4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
5AZHA 1WH3A 2KTRB 2KMAA 5FR6A 2A4ZA 2MX2A 4DBGA 1BT0A 1EO6A 3ZRFA 3TJPA 1WY8A 2KDBA 3NY5A 2UYZB 4FULA 3ZLZA 1Q0WB 2LGDA 2K25A 3CSFA 3IFWB 4W9KA 1TGZB 3I3TB 4WQOB 1V9JA 1WX7A 3EECA 4BOSC 2N9XA 3CSTA 4KZ0A 4M8MA 1WYWB 2GBJA 3DCGA 4GU2A 3VTVA 4TKNA 5LXIB 4KIKB 2KQ7A 5C1ZA 2MP2B 4K1RB 2WWZA 1L7YA 1LQBA 3KW5B 4ZYNA 3UF8A 3H1UA 2JRHA 2JWZA 4HWIB 3QK0A 5DCNA 1I35A 3SU8X 4EFOA 3OLMD 4FHKA 2GBMA 1H4RA 2LXCA 4K7WA 2ZCCA 3QCAA 1UELA 2N9EB 3APDA 3DVGX 3PSEB 4LDTB 2D10A 1EUVB 2ASQA 2KJHB 5E6PA 4HDQA 1T0YA 2LJ5A 3SHQA 1WM3A 1YD8U 2KDFB 1SIFA 5JHBA 5DPTA 2ZPNA 1WI0A 1E5WA 4RMAA 5E6NA 4BKTA 2KWCA 3L17A 4HPMB 2NS5A 4WWOA 5LLIA 4ANWA 3MHSD 4I6NB 2HD5B 4NQKE 2MBOA 2O2VB 2REXA 1P9DU 2G4SA 3V60A 2RGFA 1S1QB 4BFRA 1M94A 5BO4B 3QJZA 4IG7B 5HKHA 3PRZA 3EC8A 2KTRA 2CHWA 4K7SA 2GBNA 1U4AA 2I1JA 4GMVA 3HM6X 2JF5A 3KUZA 2C60A 2DX5B 3UQAA 2GMIC 4PS3A 2DYBA 4TV3A 1V49A 3P2BA 2AL6A 3BY4B 1SE9A 4TUUA 2LXAA 4OVVA 5AZFA 1E90A 2IO3B 4BVUC 2NR2A 3DBRI 4NY0A 4IWPA 4KIKA 3U8ZA 4FLHA 2MP2A 2MBHA 3TL5A 3RCZA 1F9JA 3TMPB 1WGGA 2L0TA 1LFDA 3RUIB 1WZ0A 3WAMA 2CKHB 5DPWA 3ECIA 3MJWA 5KHQA 3NZUA 2KDIA 1GUAB 2PE6B 2GBRA 3AXCA 4LDTD 4PYZA 1GJZA 4II2B 1WXVA 3H7PB 4ICVA 2DAJA 4A3OA 1YX6B 3W1SC 2JT4B 4DXAB 4GB9A 2BWES 2IO1B 4B6WA 4BKGA 4ANXA 3N32A 4A20A 5E6OA 2JRIB 3ZDTA 3B1LX 3VUWA 2DENB 1WJ4A 2QHOA 4ANVA 2HJ8A 1RAXA 1V80A 3T9LA 2KFJA 2ZVOA 2K6DB 2IO2B 2BKRB 2JZ3B 1NDDA 3DBHI 2NBUA 3WAPA 2MBEA 2PEAA 1P98A 4BOZB 4G3XB 4KSKC 5CHWA 4W9IA 3PLVA 4GDLB 4KV2A 1WGHA 1UGMA 1GC6A 4MSQB 2GBKA 2N9PC 2NBVB 4WJOA 1EF1A 1R4NI 2BYFA 4W9JA 2MCNB 3RD2A 2IBIB 3R7QA 4URKA 3ZRCA 1C3TA 4YL8A 1V86A 4B9KA 3HK0A 2VRRB 2KQSA 3A1QA 1VD2A 3JW0X 4ICUA 4I6LB 2KFKA 5D6JB 3CMMB 4LJPB 5TR5A 2RD0A 2JUOA 4I6PA 2Y5BB 1PQSA 4MEMA 4AWJA 3WA0A 2RSUA 4CYEA 2DZMA 2KHWB 1SGHA 3EFUA 1V5OA 2LGXA 3H9DA 2KX0A 3V6CB 3L54A 1P3QU 3H7PA 4NAWB 3PREA 2ZEQA 4WJNA 2J0MA 4GOCA 5CHFA 3RZWC 2C9WB 2IY1B 2XBBC 4JLCA 1J19A 1UBQA 3M62B 1R4MI 3SD5A 4WAAA 2KJRA 3DOWA 3ZTDA 3L16A 3RZFA 2NBWB 1WR1A 2MRPA 1TZ1A 3DDCB 2KTFA 2LVQA 5AZGA 1GC7A 4JQWC 3VHTC 4NQLB 2BPSA 4FJZA 5L83A 5DPSA 4ASWC 2KC1A 2L05A 2KZRA 3KH0A 4NJ7A 2N7DA 2D3GA 2DZJA 5D7GA 2IYDB 1OQYA 4CHKA 1HE8A 3B0AA 3EHVA 4TQ1A 1WZ3A 2M1MA 5CTRC 3U7DA 3QARA 4GXBA 4GDLA 4DHJD 2JXXA 2M0XA 4N9F4 4FA6A 2GOWA 3QX1A 4IWOA 2I1KA 3ZNHB 3N3KB 4HCPB 4XZ4A 1OTRB 3OJ4B 2LD9A 5JZEB 2BGFA 4F8CB 1YX5B 3JSVB 4FADA 1XQQA 2MBBB 3LDZE 2YVCA 2R2QA 3KUCB 4LCDE 5CX3A 3VH3B 2C7HA 2O6VA 3VDZA 1KLVA 3QHTA 1EF5A 4AOFA 2M8SA 2K6QA 3H6NA 2OOBB 4TQ0A 3PS6A 1WJ6A 4PS7A 1KOTA 4M0WB 4EOYA 4F7ZA 1WRDB 3QWZB 2WX0A 2LI5A 3PGEA 2V1YA 2KN5A 3HM3A 2EKEC 2N4FA 4HJKA 2NCNA 1V6EA 2PPHA 1WM2A 2W9NA 4NAWA 4CO7A 3UGBB 2KMCA 1KJTA 1GNUA 1IPGA 2L8JA 2LUEA 2AEHA 3PT2B 1K8RB 3WALA 3DBLI 3ZUNA 2KWUB 1X1MA 3A1QB 3WANA 2AL3A 2JPHA 4PYUA 5GMVA 4HVBA 2KFKB 1J0GA 4AUQC 3AULA 3TIXA 3A9JB 4GN1A 3DBSA 4JIOU 1XD3B 2LZ6A 4PS8A 3KYDD 1C1YB 3QC8B 4KDLB 2MBQA 4KSLC 1IP9A 2RR9A 4MGIE 2JZZA 1E8XA 2HTHA 3N30A 4MGYE 2UWQA 4MSMB 3V61A 1WR6E 4EZLA 1OEYJ 2FAZA 4NPNA 1XT9B 2J0KA 2C7MB 4FN2A 5JH5C 5G55A 3PZDA 3A33B 2KLGA 1LM8B 2KKCA 3L08A 3PLUA 4IUMB 1UD7A 3APFA 3L0WB 3RT3B 4GDKA 4ZDVA 2FCNA 5IA7A 4FJVB 1WE6A 3JSVA 3A4RA 3RULA 3MTNB 2NPTA 3Q3FA 1UBIA 5KHOA 2FUHB 2ZZPB 3C0RB 2BF8B 4W9LA 3K9OB 4DDID 2Z0EB 3M95A 4KDIC 3DVGY 3TBLD 5D94A 1OGWA 5G2NA 4W9FA 4BKSD 4G11A 4AJYB 1VCBA 2AYOB 3OAWA 3GOEA 5LXHA 5EDSA 3X0WA 4G50A 4A3PA 2CHXA 2L0FA 3QQ8B 4BKSA 3ZNZB 1UH6A 2R2OA 3ZW3A 1G6JA 2AWTA 3GZNI 2ZJDA 2HE7A 3ZNID 4EEWA 3ALBA 3NHEB 3TCAA 1WE7A 2O6VB 2PJHA 5D2MB 3A9JA 1AARA 3PVLA 4EKUA 2KNBA 3HHMA 3ONSA 2C5LC 4AJWA 1WX8A 4GIVA 3KYCD 3BINA 4WJQA 3QAQA 2D07B 3CF6E 1RLFA 2M4NA 3V6EB 1YIWA 3DVNV 1CMXB 2A5UA 5J2RA 2MA9B 4FBJB 1GG3A 2KANA 1UZXB 2K39A 3HIZA 3KVFB 4P7IA 3VH4B 4K81A 4MJSB 4MM3A 1WGYA 3U30A 3VQIA 3APCA 2IY0B 2YLMA 3A4SC 2CS4A 4IW0A 4MH0E 1A5RA 3IVFA 4HLEA 4GGQA 1YJ1A 2FCQA 3O65B 1L2NA 2L76A 2L7RA 2ZCBA 2LRUA 1E8WA 2KX3A 4M8NA 3V62A 1P0RA 4XX5A 4ZRJA 1KM7A 2IO0B 1RRBA 2LVPA 1WX9A 2LWPA 3AU4A 3WIMA 5JHAA 1NBFC 4E74A 2BKFA 2JVCA 2DYMA 2ZPYA 2ZVNA 4II3B 2BWFA 5IAAC 3R7RA 1Q1OA 3ZNGC 1QZEA 5L95C 2DYOA 2V4LA 2DAFA 2KXJA 1TBEA 3Q3JA 4FHJA 5CHVC 4ZRKA 4E71A 2WYQA 2FNJB 3NOBA 2FIFA 2ZNVB 1FXTB 2MWSB 3M3JA 2LVOA 2WX1A 3IG3A 3UINB 4RM9A 4DWFA 3ML9A 2KD0A 2M17A 2RPQA 4IM0A 3VTWA 2JY6A 4GDKB 3AU5A 3PRMB 2LRWA 3UQBA 1MG8A 1Q5WB 1WF9A 1IYFA 1WXAA 2O6VD 2C7NB 2IZVB 2KJ6A 4BBNC 2Z59B 2NPTB 2MW5A 3VUXA 4MDKE 2K8HA 3A9KB 3W1YA 1WMHA 3ZKJC 1TTNA 3JVZX 3IBEA 4MGKE 1E7UA 1E8ZA 3RYTA 2G45B 4XC2A 2XK5A 1OEYA 4DHJB 1ISNA 4JL9A 3R3MA 4G0NB 1I42A 1P1AA 2ZNVC 2J7QB 2KDEB 2KC2A 1V81A 4MJSA 5DPRA 4KZCA 3ML8A 2MQJA 4J6IA 4EZKA 2V3SA 3NS8A 4GSWA 5J17A 2KK8A 3ZDMC 3L13A 1WFYA 2XEWA 4W9CA 3M63B 4W9EA 5AEKB 4E3CA 2LGYA 4IC7B 4FJYA 1V5TA 1WXSA 4KVGB 4MELA 2FCSA 2G3QB 1JRUA 3IHPC 3QA8A 4MGZE 3VTUA 3UIPB 1WXMA 2KLCA 3L10B 4EZJA 4LJOB 4IWQA 2LASA 2KVRA 4DDGD 2L3ZA 4WWNA 4DK5A 4NNJB 4W9GA 2EMTA 2K8BA 4EUTA 3PHXB 3PTFC 2BYEA 2BYVE 4HPLB 4OVUA 2G4DB 3VAWA 3QIJA 2CU1A 1Z5SB 3K9PB 4ZRIA 3VUYA 3B08A 1WIAA 3NZSA 3VVWB 3ZTCA 4IM3A 2N7EA 2FIDA 2N1WA 2CHZA 3DPDA 2MSED 3PRPB 4RM8A 2CR5A 5J18A 3PPAA 4BBNF 2D2QA 1NI2A 3DQVA 4WWPA 3SDLC 3A9KA 4JGHB 2B3AA 4NJ6A 3S2AA 3PV1A 2PE9A 2N1VA 1ZGUB 3X23A 1J8CA 4HXDA 2DZIA 4DHZE 1H8CA 3R66C 4IM2A 2EMSA 4W9HA 3PHWB 3ENEA 3ZVVA 2D11A 2K1FA 1V2YA 2L00B 4DHZB 3LJ3A 2O2VA 2FCMA 2J0JA 3JYUA 2K8CA 4AP4C 1ZW7A 1WJUA 1WMHB 1D3ZA 3WAOA 1E8YA 4HDOA 4W9DA 2DZKA 3ZIMA 1WGDA 2XK5B 3KUDB 3AI5A 4HK2A 1LXDA 3D32A 3W1SA 1Z2MA 2MLBA 3OJ3A 1RFAA 3H7SA 4X57B 2KWVB 3DVNU 3UIOB 2KOXA 2WDTB 1S3SG 2OJRA 3T8MA 3ZO5B 3VXWA 4B95A 4K7UA 5C23A 4WJPA 4F1SA 1ZKHA 3VFKA 2Z0DB 1E7VA 1WJNA 2NVUI 1Y8RC 4ANUA 2DHZA 2KO3A 1WGRA 4HCNB 1YQBA
chains in the Genus database with same CATH superfamily
1WH3A 2KMAA 2IGHA 1EO6A 1GAQB 3WCQA 3ZLZA 3AE4B 3NZ3A 2K25A 2WQYB 3CSFA 1E7PB 1V9JA 2TSSA 2JYTA 4ZHPA 1TYGB 3AE7B 2WLBA 2GBJA 3VTVA 5LXIB 1WWTA 3RNFC 2MP2B 2W54A 3AEGB 4K1RB 2WWZA 1L7YA 3UF8A 2Z8LA 3SFDB 4HWIB 3QK0A 2Y5PA 4EFOA 1WXQA 2VZKB 2ZCCA 3EFCA 3DVGX 3PSEB 1VZ6A 2J52A 2KJHB 5E6PA 4XWTA 3SHQA 1WM3A 2KDFB 5DPTA 2ZPNA 1E5WA 5E6NA 4BKTA 5D3DA 1ESFA 1SBBB 2WDVB 3ZQ4A 3MHSD 4I6NB 2W3RA 2G4SA 3AEEB 1S1QB 1M94A 1VRAB 2I2YA 1NVID 5HKHA 1T6BX 2GBNA 1B1ZA 2JF5A 1I4PA 2WP9B 4PS3A 3V3XA 4TV3A 3Q8FA 3SEBA 4TUUA 1Q10A 1ET9A 1E90A 3Q69A 2NR2A 3DBRI 4FLHA 2MP2A 3TL5A 3TMPB 1XLQA 3H8HA 3RNCC 1WZ0A 3WAMA 2CKHB 3NZUA 3AXCA 1WXVA 3J9CA 1YX6B 1NYRA 3W1SC 2X8XX 4DXAB 4A20A 5E6OA 2JRIB 3ZDTA 1RAXA 2JZ3B 2NBUA 1PGXA 1VJKA 4HRSA 3WAPA 2MBEA 3E56A 4BOZB 3LB8C 4W9IA 2ZW1A 5HI1A 2Y5CA 4KX6B 2MJ3A 4DHJB 5J2RA 4JWSC 4W9JA 2BYFA 3RD2A 3R7QA 1C3TA 3EUB2 1XCTL 3HK0A 2KQSA 3CMMB 1UF0A 2LEKA 4I6PA 1FRDA 2WGSA 4MEMA 3MFGA 2RSUA 3NS1A 1SGHA 3EFUA 4HEA1 2KX0A 2JWUA 2JSVX 3L54A 1P3QU 3BVMA 3PREA 5CHFA 2IY1B 4JLCA 2QDFA 4YTNB 4ITKA 2KJRA 3DOWA 3Q2AC 1QILA 1RYJA 3RZFA 3DDCB 2LVQA 1GC7A 1ZUD2 4HJGE 2KZRA 2GI9A 4YSYB 4NJ7A 1ZDVA 5D7GA 3P4SB 1HE8A 1AYFA 2ONQA 4TQ1A 1N6ZA 1TS2A 1TY2A 3U7DA 4GXBA 4N9F4 4IWOA 3ZNHB 4HCPB 4XZ4A 1KRHA 5JZEB 4F8CB 4FADA 3LDZE 2SEBD 3KUCB 3VH3B 1EF5A 1HTQA 2M8SA 2OOBB 3NG0A 4TQ0A 1AN8A 3KWVA 4PS7A 2M19A 2EELA 4JE3B 1T5XD 1WRDB 4B0EA 2M56B 2WX0A 1I7HA 2EKEC 1D5MC 2NCNA 2PPHA 1WM2A 2W9NA 1IPGA 2BW2A 2AEHA 1DOIA 1K8RB 3N1YC 2KWUB 3A1QB 3WANA 5GMVA 4AUQC 2INPE 3AULA 4GN1A 1C77A 3L4PA 1TY0A 3HRDD 3KYDD 1C1YB 4C4VB 2H88B 4KSLC 2JZZA 1E8XA 1I4HA 3N30A 1L6UA 3V61A 1WSPA 1WR6E 1OEYJ 1T3QA 4NZLB 3GE8C 3GE3C 1QOAA 2J0KA 4S0RA 1TJEA 2DBYA 3PLUA 1UD7A 2ON8A 2LFIA 3RT3B 2FCNA 1HA5A 2WXKA 2KAJA 2IDYA 2FUHB 2ZZPB 2BF8B 1CJEA 3M95A 2W3SA 2K22A 1OGWA 3FILB 2AYOB 2WXLA 4BKSA 1HTOA 2R2OA 1NEKB 3AE2B 1YJIA 2L32A 4EEWA 3Q8EA 2WXNA 2KQ4X 3B2GA 2KNBA 4JX1C 2C5LC 4GIVA 3BINA 1FO4A 4FBJB 1GG3A 3KVFB 4HKQA 3U30A 1FCCC 1PGBA 4IW0A 4HLEA 3O65B 3BWUD 2ZCBA 2KX3A 2K0PA 1KM7A 3U2SC 2IPKD 4RH6A 4E74A 4L23A 4II3B 3R7RA 2V4LA 5LNK1 2DAFA 5H8YE 4N58A 3FILA 4XGAB 2OHFA 2WX1A 3IG3A 3ZJVA 4RM9A 3ML9A 2RPQA 3VTWA 1MG4A 3UQBA 1MG8A 2GB1A 1C4PA 3VUXA 2MW5A 2K8HA 3ZKJC 3EGRA 3FKYA 1E7UA 1E8ZA 1OEYA 1TS3A 1F1HA 3I63C 1K50A 1QF6A 5DPRA 3ML8A 2WU2B 5J17A 2KK8A 4HKZE 1WFYA 2I38A 1TS5A 2LGSA 4E3CA 4IDIA 1XEEA 4RGOS 4IC7B 3NVYA 5HHDG 2J4XA 4DXGA 4XDDA 4LJOB 4IWQA 2L3ZA 3TUOA 4DK5A 4NNJB 2CU3A 2EMTA 4LNIA 1T0SC 2AQ3B 2BYEA 5BYSA 1JWAD 4OVUA 2G4DB 2N9KA 2CU1A 3K9PB 1FIQA 3ZTCA 4IM3A 2CHZA 2CR5A 5J18A 3PPAA 3DQVA 3SDLC 4YTMB 3MC0B 3PV1A 4YXDB 2N1VA 4YTPB 2DZIA 1FRRA 4QAYA 3ZVVA 3DBLB 4DHZB 1JWSD 1DOXA 4AP4C 1SB3C 3ZIMA 1HQRD 1FD6A 2KYWA 3UIOB 3Q3NC 3P1MA 1TS4A 2G9HD 2PW9A 1KTKA 1D5ZC 1K51A 2DHZA 2OJWA 3EA6A 1YQBA 1JQ4A 2A4ZA 1NENB 3CWIA 3TJPA 2KDBA 3AE3B 3IFWB 3ZXRA 4WQOB 1WX7A 3EECA 4BOSC 3TEZA 4AS1A 1WYWB 3DCGA 3NJTA 4TKNA 1KH0A 4KIKB 4RNAA 5C1ZA 3HUIA 3KW5B 3H1UA 1PYWD 1HZ6A 3OLMD 1N62A 2GBMA 5IO9A 4K7WA 3QCAA 1ZXIA 2B76B 4HDQA 2CJOA 4RMAA 1E9MA 4HPMB 4WWOA 5E6JA 2O2VB 3V60A 2WXQA 1MI0A 1XXGA 3MC9A 3QJZA 3EC8A 1IGCA 2QSDA 2CHWA 1U4AA 1B9RA 4PT5A 3UQAA 1E10A 3P2BA 1IGDA 1SEBD 5IOIA 2LXAA 4NY0A 4KIKA 4RGNA 3RCZA 1JW9D 1WGGA 2L0TA 3RUIB 1UGJA 3MJWA 2KDIA 1GUAB 2QILA 4LDTD 4PYZA 1GJZA 1SF0A 2WXHA 4ICVA 1V8CA 4A3OA 4GB9A 2GRIA 2FBWB 4PK1A 4K3CA 3ZGZA 1V80A 2KFJA 1KLUD 2IO2B 1TKYA 1GB4A 1NDDA 2DLBA 2KWDA 3LYYA 1PDXA 1ZPSA 2PEAA 4G3XB 4YSZB 2N9PC 2MCNB 4URKA 3ZRCA 1QLBB 4B9KA 2KFKA 5D6JB 1QKZA 5TR5A 1C76A 2RD0A 2JUOA 4AWJA 3WA0A 1ACCA 3P4PB 2KHWB 3PZ7A 1V5OA 2LGXA 3RPFC 2ZEQA 4WJNA 2J0MA 2LJIA 4C56C 1UBQA 3L16A 3NVVA 2NBWB 3TCAA 2MRPA 5AZGA 2BPSA 3DWMA 3KH0A 2WXFA 3NVWA 1L5PA 2IYDB 4CHKA 1CZPA 3EHVA 1WZ3A 1DYQA 3FAHA 5CTRC 2ACZB 4K3BA 4FA6A 2LHDA 2I1KA 2ZW0A 1VDVA 4ZOHC 1XQQA 4UDUC 1SSNA 3AN1A 2RPVA 4AOFA 3H6NA 1T0RC 1CK1A 2KDMA 3PS6A 4M0WB 4OZBA 4F7ZA 2V3NA 3PGEA 2V1YA 4OHJA 3UGBB 2KMCA 1KJTA 1GNUA 2L8JA 3PT2B 3DBLI 3ZUNA 3SFEB 1X1MA 4HVBA 1J0GA 2FE8A 1XD3B 2LZ6A 4ZHOA 4KDLB 4MGIE 3HVZA 4KKJA 1P7EA 2UWQA 2RMMA 2WHIA 3RNBC 4EZLA 1RFKA 4RF1A 1D6EC 4FN2A 5G55A 4KGTA 1EWYC 3L08A 4IUMB 3APFA 3L0WB 1FFUA 4ZDVA 5IA7A 4FJVB 2AQ2B 3A4RA 2NPTA 4W9LA 1VZ7A 2MHJA 4KDIC 4P6VF 5G5GA 3DVGY 3TBLD 5D94A 2G1EA 4M0WA 2INNE 3Q3MC 3AMZA 1UWXA 3GOEA 4GLSC 3ZNZB 1UH6A 4RFBA 2BVCA 3ALBA 2WXGA 5D2MB 1SJED 4EKUA 3HHMA 4AJWA 1WX8A 3KYCD 2D07B 3V6EB 2A5UA 2MA9B 2WXOA 3W2DA 3VH4B 2QCZA 4MJSB 4MM3A 3FC4A 1WGYA 4A9AA 3APCA 2YLMA 4MH0E 1A5RA 2D3CA 4GGQA 1L2NA 1QOBA 4M8NA 1L4ZB 4ZRJA 3AEBB 3WIMA 2LWPA 1WX9A 5JHAA 2BKFA 2JVCA 2DYMA 1PGAA 2DYOA 4ZRKA 2WYQA 2FIFA 1FXTB 1I4RA 4ACFA 2LVOA 4P16A 1OQRA 4DWFA 2KMMA 4IM0A 3PRMB 1Q5WB 1WXAA 2C7NB 2IZVB 2KJ6A 2WDQB 4XE0A 4MDKE 1WMHA 4HROA 2N9LA 2IJ0A 4LNFA 3IBEA 4MGKE 3RYTA 3R8BA 2G45B 3AE6B 4EE2A 2PLPA 4O1NA 3IAM1 3R3MA 3ZJUA 2J7QB 1ZE3D 4MJSA 1SJHD 2MQJA 2V3SA 1R4MB 3NS8A 2L52A 3TEYA 3ZDMC 3DWGC 3BYYB 2ICIA 3M63B 1ET6A 3BIID 1V5TA 4MELA 5D3IB 3IHPC 3VTUA 3E9SA 1WXMA 2KLCA 4EZJA 4RCOA 1EU3A 3AEDB 3PTFC 4HPLB 5MPOA 2PIAA 4LNNA 1I4GA 4WIPA 3QIJA 1Z5SB 1YN4A 4Q2JA 4YWGG 3B08A 1WIAA 3VVWB 2JXTA 3AE1B 2FIDA 2N1WA 3DPDA 1TIFA 2MSED 4RM8A 4BBNF 1PFDA 2HJ1A 2PE9A 2INDC 4HXDA 5HG2A 3RNEC 3R66C 2D11A 2BS2B 2K1FA 2D5GA 2H89B 2BYTA 3JYUA 4XYCA 1FM0D 1WJUA 1D3ZA 1V97A 1E8YA 4HDOA 2DZKA 5FKAC 3KUDB 2MEKA 3AI5A 4HK2A 5FK9C 1LXDA 3CIRB 4X57B 3H7SA 3DVNU 1JRPA 1S3SG 2OJRA 3BZDB 3ZO5B 1JROA 4K7UA 4F1SA 1ZKHA 3VFKA 2JU6X 2NVUI 2WXRA 3MHZA 4ANUA 2V3PA 1L0XB 5AUKA 4HCNB 2KTRB 4DBGA 1BT0A 4FXCA 2PVGC 1WY8A 2D3AA 2Y3AA 3T3NA 4R3DA 4W9KA 3I3TB 2BB5A 3CSTA 1RM6C 1C9FA 4OZCA 2HDEA 3GZNB 4BAXA 2JRHA 2JWZA 2AQ1B 1R7SA 2OEDA 3SU8X 4FHKA 1M4VA 2LXCA 4XWWA 3APDA 1L0YB 3RFZB 3AEFB 2D10A 4LDTB 1EUVB 3VR8B 1T0YA 2LJ5A 5EE0A 1YD8U 5JHBA 1WI0A 5LLIA 4WWMA 2REXA 1P9DU 4C00A 2RGFA 1MJDA 4IG7B 1AW7A 2KTRA 4J3OD 4A6QA 4K7SA 3HM6X 1UUPA 3RMKC 3B2FA 2C60A 2DX5B 1D4BA 3NRZA 2DYBA 1V49A 1N60A 3BY4B 3I9V1 1OFFA 1V1OA 1F0ZA 5AZFA 2IO3B 4BVUC 1MHXA 3U8ZA 1L6VA 2W55A 3GB1A 2MBHA 3NVZA 1C4CA 5DPWA 3ECIA 5KHQA 2PE6B 1KLGD 2GBRA 4II2B 3H7PB 5C2TB 3R2IA 1JWMD 2IO1B 1YN5A 4ANXA 3N32A 1GB1A 1C78A 3VUWA 1WJ4A 2QHOA 2WU5B 4ANVA 3KQ4A 3T9LA 2ZVOA 1FPYA 2LHEA 1N5WA 3BK1A 4IOIE 4BZAA 4GDLB 1UGMA 1GC6A 4MSQB 2GBKA 1EF1A 2IBIB 4YL8A 3N9YC 2VRRB 1RWSA 3ZYYX 3DBRB 2R61A 1J7AA 2N7JA 4LJPB 1DOYA 2BQQA 2QC8A 1YOVB 1FEHA 4CYEA 4LLGM 3H9DA 3TSSA 1P7FA 2RDHA 3H7PA 3IAS1 3RZWC 2XBBC 1J19A 4US9A 3M62B 1R4MI 3SD5A 5I4DA 3ZTDA 3AM9A 1WR1A 1TZ1A 4KKIA 2KTFA 4JQWC 4FJZA 2K3UA 5DPSA 2D3GA 1MHHE 2QIEB 3MJ5A 3I57A 2M1MA 3BVGA 3QARA 3ZJTA 4GDLA 3T3OA 2JXXA 2M0XA 2BB6A 1V1PB 2PMVA 2GOWA 4ARCA 1F2RC 2UU7A 1EM7A 3N3KB 1DGJA 1OTRB 3OJ4B 2VH1A 3RNAC 2LD9A 2BGFA 3JSVB 1QOGA 2WXPA 1LO5D 2YVCA 4LCDE 2C7HA 2O6VA 4WURA 2V9HA 4ARIA 2K6QA 1FMAD 4S17A 4OVZA 4EOYA 3QWZB 2DNFA 2NMQA 1V6EA 5H92C 1YQ3B 2AL3A 4PYUA 2KFKB 3TIXA 3RNGC 4PS8A 2MBQA 2RR9A 4MGYE 2FAZA 1XLPA 4NPNA 1XT9B 2X38A 3W5VB 1YJJA 1V1PA 2KACA 3PZDA 3A33B 2KKCA 4GDKA 1YMHE 3DHIC 3JSVA 4D2KA 3U4EG 3MTNB 4C80A 5KHOA 3C0RB 4DDID 3TEXA 2WS3B 4W9FA 1YN3A 4G11A 1VCBA 3OAWA 1Y56A 5EDSA 3X0WA 4G50A 4A3PA 2CHXA 1FNWA 2RDBC 3N1XC 1AWDA 2AWTA 3GZNI 4ZRQA 1FNVA 5T8IA 3NHEB 2VH2A 1WE7A 2IGDA 2WXMA 1AARA 4ZYSA 3OG5A 2QEJC 3ONSA 2BS3B 1SE4A 3QAQA 3AE5B 1ZOYB 1N63A 1YIWA 3DVNV 3Q8AA 1STEA 2K39A 3HIZA 4P7IA 4K81A 2CS4A 3URYA 1YJ1A 2L76A 2L7RA 1E8WA 3P63A 3V62A 4CQNA 4XX5A 2IO0B 3Q8CA 1RRBA 2LVPA 3DBHB 2J53A 2ZPYA 2ZVNA 5IAAC 2BWFA 5L95C 2KXJA 4E71A 2FNJB 3R2TA 3Q3OC 2ZNVB 2MWSB 1BUIC 1L4DB 1R4NB 4NAMA 3UINB 2N0SB 2KD0A 5EE3A 3IT4B 2LRWA 3AEAB 2O6VD 4BBNC 2GLSA 2Z59B 2NPTB 1XF5L 3A9KB 3W1YA 1TTNA 4AQ7A 4XC2A 4MT5A 2XK5A 4JL9A 3B9JA 2MJDA 1I42A 1E0ZA 2ZNVC 1VLBA 2KDEB 1V81A 4EZKA 1VZ8A 1XLNA 2JZPA 3VR9B 3DHHC 4W9EA 5AEKB 1WXSA 1A70A 4MGZE 3L10B 1SE2A 1WYGA 4M00A 3VRBB 4W9GA 2K8BA 4MM3B 4EUTA 3PHXB 1SXTA 4MACA 2BYVE 3U7ZA 3VUYA 4ZRIA 2WDRB 4WQMA 2HTME 3PRPB 1YQ4B 4DQOC 4US8A 2QMTA 4WWPA 3A9KA 1ZXHA 5BYQA 3ABVB 4NJ6A 3S2AA 1ZGUB 1F2RI 1H8CA 1IBXB 4KGSA 4W9HA 3ENEA 2JQRB 2JX5A 1V2YA 1C79A 3C8YA 2XNAC 2FCMA 2J0JA 3BK2A 1T0QC 1ZW7A 1WMHB 2WXIA 2EKIA 2IGGA 1J7CA 1I4XA 3D32A 2XN9C 3W1SA 2MLBA 1RFAA 4RGMA 2L1AA 2J42A 2KOXA 3VXWA 4A55A 4WJPA 1E7VA 1NYQA 4LNKA 1WGRA 2BS4B 1XO3A 2PKOA 5AZHA 1GPXA 5FR6A 2MX2A 1MFWA 3ZRFA 3NY5A 4HPPA 4FULA 2UYZB 4JWUC 1Q0WB 1GOZA 2LGDA 2YEPB 3P4RB 1TGZB 1TT5B 2KN4A 2N9XA 4KZ0A 2PVOD 4M8MA 2KT7A 3RN9C 4GU2A 1IBXA 2PTLA 2KQ7A 2MJEA 1LQBA 2KVZA 4ZYNA 2BBCA 5DCNA 1I35A 3ETRA 1TZOA 5IKCM 1H4RA 1ZDXA 1UELA 4P1BC 2N9EB 2ASQA 2DWQA 1SIFA 4LNOA 5BYRA 2INCC 2KWCA 3L17A 2NS5A 4ANWA 5IP4D 2HD5B 4NQKE 2MBOA 1XCQL 4KGRA 1MVKA 4BFRA 5BO4B 3I5JC 3PRZA 2NTTA 1ROEA 4OW0A 2I1JA 4GMVA 1I4QA 1QOFA 3UI3A 3KUZA 2GMIC 2AL6A 1SE9A 3U52E 4L2YA 4OVVA 5EE9A 1J7BA 4IWPA 1JALA 4RGTA 1F9JA 1LFDA 2VZKD 5GXGB 2WNMA 1N61A 2V4IB 5TSSA 2DAJA 2JT4B 2BWES 4B6WA 4BKGA 2M0AA 3B1LX 2DENB 2HJ8A 2WXJA 1IUEA 1K53A 2K6DB 2BKRB 3DBHI 1JWUD 1E6EB 1P98A 2NTSA 4IKGA 1LGRA 4KSKC 5CHWA 3PLVA 2LUMA 1FCLA 4KV2A 2FUG1 1WGHA 2NBVB 4WJOA 1R4NI 1SE3A 4M01A 1V86A 3A1QA 1VD2A 2RDGA 3JW0X 4ICUA 4I6LB 2Y5BB 1PQSA 4C4VA 2LGIA 2DZMA 2BT6A 1KFYB 3V6CB 1VR9A 2SAKA 4NAWB 3SR6A 1JWBD 4GOCA 5HFYA 2C9WB 3AV8A 4DXFA 4MH8A 3BYTB 3N1ZC 4WAAA 4ZRPA 4B0MA 4P1CC 3VHTC 4M02A 4NQLB 4XDCA 5L83A 4ASWC 2KC1A 2L05A 4A8XC 2N7DA 2DZJA 4LK0M 1OQYA 1KF6B 3B0AA 3TEWA 3P42A 4DHJD 3QX1A 3AE9B 1HZ5A 3PO0A 4JPSA 2LMCA 1YX5B 4OZAA 2MBBB 3NUHB 5CX3A 2R2QA 3VDZA 1KLVA 2CJNA 3QHTA 5G5HA 3Q8BA 4TSSA 1WJ6A 1KOTA 5BMGA 2LI5A 1CQVA 2KN5A 3HM3A 2N4FA 1ZP0B 4HJKA 4CO7A 4NAWA 2LUEA 1C4AA 3WALA 2E3TA 5BMIA 2JPHA 4N6EB 3A9JB 3DBSA 4JIOU 3DHGC 3QC8B 1HXYD 1IP9A 3AB5A 2HTHA 1WRIA 4MSMB 1TKEA 1TKGA 2YEPF 2BTEA 4A90A 3C19A 2C7MB 1K52A 5JH5C 2KLGA 1LM8B 2K9XA 5JXVA 2K5PA 1QQRA 1WE6A 3W5UB 5FR3A 3RULA 3Q3FA 4N59A 1UBIA 1MPEA 3K9OB 2Z0EB 3PZ8A 5G2NA 2W82A 4BKSD 1F77A 4AJYB 5LXHA 2L0FA 3QQ8B 3ZW3A 1G6JA 1NI3A 5BMHA 2ZJDA 2HE7A 2QJLA 3ZNID 3ZXVA 2O6VB 2PJHA 3A9JA 3PVLA 5IN7A 4RF0A 3MC8A 1D5XC 4WJQA 3CF6E 1RLFA 2M4NA 3Q14C 1OQQA 1CMXB 1BMLC 3AE8B 3LXFA 2KANA 1UZXB 3VQIA 3W9CB 1FNUA 2IY0B 3O13A 3A4SC 3IVFA 2FCQA 2LRUA 3GS2A 1P0RA 3AU4A 3AH7A 1NBFC 1PUTA 3VRAB 4WH4A 1Q1OA 3ZNGC 1QZEA 1HEZE 4TMAB 3Q3JA 4FHJA 1TBEA 5CHVC 1EWCA 3NOBA 1QT9A 4C7YA 1FFVA 3IXSA 3M3JA 1FXIA 1UWMA 2M17A 2JY6A 4GDKB 3AU5A 1FXAA 1WF9A 1IYFA 1F52A 3MP9A 3JVZX 3GP7A 3P4QB 4YT0B 1ISNA 2AX5A 5EE1A 2JYEA 4G0NB 2MH7A 4NJCA 1P1AA 2KC2A 1WGKA 2Q5WD 4KZCA 4J6IA 4GSWA 3L13A 3KLSX 2XEWA 4W9CA 4L1BA 2L83A 2LGYA 4LTUA 4FJYA 4KVGB 2FCSA 2G3QB 1JRUA 3QA8A 3UIPB 4WAFA 1JMLA 2LASA 2KVRA 4DDGD 4WWNA 2E6XA 1ENFA 2D3BA 3VAWA 3V05A 3NZSA 2N7EA 3AECB 1L0VB 2D2QA 1NI2A 3Q6BA 4JGHB 2B3AA 3N20C 5C3JB 4YSXB 1JCKB 3IT6B 3X23A 1J8CA 4DHZE 4IM2A 2EMSA 3PHWB 4REZA 1N5XA 4C7ZA 2V0GA 1UNSA 2L00B 1XLOA 3BVZA 5AUIA 3LJ3A 3OWEB 2O2VA 2K8CA 1SIJA 3WAOA 4W9DA 1WGDA 3RI7C 2XK5B 1EU4A 1YNTE 1Z2MA 3OJ3A 2KWVB 2WDTB 3T8MA 4B95A 4USAA 5C23A 4H2AA 2Z0DB 1WJNA 1BXTA 3KWLA 1Y8RC 2KO3A 3HVDA
chains in the Genus database with same CATH topology
5AZHA 1WH3A 2KTRB 2KMAA 5FR6A 2A4ZA 2MX2A 4DBGA 1BT0A 1EO6A 3ZRFA 3TJPA 1WY8A 2KDBA 3NY5A 2UYZB 4FULA 3ZLZA 1Q0WB 2LGDA 2K25A 3CSFA 3IFWB 4W9KA 1TGZB 3I3TB 4WQOB 1V9JA 1WX7A 3EECA 4BOSC 2N9XA 3CSTA 4KZ0A 4M8MA 1WYWB 2GBJA 3DCGA 4GU2A 3VTVA 4TKNA 5LXIB 4KIKB 2KQ7A 5C1ZA 2MP2B 4K1RB 2WWZA 1L7YA 1LQBA 3KW5B 4ZYNA 3UF8A 3H1UA 2JRHA 2JWZA 4HWIB 3QK0A 5DCNA 1I35A 3SU8X 4EFOA 3OLMD 4FHKA 2GBMA 1H4RA 2LXCA 4K7WA 2ZCCA 3QCAA 1UELA 2N9EB 3APDA 3DVGX 3PSEB 4LDTB 2D10A 1EUVB 2ASQA 2KJHB 5E6PA 4HDQA 1T0YA 2LJ5A 3SHQA 1WM3A 1YD8U 2KDFB 1SIFA 5JHBA 5DPTA 2ZPNA 1WI0A 1E5WA 4RMAA 5E6NA 4BKTA 2KWCA 3L17A 4HPMB 2NS5A 4WWOA 5LLIA 4ANWA 3MHSD 4I6NB 2HD5B 4NQKE 2MBOA 2O2VB 2REXA 1P9DU 2G4SA 3V60A 2RGFA 1S1QB 4BFRA 1M94A 5BO4B 3QJZA 4IG7B 5HKHA 3PRZA 3EC8A 2KTRA 2CHWA 4K7SA 2GBNA 1U4AA 2I1JA 4GMVA 3HM6X 2JF5A 3KUZA 2C60A 2DX5B 3UQAA 2GMIC 4PS3A 2DYBA 4TV3A 1V49A 3P2BA 2AL6A 3BY4B 1SE9A 4TUUA 2LXAA 4OVVA 5AZFA 1E90A 2IO3B 4BVUC 2NR2A 3DBRI 4NY0A 4IWPA 4KIKA 3U8ZA 4FLHA 2MP2A 2MBHA 3TL5A 3RCZA 1F9JA 3TMPB 1WGGA 2L0TA 1LFDA 3RUIB 1WZ0A 3WAMA 2CKHB 5DPWA 3ECIA 3MJWA 5KHQA 3NZUA 2KDIA 1GUAB 2PE6B 2GBRA 3AXCA 4LDTD 4PYZA 1GJZA 4II2B 1WXVA 3H7PB 4ICVA 2DAJA 4A3OA 1YX6B 3W1SC 2JT4B 4DXAB 4GB9A 2BWES 2IO1B 4B6WA 4BKGA 4ANXA 3N32A 4A20A 5E6OA 2JRIB 3ZDTA 3B1LX 3VUWA 2DENB 1WJ4A 2QHOA 4ANVA 2HJ8A 1RAXA 1V80A 3T9LA 2KFJA 2ZVOA 2K6DB 2IO2B 2BKRB 2JZ3B 1NDDA 3DBHI 2NBUA 3WAPA 2MBEA 2PEAA 1P98A 4BOZB 4G3XB 4KSKC 5CHWA 4W9IA 3PLVA 4GDLB 4KV2A 1WGHA 1UGMA 1GC6A 4MSQB 2GBKA 2N9PC 2NBVB 4WJOA 1EF1A 1R4NI 2BYFA 4W9JA 2MCNB 3RD2A 2IBIB 3R7QA 4URKA 3ZRCA 1C3TA 4YL8A 1V86A 4B9KA 3HK0A 2VRRB 2KQSA 3A1QA 1VD2A 3JW0X 4ICUA 4I6LB 2KFKA 5D6JB 3CMMB 4LJPB 5TR5A 2RD0A 2JUOA 4I6PA 2Y5BB 1PQSA 4MEMA 4AWJA 3WA0A 2RSUA 4CYEA 2DZMA 2KHWB 1SGHA 3EFUA 1V5OA 2LGXA 3H9DA 2KX0A 3V6CB 3L54A 1P3QU 3H7PA 4NAWB 3PREA 2ZEQA 4WJNA 2J0MA 4GOCA 5CHFA 3RZWC 2C9WB 2IY1B 2XBBC 4JLCA 1J19A 1UBQA 3M62B 1R4MI 3SD5A 4WAAA 2KJRA 3DOWA 3ZTDA 3L16A 3RZFA 2NBWB 1WR1A 2MRPA 1TZ1A 3DDCB 2KTFA 2LVQA 5AZGA 1GC7A 4JQWC 3VHTC 4NQLB 2BPSA 4FJZA 5L83A 5DPSA 4ASWC 2KC1A 2L05A 2KZRA 3KH0A 4NJ7A 2N7DA 2D3GA 2DZJA 5D7GA 2IYDB 1OQYA 4CHKA 1HE8A 3B0AA 3EHVA 4TQ1A 1WZ3A 2M1MA 5CTRC 3U7DA 3QARA 4GXBA 4GDLA 4DHJD 2JXXA 2M0XA 4N9F4 4FA6A 2GOWA 3QX1A 4IWOA 2I1KA 3ZNHB 3N3KB 4HCPB 4XZ4A 1OTRB 3OJ4B 2LD9A 5JZEB 2BGFA 4F8CB 1YX5B 3JSVB 4FADA 1XQQA 2MBBB 3LDZE 2YVCA 2R2QA 3KUCB 4LCDE 5CX3A 3VH3B 2C7HA 2O6VA 3VDZA 1KLVA 3QHTA 1EF5A 4AOFA 2M8SA 2K6QA 3H6NA 2OOBB 4TQ0A 3PS6A 1WJ6A 4PS7A 1KOTA 4M0WB 4EOYA 4F7ZA 1WRDB 3QWZB 2WX0A 2LI5A 3PGEA 2V1YA 2KN5A 3HM3A 2EKEC 2N4FA 4HJKA 2NCNA 1V6EA 2PPHA 1WM2A 2W9NA 4NAWA 4CO7A 3UGBB 2KMCA 1KJTA 1GNUA 1IPGA 2L8JA 2LUEA 2AEHA 3PT2B 1K8RB 3WALA 3DBLI 3ZUNA 2KWUB 1X1MA 3A1QB 3WANA 2AL3A 2JPHA 4PYUA 5GMVA 4HVBA 2KFKB 1J0GA 4AUQC 3AULA 3TIXA 3A9JB 4GN1A 3DBSA 4JIOU 1XD3B 2LZ6A 4PS8A 3KYDD 1C1YB 3QC8B 4KDLB 2MBQA 4KSLC 1IP9A 2RR9A 4MGIE 2JZZA 1E8XA 2HTHA 3N30A 4MGYE 2UWQA 4MSMB 3V61A 1WR6E 4EZLA 1OEYJ 2FAZA 4NPNA 1XT9B 2J0KA 2C7MB 4FN2A 5JH5C 5G55A 3PZDA 3A33B 2KLGA 1LM8B 2KKCA 3L08A 3PLUA 4IUMB 1UD7A 3APFA 3L0WB 3RT3B 4GDKA 4ZDVA 2FCNA 5IA7A 4FJVB 1WE6A 3JSVA 3A4RA 3RULA 3MTNB 2NPTA 3Q3FA 1UBIA 5KHOA 2FUHB 2ZZPB 3C0RB 2BF8B 4W9LA 3K9OB 4DDID 2Z0EB 3M95A 4KDIC 3DVGY 3TBLD 5D94A 1OGWA 5G2NA 4W9FA 4BKSD 4G11A 4AJYB 1VCBA 2AYOB 3OAWA 3GOEA 5LXHA 5EDSA 3X0WA 4G50A 4A3PA 2CHXA 2L0FA 3QQ8B 4BKSA 3ZNZB 1UH6A 2R2OA 3ZW3A 1G6JA 2AWTA 3GZNI 2ZJDA 2HE7A 3ZNID 4EEWA 3ALBA 3NHEB 3TCAA 1WE7A 2O6VB 2PJHA 5D2MB 3A9JA 1AARA 3PVLA 4EKUA 2KNBA 3HHMA 3ONSA 2C5LC 4AJWA 1WX8A 4GIVA 3KYCD 3BINA 4WJQA 3QAQA 2D07B 3CF6E 1RLFA 2M4NA 3V6EB 1YIWA 3DVNV 1CMXB 2A5UA 5J2RA 2MA9B 4FBJB 1GG3A 2KANA 1UZXB 2K39A 3HIZA 3KVFB 4P7IA 3VH4B 4K81A 4MJSB 4MM3A 1WGYA 3U30A 3VQIA 3APCA 2IY0B 2YLMA 3A4SC 2CS4A 4IW0A 4MH0E 1A5RA 3IVFA 4HLEA 4GGQA 1YJ1A 2FCQA 3O65B 1L2NA 2L76A 2L7RA 2ZCBA 2LRUA 1E8WA 2KX3A 4M8NA 3V62A 1P0RA 4XX5A 4ZRJA 1KM7A 2IO0B 1RRBA 2LVPA 1WX9A 2LWPA 3AU4A 3WIMA 5JHAA 1NBFC 4E74A 2BKFA 2JVCA 2DYMA 2ZPYA 2ZVNA 4II3B 2BWFA 5IAAC 3R7RA 1Q1OA 3ZNGC 1QZEA 5L95C 2DYOA 2V4LA 2DAFA 2KXJA 1TBEA 3Q3JA 4FHJA 5CHVC 4ZRKA 4E71A 2WYQA 2FNJB 3NOBA 2FIFA 2ZNVB 1FXTB 2MWSB 3M3JA 2LVOA 2WX1A 3IG3A 3UINB 4RM9A 4DWFA 3ML9A 2KD0A 2M17A 2RPQA 4IM0A 3VTWA 2JY6A 4GDKB 3AU5A 3PRMB 2LRWA 3UQBA 1MG8A 1Q5WB 1WF9A 1IYFA 1WXAA 2O6VD 2C7NB 2IZVB 2KJ6A 4BBNC 2Z59B 2NPTB 2MW5A 3VUXA 4MDKE 2K8HA 3A9KB 3W1YA 1WMHA 3ZKJC 1TTNA 3JVZX 3IBEA 4MGKE 1E7UA 1E8ZA 3RYTA 2G45B 4XC2A 2XK5A 1OEYA 4DHJB 1ISNA 4JL9A 3R3MA 4G0NB 1I42A 1P1AA 2ZNVC 2J7QB 2KDEB 2KC2A 1V81A 4MJSA 5DPRA 4KZCA 3ML8A 2MQJA 4J6IA 4EZKA 2V3SA 3NS8A 4GSWA 5J17A 2KK8A 3ZDMC 3L13A 1WFYA 2XEWA 4W9CA 3M63B 4W9EA 5AEKB 4E3CA 2LGYA 4IC7B 4FJYA 1V5TA 1WXSA 4KVGB 4MELA 2FCSA 2G3QB 1JRUA 3IHPC 3QA8A 4MGZE 3VTUA 3UIPB 1WXMA 2KLCA 3L10B 4EZJA 4LJOB 4IWQA 2LASA 2KVRA 4DDGD 2L3ZA 4WWNA 4DK5A 4NNJB 4W9GA 2EMTA 2K8BA 4EUTA 3PHXB 3PTFC 2BYEA 2BYVE 4HPLB 4OVUA 2G4DB 3VAWA 3QIJA 2CU1A 1Z5SB 3K9PB 4ZRIA 3VUYA 3B08A 1WIAA 3NZSA 3VVWB 3ZTCA 4IM3A 2N7EA 2FIDA 2N1WA 2CHZA 3DPDA 2MSED 3PRPB 4RM8A 2CR5A 5J18A 3PPAA 4BBNF 2D2QA 1NI2A 3DQVA 4WWPA 3SDLC 3A9KA 4JGHB 2B3AA 4NJ6A 3S2AA 3PV1A 2PE9A 2N1VA 1ZGUB 3X23A 1J8CA 4HXDA 2DZIA 4DHZE 1H8CA 3R66C 4IM2A 2EMSA 4W9HA 3PHWB 3ENEA 3ZVVA 2D11A 2K1FA 1V2YA 2L00B 4DHZB 3LJ3A 2O2VA 2FCMA 2J0JA 3JYUA 2K8CA 4AP4C 1ZW7A 1WJUA 1WMHB 1D3ZA 3WAOA 1E8YA 4HDOA 4W9DA 2DZKA 3ZIMA 1WGDA 2XK5B 3KUDB 3AI5A 4HK2A 1LXDA 3D32A 3W1SA 1Z2MA 2MLBA 3OJ3A 1RFAA 3H7SA 4X57B 2KWVB 3DVNU 3UIOB 2KOXA 2WDTB 1S3SG 2OJRA 3T8MA 3ZO5B 3VXWA 4B95A 4K7UA 5C23A 4WJPA 4F1SA 1ZKHA 3VFKA 2Z0DB 1E7VA 1WJNA 2NVUI 1Y8RC 4ANUA 2DHZA 2KO3A 1WGRA 4HCNB 1YQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AZH A;  1WH3 A;  2KTR B;  2KMA A;  5FR6 A;  2A4Z A;  2MX2 A;  4DBG A;  1BT0 A;  1EO6 A;  3ZRF A;  3TJP A;  1WY8 A;  2KDB A;  3NY5 A;  2UYZ B;  4FUL A;  3ZLZ A;  1Q0W B;  2LGD A;  2K25 A;  3CSF A;  3IFW B;  4W9K A;  1TGZ B;  3I3T B;  4WQO B;  1V9J A;  1WX7 A;  3EEC A;  4BOS C;  2N9X A;  3CST A;  4KZ0 A;  4M8M A;  1WYW B;  2GBJ A;  3DCG A;  4GU2 A;  3VTV A;  4TKN A;  5LXI B;  4KIK B;  2KQ7 A;  5C1Z A;  2MP2 B;  4K1R B;  2WWZ A;  1L7Y A;  1LQB A;  3KW5 B;  4ZYN A;  3UF8 A;  3H1U A;  2JRH A;  2JWZ A;  4HWI B;  3QK0 A;  5DCN A;  1I35 A;  3SU8 X;  4EFO A;  3OLM D;  4FHK A;  2GBM A;  1H4R A;  2LXC A;  4K7W A;  2ZCC A;  3QCA A;  1UEL A;  2N9E B;  3APD A;  3DVG X;  3PSE B;  4LDT B;  2D10 A;  1EUV B;  2ASQ A;  2KJH B;  5E6P A;  4HDQ A;  1T0Y A;  2LJ5 A;  3SHQ A;  1WM3 A;  1YD8 U;  2KDF B;  1SIF A;  5JHB A;  5DPT A;  2ZPN A;  1WI0 A;  1E5W A;  4RMA A;  5E6N A;  4BKT A;  2KWC A;  3L17 A;  4HPM B;  2NS5 A;  4WWO A;  5LLI A;  4ANW A;  3MHS D;  4I6N B;  2HD5 B;  4NQK E;  2MBO A;  2O2V B;  2REX A;  1P9D U;  2G4S A;  3V60 A;  2RGF A;  1S1Q B;  4BFR A;  1M94 A;  5BO4 B;  3QJZ A;  4IG7 B;  5HKH A;  3PRZ A;  3EC8 A;  2KTR A;  2CHW A;  4K7S A;  2GBN A;  1U4A A;  2I1J A;  4GMV A;  3HM6 X;  2JF5 A;  3KUZ A;  2C60 A;  2DX5 B;  3UQA A;  2GMI C;  4PS3 A;  2DYB A;  4TV3 A;  1V49 A;  3P2B A;  2AL6 A;  3BY4 B;  1SE9 A;  4TUU A;  2LXA A;  4OVV A;  5AZF A;  1E90 A;  2IO3 B;  4BVU C;  2NR2 A;  3DBR I;  4NY0 A;  4IWP A;  4KIK A;  3U8Z A;  4FLH A;  2MP2 A;  2MBH A;  3TL5 A;  3RCZ A;  1F9J A;  3TMP B;  1WGG A;  2L0T A;  1LFD A;  3RUI B;  1WZ0 A;  3WAM A;  2CKH B;  5DPW A;  3ECI A;  3MJW A;  5KHQ A;  3NZU A;  2KDI A;  1GUA B;  2PE6 B;  2GBR A;  3AXC A;  4LDT D;  4PYZ A;  1GJZ A;  4II2 B;  1WXV A;  3H7P B;  4ICV A;  2DAJ A;  4A3O A;  1YX6 B;  3W1S C;  2JT4 B;  4DXA B;  4GB9 A;  2BWE S;  2IO1 B;  4B6W A;  4BKG A;  4ANX A;  3N32 A;  4A20 A;  5E6O A;  2JRI B;  3ZDT A;  3B1L X;  3VUW A;  2DEN B;  1WJ4 A;  2QHO A;  4ANV A;  2HJ8 A;  1RAX A;  1V80 A;  3T9L A;  2KFJ A;  2ZVO A;  2K6D B;  2IO2 B;  2BKR B;  2JZ3 B;  1NDD A;  3DBH I;  2NBU A;  3WAP A;  2MBE A;  2PEA A;  1P98 A;  4BOZ B;  4G3X B;  4KSK C;  5CHW A;  4W9I A;  3PLV A;  4GDL B;  4KV2 A;  1WGH A;  1UGM A;  1GC6 A;  4MSQ B;  2GBK A;  2N9P C;  2NBV B;  4WJO A;  1EF1 A;  1R4N I;  2BYF A;  4W9J A;  2MCN B;  3RD2 A;  2IBI B;  3R7Q A;  4URK A;  3ZRC A;  1C3T A;  4YL8 A;  1V86 A;  4B9K A;  3HK0 A;  2VRR B;  2KQS A;  3A1Q A;  1VD2 A;  3JW0 X;  4ICU A;  4I6L B;  2KFK A;  5D6J B;  3CMM B;  4LJP B;  5TR5 A;  2RD0 A;  2JUO A;  4I6P A;  2Y5B B;  1PQS A;  4MEM A;  4AWJ A;  3WA0 A;  2RSU A;  4CYE A;  2DZM A;  2KHW B;  1SGH A;  3EFU A;  1V5O A;  2LGX A;  3H9D A;  2KX0 A;  3V6C B;  3L54 A;  1P3Q U;  3H7P A;  4NAW B;  3PRE A;  2ZEQ A;  4WJN A;  2J0M A;  4GOC A;  5CHF A;  3RZW C;  2C9W B;  2IY1 B;  2XBB C;  4JLC A;  1J19 A;  1UBQ A;  3M62 B;  1R4M I;  3SD5 A;  4WAA A;  2KJR A;  3DOW A;  3ZTD A;  3L16 A;  3RZF A;  2NBW B;  1WR1 A;  2MRP A;  1TZ1 A;  3DDC B;  2KTF A;  2LVQ A;  5AZG A;  1GC7 A;  4JQW C;  3VHT C;  4NQL B;  2BPS A;  4FJZ A;  5L83 A;  5DPS A;  4ASW C;  2KC1 A;  2L05 A;  2KZR A;  3KH0 A;  4NJ7 A;  2N7D A;  2D3G A;  2DZJ A;  5D7G A;  2IYD B;  1OQY A;  4CHK A;  1HE8 A;  3B0A A;  3EHV A;  4TQ1 A;  1WZ3 A;  2M1M A;  5CTR C;  3U7D A;  3QAR A;  4GXB A;  4GDL A;  4DHJ D;  2JXX A;  2M0X A;  4N9F 4;  4FA6 A;  2GOW A;  3QX1 A;  4IWO A;  2I1K A;  3ZNH B;  3N3K B;  4HCP B;  4XZ4 A;  1OTR B;  3OJ4 B;  2LD9 A;  5JZE B;  2BGF A;  4F8C B;  1YX5 B;  3JSV B;  4FAD A;  1XQQ A;  2MBB B;  3LDZ E;  2YVC A;  2R2Q A;  3KUC B;  4LCD E;  5CX3 A;  3VH3 B;  2C7H A;  2O6V A;  3VDZ A;  1KLV A;  3QHT A;  1EF5 A;  4AOF A;  2M8S A;  2K6Q A;  3H6N A;  2OOB B;  4TQ0 A;  3PS6 A;  1WJ6 A;  4PS7 A;  1KOT A;  4M0W B;  4EOY A;  4F7Z A;  1WRD B;  3QWZ B;  2WX0 A;  2LI5 A;  3PGE A;  2V1Y A;  2KN5 A;  3HM3 A;  2EKE C;  2N4F A;  4HJK A;  2NCN A;  1V6E A;  2PPH A;  1WM2 A;  2W9N A;  4NAW A;  4CO7 A;  3UGB B;  2KMC A;  1KJT A;  1GNU A;  1IPG A;  2L8J A;  2LUE A;  2AEH A;  3PT2 B;  1K8R B;  3WAL A;  3DBL I;  3ZUN A;  2KWU B;  1X1M A;  3A1Q B;  3WAN A;  2AL3 A;  2JPH A;  4PYU A;  5GMV A;  4HVB A;  2KFK B;  1J0G A;  4AUQ C;  3AUL A;  3TIX A;  3A9J B;  4GN1 A;  3DBS A;  4JIO U;  1XD3 B;  2LZ6 A;  4PS8 A;  3KYD D;  1C1Y B;  3QC8 B;  4KDL B;  2MBQ A;  4KSL C;  1IP9 A;  2RR9 A;  4MGI E;  2JZZ A;  1E8X A;  2HTH A;  3N30 A;  4MGY E;  2UWQ A;  4MSM B;  3V61 A;  1WR6 E;  4EZL A;  1OEY J;  2FAZ A;  4NPN A;  1XT9 B;  2J0K A;  2C7M B;  4FN2 A;  5JH5 C;  5G55 A;  3PZD A;  3A33 B;  2KLG A;  1LM8 B;  2KKC A;  3L08 A;  3PLU A;  4IUM B;  1UD7 A;  3APF A;  3L0W B;  3RT3 B;  4GDK A;  4ZDV A;  2FCN A;  5IA7 A;  4FJV B;  1WE6 A;  3JSV A;  3A4R A;  3RUL A;  3MTN B;  2NPT A;  3Q3F A;  1UBI A;  5KHO A;  2FUH B;  2ZZP B;  3C0R B;  2BF8 B;  4W9L A;  3K9O B;  4DDI D;  2Z0E B;  3M95 A;  4KDI C;  3DVG Y;  3TBL D;  5D94 A;  1OGW A;  5G2N A;  4W9F A;  4BKS D;  4G11 A;  4AJY B;  1VCB A;  2AYO B;  3OAW A;  3GOE A;  5LXH A;  5EDS A;  3X0W A;  4G50 A;  4A3P A;  2CHX A;  2L0F A;  3QQ8 B;  4BKS A;  3ZNZ B;  1UH6 A;  2R2O A;  3ZW3 A;  1G6J A;  2AWT A;  3GZN I;  2ZJD A;  2HE7 A;  3ZNI D;  4EEW A;  3ALB A;  3NHE B;  3TCA A;  1WE7 A;  2O6V B;  2PJH A;  5D2M B;  3A9J A;  1AAR A;  3PVL A;  4EKU A;  2KNB A;  3HHM A;  3ONS A;  2C5L C;  4AJW A;  1WX8 A;  4GIV A;  3KYC D;  3BIN A;  4WJQ A;  3QAQ A;  2D07 B;  3CF6 E;  1RLF A;  2M4N A;  3V6E B;  1YIW A;  3DVN V;  1CMX B;  2A5U A;  5J2R A;  2MA9 B;  4FBJ B;  1GG3 A;  2KAN A;  1UZX B;  2K39 A;  3HIZ A;  3KVF B;  4P7I A;  3VH4 B;  4K81 A;  4MJS B;  4MM3 A;  1WGY A;  3U30 A;  3VQI A;  3APC A;  2IY0 B;  2YLM A;  3A4S C;  2CS4 A;  4IW0 A;  4MH0 E;  1A5R A;  3IVF A;  4HLE A;  4GGQ A;  1YJ1 A;  2FCQ A;  3O65 B;  1L2N A;  2L76 A;  2L7R A;  2ZCB A;  2LRU A;  1E8W A;  2KX3 A;  4M8N A;  3V62 A;  1P0R A;  4XX5 A;  4ZRJ A;  1KM7 A;  2IO0 B;  1RRB A;  2LVP A;  1WX9 A;  2LWP A;  3AU4 A;  3WIM A;  5JHA A;  1NBF C;  4E74 A;  2BKF A;  2JVC A;  2DYM A;  2ZPY A;  2ZVN A;  4II3 B;  2BWF A;  5IAA C;  3R7R A;  1Q1O A;  3ZNG C;  1QZE A;  5L95 C;  2DYO A;  2V4L A;  2DAF A;  2KXJ A;  1TBE A;  3Q3J A;  4FHJ A;  5CHV C;  4ZRK A;  4E71 A;  2WYQ A;  2FNJ B;  3NOB A;  2FIF A;  2ZNV B;  1FXT B;  2MWS B;  3M3J A;  2LVO A;  2WX1 A;  3IG3 A;  3UIN B;  4RM9 A;  4DWF A;  3ML9 A;  2KD0 A;  2M17 A;  2RPQ A;  4IM0 A;  3VTW A;  2JY6 A;  4GDK B;  3AU5 A;  3PRM B;  2LRW A;  3UQB A;  1MG8 A;  1Q5W B;  1WF9 A;  1IYF A;  1WXA A;  2O6V D;  2C7N B;  2IZV B;  2KJ6 A;  4BBN C;  2Z59 B;  2NPT B;  2MW5 A;  3VUX A;  4MDK E;  2K8H A;  3A9K B;  3W1Y A;  1WMH A;  3ZKJ C;  1TTN A;  3JVZ X;  3IBE A;  4MGK E;  1E7U A;  1E8Z A;  3RYT A;  2G45 B;  4XC2 A;  2XK5 A;  1OEY A;  4DHJ B;  1ISN A;  4JL9 A;  3R3M A;  4G0N B;  1I42 A;  1P1A A;  2ZNV C;  2J7Q B;  2KDE B;  2KC2 A;  1V81 A;  4MJS A;  5DPR A;  4KZC A;  3ML8 A;  2MQJ A;  4J6I A;  4EZK A;  2V3S A;  3NS8 A;  4GSW A;  5J17 A;  2KK8 A;  3ZDM C;  3L13 A;  1WFY A;  2XEW A;  4W9C A;  3M63 B;  4W9E A;  5AEK B;  4E3C A;  2LGY A;  4IC7 B;  4FJY A;  1V5T A;  1WXS A;  4KVG B;  4MEL A;  2FCS A;  2G3Q B;  1JRU A;  3IHP C;  3QA8 A;  4MGZ E;  3VTU A;  3UIP B;  1WXM A;  2KLC A;  3L10 B;  4EZJ A;  4LJO B;  4IWQ A;  2LAS A;  2KVR A;  4DDG D;  2L3Z A;  4WWN A;  4DK5 A;  4NNJ B;  4W9G A;  2EMT A;  2K8B A;  4EUT A;  3PHX B;  3PTF C;  2BYE A;  2BYV E;  4HPL B;  4OVU A;  2G4D B;  3VAW A;  3QIJ A;  2CU1 A;  1Z5S B;  3K9P B;  4ZRI A;  3VUY A;  3B08 A;  1WIA A;  3NZS A;  3VVW B;  3ZTC A;  4IM3 A;  2N7E A;  2FID A;  2N1W A;  2CHZ A;  3DPD A;  2MSE D;  3PRP B;  4RM8 A;  2CR5 A;  5J18 A;  3PPA A;  4BBN F;  2D2Q A;  1NI2 A;  3DQV A;  4WWP A;  3SDL C;  3A9K A;  4JGH B;  2B3A A;  4NJ6 A;  3S2A A;  3PV1 A;  2PE9 A;  2N1V A;  1ZGU B;  3X23 A;  1J8C A;  4HXD A;  2DZI A;  4DHZ E;  1H8C A;  3R66 C;  4IM2 A;  2EMS A;  4W9H A;  3PHW B;  3ENE A;  3ZVV A;  2D11 A;  2K1F A;  1V2Y A;  2L00 B;  4DHZ B;  3LJ3 A;  2O2V A;  2FCM A;  2J0J A;  3JYU A;  2K8C A;  4AP4 C;  1ZW7 A;  1WJU A;  1WMH B;  1D3Z A;  3WAO A;  1E8Y A;  4HDO A;  4W9D A;  2DZK A;  3ZIM A;  1WGD A;  2XK5 B;  3KUD B;  3AI5 A;  4HK2 A;  1LXD A;  3D32 A;  3W1S A;  1Z2M A;  2MLB A;  3OJ3 A;  1RFA A;  3H7S A;  4X57 B;  2KWV B;  3DVN U;  3UIO B;  2KOX A;  2WDT B;  1S3S G;  2OJR A;  3T8M A;  3ZO5 B;  3VXW A;  4B95 A;  4K7U A;  5C23 A;  4WJP A;  4F1S A;  1ZKH A;  3VFK A;  2Z0D B;  1E7V A;  1WJN A;  2NVU I;  1Y8R C;  4ANU A;  2DHZ A;  2KO3 A;  1WGR A;  4HCN B;  1YQB A; 
#chains in the Genus database with same CATH topology
 1WH3 A;  2KMA A;  2IGH A;  1EO6 A;  1GAQ B;  3WCQ A;  3ZLZ A;  3AE4 B;  3NZ3 A;  2K25 A;  2WQY B;  3CSF A;  1E7P B;  1V9J A;  2TSS A;  2JYT A;  4ZHP A;  1TYG B;  3AE7 B;  2WLB A;  2GBJ A;  3VTV A;  5LXI B;  1WWT A;  3RNF C;  2MP2 B;  2W54 A;  3AEG B;  4K1R B;  2WWZ A;  1L7Y A;  3UF8 A;  2Z8L A;  3SFD B;  4HWI B;  3QK0 A;  2Y5P A;  4EFO A;  1WXQ A;  2VZK B;  2ZCC A;  3EFC A;  3DVG X;  3PSE B;  1VZ6 A;  2J52 A;  2KJH B;  5E6P A;  4XWT A;  3SHQ A;  1WM3 A;  2KDF B;  5DPT A;  2ZPN A;  1E5W A;  5E6N A;  4BKT A;  5D3D A;  1ESF A;  1SBB B;  2WDV B;  3ZQ4 A;  3MHS D;  4I6N B;  2W3R A;  2G4S A;  3AEE B;  1S1Q B;  1M94 A;  1VRA B;  2I2Y A;  1NVI D;  5HKH A;  1T6B X;  2GBN A;  1B1Z A;  2JF5 A;  1I4P A;  2WP9 B;  4PS3 A;  3V3X A;  4TV3 A;  3Q8F A;  3SEB A;  4TUU A;  1Q10 A;  1ET9 A;  1E90 A;  3Q69 A;  2NR2 A;  3DBR I;  4FLH A;  2MP2 A;  3TL5 A;  3TMP B;  1XLQ A;  3H8H A;  3RNC C;  1WZ0 A;  3WAM A;  2CKH B;  3NZU A;  3AXC A;  1WXV A;  3J9C A;  1YX6 B;  1NYR A;  3W1S C;  2X8X X;  4DXA B;  4A20 A;  5E6O A;  2JRI B;  3ZDT A;  1RAX A;  2JZ3 B;  2NBU A;  1PGX A;  1VJK A;  4HRS A;  3WAP A;  2MBE A;  3E56 A;  4BOZ B;  3LB8 C;  4W9I A;  2ZW1 A;  5HI1 A;  2Y5C A;  4KX6 B;  2MJ3 A;  4DHJ B;  5J2R A;  4JWS C;  4W9J A;  2BYF A;  3RD2 A;  3R7Q A;  1C3T A;  3EUB 2;  1XCT L;  3HK0 A;  2KQS A;  3CMM B;  1UF0 A;  2LEK A;  4I6P A;  1FRD A;  2WGS A;  4MEM A;  3MFG A;  2RSU A;  3NS1 A;  1SGH A;  3EFU A;  4HEA 1;  2KX0 A;  2JWU A;  2JSV X;  3L54 A;  1P3Q U;  3BVM A;  3PRE A;  5CHF A;  2IY1 B;  4JLC A;  2QDF A;  4YTN B;  4ITK A;  2KJR A;  3DOW A;  3Q2A C;  1QIL A;  1RYJ A;  3RZF A;  3DDC B;  2LVQ A;  1GC7 A;  1ZUD 2;  4HJG E;  2KZR A;  2GI9 A;  4YSY B;  4NJ7 A;  1ZDV A;  5D7G A;  3P4S B;  1HE8 A;  1AYF A;  2ONQ A;  4TQ1 A;  1N6Z A;  1TS2 A;  1TY2 A;  3U7D A;  4GXB A;  4N9F 4;  4IWO A;  3ZNH B;  4HCP B;  4XZ4 A;  1KRH A;  5JZE B;  4F8C B;  4FAD A;  3LDZ E;  2SEB D;  3KUC B;  3VH3 B;  1EF5 A;  1HTQ A;  2M8S A;  2OOB B;  3NG0 A;  4TQ0 A;  1AN8 A;  3KWV A;  4PS7 A;  2M19 A;  2EEL A;  4JE3 B;  1T5X D;  1WRD B;  4B0E A;  2M56 B;  2WX0 A;  1I7H A;  2EKE C;  1D5M C;  2NCN A;  2PPH A;  1WM2 A;  2W9N A;  1IPG A;  2BW2 A;  2AEH A;  1DOI A;  1K8R B;  3N1Y C;  2KWU B;  3A1Q B;  3WAN A;  5GMV A;  4AUQ C;  2INP E;  3AUL A;  4GN1 A;  1C77 A;  3L4P A;  1TY0 A;  3HRD D;  3KYD D;  1C1Y B;  4C4V B;  2H88 B;  4KSL C;  2JZZ A;  1E8X A;  1I4H A;  3N30 A;  1L6U A;  3V61 A;  1WSP A;  1WR6 E;  1OEY J;  1T3Q A;  4NZL B;  3GE8 C;  3GE3 C;  1QOA A;  2J0K A;  4S0R A;  1TJE A;  2DBY A;  3PLU A;  1UD7 A;  2ON8 A;  2LFI A;  3RT3 B;  2FCN A;  1HA5 A;  2WXK A;  2KAJ A;  2IDY A;  2FUH B;  2ZZP B;  2BF8 B;  1CJE A;  3M95 A;  2W3S A;  2K22 A;  1OGW A;  3FIL B;  2AYO B;  2WXL A;  4BKS A;  1HTO A;  2R2O A;  1NEK B;  3AE2 B;  1YJI A;  2L32 A;  4EEW A;  3Q8E A;  2WXN A;  2KQ4 X;  3B2G A;  2KNB A;  4JX1 C;  2C5L C;  4GIV A;  3BIN A;  1FO4 A;  4FBJ B;  1GG3 A;  3KVF B;  4HKQ A;  3U30 A;  1FCC C;  1PGB A;  4IW0 A;  4HLE A;  3O65 B;  3BWU D;  2ZCB A;  2KX3 A;  2K0P A;  1KM7 A;  3U2S C;  2IPK D;  4RH6 A;  4E74 A;  4L23 A;  4II3 B;  3R7R A;  2V4L A;  5LNK 1;  2DAF A;  5H8Y E;  4N58 A;  3FIL A;  4XGA B;  2OHF A;  2WX1 A;  3IG3 A;  3ZJV A;  4RM9 A;  3ML9 A;  2RPQ A;  3VTW A;  1MG4 A;  3UQB A;  1MG8 A;  2GB1 A;  1C4P A;  3VUX A;  2MW5 A;  2K8H A;  3ZKJ C;  3EGR A;  3FKY A;  1E7U A;  1E8Z A;  1OEY A;  1TS3 A;  1F1H A;  3I63 C;  1K50 A;  1QF6 A;  5DPR A;  3ML8 A;  2WU2 B;  5J17 A;  2KK8 A;  4HKZ E;  1WFY A;  2I38 A;  1TS5 A;  2LGS A;  4E3C A;  4IDI A;  1XEE A;  4RGO S;  4IC7 B;  3NVY A;  5HHD G;  2J4X A;  4DXG A;  4XDD A;  4LJO B;  4IWQ A;  2L3Z A;  3TUO A;  4DK5 A;  4NNJ B;  2CU3 A;  2EMT A;  4LNI A;  1T0S C;  2AQ3 B;  2BYE A;  5BYS A;  1JWA D;  4OVU A;  2G4D B;  2N9K A;  2CU1 A;  3K9P B;  1FIQ A;  3ZTC A;  4IM3 A;  2CHZ A;  2CR5 A;  5J18 A;  3PPA A;  3DQV A;  3SDL C;  4YTM B;  3MC0 B;  3PV1 A;  4YXD B;  2N1V A;  4YTP B;  2DZI A;  1FRR A;  4QAY A;  3ZVV A;  3DBL B;  4DHZ B;  1JWS D;  1DOX A;  4AP4 C;  1SB3 C;  3ZIM A;  1HQR D;  1FD6 A;  2KYW A;  3UIO B;  3Q3N C;  3P1M A;  1TS4 A;  2G9H D;  2PW9 A;  1KTK A;  1D5Z C;  1K51 A;  2DHZ A;  2OJW A;  3EA6 A;  1YQB A;  1JQ4 A;  2A4Z A;  1NEN B;  3CWI A;  3TJP A;  2KDB A;  3AE3 B;  3IFW B;  3ZXR A;  4WQO B;  1WX7 A;  3EEC A;  4BOS C;  3TEZ A;  4AS1 A;  1WYW B;  3DCG A;  3NJT A;  4TKN A;  1KH0 A;  4KIK B;  4RNA A;  5C1Z A;  3HUI A;  3KW5 B;  3H1U A;  1PYW D;  1HZ6 A;  3OLM D;  1N62 A;  2GBM A;  5IO9 A;  4K7W A;  3QCA A;  1ZXI A;  2B76 B;  4HDQ A;  2CJO A;  4RMA A;  1E9M A;  4HPM B;  4WWO A;  5E6J A;  2O2V B;  3V60 A;  2WXQ A;  1MI0 A;  1XXG A;  3MC9 A;  3QJZ A;  3EC8 A;  1IGC A;  2QSD A;  2CHW A;  1U4A A;  1B9R A;  4PT5 A;  3UQA A;  1E10 A;  3P2B A;  1IGD A;  1SEB D;  5IOI A;  2LXA A;  4NY0 A;  4KIK A;  4RGN A;  3RCZ A;  1JW9 D;  1WGG A;  2L0T A;  3RUI B;  1UGJ A;  3MJW A;  2KDI A;  1GUA B;  2QIL A;  4LDT D;  4PYZ A;  1GJZ A;  1SF0 A;  2WXH A;  4ICV A;  1V8C A;  4A3O A;  4GB9 A;  2GRI A;  2FBW B;  4PK1 A;  4K3C A;  3ZGZ A;  1V80 A;  2KFJ A;  1KLU D;  2IO2 B;  1TKY A;  1GB4 A;  1NDD A;  2DLB A;  2KWD A;  3LYY A;  1PDX A;  1ZPS A;  2PEA A;  4G3X B;  4YSZ B;  2N9P C;  2MCN B;  4URK A;  3ZRC A;  1QLB B;  4B9K A;  2KFK A;  5D6J B;  1QKZ A;  5TR5 A;  1C76 A;  2RD0 A;  2JUO A;  4AWJ A;  3WA0 A;  1ACC A;  3P4P B;  2KHW B;  3PZ7 A;  1V5O A;  2LGX A;  3RPF C;  2ZEQ A;  4WJN A;  2J0M A;  2LJI A;  4C56 C;  1UBQ A;  3L16 A;  3NVV A;  2NBW B;  3TCA A;  2MRP A;  5AZG A;  2BPS A;  3DWM A;  3KH0 A;  2WXF A;  3NVW A;  1L5P A;  2IYD B;  4CHK A;  1CZP A;  3EHV A;  1WZ3 A;  1DYQ A;  3FAH A;  5CTR C;  2ACZ B;  4K3B A;  4FA6 A;  2LHD A;  2I1K A;  2ZW0 A;  1VDV A;  4ZOH C;  1XQQ A;  4UDU C;  1SSN A;  3AN1 A;  2RPV A;  4AOF A;  3H6N A;  1T0R C;  1CK1 A;  2KDM A;  3PS6 A;  4M0W B;  4OZB A;  4F7Z A;  2V3N A;  3PGE A;  2V1Y A;  4OHJ A;  3UGB B;  2KMC A;  1KJT A;  1GNU A;  2L8J A;  3PT2 B;  3DBL I;  3ZUN A;  3SFE B;  1X1M A;  4HVB A;  1J0G A;  2FE8 A;  1XD3 B;  2LZ6 A;  4ZHO A;  4KDL B;  4MGI E;  3HVZ A;  4KKJ A;  1P7E A;  2UWQ A;  2RMM A;  2WHI A;  3RNB C;  4EZL A;  1RFK A;  4RF1 A;  1D6E C;  4FN2 A;  5G55 A;  4KGT A;  1EWY C;  3L08 A;  4IUM B;  3APF A;  3L0W B;  1FFU A;  4ZDV A;  5IA7 A;  4FJV B;  2AQ2 B;  3A4R A;  2NPT A;  4W9L A;  1VZ7 A;  2MHJ A;  4KDI C;  4P6V F;  5G5G A;  3DVG Y;  3TBL D;  5D94 A;  2G1E A;  4M0W A;  2INN E;  3Q3M C;  3AMZ A;  1UWX A;  3GOE A;  4GLS C;  3ZNZ B;  1UH6 A;  4RFB A;  2BVC A;  3ALB A;  2WXG A;  5D2M B;  1SJE D;  4EKU A;  3HHM A;  4AJW A;  1WX8 A;  3KYC D;  2D07 B;  3V6E B;  2A5U A;  2MA9 B;  2WXO A;  3W2D A;  3VH4 B;  2QCZ A;  4MJS B;  4MM3 A;  3FC4 A;  1WGY A;  4A9A A;  3APC A;  2YLM A;  4MH0 E;  1A5R A;  2D3C A;  4GGQ A;  1L2N A;  1QOB A;  4M8N A;  1L4Z B;  4ZRJ A;  3AEB B;  3WIM A;  2LWP A;  1WX9 A;  5JHA A;  2BKF A;  2JVC A;  2DYM A;  1PGA A;  2DYO A;  4ZRK A;  2WYQ A;  2FIF A;  1FXT B;  1I4R A;  4ACF A;  2LVO A;  4P16 A;  1OQR A;  4DWF A;  2KMM A;  4IM0 A;  3PRM B;  1Q5W B;  1WXA A;  2C7N B;  2IZV B;  2KJ6 A;  2WDQ B;  4XE0 A;  4MDK E;  1WMH A;  4HRO A;  2N9L A;  2IJ0 A;  4LNF A;  3IBE A;  4MGK E;  3RYT A;  3R8B A;  2G45 B;  3AE6 B;  4EE2 A;  2PLP A;  4O1N A;  3IAM 1;  3R3M A;  3ZJU A;  2J7Q B;  1ZE3 D;  4MJS A;  1SJH D;  2MQJ A;  2V3S A;  1R4M B;  3NS8 A;  2L52 A;  3TEY A;  3ZDM C;  3DWG C;  3BYY B;  2ICI A;  3M63 B;  1ET6 A;  3BII D;  1V5T A;  4MEL A;  5D3I B;  3IHP C;  3VTU A;  3E9S A;  1WXM A;  2KLC A;  4EZJ A;  4RCO A;  1EU3 A;  3AED B;  3PTF C;  4HPL B;  5MPO A;  2PIA A;  4LNN A;  1I4G A;  4WIP A;  3QIJ A;  1Z5S B;  1YN4 A;  4Q2J A;  4YWG G;  3B08 A;  1WIA A;  3VVW B;  2JXT A;  3AE1 B;  2FID A;  2N1W A;  3DPD A;  1TIF A;  2MSE D;  4RM8 A;  4BBN F;  1PFD A;  2HJ1 A;  2PE9 A;  2IND C;  4HXD A;  5HG2 A;  3RNE C;  3R66 C;  2D11 A;  2BS2 B;  2K1F A;  2D5G A;  2H89 B;  2BYT A;  3JYU A;  4XYC A;  1FM0 D;  1WJU A;  1D3Z A;  1V97 A;  1E8Y A;  4HDO A;  2DZK A;  5FKA C;  3KUD B;  2MEK A;  3AI5 A;  4HK2 A;  5FK9 C;  1LXD A;  3CIR B;  4X57 B;  3H7S A;  3DVN U;  1JRP A;  1S3S G;  2OJR A;  3BZD B;  3ZO5 B;  1JRO A;  4K7U A;  4F1S A;  1ZKH A;  3VFK A;  2JU6 X;  2NVU I;  2WXR A;  3MHZ A;  4ANU A;  2V3P A;  1L0X B;  5AUK A;  4HCN B;  2KTR B;  4DBG A;  1BT0 A;  4FXC A;  2PVG C;  1WY8 A;  2D3A A;  2Y3A A;  3T3N A;  4R3D A;  4W9K A;  3I3T B;  2BB5 A;  3CST A;  1RM6 C;  1C9F A;  4OZC A;  2HDE A;  3GZN B;  4BAX A;  2JRH A;  2JWZ A;  2AQ1 B;  1R7S A;  2OED A;  3SU8 X;  4FHK A;  1M4V A;  2LXC A;  4XWW A;  3APD A;  1L0Y B;  3RFZ B;  3AEF B;  2D10 A;  4LDT B;  1EUV B;  3VR8 B;  1T0Y A;  2LJ5 A;  5EE0 A;  1YD8 U;  5JHB A;  1WI0 A;  5LLI A;  4WWM A;  2REX A;  1P9D U;  4C00 A;  2RGF A;  1MJD A;  4IG7 B;  1AW7 A;  2KTR A;  4J3O D;  4A6Q A;  4K7S A;  3HM6 X;  1UUP A;  3RMK C;  3B2F A;  2C60 A;  2DX5 B;  1D4B A;  3NRZ A;  2DYB A;  1V49 A;  1N60 A;  3BY4 B;  3I9V 1;  1OFF A;  1V1O A;  1F0Z A;  5AZF A;  2IO3 B;  4BVU C;  1MHX A;  3U8Z A;  1L6V A;  2W55 A;  3GB1 A;  2MBH A;  3NVZ A;  1C4C A;  5DPW A;  3ECI A;  5KHQ A;  2PE6 B;  1KLG D;  2GBR A;  4II2 B;  3H7P B;  5C2T B;  3R2I A;  1JWM D;  2IO1 B;  1YN5 A;  4ANX A;  3N32 A;  1GB1 A;  1C78 A;  3VUW A;  1WJ4 A;  2QHO A;  2WU5 B;  4ANV A;  3KQ4 A;  3T9L A;  2ZVO A;  1FPY A;  2LHE A;  1N5W A;  3BK1 A;  4IOI E;  4BZA A;  4GDL B;  1UGM A;  1GC6 A;  4MSQ B;  2GBK A;  1EF1 A;  2IBI B;  4YL8 A;  3N9Y C;  2VRR B;  1RWS A;  3ZYY X;  3DBR B;  2R61 A;  1J7A A;  2N7J A;  4LJP B;  1DOY A;  2BQQ A;  2QC8 A;  1YOV B;  1FEH A;  4CYE A;  4LLG M;  3H9D A;  3TSS A;  1P7F A;  2RDH A;  3H7P A;  3IAS 1;  3RZW C;  2XBB C;  1J19 A;  4US9 A;  3M62 B;  1R4M I;  3SD5 A;  5I4D A;  3ZTD A;  3AM9 A;  1WR1 A;  1TZ1 A;  4KKI A;  2KTF A;  4JQW C;  4FJZ A;  2K3U A;  5DPS A;  2D3G A;  1MHH E;  2QIE B;  3MJ5 A;  3I57 A;  2M1M A;  3BVG A;  3QAR A;  3ZJT A;  4GDL A;  3T3O A;  2JXX A;  2M0X A;  2BB6 A;  1V1P B;  2PMV A;  2GOW A;  4ARC A;  1F2R C;  2UU7 A;  1EM7 A;  3N3K B;  1DGJ A;  1OTR B;  3OJ4 B;  2VH1 A;  3RNA C;  2LD9 A;  2BGF A;  3JSV B;  1QOG A;  2WXP A;  1LO5 D;  2YVC A;  4LCD E;  2C7H A;  2O6V A;  4WUR A;  2V9H A;  4ARI A;  2K6Q A;  1FMA D;  4S17 A;  4OVZ A;  4EOY A;  3QWZ B;  2DNF A;  2NMQ A;  1V6E A;  5H92 C;  1YQ3 B;  2AL3 A;  4PYU A;  2KFK B;  3TIX A;  3RNG C;  4PS8 A;  2MBQ A;  2RR9 A;  4MGY E;  2FAZ A;  1XLP A;  4NPN A;  1XT9 B;  2X38 A;  3W5V B;  1YJJ A;  1V1P A;  2KAC A;  3PZD A;  3A33 B;  2KKC A;  4GDK A;  1YMH E;  3DHI C;  3JSV A;  4D2K A;  3U4E G;  3MTN B;  4C80 A;  5KHO A;  3C0R B;  4DDI D;  3TEX A;  2WS3 B;  4W9F A;  1YN3 A;  4G11 A;  1VCB A;  3OAW A;  1Y56 A;  5EDS A;  3X0W A;  4G50 A;  4A3P A;  2CHX A;  1FNW A;  2RDB C;  3N1X C;  1AWD A;  2AWT A;  3GZN I;  4ZRQ A;  1FNV A;  5T8I A;  3NHE B;  2VH2 A;  1WE7 A;  2IGD A;  2WXM A;  1AAR A;  4ZYS A;  3OG5 A;  2QEJ C;  3ONS A;  2BS3 B;  1SE4 A;  3QAQ A;  3AE5 B;  1ZOY B;  1N63 A;  1YIW A;  3DVN V;  3Q8A A;  1STE A;  2K39 A;  3HIZ A;  4P7I A;  4K81 A;  2CS4 A;  3URY A;  1YJ1 A;  2L76 A;  2L7R A;  1E8W A;  3P63 A;  3V62 A;  4CQN A;  4XX5 A;  2IO0 B;  3Q8C A;  1RRB A;  2LVP A;  3DBH B;  2J53 A;  2ZPY A;  2ZVN A;  5IAA C;  2BWF A;  5L95 C;  2KXJ A;  4E71 A;  2FNJ B;  3R2T A;  3Q3O C;  2ZNV B;  2MWS B;  1BUI C;  1L4D B;  1R4N B;  4NAM A;  3UIN B;  2N0S B;  2KD0 A;  5EE3 A;  3IT4 B;  2LRW A;  3AEA B;  2O6V D;  4BBN C;  2GLS A;  2Z59 B;  2NPT B;  1XF5 L;  3A9K B;  3W1Y A;  1TTN A;  4AQ7 A;  4XC2 A;  4MT5 A;  2XK5 A;  4JL9 A;  3B9J A;  2MJD A;  1I42 A;  1E0Z A;  2ZNV C;  1VLB A;  2KDE B;  1V81 A;  4EZK A;  1VZ8 A;  1XLN A;  2JZP A;  3VR9 B;  3DHH C;  4W9E A;  5AEK B;  1WXS A;  1A70 A;  4MGZ E;  3L10 B;  1SE2 A;  1WYG A;  4M00 A;  3VRB B;  4W9G A;  2K8B A;  4MM3 B;  4EUT A;  3PHX B;  1SXT A;  4MAC A;  2BYV E;  3U7Z A;  3VUY A;  4ZRI A;  2WDR B;  4WQM A;  2HTM E;  3PRP B;  1YQ4 B;  4DQO C;  4US8 A;  2QMT A;  4WWP A;  3A9K A;  1ZXH A;  5BYQ A;  3ABV B;  4NJ6 A;  3S2A A;  1ZGU B;  1F2R I;  1H8C A;  1IBX B;  4KGS A;  4W9H A;  3ENE A;  2JQR B;  2JX5 A;  1V2Y A;  1C79 A;  3C8Y A;  2XNA C;  2FCM A;  2J0J A;  3BK2 A;  1T0Q C;  1ZW7 A;  1WMH B;  2WXI A;  2EKI A;  2IGG A;  1J7C A;  1I4X A;  3D32 A;  2XN9 C;  3W1S A;  2MLB A;  1RFA A;  4RGM A;  2L1A A;  2J42 A;  2KOX A;  3VXW A;  4A55 A;  4WJP A;  1E7V A;  1NYQ A;  4LNK A;  1WGR A;  2BS4 B;  1XO3 A;  2PKO A;  5AZH A;  1GPX A;  5FR6 A;  2MX2 A;  1MFW A;  3ZRF A;  3NY5 A;  4HPP A;  4FUL A;  2UYZ B;  4JWU C;  1Q0W B;  1GOZ A;  2LGD A;  2YEP B;  3P4R B;  1TGZ B;  1TT5 B;  2KN4 A;  2N9X A;  4KZ0 A;  2PVO D;  4M8M A;  2KT7 A;  3RN9 C;  4GU2 A;  1IBX A;  2PTL A;  2KQ7 A;  2MJE A;  1LQB A;  2KVZ A;  4ZYN A;  2BBC A;  5DCN A;  1I35 A;  3ETR A;  1TZO A;  5IKC M;  1H4R A;  1ZDX A;  1UEL A;  4P1B C;  2N9E B;  2ASQ A;  2DWQ A;  1SIF A;  4LNO A;  5BYR A;  2INC C;  2KWC A;  3L17 A;  2NS5 A;  4ANW A;  5IP4 D;  2HD5 B;  4NQK E;  2MBO A;  1XCQ L;  4KGR A;  1MVK A;  4BFR A;  5BO4 B;  3I5J C;  3PRZ A;  2NTT A;  1ROE A;  4OW0 A;  2I1J A;  4GMV A;  1I4Q A;  1QOF A;  3UI3 A;  3KUZ A;  2GMI C;  2AL6 A;  1SE9 A;  3U52 E;  4L2Y A;  4OVV A;  5EE9 A;  1J7B A;  4IWP A;  1JAL A;  4RGT A;  1F9J A;  1LFD A;  2VZK D;  5GXG B;  2WNM A;  1N61 A;  2V4I B;  5TSS A;  2DAJ A;  2JT4 B;  2BWE S;  4B6W A;  4BKG A;  2M0A A;  3B1L X;  2DEN B;  2HJ8 A;  2WXJ A;  1IUE A;  1K53 A;  2K6D B;  2BKR B;  3DBH I;  1JWU D;  1E6E B;  1P98 A;  2NTS A;  4IKG A;  1LGR A;  4KSK C;  5CHW A;  3PLV A;  2LUM A;  1FCL A;  4KV2 A;  2FUG 1;  1WGH A;  2NBV B;  4WJO A;  1R4N I;  1SE3 A;  4M01 A;  1V86 A;  3A1Q A;  1VD2 A;  2RDG A;  3JW0 X;  4ICU A;  4I6L B;  2Y5B B;  1PQS A;  4C4V A;  2LGI A;  2DZM A;  2BT6 A;  1KFY B;  3V6C B;  1VR9 A;  2SAK A;  4NAW B;  3SR6 A;  1JWB D;  4GOC A;  5HFY A;  2C9W B;  3AV8 A;  4DXF A;  4MH8 A;  3BYT B;  3N1Z C;  4WAA A;  4ZRP A;  4B0M A;  4P1C C;  3VHT C;  4M02 A;  4NQL B;  4XDC A;  5L83 A;  4ASW C;  2KC1 A;  2L05 A;  4A8X C;  2N7D A;  2DZJ A;  4LK0 M;  1OQY A;  1KF6 B;  3B0A A;  3TEW A;  3P42 A;  4DHJ D;  3QX1 A;  3AE9 B;  1HZ5 A;  3PO0 A;  4JPS A;  2LMC A;  1YX5 B;  4OZA A;  2MBB B;  3NUH B;  5CX3 A;  2R2Q A;  3VDZ A;  1KLV A;  2CJN A;  3QHT A;  5G5H A;  3Q8B A;  4TSS A;  1WJ6 A;  1KOT A;  5BMG A;  2LI5 A;  1CQV A;  2KN5 A;  3HM3 A;  2N4F A;  1ZP0 B;  4HJK A;  4CO7 A;  4NAW A;  2LUE A;  1C4A A;  3WAL A;  2E3T A;  5BMI A;  2JPH A;  4N6E B;  3A9J B;  3DBS A;  4JIO U;  3DHG C;  3QC8 B;  1HXY D;  1IP9 A;  3AB5 A;  2HTH A;  1WRI A;  4MSM B;  1TKE A;  1TKG A;  2YEP F;  2BTE A;  4A90 A;  3C19 A;  2C7M B;  1K52 A;  5JH5 C;  2KLG A;  1LM8 B;  2K9X A;  5JXV A;  2K5P A;  1QQR A;  1WE6 A;  3W5U B;  5FR3 A;  3RUL A;  3Q3F A;  4N59 A;  1UBI A;  1MPE A;  3K9O B;  2Z0E B;  3PZ8 A;  5G2N A;  2W82 A;  4BKS D;  1F77 A;  4AJY B;  5LXH A;  2L0F A;  3QQ8 B;  3ZW3 A;  1G6J A;  1NI3 A;  5BMH A;  2ZJD A;  2HE7 A;  2QJL A;  3ZNI D;  3ZXV A;  2O6V B;  2PJH A;  3A9J A;  3PVL A;  5IN7 A;  4RF0 A;  3MC8 A;  1D5X C;  4WJQ A;  3CF6 E;  1RLF A;  2M4N A;  3Q14 C;  1OQQ A;  1CMX B;  1BML C;  3AE8 B;  3LXF A;  2KAN A;  1UZX B;  3VQI A;  3W9C B;  1FNU A;  2IY0 B;  3O13 A;  3A4S C;  3IVF A;  2FCQ A;  2LRU A;  3GS2 A;  1P0R A;  3AU4 A;  3AH7 A;  1NBF C;  1PUT A;  3VRA B;  4WH4 A;  1Q1O A;  3ZNG C;  1QZE A;  1HEZ E;  4TMA B;  3Q3J A;  4FHJ A;  1TBE A;  5CHV C;  1EWC A;  3NOB A;  1QT9 A;  4C7Y A;  1FFV A;  3IXS A;  3M3J A;  1FXI A;  1UWM A;  2M17 A;  2JY6 A;  4GDK B;  3AU5 A;  1FXA A;  1WF9 A;  1IYF A;  1F52 A;  3MP9 A;  3JVZ X;  3GP7 A;  3P4Q B;  4YT0 B;  1ISN A;  2AX5 A;  5EE1 A;  2JYE A;  4G0N B;  2MH7 A;  4NJC A;  1P1A A;  2KC2 A;  1WGK A;  2Q5W D;  4KZC A;  4J6I A;  4GSW A;  3L13 A;  3KLS X;  2XEW A;  4W9C A;  4L1B A;  2L83 A;  2LGY A;  4LTU A;  4FJY A;  4KVG B;  2FCS A;  2G3Q B;  1JRU A;  3QA8 A;  3UIP B;  4WAF A;  1JML A;  2LAS A;  2KVR A;  4DDG D;  4WWN A;  2E6X A;  1ENF A;  2D3B A;  3VAW A;  3V05 A;  3NZS A;  2N7E A;  3AEC B;  1L0V B;  2D2Q A;  1NI2 A;  3Q6B A;  4JGH B;  2B3A A;  3N20 C;  5C3J B;  4YSX B;  1JCK B;  3IT6 B;  3X23 A;  1J8C A;  4DHZ E;  4IM2 A;  2EMS A;  3PHW B;  4REZ A;  1N5X A;  4C7Z A;  2V0G A;  1UNS A;  2L00 B;  1XLO A;  3BVZ A;  5AUI A;  3LJ3 A;  3OWE B;  2O2V A;  2K8C A;  1SIJ A;  3WAO A;  4W9D A;  1WGD A;  3RI7 C;  2XK5 B;  1EU4 A;  1YNT E;  1Z2M A;  3OJ3 A;  2KWV B;  2WDT B;  3T8M A;  4B95 A;  4USA A;  5C23 A;  4H2A A;  2Z0D B;  1WJN A;  1BXT A;  3KWL A;  1Y8R C;  2KO3 A;  3HVD A; 
#chains in the Genus database with same CATH homology
 5AZH A;  1WH3 A;  2KTR B;  2KMA A;  5FR6 A;  2A4Z A;  2MX2 A;  4DBG A;  1BT0 A;  1EO6 A;  3ZRF A;  3TJP A;  1WY8 A;  2KDB A;  3NY5 A;  2UYZ B;  4FUL A;  3ZLZ A;  1Q0W B;  2LGD A;  2K25 A;  3CSF A;  3IFW B;  4W9K A;  1TGZ B;  3I3T B;  4WQO B;  1V9J A;  1WX7 A;  3EEC A;  4BOS C;  2N9X A;  3CST A;  4KZ0 A;  4M8M A;  1WYW B;  2GBJ A;  3DCG A;  4GU2 A;  3VTV A;  4TKN A;  5LXI B;  4KIK B;  2KQ7 A;  5C1Z A;  2MP2 B;  4K1R B;  2WWZ A;  1L7Y A;  1LQB A;  3KW5 B;  4ZYN A;  3UF8 A;  3H1U A;  2JRH A;  2JWZ A;  4HWI B;  3QK0 A;  5DCN A;  1I35 A;  3SU8 X;  4EFO A;  3OLM D;  4FHK A;  2GBM A;  1H4R A;  2LXC A;  4K7W A;  2ZCC A;  3QCA A;  1UEL A;  2N9E B;  3APD A;  3DVG X;  3PSE B;  4LDT B;  2D10 A;  1EUV B;  2ASQ A;  2KJH B;  5E6P A;  4HDQ A;  1T0Y A;  2LJ5 A;  3SHQ A;  1WM3 A;  1YD8 U;  2KDF B;  1SIF A;  5JHB A;  5DPT A;  2ZPN A;  1WI0 A;  1E5W A;  4RMA A;  5E6N A;  4BKT A;  2KWC A;  3L17 A;  4HPM B;  2NS5 A;  4WWO A;  5LLI A;  4ANW A;  3MHS D;  4I6N B;  2HD5 B;  4NQK E;  2MBO A;  2O2V B;  2REX A;  1P9D U;  2G4S A;  3V60 A;  2RGF A;  1S1Q B;  4BFR A;  1M94 A;  5BO4 B;  3QJZ A;  4IG7 B;  5HKH A;  3PRZ A;  3EC8 A;  2KTR A;  2CHW A;  4K7S A;  2GBN A;  1U4A A;  2I1J A;  4GMV A;  3HM6 X;  2JF5 A;  3KUZ A;  2C60 A;  2DX5 B;  3UQA A;  2GMI C;  4PS3 A;  2DYB A;  4TV3 A;  1V49 A;  3P2B A;  2AL6 A;  3BY4 B;  1SE9 A;  4TUU A;  2LXA A;  4OVV A;  5AZF A;  1E90 A;  2IO3 B;  4BVU C;  2NR2 A;  3DBR I;  4NY0 A;  4IWP A;  4KIK A;  3U8Z A;  4FLH A;  2MP2 A;  2MBH A;  3TL5 A;  3RCZ A;  1F9J A;  3TMP B;  1WGG A;  2L0T A;  1LFD A;  3RUI B;  1WZ0 A;  3WAM A;  2CKH B;  5DPW A;  3ECI A;  3MJW A;  5KHQ A;  3NZU A;  2KDI A;  1GUA B;  2PE6 B;  2GBR A;  3AXC A;  4LDT D;  4PYZ A;  1GJZ A;  4II2 B;  1WXV A;  3H7P B;  4ICV A;  2DAJ A;  4A3O A;  1YX6 B;  3W1S C;  2JT4 B;  4DXA B;  4GB9 A;  2BWE S;  2IO1 B;  4B6W A;  4BKG A;  4ANX A;  3N32 A;  4A20 A;  5E6O A;  2JRI B;  3ZDT A;  3B1L X;  3VUW A;  2DEN B;  1WJ4 A;  2QHO A;  4ANV A;  2HJ8 A;  1RAX A;  1V80 A;  3T9L A;  2KFJ A;  2ZVO A;  2K6D B;  2IO2 B;  2BKR B;  2JZ3 B;  1NDD A;  3DBH I;  2NBU A;  3WAP A;  2MBE A;  2PEA A;  1P98 A;  4BOZ B;  4G3X B;  4KSK C;  5CHW A;  4W9I A;  3PLV A;  4GDL B;  4KV2 A;  1WGH A;  1UGM A;  1GC6 A;  4MSQ B;  2GBK A;  2N9P C;  2NBV B;  4WJO A;  1EF1 A;  1R4N I;  2BYF A;  4W9J A;  2MCN B;  3RD2 A;  2IBI B;  3R7Q A;  4URK A;  3ZRC A;  1C3T A;  4YL8 A;  1V86 A;  4B9K A;  3HK0 A;  2VRR B;  2KQS A;  3A1Q A;  1VD2 A;  3JW0 X;  4ICU A;  4I6L B;  2KFK A;  5D6J B;  3CMM B;  4LJP B;  5TR5 A;  2RD0 A;  2JUO A;  4I6P A;  2Y5B B;  1PQS A;  4MEM A;  4AWJ A;  3WA0 A;  2RSU A;  4CYE A;  2DZM A;  2KHW B;  1SGH A;  3EFU A;  1V5O A;  2LGX A;  3H9D A;  2KX0 A;  3V6C B;  3L54 A;  1P3Q U;  3H7P A;  4NAW B;  3PRE A;  2ZEQ A;  4WJN A;  2J0M A;  4GOC A;  5CHF A;  3RZW C;  2C9W B;  2IY1 B;  2XBB C;  4JLC A;  1J19 A;  1UBQ A;  3M62 B;  1R4M I;  3SD5 A;  4WAA A;  2KJR A;  3DOW A;  3ZTD A;  3L16 A;  3RZF A;  2NBW B;  1WR1 A;  2MRP A;  1TZ1 A;  3DDC B;  2KTF A;  2LVQ A;  5AZG A;  1GC7 A;  4JQW C;  3VHT C;  4NQL B;  2BPS A;  4FJZ A;  5L83 A;  5DPS A;  4ASW C;  2KC1 A;  2L05 A;  2KZR A;  3KH0 A;  4NJ7 A;  2N7D A;  2D3G A;  2DZJ A;  5D7G A;  2IYD B;  1OQY A;  4CHK A;  1HE8 A;  3B0A A;  3EHV A;  4TQ1 A;  1WZ3 A;  2M1M A;  5CTR C;  3U7D A;  3QAR A;  4GXB A;  4GDL A;  4DHJ D;  2JXX A;  2M0X A;  4N9F 4;  4FA6 A;  2GOW A;  3QX1 A;  4IWO A;  2I1K A;  3ZNH B;  3N3K B;  4HCP B;  4XZ4 A;  1OTR B;  3OJ4 B;  2LD9 A;  5JZE B;  2BGF A;  4F8C B;  1YX5 B;  3JSV B;  4FAD A;  1XQQ A;  2MBB B;  3LDZ E;  2YVC A;  2R2Q A;  3KUC B;  4LCD E;  5CX3 A;  3VH3 B;  2C7H A;  2O6V A;  3VDZ A;  1KLV A;  3QHT A;  1EF5 A;  4AOF A;  2M8S A;  2K6Q A;  3H6N A;  2OOB B;  4TQ0 A;  3PS6 A;  1WJ6 A;  4PS7 A;  1KOT A;  4M0W B;  4EOY A;  4F7Z A;  1WRD B;  3QWZ B;  2WX0 A;  2LI5 A;  3PGE A;  2V1Y A;  2KN5 A;  3HM3 A;  2EKE C;  2N4F A;  4HJK A;  2NCN A;  1V6E A;  2PPH A;  1WM2 A;  2W9N A;  4NAW A;  4CO7 A;  3UGB B;  2KMC A;  1KJT A;  1GNU A;  1IPG A;  2L8J A;  2LUE A;  2AEH A;  3PT2 B;  1K8R B;  3WAL A;  3DBL I;  3ZUN A;  2KWU B;  1X1M A;  3A1Q B;  3WAN A;  2AL3 A;  2JPH A;  4PYU A;  5GMV A;  4HVB A;  2KFK B;  1J0G A;  4AUQ C;  3AUL A;  3TIX A;  3A9J B;  4GN1 A;  3DBS A;  4JIO U;  1XD3 B;  2LZ6 A;  4PS8 A;  3KYD D;  1C1Y B;  3QC8 B;  4KDL B;  2MBQ A;  4KSL C;  1IP9 A;  2RR9 A;  4MGI E;  2JZZ A;  1E8X A;  2HTH A;  3N30 A;  4MGY E;  2UWQ A;  4MSM B;  3V61 A;  1WR6 E;  4EZL A;  1OEY J;  2FAZ A;  4NPN A;  1XT9 B;  2J0K A;  2C7M B;  4FN2 A;  5JH5 C;  5G55 A;  3PZD A;  3A33 B;  2KLG A;  1LM8 B;  2KKC A;  3L08 A;  3PLU A;  4IUM B;  1UD7 A;  3APF A;  3L0W B;  3RT3 B;  4GDK A;  4ZDV A;  2FCN A;  5IA7 A;  4FJV B;  1WE6 A;  3JSV A;  3A4R A;  3RUL A;  3MTN B;  2NPT A;  3Q3F A;  1UBI A;  5KHO A;  2FUH B;  2ZZP B;  3C0R B;  2BF8 B;  4W9L A;  3K9O B;  4DDI D;  2Z0E B;  3M95 A;  4KDI C;  3DVG Y;  3TBL D;  5D94 A;  1OGW A;  5G2N A;  4W9F A;  4BKS D;  4G11 A;  4AJY B;  1VCB A;  2AYO B;  3OAW A;  3GOE A;  5LXH A;  5EDS A;  3X0W A;  4G50 A;  4A3P A;  2CHX A;  2L0F A;  3QQ8 B;  4BKS A;  3ZNZ B;  1UH6 A;  2R2O A;  3ZW3 A;  1G6J A;  2AWT A;  3GZN I;  2ZJD A;  2HE7 A;  3ZNI D;  4EEW A;  3ALB A;  3NHE B;  3TCA A;  1WE7 A;  2O6V B;  2PJH A;  5D2M B;  3A9J A;  1AAR A;  3PVL A;  4EKU A;  2KNB A;  3HHM A;  3ONS A;  2C5L C;  4AJW A;  1WX8 A;  4GIV A;  3KYC D;  3BIN A;  4WJQ A;  3QAQ A;  2D07 B;  3CF6 E;  1RLF A;  2M4N A;  3V6E B;  1YIW A;  3DVN V;  1CMX B;  2A5U A;  5J2R A;  2MA9 B;  4FBJ B;  1GG3 A;  2KAN A;  1UZX B;  2K39 A;  3HIZ A;  3KVF B;  4P7I A;  3VH4 B;  4K81 A;  4MJS B;  4MM3 A;  1WGY A;  3U30 A;  3VQI A;  3APC A;  2IY0 B;  2YLM A;  3A4S C;  2CS4 A;  4IW0 A;  4MH0 E;  1A5R A;  3IVF A;  4HLE A;  4GGQ A;  1YJ1 A;  2FCQ A;  3O65 B;  1L2N A;  2L76 A;  2L7R A;  2ZCB A;  2LRU A;  1E8W A;  2KX3 A;  4M8N A;  3V62 A;  1P0R A;  4XX5 A;  4ZRJ A;  1KM7 A;  2IO0 B;  1RRB A;  2LVP A;  1WX9 A;  2LWP A;  3AU4 A;  3WIM A;  5JHA A;  1NBF C;  4E74 A;  2BKF A;  2JVC A;  2DYM A;  2ZPY A;  2ZVN A;  4II3 B;  2BWF A;  5IAA C;  3R7R A;  1Q1O A;  3ZNG C;  1QZE A;  5L95 C;  2DYO A;  2V4L A;  2DAF A;  2KXJ A;  1TBE A;  3Q3J A;  4FHJ A;  5CHV C;  4ZRK A;  4E71 A;  2WYQ A;  2FNJ B;  3NOB A;  2FIF A;  2ZNV B;  1FXT B;  2MWS B;  3M3J A;  2LVO A;  2WX1 A;  3IG3 A;  3UIN B;  4RM9 A;  4DWF A;  3ML9 A;  2KD0 A;  2M17 A;  2RPQ A;  4IM0 A;  3VTW A;  2JY6 A;  4GDK B;  3AU5 A;  3PRM B;  2LRW A;  3UQB A;  1MG8 A;  1Q5W B;  1WF9 A;  1IYF A;  1WXA A;  2O6V D;  2C7N B;  2IZV B;  2KJ6 A;  4BBN C;  2Z59 B;  2NPT B;  2MW5 A;  3VUX A;  4MDK E;  2K8H A;  3A9K B;  3W1Y A;  1WMH A;  3ZKJ C;  1TTN A;  3JVZ X;  3IBE A;  4MGK E;  1E7U A;  1E8Z A;  3RYT A;  2G45 B;  4XC2 A;  2XK5 A;  1OEY A;  4DHJ B;  1ISN A;  4JL9 A;  3R3M A;  4G0N B;  1I42 A;  1P1A A;  2ZNV C;  2J7Q B;  2KDE B;  2KC2 A;  1V81 A;  4MJS A;  5DPR A;  4KZC A;  3ML8 A;  2MQJ A;  4J6I A;  4EZK A;  2V3S A;  3NS8 A;  4GSW A;  5J17 A;  2KK8 A;  3ZDM C;  3L13 A;  1WFY A;  2XEW A;  4W9C A;  3M63 B;  4W9E A;  5AEK B;  4E3C A;  2LGY A;  4IC7 B;  4FJY A;  1V5T A;  1WXS A;  4KVG B;  4MEL A;  2FCS A;  2G3Q B;  1JRU A;  3IHP C;  3QA8 A;  4MGZ E;  3VTU A;  3UIP B;  1WXM A;  2KLC A;  3L10 B;  4EZJ A;  4LJO B;  4IWQ A;  2LAS A;  2KVR A;  4DDG D;  2L3Z A;  4WWN A;  4DK5 A;  4NNJ B;  4W9G A;  2EMT A;  2K8B A;  4EUT A;  3PHX B;  3PTF C;  2BYE A;  2BYV E;  4HPL B;  4OVU A;  2G4D B;  3VAW A;  3QIJ A;  2CU1 A;  1Z5S B;  3K9P B;  4ZRI A;  3VUY A;  3B08 A;  1WIA A;  3NZS A;  3VVW B;  3ZTC A;  4IM3 A;  2N7E A;  2FID A;  2N1W A;  2CHZ A;  3DPD A;  2MSE D;  3PRP B;  4RM8 A;  2CR5 A;  5J18 A;  3PPA A;  4BBN F;  2D2Q A;  1NI2 A;  3DQV A;  4WWP A;  3SDL C;  3A9K A;  4JGH B;  2B3A A;  4NJ6 A;  3S2A A;  3PV1 A;  2PE9 A;  2N1V A;  1ZGU B;  3X23 A;  1J8C A;  4HXD A;  2DZI A;  4DHZ E;  1H8C A;  3R66 C;  4IM2 A;  2EMS A;  4W9H A;  3PHW B;  3ENE A;  3ZVV A;  2D11 A;  2K1F A;  1V2Y A;  2L00 B;  4DHZ B;  3LJ3 A;  2O2V A;  2FCM A;  2J0J A;  3JYU A;  2K8C A;  4AP4 C;  1ZW7 A;  1WJU A;  1WMH B;  1D3Z A;  3WAO A;  1E8Y A;  4HDO A;  4W9D A;  2DZK A;  3ZIM A;  1WGD A;  2XK5 B;  3KUD B;  3AI5 A;  4HK2 A;  1LXD A;  3D32 A;  3W1S A;  1Z2M A;  2MLB A;  3OJ3 A;  1RFA A;  3H7S A;  4X57 B;  2KWV B;  3DVN U;  3UIO B;  2KOX A;  2WDT B;  1S3S G;  2OJR A;  3T8M A;  3ZO5 B;  3VXW A;  4B95 A;  4K7U A;  5C23 A;  4WJP A;  4F1S A;  1ZKH A;  3VFK A;  2Z0D B;  1E7V A;  1WJN A;  2NVU I;  1Y8R C;  4ANU A;  2DHZ A;  2KO3 A;  1WGR A;  4HCN B;  1YQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...