4IOIE

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ioiE00
1UWXA 2KDMA 5HI1A 2J52A 2N9KA 1XCTL 3FILA 2GI9A 1XCQL 2RMMA 2PLPA 4GLSC 5JXVA 2KACA 1GB4A 1K51A 1Q10A 4HJGE 1GB1A 1HZ5A 2JWUA 4IKGA 1K50A 2LUMA 2RPVA 1JMLA 2JU6X 4OZBA 3FILB 4D2KA 1PGXA 1K53A 2IGHA 4KGRA 1IBXB 1YNTE 2QSDA 1MHHE 2LHDA 4OZCA 1IBXA 2JXTA 2JZPA 2QMTA 1MI0A 4KGSA 1C9FA 2IGDA 3V3XA 5HG2A 2K0PA 1D4BA 5BMGA 2JSVX 2OEDA 2N7JA 2IGGA 2EELA 2KWDA 1IGCA 2ZW1A 1MHXA 5HFYA 2GB1A 1FD6A 1HZ6A 2ON8A 3GB1A 2I2YA 1MVKA 3MP9A 4KGTA 2LHEA 2PW9A 2NMQA 4OZAA 4HKZE 1FCLA 1YMHE 2J53A 1PGBA 5BMIA 1P7EA 1ZXHA 2N9LA 1KH0A 4WH4A 1QKZA 1IGDA 5HHDG 2ONQA 1P7FA 1K52A 2KN4A 2I38A 2KQ4X 2PTLA 2ZW0A 4IOIE 2LGIA 1XF5L 5BMHA 1PGAA 1F2RC 1EM7A 1HEZE 1F2RI 1FCCC 4MACA 3UI3A 1MPEA
chains in the Genus database with same CATH superfamily
2W9NA 2AYOB 2G9HD 3KYCD 1EU3A 1TS2A 2K39A 3NZ3A 4US9A 3TL5A 1T0QC 4NPNA 1Z5SB 2C7MB 2PLPA 3L4PA 3RUIB 3ZYYX 1RWSA 2HTHA 2V4LA 4IWOA 5EE0A 5DPRA 3VHTC 4MH8A 1HZ5A 2Q5WD 1RRBA 4WWOA 2Z0DB 1FXAA 4K1RB 2BYFA 4NAMA 2KDFB 2L76A 1TY0A 4RGTA 1P98A 1FNUA 3R2TA 3DVNV 1QILA 2X8XX 1OQYA 1GPXA 3IAM1 4G3XB 1Q5WB 2QSDA 1KFYB 3MHZA 4IUMB 1YJJA 2K25A 2H89B 1QOAA 4GDLB 1I4QA 1YJIA 3W1YA 1E8WA 3BINA 2KFKA 4BOSC 3RD2A 5T8IA 2M0AA 3U2SC 2KWDA 3MJ5A 2KANA 2GB1A 3QARA 2GMIC 1V86A 4MT5A 5IA7A 1Q1OA 1C78A 2CHXA 1MVKA 3ZXRA 1AN8A 1SXTA 2Y5PA 4MEMA 4K81A 3VRAB 4A9AA 4OHJA 1WIAA 2FCNA 2J0JA 1RFAA 4A8XC 3VR9B 2WXHA 3NG0A 4EZJA 1TIFA 2WGSA 3PT2B 2KT7A 4C56C 1SE9A 3S2AA 2H88B 2WXIA 1R4NI 3JSVB 1NBFC 3AEGB 3Q6BA 3HVZA 1K8RB 2BTEA 1HTQA 2KQ4X 1FXIA 1SF0A 2PTLA 3QAQA 4AQ7A 1VLBA 3WANA 1YIWA 1V81A 2WLBA 1C4CA 4MACA 2MBOA 4F1SA 3RI7C 1N63A 1WMHA 2FAZA 1EWCA 2IO0B 1Q0WB 4RF1A 1UH6A 4BKSD 3LDZE 2IDYA 1ZPSA 2DYOA 4ICUA 3WCQA 3ZDTA 1Q10A 1DOIA 4WQOB 2CJOA 4EE2A 3B0AA 4LTUA 3M63B 1N62A 2BYVE 3V6EB 2KZRA 1Y8RC 3J9CA 1KLUD 2D3CA 1UWMA 5IAAC 4D2KA 1KRHA 3VDZA 1JRUA 5L83A 4HXDA 1VCBA 1QQRA 3PZ7A 1TZOA 1C77A 3BVZA 5GMVA 3P4PB 1D5ZC 1SSNA 4OVVA 1WM2A 2RDBC 3DQVA 4KDLB 3AEBB 3ZRFA 3ABVB 4XDDA 3DBRI 3URYA 1RAXA 2J0MA 4WIPA 2NR2A 2Y5CA 2C60A 4II3B 1NDDA 4FJYA 3KLSX 3P4QB 3Q3NC 4DDGD 4N59A 5G5HA 2WDRB 4HKZE 2PPHA 2FIDA 2MP2B 3B1LX 1WXMA 2GBNA 4ZHOA 2NTSA 3DDCB 2LXCA 1I4GA 2OHFA 1SB3C 3PS6A 2HJ8A 3AE9B 3RZWC 2WXPA 5H8YE 1NI2A 3AULA 3X23A 2I38A 4OW0A 3P4RB 2QEJC 3PRPB 4G0NB 2LZ6A 3KUZA 2KOXA 4BKGA 4RGOS 2WXLA 3NRZA 3RMKC 1L0VB 3AEDB 4LJOB 1GAQB 5HI1A 1P9DU 1JWSD 2KK8A 2MBQA 1LQBA 1I4XA 2K1FA 4KKIA 1E7UA 5C2TB 2MA9B 2YLMA 2JUOA 3QJZA 1UNSA 2LUEA 3Q3FA 4MM3B 1WR1A 4XE0A 3VTWA 4WWPA 2WXFA 4IDIA 1L0YB 1NEKB 1H8CA 2GBMA 4AOFA 2IGHA 1AW7A 2ICIA 5AZFA 1I4RA 4CYEA 5LLIA 4C80A 3AE1B 2ZPYA 1HTOA 1XQQA 3BZDB 3NS8A 2N1WA 2DZJA 2O6VB 4F8CB 2L32A 2M1MA 4HWIB 3RN9C 1PYWD 2G1EA 4R3DA 1YN4A 4JGHB 2KTRA 4C4VA 3Q8EA 3BK1A 5L95C 4KV2A 3ZXVA 5BMIA 2LWPA 1TS3A 4YT0B 3AE6B 2ZJDA 5IN7A 4ZYSA 2W3SA 3NZUA 1PDXA 1V6EA 1JCKB 1R4MI 3ZW3A 3TJPA 1PFDA 1MFWA 3PRMB 2ONQA 4RF0A 1L0XB 2AL6A 2KDEB 1QF6A 1FCCC 2L00B 4PYUA 3RNFC 2MX2A 4DXFA 3P4SB 3ENEA 2J52A 3LJ3A 4AS1A 2CHWA 1GG3A 1DYQA 4M01A 4BVUC 2V3NA 1XT9B 3EFCA 1GB4A 2VZKB 3N1ZC 2GLSA 2RR9A 2NPTA 4KSKC 4BKTA 2REXA 4GDLA 2D2QA 2L8JA 1EUVB 2G3QB 2XK5A 4LDTB 4ICVA 5AUIA 4LLGM 3MJWA 3A9JB 4FHKA 4AWJA 1UELA 2JYEA 1ZKHA 4S0RA 1WWTA 3GOEA 2QCZA 3DBLI 2DAFA 1FPYA 2C7HA 3ZGZA 4ZDVA 2K0PA 4DHJB 4TKNA 3HM3A 4KIKB 1CJEA 3AM9A 2GOWA 1V8CA 4YSXB 1MHXA 5CHWA 5AUKA 4HPPA 3TUOA 4MDKE 1HZ6A 3AE8B 3GB1A 3MTNB 3H9DA 3QIJA 4FBJB 5G5GA 3W9CB 4KZCA 4TV3A 5FR3A 1YD8U 2DBYA 3O13A 3M62B 5D6JB 2WXQA 2LHEA 2NMQA 4AJYB 3PREA 1FCLA 2M4NA 1XLOA 4ANUA 3ZNZB 3RFZB 2D5GA 3KWLA 1C4AA 4XZ4A 1D5MC 5FR6A 3MC9A 3CIRB 4NJCA 4DDID 4YXDB 3E9SA 1E9MA 3CSFA 3ONSA 4TQ0A 2KDIA 2KQSA 4G50A 3SFDB 2R2OA 3Q3MC 2MQJA 3TEXA 1OQRA 1KOTA 4HLEA 5E6OA 4L1BA 3ETRA 2KMAA 3L54A 1RYJA 2AWTA 3VH4B 4XWTA 3K9OB 5E6JA 4JLCA 4J6IA 3AEEB 1VZ8A 2KJ6A 4GDKB 3PO0A 3TEYA 2ZZPB 2CJNA 1YQ3B 3UIOB 2KVZA 3FILB 4O1NA 2KKCA 1XO3A 3LYYA 1R4NB 1V1OA 1FXTB 2KWUB 1ZDVA 1YQ4B 3NJTA 4A20A 4OZCA 3AN1A 2JXTA 2WX1A 1VRAB 2L7RA 1H4RA 2IGDA 2QIEB 1M94A 4JQWC 1G6JA 5HG2A 4RFBA 2OEDA 1VJKA 2G45B 4H2AA 3UQAA 4HEA1 4FULA 4ZRKA 3DHIC 1QLBB 3AE2B 2KN5A 4GOCA 3MP9A 4I6LB 3L13A 3KVFB 3WAOA 2L3ZA 1C76A 2M17A 1WI0A 2J53A 3APCA 1WGRA 4A3PA 1MG8A 2K6QA 2MHJA 4FADA 2WDQB 1YN3A 1V80A 1WXSA 5D3DA 2LMCA 2BB5A 1PQSA 2PE6B 1PGAA 3C19A 3DBRB 3PV1A 4RH6A 3P63A 2B3AA 3IAS1 2XNAC 4OVZA 2KTFA 2NBVB 4BKSA 4BFRA 2RDHA 3SFEB 1J19A 2MRPA 4F7ZA 4NAWB 1A70A 1SJED 1XCQL 1XLPA 1ZGUB 2WYQA 4MSQB 1OTRB 2V1YA 2HDEA 3I9V1 4TMAB 2LGSA 4XGAB 2CS4A 5LXIB 2A4ZA 1C79A 1L2NA 1FIQA 2MSED 4W9GA 2WS3B 2DHZA 1OEYA 4OZBA 2AQ3B 5IO9A 4I6PA 4IWPA 2EKEC 3H7PB 4K7UA 1EF5A 2PMVA 3MFGA 2BB6A 4IM0A 3P2BA 4NJ6A 1WGKA 3RPFC 4GU2A 4FXCA 1IPGA 1E8XA 2O2VB 2ON8A 4IM3A 1GUAB 1TYGB 2I1KA 2E3TA 4AP4C 3LXFA 4K3BA 2N4FA 1ET9A 3ZRCA 1WSPA 2KJHB 1WGDA 3U7ZA 1WZ0A 1TTNA 4TSSA 2D11A 3B08A 3QA8A 3BIID 2IO2B 4NNJB 5D7GA 2YVCA 4JL9A 4NZLB 3V6CB 4MGYE 1X1MA 2R2QA 5EE9A 1K52A 4IOIE 2AQ2B 3R7QA 1WYWB 3DBHI 2LFIA 3NVWA 2MBHA 3KUDB 1VD2A 4WJPA 3N9YC 2KDMA 2JYTA 3PHXB 1MG4A 1TJEA 1FFVA 2JPHA 2MW5A 2BWFA 4W9JA 4GMVA 1V1PA 2FCSA 4RCOA 1YOVB 3Q69A 3EECA 2DZIA 2WXMA 3AECB 1R4MB 3DPDA 2BYEA 1WZ3A 3NZSA 4EFOA 1C4PA 1CQVA 4BAXA 3AE7B 3W1SC 1IBXB 1ROEA 1VDVA 2MJ3A 3QK0A 2ZVOA 5H92C 5JZEB 1LGRA 4KGSA 1RFKA 3OJ4B 2QJLA 1T0YA 2ZPNA 1N60A 4EEWA 3V3XA 3OG5A 3L0WB 2NTTA 2LJ5A 1E5WA 3DHHC 3N1XC 1UUPA 1P0RA 5HFYA 4DHZE 5GXGB 3TBLD 1TZ1A 4M0WB 3B9JA 4K7SA 1GNUA 3VTUA 1V9JA 3Q14C 3T8MA 2PW9A 3APDA 2X38A 2O6VD 3PRZA 3Q8AA 4ARIA 1FFUA 1E0ZA 3SDLC 3JVZX 1C3TA 5IP4D 2DZMA 2JXXA 2N9LA 3R3MA 2LVOA 3GZNI 2BKFA 1YX5B 2BBCA 2BGFA 5J2RA 1FNVA 3GP7A 2J7QB 2KX0A 3DBLB 4HJKA 5BMHA 2FIFA 2WQYB 1BT0A 5CX3A 3IFWB 1E8ZA 1TKYA 2WXNA 4RGMA 3FILA 2KX3A 3A9KA 3CMMB 1ET6A 1HE8A 2KAJA 3PZ8A 3H6NA 3AMZA 2KACA 3ZJTA 3KYDD 1F77A 4X57B 4E71A 2JWUA 1VR9A 4IG7B 2JU6X 3PTFC 4W9LA 3QWZB 2ZEQA 1OGWA 1QT9A 3NVZA 2ZCCA 3A1QB 2K3UA 5KHQA 3GE8C 1DGJA 2LGYA 2Z0EB 4LDTD 5G55A 1UGMA 4NJ7A 3KUCB 2KD0A 1P3QU 2JX5A 4MH0E 2DX5B 4PS7A 1D4BA 3WA0A 1GOZA 2DYBA 4ITKA 1IUEA 2K6DB 2RDGA 3PVLA 2BKRB 1WJUA 2KMMA 4MSMB 2KQ7A 3TMPB 4ASWC 4DHJD 3VUXA 2GRIA 2MJDA 2E6XA 4JPSA 2W82A 2XN9C 5EE1A 3VQIA 1F1HA 2WDTB 3BK2A 5E6NA 1XLQA 2BT6A 2FUHB 5C3JB 2N7EA 2INPE 4MJSA 1B1ZA 4LNKA 4EUTA 2KN4A 2DYMA 4P1CC 4E74A 4EKUA 3EA6A 5CHVC 2HD5B 1J8CA 1UWXA 3UQBA 3X0WA 2LI5A 2LRWA 3PGEA 4J3OD 2DNFA 3AE5B 5J18A 3ZTCA 3T9LA 1UBQA 1A5RA 1HQRD 2WU2B 2MLBA 2OJRA 2UU7A 2V0GA 1LO5D 2QC8A 3AV8A 1BXTA 4FA6A 4IKGA 1TS4A 1JMLA 3B2FA 3V60A 2QILA 3T3OA 2BQQA 4RGNA 3EHVA 1NYQA 1C1YB 4MGIE 1JWUD 4YSYB 2JZPA 3HHMA 3Q8CA 1WRIA 2Z8LA 1WR6E 3QC8B 1L7YA 4B0EA 4P1BC 1F9JA 2JY6A 3U30A 1WYGA 3BYYB 3NY5A 2MWSB 5DCNA 4ANVA 4BBNC 4YTNB 4EZLA 2ZVNA 3RNBC 1EWYC 1J0GA 2LRUA 3AU5A 1FRDA 2KC2A 3KWVA 1WXVA 2Y3AA 4UDUC 4HROA 4PYZA 3IVFA 2WP9B 3ZTDA 2AX5A 2GBJA 3ZUNA 1KLGD 5G2NA 3HRDD 3IG3A 5HHDG 1JALA 1SIFA 3JSVA 4DQOC 3EC8A 1WM3A 1V97A 3OWEB 3QQ8B 4L2YA 5DPSA 1TGZB 1WMHB 2LGXA 2GBRA 4RM9A 2G4DB 2OJWA 4FJZA 2M0XA 4II2B 1WJ4A 3IT4B 4EZKA 4RNAA 2L0FA 2GI9A 1MJDA 2BWES 4M8NA 4C00A 1SJHD 3L16A 2CU1A 4WURA 1FM0D 2WXGA 4WWNA 3ZJVA 1U4AA 2K8CA 5AZHA 3UF8A 2JT4B 3H7SA 4GGQA 3ML9A 3Q8BA 4B6WA 1WH3A 1YN5A 5C1ZA 3KH0A 4KGRA 4WJNA 3HIZA 1F0ZA 1WX8A 3BWUD 3FKYA 4S17A 1AYFA 1WX9A 2FE8A 1TT5B 2ASQA 5JHAA 3ZNGC 4M8MA 2L05A 1OEYJ 4W9IA 2K22A 1KF6B 3NOBA 1BMLC 3TEWA 2TSSA 3U8ZA 3N3KB 1I7HA 1IGCA 3DWMA 3M3JA 3EGRA 4P6VF 3Q2AC 3RCZA 1KTKA 2IJ0A 4M00A 4IM2A 3V61A 2N0SB 1FRRA 4DHZB 2YEPB 3SD5A 3HUIA 2L52A 1S3SG 4KGTA 2KVRA 1DOYA 4W9FA 2AQ1B 2I1JA 3SHQA 2C9WB 3E56A 3ZQ4A 2WX0A 3EFUA 4MGKE 4CO7A 2XBBC 4MGZE 2MP2A 2M8SA 2NS5A 3BVMA 1HXYD 1L4ZB 1ZXIA 2K8BA 5D3IB 1IGDA 1V5OA 4N6EB 2CR5A 4URKA 2WHIA 2PVGC 2HTME 2FCMA 4KSLC 3L10B 3L17A 4ZRQA 3NHEB 1ZDXA 1TBEA 3TSSA 4MELA 1JRPA 4JWUC 3DWGC 1XCTL 4LNOA 5C23A 2UYZB 3A1QA 3BYTB 3C0RB 1SIJA 2JQRB 5CTRC 4HJGE 4XX5A 2BF8B 2B76B 4MM3A 2EMSA 5J17A 1K50A 2LUMA 4JWSC 2VRRB 2WWZA 3DCGA 3GZNB 1TKEA 3LB8C 2LXAA 2D3GA 1Y56A 1GJZA 3RT3B 3WIMA 5AZGA 1YNTE 2WU5B 1WY8A 3N30A 5AEKB 1T5XD 1N5XA 1MI0A 1E7VA 1XLNA 3I3TB 2KMCA 3Q8FA 3ML8A 4NQKE 3A4RA 3NVYA 2KHWB 2QDFA 3RNGC 4OVUA 1I35A 2KWVB 2KTRB 4C4VB 2O6VA 1ZOYB 1QOBA 2KDBA 1AARA 4W9HA 4LCDE 4NY0A 3ECIA 2JZZA 2VH2A 4PS3A 1P7EA 3MC0B 2W54A 1SE3A 1ZXHA 2ACZB 2V3SA 1HA5A 3ZNHB 3VXWA 1KH0A 3VFKA 3DVGX 1QKZA 4DWFA 3WALA 4RM8A 2INNE 4FHJA 2LASA 2KLCA 4N9F4 2JF5A 1STEA 2HE7A 2V3PA 1TY2A 5FK9C 3W5UB 3U7DA 1RM6C 3MC8A 1WXQA 1WJNA 2NBUA 3AEAB 2SEBD 4FJVB 1J7CA 1IP9A 2RD0A 1WJ6A 5TSSA 1QOGA 3SEBA 3Q3OC 3RZFA 2NPTB 1K51A 2PVOD 3DHGC 1ENFA 3VR8B 5I4DA 2XK5B 4LNNA 2BW2A 4TUUA 4GB9A 3P1MA 3VH3B 3TIXA 4W9CA 2ZCBA 4YTPB 3ZIMA 1L6UA 4ZRJA 5LXHA 2RSUA 2WDVB 3Q3JA 5BYSA 3A9JA 2Z59B 2N1VA 2KYWA 3ZO5B 2QMTA 3GS2A 2HJ1A 4YWGG 2LGDA 4PS8A 1UF0A 4US8A 1LXDA 3TCAA 1EF1A 2EELA 2IGGA 4ZYNA 4KIKA 1CK1A 1P1AA 3QX1A 1EU4A 2GBKA 2JRHA 2V4IB 3V05A 3W1SA 2JVCA 2K8HA 2KO3A 1ESFA 1VZ6A 1ISNA 2WXOA 4JX1C 5KHOA 4P16A 2D3BA 3IHPC 1TS5A 5D2MB 1E8YA 1FO4A 2CU3A 2CKHB 4W9DA 4YTMB 4LJPB 4HCNB 2PKOA 4FLHA 4IW0A 2NCNA 2IBIB 2INDC 2V9HA 3RNEC 2RGFA 1JWAD 2C5LC 2XEWA 1JWBD 5BO4B 2ZNVC 1T3QA 2C7NB 2ZW0A 4HKQA 1WX7A 4GSWA 1I4HA 4IC7B 2N7DA 4B9KA 3MHSD 1ZE3D 3VVWB 3U52E 3UI3A 4BZAA 1MPEA 1B9RA 2FNJB 3HVDA 3P42A 1KLVA 3K9PB 4REZA 1IYFA 2N9PC 3H1UA 4GXBA 4LNFA 2FCQA 5DPWA 4ZOHC 2OOBB 1L5PA 3I5JC 4GDKA 1FEHA 3VAWA 1PGXA 4Q2JA 2YEPF 2DAJA 2INCC 2KLGA 4HDQA 2EMTA 1E7PB 4HPLB 2N9XA 2LVPA 3KQ4A 3U4EG 3ZVVA 3APFA 4A55A 3QHTA 1CZPA 1ACCA 1JQ4A 3OLMD 4DK5A 1RLFA 1PUTA 2IYDB 1WE7A 1V2YA 5LNK1 3DOWA 1FD6A 3AXCA 1GC6A 2VZKD 2I2YA 4TQ1A 2L83A 3SU8X 5FKAC 4AUQC 1TKGA 5BYRA 3H8HA 2BS3B 3T3NA 4L23A 3N1YC 1PGBA 4YSZB 1WGHA 3WAPA 1D5XC 2PIAA 1QZEA 3N32A 2BPSA 2LVQA 5JHBA 4WJQA 5MPOA 1OQQA 4WH4A 2VH1A 3PSEB 1P7FA 2WXJA 2WNMA 1XF5L 4K3CA 1HEZE 1V49A 1F2RI 4KZ0A 2M56B 4CHKA 3IXSA 4DBGA 2KWCA 2WXRA 1L6VA 2J42A 1WGYA 4XYCA 4WAAA 5EE3A 5CHFA 1XXGA 2FUG1 3R7RA 3CSTA 4XWWA 4LNIA 2AEHA 4GLSC 4K7WA 2BS4B 4NAWA 2KJRA 3JYUA 5JXVA 3ZLZA 1WGGA 3FAHA 3PLVA 1YQBA 1V5TA 2A5UA 4A3OA 1GB1A 1T0SC 3ZDMC 1FMAD 4HK2A 1XEEA 4HDOA 3AE4B 2RPVA 3PZDA 3R8BA 4B0MA 2WXKA 4PK1A 2R61A 4A6QA 1FNWA 3NS1A 3RNCC 3VRBB 3VUWA 1C9FA 3H7PA 2AL3A 5HKHA 3CWIA 3FC4A 3OJ3A 1J7AA 2JRIB 3O65B 2BYTA 4XDCA 2BVCA 1T6BX 3PLUA 4NQLB 3UIPB 2O2VA 1WFYA 4ANWA 2L1AA 1QOFA 1YJ1A 1YX6B 1BUIC 3KW5B 1M4VA 2KFKB 4KDIC 4WQMA 2KC1A 2NVUI 2MJEA 4BOZB 1D3ZA 2RPQA 4QAYA 3M95A 1E90A 3AB5A 4BBNF 3IT6B 3CF6E 3ALBA 3JW0X 1WE6A 1J7BA 2LEKA 2BS2B 5IOIA 1F2RC 4ANXA 2D3AA 1JWMD 2MBBB 1SBBB 3ZJUA 5DPTA 1ZW7A 2J4XA 3NUHB 3V62A 2LD9A 1NYRA 2J0KA 3IBEA 1E6EB 2DZKA 1WXAA 1SGHA 1NVID 2PEAA 2EKIA 1KM7A 3HK0A 1V1PB 3RYTA 3QCAA 4KKJA 3AU4A 3DBSA 3BVGA 3R66C 3DVNU 1UBIA 2MBEA 4YL8A 1R7SA 1OFFA 2PE9A 4GN1A 3UGBB 2CHZA 2W55A 4USAA 2NBWB 1AWDA 1MHHE 2LHDA 2ZNVB 3PPAA 1IBXA 2IY1B 4M02A 1GC7A 1SEBD 3SR6A 4WAFA 2JSVX 2N7JA 2D10A 3OAWA 3BY4B 2N9EB 1XD3B 1D6EC 4GIVA 2K5PA 1SE4A 4M0WA 2DWQA 3AE3B 1KJTA 2MEKA 3DBHB 4N58A 3ZKJC 4HVBA 4FN2A 4A90A 2SAKA 2UWQA 1YMHE 4C7YA 4AJWA 2M19A 3W5VB 1ZP0B 4P7IA 1NI3A 4WWMA 1SE2A 1EO6A 2LJIA 4JIOU 4G11A 1F52A 4CQNA 3RULA 2Y5BB 3I63C 2QHOA 2IY0B 3ZNID 3UINB 3A33B 2LGIA 4ZHPA 3TEZA 1WF9A 3NVVA 3I57A 3C8YA 1VZ7A 3A9KB 2N9KA 4JE3B 3B2GA 4XC2A 2RMMA 1T0RC 1UGJA 1I42A 4IWQA 5TR5A 1JW9D 2D07B 3EUB2 5BYQA 3N20C 4LK0M 3W2DA 4W9EA 2KFJA 4WJOA 1NENB 4KX6B 4ARCA 2PJHA 2DLBA 2FBWB 1K53A 4ZRPA 1N5WA 2KNBA 1UZXB 4ZRIA 3RNAC 2G4SA 1WRDB 1DOXA 1LFDA 4RMAA 1N61A 1LM8B 5D94A 4B95A 4DXAB 1ZUD2 5BMGA 4HPMB 1UD7A 4I6NB 1S1QB 5EDSA 2IZVB 1E10A 2L0TA 2ZW1A 3AEFB 2IPKD 5E6PA 3A4SC 4C7ZA 1N6ZA 4DXGA 3AI5A 4E3CA 3VUYA 3HM6X 4KVGB 2KXJA 4PT5A 3DVGY 4OZAA 1I4PA 4W9KA 2IO3B 5IKCM 1Z2MA 4HRSA 1CMXB 3WAMA 4MJSB 2W3RA 1L4DB 3R2IA 4EOYA 3D32A 3PHWB 2DENB 2MH7A 4HCPB 2K9XA 2IO1B 4ACFA 3VTVA 2JWZA 5JH5C 3L08A 1EM7A 2MCNB 1JROA 2JZ3B 3GE3C 3AH7A
chains in the Genus database with same CATH topology
1B9RA 1OQRA 1UWXA 3HVDA 2G9HD 3P42A 4J3OD 1EU3A 1TS2A 4L1BA 3AE5B 3ETRA 3NZ3A 4US9A 4REZA 1RYJA 2PLPA 4XWTA 3L4PA 1HQRD 5E6JA 2WU2B 3ZYYX 1RWSA 3AEEB 2V0GA 5EE0A 1LO5D 1VZ8A 3AV8A 4MH8A 1HZ5A 1BXTA 2Q5WD 4GDKB 3PO0A 4ZOHC 4IKGA 3TEYA 1TS4A 1JMLA 1FXAA 1L5PA 1YQ3B 2CJNA 3B2FA 1FEHA 4NAMA 4RGTA 1TY0A 3FILB 4O1NA 1FNUA 1PGXA 3R2TA 1QILA 1XO3A 3LYYA 2QILA 1V1OA 3T3OA 3IAM1 1GPXA 4Q2JA 1ZDVA 4RGNA 2YEPF 1NYQA 1YQ4B 2QSDA 1KFYB 3MHZA 1JWUD 4OZCA 3AN1A 4YSYB 2JXTA 2JZPA 1VRAB 3Q8CA 1WRIA 2Z8LA 1E7PB 2IGDA 1YJJA 2QIEB 2H89B 1QOAA 3KQ4A 3U4EG 4GDLB 1I4QA 4B0EA 5HG2A 1YJIA 4A55A 4RFBA 1CZPA 2OEDA 1VJKA 1ACCA 5T8IA 1JQ4A 4H2AA 4HEA1 2M0AA 3U2SC 2KWDA 1PUTA 3MJ5A 1WYGA 3BYYB 5LNK1 2GB1A 1FD6A 1QLBB 3AE2B 2VZKD 4MT5A 2I2YA 4TQ1A 1C78A 2L83A 1MVKA 4YTNB 1AN8A 1SXTA 3MP9A 2Y5PA 1EWYC 5FKAC 3VRAB 1FRDA 1TKGA 4OHJA 5BYRA 3KWVA 4A9AA 1C76A 3H8HA 4A8XC 2Y3AA 3VR9B 2BS3B 2J53A 4L23A 2WXHA 4YSZB 1PGBA 3T3NA 4UDUC 4HROA 1D5XC 2PIAA 4C56C 2WP9B 2H88B 2WXIA 2AX5A 5MPOA 1OQQA 4WH4A 2WDQB 1KLGD 1YN3A 3HRDD 3AEGB 5HHDG 1JALA 3HVZA 1P7FA 2BTEA 2WXJA 5D3DA 2KQ4X 1FXIA 1SF0A 2PTLA 2LMCA 4DQOC 2BB5A 2WNMA 4AQ7A 1VLBA 1XF5L 1V97A 3OWEB 1PGAA 4L2YA 1HEZE 1F2RI 2WLBA 1C4CA 4MACA 4RH6A 2M56B 3P63A 3IXSA 3IAS1 1N63A 2XNAC 4OVZA 1EWCA 2WXRA 1L6VA 2J42A 2RDHA 3SFEB 3IT4B 5EE3A 4RNAA 1XXGA 2FUG1 2GI9A 4RF1A 4NAWB 4XWWA 1A70A 1SJED 1XCQL 1SJHD 1XLPA 4WURA 1FM0D 4GLSC 2WXGA 2BS4B 5JXVA 2IDYA 3ZJVA 1ZPSA 2DYOA 3FAHA 3WCQA 2HDEA 3I9V1 4TMAB 1Q10A 1DOIA 2CJOA 4EE2A 4LTUA 1GB1A 1N62A 1FMAD 1C79A 1XEEA 3J9CA 1FIQA 1KLUD 3AE4B 3Q8BA 2RPVA 2WS3B 4OZBA 1UWMA 3R8BA 2AQ3B 4D2KA 1KRHA 1YN5A 4KGRA 4B0MA 1F0ZA 2WXKA 1QQRA 3BWUD 3PZ7A 2R61A 4A6QA 1FNWA 1TZOA 3NS1A 1AYFA 2PMVA 2FE8A 3MFGA 3VRBB 1C77A 1C9FA 3BVZA 2K22A 1D5ZC 1KF6B 1SSNA 3P4PB 2BB6A 3CWIA 3FC4A 3TEWA 1BMLC 3AEBB 2TSSA 3ABVB 4XDDA 3URYA 1J7AA 1WGKA 3RPFC 1I7HA 1IGCA 3DWMA 3EGRA 2BYTA 4FXCA 4P6VF 4WIPA 4XDCA 2Y5CA 1T6BX 1KTKA 2IJ0A 2ON8A 1TYGB 2E3TA 3LXFA 2N0SB 1FRRA 2YEPB 2L1AA 1QOFA 3KLSX 3HUIA 3P4QB 2L52A 1ET9A 4KGTA 1WSPA 4N59A 1DOYA 1BUIC 5G5HA 1M4VA 2AQ1B 2WDRB 4HKZE 4WQMA 3U7ZA 3E56A 4ZHOA 4TSSA 2NTSA 3ZQ4A 2MJEA 3BIID 1I4GA 2OHFA 1SB3C 1HXYD 3BVMA 3AB5A 5D7GA 1L4ZB 1ZXIA 3AE9B 3IT6B 4NZLB 5D3IB 1IGDA 2WXPA 5H8YE 4N6EB 5EE9A 1K52A 2I38A 4OW0A 3P4RB 2QEJC 4IOIE 2AQ2B 2PVGC 1J7BA 2HTME 2LEKA 2BS2B 1F2RC 2LFIA 3NVWA 4ZRQA 4RGOS 1JWMD 2WXLA 1ZDXA 3NRZA 3TSSA 1SBBB 1L0VB 3ZJUA 3AEDB 3N9YC 2KDMA 1JRPA 2J4XA 2JYTA 1GAQB 4JWUC 5HI1A 3NUHB 3DWGC 1XCTL 1JWSD 1TJEA 1NYRA 1E6EB 1I4XA 4KKIA 5C2TB 1FFVA 3BYTB 1NVID 1SIJA 2JQRB 2EKIA 1UNSA 4MM3B 4HJGE 1V1PB 4XE0A 4KKJA 2B76B 3BVGA 1V1PA 1K50A 2WXFA 4RCOA 3Q69A 2LUMA 4IDIA 2WXMA 4JWSC 1L0YB 3AECB 1NEKB 1TKEA 3LB8C 2IGHA 1C4PA 1CQVA 1R7SA 3AE7B 1IBXB 1OFFA 1Y56A 1ROEA 2W55A 1VDVA 2MJ3A 1YNTE 4USAA 1AWDA 1MHHE 2LHDA 2WU5B 1IBXA 1T5XD 1AW7A 5H92C 1N5XA 2ICIA 1MI0A 4KGSA 1RFKA 1I4RA 2QJLA 1XLNA 1N60A 3V3XA 1SEBD 4C80A 3AE1B 3SR6A 4WAFA 2JSVX 2N7JA 2NTTA 3BZDB 3Q8FA 3NVYA 1UUPA 5HFYA 1D6EC 5GXGB 2L32A 3B9JA 2K5PA 1SE4A 2G1EA 1PYWD 1ZOYB 3TEXA 4M0WA 2DWQA 1QOBA 3AE3B 1YN4A 4R3DA 2MEKA 3Q8EA 4N58A 3BK1A 2PW9A 2X38A 2SAKA 4A90A 1YMHE 4C7YA 3Q8AA 2M19A 3W5VB 1ZP0B 5BMIA 1NI3A 4ARIA 1P7EA 1TS3A 3MC0B 4YT0B 2W54A 4WWMA 1SE3A 3AE6B 1FFUA 1E0ZA 4ZYSA 1ZXHA 2ACZB 2W3SA 1SE2A 1PDXA 1HA5A 2LJIA 1JCKB 2N9LA 4CQNA 1KH0A 2BBCA 1PFDA 1QKZA 2INNE 2ONQA 1FNVA 3GP7A 4RF0A 2LGIA 1L0XB 4ZHPA 1STEA 5BMHA 3TEZA 1QF6A 1FCCC 2V3PA 3NVVA 2WQYB 3I57A 3C8YA 4DXFA 1TKYA 1TY2A 5FK9C 3W5UB 2WXNA 1VZ7A 3P4SB 4RGMA 1RM6C 2J52A 4AS1A 1WXQA 2N9KA 3AEAB 2SEBD 4JE3B 3B2GA 3FILA 1DYQA 1J7CA 1ET6A 2KAJA 3PZ8A 2V3NA 2RMMA 3AMZA 1QOGA 1UGJA 5TSSA 3SEBA 2KACA 1GB4A 1JW9D 3ZJTA 1K51A 2VZKB 2PVOD 3EUB2 5BYQA 1ENFA 4LK0M 3VR8B 1F77A 3W2DA 5I4DA 2JWUA 1VR9A 2BW2A 1NENB 3P1MA 4KX6B 2JU6X 4YTPB 4ARCA 5AUIA 1L6UA 4LLGM 2DLBA 2FBWB 1K53A 1QT9A 2WDVB 3NVZA 4ZRPA 1N5WA 2JYEA 5BYSA 2K3UA 1WWTA 2QMTA 3GS2A 1DGJA 4YWGG 1DOXA 1N61A 2JX5A 3ZGZA 2K0PA 1D4BA 4US8A 1GOZA 1ZUD2 5BMGA 1CJEA 4ITKA 1IUEA 3AM9A 2EELA 2IGGA 1V8CA 2RDGA 2KMMA 1CK1A 1E10A 2ZW1A 1MHXA 4YSXB 5AUKA 1EU4A 3AEFB 2V4IB 3TUOA 1HZ6A 2IPKD 3AE8B 3GB1A 3V05A 3W1SA 5G5GA 3W9CB 5FR3A 1ESFA 1VZ6A 4C7ZA 4DXGA 2WXOA 4JX1C 2GRIA 2MJDA 2E6XA 4JPSA 2DBYA 3O13A 2W82A 4P16A 2WXQA 2LHEA 1TS5A 2XN9C 2NMQA 4PT5A 5EE1A 3VQIA 4OZAA 1FO4A 1FCLA 1I4PA 1XLOA 2CU3A 4HRSA 4YTMB 3BK2A 2PKOA 2BT6A 1XLQA 3RFZB 2D5GA 3KWLA 5C3JB 1C4AA 2W3RA 1L4DB 2INPE 1D5MC 1B1ZA 1JWAD 3R2IA 3CIRB 1JWBD 4NJCA 2MH7A 1T3QA 4YXDB 2K9XA 3E9SA 2KN4A 2ZW0A 4HKQA 1E9MA 2DYMA 4TQ0A 1I4HA 1EM7A 1JROA 3EA6A 1ZE3D 3SFDB 3U52E 3AH7A 3UI3A 1MPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWX A;  2KDM A;  5HI1 A;  2J52 A;  2N9K A;  1XCT L;  3FIL A;  2GI9 A;  1XCQ L;  2RMM A;  2PLP A;  4GLS C;  5JXV A;  2KAC A;  1GB4 A;  1K51 A;  1Q10 A;  4HJG E;  1GB1 A;  1HZ5 A;  2JWU A;  4IKG A;  1K50 A;  2LUM A;  2RPV A;  1JML A;  2JU6 X;  4OZB A;  3FIL B;  4D2K A;  1PGX A;  1K53 A;  2IGH A;  4KGR A;  1IBX B;  1YNT E;  2QSD A;  1MHH E;  2LHD A;  4OZC A;  1IBX A;  2JXT A;  2JZP A;  2QMT A;  1MI0 A;  4KGS A;  1C9F A;  2IGD A;  3V3X A;  5HG2 A;  2K0P A;  1D4B A;  5BMG A;  2JSV X;  2OED A;  2N7J A;  2IGG A;  2EEL A;  2KWD A;  1IGC A;  2ZW1 A;  1MHX A;  5HFY A;  2GB1 A;  1FD6 A;  1HZ6 A;  2ON8 A;  3GB1 A;  2I2Y A;  1MVK A;  3MP9 A;  4KGT A;  2LHE A;  2PW9 A;  2NMQ A;  4OZA A;  4HKZ E;  1FCL A;  1YMH E;  2J53 A;  1PGB A;  5BMI A;  1P7E A;  1ZXH A;  2N9L A;  1KH0 A;  4WH4 A;  1QKZ A;  1IGD A;  5HHD G;  2ONQ A;  1P7F A;  1K52 A;  2KN4 A;  2I38 A;  2KQ4 X;  2PTL A;  2ZW0 A;  4IOI E;  2LGI A;  1XF5 L;  5BMH A;  1PGA A;  1F2R C;  1EM7 A;  1HEZ E;  1F2R I;  1FCC C;  4MAC A;  3UI3 A;  1MPE A; 
#chains in the Genus database with same CATH topology
 2W9N A;  2AYO B;  2G9H D;  3KYC D;  1EU3 A;  1TS2 A;  2K39 A;  3NZ3 A;  4US9 A;  3TL5 A;  1T0Q C;  4NPN A;  1Z5S B;  2C7M B;  2PLP A;  3L4P A;  3RUI B;  3ZYY X;  1RWS A;  2HTH A;  2V4L A;  4IWO A;  5EE0 A;  5DPR A;  3VHT C;  4MH8 A;  1HZ5 A;  2Q5W D;  1RRB A;  4WWO A;  2Z0D B;  1FXA A;  4K1R B;  2BYF A;  4NAM A;  2KDF B;  2L76 A;  1TY0 A;  4RGT A;  1P98 A;  1FNU A;  3R2T A;  3DVN V;  1QIL A;  2X8X X;  1OQY A;  1GPX A;  3IAM 1;  4G3X B;  1Q5W B;  2QSD A;  1KFY B;  3MHZ A;  4IUM B;  1YJJ A;  2K25 A;  2H89 B;  1QOA A;  4GDL B;  1I4Q A;  1YJI A;  3W1Y A;  1E8W A;  3BIN A;  2KFK A;  4BOS C;  3RD2 A;  5T8I A;  2M0A A;  3U2S C;  2KWD A;  3MJ5 A;  2KAN A;  2GB1 A;  3QAR A;  2GMI C;  1V86 A;  4MT5 A;  5IA7 A;  1Q1O A;  1C78 A;  2CHX A;  1MVK A;  3ZXR A;  1AN8 A;  1SXT A;  2Y5P A;  4MEM A;  4K81 A;  3VRA B;  4A9A A;  4OHJ A;  1WIA A;  2FCN A;  2J0J A;  1RFA A;  4A8X C;  3VR9 B;  2WXH A;  3NG0 A;  4EZJ A;  1TIF A;  2WGS A;  3PT2 B;  2KT7 A;  4C56 C;  1SE9 A;  3S2A A;  2H88 B;  2WXI A;  1R4N I;  3JSV B;  1NBF C;  3AEG B;  3Q6B A;  3HVZ A;  1K8R B;  2BTE A;  1HTQ A;  2KQ4 X;  1FXI A;  1SF0 A;  2PTL A;  3QAQ A;  4AQ7 A;  1VLB A;  3WAN A;  1YIW A;  1V81 A;  2WLB A;  1C4C A;  4MAC A;  2MBO A;  4F1S A;  3RI7 C;  1N63 A;  1WMH A;  2FAZ A;  1EWC A;  2IO0 B;  1Q0W B;  4RF1 A;  1UH6 A;  4BKS D;  3LDZ E;  2IDY A;  1ZPS A;  2DYO A;  4ICU A;  3WCQ A;  3ZDT A;  1Q10 A;  1DOI A;  4WQO B;  2CJO A;  4EE2 A;  3B0A A;  4LTU A;  3M63 B;  1N62 A;  2BYV E;  3V6E B;  2KZR A;  1Y8R C;  3J9C A;  1KLU D;  2D3C A;  1UWM A;  5IAA C;  4D2K A;  1KRH A;  3VDZ A;  1JRU A;  5L83 A;  4HXD A;  1VCB A;  1QQR A;  3PZ7 A;  1TZO A;  1C77 A;  3BVZ A;  5GMV A;  3P4P B;  1D5Z C;  1SSN A;  4OVV A;  1WM2 A;  2RDB C;  3DQV A;  4KDL B;  3AEB B;  3ZRF A;  3ABV B;  4XDD A;  3DBR I;  3URY A;  1RAX A;  2J0M A;  4WIP A;  2NR2 A;  2Y5C A;  2C60 A;  4II3 B;  1NDD A;  4FJY A;  3KLS X;  3P4Q B;  3Q3N C;  4DDG D;  4N59 A;  5G5H A;  2WDR B;  4HKZ E;  2PPH A;  2FID A;  2MP2 B;  3B1L X;  1WXM A;  2GBN A;  4ZHO A;  2NTS A;  3DDC B;  2LXC A;  1I4G A;  2OHF A;  1SB3 C;  3PS6 A;  2HJ8 A;  3AE9 B;  3RZW C;  2WXP A;  5H8Y E;  1NI2 A;  3AUL A;  3X23 A;  2I38 A;  4OW0 A;  3P4R B;  2QEJ C;  3PRP B;  4G0N B;  2LZ6 A;  3KUZ A;  2KOX A;  4BKG A;  4RGO S;  2WXL A;  3NRZ A;  3RMK C;  1L0V B;  3AED B;  4LJO B;  1GAQ B;  5HI1 A;  1P9D U;  1JWS D;  2KK8 A;  2MBQ A;  1LQB A;  1I4X A;  2K1F A;  4KKI A;  1E7U A;  5C2T B;  2MA9 B;  2YLM A;  2JUO A;  3QJZ A;  1UNS A;  2LUE A;  3Q3F A;  4MM3 B;  1WR1 A;  4XE0 A;  3VTW A;  4WWP A;  2WXF A;  4IDI A;  1L0Y B;  1NEK B;  1H8C A;  2GBM A;  4AOF A;  2IGH A;  1AW7 A;  2ICI A;  5AZF A;  1I4R A;  4CYE A;  5LLI A;  4C80 A;  3AE1 B;  2ZPY A;  1HTO A;  1XQQ A;  3BZD B;  3NS8 A;  2N1W A;  2DZJ A;  2O6V B;  4F8C B;  2L32 A;  2M1M A;  4HWI B;  3RN9 C;  1PYW D;  2G1E A;  4R3D A;  1YN4 A;  4JGH B;  2KTR A;  4C4V A;  3Q8E A;  3BK1 A;  5L95 C;  4KV2 A;  3ZXV A;  5BMI A;  2LWP A;  1TS3 A;  4YT0 B;  3AE6 B;  2ZJD A;  5IN7 A;  4ZYS A;  2W3S A;  3NZU A;  1PDX A;  1V6E A;  1JCK B;  1R4M I;  3ZW3 A;  3TJP A;  1PFD A;  1MFW A;  3PRM B;  2ONQ A;  4RF0 A;  1L0X B;  2AL6 A;  2KDE B;  1QF6 A;  1FCC C;  2L00 B;  4PYU A;  3RNF C;  2MX2 A;  4DXF A;  3P4S B;  3ENE A;  2J52 A;  3LJ3 A;  4AS1 A;  2CHW A;  1GG3 A;  1DYQ A;  4M01 A;  4BVU C;  2V3N A;  1XT9 B;  3EFC A;  1GB4 A;  2VZK B;  3N1Z C;  2GLS A;  2RR9 A;  2NPT A;  4KSK C;  4BKT A;  2REX A;  4GDL A;  2D2Q A;  2L8J A;  1EUV B;  2G3Q B;  2XK5 A;  4LDT B;  4ICV A;  5AUI A;  4LLG M;  3MJW A;  3A9J B;  4FHK A;  4AWJ A;  1UEL A;  2JYE A;  1ZKH A;  4S0R A;  1WWT A;  3GOE A;  2QCZ A;  3DBL I;  2DAF A;  1FPY A;  2C7H A;  3ZGZ A;  4ZDV A;  2K0P A;  4DHJ B;  4TKN A;  3HM3 A;  4KIK B;  1CJE A;  3AM9 A;  2GOW A;  1V8C A;  4YSX B;  1MHX A;  5CHW A;  5AUK A;  4HPP A;  3TUO A;  4MDK E;  1HZ6 A;  3AE8 B;  3GB1 A;  3MTN B;  3H9D A;  3QIJ A;  4FBJ B;  5G5G A;  3W9C B;  4KZC A;  4TV3 A;  5FR3 A;  1YD8 U;  2DBY A;  3O13 A;  3M62 B;  5D6J B;  2WXQ A;  2LHE A;  2NMQ A;  4AJY B;  3PRE A;  1FCL A;  2M4N A;  1XLO A;  4ANU A;  3ZNZ B;  3RFZ B;  2D5G A;  3KWL A;  1C4A A;  4XZ4 A;  1D5M C;  5FR6 A;  3MC9 A;  3CIR B;  4NJC A;  4DDI D;  4YXD B;  3E9S A;  1E9M A;  3CSF A;  3ONS A;  4TQ0 A;  2KDI A;  2KQS A;  4G50 A;  3SFD B;  2R2O A;  3Q3M C;  2MQJ A;  3TEX A;  1OQR A;  1KOT A;  4HLE A;  5E6O A;  4L1B A;  3ETR A;  2KMA A;  3L54 A;  1RYJ A;  2AWT A;  3VH4 B;  4XWT A;  3K9O B;  5E6J A;  4JLC A;  4J6I A;  3AEE B;  1VZ8 A;  2KJ6 A;  4GDK B;  3PO0 A;  3TEY A;  2ZZP B;  2CJN A;  1YQ3 B;  3UIO B;  2KVZ A;  3FIL B;  4O1N A;  2KKC A;  1XO3 A;  3LYY A;  1R4N B;  1V1O A;  1FXT B;  2KWU B;  1ZDV A;  1YQ4 B;  3NJT A;  4A20 A;  4OZC A;  3AN1 A;  2JXT A;  2WX1 A;  1VRA B;  2L7R A;  1H4R A;  2IGD A;  2QIE B;  1M94 A;  4JQW C;  1G6J A;  5HG2 A;  4RFB A;  2OED A;  1VJK A;  2G45 B;  4H2A A;  3UQA A;  4HEA 1;  4FUL A;  4ZRK A;  3DHI C;  1QLB B;  3AE2 B;  2KN5 A;  4GOC A;  3MP9 A;  4I6L B;  3L13 A;  3KVF B;  3WAO A;  2L3Z A;  1C76 A;  2M17 A;  1WI0 A;  2J53 A;  3APC A;  1WGR A;  4A3P A;  1MG8 A;  2K6Q A;  2MHJ A;  4FAD A;  2WDQ B;  1YN3 A;  1V80 A;  1WXS A;  5D3D A;  2LMC A;  2BB5 A;  1PQS A;  2PE6 B;  1PGA A;  3C19 A;  3DBR B;  3PV1 A;  4RH6 A;  3P63 A;  2B3A A;  3IAS 1;  2XNA C;  4OVZ A;  2KTF A;  2NBV B;  4BKS A;  4BFR A;  2RDH A;  3SFE B;  1J19 A;  2MRP A;  4F7Z A;  4NAW B;  1A70 A;  1SJE D;  1XCQ L;  1XLP A;  1ZGU B;  2WYQ A;  4MSQ B;  1OTR B;  2V1Y A;  2HDE A;  3I9V 1;  4TMA B;  2LGS A;  4XGA B;  2CS4 A;  5LXI B;  2A4Z A;  1C79 A;  1L2N A;  1FIQ A;  2MSE D;  4W9G A;  2WS3 B;  2DHZ A;  1OEY A;  4OZB A;  2AQ3 B;  5IO9 A;  4I6P A;  4IWP A;  2EKE C;  3H7P B;  4K7U A;  1EF5 A;  2PMV A;  3MFG A;  2BB6 A;  4IM0 A;  3P2B A;  4NJ6 A;  1WGK A;  3RPF C;  4GU2 A;  4FXC A;  1IPG A;  1E8X A;  2O2V B;  2ON8 A;  4IM3 A;  1GUA B;  1TYG B;  2I1K A;  2E3T A;  4AP4 C;  3LXF A;  4K3B A;  2N4F A;  1ET9 A;  3ZRC A;  1WSP A;  2KJH B;  1WGD A;  3U7Z A;  1WZ0 A;  1TTN A;  4TSS A;  2D11 A;  3B08 A;  3QA8 A;  3BII D;  2IO2 B;  4NNJ B;  5D7G A;  2YVC A;  4JL9 A;  4NZL B;  3V6C B;  4MGY E;  1X1M A;  2R2Q A;  5EE9 A;  1K52 A;  4IOI E;  2AQ2 B;  3R7Q A;  1WYW B;  3DBH I;  2LFI A;  3NVW A;  2MBH A;  3KUD B;  1VD2 A;  4WJP A;  3N9Y C;  2KDM A;  2JYT A;  3PHX B;  1MG4 A;  1TJE A;  1FFV A;  2JPH A;  2MW5 A;  2BWF A;  4W9J A;  4GMV A;  1V1P A;  2FCS A;  4RCO A;  1YOV B;  3Q69 A;  3EEC A;  2DZI A;  2WXM A;  3AEC B;  1R4M B;  3DPD A;  2BYE A;  1WZ3 A;  3NZS A;  4EFO A;  1C4P A;  1CQV A;  4BAX A;  3AE7 B;  3W1S C;  1IBX B;  1ROE A;  1VDV A;  2MJ3 A;  3QK0 A;  2ZVO A;  5H92 C;  5JZE B;  1LGR A;  4KGS A;  1RFK A;  3OJ4 B;  2QJL A;  1T0Y A;  2ZPN A;  1N60 A;  4EEW A;  3V3X A;  3OG5 A;  3L0W B;  2NTT A;  2LJ5 A;  1E5W A;  3DHH C;  3N1X C;  1UUP A;  1P0R A;  5HFY A;  4DHZ E;  5GXG B;  3TBL D;  1TZ1 A;  4M0W B;  3B9J A;  4K7S A;  1GNU A;  3VTU A;  1V9J A;  3Q14 C;  3T8M A;  2PW9 A;  3APD A;  2X38 A;  2O6V D;  3PRZ A;  3Q8A A;  4ARI A;  1FFU A;  1E0Z A;  3SDL C;  3JVZ X;  1C3T A;  5IP4 D;  2DZM A;  2JXX A;  2N9L A;  3R3M A;  2LVO A;  3GZN I;  2BKF A;  1YX5 B;  2BBC A;  2BGF A;  5J2R A;  1FNV A;  3GP7 A;  2J7Q B;  2KX0 A;  3DBL B;  4HJK A;  5BMH A;  2FIF A;  2WQY B;  1BT0 A;  5CX3 A;  3IFW B;  1E8Z A;  1TKY A;  2WXN A;  4RGM A;  3FIL A;  2KX3 A;  3A9K A;  3CMM B;  1ET6 A;  1HE8 A;  2KAJ A;  3PZ8 A;  3H6N A;  3AMZ A;  2KAC A;  3ZJT A;  3KYD D;  1F77 A;  4X57 B;  4E71 A;  2JWU A;  1VR9 A;  4IG7 B;  2JU6 X;  3PTF C;  4W9L A;  3QWZ B;  2ZEQ A;  1OGW A;  1QT9 A;  3NVZ A;  2ZCC A;  3A1Q B;  2K3U A;  5KHQ A;  3GE8 C;  1DGJ A;  2LGY A;  2Z0E B;  4LDT D;  5G55 A;  1UGM A;  4NJ7 A;  3KUC B;  2KD0 A;  1P3Q U;  2JX5 A;  4MH0 E;  2DX5 B;  4PS7 A;  1D4B A;  3WA0 A;  1GOZ A;  2DYB A;  4ITK A;  1IUE A;  2K6D B;  2RDG A;  3PVL A;  2BKR B;  1WJU A;  2KMM A;  4MSM B;  2KQ7 A;  3TMP B;  4ASW C;  4DHJ D;  3VUX A;  2GRI A;  2MJD A;  2E6X A;  4JPS A;  2W82 A;  2XN9 C;  5EE1 A;  3VQI A;  1F1H A;  2WDT B;  3BK2 A;  5E6N A;  1XLQ A;  2BT6 A;  2FUH B;  5C3J B;  2N7E A;  2INP E;  4MJS A;  1B1Z A;  4LNK A;  4EUT A;  2KN4 A;  2DYM A;  4P1C C;  4E74 A;  4EKU A;  3EA6 A;  5CHV C;  2HD5 B;  1J8C A;  1UWX A;  3UQB A;  3X0W A;  2LI5 A;  2LRW A;  3PGE A;  4J3O D;  2DNF A;  3AE5 B;  5J18 A;  3ZTC A;  3T9L A;  1UBQ A;  1A5R A;  1HQR D;  2WU2 B;  2MLB A;  2OJR A;  2UU7 A;  2V0G A;  1LO5 D;  2QC8 A;  3AV8 A;  1BXT A;  4FA6 A;  4IKG A;  1TS4 A;  1JML A;  3B2F A;  3V60 A;  2QIL A;  3T3O A;  2BQQ A;  4RGN A;  3EHV A;  1NYQ A;  1C1Y B;  4MGI E;  1JWU D;  4YSY B;  2JZP A;  3HHM A;  3Q8C A;  1WRI A;  2Z8L A;  1WR6 E;  3QC8 B;  1L7Y A;  4B0E A;  4P1B C;  1F9J A;  2JY6 A;  3U30 A;  1WYG A;  3BYY B;  3NY5 A;  2MWS B;  5DCN A;  4ANV A;  4BBN C;  4YTN B;  4EZL A;  2ZVN A;  3RNB C;  1EWY C;  1J0G A;  2LRU A;  3AU5 A;  1FRD A;  2KC2 A;  3KWV A;  1WXV A;  2Y3A A;  4UDU C;  4HRO A;  4PYZ A;  3IVF A;  2WP9 B;  3ZTD A;  2AX5 A;  2GBJ A;  3ZUN A;  1KLG D;  5G2N A;  3HRD D;  3IG3 A;  5HHD G;  1JAL A;  1SIF A;  3JSV A;  4DQO C;  3EC8 A;  1WM3 A;  1V97 A;  3OWE B;  3QQ8 B;  4L2Y A;  5DPS A;  1TGZ B;  1WMH B;  2LGX A;  2GBR A;  4RM9 A;  2G4D B;  2OJW A;  4FJZ A;  2M0X A;  4II2 B;  1WJ4 A;  3IT4 B;  4EZK A;  4RNA A;  2L0F A;  2GI9 A;  1MJD A;  2BWE S;  4M8N A;  4C00 A;  1SJH D;  3L16 A;  2CU1 A;  4WUR A;  1FM0 D;  2WXG A;  4WWN A;  3ZJV A;  1U4A A;  2K8C A;  5AZH A;  3UF8 A;  2JT4 B;  3H7S A;  4GGQ A;  3ML9 A;  3Q8B A;  4B6W A;  1WH3 A;  1YN5 A;  5C1Z A;  3KH0 A;  4KGR A;  4WJN A;  3HIZ A;  1F0Z A;  1WX8 A;  3BWU D;  3FKY A;  4S17 A;  1AYF A;  1WX9 A;  2FE8 A;  1TT5 B;  2ASQ A;  5JHA A;  3ZNG C;  4M8M A;  2L05 A;  1OEY J;  4W9I A;  2K22 A;  1KF6 B;  3NOB A;  1BML C;  3TEW A;  2TSS A;  3U8Z A;  3N3K B;  1I7H A;  1IGC A;  3DWM A;  3M3J A;  3EGR A;  4P6V F;  3Q2A C;  3RCZ A;  1KTK A;  2IJ0 A;  4M00 A;  4IM2 A;  3V61 A;  2N0S B;  1FRR A;  4DHZ B;  2YEP B;  3SD5 A;  3HUI A;  2L52 A;  1S3S G;  4KGT A;  2KVR A;  1DOY A;  4W9F A;  2AQ1 B;  2I1J A;  3SHQ A;  2C9W B;  3E56 A;  3ZQ4 A;  2WX0 A;  3EFU A;  4MGK E;  4CO7 A;  2XBB C;  4MGZ E;  2MP2 A;  2M8S A;  2NS5 A;  3BVM A;  1HXY D;  1L4Z B;  1ZXI A;  2K8B A;  5D3I B;  1IGD A;  1V5O A;  4N6E B;  2CR5 A;  4URK A;  2WHI A;  2PVG C;  2HTM E;  2FCM A;  4KSL C;  3L10 B;  3L17 A;  4ZRQ A;  3NHE B;  1ZDX A;  1TBE A;  3TSS A;  4MEL A;  1JRP A;  4JWU C;  3DWG C;  1XCT L;  4LNO A;  5C23 A;  2UYZ B;  3A1Q A;  3BYT B;  3C0R B;  1SIJ A;  2JQR B;  5CTR C;  4HJG E;  4XX5 A;  2BF8 B;  2B76 B;  4MM3 A;  2EMS A;  5J17 A;  1K50 A;  2LUM A;  4JWS C;  2VRR B;  2WWZ A;  3DCG A;  3GZN B;  1TKE A;  3LB8 C;  2LXA A;  2D3G A;  1Y56 A;  1GJZ A;  3RT3 B;  3WIM A;  5AZG A;  1YNT E;  2WU5 B;  1WY8 A;  3N30 A;  5AEK B;  1T5X D;  1N5X A;  1MI0 A;  1E7V A;  1XLN A;  3I3T B;  2KMC A;  3Q8F A;  3ML8 A;  4NQK E;  3A4R A;  3NVY A;  2KHW B;  2QDF A;  3RNG C;  4OVU A;  1I35 A;  2KWV B;  2KTR B;  4C4V B;  2O6V A;  1ZOY B;  1QOB A;  2KDB A;  1AAR A;  4W9H A;  4LCD E;  4NY0 A;  3ECI A;  2JZZ A;  2VH2 A;  4PS3 A;  1P7E A;  3MC0 B;  2W54 A;  1SE3 A;  1ZXH A;  2ACZ B;  2V3S A;  1HA5 A;  3ZNH B;  3VXW A;  1KH0 A;  3VFK A;  3DVG X;  1QKZ A;  4DWF A;  3WAL A;  4RM8 A;  2INN E;  4FHJ A;  2LAS A;  2KLC A;  4N9F 4;  2JF5 A;  1STE A;  2HE7 A;  2V3P A;  1TY2 A;  5FK9 C;  3W5U B;  3U7D A;  1RM6 C;  3MC8 A;  1WXQ A;  1WJN A;  2NBU A;  3AEA B;  2SEB D;  4FJV B;  1J7C A;  1IP9 A;  2RD0 A;  1WJ6 A;  5TSS A;  1QOG A;  3SEB A;  3Q3O C;  3RZF A;  2NPT B;  1K51 A;  2PVO D;  3DHG C;  1ENF A;  3VR8 B;  5I4D A;  2XK5 B;  4LNN A;  2BW2 A;  4TUU A;  4GB9 A;  3P1M A;  3VH3 B;  3TIX A;  4W9C A;  2ZCB A;  4YTP B;  3ZIM A;  1L6U A;  4ZRJ A;  5LXH A;  2RSU A;  2WDV B;  3Q3J A;  5BYS A;  3A9J A;  2Z59 B;  2N1V A;  2KYW A;  3ZO5 B;  2QMT A;  3GS2 A;  2HJ1 A;  4YWG G;  2LGD A;  4PS8 A;  1UF0 A;  4US8 A;  1LXD A;  3TCA A;  1EF1 A;  2EEL A;  2IGG A;  4ZYN A;  4KIK A;  1CK1 A;  1P1A A;  3QX1 A;  1EU4 A;  2GBK A;  2JRH A;  2V4I B;  3V05 A;  3W1S A;  2JVC A;  2K8H A;  2KO3 A;  1ESF A;  1VZ6 A;  1ISN A;  2WXO A;  4JX1 C;  5KHO A;  4P16 A;  2D3B A;  3IHP C;  1TS5 A;  5D2M B;  1E8Y A;  1FO4 A;  2CU3 A;  2CKH B;  4W9D A;  4YTM B;  4LJP B;  4HCN B;  2PKO A;  4FLH A;  4IW0 A;  2NCN A;  2IBI B;  2IND C;  2V9H A;  3RNE C;  2RGF A;  1JWA D;  2C5L C;  2XEW A;  1JWB D;  5BO4 B;  2ZNV C;  1T3Q A;  2C7N B;  2ZW0 A;  4HKQ A;  1WX7 A;  4GSW A;  1I4H A;  4IC7 B;  2N7D A;  4B9K A;  3MHS D;  1ZE3 D;  3VVW B;  3U52 E;  3UI3 A;  4BZA A;  1MPE A;  1B9R A;  2FNJ B;  3HVD A;  3P42 A;  1KLV A;  3K9P B;  4REZ A;  1IYF A;  2N9P C;  3H1U A;  4GXB A;  4LNF A;  2FCQ A;  5DPW A;  4ZOH C;  2OOB B;  1L5P A;  3I5J C;  4GDK A;  1FEH A;  3VAW A;  1PGX A;  4Q2J A;  2YEP F;  2DAJ A;  2INC C;  2KLG A;  4HDQ A;  2EMT A;  1E7P B;  4HPL B;  2N9X A;  2LVP A;  3KQ4 A;  3U4E G;  3ZVV A;  3APF A;  4A55 A;  3QHT A;  1CZP A;  1ACC A;  1JQ4 A;  3OLM D;  4DK5 A;  1RLF A;  1PUT A;  2IYD B;  1WE7 A;  1V2Y A;  5LNK 1;  3DOW A;  1FD6 A;  3AXC A;  1GC6 A;  2VZK D;  2I2Y A;  4TQ1 A;  2L83 A;  3SU8 X;  5FKA C;  4AUQ C;  1TKG A;  5BYR A;  3H8H A;  2BS3 B;  3T3N A;  4L23 A;  3N1Y C;  1PGB A;  4YSZ B;  1WGH A;  3WAP A;  1D5X C;  2PIA A;  1QZE A;  3N32 A;  2BPS A;  2LVQ A;  5JHB A;  4WJQ A;  5MPO A;  1OQQ A;  4WH4 A;  2VH1 A;  3PSE B;  1P7F A;  2WXJ A;  2WNM A;  1XF5 L;  4K3C A;  1HEZ E;  1V49 A;  1F2R I;  4KZ0 A;  2M56 B;  4CHK A;  3IXS A;  4DBG A;  2KWC A;  2WXR A;  1L6V A;  2J42 A;  1WGY A;  4XYC A;  4WAA A;  5EE3 A;  5CHF A;  1XXG A;  2FUG 1;  3R7R A;  3CST A;  4XWW A;  4LNI A;  2AEH A;  4GLS C;  4K7W A;  2BS4 B;  4NAW A;  2KJR A;  3JYU A;  5JXV A;  3ZLZ A;  1WGG A;  3FAH A;  3PLV A;  1YQB A;  1V5T A;  2A5U A;  4A3O A;  1GB1 A;  1T0S C;  3ZDM C;  1FMA D;  4HK2 A;  1XEE A;  4HDO A;  3AE4 B;  2RPV A;  3PZD A;  3R8B A;  4B0M A;  2WXK A;  4PK1 A;  2R61 A;  4A6Q A;  1FNW A;  3NS1 A;  3RNC C;  3VRB B;  3VUW A;  1C9F A;  3H7P A;  2AL3 A;  5HKH A;  3CWI A;  3FC4 A;  3OJ3 A;  1J7A A;  2JRI B;  3O65 B;  2BYT A;  4XDC A;  2BVC A;  1T6B X;  3PLU A;  4NQL B;  3UIP B;  2O2V A;  1WFY A;  4ANW A;  2L1A A;  1QOF A;  1YJ1 A;  1YX6 B;  1BUI C;  3KW5 B;  1M4V A;  2KFK B;  4KDI C;  4WQM A;  2KC1 A;  2NVU I;  2MJE A;  4BOZ B;  1D3Z A;  2RPQ A;  4QAY A;  3M95 A;  1E90 A;  3AB5 A;  4BBN F;  3IT6 B;  3CF6 E;  3ALB A;  3JW0 X;  1WE6 A;  1J7B A;  2LEK A;  2BS2 B;  5IOI A;  1F2R C;  4ANX A;  2D3A A;  1JWM D;  2MBB B;  1SBB B;  3ZJU A;  5DPT A;  1ZW7 A;  2J4X A;  3NUH B;  3V62 A;  2LD9 A;  1NYR A;  2J0K A;  3IBE A;  1E6E B;  2DZK A;  1WXA A;  1SGH A;  1NVI D;  2PEA A;  2EKI A;  1KM7 A;  3HK0 A;  1V1P B;  3RYT A;  3QCA A;  4KKJ A;  3AU4 A;  3DBS A;  3BVG A;  3R66 C;  3DVN U;  1UBI A;  2MBE A;  4YL8 A;  1R7S A;  1OFF A;  2PE9 A;  4GN1 A;  3UGB B;  2CHZ A;  2W55 A;  4USA A;  2NBW B;  1AWD A;  1MHH E;  2LHD A;  2ZNV B;  3PPA A;  1IBX A;  2IY1 B;  4M02 A;  1GC7 A;  1SEB D;  3SR6 A;  4WAF A;  2JSV X;  2N7J A;  2D10 A;  3OAW A;  3BY4 B;  2N9E B;  1XD3 B;  1D6E C;  4GIV A;  2K5P A;  1SE4 A;  4M0W A;  2DWQ A;  3AE3 B;  1KJT A;  2MEK A;  3DBH B;  4N58 A;  3ZKJ C;  4HVB A;  4FN2 A;  4A90 A;  2SAK A;  2UWQ A;  1YMH E;  4C7Y A;  4AJW A;  2M19 A;  3W5V B;  1ZP0 B;  4P7I A;  1NI3 A;  4WWM A;  1SE2 A;  1EO6 A;  2LJI A;  4JIO U;  4G11 A;  1F52 A;  4CQN A;  3RUL A;  2Y5B B;  3I63 C;  2QHO A;  2IY0 B;  3ZNI D;  3UIN B;  3A33 B;  2LGI A;  4ZHP A;  3TEZ A;  1WF9 A;  3NVV A;  3I57 A;  3C8Y A;  1VZ7 A;  3A9K B;  2N9K A;  4JE3 B;  3B2G A;  4XC2 A;  2RMM A;  1T0R C;  1UGJ A;  1I42 A;  4IWQ A;  5TR5 A;  1JW9 D;  2D07 B;  3EUB 2;  5BYQ A;  3N20 C;  4LK0 M;  3W2D A;  4W9E A;  2KFJ A;  4WJO A;  1NEN B;  4KX6 B;  4ARC A;  2PJH A;  2DLB A;  2FBW B;  1K53 A;  4ZRP A;  1N5W A;  2KNB A;  1UZX B;  4ZRI A;  3RNA C;  2G4S A;  1WRD B;  1DOX A;  1LFD A;  4RMA A;  1N61 A;  1LM8 B;  5D94 A;  4B95 A;  4DXA B;  1ZUD 2;  5BMG A;  4HPM B;  1UD7 A;  4I6N B;  1S1Q B;  5EDS A;  2IZV B;  1E10 A;  2L0T A;  2ZW1 A;  3AEF B;  2IPK D;  5E6P A;  3A4S C;  4C7Z A;  1N6Z A;  4DXG A;  3AI5 A;  4E3C A;  3VUY A;  3HM6 X;  4KVG B;  2KXJ A;  4PT5 A;  3DVG Y;  4OZA A;  1I4P A;  4W9K A;  2IO3 B;  5IKC M;  1Z2M A;  4HRS A;  1CMX B;  3WAM A;  4MJS B;  2W3R A;  1L4D B;  3R2I A;  4EOY A;  3D32 A;  3PHW B;  2DEN B;  2MH7 A;  4HCP B;  2K9X A;  2IO1 B;  4ACF A;  3VTV A;  2JWZ A;  5JH5 C;  3L08 A;  1EM7 A;  2MCN B;  1JRO A;  2JZ3 B;  3GE3 C;  3AH7 A; 
#chains in the Genus database with same CATH homology
 1B9R A;  1OQR A;  1UWX A;  3HVD A;  2G9H D;  3P42 A;  4J3O D;  1EU3 A;  1TS2 A;  4L1B A;  3AE5 B;  3ETR A;  3NZ3 A;  4US9 A;  4REZ A;  1RYJ A;  2PLP A;  4XWT A;  3L4P A;  1HQR D;  5E6J A;  2WU2 B;  3ZYY X;  1RWS A;  3AEE B;  2V0G A;  5EE0 A;  1LO5 D;  1VZ8 A;  3AV8 A;  4MH8 A;  1HZ5 A;  1BXT A;  2Q5W D;  4GDK B;  3PO0 A;  4ZOH C;  4IKG A;  3TEY A;  1TS4 A;  1JML A;  1FXA A;  1L5P A;  1YQ3 B;  2CJN A;  3B2F A;  1FEH A;  4NAM A;  4RGT A;  1TY0 A;  3FIL B;  4O1N A;  1FNU A;  1PGX A;  3R2T A;  1QIL A;  1XO3 A;  3LYY A;  2QIL A;  1V1O A;  3T3O A;  3IAM 1;  1GPX A;  4Q2J A;  1ZDV A;  4RGN A;  2YEP F;  1NYQ A;  1YQ4 B;  2QSD A;  1KFY B;  3MHZ A;  1JWU D;  4OZC A;  3AN1 A;  4YSY B;  2JXT A;  2JZP A;  1VRA B;  3Q8C A;  1WRI A;  2Z8L A;  1E7P B;  2IGD A;  1YJJ A;  2QIE B;  2H89 B;  1QOA A;  3KQ4 A;  3U4E G;  4GDL B;  1I4Q A;  4B0E A;  5HG2 A;  1YJI A;  4A55 A;  4RFB A;  1CZP A;  2OED A;  1VJK A;  1ACC A;  5T8I A;  1JQ4 A;  4H2A A;  4HEA 1;  2M0A A;  3U2S C;  2KWD A;  1PUT A;  3MJ5 A;  1WYG A;  3BYY B;  5LNK 1;  2GB1 A;  1FD6 A;  1QLB B;  3AE2 B;  2VZK D;  4MT5 A;  2I2Y A;  4TQ1 A;  1C78 A;  2L83 A;  1MVK A;  4YTN B;  1AN8 A;  1SXT A;  3MP9 A;  2Y5P A;  1EWY C;  5FKA C;  3VRA B;  1FRD A;  1TKG A;  4OHJ A;  5BYR A;  3KWV A;  4A9A A;  1C76 A;  3H8H A;  4A8X C;  2Y3A A;  3VR9 B;  2BS3 B;  2J53 A;  4L23 A;  2WXH A;  4YSZ B;  1PGB A;  3T3N A;  4UDU C;  4HRO A;  1D5X C;  2PIA A;  4C56 C;  2WP9 B;  2H88 B;  2WXI A;  2AX5 A;  5MPO A;  1OQQ A;  4WH4 A;  2WDQ B;  1KLG D;  1YN3 A;  3HRD D;  3AEG B;  5HHD G;  1JAL A;  3HVZ A;  1P7F A;  2BTE A;  2WXJ A;  5D3D A;  2KQ4 X;  1FXI A;  1SF0 A;  2PTL A;  2LMC A;  4DQO C;  2BB5 A;  2WNM A;  4AQ7 A;  1VLB A;  1XF5 L;  1V97 A;  3OWE B;  1PGA A;  4L2Y A;  1HEZ E;  1F2R I;  2WLB A;  1C4C A;  4MAC A;  4RH6 A;  2M56 B;  3P63 A;  3IXS A;  3IAS 1;  1N63 A;  2XNA C;  4OVZ A;  1EWC A;  2WXR A;  1L6V A;  2J42 A;  2RDH A;  3SFE B;  3IT4 B;  5EE3 A;  4RNA A;  1XXG A;  2FUG 1;  2GI9 A;  4RF1 A;  4NAW B;  4XWW A;  1A70 A;  1SJE D;  1XCQ L;  1SJH D;  1XLP A;  4WUR A;  1FM0 D;  4GLS C;  2WXG A;  2BS4 B;  5JXV A;  2IDY A;  3ZJV A;  1ZPS A;  2DYO A;  3FAH A;  3WCQ A;  2HDE A;  3I9V 1;  4TMA B;  1Q10 A;  1DOI A;  2CJO A;  4EE2 A;  4LTU A;  1GB1 A;  1N62 A;  1FMA D;  1C79 A;  1XEE A;  3J9C A;  1FIQ A;  1KLU D;  3AE4 B;  3Q8B A;  2RPV A;  2WS3 B;  4OZB A;  1UWM A;  3R8B A;  2AQ3 B;  4D2K A;  1KRH A;  1YN5 A;  4KGR A;  4B0M A;  1F0Z A;  2WXK A;  1QQR A;  3BWU D;  3PZ7 A;  2R61 A;  4A6Q A;  1FNW A;  1TZO A;  3NS1 A;  1AYF A;  2PMV A;  2FE8 A;  3MFG A;  3VRB B;  1C77 A;  1C9F A;  3BVZ A;  2K22 A;  1D5Z C;  1KF6 B;  1SSN A;  3P4P B;  2BB6 A;  3CWI A;  3FC4 A;  3TEW A;  1BML C;  3AEB B;  2TSS A;  3ABV B;  4XDD A;  3URY A;  1J7A A;  1WGK A;  3RPF C;  1I7H A;  1IGC A;  3DWM A;  3EGR A;  2BYT A;  4FXC A;  4P6V F;  4WIP A;  4XDC A;  2Y5C A;  1T6B X;  1KTK A;  2IJ0 A;  2ON8 A;  1TYG B;  2E3T A;  3LXF A;  2N0S B;  1FRR A;  2YEP B;  2L1A A;  1QOF A;  3KLS X;  3HUI A;  3P4Q B;  2L52 A;  1ET9 A;  4KGT A;  1WSP A;  4N59 A;  1DOY A;  1BUI C;  5G5H A;  1M4V A;  2AQ1 B;  2WDR B;  4HKZ E;  4WQM A;  3U7Z A;  3E56 A;  4ZHO A;  4TSS A;  2NTS A;  3ZQ4 A;  2MJE A;  3BII D;  1I4G A;  2OHF A;  1SB3 C;  1HXY D;  3BVM A;  3AB5 A;  5D7G A;  1L4Z B;  1ZXI A;  3AE9 B;  3IT6 B;  4NZL B;  5D3I B;  1IGD A;  2WXP A;  5H8Y E;  4N6E B;  5EE9 A;  1K52 A;  2I38 A;  4OW0 A;  3P4R B;  2QEJ C;  4IOI E;  2AQ2 B;  2PVG C;  1J7B A;  2HTM E;  2LEK A;  2BS2 B;  1F2R C;  2LFI A;  3NVW A;  4ZRQ A;  4RGO S;  1JWM D;  2WXL A;  1ZDX A;  3NRZ A;  3TSS A;  1SBB B;  1L0V B;  3ZJU A;  3AED B;  3N9Y C;  2KDM A;  1JRP A;  2J4X A;  2JYT A;  1GAQ B;  4JWU C;  5HI1 A;  3NUH B;  3DWG C;  1XCT L;  1JWS D;  1TJE A;  1NYR A;  1E6E B;  1I4X A;  4KKI A;  5C2T B;  1FFV A;  3BYT B;  1NVI D;  1SIJ A;  2JQR B;  2EKI A;  1UNS A;  4MM3 B;  4HJG E;  1V1P B;  4XE0 A;  4KKJ A;  2B76 B;  3BVG A;  1V1P A;  1K50 A;  2WXF A;  4RCO A;  3Q69 A;  2LUM A;  4IDI A;  2WXM A;  4JWS C;  1L0Y B;  3AEC B;  1NEK B;  1TKE A;  3LB8 C;  2IGH A;  1C4P A;  1CQV A;  1R7S A;  3AE7 B;  1IBX B;  1OFF A;  1Y56 A;  1ROE A;  2W55 A;  1VDV A;  2MJ3 A;  1YNT E;  4USA A;  1AWD A;  1MHH E;  2LHD A;  2WU5 B;  1IBX A;  1T5X D;  1AW7 A;  5H92 C;  1N5X A;  2ICI A;  1MI0 A;  4KGS A;  1RFK A;  1I4R A;  2QJL A;  1XLN A;  1N60 A;  3V3X A;  1SEB D;  4C80 A;  3AE1 B;  3SR6 A;  4WAF A;  2JSV X;  2N7J A;  2NTT A;  3BZD B;  3Q8F A;  3NVY A;  1UUP A;  5HFY A;  1D6E C;  5GXG B;  2L32 A;  3B9J A;  2K5P A;  1SE4 A;  2G1E A;  1PYW D;  1ZOY B;  3TEX A;  4M0W A;  2DWQ A;  1QOB A;  3AE3 B;  1YN4 A;  4R3D A;  2MEK A;  3Q8E A;  4N58 A;  3BK1 A;  2PW9 A;  2X38 A;  2SAK A;  4A90 A;  1YMH E;  4C7Y A;  3Q8A A;  2M19 A;  3W5V B;  1ZP0 B;  5BMI A;  1NI3 A;  4ARI A;  1P7E A;  1TS3 A;  3MC0 B;  4YT0 B;  2W54 A;  4WWM A;  1SE3 A;  3AE6 B;  1FFU A;  1E0Z A;  4ZYS A;  1ZXH A;  2ACZ B;  2W3S A;  1SE2 A;  1PDX A;  1HA5 A;  2LJI A;  1JCK B;  2N9L A;  4CQN A;  1KH0 A;  2BBC A;  1PFD A;  1QKZ A;  2INN E;  2ONQ A;  1FNV A;  3GP7 A;  4RF0 A;  2LGI A;  1L0X B;  4ZHP A;  1STE A;  5BMH A;  3TEZ A;  1QF6 A;  1FCC C;  2V3P A;  3NVV A;  2WQY B;  3I57 A;  3C8Y A;  4DXF A;  1TKY A;  1TY2 A;  5FK9 C;  3W5U B;  2WXN A;  1VZ7 A;  3P4S B;  4RGM A;  1RM6 C;  2J52 A;  4AS1 A;  1WXQ A;  2N9K A;  3AEA B;  2SEB D;  4JE3 B;  3B2G A;  3FIL A;  1DYQ A;  1J7C A;  1ET6 A;  2KAJ A;  3PZ8 A;  2V3N A;  2RMM A;  3AMZ A;  1QOG A;  1UGJ A;  5TSS A;  3SEB A;  2KAC A;  1GB4 A;  1JW9 D;  3ZJT A;  1K51 A;  2VZK B;  2PVO D;  3EUB 2;  5BYQ A;  1ENF A;  4LK0 M;  3VR8 B;  1F77 A;  3W2D A;  5I4D A;  2JWU A;  1VR9 A;  2BW2 A;  1NEN B;  3P1M A;  4KX6 B;  2JU6 X;  4YTP B;  4ARC A;  5AUI A;  1L6U A;  4LLG M;  2DLB A;  2FBW B;  1K53 A;  1QT9 A;  2WDV B;  3NVZ A;  4ZRP A;  1N5W A;  2JYE A;  5BYS A;  2K3U A;  1WWT A;  2QMT A;  3GS2 A;  1DGJ A;  4YWG G;  1DOX A;  1N61 A;  2JX5 A;  3ZGZ A;  2K0P A;  1D4B A;  4US8 A;  1GOZ A;  1ZUD 2;  5BMG A;  1CJE A;  4ITK A;  1IUE A;  3AM9 A;  2EEL A;  2IGG A;  1V8C A;  2RDG A;  2KMM A;  1CK1 A;  1E10 A;  2ZW1 A;  1MHX A;  4YSX B;  5AUK A;  1EU4 A;  3AEF B;  2V4I B;  3TUO A;  1HZ6 A;  2IPK D;  3AE8 B;  3GB1 A;  3V05 A;  3W1S A;  5G5G A;  3W9C B;  5FR3 A;  1ESF A;  1VZ6 A;  4C7Z A;  4DXG A;  2WXO A;  4JX1 C;  2GRI A;  2MJD A;  2E6X A;  4JPS A;  2DBY A;  3O13 A;  2W82 A;  4P16 A;  2WXQ A;  2LHE A;  1TS5 A;  2XN9 C;  2NMQ A;  4PT5 A;  5EE1 A;  3VQI A;  4OZA A;  1FO4 A;  1FCL A;  1I4P A;  1XLO A;  2CU3 A;  4HRS A;  4YTM B;  3BK2 A;  2PKO A;  2BT6 A;  1XLQ A;  3RFZ B;  2D5G A;  3KWL A;  5C3J B;  1C4A A;  2W3R A;  1L4D B;  2INP E;  1D5M C;  1B1Z A;  1JWA D;  3R2I A;  3CIR B;  1JWB D;  4NJC A;  2MH7 A;  1T3Q A;  4YXD B;  2K9X A;  3E9S A;  2KN4 A;  2ZW0 A;  4HKQ A;  1E9M A;  2DYM A;  4TQ0 A;  1I4H A;  1EM7 A;  1JRO A;  3EA6 A;  1ZE3 D;  3SFD B;  3U52 E;  3AH7 A;  3UI3 A;  1MPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...