4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
2N7DA 2NPTA 3O65B 2MLBA 5TR5A 1Z5SB 4WWNA 1H8CA 3PZDA 3IHPC 3QJZA 5D94A 4DK5A 4YL8A 1GC7A 3JSVB 3ML9A 3Q3JA 4BBNF 4HPLB 2Z59B 4F7ZA 5G55A 4FJYA 2JZZA 3OJ4B 1LM8B 2V4LA 3A9KB 1D3ZA 4FLHA 2XK5B 2MBQA 4DDID 2D2QA 2I1KA 3PHXB 3WANA 2C7MB 2R2OA 3PHWB 4ICUA 4J6IA 3APFA 4PS8A 3ZIMA 3ZW3A 2RSUA 3LJ3A 3EHVA 2BF8B 3ZTDA 3HHMA 1YIWA 3ENEA 3VDZA 2EMSA 3A1QB 4HCPB 2O2VB 1SE9A 3H7PA 2HJ8A 4AJYB 2M0XA 4IW0A 2JRHA 1C3TA 3EFUA 4BOSC 4MJSA 2KN5A 4B95A 4FADA 2D10A 4GN1A 3VXWA 4NAWA 3CF6E 2MX2A 2IY1B 5GMVA 4OVUA 2O6VB 2O6VD 1TGZB 4ZRJA 2MBBB 2BKFA 2LRUA 1IYFA 4KZCA 2K39A 3PRPB 2G4DB 1WX9A 2IBIB 1GUAB 4KV2A 4E3CA 2KWVB 4HCNB 1V5OA 4AOFA 4RM9A 4EKUA 2KTRB 2FIDA 4ZYNA 4AUQC 2CHWA 4GU2A 5AEKB 2GBMA 2REXA 2IO3B 2LGXA 2NVUI 3NOBA 3M63B 3AULA 4MGIE 1WM2A 5L83A 3QCAA 5J2RA 3KUDB 1UGMA 4FHJA 3OLMD 3ZTCA 2KDFB 4JLCA 2L0TA 1V49A 3W1SA 3ZLZA 3WAPA 1WRDB 3UQBA 2V3SA 3NZUA 4E71A 3U30A 1Q0WB 4TV3A 2L05A 1E8XA 3EC8A 1S1QB 3KW5B 3SD5A 3VTWA 1WMHB 3NY5A 4G50A 2AL3A 2DZIA 4RMAA 2KX0A 4E74A 1L2NA 2M8SA 3Q3FA 1WE6A 5AZGA 4DHZE 5J17A 5JH5C 1V80A 3DVGX 4ANWA 1XQQA 1ZW7A 4LDTD 3H7PB 4AP4C 1P9DU 2BKRB 3QC8B 1OEYA 4KDLB 5EDSA 2IY0B 2KK8A 2CHZA 3R66C 1K8RB 4MGKE 3VH4B 4PS7A 2DENB 4KVGB 3DCGA 4HJKA 3DVNV 3CSTA 1YD8U 4NPNA 3VTVA 4DDGD 2HE7A 1E8WA 3JVZX 4MEMA 2Z0EB 1WH3A 5DCNA 2C9WB 1V9JA 3ZNGC 1WE7A 3L16A 2ZPNA 2KX3A 4NY0A 2JXXA 1X1MA 5E6NA 2MBEA 2ZEQA 3TMPB 2N4FA 2MW5A 3N30A 3ECIA 3UF8A 2G3QB 3SU8X 1KJTA 4N9F4 2OOBB 2KJHB 4K1RB 1I35A 5CHVC 2J7QB 2LGDA 2ZCBA 2LGYA 4MGYE 3PSEB 4KSKC 1P98A 1PQSA 1V6EA 2PJHA 4LJOB 4WWOA 4DHJD 3RCZA 5CHFA 1E90A 3MTNB 4MM3A 1UBIA 4FHKA 5CTRC 3HK0A 4RM8A 3UQAA 3IG3A 1Q5WB 4AWJA 2KFKA 2RPQA 4WJQA 2JZ3B 3HM6X 2JRIB 1LFDA 3W1YA 4DHJB 2ZVNA 4WAAA 3ZRFA 2L7RA 2BWES 4MSQB 2J0JA 2MA9B 4W9EA 2LVQA 2J0KA 4W9HA 1ISNA 2D07B 2IYDB 4NAWB 3RUIB 3L13A 3RT3B 4HWIB 1WJ4A 2LUEA 4JQWC 4GDLA 4K81A 1M94A 4CHKA 4URKA 3VTUA 1EF1A 2JWZA 3VUWA 3L10B 3QQ8B 1EO6A 1ZKHA 2CU1A 4FBJB 4DHZB 3TIXA 1KOTA 3HIZA 2K8HA 3PPAA 3BINA 4HVBA 1VCBA 2AYOB 2GOWA 2O2VA 1E8ZA 1LQBA 2KXJA 3RZFA 1XD3B 2KDIA 2ASQA 1T0YA 2IZVB 2KFJA 3DOWA 4FJZA 3WALA 3H7SA 4W9IA 1KM7A 1VD2A 5C1ZA 4IG7B 2KOXA 2FCQA 4ZRIA 3P2BA 4MJSB 3PV1A 4P7IA 2ZJDA 3RZWC 1FXTB 5AZFA 2MCNB 2FCMA 1WJNA 2MP2A 3H1UA 3PLUA 4XZ4A 1NDDA 3ML8A 4KIKA 3KUCB 4K7WA 4MELA 4OVVA 1EUVB 3PREA 4CO7A 5DPRA 3AU4A 3L08A 3A9JA 2KJRA 4JIOU 2G45B 1EF5A 1L7YA 1WYWB 3QAQA 5DPWA 2KVRA 5IA7A 2FIFA 2IO1B 2LRWA 3DBRI 2ZPYA 3ZDMC 4II2B 2XK5A 4M8MA 3PS6A 3ZRCA 1GC6A 1E5WA 2C5LC 2K6DB 2KKCA 2WDTB 3QARA 3V61A 1WM3A 4JGHB 3ZUNA 3WAOA 1MG8A 4DWFA 2CR5A 4NQLB 1WI0A 1H4RA 5JHBA 3ZKJC 2GBRA 2NBVB 1ZGUB 2KQ7A 2Y5BB 2KLCA 2M4NA 2LZ6A 2KHWB 4XX5A 2L3ZA 2DYOA 3DBSA 2LJ5A 3PT2B 3UIOB 2MWSB 4ANVA 1P0RA 1WXSA 2KDEB 2MBHA 2CS4A 2NBUA 5C23A 2C7NB 3WA0A 4GOCA 3AU5A 3PRZA 3DQVA 1C1YB 2KTRA 4GDKB 2C7HA 3K9PB 1R4NI 4GGQA 3WAMA 3X0WA 3APDA 1NI2A 2DX5B 3A4SC 5D6JB 1OTRB 5KHOA 3OJ3A 4NJ7A 2KWUB 3W1SC 3RYTA 2B3AA 3KUZA 1WGGA 3PLVA 2NCNA 4ASWC 1IP9A 4HK2A 1JRUA 1E8YA 3KH0A 1YQBA 2GBKA 5E6OA 5J18A 1WR1A 1V81A 4HXDA 4MDKE 1YX6B 1WX7A 2L76A 2ZNVC 2WYQA 4W9KA 2NBWB 3RULA 5G2NA 1WZ3A 1RFAA 4PYUA 4BVUC 4GB9A 2XEWA 3I3TB 3RD2A 5LLIA 4FN2A 1QZEA 4II3B 2A4ZA 2KQSA 1WGYA 1WXMA 2JY6A 4MH0E 4TKNA 3TBLD 4EOYA 2M1MA 2NS5A 3A1QA 2GBJA 3IVFA 4W9JA 4ZRKA 1A5RA 4WJNA 1Z2MA 2MRPA 2ZNVB 5IAAC 4M0WB 4I6LB 2KWCA 3QIJA 3VUYA 3HM3A 1GG3A 3SDLC 1R4MI 4HDQA 2BYFA 1P3QU 1SIFA 3VUXA 2ZVOA 2KLGA 4F1SA 2IO0B 4BFRA 3U8ZA 4NNJB 2OJRA 5LXHA 5DPSA 5D7GA 2LXCA 5CHWA 5CX3A 4CYEA 2DZMA 4FULA 3R3MA 4DBGA 1V86A 1UELA 2J0MA 2MQJA 2N7EA 1P1AA 1E7VA 1RAXA 5LXIB 2W9NA 2DZKA 4KZ0A 3ZDTA 4F8CB 2LVOA 1AARA 2VRRB 4IWQA 4KDIC 4EUTA 4K7SA 3OAWA 4EFOA 4M8NA 3QA8A 3IBEA 4IUMB 1KLVA 2C60A 2KMAA 3DBHI 2CKHB 2V1YA 1WFYA 3UIPB 4BOZB 2JPHA 2JUOA 4IM2A 1UBQA 2JF5A 2ZCCA 3UINB 2N9XA 3V6EB 1S3SG 2BYEA 4G0NB 3M95A 2XBBC 2KANA 3B08A 5JHAA 4HDOA 2DHZA 3DVNU 2RR9A 1V2YA 1E7UA 5JZEB 4WJPA 2FCSA 4W9GA 4W9LA 1IPGA 4FJVB 2BYVE 4EZKA 3U7DA 2EKEC 2Z0DB 4ANUA 2KO3A 2K8CA 1G6JA 1Q1OA 4DXAB 2MBOA 2NPTB 4LCDE 1XT9B 1UD7A 2PE9A 1WJUA 1TBEA 4W9CA 4BKSD 4IWOA 1WGRA 3MJWA 2KC2A 2WX1A 5BO4B 1U4AA 2PEAA 2CHXA 2PPHA 3DPDA 2EMTA 2L00B 3PTFC 3V60A 3H6NA 3DVGY 2K25A 3A9KA 3C0RB 3A4RA 2N9PC 3EECA 2KFKB 3PVLA 4PYZA 4GXBA 2FCNA 4NJ6A 5DPTA 2KMCA 3ZNZB 2GBNA 2N9EB 1RLFA 2LXAA 4XC2A 4W9FA 1OEYJ 3T8MA 2MP2B 2GMIC 3VHTC 4MGZE 4W9DA 2AL6A 3VH3B 3ZVVA 3BY4B 2HTHA 3ZNID 4IWPA 3D32A 3CMMB 1NBFC 2DYMA 2KZRA 1I42A 3PGEA 1HE8A 3KYCD 4GIVA 4TQ0A 2K8BA 5HKHA 3M3JA 2LASA 3V62A 3VQIA 4EZLA 4A3OA 2KD0A 4FA6A 1WMHA 1WGHA 1OGWA 2KC1A 2DZJA 1J0GA 2HD5B 3TCAA 3QX1A 4I6PA 1SGHA 3ALBA 3ZNHB 2MSED 2D11A 3VVWB 2BWFA 2UWQA 2WX0A 4HPMB 3S2AA 2QHOA 1OQYA 1WGDA 2L8JA 1YJ1A 4LDTB 3X23A 5KHQA 1WIAA 3AI5A 3N3KB 4ZDVA 3JYUA 4MSMB 3L17A 3AXCA 3N32A 2DAJA 3GZNI 3PRMB 4WWPA 4BKSA 2RD0A 3KYDD 2IO2B 1WJ6A 2I1JA 4BBNC 3R7QA 2BPSA 3DBLI 3CSFA 3T9LA 3VFKA 4B6WA 4GDKA 3SHQA 4GMVA 4IC7B 4HLEA 2N1VA 3B1LX 3R7RA 2O6VA 3VAWA 3M62B 3NS8A 3NZSA 3B0AA 3ZO5B 1GJZA 2KDBA 3H9DA 2AEHA 2WWZA 2KTFA 1WZ0A 4I6NB 2KJ6A 2LI5A 2UYZB 3JW0X 3JSVA 4G3XB 2FUHB 3A33B 3DDCB 3V6CB 4PS3A 1LXDA 1YX5B 4ICVA 4GSWA 1GNUA 2YLMA 4KSLC 4WJOA 4JL9A 2FNJB 5E6PA 1WXVA 3ONSA 2AWTA 1TZ1A 4G11A 4A3PA 1F9JA 3UGBB 2FAZA 3QHTA 2JVCA 2NR2A 4K7UA 2LWPA 4WQOB 2BGFA 1UZXB 4NQKE 2K6QA 3APCA 4LJPB 4IM3A 2DYBA 3KVFB 1TTNA 2D3GA 3QWZB 4EEWA 4X57B 4GDLB 3A9JB 2PE6B 3TJPA 3K9OB 5AZHA 1J19A 1WXAA 4EZJA 4TUUA 4ANXA 1UH6A 4BKTA 1WY8A 2M17A 2DAFA 4AJWA 4IM0A 2N1WA 3MHSD 1WX8A 3GOEA 2G4SA 3TL5A 2RGFA 1BT0A 2L0FA 1CMXB 2ZZPB 3L0WB 1Y8RC 1V5TA 2R2QA 3NHEB 5D2MB 3QK0A 2YVCA 2LVPA 1WR6E 3LDZE 2K1FA 4A20A 1WF9A 1RRBA 3WIMA 5FR6A 2KNBA 2JT4B 4TQ1A 5L95C 3L54A 4KIKB 2A5UA 2LD9A 3IFWB 1J8CA 4B9KA 4BKGA
chains in the Genus database with same CATH superfamily
4LNNA 3O65B 1Q10A 1SXTA 1Z5SB 5E6JA 3RNEC 3RFZB 5D94A 1GC7A 3ML9A 1TJEA 1AYFA 5G55A 2XK5B 2I1KA 3AN1A 3PHXB 3PHWB 4J6IA 3ZW3A 2RSUA 3LJ3A 3ZTDA 3HHMA 1YIWA 3VDZA 2MJDA 3A1QB 3H7PA 4AJYB 2HJ8A 2JRHA 1QOFA 2HJ1A 4MJSA 4GN1A 4REZA 2MX2A 1SE4A 2QC8A 5IKCM 2Q5WD 2K39A 2OHFA 2G4DB 1FNUA 4AOFA 1XCQL 2FIDA 3MC0B 4GU2A 3M63B 3VRAB 3DWGC 3QCAA 3KUDB 4O1NA 3ZQ4A 4FHJA 4P16A 2FE8A 4AQ7A 1VZ8A 1VR9A 3ZLZA 3WAPA 3Q2AC 1JWUD 3CWIA 4E71A 1Q0WB 4C7YA 4RMAA 2M8SA 3Q3FA 4DHZE 2RDBC 5H92C 5JH5C 3W5VB 1ZW7A 4LDTD 2INDC 4AP4C 1P9DU 2BKRB 2GLSA 1OEYA 2ACZB 4M00A 3DVNV 3CSTA 1YD8U 1EWYC 1E8WA 1WH3A 3GP7A 3NVVA 1V9JA 1TY2A 3N1YC 4S17A 4NY0A 2HTME 3SR6A 3EFCA 2N4FA 2MW5A 1TT5B 1FRDA 3H8HA 2J7QB 1PQSA 1V6EA 2W55A 4WWOA 2VZKD 5CTRC 4XDCA 3UQAA 5C2TB 3IG3A 2KFKA 5T8IA 2JZ3B 4WQMA 2ZVNA 3Q3MC 1A70A 1ZDVA 4NAWB 3FILA 4LK0M 1KRHA 2KYWA 1KFYB 2UU7A 5D3IB 1WJ4A 3CIRB 2WDVB 2JWZA 2I38A 3L10B 4HPPA 4FBJB 3BZDB 1KOTA 4KKJA 1VLBA 3BINA 1C77A 2GOWA 4HVBA 2J42A 3DOWA 3WALA 1YMHE 3AE5B 2IGDA 5C1ZA 4ZRIA 2E6XA 4P7IA 1FCCC 1I4QA 2DNFA 2L52A 1NDDA 3KUCB 1PGXA 4PT5A 4WWMA 4CO7A 1XEEA 2KJRA 1C4CA 3NVZA 2W3SA 5IOIA 1SB3C 5IA7A 2LRWA 3DBRI 2MJ3A 3DHHC 4JGHB 3WAOA 2CR5A 1H4RA 5JHBA 1QT9A 3Q8EA 2M4NA 2EKIA 3DBSA 2GB1A 2MWSB 1I4RA 3I5JC 2RDGA 1P7FA 1WXSA 1OFFA 2C7NB 3KLSX 3PRZA 3DQVA 2KTRA 2BS4B 4M02A 4GGQA 5MPOA 5HG2A 1UWMA 3APDA 1NI2A 2DX5B 3NVYA 1VZ6A 2KWUB 1GB4A 3RYTA 4KGRA 2B3AA 1V1OA 1WGGA 3PLVA 1MHHE 3GS2A 5J18A 4HXDA 2V4IB 1WX7A 2WYQA 3RULA 1WZ3A 1RFAA 3I3TB 4FN2A 2KQSA 4S0RA 2OJWA 3NVWA 2M1MA 2NS5A 2GBJA 1A5RA 4ZRKA 3E56A 1Z2MA 2ICIA 4CQNA 5HFYA 2BYFA 2ZVOA 3AE3B 1K51A 4F1SA 2IO0B 2QDFA 4BFRA 1FNVA 4ZHPA 1BXTA 1FM0D 1CK1A 2LGIA 4DBGA 2N7EA 1FEHA 1FFVA 1IBXB 5LXIB 4HKZE 4A90A 2DZKA 3ZDTA 1AARA 4EFOA 1QF6A 4IUMB 1KLVA 5HHDG 2WXLA 1J7BA 1WFYA 3UIPB 2JPHA 2JF5A 3UINB 3W9CB 2BB6A 2XBBC 2KANA 5JHAA 4HDOA 3DVNU 4WJPA 1IPGA 4ZRPA 4DXFA 4M01A 2EKEC 2Z0DB 2K8CA 1G6JA 1Q1OA 2KQ4X 2NPTB 1UD7A 1TIFA 1WJUA 3SFEB 2KC2A 1EU3A 4WURA 1TS4A 2L00B 3PTFC 2TSSA 3C0RB 4LNFA 3A4RA 2VZKB 2KFKB 3PO0A 2FCNA 3IXSA 1SIJA 1JWSD 2GBNA 2N9EB 4JX1C 5FKAC 2AL6A 3RPFC 4A55A 3FC4A 3SEBA 2DYMA 2W3RA 3M3JA 4EZLA 1VDVA 2KD0A 4MM3B 1WMHA 2DZJA 1ET9A 3TCAA 2PLPA 1SGHA 2D11A 2DBYA 1FXAA 2QHOA 2L8JA 1YJ1A 2BBCA 2YEPB 4M0WA 4LTUA 1BUIC 1ACCA 3TEZA 1WJ6A 4YWGG 4K3BA 4GDKA 1R4NB 3GB1A 3B1LX 3R7RA 1ZE3D 2H89B 3M62B 3NS8A 1B1ZA 3B0AA 2KDBA 3H9DA 2K22A 2KTFA 1F77A 3ETRA 1GNUA 4KSLC 4JL9A 4XWTA 5E6PA 1WXVA 3ONSA 1N5WA 4OZBA 3QHTA 4K7UA 2NR2A 4WQOB 1UZXB 4NQKE 1PGAA 4YTMB 2K6QA 4B0EA 1JALA 2DYBA 5BYSA 3KVFB 2WLBA 1KH0A 2ONQA 3AEBB 3TJPA 2MJEA 3DWMA 1I4XA 1JROA 1TY0A 4IM0A 1ET6A 3MHSD 1WX8A 2JSVX 1FCLA 1D5ZC 3ZXVA 1QLBB 5C3JB 3QK0A 1MHXA 1WF9A 1RRBA 1JWMD 3VRBB 1I4HA 2JT4B 4TQ1A 1XLPA 2A5UA 4YSYB 1MJDA 1BMLC 2N7DA 3IHPC 3QJZA 2LHEA 3Q3JA 4BBNF 2Z59B 4TSSA 3OJ4B 1LM8B 2V4LA 2QIEB 2MBQA 4P6VF 1WYGA 1LO5D 2C7MB 3ZIMA 2BF8B 4HCPB 1SE9A 3EFUA 2WU5B 2J4XA 5GMVA 4OVUA 2O6VB 2O6VD 2RMMA 2LRUA 1IYFA 3N9YC 2BW2A 1FNWA 2IBIB 1GUAB 4E3CA 1WRIA 4ZYNA 2CHWA 4RGOS 2GBMA 2XN9C 2NVUI 1J7AA 2VH2A 3P4SB 2DWQA 4LNIA 3L4PA 4RNAA 3ZTCA 4JLCA 2BS2B 2L0TA 1SF0A 1WRDB 4IKGA 1E8XA 1S1QB 1PUTA 1STEA 1L2NA 2AL3A 2DZIA 4E74A 2KX0A 4C80A 1L4DB 2CJOA 5HI1A 1V80A 2PVOD 1FPYA 4PS7A 1JMLA 1PGBA 4HKQA 4A6QA 1WE7A 4RF1A 2IJ0A 5AUIA 5E6NA 2ZEQA 3Q8CA 3ECIA 3UF8A 2NMQA 2G3QB 1KJTA 2OOBB 1I35A 1ZUD2 1D4BA 1XCTL 3PSEB 1P98A 3V3XA 4LJOB 5CHFA 1E90A 3MTNB 3PZ7A 1IBXA 4AWJA 3HM6X 2JRIB 3W1YA 2WXPA 5IN7A 3ZRFA 1UGJA 2WDQB 4MSQB 2MA9B 4W9EA 2LVQA 3EUB2 2H88B 4W9HA 2D07B 2JX5A 2IYDB 3L13A 3RT3B 3UI3A 1JCKB 4JQWC 4ZYSA 1T5XD 3LB8C 4K81A 3MJ5A 1EF1A 1QOAA 1ZKHA 4DHZB 3KQ4A 3TIXA 3O13A 3OG5A 2AYOB 2O2VA 1E8ZA 1LQBA 3RZFA 1XD3B 1T0YA 2LJIA 1DOXA 3H7SA 4W9IA 1KM7A 3P2BA 5AZFA 2MCNB 3P4RB 4C7ZA 3H1UA 3HRDD 3ABVB 4XZ4A 1XLNA 2MH7A 1EUVB 3PREA 5DPRA 4JIOU 4DXGA 1EF5A 1N5XA 3QAQA 3VR9B 2IO1B 1TKGA 2QSDA 4YTPB 4II2B 3ZRCA 3Q8FA 2KKCA 4OW0A 4GLSC 3MP9A 1MG8A 4NQLB 4ACFA 1WI0A 3RNGC 2GBRA 2NBVB 2KQ7A 3ZGZA 4XX5A 2L3ZA 3FILB 3PT2B 3UIOB 2LGSA 3PZ8A 4C56C 1P0RA 1NYQA 5C23A 3GE3C 3K9PB 5D3DA 1R4NI 3IAS1 3WAMA 1E10A 1UNSA 3R2IA 3W2DA 3TEXA 4YSZB 5KHOA 4NJ7A 1C9FA 3GE8C 2L1AA 4ASWC 2NCNA 3P63A 1E8YA 2GBKA 1WR1A 4MDKE 2ZNVC 4W9KA 2NBWB 5G2NA 3AEFB 2JY6A 4TKNA 1E7PB 5G5GA 3E9SA 4C00A 1FO4A 4I6LB 2WXJA 3QIJA 3VUYA 1GG3A 4HDQA 1WSPA 3MC9A 3U8ZA 1YNTE 2M56B 4ZOHC 2OJRA 5D7GA 5CHWA 5CX3A 1ROEA 2MQJA 2J0MA 1RAXA 4KZ0A 4EUTA 3IBEA 1YOVB 3BVZA 4IM2A 2BYEA 4G0NB 3ZJTA 2RR9A 5JZEB 3NZ3A 4W9LA 4XE0A 5BYRA 2BYVE 4EZKA 4ANUA 1JRPA 1XT9B 2PE9A 3B9JA 1XLQA 1U4AA 4WH4A 3DVGY 2K25A 3BK1A 4J3OD 3EECA 4NJ6A 2QEJC 4RGMA 3RNAC 4XC2A 2WXIA 4US9A 3AE7B 2JU6X 2K5PA 3VH3B 3ZNID 4IWPA 4UDUC 2KZRA 4YXDB 4TQ0A 5HKHA 2LASA 3VQIA 4ZHOA 4ITKA 2QMTA 3AE8B 1Y56A 4PK1A 1C4AA 5H8YE 1L5PA 1JWAD 2JXTA 3ALBA 2BYTA 3VVWB 2UWQA 1MPEA 3X23A 1L0VB 1F2RI 3L17A 3N32A 1SE3A 1ZPSA 1WWTA 4BZAA 3PRMB 2M19A 2I1JA 4BBNC 1CJEA 2BPSA 1T0SC 2FBWB 4IC7B 5JXVA 3VAWA 1E6EB 3AEGB 1GJZA 1SEBD 5GXGB 3V6CB 4OVZA 4ICVA 2FNJB 3ZJUA 2SEBD 2AWTA 2GI9A 4A3PA 2JVCA 4H2AA 3U4EG 2BGFA 2INNE 3APCA 4LJPB 1TTNA 4EEWA 4X57B 2PE6B 3K9OB 4EZJA 3FAHA 4TUUA 1UH6A 2V3NA 2L0FA 1N6ZA 3LYYA 1V5TA 5D2MB 1L0XB 1KLGD 5FR6A 3NUHB 2L83A 3L54A 2NPTA 5TR5A 4WWNA 3PZDA 2YEPF 4DK5A 3JSVB 3BK2A 5IO9A 4F7ZA 4FJYA 2JZZA 4L2YA 1D3ZA 1L6UA 4FLHA 4YT0B 1K52A 4DDID 2D2QA 2WNMA 5G5HA 2CJNA 3EHVA 1HTQA 3ENEA 2EMSA 1F0ZA 2M0XA 4IW0A 1C3TA 4BOSC 3URYA 1N61A 4B95A 3V05A 3VXWA 2WXKA 3CF6E 4ZRJA 3AEDB 5I4DA 3PRPB 4RH6A 4EKUA 2KTRB 2RDHA 1OQQA 1L4ZB 2NTTA 1HA5A 1GB1A 2LHDA 2REXA 2IO3B 2WXGA 2LGXA 3NOBA 4KX6B 3AULA 1WM2A 5L83A 5J2RA 1UGMA 4RF0A 2KDFB 4R3DA 5EE1A 3W1SA 1CZPA 3NZUA 4TV3A 2L05A 3EC8A 5EE0A 2WXFA 3SD5A 1QKZA 1WMHB 3NY5A 4G50A 1E9MA 4XYCA 1GPXA 1IUEA 5J17A 3Q8AA 2N9LA 4RFBA 3DVGX 3H7PB 2AQ1B 3QC8B 3TSSA 5EDSA 4KDLB 2KK8A 2CHZA 3R66C 1K8RB 3VH4B 2DENB 4KVGB 4HJKA 4DDGD 3B2FA 3JVZX 3NS1A 4MEMA 2Z0EB 5DCNA 1XF5L 2C9WB 2MEKA 3ZNGC 2NTSA 2KX3A 2JXXA 3TMPB 2MBEA 3N30A 3HUIA 3KWLA 4N9F4 5BMGA 2KJHB 4K1RB 2LGDA 2ZCBA 2LGYA 2WGSA 4MGYE 2V0GA 2PJHA 4DHJD 3RCZA 1D5XC 4MM3A 4FHKA 4D2KA 3HK0A 4RM8A 5TSSA 1LFDA 1XXGA 4DHJB 3I9V1 5BMHA 2J0JA 2J0KA 2R61A 2WXHA 3U7ZA 1ISNA 3RUIB 4LNOA 2D3CA 2WXNA 1TS5A 4BAXA 1TYGB 1PYWD 1TKEA 1M94A 3Q3NC 4AS1A 3VUWA 1EO6A 1HQRD 3HIZA 4DQOC 3PPAA 4KGTA 4P1CC 2IZVB 4FJZA 4EE2A 3B2GA 3RNFC 2FCQA 3PV1A 3IAM1 3RZWC 2ZJDA 3DHIC 2K3UA 3I57A 2FCMA 4RCOA 3PLUA 1MI0A 5BMIA 3ML8A 4KIKA 4K7WA 1V97A 4MELA 4OVVA 4N59A 3AU4A 3A9JA 3SFDB 1CQVA 1L7YA 4JPSA 2D3BA 1NEKB 2J53A 2KVRA 1ZP0B 2ZPYA 3ZDMC 2XK5A 4M8MA 1GC6A 1E5WA 1HTOA 1YN4A 2C5LC 1LGRA 2JYTA 3V61A 1TS2A 3ZKJC 1ZGUB 2KLCA 2KHWB 1T6BX 4ANVA 2AQ3B 3ZJVA 2PMVA 2DLBA 2MHJA 2NBUA 4ARCA 3WA0A 4GOCA 3AU5A 1F2RC 1C1YB 1KF6B 4GDKB 1FMAD 2C7HA 3AM9A 1T0RC 2G1EA 2B76B 3BVGA 3Q6BA 3A4SC 5D6JB 1OTRB 1YN3A 2Z8LA 3OJ3A 1MG4A 2JWUA 3W1SC 3T3NA 3KUZA 1IP9A 2RPVA 1JRUA 3KH0A 3MHZA 2Y5PA 2L32A 4N58A 2INCC 1YX6B 1N62A 4YSXB 1EM7A 5BYQA 5LLIA 5FR3A 1QZEA 4OZCA 1WGYA 4MH0E 4EOYA 3TBLD 3A1QA 1ENFA 3IVFA 2Y3AA 4W9JA 4WJNA 3BYYB 1XO3A 4KKIA 4N6EB 2KWCA 1R4MI 3VUXA 1R7SA 2JZPA 1N60A 3AB5A 2KLGA 5AUKA 4NNJB 1I4PA 5LXHA 3Q14C 3R2TA 1E7VA 2W9NA 2VRRB 2INPE 4IWQA 4KDIC 1C78A 3OAWA 2BT6A 2KMAA 3DBHI 4BOZB 3V6EB 2WHIA 1S3SG 2GRIA 3B08A 1DYQA 1KTKA 2SAKA 3I63C 1E7UA 4IDIA 4TMAB 2FCSA 1N63A 2IPKD 4HEA1 4FJVB 4NZLB 1P7EA 3U7DA 1NYRA 3AE6B 2KO3A 3N20C 4YTNB 4DXAB 2MBOA 4LCDE 1TBEA 4BKSD 4IWOA 3OWEB 1WGRA 2WX1A 2PEAA 3DPDA 3A9KA 1J7CA 3PVLA 4PYZA 4GXBA 4ZRQA 2KMCA 3ZNZB 3P42A 1EWCA 1RLFA 2LXAA 4XGAB 1OEYJ 3T8MA 2MP2B 2GMIC 3AE1B 3VHTC 4W9DA 2HTHA 2E3TA 2BVCA 1NBFC 4MACA 4Q2JA 4NAMA 1HE8A 3KYCD 2K8BA 2PVGC 1NI3A 2I2YA 3N1XC 4QAYA 1WGHA 2KC1A 1J0GA 2HD5B 2N0SB 3ZNHB 1R4MB 2MSED 4C4VA 1DGJA 1K53A 1OQYA 4LDTB 1WIAA 3N3KB 4ZDVA 1AN8A 2ZW0A 3JYUA 3AXCA 2QCZA 2DAJA 3GZNI 4WWPA 2KMMA 4BKSA 2RD0A 4OZAA 3Q8BA 2M0AA 3R7QA 3T9LA 3VFKA 4B6WA 1V1PB 3SHQA 1FXIA 2O6VA 3NZSA 2FUG1 3VR8B 2AEHA 1UWXA 1FFUA 1WZ0A 4I6NB 3IT4B 3P4QB 2LI5A 4G3XB 3A33B 4XWWA 3DDCB 1YX5B 4GSWA 1RM6C 3BYTB 4IOIE 4G11A 1F9JA 2FAZA 2LWPA 3AMZA 3HVDA 4OHJA 4IM3A 3R8BA 3NJTA 2X8XX 3N1ZC 2D3GA 3QWZB 3Q69A 2AQ2B 4GDLB 4ARIA 2ZW1A 2K0PA 5AZHA 1J19A 1WXAA 1SSNA 3AEAB 1EU4A 2DAFA 3AE9B 1HEZE 2N1WA 5LNK1 2G4SA 2V9HA 2RGFA 3L0WB 1Y8RC 2R2QA 3NHEB 1WR6E 3LDZE 2K1FA 1OQRA 2LUMA 2WQYB 3U52E 3RMKC 1NVID 5L95C 2WS3B 2LEKA 2LD9A 3IFWB 3C8YA 2MLBA 1FIQA 1H8CA 1XLOA 1HZ5A 4YL8A 1HZ6A 4HPLB 1FD6A 4WAFA 3A9KB 1RYJA 1M4VA 3WANA 2R2OA 4ICUA 2VH1A 3APFA 4PS8A 4P1BC 1TKYA 3DBRB 2KVZA 2O2VB 1TZOA 1DOYA 2KN5A 4FADA 2WXQA 2D10A 4NAWA 3C19A 2IY1B 5IP4D 2J52A 1TGZB 2MBBB 2BKFA 4C4VB 3RNBC 4KZCA 2W82A 1WX9A 4KV2A 2KWVB 2WP9B 1V5OA 4HCNB 4RM9A 3ZYYX 4AUQC 5AEKB 2HDEA 4A9AA 4MGIE 3OLMD 4USAA 5EE3A 1V49A 3UQBA 2V3SA 3U30A 2D5GA 2BB5A 3IT6B 3KW5B 1D6EC 5EE9A 3RN9C 3VTWA 1ZXHA 1WE6A 2WXOA 3EGRA 5AZGA 1AWDA 1F52A 1SBBB 1QOGA 4ANWA 1XQQA 4FXCA 2IY0B 1NENB 4MGKE 1E0ZA 3DCGA 4NPNA 3VTVA 2HE7A 4US8A 3P4PB 1GAQB 3L16A 2ZPNA 1X1MA 1T3QA 3SU8X 3MC8A 1RWSA 5CHVC 3AE4B 4L1BA 2AX5A 4KSKC 2KACA 1UBIA 1Q5WB 2RPQA 4WJQA 3AH7A 3GZNB 4WAAA 1YQ4B 2L7RA 2BWES 1L0YB 2KN4A 1DOIA 4JE3B 5FK9C 2N9KA 1ZDXA 4RGTA 1IGCA 3LXFA 4HWIB 2LUEA 4GDLA 4CHKA 4URKA 3VTUA 2EELA 1FRRA 3QQ8B 2CU1A 1YN5A 3P1MA 4HJGE 2K8HA 3W5UB 1VCBA 2KXJA 2KDIA 2ASQA 2KFJA 3KWVA 1WGKA 1VD2A 4IG7B 2KOXA 4MJSB 1FXTB 2W54A 3BIID 1WJNA 2MP2A 3DBLB 3TEWA 2G9HD 3L08A 1V8CA 1MFWA 2G45B 1WYWB 5DPWA 2FIFA 1F1HA 3PS6A 3AE2B 2X38A 1ESFA 2K6DB 2WDTB 3Q3OC 3QARA 1WM3A 2CU3A 3ZUNA 1SJHD 3WCQA 4DWFA 3AV8A 2Y5BB 2LZ6A 1D5MC 2DYOA 2LJ5A 3DBHB 4RGNA 2V3PA 2KDEB 2MBHA 2CS4A 4JWSC 3HVZA 4XDDA 2XNAC 3BWUD 4JWUC 3X0WA 1PFDA 1JQ4A 1YJJA 2KDMA 4B0MA 2WXRA 3AECB 2LMCA 4MH8A 3FKYA 1C4PA 4HK2A 1VRAB 3NG0A 1YQBA 2KWDA 5E6OA 2WDRB 1V81A 2L76A 4PYUA 4BVUC 4GB9A 2XEWA 3RD2A 3T3OA 1V1PA 1RFKA 4II3B 2A4ZA 1JWBD 1WXMA 1VZ7A 2PTLA 2MRPA 2ZNVB 5IAAC 4M0WB 4NJCA 3HM3A 3SDLC 2WU2B 1P3QU 1SIFA 3BVMA 2JQRB 3TEYA 1YJIA 5DPSA 2LXCA 4CYEA 2DZMA 4FULA 3R3MA 1I7HA 1V86A 2PW9A 1UELA 4HROA 1P1AA 2IDYA 1T0QC 4F8CB 2LVOA 4K7SA 4M8NA 3QA8A 2IGHA 2BS3B 2C60A 3MFGA 2CKHB 2V1YA 1L6VA 1MVKA 2JUOA 1UBQA 1ZXIA 2ZCCA 2N9XA 2ON8A 3M95A 1QQRA 2DHZA 1V2YA 2KT7A 4W9GA 1UUPA 3DHGC 1HXYD 3EA6A 1K50A 3J9CA 4W9CA 3ZXRA 3MJWA 5BO4B 1QILA 2CHXA 2PPHA 2EMTA 3V60A 3H6NA 3RI7C 2N9PC 1C76A 1QOBA 5DPTA 4W9FA 4LLGM 4MGZE 1I4GA 3ZVVA 3BY4B 1B9RA 3D32A 3CMMB 2IGGA 3PGEA 1I42A 4GIVA 3V62A 4A3OA 4FA6A 1OGWA 1AW7A 3QX1A 4I6PA 4K3CA 2PKOA 2BWFA 2WX0A 3U2SC 4HPMB 3S2AA 5KHQA 1WGDA 3AI5A 1TS3A 4MSMB 2OEDA 4HRSA 1C79A 1UF0A 3KYDD 2IO2B 1KLUD 1WXQA 4A8XC 2BQQA 4L23A 3DBLI 3CSFA 4GMVA 4KGSA 4HLEA 2N1VA 3ZO5B 1VJKA 1IGDA 2WWZA 2WXMA 2KJ6A 1SE2A 2KAJA 2UYZB 3JW0X 3JSVA 4MT5A 2PIAA 1ZOYB 2FUHB 4PS3A 1LXDA 1PDXA 2YLMA 3TUOA 4WJOA 4WIPA 1TZ1A 2LFIA 3UGBB 2QILA 1GOZA 2N7JA 2QJLA 3A9JB 2K9XA 2D3AA 2JYEA 2Y5CA 2BTEA 4ANXA 4BKTA 1WY8A 2M17A 4AJWA 3RNCC 3AEEB 3TL5A 3GOEA 1SJED 1BT0A 1CMXB 1YQ3B 2ZZPB 2YVCA 2LVPA 4A20A 4LNKA 3WIMA 3NRZA 2KNBA 1JW9D 4KIKB 1J8CA 4B9KA 4BKGA
chains in the Genus database with same CATH topology
2N7DA 2NPTA 3O65B 2MLBA 5TR5A 1Z5SB 4WWNA 1H8CA 3PZDA 3IHPC 3QJZA 5D94A 4DK5A 4YL8A 1GC7A 3JSVB 3ML9A 3Q3JA 4BBNF 4HPLB 2Z59B 4F7ZA 5G55A 4FJYA 2JZZA 3OJ4B 1LM8B 2V4LA 3A9KB 1D3ZA 4FLHA 2XK5B 2MBQA 4DDID 2D2QA 2I1KA 3PHXB 3WANA 2C7MB 2R2OA 3PHWB 4ICUA 4J6IA 3APFA 4PS8A 3ZIMA 3ZW3A 2RSUA 3LJ3A 3EHVA 2BF8B 3ZTDA 3HHMA 1YIWA 3ENEA 3VDZA 2EMSA 3A1QB 4HCPB 2O2VB 1SE9A 3H7PA 2HJ8A 4AJYB 2M0XA 4IW0A 2JRHA 1C3TA 3EFUA 4BOSC 4MJSA 2KN5A 4B95A 4FADA 2D10A 4GN1A 3VXWA 4NAWA 3CF6E 2MX2A 2IY1B 5GMVA 4OVUA 2O6VB 2O6VD 1TGZB 4ZRJA 2MBBB 2BKFA 2LRUA 1IYFA 4KZCA 2K39A 3PRPB 2G4DB 1WX9A 2IBIB 1GUAB 4KV2A 4E3CA 2KWVB 4HCNB 1V5OA 4AOFA 4RM9A 4EKUA 2KTRB 2FIDA 4ZYNA 4AUQC 2CHWA 4GU2A 5AEKB 2GBMA 2REXA 2IO3B 2LGXA 2NVUI 3NOBA 3M63B 3AULA 4MGIE 1WM2A 5L83A 3QCAA 5J2RA 3KUDB 1UGMA 4FHJA 3OLMD 3ZTCA 2KDFB 4JLCA 2L0TA 1V49A 3W1SA 3ZLZA 3WAPA 1WRDB 3UQBA 2V3SA 3NZUA 4E71A 3U30A 1Q0WB 4TV3A 2L05A 1E8XA 3EC8A 1S1QB 3KW5B 3SD5A 3VTWA 1WMHB 3NY5A 4G50A 2AL3A 2DZIA 4RMAA 2KX0A 4E74A 1L2NA 2M8SA 3Q3FA 1WE6A 5AZGA 4DHZE 5J17A 5JH5C 1V80A 3DVGX 4ANWA 1XQQA 1ZW7A 4LDTD 3H7PB 4AP4C 1P9DU 2BKRB 3QC8B 1OEYA 4KDLB 5EDSA 2IY0B 2KK8A 2CHZA 3R66C 1K8RB 4MGKE 3VH4B 4PS7A 2DENB 4KVGB 3DCGA 4HJKA 3DVNV 3CSTA 1YD8U 4NPNA 3VTVA 4DDGD 2HE7A 1E8WA 3JVZX 4MEMA 2Z0EB 1WH3A 5DCNA 2C9WB 1V9JA 3ZNGC 1WE7A 3L16A 2ZPNA 2KX3A 4NY0A 2JXXA 1X1MA 5E6NA 2MBEA 2ZEQA 3TMPB 2N4FA 2MW5A 3N30A 3ECIA 3UF8A 2G3QB 3SU8X 1KJTA 4N9F4 2OOBB 2KJHB 4K1RB 1I35A 5CHVC 2J7QB 2LGDA 2ZCBA 2LGYA 4MGYE 3PSEB 4KSKC 1P98A 1PQSA 1V6EA 2PJHA 4LJOB 4WWOA 4DHJD 3RCZA 5CHFA 1E90A 3MTNB 4MM3A 1UBIA 4FHKA 5CTRC 3HK0A 4RM8A 3UQAA 3IG3A 1Q5WB 4AWJA 2KFKA 2RPQA 4WJQA 2JZ3B 3HM6X 2JRIB 1LFDA 3W1YA 4DHJB 2ZVNA 4WAAA 3ZRFA 2L7RA 2BWES 4MSQB 2J0JA 2MA9B 4W9EA 2LVQA 2J0KA 4W9HA 1ISNA 2D07B 2IYDB 4NAWB 3RUIB 3L13A 3RT3B 4HWIB 1WJ4A 2LUEA 4JQWC 4GDLA 4K81A 1M94A 4CHKA 4URKA 3VTUA 1EF1A 2JWZA 3VUWA 3L10B 3QQ8B 1EO6A 1ZKHA 2CU1A 4FBJB 4DHZB 3TIXA 1KOTA 3HIZA 2K8HA 3PPAA 3BINA 4HVBA 1VCBA 2AYOB 2GOWA 2O2VA 1E8ZA 1LQBA 2KXJA 3RZFA 1XD3B 2KDIA 2ASQA 1T0YA 2IZVB 2KFJA 3DOWA 4FJZA 3WALA 3H7SA 4W9IA 1KM7A 1VD2A 5C1ZA 4IG7B 2KOXA 2FCQA 4ZRIA 3P2BA 4MJSB 3PV1A 4P7IA 2ZJDA 3RZWC 1FXTB 5AZFA 2MCNB 2FCMA 1WJNA 2MP2A 3H1UA 3PLUA 4XZ4A 1NDDA 3ML8A 4KIKA 3KUCB 4K7WA 4MELA 4OVVA 1EUVB 3PREA 4CO7A 5DPRA 3AU4A 3L08A 3A9JA 2KJRA 4JIOU 2G45B 1EF5A 1L7YA 1WYWB 3QAQA 5DPWA 2KVRA 5IA7A 2FIFA 2IO1B 2LRWA 3DBRI 2ZPYA 3ZDMC 4II2B 2XK5A 4M8MA 3PS6A 3ZRCA 1GC6A 1E5WA 2C5LC 2K6DB 2KKCA 2WDTB 3QARA 3V61A 1WM3A 4JGHB 3ZUNA 3WAOA 1MG8A 4DWFA 2CR5A 4NQLB 1WI0A 1H4RA 5JHBA 3ZKJC 2GBRA 2NBVB 1ZGUB 2KQ7A 2Y5BB 2KLCA 2M4NA 2LZ6A 2KHWB 4XX5A 2L3ZA 2DYOA 3DBSA 2LJ5A 3PT2B 3UIOB 2MWSB 4ANVA 1P0RA 1WXSA 2KDEB 2MBHA 2CS4A 2NBUA 5C23A 2C7NB 3WA0A 4GOCA 3AU5A 3PRZA 3DQVA 1C1YB 2KTRA 4GDKB 2C7HA 3K9PB 1R4NI 4GGQA 3WAMA 3X0WA 3APDA 1NI2A 2DX5B 3A4SC 5D6JB 1OTRB 5KHOA 3OJ3A 4NJ7A 2KWUB 3W1SC 3RYTA 2B3AA 3KUZA 1WGGA 3PLVA 2NCNA 4ASWC 1IP9A 4HK2A 1JRUA 1E8YA 3KH0A 1YQBA 2GBKA 5E6OA 5J18A 1WR1A 1V81A 4HXDA 4MDKE 1YX6B 1WX7A 2L76A 2ZNVC 2WYQA 4W9KA 2NBWB 3RULA 5G2NA 1WZ3A 1RFAA 4PYUA 4BVUC 4GB9A 2XEWA 3I3TB 3RD2A 5LLIA 4FN2A 1QZEA 4II3B 2A4ZA 2KQSA 1WGYA 1WXMA 2JY6A 4MH0E 4TKNA 3TBLD 4EOYA 2M1MA 2NS5A 3A1QA 2GBJA 3IVFA 4W9JA 4ZRKA 1A5RA 4WJNA 1Z2MA 2MRPA 2ZNVB 5IAAC 4M0WB 4I6LB 2KWCA 3QIJA 3VUYA 3HM3A 1GG3A 3SDLC 1R4MI 4HDQA 2BYFA 1P3QU 1SIFA 3VUXA 2ZVOA 2KLGA 4F1SA 2IO0B 4BFRA 3U8ZA 4NNJB 2OJRA 5LXHA 5DPSA 5D7GA 2LXCA 5CHWA 5CX3A 4CYEA 2DZMA 4FULA 3R3MA 4DBGA 1V86A 1UELA 2J0MA 2MQJA 2N7EA 1P1AA 1E7VA 1RAXA 5LXIB 2W9NA 2DZKA 4KZ0A 3ZDTA 4F8CB 2LVOA 1AARA 2VRRB 4IWQA 4KDIC 4EUTA 4K7SA 3OAWA 4EFOA 4M8NA 3QA8A 3IBEA 4IUMB 1KLVA 2C60A 2KMAA 3DBHI 2CKHB 2V1YA 1WFYA 3UIPB 4BOZB 2JPHA 2JUOA 4IM2A 1UBQA 2JF5A 2ZCCA 3UINB 2N9XA 3V6EB 1S3SG 2BYEA 4G0NB 3M95A 2XBBC 2KANA 3B08A 5JHAA 4HDOA 2DHZA 3DVNU 2RR9A 1V2YA 1E7UA 5JZEB 4WJPA 2FCSA 4W9GA 4W9LA 1IPGA 4FJVB 2BYVE 4EZKA 3U7DA 2EKEC 2Z0DB 4ANUA 2KO3A 2K8CA 1G6JA 1Q1OA 4DXAB 2MBOA 2NPTB 4LCDE 1XT9B 1UD7A 2PE9A 1WJUA 1TBEA 4W9CA 4BKSD 4IWOA 1WGRA 3MJWA 2KC2A 2WX1A 5BO4B 1U4AA 2PEAA 2CHXA 2PPHA 3DPDA 2EMTA 2L00B 3PTFC 3V60A 3H6NA 3DVGY 2K25A 3A9KA 3C0RB 3A4RA 2N9PC 3EECA 2KFKB 3PVLA 4PYZA 4GXBA 2FCNA 4NJ6A 5DPTA 2KMCA 3ZNZB 2GBNA 2N9EB 1RLFA 2LXAA 4XC2A 4W9FA 1OEYJ 3T8MA 2MP2B 2GMIC 3VHTC 4MGZE 4W9DA 2AL6A 3VH3B 3ZVVA 3BY4B 2HTHA 3ZNID 4IWPA 3D32A 3CMMB 1NBFC 2DYMA 2KZRA 1I42A 3PGEA 1HE8A 3KYCD 4GIVA 4TQ0A 2K8BA 5HKHA 3M3JA 2LASA 3V62A 3VQIA 4EZLA 4A3OA 2KD0A 4FA6A 1WMHA 1WGHA 1OGWA 2KC1A 2DZJA 1J0GA 2HD5B 3TCAA 3QX1A 4I6PA 1SGHA 3ALBA 3ZNHB 2MSED 2D11A 3VVWB 2BWFA 2UWQA 2WX0A 4HPMB 3S2AA 2QHOA 1OQYA 1WGDA 2L8JA 1YJ1A 4LDTB 3X23A 5KHQA 1WIAA 3AI5A 3N3KB 4ZDVA 3JYUA 4MSMB 3L17A 3AXCA 3N32A 2DAJA 3GZNI 3PRMB 4WWPA 4BKSA 2RD0A 3KYDD 2IO2B 1WJ6A 2I1JA 4BBNC 3R7QA 2BPSA 3DBLI 3CSFA 3T9LA 3VFKA 4B6WA 4GDKA 3SHQA 4GMVA 4IC7B 4HLEA 2N1VA 3B1LX 3R7RA 2O6VA 3VAWA 3M62B 3NS8A 3NZSA 3B0AA 3ZO5B 1GJZA 2KDBA 3H9DA 2AEHA 2WWZA 2KTFA 1WZ0A 4I6NB 2KJ6A 2LI5A 2UYZB 3JW0X 3JSVA 4G3XB 2FUHB 3A33B 3DDCB 3V6CB 4PS3A 1LXDA 1YX5B 4ICVA 4GSWA 1GNUA 2YLMA 4KSLC 4WJOA 4JL9A 2FNJB 5E6PA 1WXVA 3ONSA 2AWTA 1TZ1A 4G11A 4A3PA 1F9JA 3UGBB 2FAZA 3QHTA 2JVCA 2NR2A 4K7UA 2LWPA 4WQOB 2BGFA 1UZXB 4NQKE 2K6QA 3APCA 4LJPB 4IM3A 2DYBA 3KVFB 1TTNA 2D3GA 3QWZB 4EEWA 4X57B 4GDLB 3A9JB 2PE6B 3TJPA 3K9OB 5AZHA 1J19A 1WXAA 4EZJA 4TUUA 4ANXA 1UH6A 4BKTA 1WY8A 2M17A 2DAFA 4AJWA 4IM0A 2N1WA 3MHSD 1WX8A 3GOEA 2G4SA 3TL5A 2RGFA 1BT0A 2L0FA 1CMXB 2ZZPB 3L0WB 1Y8RC 1V5TA 2R2QA 3NHEB 5D2MB 3QK0A 2YVCA 2LVPA 1WR6E 3LDZE 2K1FA 4A20A 1WF9A 1RRBA 3WIMA 5FR6A 2KNBA 2JT4B 4TQ1A 5L95C 3L54A 4KIKB 2A5UA 2LD9A 3IFWB 1J8CA 4B9KA 4BKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7D A;  2NPT A;  3O65 B;  2MLB A;  5TR5 A;  1Z5S B;  4WWN A;  1H8C A;  3PZD A;  3IHP C;  3QJZ A;  5D94 A;  4DK5 A;  4YL8 A;  1GC7 A;  3JSV B;  3ML9 A;  3Q3J A;  4BBN F;  4HPL B;  2Z59 B;  4F7Z A;  5G55 A;  4FJY A;  2JZZ A;  3OJ4 B;  1LM8 B;  2V4L A;  3A9K B;  1D3Z A;  4FLH A;  2XK5 B;  2MBQ A;  4DDI D;  2D2Q A;  2I1K A;  3PHX B;  3WAN A;  2C7M B;  2R2O A;  3PHW B;  4ICU A;  4J6I A;  3APF A;  4PS8 A;  3ZIM A;  3ZW3 A;  2RSU A;  3LJ3 A;  3EHV A;  2BF8 B;  3ZTD A;  3HHM A;  1YIW A;  3ENE A;  3VDZ A;  2EMS A;  3A1Q B;  4HCP B;  2O2V B;  1SE9 A;  3H7P A;  2HJ8 A;  4AJY B;  2M0X A;  4IW0 A;  2JRH A;  1C3T A;  3EFU A;  4BOS C;  4MJS A;  2KN5 A;  4B95 A;  4FAD A;  2D10 A;  4GN1 A;  3VXW A;  4NAW A;  3CF6 E;  2MX2 A;  2IY1 B;  5GMV A;  4OVU A;  2O6V B;  2O6V D;  1TGZ B;  4ZRJ A;  2MBB B;  2BKF A;  2LRU A;  1IYF A;  4KZC A;  2K39 A;  3PRP B;  2G4D B;  1WX9 A;  2IBI B;  1GUA B;  4KV2 A;  4E3C A;  2KWV B;  4HCN B;  1V5O A;  4AOF A;  4RM9 A;  4EKU A;  2KTR B;  2FID A;  4ZYN A;  4AUQ C;  2CHW A;  4GU2 A;  5AEK B;  2GBM A;  2REX A;  2IO3 B;  2LGX A;  2NVU I;  3NOB A;  3M63 B;  3AUL A;  4MGI E;  1WM2 A;  5L83 A;  3QCA A;  5J2R A;  3KUD B;  1UGM A;  4FHJ A;  3OLM D;  3ZTC A;  2KDF B;  4JLC A;  2L0T A;  1V49 A;  3W1S A;  3ZLZ A;  3WAP A;  1WRD B;  3UQB A;  2V3S A;  3NZU A;  4E71 A;  3U30 A;  1Q0W B;  4TV3 A;  2L05 A;  1E8X A;  3EC8 A;  1S1Q B;  3KW5 B;  3SD5 A;  3VTW A;  1WMH B;  3NY5 A;  4G50 A;  2AL3 A;  2DZI A;  4RMA A;  2KX0 A;  4E74 A;  1L2N A;  2M8S A;  3Q3F A;  1WE6 A;  5AZG A;  4DHZ E;  5J17 A;  5JH5 C;  1V80 A;  3DVG X;  4ANW A;  1XQQ A;  1ZW7 A;  4LDT D;  3H7P B;  4AP4 C;  1P9D U;  2BKR B;  3QC8 B;  1OEY A;  4KDL B;  5EDS A;  2IY0 B;  2KK8 A;  2CHZ A;  3R66 C;  1K8R B;  4MGK E;  3VH4 B;  4PS7 A;  2DEN B;  4KVG B;  3DCG A;  4HJK A;  3DVN V;  3CST A;  1YD8 U;  4NPN A;  3VTV A;  4DDG D;  2HE7 A;  1E8W A;  3JVZ X;  4MEM A;  2Z0E B;  1WH3 A;  5DCN A;  2C9W B;  1V9J A;  3ZNG C;  1WE7 A;  3L16 A;  2ZPN A;  2KX3 A;  4NY0 A;  2JXX A;  1X1M A;  5E6N A;  2MBE A;  2ZEQ A;  3TMP B;  2N4F A;  2MW5 A;  3N30 A;  3ECI A;  3UF8 A;  2G3Q B;  3SU8 X;  1KJT A;  4N9F 4;  2OOB B;  2KJH B;  4K1R B;  1I35 A;  5CHV C;  2J7Q B;  2LGD A;  2ZCB A;  2LGY A;  4MGY E;  3PSE B;  4KSK C;  1P98 A;  1PQS A;  1V6E A;  2PJH A;  4LJO B;  4WWO A;  4DHJ D;  3RCZ A;  5CHF A;  1E90 A;  3MTN B;  4MM3 A;  1UBI A;  4FHK A;  5CTR C;  3HK0 A;  4RM8 A;  3UQA A;  3IG3 A;  1Q5W B;  4AWJ A;  2KFK A;  2RPQ A;  4WJQ A;  2JZ3 B;  3HM6 X;  2JRI B;  1LFD A;  3W1Y A;  4DHJ B;  2ZVN A;  4WAA A;  3ZRF A;  2L7R A;  2BWE S;  4MSQ B;  2J0J A;  2MA9 B;  4W9E A;  2LVQ A;  2J0K A;  4W9H A;  1ISN A;  2D07 B;  2IYD B;  4NAW B;  3RUI B;  3L13 A;  3RT3 B;  4HWI B;  1WJ4 A;  2LUE A;  4JQW C;  4GDL A;  4K81 A;  1M94 A;  4CHK A;  4URK A;  3VTU A;  1EF1 A;  2JWZ A;  3VUW A;  3L10 B;  3QQ8 B;  1EO6 A;  1ZKH A;  2CU1 A;  4FBJ B;  4DHZ B;  3TIX A;  1KOT A;  3HIZ A;  2K8H A;  3PPA A;  3BIN A;  4HVB A;  1VCB A;  2AYO B;  2GOW A;  2O2V A;  1E8Z A;  1LQB A;  2KXJ A;  3RZF A;  1XD3 B;  2KDI A;  2ASQ A;  1T0Y A;  2IZV B;  2KFJ A;  3DOW A;  4FJZ A;  3WAL A;  3H7S A;  4W9I A;  1KM7 A;  1VD2 A;  5C1Z A;  4IG7 B;  2KOX A;  2FCQ A;  4ZRI A;  3P2B A;  4MJS B;  3PV1 A;  4P7I A;  2ZJD A;  3RZW C;  1FXT B;  5AZF A;  2MCN B;  2FCM A;  1WJN A;  2MP2 A;  3H1U A;  3PLU A;  4XZ4 A;  1NDD A;  3ML8 A;  4KIK A;  3KUC B;  4K7W A;  4MEL A;  4OVV A;  1EUV B;  3PRE A;  4CO7 A;  5DPR A;  3AU4 A;  3L08 A;  3A9J A;  2KJR A;  4JIO U;  2G45 B;  1EF5 A;  1L7Y A;  1WYW B;  3QAQ A;  5DPW A;  2KVR A;  5IA7 A;  2FIF A;  2IO1 B;  2LRW A;  3DBR I;  2ZPY A;  3ZDM C;  4II2 B;  2XK5 A;  4M8M A;  3PS6 A;  3ZRC A;  1GC6 A;  1E5W A;  2C5L C;  2K6D B;  2KKC A;  2WDT B;  3QAR A;  3V61 A;  1WM3 A;  4JGH B;  3ZUN A;  3WAO A;  1MG8 A;  4DWF A;  2CR5 A;  4NQL B;  1WI0 A;  1H4R A;  5JHB A;  3ZKJ C;  2GBR A;  2NBV B;  1ZGU B;  2KQ7 A;  2Y5B B;  2KLC A;  2M4N A;  2LZ6 A;  2KHW B;  4XX5 A;  2L3Z A;  2DYO A;  3DBS A;  2LJ5 A;  3PT2 B;  3UIO B;  2MWS B;  4ANV A;  1P0R A;  1WXS A;  2KDE B;  2MBH A;  2CS4 A;  2NBU A;  5C23 A;  2C7N B;  3WA0 A;  4GOC A;  3AU5 A;  3PRZ A;  3DQV A;  1C1Y B;  2KTR A;  4GDK B;  2C7H A;  3K9P B;  1R4N I;  4GGQ A;  3WAM A;  3X0W A;  3APD A;  1NI2 A;  2DX5 B;  3A4S C;  5D6J B;  1OTR B;  5KHO A;  3OJ3 A;  4NJ7 A;  2KWU B;  3W1S C;  3RYT A;  2B3A A;  3KUZ A;  1WGG A;  3PLV A;  2NCN A;  4ASW C;  1IP9 A;  4HK2 A;  1JRU A;  1E8Y A;  3KH0 A;  1YQB A;  2GBK A;  5E6O A;  5J18 A;  1WR1 A;  1V81 A;  4HXD A;  4MDK E;  1YX6 B;  1WX7 A;  2L76 A;  2ZNV C;  2WYQ A;  4W9K A;  2NBW B;  3RUL A;  5G2N A;  1WZ3 A;  1RFA A;  4PYU A;  4BVU C;  4GB9 A;  2XEW A;  3I3T B;  3RD2 A;  5LLI A;  4FN2 A;  1QZE A;  4II3 B;  2A4Z A;  2KQS A;  1WGY A;  1WXM A;  2JY6 A;  4MH0 E;  4TKN A;  3TBL D;  4EOY A;  2M1M A;  2NS5 A;  3A1Q A;  2GBJ A;  3IVF A;  4W9J A;  4ZRK A;  1A5R A;  4WJN A;  1Z2M A;  2MRP A;  2ZNV B;  5IAA C;  4M0W B;  4I6L B;  2KWC A;  3QIJ A;  3VUY A;  3HM3 A;  1GG3 A;  3SDL C;  1R4M I;  4HDQ A;  2BYF A;  1P3Q U;  1SIF A;  3VUX A;  2ZVO A;  2KLG A;  4F1S A;  2IO0 B;  4BFR A;  3U8Z A;  4NNJ B;  2OJR A;  5LXH A;  5DPS A;  5D7G A;  2LXC A;  5CHW A;  5CX3 A;  4CYE A;  2DZM A;  4FUL A;  3R3M A;  4DBG A;  1V86 A;  1UEL A;  2J0M A;  2MQJ A;  2N7E A;  1P1A A;  1E7V A;  1RAX A;  5LXI B;  2W9N A;  2DZK A;  4KZ0 A;  3ZDT A;  4F8C B;  2LVO A;  1AAR A;  2VRR B;  4IWQ A;  4KDI C;  4EUT A;  4K7S A;  3OAW A;  4EFO A;  4M8N A;  3QA8 A;  3IBE A;  4IUM B;  1KLV A;  2C60 A;  2KMA A;  3DBH I;  2CKH B;  2V1Y A;  1WFY A;  3UIP B;  4BOZ B;  2JPH A;  2JUO A;  4IM2 A;  1UBQ A;  2JF5 A;  2ZCC A;  3UIN B;  2N9X A;  3V6E B;  1S3S G;  2BYE A;  4G0N B;  3M95 A;  2XBB C;  2KAN A;  3B08 A;  5JHA A;  4HDO A;  2DHZ A;  3DVN U;  2RR9 A;  1V2Y A;  1E7U A;  5JZE B;  4WJP A;  2FCS A;  4W9G A;  4W9L A;  1IPG A;  4FJV B;  2BYV E;  4EZK A;  3U7D A;  2EKE C;  2Z0D B;  4ANU A;  2KO3 A;  2K8C A;  1G6J A;  1Q1O A;  4DXA B;  2MBO A;  2NPT B;  4LCD E;  1XT9 B;  1UD7 A;  2PE9 A;  1WJU A;  1TBE A;  4W9C A;  4BKS D;  4IWO A;  1WGR A;  3MJW A;  2KC2 A;  2WX1 A;  5BO4 B;  1U4A A;  2PEA A;  2CHX A;  2PPH A;  3DPD A;  2EMT A;  2L00 B;  3PTF C;  3V60 A;  3H6N A;  3DVG Y;  2K25 A;  3A9K A;  3C0R B;  3A4R A;  2N9P C;  3EEC A;  2KFK B;  3PVL A;  4PYZ A;  4GXB A;  2FCN A;  4NJ6 A;  5DPT A;  2KMC A;  3ZNZ B;  2GBN A;  2N9E B;  1RLF A;  2LXA A;  4XC2 A;  4W9F A;  1OEY J;  3T8M A;  2MP2 B;  2GMI C;  3VHT C;  4MGZ E;  4W9D A;  2AL6 A;  3VH3 B;  3ZVV A;  3BY4 B;  2HTH A;  3ZNI D;  4IWP A;  3D32 A;  3CMM B;  1NBF C;  2DYM A;  2KZR A;  1I42 A;  3PGE A;  1HE8 A;  3KYC D;  4GIV A;  4TQ0 A;  2K8B A;  5HKH A;  3M3J A;  2LAS A;  3V62 A;  3VQI A;  4EZL A;  4A3O A;  2KD0 A;  4FA6 A;  1WMH A;  1WGH A;  1OGW A;  2KC1 A;  2DZJ A;  1J0G A;  2HD5 B;  3TCA A;  3QX1 A;  4I6P A;  1SGH A;  3ALB A;  3ZNH B;  2MSE D;  2D11 A;  3VVW B;  2BWF A;  2UWQ A;  2WX0 A;  4HPM B;  3S2A A;  2QHO A;  1OQY A;  1WGD A;  2L8J A;  1YJ1 A;  4LDT B;  3X23 A;  5KHQ A;  1WIA A;  3AI5 A;  3N3K B;  4ZDV A;  3JYU A;  4MSM B;  3L17 A;  3AXC A;  3N32 A;  2DAJ A;  3GZN I;  3PRM B;  4WWP A;  4BKS A;  2RD0 A;  3KYD D;  2IO2 B;  1WJ6 A;  2I1J A;  4BBN C;  3R7Q A;  2BPS A;  3DBL I;  3CSF A;  3T9L A;  3VFK A;  4B6W A;  4GDK A;  3SHQ A;  4GMV A;  4IC7 B;  4HLE A;  2N1V A;  3B1L X;  3R7R A;  2O6V A;  3VAW A;  3M62 B;  3NS8 A;  3NZS A;  3B0A A;  3ZO5 B;  1GJZ A;  2KDB A;  3H9D A;  2AEH A;  2WWZ A;  2KTF A;  1WZ0 A;  4I6N B;  2KJ6 A;  2LI5 A;  2UYZ B;  3JW0 X;  3JSV A;  4G3X B;  2FUH B;  3A33 B;  3DDC B;  3V6C B;  4PS3 A;  1LXD A;  1YX5 B;  4ICV A;  4GSW A;  1GNU A;  2YLM A;  4KSL C;  4WJO A;  4JL9 A;  2FNJ B;  5E6P A;  1WXV A;  3ONS A;  2AWT A;  1TZ1 A;  4G11 A;  4A3P A;  1F9J A;  3UGB B;  2FAZ A;  3QHT A;  2JVC A;  2NR2 A;  4K7U A;  2LWP A;  4WQO B;  2BGF A;  1UZX B;  4NQK E;  2K6Q A;  3APC A;  4LJP B;  4IM3 A;  2DYB A;  3KVF B;  1TTN A;  2D3G A;  3QWZ B;  4EEW A;  4X57 B;  4GDL B;  3A9J B;  2PE6 B;  3TJP A;  3K9O B;  5AZH A;  1J19 A;  1WXA A;  4EZJ A;  4TUU A;  4ANX A;  1UH6 A;  4BKT A;  1WY8 A;  2M17 A;  2DAF A;  4AJW A;  4IM0 A;  2N1W A;  3MHS D;  1WX8 A;  3GOE A;  2G4S A;  3TL5 A;  2RGF A;  1BT0 A;  2L0F A;  1CMX B;  2ZZP B;  3L0W B;  1Y8R C;  1V5T A;  2R2Q A;  3NHE B;  5D2M B;  3QK0 A;  2YVC A;  2LVP A;  1WR6 E;  3LDZ E;  2K1F A;  4A20 A;  1WF9 A;  1RRB A;  3WIM A;  5FR6 A;  2KNB A;  2JT4 B;  4TQ1 A;  5L95 C;  3L54 A;  4KIK B;  2A5U A;  2LD9 A;  3IFW B;  1J8C A;  4B9K A;  4BKG A; 
#chains in the Genus database with same CATH topology
 4LNN A;  3O65 B;  1Q10 A;  1SXT A;  1Z5S B;  5E6J A;  3RNE C;  3RFZ B;  5D94 A;  1GC7 A;  3ML9 A;  1TJE A;  1AYF A;  5G55 A;  2XK5 B;  2I1K A;  3AN1 A;  3PHX B;  3PHW B;  4J6I A;  3ZW3 A;  2RSU A;  3LJ3 A;  3ZTD A;  3HHM A;  1YIW A;  3VDZ A;  2MJD A;  3A1Q B;  3H7P A;  4AJY B;  2HJ8 A;  2JRH A;  1QOF A;  2HJ1 A;  4MJS A;  4GN1 A;  4REZ A;  2MX2 A;  1SE4 A;  2QC8 A;  5IKC M;  2Q5W D;  2K39 A;  2OHF A;  2G4D B;  1FNU A;  4AOF A;  1XCQ L;  2FID A;  3MC0 B;  4GU2 A;  3M63 B;  3VRA B;  3DWG C;  3QCA A;  3KUD B;  4O1N A;  3ZQ4 A;  4FHJ A;  4P16 A;  2FE8 A;  4AQ7 A;  1VZ8 A;  1VR9 A;  3ZLZ A;  3WAP A;  3Q2A C;  1JWU D;  3CWI A;  4E71 A;  1Q0W B;  4C7Y A;  4RMA A;  2M8S A;  3Q3F A;  4DHZ E;  2RDB C;  5H92 C;  5JH5 C;  3W5V B;  1ZW7 A;  4LDT D;  2IND C;  4AP4 C;  1P9D U;  2BKR B;  2GLS A;  1OEY A;  2ACZ B;  4M00 A;  3DVN V;  3CST A;  1YD8 U;  1EWY C;  1E8W A;  1WH3 A;  3GP7 A;  3NVV A;  1V9J A;  1TY2 A;  3N1Y C;  4S17 A;  4NY0 A;  2HTM E;  3SR6 A;  3EFC A;  2N4F A;  2MW5 A;  1TT5 B;  1FRD A;  3H8H A;  2J7Q B;  1PQS A;  1V6E A;  2W55 A;  4WWO A;  2VZK D;  5CTR C;  4XDC A;  3UQA A;  5C2T B;  3IG3 A;  2KFK A;  5T8I A;  2JZ3 B;  4WQM A;  2ZVN A;  3Q3M C;  1A70 A;  1ZDV A;  4NAW B;  3FIL A;  4LK0 M;  1KRH A;  2KYW A;  1KFY B;  2UU7 A;  5D3I B;  1WJ4 A;  3CIR B;  2WDV B;  2JWZ A;  2I38 A;  3L10 B;  4HPP A;  4FBJ B;  3BZD B;  1KOT A;  4KKJ A;  1VLB A;  3BIN A;  1C77 A;  2GOW A;  4HVB A;  2J42 A;  3DOW A;  3WAL A;  1YMH E;  3AE5 B;  2IGD A;  5C1Z A;  4ZRI A;  2E6X A;  4P7I A;  1FCC C;  1I4Q A;  2DNF A;  2L52 A;  1NDD A;  3KUC B;  1PGX A;  4PT5 A;  4WWM A;  4CO7 A;  1XEE A;  2KJR A;  1C4C A;  3NVZ A;  2W3S A;  5IOI A;  1SB3 C;  5IA7 A;  2LRW A;  3DBR I;  2MJ3 A;  3DHH C;  4JGH B;  3WAO A;  2CR5 A;  1H4R A;  5JHB A;  1QT9 A;  3Q8E A;  2M4N A;  2EKI A;  3DBS A;  2GB1 A;  2MWS B;  1I4R A;  3I5J C;  2RDG A;  1P7F A;  1WXS A;  1OFF A;  2C7N B;  3KLS X;  3PRZ A;  3DQV A;  2KTR A;  2BS4 B;  4M02 A;  4GGQ A;  5MPO A;  5HG2 A;  1UWM A;  3APD A;  1NI2 A;  2DX5 B;  3NVY A;  1VZ6 A;  2KWU B;  1GB4 A;  3RYT A;  4KGR A;  2B3A A;  1V1O A;  1WGG A;  3PLV A;  1MHH E;  3GS2 A;  5J18 A;  4HXD A;  2V4I B;  1WX7 A;  2WYQ A;  3RUL A;  1WZ3 A;  1RFA A;  3I3T B;  4FN2 A;  2KQS A;  4S0R A;  2OJW A;  3NVW A;  2M1M A;  2NS5 A;  2GBJ A;  1A5R A;  4ZRK A;  3E56 A;  1Z2M A;  2ICI A;  4CQN A;  5HFY A;  2BYF A;  2ZVO A;  3AE3 B;  1K51 A;  4F1S A;  2IO0 B;  2QDF A;  4BFR A;  1FNV A;  4ZHP A;  1BXT A;  1FM0 D;  1CK1 A;  2LGI A;  4DBG A;  2N7E A;  1FEH A;  1FFV A;  1IBX B;  5LXI B;  4HKZ E;  4A90 A;  2DZK A;  3ZDT A;  1AAR A;  4EFO A;  1QF6 A;  4IUM B;  1KLV A;  5HHD G;  2WXL A;  1J7B A;  1WFY A;  3UIP B;  2JPH A;  2JF5 A;  3UIN B;  3W9C B;  2BB6 A;  2XBB C;  2KAN A;  5JHA A;  4HDO A;  3DVN U;  4WJP A;  1IPG A;  4ZRP A;  4DXF A;  4M01 A;  2EKE C;  2Z0D B;  2K8C A;  1G6J A;  1Q1O A;  2KQ4 X;  2NPT B;  1UD7 A;  1TIF A;  1WJU A;  3SFE B;  2KC2 A;  1EU3 A;  4WUR A;  1TS4 A;  2L00 B;  3PTF C;  2TSS A;  3C0R B;  4LNF A;  3A4R A;  2VZK B;  2KFK B;  3PO0 A;  2FCN A;  3IXS A;  1SIJ A;  1JWS D;  2GBN A;  2N9E B;  4JX1 C;  5FKA C;  2AL6 A;  3RPF C;  4A55 A;  3FC4 A;  3SEB A;  2DYM A;  2W3R A;  3M3J A;  4EZL A;  1VDV A;  2KD0 A;  4MM3 B;  1WMH A;  2DZJ A;  1ET9 A;  3TCA A;  2PLP A;  1SGH A;  2D11 A;  2DBY A;  1FXA A;  2QHO A;  2L8J A;  1YJ1 A;  2BBC A;  2YEP B;  4M0W A;  4LTU A;  1BUI C;  1ACC A;  3TEZ A;  1WJ6 A;  4YWG G;  4K3B A;  4GDK A;  1R4N B;  3GB1 A;  3B1L X;  3R7R A;  1ZE3 D;  2H89 B;  3M62 B;  3NS8 A;  1B1Z A;  3B0A A;  2KDB A;  3H9D A;  2K22 A;  2KTF A;  1F77 A;  3ETR A;  1GNU A;  4KSL C;  4JL9 A;  4XWT A;  5E6P A;  1WXV A;  3ONS A;  1N5W A;  4OZB A;  3QHT A;  4K7U A;  2NR2 A;  4WQO B;  1UZX B;  4NQK E;  1PGA A;  4YTM B;  2K6Q A;  4B0E A;  1JAL A;  2DYB A;  5BYS A;  3KVF B;  2WLB A;  1KH0 A;  2ONQ A;  3AEB B;  3TJP A;  2MJE A;  3DWM A;  1I4X A;  1JRO A;  1TY0 A;  4IM0 A;  1ET6 A;  3MHS D;  1WX8 A;  2JSV X;  1FCL A;  1D5Z C;  3ZXV A;  1QLB B;  5C3J B;  3QK0 A;  1MHX A;  1WF9 A;  1RRB A;  1JWM D;  3VRB B;  1I4H A;  2JT4 B;  4TQ1 A;  1XLP A;  2A5U A;  4YSY B;  1MJD A;  1BML C;  2N7D A;  3IHP C;  3QJZ A;  2LHE A;  3Q3J A;  4BBN F;  2Z59 B;  4TSS A;  3OJ4 B;  1LM8 B;  2V4L A;  2QIE B;  2MBQ A;  4P6V F;  1WYG A;  1LO5 D;  2C7M B;  3ZIM A;  2BF8 B;  4HCP B;  1SE9 A;  3EFU A;  2WU5 B;  2J4X A;  5GMV A;  4OVU A;  2O6V B;  2O6V D;  2RMM A;  2LRU A;  1IYF A;  3N9Y C;  2BW2 A;  1FNW A;  2IBI B;  1GUA B;  4E3C A;  1WRI A;  4ZYN A;  2CHW A;  4RGO S;  2GBM A;  2XN9 C;  2NVU I;  1J7A A;  2VH2 A;  3P4S B;  2DWQ A;  4LNI A;  3L4P A;  4RNA A;  3ZTC A;  4JLC A;  2BS2 B;  2L0T A;  1SF0 A;  1WRD B;  4IKG A;  1E8X A;  1S1Q B;  1PUT A;  1STE A;  1L2N A;  2AL3 A;  2DZI A;  4E74 A;  2KX0 A;  4C80 A;  1L4D B;  2CJO A;  5HI1 A;  1V80 A;  2PVO D;  1FPY A;  4PS7 A;  1JML A;  1PGB A;  4HKQ A;  4A6Q A;  1WE7 A;  4RF1 A;  2IJ0 A;  5AUI A;  5E6N A;  2ZEQ A;  3Q8C A;  3ECI A;  3UF8 A;  2NMQ A;  2G3Q B;  1KJT A;  2OOB B;  1I35 A;  1ZUD 2;  1D4B A;  1XCT L;  3PSE B;  1P98 A;  3V3X A;  4LJO B;  5CHF A;  1E90 A;  3MTN B;  3PZ7 A;  1IBX A;  4AWJ A;  3HM6 X;  2JRI B;  3W1Y A;  2WXP A;  5IN7 A;  3ZRF A;  1UGJ A;  2WDQ B;  4MSQ B;  2MA9 B;  4W9E A;  2LVQ A;  3EUB 2;  2H88 B;  4W9H A;  2D07 B;  2JX5 A;  2IYD B;  3L13 A;  3RT3 B;  3UI3 A;  1JCK B;  4JQW C;  4ZYS A;  1T5X D;  3LB8 C;  4K81 A;  3MJ5 A;  1EF1 A;  1QOA A;  1ZKH A;  4DHZ B;  3KQ4 A;  3TIX A;  3O13 A;  3OG5 A;  2AYO B;  2O2V A;  1E8Z A;  1LQB A;  3RZF A;  1XD3 B;  1T0Y A;  2LJI A;  1DOX A;  3H7S A;  4W9I A;  1KM7 A;  3P2B A;  5AZF A;  2MCN B;  3P4R B;  4C7Z A;  3H1U A;  3HRD D;  3ABV B;  4XZ4 A;  1XLN A;  2MH7 A;  1EUV B;  3PRE A;  5DPR A;  4JIO U;  4DXG A;  1EF5 A;  1N5X A;  3QAQ A;  3VR9 B;  2IO1 B;  1TKG A;  2QSD A;  4YTP B;  4II2 B;  3ZRC A;  3Q8F A;  2KKC A;  4OW0 A;  4GLS C;  3MP9 A;  1MG8 A;  4NQL B;  4ACF A;  1WI0 A;  3RNG C;  2GBR A;  2NBV B;  2KQ7 A;  3ZGZ A;  4XX5 A;  2L3Z A;  3FIL B;  3PT2 B;  3UIO B;  2LGS A;  3PZ8 A;  4C56 C;  1P0R A;  1NYQ A;  5C23 A;  3GE3 C;  3K9P B;  5D3D A;  1R4N I;  3IAS 1;  3WAM A;  1E10 A;  1UNS A;  3R2I A;  3W2D A;  3TEX A;  4YSZ B;  5KHO A;  4NJ7 A;  1C9F A;  3GE8 C;  2L1A A;  4ASW C;  2NCN A;  3P63 A;  1E8Y A;  2GBK A;  1WR1 A;  4MDK E;  2ZNV C;  4W9K A;  2NBW B;  5G2N A;  3AEF B;  2JY6 A;  4TKN A;  1E7P B;  5G5G A;  3E9S A;  4C00 A;  1FO4 A;  4I6L B;  2WXJ A;  3QIJ A;  3VUY A;  1GG3 A;  4HDQ A;  1WSP A;  3MC9 A;  3U8Z A;  1YNT E;  2M56 B;  4ZOH C;  2OJR A;  5D7G A;  5CHW A;  5CX3 A;  1ROE A;  2MQJ A;  2J0M A;  1RAX A;  4KZ0 A;  4EUT A;  3IBE A;  1YOV B;  3BVZ A;  4IM2 A;  2BYE A;  4G0N B;  3ZJT A;  2RR9 A;  5JZE B;  3NZ3 A;  4W9L A;  4XE0 A;  5BYR A;  2BYV E;  4EZK A;  4ANU A;  1JRP A;  1XT9 B;  2PE9 A;  3B9J A;  1XLQ A;  1U4A A;  4WH4 A;  3DVG Y;  2K25 A;  3BK1 A;  4J3O D;  3EEC A;  4NJ6 A;  2QEJ C;  4RGM A;  3RNA C;  4XC2 A;  2WXI A;  4US9 A;  3AE7 B;  2JU6 X;  2K5P A;  3VH3 B;  3ZNI D;  4IWP A;  4UDU C;  2KZR A;  4YXD B;  4TQ0 A;  5HKH A;  2LAS A;  3VQI A;  4ZHO A;  4ITK A;  2QMT A;  3AE8 B;  1Y56 A;  4PK1 A;  1C4A A;  5H8Y E;  1L5P A;  1JWA D;  2JXT A;  3ALB A;  2BYT A;  3VVW B;  2UWQ A;  1MPE A;  3X23 A;  1L0V B;  1F2R I;  3L17 A;  3N32 A;  1SE3 A;  1ZPS A;  1WWT A;  4BZA A;  3PRM B;  2M19 A;  2I1J A;  4BBN C;  1CJE A;  2BPS A;  1T0S C;  2FBW B;  4IC7 B;  5JXV A;  3VAW A;  1E6E B;  3AEG B;  1GJZ A;  1SEB D;  5GXG B;  3V6C B;  4OVZ A;  4ICV A;  2FNJ B;  3ZJU A;  2SEB D;  2AWT A;  2GI9 A;  4A3P A;  2JVC A;  4H2A A;  3U4E G;  2BGF A;  2INN E;  3APC A;  4LJP B;  1TTN A;  4EEW A;  4X57 B;  2PE6 B;  3K9O B;  4EZJ A;  3FAH A;  4TUU A;  1UH6 A;  2V3N A;  2L0F A;  1N6Z A;  3LYY A;  1V5T A;  5D2M B;  1L0X B;  1KLG D;  5FR6 A;  3NUH B;  2L83 A;  3L54 A;  2NPT A;  5TR5 A;  4WWN A;  3PZD A;  2YEP F;  4DK5 A;  3JSV B;  3BK2 A;  5IO9 A;  4F7Z A;  4FJY A;  2JZZ A;  4L2Y A;  1D3Z A;  1L6U A;  4FLH A;  4YT0 B;  1K52 A;  4DDI D;  2D2Q A;  2WNM A;  5G5H A;  2CJN A;  3EHV A;  1HTQ A;  3ENE A;  2EMS A;  1F0Z A;  2M0X A;  4IW0 A;  1C3T A;  4BOS C;  3URY A;  1N61 A;  4B95 A;  3V05 A;  3VXW A;  2WXK A;  3CF6 E;  4ZRJ A;  3AED B;  5I4D A;  3PRP B;  4RH6 A;  4EKU A;  2KTR B;  2RDH A;  1OQQ A;  1L4Z B;  2NTT A;  1HA5 A;  1GB1 A;  2LHD A;  2REX A;  2IO3 B;  2WXG A;  2LGX A;  3NOB A;  4KX6 B;  3AUL A;  1WM2 A;  5L83 A;  5J2R A;  1UGM A;  4RF0 A;  2KDF B;  4R3D A;  5EE1 A;  3W1S A;  1CZP A;  3NZU A;  4TV3 A;  2L05 A;  3EC8 A;  5EE0 A;  2WXF A;  3SD5 A;  1QKZ A;  1WMH B;  3NY5 A;  4G50 A;  1E9M A;  4XYC A;  1GPX A;  1IUE A;  5J17 A;  3Q8A A;  2N9L A;  4RFB A;  3DVG X;  3H7P B;  2AQ1 B;  3QC8 B;  3TSS A;  5EDS A;  4KDL B;  2KK8 A;  2CHZ A;  3R66 C;  1K8R B;  3VH4 B;  2DEN B;  4KVG B;  4HJK A;  4DDG D;  3B2F A;  3JVZ X;  3NS1 A;  4MEM A;  2Z0E B;  5DCN A;  1XF5 L;  2C9W B;  2MEK A;  3ZNG C;  2NTS A;  2KX3 A;  2JXX A;  3TMP B;  2MBE A;  3N30 A;  3HUI A;  3KWL A;  4N9F 4;  5BMG A;  2KJH B;  4K1R B;  2LGD A;  2ZCB A;  2LGY A;  2WGS A;  4MGY E;  2V0G A;  2PJH A;  4DHJ D;  3RCZ A;  1D5X C;  4MM3 A;  4FHK A;  4D2K A;  3HK0 A;  4RM8 A;  5TSS A;  1LFD A;  1XXG A;  4DHJ B;  3I9V 1;  5BMH A;  2J0J A;  2J0K A;  2R61 A;  2WXH A;  3U7Z A;  1ISN A;  3RUI B;  4LNO A;  2D3C A;  2WXN A;  1TS5 A;  4BAX A;  1TYG B;  1PYW D;  1TKE A;  1M94 A;  3Q3N C;  4AS1 A;  3VUW A;  1EO6 A;  1HQR D;  3HIZ A;  4DQO C;  3PPA A;  4KGT A;  4P1C C;  2IZV B;  4FJZ A;  4EE2 A;  3B2G A;  3RNF C;  2FCQ A;  3PV1 A;  3IAM 1;  3RZW C;  2ZJD A;  3DHI C;  2K3U A;  3I57 A;  2FCM A;  4RCO A;  3PLU A;  1MI0 A;  5BMI A;  3ML8 A;  4KIK A;  4K7W A;  1V97 A;  4MEL A;  4OVV A;  4N59 A;  3AU4 A;  3A9J A;  3SFD B;  1CQV A;  1L7Y A;  4JPS A;  2D3B A;  1NEK B;  2J53 A;  2KVR A;  1ZP0 B;  2ZPY A;  3ZDM C;  2XK5 A;  4M8M A;  1GC6 A;  1E5W A;  1HTO A;  1YN4 A;  2C5L C;  1LGR A;  2JYT A;  3V61 A;  1TS2 A;  3ZKJ C;  1ZGU B;  2KLC A;  2KHW B;  1T6B X;  4ANV A;  2AQ3 B;  3ZJV A;  2PMV A;  2DLB A;  2MHJ A;  2NBU A;  4ARC A;  3WA0 A;  4GOC A;  3AU5 A;  1F2R C;  1C1Y B;  1KF6 B;  4GDK B;  1FMA D;  2C7H A;  3AM9 A;  1T0R C;  2G1E A;  2B76 B;  3BVG A;  3Q6B A;  3A4S C;  5D6J B;  1OTR B;  1YN3 A;  2Z8L A;  3OJ3 A;  1MG4 A;  2JWU A;  3W1S C;  3T3N A;  3KUZ A;  1IP9 A;  2RPV A;  1JRU A;  3KH0 A;  3MHZ A;  2Y5P A;  2L32 A;  4N58 A;  2INC C;  1YX6 B;  1N62 A;  4YSX B;  1EM7 A;  5BYQ A;  5LLI A;  5FR3 A;  1QZE A;  4OZC A;  1WGY A;  4MH0 E;  4EOY A;  3TBL D;  3A1Q A;  1ENF A;  3IVF A;  2Y3A A;  4W9J A;  4WJN A;  3BYY B;  1XO3 A;  4KKI A;  4N6E B;  2KWC A;  1R4M I;  3VUX A;  1R7S A;  2JZP A;  1N60 A;  3AB5 A;  2KLG A;  5AUK A;  4NNJ B;  1I4P A;  5LXH A;  3Q14 C;  3R2T A;  1E7V A;  2W9N A;  2VRR B;  2INP E;  4IWQ A;  4KDI C;  1C78 A;  3OAW A;  2BT6 A;  2KMA A;  3DBH I;  4BOZ B;  3V6E B;  2WHI A;  1S3S G;  2GRI A;  3B08 A;  1DYQ A;  1KTK A;  2SAK A;  3I63 C;  1E7U A;  4IDI A;  4TMA B;  2FCS A;  1N63 A;  2IPK D;  4HEA 1;  4FJV B;  4NZL B;  1P7E A;  3U7D A;  1NYR A;  3AE6 B;  2KO3 A;  3N20 C;  4YTN B;  4DXA B;  2MBO A;  4LCD E;  1TBE A;  4BKS D;  4IWO A;  3OWE B;  1WGR A;  2WX1 A;  2PEA A;  3DPD A;  3A9K A;  1J7C A;  3PVL A;  4PYZ A;  4GXB A;  4ZRQ A;  2KMC A;  3ZNZ B;  3P42 A;  1EWC A;  1RLF A;  2LXA A;  4XGA B;  1OEY J;  3T8M A;  2MP2 B;  2GMI C;  3AE1 B;  3VHT C;  4W9D A;  2HTH A;  2E3T A;  2BVC A;  1NBF C;  4MAC A;  4Q2J A;  4NAM A;  1HE8 A;  3KYC D;  2K8B A;  2PVG C;  1NI3 A;  2I2Y A;  3N1X C;  4QAY A;  1WGH A;  2KC1 A;  1J0G A;  2HD5 B;  2N0S B;  3ZNH B;  1R4M B;  2MSE D;  4C4V A;  1DGJ A;  1K53 A;  1OQY A;  4LDT B;  1WIA A;  3N3K B;  4ZDV A;  1AN8 A;  2ZW0 A;  3JYU A;  3AXC A;  2QCZ A;  2DAJ A;  3GZN I;  4WWP A;  2KMM A;  4BKS A;  2RD0 A;  4OZA A;  3Q8B A;  2M0A A;  3R7Q A;  3T9L A;  3VFK A;  4B6W A;  1V1P B;  3SHQ A;  1FXI A;  2O6V A;  3NZS A;  2FUG 1;  3VR8 B;  2AEH A;  1UWX A;  1FFU A;  1WZ0 A;  4I6N B;  3IT4 B;  3P4Q B;  2LI5 A;  4G3X B;  3A33 B;  4XWW A;  3DDC B;  1YX5 B;  4GSW A;  1RM6 C;  3BYT B;  4IOI E;  4G11 A;  1F9J A;  2FAZ A;  2LWP A;  3AMZ A;  3HVD A;  4OHJ A;  4IM3 A;  3R8B A;  3NJT A;  2X8X X;  3N1Z C;  2D3G A;  3QWZ B;  3Q69 A;  2AQ2 B;  4GDL B;  4ARI A;  2ZW1 A;  2K0P A;  5AZH A;  1J19 A;  1WXA A;  1SSN A;  3AEA B;  1EU4 A;  2DAF A;  3AE9 B;  1HEZ E;  2N1W A;  5LNK 1;  2G4S A;  2V9H A;  2RGF A;  3L0W B;  1Y8R C;  2R2Q A;  3NHE B;  1WR6 E;  3LDZ E;  2K1F A;  1OQR A;  2LUM A;  2WQY B;  3U52 E;  3RMK C;  1NVI D;  5L95 C;  2WS3 B;  2LEK A;  2LD9 A;  3IFW B;  3C8Y A;  2MLB A;  1FIQ A;  1H8C A;  1XLO A;  1HZ5 A;  4YL8 A;  1HZ6 A;  4HPL B;  1FD6 A;  4WAF A;  3A9K B;  1RYJ A;  1M4V A;  3WAN A;  2R2O A;  4ICU A;  2VH1 A;  3APF A;  4PS8 A;  4P1B C;  1TKY A;  3DBR B;  2KVZ A;  2O2V B;  1TZO A;  1DOY A;  2KN5 A;  4FAD A;  2WXQ A;  2D10 A;  4NAW A;  3C19 A;  2IY1 B;  5IP4 D;  2J52 A;  1TGZ B;  2MBB B;  2BKF A;  4C4V B;  3RNB C;  4KZC A;  2W82 A;  1WX9 A;  4KV2 A;  2KWV B;  2WP9 B;  1V5O A;  4HCN B;  4RM9 A;  3ZYY X;  4AUQ C;  5AEK B;  2HDE A;  4A9A A;  4MGI E;  3OLM D;  4USA A;  5EE3 A;  1V49 A;  3UQB A;  2V3S A;  3U30 A;  2D5G A;  2BB5 A;  3IT6 B;  3KW5 B;  1D6E C;  5EE9 A;  3RN9 C;  3VTW A;  1ZXH A;  1WE6 A;  2WXO A;  3EGR A;  5AZG A;  1AWD A;  1F52 A;  1SBB B;  1QOG A;  4ANW A;  1XQQ A;  4FXC A;  2IY0 B;  1NEN B;  4MGK E;  1E0Z A;  3DCG A;  4NPN A;  3VTV A;  2HE7 A;  4US8 A;  3P4P B;  1GAQ B;  3L16 A;  2ZPN A;  1X1M A;  1T3Q A;  3SU8 X;  3MC8 A;  1RWS A;  5CHV C;  3AE4 B;  4L1B A;  2AX5 A;  4KSK C;  2KAC A;  1UBI A;  1Q5W B;  2RPQ A;  4WJQ A;  3AH7 A;  3GZN B;  4WAA A;  1YQ4 B;  2L7R A;  2BWE S;  1L0Y B;  2KN4 A;  1DOI A;  4JE3 B;  5FK9 C;  2N9K A;  1ZDX A;  4RGT A;  1IGC A;  3LXF A;  4HWI B;  2LUE A;  4GDL A;  4CHK A;  4URK A;  3VTU A;  2EEL A;  1FRR A;  3QQ8 B;  2CU1 A;  1YN5 A;  3P1M A;  4HJG E;  2K8H A;  3W5U B;  1VCB A;  2KXJ A;  2KDI A;  2ASQ A;  2KFJ A;  3KWV A;  1WGK A;  1VD2 A;  4IG7 B;  2KOX A;  4MJS B;  1FXT B;  2W54 A;  3BII D;  1WJN A;  2MP2 A;  3DBL B;  3TEW A;  2G9H D;  3L08 A;  1V8C A;  1MFW A;  2G45 B;  1WYW B;  5DPW A;  2FIF A;  1F1H A;  3PS6 A;  3AE2 B;  2X38 A;  1ESF A;  2K6D B;  2WDT B;  3Q3O C;  3QAR A;  1WM3 A;  2CU3 A;  3ZUN A;  1SJH D;  3WCQ A;  4DWF A;  3AV8 A;  2Y5B B;  2LZ6 A;  1D5M C;  2DYO A;  2LJ5 A;  3DBH B;  4RGN A;  2V3P A;  2KDE B;  2MBH A;  2CS4 A;  4JWS C;  3HVZ A;  4XDD A;  2XNA C;  3BWU D;  4JWU C;  3X0W A;  1PFD A;  1JQ4 A;  1YJJ A;  2KDM A;  4B0M A;  2WXR A;  3AEC B;  2LMC A;  4MH8 A;  3FKY A;  1C4P A;  4HK2 A;  1VRA B;  3NG0 A;  1YQB A;  2KWD A;  5E6O A;  2WDR B;  1V81 A;  2L76 A;  4PYU A;  4BVU C;  4GB9 A;  2XEW A;  3RD2 A;  3T3O A;  1V1P A;  1RFK A;  4II3 B;  2A4Z A;  1JWB D;  1WXM A;  1VZ7 A;  2PTL A;  2MRP A;  2ZNV B;  5IAA C;  4M0W B;  4NJC A;  3HM3 A;  3SDL C;  2WU2 B;  1P3Q U;  1SIF A;  3BVM A;  2JQR B;  3TEY A;  1YJI A;  5DPS A;  2LXC A;  4CYE A;  2DZM A;  4FUL A;  3R3M A;  1I7H A;  1V86 A;  2PW9 A;  1UEL A;  4HRO A;  1P1A A;  2IDY A;  1T0Q C;  4F8C B;  2LVO A;  4K7S A;  4M8N A;  3QA8 A;  2IGH A;  2BS3 B;  2C60 A;  3MFG A;  2CKH B;  2V1Y A;  1L6V A;  1MVK A;  2JUO A;  1UBQ A;  1ZXI A;  2ZCC A;  2N9X A;  2ON8 A;  3M95 A;  1QQR A;  2DHZ A;  1V2Y A;  2KT7 A;  4W9G A;  1UUP A;  3DHG C;  1HXY D;  3EA6 A;  1K50 A;  3J9C A;  4W9C A;  3ZXR A;  3MJW A;  5BO4 B;  1QIL A;  2CHX A;  2PPH A;  2EMT A;  3V60 A;  3H6N A;  3RI7 C;  2N9P C;  1C76 A;  1QOB A;  5DPT A;  4W9F A;  4LLG M;  4MGZ E;  1I4G A;  3ZVV A;  3BY4 B;  1B9R A;  3D32 A;  3CMM B;  2IGG A;  3PGE A;  1I42 A;  4GIV A;  3V62 A;  4A3O A;  4FA6 A;  1OGW A;  1AW7 A;  3QX1 A;  4I6P A;  4K3C A;  2PKO A;  2BWF A;  2WX0 A;  3U2S C;  4HPM B;  3S2A A;  5KHQ A;  1WGD A;  3AI5 A;  1TS3 A;  4MSM B;  2OED A;  4HRS A;  1C79 A;  1UF0 A;  3KYD D;  2IO2 B;  1KLU D;  1WXQ A;  4A8X C;  2BQQ A;  4L23 A;  3DBL I;  3CSF A;  4GMV A;  4KGS A;  4HLE A;  2N1V A;  3ZO5 B;  1VJK A;  1IGD A;  2WWZ A;  2WXM A;  2KJ6 A;  1SE2 A;  2KAJ A;  2UYZ B;  3JW0 X;  3JSV A;  4MT5 A;  2PIA A;  1ZOY B;  2FUH B;  4PS3 A;  1LXD A;  1PDX A;  2YLM A;  3TUO A;  4WJO A;  4WIP A;  1TZ1 A;  2LFI A;  3UGB B;  2QIL A;  1GOZ A;  2N7J A;  2QJL A;  3A9J B;  2K9X A;  2D3A A;  2JYE A;  2Y5C A;  2BTE A;  4ANX A;  4BKT A;  1WY8 A;  2M17 A;  4AJW A;  3RNC C;  3AEE B;  3TL5 A;  3GOE A;  1SJE D;  1BT0 A;  1CMX B;  1YQ3 B;  2ZZP B;  2YVC A;  2LVP A;  4A20 A;  4LNK A;  3WIM A;  3NRZ A;  2KNB A;  1JW9 D;  4KIK B;  1J8C A;  4B9K A;  4BKG A; 
#chains in the Genus database with same CATH homology
 2N7D A;  2NPT A;  3O65 B;  2MLB A;  5TR5 A;  1Z5S B;  4WWN A;  1H8C A;  3PZD A;  3IHP C;  3QJZ A;  5D94 A;  4DK5 A;  4YL8 A;  1GC7 A;  3JSV B;  3ML9 A;  3Q3J A;  4BBN F;  4HPL B;  2Z59 B;  4F7Z A;  5G55 A;  4FJY A;  2JZZ A;  3OJ4 B;  1LM8 B;  2V4L A;  3A9K B;  1D3Z A;  4FLH A;  2XK5 B;  2MBQ A;  4DDI D;  2D2Q A;  2I1K A;  3PHX B;  3WAN A;  2C7M B;  2R2O A;  3PHW B;  4ICU A;  4J6I A;  3APF A;  4PS8 A;  3ZIM A;  3ZW3 A;  2RSU A;  3LJ3 A;  3EHV A;  2BF8 B;  3ZTD A;  3HHM A;  1YIW A;  3ENE A;  3VDZ A;  2EMS A;  3A1Q B;  4HCP B;  2O2V B;  1SE9 A;  3H7P A;  2HJ8 A;  4AJY B;  2M0X A;  4IW0 A;  2JRH A;  1C3T A;  3EFU A;  4BOS C;  4MJS A;  2KN5 A;  4B95 A;  4FAD A;  2D10 A;  4GN1 A;  3VXW A;  4NAW A;  3CF6 E;  2MX2 A;  2IY1 B;  5GMV A;  4OVU A;  2O6V B;  2O6V D;  1TGZ B;  4ZRJ A;  2MBB B;  2BKF A;  2LRU A;  1IYF A;  4KZC A;  2K39 A;  3PRP B;  2G4D B;  1WX9 A;  2IBI B;  1GUA B;  4KV2 A;  4E3C A;  2KWV B;  4HCN B;  1V5O A;  4AOF A;  4RM9 A;  4EKU A;  2KTR B;  2FID A;  4ZYN A;  4AUQ C;  2CHW A;  4GU2 A;  5AEK B;  2GBM A;  2REX A;  2IO3 B;  2LGX A;  2NVU I;  3NOB A;  3M63 B;  3AUL A;  4MGI E;  1WM2 A;  5L83 A;  3QCA A;  5J2R A;  3KUD B;  1UGM A;  4FHJ A;  3OLM D;  3ZTC A;  2KDF B;  4JLC A;  2L0T A;  1V49 A;  3W1S A;  3ZLZ A;  3WAP A;  1WRD B;  3UQB A;  2V3S A;  3NZU A;  4E71 A;  3U30 A;  1Q0W B;  4TV3 A;  2L05 A;  1E8X A;  3EC8 A;  1S1Q B;  3KW5 B;  3SD5 A;  3VTW A;  1WMH B;  3NY5 A;  4G50 A;  2AL3 A;  2DZI A;  4RMA A;  2KX0 A;  4E74 A;  1L2N A;  2M8S A;  3Q3F A;  1WE6 A;  5AZG A;  4DHZ E;  5J17 A;  5JH5 C;  1V80 A;  3DVG X;  4ANW A;  1XQQ A;  1ZW7 A;  4LDT D;  3H7P B;  4AP4 C;  1P9D U;  2BKR B;  3QC8 B;  1OEY A;  4KDL B;  5EDS A;  2IY0 B;  2KK8 A;  2CHZ A;  3R66 C;  1K8R B;  4MGK E;  3VH4 B;  4PS7 A;  2DEN B;  4KVG B;  3DCG A;  4HJK A;  3DVN V;  3CST A;  1YD8 U;  4NPN A;  3VTV A;  4DDG D;  2HE7 A;  1E8W A;  3JVZ X;  4MEM A;  2Z0E B;  1WH3 A;  5DCN A;  2C9W B;  1V9J A;  3ZNG C;  1WE7 A;  3L16 A;  2ZPN A;  2KX3 A;  4NY0 A;  2JXX A;  1X1M A;  5E6N A;  2MBE A;  2ZEQ A;  3TMP B;  2N4F A;  2MW5 A;  3N30 A;  3ECI A;  3UF8 A;  2G3Q B;  3SU8 X;  1KJT A;  4N9F 4;  2OOB B;  2KJH B;  4K1R B;  1I35 A;  5CHV C;  2J7Q B;  2LGD A;  2ZCB A;  2LGY A;  4MGY E;  3PSE B;  4KSK C;  1P98 A;  1PQS A;  1V6E A;  2PJH A;  4LJO B;  4WWO A;  4DHJ D;  3RCZ A;  5CHF A;  1E90 A;  3MTN B;  4MM3 A;  1UBI A;  4FHK A;  5CTR C;  3HK0 A;  4RM8 A;  3UQA A;  3IG3 A;  1Q5W B;  4AWJ A;  2KFK A;  2RPQ A;  4WJQ A;  2JZ3 B;  3HM6 X;  2JRI B;  1LFD A;  3W1Y A;  4DHJ B;  2ZVN A;  4WAA A;  3ZRF A;  2L7R A;  2BWE S;  4MSQ B;  2J0J A;  2MA9 B;  4W9E A;  2LVQ A;  2J0K A;  4W9H A;  1ISN A;  2D07 B;  2IYD B;  4NAW B;  3RUI B;  3L13 A;  3RT3 B;  4HWI B;  1WJ4 A;  2LUE A;  4JQW C;  4GDL A;  4K81 A;  1M94 A;  4CHK A;  4URK A;  3VTU A;  1EF1 A;  2JWZ A;  3VUW A;  3L10 B;  3QQ8 B;  1EO6 A;  1ZKH A;  2CU1 A;  4FBJ B;  4DHZ B;  3TIX A;  1KOT A;  3HIZ A;  2K8H A;  3PPA A;  3BIN A;  4HVB A;  1VCB A;  2AYO B;  2GOW A;  2O2V A;  1E8Z A;  1LQB A;  2KXJ A;  3RZF A;  1XD3 B;  2KDI A;  2ASQ A;  1T0Y A;  2IZV B;  2KFJ A;  3DOW A;  4FJZ A;  3WAL A;  3H7S A;  4W9I A;  1KM7 A;  1VD2 A;  5C1Z A;  4IG7 B;  2KOX A;  2FCQ A;  4ZRI A;  3P2B A;  4MJS B;  3PV1 A;  4P7I A;  2ZJD A;  3RZW C;  1FXT B;  5AZF A;  2MCN B;  2FCM A;  1WJN A;  2MP2 A;  3H1U A;  3PLU A;  4XZ4 A;  1NDD A;  3ML8 A;  4KIK A;  3KUC B;  4K7W A;  4MEL A;  4OVV A;  1EUV B;  3PRE A;  4CO7 A;  5DPR A;  3AU4 A;  3L08 A;  3A9J A;  2KJR A;  4JIO U;  2G45 B;  1EF5 A;  1L7Y A;  1WYW B;  3QAQ A;  5DPW A;  2KVR A;  5IA7 A;  2FIF A;  2IO1 B;  2LRW A;  3DBR I;  2ZPY A;  3ZDM C;  4II2 B;  2XK5 A;  4M8M A;  3PS6 A;  3ZRC A;  1GC6 A;  1E5W A;  2C5L C;  2K6D B;  2KKC A;  2WDT B;  3QAR A;  3V61 A;  1WM3 A;  4JGH B;  3ZUN A;  3WAO A;  1MG8 A;  4DWF A;  2CR5 A;  4NQL B;  1WI0 A;  1H4R A;  5JHB A;  3ZKJ C;  2GBR A;  2NBV B;  1ZGU B;  2KQ7 A;  2Y5B B;  2KLC A;  2M4N A;  2LZ6 A;  2KHW B;  4XX5 A;  2L3Z A;  2DYO A;  3DBS A;  2LJ5 A;  3PT2 B;  3UIO B;  2MWS B;  4ANV A;  1P0R A;  1WXS A;  2KDE B;  2MBH A;  2CS4 A;  2NBU A;  5C23 A;  2C7N B;  3WA0 A;  4GOC A;  3AU5 A;  3PRZ A;  3DQV A;  1C1Y B;  2KTR A;  4GDK B;  2C7H A;  3K9P B;  1R4N I;  4GGQ A;  3WAM A;  3X0W A;  3APD A;  1NI2 A;  2DX5 B;  3A4S C;  5D6J B;  1OTR B;  5KHO A;  3OJ3 A;  4NJ7 A;  2KWU B;  3W1S C;  3RYT A;  2B3A A;  3KUZ A;  1WGG A;  3PLV A;  2NCN A;  4ASW C;  1IP9 A;  4HK2 A;  1JRU A;  1E8Y A;  3KH0 A;  1YQB A;  2GBK A;  5E6O A;  5J18 A;  1WR1 A;  1V81 A;  4HXD A;  4MDK E;  1YX6 B;  1WX7 A;  2L76 A;  2ZNV C;  2WYQ A;  4W9K A;  2NBW B;  3RUL A;  5G2N A;  1WZ3 A;  1RFA A;  4PYU A;  4BVU C;  4GB9 A;  2XEW A;  3I3T B;  3RD2 A;  5LLI A;  4FN2 A;  1QZE A;  4II3 B;  2A4Z A;  2KQS A;  1WGY A;  1WXM A;  2JY6 A;  4MH0 E;  4TKN A;  3TBL D;  4EOY A;  2M1M A;  2NS5 A;  3A1Q A;  2GBJ A;  3IVF A;  4W9J A;  4ZRK A;  1A5R A;  4WJN A;  1Z2M A;  2MRP A;  2ZNV B;  5IAA C;  4M0W B;  4I6L B;  2KWC A;  3QIJ A;  3VUY A;  3HM3 A;  1GG3 A;  3SDL C;  1R4M I;  4HDQ A;  2BYF A;  1P3Q U;  1SIF A;  3VUX A;  2ZVO A;  2KLG A;  4F1S A;  2IO0 B;  4BFR A;  3U8Z A;  4NNJ B;  2OJR A;  5LXH A;  5DPS A;  5D7G A;  2LXC A;  5CHW A;  5CX3 A;  4CYE A;  2DZM A;  4FUL A;  3R3M A;  4DBG A;  1V86 A;  1UEL A;  2J0M A;  2MQJ A;  2N7E A;  1P1A A;  1E7V A;  1RAX A;  5LXI B;  2W9N A;  2DZK A;  4KZ0 A;  3ZDT A;  4F8C B;  2LVO A;  1AAR A;  2VRR B;  4IWQ A;  4KDI C;  4EUT A;  4K7S A;  3OAW A;  4EFO A;  4M8N A;  3QA8 A;  3IBE A;  4IUM B;  1KLV A;  2C60 A;  2KMA A;  3DBH I;  2CKH B;  2V1Y A;  1WFY A;  3UIP B;  4BOZ B;  2JPH A;  2JUO A;  4IM2 A;  1UBQ A;  2JF5 A;  2ZCC A;  3UIN B;  2N9X A;  3V6E B;  1S3S G;  2BYE A;  4G0N B;  3M95 A;  2XBB C;  2KAN A;  3B08 A;  5JHA A;  4HDO A;  2DHZ A;  3DVN U;  2RR9 A;  1V2Y A;  1E7U A;  5JZE B;  4WJP A;  2FCS A;  4W9G A;  4W9L A;  1IPG A;  4FJV B;  2BYV E;  4EZK A;  3U7D A;  2EKE C;  2Z0D B;  4ANU A;  2KO3 A;  2K8C A;  1G6J A;  1Q1O A;  4DXA B;  2MBO A;  2NPT B;  4LCD E;  1XT9 B;  1UD7 A;  2PE9 A;  1WJU A;  1TBE A;  4W9C A;  4BKS D;  4IWO A;  1WGR A;  3MJW A;  2KC2 A;  2WX1 A;  5BO4 B;  1U4A A;  2PEA A;  2CHX A;  2PPH A;  3DPD A;  2EMT A;  2L00 B;  3PTF C;  3V60 A;  3H6N A;  3DVG Y;  2K25 A;  3A9K A;  3C0R B;  3A4R A;  2N9P C;  3EEC A;  2KFK B;  3PVL A;  4PYZ A;  4GXB A;  2FCN A;  4NJ6 A;  5DPT A;  2KMC A;  3ZNZ B;  2GBN A;  2N9E B;  1RLF A;  2LXA A;  4XC2 A;  4W9F A;  1OEY J;  3T8M A;  2MP2 B;  2GMI C;  3VHT C;  4MGZ E;  4W9D A;  2AL6 A;  3VH3 B;  3ZVV A;  3BY4 B;  2HTH A;  3ZNI D;  4IWP A;  3D32 A;  3CMM B;  1NBF C;  2DYM A;  2KZR A;  1I42 A;  3PGE A;  1HE8 A;  3KYC D;  4GIV A;  4TQ0 A;  2K8B A;  5HKH A;  3M3J A;  2LAS A;  3V62 A;  3VQI A;  4EZL A;  4A3O A;  2KD0 A;  4FA6 A;  1WMH A;  1WGH A;  1OGW A;  2KC1 A;  2DZJ A;  1J0G A;  2HD5 B;  3TCA A;  3QX1 A;  4I6P A;  1SGH A;  3ALB A;  3ZNH B;  2MSE D;  2D11 A;  3VVW B;  2BWF A;  2UWQ A;  2WX0 A;  4HPM B;  3S2A A;  2QHO A;  1OQY A;  1WGD A;  2L8J A;  1YJ1 A;  4LDT B;  3X23 A;  5KHQ A;  1WIA A;  3AI5 A;  3N3K B;  4ZDV A;  3JYU A;  4MSM B;  3L17 A;  3AXC A;  3N32 A;  2DAJ A;  3GZN I;  3PRM B;  4WWP A;  4BKS A;  2RD0 A;  3KYD D;  2IO2 B;  1WJ6 A;  2I1J A;  4BBN C;  3R7Q A;  2BPS A;  3DBL I;  3CSF A;  3T9L A;  3VFK A;  4B6W A;  4GDK A;  3SHQ A;  4GMV A;  4IC7 B;  4HLE A;  2N1V A;  3B1L X;  3R7R A;  2O6V A;  3VAW A;  3M62 B;  3NS8 A;  3NZS A;  3B0A A;  3ZO5 B;  1GJZ A;  2KDB A;  3H9D A;  2AEH A;  2WWZ A;  2KTF A;  1WZ0 A;  4I6N B;  2KJ6 A;  2LI5 A;  2UYZ B;  3JW0 X;  3JSV A;  4G3X B;  2FUH B;  3A33 B;  3DDC B;  3V6C B;  4PS3 A;  1LXD A;  1YX5 B;  4ICV A;  4GSW A;  1GNU A;  2YLM A;  4KSL C;  4WJO A;  4JL9 A;  2FNJ B;  5E6P A;  1WXV A;  3ONS A;  2AWT A;  1TZ1 A;  4G11 A;  4A3P A;  1F9J A;  3UGB B;  2FAZ A;  3QHT A;  2JVC A;  2NR2 A;  4K7U A;  2LWP A;  4WQO B;  2BGF A;  1UZX B;  4NQK E;  2K6Q A;  3APC A;  4LJP B;  4IM3 A;  2DYB A;  3KVF B;  1TTN A;  2D3G A;  3QWZ B;  4EEW A;  4X57 B;  4GDL B;  3A9J B;  2PE6 B;  3TJP A;  3K9O B;  5AZH A;  1J19 A;  1WXA A;  4EZJ A;  4TUU A;  4ANX A;  1UH6 A;  4BKT A;  1WY8 A;  2M17 A;  2DAF A;  4AJW A;  4IM0 A;  2N1W A;  3MHS D;  1WX8 A;  3GOE A;  2G4S A;  3TL5 A;  2RGF A;  1BT0 A;  2L0F A;  1CMX B;  2ZZP B;  3L0W B;  1Y8R C;  1V5T A;  2R2Q A;  3NHE B;  5D2M B;  3QK0 A;  2YVC A;  2LVP A;  1WR6 E;  3LDZ E;  2K1F A;  4A20 A;  1WF9 A;  1RRB A;  3WIM A;  5FR6 A;  2KNB A;  2JT4 B;  4TQ1 A;  5L95 C;  3L54 A;  4KIK B;  2A5U A;  2LD9 A;  3IFW B;  1J8C A;  4B9K A;  4BKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...