4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
2DYMA 4X57B 4IWQA 2DZMA 3A9JB 3VUYA 3LDZE 2IO0B 4YL8A 3M62B 1VD2A 2C7NB 2V3SA 3CSFA 3VHTC 4PYUA 4IM0A 3AU4A 2IO1B 5D2MB 1IYFA 4MGZE 3T9LA 4TQ0A 2L76A 2MWSB 2LRUA 3KW5B 2ZNVC 4TUUA 4FBJB 4WQOB 1TGZB 2W9NA 5KHQA 1WYWB 3L16A 1RRBA 2O6VD 3DBLI 2CKHB 3QA8A 3NZSA 3JSVB 3PV1A 2PE9A 3K9PB 2MCNB 4MM3A 1V86A 4GDKA 1WI0A 5DPRA 3ECIA 4N9F4 1V5OA 3QX1A 3VTVA 2FCQA 4NQKE 1WRDB 2GBNA 4W9IA 1WM2A 4BOZB 5JHAA 2LVQA 3APCA 5E6OA 1CMXB 1P98A 2FNJB 2C7MB 3M3JA 1E5WA 4GGQA 4KVGB 2WYQA 3R66C 2DAFA 2JUOA 2JZZA 2IY1B 4IUMB 5EDSA 1E8XA 3WAPA 2K1FA 4LDTD 4WJOA 1WH3A 2JRIB 1KJTA 2ZEQA 4AOFA 4ZRJA 4NPNA 5LLIA 3WALA 1TZ1A 1Q5WB 1P0RA 4HK2A 5DCNA 3RD2A 2N7EA 2LZ6A 3L13A 3W1SA 1UGMA 4FJYA 3W1YA 3VDZA 5BO4B 3B08A 2G4SA 4MGIE 4BBNF 2QHOA 3DVNU 4W9KA 2D07B 5E6PA 1EO6A 3KVFB 3A4SC 4HDQA 2RD0A 3RCZA 4DHZB 3R3MA 2LI5A 3ML9A 1WY8A 3B1LX 1OQYA 2FCMA 3K9OB 2UWQA 2L05A 3RZWC 4AJYB 3GZNI 3JSVA 5DPTA 3EC8A 4ZRIA 3EHVA 3C0RB 1P3QU 4G3XB 2KTFA 2G4DB 4DDID 1QZEA 2M4NA 3CSTA 3UQBA 2KMAA 4EKUA 3L08A 2I1JA 3BY4B 3V61A 3AULA 2LD9A 4E3CA 2BPSA 4M8MA 2ZZPB 4HVBA 1LQBA 2DX5B 3W1SC 3PLVA 2I1KA 3VFKA 1V2YA 3VTWA 1NDDA 1RLFA 3CMMB 2M1MA 3PTFC 2LVPA 2JPHA 5L83A 1HE8A 2K8HA 2NR2A 2NBUA 2AEHA 1ZKHA 2O6VB 3HK0A 2KC2A 1OEYJ 2BKRB 3DPDA 4EZLA 3JYUA 1WE6A 4XX5A 4ANWA 4WWOA 2KANA 3NS8A 3AU5A 3KH0A 3QAQA 4W9HA 2CU1A 3H9DA 3PRPB 3APFA 1YX5B 2RR9A 3N30A 4TQ1A 4EFOA 3QARA 3VQIA 2KWUB 3NY5A 3T8MA 1WIAA 2KXJA 2LASA 2IBIB 2KX3A 4ICUA 4JLCA 1Z2MA 1BT0A 2IZVB 2YLMA 3UQAA 4ANVA 3V6EB 5GMVA 3OJ3A 4II2B 2KZRA 1V9JA 2DZJA 3WA0A 3ZNHB 4DHJB 2BYFA 4B95A 4I6PA 4TV3A 3PLUA 4DK5A 1WFYA 4RM9A 3TCAA 2KWVB 4WWPA 2NVUI 1XD3B 3KUDB 1WGHA 3B0AA 4IM2A 2K25A 4FADA 2DYOA 2LGXA 1PQSA 1JRUA 2LXCA 4K7SA 3PZDA 1V6EA 3ZDTA 4KDIC 4ZYNA 2C60A 4KZCA 2WX1A 4IW0A 4AUQC 2M17A 3ONSA 3JVZX 1Y8RC 2EMTA 4DHZE 4MEMA 1M94A 2FCNA 2ZPYA 3A1QA 4KIKA 5CHVC 1F9JA 1V49A 3DBRI 4G50A 2JT4B 2IO2B 2ZCBA 3KUZA 3IHPC 3MJWA 2NPTB 3H6NA 5TR5A 1J8CA 3ZRFA 4BFRA 2DYBA 3Q3FA 4MH0E 2KQSA 1G6JA 2KDBA 2REXA 1WGGA 4K1RB 3DBSA 4AWJA 1Q0WB 1WMHB 4EOYA 3AXCA 3KYCD 4E74A 3L17A 3HIZA 2LRWA 2DENB 2N9PC 3R7QA 3RYTA 2R2QA 2DZKA 4PS3A 4TKNA 3EFUA 3KUCB 4GDLB 2KTRB 1YD8U 2N1VA 2KVRA 3A9KA 1NBFC 4IM3A 3ZIMA 1OTRB 5C23A 2AWTA 4A3OA 4JL9A 2KFJA 2K8CA 1P1AA 2N7DA 3ZKJC 1WF9A 2K39A 2KJ6A 3H1UA 3MHSD 3TL5A 4F7ZA 3ZTCA 1LFDA 2GBKA 1WX7A 2M0XA 5AEKB 1WGRA 3ZLZA 2KN5A 2VRRB 2XK5B 3KYDD 4OVUA 3A9JA 3UGBB 4BKSA 2N4FA 4IWOA 3M63B 1WXVA 3H7SA 3VVWB 4GSWA 1UH6A 3DBHI 2NPTA 2NCNA 1C1YB 3PREA 4RMAA 3VAWA 4AP4C 4J6IA 4FJVB 2B3AA 3RULA 3SDLC 5JHBA 4OVVA 2KC1A 1V80A 4WJQA 2C5LC 2ZVOA 2KMCA 2KWCA 4W9FA 3WAOA 1WX9A 1L7YA 2V4LA 1NI2A 5AZGA 5AZHA 1E8WA 3QCAA 4I6NB 4RM8A 4KV2A 1WGDA 4GDLA 1RAXA 3ZDMC 1ZW7A 2V1YA 2WWZA 3RZFA 4WJPA 2C9WB 2DAJA 4NY0A 3HHMA 3ZTDA 1I42A 2MX2A 2WDTB 1WZ3A 4CO7A 2KNBA 2KFKB 3PHWB 2BF8B 3QHTA 1Q1OA 2MA9B 4CYEA 1A5RA 4NAWB 5E6NA 2XK5A 4MGYE 2KLGA 4DXAB 1E7UA 4KDLB 5CHWA 4EUTA 3DVNV 3I3TB 2EKEC 3DCGA 3QK0A 3U7DA 3V60A 2AL3A 4K7WA 2GOWA 1E8YA 2AYOB 1EF1A 1OGWA 1WR1A 2KDEB 2Z0DB 4M0WB 4IC7B 5D7GA 3VH3B 2HD5B 2KOXA 1YQBA 2MRPA 3U8ZA 2BYEA 5HKHA 1LM8B 1KOTA 2LVOA 3V6CB 2BWES 1EUVB 2EMSA 3D32A 2M8SA 3RUIB 1C3TA 1MG8A 4LDTB 1UBIA 2LUEA 3WIMA 5G2NA 1XQQA 4WAAA 3WAMA 4HXDA 2UYZB 3L0WB 4A3PA 4GXBA 1V5TA 3H7PB 5IA7A 3R7RA 4BOSC 2PJHA 2L7RA 4GN1A 2LXAA 2KX0A 3PPAA 4GOCA 2Z0EB 1IPGA 4URKA 2K8BA 3L54A 2MBEA 3GOEA 3VUXA 2IO3B 2MBHA 4NAWA 4HJKA 4KSKC 4W9DA 4AJWA 3CF6E 2CS4A 1SGHA 3PRMB 1GNUA 2FIDA 2HE7A 4NJ7A 3NZUA 1R4MI 4KZ0A 3A4RA 2O6VA 1UBQA 1UELA 2JF5A 2L0FA 4FULA 4BBNC 5LXIB 4ASWC 4DBGA 5D6JB 2KLCA 2L8JA 1WE7A 4GDKB 2OOBB 4WWNA 1U4AA 4BKGA 2DHZA 5G55A 4MSQB 3ZRCA 3QQ8B 3PVLA 2LJ5A 1TBEA 1L2NA 1IP9A 3PRZA 3ZVVA 2D11A 2CR5A 2N1WA 2BKFA 2KHWB 3PSEB 2D2QA 2ZCCA 3M95A 2BWFA 4KSLC 1AARA 5KHOA 4I6LB 1I35A 1R4NI 1WGYA 2CHWA 2MBBB 1YX6B 3H7PA 3NOBA 4ICVA 2N9XA 4W9CA 2RGFA 4W9EA 3VXWA 3P2BA 4GU2A 2BYVE 2XEWA 3UF8A 3IBEA 2JXXA 1FXTB 5J18A 4GIVA 5D94A 3ZO5B 2KK8A 4B6WA 1WJNA 2GBMA 2KJHB 4LJOB 3L10B 4IG7B 2J7QB 4HPLB 1D3ZA 3ML8A 1K8RB 4JQWC 1WJ6A 3ZNID 2G45B 4XZ4A 4ANUA 1S1QB 2IYDB 1Z5SB 3HM3A 3PHXB 3ZNZB 2FUHB 2RPQA 2ASQA 4HCNB 4LJPB 4K81A 2K6QA 2CHZA 3QJZA 5J2RA 2JZ3B 2G3QB 3ZW3A 2JWZA 2C7HA 4PYZA 3UIPB 4JIOU 2ZPNA 3AI5A 1E7VA 3HM6X 2DZIA 1YJ1A 2FCSA 2MBQA 1WMHA 3OLMD 4CHKA 1LXDA 4NNJB 2N9EB 2L0TA 2MSED 2LGYA 3APDA 3OAWA 3U30A 1SIFA 1XT9B 3SU8X 1KLVA 3VH4B 4EEWA 2XBBC 1RFAA 2KTRA 2IY0B 4IWPA 3RT3B 2LWPA 1WXSA 2NS5A 4P7IA 2J0JA 3DOWA 5LXHA 2MP2B 4BKTA 1WX8A 2GMIC 3DVGX 2HJ8A 5CX3A 1WZ0A 4HWIB 4MSMB 1J19A 2CHXA 4G0NB 4DHJD 4W9JA 2ZJDA 2L3ZA 2KDFB 3A33B 1UD7A 4FLHA 3DVGY 4HDOA 2FIFA 1GUAB 4B9KA 1GG3A 1J0GA 2JRHA 2FAZA 5IAAC 3QWZB 1ISNA 4ZRKA 2R2OA 2GBRA 3QIJA 4ANXA 4BKSD 1WM3A 5JZEB 4HPMB 4W9GA 5CHFA 5L95C 3OJ4B 2KQ7A 3ALBA 5AZFA 2ZNVB 3TIXA 4MJSB 2GBJA 4PS8A 1T0YA 4EZJA 1H8CA 3DQVA 2O2VB 2RSUA 2MBOA 5JH5C 2PEAA 3SHQA 1P9DU 4MGKE 1UZXB 4FHJA 4M8NA 4A20A 2J0MA 3PT2B 4FA6A 3X0WA 2PPHA 3MTNB 1GC6A 5CTRC 3TBLD 2MP2A 4FHKA 3Q3JA 2YVCA 3PS6A 1H4RA 3NHEB 4MDKE 3TJPA 1WR6E 2K6DB 2LGDA 4HLEA 3IFWB 3N3KB 2KO3A 5DPSA 3JW0X 4EZKA 3A1QB 4KIKB 4XC2A 5C1ZA 1SE9A 4DWFA 2KFKA 3BINA 4NQLB 4PS7A 4GB9A 4BVUC 1S3SG 4HCPB 2BGFA 3QC8B 2NBVB 1V81A 1ZGUB 2MQJA 2OJRA 2Y5BB 1KM7A 3IVFA 4MELA 4W9LA 3X23A 1E8ZA 1WJUA 2KJRA 2AL6A 2JY6A 3ENEA 4E71A 1TTNA 4II3B 2PE6B 3PGEA 4K7UA 1GC7A 2NBWB 3V62A 3TMPB 2MLBA 3IG3A 2A4ZA 5DPWA 1WXAA 3DDCB 2D10A 5FR6A 4LCDE 5J17A 4G11A 1E90A 3S2AA 3UINB 1WJ4A 2HTHA 3A9KB 4GMVA 4MJSA 3SD5A 3VUWA 1GJZA 3VTUA 2O2VA 4FJZA 1WXMA 2JVCA 2KKCA 4JGHB 2KD0A 4WJNA 4FN2A 4DDGD 2L00B 1EF5A 1OEYA 3WANA 1YIWA 4F8CB 2D3GA 3EECA 2A5UA 2MW5A 2KDIA 2WX0A 1VCBA 3ZNGC 2Z59B 2J0KA 4NJ6A 1X1MA 4ZDVA 2ZVNA 3UIOB 3ZUNA 4F1SA 3N32A 3LJ3A 3O65B
chains in the Genus database with same CATH superfamily
3GE8C 4C7ZA 2WXPA 3Q3NC 4IM0A 4MGZE 2MWSB 3U4EG 4A6QA 4FBJB 1FIQA 1TGZB 5KHQA 1WYWB 2WGSA 1RRBA 3QA8A 3PV1A 2PE9A 3K9PB 2MCNB 4USAA 5DPRA 4N9F4 3DHHC 1V5OA 3QX1A 3RMKC 3I63C 2GBNA 4W9IA 5JHAA 2HTME 3APCA 4DQOC 2WYQA 1PFDA 3R66C 2JZZA 1VR9A 3WAPA 4WJOA 2ZEQA 2I38A 3WALA 1TZ1A 1TS4A 4XGAB 1L6UA 4ARIA 3W1YA 5BO4B 2PTLA 3B08A 2KWDA 4MGIE 2D07B 3DWGC 3A4SC 3KVFB 1PUTA 2LI5A 4BZAA 5EE0A 1WY8A 4C56C 1CQVA 2L05A 4AJYB 3GZNI 3I57A 3JSVA 3EHVA 3VR9B 2M4NA 3CSTA 4WAFA 1C4PA 2KMAA 2JX5A 3V61A 4E3CA 3TSSA 2ZZPB 4MT5A 3W1SC 3PLVA 2I1KA 1QKZA 1C4CA 1IGCA 3CMMB 2DWQA 2LVPA 1SE3A 5HI1A 1ZKHA 3HK0A 4OZAA 2BKRB 2ZW0A 2D3BA 4LNFA 3JYUA 2CJNA 4W9HA 4CQNA 3N1YC 3H9DA 3PRPB 4WQMA 1TJEA 1YX5B 1WWTA 3IAM1 3NY5A 1F0ZA 2IZVB 4ANVA 1V9JA 3ZNHB 4B95A 4I6PA 2KWVB 2NVUI 3B0AA 3AV8A 4BAXA 2D3AA 2INNE 2LXCA 1PQSA 4K7SA 1V6EA 3ZDTA 4ZYNA 1SJHD 4IW0A 4AS1A 1JRPA 3JVZX 4XYCA 1F52A 2EMTA 3BIID 2FCNA 5CHVC 2JT4B 3KUZA 3IHPC 2QC8A 2YEPF 4MH0E 2RMMA 4HKZE 2L1AA 1WMHB 2QMTA 2DENB 1FFVA 2WXRA 1KFYB 2DZKA 3EFUA 1FD6A 2KTRB 3NVVA 3I5JC 3ZIMA 2WXKA 2WHIA 4A3OA 4JL9A 1HQRD 2E6XA 3ZTCA 3DHGC 1LFDA 5AEKB 1WGRA 5BMHA 3ZLZA 2KN5A 2VRRB 3UGBB 4IWOA 4RCOA 3DBHI 1C1YB 3PREA 3VAWA 4AP4C 3SDLC 4FJVB 2B3AA 5JHBA 2VZKB 4W9FA 4UDUC 1GB1A 4FXCA 5AZHA 1E8WA 4RF1A 2SEBD 3ZDMC 4S0RA 1SJED 2V1YA 2WWZA 1QOBA 1P7FA 3ZTDA 1I42A 1T3QA 2N7JA 2IGGA 3HVZA 2KFKB 3QHTA 1A70A 3NVYA 2MA9B 4CYEA 3AMZA 4EE2A 4MGYE 4A9AA 3EUB2 3U7DA 3DCGA 1E8YA 1WR1A 4IC7B 2MRPA 2BYEA 1LM8B 2PVGC 2LVOA 1NI3A 1FNWA 1D5ZC 3EA6A 3B2FA 3GP7A 3MC0B 4WAAA 3L0WB 2NMQA 1VRAB 1V5TA 1VZ8A 1UWXA 3R7RA 4BOSC 3BK1A 2K8BA 3AE9B 3GOEA 1SGHA 3PRMB 3E9SA 1GNUA 2FIDA 3NG0A 1BMLC 2HE7A 3E56A 1R4MI 1E0ZA 2INCC 1VLBA 5EE3A 1T6BX 3RNCC 3AE3B 1WE7A 4BKGA 2DHZA 3ZRCA 3AEBB 3QQ8B 2LJ5A 3Q8BA 1L2NA 1CJEA 4C00A 3TEYA 4KSLC 3MC9A 1K50A 1R4NI 2CHWA 2N9XA 1RWSA 4GU2A 3AH7A 1VJKA 4GIVA 3ZO5B 3PZ8A 2GBMA 4LJOB 4OVZA 3L10B 4IG7B 2BVCA 4P16A 4HPLB 1D3ZA 3ML8A 3BYTB 2IYDB 3HM3A 3R2IA 4HCNB 3B2GA 4K81A 2CU3A 2CHZA 1DYQA 5C2TB 4P1CC 1JWUD 3OLMD 2I2YA 2EKIA 2N9EB 2L0TA 2MSED 3APDA 3U30A 1XT9B 3SU8X 2IY0B 3RT3B 1QILA 5LXHA 2KACA 2HJ8A 1JROA 4HWIB 4MSMB 2CHXA 1E7PB 3BVZA 4LNIA 3A33B 1N63A 3DVGY 1RM6C 1TS2A 4JE3B 1STEA 1GG3A 4KKIA 2JRHA 5IAAC 2J53A 3MC8A 1MG4A 3QIJA 2QSDA 2IDYA 4MJSB 3DWMA 4PS8A 3B9JA 4RF0A 5JH5C 2FE8A 1P9DU 1UZXB 4N6EB 4M8NA 3PT2B 4JX1C 1ZXHA 3GZNB 2MP2A 4FHKA 1H4RA 3TEWA 3CWIA 3IFWB 3Q14C 1TY2A 3JW0X 4RGMA 4EZKA 5C1ZA 1JWAD 2BGFA 3LYYA 2AX5A 4R3DA 1ZDVA 2OJRA 1WYGA 2WXQA 1I4PA 1KM7A 2Y5BB 1LGRA 1ZOYB 1SBBB 1HXYD 3PGEA 1GC7A 2MLBA 3IG3A 4K3BA 3R8BA 2PIAA 1E90A 1GOZA 2INPE 2O2VA 4HEA1 2KKCA 2VZKD 2N9KA 1IBXA 2K3UA 4WJNA 5BYRA 2RDBC 4HRSA 3WANA 4YTMB 2MW5A 3RNBC 2ZVNA 3UIOB 3N32A 1V97A 2QJLA 3LDZE 2IO0B 3M62B 3CSFA 1TT5B 3VHTC 5IOIA 2KN4A 1KRHA 4PYUA 1OFFA 1N62A 4ZRQA 4TQ0A 3KW5B 4TUUA 1FRRA 4WQOB 2O6VD 3DBLI 2CKHB 4RGTA 4NJCA 4GDKA 1WI0A 2FCQA 2PVOD 4NQKE 1WM2A 3M3JA 2C7MB 4GGQA 2DAFA 2JUOA 1N5WA 2IY1B 1E8XA 1WH3A 2JWUA 4NPNA 1Q5WB 4OZBA 3ZXVA 5DCNA 1JQ4A 3RD2A 2N7EA 4ZYSA 2AQ2B 2LZ6A 3W1SA 1F2RC 2V3NA 4BBNF 1HZ5A 2WNMA 4W9KA 2PKOA 1QF6A 3N1ZC 3ML9A 3B1LX 1OQYA 2Y5PA 3DHIC 1XF5L 3RZWC 2BQQA 5FR3A 5DPTA 1PGXA 3ABVB 1Y56A 2KTFA 2G4DB 3UQBA 1NYQA 3L08A 1E6EB 2LD9A 1DOIA 2BPSA 4M8MA 4ARCA 3VTWA 3BZDB 2V0GA 4XDCA 3N20C 4HKQA 2JPHA 5L83A 1L0VB 1OEYJ 3GB1A 3Q8EA 1WE6A 5IO9A 4WWOA 3J9CA 3QAQA 1ROEA 2CU1A 3APFA 4EFOA 3U7ZA 4TSSA 3T8MA 2LASA 2IBIB 4ICUA 4JLCA 3VR8B 1Z2MA 4OW0A 1UUPA 2JZPA 3V6EB 5GMVA 3OJ3A 4II2B 4LLGM 1QOGA 4TV3A 4RM9A 3TCAA 4WWPA 5BYSA 3KUDB 4FADA 1JRUA 2ONQA 3PZDA 4KDIC 1AYFA 4AUQC 2M17A 5FKAC 1Y8RC 1CK1A 4KIKA 2IJ0A 3DBRI 4G50A 2IO2B 2NPTB 3H6NA 5TR5A 3ZRFA 4BFRA 2JQRB 1JALA 4TMAB 3RNFC 2KDBA 2REXA 4K1RB 4EOYA 1L0YB 3KYCD 2N9PC 2W82A 2R2QA 4PS3A 4GDLB 1I7HA 5TSSA 1TY0A 2N1VA 4IM3A 1NBFC 1FFUA 1QOAA 3SFEB 2AWTA 2GLSA 4KGRA 2M19A 5AUIA 2KFJA 1P1AA 1YN5A 3ZKJC 4F7ZA 2K39A 2GBKA 4ZHOA 1ET9A 2INDC 3T3OA 3M63B 3VVWB 2MH7A 4GSWA 3AE6B 1Q10A 2NCNA 3RULA 1V80A 2C5LC 1JMLA 2KMCA 3WAOA 5H8YE 5AZGA 2MJDA 2L32A 3U52E 2DAJA 3FAHA 1CZPA 3PHWB 1ZDXA 1A5RA 1I4XA 3ZYYX 3ETRA 2XK5A 3AE2B 1E7UA 4KDLB 4EUTA 3DVNV 3ZGZA 3UI3A 1EF1A 1XEEA 2KDEB 2Z0DB 1C76A 1TKYA 5D7GA 5IN7A 1ZP0B 3U8ZA 5HKHA 1GB4A 1KOTA 1EUVB 2M8SA 1MI0A 4KGTA 1IBXB 2WXMA 5G2NA 1UF0A 2MJEA 1MFWA 1N5XA 3Q8FA 2LXAA 2KX0A 3L54A 3V05A 1UNSA 2IO3B 4NAWA 4HJKA 4KSKC 1VDVA 2CJOA 2BW2A 4KZ0A 2JF5A 3FILA 4FULA 2NTTA 4BBNC 2FBWB 5D6JB 4GDKB 4B0MA 2OOBB 1U4AA 1UGJA 1ZPSA 3PRZA 3ZVVA 2D11A 2CR5A 2KHWB 1RYJA 3W2DA 1TS3A 2ACZB 3H7PA 1YX6B 4W9CA 4W9EA 3VXWA 1AWDA 3P2BA 2BYVE 4M00A 5J18A 2B76B 2J7QB 1K8RB 2G45B 2FUHB 2V4IB 3QJZA 1PGBA 2JZ3B 5FK9C 3ZW3A 4PK1A 2C7HA 3UIPB 2WU5B 4CHKA 2JYEA 1SIFA 1KLVA 2W3RA 3VH4B 4EEWA 2XBBC 1RFAA 4IWPA 2LWPA 1WXSA 4P7IA 2J0JA 3DOWA 4BKTA 1TIFA 1WX8A 2GMIC 3KLSX 3LXFA 1J19A 4KGSA 2XN9C 4FLHA 3OWEB 2G9HD 2FIFA 2FAZA 1QQRA 2WS3B 2WXJA 4ZRKA 2BT6A 4C4VA 4BKSD 1WM3A 4PT5A 1ACCA 1FNUA 2BBCA 3OJ4B 5AZFA 2ZNVB 2GBJA 1T0YA 1MJDA 2JYTA 4MGKE 2J0MA 1SEBD 2PPHA 1F2RI 2BB5A 5CTRC 2YVCA 1P7EA 1R7SA 2K6DB 1E10A 2E3TA 2WXNA 5DPSA 4KIKB 4DWFA 3BINA 4HJGE 4HCPB 2LHEA 3QC8B 4MELA 4W9LA 4E71A 1BUIC 1TTNA 4II3B 3AEEB 2PE6B 2NBWB 2A4ZA 4M0WA 1WXAA 3MJ5A 5FR6A 3IT6B 4G11A 3UINB 4XDDA 1WJ4A 2SAKA 1OQQA 1PYWD 2AQ3B 3VUWA 3VTUA 1J7CA 4FJZA 4JGHB 4FN2A 1EF5A 1OEYA 3AM9A 1VCBA 2J0KA 1XCQL 4ZDVA 3ZUNA 4YSYB 3LJ3A 2DYMA 4IWQA 2FUG1 3BWUD 1IYFA 3T9LA 4L1BA 2LRUA 4YSXB 2HDEA 2W9NA 3L16A 3JSVB 3OG5A 4MM3A 2LEKA 3RNEC 1KTKA 1WRDB 2LVQA 1CMXB 4KVGB 3L4PA 4IUMB 1KJTA 4US9A 4AOFA 2LGIA 4ZRJA 1L0XB 3MP9A 1P0RA 2N0SB 4HK2A 3L13A 1UGMA 3VDZA 2QHOA 3DVNU 5E6PA 2IPKD 4N58A 4HDQA 2RD0A 4A90A 4DHZB 1KLUD 3KQ4A 3T3NA 3K9OB 2WDQB 2UWQA 2V9HA 1XXGA 1SB3C 4YSZB 3P4SB 1P3QU 1FCCC 4DDID 2OEDA 2WP9B 3W5UB 1YJIA 2I1JA 3BY4B 3AULA 3AEGB 2KT7A 1NVID 4Q2JA 4H2AA 1V2YA 1YQ4B 1NDDA 1RLFA 1MVKA 3PTFC 1HE8A 2K8HA 2NR2A 1JCKB 4XE0A 2D5GA 3FILB 1L5PA 4LNNA 1I4QA 1L4ZB 2WLBA 3DPDA 1I4HA 4XX5A 4ANWA 5MPOA 3KH0A 1T0QC 1M4VA 2K0PA 2LHDA 1SXTA 1YJJA 3AE4B 3BYYB 2K22A 3QARA 1FM0D 3VQIA 2X8XX 1ZUD2 2QCZA 3EGRA 3UQAA 2KAJA 3Q3MC 4DHJB 1EWCA 3PLUA 1LO5D 1WGHA 2WXLA 2KYWA 5EE9A 1EU4A 2BTEA 2LGXA 3VRAB 3ZXRA 2C60A 3Q8CA 4KZCA 4B0EA 4P1BC 1JWMD 3ONSA 4D2KA 1M94A 3A1QA 1F9JA 1V49A 2ZCBA 3MJWA 1J8CA 2DYBA 1K51A 1WGGA 4AWJA 3AXCA 2J4XA 1DGJA 2LRWA 3R7QA 3P63A 1F1HA 1XCTL 3AEFB 1C79A 2J52A 3A9KA 3ZJTA 4C7YA 2K5PA 1OTRB 2K8CA 4HVBA 1WF9A 2KJ6A 3H1UA 3MHSD 3Q8AA 1WX7A 1TKEA 2HJ1A 2UU7A 4OVUA 3A9JA 1C4AA 2N4FA 1WXVA 4OHJA 1UH6A 4C4VB 4EZLA 4J6IA 4LTUA 4WJQA 3RI7C 2H89B 1WX9A 2VH2A 1L7YA 2V4LA 3QCAA 4RM8A 1ZXIA 3W9CB 5G5HA 3RZFA 4YXDB 3DBHB 3HHMA 3R2TA 2MX2A 2WU2B 2WDTB 5E6JA 2BF8B 1ZE3D 2WDVB 4L23A 3P4QB 1D5XC 2RDHA 3HVDA 3HUIA 4AQ7A 2KLGA 5CHWA 3QK0A 3V60A 2AL3A 2W55A 4K7WA 2GOWA 2AYOB 3VH3B 4M0WB 1BXTA 1I4GA 2KOXA 1YQBA 1UWMA 3V6CB 4J3OD 2EMSA 3D32A 3RUIB 3P4RB 1C3TA 1MG8A 4LDTB 3WIMA 2IGDA 2UYZB 4A3PA 4GXBA 5IA7A 4MH8A 2PJHA 4GN1A 5G5GA 1NYRA 1VZ7A 1IPGA 2MBEA 3NUHB 2LFIA 2AQ1B 1WXQA 3C8YA 4NJ7A 3NZUA 2D3CA 3RN9C 2O6VA 1UBQA 4ASWC 1YMHE 4DBGA 1XLOA 1B1ZA 5HG2A 4MM3B 2ICIA 4WWNA 4IKGA 3AECB 4MSQB 2RPVA 3PVLA 1IP9A 2BKFA 4N59A 2D2QA 3M95A 2NTSA 2Y3AA 4I6LB 1R4MB 1WGYA 3NOBA 3AN1A 3NVWA 2XEWA 3AEDB 3RNAC 1FXTB 3ZJUA 2KK8A 4B6WA 2BS3B 1WJ6A 2ZW1A 4XZ4A 1S1QB 4XWTA 3PHXB 3ZNZB 5I4DA 2QIEB 2RPQA 1R4NB 4LJPB 4NAMA 3RNGC 1MPEA 5J2RA 2G3QB 2JWZA 1DOYA 3PZ7A 2ZPNA 3AI5A 3HM6X 4WURA 3TEXA 2DZIA 1YJ1A 1FXAA 4NNJB 2LGYA 3OAWA 4US8A 2NS5A 2MP2B 1WZ0A 4DHJD 2L3ZA 1KLGD 3VRBB 1UD7A 1GUAB 4B9KA 4KKJA 3QWZB 1ISNA 1C9FA 2X38A 5JZEB 4HPMB 4W9GA 5L95C 3TIXA 4EZJA 3DQVA 2O2VB 2QILA 2MBOA 2RSUA 1V8CA 1WGKA 4FHJA 4A20A 2BB6A 2GB1A 1NENB 4MDKE 3TJPA 3PS6A 1J7BA 2WXHA 1WR6E 1YNTE 2LGDA 4HLEA 3N3KB 2DLBA 1EWYC 3A1QB 4XC2A 4C80A 3AE7B 4PS7A 1JWSD 1S3SG 2MJ3A 2NBVB 4DXFA 2MQJA 3X23A 3IVFA 1E8ZA 2KJRA 2AL6A 3ENEA 2WXFA 4K7UA 3V62A 3O13A 2D10A 4LCDE 5J17A 1ESFA 1ET6A 4MJSA 3A9KB 1JWBD 2JVCA 3N1XC 2KD0A 4S17A 2L00B 3IT4B 2GRIA 4F8CB 1N60A 3EECA 2A5UA 2WX0A 2KDIA 2Z59B 4NJ6A 1X1MA 1TZOA 3MHZA 2WDRB 1FRDA 2WQYB 3O65B 4X57B 2DZMA 3A9JB 3VUYA 4YL8A 1VD2A 2C7NB 2V3SA 1V1PA 2PLPA 3RFZB 3BVMA 4ZRPA 3AU4A 2IO1B 1PGAA 5D2MB 3ZJVA 3NZ3A 2L76A 1YN4A 1TKGA 3KWVA 2ZNVC 3AB5A 3NZSA 1V86A 3VTVA 3ECIA 5IP4D 2Y5CA 4BOZB 2KQ4X 1HTOA 5E6OA 1P98A 1QLBB 2FNJB 1E5WA 2L83A 4M01A 1YN3A 5JXVA 5EDSA 2K1FA 4LDTD 2JRIB 1GPXA 1T5XD 1K52A 1TS5A 5LLIA 4RGNA 1HEZE 3DBLB 2GI9A 1QT9A 2M56B 3H8HA 1IGDA 4FJYA 1WRIA 1YQ3B 2G4SA 1D4BA 1EO6A 5HFYA 3RCZA 3R3MA 1EM7A 2FCMA 3MFGA 1PDXA 3IAS1 5BYQA 3TEZA 2LMCA 3EC8A 4ZRIA 1FO4A 3C0RB 4G3XB 1QZEA 1KF6B 4EKUA 1SE2A 4A55A 1ENFA 1LQBA 2DX5B 3VFKA 3W5VB 2M1MA 4K3CA 2G1EA 2NBUA 2AEHA 2OJWA 1XLPA 2O6VB 4LK0M 2KC2A 4LNOA 3WCQA 1J7AA 2KANA 3NS8A 4ACFA 3AU5A 2VH1A 3N30A 2RR9A 4TQ1A 1HTQA 4YT0B 2QDFA 4RNAA 2KWUB 1TYGB 5H92C 5D3IB 1WIAA 4WWMA 2KXJA 2KX3A 1D5MC 1BT0A 2DNFA 3C19A 2YLMA 2KZRA 2DZJA 2PMVA 3WA0A 2BYFA 4DK5A 1WFYA 2M0AA 3NJTA 1XD3B 4IM2A 2K25A 1AW7A 2DYOA 3Q69A 3P1MA 4QAYA 3URYA 2WX1A 4LNKA 1EU3A 4DHZE 4MEMA 2ZPYA 3Q3FA 2KQSA 1G6JA 2XNAC 3DBSA 1Q0WB 4NZLB 5AUKA 3Q3OC 4E74A 3L17A 3HIZA 1KH0A 3IXSA 3RYTA 3U2SC 4TKNA 3NS1A 3KUCB 2OHFA 1YD8U 2KVRA 3EFCA 3ZQ4A 1T0RC 3DBRB 5C23A 3LB8C 2N7DA 1L4DB 3TL5A 2KMMA 2M0XA 1MHXA 2WXGA 2LJIA 2XK5B 2Q5WD 3CIRB 3KYDD 4BKSA 4YWGG 2LUMA 3H7SA 2NPTA 4RMAA 4OVVA 1OQRA 2KC1A 4HPPA 2ZVOA 2KWCA 1FEHA 1NI2A 4I6NB 3NRZA 4KV2A 1FCLA 1WGDA 1NEKB 4GDLA 1RAXA 1N6ZA 1ZW7A 1E9MA 4WJPA 4GLSC 3GE3C 2C9WB 4NY0A 4M02A 1WZ3A 5LNK1 4CO7A 2KNBA 1Q1OA 4NAWB 5E6NA 3FKYA 1V1OA 5EE1A 1IUEA 4DXGA 4DXAB 5BMGA 3BVGA 2EKEC 3I3TB 3FC4A 2BS4B 1MHHE 1AN8A 1C78A 1OGWA 5D3DA 2HD5B 2W54A 1YOVB 2BWES 3AE1B 1UBIA 2LUEA 1GAQB 1XQQA 3WAMA 4HXDA 4RH6A 3H7PB 2PW9A 4A8XC 2L7RA 3PPAA 4GOCA 3RPFC 2Z0EB 4URKA 4HROA 1C77A 3VUXA 2R61A 1V1PB 2MBHA 2J42A 4W9DA 4AJWA 3CF6E 2CS4A 1SIJA 5GXGB 2EELA 3A4RA 1DOXA 1UELA 2L0FA 1QOFA 5LXIB 2KLCA 2JXTA 2L8JA 2KDMA 4YTNB 5G55A 1K53A 2N9LA 1TBEA 4P6VF 4ITKA 2N1WA 2LGSA 2K9XA 3PSEB 2ZCCA 3SEBA 2QEJC 1F77A 2BWFA 3GS2A 1AARA 1FPYA 5HHDG 5KHOA 1XLQA 1I35A 3PO0A 2MBBB 4ICVA 4OZCA 2YEPB 2RGFA 3UF8A 3IBEA 2JXXA 5D94A 4JWSC 5IKCM 1WJNA 2KVZA 4RGOS 2KJHB 1XLNA 3TUOA 2V3PA 3KWLA 4JQWC 2L52A 3ZNID 1FNVA 4ANUA 2RDGA 1Z5SB 1N61A 2MHJA 2ASQA 1T0SC 4O1NA 5BMIA 2K6QA 5T8IA 4PYZA 1XO3A 4JIOU 1E7VA 2JU6X 4MACA 1RFKA 2FCSA 2MBQA 1WMHA 1SF0A 3I9V1 1LXDA 3SFDB 4RFBA 1VZ6A 1SSNA 4YTPB 2KTRA 1L6VA 2BS2B 5C3JB 2H88B 3DVGX 5CX3A 2MEKA 4G0NB 4W9JA 4WH4A 2ZJDA 2KDFB 3HRDD 1HA5A 4WIPA 4HDOA 4XWWA 2DBYA 1J0GA 1WSPA 2R2OA 2GBRA 4ANXA 4REZA 2W3SA 2WXOA 5CHFA 2JSVX 1FMAD 2KQ7A 3ALBA 2IGHA 3Q2AC 1H8CA 4IOIE 4JWUC 2PEAA 4IDIA 3SHQA 1I4RA 4FA6A 3X0WA 3MTNB 1GC6A 3TBLD 3Q3JA 3NHEB 3SR6A 3N9YC 2KO3A 4JPSA 1SE9A 3P42A 2KFKA 4NQLB 3P4PB 4KX6B 4GB9A 4BVUC 3AE5B 1V81A 1ZGUB 2TSSA 1WJUA 2JY6A 2Z8LA 2ON8A 3TMPB 1JW9D 4L2YA 5DPWA 3V3XA 3DDCB 3S2AA 2BYTA 1D6EC 2WXIA 2HTHA 4GMVA 3SD5A 1GJZA 4ZHPA 1WXMA 4ZOHC 3AE8B 4DDGD 1B9RA 1HZ6A 1YIWA 2D3GA 3NVZA 3ZNGC 3Q6BA 1FXIA 1SE4A 3AEAB 3BK2A 4F1SA
chains in the Genus database with same CATH topology
2DYMA 4X57B 4IWQA 2DZMA 3A9JB 3VUYA 3LDZE 2IO0B 4YL8A 3M62B 1VD2A 2C7NB 2V3SA 3CSFA 3VHTC 4PYUA 4IM0A 3AU4A 2IO1B 5D2MB 1IYFA 4MGZE 3T9LA 4TQ0A 2L76A 2MWSB 2LRUA 3KW5B 2ZNVC 4TUUA 4FBJB 4WQOB 1TGZB 2W9NA 5KHQA 1WYWB 3L16A 1RRBA 2O6VD 3DBLI 2CKHB 3QA8A 3NZSA 3JSVB 3PV1A 2PE9A 3K9PB 2MCNB 4MM3A 1V86A 4GDKA 1WI0A 5DPRA 3ECIA 4N9F4 1V5OA 3QX1A 3VTVA 2FCQA 4NQKE 1WRDB 2GBNA 4W9IA 1WM2A 4BOZB 5JHAA 2LVQA 3APCA 5E6OA 1CMXB 1P98A 2FNJB 2C7MB 3M3JA 1E5WA 4GGQA 4KVGB 2WYQA 3R66C 2DAFA 2JUOA 2JZZA 2IY1B 4IUMB 5EDSA 1E8XA 3WAPA 2K1FA 4LDTD 4WJOA 1WH3A 2JRIB 1KJTA 2ZEQA 4AOFA 4ZRJA 4NPNA 5LLIA 3WALA 1TZ1A 1Q5WB 1P0RA 4HK2A 5DCNA 3RD2A 2N7EA 2LZ6A 3L13A 3W1SA 1UGMA 4FJYA 3W1YA 3VDZA 5BO4B 3B08A 2G4SA 4MGIE 4BBNF 2QHOA 3DVNU 4W9KA 2D07B 5E6PA 1EO6A 3KVFB 3A4SC 4HDQA 2RD0A 3RCZA 4DHZB 3R3MA 2LI5A 3ML9A 1WY8A 3B1LX 1OQYA 2FCMA 3K9OB 2UWQA 2L05A 3RZWC 4AJYB 3GZNI 3JSVA 5DPTA 3EC8A 4ZRIA 3EHVA 3C0RB 1P3QU 4G3XB 2KTFA 2G4DB 4DDID 1QZEA 2M4NA 3CSTA 3UQBA 2KMAA 4EKUA 3L08A 2I1JA 3BY4B 3V61A 3AULA 2LD9A 4E3CA 2BPSA 4M8MA 2ZZPB 4HVBA 1LQBA 2DX5B 3W1SC 3PLVA 2I1KA 3VFKA 1V2YA 3VTWA 1NDDA 1RLFA 3CMMB 2M1MA 3PTFC 2LVPA 2JPHA 5L83A 1HE8A 2K8HA 2NR2A 2NBUA 2AEHA 1ZKHA 2O6VB 3HK0A 2KC2A 1OEYJ 2BKRB 3DPDA 4EZLA 3JYUA 1WE6A 4XX5A 4ANWA 4WWOA 2KANA 3NS8A 3AU5A 3KH0A 3QAQA 4W9HA 2CU1A 3H9DA 3PRPB 3APFA 1YX5B 2RR9A 3N30A 4TQ1A 4EFOA 3QARA 3VQIA 2KWUB 3NY5A 3T8MA 1WIAA 2KXJA 2LASA 2IBIB 2KX3A 4ICUA 4JLCA 1Z2MA 1BT0A 2IZVB 2YLMA 3UQAA 4ANVA 3V6EB 5GMVA 3OJ3A 4II2B 2KZRA 1V9JA 2DZJA 3WA0A 3ZNHB 4DHJB 2BYFA 4B95A 4I6PA 4TV3A 3PLUA 4DK5A 1WFYA 4RM9A 3TCAA 2KWVB 4WWPA 2NVUI 1XD3B 3KUDB 1WGHA 3B0AA 4IM2A 2K25A 4FADA 2DYOA 2LGXA 1PQSA 1JRUA 2LXCA 4K7SA 3PZDA 1V6EA 3ZDTA 4KDIC 4ZYNA 2C60A 4KZCA 2WX1A 4IW0A 4AUQC 2M17A 3ONSA 3JVZX 1Y8RC 2EMTA 4DHZE 4MEMA 1M94A 2FCNA 2ZPYA 3A1QA 4KIKA 5CHVC 1F9JA 1V49A 3DBRI 4G50A 2JT4B 2IO2B 2ZCBA 3KUZA 3IHPC 3MJWA 2NPTB 3H6NA 5TR5A 1J8CA 3ZRFA 4BFRA 2DYBA 3Q3FA 4MH0E 2KQSA 1G6JA 2KDBA 2REXA 1WGGA 4K1RB 3DBSA 4AWJA 1Q0WB 1WMHB 4EOYA 3AXCA 3KYCD 4E74A 3L17A 3HIZA 2LRWA 2DENB 2N9PC 3R7QA 3RYTA 2R2QA 2DZKA 4PS3A 4TKNA 3EFUA 3KUCB 4GDLB 2KTRB 1YD8U 2N1VA 2KVRA 3A9KA 1NBFC 4IM3A 3ZIMA 1OTRB 5C23A 2AWTA 4A3OA 4JL9A 2KFJA 2K8CA 1P1AA 2N7DA 3ZKJC 1WF9A 2K39A 2KJ6A 3H1UA 3MHSD 3TL5A 4F7ZA 3ZTCA 1LFDA 2GBKA 1WX7A 2M0XA 5AEKB 1WGRA 3ZLZA 2KN5A 2VRRB 2XK5B 3KYDD 4OVUA 3A9JA 3UGBB 4BKSA 2N4FA 4IWOA 3M63B 1WXVA 3H7SA 3VVWB 4GSWA 1UH6A 3DBHI 2NPTA 2NCNA 1C1YB 3PREA 4RMAA 3VAWA 4AP4C 4J6IA 4FJVB 2B3AA 3RULA 3SDLC 5JHBA 4OVVA 2KC1A 1V80A 4WJQA 2C5LC 2ZVOA 2KMCA 2KWCA 4W9FA 3WAOA 1WX9A 1L7YA 2V4LA 1NI2A 5AZGA 5AZHA 1E8WA 3QCAA 4I6NB 4RM8A 4KV2A 1WGDA 4GDLA 1RAXA 3ZDMC 1ZW7A 2V1YA 2WWZA 3RZFA 4WJPA 2C9WB 2DAJA 4NY0A 3HHMA 3ZTDA 1I42A 2MX2A 2WDTB 1WZ3A 4CO7A 2KNBA 2KFKB 3PHWB 2BF8B 3QHTA 1Q1OA 2MA9B 4CYEA 1A5RA 4NAWB 5E6NA 2XK5A 4MGYE 2KLGA 4DXAB 1E7UA 4KDLB 5CHWA 4EUTA 3DVNV 3I3TB 2EKEC 3DCGA 3QK0A 3U7DA 3V60A 2AL3A 4K7WA 2GOWA 1E8YA 2AYOB 1EF1A 1OGWA 1WR1A 2KDEB 2Z0DB 4M0WB 4IC7B 5D7GA 3VH3B 2HD5B 2KOXA 1YQBA 2MRPA 3U8ZA 2BYEA 5HKHA 1LM8B 1KOTA 2LVOA 3V6CB 2BWES 1EUVB 2EMSA 3D32A 2M8SA 3RUIB 1C3TA 1MG8A 4LDTB 1UBIA 2LUEA 3WIMA 5G2NA 1XQQA 4WAAA 3WAMA 4HXDA 2UYZB 3L0WB 4A3PA 4GXBA 1V5TA 3H7PB 5IA7A 3R7RA 4BOSC 2PJHA 2L7RA 4GN1A 2LXAA 2KX0A 3PPAA 4GOCA 2Z0EB 1IPGA 4URKA 2K8BA 3L54A 2MBEA 3GOEA 3VUXA 2IO3B 2MBHA 4NAWA 4HJKA 4KSKC 4W9DA 4AJWA 3CF6E 2CS4A 1SGHA 3PRMB 1GNUA 2FIDA 2HE7A 4NJ7A 3NZUA 1R4MI 4KZ0A 3A4RA 2O6VA 1UBQA 1UELA 2JF5A 2L0FA 4FULA 4BBNC 5LXIB 4ASWC 4DBGA 5D6JB 2KLCA 2L8JA 1WE7A 4GDKB 2OOBB 4WWNA 1U4AA 4BKGA 2DHZA 5G55A 4MSQB 3ZRCA 3QQ8B 3PVLA 2LJ5A 1TBEA 1L2NA 1IP9A 3PRZA 3ZVVA 2D11A 2CR5A 2N1WA 2BKFA 2KHWB 3PSEB 2D2QA 2ZCCA 3M95A 2BWFA 4KSLC 1AARA 5KHOA 4I6LB 1I35A 1R4NI 1WGYA 2CHWA 2MBBB 1YX6B 3H7PA 3NOBA 4ICVA 2N9XA 4W9CA 2RGFA 4W9EA 3VXWA 3P2BA 4GU2A 2BYVE 2XEWA 3UF8A 3IBEA 2JXXA 1FXTB 5J18A 4GIVA 5D94A 3ZO5B 2KK8A 4B6WA 1WJNA 2GBMA 2KJHB 4LJOB 3L10B 4IG7B 2J7QB 4HPLB 1D3ZA 3ML8A 1K8RB 4JQWC 1WJ6A 3ZNID 2G45B 4XZ4A 4ANUA 1S1QB 2IYDB 1Z5SB 3HM3A 3PHXB 3ZNZB 2FUHB 2RPQA 2ASQA 4HCNB 4LJPB 4K81A 2K6QA 2CHZA 3QJZA 5J2RA 2JZ3B 2G3QB 3ZW3A 2JWZA 2C7HA 4PYZA 3UIPB 4JIOU 2ZPNA 3AI5A 1E7VA 3HM6X 2DZIA 1YJ1A 2FCSA 2MBQA 1WMHA 3OLMD 4CHKA 1LXDA 4NNJB 2N9EB 2L0TA 2MSED 2LGYA 3APDA 3OAWA 3U30A 1SIFA 1XT9B 3SU8X 1KLVA 3VH4B 4EEWA 2XBBC 1RFAA 2KTRA 2IY0B 4IWPA 3RT3B 2LWPA 1WXSA 2NS5A 4P7IA 2J0JA 3DOWA 5LXHA 2MP2B 4BKTA 1WX8A 2GMIC 3DVGX 2HJ8A 5CX3A 1WZ0A 4HWIB 4MSMB 1J19A 2CHXA 4G0NB 4DHJD 4W9JA 2ZJDA 2L3ZA 2KDFB 3A33B 1UD7A 4FLHA 3DVGY 4HDOA 2FIFA 1GUAB 4B9KA 1GG3A 1J0GA 2JRHA 2FAZA 5IAAC 3QWZB 1ISNA 4ZRKA 2R2OA 2GBRA 3QIJA 4ANXA 4BKSD 1WM3A 5JZEB 4HPMB 4W9GA 5CHFA 5L95C 3OJ4B 2KQ7A 3ALBA 5AZFA 2ZNVB 3TIXA 4MJSB 2GBJA 4PS8A 1T0YA 4EZJA 1H8CA 3DQVA 2O2VB 2RSUA 2MBOA 5JH5C 2PEAA 3SHQA 1P9DU 4MGKE 1UZXB 4FHJA 4M8NA 4A20A 2J0MA 3PT2B 4FA6A 3X0WA 2PPHA 3MTNB 1GC6A 5CTRC 3TBLD 2MP2A 4FHKA 3Q3JA 2YVCA 3PS6A 1H4RA 3NHEB 4MDKE 3TJPA 1WR6E 2K6DB 2LGDA 4HLEA 3IFWB 3N3KB 2KO3A 5DPSA 3JW0X 4EZKA 3A1QB 4KIKB 4XC2A 5C1ZA 1SE9A 4DWFA 2KFKA 3BINA 4NQLB 4PS7A 4GB9A 4BVUC 1S3SG 4HCPB 2BGFA 3QC8B 2NBVB 1V81A 1ZGUB 2MQJA 2OJRA 2Y5BB 1KM7A 3IVFA 4MELA 4W9LA 3X23A 1E8ZA 1WJUA 2KJRA 2AL6A 2JY6A 3ENEA 4E71A 1TTNA 4II3B 2PE6B 3PGEA 4K7UA 1GC7A 2NBWB 3V62A 3TMPB 2MLBA 3IG3A 2A4ZA 5DPWA 1WXAA 3DDCB 2D10A 5FR6A 4LCDE 5J17A 4G11A 1E90A 3S2AA 3UINB 1WJ4A 2HTHA 3A9KB 4GMVA 4MJSA 3SD5A 3VUWA 1GJZA 3VTUA 2O2VA 4FJZA 1WXMA 2JVCA 2KKCA 4JGHB 2KD0A 4WJNA 4FN2A 4DDGD 2L00B 1EF5A 1OEYA 3WANA 1YIWA 4F8CB 2D3GA 3EECA 2A5UA 2MW5A 2KDIA 2WX0A 1VCBA 3ZNGC 2Z59B 2J0KA 4NJ6A 1X1MA 4ZDVA 2ZVNA 3UIOB 3ZUNA 4F1SA 3N32A 3LJ3A 3O65B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYM A;  4X57 B;  4IWQ A;  2DZM A;  3A9J B;  3VUY A;  3LDZ E;  2IO0 B;  4YL8 A;  3M62 B;  1VD2 A;  2C7N B;  2V3S A;  3CSF A;  3VHT C;  4PYU A;  4IM0 A;  3AU4 A;  2IO1 B;  5D2M B;  1IYF A;  4MGZ E;  3T9L A;  4TQ0 A;  2L76 A;  2MWS B;  2LRU A;  3KW5 B;  2ZNV C;  4TUU A;  4FBJ B;  4WQO B;  1TGZ B;  2W9N A;  5KHQ A;  1WYW B;  3L16 A;  1RRB A;  2O6V D;  3DBL I;  2CKH B;  3QA8 A;  3NZS A;  3JSV B;  3PV1 A;  2PE9 A;  3K9P B;  2MCN B;  4MM3 A;  1V86 A;  4GDK A;  1WI0 A;  5DPR A;  3ECI A;  4N9F 4;  1V5O A;  3QX1 A;  3VTV A;  2FCQ A;  4NQK E;  1WRD B;  2GBN A;  4W9I A;  1WM2 A;  4BOZ B;  5JHA A;  2LVQ A;  3APC A;  5E6O A;  1CMX B;  1P98 A;  2FNJ B;  2C7M B;  3M3J A;  1E5W A;  4GGQ A;  4KVG B;  2WYQ A;  3R66 C;  2DAF A;  2JUO A;  2JZZ A;  2IY1 B;  4IUM B;  5EDS A;  1E8X A;  3WAP A;  2K1F A;  4LDT D;  4WJO A;  1WH3 A;  2JRI B;  1KJT A;  2ZEQ A;  4AOF A;  4ZRJ A;  4NPN A;  5LLI A;  3WAL A;  1TZ1 A;  1Q5W B;  1P0R A;  4HK2 A;  5DCN A;  3RD2 A;  2N7E A;  2LZ6 A;  3L13 A;  3W1S A;  1UGM A;  4FJY A;  3W1Y A;  3VDZ A;  5BO4 B;  3B08 A;  2G4S A;  4MGI E;  4BBN F;  2QHO A;  3DVN U;  4W9K A;  2D07 B;  5E6P A;  1EO6 A;  3KVF B;  3A4S C;  4HDQ A;  2RD0 A;  3RCZ A;  4DHZ B;  3R3M A;  2LI5 A;  3ML9 A;  1WY8 A;  3B1L X;  1OQY A;  2FCM A;  3K9O B;  2UWQ A;  2L05 A;  3RZW C;  4AJY B;  3GZN I;  3JSV A;  5DPT A;  3EC8 A;  4ZRI A;  3EHV A;  3C0R B;  1P3Q U;  4G3X B;  2KTF A;  2G4D B;  4DDI D;  1QZE A;  2M4N A;  3CST A;  3UQB A;  2KMA A;  4EKU A;  3L08 A;  2I1J A;  3BY4 B;  3V61 A;  3AUL A;  2LD9 A;  4E3C A;  2BPS A;  4M8M A;  2ZZP B;  4HVB A;  1LQB A;  2DX5 B;  3W1S C;  3PLV A;  2I1K A;  3VFK A;  1V2Y A;  3VTW A;  1NDD A;  1RLF A;  3CMM B;  2M1M A;  3PTF C;  2LVP A;  2JPH A;  5L83 A;  1HE8 A;  2K8H A;  2NR2 A;  2NBU A;  2AEH A;  1ZKH A;  2O6V B;  3HK0 A;  2KC2 A;  1OEY J;  2BKR B;  3DPD A;  4EZL A;  3JYU A;  1WE6 A;  4XX5 A;  4ANW A;  4WWO A;  2KAN A;  3NS8 A;  3AU5 A;  3KH0 A;  3QAQ A;  4W9H A;  2CU1 A;  3H9D A;  3PRP B;  3APF A;  1YX5 B;  2RR9 A;  3N30 A;  4TQ1 A;  4EFO A;  3QAR A;  3VQI A;  2KWU B;  3NY5 A;  3T8M A;  1WIA A;  2KXJ A;  2LAS A;  2IBI B;  2KX3 A;  4ICU A;  4JLC A;  1Z2M A;  1BT0 A;  2IZV B;  2YLM A;  3UQA A;  4ANV A;  3V6E B;  5GMV A;  3OJ3 A;  4II2 B;  2KZR A;  1V9J A;  2DZJ A;  3WA0 A;  3ZNH B;  4DHJ B;  2BYF A;  4B95 A;  4I6P A;  4TV3 A;  3PLU A;  4DK5 A;  1WFY A;  4RM9 A;  3TCA A;  2KWV B;  4WWP A;  2NVU I;  1XD3 B;  3KUD B;  1WGH A;  3B0A A;  4IM2 A;  2K25 A;  4FAD A;  2DYO A;  2LGX A;  1PQS A;  1JRU A;  2LXC A;  4K7S A;  3PZD A;  1V6E A;  3ZDT A;  4KDI C;  4ZYN A;  2C60 A;  4KZC A;  2WX1 A;  4IW0 A;  4AUQ C;  2M17 A;  3ONS A;  3JVZ X;  1Y8R C;  2EMT A;  4DHZ E;  4MEM A;  1M94 A;  2FCN A;  2ZPY A;  3A1Q A;  4KIK A;  5CHV C;  1F9J A;  1V49 A;  3DBR I;  4G50 A;  2JT4 B;  2IO2 B;  2ZCB A;  3KUZ A;  3IHP C;  3MJW A;  2NPT B;  3H6N A;  5TR5 A;  1J8C A;  3ZRF A;  4BFR A;  2DYB A;  3Q3F A;  4MH0 E;  2KQS A;  1G6J A;  2KDB A;  2REX A;  1WGG A;  4K1R B;  3DBS A;  4AWJ A;  1Q0W B;  1WMH B;  4EOY A;  3AXC A;  3KYC D;  4E74 A;  3L17 A;  3HIZ A;  2LRW A;  2DEN B;  2N9P C;  3R7Q A;  3RYT A;  2R2Q A;  2DZK A;  4PS3 A;  4TKN A;  3EFU A;  3KUC B;  4GDL B;  2KTR B;  1YD8 U;  2N1V A;  2KVR A;  3A9K A;  1NBF C;  4IM3 A;  3ZIM A;  1OTR B;  5C23 A;  2AWT A;  4A3O A;  4JL9 A;  2KFJ A;  2K8C A;  1P1A A;  2N7D A;  3ZKJ C;  1WF9 A;  2K39 A;  2KJ6 A;  3H1U A;  3MHS D;  3TL5 A;  4F7Z A;  3ZTC A;  1LFD A;  2GBK A;  1WX7 A;  2M0X A;  5AEK B;  1WGR A;  3ZLZ A;  2KN5 A;  2VRR B;  2XK5 B;  3KYD D;  4OVU A;  3A9J A;  3UGB B;  4BKS A;  2N4F A;  4IWO A;  3M63 B;  1WXV A;  3H7S A;  3VVW B;  4GSW A;  1UH6 A;  3DBH I;  2NPT A;  2NCN A;  1C1Y B;  3PRE A;  4RMA A;  3VAW A;  4AP4 C;  4J6I A;  4FJV B;  2B3A A;  3RUL A;  3SDL C;  5JHB A;  4OVV A;  2KC1 A;  1V80 A;  4WJQ A;  2C5L C;  2ZVO A;  2KMC A;  2KWC A;  4W9F A;  3WAO A;  1WX9 A;  1L7Y A;  2V4L A;  1NI2 A;  5AZG A;  5AZH A;  1E8W A;  3QCA A;  4I6N B;  4RM8 A;  4KV2 A;  1WGD A;  4GDL A;  1RAX A;  3ZDM C;  1ZW7 A;  2V1Y A;  2WWZ A;  3RZF A;  4WJP A;  2C9W B;  2DAJ A;  4NY0 A;  3HHM A;  3ZTD A;  1I42 A;  2MX2 A;  2WDT B;  1WZ3 A;  4CO7 A;  2KNB A;  2KFK B;  3PHW B;  2BF8 B;  3QHT A;  1Q1O A;  2MA9 B;  4CYE A;  1A5R A;  4NAW B;  5E6N A;  2XK5 A;  4MGY E;  2KLG A;  4DXA B;  1E7U A;  4KDL B;  5CHW A;  4EUT A;  3DVN V;  3I3T B;  2EKE C;  3DCG A;  3QK0 A;  3U7D A;  3V60 A;  2AL3 A;  4K7W A;  2GOW A;  1E8Y A;  2AYO B;  1EF1 A;  1OGW A;  1WR1 A;  2KDE B;  2Z0D B;  4M0W B;  4IC7 B;  5D7G A;  3VH3 B;  2HD5 B;  2KOX A;  1YQB A;  2MRP A;  3U8Z A;  2BYE A;  5HKH A;  1LM8 B;  1KOT A;  2LVO A;  3V6C B;  2BWE S;  1EUV B;  2EMS A;  3D32 A;  2M8S A;  3RUI B;  1C3T A;  1MG8 A;  4LDT B;  1UBI A;  2LUE A;  3WIM A;  5G2N A;  1XQQ A;  4WAA A;  3WAM A;  4HXD A;  2UYZ B;  3L0W B;  4A3P A;  4GXB A;  1V5T A;  3H7P B;  5IA7 A;  3R7R A;  4BOS C;  2PJH A;  2L7R A;  4GN1 A;  2LXA A;  2KX0 A;  3PPA A;  4GOC A;  2Z0E B;  1IPG A;  4URK A;  2K8B A;  3L54 A;  2MBE A;  3GOE A;  3VUX A;  2IO3 B;  2MBH A;  4NAW A;  4HJK A;  4KSK C;  4W9D A;  4AJW A;  3CF6 E;  2CS4 A;  1SGH A;  3PRM B;  1GNU A;  2FID A;  2HE7 A;  4NJ7 A;  3NZU A;  1R4M I;  4KZ0 A;  3A4R A;  2O6V A;  1UBQ A;  1UEL A;  2JF5 A;  2L0F A;  4FUL A;  4BBN C;  5LXI B;  4ASW C;  4DBG A;  5D6J B;  2KLC A;  2L8J A;  1WE7 A;  4GDK B;  2OOB B;  4WWN A;  1U4A A;  4BKG A;  2DHZ A;  5G55 A;  4MSQ B;  3ZRC A;  3QQ8 B;  3PVL A;  2LJ5 A;  1TBE A;  1L2N A;  1IP9 A;  3PRZ A;  3ZVV A;  2D11 A;  2CR5 A;  2N1W A;  2BKF A;  2KHW B;  3PSE B;  2D2Q A;  2ZCC A;  3M95 A;  2BWF A;  4KSL C;  1AAR A;  5KHO A;  4I6L B;  1I35 A;  1R4N I;  1WGY A;  2CHW A;  2MBB B;  1YX6 B;  3H7P A;  3NOB A;  4ICV A;  2N9X A;  4W9C A;  2RGF A;  4W9E A;  3VXW A;  3P2B A;  4GU2 A;  2BYV E;  2XEW A;  3UF8 A;  3IBE A;  2JXX A;  1FXT B;  5J18 A;  4GIV A;  5D94 A;  3ZO5 B;  2KK8 A;  4B6W A;  1WJN A;  2GBM A;  2KJH B;  4LJO B;  3L10 B;  4IG7 B;  2J7Q B;  4HPL B;  1D3Z A;  3ML8 A;  1K8R B;  4JQW C;  1WJ6 A;  3ZNI D;  2G45 B;  4XZ4 A;  4ANU A;  1S1Q B;  2IYD B;  1Z5S B;  3HM3 A;  3PHX B;  3ZNZ B;  2FUH B;  2RPQ A;  2ASQ A;  4HCN B;  4LJP B;  4K81 A;  2K6Q A;  2CHZ A;  3QJZ A;  5J2R A;  2JZ3 B;  2G3Q B;  3ZW3 A;  2JWZ A;  2C7H A;  4PYZ A;  3UIP B;  4JIO U;  2ZPN A;  3AI5 A;  1E7V A;  3HM6 X;  2DZI A;  1YJ1 A;  2FCS A;  2MBQ A;  1WMH A;  3OLM D;  4CHK A;  1LXD A;  4NNJ B;  2N9E B;  2L0T A;  2MSE D;  2LGY A;  3APD A;  3OAW A;  3U30 A;  1SIF A;  1XT9 B;  3SU8 X;  1KLV A;  3VH4 B;  4EEW A;  2XBB C;  1RFA A;  2KTR A;  2IY0 B;  4IWP A;  3RT3 B;  2LWP A;  1WXS A;  2NS5 A;  4P7I A;  2J0J A;  3DOW A;  5LXH A;  2MP2 B;  4BKT A;  1WX8 A;  2GMI C;  3DVG X;  2HJ8 A;  5CX3 A;  1WZ0 A;  4HWI B;  4MSM B;  1J19 A;  2CHX A;  4G0N B;  4DHJ D;  4W9J A;  2ZJD A;  2L3Z A;  2KDF B;  3A33 B;  1UD7 A;  4FLH A;  3DVG Y;  4HDO A;  2FIF A;  1GUA B;  4B9K A;  1GG3 A;  1J0G A;  2JRH A;  2FAZ A;  5IAA C;  3QWZ B;  1ISN A;  4ZRK A;  2R2O A;  2GBR A;  3QIJ A;  4ANX A;  4BKS D;  1WM3 A;  5JZE B;  4HPM B;  4W9G A;  5CHF A;  5L95 C;  3OJ4 B;  2KQ7 A;  3ALB A;  5AZF A;  2ZNV B;  3TIX A;  4MJS B;  2GBJ A;  4PS8 A;  1T0Y A;  4EZJ A;  1H8C A;  3DQV A;  2O2V B;  2RSU A;  2MBO A;  5JH5 C;  2PEA A;  3SHQ A;  1P9D U;  4MGK E;  1UZX B;  4FHJ A;  4M8N A;  4A20 A;  2J0M A;  3PT2 B;  4FA6 A;  3X0W A;  2PPH A;  3MTN B;  1GC6 A;  5CTR C;  3TBL D;  2MP2 A;  4FHK A;  3Q3J A;  2YVC A;  3PS6 A;  1H4R A;  3NHE B;  4MDK E;  3TJP A;  1WR6 E;  2K6D B;  2LGD A;  4HLE A;  3IFW B;  3N3K B;  2KO3 A;  5DPS A;  3JW0 X;  4EZK A;  3A1Q B;  4KIK B;  4XC2 A;  5C1Z A;  1SE9 A;  4DWF A;  2KFK A;  3BIN A;  4NQL B;  4PS7 A;  4GB9 A;  4BVU C;  1S3S G;  4HCP B;  2BGF A;  3QC8 B;  2NBV B;  1V81 A;  1ZGU B;  2MQJ A;  2OJR A;  2Y5B B;  1KM7 A;  3IVF A;  4MEL A;  4W9L A;  3X23 A;  1E8Z A;  1WJU A;  2KJR A;  2AL6 A;  2JY6 A;  3ENE A;  4E71 A;  1TTN A;  4II3 B;  2PE6 B;  3PGE A;  4K7U A;  1GC7 A;  2NBW B;  3V62 A;  3TMP B;  2MLB A;  3IG3 A;  2A4Z A;  5DPW A;  1WXA A;  3DDC B;  2D10 A;  5FR6 A;  4LCD E;  5J17 A;  4G11 A;  1E90 A;  3S2A A;  3UIN B;  1WJ4 A;  2HTH A;  3A9K B;  4GMV A;  4MJS A;  3SD5 A;  3VUW A;  1GJZ A;  3VTU A;  2O2V A;  4FJZ A;  1WXM A;  2JVC A;  2KKC A;  4JGH B;  2KD0 A;  4WJN A;  4FN2 A;  4DDG D;  2L00 B;  1EF5 A;  1OEY A;  3WAN A;  1YIW A;  4F8C B;  2D3G A;  3EEC A;  2A5U A;  2MW5 A;  2KDI A;  2WX0 A;  1VCB A;  3ZNG C;  2Z59 B;  2J0K A;  4NJ6 A;  1X1M A;  4ZDV A;  2ZVN A;  3UIO B;  3ZUN A;  4F1S A;  3N32 A;  3LJ3 A;  3O65 B; 
#chains in the Genus database with same CATH topology
 3GE8 C;  4C7Z A;  2WXP A;  3Q3N C;  4IM0 A;  4MGZ E;  2MWS B;  3U4E G;  4A6Q A;  4FBJ B;  1FIQ A;  1TGZ B;  5KHQ A;  1WYW B;  2WGS A;  1RRB A;  3QA8 A;  3PV1 A;  2PE9 A;  3K9P B;  2MCN B;  4USA A;  5DPR A;  4N9F 4;  3DHH C;  1V5O A;  3QX1 A;  3RMK C;  3I63 C;  2GBN A;  4W9I A;  5JHA A;  2HTM E;  3APC A;  4DQO C;  2WYQ A;  1PFD A;  3R66 C;  2JZZ A;  1VR9 A;  3WAP A;  4WJO A;  2ZEQ A;  2I38 A;  3WAL A;  1TZ1 A;  1TS4 A;  4XGA B;  1L6U A;  4ARI A;  3W1Y A;  5BO4 B;  2PTL A;  3B08 A;  2KWD A;  4MGI E;  2D07 B;  3DWG C;  3A4S C;  3KVF B;  1PUT A;  2LI5 A;  4BZA A;  5EE0 A;  1WY8 A;  4C56 C;  1CQV A;  2L05 A;  4AJY B;  3GZN I;  3I57 A;  3JSV A;  3EHV A;  3VR9 B;  2M4N A;  3CST A;  4WAF A;  1C4P A;  2KMA A;  2JX5 A;  3V61 A;  4E3C A;  3TSS A;  2ZZP B;  4MT5 A;  3W1S C;  3PLV A;  2I1K A;  1QKZ A;  1C4C A;  1IGC A;  3CMM B;  2DWQ A;  2LVP A;  1SE3 A;  5HI1 A;  1ZKH A;  3HK0 A;  4OZA A;  2BKR B;  2ZW0 A;  2D3B A;  4LNF A;  3JYU A;  2CJN A;  4W9H A;  4CQN A;  3N1Y C;  3H9D A;  3PRP B;  4WQM A;  1TJE A;  1YX5 B;  1WWT A;  3IAM 1;  3NY5 A;  1F0Z A;  2IZV B;  4ANV A;  1V9J A;  3ZNH B;  4B95 A;  4I6P A;  2KWV B;  2NVU I;  3B0A A;  3AV8 A;  4BAX A;  2D3A A;  2INN E;  2LXC A;  1PQS A;  4K7S A;  1V6E A;  3ZDT A;  4ZYN A;  1SJH D;  4IW0 A;  4AS1 A;  1JRP A;  3JVZ X;  4XYC A;  1F52 A;  2EMT A;  3BII D;  2FCN A;  5CHV C;  2JT4 B;  3KUZ A;  3IHP C;  2QC8 A;  2YEP F;  4MH0 E;  2RMM A;  4HKZ E;  2L1A A;  1WMH B;  2QMT A;  2DEN B;  1FFV A;  2WXR A;  1KFY B;  2DZK A;  3EFU A;  1FD6 A;  2KTR B;  3NVV A;  3I5J C;  3ZIM A;  2WXK A;  2WHI A;  4A3O A;  4JL9 A;  1HQR D;  2E6X A;  3ZTC A;  3DHG C;  1LFD A;  5AEK B;  1WGR A;  5BMH A;  3ZLZ A;  2KN5 A;  2VRR B;  3UGB B;  4IWO A;  4RCO A;  3DBH I;  1C1Y B;  3PRE A;  3VAW A;  4AP4 C;  3SDL C;  4FJV B;  2B3A A;  5JHB A;  2VZK B;  4W9F A;  4UDU C;  1GB1 A;  4FXC A;  5AZH A;  1E8W A;  4RF1 A;  2SEB D;  3ZDM C;  4S0R A;  1SJE D;  2V1Y A;  2WWZ A;  1QOB A;  1P7F A;  3ZTD A;  1I42 A;  1T3Q A;  2N7J A;  2IGG A;  3HVZ A;  2KFK B;  3QHT A;  1A70 A;  3NVY A;  2MA9 B;  4CYE A;  3AMZ A;  4EE2 A;  4MGY E;  4A9A A;  3EUB 2;  3U7D A;  3DCG A;  1E8Y A;  1WR1 A;  4IC7 B;  2MRP A;  2BYE A;  1LM8 B;  2PVG C;  2LVO A;  1NI3 A;  1FNW A;  1D5Z C;  3EA6 A;  3B2F A;  3GP7 A;  3MC0 B;  4WAA A;  3L0W B;  2NMQ A;  1VRA B;  1V5T A;  1VZ8 A;  1UWX A;  3R7R A;  4BOS C;  3BK1 A;  2K8B A;  3AE9 B;  3GOE A;  1SGH A;  3PRM B;  3E9S A;  1GNU A;  2FID A;  3NG0 A;  1BML C;  2HE7 A;  3E56 A;  1R4M I;  1E0Z A;  2INC C;  1VLB A;  5EE3 A;  1T6B X;  3RNC C;  3AE3 B;  1WE7 A;  4BKG A;  2DHZ A;  3ZRC A;  3AEB B;  3QQ8 B;  2LJ5 A;  3Q8B A;  1L2N A;  1CJE A;  4C00 A;  3TEY A;  4KSL C;  3MC9 A;  1K50 A;  1R4N I;  2CHW A;  2N9X A;  1RWS A;  4GU2 A;  3AH7 A;  1VJK A;  4GIV A;  3ZO5 B;  3PZ8 A;  2GBM A;  4LJO B;  4OVZ A;  3L10 B;  4IG7 B;  2BVC A;  4P16 A;  4HPL B;  1D3Z A;  3ML8 A;  3BYT B;  2IYD B;  3HM3 A;  3R2I A;  4HCN B;  3B2G A;  4K81 A;  2CU3 A;  2CHZ A;  1DYQ A;  5C2T B;  4P1C C;  1JWU D;  3OLM D;  2I2Y A;  2EKI A;  2N9E B;  2L0T A;  2MSE D;  3APD A;  3U30 A;  1XT9 B;  3SU8 X;  2IY0 B;  3RT3 B;  1QIL A;  5LXH A;  2KAC A;  2HJ8 A;  1JRO A;  4HWI B;  4MSM B;  2CHX A;  1E7P B;  3BVZ A;  4LNI A;  3A33 B;  1N63 A;  3DVG Y;  1RM6 C;  1TS2 A;  4JE3 B;  1STE A;  1GG3 A;  4KKI A;  2JRH A;  5IAA C;  2J53 A;  3MC8 A;  1MG4 A;  3QIJ A;  2QSD A;  2IDY A;  4MJS B;  3DWM A;  4PS8 A;  3B9J A;  4RF0 A;  5JH5 C;  2FE8 A;  1P9D U;  1UZX B;  4N6E B;  4M8N A;  3PT2 B;  4JX1 C;  1ZXH A;  3GZN B;  2MP2 A;  4FHK A;  1H4R A;  3TEW A;  3CWI A;  3IFW B;  3Q14 C;  1TY2 A;  3JW0 X;  4RGM A;  4EZK A;  5C1Z A;  1JWA D;  2BGF A;  3LYY A;  2AX5 A;  4R3D A;  1ZDV A;  2OJR A;  1WYG A;  2WXQ A;  1I4P A;  1KM7 A;  2Y5B B;  1LGR A;  1ZOY B;  1SBB B;  1HXY D;  3PGE A;  1GC7 A;  2MLB A;  3IG3 A;  4K3B A;  3R8B A;  2PIA A;  1E90 A;  1GOZ A;  2INP E;  2O2V A;  4HEA 1;  2KKC A;  2VZK D;  2N9K A;  1IBX A;  2K3U A;  4WJN A;  5BYR A;  2RDB C;  4HRS A;  3WAN A;  4YTM B;  2MW5 A;  3RNB C;  2ZVN A;  3UIO B;  3N32 A;  1V97 A;  2QJL A;  3LDZ E;  2IO0 B;  3M62 B;  3CSF A;  1TT5 B;  3VHT C;  5IOI A;  2KN4 A;  1KRH A;  4PYU A;  1OFF A;  1N62 A;  4ZRQ A;  4TQ0 A;  3KW5 B;  4TUU A;  1FRR A;  4WQO B;  2O6V D;  3DBL I;  2CKH B;  4RGT A;  4NJC A;  4GDK A;  1WI0 A;  2FCQ A;  2PVO D;  4NQK E;  1WM2 A;  3M3J A;  2C7M B;  4GGQ A;  2DAF A;  2JUO A;  1N5W A;  2IY1 B;  1E8X A;  1WH3 A;  2JWU A;  4NPN A;  1Q5W B;  4OZB A;  3ZXV A;  5DCN A;  1JQ4 A;  3RD2 A;  2N7E A;  4ZYS A;  2AQ2 B;  2LZ6 A;  3W1S A;  1F2R C;  2V3N A;  4BBN F;  1HZ5 A;  2WNM A;  4W9K A;  2PKO A;  1QF6 A;  3N1Z C;  3ML9 A;  3B1L X;  1OQY A;  2Y5P A;  3DHI C;  1XF5 L;  3RZW C;  2BQQ A;  5FR3 A;  5DPT A;  1PGX A;  3ABV B;  1Y56 A;  2KTF A;  2G4D B;  3UQB A;  1NYQ A;  3L08 A;  1E6E B;  2LD9 A;  1DOI A;  2BPS A;  4M8M A;  4ARC A;  3VTW A;  3BZD B;  2V0G A;  4XDC A;  3N20 C;  4HKQ A;  2JPH A;  5L83 A;  1L0V B;  1OEY J;  3GB1 A;  3Q8E A;  1WE6 A;  5IO9 A;  4WWO A;  3J9C A;  3QAQ A;  1ROE A;  2CU1 A;  3APF A;  4EFO A;  3U7Z A;  4TSS A;  3T8M A;  2LAS A;  2IBI B;  4ICU A;  4JLC A;  3VR8 B;  1Z2M A;  4OW0 A;  1UUP A;  2JZP A;  3V6E B;  5GMV A;  3OJ3 A;  4II2 B;  4LLG M;  1QOG A;  4TV3 A;  4RM9 A;  3TCA A;  4WWP A;  5BYS A;  3KUD B;  4FAD A;  1JRU A;  2ONQ A;  3PZD A;  4KDI C;  1AYF A;  4AUQ C;  2M17 A;  5FKA C;  1Y8R C;  1CK1 A;  4KIK A;  2IJ0 A;  3DBR I;  4G50 A;  2IO2 B;  2NPT B;  3H6N A;  5TR5 A;  3ZRF A;  4BFR A;  2JQR B;  1JAL A;  4TMA B;  3RNF C;  2KDB A;  2REX A;  4K1R B;  4EOY A;  1L0Y B;  3KYC D;  2N9P C;  2W82 A;  2R2Q A;  4PS3 A;  4GDL B;  1I7H A;  5TSS A;  1TY0 A;  2N1V A;  4IM3 A;  1NBF C;  1FFU A;  1QOA A;  3SFE B;  2AWT A;  2GLS A;  4KGR A;  2M19 A;  5AUI A;  2KFJ A;  1P1A A;  1YN5 A;  3ZKJ C;  4F7Z A;  2K39 A;  2GBK A;  4ZHO A;  1ET9 A;  2IND C;  3T3O A;  3M63 B;  3VVW B;  2MH7 A;  4GSW A;  3AE6 B;  1Q10 A;  2NCN A;  3RUL A;  1V80 A;  2C5L C;  1JML A;  2KMC A;  3WAO A;  5H8Y E;  5AZG A;  2MJD A;  2L32 A;  3U52 E;  2DAJ A;  3FAH A;  1CZP A;  3PHW B;  1ZDX A;  1A5R A;  1I4X A;  3ZYY X;  3ETR A;  2XK5 A;  3AE2 B;  1E7U A;  4KDL B;  4EUT A;  3DVN V;  3ZGZ A;  3UI3 A;  1EF1 A;  1XEE A;  2KDE B;  2Z0D B;  1C76 A;  1TKY A;  5D7G A;  5IN7 A;  1ZP0 B;  3U8Z A;  5HKH A;  1GB4 A;  1KOT A;  1EUV B;  2M8S A;  1MI0 A;  4KGT A;  1IBX B;  2WXM A;  5G2N A;  1UF0 A;  2MJE A;  1MFW A;  1N5X A;  3Q8F A;  2LXA A;  2KX0 A;  3L54 A;  3V05 A;  1UNS A;  2IO3 B;  4NAW A;  4HJK A;  4KSK C;  1VDV A;  2CJO A;  2BW2 A;  4KZ0 A;  2JF5 A;  3FIL A;  4FUL A;  2NTT A;  4BBN C;  2FBW B;  5D6J B;  4GDK B;  4B0M A;  2OOB B;  1U4A A;  1UGJ A;  1ZPS A;  3PRZ A;  3ZVV A;  2D11 A;  2CR5 A;  2KHW B;  1RYJ A;  3W2D A;  1TS3 A;  2ACZ B;  3H7P A;  1YX6 B;  4W9C A;  4W9E A;  3VXW A;  1AWD A;  3P2B A;  2BYV E;  4M00 A;  5J18 A;  2B76 B;  2J7Q B;  1K8R B;  2G45 B;  2FUH B;  2V4I B;  3QJZ A;  1PGB A;  2JZ3 B;  5FK9 C;  3ZW3 A;  4PK1 A;  2C7H A;  3UIP B;  2WU5 B;  4CHK A;  2JYE A;  1SIF A;  1KLV A;  2W3R A;  3VH4 B;  4EEW A;  2XBB C;  1RFA A;  4IWP A;  2LWP A;  1WXS A;  4P7I A;  2J0J A;  3DOW A;  4BKT A;  1TIF A;  1WX8 A;  2GMI C;  3KLS X;  3LXF A;  1J19 A;  4KGS A;  2XN9 C;  4FLH A;  3OWE B;  2G9H D;  2FIF A;  2FAZ A;  1QQR A;  2WS3 B;  2WXJ A;  4ZRK A;  2BT6 A;  4C4V A;  4BKS D;  1WM3 A;  4PT5 A;  1ACC A;  1FNU A;  2BBC A;  3OJ4 B;  5AZF A;  2ZNV B;  2GBJ A;  1T0Y A;  1MJD A;  2JYT A;  4MGK E;  2J0M A;  1SEB D;  2PPH A;  1F2R I;  2BB5 A;  5CTR C;  2YVC A;  1P7E A;  1R7S A;  2K6D B;  1E10 A;  2E3T A;  2WXN A;  5DPS A;  4KIK B;  4DWF A;  3BIN A;  4HJG E;  4HCP B;  2LHE A;  3QC8 B;  4MEL A;  4W9L A;  4E71 A;  1BUI C;  1TTN A;  4II3 B;  3AEE B;  2PE6 B;  2NBW B;  2A4Z A;  4M0W A;  1WXA A;  3MJ5 A;  5FR6 A;  3IT6 B;  4G11 A;  3UIN B;  4XDD A;  1WJ4 A;  2SAK A;  1OQQ A;  1PYW D;  2AQ3 B;  3VUW A;  3VTU A;  1J7C A;  4FJZ A;  4JGH B;  4FN2 A;  1EF5 A;  1OEY A;  3AM9 A;  1VCB A;  2J0K A;  1XCQ L;  4ZDV A;  3ZUN A;  4YSY B;  3LJ3 A;  2DYM A;  4IWQ A;  2FUG 1;  3BWU D;  1IYF A;  3T9L A;  4L1B A;  2LRU A;  4YSX B;  2HDE A;  2W9N A;  3L16 A;  3JSV B;  3OG5 A;  4MM3 A;  2LEK A;  3RNE C;  1KTK A;  1WRD B;  2LVQ A;  1CMX B;  4KVG B;  3L4P A;  4IUM B;  1KJT A;  4US9 A;  4AOF A;  2LGI A;  4ZRJ A;  1L0X B;  3MP9 A;  1P0R A;  2N0S B;  4HK2 A;  3L13 A;  1UGM A;  3VDZ A;  2QHO A;  3DVN U;  5E6P A;  2IPK D;  4N58 A;  4HDQ A;  2RD0 A;  4A90 A;  4DHZ B;  1KLU D;  3KQ4 A;  3T3N A;  3K9O B;  2WDQ B;  2UWQ A;  2V9H A;  1XXG A;  1SB3 C;  4YSZ B;  3P4S B;  1P3Q U;  1FCC C;  4DDI D;  2OED A;  2WP9 B;  3W5U B;  1YJI A;  2I1J A;  3BY4 B;  3AUL A;  3AEG B;  2KT7 A;  1NVI D;  4Q2J A;  4H2A A;  1V2Y A;  1YQ4 B;  1NDD A;  1RLF A;  1MVK A;  3PTF C;  1HE8 A;  2K8H A;  2NR2 A;  1JCK B;  4XE0 A;  2D5G A;  3FIL B;  1L5P A;  4LNN A;  1I4Q A;  1L4Z B;  2WLB A;  3DPD A;  1I4H A;  4XX5 A;  4ANW A;  5MPO A;  3KH0 A;  1T0Q C;  1M4V A;  2K0P A;  2LHD A;  1SXT A;  1YJJ A;  3AE4 B;  3BYY B;  2K22 A;  3QAR A;  1FM0 D;  3VQI A;  2X8X X;  1ZUD 2;  2QCZ A;  3EGR A;  3UQA A;  2KAJ A;  3Q3M C;  4DHJ B;  1EWC A;  3PLU A;  1LO5 D;  1WGH A;  2WXL A;  2KYW A;  5EE9 A;  1EU4 A;  2BTE A;  2LGX A;  3VRA B;  3ZXR A;  2C60 A;  3Q8C A;  4KZC A;  4B0E A;  4P1B C;  1JWM D;  3ONS A;  4D2K A;  1M94 A;  3A1Q A;  1F9J A;  1V49 A;  2ZCB A;  3MJW A;  1J8C A;  2DYB A;  1K51 A;  1WGG A;  4AWJ A;  3AXC A;  2J4X A;  1DGJ A;  2LRW A;  3R7Q A;  3P63 A;  1F1H A;  1XCT L;  3AEF B;  1C79 A;  2J52 A;  3A9K A;  3ZJT A;  4C7Y A;  2K5P A;  1OTR B;  2K8C A;  4HVB A;  1WF9 A;  2KJ6 A;  3H1U A;  3MHS D;  3Q8A A;  1WX7 A;  1TKE A;  2HJ1 A;  2UU7 A;  4OVU A;  3A9J A;  1C4A A;  2N4F A;  1WXV A;  4OHJ A;  1UH6 A;  4C4V B;  4EZL A;  4J6I A;  4LTU A;  4WJQ A;  3RI7 C;  2H89 B;  1WX9 A;  2VH2 A;  1L7Y A;  2V4L A;  3QCA A;  4RM8 A;  1ZXI A;  3W9C B;  5G5H A;  3RZF A;  4YXD B;  3DBH B;  3HHM A;  3R2T A;  2MX2 A;  2WU2 B;  2WDT B;  5E6J A;  2BF8 B;  1ZE3 D;  2WDV B;  4L23 A;  3P4Q B;  1D5X C;  2RDH A;  3HVD A;  3HUI A;  4AQ7 A;  2KLG A;  5CHW A;  3QK0 A;  3V60 A;  2AL3 A;  2W55 A;  4K7W A;  2GOW A;  2AYO B;  3VH3 B;  4M0W B;  1BXT A;  1I4G A;  2KOX A;  1YQB A;  1UWM A;  3V6C B;  4J3O D;  2EMS A;  3D32 A;  3RUI B;  3P4R B;  1C3T A;  1MG8 A;  4LDT B;  3WIM A;  2IGD A;  2UYZ B;  4A3P A;  4GXB A;  5IA7 A;  4MH8 A;  2PJH A;  4GN1 A;  5G5G A;  1NYR A;  1VZ7 A;  1IPG A;  2MBE A;  3NUH B;  2LFI A;  2AQ1 B;  1WXQ A;  3C8Y A;  4NJ7 A;  3NZU A;  2D3C A;  3RN9 C;  2O6V A;  1UBQ A;  4ASW C;  1YMH E;  4DBG A;  1XLO A;  1B1Z A;  5HG2 A;  4MM3 B;  2ICI A;  4WWN A;  4IKG A;  3AEC B;  4MSQ B;  2RPV A;  3PVL A;  1IP9 A;  2BKF A;  4N59 A;  2D2Q A;  3M95 A;  2NTS A;  2Y3A A;  4I6L B;  1R4M B;  1WGY A;  3NOB A;  3AN1 A;  3NVW A;  2XEW A;  3AED B;  3RNA C;  1FXT B;  3ZJU A;  2KK8 A;  4B6W A;  2BS3 B;  1WJ6 A;  2ZW1 A;  4XZ4 A;  1S1Q B;  4XWT A;  3PHX B;  3ZNZ B;  5I4D A;  2QIE B;  2RPQ A;  1R4N B;  4LJP B;  4NAM A;  3RNG C;  1MPE A;  5J2R A;  2G3Q B;  2JWZ A;  1DOY A;  3PZ7 A;  2ZPN A;  3AI5 A;  3HM6 X;  4WUR A;  3TEX A;  2DZI A;  1YJ1 A;  1FXA A;  4NNJ B;  2LGY A;  3OAW A;  4US8 A;  2NS5 A;  2MP2 B;  1WZ0 A;  4DHJ D;  2L3Z A;  1KLG D;  3VRB B;  1UD7 A;  1GUA B;  4B9K A;  4KKJ A;  3QWZ B;  1ISN A;  1C9F A;  2X38 A;  5JZE B;  4HPM B;  4W9G A;  5L95 C;  3TIX A;  4EZJ A;  3DQV A;  2O2V B;  2QIL A;  2MBO A;  2RSU A;  1V8C A;  1WGK A;  4FHJ A;  4A20 A;  2BB6 A;  2GB1 A;  1NEN B;  4MDK E;  3TJP A;  3PS6 A;  1J7B A;  2WXH A;  1WR6 E;  1YNT E;  2LGD A;  4HLE A;  3N3K B;  2DLB A;  1EWY C;  3A1Q B;  4XC2 A;  4C80 A;  3AE7 B;  4PS7 A;  1JWS D;  1S3S G;  2MJ3 A;  2NBV B;  4DXF A;  2MQJ A;  3X23 A;  3IVF A;  1E8Z A;  2KJR A;  2AL6 A;  3ENE A;  2WXF A;  4K7U A;  3V62 A;  3O13 A;  2D10 A;  4LCD E;  5J17 A;  1ESF A;  1ET6 A;  4MJS A;  3A9K B;  1JWB D;  2JVC A;  3N1X C;  2KD0 A;  4S17 A;  2L00 B;  3IT4 B;  2GRI A;  4F8C B;  1N60 A;  3EEC A;  2A5U A;  2WX0 A;  2KDI A;  2Z59 B;  4NJ6 A;  1X1M A;  1TZO A;  3MHZ A;  2WDR B;  1FRD A;  2WQY B;  3O65 B;  4X57 B;  2DZM A;  3A9J B;  3VUY A;  4YL8 A;  1VD2 A;  2C7N B;  2V3S A;  1V1P A;  2PLP A;  3RFZ B;  3BVM A;  4ZRP A;  3AU4 A;  2IO1 B;  1PGA A;  5D2M B;  3ZJV A;  3NZ3 A;  2L76 A;  1YN4 A;  1TKG A;  3KWV A;  2ZNV C;  3AB5 A;  3NZS A;  1V86 A;  3VTV A;  3ECI A;  5IP4 D;  2Y5C A;  4BOZ B;  2KQ4 X;  1HTO A;  5E6O A;  1P98 A;  1QLB B;  2FNJ B;  1E5W A;  2L83 A;  4M01 A;  1YN3 A;  5JXV A;  5EDS A;  2K1F A;  4LDT D;  2JRI B;  1GPX A;  1T5X D;  1K52 A;  1TS5 A;  5LLI A;  4RGN A;  1HEZ E;  3DBL B;  2GI9 A;  1QT9 A;  2M56 B;  3H8H A;  1IGD A;  4FJY A;  1WRI A;  1YQ3 B;  2G4S A;  1D4B A;  1EO6 A;  5HFY A;  3RCZ A;  3R3M A;  1EM7 A;  2FCM A;  3MFG A;  1PDX A;  3IAS 1;  5BYQ A;  3TEZ A;  2LMC A;  3EC8 A;  4ZRI A;  1FO4 A;  3C0R B;  4G3X B;  1QZE A;  1KF6 B;  4EKU A;  1SE2 A;  4A55 A;  1ENF A;  1LQB A;  2DX5 B;  3VFK A;  3W5V B;  2M1M A;  4K3C A;  2G1E A;  2NBU A;  2AEH A;  2OJW A;  1XLP A;  2O6V B;  4LK0 M;  2KC2 A;  4LNO A;  3WCQ A;  1J7A A;  2KAN A;  3NS8 A;  4ACF A;  3AU5 A;  2VH1 A;  3N30 A;  2RR9 A;  4TQ1 A;  1HTQ A;  4YT0 B;  2QDF A;  4RNA A;  2KWU B;  1TYG B;  5H92 C;  5D3I B;  1WIA A;  4WWM A;  2KXJ A;  2KX3 A;  1D5M C;  1BT0 A;  2DNF A;  3C19 A;  2YLM A;  2KZR A;  2DZJ A;  2PMV A;  3WA0 A;  2BYF A;  4DK5 A;  1WFY A;  2M0A A;  3NJT A;  1XD3 B;  4IM2 A;  2K25 A;  1AW7 A;  2DYO A;  3Q69 A;  3P1M A;  4QAY A;  3URY A;  2WX1 A;  4LNK A;  1EU3 A;  4DHZ E;  4MEM A;  2ZPY A;  3Q3F A;  2KQS A;  1G6J A;  2XNA C;  3DBS A;  1Q0W B;  4NZL B;  5AUK A;  3Q3O C;  4E74 A;  3L17 A;  3HIZ A;  1KH0 A;  3IXS A;  3RYT A;  3U2S C;  4TKN A;  3NS1 A;  3KUC B;  2OHF A;  1YD8 U;  2KVR A;  3EFC A;  3ZQ4 A;  1T0R C;  3DBR B;  5C23 A;  3LB8 C;  2N7D A;  1L4D B;  3TL5 A;  2KMM A;  2M0X A;  1MHX A;  2WXG A;  2LJI A;  2XK5 B;  2Q5W D;  3CIR B;  3KYD D;  4BKS A;  4YWG G;  2LUM A;  3H7S A;  2NPT A;  4RMA A;  4OVV A;  1OQR A;  2KC1 A;  4HPP A;  2ZVO A;  2KWC A;  1FEH A;  1NI2 A;  4I6N B;  3NRZ A;  4KV2 A;  1FCL A;  1WGD A;  1NEK B;  4GDL A;  1RAX A;  1N6Z A;  1ZW7 A;  1E9M A;  4WJP A;  4GLS C;  3GE3 C;  2C9W B;  4NY0 A;  4M02 A;  1WZ3 A;  5LNK 1;  4CO7 A;  2KNB A;  1Q1O A;  4NAW B;  5E6N A;  3FKY A;  1V1O A;  5EE1 A;  1IUE A;  4DXG A;  4DXA B;  5BMG A;  3BVG A;  2EKE C;  3I3T B;  3FC4 A;  2BS4 B;  1MHH E;  1AN8 A;  1C78 A;  1OGW A;  5D3D A;  2HD5 B;  2W54 A;  1YOV B;  2BWE S;  3AE1 B;  1UBI A;  2LUE A;  1GAQ B;  1XQQ A;  3WAM A;  4HXD A;  4RH6 A;  3H7P B;  2PW9 A;  4A8X C;  2L7R A;  3PPA A;  4GOC A;  3RPF C;  2Z0E B;  4URK A;  4HRO A;  1C77 A;  3VUX A;  2R61 A;  1V1P B;  2MBH A;  2J42 A;  4W9D A;  4AJW A;  3CF6 E;  2CS4 A;  1SIJ A;  5GXG B;  2EEL A;  3A4R A;  1DOX A;  1UEL A;  2L0F A;  1QOF A;  5LXI B;  2KLC A;  2JXT A;  2L8J A;  2KDM A;  4YTN B;  5G55 A;  1K53 A;  2N9L A;  1TBE A;  4P6V F;  4ITK A;  2N1W A;  2LGS A;  2K9X A;  3PSE B;  2ZCC A;  3SEB A;  2QEJ C;  1F77 A;  2BWF A;  3GS2 A;  1AAR A;  1FPY A;  5HHD G;  5KHO A;  1XLQ A;  1I35 A;  3PO0 A;  2MBB B;  4ICV A;  4OZC A;  2YEP B;  2RGF A;  3UF8 A;  3IBE A;  2JXX A;  5D94 A;  4JWS C;  5IKC M;  1WJN A;  2KVZ A;  4RGO S;  2KJH B;  1XLN A;  3TUO A;  2V3P A;  3KWL A;  4JQW C;  2L52 A;  3ZNI D;  1FNV A;  4ANU A;  2RDG A;  1Z5S B;  1N61 A;  2MHJ A;  2ASQ A;  1T0S C;  4O1N A;  5BMI A;  2K6Q A;  5T8I A;  4PYZ A;  1XO3 A;  4JIO U;  1E7V A;  2JU6 X;  4MAC A;  1RFK A;  2FCS A;  2MBQ A;  1WMH A;  1SF0 A;  3I9V 1;  1LXD A;  3SFD B;  4RFB A;  1VZ6 A;  1SSN A;  4YTP B;  2KTR A;  1L6V A;  2BS2 B;  5C3J B;  2H88 B;  3DVG X;  5CX3 A;  2MEK A;  4G0N B;  4W9J A;  4WH4 A;  2ZJD A;  2KDF B;  3HRD D;  1HA5 A;  4WIP A;  4HDO A;  4XWW A;  2DBY A;  1J0G A;  1WSP A;  2R2O A;  2GBR A;  4ANX A;  4REZ A;  2W3S A;  2WXO A;  5CHF A;  2JSV X;  1FMA D;  2KQ7 A;  3ALB A;  2IGH A;  3Q2A C;  1H8C A;  4IOI E;  4JWU C;  2PEA A;  4IDI A;  3SHQ A;  1I4R A;  4FA6 A;  3X0W A;  3MTN B;  1GC6 A;  3TBL D;  3Q3J A;  3NHE B;  3SR6 A;  3N9Y C;  2KO3 A;  4JPS A;  1SE9 A;  3P42 A;  2KFK A;  4NQL B;  3P4P B;  4KX6 B;  4GB9 A;  4BVU C;  3AE5 B;  1V81 A;  1ZGU B;  2TSS A;  1WJU A;  2JY6 A;  2Z8L A;  2ON8 A;  3TMP B;  1JW9 D;  4L2Y A;  5DPW A;  3V3X A;  3DDC B;  3S2A A;  2BYT A;  1D6E C;  2WXI A;  2HTH A;  4GMV A;  3SD5 A;  1GJZ A;  4ZHP A;  1WXM A;  4ZOH C;  3AE8 B;  4DDG D;  1B9R A;  1HZ6 A;  1YIW A;  2D3G A;  3NVZ A;  3ZNG C;  3Q6B A;  1FXI A;  1SE4 A;  3AEA B;  3BK2 A;  4F1S A; 
#chains in the Genus database with same CATH homology
 2DYM A;  4X57 B;  4IWQ A;  2DZM A;  3A9J B;  3VUY A;  3LDZ E;  2IO0 B;  4YL8 A;  3M62 B;  1VD2 A;  2C7N B;  2V3S A;  3CSF A;  3VHT C;  4PYU A;  4IM0 A;  3AU4 A;  2IO1 B;  5D2M B;  1IYF A;  4MGZ E;  3T9L A;  4TQ0 A;  2L76 A;  2MWS B;  2LRU A;  3KW5 B;  2ZNV C;  4TUU A;  4FBJ B;  4WQO B;  1TGZ B;  2W9N A;  5KHQ A;  1WYW B;  3L16 A;  1RRB A;  2O6V D;  3DBL I;  2CKH B;  3QA8 A;  3NZS A;  3JSV B;  3PV1 A;  2PE9 A;  3K9P B;  2MCN B;  4MM3 A;  1V86 A;  4GDK A;  1WI0 A;  5DPR A;  3ECI A;  4N9F 4;  1V5O A;  3QX1 A;  3VTV A;  2FCQ A;  4NQK E;  1WRD B;  2GBN A;  4W9I A;  1WM2 A;  4BOZ B;  5JHA A;  2LVQ A;  3APC A;  5E6O A;  1CMX B;  1P98 A;  2FNJ B;  2C7M B;  3M3J A;  1E5W A;  4GGQ A;  4KVG B;  2WYQ A;  3R66 C;  2DAF A;  2JUO A;  2JZZ A;  2IY1 B;  4IUM B;  5EDS A;  1E8X A;  3WAP A;  2K1F A;  4LDT D;  4WJO A;  1WH3 A;  2JRI B;  1KJT A;  2ZEQ A;  4AOF A;  4ZRJ A;  4NPN A;  5LLI A;  3WAL A;  1TZ1 A;  1Q5W B;  1P0R A;  4HK2 A;  5DCN A;  3RD2 A;  2N7E A;  2LZ6 A;  3L13 A;  3W1S A;  1UGM A;  4FJY A;  3W1Y A;  3VDZ A;  5BO4 B;  3B08 A;  2G4S A;  4MGI E;  4BBN F;  2QHO A;  3DVN U;  4W9K A;  2D07 B;  5E6P A;  1EO6 A;  3KVF B;  3A4S C;  4HDQ A;  2RD0 A;  3RCZ A;  4DHZ B;  3R3M A;  2LI5 A;  3ML9 A;  1WY8 A;  3B1L X;  1OQY A;  2FCM A;  3K9O B;  2UWQ A;  2L05 A;  3RZW C;  4AJY B;  3GZN I;  3JSV A;  5DPT A;  3EC8 A;  4ZRI A;  3EHV A;  3C0R B;  1P3Q U;  4G3X B;  2KTF A;  2G4D B;  4DDI D;  1QZE A;  2M4N A;  3CST A;  3UQB A;  2KMA A;  4EKU A;  3L08 A;  2I1J A;  3BY4 B;  3V61 A;  3AUL A;  2LD9 A;  4E3C A;  2BPS A;  4M8M A;  2ZZP B;  4HVB A;  1LQB A;  2DX5 B;  3W1S C;  3PLV A;  2I1K A;  3VFK A;  1V2Y A;  3VTW A;  1NDD A;  1RLF A;  3CMM B;  2M1M A;  3PTF C;  2LVP A;  2JPH A;  5L83 A;  1HE8 A;  2K8H A;  2NR2 A;  2NBU A;  2AEH A;  1ZKH A;  2O6V B;  3HK0 A;  2KC2 A;  1OEY J;  2BKR B;  3DPD A;  4EZL A;  3JYU A;  1WE6 A;  4XX5 A;  4ANW A;  4WWO A;  2KAN A;  3NS8 A;  3AU5 A;  3KH0 A;  3QAQ A;  4W9H A;  2CU1 A;  3H9D A;  3PRP B;  3APF A;  1YX5 B;  2RR9 A;  3N30 A;  4TQ1 A;  4EFO A;  3QAR A;  3VQI A;  2KWU B;  3NY5 A;  3T8M A;  1WIA A;  2KXJ A;  2LAS A;  2IBI B;  2KX3 A;  4ICU A;  4JLC A;  1Z2M A;  1BT0 A;  2IZV B;  2YLM A;  3UQA A;  4ANV A;  3V6E B;  5GMV A;  3OJ3 A;  4II2 B;  2KZR A;  1V9J A;  2DZJ A;  3WA0 A;  3ZNH B;  4DHJ B;  2BYF A;  4B95 A;  4I6P A;  4TV3 A;  3PLU A;  4DK5 A;  1WFY A;  4RM9 A;  3TCA A;  2KWV B;  4WWP A;  2NVU I;  1XD3 B;  3KUD B;  1WGH A;  3B0A A;  4IM2 A;  2K25 A;  4FAD A;  2DYO A;  2LGX A;  1PQS A;  1JRU A;  2LXC A;  4K7S A;  3PZD A;  1V6E A;  3ZDT A;  4KDI C;  4ZYN A;  2C60 A;  4KZC A;  2WX1 A;  4IW0 A;  4AUQ C;  2M17 A;  3ONS A;  3JVZ X;  1Y8R C;  2EMT A;  4DHZ E;  4MEM A;  1M94 A;  2FCN A;  2ZPY A;  3A1Q A;  4KIK A;  5CHV C;  1F9J A;  1V49 A;  3DBR I;  4G50 A;  2JT4 B;  2IO2 B;  2ZCB A;  3KUZ A;  3IHP C;  3MJW A;  2NPT B;  3H6N A;  5TR5 A;  1J8C A;  3ZRF A;  4BFR A;  2DYB A;  3Q3F A;  4MH0 E;  2KQS A;  1G6J A;  2KDB A;  2REX A;  1WGG A;  4K1R B;  3DBS A;  4AWJ A;  1Q0W B;  1WMH B;  4EOY A;  3AXC A;  3KYC D;  4E74 A;  3L17 A;  3HIZ A;  2LRW A;  2DEN B;  2N9P C;  3R7Q A;  3RYT A;  2R2Q A;  2DZK A;  4PS3 A;  4TKN A;  3EFU A;  3KUC B;  4GDL B;  2KTR B;  1YD8 U;  2N1V A;  2KVR A;  3A9K A;  1NBF C;  4IM3 A;  3ZIM A;  1OTR B;  5C23 A;  2AWT A;  4A3O A;  4JL9 A;  2KFJ A;  2K8C A;  1P1A A;  2N7D A;  3ZKJ C;  1WF9 A;  2K39 A;  2KJ6 A;  3H1U A;  3MHS D;  3TL5 A;  4F7Z A;  3ZTC A;  1LFD A;  2GBK A;  1WX7 A;  2M0X A;  5AEK B;  1WGR A;  3ZLZ A;  2KN5 A;  2VRR B;  2XK5 B;  3KYD D;  4OVU A;  3A9J A;  3UGB B;  4BKS A;  2N4F A;  4IWO A;  3M63 B;  1WXV A;  3H7S A;  3VVW B;  4GSW A;  1UH6 A;  3DBH I;  2NPT A;  2NCN A;  1C1Y B;  3PRE A;  4RMA A;  3VAW A;  4AP4 C;  4J6I A;  4FJV B;  2B3A A;  3RUL A;  3SDL C;  5JHB A;  4OVV A;  2KC1 A;  1V80 A;  4WJQ A;  2C5L C;  2ZVO A;  2KMC A;  2KWC A;  4W9F A;  3WAO A;  1WX9 A;  1L7Y A;  2V4L A;  1NI2 A;  5AZG A;  5AZH A;  1E8W A;  3QCA A;  4I6N B;  4RM8 A;  4KV2 A;  1WGD A;  4GDL A;  1RAX A;  3ZDM C;  1ZW7 A;  2V1Y A;  2WWZ A;  3RZF A;  4WJP A;  2C9W B;  2DAJ A;  4NY0 A;  3HHM A;  3ZTD A;  1I42 A;  2MX2 A;  2WDT B;  1WZ3 A;  4CO7 A;  2KNB A;  2KFK B;  3PHW B;  2BF8 B;  3QHT A;  1Q1O A;  2MA9 B;  4CYE A;  1A5R A;  4NAW B;  5E6N A;  2XK5 A;  4MGY E;  2KLG A;  4DXA B;  1E7U A;  4KDL B;  5CHW A;  4EUT A;  3DVN V;  3I3T B;  2EKE C;  3DCG A;  3QK0 A;  3U7D A;  3V60 A;  2AL3 A;  4K7W A;  2GOW A;  1E8Y A;  2AYO B;  1EF1 A;  1OGW A;  1WR1 A;  2KDE B;  2Z0D B;  4M0W B;  4IC7 B;  5D7G A;  3VH3 B;  2HD5 B;  2KOX A;  1YQB A;  2MRP A;  3U8Z A;  2BYE A;  5HKH A;  1LM8 B;  1KOT A;  2LVO A;  3V6C B;  2BWE S;  1EUV B;  2EMS A;  3D32 A;  2M8S A;  3RUI B;  1C3T A;  1MG8 A;  4LDT B;  1UBI A;  2LUE A;  3WIM A;  5G2N A;  1XQQ A;  4WAA A;  3WAM A;  4HXD A;  2UYZ B;  3L0W B;  4A3P A;  4GXB A;  1V5T A;  3H7P B;  5IA7 A;  3R7R A;  4BOS C;  2PJH A;  2L7R A;  4GN1 A;  2LXA A;  2KX0 A;  3PPA A;  4GOC A;  2Z0E B;  1IPG A;  4URK A;  2K8B A;  3L54 A;  2MBE A;  3GOE A;  3VUX A;  2IO3 B;  2MBH A;  4NAW A;  4HJK A;  4KSK C;  4W9D A;  4AJW A;  3CF6 E;  2CS4 A;  1SGH A;  3PRM B;  1GNU A;  2FID A;  2HE7 A;  4NJ7 A;  3NZU A;  1R4M I;  4KZ0 A;  3A4R A;  2O6V A;  1UBQ A;  1UEL A;  2JF5 A;  2L0F A;  4FUL A;  4BBN C;  5LXI B;  4ASW C;  4DBG A;  5D6J B;  2KLC A;  2L8J A;  1WE7 A;  4GDK B;  2OOB B;  4WWN A;  1U4A A;  4BKG A;  2DHZ A;  5G55 A;  4MSQ B;  3ZRC A;  3QQ8 B;  3PVL A;  2LJ5 A;  1TBE A;  1L2N A;  1IP9 A;  3PRZ A;  3ZVV A;  2D11 A;  2CR5 A;  2N1W A;  2BKF A;  2KHW B;  3PSE B;  2D2Q A;  2ZCC A;  3M95 A;  2BWF A;  4KSL C;  1AAR A;  5KHO A;  4I6L B;  1I35 A;  1R4N I;  1WGY A;  2CHW A;  2MBB B;  1YX6 B;  3H7P A;  3NOB A;  4ICV A;  2N9X A;  4W9C A;  2RGF A;  4W9E A;  3VXW A;  3P2B A;  4GU2 A;  2BYV E;  2XEW A;  3UF8 A;  3IBE A;  2JXX A;  1FXT B;  5J18 A;  4GIV A;  5D94 A;  3ZO5 B;  2KK8 A;  4B6W A;  1WJN A;  2GBM A;  2KJH B;  4LJO B;  3L10 B;  4IG7 B;  2J7Q B;  4HPL B;  1D3Z A;  3ML8 A;  1K8R B;  4JQW C;  1WJ6 A;  3ZNI D;  2G45 B;  4XZ4 A;  4ANU A;  1S1Q B;  2IYD B;  1Z5S B;  3HM3 A;  3PHX B;  3ZNZ B;  2FUH B;  2RPQ A;  2ASQ A;  4HCN B;  4LJP B;  4K81 A;  2K6Q A;  2CHZ A;  3QJZ A;  5J2R A;  2JZ3 B;  2G3Q B;  3ZW3 A;  2JWZ A;  2C7H A;  4PYZ A;  3UIP B;  4JIO U;  2ZPN A;  3AI5 A;  1E7V A;  3HM6 X;  2DZI A;  1YJ1 A;  2FCS A;  2MBQ A;  1WMH A;  3OLM D;  4CHK A;  1LXD A;  4NNJ B;  2N9E B;  2L0T A;  2MSE D;  2LGY A;  3APD A;  3OAW A;  3U30 A;  1SIF A;  1XT9 B;  3SU8 X;  1KLV A;  3VH4 B;  4EEW A;  2XBB C;  1RFA A;  2KTR A;  2IY0 B;  4IWP A;  3RT3 B;  2LWP A;  1WXS A;  2NS5 A;  4P7I A;  2J0J A;  3DOW A;  5LXH A;  2MP2 B;  4BKT A;  1WX8 A;  2GMI C;  3DVG X;  2HJ8 A;  5CX3 A;  1WZ0 A;  4HWI B;  4MSM B;  1J19 A;  2CHX A;  4G0N B;  4DHJ D;  4W9J A;  2ZJD A;  2L3Z A;  2KDF B;  3A33 B;  1UD7 A;  4FLH A;  3DVG Y;  4HDO A;  2FIF A;  1GUA B;  4B9K A;  1GG3 A;  1J0G A;  2JRH A;  2FAZ A;  5IAA C;  3QWZ B;  1ISN A;  4ZRK A;  2R2O A;  2GBR A;  3QIJ A;  4ANX A;  4BKS D;  1WM3 A;  5JZE B;  4HPM B;  4W9G A;  5CHF A;  5L95 C;  3OJ4 B;  2KQ7 A;  3ALB A;  5AZF A;  2ZNV B;  3TIX A;  4MJS B;  2GBJ A;  4PS8 A;  1T0Y A;  4EZJ A;  1H8C A;  3DQV A;  2O2V B;  2RSU A;  2MBO A;  5JH5 C;  2PEA A;  3SHQ A;  1P9D U;  4MGK E;  1UZX B;  4FHJ A;  4M8N A;  4A20 A;  2J0M A;  3PT2 B;  4FA6 A;  3X0W A;  2PPH A;  3MTN B;  1GC6 A;  5CTR C;  3TBL D;  2MP2 A;  4FHK A;  3Q3J A;  2YVC A;  3PS6 A;  1H4R A;  3NHE B;  4MDK E;  3TJP A;  1WR6 E;  2K6D B;  2LGD A;  4HLE A;  3IFW B;  3N3K B;  2KO3 A;  5DPS A;  3JW0 X;  4EZK A;  3A1Q B;  4KIK B;  4XC2 A;  5C1Z A;  1SE9 A;  4DWF A;  2KFK A;  3BIN A;  4NQL B;  4PS7 A;  4GB9 A;  4BVU C;  1S3S G;  4HCP B;  2BGF A;  3QC8 B;  2NBV B;  1V81 A;  1ZGU B;  2MQJ A;  2OJR A;  2Y5B B;  1KM7 A;  3IVF A;  4MEL A;  4W9L A;  3X23 A;  1E8Z A;  1WJU A;  2KJR A;  2AL6 A;  2JY6 A;  3ENE A;  4E71 A;  1TTN A;  4II3 B;  2PE6 B;  3PGE A;  4K7U A;  1GC7 A;  2NBW B;  3V62 A;  3TMP B;  2MLB A;  3IG3 A;  2A4Z A;  5DPW A;  1WXA A;  3DDC B;  2D10 A;  5FR6 A;  4LCD E;  5J17 A;  4G11 A;  1E90 A;  3S2A A;  3UIN B;  1WJ4 A;  2HTH A;  3A9K B;  4GMV A;  4MJS A;  3SD5 A;  3VUW A;  1GJZ A;  3VTU A;  2O2V A;  4FJZ A;  1WXM A;  2JVC A;  2KKC A;  4JGH B;  2KD0 A;  4WJN A;  4FN2 A;  4DDG D;  2L00 B;  1EF5 A;  1OEY A;  3WAN A;  1YIW A;  4F8C B;  2D3G A;  3EEC A;  2A5U A;  2MW5 A;  2KDI A;  2WX0 A;  1VCB A;  3ZNG C;  2Z59 B;  2J0K A;  4NJ6 A;  1X1M A;  4ZDV A;  2ZVN A;  3UIO B;  3ZUN A;  4F1S A;  3N32 A;  3LJ3 A;  3O65 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...