4IOIE

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
b'SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ioiE00
5BMIA 2KN4A 4OZAA 1PGAA 3MP9A 5JXVA 2KWDA 4MACA 2NMQA 1Q10A 4HKZE 2JSVX 1MPEA 5BMGA 2GI9A 1GB1A 1MVKA 1UWXA 2LUMA 5HI1A 2JU6X 1MHHE 3FILA 5BMHA 1K50A 4KGRA 1QKZA 1XCQL 1PGBA 1JMLA 1YNTE 1XCTL 4OZBA 2N9KA 2KQ4X 2LHEA 2IGDA 2QMTA 1HEZE 1FD6A 4IKGA 3GB1A 1K51A 4IOIE 2I2YA 2N9LA 2PTLA 1K53A 2JWUA 1MHXA 2ONQA 2IGGA 4KGSA 1IBXA 3UI3A 1D4BA 2KACA 2LHDA 2JXTA 1MI0A 2I38A 1IGCA 1P7EA 2PW9A 4GLSC 1IGDA 1KH0A 2OEDA 4D2KA 3FILB 4HJGE 2ZW1A 4KGTA 2ZW0A 1HZ6A 2IGHA 2GB1A 5HG2A 2QSDA 2KDMA 1IBXB 2N7JA 4OZCA 1F2RI 1ZXHA 2EELA 2J53A 1K52A 2RMMA 2LGIA 2JZPA 5HFYA 1C9FA 4WH4A 1YMHE 5HHDG 1XF5L 1EM7A 2PLPA 1PGXA 1FCLA 2ON8A 1FCCC 2J52A 2RPVA 1F2RC 1P7FA 2K0PA 1HZ5A 1GB4A 3V3XA
chains in the Genus database with same CATH superfamily
5EE3A 3UGBB 2BWFA 2JQRB 4A3PA 4MACA 3CWIA 2YEPF 4DDGD 3SFDB 2PE6B 4HJKA 1WJ6A 1JALA 2L00B 2K25A 4WJQA 1C1YB 3R66C 1LM8B 4DQOC 3PSEB 4K81A 4DXFA 1PGBA 2WDRB 5EE0A 3TJPA 2TSSA 3PHXB 4X57B 3VRBB 1WXSA 2D3CA 5IOIA 2NPTA 1WM3A 2PJHA 1NI3A 1WE7A 4PS7A 2AEHA 2WXPA 4GIVA 2WXKA 2N9LA 2HJ1A 1TS4A 2LUEA 2PKOA 1CQVA 3BZDB 2GRIA 1WRDB 4LDTB 4WURA 1LO5D 5BYQA 3AEBB 4C00A 3AE3B 3WALA 5D7GA 2NTTA 2RPQA 3HVZA 2L32A 4MDKE 5HG2A 1OGWA 3RNCC 1P1AA 3AMZA 4OZCA 3DBRB 1RAXA 2I1JA 2EELA 3APDA 2NPTB 3AB5A 3HUIA 1WR6E 3QWZB 5BYRA 3RI7C 1DOYA 1CZPA 4LNOA 3I63C 5JHAA 3GP7A 3LDZE 4GXBA 2ON8A 1D6EC 3N32A 3C19A 3IAS1 3KQ4A 1AN8A 3M62B 4ZHPA 3PZ7A 1AW7A 3QARA 5JXVA 3TIXA 4B0MA 1QLBB 5E6PA 3RPFC 1UWXA 1FXAA 4W9DA 1XLQA 2LUMA 2NR2A 1ZOYB 3ZDTA 1UF0A 1ZUD2 1BT0A 2ZPNA 1IPGA 3FKYA 2I1KA 3WANA 2GBRA 1E7PB 4FLHA 1MJDA 1TYGB 3B9JA 2X38A 2ZJDA 3WA0A 2JPHA 2NCNA 3RULA 3I57A 4P1CC 3NUHB 1V80A 1N62A 1VDVA 2MH7A 5GMVA 2DZIA 4BFRA 2N9XA 3U52E 3ZRFA 4B0EA 1YN5A 3ZTCA 1HQRD 2DAJA 4S17A 2IGGA 2KDFB 3VHTC 2E6XA 1N5WA 2K39A 3UI3A 4EEWA 1FRRA 4TQ1A 2LI5A 1C79A 3N9YC 3SR6A 2RDBC 2KJRA 4FJYA 1I4QA 4C7ZA 3BIID 2WYQA 1NEKB 3H1UA 2WXIA 2ZW1A 2ZW0A 1T5XD 4MGKE 4JIOU 2BYEA 3OWEB 4HPPA 1HE8A 3CSFA 4ICVA 1YQ3B 1Q5WB 2DZJA 4MGZE 1GAQB 2FBWB 1YMHE 4KSLC 1DGJA 3DBSA 2IY1B 3VUXA 3MC0B 2IO0B 5IA7A 2AX5A 4W9IA 1FFVA 1UUPA 2N9PC 2WU5B 4LTUA 3R7QA 3V3XA 3FC4A 2IYDB 1ZW7A 3ML8A 2J0JA 3MTNB 1FPYA 2CKHB 2L0TA 5JZEB 4KZCA 1RM6C 3GZNB 3W1SC 3VQIA 1TZOA 1MHHE 1NVID 2MHJA 3E56A 3IT4B 4JWUC 1QKZA 2MJEA 4E74A 3A9JB 4M8NA 3OAWA 2KWVB 2KTFA 3DBHI 1N5XA 4G0NB 4GGQA 2LVPA 2QIEB 4HXDA 2V3PA 1V6EA 4RH6A 2CU1A 1VCBA 2BS4B 5LXIB 3AEFB 1EWYC 4DXAB 3VUWA 2WDQB 1HTOA 2Z59B 2KWUB 5E6NA 2WXJA 4REZA 3RNFC 4ZYNA 4YXDB 3ZYYX 3DQVA 1OQQA 4ZRQA 4PK1A 3EUB2 3ZW3A 1UBIA 4PS3A 5TSSA 1PQSA 3PVLA 1JWBD 3V05A 4DDID 2PE9A 3PZ8A 2HE7A 2MP2B 3ML9A 4GLSC 1IGDA 2C7HA 4NJCA 5EE9A 1KLUD 1KRHA 1SE2A 4B9KA 4NAWA 1IBXB 1D5XC 4GDLA 1F2RI 1I4GA 2HD5B 3U8ZA 3JSVA 1CK1A 1WYGA 5CHWA 4A6QA 2CS4A 1TKEA 4W9KA 2JZPA 2D2QA 2MBEA 1YQBA 1C9FA 3PRPB 1QOFA 3OLMD 2PLPA 4NNJB 1J7BA 2DHZA 4DBGA 1FCCC 4BKTA 4ZOHC 2BB6A 2V4LA 4IM0A 4IUMB 4KX6B 2ZNVC 3VAWA 2KN4A 3SHQA 3TEZA 4IM3A 4IWPA 1WXVA 2V9HA 3PGEA 1KF6B 1C3TA 4IDIA 2GI9A 1MVKA 1I4PA 4OHJA 4ZRJA 1WWTA 2KO3A 4NAWB 2K6DB 3FILA 3ONSA 3DDCB 2V0GA 1NI2A 4CHKA 1F1HA 2WNMA 1WSPA 1WXMA 4JGHB 2WXNA 3B08A 4UDUC 3DVNU 2KQ4X 3D32A 1FIQA 2Z8LA 3RNBC 4EFOA 1HA5A 3VH4B 2MBHA 2G3QB 3Q14C 3Q6BA 3E9SA 4HROA 3N1ZC 3URYA 2VZKD 3L16A 1QOBA 1I7HA 4XWTA 1CMXB 1MFWA 2I2YA 3PPAA 3ALBA 4E71A 2MJ3A 3ZJUA 5H8YE 3ZQ4A 4BKSD 3W5UB 1PUTA 2KACA 1P98A 1F9JA 1WZ0A 1P7EA 2N7EA 2N4FA 4D2KA 3FILB 3EA6A 2MW5A 2NS5A 2YLMA 3QCAA 5C2TB 2DYMA 1ZXHA 1T0YA 1QOGA 4EZJA 3SEBA 2M0XA 3TBLD 4DK5A 3X23A 4JLCA 2CHXA 1P0RA 3L08A 3APFA 3KVFB 2W3SA 5IKCM 3ZVVA 2L76A 2AQ2B 4A20A 4MJSB 1Q1OA 1XLOA 4NAMA 4LNIA 3HM3A 3RNGC 5GXGB 2IDYA 2K8CA 2JSVX 2BYVE 2ZNVB 2H89B 3SFEB 3M63B 4XWWA 2JU6X 3NG0A 4GSWA 3DHHC 2ZVOA 1HXYD 1XEEA 3IT6B 3U2SC 2G45B 4OVUA 4P1BC 2WWZA 2JT4B 5HKHA 2K6QA 3ZJTA 3U30A 1L6VA 4K3BA 2LMCA 3CSTA 2J0KA 4NQKE 4MGYE 4ITKA 3BY4B 2Y3AA 2KLGA 2MLBA 2KAJA 2LGDA 4RM8A 3ZXVA 3ZGZA 2FNJB 2AQ1B 2KDIA 5FK9C 3P2BA 2K1FA 2ACZB 1LGRA 2N9EB 4RMAA 1I42A 3I9V1 2KDEB 5H92C 4IM2A 1YQ4B 4II2B 4DHJD 4WJPA 3VTWA 1P9DU 4A9AA 2MBOA 1TJEA 3CF6E 3H7PA 2IY0B 2RDGA 2SAKA 2J53A 3S2AA 2K9XA 4B6WA 2RMMA 2LGIA 4EUTA 1STEA 2KDBA 2FUHB 3RNAC 1YX5B 2EMTA 4IW0A 1EM7A 5C23A 5D3DA 2XBBC 1YIWA 1Z5SB 2KJHB 1FCLA 3P4PB 4GMVA 1IUEA 1Q0WB 2BQQA 2J42A 2XNAC 2V1YA 1PGAA 2JYEA 1Y56A 2PVGC 4MSMB 2PVOD 1H8CA 4RGOS 5D3IB 4L23A 1FMAD 2JUOA 1L0XB 1V1OA 5JH5C 1T3QA 3EFUA 3A4SC 5C3JB 5EDSA 2O6VD 2KFKB 4JE3B 2W3RA 2LZ6A 1MG8A 1T0RC 3L0WB 3H7PB 2DZKA 2EMSA 4LNKA 1I4RA 1XCTL 4ICUA 3KUDB 3VR9B 3DBLI 3L10B 4I6LB 1NDDA 4MEMA 4WWPA 2IGDA 2BW2A 4XZ4A 3TUOA 2RD0A 2UWQA 3P63A 4IKGA 4HCPB 4HWIB 5CHFA 4HVBA 3SDLC 5AEKB 3NVYA 3X0WA 3CIRB 2L83A 4W9LA 1D5ZC 5BO4B 3J9CA 3MFGA 2WX0A 3RMKC 2XN9C 4NPNA 5CHVC 4KV2A 1YJ1A 2AQ3B 4TUUA 3NZUA 2VH1A 2OEDA 2OJRA 1E8XA 4US9A 2INNE 3UIOB 5E6OA 1UELA 2CJOA 2IO1B 2N7JA 5AZGA 2FAZA 2MBBB 1X1MA 3Q8BA 1SF0A 5G5HA 1XQQA 4EKUA 3AEGB 1L7YA 2XK5B 1TY2A 3B2FA 4FN2A 1R4NI 1BXTA 2C9WB 5AZHA 2JVCA 1SSNA 2YEPB 2RPVA 3Q8CA 1YJIA 4M8MA 2FE8A 1TT5B 3Q3FA 1WXAA 3ECIA 2OHFA 1AWDA 2M19A 2C7MB 2L7RA 3M95A 3P42A 4IG7B 1TTNA 3Q69A 2BWES 4HK2A 3TEXA 2FCQA 1N60A 1UH6A 2KZRA 4TQ0A 1JQ4A 1JMLA 1DYQA 4AOFA 3P4QB 1AYFA 2AL6A 1EWCA 2L8JA 4BKSA 3IG3A 4K1RB 2E3TA 5AUIA 4N58A 1HEZE 1WH3A 3W1YA 3BK2A 5D94A 1L6UA 2INCC 1TY0A 1N61A 3ABVB 4GDKA 4ZRIA 1V81A 1WF9A 4RGNA 1MHXA 3NVVA 1CJEA 1R7SA 4GU2A 2L1AA 3MC8A 4HKQA 1NENB 4LNNA 4HPMB 2BVCA 1E6EB 1WI0A 1B9RA 4C7YA 2I38A 4KDIC 3NY5A 1FXIA 4YTNB 2BBCA 2VZKB 1WXQA 1L4ZB 4HJGE 4WQMA 1GG3A 5L95C 1GPXA 1FO4A 1VR9A 4RGMA 3TEWA 1PYWD 1OQRA 1JRUA 2BF8B 2JXXA 1N6ZA 4KKJA 5DPTA 3AN1A 2KMAA 1J7AA 1R4MB 5KHOA 4FJZA 5I4DA 4HDQA 1SE9A 1UBQA 1WRIA 4CQNA 1FM0D 4GDKB 4GN1A 2YVCA 4G3XB 2KT7A 2W55A 2D5GA 4QAYA 4OZAA 1ZDXA 3A9JA 3UINB 1XD3B 1GB1A 3P4SB 2R2QA 4LNFA 3MC9A 2FIFA 2INPE 3ETRA 1V8CA 4F7ZA 3ZNZB 3TMPB 4ANXA 1WIAA 4OZBA 2KVZA 3DHIC 1ET9A 2FCMA 1PDXA 2KKCA 3PTFC 4BOSC 2D3GA 1UWMA 3VRAB 2AYOB 2G4DB 4MM3B 5D2MB 3AI5A 2D11A 2MP2A 3HK0A 4ARIA 2BYFA 2LRUA 2O2VA 3PLUA 3SU8X 1Y8RC 1G6JA 3MJWA 4LK0M 4ANVA 1IBXA 3QX1A 2IBIB 3AE9B 1FXTB 1P3QU 2LFIA 3H8HA 4KSKC 2VRRB 2B76B 1EU4A 2LHDA 2XEWA 4ZYSA 2ZVNA 1YN3A 5LLIA 3KW5B 3HIZA 2KYWA 1EF5A 1BMLC 4ANWA 4AS1A 3JYUA 5KHQA 3WAOA 2CHWA 2IGHA 5FR3A 3PHWB 4ARCA 2KDMA 2NTSA 4W9FA 4WJNA 3TSSA 3V62A 5FKAC 4RM9A 5J17A 4I6NB 1WJNA 2JF5A 2DNFA 3PRZA 2WXQA 1T0SC 1TIFA 1ZGUB 3RT3B 4BKGA 2O2VB 2O6VA 3H9DA 4DHJB 3VH3B 2KVRA 5BYSA 1RFKA 1TKGA 2Y5CA 4K3CA 4RF0A 3W2DA 2IJ0A 2FCSA 2WQYB 1OQYA 2N7DA 3DVGX 4WJOA 3O65B 4JX1C 2K8BA 3IAM1 3BVMA 2WXMA 2KC2A 2FIDA 3W1SA 1H4RA 1WX7A 3BINA 5BMGA 2RDHA 4US8A 1M94A 3AE8B 3AH7A 2G4SA 1WGHA 3LYYA 3IHPC 1XCQL 2LGYA 3HRDD 2M0AA 2CU3A 1E7VA 3KYCD 1WJUA 5D6JB 1L4DB 1UZXB 3A4RA 3WAMA 2JX5A 1WX8A 3ZLZA 2O6VB 1A70A 3U4EG 2DAFA 2Z0DB 4YSXB 1C77A 1JW9D 1WX9A 1K53A 1J0GA 3NS8A 1E9MA 1KFYB 5J2RA 2WXLA 1ZXIA 3VFKA 4C4VA 1EUVB 2JXTA 1A5RA 3L17A 1I35A 1JWMD 4LJOB 2L0FA 3QC8B 1QZEA 4HLEA 2C7NB 3PV1A 2LGXA 4MJSA 1NBFC 2IPKD 4FHJA 3MHZA 4GB9A 3TL5A 3VVWB 3B1LX 4AJWA 1K52A 2LGSA 3Q2AC 2MJDA 1WGDA 1EO6A 2REXA 5HHDG 2KX0A 1JCKB 3P4RB 2J52A 1F2RC 2KWCA 2KQSA 3AXCA 3L13A 2Y5PA 4B95A 3ZNID 2BT6A 4C4VB 3KH0A 2KANA 2LJIA 3RFZB 4XYCA 1SGHA 4EE2A 4I6PA 3BVZA 1VZ8A 1WMHB 5CTRC 1V5OA 1VD2A 3N1YC 2NBVB 2LVQA 3PRMB 2GMIC 4J3OD 3R7RA 3AEEB 2RGFA 2V3SA 3HVDA 1KM7A 1J19A 2JZ3B 3NRZA 5JHBA 4PT5A 3ZDMC 5DPWA 2AL3A 2DENB 2J7QB 1YD8U 3DBRI 1FD6A 4NY0A 1ACCA 3QHTA 4WAFA 2M1MA 2JWUA 4P16A 3JW0X 1VLBA 1SIFA 4HPLB 5CX3A 2D3BA 4M0WA 4YTMB 2EKEC 3DBHB 3L4PA 2JY6A 1V9JA 3AE4B 4PYUA 4OVVA 2WDVB 3DVNV 2NVUI 2KLCA 1N63A 3DVGY 2CR5A 3A9KB 1UGMA 3U7DA 1XF5L 1WE6A 3RZWC 1C4PA 3AECB 1WFYA 3DCGA 1SE3A 3L54A 2KFKA 3A33B 4MSQB 1ZP0B 1GUAB 1HZ5A 1ROEA 3VDZA 2KQ7A 3Q3MC 3K9OB 2KNBA 5J18A 3RYTA 1E10A 2PIAA 4M0WB 3ZUNA 2L3ZA 1MPEA 4FULA 2DYOA 2RR9A 2ZZPB 2LWPA 3AM9A 5LNK1 4W9HA 3DOWA 3WIMA 1V49A 2JYTA 3NZSA 3AEDB 3Q3NC 4XDDA 4HDOA 4KVGB 3GS2A 3T3OA 2WXRA 1FNUA 2L05A 2Q5WD 4GOCA 1TGZB 2QMTA 1YN4A 4A8XC 1F77A 4N59A 1V86A 4J6IA 1KLVA 3Q8AA 3N30A 3RCZA 2ZEQA 4IOIE 2DYBA 2PTLA 1NYQA 2WS3B 2UU7A 4EZLA 4JL9A 3BVGA 1C4AA 5C1ZA 3LB8C 2GOWA 3IXSA 2KMCA 2KTRA 2ZCBA 4CO7A 4RCOA 2HDEA 2WLBA 2MWSB 2WXOA 1JWSD 3P1MA 4JWSC 2X8XX 5LXHA 3RNEC 2XK5A 1TS5A 1ESFA 3QIJA 2QSDA 3GOEA 1SXTA 1YX6B 3NZ3A 2GBJA 3GZNI 1E8ZA 1RLFA 1FNVA 5IAAC 3EC8A 4C56C 4ANUA 1V2YA 4F1SA 3QK0A 2M17A 2ICIA 2KOXA 4IWQA 2C5LC 5EE1A 3OJ4B 2V3NA 3WAPA 4AJYB 3IBEA 5AUKA 2JZZA 5BMIA 2KTRB 3MHSD 3BK1A 4XX5A 2G9HD 1L0YB 1S3SG 3Q3OC 1Q10A 4II3B 3KWLA 2J4XA 3DHGC 1JWUD 2LRWA 5HI1A 1E5WA 1UD7A 2QEJC 4W9EA 2R2OA 2M56B 2W82A 4OVZA 3IFWB 1NYRA 1XO3A 4NJ7A 3N20C 3R3MA 4AP4C 1QT9A 4OW0A 4TKNA 4K7UA 2LXCA 2DWQA 2QDFA 1LQBA 2M4NA 1K51A 4N6EB 2GBMA 4ASWC 4MELA 4PYZA 4L1BA 1WR1A 2WXFA 4FXCA 1VZ6A 2UYZB 1MI0A 4A3OA 4LLGM 1UGJA 1D5MC 4YSZB 4KKIA 1RFAA 1HZ6A 1DOIA 3APCA 2WP9B 2QJLA 2D10A 1OEYJ 1TZ1A 2QCZA 3V6CB 2H88B 4YWGG 1F0ZA 5MPOA 1J7CA 1E8YA 2KJ6A 4L2YA 5AZFA 1I4XA 1GC7A 3EFCA 5DPRA 3UF8A 1RYJA 2LEKA 3QJZA 2LASA 4NJ6A 3AEAB 3LJ3A 3QQ8B 2B3AA 2HTME 4YT0B 4YTPB 2K0PA 1ZE3D 1SE4A 2KC1A 2K8HA 2BGFA 3C8YA 4WIPA 3H6NA 1OTRB 2A5UA 3KUZA 1E7UA 5IO9A 3B2GA 2KXJA 1ZDVA 1PFDA 3VUYA 2N1WA 2K5PA 4MM3A 4KGRA 4NZLB 4R3DA 4RF1A 4DHZB 1YNTE 2JWZA 1YOVB 3Q8FA 1YJJA 1V97A 2DBYA 3PS6A 3B0AA 5FR6A 5L83A 1FEHA 1ISNA 1GOZA 3ZO5B 3ZXRA 1WGRA 2LD9A 4DWFA 3NOBA 1EU3A 2D07B 4WWNA 4TSSA 1VZ7A 3A1QA 5DCNA 3O13A 2MA9B 3WCQA 3CMMB 2DLBA 2WGSA 3AULA 4Q2JA 3AU4A 2ONQA 4W9CA 4FA6A 2WXHA 3GE3C 2PEAA 4HRSA 1LFDA 5DPSA 1ZKHA 3JVZX 4LCDE 2A4ZA 4YSYB 1IGCA 4MH8A 1KH0A 1FRDA 3DBLB 4BOZB 2JRIB 3N3KB 4KGTA 3RN9C 1QOAA 1S1QB 4W9GA 3AE1B 1T0QC 3HHMA 2BS2B 3I5JC 1VRAB 1MG4A 3NHEB 3ZIMA 3AE6B 5IP4D 2INDC 4XGAB 3NS1A 3ZRCA 5T8IA 3A1QB 3LXFA 2WDTB 3V60A 3Q3JA 3N1XC 3PZDA 1L5PA 4CYEA 4IC7B 1IP9A 1GB4A 2MSED 4USAA 2BS3B 3VXWA 2MQJA 2RSUA 3V61A 1M4VA 1QILA 1EF1A 4XDCA 2V4IB 1RWSA 4K7WA 3W9CB 2DZMA 2FCNA 3VTUA 1SJHD 2GBNA 3DWMA 3VTVA 2GLSA 2QC8A 2L52A 4KZ0A 2QILA 4P6VF 3OJ3A 2ASQA 2EKIA 1K50A 4RNAA 2SEBD 3T3NA 3C0RB 1R4NB 5IN7A 4A90A 2BTEA 4ACFA 3DWGC 4LDTD 1WM2A 3BWUD 4RFBA 2BB5A 4EOYA 4ZHOA 1B1ZA 3OG5A 3PLVA 4M02A 4ZDVA 3V6EB 3KUCB 4LJPB 4O1NA 2VH2A 2GBKA 2KD0A 3ZTDA 1WGYA 4FBJB 1ENFA 2WHIA 4MGIE 2D3AA 2BYTA 3BYYB 4WQOB 2HTHA 2CHZA 1BUIC 2LJ5A 3RUIB 3VR8B 1HTQA 3PREA 4WWOA 1C76A 3T9LA 3AE5B 2PMVA 2CJNA 3UQBA 3EECA 2Z0EB 2KHWB 3KYDD 3EHVA 4HEA1 2NBWB 2MBQA 1LXDA 4DXGA 3TEYA 1Z2MA 1WY8A 4KDLB 4BZAA 3R2TA 4JQWC 1L0VB 1WYWB 4GDLB 4TMAB 3KLSX 1TS2A 3JSVB 4AQ7A 1GC6A 1P7FA 1WMHA 2KFJA 4PS8A 1UNSA 2IZVB 1SB3C 3HM6X 1QQRA 3R8BA 3MP9A 2LXAA 2W54A 1JRPA 1J8CA 2Y5BB 3AE7B 4HKZE 2J0MA 1L2NA 5G5GA 1V1PA 1QF6A 3H7SA 3GE8C 4BVUC 2WU2B 4AUQC 3W5VB 1DOXA 5BMHA 1JROA 3NJTA 2BKFA 1IYFA 3NVZA 2C60A 3QAQA 1I4HA 2WX1A 2WXGA 3ENEA 2N1VA 2N0SB 1VJKA 4NQLB 3BYTB 2MRPA 1KJTA 3PT2B 3PO0A 4MH0E 1SBBB 5G55A 3GB1A 5TR5A 1D3ZA 4ZRKA 3ZNGC 4G11A 1TBEA 4BBNC 1GNUA 4XE0A 3ZKJC 3RZFA 4F8CB 4BAXA 1SEBD 1V1PB 2PW9A 1XLPA 1FNWA 1U4AA 3A9KA 3EGRA 3AE2B 3I3TB 2HJ8A 2ZCCA 1ZPSA 2GB1A 4H2AA 4EZKA 1RRBA 3AU5A 3NVWA 4KIKA 1E8WA 4FADA 5HFYA 4K7SA 4HCNB 2KK8A 4WH4A 1WZ3A 2MCNB 4FHKA 2DX5B 4S0RA 4YL8A 2M8SA 1SIJA 4TV3A 4AWJA 3Q8EA 3IVFA 4FJVB 4W9JA 2G1EA 2KX3A 4RGTA 1C4CA 1GJZA 5E6JA 1XLNA 2MEKA 2K22A 4A55A 1WJ4A 4BBNF 1T6BX 1K8RB 2KWDA 3QA8A 2AWTA 3SD5A 2IO3B 1FFUA 2NMQA 3FAHA 3T8MA 2OJWA 1E0ZA 3AV8A 1OEYA 3RD2A 1V5TA 1F52A 4KIKB 2N9KA 4XC2A 3UIPB 2LHEA 2KN5A 1TKYA 3DPDA 1XXGA 4DHZE 4C80A 3U7ZA 2LVOA 4URKA 3ZNHB 2R61A 2OOBB 3R2IA 2BKRB 1R4MI 1KTKA 1ET6A 2KMMA 4M00A 1WGGA 2QHOA 2MX2A 4KGSA 1E90A 3UQAA 4MT5A 3TCAA 2W9NA 2K3UA 3M3JA 1D4BA 4P7IA 2IO2B 3K9PB 4ZRPA 4IWOA 3ZJVA 1AARA 4N9F4 1XT9B 4WAAA 2JRHA 5G2NA 1SJED 3MJ5A 2BPSA 1KOTA 1KLGD 4JPSA 4E3CA 1WGKA 4WWMA 1TS3A 2ZPYA 1PGXA 1C78A 2FUG1 1OFFA 1JWAD 3KWVA 4G50A 4M01A 2PPHA 2NBUA
chains in the Genus database with same CATH topology
5EE3A 1ZE3D 1SE4A 3IAM1 3BVMA 2JQRB 3C8YA 2WXMA 2IDYA 4WIPA 4MACA 3CWIA 2YEPF 3SFDB 3W1SA 2JSVX 5BMGA 1JALA 3B2GA 2H89B 3SFEB 2RDHA 4US8A 4XWWA 1ZDVA 1PFDA 3AE8B 2JU6X 4DQOC 2K5PA 3AH7A 4KGRA 4NZLB 4R3DA 3LYYA 4DXFA 4RF1A 1XCQL 1HXYD 1XEEA 3IT6B 1PGBA 2WDRB 5EE0A 1YNTE 3HRDD 3U2SC 3Q8FA 2M0AA 1YJJA 1V97A 2CU3A 2DBYA 2TSSA 3VRBB 1L4DB 1FEHA 1GOZA 2JX5A 3ZJTA 1NI3A 1L6VA 1A70A 3U4EG 1EU3A 2LMCA 2WXPA 4YSXB 4TSSA 1VZ7A 1C77A 2WXKA 3O13A 1JW9D 4ITKA 3WCQA 2N9LA 2Y3AA 1K53A 2DLBA 1TS4A 4Q2JA 1E9MA 1KFYB 2ONQA 2KAJA 2PKOA 2WXHA 1CQVA 2WXLA 1ZXIA 3BZDB 3ZGZA 4HRSA 2GRIA 2AQ1B 5FK9C 4WURA 2JXTA 1LO5D 4YSYB 5BYQA 1IGCA 3AEBB 4MH8A 3AE3B 2ACZB 1KH0A 1FRDA 1JWMD 5D7GA 4KGTA 3I9V1 2NTTA 5H92C 1QOAA 3HVZA 2L32A 5HG2A 1YQ4B 3AE1B 3AMZA 4OZCA 4A9AA 2IPKD 1TJEA 2EELA 2BS2B 2RDGA 2SAKA 3MHZA 1VRAB 2J53A 2K9XA 1K52A 2RMMA 3AB5A 3HUIA 2LGIA 2MJDA 1STEA 3AE6B 5BYRA 1DOYA 1CZPA 3NS1A 5HHDG 1EM7A 5T8IA 5D3DA 3GP7A 1FCLA 3LXFA 1JCKB 2ON8A 3P4RB 3P4PB 2J52A 1D6EC 1F2RC 1IUEA 1L5PA 3IAS1 3KQ4A 1AN8A 4ZHPA 1GB4A 2J42A 4USAA 2BS3B 2XNAC 3PZ7A 1PGAA 2JYEA 1M4VA 1QILA 1Y56A 2PVGC 1AW7A 2Y5PA 4XDCA 2V4IB 1RWSA 5JXVA 2BT6A 2PVOD 3W9CB 4RGOS 1SJHD 3DWMA 2LJIA 5D3IB 4L23A 1FMAD 1L0XB 4B0MA 1QLBB 1V1OA 1T3QA 3RPFC 1UWXA 3RFZB 2L52A 1FXAA 2QILA 1XLQA 4EE2A 4P6VF 5C3JB 2LUMA 3BVZA 1ZOYB 1VZ8A 2EKIA 1K50A 1ZUD2 4RNAA 2SEBD 4JE3B 2W3RA 3T3NA 4J3OD 3AEEB 1E7PB 1I4RA 1XCTL 3VR9B 3HVDA 3NRZA 4A90A 2BTEA 1TYGB 3B9JA 2X38A 4PT5A 3DWGC 2IGDA 2BW2A 3TUOA 3I57A 3P63A 3BWUD 3NUHB 1FD6A 4RFBA 2BB5A 4IKGA 1N62A 1VDVA 2MH7A 3U52E 4ZHOA 1B1ZA 1ACCA 4WAFA 4O1NA 4B0EA 2JWUA 3NVYA 1YN5A 4P16A 3CIRB 2L83A 1HQRD 1D5ZC 1VLBA 2IGGA 3J9CA 3MFGA 1ENFA 2XN9C 2E6XA 1N5WA 2BYTA 3UI3A 3BYYB 1FRRA 4TQ1A 1BUIC 2AQ3B 1C79A 3VR8B 3N9YC 4M0WA 3SR6A 4YTMB 1I4QA 4C7ZA 2OEDA 3BIID 1C76A 1NEKB 3L4PA 2WXIA 2ZW1A 4US9A 2ZW0A 1T5XD 3AE5B 2INNE 3OWEB 2PMVA 2CJOA 3AE4B 2CJNA 2N7JA 2WDVB 1YQ3B 4HEA1 1N63A 4DXGA 3TEYA 1GAQB 2FBWB 3Q8BA 1SF0A 5G5HA 3AEGB 1YMHE 3R2TA 1XF5L 1DGJA 1TY2A 1C4PA 3AECB 3B2FA 1BXTA 3MC0B 1L0VB 1SE3A 4GDLB 4TMAB 1SSNA 2AX5A 1FFVA 1TS2A 2RPVA 2YEPB 3KLSX 1UUPA 2WU5B 4AQ7A 1ZP0B 3Q8CA 1P7FA 1YJIA 4LTUA 1HZ5A 1UNSA 1ROEA 1SB3C 3V3XA 2FE8A 1QQRA 3FC4A 3R8BA 3MP9A 2W54A 1JRPA 2OHFA 1E10A 3AE7B 2PIAA 1AWDA 4HKZE 1MPEA 2M19A 2DYOA 5G5GA 3P42A 1V1PA 3AM9A 5LNK1 1QF6A 3Q69A 1RM6C 2WU2B 3VQIA 1TZOA 3W5VB 1MHHE 1NVID 4JWUC 3E56A 1JROA 2JYTA 3IT4B 5BMHA 1DOXA 3TEXA 3AEDB 1QKZA 1N60A 4XDDA 2MJEA 3GS2A 4TQ0A 1JQ4A 3T3OA 1JMLA 2WXRA 1DYQA 3NVZA 3P4QB 1AYFA 1FNUA 1EWCA 1N5XA 1I4HA 2QIEB 2WXGA 2V3PA 4RH6A 2Q5WD 2N0SB 2E3TA 5AUIA 4N58A 2QMTA 1VJKA 1HEZE 1YN4A 3BYTB 2BS4B 4A8XC 3AEFB 3PO0A 1EWYC 1SBBB 1F77A 2WDQB 3BK2A 4N59A 1L6UA 3GB1A 3Q8AA 1TY0A 4IOIE 1N61A 2WXJA 4REZA 3ABVB 2PTLA 1NYQA 4RGNA 4YXDB 1MHXA 3ZYYX 3NVVA 2WS3B 1CJEA 1R7SA 1OQQA 3BVGA 1C4AA 4XE0A 3LB8C 4ZRQA 3IXSA 3EUB2 2L1AA 4HKQA 1NENB 5TSSA 3V05A 1E6EB 1JWBD 1SEBD 1V1PB 4C7YA 4RCOA 2HDEA 1B9RA 2WLBA 2I38A 3PZ8A 2WXOA 1JWSD 3P1MA 2PW9A 4JWSC 1FXIA 1XLPA 4GLSC 4YTNB 1IGDA 2BBCA 1FNWA 2VZKB 1WXQA 1L4ZB 4HJGE 4NJCA 4WQMA 5EE9A 1KLUD 3EGRA 1KRHA 1SE2A 1TS5A 3AE2B 1ESFA 1ZPSA 2GB1A 1GPXA 2QSDA 1FO4A 1VR9A 4RGMA 3TEWA 4H2AA 1SXTA 1PYWD 1D5XC 1OQRA 1IBXB 1F2RI 1I4GA 1CK1A 1WYGA 4KKJA 3NZ3A 4A6QA 1TKEA 3AN1A 1J7AA 3NVWA 2JZPA 5I4DA 5HFYA 1FNVA 4C56C 1C9FA 4WH4A 1QOFA 2PLPA 1SIJA 1J7BA 1WRIA 2ICIA 3Q8EA 4CQNA 1FCCC 1FM0D 4GDKB 2G1EA 4RGTA 2BB6A 1C4CA 4ZOHC 5EE1A 5E6JA 1XLNA 2V3NA 2MEKA 2K22A 4KX6B 4A55A 2W55A 5AUKA 2D5GA 5BMIA 2KN4A 4OZAA 1ZDXA 3BK1A 3TEZA 1T6BX 2KWDA 2G9HD 1L0YB 2NMQA 1FFUA 3FAHA 1Q10A 1KF6B 4IDIA 2GI9A 1GB1A 3P4SB 1MVKA 1I4PA 3KWLA 4OHJA 2J4XA 1JWUD 1WWTA 5HI1A 2INPE 4NAWB 3FILA 2QEJC 2V0GA 2M56B 1E0ZA 3AV8A 2W82A 1V8CA 3ETRA 4OVZA 2WNMA 1WSPA 1NYRA 1XO3A 2WXNA 4OZBA 1ET9A 2N9KA 1PDXA 1QT9A 4UDUC 4OW0A 2KQ4X 2LHEA 1FIQA 2Z8LA 1TKYA 1HA5A 1UWMA 3VRAB 2DWQA 1XXGA 4C80A 3E9SA 4HROA 4MM3B 3URYA 3U7ZA 2VZKD 1QOBA 4ARIA 1I7HA 4XWTA 1K51A 2I2YA 2R61A 3R2IA 4N6EB 1KTKA 2MJ3A 1ET6A 3ZJUA 2KMMA 4LK0M 4KGSA 4L1BA 5H8YE 1IBXA 3ZQ4A 3AE9B 4MT5A 2WXFA 2LFIA 2K3UA 3H8HA 3W5UB 1D4BA 4FXCA 1PUTA 2B76B 2KACA 1EU4A 1VZ6A 2LHDA 4ZYSA 4ZRPA 1YN3A 1MI0A 1P7EA 3ZJVA 4LLGM 1BMLC 1UGJA 4D2KA 4AS1A 3FILB 1D5MC 4YSZB 3EA6A 4KKIA 1HZ6A 2IGHA 5FR3A 1DOIA 2WP9B 2QJLA 4ARCA 2KDMA 2NTSA 3TSSA 5C2TB 2DYMA 2H88B 1ZXHA 5FKAC 1QOGA 3SEBA 4YWGG 1F0ZA 1SJED 3MJ5A 5MPOA 1J7CA 1KLGD 4L2YA 4JPSA 1I4XA 2WXQA 1RYJA 2LEKA 2W3SA 1WGKA 4WWMA 1TS3A 1PGXA 3AEAB 1C78A 5BYSA 2AQ2B 1RFKA 1TKGA 2FUG1 1OFFA 2Y5CA 4RF0A 3W2DA 2IJ0A 1XLOA 1JWAD 3KWVA 2HTME 2WQYB 4NAMA 4YT0B 4YTPB 2K0PA 5GXGB 4JX1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMI A;  2KN4 A;  4OZA A;  1PGA A;  3MP9 A;  5JXV A;  2KWD A;  4MAC A;  2NMQ A;  1Q10 A;  4HKZ E;  2JSV X;  1MPE A;  5BMG A;  2GI9 A;  1GB1 A;  1MVK A;  1UWX A;  2LUM A;  5HI1 A;  2JU6 X;  1MHH E;  3FIL A;  5BMH A;  1K50 A;  4KGR A;  1QKZ A;  1XCQ L;  1PGB A;  1JML A;  1YNT E;  1XCT L;  4OZB A;  2N9K A;  2KQ4 X;  2LHE A;  2IGD A;  2QMT A;  1HEZ E;  1FD6 A;  4IKG A;  3GB1 A;  1K51 A;  4IOI E;  2I2Y A;  2N9L A;  2PTL A;  1K53 A;  2JWU A;  1MHX A;  2ONQ A;  2IGG A;  4KGS A;  1IBX A;  3UI3 A;  1D4B A;  2KAC A;  2LHD A;  2JXT A;  1MI0 A;  2I38 A;  1IGC A;  1P7E A;  2PW9 A;  4GLS C;  1IGD A;  1KH0 A;  2OED A;  4D2K A;  3FIL B;  4HJG E;  2ZW1 A;  4KGT A;  2ZW0 A;  1HZ6 A;  2IGH A;  2GB1 A;  5HG2 A;  2QSD A;  2KDM A;  1IBX B;  2N7J A;  4OZC A;  1F2R I;  1ZXH A;  2EEL A;  2J53 A;  1K52 A;  2RMM A;  2LGI A;  2JZP A;  5HFY A;  1C9F A;  4WH4 A;  1YMH E;  5HHD G;  1XF5 L;  1EM7 A;  2PLP A;  1PGX A;  1FCL A;  2ON8 A;  1FCC C;  2J52 A;  2RPV A;  1F2R C;  1P7F A;  2K0P A;  1HZ5 A;  1GB4 A;  3V3X A; 
#chains in the Genus database with same CATH topology
 5EE3 A;  3UGB B;  2BWF A;  2JQR B;  4A3P A;  4MAC A;  3CWI A;  2YEP F;  4DDG D;  3SFD B;  2PE6 B;  4HJK A;  1WJ6 A;  1JAL A;  2L00 B;  2K25 A;  4WJQ A;  1C1Y B;  3R66 C;  1LM8 B;  4DQO C;  3PSE B;  4K81 A;  4DXF A;  1PGB A;  2WDR B;  5EE0 A;  3TJP A;  2TSS A;  3PHX B;  4X57 B;  3VRB B;  1WXS A;  2D3C A;  5IOI A;  2NPT A;  1WM3 A;  2PJH A;  1NI3 A;  1WE7 A;  4PS7 A;  2AEH A;  2WXP A;  4GIV A;  2WXK A;  2N9L A;  2HJ1 A;  1TS4 A;  2LUE A;  2PKO A;  1CQV A;  3BZD B;  2GRI A;  1WRD B;  4LDT B;  4WUR A;  1LO5 D;  5BYQ A;  3AEB B;  4C00 A;  3AE3 B;  3WAL A;  5D7G A;  2NTT A;  2RPQ A;  3HVZ A;  2L32 A;  4MDK E;  5HG2 A;  1OGW A;  3RNC C;  1P1A A;  3AMZ A;  4OZC A;  3DBR B;  1RAX A;  2I1J A;  2EEL A;  3APD A;  2NPT B;  3AB5 A;  3HUI A;  1WR6 E;  3QWZ B;  5BYR A;  3RI7 C;  1DOY A;  1CZP A;  4LNO A;  3I63 C;  5JHA A;  3GP7 A;  3LDZ E;  4GXB A;  2ON8 A;  1D6E C;  3N32 A;  3C19 A;  3IAS 1;  3KQ4 A;  1AN8 A;  3M62 B;  4ZHP A;  3PZ7 A;  1AW7 A;  3QAR A;  5JXV A;  3TIX A;  4B0M A;  1QLB B;  5E6P A;  3RPF C;  1UWX A;  1FXA A;  4W9D A;  1XLQ A;  2LUM A;  2NR2 A;  1ZOY B;  3ZDT A;  1UF0 A;  1ZUD 2;  1BT0 A;  2ZPN A;  1IPG A;  3FKY A;  2I1K A;  3WAN A;  2GBR A;  1E7P B;  4FLH A;  1MJD A;  1TYG B;  3B9J A;  2X38 A;  2ZJD A;  3WA0 A;  2JPH A;  2NCN A;  3RUL A;  3I57 A;  4P1C C;  3NUH B;  1V80 A;  1N62 A;  1VDV A;  2MH7 A;  5GMV A;  2DZI A;  4BFR A;  2N9X A;  3U52 E;  3ZRF A;  4B0E A;  1YN5 A;  3ZTC A;  1HQR D;  2DAJ A;  4S17 A;  2IGG A;  2KDF B;  3VHT C;  2E6X A;  1N5W A;  2K39 A;  3UI3 A;  4EEW A;  1FRR A;  4TQ1 A;  2LI5 A;  1C79 A;  3N9Y C;  3SR6 A;  2RDB C;  2KJR A;  4FJY A;  1I4Q A;  4C7Z A;  3BII D;  2WYQ A;  1NEK B;  3H1U A;  2WXI A;  2ZW1 A;  2ZW0 A;  1T5X D;  4MGK E;  4JIO U;  2BYE A;  3OWE B;  4HPP A;  1HE8 A;  3CSF A;  4ICV A;  1YQ3 B;  1Q5W B;  2DZJ A;  4MGZ E;  1GAQ B;  2FBW B;  1YMH E;  4KSL C;  1DGJ A;  3DBS A;  2IY1 B;  3VUX A;  3MC0 B;  2IO0 B;  5IA7 A;  2AX5 A;  4W9I A;  1FFV A;  1UUP A;  2N9P C;  2WU5 B;  4LTU A;  3R7Q A;  3V3X A;  3FC4 A;  2IYD B;  1ZW7 A;  3ML8 A;  2J0J A;  3MTN B;  1FPY A;  2CKH B;  2L0T A;  5JZE B;  4KZC A;  1RM6 C;  3GZN B;  3W1S C;  3VQI A;  1TZO A;  1MHH E;  1NVI D;  2MHJ A;  3E56 A;  3IT4 B;  4JWU C;  1QKZ A;  2MJE A;  4E74 A;  3A9J B;  4M8N A;  3OAW A;  2KWV B;  2KTF A;  3DBH I;  1N5X A;  4G0N B;  4GGQ A;  2LVP A;  2QIE B;  4HXD A;  2V3P A;  1V6E A;  4RH6 A;  2CU1 A;  1VCB A;  2BS4 B;  5LXI B;  3AEF B;  1EWY C;  4DXA B;  3VUW A;  2WDQ B;  1HTO A;  2Z59 B;  2KWU B;  5E6N A;  2WXJ A;  4REZ A;  3RNF C;  4ZYN A;  4YXD B;  3ZYY X;  3DQV A;  1OQQ A;  4ZRQ A;  4PK1 A;  3EUB 2;  3ZW3 A;  1UBI A;  4PS3 A;  5TSS A;  1PQS A;  3PVL A;  1JWB D;  3V05 A;  4DDI D;  2PE9 A;  3PZ8 A;  2HE7 A;  2MP2 B;  3ML9 A;  4GLS C;  1IGD A;  2C7H A;  4NJC A;  5EE9 A;  1KLU D;  1KRH A;  1SE2 A;  4B9K A;  4NAW A;  1IBX B;  1D5X C;  4GDL A;  1F2R I;  1I4G A;  2HD5 B;  3U8Z A;  3JSV A;  1CK1 A;  1WYG A;  5CHW A;  4A6Q A;  2CS4 A;  1TKE A;  4W9K A;  2JZP A;  2D2Q A;  2MBE A;  1YQB A;  1C9F A;  3PRP B;  1QOF A;  3OLM D;  2PLP A;  4NNJ B;  1J7B A;  2DHZ A;  4DBG A;  1FCC C;  4BKT A;  4ZOH C;  2BB6 A;  2V4L A;  4IM0 A;  4IUM B;  4KX6 B;  2ZNV C;  3VAW A;  2KN4 A;  3SHQ A;  3TEZ A;  4IM3 A;  4IWP A;  1WXV A;  2V9H A;  3PGE A;  1KF6 B;  1C3T A;  4IDI A;  2GI9 A;  1MVK A;  1I4P A;  4OHJ A;  4ZRJ A;  1WWT A;  2KO3 A;  4NAW B;  2K6D B;  3FIL A;  3ONS A;  3DDC B;  2V0G A;  1NI2 A;  4CHK A;  1F1H A;  2WNM A;  1WSP A;  1WXM A;  4JGH B;  2WXN A;  3B08 A;  4UDU C;  3DVN U;  2KQ4 X;  3D32 A;  1FIQ A;  2Z8L A;  3RNB C;  4EFO A;  1HA5 A;  3VH4 B;  2MBH A;  2G3Q B;  3Q14 C;  3Q6B A;  3E9S A;  4HRO A;  3N1Z C;  3URY A;  2VZK D;  3L16 A;  1QOB A;  1I7H A;  4XWT A;  1CMX B;  1MFW A;  2I2Y A;  3PPA A;  3ALB A;  4E71 A;  2MJ3 A;  3ZJU A;  5H8Y E;  3ZQ4 A;  4BKS D;  3W5U B;  1PUT A;  2KAC A;  1P98 A;  1F9J A;  1WZ0 A;  1P7E A;  2N7E A;  2N4F A;  4D2K A;  3FIL B;  3EA6 A;  2MW5 A;  2NS5 A;  2YLM A;  3QCA A;  5C2T B;  2DYM A;  1ZXH A;  1T0Y A;  1QOG A;  4EZJ A;  3SEB A;  2M0X A;  3TBL D;  4DK5 A;  3X23 A;  4JLC A;  2CHX A;  1P0R A;  3L08 A;  3APF A;  3KVF B;  2W3S A;  5IKC M;  3ZVV A;  2L76 A;  2AQ2 B;  4A20 A;  4MJS B;  1Q1O A;  1XLO A;  4NAM A;  4LNI A;  3HM3 A;  3RNG C;  5GXG B;  2IDY A;  2K8C A;  2JSV X;  2BYV E;  2ZNV B;  2H89 B;  3SFE B;  3M63 B;  4XWW A;  2JU6 X;  3NG0 A;  4GSW A;  3DHH C;  2ZVO A;  1HXY D;  1XEE A;  3IT6 B;  3U2S C;  2G45 B;  4OVU A;  4P1B C;  2WWZ A;  2JT4 B;  5HKH A;  2K6Q A;  3ZJT A;  3U30 A;  1L6V A;  4K3B A;  2LMC A;  3CST A;  2J0K A;  4NQK E;  4MGY E;  4ITK A;  3BY4 B;  2Y3A A;  2KLG A;  2MLB A;  2KAJ A;  2LGD A;  4RM8 A;  3ZXV A;  3ZGZ A;  2FNJ B;  2AQ1 B;  2KDI A;  5FK9 C;  3P2B A;  2K1F A;  2ACZ B;  1LGR A;  2N9E B;  4RMA A;  1I42 A;  3I9V 1;  2KDE B;  5H92 C;  4IM2 A;  1YQ4 B;  4II2 B;  4DHJ D;  4WJP A;  3VTW A;  1P9D U;  4A9A A;  2MBO A;  1TJE A;  3CF6 E;  3H7P A;  2IY0 B;  2RDG A;  2SAK A;  2J53 A;  3S2A A;  2K9X A;  4B6W A;  2RMM A;  2LGI A;  4EUT A;  1STE A;  2KDB A;  2FUH B;  3RNA C;  1YX5 B;  2EMT A;  4IW0 A;  1EM7 A;  5C23 A;  5D3D A;  2XBB C;  1YIW A;  1Z5S B;  2KJH B;  1FCL A;  3P4P B;  4GMV A;  1IUE A;  1Q0W B;  2BQQ A;  2J42 A;  2XNA C;  2V1Y A;  1PGA A;  2JYE A;  1Y56 A;  2PVG C;  4MSM B;  2PVO D;  1H8C A;  4RGO S;  5D3I B;  4L23 A;  1FMA D;  2JUO A;  1L0X B;  1V1O A;  5JH5 C;  1T3Q A;  3EFU A;  3A4S C;  5C3J B;  5EDS A;  2O6V D;  2KFK B;  4JE3 B;  2W3R A;  2LZ6 A;  1MG8 A;  1T0R C;  3L0W B;  3H7P B;  2DZK A;  2EMS A;  4LNK A;  1I4R A;  1XCT L;  4ICU A;  3KUD B;  3VR9 B;  3DBL I;  3L10 B;  4I6L B;  1NDD A;  4MEM A;  4WWP A;  2IGD A;  2BW2 A;  4XZ4 A;  3TUO A;  2RD0 A;  2UWQ A;  3P63 A;  4IKG A;  4HCP B;  4HWI B;  5CHF A;  4HVB A;  3SDL C;  5AEK B;  3NVY A;  3X0W A;  3CIR B;  2L83 A;  4W9L A;  1D5Z C;  5BO4 B;  3J9C A;  3MFG A;  2WX0 A;  3RMK C;  2XN9 C;  4NPN A;  5CHV C;  4KV2 A;  1YJ1 A;  2AQ3 B;  4TUU A;  3NZU A;  2VH1 A;  2OED A;  2OJR A;  1E8X A;  4US9 A;  2INN E;  3UIO B;  5E6O A;  1UEL A;  2CJO A;  2IO1 B;  2N7J A;  5AZG A;  2FAZ A;  2MBB B;  1X1M A;  3Q8B A;  1SF0 A;  5G5H A;  1XQQ A;  4EKU A;  3AEG B;  1L7Y A;  2XK5 B;  1TY2 A;  3B2F A;  4FN2 A;  1R4N I;  1BXT A;  2C9W B;  5AZH A;  2JVC A;  1SSN A;  2YEP B;  2RPV A;  3Q8C A;  1YJI A;  4M8M A;  2FE8 A;  1TT5 B;  3Q3F A;  1WXA A;  3ECI A;  2OHF A;  1AWD A;  2M19 A;  2C7M B;  2L7R A;  3M95 A;  3P42 A;  4IG7 B;  1TTN A;  3Q69 A;  2BWE S;  4HK2 A;  3TEX A;  2FCQ A;  1N60 A;  1UH6 A;  2KZR A;  4TQ0 A;  1JQ4 A;  1JML A;  1DYQ A;  4AOF A;  3P4Q B;  1AYF A;  2AL6 A;  1EWC A;  2L8J A;  4BKS A;  3IG3 A;  4K1R B;  2E3T A;  5AUI A;  4N58 A;  1HEZ E;  1WH3 A;  3W1Y A;  3BK2 A;  5D94 A;  1L6U A;  2INC C;  1TY0 A;  1N61 A;  3ABV B;  4GDK A;  4ZRI A;  1V81 A;  1WF9 A;  4RGN A;  1MHX A;  3NVV A;  1CJE A;  1R7S A;  4GU2 A;  2L1A A;  3MC8 A;  4HKQ A;  1NEN B;  4LNN A;  4HPM B;  2BVC A;  1E6E B;  1WI0 A;  1B9R A;  4C7Y A;  2I38 A;  4KDI C;  3NY5 A;  1FXI A;  4YTN B;  2BBC A;  2VZK B;  1WXQ A;  1L4Z B;  4HJG E;  4WQM A;  1GG3 A;  5L95 C;  1GPX A;  1FO4 A;  1VR9 A;  4RGM A;  3TEW A;  1PYW D;  1OQR A;  1JRU A;  2BF8 B;  2JXX A;  1N6Z A;  4KKJ A;  5DPT A;  3AN1 A;  2KMA A;  1J7A A;  1R4M B;  5KHO A;  4FJZ A;  5I4D A;  4HDQ A;  1SE9 A;  1UBQ A;  1WRI A;  4CQN A;  1FM0 D;  4GDK B;  4GN1 A;  2YVC A;  4G3X B;  2KT7 A;  2W55 A;  2D5G A;  4QAY A;  4OZA A;  1ZDX A;  3A9J A;  3UIN B;  1XD3 B;  1GB1 A;  3P4S B;  2R2Q A;  4LNF A;  3MC9 A;  2FIF A;  2INP E;  3ETR A;  1V8C A;  4F7Z A;  3ZNZ B;  3TMP B;  4ANX A;  1WIA A;  4OZB A;  2KVZ A;  3DHI C;  1ET9 A;  2FCM A;  1PDX A;  2KKC A;  3PTF C;  4BOS C;  2D3G A;  1UWM A;  3VRA B;  2AYO B;  2G4D B;  4MM3 B;  5D2M B;  3AI5 A;  2D11 A;  2MP2 A;  3HK0 A;  4ARI A;  2BYF A;  2LRU A;  2O2V A;  3PLU A;  3SU8 X;  1Y8R C;  1G6J A;  3MJW A;  4LK0 M;  4ANV A;  1IBX A;  3QX1 A;  2IBI B;  3AE9 B;  1FXT B;  1P3Q U;  2LFI A;  3H8H A;  4KSK C;  2VRR B;  2B76 B;  1EU4 A;  2LHD A;  2XEW A;  4ZYS A;  2ZVN A;  1YN3 A;  5LLI A;  3KW5 B;  3HIZ A;  2KYW A;  1EF5 A;  1BML C;  4ANW A;  4AS1 A;  3JYU A;  5KHQ A;  3WAO A;  2CHW A;  2IGH A;  5FR3 A;  3PHW B;  4ARC A;  2KDM A;  2NTS A;  4W9F A;  4WJN A;  3TSS A;  3V62 A;  5FKA C;  4RM9 A;  5J17 A;  4I6N B;  1WJN A;  2JF5 A;  2DNF A;  3PRZ A;  2WXQ A;  1T0S C;  1TIF A;  1ZGU B;  3RT3 B;  4BKG A;  2O2V B;  2O6V A;  3H9D A;  4DHJ B;  3VH3 B;  2KVR A;  5BYS A;  1RFK A;  1TKG A;  2Y5C A;  4K3C A;  4RF0 A;  3W2D A;  2IJ0 A;  2FCS A;  2WQY B;  1OQY A;  2N7D A;  3DVG X;  4WJO A;  3O65 B;  4JX1 C;  2K8B A;  3IAM 1;  3BVM A;  2WXM A;  2KC2 A;  2FID A;  3W1S A;  1H4R A;  1WX7 A;  3BIN A;  5BMG A;  2RDH A;  4US8 A;  1M94 A;  3AE8 B;  3AH7 A;  2G4S A;  1WGH A;  3LYY A;  3IHP C;  1XCQ L;  2LGY A;  3HRD D;  2M0A A;  2CU3 A;  1E7V A;  3KYC D;  1WJU A;  5D6J B;  1L4D B;  1UZX B;  3A4R A;  3WAM A;  2JX5 A;  1WX8 A;  3ZLZ A;  2O6V B;  1A70 A;  3U4E G;  2DAF A;  2Z0D B;  4YSX B;  1C77 A;  1JW9 D;  1WX9 A;  1K53 A;  1J0G A;  3NS8 A;  1E9M A;  1KFY B;  5J2R A;  2WXL A;  1ZXI A;  3VFK A;  4C4V A;  1EUV B;  2JXT A;  1A5R A;  3L17 A;  1I35 A;  1JWM D;  4LJO B;  2L0F A;  3QC8 B;  1QZE A;  4HLE A;  2C7N B;  3PV1 A;  2LGX A;  4MJS A;  1NBF C;  2IPK D;  4FHJ A;  3MHZ A;  4GB9 A;  3TL5 A;  3VVW B;  3B1L X;  4AJW A;  1K52 A;  2LGS A;  3Q2A C;  2MJD A;  1WGD A;  1EO6 A;  2REX A;  5HHD G;  2KX0 A;  1JCK B;  3P4R B;  2J52 A;  1F2R C;  2KWC A;  2KQS A;  3AXC A;  3L13 A;  2Y5P A;  4B95 A;  3ZNI D;  2BT6 A;  4C4V B;  3KH0 A;  2KAN A;  2LJI A;  3RFZ B;  4XYC A;  1SGH A;  4EE2 A;  4I6P A;  3BVZ A;  1VZ8 A;  1WMH B;  5CTR C;  1V5O A;  1VD2 A;  3N1Y C;  2NBV B;  2LVQ A;  3PRM B;  2GMI C;  4J3O D;  3R7R A;  3AEE B;  2RGF A;  2V3S A;  3HVD A;  1KM7 A;  1J19 A;  2JZ3 B;  3NRZ A;  5JHB A;  4PT5 A;  3ZDM C;  5DPW A;  2AL3 A;  2DEN B;  2J7Q B;  1YD8 U;  3DBR I;  1FD6 A;  4NY0 A;  1ACC A;  3QHT A;  4WAF A;  2M1M A;  2JWU A;  4P16 A;  3JW0 X;  1VLB A;  1SIF A;  4HPL B;  5CX3 A;  2D3B A;  4M0W A;  4YTM B;  2EKE C;  3DBH B;  3L4P A;  2JY6 A;  1V9J A;  3AE4 B;  4PYU A;  4OVV A;  2WDV B;  3DVN V;  2NVU I;  2KLC A;  1N63 A;  3DVG Y;  2CR5 A;  3A9K B;  1UGM A;  3U7D A;  1XF5 L;  1WE6 A;  3RZW C;  1C4P A;  3AEC B;  1WFY A;  3DCG A;  1SE3 A;  3L54 A;  2KFK A;  3A33 B;  4MSQ B;  1ZP0 B;  1GUA B;  1HZ5 A;  1ROE A;  3VDZ A;  2KQ7 A;  3Q3M C;  3K9O B;  2KNB A;  5J18 A;  3RYT A;  1E10 A;  2PIA A;  4M0W B;  3ZUN A;  2L3Z A;  1MPE A;  4FUL A;  2DYO A;  2RR9 A;  2ZZP B;  2LWP A;  3AM9 A;  5LNK 1;  4W9H A;  3DOW A;  3WIM A;  1V49 A;  2JYT A;  3NZS A;  3AED B;  3Q3N C;  4XDD A;  4HDO A;  4KVG B;  3GS2 A;  3T3O A;  2WXR A;  1FNU A;  2L05 A;  2Q5W D;  4GOC A;  1TGZ B;  2QMT A;  1YN4 A;  4A8X C;  1F77 A;  4N59 A;  1V86 A;  4J6I A;  1KLV A;  3Q8A A;  3N30 A;  3RCZ A;  2ZEQ A;  4IOI E;  2DYB A;  2PTL A;  1NYQ A;  2WS3 B;  2UU7 A;  4EZL A;  4JL9 A;  3BVG A;  1C4A A;  5C1Z A;  3LB8 C;  2GOW A;  3IXS A;  2KMC A;  2KTR A;  2ZCB A;  4CO7 A;  4RCO A;  2HDE A;  2WLB A;  2MWS B;  2WXO A;  1JWS D;  3P1M A;  4JWS C;  2X8X X;  5LXH A;  3RNE C;  2XK5 A;  1TS5 A;  1ESF A;  3QIJ A;  2QSD A;  3GOE A;  1SXT A;  1YX6 B;  3NZ3 A;  2GBJ A;  3GZN I;  1E8Z A;  1RLF A;  1FNV A;  5IAA C;  3EC8 A;  4C56 C;  4ANU A;  1V2Y A;  4F1S A;  3QK0 A;  2M17 A;  2ICI A;  2KOX A;  4IWQ A;  2C5L C;  5EE1 A;  3OJ4 B;  2V3N A;  3WAP A;  4AJY B;  3IBE A;  5AUK A;  2JZZ A;  5BMI A;  2KTR B;  3MHS D;  3BK1 A;  4XX5 A;  2G9H D;  1L0Y B;  1S3S G;  3Q3O C;  1Q10 A;  4II3 B;  3KWL A;  2J4X A;  3DHG C;  1JWU D;  2LRW A;  5HI1 A;  1E5W A;  1UD7 A;  2QEJ C;  4W9E A;  2R2O A;  2M56 B;  2W82 A;  4OVZ A;  3IFW B;  1NYR A;  1XO3 A;  4NJ7 A;  3N20 C;  3R3M A;  4AP4 C;  1QT9 A;  4OW0 A;  4TKN A;  4K7U A;  2LXC A;  2DWQ A;  2QDF A;  1LQB A;  2M4N A;  1K51 A;  4N6E B;  2GBM A;  4ASW C;  4MEL A;  4PYZ A;  4L1B A;  1WR1 A;  2WXF A;  4FXC A;  1VZ6 A;  2UYZ B;  1MI0 A;  4A3O A;  4LLG M;  1UGJ A;  1D5M C;  4YSZ B;  4KKI A;  1RFA A;  1HZ6 A;  1DOI A;  3APC A;  2WP9 B;  2QJL A;  2D10 A;  1OEY J;  1TZ1 A;  2QCZ A;  3V6C B;  2H88 B;  4YWG G;  1F0Z A;  5MPO A;  1J7C A;  1E8Y A;  2KJ6 A;  4L2Y A;  5AZF A;  1I4X A;  1GC7 A;  3EFC A;  5DPR A;  3UF8 A;  1RYJ A;  2LEK A;  3QJZ A;  2LAS A;  4NJ6 A;  3AEA B;  3LJ3 A;  3QQ8 B;  2B3A A;  2HTM E;  4YT0 B;  4YTP B;  2K0P A;  1ZE3 D;  1SE4 A;  2KC1 A;  2K8H A;  2BGF A;  3C8Y A;  4WIP A;  3H6N A;  1OTR B;  2A5U A;  3KUZ A;  1E7U A;  5IO9 A;  3B2G A;  2KXJ A;  1ZDV A;  1PFD A;  3VUY A;  2N1W A;  2K5P A;  4MM3 A;  4KGR A;  4NZL B;  4R3D A;  4RF1 A;  4DHZ B;  1YNT E;  2JWZ A;  1YOV B;  3Q8F A;  1YJJ A;  1V97 A;  2DBY A;  3PS6 A;  3B0A A;  5FR6 A;  5L83 A;  1FEH A;  1ISN A;  1GOZ A;  3ZO5 B;  3ZXR A;  1WGR A;  2LD9 A;  4DWF A;  3NOB A;  1EU3 A;  2D07 B;  4WWN A;  4TSS A;  1VZ7 A;  3A1Q A;  5DCN A;  3O13 A;  2MA9 B;  3WCQ A;  3CMM B;  2DLB A;  2WGS A;  3AUL A;  4Q2J A;  3AU4 A;  2ONQ A;  4W9C A;  4FA6 A;  2WXH A;  3GE3 C;  2PEA A;  4HRS A;  1LFD A;  5DPS A;  1ZKH A;  3JVZ X;  4LCD E;  2A4Z A;  4YSY B;  1IGC A;  4MH8 A;  1KH0 A;  1FRD A;  3DBL B;  4BOZ B;  2JRI B;  3N3K B;  4KGT A;  3RN9 C;  1QOA A;  1S1Q B;  4W9G A;  3AE1 B;  1T0Q C;  3HHM A;  2BS2 B;  3I5J C;  1VRA B;  1MG4 A;  3NHE B;  3ZIM A;  3AE6 B;  5IP4 D;  2IND C;  4XGA B;  3NS1 A;  3ZRC A;  5T8I A;  3A1Q B;  3LXF A;  2WDT B;  3V60 A;  3Q3J A;  3N1X C;  3PZD A;  1L5P A;  4CYE A;  4IC7 B;  1IP9 A;  1GB4 A;  2MSE D;  4USA A;  2BS3 B;  3VXW A;  2MQJ A;  2RSU A;  3V61 A;  1M4V A;  1QIL A;  1EF1 A;  4XDC A;  2V4I B;  1RWS A;  4K7W A;  3W9C B;  2DZM A;  2FCN A;  3VTU A;  1SJH D;  2GBN A;  3DWM A;  3VTV A;  2GLS A;  2QC8 A;  2L52 A;  4KZ0 A;  2QIL A;  4P6V F;  3OJ3 A;  2ASQ A;  2EKI A;  1K50 A;  4RNA A;  2SEB D;  3T3N A;  3C0R B;  1R4N B;  5IN7 A;  4A90 A;  2BTE A;  4ACF A;  3DWG C;  4LDT D;  1WM2 A;  3BWU D;  4RFB A;  2BB5 A;  4EOY A;  4ZHO A;  1B1Z A;  3OG5 A;  3PLV A;  4M02 A;  4ZDV A;  3V6E B;  3KUC B;  4LJP B;  4O1N A;  2VH2 A;  2GBK A;  2KD0 A;  3ZTD A;  1WGY A;  4FBJ B;  1ENF A;  2WHI A;  4MGI E;  2D3A A;  2BYT A;  3BYY B;  4WQO B;  2HTH A;  2CHZ A;  1BUI C;  2LJ5 A;  3RUI B;  3VR8 B;  1HTQ A;  3PRE A;  4WWO A;  1C76 A;  3T9L A;  3AE5 B;  2PMV A;  2CJN A;  3UQB A;  3EEC A;  2Z0E B;  2KHW B;  3KYD D;  3EHV A;  4HEA 1;  2NBW B;  2MBQ A;  1LXD A;  4DXG A;  3TEY A;  1Z2M A;  1WY8 A;  4KDL B;  4BZA A;  3R2T A;  4JQW C;  1L0V B;  1WYW B;  4GDL B;  4TMA B;  3KLS X;  1TS2 A;  3JSV B;  4AQ7 A;  1GC6 A;  1P7F A;  1WMH A;  2KFJ A;  4PS8 A;  1UNS A;  2IZV B;  1SB3 C;  3HM6 X;  1QQR A;  3R8B A;  3MP9 A;  2LXA A;  2W54 A;  1JRP A;  1J8C A;  2Y5B B;  3AE7 B;  4HKZ E;  2J0M A;  1L2N A;  5G5G A;  1V1P A;  1QF6 A;  3H7S A;  3GE8 C;  4BVU C;  2WU2 B;  4AUQ C;  3W5V B;  1DOX A;  5BMH A;  1JRO A;  3NJT A;  2BKF A;  1IYF A;  3NVZ A;  2C60 A;  3QAQ A;  1I4H A;  2WX1 A;  2WXG A;  3ENE A;  2N1V A;  2N0S B;  1VJK A;  4NQL B;  3BYT B;  2MRP A;  1KJT A;  3PT2 B;  3PO0 A;  4MH0 E;  1SBB B;  5G55 A;  3GB1 A;  5TR5 A;  1D3Z A;  4ZRK A;  3ZNG C;  4G11 A;  1TBE A;  4BBN C;  1GNU A;  4XE0 A;  3ZKJ C;  3RZF A;  4F8C B;  4BAX A;  1SEB D;  1V1P B;  2PW9 A;  1XLP A;  1FNW A;  1U4A A;  3A9K A;  3EGR A;  3AE2 B;  3I3T B;  2HJ8 A;  2ZCC A;  1ZPS A;  2GB1 A;  4H2A A;  4EZK A;  1RRB A;  3AU5 A;  3NVW A;  4KIK A;  1E8W A;  4FAD A;  5HFY A;  4K7S A;  4HCN B;  2KK8 A;  4WH4 A;  1WZ3 A;  2MCN B;  4FHK A;  2DX5 B;  4S0R A;  4YL8 A;  2M8S A;  1SIJ A;  4TV3 A;  4AWJ A;  3Q8E A;  3IVF A;  4FJV B;  4W9J A;  2G1E A;  2KX3 A;  4RGT A;  1C4C A;  1GJZ A;  5E6J A;  1XLN A;  2MEK A;  2K22 A;  4A55 A;  1WJ4 A;  4BBN F;  1T6B X;  1K8R B;  2KWD A;  3QA8 A;  2AWT A;  3SD5 A;  2IO3 B;  1FFU A;  2NMQ A;  3FAH A;  3T8M A;  2OJW A;  1E0Z A;  3AV8 A;  1OEY A;  3RD2 A;  1V5T A;  1F52 A;  4KIK B;  2N9K A;  4XC2 A;  3UIP B;  2LHE A;  2KN5 A;  1TKY A;  3DPD A;  1XXG A;  4DHZ E;  4C80 A;  3U7Z A;  2LVO A;  4URK A;  3ZNH B;  2R61 A;  2OOB B;  3R2I A;  2BKR B;  1R4M I;  1KTK A;  1ET6 A;  2KMM A;  4M00 A;  1WGG A;  2QHO A;  2MX2 A;  4KGS A;  1E90 A;  3UQA A;  4MT5 A;  3TCA A;  2W9N A;  2K3U A;  3M3J A;  1D4B A;  4P7I A;  2IO2 B;  3K9P B;  4ZRP A;  4IWO A;  3ZJV A;  1AAR A;  4N9F 4;  1XT9 B;  4WAA A;  2JRH A;  5G2N A;  1SJE D;  3MJ5 A;  2BPS A;  1KOT A;  1KLG D;  4JPS A;  4E3C A;  1WGK A;  4WWM A;  1TS3 A;  2ZPY A;  1PGX A;  1C78 A;  2FUG 1;  1OFF A;  1JWA D;  3KWV A;  4G50 A;  4M01 A;  2PPH A;  2NBU A; 
#chains in the Genus database with same CATH homology
 5EE3 A;  1ZE3 D;  1SE4 A;  3IAM 1;  3BVM A;  2JQR B;  3C8Y A;  2WXM A;  2IDY A;  4WIP A;  4MAC A;  3CWI A;  2YEP F;  3SFD B;  3W1S A;  2JSV X;  5BMG A;  1JAL A;  3B2G A;  2H89 B;  3SFE B;  2RDH A;  4US8 A;  4XWW A;  1ZDV A;  1PFD A;  3AE8 B;  2JU6 X;  4DQO C;  2K5P A;  3AH7 A;  4KGR A;  4NZL B;  4R3D A;  3LYY A;  4DXF A;  4RF1 A;  1XCQ L;  1HXY D;  1XEE A;  3IT6 B;  1PGB A;  2WDR B;  5EE0 A;  1YNT E;  3HRD D;  3U2S C;  3Q8F A;  2M0A A;  1YJJ A;  1V97 A;  2CU3 A;  2DBY A;  2TSS A;  3VRB B;  1L4D B;  1FEH A;  1GOZ A;  2JX5 A;  3ZJT A;  1NI3 A;  1L6V A;  1A70 A;  3U4E G;  1EU3 A;  2LMC A;  2WXP A;  4YSX B;  4TSS A;  1VZ7 A;  1C77 A;  2WXK A;  3O13 A;  1JW9 D;  4ITK A;  3WCQ A;  2N9L A;  2Y3A A;  1K53 A;  2DLB A;  1TS4 A;  4Q2J A;  1E9M A;  1KFY B;  2ONQ A;  2KAJ A;  2PKO A;  2WXH A;  1CQV A;  2WXL A;  1ZXI A;  3BZD B;  3ZGZ A;  4HRS A;  2GRI A;  2AQ1 B;  5FK9 C;  4WUR A;  2JXT A;  1LO5 D;  4YSY B;  5BYQ A;  1IGC A;  3AEB B;  4MH8 A;  3AE3 B;  2ACZ B;  1KH0 A;  1FRD A;  1JWM D;  5D7G A;  4KGT A;  3I9V 1;  2NTT A;  5H92 C;  1QOA A;  3HVZ A;  2L32 A;  5HG2 A;  1YQ4 B;  3AE1 B;  3AMZ A;  4OZC A;  4A9A A;  2IPK D;  1TJE A;  2EEL A;  2BS2 B;  2RDG A;  2SAK A;  3MHZ A;  1VRA B;  2J53 A;  2K9X A;  1K52 A;  2RMM A;  3AB5 A;  3HUI A;  2LGI A;  2MJD A;  1STE A;  3AE6 B;  5BYR A;  1DOY A;  1CZP A;  3NS1 A;  5HHD G;  1EM7 A;  5T8I A;  5D3D A;  3GP7 A;  1FCL A;  3LXF A;  1JCK B;  2ON8 A;  3P4R B;  3P4P B;  2J52 A;  1D6E C;  1F2R C;  1IUE A;  1L5P A;  3IAS 1;  3KQ4 A;  1AN8 A;  4ZHP A;  1GB4 A;  2J42 A;  4USA A;  2BS3 B;  2XNA C;  3PZ7 A;  1PGA A;  2JYE A;  1M4V A;  1QIL A;  1Y56 A;  2PVG C;  1AW7 A;  2Y5P A;  4XDC A;  2V4I B;  1RWS A;  5JXV A;  2BT6 A;  2PVO D;  3W9C B;  4RGO S;  1SJH D;  3DWM A;  2LJI A;  5D3I B;  4L23 A;  1FMA D;  1L0X B;  4B0M A;  1QLB B;  1V1O A;  1T3Q A;  3RPF C;  1UWX A;  3RFZ B;  2L52 A;  1FXA A;  2QIL A;  1XLQ A;  4EE2 A;  4P6V F;  5C3J B;  2LUM A;  3BVZ A;  1ZOY B;  1VZ8 A;  2EKI A;  1K50 A;  1ZUD 2;  4RNA A;  2SEB D;  4JE3 B;  2W3R A;  3T3N A;  4J3O D;  3AEE B;  1E7P B;  1I4R A;  1XCT L;  3VR9 B;  3HVD A;  3NRZ A;  4A90 A;  2BTE A;  1TYG B;  3B9J A;  2X38 A;  4PT5 A;  3DWG C;  2IGD A;  2BW2 A;  3TUO A;  3I57 A;  3P63 A;  3BWU D;  3NUH B;  1FD6 A;  4RFB A;  2BB5 A;  4IKG A;  1N62 A;  1VDV A;  2MH7 A;  3U52 E;  4ZHO A;  1B1Z A;  1ACC A;  4WAF A;  4O1N A;  4B0E A;  2JWU A;  3NVY A;  1YN5 A;  4P16 A;  3CIR B;  2L83 A;  1HQR D;  1D5Z C;  1VLB A;  2IGG A;  3J9C A;  3MFG A;  1ENF A;  2XN9 C;  2E6X A;  1N5W A;  2BYT A;  3UI3 A;  3BYY B;  1FRR A;  4TQ1 A;  1BUI C;  2AQ3 B;  1C79 A;  3VR8 B;  3N9Y C;  4M0W A;  3SR6 A;  4YTM B;  1I4Q A;  4C7Z A;  2OED A;  3BII D;  1C76 A;  1NEK B;  3L4P A;  2WXI A;  2ZW1 A;  4US9 A;  2ZW0 A;  1T5X D;  3AE5 B;  2INN E;  3OWE B;  2PMV A;  2CJO A;  3AE4 B;  2CJN A;  2N7J A;  2WDV B;  1YQ3 B;  4HEA 1;  1N63 A;  4DXG A;  3TEY A;  1GAQ B;  2FBW B;  3Q8B A;  1SF0 A;  5G5H A;  3AEG B;  1YMH E;  3R2T A;  1XF5 L;  1DGJ A;  1TY2 A;  1C4P A;  3AEC B;  3B2F A;  1BXT A;  3MC0 B;  1L0V B;  1SE3 A;  4GDL B;  4TMA B;  1SSN A;  2AX5 A;  1FFV A;  1TS2 A;  2RPV A;  2YEP B;  3KLS X;  1UUP A;  2WU5 B;  4AQ7 A;  1ZP0 B;  3Q8C A;  1P7F A;  1YJI A;  4LTU A;  1HZ5 A;  1UNS A;  1ROE A;  1SB3 C;  3V3X A;  2FE8 A;  1QQR A;  3FC4 A;  3R8B A;  3MP9 A;  2W54 A;  1JRP A;  2OHF A;  1E10 A;  3AE7 B;  2PIA A;  1AWD A;  4HKZ E;  1MPE A;  2M19 A;  2DYO A;  5G5G A;  3P42 A;  1V1P A;  3AM9 A;  5LNK 1;  1QF6 A;  3Q69 A;  1RM6 C;  2WU2 B;  3VQI A;  1TZO A;  3W5V B;  1MHH E;  1NVI D;  4JWU C;  3E56 A;  1JRO A;  2JYT A;  3IT4 B;  5BMH A;  1DOX A;  3TEX A;  3AED B;  1QKZ A;  1N60 A;  4XDD A;  2MJE A;  3GS2 A;  4TQ0 A;  1JQ4 A;  3T3O A;  1JML A;  2WXR A;  1DYQ A;  3NVZ A;  3P4Q B;  1AYF A;  1FNU A;  1EWC A;  1N5X A;  1I4H A;  2QIE B;  2WXG A;  2V3P A;  4RH6 A;  2Q5W D;  2N0S B;  2E3T A;  5AUI A;  4N58 A;  2QMT A;  1VJK A;  1HEZ E;  1YN4 A;  3BYT B;  2BS4 B;  4A8X C;  3AEF B;  3PO0 A;  1EWY C;  1SBB B;  1F77 A;  2WDQ B;  3BK2 A;  4N59 A;  1L6U A;  3GB1 A;  3Q8A A;  1TY0 A;  4IOI E;  1N61 A;  2WXJ A;  4REZ A;  3ABV B;  2PTL A;  1NYQ A;  4RGN A;  4YXD B;  1MHX A;  3ZYY X;  3NVV A;  2WS3 B;  1CJE A;  1R7S A;  1OQQ A;  3BVG A;  1C4A A;  4XE0 A;  3LB8 C;  4ZRQ A;  3IXS A;  3EUB 2;  2L1A A;  4HKQ A;  1NEN B;  5TSS A;  3V05 A;  1E6E B;  1JWB D;  1SEB D;  1V1P B;  4C7Y A;  4RCO A;  2HDE A;  1B9R A;  2WLB A;  2I38 A;  3PZ8 A;  2WXO A;  1JWS D;  3P1M A;  2PW9 A;  4JWS C;  1FXI A;  1XLP A;  4GLS C;  4YTN B;  1IGD A;  2BBC A;  1FNW A;  2VZK B;  1WXQ A;  1L4Z B;  4HJG E;  4NJC A;  4WQM A;  5EE9 A;  1KLU D;  3EGR A;  1KRH A;  1SE2 A;  1TS5 A;  3AE2 B;  1ESF A;  1ZPS A;  2GB1 A;  1GPX A;  2QSD A;  1FO4 A;  1VR9 A;  4RGM A;  3TEW A;  4H2A A;  1SXT A;  1PYW D;  1D5X C;  1OQR A;  1IBX B;  1F2R I;  1I4G A;  1CK1 A;  1WYG A;  4KKJ A;  3NZ3 A;  4A6Q A;  1TKE A;  3AN1 A;  1J7A A;  3NVW A;  2JZP A;  5I4D A;  5HFY A;  1FNV A;  4C56 C;  1C9F A;  4WH4 A;  1QOF A;  2PLP A;  1SIJ A;  1J7B A;  1WRI A;  2ICI A;  3Q8E A;  4CQN A;  1FCC C;  1FM0 D;  4GDK B;  2G1E A;  4RGT A;  2BB6 A;  1C4C A;  4ZOH C;  5EE1 A;  5E6J A;  1XLN A;  2V3N A;  2MEK A;  2K22 A;  4KX6 B;  4A55 A;  2W55 A;  5AUK A;  2D5G A;  5BMI A;  2KN4 A;  4OZA A;  1ZDX A;  3BK1 A;  3TEZ A;  1T6B X;  2KWD A;  2G9H D;  1L0Y B;  2NMQ A;  1FFU A;  3FAH A;  1Q10 A;  1KF6 B;  4IDI A;  2GI9 A;  1GB1 A;  3P4S B;  1MVK A;  1I4P A;  3KWL A;  4OHJ A;  2J4X A;  1JWU D;  1WWT A;  5HI1 A;  2INP E;  4NAW B;  3FIL A;  2QEJ C;  2V0G A;  2M56 B;  1E0Z A;  3AV8 A;  2W82 A;  1V8C A;  3ETR A;  4OVZ A;  2WNM A;  1WSP A;  1NYR A;  1XO3 A;  2WXN A;  4OZB A;  1ET9 A;  2N9K A;  1PDX A;  1QT9 A;  4UDU C;  4OW0 A;  2KQ4 X;  2LHE A;  1FIQ A;  2Z8L A;  1TKY A;  1HA5 A;  1UWM A;  3VRA B;  2DWQ A;  1XXG A;  4C80 A;  3E9S A;  4HRO A;  4MM3 B;  3URY A;  3U7Z A;  2VZK D;  1QOB A;  4ARI A;  1I7H A;  4XWT A;  1K51 A;  2I2Y A;  2R61 A;  3R2I A;  4N6E B;  1KTK A;  2MJ3 A;  1ET6 A;  3ZJU A;  2KMM A;  4LK0 M;  4KGS A;  4L1B A;  5H8Y E;  1IBX A;  3ZQ4 A;  3AE9 B;  4MT5 A;  2WXF A;  2LFI A;  2K3U A;  3H8H A;  3W5U B;  1D4B A;  4FXC A;  1PUT A;  2B76 B;  2KAC A;  1EU4 A;  1VZ6 A;  2LHD A;  4ZYS A;  4ZRP A;  1YN3 A;  1MI0 A;  1P7E A;  3ZJV A;  4LLG M;  1BML C;  1UGJ A;  4D2K A;  4AS1 A;  3FIL B;  1D5M C;  4YSZ B;  3EA6 A;  4KKI A;  1HZ6 A;  2IGH A;  5FR3 A;  1DOI A;  2WP9 B;  2QJL A;  4ARC A;  2KDM A;  2NTS A;  3TSS A;  5C2T B;  2DYM A;  2H88 B;  1ZXH A;  5FKA C;  1QOG A;  3SEB A;  4YWG G;  1F0Z A;  1SJE D;  3MJ5 A;  5MPO A;  1J7C A;  1KLG D;  4L2Y A;  4JPS A;  1I4X A;  2WXQ A;  1RYJ A;  2LEK A;  2W3S A;  1WGK A;  4WWM A;  1TS3 A;  1PGX A;  3AEA B;  1C78 A;  5BYS A;  2AQ2 B;  1RFK A;  1TKG A;  2FUG 1;  1OFF A;  2Y5C A;  4RF0 A;  3W2D A;  2IJ0 A;  1XLO A;  1JWA D;  3KWV A;  2HTM E;  2WQY B;  4NAM A;  4YT0 B;  4YTP B;  2K0P A;  5GXG B;  4JX1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...