1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
2QILA 2CHBD 2NTTA 1HQRD 1MD2D 1JR0D 1GOZA 1UUPA 1ET6A 1F77A 2RDHA 1AN8A 4BWGB 2ICIA 1KLGD 1PZJD 1KTKA 1FD7D 4DXFA 1RDPD 1JWUD 3R8BA 1ENFA 1FNUA 5I4DA 3KLSX 3MFGA 2TSSA 1T5XD 1I4XA 1HA5A 1CT1D 3R2IA 2XNAC 1EU4A 1I4QA 3CHBD 3SEBA 3BYYB 1V1PB 4UDUC 1BCPC 4RCOA 3DWQA 3OWEB 1CQVA 5D3DA 1LTID 1SJED 4ZYSA 1LLRD 1JWMD 1PTOH 1SE3A 1STEA 3O13A 3R2TA 1TS4A 1SXTA 1B1ZA 1JCKB 4RGTA 1FNWA 1AW7A 3URYA 1SE2A 1D6EC 1LT5D 2AQ2B 1M4VA 1S5DD 1FNVA 1BCPF 1YN4A 5FK9C 1SEBD 3BYTB 1PTOB 1PRTB 3TSSA 1CHPD 1SBBB 1LO5D 2IPKD 4RH6A 1S5FD 1EWCA 1KLUD 1S5CD 3V05A 4C56C 1B44D 1LT4D 1LTAD 1LTTD 1D5ZC 4RGMA 1TS2A 3MC0B 1CHQD 1BCPD 1PTOC 1PZID 4O1NA 4OHJA 2J4XA 1SE4A 2QEJC 1PYWD 4TSSA 1TY2A 1EU3A 2AQ3B 3EA6A 1EFID 1EEID 1XTCD 1UNSA 2NTSA 1G8ZD 3DWAA 1QILA 3EFXD 4RFBA 4DXGA 1L0XB 1LTBD 3BZDB 4NZLB 1LT3D 1FGBD 4L63B 1S5ED 5D3IB 1PTOF 1L0YB 2R61A 1PRTF 1ET9A 1HTLD 2Z8LA 1I4RA 1LTGD 2O2LD 1DJRD 2SEBD 4L6TB 1LTRD 5TSSA 1D5XC 1YN5A 1DYQA 1SJHD 1PZKD 5ELFA 1I4GA 1CK1A 3BVZA 1TY0A 5ELCA 1V1PA 2XRSD 1PRTC 1RCVD 2XN9C 4Z9CB 1I4PA 1TS3A 1BXTA 4K6LA 1XXGA 1ESFA 4RHRA 1V1OA 2RDGA 1LTSD 1RF2D 1YN3A 1TS5A 1BCPB 4RGOS 1HXYD 2WV6D 1RD9D 3DWPA 4RGNA 5ELBA 5FKAC 1PTOD 2G9HD 2XRQD 1I4HA 4RHSA 1D5MC 3BVMA 3BVGA 1JWSD 1EEFD 3W2DA 5ELEA 2AQ1B 5ELDA 1LT6D 1S5BD 3GP7A 1JQYD 2IJ0A 1PRTD
chains in the Genus database with same CATH superfamily
2D0OA 3R93A 4KLKA 4JYAQ 3ERQA 4LCDE 3EFCA 3GQBA 2W55A 4ZRKA 3M4YA 4IO9A 1ZDVA 2JRIB 3Q6BA 3TP6A 3ZQ4A 3RFZB 2FMMA 2LXKA 1K52A 1FD7D 4DR3L 4IM0A 2ATWA 4LDTB 2H4OA 1YIWA 2YLMA 4LF9Q 2PZTA 1GC7A 4LUOA 2D2QA 5IWAQ 2LVOA 1CZPA 4FO2A 4JL9A 1EY9A 4BBRG 1G91A 2JYOA 1PH8A 2WB1E 2R2OA 4OXPA 5DCNA 3M3YH 1D4BA 4GMVA 2UU9Q 4IJHA 2WXNA 1XT9B 3FHWA 2NUCA 1VQ5A 2WYQA 2CWPA 3SK8A 1WH3A 3KUCB 1KH0A 3RLFA 2WKDA 1LQBA 2LUMA 5EJWA 3H91A 4DR2L 2ZTDA 1V80A 2IBIB 3V61A 1U9RA 1FYCA 5KNBA 3V6CB 1M4VA 2HDMA 3FDTA 4M0WB 5JJIA 1CM9A 3HG9A 4DV0L 2JRHA 4ZKBB 1UF0A 3AXCA 4NB3A 5BMHA 5A2QL 1L1OA 5DPWA 4L8JA 3QA8A 4DR4L 4G7HC 1YZ6A 2A6EC 3AB9A 3IFDA 5CV5A 2JZZA 4UHVA 5J2RA 4JI6Q 1DOKA 2UXCQ 4DR5L 5I2XA 2D3AA 2KWVB 5EBDA 1QQRA 3HOVG 5BYQA 1PTOC 1YJNA 2Y0SB 2ONQA 1DGSA 2DX5B 2H5XA 1PDXA 2LEKA 1EYDA 3TIXA 4KSKC 1G8ZD 2JWUA 1QILA 4FJVB 1Z7TA 3HOZG 1O7ZA 1KIXA 3KH0A 5IP7H 4IUQA 4YY3L 4M00A 4KD3A 5FLXc 3GTLB 2IL8A 4CGYB 2K52A 1DCZA 1Y8NB 4YCVA 1QG7A 2CU3A 1HTPA 5CV7A 4DR3Q 4URKA 4K8JA 3KJPA 3OJ4B 4AS1A 1EY8A 1TWCH 2KTFA 4F7XA 3GTOB 4LNQA 3QOLA 1YHBA 2MSED 1CFMA 3NPPA 4KKUA 4OEMB 1WX9A 3E3XA 4X65L 3PPAA 3OJ3A 2BF8B 1DXMA 3S16H 2N1VA 4GZYC 1FCLA 2F0GA 3BVZA 2LRUA 5DPTA 1UELA 3I4OA 1N34L 1K8OA 3TEYA 2CQOA 4KGSA 4IOIE 3VUYA 3GTOH 3B08A 4DR2Q 1K0RA 1Q81C 3AI5A 3OOCA 2JQRB 3V2TA 4RGOS 2KX0A 1MI2A 4WORA 4DV0Q 3A56A 3CCJA 3MP9A 3DWPA 5MPOA 1BOSA 4ZK9B 2IHEA 2WIIB 4QCLA 4DR1L 4B9KA 3Q8CA 1NDDA 4DR4Q 3PF5A 2L32A 1V5OA 1VQJA 2N9LA 1JE5A 4XYCA 3AE7B 4DR5Q 4RWSC 4C3JB 2REXA 1UWMA 3PHWB 1QUQA 5FLXE 5LL6S 2PZWA 4LF7L 1IYVA 1GO3E 4A55A 5J39A 2B8FA 2LXCA 2LMCA 2JEBI 1ET6A 1GD7A 2KHSA 2O4XA 1HNZL 4YY3Q 4DGZA 3OYYA 3CC4A 4UAIA 3OG5A 3RZFA 4CHKA 2K28A 4WJNA 4YCWA 4DUZL 3W1SC 4CO7A 3RN5A 1RODA 2KMMA 2Z0EB 4NKLA 3D4RA 1C8CA 1N6ZA 3CC2A 2BWES 3PV0A 4N8FA 4NXML 4LFAL 4X65Q 2E76C 3LWEA 3AM9A 1LABA 4K0KL 2GOWA 1ENCA 2WLBA 4W9JA 3ALBA 1LLRD 3S1NB 1YJJA 2F0PA 3M7NA 2LUEA 1N34Q 2XWBB 1TS4A 2SNMA 4RAUC 2N9PC 4IUMB 4DHZE 1ZXHA 3ML8A 4KHZA 1E22A 2VUMB 4X3KA 1PXUA 2E5LL 2FCQA 4POGA 3Q24A 3AU7A 3AEDB 1K51A 4PMWA 1J7BA 4YTNB 2CKHB 3SDZA 4B9XA 3PO3B 4K5VA 5GAEC 5M3FB 2CS4A 1LO5D 4DR1Q 1YIJA 3S1NH 2A6HC 2I1JA 4U673 2ZJDA 4KV6A 1NNXA 1P1AA 2DYMA 2EE1A 4CDEC 3HIZA 4HR7B 2LGXA 4JI2L 5E7NA 5J18A 4DK3C 1JRPA 4X64L 4KHVA 2KQ3A 2A73B 5LMNW 4LF7Q 1FIQA 3H6NA 1EU3A 3KBGA 2CHZA 4JGHB 3PO3H 2AUJD 5M3FH 2A68D 4CJ2C 2L9HA 2IO1B 1HNZQ 1T0SC 4HWIB 4N6EB 4ANWA 2KT7A 4GN4B 2VB3X 1HUNA 1PTOF 1B4OA 3NP8A 1VDVA 2E6XA 2IYDB 4IPGA 2M8SA 3K7AB 1LTGD 3V62A 4I6PA 4NXNL 4I6LB 5CX3A 1C7YA 3AMZA 5TSSA 5IP7G 2NVQB 1WYWB 2RDBC 2B39A 4NXMQ 5DEHA 4JI3L 2JSOA 4LFAQ 4NQLB 3OSOA 1WWTA 3Q22A 4K0KQ 4GLVB 2V1CC 2Y0SG 1SFOB 1RCVD 3K7AH 4K6DA 2KVMA 1I4PA 2LXJA 4XYOA 4IJLA 2UXDL 3T8MA 2RQXA 1Q86C 3A4SC 3CCMA 3KYDD 4ZHPA 2L8JA 2E5LQ 1QOAA 2PW5A 1TZ1A 3NBIA 4B3TQ 1HXYD 1LXDA 4V0BA 1X3GA 4PYUA 1BBXC 1KD1C 1I50B 4DV2L 3ZKJC 2IGHA 4YWLA 4TVAB 1P0RA 1QOFA 2C5LC 2VZAA 4XQJA 3PRZA 1VCIA 1SFOH 1MJDA 2PPHA 4YT0B 2JZPA 2NBVB 1SRUA 3JVZX 3ZTCA 4CDCC 4KGTA 1XLOA 1X56A 3SD5A 2J0MA 3UIPB 4GN1A 1QOHA 4JI2Q 3J80c 4K1RB 2MGSA 1KNAA 4X64Q 2WWZA 1I50H 3PS6A 4DWFA 1K8RB 2HDLA 1FJGL 3IKJA 5COYA 2M00A 1AN8A 1E3PA 2ZJRA 2VQFL 2F0WA 3T3NA 1FCCC 1NMFA 5DLQE 5F2DA 5IGBA 1NUCA 2AUKA 1XD3B 4IC7B 1FNUA 3UF8A 4P72A 3E0JA 2K25A 3ZRFA 3IFTA 4NXNQ 3EUB2 1P16A 4G7ZC 3AE8B 3I5JC 4LNNA 1CT1D 5C3EB 1C77A 3QAQA 2Y5BB 1J6QA 1WFYA 1J9OA 4KY6A 2K03A 1AFPA 4KMUC 4JI3Q 3NWSA 4C3JG 3U8ZA 4MGYE 3L16A 4TV3A 2OOBB 2MJEA 3B1LX 1L1OC 1TKYA 4R1JA 2C7MB 3BK2A 3KUZA 4P1CC 1QNUA 5HGQA 4A3DB 3CSFA 1TWFB 4L5TA 4N9TA 2I38A 3DXJC 2UXDQ 2QJLA 1D8LA 2BKRB 1EIFA 2X8XX 5C3EH 2R3ZA 1A5RA 1U4LA 1AZQA 2DYOA 1G2SA 1U4AA 2XGTA 4MM3A 1IBLL 2NPTA 1EUJA 2SDFA 4S3SA 4DV2Q 1BMLC 2OJRA 3J80E 1RFAA 3S15B 1CA6A 1R4PB 4OX9L 1GM5A 1KLUD 1CSQA 4A3DH 2JX5A 2LD9A 1TWFH 2B2VA 2GN5A 4JV5L 3S2HB 1HH2P 3PUZA 4NAMA 5CHVC 1FO4A 1E7ZA 1EY4A 2AWTA 4ZUJA 2X38A 4JI5L 3UINB 5IT9c 2J4XA 2K5PA 4A3GB 4MSQB 4QL5A 4O0AA 4ANXA 1EFID 3A74A 3TZUA 3J9CA 3S15H 3BZDB 1FJGQ 5JPNC 2VUMG 2K8BA 3N3KB 1VQEA 2FCNA 2FFKB 4TQUS 2IX0A 3WDNA 2VQFQ 4DV6L 2FCMA 1DOIA 3S2HH 3M9BA 2JA9A 3BG3A 3AH7A 3SXHA 1S4ZA 1F52A 2F0DA 4OONA 1N63A 1RIPA 5G5HA 3WAPA 4NNJB 4J3OD 3MAQA 3PO3G 5M3FG 2KQSA 2IT1A 2EVBA 4NPNA 4ZOHC 1Y8RC 4DQOC 1X54A 2LZ6A 1KRHA 1YNJC 1I42A 2LS01 1XLPA 3AE9B 2Q2UA 2N9EB 3LNNA 2JXTA 1IYUA 1TIFA 4RF1A 4KV2A 1P8LA 1WJJA 1QVGA 2O2VB 1N33L 3K6OA 2BYEA 1O7YA 1PHJA 3K9OB 3N1XC 3MTNB 1TU2B 2HHHL 1BXTA 1NY4A 1JC7A 1S3OA 5CORA 2K0PA 3A8KE 1STNA 3DVNU 2PQEA 4KDLB 2DGYA 1SNQA 1TS5A 5CV4A 2RPVA 2MCNB 2CFMA 3RNFC 4EZLA 1IBLQ 1V1QA 2G9HD 1T5EA 3GTQB 4RHSA 2KCTA 3K0XA 5IT9E 4OX9Q 1MVKA 1YNTE 1GUAB 2Y3AA 1IBML 2GVAA 2YTVA 5EKIA 4JV5Q 3AB5A 3W2DA 3L7ZC 1KFYB 1BF4A 3FKYA 1YNXA 3Q0AA 1E1TA 1E7PB 2W3RA 2Z0SA 3R7RA 3CW2C 4P71A 3HRZC 3DWGC 2BS3B 3GP7A 4JI5Q 4XC2A 3TBLD 4YTMB 2OQKA 2VNUD 2JN4A 2PZUA 3NUHB 4IWQA 3KQ4A 1JJCB 3VRBB 2I0QA 3ULJA 4PG3A 3RMHA 1KDBA 4IUNA 2JVCA 1PGBA 5C5LA 4GOPA 3L10B 5G3LD 4DV6Q 2W3SA 3KLSA 3CAMA 4HKQA 3HGBA 3VA5A 2KBNA 3E5SA 3CCVA 1KC8C 3FILB 3NTHA 3V3XA 4NJ7A 2TSSA 5JEAH 2Q2TA 1UGJA 2PE9A 1AYFA 1AE2A 3F1ZA 2B2UA 4DNRB 1A3VA 1WX8A 1OEYA 1Z5SB 1I4QA 1LUZA 4P74A 5JXVA 2K05A 4ARCA 1W6JA 3WANA 4HMIA 2HT1A 1D3ZA 1N33Q 2BA0A 4TQ0A 4D2KA 2BB6A 1Q12A 2O2VA 4JI7L 3KLWA 3ZO5B 5E1FA 1WR1A 1JCKB 2IWHA 2HHHQ 2F0IA 4HDOA 4LJPB 3FVQA 1HZCA 4ACFA 3ONSA 1I6VC 2KJXA 4XWWA 4MELA 1FNVA 3C8YA 3GTPB 3ZJVA 2KCNA 3HM3A 3V60A 5CHFA 1LTLA 2MJ8A 4X3SA 3BYTB 1PTOB 2D62A 3MEFA 1PA6A 4OIKA 1TKEA 1XNQL 2E2HB 3ZDMC 4DXAB 1VQCA 3MWYW 2BBCA 4RCNA 1C4QA 3E0EA 2JJQA 1MIUA 1EWCA 1NAPA 1WXVA 3NVWA 3GD7A 1ISNA 3RUIB 2K75A 5C3EG 1IBMQ 4W9LA 3HS0C 3Q6SA 1KJTA 3A55A 2PPBC 1PUTA 5M9OA 3MC0B 3Q3NC 4XT1B 4JWUC 1HTQA 1XPRA 2DHZA 3GTPH 2INCC 4GKKL 2V1YA 2INNE 3Q8AA 2EYPA 3Q2AC 1TY2A 4A3DG 4EZJA 2UWQA 2E2HH 3A4RA 4FULA 2R7ZB 3WA0A 3U9SA 2JXMB 3F2BA 2CVRA 2QSDA 2J7ZA 4K3CA 1U4RA 5EPLA 1HZ6A 3I90A 4QY7A 5FOBB 1EQRA 1QNKA 1RJTA 4C80A 4DHJD 2AHOB 2CJOA 4MACA 4EQPA 5K36H 3CF6E 3FILA 2A69D 4A3LH 3TEWA 1YBYA 1L4DB 4GXBA 2R7ZH 3SR6A 2KJ6A 3RT3B 3X3NA 4II3B 3FKIB 4R3DA 1V5TA 4ZRZA 4QB4A 2BH8A 3C1EA 4A3GG 3Q8BA 4Z9CB 4JI7Q 3IAS1 2E75C 2OEOA 4IN3A 1K8MA 1WOCA 1GAQB 2R2QA 4DU9A 2A1AA 3RN2A 1L6UA 3ETRA 1V1OA 4MIUA 1XCTL 2FJ2A 2EIFA 3K80C 1C4AA 1H95A 3ZIMA 5E6PA 1M1KC 3FKIH 2WAQB 3EQLC 2XRQD 5LMUL 1XNQQ 1WJ4A 1N62A 1E8YA 2K22A 2FUG1 4Q2JA 3EBEA 2L1AA 3E56A 2PTLA 1FMAD 1EUVB 2FE8A 1A15A 3X0WA 1EZ8A 2ZXRA 2QCPX 2E2JH 1TYGB 2D10A 2WHIA 3NHEB 5ELEA 5G2NA 4APVA 5KIXA 4MTKA 4CJ1B 3M4OH 3LDZE 1IKMA 2GBNA 4FN2A 1K8AC 3SE0A 1E9MA 2MHJA 4GKKQ 1Q8IA 3FP9A 1YHQA 4ZQ3A 4EGVA 1WGGA 2UUAL 1D2BA 3CQZB 1EYAA 4JBWA 1EOVA 4KY5A 1VQ7A 2DY8A 1V6EA 2C7NB 3D32A 1FXAA 2WP9B 4LK0M 2B2WC 5EBCA 4TKNA 3MXNB 5J17A 4E71A 1EWIA 4XQQA 4IUPA 1RTOA 3VR6A 4DXFA 3K5LA 2H88B 3M63B 2LHEA 3VQIA 4A90A 2Z6KC 2DUDA 5IY0A 2LFIA 3R8BA 2XK5A 1TVXA 1KF6B 5JVH3 3K5NA 2HJ1A 1EF1A 1HRJA 4YXDB 5I6WA 2LFNA 1SIFA 3TRZA 3JAMi 3CQZH 3NQTA 4BA2I 2ZEQA 3HM6X 3BYYB 3UGBB 4UDUC 4DFAA 1E8WA 1RLFA 4TRDA 4KKSA 2FXQA 1GJZA 2P5ZX 1OXSC 1C1YB 2QDLA 2BQQA 1N60A 3U58A 5JZEB 2B2VC 2LXAA 4A9AA 5JJZA 3NUCA 2OF1A 3PIP3 3NVVA 2PW7A 5JH5C 2F03A 3KWVA 3TS2A 1X55A 2EXZA 3DHQA 4IPDA 1Q5WB 1TTNA 2ZW0A 4TMAB 4KKTA 3RZDB 1WE7A 2LGYA 4O2DA 2ZCCA 4DV7L 1S40A 5LMUQ 2N7EA 2NZOA 4KD4A 4MJSB 2Z1CA 1CKNB 1C76A 3DHGC 4LFBL 5LXIB 3C2PA 2D11A 3I91A 1NCVA 1TS2A 5AJ3L 3Q23A 1KLVA 1IYJB 1UGMA 1H9SA 1SMYC 1UEAB 4KJOA 2WXJA 3TP8A 1PYWD 5C23A 2J52A 3RZDH 3PLUA 4HIDA 2UUAQ 3ZJYC 1RM6C 1ILPA 2NVXB 2JWZA 4L63B 1UEBA 4NP5A 2PI2E 2IW3A 1Z6HA 1WVLA 1JOOA 4HVBA 4L23A 3RLNA 4EX5A 1WFQA 2ON8A 3L0WB 4KKIA 5D6JB 4FHKA 2NVTB 4FP5D 1BBUA 4A3CG 4KI0A 1OXXK 3TEHB 1YJWA 4J15A 1YMHE 1B3AA 5ELFA 2KTRA 4HROA 2NVXH 1CK1A 1X3PA 2WX0A 4DHJB 1F9PA 1VQNA 5NUCA 5K36G 2F3WA 1NYQA 1EYCA 4ZLTF 1B50A 2IDYA 1QVCA 2NVTH 1EWYC 2WDVB 1KXLA 5DM73 2R7ZG 1VS0A 5C0XH 1YHAA 2VY3A 1ILQA 3QK0A 3QO2A 2QHOA 1BCPB 4Q0FA 4J6IA 3HUIA 4B95A 2E2IH 3AE1B 3VA7A 2BS4B 4N8X1 2DJGC 2EKEC 5FKAC 1C4CA 2MHVA 2HCIA 4DK0A 4DV7Q 2NWGA 2UUBL 2G1EA 4A3FB 2EYLA 4IUVA 1LGRA 1HZ5A 2KFKA 1IUEA 2HQEA 4RF0A 3DM3A 1WTWA 4JX1C 2KVZA 4L1BA 3KVFB 4KZ0A 4GOPC 3SFDB 4LFBQ 2OEDA 4FHJA 3KFUA 3U52E 1CKNA 3Q8FA 4C00A 3KF6A 2L12A 3PO0A 2K4KA 3ZNGC 4O42A 3LWUA 3NEMA 5AJ3Q 2BKFA 3FKIG 4KTAA 2KDIA 3NTKA 2IJ0A 3R3OA 1PRTD 3KUDB 1FL0A 3WOFA 2B2UC 1HNXL 1A6XA 2ZPYA 1JALA 2K5QA 3L17A 4CBVA 3HZXA 3H8HA 2D3GA 2QDBA 4A3FH 1X1MA 3HVDA 4FLHA 3W5VB 4BKGA 4FXCA 1EOTA 3BJUA 4QF4A 2BVCA 4JVZA 4DK6C 1EYGA 1RL2A 5T1GA 1JB7A 2KEDA 3PHXB 2GB1A 1JMCA 2OWOA 4HJ8A 1WZ0A 2WAQG 1WTOA 3CPWA 3OW2A 1OEYJ 5AEKB 3RNCC 1PYBA 3ZXRA 2D5GA 4A3BB 3PRMB 3MXGA 3G48A 2D2CC 1EU4A 1EY7A 4PS3A 1N32L 2WDTB 3HFZB 4HEDA 2E74C 4RCOA 2K04A 3VHTC 3AU4A 1UE1A 3PQIA 1PH2A 2F4VL 3BDLA 2WAQE 5GAGC 1V97A 1E7UA 2NR2A 2PKOA 4NJ6A 3QX1A 2NMQA 4LNIA 3VR9B 4GLSC 3CRKC 2ASQA 1PFBA 1SNPA 4G7OC 3M3YB 4A3BH 4EFOA 4CKBA 2RGFA 4OL7A 3FPPA 1MG8A 1Q1EA 2BE5D 1VJKA 2X6LA 2QMTA 3DBLI 3IG3A 3QWZB 3QQ8B 2F0UA 3ONAB 1UE5A 2UUBQ 2YVCA 1EY0A 1DOMA 3V05A 2WFWA 3UE1A 2KWUB 2VZKD 5JHAA 2DNCA 2QW7A 4QIWB 4A76A 1WTHA 1YJ9A 1WXAA 2Z6BA 2KDEB 3DOWA 1XX8A 4MGZE 2MBBB 1K0SA 2K5HA 4LJOB 2J7QB 3M62B 2MRPA 2FCSA 3EA6A 2GVBA 1EEID 2NTSA 1HNXQ 2WACA 3NXWA 4ME3A 4DXGA 4BY1B 1OFFA 3WWVA 2A5UA 3TN2A 1F0ZA 1HUMA 3I4NH 3H94A 4G3XB 5D3IB 4AP4C 3TQYA 3H9DA 1R4QB 2OTJA 3BS1A 5CTRC 3U2SC 2PMZE 2HUGA 1VZ7A 4TKOB 3I3CA 1C78A 3UDXA 2KDMA 3R3MA 1VQGA 4HTHA 4BY1H 1DYQA 1MHWC 1N32Q 1K50A 3G7LA 1QUQB 4DV1L 2EELA 3L4PA 1TQOA 1TZOA 1TWCB 1WX7A 2F4VQ 2EY6A 2N88A 3U4VA 1CI3M 3DBLB 1K9MC 2WKCA 4E3CA 1MKHA 2LMCB 3S14H 3OLMD 4RHRA 2KMCA 3S16B 1E90A 4W9DA 1V86A 5ISRA 5BYRA 1N9WA 2K8HA 4A93B 1Z9FA 4LNOA 1IL8A 1K8GA 4CJ0B 1PFMA 1H9JA 2K33A 4XDXA 3AEBB 1J19A 2FIFA 5C0XG 3HOUH 1PGAA 1ZKHA 3PTFC 3NVZA 3DUZA 3UI2A 3BZKA 1NVID 1X3QA 4F8MA 3APFA 3GS2A 4M8NA 4ANVA 1WGKA 3DVNV 1WI5A 1XJVA 1H4RA 3RD4A 3M3JA 5FJ8H 1GUSA 3B2GA 5EKLA 3GTKH 4A93H 2WXGA 2A5HA 2ES2A 1YNNC 5IYCH 4DK5A 2L5TA 4W9GA 4PNYA 4K7SA 4HIOA 2VH2A 4I6NB 4IM3A 2I1KA 3HOWB 2INPE 2WXLA 4M8MA 1D7QA 1UBQA 4AOFA 3A9JA 2BYTA 2F0JA 4YSXB 1U0LA 1AZPA 3PIPA 1BKBA 4A3FG 2K6AA 2MQJA 1C48A 2CW0D 5KNCA 2Q5WD 4OWXB 2G3QB 4LK1C 4HK2A 4HIMA 1WGYA 3VR4A 1W3SA 1I7HA 4ZYNA 1NBWA 2KYWA 5G5GA 4DV1Q 3I56A 3WAMA 1LTID 1IHZA 3MJ5A 3N1ZC 3HOWH 1MPEA 4IG7B 2K6DB 2FMCA 4N9PA 4JIOU 1VQHA 4GB9A 2Z4HA 1SXTA 2MQHA 2OJWA 2G45B 3CCLA 4BOSC 4IW0A 1SE2A 2EYJA 3T16A 2PMVA 1JW9D 3C1FA 1QZEA 1YN4A 5K5PA 3FC4A 3PLVA 3U4EG 3P4PB 4DBGA 1IP9A 2JF5A 4XGAB 2N3SA 3SFEB 3CMAA 1BDOA 3UQAA 5HGTA 2M56B 1VF7A 3MFYA 4R4IA 2LWPA 5C4JB 1B44D 3AULA 4A3BG 3DBHB 3MHZA 4YWGG 2B8GA 2F4IA 3SK4A 4BY7B 2F0SA 3NELA 3P1HA 5EPKA 3J7ZC 4ZUIA 4OHJA 3TZDA 3TEZA 4EKUA 2NZHA 4K14A 4M02A 2IY0B 2BT6A 3LJ3A 3D6WA 3KOJA 1JORA 1QKZA 3N1YC 4ICVA 5G55A 2ZXPA 1NI2A 1KL9A 3TUOA 1F2LA 5KNDA 3F2DA 5C4JH 3NRZA 1VZ8A 4BY7H 3J81i 3J7AV 2W9NA 3PIO3 1CUKA 1HTLD 1F2RC 2DLBA 5IA7A 4JC0A 1EIGA 4H13C 3VTWA 1WIAA 2SEBD 1SYFA 2L11A 1E10A 4A3OA 4FYDA 1BT0A 3EHVA 3K58A 4POFA 4DAMA 5KGUA 3DEPA 3AECB 1E7VA 3RNUA 4FF2A 5IIFA 2IY5B 2BS2B 5BO4B 1G2TA 2RF4A 1TS3A 3RYTA 3ZW3A 4BY1G 4C3HH 1VQIA 1STBA 2DZMA 2F1MA 3SGIA 1PH5A 2D07B 3P4QB 1MSGA 1GB1A 2F0QA 3KK7A 1CTMA 2I46A 1V43A 4JQWC 1Y8OB 4DUZQ 1Y1VB 4F88A 3L2PA 3BVGA 3I2ZA 5EAYA 2YU9B 3PT2B 4G50A 1E8ZA 1ZW7A 1F2MA 2XTIA 2YTYA 3TL5A 3HKZB 2AQ1B 1A70A 2ID0A 2L0CA 3B2FA 3VH4B 1S5BD 1OGWA 1EY6A 2FNJB 3UIOB 1SNDA 3T53B 4BOZB 2LY7A 2YEPF 1PYSB 3S1RB 3HOUG 4P16A 2KZRA 1HQRD 2Q8RE 1Y1VH 5J1ZA 3ND8A 1WJ6A 1NMGA 2YU9H 4EVOA 4OO1I 1Q8KA 2ICIA 4TUUA 2KEEA 3DMUA 4HJ9A 5FJ8G 4MM3B 2NPTB 4KKJA 4DDID 2N8NA 2Y0SE 4A93G 2HJ8A 4W9CA 3TMPB 1TWHH 4F87A 5I4DA 5IYCG 3AE6B 3T51B 5C0XJ 2NCNA 3FRPB 1QE6A 1XEEA 3EJIA 3L9AX 3S1RH 4MZ9A 2KHJA 5FR6A 1PGXA 1IXRA 4A8XC 1IPGA 4LF6L 3NS8A 1BCPC 3K0YA 1CQVA 1SNCA 1VQAA 4RKLA 5T1IA 3STBD 2PE6B 4G0NB 3RZWC 4GNXB 1XWEA 1PLFA 1ESRA 3UDIA 4QJFA 1B1ZA 5BMGA 1E0ZA 1TT5B 4R9WA 4KVGB 2KUMA 3ZGZA 2MWSB 3VYSA 2MJDA 4B3RL 1MJEA 4C7ZA 4QQBX 1VR9A 2OXPA 4Y52H 3HOWG 3VRAB 3TSSA 2LI5A 4PS8A 1YQ4B 1R4NB 4ZRPA 4HKZE 5C4XB 4TQ1A 4JW0A 1C3TA 4C56C 4DUYL 3DHIC 1TT2A 1Q1OA 1WXSA 3HVZA 2R7DA 2KQ7A 1MSHA 2DBYA 1HEZE 1YOVB 2G4SA 2KC1A 3MXUA 2RHQB 2JA8H 2HTHA 3P4RB 4JWSC 2EY2A 4WURA 3ZNHB 2AQ3B 3NQIA 3H15A 1TWGB 4KSLC 3BDCA 1JWAD 1JOKA 4HCEA 3GTGB 1A8VA 1LT3D 5C4XH 1U4MA 2VW9A 2I5LX 2AMCB 2JU6X 3GE3C 2ZJQA 2PIAA 1ASYA 2KHWB 5FO9B 2L76A 4OO1H 3T13A 3BDOA 3BK1A 3GE8C 1X9NA 1YQBA 4NJCA 2MBHA 3F2UA 3LXFA 2A6ED 5G3LF 1TWGH 2KWCA 2JT4B 2JA6B 2EJMA 5C2TB 4BY7G 1N61A 1SMXA 1ZYRC 3GTGH 3L08A 5JHBA 4LF6Q 1VMPA 1OTRB 3DQVA 1ZEQX 1OQQA 3BU2A 3A1QB 4MSMB 4FXDA 1VQ4A 3CKIB 3UDGA 3DCGA 3EC8A 1ZP0B 2HD5B 2LVQA 2G5DA 2F0LA 2LHDA 4GNXA 4WJQA 1AP0A 1PMRA 1Y56A 2WX1A 4JBJA 3WIMA 1EWHA 5TR5A 2K39A 4K6LA 1KAAA 1VRAB 4OVUA 1YEZA 4GOPB 4B3RQ 1ROEA 2EYOA 3S1MB 3APCA 5EE3A 3QWNA 5EE0A 2JA6H 3RD2A 2XWJB 2ZVNA 3QJZA 4UP8A 4HSVA 3S24A 2BTEA 5ELBA 1RKNA 4FBJB 4OELB 4BBSB 5DPRA 5GXGB 1A0IA 4AYBB 2GBRA 1F2YA 3ER0A 4G11A 3NHHA 3QR8A 5EKKA 4HSPA 4DUYQ 4DV3L 4JK1C 4PZ8A 4LNKA 4MGKE 2WXIA 4IKGA 5I2YA 1EFWA 3S1MH 1PDQA 5IGDA 3RN9C 1H9RA 4GLXA 1K53A 3T1YL 2KACA 3AEGB 3AN1A 3ZUNA 4NDXA 3U7ZA 4BBSH 1K3RA 2QDFA 3IT4B 4YIJA 1EZ6A 2WP8J 4JPSA 4EQ5A 3JW0X 4BWGB 3Q3OC 1WSPA 3CSTA 4KDIC 1QWYA 2BPSA 4I65A 1T0QC 1E2WA 1VQ8A 2G4DB 1BBWA 1STYA 4ABNA 3VYUA 1ENFA 5D14A 4AWJA 2EQSA 1SDFA 2F0TA 2JA7B 5CV8A 4EUTA 1IBXA 1Y1VG 2CJNA 4BS9A 4ZKCB 3G6EA 4JBMA 4YHHL 2N1WA 1G6ZA 4JPBW 2JUOA 3R2IA 2C7HA 3FAHA 2H89B 4J8QA 3HKZG 2M0XA 3IL8A 1HZBA 1CMXB 2RR9A 4XT3B 3SR1A 1TKGA 4J1MA 1FFVA 1B9RA 3CWIA 3A1QA 1GUNA 1X3EA 2PQAA 3M4QA 3OW7A 3ZYYX 1PH6A 1QJOA 2JA7H 1D1IA 4GDLA 4NAWA 1FNWA 1WRIA 2L7RA 4C3IB 1S5DD 1BCPF 1STGA 4DV5L 3VFKA 4AQYL 2RSOA 1Q82C 4HPPA 4OWWB 3JAML 1LYLA 1SAPA 1A62A 2J0JA 1IYFA 4PV1C 2K01A 3PO2H 1FM0D 3I57A 5H92C 4QGUA 3C19A 3D8GA 2IO3B 4DV3Q 1U4PA 4YWKA 3PIOA 2PJHA 4O1NA 4C3IH 4JCVE 2NS5A 5E3FA 2K5DA 2PNHA 3EROA 4PMBA 4C1NK 4BKSD 1DOXA 1H9KA 1EL0A 1M94A 3MTSA 3CRLC 3CCQA 1VCBA 2MP2B 4PMCA 1N5XA 4JE3B 2RDFA 1XO3A 3RCZA 4LF4L 5M3MB 4YCUA 1S5ED 3RNEC 1AARA 3TCAA 4XQNA 1YX6B 2KANA 1B9MA 2KO3A 3U4ZA 2NBWB 3ZNZB 3D4WA 4NPSA 1LTRD 5C4XG 2A6HD 4YHHQ 3VXWA 3MXPA 1VQ6A 2AL6A 2GBKA 4P1BC 5M3MH 1ZXTA 2YTXA 3EVQA 2MBQA 1LV9A 1O78A 1TY0A 4OO1G 2N9XA 1CZWA 4R8IA 1X65A 3JC66 2C9OA 1OXUA 2Z4IA 1XYIA 2L52A 2YEPB 3I4LA 2ZM6L 2HQLA 4B08A 5FO7B 3K57A 2WXHA 3PV1A 2M2LA 4HIKA 1KDAA 5E4XA 1Q10A 4DV5Q 1Z2MA 4PS7A 3H3VH 4CQNA 1L2NA 2XK5B 2QC8A 3PREA 1VQDA 2VXWA 2WS3B 2Y5PA 5HG2A 1R9TB 4EEWA 3P42A 2F0OA 1TIID 1JMLA 2NBFA 3LGJA 4XIGS 1DOLA 3RNAC 1DZ1A 3DLLA 4NW2A 4DNIA 2KCMA 4QUCA 3AE4B 3PVLA 3R66C 3K8AA 4ZAIA 2JA6G 3IHPC 3ULPA 3M85A 1SYGA 1B9NA 2L3ZA 3A9KB 2K3UA 3QHTA 2AWOA 2CHBD 2AWNA 4XYQA 5JPMC 5BN3A 3I3TB 3N52A 5E4WC 4GDKB 3FEWX 2BYFA 1R9TH 2E2JB 2EMTA 2MP2A 2WXKA 4LF4Q 2RDHA 2WGSA 1XPOA 1SROA 3M4OB 2F3VA 4UP9A 4RM8A 1F2RI 4M01A 5I6YA 2Z0DB 1TKWB 3S2DB 3MFGA 2KN5A 4BBSG 4AYBG 2B2YA 5HY6A 2KDBA 1GG3A 3CU7A 1V8QA 3CHBD 2ZCBA 5IGCA 2CQAA 1WM3A 1KRSA 2WXMA 2DWQA 1H9SB 3OWEB 3EFUA 4H7BA 5IGGA 1S72A 3V6EB 3W9CB 3P20A 1ONLA 2MO1A 2MEKA 1YI2A 4AYBE 4C2MB 4M1UB 1WXMA 2V9HA 5D7GA 3S2DH 4HRSA 1A2TA 1XLQA 3URYA 5AZHA 4LUVA 2ZM6Q 5LLIA 1E2VA 4DDGD 1NENB 2KFJA 5C6AA 4P6VF 4IWPA 3AEFB 1L7YA 1YJIA 1TXYA 1ZGUB 2X69A 3SHLA 1WTPA 4JG2A 4DKAC 4LAAA 3Q14C 4ANUA 1CHPD 2JA7G 3LB8C 3K5MA 4KGRA 4REZA 3KUPA 4C2MH 2KAJA 4RKBA 4PZ6A 1MHHE 2MBOA 2R92B 1LTAD 2KTRB 3JSVB 2DAJA 5CHWA 4AJWA 3TJPA 1A2UA 1JROA 3PUYA 2IY1B 3NOBA 3VDZA 2RBMA 3J80i 4L2YA 1J8CA 5IN7A 4HJ5A 5LXHA 3A9KA 2D5DA 5C0XI 3QB3A 5JEAG 2JK8A 2FUHB 3EFXD 1WM2A 1L0XB 4GDKA 1UBIA 3U30A 2WB1B 4R4QA 4W9HA 2Q2IA 4FNFA 4C3IG 2R92H 2RCFA 1PRTF 4XWTA 3SHQA 5CC4A 1GVPA 2VRRB 3AEAB 1FRRA 2EYFA 4GNXC 1WRDB 5C4ZA 3B0AA 3X3MA 3D3RA 3H6MA 2CW0C 2O2LD 1Y14B 2KFKB 4ODGA 2K8CA 2GLSA 3VTUA 3ZXVA 1SYBA 5HHDG 4WWNA 1FR3A 1GB4A 3WCQA 1GUOA 4X62L 2KXJA 3KF6B 3IAYA 4DR7L 3PUVA 2EMSA 4A20A 2C5CA 4DK1A 4B6WA 3HOYH 4MH8A 3F2CA 4LDTD 4H2AA 5C4HA 1Q1BA 3UDFA 2V3SA 2F52A 3E9IA 2N4FA 3D6CA 2EDGA 3PUWA 3PMFA 1P7EA 1RRBA 2KC2A 2N49A 5M3MG 1IGCA 2DZKA 3I72A 3VYRA 2F0VA 5GADC 3KF8B 4G4KA 4FF4A 2XBBC 1EQQA 5C3WA 1GHJA 2VQEL 1V9JA 4GGQA 1BUVT 3GOEA 2K5WA 1OTCA 4WQOB 2FINB 2QGQA 4I7AA 4BXXH 2EOTA 4FA6A 2RHSB 1MJCA 1YNJD 4JI1L 2JY6A 1EEFD 4A3JB 4ZRIA 4A6QA 2BDNA 4FXGC 4GIVA 2E2IB 3JSVA 3A33B 3DHHC 5H8YE 2INDC 2LSSA 3V96A 2HE7A 3B9JA 5E6OA 5M5YB 2K9XA 4IPHA 2NVUI 2UU7A 3S9WA 4HDQA 1G291 4A3LG 4AUQC 3D31A 3C0RB 5IKCM 2JE6I 3AFPA 1R4MI 2GA4B 4MEMA 3I73A 4FF1A 4A3JH 1CJEA 4EZKA 5KYIA 2J42A 1U5KA 4BKSA 4R4OA 3NSWA 1AEXA 4DN4M 5M5YH 2WXPA 2ZW1A 1HA5A 4JOIA 1C4PA 4X62Q 1VD2A 1E1OA 1KAWA 4DR7Q 5GQOA 1WYGA 1YQ3B 1O7IA 2RMMA 1HFGA 4XDCA 3QOJA 1SE3A 3VAWA 3M7GA 1KRTA 2ZPNA 3RULA 1A3TA 4KJNA 3QARA 2LVPA 4JLCA 2A68C 2X6GA 1D6EC 1LT5D 4IM2A 4R4TA 2NN6I 2RVLA 1L6VA 1H9MA 1EO6A 4WFN3 2VQEQ 3KF8A 3U50C 1KHIA 3L0OA 4J6HA 3DBRB 1JE4A 3LYYA 3W5OA 1WD0A 2I5MX 4JI1Q 3T1HL 1C9OA 4HEA1 4N9F4 5JVG3 1R4MB 1HE8A 3ABVB 1VQKA 2KCCA 5D94A 2F3IA 1VQFA 2HIXA 2QEJC 4TSSA 2BOSA 5EQ0A 1QCBD 3BWUD 4WQMA 3W1YA 1WGHA 3CP0A 4RFBA 4V190 3QIJA 4QAYA 1VQPA 4OGQC 1CA5A 4KZCA 3K9PB 4HJAA 2B3AA 3VYTA 1P9DU 2DAFA 1BR9A 1KNEA 1PFNA 3CCSA 2WXRA 3L54A 1NSNS 1Y1WB 1MFWA 2QA4A 1JB3A 1HZ9A 4JI6L 4X6AH 2C60A 2AL3A 3I4NB 1WTQA 2ZVOA 4YSYB 1NJIC 1L5PA 2R92G 4Q5VA 5KHQA 1I4GA 5E6NA 1XMOL 1HNWL 1ICWA 1PH4A 5JEAJ 1SE9A 3ECIA 1Q0WB 1XMQL 3J81L 1GUTA 3PGZA 2A74C 3I4MB 1Q3LA 1V9PA 4I7ZC 1Y1WH 1HA6A 1LTSD 2WB1G 1F2ZA 3A9JB 5JOBA 1HHVA 3HOYG 2LRWA 2LJIA 2OQ0A 2CH4A 5BYSA 2RCNA 4BA1I 1PV4A 1MI0A 3AV8A 3MA2B 1V8CA 3N32A 5LNK1 3S14B 4FF3A 1B70B 2NN6H 3U7DA 3W5UB 1IKLA 3I4MH 2MP1A 3T1HQ 1EM7A 2CCZA 1LT6D 1F9RA 3J81j 1JQYD 3RLOA 1JOQA 5EE9A 4H02A 3A54A 3SDLC 4BXXG 2B2YC 2B2TA 2NTTA 3HOUB 2JEAI 4A3PA 1DOYA 3ZDTA 5FLMH 4B0EA 3ZVVA 2DJFC 1F77A 4R8NA 2D9UA 3H3VC 1SB3C 1SN8A 1I35A 2XSCA 3RI7C 1IBKL 3GTKB 3OHXC 1RDPD 4WJWA 1NI3A 4IOAA 3KLSX 4K2LA 2JXXA 3BINA 4ZRJA 4ZDVA 2WU2B 4HLEA 1I4XA 2AX5A 3T56B 4RG1A 1PH9A 2KK8A 3M95A 1FFUA 4MT5A 2PVOD 2JQOA 2QF7A 1ML0D 4A3JG 3I8ZA 2EYHA 3MZ5A 3CC7A 3DWQA 5D3DA 2ACZB 3AE5B 2OTLA 1XMOQ 3CCUA 1HNWQ 1XLNA 4GSWA 1GPXA 4IDIA 4KIKA 3PCOB 3C3LA 4IWOA 1XMQQ 1B7YB 3DBHI 3KWLA 4K8IA 1AW7A 4GKJL 2EJGC 3UI3A 1J5EL 4P75A 2L0TA 5IAAC 4QUFA 5HFYA 4LNFA 2PCFB 4EOYA 1PRTB 1SGHA 2BH2A 1G6PA 4BZAA 1WD1A 1SBBB 3RNBC 4RH6A 2E2DC 1O80A 4NQKE 2LJ5A 3GB1A 4GN3B 1J7AA 2KJHB 5DNFA 4BAXA 3OMCA 1VQ9A 1LT4D 3P63A 2BW2A 3HKSA 3T4AC 3CMEA 2CWAA 4A3KB 1P3QU 3KLRA 4A3IB 4HCSA 3GTLH 1CHQD 1WZ3A 4F1SA 4PZ7A 4ZCKA 4BFRA 5FR3A 1WCMB 1AE3A 2SNSA 5J3BA 4AH6A 1XTCD 3WOEA 1UNSA 4FDBA 4H44C 2EZVA 3P4SB 1IZ6A 4IUUA 2M9VA 2V4DA 3IT6B 5C3XA 2OCEA 3J7A5 4M0WA 4A3KH 4K3BA 3X23A 4A3IH 2WINB 1FGUA 1IBKQ 4L5SA 1LM8B 2KA7A 5M5XB 5HI1A 1IW7D 3A5UA 4L6TB 3AEVA 1XF5L 1WCMH 2EXDA 1NTGA 5CV9A 1J8IA 1A3UA 2KQ4X 2LASA 2A8VA 3TEXA 1PZKD 3NK9A 3U9OA 4CKEA 3NWTA 5GMVA 4WWOA 3MVVA 2B3GA 2BA1A 5ELCA 2WXOA 4K5WA 4MHEA 5CV6A 2GBMA 3N9YC 4ALPA 1SMYD 1I3QB 3TBIB 5I9OA 3AYHB 1GHKA 2L05A 1MGSA 4IQZA 2VZKB 2K50A 2XIWA 3AQQA 5M5XH 4QMGA 1NEKB 1XXGA 4F8CB 2LKVA 1ESFA 1XTDA 3QJYA 4X3TA 1N8RC 2L4NA 5GAHC 4GKJQ 2O6VD 3E9SA 2JYTA 3VR3A 3PZDA 5IOIA 3ZJTA 2MBEA 1E24A 4C3JH 2R6GA 4DV4L 1J5EQ 1DGJA 2IX1A 1QOBA 1M90C 2B76B 2M1MA 2L83A 3GTJB 2C9WB 1OQYA 5CBEE 5C3JB 4C3HB 2YV5A 3VUXA 4KK7A 1I3QH 1Y1WG 1S3SG 1GUWA 2ZNVB 4DAPA 1IGDA 4HJGE 1WE6A 3I4NG 4W9EA 2VH1A 2Z59B 1HQMC 4WAAA 3J7AF 2N0SB 1WGRA 3QCAA 4WJOA 4UY8C 5IO9A 3SU8X 3CD6A 2O5IC 3VR8B 2NN6G 2UUCL 2QKIC 1LFDA 4JOIC 1T0YA 2WQYB 3GTJH 1L2FA 1NYRA 3I4MG 4QIWE 4R4CA 2VB2X 4IURA 4ICUA 4II2B 4B3TL 1HTOA 1UD7A 2GMIC 5IP4D 3DEOA 2K32A 1PZJD 1UAPA 2K7VA 3SK6A 2IZVB 3NZSA 2D0PA 1YVCA 2NYZD 1P7FA 3AE2B 2O5JC 1T5XD 5FLMG 3RR5A 5IYDH 2DNEA 5JJKA 2VUMH 2DYBA 5EE1A 4X66L 1V1PB 2DZJA 3ZNID 2CKZB 3N6RA 1TWHB 1WJNA 2PNRC 2BCOA 1WXQA 2PYKA 3MHSD 1JWMD 2KX3A 2I2YA 1JQ4A 5FLXL 1R4NI 2KOLA 1QOGA 4HXDA 4RGTA 4ITKA 1SF0A 4WIPA 1FD6A 2AQ2B 2I5HA 4YTPB 3DPDA 1DONA 1STHA 5FK9C 2LGSA 3DWMA 1KQSA 3E9HA 5IE8A 4DV4Q 1UH6A 2WXFA 2RKSA 1TWAB 1FPYA 3WALA 4DAVA 1JT8A 1VZ6A 3RUZA 2A69C 2NB0A 4PQXA 4E6IA 1RFKA 3OIPA 3MHBA 1UE7A 3D4DA 3OWFA 3C46A 3KDFB 1WF9A 1ZPSA 1LTTD 2MLBA 1G51A 3CXCA 1T3QA 1J0GA 1EQVA 2K1FA 3CMMB 1SIJA 2IO0B 2PO4A 1EY5A 2EY5A 3TP5A 5IOCA 1ZKOA 2UUCQ 1TWAH 4JI8L 1ZE3D 4IUTA 4LJZC 4CYEA 5E6JA 4FJZA 2MPMA 1X32A 2NVQH 1XQQA 2F0NA 1OXVA 2XVSA 1XPUA 2JA8B 2IGGA 3NENA 2E8GA 1I4RA 1W6KA 1KOTA 1B3QA 1GKHA 1QZGA 1K3BC 1PFSA 5AFWA 2R93B 2J53A 4WJ3M 1NR4A 4IFDI 2EPBA 3APDA 3JAMc 1LACA 1D5XC 4RMFA 4HJ7A 5BN5A 1K73C 4A3KG 1N36L 4X66Q 4A3IG 4AJYB 4KY7A 2DZIA 2WDRB 1V1PA 1SSNA 3IXSA 2SOBA 1JICA 3E6ZX 1WCMG 2UYZB 4PYZA 3NVYA 4WH4A 2R93H 1PQSA 3WAOA 5KRUA 4A75A 5AZGA 4L5RC 2BB5A 2F0KA 4F7ZA 3QC8B 1YITA 1BUIC 2WV6D 3J7YW 2WU5B 1RD9D 5I9PA 5KYLA 3CIRB 4PT5A 4B3SL 3HOXB 3BY4B 4MGIE 2B2TC 1IBXB 3PGEA 5AZFA 2OHFA 2O6VB 3Q8DA 1C79A 4A3MB 4DNTB 3IVFA 4KN4C 2Q8IB 1RYJA 4PK1A 1X3FA 1HZAA 2B2WA 3G6JB 3TMEA 5IGFA 4GU2A 3KDFA 5ELDA 1UE6A 4W9IA 4MH0E 4K5XA 4CHTB 4N58A 1XCQL 2Z6KA 1PTOD 3D0FA 2PQAB 3NBHB 5ELNA 3W3AA 4NAWB 3ND9A 4GDLB 1T9HA 3HOXH 4JI8Q 3A8JE 2B63B 3H1UA 3T3OA 3N30A 1JR0D 2QCZA 4GN5A 2FHTA 1EF5A 1Z47A 3JAME 4A3MH 4A3EB 4YWMA 2FBWB 2KN4A 1WYDA 3AE3B 1KTKA 1GJXA 2I07B 4LFCL 4HCNB 4BKTA 1PH3A 1HR0L 1I5FA 2MA9B 3K81C 4C3HG 4JI0L 1CQFA 2Q8TA 1VQLA 2ZJPA 2EY1A 2B63H 2BGFA 3VDYA 3I7FA 5D65A 1D1KA 1WTVA 2TMPA 5L95C 3CF5A 4IFDH 4MDKE 3IRBA 1N36Q 1GNUA 4B3ML 2Q2HA 2RA4A 1YJ1A 4KHPL 4A3EH 1SJED 4ZYSA 4FADA 3EN2A 1STEA 1MHXA 2NBUA 4ILWA 2BWFA 1ZDXA 3MC8A 2NZ1D 1YNND 5IYDG 2J0TD 1JJ2A 1NBFC 1WI0A 3HRDD 3NS1A 4BVUC 2JP1A 1M8AA 1CZGA 2K6QA 1SYDA 4WRDA 2W54A 3GO5A 3GV3A 4HAEA 3VR2A 4DAYB 4GOCA 1BNZA 4B3SQ 1ICFB 3ZJUA 3W1BA 1HPCA 4A3GH 2ZTEA 2N7JA 3VUWA 1S5CD 4FXKC 3K59A 1P98A 2V3NA 2O6VA 1Y8PB 1QZHA 5JAVA 4XX5A 4RGMA 1MBYA 3GTMB 1WGDA 2RSUA 2MO0A 1I94L 5M5WB 3PO2B 3GZNI 1WR6E 3ULLA 1EIYB 3JYUA 2RSNA 2AKWB 3ITPA 3NBHA 3P75A 1EIHA 2G9DA 5L83A 2UXBL 3H3VI 2HDEA 2WDQB 3HKZE 3ML9A 1KM7A 4ASWC 3N20C 2A4ZA 2KOXA 4K7WA 4JI4L 4LFCQ 3PF4A 1L4ZB 1SNMA 3GTMH 1F9SA 1HR0Q 1Q46A 5M5WH 3P7JA 2WXQA 4JI0Q 3J80L 3FMCA 4ZRQA 2HCCA 4P2CB 1B2TA 2M0AA 2K5NA 2M19A 1QB5D 3P1MA 4B3MQ 4HCPB 2E3TA 4RNAA 4KHPQ 4XDDA 1E6EB 1PRTC 2WNMA 3DVGY 2XN9C 3F8TA 2M17A 3T1YQ 3GTQH 3I63C 3NJTA 2KHIA 2PEAA 2L00B 1ZOYB 1VDZA 4ZHOA 5H1SE 1HFNA 5DAUA 5A35A 1RF2D 1UZXB 1OXTA 3DDCB 3TP7A 1OQRA 1PFDA 3PSIA 5HURA 2JA5B 2ALYB 2NVYB 2JA8G 1SSOA 3W1GA 1FEHA 3HP3A 1T6BX 2R93G 2V4LA 4DAYA 1D5MC 2KLGA 2SAKA 1Y69U 3GZNB 2ICEC 2W82A 5AUKA 1II3A 2QEXA 4EQNA 3BIID 1KDCA 2BDOA 5IYBH 2N7DA 1FXTB 1WY8A 4W9KA 3H0GB 3OPOA 4LF8L 4BBNC 2Z9HA 1I94Q 3LX0A 3S1QB 1RHPA 2JA5H 1A63A 2NVYH 3OTOL 4K81A 4P7IA 4RMAA 1NE3A 2FIDA 3KW5B 1GOZA 1UUPA 4IPCA 2KLCA 1PH7A 2VL6A 2UXBQ 2JPHA 2V4IB 3VVWB 2C35B 1KLGD 2BE5C 2K1BA 3ERSX 4NMZA 4OWTB 2EJFC 4CDFC 4M8AA 2EYMA 4UP7A 1C0AA 3MC9A 1STAA 1JRUA 4JI4Q 4N59A 4AQYQ 2H1EA 1O7LA 3H0GH 3HOXG 2CHWA 3BZCA 2ASBA 2HD3A 3S1QH 1WMHB 5LHY1 4HN7A 2K5VA 1SLJA 2XNAC 4X3UA 5IT9L 4XTCS 2L15A 4A3MG 1UWVA 1ASZA 2DN8A 1F1HA 1QT9A 5DM63 4LUZA 5AUIA 2L1BA 3ZRCA 4G57A 3A5ZB 5BN4A 1CKMA 2JZ3B 4XE0A 3KJOA 3GDEA 4OZCA 1PTOH 3O13A 1T0RC 4IOCA 5C44B 3M4PA 3SVMA 4LF5L 2B63G 2K14A 4A3CH 3AFQA 1R7SA 5DPSA 3NE5B 1FXIA 2ZNVC 4LTUA 4C7YA 4IFDG 3KYHC 3MEHA 3DBSA 5KHOA 4DF7A 4OZBA 4A3EG 2YYZA 3T9LA 1VQBA 1W2BA 4US8A 3I55A 1PVOA 1Q90A 3RZOB 2IPKD 1I6HB 1E8XA 3S2AA 5C44H 5IODA 1VF5C 1D5ZC 5CGKA 2D3BA 4US9A 1OO9B 2B29A 4Y7NB 2PI2A 1BCPD 3QIAA 1PZID 4L5QA 1WTRA 4LF8Q 1HCZA 2MNAA 4P73A 3VR5A 1RWSA 2GRIA 1WTXA 1B8AA 3FPUB 1AH9A 2DNFA 3OTOQ 2AEHA 1V2YA 3DM1A 3DWAA 2VS1A 5C5MA 3A7LA 5CMDA 1LTBD 1L0WA 3RZOH 1I6HH 1RTNA 3AU5A 4WAFA 5BR8L 1X6OA 3S17B 3IAM1 4E74A 5HKHA 3I9V1 5LL6X 2R61A 1L0YB 3H09A 4OVZA 1ET9A 3GV6A 5IGEA 3H7PB 2ZT9C 5D2MB 2MJ3A 4Y7NH 4K7UA 3TS0A 1E0BA 3A8IE 1SYCA 3MJWA 3RMKC 5IP9H 1S1QB 1ACCA 1YN5A 4YSZB 2MX2A 1SJHD 1WMHA 4AQ7A 1K83B 1GUGA 2ENBA 3RPFC 3S17H 3CCEA 1PH1A 4C4VB 2XRSD 4CKCA 3Q8EA 2MUYA 1BO0A 3OMGA 1J7CA 3PO2G 4ARIA 3K7UC 3EECA 2A19A 2L0FA 4B0MA 5LMNL 2IO2B 4LF5Q 2ZTCA 1ZUD2 2J0KA 5CYUA 2RDGA 1ZXIA 1DD2A 1EQTA 1WJUA 3Q3JA 1K83H 1TBEA 3HOYB 2AYOB 3NG0A 4XZ4A 1SR3A 3I70A 4WWPA 4S0RA 4WJPA 4DR6L 1I4HA 2MFIA 3PUXA 2JSVX 3TDQA 2F0HA 1CKOA 4LWCA 1E2ZA 4DA2A 4H0LC 4BBRB 2N55A 3PZ8A 1KABA 2CH4W 2DENB 2PW9A 4ME5A 2RPQA 1ZYRD 1F9JA 1C9FA 4CDDC 4OVVA 2PMZB 1JWSD 4AIMA 4EE2A 5EDSA 2QILA 3HHMA 3O65B 2KDFB 2LGIA 3AEEB 3TREA 1RAXA 1MD2D 2EKIA 2ZXOA 4MTNA 5IYBG 1IL2A 4ID6A 2F0FA 5BR8Q 4BBRH 3R7QA 3J81c 4BBNF 4NY0A 5GROA 3EIVA 3VH3B 2KENA 1V49A 1ENAA 2JA5G 1JWUD 1NR2A 1IW7C 5ELOA 2GBJA 2QIEB 2PLPA 3H7PA 5L37A 2L55A 3A7AB 1B53A 5BMIA 5JJLA 4OW0A 3H7SA 3SEBA 1G6JA 4C1NI 3AMUA 2KMAA 1BVSA 3HOVB 3PSEB 5CR3A 3H0GG 4GLAC 2KNBA 3R2TA 3P2BA 4RM9A 4JBKA 4C4VA 2N9KA 2N78A 3W1SA 1FVIA 3DBRI 3ZTDA 1TJEA 5FO8B 5LMNQ 3HOZB 3NZUA 2HIVA 2CU1A 2KJRA 1TR5A 1SNOA 2Y5CA 4DPGA 3HK0A 3UQBA 4GS3A 2R7FA 3Q3FA 3EGRA 3MXNA 1E5WA 1UWXA 1SEBD 4OIJA 3HOVH 5J22A 3NZ3A 2CR5A 4LW1A 2FAZA 4DR6Q 2KWDA 3K5OA 3OAWA 1S5FD 2PVGC 4B9WA 1GXDC 3HOZH 2XEWA 4WJ4A 2ZZPB 4U68A 2V0GA 2JYEA 4RA8A 1VMCA 3L13A 1XNRL 1YX5B 3HEJA 3J81E 1HJPA 1SE4A 3Q69A 4JYAL 1VQMA 4IZ8A 5KEEA 5C44G 1L0VB 4UPAA 4IFDJ 2CHXA 4MN3A 3CCRA 4NZLB 3G4SA 1CSPA 1FGBD 2KD0A 4K2KA 4HPMB 1K28A 2OT2A 2F0MA 5CBAE 3G71A 2BYVE 4WWMA 5EGTA 2Z8LA 5T8IA 1F9QA 4LF9L 1V81A 5C1ZA 4X57B 2IHFA 1H8CA 5IWAL 4ULLA 1TGZB 1DJRD 2GI9A 1YD8U 3ENEA 3ZLZA 3PZ7A 3L3OC 4MJSA 2MW5A 4YL8A 1LM0A 1VQOA 2KKCA 1BQQT 2V3PA 3OIQA 4HMJA 3KYCD 4FJYA 2UU9L 1DM0B 1MG4A 2DY7A 1JWBD 2F0EA 4A4IA 2LGDA 3QG1A 3B6YA 5IP9G 4S17A 3A0JA 3RNGC 4MNOA 4FVMA 1JJGA 1N5WA 2KVRA 3IFWB 4IALA 4EQOA 1QF6A 3SK5A 3KBXA 4USAA 3IBEA 2IX3A 2M4NA 1YN3A 1GC6A 1QLBB 1SE8A 5A2QE 3DVGX 4HPLB 4KN7C 1HR0W 2MH7A 5EPJA 1L1OB 2RD0A 3NY5A 4RGNA 1VLBA 1QVFA 1SYEA 4KX6B 1FRDA 4HJKA 4OZAA 3BVMA 2D3CA 2HTME 4DHZB 3NTIA 4XXEA 3UE0A 2UXCL 3PRPB 4LLGM 2IGDA 3VTVA 2KECA 3STBC 1Q7YC 3ICEA 4KIKB 3CPFA 1AWDA 1XNRQ 4LMQD 3Q3MC 4W9FA
chains in the Genus database with same CATH topology
3R93A 3ERQA 3GQBA 2W55A 3M4YA 1ZDVA 3RFZB 3TP6A 2FMMA 1K52A 1FD7D 2H4OA 2PZTA 1CZPA 4FO2A 1EY9A 1G91A 2JYOA 1D4BA 2WXNA 2NUCA 3SK8A 1KH0A 3RLFA 2WKDA 2LUMA 5EJWA 3H91A 1U9RA 1FYCA 5KNBA 1M4VA 2HDMA 3FDTA 1CM9A 3HG9A 4ZKBB 5BMHA 5A2QL 4L8JA 4G7HC 2A6EC 5CV5A 3AB9A 3IFDA 1DOKA 5I2XA 5EBDA 1QQRA 5BYQA 1PTOC 2Y0SB 2ONQA 1PDXA 2LEKA 1EYDA 1G8ZD 2JWUA 1QILA 1Z7TA 1O7ZA 4IUQA 4KD3A 3GTLB 2IL8A 4CGYB 1DCZA 1Y8NB 1QG7A 2CU3A 1HTPA 5CV7A 4K8JA 4AS1A 1EY8A 4F7XA 3GTOB 3QOLA 1CFMA 3NPPA 4KKUA 1DXMA 4GZYC 1FCLA 2F0GA 3BVZA 1K8OA 3TEYA 4KGSA 4IOIE 3OOCA 2JQRB 3V2TA 4RGOS 1MI2A 4WORA 3A56A 3MP9A 3DWPA 1BOSA 4ZK9B 2WIIB 4QCLA 3Q8CA 2L32A 2N9LA 3AE7B 4RWSC 4C3JB 1UWMA 5FLXE 5LL6S 2PZWA 1IYVA 4A55A 5J39A 2B8FA 2LMCA 2JEBI 1ET6A 2KHSA 2O4XA 4DGZA 4UAIA 2K28A 1RODA 2KMMA 4NKLA 3D4RA 1C8CA 3PV0A 2E76C 3LWEA 3AM9A 1LABA 1ENCA 2WLBA 1LLRD 3S1NB 1YJJA 2F0PA 2XWBB 1TS4A 2SNMA 4RAUC 1ZXHA 4KHZA 2VUMB 4X3KA 1PXUA 3Q24A 3AU7A 3AEDB 1K51A 4PMWA 1J7BA 4YTNB 3SDZA 4B9XA 3PO3B 4K5VA 5M3FB 1LO5D 2A6HC 4U673 4KV6A 2DYMA 2EE1A 4HR7B 1JRPA 4KHVA 2KQ3A 2A73B 1FIQA 1EU3A 3KBGA 2AUJD 2A68D 4CJ2C 2L9HA 4N6EB 2VB3X 1HUNA 1PTOF 1B4OA 3NP8A 1VDVA 2E6XA 3K7AB 1LTGD 3AMZA 5TSSA 2NVQB 2B39A 5DEHA 2JSOA 3OSOA 1WWTA 3Q22A 1SFOB 1RCVD 4K6DA 2KVMA 1I4PA 4XYOA 2RQXA 4ZHPA 1QOAA 2PW5A 3NBIA 1HXYD 4V0BA 1BBXC 1I50B 2IGHA 1QOFA 4XQJA 1VCIA 4YT0B 2JZPA 4KGTA 1XLOA 1QOHA 2MGSA 1KNAA 2HDLA 3IKJA 5COYA 2M00A 1AN8A 2F0WA 3T3NA 1FCCC 5IGBA 5F2DA 1NUCA 2AUKA 1FNUA 3E0JA 3IFTA 3EUB2 4G7ZC 3AE8B 1CT1D 5C3EB 1C77A 1J9OA 4KY6A 2K03A 1AFPA 4KMUC 3NWSA 4C3JG 2MJEA 1TKYA 3BK2A 1QNUA 4A3DB 1TWFB 4N9TA 2I38A 3DXJC 2QJLA 2R3ZA 1U4LA 1AZQA 2DYOA 1G2SA 2SDFA 4S3SA 1BMLC 3J80E 3S15B 1CA6A 1R4PB 1KLUD 2JX5A 2B2VA 3S2HB 3PUZA 4NAMA 1FO4A 1EY4A 4ZUJA 2X38A 2J4XA 2K5PA 4A3GB 1EFID 3TZUA 3J9CA 3BZDB 5JPNC 2FFKB 4TQUS 2IX0A 3WDNA 3AH7A 1DOIA 3BG3A 3SXHA 1S4ZA 2F0DA 1N63A 5G5HA 4J3OD 3MAQA 2IT1A 2EVBA 4ZOHC 4DQOC 1KRHA 1YNJC 2LS01 1XLPA 3AE9B 3LNNA 2JXTA 1IYUA 4RF1A 3K6OA 1O7YA 1TU2B 2K0PA 1BXTA 5CORA 1JC7A 3A8KE 1STNA 2PQEA 5CV4A 1SNQA 1TS5A 2RPVA 2G9HD 1T5EA 3GTQB 4RHSA 5IT9E 1YNTE 1MVKA 2Y3AA 5EKIA 3AB5A 3W2DA 3L7ZC 1KFYB 1BF4A 3Q0AA 1E7PB 2W3RA 3HRZC 3DWGC 2BS3B 3GP7A 4YTMB 2VNUD 2PZUA 3NUHB 3KQ4A 3VRBB 3RMHA 1KDBA 4IUNA 1PGBA 5C5LA 5G3LD 2W3SA 3KLSA 4HKQA 3HGBA 3VA5A 3E5SA 3FILB 3NTHA 3V3XA 2TSSA 5JEAH 1UGJA 1AYFA 4DNRB 2B2UA 1A3VA 5JXVA 1I4QA 2K05A 4ARCA 1W6JA 4HMIA 2BA0A 4TQ0A 4D2KA 2BB6A 1Q12A 5E1FA 1JCKB 2IWHA 2F0IA 3FVQA 1I6VC 2KJXA 4XWWA 1FNVA 3C8YA 3GTPB 3ZJVA 2KCNA 2MJ8A 4X3SA 3BYTB 1PTOB 2D62A 4OIKA 1TKEA 2E2HB 3MWYW 2BBCA 4RCNA 1C4QA 1EWCA 1NAPA 3NVWA 3GD7A 3HS0C 3Q6SA 3A55A 2PPBC 1PUTA 5M9OA 3MC0B 4XT1B 4JWUC 3Q8AA 2INNE 2EYPA 1TY2A 2R7ZB 3U9SA 2JXMB 2CVRA 2QSDA 2J7ZA 1U4RA 5EPLA 1HZ6A 3I90A 5FOBB 1QNKA 1RJTA 4C80A 2CJOA 4MACA 4EQPA 5K36H 3FILA 2A69D 3TEWA 1L4DB 3SR6A 3X3NA 3FKIB 4R3DA 4ZRZA 4QB4A 3C1EA 3Q8BA 4Z9CB 3IAS1 2E75C 2OEOA 4IN3A 1K8MA 1GAQB 4DU9A 1L6UA 3ETRA 1V1OA 4MIUA 1XCTL 2FJ2A 1C4AA 2WAQB 3EQLC 2XRQD 2K22A 1N62A 2FUG1 4Q2JA 2L1AA 3E56A 2PTLA 1FMAD 2FE8A 1A15A 1EZ8A 2ZXRA 2QCPX 1TYGB 5ELEA 5KIXA 4CJ1B 1IKMA 3SE0A 1E9MA 1Q8IA 4ZQ3A 4EGVA 1D2BA 3CQZB 1EYAA 4JBWA 4KY5A 2DY8A 1FXAA 2WP9B 4LK0M 2B2WC 5EBCA 4XQQA 3VR6A 4IUPA 1RTOA 3K5LA 4DXFA 2H88B 3VQIA 4A90A 2LHEA 2LFIA 3R8BA 1TVXA 1KF6B 5JVH3 3K5NA 4YXDB 1HRJA 5I6WA 2LFNA 3NQTA 4BA2I 3BYYB 4UDUC 4DFAA 4TRDA 4KKSA 1OXSC 1N60A 2B2VC 4A9AA 5JJZA 3NUCA 2OF1A 3PIP3 3NVVA 2PW7A 2F03A 3KWVA 3DHQA 2EXZA 2ZW0A 4TMAB 4KKTA 3RZDB 4KD4A 2Z1CA 1C76A 3C2PA 3I91A 1NCVA 1TS2A 3Q23A 1H9SA 1SMYC 1UEAB 4KJOA 2WXJA 3TP8A 1PYWD 2J52A 1RM6C 1ILPA 2NVXB 4L63B 4NP5A 2IW3A 1Z6HA 1WVLA 1JOOA 4L23A 2ON8A 4KKIA 2NVTB 4FP5D 4KI0A 1OXXK 1YMHE 1B3AA 5ELFA 4HROA 1CK1A 1X3PA 1F9PA 5NUCA 5K36G 2F3WA 1EYCA 4ZLTF 1B50A 2IDYA 1EWYC 2WDVB 5DM73 5C0XH 1ILQA 3QO2A 1BCPB 4Q0FA 3HUIA 3AE1B 3VA7A 2BS4B 5FKAC 1C4CA 2MHVA 2HCIA 4DK0A 2G1EA 2NWGA 4A3FB 2EYLA 4IUVA 1HZ5A 1IUEA 2HQEA 4RF0A 1WTWA 4L1BA 4JX1C 3SFDB 2OEDA 3U52E 3Q8FA 2L12A 3PO0A 4O42A 3LWUA 4KTAA 3NTKA 2IJ0A 3R3OA 1PRTD 3WOFA 2B2UC 1A6XA 1JALA 2K5QA 4CBVA 3HZXA 3H8HA 2QDBA 3HVDA 3W5VB 4FXCA 1EOTA 4QF4A 5T1GA 2KEDA 2GB1A 1WTOA 2D5GA 4A3BB 3MXGA 2D2CC 1EU4A 1EY7A 4HEDA 2E74C 4RCOA 2K04A 3BDLA 1V97A 2PKOA 2NMQA 3VR9B 4GLSC 3CRKC 1PFBA 1SNPA 4G7OC 3M3YB 4CKBA 4OL7A 3FPPA 1VJKA 1Q1EA 2BE5D 2X6LA 2QMTA 2F0UA 3ONAB 1EY0A 1DOMA 3V05A 2VZKD 2DNCA 4QIWB 1XX8A 3EA6A 1EEID 2NTSA 4BY1B 2WACA 3NXWA 1OFFA 4DXGA 1F0ZA 3TN2A 1HUMA 3H94A 5D3IB 1R4QB 3BS1A 3U2SC 2HUGA 1VZ7A 4TKOB 3I3CA 1C78A 2KDMA 4HTHA 1DYQA 1K50A 3G7LA 2EELA 3L4PA 1TQOA 1TZOA 1TWCB 2EY6A 2N88A 1CI3M 2WKCA 2LMCB 4RHRA 3S16B 5ISRA 5BYRA 4A93B 1IL8A 4CJ0B 1PFMA 1H9JA 2K33A 4XDXA 3AEBB 5C0XG 1PGAA 3NVZA 3DUZA 3UI2A 1NVID 3GS2A 1X3QA 4F8MA 1WGKA 3RD4A 3B2GA 1GUSA 5EKLA 2WXGA 2A5HA 1YNNC 2L5TA 4PNYA 3HOWB 2INPE 2WXLA 2BYTA 2F0JA 4YSXB 1AZPA 2K6AA 1C48A 2CW0D 5KNCA 2Q5WD 4LK1C 3VR4A 1I7HA 5G5GA 1LTID 1IHZA 3MJ5A 1MPEA 2FMCA 4N9PA 2Z4HA 1SXTA 1SE2A 2EYJA 3T16A 2PMVA 1JW9D 3C1FA 1YN4A 3FC4A 5K5PA 3U4EG 3P4PB 3SFEB 1BDOA 5HGTA 2M56B 1VF7A 3MFYA 5C4JB 1B44D 3MHZA 4YWGG 2B8GA 2F4IA 3SK4A 4BY7B 2F0SA 3P1HA 5EPKA 4ZUIA 4OHJA 3TZDA 3TEZA 4K14A 2BT6A 3D6WA 1JORA 1QKZA 2ZXPA 3TUOA 1F2LA 5KNDA 3NRZA 1VZ8A 3J7AV 3PIO3 1HTLD 1F2RC 2DLBA 1EIGA 4H13C 2SEBD 1SYFA 2L11A 1E10A 4FYDA 3K58A 5KGUA 3DEPA 3AECB 4FF2A 5IIFA 2BS2B 1G2TA 1TS3A 1STBA 2F1MA 3P4QB 1MSGA 1GB1A 2F0QA 3KK7A 1CTMA 2I46A 1V43A 1Y8OB 1Y1VB 4F88A 3BVGA 2YU9B 1F2MA 3HKZB 2AQ1B 1A70A 2ID0A 2L0CA 3B2FA 1S5BD 1EY6A 1SNDA 3T53B 2LY7A 2YEPF 3S1RB 4P16A 1HQRD 2Q8RE 5J1ZA 3ND8A 4EVOA 4OO1I 2ICIA 2KEEA 3DMUA 4MM3B 4KKJA 4F87A 5I4DA 3AE6B 3T51B 5C0XJ 3FRPB 1QE6A 1XEEA 3EJIA 3L9AX 1PGXA 4A8XC 1BCPC 3K0YA 1CQVA 1SNCA 4RKLA 5T1IA 1XWEA 1PLFA 1ESRA 1B1ZA 5BMGA 1E0ZA 4R9WA 2KUMA 3ZGZA 3VYSA 2MJDA 4C7ZA 1VR9A 2OXPA 3VRAB 3TSSA 1YQ4B 4ZRPA 4HKZE 5C4XB 4TQ1A 4C56C 1TT2A 3HVZA 1MSHA 2DBYA 1HEZE 3MXUA 3P4RB 4JWSC 2EY2A 4WURA 2AQ3B 3NQIA 1TWGB 3BDCA 1JWAD 1JOKA 4HCEA 3GTGB 1LT3D 1U4MA 2JU6X 2PIAA 5FO9B 4OO1H 3T13A 3BDOA 3BK1A 4NJCA 3F2UA 3LXFA 2A6ED 5G3LF 5C2TB 2JA6B 2EJMA 1N61A 1ZYRC 1VMPA 1ZEQX 1OQQA 4FXDA 3CKIB 1ZP0B 2F0LA 2LHDA 3ZQ4A 1AP0A 1PMRA 1Y56A 1EWHA 4K6LA 1KAAA 1VRAB 1ROEA 2EYOA 3S1MB 5EE0A 5EE3A 3QWNA 2XWJB 4HSVA 2BTEA 5ELBA 1RKNA 4BBSB 5GXGB 4AYBB 1F2YA 3NHHA 5EKKA 4HSPA 4JK1C 2WXIA 4IKGA 5I2YA 1PDQA 5IGDA 1H9RA 1K53A 2KACA 3AEGB 3AN1A 4NDXA 3U7ZA 3IT4B 4YIJA 1EZ6A 2WP8J 4JPSA 4BWGB 1WSPA 1QWYA 4I65A 1E2WA 1STYA 4ABNA 3VYUA 1ENFA 5D14A 2F0TA 1SDFA 2JA7B 1IBXA 5CV8A 2CJNA 4BS9A 4ZKCB 1G6ZA 3R2IA 3FAHA 2H89B 4J8QA 3IL8A 4XT3B 3SR1A 1TKGA 4J1MA 1FFVA 1B9RA 3CWIA 1GUNA 3OW7A 3ZYYX 1QJOA 1D1IA 1FNWA 1WRIA 4C3IB 1S5DD 1BCPF 1STGA 2RSOA 3JAML 1SAPA 4PV1C 2K01A 3I57A 1FM0D 5H92C 3D8GA 1U4PA 4O1NA 5E3FA 2K5DA 4C1NK 3EROA 4PMBA 1DOXA 1H9KA 1EL0A 3MTSA 3CRLC 4PMCA 1N5XA 4JE3B 2RDFA 1XO3A 5M3MB 1S5ED 4XQNA 1B9MA 3D4WA 1LTRD 2A6HD 3MXPA 1ZXTA 3EVQA 1LV9A 1O78A 1TY0A 4OO1G 1CZWA 4R8IA 2C9OA 1OXUA 2Z4IA 1XYIA 2L52A 2YEPB 3I4LA 4B08A 5FO7B 3K57A 2WXHA 2M2LA 1KDAA 5E4XA 1Q10A 4CQNA 2VXWA 2WS3B 2Y5PA 5HG2A 1R9TB 3P42A 2F0OA 1TIID 1JMLA 2NBFA 4XIGS 1DOLA 1DZ1A 4NW2A 3AE4B 4QUCA 4ZAIA 3M85A 1SYGA 1B9NA 2K3UA 2AWOA 2CHBD 2AWNA 4XYQA 5JPMC 5BN3A 4GDKB 3N52A 5E4WC 3FEWX 2E2JB 2WXKA 2RDHA 3M4OB 2F3VA 1F2RI 5I6YA 1TKWB 3S2DB 3MFGA 2B2YA 3CU7A 1V8QA 3CHBD 5IGCA 2CQAA 2WXMA 2DWQA 1H9SB 3OWEB 4H7BA 5IGGA 3W9CB 3P20A 1ONLA 2MEKA 4C2MB 4M1UB 5D7GA 4HRSA 1A2TA 1XLQA 3URYA 1E2VA 1NENB 5C6AA 4P6VF 3AEFB 1YJIA 2X69A 3SHLA 1WTPA 4LAAA 1CHPD 3LB8C 3K5MA 4KGRA 4REZA 3KUPA 2KAJA 4RKBA 1MHHE 2R92B 1LTAD 1A2UA 1JROA 3PUYA 2RBMA 4L2YA 2D5DA 5C0XI 3QB3A 5JEAG 3EFXD 1L0XB 2WB1B 4FNFA 4C3IG 1PRTF 4XWTA 5CC4A 3AEAB 1FRRA 2EYFA 5C4ZA 3X3MA 3D3RA 3H6MA 2CW0C 2O2LD 4ODGA 1SYBA 5HHDG 1FR3A 1GB4A 3WCQA 1GUOA 3IAYA 3PUVA 2C5CA 4DK1A 4MH8A 4H2AA 5C4HA 1Q1BA 3D6CA 2EDGA 3PUWA 3PMFA 1P7EA 1IGCA 3I72A 3VYRA 2F0VA 4G4KA 4FF4A 5C3WA 1GHJA 1BUVT 2K5WA 2FINB 2EOTA 1YNJD 1EEFD 4A3JB 2BDNA 4FXGC 2E2IB 5H8YE 3V96A 3B9JA 5M5YB 2K9XA 3S9WA 1G291 3D31A 2JE6I 2GA4B 3I73A 4FF1A 1CJEA 5KYIA 2J42A 3NSWA 1AEXA 4DN4M 2WXPA 2ZW1A 1HA5A 1C4PA 1WYGA 1YQ3B 2RMMA 1HFGA 4XDCA 3QOJA 1SE3A 3M7GA 1A3TA 4KJNA 2A68C 2X6GA 1D6EC 1LT5D 2NN6I 2RVLA 1L6VA 1H9MA 4WFN3 3KF8A 4J6HA 1JE4A 3LYYA 1WD0A 4HEA1 5JVG3 3ABVB 2KCCA 2QEJC 4TSSA 5EQ0A 2BOSA 1QCBD 3BWUD 4WQMA 4RFBA 4V190 4OGQC 1CA5A 3VYTA 1BR9A 1KNEA 1PFNA 2WXRA 1NSNS 1Y1WB 1JB3A 3I4NB 1WTQA 4YSYB 1L5PA 4Q5VA 1I4GA 1ICWA 5JEAJ 3J81L 1GUTA 2A74C 3I4MB 1Q3LA 4I7ZC 1HA6A 1LTSD 1F2ZA 5JOBA 1HHVA 2LJIA 5BYSA 4BA1I 1MI0A 3AV8A 3MA2B 1V8CA 5LNK1 3S14B 4FF3A 2NN6H 3W5UB 1IKLA 2MP1A 1EM7A 1LT6D 1F9RA 1JQYD 5EE9A 1JOQA 3A54A 2B2YC 2B2TA 2NTTA 3HOUB 2JEAI 1DOYA 4B0EA 1F77A 4R8NA 2D9UA 3H3VC 1SB3C 2XSCA 3GTKB 3OHXC 1RDPD 4WJWA 1NI3A 3KLSX 4K2LA 2WU2B 1I4XA 2AX5A 3T56B 1FFUA 4MT5A 2PVOD 2QF7A 1ML0D 2ACZB 3I8ZA 2EYHA 3MZ5A 3AE5B 3DWQA 5D3DA 1XLNA 1GPXA 4IDIA 3C3LA 3KWLA 4K8IA 1AW7A 2EJGC 3UI3A 5HFYA 4QUFA 2PCFB 1PRTB 1WD1A 1SBBB 4RH6A 2E2DC 1O80A 3GB1A 1J7AA 5DNFA 3OMCA 1LT4D 3P63A 2BW2A 3T4AC 4A3KB 3KLRA 4A3IB 4HCSA 1CHQD 5FR3A 1WCMB 2SNSA 1XTCD 3WOEA 1UNSA 4H44C 2EZVA 3P4SB 4IUUA 2M9VA 2V4DA 3IT6B 5C3XA 4M0WA 2WINB 2KA7A 5M5XB 5HI1A 1IW7D 4L6TB 1XF5L 5CV9A 1J8IA 1A3UA 2KQ4X 3TEXA 1PZKD 3NK9A 3U9OA 4CKEA 3NWTA 3MVVA 2BA1A 5ELCA 2WXOA 4K5WA 4MHEA 5CV6A 3N9YC 1SMYD 1I3QB 3TBIB 5I9OA 1GHKA 1MGSA 4IQZA 2VZKB 2XIWA 4QMGA 1NEKB 1XXGA 5MPOA 2LKVA 1ESFA 3QJYA 4X3TA 3E9SA 2L4NA 3ZJTA 2JYTA 3VR3A 1QOBA 2R6GA 1DGJA 2IX1A 2B76B 2L83A 3GTJB 5CBEE 5C3JB 4C3HB 4KK7A 1GUWA 4DAPA 1IGDA 4HJGE 1HQMC 3J7AF 2N0SB 2O5IC 3VR8B 2NN6G 2QKIC 2WQYB 1NYRA 2VB2X 4IURA 3DEOA 2K32A 1PZJD 1UAPA 2K7VA 3SK6A 2NYZD 1P7FA 3AE2B 2O5JC 1T5XD 2DNEA 5EE1A 1V1PB 3N6RA 1TWHB 2PNRC 2BCOA 1WXQA 2PYKA 2I2YA 1JWMD 1JQ4A 5FLXL 2KOLA 1QOGA 4RGTA 4ITKA 1SF0A 4WIPA 1FD6A 2AQ2B 4YTPB 1DONA 1STHA 5FK9C 3DWMA 2WXFA 2RKSA 1TWAB 4DAVA 1VZ6A 3RUZA 2A69C 2NB0A 4PQXA 4E6IA 1RFKA 3OIPA 3MHBA 3OWFA 3D4DA 3C46A 1ZPSA 1LTTD 1T3QA 1EQVA 1SIJA 2PO4A 1EY5A 2EY5A 3TP5A 5IOCA 1ZKOA 1ZE3D 4IUTA 4LJZC 5E6JA 2MPMA 1X32A 2F0NA 1OXVA 2XVSA 2JA8B 2IGGA 1I4RA 1W6KA 2R93B 5AFWA 2J53A 1NR4A 4IFDI 2EPBA 1LACA 1D5XC 5BN5A 4KY7A 2WDRB 1V1PA 1SSNA 3IXSA 2SOBA 1JICA 3E6ZX 3NVYA 4WH4A 5KRUA 2BB5A 2F0KA 1BUIC 2WV6D 3J7YW 2WU5B 1RD9D 5I9PA 5KYLA 3CIRB 4PT5A 3HOXB 1IBXB 2B2TC 2OHFA 1C79A 4A3MB 4DNTB 4KN4C 2Q8IB 1RYJA 2B2WA 3G6JB 3TMEA 5IGFA 5ELDA 4K5XA 4CHTB 4N58A 1XCQL 1PTOD 4NAWB 3W3AA 3ND9A 4GDLB 2B63B 3A8JE 3T3OA 1JR0D 2FHTA 1Z47A 3JAME 4A3EB 2FBWB 2KN4A 3AE3B 1KTKA 1GJXA 2I07B 4C3HG 1CQFA 2Q8TA 2EY1A 5D65A 1D1KA 1WTVA 2TMPA 4IFDH 2RA4A 1SJED 4ZYSA 1STEA 1MHXA 4ILWA 1ZDXA 2NZ1D 1YNND 2J0TD 3NS1A 3HRDD 2JP1A 1M8AA 1CZGA 1SYDA 4WRDA 2W54A 3GO5A 3GV3A 4HAEA 3VR2A 1BNZA 3ZJUA 1HPCA 2N7JA 1S5CD 4FXKC 3K59A 2V3NA 1Y8PB 5JAVA 4RGMA 1MBYA 3GTMB 5M5WB 3PO2B 2RSNA 3ITPA 3NBHA 3P75A 1EIHA 2G9DA 2HDEA 2WDQB 1L4ZB 1SNMA 1F9SA 3P7JA 2WXQA 3J80L 3FMCA 4ZRQA 2HCCA 4P2CB 1B2TA 2M0AA 2M19A 1QB5D 3P1MA 4RNAA 2E3TA 4XDDA 1E6EB 1PRTC 2WNMA 2XN9C 1ZOYB 1VDZA 4ZHOA 1HFNA 5DAUA 5A35A 1RF2D 1OXTA 3TP7A 1OQRA 1PFDA 5HURA 2JA5B 2NVYB 1SSOA 1FEHA 3HP3A 1T6BX 4DAYA 1D5MC 2SAKA 1Y69U 2ICEC 2W82A 5AUKA 1II3A 4EQNA 3BIID 1KDCA 2BDOA 3H0GB 3OPOA 3LX0A 3S1QB 1RHPA 1GOZA 1UUPA 2V4IB 2K1BA 1KLGD 2BE5C 4NMZA 2EJFC 4N59A 4M8AA 2EYMA 4A6QA 1STAA 2H1EA 1O7LA 5LHY1 4HN7A 2XNAC 4X3UA 5IT9L 4XTCS 5AUIA 2DN8A 1QT9A 5DM63 2L1BA 4G57A 5BN4A 4XE0A 4OZCA 1PTOH 3O13A 5C44B 3SVMA 1R7SA 3NE5B 1FXIA 4LTUA 4C7YA 4IFDG 3MEHA 4DF7A 4OZBA 2YYZA 4US8A 1I6HB 1Q90A 3RZOB 2IPKD 5IODA 1VF5C 1D5ZC 5CGKA 4US9A 1OO9B 4Y7NB 3M7NA 1NYQA 1BCPD 3QIAA 1PZID 1WTRA 1HCZA 3VR5A 1RWSA 2GRIA 1WTXA 3FPUB 3DM1A 3DWAA 5C5MA 3A7LA 5CMDA 1LTBD 1RTNA 4WAFA 3S17B 3IAM1 3I9V1 5LL6X 2R61A 1L0YB 3H09A 4OVZA 1ET9A 3GV6A 5IGEA 2ZT9C 2MJ3A 1E0BA 3A8IE 1SYCA 1ACCA 1YN5A 4YSZB 4AQ7A 1SJHD 1K83B 1GUGA 2ENBA 3RPFC 2XRSD 4CKCA 3Q8EA 2MUYA 1BO0A 3OMGA 1J7CA 4ARIA 4B0MA 1ZUD2 5CYUA 2RDGA 1ZXIA 1DD2A 1EQTA 3HOYB 3I70A 1I4HA 3PUXA 2JSVX 3TDQA 2F0HA 1E2ZA 4DA2A 4H0LC 4BBRB 2N55A 3PZ8A 1KABA 2PW9A 4ME5A 1ZYRD 1C9FA 2PMZB 1JWSD 4EE2A 2QILA 2LGIA 3AEEB 2EKIA 1MD2D 2ZXOA 4ID6A 2F0FA 1ENAA 1JWUD 1NR2A 1IW7C 2QIEB 2PLPA 2L55A 3A7AB 1B53A 5BMIA 4OW0A 3SEBA 4C1NI 3AMUA 3HOVB 5CR3A 3R2TA 2N9KA 3W1SA 1TJEA 5FO8B 3HOZB 1TR5A 1SNOA 2Y5CA 3EGRA 3MXNA 1UWXA 1SEBD 4OIJA 5J22A 3NZ3A 2KWDA 3K5OA 1S5FD 2PVGC 4B9WA 1GXDC 4U68A <