1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
1RD9D 1D5XC 1S5CD 1EEID 1EEFD 1S5BD 1YN5A 1FD7D 1JQYD 1STEA 3TSSA 1I4RA 4UDUC 1UUPA 3V05A 2NTTA 4L6TB 1PTOD 1LTTD 1ET9A 3O13A 1UNSA 1CK1A 1PZJD 3BYTB 2ICIA 1BCPF 1L0XB 3DWPA 1LTGD 1FNWA 1FNUA 4RGMA 1HTLD 1SE2A 1EWCA 1SE3A 4RGOS 3DWAA 2CHBD 1ESFA 3BVMA 4RHSA 1LT5D 3R2IA 4RCOA 4C56C 2NTSA 1LTSD 1XXGA 1RF2D 3DWQA 1PRTD 1SE4A 1KLGD 2TSSA 5D3IB 5ELBA 1LTAD 1S5ED 1SEBD 1EFID 1FNVA 1KTKA 4TSSA 4L63B 1BXTA 1ENFA 4DXFA 2J4XA 5ELDA 1HA5A 3KLSX 1PRTB 1RCVD 3BVGA 1JWMD 1SJED 1CT1D 5I4DA 1PZKD 3BVZA 4Z9CB 1LT4D 1LLRD 1JWUD 1HQRD 1DYQA 1DJRD 1AW7A 1D5ZC 1S5DD 4NZLB 1TS5A 1QILA 1PZID 3W2DA 1JR0D 1JWSD 2AQ2B 1YN3A 3MC0B 1TS2A 3BYYB 2QEJC 2WV6D 1MD2D 1T5XD 1D5MC 1I4PA 2G9HD 1EU4A 1PRTC 3GP7A 1I4QA 4ZYSA 1PTOB 1I4GA 2IPKD 1KLUD 1FGBD 2O2LD 2R61A 3MFGA 1CQVA 1S5FD 1TY2A 5FKAC 1V1PB 1GOZA 1LT6D 4DXGA 1TS4A 5D3DA 5ELFA 1PTOH 1G8ZD 1SXTA 1BCPC 1LTID 3OWEB 1SBBB 3R2TA 5ELEA 2AQ1B 1JCKB 5TSSA 1CHPD 1HXYD 4K6LA 1I4HA 1LO5D 1ET6A 1PYWD 2RDGA 5ELCA 3EA6A 1PTOC 1EU3A 4RGNA 1B1ZA 4RHRA 1V1PA 1LTBD 3BZDB 1PTOF 1AN8A 1B44D 2IJ0A 1SJHD 2XNAC 4OHJA 1V1OA 3R8BA 2XN9C 1BCPD 1BCPB 3CHBD 2XRQD 1D6EC 2SEBD 3URYA 1LT3D 2Z8LA 1M4VA 1TS3A 1RDPD 3SEBA 1F77A 2AQ3B 1LTRD 4RFBA 4RGTA 2QILA 5FK9C 1TY0A 4BWGB 1CHQD 2XRSD 3EFXD 4RH6A 1XTCD 2RDHA 1I4XA 1PRTF 1YN4A 1L0YB 4O1NA
chains in the Genus database with same CATH superfamily
3KVFB 3RYTA 3N20C 5HURA 2D3AA 2LKVA 1I4RA 4C80A 4QF4A 2LXJA 1N33Q 4XXEA 1I6HB 3D32A 1HFGA 1WXVA 3MJWA 4ZRQA 5EKKA 2I07B 2IO3B 2WP9B 1CI3M 3J80c 1CK1A 3H8HA 4YTPB 4YL8A 4JI6Q 1NJIC 3VA5A 3W1YA 4CQNA 3ZJYC 3HRZC 1IYVA 1SRUA 2B63G 1N5XA 3PV1A 1P1AA 2EXZA 1E0ZA 1LACA 2LFNA 1B70B 2L52A 4RGOS 1ZYRD 2MRPA 3H9DA 1BMLC 3J81L 4D2KA 3CCQA 3N1XC 4C56C 1EOVA 3RNGC 2IHFA 4AS1A 1RFKA 1U4AA 4IOIE 5IT9L 3Q22A 1PRTD 1OEYA 3AMUA 3E5SA 4XE0A 3N3KB 1WX8A 2KWVB 4DU9A 4II3B 2OT2A 4ZK9B 2QGQA 1J8CA 3HS0C 4JI7Q 1AH9A 2WAQG 5JJKA 4HJGE 2BKRB 2F0OA 2RSUA 1IGDA 1ZYRC 3C1FA 1NENB 1RCVD 2DENB 1K0RA 5LHY1 5A35A 2B2YA 2LGIA 3QR8A 2HJ1A 1YD8U 2EOTA 3TN2A 5HGTA 2FHTA 1DYQA 2C7HA 4FHKA 3KW5B 4IFDI 1ONLA 1UWMA 1TS5A 1IKLA 1QILA 1WMHA 3CP0A 3PIPA 3C3LA 5MPOA 2K8CA 3LDZE 2O6VA 2L0TA 1UWVA 1KDBA 3NTHA 2ZXRA 1HR0Q 2MO0A 2F0FA 2PZTA 2WP8J 4NXNL 2CCZA 3LYYA 1WF9A 4IURA 2B2WC 2GBJA 2WKCA 1Q86C 3Q14C 2JXTA 3QOLA 1YHAA 3DPDA 2HQLA 2GLSA 4BKTA 1S5FD 3RN2A 4B3TL 3ML9A 1DM0B 5E6NA 2A6HD 4LNQA 4LFBQ 4LUOA 1A70A 3BZKA 2VQFQ 3H0GG 1CKNB 1RHPA 3L0WB 1XNRQ 2AQ1B 4A8XC 1E7VA 2UU7A 3QA8A 1JCKB 1IBLL 1HXYD 2JA6H 3S17B 4A3BH 2LASA 1WTHA 1TZOA 2V4DA 2Q8TA 3ZNID 4USAA 3EJIA 4JC0A 3CC2A 1HUMA 2K01A 3E9HA 5KNBA 4LF9Q 1UF0A 4MH8A 3UINB 3ZKJC 2Z59B 1PXUA 2F1MA 1FJGL 4HDQA 4B3SQ 1D2BA 5KNCA 2K39A 2N9LA 1E0BA 5C4XB 4A3GG 2K03A 3APFA 1A63A 3FEWX 2B2WA 2LVQA 4RF0A 3SEBA 1XPOA 3HVDA 1MJDA 3SU8X 2EYHA 3NVWA 1FJGQ 3QQ8B 4MJSA 1GHJA 3D4RA 1O7YA 2F0KA 1K8AC 1L1OB 1BVSA 4GOCA 5J17A 1BBWA 4IALA 4OZBA 1L6VA 1K53A 5M3MG 2JYEA 3MTNB 1KRTA 5M3FG 1YQ3B 1HUNA 3GTMH 3JW0X 1L1OC 3AFPA 3VTVA 4UDUC 2ZM6Q 2VZKD 4WURA 1EYDA 3UF8A 2CQAA 3GE8C 4GN1A 4HCEA 1H9KA 4AH6A 2HCIA 3P42A 4OVZA 4P1BC 5GAHC 1EYGA 4ME3A 1XNQL 3RMKC 2IX3A 5EKLA 4CDCC 3NBHA 3IFTA 3NSWA 3LJ3A 1WTWA 2QC8A 2MBHA 4YCUA 4H2AA 3WAPA 2N78A 3K8AA 5I2YA 2DWQA 3NVYA 1SE2A 4GLAC 1GUWA 3MP9A 2KDMA 5IP7H 5IYBG 2NS5A 1N5WA 2CHBD 5IYDG 1RTNA 1ICFB 2PVOD 5CHWA 3R7RA 2BDOA 2GOWA 3I9V1 2JJQA 4HCSA 5M5XB 1YIJA 4WIPA 5CGKA 2VL6A 3GTQH 1XCTL 1B3AA 4NJCA 1F0ZA 5C44H 3OJ4B 5ELBA 1S5ED 3ZJUA 1LTLA 1EFID 2JXXA 3GOEA 3VUWA 1YJJA 3RZOH 1U4MA 1M94A 1F2MA 1RL2A 2EYLA 4CJ1B 4FP5D 2WB1G 1Z9FA 5KGUA 2VY3A 5CYUA 4FF4A 2LMCB 3H7PA 4IW0A 2RA4A 1SGHA 2ASQA 2OEOA 1TWGB 2K5QA 4LAAA 3T4AC 4GNXC 5K36H 2KJ6A 3DVGX 4KGRA 4F8CB 2KVMA 3ZO5B 1K8GA 4DDID 4G11A 2HD5B 3NQIA 2YU9H 3GTOH 1L4ZB 2K0PA 1Y1WB 4MGZE 3P4QB 2JUOA 1SYEA 4HIKA 2QEJC 5IOIA 2JU6X 4NB3A 5H92C 3TS0A 3RD2A 1R4NI 4PT5A 3J7AF 3PLVA 5CR3A 3A1QA 4HJ5A 4P2CB 4A93H 2MNAA 4C3HB 2WFWA 3ML8A 1J5EQ 1PH3A 1FGBD 3QG1A 3NRZA 4M01A 1TY2A 4L1BA 4QIWB 2ZT9C 2LUEA 2N49A 1JMCA 1GOZA 4DXGA 4JI6L 4JI3Q 2WIIB 5IODA 4FXGC 3TP5A 1ZUD2 2KAJA 3SVMA 1QVGA 3RCZA 4B0EA 4KHZA 1CHPD 2JYTA 2L8JA 4N9TA 2QDFA 4K8JA 5M3FB 3HOYH 2INCC 1BO0A 2KTRA 1JT8A 2MEKA 2MSED 1SR3A 3WANA 1PVOA 3MXUA 3B2FA 3FILA 3AEFB 1J7AA 4QUFA 1WRIA 2OQKA 5DPRA 3DLLA 1YJNA 3PIP3 2Z6KA 2QDBA 5NUCA 3C19A 3VVWB 5G55A 2XRQD 2NVTH 1WGRA 2Z8LA 4DV4Q 5EJWA 3BZCA 3PO3B 3U4EG 5CORA 3NK9A 1LTRD 4RGTA 4NAWA 2Z0SA 1GNUA 3U7ZA 1VQ7A 4EFOA 1PMRA 4BWGB 2L0CA 2CWAA 4JVZA 2K50A 1Z2MA 4WJQA 3AB5A 3SD5A 1V43A 2L11A 2VZAA 1PRTF 1IKMA 3V6CB 2PQAA 2QMTA 4QB4A 1J5EL 4WORA 2WDVB 1D5XC 4KN4C 3STBD 1YN5A 2LRWA 4DV0Q 4K0KQ 3B9JA 1NBWA 3NXWA 1JMLA 2RR9A 2WXFA 1GHKA 1WR1A 5CHFA 3I4NG 1WRDB 1WGYA 3GE3C 2LRUA 3O13A 4K5XA 2RVLA 2JN4A 2PE6B 4OZAA 5AFWA 3VXWA 3ZVVA 3F2DA 2AUKA 2KO3A 4OL7A 1IZ6A 4UP7A 4LNIA 3MFYA 1EY5A 2ZTCA 4JPSA 5CMDA 4R1JA 2E5LL 5JJIA 3G6JB 1UELA 2N55A 2F4VQ 3RNBC 1TIID 4JI1L 2AWOA 3VQIA 2F0IA 2K6AA 1FCCC 5C0XJ 2QJLA 3LXFA 1N9WA 2K1FA 3JSVB 4DGZA 1TKWB 1SFOH 5AZGA 4PQXA 4PZ8A 2FJ2A 1C48A 1A2UA 3K7UC 3S2AA 3DQVA 5D3IB 1VQNA 4AP4C 2HDMA 5C0XH 1KH0A 2LSSA 1UZXB 2W3SA 3AEGB 2SNMA 3VR8B 2EYFA 1VS0A 2L4NA 3A8JE 5BYRA 3PRPB 1SYDA 1FGUA 2CFMA 1HZ6A 3RZWC 4XQJA 1B7YB 2NWGA 4E6IA 4DV5Q 2R7ZB 2G4DB 2RSOA 2JWUA 1YNND 4U673 2KDFB 1UEAB 4X66L 5L37A 4J3OD 3OYYA 4A3IB 2E2JH 2UXDL 2LHEA 4P74A 4A3MH 1OEYJ 1WXQA 1TKEA 2LJIA 1KAAA 2AUJD 4FDBA 5JHAA 2QSDA 5T1GA 3K0YA 2HTHA 3RNCC 4YSYB 2R3ZA 5GAGC 2JA5H 1IUEA 2G9HD 3J80E 1U0LA 1YIWA 5CBAE 1R4PB 4ZUIA 3E3XA 3GP7A 3OAWA 4LF4Q 1C4PA 1Y8OB 3NPPA 2M1MA 1NR4A 2O2LD 1WTPA 3AI5A 3H09A 3PS6A 4FJZA 1CUKA 4EEWA 3LX0A 2OJRA 2CQOA 3SK4A 3H3VI 2DYMA 4K2KA 2IHEA 3C2PA 1NBFC 5ELFA 2NBWB 2JK8A 1Y56A 3SK6A 3FDTA 3MEFA 3LB8C 2KANA 2XGTA 4B3SL 3V62A 1SYFA 4QGUA 3EA6A 3RULA 1B8AA 1YEZA 2D2QA 3I70A 4LF9L 1UBQA 2PQEA 2UUBL 3DCGA 2V3PA 3SR6A 1GVPA 4A3DB 2QHOA 3HOZH 4CHTB 3TBIB 4PZ7A 1KD1C 3CC4A 1NCVA 1OXUA 1G6PA 1WI5A 5JZEB 3UQAA 1IBLQ 1FCLA 1RODA 2WB1B 4IG7B 4ARIA 5JVH3 3VH4B 5IT9c 2CH4W 3P75A 2L1BA 5FLMG 3RUZA 4WAAA 2WXJA 3M3YB 4OXPA 2WXIA 1WFYA 1K8RB 2MH7A 3SHQA 3L10B 1GD7A 4B3TQ 1X54A 2RDHA 3GTKH 1SIJA 4JOIA 4P73A 5C4JH 4HJ8A 1PH5A 3F2BA 2JA8B 2K04A 5I9PA 4ZRJA 4GN3B 1YI2A 3PREA 4JBMA 4HCPB 1XTDA 1IW7D 2BB5A 1T3QA 3KJOA 3KLSA 2A4ZA 2EQSA 2ZJRA 2ZPYA 3DWGC 3IFWB 5FLMH 1JALA 1VQCA 4WJWA 3ZJTA 1Z6HA 2PCFB 3NTIA 5IE8A 3HFZB 1KXLA 5LLIA 4FXKC 5JEAJ 1SMXA 1FMAD 3ETRA 3DWPA 2OCEA 2K5PA 4OWXB 4MZ9A 3PO3G 3OW7A 3I2ZA 2V3SA 4ZRPA 4GOPA 3HOVH 1MIUA 4LFCL 2RD0A 1O7IA 2YVCA 3DWAA 1UE7A 1X3EA 4C3IH 2WAQB 2CJOA 4A3GB 4C3HG 1MFWA 3LGJA 3KQ4A 1UE5A 1W3SA 4DK0A 4JI7L 1TWFB 4GN5A 5I6YA 3RMHA 5G2NA 3I73A 4DKAC 2K5DA 1PH2A 1P9DU 1VR9A 2XTIA 2TSSA 4JOIC 1UWXA 2KFKA 1PYBA 4LMQD 4YWMA 2NVTB 4YSXB 2JEAI 5JHBA 2M8SA 2PPHA 4DK1A 4L63B 5EGTA 2X6LA 1F2LA 5C1ZA 1W2BA 3M4QA 2J42A 1C4CA 2WXMA 2PO4A 2MJDA 2B3AA 2KX3A 4ULLA 2FFKB 3BDOA 2R7DA 1T0YA 1HPCA 2VZKB 2PTLA 3AE2B 2K52A 3QB3A 4F8MA 2IBIB 2ZVOA 1ZEQX 1K9MC 3W2DA 2VB2X 3D4DA 1TS2A 2MQJA 2QKIC 4X3KA 1IBXA 3DVGY 2WS3B 1D5MC 3HM6X 1PH1A 2MW5A 3AQQA 4DF7A 4N9PA 3GTGH 1A5RA 1WM2A 2FIFA 1CQFA 1PTOB 4B95A 4BY7G 4WH4A 3DHGC 4IPCA 2NVXB 3MC9A 1GJZA 4MDKE 1IBML 2D5GA 2L00B 3JVZX 3NS1A 4OZCA 1VJKA 4BBSB 1WOCA 2P5ZX 4IUTA 4PMWA 2FCSA 5C3JB 2EMSA 3OIPA 1SXTA 3MEHA 2DZJA 5FR3A 1TWHB 4JV5L 3J7ZC 3M95A 5H1SE 4B9XA 1AFPA 1QZGA 3PT2B 3K59A 4WAFA 5E4XA 3QCAA 4F7XA 4N8X1 2GBNA 4DV1Q 3S1QH 1TWCB 3NHEB 3CAMA 4A3LG 3Q3MC 2MJ8A 2KECA 1LYLA 3M9BA 3J7YW 5BMGA 1MHXA 3VUXA 2EZVA 1GXDC 1L1OA 1O7ZA 1V1OA 4H02A 2F03A 5KRUA 4L5SA 3PF4A 2MX2A 2I1JA 2M4NA 4LTUA 1BUVT 1IBKQ 1D6EC 2SEBD 2BS3B 4PK1A 1LT3D 1E6EB 4A3FG 2LXAA 5CX3A 1GM5A 3OMCA 2IY0B 4DUZL 5LNK1 1W6JA 2MQHA 2I0QA 4W9JA 1UAPA 1ZPSA 1YOVB 3NUHB 1SIFA 3AEVA 3IXSA 1FRDA 3A7AB 4A3KG 1I4XA 4HVBA 3NZSA 2WXKA 1LTTD 1VQKA 4M8AA 3QWZB 4JLCA 1STYA 3IHPC 1Q10A 3I4OA 1JQYD 4G7ZC 2PMZE 1DGSA 3U9SA 2FCNA 5DEHA 1JOQA 5C6AA 1NVID 1EO6A 2YEPB 3N1ZC 4WJ4A 2RGFA 1TQOA 2UUCL 2PW7A 2UXCQ 3RI7C 1WX9A 1WIAA 1PZJD 1V49A 3TMPB 4P7IA 1G2SA 3L2PA 2B2VA 3CCRA 2HE7A 4YWLA 4I6NB 1FNUA 4IC7B 2PW5A 4A3KH 4JW0A 2C5LC 3P20A 3N32A 3P2BA 5KHOA 1GUOA 3SFDB 2NBUA 1ICWA 3VAWA 3T51B 1OTRB 1YMHE 1HNXL 3DBRB 2ALYB 2VQEQ 3HOVG 4IUPA 1OTCA 2XBBC 4PMCA 4Y7NB 5EQ0A 4XX5A 1VQLA 3Q8EA 4B3RL 3AE4B 4KN7C 1A6XA 1WM3A 2LEKA 3AE8B 4HPLB 3B2GA 2JZZA 4BY7B 2MO1A 5EE9A 4TSSA 1EUVB 5DM63 3AEBB 3VR3A 1Q0WB 1XMOL 2FAZA 3I57A 2JQRB 1HA5A 2A74C 4KK7A 5LMNQ 4A3PA 4TKOB 1I35A 3A1QB 3EECA 4CDDC 1X56A 4HROA 1WGHA 1UE1A 2K5VA 1PDXA 1EY9A 2GA4B 1YNXA 4JI4L 1Q12A 4A3DG 5D94A 4OW0A 1Q7YC 1SF0A 2R92H 3J9CA 1MG8A 2DN8A 1HZ5A 5E6JA 2J0TD 2AQ2B 3KLRA 3QWNA 1WVLA 1MI2A 3QO2A 3OSOA 2JZ3B 3Q6BA 2PZUA 2V4LA 3I55A 1VF7A 5JVG3 4X3SA 2KJXA 4MEMA 1OXXK 1YX5B 1GUTA 4MNOA 3WAOA 4DV3L 2PMZB 2JA9A 1ESRA 3AV8A 3PUXA 1ZE3D 1XLOA 4V190 2F4IA 3S9WA 4X62Q 3BINA 3RNUA 1FR3A 3D6WA 5M5WH 2WU5B 1HZAA 4RNAA 1X9NA 4BBRB 2N0SB 4P16A 4ZQ3A 3RFZB 5IGDA 2KMAA 3DWMA 1OXVA 4R4CA 2D5DA 2A6ED 3A8IE 1PYWD 2R6GA 2XIWA 4ZDVA 4KD3A 1N34L 1FFUA 2A5HA 3G48A 4JBKA 2KACA 4XYQA 2DAFA 4XT1B 2OXPA 1DD2A 1STGA 2ZNVB 4NW2A 2N9KA 3DBLI 4DAVA 1E90A 3B08A 1KJTA 1KFYB 1LQBA 3CCVA 1NDDA 3UQBA 1KIXA 3E0EA 2UUAQ 3ZNZB 3RPFC 2A69C 4R4QA 2O6VB 4M8MA 2AQ3B 4DNIA 3GDEA 1WSPA 2AKWB 4JIOU 2K4KA 3W9CB 3U4ZA 1WY8A 4ZOHC 5C23A 4IJHA 4AQYQ 2JRIB 3ZXVA 1Q90A 2GN5A 4DV7Q 1WTOA 4XYCA 4EGVA 2KJRA 2O6VD 3GV6A 1XMQL 4YWKA 4JE3B 1CKOA 1N34Q 1RD9D 1L0VB 2LVOA 3ONAB 1HNZQ 3T3OA 2INPE 3A56A 5M3MH 1RM6C 2QW7A 2BF8B 2CU3A 2MBEA 2MBBB 2WYQA 1KL9A 4HDOA 1IPGA 3Q8BA 3ER0A 1CKNA 4JI2L 3A7LA 3U7DA 4BFRA 3WWVA 1P7FA 3DUZA 1ROEA 5IA7A 3BYTB 3PO2H 4UP8A 1QOBA 1VQEA 2O4XA 2JF5A 4IO9A 3D8GA 4K3BA 1NY4A 3N6RA 5KIXA 3V60A 4A3BB 1EZ8A 1MSHA 2K5HA 2ASBA 2VUMB 1KLVA 2WB1E 4RHSA 3Q3NC 1LT5D 3D3RA 2FCQA 4KGTA 2MWSB 1KNEA 1RF2D 1XXGA 4RAUC 2PYKA 5EPKA 5BR8Q 4DV2Q 2NVQB 1DOIA 1P7EA 2O5JC 3KUZA 1J0GA 1A15A 3T16A 1T0SC 4R8NA 1O78A 2F0SA 4OIKA 1Y1VB 2N1WA 4URKA 2K8BA 2ZCBA 4AQ7A 4JI4Q 4DK5A 1E2ZA 5IT9E 2Q2HA 5C4XH 4FN2A 1MBYA 5HHDG 3RLNA 3MWYW 2B63H 1HH2P 3BDCA 4NPNA 4ANXA 2BS2B 4HCNB 1EIHA 1SJED 4WWNA 3NQTA 2FINB 4Z9CB 4DR7L 2K28A 2KVRA 1XLQA 4XDCA 1N61A 1D5ZC 1V8CA 4HK2A 4IPDA 2F0VA 3AE3B 4A3FH 2DHZA 2PE9A 4KI0A 1H95A 2WXGA 4W9HA 3TIXA 3ZRCA 3AB9A 4IFDJ 3NZUA 4OEMB 4OO1G 4M0WB 4LFAL 4N9F4 2KEEA 4ALPA 1I4PA 3DBSA 2CJNA 2VQEL 2W3RA 3GTPH 4M02A 1BR9A 3R93A 1E2WA 1T6BX 3UDIA 3A9JB 3KYHC 4DXAB 2HHHL 1NEKB 2KA7A 4A3KB 1VQDA 1KM7A 1TS4A 1TWAB 1PGBA 3EFUA 3FC4A 2EYMA 4OX9Q 2UXCL 2A69D 3HOUH 2IDYA 4BKSD 3S2DB 3VTWA 1QG7A 5LXIB 1VZ7A 4P1CC 1PA6A 4W9DA 1TR5A 1B4OA 1QE6A 1EWHA 2NCNA 5GAEC 1YZ6A 4JI8L 4H13C 5F2DA 4IDIA 5AZFA 4UHVA 1V1PA 1HFNA 1S72A 1HNWQ 4G0NB 3NJTA 2ID0A 1X3QA 2XN9C 1G51A 5CV8A 1WZ3A 1IP9A 3LNNA 5LMUL 1YQBA 2BYFA 2R93B 4GDKA 2NR2A 1WD0A 2RPVA 2D62A 1J7BA 4LJPB 5LXHA 1Q81C 2OOBB 3HK0A 4IWPA 4JK1C 3A54A 4ZRKA 4LJZC 5G5GA 5JPMC 1Y1WH 2L32A 3VHTC 4RH6A 4C1NK 5JJLA 2FXQA 3L9AX 4ZHPA 3P63A 2EY6A 2RKSA 3CRLC 2E2IH 3OTOQ 3D0FA 4FLHA 3CQZB 2CHWA 3IVFA 1MI0A 1EY0A 3EC8A 2RSNA 1EEID 1ZXHA 3H1UA 2NBVB 3TSSA 2HIVA 3K5MA 2K14A 4JI5Q 4LFAQ 2PEAA 3J7AV 3KBXA 5JEAH 5GXGB 2NTTA 4CO7A 4CKBA 1BOSA 4L6TB 1C7YA 4ANVA 3N1YC 3S1MH 1CSPA 1IL2A 1SE9A 3WDNA 1WCMB 1MPEA 2M2LA 4M8NA 4KY6A 2N8NA 1D4BA 2ICIA 4OIJA 2JSOA 1BCPF 2A1AA 1WXSA 2KWCA 1FD6A 4KIKA 3CCUA 1IBMQ 4DR7Q 1HTLD 4QMGA 2RDFA 1CFMA 2M17A 3FILB 2K6QA 1SFOB 1YNJC 4FXDA 1X32A 1SDFA 3EHVA 4US8A 4YCWA 2EELA 3HG9A 3H7SA 3ZTCA 5FO8B 3D4WA 4IUQA 1XJVA 2JA8G 4C3JB 1OFFA 1SSNA 2VH2A 3AE5B 4BBRG 4DK3C 4EQNA 3U50C 3ZQ4A 2INDC 2YEPF 2WHIA 2KOLA 5BR8L 2UU9L 4IFDH 2QCPX 1RFAA 5CV4A 1VQMA 3WA0A 1PHJA 3M7GA 4GGQA 1D8LA 3BK1A 3O65B 2K25A 2EPBA 4ANUA 4HKQA 4AYBB 1PZKD 1CSQA 2WAQE 3VR4A 3M7NA 3KUDB 2ENBA 1JWUD 3RZOB 2JA5B 3L4PA 3SDLC 4FADA 4RKLA 3KF6A 3UGBB 4HMIA 1R9TB 4A3EB 3WCQA 4JL9A 3JC66 4JI2Q 1J9OA 1U5KA 2JA7B 3TP6A 1FO4A 3V6EB 2TMPA 1EU4A 2E8GA 3CC7A 3I4MB 4Y52H 3S14B 3IKJA 5CV9A 1I4QA 4HIOA 1HNZL 2LXCA 1PUTA 2M56B 4JBWA 1I4GA 4IUUA 2CHZA 3K81C 2C35B 5K5PA 3PQIA 1E1TA 3GTJB 3OOCA 4DBGA 2V0GA 1RKNA 1Q8KA 3PSIA 2FBWB 4FNFA 2UXBQ 3V61A 2NPTA 2JP1A 3PLUA 2ZXOA 1MGSA 4A3JB 2C9WB 1G8ZD 4A6QA 5H8YE 4L2YA 3Q8AA 3GZNI 1X3GA 3OWEB 1NTGA 3R2TA 3FKIG 3TZUA 4MTNA 5K36G 2LZ6A 1UE6A 3AFQA 1MVKA 5ELCA 2HTME 4FJVB 3GO5A 3HKZG 4ZCKA 5FLXL 1PTOF 2XVSA 2L1AA 2EDGA 2LGXA 3VTUA 2Y0SB 1Q1OA 2WKDA 2BBCA 2KC2A 1FIQA 2VH1A 3PO0A 2NVYB 1BBXC 4Q0FA 3CHBD 3VFKA 1QOHA 4TV3A 4L23A 1EM7A 3DMUA 3GD7A 4QJFA 1PV4A 2K8HA 1IW7C 3NTKA 2B2VC 4N59A 3T1HL 2KCMA 3AYHB 3U52E 5DPWA 1QVFA 3TMEA 2W55A 2F0MA 1GUGA 5J39A 1XTCD 1J8IA 4LF6Q 1AE2A 5IKCM 5ELOA 3MTSA 3T8MA 1MG4A 2BE5D 4DR4Q 1K83H 2IYDB 2WINB 4OELB 1I3QB 4W9GA 3HOXH 4TQUS 1IGCA 2PIAA 3EQLC 3Q3JA 3SK5A 3VR6A 5HFYA 1PFDA 1RYJA 4JBJA 4ILWA 4ZRZA 1L7YA 3OJ3A 3HP3A 2OF1A 1A2TA 3CRKC 1TZ1A 2J0MA 1OQQA 4NXML 5DPSA 1F9QA 1II3A 4LUVA 1L0XB 5D6JB 3S15B 3PGEA 4EVOA 4ZYNA 3TUOA 2V1CC 2VB3X 3NP8A 4P71A 4ITKA 5LL6S 4LF4L 1D1IA 3I4NB 3HOYB 1H9JA 3PUVA 4A3BG 2KN5A 4X65Q 2LS01 4YT0B 1TXYA 3AMZA 4K8IA 4A3DH 3S24A 3H0GH 3IAS1 1SAPA 1Q3LA 1SNQA 4X64L 1GUAB 5BMHA 3WOEA 1B3QA 1GUSA 1E5WA 2V1YA 2WQYB 4LF8L 1KRHA 2KT7A 1V97A 1H8CA 2UXDQ 2BH2A 4LF5Q 2RF4A 1MHHE 1PGAA 4O0AA 1SMYC 2LI5A 3RR5A 1HNXQ 5EE1A 5C3EH 2Z0DB 1H9SB 2KQSA 4K81A 3EIVA 2PNRC 5D14A 4BXXH 5D65A 1N32Q 3TDQA 1L4DB 4K2LA 1R7SA 4A76A 3PCOB 1GJXA 1EQVA 1LLRD 1MKHA 4MN3A 2QDLA 3MA2B 4G7OC 3TEYA 1OO9B 2MHVA 5IN7A 1Y1WG 4JCVE 2BTEA 4PG3A 2K7VA 3HVZA 5FO7B 4I6PA 3FP9A 5AUIA 3CSTA 3CCMA 1FYCA 4TKNA 2Z1CA 4DAPA 1M1KC 5FJ8G 5IAAC 1UGMA 1MD2D 2Z0EB 1SMYD 3HOZG 1VQBA 3M62B 4JI1Q 1ACCA 1RRBA 2E5LQ 1SYGA 1XPUA 1E24A 3A9KA 3KF8B 3C46A 3X0WA 1I7HA 4ZYSA 4WJ3M 4GOPB 1PGXA 1WYGA 3HOYG 1KLUD 1TWHH 4HR7B 3AEDB 3L54A 4MH0E 4DR6L 2B39A 3HOWH 2ZJQA 1NI2A 5IP9G 3FKIH 5ISRA 3RUIB 5D3DA 2AL6A 1JE5A 1C79A 2IW3A 4HXDA 3CSFA 1EF1A 4C7ZA 3T3NA 4R4IA 4G3XB 1SBBB 2KMMA 1E8YA 5DAUA 4CGYB 5A2QL 2B76B 1ASYA 2PJHA 4K0KL 1NYRA 4DV0L 1EU3A 2XK5B 4B9WA 2KNBA 4Q2JA 5FLXc 5CHVC 2KHIA 1E2VA 1H9SA 1C0AA 4MJSB 4QAYA 2KFJA 1AE3A 3PGZA 3PZ8A 1F2YA 2IWHA 1JORA 2IGGA 4DV1L 3J81c 3N9YC 4BAXA 1E7PB 4GIVA 1V6EA 5IO9A 1XWEA 4EQPA 4UY8C 4IUNA 4MIUA 3Q2AC 1X3PA 2KVZA 4EOYA 2ONQA 2CWPA 1DOLA 2IT1A 3FHWA 4X3UA 1R9TH 2H88B 2XRSD 3SXHA 3IT4B 4YTMB 3A9KB 2KHWB 2MP2A 1Q82C 3RN9C 3NBHB 4J8QA 1I50H 4TUUA 4O1NA 4NJ7A 2HDLA 3ZXRA 4ZKCB 2Y0SE 1YVCA 3GTGB 2I5MX 1S5BD 3TJPA 3CMAA 4B0MA 1FD7D 4B08A 5IYCH 4YXDB 4N8FA 2DBYA 4DR5L 3V05A 3GTJH 4KKIA 1YX6B 2F3VA 3E9IA 3J80i 1VDVA 2MFIA 4A3OA 1YJ1A 3H3VH 2R7FA 4EE2A 3UE1A 2EXDA 5IGEA 1EFWA 1HZ9A 1JJCB 1PFSA 1I6HH 1EIFA 1LM8B 1FNWA 4RGMA 1CA5A 5TR5A 2L05A 4LK1C 2H4OA 2G5DA 3BU2A 3SK8A 5KYLA 5M9OA 1KC8C 4BY1H 1TYGB 2I38A 4HN7A 3PPAA 2M0XA 1WI0A 5KHQA 5FOBB 2BH8A 1VQOA 1VQ8A 4IWQA 4WJNA 3W5UB 1HCZA 2Y5BB 2LMCA 3F2CA 3H7PB 3HKZB 2Z6BA 2L9HA 1X6OA 1OQRA 3I90A 3BIID 2NVYH 3X3MA 3DBHB 5G5HA 2JEBI 2ZVNA 5HKHA 2OQ0A 4JI0L 1NUCA 1YQ4B 2MHJA 2RPQA 1BXTA 2A73B 4GKKL 2HJ8A 1E22A 2O2VB 2GMIC 2DX5B 4LLGM 1TU2B 2R92B 2K22A 1KAWA 1I5FA 4LFCQ 3S16H 1VDZA 5I4DA 1JC7A 3D31A 4GOPC 1G6ZA 2ICEC 1LGRA 5EBDA 3U9OA 2FNJB 4IKGA 1S5DD 3APDA 4S0RA 4J6HA 5E4WC 4RKBA 4B6WA 3TBLD 5BN3A 3HOUG 4A93B 1XO3A 3MHSD 4C3HH 4IM3A 3VA7A 2E3TA 2WV6D 4HWIB 4DR3L 1T5XD 1H9MA 4HEDA 1EQTA 2JA7G 1DOMA 3RNFC 1ASZA 4DHJB 1WZ0A 1C76A 2RMMA 3GTMB 1V86A 4X6AH 1V80A 2AHOB 1X3FA 3V96A 1F2RI 3HOXG 1QKZA 1QOAA 2KTRB 5FKAC 4F87A 1V1PB 4XWWA 3QJYA 1E1OA 2ZW1A 1XNQQ 4J6IA 1VLBA 3N52A 3U30A 3ZUNA 1NNXA 1AWDA 1Y8RC 1UD7A 2ZM6L 2RDBC 4K7WA 3M3JA 1C4AA 1E8XA 3P1MA 4NAWB 1STBA 4K14A 2ZEQA 1RAXA 3VDYA 2IZVB 1LTBD 3BZDB 2JZPA 3TL5A 5FO9B 1AN8A 2F0GA 2UUBQ 3Q24A 4B3ML 4OO1H 1CJEA 2PKOA 3ZLZA 3H6MA 4YHHL 5EBCA 1WCMG 2PI2A 4EX5A 3P7JA 2PQAB 1KRSA 1Q1BA 5C44B 2WXNA 3R7QA 4PZ6A 1TS3A 2D10A 2EJFC 2BW2A 2A5UA 4BXXG 1QNKA 3E6ZX 2Y5PA 1NAPA 1GB4A 3P1HA 1S3SG 1IXRA 4B3MQ 2JX5A 3K6OA 3ZTDA 3CXCA 5IYCG 2Q2TA 1ENAA 2J52A 3MJ5A 1CZPA 4RM9A 4LDTD 3ECIA 3LWEA 3VR9B 3CF6E 1LFDA 3AECB 5HI1A 2DYOA 1E3PA 2A19A 1UUPA 3NZ3A 1XNRL 3EVQA 1YJ9A 2XWJB 5IOCA 5CC4A 4KJOA 3CIRB 4IZ8A 4XDDA 4ZHOA 3QOJA 3A74A 1A3VA 1ILPA 3Q3FA 1UNSA 1SB3C 1KDAA 1VQ6A 1IYFA 4IOCA 1D1KA 2EYOA 2B2TC 4O42A 3ZGZA 3OLMD 1F9SA 1VD2A 2BVCA 2WGSA 2WXLA 3ONSA 4LK0M 4DHZE 3DBRI 4FF2A 4ABNA 1ESFA 1NMFA 3BVMA 4Q5VA 4NXNQ 4RCOA 3DHQA 4WRDA 2LUMA 3KDFB 4A55A 3KWVA 2JSVX 4XWTA 1EZ6A 1PDQA 1SE4A 2N88A 3F8TA 4RWSC 2SOBA 3TP8A 3V3XA 4UAIA 2K5NA 1KQSA 1EIYB 2O5IC 4A3CH 1TBEA 3KF6B 2QA4A 3D6CA 1M8AA 4Y7NH 1WE6A 1KNAA 1KTKA 2KKCA 4X57B 3HRDD 4GNXB 2J4XA 2SNSA 2ZTDA 3CCEA 4BKGA 5C0XG 4APVA 1E9MA 2CS4A 4KDIC 3BVZA 3CU7A 2F0WA 1F1HA 4WQMA 4JI0Q 1AW7A 1FXTB 4CDEC 4NZLB 2FUHB 2EKIA 4P75A 1VQ4A 1VQPA 2X69A 1YN3A 2N7JA 3GTPB 2Y3AA 4NQKE 2F0UA 4KKUA 4BS9A 2IO0B 2A6EC 2EYJA 2N7DA 1P16A 2L5TA 4OONA 3RLFA 1EF5A 2L55A 5AJ3L 3ULJA 1WJJA 1CM9A 2CW0D 1ILQA 1W6KA 2L7RA 2MPMA 2XSCA 3M4OH 2IY5B 2E2HH 2OHFA 4F1SA 4YIJA 4JQWC 3BY4B 4EQOA 1WMHB 2IY1B 3E9SA 4G7HC 1FVIA 2EJGC 4K1RB 4DHZB 1E8ZA 4DWFA 3KDFA 4KKSA 2DZKA 2R92G 3ZRFA 3NWTA 2RHSB 5FR6A 3GV3A 5IGCA 1Y69U 1QT9A 3WOFA 1N33L 1WXMA 4FO2A 4OVUA 1GUNA 4KD4A 3BK2A 4HKZE 4HPMB 1X55A 4J1MA 2WACA 5GADC 2PMVA 2H5XA 1YHBA 3AEEB 3CMMB 4W9IA 4ICUA 4L8JA 2V4IB 3MZ5A 4E74A 1STNA 3OHXC 2IJ0A 4DAMA 3T53B 4CKEA 3I4MG 4FYDA 2Z4HA 3CF5A 4GDLB 4XZ4A 3OMGA 1C9OA 5M3FH 3ZJVA 1PH6A 1BBUA 2CH4A 3S16B 4UPAA 2LGSA 2JE6I 2PZWA 2V3NA 5EAYA 1M4VA 2PI2E 3MXNB 3H6NA 3GTKB 1GC7A 2N7EA 3BDLA 2E2IB 4FA6A 2W82A 4M0WA 2BB6A 4JI3L 1CHQD 3AXCA 3PTFC 3EFXD 4R9WA 4C2MH 4GKJL 3G6EA 3TEWA 3DOWA 4W9EA 4P72A 1XF5L 3QIAA 2YTXA 1EYCA 1WJUA 2KQ4X 2OJWA 3K9PB 2GBKA 2F3IA 4PYZA 4I65A 4AYBG 5AJ3Q 1FXIA 1VMCA 3PF5A 2JY6A 4PS7A 2B2UA 3ZDMC 2JYOA 2KQ3A 4P6VF 4YWGG 1HTOA 3KUPA 2LD9A 3QARA 3SFEB 2VS1A 5J18A 3QJZA 1JOKA 5M3MB 2DZIA 3PIO3 1O7LA 2HD3A 2RHQB 4ME5A 3HOUB 1F2RC 1ZDVA 2RCNA 5JAVA 1HE8A 1BDOA 2HQEA 2QIEB 2KFKB 2L12A 5J22A 4QIWE 2WX1A 1V8QA 1Q1EA 1DOKA 1F9PA 1K50A 2MBQA 2CHXA 5FLXE 2EY1A 5HGQA 2K3UA 3AE9B 4RA8A 2AX5A 4A20A 4HSVA 2KQ7A 4HJ7A 1IYJB 3UI3A 2A68D 5LMNW 1YNNC 1LTSD 5BN4A 1N8RC 2KWUB 5EPLA 4TVAB 2ZTEA 3MXNA 5I2XA 1MHWC 3AN1A 3HEJA 4POGA 5FJ8H 4RMAA 2Q2IA 3BG3A 3I4LA 3RZDB 4MTKA 4PV1C 2KC1A 1N32L 2RCFA 5ELDA 4FVMA 3AM9A 4N6EB 3BVGA 3QC8B 2RBMA 2NZ1D 1JWMD 2LHDA 2N1VA 4EZKA 4MM3B 4XTCS 4KV6A 1VQGA 3PUYA 4LF5L 3K7AH 2AEHA 5BO4B 1TKGA 5C5MA 1DJRD 3DDCB 5CV7A 2N9XA 1PQSA 1V81A 4DDGD 1PZID 1S3OA 3RLOA 2JRHA 5C4ZA 4XQNA 3G7LA 2H1EA 3BYYB 2PLPA 4IM0A 4FXCA 1EY4A 2NVXH 4BA1I 2DY8A 3DEOA 5AZHA 4HIMA 2ACZB 1QZEA 2J7QB 3GTLB 4X65L 4E3CA 5M5YH 2KZRA 1UGJA 3K5OA 2BGFA 3FRPB 5BN5A 1FXAA 2SAKA 3RT3B 1H9RA 2OTLA 3M63B 4DAYB 4FBJB 4W9CA 4OVVA 1QCBD 1VCBA 5IYBH 3SDZA 3HKZE 1SROA 1VQ9A 4NAMA 2J0JA 1JW9D 3G4SA 2D3GA 4ZRIA 5GMVA 1GAQB 1BQQT 2GBRA 4NXMQ 1T5EA 4BOZB 4HPPA 1SE8A 2KDIA 2G4SA 2DYBA 4QQBX 1WGGA 2ZJDA 1OQYA 3DHHC 4WWMA 1KOTA 2IO2B 4F7ZA 4IUVA 2R2OA 2OTJA 1TKYA 3HOVB 1I4HA 1LO5D 1Y8PB 3A5ZB 4UP9A 4C3JH 1QLBB 2KOXA 4A3MG 1BT0A 1K0SA 4YHHQ 1XYIA 2DUDA 4HMJA 1E7UA 1VQIA 3I5JC 3UIOB 3J81j 1EQQA 1K3BC 4GMVA 1YBYA 4LF6L 5IYDH 2MA9B 5DNFA 1NMGA 2XWBB 4OHJA 2JA5G 2MP2B 1WTXA 2LXKA 1BCPB 3T1HQ 2KBNA 4YTNB 3W3AA 4I7AA 4WQOB 5KEEA 2MCNB 1XCQL 3L13A 3QX1A 2EVBA 2K5WA 2VQFL 5C4JB 1JWBD 1B50A 4MGYE 3TS2A 5CV6A 4LFBL 3OPOA 4BZAA 1P8LA 1DCZA 1HRJA 1L2NA 3ZDTA 3PO3H 1AEXA 1SLJA 2EYPA 2NZHA 4DR2L 1R4MB 5C5LA 3CPFA 4DAYA 1JOOA 2DAJA 4W9FA 4L5TA 1NI3A 3S14H 1BKBA 1EEFD 3HKSA 1GG3A 3CCJA 3QIJA 1DOYA 1S4ZA 1STEA 3Q23A 4KY7A 4XC2A 3PMFA 1HR0L 3OWFA 4DR3Q 1PLFA 4PNYA 1JJGA 2IX0A 5I9OA 3VYRA 2HCCA 1B53A 1QUQB 5JJZA 1L6UA 3EUB2 3TEZA 5CV5A 4DHJD 2D3BA 2C9OA 5IWAL 2FIDA 4C3IB 3I4NH 4A3GH 2KCCA 3Q0AA 1YJIA 1WYDA 3VDZA 1SN8A 1T9HA 4XYOA 4ZAIA 2K9XA 1QVCA 3DEPA 1V2YA 4KDLB 3ABVB 4WWPA 5C3WA 4BOSC 2O2VA 3FVQA 3W5OA 2Z9HA 2PNHA 3A0JA 4GKKQ 2X8XX 1JROA 3H94A 3DWQA 4A4IA 1V5TA 3P4RB 5GROA 1KLGD 2NMQA 1PFNA 1ZW7A 2WXPA 2J7ZA 1A3UA 1WR6E 3CCLA 1C1YB 1SEBD 4KVGB 5E7NA 2YTYA 3NVVA 3RD4A 1ZDXA 3PVLA 4FHJA 1ENFA 2L83A 2WWZA 1HZCA 1J6QA 3ZYYX 3DBLB 3HIZA 1PRTB 3A4RA 1HR0W 2E75C 4R8IA 5CBEE 2ZCCA 1C9FA 2DNEA 4M1UB 1T0RC 3VUYA 4DFAA 3IAYA 3JSVA 5EE3A 3HM3A 3K5NA 1SNCA 2D2CC 3I7FA 1QWYA 3TRZA 1FFVA 1FM0D 2KJHB 3UDXA 1EIGA 2UU9Q 2NVUI 1K83B 2W9NA 1C4QA 1U4RA 3OG5A 4K7SA 4PS8A 5G3LD 1N60A 3Q8FA 3PHWB 1EQRA 3HOXB 1L2FA 3NELA 1B9MA 4AYBE 2D07B 3KWLA 1EUJA 4OO1I 4C4VA 4DR5Q 4AUQC 3S1RH 2LGYA 3LWUA 3NY5A 3Q8CA 4KLKA 3VR2A 2W54A 3VYSA 4IFDG 2X38A 3T1YL 2KUMA 5C3XA 4AOFA 4RM8A 2JA6B 1SNOA 3S17H 4BBNC 1FRRA 1PTOH 4KTAA 4GLVB 3UIPB 1K8MA 3S1QB 2I5LX 3HUIA 4DR1L 3WALA 3DVNV 4NKLA 3ITPA 3EROA 4LNKA 2B8FA 4IPGA 4KJNA 4JI5L 2KEDA 1WD1A 3U4VA 1K51A 1V1QA 2GVBA 2PW9A 3MAQA 5A2QE 1HTQA 1G91A 5J3BA 1B1ZA 3OTOL 4C3JG 3K58A 2BQQA 1QF6A 1JB7A 3RZDH 3CWIA 4C7YA 3A55A 4DV6L 4H7BA 4WWOA 4RF1A 3X3NA 1AZQA 4DUYQ 4NMZA 2I2YA 1LXDA 2LFIA 3L16A 3GTQB 2A6HC 4LW1A 3GZNB 4IJLA 1A62A 3DM3A 4JX1C 4BY7H 3ENEA 4OGQC 4LNOA 1GB1A 3IFDA 3K57A 3HOZB 3K7AB 1FL0A 4RFBA 3R3OA 5IGGA 3S1NB 4CKCA 3CW2C 3P4SB 2B2TA 4EKUA 5LMUQ 1EY8A 2Y0SG 4A3JG 1SYCA 5EE0A 3KH0A 3GS2A 3PV0A 1JQ4A 1HHVA 2KWDA 1KABA 1WX7A 4DR6Q 2F3WA 3J81i 1YITA 4FF1A 3HGBA 1L0YB 2ZNVC 4CJ2C 3I63C 4RMFA 2Q8IB 5IP7G 3M3YH 3E0JA 4JI8Q 3I72A 1EWIA 2CVRA 3UDGA 2GVAA 5IGBA 4A3LH 1PH9A 3TQYA 2KK8A 1J7CA 3AULA 1NR2A 3K9OB 2KX0A 4KZ0A 3RZFA 3KBGA 1J19A 4KSKC 2F52A 1XQQA 2G3QB 4OX9L 1LUZA 3SGIA 1F9JA 3L17A 4A3EG 4PS3A 4EZJA 1TJEA 3HHMA 3OIQA 3NHHA 4OWWB 4BY1G 5JH5C 2HHHQ 1LTGD 3KUCB 3M4PA 4NJ6A 1G2TA 1GO3E 5JXVA 5I6WA 2MJ3A 5E3FA 4DK6C 2N3SA 1DONA 2IO1B 4GNXA 3RNEC 2YV5A 2EKEC 2E74C 3R2IA 2L15A 4C3IG 2NUCA 4HAEA 4GSWA 3TCAA 1I94Q 1QQRA 4LF8Q 2LWPA 1WTQA 3UE0A 3HZXA 4X3TA 3A33B 1KF6B 4X64Q 1V9JA 4I6LB 1G291 3DVNU 4TQ0A 2F0LA 4IOAA 1FEHA 3STBC 1MSGA 3C0RB 4IUMB 2M0AA 1RTOA 5D2MB 2K32A 1WGDA 2R7ZG 3BS1A 1PH7A 3JAML 1AYFA 2V9HA 3BWUD 1O80A 2L76A 4TMAB 2ON8A 2NYZD 2C5CA 4E71A 3I56A 1JWSD 1HZBA 3I8ZA 1Z7TA 4KMUC 5C4XG 1LV9A 2DJGC 5L83A 1CZWA 2F0JA 3W1SA 4WJOA 2EY5A 4ZKBB 2A68C 1EYAA 4YY3Q 2D11A 1PFMA 3PIOA 3R3MA 3AEAB 5C3EG 5IIFA 2YLMA 5M5WB 2KYWA 1UH6A 4V0BA 4DR4L 2EMTA 4IQZA 4A3CG 2Z6KC 4MGKE 4C1NI 4HJKA 1OXSC 2BA0A 1NSNS 4GLXA 2H89B 3PO2B 1JWAD 4GDLA 4LJOB 5HG2A 1VQJA 2WLBA 1LTID 4LWCA 4LCDE 2WDTB 2KCTA 2YYZA 2ZPNA 3NG0A 2L3ZA 3T9LA 4DQOC 3FKIB 4K6LA 4BBSH 4AWJA 4JYAL 1N6ZA 1R4QB 3IT6B 3ERQA 2C7MB 3T13A 3F1ZA 4H44C 1C3TA 2JVCA 2CW0C 2M00A 1XMQQ 1L5PA 3CCSA 1XT9B 5AUKA 1BUIC 4HLEA 2D0PA 3OW2A 2UWQA 3R8BA 5M5XH 2F0DA 3QHTA 3NEMA 3W1SC 4GS3A 1K3RA 3CKIB 1GPXA 1Q46A 3VYUA 4EQ5A 2INNE 3SHLA 5IP9H 1RDPD 2OWOA 1E8WA 2K6DB 1KHIA 3AE1B 3AE7B 2UUAL 4BBNF 2JQOA 2A8VA 5AEKB 1UBIA 4BBSG 4CBVA 3KYCD 2QILA 4HTHA 4WFN3 3NBIA 1C8CA 1QNUA 3VR5A 1YHQA 2BOSA 4XT3B 2B3GA 3ND8A 2UXBL 2E2DC 1S1QB 3AU7A 2AWTA 2J0KA 4O2DA 1LM0A 1CMXB 5D7GA 3S1RB 1YN4A 4LF7L 4K6DA 3S1MB 2YU9B 3GTOB 1H4RA 1VQFA 3K80C 4NDXA 1QJOA 4HSPA 4JYAQ 2L0FA 4XGAB 4ASWC 4QL5A 4AJWA 1U9RA 3HOWB 2KXJA 2Z4IA 1PTOD 2KDBA 4ID6A 1RLFA 2REXA 3EN2A 4HJ9A 1A8VA 3B1LX 2QCZA 3H3VC 3L08A 5J2RA 1TTNA 3WAMA 4RG1A 4H0LC 4A3IG 3EBEA 4A9AA 3PUZA 1V9PA 1XD3B 2C7NB 3AH7A 3U58A 1EWCA 2IGHA 1SE3A 5IGFA 1HQMC 4BA2I 3S2DH 1Y1VH 2JA6G 2FMCA 3NWSA 4YY3L 4MGIE 4DPGA 2KHJA 2HT1A 1G6JA 4MM3A 2BDNA 4BY1B 4KHPQ 5T8IA 4IPHA 3FMCA 2ZW0A 1C77A 3TZDA 2VUMH 3Q6SA 1WTRA 4KV2A 2F0QA 2KN4A 5EPJA 1LTAD 2R7ZH 3S2HB 3W5VB 1TT2A 1WFQA 1D3ZA 4R4TA 2VXWA 4A3IH 3ICEA 1PYSB 4DXFA 4KZCA 4B9KA 4A3FB 4K3CA 2X6GA 2MUYA 2ZJPA 1WJNA 2VNUD 1WWTA 2DLBA 1CT1D 2IX1A 1ML0D 5EDSA 3VYTA 1I50B 1X65A 4TQ1A 1N36L 3RN5A 4QUCA 4AJYB 4GZYC 1JR0D 2ES2A 3A5UA 3IG3A 1XLPA 4ZUJA 4DA2A 1PH4A 2NPTB 1ZKOA 4LUZA 4C00A 1WJ6A 1TWGH 2SDFA 1ZGUB 2I46A 1C78A 4A90A 1QOFA 1P98A 2EJMA 2N9EB 4NNJB 2CKHB 3Q69A 3PSEB 2R61A 3ZIMA 1EY6A 3X23A 2NN6I 3L0OA 2B2YC 1I42A 1LT6D 2BA1A 2F0TA 3M4YA 3TREA 1WE7A 2BT6A 4KGSA 1BF4A 1STHA 4MSQB 2FMMA 1SYBA 1VRAB 2J53A 4W9KA 1F52A 2NVQH 1P3QU 4G4KA 2RDGA 5BYQA 4JPBW 2WNMA 4HEA1 4RGNA 2DNFA 2ATWA 1B9RA 1K8OA 2JXMB 2NB0A 3C1EA 1HNWL 1P0RA 4ARCA 1SJHD 2XNAC 2DZMA 4IM2A 2B63B 1AP0A 1EY7A 3MXPA 4GXBA 2Q8RE 2K75A 4GU2A 3L7ZC 1TIFA 2CU1A 4DUZQ 2G9DA 1VQHA 2GRIA 2HIXA 2HUGA 4S17A 1JJ2A 1SNPA 2BKFA 1HA6A 2EIFA 1TT5B 3CQZH 4ICVA 1K28A 2DY7A 1F2ZA 1CA6A 1RWSA 3RNAC 4DV6Q 1VMPA 4S3SA 1SSOA 3ALBA 4DN4M 3QK0A 3UDFA 4MELA 2RQXA 4A3MB 4JWUC 4XQQA 2CKZB 3EFCA 2DJFC 1EWYC 1YNTE 2QEXA 3M4OB 3CPWA 4IWOA 3ZNHB 4JGHB 1DGJA 4BVUC 3F2UA 4NP5A 2BPSA 2ZZPB 1VZ8A 4A93G 2AL3A 1V5OA 2QF7A 4CJ0B 4L5RC 3ZW3A 5KNDA 1TWAH 1ET9A 3G71A 1NE3A 1RJTA 4LNNA 1N36Q 2K05A 4KX6B 1MJCA 4I7ZC 3BJUA 3Q8DA 4J15A 3L3OC 2GB1A 1JB3A 1VQ5A 1R4MI 2EY2A 4YCVA 3T1YQ 4AIMA 2YTVA 3H0GB 1ZXIA 2LJ5A 3NE5B 3KFUA 4A3JH 1HJPA 2AWNA 3A8KE 2VRRB 2MGSA 1I6VC 4IN3A 2G1EA 4LNFA 1E10A 2IGDA 4JG2A 1DZ1A 2WDRB 1VCIA 2NTSA 1YJWA 3GB1A 4MHEA 5EKIA 3J7A5 4GN4B 3KK7A 1IHZA 2K33A 4QY7A 3R66C 4PYUA 1VZ6A 3MHZA 4KHPL 1EOTA 4DV2L 1GC6A 5E6OA 3TEHB 2VUMG 4K5WA 1NYQA 1VQAA 4GLSC 4C4VB 1XEEA 1VF5C 1YNJD 3KLSX 1ISNA 4KSLC 4A3EH 4A75A 1AARA 2KHSA 4C2MB 3KF8A 2UYZB 2DGYA 3B6YA 2AYOB 2PVGC 3JAME 1QZHA 5M5YB 2K1BA 2MJEA 2F0EA 2WXQA 5CTRC 3MC0B 3MVVA 2NN6H 5C44G 1R4NB 2MBOA 4DNTB 2G45B 4G57A 3DBHI 2E2JB 3PZDA 4ANWA 5IP4D 5DLQE 2WXOA 3KYDD 2EE1A 3AU4A 1ZXTA 5DM73 1PRTC 2JA8H 4TRDA 4PMBA 1WCMH 3U2SC 3IRBA 2B8GA 2IPKD 4LF7Q 4NY0A 5JOBA 1N63A 1XLNA 1CQVA 2XK5A 5C4HA 5GQOA 1Z47A 3JAMi 1CKMA 1CTMA 4DV7L 4K5VA 3J81E 4AQYL 1JE4A 1WYWB 5HY6A 4K7UA 4N58A 1RIPA 1TVXA 2I5HA 5IWAQ 3NUCA 1MJEA 1OGWA 2E2HB 3APCA 3TEXA 3GQBA 2BS4B 2E6XA 3VRBB 3VRAB 5ELEA 1K52A 3V2TA 2WX0A 3AE6B 2NN6G 2KTFA 2OEDA 2Q5WD 3CD6A 1ET6A 1PTOC 2WXHA 3KOJA 4KHVA 3A9JA 3DHIC 5BMIA 4RHRA 1ZOYB 4DR2Q 1JRPA 4FULA 4HRSA 3S2HH 1TWFH 2I1KA 1Y1VG 1B44D 1BNZA 1ZKHA 2GI9A 4R3DA 4EUTA 1PFBA 2WU2B 2E76C 3NENA 1F9RA 3K5LA 2LGDA 1N62A 3URYA 4HJAA 3FPPA 3IBEA 2NZOA 1K73C 1Y14B 2IL8A 2FCMA 4KY5A 3DXJC 3P4PB 1TY0A 3IL8A 3UI2A 4X62L 2KCNA 2R93H 3K0XA 3B0AA 2AMCB 5L95C 4U68A 3MHBA 1XX8A 3ND9A 3ZNGC 4DV3Q 1B2TA 1S5CD 3KJPA 2Y5CA 5IY0A 4GDKB 1A3TA 5DPTA 2LY7A 5KYIA 3IAM1 3JYUA 4ACFA 3NVZA 2F0HA 1PH8A 1WXAA 1XPRA 3W1GA 3A4SC 1U4PA 4ZLTF 1KDCA 3C8YA 4BKSA 1FPYA 2KENA 4WJPA 2FE8A 3DM1A 2BWFA 1CZGA 1DOXA 1E7ZA 4W9LA 3I3TB 1WH3A 3E56A 2BYTA 4US9A 4XDXA 5DCNA 5C2TB 4CYEA 4M00A 2Q2UA 2R2QA 3MC8A 3VH3B 5LMNL 1HEZE 1IBXB 1XMOQ 2WDQB 1EL0A 3ULPA 4BBRH 3S15H 2D0OA 3KLWA 3W1BA 4QCLA 2D9UA 4YSZB 2B2UC 5BYSA 2M9VA 5E1FA 5C3EB 4ODGA 2XEWA 4KIKB 4G50A 2M19A 4RCNA 1I94L 3I91A 4B3RQ 2MLBA 4R4OA 2KD0A 1FNVA 4X66Q 2GBMA 3PUWA 3MXGA 4DV5L 1U4LA 5ELNA 2MP1A 2DNCA 3PO2G 2N4FA 4POFA 1SNMA 2FUG1 4FJYA 1Q8IA 1DXMA 1Y8NB 3HOWG 1LT4D 1HQRD 4CHKA 3PRZA 4CDFC 3SE0A 1Z5SB 3QAQA 3WIMA 3TP7A 1I3QH 1QUQA 2F0NA 3CMEA 2KLCA 2CR5A 2UUCQ 2B29A 3AU5A 4LDTB 2PPBC 4MT5A 1WGKA 3U8ZA 3I3CA 1QB5D 2F4VL 3NOBA 5E6PA 5JEAG 4L5QA 1ENCA 3MFGA 2JWZA 1JICA 3ERSX 2JA7H 1X1MA 1UEBA 3NS8A 3PHXB 4GB9A 2F0PA 2WXRA 4F88A 3GTLH 3I4MH 1L0WA 2JPHA 5C0XI 3JAMc 3H91A 3M85A 4II2B 4NQLB 1BCPC 1WJ4A 2KLGA 1D7QA 1HTPA 4DNRB 2BYEA 1IL8A 1LABA 2BCOA 1IYUA 5J1ZA 3FAHA 5TSSA 3FPUB 4KKTA 1ZP0B 1IBKL 4FF3A 2KDEB 3N30A 2NBFA 3ULLA 4DUYL 3SR1A 4KKJA 1AZPA 2BE5C 1SNDA 1T0QC 1A0IA 3H15A 4GKJQ 2C60A 1QOGA 2BWES 2BYVE 3S1NH 4REZA 1M90C 1TWCH 1BCPD 1WTVA 2N9PC 1OXTA 2VW9A 1S40A 2KMCA 4DV4L 2R93G 4DR1Q 5JPNC 1GKHA 5COYA 4JV5Q 1F77A 1JRUA 2HDEA 2LVPA 3PZ7A 3Q3OC 4JWSC 4EZLA 4OWTB 5FK9C 4XIGS 4MACA 4HIDA 3J80L 3EGRA 3FKYA 2JT4B 5G3LF 3T56B 4MSMB 2D3CA 1B9NA 5T1IA 1STAA 4NPSA 2ZXPA 1Q5WB 5LL6X 3PRMB 1TGZB
chains in the Genus database with same CATH topology
5HURA 2LKVA 1I4RA 4C80A 4QF4A 4XXEA 1I6HB 4ZRQA 1HFGA 5EKKA 2I07B 2WP9B 1CI3M 1CK1A 3H8HA 4YTPB 3VA5A 4CQNA 3HRZC 1IYVA 1N5XA 2EXZA 1E0ZA 1LACA 2LFNA 2L52A 4RGOS 1ZYRD 1BMLC 3J81L 4D2KA 4C56C 4AS1A 1RFKA 4IOIE 5IT9L 3Q22A 1PRTD 3AMUA 3E5SA 4XE0A 4DU9A 2OT2A 4ZK9B 3HS0C 4HJGE 2F0OA 1IGDA 1ZYRC 3C1FA 1NENB 1RCVD 2LGIA 5LHY1 5A35A 2B2YA 2EOTA 3TN2A 5HGTA 2FHTA 1DYQA 4IFDI 1ONLA 1UWMA 1TS5A 1IKLA 1QILA 3C3LA 5MPOA 1KDBA 2ZXRA 3NTHA 2F0FA 2PZTA 2WP8J 3LYYA 4IURA 2B2WC 2WKCA 2JXTA 3QOLA 1S5FD 1DM0B 2A6HD 1A70A 1RHPA 2AQ1B 4A8XC 1JCKB 3S17B 1HXYD 1TZOA 2V4DA 2Q8TA 4USAA 3EJIA 1HUMA 2K01A 5KNBA 4MH8A 1PXUA 2F1MA 1D2BA 5KNCA 2N9LA 1E0BA 5C4XB 2K03A 3FEWX 2B2WA 4RF0A 3SEBA 3HVDA 2EYHA 3NVWA 1GHJA 3D4RA 1O7YA 2F0KA 4IALA 4OZBA 1L6VA 1K53A 2JYEA 1YQ3B 1HUNA 4UDUC 2VZKD 4WURA 1EYDA 2CQAA 4HCEA 1H9KA 3P42A 2HCIA 4OVZA 2IX3A 5EKLA 3NBHA 3IFTA 3NSWA 1WTWA 4H2AA 5I2YA 2DWQA 3NVYA 1SE2A 1GUWA 3MP9A 2KDMA 1N5WA 2CHBD 1RTNA 2PVOD 2BDOA 3I9V1 5M5XB 4HCSA 4WIPA 5CGKA 4NJCA 1XCTL 1B3AA 1F0ZA 5ELBA 1S5ED 3ZJUA 1EFID 1YJJA 1U4MA 1F2MA 2EYLA 4CJ1B 4FP5D 5KGUA 5CYUA 4FF4A 2LMCB 2RA4A 2OEOA 1TWGB 2K5QA 4LAAA 3T4AC 5K36H 4KGRA 2KVMA 3NQIA 1L4ZB 2K0PA 1Y1WB 3P4QB 1SYEA 2QEJC 2JU6X 5H92C 4PT5A 3J7AF 5CR3A 4P2CB 4C3HB 1FGBD 3QG1A 3NRZA 1TY2A 4L1BA 4QIWB 2ZT9C 1GOZA 4DXGA 2WIIB 5IODA 4FXGC 3TP5A 1ZUD2 2KAJA 3SVMA 4B0EA 4KHZA 1CHPD 2JYTA 4N9TA 4K8JA 5M3FB 1BO0A 2MEKA 3MXUA 3B2FA 3FILA 3AEFB 1J7AA 4QUFA 1WRIA 3PIP3 2QDBA 5NUCA 2XRQD 2Z8LA 5EJWA 3PO3B 3U4EG 5CORA 3NK9A 1LTRD 4RGTA 3U7ZA 1PMRA 4BWGB 2L0CA 3AB5A 1V43A 2L11A 1PRTF 1IKMA 2QMTA 4QB4A 4WORA 2WDVB 1D5XC 4KN4C 1YN5A 3B9JA 3NXWA 1JMLA 2WXFA 1GHKA 3O13A 4K5XA 2RVLA 4OZAA 5AFWA 2AUKA 4OL7A 3MFYA 1EY5A 4JPSA 5CMDA 3G6JB 2N55A 1TIID 2AWOA 3VQIA 2F0IA 2K6AA 1FCCC 5C0XJ 2QJLA 3LXFA 4DGZA 1TKWB 4PQXA 2FJ2A 1C48A 1A2UA 5D3IB 2HDMA 5C0XH 1KH0A 2W3SA 3AEGB 2SNMA 3VR8B 2EYFA 2L4NA 3A8JE 5BYRA 1SYDA 1HZ6A 4XQJA 2NWGA 4E6IA 2R7ZB 2RSOA 2JWUA 1YNND 4U673 1UEAB 4J3OD 4A3IB 2LHEA 1WXQA 1TKEA 2LJIA 1KAAA 2AUJD 2QSDA 5T1GA 3K0YA 4YSYB 2R3ZA 1IUEA 2G9HD 3J80E 5CBAE 1R4PB 4ZUIA 3GP7A 1C4PA 1Y8OB 3NPPA 1NR4A 2O2LD 1WTPA 3H09A 3LX0A 3SK4A 2DYMA 4K2KA 3C2PA 5ELFA 1Y56A 3SK6A 3FDTA 3LB8C 1SYFA 3EA6A 3I70A 2PQEA 2V3PA 3SR6A 4A3DB 4CHTB 3TBIB 1NCVA 1OXUA 1FCLA 1RODA 2WB1B 4ARIA 5JVH3 3P75A 2L1BA 3RUZA 2WXJA 3M3YB 2WXIA 2MH7A 2RDHA 1SIJA 2JA8B 2K04A 5I9PA 2BB5A 1IW7D 1T3QA 3KLSA 3DWGC 1JALA 4WJWA 3ZJTA 1Z6HA 2PCFB 3NTIA 4FXKC 5JEAJ 1FMAD 3ETRA 3DWPA 2K5PA 3OW7A 4ZRPA 3DWAA 2WAQB 2CJOA 4A3GB 4C3HG 3KQ4A 4DK0A 1TWFB 5I6YA 3RMHA 3I73A 2K5DA 1VR9A 1UWXA 2TSSA 4LMQD 2NVTB 4YSXB 2JEAI 4DK1A 4L63B 5EGTA 2X6LA 1F2LA 2J42A 1C4CA 2WXMA 2PO4A 2MJDA 4ULLA 2FFKB 3BDOA 1HPCA 2VZKB 2PTLA 3AE2B 3QB3A 4F8MA 1ZEQX 3W2DA 2VB2X 3D4DA 1TS2A 2QKIC 4X3KA 1IBXA 2WS3B 1D5MC 4DF7A 4N9PA 1CQFA 1PTOB 4WH4A 2NVXB 2D5GA 3NS1A 4OZCA 1VJKA 4BBSB 4IUTA 4PMWA 5C3JB 3OIPA 1SXTA 3MEHA 5FR3A 1TWHB 1AFPA 4B9XA 3K59A 4WAFA 5E4XA 4F7XA 1TWCB 2MJ8A 2KECA 5BMGA 3J7YW 1MHXA 2EZVA 1GXDC 1O7ZA 1V1OA 2F03A 5KRUA 4LTUA 1BUVT 1D6EC 2SEBD 2BS3B 1LT3D 1E6EB 3OMCA 5LNK1 1W6JA 1UAPA 1ZPSA 3NUHB 3IXSA 1FRDA 3A7AB 1I4XA 2WXKA 1LTTD 4M8AA 1STYA 1Q10A 1JQYD 4G7ZC 3U9SA 5DEHA 1JOQA 5C6AA 1NVID 2YEPB 1TQOA 2PW7A 1PZJD 1G2SA 2B2VA 1FNUA 2PW5A 3P20A 3SFDB 1GUOA 1ICWA 3T51B 1YMHE 4IUPA 4PMCA 4Y7NB 5EQ0A 3Q8EA 3AE4B 4KN7C 1A6XA 2LEKA 3AE8B 3B2GA 4BY7B 5EE9A 4TSSA 5DM63 3AEBB 3VR3A 3I57A 2JQRB 1HA5A 2A74C 4KK7A 4TKOB 4HROA 1PDXA 1EY9A 2GA4B 1Q12A 4OW0A 1SF0A 3J9CA 2DN8A 1HZ5A 5E6JA 2J0TD 2AQ2B 3KLRA 3QWNA 1WVLA 1MI2A 3QO2A 3OSOA 2PZUA 1VF7A 5JVG3 4X3SA 2KJXA 1OXXK 1GUTA 2PMZB 1ESRA 3AV8A 3PUXA 1ZE3D 1XLOA 4V190 2F4IA 3S9WA 1FR3A 3D6WA 2WU5B 4RNAA 4BBRB 2N0SB 4P16A 4ZQ3A 3RFZB 5IGDA 3DWMA 1OXVA 2D5DA 2A6ED 3A8IE 1PYWD 2R6GA 2XIWA 4KD3A 1FFUA 2A5HA 2KACA 4XYQA 4XT1B 2OXPA 1DD2A 1STGA 4NW2A 2N9KA 4DAVA 1KFYB 3RPFC 2A69C 2AQ3B 1WSPA 3W9CB 4ZOHC 1Q90A 1WTOA 4EGVA 4JE3B 3GV6A 1L0VB 1RD9D 3ONAB 3T3OA 2INPE 3A56A 1RM6C 2CU3A 3Q8BA 3A7LA 1P7FA 3DUZA 1ROEA 3BYTB 1QOBA 2O4XA 3D8GA 3N6RA 5KIXA 4A3BB 1EZ8A 1MSHA 2VUMB 4RHSA 1LT5D 3D3RA 4KGTA 1KNEA 1RF2D 1XXGA 4RAUC 2PYKA 5EPKA 2NVQB 1DOIA 2ON8A 1P7EA 2O5JC 1A15A 3T16A 4R8NA 1O78A 2F0SA 4OIKA 1Y1VB 4AQ7A 1E2ZA 5IT9E 1MBYA 5HHDG 3MWYW 3BDCA 2BS2B 1EIHA 1SJED 3NQTA 2FINB 4Z9CB 2K28A 1XLQA 4XDCA 1N61A 1D5ZC 1V8CA 2F0VA 3AE3B 4KI0A 2WXGA 3AB9A 4IFDJ 4OO1G 2KEEA 1I4PA 2CJNA 2W3RA 1BR9A 3R93A 1E2WA 1T6BX 1NEKB 2KA7A 4A3KB 1PGBA 1TS4A 1TWAB 3FC4A 2EYMA 2A69D 2IDYA 3S2DB 1QG7A 1VZ7A 1TR5A 1B4OA 1QE6A 1EWHA 4H13C 5F2DA 4IDIA 1V1PA 1HFNA 2ID0A 1X3QA 2XN9C 5CV8A 3LNNA 2R93B 2RPVA 1WD0A 2D62A 1J7BA 4JK1C 3A54A 4LJZC 5G5GA 5JPMC 2L32A 4RH6A 4C1NK 3L9AX 4ZHPA 3P63A 2EY6A 2RKSA 3CRLC 3CQZB 1MI0A 1EY0A 2RSNA 1EEID 1ZXHA 3TSSA 3K5MA 3J7AV 3KBXA 5JEAH 5GXGB 2NTTA 4CKBA 1BOSA 4L6TB 3WDNA 1WCMB 1MPEA 2M2LA 4KY6A 1D4BA 2ICIA 4OIJA 2JSOA 1BCPF 1FD6A 1HTLD 4QMGA 2RDFA 1CFMA 3FILB 1SFOB 1YNJC 4FXDA 1X32A 1SDFA 4US8A 2EELA 3HG9A 5FO8B 3D4WA 4IUQA 1OFFA 4C3JB 3AE5B 1SSNA 4EQNA 3ZQ4A 2YEPF 2KOLA 4IFDH 2QCPX 5CV4A 3M7GA 3BK1A 2EPBA 4HKQA 4AYBB 1PZKD 3M7NA 3VR4A 2ENBA 1JWUD 3RZOB 2JA5B 3L4PA 4RKLA 4HMIA 1R9TB 4A3EB 3WCQA 1J9OA 2JA7B 3TP6A 1FO4A 2TMPA 1EU4A 3I4MB 3S14B 3IKJA 5CV9A 1I4QA 2M56B 1PUTA 1I4GA 4JBWA 4IUUA 5K5PA 3GTJB 3OOCA 2V0GA 1RKNA 2FBWB 4FNFA 2JP1A 2ZXOA 1MGSA 4A3JB 1G8ZD 4A6QA 5H8YE 4L2YA 3Q8AA 3OWEB 3R2TA 3TZUA 5K36G 1MVKA 5ELCA 2HTME 3GO5A 5FLXL 1PTOF 2XVSA 2L1AA 2EDGA 2Y0SB 2BBCA 2WKDA 3PO0A 1FIQA 2NVYB 1BBXC 4Q0FA 3CHBD 1QOHA 4L23A 1EM7A 3DMUA 3GD7A 1IW7C 3NTKA 2B2VC 4N59A 3U52E 3TMEA 2W55A 2F0MA 1GUGA 5J39A 1XTCD 1J8IA 3MTSA 2BE5D 2WINB 1I3QB 4TQUS 1IGCA 2PIAA 3EQLC 3SK5A 3VR6A 5HFYA 1PFDA 1RYJA 4ILWA 4ZRZA 3HP3A 2OF1A 1A2TA 3CRKC 1OQQA 1F9QA 1II3A 1L0XB 3S15B 4EVOA 3TUOA 2VB3X 3NP8A 4ITKA 5LL6S 1D1IA 3I4NB 3HOYB 1H9JA 3PUVA 2LS01 4YT0B 3AMZA 4K8IA 3IAS1 1SAPA 1Q3LA 1SNQA 5BMHA 3WOEA 1GUSA 2WQYB 1KRHA 1V97A 1MHHE 1PGAA 1SMYC 5EE1A 1H9SB 2PNRC 5D14A 1R7SA 5D65A 3TDQA 1L4DB 4K2LA 1GJXA 1EQVA 1LLRD 4MN3A 3MA2B 4G7OC 3TEYA 1OO9B 2MHVA 2BTEA 2K7VA 3HVZA 5FO7B 5AUIA 1FYCA 2Z1CA 4DAPA 1MD2D 1SMYD 1ACCA 1SYGA 3C46A 1I7HA 4ZYSA 1PGXA 1WYGA 1KLUD 4HR7B 3AEDB 2B39A 5ISRA 5D3DA 1C79A 2IW3A 3T3NA 4C7ZA 1SBBB 2KMMA 5DAUA 5A2QL 4CGYB 2B76B 1NYRA 1EU3A 4B9WA 4Q2JA 1E2VA 1H9SA 3PZ8A 1F2YA 2IWHA 1JORA 2IGGA 3N9YC 1E7PB 1XWEA 4EQPA 4IUNA 4MIUA 1X3PA 2ONQA 1DOLA 2IT1A 4X3UA 2H88B 2XRSD 3SXHA 3IT4B 4YTMB 4J8QA 4O1NA 2HDLA 4ZKCB 3GTGB 1S5BD 4B0MA 1FD7D 4B08A 4YXDB 2DBYA 3V05A 4KKIA 2F3VA 1VDVA 4EE2A 5IGEA 1FNWA 4RGMA 1CA5A 4LK1C 2H4OA 1TYGB 5KYLA 3SK8A 5M9OA 2I38A 4HN7A 5FOBB 3W5UB 1HCZA 2LMCA 3HKZB 2L9HA 1OQRA 3I90A 3BIID 3X3MA 5G5HA 2JEBI 1NUCA 1YQ4B 1BXTA 2A73B 4LLGM 1TU2B 2R92B 2K22A 1VDZA 5I4DA 1JC7A 3D31A 1G6ZA 2ICEC 5EBDA 3U9OA 4IKGA 1S5DD 4J6HA 5E4WC 4RKBA 5BN3A 4A93B 1XO3A 3VA7A 2E3TA 2WV6D 1T5XD 1H9MA 4HEDA 1EQTA 1DOMA 1C76A 2RMMA 3GTMB 3V96A 1F2RI 1QKZA 1QOAA 5FKAC 4F87A 1V1PB 4XWWA 3QJYA 2ZW1A 1VLBA 3N52A 1AWDA 1C4AA 3P1MA 4NAWB 1STBA 4K14A 1LTBD 3BZDB 2JZPA 5FO9B 1AN8A 2F0GA 2PKOA 3Q24A 4OO1H 1CJEA 3H6MA 5EBCA 3P7JA 1Q1BA 5C44B 2WXNA 1TS3A 2EJFC 2BW2A 1QNKA 3E6ZX 2Y5PA 1NAPA 1GB4A 3P1HA 2JX5A 3K6OA 1ENAA 2J52A 3MJ5A 1CZPA 3LWEA 3VR9B 3AECB 5HI1A 2DYOA 1UUPA 3NZ3A 3EVQA 4ZHOA 2XWJB 5IOCA 5CC4A 4KJOA 3CIRB 4IZ8A 4XDDA 3QOJA 1A3VA 1ILPA 1UNSA 1SB3C 1KDAA 1D1KA 2EYOA 2B2TC 4O42A 3ZGZA 1F9SA 4LK0M 2WXLA 4FF2A 4ABNA 1ESFA 3BVMA 4Q5VA 4RCOA 3DHQA 4WRDA 2LUMA 4A55A 3KWVA 2JSVX 4XWTA 1EZ6A 1PDQA 1SE4A 2N88A 4RWSC 3TP8A 2SOBA 3V3XA 4UAIA 2O5IC 3D6CA 1M8AA 1KNAA 1KTKA 3HRDD 2J4XA 2SNSA 5C0XG 1E9MA 3BVZA 3CU7A 2F0WA 4WQMA 1AW7A 4NZLB 2EKIA 2X69A 1YN3A 2N7JA 3GTPB 2Y3AA 2F0UA 4KKUA 4BS9A 2A6EC 2EYJA 2L5TA 3RLFA 2L55A 1CM9A 2CW0D 1ILQA 1W6KA 2MPMA 2XSCA 2OHFA 4YIJA 4EQOA 3E9SA 4G7HC 2EJGC 4KKSA 3NWTA 3GV3A 5IGCA 1Y69U 1QT9A 3WOFA 4FO2A 1GUNA 4KD4A 3BK2A 4HKZE 4J1MA 2WACA 2PMVA 3AEEB 4L8JA 2V4IB 3MZ5A 1STNA 3OHXC 2IJ0A 3T53B 4CKEA 4FYDA 2Z4HA 4GDLB 3OMGA 3ZJVA 3S16B 2JE6I 2PZWA 2V3NA 1M4VA 3GTKB 3BDLA 2E2IB 2W82A 4M0WA 2BB6A 1CHQD 3EFXD 4R9WA 3TEWA 1XF5L 3QIAA 2KQ4X 1EYCA 4I65A 1FXIA 1VMCA 2B2UA 2JYOA 2KQ3A 4P6VF 4YWGG 3KUPA 3SFEB 1JOKA 5M3MB 3PIO3 1O7LA 4ME5A 3HOUB 1F2RC 1ZDVA 5JAVA 1BDOA 2HQEA 2QIEB 2L12A 5J22A 1V8QA 1Q1EA 1DOKA 1F9PA 1K50A 5FLXE 2EY1A 2K3UA 3AE9B 4RA8A 2AX5A 4HSVA 3UI3A 2A68D 1YNNC 1LTSD 5BN4A 5EPLA 3MXNA 5I2XA 3AN1A 3HEJA 3BG3A 3I4LA 3RZDB 4PV1C 5ELDA 4FVMA 3AM9A 4N6EB 3BVGA 2RBMA 2NZ1D 1JWMD 2LHDA 4MM3B 4XTCS 4KV6A 3PUYA 1TKGA 5C5MA 1DJRD 5CV7A 1PZID 5C4ZA 4XQNA 3G7LA 2H1EA 3BYYB 2PLPA 4FXCA 1EY4A 4BA1I 2DY8A 3DEOA 2ACZB 3GTLB 1UGJA 3K5OA 3FRPB 5BN5A 1FXAA 2SAKA 1H9RA 1QCBD 3SDZA 4NAMA 1JW9D 1GAQB 1BQQT 1T5EA 4WWMA 4IUVA 1TKYA 3HOVB 1I4HA 1LO5D 1Y8PB 1QLBB 1XYIA 4HMJA 5DNFA 2XWBB 4OHJA 1WTXA 1BCPB 4YTNB 3W3AA 5KEEA 1XCQL 2EVBA 2K5WA 5C4JB 1JWBD 1B50A 5CV6A 3OPOA 1DCZA 1HRJA 1AEXA 2EYPA 5C5LA 4DAYA 1JOOA 1NI3A 1EEFD 1DOYA 1S4ZA 1STEA 3Q23A 4KY7A 3PMFA 3OWFA 1PLFA 4PNYA 2IX0A 5I9OA 3VYRA 2HCCA 1B53A 5JJZA 1L6UA 3EUB2 3TEZA 5CV5A 2C9OA 4C3IB 2KCCA 3Q0AA 1YJIA 4XYOA 4ZAIA 2K9XA 3DEPA 3ABVB 5C3WA 3FVQA 1JROA 3H94A 3DWQA 3P4RB 1KLGD 2NMQA 1PFNA 2WXPA 2J7ZA 1A3UA 1SEBD 3NVVA 3RD4A 1ZDXA 1ENFA 2L83A 3ZYYX 1PRTB 2E75C 4R8IA 5CBEE 1C9FA 2DNEA 4M1UB 4DFAA 3IAYA 5EE3A 3K5NA 1SNCA 2D2CC 1QWYA 1FFVA 1FM0D 1EIGA 1K83B 1C4QA 1U4RA 5G3LD 1N60A 3Q8FA 3HOXB 3KWLA 1B9MA 4OO1I 3LWUA 3Q8CA 3VR2A 2W54A 3VYSA 4IFDG 2X38A 2KUMA 5C3XA 2JA6B 1SNOA 1FRRA 1PTOH 4KTAA 1K8MA 3S1QB 3HUIA 4NKLA 3ITPA 3EROA 1WD1A 2B8FA 4KJNA 2KEDA 1K51A 2PW9A 3MAQA 5A2QE 1G91A 3K58A 1B1ZA 4C3JG 3CWIA 4C7YA 3A55A 4H7BA 4RF1A 3X3NA 1AZQA 4NMZA 2I2YA 2LFIA 3GTQB 2A6HC 4JX1C 4OGQC 1GB1A 3IFDA 3K57A 3HOZB 3K7AB 4RFBA 3R3OA 5IGGA 3S1NB 4CKCA 3P4SB 2B2TA 1EY8A 1SYCA 5EE0A 3GS2A 3PV0A 1JQ4A 1HHVA 2KWDA 1KABA 1QF6A 2F3WA 4FF1A 3HGBA 1L0YB 4CJ2C 2Q8IB 3E0JA 3I72A 2CVRA 5IGBA 1J7CA 1NR2A 3KBGA 1TJEA 3OIQA 3NHHA 1LTGD 1G2TA 5JXVA 5I6WA 2MJ3A 5E3FA 1DONA 2E74C 3R2IA 4C3IG 2NUCA 4HAEA 1QQRA 1WTQA 3HZXA 4X3TA 1KF6B 1G291 4TQ0A 2F0LA 1FEHA 1MSGA 2M0AA 1RTOA 2K32A 3BS1A 3JAML 1AYFA 3BWUD 1O80A 4TMAB 2NYZD 2C5CA 1JWSD 3I8ZA 1Z7TA 4KMUC 1LV9A 1CZWA 2F0JA 3W1SA 2EY5A 4ZKBB 2A68C 1EYAA 1PFMA 3AEAB 5IIFA 5M5WB 4V0BA 4IQZA 4C1NI 1OXSC 2BA0A 1NSNS 1IBXB 2H89B 3PO2B 1JWAD 5HG2A 2WLBA 1LTID 2YYZA 4DQOC 3FKIB 4K6LA 1R4QB 3IT6B 3ERQA 3T13A 4H44C 2CW0C 2M00A 1L5PA 5AUKA 1BUIC 3R8BA 2F0DA 3CKIB 1GPXA 3VYUA 2INNE 3SHLA 1RDPD 3AE1B 3AE7B 4CBVA 2QILA 4HTHA 4WFN3 3NBIA 1C8CA 3VR5A 1QNUA 5C2TB 2BOSA 4XT3B 3ND8A 2E2DC 3AU7A 5D7GA 3S1RB 1YN4A 4K6DA 3S1MB 2YU9B 3GTOB 4NDXA 1QJOA 4HSPA 1U9RA 3HOWB 2Z4IA 1PTOD 4ID6A 3H3VC 4H0LC 4A9AA 3PUZA 3AH7A 1EWCA 2IGHA 1SE3A 5IGFA 1HQMC 4BA2I 2FMCA 3NWSA 2BDNA 4BY1B 5T8IA 3FMCA 2ZW0A 1C77A 3TZDA 3Q6SA 1WTRA 2F0QA 2KN4A 5EPJA 1LTAD 3S2HB 3W5VB 1TT2A 2VXWA 4DXFA 4A3FB 2X6GA 2MUYA 2VNUD 1WWTA 2DLBA 1CT1D 2IX1A 1ML0D 3VYTA 1I50B 4TQ1A 4QUCA 4GZYC 1JR0D 1XLPA 4ZUJA 4DA2A 1ZKOA 2SDFA 2I46A 1C78A 4A90A 1QOFA 2EJMA 3Q69A 2R61A 1EY6A 2NN6I 2B2YC 1LT6D 2BA1A 2F0TA 3M4YA 2BT6A 4KGSA 1BF4A 1STHA 2FMMA 1SYBA 1VRAB 2J53A 4G4KA 2RDGA 5BYQA 2WNMA 4HEA1 4RGNA 1B9RA 1K8OA 2JXMB 2NB0A 3C1EA 4ARCA 1SJHD 2XNAC 2B63B 1AP0A 1EY7A 3MXPA 2Q8RE 3L7ZC 2G9DA 2GRIA 2HUGA 1SNPA 1HA6A 2DY7A 1F2ZA 1CA6A 1RWSA 1VMPA 4S3SA 1SSOA 4DN4M 2RQXA 4A3MB 4JWUC 4XQQA 1YNTE 1EWYC 3M4OB 1DGJA 3F2UA 4NP5A 1VZ8A 2QF7A 4CJ0B 5KNDA 1ET9A 1RJTA 2K05A 4KX6B 4I7ZC 3L3OC 2GB1A 1JB3A 2EY2A 3H0GB 1ZXIA 3NE5B 2AWNA 3A8KE 2MGSA 1I6VC 4IN3A 2G1EA 1E10A 2IGDA 1DZ1A 2WDRB 1VCIA 2NTSA 3GB1A 4MHEA 5EKIA 3KK7A 1IHZA 2K33A 1VZ6A 3MHZA 1EOTA 4K5WA 1NYQA 4GLSC 1XEEA 1VF5C 1YNJD 3KLSX 2KHSA 4C2MB 3KF8A 2PVGC 3JAME 5M5YB 2K1BA 2MJEA 2F0EA 2WXQA 3MC0B 3MVVA 2NN6H 4DNTB 4G57A 2E2JB 2WXOA 2EE1A 1ZXTA 5DM73 1PRTC 4TRDA 4PMBA 3U2SC 2B8GA 2IPKD 5JOBA 1N63A 1XLNA 1CQVA 5C4HA 1Z47A 1CTMA 4K5VA 3J81E 4N58A 1JE4A 1TVXA 3NUCA 2E2HB 3TEXA 3VRBB 3GQBA 2BS4B 2E6XA 3VRAB 5ELEA 1K52A 3V2TA 3AE6B 2NN6G 2OEDA 2Q5WD 1ET6A 1PTOC 2WXHA 4KHVA 5BMIA 4RHRA 1ZOYB 1JRPA 4HRSA 1B44D 1BNZA 2GI9A 4R3DA 1PFBA 2WU2B 2E76C 1F9RA 3K5LA 1N62A 3URYA 3FPPA 2IL8A 4KY5A 3DXJC 3P4PB 1TY0A 3IL8A 3UI2A 2KCNA 4U68A 3MHBA 1XX8A 3ND9A 1B2TA 1S5CD 2Y5CA 4GDKB 1A3TA 2LY7A 5KYIA 3IAM1 3NVZA 2F0HA 1U4PA 4ZLTF 1KDCA 3C8YA 2FE8A 3DM1A 1CZGA 1DOXA 3E56A 2BYTA 4US9A 4XDXA 1HEZE 2WDQB 1EL0A 4QCLA 2D9UA 4YSZB 2B2UC 5BYSA 2M9VA 5E1FA 5C3EB 4ODGA 2M19A 4RCNA 3I91A 1FNVA 3PUWA 3MXGA 1U4LA 2MP1A 2DNCA