M A;  1YX5 B;  3ZNZ B;  3VUY A;  2KC2 A;  4GOC A;  3HM3 A;  3QHT A;  4E3C A;  1KM7 A;  2RGF A;  2CU1 A;  3ALB A;  1WR6 E;  2GBM A;  5CX3 A;  3W1Y A;  2LGD A;  4PS7 A;  3RUL A;  2JVC A;  3T8M A;  2KLG A;  3SDL C;  2MCN B;  3VH3 B;  2BGF A;  3QCA A;  4BBN C;  2KXJ A;  2M0X A;  3TCA A;  2AWT A;  3MTN B;  4W9D A;  3S2A A;  4WWN A;  2DX5 B;  1D3Z A;  1WRD B;  3QX1 A;  5EDS A;  1H8C A;  1WJU A;  1Y8R C;  2K1F A;  3WAO A;  5KHQ A;  2N7E A;  1GC6 A;  5JHB A;  2FID A;  1LXD A;  3JVZ X;  2JY6 A;  2KAN A;  1J8C A;  2K39 A;  2MLB A;  3A9K A;  2BWE S;  2BYE A;  3VQI A;  3ZLZ A;  1OTR B;  2L0F A;  1EF1 A;  2N1V A;  4LDT D;  3PLU A;  1UBI A;  2GBK A;  3VDZ A;  3N32 A;  4ICV A;  1E90 A;  2MQJ A;  2JWZ A;  3PHW B;  2PE9 A;  3MHS D;  4IWO A;  2N9P C;  2NBW B;  1EF5 A;  2LD9 A;  2MRP A;  2OJR A;  4DHJ B;  3L0W B;  3OJ4 B;  4WWP A;  4AP4 C;  3DBS A;  1WZ3 A;  2J0M A;  3A9J B;  5D2M B;  1E5W A;  4MDK E;  4WJN A;  2LGX A;  4BFR A;  1TGZ B;  3ZDM C;  4W9K A;  1VCB A;  3RYT A;  1WX9 A;  2ZPN A;  2LWP A;  5AZH A;  5BO4 B;  4FHJ A;  4NJ7 A;  1WXA A;  4CO7 A;  3APC A;  5CHW A;  2KTR A;  1V81 A;  4X57 B;  3KW5 B;  3V62 A;  1BT0 A;  2FCQ A;  2MBE A;  2A4Z A;  3H9D A;  4K7S A;  3ZKJ C;  3QIJ A;  4KSK C;  2C7M B;  5L95 C;  3CSF A;  4MSQ B;  2M8S A;  4BKS D;  2DEN B;  4MGY E;  5DPS A;  3D32 A;  2ZVN A;  4JL9 A;  2AEH A;  2K6D B;  1WXS A;  2G45 B;  4HK2 A;  3RUI B;  4CYE A;  4KDL B;  2FIF A;  3DOW A;  3K9P B;  3VXW A;  2JT4 B;  1OEY A;  5E6N A;  1WE6 A;  2KFK B;  2XBB C;  2ZCC A;  2GBN A;  1GUA B;  1WX7 A;  3L10 B;  4MEL A;  5IA7 A;  3HIZ A;  3NZS A;  3V61 A;  3RCZ A;  2KNB A;  2C60 A;  3Q3J A;  4GMV A;  1E8W A;  2LRW A;  4II2 B;  3DVG X;  4GSW A;  3NOB A;  3TIX A;  3U30 A;  1WY8 A;  2KJH B;  2NPT B;  3DCG A;  4W9J A;  4W9L A;  2KZR A;  1ZGU B;  2MW5 A;  4FN2 A;  4I6N B;  1EO6 A;  1GNU A;  1WI0 A;  2GMI C;  5C1Z A;  4BOZ B;  3L54 A;  3M3J A;  1WJ6 A;  4DHZ E;  4G11 A;  1P3Q U;  2KWC A;  5D6J B;  5GMV A;  3OLM D;  2L76 A;  4W9I A;  5KHO A;  2CHX A;  3AXC A;  3H7P A;  2KX0 A;  4YL8 A;  1V6E A;  4OVV A;  1HE8 A;  3UIN B;  3GZN I;  5TR5 A;  3PRE A;  4GDK B;  2BPS A;  4KVG B;  2LAS A;  4NAW A;  2O6V B;  4IC7 B;  1U4A A;  4JGH B;  4BVU C;  4DBG A;  2KJR A;  3UGB B;  1Q1O A;  4HPM B;  4GIV A;  2N4F A;  1IP9 A;  3M95 A;  4B95 A;  2K8B A;  2DYO A;  2KFK A;  2KTR B;  3QK0 A;  4GN1 A;  2G4D B;  5DPR A;  2J0K A;  3C0R B;  1RRB A;  2LXA A;  4I6L B;  1F9J A;  2LJ5 A;  2Y5B B;  1V9J A;  3KVF B;  4GDK A;  4HCN B;  3ZTD A;  3WAL A;  4XX5 A;  2L7R A;  4MSM B;  2JUO A;  1R4M I;  2LZ6 A;  1V2Y A;  4MM3 A;  2KC1 A;  1M94 A;  2ASQ A;  4TQ0 A;  1ZW7 A;  2GBJ A;  1GG3 A;  3WIM A;  2BKF A;  1KOT A;  2IBI B;  2V4L A;  4LCD E;  4LJO B;  3NY5 A;  3PRP B;  1MG8 A;  2O6V D;  3ML8 A;  1XD3 B;  2KX3 A;  4HPL B;  1P98 A;  1KJT A;  2G4S A;  3VUW A;  1JRU A;  3I3T B;  2DZM A;  2C7H A;  2XK5 A;  3ZVV A;  4EUT A;  4EZJ A;  1LQB A;  2KFJ A;  3OAW A;  5D94 A;  3AU4 A;  4CHK A;  2YVC A;  4HXD A;  4MEM A;  4M0W B;  1XT9 B;  3PSE B;  2D11 A;  3ENE A;  3H6N A;  2YLM A;  2WDT B;  2L00 B;  1CMX B;  2KJ6 A;  3R3M A;  2C5L C;  2REX A;  2XEW A;  2LVP A;  4EOY A;  1WX8 A;  4IUM B;  2J7Q B;  4F7Z A;  2JZZ A;  2VRR B;  3DQV A;  3EHV A;  5E6O A;  1TTN A;  4MJS A;  1I35 A;  3U8Z A;  2K25 A;  1P9D U;  2PEA A;  3V60 A;  3ZRF A;  3UF8 A;  2LXC A;  2JPH A;  2NVU I;  4FJY A;  4WJP A;  3PT2 B;  2JRH A;  1Q0W B;  4KSL C;  3NHE B;  3ZO5 B;  1GJZ A;  4AUQ C;  3OJ3 A;  3VTV A;  1OGW A;  2IO3 B;  4A20 A;  2LVO A;  2HE7 A;  3NS8 A;  2WYQ A;  2IO2 B;  3TL5 A;  2FCN A;  1WIA A;  1WM2 A;  3BY4 B;  3EC8 A;  3N3K B;  4GDL B;  2J0J A;  3DBR I;  4PYZ A;  2EMS A;  4HLE A;  3NZU A;  1WGH A;  2O2V B;  4WJQ A;  2PPH A;  3N30 A;  5AZF A;  2NS5 A;  4WQO B;  1WE7 A;  2D10 A;  2HTH A;  4WAA A;  2XK5 B;  2PJH A;  1WGD A;  2WWZ A;  3KYC D;  2RSU A;  4KIK A;  4ANX A;  4FAD A;  1YJ1 A;  2IZV B;  4E74 A;  3PRM B;  2A5U A;  2NCN A;  1SIF A;  4IG7 B;  3PTF C;  3IHP C;  1L7Y A;  3UIP B;  4ZYN A;  3ZIM A;  2MWS B;  2C7N B;  5HKH A;  4GXB A;  3Q3F A;  4RM8 A;  1IYF A;  4A3P A;  2C9W B;  1P1A A;  2BWF A;  2CKH B;  1UGM A;  1XQQ A;  2I1J A;  4FA6 A;  3L08 A;  4KZ0 A;  3AI5 A;  2WX0 A;  2DZI A;  4IWP A;  4F8C B; 
#chains in the Genus database with same CATH topology
 3AEB B;  3RD2 A;  1LGR A;  4JX1 C;  5DPW A;  2E3T A;  2VH1 A;  5JHA A;  2DLB A;  2NR2 A;  2JZ3 B;  3AEE B;  1FNW A;  4MGZ E;  2DYM A;  2KOX A;  4ZRJ A;  1SSN A;  1I4H A;  2RDB C;  2KDB A;  3MFG A;  3BYY B;  3IVF A;  3KUC B;  2V9H A;  1JRP A;  2BKR B;  3KQ4 A;  4W9F A;  2RPV A;  4AJW A;  3A1Q B;  4JIO U;  3MJW A;  1L2N A;  2IDY A;  1X1M A;  1ZDX A;  2MX2 A;  2B76 B;  2NBU A;  2QSD A;  1UZX B;  4E71 A;  3T9L A;  1WWT A;  1SE9 A;  3MJ5 A;  4FUL A;  4KKJ A;  4TQ1 A;  3A9J A;  4C7Y A;  2WXJ A;  3V6C B;  1BXT A;  5G5G A;  2HJ8 A;  3AN1 A;  2QMT A;  2DYB A;  2NBV B;  2MBQ A;  1YMH E;  4G50 A;  3SU8 X;  2ZNV C;  3VAW A;  4KDI C;  3FAH A;  2GOW A;  2O6V A;  2DWQ A;  2WXQ A;  3V6E B;  5CTR C;  2J53 A;  4XWW A;  2DHZ A;  4NQL B;  3U7D A;  1D5Z C;  3N9Y C;  4GDL A;  3AEF B;  2JWU A;  4RCO A;  5H8Y E;  2PLP A;  4NJC A;  3P4P B;  4PS8 A;  1V8C A;  1RFA A;  1VLB A;  3KH0 A;  1TKE A;  1YQ4 B;  4ACF A;  3L16 A;  1VZ7 A;  2AL3 A;  4EFO A;  5EE9 A;  1WGG A;  1YN3 A;  1KRH A;  2KDM A;  1QOA A;  3AE7 B;  1E7U A;  3SHQ A;  4O1N A;  2JXT A;  2IY1 B;  3DWM A;  2LFI A;  1UEL A;  2BYF A;  4FJV B;  1C3T A;  1N5W A;  3VH4 B;  1SF0 A;  3AED B;  2DAJ A;  3RT3 B;  2LRU A;  5D3I B;  4NAM A;  1S3S G;  4ASW C;  3A4S C;  1Z5S B;  3X0W A;  1FMA D;  4BKS A;  2AQ1 B;  2MP2 A;  2KN5 A;  4MGK E;  4FJZ A;  4CO7 A;  5G55 A;  3VTW A;  1E7V A;  3GP7 A;  3Q8C A;  2H89 B;  3LJ3 A;  2OED A;  4MH8 A;  2V3S A;  4LNK A;  3VRB B;  2RMM A;  1G6J A;  1IGD A;  3FIL A;  1ZKH A;  1PFD A;  2V0G A;  3R7Q A;  5MPO A;  2KWV B;  2K6Q A;  1ISN A;  1TJE A;  4DXA B;  5LNK 1;  3ZTC A;  4XC2 A;  2AL6 A;  1CQV A;  1HA5 A;  1T6B X;  1UD7 A;  4B9K A;  3ZW3 A;  1R4N I;  5CHV C;  1NDD A;  4BOS C;  4B6W A;  3N1X C;  2M4N A;  2L8J A;  2DBY A;  2GBR A;  4M8N A;  1VDV A;  4LDT B;  1ZOY B;  2QJL A;  2OHF A;  3A33 B;  1S1Q B;  3KYD D;  4IWQ A;  4NAW B;  1OQY A;  2LGY A;  1UNS A;  2JX5 A;  5D7G A;  1D5M C;  1N63 A;  3N20 C;  5TSS A;  1TKY A;  4KIK B;  4IDI A;  2PMV A;  1T3Q A;  1V5O A;  3NG0 A;  4A55 A;  3ZNZ B;  2BS2 B;  1DOX A;  4GOC A;  4RGM A;  3AEC B;  4REZ A;  2K9X A;  4PS7 A;  2SEB D;  3LXF A;  4HRO A;  3MP9 A;  2WXR A;  1SE4 A;  2PKO A;  2JQR B;  4XDC A;  3TCA A;  3PZ7 A;  3B2G A;  5EDS A;  1WJU A;  1Y8R C;  2K1F A;  5KHQ A;  1N60 A;  1T5X D;  2JY6 A;  2KAN A;  2ZW0 A;  2BWE S;  3ZLZ A;  2N1V A;  1EF1 A;  3PLU A;  3VDZ A;  2PE9 A;  3MHZ A;  1CZP A;  3RNB C;  4DHJ B;  3ZYY X;  2OJW A;  4WIP A;  4AP4 C;  3DBS A;  1QT9 A;  4YXD B;  2LGX A;  1FIQ A;  3Q3M C;  1WYG A;  3Q8B A;  5BO4 B;  1UWX A;  3AE2 B;  3BK2 A;  2LUM A;  1P7E A;  4NJ7 A;  2Q5W D;  3V62 A;  1BT0 A;  1MI0 A;  3BVG A;  4MSQ B;  3WCQ A;  3RNG C;  2ZVN A;  4NZL B;  2K6D B;  1WXS A;  4KDL B;  1D6E C;  2JT4 B;  5D3D A;  1OEY A;  3UI3 A;  3Q14 C;  4MEL A;  4M02 A;  2WXG A;  3RCZ A;  4A8X C;  4LNI A;  3DVG X;  2V4I B;  4W9J A;  4C80 A;  2MW5 A;  1WI0 A;  5C1Z A;  3DWG C;  2HDE A;  2WDV B;  3GS2 A;  4S0R A;  4G11 A;  3NVY A;  3AE5 B;  1P3Q U;  5D6J B;  1SXT A;  3AXC A;  4YL8 A;  4OVV A;  1E7P B;  1TZO A;  3B2F A;  4KVG B;  4IC7 B;  4BVU C;  4DBG A;  2GB1 A;  2QCZ A;  4MM3 B;  3C8Y A;  1TS4 A;  1C78 A;  2KFK A;  2BS4 B;  1RRB A;  2LXA A;  4I6L B;  2LJ5 A;  2JUO A;  3W5U B;  5AUI A;  2KC1 A;  3BII D;  4RNA A;  2BKF A;  2IBI B;  2AX5 A;  3PRP B;  3ML8 A;  2KWD A;  4HPL B;  1KJT A;  3SEB A;  1VZ8 A;  2R61 A;  2XK5 A;  4EUT A;  4N59 A;  1JWA D;  1LQB A;  2KFJ A;  3OAW A;  1QOF A;  4M0W A;  4M01 A;  3RN9 C;  1B1Z A;  2L00 B;  2KJ6 A;  3R3M A;  2GRI A;  4UDU C;  1FNU A;  1WX8 A;  1MPE A;  1FD6 A;  1OQQ A;  4IUM B;  5T8I A;  2J7Q B;  3DQV A;  1I35 A;  2N0S B;  4JPS A;  1TTN A;  4MJS A;  3U8Z A;  1VZ6 A;  3UF8 A;  2NVU I;  2JPH A;  2W54 A;  4KSL C;  1GJZ A;  4AUQ C;  3VTV A;  2WYQ A;  1WIA A;  2WQY B;  1WGH A;  2O2V B;  2INN E;  4XWT A;  2ICI A;  1IUE A;  2XK5 B;  3AM9 A;  3KYC D;  2RSU A;  3P4R B;  1RFK A;  4BAX A;  4IG7 B;  3IHP C;  4ZYN A;  2C7N B;  3EA6 A;  3Q3F A;  1XLN A;  4RM8 A;  1GAQ B;  4YSX B;  4ITK A;  2BWF A;  2BQQ A;  2BYT A;  1ZXI A;  1UGM A;  1XQQ A;  3RNF C;  2DZI A;  1KH0 A;  5IAA C;  2IGH A;  2G3Q B;  2FCS A;  4EEW A;  2J42 A;  5FKA C;  1OEY J;  2J4X A;  4ANU A;  1J7A A;  4FHK A;  1HEZ E;  3HVZ A;  3DHH C;  4N9F 4;  3ZNH B;  1KLU D;  1V80 A;  3ZDT A;  5DPT A;  1FO4 A;  1CK1 A;  1KFY B;  4YTN B;  2MBO A;  3Q69 A;  4A90 A;  3MC8 A;  2L05 A;  1HTQ A;  4FLH A;  2EKI A;  3JSV B;  3U52 E;  3ZRC A;  4PS3 A;  4EKU A;  1E6E B;  3P1M A;  3PRZ A;  1OFF A;  3DVG Y;  3NZ3 A;  1NEN B;  2Z0E B;  1TS2 A;  3Q8F A;  4ZRQ A;  4TKN A;  4OZB A;  1I42 A;  1LM8 B;  1N5X A;  4H2A A;  1E8Y A;  3WAP A;  1C4C A;  2JZP A;  4C56 C;  2BBC A;  2L83 A;  1HZ6 A;  4L1B A;  3Q6B A;  1NI2 A;  3DVN U;  2GI9 A;  4L2Y A;  1FPY A;  2K5P A;  1UH6 A;  2G9H D;  4HWI B;  2CR5 A;  1MVK A;  1TY0 A;  2JSV X;  2X8X X;  4XE0 A;  3FKY A;  4GU2 A;  2M17 A;  5AUK A;  3HM6 X;  1WZ0 A;  2N9X A;  3VHT C;  1SIJ A;  2KQS A;  3CWI A;  2LHD A;  5FR6 A;  2JU6 X;  1XCQ L;  4XYC A;  2MA9 B;  5GXG B;  5JXV A;  3NVW A;  4LLG M;  3PPA A;  3BK1 A;  2LVQ A;  1YNT E;  3B0A A;  1WYW B;  4HVB A;  4PT5 A;  4DHJ D;  2WHI A;  1C4P A;  1WRI A;  4NNJ B;  4NJ6 A;  2PE6 B;  1UWM A;  1F2R I;  4XZ4 A;  3HHM A;  1WM3 A;  1WSP A;  2D2Q A;  2W9N A;  5BMI A;  4P1C C;  3TEW A;  4B0M A;  2L3Z A;  4S17 A;  2N1W A;  1XEE A;  3TJP A;  3Q3O C;  1ENF A;  3DBH I;  1FEH A;  2FNJ B;  4KZC A;  5E6P A;  1RLF A;  1P0R A;  1PQS A;  1H4R A;  4NY0 A;  2QC8 A;  2QDF A;  1ROE A;  1WMH A;  3IBE A;  1WF9 A;  2NPT A;  1MFW A;  5BMH A;  5J17 A;  4HCP B;  1TS3 A;  2D3G A;  2Z8L A;  3ML9 A;  3NJT A;  3URY A;  3V3X A;  3RPF C;  1TS5 A;  1AAR A;  1PYW D;  3NVZ A;  4OVU A;  3HVD A;  2K0P A;  3HK0 A;  2MSE D;  2D3C A;  1F52 A;  1V86 A;  2MBB B;  1ET9 A;  1AW7 A;  4ZHO A;  1TKG A;  4K3B A;  2I2Y A;  5LXH A;  1STE A;  5C23 A;  3IT4 B;  1NBF C;  2KAC A;  1T0Y A;  2WXM A;  4BKG A;  2DZJ A;  1TY2 A;  1WXM A;  4JWU C;  3KUD B;  5DCN A;  3VVW B;  2KKC A;  5LXI B;  1V1P B;  4JLC A;  1MJD A;  2MJ3 A;  3TEZ A;  4RH6 A;  3ONS A;  5BYQ A;  3DPD A;  4DDG D;  3O65 B;  1NYR A;  3KWV A;  1WJ4 A;  2W3R A;  1N6Z A;  2LI5 A;  3AE3 B;  4DXF A;  3L13 A;  3AEG B;  3GOE A;  1YX5 B;  2N9L A;  3VUY A;  2KC2 A;  1VRA B;  3IXS A;  2RGF A;  2CU1 A;  1WR6 E;  5G5H A;  3W1Y A;  2JVC A;  5EE3 A;  4ZHP A;  2KLG A;  3SDL C;  2MCN B;  3VH3 B;  2BGF A;  3QCA A;  4BBN C;  1GOZ A;  2KXJ A;  2M0X A;  3GB1 A;  4MT5 A;  3S2A A;  5I4D A;  1D3Z A;  1WRD B;  1XLQ A;  3QX1 A;  3W2D A;  1H8C A;  4PK1 A;  2W3S A;  3T3N A;  3WAO A;  1QQR A;  1RYJ A;  4P6V F;  3JVZ X;  2K39 A;  1OTR B;  2L0F A;  4OZA A;  1UBI A;  1E90 A;  3PHW B;  1R4N B;  3MHS D;  4IWO A;  2N9P C;  2NBW B;  2L32 A;  1HQR D;  1KF6 B;  2MRP A;  4YT0 B;  3L0W B;  4WWP A;  3TUO A;  2AQ3 B;  1MG4 A;  1WZ3 A;  2J0M A;  1R7S A;  4WJN A;  4BFR A;  3ZDM C;  1DOI A;  1VCB A;  1WX9 A;  2LWP A;  2W82 A;  3W5V B;  3DHI C;  4FHJ A;  2Y5P A;  5CHW A;  1JCK B;  1UGJ A;  1AWD A;  2MBE A;  4F1S A;  3QIJ A;  2XN9 C;  2WGS A;  3CSF A;  4LNN A;  2DEN B;  4MGY E;  3D32 A;  4JL9 A;  2AEH A;  4CYE A;  2G45 B;  1SE3 A;  1SEB D;  3VXW A;  2FIF A;  2XBB C;  2GBN A;  2G1E A;  3L10 B;  4YTP B;  4P16 A;  4GSW A;  1YN5 A;  2IGG A;  2NPT B;  4I6N B;  2LHE A;  1EO6 A;  1XO3 A;  2GMI C;  4BOZ B;  3M3J A;  2KWC A;  5GMV A;  1PDX A;  3BYT B;  2KX0 A;  3UIN B;  3GZN I;  3PRE A;  4GDK B;  2BPS A;  4AQ7 A;  1Y56 A;  4NAW A;  1I7H A;  3AV8 A;  2KJR A;  1ESF A;  4HPM B;  4GIV A;  3M95 A;  5EE0 A;  4B95 A;  1UUP A;  2WXF A;  2DYO A;  3QK0 A;  2J0K A;  1T0R C;  2HTM E;  3VR8 B;  3WAL A;  4OZC A;  2BS3 B;  1FCC C;  2LZ6 A;  4MM3 A;  3HRD D;  4TQ0 A;  1ZW7 A;  2INC C;  2GBJ A;  1GG3 A;  1YQ3 B;  3WIM A;  1VR9 A;  3NY5 A;  1DGJ A;  1XD3 B;  4HJG E;  1P98 A;  1JRU A;  2WXP A;  2DZM A;  2C7H A;  3ZVV A;  2YVC A;  3EFC A;  4HXD A;  4CQN A;  4MEM A;  4M0W B;  1QIL A;  3PSE B;  3I5J C;  2D11 A;  1JWM D;  3ETR A;  3ENE A;  4OHJ A;  3DBH B;  2WDT B;  1CMX B;  3VR9 B;  4FXC A;  2XEW A;  3CIR B;  2JZZ A;  2VRR B;  1RM6 C;  2PEA A;  4QAY A;  4FJY A;  2DNF A;  2JRH A;  4WAF A;  2IO3 B;  2HE7 A;  3NS8 A;  3TL5 A;  2FCN A;  4HLE A;  3NZU A;  1E9M A;  3AE9 B;  2SAK A;  2RDG A;  4WQO B;  1WE7 A;  4WAA A;  1C4A A;  2WWZ A;  4KIK A;  1YJ1 A;  2IZV B;  3UIP B;  1JQ4 A;  3ZIM A;  2MWS B;  5HKH A;  2PIA A;  1IYF A;  4A3P A;  2C9W B;  1P1A A;  5IN7 A;  2CKH B;  3DBR B;  4FA6 A;  3L08 A;  2KN4 A;  2WX0 A;  4RGO S;  3VTU A;  1DOY A;  1PGX A;  1LFD A;  3QQ8 B;  4LNO A;  1N61 A;  2KQ7 A;  3TBL D;  2R2Q A;  4AOF A;  2K8C A;  2M0A A;  3DDC B;  3P4Q B;  4DDI D;  1C79 A;  3TMP B;  4HRS A;  2MJD A;  4L23 A;  3E9S A;  3RNE C;  1I4Q A;  2KHW B;  2KMC A;  2LGI A;  3N1Z C;  1TYG B;  4A9A A;  4WJO A;  4KV2 A;  1TZ1 A;  2MJE A;  1YJJ A;  2HJ1 A;  1HTO A;  2WX1 A;  4RMA A;  3WAM A;  1J19 A;  1UBQ A;  2GLS A;  1I4R A;  3QWZ B;  5C3J B;  2BB5 A;  2ZPY A;  1L6V A;  3IT6 B;  2WS3 B;  3R66 C;  3I57 A;  4W9C A;  1V97 A;  2EMT A;  1XF5 L;  2ZVO A;  3L4P A;  4YSY B;  5IO9 A;  1IGC A;  2MEK A;  2ZCB A;  2K22 A;  4ANV A;  3RZF A;  1E10 A;  2DZK A;  2L52 A;  2N9K A;  4TUU A;  1E8X A;  4FBJ B;  5LLI A;  1SJH D;  3B08 A;  1WJN A;  4MJS B;  4US9 A;  4A3O A;  3GE8 C;  1FM0 D;  4ANW A;  1ZDV A;  4WWO A;  3QAR A;  3UQB A;  3ZJU A;  2KO3 A;  1HXY D;  4IM2 A;  2FAZ A;  4HDO A;  1RWS A;  4K1R B;  3ECI A;  3H1U A;  4W9H A;  1PGB A;  3SR6 A;  3VFK A;  3EFU A;  4II3 B;  4G3X B;  1I4P A;  3SFD B;  1GC7 A;  3P2B A;  4MGI E;  3RMK C;  3PO0 A;  4OVZ A;  3AUL A;  1YD8 U;  3EGR A;  4RM9 A;  2EKE C;  3V05 A;  2V1Y A;  1WGY A;  2UYZ B;  4G0N B;  3LYY A;  3U4E G;  2IY0 B;  3AB5 A;  1WH3 A;  4KKI A;  1NVI D;  2QHO A;  1FFV A;  3DHG C;  1SGH A;  1KTK A;  4IM3 A;  4ZRI A;  2Z59 B;  3IFW B;  1EUV B;  2VZK B;  4YSZ B;  2JXX A;  4HJK A;  1WMH B;  2RR9 A;  5G2N A;  4GGQ A;  1K8R B;  2JYE A;  3R2I A;  1ZXH A;  2ZW1 A;  2D5G A;  2OOB B;  2I1K A;  3OG5 A;  1WR1 A;  3H7S A;  5AEK B;  2KQ4 X;  4Q2J A;  4HDQ A;  4KGR A;  4I6P A;  4LJP B;  5L83 A;  2KD0 A;  4ARI A;  1YX6 B;  3DBL I;  2BF8 B;  2WP9 B;  3R2T A;  2KDF B;  2FCM A;  2KDI A;  2MP2 B;  1NYQ A;  3APF A;  4JE3 B;  5IKC M;  3FC4 A;  1SE2 A;  5H92 C;  2CS4 A;  3BWU D;  3RFZ B;  2M19 A;  1E8Z A;  1RAX A;  2IYD B;  4ICU A;  3GZN B;  4WUR A;  2X38 A;  2KLC A;  4MAC A;  4LNF A;  2IO0 B;  3JW0 X;  4TMA B;  2KMM A;  3CF6 E;  3KLS X;  5AZG A;  3CMM B;  3WA0 A;  3AU5 A;  2RD0 A;  5JZE B;  3RZW C;  4M8M A;  3ZNI D;  3AE6 B;  4C4V A;  3WAN A;  5JH5 C;  4J6I A;  3DVN V;  4KX6 B;  2ACZ B;  3LDZ E;  3FIL B;  2M1M A;  3Q2A C;  4E3C A;  3R8B A;  5CX3 A;  2LGD A;  1EWY C;  3T8M A;  1NI3 A;  1ET6 A;  5FR3 A;  2AWT A;  3MTN B;  3O13 A;  4W9D A;  1XLP A;  2N7E A;  2YEP F;  1GC6 A;  2FID A;  3ZQ4 A;  2MLB A;  3A9K A;  1FRD A;  3T3O A;  2GBK A;  3IAS 1;  3N32 A;  5FK9 C;  2LD9 A;  1R4M B;  1L6U A;  2OJR A;  1FCL A;  1ZP0 B;  3OJ4 B;  1F2R C;  4RF1 A;  3A9J B;  4MDK E;  1TGZ B;  2L1A A;  2ZPN A;  3APC A;  1SJE D;  2KTR A;  4USA A;  3BVM A;  3KW5 B;  1F1H A;  5L95 C;  2A4Z A;  2C7M B;  2WDQ B;  1P7F A;  2LJI A;  4BKS D;  4C4V B;  4KGT A;  4HK2 A;  3K9P B;  5E6N A;  1WE6 A;  2KFK B;  1WX7 A;  5IA7 A;  3HIZ A;  3NZS A;  2KNB A;  1I4G A;  2J52 A;  2C60 A;  3Q3J A;  1FNV A;  2LRW A;  4II2 B;  3TEY A;  3NOB A;  3U30 A;  1WY8 A;  2KZR A;  1WJ6 A;  4DHZ E;  1QKZ A;  5BYR A;  4W9I A;  3Q3N C;  3H7P A;  1CJE A;  5TR5 A;  1DYQ A;  2O6V B;  1U4A A;  4JGH B;  3ZJT A;  3UGB B;  1IP9 A;  3TSS A;  4N58 A;  3P4S B;  3ZJV A;  3EUB 2;  4HPP A;  4GDK A;  3ZTD A;  4JWS C;  4XX5 A;  4MSM B;  1V2Y A;  3ZXV A;  3IAM 1;  2BB6 A;  1M94 A;  2H88 B;  2ASQ A;  1HZ5 A;  2LMC A;  1KOT A;  2V4L A;  1V1P A;  2ON8 A;  1MG8 A;  1FXA A;  3VUW A;  3I3T B;  3I63 C;  4EZJ A;  2CJN A;  2WDR B;  2E6X A;  4CHK A;  4HKZ E;  1XT9 B;  3H6N A;  1EU4 A;  2YLM A;  2NTT A;  3B9J A;  3ZXR A;  2UU7 A;  3RNA C;  3EHV A;  1F0Z A;  3V60 A;  3ZRF A;  2LXC A;  4WJP A;  1Q0W B;  3NHE B;  2WXO A;  3HUI A;  4A20 A;  1OGW A;  2LVO A;  1C77 A;  2IO2 B;  2JYT A;  1GB1 A;  4PYZ A;  2EMS A;  1SBB B;  4RF0 A;  4WJQ A;  4ZRP A;  3N30 A;  2NS5 A;  2HTH A;  4ANX A;  1WGD A;  4FAD A;  1JWS D;  5IOI A;  2VH2 A;  4E74 A;  3PRM B;  2NCN A;  1SIF A;  1L7Y A;  2WXH A;  4GXB A;  4RGN A;  3ABV B;  3BVZ A;  4KZ0 A;  4IWP A;  4DK5 A;  1C1Y B;  1PUT A;  2AQ2 B;  3TEX A;  1L0X B;  3MC0 B;  1K52 A;  2KDE B;  4KGS A;  2FUG 1;  2DAF A;  2N7D A;  2JF5 A;  2WNM A;  1NEK B;  4PYU A;  2KMA A;  4GB9 A;  3H7P B;  4NQK E;  1V49 A;  1WFY A;  3PS6 A;  1VD2 A;  2KTF A;  1Q5W B;  4W9G A;  2UWQ A;  1QOG A;  3L17 A;  4ZRK A;  1QZE A;  1GB4 A;  4C00 A;  4C7Z A;  5J18 A;  1FXT B;  1AN8 A;  2ZZP B;  2Z0D B;  2NMQ A;  3PGE A;  2MHJ A;  1TBE A;  3QC8 B;  3W9C B;  1IPG A;  1WXV A;  2IND C;  2K8H A;  1TIF A;  3W1S A;  2ZJD A;  3APD A;  1FRR A;  2WXL A;  2ZNV B;  5CHF A;  3Q8A A;  3B1L X;  2IO1 B;  4IM0 A;  4MH0 E;  2AYO B;  1J0G A;  2QIL A;  2BW2 A;  2Y3A A;  3Q8E A;  2LUE A;  4EE2 A;  1XLO A;  1PGA A;  3U2S C;  4BKT A;  4JQW C;  3M63 B;  2IPK D;  1L0Y B;  4LK0 M;  3U7Z A;  3PV1 A;  1EWC A;  2CHW A;  3QAQ A;  2INP E;  2N9E B;  2FE8 A;  2FUH B;  2KWU B;  4K7W A;  1YQB A;  4URK A;  3DBL B;  4EZK A;  2YEP B;  2VZK D;  4A6Q A;  4AJY B;  1OQR A;  2EEL A;  2O2V A;  3UIO B;  4DWF A;  3BIN A;  2RDH A;  1V5T A;  4B0E A;  2CHZ A;  2KK8 A;  3A4R A;  3H8H A;  3W1S C;  2KYW A;  4K7U A;  3A9K B;  4K81 A;  1MHX A;  5HI1 A;  3A1Q A;  3P63 A;  1SB3 C;  1C76 A;  3EEC A;  2WXN A;  2BYV E;  2RPQ A;  2PVO D;  1FFU A;  1V1O A;  1VJK A;  1YIW A;  4ZOH C;  2QEJ C;  3CST A;  1T0Q C;  1Z2M A;  5HFY A;  3M62 B;  3NRZ A;  3K9O B;  4BBN F;  2LGS A;  4N6E B;  1JWU D;  2FBW B;  4HKQ A;  1UF0 A;  3PZD A;  4IOI E;  3VRA B;  1EU3 A;  1EM7 A;  4IW0 A;  2HD5 B;  3JYU A;  3X23 A;  2WXI A;  1J7C A;  2D07 B;  1B9R A;  1GPX A;  3NS1 A;  3JSV A;  3QA8 A;  3NVV A;  4DHZ B;  4TV3 A;  1L4D B;  4EZL A;  2WU5 B;  1KLV A;  3PZ8 A;  1K51 A;  3AE1 B;  2K3U A;  3PLV A;  2V3P A;  3AMZ A;  2MH7 A;  2CU3 A;  2ONQ A;  3PVL A;  2L0T A;  1WGK A;  3KUZ A;  2KVR A;  3UQA A;  2B3A A;  2KT7 A;  4M00 A;  2ZEQ A;  2WU2 B;  1JML A;  2MBH A;  4R3D A;  1JWB D;  1M4V A;  3PHX B;  4RGT A;  3AEA B;  5J2R A;  4W9E A;  3ZNG C;  1C9F A;  1YOV B;  3ZUN A;  1BML C;  2JRI B;  1A5R A;  5EE1 A;  4ZDV A;  3SD5 A;  4LTU A;  4IKG A;  2W55 A;  3KWL A;  3VUX A;  1L5P A;  2V3N A;  4TSS A;  3RNC C;  4AWJ A;  1WGR A;  1QLB B;  3RI7 C;  4P7I A;  2R2O A;  3IG3 A;  3QJZ A;  4XDD A;  4NPN A;  3R7R A;  3I9V 1;  3HM3 A;  4YWG G;  3QHT A;  3MC9 A;  1KM7 A;  3NUH B;  3ALB A;  3AE4 B;  2GBM A;  3OWE B;  5E6J A;  3RUL A;  1IBX A;  2D3A A;  3J9C A;  4GLS C;  3AE8 B;  1AYF A;  4WWN A;  2DX5 B;  1BUI C;  1I4X A;  2NTS A;  1QOB A;  1FXI A;  5JHB A;  2LEK A;  1LXD A;  2Y5C A;  1J8C A;  2BYE A;  1K53 A;  3VQI A;  2PW9 A;  4LDT D;  1YJI A;  4ICV A;  2MQJ A;  2JWZ A;  1ZUD 2;  1EF5 A;  1T0S C;  2CJO A;  3GE3 C;  2N7J A;  1XCT L;  5D2M B;  4BZA A;  1E5W A;  4HEA 1;  1QF6 A;  4W9K A;  3RYT A;  1Q10 A;  5AZH A;  4ZYS A;  2IJ0 A;  3C19 A;  1WXA A;  1V81 A;  4X57 B;  2FCQ A;  3H9D A;  4K7S A;  3ZKJ C;  4KSK C;  2IGD A;  1IBX B;  1A70 A;  2KAJ A;  1XXG A;  2M8S A;  2M56 B;  5DPS A;  3ZGZ A;  3RUI B;  3DOW A;  1ACC A;  2ZCC A;  5BMG A;  1GUA B;  2PVG C;  1JAL A;  3V61 A;  2WXK A;  4D2K A;  1KLG D;  4GMV A;  1E8W A;  2BVC A;  3SFE B;  3TIX A;  2KJH B;  3DCG A;  4W9L A;  1ZGU B;  4FN2 A;  1GNU A;  2BT6 A;  3L54 A;  4RFB A;  2TSS A;  2WLB A;  2BTE A;  1ZPS A;  4ARC A;  4XGA B;  3OLM D;  2L76 A;  5KHO A;  2CHX A;  1V6E A;  1JRO A;  1HE8 A;  5BYS A;  1F77 A;  2LAS A;  4OW0 A;  4K3C A;  1Q1O A;  2N4F A;  1E0Z A;  2K8B A;  4P1B C;  4GN1 A;  2KTR B;  5DPR A;  2G4D B;  4WH4 A;  3C0R B;  1F9J A;  2QIE B;  2Y5B B;  1V9J A;  3KVF B;  4HCN B;  2L7R A;  4US8 A;  1R4M I;  4J3O D;  3P42 A;  3E56 A;  3LB8 C;  4LCD E;  4LJO B;  1L0V B;  2O6V D;  2KX3 A;  5HHD G;  2G4S A;  1JW9 D;  1ZE3 D;  1LO5 D;  5D94 A;  3AU4 A;  3N1Y C;  1WXQ A;  3BZD B;  5IP4 D;  2C5L C;  2REX A;  2LVP A;  2D3B A;  4EOY A;  4F7Z A;  5E6O A;  4WQM A;  4YTM B;  2K25 A;  2PTL A;  1P9D U;  5C2T B;  4DQO C;  3PT2 B;  1N62 A;  3ZO5 B;  1L4Z B;  3AH7 A;  3OJ3 A;  1D5X C;  1WM2 A;  3BY4 B;  3EC8 A;  3N3K B;  4GDL B;  2J0J A;  3DBR I;  2PPH A;  5AZF A;  2D10 A;  2PJH A;  2I38 A;  2XNA C;  2A5U A;  1J7B A;  1MHH E;  3PTF C;  5HG2 A;  1TT5 B;  4AS1 A;  1K50 A;  1YN4 A;  2KVZ A;  4DXG A;  1D4B A;  4WWM A;  2I1J A;  3AI5 A;  4F8C B; 
#chains in the Genus database with same CATH homology
 3RD2 A;  5IAA C;  4DK5 A;  1C1Y B;  3VTU A;  1LFD A;  3QQ8 B;  2G3Q B;  2FCS A;  2KQ7 A;  3TBL D;  2R2Q A;  5DPW A;  4AOF A;  2K8C A;  2KDE B;  3DDC B;  4DDI D;  4EEW A;  5JHA A;  2DAF A;  2N7D A;  3TMP B;  2JF5 A;  1OEY J;  2NR2 A;  2JZ3 B;  4ANU A;  4FHK A;  4PYU A;  2KMA A;  4GB9 A;  4MGZ E;  2DYM A;  3H7P B;  2KOX A;  4N9F 4;  4NQK E;  1V49 A;  1WFY A;  4ZRJ A;  2KDB A;  3ZNH B;  3IVF A;  1VD2 A;  3KUC B;  1V80 A;  2KTF A;  1Q5W B;  3PS6 A;  3ZDT A;  5DPT A;  4W9G A;  2KHW B;  2KMC A;  2UWQ A;  3L17 A;  4WJO A;  4ZRK A;  1QZE A;  4KV2 A;  1TZ1 A;  2BKR B;  2MBO A;  5J18 A;  2L05 A;  4W9F A;  1FXT B;  4FLH A;  2ZZP B;  2Z0D B;  3JSV B;  4AJW A;  3ZRC A;  3A1Q B;  4JIO U;  3MJW A;  1L2N A;  1X1M A;  2WX1 A;  2MX2 A;  4PS3 A;  4RMA A;  3WAM A;  1J19 A;  1UBQ A;  2NBU A;  3PGE A;  1TBE A;  3QC8 B;  4EKU A;  1UZX B;  4E71 A;  3PRZ A;  3T9L A;  3DVG Y;  1IPG A;  1SE9 A;  1WXV A;  2K8H A;  2Z0E B;  4FUL A;  4TQ1 A;  3A9J A;  3QWZ B;  3V6C B;  3W1S A;  4TKN A;  2HJ8 A;  2ZJD A;  3APD A;  2ZPY A;  1I42 A;  1LM8 B;  2DYB A;  1E8Y A;  2NBV B;  2ZNV B;  3R66 C;  3WAP A;  2MBQ A;  4G50 A;  5CHF A;  4W9C A;  3B1L X;  2IO1 B;  2EMT A;  4IM0 A;  2ZVO A;  3SU8 X;  2ZNV C;  3VAW A;  4KDI C;  4MH0 E;  4F1S A;  1NI2 A;  2AYO B;  1J0G A;  2GOW A;  2O6V A;  3DVN U;  2ZCB A;  2LUE A;  4ANV A;  1UH6 A;  4BKT A;  3RZF A;  4JQW C;  3V6E B;  4HWI B;  2DZK A;  2CR5 A;  5CTR C;  4TUU A;  1E8X A;  4FBJ B;  3M63 B;  5LLI A;  2DHZ A;  4NQL B;  3B08 A;  1WJN A;  4GDL A;  4MJS B;  3U7D A;  4GU2 A;  4A3O A;  2M17 A;  4ANW A;  4WWO A;  3QAR A;  3PV1 A;  3HM6 X;  3UQB A;  1WZ0 A;  4PS8 A;  2CHW A;  3QAQ A;  2N9E B;  1RFA A;  2N9X A;  2KWU B;  2FUH B;  3VHT C;  2KO3 A;  1YQB A;  2KQS A;  3KH0 A;  4K7W A;  4EZK A;  4URK A;  4IM2 A;  2FAZ A;  4AJY B;  5FR6 A;  3L16 A;  4HDO A;  2AL3 A;  2MA9 B;  2O2V A;  3UIO B;  4DWF A;  4K1R B;  4EFO A;  1WGG A;  3BIN A;  1V5T A;  3PPA A;  1E7U A;  2CHZ A;  2LVQ A;  3SHQ A;  3B0A A;  1WYW B;  4HVB A;  2IY1 B;  2KK8 A;  3A4R A;  3ECI A;  3H1U A;  4W9H A;  3W1S C;  4DHJ D;  3VFK A;  4K7U A;  1UEL A;  3A9K B;  2BYF A;  4NJ6 A;  4NNJ B;  4FJV B;  2PE6 B;  1C3T A;  3EFU A;  4II3 B;  4K81 A;  3VH4 B;  4G3X B;  3A1Q A;  4XZ4 A;  1GC7 A;  3P2B A;  4MGI E;  3HHM A;  2DAJ A;  3RT3 B;  1WM3 A;  3EEC A;  2LRU A;  2BYV E;  2RPQ A;  3AUL A;  1YD8 U;  4RM9 A;  2EKE C;  1S3S G;  1YIW A;  4ASW C;  2D2Q A;  2W9N A;  3CST A;  2V1Y A;  3A4S C;  1Z5S B;  1WGY A;  1Z2M A;  2UYZ B;  4G0N B;  3X0W A;  3M62 B;  2L3Z A;  2N1W A;  3K9O B;  4BBN F;  4BKS A;  3TJP A;  2IY0 B;  1WH3 A;  3DBH I;  2MP2 A;  2QHO A;  2FNJ B;  1SGH A;  2KN5 A;  3PZD A;  4IM3 A;  4KZC A;  5E6P A;  4ZRI A;  4IW0 A;  2HD5 B;  4MGK E;  1RLF A;  4FJZ A;  1P0R A;  2Z59 B;  5G55 A;  3JYU A;  3VTW A;  3X23 A;  1PQS A;  1EUV B;  1H4R A;  3IFW B;  4NY0 A;  1E7V A;  2JXX A;  1WMH A;  3IBE A;  4HJK A;  1WMH B;  1WF9 A;  2D07 B;  2NPT A;  2RR9 A;  4GGQ A;  5G2N A;  1K8R B;  3LJ3 A;  3JSV A;  2V3S A;  5J17 A;  3QA8 A;  4HCP B;  4DHZ B;  2D3G A;  1G6J A;  3ML9 A;  4TV3 A;  2OOB B;  1ZKH A;  2I1K A;  1WR1 A;  3H7S A;  5AEK B;  1AAR A;  4HDQ A;  4I6P A;  4LJP B;  3R7Q A;  5L83 A;  4EZL A;  1KLV A;  4OVU A;  2KWV B;  2K6Q A;  2KD0 A;  1ISN A;  3PLV A;  4DXA B;  3HK0 A;  3ZTC A;  4XC2 A;  2AL6 A;  2MSE D;  1YX6 B;  3DBL I;  2BF8 B;  1V86 A;  2MBB B;  2KDF B;  1UD7 A;  2FCM A;  4B9K A;  2KDI A;  2MP2 B;  3PVL A;  2L0T A;  5LXH A;  3ZW3 A;  3KUZ A;  1R4N I;  2KVR A;  3APF A;  3UQA A;  2B3A A;  5C23 A;  5CHV C;  1NBF C;  2ZEQ A;  1T0Y A;  1NDD A;  4BKG A;  2DZJ A;  2CS4 A;  2MBH A;  4BOS C;  1WXM A;  1E8Z A;  3PHX B;  4B6W A;  5J2R A;  3KUD B;  4W9E A;  1RAX A;  5DCN A;  2IYD B;  3VVW B;  2KKC A;  3ZNG C;  3ZUN A;  5LXI B;  4ICU A;  4JLC A;  2JRI B;  1A5R A;  2KLC A;  2M4N A;  2L8J A;  4ZDV A;  3SD5 A;  2IO0 B;  3JW0 X;  3CF6 E;  3ONS A;  5AZG A;  2GBR A;  4M8N A;  4LDT B;  3CMM B;  3VUX A;  3DPD A;  4DDG D;  3WA0 A;  3O65 B;  3A33 B;  1S1Q B;  3KYD D;  3AU5 A;  4IWQ A;  2RD0 A;  4AWJ A;  4NAW B;  5JZE B;  3RZW C;  1WGR A;  1WJ4 A;  4M8M A;  3ZNI D;  1OQY A;  2LGY A;  4P7I A;  2LI5 A;  5D7G A;  3WAN A;  2R2O A;  5JH5 C;  4J6I A;  3DVN V;  3L13 A;  4KIK B;  3LDZ E;  3IG3 A;  1V5O A;  3QJZ A;  4NPN A;  3R7R A;  3GOE A;  2M1M A;  1YX5 B;  3ZNZ B;  3VUY A;  2KC2 A;  4GOC A;  3HM3 A;  3QHT A;  4E3C A;  1KM7 A;  2RGF A;  2CU1 A;  3ALB A;  1WR6 E;  2GBM A;  5CX3 A;  3W1Y A;  2LGD A;  4PS7 A;  3RUL A;  2JVC A;  3T8M A;  2KLG A;  3SDL C;  2MCN B;  3VH3 B;  2BGF A;  3QCA A;  4BBN C;  2KXJ A;  2M0X A;  3TCA A;  2AWT A;  3MTN B;  4W9D A;  3S2A A;  4WWN A;  2DX5 B;  1D3Z A;  1WRD B;  3QX1 A;  5EDS A;  1H8C A;  1WJU A;  1Y8R C;  2K1F A;  3WAO A;  5KHQ A;  2N7E A;  1GC6 A;  5JHB A;  2FID A;  1LXD A;  3JVZ X;  2JY6 A;  2KAN A;  1J8C A;  2K39 A;  2MLB A;  3A9K A;  2BWE S;  2BYE A;  3VQI A;  3ZLZ A;  1OTR B;  2L0F A;  1EF1 A;  2N1V A;  4LDT D;  3PLU A;  1UBI A;  2GBK A;  3VDZ A;  3N32 A;  4ICV A;  1E90 A;  2MQJ A;  2JWZ A;  3PHW B;  2PE9 A;  3MHS D;  4IWO A;  2N9P C;  2NBW B;  1EF5 A;  2LD9 A;  2MRP A;  2OJR A;  4DHJ B;  3L0W B;  3OJ4 B;  4WWP A;  4AP4 C;  3DBS A;  1WZ3 A;  2J0M A;  3A9J B;  5D2M B;  1E5W A;  4MDK E;  4WJN A;  2LGX A;  4BFR A;  1TGZ B;  3ZDM C;  4W9K A;  1VCB A;  3RYT A;  1WX9 A;  2ZPN A;  2LWP A;  5AZH A;  5BO4 B;  4FHJ A;  4NJ7 A;  1WXA A;  4CO7 A;  3APC A;  5CHW A;  2KTR A;  1V81 A;  4X57 B;  3KW5 B;  3V62 A;  1BT0 A;  2FCQ A;  2MBE A;  2A4Z A;  3H9D A;  4K7S A;  3ZKJ C;  3QIJ A;  4KSK C;  2C7M B;  5L95 C;  3CSF A;  4MSQ B;  2M8S A;  4BKS D;  2DEN B;  4MGY E;  5DPS A;  3D32 A;  2ZVN A;  4JL9 A;  2AEH A;  2K6D B;  1WXS A;  2G45 B;  4HK2 A;  3RUI B;  4CYE A;  4KDL B;  2FIF A;  3DOW A;  3K9P B;  3VXW A;  2JT4 B;  1OEY A;  5E6N A;  1WE6 A;  2KFK B;  2XBB C;  2ZCC A;  2GBN A;  1GUA B;  1WX7 A;  3L10 B;  4MEL A;  5IA7 A;  3HIZ A;  3NZS A;  3V61 A;  3RCZ A;  2KNB A;  2C60 A;  3Q3J A;  4GMV A;  1E8W A;  2LRW A;  4II2 B;  3DVG X;  4GSW A;  3NOB A;  3TIX A;  3U30 A;  1WY8 A;  2KJH B;  2NPT B;  3DCG A;  4W9J A;  4W9L A;  2KZR A;  1ZGU B;  2MW5 A;  4FN2 A;  4I6N B;  1EO6 A;  1GNU A;  1WI0 A;  2GMI C;  5C1Z A;  4BOZ B;  3L54 A;  3M3J A;  1WJ6 A;  4DHZ E;  4G11 A;  1P3Q U;  2KWC A;  5D6J B;  5GMV A;  3OLM D;  2L76 A;  4W9I A;  5KHO A;  2CHX A;  3AXC A;  3H7P A;  2KX0 A;  4YL8 A;  1V6E A;  4OVV A;  1HE8 A;  3UIN B;  3GZN I;  5TR5 A;  3PRE A;  4GDK B;  2BPS A;  4KVG B;  2LAS A;  4NAW A;  2O6V B;  4IC7 B;  1U4A A;  4JGH B;  4BVU C;  4DBG A;  2KJR A;  3UGB B;  1Q1O A;  4HPM B;  4GIV A;  2N4F A;  1IP9 A;  3M95 A;  4B95 A;  2K8B A;  2DYO A;  2KFK A;  2KTR B;  3QK0 A;  4GN1 A;  2G4D B;  5DPR A;  2J0K A;  3C0R B;  1RRB A;  2LXA A;  4I6L B;  1F9J A;  2LJ5 A;  2Y5B B;  1V9J A;  3KVF B;  4GDK A;  4HCN B;  3ZTD A;  3WAL A;  4XX5 A;  2L7R A;  4MSM B;  2JUO A;  1R4M I;  2LZ6 A;  1V2Y A;  4MM3 A;  2KC1 A;  1M94 A;  2ASQ A;  4TQ0 A;  1ZW7 A;  2GBJ A;  1GG3 A;  3WIM A;  2BKF A;  1KOT A;  2IBI B;  2V4L A;  4LCD E;  4LJO B;  3NY5 A;  3PRP B;  1MG8 A;  2O6V D;  3ML8 A;  1XD3 B;  2KX3 A;  4HPL B;  1P98 A;  1KJT A;  2G4S A;  3VUW A;  1JRU A;  3I3T B;  2DZM A;  2C7H A;  2XK5 A;  3ZVV A;  4EUT A;  4EZJ A;  1LQB A;  2KFJ A;  3OAW A;  5D94 A;  3AU4 A;  4CHK A;  2YVC A;  4HXD A;  4MEM A;  4M0W B;  1XT9 B;  3PSE B;  2D11 A;  3ENE A;  3H6N A;  2YLM A;  2WDT B;  2L00 B;  1CMX B;  2KJ6 A;  3R3M A;  2C5L C;  2REX A;  2XEW A;  2LVP A;  4EOY A;  1WX8 A;  4IUM B;  2J7Q B;  4F7Z A;  2JZZ A;  2VRR B;  3DQV A;  3EHV A;  5E6O A;  1TTN A;  4MJS A;  1I35 A;  3U8Z A;  2K25 A;  1P9D U;  2PEA A;  3V60 A;  3ZRF A;  3UF8 A;  2LXC A;  2JPH A;  2NVU I;  4FJY A;  4WJP A;  3PT2 B;  2JRH A;  1Q0W B;  4KSL C;  3NHE B;  3ZO5 B;  1GJZ A;  4AUQ C;  3OJ3 A;  3VTV A;  1OGW A;  2IO3 B;  4A20 A;  2LVO A;  2HE7 A;  3NS8 A;  2WYQ A;  2IO2 B;  3TL5 A;  2FCN A;  1WIA A;  1WM2 A;  3BY4 B;  3EC8 A;  3N3K B;  4GDL B;  2J0J A;  3DBR I;  4PYZ A;  2EMS A;  4HLE A;  3NZU A;  1WGH A;  2O2V B;  4WJQ A;  2PPH A;  3N30 A;  5AZF A;  2NS5 A;  4WQO B;  1WE7 A;  2D10 A;  2HTH A;  4WAA A;  2XK5 B;  2PJH A;  1WGD A;  2WWZ A;  3KYC D;  2RSU A;  4KIK A;  4ANX A;  4FAD A;  1YJ1 A;  2IZV B;  4E74 A;  3PRM B;  2A5U A;  2NCN A;  1SIF A;  4IG7 B;  3PTF C;  3IHP C;  1L7Y A;  3UIP B;  4ZYN A;  3ZIM A;  2MWS B;  2C7N B;  5HKH A;  4GXB A;  3Q3F A;  4RM8 A;  1IYF A;  4A3P A;  2C9W B;  1P1A A;  2BWF A;  2CKH B;  1UGM A;  1XQQ A;  2I1J A;  4FA6 A;  3L08 A;  4KZ0 A;  3AI5 A;  2WX0 A;  2DZI A;  4IWP A;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...