1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
2R61A 1ET6A 2RDGA 3BYYB 2AQ3B 3BYTB 1PZJD 1SJED 3EFXD 5ELFA 1I4QA 1L0XB 1BCPF 1FD7D 1T5XD 2AQ2B 1AN8A 2G9HD 1DJRD 4Z9CB 1YN4A 1BCPD 3R8BA 5FKAC 2XNAC 1FNWA 1D5XC 2QEJC 1SJHD 3BVZA 3MFGA 1FGBD 1SE2A 5TSSA 3TSSA 1D5ZC 4ZYSA 1HTLD 2XN9C 4O1NA 1ESFA 2AQ1B 1BCPB 1RF2D 1SXTA 4L6TB 3URYA 1GOZA 1I4HA 3O13A 4NZLB 4RCOA 1LT6D 1AW7A 1JR0D 3BZDB 1PRTC 4BWGB 1PTOH 3BVGA 3GP7A 1TS3A 1B44D 1ENFA 3R2TA 4C56C 2NTSA 4RFBA 1SE4A 2QILA 5ELCA 1S5ED 1RCVD 4RH6A 2J4XA 4UDUC 1LTID 1UUPA 2RDHA 2SEBD 2IJ0A 1BXTA 1CHQD 3OWEB 1G8ZD 1EU4A 1CHPD 2XRQD 1JQYD 1LTRD 1I4XA 5FK9C 1EWCA 1XTCD 1SEBD 3DWQA 5I4DA 1XXGA 3MC0B 1B1ZA 2NTTA 2CHBD 1CT1D 1PYWD 1LTAD 1PRTB 3R2IA 4RHRA 1EFID 1LTBD 1STEA 1V1OA 1PZKD 1CK1A 1CQVA 1PZID 1LT5D 1PTOC 1D5MC 1TY2A 1FNUA 1HXYD 5ELDA 1JWMD 1S5CD 1SE3A 4RGMA 2ICIA 4RGNA 1PRTF 1RD9D 3DWPA 1YN5A 1BCPC 1PRTD 1UNSA 4RGTA 4RGOS 1JWUD 1I4PA 1PTOD 3CHBD 1I4GA 1JCKB 4RHSA 2O2LD 1HQRD 1V1PA 4TSSA 4DXGA 1HA5A 1QILA 1TY0A 1TS5A 3EA6A 1TS4A 1ET9A 1S5DD 1I4RA 1KLGD 3DWAA 1LTSD 1LO5D 1S5BD 1KTKA 4L63B 1LTGD 2Z8LA 1FNVA 4OHJA 1TS2A 1PTOB 3V05A 1D6EC 4DXFA 1KLUD 1LLRD 3BVMA 1YN3A 2WV6D 3KLSX 2XRSD 3W2DA 5ELBA 1DYQA 1S5FD 1SBBB 1EEFD 1F77A 4K6LA 5D3DA 1LT3D 1MD2D 1RDPD 1L0YB 1EU3A 1EEID 3SEBA 5ELEA 1PTOF 2TSSA 1M4VA 1LT4D 1V1PB 1JWSD 1LTTD 5D3IB 2IPKD
chains in the Genus database with same CATH superfamily
1A2UA 1PFSA 4KY6A 3PHWB 1PXUA 5GAGC 1PZJD 3NQIA 4LFAL 3EFXD 1YJ1A 1PFDA 1BCPF 2VRRB 3H7SA 2G9HD 1Z5SB 3IHPC 3ECIA 3KF8A 3RUZA 1JOQA 1ZXIA 2KNBA 4ZAIA 2JYOA 3QIJA 2QIEB 1RAXA 2HT1A 4CKBA 3M7NA 1OFFA 1TZ1A 3KUZA 4ILWA 3M62B 3FKYA 3Q8CA 1Q12A 3PIO3 1FFVA 5ELNA 3BZCA 2R7ZB 3WAPA 4HEDA 2DJGC 2V1YA 2NVYH 2WGSA 4BKGA 2NN6I 3S24A 1JR0D 2FHTA 4KI0A 3BZDB 4A3MH 1C78A 1N5XA 4A3CG 1U4AA 2V4IB 4KTAA 3ZTDA 4HCEA 3APCA 4DUZQ 2JN4A 1II3A 2CHWA 1O78A 3I4OA 4N9TA 3R2TA 1JC7A 1HZ5A 5IOCA 2A68D 3ZRFA 1Q5WB 1KABA 2IL8A 4KHPQ 3SDLC 2DBYA 1YNJD 1EL0A 3MTSA 2EY2A 4KZ0A 5BMHA 1SMYC 4WJQA 1K8GA 1YEZA 4XQQA 3VYRA 4OVZA 3G6JB 2WXQA 3K7UC 3TP8A 4KVGB 2NMQA 4JPBW 1PH8A 4JI0Q 2KN4A 3PPAA 4DV5L 4LF5Q 2CHZA 1NMGA 2ZVOA 1VQDA 3QHTA 4MIUA 3TP5A 1ASZA 1WWTA 2N9PC 2QC8A 2OJWA 2CHBD 4OEMB 3S2DB 1H8CA 3M3YH 2ZJRA 1PA6A 2I38A 2KDFB 2MP2B 1V1OA 4M1UB 2ZJPA 3QQ8B 1XNRL 1JE5A 4P75A 4LJOB 1WD1A 1TY2A 3U8ZA 3IAYA 1C4QA 2Y0SG 4A3BB 4DR3L 1SDFA 2R7DA 5M3FG 1HUMA 1V5OA 4MEMA 3I4NG 3MA2B 1UBQA 2X8XX 1YITA 2F0NA 2D10A 2RPVA 3L08A 2JA7B 1WR6E 4XWTA 2PO4A 4KY5A 3HOWG 4R8IA 3W5OA 3VUXA 3S1NH 3OLMD 1UF0A 1E8XA 4HAEA 4GDLB 5J22A 4C3IG 5M5YH 4HROA 3TP7A 2KCMA 2D5DA 2ASQA 1JB3A 1QZHA 2F03A 1TR5A 3L0OA 5IP9H 2OT2A 2EY1A 4L63B 2K5VA 4IDIA 4FBJB 2KFJA 4JI8L 1UBIA 1SYDA 1BR9A 1MI2A 1BMLC 2MA9B 2JZ3B 2SAKA 3AMUA 1E24A 3IVFA 4CYEA 1EQRA 2MFIA 4JVZA 1RRBA 1GC7A 2K1BA 3I4MH 1GJXA 1SBBB 1A62A 3QR8A 4B3TQ 2A68C 5ELOA 3M4OB 1HE8A 2LXCA 3R7RA 1YNJC 2CJNA 1LM0A 4UPAA 1RDPD 1QT9A 4DFAA 1EU3A 3F1ZA 3Q8FA 2DY8A 5C0XI 1OQYA 1Y8PB 2MO0A 1TYGB 3K59A 3H15A 1U5KA 3F2UA 4HPLB 2CCZA 3ZJTA 2RDGA 1CKOA 1PMRA 2OHFA 3SFDB 4HRSA 2L1AA 1X3GA 2VB3X 1R9TH 3PHXB 1HR0Q 5LXHA 4GOPA 1FXAA 4OL7A 3B2FA 1FJGL 3K0XA 5D65A 2R92H 2X69A 1OTRB 4J15A 4OVUA 1CMXB 4GLSC 2F0LA 3HOXH 3MC9A 2Q5WD 2MGSA 2LKVA 4WJ3M 3RNUA 2ID0A 1XLOA 1D4BA 1RF2D 3IRBA 1R4PB 3K9OB 3BZKA 2JA6B 2HJ8A 4XC2A 3U4VA 1LT6D 1WTPA 1Q8KA 1Q3LA 4JGHB 2HCCA 2JU6X 3AEAB 3HFZB 1WCMG 3T1YL 3IBEA 1UWVA 1NR4A 4MH0E 5LLIA 4KIKA 2WFWA 3ULJA 1SIFA 2BDNA 4DK3C 4AUQC 3RD2A 2V3SA 1VDZA 3CRLC 2O6VB 2MP1A 5E6PA 3PRMB 2QF7A 4A93H 3OJ4B 2ES2A 3FAHA 4WJWA 2WQYB 4GDKB 3CXCA 4ZK9B 1EFWA 1E0ZA 2NZ1D 4UP7A 2A74C 4DUYL 4IUVA 4FJVB 5LMUL 2KX3A 1EIGA 4BS9A 2CJOA 4B3SQ 2M4NA 4FXKC 1BO0A 5FR6A 2EJFC 3VR8B 1EY5A 1WJJA 5AJ3Q 1WGRA 4WJNA 4ANVA 1VQ6A 1MGSA 3GTKH 3Q3MC 3B08A 1B7YB 5IWAL 1STEA 1WX7A 3NS8A 3ZUNA 5KHQA 1A2TA 5H92C 3G48A 4X6AH 1W2BA 1EIHA 3HGBA 4KDIC 5C4JB 4F88A 4W9FA 3F2CA 2CW0D 2JA8G 1K9MC 2BE5C 4YHHL 4K6DA 4DV7L 3SU8X 1L4ZB 3C0RB 3VH4B 4CJ0B 1CKMA 1EO6A 1GNUA 4ZKBB 2N7EA 2M17A 3VR6A 2XK5A 4JLCA 4OZBA 5C6AA 1STAA 2HIXA 5D94A 3FDTA 3A55A 4RGOS 4LFAQ 3U58A 2BVCA 2LUMA 5G2NA 1E7ZA 2MNAA 2K5WA 4O2DA 2WU2B 1AEXA 2DHZA 3SGIA 4Y52H 1TWAH 4IM2A 1ICWA 1VQ8A 1WGHA 3CWIA 1V6EA 1WMHA 1YX6B 3U30A 3AFPA 4HR7B 3DWAA 1I6HB 1LTSD 1DD2A 1T3QA 1VQBA 1S5BD 1VQIA 4DU9A 1AE3A 1NE3A 2Z8LA 4LW1A 3M3YB 4ZOHC 3ZKJC 4BKSA 1IBMQ 1K53A 4A3IB 4CDFC 1ILPA 5GADC 2BS3B 4EUTA 2B3AA 1DGSA 4XIGS 3U9OA 2C9WB 5E7NA 4CKEA 2LXJA 2JUOA 2W55A 1F2LA 5IYDG 3BIID 5FLMH 3Q8BA 1CKNA 1I3QH 4R4CA 4Q0FA 1HFGA 4H13C 1HNXL 2NZHA 1L0YB 3A56A 4EQOA 2K6QA 5E6JA 5GQOA 5CGKA 2TSSA 1WTVA 4HVBA 4XT3B 3IAS1 4HDOA 4MHEA 2NPTA 2GRIA 4C80A 1SRUA 3SHLA 5IGBA 1E2WA 1ET6A 1TWFH 2YTYA 2PEAA 1PGBA 2Z9HA 3L7ZC 4X65L 1KAAA 2LY7A 2BYEA 5COYA 4IW0A 4IWPA 3DWGC 3W1SA 1BBWA 3H0GH 3PUWA 4Z9CB 3FEWX 4DV5Q 1BCPD 3KJPA 4BBNC 2NVUI 1W6KA 5C5LA 2EYPA 2XNAC 1V86A 2F0IA 4KHVA 2MBHA 2KDEB 3MXNB 1XNQL 1M1KC 2BKFA 1DM0B 3PO2G 4YSYB 2CW0C 5KIXA 3HIZA 2PLPA 1O7LA 2Q8RE 2DAFA 3B9JA 1XNRQ 4GN1A 3PREA 4XYQA 3J81i 4QUFA 4QIWE 3KUDB 3ZQ4A 2QGQA 4DR3Q 1YMHE 1HPCA 4AIMA 1PUTA 3NY5A 2VQEL 3UDFA 1J5EL 4QQBX 2BS4B 2D3AA 1B44D 2FUHB 1MSGA 1ZPSA 2KEDA 2NTSA 1WSPA 3RT3B 3HKZB 4N8FA 4CO7A 1TWCH 4GKJQ 3P1MA 2G4DB 4YL8A 1O7YA 3VTUA 2DY7A 4MELA 2MX2A 3KK7A 1LTID 1K83H 1WM2A 2KTFA 4FF3A 2NVXB 1HTOA 5DPWA 2R2QA 4FVMA 3QX1A 1X55A 5KGUA 3GTGH 1OEYJ 1UELA 5IP7G 3K5NA 2KC2A 1D3ZA 4JI8Q 2G9DA 3RMHA 4BBRG 2LXAA 4HCPB 4A3FH 3UQAA 1WE6A 3VRBB 4NNJB 4AP4C 1VZ8A 1LTBD 3TN2A 1K3RA 2JPHA 4A55A 3JW0X 1ACCA 2MO1A 2WXFA 5G5HA 2N7DA 1FCLA 3ENEA 2NVTH 1C0AA 4NDXA 5JPNC 2F0FA 1JWMD 3CAMA 2CHXA 4RGMA 2JA5H 3BDOA 3K9PB 4YSZB 3QO2A 1I50H 4KN7C 2E76C 1F2MA 2ASBA 1F9QA 3OHXC 1F1HA 1YJIA 1YN5A 1BCPC 5IO9A 2PW7A 3CHBD 3S17B 1XMQL 1JCKB 2SOBA 2KLGA 1FJGQ 2KCTA 2C9OA 2N49A 4HIKA 4NKLA 3J80i 2F0PA 4BBSB 1MVKA 4C00A 2AUJD 3SXHA 3BU2A 1KF6B 1WX8A 3PRZA 3U4EG 4M8AA 4PZ7A 2KMCA 3CPWA 2D3BA 3GTKB 2FBWB 1KTKA 3I9V1 1IW7D 1RTNA 1SMXA 4OHJA 3AXCA 1TS2A 4DV2L 4R4OA 2K25A 5FLMG 5EKKA 2C35B 2WB1G 4JBJA 5HURA 3S15H 5A2QE 3A1QA 4RWSC 3X3NA 3AE5B 1C76A 3N1ZC 1SFOH 2WXHA 4JWUC 3ZXRA 1KRTA 3T1YQ 2YLMA 2ZJQA 2A5HA 1PH6A 2LD9A 4C4VB 5BMIA 1JICA 1S3OA 4DBGA 2NVQB 2PMZE 2ZJDA 3L9AX 2VZAA 3HOYH 3L4PA 1V43A 4B0MA 4BKSD 2B39A 3H0GG 4BY7B 3ZRCA 4X66L 1ISNA 1DOMA 3F2BA 2KD0A 2WXMA 1K51A 1SJED 3ITPA 4G0NB 2KYWA 4QAYA 4DUYQ 1DJRD 4KKJA 5LMUQ 1AFPA 4LLGM 3J81E 2KQ7A 3R66C 3T16A 3DMUA 4HMIA 2VUMG 4GXBA 3PF5A 1C3TA 1WFQA 4JK1C 1M8AA 2A73B 2KWCA 5IWAQ 3I73A 1WX9A 1NTGA 3LGJA 3E56A 3I8ZA 4LNFA 1BCPB 3C8YA 3FPPA 2MBEA 1TIID 1I3QB 4E71A 4EOYA 2I2YA 1V9PA 1F9RA 4YHHQ 4DV7Q 2AWOA 1KQSA 3RR5A 3QARA 2ACZB 4I6LB 4H7BA 2E2IB 3GTQB 2C5CA 3AQQA 1KNEA 2BH8A 4APVA 1B9NA 4FF1A 3AM9A 4EZLA 3AU7A 2Q8TA 1SE4A 4GOPB 1SLJA 4B9XA 5IA7A 2HD3A 4LF7L 2PQEA 1FMAD 4P7IA 3TL5A 4NXNQ 2XWJB 2B63B 1JRPA 2GLSA 4G57A 1IW7C 3T8MA 4BZAA 2A19A 2DN8A 1GO3E 4ZUIA 3T9LA 2XRQD 4A3FG 1WJ6A 2K01A 1MJDA 4M01A 1XWEA 4FXDA 4JI7L 2L15A 3CC2A 4YSXB 2F0EA 2DX5B 2UYZB 1WZ0A 5C1ZA 4KD4A 2N55A 4C2MB 2ON8A 5BYRA 3ABVB 1PYWD 1N36L 4M02A 1A63A 1I35A 2ZXPA 1OXTA 1UEBA 1Y1VG 2FJ2A 1PZKD 3T1HL 3GV3A 2B8GA 3SK4A 1EYDA 1CK1A 1EIYB 5CV6A 1ZUD2 3I5JC 3M63B 1WGKA 1G2TA 1IP9A 3KLWA 1HNXQ 5E6NA 4X3SA 3NZSA 4NJ7A 2VQFL 2OQ0A 1Y69U 3Q8AA 1FXTB 3K7AB 4XQNA 4LK0M 1B53A 4FNFA 1K0SA 2PQAA 1DXMA 5J39A 4W9EA 4W9CA 1TWCB 3H1UA 4PK1A 1RD9D 2IO1B 3LX0A 4KHZA 1K83B 3RZOB 2DLBA 3ND9A 4X65Q 5BR8L 2MW5A 1CQFA 5C4XB 3MWYW 3NWSA 1AWDA 2L32A 2LASA 2JK8A 2J52A 1PH7A 4GDLA 5C3JB 2Z59B 1TBEA 2YVCA 2NBFA 1HA5A 1VZ6A 3NTKA 4DNTB 1WGYA 3RZWC 3EHVA 5FLXL 1CA6A 3Q69A 1FVIA 3S1MB 3RLNA 3VXWA 1JALA 1TKWB 1IBKL 3QA8A 2UUAL 4DXFA 2AL6A 2MBOA 4ULLA 2KQSA 3PZ8A 5EPLA 4MTNA 3J81c 1C9FA 3W2DA 2LFNA 2N9KA 3KLSA 4RMFA 4IFDH 2DAJA 1HR0W 4B3ML 2PTLA 4K6LA 1J5EQ 3MXGA 4EFOA 1SNDA 3VR5A 4G50A 2BYVE 1CTMA 1UAPA 1EEID 4GLAC 4GS3A 4KHPL 1VQHA 5EKIA 3RN2A 2K22A 1N32L 1VRAB 1ZP0B 1EYCA 4A3KB 4BY1B 1GUSA 2G5DA 2HTHA 2KX0A 1ZKOA 5D3IB 3EROA 4MSMB 2R61A 4RCNA 1KXLA 1TQOA 4M8MA 3IFTA 1E1OA 1PFBA 1R4NI 3DQVA 4NQLB 4DHJB 1AN8A 4LF5L 3U7ZA 3V61A 3R8BA 1XTDA 3VR4A 3TCAA 3AI5A 5EE0A 2QEJC 3NBIA 3FKIH 4NQKE 1VF5C 3RZFA 2JEBI 1KJTA 5D2MB 1KDBA 4LJPB 4A3GG 3H91A 3S15B 2K9XA 4ZYSA 2OCEA 4ZCKA 1STBA 4U673 1OXUA 2KCNA 2XN9C 1TKEA 1E2VA 1SFOB 3NWTA 3UE0A 5G55A 3W1YA 4AQ7A 1HNZL 1GAQB 2ONQA 1SXTA 5JH5C 1OEYA 3I4LA 2WXPA 3I72A 4DHZB 3I3TB 2NPTB 3RNEC 2H89B 2ZT9C 2KDBA 2YV5A 3J7YW 3I2ZA 1YJWA 1E7VA 2EKIA 2K50A 3RFZB 2OWOA 1YHAA 1QZEA 2I5LX 3TEXA 2PW5A 2RBMA 3M9BA 1XMQQ 2L0CA 1CZGA 4J1MA 1Q7YC 1SYGA 4EQPA 3PO3B 2KXJA 2O6VA 3DM3A 3MJWA 1QF6A 4ODGA 3J80c 4A90A 5MPOA 1LM8B 4UY8C 4XWWA 3WOFA 5NUCA 1I4XA 5M3MB 4LNIA 5FO7B 2CH4A 1CZWA 3PV0A 1EF1A 1NCVA 1U0LA 3ULPA 2MJ3A 4IPHA 5J3BA 5CHVC 1MSHA 3DWQA 4X62L 3S14H 1F52A 4DV2Q 1H9KA 1MJEA 1ROEA 1WXSA 5C3EB 1EWHA 3NUCA 1JORA 3N20C 1PRTB 3R2IA 4L8JA 4CDDC 1JE4A 2PI2E 2KAJA 4XQJA 1X32A 3GO5A 1E0BA 4DGZA 3AEFB 5HKHA 2WHIA 1S1QB 1SYCA 2BOSA 4A3CH 4LFBL 4PNYA 1EY6A 1SE3A 1WTWA 1NI2A 5JHAA 2FMCA 1WJUA 2EMSA 2K5PA 3PT2B 2KUMA 4JBKA 4WIPA 1RL2A 3BJUA 4X66Q 4K5XA 1P16A 2Y0SE 3DEOA 4RGTA 1BUIC 4A3LG 3EQLC 3OIQA 3G6EA 1C4CA 1S4ZA 5DM73 1GVPA 1D1KA 1HQRD 1V1PA 3E9HA 4R8NA 5I9OA 4P1CC 1WI0A 2MPMA 1QVGA 2PNRC 1BBXC 3J7ZC 1E22A 5K36G 2N78A 1F2ZA 4XDDA 1YQ3B 5HI1A 3TEYA 1LTGD 1DOIA 3EECA 1HZ6A 3C19A 1PTOB 4P74A 1GHKA 4K3BA 3NVYA 1LLRD 3GTLB 1C9OA 1E8ZA 3CD6A 4XE0A 1OQQA 1Q81C 3D4RA 1KM7A 3LNNA 3EVQA 3IFWB 2RCNA 4TQ1A 4TVAB 5M3FH 3N6RA 4KSKC 3I4NH 1X3EA 1KRHA 3AULA 1N63A 1B9RA 3Q3FA 1IBXB 1LT4D 5DEHA 4LF7Q 2FIDA 2O5JC 3Q3JA 3NRZA 2Q2IA 2DZKA 1QNKA 2KVMA 5GROA 4DR5L 4B9WA 3HOWH 1VLBA 2CU1A 1BT0A 2K33A 3VUYA 5AZFA 3FKIG 4J8QA 4MM3A 3EFCA 4A3JH 2G45B 1RJTA 5JHBA 1DONA 3V6CB 4WORA 2D5GA 3QK0A 5EAYA 4JI7Q 1P9DU 2WXIA 3IFDA 3AV8A 3HOVB 3H3VH 3PUYA 5FO9B 3A1QB 1KHIA 2E2HH 3KFUA 2BB5A 3MHSD 1WRIA 3MXNA 4EEWA 1N36Q 1FGBD 3PIOA 4A6QA 4K7SA 3UGBB 1UE6A 1D5ZC 1ZXTA 5DCNA 2REXA 1XD3B 4YWKA 1RYJA 3TMEA 3Q6BA 4PMBA 2I5MX 3T1HQ 1VZ7A 4N59A 3CMEA 4GKKL 2E5LQ 1E10A 2MBBB 3DEPA 2VQFQ 2IY1B 1AW7A 1A70A 3CQZH 4K3CA 2EQSA 3L17A 4JOIC 5BYQA 4A20A 1ESRA 2R7ZG 1GM5A 1GUNA 3EC8A 3S16B 4HJGE 3V62A 2B2TC 4PYZA 2F0JA 2QILA 5ELCA 1UGMA 5BR8Q 4P16A 3TZUA 2Q2TA 5H1SE 4WJOA 1VQJA 1B2TA 3A5ZB 1H95A 3A8KE 4MH8A 3ZNGC 2YYZA 1PLFA 3I7FA 2VZKD 3N1YC 2WXOA 5FK9C 3W1BA 3M4QA 2RPQA 3L54A 4ZDVA 3A33B 1I42A 1IBKQ 2WX0A 1IBML 3ZNHB 2UUAQ 1XO3A 3STBD 4BFRA 3D31A 5JVG3 2UUBL 2F0TA 5C0XG 1KIXA 2O6VD 4YWMA 4B3MQ 1SNOA 2EPBA 3U50C 4IUTA 2R93B 3HVZA 3NJTA 1B4OA 2AHOB 2WACA 4HSPA 4QF4A 1JOOA 3SK5A 1TT2A 1WCMH 5DNFA 5ELDA 2B2VA 4KGTA 4WWOA 3G7LA 2UXCL 1G6JA 2F0OA 1N32Q 4M8NA 1KDAA 1QVFA 2CS4A 2V0GA 3K5OA 4CGYB 3AMZA 5JJKA 2BWFA 5KNDA 1L6UA 3FMCA 2JXMB 4KGSA 2O4XA 4A3BG 3S1QH 1Q86C 4JG2A 3HP3A 4ACFA 3TDQA 1Z9FA 3VFKA 2JA7G 3T4AC 2M9VA 4KJNA 4XGAB 3FVQA 1PDXA 4RM9A 2HUGA 2RA4A 3PTFC 5C44H 2EDGA 2F0QA 3RN5A 1EY9A 1VJKA 3GTOB 3BVMA 1A15A 4DAVA 1HNZQ 2EXZA 4JL9A 4URKA 4GZYC 1BOSA 1EUJA 2PQAB 1WVLA 4UAIA 1IPGA 2Y5BB 4XYCA 1YIJA 1IUEA 1FXIA 1HZCA 3S2HH 1X56A 1QWYA 1SYBA 5JOBA 3U4ZA 2JA8H 4C4VA 1STNA 4ZRJA 3HUIA 5JJZA 4GKJL 3P63A 3AU4A 2YTVA 4AWJA 2R3ZA 3HEJA 2YU9H 2N0SB 3NP8A 3GTMH 1Z7TA 2KC1A 4JCVE 4A3JG 3QIAA 1AZPA 2E2JB 1JWAD 4PQXA 2VB2X 2WXJA 2XSCA 3STBC 4UP9A 3P2BA 2CU3A 1L0XB 1NNXA 2DZMA 2BQQA 1SNQA 2L55A 1PH3A 2WWZA 3RCZA 3U9SA 4X62Q 4G7OC 3ZLZA 3VYSA 3D4WA 4US9A 1XMOL 2LRWA 2QEXA 3ZTCA 3BVZA 1L7YA 4N9F4 5CHFA 2JX5A 2CH4W 1FO4A 4TUUA 2AQ1B 4OO1I 1ZDXA 2EY6A 2D0OA 4JI6L 4W9IA 1KRSA 2LGSA 4LFBQ 1B50A 1VQPA 1H4RA 1PFMA 5M3FB 1L2NA 2I1JA 4IPDA 5EKLA 5IYDH 4BWGB 1UE7A 2XEWA 5D7GA 4G11A 2KOLA 1TWHB 2JJQA 3PIPA 2A5UA 2WLBA 2D2CC 2KJRA 4DR7L 3HOWB 3KF6A 2JA6G 3NVVA 5JZEB 1XJVA 4R4QA 5C5MA 4C3IB 1NMFA 2VL6A 3NELA 4UDUC 4DNRB 4QJFA 2JZZA 2WAQB 3HKSA 3TIXA 1JOKA 4H44C 2RDFA 2E8GA 2P5ZX 3TRZA 4IFDJ 3FHWA 4GN4B 1T6BX 4UP8A 3G71A 1MI0A 4H02A 2EE1A 5KHOA 1RIPA 5G5GA 3PO2H 2LVOA 1IZ6A 1E8WA 3MFYA 2JSVX 2VZKB 1EFID 4AYBG 3ONAB 4IUMB 3PIP3 2C5LC 4TKNA 4PZ6A 1LT5D 3C1EA 5IP4D 2AEHA 1HXYD 1A5RA 3LXFA 4USAA 3IKJA 1VCBA 1S72A 1FFUA 1N61A 5C23A 2EYHA 3R7QA 2KHIA 4GIVA 3I90A 5IGGA 4MZ9A 1PRTF 4JX1C 1B3AA 2GBRA 5FR3A 4IO9A 4DR5Q 1B9MA 4G7ZC 4IKGA 5JEAJ 2L4NA 4EKUA 2Y5CA 5EPKA 4RHSA 3NEMA 1NYQA 4MGZE 3GB1A 1N9WA 2MH7A 1X6OA 2F0HA 3PLVA 2KCCA 5LNK1 4TV3A 5C44G 1FM0D 3KBXA 4LFCL 2LI5A 5D14A 3NTIA 4OGQC 3MTNB 3MEHA 3VDZA 1EYGA 2NVYB 2IZVB 2HJ1A 3GS2A 5I6WA 2VH2A 2NUCA 3J7AV 5IP7H 1J19A 4A3MB 4BBRH 1GB4A 2CWAA 2F1MA 1FRRA 3Q0AA 5DPTA 4GKKQ 4WWMA 2K7VA 3B6YA 1KFYB 1UWMA 2Z4HA 3L16A 1I5FA 2M1MA 1S5FD 4KY7A 1MHXA 1W6JA 2A6ED 1WD0A 4GN5A 2LRUA 2D07B 3Q2AC 1Q10A 3CC4A 2WB1E 2BF8B 3H3VI 4FXCA 4JPSA 3PSEB 5ELEA 3ER0A 1PTOF 3QJYA 2NBUA 1A3TA 3U52E 1G2SA 1V1PB 1EQQA 4NXNL 3QOLA 1UD7A 1K73C 4C3JH 4L5TA 3GZNB 4ASWC 4WRDA 2UXBL 2J7QB 4KLKA 2IT1A 1C48A 1NEKB 1L0WA 2K1FA 2MSED 4IPGA 3VR3A 1V97A 1YOVB 1CUKA 1QQRA 4IM0A 3TQYA 3N30A 3PGEA 2JXTA 2RVLA 2JXXA 4ZLTF 4KKSA 1SE2A 2UUBQ 2BA1A 1G51A 3CMMB 2HHHQ 3H7PA 3MEFA 4LDTB 2N9XA 1I6VC 3BY4B 3DHHC 4DN4M 3URYA 3S2HB 4QCLA 2EYMA 4DV6Q 2WXKA 2E75C 1KOTA 1Y1WG 2L76A 3SD5A 2UXCQ 3S1NB 3D6WA 3GQBA 2RQXA 3HOZH 3GTMB 2EELA 1F9JA 1QOAA 5J18A 1EZ6A 4OWXB 3CSFA 5M5YB 5H8YE 4HCSA 4MM3B 4S0RA 2LMCA 1QOFA 1N62A 4GNXB 2NS5A 1GD7A 5GMVA 1F0ZA 1UUPA 3N1XC 2H1EA 2IJ0A 2EYFA 5C3WA 3H9DA 3TEHB 4LF8Q 4TQ0A 3B1LX 2B8FA 3K5LA 2N9LA 3T53B 1GB1A 3S1RH 1WY8A 4PG3A 3I4MB 3PVLA 3E5SA 2VUMH 1GKHA 2A6EC 3ZIMA 4B95A 1FGUA 5A35A 2NTTA 2M8SA 2LGXA 3APDA 1JJCB 2FNJB 1CFMA 3ML9A 1LTAD 3GTPH 3VQIA 1QZGA 1Q82C 4NMZA 1JW9D 4WWPA 2I0QA 3GZNI 2KEEA 1A0IA 1KNAA 3J7A5 4X3UA 4Y7NH 4HJKA 3TBLD 1R9TB 3NHEB 2JYTA 2KLCA 5EE1A 5M5XH 3ZNID 1NVID 1CI3M 4OWTB 4KD3A 4NW2A 2K8HA 2R92B 3KYDD 2RDBC 1ZE3D 3HOXB 4MSQB 4CKCA 4OZCA 2KA7A 3CF5A 2LEKA 2Z0DB 1NAPA 1MG8A 1TY0A 5M5WH 3F8TA 1LXDA 1ET9A 1XMOQ 4DV0L 5GXGB 1KLGD 2CWPA 1Q1BA 3B2GA 3NZ3A 2WKDA 3K81C 2IO3B 3QG1A 3RZDH 3IT4B 1IYVA 1D6EC 4JI6Q 1STGA 4BBSG 2D9UA 1FR3A 3KLSX 1Y1VH 4LNKA 1IKLA 2VY3A 2Z6KA 4L23A 1YQBA 2JY6A 2FXQA 3E0JA 4JI2L 2WDQB 4C3JG 1CSQA 5LMNL 3CF6E 4MGYE 3SEBA 4DR7Q 3PRPB 4A93B 1L6VA 3KOJA 4JW0A 1E7PB 2INNE 5HG2A 1IBXA 1PYBA 3RLOA 1YHQA 2IW3A 1YNTE 4HXDA 2I07B 3JSVA 5JXVA 3R93A 2LXKA 3QOJA 1OGWA 3G4SA 1AH9A 1LABA 2EVBA 3KWVA 1WI5A 1VQOA 4GOPC 1FIQA 4X64L 1SIJA 1CJEA 4FADA 3M95A 1BVSA 2XVSA 4L5RC 4BY7G 4BBRB 2PYKA 1D5XC 3I55A 2KQ4X 1R4MB 3AH7A 3ALBA 2L9HA 3SFEB 3AE1B 1E5WA 3VYUA 2F3VA 3O65B 1V2YA 1JROA 5EGTA 4HPMB 3HOZG 2IYDB 1K8AC 3TZDA 2WP8J 1V1QA 4AJYB 4DHJD 2A1AA 2SNMA 2QW7A 1EYAA 3BDLA 3KWLA 4L5QA 4G7HC 3W5VB 4DAYB 3JAMi 1PHJA 3M3JA 2L52A 4DV4L 1PGAA 2D62A 2DNCA 3VVWB 1RTOA 1TWAB 1V9JA 1ILQA 1PH9A 4FXGC 3AECB 4NAMA 4ARCA 3Q23A 4N6EB 3GE8C 4US8A 4KMUC 1CA5A 1DOXA 1XLPA 4LFCQ 2SEBD 1EWYC 2BTEA 1WTQA 3WCQA 3ULLA 2DYOA 2LWPA 2WINB 1LTLA 1EWIA 2QA4A 1EWCA 2LVPA 3SHQA 1SEBD 2N88A 3WDNA 2B3GA 1C77A 4MACA 4L2YA 3V60A 2QDBA 2IHEA 2KJHB 2K5NA 1T5EA 3CIRB 4RF0A 5EBDA 4R3DA 2WB1B 3PUVA 5KYLA 4P72A 5KYIA 2DNEA 1BNZA 4A3GH 1J8IA 1QE6A 2JWZA 3NS1A 4LNNA 4C7ZA 1L4DB 1X3PA 4RNAA 1FD6A 1GUOA 3BS1A 1QJOA 5JPMC 2G4SA 4PS7A 1V81A 3KF6B 3L10B 1TWFB 2N9EB 1DCZA 4JI3Q 4A3DG 1Q1EA 1S5CD 2HDLA 3MHBA 1U4PA 2AWTA 4JI1L 3DBHB 3JVZX 1L5PA 3H0GB 2I46A 5LXIB 1XPOA 4A4IA 5J17A 2UXBQ 3SK6A 1R4MI 1PRTD 3D8GA 2JE6I 1F2RI 2L11A 3HOUH 2XTIA 2ZM6L 2EJMA 2KMMA 2R2OA 3DWMA 2E74C 2K5QA 1QILA 3D0FA 3EA6A 3CCMA 2KQ3A 2VUMB 4FULA 4TKOB 4B6WA 1R4NB 1WTRA 3GE3C 4LCDE 1ASYA 1KH0A 1WXVA 1SSNA 2E5LL 1YN3A 2K32A 1WJNA 1KLUD 3ETRA 3E0EA 1GUGA 4W9DA 3PZDA 2KHJA 2PVGC 3D6CA 4DR4L 3VAWA 4G4KA 4DKAC 2PMVA 1WOCA 3J80E 1X3QA 1WRDB 2H4OA 2H88B 3IT6B 4ABNA 4IJLA 5D3DA 1VMCA 3MHZA 4LUZA 3BINA 1SYEA 3LYYA 3NOBA 2ZW0A 1Y8RC 3AEGB 2IWHA 1JWSD 1PTOD 5L37A 1QOGA 4FLHA 4HDQA 2IPKD 3CCEA 3GTGB 3AE4B 2BW2A 4A3OA 2A6HD 4GGQA 4QIWB 2F0UA 4A3LH 2N1VA 4ANWA 4A3FB 3W1SC 3UF8A 2AQ2B 5EE3A 4I7ZC 1E7UA 1Y14B 4A3KG 2PI2A 4BY1G 4FJYA 4IOIE 5LL6S 3KDFB 5K36H 2NN6H 2ZXRA 3T56B 2ICEC 2NVTB 4A75A 2Q8IB 3KJOA 1Y1VB 3JAME 2NR2A 5EJWA 1MG4A 1QG7A 3CCVA 3DBHI 4O1NA 1XPUA 2JA5B 2Y5PA 2X6GA 5CMDA 4KN4C 1I50B 4KDLB 3M4PA 4II2B 1UEAB 3QC8B 2WXNA 2SNSA 5CV4A 4X3TA 1Z47A 1P3QU 1UE1A 3P4RB 2VH1A 1PRTC 4IUQA 4HWIB 2KENA 4DK5A 4DR6L 3BVGA 3UI2A 1LACA 3R3OA 4ALPA 4C56C 2CFMA 4RFBA 5JVH3 4W9JA 1VMPA 3M4YA 2WDRB 2DUDA 2KWVB 4D2KA 4OX9L 1F9PA 3VR2A 2LS01 4K8IA 4AQYL 4A3EH 1HJPA 2K14A 4V0BA 4BXXH 3UDGA 1EU4A 4DV0Q 2INDC 1FYCA 5DPSA 3Q6SA 4NJ6A 4IUPA 1PGXA 5BN4A 3GTJH 1JMCA 5CYUA 4H0LC 4V190 1TKYA 1XEEA 3PZ7A 1QUQA 3N32A 3MC0B 3A74A 4CBVA 5IE8A 3PO3G 2BBCA 2KTRB 2L8JA 4HLEA 1TWGH 1S3SG 1MKHA 3HOYB 5M3MG 2UUCL 3KQ4A 4HTHA 3D3RA 1NYRA 5CBEE 4JI2Q 1JB7A 4MJSB 4N58A 2KHSA 3OIPA 1PTOC 4XX5A 5LMNQ 3KBGA 2LMCB 1ENAA 2MUYA 3A5UA 1X3FA 2A6HC 2R7ZH 1L1OB 5JJLA 1PQSA 4C3HG 4C1NI 2IX0A 5BN3A 3HOUG 2C7NB 3NVZA 1IHZA 4LF6L 2KOXA 4IWQA 4YXDB 5CHWA 1RFAA 3A7AB 2MHJA 5T1GA 2LSSA 1HFNA 2RCFA 3OW7A 1I4PA 4TMAB 3SR6A 2GA4B 4X64Q 3DVGX 1E9MA 4FHJA 4IUNA 1VQ5A 1VQ7A 4B3RL 1K52A 2K28A 1XLNA 1L0VB 5BO4B 2PMZB 1J7BA 1PH2A 1TT5B 3HK0A 2JRHA 2MJ8A 3AFQA 3T13A 4JI4Q 4K5VA 1HZBA 4LAAA 3ZDTA 1D2BA 2PZWA 1MPEA 2BH2A 1J8CA 2AKWB 4FA6A 4CQNA 1IGDA 4POFA 1PH4A 1I94L 3SK8A 2GBMA 4X3KA 2BWES 5C0XH 5ELBA 3BWUD 3OMGA 2MEKA 4OIKA 2ZW1A 4NPNA 5L95C 1D8LA 1GUWA 2YTXA 2BYFA 4KX6B 4EQ5A 1KC8C 3JAMc 4J3OD 1LT3D 1WFYA 1IYUA 4DV4Q 2WNMA 3SDZA 3HRDD 1TJEA 4LF4Q 4PMWA 3VTWA 3W5UB 2JEAI 3S2DH 2ZPYA 3VA7A 1ZOYB 2KKCA 3BK2A 3OG5A 5A2QL 5IOIA 3A4RA 1IYFA 3AEVA 5BMGA 2L7RA 2DGYA 4BA2I 1RM6C 2PZUA 2W82A 5EBCA 4WFN3 4A3BH 3PSIA 5AEKB 2JWUA 2PCFB 2L0FA 2NN6G 4YT0B 2RKSA 4K7WA 4ZRPA 3ZVVA 1BUVT 1VQLA 4OZAA 1SAPA 4HJ5A 4LUVA 2KZRA 2JA7H 1SNCA 3AB5A 1M90C 1NI3A 2ZNVB 1FNWA 5EPJA 2EYLA 4LF9L 2M2LA 4XDXA 4YY3Q 1KL9A 4BA1I 1C79A 3S2AA 4DDGD 3ZJUA 3TSSA 3NENA 1WTHA 2K0PA 4HK2A 1LFDA 1D1IA 4H2AA 1LQBA 3OW2A 3J81L 4K81A 3AE9B 4JC0A 2ZCCA 4WQOB 1EF5A 3QWNA 2OEOA 1H9MA 5CV5A 3SE0A 3MC8A 3TEZA 3I63C 3JSVB 4JI1Q 2JRIB 3NZUA 3RUIB 3PUXA 3C2PA 2MLBA 1NENB 4W9GA 5BN5A 4ZUJA 1SE8A 1IYJB 4A3EG 4IALA 5IT9E 3D32A 1TKGA 1IL2A 2N1WA 1G6PA 4RAUC 4BXXG 1X65A 2LFIA 4YCVA 2V3NA 1HCZA 2KACA 4BKTA 3EBEA 2N8NA 2ZM6Q 1ZW7A 2WXLA 4B0EA 1HA6A 4GNXA 1V49A 2YEPB 4QB4A 2ZEQA 3DVNV 4PS3A 1CHQD 1A6XA 4J6IA 1SSOA 3DVGY 3GOEA 3ONSA 3W1GA 1LTRD 4HKZE 1YQ4B 2PE9A 4CJ1B 2NYZD 3LWUA 2D3CA 3DHGC 3DBSA 3UE1A 4MGIE 2JQRB 1XXGA 2K6AA 2QDLA 3J7AF 3DBRB 1J7CA 3N3KB 4A8XC 4ZHOA 4DR4Q 3JYUA 3UQBA 2HQEA 5IGEA 3WIMA 1PYSB 4P1BC 1SYFA 4CJ2C 2W9NA 4PS8A 2O2VB 2SDFA 3A8IE 5C4HA 4MNOA 1D5MC 1FNUA 2B29A 1IKMA 4LK1C 1SGHA 4AYBE 1VS0A 3C3LA 4AS1A 5I2XA 1SNMA 2DENB 2EIFA 4YIJA 4HJ7A 2DWQA 4K7UA 2JA6H 3RI7C 3DWPA 5LL6X 5IYBH 4YCUA 1J9OA 3ERSX 1JWUD 3FKIB 3NQTA 3KYCD 3C46A 3A0JA 4GN3B 3IAM1 1OXXK 3NPPA 2WDTB 2I1KA 2WKCA 3J80L 1N34L 3NK9A 4OO1G 4OONA 5JAVA 4R4IA 4P6VF 1S5DD 4U68A 2M0AA 4DA2A 3PGZA 1FCCC 3RD4A 2HHHL 1LO5D 1UGJA 1Y8OB 4DAPA 1TWGB 4TQUS 1JMLA 1RFKA 2GBJA 3IL8A 4L5SA 3TJPA 4ANUA 2WV6D 4DV6L 1LYLA 3IG3A 4K1RB 1XYIA 2K75A 1KDCA 1QB5D 1P8LA 2EXDA 1EEFD 1F77A 1VQNA 3CW2C 4OVVA 1Q0WB 3RULA 4DR6Q 3A8JE 4RKLA 4GLVB 3VYTA 3P7JA 3P4SB 1IBLL 2L00B 3N52A 4ARIA 2ZPNA 3AE7B 2LVQA 2GB1A 3DOWA 4IFDI 3JC66 4FHKA 1PDQA 4A9AA 3JAML 4OX9Q 1VDVA 1QKZA 5CORA 5C4JH 4AQYQ 2NCNA 5KNCA 2Y3AA 4KV2A 3FP9A 3OMCA 4DK1A 3OTOQ 4LF8L 3S14B 3DBRI 3X23A 1NY4A 1UE5A 2OQKA 4FJZA 1FD7D 2HDMA 2RHSB 2HQLA 5IT9c 1PH1A 2M19A 2E3TA 1OXSC 5HHDG 2F0VA 2OEDA 1G91A 5FKAC 4WURA 5IN7A 3P4QB 4DK0A 3RNBC 1IL8A 4WH4A 1Z6HA 1C4AA 3OWFA 3H3VC 4CDCC 4OXPA 3U2SC 3UIPB 1TU2B 2UUCQ 3QCAA 2IX3A 3PMFA 1A3VA 2L5TA 3K6OA 1QOBA 5J1ZA 3E3XA 4HIDA 3CCRA 2BT6A 2MCNB 1I6HH 5F2DA 3VH3B 4GB9A 1VCIA 4NZLB 4ANXA 3P75A 4ID6A 3TREA 3L2PA 1AP0A 3GV6A 1JQ4A 4DR2L 3MJ5A 3OAWA 1XX8A 3T3OA 3PO0A 3Q22A 1U4MA 1ML0D 3KUPA 4DAYA 4A3IH 2NWGA 4LF6Q 4JWSC 3DPDA 2NB0A 4HJ8A 2FINB 3H8HA 4QUCA 4GLXA 1S5ED 5G3LF 2XGTA 3CCJA 2L0TA 4LDTD 2J53A 1A8VA 5CV9A 1JJ2A 4B3RQ 4ZQ3A 3OWEB 4NAWA 1YI2A 1BF4A 3AU5A 2V4DA 5FJ8H 3ZYYX 1RWSA 4ZYNA 1JQYD 2KVRA 1TVXA 3ZXVA 2J0TD 1I94Q 1E8YA 2L05A 4HJAA 1B1ZA 2R6GA 3PUZA 5K5PA 2Y0SB 2WAQG 1MJCA 3HKZE 2RHQB 2M0XA 3I4NB 1UH6A 2ZXOA 3DUZA 4EZKA 2KANA 1NJIC 1WM3A 3RMKC 3WANA 2EMTA 3KLRA 1WZ3A 1CQVA 2OTLA 2ZCBA 3TUOA 1Y1WH 3U7DA 3EN2A 2C7MB 3VDYA 2IO0B 2DZIA 4XZ4A 1GPXA 3OPOA 1OO9B 1GUTA 1HRJA 5IYBG 1Q1OA 3AE6B 3HVDA 2HIVA 1HH2P 4A3JB 4HKQA 4EX5A 1WF9A 2ENBA 2A69D 1C7YA 4FP5D 2RGFA 4HJ9A 2FE8A 2UU9Q 2E2HB 3QWZB 1J7AA 2FIFA 1P98A 4R9WA 5T1IA 3ZGZA 1QUQB 1H9SB 2WS3B 1MHWC 4RM8A 1AARA 1F9SA 2KWUB 3A4SC 2BE5D 5CC4A 1PV4A 1DOKA 4MT5A 2KT7A 2EZVA 1EOTA 4LF9Q 1WXAA 2C60A 4ZRQA 1I4RA 2BDOA 2F4VL 4HIOA 4KV6A 2UWQA 4YWGG 3CQZB 4KKTA 4OW0A 4CHKA 5HFYA 2WYQA 4BAXA 2M00A 2IGDA 2NVXH 2MQJA 3CCLA 2BKRB 2QMTA 4YTNB 2IDYA 3ZO5B 4JYAL 1P0RA 2JF5A 1J0GA 1MIUA 2FMMA 3A54A 1EQVA 3V96A 2W3RA 3K0YA 2VNUD 4WJPA 2JT4B 3TEWA 1VR9A 3QJZA 4A3MG 3OSOA 2QSDA 3P4PB 2F0WA 3PQIA 2K03A 1BBUA 3E9IA 4WQMA 4ITKA 4RKBA 1VQAA 4OIJA 1SF0A 1M4VA 2AMCB 2GBNA 2ZTEA 1DOLA 2Z0EB 4K0KQ 4W9KA 5AUIA 2BYTA 1OXVA 5EE9A 2LUEA 1IXRA 1V80A 4E3CA 2V4LA 4AH6A 3BYYB 4PMCA 3BYTB 4IG7B 1EY4A 3P1HA 5AFWA 4JBWA 2IBIB 3N9YC 2F3IA 3V2TA 4GOCA 3C1FA 4W9HA 4POGA 2IHFA 1IGCA 1HNWL 4DV3Q 3KVFB 4MDKE 4GNXC 3X3MA 1YHBA 3P20A 3ZNZB 3H09A 1LGRA 4IWOA 1FEHA 2X6LA 3KDFA 1JWBD 2L12A 1YNXA 2VXWA 2KDIA 2MJDA 4F7XA 3S17H 5IT9L 2V3PA 3OOCA 3EGRA 3I57A 4ZRIA 4AYBB 2B2UA 1WCMB 5GAEC 1C4PA 4K8JA 3OYYA 4BBSH 2A4ZA 1E3PA 2D11A 1VQCA 2RD0A 3QAQA 4A3IG 3K80C 4JI3L 2FCQA 5HGQA 4RCOA 5IIFA 2A69C 3WA0A 3CMAA 4M0WB 1ZEQX 1AZQA 3S1QB 2J0JA 2PPBC 3GP7A 5I9PA 2DYBA 4ME5A 5BYSA 1E90A 2KWDA 4I7AA 1W3SA 4EQNA 5FJ8G 3LDZE 3HS0C 4RH6A 4HPPA 4NY0A 2ZVNA 2Z1CA 1XPRA 1TTNA 3RNAC 5C44B 2IY5B 2NVQH 4TRDA 4R4TA 1N34Q 2RMMA 4C7YA 4ICVA 3P42A 1HTPA 1U4RA 4S3SA 5LMNW 2CKHB 5C0XJ 2CQAA 3DLLA 2BB6A 1HTQA 1N60A 4KGRA 1U4LA 4BY7H 1STHA 1BQQT 2VW9A 1SROA 1ZXHA 3K8AA 1E6EB 1N6ZA 5IY0A 2V9HA 4MTKA 5IP9G 2H5XA 2IGHA 4L1BA 2JA8B 3WAOA 2WX1A 4K2LA 4R1JA 5E4XA 1P7FA 1LUZA 1HUNA 2KTRA 3H6MA 4A3PA 2JA9A 1HZ9A 2YEPF 4RHRA 1ICFB 3E6ZX 2YU9B 3AE3B 4B9KA 3I4MG 4QMGA 3VUWA 4EE2A 5JJIA 1RLFA 1TGZB 4HCNB 4MJSA 1VF7A 1KAWA 1IBLQ 5J2RA 2EYOA 2B2VC 1QVCA 3EIVA 2UXDL 4B08A 1V5TA 4HEA1 5KNBA 1L1OA 1QNUA 2W54A 5E3FA 1X9NA 3LWEA 1DZ1A 3SR1A 2ICIA 4DF7A 1G6ZA 2ZTCA 4DDID 2C7HA 1EIFA 4QY7A 3NUHB 2NBWB 1B8AA 5FLXE 1UNSA 3HKZG 1N33L 1WJ4A 2OOBB 2BA0A 2E2IH 3VHTC 4NB3A 1NUCA 3GTQH 3HG9A 4DQOC 3K58A 4AJWA 2O2LD 2L1BA 2NZOA 3OJ3A 4DXAB 3SVMA 2R92G 2KFKB 3DVNU 2HE7A 4DPGA 2Z6BA 3PF4A 3WALA 3HOXG 2B63H 1XCTL 2WXGA 3KW5B 2HCIA 1VD2A 2PZTA 2WU5B 4HN7A 2XRSD 1Y1WB 3W9CB 4ZHPA 2LJ5A 4FF2A 4DR2Q 1F2RC 1JJGA 3ICEA 3KYHC 4C2MH 4REZA 3UIOB 4A3DH 1NSNS 3A9JB 4KKUA 2LHEA 1JRUA 2MWSB 4IPCA 1ZYRD 4X57B 4PYUA 2B2WA 1NDDA 1NBWA 2VS1A 2K4KA 2K8CA 3DBLB 2F52A 2AQ3B 3MZ5A 2CVRA 3K7AH 5C4ZA 2F0GA 3PO2B 1I4QA 4A93G 1T5XD 1Q8IA 1XCQL 1RODA 2BGFA 4BVUC 1YN4A 3KF8B 3FILA 2TMPA 3RZOH 1C8CA 1EY8A 4XTCS 1SJHD 5C4XH 4DR1L 2J42A 3MFGA 1WYDA 1YNND 2ZTDA 5FOBB 5DM63 3NBHA 4NP5A 3PLUA 2JYEA 5TR5A 1EY7A 1ESFA 4WWNA 4CHTB 2JVCA 3AEEB 2O5IC 2KBNA 3ML8A 1GOZA 4I6PA 3O13A 3S1MH 1VQEA 1WR1A 3T51B 4EGVA 5FO8B 5KRUA 1Z2MA 1CSPA 4A76A 2HTME 5T8IA 3F2DA 2D3GA 5IKCM 4BOZB 2MRPA 4O42A 3A9KA 1FL0A 3AB9A 3MVVA 1WGDA 2QCPX 4IJHA 3RNCC 2GN5A 3APFA 4YTPB 3L3OC 4GSWA 5M9OA 1TIFA 1X1MA 3VR9B 1GHJA 5G3LD 2GMIC 4EZJA 1VQ4A 2PE6B 3CCSA 4JBMA 1OQRA 3H7PB 3TS0A 4JI4L 1YX5B 1K0RA 2B76B 2F4VQ 4DHZE 3ZJVA 4A3KH 4BY1H 2PJHA 5FLXc 4QL5A 3BDCA 2L83A 1XTCD 4IC7B 1RHPA 1XQQA 1QOHA 2AUKA 4P71A 3VA5A 5I4DA 3M85A 2RF4A 1X54A 4JYAQ 4FF4A 5AUKA 1CT1D 1PFNA 3PV1A 4O0AA 3PCOB 3AN1A 1O7ZA 3M7GA 1ZYRC 5CV8A 4F87A 1UZXB 2QCZA 3A7LA 4PV1C 4C3JB 4LF4L 1T0SC 2BS2B 2D2QA 2IO2B 2MBQA 2A8VA 4IURA 2O2VA 5E1FA 3DBLI 4DV1L 1K28A 2K6DB 3EFUA 4HSVA 2F3WA 5IGCA 1LV9A 5EQ0A 2EYJA 4RGNA 1MHHE 4NAWB 3V6EB 1R7SA 4XT1B 1I7HA 1CZPA 2XBBC 4N8X1 3ND8A 2RSOA 4ZRZA 1MFWA 3J9CA 1F2YA 4JI5L 4LUOA 2FUG1 1GJZA 4J6HA 2FFKB 1HNWQ 1YNNC 3DM1A 2B63G 4CDEC 2DZJA 3K5MA 4NXML 4YY3L 2K5HA 4LWCA 1C1YB 3W3AA 4ZRKA 3CU7A 3AE8B 4W9LA 3HM3A 2IX1A 2EKEC 1SN8A 3PO3H 4XDCA 3Q8DA 5CR3A 4ZKCB 4BOSC 2KHWB 3HOZB 2PKOA 5CTRC 5M3MH 4N9PA 1YJNA 2GI9A 3ZW3A 3RLFA 3DHQA 4XYOA 5D6JB 2B2UC 1WIAA 5HGTA 1YBYA 2LHDA 5I6YA 3ZDMC 5C3EH 2LJIA 3NVWA 1MD2D 2KJXA 2KJ6A 4JE3B 2B2YA 3ERQA 4YTMB 1YJJA 2F0KA 3I3CA 4OELB 4C3HH 1M94A 1WYGA 5C2TB 4WAAA 3E9SA 1Y56A 5IODA 4PZ8A 1LTTD 3CSTA 2I5HA 3CRKC 3S1RB 2E6XA 2UU7A 1EQTA 5AZHA 3NHHA 5CV7A 1KLVA 4QGUA 3RPFC 1VQFA 1R4QB 5C4XG 1K8OA 3KH0A 3GTPB 1N5WA 2F4IA 1VQGA 5GAHC 1QLBB 3J81j 2DYMA 2QHOA 2K5DA 2WDVB 2X38A 2K8BA 3HHMA 1DOYA 1V8CA 2BCOA 3UDXA 3S9WA 2KN5A 5TSSA 4NPSA 1WTXA 4YWLA 2AWNA 1EUVB 4EVOA 4Y7NB 1HTLD 4KJOA 2ZZPB 2QDFA 3I70A 5M5XB 4KSLC 4L6TB 1FPYA 5IYCH 1YVCA 3CCUA 1EZ8A 4E6IA 1P7EA 4JV5L 4A3DB 2UXDQ 2QJLA 3Q14C 1AYFA 4DAMA 4LNQA 4JOIA 1PTOH 3RN9C 2MP2A 3MP9A 3GTLH 2JA5G 3LB8C 1ENFA 4KIKB 2R7FA 2B2TA 5M5WB 4YCWA 2J7ZA 1WTOA 1N33Q 3CP0A 1WXQA 2INPE 3K57A 2JZPA 1RCVD 2L3ZA 3R3MA 1L1OC 2EOTA 3RYTA 5IGFA 2J4XA 3RZDB 2RSNA 3VTVA 1TXYA 2K52A 4DK6C 1HEZE 1G8ZD 1V8QA 2AL3A 1K8RB 2FCNA 4GU2A 2Z0SA 2JQOA 1SE9A 3UINB 2N7JA 2GVAA 2Z4IA 4IZ8A 1GXDC 1DGJA 1ENCA 1XNQQ 1B3QA 1GC6A 4P2CB 3HOVH 2INCC 1H9JA 2N4FA 1FRDA 1PZID 2WP9B 1K8MA 1A3UA 3V3XA 1WYWB 2IY0B 2RSUA 2FCSA 3ZJYC 3HOYG 2XK5B 1STYA 4DUZL 2VQEQ 1BDOA 1H9RA 1HQMC 3OTOL 2NBVB 1WE7A 3HZXA 4FN2A 2PNHA 1E2ZA 4F7ZA 4ME3A 1B70B 1RKNA 1T0RC 3BG3A 2PVOD 2PPHA 1I4GA 1Y8NB 2B2WC 4GMVA 4KK7A 1H9SA 2Q2UA 3S16H 4DXGA 4MN3A 1YZ6A 2ALYB 1K3BC 2JSOA 3NTHA 4LNOA 1TS4A 1J6QA 2OF1A 3FRPB 1WMHB 4DR1Q 2J0MA 5LHY1 3AEBB 4JI0L 2RR9A 1WGGA 4XXEA 1Q46A 4JQWC 2KDMA 2E2DC 4Q2JA 2BPSA 4WAFA 1GUAB 4RMAA 5C3EG 2ZNVC 1T9HA 5JEAH 1HHVA 2Z6KC 3BK1A 3X0WA 1TZOA 1E1TA 1U9RA 5DLQE 2F0MA 4RF1A 3WAMA 2GVBA 2F0DA 1CKNB 4ICUA 2F0SA 2G1EA 3GDEA 1ZDVA 3Q8EA 5E6OA 4IQZA 4LTUA 3I56A 3PS6A 2LGIA 3Q3OC 1NBFC 3DHIC 2R93H 1HZAA 3GD7A 3WWVA 3MXPA 4KKIA 2XWBB 3AYHB 2Q2HA 4JIOU 1XF5L 1D7QA 2AX5A 1BKBA 3Q24A 1YJ9A 2K3UA 3CKIB 2OJRA 4FO2A 5ELFA 3FPUB 3MXUA 4A3GB 1XT9B 2OXPA 2KECA 1SNPA 4OO1H 3KUCB 3NE5B 3AE2B 1L2FA 2QKIC 5EDSA 1N8RC 1VQMA 4P73A 5IYCG 4IOCA 2J0KA 4DWFA 5ISRA 3IXSA 4GDKA 4IUUA 3NG0A 2AYOB 4IM3A 4K2KA 1VQKA 3TS2A 5IAAC 1I4HA 1KD1C 3MAQA 3TBIB 4DV1Q 2V1CC 5C3XA 4B3TL 4C3HB 4M0WA 2W3SA 1QCBD 3GTOH 1G291 1S40A 3HOUB 1TS3A 2N3SA 2UU9L 3AEDB 4S17A 3NSWA 2K39A 3CPFA 1YD8U 3UI3A 2K05A 3H6NA 5DPRA 4JI5Q 2HD5B 2MQHA 4RA8A 4Q5VA 2WXRA 3FILB 3VRAB 3WOEA 2EJGC 2ATWA 2RDHA 2LGDA 1NR2A 4M00A 1BXTA 1O7IA 4NXMQ 3NXWA 1CHPD 3NBHB 5HY6A 1HR0L 3EUB2 3TP6A 5L83A 4I65A 2E2JH 2OTJA 3EJIA 5KEEA 4UHVA 4FYDA 2MHVA 4NJCA 2MJEA 3HOVG 1AE2A 2CKZB 4BBNF 3QB3A 3H94A 4FDBA 4I6NB 1JT8A 4II3B 4PT5A 1T0YA 4IOAA 2GBKA 2WIIB 2HDEA 3HRZC 4IFDG 1P1AA 3A9KB 4IN3A 1SB3C 4G3XB 2WAQE 4DNIA 3HM6X 4HMJA 2EY5A 4K14A 2KO3A 2IGGA 1WH3A 3M4OH 2CR5A 4F1SA 3DDCB 3LJ3A 4K0KL 3L13A 3CC7A 1PVOA 2LZ6A 4E74A 5CBAE 3DCGA 4LMQD 2K04A 1ZGUB 1Q90A 2PW9A 2B2YC 2DJFC 1K50A 4AOFA 3RNFC 1EOVA 5DAUA 1GG3A 4DV3L 1XLQA 3RNGC 1TWHH 4TSSA 2FCMA 1O80A 1ONLA 3UDIA 1UWXA 2DNFA 4MGKE 1MBYA 1TS5A 1T0QC 1SR3A 2KFKA 4C1NK 5JEAG 1PH5A 1SMYD 2LGYA 3I91A 4C3IH 2GOWA 4KZCA 3V05A 1FNVA 2G3QB 1CM9A 4B3SL 3T3NA 2XIWA 4F8MA 5I2YA 4LJZC 5AJ3L 2D0PA 4HIMA 2KK8A 3D4DA 1EY0A 4JV5Q 3B0AA 1ZKHA 2PIAA 4F8CB 1DYQA 3L0WB 4K5WA 3CCQA 4OWWB 2KMAA 5IGDA 1VQ9A 2R93G 1OTCA 2M56B 2CQOA 2KVZA 3Q3NC 5AZGA 2JP1A 4A3EB 4WJ4A 2FAZA 3DXJC 1YIWA 3FC4A 5CX3A 3A9JA 5E4WC 1EM7A 4RG1A 3TMPB 1WXMA 3GTJB
chains in the Genus database with same CATH topology
1A2UA 4KY6A 1PXUA 1PZJD 3NQIA 3EFXD 1PFDA 1BCPF 2G9HD 3KF8A 3RUZA 1JOQA 1ZXIA 4ZAIA 2JYOA 2QIEB 3M7NA 4CKBA 1OFFA 3Q8CA 4ILWA 1Q12A 3PIO3 1FFVA 2R7ZB 4HEDA 2NN6I 1JR0D 2FHTA 4KI0A 3BZDB 1C78A 1N5XA 2V4IB 4KTAA 4HCEA 1II3A 1O78A 4N9TA 3R2TA 1JC7A 1HZ5A 5IOCA 2A68D 1KABA 2IL8A 2DBYA 1YNJD 1EL0A 3MTSA 2EY2A 5BMHA 1SMYC 4XQQA 3VYRA 4OVZA 3G6JB 2WXQA 3TP8A 2NMQA 2KN4A 4MIUA 3TP5A 1WWTA 2CHBD 3S2DB 2I38A 1V1OA 4M1UB 1WD1A 1TY2A 3IAYA 1C4QA 4A3BB 1SDFA 1HUMA 3MA2B 2F0NA 2RPVA 2JA7B 4XWTA 2PO4A 4KY5A 4R8IA 4HAEA 4GDLB 5J22A 4C3IG 4HROA 3TP7A 2D5DA 1JB3A 2F03A 1TR5A 2OT2A 2EY1A 4L63B 4IDIA 1SYDA 1BR9A 1MI2A 1BMLC 2SAKA 3AMUA 2K1BA 1GJXA 1SBBB 3M4OB 2A68C 1YNJC 2CJNA 1RDPD 1QT9A 4DFAA 1EU3A 3Q8FA 2DY8A 5C0XI 1Y8PB 1TYGB 3K59A 3F2UA 3ZJTA 2RDGA 1PMRA 2OHFA 3SFDB 4HRSA 2L1AA 2VB3X 1FXAA 4OL7A 3B2FA 5D65A 2X69A 4GLSC 2F0LA 2Q5WD 2MGSA 2LKVA 2ID0A 1XLOA 1D4BA 1RF2D 1R4PB 2JA6B 1LT6D 1WTPA 1Q3LA 2HCCA 2JU6X 3AEAB 1NR4A 2BDNA 1VDZA 3CRLC 2MP1A 2QF7A 3FAHA 4WJWA 2WQYB 4GDKB 4ZK9B 1E0ZA 2NZ1D 2A74C 4IUVA 1EIGA 4BS9A 2CJOA 4FXKC 1BO0A 2EJFC 3VR8B 1EY5A 1MGSA 1STEA 1A2TA 5H92C 1EIHA 3HGBA 5C4JB 4F88A 2CW0D 2BE5C 4K6DA 1L4ZB 4CJ0B 4ZKBB 3VR6A 4OZBA 5C6AA 1STAA 3FDTA 3A55A 4RGOS 2LUMA 2K5WA 2WU2B 1AEXA 1ICWA 3CWIA 4HR7B 1I6HB 3DWAA 1DD2A 1LTSD 1T3QA 1S5BD 4DU9A 3M3YB 4ZOHC 2Z8LA 1K53A 4A3IB 1ILPA 2BS3B 4XIGS 3U9OA 4CKEA 2W55A 1F2LA 3BIID 3Q8BA 4Q0FA 1HFGA 4H13C 1L0YB 3A56A 4EQOA 5E6JA 5CGKA 2TSSA 1WTVA 4XT3B 3IAS1 4C80A 4MHEA 2GRIA 3SHLA 5IGBA 1E2WA 1ET6A 1PGBA 3L7ZC 1KAAA 2LY7A 5COYA 3W1SA 3DWGC 3PUWA 4Z9CB 3FEWX 1BCPD 1W6KA 5C5LA 2EYPA 2XNAC 2F0IA 4KHVA 1DM0B 4YSYB 2CW0C 5KIXA 2PLPA 1O7LA 2Q8RE 3B9JA 4XYQA 4QUFA 3ZQ4A 1YMHE 1HPCA 1PUTA 2BS4B 1B44D 1MSGA 1ZPSA 2KEDA 2NTSA 1WSPA 3HKZB 3P1MA 1O7YA 2DY7A 3KK7A 1LTID 4FF3A 2NVXB 4FVMA 5KGUA 3K5NA 2G9DA 3RMHA 3VRBB 1VZ8A 1LTBD 3TN2A 4A55A 1ACCA 2WXFA 5G5HA 1FCLA 4NDXA 5JPNC 2F0FA 1JWMD 4RGMA 3BDOA 4YSZB 3QO2A 4KN7C 2E76C 1F2MA 1F9QA 3OHXC 1YJIA 1YN5A 1BCPC 2PW7A 3CHBD 3S17B 1JCKB 2SOBA 2C9OA 4NKLA 4BBSB 2F0PA 1MVKA 2AUJD 3SXHA 1KF6B 3U4EG 4M8AA 3GTKB 2FBWB 1KTKA 3I9V1 1IW7D 1RTNA 4OHJA 1TS2A 5EKKA 5HURA 5A2QE 4RWSC 3X3NA 3AE5B 1C76A 2WXHA 4JWUC 2A5HA 5BMIA 1JICA 2NVQB 3L9AX 3L4PA 1V43A 4B0MA 2B39A 4BY7B 2WXMA 1DOMA 1K51A 1SJED 3ITPA 1DJRD 4KKJA 1AFPA 4LLGM 3J81E 3T16A 3DMUA 4HMIA 4JK1C 1M8AA 2A73B 3I73A 3E56A 3I8ZA 1BCPB 3C8YA 3FPPA 1TIID 1I3QB 2I2YA 1F9RA 2AWOA 2ACZB 4H7BA 2E2IB 3GTQB 2C5CA 1KNEA 3AM9A 1B9NA 4FF1A 3AU7A 2Q8TA 1SE4A 4B9XA 2PQEA 1FMAD 2XWJB 2B63B 1JRPA 4G57A 1IW7C 2DN8A 4ZUIA 2XRQD 2K01A 1XWEA 4FXDA 4YSXB 2F0EA 4KD4A 2N55A 4C2MB 2ON8A 5BYRA 3ABVB 1PYWD 2ZXPA 1OXTA 2FJ2A 1PZKD 2HTME 3GV3A 2B8GA 3SK4A 1EYDA 1CK1A 1ZUD2 5CV6A 1WGKA 1G2TA 4X3SA 1Y69U 3Q8AA 3K7AB 4XQNA 4LK0M 1B53A 4FNFA 1DXMA 5J39A 1TWCB 1RD9D 3LX0A 4KHZA 1K83B 3RZOB 2DLBA 3ND9A 1CQFA 5C4XB 3MWYW 3NWSA 1AWDA 2L32A 2J52A 5C3JB 2NBFA 1HA5A 1VZ6A 3NTKA 4DNTB 5FLXL 1CA6A 3Q69A 3S1MB 1JALA 1TKWB 4DXFA 3PZ8A 4ULLA 5EPLA 1C9FA 3W2DA 2LFNA 2N9KA 3KLSA 4IFDH 2PTLA 4K6LA 3MXGA 1SNDA 3VR5A 1CTMA 1UAPA 1EEID 5EKIA 2K22A 1VRAB 1ZP0B 1EYCA 4A3KB 4BY1B 1GUSA 1ZKOA 5D3IB 3EROA 2R61A 4RCNA 1TQOA 3IFTA 1PFBA 1AN8A 3U7ZA 3R8BA 3VR4A 5EE0A 2QEJC 3NBIA 1VF5C 2JEBI 1KDBA 3S15B 3H91A 2K9XA 4ZYSA 4U673 1STBA 1OXUA 2KCNA 2XN9C 1TKEA 1E2VA 1SFOB 3NWTA 4AQ7A 1GAQB 2ONQA 1SXTA 3I4LA 2WXPA 3I72A 2H89B 2ZT9C 3J7YW 2EKIA 3RFZB 3TEXA 2PW5A 2RBMA 2L0CA 1CZGA 4J1MA 1SYGA 4EQPA 3PO3B 1QF6A 4ODGA 4A90A 5MPOA 4XWWA 3WOFA 5NUCA 1I4XA 5M3MB 5FO7B 3PV0A 1CZWA 1NCVA 2MJ3A 1MSHA 3DWQA 1H9KA 1ROEA 5C3EB 1EWHA 3NUCA 1JORA 1PRTB 3R2IA 4L8JA 1JE4A 2KAJA 4XQJA 1X32A 3GO5A 1E0BA 4DGZA 3AEFB 1SYCA 2BOSA 4PNYA 1EY6A 1SE3A 1WTWA 2FMCA 2K5PA 2KUMA 4WIPA 4K5XA 3DEOA 4RGTA 1BUIC 3EQLC 3OIQA 1C4CA 1S4ZA 5DM73 1HQRD 1D1KA 1V1PA 4R8NA 5I9OA 2MPMA 1BBXC 2PNRC 5K36G 1F2ZA 4XDDA 1YQ3B 5HI1A 3TEYA 1LTGD 1DOIA 1HZ6A 1PTOB 1GHKA 3NVYA 1LLRD 3GTLB 4XE0A 1OQQA 3D4RA 3LNNA 3EVQA 4TQ1A 3N6RA 1KRHA 1B9RA 1N63A 1IBXB 1LT4D 5DEHA 2O5JC 3NRZA 1QNKA 2KVMA 1VLBA 4B9WA 2K33A 4J8QA 1RJTA 1DONA 4WORA 2D5GA 2WXIA 3IFDA 3AV8A 3HOVB 3PUYA 5FO9B 2BB5A 1WRIA 3MXNA 1FGBD 4A6QA 1D5ZC 1ZXTA 1RYJA 3TMEA 4PMBA 4N59A 1VZ7A 1E10A 3DEPA 1AW7A 1A70A 5BYQA 1ESRA 1GUNA 3S16B 4HJGE 2B2TC 2F0JA 2QILA 5ELCA 4P16A 3TZUA 1B2TA 3A8KE 4MH8A 2YYZA 1PLFA 2VZKD 2WXOA 5FK9C 1XO3A 3D31A 5JVG3 2F0TA 5C0XG 1SNOA 2EPBA 2R93B 4IUTA 3HVZA 1B4OA 2WACA 4HSPA 4QF4A 1JOOA 3SK5A 1TT2A 5ELDA 5DNFA 2B2VA 4KGTA 3G7LA 2F0OA 1KDAA 2V0GA 3K5OA 4CGYB 3AMZA 5KNDA 1L6UA 3FMCA 2JXMB 4KGSA 2O4XA 3HP3A 3TDQA 3T4AC 2M9VA 4KJNA 3FVQA 1PDXA 2HUGA 2RA4A 2EDGA 2F0QA 1EY9A 1VJKA 3GTOB 3BVMA 1A15A 4DAVA 2EXZA 4GZYC 1BOSA 1WVLA 4UAIA 1IUEA 1FXIA 1QWYA 1SYBA 5JOBA 1STNA 3HUIA 5JJZA 3P63A 2R3ZA 3HEJA 2N0SB 3NP8A 1Z7TA 1AZPA 3QIAA 2E2JB 1JWAD 4PQXA 2VB2X 2WXJA 2XSCA 2CU3A 1L0XB 1SNQA 2L55A 3U9SA 4G7OC 3VYSA 3D4WA 4US9A 3BVZA 2JX5A 1FO4A 2AQ1B 4OO1I 1ZDXA 2EY6A 1B50A 1PFMA 5M3FB 5EKLA 4BWGB 5D7GA 2KOLA 1TWHB 2WLBA 2D2CC 3HOWB 3NVVA 5C5MA 4C3IB 4UDUC 4DNRB 2WAQB 1JOKA 4H44C 2RDFA 4IFDJ 1T6BX 1MI0A 2EE1A 5G5GA 3MFYA 2JSVX 2VZKB 1EFID 3ONAB 3PIP3 1LT5D 3C1EA 1HXYD 3LXFA 4USAA 3IKJA 1FFUA 1N61A 2EYHA 3I90A 5IGGA 4JX1C 1PRTF 5FR3A 1B3AA 4IKGA 1B9MA 4G7ZC 5JEAJ 2L4NA 2Y5CA 5EPKA 4RHSA 1NYQA 3GB1A 2MH7A 2F0HA 2KCCA 5LNK1 1FM0D 3KBXA 5D14A 4OGQC 3NTIA 3MEHA 2NVYB 3GS2A 5I6WA 2NUCA 3J7AV 4A3MB 1GB4A 2F1MA 1FRRA 3Q0AA 4WWMA 2K7VA 1KFYB 1UWMA 2Z4HA 1S5FD 4KY7A 1MHXA 1W6JA 2A6ED 1WD0A 1Q10A 4FXCA 4JPSA 5ELEA 1PTOF 3QJYA 1A3TA 3U52E 1G2SA 1V1PB 3QOLA 4WRDA 1NEKB 2IT1A 1C48A 3VR3A 1V97A 1QQRA 2JXTA 2RVLA 4ZLTF 4KKSA 1SE2A 2BA1A 1I6VC 4DN4M 3URYA 3S2HB 4QCLA 2EYMA 2WXKA 2E75C 3S1NB 3D6WA 3GQBA 2RQXA 2EELA 3GTMB 1QOAA 1EZ6A 5H8YE 5M5YB 4HCSA 4MM3B 2LMCA 1QOFA 1N62A 1F0ZA 1UUPA 2H1EA 2IJ0A 2EYFA 5C3WA 4TQ0A 2B8FA 3K5LA 2N9LA 3T53B 1GB1A 3I4MB 3E5SA 2A6EC 5A35A 2NTTA 3VQIA 1CFMA 1LTAD 4NMZA 1JW9D 2KEEA 1KNAA 4X3UA 1R9TB 2JYTA 5EE1A 1NVID 1CI3M 4KD3A 4NW2A 2R92B 1ZE3D 3HOXB 4CKCA 4OZCA 2KA7A 2LEKA 1NAPA 1TY0A 1ET9A 5GXGB 1KLGD 1Q1BA 3B2GA 3NZ3A 2WKDA 3QG1A 3IT4B 1IYVA 1D6EC 1STGA 2D9UA 1FR3A 3KLSX 1IKLA 4L23A 3E0JA 2WDQB 4C3JG 3SEBA 4A93B 1L6VA 2INNE 1E7PB 5HG2A 1IBXA 2IW3A 1YNTE 5JXVA 2I07B 3R93A 3QOJA 1LABA 2EVBA 3KWVA 1FIQA 1SIJA 1CJEA 2XVSA 4BBRB 2PYKA 1D5XC 2KQ4X 3AH7A 2L9HA 3SFEB 3AE1B 3VYUA 2F3VA 1JROA 5EGTA 3TZDA 2WP8J 2SNMA 1EYAA 3BDLA 3KWLA 4G7HC 3W5VB 2L52A 1PGAA 2D62A 2DNCA 1RTOA 1TWAB 1ILQA 4FXGC 3AECB 4NAMA 4ARCA 3Q23A 4N6EB 4US8A 4KMUC 1CA5A 1DOXA 1XLPA 2SEBD 1EWYC 2BTEA 1WTQA 3WCQA 2DYOA 2WINB 1EWCA 1SEBD 2N88A 3WDNA 1C77A 4MACA 4L2YA 2QDBA 1T5EA 3CIRB 4RF0A 5EBDA 4R3DA 2WB1B 3PUVA 5KYLA 5KYIA 1BNZA 2DNEA 1J8IA 3AE9B 3NS1A 1QE6A 4C7ZA 1L4DB 1X3PA 4RNAA 1FD6A 1GUOA 3BS1A 1QJOA 5JPMC 1TWFB 1DCZA 1Q1EA 1S5CD 2HDLA 3MHBA 1U4PA 1L5PA 3H0GB 2I46A 3SK6A 1PRTD 3D8GA 2JE6I 1F2RI 2L11A 2KMMA 2EJMA 3DWMA 2E74C 2K5QA 1QILA 3EA6A 2KQ3A 2VUMB 4TKOB 1WTRA 1KH0A 1SSNA 1YN3A 2K32A 3ETRA 1KLUD 1GUGA 2PVGC 3D6CA 4G4KA 2PMVA 2H88B 3J80E 1X3QA 2H4OA 3IT6B 4ABNA 5D3DA 1VMCA 3MHZA 3LYYA 1SYEA 2ZW0A 3AEGB 2IWHA 1JWSD 1PTOD 1QOGA 2IPKD 3GTGB 3AE4B 2BW2A 2A6HD 4QIWB 2F0UA 4A3FB 2AQ2B 5EE3A 4I7ZC 4IOIE 5LL6S 5K36H 2NN6H 2ZXRA 3T56B 2ICEC 2NVTB 2Q8IB 1Y1VB 3JAME 5EJWA 1QG7A 4O1NA 2JA5B 2Y5PA 2X6GA 5CMDA 4KN4C 1I50B 1UEAB 2WXNA 2SNSA 5CV4A 4X3TA 1Z47A 3P4RB 1PRTC 4IUQA 3BVGA 3UI2A 1LACA 3R3OA 4C56C 4RFBA 5JVH3 1VMPA 3M4YA 2WDRB 4D2KA 1F9PA 3VR2A 2LS01 4K8IA 4V0BA 1EU4A 1FYCA 3Q6SA 4IUPA 1PGXA 5BN4A 4V190 5CYUA 4H0LC 1XEEA 1TKYA 3PZ7A 3MC0B 4CBVA 2BBCA 3HOYB 3KQ4A 4HTHA 3D3RA 1NYRA 5CBEE 4N58A 2KHSA 3OIPA 1PTOC 3KBGA 2LMCB 1ENAA 2MUYA 2A6HC 4C3HG 4C1NI 2IX0A 5BN3A 3NVZA 1IHZA 4YXDB 3A7AB 5T1GA 1HFNA 3OW7A 1I4PA 4TMAB 3SR6A 2GA4B 1E9MA 4IUNA 1XLNA 1K52A 2K28A 1L0VB 2PMZB 1J7BA 2MJ8A 3T13A 4K5VA 4LAAA 1D2BA 2PZWA 1MPEA 4CQNA 1IGDA 3SK8A 4X3KA 5C0XH 5ELBA 3BWUD 3OMGA 2MEKA 4OIKA 2ZW1A 1GUWA 4KX6B 4J3OD 1LT3D 2WNMA 1IYUA 3HRDD 3SDZA 3W5UB 1TJEA 4PMWA 2JEAI 3VA7A 1ZOYB 3BK2A 5A2QL 5BMGA 4BA2I 1RM6C 2PZUA 2W82A 5EBCA 4WFN3 2JWUA 2PCFB 2NN6G 4YT0B 2RKSA 4ZRPA 1BUVT 4OZAA 1SAPA 1SNCA 3AB5A 1NI3A 1FNWA 5EPJA 2EYLA 2M2LA 4XDXA 3ZJUA 1C79A 4BA1I 3TSSA 2K0PA 1D1IA 4H2AA 3J81L 3QWNA 2OEOA 1H9MA 5CV5A 3SE0A 3TEZA 3PUXA 3C2PA 1NENB 5BN5A 4ZUJA 4IALA 5IT9E 1TKGA 4RAUC 2LFIA 2V3NA 1HCZA 2KACA 4B0EA 2WXLA 1HA6A 2YEPB 4QB4A 1CHQD 1A6XA 1SSOA 1LTRD 4HKZE 1YQ4B 4CJ1B 2NYZD 3LWUA 2JQRB 1XXGA 2K6AA 3J7AF 1J7CA 4ZHOA 2HQEA 5IGEA 1SYFA 4CJ2C 2SDFA 3A8IE 5C4HA 1D5MC 1FNUA 1IKMA 4LK1C 3C3LA 4AS1A 5I2XA 1SNMA 4YIJA 2DWQA 3DWPA 5LL6X 1J9OA 1JWUD 3FKIB 3NQTA 3C46A 3IAM1 1OXXK 3NPPA 2WKCA 3J80L 3NK9A 4OO1G 4P6VF 5JAVA 1S5DD 4U68A 2M0AA 4DA2A 1FCCC 3RD4A 1LO5D 1UGJA 1Y8OB 4DAPA 1TWGB 4TQUS 1JMLA 1RFKA 3IL8A 2WV6D 1XYIA 1KDCA 1QB5D 1EEFD 1F77A 3A8JE 4RKLA 3VYTA 3P7JA 3P4SB 3N52A 4ARIA 3AE7B 2GB1A 4A9AA 4IFDI 1PDQA 3JAML 1VDVA 1QKZA 5CORA 2Y3AA 5KNCA 3OMCA 4DK1A 3S14B 1FD7D 2HDMA 2M19A 2E3TA 1OXSC 5HHDG 2F0VA 2OEDA 1G91A 5FKAC 4WURA 3P4QB 4DK0A 1IL8A 4WH4A 1Z6HA 1C4AA 3OWFA 3H3VC 3U2SC 1TU2B 2IX3A 3PMFA 1A3VA 2L5TA 3K6OA 1QOBA 5J1ZA 2BT6A 5F2DA 1VCIA 4NZLB 3P75A 4ID6A 1AP0A 3GV6A 1JQ4A 3MJ5A 3T3OA 1XX8A 3PO0A 3Q22A 1U4MA 1ML0D 3KUPA 4DAYA 2NWGA 4JWSC 2NB0A 2FINB 3H8HA 4QUCA 1S5ED 5G3LF 2J53A 5CV9A 4ZQ3A 3OWEB 1BF4A 2V4DA 3ZYYX 1RWSA 1JQYD 1TVXA 2J0TD 1B1ZA 2R6GA 3PUZA 5K5PA 2Y0SB 3I4NB 2ZXOA 3DUZA 3KLRA 1CQVA 3TUOA 1GPXA 3OPOA 1OO9B 1GUTA 1HRJA 3AE6B 3HVDA 4A3JB 4HKQA 2ENBA 2A69D 4FP5D 2FE8A 2E2HB 1J7AA 4R9WA 5T1IA 3ZGZA 1H9SB 2WS3B 1F9SA 2BE5D 5CC4A 4MT5A 1DOKA 2EZVA 1EOTA 4ZRQA 1I4RA 2BDOA 4KV6A 4YWGG 3CQZB 4KKTA 4OW0A 5HFYA 2M00A 2IGDA 4YTNB 2QMTA 2IDYA 2FMMA 2W3RA 3A54A 1EQVA 3V96A 3K0YA 2VNUD 3TEWA 1VR9A 3OSOA 2QSDA 3P4PB 2F0WA 2K03A 4WQMA 4ITKA 4RKBA 4OIJA 1SF0A 1M4VA 1DOLA 5AUIA 2BYTA 1OXVA 5EE9A 3BYYB 4PMCA 3BYTB 1EY4A 3P1HA 5AFWA 4JBWA 3N9YC 3V2TA 3C1FA 1IGCA 3X3MA 3P20A 3H09A 1FEHA 2X6LA 1JWBD 2L12A 2VXWA 2MJDA 4A8XC 2V3PA 4F7XA 3EGRA 5IT9L 3OOCA 3I57A 4AYBB 2B2UA 1WCMB 1C4PA 4K8JA 4RCOA 5IIFA 2A69C 1ZEQX 1AZQA 3S1QB 2PPBC 3GP7A 5I9PA 4ME5A 5BYSA 2KWDA 4EQNA 3HS0C 4RH6A 2Z1CA 4C7YA 5C44B 4TRDA 2RMMA 3P42A 1HTPA 1U4RA 4S3SA 5C0XJ 2CQAA 2BB6A 1N60A 4KGRA 1U4LA 1STHA 1BQQT 1ZXHA 1E6EB 2IGHA 4L1BA 2JA8B 4K2LA 5E4XA 1P7FA 1HUNA 3H6MA 2YEPF 4RHRA 3E6ZX 2YU9B 3AE3B 4QMGA 4EE2A 1VF7A 2EYOA 2B2VC 4HEA1 4B08A 5KNBA 2W54A 1QNUA 5E3FA 3LWEA 1DZ1A 3SR1A 2ICIA 4DF7A 1G6ZA 3NUHB 5FLXE 1UNSA 2BA0A 4DQOC 1NUCA 3HG9A 3K58A 2O2LD 2L1BA 3SVMA 1XCTL 2WXGA 2HCIA 2PZTA 2WU5B 4HN7A 2XRSD 1Y1WB 3W9CB 4ZHPA 4FF2A 1F2RC 4REZA 1NSNS 4KKUA 2LHEA 1ZYRD 2B2WA 2AQ3B 3MZ5A 2CVRA 5C4ZA 2F0GA 3PO2B 1I4QA 1T5XD 1Q8IA 1XCQL 1RODA 1YN4A 3FILA 2TMPA 1C8CA 1EY8A 4XTCS 1SJHD 2J42A 3MFGA 1YNND 5FOBB 5DM63 3NBHA 4NP5A 2JYEA 1EY7A 1ESFA 4CHTB 3AEEB 2O5IC 1GOZA 3O13A 3T51B 4EGVA 5FO8B 5KRUA 5T8IA 4O42A 3AB9A 3MVVA 2QCPX 4YTPB 3L3OC 5M9OA 3VR9B 1GHJA 5G3LD 1OQRA 2B76B 3ZJVA 2L83A 3BDCA 1XTCD 1RHPA 1QOHA 2AUKA 3VA5A 5I4DA 3M85A 4FF4A 5AUKA 1CT1D 1PFNA 3AN1A 1O7ZA 3M7GA 1ZYRC 5CV8A 4F87A 3A7LA 4PV1C 4C3JB 2BS2B 4IURA 5E1FA 4HSVA 2F3WA 5IGCA 1LV9A 5EQ0A 2EYJA 4RGNA 1MHHE 4NAWB 1R7SA 4XT1B 1I7HA 1CZPA 3ND8A 2RSOA 4ZRZA 3J9CA 1F2YA 2FUG1 4J6HA 2FFKB 1YNNC 3DM1A 3K5MA 3W3AA 3CU7A 3AE8B 2IX1A 4XDCA 5CR3A 4ZKCB 3HOZB 2PKOA 4N9PA 2GI9A 3RLFA 3DHQA 4XYOA 2B2UC 5HGTA 2LHDA 5I6YA 2LJIA 3NVWA 1MD2D 2KJXA 4JE3B 2B2YA 3ERQA 4YTMB 1YJJA 2F0KA 3I3CA 1WYGA 5C2TB 3E9SA 1Y56A 5IODA 1LTTD 3CRKC 3S1RB 2E6XA 1EQTA 3NHHA 5CV7A 3RPFC 1R4QB 1K8OA 3GTPB 1N5WA 2F4IA 2DYMA 1QLBB 2K5DA 2WDVB 2X38A 1DOYA 1V8CA 2BCOA 3S9WA 5TSSA 1WTXA 2AWNA 4EVOA 4Y7NB 1HTLD 4KJOA 3I70A 5M5XB 4L6TB 1P7EA 1EZ8A 4E6IA 4A3DB 2QJLA 1AYFA 1PTOH 3MP9A 3LB8C 1ENFA 2B2TA 5M5WB 2J7ZA 1WTOA 1WXQA 2INPE 3K57A 2JZPA 1RCVD 2EOTA 5IGFA 2J4XA 3RZDB 2RSNA 1HEZE 1G8ZD 1V8QA 2N7JA 2Z4IA 4IZ8A 1GXDC 1DGJA 1ENCA 4P2CB 1H9JA 1FRDA 1PZID 2WP9B 1K8MA 1A3UA 3V3XA 1STYA 1BDOA 1H9RA 1HQMC 3HZXA 1E2ZA 1RKNA 3BG3A 2PVOD 1I4GA 1Y8NB 2B2WC 4KK7A 1H9SA 4DXGA 4MN3A 2JSOA 3NTHA 1TS4A 2OF1A 3FRPB 5LHY1 3AEBB 4XXEA 2KDMA 2E2DC 4Q2JA 4WAFA 5JEAH 1HHVA 3BK1A 1TZOA 1U9RA 4RF1A 2F0MA 2F0DA 2F0SA 2G1EA 1ZDVA 3Q8EA 4IQZA 4LTUA 2LGIA 3GD7A 4KKIA 3MXPA 2XWBB 1XF5L 2AX5A 3Q24A 2K3UA 3CKIB 4FO2A 5ELFA 3FPUB 3MXUA 4A3GB 2OXPA 2KECA 1SNPA 4OO1H 3NE5B 3AE2B 2QKIC 5ISRA 3IXSA 4IUUA 4K2KA 1I4HA 3MAQA 3TBIB 5C3XA 4C3HB 4M0WA 2W3SA 1QCBD 1G291 3HOUB 1TS3A 3AEDB 3NSWA 3UI3A 2K05A 2WXRA 3FILB 4Q5VA 4RA8A 3VRAB 3WOEA 2EJGC