4WJOA

Crystal structure of sumo1 in complex with pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjoA00
2LD9A 2KK8A 2J0KA 2JRIB 2W9NA 4AWJA 4GXBA 3Q3FA 2KMCA 1WXAA 1TZ1A 4FN2A 3VUWA 4WWPA 3VVWB 4BOSC 2PE6B 4B95A 1PQSA 3K9PB 2NPTB 3CMMB 4FADA 4KZCA 3DVGY 1SE9A 3VH4B 4IM3A 2PEAA 1WGHA 1XT9B 3QC8B 2N1VA 5DPSA 1V80A 4ANXA 4CYEA 5JH5C 5CHWA 2BKFA 4JIOU 3WA0A 1WH3A 4B6WA 3W1SA 3S2AA 4IWQA 1P98A 2REXA 2O6VA 4DBGA 1K8RB 2EMSA 3PTFC 4WJPA 4BKSD 1YQBA 4GSWA 2V1YA 4II2B 4GDLA 3ONSA 5D94A 3WAMA 4WJQA 2L76A 2MCNB 3BINA 2NBUA 1EUVB 3N3KB 3V6EB 3A9KB 3DVGX 2KKCA 1EO6A 1VCBA 4HDQA 3VTWA 3LJ3A 2GBJA 2LVPA 2KHWB 4WAAA 4IUMB 2FCNA 1WJNA 2J0JA 2K8BA 2RR9A 3H7PA 1NDDA 2KOXA 2K8CA 4GU2A 4EOYA 1U4AA 2Y5BB 4NY0A 4BOZB 5HKHA 3JYUA 3PHWB 4A3PA 3EECA 3H7SA 3KYCD 3QAQA 2LGXA 3V62A 2NPTA 2ZVNA 3OJ4B 4MJSB 4EZJA 2KJHB 2BYEA 2RSUA 1Z2MA 3H1UA 2N7DA 3JSVB 3Q3JA 3VFKA 2DYMA 3LDZE 2CKHB 3NS8A 2N4FA 1VD2A 5JHBA 2NVUI 5EDSA 1BT0A 1TBEA 1UD7A 2G45B 3N32A 4ZRIA 3A33B 1JRUA 2LWPA 1GNUA 2M1MA 4G50A 2BPSA 5DPWA 1E5WA 1QZEA 4KIKA 2MP2B 1TTNA 3PV1A 2FCMA 4WWOA 3WANA 5AZHA 2D2QA 2KMAA 2MSED 3IFWB 4MEMA 1RRBA 2LRWA 2NS5A 1J8CA 3PRMB 3A9KA 1ZKHA 3QARA 3HIZA 2ZJDA 4LDTB 4BKGA 3A1QB 4TUUA 2DAJA 2C7NB 3KUDB 2GBKA 2LGYA 5IAAC 1UGMA 5JHAA 3QA8A 2K39A 2ZPYA 1RFAA 2KLGA 3A4RA 4XC2A 1CMXB 4CO7A 2JZZA 2DZIA 4HPMB 3RULA 3TL5A 3UQAA 2MBQA 5JZEB 2UYZB 3VDZA 1YX5B 2IY1B 1X1MA 2HD5B 4MSQB 4MJSA 2KWUB 3KUCB 3VHTC 5AEKB 2JF5A 3W1YA 2WDTB 3GZNI 3HM3A 2GBNA 3R7RA 4W9LA 3SU8X 4W9JA 2DZMA 4PS7A 4DWFA 2MBOA 2K8HA 4MELA 3DPDA 5E6OA 2XBBC 3ML9A 2BGFA 1WR1A 2CHWA 4ANVA 2MX2A 2N9PC 3RT3B 2FNJB 4IW0A 3A4SC 2NBWB 2A4ZA 5D6JB 3UIOB 1UBQA 2DHZA 5LXIB 3QHTA 2CU1A 3D32A 4DHJD 3ZTCA 2MP2A 4OVVA 5LLIA 4FA6A 1UH6A 4XZ4A 4HK2A 3UIPB 1E8XA 2AL3A 4F7ZA 2YLMA 4JGHB 4HVBA 4PYZA 1UELA 1WJUA 4F8CB 1E8YA 3PHXB 2IO1B 1ISNA 3L10B 3ZDMC 4DHZE 2Z0DB 2KLCA 1C1YB 2KC1A 3H9DA 3PS6A 4G0NB 4DXAB 3A1QA 3RD2A 3ZO5B 4E3CA 3RZFA 4NQLB 2ZCBA 2D07B 2HTHA 1LM8B 2XEWA 3DBHI 3X0WA 3MTNB 3ZRFA 4ANWA 4AJYB 1MG8A 2KTRB 4NJ6A 1WX8A 1Q5WB 1KLVA 3W1SC 2WX1A 4EZKA 3PPAA 4MH0E 4FHKA 1Q0WB 1EF5A 3WIMA 4DDID 4FJYA 2WWZA 2KO3A 3C0RB 2C7MB 4HXDA 1HE8A 4EEWA 1IYFA 4FJZA 2WX0A 4ICVA 2ZNVC 1H8CA 2J0MA 1EF1A 1WE6A 1YD8U 3ALBA 4AJWA 3B0AA 2VRRB 3UF8A 2UWQA 3V61A 3H6NA 3AU5A 3DVNV 4NQKE 3ZIMA 4PS8A 1GJZA 2N7EA 4EFOA 2IYDB 5D2MB 5AZFA 4BFRA 4HLEA 2MQJA 1KOTA 3DVNU 2G4DB 4G3XB 1WE7A 1YJ1A 2Z59B 4EUTA 2I1JA 3IHPC 4WQOB 4WWNA 1WX7A 4MGZE 5G55A 4MSMB 3RUIB 2HJ8A 4BBNC 2C7HA 4KSKC 1UZXB 2MLBA 3U30A 3B1LX 2LUEA 3ZNGC 2MBEA 3P2BA 3AI5A 2LGDA 2OJRA 5CTRC 4W9IA 2NCNA 3DBSA 2KTRA 4TQ1A 4X57B 3QIJA 2GBMA 2JPHA 2KDFB 3R3MA 2C5LC 3QQ8B 3DCGA 3L13A 1WF9A 4DHZB 4W9DA 2B3AA 2V3SA 3OJ3A 3ZTDA 4AOFA 3M62B 4AUQC 4II3B 1I35A 1V5OA 4TKNA 2KWCA 3PREA 4CHKA 4GB9A 2L00B 5E6NA 1P0RA 3PSEB 1V49A 3VUYA 2CS4A 1H4RA 4I6NB 4HJKA 1KM7A 3UINB 2NR2A 3KW5B 5J17A 2L8JA 1WXVA 4BBNF 4FLHA 2DZKA 4W9GA 3PZDA 2KJRA 1E8ZA 1OGWA 2LRUA 3APFA 4ZYNA 1E7UA 4AP4C 3QWZB 3PRZA 1P3QU 2JVCA 3L54A 3VXWA 3DQVA 4F1SA 3ZW3A 4DDGD 4RMAA 4MGIE 2IY0B 3TBLD 3SHQA 5DPTA 3VAWA 2KFJA 4IM2A 2KTFA 4RM9A 3ZNZB 1IP9A 3NZUA 4JL9A 4NAWB 4GDKB 4A3OA 2BKRB 1V5TA 3NOBA 3ZNID 2ZCCA 4YL8A 2LASA 3T9LA 5C23A 4ASWC 4GGQA 1WJ4A 3PLUA 4KV2A 5GMVA 2ZVOA 5DCNA 2C9WB 1S1QB 2C60A 3JSVA 1I42A 1ZW7A 1WIAA 3PGEA 2RPQA 3APCA 3ZDTA 4KZ0A 3IG3A 3TCAA 3U7DA 1WMHB 1R4MI 2M4NA 5J18A 2KWVB 1WZ0A 2KD0A 2CHXA 2LZ6A 3L0WB 1TGZB 1WJ6A 2M17A 4NNJB 3NHEB 1GG3A 4ZRKA 3M95A 3V60A 4DK5A 2K1FA 1OEYJ 3M3JA 1NBFC 4TV3A 4M8NA 2AWTA 1KJTA 2K6DB 2L05A 4ZRJA 2O6VD 2DENB 4JLCA 3T8MA 4B9KA 4FBJB 4IG7B 3ZVVA 1WGDA 3OAWA 2HE7A 5IA7A 3AXCA 1YIWA 4DHJB 4FHJA 5CHVC 2DX5B 3JVZX 4KVGB 3PT2B 4M8MA 4ZDVA 2MBBB 3M63B 4HCNB 2JY6A 4HDOA 3QK0A 5DPRA 2MW5A 3QX1A 3VTVA 4ANUA 1WR6E 2MA9B 3B08A 2ZEQA 4GDLB 4W9FA 4LJPB 2KX0A 3KVFB 2JWZA 1Q1OA 1J0GA 3DDCB 4NAWA 3L16A 2BF8B 3CSTA 2G4SA 1WI0A 4OVUA 2JZ3B 5J2RA 2KNBA 3KUZA 1RLFA 5G2NA 2ASQA 2K6QA 2KX3A 1GUAB 2IZVB 4W9CA 3PVLA 2KQSA 3K9OB 4K7SA 2FUHB 1WMHA 2JXXA 2M0XA 1WGRA 3AULA 2FIFA 1V2YA 5BO4B 1F9JA 4KDLB 2RGFA 4LCDE 4WJOA 1UBIA 5L83A 3HK0A 3CF6E 4RM8A 3U8ZA 1FXTB 1WGYA 3ZUNA 1Z5SB 3VTUA 2MRPA 3WAOA 4EZLA 2KC2A 3VH3B 2L0TA 3EFUA 3OLMD 1WRDB 3VQIA 1WM3A 1WFYA 2O2VB 1XD3B 3KH0A 1E7VA 3RYTA 3VUXA 2R2OA 2KANA 3X23A 1ZGUB 4WJNA 4MDKE 4KIKB 3TIXA 3CSFA 1M94A 3APDA 4IWOA 3TJPA 2N9XA 3DBRI 4IWPA 2L7RA 1V9JA 2IO0B 2GOWA 1L2NA 4GN1A 1Y8RC 1V86A 2R2QA 4LJOB 2FAZA 3ZNHB 3V6CB 4J6IA 2KXJA 2KFKB 4HPLB 5KHOA 3RZWC 5D7GA 2BYFA 1RAXA 2D11A 2N1WA 1T0YA 2JRHA 3BY4B 4E71A 1GC7A 2PE9A 1V6EA 1E90A 2L3ZA 4JQWC 1A5RA 3JW0X 2K25A 4HWIB 4MGYE 3PRPB 2NBVB 4IC7B 4K7WA 2KJ6A 4MGKE 2EKEC 3ML8A 3L08A 1J19A 1WYWB 2N9EB 4HCPB 5FR6A 1WZ3A 2EMTA 3DOWA 2J7QB 4ICUA 1V81A 2IBIB 5CX3A 4K7UA 2IO3B 4BKTA 4IM0A 4BKSA 2KDEB 2KDBA 2MBHA 2XK5B 2KQ7A 2LVQA 3SD5A 2JT4B 5C1ZA 3HM6X 3R66C 4MM3A 4URKA 1C3TA 1AARA 2FCSA 1P1AA 2IO2B 2GBRA 2LXAA 2DYBA 3ECIA 3ZRCA 2LI5A 4M0WB 2O2VA 4G11A 1P9DU 2MWSB 2L0FA 1S3SG 2PPHA 1WGGA 4LDTD 3UGBB 3TMPB 3A9JB 1SGHA 2LJ5A 2KN5A 1R4NI 2PJHA 3N30A 4NPNA 1LXDA 2KVRA 2LVOA 3DBLI 3IVFA 3QCAA 3ENEA 4GMVA 2AL6A 2A5UA 3WALA 2Z0EB 2JUOA 3I3TB 2KFKA 5L95C 1OQYA 3HHMA 1WXMA 2YVCA 2AYOB 3MHSD 1YX6B 2ZPNA 4PS3A 3RCZA 2WYQA 1L7YA 1OEYA 2ZZPB 3O65B 3NZSA 4N9F4 4W9HA 2CR5A 4XX5A 3EC8A 5CHFA 4TQ0A 1WM2A 2I1KA 2CHZA 3PLVA 1WY8A 2FCQA 5E6PA 1NI2A 3GOEA 3KYDD 2BWES 2FIDA 2M8SA 1LFDA 1GC6A 4PYUA 2BYVE 3ZLZA 3R7QA 3NY5A 3IBEA 1OTRB 3UQBA 2LXCA 4FULA 2DZJA 5LXHA 3ZKJC 4GIVA 4E74A 2OOBB 1E8WA 2BWFA 2D10A 2DYOA 2KZRA 5KHQA 2G3QB 1WX9A 1IPGA 4I6PA 4EKUA 3WAPA 2XK5A 1G6JA 2GMIC 5AZGA 4BVUC 1SIFA 2QHOA 3EHVA 3AU4A 2KDIA 2O6VB 4P7IA 1D3ZA 1WXSA 4NJ7A 4KDIC 4I6LB 4W9KA 2RD0A 4KSLC 5TR5A 2DAFA 3A9JA 4W9EA 3SDLC 4A20A 4GDKA 2V4LA 2AEHA 2ZNVB 3L17A 4FJVB 3QJZA 4K81A 4GOCA 4K1RB 1XQQA 3MJWA 1LQBA 2D3GA 3H7PB
chains in the Genus database with same CATH superfamily
2KK8A 2J0KA 4AWJA 4GXBA 3Q3FA 1WXAA 3VVWB 3GS2A 4B95A 2PEAA 1XT9B 4ANXA 4CYEA 3WA0A 2J42A 3Q8FA 1SSNA 3AE3B 1JROA 3W1SA 4WWMA 2O6VA 4N6EB 4BKSD 3AV8A 3SFDB 2NBUA 3B9JA 2KKCA 1EO6A 3VTWA 2GBJA 2J0JA 2JXTA 5FR3A 1NYRA 4EOYA 2Y5BB 4NY0A 5D3DA 4BOZB 5HKHA 3PHWB 4A3PA 2K9XA 2ZVNA 4EZJA 2ICIA 2RSUA 3H1UA 3J9CA 2GI9A 4XWWA 3T3NA 3IT6B 4JWUC 5EDSA 3ABVB 1UD7A 2LWPA 2M1MA 5DPWA 1E5WA 1PGAA 4KIKA 3RPFC 3PV1A 2WXIA 3NVYA 4M02A 3HRDD 3IFWB 3A9KA 5BYRA 1ET6A 3A1QB 4KGSA 2DNFA 2GBKA 4R3DA 3QA8A 2WGSA 1RFAA 4XC2A 1MJDA 1ESFA 1YOVB 3TL5A 2MBQA 3Q6BA 2IY1B 2BQQA 2PIAA 4MJSA 4RF0A 2GLSA 4ZRQA 2WDTB 1MVKA 2V0GA 4P1CC 4MELA 3DPDA 2CHWA 2A4ZA 5D6JB 5LXIB 1AYFA 1BMLC 1UH6A 2PMVA 3PO0A 1IUEA 5FK9C 2YLMA 5HHDG 3W2DA 4HVBA 4IKGA 2QEJC 2IDYA 1KLGD 3ZDMC 5HI1A 4DXAB 3ZO5B 1DGJA 2NTTA 3GP7A 1AWDA 2HTHA 3DBHI 4ANWA 3MTNB 3ZRFA 1L0VB 4AJYB 2KTRB 3RNEC 4NJ6A 1Q5WB 3CIRB 1QOGA 3MHZA 3Q3OC 1SB3C 2LJIA 4DDID 2LHDA 5D3IB 3UI3A 3TEXA 1B1ZA 3P42A 4HXDA 3MC0B 1EF1A 3ALBA 1JWBD 4AJWA 2VRRB 2UWQA 2JU6X 4NJCA 2IYDB 4ZHOA 1SJHD 4HLEA 3TEWA 1ZPSA 3URYA 3WCQA 1N60A 2WDVB 1DYQA 2I1JA 4S0RA 1WX7A 4AS1A 4KSKC 1FNWA 3ZNGC 3P2BA 2WXGA 3AI5A 2LGDA 5CTRC 4W9IA 4PK1A 3DBSA 4X57B 2KAJA 3R3MA 2YEPB 4C7ZA 1WF9A 4W9DA 4II3B 1V5OA 4TKNA 3PREA 4GB9A 5E6NA 1P0RA 3AE2B 3N1ZC 2NR2A 2RDBC 5BMHA 2AX5A 4FLHA 4ITKA 2DZKA 1E8ZA 4AP4C 2JYEA 3VXWA 4XDDA 3TBLD 2L52A 2KFJA 1XXGA 2KTFA 4RM9A 1YQ3B 4IOIE 4JL9A 2BYTA 3NOBA 1KLUD 4YL8A 3T9LA 4GGQA 1L0YB 5GMVA 2BS3B 4US8A 1S1QB 3JSVA 1SIJA 1ZW7A 4OHJA 2RPQA 2OHFA 4KZ0A 1R4MI 2Y5CA 2KD0A 3ZJTA 2CHXA 1XF5L 4MH8A 1TGZB 1WJ6A 4S17A 1L5PA 4DK5A 4YSYB 5H92C 4TV3A 1L6VA 2K6DB 2DWQA 4YSZB 4US9A 3W5VB 2INPE 3OAWA 2HE7A 1XLQA 3JVZX 4HCNB 1FXIA 2JY6A 1C9FA 2WDQB 4ANUA 2QDFA 2Y5PA 2BBCA 3HVZA 4LJPB 4W9FA 4D2KA 1L0XB 1YN3A 1Q1OA 2JWZA 3NVWA 3DDCB 4L2YA 2I38A 3MP9A 2BB6A 2KNBA 1RLFA 4C80A 2K6QA 3KWVA 2KX3A 4ZHPA 4KX6B 5BYQA 5HFYA 2FUHB 3NVVA 1WMHA 2M0XA 2ONQA 1QQRA 1UGJA 1F9JA 4WAFA 3DWGC 3HK0A 1FXTB 3ZUNA 2MHJA 1PDXA 3BVZA 2L0TA 4P6VF 3KH0A 1WFYA 3TSSA 3VUXA 2R2OA 4WJNA 4KIKB 5AUKA 1M94A 3APDA 4IWOA 5TSSA 4NZLB 5IP4D 4CQNA 1V9JA 1Y8RC 1V86A 4LJOB 2FAZA 3V6CB 2QCZA 4HPLB 4HKZE 2BYFA 2JRHA 2WNMA 1GC7A 4BZAA 2OJWA 3JW0X 2K25A 4HWIB 2KMMA 1WRIA 4RGMA 1EM7A 1VZ7A 4WH4A 2M56B 3DOWA 2IBIB 2IO3B 4IM0A 4C4VB 1D4BA 1ZUD2 2XK5B 2LVQA 5C1ZA 2WXQA 4URKA 2LI5A 4YXDB 1FXAA 1S3SG 3O13A 2LJ5A 1R4NI 1R4MB 1LXDA 2KVRA 4FXCA 4RH6A 3ENEA 4ZYSA 3H8HA 2GRIA 1WXMA 2YVCA 2ZPNA 3RCZA 3O65B 4W9HA 1XO3A 1GB4A 1STEA 3KWLA 4JE3B 4ARCA 4B0EA 1NI2A 3GOEA 2M8SA 1GC6A 2YEPF 2WQYB 3IBEA 1OTRB 3UQBA 2VZKB 2DZJA 5LXHA 2V3NA 1E8WA 2JSVX 3AH7A 3WAPA 5AZGA 3AU4A 1WXSA 4M0WA 1NEKB 1FCCC 4I6LB 2V4IB 5EE1A 1CZPA 3OG5A 4A20A 4HJGE 5BMIA 1MI0A 4YT0B 4K1RB 1DOXA 3NUHB 4TSSA 3RI7C 4PT5A 1ROEA 2LD9A 1IGDA 4ACFA 4C00A 4O1NA 4WWPA 4BOSC 2NPTB 4M00A 4RFBA 3DVGY 1UWXA 1D5XC 3QC8B 5JH5C 3NG0A 1ZXHA 4NAMA 3SR6A 5IN7A 2Y3AA 4IWQA 3Q8BA 2L32A 4DBGA 1K8RB 2W82A 3PTFC 2W55A 2V1YA 2H88B 3ONSA 3N1XC 3WAMA 2JZPA 3BINA 3V6EB 1C79A 4DQOC 1VCBA 4HDQA 1QKZA 2LVPA 1YMHE 3LXFA 4IUMB 3H7PA 4GU2A 1FPYA 3NVZA 2PTLA 3KYCD 1F1HA 3AE9B 3ETRA 2LGXA 3V62A 2BW2A 2WXKA 3GE8C 3P4SB 2KJHB 2BYEA 3JSVB 3MJ5A 3NS8A 2CKHB 2NVUI 1R4NB 1BT0A 1TBEA 1XCTL 4WIPA 3A33B 1JRUA 1JQ4A 1GNUA 1TYGB 4G50A 1TT5B 2MP2B 3WANA 5AZHA 2D2QA 1V1PA 1OQQA 1J8CA 3PRMB 1D6EC 3QARA 4LDTB 4BKGA 1LO5D 4USAA 1FNVA 4LNNA 3KUDB 5IAAC 2KLGA 4CO7A 3Q8CA 3RULA 4HPPA 4YSXB 2FUG1 2E3TA 2HD5B 2INDC 2L1AA 1IBXA 2KWUB 2K22A 1I4PA 3W1YA 3R7RA 2GBNA 3SU8X 4W9LA 4W9JA 2MBOA 2XBBC 4ANVA 4JPSA 4WQMA 2KACA 3UIOB 4FA6A 4OVVA 3KLSX 1JALA 3MFGA 1P7FA 4F7ZA 4JGHB 1QT9A 3L10B 1ISNA 2MJDA 3SFEB 1TY0A 3PS6A 4G0NB 4E3CA 2JX5A 3RZFA 1IGCA 3R2IA 4A55A 4MH0E 1TS3A 2PVOD 1Q0WB 1ZP0B 3WIMA 2IPKD 3EUB2 4A9AA 4FJYA 2WWZA 3C0RB 3VR9B 2C7MB 4EEWA 1IYFA 2WX0A 2J0MA 1WE6A 3DVNV 4NQKE 3ZIMA 5HG2A 4PS8A 2N7EA 5D2MB 1WXQA 5AZFA 1HZ6A 4G3XB 2Z59B 3IHPC 5G55A 3RUIB 2HJ8A 4BBNC 5T8IA 3U30A 3C8YA 2LUEA 2OJRA 1HA5A 1N6ZA 3R8BA 4TMAB 1T5XD 4TQ1A 3QIJA 2JPHA 3NRZA 3DCGA 3L13A 4DHZB 1GOZA 3M62B 4C56C 2KWCA 2I2YA 3BZDB 2CS4A 4A90A 1CJEA 3N20C 4BBNF 2MJEA 3PZDA 4W9GA 2KJRA 3APFA 2LRUA 3QWZB 2LFIA 3L54A 4A6QA 3ZW3A 1ZDXA 5GXGB 4XDCA 4RMAA 1FFVA 1HTQA 3SHQA 5DPTA 3VAWA 4IM2A 4RGNA 3NZUA 1GB1A 2WXMA 1V5TA 4JWSC 2ZCCA 2LASA 1QOAA 3PZ7A 1DOIA 4ASWC 3Q8EA 1ZE3D 2ZVOA 2RDHA 3TCAA 2M4NA 3N1YC 5J18A 2VZKD 2KWVB 2LZ6A 1HEZE 1KTKA 4ZRKA 3M95A 3V60A 4REZA 2K1FA 2QMTA 2N0SB 4FBJB 4IG7B 3ZVVA 1WSPA 2N9KA 4QAYA 1YIWA 4DHJB 4ZDVA 4M8MA 2MBBB 1F52A 1I4RA 3RNCC 3VTVA 1WR6E 2MA9B 1C4PA 1TS2A 1JCKB 3KVFB 3V05A 4NAWA 1N61A 2WXLA 3L16A 1N5XA 3CSTA 4OVUA 5J2RA 2ASQA 1GUAB 2IZVB 4K7SA 1AN8A 1WGRA 3AEAB 1V2YA 5BO4B 3P1MA 3FC4A 4WJOA 3P63A 1UBIA 1ZOYB 1WGYA 3VTUA 2MRPA 2KC2A 3VH3B 3EFUA 1E7VA 2INNE 3X23A 4MDKE 3VRBB 3TIXA 2RMMA 3AEFB 2N9XA 4YTNB 3AE1B 1L2NA 2WP9B 1V1PB 5G5GA 2R2QA 4UDUC 1MFWA 3TEYA 3AM9A 1QOFA 1FD6A 3RZWC 1RAXA 2N1WA 2FBWB 4P16A 1I4QA 2L3ZA 1T3QA 3RNAC 4MGYE 2NBVB 1K52A 1WYWB 1WZ3A 1RM6C 1RYJA 2VH2A 1J7CA 2B76B 2KDEB 2MBHA 2KQ7A 2KVZA 3HM6X 4MM3A 2GBRA 2DYBA 3ZJVA 2O2VA 1P9DU 4HROA 2PPHA 4LDTD 3UGBB 2KYWA 1SGHA 2KN5A 2PJHA 3N30A 3QCAA 3DBLI 4GMVA 1HTOA 2KFKA 5L95C 3V3XA 3MHSD 2JQRB 2L83A 2ZZPB 3FILA 4XX5A 4N9F4 4A8XC 4TQ0A 2CR5A 3PLVA 2FCQA 3KYDD 1LFDA 2BYVE 3R7QA 1XLOA 1JWAD 2LXCA 3OWEB 1I4HA 4GIVA 2OOBB 2BWFA 2D10A 1IPGA 3EGRA 4EKUA 1NI3A 2GMIC 4BVUC 2QHOA 1M4VA 3EHVA 2KDIA 2O6VB 1N63A 3FAHA 4OZCA 1XCQL 1WYGA 3A9JA 3SDLC 1MHXA 4GDKA 3L17A 1J7BA 4GOCA 3U2SC 4JX1C 1VRAB 2JRIB 2W9NA 5E6JA 4FN2A 3P4QB 1PQSA 3K9PB 3CMMB 4KZCA 1P7EA 1V1OA 4LNFA 2N1VA 4JIOU 1WH3A 4B6WA 2QSDA 3E56A 1P98A 2QILA 2REXA 3DHHC 1FO4A 1NENB 4II2B 4WJQA 3AEGB 2L76A 3A9KB 4GLSC 1TS4A 4RGTA 4N58A 2N9LA 3RNGC 2CJNA 1E9MA 1KH0A 2KHWB 1VJKA 3JYUA 1I7HA 2KN4A 4HKQA 1SF0A 4MJSB 1Z2MA 2N7DA 2DYMA 2XNAC 3LDZE 2N4FA 1SE2A 2LGIA 2ZW0A 2G45B 3N32A 4ZRIA 3DBLB 2BPSA 1QZEA 1Q10A 4RCOA 2FCMA 1K50A 1YJJA 5C3JB 4WWOA 1Y56A 2KMAA 2MSED 1RRBA 2LRWA 1JW9D 2PLPA 3HIZA 4MT5A 2BT6A 4DXGA 3B2FA 4TUUA 2DAJA 2Q5WD 2WDRB 3AE5B 3TUOA 2C7NB 1YN4A 2LGYA 1TKGA 1UGMA 1C76A 5C2TB 1UWMA 3SEBA 3UQAA 1C4AA 5JZEB 2UYZB 1YX5B 3DHGC 1X1MA 4MSQB 3KUCB 3VHTC 1MPEA 3GZNI 3HM3A 2DZMA 1I4XA 4DWFA 5E6OA 3P4RB 2FE8A 1WR1A 2LGSA 4YTMB 2N9PC 3RT3B 3I63C 3VRAB 3D32A 4DHJD 5LLIA 3EFCA 4LLGM 4XZ4A 1FMAD 4HK2A 3UIPB 5BYSA 2AL3A 1HQRD 1TS5A 4PYZA 1E8YA 3PHXB 4DHZE 2KLCA 5JXVA 3A1QA 1VZ8A 4NQLB 2ZCBA 2XEWA 4HEA1 3X0WA 4YTPB 1MG8A 4BAXA 1PYWD 2JYTA 2K0PA 1WX8A 3W1SC 2WX1A 2VH1A 1ZDVA 3RMKC 1HE8A 2ACZB 4ICVA 1H8CA 1SEBD 1YD8U 2N7JA 3UF8A 3AU5A 2INCC 4ARIA 1GJZA 3BK2A 4EFOA 4BFRA 2MQJA 2MH7A 1KOTA 3PZ8A 3DVNU 4EUTA 1WE7A 1YJIA 1V8CA 4WQOB 4MGZE 4MSMB 2C7HA 1UZXB 2MLBA 3B1LX 2MBEA 2NCNA 2KTRA 2KDFB 3QQ8B 1FRDA 2B3AA 4AOFA 4AUQC 2J4XA 1T6BX 2L00B 3AEEB 3UINB 2IJ0A 3NJTA 4ZYNA 3FKYA 4DXFA 4DDGD 2EKIA 4MACA 4MGIE 1A70A 3GZNB 4GDKB 2BKRB 1ZXIA 2CU3A 5C23A 3Q14C 4KV2A 3PLUA 2W54A 1FM0D 2C60A 1I42A 5EE3A 3PGEA 3APCA 3IG3A 1L4DB 1WMHB 1WZ0A 4EE2A 4NNJB 3NHEB 1GG3A 1SJED 1OEYJ 3M3JA 1FFUA 2AWTA 4ZRJA 2O6VD 1N62A 4B9KA 2MEKA 1QF6A 3Q2AC 3IT4B 5CHVC 2DX5B 4KVGB 3PT2B 3BK1A 3M63B 3L4PA 5IO9A 2MW5A 3QX1A 1DOYA 1VLBA 1BUIC 2KX0A 1FNUA 1J0GA 1TKYA 3E9SA 3NS1A 2H89B 4XGAB 2WXJA 2BF8B 2G4SA 1WI0A 1CQVA 2SAKA 2JZ3B 5IOIA 5G2NA 4XE0A 1ACCA 4OVZA 1E7PB 4W9CA 3PVLA 1QLBB 1FEHA 4OZAA 2KQSA 1EWCA 2UU7A 3AULA 1T0SC 1TY2A 4KDLB 1FIQA 2RGFA 2K3UA 2D3AA 3AEDB 5BMGA 3BIID 4RM8A 2PW9A 1PUTA 1Z5SB 1E6EB 3AMZA 3WAOA 4EZLA 3OLMD 3BVGA 1WM3A 1JMLA 3ZJUA 1XD3B 2D5GA 2KANA 1ZGUB 2D3BA 3CSFA 2BS2B 3TJPA 3DBRI 4IWPA 2L7RA 2SEBD 2WLBA 3ZNHB 2DLBA 1V97A 1ENFA 2D11A 2GB1A 1T0YA 3BY4B 1E90A 3NZ3A 4JQWC 3ZGZA 1A5RA 3RN9C 2KT7A 3ZYYX 4LK0M 4K7WA 2KJ6A 4MGKE 2N9EB 4HCPB 5FR6A 2M0AA 2CJOA 5CX3A 3ZXVA 4KKIA 4BKSA 1AW7A 3SD5A 3W9CB 2D3CA 2JT4B 3R66C 1C3TA 2WHIA 2IO2B 1K53A 4ZOHC 3ECIA 3ZRCA 4M0WB 4G11A 2MWSB 4H2AA 1WGGA 1D5MC 1JRPA 2ON8A 1GAQB 3IVFA 1FCLA 2AL6A 3WALA 3I3TB 1PFDA 4RGOS 1OQYA 1WWTA 2K5PA 2X8XX 2AYOB 1YX6B 3TEZA 4PS3A 2WYQA 1L7YA 3NZSA 1B9RA 3EC8A 5CHFA 2CHZA 2I1KA 3W5UB 1WY8A 5E6PA 2BWES 4PYUA 1F2RI 1I4GA 1OFFA 1BXTA 4E74A 5KHQA 2KZRA 5IKCM 2G3QB 4C4VA 1G6JA 2XK5A 4KGRA 2IGDA 2WS3B 3Q3MC 1D3ZA 4NJ7A 2DAFA 2RDGA 4W9EA 2V4LA 2AEHA 2ZNVB 2WXHA 2BS4B 4FJVB 2AQ1B 4K81A 4YWGG 1XQQA 3MJWA 4M01A 4OZBA 2D3GA 1MG4A 3H7PB 2WXRA 2KMCA 2KQ4X 1TZ1A 3VUWA 2RPVA 2PE6B 1UUPA 4FADA 1EU3A 1SE9A 3VH4B 4IM3A 1WGHA 3N9YC 4XYCA 1SE3A 3AE4B 3DBRB 5DPSA 1V80A 5CHWA 2BKFA 3AE6B 2KWDA 2AQ2B 2G9HD 1SE4A 3R2TA 3S2AA 3I57A 2QIEB 2EMSA 4WJPA 1YQBA 4GSWA 4GDLA 5D94A 2MCNB 3AECB 2JWUA 1SBBB 1EUVB 3N3KB 4XWTA 3DVGX 2QJLA 2KDMA 3VR8B 3U7ZA 3LJ3A 1HZ5A 4WAAA 2FCNA 1WJNA 2K8BA 2RR9A 4AQ7A 1NDDA 2KOXA 2K8CA 3IXSA 1U4AA 3EECA 3H7SA 1VZ6A 2M19A 5H8YE 3QAQA 1IBXB 2NPTA 3OJ4B 3BWUD 2WU5B 3Q3JA 3VFKA 1NVID 1KRHA 1VD2A 5JHBA 1FRRA 2WXOA 1TTNA 4ZRPA 4P1BC 4MEMA 2NS5A 2X38A 1XLPA 1ZKHA 2ZJDA 4LTUA 5JHAA 3T3OA 2K39A 2ZPYA 3A4RA 1CMXB 2HDEA 2JZZA 2DZIA 4HPMB 2J53A 2R61A 3Q8AA 1L4ZB 1N5WA 3VDZA 1D5ZC 2Z8LA 1YN5A 4K3CA 5AEKB 2JF5A 3RNFC 4PS7A 2IGHA 1F0ZA 2K8HA 3ML9A 2BGFA 2MX2A 2FNJB 4IW0A 3A4SC 2NBWB 1UBQA 2DHZA 3QHTA 2CU1A 3ZTCA 2MP2A 1E8XA 1UELA 1WJUA 3DBHB 4F8CB 2IO1B 3IAS1 2Z0DB 3AE7B 1C1YB 4LNOA 2KC1A 4L23A 3H9DA 3RD2A 2D07B 4L1BA 1LM8B 4RF1A 2XN9C 1KLVA 2QC8A 4EZKA 3PPAA 4FHKA 2AQ3B 1R7SA 1EF5A 2KO3A 1VR9A 3AEBB 3Q69A 1E0ZA 4FJZA 2ZNVC 1JWSD 5LNK1 2NTSA 3B0AA 1KF6B 1E10A 3V61A 3H6NA 3HVDA 5AUIA 3RNBC 1XLNA 1RFKA 2G4DB 1YJ1A 1TIFA 2WU2B 3I5JC 4WWNA 2BTEA 3RFZB 1ET9A 2GBMA 2E6XA 2C5LC 3C19A 3IAM1 3OJ3A 2V3SA 3ZTDA 1I35A 3GB1A 1C77A 1QILA 3U52E 4CHKA 3LB8C 1MHHE 3PSEB 1V49A 3VUYA 1H4RA 4I6NB 4HJKA 1KM7A 3KW5B 5J17A 2L8JA 3B2GA 1WXVA 3U4EG 2HTME 1OGWA 2W3RA 1E7UA 3PRZA 1P3QU 2JVCA 2LUMA 1RWSA 3DQVA 4F1SA 4HRSA 3LYYA 3CWIA 2PVGC 3I9V1 3P4PB 2IY0B 4C7YA 1NYQA 4WURA 3ZNZB 2MJ3A 1IP9A 4NAWB 3BYYB 4A3OA 3ZNID 5I4DA 1PGXA 1WJ4A 2IGGA 5DCNA 2C9WB 1WIAA 3DWMA 3ZDTA 2LHEA 3U7DA 2LMCA 4IDIA 1EWYC 3MC9A 3L0WB 2M17A 1F2RC 3BYTB 1J7AA 2V3PA 1NBFC 4M8NA 1KJTA 2L05A 2NMQA 2DENB 4JLCA 3T8MA 3KQ4A 5IA7A 1WGDA 3AXCA 4FHJA 4HDOA 2ZW1A 1TZOA 3QK0A 5DPRA 2WXFA 4KGTA 1K51A 3B08A 4N59A 2ZEQA 4GDLB 5FKAC 2G1EA 1TJEA 4Q2JA 3AE8B 3BVMA 3KUZA 5G5HA 2HJ1A 1JWMD 3HUIA 3K9OB 5MPOA 4B0MA 2JXXA 2V9HA 2FIFA 4LCDE 3ZQ4A 5L83A 1WGKA 2W3SA 3CF6E 3U8ZA 1UNSA 3AB5A 2PKOA 4MM3B 1WRDB 3VQIA 2O2VB 1OQRA 4LNKA 3RYTA 2LEKA 4OW0A 3EA6A 2IO0B 2GOWA 2WXNA 4GN1A 2WXPA 4J6IA 2KXJA 2KFKB 5KHOA 5D7GA 2BB5A 3GE3C 1SXTA 1CK1A 1JWUD 4E71A 2PE9A 1V6EA 3FILB 1UF0A 1GPXA 3PRPB 4IC7B 2EKEC 3ML8A 3L08A 1J19A 1L6UA 2EMTA 5EE0A 2J7QB 4ICUA 1V81A 4K7UA 1LGRA 1XEEA 4BKTA 2KDBA 1YQ4B 1AARA 2FCSA 1P1AA 1YNTE 4LNIA 2LXAA 2L0FA 3ZXRA 5EE9A 3TMPB 3A9JB 4NPNA 2LVOA 2A5UA 2Z0EB 2BVCA 2JUOA 1PGBA 3HHMA 1HXYD 1EU4A 2DBYA 1OEYA 1TKEA 1WM2A 1T0RC 2EELA 2FIDA 4K3BA 3MC8A 3ZLZA 2J52A 3NY5A 3Q3NC 4FULA 3ZKJC 1T0QC 2DYOA 1WX9A 4I6PA 2OEDA 1C4CA 1SIFA 4P7IA 4KKJA 4RNAA 1KFYB 4KDIC 4W9KA 2RD0A 4KSLC 1F77A 5TR5A 1QOBA 3AN1A 2TSSA 1C78A 3DHIC 3QJZA 1VDVA 1LQBA 4J3OD
chains in the Genus database with same CATH topology
2LD9A 2KK8A 2J0KA 2JRIB 2W9NA 4AWJA 4GXBA 3Q3FA 2KMCA 1WXAA 1TZ1A 4FN2A 3VUWA 4WWPA 3VVWB 4BOSC 2PE6B 4B95A 1PQSA 3K9PB 2NPTB 3CMMB 4FADA 4KZCA 3DVGY 1SE9A 3VH4B 4IM3A 2PEAA 1WGHA 1XT9B 3QC8B 2N1VA 5DPSA 1V80A 4ANXA 4CYEA 5JH5C 5CHWA 2BKFA 4JIOU 3WA0A 1WH3A 4B6WA 3W1SA 3S2AA 4IWQA 1P98A 2REXA 2O6VA 4DBGA 1K8RB 2EMSA 3PTFC 4WJPA 4BKSD 1YQBA 4GSWA 2V1YA 4II2B 4GDLA 3ONSA 5D94A 3WAMA 4WJQA 2L76A 2MCNB 3BINA 2NBUA 1EUVB 3N3KB 3V6EB 3A9KB 3DVGX 2KKCA 1EO6A 1VCBA 4HDQA 3VTWA 3LJ3A 2GBJA 2LVPA 2KHWB 4WAAA 4IUMB 2FCNA 1WJNA 2J0JA 2K8BA 2RR9A 3H7PA 1NDDA 2KOXA 2K8CA 4GU2A 4EOYA 1U4AA 2Y5BB 4NY0A 4BOZB 5HKHA 3JYUA 3PHWB 4A3PA 3EECA 3H7SA 3KYCD 3QAQA 2LGXA 3V62A 2NPTA 2ZVNA 3OJ4B 4MJSB 4EZJA 2KJHB 2BYEA 2RSUA 1Z2MA 3H1UA 2N7DA 3JSVB 3Q3JA 3VFKA 2DYMA 3LDZE 2CKHB 3NS8A 2N4FA 1VD2A 5JHBA 2NVUI 5EDSA 1BT0A 1TBEA 1UD7A 2G45B 3N32A 4ZRIA 3A33B 1JRUA 2LWPA 1GNUA 2M1MA 4G50A 2BPSA 5DPWA 1E5WA 1QZEA 4KIKA 2MP2B 1TTNA 3PV1A 2FCMA 4WWOA 3WANA 5AZHA 2D2QA 2KMAA 2MSED 3IFWB 4MEMA 1RRBA 2LRWA 2NS5A 1J8CA 3PRMB 3A9KA 1ZKHA 3QARA 3HIZA 2ZJDA 4LDTB 4BKGA 3A1QB 4TUUA 2DAJA 2C7NB 3KUDB 2GBKA 2LGYA 5IAAC 1UGMA 5JHAA 3QA8A 2K39A 2ZPYA 1RFAA 2KLGA 3A4RA 4XC2A 1CMXB 4CO7A 2JZZA 2DZIA 4HPMB 3RULA 3TL5A 3UQAA 2MBQA 5JZEB 2UYZB 3VDZA 1YX5B 2IY1B 1X1MA 2HD5B 4MSQB 4MJSA 2KWUB 3KUCB 3VHTC 5AEKB 2JF5A 3W1YA 2WDTB 3GZNI 3HM3A 2GBNA 3R7RA 4W9LA 3SU8X 4W9JA 2DZMA 4PS7A 4DWFA 2MBOA 2K8HA 4MELA 3DPDA 5E6OA 2XBBC 3ML9A 2BGFA 1WR1A 2CHWA 4ANVA 2MX2A 2N9PC 3RT3B 2FNJB 4IW0A 3A4SC 2NBWB 2A4ZA 5D6JB 3UIOB 1UBQA 2DHZA 5LXIB 3QHTA 2CU1A 3D32A 4DHJD 3ZTCA 2MP2A 4OVVA 5LLIA 4FA6A 1UH6A 4XZ4A 4HK2A 3UIPB 1E8XA 2AL3A 4F7ZA 2YLMA 4JGHB 4HVBA 4PYZA 1UELA 1WJUA 4F8CB 1E8YA 3PHXB 2IO1B 1ISNA 3L10B 3ZDMC 4DHZE 2Z0DB 2KLCA 1C1YB 2KC1A 3H9DA 3PS6A 4G0NB 4DXAB 3A1QA 3RD2A 3ZO5B 4E3CA 3RZFA 4NQLB 2ZCBA 2D07B 2HTHA 1LM8B 2XEWA 3DBHI 3X0WA 3MTNB 3ZRFA 4ANWA 4AJYB 1MG8A 2KTRB 4NJ6A 1WX8A 1Q5WB 1KLVA 3W1SC 2WX1A 4EZKA 3PPAA 4MH0E 4FHKA 1Q0WB 1EF5A 3WIMA 4DDID 4FJYA 2WWZA 2KO3A 3C0RB 2C7MB 4HXDA 1HE8A 4EEWA 1IYFA 4FJZA 2WX0A 4ICVA 2ZNVC 1H8CA 2J0MA 1EF1A 1WE6A 1YD8U 3ALBA 4AJWA 3B0AA 2VRRB 3UF8A 2UWQA 3V61A 3H6NA 3AU5A 3DVNV 4NQKE 3ZIMA 4PS8A 1GJZA 2N7EA 4EFOA 2IYDB 5D2MB 5AZFA 4BFRA 4HLEA 2MQJA 1KOTA 3DVNU 2G4DB 4G3XB 1WE7A 1YJ1A 2Z59B 4EUTA 2I1JA 3IHPC 4WQOB 4WWNA 1WX7A 4MGZE 5G55A 4MSMB 3RUIB 2HJ8A 4BBNC 2C7HA 4KSKC 1UZXB 2MLBA 3U30A 3B1LX 2LUEA 3ZNGC 2MBEA 3P2BA 3AI5A 2LGDA 2OJRA 5CTRC 4W9IA 2NCNA 3DBSA 2KTRA 4TQ1A 4X57B 3QIJA 2GBMA 2JPHA 2KDFB 3R3MA 2C5LC 3QQ8B 3DCGA 3L13A 1WF9A 4DHZB 4W9DA 2B3AA 2V3SA 3OJ3A 3ZTDA 4AOFA 3M62B 4AUQC 4II3B 1I35A 1V5OA 4TKNA 2KWCA 3PREA 4CHKA 4GB9A 2L00B 5E6NA 1P0RA 3PSEB 1V49A 3VUYA 2CS4A 1H4RA 4I6NB 4HJKA 1KM7A 3UINB 2NR2A 3KW5B 5J17A 2L8JA 1WXVA 4BBNF 4FLHA 2DZKA 4W9GA 3PZDA 2KJRA 1E8ZA 1OGWA 2LRUA 3APFA 4ZYNA 1E7UA 4AP4C 3QWZB 3PRZA 1P3QU 2JVCA 3L54A 3VXWA 3DQVA 4F1SA 3ZW3A 4DDGD 4RMAA 4MGIE 2IY0B 3TBLD 3SHQA 5DPTA 3VAWA 2KFJA 4IM2A 2KTFA 4RM9A 3ZNZB 1IP9A 3NZUA 4JL9A 4NAWB 4GDKB 4A3OA 2BKRB 1V5TA 3NOBA 3ZNID 2ZCCA 4YL8A 2LASA 3T9LA 5C23A 4ASWC 4GGQA 1WJ4A 3PLUA 4KV2A 5GMVA 2ZVOA 5DCNA 2C9WB 1S1QB 2C60A 3JSVA 1I42A 1ZW7A 1WIAA 3PGEA 2RPQA 3APCA 3ZDTA 4KZ0A 3IG3A 3TCAA 3U7DA 1WMHB 1R4MI 2M4NA 5J18A 2KWVB 1WZ0A 2KD0A 2CHXA 2LZ6A 3L0WB 1TGZB 1WJ6A 2M17A 4NNJB 3NHEB 1GG3A 4ZRKA 3M95A 3V60A 4DK5A 2K1FA 1OEYJ 3M3JA 1NBFC 4TV3A 4M8NA 2AWTA 1KJTA 2K6DB 2L05A 4ZRJA 2O6VD 2DENB 4JLCA 3T8MA 4B9KA 4FBJB 4IG7B 3ZVVA 1WGDA 3OAWA 2HE7A 5IA7A 3AXCA 1YIWA 4DHJB 4FHJA 5CHVC 2DX5B 3JVZX 4KVGB 3PT2B 4M8MA 4ZDVA 2MBBB 3M63B 4HCNB 2JY6A 4HDOA 3QK0A 5DPRA 2MW5A 3QX1A 3VTVA 4ANUA 1WR6E 2MA9B 3B08A 2ZEQA 4GDLB 4W9FA 4LJPB 2KX0A 3KVFB 2JWZA 1Q1OA 1J0GA 3DDCB 4NAWA 3L16A 2BF8B 3CSTA 2G4SA 1WI0A 4OVUA 2JZ3B 5J2RA 2KNBA 3KUZA 1RLFA 5G2NA 2ASQA 2K6QA 2KX3A 1GUAB 2IZVB 4W9CA 3PVLA 2KQSA 3K9OB 4K7SA 2FUHB 1WMHA 2JXXA 2M0XA 1WGRA 3AULA 2FIFA 1V2YA 5BO4B 1F9JA 4KDLB 2RGFA 4LCDE 4WJOA 1UBIA 5L83A 3HK0A 3CF6E 4RM8A 3U8ZA 1FXTB 1WGYA 3ZUNA 1Z5SB 3VTUA 2MRPA 3WAOA 4EZLA 2KC2A 3VH3B 2L0TA 3EFUA 3OLMD 1WRDB 3VQIA 1WM3A 1WFYA 2O2VB 1XD3B 3KH0A 1E7VA 3RYTA 3VUXA 2R2OA 2KANA 3X23A 1ZGUB 4WJNA 4MDKE 4KIKB 3TIXA 3CSFA 1M94A 3APDA 4IWOA 3TJPA 2N9XA 3DBRI 4IWPA 2L7RA 1V9JA 2IO0B 2GOWA 1L2NA 4GN1A 1Y8RC 1V86A 2R2QA 4LJOB 2FAZA 3ZNHB 3V6CB 4J6IA 2KXJA 2KFKB 4HPLB 5KHOA 3RZWC 5D7GA 2BYFA 1RAXA 2D11A 2N1WA 1T0YA 2JRHA 3BY4B 4E71A 1GC7A 2PE9A 1V6EA 1E90A 2L3ZA 4JQWC 1A5RA 3JW0X 2K25A 4HWIB 4MGYE 3PRPB 2NBVB 4IC7B 4K7WA 2KJ6A 4MGKE 2EKEC 3ML8A 3L08A 1J19A 1WYWB 2N9EB 4HCPB 5FR6A 1WZ3A 2EMTA 3DOWA 2J7QB 4ICUA 1V81A 2IBIB 5CX3A 4K7UA 2IO3B 4BKTA 4IM0A 4BKSA 2KDEB 2KDBA 2MBHA 2XK5B 2KQ7A 2LVQA 3SD5A 2JT4B 5C1ZA 3HM6X 3R66C 4MM3A 4URKA 1C3TA 1AARA 2FCSA 1P1AA 2IO2B 2GBRA 2LXAA 2DYBA 3ECIA 3ZRCA 2LI5A 4M0WB 2O2VA 4G11A 1P9DU 2MWSB 2L0FA 1S3SG 2PPHA 1WGGA 4LDTD 3UGBB 3TMPB 3A9JB 1SGHA 2LJ5A 2KN5A 1R4NI 2PJHA 3N30A 4NPNA 1LXDA 2KVRA 2LVOA 3DBLI 3IVFA 3QCAA 3ENEA 4GMVA 2AL6A 2A5UA 3WALA 2Z0EB 2JUOA 3I3TB 2KFKA 5L95C 1OQYA 3HHMA 1WXMA 2YVCA 2AYOB 3MHSD 1YX6B 2ZPNA 4PS3A 3RCZA 2WYQA 1L7YA 1OEYA 2ZZPB 3O65B 3NZSA 4N9F4 4W9HA 2CR5A 4XX5A 3EC8A 5CHFA 4TQ0A 1WM2A 2I1KA 2CHZA 3PLVA 1WY8A 2FCQA 5E6PA 1NI2A 3GOEA 3KYDD 2BWES 2FIDA 2M8SA 1LFDA 1GC6A 4PYUA 2BYVE 3ZLZA 3R7QA 3NY5A 3IBEA 1OTRB 3UQBA 2LXCA 4FULA 2DZJA 5LXHA 3ZKJC 4GIVA 4E74A 2OOBB 1E8WA 2BWFA 2D10A 2DYOA 2KZRA 5KHQA 2G3QB 1WX9A 1IPGA 4I6PA 4EKUA 3WAPA 2XK5A 1G6JA 2GMIC 5AZGA 4BVUC 1SIFA 2QHOA 3EHVA 3AU4A 2KDIA 2O6VB 4P7IA 1D3ZA 1WXSA 4NJ7A 4KDIC 4I6LB 4W9KA 2RD0A 4KSLC 5TR5A 2DAFA 3A9JA 4W9EA 3SDLC 4A20A 4GDKA 2V4LA 2AEHA 2ZNVB 3L17A 4FJVB 3QJZA 4K81A 4GOCA 4K1RB 1XQQA 3MJWA 1LQBA 2D3GA 3H7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD9 A;  2KK8 A;  2J0K A;  2JRI B;  2W9N A;  4AWJ A;  4GXB A;  3Q3F A;  2KMC A;  1WXA A;  1TZ1 A;  4FN2 A;  3VUW A;  4WWP A;  3VVW B;  4BOS C;  2PE6 B;  4B95 A;  1PQS A;  3K9P B;  2NPT B;  3CMM B;  4FAD A;  4KZC A;  3DVG Y;  1SE9 A;  3VH4 B;  4IM3 A;  2PEA A;  1WGH A;  1XT9 B;  3QC8 B;  2N1V A;  5DPS A;  1V80 A;  4ANX A;  4CYE A;  5JH5 C;  5CHW A;  2BKF A;  4JIO U;  3WA0 A;  1WH3 A;  4B6W A;  3W1S A;  3S2A A;  4IWQ A;  1P98 A;  2REX A;  2O6V A;  4DBG A;  1K8R B;  2EMS A;  3PTF C;  4WJP A;  4BKS D;  1YQB A;  4GSW A;  2V1Y A;  4II2 B;  4GDL A;  3ONS A;  5D94 A;  3WAM A;  4WJQ A;  2L76 A;  2MCN B;  3BIN A;  2NBU A;  1EUV B;  3N3K B;  3V6E B;  3A9K B;  3DVG X;  2KKC A;  1EO6 A;  1VCB A;  4HDQ A;  3VTW A;  3LJ3 A;  2GBJ A;  2LVP A;  2KHW B;  4WAA A;  4IUM B;  2FCN A;  1WJN A;  2J0J A;  2K8B A;  2RR9 A;  3H7P A;  1NDD A;  2KOX A;  2K8C A;  4GU2 A;  4EOY A;  1U4A A;  2Y5B B;  4NY0 A;  4BOZ B;  5HKH A;  3JYU A;  3PHW B;  4A3P A;  3EEC A;  3H7S A;  3KYC D;  3QAQ A;  2LGX A;  3V62 A;  2NPT A;  2ZVN A;  3OJ4 B;  4MJS B;  4EZJ A;  2KJH B;  2BYE A;  2RSU A;  1Z2M A;  3H1U A;  2N7D A;  3JSV B;  3Q3J A;  3VFK A;  2DYM A;  3LDZ E;  2CKH B;  3NS8 A;  2N4F A;  1VD2 A;  5JHB A;  2NVU I;  5EDS A;  1BT0 A;  1TBE A;  1UD7 A;  2G45 B;  3N32 A;  4ZRI A;  3A33 B;  1JRU A;  2LWP A;  1GNU A;  2M1M A;  4G50 A;  2BPS A;  5DPW A;  1E5W A;  1QZE A;  4KIK A;  2MP2 B;  1TTN A;  3PV1 A;  2FCM A;  4WWO A;  3WAN A;  5AZH A;  2D2Q A;  2KMA A;  2MSE D;  3IFW B;  4MEM A;  1RRB A;  2LRW A;  2NS5 A;  1J8C A;  3PRM B;  3A9K A;  1ZKH A;  3QAR A;  3HIZ A;  2ZJD A;  4LDT B;  4BKG A;  3A1Q B;  4TUU A;  2DAJ A;  2C7N B;  3KUD B;  2GBK A;  2LGY A;  5IAA C;  1UGM A;  5JHA A;  3QA8 A;  2K39 A;  2ZPY A;  1RFA A;  2KLG A;  3A4R A;  4XC2 A;  1CMX B;  4CO7 A;  2JZZ A;  2DZI A;  4HPM B;  3RUL A;  3TL5 A;  3UQA A;  2MBQ A;  5JZE B;  2UYZ B;  3VDZ A;  1YX5 B;  2IY1 B;  1X1M A;  2HD5 B;  4MSQ B;  4MJS A;  2KWU B;  3KUC B;  3VHT C;  5AEK B;  2JF5 A;  3W1Y A;  2WDT B;  3GZN I;  3HM3 A;  2GBN A;  3R7R A;  4W9L A;  3SU8 X;  4W9J A;  2DZM A;  4PS7 A;  4DWF A;  2MBO A;  2K8H A;  4MEL A;  3DPD A;  5E6O A;  2XBB C;  3ML9 A;  2BGF A;  1WR1 A;  2CHW A;  4ANV A;  2MX2 A;  2N9P C;  3RT3 B;  2FNJ B;  4IW0 A;  3A4S C;  2NBW B;  2A4Z A;  5D6J B;  3UIO B;  1UBQ A;  2DHZ A;  5LXI B;  3QHT A;  2CU1 A;  3D32 A;  4DHJ D;  3ZTC A;  2MP2 A;  4OVV A;  5LLI A;  4FA6 A;  1UH6 A;  4XZ4 A;  4HK2 A;  3UIP B;  1E8X A;  2AL3 A;  4F7Z A;  2YLM A;  4JGH B;  4HVB A;  4PYZ A;  1UEL A;  1WJU A;  4F8C B;  1E8Y A;  3PHX B;  2IO1 B;  1ISN A;  3L10 B;  3ZDM C;  4DHZ E;  2Z0D B;  2KLC A;  1C1Y B;  2KC1 A;  3H9D A;  3PS6 A;  4G0N B;  4DXA B;  3A1Q A;  3RD2 A;  3ZO5 B;  4E3C A;  3RZF A;  4NQL B;  2ZCB A;  2D07 B;  2HTH A;  1LM8 B;  2XEW A;  3DBH I;  3X0W A;  3MTN B;  3ZRF A;  4ANW A;  4AJY B;  1MG8 A;  2KTR B;  4NJ6 A;  1WX8 A;  1Q5W B;  1KLV A;  3W1S C;  2WX1 A;  4EZK A;  3PPA A;  4MH0 E;  4FHK A;  1Q0W B;  1EF5 A;  3WIM A;  4DDI D;  4FJY A;  2WWZ A;  2KO3 A;  3C0R B;  2C7M B;  4HXD A;  1HE8 A;  4EEW A;  1IYF A;  4FJZ A;  2WX0 A;  4ICV A;  2ZNV C;  1H8C A;  2J0M A;  1EF1 A;  1WE6 A;  1YD8 U;  3ALB A;  4AJW A;  3B0A A;  2VRR B;  3UF8 A;  2UWQ A;  3V61 A;  3H6N A;  3AU5 A;  3DVN V;  4NQK E;  3ZIM A;  4PS8 A;  1GJZ A;  2N7E A;  4EFO A;  2IYD B;  5D2M B;  5AZF A;  4BFR A;  4HLE A;  2MQJ A;  1KOT A;  3DVN U;  2G4D B;  4G3X B;  1WE7 A;  1YJ1 A;  2Z59 B;  4EUT A;  2I1J A;  3IHP C;  4WQO B;  4WWN A;  1WX7 A;  4MGZ E;  5G55 A;  4MSM B;  3RUI B;  2HJ8 A;  4BBN C;  2C7H A;  4KSK C;  1UZX B;  2MLB A;  3U30 A;  3B1L X;  2LUE A;  3ZNG C;  2MBE A;  3P2B A;  3AI5 A;  2LGD A;  2OJR A;  5CTR C;  4W9I A;  2NCN A;  3DBS A;  2KTR A;  4TQ1 A;  4X57 B;  3QIJ A;  2GBM A;  2JPH A;  2KDF B;  3R3M A;  2C5L C;  3QQ8 B;  3DCG A;  3L13 A;  1WF9 A;  4DHZ B;  4W9D A;  2B3A A;  2V3S A;  3OJ3 A;  3ZTD A;  4AOF A;  3M62 B;  4AUQ C;  4II3 B;  1I35 A;  1V5O A;  4TKN A;  2KWC A;  3PRE A;  4CHK A;  4GB9 A;  2L00 B;  5E6N A;  1P0R A;  3PSE B;  1V49 A;  3VUY A;  2CS4 A;  1H4R A;  4I6N B;  4HJK A;  1KM7 A;  3UIN B;  2NR2 A;  3KW5 B;  5J17 A;  2L8J A;  1WXV A;  4BBN F;  4FLH A;  2DZK A;  4W9G A;  3PZD A;  2KJR A;  1E8Z A;  1OGW A;  2LRU A;  3APF A;  4ZYN A;  1E7U A;  4AP4 C;  3QWZ B;  3PRZ A;  1P3Q U;  2JVC A;  3L54 A;  3VXW A;  3DQV A;  4F1S A;  3ZW3 A;  4DDG D;  4RMA A;  4MGI E;  2IY0 B;  3TBL D;  3SHQ A;  5DPT A;  3VAW A;  2KFJ A;  4IM2 A;  2KTF A;  4RM9 A;  3ZNZ B;  1IP9 A;  3NZU A;  4JL9 A;  4NAW B;  4GDK B;  4A3O A;  2BKR B;  1V5T A;  3NOB A;  3ZNI D;  2ZCC A;  4YL8 A;  2LAS A;  3T9L A;  5C23 A;  4ASW C;  4GGQ A;  1WJ4 A;  3PLU A;  4KV2 A;  5GMV A;  2ZVO A;  5DCN A;  2C9W B;  1S1Q B;  2C60 A;  3JSV A;  1I42 A;  1ZW7 A;  1WIA A;  3PGE A;  2RPQ A;  3APC A;  3ZDT A;  4KZ0 A;  3IG3 A;  3TCA A;  3U7D A;  1WMH B;  1R4M I;  2M4N A;  5J18 A;  2KWV B;  1WZ0 A;  2KD0 A;  2CHX A;  2LZ6 A;  3L0W B;  1TGZ B;  1WJ6 A;  2M17 A;  4NNJ B;  3NHE B;  1GG3 A;  4ZRK A;  3M95 A;  3V60 A;  4DK5 A;  2K1F A;  1OEY J;  3M3J A;  1NBF C;  4TV3 A;  4M8N A;  2AWT A;  1KJT A;  2K6D B;  2L05 A;  4ZRJ A;  2O6V D;  2DEN B;  4JLC A;  3T8M A;  4B9K A;  4FBJ B;  4IG7 B;  3ZVV A;  1WGD A;  3OAW A;  2HE7 A;  5IA7 A;  3AXC A;  1YIW A;  4DHJ B;  4FHJ A;  5CHV C;  2DX5 B;  3JVZ X;  4KVG B;  3PT2 B;  4M8M A;  4ZDV A;  2MBB B;  3M63 B;  4HCN B;  2JY6 A;  4HDO A;  3QK0 A;  5DPR A;  2MW5 A;  3QX1 A;  3VTV A;  4ANU A;  1WR6 E;  2MA9 B;  3B08 A;  2ZEQ A;  4GDL B;  4W9F A;  4LJP B;  2KX0 A;  3KVF B;  2JWZ A;  1Q1O A;  1J0G A;  3DDC B;  4NAW A;  3L16 A;  2BF8 B;  3CST A;  2G4S A;  1WI0 A;  4OVU A;  2JZ3 B;  5J2R A;  2KNB A;  3KUZ A;  1RLF A;  5G2N A;  2ASQ A;  2K6Q A;  2KX3 A;  1GUA B;  2IZV B;  4W9C A;  3PVL A;  2KQS A;  3K9O B;  4K7S A;  2FUH B;  1WMH A;  2JXX A;  2M0X A;  1WGR A;  3AUL A;  2FIF A;  1V2Y A;  5BO4 B;  1F9J A;  4KDL B;  2RGF A;  4LCD E;  4WJO A;  1UBI A;  5L83 A;  3HK0 A;  3CF6 E;  4RM8 A;  3U8Z A;  1FXT B;  1WGY A;  3ZUN A;  1Z5S B;  3VTU A;  2MRP A;  3WAO A;  4EZL A;  2KC2 A;  3VH3 B;  2L0T A;  3EFU A;  3OLM D;  1WRD B;  3VQI A;  1WM3 A;  1WFY A;  2O2V B;  1XD3 B;  3KH0 A;  1E7V A;  3RYT A;  3VUX A;  2R2O A;  2KAN A;  3X23 A;  1ZGU B;  4WJN A;  4MDK E;  4KIK B;  3TIX A;  3CSF A;  1M94 A;  3APD A;  4IWO A;  3TJP A;  2N9X A;  3DBR I;  4IWP A;  2L7R A;  1V9J A;  2IO0 B;  2GOW A;  1L2N A;  4GN1 A;  1Y8R C;  1V86 A;  2R2Q A;  4LJO B;  2FAZ A;  3ZNH B;  3V6C B;  4J6I A;  2KXJ A;  2KFK B;  4HPL B;  5KHO A;  3RZW C;  5D7G A;  2BYF A;  1RAX A;  2D11 A;  2N1W A;  1T0Y A;  2JRH A;  3BY4 B;  4E71 A;  1GC7 A;  2PE9 A;  1V6E A;  1E90 A;  2L3Z A;  4JQW C;  1A5R A;  3JW0 X;  2K25 A;  4HWI B;  4MGY E;  3PRP B;  2NBV B;  4IC7 B;  4K7W A;  2KJ6 A;  4MGK E;  2EKE C;  3ML8 A;  3L08 A;  1J19 A;  1WYW B;  2N9E B;  4HCP B;  5FR6 A;  1WZ3 A;  2EMT A;  3DOW A;  2J7Q B;  4ICU A;  1V81 A;  2IBI B;  5CX3 A;  4K7U A;  2IO3 B;  4BKT A;  4IM0 A;  4BKS A;  2KDE B;  2KDB A;  2MBH A;  2XK5 B;  2KQ7 A;  2LVQ A;  3SD5 A;  2JT4 B;  5C1Z A;  3HM6 X;  3R66 C;  4MM3 A;  4URK A;  1C3T A;  1AAR A;  2FCS A;  1P1A A;  2IO2 B;  2GBR A;  2LXA A;  2DYB A;  3ECI A;  3ZRC A;  2LI5 A;  4M0W B;  2O2V A;  4G11 A;  1P9D U;  2MWS B;  2L0F A;  1S3S G;  2PPH A;  1WGG A;  4LDT D;  3UGB B;  3TMP B;  3A9J B;  1SGH A;  2LJ5 A;  2KN5 A;  1R4N I;  2PJH A;  3N30 A;  4NPN A;  1LXD A;  2KVR A;  2LVO A;  3DBL I;  3IVF A;  3QCA A;  3ENE A;  4GMV A;  2AL6 A;  2A5U A;  3WAL A;  2Z0E B;  2JUO A;  3I3T B;  2KFK A;  5L95 C;  1OQY A;  3HHM A;  1WXM A;  2YVC A;  2AYO B;  3MHS D;  1YX6 B;  2ZPN A;  4PS3 A;  3RCZ A;  2WYQ A;  1L7Y A;  1OEY A;  2ZZP B;  3O65 B;  3NZS A;  4N9F 4;  4W9H A;  2CR5 A;  4XX5 A;  3EC8 A;  5CHF A;  4TQ0 A;  1WM2 A;  2I1K A;  2CHZ A;  3PLV A;  1WY8 A;  2FCQ A;  5E6P A;  1NI2 A;  3GOE A;  3KYD D;  2BWE S;  2FID A;  2M8S A;  1LFD A;  1GC6 A;  4PYU A;  2BYV E;  3ZLZ A;  3R7Q A;  3NY5 A;  3IBE A;  1OTR B;  3UQB A;  2LXC A;  4FUL A;  2DZJ A;  5LXH A;  3ZKJ C;  4GIV A;  4E74 A;  2OOB B;  1E8W A;  2BWF A;  2D10 A;  2DYO A;  2KZR A;  5KHQ A;  2G3Q B;  1WX9 A;  1IPG A;  4I6P A;  4EKU A;  3WAP A;  2XK5 A;  1G6J A;  2GMI C;  5AZG A;  4BVU C;  1SIF A;  2QHO A;  3EHV A;  3AU4 A;  2KDI A;  2O6V B;  4P7I A;  1D3Z A;  1WXS A;  4NJ7 A;  4KDI C;  4I6L B;  4W9K A;  2RD0 A;  4KSL C;  5TR5 A;  2DAF A;  3A9J A;  4W9E A;  3SDL C;  4A20 A;  4GDK A;  2V4L A;  2AEH A;  2ZNV B;  3L17 A;  4FJV B;  3QJZ A;  4K81 A;  4GOC A;  4K1R B;  1XQQ A;  3MJW A;  1LQB A;  2D3G A;  3H7P B; 
#chains in the Genus database with same CATH topology
 2KK8 A;  2J0K A;  4AWJ A;  4GXB A;  3Q3F A;  1WXA A;  3VVW B;  3GS2 A;  4B95 A;  2PEA A;  1XT9 B;  4ANX A;  4CYE A;  3WA0 A;  2J42 A;  3Q8F A;  1SSN A;  3AE3 B;  1JRO A;  3W1S A;  4WWM A;  2O6V A;  4N6E B;  4BKS D;  3AV8 A;  3SFD B;  2NBU A;  3B9J A;  2KKC A;  1EO6 A;  3VTW A;  2GBJ A;  2J0J A;  2JXT A;  5FR3 A;  1NYR A;  4EOY A;  2Y5B B;  4NY0 A;  5D3D A;  4BOZ B;  5HKH A;  3PHW B;  4A3P A;  2K9X A;  2ZVN A;  4EZJ A;  2ICI A;  2RSU A;  3H1U A;  3J9C A;  2GI9 A;  4XWW A;  3T3N A;  3IT6 B;  4JWU C;  5EDS A;  3ABV B;  1UD7 A;  2LWP A;  2M1M A;  5DPW A;  1E5W A;  1PGA A;  4KIK A;  3RPF C;  3PV1 A;  2WXI A;  3NVY A;  4M02 A;  3HRD D;  3IFW B;  3A9K A;  5BYR A;  1ET6 A;  3A1Q B;  4KGS A;  2DNF A;  2GBK A;  4R3D A;  3QA8 A;  2WGS A;  1RFA A;  4XC2 A;  1MJD A;  1ESF A;  1YOV B;  3TL5 A;  2MBQ A;  3Q6B A;  2IY1 B;  2BQQ A;  2PIA A;  4MJS A;  4RF0 A;  2GLS A;  4ZRQ A;  2WDT B;  1MVK A;  2V0G A;  4P1C C;  4MEL A;  3DPD A;  2CHW A;  2A4Z A;  5D6J B;  5LXI B;  1AYF A;  1BML C;  1UH6 A;  2PMV A;  3PO0 A;  1IUE A;  5FK9 C;  2YLM A;  5HHD G;  3W2D A;  4HVB A;  4IKG A;  2QEJ C;  2IDY A;  1KLG D;  3ZDM C;  5HI1 A;  4DXA B;  3ZO5 B;  1DGJ A;  2NTT A;  3GP7 A;  1AWD A;  2HTH A;  3DBH I;  4ANW A;  3MTN B;  3ZRF A;  1L0V B;  4AJY B;  2KTR B;  3RNE C;  4NJ6 A;  1Q5W B;  3CIR B;  1QOG A;  3MHZ A;  3Q3O C;  1SB3 C;  2LJI A;  4DDI D;  2LHD A;  5D3I B;  3UI3 A;  3TEX A;  1B1Z A;  3P42 A;  4HXD A;  3MC0 B;  1EF1 A;  3ALB A;  1JWB D;  4AJW A;  2VRR B;  2UWQ A;  2JU6 X;  4NJC A;  2IYD B;  4ZHO A;  1SJH D;  4HLE A;  3TEW A;  1ZPS A;  3URY A;  3WCQ A;  1N60 A;  2WDV B;  1DYQ A;  2I1J A;  4S0R A;  1WX7 A;  4AS1 A;  4KSK C;  1FNW A;  3ZNG C;  3P2B A;  2WXG A;  3AI5 A;  2LGD A;  5CTR C;  4W9I A;  4PK1 A;  3DBS A;  4X57 B;  2KAJ A;  3R3M A;  2YEP B;  4C7Z A;  1WF9 A;  4W9D A;  4II3 B;  1V5O A;  4TKN A;  3PRE A;  4GB9 A;  5E6N A;  1P0R A;  3AE2 B;  3N1Z C;  2NR2 A;  2RDB C;  5BMH A;  2AX5 A;  4FLH A;  4ITK A;  2DZK A;  1E8Z A;  4AP4 C;  2JYE A;  3VXW A;  4XDD A;  3TBL D;  2L52 A;  2KFJ A;  1XXG A;  2KTF A;  4RM9 A;  1YQ3 B;  4IOI E;  4JL9 A;  2BYT A;  3NOB A;  1KLU D;  4YL8 A;  3T9L A;  4GGQ A;  1L0Y B;  5GMV A;  2BS3 B;  4US8 A;  1S1Q B;  3JSV A;  1SIJ A;  1ZW7 A;  4OHJ A;  2RPQ A;  2OHF A;  4KZ0 A;  1R4M I;  2Y5C A;  2KD0 A;  3ZJT A;  2CHX A;  1XF5 L;  4MH8 A;  1TGZ B;  1WJ6 A;  4S17 A;  1L5P A;  4DK5 A;  4YSY B;  5H92 C;  4TV3 A;  1L6V A;  2K6D B;  2DWQ A;  4YSZ B;  4US9 A;  3W5V B;  2INP E;  3OAW A;  2HE7 A;  1XLQ A;  3JVZ X;  4HCN B;  1FXI A;  2JY6 A;  1C9F A;  2WDQ B;  4ANU A;  2QDF A;  2Y5P A;  2BBC A;  3HVZ A;  4LJP B;  4W9F A;  4D2K A;  1L0X B;  1YN3 A;  1Q1O A;  2JWZ A;  3NVW A;  3DDC B;  4L2Y A;  2I38 A;  3MP9 A;  2BB6 A;  2KNB A;  1RLF A;  4C80 A;  2K6Q A;  3KWV A;  2KX3 A;  4ZHP A;  4KX6 B;  5BYQ A;  5HFY A;  2FUH B;  3NVV A;  1WMH A;  2M0X A;  2ONQ A;  1QQR A;  1UGJ A;  1F9J A;  4WAF A;  3DWG C;  3HK0 A;  1FXT B;  3ZUN A;  2MHJ A;  1PDX A;  3BVZ A;  2L0T A;  4P6V F;  3KH0 A;  1WFY A;  3TSS A;  3VUX A;  2R2O A;  4WJN A;  4KIK B;  5AUK A;  1M94 A;  3APD A;  4IWO A;  5TSS A;  4NZL B;  5IP4 D;  4CQN A;  1V9J A;  1Y8R C;  1V86 A;  4LJO B;  2FAZ A;  3V6C B;  2QCZ A;  4HPL B;  4HKZ E;  2BYF A;  2JRH A;  2WNM A;  1GC7 A;  4BZA A;  2OJW A;  3JW0 X;  2K25 A;  4HWI B;  2KMM A;  1WRI A;  4RGM A;  1EM7 A;  1VZ7 A;  4WH4 A;  2M56 B;  3DOW A;  2IBI B;  2IO3 B;  4IM0 A;  4C4V B;  1D4B A;  1ZUD 2;  2XK5 B;  2LVQ A;  5C1Z A;  2WXQ A;  4URK A;  2LI5 A;  4YXD B;  1FXA A;  1S3S G;  3O13 A;  2LJ5 A;  1R4N I;  1R4M B;  1LXD A;  2KVR A;  4FXC A;  4RH6 A;  3ENE A;  4ZYS A;  3H8H A;  2GRI A;  1WXM A;  2YVC A;  2ZPN A;  3RCZ A;  3O65 B;  4W9H A;  1XO3 A;  1GB4 A;  1STE A;  3KWL A;  4JE3 B;  4ARC A;  4B0E A;  1NI2 A;  3GOE A;  2M8S A;  1GC6 A;  2YEP F;  2WQY B;  3IBE A;  1OTR B;  3UQB A;  2VZK B;  2DZJ A;  5LXH A;  2V3N A;  1E8W A;  2JSV X;  3AH7 A;  3WAP A;  5AZG A;  3AU4 A;  1WXS A;  4M0W A;  1NEK B;  1FCC C;  4I6L B;  2V4I B;  5EE1 A;  1CZP A;  3OG5 A;  4A20 A;  4HJG E;  5BMI A;  1MI0 A;  4YT0 B;  4K1R B;  1DOX A;  3NUH B;  4TSS A;  3RI7 C;  4PT5 A;  1ROE A;  2LD9 A;  1IGD A;  4ACF A;  4C00 A;  4O1N A;  4WWP A;  4BOS C;  2NPT B;  4M00 A;  4RFB A;  3DVG Y;  1UWX A;  1D5X C;  3QC8 B;  5JH5 C;  3NG0 A;  1ZXH A;  4NAM A;  3SR6 A;  5IN7 A;  2Y3A A;  4IWQ A;  3Q8B A;  2L32 A;  4DBG A;  1K8R B;  2W82 A;  3PTF C;  2W55 A;  2V1Y A;  2H88 B;  3ONS A;  3N1X C;  3WAM A;  2JZP A;  3BIN A;  3V6E B;  1C79 A;  4DQO C;  1VCB A;  4HDQ A;  1QKZ A;  2LVP A;  1YMH E;  3LXF A;  4IUM B;  3H7P A;  4GU2 A;  1FPY A;  3NVZ A;  2PTL A;  3KYC D;  1F1H A;  3AE9 B;  3ETR A;  2LGX A;  3V62 A;  2BW2 A;  2WXK A;  3GE8 C;  3P4S B;  2KJH B;  2BYE A;  3JSV B;  3MJ5 A;  3NS8 A;  2CKH B;  2NVU I;  1R4N B;  1BT0 A;  1TBE A;  1XCT L;  4WIP A;  3A33 B;  1JRU A;  1JQ4 A;  1GNU A;  1TYG B;  4G50 A;  1TT5 B;  2MP2 B;  3WAN A;  5AZH A;  2D2Q A;  1V1P A;  1OQQ A;  1J8C A;  3PRM B;  1D6E C;  3QAR A;  4LDT B;  4BKG A;  1LO5 D;  4USA A;  1FNV A;  4LNN A;  3KUD B;  5IAA C;  2KLG A;  4CO7 A;  3Q8C A;  3RUL A;  4HPP A;  4YSX B;  2FUG 1;  2E3T A;  2HD5 B;  2IND C;  2L1A A;  1IBX A;  2KWU B;  2K22 A;  1I4P A;  3W1Y A;  3R7R A;  2GBN A;  3SU8 X;  4W9L A;  4W9J A;  2MBO A;  2XBB C;  4ANV A;  4JPS A;  4WQM A;  2KAC A;  3UIO B;  4FA6 A;  4OVV A;  3KLS X;  1JAL A;  3MFG A;  1P7F A;  4F7Z A;  4JGH B;  1QT9 A;  3L10 B;  1ISN A;  2MJD A;  3SFE B;  1TY0 A;  3PS6 A;  4G0N B;  4E3C A;  2JX5 A;  3RZF A;  1IGC A;  3R2I A;  4A55 A;  4MH0 E;  1TS3 A;  2PVO D;  1Q0W B;  1ZP0 B;  3WIM A;  2IPK D;  3EUB 2;  4A9A A;  4FJY A;  2WWZ A;  3C0R B;  3VR9 B;  2C7M B;  4EEW A;  1IYF A;  2WX0 A;  2J0M A;  1WE6 A;  3DVN V;  4NQK E;  3ZIM A;  5HG2 A;  4PS8 A;  2N7E A;  5D2M B;  1WXQ A;  5AZF A;  1HZ6 A;  4G3X B;  2Z59 B;  3IHP C;  5G55 A;  3RUI B;  2HJ8 A;  4BBN C;  5T8I A;  3U30 A;  3C8Y A;  2LUE A;  2OJR A;  1HA5 A;  1N6Z A;  3R8B A;  4TMA B;  1T5X D;  4TQ1 A;  3QIJ A;  2JPH A;  3NRZ A;  3DCG A;  3L13 A;  4DHZ B;  1GOZ A;  3M62 B;  4C56 C;  2KWC A;  2I2Y A;  3BZD B;  2CS4 A;  4A90 A;  1CJE A;  3N20 C;  4BBN F;  2MJE A;  3PZD A;  4W9G A;  2KJR A;  3APF A;  2LRU A;  3QWZ B;  2LFI A;  3L54 A;  4A6Q A;  3ZW3 A;  1ZDX A;  5GXG B;  4XDC A;  4RMA A;  1FFV A;  1HTQ A;  3SHQ A;  5DPT A;  3VAW A;  4IM2 A;  4RGN A;  3NZU A;  1GB1 A;  2WXM A;  1V5T A;  4JWS C;  2ZCC A;  2LAS A;  1QOA A;  3PZ7 A;  1DOI A;  4ASW C;  3Q8E A;  1ZE3 D;  2ZVO A;  2RDH A;  3TCA A;  2M4N A;  3N1Y C;  5J18 A;  2VZK D;  2KWV B;  2LZ6 A;  1HEZ E;  1KTK A;  4ZRK A;  3M95 A;  3V60 A;  4REZ A;  2K1F A;  2QMT A;  2N0S B;  4FBJ B;  4IG7 B;  3ZVV A;  1WSP A;  2N9K A;  4QAY A;  1YIW A;  4DHJ B;  4ZDV A;  4M8M A;  2MBB B;  1F52 A;  1I4R A;  3RNC C;  3VTV A;  1WR6 E;  2MA9 B;  1C4P A;  1TS2 A;  1JCK B;  3KVF B;  3V05 A;  4NAW A;  1N61 A;  2WXL A;  3L16 A;  1N5X A;  3CST A;  4OVU A;  5J2R A;  2ASQ A;  1GUA B;  2IZV B;  4K7S A;  1AN8 A;  1WGR A;  3AEA B;  1V2Y A;  5BO4 B;  3P1M A;  3FC4 A;  4WJO A;  3P63 A;  1UBI A;  1ZOY B;  1WGY A;  3VTU A;  2MRP A;  2KC2 A;  3VH3 B;  3EFU A;  1E7V A;  2INN E;  3X23 A;  4MDK E;  3VRB B;  3TIX A;  2RMM A;  3AEF B;  2N9X A;  4YTN B;  3AE1 B;  1L2N A;  2WP9 B;  1V1P B;  5G5G A;  2R2Q A;  4UDU C;  1MFW A;  3TEY A;  3AM9 A;  1QOF A;  1FD6 A;  3RZW C;  1RAX A;  2N1W A;  2FBW B;  4P16 A;  1I4Q A;  2L3Z A;  1T3Q A;  3RNA C;  4MGY E;  2NBV B;  1K52 A;  1WYW B;  1WZ3 A;  1RM6 C;  1RYJ A;  2VH2 A;  1J7C A;  2B76 B;  2KDE B;  2MBH A;  2KQ7 A;  2KVZ A;  3HM6 X;  4MM3 A;  2GBR A;  2DYB A;  3ZJV A;  2O2V A;  1P9D U;  4HRO A;  2PPH A;  4LDT D;  3UGB B;  2KYW A;  1SGH A;  2KN5 A;  2PJH A;  3N30 A;  3QCA A;  3DBL I;  4GMV A;  1HTO A;  2KFK A;  5L95 C;  3V3X A;  3MHS D;  2JQR B;  2L83 A;  2ZZP B;  3FIL A;  4XX5 A;  4N9F 4;  4A8X C;  4TQ0 A;  2CR5 A;  3PLV A;  2FCQ A;  3KYD D;  1LFD A;  2BYV E;  3R7Q A;  1XLO A;  1JWA D;  2LXC A;  3OWE B;  1I4H A;  4GIV A;  2OOB B;  2BWF A;  2D10 A;  1IPG A;  3EGR A;  4EKU A;  1NI3 A;  2GMI C;  4BVU C;  2QHO A;  1M4V A;  3EHV A;  2KDI A;  2O6V B;  1N63 A;  3FAH A;  4OZC A;  1XCQ L;  1WYG A;  3A9J A;  3SDL C;  1MHX A;  4GDK A;  3L17 A;  1J7B A;  4GOC A;  3U2S C;  4JX1 C;  1VRA B;  2JRI B;  2W9N A;  5E6J A;  4FN2 A;  3P4Q B;  1PQS A;  3K9P B;  3CMM B;  4KZC A;  1P7E A;  1V1O A;  4LNF A;  2N1V A;  4JIO U;  1WH3 A;  4B6W A;  2QSD A;  3E56 A;  1P98 A;  2QIL A;  2REX A;  3DHH C;  1FO4 A;  1NEN B;  4II2 B;  4WJQ A;  3AEG B;  2L76 A;  3A9K B;  4GLS C;  1TS4 A;  4RGT A;  4N58 A;  2N9L A;  3RNG C;  2CJN A;  1E9M A;  1KH0 A;  2KHW B;  1VJK A;  3JYU A;  1I7H A;  2KN4 A;  4HKQ A;  1SF0 A;  4MJS B;  1Z2M A;  2N7D A;  2DYM A;  2XNA C;  3LDZ E;  2N4F A;  1SE2 A;  2LGI A;  2ZW0 A;  2G45 B;  3N32 A;  4ZRI A;  3DBL B;  2BPS A;  1QZE A;  1Q10 A;  4RCO A;  2FCM A;  1K50 A;  1YJJ A;  5C3J B;  4WWO A;  1Y56 A;  2KMA A;  2MSE D;  1RRB A;  2LRW A;  1JW9 D;  2PLP A;  3HIZ A;  4MT5 A;  2BT6 A;  4DXG A;  3B2F A;  4TUU A;  2DAJ A;  2Q5W D;  2WDR B;  3AE5 B;  3TUO A;  2C7N B;  1YN4 A;  2LGY A;  1TKG A;  1UGM A;  1C76 A;  5C2T B;  1UWM A;  3SEB A;  3UQA A;  1C4A A;  5JZE B;  2UYZ B;  1YX5 B;  3DHG C;  1X1M A;  4MSQ B;  3KUC B;  3VHT C;  1MPE A;  3GZN I;  3HM3 A;  2DZM A;  1I4X A;  4DWF A;  5E6O A;  3P4R B;  2FE8 A;  1WR1 A;  2LGS A;  4YTM B;  2N9P C;  3RT3 B;  3I63 C;  3VRA B;  3D32 A;  4DHJ D;  5LLI A;  3EFC A;  4LLG M;  4XZ4 A;  1FMA D;  4HK2 A;  3UIP B;  5BYS A;  2AL3 A;  1HQR D;  1TS5 A;  4PYZ A;  1E8Y A;  3PHX B;  4DHZ E;  2KLC A;  5JXV A;  3A1Q A;  1VZ8 A;  4NQL B;  2ZCB A;  2XEW A;  4HEA 1;  3X0W A;  4YTP B;  1MG8 A;  4BAX A;  1PYW D;  2JYT A;  2K0P A;  1WX8 A;  3W1S C;  2WX1 A;  2VH1 A;  1ZDV A;  3RMK C;  1HE8 A;  2ACZ B;  4ICV A;  1H8C A;  1SEB D;  1YD8 U;  2N7J A;  3UF8 A;  3AU5 A;  2INC C;  4ARI A;  1GJZ A;  3BK2 A;  4EFO A;  4BFR A;  2MQJ A;  2MH7 A;  1KOT A;  3PZ8 A;  3DVN U;  4EUT A;  1WE7 A;  1YJI A;  1V8C A;  4WQO B;  4MGZ E;  4MSM B;  2C7H A;  1UZX B;  2MLB A;  3B1L X;  2MBE A;  2NCN A;  2KTR A;  2KDF B;  3QQ8 B;  1FRD A;  2B3A A;  4AOF A;  4AUQ C;  2J4X A;  1T6B X;  2L00 B;  3AEE B;  3UIN B;  2IJ0 A;  3NJT A;  4ZYN A;  3FKY A;  4DXF A;  4DDG D;  2EKI A;  4MAC A;  4MGI E;  1A70 A;  3GZN B;  4GDK B;  2BKR B;  1ZXI A;  2CU3 A;  5C23 A;  3Q14 C;  4KV2 A;  3PLU A;  2W54 A;  1FM0 D;  2C60 A;  1I42 A;  5EE3 A;  3PGE A;  3APC A;  3IG3 A;  1L4D B;  1WMH B;  1WZ0 A;  4EE2 A;  4NNJ B;  3NHE B;  1GG3 A;  1SJE D;  1OEY J;  3M3J A;  1FFU A;  2AWT A;  4ZRJ A;  2O6V D;  1N62 A;  4B9K A;  2MEK A;  1QF6 A;  3Q2A C;  3IT4 B;  5CHV C;  2DX5 B;  4KVG B;  3PT2 B;  3BK1 A;  3M63 B;  3L4P A;  5IO9 A;  2MW5 A;  3QX1 A;  1DOY A;  1VLB A;  1BUI C;  2KX0 A;  1FNU A;  1J0G A;  1TKY A;  3E9S A;  3NS1 A;  2H89 B;  4XGA B;  2WXJ A;  2BF8 B;  2G4S A;  1WI0 A;  1CQV A;  2SAK A;  2JZ3 B;  5IOI A;  5G2N A;  4XE0 A;  1ACC A;  4OVZ A;  1E7P B;  4W9C A;  3PVL A;  1QLB B;  1FEH A;  4OZA A;  2KQS A;  1EWC A;  2UU7 A;  3AUL A;  1T0S C;  1TY2 A;  4KDL B;  1FIQ A;  2RGF A;  2K3U A;  2D3A A;  3AED B;  5BMG A;  3BII D;  4RM8 A;  2PW9 A;  1PUT A;  1Z5S B;  1E6E B;  3AMZ A;  3WAO A;  4EZL A;  3OLM D;  3BVG A;  1WM3 A;  1JML A;  3ZJU A;  1XD3 B;  2D5G A;  2KAN A;  1ZGU B;  2D3B A;  3CSF A;  2BS2 B;  3TJP A;  3DBR I;  4IWP A;  2L7R A;  2SEB D;  2WLB A;  3ZNH B;  2DLB A;  1V97 A;  1ENF A;  2D11 A;  2GB1 A;  1T0Y A;  3BY4 B;  1E90 A;  3NZ3 A;  4JQW C;  3ZGZ A;  1A5R A;  3RN9 C;  2KT7 A;  3ZYY X;  4LK0 M;  4K7W A;  2KJ6 A;  4MGK E;  2N9E B;  4HCP B;  5FR6 A;  2M0A A;  2CJO A;  5CX3 A;  3ZXV A;  4KKI A;  4BKS A;  1AW7 A;  3SD5 A;  3W9C B;  2D3C A;  2JT4 B;  3R66 C;  1C3T A;  2WHI A;  2IO2 B;  1K53 A;  4ZOH C;  3ECI A;  3ZRC A;  4M0W B;  4G11 A;  2MWS B;  4H2A A;  1WGG A;  1D5M C;  1JRP A;  2ON8 A;  1GAQ B;  3IVF A;  1FCL A;  2AL6 A;  3WAL A;  3I3T B;  1PFD A;  4RGO S;  1OQY A;  1WWT A;  2K5P A;  2X8X X;  2AYO B;  1YX6 B;  3TEZ A;  4PS3 A;  2WYQ A;  1L7Y A;  3NZS A;  1B9R A;  3EC8 A;  5CHF A;  2CHZ A;  2I1K A;  3W5U B;  1WY8 A;  5E6P A;  2BWE S;  4PYU A;  1F2R I;  1I4G A;  1OFF A;  1BXT A;  4E74 A;  5KHQ A;  2KZR A;  5IKC M;  2G3Q B;  4C4V A;  1G6J A;  2XK5 A;  4KGR A;  2IGD A;  2WS3 B;  3Q3M C;  1D3Z A;  4NJ7 A;  2DAF A;  2RDG A;  4W9E A;  2V4L A;  2AEH A;  2ZNV B;  2WXH A;  2BS4 B;  4FJV B;  2AQ1 B;  4K81 A;  4YWG G;  1XQQ A;  3MJW A;  4M01 A;  4OZB A;  2D3G A;  1MG4 A;  3H7P B;  2WXR A;  2KMC A;  2KQ4 X;  1TZ1 A;  3VUW A;  2RPV A;  2PE6 B;  1UUP A;  4FAD A;  1EU3 A;  1SE9 A;  3VH4 B;  4IM3 A;  1WGH A;  3N9Y C;  4XYC A;  1SE3 A;  3AE4 B;  3DBR B;  5DPS A;  1V80 A;  5CHW A;  2BKF A;  3AE6 B;  2KWD A;  2AQ2 B;  2G9H D;  1SE4 A;  3R2T A;  3S2A A;  3I57 A;  2QIE B;  2EMS A;  4WJP A;  1YQB A;  4GSW A;  4GDL A;  5D94 A;  2MCN B;  3AEC B;  2JWU A;  1SBB B;  1EUV B;  3N3K B;  4XWT A;  3DVG X;  2QJL A;  2KDM A;  3VR8 B;  3U7Z A;  3LJ3 A;  1HZ5 A;  4WAA A;  2FCN A;  1WJN A;  2K8B A;  2RR9 A;  4AQ7 A;  1NDD A;  2KOX A;  2K8C A;  3IXS A;  1U4A A;  3EEC A;  3H7S A;  1VZ6 A;  2M19 A;  5H8Y E;  3QAQ A;  1IBX B;  2NPT A;  3OJ4 B;  3BWU D;  2WU5 B;  3Q3J A;  3VFK A;  1NVI D;  1KRH A;  1VD2 A;  5JHB A;  1FRR A;  2WXO A;  1TTN A;  4ZRP A;  4P1B C;  4MEM A;  2NS5 A;  2X38 A;  1XLP A;  1ZKH A;  2ZJD A;  4LTU A;  5JHA A;  3T3O A;  2K39 A;  2ZPY A;  3A4R A;  1CMX B;  2HDE A;  2JZZ A;  2DZI A;  4HPM B;  2J53 A;  2R61 A;  3Q8A A;  1L4Z B;  1N5W A;  3VDZ A;  1D5Z C;  2Z8L A;  1YN5 A;  4K3C A;  5AEK B;  2JF5 A;  3RNF C;  4PS7 A;  2IGH A;  1F0Z A;  2K8H A;  3ML9 A;  2BGF A;  2MX2 A;  2FNJ B;  4IW0 A;  3A4S C;  2NBW B;  1UBQ A;  2DHZ A;  3QHT A;  2CU1 A;  3ZTC A;  2MP2 A;  1E8X A;  1UEL A;  1WJU A;  3DBH B;  4F8C B;  2IO1 B;  3IAS 1;  2Z0D B;  3AE7 B;  1C1Y B;  4LNO A;  2KC1 A;  4L23 A;  3H9D A;  3RD2 A;  2D07 B;  4L1B A;  1LM8 B;  4RF1 A;  2XN9 C;  1KLV A;  2QC8 A;  4EZK A;  3PPA A;  4FHK A;  2AQ3 B;  1R7S A;  1EF5 A;  2KO3 A;  1VR9 A;  3AEB B;  3Q69 A;  1E0Z A;  4FJZ A;  2ZNV C;  1JWS D;  5LNK 1;  2NTS A;  3B0A A;  1KF6 B;  1E10 A;  3V61 A;  3H6N A;  3HVD A;  5AUI A;  3RNB C;  1XLN A;  1RFK A;  2G4D B;  1YJ1 A;  1TIF A;  2WU2 B;  3I5J C;  4WWN A;  2BTE A;  3RFZ B;  1ET9 A;  2GBM A;  2E6X A;  2C5L C;  3C19 A;  3IAM 1;  3OJ3 A;  2V3S A;  3ZTD A;  1I35 A;  3GB1 A;  1C77 A;  1QIL A;  3U52 E;  4CHK A;  3LB8 C;  1MHH E;  3PSE B;  1V49 A;  3VUY A;  1H4R A;  4I6N B;  4HJK A;  1KM7 A;  3KW5 B;  5J17 A;  2L8J A;  3B2G A;  1WXV A;  3U4E G;  2HTM E;  1OGW A;  2W3R A;  1E7U A;  3PRZ A;  1P3Q U;  2JVC A;  2LUM A;  1RWS A;  3DQV A;  4F1S A;  4HRS A;  3LYY A;  3CWI A;  2PVG C;  3I9V 1;  3P4P B;  2IY0 B;  4C7Y A;  1NYQ A;  4WUR A;  3ZNZ B;  2MJ3 A;  1IP9 A;  4NAW B;  3BYY B;  4A3O A;  3ZNI D;  5I4D A;  1PGX A;  1WJ4 A;  2IGG A;  5DCN A;  2C9W B;  1WIA A;  3DWM A;  3ZDT A;  2LHE A;  3U7D A;  2LMC A;  4IDI A;  1EWY C;  3MC9 A;  3L0W B;  2M17 A;  1F2R C;  3BYT B;  1J7A A;  2V3P A;  1NBF C;  4M8N A;  1KJT A;  2L05 A;  2NMQ A;  2DEN B;  4JLC A;  3T8M A;  3KQ4 A;  5IA7 A;  1WGD A;  3AXC A;  4FHJ A;  4HDO A;  2ZW1 A;  1TZO A;  3QK0 A;  5DPR A;  2WXF A;  4KGT A;  1K51 A;  3B08 A;  4N59 A;  2ZEQ A;  4GDL B;  5FKA C;  2G1E A;  1TJE A;  4Q2J A;  3AE8 B;  3BVM A;  3KUZ A;  5G5H A;  2HJ1 A;  1JWM D;  3HUI A;  3K9O B;  5MPO A;  4B0M A;  2JXX A;  2V9H A;  2FIF A;  4LCD E;  3ZQ4 A;  5L83 A;  1WGK A;  2W3S A;  3CF6 E;  3U8Z A;  1UNS A;  3AB5 A;  2PKO A;  4MM3 B;  1WRD B;  3VQI A;  2O2V B;  1OQR A;  4LNK A;  3RYT A;  2LEK A;  4OW0 A;  3EA6 A;  2IO0 B;  2GOW A;  2WXN A;  4GN1 A;  2WXP A;  4J6I A;  2KXJ A;  2KFK B;  5KHO A;  5D7G A;  2BB5 A;  3GE3 C;  1SXT A;  1CK1 A;  1JWU D;  4E71 A;  2PE9 A;  1V6E A;  3FIL B;  1UF0 A;  1GPX A;  3PRP B;  4IC7 B;  2EKE C;  3ML8 A;  3L08 A;  1J19 A;  1L6U A;  2EMT A;  5EE0 A;  2J7Q B;  4ICU A;  1V81 A;  4K7U A;  1LGR A;  1XEE A;  4BKT A;  2KDB A;  1YQ4 B;  1AAR A;  2FCS A;  1P1A A;  1YNT E;  4LNI A;  2LXA A;  2L0F A;  3ZXR A;  5EE9 A;  3TMP B;  3A9J B;  4NPN A;  2LVO A;  2A5U A;  2Z0E B;  2BVC A;  2JUO A;  1PGB A;  3HHM A;  1HXY D;  1EU4 A;  2DBY A;  1OEY A;  1TKE A;  1WM2 A;  1T0R C;  2EEL A;  2FID A;  4K3B A;  3MC8 A;  3ZLZ A;  2J52 A;  3NY5 A;  3Q3N C;  4FUL A;  3ZKJ C;  1T0Q C;  2DYO A;  1WX9 A;  4I6P A;  2OED A;  1C4C A;  1SIF A;  4P7I A;  4KKJ A;  4RNA A;  1KFY B;  4KDI C;  4W9K A;  2RD0 A;  4KSL C;  1F77 A;  5TR5 A;  1QOB A;  3AN1 A;  2TSS A;  1C78 A;  3DHI C;  3QJZ A;  1VDV A;  1LQB A;  4J3O D; 
#chains in the Genus database with same CATH homology
 2LD9 A;  2KK8 A;  2J0K A;  2JRI B;  2W9N A;  4AWJ A;  4GXB A;  3Q3F A;  2KMC A;  1WXA A;  1TZ1 A;  4FN2 A;  3VUW A;  4WWP A;  3VVW B;  4BOS C;  2PE6 B;  4B95 A;  1PQS A;  3K9P B;  2NPT B;  3CMM B;  4FAD A;  4KZC A;  3DVG Y;  1SE9 A;  3VH4 B;  4IM3 A;  2PEA A;  1WGH A;  1XT9 B;  3QC8 B;  2N1V A;  5DPS A;  1V80 A;  4ANX A;  4CYE A;  5JH5 C;  5CHW A;  2BKF A;  4JIO U;  3WA0 A;  1WH3 A;  4B6W A;  3W1S A;  3S2A A;  4IWQ A;  1P98 A;  2REX A;  2O6V A;  4DBG A;  1K8R B;  2EMS A;  3PTF C;  4WJP A;  4BKS D;  1YQB A;  4GSW A;  2V1Y A;  4II2 B;  4GDL A;  3ONS A;  5D94 A;  3WAM A;  4WJQ A;  2L76 A;  2MCN B;  3BIN A;  2NBU A;  1EUV B;  3N3K B;  3V6E B;  3A9K B;  3DVG X;  2KKC A;  1EO6 A;  1VCB A;  4HDQ A;  3VTW A;  3LJ3 A;  2GBJ A;  2LVP A;  2KHW B;  4WAA A;  4IUM B;  2FCN A;  1WJN A;  2J0J A;  2K8B A;  2RR9 A;  3H7P A;  1NDD A;  2KOX A;  2K8C A;  4GU2 A;  4EOY A;  1U4A A;  2Y5B B;  4NY0 A;  4BOZ B;  5HKH A;  3JYU A;  3PHW B;  4A3P A;  3EEC A;  3H7S A;  3KYC D;  3QAQ A;  2LGX A;  3V62 A;  2NPT A;  2ZVN A;  3OJ4 B;  4MJS B;  4EZJ A;  2KJH B;  2BYE A;  2RSU A;  1Z2M A;  3H1U A;  2N7D A;  3JSV B;  3Q3J A;  3VFK A;  2DYM A;  3LDZ E;  2CKH B;  3NS8 A;  2N4F A;  1VD2 A;  5JHB A;  2NVU I;  5EDS A;  1BT0 A;  1TBE A;  1UD7 A;  2G45 B;  3N32 A;  4ZRI A;  3A33 B;  1JRU A;  2LWP A;  1GNU A;  2M1M A;  4G50 A;  2BPS A;  5DPW A;  1E5W A;  1QZE A;  4KIK A;  2MP2 B;  1TTN A;  3PV1 A;  2FCM A;  4WWO A;  3WAN A;  5AZH A;  2D2Q A;  2KMA A;  2MSE D;  3IFW B;  4MEM A;  1RRB A;  2LRW A;  2NS5 A;  1J8C A;  3PRM B;  3A9K A;  1ZKH A;  3QAR A;  3HIZ A;  2ZJD A;  4LDT B;  4BKG A;  3A1Q B;  4TUU A;  2DAJ A;  2C7N B;  3KUD B;  2GBK A;  2LGY A;  5IAA C;  1UGM A;  5JHA A;  3QA8 A;  2K39 A;  2ZPY A;  1RFA A;  2KLG A;  3A4R A;  4XC2 A;  1CMX B;  4CO7 A;  2JZZ A;  2DZI A;  4HPM B;  3RUL A;  3TL5 A;  3UQA A;  2MBQ A;  5JZE B;  2UYZ B;  3VDZ A;  1YX5 B;  2IY1 B;  1X1M A;  2HD5 B;  4MSQ B;  4MJS A;  2KWU B;  3KUC B;  3VHT C;  5AEK B;  2JF5 A;  3W1Y A;  2WDT B;  3GZN I;  3HM3 A;  2GBN A;  3R7R A;  4W9L A;  3SU8 X;  4W9J A;  2DZM A;  4PS7 A;  4DWF A;  2MBO A;  2K8H A;  4MEL A;  3DPD A;  5E6O A;  2XBB C;  3ML9 A;  2BGF A;  1WR1 A;  2CHW A;  4ANV A;  2MX2 A;  2N9P C;  3RT3 B;  2FNJ B;  4IW0 A;  3A4S C;  2NBW B;  2A4Z A;  5D6J B;  3UIO B;  1UBQ A;  2DHZ A;  5LXI B;  3QHT A;  2CU1 A;  3D32 A;  4DHJ D;  3ZTC A;  2MP2 A;  4OVV A;  5LLI A;  4FA6 A;  1UH6 A;  4XZ4 A;  4HK2 A;  3UIP B;  1E8X A;  2AL3 A;  4F7Z A;  2YLM A;  4JGH B;  4HVB A;  4PYZ A;  1UEL A;  1WJU A;  4F8C B;  1E8Y A;  3PHX B;  2IO1 B;  1ISN A;  3L10 B;  3ZDM C;  4DHZ E;  2Z0D B;  2KLC A;  1C1Y B;  2KC1 A;  3H9D A;  3PS6 A;  4G0N B;  4DXA B;  3A1Q A;  3RD2 A;  3ZO5 B;  4E3C A;  3RZF A;  4NQL B;  2ZCB A;  2D07 B;  2HTH A;  1LM8 B;  2XEW A;  3DBH I;  3X0W A;  3MTN B;  3ZRF A;  4ANW A;  4AJY B;  1MG8 A;  2KTR B;  4NJ6 A;  1WX8 A;  1Q5W B;  1KLV A;  3W1S C;  2WX1 A;  4EZK A;  3PPA A;  4MH0 E;  4FHK A;  1Q0W B;  1EF5 A;  3WIM A;  4DDI D;  4FJY A;  2WWZ A;  2KO3 A;  3C0R B;  2C7M B;  4HXD A;  1HE8 A;  4EEW A;  1IYF A;  4FJZ A;  2WX0 A;  4ICV A;  2ZNV C;  1H8C A;  2J0M A;  1EF1 A;  1WE6 A;  1YD8 U;  3ALB A;  4AJW A;  3B0A A;  2VRR B;  3UF8 A;  2UWQ A;  3V61 A;  3H6N A;  3AU5 A;  3DVN V;  4NQK E;  3ZIM A;  4PS8 A;  1GJZ A;  2N7E A;  4EFO A;  2IYD B;  5D2M B;  5AZF A;  4BFR A;  4HLE A;  2MQJ A;  1KOT A;  3DVN U;  2G4D B;  4G3X B;  1WE7 A;  1YJ1 A;  2Z59 B;  4EUT A;  2I1J A;  3IHP C;  4WQO B;  4WWN A;  1WX7 A;  4MGZ E;  5G55 A;  4MSM B;  3RUI B;  2HJ8 A;  4BBN C;  2C7H A;  4KSK C;  1UZX B;  2MLB A;  3U30 A;  3B1L X;  2LUE A;  3ZNG C;  2MBE A;  3P2B A;  3AI5 A;  2LGD A;  2OJR A;  5CTR C;  4W9I A;  2NCN A;  3DBS A;  2KTR A;  4TQ1 A;  4X57 B;  3QIJ A;  2GBM A;  2JPH A;  2KDF B;  3R3M A;  2C5L C;  3QQ8 B;  3DCG A;  3L13 A;  1WF9 A;  4DHZ B;  4W9D A;  2B3A A;  2V3S A;  3OJ3 A;  3ZTD A;  4AOF A;  3M62 B;  4AUQ C;  4II3 B;  1I35 A;  1V5O A;  4TKN A;  2KWC A;  3PRE A;  4CHK A;  4GB9 A;  2L00 B;  5E6N A;  1P0R A;  3PSE B;  1V49 A;  3VUY A;  2CS4 A;  1H4R A;  4I6N B;  4HJK A;  1KM7 A;  3UIN B;  2NR2 A;  3KW5 B;  5J17 A;  2L8J A;  1WXV A;  4BBN F;  4FLH A;  2DZK A;  4W9G A;  3PZD A;  2KJR A;  1E8Z A;  1OGW A;  2LRU A;  3APF A;  4ZYN A;  1E7U A;  4AP4 C;  3QWZ B;  3PRZ A;  1P3Q U;  2JVC A;  3L54 A;  3VXW A;  3DQV A;  4F1S A;  3ZW3 A;  4DDG D;  4RMA A;  4MGI E;  2IY0 B;  3TBL D;  3SHQ A;  5DPT A;  3VAW A;  2KFJ A;  4IM2 A;  2KTF A;  4RM9 A;  3ZNZ B;  1IP9 A;  3NZU A;  4JL9 A;  4NAW B;  4GDK B;  4A3O A;  2BKR B;  1V5T A;  3NOB A;  3ZNI D;  2ZCC A;  4YL8 A;  2LAS A;  3T9L A;  5C23 A;  4ASW C;  4GGQ A;  1WJ4 A;  3PLU A;  4KV2 A;  5GMV A;  2ZVO A;  5DCN A;  2C9W B;  1S1Q B;  2C60 A;  3JSV A;  1I42 A;  1ZW7 A;  1WIA A;  3PGE A;  2RPQ A;  3APC A;  3ZDT A;  4KZ0 A;  3IG3 A;  3TCA A;  3U7D A;  1WMH B;  1R4M I;  2M4N A;  5J18 A;  2KWV B;  1WZ0 A;  2KD0 A;  2CHX A;  2LZ6 A;  3L0W B;  1TGZ B;  1WJ6 A;  2M17 A;  4NNJ B;  3NHE B;  1GG3 A;  4ZRK A;  3M95 A;  3V60 A;  4DK5 A;  2K1F A;  1OEY J;  3M3J A;  1NBF C;  4TV3 A;  4M8N A;  2AWT A;  1KJT A;  2K6D B;  2L05 A;  4ZRJ A;  2O6V D;  2DEN B;  4JLC A;  3T8M A;  4B9K A;  4FBJ B;  4IG7 B;  3ZVV A;  1WGD A;  3OAW A;  2HE7 A;  5IA7 A;  3AXC A;  1YIW A;  4DHJ B;  4FHJ A;  5CHV C;  2DX5 B;  3JVZ X;  4KVG B;  3PT2 B;  4M8M A;  4ZDV A;  2MBB B;  3M63 B;  4HCN B;  2JY6 A;  4HDO A;  3QK0 A;  5DPR A;  2MW5 A;  3QX1 A;  3VTV A;  4ANU A;  1WR6 E;  2MA9 B;  3B08 A;  2ZEQ A;  4GDL B;  4W9F A;  4LJP B;  2KX0 A;  3KVF B;  2JWZ A;  1Q1O A;  1J0G A;  3DDC B;  4NAW A;  3L16 A;  2BF8 B;  3CST A;  2G4S A;  1WI0 A;  4OVU A;  2JZ3 B;  5J2R A;  2KNB A;  3KUZ A;  1RLF A;  5G2N A;  2ASQ A;  2K6Q A;  2KX3 A;  1GUA B;  2IZV B;  4W9C A;  3PVL A;  2KQS A;  3K9O B;  4K7S A;  2FUH B;  1WMH A;  2JXX A;  2M0X A;  1WGR A;  3AUL A;  2FIF A;  1V2Y A;  5BO4 B;  1F9J A;  4KDL B;  2RGF A;  4LCD E;  4WJO A;  1UBI A;  5L83 A;  3HK0 A;  3CF6 E;  4RM8 A;  3U8Z A;  1FXT B;  1WGY A;  3ZUN A;  1Z5S B;  3VTU A;  2MRP A;  3WAO A;  4EZL A;  2KC2 A;  3VH3 B;  2L0T A;  3EFU A;  3OLM D;  1WRD B;  3VQI A;  1WM3 A;  1WFY A;  2O2V B;  1XD3 B;  3KH0 A;  1E7V A;  3RYT A;  3VUX A;  2R2O A;  2KAN A;  3X23 A;  1ZGU B;  4WJN A;  4MDK E;  4KIK B;  3TIX A;  3CSF A;  1M94 A;  3APD A;  4IWO A;  3TJP A;  2N9X A;  3DBR I;  4IWP A;  2L7R A;  1V9J A;  2IO0 B;  2GOW A;  1L2N A;  4GN1 A;  1Y8R C;  1V86 A;  2R2Q A;  4LJO B;  2FAZ A;  3ZNH B;  3V6C B;  4J6I A;  2KXJ A;  2KFK B;  4HPL B;  5KHO A;  3RZW C;  5D7G A;  2BYF A;  1RAX A;  2D11 A;  2N1W A;  1T0Y A;  2JRH A;  3BY4 B;  4E71 A;  1GC7 A;  2PE9 A;  1V6E A;  1E90 A;  2L3Z A;  4JQW C;  1A5R A;  3JW0 X;  2K25 A;  4HWI B;  4MGY E;  3PRP B;  2NBV B;  4IC7 B;  4K7W A;  2KJ6 A;  4MGK E;  2EKE C;  3ML8 A;  3L08 A;  1J19 A;  1WYW B;  2N9E B;  4HCP B;  5FR6 A;  1WZ3 A;  2EMT A;  3DOW A;  2J7Q B;  4ICU A;  1V81 A;  2IBI B;  5CX3 A;  4K7U A;  2IO3 B;  4BKT A;  4IM0 A;  4BKS A;  2KDE B;  2KDB A;  2MBH A;  2XK5 B;  2KQ7 A;  2LVQ A;  3SD5 A;  2JT4 B;  5C1Z A;  3HM6 X;  3R66 C;  4MM3 A;  4URK A;  1C3T A;  1AAR A;  2FCS A;  1P1A A;  2IO2 B;  2GBR A;  2LXA A;  2DYB A;  3ECI A;  3ZRC A;  2LI5 A;  4M0W B;  2O2V A;  4G11 A;  1P9D U;  2MWS B;  2L0F A;  1S3S G;  2PPH A;  1WGG A;  4LDT D;  3UGB B;  3TMP B;  3A9J B;  1SGH A;  2LJ5 A;  2KN5 A;  1R4N I;  2PJH A;  3N30 A;  4NPN A;  1LXD A;  2KVR A;  2LVO A;  3DBL I;  3IVF A;  3QCA A;  3ENE A;  4GMV A;  2AL6 A;  2A5U A;  3WAL A;  2Z0E B;  2JUO A;  3I3T B;  2KFK A;  5L95 C;  1OQY A;  3HHM A;  1WXM A;  2YVC A;  2AYO B;  3MHS D;  1YX6 B;  2ZPN A;  4PS3 A;  3RCZ A;  2WYQ A;  1L7Y A;  1OEY A;  2ZZP B;  3O65 B;  3NZS A;  4N9F 4;  4W9H A;  2CR5 A;  4XX5 A;  3EC8 A;  5CHF A;  4TQ0 A;  1WM2 A;  2I1K A;  2CHZ A;  3PLV A;  1WY8 A;  2FCQ A;  5E6P A;  1NI2 A;  3GOE A;  3KYD D;  2BWE S;  2FID A;  2M8S A;  1LFD A;  1GC6 A;  4PYU A;  2BYV E;  3ZLZ A;  3R7Q A;  3NY5 A;  3IBE A;  1OTR B;  3UQB A;  2LXC A;  4FUL A;  2DZJ A;  5LXH A;  3ZKJ C;  4GIV A;  4E74 A;  2OOB B;  1E8W A;  2BWF A;  2D10 A;  2DYO A;  2KZR A;  5KHQ A;  2G3Q B;  1WX9 A;  1IPG A;  4I6P A;  4EKU A;  3WAP A;  2XK5 A;  1G6J A;  2GMI C;  5AZG A;  4BVU C;  1SIF A;  2QHO A;  3EHV A;  3AU4 A;  2KDI A;  2O6V B;  4P7I A;  1D3Z A;  1WXS A;  4NJ7 A;  4KDI C;  4I6L B;  4W9K A;  2RD0 A;  4KSL C;  5TR5 A;  2DAF A;  3A9J A;  4W9E A;  3SDL C;  4A20 A;  4GDK A;  2V4L A;  2AEH A;  2ZNV B;  3L17 A;  4FJV B;  3QJZ A;  4K81 A;  4GOC A;  4K1R B;  1XQQ A;  3MJW A;  1LQB A;  2D3G A;  3H7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...