1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
1LTRD 1TY0A 4K6LA 5FK9C 5ELFA 3SEBA 1PTOB 1SXTA 5I4DA 1S5DD 2AQ2B 1V1PA 3BVZA 3BVGA 1FNUA 1JCKB 1YN3A 3BZDB 4DXFA 1TS5A 1G8ZD 4C56C 4RGOS 1UUPA 2IJ0A 1CHQD 1UNSA 3KLSX 1PTOD 5ELEA 2XRQD 2Z8LA 1FNVA 1LTBD 3R8BA 1YN4A 1I4RA 1L0YB 1B1ZA 1HTLD 3R2TA 1LT5D 3DWAA 1ENFA 4RGMA 1RDPD 2IPKD 1PRTC 3EA6A 5D3IB 1DJRD 1EFID 1PTOF 1SE2A 1XXGA 1CT1D 1HQRD 1QILA 2SEBD 2ICIA 1BCPC 5D3DA 1JWUD 2AQ1B 1RD9D 1EEID 1YN5A 1LT3D 3BYTB 1EWCA 2AQ3B 1JWMD 4RHRA 2TSSA 3O13A 1PYWD 3BYYB 4UDUC 4L63B 5ELBA 1I4PA 1EEFD 2QEJC 1T5XD 2XNAC 1SBBB 4NZLB 1KLGD 3TSSA 1LTID 1JR0D 1S5BD 2NTTA 2CHBD 3URYA 1KLUD 1D5MC 2XN9C 1RF2D 1PZKD 1BXTA 1LTGD 1ET9A 1XTCD 1SE3A 2NTSA 1I4QA 4OHJA 1SJED 1S5CD 1S5FD 3DWPA 4RH6A 1HA5A 5ELDA 1S5ED 1GOZA 1F77A 1CK1A 1STEA 1I4GA 1PRTF 1D5XC 1PRTB 1M4VA 3CHBD 3EFXD 1LLRD 1SE4A 1ET6A 4RCOA 5TSSA 5ELCA 4ZYSA 4L6TB 4RGTA 1TS2A 1FNWA 4TSSA 1PTOC 3R2IA 1D6EC 3W2DA 1LT6D 1ESFA 3V05A 1JWSD 1CHPD 2J4XA 3BVMA 1I4HA 1AN8A 2QILA 3GP7A 1PZJD 2WV6D 1EU3A 4O1NA 1TY2A 1PRTD 1SJHD 2O2LD 1TS3A 1I4XA 1HXYD 1MD2D 1FD7D 2XRSD 1BCPD 1V1OA 1RCVD 4RFBA 5FKAC 1CQVA 1D5ZC 1SEBD 1TS4A 1PZID 1EU4A 1LTAD 1PTOH 3OWEB 1L0XB 3MC0B 1AW7A 1FGBD 2RDGA 3DWQA 3MFGA 4BWGB 4RHSA 1BCPF 1BCPB 1DYQA 1V1PB 2R61A 1LT4D 4RGNA 4Z9CB 1JQYD 1KTKA 1LTTD 1LTSD 2G9HD 2RDHA 4DXGA 1LO5D 1B44D
chains in the Genus database with same CATH superfamily
2MUYA 4POFA 2PZTA 3OYYA 1PTOB 3HS0C 4R8NA 1V6EA 2MX2A 3BVGA 1F2RC 3A4SC 2H5XA 1OEYA 1A3TA 4X3TA 3AEDB 3CW2C 3HK0A 3CCVA 4DR2Q 1WM2A 3PLVA 2TMPA 5LL6X 4HPLB 4RGOS 1ZW7A 1GG3A 5CV9A 3N1YC 3VTUA 2VXWA 1N60A 3CCQA 4UPAA 3CC4A 2IGGA 2MLBA 3PF5A 1L1OC 3UE0A 4DV0Q 5LMNQ 3AE7B 1HRJA 1NY4A 4HCEA 4R4CA 4AQYQ 1BVSA 1OQQA 2JA8H 4DV7L 5CBAE 2IY1B 3TDQA 1VZ6A 4A3DH 1WXVA 2PEAA 4IC7B 4GS3A 3K7AH 4KKUA 2KVRA 1CT1D 3BDOA 4KIKB 2WP9B 1WYDA 2K05A 4HDQA 3WCQA 4BKSD 3VAWA 4FLHA 4IPHA 4AYBG 3PCOB 3TEHB 2KFJA 4FXGC 1YN5A 3UINB 1X3GA 1WX9A 3TREA 3UDGA 2HCIA 2HD3A 4DFAA 4OL7A 5BN3A 1E9MA 2GLSA 4ME5A 4YCWA 1WGHA 4XYQA 3R3OA 2WAQB 1I50H 3J81i 4JOIA 4RMAA 4W9KA 3MXGA 4ANUA 3N20C 2PPHA 1AE2A 4JI7Q 3HOYH 4EGVA 2W54A 3VR2A 1H9SB 4DDGD 1UE5A 4MM3A 3NBIA 2L12A 4I7ZC 4G7ZC 3VDYA 1STBA 3S1NB 2ACZB 3J7AV 5ELDA 4DA2A 1OXUA 1S5ED 3HOXH 1Z7TA 1OTCA 1YJJA 1PV4A 5IGCA 4ZOHC 3RLFA 4KDLB 2A5UA 2F0EA 2PIAA 4AWJA 3CHBD 1VD2A 3T56B 1ZKHA 3DOWA 1ET6A 4GDLA 1WTPA 3CIRB 3ZLZA 1Z9FA 1VQLA 5IP9H 3IAM1 2LMCA 2Q2IA 2K1BA 3K0YA 1Z6HA 3K7AB 1LT6D 3KDFB 2BDNA 1FJGQ 2J4XA 1HR0Q 2YU9H 2QILA 4TV3A 2HT1A 4R9WA 3BK2A 2GOWA 1JJ2A 2DYOA 4JI3L 3AB9A 5KYLA 1FFUA 2SNMA 2RHQB 2KT7A 2MHJA 2K0PA 3T9LA 4MNOA 3F8TA 3RZDB 2UUAL 4P1CC 1HPCA 3HZXA 2LXCA 3OMCA 2WXOA 1JRUA 2MBQA 1EL0A 4ZAIA 4HEDA 1HA6A 2OTLA 4OVZA 2KEEA 4QY7A 1I50B 3U9OA 5EPJA 4ZHPA 1RIPA 2KWDA 5LMNW 2WU2B 1HZ5A 3I2ZA 4BWGB 5IGGA 2ZM6L 3R66C 4C2MH 1VMCA 2JA7G 2O5JC 5JEAG 3A5ZB 2AWTA 4N8FA 2R2QA 5IE8A 4LUVA 2BT6A 1V2YA 5G3LF 1R4QB 4KD4A 5IYDH 3QB3A 1C4AA 4K6LA 4JI2L 3AEVA 5I4DA 4YY3Q 2PMVA 3KYCD 1NYQA 3BZCA 4YCVA 2F0LA 3V62A 5IT9c 2L5TA 1K8MA 4Q0FA 2D11A 4LFCQ 1EY7A 1CUKA 2CJOA 1WE7A 3J81j 1Q8IA 4HMJA 1FL0A 5J39A 1PXUA 4MM3B 1U0LA 4RKBA 3KOJA 1STGA 3D4WA 4OVUA 4XQQA 3I55A 1PH1A 2DAFA 3B2FA 2KHSA 3A9KA 4GKKQ 1HTLD 2IZVB 2M8SA 4LNFA 3VH3B 1IW7C 3SK8A 1C7YA 1J8CA 4P2CB 1LXDA 4A8XC 1A5RA 4A3CG 4GDLB 1HNZQ 2FUHB 4ACFA 4C3JG 3KYDD 3QQ8B 1J6QA 2FAZA 2B39A 2F4VL 2PMZE 2LMCB 2X69A 3W1BA 1QILA 4C3IH 1TKEA 3Q0AA 3NVWA 3CC7A 5E4XA 3S24A 2XIWA 3DVGX 4C2MB 4ALPA 2MQJA 5JXVA 4IPDA 1V49A 1IXRA 2C60A 2Z1CA 2K39A 2VB2X 4LAAA 5CV7A 2TSSA 1Z2MA 5CV6A 3PHWB 1CSQA 2CH4W 1V43A 1HR0W 2J42A 4E3CA 4IFDH 4G50A 3IFTA 4TQUS 1JOOA 3ZKJC 3AEFB 4YTMB 4HTHA 2SDFA 1RM6C 3C3LA 2Z4IA 1LTGD 2GBRA 4XQJA 2GI9A 1ENAA 4A6QA 3DM3A 1WJJA 4OIJA 3PT2B 4XE0A 4C7YA 2FCNA 4RWSC 1CKNA 1STNA 1NNXA 3EFCA 5CV4A 1K8AC 3H3VH 1D5XC 2F0JA 1GM5A 4RF0A 1C1YB 2PKOA 4LF8L 3NRZA 4WJQA 1W2BA 1KJTA 4YWLA 3DEPA 4P6VF 2EJMA 2C9OA 2CH4A 2NBWB 5G2NA 2KX3A 1JWSD 2PE6B 1EYCA 3GTKH 4C3IB 4A3BH 3IRBA 4PZ6A 1WYWB 2MJEA 1XMQL 3KF6A 4K5XA 2V4DA 1STYA 5FLXL 4DGZA 4GNXA 3GQBA 1PFSA 4OW0A 2DNCA 5IY0A 1C79A 1Q1OA 3AV8A 1A15A 3CCJA 4A90A 4GN3B 5LMUL 2L7RA 1QNUA 5M5WB 2UXDL 2GBJA 2B2VA 1R4NI 3RMHA 1TS4A 2BGFA 1VQJA 5C44G 2IX0A 2EIFA 3AEAB 2EYOA 2NR2A 2BS4B 3IBEA 4CJ0B 1YNND 1YNXA 1ZUD2 2G1EA 5IYCG 3T53B 1AW7A 4KHPQ 4MJSA 5AZFA 4X3UA 4A3FH 4A3JB 3ZUNA 1E0ZA 2YEPF 4Z9CB 2Q8RE 2F03A 4RCNA 2G9HD 4YL8A 5C5MA 2F4IA 4W9GA 2IW3A 4CGYB 4PZ7A 1AE3A 1CA6A 2F0GA 1K53A 1FNUA 4FNFA 3AI5A 1L7YA 4DF7A 1CI3M 4JK1C 2ALYB 1IBML 1Z5SB 3AE5B 4BZAA 3OPOA 5D6JB 3P20A 3J7A5 3MHSD 3FVQA 4XDXA 1GB4A 1UUPA 2NN6G 4A3MG 4GXBA 2B2TC 4PS7A 3K58A 1HNXQ 4KV2A 4OWXB 5C0XG 3ULLA 4DR5L 1YI2A 3AE3B 3IFWB 1E2VA 2DUDA 2GB1A 4O0AA 3HOVH 2Z8LA 2IBIB 4POGA 4KHZA 1CKNB 1B1ZA 2WB1G 2L76A 5NUCA 2F0UA 1A3UA 3F2BA 4D2KA 2KCTA 4JI8L 1X9NA 5BR8L 1XQQA 2RR9A 4ZQ3A 4MH0E 4II2B 2JY6A 2OQKA 2KZRA 4ARCA 1FEHA 2N78A 3T1HL 1YHQA 2PTLA 2KXJA 2FHTA 4DQOC 4A3FB 1FM0D 3OG5A 4CDDC 5IWAQ 4ILWA 1IYVA 1BBUA 1VQMA 3M7NA 3KF6B 3ONAB 4MHEA 3KH0A 3NVYA 1GUGA 5KNDA 4DV1Q 1QVGA 3N32A 1GJZA 2E74C 1XYIA 3ECIA 3OJ4B 3Q3NC 3T13A 1XEEA 3VQIA 1C4PA 2XNAC 5E3FA 1JW9D 1B9NA 3TP8A 3TSSA 1XT9B 2WXMA 2KTRA 1QG7A 4WORA 1E2WA 4XT3B 1Q10A 3VRBB 4WH4A 1NBWA 2GBKA 2LVQA 3GTQB 2ZNVB 5JH5C 1GAQB 2UUBL 2UXCL 3NJTA 4BY7H 1HA5A 4JBMA 3EBEA 1SIJA 2ONQA 1ZYRD 1EYDA 1SYEA 2W9NA 3HOVB 5C3XA 3STBC 1I4GA 1YMHE 1X54A 1M4VA 3NXWA 2AL3A 3ERSX 1LACA 1XD3B 3PUVA 1FVIA 1SAPA 1L2FA 2L9HA 1QOHA 3S1QH 3RULA 2RQXA 1V9PA 2XWJB 2N55A 4FHJA 1ESFA 2Z4HA 4B3TL 1TWHB 1I3QH 3BJUA 2OCEA 1WI5A 2AL6A 3DBRB 1UF0A 2N9EB 2E75C 4JI1L 4A3IH 3VXWA 4P74A 1NJIC 2RSUA 1VCIA 1S3OA 4OZAA 3V6CB 3VUXA 4HJ9A 1Q46A 2IHEA 3TMPB 1EFWA 4B3MQ 1V5OA 3FHWA 4FF2A 2OOBB 3AEGB 2Q8IB 1C4QA 1RODA 4XGAB 2I0QA 1SEBD 3IT4B 1BDOA 3B6YA 1C3TA 2FNJB 2D10A 5CGKA 4MGZE 2JUOA 4J1MA 4PV1C 1QB5D 1DOIA 1F52A 2V9HA 5I9PA 4F8CB 4A3LG 5GAHC 3VYRA 1KAWA 1LT4D 1P3QU 3WAOA 1X55A 3Q6SA 3RLOA 1N8RC 3ULJA 1GC6A 4HRSA 4BY7B 2L05A 4MELA 2K28A 1U4RA 2JT4B 3RN9C 3NQIA 4X65Q 2C7NB 1JICA 1ENCA 4B3SQ 3PHXB 1SFOB 2XBBC 1S4ZA 4GOCA 1SNCA 2INNE 3V3XA 3B08A 3ZNHB 5CORA 1SNOA 1TJEA 3S1QB 5KRUA 1RAXA 2B3GA 1I94Q 1PYBA 4X64L 2MWSB 3UI3A 4IUVA 1UNSA 1V8QA 2K01A 2RD0A 3VDZA 2B3AA 4IUNA 1VF7A 3DMUA 5EBCA 4K3CA 3L7ZC 3AM9A 3T3OA 3A9JB 2XVSA 2R7FA 1YN4A 4LW1A 4NKLA 1PH8A 2CKHB 3QIAA 1LM8B 2JN4A 4JCVE 1BMLC 2QDBA 3D0FA 2JYTA 2M1MA 4EZKA 1MKHA 2AWOA 5E7NA 1YX5B 5DPSA 3K81C 2I5LX 4KY6A 4HIKA 2QC8A 4Q5VA 3M63B 3F1ZA 1PFNA 1NENB 1FCCC 3DQVA 4MSQB 1HJPA 1U4AA 3SDZA 2BA0A 1TWCB 1MG4A 3L16A 1WJNA 1LGRA 3T1YQ 3NS1A 3CXCA 1GXDC 3CCEA 4K3BA 1YIWA 4XIGS 3H3VC 1EOTA 3H7PA 1UELA 1HUNA 3HOUG 4HK2A 4K5WA 2BYVE 2O6VD 1LTID 3AQQA 3GD7A 3PQIA 4QIWE 3U9SA 3URYA 1KLUD 2NBFA 4DAYB 4G11A 2JQRB 1TU2B 3K5MA 2PZUA 1F2ZA 3U50C 4EQNA 1QOBA 4YWGG 1S5CD 3PO0A 1HTQA 3UI2A 3D31A 1SSOA 5D14A 2K6AA 1CJEA 1RTOA 3SR1A 2KJ6A 4BBSG 1JWBD 1EY0A 1T6BX 1MHHE 1YNJD 4UAIA 3I7FA 3CQZB 1EY8A 1CK1A 1VDZA 5GROA 3L4PA 5C1ZA 3E0EA 4WQOB 5AJ3L 3AMZA 1Q86C 4YHHQ 5EE3A 1EQTA 1ZGUB 4KLKA 4XX5A 2NB0A 4DV2L 4DN4M 1LQBA 2N88A 3HUIA 4IOAA 4NJCA 4A4IA 2K14A 3K7UC 3TQYA 1EF1A 1Q3LA 3NWSA 4Y7NH 3NENA 3GE3C 3NS8A 3RNGC 5EAYA 2RCNA 1MGSA 3WIMA 3TEYA 2VQFL 1MD2D 1PH7A 2WDQB 3SK4A 4K2KA 3KVFB 2UUCQ 5JAVA 4QGUA 4C80A 2DNFA 4DK5A 3HEJA 4HJ8A 5LL6S 4HIOA 1HZ9A 3W5UB 5GXGB 2B63B 1RTNA 2AUKA 4OZBA 1QWYA 5FLXc 3FKIG 5E6NA 3S2HH 1N62A 2WU5B 2HIXA 1B9MA 4GB9A 3VFKA 4IM0A 4DV0L 3P63A 5LMNL 2FUG1 4F7ZA 4DBGA 1LTSD 1M8AA 1SB3C 3GOEA 4ZHOA 1E22A 2H4OA 1UGMA 1IYFA 2WDVB 1EF5A 4L1BA 2VUMH 5CR3A 1V81A 2BH2A 2C5LC 2NN6I 3DHQA 2KMCA 3S2DH 3SXHA 2DWQA 1VR9A 1TS5A 4OONA 5C0XI 4A3MB 4N58A 4A55A 2MW5A 3D3RA 1CHQD 3P4QB 3RCZA 1HZBA 3AFPA 4Y7NB 4WIPA 5EBDA 1W6JA 1XNRQ 1PTOD 2KDEB 3HVDA 3B0AA 2D3GA 4RF1A 2XRQD 3BDCA 4RAUC 5FR6A 4YSXB 2WB1B 5CBEE 2VQEQ 4KKTA 3CD6A 1GHKA 4TUUA 3E0JA 2J7QB 5M9OA 2K1FA 4JI7L 2W55A 4B0MA 4L5RC 2EXZA 1ISNA 4GOPA 1HQRD 5AUIA 5DPRA 1GUNA 1XJVA 2R7ZG 1A70A 2LS01 2E2HH 3OIQA 3HG9A 1BQQT 3I72A 4IQZA 3JAMi 4FXDA 3PRMB 4IALA 3TBIB 1GJXA 2KKCA 1AZQA 1E7VA 2EZVA 1YNNC 2KN4A 3CC2A 3MJ5A 4KHVA 5M3MH 2OJRA 2JXXA 2QHOA 1IBKL 2DZIA 3CMAA 2RPQA 1QOGA 1FCLA 1NSNS 3S15B 4L23A 4XC2A 1SBBB 4NZLB 4BOZB 1CSPA 1ICFB 2WINB 3QO2A 1VQHA 3QOLA 2MJ8A 5EKLA 2LHEA 2WNMA 2BCOA 1D1IA 3S2DB 2FFKB 2OHFA 4F88A 1HR0L 4HKZE 1XTCD 1PZKD 4CHTB 4M0WB 4GKJL 2HHHQ 2K5HA 2NTSA 1I4QA 3PUZA 4OHJA 2R93G 3GTLB 2MSED 1MJCA 4OZCA 2QDFA 3SR6A 5JZEB 3DWPA 3S1RB 2R7DA 3HOZG 5JVH3 1HNWQ 3ZW3A 1CKOA 3EIVA 3GTOH 1AFPA 2F3WA 2BS2B 5C0XJ 2WHIA 4A93H 2VZKB 1EY6A 2KQ4X 2M19A 5BO4B 2VL6A 4A3KH 2I1KA 1EQRA 2M4NA 1SN8A 3L9AX 3MXPA 1GUTA 3R2IA 1D6EC 2NVTH 1YD8U 1CHPD 5AZGA 5ISRA 5EDSA 3CRLC 4QAYA 1PZJD 2WV6D 3MFYA 1QF6A 2K5NA 3L3OC 3J80i 2E2HB 1S1QB 2N8NA 2VY3A 1TIFA 3LXFA 3MVVA 3LB8C 1H9RA 5CV5A 3N1ZC 1XLQA 3I4NH 1HXYD 1T0SC 4OO1H 4P71A 5FLMG 1QVCA 2Y0SB 4YY3L 1M94A 1KDBA 2JA6H 1D5ZC 1WTXA 1PZID 3GZNI 2KK8A 2KBNA 4RA8A 1PTOH 1B53A 2WIIB 4TKOB 1HTPA 4LFCL 3S1MH 1ZOYB 1K51A 5DPTA 2E76C 5C3EH 4PZ8A 2PPBC 2L55A 1ZE3D 1EZ8A 3VYUA 2CHZA 4KKSA 4RHSA 4GOPB 3OSOA 3DBHI 3DVNV 3NBHB 2G5DA 2CKZB 4MGKE 3CCRA 1L6UA 1TQOA 4FADA 2L0FA 4P75A 4BY1G 4GKKL 1I6HB 3R7QA 1IZ6A 4JI4Q 3CF5A 3BVZA 3IAYA 5DNFA 1IGDA 4ABNA 1HNZL 2L1AA 2L15A 4A3PA 1U4MA 2VNUD 3L13A 4LF4Q 4PNYA 5LLIA 4JI5Q 1ZYRC 1G8ZD 2A69D 3VR6A 1WTVA 2NVTB 2WACA 2PCFB 4HDOA 5LXHA 4YCUA 5I2XA 1BOSA 5ELOA 1ZP0B 4KI0A 2LWPA 1W6KA 1SNQA 3JSVB 4WWNA 4B0EA 2ATWA 3UDXA 1VJKA 1IYJB 3DCGA 3CPWA 4ZYNA 2HDLA 2HDEA 1WXSA 1MJDA 1C78A 3HGBA 4HSPA 4NXNL 1A2TA 4US9A 1SE8A 4IDIA 1IP9A 2IX1A 4JV5L 4YSZB 2JA6B 3PS6A 5AFWA 3KBGA 1RDPD 2LASA 2DN8A 1J0GA 5D3IB 1F1HA 4A3GB 1UE6A 4FULA 4WJNA 2I46A 5HY6A 3VVWB 2DJFC 3KUPA 3S1MB 1EWIA 1CTMA 2YTXA 5C3EB 1SYBA 4W9HA 2MRPA 3NHHA 2JRIB 2LI5A 4B9KA 3TZUA 1EEID 3FRPB 1BT0A 4XWWA 1OFFA 4YWKA 2MP1A 1KD1C 2N0SB 5DCNA 4WJOA 3H0GB 2NCNA 1WJ4A 3U52E 2K04A 1EIFA 4FA6A 5H92C 2F0IA 2K8HA 2KENA 2FMMA 1YHBA 3S1NH 1DGJA 4OVVA 1KF6B 4ZRPA 3I70A 1L4DB 3ZXVA 3KUZA 2QEJC 1F9SA 3ALBA 2E2IB 1TT5B 2JK8A 2N7EA 3UIOB 2G4SA 4EKUA 4L8JA 4IJHA 1E90A 2KX0A 4JX1C 4CDEC 4S17A 4EFOA 1ET9A 3NZSA 3I9V1 4NNJB 4G7OC 3UF8A 5I9OA 5HFYA 2OJWA 1N36Q 1S5FD 3T4AC 1FXTB 3NEMA 4LJZC 4PS3A 3TP6A 4MTNA 4B3RQ 2F0FA 3U4VA 4DK3C 2M2LA 5BMIA 1F77A 1YJIA 4OGQC 1IL2A 5IP7G 1E10A 2F3IA 2R92H 3E5SA 4DHZB 3TBLD 3SHQA 1HTOA 3TUOA 2YV5A 4A3BG 4NJ7A 3PO3G 4HKQA 3RZDH 4DUZQ 1OXTA 4CDFC 1FNWA 2JE6I 4TSSA 2GMIC 4KHPL 2L32A 1Q0WB 4M1UB 1PH2A 4BBRG 2KDIA 2VH1A 3UIPB 3RN2A 5IKCM 3EC8A 5FLXE 2K8CA 3P75A 2HTME 3HM3A 1WOCA 3A33B 1TTNA 2O2LD 1DOKA 1TS3A 4LFBQ 1KXLA 3DVNU 3FDTA 2XWBB 1Y69U 2ZPYA 3KYHC 3ETRA 4IUTA 1IBXA 1OXVA 1K52A 3PV0A 1EQQA 3AECB 5BYRA 1K3BC 2ZTDA 3FKIB 2H1EA 2FCMA 4C3HH 2RBMA 3E9HA 4V0BA 1EO6A 1YJ1A 1NR4A 1YJ9A 2YTVA 1A3VA 3U30A 1SYGA 4BXXG 1DOLA 5E6JA 2K50A 1XCQL 2K3UA 1E1TA 4NXMQ 1XPUA 1JT8A 1NDDA 1AWDA 2DX5B 3WA0A 2K7VA 3Q3OC 5FJ8G 4IUUA 1N34L 4AJWA 2C7MB 3UQAA 1G2SA 3BS1A 1CKMA 1KQSA 1WTHA 3RMKC 4JBJA 3WAPA 2BWFA 4DV4Q 2BDOA 3NUHB 1VQ6A 2R92B 4I6LB 1TVXA 4LUZA 3D8GA 2CJNA 4JIOU 2JX5A 3BZDB 1Y8PB 2PW9A 3R93A 3APFA 2JA5G 1S40A 3NE5B 3MAQA 3GV6A 3A8KE 4KN7C 4L5SA 5KHOA 2ZVNA 1EWHA 1YNJC 1VQEA 5DPWA 2B2YA 4NB3A 2L52A 4JYAQ 5ELEA 1TWFB 3DHIC 1MBYA 3RR5A 4DV1L 3ITPA 2HQEA 1FGUA 3MXNA 1FNVA 1X3EA 1K8GA 1TKYA 1EOVA 1UEBA 3VTWA 1VZ7A 2J0TD 1TKGA 4IWQA 4KY7A 1K50A 4RGMA 3FILA 1MSGA 2DLBA 1EIYB 3S2AA 3B1LX 3K5NA 4ZRQA 1HFGA 2PW5A 4ZRKA 3A5UA 2WXFA 4C3HB 1XXGA 4BKSA 5BMGA 5IIFA 1O7ZA 2FIFA 3RI7C 1A62A 4UP8A 3RZOB 1WI0A 3MHBA 2HCCA 4DR3L 3WALA 5IGDA 2B2WC 3MWYW 2AQ3B 5KNBA 3PMFA 3G71A 1R7SA 2C5CA 3GV3A 1JQ4A 1N61A 1WJUA 2DHZA 2UYZB 5IO9A 1PYWD 4XDDA 2L00B 1I4PA 2Z0SA 5C4XG 1KRHA 4HCPB 2V4LA 4HPMB 3BK1A 1O78A 2RKSA 4EQPA 1KLGD 1WFQA 1NYRA 4ZUJA 1JR0D 4PT5A 5T1GA 5FR3A 4HXDA 4WURA 1GUAB 4IUQA 2FBWB 1PFBA 2R93B 2DZKA 3EVQA 5ELNA 2D2QA 3HOZB 5IYBG 3ZRCA 4RG1A 2K32A 1WTWA 1Y1VH 5C3WA 2ASBA 1IHZA 4US8A 4WQMA 4A76A 1N33L 2XGTA 5DEHA 2WAQE 4X62Q 1CA5A 1FMAD 1QZEA 2Y5BB 3Q3FA 4B3ML 2F0HA 5L37A 2BTEA 4MH8A 2FIDA 5ELCA 3Q6BA 1B2TA 4OXPA 3ERQA 5M5WH 3NTIA 3V61A 5K36H 1PTOC 5BN5A 4R4IA 2LFIA 2QF7A 2G3QB 3AEBB 3DVGY 4K14A 1PH3A 3GP7A 5M5XB 4E74A 2K5DA 3PGEA 3UGBB 4IUPA 4O1NA 1KOTA 3WOEA 1PGBA 2BE5D 1KRSA 4JBKA 2JP1A 4II3B 1SNPA 2X6LA 4A3JH 1NBFC 4LDTB 1V1OA 4X65L 4LFAL 2DYMA 1RCVD 2ZCCA 4JVZA 4DV5L 2AEHA 2FCQA 3E9SA 3Q8BA 3X23A 2MA9B 5KEEA 1LTAD 2ASQA 2QSDA 1A8VA 1NUCA 4ZRZA 5G55A 3APDA 1E8XA 3JVZX 2L0TA 4KN4C 1I94L 2QIEB 1TWGB 5BYQA 1E7UA 1B50A 1UH6A 4QUFA 3QIJA 1Q82C 2N9LA 3DHHC 4BBNC 2BOSA 3WDNA 1Y1VB 4LTUA 4K7SA 3G6JB 3NUCA 5EKKA 1PH5A 4LNKA 5C4ZA 4K0KL 2R3ZA 1UE1A 3KJOA 3H09A 4DR1Q 1J8IA 1SXTA 4ARIA 1S5DD 4JWUC 4M8NA 3V60A 5KYIA 1YN3A 4L5TA 3QARA 1HZAA 4KZ0A 1U4PA 1VLBA 1G6PA 3A9KB 4C56C 4NW2A 3Q8AA 1L0VB 1X1MA 2IJ0A 4GZYC 1V9JA 1HZCA 1P8LA 1T3QA 4IM3A 1R4NB 3KLSX 4CO7A 2GVBA 3A7AB 3UE1A 2K6QA 5EJWA 2E5LQ 2EQSA 3Q24A 1SNDA 2MHVA 4DUYL 4F87A 2ZEQA 2WQYB 3A56A 4MDKE 4XTCS 2IYDB 4NAWA 1SGHA 1LT5D 4NMZA 2QMTA 1J5EL 3DWAA 4PMWA 2KNBA 4WFN3 5J22A 3RNAC 4JWSC 1KFYB 2MBHA 4LF7L 1PUTA 1PDXA 3GTGB 4W9LA 4LJOB 1TKWB 3HKZG 2ZZPB 4YTNB 4LK1C 4X3SA 2RDBC 3Q3JA 4GLVB 2KJHB 4BKTA 2WDTB 3L54A 5HG2A 1DGSA 3ZRFA 3W1SC 4MGYE 2L83A 1DCZA 3W3AA 3T51B 3CCSA 3GTQH 4GN1A 1O80A 5HI1A 5FO8B 1FR3A 2LUEA 4RHRA 4IG7B 2MO0A 4HAEA 4L63B 3ZTCA 4YHHL 1T0QC 3WOFA 2CQAA 5JJLA 1NMFA 3K80C 3H3VI 4J8QA 3LGJA 1FFVA 1JRPA 2KEDA 4XZ4A 3I4MG 3KF8A 1Q1BA 3FEWX 2NPTA 3BINA 4DR6Q 3M95A 1MIUA 1E7ZA 1L6VA 1JALA 2NS5A 4EVOA 4ZKCB 4RM9A 4B95A 2LUMA 1TWHH 4AYBB 3M3JA 4ZDVA 3J7ZC 1BBXC 5EPKA 1AARA 4AQ7A 3PZ7A 4IUMB 4LNOA 2A69C 3AMUA 3PO3B 1LV9A 1WGGA 4X57B 3WANA 3K6OA 4W9EA 4GNXB 2LJIA 3ZNZB 5IGEA 5CTRC 1LTLA 3BVMA 3P42A 4LCDE 2D62A 1I4HA 4EUTA 3HFZB 1EU3A 2F3VA 5COYA 4JOIC 1TZOA 5E6OA 2JA7H 4NP5A 2BQQA 5JEAH 3BG3A 3M85A 1RWSA 4OELB 2F0OA 4MJSB 1ZDVA 1SF0A 1BCPD 4TQ0A 2CR5A 1HH2P 3OW2A 4KSLC 1D1KA 3ULPA 2V3PA 4G57A 2LGSA 5IP4D 3SHLA 2KFKA 3AXCA 4ME3A 4RKLA 1SFOH 1VQOA 2IL8A 2ENBA 4UP9A 3L0WB 4DNIA 4LF5Q 2KDFB 1FGBD 2RDGA 4FP5D 4WJPA 3ZJTA 1O7IA 4C4VA 3K59A 4OIKA 2KLCA 1IUEA 3N1XC 1JQYD 2EYLA 5L83A 4HROA 3I4OA 3MTSA 1WZ3A 4DXGA 2L0CA 4WJ4A 3I4LA 1WRIA 2ZT9C 1JC7A 4JI0L 2BF8B 3CCUA 2C7HA 1HQMC 3W9CB 1XPRA 1OGWA 4JG2A 2Q2HA 3QJYA 1WY8A 2WXKA 3F2UA 3KLSA 1XF5L 1BKBA 2GBMA 4O2DA 2M56B 3KWLA 1Y1WG 3OWFA 3CP0A 4QCLA 2JA5B 4MGIE 3VYSA 4EZLA 4A3CH 2A8VA 2Q2TA 1GO3E 2K6DB 2PYKA 1P0RA 4C3JH 3Q2AC 2D3AA 3C1FA 3SE0A 2BYEA 1ROEA 3DWGC 3Q23A 1NR2A 3K0XA 2CCZA 3V6EB 2NPTB 1F2YA 2CHXA 2JA7B 3QR8A 3EUB2 4OWWB 1TWCH 4LNIA 2Y5CA 2AYOB 1WXQA 1L0YB 1EM7A 1QLBB 3CWIA 3U8ZA 3VR5A 3EJIA 5E1FA 1JMCA 2JVCA 4IWOA 1Y14B 4QF4A 3PO2G 1QNKA 3LWUA 1EIHA 4FVMA 3N6RA 3IHPC 4FJVB 3M7GA 3QK0A 2I1JA 1WTQA 1A6XA 2HHHL 3VHTC 2HD5B 1ESRA 1RJTA 2I5HA 3AH7A 1O7YA 2ICIA 3KJPA 1X3PA 1H95A 1ASZA 2OTJA 1JB3A 1HE8A 3ENEA 2N3SA 2AQ1B 4HIDA 1SR3A 4ZCKA 2KWUB 2UU9L 3MP9A 2KTRB 4KK7A 4DV3Q 1MVKA 2BW2A 4JL9A 1JWMD 3ZIMA 4DAPA 1WVLA 1MFWA 2GBNA 2IX3A 5C4XB 1FO4A 2E3TA 4RM8A 1FD6A 4A3EG 2A74C 3CQZH 1WR1A 1XX8A 1DXMA 1WCMG 2KFKB 4R4OA 1IPGA 5D7GA 2XTIA 4OWTB 1YHAA 3MXUA 4C3JB 3D6WA 3CKIB 1D7QA 1F9RA 1UAPA 4HSVA 4BA2I 4PYUA 4E6IA 1BUVT 3SFDB 1KDAA 2F0PA 1ZDXA 3R3MA 3SU8X 1KNEA 4HN7A 3ND9A 3H91A 1VRAB 2DY7A 1GOZA 1H9JA 3C19A 2PLPA 3EGRA 2IT1A 4A20A 4F8MA 4LF8Q 3VYTA 3HOWG 3EROA 1PRTB 2LXKA 2KAJA 3H94A 1XO3A 4EZJA 1QUQA 1P9DU 2BKFA 1PLFA 3TMEA 1WYGA 1CMXB 5C44H 4JI6L 4MTKA 1T0YA 2AMCB 1XMQQ 2E8GA 5CC4A 3L2PA 3TZDA 3LJ3A 4HJAA 3LDZE 2B63H 4OO1G 5IYCH 4K8IA 3J81E 1NEKB 2MP2A 2NVUI 3QC8B 4HJGE 1E1OA 1ZXTA 4C00A 2VZKD 1ICWA 2B29A 3G4SA 1PFDA 1V86A 1SJHD 2KTFA 2WX1A 3BWUD 4ZRJA 2UXDQ 5LNK1 1UEAB 4L2YA 2FJ2A 4G4KA 4NJ6A 1C76A 4JW0A 5M5YH 3RNFC 4BOSC 4KV6A 4ANXA 2LFNA 1AYFA 3HRDD 1EY5A 1YQ4B 5G5GA 1V1QA 4LF4L 1WX8A 2A19A 2JPHA 2OEDA 1L2NA 1L1OA 1V80A 4XXEA 3OTOL 3MC0B 5C4JB 3OLMD 4A9AA 5IA7A 3PUXA 2FE8A 1FPYA 1BCPB 2NN6H 4A3MH 5HURA 2K9XA 1SROA 5KGUA 5C0XH 1D2BA 1TZ1A 2A6ED 1J19A 2IGHA 1B3QA 5F2DA 1G6JA 1NI3A 1KDCA 1VF5C 1WR6E 2EOTA 1U4LA 2BBCA 1IBMQ 3J80L 2G9DA 5JPNC 1WRDB 4I65A 1HCZA 3KLWA 1XLOA 4M8AA 4ODGA 3C46A 5C44B 1DOXA 3E3XA 2XSCA 4DR5Q 3V2TA 2B2VC 1R4MI 2LY7A 4DR2L 1M1KC 1WX7A 1EY9A 1X3QA 5M3FG 2NWGA 1R4MB 3NTHA 2G45B 2DZJA 2GVAA 2EYJA 2KUMA 1FXAA 2CHWA 4YIJA 5CHWA 1ONLA 4IPGA 2ZNVC 1H9MA 2HIVA 4DR4Q 4FJYA 3RZFA 4JI8Q 4M8MA 2WAQG 4LF9Q 2J52A 1P7FA 4DNRB 5JVG3 5M5YB 1E3PA 4AQYL 4MIUA 4JGHB 4K6DA 3T1HQ 3ER0A 4GGQA 1QUQB 3TS0A 4GDKA 1T0RC 1STHA 2BE5C 3HKZB 1R4PB 1PTOF 1E8YA 3U7DA 3S15H 3GS2A 5AZHA 2OWOA 1WF9A 4M00A 4AP4C 1N36L 1UBIA 2UWQA 3BIID 4QL5A 3H7PB 3P1MA 3T3NA 2MP2B 4IO9A 2EDGA 2CW0D 1F2RI 4HPPA 3DBLI 3BYTB 5CMDA 5C4HA 2EMTA 3GTLH 2F0WA 2JA8G 3S1RH 2VRRB 1I7HA 4A3DG 4UDUC 1HFNA 1YQ3B 1C8CA 3NTKA 2F1MA 4TKNA 2M0XA 3U4EG 2OEOA 3B9JA 4GN4B 5MPOA 2D0OA 1S5BD 4BFRA 2L1BA 1WXAA 2G4DB 1AH9A 3AU4A 2ZXPA 2UUBQ 1VZ8A 3QX1A 4NPNA 3TS2A 4IPCA 1SE3A 3H8HA 3S9WA 5LHY1 4X3KA 2WXPA 4RH6A 2KACA 4BBNF 2MGSA 3A1QA 4LFBL 1VQGA 5AEKB 2EKIA 3PSEB 3IL8A 3DDCB 1GUSA 4B6WA 4TRDA 2VH2A 1KAAA 3PRZA 3FKYA 3I73A 4PS8A 1WZ0A 1LLRD 1QOFA 2GA4B 3H15A 3VH4B 4A75A 3HOYG 2LZ6A 4B3TQ 3U2SC 2NBVB 4MN3A 3ZQ4A 1ZKOA 2EY6A 4KKJA 3JC66 4R3DA 1PFMA 3A0JA 4JLCA 4KMUC 2PI2E 4JI1Q 2M17A 2F0KA 1NCVA 1CZPA 1XNQQ 4A3LH 1IGCA 1FJGL 2BB5A 3HOXG 1GKHA 4KTAA 4AH6A 2F0QA 3W1YA 1C48A 3NVVA 4DV4L 3EHVA 4PG3A 2Q5WD 3IFDA 5EE9A 1PYSB 2N49A 5FKAC 5FOBB 3DBSA 3L08A 1I6HH 5IP9G 4GIVA 4DDID 3QA8A 2Q2UA 4HLEA 1CFMA 3ICEA 4GDKB 3ZYYX 2AHOB 2LRWA 3TEXA 3N52A 3GDEA 3K57A 1NI2A 4FBJB 4KKIA 2ES2A 1X65A 3SD5A 2WFWA 4QJFA 3QHTA 2KCMA 3SGIA 2ZXOA 2KQ7A 3TEZA 1WD0A 5JJIA 3Q8CA 1K0SA 5BN4A 3J81L 5FK9C 5ELFA 3J7AF 3VUYA 2AQ2B 1V1PA 4X64Q 3AE8B 2BWES 3SK6A 2KDMA 2ON8A 1Y56A 4K8JA 1WE6A 1PGAA 4AOFA 2GRIA 3Q22A 3APCA 1OTRB 4A3GH 2JA9A 2IO2B 4HIMA 4XT1B 1VQ7A 3GZNB 4QMGA 5IYDG 2YVCA 2HJ8A 3A1QB 4E71A 3CSTA 1OXXK 1G291 2ZTCA 3I90A 1OQRA 4B9XA 3PO2B 1I6VC 2R6GA 3DBHB 3H0GH 4DV6Q 3S17B 1GC7A 4H2AA 2M9VA 5DLQE 2E2JB 2JXTA 3IG3A 4P72A 3S16H 4ZRIA 4HJ7A 1J7CA 2V0GA 2K8BA 4DNTB 1YNTE 4IOCA 4WJ3M 2SEBD 3BU2A 2WB1E 2X6GA 2WKDA 1BCPC 4JC0A 2E2IH 1EY4A 4X6AH 1FRRA 2LGYA 4NQKE 5CV8A 3VR3A 4CYEA 4DK0A 3RLNA 2EKEC 1TR5A 4X62L 2JZZA 1H9KA 3K8AA 4G7HC 4NY0A 1V97A 3G6EA 2KD0A 3DXJC 4A3EB 2MBEA 1VQ4A 3MTNB 1KM7A 1SYFA 1UE7A 4FXKC 3AN1A 1S3SG 2C35B 2ZJPA 2V1CC 4C3IG 2J0KA 5IODA 3ONSA 1B4OA 2K03A 1BXTA 2LRUA 3VRAB 1F2MA 4F1SA 3E9IA 3FPPA 4H13C 4YSYB 2MEKA 2Z6KC 3OW7A 4KGSA 4G3XB 4OEMB 2MH7A 4YWMA 1BF4A 4OX9Q 4HJ5A 1PQSA 1QKZA 4KVGB 3HOWB 1VQFA 2FMCA 1P16A 3X3MA 3NPPA 1RKNA 4DV2Q 4O42A 3EFXD 1Q1EA 2EE1A 3P1HA 4IFDG 4ZYSA 2KC2A 1XLPA 1STAA 1KNAA 4OO1I 1RHPA 2L8JA 1LYLA 1QQRA 2F0VA 3S16B 3P4SB 1XLNA 4UHVA 3HOUB 4N9F4 1T9HA 1VQ8A 1DM0B 1MI2A 5EGTA 1YJNA 3FKIH 1GHJA 1JOKA 3GTMB 1E8WA 2KHJA 2AX5A 1J7AA 2WLBA 4QB4A 2IY5B 1I5FA 3NOBA 4PK1A 2WDRB 2LJ5A 4B08A 1TT2A 5J1ZA 1I4XA 1IYUA 2CFMA 3JAMc 1C77A 4WAAA 1FD7D 1QOAA 5J18A 5JOBA 2KMMA 4DR1L 3W1SA 4FO2A 2F52A 3KDFA 2JEAI 4ID6A 1CM9A 1NTGA 3STBD 4BBSB 2K25A 3UDIA 3PIOA 1QZGA 1K8OA 4ICUA 4USAA 2B2TA 1KIXA 2I38A 1U9RA 2A4ZA 3EFUA 1F0ZA 4XWTA 4K2LA 2REXA 2WXRA 1SMYD 1L0XB 1LUZA 2A68D 3AULA 3DUZA 2CS4A 3NHEB 1WJ6A 2WXJA 3MFGA 1QT9A 1WIAA 2L11A 4LDTD 1LM0A 3G48A 3M4OB 1DYQA 5HGQA 2Y0SE 2E5LL 3O65B 5J2RA 2MQHA 4F7XA 3RZWC 1LTTD 4W9JA 1VQ5A 3AE2B 4H7BA 1PVOA 1NAPA 1WGDA 1B44D 4P16A 3PVLA 3S14B 1TBEA 1LTRD 2DAJA 2XEWA 3HKSA 1TWFH 1N5WA 3ZGZA 2DGYA 2AUJD 2CVRA 1YEZA 5JJKA 2CWPA 4S3SA 5E6PA 3U58A 1MHWC 1X6OA 4MSMB 4DR7Q 2B8GA 2K5WA 1MPEA 4LNNA 4A3FG 4DHJB 1ACCA 5M3FB 2QJLA 1K83H 4IURA 1R9TB 1EYGA 4LF6Q 2R7ZH 2N7DA 4N9PA 2OQ0A 3ZNGC 4LWCA 4PQXA 1UZXB 2FCSA 3J80c 2A6HD 2PMZB 2N9XA 3NG0A 4JPSA 4K7UA 2O4XA 1HNXL 3RZOH 4JE3B 4EE2A 5IGFA 2CQOA 2BPSA 1I4RA 2NVXH 1H8CA 3NELA 1ASYA 1DOYA 5D65A 4N9TA 2JRHA 1KABA 2IWHA 4IM2A 3TRZA 2DYBA 3OAWA 1XPOA 2JU6X 1PDQA 4H44C 1DJRD 1SE2A 4K5VA 3FC4A 4DR6L 1E6EB 2CU3A 5D3DA 1WTOA 1Q7YC 3TEWA 3C0RB 2JEBI 2R93H 1HZ6A 3KWVA 3MC9A 4ZKBB 2JA8B 1TXYA 2VW9A 3HOVG 3HOZH 4IW0A 1EWCA 4A3DB 1IBKQ 2C9WB 2EMSA 1CZGA 5IWAL 4TMAB 1VQ9A 5L95C 1T5EA 2OF1A 2ID0A 3BYYB 2QEXA 3KUCB 4YXDB 5ELBA 1X56A 2HQLA 1C0AA 2KQSA 2N1VA 1EEFD 2K5VA 4QUCA 1Q5WB 3BY4B 4ASWC 4GKJQ 4CQNA 1E0BA 3D4RA 2LVOA 4GLAC 2SNSA 3QAQA 2A6EC 1GD7A 2N7JA 2M00A 2XK5A 2KVZA 1PH9A 1K83B 3ZNID 1V5TA 4FF4A 2R7ZB 1J9OA 5M5XH 4N59A 1JOQA 1C9OA 5EPLA 2D0PA 3VR4A 3PIPA 4I7AA 4GOPC 5I2YA 4IKGA 1E2ZA 3KFUA 4M02A 3DWMA 5FLMH 2NVXB 2HE7A 2J53A 3HOYB 1N32Q 1XMOQ 3W5VB 2IGDA 3F2DA 3IAS1 3A54A 1TWAH 1JWAD 1F2LA 3WWVA 2B2UC 4LF5L 2DBYA 5T1IA 3W2DA 2EYHA 1ILPA 3IT6B 2ZVOA 3C8YA 3E56A 2I07B 5J3BA 1AN8A 1EYAA 4KJOA 3PGZA 3QG1A 1TWGH 4BY7G 3HOXB 1G6ZA 3MC8A 4LLGM 1B7YB 4DHZE 2BYTA 4CKCA 1IBXB 4MT5A 2WGSA 2BA1A 3RFZB 4TVAB 3VR9B 3GE8C 3Q3MC 1MG8A 1TGZB 4X66Q 1UWXA 2XRSD 3SK5A 1E7PB 2FXQA 3I3CA 5CYUA 5GAEC 4BY1H 4GLSC 2EYMA 2X38A 4WWPA 3HM6X 3D32A 1WGYA 2B8FA 1EQVA 2PNRC 3DEOA 1AEXA 3CCLA 5G3LD 2YU9B 4C7ZA 3Q8DA 1JMLA 4PMBA 1YQBA 1X3FA 2ZCBA 1BO0A 2CW0C 1JJCB 3GO5A 4HR7B 1OEYJ 4P73A 3PUWA 2HTHA 1V8CA 3I56A 3ML8A 2QDLA 4WRDA 4YT0B 1FXIA 4A3IG 2ZTEA 1KTKA 3FMCA 5JPMC 1ZPSA 2W3SA 4CBVA 3MJWA 2K75A 1UWMA 2YLMA 3SEBA 1RYJA 3CAMA 1JROA 1PMRA 4EX5A 1B3AA 2EJFC 4K81A 4IOIE 4B3SL 4DXFA 1TWAB 3MXNB 3ZXRA 4JBWA 1H4RA 3LWEA 2Q8TA 3NP8A 2JWUA 2HUGA 2QCPX 3FILB 2XK5B 1VQIA 3J81c 3GTGH 3N30A 4DV3L 4N8X1 1MJEA 1IBLQ 2UXBQ 4NXNQ 1JE5A 1N9WA 4HMIA 2Y5PA 3CMMB 2JF5A 1PH6A 4JV5Q 1JORA 3UQBA 2K5PA 2D3BA 2MBBB 2VB3X 3R2TA 1PH4A 2W3RA 1B8AA 4G0NB 4BY1B 1QE6A 5C2TB 5EE0A 2KMAA 3M4PA 4ULLA 1GB1A 5KHQA 2A1AA 3MHZA 4J3OD 1A0IA 5DAUA 1EFID 2F0SA 1BR9A 2WX0A 3EECA 2VZAA 4CJ1B 1PHJA 4K1RB 4KZCA 5BYSA 2D07B 1LT3D 5HHDG 5H1SE 1WTRA 3R7RA 2PO4A 3T1YL 1Q90A 1VCBA 1QCBD 1WWTA 1KHIA 2KWCA 4J6HA 5IP7H 2CWAA 4DV7Q 1JE4A 3W1GA 4FF1A 2MJ3A 2WXGA 3FAHA 3PO3H 1K9MC 2CHBD 3D6CA 1L5PA 2KO3A 1KH0A 1VS0A 2IO3B 2PZWA 1ML0D 2V1YA 3U7ZA 2PQAA 1FIQA 1SYDA 4BBRH 4GLXA 5EE1A 4DKAC 1K8RB 3A7LA 2RPVA 2SAKA 4WWOA 1OO9B 4WAFA 3NVZA 4IFDI 2IO1B 4BS9A 3OOCA 5IGBA 3SFEB 3D4DA 4NPSA 3PLUA 1ZEQX 2BB6A 1PRTF 2B63G 3JAME 1VMPA 3ND8A 2BH8A 1WXMA 5JHBA 1YITA 4KGRA 1SNMA 2MFIA 1KRTA 2NUCA 2RGFA 4FHKA 3VR8B 3DLLA 3GB1A 2A73B 3CU7A 3LYYA 5CHVC 3TP7A 3TN2A 5JJZA 2ZJRA 3I8ZA 4IWPA 3C1EA 3HRZC 2KDBA 4I6PA 5T8IA 4BXXH 2KYWA 2RF4A 3AYHB 1G91A 1PRTD 2LSSA 2J7ZA 4APVA 4URKA 3M3YH 1DONA 2LGXA 3I5JC 5FJ8H 3FPUB 2KJRA 2KWVB 2V3NA 4GN5A 3QCAA 3TCAA 5D2MB 3MEHA 3M62B 4V190 1FRDA 3J9CA 4UY8C 4A3OA 3CPFA 1EU4A 5KNCA 2UUCL 2N1WA 3KW5B 1B9RA 2LD9A 3GTKB 1P7EA 3I63C 3PRPB 2ZJQA 4A3BB 2DY8A 3ML9A 4ICVA 2QA4A 2L4NA 2EYFA 1IKMA 3DWQA 2JA5H 3AU5A 2ICEC 4EQOA 1BCPF 1F9QA 4RGNA 4BBRB 2ZW0A 1Q12A 1N34Q 3TP5A 1TIID 3J7YW 3NK9A 3GTJH 4BVUC 1K73C 4DR4L 2KC1A 2QGQA 4JI3Q 3PIO3 4LF9L 1M90C 5C5LA 1VQNA 3J80E 2BVCA 2UUAQ 3ZJUA 2NMQA 1AP0A 4U673 4RNAA 2PW7A 1LFDA 5LXIB 2DJGC 3U4ZA 1JCKB 2BS3B 5C23A 3AEEB 4H02A 3NWTA 1NVID 4XDCA 2KCCA 1RLFA 1S72A 3BDLA 4IFDJ 3CSFA 2YYZA 5A2QE 2WXLA 4NAWB 1BBWA 4BKGA 4R1JA 2PQAB 4AUQC 2ZM6Q 1SMXA 5DM63 4CJ2C 4KGTA 3JW0X 3KBXA 3ZJYC 1VQCA 4S0RA 2MJDA 2IDYA 3M3YB 3PZDA 2KOXA 3I91A 3R8BA 1XNRL 2VUMG 3DHGC 5KIXA 2EJGC 2N4FA 4I6NB 4JI2Q 4QQBX 3QJZA 2KLGA 3FP9A 2VQEL 1L0WA 5C4XH 2K5QA 1F9PA 3NZUA 2ZW1A 2LKVA 4AJYB 2HDMA 2D3CA 2RA4A 2Z9HA 4DR3Q 3A9JA 2WXHA 2EPBA 4ANWA 4ZK9B 4HWIB 4DK1A 1AZPA 2JYOA 2WXIA 2JWZA 2QKIC 4QIWB 5IYBH 2RSNA 1NE3A 4KD3A 4LJPB 5G5HA 3GTJB 4R4TA 2KCNA 4PYZA 3KF8B 4LK0M 1SMYC 4KJNA 2RVLA 2I5MX 4WJWA 2A68C 4LNQA 2B2YC 2PQEA 3K9OB 3PREA 1RL2A 2NZOA 4IJLA 3NQTA 4FXCA 4BA1I 3DBRI 3PTFC 3H6MA 1N63A 2LXAA 4C1NK 4REZA 1K28A 3TL5A 4FF3A 2XN9C 2PJHA 1RF2D 2F4VQ 3H9DA 5HKHA 5I6YA 1N33Q 1SJED 3BZKA 1O7LA 1XNQL 3C2PA 4M01A 3GTPH 1F9JA 3DPDA 3H7SA 2ZJDA 3AE9B 3ZVVA 4HCSA 3L17A 2Y0SG 3I3TB 1GUWA 4UP7A 3IXSA 4DAYA 5M3MG 2NVQH 1HNWL 3TIXA 2WYQA 3CF6E 3ABVB 3PSIA 4W9DA 3RPFC 2MNAA 4Y52H 2RSOA 1YX6B 1SDFA 5IT9E 1XCTL 5D94A 3MEFA 2K52A 4LUOA 2DENB 4K7WA 4AYBE 4MACA 1K3RA 3A55A 2A6HC 1D4BA 2EELA 1SLJA 2DZMA 2PI2A 1BNZA 1GPXA 1WMHA 2QW7A 2KECA 3X3NA 3P2BA 4ANVA 1GUOA 2NZHA 3AFQA 1CZWA 4LFAQ 5C4JH 3PIP3 3RNUA 1N6ZA 2HJ1A 3AE6B 1OQYA 4DV5Q 5GAGC 1WFYA 3PPAA 4A93G 5I6WA 5BMHA 4A3KG 4C4VB 4RFBA 1WM3A 3CMEA 3NZ3A 2V3SA 4H0LC 3CRKC 1YVCA 3P4RB 2K4KA 3PF4A 1I3QB 3OWEB 2JZPA 1B70B 1EUJA 4XQNA 1Q8KA 2NYZD 3VTVA 3JAML 4A3IB 1KLVA 2F0NA 2AWNA 1WGRA 5C6AA 2EXDA 2YEPB 1G51A 1U5KA 1WSPA 5DM73 3I4NG 4K0KQ 3GTPB 2KOLA 3KQ4A 2P5ZX 3PUYA 3HHMA 2Z6KA 3UDFA 5TR5A 4Q2JA 2I2YA 4DAVA 2JA6G 1TY0A 4DV6L 2PVOD 2NVQB 5LMUQ 3KUDB 5IAAC 2RHSB 4DK6C 3AE4B 5K5PA 2L3ZA 2KA7A 4A3GG 3P4PB 2WS3B 1EZ6A 2KQ3A 2RDFA 5CX3A 3KK7A 2KN5A 4JI4L 1II3A 5C3EG 3PZ8A 1ZXIA 1YBYA 1MSHA 1MI0A 4FN2A 4ZUIA 3SDLC 4JI5L 1Y8RC 1RFAA 3WAMA 5IN7A 4DUYQ 3H0GG 1SYCA 5JEAJ 3AB5A 1DOMA 4N6EB 3VA7A 1GNUA 4AS1A 2F0DA 1YIJA 2Z6BA 1J5EQ 2N9KA 3L10B 3RT3B 2N9PC 3RNBC 3QWZB 3LX0A 3T16A 3SVMA 4WWMA 4J15A 1A2UA 3EN2A 4LF7Q 1SRUA 3Q8FA 2MO1A 2RCFA 1G2TA 3HVZA 4YTPB 4L5QA 3RD2A 3H1UA 5E4WC 3EA6A 1FYCA 2NVYH 2QCZA 4GNXC 2ZXRA 2AKWB 3I4MH 4KDIC 1Z47A 1C4CA 3OJ3A 3IVFA 2INCC 1JWUD 3ZDMC 3ZO5B 4KX6B 1WMHB 4DXAB 4OX9L 1N5XA 2WXNA 2R2OA 1UWVA 2NBUA 3L0OA 5A2QL 1A63A 2CU1A 2PE9A 1XTDA 5IOIA 3RUZA 1OXSC 1SSNA 3AE1B 1E24A 1WGKA 3MA2B 4XYCA 1T5XD 3W5OA 1Q81C 2D5GA 4IN3A 5BR8Q 3NSWA 4CHKA 4GMVA 4W9IA 3K5OA 1VQPA 1WD1A 2KJXA 1K0RA 3F2CA 2E6XA 2LVPA 3VUWA 5IOCA 2O5IC 4HEA1 4ITKA 1QZHA 2WKCA 1I35A 3K5LA 1UBQA 3RYTA 4HCNB 2WP8J 2DNEA 4HVBA 2PNHA 3A74A 2JZ3B 4RMFA 2SOBA 4B3RL 1P98A 1STEA 4M0WA 3ZDTA 5HGTA 4W9FA 4HJKA 4RCOA 1SE4A 1YZ6A 2EYPA 2Y3AA 4L6TB 1QJOA 2JXMB 3HP3A 2JSOA 1HHVA 3DBLB 3X0WA 1TS2A 4MEMA 5GQOA 3CCMA 1JB7A 5FO7B 4GU2A 3AU7A 3M4QA 1UD7A 2NVYB 3V05A 1IW7D 4DUZL 2A5HA 2O6VA 3A4RA 3Q8EA 4KSKC 2O2VA 3I4MB 1W3SA 2LHDA 3RD4A 2UXCQ 2Z0EB 1L1OB 1RFKA 1E8ZA 2R92G 2EY5A 4W9CA 3T8MA 1CQVA 2KVMA 1WH3A 4AIMA 4IZ8A 1Y1WH 4DR7L 2INDC 4CKEA 5C3JB 4NQLB 2J0MA 2KHIA 4LF6L 5EKIA 3N9YC 2MBOA 4JI0Q 3TJPA 2VS1A 4J6IA 5IT9L 1VDVA 4R4QA 3M4YA 2IO0B 2FINB 1P1AA 1LABA 1LO5D 2BYFA 4DWFA 4NXML 2WWZA 2D5DA 4XYOA 2JJQA 3OHXC 1HEZE 2EY2A 2PVGC 4JQWC 3KLRA 2ZPNA 3NBHA 3S2HB 4C3HG 2F0MA 1KL9A 3PO2H 4LMQD 3S17H 2GN5A 2E2JH 3Q69A 1VQDA 1Y8OB 2B2WA 3ZTDA 1PGXA 1JJGA 1SE9A 2B2UA 1DD2A 1Y8NB 4JPBW 4ZLTF 1XWEA 2EVBA 4DPGA 1VQAA 2NZ1D 3P7JA 2VUMB 4DAMA 1EWYC 1LTBD 4JYAL 1KC8C 3DM1A 1UGJA 4DHJD 4EQ5A 2K33A 4EEWA 2MPMA 1QVFA 1DZ1A 1ENFA 5AUKA 3HIZA 2INPE 3A8IE 4A3EH 1D8LA 2IPKD 1YJWA 1PRTC 4CDCC 3JSVA 1Y1WB 1IL8A 1WCMH 1CQFA 2F0TA 2UU7A 2UU9Q 4EOYA 1HUMA 2O6VB 1RD9D 1J7BA 2O2VB 5H8YE 3OMGA 3OIPA 4MZ9A 4DU9A 1RRBA 1ZXHA 2MCNB 2JYEA 2M0AA 3JYUA 1EIGA 3HKZE 2IHFA 3M9BA 3O13A 2LEKA 2RMMA 1N32L 2X8XX 2D9UA 2E2DC 1XMOL 5A35A 4KY5A 3HOWH 3N3KB 1IKLA 1EUVB 2K22A 2NTTA 4BAXA 2IY0B 3QOJA 4P7IA 1BUIC 3RN5A 2LGIA 1D5MC 2J0JA 4R8IA 5EQ0A 5CHFA 4U68A 2D2CC 3H6NA 3LNNA 2JQOA 2W82A 1VQBA 3HOUH 2EY1A 1GVPA 5JHAA 5GADC 2H88B 4X66L 5M3MB 3GTMH 1L4ZB 3A8JE 3MZ5A 3IKJA 3ZJVA 1E5WA 3V96A 4JI6Q 3NY5A 5TSSA 1I42A 4RGTA 5GMVA 1X32A 4BBSH 3RNCC 4KIKA 4TQ1A 4CKBA 1WCMB 4GSWA 1Y1VG 4FDBA 3GTOB 4PMCA 1TY2A 3I57A 3Q14C 3K9PB 2LXJA 1MHXA 2LGDA 4A93B 3RUIB 1PA6A 3M4OH 1NMGA 3G7LA 4A3KB 1ILQA 4FJZA 4NAMA 1SIFA 2JSVX 2Z59B 1VQKA 3B2GA 2BKRB 3OTOQ 1C9FA 5AJ3Q 5K36G 3S14H 1D3ZA 4C1NI 3PV1A 4B9WA 2H89B 4P1BC 4NDXA 2B76B 3QWNA 1H9SA 2WXQA 3EQLC 2KHWB 5J17A 1YOVB 2OXPA 3VA5A 3I4NB 1V1PB 2R61A 3E6ZX 5FO9B 4FYDA 2YTYA 1IBLL 2KANA 2UXBL 2Z0DB 4A3JG 5M3FH 2OT2A 1R9TH 2RDHA 3RNEC 2V4IB 2VQFQ 1TYGB
chains in the Genus database with same CATH topology
2MUYA 2PZTA 1PTOB 3HS0C 4R8NA 3BVGA 1F2RC 1A3TA 4X3TA 3AEDB 2TMPA 5LL6X 4RGOS 5CV9A 2VXWA 1N60A 2IGGA 3AE7B 1HRJA 4HCEA 1OQQA 5CBAE 3TDQA 1VZ6A 4KKUA 1CT1D 3BDOA 2WP9B 3WCQA 2K05A 4FXGC 1YN5A 2HCIA 4DFAA 4OL7A 5BN3A 1E9MA 4ME5A 4XYQA 3R3OA 2WAQB 3MXGA 4EGVA 2W54A 3VR2A 1H9SB 3NBIA 2L12A 4I7ZC 4G7ZC 1STBA 3S1NB 2ACZB 3J7AV 5ELDA 4DA2A 1OXUA 1S5ED 1YJJA 1Z7TA 5IGCA 4ZOHC 3RLFA 2F0EA 2PIAA 3CHBD 3T56B 1ET6A 1WTPA 3CIRB 3IAM1 2LMCA 2K1BA 3K0YA 1Z6HA 3K7AB 1LT6D 2BDNA 2J4XA 2QILA 4R9WA 3BK2A 2DYOA 5KYLA 3AB9A 1FFUA 2SNMA 2K0PA 3RZDB 1HPCA 3HZXA 3OMCA 2WXOA 1EL0A 4ZAIA 4HEDA 1HA6A 4OVZA 2KEEA 1I50B 3U9OA 5EPJA 4ZHPA 2KWDA 2WU2B 1HZ5A 5IGGA 4BWGB 1VMCA 2O5JC 5JEAG 2BT6A 5G3LF 1R4QB 4KD4A 3QB3A 1C4AA 4K6LA 5I4DA 2PMVA 1NYQA 2F0LA 2L5TA 1K8MA 4Q0FA 1EY7A 2CJOA 1Q8IA 4HMJA 5J39A 1PXUA 4MM3B 4RKBA 1STGA 3D4WA 4XQQA 3B2FA 2KHSA 1HTLD 1IW7C 3SK8A 4P2CB 4A8XC 4GDLB 4C3JG 2B39A 2LMCB 2X69A 1TKEA 1QILA 3Q0AA 3NVWA 5E4XA 2XIWA 4C2MB 5JXVA 2Z1CA 4LAAA 2VB2X 5CV7A 2TSSA 5CV6A 1V43A 2J42A 4IFDH 3IFTA 4TQUS 1JOOA 3AEFB 4YTMB 4HTHA 2SDFA 1RM6C 3C3LA 2Z4IA 1LTGD 4XQJA 2GI9A 1ENAA 4A6QA 4OIJA 4XE0A 4RWSC 1STNA 5CV4A 1D5XC 2F0JA 4RF0A 2PKOA 3NRZA 4P6VF 3DEPA 2EJMA 2C9OA 1JWSD 1EYCA 4C3IB 2MJEA 4K5XA 2V4DA 1STYA 5FLXL 4DGZA 3GQBA 4OW0A 2DNCA 1C79A 3AV8A 1A15A 4A90A 1QNUA 5M5WB 2B2VA 3RMHA 1TS4A 2IX0A 3AEAB 2EYOA 2BS4B 4CJ0B 1YNND 1ZUD2 2G1EA 3T53B 1AW7A 4X3UA 4A3JB 1E0ZA 2YEPF 4Z9CB 2Q8RE 2F03A 4RCNA 2G9HD 5C5MA 2F4IA 2IW3A 4CGYB 1CA6A 2F0GA 1K53A 1FNUA 4FNFA 4DF7A 1CI3M 4JK1C 3AE5B 3OPOA 3P20A 3FVQA 4XDXA 1GB4A 1UUPA 2NN6G 2B2TC 3K58A 5C0XG 3AE3B 1E2VA 2GB1A 2Z8LA 4KHZA 1B1ZA 5NUCA 2F0UA 1A3UA 4D2KA 4ZQ3A 4ARCA 1FEHA 2PTLA 2FHTA 4DQOC 4A3FB 1FM0D 4ILWA 1IYVA 3M7NA 3ONAB 3NVYA 4MHEA 1GUGA 5KNDA 2E74C 1XYIA 3T13A 1XEEA 3VQIA 1C4PA 2XNAC 5E3FA 1JW9D 1B9NA 3TP8A 3TSSA 2WXMA 5G5GA 1QG7A 4WORA 1E2WA 4XT3B 1Q10A 3VRBB 4WH4A 3GTQB 1GAQB 1HA5A 1SIJA 2ONQA 1ZYRD 1EYDA 1SYEA 3HOVB 5C3XA 1I4GA 1YMHE 3NXWA 1M4VA 1LACA 3PUVA 1SAPA 2L9HA 1QOHA 2RQXA 2XWJB 2N55A 1ESFA 2Z4HA 1TWHB 2E75C 1VCIA 4OZAA 3AEGB 4FF2A 2Q8IB 1C4QA 1RODA 1SEBD 3IT4B 1BDOA 5CGKA 4J1MA 4PV1C 1QB5D 1DOIA 5I9PA 3VYRA 1LT4D 4HRSA 3Q6SA 4BY7B 2K28A 1U4RA 3NQIA 1JICA 1ENCA 1SFOB 3V3XA 1S4ZA 1SNCA 2INNE 5CORA 1SNOA 1TJEA 3S1QB 5KRUA 3UI3A 4IUVA 1UNSA 1V8QA 2K01A 4IUNA 1VF7A 3DMUA 5EBCA 3L7ZC 3AM9A 3T3OA 2XVSA 1YN4A 4NKLA 3QIAA 1BMLC 2QDBA 2JYTA 2AWOA 4KY6A 4Q5VA 1PFNA 1NENB 1FCCC 3SDZA 2BA0A 1TWCB 3NS1A 1GXDC 4XIGS 3H3VC 1EOTA 1HUNA 4K5WA 1LTID 3GD7A 3U9SA 3URYA 1KLUD 2NBFA 2JQRB 1TU2B 3K5MA 2PZUA 1F2ZA 4YWGG 4EQNA 1QOBA 1S5CD 3PO0A 3UI2A 3D31A 1SSOA 5D14A 2K6AA 1CJEA 1RTOA 3SR1A 1JWBD 1EY0A 1T6BX 1MHHE 1YNJD 4UAIA 3L4PA 3CQZB 1EY8A 1CK1A 1VDZA 3AMZA 5EE3A 1EQTA 2NB0A 4DN4M 3HUIA 2N88A 4NJCA 1Q3LA 3NWSA 1MGSA 3TEYA 1MD2D 2WDQB 3SK4A 4K2KA 5JAVA 3HEJA 5LL6S 3W5UB 5GXGB 2B63B 1RTNA 2AUKA 4OZBA 1QWYA 1N62A 2WU5B 1B9MA 3P63A 2FUG1 1LTSD 1M8AA 1SB3C 4ZHOA 2H4OA 2WDVB 4L1BA 5CR3A 2NN6I 3DHQA 3SXHA 2DWQA 1VR9A 1TS5A 5C0XI 4A3MB 4N58A 4A55A 3D3RA 1CHQD 3P4QB 4Y7NB 4WIPA 5EBDA 1W6JA 3HVDA 1PTOD 4RF1A 2XRQD 3BDCA 4RAUC 4YSXB 2WB1B 5CBEE 4KKTA 1GHKA 3E0JA 2W55A 5M9OA 4B0MA 2EXZA 1HQRD 5AUIA 1GUNA 1A70A 2LS01 3OIQA 3HG9A 1BQQT 3I72A 4IQZA 4FXDA 4IALA 3TBIB 1GJXA 1AZQA 2EZVA 1YNNC 2KN4A 3MJ5A 4KHVA 1FCLA 1QOGA 1NSNS 3S15B 4L23A 1SBBB 4NZLB 2WINB 3QO2A 3QOLA 2MJ8A 5EKLA 2LHEA 2WNMA 2BCOA 1D1IA 3S2DB 2FFKB 2OHFA 4F88A 4HKZE 1XTCD 1PZKD 4CHTB 2NTSA 1I4QA 3PUZA 4OHJA 4OZCA 3GTLB 3SR6A 3DWPA 3S1RB 5JVH3 1AFPA 2F3WA 2BS2B 5C0XJ 2VZKB 1EY6A 2KQ4X 2M19A 3L9AX 3MXPA 1GUTA 3R2IA 1D6EC 1CHPD 5ISRA 3CRLC 1PZJD 2WV6D 3MFYA 1QF6A 3L3OC 2E2HB 3LXFA 3MVVA 3LB8C 1H9RA 5CV5A 1XLQA 1HXYD 4OO1H 2Y0SB 1KDBA 1D5ZC 1WTXA 1PZID 4RA8A 1PTOH 1B53A 2WIIB 4TKOB 1HTPA 1ZOYB 1K51A 2E76C 2PPBC 2L55A 1ZE3D 1EZ8A 3VYUA 4KKSA 4RHSA 3OSOA 1L6UA 1TQOA 1I6HB 3IAYA 3BVZA 5DNFA 1IGDA 4ABNA 2L1AA 1U4MA 2VNUD 4PNYA 1ZYRC 1G8ZD 2A69D 3VR6A 1WTVA 2NVTB 2WACA 2PCFB 5I2XA 1BOSA 1ZP0B 4KI0A 1W6KA 1SNQA 4B0EA 1VJKA 2HDLA 2HDEA 1C78A 3HGBA 4HSPA 1A2TA 4US9A 4IDIA 2IX1A 4YSZB 2JA6B 5AFWA 3KBGA 1RDPD 2DN8A 5D3IB 4A3GB 2I46A 3S1MB 3KUPA 1CTMA 5C3EB 1SYBA 3NHHA 3TZUA 1EEID 3FRPB 4XWWA 1OFFA 2MP1A 2N0SB 3H0GB 3U52E 2K04A 5H92C 2F0IA 2FMMA 1DGJA 1KF6B 4ZRPA 3I70A 1L4DB 2QEJC 1F9SA 2E2IB 4L8JA 4JX1C 1ET9A 3I9V1 4G7OC 5I9OA 5HFYA 1S5FD 3T4AC 4LJZC 3TP6A 2F0FA 2M2LA 5BMIA 1F77A 1YJIA 4OGQC 1E10A 3E5SA 3TUOA 4HKQA 1OXTA 1FNWA 2JE6I 4TSSA 2L32A 4M1UB 5FLXE 3P75A 2HTME 2O2LD 1DOKA 1TS3A 3FDTA 2XWBB 1Y69U 3ETRA 4IUTA 1IBXA 1OXVA 1K52A 3PV0A 3AECB 5BYRA 3FKIB 2H1EA 2RBMA 4V0BA 1NR4A 1A3VA 1SYGA 1DOLA 5E6JA 2K3UA 1XCQL 1AWDA 2K7VA 4IUUA 1G2SA 3BS1A 2BDOA 3NUHB 2R92B 1TVXA 3D8GA 2CJNA 2JX5A 3BZDB 1Y8PB 2PW9A 3R93A 3NE5B 3MAQA 3GV6A 3A8KE 4KN7C 1EWHA 1YNJC 2B2YA 2L52A 5ELEA 1TWFB 1MBYA 3ITPA 2HQEA 1TKYA 3MXNA 1FNVA 1VZ7A 2J0TD 1TKGA 4KY7A 1K50A 4RGMA 3FILA 1MSGA 2DLBA 3K5NA 4ZRQA 1HFGA 2PW5A 2WXFA 4C3HB 1XXGA 5BMGA 5IIFA 1O7ZA 3RZOB 3MHBA 2HCCA 5IGDA 2B2WC 3MWYW 2AQ3B 5KNBA 3PMFA 1R7SA 1JQ4A 2C5CA 3GV3A 1N61A 1PYWD 4XDDA 1I4PA 1KRHA 3BK1A 1O78A 2RKSA 4EQPA 1KLGD 1NYRA 4ZUJA 1JR0D 4PT5A 5T1GA 5FR3A 4WURA 4IUQA 2FBWB 1PFBA 2R93B 3EVQA 3HOZB 2K32A 1WTWA 5C3WA 1IHZA 4US8A 4WQMA 5DEHA 1CA5A 1FMAD 2F0HA 2BTEA 4MH8A 5ELCA 1B2TA 3ERQA 3NTIA 5K36H 1PTOC 5BN5A 2LFIA 2QF7A 3AEBB 4K14A 3GP7A 5M5XB 2K5DA 4IUPA 4O1NA 3WOEA 1PGBA 2BE5D 2JP1A 1SNPA 2X6LA 1V1OA 2DYMA 1RCVD 3E9SA 3Q8BA 5KEEA 1LTAD 2QSDA 1NUCA 4ZRZA 4KN4C 2QIEB 1TWGB 1B50A 4QUFA 2N9LA 2BOSA 3WDNA 1Y1VB 4LTUA 3G6JB 3NUCA 5EKKA 5C4ZA 2R3ZA 3H09A 1J8IA 1SXTA 4ARIA 1S5DD 4JWUC 5KYIA 1YN3A 1U4PA 1VLBA 4C56C 4NW2A 3Q8AA 1L0VB 2IJ0A 4GZYC 1T3QA 3KLSX 3A7AB 5EJWA 3Q24A 1SNDA 2MHVA 4F87A 2WQYB 3A56A 4XTCS 1LT5D 4NMZA 2QMTA 3DWAA 4PMWA 4WFN3 5J22A 4JWSC 1KFYB 1PUTA 1PDXA 3GTGB 1TKWB 4YTNB 4LK1C 4X3SA 5HG2A 2L83A 1DCZA 3W3AA 3T51B 1O80A 5HI1A 5FO8B 1FR3A 4RHRA 4HAEA 4L63B 3WOFA 2CQAA 4J8QA 1FFVA 1JRPA 2KEDA 3KF8A 1Q1BA 3FEWX 1L6VA 1JALA 4EVOA 4ZKCB 2LUMA 4AYBB 1BBXC 5EPKA 4AQ7A 3PZ7A 2A69C 3AMUA 3PO3B 1LV9A 3K6OA 2LJIA 5IGEA 3BVMA 3P42A 2D62A 1I4HA 1EU3A 2F3VA 5COYA 1TZOA 4NP5A 5JEAH 3BG3A 3M85A 1RWSA 2F0OA 1ZDVA 1SF0A 1BCPD 4TQ0A 1D1KA 2V3PA 4G57A 3SHLA 4RKLA 2IL8A 2ENBA 1FGBD 2RDGA 4FP5D 3ZJTA 3K59A 4OIKA 1IUEA 1JQYD 2EYLA 4HROA 3MTSA 4DXGA 2L0CA 3I4LA 1WRIA 2ZT9C 1JC7A 1HQMC 3W9CB 3QJYA 2WXKA 3F2UA 3KLSA 1XF5L 2M56B 3KWLA 4QCLA 3OWFA 2JA5B 3VYSA 2PYKA 3C1FA 3SE0A 1ROEA 3DWGC 3Q23A 1NR2A 1F2YA 2JA7B 3EUB2 2Y5CA 1WXQA 1L0YB 1EM7A 1QLBB 3CWIA 3VR5A 3EJIA 5E1FA 4QF4A 1QNKA 3LWUA 1EIHA 4FVMA 3N6RA 3M7GA 1WTQA 1A6XA 1ESRA 1RJTA 3AH7A 1O7YA 2ICIA 1X3PA 1JB3A 2AQ1B 3MP9A 4KK7A 1MVKA 2BW2A 1JWMD 4DAPA 1WVLA 2IX3A 5C4XB 1FO4A 2E3TA 1FD6A 2A74C 1XX8A 1DXMA 5D7GA 3MXUA 4C3JB 3D6WA 3CKIB 3SFDB 1F9RA 1UAPA 4HSVA 4BA2I 4C80A 4E6IA 1BUVT 1KDAA 2F0PA 1ZDXA 1KNEA 4HN7A 3ND9A 3H91A 1VRAB 2DY7A 1GOZA 1H9JA 2PLPA 3EGRA 2IT1A 4F8MA 3VYTA 3EROA 1PRTB 2KAJA 3H94A 1XO3A 1PLFA 3TMEA 1WYGA 5CC4A 3TZDA 4OO1G 4K8IA 3J81E 1NEKB 4HJGE 1ZXTA 2VZKD 1ICWA 1PFDA 5LNK1 1SJHD 3BWUD 1UEAB 4L2YA 2FJ2A 4G4KA 1C76A 4KV6A 2LFNA 1AYFA 3HRDD 1EY5A 1YQ4B 2OEDA 4XXEA 3MC0B 5C4JB 4A9AA 3PUXA 2FE8A 1BCPB 2NN6H 5HURA 2K9XA 5KGUA 5C0XH 1D2BA 2A6ED 2IGHA 5F2DA 1NI3A 1KDCA 1VF5C 2EOTA 1U4LA 2BBCA 3J80L 2G9DA 5JPNC 4I65A 1HCZA 1XLOA 4M8AA 4ODGA 3C46A 5C44B 1DOXA 2XSCA 3V2TA 2B2VC 2LY7A 1EY9A 1X3QA 2NWGA 3NTHA 1FXAA 2EYJA 2KUMA 4YIJA 1ONLA 1H9MA 2J52A 1P7FA 4DNRB 5JVG3 5M5YB 4MIUA 4K6DA 1STHA 2BE5C 3HKZB 1R4PB 1PTOF 3GS2A 3BIID 3P1MA 3T3NA 2EDGA 2CW0D 1F2RI 3BYTB 5CMDA 5C4HA 2F0WA 1I7HA 4UDUC 1HFNA 1YQ3B 1C8CA 3NTKA 2F1MA 3U4EG 2OEOA 3B9JA 5MPOA 1S5BD 2L1BA 2ZXPA 1VZ8A 1SE3A 3H8HA 3S9WA 5LHY1 4X3KA 2WXPA 4RH6A 2KACA 2MGSA 2EKIA 3IL8A 1GUSA 4TRDA 1KAAA 3I73A 1LLRD 1QOFA 2GA4B 3U2SC 4MN3A 3ZQ4A 1ZKOA 2EY6A 4KKJA 4R3DA 1PFMA 4KMUC 2F0KA 1NCVA 1CZPA 1IGCA 2BB5A 4KTAA 2F0QA 1C48A 3NVVA 5EE9A 2Q5WD 3IFDA 5FKAC 5FOBB 1CFMA 4GDKB 3ZYYX 3TEXA 3N52A 3K57A 4KKIA 2ZXOA 3TEZA 1WD0A 3Q8CA 5BN4A 3J81L 5FK9C 5ELFA 3J7AF 2AQ2B 1V1PA 3AE8B 3SK6A 2KDMA 2ON8A 1Y56A 4K8JA 1PGAA 2GRIA 3Q22A 4XT1B 4QMGA 1OXXK 1G291 3I90A 1OQRA 4B9XA 3PO2B 1I6VC 2R6GA 4H2AA 3S17B 2M9VA 2E2JB 2JXTA 1J7CA 2V0GA 4DNTB 1YNTE 2SEBD 2X6GA 2WKDA 1BCPC 1EY4A 1FRRA 5CV8A 3VR3A 4DK0A 1TR5A 1H9KA 4G7HC 1V97A 3DXJC 4A3EB 1SYFA 4FXKC 3AN1A 4C3IG 5IODA 1B4OA 2K03A 1BXTA 3VRAB 1F2MA 3FPPA 4H13C 4YSYB 2MEKA 3OW7A 4KGSA 2MH7A 1BF4A 1QKZA 3HOWB 2FMCA 3X3MA 3NPPA 1RKNA 4O42A 3EFXD 1Q1EA 2EE1A 3P1HA 4IFDG 4ZYSA 1XLPA 1STAA 1KNAA 4OO1I 1RHPA 1QQRA 2F0VA 3S16B 3P4SB 1XLNA 3HOUB 1DM0B 1MI2A 5EGTA 1GHJA 1JOKA 3GTMB 2AX5A 2WLBA 1J7AA 4QB4A 2WDRB 4B08A 1TT2A 5J1ZA 1I4XA 1IYUA 1C77A 1FD7D 1QOAA 5JOBA 2KMMA 3W1SA 4FO2A 2JEAI 4ID6A 1CM9A 4BBSB 1K8OA 4USAA 2B2TA 2I38A 1U9RA 1F0ZA 4XWTA 4K2LA 2WXRA 1SMYD 1L0XB 2A68D 3DUZA 2WXJA 3MFGA 1QT9A 2L11A 3M4OB 1DYQA 4F7XA 1LTTD 3AE2B 4H7BA 1NAPA 4P16A 1B44D 3S14B 1LTRD 3ZGZA 1N5WA 2AUJD 2CVRA 4S3SA 2B8GA 2K5WA 1MPEA 1ACCA 5M3FB 2QJLA 4IURA 1R9TB 4N9PA 4PQXA 2A6HD 2PMZB 4JPSA 2O4XA 4JE3B 4EE2A 5IGFA 1I4RA 1DOYA 5D65A 4N9TA 1KABA 2IWHA 2JU6X 1PDQA 4H44C 1DJRD 1SE2A 4K5VA 3FC4A 2CU3A 1E6EB 5D3DA 1WTOA 3TEWA 2JEBI 1HZ6A 3KWVA 4ZKBB 2JA8B 1EWCA 4A3DB 4TMAB 1CZGA 1T5EA 2OF1A 2ID0A 3BYYB 4YXDB 5ELBA 1EEFD 4QUCA 4CQNA 1E0BA 3D4RA 2SNSA 2A6EC 2N7JA 2M00A 1K83B 4FF4A 2R7ZB 1J9OA 4N59A 1JOQA 5EPLA 4IKGA 3VR4A 5I2YA 1E2ZA 3DWMA 2NVXB 2J53A 3HOYB 3W5VB 2IGDA 3IAS1 3A54A 1JWAD 1F2LA 2B2UC 2DBYA 3IT6B 5T1IA 3W2DA 2EYHA 1ILPA 3C8YA 3E56A 2I07B 1AN8A 1EYAA 4KJOA 3QG1A 1G6ZA 3HOXB 4LLGM 2BYTA 1IBXB 4CKCA 4MT5A 3RFZB 2BA1A 3VR9B 1UWXA 2XRSD 3SK5A 1E7PB 3I3CA 5CYUA 4GLSC 2EYMA 2X38A 4C7YA 2B8FA 1EQVA 2PNRC 3DEOA 1AEXA 4C7ZA 5G3LD 2YU9B 1JMLA 4PMBA 1BO0A 2CW0C 3GO5A 4HR7B 3PUWA 1V8CA 4WRDA 4YT0B 1FXIA 1KTKA 3FMCA 5JPMC 1ZPSA 2W3SA 4CBVA 1UWMA 3SEBA 1RYJA 1JROA 1PMRA 1B3AA 2EJFC 4IOIE 4DXFA 1TWAB 4JBWA 3LWEA 2Q8TA 3NP8A 2JWUA 2HUGA 2QCPX 3FILB 4HMIA 2Y5PA 1JORA 2K5PA 2VB3X 3R2TA 2W3RA 4BY1B 1QE6A 5C2TB 5EE0A 4ULLA 1GB1A 3MHZA 4J3OD 5DAUA 1EFID 2F0SA 1BR9A 4CJ1B 5BYSA 1LT3D 5HHDG 1WTRA 2PO4A 1WWTA 1Q90A 5BYQA 1QCBD 4J6HA 1JE4A 4FF1A 2MJ3A 2WXGA 3FAHA 2CHBD 3D6CA 1L5PA 1KH0A 3U7ZA 2PZWA 1ML0D 1FIQA 1SYDA 5EE1A 3A7LA 2RPVA 2SAKA 1OO9B 4WAFA 3NVZA 4IFDI 4BS9A 3OOCA 5IGBA 3SFEB 3D4DA 1ZEQX 2BB6A 1PRTF 3JAME 1VMPA 3ND8A 4KGRA 1SNMA 2NUCA 3VR8B 3GB1A 2A73B 3CU7A 3LYYA 3TP7A 3TN2A 5JJZA 3I8ZA 3C1EA 3HRZC 5T8IA 1G91A 1PRTD 2J7ZA 1DONA 3FPUB 2V3NA 3MEHA 4V190 1FRDA 3J9CA 1B9RA 5KNCA 1EU4A 3GTKB 1P7EA 4A3BB 2DY8A 2L4NA 2EYFA 1IKMA 3DWQA 2ICEC 4EQOA 1BCPF 1F9QA 4RGNA 4BBRB 2ZW0A 1Q12A 3TP5A 1TIID 3J7YW 3NK9A 3PIO3 5C5LA 3J80E 3ZJUA 2NMQA 1AP0A 4U673 4RNAA 2PW7A 2BS3B 1JCKB 3AEEB 3NWTA 1NVID 4XDCA 2KCCA 3BDLA 4IFDJ 2YYZA 5A2QE 2WXLA 4NAWB 5DM63 4CJ2C 4KGTA 3KBXA 2MJDA 2IDYA 3M3YB 3I91A 3R8BA 5KIXA 2EJGC 2K5QA 1F9PA 2ZW1A 2LKVA 2HDMA 2RA4A 2WXHA 2EPBA 4ZK9B 4DK1A 1AZPA 2JYOA 2WXIA 2QKIC 4QIWB 2RSNA 4KD3A 5G5HA 3GTJB 2KCNA 4LK0M 1SMYC 4KJNA 2RVLA 4WJWA 2A68C 2B2YC 2PQEA 3NQTA 4FXCA 4BA1I 3H6MA 1N63A 4C1NK 4REZA 4FF3A 2XN9C 1RF2D 5I6YA 1SJED 1O7LA 3C2PA 3AE9B 4HCSA 1GUWA 3IXSA 4DAYA 3ABVB 3RPFC 2RSOA 1SDFA 5IT9E 1XCTL 4MACA 2A6HC 3A55A 1D4BA 2EELA 1GPXA 1BNZA 2KECA 3X3NA 1GUOA 3PIP3 1CZWA 3AE6B 5I6WA 5BMHA 4RFBA 3NZ3A 4H0LC 3CRKC 3P4RB 1I3QB 3OWEB 2JZPA 4XQNA 2NYZD 3JAML 4A3IB 2F0NA 2AWNA 5C6AA 2YEPB 1WSPA 5DM73 3GTPB 2KOLA 3KQ4A 3PUYA 4Q2JA 2I2YA 4DAVA 1TY0A 2PVOD 2NVQB 3AE4B 5K5PA 2KA7A 3P4PB 2WS3B 1EZ6A 2KQ3A 2RDFA 3KK7A 1II3A 3PZ8A 1ZXIA 1MSHA 1MI0A 4ZUIA 5JEAJ 1SYCA 3AB5A 1DOMA 4N6EB 3VA7A 4AS1A 2F0DA 2N9KA 4WWMA 3LX0A 3T16A 3SVMA 1A2UA 3Q8FA 1G2TA 3HVZA 4YTPB 5E4WC 3EA6A 1FYCA 2ZXRA 1Z47A 1C4CA 1JWUD 4KX6B 1N5XA 2WXNA 5A2QL 3RUZA 1OXSC 1SSNA 3AE1B 1WGKA 3MA2B 1T5XD 2D5GA 4IN3A 3NSWA 3K5OA 1WD1A 2KJXA 2E6XA 5IOCA 2O5IC 4HEA1 4ITKA 2WKCA 3K5LA 2WP8J 2DNEA 2SOBA 4M0WA 1STEA 5HGTA 4RCOA 1SE4A 2EYPA 2Y3AA 4L6TB 1QJOA 2JXMB 3HP3A 2JSOA 1HHVA 1TS2A 5FO7B 3AU7A 3Q8EA 3V05A 2NVYB 1IW7D 2A5HA 3I4MB 2LHDA 3RD4A 1RFKA 2EY5A 1CQVA 2KVMA 4IZ8A 4CKEA 5C3JB 5EKIA 3N9YC 5IT9L 1VDVA 3M4YA 2FINB 1LABA 1LO5D 2D5DA 4XYOA 3OHXC 1HEZE 2EY2A 2PVGC 3KLRA 3NBHA 3S2HB 4C3HG 2F0MA 4LMQD 3Q69A 1Y8OB 2B2WA 1PGXA 2B2UA 1DD2A 1Y8NB 4ZLTF 1XWEA 2EVBA 2NZ1D 3P7JA 2VUMB 1EWYC 1LTBD 3DM1A 1UGJA 2K33A 2MPMA 5AUKA 1DZ1A 1ENFA 2INPE 3A8IE 2IPKD 1PRTC 1Y1WB 1IL8A 1CQFA 2F0TA 1HUMA 1RD9D 1J7BA 5H8YE 3OMGA 3OIPA 4DU9A 1ZXHA 2JYEA 2M0AA 1EIGA 2LEKA 3O13A