1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
1V1PA 1EU4A 1DJRD 5ELFA 3DWQA 1LTID 1LT3D 2O2LD 1LT6D 3EA6A 5I4DA 3R2IA 3BVMA 5ELEA 3BYYB 1SJED 3URYA 1BXTA 2RDHA 3V05A 1PTOD 1V1PB 1M4VA 1LTRD 1S5ED 4RGMA 1XTCD 1LLRD 2XRQD 4Z9CB 1GOZA 1D6EC 2WV6D 2CHBD 1KTKA 1JWUD 3TSSA 3R8BA 1BCPD 4O1NA 3BYTB 1PRTD 1LTTD 1AW7A 4OHJA 1LTAD 1PTOH 4RH6A 1JWSD 1TS2A 1RCVD 1D5MC 1TS3A 1SBBB 5ELDA 2XRSD 3CHBD 4RGNA 3BVGA 1ET9A 1EU3A 2XN9C 2G9HD 1FNWA 1HQRD 3DWAA 2RDGA 1STEA 1SJHD 1UNSA 2QILA 1BCPC 1PZJD 1SEBD 1ET6A 4DXFA 1PZID 1ESFA 3SEBA 3EFXD 1LO5D 2NTSA 1FGBD 1D5XC 1PTOC 1HTLD 1JR0D 2IPKD 1S5FD 1L0YB 1FD7D 1PTOB 1QILA 5ELBA 1XXGA 1LTGD 2XNAC 1I4RA 4NZLB 2AQ2B 4L6TB 4L63B 4ZYSA 1CQVA 1YN3A 1G8ZD 3O13A 1PRTF 1JWMD 1F77A 4RHRA 1CK1A 1I4HA 4C56C 1AN8A 1L0XB 1PTOF 2IJ0A 2R61A 1B44D 1S5DD 1TS4A 4K6LA 1BCPF 2AQ1B 3BVZA 1JCKB 1PRTB 2TSSA 5FKAC 2ICIA 1EFID 5TSSA 1LT5D 1TY2A 3BZDB 1CHQD 1FNUA 4RCOA 3GP7A 1I4XA 1YN5A 5D3IB 1LTSD 1KLUD 3KLSX 4RGTA 1JQYD 1BCPB 1B1ZA 3W2DA 1ENFA 1SE2A 3R2TA 3DWPA 1DYQA 5ELCA 2NTTA 3MFGA 5D3DA 1SXTA 1TS5A 2J4XA 1HA5A 4RGOS 1SE4A 1UUPA 1EWCA 1D5ZC 1SE3A 1YN4A 1CHPD 1I4PA 1I4QA 2AQ3B 1PZKD 1FNVA 1HXYD 2QEJC 1EEFD 1MD2D 1S5CD 4TSSA 1PYWD 1LT4D 1S5BD 2SEBD 4RFBA 1LTBD 1EEID 4RHSA 5FK9C 2Z8LA 1TY0A 1V1OA 4BWGB 1KLGD 1T5XD 3MC0B 1CT1D 1RD9D 3OWEB 1RF2D 4DXGA 1I4GA 1PRTC 1RDPD 4UDUC
chains in the Genus database with same CATH superfamily
1DJRD 2QC8A 1PUTA 1VQAA 3VUWA 2D5DA 5CV4A 4B08A 3AEVA 1SJED 3QOLA 2KOXA 3NBHB 2L52A 5C0XJ 1LTRD 4DAYA 2NN6G 4ZHPA 2NVTH 2E76C 2A74C 1STAA 2WV6D 3F2BA 2IY5B 4P7IA 3X0WA 3JVZX 3UQAA 1JWUD 1BT0A 2ID0A 3TSSA 2RCFA 4O1NA 4LUVA 1X1MA 4RNAA 4NB3A 4H7BA 3LYYA 1GPXA 2F0SA 1PTOH 2HIVA 4JV5L 4A3GH 4GGQA 4W9DA 1WJ6A 2JA8B 3BDCA 3KBGA 2R7ZB 1I6HB 4RM9A 3MVVA 3FEWX 1R4NI 1M94A 3VVWB 2W82A 2B29A 4IFDI 2D11A 2J52A 4AQYQ 4GOPC 4TUUA 2MBBB 1I5FA 2NCNA 2N1WA 3KF8A 1P16A 2IL8A 3MJ5A 1W6KA 2WXNA 1VQCA 1H9SA 2HDLA 2JQOA 3ZJYC 1EL0A 2JU6X 4RF0A 2LXAA 2Z59B 5DPTA 2OWOA 2YTYA 2IX3A 1LM8B 3EGRA 4WQOB 3DMUA 2RR9A 5M5XH 5IKCM 4LNQA 1GD7A 3T1HQ 1JORA 3AMZA 2UU7A 1QILA 4IJLA 4UP7A 4OO1G 1F0ZA 2WKCA 1H9KA 1S1QB 2L3ZA 5IO9A 3E9HA 1IBLQ 4MGIE 5EE3A 3HEJA 3HVDA 1D7QA 2C7HA 3KWVA 1VQGA 4A3CH 4JIOU 4OEMB 1XWEA 1GM5A 1F9PA 4EKUA 3KK7A 3U4VA 4C56C 3H0GH 1S40A 2L1BA 5JOBA 3VTVA 1EUVB 4ZRQA 2UUBL 4B3RL 3KUZA 3EBEA 2OTLA 3R3MA 2PCFB 4A93G 2N9XA 1B7YB 5DPWA 4A3DH 3DXJC 2A1AA 1C4PA 3DQVA 4II3B 3F8TA 5LL6X 3GTPB 1WE7A 2JEAI 1U4RA 3VR6A 1XO3A 1SNCA 2VQFL 2V4IB 2VW9A 4WWNA 4YTPB 3BS1A 4AQ7A 1I3QH 1SDFA 4LF4Q 1T6BX 3MHSD 1KABA 4C80A 5C23A 2QDLA 4X3KA 3W2DA 1A2TA 5IYBH 1TWGH 2F4VL 1F9QA 4GKKL 1ACCA 2E8GA 1WM3A 4GN1A 2KZRA 3I3CA 5D3DA 3ZRCA 5IYDG 4BBNF 1O80A 4FHKA 3LXFA 4HPLB 4M8MA 2JEBI 3L16A 5I6YA 1NVID 4EEWA 1DOLA 2ALYB 1D5ZC 2H4OA 3E3XA 2Z0EB 1NJIC 4F8CB 1EYAA 2KNBA 3AE2B 2Q2HA 4W9FA 4TSSA 3QJZA 1PYWD 4DR4L 2LSSA 1OXTA 3AFQA 2J7QB 3R7RA 3NS8A 3GTMH 4JOIC 1MIUA 3GS2A 5D7GA 3VR9B 3E9IA 3JW0X 4TMAB 1T5XD 4GKKQ 5LNK1 1RD9D 5G5HA 3PLUA 3ZXVA 4C4VB 3S1QB 2FXQA 1EY4A 1V1PA 1X3FA 1I7HA 2Y5PA 3W9CB 3RZDB 3FKYA 2Z6KA 4C7YA 2B2VC 4OGQC 1CA5A 1NR4A 5EPJA 3J7ZC 3HIZA 2KFKB 4LF8Q 1UBQA 1Y8PB 3BYYB 1C48A 4K1RB 3V05A 2N7JA 3NTIA 2O6VB 1NTGA 3FKIB 1D4BA 1SRUA 1STHA 3PZ8A 1X9NA 3Q23A 3AE9B 1KF6B 4DHJD 3HRZC 5IYBG 2CWPA 1BMLC 4FJZA 1NNXA 2BA0A 1JT8A 1LTAD 4KKJA 3T51B 2M4NA 1UD7A 3QQ8B 1FMAD 1C1YB 1KDAA 2GBRA 5T1GA 1PFBA 2BH2A 3BVGA 4JVZA 1Z6HA 1ET9A 1LUZA 2F0QA 2KHIA 5DPRA 4H2AA 3I70A 3KOJA 1MJEA 1O7LA 1G6ZA 5C0XG 2WXLA 3APDA 2QCZA 4P1CC 4G7OC 5HGTA 3PGZA 2QILA 4ASWC 4A20A 4DQOC 2BB5A 4NXNQ 1EY0A 1QQRA 4WWOA 1XNQQ 1STYA 1QVGA 3K58A 3VRAB 2A6HC 4NW2A 4JK1C 3IL8A 4JE3B 1WR1A 4OELB 1S5FD 5EAYA 3NRZA 1FD7D 1WTVA 4DV1L 1HR0W 1IKMA 4A6QA 4HEA1 3K5OA 1I4RA 2PMVA 1EY9A 2J0TD 3H7PB 3VUXA 4AP4C 5J3BA 2DJGC 2YTXA 2ONQA 2KQ3A 3MWYW 3H6NA 5BMHA 4L63B 4EQPA 1EO6A 3OW2A 2LUEA 2EYOA 2F0KA 3AH7A 4A75A 3T3NA 1HNXL 1LM0A 5C4XB 1PRTF 3HS0C 4GIVA 4KX6B 3N20C 2IJ0A 3NQTA 2L1AA 1SNDA 5FO7B 4WJWA 3TP5A 4CJ2C 5AFWA 5M3MH 2IBIB 2KYWA 1QOFA 3DEOA 4CDFC 1XJVA 5FO8B 2WWZA 1GO3E 4BBRH 2WKDA 4LF6Q 3NK9A 4B3TQ 1HTQA 1C78A 4U68A 1S4ZA 1PFSA 5JJKA 2F3WA 2IYDB 3HKZE 1QWYA 1LT5D 5TSSA 3RLNA 1KIXA 1ONLA 2BE5D 4G7ZC 2NS5A 4ZRIA 4A3KH 2PKOA 2F0FA 1NAPA 4X64L 3DBHB 3ETRA 1B9NA 4M00A 4RG1A 3ZNZB 1QNKA 3MA2B 1SYEA 4DGZA 3J80E 1WXSA 2Y0SE 1IL2A 4BVUC 4XX5A 1P98A 3ONAB 1EYCA 1O78A 2KTRB 3A7AB 1SYBA 4OVZA 2DYBA 4R9WA 1SE4A 4I6PA 1B70B 1CI3M 1EOTA 1OO9B 2CWAA 1YN4A 3C0RB 1QE6A 1IYVA 1SYFA 4WJNA 4E71A 1IBKL 5G2NA 3AMUA 2XVSA 2WXPA 1LT4D 1DGJA 1EY7A 3TP8A 5H1SE 2ZJPA 1YQ3B 4LLGM 3AE3B 1MJDA 1CKMA 5I9PA 1LQBA 3FKIG 4P74A 3PO3G 4IPDA 1CT1D 4K5VA 4A3BH 1TIID 4W9LA 4C1NK 2IGDA 1IZ6A 1EWIA 3HOYG 2C7NB 1FR3A 4L2YA 1AARA 5J1ZA 4DAPA 1SN8A 2VNUD 2ZNVB 5ELEA 3MXNA 5HURA 4HDOA 2CQAA 4IOIE 4JLCA 2RDHA 4ZUJA 3FHWA 4I7ZC 1T9HA 2QF7A 4ZLTF 1Y14B 1UEAB 1XCQL 1VQKA 1PGAA 2FCSA 3AEBB 1T0RC 3HOUB 2LJ5A 4A3MH 4DK1A 1S72A 1WJ4A 2LHDA 2V9HA 5CTRC 3J7YW 2DZMA 2UU9L 4GLVB 3MC9A 1Q82C 2NPTA 4YTMB 1C9FA 3S1RH 5J17A 1FM0D 1X54A 2X6LA 3OIQA 1UH6A 1FRRA 2ZT9C 1L1OA 3LX0A 1YITA 4C3HG 2E5LL 3TZUA 4LF7Q 1IUEA 4RF1A 1HZBA 1TWHH 2LXJA 3G48A 5GAGC 4ZCKA 4G4KA 1XMQL 2RSNA 1MFWA 1U0LA 2F52A 2HCCA 3L9AX 1FPYA 3SDLC 1T0YA 1EF1A 2V3PA 3QWNA 2LVOA 1YHAA 1XTDA 2F3VA 2M56B 2MLBA 1AEXA 1OTRB 5GXGB 1N61A 3HOWG 2KUMA 3NEMA 1P8LA 5IAAC 5CR3A 4PS7A 1PTOC 1Y1WG 3TP7A 1PGXA 1P9DU 2C35B 2K50A 4DV5Q 1ASZA 2N9EB 1C7YA 4HDQA 1QJOA 4JI3L 4DF7A 1N9WA 1U4AA 3D0FA 4KD4A 1E8YA 1QCBD 4TQUS 2HDMA 5IOCA 3E0EA 1KLVA 2KWDA 2A6ED 2Q8RE 1KOTA 2RHSB 3FVQA 2ICEC 4RHRA 2AYOB 2HJ8A 2KXJA 2WS3B 2KC1A 1VQLA 3APCA 4X57B 2F0EA 1I94Q 4C00A 4AUQC 2GBKA 3NZUA 4OZBA 3VDZA 2QJLA 3ZJUA 2KJHB 1S5DD 1GJZA 2WP9B 3S15B 4K6LA 3AN1A 2LFNA 4LF6L 3VH3B 2OQKA 1KRTA 4ID6A 2JE6I 2GI9A 4BKGA 1YJWA 2F0NA 3I4OA 1YOVB 2KTFA 4JI1L 2RVLA 3IBEA 4DDID 5BN3A 2MBEA 2JX5A 1WJUA 1T3QA 4OZAA 1XMOQ 2UUCL 1SSOA 4GOPB 3QK0A 4DV7Q 1MI2A 1E8XA 2WXOA 3ICEA 5JZEB 5C5MA 1CZWA 1N5XA 4N9TA 4JC0A 2PVGC 1D3ZA 1FFVA 1UE7A 2EJFC 2B39A 2NTTA 5GQOA 1UWVA 5JVH3 1KRHA 3GOEA 3J80c 4DAMA 1HFNA 4OIKA 3PRMB 4J1MA 4YCUA 2N7DA 4KZCA 2WDTB 4R4TA 1UUPA 2FHTA 2X69A 3RD4A 3HOXB 2Y5BB 1E2WA 1CHPD 4W9IA 2JP1A 1SFOB 4LNIA 2LFIA 3S14H 2PMZB 1H95A 1GHJA 2DJFC 3GTGB 5FJ8H 5EE1A 3RT3B 4OWWB 1WTXA 3ZTCA 1GUOA 5JXVA 3EIVA 4IJHA 3JAMi 2EKIA 3GTPH 2EYMA 1F2ZA 1F9RA 2A73B 2PE9A 4A3IH 4JI0Q 1ISNA 1H9SB 3KUPA 1IYJB 2JYTA 4IWOA 4C7ZA 5BO4B 4GN4B 1Y1WB 1EU4A 3TEXA 1LT3D 3D4RA 1LT6D 5J2RA 1TXYA 4A3EB 1WXAA 2LXCA 2PE6B 1ZKOA 4ME3A 1MVKA 3GTOB 2I1JA 3AEGB 1M4VA 3R7QA 2PW5A 4W9JA 4G7HC 2M2LA 5C4XG 3ZYYX 4PYZA 1K0SA 2PYKA 1WGHA 2MSED 4JBKA 3HRDD 2XWJB 5JVG3 4M8AA 2LI5A 4ALPA 5BN4A 1F2MA 4RH6A 2ZVOA 1QF6A 2F4IA 1AZQA 3RNEC 2EYPA 5CMDA 3TP6A 1H4RA 1SBBB 4ZUIA 1MKHA 1V9PA 3T3OA 1LGRA 3RNAC 2KHJA 3MXNB 3TDQA 2E2IH 3S15H 2LY7A 1QOBA 1J7BA 4HIKA 1NMFA 3MXGA 1JB7A 3S2HH 5EQ0A 4X6AH 4DV0Q 4A3KG 1WGGA 2INPE 1B4OA 3RPFC 3ZJVA 1N32Q 2KDMA 4A3JB 3I55A 2UYZB 2Y0SB 1ET6A 2JRHA 1F2LA 1OXVA 3JAMc 2M00A 4QAYA 1ESFA 1NR2A 4JV5Q 5KHQA 4APVA 1K52A 4HIMA 1HTLD 2AHOB 4HSPA 1PH7A 3C46A 3PUYA 3QIAA 2MWSB 2L83A 1BUVT 1XXGA 4DR1Q 1KNEA 3VYRA 2JA6B 4YL8A 3T8MA 5IWAQ 2PZTA 4AJWA 2KBNA 2KDBA 1MHWC 3RULA 3PRPB 2LHEA 1C4CA 3ENEA 5J39A 2KHSA 1Q46A 1IBLL 2R2QA 4TVAB 4ZYSA 2XGTA 5FLMH 1DZ1A 4GDLB 4IDIA 4X66Q 2J0KA 2GVAA 2SDFA 2IGHA 4TKNA 2VQFQ 4MGKE 3PGEA 3L4PA 3I9V1 2K01A 2V3SA 4NP5A 2D2CC 4RAUC 1N34L 4Y52H 3BINA 2PZWA 2Z6KC 1IBXB 3L0OA 3NP8A 3KDFA 2NYZD 4FDBA 3AE8B 1TS4A 2JZPA 5JH5C 2LASA 4KHPL 2F0LA 1HNWL 1XYIA 2D2QA 1MSGA 1G6PA 2EY2A 1RTOA 4KY7A 2R92B 1PH6A 2MJ3A 1DCZA 3CF5A 4E3CA 3LDZE 3RNFC 5C0XH 1OEYJ 4HPMB 1T0SC 3TQYA 1V49A 3NVWA 4H0LC 1HH2P 1VZ8A 2KJRA 4KZ0A 1SE2A 4JI7L 4KI0A 1SB3C 4L5QA 3NOBA 1O7YA 2K6AA 1WF9A 1TS5A 5F2DA 1TWCB 3KUCB 4KY6A 3A8KE 4NDXA 3UDFA 1R9TB 4RGOS 3MAQA 3DVNU 4FA6A 4LF7L 4IW0A 3DVNV 1UF0A 4PG3A 1SMXA 2NBFA 2AQ3B 3GTQB 1D8LA 2Z0DB 2I07B 1MD2D 2DY7A 5HHDG 1C8CA 3GV6A 1N8RC 4RFBA 5KNBA 2JRIB 2K4KA 1AYFA 1ZXIA 5JEAG 4DV2Q 4XQJA 4P75A 3PV1A 3TJPA 4WURA 2YU9H 4A3PA 1SF0A 3ML9A 2LGYA 4LWCA 2JSVX 3SU8X 3GD7A 2ZCBA 5EJWA 1B3QA 2LJIA 1PYSB 1VZ7A 1W2BA 1VQDA 2MRPA 2C5CA 4MSQB 4EVOA 4FHJA 4X65L 4X3UA 2PW9A 4KMUC 4LUOA 5DNFA 1XEEA 1AE2A 2N49A 1VQBA 3N6RA 2VUMG 5KNDA 3RD2A 1JICA 5CGKA 1IBMQ 5HG2A 4J15A 3OMGA 4KSLC 3PSIA 1ZGUB 1C77A 3NENA 5DM63 2RCNA 2QDBA 1BF4A 1WGRA 1PYBA 1QG7A 2P5ZX 2B2UA 2D62A 2XRSD 2EYLA 4BKSA 1XD3B 4C4VA 4ODGA 1H9JA 2M17A 5LMUL 4A3JH 3D6CA 1XMOL 2UUCQ 3HOZH 2EXDA 4LJPB 1TKWB 2BKFA 3QO2A 3A74A 4IUTA 4TQ1A 1STEA 3H0GG 2KMCA 4B9KA 4US8A 1K28A 2PPHA 3DCGA 3ZKJC 3SEBA 3E6ZX 3I2ZA 2KX3A 1TVXA 3PQIA 1YHQA 1OFFA 1F2RI 2AMCB 2PMZE 3MFYA 1ILPA 1WRIA 5KYLA 4OXPA 3DBRB 3DHIC 4YY3Q 2BDOA 4IG7B 2O2VA 3CWIA 3HOUH 2Y3AA 1Q86C 3GTKB 1V2YA 2HTME 2INDC 3LJ3A 4LNNA 2NN6I 3DM1A 1GHKA 1AE3A 2OEOA 2VUMB 2OCEA 2K1BA 4BOSC 4DUZL 3L10B 5FR6A 4MIUA 3A4RA 1HNZQ 3RYTA 5GAHC 2HT1A 2B3AA 3W5VB 5DM73 3MTSA 1OEYA 4FLHA 3HOWH 1WD0A 3QB3A 4DV4L 1TWFB 2B63H 1TKEA 5M5WH 2IO1B 2L11A 2KA7A 4K2KA 2C7MB 4L23A 4GDLA 4M8NA 3H6MA 3IRBA 3F2CA 1MG4A 3ABVB 3TIXA 5EGTA 2HDEA 4MELA 1NYRA 1V6EA 2HTHA 4CKBA 4CKEA 4GLXA 4N9PA 1DOIA 1WFYA 3S14B 1PFNA 4HJKA 2ZJDA 3E9SA 4BY1G 1ZDXA 2MHVA 1P3QU 1RL2A 4ANUA 5E7NA 2PQAB 2N9LA 2B2TC 3SFDB 4XZ4A 4X62Q 4AJYB 1AZPA 4XXEA 3TEZA 2R6GA 2BBCA 3P1MA 4JCVE 1K0RA 2IX0A 1N36L 2BKRB 1WX7A 5A2QE 3GQBA 3ULJA 2WQYB 1QZGA 2I1KA 4DBGA 5C3EG 3ZNHB 1S5CD 3S1NH 3SDZA 1BBUA 3S16H 1VQEA 1SE8A 2K75A 3P4RB 5CV9A 2WX0A 5IYCH 2J0MA 5FK9C 3KJPA 4OONA 4EOYA 2QDFA 3S9WA 2Z8LA 1BNZA 2UUBQ 4B3RQ 3S16B 2KWVB 2NPTB 3GZNB 3OWEB 2G1EA 3PIP3 1RF2D 3NPPA 3GDEA 3HOYH 1ZUD2 5JHAA 3TRZA 1NBWA 1PRTC 4FNFA 1ILQA 1V8QA 2F3IA 2DAJA 1YIJA 2PEAA 1SNPA 4A3CG 3W1GA 4AOFA 1LFDA 2GA4B 4MJSB 1IPGA 3H7SA 3I4LA 4OVUA 2EVBA 4IM2A 3FILA 2NWGA 1R4MI 4IM0A 5E6OA 1ZDVA 2KN5A 4Z9CB 5E4XA 1VQHA 3U9OA 5JAVA 1K9MC 3IVFA 1EQRA 1ZW7A 4KY5A 5KGUA 4JOIA 3KLSA 1J19A 1E22A 4R1JA 1IYFA 2MQJA 3CC7A 5LMNW 1EFWA 1DOYA 1D5MC 4JI4L 1Z47A 2R93B 1D2BA 3T9LA 2JXXA 1DOKA 1PDQA 1VQMA 2MUYA 2WLBA 3NWSA 3DBLI 1DONA 3VRBB 2I5MX 5D65A 2PIAA 4OL7A 3QAQA 4II2B 3PF5A 1HZAA 2RDGA 4XC2A 1VD2A 4LMQD 3S1MH 2EYFA 3K0YA 2UXBQ 1BCPC 3JSVA 2PQAA 5C4XH 4IM3A 3PS6A 1JW9D 1KC8C 1FGBD 3LWUA 1P1AA 2AX5A 1VLBA 4GDKA 3I4NB 2WFWA 4LNOA 3CAMA 2MQHA 3J80L 2QCPX 5MPOA 1Q81C 4JI4Q 2KAJA 2INNE 3Q8DA 2RQXA 1Y69U 1B9RA 2A68D 4URKA 3I4NH 1WTOA 4K14A 4MN3A 2V1CC 4IO9A 2FJ2A 3A33B 2VS1A 3N1XC 2EY6A 3CC2A 1WTRA 3H3VH 1WJNA 4I6NB 3UE1A 3S1MB 2CHZA 2H1EA 2V4LA 4JQWC 4L5TA 1L6VA 4FJYA 2PVOD 3Q14C 3D32A 4IFDH 2W3SA 5C6AA 4YWMA 4KGTA 1E7UA 1JCKB 2TSSA 2ZM6Q 3S2DB 3M9BA 4PQXA 4XYCA 2JA8H 1LV9A 1I6HH 2JA9A 1NSNS 2OT2A 1XF5L 4KHVA 4DPGA 4IZ8A 1UWMA 2NB0A 5LHY1 3CMEA 3EFUA 4F87A 4RGTA 3TS2A 3VYUA 4BBNC 2NVTB 1IBML 3W5UB 1WJJA 2MP1A 4YIJA 2KMMA 1N5WA 4KHZA 2E2JH 3KLWA 3SE0A 2O6VD 2J4XA 3Q3OC 5C3XA 1GJXA 4A3GG 2RGFA 1PA6A 3H91A 1I4PA 1X56A 4NAWB 4GOCA 3FP9A 1YMHE 3ULPA 4JI2L 4NY0A 2EJGC 4FYDA 3R93A 1KNAA 1EM7A 1BUIC 3GB1A 4NKLA 1PMRA 2NN6H 5C44B 1ZXHA 2ZPNA 2BDNA 1O7IA 2KWCA 4RHSA 2BQQA 2N55A 4GDKB 3CSTA 2HJ1A 2Z9HA 2JK8A 4WJ3M 1F2RC 3CCRA 1YQ4B 3MJWA 5TR5A 1FL0A 3J7AF 1V81A 1WOCA 4ULLA 2WXJA 3VXWA 1CUKA 2QW7A 1H9RA 1TWFH 2A6HD 2XWBB 4J6HA 5GADC 2B63B 4A3DB 2Q2UA 3F2UA 1FFUA 1RDPD 4FF3A 4DR6L 3M7GA 3PSEB 2WAQB 4OO1H 3UE0A 1YNNC 5CBAE 1RFKA 4ZHOA 3Q8EA 5CHWA 4BY7H 2SOBA 4BXXG 3A9KA 3PUWA 4OW0A 4HCEA 2BH8A 4BBSH 1IGDA 2YTVA 5FLXc 3H94A 1SNOA 2HD3A 4FXGC 1HZ5A 1QKZA 1TJEA 3H9DA 3B1LX 4ZRPA 3D3RA 3EHVA 3HOVH 2D3CA 3NVYA 2NBVB 3P42A 5AZFA 2KX0A 5K36G 2FCMA 2UWQA 3KLRA 3NBHA 4JI5L 4HSVA 3CCJA 3FILB 4A90A 1V86A 2EIFA 4RGNA 4EX5A 3QJYA 4POGA 2JA7B 3BG3A 5IWAL 4B0MA 3C1FA 2RF4A 1EU3A 2XN9C 3BJUA 2IY0B 2FAZA 5IP4D 1FNWA 3VR5A 2EY1A 1K3BC 4FXDA 1YX5B 2KO3A 2MBQA 3X23A 1N33L 1L2FA 2CH4A 4GLAC 4A3MG 4FBJB 4B9WA 4HJ5A 1C79A 2GLSA 4GB9A 1PFMA 1QUQB 2BA1A 1ZXTA 2Q8TA 3BZCA 2C60A 3WAOA 1L1OC 1M1KC 1E0ZA 2R92G 3KF6B 4LK1C 5CORA 5ELBA 1ZKHA 1VZ6A 5H8YE 1ML0D 4HPPA 2D0PA 4PT5A 3TS0A 4MTNA 1JROA 1ZP0B 2VH2A 2K5VA 3FKIH 1B8AA 1G8ZD 2O5JC 2KC2A 4BY7G 4BXXH 3AB9A 1EYGA 3UIPB 3EVQA 4A3BG 2KD0A 4KJNA 3T4AC 5IYCG 2J42A 3HOZB 4F7XA 2PJHA 2KQ7A 3BY4B 2BS2B 3PRZA 4W9HA 4JI8L 1FXIA 1IL8A 3FC4A 1A3VA 2N1VA 3P2BA 2JWUA 4P16A 1CSPA 2R7ZH 1OXUA 4FF4A 1I42A 3GE3C 4KHPQ 2A5HA 3CCLA 4RA8A 2EE1A 5A2QL 4K0KQ 3P4SB 3V6CB 3HOZG 4B9XA 1F9SA 1YN5A 2ENBA 2I5HA 2RSOA 5D3IB 3IG3A 1Y56A 1TQOA 4MEMA 5HY6A 2WXIA 3VTWA 4EZKA 3SHLA 3QARA 2KEDA 3EN2A 1HQMC 3KBXA 4HAEA 3GTOH 4IURA 2ON8A 4LW1A 2RMMA 5IGFA 1HPCA 4DR7L 2K25A 3GTLB 1WM2A 5KIXA 3NY5A 4FP5D 4J6IA 2L12A 3M85A 1IW7C 2B63G 3KVFB 3LWEA 3L3OC 2Z4IA 3VR2A 2AWTA 2QEXA 4MH0E 3SD5A 4YSXB 3P20A 1CA6A 2QEJC 2TMPA 2OF1A 1BBXC 3RFZB 1RFAA 3W1BA 4X65Q 2K04A 4C2MB 4ARIA 1LTBD 4DA2A 4LFAQ 1CZPA 2LUMA 2N9PC 4A93H 4PMCA 2BCOA 2MCNB 1GC7A 2WDQB 1V1OA 3CC4A 1ESRA 4K2LA 1L7YA 2C5LC 1KXLA 2JA7G 1M8AA 5CV7A 1WSPA 4C3HB 1R4NB 1WGDA 4UDUC 1LACA 3CCQA 2O6VA 4LDTB 3P4QB 1HCZA 1VCBA 3L13A 2CU3A 3AV8A 3B9JA 3H0GB 4G0NB 5C5LA 2K6QA 4V0BA 2LGDA 1V1PB 2YV5A 4LF4L 4HN7A 2WXFA 2B2UC 4GKJL 1Q1OA 2M0AA 1LLRD 2NVUI 4RMAA 4MT5A 3DDCB 5IOIA 3FAHA 5FLXL 4BA2I 1ENCA 1N60A 3VYSA 2BGFA 1AW7A 1VQPA 2F0HA 4UPAA 4OWTB 4LF9L 2PI2E 2B76B 1TKYA 3ALBA 1BO0A 4MACA 3MHZA 4GN3B 3X3MA 4DV5L 2VZKB 2WYQA 3RZOB 3Q0AA 5J22A 4IN3A 3A9JB 3DWAA 3L7ZC 3CXCA 1UNSA 2C9OA 4GKJQ 1Y8RC 4HKZE 4JX1C 5C4HA 1P7EA 1YJJA 1V97A 4US9A 1IP9A 3J7A5 1WYDA 4CJ0B 1AH9A 1D5XC 2AWNA 5IN7A 2JUOA 1L0YB 1SGHA 3PUXA 5EE9A 4IALA 4HCPB 1SNQA 3I8ZA 1YNND 4GOPA 4NQLB 3WAMA 1GUNA 2ZJQA 3NVZA 4NAWA 4NNJB 1YN3A 3PLVA 3P1HA 3UI2A 5AEKB 3AULA 2IZVB 2K52A 2SNSA 3KYCD 3MEFA 4WH4A 4DV2L 4HROA 1PVOA 3G4SA 1PQSA 1KHIA 1WYWB 1AN8A 4NJ7A 3GV3A 3D31A 5BN5A 3T1YL 4CO7A 4HVBA 1J5EQ 5D94A 1B44D 5BR8Q 1X3GA 2M0XA 1EZ8A 4RKLA 2N78A 4DUYL 3BK1A 2HE7A 2K5QA 3PIOA 1C4QA 3WWVA 3PIPA 3H1UA 4KVGB 3VUYA 2L00B 4DXAB 4DHJB 3WALA 1VCIA 1NEKB 2MO1A 1YZ6A 3HOVB 3CMMB 2YLMA 5HI1A 2OEDA 1IGCA 4QCLA 1FCCC 4KIKA 3AEAB 4Y7NB 5EDSA 4IUQA 3KDFB 2A5UA 1L4ZB 2QIEB 4MM3A 2XBBC 5ELCA 4R3DA 3OIPA 3UDIA 5M3FB 4GNXB 2AL6A 1EIHA 4YHHQ 4WAAA 4HMJA 4JI1Q 1KQSA 4F88A 4K7SA 1EWCA 1PHJA 3MTNB 4I6LB 2K05A 1N36Q 3M95A 3BK2A 4ITKA 1NI3A 3AE7B 1EWHA 2ZTCA 1EEFD 1K8OA 1U4MA 2BT6A 2SEBD 3QX1A 1UE1A 3KF6A 2EYJA 4ZRKA 4UAIA 2ZNVC 1TY0A 3D8GA 4R8NA 4ZQ3A 1U5KA 3MC0B 4EQ5A 1XLNA 2C9WB 3PIO3 4IOCA 4UP9A 4DXGA 2EMSA 3Q3MC 4P6VF 2YVCA 5IIFA 3PVLA 4WAFA 4DAYB 2CFMA 1QVFA 5FLMG 4LCDE 4A3FB 1YD8U 2FMMA 1KAWA 3DWQA 4LF8L 3P4PB 4MJSA 2L32A 3C19A 2EZVA 3WCQA 3URYA 3M7NA 2ZXRA 2JZ3B 3RZFA 4PZ6A 2M8SA 1SMYD 2CW0C 4CJ1B 2XRQD 2CCZA 2D5GA 2D10A 4EQOA 3DVGY 2BF8B 2XK5A 4QIWE 1BCPD 3IHPC 4HKQA 5E1FA 2KCTA 2WXQA 3B0AA 1TS2A 1Q1EA 5ELDA 4XT1B 3I56A 4WJQA 2EMTA 3H09A 2ZZPB 3CHBD 3M4OH 4HRSA 3SR6A 3PMFA 2KT7A 1K3RA 2B3GA 1LTLA 3EUB2 1F2YA 4DV0L 4POFA 3L2PA 3KYDD 5G55A 2IO3B 4X66L 4DV6L 4A3EG 1HHVA 2M19A 2BPSA 1JMLA 2XK5B 3QR8A 1Z9FA 3EFXD 3APFA 1N6ZA 2WAQG 5T1IA 4PZ8A 1WH3A 5BMIA 1JR0D 1X32A 4ZK9B 2K3UA 1TU2B 2B8GA 1A6XA 4K5XA 4KIKB 3CRLC 5DPSA 4BBRG 3GO5A 3D6WA 4JBWA 4HIDA 2CKHB 3K5LA 1EIYB 2L7RA 1OGWA 1VS0A 5EKKA 2ZJRA 1HZ9A 4M1UB 1MSHA 4AQYL 3AE4B 4N8X1 3IT6B 3A5ZB 2KEEA 1N63A 2WXMA 1Y1VG 5IE8A 2D3AA 1XNRL 3HM3A 4TV3A 1J0GA 4CDCC 1SSNA 1XPRA 4KK7A 4NPNA 2JN4A 4GU2A 5KHOA 1YBYA 2AUKA 3J81L 1UGMA 4DNRB 4P1BC 1Y8NB 5FR3A 1YJ1A 5K5PA 3KH0A 3K9PB 3V96A 2NVQB 4NJ6A 2RPQA 1TWHB 1FYCA 2QSDA 2AWOA 1TY2A 2MJEA 2MW5A 4IKGA 1NCVA 3S1RB 5KYIA 3NBIA 4FN2A 2RA4A 2CJOA 3HP3A 2RPVA 4HJAA 4K81A 4ANWA 4KD3A 3CKIB 3PHWB 1GUAB 5DLQE 4XQQA 2CS4A 3Q8BA 4KV2A 1H8CA 3B6YA 2K0PA 2JYEA 2BOSA 2BWES 2PPBC 1EY5A 4C3IB 3ZNID 3T56B 1U9RA 1XCTL 2BYTA 5JJLA 3QG1A 1FO4A 1PDXA 4KKUA 1IW7D 5E6NA 2KVRA 2FBWB 1PH5A 1SE3A 1HE8A 4YTNB 3ECIA 2WB1E 4H13C 4DV3L 4A3BB 1TGZB 2K14A 1I35A 1S5BD 2LGXA 4TQ0A 3VHTC 3J81j 2CHWA 1HFGA 1EF5A 1BOSA 4PMWA 3PO2B 3SGIA 3PO2H 3ITPA 2WDVB 3VR3A 4OO1I 3DBLB 3OOCA 1II3A 1KLGD 1YX6B 4ZYNA 4BFRA 2M1MA 1E9MA 1NMGA 2A69C 1YNXA 3U7ZA 4UY8C 3TEYA 2Q5WD 3QOJA 2RBMA 4D2KA 3RR5A 3A54A 3K81C 4ZKCB 4CHTB 4KDLB 4USAA 5T8IA 3NJTA 2W9NA 5D2MB 3S24A 2JJQA 2X8XX 1TWAH 4DR4Q 4AYBE 1MG8A 2G4DB 3K80C 3H8HA 1GOZA 2KCNA 1PFDA 1YQBA 2PNHA 1J5EL 5C3WA 4Q0FA 4WJOA 4B3MQ 2R93G 2D3GA 2VY3A 5C4JH 4QQBX 5IYDH 1WWTA 2NR2A 3AXCA 1JWSD 1RCVD 1BBWA 4XYQA 2E2HH 5LXHA 4GLSC 5M5WB 3AM9A 3Q69A 2XIWA 1U4PA 1ICWA 4JYAL 2VQEL 1WX8A 2LVQA 2MNAA 1M90C 3HOWB 4B6WA 1E5WA 1TTNA 3MEHA 1RTNA 3W1YA 1CFMA 1CZGA 4FF1A 4KKSA 1JRUA 1ZPSA 3S17B 1EQTA 4IC7B 1PH4A 2PW7A 2IWHA 3VH4B 2KLCA 1JWAD 4IUNA 3LB8C 3VYTA 5GROA 3G71A 4K5WA 3NZSA 4FULA 3BDOA 1UE5A 2L76A 2NBWB 3ZGZA 3EJIA 5C4JB 2JA6G 3QC8B 4R4OA 2FUHB 3LGJA 4YY3L 3A55A 4NZLB 3KW5B 4L6TB 2MJ8A 3TL5A 3UF8A 1GUWA 2RDBC 4ANVA 2NVXH 2A6EC 2L8JA 3NG0A 3HOUG 5CC4A 2RDFA 4RWSC 4A3LH 4M02A 5AJ3Q 3KQ4A 4O0AA 3CCUA 3QHTA 1O7ZA 1XNRQ 1A70A 1ZYRC 5IGBA 2F0WA 5GAEC 1J7CA 1BDOA 4RM8A 3IFTA 4PV1C 4LF5L 4LNFA 4M01A 2HHHL 3S1QH 1NY4A 5NUCA 2I0QA 2CR5A 3HOYB 4RKBA 1PRTB 3M4OB 2DYOA 2JQRB 3HKSA 1VQ4A 2ICIA 2O4XA 1PLFA 2W54A 4XDDA 4PMBA 3BZDB 3OW7A 1JJ2A 1NBFC 2NVYB 4BAXA 1DXMA 1I4XA 4O2DA 2L5TA 3IXSA 3PPAA 5JEAH 3PTFC 3TUOA 3VR8B 5C44H 2ZW0A 3TEHB 3VR4A 3S1NB 4DUZQ 2ZVNA 5FJ8G 4GN5A 1WI0A 3K57A 1HZ6A 3J81E 1N62A 3DWPA 1WMHA 1R4PB 3I7FA 3U9SA 3CIRB 2N4FA 2WNMA 4OIJA 4QF4A 4R8IA 3G7LA 3Q3NC 1OQQA 2L4NA 4LF5Q 4DK3C 1WE6A 3MZ5A 1SXTA 1XQQA 2H89B 3JAME 3N1ZC 3PZDA 1DOXA 1GAQB 3NTKA 1YIWA 4LUZA 1JOQA 1A3TA 2G9DA 2ACZB 3Q8FA 2JA8G 4REZA 4YWKA 3UINB 4P2CB 5G3LF 4HLEA 1Z2MA 1TWGB 3K0XA 3H3VI 4FVMA 2K6DB 1FNVA 3PHXB 2UXDQ 2NZOA 1WZ0A 3AU7A 1EEID 1GUGA 1B9MA 4LFCL 3RUZA 2L05A 4PZ7A 4XT3B 3FDTA 4A3KB 3I5JC 2KJ6A 2OOBB 1QUQA 1J8IA 2EY5A 1E8WA 2CH4W 3GTQH 2UXCL 3D4DA 3ERSX 2KJXA 1JJCB 3NQIA 4BBRB 1X3PA 5IGGA 1WGYA 4LF9Q 3ND9A 2JVCA 4R4CA 3PV0A 2GBNA 2ZTDA 2G45B 4B0EA 1TWCH 3BVMA 3HKZB 3P75A 1BVSA 1CTMA 1MHHE 3PO2G 1BXTA 2IHEA 2KOLA 1VQFA 4CDDC 3JAML 1HTOA 5CV6A 5CV5A 5IP7G 4ILWA 3IFDA 1PH9A 1GUSA 4JI7Q 1I3QB 5EE0A 1CKNB 3M4QA 5GMVA 1GKHA 3F1ZA 2RD0A 3AU5A 1ASYA 3UQBA 4OHJA 3DOWA 2A68C 3C3LA 2R92H 2WGSA 3VAWA 4JW0A 3M63B 2OXPA 4PYUA 2M9VA 4S3SA 3G6JB 2NVQH 3AEDB 2CQOA 1S3OA 2PZUA 4K8JA 3CQZB 1HQRD 4QJFA 2KCCA 2WXHA 4OZCA 3BIID 3ZIMA 4DR3L 3L0WB 3JC66 1LYLA 1PZJD 2WAQE 1FXAA 2IGGA 2WHIA 5LLIA 1XLQA 3QCAA 1STGA 4Q5VA 2I5LX 2NUCA 3GTKH 3TBIB 2E2HB 4IUVA 3KUDB 2ZXPA 4KN7C 2V4DA 3I91A 2AEHA 2A19A 2IW3A 2JF5A 3EECA 1GG3A 1VDZA 3X3NA 1VQJA 1JRPA 1G2TA 2OHFA 1MGSA 3M4YA 4LFBL 4QIWB 1SAPA 2Y0SG 3FPPA 5JPMC 2FIFA 3O13A 2LGSA 1Y1VB 1E2VA 4A76A 2J0JA 4I65A 4KLKA 1QT9A 1L0XB 1PTOF 1QB5D 1SE9A 3RZDH 4IFDJ 1IYUA 3RNUA 1SLJA 1MJCA 3BU2A 3STBD 3ZW3A 5AZGA 3OMCA 4IUPA 4A9AA 1R4MB 3QIJA 1K83B 3MHBA 1I50B 5FO9B 3BVZA 1YNTE 2KKCA 5J18A 4IPGA 1X3EA 3WANA 3I4MH 2EYHA 4EZLA 3EROA 4JG2A 4KKIA 3ER0A 3CRKC 5M3FG 3M3YH 4X3TA 2LMCA 4MH8A 2DY8A 2ZTEA 2DNEA 2WB1B 1LTSD 2OQ0A 2DYMA 4GNXC 3ZVVA 4YCVA 1JQYD 1BCPB 3N3KB 2KMAA 2LVPA 3U52E 1Q3LA 1KDBA 1AFPA 4MGYE 3T16A 3RNGC 1QOAA 2EKEC 1WCMH 4XTCS 4QL5A 5FLXE 2D3BA 1DD2A 1YVCA 3ND8A 3CCSA 1EY8A 2QA4A 1CKOA 5M5YH 3TREA 4DV4Q 2KLGA 1IXRA 4KV6A 3Q22A 2R7DA 1WZ3A 3DWMA 3PUVA 4C3IH 2MH7A 4G50A 3V61A 1FJGL 1FCLA 3BDLA 4JI2Q 1I4QA 2KCMA 3UI3A 1A5RA 5IGEA 3B2GA 2AUJD 4JI6Q 2Z6BA 1MI0A 3W1SC 3CCEA 3KWLA 4BA1I 4N58A 5LMNL 1XNQL 1J9OA 4WRDA 1L6UA 3Q8AA 3D4WA 3JSVB 1QZHA 1E10A 4ICUA 1EWYC 5HFYA 4A3OA 5ELNA 1I4GA 4EGVA 3GTJB 4JPSA 4B3SL 2G3QB 3I73A 3P63A 1V43A 4F8MA 1VQ5A 2UUAL 2DZIA 4JGHB 2DN8A 2O2LD 5C3JB 3NWTA 4K0KL 3TN2A 1Q90A 4AYBG 4P73A 2K03A 3NELA 1VQIA 1VQ8A 2MBHA 1PTOD 3KJOA 1HNXQ 2KENA 3BWUD 4B95A 3UDXA 3Q6SA 3T1YQ 1K73C 2L9HA 3J81c 4J8QA 1VQ9A 2K22A 3HUIA 1RODA 5KEEA 2OJWA 2MGSA 4JL9A 4C3IG 3ZQ4A 2PI2A 4K7UA 2G9HD 2EOTA 2KHWB 4P71A 1F1HA 2VL6A 1TIFA 1QVCA 3UIOB 1WTWA 5A35A 2K8BA 4HXDA 1WTQA 4PS8A 1NENB 1LO5D 3HKZG 4N59A 1RYJA 5D14A 3AEEB 3RI7C 4YHHL 2PLPA 3AU4A 2K5WA 2E3TA 2AQ2B 4E6IA 1CMXB 1ZEQX 2L15A 3CP0A 2OTJA 2VB3X 3SHQA 2SAKA 1ZE3D 4HIOA 1WXQA 1CQVA 5JHBA 1ROEA 1FD6A 1JOOA 2LS01 4QGUA 2I46A 1AWDA 2F1MA 5CHVC 1YHBA 4K6DA 1Y1WH 3CQZH 4FXCA 1X6OA 1WMHB 1WVLA 4A55A 4OX9L 4BY1H 1Q5WB 2E2IB 1WY8A 2KN4A 2K5NA 5FOBB 4DR7Q 2LZ6A 4G11A 3AFPA 2K33A 1XX8A 3CMAA 1V9JA 3EFCA 2YYZA 3NZ3A 1FNUA 3U58A 2YU9B 4A93B 2O2VB 3ML8A 2XTIA 3V2TA 2BTEA 1UEBA 2N7EA 2B2YC 4DV3Q 4JPBW 4NPSA 3KLSX 2VB2X 2FCNA 3ERQA 1UE6A 4FXKC 3A8JE 4BBSB 1B1ZA 3SK6A 1F9JA 3AEFB 4DK0A 1ENFA 1STNA 3R2TA 1WXMA 3GE8C 4YXDB 4DHZE 1TR5A 2Q2IA 4DU9A 2L55A 2EJMA 2ZXOA 3MFGA 1LXDA 5M3MG 1YJ9A 3A1QA 2F0MA 1JOKA 1S3SG 3OJ3A 3GTLH 5M3FH 3AE1B 1HUMA 3DHQA 4WJ4A 1WCMB 3R66C 4LDTD 3SXHA 4F1SA 4GXBA 1FJGQ 1C0AA 2BS3B 3KFUA 1GXDC 2AL3A 3I3TB 2Z1CA 4QB4A 1C9OA 1E3PA 1HXYD 3FMCA 4EQNA 2HQEA 5CYUA 4A3LG 1PGBA 3H7PA 1XPOA 3JYUA 4J3OD 2KQ4X 3K5MA 3RN9C 1SIFA 1TKGA 2WXKA 4TKOB 1FXTB 4WQMA 1YI2A 4RCNA 1WTPA 3AI5A 1B3AA 2N8NA 1E90A 2UU9Q 1BR9A 2AKWB 2HIXA 1RIPA 4BWGB 5I2YA 1GC6A 2FNJB 1J8CA 4L5RC 3DBSA 3RLOA 4DN4M 4H02A 2JY6A 4AH6A 3A9KB 1A15A 2B2TA 4DNIA 5I4DA 4DAVA 5D6JB 4ZRJA 3IT4B 2PTLA 1Q1BA 3NHEB 5H92C 2HCIA 4LFAL 3NS1A 1L1OB 1OTCA 1HRJA 3PREA 3NTHA 1PH8A 3VA5A 5I6WA 2KDEB 2L0TA 2KACA 3NVVA 4K3BA 1PRTD 1X65A 1H9MA 2E75C 3NXWA 2KWUB 3VQIA 1HTPA 3ZDMC 3U4ZA 1RHPA 1FIQA 3L54A 1JALA 5E4WC 1V8CA 4LTUA 4NXML 3I63C 2D0OA 4DNTB 2E2DC 4AS1A 4MGZE 1FRDA 3U2SC 4ARCA 1EYDA 3SVMA 1Q0WB 3HK0A 3S2HB 5L95C 3H3VC 2D9UA 4QUCA 5AJ3L 3OYYA 3AQQA 1L0VB 3A1QB 5IP7H 1PZID 5AZHA 2MP2A 3S2AA 2NTSA 5C4ZA 3R3OA 3CD6A 5BYRA 5E6JA 1EOVA 2IPKD 4A3DG 1SR3A 2G5DA 5BR8L 3IAM1 4ZOHC 2VH1A 3MC8A 4BZAA 1DGSA 2B8FA 4DR6Q 3Q2AC 4JWUC 1OQRA 2IT1A 3PO3B 2FUG1 2K1FA 3ZUNA 2GOWA 1T5EA 4TRDA 5G5GA 3IKJA 4XIGS 4E74A 1G2SA 2FINB 1Q7YC 3CU7A 1G291 1NUCA 3CPFA 5C3EH 2JPHA 2MA9B 2BYFA 4A8XC 1J6QA 4BBSG 2BE5C 4NJCA 1K8AC 4BY7B 4R4IA 4NXNL 1F77A 1MBYA 4A3EH 2N3SA 4ZAIA 2KTRA 4XWTA 3DPDA 2H88B 4CGYB 1CJEA 2KECA 5EPKA 3DLLA 4OX9Q 4JI0L 2FE8A 4IUMB 2JA7H 4EUTA 1VJKA 4B3TL 3AYHB 3J81i 1UGJA 4C3JH 1YJNA 4DKAC 2MPMA 3DHGC 4MSMB 2DWQA 1VMPA 1EQQA 2O5IC 4M0WA 5BYQA 2I2YA 1TZ1A 4A3JG 3SFEB 3DVGX 3RCZA 2F0JA 3OHXC 1VRAB 1SIJA 4A3MB 1TWAB 2BYEA 1SFOH 4GS3A 4ZRZA 3WOFA 3HOXH 2I38A 2BWFA 1UWXA 1DOMA 1VMCA 3PUZA 3Q24A 4IOAA 4MTKA 2HQLA 4JBMA 1C76A 3V62A 5CX3A 1K50A 3I4MG 4BKSD 1A62A 2QGQA 4IUUA 1A63A 4MZ9A 1P0RA 5IY0A 3Q3JA 4WIPA 3U4EG 1N32L 3K59A 2RHQB 3NE5B 2INCC 3EC8A 2JWZA 2MO0A 3ULLA 1A0IA 2WU5B 2IHFA 3NSWA 3I4MB 2VRRB 3S2DH 2F0GA 4JI8Q 1B50A 2OJRA 1I50H 3TCAA 3ZLZA 4ZKBB 4S17A 3B2FA 4DV1Q 1X55A 4X62L 2K9XA 2ZPYA 3ZTDA 5AUIA 3EA6A 3I4NG 2LRUA 1ICFB 2UXDL 4QMGA 2LD9A 1ENAA 4CKCA 4LFCQ 2K7VA 4HCNB 1PH2A 2E74C 3VDYA 2UXBL 1S5ED 3HGBA 2NVXB 4WWMA 3L17A 3CCMA 4LJOB 2N88A 1KTKA 1C3TA 4UP8A 2QKIC 4DV6Q 3RN2A 3EQLC 2F4VQ 1K8GA 1N34Q 2EDGA 2W55A 3HVZA 4A3FG 3HOXG 4KGRA 1LTTD 2V1YA 2NVYH 1E1OA 1TYGB 2F0UA 1CM9A 2A4ZA 3I57A 4W9KA 3MXUA 2JZZA 3DEPA 3GZNI 2R3ZA 1EIFA 3WIMA 3A0JA 2KVMA 4PNYA 3SR1A 1VQ7A 4A4IA 4JI3Q 4XGAB 2FIDA 4R4QA 5L83A 3T13A 1FVIA 1EIGA 3J80i 1KDCA 2DGYA 4DXFA 2FCQA 2JXTA 3RLFA 4L5SA 1KJTA 2KK8A 1JQ4A 1V1QA 2R93H 2FFKB 2WP8J 3V3XA 4A3IG 1NI2A 4JWSC 4NAMA 3ZJTA 1KFYB 2F0DA 4UHVA 4XQNA 3SK5A 5I9OA 4DR5L 3PO3H 3U7DA 4LK0M 1NYQA 1VR9A 1K51A 4YSZB 5JEAJ 2QHOA 3RMKC 4ABNA 5M9OA 4DR3Q 4ME5A 4LFBQ 2MBOA 1JMCA 4BKTA 2GN5A 5C2TB 1JB3A 1I4HA 2VXWA 2PO4A 4GNXA 3UGBB 2F0TA 1XPUA 2BW2A 1WD1A 4ICVA 3QA8A 4H44C 3K5NA 1WFQA 1HJPA 3RNCC 4KKTA 2ES2A 2N0SB 4K3CA 4XE0A 5FKAC 1EFID 4NMZA 4XDCA 2LMCB 4RCOA 2E6XA 3GTMB 1C4AA 1KAAA 3T53B 1HR0L 3NHHA 1RKNA 2Z4HA 4L8JA 2GMIC 1JE4A 5E3FA 3KYHC 4C1NI 1CQFA 3PT2B 1G6JA 1QOHA 4V190 4RMFA 1WI5A 1DYQA 1STBA 1VF5C 1CSQA 3DBRI 3V60A 5JPNC 4F7ZA 1B53A 3M4PA 5LMNQ 1YEZA 5EKLA 5JJZA 5IT9L 2KDIA 5K36H 3ZO5B 2K5PA 3M62B 5ISRA 4HJ7A 3A56A 1WXVA 2E2JB 3AE6B 1KL9A 1ZYRD 4LNKA 5AUKA 1Z7TA 5KNCA 2GRIA 4X3SA 1T0QC 1DM0B 1F52A 3N30A 4G57A 1SYDA 1E7VA 1TZOA 1GB4A 1PV4A 3H15A 1HR0Q 3C8YA 1Q10A 2XSCA 4YWGG 4QUFA 4GZYC 3OLMD 3ZRFA 2ZEQA 3Q3FA 4GSWA 1L2NA 1E0BA 4N8FA 2GBMA 3SK8A 2WXGA 1QLBB 2EPBA 2NZHA 3K6OA 2HHHQ 1V5OA 4G3XB 4N9F4 4YWLA 1WIAA 2R2OA 1SNMA 3Q6BA 4NQKE 3LNNA 4CHKA 4B3ML 4JI5Q 5EPLA 3PF4A 3A9JA 5IP9G 2K8HA 2LXKA 4KN4C 5M3MB 1JE5A 3OTOL 4DR2L 1LTID 1VQOA 2KFJA 3VA7A 3DBHI 3HHMA 1WGKA 4JI6L 3OPOA 1E7ZA 4X64Q 5G3LD 4JYAQ 2DNFA 5DCNA 1RRBA 3U30A 2L0CA 5IT9E 3M3JA 2DX5B 3WA0A 4KGSA 2MX2A 1GUTA 5IGCA 3N1YC 3C2PA 3FPUB 3R8BA 2WIIB 2DHZA 4AYBB 4WORA 2RKSA 2B2WA 5COYA 3CF6E 4HK2A 4IWPA 3K7UC 2HUGA 2MHJA 2QMTA 2ASBA 1TS3A 2MFIA 3N52A 3K8AA 4AIMA 5IGDA 5M5XB 2R7ZG 1L4DB 2DAFA 4W9GA 4GMVA 2WINB 5BMGA 3AECB 2DENB 1IHZA 1Q8KA 4BY1B 3OTOQ 4DR2Q 4ZDVA 1GNUA 2FMCA 2IDYA 2N9KA 3PO0A 3S17H 3STBC 2LRWA 4KDIC 3W1SA 3NUHB 1A3UA 3CCVA 5BYSA 2GB1A 2VUMH 2F03A 4YSYB 1E1TA 3VFKA 1KH0A 4DDGD 5HKHA 1A8VA 2KVZA 2A69D 1GB1A 2UXCQ 4ANXA 1MHXA 2VZAA 3E0JA 2EELA 1PTOB 2NZ1D 3DWGC 1OQYA 2GVBA 1X3QA 2XNAC 1TBEA 2HD5B 2JA6H 5IP9H 1Q12A 2ATWA 2ZCCA 3U50C 4YT0B 4W9CA 2X38A 3N9YC 3IAS1 2JT4B 1I6VC 5ELOA 1XT9B 1WX9A 4P72A 2CJNA 1N33Q 1OXXK 2VZKD 4LJZC 2JA5G 4EZJA 2V0GA 1TT2A 1LABA 3RZOH 4MM3B 1U4LA 4FO2A 3WAPA 3J7AV 5LXIB 1E8ZA 2J53A 4IPHA 3A8IE 2AQ1B 2JSOA 4QY7A 1IKLA 4B3SQ 5EKIA 1BKBA 1WTHA 1SROA 2UUAQ 4M0WB 4L1BA 2B2WC 2LWPA 1CHQD 2CHXA 4CBVA 3GP7A 4PK1A 2JXMB 2K28A 4XDXA 1NDDA 1KLUD 2Q2TA 4IQZA 3QWZB 5DEHA 4BOZB 1V80A 2ASQA 5C44G 4LAAA 1P7FA 1E6EB 2YEPB 1K8MA 3OSOA 3TEWA 1PH1A 2IY1B 3CSFA 3C1EA 4W9EA 1R9TH 2WACA 4DHZB 5C1ZA 1HNWQ 4A3FH 1YJIA 3OJ4B 1K53A 2CVRA 4K8IA 3NUCA 4U673 1IBKQ 3KF8B 4C3JG 2NMQA 1FGUA 1A2UA 4FJVB 1G91A 2W3RA 1PZKD 1KRSA 3RMHA 1RAXA 4K7WA 3HG9A 4HJGE 3G6EA 3K7AB 1EQVA 2CU1A 2K39A 2WX1A 3WOEA 3BZKA 2JA5H 2MP2B 2IO2B 4C3JB 4KTAA 2BYVE 2L0FA 1Z5SB 4XWWA 1E24A 5JJIA 1B2TA 3HM6X 1YNJC 1L5PA 2CKZB 1JC7A 5CHFA 2XEWA 2D07B 2LGIA 3CPWA 4EFOA 3TBLD 2K32A 4IWQA 1R7SA 5ELFA 5KRUA 2E5LQ 5M5YB 1K8RB 2KFKA 1W6JA 3R2IA 3IAYA 1BQQT 1GVPA 1YNJD 2F0PA 2NBUA 3E56A 4FF2A 2DZJA 4I7AA 3FRPB 3E5SA 4CYEA 4DK5A 4RGMA 1XTCD 1J7AA 3HZXA 4YCWA 1D6EC 3W3AA 1Q8IA 2CHBD 4HTHA 5C3EB 2WB1G 1MPEA 3ZXRA 3N32A 2SNMA 3A7LA 3TMEA 3B08A 3RZWC 3BYTB 3I90A 3P7JA 1V5TA 3M3YB 3V6EB 4DR5Q 2YEPF 3DM3A 4WWPA 2F0IA 4BS9A 1EY6A 3OAWA 3ZDTA 1E2ZA 2ZM6L 3W5OA 1XMQQ 1W3SA 2IX1A 2DZKA 2IO0B 1TT5B 2K8CA 4MDKE 2WDRB 4FADA 3DUZA 5IA7A 1RJTA 4DK6C 5L37A 3RNBC 5CV8A 1G51A 1SJHD 2ZW1A 2EXZA 1SEBD 1SYGA 5HGQA 5C0XI 1PH3A 2MJDA 3HOVG 1Y1VH 2BS4B 2PNRC 3F2DA 2GBJA 1WR6E 2G4SA 4HCSA 3MP9A 3T1HL 1HZCA 4JBJA 4XYOA 1HNZL 1FEHA 1QZEA 3AE5B 4A3GB 4DUYQ 1RLFA 2F0OA 1KM7A 1L0WA 1LTGD 2MEKA 5I2XA 5IT9c 2WU2B 5IODA 5LMUQ 2PQEA 2K5DA 3CW2C 4HJ9A 2VQEQ 3OG5A 3PCOB 1XLPA 3L08A 1JWMD 5LL6S 1RWSA 1CK1A 4DV7L 3SK4A 1I94L 1XLOA 1SYCA 2RSUA 2R61A 4CDEC 1KD1C 2B2VA 3MXPA 2KDFB 3DHHC 1AP0A 2LEKA 1D1IA 2K5HA 5CBEE 4PS3A 4WJPA 3RUIB 4MHEA 3O65B 2KANA 2BVCA 4EE2A 3PZ7A 1BCPF 1R4QB 3A5UA 2DNCA 1QOGA 4Q2JA 3A4SC 2Q8IB 1D1KA 4MNOA 2B2YA 4DWFA 4HR7B 3TZDA 2H5XA 4ACFA 3Q8CA 1E7PB 2V3NA 1HEZE 2WXRA 2A8VA 4KSKC 3K7AH 1RM6C 2REXA 4OWXB 3GTGH 4OVVA 1ZOYB 2R7FA 4HEDA 5EBDA 1IBXA 2F0VA 1UAPA 1HA6A 4CQNA 5DAUA 3UDGA 1WRDB 3WDNA 1VQNA 1HUNA 3J9CA 4S0RA 1WCMG 4WFN3 1HA5A 3RN5A 4HJ8A 4HMIA 2KQSA 4N6EB 4DR1L 3VTUA 1JWBD 3ZNGC 4O42A 4IFDG 3HFZB 2J7ZA 4C3HH 3I72A 4DFAA 3GTJH 3IFWB 4NXMQ 3K9OB 4A3IB 1SMYC 2CW0D 2DBYA 3TMPB 4AWJA 1EZ6A 1VF7A 2DLBA 1PXUA 1OXSC 4Y7NH 4HWIB 1JJGA 1VDVA 2JA5B 2Z0SA 1UZXB 4IPCA 1WYGA 1VQ6A 3OWFA 1UBIA 2BB6A 1Y8OB 1UELA 5E6PA 4C2MH 3ONSA 2JYOA 5EBCA 4KJOA 3U8ZA 1CKNA 1EUJA 3AB5A 1K83H 1NE3A 2LKVA 2X6GA 1QNUA 2Y5CA 2EQSA 2DUDA
chains in the Genus database with same CATH topology
1DJRD 1PUTA 2D5DA 5CV4A 4B08A 1SJED 3QOLA 2L52A 5C0XJ 1LTRD 4DAYA 2NN6G 4ZHPA 2E76C 2A74C 1STAA 2WV6D 1JWUD 2ID0A 3TSSA 4O1NA 4RNAA 3LYYA 4H7BA 1GPXA 2F0SA 1PTOH 2JA8B 3BDCA 3KBGA 2R7ZB 1I6HB 3MVVA 3FEWX 2W82A 4IFDI 2J52A 3KF8A 2IL8A 3MJ5A 1W6KA 2WXNA 1H9SA 2HDLA 1EL0A 2JU6X 4RF0A 2IX3A 3EGRA 3DMUA 1JORA 3AMZA 1QILA 4OO1G 1F0ZA 2WKCA 1H9KA 5EE3A 3HEJA 3HVDA 3KWVA 1XWEA 1F9PA 3KK7A 4C56C 2L1BA 5JOBA 4ZRQA 2PCFB 3DXJC 1C4PA 5LL6X 3GTPB 2JEAI 1U4RA 3VR6A 1XO3A 1SNCA 2V4IB 4YTPB 3BS1A 4AQ7A 1SDFA 1T6BX 1KABA 4X3KA 3W2DA 1A2TA 1F9QA 1ACCA 3I3CA 5D3DA 1O80A 3LXFA 2JEBI 5I6YA 1NVID 1DOLA 1D5ZC 2H4OA 1EYAA 3AE2B 4TSSA 1PYWD 1OXTA 5D7GA 3GS2A 3VR9B 4TMAB 1T5XD 5LNK1 1RD9D 5G5HA 3S1QB 1EY4A 1V1PA 1I7HA 2Y5PA 3W9CB 3RZDB 4C7YA 2B2VC 4OGQC 1CA5A 1NR4A 5EPJA 1Y8PB 3BYYB 1C48A 3V05A 2N7JA 3NTIA 3FKIB 1D4BA 1STHA 3PZ8A 3Q23A 3AE9B 1KF6B 3HRZC 1BMLC 2BA0A 1LTAD 4KKJA 3T51B 1FMAD 1KDAA 5T1GA 1PFBA 3BVGA 1Z6HA 1ET9A 2F0QA 4H2AA 3I70A 1O7LA 1G6ZA 5C0XG 2WXLA 4G7OC 5HGTA 2QILA 4DQOC 2BB5A 1EY0A 1QQRA 1STYA 3K58A 3VRAB 2A6HC 4JK1C 4NW2A 3IL8A 4JE3B 3NRZA 1S5FD 1FD7D 1WTVA 1IKMA 4A6QA 4HEA1 3K5OA 1I4RA 2PMVA 1EY9A 2J0TD 2ONQA 2KQ3A 3MWYW 5BMHA 4L63B 4EQPA 2EYOA 2F0KA 3AH7A 3T3NA 5C4XB 1PRTF 3HS0C 4KX6B 2IJ0A 3NQTA 2L1AA 1SNDA 5FO7B 4WJWA 3TP5A 4CJ2C 5AFWA 3NVYA 3P42A 1QOFA 3DEOA 5FO8B 2WKDA 3NK9A 1C78A 4U68A 1S4ZA 2F3WA 5TSSA 1QWYA 1LT5D 4G7ZC 1ONLA 2BE5D 2PKOA 2F0FA 1NAPA 3ETRA 1B9NA 1QNKA 3MA2B 1SYEA 4DGZA 3J80E 3ONAB 1EYCA 1O78A 3A7AB 1SYBA 4OVZA 4R9WA 1SE4A 1CI3M 1EOTA 1OO9B 1YN4A 1QE6A 1IYVA 1SYFA 3AMUA 2XVSA 2WXPA 1LT4D 1DGJA 1EY7A 3TP8A 1YQ3B 4LLGM 3AE3B 5I9PA 1CT1D 4K5VA 1TIID 4C1NK 2IGDA 1FR3A 4L2YA 5J1ZA 4DAPA 2VNUD 5ELEA 3MXNA 5HURA 2CQAA 4IOIE 2RDHA 4ZUJA 4I7ZC 4ZLTF 2QF7A 1XCQL 3AEBB 1UEAB 4P6VF 1PGAA 3HOUB 4DK1A 2LHDA 3J7YW 4YTMB 1FM0D 2X6LA 3OIQA 1FRRA 2ZT9C 3LX0A 1IUEA 4C3HG 4RF1A 3TZUA 4G4KA 2RSNA 2HCCA 3L9AX 2V3PA 3QWNA 2F3VA 2M56B 1AEXA 5GXGB 1N61A 2KUMA 5CR3A 1PTOC 3TP7A 1PGXA 1QJOA 4DF7A 4KD4A 1QCBD 4TQUS 2HDMA 5IOCA 2KWDA 2A6ED 2Q8RE 3FVQA 2ICEC 4RHRA 2WS3B 2F0EA 4OZBA 2QJLA 3ZJUA 1S5DD 2WP9B 3S15B 4K6LA 3AN1A 2LFNA 4ID6A 2JE6I 2GI9A 2F0NA 2RVLA 5BN3A 2JX5A 4OZAA 1T3QA 1SSOA 1MI2A 2WXOA 5C5MA 1CZWA 1N5XA 4N9TA 2PVGC 1FFVA 2EJFC 2B39A 2NTTA 5JVH3 1KRHA 1HFNA 4OIKA 4J1MA 3HOXB 1UUPA 2FHTA 3RD4A 2X69A 1C9FA 1E2WA 1CHPD 2JP1A 1SFOB 2LFIA 2PMZB 1GHJA 3GTGB 5EE1A 1WTXA 1GUOA 5JXVA 2EKIA 2EYMA 1F2ZA 1F9RA 2A73B 1H9SB 3KUPA 4C7ZA 2JYTA 1Y1WB 1EU4A 3TEXA 1LT3D 3D4RA 1LT6D 4A3EB 1ZKOA 1MVKA 3GTOB 3AEGB 1M4VA 2PW5A 4G7HC 2M2LA 3ZYYX 2PYKA 3HRDD 2XWJB 5JVG3 4M8AA 5BN4A 1F2MA 4RH6A 1QF6A 2F4IA 1AZQA 2EYPA 5CMDA 3TP6A 1SBBB 4ZUIA 3T3OA 3TDQA 2LY7A 1QOBA 1J7BA 3MXGA 5EQ0A 2INPE 1B4OA 3RPFC 3ZJVA 2KDMA 4A3JB 2Y0SB 1ET6A 1F2LA 1OXVA 2M00A 1ESFA 1NR2A 1K52A 1HTLD 4HSPA 3C46A 3PUYA 3QIAA 2L83A 1BUVT 2JA6B 1XXGA 1KNEA 3VYRA 2PZTA 2LHEA 1C4CA 5J39A 2KHSA 4ZYSA 4IDIA 4GDLB 1DZ1A 2SDFA 2IGHA 3L4PA 3I9V1 2K01A 4NP5A 2D2CC 4RAUC 1IBXB 2PZWA 3NP8A 3AE8B 2NYZD 1TS4A 2JZPA 2F0LA 1XYIA 1MSGA 2EY2A 1RTOA 4KY7A 2R92B 2MJ3A 1DCZA 5C0XH 3NVWA 4H0LC 1VZ8A 1SE2A 4KI0A 1SB3C 1O7YA 2K6AA 1TS5A 5F2DA 1TWCB 4KY6A 3A8KE 4NDXA 1R9TB 4RGOS 3MAQA 2NBFA 2AQ3B 3GTQB 2I07B 1MD2D 2DY7A 5HHDG 1C8CA 3GV6A 4RFBA 5KNBA 1AYFA 1ZXIA 5JEAG 4XQJA 4WURA 1SF0A 2JSVX 3GD7A 5EJWA 2LJIA 1VZ7A 2C5CA 4EVOA 4X3UA 2PW9A 4KMUC 5DNFA 1XEEA 3N6RA 5KNDA 1JICA 5CGKA 5HG2A 3OMGA 1C77A 5DM63 2QDBA 1BF4A 1QG7A 2B2UA 2D62A 2XRSD 2EYLA 4ODGA 1H9JA 3D6CA 1TKWB 4TQ1A 3QO2A 4IUTA 1STEA 4US8A 3SEBA 3E6ZX 1TVXA 1OFFA 1F2RI 1ILPA 3MFYA 1WRIA 5KYLA 2BDOA 3CWIA 2Y3AA 3GTKB 2HTME 2NN6I 3DM1A 1GHKA 2OEOA 2VUMB 2K1BA 4MIUA 3W5VB 5DM73 3MTSA 1WD0A 3QB3A 1TWFB 1TKEA 2L11A 2KA7A 4K2KA 4L23A 3H6MA 3ABVB 5EGTA 2HDEA 1NYRA 4CKBA 4CKEA 1DOIA 4N9PA 3S14B 1PFNA 3E9SA 1ZDXA 2MHVA 2N9LA 2B2TC 3SFDB 1AZPA 4XXEA 3TEZA 2R6GA 2BBCA 3P1MA 2IX0A 5A2QE 3GQBA 2WQYB 1S5CD 3SDZA 3P4RB 5CV9A 5FK9C 3S9WA 2Z8LA 1BNZA 3S16B 3OWEB 2G1EA 3PIP3 1RF2D 3NPPA 1ZUD2 1PRTC 4FNFA 1V8QA 1ILQA 1SNPA 2GA4B 3I4LA 2EVBA 3FILA 2NWGA 1ZDVA 4Z9CB 5E4XA 3U9OA 5JAVA 4KY5A 5KGUA 3KLSA 1DOYA 1D5MC 1Z47A 2R93B 1D2BA 1DOKA 1PDQA 2WLBA 2MUYA 3NWSA 1DONA 3VRBB 5D65A 2PIAA 4OL7A 2RDGA 4LMQD 2EYFA 3K0YA 1BCPC 1JW9D 1FGBD 3LWUA 2AX5A 1VLBA 3I4NB 3J80L 2QCPX 5MPOA 2KAJA 2INNE 2RQXA 1Y69U 1B9RA 2A68D 1WTOA 4K14A 4MN3A 2FJ2A 2EY6A 1WTRA 3S1MB 2H1EA 1L6VA 2PVOD 4IFDH 2W3SA 5C6AA 4KGTA 1JCKB 2TSSA 3S2DB 4PQXA 1LV9A 1NSNS 2OT2A 1XF5L 4KHVA 4IZ8A 1UWMA 2NB0A 5LHY1 4F87A 4RGTA 3VYUA 2NVTB 3W5UB 2MP1A 4YIJA 2KMMA 1N5WA 4KHZA 3SE0A 2J4XA 5C3XA 1GJXA 3H91A 1I4PA 4NAWB 1YMHE 2EJGC 4FYDA 3R93A 1KNAA 1EM7A 1BUIC 3GB1A 4NKLA 1PMRA 2NN6H 5C44B 1ZXHA 2BDNA 4RHSA 2N55A 4GDKB 1F2RC 1YQ4B 3J7AF 2WXJA 4ULLA 1H9RA 2A6HD 2XWBB 2B63B 4J6HA 4A3DB 3F2UA 1FFUA 1RDPD 4FF3A 3M7GA 2WAQB 4OO1H 1YNNC 5CBAE 1RFKA 4ZHOA 3Q8EA 2SOBA 3PUWA 4OW0A 4HCEA 1IGDA 1TJEA 3H94A 1SNOA 4FXGC 1HZ5A 1QKZA 4ZRPA 3D3RA 5K36G 4A90A 3KLRA 3NBHA 4HSVA 3FILB 2JA7B 4RGNA 3QJYA 3BG3A 4B0MA 3C1FA 1EU3A 2XN9C 1FNWA 3VR5A 2EY1A 4FXDA 4B9WA 1C79A 1PFMA 2BA1A 1ZXTA 2Q8TA 1E0ZA 4LK1C 5CORA 5ELBA 1VZ6A 5H8YE 1ML0D 4PT5A 1JROA 1ZP0B 1G8ZD 2O5JC 3AB9A 3EVQA 4KJNA 3T4AC 2J42A 3HOZB 4F7XA 2BS2B 1FXIA 1IL8A 3FC4A 1A3VA 2JWUA 4P16A 1OXUA 4FF4A 2A5HA 4RA8A 2EE1A 5A2QL 3P4SB 4B9XA 1F9SA 1YN5A 2ENBA 2RSOA 5D3IB 1Y56A 1TQOA 2WXIA 3SHLA 2KEDA 1HQMC 3KBXA 4HAEA 2ON8A 4IURA 2RMMA 5IGFA 1HPCA 3GTLB 5KIXA 4FP5D 2L12A 3M85A 1IW7C 3LWEA 3L3OC 2Z4IA 3VR2A 4YSXB 3P20A 1CA6A 2QEJC 2TMPA 2OF1A 1BBXC 3RFZB 2K04A 4C2MB 4ARIA 1LTBD 4DA2A 1CZPA 2LUMA 4PMCA 2BCOA 2WDQB 1V1OA 1ESRA 4K2LA 1M8AA 5CV7A 1WSPA 4C3HB 4UDUC 1LACA 3P4QB 1HCZA 2CU3A 3AV8A 3B9JA 3H0GB 5C5LA 4V0BA 1V1PB 2WXFA 4HN7A 2B2UC 2M0AA 1LLRD 4MT5A 3FAHA 5FLXL 4BA2I 1ENCA 1N60A 3VYSA 1AW7A 2F0HA 2B76B 1TKYA 1BO0A 4MACA 3MHZA 3X3MA 2VZKB 3RZOB 3Q0AA 5J22A 4IN3A 3DWAA 3L7ZC 1UNSA 2C9OA 4HKZE 4JX1C 5C4HA 1P7EA 1YJJA 1V97A 4US9A 4CJ0B 1D5XC 2AWNA 1L0YB 3PUXA 5EE9A 4IALA 1SNQA 3I8ZA 1YNND 1GUNA 3NVZA 1YN3A 3P1HA 3UI2A 2SNSA 4WH4A 4HROA 1AN8A 3GV3A 3D31A 5BN5A 1B44D 1EZ8A 4RKLA 3BK1A 2K5QA 1C4QA 1VCIA 1NEKB 3HOVB 5HI1A 2OEDA 1IGCA 4QCLA 1FCCC 3AEAB 4Y7NB 4IUQA 1L4ZB 2QIEB 5ELCA 4R3DA 3OIPA 5M3FB 1EIHA 4HMJA 4F88A 1EWCA 2K05A 4ITKA 3BK2A 1NI3A 3AE7B 1EWHA 1K8OA 1EEFD 1U4MA 2BT6A 2SEBD 2EYJA 4UAIA 1TY0A 3D8GA 4R8NA 4ZQ3A 1XLNA 3MC0B 3PIO3 4DXGA 5IIFA 4WAFA 4A3FB 2FMMA 3DWQA 3P4PB 2L32A 2EZVA 3WCQA 3URYA 3M7NA 2ZXRA 1SMYD 2CW0C 4CJ1B 2XRQD 2D5GA 4EQOA 4HKQA 1BCPD 5E1FA 2WXQA 1TS2A 1Q1EA 5ELDA 4XT1B 3H09A 3SR6A 3CHBD 4HRSA 3PMFA 3EUB2 1F2YA 1HHVA 2M19A 1JMLA 3EFXD 5T1IA 5BMIA 1JR0D 1X32A 4ZK9B 2K3UA 1TU2B 2B8GA 1A6XA 4K5XA 3CRLC 3GO5A 3D6WA 4JBWA 3K5LA 5EKKA 4M1UB 1MSHA 3AE4B 3IT6B 2KEEA 1N63A 2WXMA 1SSNA 4KK7A 3V3XA 2AUKA 3J81L 4DNRB 1Y8NB 5FR3A 5K5PA 3V96A 2NVQB 1TWHB 1FYCA 2QSDA 2AWOA 1TY2A 2MJEA 4IKGA 1NCVA 3S1RB 5KYIA 3NBIA 2RA4A 2CJOA 3HP3A 2RPVA 4KD3A 3CKIB 3Q8BA 4XQQA 2K0PA 2JYEA 2BOSA 2PPBC 1EY5A 4C3IB 3T56B 1U9RA 1XCTL 2BYTA 3QG1A 1FO4A 1PDXA 4KKUA 1IW7D 2FBWB 1SE3A 4YTNB 4H13C 4A3BB 1S5BD 4TQ0A 1HFGA 1BOSA 4PMWA 3PO2B 2WDVB 3ITPA 3VR3A 4OO1I 3OOCA 1II3A 1KLGD 1E9MA 2A69C 3U7ZA 3TEYA 2Q5WD 3QOJA 2RBMA 4D2KA 3A54A 4ZKCB 4CHTB 4USAA 3H8HA 1GOZA 2KCNA 1PFDA 5C3WA 4Q0FA 1WWTA 1JWSD 1RCVD 4XYQA 4GLSC 5M5WB 3AM9A 3Q69A 2XIWA 1U4PA 1ICWA 3HOWB 3MEHA 1RTNA 1CFMA 1CZGA 4FF1A 4KKSA 1ZPSA 3S17B 1EQTA 2PW7A 2IWHA 1JWAD 4IUNA 3LB8C 3VYTA 4K5WA 3BDOA 3ZGZA 3EJIA 5C4JB 4NZLB 3A55A 4L6TB 2MJ8A 1GUWA 2A6EC 5CC4A 2RDFA 4RWSC 3KQ4A 1O7ZA 1A70A 1ZYRC 5IGBA 2F0WA 1J7CA 1BDOA 3IFTA 4PV1C 5NUCA 3HOYB 4RKBA 1PRTB 3M4OB 2DYOA 2JQRB 2ICIA 2O4XA 1PLFA 2W54A 4XDDA 4PMBA 3BZDB 3OW7A 2NVYB 1DXMA 1I4XA 2L5TA 3IXSA 3TUOA 5JEAH 3VR8B 2ZW0A 3VR4A 3S1NB 3K57A 1HZ6A 3J81E 1N62A 3DWPA 3CIRB 1R4PB 3U9SA 2WNMA 4OIJA 4QF4A 4R8IA 3G7LA 1OQQA 2L4NA 3MZ5A 1SXTA 2H89B 3JAME 1DOXA 1GAQB 3NTKA 2ACZB 1JOQA 1A3TA 2G9DA 3Q8FA 4REZA 4P2CB 5G3LF 1TWGB 4FVMA 1FNVA 3AU7A 1EEID 1GUGA 1B9MA 3RUZA 4XT3B 3FDTA 4A3KB 1J8IA 2EY5A 3D4DA 2KJXA 3NQIA 4BBRB 1X3PA 5IGGA 3ND9A 3PV0A 4B0EA 3BVMA 3HKZB 3P75A 1CTMA 1MHHE 1BXTA 2KOLA 3JAML 5CV6A 5CV5A 4ILWA 3IFDA 1GUSA 1I3QB 5EE0A 4OHJA 2A68C 3C3LA 2OXPA 2M9VA 4S3SA 3G6JB 3AEDB 2PZUA 4K8JA 3CQZB 1HQRD 2KCCA 2WXHA 4OZCA 3BIID 1FXAA 1PZJD 2IGGA 1XLQA 1STGA 4Q5VA 2NUCA 3TBIB 2E2HB 4IUVA 2ZXPA 4KN7C 2V4DA 3I91A 2IW3A 1VDZA 3X3NA 1JRPA 1G2TA 2OHFA 1MGSA 3M4YA 4QIWB 1SAPA 5JPMC 3FPPA 3O13A 1Y1VB 1E2VA 4I65A 1QT9A 1L0XB 1PTOF 1QB5D 4IFDJ 1IYUA 3OMCA 4IUPA 4A9AA 1K83B 3MHBA 1I50B 5FO9B 3BVZA 1YNTE 2EYHA 3EROA 4KKIA 3CRKC 2LMCA 4MH8A 4X3TA 2DY8A 2DNEA 2WB1B 1LTSD 2DYMA 1JQYD 1BCPB 3U52E 1Q3LA 1KDBA 1AFPA 3T16A 1QOAA 4XTCS 5FLXE 1DD2A 3ND8A 1EY8A 4LTUA 3DWMA 4KV6A 3Q22A 3PUVA 2MH7A 1FCLA 3BDLA 1I4QA 3UI3A 5IGEA 3B2GA 2AUJD 1MI0A 3KWLA 4BA1I 4N58A 1J9OA 4WRDA 1L6UA 3Q8AA 3D4WA 1E10A 1EWYC 5HFYA 1I4GA 4EGVA 3GTJB 4JPSA 3I73A 3P63A 1V43A 4F8MA 2DN8A 2O2LD 5C3JB 3NWTA 3TN2A 1Q90A 2K03A 1PTOD 3BWUD 3Q6SA 2L9HA 4J8QA 2K22A 3HUIA 1RODA 5KEEA 2MGSA 4C3IG 3ZQ4A 2G9HD 2EOTA 1WTWA 5A35A 1WTQA 1NENB 1LO5D 4N59A 1RYJA 5D14A 3AEEB 2PLPA 2K5WA 2E3TA 2AQ2B 4E6IA 1ZEQX 2VB3X 2SAKA 1ZE3D 1WXQA 1CQVA 1ROEA 1FD6A 1JOOA 2LS01 2I46A 1AWDA 2F1MA 4K6DA 4FXCA 1WVLA 4A55A 2E2IB 2KN4A 5FOBB 2K33A 1XX8A 2YYZA 3NZ3A 1FNUA 4A93B 2YU9B 3V2TA 2BTEA 2B2YC 3KLSX 2VB2X 3ERQA 4FXKC 3A8JE 4BBSB 1B1ZA 3SK6A 3AEFB 4DK0A 1ENFA 1STNA 3R2TA 4YXDB 1TR5A 4DU9A 2L55A 2EJMA 2ZXOA 3MFGA 2F0MA 1JOKA 3AE1B 1HUMA 3DHQA 1WCMB 3SXHA 2BS3B 1GXDC 2Z1CA 4QB4A 1HXYD 3FMCA 4EQNA 2HQEA 5CYUA 1PGBA 4J3OD 2KQ4X 3K5MA 1TKGA 2WXKA 4TKOB 4WQMA 4RCNA 1WTPA 1B3AA 1BR9A 4BWGB 5I2YA 4DN4M 1A15A 2B2TA 5I4DA 4DAVA 3IT4B 2PTLA 1Q1BA 5H92C 2HCIA 3NS1A 1HRJA 3NTHA 3VA5A 5I6WA 2KACA 3NVVA 1PRTD 1H9MA 2E75C 3NXWA 3VQIA 1HTPA 1RHPA 1FIQA 1JALA 5E4WC 1V8CA 4DNTB 2E2DC 4AS1A 1FRDA 3U2SC 4ARCA 1EYDA 3SVMA 3S2HB 3H3VC 2D9UA 4QUCA 1L0VB 1PZID 2NTSA 5C4ZA 3R3OA 5BYRA 5E6JA 2IPKD 3IAM1 4ZOHC 2B8FA 4JWUC 1OQRA 2IT1A 3PO3B 2FUG1 1T5EA 4TRDA 5G5GA 3IKJA 4XIGS 1G2SA 2FINB 3CU7A 1G291 1NUCA 2BE5C 4NJCA 4BY7B 1F77A 1MBYA 4ZAIA 4XWTA 2H88B 4CGYB 1CJEA 2KECA 5EPKA 2FE8A 1VJKA 1UGJA 2MPMA 2DWQA 1VMPA 2O5IC 4M0WA 5BYQA 2I2YA 3SFEB 2F0JA 3OHXC 1VRAB 1SIJA 4A3MB 1TWAB 4ZRZA 3WOFA 2I38A 1UWXA 1DOMA 1VMCA 3PUZA 3Q24A 1C76A 1K50A 4IUUA 4WIPA 3U4EG 3K59A 3NE5B 2WU5B 3NSWA 3I4MB 2F0GA 1B50A 4ZKBB 3B2FA 2K9XA 5AUIA 3EA6A 4QMGA 1ENAA 4CKCA 2K7VA 2E74C 2NVXB 1S5ED 3HGBA 4WWMA 2N88A 1KTKA 2QKIC 3EQLC 2EDGA 2W55A 3HVZA 4KGRA 1LTTD 1TYGB 2F0UA 1CM9A 3I57A 3MXUA 3DEPA 2R3ZA 2KVMA 4PNYA 3SR1A 3T13A 1EIGA 1KDCA 4DXFA 2JXTA 3RLFA 1JQ4A 2FFKB 2WP8J 3ZJTA 4JWSC 4NAMA 1KFYB 2F0DA 4XQNA 3SK5A 5I9OA 4LK0M 1NYQA 1VR9A 1K51A 4YSZB 5JEAJ 4ABNA 5M9OA 4ME5A 5C2TB 1JB3A 1I4HA 2VXWA 2PO4A 2F0TA 2BW2A 1WD1A 4H44C 3K5NA 4KKTA 2N0SB 4XE0A 5FKAC 1EFID 4NMZA 4XDCA 2LMCB 4RCOA 2E6XA 3GTMB 1C4AA 1KAAA 3T53B 3NHHA 1RKNA 2Z4HA 4L8JA 1JE4A 5E3FA 4C1NI 1CQFA 1QOHA 4V190 1DYQA 1STBA 1VF5C 5JPNC 1B53A 5EKLA 5JJZA 5IT9L 5K36H 2K5PA 5ISRA 3A56A 2E2JB 3AE6B 1ZYRD 5AUKA 1Z7TA 5KNCA 2GRIA 4X3SA 1DM0B 4G57A 1SYDA 1TZOA 1GB4A 3C8YA 1Q10A 2XSCA 4YWGG 4QUFA 4GZYC 1E0BA 3SK8A 2WXGA 1QLBB 2EPBA 3K6OA 4C80A 1SNMA 3LNNA 5EPLA 4KN4C 5M3MB 1LTID 3VA7A 1WGKA 3OPOA 5G3LD 2L0CA 5IT9E 4KGSA 1GUTA 5IGCA 3C2PA 3FPUB 3R8BA 2WIIB 4AYBB 4WORA 2RKSA 2B2WA 5COYA 2HUGA 2QMTA 1TS3A 3N52A 5M5XB 1L4DB 5IGDA 5BMGA 2WINB 3AECB 1IHZA 4BY1B 2FMCA 2IDYA 2N9KA 3PO0A 3W1SA 3NUHB 1A3UA 5BYSA 2GB1A 2F03A 4YSYB 1KH0A 2A69D 1GB1A 1MHXA 2EELA 3E0JA 1PTOB 2NZ1D 3DWGC 1X3QA 2XNAC 1Q12A 4YT0B 2X38A 3N9YC 3IAS1 1I6VC 2CJNA 2VZKD 1OXXK 4LJZC 2V0GA 1TT2A 1LABA 4MM3B 1U4LA 4FO2A 3J7AV 2J53A 3A8IE 2AQ1B 2JSOA 1IKLA 5EKIA 4L1BA 2B2WC 1CHQD 4CBVA 3GP7A 2JXMB 2K28A 4XDXA 1KLUD 4IQZA 5DEHA 4LAAA 1P7FA 1E6EB 2YEPB 1K8MA 3OSOA 3TEWA 3C1EA 2WACA 1YJIA 1K53A 2CVRA 3NUCA 4U673 4K8IA 2NMQA 4C3JG 1A2UA 1G91A 2W3RA 1PZKD 3RMHA 3HG9A 4HJGE 3K7AB 1EQVA 3WOEA 4C3JB 4KTAA 4XWWA 1B2TA 1YNJC 1L5PA 1JC7A 2LGIA 2K32A 1R7SA 5ELFA 5KRUA 5M5YB 1W6JA 3R2IA 3IAYA 1BQQT 1YNJD 2F0PA 3E56A 4FF2A 3FRPB 3E5SA 4RGMA 1XTCD 1J7AA 3HZXA 1D6EC 3W3AA 1Q8IA 2CHBD 4HTHA 5C3EB 1MPEA 2SNMA 3A7LA 3TMEA 3BYTB 3I90A 3P7JA 3M3YB 2YEPF 2F0IA 4BS9A 1EY6A 1E2ZA 2IX1A 2WDRB 3DUZA 1RJTA 5CV8A 2ZW1A 1SJHD 4A8XC 2EXZA 1SEBD 1SYGA 5C0XI 2MJDA 2BS4B 2PNRC 4HCSA 3MP9A 4XYOA 1FEHA 3AE5B 4A3GB 2F0OA 1LTGD 2MEKA 5I2XA 2WU2B 5IODA 2PQEA 2K5DA 1XLPA 1JWMD 5LL6S 1RWSA 1CK1A 1XLOA 3SK4A 1SYCA 2R61A 2B2VA 3MXPA 1AP0A