1SJHD

Hla-dr1 complexed with a 13 residue hiv capsid peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjhD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjhD02
1KLUD 1SE3A 5FKAC 4NZLB 1LTAD 1DJRD 1S5DD 3BVZA 4RHSA 4RGNA 5ELBA 3W2DA 3O13A 4UDUC 1B44D 5D3IB 1V1PB 5TSSA 1BCPB 1PRTD 2XRQD 1G8ZD 1HXYD 1FNWA 3DWPA 2AQ2B 3GP7A 1D5XC 1FD7D 4ZYSA 1EU4A 3DWQA 1I4PA 1TY2A 1EU3A 1LLRD 1DYQA 1LO5D 1F77A 1JCKB 1EEID 1ENFA 1SJED 2SEBD 1PTOB 4DXGA 4RGMA 1PRTF 2QILA 2O2LD 3BYTB 1L0YB 2QEJC 2RDGA 1UUPA 3R8BA 1LTSD 1EWCA 1LT5D 1M4VA 3KLSX 2CHBD 3CHBD 4C56C 1PYWD 3V05A 1BCPD 1FNUA 1B1ZA 1I4XA 1LTID 1RF2D 2G9HD 2ICIA 3DWAA 1PZID 4RFBA 1ESFA 1D5MC 1D5ZC 1HA5A 5ELEA 1CT1D 3URYA 2XRSD 1CK1A 1ET9A 1S5ED 1LT4D 2TSSA 1EFID 1RCVD 1PTOD 1XTCD 1BCPF 1I4QA 1TS4A 1RDPD 1FNVA 1ET6A 3BVGA 4O1NA 1S5FD 1PZKD 1PRTC 1JQYD 1TS5A 1GOZA 2R61A 4RCOA 2WV6D 2NTSA 3TSSA 1TS2A 1SXTA 1SJHD 1YN4A 3BYYB 4K6LA 1PTOF 1S5BD 1SBBB 1LTTD 1YN5A 4L63B 5ELDA 1L0XB 1LTRD 3MFGA 1XXGA 1FGBD 2XNAC 4TSSA 1LTBD 2Z8LA 1LT3D 3EA6A 4OHJA 2XN9C 4RGOS 3BZDB 1CHPD 1JR0D 1S5CD 5FK9C 1AW7A 1LT6D 3R2TA 4BWGB 2NTTA 1QILA 4DXFA 1TY0A 2AQ3B 1BCPC 3MC0B 3SEBA 1YN3A 2AQ1B 1HTLD 2IPKD 4RGTA 1T5XD 1SE2A 1LTGD 1TS3A 1I4GA 1I4HA 3BVMA 1CHQD 1EEFD 1AN8A 1JWUD 1KTKA 1PRTB 1KLGD 1PTOH 1D6EC 2RDHA 3R2IA 1PTOC 4RHRA 1JWSD 1PZJD 4L6TB 4RH6A 1SE4A 1STEA 1V1OA 1I4RA 5ELCA 1UNSA 2IJ0A 2J4XA 1RD9D 1MD2D 3OWEB 5ELFA 1JWMD 5I4DA 1BXTA 1SEBD 1V1PA 5D3DA 1CQVA 1HQRD 4Z9CB 3EFXD
chains in the Genus database with same CATH superfamily
2QMTA 4ABNA 2BYFA 4DNTB 3P20A 4JIOU 4ODGA 3OSOA 4IUTA 4WJPA 2XK5B 4U673 3E9HA 3LDZE 2Q8RE 3KYHC 5KIXA 2UXBL 3DWMA 1FNWA 4DA2A 1OGWA 2MBEA 1HNXL 5IO9A 1E8YA 1PXUA 5M3FH 1SNOA 4LF8Q 4RG1A 2F4VL 1VR9A 3TDQA 4LNKA 2FMMA 2F0DA 1T0YA 1N62A 3HKSA 1QLBB 3QARA 3A54A 2BQQA 2N3SA 4K5XA 4JI1Q 3D0FA 5JJIA 1MHXA 2CHWA 3RD2A 5GROA 4DV5L 1TWGH 4HIOA 2FHTA 2JZZA 2EJMA 4DV0Q 4W9EA 3FKIH 2CCZA 1XPUA 4IURA 3MXUA 2HCCA 3PHWB 2WB1G 1JC7A 2N55A 4M8AA 2L55A 2PZWA 2K7VA 4B3MQ 2DNFA 1F2MA 2W3RA 4OO1I 5J2RA 1NJIC 3JAML 4OGQC 1LQBA 4A3BH 3VR3A 2IO2B 5E3FA 1EQVA 4NP5A 1MSHA 5D65A 2BYEA 2DYBA 3B08A 3QHTA 5C23A 4AWJA 4W9HA 1VQAA 2C35B 2ICIA 4JBWA 3UDIA 2PYKA 1GHKA 2AEHA 2O6VB 1N5XA 1SE8A 3WWVA 1STBA 3WCQA 2WIIB 3G71A 1Y1WB 3TIXA 3JW0X 2KHIA 3V2TA 1HNWQ 2M0XA 4L1BA 1CK1A 5IP9H 2KMMA 1LT4D 5GAEC 4TQ0A 2CVRA 4OIJA 3PTFC 1I4QA 1JWBD 5L95C 2W3SA 4RF1A 5G2NA 3WA0A 2NVXB 3DBLB 1S4ZA 3NE5B 1CA5A 4DXAB 2KX0A 4DQOC 1W3SA 2QC8A 3U9SA 2K9XA 1BVSA 1VZ6A 3TSSA 4CKBA 5IGFA 4KZCA 4M1UB 1SJHD 5EQ0A 3ZDMC 3UIOB 1S5BD 4GDKB 3CMMB 1RODA 2KMAA 3MFGA 3S1QB 3Q8BA 3WAPA 3QJYA 2N9PC 3KDFA 4F7ZA 5EDSA 2XNAC 4PMBA 4BBRB 1STAA 4WJ4A 4LF5Q 3S15B 4BY1B 3KF8B 3ZW3A 5C0XI 1JR0D 3CSTA 1B7YB 4A55A 1K83H 1YJIA 4LFAL 1XNQQ 3MWYW 1L0VB 4H2AA 3Q6SA 2NVTH 4DR4Q 3ERQA 1VDZA 1V43A 2ICEC 4XQNA 3HOVH 1B8AA 1I4GA 2EE1A 2D62A 1WZ3A 3AECB 4HDQA 1UH6A 1D6EC 4DAYA 1DD2A 4JGHB 4E71A 4DFAA 3OYYA 1C79A 3DBSA 1CZPA 3VVWB 1PFDA 4NY0A 4A3JB 1YD8U 2SNSA 4P74A 3CRLC 2ZCBA 5EKLA 2JZPA 4DV4Q 1UNSA 2IJ0A 4EQOA 3A7LA 4BFRA 1NY4A 3TN2A 2OWOA 4J6IA 3RZFA 1E2ZA 4OWWB 1FPYA 3EROA 4JYAQ 3DEPA 3I4MG 4A3IH 2K6QA 4X3SA 1AZQA 2JA6G 3HKZB 4EZJA 4OO1H 4KGSA 4WAAA 1N34Q 4C80A 4YWMA 4LWCA 4A75A 4NZLB 1K3BC 4BAXA 5CV9A 4J6HA 1Y56A 2A5HA 3IT4B 1TIID 4UDUC 1B44D 1U0LA 1EY7A 1XO3A 2XRQD 1I3QH 2M9VA 2BB5A 4JPSA 1Q12A 5JEAJ 4IFDI 2FJ2A 1N8RC 3GTOB 2L8JA 2FINB 1AWDA 2IO1B 4KJOA 5NUCA 1TBEA 1ZOYB 1VDVA 4OVZA 3AEVA 1MJCA 1GM5A 1N32L 1F9SA 4BBSG 2LGDA 1I50B 3A9JA 4ARCA 4R4TA 3BYTB 3BINA 4CJ2C 4DR6Q 3L10B 2KVMA 2KQSA 1V1QA 4HPMB 5IA7A 2I5LX 1MJEA 4IM0A 1FO4A 3D4DA 3TZUA 1LACA 1A62A 5A2QL 3S16B 5A2QE 1N63A 4KKJA 3H94A 2MW5A 4P71A 4A3OA 3G48A 5C0XH 2D2CC 2Z1CA 2NVXH 2WDQB 4JBMA 1UF0A 3EHVA 2UXBQ 2A68C 2K5NA 2FFKB 3SK4A 3NOBA 2KTRA 3N52A 1HNXQ 5HKHA 1QNUA 3W3AA 1EUJA 1LV9A 2F4VQ 1OFFA 3I4LA 4O0AA 1P98A 2W9NA 3RMKC 4X3UA 4A4IA 1ZGUB 5J22A 1L7YA 3MTNB 2OCEA 1HRJA 3KLWA 3S1QH 4DV5Q 2LVPA 5E6PA 4R4IA 1ZE3D 2UWQA 2MBOA 1XLOA 4JOIC 2WDTB 2ZW0A 3GB1A 4MH0E 2WINB 3DBHB 1ICFB 3KJOA 4GOPC 4DHJD 1VCIA 1R9TH 3GS2A 1QG7A 2F52A 4DK1A 1PH4A 1E5WA 5C4XG 1QOFA 2KN5A 1IHZA 2WDRB 3ML8A 4JCVE 2C9WB 1ASYA 4LFBL 3RMHA 4KV2A 2AUKA 3E5SA 1ZEQX 4LUVA 2XEWA 3ONAB 5FK9C 1B4OA 2IHFA 2XWBB 1STHA 3H6MA 1YQ4B 2A1AA 2MPMA 4J3OD 1LYLA 2A6HC 3I7FA 2R92H 4G3XB 4BBNC 4NXML 2V1CC 2AQ1B 4YSZB 3A0JA 3GTLB 4KTAA 4JWUC 2L12A 3HOUG 4A3JH 3DBHI 3UF8A 3HOWG 1EQRA 1SYGA 4IFDH 3Q69A 5EE3A 1CSPA 2IW3A 4KN4C 5KRUA 2VNUD 1TWHH 2KMCA 1J7BA 2NMQA 4PS7A 4OZBA 5C3EG 1NCVA 4NMZA 2FMCA 4XXEA 4MEMA 5JPNC 5FJ8H 3EECA 4BOZB 2WXRA 3NWTA 3GTMB 2IGHA 1GJZA 2DZIA 1TWCB 4HJAA 2CH4A 1L0WA 3MHBA 2A5UA 3NZ3A 4IW0A 3DVNU 4MGKE 4L2YA 4LFAQ 3T1YL 2KC1A 3GTOH 1U4PA 2Q2TA 4RHSA 5D14A 1RFKA 1HZCA 3HG9A 3B1LX 4ICUA 1WGRA 3U8ZA 5AZGA 1WTVA 4WWPA 5TSSA 4PZ6A 2EXDA 1E0ZA 2AQ2B 4WQMA 2LMCB 3H8HA 3TEHB 2KWVB 2MJDA 3Q8DA 3EGRA 2SNMA 3I55A 1YI2A 2LGYA 3K7AH 1M94A 3V3XA 2EY6A 2LVOA 1QE6A 2PPBC 2BA1A 1T3QA 3RN2A 4LK1C 3SK5A 4TUUA 2DGYA 1FYCA 3ZYYX 3BDCA 2PJHA 4EOYA 1MBYA 1OO9B 3D4RA 3U4VA 1GAQB 2VB2X 2D11A 2UUAL 3S16H 1MJDA 3L54A 3N1YC 4JK1C 1LTSD 2CHZA 1UE5A 1C1YB 1M4VA 1W6JA 1PYSB 3TP6A 3J80c 5IT9E 3ZO5B 3I56A 3T13A 3B9JA 3DQVA 2KVRA 4B3SL 1BCPD 3DHGC 1IZ6A 5CGKA 1B1ZA 1UE6A 5FLXc 3LYYA 4KKTA 2G9HD 3TRZA 3TUOA 1Y1VG 2K1BA 2JYEA 1HTPA 4DPGA 4AYBE 3G6EA 3GO5A 1J8CA 1VQNA 1EY8A 5C4HA 1QZGA 2N7JA 2INDC 3D32A 2E2IH 4LF9L 2XIWA 3QWNA 2PI2A 3N1XC 4JX1C 1SYCA 2HIVA 4GLVB 1Q1EA 1YVCA 1WJ6A 4PQXA 3M3YH 5IYCH 3I4MB 1PZKD 1IBKL 4EFOA 4DK3C 1YNNC 3Q6BA 1YX5B 2INCC 3UGBB 1JMLA 2WS3B 1M90C 2E74C 3ULLA 3TJPA 4KHVA 4B9WA 4AH6A 2DX5B 2K39A 1UEBA 2IT1A 2KANA 2Y0SG 3L7ZC 2LZ6A 1XXGA 1DOMA 2HTHA 1GHJA 1K8RB 3CF5A 4NAWB 2ZW1A 2NWGA 4K14A 4QL5A 1A2UA 3NVYA 5HHDG 3VRBB 4MSQB 2MBBB 2L5TA 3EJIA 4K2LA 3ETRA 4DNIA 4HSPA 4WJWA 2HCIA 2JA7H 1C3TA 1WTHA 3GTLH 3C2PA 1QJOA 3CQZB 5CV4A 3VUYA 4BBSB 4IO9A 4A3PA 4PMCA 3T3NA 2BW2A 2MSED 4A90A 3L0WB 4JOIA 5CYUA 3W1BA 4W9GA 1TS3A 3J80E 1A6XA 3DPDA 1ROEA 1G51A 3P63A 3PZDA 2ZT9C 4LNNA 4MGYE 1WGKA 4GOPA 1AN8A 1JE4A 1H9KA 2RVLA 1YNND 2WAQG 3C1FA 3AB5A 1KLGD 1O80A 2A73B 4HJ5A 3GTMH 2DJFC 5FLXE 1EF5A 1KABA 1TWCH 1YQ3B 4XZ4A 3ZNZB 3TMEA 1T0QC 3DM3A 3VR8B 3NTHA 2ZTEA 3NG0A 3I90A 2J4XA 1MIUA 5M3FG 2KO3A 3I2ZA 3E3XA 4LFBQ 3E0EA 1QB5D 1S3OA 1IKLA 5HY6A 4HIMA 3RULA 1KLUD 3FP9A 1E8ZA 1GG3A 2R6GA 1L5PA 3FKIG 4RGNA 4OVVA 2VH1A 4NXMQ 4IN3A 1G91A 1PQSA 3CCQA 3NS8A 5BMGA 2WXKA 4NAMA 1CKMA 2H88B 2LWPA 1TWAB 5J18A 5JVG3 4ZYSA 4PS3A 2BTEA 1QOAA 4LK0M 1VQDA 4A3BG 5C4XB 3H09A 1WF9A 3LX0A 4DR1L 4K1RB 3PIP3 4GKJL 2D5GA 1HUNA 2JF5A 3QIAA 4JI2L 4E74A 2QCZA 2MO1A 4WRDA 2V9HA 3GTQB 2GBJA 5IP9G 1C48A 2PQAA 2NR2A 1ZYRC 3HOZH 3R66C 1KNAA 1KIXA 4GZYC 1F52A 5IP7H 4KD4A 2LD9A 2N9LA 3HOUB 3MJ5A 1YQBA 3HOWB 3ZNID 2MRPA 1QUQA 2B3AA 3T1YQ 3CXCA 4P6VF 5IE8A 1AZPA 2DN8A 4P75A 3DWAA 2HJ8A 1V97A 5C3EB 2M56B 1IBXA 1PGAA 1T0SC 3ND9A 1FCLA 1XTCD 4DK0A 2OJRA 4FHKA 3GTPB 3WALA 3AMUA 3RZOH 1VQGA 1IYVA 1JWAD 1W2BA 5M5YB 1WRDB 2C7NB 4JI3L 3A4RA 3IFTA 1HR0W 1SNCA 2ZXRA 4IOAA 3N3KB 3NUHB 1STGA 2KN4A 3X3NA 2VZKB 4DR2L 3I9V1 3L13A 2NUCA 1Z6HA 4GN5A 4EE2A 2UUAQ 3PO3B 2EYOA 1A3VA 3TEYA 2ZJRA 1HR0L 1ZYRD 1R4NB 1XD3B 3Q3FA 2MP1A 1YBYA 4A3EH 2JX5A 4TKOB 2WXQA 3H7PB 3HOVG 3NZSA 5DPWA 5K36H 3EVQA 2N4FA 3A5ZB 4HROA 4ICVA 3J7ZC 4JG2A 4B3SQ 3BWUD 2OQ0A 4DUZL 1VQ8A 4YWGG 3R7QA 1UWMA 1NTGA 3DCGA 4YTNB 5AZFA 4YTPB 3J7A5 3RUZA 1K9MC 4L23A 1UAPA 1LM8B 2AWTA 2F0VA 2XSCA 1WE7A 2ZPNA 4S17A 1C9OA 1EY6A 4XYQA 1HJPA 4LF9Q 1WH3A 4BKSD 5BYSA 3Q24A 1LTGD 4A3IG 1E8XA 1R4NI 5I6WA 4O42A 4OO1G 1KTKA 1IBKQ 3BJUA 2L1AA 1CKNB 2X38A 2ZZPB 2PEAA 3HUIA 3VTVA 2R3ZA 4WH4A 2K5QA 1PTOC 1IGCA 1C76A 4IWQA 2LRWA 4W9JA 2NVQB 5LNK1 5HG2A 1Y1VB 3PCOB 1CTMA 3RNUA 4R8IA 2L32A 1ILQA 3L08A 3N9YC 4FXCA 4G0NB 1VQIA 3RCZA 1VZ8A 1RRBA 3CMAA 4LUOA 1E10A 3K7UC 1F0ZA 5LMUL 5CC4A 2DAJA 2GVAA 1CQVA 2F0FA 1D7QA 3OJ3A 4GNXC 2V0GA 1YJ9A 3E9SA 1LGRA 4HEDA 1ML0D 1ISNA 1TWAH 1SN8A 2VZAA 4JI4L 2NBVB 3OMCA 2EDGA 4EVOA 3PIO3 1P16A 2Q2HA 3BDLA 5I6YA 1HZ6A 2CKHB 2JQRB 2MP2A 2GB1A 1PRTD 2LS01 4J8QA 4FJVB 1SYEA 4IM3A 2QDFA 2Z4IA 5KNBA 4DN4M 3NBHB 4QUFA 1EU3A 1E7ZA 3Q8AA 1LLRD 2G9DA 4ITKA 3GTQH 1G6PA 4K8IA 2PW9A 4DR7L 3ZNGC 4LF6L 4B08A 4GMVA 1VMPA 5C0XG 1NYRA 1UGMA 2KDEB 4C7ZA 3MEHA 1KOTA 2QEJC 4CHTB 2K5PA 3N30A 4JQWC 3TQYA 4KKIA 3I4OA 2KJXA 3DVGX 1EZ6A 3CHBD 1EY4A 1SYDA 5LHY1 1Q0WB 3F2BA 3P4SB 4NPNA 4YSXB 2L1BA 2LRUA 2K5HA 5C3EH 4C3IB 4R4QA 2BWFA 4AUQC 1FCCC 2WAQB 1EWYC 3GTPH 1C4PA 1FIQA 4RFBA 2DZJA 4RWSC 1EIFA 5M5YH 1WX7A 4LJZC 2KQ7A 2EYHA 3U9OA 4ZUIA 3K80C 5JJLA 3UDXA 1MG4A 3KWLA 3VXWA 1RKNA 3X3MA 1MI2A 3NJTA 1VQPA 1JE5A 4LUZA 3VR4A 4ALPA 1TJEA 1A5RA 2VL6A 2D3BA 3PO3H 2JA8H 3SD5A 2XTIA 4DR1Q 1KRTA 2D3CA 3QB3A 5EPLA 2WHIA 4ZYNA 2Q8IB 4GKJQ 1GOZA 1VLBA 1P1AA 4IUNA 4JI2Q 2JSOA 2Y5PA 3NQTA 3I91A 1PH9A 4XQJA 4FF2A 1Z47A 2MFIA 2R92G 4GSWA 2WXLA 3LNNA 4RF0A 4XWWA 1VQ9A 2KCTA 3K81C 2ZNVC 4R3DA 3NXWA 5IOCA 3FRPB 4A3JG 2UU9L 2WXHA 4KHZA 1YEZA 4IFDG 4OIKA 5E6JA 1I35A 4J1MA 4ZQ3A 1VF5C 1FR3A 4A3BB 1N36L 4OW0A 3TEXA 4AJYB 1HA6A 5DNFA 3CU7A 5G3LD 5IGGA 2LGSA 5JAVA 4DXFA 3PF4A 5FJ8G 2WXPA 2K4KA 1EOTA 3QR8A 3IG3A 4APVA 2B2TA 1J0GA 3CCLA 1F2RC 2BH8A 1EZ8A 3AEGB 2DY8A 3MZ5A 1Y8OB 1VQCA 4P73A 4O2DA 4X64L 3STBC 2XBBC 2WP9B 2VQFL 1X56A 4I7ZC 1OXSC 1CM9A 2LFNA 4JI3Q 1GD7A 2MJ8A 2M4NA 4L5QA 1JB3A 1TKEA 2IY0B 2V1YA 2F0MA 2Z6KC 5G55A 1WCMB 4HKZE 5HGQA 4DV7L 4DR2Q 4HJGE 3PGZA 3QK0A 3M4PA 5G5GA 1JWSD 1QZEA 1GB4A 2ENBA 1V1OA 5M5XH 5C5MA 2BCOA 1HR0Q 1I4RA 5ELOA 5ELCA 3OWFA 4K2KA 2KBNA 1N5WA 3KOJA 2EMTA 4I7AA 4IPHA 4WWMA 1XPRA 4DGZA 4EQ5A 1BQQT 4DUZQ 4WURA 1D3ZA 2N49A 1SNPA 3AE8B 4AS1A 5DPSA 1OTCA 5CX3A 2UU7A 2LSSA 4WJQA 4Q0FA 2EZVA 1T0RC 5LL6S 2QF7A 1K83B 3E0JA 5ELBA 2UXCL 1WYGA 5K5PA 5C44G 3HOXH 1YNJC 2JU6X 1ONLA 1EIHA 4LF7L 2IX0A 2MHVA 2KECA 1KXLA 5CHFA 3STBD 2NVTB 1WXQA 4NQLB 3UE1A 1BT0A 1TY2A 4LF4L 3SXHA 1K73C 3HOVB 1QQRA 2WYQA 1F77A 4C4VA 4NPSA 1SJED 4FADA 2GBRA 3NRZA 3UQBA 4NNJB 2QGQA 1O7LA 1EQQA 3RT3B 5J39A 4GNXA 1STYA 2BVCA 4XDDA 2G4SA 4UP8A 4C3IH 3DXJC 1UUPA 2IX3A 3R8BA 3SVMA 4MIUA 2FCNA 5D2MB 5EE0A 2MQJA 3V62A 4KIKB 5LMUQ 1XCTL 3GE3C 3BIID 2K8CA 1GC7A 1PDXA 2INNE 4UPAA 5IYCG 4A3IB 1SLJA 1WMHA 1PH8A 4M0WA 4OONA 3OG5A 2N88A 1GUAB 4JI4Q 3KFUA 2KFKA 2KAJA 3LB8C 3W1GA 3EFCA 4B3RQ 1K50A 4CDFC 5DPTA 3M3JA 4ANVA 4CBVA 2QSDA 3TEWA 1ILPA 1L6VA 1I3QB 1QVFA 1GJXA 3DHQA 3A8KE 3ND8A 3NPPA 3KF6A 1WJUA 3RN5A 3VUXA 2BB6A 4DR7Q 2NPTB 2I07B 2QA4A 2JA7G 4BKTA 1ZKHA 1F9JA 1Q8IA 5IYDH 2BDNA 3BYYB 3M63B 4KDIC 3SK8A 4A3DH 4FF1A 5JHBA 4JVZA 2HT1A 4HEA1 3RNGC 1HZ5A 4RCNA 2K32A 3NVVA 1GXDC 3H0GH 1LTBD 2O2VB 2K25A 2HUGA 3BZDB 2PI2E 3D31A 3KUPA 1CHPD 2IWHA 1PH2A 4QB4A 5AFWA 4FXGC 1PGXA 1M8AA 2DYMA 1NAPA 2X69A 4AYBG 2N7EA 2VW9A 3KUCB 4CQNA 5DM73 2IZVB 4GB9A 4KX6B 1WCMH 5E7NA 3PUXA 1T5XD 1WI5A 3P7JA 4N58A 4KK7A 1WX8A 3QQ8B 3W1YA 4GDLB 3WAMA 2CU3A 1WGYA 2W82A 3GDEA 4FJZA 2K01A 1FXTB 1KRHA 1JWUD 3SDZA 3BY4B 5EBDA 4NW2A 5KNDA 4DDGD 1Q82C 3NQIA 5M5WH 2L0FA 2ONQA 2GRIA 5D94A 1ZKOA 1Q86C 3AULA 2D5DA 3CC2A 3H9DA 1YNTE 2MLBA 1H9JA 1BR9A 1LXDA 2BGFA 2ALYB 3K59A 4V190 3MXNB 1BUIC 4HSVA 1QT9A 2F3IA 2KDIA 1RD9D 4RNAA 1ZP0B 1MD2D 3LWEA 1WD1A 2UU9Q 1V81A 3UINB 1R9TB 1C4QA 5BN5A 3Q14C 1VQMA 2BPSA 1XJVA 5CBAE 4JC0A 3ZRCA 1DOLA 3PLVA 3V96A 4F7XA 4GKKL 2DY7A 1GUOA 2PZTA 1N36Q 1KJTA 3PRPB 1BOSA 5AUIA 3UDFA 4C3HH 4EZKA 1JMCA 2I5HA 5GXGB 3APFA 3RFZB 4JV5L 2L4NA 3K6OA 2Z6KA 1BCPB 2PPHA 3AYHB 2R92B 3AFPA 1SIJA 4JBKA 2LXJA 3HOZG 4X64Q 4B9KA 1C9FA 3PRMB 4ZDVA 2VQFQ 2MH7A 3P1MA 5IP7G 2KQ4X 4CGYB 4X3TA 2JXTA 2GVBA 4R8NA 1FRRA 4RM8A 5E4XA 3AM9A 2N1WA 4DV7Q 3UI2A 1DXMA 1TWHB 2KLCA 1IW7C 1BF4A 3AE3B 3ZXRA 2D9UA 3P4PB 3VTWA 2WXGA 3MVVA 2NVYH 5FLMH 1IYJB 5GADC 4LJPB 5DPRA 3D4WA 3K5NA 1F9PA 1QOGA 4LDTD 3L3OC 3V05A 1NEKB 1FNUA 1K0SA 3RNEC 2IDYA 2I5MX 1XYIA 2UXCQ 4YT0B 1ESRA 1KL9A 3RI7C 1D5MC 2PVGC 2F0PA 2PZUA 4IKGA 3VYSA 4LF7Q 3JSVB 3MAQA 1HNZL 3S2DB 2Q8TA 4DR3L 1I5FA 4DAPA 4A3EG 1WZ0A 1G6JA 2JEAI 4YXDB 5K36G 4LF4Q 1G6ZA 1L1OC 3NHHA 4KI0A 1JJ2A 3Q8EA 4REZA 2PO4A 3A9KA 2DZMA 2R93H 1GNUA 4O1NA 5KEEA 3V6CB 2RSNA 3K7AB 3SFEB 1A3UA 3P4QB 4DV1L 1WGHA 3AE1B 1YJWA 3CCMA 1BKBA 1PFBA 3EFUA 4DK5A 3IHPC 2NZHA 3FKYA 5C44B 4II3B 1V49A 4ANUA 1HCZA 3MA2B 1HE8A 4TQ1A 4F8MA 1SMXA 4MTKA 1S72A 4X57B 4RGOS 1FVIA 2RDFA 2K0PA 2Z9HA 2GMIC 2EJGC 2YEPB 3CCUA 5CTRC 1HZ9A 4KD3A 1R4MB 3TMPB 4PS8A 1KH0A 4BS9A 2IPKD 2X8XX 1IYUA 1H9SB 3J80i 5H1SE 4LNQA 2MO0A 2E2IB 3S2AA 5HFYA 3FMCA 1IPGA 1EM7A 1KDCA 1HTOA 1C77A 3DVGY 4QF4A 2P5ZX 3PO2H 4DV6L 3HVDA 4YL8A 1WR6E 3F1ZA 3M3YB 4LNFA 2EIFA 1S1QB 5DAUA 2JVCA 4IOCA 1I42A 1NR4A 5KHOA 1BBUA 4RHRA 1XCQL 1RL2A 1WX9A 2LGXA 3AE9B 3ZNHB 2NZOA 5IP4D 3Q0AA 1RYJA 2CU1A 2PNHA 4G7OC 2EYLA 1R4MI 3AI5A 4N8X1 3K58A 3PQIA 3L4PA 3AE6B 3J81i 1Q81C 3Q8CA 2C5LC 2KFJA 2PKOA 1EIYB 2A68D 2G3QB 2KKCA 2IO0B 3F8TA 3BZCA 5FKAC 1Q8KA 1U9RA 4BY7H 4CKEA 3NTKA 4ZK9B 2JA7B 4YWKA 3LGJA 3VAWA 1A3TA 3M9BA 3NP8A 4K3BA 4AJWA 3WOEA 3S1RB 1CMXB 1KF6B 2RPVA 1K28A 1ICWA 3KLRA 4MM3B 4KKUA 3RLFA 2F3VA 1RJTA 4HXDA 3VDZA 3TS0A 3DWQA 3IFDA 1RFAA 2M0AA 3ZUNA 3S1NB 5CV6A 3U52E 1JT8A 2JSVX 4C00A 5EBCA 2OXPA 1CSQA 3WDNA 3VFKA 4LCDE 2K6DB 1MHHE 2RR9A 1L0YB 4Y52H 3MTSA 2RCNA 4C3JH 3HOYH 1LT5D 4AYBB 1P9DU 2SOBA 1PUTA 3EIVA 2Q2IA 3PO3G 2JA8G 4RMFA 2AL6A 4II2B 3E56A 2A6HD 5JOBA 1GC6A 2L52A 3M62B 2GLSA 3FILB 4YCVA 3S2DH 4MDKE 5C3JB 2KVZA 4JBJA 2N0SB 3C0RB 2IGGA 1V86A 1E7UA 1X1MA 2N9EB 2OHFA 4JV5Q 1YIJA 4HJ8A 1T6BX 2F0TA 4M8MA 3P75A 5M3MB 1KD1C 5LMNL 4ULLA 1X9NA 1TVXA 4IUUA 1U4RA 2PW7A 2JA5H 3APDA 1S5ED 2WX0A 5CHVC 2VUMG 3VR6A 1YOVB 2INPE 3IFWB 4WAFA 1D4BA 1BCPF 1MGSA 1OQQA 1K8MA 1PH3A 3U2SC 1F2ZA 3IAS1 2EPBA 2BF8B 2CS4A 5IN7A 4A6QA 2HD3A 3PUYA 5C44H 1JQYD 2F0IA 4RCOA 3RNFC 2RQXA 3P1HA 5IT9L 3EUB2 1SXTA 4FP5D 3H7SA 3AQQA 3TBLD 4DWFA 2G4DB 2V3SA 1WXAA 4L63B 4MJSA 1AE3A 2O5IC 4HTHA 4GXBA 4WFN3 4KGTA 3HOZB 1J7AA 2CKZB 3VA7A 2RSOA 1XWEA 4IPCA 1AP0A 2KWCA 2AHOB 1V8QA 4ANXA 4FXKC 4TVAB 1XMQL 2NVUI 1L1OA 1QKZA 1SR3A 4D2KA 1KQSA 4B0MA 3M4YA 3T1HL 4KKSA 4X65L 1FXAA 1HNZQ 1PYBA 2KUMA 3OW2A 3J81c 4DR3Q 2L9HA 2PTLA 4DAMA 1SE2A 4JI0L 4HK2A 1N32Q 3S14H 1F1HA 3T8MA 3N20C 4DR5L 3RZOB 1PRTB 2NN6I 4DV1Q 3A1QA 4DU9A 3HFZB 4L5SA 4XX5A 3A5UA 2LVQA 3AXCA 1WR1A 1PZJD 3HOXG 5LLIA 3SK6A 3S24A 3B0AA 3CC7A 1TZOA 3L9AX 1PLFA 4IUPA 2XK5A 2BS3B 3A8IE 4LNIA 4A3EB 1ZW7A 2JRHA 1Z5SB 3AEFB 4IOIE 3GZNB 2F1MA 2WKCA 3WANA 4Z9CB 4QMGA 1XLPA 3S1RH 1UBQA 2EOTA 2W54A 3T9LA 2ES2A 1XLNA 1X54A 2IYDB 1X3QA 1A70A 3CCSA 1K8GA 1MI0A 3J80L 3RYTA 3S1NH 3O13A 2F3WA 4C3IG 2I1KA 2YEPF 5AUKA 1V1PB 3ZQ4A 3N1ZC 1FGUA 3SFDB 1O7ZA 5C4ZA 3U7DA 1JORA 5FLXL 3HIZA 4RKBA 2RKSA 5BYRA 5GAHC 3G6JB 4KV6A 1D8LA 4MELA 5T8IA 4UHVA 4DV6Q 1IL8A 3ABVB 3P2BA 2JK8A 2QW7A 1Q90A 3GZNI 4LAAA 2HQEA 1WYDA 2NB0A 2SEBD 2NYZD 2B8GA 3WOFA 4DXGA 1UGJA 5JVH3 4IUQA 2O2LD 4RMAA 4KY6A 3RNAC 3DBRB 2EQSA 3CCRA 3ZTDA 4BOSC 3PPAA 5IY0A 4W9CA 2O6VA 3I57A 3J81E 2R7ZH 1WSPA 4R4OA 2BA0A 2EKEC 4C56C 2AKWB 5M3MH 2ZXPA 2L83A 5JEAH 3AE2B 1J8IA 5AZHA 4ZUJA 1KRSA 1K52A 3NENA 1U5KA 1XLQA 4MACA 5IYDG 2F0EA 2KZRA 1E2VA 1D5ZC 4A3DG 2G45B 2KX3A 3RPFC 2JT4B 1PV4A 2D0OA 3AU4A 2OEOA 3Q8FA 1EFWA 1B9NA 1VQ4A 3DBRI 4A20A 3L2PA 2BYTA 2BYVE 1VQ7A 3H0GG 4GDKA 2LHEA 1ET6A 3HM6X 1NNXA 1S5FD 3SHLA 2E5LL 2PMZB 2GBMA 3RR5A 2R61A 1X6OA 4WQOB 1E8WA 2NN6H 1NVID 1DCZA 2H1EA 2Z0DB 1PVOA 3KF8A 5JJZA 3VHTC 2J7ZA 2JYTA 3Q3MC 1WCMG 3OHXC 3K8AA 2O2VA 1HHVA 4QAYA 4W9LA 3PF5A 3LWUA 1ENAA 4PK1A 2IL8A 3TP5A 3PMFA 4TSSA 1PFNA 1O78A 1LT3D 4YCWA 3EA6A 2LGIA 3ECIA 4OHJA 2J42A 3RNBC 4A93B 4FJYA 2J0TD 3VQIA 5C4JH 2LUEA 3CAMA 4XTCS 3KDFB 3E9IA 2R7FA 2LI5A 1WRIA 5LMNQ 2QKIC 3DEOA 3LXFA 3ZIMA 3MC0B 3QWZB 2KDBA 1X3PA 1HTQA 2DNCA 2B2TC 5I9OA 2J0MA 3GQBA 4A3MB 2LXCA 1I4HA 1XNRL 2J0JA 4WIPA 2X6GA 2YVCA 2JA8B 3BK1A 4C3HG 1E24A 2OEDA 1PTOH 2G1EA 2DYOA 4CDCC 1NUCA 5EPJA 3CCEA 2FBWB 2KEEA 1EWHA 4ZRPA 2PMZE 2FUG1 1SNDA 3WIMA 3I72A 3DVNV 1HFGA 1WTWA 1P7EA 3KUZA 5L83A 3FHWA 1CQFA 3OWEB 1XTDA 4DAYB 2RD0A 4K81A 2VUMB 2PNRC 1SEBD 3F2DA 1SIFA 2R7DA 2IO3B 2B63H 3EFXD 2EMSA 3W9CB 1XMQQ 1X3FA 3RLNA 2DZKA 4K7WA 4FA6A 2K33A 1TIFA 1Q10A 3T1HQ 1VF7A 5CORA 2JRIB 4X65Q 2BKFA 3ZJUA 1YHBA 2O5JC 3VYTA 1KAWA 3D6WA 3HEJA 1CZWA 3N6RA 4MHEA 4JI0Q 5FLMG 2MWSB 3U4ZA 3TP7A 1NMGA 3BU2A 4B0EA 4DR5Q 2V3PA 2EYPA 4A76A 2BE5C 4X62L 3OJ4B 3K0XA 3MP9A 4PMWA 4GLXA 1TYGB 1ZXIA 1IKMA 2J7QB 2K8HA 5FR6A 4IUVA 1PRTF 1PMRA 4JPBW 4QUCA 1KM7A 4IG7B 2FUHB 2V3NA 4M01A 2JA9A 3I73A 3DWGC 3M7GA 1TU2B 1YHQA 1K0RA 5M5XB 1QVGA 3DLLA 1WVLA 1FJGL 3L16A 4CO7A 4HKQA 1DOXA 3KLSX 1SNMA 3ONSA 5JXVA 5CV5A 3MHZA 4I6LB 2R93G 2JXXA 3A9JB 3AN1A 3QIJA 3ZXVA 2RHQB 4LMQD 2R2OA 3KJPA 3OLMD 4W9DA 4TQUS 4ZRIA 1JOOA 3SHQA 4XWTA 3X23A 4DK6C 1NYQA 1J5EL 4XDCA 2JP1A 2KEDA 3A56A 4AOFA 2K04A 3Q23A 1OEYJ 3VR9B 2B2YC 3ZGZA 2FAZA 2DAFA 5BMHA 1YITA 3PT2B 2JN4A 1AEXA 5ELEA 5C5LA 3CCJA 1Q3LA 4JWSC 3HOXB 4A3KH 1N33L 1ET9A 2C7HA 2ZJDA 1JOQA 4NJ6A 4B95A 1PTOD 4A3FH 3H3VI 4JLCA 3VDYA 4EUTA 1GPXA 2KDFB 3IBEA 1W6KA 4FULA 1NBWA 3MHSD 1X65A 2XVSA 3HM3A 3OIQA 4JL9A 1XPOA 2KTRB 1EQTA 2YU9H 2FCQA 4JI6L 3EN2A 2FNJB 4AIMA 4DV3L 4A93H 3V61A 2B2UC 5C1ZA 1LFDA 2EY2A 1SSOA 2F0JA 1L0XB 2YTXA 1QOBA 2WU2B 1Y8RC 5IGBA 2JE6I 3P42A 4NKLA 3FDTA 2RBMA 2Z8LA 5MPOA 3PO2G 2KNBA 4R1JA 4OWXB 1Q1OA 1J19A 2KENA 3S1MH 2V4LA 1AW7A 2F0SA 4XYOA 1WXVA 4JE3B 4NJ7A 1KLVA 4A3MH 3OOCA 3J9CA 3IAM1 4V0BA 4LW1A 4PV1C 1EWIA 3A4SC 3JAMi 5H92C 1ZPSA 5EE1A 3FPUB 1UWXA 1SMYC 4FBJB 3K9OB 2Z59B 3GTGH 2WP8J 2E5LQ 2CQAA 1OQYA 2E6XA 5G3LF 2ZTDA 4A3CH 2ZVNA 2PQEA 2RA4A 1F2YA 4BY7G 1IUEA 3I63C 2YV5A 3MFYA 3ALBA 3PSIA 2VUMH 3ZJYC 1WGGA 5EAYA 5JJKA 2HJ1A 3W5VB 1RTNA 2PW5A 5IGDA 4DBGA 3HK0A 3EBEA 4DV2L 4HIDA 3G4SA 1ZUD2 4A3DB 2K8BA 2WWZA 2WXNA 1DOIA 2F0GA 2A69C 1E1OA 2K5VA 2LXAA 3I4NB 2ACZB 1J7CA 3DUZA 1HQRD 3JC66 1KDBA 3ULPA 1D1KA 3J7AF 3H0GB 3M4OH 4P2CB 2LMCA 2WACA 1SE3A 2DUDA 3OTOL 4GS3A 4TRDA 2Y3AA 5GQOA 2D07B 3W2DA 3NS1A 4A9AA 4C3JG 2JEBI 3V60A 4HDOA 1C0AA 4LDTB 3T56B 3HOYG 4IPDA 5C3XA 3GP7A 3NEMA 5DEHA 1D5XC 2D3GA 2L05A 1EY0A 1JOKA 2MNAA 1K8OA 1RAXA 2Y5CA 4MGIE 2D0PA 1XNRQ 1FFVA 3H3VH 4OWTB 5C0XJ 2QEXA 2ZJQA 4ASWC 3VUWA 1LO5D 4UP7A 4IM2A 4N9TA 1JCKB 1II3A 1C4AA 4CDEC 1WIAA 3U30A 1TXYA 5M5WB 2LUMA 3R3OA 3ENEA 3H6NA 1N60A 1CA6A 5FR3A 3PUWA 4YY3L 2JA5G 2C7MB 3N32A 2PIAA 2VY3A 4HCPB 1CI3M 4I6NB 2A69D 1WI0A 2C60A 5IAAC 2PMVA 1WJJA 1XF5L 1H95A 3FAHA 3KBGA 4KY7A 3BG3A 3MC8A 4KDLB 3Q3OC 2K03A 4LLGM 5AJ3L 1WFQA 2J0KA 1H9RA 3CW2C 1A0IA 1EYCA 3QAQA 3OMGA 1HQMC 1NE3A 2LKVA 4C3HB 4HCEA 1EOVA 2M8SA 2BWES 3QOLA 1B2TA 3NVZA 1YJJA 3KH0A 3E6ZX 1B9MA 2IY1B 3PO0A 1MG8A 4X62Q 2WFWA 2OOBB 3BVGA 2OT2A 1Y69U 1TS5A 4M8NA 2HHHL 2KC2A 3RD4A 5E1FA 3JAMc 1TTNA 1Q7YC 1F9RA 1QCBD 1FJGQ 2AYOB 3UQAA 4IFDJ 2CWPA 4X66L 2PE6B 1PDQA 2B2YA 4DHJB 1RHPA 2NVYB 4G50A 1C8CA 4AQYL 1YNJD 4NQKE 1J5EQ 4YTMB 3I3TB 2E2JH 4XIGS 3AU7A 1GUWA 4HLEA 4WWNA 1YX6B 5D6JB 1D1IA 1V8CA 1O7YA 4HN7A 4IALA 1N33Q 1WTQA 4N6EB 1YN3A 1VCBA 3GOEA 3NVWA 4PYUA 4LF6Q 5CMDA 2BOSA 4JI7L 2MJEA 2I0QA 2IBIB 2KQ3A 2HQLA 2B2UA 2JJQA 3BVMA 1EEFD 3Q2AC 3DM1A 1OXXK 3KW5B 4KVGB 2K75A 2R93B 4HPLB 2KJHB 4UP9A 5CBEE 4BKGA 3I4NH 3EC8A 4JI6Q 4K7UA 4HWIB 4E3CA 4IJHA 4DV3Q 2QCPX 2N7DA 4P16A 4MZ9A 1B3AA 3TBIB 3OIPA 2CHXA 4GOPB 2KWDA 1LABA 4FF3A 2NBWB 2BH2A 4KGRA 4I6PA 1E90A 2KLGA 5DCNA 3CP0A 3P4RB 4XGAB 1TR5A 4MH8A 2KOLA 1DZ1A 2MJ3A 4PZ7A 2B76B 1X3GA 1E9MA 2PLPA 4GLAC 1BMLC 1GVPA 2B2VC 4L5TA 2FCMA 2RPQA 1XMOL 3JAME 4JW0A 5ELNA 2LXKA 4GGQA 1VD2A 2UXDL 2R7ZG 2PVOD 3H15A 3JYUA 3VR5A 5AEKB 3HS0C 3I8ZA 1FL0A 1FD7D 1XQQA 3F2CA 1KFYB 1QNKA 5M3MG 3T53B 3K5OA 2MQHA 2BBCA 2D10A 3PRZA 5D7GA 3KK7A 4PT5A 5JEAG 4PG3A 5IWAL 1KDAA 4MN3A 3PO2B 4C1NI 1VS0A 1RWSA 1TWFH 2BKRB 4ZRJA 4DDID 3VH3B 5EKIA 4A3LH 3QJZA 3NZUA 3PIPA 2EXZA 2YYZA 4DV2Q 3GV3A 4C2MB 3ML9A 2E2HH 4G4KA 2OTJA 1EL0A 4L5RC 4XC2A 3OPOA 3Q3NC 2RCFA 4BXXH 3S17H 1WTOA 3DHHC 3OTOQ 4S3SA 1LTID 5FOBB 3QA8A 3R7RA 5E4WC 2CR5A 4TKNA 2NN6G 5KHQA 4JI8L 2MUYA 4EX5A 2PQAB 4G11A 2B3GA 4BY7B 1FD6A 1GUNA 1SRUA 5BR8L 2J53A 3DBLI 3VRAB 3HGBA 4KHPL 3HZXA 1QUQB 2I2YA 1TS4A 4FYDA 4N8FA 5LL6X 2I1JA 5BMIA 1H8CA 1RDPD 4MTNA 2K14A 3AB9A 3H7PA 3CKIB 5T1IA 1EYDA 2JY6A 2LASA 1IBXB 2G5DA 4RA8A 3C1EA 3VH4B 2M17A 4HMJA 4P1BC 3PS6A 4YY3Q 2M19A 3IAYA 2FIDA 2DENB 1DONA 4W9FA 1LTRD 4C3JB 1V9JA 1EYAA 1DGSA 5IYBH 3HOYB 1IBLL 4DUYL 2B39A 3KBXA 2E2DC 5AJ3Q 3CMEA 3M7NA 1A63A 1GB1A 1QF6A 1VQHA 3KUDB 1X32A 4MSMB 3I70A 4XDXA 2REXA 3V6EB 2ZJPA 4RM9A 1HH2P 3X0WA 5A35A 3M85A 4AP4C 4DNRB 2AX5A 4HCSA 3PHXB 1CKNA 1QILA 2AQ3B 2ZPYA 3PV1A 2ON8A 3CC4A 3B2FA 4MNOA 2JA5B 4M02A 4P7IA 4YSYB 3SU8X 2X6LA 3QG1A 3I5JC 3IT6B 4QJFA 1IW7D 3AU5A 1GUSA 2K6AA 1Q1BA 2B63G 1V5OA 2KOXA 2Y5BB 4ZKCB 1WM3A 2GBKA 2BDOA 2RDHA 1KNEA 2UUCL 2VQEL 2HHHQ 2QDLA 4POGA 1PH7A 2HDEA 2NBFA 1OTRB 3AV8A 1NBFC 2EY5A 2K05A 5CV7A 4L6TB 4RH6A 1VQ5A 2DNEA 2Z6BA 3NELA 4LTUA 5IOIA 5J1ZA 4ZHOA 5IGEA 1PGBA 4UAIA 1MFWA 4X66Q 1TT5B 2MGSA 1WWTA 2D3AA 4IJLA 1L2NA 5EPKA 2ZM6L 2RF4A 4W9KA 3U58A 1FXIA 1T5EA 1BXTA 4AQYQ 3GE8C 1VQ6A 4XQQA 5T1GA 3GV6A 3A7AB 1E22A 1WM2A 3D8GA 3BZKA 3SE0A 1WTXA 1YJ1A 3C8YA 1YIWA 1C4CA 3ZJVA 3ZDTA 3NBHA 3VYUA 1LTAD 4A3GB 5DM63 1S5DD 2V4IB 2KK8A 1Y1WH 3PV0A 4X3KA 5COYA 1GO3E 1K3RA 1R7SA 3PUZA 1PHJA 3K5LA 5CR3A 1PH6A 3TP8A 2Q2UA 3W1SC 4JI7Q 4BA2I 2EY1A 3SGIA 1PH1A 3HKZE 3G7LA 3PIOA 2KT7A 4P72A 4ZRZA 3UE0A 1HUMA 2AWOA 2H89B 1GUTA 5JPMC 2EELA 2HIXA 3S14B 5G5HA 4NXNL 1KC8C 3OW7A 4Q2JA 1SNQA 4FVMA 1S3SG 2EKIA 1FM0D 2MP2B 4C2MH 3EQLC 3FPPA 2JQOA 1N9WA 2C5CA 5JHAA 3CIRB 4Y7NB 4C1NK 2F4IA 4FO2A 1Y14B 3M4QA 2RDGA 5EGTA 4KLKA 1AARA 1SF0A 3MJWA 4A3KG 4K7SA 4KSKC 1SDFA 4OX9L 1PH5A 3TL5A 1EWCA 4B6WA 2CQOA 4A3FG 3GTJB 4YHHL 2B2VA 4BBRH 1L6UA 3S15H 4BY1H 1EUVB 2HTME 1PYWD 4ARIA 1A8VA 4ME3A 5BN4A 1AH9A 3U4EG 1I94L 2L3ZA 4ZAIA 1PZID 1XMOQ 1ESFA 4A93G 1CZGA 1HA5A 3URYA 2UXDQ 2KCCA 2JPHA 3CWIA 3TEZA 4BBNF 2ID0A 3OAWA 3VR2A 3Q3JA 1SAPA 5IWAQ 2K22A 1YNXA 2RGFA 3UI3A 4G7HC 5IT9c 1ZXTA 4WJNA 5JZEB 2WB1B 1TKWB 2ATWA 2B2WC 3PREA 4A3MG 3L17A 1PA6A 3TREA 3VYRA 1VJKA 1WXMA 3CD6A 2EYFA 4GKKQ 5LMNW 1LTTD 2BS2B 5I9PA 4YIJA 1OXUA 4B3TL 2O6VD 5KYLA 3A74A 2R7ZB 5JH5C 3A8JE 4QCLA 4W9IA 4AQ7A 4HRSA 5KGUA 4KJNA 2XN9C 4A3CG 2F03A 2L0CA 3K9PB 1E7PB 4BZAA 4JI8Q 3W5UB 1LT6D 3R2TA 1UZXB 2ASQA 3KWVA 1RIPA 2RMMA 1HPCA 5BR8Q 5F2DA 3NWSA 4HIKA 1TY0A 1J6QA 1BCPC 1LM0A 1I6HB 4KHPQ 1NI3A 2MBQA 2JYOA 1I7HA 1SE9A 3RZWC 2WNMA 5FO7B 4ILWA 4EQNA 2O4XA 4HMIA 1CHQD 4OVUA 3ER0A 3Q22A 2MHJA 1OEYA 4BVUC 2HD5B 1I50H 4FF4A 1VQKA 4CYEA 3W5OA 4RAUC 4HR7B 4XT1B 1OXVA 2WB1E 1JALA 1F9QA 4NB3A 3SR1A 1Z2MA 2CFMA 4KZ0A 4K0KL 3HP3A 3IVFA 2F0OA 3PGEA 4A3GH 5IGCA 3CPFA 5HGTA 1UE1A 1IBLQ 2R2QA 2H5XA 4DUYQ 1RLFA 1JWMD 3M95A 1LTLA 3ZVVA 3AE7B 3CPWA 3HRDD 3T4AC 5KNCA 1TQOA 2M00A 4EQPA 1DJRD 2CJOA 4OEMB 1B9RA 5C4JB 3ZLZA 2WXMA 5FO8B 2QIEB 2VRRB 5D3IB 5H8YE 4ACFA 3K5MA 2CJNA 3GTKB 4N9F4 1HXYD 2QDBA 2KHWB 3QO2A 3AFQA 3U50C 5IKCM 1EU4A 2Z0SA 4HAEA 4Y7NH 1AFPA 1H4RA 4OL7A 2ZXOA 1EY9A 2KXJA 2UUCQ 2VQEQ 3B6YA 4ZCKA 3GTJH 4KIKA 2ZEQA 4C7YA 1PTOB 3ZKJC 1K51A 5C3WA 3NSWA 4QQBX 3DDCB 1GKHA 2JA6B 2ZM6Q 2UUBL 5GAGC 1HFNA 4F8CB 4J15A 4C4VB 2CHBD 2F0LA 4US9A 1ZXHA 4KN7C 2V4DA 1L2FA 1I6VC 1TGZB 4JI5L 3PZ8A 4HJKA 5GMVA 3PUVA 4ZLTF 4QGUA 1V6EA 3W1SA 1IP9A 5KYIA 4GNXB 1ASZA 3BDOA 2KJRA 2B63B 1I4XA 3QCAA 1XX8A 5BYQA 4H13C 4ZOHC 2CWAA 1S40A 4X6AH 1FFUA 2NPTA 1T9HA 3AEEB 5CHWA 2OTLA 2FXQA 1CT1D 1V80A 1IL2A 1A2TA 1NDDA 3JVZX 2WX1A 5E6NA 2BT6A 1WMHB 1EFID 4M0WB 2AL3A 1B53A 2K5WA 2L76A 2YLMA 4NJCA 4USAA 4OELB 2M1MA 4K3CA 4NXNQ 2KFKB 2KCMA 1SFOB 3S2HB 5C6AA 3VA5A 3J81L 3B2GA 2A19A 2K28A 1DOKA 2NTSA 4CKCA 2PCFB 1IXRA 4F87A 1TS2A 1U4LA 1P8LA 1Y8PB 3J81j 2DWQA 2WKDA 2NCNA 1U4MA 2E76C 3QOJA 4XT3B 3I3CA 2VH2A 2WLBA 2OQKA 1D2BA 1WYWB 2DLBA 4OX9Q 3KF6B 3PLUA 1F2LA 4YHHQ 2ZTCA 3ITPA 3K57A 3CF6E 1EO6A 4QIWB 4K5WA 1VRAB 2L00B 1IGDA 1BBXC 1E1TA 4POFA 3AEAB 3BS1A 1L4DB 1UWVA 1I6HH 1UE7A 4CHKA 4P1CC 3CCVA 1ZDXA 1I94Q 2D2QA 1ACCA 3I4NG 4GDLA 2JXMB 2F0QA 1QVCA 2NTTA 2WXIA 4K8JA 1HZBA 1SYBA 2B2WA 5DLQE 4H0LC 1P3QU 2HDLA 2Z0EB 4A3KB 3CSFA 4XYCA 2N8NA 4HPPA 1UELA 2TMPA 4A3FB 2UYZB 3A55A 3MC9A 3DMUA 3MXNA 3DOWA 4OZCA 1GUGA 1NR2A 4Q5VA 2WDVB 1A15A 2A6EC 1XEEA 3FEWX 1B50A 2KTFA 4DAVA 1NENB 5EE9A 2KJ6A 5I2YA 4ZRQA 1TKYA 1SE4A 1WTPA 2N78A 1E0BA 3ULJA 1K8AC 2YU9B 1YHAA 1YMHE 4B3TQ 1QOHA 2FCSA 3RN9C 2EJFC 3AEDB 3RZDB 1M1KC 4ID6A 1N6ZA 2GOWA 2L0TA 2LY7A 1JRUA 3R93A 4GU2A 3ZJTA 4WORA 3HRZC 1EF1A 2K3UA 3GTKH 2RDBC 2YTVA 2JZ3B 4QIWE 2WXJA 2M2LA 3L0OA 2BS4B 3S1MB 3BVZA 1MSGA 4H7BA 1AE2A 4A3LG 1KAAA 5HURA 2FE8A 4WJOA 5C2TB 3DWPA 3NY5A 2A74C 2IGDA 3MXGA 4XE0A 1DGJA 2Z4HA 3I4MH 1DYQA 1JRPA 4BXXG 2JWZA 2JA6H 2Q5WD 1JJCB 4LFCL 3GTGB 1XT9B 1Z9FA 2A6ED 4KY5A 1EEID 1CJEA 1CUKA 1DM0B 4IPGA 2QILA 1MKHA 4IC7B 1JW9D 1EY5A 3NBIA 2FIFA 4K0KQ 1E3PA 2DBYA 3A33B 3TS2A 3AMZA 1KHIA 4FLHA 1WGDA 1UBIA 1X3EA 2VXWA 1E2WA 1SROA 4L8JA 4IUMB 4EGVA 1WXSA 1F2RI 3JSVA 4GOCA 4B9XA 4F1SA 1B3QA 3HVZA 2NS5A 2DJGC 4TV3A 1N61A 3M4OB 1JQ4A 2QJLA 2WQYB 3CQZH 4FXDA 2IY5B 4BBSH 1TZ1A 5E6OA 3TCAA 3ZTCA 4IZ8A 1SFOH 4DKAC 3S2HH 2A4ZA 2K5DA 2XRSD 2RHSB 1JJGA 1FEHA 4IWPA 2GA4B 4FDBA 5IYBG 2K1FA 4QY7A 5ISRA 3MXPA 4U68A 4H02A 4YCUA 1MPEA 1C7YA 1VQFA 3T51B 3R3MA 1HEZE 3QC8B 1PRTC 3IKJA 5TR5A 4FHJA 1SSNA 2WV6D 4NDXA 4HJ7A 4IWOA 2C9OA 2HDMA 2DHZA 1X55A 4K6LA 1PTOF 4PNYA 1JB7A 4KSLC 2KHSA 5HI1A 1SBBB 1VQEA 2IHEA 2UUBQ 1V5TA 1YN5A 1BNZA 2L7RA 3A9KB 4FN2A 1IBML 1Z7TA 1IYFA 1NMFA 1STNA 2AWNA 4JI5Q 3IL8A 2MBHA 3NK9A 1SB3C 3S9WA 2W55A 1PFSA 2WU5B 3AE4B 1H9SA 2N1VA 1S5CD 3AE5B 3BK2A 4G57A 4A8XC 2KD0A 3GD7A 2KCNA 4BWGB 4R9WA 2EYJA 3NUCA 5BN3A 3FC4A 2BE5D 1WD0A 1AYFA 3ERSX 4PZ8A 2J52A 3AEBB 2SAKA 2OF1A 2WGSA 3NTIA 4RGTA 5C4XH 2I38A 4ANWA 5LXHA 4IQZA 3ZRFA 1WOCA 5FO9B 4B3RL 3RUIB 4EZLA 4LF8L 1SGHA 1UD7A 1WE6A 1C78A 3KQ4A 1VZ7A 4OXPA 4G7ZC 3RLOA 3R2IA 2Y0SB 1R4QB 4JI1L 3RZDH 3J7AV 1O7IA 1Y1WG 4LNOA 3CRKC 2B8FA 1SYFA 1K53A 2KWUB 4DV0L 1STEA 3LJ3A 3UIPB 1J9OA 5EJWA 5M9OA 2GBNA 1ENCA 1WFYA 5IIFA 3D3RA 2NBUA 4B3ML 2A8VA 3HOUH 4TMAB 3HOWH 1MVKA 4ZKBB 4GIVA 2F0UA 1OQRA 3NHEB 4MM3A 4K6DA 1B70B 3VTUA 2AUJD 2AMCB 1DOYA 4FNFA 1V2YA 3FVQA 2E2JB 2XGTA 1VQJA 2K50A 2F0KA 1QZHA 1ZDVA 2JUOA 1LUZA 3QX1A 4DF7A 1G8ZD 1EYGA 2QHOA 1HNWL 4MGZE 2EYMA 4R4CA 4BBRG 3C19A 4E6IA 2MX2A 4BA1I 2VB3X 4BY1G 1I4PA 4N59A 4URKA 4GN3B 3PSEB 1TT2A 2KDMA 2E8GA 1WJ4A 5J17A 1ENFA 2E3TA 1PFMA 5J3BA 2YTYA 4RGMA 2RSUA 5M3FB 1BDOA 3FILA 4WJ3M 1WY8A 2Y0SE 4CDDC 1VMCA 3UDGA 1WTRA 3SR6A 1Q5WB 2KA7A 2VS1A 3PZ7A 4S0RA 2GN5A 2LHDA 1R4PB 1TWGB 4N9PA 1H9MA 2B29A 1HZAA 3U7ZA 4HCNB 3FKIB 4MT5A 4H44C 5LXIB 1U4AA 3D6CA 1NSNS 1EIGA 1G291 1Y8NB 4LF5L 1RF2D 2E75C 2I46A 1UEAB 1SMYD 2ZCCA 1YZ6A 1VQOA 3O65B 3WAOA 1XNQL 4EKUA 4US8A 3T16A 5I2XA 1VQLA 4BKSA 2F0NA 3C3LA 3HHMA 2LEKA 3IXSA 2LJ5A 1CFMA 1VQBA 1CKOA 2TSSA 1JROA 2KYWA 1RCVD 4DR4L 4GLSC 1BBWA 1G2TA 4GN1A 3HKZG 3ICEA 3F2UA 2N9KA 2CW0C 1P7FA 2WAQE 1FNVA 4LFCQ 1WJNA 2F0HA 2L11A 2MA9B 3RNCC 3J7YW 2ASBA 3KYDD 1FRDA 1E6EB 1BUVT 2NVQH 4EEWA 1TWFB 4ZRKA 1Y1VH 3IRBA 2K52A 1YN4A 2IX1A 3KLSA 2WXOA 5ELDA 5BO4B 1L4ZB 4DV4L 4DHZB 5EKKA 2CH4W 1FGBD 1YJNA 4WWOA 2MCNB 4IDIA 4JYAL 2E2HB 2N9XA 1Q46A 2WXFA 4ME5A 1RM6C 2LJIA 3PVLA 2PE9A 4GN4B 2OJWA 1FMAD 3KYCD 3S17B 1N34L 2ZVOA 4MJSB 1RTOA 3TZDA 4KMUC 3APCA 3T3OA 1QWYA 4CJ0B 2HE7A 4YWLA 3K0YA 3SEBA 4F88A 4A3GG 1HTLD 2H4OA 4M00A 2MEKA 4ZHPA 5CV8A 5L37A 2VZKD 2CW0D 4NAWA 3H1UA 1L1OB 2NZ1D 2EVBA 2LFIA 1OXTA 4LJOB 1V9PA 3DHIC 2JWUA 4HJ9A 3H91A 2F0WA 2KHJA 3SDLC 1G2SA 4OZAA 1P0RA 1E7VA 2XWJB 2L15A 4CJ1B 3MEFA 3AH7A 4HVBA 3H3VC 1BO0A 1NI2A 4DR6L 1IBMQ 2ZNVB 2GI9A 1MHWC 2SDFA 3C46A 3KVFB 5ELFA 1TKGA 5IODA 5I4DA 3A1QB 4RKLA 4K5VA 4UY8C 1V1PA 1JICA 5D3DA 4I65A 2KACA 4DHZE 4PYZA
chains in the Genus database with same CATH topology
2QMTA 4ABNA 4DNTB 3P20A 4ODGA 3OSOA 4IUTA 4U673 2Q8RE 5KIXA 3DWMA 1FNWA 4DA2A 1PXUA 1SNOA 1VR9A 3TDQA 2FMMA 2F0DA 1N62A 1QLBB 3A54A 4K5XA 1MHXA 2FHTA 2EJMA 4IURA 3MXUA 2HCCA 1JC7A 2N55A 4M8AA 2L55A 2PZWA 2K7VA 1F2MA 2W3RA 4OO1I 3JAML 4OGQC 3VR3A 5E3FA 1EQVA 4NP5A 1MSHA 5D65A 2ICIA 4JBWA 1GHKA 2PYKA 1N5XA 1STBA 3WCQA 2WIIB 1Y1WB 3V2TA 4L1BA 1CK1A 4TQ0A 2KMMA 1LT4D 2CVRA 4OIJA 1I4QA 1JWBD 2W3SA 4RF1A 2NVXB 1S4ZA 3NE5B 1CA5A 4DQOC 3U9SA 2K9XA 1VZ6A 3TSSA 4CKBA 5IGFA 4M1UB 1SJHD 5EQ0A 1S5BD 4GDKB 1RODA 3MFGA 3S1QB 3Q8BA 3QJYA 2XNAC 4PMBA 4BBRB 1STAA 3S15B 4BY1B 5C0XI 1JR0D 4A55A 1YJIA 3MWYW 1L0VB 4H2AA 3Q6SA 3ERQA 1VDZA 1V43A 2ICEC 4XQNA 1I4GA 2EE1A 2D62A 3AECB 1D6EC 4DAYA 1DD2A 4DFAA 1C79A 1CZPA 1PFDA 4A3JB 2SNSA 3CRLC 5EKLA 2JZPA 1UNSA 2IJ0A 4EQOA 3A7LA 3TN2A 1E2ZA 3EROA 3DEPA 4X3SA 1AZQA 3HKZB 4OO1H 4KGSA 4C80A 4NZLB 5CV9A 4J6HA 1Y56A 2A5HA 3IT4B 1TIID 4UDUC 1B44D 1EY7A 1XO3A 2XRQD 2M9VA 2BB5A 4JPSA 1Q12A 5JEAJ 4IFDI 2FJ2A 3GTOB 2FINB 1AWDA 4KJOA 5NUCA 1ZOYB 1VDVA 4OVZA 1F9SA 4ARCA 1I50B 3BYTB 4CJ2C 2KVMA 1FO4A 3D4DA 3TZUA 1LACA 5A2QL 3S16B 5A2QE 1N63A 4KKJA 3H94A 5C0XH 2D2CC 2Z1CA 2WDQB 2A68C 3SK4A 2FFKB 3N52A 1QNUA 3W3AA 1LV9A 1OFFA 3I4LA 4X3UA 5J22A 1HRJA 1ZE3D 1XLOA 2ZW0A 3GB1A 2WINB 1VCIA 3GS2A 1QG7A 2WDRB 4DK1A 1QOFA 1IHZA 3RMHA 2AUKA 3E5SA 1ZEQX 3ONAB 5FK9C 1B4OA 2XWBB 1STHA 3H6MA 1YQ4B 2MPMA 4J3OD 2A6HC 2AQ1B 4YSZB 3GTLB 4KTAA 4JWUC 2L12A 1SYGA 4IFDH 3Q69A 5EE3A 2IW3A 4KN4C 5KRUA 2VNUD 1J7BA 2NMQA 4OZBA 1NCVA 4NMZA 2FMCA 4XXEA 5JPNC 2WXRA 3NWTA 3GTMB 2IGHA 1TWCB 3MHBA 3NZ3A 4L2YA 1U4PA 4RHSA 5D14A 1RFKA 3HG9A 1WTVA 5TSSA 1E0ZA 2AQ2B 4WQMA 2LMCB 3H8HA 2MJDA 3EGRA 2SNMA 3V3XA 2EY6A 1QE6A 2PPBC 2BA1A 1T3QA 4LK1C 3SK5A 3ZYYX 1FYCA 3BDCA 1MBYA 1OO9B 3D4RA 1GAQB 2VB2X 4JK1C 1LTSD 1M4VA 1W6JA 3TP6A 5IT9E 3T13A 3B9JA 1BCPD 5CGKA 1B1ZA 3LYYA 4KKTA 2G9HD 3TUOA 2K1BA 2JYEA 1HTPA 3GO5A 1EY8A 5C4HA 2N7JA 2XIWA 3QWNA 4JX1C 1SYCA 1Q1EA 4PQXA 3I4MB 1PZKD 1YNNC 1JMLA 2WS3B 2E74C 4KHVA 4B9WA 2IT1A 3L7ZC 1XXGA 1DOMA 1GHJA 4NAWB 2ZW1A 2NWGA 4K14A 5HHDG 1A2UA 3NVYA 3VRBB 2L5TA 3EJIA 4K2LA 3ETRA 4HSPA 4WJWA 2HCIA 3C2PA 1QJOA 3CQZB 5CV4A 4BBSB 4PMCA 3T3NA 2BW2A 4A90A 5CYUA 1TS3A 3J80E 1A6XA 3P63A 1ROEA 2ZT9C 1WGKA 1AN8A 1JE4A 1H9KA 2RVLA 1YNND 3C1FA 3AB5A 1KLGD 1O80A 2A73B 1YQ3B 5FLXE 1KABA 3TMEA 3VR8B 3NTHA 3I90A 2J4XA 1QB5D 1IKLA 1KLUD 2R6GA 1L5PA 4RGNA 4IN3A 1G91A 5BMGA 2WXKA 4NAMA 2H88B 1TWAB 5JVG3 4ZYSA 2BTEA 1QOAA 4LK0M 5C4XB 3H09A 3LX0A 3PIP3 2D5GA 1HUNA 3QIAA 4WRDA 3GTQB 1C48A 1ZYRC 1KNAA 4GZYC 2N9LA 4KD4A 3MJ5A 3HOUB 3HOWB 4P6VF 1AZPA 2DN8A 3DWAA 1V97A 5C3EB 2M56B 1IBXA 1PGAA 3ND9A 1FCLA 1XTCD 4DK0A 3GTPB 3AMUA 1IYVA 1JWAD 5M5YB 3IFTA 1SNCA 2ZXRA 3NUHB 1STGA 2KN4A 3X3NA 2VZKB 3I9V1 2NUCA 1Z6HA 4EE2A 3PO3B 2EYOA 1A3VA 3TEYA 1ZYRD 2MP1A 2JX5A 2WXQA 4TKOB 5K36H 3EVQA 4HROA 3BWUD 4YWGG 1UWMA 4YTNB 4YTPB 3RUZA 4L23A 1UAPA 2F0VA 2XSCA 1EY6A 4XYQA 5BYSA 3Q24A 1LTGD 5I6WA 4O42A 4OO1G 1KTKA 2L1AA 2X38A 3HUIA 2R3ZA 4WH4A 2K5QA 1PTOC 1IGCA 1C76A 2NVQB 5LNK1 5HG2A 1Y1VB 3N9YC 1CTMA 4R8IA 2L32A 1ILQA 4FXCA 1VZ8A 1E10A 1F0ZA 5CC4A 1CQVA 2F0FA 2V0GA 3E9SA 4HEDA 1ML0D 3OMCA 2EDGA 4EVOA 3PIO3 3BDLA 2JQRB 5I6YA 1HZ6A 2GB1A 1PRTD 2LS01 4J8QA 1SYEA 2Z4IA 5KNBA 4DN4M 4QUFA 1EU3A 3Q8AA 1LLRD 2G9DA 4ITKA 4K8IA 2PW9A 4B08A 1VMPA 5C0XG 1NYRA 4C7ZA 3MEHA 2QEJC 4CHTB 2K5PA 4KKIA 2KJXA 1EZ6A 3CHBD 1EY4A 1SYDA 5LHY1 4YSXB 3P4SB 2L1BA 4C3IB 1FCCC 2WAQB 1EWYC 1C4PA 1FIQA 4RFBA 4RWSC 4LJZC 2EYHA 3U9OA 4ZUIA 3KWLA 1RKNA 3X3MA 1MI2A 3VR4A 1TJEA 3QB3A 5EPLA 2Q8IB 1GOZA 1VLBA 4IUNA 2JSOA 2Y5PA 3NQTA 3I91A 4XQJA 4FF2A 1Z47A 2WXLA 3LNNA 4RF0A 4XWWA 4R3DA 3NXWA 5IOCA 3FRPB 2WXHA 4KHZA 4IFDG 4OIKA 5E6JA 4J1MA 4ZQ3A 1VF5C 1FR3A 4A3BB 4OW0A 3TEXA 1HA6A 5DNFA 3CU7A 5G3LD 5IGGA 5JAVA 4DXFA 2WXPA 1EOTA 2B2TA 1F2RC 1EZ8A 3AEGB 2DY8A 1Y8OB 3MZ5A 2WP9B 4I7ZC 1CM9A 1OXSC 2LFNA 2MJ8A 1JB3A 1TKEA 2F0MA 1WCMB 4HKZE 4HJGE 5G5GA 1JWSD 1GB4A 2ENBA 1V1OA 5C5MA 2BCOA 1I4RA 5ELCA 3OWFA 4K2KA 1N5WA 4WWMA 4DGZA 1BQQT 4WURA 1SNPA 3AE8B 4AS1A 4Q0FA 2EZVA 5LL6S 2QF7A 1K83B 3E0JA 5ELBA 1WYGA 5K5PA 1YNJC 2JU6X 1ONLA 1EIHA 2IX0A 2MHVA 2KECA 2NVTB 1WXQA 1TY2A 3SXHA 3HOVB 1QQRA 1F77A 1SJED 3NRZA 1O7LA 5J39A 1STYA 4XDDA 2IX3A 3DXJC 1UUPA 5EE0A 3R8BA 3SVMA 4MIUA 1XCTL 3BIID 1PDXA 2INNE 4A3IB 4M0WA 2N88A 2KAJA 3LB8C 1K50A 3TEWA 4CBVA 2QSDA 1ILPA 1L6VA 1I3QB 1GJXA 3DHQA 3A8KE 3ND8A 3NPPA 2BB6A 2I07B 1Q8IA 2BDNA 3BYYB 3SK8A 4FF1A 4HEA1 1HZ5A 4RCNA 2K32A 3NVVA 1GXDC 1LTBD 2HUGA 3BZDB 3D31A 3KUPA 1CHPD 2IWHA 4QB4A 5AFWA 4FXGC 1PGXA 1M8AA 2DYMA 1NAPA 2X69A 4CQNA 5DM73 4KX6B 3PUXA 1T5XD 3P7JA 4N58A 4KK7A 4GDLB 2CU3A 2W82A 2K01A 1KRHA 1JWUD 3SDZA 5EBDA 4NW2A 5KNDA 3NQIA 2ONQA 2GRIA 1ZKOA 2D5DA 1YNTE 1H9JA 1BR9A 3K59A 4V190 1BUIC 4HSVA 1QT9A 4RNAA 1RD9D 1ZP0B 1MD2D 3LWEA 1WD1A 1R9TB 1C4QA 5BN5A 5CBAE 1DOLA 3V96A 4F7XA 2DY7A 1GUOA 2PZTA 5AUIA 1BOSA 5GXGB 3RFZB 2L4NA 3K6OA 1BCPB 2R92B 1SIJA 1C9FA 2MH7A 3P1MA 2KQ4X 4CGYB 4X3TA 2JXTA 4R8NA 1FRRA 5E4XA 3AM9A 3UI2A 1DXMA 1TWHB 1IW7C 1BF4A 3AE3B 2D9UA 3P4PB 2WXGA 3MVVA 3D4WA 3K5NA 1F9PA 1QOGA 3L3OC 3V05A 1NEKB 1FNUA 2IDYA 1XYIA 4YT0B 1ESRA 1D5MC 2PVGC 2F0PA 2PZUA 4IKGA 3VYSA 3MAQA 3S2DB 2Q8TA 4DAPA 2JEAI 4YXDB 5K36G 1G6ZA 3NHHA 4KI0A 3Q8EA 4REZA 2PO4A 4O1NA 5KEEA 2RSNA 3K7AB 3SFEB 1A3UA 3P4QB 3AE1B 1PFBA 5C44B 1HCZA 3MA2B 4TQ1A 4F8MA 4RGOS 2RDFA 2K0PA 2EJGC 2YEPB 4KD3A 1KH0A 4BS9A 2IPKD 1IYUA 1H9SB 2E2IB 5HFYA 3FMCA 1EM7A 1KDCA 1C77A 4QF4A 3HVDA 3M3YB 5DAUA 1NR4A 4RHRA 1XCQL 3AE9B 3Q0AA 1RYJA 4G7OC 2EYLA 3K58A 3L4PA 3AE6B 3Q8CA 2PKOA 2A68D 5FKAC 1U9RA 4CKEA 3NTKA 4ZK9B 2JA7B 1A3TA 3NP8A 3WOEA 3S1RB 1KF6B 2RPVA 3KLRA 1ICWA 4MM3B 4KKUA 3RLFA 2F3VA 1RJTA 3DWQA 3IFDA 2M0AA 3S1NB 5CV6A 3U52E 2JSVX 5EBCA 2OXPA 3WDNA 1MHHE 1L0YB 3MTSA 1LT5D 4AYBB 2SOBA 1PUTA 3E56A 2A6HD 5JOBA 2L52A 3FILB 5C3JB 2N0SB 2IGGA 2OHFA 1T6BX 2F0TA 3P75A 5M3MB 4ULLA 1TVXA 4IUUA 1U4RA 2PW7A 1S5ED 2INPE 3VR6A 4WAFA 1D4BA 1BCPF 1MGSA 1OQQA 1K8MA 3U2SC 1F2ZA 3IAS1 2EPBA 4A6QA 3PUYA 1JQYD 2F0IA 4RCOA 2RQXA 5IT9L 3P1HA 3EUB2 1SXTA 4FP5D 4L63B 2O5IC 4HTHA 4WFN3 4KGTA 3HOZB 1J7AA 3VA7A 2RSOA 1XWEA 1AP0A 1V8QA 4FXKC 1QKZA 4D2KA 4B0MA 3M4YA 4KKSA 1FXAA 2KUMA 2L9HA 2PTLA 1SE2A 3RZOB 1PRTB 2NN6I 4DU9A 1PZJD 3SK6A 1TZOA 3L9AX 1PLFA 4IUPA 2BS3B 3A8IE 4A3EB 3AEFB 4IOIE 2F1MA 2WKCA 4Z9CB 4QMGA 1XLPA 2EOTA 2W54A 1XLNA 1X3QA 1A70A 1MI0A 3J80L 3O13A 2F3WA 4C3IG 2YEPF 5AUKA 1V1PB 3ZQ4A 3SFDB 1O7ZA 5C4ZA 1JORA 5FLXL 4RKBA 2RKSA 5BYRA 3G6JB 4KV6A 5T8IA 1IL8A 3ABVB 1Q90A 4LAAA 2HQEA 2NB0A 2SEBD 2NYZD 2B8GA 3WOFA 4DXGA 1UGJA 5JVH3 4IUQA 2O2LD 4KY6A 3I57A 3J81E 1WSPA 2BA0A 4C56C 2ZXPA 2L83A 5JEAH 3AE2B 1J8IA 4ZUJA 1K52A 1XLQA 4MACA 2F0EA 1E2VA 1D5ZC 3RPFC 2OEOA 3Q8FA 1B9NA 2BYTA 2LHEA 1ET6A 1S5FD 3SHLA 2PMZB 2R61A 2NN6H 1NVID 1DCZA 2H1EA 3KF8A 5JJZA 2J7ZA 2JYTA 3OHXC 1HHVA 3LWUA 1ENAA 2IL8A 3TP5A 3PMFA 4TSSA 1PFNA 1O78A 1LT3D 2LGIA 3EA6A 4OHJA 2J42A 4A93B 2J0TD 3VQIA 4XTCS 1WRIA 2QKIC 3DEOA 3LXFA 3MC0B 1X3PA 2DNCA 2B2TC 5I9OA 3GQBA 4A3MB 1I4HA 4WIPA 2X6GA 2JA8B 3BK1A 4C3HG 2OEDA 1PTOH 2G1EA 2DYOA 1NUCA 5EPJA 2FBWB 2KEEA 1EWHA 4ZRPA 2FUG1 1SNDA 3I72A 1HFGA 1WTWA 1P7EA 3OWEB 1CQFA 2VUMB 2PNRC 1SEBD 3EFXD 3W9CB 2K33A 1Q10A 1VF7A 5CORA 3ZJUA 2O5JC 3VYTA 3D6WA 3HEJA 1CZWA 3N6RA 4MHEA 3TP7A 4B0EA 2V3PA 2EYPA 2BE5C 3MP9A 4PMWA 1ZXIA 1TYGB 1IKMA 4IUVA 1PRTF 1PMRA 4QUCA 2V3NA 3I73A 3DWGC 3M7GA 1TU2B 5M5XB 4HKQA 1DOXA 1WVLA 3KLSX 1SNMA 5JXVA 5CV5A 3MHZA 3AN1A 4LMQD 4TQUS 1JOOA 4XWTA 1NYQA 4XDCA 2JP1A 2KEDA 3A56A 2K04A 3Q23A 3VR9B 2B2YC 3ZGZA 5BMHA 5ELEA 1AEXA 5C5LA 1Q3LA 4JWSC 3HOXB 1ET9A 1JOQA 1PTOD 1GPXA 1W6KA 2XVSA 3OIQA 1EQTA 2B2UC 2EY2A 1SSOA 2F0JA 1L0XB 1QOBA 2WU2B 5IGBA 2JE6I 3P42A 4NKLA 3FDTA 2RBMA 2Z8LA 5MPOA 4JE3B 1AW7A 2F0SA 4XYOA 3OOCA 3J9CA 3IAM1 4V0BA 4PV1C 5H92C 1ZPSA 5EE1A 3FPUB 1UWXA 1SMYC 2WP8J 2CQAA 2E6XA 5G3LF 2PQEA 2RA4A 1F2YA 1IUEA 3MFYA 3W5VB 1RTNA 2PW5A 5IGDA 2WXNA 1ZUD2 4A3DB 1DOIA 2F0GA 2A69C 3I4NB 2ACZB 1J7CA 3DUZA 1HQRD 3J7AF 1KDBA 1D1KA 3H0GB 4P2CB 2LMCA 2WACA 1SE3A 4TRDA 2Y3AA 4A9AA 3W2DA 3NS1A 4C3JG 2JEBI 3T56B 5C3XA 3GP7A 5DEHA 1D5XC 1EY0A 1JOKA 1K8OA 2Y5CA 1FFVA 5C0XJ 1LO5D 4N9TA 1JCKB 1II3A 1C4AA 5M5WB 2LUMA 3R3OA 1N60A 1CA6A 5FR3A 3PUWA 2PIAA 1CI3M 2A69D 2PMVA 1XF5L 3FAHA 3KBGA 4KY7A 3BG3A 2K03A 4LLGM 1H9RA 1EYCA 3OMGA 1HQMC 4C3HB 2LKVA 4HCEA 3QOLA 1B2TA 3NVZA 1YJJA 3E6ZX 1B9MA 3PO0A 3BVGA 2OT2A 1Y69U 1TS5A 3RD4A 5E1FA 1F9RA 1QCBD 4IFDJ 1PDQA 2B2YA 1RHPA 2NVYB 1C8CA 1YNJD 4YTMB 4XIGS 3AU7A 1GUWA 1D1IA 1V8CA 1O7YA 4HN7A 4IALA 4N6EB 1WTQA 1YN3A 3NVWA 5CMDA 2BOSA 2MJEA 2KQ3A 2B2UA 3BVMA 1EEFD 3DM1A 1OXXK 2R93B 5CBEE 2QCPX 4P16A 1B3AA 3TBIB 3OIPA 2KWDA 1LABA 4FF3A 4KGRA 3P4RB 1TR5A 4MH8A 2KOLA 1DZ1A 2MJ3A 2B76B 1E9MA 2PLPA 1BMLC 2B2VC 3JAME 2PVOD 3VR5A 3HS0C 3I8ZA 1FD7D 1KFYB 1QNKA 3T53B 3K5OA 2BBCA 5D7GA 3KK7A 4PT5A 5JEAG 1KDAA 4MN3A 3PO2B 4C1NI 1RWSA 5EKIA 2EXZA 2YYZA 3GV3A 4C2MB 4G4KA 1EL0A 3OPOA 1WTOA 4S3SA 1LTID 5FOBB 5E4WC 2NN6G 2MUYA 4BY7B 1FD6A 1GUNA 2J53A 3VRAB 3HGBA 3HZXA 2I2YA 1TS4A 4FYDA 5LL6X 5BMIA 1RDPD 3AB9A 3CKIB 5T1IA 1EYDA 1IBXB 4RA8A 3C1EA 4HMJA 2M19A 3IAYA 1DONA 1LTRD 4C3JB 1EYAA 3HOYB 2B39A 3KBXA 2E2DC 3M7NA 1GB1A 1QF6A 1X32A 3I70A 4XDXA 5A35A 3M85A 4DNRB 2AX5A 4HCSA 1QILA 2AQ3B 2ON8A 3B2FA 2JA5B 4YSYB 2X6LA 3QG1A 3IT6B 1IW7D 1GUSA 2K6AA 1Q1BA 4ZKCB 2BDOA 2RDHA 1KNEA 2HDEA 3AV8A 2NBFA 2EY5A 2K05A 5CV7A 4L6TB 4RH6A 2DNEA 4LTUA 4ZHOA 5J1ZA 5IGEA 1PGBA 4UAIA 1WWTA 2MGSA 5EPKA 1FXIA 1T5EA 1BXTA 4XQQA 5T1GA 3GV6A 3A7AB 3D8GA 3SE0A 3C8YA 1WTXA 1C4CA 3ZJVA 3NBHA 3VYUA 1LTAD 4A3GB 5DM63 1S5DD 2V4IB 3PV0A 4X3KA 5COYA 1R7SA 3PUZA 3K5LA 5CR3A 3TP8A 4BA2I 2EY1A 3G7LA 4ZRZA 1HUMA 2AWOA 2H89B 1GUTA 5JPMC 2EELA 3S14B 5G5HA 3OW7A 4Q2JA 1SNQA 4FVMA 2EKIA 1FM0D 3EQLC 3FPPA 2C5CA 3CIRB 4Y7NB 4C1NK 2F4IA 4FO2A 5EGTA 2RDGA 1SF0A 1SDFA 1EWCA 3GTJB 2B2VA 1L6UA 2HTME 1PYWD 4ARIA 5BN4A 3U4EG 4ZAIA 1PZID 1ESFA 1CZGA 1HA5A 3URYA 3CWIA 2KCCA 3TEZA 2ID0A 3VR2A 1SAPA 2K22A 3UI3A 4G7HC 1ZXTA 2WB1B 1TKWB 2B2WC 3VYRA 1VJKA 2EYFA 1LTTD 2BS2B 5I9PA 4YIJA 1OXUA 5KYLA 2R7ZB 3A8JE 4QCLA 4AQ7A 4HRSA 5KGUA 4KJNA 2XN9C 2F03A 2L0CA 1E7PB 3W5UB 1LT6D 3R2TA 3KWVA 2RMMA 1HPCA 5F2DA 3NWSA 1TY0A 1BCPC 1I6HB 1NI3A 2JYOA 1I7HA 2WNMA 5FO7B 4ILWA 4EQNA 2O4XA 4HMIA 1CHQD 3Q22A 4FF4A 4RAUC 4HR7B 4XT1B 1OXVA 1JALA 1F9QA 3SR1A 3HP3A 2F0OA 5IGCA 5HGTA 1JWMD 3AE7B 3HRDD 3T4AC 5KNCA 1TQOA 2M00A 4EQPA 1DJRD 2CJOA 1B9RA 5C4JB 2WXMA 5FO8B 2QIEB 5D3IB 5H8YE 3K5MA 2CJNA 3GTKB 1HXYD 2QDBA 3QO2A 1EU4A 4HAEA 1AFPA 4OL7A 2ZXOA 1EY9A 4C7YA 1PTOB 1K51A 5C3WA 3NSWA 2JA6B 1HFNA 2CHBD 2F0LA 4US9A 1ZXHA 4KN7C 2V4DA 1I6VC 3PZ8A 3W1SA 3PUVA 4ZLTF 5KYIA 3BDOA 2B63B 1I4XA 1XX8A 5BYQA 4H13C 4ZOHC 1FFUA 3AEEB 1CT1D 1A2TA 2BT6A 1EFID 4USAA 1B53A 2K5WA 4NJCA 1SFOB 3S2HB 5C6AA 3VA5A 3J81L 3B2GA 4F87A 2K28A 1DOKA 2NTSA 4CKCA 2PCFB 1TS2A 1U4LA 2DWQA 1Y8PB 2WKDA 1U4MA 2E76C 3QOJA 4XT3B 3I3CA 2WLBA 1D2BA 2DLBA 1F2LA 3ITPA 3K57A 4QIWB 4K5WA 1VRAB 1IGDA 1BBXC 3AEAB 3BS1A 1L4DB 1ZDXA 1ACCA 2JXMB 2F0QA 2NTTA 2WXIA 4K8JA 1SYBA 2B2WA 4H0LC 2HDLA 4A3KB 2TMPA 4A3FB 3A55A 3DMUA 3MXNA 4OZCA 1GUGA 1NR2A 4Q5VA 2WDVB 1A15A 2A6EC 1XEEA 3FEWX 1B50A 5EE9A 4DAVA 1NENB 5I2YA 4ZRQA 1TKYA 1SE4A 1WTPA 1E0BA 2YU9B 1YMHE 1QOHA 2EJFC 3AEDB 3RZDB 4ID6A 3ZJTA 2LY7A 3R93A 4WORA 3HRZC 2K3UA 2WXJA 2M2LA 2BS4B 3S1MB 3BVZA 1MSGA 4H7BA 1KAAA 5HURA 2FE8A 5C2TB 3DWPA 2A74C 2IGDA 3MXGA 4XE0A 1DGJA 2Z4HA 1DYQA 1JRPA 2Q5WD 3GTGB 2A6ED 4KY5A 1EEID 1CJEA 1DM0B 2QILA 1JW9D 1EY5A 3NBIA 2DBYA 3AMZA 2VXWA 1E2WA 4L8JA 4EGVA 1F2RI 4B9XA 3HVZA 1N61A 3M4OB 1JQ4A 2QJLA 2WQYB 4FXDA 4IZ8A 2K5DA 2XRSD 1FEHA 2GA4B 5ISRA 3MXPA 4U68A 1MPEA 3T51B 1HEZE 1PRTC 3IKJA 1SSNA 2WV6D 4NDXA 2C9OA 2HDMA 4K6LA 1PTOF 4PNYA 2KHSA 5HI1A 1SBBB 1YN5A 1BNZA 1Z7TA 1STNA 2AWNA 3IL8A 3NK9A 1SB3C 3S9WA 2W55A 2WU5B 3AE4B 1H9SA 1S5CD 3AE5B 3BK2A 4G57A 4A8XC 3GD7A 2KCNA 4BWGB 4R9WA 2EYJA 3NUCA 5BN3A 3FC4A 2BE5D 1WD0A 1AYFA 2J52A 3AEBB 2SAKA 2OF1A 3NTIA 4RGTA 2I38A 4IQZA 5FO9B 3KQ4A 1C78A 1VZ7A 4G7ZC 3R2IA 2Y0SB 1R4QB 3J7AV 3CRKC 2B8FA 1SYFA 1K53A 1STEA 1J9OA 5EJWA 5M9OA 1ENCA 5IIFA 3D3RA 4TMAB 1MVKA 4ZKBB 2F0UA 1OQRA 4K6DA 2AUJD 1DOYA 4FNFA 3FVQA 2E2JB 2F0KA 1ZDVA 4DF7A 1G8ZD 2EYMA 4E6IA 4BA1I 2VB3X 1I4PA 4N59A 1TT2A 2KDMA 1ENFA 2E3TA 1PFMA 4RGMA 5M3FB 1BDOA 3FILA 1VMCA 1WTRA 3SR6A 2KA7A 3PZ7A 2LHDA 1R4PB 1TWGB 4N9PA 1H9MA 3U7ZA 3FKIB 4MT5A 4H44C 3D6CA 1NSNS 1EIGA 1G291 1Y8NB 1RF2D 2E75C 2I46A 1UEAB 1SMYD 4US8A 3T16A 5I2XA 2F0NA 3C3LA 3IXSA 2LEKA 1CFMA 2TSSA 1JROA 4GLSC 1RCVD 1G2TA 3F2UA 2N9KA 2CW0C 1P7FA