4IOIE

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
b'SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
molecule tags Immune system
source organism Homo sapiens
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ioiE00
2IGGA 1ZXHA 2JXTA 2RMMA 1YMHE 5BMHA 1IGCA 1P7EA 1FD6A 1MHHE 2QSDA 1HZ5A 4OZAA 2N9KA 2ONQA 2KACA 2LHEA 1HZ6A 4OZBA 5JXVA 1IGDA 5HG2A 2IGHA 2EELA 1FCLA 1D4BA 2J52A 5BMGA 1YNTE 2KDMA 2N7JA 2OEDA 1QKZA 2NMQA 1XCTL 2J53A 5HFYA 1JMLA 4HJGE 2GI9A 1MPEA 1MVKA 1KH0A 2JZPA 3FILB 1F2RC 1EM7A 1XF5L 2ZW1A 2KWDA 4KGTA 4KGRA 4MACA 1Q10A 1K50A 2IGDA 1GB1A 1K51A 1MI0A 4GLSC 3GB1A 4IOIE 3V3XA 1PGAA 2I2YA 2N9LA 4IKGA 5BMIA 1HEZE 2LGIA 2GB1A 4OZCA 2JWUA 5HHDG 3FILA 1PGXA 1IBXB 4HKZE 2KN4A 1P7FA 4WH4A 2JU6X 2PTLA 2ZW0A 2K0PA 1FCCC 1F2RI 1K52A 5HI1A 2RPVA 1XCQL 2QMTA 2KQ4X 4KGSA 2LUMA 2PLPA 3UI3A 4D2KA 2JSVX 2ON8A 2LHDA 1GB4A 1K53A 1PGBA 1IBXA 1C9FA 1UWXA 1MHXA 2I38A 2PW9A 3MP9A
chains in the Genus database with same CATH superfamily
1ZXHA 3T3OA 4AS1A 1NDDA 4LNKA 4MDKE 5C1ZA 2JY6A 1WM3A 4M8MA 4HCNB 2NBWB 1ACCA 1D5MC 1ROEA 1TGZB 2AWTA 4IUMB 1RWSA 1WX7A 5EE0A 1YJIA 2LD9A 5LXIB 3N3KB 1ET9A 1JROA 3AE1B 2J52A 3M62B 3N1YC 5J17A 1VZ8A 4C7ZA 3PRPB 4MELA 2CJNA 4W9GA 2VZKD 2PIAA 4LCDE 3NVYA 4N9F4 2JXXA 1WRDB 3RNAC 3IHPC 3LYYA 2GBKA 3EECA 3PRMB 1C77A 2N9XA 5BO4B 1YN5A 1YOVB 4PT5A 3KW5B 1EM7A 4M0WB 3ZJVA 1C79A 3QA8A 3IT4B 1EU3A 3EHVA 3RNBC 1L5PA 2GMIC 4YTMB 1X1MA 1VDVA 4JQWC 2DX5B 3M95A 4RF1A 5T8IA 3DCGA 4BVUC 2GB1A 3PVLA 3B08A 1VZ7A 2KFKA 3FILA 2Z0DB 3V6EB 4MT5A 2JU6X 4LJOB 1FM0D 2V1YA 2WQYB 4A55A 3TIXA 2PLPA 3P1MA 5E6PA 1WE7A 2DYMA 3Q8AA 1YIWA 2WWZA 2IO3B 3B9JA 4YL8A 2BVCA 2KFKB 3FILB 4NQKE 3DBHB 3NJTA 2AEHA 2NTSA 5JHAA 4XGAB 1OTRB 2HD5B 3PT2B 5AZFA 4OZAA 4JWUC 1WMHB 2N9EB 2PMVA 2MBOA 4II2B 5DCNA 1GUAB 4ZRQA 1T6BX 4GMVA 1VZ6A 4ZRJA 2M1MA 4XWWA 2V0GA 3VTWA 3VRAB 1ZW7A 1KLGD 1U4AA 2W9NA 2QEJC 1N5XA 3OLMD 1YNTE 4XX5A 2M17A 1TKYA 4N59A 2QJLA 2N7JA 2OEDA 2DHZA 3VXWA 1N5WA 2A5UA 4W9DA 1WGRA 3UGBB 4RGTA 1WRIA 4GN1A 2IDYA 5E6OA 4RH6A 3W5VB 3TJPA 4WQMA 2BT6A 4JWSC 1WFYA 4HPMB 4C80A 2CJOA 1XF5L 2ZW1A 1EU4A 2DZKA 1GB1A 1OQQA 4TQ0A 2K5PA 3GZNI 3MC8A 1P9DU 2O6VB 3Q3JA 5G5HA 2YLMA 1WF9A 4BBNF 1ESFA 2NPTB 3P63A 1SIJA 2K22A 4GIVA 3Q69A 3WAMA 2KQSA 2MWSB 2JF5A 1RM6C 2K8BA 1FO4A 3V62A 3AEEB 4XWTA 1OGWA 2Y3AA 3DVGY 5AUIA 2K8HA 3ZRCA 5IA7A 2V4LA 2KOXA 3HUIA 4G3XB 3T8MA 3H6NA 5D7GA 1YN4A 2KC2A 1PGBA 2C5LC 1V97A 1Q0WB 2OJWA 3LDZE 3QQ8B 3IT6B 3PS6A 4LNNA 4HXDA 4LNOA 1RFKA 3AB5A 1PQSA 4ZHPA 1IGCA 1I35A 1Z2MA 2KJHB 2WXHA 2AL3A 2INCC 4IM3A 3OAWA 2PJHA 3SEBA 1TJEA 3BVMA 2X38A 2Y5PA 2UWQA 4NZLB 5G5GA 1CMXB 2KX3A 3E56A 2FE8A 5DPRA 4WAFA 1KOTA 1QLBB 1WH3A 2LRUA 4HROA 1JALA 1CK1A 3K9OB 1DOIA 4KVGB 4RM9A 3UIPB 4ZRPA 2J53A 3BYTB 4KKIA 4KZ0A 5CHWA 1PDXA 2PVOD 1WIAA 2IO1B 3ETRA 3VRBB 3TUOA 2V9HA 3R8BA 1T0SC 2WDVB 1FMAD 3QCAA 3WCQA 3CF6E 4K7WA 4MGKE 3UIOB 3WAOA 4OVZA 1Y56A 2WXGA 4WAAA 4KX6B 4PS7A 1NI2A 4GLSC 5FK9C 4G11A 5TSSA 3ZJTA 2N9LA 3TSSA 3AH7A 1SJHD 2JYTA 2JX5A 1MFWA 3NZUA 1E10A 3R3MA 3DDCB 2KWUB 4YXDB 3EC8A 3N1XC 2BYEA 3ZNZB 2RR9A 1Y8RC 4A8XC 2KLGA 2L00B 1UWXA 1DYQA 4KSLC 1EF5A 2JXTA 3Q3NC 3BINA 3R2TA 4IW0A 3Q8FA 3EA6A 3OJ4B 5L83A 4GDKB 3I63C 1LFDA 1UH6A 2DNFA 3H7PB 2JRIB 2G4SA 1WWTA 5J18A 3I3TB 1GC7A 1NI3A 4MM3B 4LDTD 3IVFA 1R4NI 1L6VA 2WXPA 2D3GA 2V3NA 2WP9B 2KDEB 1J7AA 3VH3B 3TEXA 4MSMB 3MTNB 2BGFA 3A9KA 3NVVA 2FUG1 2INPE 1EUVB 1Z5SB 2O6VD 1FXAA 3A9JB 3AU4A 4HJGE 3L4PA 3MJWA 4QAYA 2K39A 2CHZA 5CHVC 1MPEA 2ZCCA 3BK1A 1WX9A 1YX6B 2ZJDA 4A90A 3U30A 2KWDA 1HA5A 4P1BC 2R2OA 2IGDA 1FNUA 1E8YA 4ANVA 3Q2AC 4K3BA 2W54A 3A1QB 3V3XA 4IWOA 4ZDVA 4M00A 5C2TB 1PGAA 1J0GA 3ZQ4A 3L16A 1AARA 2W3SA 2ZPNA 3NS8A 2XNAC 3ZO5B 1N63A 2NVUI 1PGXA 1JCKB 5D3IB 4HKZE 3ML9A 3HVDA 1MJDA 1UBQA 3W5UB 1QZEA 4DHZB 2KHWB 1V49A 2RPVA 2EKIA 2CHWA 3U7DA 2JVCA 4EEWA 2LUMA 1RAXA 1T0YA 4ZYNA 3VTVA 3P2BA 3PZ7A 2N7DA 1NENB 3KYCD 2D5GA 3MP9A 3JSVB 1V1OA 2EMTA 1E8WA 3ALBA 1FFVA 4IWQA 3EFUA 2YVCA 4ITKA 2V4IB 4NAMA 2BS3B 1KJTA 3ZW3A 5C23A 1LXDA 3A9JA 4KDIC 2KACA 3BY4B 1HZ6A 1J8CA 2PEAA 2XN9C 2D10A 1FRRA 4ANXA 2IY0B 4JX1C 2KDIA 2AX5A 2K6DB 3W1SA 3AULA 4MM3A 4NPNA 3RZFA 1SJED 1T5XD 4NQLB 3AEGB 2PKOA 4XC2A 4S0RA 1JMLA 3VHTC 1TT5B 4DQOC 1P98A 4W9EA 1SSNA 1WGDA 2H89B 3P42A 4YWGG 3R66C 3VDZA 1E8XA 2MJDA 4XYCA 1KH0A 1NBFC 4ANWA 4O1NA 1RFAA 1SIFA 4MACA 4ASWC 2KDFB 4FULA 1UBIA 4JPSA 1WJ6A 1TKGA 3V60A 4WURA 1TYGB 3NUHB 4GSWA 4DXAB 2O2VB 2HJ1A 3NOBA 1GG3A 2N1WA 3AE8B 3DHIC 4WH4A 4FJZA 3VTUA 1F52A 1K52A 3RNGC 5DPSA 2H88B 1P3QU 2BWES 4KGSA 1WYGA 2SEBD 1Q5WB 3VR9B 2JSVX 1A70A 3Q8CA 2KNBA 4TQ1A 4RF0A 2W82A 4NY0A 2HDEA 2LXAA 1V1PA 4DHJB 2W3RA 2I38A 4FXCA 4PS3A 3B2FA 3AECB 3FKYA 1P7EA 2WYQA 1HZ5A 4W9KA 3X0WA 2KC1A 2WU2B 2I1JA 3HM3A 3WIMA 4F7ZA 1AWDA 2LASA 2BPSA 3U8ZA 2VRRB 3ZIMA 1IPGA 3VFKA 1SE9A 5EE3A 1V81A 2INNE 4GDLA 3UQAA 1E0ZA 1J7BA 1C78A 2KN5A 3B0AA 1D4BA 2D3AA 1R4MI 2JZ3B 3IAS1 1KLVA 4K3CA 5EE1A 4JE3B 2GLSA 3AEAB 2C9WB 1QOFA 3UF8A 1C4CA 2L1AA 3TL5A 4ZHOA 2VH2A 2IYDB 1OEYA 4ICUA 1WZ3A 3PGEA 2D3BA 4HPPA 3PRZA 5LLIA 3AEBB 2M0XA 3HHMA 1K50A 4C4VB 5EDSA 1VD2A 3KQ4A 2V3PA 2FCQA 2VH1A 4G50A 3U7ZA 4IKGA 4FJYA 3DWGC 2M4NA 3L10B 3Q8BA 3PHXB 3LXFA 1AYFA 3AEDB 3JYUA 3ENEA 2XBBC 4YSXB 2HTME 4NJCA 4C7YA 5JHBA 2MSED 3R7RA 3APCA 4K81A 4M0WA 1S1QB 2G4DB 1N62A 1XCQL 4RM8A 3DVNV 4NAWB 1HTOA 5DPTA 3NHEB 1XD3B 2ZVNA 4YTPB 2EKEC 4C4VA 4B9KA 1V1PB 2IGGA 1E7VA 1WE6A 2ZCBA 4ACFA 2LEKA 2RD0A 4HDQA 4EUTA 2KQ7A 2MHJA 2MX2A 1LQBA 3A1QA 3HRDD 3QWZB 4IM2A 2LZ6A 2NCNA 1TKEA 5CX3A 3N32A 4LDTB 2KWVB 4X57B 3KLSX 2KMCA 1ZDVA 5HG2A 1QOGA 5GXGB 1SXTA 1FCLA 2LWPA 4USAA 1KRHA 2HJ8A 3FC4A 2KJRA 2GBMA 4WQOB 3BZDB 2G3QB 4TMAB 4B6WA 3A33B 1EWYC 1V6EA 3I57A 2MQJA 4B0MA 1FRDA 4I6PA 2LJ5A 2OHFA 3OJ3A 3E9SA 1SGHA 1M4VA 2DZMA 4FHJA 3ZYYX 3U4EG 4EZLA 3MC0B 4IOIE 3ZKJC 1QT9A 2I2YA 2K25A 3R2IA 1TTNA 2ZNVC 1NVID 1V5OA 2LUEA 1WI0A 2BW2A 3Q6BA 1UGMA 4YT0B 4ICVA 1FXTB 2BTEA 3AN1A 2AQ2B 3RZWC 3QHTA 1B1ZA 1JRUA 1E90A 1TS4A 3WA0A 4HKQA 1T0QC 1K53A 1UELA 3TEYA 1JWSD 4DHJD 5BYQA 4LTUA 1XEEA 3O65B 1LGRA 1NYRA 1PYWD 2TSSA 4RCOA 5AUKA 2KT7A 3N20C 3Q3OC 3H9DA 5D2MB 2CR5A 1F9JA 2B76B 3RYTA 4K1RB 4DBGA 2GBRA 4HK2A 4MGIE 4HLEA 4BKTA 4W9IA 3VQIA 2MJ3A 2M0AA 5FR3A 2AYOB 2MJEA 3PTFC 2I1KA 2BS2B 3KWVA 2RDGA 4F8CB 4WWOA 2L0TA 2RDBC 3AE3B 3DVGX 2KFJA 3V05A 2W55A 4C00A 1MVKA 5MPOA 4YSYB 4P1CC 4KGTA 4J6IA 1Q10A 2G1EA 2WHIA 5C3JB 4RNAA 3MHZA 2FIDA 3ZGZA 5BYSA 2J7QB 5BMIA 4RGOS 2L76A 2QC8A 2WS3B 4OZCA 4A3PA 2WX1A 3W1SC 4AOFA 2YEPF 4ANUA 2K0PA 2KKCA 2IO0B 4NNJB 4MJSB 1N61A 1WXAA 2WDTB 2JWZA 2ON8A 3RI7C 1WXMA 3ECIA 2N9PC 3PLVA 2LGYA 2FCSA 1KLUD 1KM7A 2ICIA 3OG5A 5DPWA 3PSEB 1G6JA 3AEFB 3L13A 2ZPYA 1STEA 1WSPA 3C0RB 1WJNA 2WXJA 2LJIA 2L52A 3PHWB 4TV3A 2KO3A 3BWUD 3N1ZC 1L6UA 1ET6A 1E6EB 4ARIA 2SAKA 4BOSC 1OEYJ 1UGJA 2RSUA 1YD8U 1UUPA 4EFOA 3PREA 1ZE3D 2WXOA 3HIZA 2JYEA 2MBEA 4TKNA 2ZNVB 3D32A 3RN9C 2OOBB 4A6QA 2PE6B 2G9HD 1GPXA 4GU2A 2AL6A 1WJ4A 1CZPA 2MA9B 1GAQB 2MRPA 2WXKA 4EE2A 4E71A 5IO9A 2LGXA 3KUCB 4L1BA 3ZTDA 5IP4D 3APDA 2E6XA 4PS8A 1E9MA 3DBLB 3VUWA 2DZJA 4DDGD 1K51A 2MEKA 1WXSA 1WY8A 3H1UA 1BT0A 2BWFA 3VUYA 2J4XA 2QDFA 1L0XB 1JWMD 3V61A 2XK5B 3M3JA 4MH0E 2WNMA 4A3OA 4GGQA 1FPYA 2WDRB 4R3DA 3ZRFA 2L32A 1TZ1A 2KQ4X 3SD5A 1B9RA 2FCMA 3NZ3A 3NZSA 2BYFA 4FBJB 3URYA 1C9FA 4LNFA 2M56B 1SE4A 2NTTA 1TS5A 4DWFA 4CQNA 4L23A 4CO7A 1E7PB 4URKA 4WJOA 2IJ0A 2BF8B 5IKCM 3ZDTA 3APFA 4RGNA 4DHZE 2K3UA 3SDLC 1IGDA 2IBIB 1ZPSA 4BKGA 5AZHA 5BYRA 1SB3C 1F1HA 3AE6B 2FAZA 1QOAA 3ZVVA 3U2SC 5E6NA 4KKJA 1WZ0A 3IG3A 4JIOU 1J19A 3HK0A 1K8RB 1N60A 2FUHB 2LMCA 2WXNA 3H8HA 2GI9A 1ZOYB 2XEWA 1V80A 1VR9A 1RLFA 3I5JC 4W9LA 3WAPA 1YQBA 4AJWA 2REXA 3C8YA 3GB1A 4HRSA 1MG8A 4GOCA 3K9PB 1HEZE 2HE7A 1TIFA 1A5RA 5HHDG 4ARCA 1UF0A 4GB9A 1I42A 2DYOA 1WJUA 5H8YE 4MH8A 3M63B 4HPLB 4TSSA 3AXCA 4WWPA 1SBBB 2DAJA 5JZEB 1QF6A 2KAJA 1BMLC 1MHXA 1FEHA 3DOWA 1YJ1A 2JUOA 1D3ZA 3N30A 2RMMA 3DBHI 3L0WB 2KZRA 1JQ4A 5J2RA 2LGSA 1SE3A 2GOWA 5BMHA 3Q8EA 4B95A 2C7NB 2ZEQA 2Z0EB 3ZJUA 3AE2B 1FNWA 4W9FA 4N6EB 1C1YB 5FR6A 4DDID 2JZZA 1EO6A 2IGHA 3X23A 3KWLA 2O2VA 4CYEA 1V2YA 2DAFA 4YSZB 1KFYB 1QKZA 2NMQA 3VUXA 2CU3A 4MGYE 1V86A 2QIEB 4FA6A 2D3CA 4M01A 2WXIA 4PYZA 2KVZA 1AN8A 1RRBA 2JZPA 2UU7A 1XO3A 1F2RC 4Q2JA 1H8CA 5AZGA 2GRIA 3RT3B 3W1YA 2HTHA 2J0MA 2INDC 4HEA1 1LO5D 1JWBD 4HJKA 3CSTA 1L4ZB 1WYWB 1TY0A 2FIFA 3GE8C 2EMSA 1GC6A 4M8NA 1WR1A 2N7EA 2B3AA 3BK2A 2WXMA 2BQQA 4AJYB 5HI1A 5LXHA 4G0NB 5KHQA 1YX5B 4A9AA 1R7SA 3QC8B 5EE9A 3ONSA 4OHJA 2LFIA 2Y5BB 2Z59B 1GB4A 2WDQB 1DOYA 4FHKA 5IOIA 3Q3MC 1KTKA 2MP2B 2DWQA 2UYZB 1E5WA 2KLCA 1XLPA 3TEZA 5HKHA 2YEPB 1TZOA 1TBEA 1FD6A 3JW0X 2QILA 1MHHE 2QSDA 1D5ZC 1I4RA 1I4XA 3GE3C 4IWPA 2L3ZA 4OZBA 5JXVA 1C76A 2BYVE 1XQQA 1QOBA 2BKFA 1WGYA 4BOZB 3A4RA 1DGJA 2C7MB 3C19A 1XLNA 1T3QA 4LJPB 2KDMA 3ZDMC 1LM8B 2MP2A 4FN2A 3GP7A 2E3TA 1PUTA 4FJVB 4IM0A 2KXJA 4E3CA 1TS3A 1M94A 4WIPA 3EGRA 3RNCC 2MCNB 1ZDXA 3P4QB 2CKHB 3NS1A 3N9YC 4B0EA 3CMMB 2C60A 1UZXB 4KGRA 2OJRA 3DBLI 1J7CA 3A9KB 2FBWB 2GBNA 5IN7A 4HDOA 1MI0A 2X8XX 4WWMA 1NEKB 3QARA 2CS4A 2MH7A 3CIRB 3EUB2 4KZCA 1RYJA 3FAHA 4HVBA 2L0FA 4W9HA 3RD2A 2LVOA 1ZKHA 1ZXIA 2WLBA 2KN4A 1L7YA 3U52E 1F2RI 3TCAA 3QX1A 2D11A 4GDKA 3Q3FA 4K7UA 4CHKA 3IAM1 4KIKA 1PFDA 5G2NA 1P1AA 2PW9A 3UQBA 2K8CA 3P4RB 3RNEC 4IDIA 1TY2A 5GMVA 3V6CB 2G45B 2N9KA 3TMPB 3DBSA 2MLBA 2CHXA 4AP4C 2Z8LA 3NRZA 4PYUA 3QK0A 3CSFA 2EELA 4UDUC 1R4NB 3Q14C 1GOZA 1BXTA 3P4PB 1I4HA 3IBEA 3ZNGC 2MBQA 3IFWB 5HFYA 1IP9A 3H7PA 1XT9B 1D6EC 2QCZA 3BVGA 4GXBA 3J9CA 4LLGM 1IUEA 3ABVB 4ZOHC 3QIJA 5CTRC 1I4QA 3UINB 1I7HA 4I6LB 4WWNA 1ISNA 5L95C 2DYBA 2KK8A 1GNUA 5G55A 4P7IA 3VH4B 1YQ3B 1WMHA 2JT4B 1JWAD 4IG7B 2K6QA 4AWJA 3B2GA 2NPTA 2IO2B 4P16A 2A4ZA 3DBRB 1VLBA 3BVZA 2RPQA 5CHFA 1SEBD 2JWUA 1F0ZA 2L83A 2LXCA 1WXVA 2PTLA 3DQVA 1JRPA 4A20A 3R7QA 3RUIB 4KV2A 2WXFA 1L0YB 4KSKC 1KF6B 4XDDA 3ZNHB 2KWCA 2V3SA 3T9LA 2JQRB 4US9A 5H92C 3ZNID 2NBVB 1F77A 2BS4B 2IY1B 2N1VA 2VZKB 5IAAC 4L2YA 3AE7B 2KDBA 3NVWA 3L54A 4DK5A 3AE4B 4US8A 5AEKB 1FNVA 4NJ7A 4EZJA 3KVFB 2LGDA 3RNFC 2ONQA 1C4PA 4BAXA 3L17A 1EWCA 2FNJB 3MFGA 3AE9B 2ASQA 2KTFA 2LI5A 3AI5A 5D94A 4DXFA 1VCBA 3VVWB 2DBYA 4OVUA 5JH5C 2KMAA 2MW5A 1SE2A 3GOEA 2O6VA 3T3NA 1OQRA 1BUIC 3O13A 2BKRB 4C56C 1XCTL 1OQYA 1DOXA 1S3SG 2KMMA 2QHOA 3DHHC 5LNK1 1SF0A 4OVVA 3H7SA 2FCNA 3PZ8A 4S17A 3NY5A 1UNSA 4WJPA 2WXLA 4BKSA 1TS2A 2Q5WD 3PLUA 1L2NA 2BBCA 1ENFA 1IYFA 4IC7B 1ZP0B 4RFBA 4J3OD 3AM9A 4FLHA 2BB5A 2ZVOA 1GJZA 3ZXRA 2PVGC 4NAWA 1FFUA 3TBLD 4WJNA 3JSVA 5KHOA 2PPHA 1VJKA 1E8ZA 2AQ3B 2ZW0A 2KJ6A 1Q1OA 1FCCC 3PZDA 5D3DA 3P4SB 3LJ3A 3PV1A 2JPHA 2WGSA 2WX0A 3HM6X 2J0JA 2R2QA 4ZRIA 2R61A 1V5TA 2DENB 4JL9A 2RDHA 4YTNB 1H4RA 2D07B 3DVNU 1HE8A 4LK0M 4PK1A 2AQ1B 3WANA 4JLCA 4XZ4A 1WXQA 4REZA 3A4SC 1MG4A 2LHEA 4W9CA 1E7UA 3B1LX 1YQ4B 3NVZA 2XK5A 3PPAA 1ZUD2 1HXYD 5TR5A 4N58A 1OFFA 1D5XC 2WXQA 3ZTCA 4FADA 2WXRA 2J0KA 1R4MB 4OW0A 1AW7A 4GDLB 2KTRB 2BB6A 1C3TA 4E74A 3ZUNA 2KX0A 2KVRA 3SFEB 3L08A 3MC9A 4BKSD 3DPDA 2KYWA 2JRHA 1T0RC 1WGKA 4F1SA 2M8SA 1XLQA 2LVQA 3BYYB 3DHGC 4NJ6A 3RPFC 4WJQA 4AUQC 4ZYSA 1YN3A 3GZNB 3LB8C 2PE9A 5D6JB 4RMAA 2K1FA 3KUDB 4EOYA 4HWIB 3OWEB 1QQRA 4BZAA 2ACZB 1N6ZA 1VRAB 3CWIA 4HCPB 3NG0A 1CJEA 1IBXB 3WALA 3QAQA 1UD7A 4XE0A 1JW9D 3VAWA 4AQ7A 1QILA 1P0RA 1L0VB 1YJJA 2N0SB 4II3B 4BFRA 3VR8B 1FXIA 2L7RA 4EKUA 3SR6A 3W9CB 2LVPA 4I6NB 3UI3A 3KUZA 2KD0A 4D2KA 4LNIA 3MHSD 3S2AA 4DXGA 2LHDA 4P6VF 3SHQA 1CQVA 1WGHA 4JGHB 2ZZPB 1IBXA 4MSQB 1I4PA 4XDCA 1NYQA 2LRWA 1YMHE 3PO0A 4BBNC 4KDLB 3I9V1 1C4AA 4W9JA 2IZVB 4H2AA 1HTQA 4K7SA 1WGGA 3AV8A 2M19A 2DZIA 3AU5A 4M02A 4MGZE 2Y5CA 4ZRKA 3RMKC 1V8CA 1XLOA 2K9XA 3AE5B 5FKAC 5I4DA 2NBUA 1XXGA 5BMGA 2WU5B 2GBJA 4MEMA 1WR6E 1V9JA 3ML8A 2L05A 4RGMA 3DWMA 2CU1A 2KTRA 2J42A 3ZXVA 1WX8A 2N4FA 2L8JA 1HQRD 1FIQA 2MBHA 3HVZA 4TUUA 3SFDB 3RFZB 3JVZX 3AMZA 3SU8X 1JWUD 3GS2A 2NS5A 2MBBB 3W2DA 1I4GA 4KIKB 3EFCA 3IXSA 3MJ5A 2BYTA 1WM2A 2D2QA 5E6JA 3RCZA 3DBRI 3TEWA 2RGFA 2LGIA 4MJSA 1L4DB 4EZKA 1UWMA 2C7HA 3KH0A 3BIID 3RULA 1P7FA 2QMTA 2KANA 3KYDD 3QJZA 1ZGUB 2IPKD 2DLBA 2NR2A 3ZLZA 1EF1A
chains in the Genus database with same CATH topology
1ZXHA 1V1OA 1KLUD 3T3OA 2ICIA 4AS1A 3P4RB 3AEFB 1FFVA 1STEA 1WSPA 4IDIA 1TY2A 4ITKA 2V4IB 2WXJA 4NAMA 2BS3B 2LJIA 2L52A 2N9KA 1ACCA 1D5MC 1ROEA 2KACA 1HZ6A 1RWSA 3BWUD 5EE0A 1L6UA 1ET6A 1E6EB 1YJIA 2XN9C 4ARIA 1FRRA 2SAKA 2Z8LA 1ET9A 3NRZA 4JX1C 1JROA 3AE1B 2EELA 2AX5A 4UDUC 3W1SA 2J52A 1UGJA 1GOZA 1UUPA 1BXTA 1SJED 1T5XD 3P4PB 1ZE3D 2WXOA 1I4HA 1VZ8A 4C7ZA 3AEGB 2PKOA 2CJNA 2JYEA 2VZKD 2PIAA 5HFYA 4A6QA 1JMLA 4DQOC 2G9HD 1GPXA 1D6EC 1SSNA 3BVGA 3NVYA 1CZPA 2H89B 1GAQB 3J9CA 3LYYA 2WXKA 3P42A 4LLGM 4EE2A 4YWGG 1IUEA 3ABVB 2MJDA 4ZOHC 1C77A 1KH0A 1I4QA 4L1BA 1I7HA 4O1NA 1YN5A 4PT5A 1EM7A 2E6XA 3ZJVA 1C79A 1E9MA 3IT4B 4MACA 1EU3A 1L5PA 1YQ3B 1K51A 2MEKA 4YTMB 4JPSA 1TKGA 1VDVA 1JWAD 4WURA 3B2GA 1TYGB 3NUHB 4RF1A 5T8IA 4P16A 1VLBA 2J4XA 3BVZA 1L0XB 2GB1A 1JWMD 1SEBD 2JWUA 1F0ZA 1VZ7A 2WNMA 3AE8B 3FILA 2L83A 2WDRB 4WH4A 4MT5A 2JU6X 4R3DA 2PTLA 1FM0D 1JRPA 2L32A 1K52A 2H88B 2WQYB 2WXFA 4A55A 1L0YB 2KQ4X 4KGSA 1WYGA 2PLPA 3P1MA 1B9RA 2SEBD 1KF6B 4XDDA 3VR9B 2DYMA 1A70A 2JSVX 3Q8CA 3Q8AA 3NZ3A 2JQRB 4RF0A 4TQ1A 2W82A 4US9A 5H92C 1F77A 2BS4B 2HDEA 3URYA 1C9FA 3B9JA 1V1PA 2W3RA 2I38A 3FILB 2M56B 4FXCA 3B2FA 1SE4A 2VZKB 4L2YA 2NTTA 1TS5A 3AECB 3AE7B 2NTSA 4CQNA 3NVWA 4L23A 1E7PB 3AE4B 4US8A 1FNVA 1P7EA 2IJ0A 1HZ5A 4OZAA 4JWUC 2ONQA 2WU2B 1C4PA 1AWDA 2PMVA 1EWCA 4RGNA 4ZRQA 1T6BX 1VZ6A 2K3UA 3MFGA 3AE9B 1IGDA 5EE3A 4XWWA 1ZPSA 2INNE 2V0GA 4DXFA 2DBYA 1SB3C 1J7BA 5BYRA 1E0ZA 3AE6B 1C78A 3VRAB 1D4BA 1KLGD 2QEJC 1QOAA 1N5XA 1SE2A 3IAS1 1YNTE 3U2SC 3T3NA 1OQRA 1BUIC 1TKYA 3O13A 4N59A 2QJLA 4KKJA 2N7JA 2OEDA 4C56C 1XCTL 1N5WA 1DOXA 5EE1A 2KMMA 4JE3B 4RGTA 1WRIA 3AEAB 1QOFA 2IDYA 5LNK1 1N60A 4RH6A 1SF0A 2LMCA 1C4CA 2WXNA 3H8HA 2GI9A 3PZ8A 1ZOYB 2L1AA 3W5VB 4ZHOA 1UNSA 1VR9A 2WXLA 1TS2A 2Q5WD 4WQMA 2BT6A 4JWSC 2BBCA 4C80A 2CJOA 1ENFA 1XF5L 2ZW1A 3AEBB 1ZP0B 1EU4A 1K50A 1GB1A 3C8YA 4RFBA 1OQQA 4TQ0A 2K5PA 4J3OD 3GB1A 3KQ4A 2V3PA 4HRSA 5G5HA 3AM9A 2BB5A 3U7ZA 4IKGA 3DWGC 3Q8BA 2PVGC 1AYFA 1HEZE 1ESFA 3AEDB 3LXFA 1FFUA 4YSXB 3P63A 1SIJA 2K22A 3Q69A 5HHDG 2HTME 4NJCA 1RM6C 4C7YA 1FO4A 1VJKA 2AQ3B 4ARCA 3AEEB 2DYOA 2ZW0A 4XWTA 2Y3AA 5AUIA 4M0WA 5H8YE 1FCCC 5D3DA 4MH8A 3P4SB 1N62A 1XCQL 4TSSA 1SBBB 3HUIA 4NAWB 1QF6A 5D7GA 1YN4A 1PGBA 2KAJA 1V97A 1BMLC 2R61A 1MHXA 4YTPB 1FEHA 3IT6B 1V1PB 2IGGA 2RMMA 2RDHA 4YTNB 1JQ4A 2LEKA 1RFKA 1SE3A 3AB5A 4ZHPA 5BMHA 1IGCA 3Q8EA 4LK0M 2WXHA 2AQ1B 3HRDD 3SEBA 3ZJUA 1WXQA 3AE2B 1FNWA 1TJEA 4REZA 3BVMA 2X38A 4N6EB 2LHEA 2Y5PA 1TKEA 4NZLB 5G5GA 1YQ4B 3E56A 3KLSX 3NVZA 2FE8A 1ZDVA 5HG2A 2IGHA 4WAFA 1ZUD2 1QOGA 1QLBB 1HXYD 4HROA 5GXGB 1JALA 4N58A 1CK1A 1SXTA 1OFFA 3KWLA 1D5XC 1DOIA 2WXQA 1FCLA 2WXRA 4USAA 1KRHA 4OW0A 3FC4A 4YSZB 1AW7A 4GDLB 3BZDB 1KFYB 4ZRPA 2BB6A 1QKZA 2NMQA 4TMAB 2CU3A 2J53A 2QIEB 1EWYC 3BYTB 4KKIA 3I57A 1PDXA 2WXIA 3SFEB 2PVOD 3ETRA 3VRBB 3TUOA 4B0MA 1AN8A 1FRDA 3R8BA 2OHFA 2WDVB 1FMAD 2JZPA 3WCQA 3E9SA 1WGKA 1XO3A 1F2RC 4OVZA 1M4VA 1Y56A 2WXGA 1XLQA 3BYYB 4KX6B 4Q2JA 2GRIA 3RPFC 4HEA1 3ZYYX 1LO5D 3U4EG 4ZYSA 4GLSC 1YN3A 1JWBD 3LB8C 3MC0B 4IOIE 5FK9C 1QT9A 5TSSA 3ZJTA 2I2YA 2N9LA 3R2IA 1L4ZB 3OWEB 1QQRA 1NVID 1TY0A 3TSSA 2ACZB 1VRAB 3CWIA 2BW2A 3AH7A 1SJHD 1CJEA 2JYTA 2JX5A 1IBXB 4YT0B 4XE0A 1JW9D 3BK2A 4AQ7A 2BTEA 1QILA 3AN1A 2AQ2B 2WXMA 1E10A 1L0VB 1YJJA 2N0SB 5HI1A 3VR8B 1FXIA 1B1ZA 3SR6A 4YXDB 3W9CB 3UI3A 1TS4A 4A9AA 4D2KA 4HKQA 1R7SA 5EE9A 4DXGA 2LHDA 4OHJA 2LFIA 4P6VF 1GB4A 1K53A 4A8XC 2WDQB 3TEYA 1DOYA 1CQVA 1JWSD 5BYQA 1UWXA 4LTUA 1DYQA 1XEEA 1KTKA 1IBXA 2DWQA 1NYRA 1PYWD 2JXTA 2TSSA 1I4PA 4RCOA 3R2TA 4XDCA 1NYQA 5AUKA 1XLPA 1YMHE 3PO0A 3TEZA 3Q8FA 3EA6A 2YEPB 1TZOA 1FD6A 2QILA 2B76B 1MHHE 2QSDA 3I9V1 1C4AA 1D5ZC 4H2AA 1I4RA 4GDKB 1I4XA 3AV8A 2M19A 4OZBA 5JXVA 1C76A 2Y5CA 3VQIA 2MJ3A 1WWTA 2M0AA 5FR3A 2MJEA 1V8CA 1NI3A 1XLOA 2K9XA 1QOBA 4MM3B 3AE5B 5FKAC 5I4DA 1DGJA 2BS2B 1XXGA 5BMGA 1L6VA 2WU5B 2WXPA 1XLNA 1T3QA 3KWVA 2V3NA 2WP9B 2KDMA 1J7AA 3TEXA 3DWMA 3GP7A 4RGMA 2RDGA 2E3TA 2J42A 3NVVA 1PUTA 2FUG1 2INPE 1FXAA 1TS3A 3AE3B 3L4PA 4HJGE 4WIPA 1HQRD 3EGRA 3V05A 1FIQA 2W55A 1MPEA 3HVZA 1MVKA 1ZDXA 3P4QB 5MPOA 3NS1A 3N9YC 3BK1A 4B0EA 3SFDB 4A90A 3RFZB 4YSYB 3AMZA 2KWDA 1HA5A 4KGTA 4KGRA 1JWUD 1J7CA 1Q10A 2FBWB 2IGDA 3GS2A 1FNUA 2G1EA 3W2DA 1MI0A 2W54A 3V3XA 5C3JB 1I4GA 4WWMA 4RNAA 5C2TB 1NEKB 1PGAA 3CIRB 2MH7A 3EUB2 3IXSA 3MJ5A 3MHZA 5BYSA 1RYJA 2BYTA 5E6JA 3ZGZA 3ZQ4A 3TEWA 5BMIA 3FAHA 4RGOS 2LGIA 2W3SA 1L4DB 2WS3B 2XNAC 4OZCA 1N63A 1UWMA 1PGXA 1JCKB 5D3IB 4HKZE 1ZXIA 2WLBA 3BIID 3HVDA 2KN4A 1P7FA 2YEPF 3U52E 3W5UB 2K0PA 1F2RI 2RPVA 2EKIA 2QMTA 2LUMA 1N61A 2ON8A 3IAM1 2IPKD 2DLBA 1PFDA 3PZ7A 1NENB 2PW9A 2D5GA 3MP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGG A;  1ZXH A;  2JXT A;  2RMM A;  1YMH E;  5BMH A;  1IGC A;  1P7E A;  1FD6 A;  1MHH E;  2QSD A;  1HZ5 A;  4OZA A;  2N9K A;  2ONQ A;  2KAC A;  2LHE A;  1HZ6 A;  4OZB A;  5JXV A;  1IGD A;  5HG2 A;  2IGH A;  2EEL A;  1FCL A;  1D4B A;  2J52 A;  5BMG A;  1YNT E;  2KDM A;  2N7J A;  2OED A;  1QKZ A;  2NMQ A;  1XCT L;  2J53 A;  5HFY A;  1JML A;  4HJG E;  2GI9 A;  1MPE A;  1MVK A;  1KH0 A;  2JZP A;  3FIL B;  1F2R C;  1EM7 A;  1XF5 L;  2ZW1 A;  2KWD A;  4KGT A;  4KGR A;  4MAC A;  1Q10 A;  1K50 A;  2IGD A;  1GB1 A;  1K51 A;  1MI0 A;  4GLS C;  3GB1 A;  4IOI E;  3V3X A;  1PGA A;  2I2Y A;  2N9L A;  4IKG A;  5BMI A;  1HEZ E;  2LGI A;  2GB1 A;  4OZC A;  2JWU A;  5HHD G;  3FIL A;  1PGX A;  1IBX B;  4HKZ E;  2KN4 A;  1P7F A;  4WH4 A;  2JU6 X;  2PTL A;  2ZW0 A;  2K0P A;  1FCC C;  1F2R I;  1K52 A;  5HI1 A;  2RPV A;  1XCQ L;  2QMT A;  2KQ4 X;  4KGS A;  2LUM A;  2PLP A;  3UI3 A;  4D2K A;  2JSV X;  2ON8 A;  2LHD A;  1GB4 A;  1K53 A;  1PGB A;  1IBX A;  1C9F A;  1UWX A;  1MHX A;  2I38 A;  2PW9 A;  3MP9 A; 
#chains in the Genus database with same CATH topology
 1ZXH A;  3T3O A;  4AS1 A;  1NDD A;  4LNK A;  4MDK E;  5C1Z A;  2JY6 A;  1WM3 A;  4M8M A;  4HCN B;  2NBW B;  1ACC A;  1D5M C;  1ROE A;  1TGZ B;  2AWT A;  4IUM B;  1RWS A;  1WX7 A;  5EE0 A;  1YJI A;  2LD9 A;  5LXI B;  3N3K B;  1ET9 A;  1JRO A;  3AE1 B;  2J52 A;  3M62 B;  3N1Y C;  5J17 A;  1VZ8 A;  4C7Z A;  3PRP B;  4MEL A;  2CJN A;  4W9G A;  2VZK D;  2PIA A;  4LCD E;  3NVY A;  4N9F 4;  2JXX A;  1WRD B;  3RNA C;  3IHP C;  3LYY A;  2GBK A;  3EEC A;  3PRM B;  1C77 A;  2N9X A;  5BO4 B;  1YN5 A;  1YOV B;  4PT5 A;  3KW5 B;  1EM7 A;  4M0W B;  3ZJV A;  1C79 A;  3QA8 A;  3IT4 B;  1EU3 A;  3EHV A;  3RNB C;  1L5P A;  2GMI C;  4YTM B;  1X1M A;  1VDV A;  4JQW C;  2DX5 B;  3M95 A;  4RF1 A;  5T8I A;  3DCG A;  4BVU C;  2GB1 A;  3PVL A;  3B08 A;  1VZ7 A;  2KFK A;  3FIL A;  2Z0D B;  3V6E B;  4MT5 A;  2JU6 X;  4LJO B;  1FM0 D;  2V1Y A;  2WQY B;  4A55 A;  3TIX A;  2PLP A;  3P1M A;  5E6P A;  1WE7 A;  2DYM A;  3Q8A A;  1YIW A;  2WWZ A;  2IO3 B;  3B9J A;  4YL8 A;  2BVC A;  2KFK B;  3FIL B;  4NQK E;  3DBH B;  3NJT A;  2AEH A;  2NTS A;  5JHA A;  4XGA B;  1OTR B;  2HD5 B;  3PT2 B;  5AZF A;  4OZA A;  4JWU C;  1WMH B;  2N9E B;  2PMV A;  2MBO A;  4II2 B;  5DCN A;  1GUA B;  4ZRQ A;  1T6B X;  4GMV A;  1VZ6 A;  4ZRJ A;  2M1M A;  4XWW A;  2V0G A;  3VTW A;  3VRA B;  1ZW7 A;  1KLG D;  1U4A A;  2W9N A;  2QEJ C;  1N5X A;  3OLM D;  1YNT E;  4XX5 A;  2M17 A;  1TKY A;  4N59 A;  2QJL A;  2N7J A;  2OED A;  2DHZ A;  3VXW A;  1N5W A;  2A5U A;  4W9D A;  1WGR A;  3UGB B;  4RGT A;  1WRI A;  4GN1 A;  2IDY A;  5E6O A;  4RH6 A;  3W5V B;  3TJP A;  4WQM A;  2BT6 A;  4JWS C;  1WFY A;  4HPM B;  4C80 A;  2CJO A;  1XF5 L;  2ZW1 A;  1EU4 A;  2DZK A;  1GB1 A;  1OQQ A;  4TQ0 A;  2K5P A;  3GZN I;  3MC8 A;  1P9D U;  2O6V B;  3Q3J A;  5G5H A;  2YLM A;  1WF9 A;  4BBN F;  1ESF A;  2NPT B;  3P63 A;  1SIJ A;  2K22 A;  4GIV A;  3Q69 A;  3WAM A;  2KQS A;  2MWS B;  2JF5 A;  1RM6 C;  2K8B A;  1FO4 A;  3V62 A;  3AEE B;  4XWT A;  1OGW A;  2Y3A A;  3DVG Y;  5AUI A;  2K8H A;  3ZRC A;  5IA7 A;  2V4L A;  2KOX A;  3HUI A;  4G3X B;  3T8M A;  3H6N A;  5D7G A;  1YN4 A;  2KC2 A;  1PGB A;  2C5L C;  1V97 A;  1Q0W B;  2OJW A;  3LDZ E;  3QQ8 B;  3IT6 B;  3PS6 A;  4LNN A;  4HXD A;  4LNO A;  1RFK A;  3AB5 A;  1PQS A;  4ZHP A;  1IGC A;  1I35 A;  1Z2M A;  2KJH B;  2WXH A;  2AL3 A;  2INC C;  4IM3 A;  3OAW A;  2PJH A;  3SEB A;  1TJE A;  3BVM A;  2X38 A;  2Y5P A;  2UWQ A;  4NZL B;  5G5G A;  1CMX B;  2KX3 A;  3E56 A;  2FE8 A;  5DPR A;  4WAF A;  1KOT A;  1QLB B;  1WH3 A;  2LRU A;  4HRO A;  1JAL A;  1CK1 A;  3K9O B;  1DOI A;  4KVG B;  4RM9 A;  3UIP B;  4ZRP A;  2J53 A;  3BYT B;  4KKI A;  4KZ0 A;  5CHW A;  1PDX A;  2PVO D;  1WIA A;  2IO1 B;  3ETR A;  3VRB B;  3TUO A;  2V9H A;  3R8B A;  1T0S C;  2WDV B;  1FMA D;  3QCA A;  3WCQ A;  3CF6 E;  4K7W A;  4MGK E;  3UIO B;  3WAO A;  4OVZ A;  1Y56 A;  2WXG A;  4WAA A;  4KX6 B;  4PS7 A;  1NI2 A;  4GLS C;  5FK9 C;  4G11 A;  5TSS A;  3ZJT A;  2N9L A;  3TSS A;  3AH7 A;  1SJH D;  2JYT A;  2JX5 A;  1MFW A;  3NZU A;  1E10 A;  3R3M A;  3DDC B;  2KWU B;  4YXD B;  3EC8 A;  3N1X C;  2BYE A;  3ZNZ B;  2RR9 A;  1Y8R C;  4A8X C;  2KLG A;  2L00 B;  1UWX A;  1DYQ A;  4KSL C;  1EF5 A;  2JXT A;  3Q3N C;  3BIN A;  3R2T A;  4IW0 A;  3Q8F A;  3EA6 A;  3OJ4 B;  5L83 A;  4GDK B;  3I63 C;  1LFD A;  1UH6 A;  2DNF A;  3H7P B;  2JRI B;  2G4S A;  1WWT A;  5J18 A;  3I3T B;  1GC7 A;  1NI3 A;  4MM3 B;  4LDT D;  3IVF A;  1R4N I;  1L6V A;  2WXP A;  2D3G A;  2V3N A;  2WP9 B;  2KDE B;  1J7A A;  3VH3 B;  3TEX A;  4MSM B;  3MTN B;  2BGF A;  3A9K A;  3NVV A;  2FUG 1;  2INP E;  1EUV B;  1Z5S B;  2O6V D;  1FXA A;  3A9J B;  3AU4 A;  4HJG E;  3L4P A;  3MJW A;  4QAY A;  2K39 A;  2CHZ A;  5CHV C;  1MPE A;  2ZCC A;  3BK1 A;  1WX9 A;  1YX6 B;  2ZJD A;  4A90 A;  3U30 A;  2KWD A;  1HA5 A;  4P1B C;  2R2O A;  2IGD A;  1FNU A;  1E8Y A;  4ANV A;  3Q2A C;  4K3B A;  2W54 A;  3A1Q B;  3V3X A;  4IWO A;  4ZDV A;  4M00 A;  5C2T B;  1PGA A;  1J0G A;  3ZQ4 A;  3L16 A;  1AAR A;  2W3S A;  2ZPN A;  3NS8 A;  2XNA C;  3ZO5 B;  1N63 A;  2NVU I;  1PGX A;  1JCK B;  5D3I B;  4HKZ E;  3ML9 A;  3HVD A;  1MJD A;  1UBQ A;  3W5U B;  1QZE A;  4DHZ B;  2KHW B;  1V49 A;  2RPV A;  2EKI A;  2CHW A;  3U7D A;  2JVC A;  4EEW A;  2LUM A;  1RAX A;  1T0Y A;  4ZYN A;  3VTV A;  3P2B A;  3PZ7 A;  2N7D A;  1NEN B;  3KYC D;  2D5G A;  3MP9 A;  3JSV B;  1V1O A;  2EMT A;  1E8W A;  3ALB A;  1FFV A;  4IWQ A;  3EFU A;  2YVC A;  4ITK A;  2V4I B;  4NAM A;  2BS3 B;  1KJT A;  3ZW3 A;  5C23 A;  1LXD A;  3A9J A;  4KDI C;  2KAC A;  3BY4 B;  1HZ6 A;  1J8C A;  2PEA A;  2XN9 C;  2D10 A;  1FRR A;  4ANX A;  2IY0 B;  4JX1 C;  2KDI A;  2AX5 A;  2K6D B;  3W1S A;  3AUL A;  4MM3 A;  4NPN A;  3RZF A;  1SJE D;  1T5X D;  4NQL B;  3AEG B;  2PKO A;  4XC2 A;  4S0R A;  1JML A;  3VHT C;  1TT5 B;  4DQO C;  1P98 A;  4W9E A;  1SSN A;  1WGD A;  2H89 B;  3P42 A;  4YWG G;  3R66 C;  3VDZ A;  1E8X A;  2MJD A;  4XYC A;  1KH0 A;  1NBF C;  4ANW A;  4O1N A;  1RFA A;  1SIF A;  4MAC A;  4ASW C;  2KDF B;  4FUL A;  1UBI A;  4JPS A;  1WJ6 A;  1TKG A;  3V60 A;  4WUR A;  1TYG B;  3NUH B;  4GSW A;  4DXA B;  2O2V B;  2HJ1 A;  3NOB A;  1GG3 A;  2N1W A;  3AE8 B;  3DHI C;  4WH4 A;  4FJZ A;  3VTU A;  1F52 A;  1K52 A;  3RNG C;  5DPS A;  2H88 B;  1P3Q U;  2BWE S;  4KGS A;  1WYG A;  2SEB D;  1Q5W B;  3VR9 B;  2JSV X;  1A70 A;  3Q8C A;  2KNB A;  4TQ1 A;  4RF0 A;  2W82 A;  4NY0 A;  2HDE A;  2LXA A;  1V1P A;  4DHJ B;  2W3R A;  2I38 A;  4FXC A;  4PS3 A;  3B2F A;  3AEC B;  3FKY A;  1P7E A;  2WYQ A;  1HZ5 A;  4W9K A;  3X0W A;  2KC1 A;  2WU2 B;  2I1J A;  3HM3 A;  3WIM A;  4F7Z A;  1AWD A;  2LAS A;  2BPS A;  3U8Z A;  2VRR B;  3ZIM A;  1IPG A;  3VFK A;  1SE9 A;  5EE3 A;  1V81 A;  2INN E;  4GDL A;  3UQA A;  1E0Z A;  1J7B A;  1C78 A;  2KN5 A;  3B0A A;  1D4B A;  2D3A A;  1R4M I;  2JZ3 B;  3IAS 1;  1KLV A;  4K3C A;  5EE1 A;  4JE3 B;  2GLS A;  3AEA B;  2C9W B;  1QOF A;  3UF8 A;  1C4C A;  2L1A A;  3TL5 A;  4ZHO A;  2VH2 A;  2IYD B;  1OEY A;  4ICU A;  1WZ3 A;  3PGE A;  2D3B A;  4HPP A;  3PRZ A;  5LLI A;  3AEB B;  2M0X A;  3HHM A;  1K50 A;  4C4V B;  5EDS A;  1VD2 A;  3KQ4 A;  2V3P A;  2FCQ A;  2VH1 A;  4G50 A;  3U7Z A;  4IKG A;  4FJY A;  3DWG C;  2M4N A;  3L10 B;  3Q8B A;  3PHX B;  3LXF A;  1AYF A;  3AED B;  3JYU A;  3ENE A;  2XBB C;  4YSX B;  2HTM E;  4NJC A;  4C7Y A;  5JHB A;  2MSE D;  3R7R A;  3APC A;  4K81 A;  4M0W A;  1S1Q B;  2G4D B;  1N62 A;  1XCQ L;  4RM8 A;  3DVN V;  4NAW B;  1HTO A;  5DPT A;  3NHE B;  1XD3 B;  2ZVN A;  4YTP B;  2EKE C;  4C4V A;  4B9K A;  1V1P B;  2IGG A;  1E7V A;  1WE6 A;  2ZCB A;  4ACF A;  2LEK A;  2RD0 A;  4HDQ A;  4EUT A;  2KQ7 A;  2MHJ A;  2MX2 A;  1LQB A;  3A1Q A;  3HRD D;  3QWZ B;  4IM2 A;  2LZ6 A;  2NCN A;  1TKE A;  5CX3 A;  3N32 A;  4LDT B;  2KWV B;  4X57 B;  3KLS X;  2KMC A;  1ZDV A;  5HG2 A;  1QOG A;  5GXG B;  1SXT A;  1FCL A;  2LWP A;  4USA A;  1KRH A;  2HJ8 A;  3FC4 A;  2KJR A;  2GBM A;  4WQO B;  3BZD B;  2G3Q B;  4TMA B;  4B6W A;  3A33 B;  1EWY C;  1V6E A;  3I57 A;  2MQJ A;  4B0M A;  1FRD A;  4I6P A;  2LJ5 A;  2OHF A;  3OJ3 A;  3E9S A;  1SGH A;  1M4V A;  2DZM A;  4FHJ A;  3ZYY X;  3U4E G;  4EZL A;  3MC0 B;  4IOI E;  3ZKJ C;  1QT9 A;  2I2Y A;  2K25 A;  3R2I A;  1TTN A;  2ZNV C;  1NVI D;  1V5O A;  2LUE A;  1WI0 A;  2BW2 A;  3Q6B A;  1UGM A;  4YT0 B;  4ICV A;  1FXT B;  2BTE A;  3AN1 A;  2AQ2 B;  3RZW C;  3QHT A;  1B1Z A;  1JRU A;  1E90 A;  1TS4 A;  3WA0 A;  4HKQ A;  1T0Q C;  1K53 A;  1UEL A;  3TEY A;  1JWS D;  4DHJ D;  5BYQ A;  4LTU A;  1XEE A;  3O65 B;  1LGR A;  1NYR A;  1PYW D;  2TSS A;  4RCO A;  5AUK A;  2KT7 A;  3N20 C;  3Q3O C;  3H9D A;  5D2M B;  2CR5 A;  1F9J A;  2B76 B;  3RYT A;  4K1R B;  4DBG A;  2GBR A;  4HK2 A;  4MGI E;  4HLE A;  4BKT A;  4W9I A;  3VQI A;  2MJ3 A;  2M0A A;  5FR3 A;  2AYO B;  2MJE A;  3PTF C;  2I1K A;  2BS2 B;  3KWV A;  2RDG A;  4F8C B;  4WWO A;  2L0T A;  2RDB C;  3AE3 B;  3DVG X;  2KFJ A;  3V05 A;  2W55 A;  4C00 A;  1MVK A;  5MPO A;  4YSY B;  4P1C C;  4KGT A;  4J6I A;  1Q10 A;  2G1E A;  2WHI A;  5C3J B;  4RNA A;  3MHZ A;  2FID A;  3ZGZ A;  5BYS A;  2J7Q B;  5BMI A;  4RGO S;  2L76 A;  2QC8 A;  2WS3 B;  4OZC A;  4A3P A;  2WX1 A;  3W1S C;  4AOF A;  2YEP F;  4ANU A;  2K0P A;  2KKC A;  2IO0 B;  4NNJ B;  4MJS B;  1N61 A;  1WXA A;  2WDT B;  2JWZ A;  2ON8 A;  3RI7 C;  1WXM A;  3ECI A;  2N9P C;  3PLV A;  2LGY A;  2FCS A;  1KLU D;  1KM7 A;  2ICI A;  3OG5 A;  5DPW A;  3PSE B;  1G6J A;  3AEF B;  3L13 A;  2ZPY A;  1STE A;  1WSP A;  3C0R B;  1WJN A;  2WXJ A;  2LJI A;  2L52 A;  3PHW B;  4TV3 A;  2KO3 A;  3BWU D;  3N1Z C;  1L6U A;  1ET6 A;  1E6E B;  4ARI A;  2SAK A;  4BOS C;  1OEY J;  1UGJ A;  2RSU A;  1YD8 U;  1UUP A;  4EFO A;  3PRE A;  1ZE3 D;  2WXO A;  3HIZ A;  2JYE A;  2MBE A;  4TKN A;  2ZNV B;  3D32 A;  3RN9 C;  2OOB B;  4A6Q A;  2PE6 B;  2G9H D;  1GPX A;  4GU2 A;  2AL6 A;  1WJ4 A;  1CZP A;  2MA9 B;  1GAQ B;  2MRP A;  2WXK A;  4EE2 A;  4E71 A;  5IO9 A;  2LGX A;  3KUC B;  4L1B A;  3ZTD A;  5IP4 D;  3APD A;  2E6X A;  4PS8 A;  1E9M A;  3DBL B;  3VUW A;  2DZJ A;  4DDG D;  1K51 A;  2MEK A;  1WXS A;  1WY8 A;  3H1U A;  1BT0 A;  2BWF A;  3VUY A;  2J4X A;  2QDF A;  1L0X B;  1JWM D;  3V61 A;  2XK5 B;  3M3J A;  4MH0 E;  2WNM A;  4A3O A;  4GGQ A;  1FPY A;  2WDR B;  4R3D A;  3ZRF A;  2L32 A;  1TZ1 A;  2KQ4 X;  3SD5 A;  1B9R A;  2FCM A;  3NZ3 A;  3NZS A;  2BYF A;  4FBJ B;  3URY A;  1C9F A;  4LNF A;  2M56 B;  1SE4 A;  2NTT A;  1TS5 A;  4DWF A;  4CQN A;  4L23 A;  4CO7 A;  1E7P B;  4URK A;  4WJO A;  2IJ0 A;  2BF8 B;  5IKC M;  3ZDT A;  3APF A;  4RGN A;  4DHZ E;  2K3U A;  3SDL C;  1IGD A;  2IBI B;  1ZPS A;  4BKG A;  5AZH A;  5BYR A;  1SB3 C;  1F1H A;  3AE6 B;  2FAZ A;  1QOA A;  3ZVV A;  3U2S C;  5E6N A;  4KKJ A;  1WZ0 A;  3IG3 A;  4JIO U;  1J19 A;  3HK0 A;  1K8R B;  1N60 A;  2FUH B;  2LMC A;  2WXN A;  3H8H A;  2GI9 A;  1ZOY B;  2XEW A;  1V80 A;  1VR9 A;  1RLF A;  3I5J C;  4W9L A;  3WAP A;  1YQB A;  4AJW A;  2REX A;  3C8Y A;  3GB1 A;  4HRS A;  1MG8 A;  4GOC A;  3K9P B;  1HEZ E;  2HE7 A;  1TIF A;  1A5R A;  5HHD G;  4ARC A;  1UF0 A;  4GB9 A;  1I42 A;  2DYO A;  1WJU A;  5H8Y E;  4MH8 A;  3M63 B;  4HPL B;  4TSS A;  3AXC A;  4WWP A;  1SBB B;  2DAJ A;  5JZE B;  1QF6 A;  2KAJ A;  1BML C;  1MHX A;  1FEH A;  3DOW A;  1YJ1 A;  2JUO A;  1D3Z A;  3N30 A;  2RMM A;  3DBH I;  3L0W B;  2KZR A;  1JQ4 A;  5J2R A;  2LGS A;  1SE3 A;  2GOW A;  5BMH A;  3Q8E A;  4B95 A;  2C7N B;  2ZEQ A;  2Z0E B;  3ZJU A;  3AE2 B;  1FNW A;  4W9F A;  4N6E B;  1C1Y B;  5FR6 A;  4DDI D;  2JZZ A;  1EO6 A;  2IGH A;  3X23 A;  3KWL A;  2O2V A;  4CYE A;  1V2Y A;  2DAF A;  4YSZ B;  1KFY B;  1QKZ A;  2NMQ A;  3VUX A;  2CU3 A;  4MGY E;  1V86 A;  2QIE B;  4FA6 A;  2D3C A;  4M01 A;  2WXI A;  4PYZ A;  2KVZ A;  1AN8 A;  1RRB A;  2JZP A;  2UU7 A;  1XO3 A;  1F2R C;  4Q2J A;  1H8C A;  5AZG A;  2GRI A;  3RT3 B;  3W1Y A;  2HTH A;  2J0M A;  2IND C;  4HEA 1;  1LO5 D;  1JWB D;  4HJK A;  3CST A;  1L4Z B;  1WYW B;  1TY0 A;  2FIF A;  3GE8 C;  2EMS A;  1GC6 A;  4M8N A;  1WR1 A;  2N7E A;  2B3A A;  3BK2 A;  2WXM A;  2BQQ A;  4AJY B;  5HI1 A;  5LXH A;  4G0N B;  5KHQ A;  1YX5 B;  4A9A A;  1R7S A;  3QC8 B;  5EE9 A;  3ONS A;  4OHJ A;  2LFI A;  2Y5B B;  2Z59 B;  1GB4 A;  2WDQ B;  1DOY A;  4FHK A;  5IOI A;  3Q3M C;  1KTK A;  2MP2 B;  2DWQ A;  2UYZ B;  1E5W A;  2KLC A;  1XLP A;  3TEZ A;  5HKH A;  2YEP B;  1TZO A;  1TBE A;  1FD6 A;  3JW0 X;  2QIL A;  1MHH E;  2QSD A;  1D5Z C;  1I4R A;  1I4X A;  3GE3 C;  4IWP A;  2L3Z A;  4OZB A;  5JXV A;  1C76 A;  2BYV E;  1XQQ A;  1QOB A;  2BKF A;  1WGY A;  4BOZ B;  3A4R A;  1DGJ A;  2C7M B;  3C19 A;  1XLN A;  1T3Q A;  4LJP B;  2KDM A;  3ZDM C;  1LM8 B;  2MP2 A;  4FN2 A;  3GP7 A;  2E3T A;  1PUT A;  4FJV B;  4IM0 A;  2KXJ A;  4E3C A;  1TS3 A;  1M94 A;  4WIP A;  3EGR A;  3RNC C;  2MCN B;  1ZDX A;  3P4Q B;  2CKH B;  3NS1 A;  3N9Y C;  4B0E A;  3CMM B;  2C60 A;  1UZX B;  4KGR A;  2OJR A;  3DBL I;  1J7C A;  3A9K B;  2FBW B;  2GBN A;  5IN7 A;  4HDO A;  1MI0 A;  2X8X X;  4WWM A;  1NEK B;  3QAR A;  2CS4 A;  2MH7 A;  3CIR B;  3EUB 2;  4KZC A;  1RYJ A;  3FAH A;  4HVB A;  2L0F A;  4W9H A;  3RD2 A;  2LVO A;  1ZKH A;  1ZXI A;  2WLB A;  2KN4 A;  1L7Y A;  3U52 E;  1F2R I;  3TCA A;  3QX1 A;  2D11 A;  4GDK A;  3Q3F A;  4K7U A;  4CHK A;  3IAM 1;  4KIK A;  1PFD A;  5G2N A;  1P1A A;  2PW9 A;  3UQB A;  2K8C A;  3P4R B;  3RNE C;  4IDI A;  1TY2 A;  5GMV A;  3V6C B;  2G45 B;  2N9K A;  3TMP B;  3DBS A;  2MLB A;  2CHX A;  4AP4 C;  2Z8L A;  3NRZ A;  4PYU A;  3QK0 A;  3CSF A;  2EEL A;  4UDU C;  1R4N B;  3Q14 C;  1GOZ A;  1BXT A;  3P4P B;  1I4H A;  3IBE A;  3ZNG C;  2MBQ A;  3IFW B;  5HFY A;  1IP9 A;  3H7P A;  1XT9 B;  1D6E C;  2QCZ A;  3BVG A;  4GXB A;  3J9C A;  4LLG M;  1IUE A;  3ABV B;  4ZOH C;  3QIJ A;  5CTR C;  1I4Q A;  3UIN B;  1I7H A;  4I6L B;  4WWN A;  1ISN A;  5L95 C;  2DYB A;  2KK8 A;  1GNU A;  5G55 A;  4P7I A;  3VH4 B;  1YQ3 B;  1WMH A;  2JT4 B;  1JWA D;  4IG7 B;  2K6Q A;  4AWJ A;  3B2G A;  2NPT A;  2IO2 B;  4P16 A;  2A4Z A;  3DBR B;  1VLB A;  3BVZ A;  2RPQ A;  5CHF A;  1SEB D;  2JWU A;  1F0Z A;  2L83 A;  2LXC A;  1WXV A;  2PTL A;  3DQV A;  1JRP A;  4A20 A;  3R7Q A;  3RUI B;  4KV2 A;  2WXF A;  1L0Y B;  4KSK C;  1KF6 B;  4XDD A;  3ZNH B;  2KWC A;  2V3S A;  3T9L A;  2JQR B;  4US9 A;  5H92 C;  3ZNI D;  2NBV B;  1F77 A;  2BS4 B;  2IY1 B;  2N1V A;  2VZK B;  5IAA C;  4L2Y A;  3AE7 B;  2KDB A;  3NVW A;  3L54 A;  4DK5 A;  3AE4 B;  4US8 A;  5AEK B;  1FNV A;  4NJ7 A;  4EZJ A;  3KVF B;  2LGD A;  3RNF C;  2ONQ A;  1C4P A;  4BAX A;  3L17 A;  1EWC A;  2FNJ B;  3MFG A;  3AE9 B;  2ASQ A;  2KTF A;  2LI5 A;  3AI5 A;  5D94 A;  4DXF A;  1VCB A;  3VVW B;  2DBY A;  4OVU A;  5JH5 C;  2KMA A;  2MW5 A;  1SE2 A;  3GOE A;  2O6V A;  3T3N A;  1OQR A;  1BUI C;  3O13 A;  2BKR B;  4C56 C;  1XCT L;  1OQY A;  1DOX A;  1S3S G;  2KMM A;  2QHO A;  3DHH C;  5LNK 1;  1SF0 A;  4OVV A;  3H7S A;  2FCN A;  3PZ8 A;  4S17 A;  3NY5 A;  1UNS A;  4WJP A;  2WXL A;  4BKS A;  1TS2 A;  2Q5W D;  3PLU A;  1L2N A;  2BBC A;  1ENF A;  1IYF A;  4IC7 B;  1ZP0 B;  4RFB A;  4J3O D;  3AM9 A;  4FLH A;  2BB5 A;  2ZVO A;  1GJZ A;  3ZXR A;  2PVG C;  4NAW A;  1FFU A;  3TBL D;  4WJN A;  3JSV A;  5KHO A;  2PPH A;  1VJK A;  1E8Z A;  2AQ3 B;  2ZW0 A;  2KJ6 A;  1Q1O A;  1FCC C;  3PZD A;  5D3D A;  3P4S B;  3LJ3 A;  3PV1 A;  2JPH A;  2WGS A;  2WX0 A;  3HM6 X;  2J0J A;  2R2Q A;  4ZRI A;  2R61 A;  1V5T A;  2DEN B;  4JL9 A;  2RDH A;  4YTN B;  1H4R A;  2D07 B;  3DVN U;  1HE8 A;  4LK0 M;  4PK1 A;  2AQ1 B;  3WAN A;  4JLC A;  4XZ4 A;  1WXQ A;  4REZ A;  3A4S C;  1MG4 A;  2LHE A;  4W9C A;  1E7U A;  3B1L X;  1YQ4 B;  3NVZ A;  2XK5 A;  3PPA A;  1ZUD 2;  1HXY D;  5TR5 A;  4N58 A;  1OFF A;  1D5X C;  2WXQ A;  3ZTC A;  4FAD A;  2WXR A;  2J0K A;  1R4M B;  4OW0 A;  1AW7 A;  4GDL B;  2KTR B;  2BB6 A;  1C3T A;  4E74 A;  3ZUN A;  2KX0 A;  2KVR A;  3SFE B;  3L08 A;  3MC9 A;  4BKS D;  3DPD A;  2KYW A;  2JRH A;  1T0R C;  1WGK A;  4F1S A;  2M8S A;  1XLQ A;  2LVQ A;  3BYY B;  3DHG C;  4NJ6 A;  3RPF C;  4WJQ A;  4AUQ C;  4ZYS A;  1YN3 A;  3GZN B;  3LB8 C;  2PE9 A;  5D6J B;  4RMA A;  2K1F A;  3KUD B;  4EOY A;  4HWI B;  3OWE B;  1QQR A;  4BZA A;  2ACZ B;  1N6Z A;  1VRA B;  3CWI A;  4HCP B;  3NG0 A;  1CJE A;  1IBX B;  3WAL A;  3QAQ A;  1UD7 A;  4XE0 A;  1JW9 D;  3VAW A;  4AQ7 A;  1QIL A;  1P0R A;  1L0V B;  1YJJ A;  2N0S B;  4II3 B;  4BFR A;  3VR8 B;  1FXI A;  2L7R A;  4EKU A;  3SR6 A;  3W9C B;  2LVP A;  4I6N B;  3UI3 A;  3KUZ A;  2KD0 A;  4D2K A;  4LNI A;  3MHS D;  3S2A A;  4DXG A;  2LHD A;  4P6V F;  3SHQ A;  1CQV A;  1WGH A;  4JGH B;  2ZZP B;  1IBX A;  4MSQ B;  1I4P A;  4XDC A;  1NYQ A;  2LRW A;  1YMH E;  3PO0 A;  4BBN C;  4KDL B;  3I9V 1;  1C4A A;  4W9J A;  2IZV B;  4H2A A;  1HTQ A;  4K7S A;  1WGG A;  3AV8 A;  2M19 A;  2DZI A;  3AU5 A;  4M02 A;  4MGZ E;  2Y5C A;  4ZRK A;  3RMK C;  1V8C A;  1XLO A;  2K9X A;  3AE5 B;  5FKA C;  5I4D A;  2NBU A;  1XXG A;  5BMG A;  2WU5 B;  2GBJ A;  4MEM A;  1WR6 E;  1V9J A;  3ML8 A;  2L05 A;  4RGM A;  3DWM A;  2CU1 A;  2KTR A;  2J42 A;  3ZXV A;  1WX8 A;  2N4F A;  2L8J A;  1HQR D;  1FIQ A;  2MBH A;  3HVZ A;  4TUU A;  3SFD B;  3RFZ B;  3JVZ X;  3AMZ A;  3SU8 X;  1JWU D;  3GS2 A;  2NS5 A;  2MBB B;  3W2D A;  1I4G A;  4KIK B;  3EFC A;  3IXS A;  3MJ5 A;  2BYT A;  1WM2 A;  2D2Q A;  5E6J A;  3RCZ A;  3DBR I;  3TEW A;  2RGF A;  2LGI A;  4MJS A;  1L4D B;  4EZK A;  1UWM A;  2C7H A;  3KH0 A;  3BII D;  3RUL A;  1P7F A;  2QMT A;  2KAN A;  3KYD D;  3QJZ A;  1ZGU B;  2IPK D;  2DLB A;  2NR2 A;  3ZLZ A;  1EF1 A; 
#chains in the Genus database with same CATH homology
 1ZXH A;  1V1O A;  1KLU D;  3T3O A;  2ICI A;  4AS1 A;  3P4R B;  3AEF B;  1FFV A;  1STE A;  1WSP A;  4IDI A;  1TY2 A;  4ITK A;  2V4I B;  2WXJ A;  4NAM A;  2BS3 B;  2LJI A;  2L52 A;  2N9K A;  1ACC A;  1D5M C;  1ROE A;  2KAC A;  1HZ6 A;  1RWS A;  3BWU D;  5EE0 A;  1L6U A;  1ET6 A;  1E6E B;  1YJI A;  2XN9 C;  4ARI A;  1FRR A;  2SAK A;  2Z8L A;  1ET9 A;  3NRZ A;  4JX1 C;  1JRO A;  3AE1 B;  2EEL A;  2AX5 A;  4UDU C;  3W1S A;  2J52 A;  1UGJ A;  1GOZ A;  1UUP A;  1BXT A;  1SJE D;  1T5X D;  3P4P B;  1ZE3 D;  2WXO A;  1I4H A;  1VZ8 A;  4C7Z A;  3AEG B;  2PKO A;  2CJN A;  2JYE A;  2VZK D;  2PIA A;  5HFY A;  4A6Q A;  1JML A;  4DQO C;  2G9H D;  1GPX A;  1D6E C;  1SSN A;  3BVG A;  3NVY A;  1CZP A;  2H89 B;  1GAQ B;  3J9C A;  3LYY A;  2WXK A;  3P42 A;  4LLG M;  4EE2 A;  4YWG G;  1IUE A;  3ABV B;  2MJD A;  4ZOH C;  1C77 A;  1KH0 A;  1I4Q A;  4L1B A;  1I7H A;  4O1N A;  1YN5 A;  4PT5 A;  1EM7 A;  2E6X A;  3ZJV A;  1C79 A;  1E9M A;  3IT4 B;  4MAC A;  1EU3 A;  1L5P A;  1YQ3 B;  1K51 A;  2MEK A;  4YTM B;  4JPS A;  1TKG A;  1VDV A;  1JWA D;  4WUR A;  3B2G A;  1TYG B;  3NUH B;  4RF1 A;  5T8I A;  4P16 A;  1VLB A;  2J4X A;  3BVZ A;  1L0X B;  2GB1 A;  1JWM D;  1SEB D;  2JWU A;  1F0Z A;  1VZ7 A;  2WNM A;  3AE8 B;  3FIL A;  2L83 A;  2WDR B;  4WH4 A;  4MT5 A;  2JU6 X;  4R3D A;  2PTL A;  1FM0 D;  1JRP A;  2L32 A;  1K52 A;  2H88 B;  2WQY B;  2WXF A;  4A55 A;  1L0Y B;  2KQ4 X;  4KGS A;  1WYG A;  2PLP A;  3P1M A;  1B9R A;  2SEB D;  1KF6 B;  4XDD A;  3VR9 B;  2DYM A;  1A70 A;  2JSV X;  3Q8C A;  3Q8A A;  3NZ3 A;  2JQR B;  4RF0 A;  4TQ1 A;  2W82 A;  4US9 A;  5H92 C;  1F77 A;  2BS4 B;  2HDE A;  3URY A;  1C9F A;  3B9J A;  1V1P A;  2W3R A;  2I38 A;  3FIL B;  2M56 B;  4FXC A;  3B2F A;  1SE4 A;  2VZK B;  4L2Y A;  2NTT A;  1TS5 A;  3AEC B;  3AE7 B;  2NTS A;  4CQN A;  3NVW A;  4L23 A;  1E7P B;  3AE4 B;  4US8 A;  1FNV A;  1P7E A;  2IJ0 A;  1HZ5 A;  4OZA A;  4JWU C;  2ONQ A;  2WU2 B;  1C4P A;  1AWD A;  2PMV A;  1EWC A;  4RGN A;  4ZRQ A;  1T6B X;  1VZ6 A;  2K3U A;  3MFG A;  3AE9 B;  1IGD A;  5EE3 A;  4XWW A;  1ZPS A;  2INN E;  2V0G A;  4DXF A;  2DBY A;  1SB3 C;  1J7B A;  5BYR A;  1E0Z A;  3AE6 B;  1C78 A;  3VRA B;  1D4B A;  1KLG D;  2QEJ C;  1QOA A;  1N5X A;  1SE2 A;  3IAS 1;  1YNT E;  3U2S C;  3T3N A;  1OQR A;  1BUI C;  1TKY A;  3O13 A;  4N59 A;  2QJL A;  4KKJ A;  2N7J A;  2OED A;  4C56 C;  1XCT L;  1N5W A;  1DOX A;  5EE1 A;  2KMM A;  4JE3 B;  4RGT A;  1WRI A;  3AEA B;  1QOF A;  2IDY A;  5LNK 1;  1N60 A;  4RH6 A;  1SF0 A;  2LMC A;  1C4C A;  2WXN A;  3H8H A;  2GI9 A;  3PZ8 A;  1ZOY B;  2L1A A;  3W5V B;  4ZHO A;  1UNS A;  1VR9 A;  2WXL A;  1TS2 A;  2Q5W D;  4WQM A;  2BT6 A;  4JWS C;  2BBC A;  4C80 A;  2CJO A;  1ENF A;  1XF5 L;  2ZW1 A;  3AEB B;  1ZP0 B;  1EU4 A;  1K50 A;  1GB1 A;  3C8Y A;  4RFB A;  1OQQ A;  4TQ0 A;  2K5P A;  4J3O D;  3GB1 A;  3KQ4 A;  2V3P A;  4HRS A;  5G5H A;  3AM9 A;  2BB5 A;  3U7Z A;  4IKG A;  3DWG C;  3Q8B A;  2PVG C;  1AYF A;  1HEZ E;  1ESF A;  3AED B;  3LXF A;  1FFU A;  4YSX B;  3P63 A;  1SIJ A;  2K22 A;  3Q69 A;  5HHD G;  2HTM E;  4NJC A;  1RM6 C;  4C7Y A;  1FO4 A;  1VJK A;  2AQ3 B;  4ARC A;  3AEE B;  2DYO A;  2ZW0 A;  4XWT A;  2Y3A A;  5AUI A;  4M0W A;  5H8Y E;  1FCC C;  5D3D A;  4MH8 A;  3P4S B;  1N62 A;  1XCQ L;  4TSS A;  1SBB B;  3HUI A;  4NAW B;  1QF6 A;  5D7G A;  1YN4 A;  1PGB A;  2KAJ A;  1V97 A;  1BML C;  2R61 A;  1MHX A;  4YTP B;  1FEH A;  3IT6 B;  1V1P B;  2IGG A;  2RMM A;  2RDH A;  4YTN B;  1JQ4 A;  2LEK A;  1RFK A;  1SE3 A;  3AB5 A;  4ZHP A;  5BMH A;  1IGC A;  3Q8E A;  4LK0 M;  2WXH A;  2AQ1 B;  3HRD D;  3SEB A;  3ZJU A;  1WXQ A;  3AE2 B;  1FNW A;  1TJE A;  4REZ A;  3BVM A;  2X38 A;  4N6E B;  2LHE A;  2Y5P A;  1TKE A;  4NZL B;  5G5G A;  1YQ4 B;  3E56 A;  3KLS X;  3NVZ A;  2FE8 A;  1ZDV A;  5HG2 A;  2IGH A;  4WAF A;  1ZUD 2;  1QOG A;  1QLB B;  1HXY D;  4HRO A;  5GXG B;  1JAL A;  4N58 A;  1CK1 A;  1SXT A;  1OFF A;  3KWL A;  1D5X C;  1DOI A;  2WXQ A;  1FCL A;  2WXR A;  4USA A;  1KRH A;  4OW0 A;  3FC4 A;  4YSZ B;  1AW7 A;  4GDL B;  3BZD B;  1KFY B;  4ZRP A;  2BB6 A;  1QKZ A;  2NMQ A;  4TMA B;  2CU3 A;  2J53 A;  2QIE B;  1EWY C;  3BYT B;  4KKI A;  3I57 A;  1PDX A;  2WXI A;  3SFE B;  2PVO D;  3ETR A;  3VRB B;  3TUO A;  4B0M A;  1AN8 A;  1FRD A;  3R8B A;  2OHF A;  2WDV B;  1FMA D;  2JZP A;  3WCQ A;  3E9S A;  1WGK A;  1XO3 A;  1F2R C;  4OVZ A;  1M4V A;  1Y56 A;  2WXG A;  1XLQ A;  3BYY B;  4KX6 B;  4Q2J A;  2GRI A;  3RPF C;  4HEA 1;  3ZYY X;  1LO5 D;  3U4E G;  4ZYS A;  4GLS C;  1YN3 A;  1JWB D;  3LB8 C;  3MC0 B;  4IOI E;  5FK9 C;  1QT9 A;  5TSS A;  3ZJT A;  2I2Y A;  2N9L A;  3R2I A;  1L4Z B;  3OWE B;  1QQR A;  1NVI D;  1TY0 A;  3TSS A;  2ACZ B;  1VRA B;  3CWI A;  2BW2 A;  3AH7 A;  1SJH D;  1CJE A;  2JYT A;  2JX5 A;  1IBX B;  4YT0 B;  4XE0 A;  1JW9 D;  3BK2 A;  4AQ7 A;  2BTE A;  1QIL A;  3AN1 A;  2AQ2 B;  2WXM A;  1E10 A;  1L0V B;  1YJJ A;  2N0S B;  5HI1 A;  3VR8 B;  1FXI A;  1B1Z A;  3SR6 A;  4YXD B;  3W9C B;  3UI3 A;  1TS4 A;  4A9A A;  4D2K A;  4HKQ A;  1R7S A;  5EE9 A;  4DXG A;  2LHD A;  4OHJ A;  2LFI A;  4P6V F;  1GB4 A;  1K53 A;  4A8X C;  2WDQ B;  3TEY A;  1DOY A;  1CQV A;  1JWS D;  5BYQ A;  1UWX A;  4LTU A;  1DYQ A;  1XEE A;  1KTK A;  1IBX A;  2DWQ A;  1NYR A;  1PYW D;  2JXT A;  2TSS A;  1I4P A;  4RCO A;  3R2T A;  4XDC A;  1NYQ A;  5AUK A;  1XLP A;  1YMH E;  3PO0 A;  3TEZ A;  3Q8F A;  3EA6 A;  2YEP B;  1TZO A;  1FD6 A;  2QIL A;  2B76 B;  1MHH E;  2QSD A;  3I9V 1;  1C4A A;  1D5Z C;  4H2A A;  1I4R A;  4GDK B;  1I4X A;  3AV8 A;  2M19 A;  4OZB A;  5JXV A;  1C76 A;  2Y5C A;  3VQI A;  2MJ3 A;  1WWT A;  2M0A A;  5FR3 A;  2MJE A;  1V8C A;  1NI3 A;  1XLO A;  2K9X A;  1QOB A;  4MM3 B;  3AE5 B;  5FKA C;  5I4D A;  1DGJ A;  2BS2 B;  1XXG A;  5BMG A;  1L6V A;  2WU5 B;  2WXP A;  1XLN A;  1T3Q A;  3KWV A;  2V3N A;  2WP9 B;  2KDM A;  1J7A A;  3TEX A;  3DWM A;  3GP7 A;  4RGM A;  2RDG A;  2E3T A;  2J42 A;  3NVV A;  1PUT A;  2FUG 1;  2INP E;  1FXA A;  1TS3 A;  3AE3 B;  3L4P A;  4HJG E;  4WIP A;  1HQR D;  3EGR A;  3V05 A;  1FIQ A;  2W55 A;  1MPE A;  3HVZ A;  1MVK A;  1ZDX A;  3P4Q B;  5MPO A;  3NS1 A;  3N9Y C;  3BK1 A;  4B0E A;  3SFD B;  4A90 A;  3RFZ B;  4YSY B;  3AMZ A;  2KWD A;  1HA5 A;  4KGT A;  4KGR A;  1JWU D;  1J7C A;  1Q10 A;  2FBW B;  2IGD A;  3GS2 A;  1FNU A;  2G1E A;  3W2D A;  1MI0 A;  2W54 A;  3V3X A;  5C3J B;  1I4G A;  4WWM A;  4RNA A;  5C2T B;  1NEK B;  1PGA A;  3CIR B;  2MH7 A;  3EUB 2;  3IXS A;  3MJ5 A;  3MHZ A;  5BYS A;  1RYJ A;  2BYT A;  5E6J A;  3ZGZ A;  3ZQ4 A;  3TEW A;  5BMI A;  3FAH A;  4RGO S;  2LGI A;  2W3S A;  1L4D B;  2WS3 B;  2XNA C;  4OZC A;  1N63 A;  1UWM A;  1PGX A;  1JCK B;  5D3I B;  4HKZ E;  1ZXI A;  2WLB A;  3BII D;  3HVD A;  2KN4 A;  1P7F A;  2YEP F;  3U52 E;  3W5U B;  2K0P A;  1F2R I;  2RPV A;  2EKI A;  2QMT A;  2LUM A;  1N61 A;  2ON8 A;  3IAM 1;  2IPK D;  2DLB A;  1PFD A;  3PZ7 A;  1NEN B;  2PW9 A;  2D5G A;  3MP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...