2MP2B

Solution structure of sumo dimer in complex with sim2-3 from rnf4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
GSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 3
publication title Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mp2B00
4XC2A 2XEWA 2LWPA 3TMPB 1E8ZA 3H7PB 2L7RA 3NZSA 2CKHB 2MP2A 1LXDA 1WGYA 1WZ3A 2G4DB 2KD0A 4I6LB 5BO4B 2BKRB 4FULA 4HCPB 4WWPA 4WWOA 1Q0WB 3U7DA 1TZ1A 4KZCA 4WJNA 3M95A 4EZLA 1IPGA 2R2OA 3S2AA 2FAZA 3VDZA 2LGXA 1Y8RC 3TCAA 1P9DU 2G45B 3VUXA 3SU8X 4K1RB 1GC7A 4II3B 1VD2A 1IYFA 3RT3B 1E8WA 1V2YA 3R7QA 2NCNA 4AJYB 2JY6A 4GB9A 3NHEB 3A4RA 2IO1B 1L7YA 2KX3A 5G2NA 1UELA 2K8BA 4IWQA 4HCNB 3DQVA 4I6NB 3DVGX 4BKSD 3IG3A 5D7GA 2Z59B 2V1YA 4GIVA 3ML8A 2BWFA 2KJRA 2KN5A 1S3SG 3ZUNA 4BBNC 2V4LA 4BKSA 3WIMA 2KO3A 4JLCA 2XK5B 4NNJB 1KLVA 2M4NA 4RM9A 4LDTD 1C3TA 5JHAA 2O2VB 1SGHA 2UWQA 3VH3B 3AULA 4NJ7A 1V9JA 2KC2A 5DCNA 1UH6A 4BKTA 3KUZA 1Q5WB 2DAJA 2LVOA 2MWSB 3A1QA 3DBSA 3Q3JA 2K39A 2KQSA 2LXAA 3V62A 4EEWA 2DX5B 4OVVA 4K7UA 3MHSD 4MM3A 2ZEQA 1EUVB 1FXTB 4FN2A 2YLMA 3ZRFA 2N1VA 5IAAC 3V6CB 2JT4B 1J0GA 3VUWA 3A9KA 5LLIA 3JSVA 4NJ6A 5AZGA 2KC1A 2D07B 2K25A 3UF8A 4F1SA 2KMAA 2IO3B 1Z5SB 3B0AA 3H6NA 2A4ZA 2ZCBA 4DHJD 3KH0A 3DOWA 3R3MA 4E74A 4ICUA 3OJ4B 4IWPA 4TUUA 4A20A 2J0KA 5C1ZA 2L00B 1PQSA 4A3OA 2C7HA 3VTWA 1WE6A 5JHBA 3B1LX 4MGIE 4NAWB 2BGFA 4CHKA 5J18A 1SIFA 1P0RA 2KTRA 2EKEC 1ZW7A 3IVFA 3QA8A 3APDA 2ZNVB 3QJZA 4JL9A 4K7WA 4LJPB 1WXVA 2CHWA 3OAWA 2IYDB 1WY8A 4WJPA 2NS5A 1RRBA 4N9F4 2JWZA 5DPSA 4KSKC 4B6WA 2M1MA 2WDTB 3VTVA 1J19A 3WAPA 3CSFA 4KIKB 3DBRI 2FIFA 1XQQA 3PGEA 4FJVB 2DZJA 4BKGA 1UBQA 1WJUA 1TTNA 4MGKE 4TKNA 1CMXB 3WAMA 4W9DA 5AZFA 2NBUA 4YL8A 3L54A 2AL3A 3VXWA 1OTRB 2AYOB 2IO0B 3GOEA 2KDFB 1E5WA 3N3KB 4RMAA 3KVFB 3RYTA 4F7ZA 1WZ0A 2GBMA 1RLFA 2KVRA 2CS4A 3W1YA 2D11A 2HD5B 2FIDA 5DPTA 4XX5A 4I6PA 1WIAA 1EF5A 1WMHA 3BINA 3D32A 3V6EB 4DDID 5CHWA 5DPWA 1V86A 1WYWB 3H7PA 1S1QB 3QIJA 4ZDVA 4DWFA 2OJRA 2AEHA 3DVGY 3CSTA 3KUCB 2D2QA 2HE7A 3PVLA 2R2QA 1T0YA 2MBEA 4BOSC 2LJ5A 1WGGA 2DYOA 2K1FA 4GDLB 5KHOA 2V3SA 3AU4A 4GGQA 1QZEA 1YIWA 4HWIB 3OLMD 1WR1A 3TL5A 3P2BA 5KHQA 3AXCA 5JH5C 3PPAA 3KYCD 2K8CA 3I3TB 2ZPYA 5D2MB 4X57B 1KM7A 2NBWB 1RFAA 2GOWA 4GXBA 2BPSA 1GJZA 4IW0A 1OEYJ 4MGYE 3EECA 2MBHA 4EOYA 4KDIC 3ZTCA 4ANUA 4BVUC 1WGDA 5E6PA 2FCQA 2O6VB 1P3QU 2GBRA 4M0WB 3A4SC 4MJSB 1A5RA 1WF9A 3N30A 2N9XA 2ZCCA 1OQYA 3NS8A 4HDOA 2RR9A 2KJHB 4GU2A 4PS3A 3GZNI 4FJYA 4DDGD 4EZKA 4TQ1A 2LGYA 3ECIA 2REXA 2XK5A 4J6IA 4WQOB 3JW0X 2FCMA 3ZDMC 3RZWC 1RAXA 1V5TA 2JXXA 3H7SA 3O65B 3L10B 4HJKA 4TV3A 2KLGA 1YX5B 1E8YA 2KXJA 4AOFA 5EDSA 2KTFA 5J17A 4W9FA 1WH3A 3ZNHB 2GBKA 4GOCA 2JZ3B 3KW5B 5TR5A 5LXHA 4PYZA 1MG8A 5CHVC 1OEYA 1P1AA 1KJTA 4DHZB 2PPHA 4G0NB 2PJHA 2NPTB 5DPRA 3ZO5B 3VVWB 1WJNA 2MRPA 3QC8B 2AWTA 3M3JA 1EF1A 1Z2MA 2KWCA 4HK2A 2NVUI 4FLHA 3ZTDA 4HVBA 1TBEA 1UBIA 1WRDB 4LJOB 3PRPB 4FJZA 2FCSA 2ZPNA 3PV1A 4MH0E 3ZW3A 2ZZPB 1IP9A 2RPQA 4NAWA 3U30A 1LFDA 2M0XA 2GBJA 4IM0A 3ZVVA 4CO7A 2LI5A 1KOTA 5D94A 4DXAB 4ANXA 2OOBB 2HTHA 3EC8A 4FHKA 2RD0A 3CF6E 3TIXA 4DK5A 2EMTA 1Q1OA 2UYZB 4KVGB 3ZLZA 4E71A 3IBEA 3NY5A 1JRUA 3VQIA 4JGHB 4KZ0A 3ONSA 3CMMB 3HHMA 4IUMB 3T9LA 2CHXA 2KFKB 3ML9A 2M17A 1UD7A 5AZHA 3PHWB 1OGWA 5E6OA 4TQ0A 3M62B 1WXMA 1WJ4A 3A9JB 2CU1A 5L95C 2KWUB 3ZNGC 5CX3A 4AP4C 2Z0DB 3EFUA 4HPMB 4M8MA 2LZ6A 3SDLC 3OJ3A 3KUDB 1WM3A 2K6DB 3U8ZA 3IHPC 3W1SA 3X0WA 3APCA 4W9IA 1E7VA 3SD5A 1SE9A 5L83A 2JRIB 2KJ6A 3PRZA 2CR5A 3DBLI 1LM8B 2FNJB 4F8CB 2KFJA 3RZFA 4MELA 3L16A 3VFKA 2N4FA 1WX7A 1R4NI 3DBHI 2KWVB 2GBNA 2KDIA 3ZNZB 4W9EA 4IG7B 1V6EA 2JRHA 3VHTC 4DHJB 4EZJA 4GDLA 3RCZA 3PHXB 1H4RA 4ZRKA 2RSUA 2M8SA 3L08A 3JYUA 5D6JB 1YX6B 1E90A 2KQ7A 4MGZE 4IM3A 2L05A 3WA0A 3ENEA 2JF5A 1GG3A 4KV2A 2MW5A 3VTUA 4IC7B 4NPNA 3SHQA 2L8JA 1V49A 2BYFA 3R66C 2N9EB 2B3AA 3UIPB 2FCNA 4HPLB 3DVNU 4MSQB 2O6VA 2W9NA 1LQBA 4K7SA 2PEAA 4MJSA 3HIZA 3ZKJC 2LVQA 3MTNB 1XT9B 2DZMA 2KNBA 4MEMA 4FHJA 4G3XB 2WYQA 4B9KA 4FBJB 4FA6A 4WWNA 5G55A 4ZYNA 2WX0A 2Z0EB 4W9GA 2J0JA 4ZRJA 2YVCA 1WGHA 2HJ8A 2L3ZA 4GDKB 3ZRCA 4RM8A 1V5OA 2BKFA 2C7MB 2Y5BB 5CTRC 1I35A 4URKA 2G4SA 2ASQA 2DENB 2MCNB 4EKUA 1WX9A 2N1WA 1UZXB 2DHZA 4IWOA 5LXIB 3PSEB 4G50A 4PYUA 4II2B 1F9JA 2N9PC 3HM6X 3Q3FA 3QQ8B 3UGBB 2O2VA 4FADA 3EHVA 3L0WB 5IA7A 4OVUA 4KDLB 3R7RA 2NPTA 2XBBC 1YD8U 2C7NB 4NQKE 2DZKA 2K6QA 2ZNVC 4MSMB 3HM3A 1AARA 4P7IA 3TBLD 1U4AA 3APFA 2L0TA 4XZ4A 3VH4B 2MP2B 4NQLB 3PREA 3ZIMA 3AU5A 3BY4B 3QARA 2JPHA 2C60A 4A3PA 3LDZE 2N7EA 3RD2A 3V60A 3JVZX 2A5UA 2JVCA 3IFWB 3VAWA 1WI0A 2K8HA 3DDCB 4JQWC 4ANVA 2ZJDA 2NR2A 4GMVA 1WR6E 1C1YB 1GC6A 2LRUA 2D3GA 2KDEB 4EFOA 1YQBA 5AEKB 2LUEA 2RGFA 3DVNV 4NY0A 2IY0B 3QHTA 2VRRB 2KZRA 4W9JA 2DZIA 1P98A 2BYVE 4HXDA 1NBFC 1NI2A 3QX1A 3LJ3A 2MBOA 5GMVA 3RULA 3W1SC 2KFKA 3QAQA 5FR6A 4DHZE 3ZDTA 2LASA 4ASWC 3A9JA 1GNUA 3WAOA 1L2NA 4W9HA 4M8NA 4ICVA 1H8CA 1TGZB 1NDDA 1E8XA 2PE9A 3PLUA 4W9KA 3PS6A 4KIKA 4BFRA 2DYBA 2L76A 2I1JA 1EO6A 2IY1B 2NBVB 1E7UA 2QHOA 1UGMA 2FUHB 1D3ZA 2D10A 3H1UA 4KSLC 4ANWA 3K9OB 3L13A 2WWZA 4GN1A 4HLEA 2CHZA 2KKCA 3A33B 3KYDD 2G3QB 2KANA 2KLCA 1WFYA 3A1QB 4W9CA 4LDTB 3NOBA 1V80A 2J7QB 3DCGA 4WJQA 1R4MI 1J8CA 2WX1A 4PS7A 4DBGA 4K81A 3ALBA 5CHFA 1ISNA 1XD3B 2GMIC 2LVPA 3A9KB 2BF8B 3AI5A 3JSVB 2KHWB 5E6NA 1WM2A 3DPDA 3H9DA 3V61A 2IBIB 4G11A 1ZKHA 2JZZA 3HK0A 3N32A 4JIOU 3QCAA 2LD9A 2KOXA 4ZRIA 2L0FA 4AUQC 1HE8A 1BT0A 1VCBA 3QWZB 2BYEA 4HDQA 2N7DA 3K9PB 3WALA 2BWES 2MBBB 3L17A 3X23A 3PLVA 2LRWA 3B08A 1ZGUB 2C9WB 3QK0A 4GSWA 1X1MA 2MLBA 4PS8A 3VUYA 1GUAB 2KTRB 4MDKE 4W9LA 3RUIB 3UQBA 1WGRA 1WJ6A 1YJ1A 3NZUA 1K8RB 1WXAA 2EMSA 2O6VD 2JUOA 3PT2B 4AWJA 2LXCA 2MA9B 2MSED 3UIOB 3M63B 4BOZB 2C5LC 2KK8A 3PRMB 3TJPA 3WANA 3MJWA 4LCDE 2LGDA 1V81A 2KMCA 2IZVB 2ZVNA 2ZVOA 2PE6B 2DAFA 4GDKA 3ZNID 2IO2B 4WJOA 2MQJA 4EUTA 2J0MA 2I1KA 2DYMA 4IM2A 3T8MA 4CYEA 5J2RA 1I42A 1G6JA 5HKHA 3PTFC 1WX8A 2MX2A 5C23A 2MBQA 3UQAA 1WXSA 2KX0A 3PZDA 1M94A 2AL6A 3C0RB 4WAAA 4BBNF 4AJWA 2KDBA 3UINB 4E3CA 5JZEB 1WE7A 4B95A 1WMHB
chains in the Genus database with same CATH superfamily
2K3UA 3Q2AC 3TMPB 1E8ZA 2L7RA 3NZSA 1WGYA 2KD0A 1WZ3A 2QILA 1SSNA 3BVMA 3M95A 1IPGA 1V97A 1Y8RC 4RF0A 1KFYB 1P9DU 2G45B 1JWBD 3N20C 4II3B 2D5GA 5IOIA 3R7QA 3SFEB 4GB9A 5G2NA 2WXMA 3AE2B 4I6NB 3P42A 2Z59B 2V1YA 2V4LA 4BKSA 3RNEC 2XK5B 1ZDXA 3NG0A 2M4NA 2O2VB 3VH3B 1Q5WB 2DAJA 1VZ6A 2LVOA 3DBSA 4YXDB 2KQSA 3PO0A 3AEEB 4EEWA 2DX5B 2PIAA 2INCC 5IAAC 3V6CB 2JT4B 2INNE 3A9KA 3VUWA 4ZRQA 3IT6B 4WQMA 2BYTA 3MC9A 1YMHE 3VRAB 1PFDA 2BT6A 2WQYB 2CJOA 3OJ4B 4A20A 2J0KA 4USAA 1WE6A 5H8YE 5JHBA 1D4BA 4MGIE 1F77A 1NI3A 4XWWA 1ZW7A 2ZNVB 1N5WA 2CHWA 1N5XA 2NS5A 4B6WA 2YEPF 3P4SB 4KKIA 3PGEA 1M4VA 2DZJA 3FC4A 1NYRA 2M0AA 2NBUA 1XEEA 4M02A 2AL3A 2GB1A 3VXWA 1OTRB 1D5ZC 2AYOB 2IO0B 1HA5A 3GOEA 1L4DB 2KDFB 4JPSA 3AE3B 3W1YA 2HD5B 2FIDA 1WIAA 3D32A 3V6EB 5CHWA 1WYWB 4ZDVA 1VZ8A 4DWFA 5E6JA 3C19A 3KLSX 3MC0B 2DYOA 1SJED 4GGQA 3PPAA 3SEBA 4PK1A 2L32A 1KLUD 2NBWB 4RH6A 1RFAA 4GXBA 2AQ1B 2BPSA 1GJZA 3RNGC 1EWCA 4KDIC 2FCQA 2W54A 1VR9A 2E3TA 2N9XA 1OQYA 3NS8A 2KJHB 4GU2A 4FJYA 4RGMA 4EZKA 4TQ1A 2XK5A 1TYGB 3MC8A 3Q8EA 1V5TA 4HJKA 3H7SA 3L10B 3AV8A 1HZ5A 1PYWD 1ACCA 4WAFA 2KXJA 2GRIA 2KTFA 1E0ZA 4W9FA 4GLSC 5EE0A 5LXHA 1OEYA 3IT4B 2PPHA 4G0NB 1I4XA 5DPRA 3ZO5B 1EU4A 2FBWB 3RNFC 4HK2A 4FLHA 3ZTDA 4YSXB 4FJZA 3PV1A 1Q10A 1IP9A 1LFDA 2D3CA 2GBJA 4IM0A 3AE4B 5D94A 4ANXA 3NVWA 1GOZA 2OOBB 3CF6E 2WXIA 4KVGB 4RF1A 2ICIA 3DHHC 3W9CB 1XXGA 2HTME 3RNAC 2TSSA 4ARIA 1ZXHA 1OFFA 3EFUA 3SDLC 1MJDA 1MFWA 3CIRB 2K6DB 3U8ZA 1CQVA 3IHPC 3X0WA 1E7VA 2JRIB 2CR5A 3DBLI 1LM8B 2MH7A 2FNJB 2G1EA 1JALA 2N4FA 1WX7A 1R4NI 2GLSA 3DBHI 3J9CA 2Q5WD 3ZNZB 4W9EA 3VHTC 1BMLC 1H4RA 3DBLB 3P63A 2RSUA 1N63A 1UWMA 1YX6B 2D3AA 1E90A 4EE2A 2KQ7A 3ETRA 2MJDA 1L6VA 1GG3A 1ET6A 4LNFA 1XLNA 3DVNU 4A6QA 5IP4D 2KT7A 1MVKA 3AE1B 2LVQA 2KNBA 1UUPA 4FHJA 2WYQA 5T8IA 3TEYA 3B2GA 3AMZA 2BKFA 5CTRC 1NEKB 1TIFA 1I35A 4URKA 2G4SA 3BK2A 4ZYSA 3V3XA 1K51A 1WX9A 3AEBB 1UZXB 5BYSA 4D2KA 1F9JA 1CJEA 3QQ8B 1SE4A 5IA7A 4NQKE 2K6QA 1DOXA 1T0RC 2JWUA 2G9HD 3PREA 1D5MC 4LNKA 2C60A 3V60A 2K5PA 4JQWC 1ZPSA 1EWYC 2KDEB 4EFOA 1PUTA 2LUEA 2RGFA 2KMMA 1DGJA 2IY0B 3QHTA 1P98A 2BYVE 1FNUA 1FD6A 3QX1A 5FR6A 4PT5A 2LGSA 1AWDA 2EKIA 4W9KA 1V1PB 4BFRA 2L76A 2QDFA 2D10A 3L13A 4AS1A 2KKCA 2WXQA 2IJ0A 2KANA 1YNTE 4LNIA 4W9CA 3DCGA 1YJJA 2PMVA 4JE3B 1J8CA 4PS7A 4HJGE 3JSVB 4P6VF 3MP9A 2J52A 4C00A 2OHFA 1TS5A 3V61A 3N32A 1FIQA 1VDVA 4AUQC 1L4ZB 3K9PB 4RFBA 4M01A 1AN8A 4HKQA 1I4HA 4OHJA 3QK0A 3BYYB 3NRZA 1WYGA 4W9LA 3RUIB 1WGRA 1YJ1A 1FXAA 1QF6A 2MHJA 1WXAA 3PT2B 2O6VD 3P4QB 2C5LC 3PRMB 3TJPA 4LCDE 1V81A 2IZVB 2ZVNA 1N60A 2DAFA 3Q3NC 2IO2B 4WJOA 2H89B 3T8MA 1WX8A 5C23A 2SEBD 2QJLA 2JZPA 4WAAA 4AJWA 4BZAA 4E3CA 3UINB 2QMTA 3B2FA 4B95A 1WMHB 3Q14C 1YN5A 2BKRB 4FULA 1Q0WB 1GB1A 1TZ1A 1KTKA 1ESFA 5MPOA 4EZLA 2R2OA 1MG4A 3VDZA 1TZOA 2CU3A 2B76B 3SU8X 4ZRPA 3VR9B 3RT3B 1E8WA 1V2YA 4AJYB 2JY6A 5HFYA 2QC8A 4XE0A 3SFDB 1JCKB 1A70A 2IO1B 2K8BA 4IWQA 3DQVA 3IG3A 2XN9C 3ML8A 2BWFA 1V1PA 3ZUNA 4BBNC 1T3QA 4JLCA 4RNAA 2PLPA 2WP9B 4RM9A 2KAJA 4R3DA 2KC2A 1UH6A 4BKTA 1N62A 2LXAA 5EE9A 3MHSD 3ZRFA 2N1VA 2W82A 5LLIA 3JSVA 1L6UA 2KC1A 2D07B 2WXOA 1T0QC 4ARCA 1Z5SB 1YN4A 3H6NA 2N9LA 4TUUA 5C1ZA 2WHIA 1KRHA 1WRIA 3VTWA 2BBCA 3B1LX 4HRSA 4CHKA 4N59A 1P0RA 3QA8A 2KYWA 3APDA 1STEA 4LJPB 4C7ZA 2IYDB 2WGSA 1RRBA 3NJTA 2JWZA 2HDEA 2WDTB 3WAPA 3RMKC 3CSFA 3DBRI 5C2TB 2Z8LA 4MH8A 1FEHA 3L54A 3TEZA 5JXVA 2RDHA 3KVFB 2CS4A 1EF5A 1WMHA 1L0YB 3BINA 1C9FA 3QIJA 1ENFA 3DVGY 3PVLA 2D2QA 2HE7A 1OQRA 5FKAC 4BOSC 2L83A 1TJEA 5AUKA 2LUMA 3IAM1 2K8CA 5AUIA 4A90A 2BS3B 4XYCA 2L1AA 3URYA 4MGYE 3EECA 2RDBC 4ANUA 1WGDA 1IBXB 2O6VB 3A4SC 4MJSB 4K3CA 1A5RA 1WF9A 2ZCCA 3FILB 4PS3A 4DDGD 3ECIA 3Q3OC 3TEXA 1LO5D 1YX5B 3N1YC 4AOFA 5J17A 1RM6C 5BMIA 1WH3A 3ZNHB 1MG8A 1NENB 3I9V1 4XDCA 1KJTA 4OVZA 4DHZB 2PJHA 4KGSA 1WJNA 2MRPA 2WDQB 1Z2MA 2PVGC 3PRPB 2ZZPB 2M0XA 4CO7A 1KOTA 4DXAB 3E56A 1TY0A 1C4AA 2EMTA 4NZLB 2UYZB 3BVZA 1XCQL 1JRUA 4JGHB 3T9LA 3CMMB 1C4PA 2CHXA 2KFKB 3ZJVA 2PTLA 2WXLA 2Y3AA 3ML9A 5AZHA 1OGWA 5E6OA 2JSVX 5HHDG 3M62B 4TQ0A 2CU1A 5L95C 1HQRD 3ZNGC 2Y5CA 3NZ3A 5CX3A 5BMGA 3U4EG 4M8MA 2LZ6A 4DQOC 1MHHE 1WM3A 1F0ZA 2I38A 5I4DA 1JQ4A 2KJ6A 4F8CB 3SR6A 3RZFA 3TSSA 3WCQA 2BB5A 4KGTA 3T3NA 4IG7B 1V6EA 3PHXB 2DBYA 4N6EB 2M8SA 1V8CA 1ZP0B 3EGRA 4J3OD 2FUG1 2LGIA 4A55A 1MI0A 4MGZE 2L05A 3ENEA 3VTUA 2N9EB 2B3AA 2FCNA 4HPLB 1IBXA 2O6VA 2PEAA 4MJSA 2PKOA 3AEFB 3RNCC 4MEMA 4FBJB 2BB6A 3FILA 4G3XB 4WWNA 2KN4A 4ZYNA 4S0RA 1WXQA 2N0SB 4ZRJA 4O1NA 3ZRCA 2BQQA 1V5OA 2ASQA 5GXGB 3AEAB 3U52E 4IWOA 4ZHPA 5LXIB 3BWUD 3Q3FA 2O2VA 3Q8BA 4FADA 3EHVA 3L0WB 4OVUA 2XBBC 2C7NB 1K50A 2DLBA 3FAHA 4P7IA 3APFA 2L0TA 3N1ZC 3U7ZA 4NQLB 2LEKA 2Y5PA 3QARA 1FCLA 3LDZE 2N7EA 2JVCA 2IDYA 3W5UB 2ZJDA 2LRUA 1T5XD 1E9MA 4OZCA 1I7HA 2VRRB 4W9JA 1F2RC 3LJ3A 2MBOA 5GMVA 3RULA 5HI1A 3W1SC 2KFKA 1QOGA 1GB4A 3ZDTA 2LASA 2RMMA 4ASWC 3WAOA 1E6EB 1JMLA 4ICVA 1XCTL 2V4IB 3PS6A 2DYBA 2I1JA 1E7UA 1UGMA 1D3ZA 3H1UA 3ZJUA 4HLEA 2CHZA 3H8HA 3KYDD 4ACFA 3A1QB 2OEDA 3GS2A 3Q8AA 1FM0D 3NOBA 2IGDA 4YT0B 4MM3B 2WS3B 4KX6B 2QIEB 2WX1A 1VRAB 5CHFA 2LVPA 2BF8B 2WLBA 5E6NA 1WM2A 1RYJA 3H9DA 1PGXA 4G11A 3NUHB 1ZKHA 2L52A 3QCAA 2KOXA 2KWDA 1HE8A 1BT0A 4LK0M 4LNNA 5D3DA 2BYEA 1N61A 3L17A 1F2RI 1TT5B 1KF6B 3AE9B 1X1MA 2MLBA 4GSWA 3VUYA 4JWSC 2VZKD 1I4RA 1R4NB 3AEGB 3DBHB 1WJ6A 2J42A 1YJIA 1K8RB 2QCZA 2LXCA 2MA9B 3UIOB 1SF0A 3MJWA 1I4GA 4LTUA 1E10A 4NJCA 3AECB 4CYEA 1I42A 1XLOA 2J4XA 4M00A 2MX2A 3RFZB 2MBQA 1WXSA 2KX0A 3C0RB 2NTTA 5JZEB 4TSSA 3P4RB 5IKCM 4XC2A 3IXSA 2LWPA 3ZXVA 1QOBA 1FCCC 4I6LB 2G4DB 1QOFA 2IGGA 4WWPA 4HCPB 2ZW0A 4DXFA 3U7DA 2X38A 4KZCA 4WJNA 3DWGC 2JXTA 3EA6A 1SBBB 3Q69A 2FAZA 3S2AA 2LGXA 2W3SA 1SEBD 2WU5B 3VUXA 1GC7A 1QILA 3AB5A 2NCNA 3NHEB 3A4RA 1L7YA 2KX3A 1UELA 2WXRA 2WXFA 4HCNB 3DVGX 4BKSD 2KJRA 2KN5A 1S3SG 4L23A 3LB8C 3WIMA 1KLVA 4LDTD 1SGHA 4YTMB 4P16A 3RI7C 1SJHD 3AULA 4NJ7A 5IO9A 3KUZA 3TCAA 1XLPA 3A1QA 1EM7A 4OVVA 4K7UA 1WGKA 4MM3A 2ZEQA 1EUVB 1J0GA 2IGHA 2K25A 2KMAA 2BVCA 3B0AA 5G5HA 1TY2A 4DHJD 4RGOS 3DOWA 4ICUA 4IWPA 4A3OA 2CJNA 4NAWB 2JU6X 3UI3A 1SIFA 4K7WA 3QJZA 2K22A 1WXVA 1NVID 3OAWA 1QLBB 1WY8A 4KSKC 2M1MA 4KIKB 2FIFA 1XQQA 2WDRB 4FJVB 3MFGA 1WJUA 3LXFA 4TKNA 3WAMA 2WXKA 4YL8A 1YOVB 1K53A 3ABVB 3N3KB 2K9XA 3RYTA 3P1MA 1R7SA 1WZ0A 2GBMA 3P4PB 2D11A 5DPTA 4XX5A 4I6PA 1ZE3D 1V86A 1S1QB 1XLQA 3AE6B 2OJRA 1PDXA 2AEHA 3KUCB 4MT5A 2R2QA 1D5XC 1T0YA 1IUEA 2MBEA 5KHOA 3AU4A 3N9YC 2PW9A 4XWTA 3OLMD 3MJ5A 3TL5A 3P2BA 5KHQA 3KWLA 3KYCD 5D2MB 1KM7A 2VZKB 1OEYJ 2R61A 4EOYA 1QOAA 5E6PA 2AQ2B 2UU7A 2DNFA 1JWAD 4M0WB 1C79A 4Q2JA 3GZNI 5BYQA 2LGYA 4J6IA 2FCMA 1F52A 1HEZE 3RZWC 1RAXA 2JXXA 4IKGA 1KH0A 1JWMD 3ZXRA 1SE2A 2GBKA 2H88B 4GOCA 3GZNB 3KW5B 5TR5A 3I57A 1UF0A 2NPTB 3QC8B 4XGAB 2AWTA 1EF1A 3RPFC 1F1HA 5BYRA 3BVGA 1I4QA 4HVBA 1TBEA 3NS1A 1WRDB 2ZPNA 4MH0E 3N1XC 4XDDA 2RPQA 4NAWA 3ZVVA 5FR3A 2LI5A 2HTHA 3EC8A 4JX1C 3TIXA 4DK5A 1Q1OA 4E71A 3E9SA 3IBEA 3NY5A 3VQIA 1SE3A 4IUMB 2QEJC 2M17A 1UD7A 1WXMA 3A9JB 4C4VB 2MJ3A 4K3BA 3HRDD 2Z0DB 4HPMB 4WH4A 2I2YA 3O13A 3OJ3A 3SD5A 5L83A 1SE9A 2K0PA 1B1ZA 3PRZA 1L5PA 2KQ4X 2KFJA 4YSYB 3DBRB 2GBNA 1IGDA 3EFCA 2BTEA 3TUOA 2JRHA 4KGRA 4DHJB 4KKJA 5IN7A 1D6EC 4ZRKA 2LHDA 1TKGA 3L08A 2WXNA 3JYUA 3AEDB 1TS3A 4IM3A 4KV2A 1UNSA 2MW5A 3SHQA 2W9NA 4A9AA 4M0WA 3GP7A 3HIZA 3MTNB 1XT9B 2DZMA 4B9KA 2RPVA 4FA6A 2WX0A 4W9GA 2V0GA 1P7EA 2YVCA 1QKZA 2HJ8A 2L3ZA 4GDKB 2C7MB 2Y5BB 3BZDB 3BK1A 2MCNB 4EKUA 3I5JC 2DHZA 3PSEB 1FMAD 4PYUA 4II2B 2N9PC 3HM6X 3UGBB 2WXJA 3R7RA 2NPTA 1C78A 1YD8U 3GE3C 4UDUC 4RCOA 2ZNVC 3HM3A 1AARA 1U4AA 2MP2B 3BY4B 4HROA 4A3PA 3RD2A 3JVZX 2A5UA 4C7YA 1WI0A 1FXIA 4ANVA 2NR2A 3BIID 1YQBA 1ZOYB 4NY0A 1J7CA 2KZRA 4HXDA 1NI2A 1DOIA 4JWUC 3QAQA 3IAS1 1TKYA 3A9JA 4C4VA 1VJKA 2VH1A 1H8CA 2YEPB 1E8XA 3R2IA 5H92C 4DXGA 3PLUA 1FNVA 1XO3A 1EO6A 2NBVB 2QHOA 2FUHB 4CQNA 1SXTA 2G3QB 1PGAA 2JYTA 1L0XB 1JWUD 3ZGZA 1FFVA 1V80A 2J7QB 2HJ1A 3HUIA 4DBGA 2W3RA 4K81A 3ALBA 1XD3B 3C8YA 2KHWB 3AM9A 3KQ4A 3DPDA 4MACA 4JIOU 2JZZA 3HK0A 3QWZB 2BWES 3X23A 1CK1A 3PLVA 2LRWA 2M19A 3B08A 1ZGUB 1JW9D 3LYYA 2C9WB 1T6BX 1GUAB 2KTRB 4MDKE 1P7FA 3NZUA 2IPKD 1V1OA 2EMSA 2JUOA 4AWJA 2MSED 2KK8A 3WANA 2XNAC 2PE6B 4GDKA 4WIPA 1B9RA 2VH2A 1TS4A 4EUTA 2J0MA 5J2RA 1G6JA 3PTFC 3UQAA 3PZDA 2AL6A 5G5GA 1ET9A 1I4PA 1WE7A 2XEWA 3H7PB 1IGCA 2WDVB 2CKHB 2MP2A 1LXDA 5BO4B 4WWOA 4WURA 3PZ8A 4ZOHC 4LLGM 1DYQA 4K1RB 1VD2A 1IYFA 1RFKA 2JYEA 2FE8A 1KLGD 3I63C 5LNK1 2NTSA 5D7GA 4GIVA 2KO3A 4OZAA 4NNJB 1C3TA 5JHAA 2UWQA 1V9JA 5DCNA 5BMHA 3Q3JA 2MWSB 4A8XC 2K39A 3V62A 1CZPA 1FO4A 1C4CA 1FXTB 4FN2A 2YLMA 1JWSD 4NJ6A 5AZGA 2LHEA 2BS4B 3UF8A 4F1SA 2IO3B 4YWGG 1J7BA 2A4ZA 2ZCBA 1FPYA 3KH0A 5FK9C 3R3MA 2INPE 4E74A 2MEKA 2L00B 1PQSA 2X8XX 2C7HA 5C3JB 2BGFA 5J18A 2KTRA 2EKEC 3IVFA 4JL9A 4WJPA 4N9F4 5DPSA 1C76A 3VTVA 1J19A 3MHZA 2SAKA 4BKGA 1UBQA 1HXYD 1TTNA 1NYQA 4MGKE 1CMXB 1OQQA 4W9DA 5AZFA 2EELA 4ITKA 1E5WA 4RMAA 3FKYA 4H2AA 2NMQA 3DWMA 4F7ZA 4NAMA 1RLFA 2KVRA 2WXPA 5DPWA 4DDID 1FNWA 1HTQA 5EE3A 2ONQA 3H7PA 3VR8B 3CSTA 4WWMA 3R2TA 1K52A 1YQ3B 2LJ5A 1WGGA 2K1FA 3AE5B 4GDLB 4RGTA 2BS2B 2V3SA 4QAYA 5EE1A 3GB1A 1QZEA 1YIWA 4HWIB 4S17A 1WR1A 3NVYA 3AXCA 5JH5C 1UGJA 1VLBA 3I3TB 2ZPYA 3HVZA 4X57B 1WSPA 2GOWA 5HG2A 1GPXA 4IW0A 2MBHA 3B9JA 3TEWA 3ZTCA 4BVUC 3R8BA 1P3QU 2GBRA 1TKEA 4IOIE 4TMAB 4IDIA 2N9KA 1ZDVA 3DHIC 3N30A 4HDOA 2RR9A 1T0SC 1GAQB 2WXGA 4WQOB 2REXA 3JW0X 3ZDMC 4TV3A 3O65B 2KLGA 4ZHOA 2MJEA 1E8YA 2N7JA 4OZBA 5EDSA 4YTNB 2JZ3B 4PYZA 5CHVC 1P1AA 1FFUA 3AN1A 3VVWB 3M3JA 3DHGC 1E7PB 2KWCA 2NVUI 4LNOA 1UBIA 4LJOB 2KVZA 2FCSA 3ZW3A 2WXHA 2KACA 3EUB2 4REZA 3U30A 3RN9C 2OJWA 2AQ3B 4FHKA 2RD0A 2RDGA 1TS2A 3ZLZA 4KZ0A 3ONSA 4P1BC 1PGBA 3HHMA 5TSSA 2QSDA 1L0VB 3PHWB 3KWVA 1WJ4A 2AX5A 2J53A 2KWUB 2LFIA 4AP4C 1SIJA 2GI9A 2M56B 3KUDB 3W1SA 1LGRA 3APCA 4W9IA 4US9A 3ZQ4A 2D3BA 4MELA 3L16A 3VFKA 1J7AA 2KWVB 4HPPA 1N6ZA 3OWEB 3Q8FA 2KDIA 4HKZE 4EZJA 3Q6BA 4GDLA 4N58A 3RCZA 1SB3C 1MHXA 5D6JB 4YSZB 3WA0A 2JF5A 1C77A 4IC7B 1MPEA 4NPNA 2LJIA 2L8JA 1V49A 2BYFA 3R66C 1QT9A 3UIPB 1ZUD2 4FXCA 1ZXIA 4MSQB 4C80A 1LQBA 4K7SA 3U2SC 1UWXA 3BYTB 3ZKJC 4B0EA 2V3PA 5G55A 2Z0EB 3Q8CA 2J0JA 1WWTA 1WGHA 3W5VB 4RM8A 4BAXA 1YN3A 2DENB 2N1WA 4G50A 1EU3A 4L2YA 3AE8B 4KDLB 4RGNA 1HTOA 3ZJTA 3NVZA 3VRBB 2DZKA 4MSMB 3TBLD 2W55A 4XZ4A 3VH4B 3ZIMA 2INDC 3AU5A 4OW0A 1AW7A 4L1BA 2JPHA 3CWIA 2LMCA 3PZ7A 1AYFA 3IFWB 3VAWA 2K8HA 3DDCB 4GMVA 1WR6E 1C1YB 1GC6A 2D3GA 1RWSA 5AEKB 3ZYYX 1QQRA 3DVNV 1Y56A 1HZ6A 2DZIA 3Q3MC 1FRRA 1DOYA 1NBFC 1BUIC 4B0MA 4P1CC 1FRDA 4DHZE 3RNBC 1L2NA 1GNUA 4US8A 2V3NA 4W9HA 4HEA1 4M8NA 1TGZB 1NDDA 2WNMA 2PE9A 2ACZB 2BW2A 4KIKA 3V05A 3GE8C 2IY1B 4KSLC 4ANWA 3K9OB 2WWZA 4GN1A 1ROEA 3A33B 4YTPB 2KLCA 1WFYA 4LDTB 5D3IB 1JROA 4WJQA 1R4MI 1YQ4B 1ISNA 3AI5A 2GMIC 1BXTA 3A9KB 3AE7B 2DWQA 3NVVA 2IBIB 2WU2B 2LD9A 4ZRIA 2L0FA 4C56C 1VCBA 4HDQA 2N7DA 3WALA 1R4MB 2MBBB 2E6XA 3AH7A 3L4PA 4PS8A 2PVOD 2ZW1A 3UQBA 1VZ7A 2V9HA 2JQRB 1XF5L 2ON8A 3M63B 4BOZB 2LGDA 2KMCA 2ZVOA 3ZNID 1JRPA 3T3OA 2JX5A 3HVDA 4AQ7A 2MQJA 2I1KA 2DYMA 4IM2A 5HKHA 1M94A 2KDMA 3W2DA 4BBNF 2KDBA 3OG5A
chains in the Genus database with same CATH topology
4XC2A 2XEWA 2LWPA 3TMPB 1E8ZA 3H7PB 2L7RA 3NZSA 2CKHB 2MP2A 1LXDA 1WGYA 1WZ3A 2G4DB 2KD0A 4I6LB 5BO4B 2BKRB 4FULA 4HCPB 4WWPA 4WWOA 1Q0WB 3U7DA 1TZ1A 4KZCA 4WJNA 3M95A 4EZLA 1IPGA 2R2OA 3S2AA 2FAZA 3VDZA 2LGXA 1Y8RC 3TCAA 1P9DU 2G45B 3VUXA 3SU8X 4K1RB 1GC7A 4II3B 1VD2A 1IYFA 3RT3B 1E8WA 1V2YA 3R7QA 2NCNA 4AJYB 2JY6A 4GB9A 3NHEB 3A4RA 2IO1B 1L7YA 2KX3A 5G2NA 1UELA 2K8BA 4IWQA 4HCNB 3DQVA 4I6NB 3DVGX 4BKSD 3IG3A 5D7GA 2Z59B 2V1YA 4GIVA 3ML8A 2BWFA 2KJRA 2KN5A 1S3SG 3ZUNA 4BBNC 2V4LA 4BKSA 3WIMA 2KO3A 4JLCA 2XK5B 4NNJB 1KLVA 2M4NA 4RM9A 4LDTD 1C3TA 5JHAA 2O2VB 1SGHA 2UWQA 3VH3B 3AULA 4NJ7A 1V9JA 2KC2A 5DCNA 1UH6A 4BKTA 3KUZA 1Q5WB 2DAJA 2LVOA 2MWSB 3A1QA 3DBSA 3Q3JA 2K39A 2KQSA 2LXAA 3V62A 4EEWA 2DX5B 4OVVA 4K7UA 3MHSD 4MM3A 2ZEQA 1EUVB 1FXTB 4FN2A 2YLMA 3ZRFA 2N1VA 5IAAC 3V6CB 2JT4B 1J0GA 3VUWA 3A9KA 5LLIA 3JSVA 4NJ6A 5AZGA 2KC1A 2D07B 2K25A 3UF8A 4F1SA 2KMAA 2IO3B 1Z5SB 3B0AA 3H6NA 2A4ZA 2ZCBA 4DHJD 3KH0A 3DOWA 3R3MA 4E74A 4ICUA 3OJ4B 4IWPA 4TUUA 4A20A 2J0KA 5C1ZA 2L00B 1PQSA 4A3OA 2C7HA 3VTWA 1WE6A 5JHBA 3B1LX 4MGIE 4NAWB 2BGFA 4CHKA 5J18A 1SIFA 1P0RA 2KTRA 2EKEC 1ZW7A 3IVFA 3QA8A 3APDA 2ZNVB 3QJZA 4JL9A 4K7WA 4LJPB 1WXVA 2CHWA 3OAWA 2IYDB 1WY8A 4WJPA 2NS5A 1RRBA 4N9F4 2JWZA 5DPSA 4KSKC 4B6WA 2M1MA 2WDTB 3VTVA 1J19A 3WAPA 3CSFA 4KIKB 3DBRI 2FIFA 1XQQA 3PGEA 4FJVB 2DZJA 4BKGA 1UBQA 1WJUA 1TTNA 4MGKE 4TKNA 1CMXB 3WAMA 4W9DA 5AZFA 2NBUA 4YL8A 3L54A 2AL3A 3VXWA 1OTRB 2AYOB 2IO0B 3GOEA 2KDFB 1E5WA 3N3KB 4RMAA 3KVFB 3RYTA 4F7ZA 1WZ0A 2GBMA 1RLFA 2KVRA 2CS4A 3W1YA 2D11A 2HD5B 2FIDA 5DPTA 4XX5A 4I6PA 1WIAA 1EF5A 1WMHA 3BINA 3D32A 3V6EB 4DDID 5CHWA 5DPWA 1V86A 1WYWB 3H7PA 1S1QB 3QIJA 4ZDVA 4DWFA 2OJRA 2AEHA 3DVGY 3CSTA 3KUCB 2D2QA 2HE7A 3PVLA 2R2QA 1T0YA 2MBEA 4BOSC 2LJ5A 1WGGA 2DYOA 2K1FA 4GDLB 5KHOA 2V3SA 3AU4A 4GGQA 1QZEA 1YIWA 4HWIB 3OLMD 1WR1A 3TL5A 3P2BA 5KHQA 3AXCA 5JH5C 3PPAA 3KYCD 2K8CA 3I3TB 2ZPYA 5D2MB 4X57B 1KM7A 2NBWB 1RFAA 2GOWA 4GXBA 2BPSA 1GJZA 4IW0A 1OEYJ 4MGYE 3EECA 2MBHA 4EOYA 4KDIC 3ZTCA 4ANUA 4BVUC 1WGDA 5E6PA 2FCQA 2O6VB 1P3QU 2GBRA 4M0WB 3A4SC 4MJSB 1A5RA 1WF9A 3N30A 2N9XA 2ZCCA 1OQYA 3NS8A 4HDOA 2RR9A 2KJHB 4GU2A 4PS3A 3GZNI 4FJYA 4DDGD 4EZKA 4TQ1A 2LGYA 3ECIA 2REXA 2XK5A 4J6IA 4WQOB 3JW0X 2FCMA 3ZDMC 3RZWC 1RAXA 1V5TA 2JXXA 3H7SA 3O65B 3L10B 4HJKA 4TV3A 2KLGA 1YX5B 1E8YA 2KXJA 4AOFA 5EDSA 2KTFA 5J17A 4W9FA 1WH3A 3ZNHB 2GBKA 4GOCA 2JZ3B 3KW5B 5TR5A 5LXHA 4PYZA 1MG8A 5CHVC 1OEYA 1P1AA 1KJTA 4DHZB 2PPHA 4G0NB 2PJHA 2NPTB 5DPRA 3ZO5B 3VVWB 1WJNA 2MRPA 3QC8B 2AWTA 3M3JA 1EF1A 1Z2MA 2KWCA 4HK2A 2NVUI 4FLHA 3ZTDA 4HVBA 1TBEA 1UBIA 1WRDB 4LJOB 3PRPB 4FJZA 2FCSA 2ZPNA 3PV1A 4MH0E 3ZW3A 2ZZPB 1IP9A 2RPQA 4NAWA 3U30A 1LFDA 2M0XA 2GBJA 4IM0A 3ZVVA 4CO7A 2LI5A 1KOTA 5D94A 4DXAB 4ANXA 2OOBB 2HTHA 3EC8A 4FHKA 2RD0A 3CF6E 3TIXA 4DK5A 2EMTA 1Q1OA 2UYZB 4KVGB 3ZLZA 4E71A 3IBEA 3NY5A 1JRUA 3VQIA 4JGHB 4KZ0A 3ONSA 3CMMB 3HHMA 4IUMB 3T9LA 2CHXA 2KFKB 3ML9A 2M17A 1UD7A 5AZHA 3PHWB 1OGWA 5E6OA 4TQ0A 3M62B 1WXMA 1WJ4A 3A9JB 2CU1A 5L95C 2KWUB 3ZNGC 5CX3A 4AP4C 2Z0DB 3EFUA 4HPMB 4M8MA 2LZ6A 3SDLC 3OJ3A 3KUDB 1WM3A 2K6DB 3U8ZA 3IHPC 3W1SA 3X0WA 3APCA 4W9IA 1E7VA 3SD5A 1SE9A 5L83A 2JRIB 2KJ6A 3PRZA 2CR5A 3DBLI 1LM8B 2FNJB 4F8CB 2KFJA 3RZFA 4MELA 3L16A 3VFKA 2N4FA 1WX7A 1R4NI 3DBHI 2KWVB 2GBNA 2KDIA 3ZNZB 4W9EA 4IG7B 1V6EA 2JRHA 3VHTC 4DHJB 4EZJA 4GDLA 3RCZA 3PHXB 1H4RA 4ZRKA 2RSUA 2M8SA 3L08A 3JYUA 5D6JB 1YX6B 1E90A 2KQ7A 4MGZE 4IM3A 2L05A 3WA0A 3ENEA 2JF5A 1GG3A 4KV2A 2MW5A 3VTUA 4IC7B 4NPNA 3SHQA 2L8JA 1V49A 2BYFA 3R66C 2N9EB 2B3AA 3UIPB 2FCNA 4HPLB 3DVNU 4MSQB 2O6VA 2W9NA 1LQBA 4K7SA 2PEAA 4MJSA 3HIZA 3ZKJC 2LVQA 3MTNB 1XT9B 2DZMA 2KNBA 4MEMA 4FHJA 4G3XB 2WYQA 4B9KA 4FBJB 4FA6A 4WWNA 5G55A 4ZYNA 2WX0A 2Z0EB 4W9GA 2J0JA 4ZRJA 2YVCA 1WGHA 2HJ8A 2L3ZA 4GDKB 3ZRCA 4RM8A 1V5OA 2BKFA 2C7MB 2Y5BB 5CTRC 1I35A 4URKA 2G4SA 2ASQA 2DENB 2MCNB 4EKUA 1WX9A 2N1WA 1UZXB 2DHZA 4IWOA 5LXIB 3PSEB 4G50A 4PYUA 4II2B 1F9JA 2N9PC 3HM6X 3Q3FA 3QQ8B 3UGBB 2O2VA 4FADA 3EHVA 3L0WB 5IA7A 4OVUA 4KDLB 3R7RA 2NPTA 2XBBC 1YD8U 2C7NB 4NQKE 2DZKA 2K6QA 2ZNVC 4MSMB 3HM3A 1AARA 4P7IA 3TBLD 1U4AA 3APFA 2L0TA 4XZ4A 3VH4B 2MP2B 4NQLB 3PREA 3ZIMA 3AU5A 3BY4B 3QARA 2JPHA 2C60A 4A3PA 3LDZE 2N7EA 3RD2A 3V60A 3JVZX 2A5UA 2JVCA 3IFWB 3VAWA 1WI0A 2K8HA 3DDCB 4JQWC 4ANVA 2ZJDA 2NR2A 4GMVA 1WR6E 1C1YB 1GC6A 2LRUA 2D3GA 2KDEB 4EFOA 1YQBA 5AEKB 2LUEA 2RGFA 3DVNV 4NY0A 2IY0B 3QHTA 2VRRB 2KZRA 4W9JA 2DZIA 1P98A 2BYVE 4HXDA 1NBFC 1NI2A 3QX1A 3LJ3A 2MBOA 5GMVA 3RULA 3W1SC 2KFKA 3QAQA 5FR6A 4DHZE 3ZDTA 2LASA 4ASWC 3A9JA 1GNUA 3WAOA 1L2NA 4W9HA 4M8NA 4ICVA 1H8CA 1TGZB 1NDDA 1E8XA 2PE9A 3PLUA 4W9KA 3PS6A 4KIKA 4BFRA 2DYBA 2L76A 2I1JA 1EO6A 2IY1B 2NBVB 1E7UA 2QHOA 1UGMA 2FUHB 1D3ZA 2D10A 3H1UA 4KSLC 4ANWA 3K9OB 3L13A 2WWZA 4GN1A 4HLEA 2CHZA 2KKCA 3A33B 3KYDD 2G3QB 2KANA 2KLCA 1WFYA 3A1QB 4W9CA 4LDTB 3NOBA 1V80A 2J7QB 3DCGA 4WJQA 1R4MI 1J8CA 2WX1A 4PS7A 4DBGA 4K81A 3ALBA 5CHFA 1ISNA 1XD3B 2GMIC 2LVPA 3A9KB 2BF8B 3AI5A 3JSVB 2KHWB 5E6NA 1WM2A 3DPDA 3H9DA 3V61A 2IBIB 4G11A 1ZKHA 2JZZA 3HK0A 3N32A 4JIOU 3QCAA 2LD9A 2KOXA 4ZRIA 2L0FA 4AUQC 1HE8A 1BT0A 1VCBA 3QWZB 2BYEA 4HDQA 2N7DA 3K9PB 3WALA 2BWES 2MBBB 3L17A 3X23A 3PLVA 2LRWA 3B08A 1ZGUB 2C9WB 3QK0A 4GSWA 1X1MA 2MLBA 4PS8A 3VUYA 1GUAB 2KTRB 4MDKE 4W9LA 3RUIB 3UQBA 1WGRA 1WJ6A 1YJ1A 3NZUA 1K8RB 1WXAA 2EMSA 2O6VD 2JUOA 3PT2B 4AWJA 2LXCA 2MA9B 2MSED 3UIOB 3M63B 4BOZB 2C5LC 2KK8A 3PRMB 3TJPA 3WANA 3MJWA 4LCDE 2LGDA 1V81A 2KMCA 2IZVB 2ZVNA 2ZVOA 2PE6B 2DAFA 4GDKA 3ZNID 2IO2B 4WJOA 2MQJA 4EUTA 2J0MA 2I1KA 2DYMA 4IM2A 3T8MA 4CYEA 5J2RA 1I42A 1G6JA 5HKHA 3PTFC 1WX8A 2MX2A 5C23A 2MBQA 3UQAA 1WXSA 2KX0A 3PZDA 1M94A 2AL6A 3C0RB 4WAAA 4BBNF 4AJWA 2KDBA 3UINB 4E3CA 5JZEB 1WE7A 4B95A 1WMHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XC2 A;  2XEW A;  2LWP A;  3TMP B;  1E8Z A;  3H7P B;  2L7R A;  3NZS A;  2CKH B;  2MP2 A;  1LXD A;  1WGY A;  1WZ3 A;  2G4D B;  2KD0 A;  4I6L B;  5BO4 B;  2BKR B;  4FUL A;  4HCP B;  4WWP A;  4WWO A;  1Q0W B;  3U7D A;  1TZ1 A;  4KZC A;  4WJN A;  3M95 A;  4EZL A;  1IPG A;  2R2O A;  3S2A A;  2FAZ A;  3VDZ A;  2LGX A;  1Y8R C;  3TCA A;  1P9D U;  2G45 B;  3VUX A;  3SU8 X;  4K1R B;  1GC7 A;  4II3 B;  1VD2 A;  1IYF A;  3RT3 B;  1E8W A;  1V2Y A;  3R7Q A;  2NCN A;  4AJY B;  2JY6 A;  4GB9 A;  3NHE B;  3A4R A;  2IO1 B;  1L7Y A;  2KX3 A;  5G2N A;  1UEL A;  2K8B A;  4IWQ A;  4HCN B;  3DQV A;  4I6N B;  3DVG X;  4BKS D;  3IG3 A;  5D7G A;  2Z59 B;  2V1Y A;  4GIV A;  3ML8 A;  2BWF A;  2KJR A;  2KN5 A;  1S3S G;  3ZUN A;  4BBN C;  2V4L A;  4BKS A;  3WIM A;  2KO3 A;  4JLC A;  2XK5 B;  4NNJ B;  1KLV A;  2M4N A;  4RM9 A;  4LDT D;  1C3T A;  5JHA A;  2O2V B;  1SGH A;  2UWQ A;  3VH3 B;  3AUL A;  4NJ7 A;  1V9J A;  2KC2 A;  5DCN A;  1UH6 A;  4BKT A;  3KUZ A;  1Q5W B;  2DAJ A;  2LVO A;  2MWS B;  3A1Q A;  3DBS A;  3Q3J A;  2K39 A;  2KQS A;  2LXA A;  3V62 A;  4EEW A;  2DX5 B;  4OVV A;  4K7U A;  3MHS D;  4MM3 A;  2ZEQ A;  1EUV B;  1FXT B;  4FN2 A;  2YLM A;  3ZRF A;  2N1V A;  5IAA C;  3V6C B;  2JT4 B;  1J0G A;  3VUW A;  3A9K A;  5LLI A;  3JSV A;  4NJ6 A;  5AZG A;  2KC1 A;  2D07 B;  2K25 A;  3UF8 A;  4F1S A;  2KMA A;  2IO3 B;  1Z5S B;  3B0A A;  3H6N A;  2A4Z A;  2ZCB A;  4DHJ D;  3KH0 A;  3DOW A;  3R3M A;  4E74 A;  4ICU A;  3OJ4 B;  4IWP A;  4TUU A;  4A20 A;  2J0K A;  5C1Z A;  2L00 B;  1PQS A;  4A3O A;  2C7H A;  3VTW A;  1WE6 A;  5JHB A;  3B1L X;  4MGI E;  4NAW B;  2BGF A;  4CHK A;  5J18 A;  1SIF A;  1P0R A;  2KTR A;  2EKE C;  1ZW7 A;  3IVF A;  3QA8 A;  3APD A;  2ZNV B;  3QJZ A;  4JL9 A;  4K7W A;  4LJP B;  1WXV A;  2CHW A;  3OAW A;  2IYD B;  1WY8 A;  4WJP A;  2NS5 A;  1RRB A;  4N9F 4;  2JWZ A;  5DPS A;  4KSK C;  4B6W A;  2M1M A;  2WDT B;  3VTV A;  1J19 A;  3WAP A;  3CSF A;  4KIK B;  3DBR I;  2FIF A;  1XQQ A;  3PGE A;  4FJV B;  2DZJ A;  4BKG A;  1UBQ A;  1WJU A;  1TTN A;  4MGK E;  4TKN A;  1CMX B;  3WAM A;  4W9D A;  5AZF A;  2NBU A;  4YL8 A;  3L54 A;  2AL3 A;  3VXW A;  1OTR B;  2AYO B;  2IO0 B;  3GOE A;  2KDF B;  1E5W A;  3N3K B;  4RMA A;  3KVF B;  3RYT A;  4F7Z A;  1WZ0 A;  2GBM A;  1RLF A;  2KVR A;  2CS4 A;  3W1Y A;  2D11 A;  2HD5 B;  2FID A;  5DPT A;  4XX5 A;  4I6P A;  1WIA A;  1EF5 A;  1WMH A;  3BIN A;  3D32 A;  3V6E B;  4DDI D;  5CHW A;  5DPW A;  1V86 A;  1WYW B;  3H7P A;  1S1Q B;  3QIJ A;  4ZDV A;  4DWF A;  2OJR A;  2AEH A;  3DVG Y;  3CST A;  3KUC B;  2D2Q A;  2HE7 A;  3PVL A;  2R2Q A;  1T0Y A;  2MBE A;  4BOS C;  2LJ5 A;  1WGG A;  2DYO A;  2K1F A;  4GDL B;  5KHO A;  2V3S A;  3AU4 A;  4GGQ A;  1QZE A;  1YIW A;  4HWI B;  3OLM D;  1WR1 A;  3TL5 A;  3P2B A;  5KHQ A;  3AXC A;  5JH5 C;  3PPA A;  3KYC D;  2K8C A;  3I3T B;  2ZPY A;  5D2M B;  4X57 B;  1KM7 A;  2NBW B;  1RFA A;  2GOW A;  4GXB A;  2BPS A;  1GJZ A;  4IW0 A;  1OEY J;  4MGY E;  3EEC A;  2MBH A;  4EOY A;  4KDI C;  3ZTC A;  4ANU A;  4BVU C;  1WGD A;  5E6P A;  2FCQ A;  2O6V B;  1P3Q U;  2GBR A;  4M0W B;  3A4S C;  4MJS B;  1A5R A;  1WF9 A;  3N30 A;  2N9X A;  2ZCC A;  1OQY A;  3NS8 A;  4HDO A;  2RR9 A;  2KJH B;  4GU2 A;  4PS3 A;  3GZN I;  4FJY A;  4DDG D;  4EZK A;  4TQ1 A;  2LGY A;  3ECI A;  2REX A;  2XK5 A;  4J6I A;  4WQO B;  3JW0 X;  2FCM A;  3ZDM C;  3RZW C;  1RAX A;  1V5T A;  2JXX A;  3H7S A;  3O65 B;  3L10 B;  4HJK A;  4TV3 A;  2KLG A;  1YX5 B;  1E8Y A;  2KXJ A;  4AOF A;  5EDS A;  2KTF A;  5J17 A;  4W9F A;  1WH3 A;  3ZNH B;  2GBK A;  4GOC A;  2JZ3 B;  3KW5 B;  5TR5 A;  5LXH A;  4PYZ A;  1MG8 A;  5CHV C;  1OEY A;  1P1A A;  1KJT A;  4DHZ B;  2PPH A;  4G0N B;  2PJH A;  2NPT B;  5DPR A;  3ZO5 B;  3VVW B;  1WJN A;  2MRP A;  3QC8 B;  2AWT A;  3M3J A;  1EF1 A;  1Z2M A;  2KWC A;  4HK2 A;  2NVU I;  4FLH A;  3ZTD A;  4HVB A;  1TBE A;  1UBI A;  1WRD B;  4LJO B;  3PRP B;  4FJZ A;  2FCS A;  2ZPN A;  3PV1 A;  4MH0 E;  3ZW3 A;  2ZZP B;  1IP9 A;  2RPQ A;  4NAW A;  3U30 A;  1LFD A;  2M0X A;  2GBJ A;  4IM0 A;  3ZVV A;  4CO7 A;  2LI5 A;  1KOT A;  5D94 A;  4DXA B;  4ANX A;  2OOB B;  2HTH A;  3EC8 A;  4FHK A;  2RD0 A;  3CF6 E;  3TIX A;  4DK5 A;  2EMT A;  1Q1O A;  2UYZ B;  4KVG B;  3ZLZ A;  4E71 A;  3IBE A;  3NY5 A;  1JRU A;  3VQI A;  4JGH B;  4KZ0 A;  3ONS A;  3CMM B;  3HHM A;  4IUM B;  3T9L A;  2CHX A;  2KFK B;  3ML9 A;  2M17 A;  1UD7 A;  5AZH A;  3PHW B;  1OGW A;  5E6O A;  4TQ0 A;  3M62 B;  1WXM A;  1WJ4 A;  3A9J B;  2CU1 A;  5L95 C;  2KWU B;  3ZNG C;  5CX3 A;  4AP4 C;  2Z0D B;  3EFU A;  4HPM B;  4M8M A;  2LZ6 A;  3SDL C;  3OJ3 A;  3KUD B;  1WM3 A;  2K6D B;  3U8Z A;  3IHP C;  3W1S A;  3X0W A;  3APC A;  4W9I A;  1E7V A;  3SD5 A;  1SE9 A;  5L83 A;  2JRI B;  2KJ6 A;  3PRZ A;  2CR5 A;  3DBL I;  1LM8 B;  2FNJ B;  4F8C B;  2KFJ A;  3RZF A;  4MEL A;  3L16 A;  3VFK A;  2N4F A;  1WX7 A;  1R4N I;  3DBH I;  2KWV B;  2GBN A;  2KDI A;  3ZNZ B;  4W9E A;  4IG7 B;  1V6E A;  2JRH A;  3VHT C;  4DHJ B;  4EZJ A;  4GDL A;  3RCZ A;  3PHX B;  1H4R A;  4ZRK A;  2RSU A;  2M8S A;  3L08 A;  3JYU A;  5D6J B;  1YX6 B;  1E90 A;  2KQ7 A;  4MGZ E;  4IM3 A;  2L05 A;  3WA0 A;  3ENE A;  2JF5 A;  1GG3 A;  4KV2 A;  2MW5 A;  3VTU A;  4IC7 B;  4NPN A;  3SHQ A;  2L8J A;  1V49 A;  2BYF A;  3R66 C;  2N9E B;  2B3A A;  3UIP B;  2FCN A;  4HPL B;  3DVN U;  4MSQ B;  2O6V A;  2W9N A;  1LQB A;  4K7S A;  2PEA A;  4MJS A;  3HIZ A;  3ZKJ C;  2LVQ A;  3MTN B;  1XT9 B;  2DZM A;  2KNB A;  4MEM A;  4FHJ A;  4G3X B;  2WYQ A;  4B9K A;  4FBJ B;  4FA6 A;  4WWN A;  5G55 A;  4ZYN A;  2WX0 A;  2Z0E B;  4W9G A;  2J0J A;  4ZRJ A;  2YVC A;  1WGH A;  2HJ8 A;  2L3Z A;  4GDK B;  3ZRC A;  4RM8 A;  1V5O A;  2BKF A;  2C7M B;  2Y5B B;  5CTR C;  1I35 A;  4URK A;  2G4S A;  2ASQ A;  2DEN B;  2MCN B;  4EKU A;  1WX9 A;  2N1W A;  1UZX B;  2DHZ A;  4IWO A;  5LXI B;  3PSE B;  4G50 A;  4PYU A;  4II2 B;  1F9J A;  2N9P C;  3HM6 X;  3Q3F A;  3QQ8 B;  3UGB B;  2O2V A;  4FAD A;  3EHV A;  3L0W B;  5IA7 A;  4OVU A;  4KDL B;  3R7R A;  2NPT A;  2XBB C;  1YD8 U;  2C7N B;  4NQK E;  2DZK A;  2K6Q A;  2ZNV C;  4MSM B;  3HM3 A;  1AAR A;  4P7I A;  3TBL D;  1U4A A;  3APF A;  2L0T A;  4XZ4 A;  3VH4 B;  2MP2 B;  4NQL B;  3PRE A;  3ZIM A;  3AU5 A;  3BY4 B;  3QAR A;  2JPH A;  2C60 A;  4A3P A;  3LDZ E;  2N7E A;  3RD2 A;  3V60 A;  3JVZ X;  2A5U A;  2JVC A;  3IFW B;  3VAW A;  1WI0 A;  2K8H A;  3DDC B;  4JQW C;  4ANV A;  2ZJD A;  2NR2 A;  4GMV A;  1WR6 E;  1C1Y B;  1GC6 A;  2LRU A;  2D3G A;  2KDE B;  4EFO A;  1YQB A;  5AEK B;  2LUE A;  2RGF A;  3DVN V;  4NY0 A;  2IY0 B;  3QHT A;  2VRR B;  2KZR A;  4W9J A;  2DZI A;  1P98 A;  2BYV E;  4HXD A;  1NBF C;  1NI2 A;  3QX1 A;  3LJ3 A;  2MBO A;  5GMV A;  3RUL A;  3W1S C;  2KFK A;  3QAQ A;  5FR6 A;  4DHZ E;  3ZDT A;  2LAS A;  4ASW C;  3A9J A;  1GNU A;  3WAO A;  1L2N A;  4W9H A;  4M8N A;  4ICV A;  1H8C A;  1TGZ B;  1NDD A;  1E8X A;  2PE9 A;  3PLU A;  4W9K A;  3PS6 A;  4KIK A;  4BFR A;  2DYB A;  2L76 A;  2I1J A;  1EO6 A;  2IY1 B;  2NBV B;  1E7U A;  2QHO A;  1UGM A;  2FUH B;  1D3Z A;  2D10 A;  3H1U A;  4KSL C;  4ANW A;  3K9O B;  3L13 A;  2WWZ A;  4GN1 A;  4HLE A;  2CHZ A;  2KKC A;  3A33 B;  3KYD D;  2G3Q B;  2KAN A;  2KLC A;  1WFY A;  3A1Q B;  4W9C A;  4LDT B;  3NOB A;  1V80 A;  2J7Q B;  3DCG A;  4WJQ A;  1R4M I;  1J8C A;  2WX1 A;  4PS7 A;  4DBG A;  4K81 A;  3ALB A;  5CHF A;  1ISN A;  1XD3 B;  2GMI C;  2LVP A;  3A9K B;  2BF8 B;  3AI5 A;  3JSV B;  2KHW B;  5E6N A;  1WM2 A;  3DPD A;  3H9D A;  3V61 A;  2IBI B;  4G11 A;  1ZKH A;  2JZZ A;  3HK0 A;  3N32 A;  4JIO U;  3QCA A;  2LD9 A;  2KOX A;  4ZRI A;  2L0F A;  4AUQ C;  1HE8 A;  1BT0 A;  1VCB A;  3QWZ B;  2BYE A;  4HDQ A;  2N7D A;  3K9P B;  3WAL A;  2BWE S;  2MBB B;  3L17 A;  3X23 A;  3PLV A;  2LRW A;  3B08 A;  1ZGU B;  2C9W B;  3QK0 A;  4GSW A;  1X1M A;  2MLB A;  4PS8 A;  3VUY A;  1GUA B;  2KTR B;  4MDK E;  4W9L A;  3RUI B;  3UQB A;  1WGR A;  1WJ6 A;  1YJ1 A;  3NZU A;  1K8R B;  1WXA A;  2EMS A;  2O6V D;  2JUO A;  3PT2 B;  4AWJ A;  2LXC A;  2MA9 B;  2MSE D;  3UIO B;  3M63 B;  4BOZ B;  2C5L C;  2KK8 A;  3PRM B;  3TJP A;  3WAN A;  3MJW A;  4LCD E;  2LGD A;  1V81 A;  2KMC A;  2IZV B;  2ZVN A;  2ZVO A;  2PE6 B;  2DAF A;  4GDK A;  3ZNI D;  2IO2 B;  4WJO A;  2MQJ A;  4EUT A;  2J0M A;  2I1K A;  2DYM A;  4IM2 A;  3T8M A;  4CYE A;  5J2R A;  1I42 A;  1G6J A;  5HKH A;  3PTF C;  1WX8 A;  2MX2 A;  5C23 A;  2MBQ A;  3UQA A;  1WXS A;  2KX0 A;  3PZD A;  1M94 A;  2AL6 A;  3C0R B;  4WAA A;  4BBN F;  4AJW A;  2KDB A;  3UIN B;  4E3C A;  5JZE B;  1WE7 A;  4B95 A;  1WMH B; 
#chains in the Genus database with same CATH topology
 2K3U A;  3Q2A C;  3TMP B;  1E8Z A;  2L7R A;  3NZS A;  1WGY A;  2KD0 A;  1WZ3 A;  2QIL A;  1SSN A;  3BVM A;  3M95 A;  1IPG A;  1V97 A;  1Y8R C;  4RF0 A;  1KFY B;  1P9D U;  2G45 B;  1JWB D;  3N20 C;  4II3 B;  2D5G A;  5IOI A;  3R7Q A;  3SFE B;  4GB9 A;  5G2N A;  2WXM A;  3AE2 B;  4I6N B;  3P42 A;  2Z59 B;  2V1Y A;  2V4L A;  4BKS A;  3RNE C;  2XK5 B;  1ZDX A;  3NG0 A;  2M4N A;  2O2V B;  3VH3 B;  1Q5W B;  2DAJ A;  1VZ6 A;  2LVO A;  3DBS A;  4YXD B;  2KQS A;  3PO0 A;  3AEE B;  4EEW A;  2DX5 B;  2PIA A;  2INC C;  5IAA C;  3V6C B;  2JT4 B;  2INN E;  3A9K A;  3VUW A;  4ZRQ A;  3IT6 B;  4WQM A;  2BYT A;  3MC9 A;  1YMH E;  3VRA B;  1PFD A;  2BT6 A;  2WQY B;  2CJO A;  3OJ4 B;  4A20 A;  2J0K A;  4USA A;  1WE6 A;  5H8Y E;  5JHB A;  1D4B A;  4MGI E;  1F77 A;  1NI3 A;  4XWW A;  1ZW7 A;  2ZNV B;  1N5W A;  2CHW A;  1N5X A;  2NS5 A;  4B6W A;  2YEP F;  3P4S B;  4KKI A;  3PGE A;  1M4V A;  2DZJ A;  3FC4 A;  1NYR A;  2M0A A;  2NBU A;  1XEE A;  4M02 A;  2AL3 A;  2GB1 A;  3VXW A;  1OTR B;  1D5Z C;  2AYO B;  2IO0 B;  1HA5 A;  3GOE A;  1L4D B;  2KDF B;  4JPS A;  3AE3 B;  3W1Y A;  2HD5 B;  2FID A;  1WIA A;  3D32 A;  3V6E B;  5CHW A;  1WYW B;  4ZDV A;  1VZ8 A;  4DWF A;  5E6J A;  3C19 A;  3KLS X;  3MC0 B;  2DYO A;  1SJE D;  4GGQ A;  3PPA A;  3SEB A;  4PK1 A;  2L32 A;  1KLU D;  2NBW B;  4RH6 A;  1RFA A;  4GXB A;  2AQ1 B;  2BPS A;  1GJZ A;  3RNG C;  1EWC A;  4KDI C;  2FCQ A;  2W54 A;  1VR9 A;  2E3T A;  2N9X A;  1OQY A;  3NS8 A;  2KJH B;  4GU2 A;  4FJY A;  4RGM A;  4EZK A;  4TQ1 A;  2XK5 A;  1TYG B;  3MC8 A;  3Q8E A;  1V5T A;  4HJK A;  3H7S A;  3L10 B;  3AV8 A;  1HZ5 A;  1PYW D;  1ACC A;  4WAF A;  2KXJ A;  2GRI A;  2KTF A;  1E0Z A;  4W9F A;  4GLS C;  5EE0 A;  5LXH A;  1OEY A;  3IT4 B;  2PPH A;  4G0N B;  1I4X A;  5DPR A;  3ZO5 B;  1EU4 A;  2FBW B;  3RNF C;  4HK2 A;  4FLH A;  3ZTD A;  4YSX B;  4FJZ A;  3PV1 A;  1Q10 A;  1IP9 A;  1LFD A;  2D3C A;  2GBJ A;  4IM0 A;  3AE4 B;  5D94 A;  4ANX A;  3NVW A;  1GOZ A;  2OOB B;  3CF6 E;  2WXI A;  4KVG B;  4RF1 A;  2ICI A;  3DHH C;  3W9C B;  1XXG A;  2HTM E;  3RNA C;  2TSS A;  4ARI A;  1ZXH A;  1OFF A;  3EFU A;  3SDL C;  1MJD A;  1MFW A;  3CIR B;  2K6D B;  3U8Z A;  1CQV A;  3IHP C;  3X0W A;  1E7V A;  2JRI B;  2CR5 A;  3DBL I;  1LM8 B;  2MH7 A;  2FNJ B;  2G1E A;  1JAL A;  2N4F A;  1WX7 A;  1R4N I;  2GLS A;  3DBH I;  3J9C A;  2Q5W D;  3ZNZ B;  4W9E A;  3VHT C;  1BML C;  1H4R A;  3DBL B;  3P63 A;  2RSU A;  1N63 A;  1UWM A;  1YX6 B;  2D3A A;  1E90 A;  4EE2 A;  2KQ7 A;  3ETR A;  2MJD A;  1L6V A;  1GG3 A;  1ET6 A;  4LNF A;  1XLN A;  3DVN U;  4A6Q A;  5IP4 D;  2KT7 A;  1MVK A;  3AE1 B;  2LVQ A;  2KNB A;  1UUP A;  4FHJ A;  2WYQ A;  5T8I A;  3TEY A;  3B2G A;  3AMZ A;  2BKF A;  5CTR C;  1NEK B;  1TIF A;  1I35 A;  4URK A;  2G4S A;  3BK2 A;  4ZYS A;  3V3X A;  1K51 A;  1WX9 A;  3AEB B;  1UZX B;  5BYS A;  4D2K A;  1F9J A;  1CJE A;  3QQ8 B;  1SE4 A;  5IA7 A;  4NQK E;  2K6Q A;  1DOX A;  1T0R C;  2JWU A;  2G9H D;  3PRE A;  1D5M C;  4LNK A;  2C60 A;  3V60 A;  2K5P A;  4JQW C;  1ZPS A;  1EWY C;  2KDE B;  4EFO A;  1PUT A;  2LUE A;  2RGF A;  2KMM A;  1DGJ A;  2IY0 B;  3QHT A;  1P98 A;  2BYV E;  1FNU A;  1FD6 A;  3QX1 A;  5FR6 A;  4PT5 A;  2LGS A;  1AWD A;  2EKI A;  4W9K A;  1V1P B;  4BFR A;  2L76 A;  2QDF A;  2D10 A;  3L13 A;  4AS1 A;  2KKC A;  2WXQ A;  2IJ0 A;  2KAN A;  1YNT E;  4LNI A;  4W9C A;  3DCG A;  1YJJ A;  2PMV A;  4JE3 B;  1J8C A;  4PS7 A;  4HJG E;  3JSV B;  4P6V F;  3MP9 A;  2J52 A;  4C00 A;  2OHF A;  1TS5 A;  3V61 A;  3N32 A;  1FIQ A;  1VDV A;  4AUQ C;  1L4Z B;  3K9P B;  4RFB A;  4M01 A;  1AN8 A;  4HKQ A;  1I4H A;  4OHJ A;  3QK0 A;  3BYY B;  3NRZ A;  1WYG A;  4W9L A;  3RUI B;  1WGR A;  1YJ1 A;  1FXA A;  1QF6 A;  2MHJ A;  1WXA A;  3PT2 B;  2O6V D;  3P4Q B;  2C5L C;  3PRM B;  3TJP A;  4LCD E;  1V81 A;  2IZV B;  2ZVN A;  1N60 A;  2DAF A;  3Q3N C;  2IO2 B;  4WJO A;  2H89 B;  3T8M A;  1WX8 A;  5C23 A;  2SEB D;  2QJL A;  2JZP A;  4WAA A;  4AJW A;  4BZA A;  4E3C A;  3UIN B;  2QMT A;  3B2F A;  4B95 A;  1WMH B;  3Q14 C;  1YN5 A;  2BKR B;  4FUL A;  1Q0W B;  1GB1 A;  1TZ1 A;  1KTK A;  1ESF A;  5MPO A;  4EZL A;  2R2O A;  1MG4 A;  3VDZ A;  1TZO A;  2CU3 A;  2B76 B;  3SU8 X;  4ZRP A;  3VR9 B;  3RT3 B;  1E8W A;  1V2Y A;  4AJY B;  2JY6 A;  5HFY A;  2QC8 A;  4XE0 A;  3SFD B;  1JCK B;  1A70 A;  2IO1 B;  2K8B A;  4IWQ A;  3DQV A;  3IG3 A;  2XN9 C;  3ML8 A;  2BWF A;  1V1P A;  3ZUN A;  4BBN C;  1T3Q A;  4JLC A;  4RNA A;  2PLP A;  2WP9 B;  4RM9 A;  2KAJ A;  4R3D A;  2KC2 A;  1UH6 A;  4BKT A;  1N62 A;  2LXA A;  5EE9 A;  3MHS D;  3ZRF A;  2N1V A;  2W82 A;  5LLI A;  3JSV A;  1L6U A;  2KC1 A;  2D07 B;  2WXO A;  1T0Q C;  4ARC A;  1Z5S B;  1YN4 A;  3H6N A;  2N9L A;  4TUU A;  5C1Z A;  2WHI A;  1KRH A;  1WRI A;  3VTW A;  2BBC A;  3B1L X;  4HRS A;  4CHK A;  4N59 A;  1P0R A;  3QA8 A;  2KYW A;  3APD A;  1STE A;  4LJP B;  4C7Z A;  2IYD B;  2WGS A;  1RRB A;  3NJT A;  2JWZ A;  2HDE A;  2WDT B;  3WAP A;  3RMK C;  3CSF A;  3DBR I;  5C2T B;  2Z8L A;  4MH8 A;  1FEH A;  3L54 A;  3TEZ A;  5JXV A;  2RDH A;  3KVF B;  2CS4 A;  1EF5 A;  1WMH A;  1L0Y B;  3BIN A;  1C9F A;  3QIJ A;  1ENF A;  3DVG Y;  3PVL A;  2D2Q A;  2HE7 A;  1OQR A;  5FKA C;  4BOS C;  2L83 A;  1TJE A;  5AUK A;  2LUM A;  3IAM 1;  2K8C A;  5AUI A;  4A90 A;  2BS3 B;  4XYC A;  2L1A A;  3URY A;  4MGY E;  3EEC A;  2RDB C;  4ANU A;  1WGD A;  1IBX B;  2O6V B;  3A4S C;  4MJS B;  4K3C A;  1A5R A;  1WF9 A;  2ZCC A;  3FIL B;  4PS3 A;  4DDG D;  3ECI A;  3Q3O C;  3TEX A;  1LO5 D;  1YX5 B;  3N1Y C;  4AOF A;  5J17 A;  1RM6 C;  5BMI A;  1WH3 A;  3ZNH B;  1MG8 A;  1NEN B;  3I9V 1;  4XDC A;  1KJT A;  4OVZ A;  4DHZ B;  2PJH A;  4KGS A;  1WJN A;  2MRP A;  2WDQ B;  1Z2M A;  2PVG C;  3PRP B;  2ZZP B;  2M0X A;  4CO7 A;  1KOT A;  4DXA B;  3E56 A;  1TY0 A;  1C4A A;  2EMT A;  4NZL B;  2UYZ B;  3BVZ A;  1XCQ L;  1JRU A;  4JGH B;  3T9L A;  3CMM B;  1C4P A;  2CHX A;  2KFK B;  3ZJV A;  2PTL A;  2WXL A;  2Y3A A;  3ML9 A;  5AZH A;  1OGW A;  5E6O A;  2JSV X;  5HHD G;  3M62 B;  4TQ0 A;  2CU1 A;  5L95 C;  1HQR D;  3ZNG C;  2Y5C A;  3NZ3 A;  5CX3 A;  5BMG A;  3U4E G;  4M8M A;  2LZ6 A;  4DQO C;  1MHH E;  1WM3 A;  1F0Z A;  2I38 A;  5I4D A;  1JQ4 A;  2KJ6 A;  4F8C B;  3SR6 A;  3RZF A;  3TSS A;  3WCQ A;  2BB5 A;  4KGT A;  3T3N A;  4IG7 B;  1V6E A;  3PHX B;  2DBY A;  4N6E B;  2M8S A;  1V8C A;  1ZP0 B;  3EGR A;  4J3O D;  2FUG 1;  2LGI A;  4A55 A;  1MI0 A;  4MGZ E;  2L05 A;  3ENE A;  3VTU A;  2N9E B;  2B3A A;  2FCN A;  4HPL B;  1IBX A;  2O6V A;  2PEA A;  4MJS A;  2PKO A;  3AEF B;  3RNC C;  4MEM A;  4FBJ B;  2BB6 A;  3FIL A;  4G3X B;  4WWN A;  2KN4 A;  4ZYN A;  4S0R A;  1WXQ A;  2N0S B;  4ZRJ A;  4O1N A;  3ZRC A;  2BQQ A;  1V5O A;  2ASQ A;  5GXG B;  3AEA B;  3U52 E;  4IWO A;  4ZHP A;  5LXI B;  3BWU D;  3Q3F A;  2O2V A;  3Q8B A;  4FAD A;  3EHV A;  3L0W B;  4OVU A;  2XBB C;  2C7N B;  1K50 A;  2DLB A;  3FAH A;  4P7I A;  3APF A;  2L0T A;  3N1Z C;  3U7Z A;  4NQL B;  2LEK A;  2Y5P A;  3QAR A;  1FCL A;  3LDZ E;  2N7E A;  2JVC A;  2IDY A;  3W5U B;  2ZJD A;  2LRU A;  1T5X D;  1E9M A;  4OZC A;  1I7H A;  2VRR B;  4W9J A;  1F2R C;  3LJ3 A;  2MBO A;  5GMV A;  3RUL A;  5HI1 A;  3W1S C;  2KFK A;  1QOG A;  1GB4 A;  3ZDT A;  2LAS A;  2RMM A;  4ASW C;  3WAO A;  1E6E B;  1JML A;  4ICV A;  1XCT L;  2V4I B;  3PS6 A;  2DYB A;  2I1J A;  1E7U A;  1UGM A;  1D3Z A;  3H1U A;  3ZJU A;  4HLE A;  2CHZ A;  3H8H A;  3KYD D;  4ACF A;  3A1Q B;  2OED A;  3GS2 A;  3Q8A A;  1FM0 D;  3NOB A;  2IGD A;  4YT0 B;  4MM3 B;  2WS3 B;  4KX6 B;  2QIE B;  2WX1 A;  1VRA B;  5CHF A;  2LVP A;  2BF8 B;  2WLB A;  5E6N A;  1WM2 A;  1RYJ A;  3H9D A;  1PGX A;  4G11 A;  3NUH B;  1ZKH A;  2L52 A;  3QCA A;  2KOX A;  2KWD A;  1HE8 A;  1BT0 A;  4LK0 M;  4LNN A;  5D3D A;  2BYE A;  1N61 A;  3L17 A;  1F2R I;  1TT5 B;  1KF6 B;  3AE9 B;  1X1M A;  2MLB A;  4GSW A;  3VUY A;  4JWS C;  2VZK D;  1I4R A;  1R4N B;  3AEG B;  3DBH B;  1WJ6 A;  2J42 A;  1YJI A;  1K8R B;  2QCZ A;  2LXC A;  2MA9 B;  3UIO B;  1SF0 A;  3MJW A;  1I4G A;  4LTU A;  1E10 A;  4NJC A;  3AEC B;  4CYE A;  1I42 A;  1XLO A;  2J4X A;  4M00 A;  2MX2 A;  3RFZ B;  2MBQ A;  1WXS A;  2KX0 A;  3C0R B;  2NTT A;  5JZE B;  4TSS A;  3P4R B;  5IKC M;  4XC2 A;  3IXS A;  2LWP A;  3ZXV A;  1QOB A;  1FCC C;  4I6L B;  2G4D B;  1QOF A;  2IGG A;  4WWP A;  4HCP B;  2ZW0 A;  4DXF A;  3U7D A;  2X38 A;  4KZC A;  4WJN A;  3DWG C;  2JXT A;  3EA6 A;  1SBB B;  3Q69 A;  2FAZ A;  3S2A A;  2LGX A;  2W3S A;  1SEB D;  2WU5 B;  3VUX A;  1GC7 A;  1QIL A;  3AB5 A;  2NCN A;  3NHE B;  3A4R A;  1L7Y A;  2KX3 A;  1UEL A;  2WXR A;  2WXF A;  4HCN B;  3DVG X;  4BKS D;  2KJR A;  2KN5 A;  1S3S G;  4L23 A;  3LB8 C;  3WIM A;  1KLV A;  4LDT D;  1SGH A;  4YTM B;  4P16 A;  3RI7 C;  1SJH D;  3AUL A;  4NJ7 A;  5IO9 A;  3KUZ A;  3TCA A;  1XLP A;  3A1Q A;  1EM7 A;  4OVV A;  4K7U A;  1WGK A;  4MM3 A;  2ZEQ A;  1EUV B;  1J0G A;  2IGH A;  2K25 A;  2KMA A;  2BVC A;  3B0A A;  5G5H A;  1TY2 A;  4DHJ D;  4RGO S;  3DOW A;  4ICU A;  4IWP A;  4A3O A;  2CJN A;  4NAW B;  2JU6 X;  3UI3 A;  1SIF A;  4K7W A;  3QJZ A;  2K22 A;  1WXV A;  1NVI D;  3OAW A;  1QLB B;  1WY8 A;  4KSK C;  2M1M A;  4KIK B;  2FIF A;  1XQQ A;  2WDR B;  4FJV B;  3MFG A;  1WJU A;  3LXF A;  4TKN A;  3WAM A;  2WXK A;  4YL8 A;  1YOV B;  1K53 A;  3ABV B;  3N3K B;  2K9X A;  3RYT A;  3P1M A;  1R7S A;  1WZ0 A;  2GBM A;  3P4P B;  2D11 A;  5DPT A;  4XX5 A;  4I6P A;  1ZE3 D;  1V86 A;  1S1Q B;  1XLQ A;  3AE6 B;  2OJR A;  1PDX A;  2AEH A;  3KUC B;  4MT5 A;  2R2Q A;  1D5X C;  1T0Y A;  1IUE A;  2MBE A;  5KHO A;  3AU4 A;  3N9Y C;  2PW9 A;  4XWT A;  3OLM D;  3MJ5 A;  3TL5 A;  3P2B A;  5KHQ A;  3KWL A;  3KYC D;  5D2M B;  1KM7 A;  2VZK B;  1OEY J;  2R61 A;  4EOY A;  1QOA A;  5E6P A;  2AQ2 B;  2UU7 A;  2DNF A;  1JWA D;  4M0W B;  1C79 A;  4Q2J A;  3GZN I;  5BYQ A;  2LGY A;  4J6I A;  2FCM A;  1F52 A;  1HEZ E;  3RZW C;  1RAX A;  2JXX A;  4IKG A;  1KH0 A;  1JWM D;  3ZXR A;  1SE2 A;  2GBK A;  2H88 B;  4GOC A;  3GZN B;  3KW5 B;  5TR5 A;  3I57 A;  1UF0 A;  2NPT B;  3QC8 B;  4XGA B;  2AWT A;  1EF1 A;  3RPF C;  1F1H A;  5BYR A;  3BVG A;  1I4Q A;  4HVB A;  1TBE A;  3NS1 A;  1WRD B;  2ZPN A;  4MH0 E;  3N1X C;  4XDD A;  2RPQ A;  4NAW A;  3ZVV A;  5FR3 A;  2LI5 A;  2HTH A;  3EC8 A;  4JX1 C;  3TIX A;  4DK5 A;  1Q1O A;  4E71 A;  3E9S A;  3IBE A;  3NY5 A;  3VQI A;  1SE3 A;  4IUM B;  2QEJ C;  2M17 A;  1UD7 A;  1WXM A;  3A9J B;  4C4V B;  2MJ3 A;  4K3B A;  3HRD D;  2Z0D B;  4HPM B;  4WH4 A;  2I2Y A;  3O13 A;  3OJ3 A;  3SD5 A;  5L83 A;  1SE9 A;  2K0P A;  1B1Z A;  3PRZ A;  1L5P A;  2KQ4 X;  2KFJ A;  4YSY B;  3DBR B;  2GBN A;  1IGD A;  3EFC A;  2BTE A;  3TUO A;  2JRH A;  4KGR A;  4DHJ B;  4KKJ A;  5IN7 A;  1D6E C;  4ZRK A;  2LHD A;  1TKG A;  3L08 A;  2WXN A;  3JYU A;  3AED B;  1TS3 A;  4IM3 A;  4KV2 A;  1UNS A;  2MW5 A;  3SHQ A;  2W9N A;  4A9A A;  4M0W A;  3GP7 A;  3HIZ A;  3MTN B;  1XT9 B;  2DZM A;  4B9K A;  2RPV A;  4FA6 A;  2WX0 A;  4W9G A;  2V0G A;  1P7E A;  2YVC A;  1QKZ A;  2HJ8 A;  2L3Z A;  4GDK B;  2C7M B;  2Y5B B;  3BZD B;  3BK1 A;  2MCN B;  4EKU A;  3I5J C;  2DHZ A;  3PSE B;  1FMA D;  4PYU A;  4II2 B;  2N9P C;  3HM6 X;  3UGB B;  2WXJ A;  3R7R A;  2NPT A;  1C78 A;  1YD8 U;  3GE3 C;  4UDU C;  4RCO A;  2ZNV C;  3HM3 A;  1AAR A;  1U4A A;  2MP2 B;  3BY4 B;  4HRO A;  4A3P A;  3RD2 A;  3JVZ X;  2A5U A;  4C7Y A;  1WI0 A;  1FXI A;  4ANV A;  2NR2 A;  3BII D;  1YQB A;  1ZOY B;  4NY0 A;  1J7C A;  2KZR A;  4HXD A;  1NI2 A;  1DOI A;  4JWU C;  3QAQ A;  3IAS 1;  1TKY A;  3A9J A;  4C4V A;  1VJK A;  2VH1 A;  1H8C A;  2YEP B;  1E8X A;  3R2I A;  5H92 C;  4DXG A;  3PLU A;  1FNV A;  1XO3 A;  1EO6 A;  2NBV B;  2QHO A;  2FUH B;  4CQN A;  1SXT A;  2G3Q B;  1PGA A;  2JYT A;  1L0X B;  1JWU D;  3ZGZ A;  1FFV A;  1V80 A;  2J7Q B;  2HJ1 A;  3HUI A;  4DBG A;  2W3R A;  4K81 A;  3ALB A;  1XD3 B;  3C8Y A;  2KHW B;  3AM9 A;  3KQ4 A;  3DPD A;  4MAC A;  4JIO U;  2JZZ A;  3HK0 A;  3QWZ B;  2BWE S;  3X23 A;  1CK1 A;  3PLV A;  2LRW A;  2M19 A;  3B08 A;  1ZGU B;  1JW9 D;  3LYY A;  2C9W B;  1T6B X;  1GUA B;  2KTR B;  4MDK E;  1P7F A;  3NZU A;  2IPK D;  1V1O A;  2EMS A;  2JUO A;  4AWJ A;  2MSE D;  2KK8 A;  3WAN A;  2XNA C;  2PE6 B;  4GDK A;  4WIP A;  1B9R A;  2VH2 A;  1TS4 A;  4EUT A;  2J0M A;  5J2R A;  1G6J A;  3PTF C;  3UQA A;  3PZD A;  2AL6 A;  5G5G A;  1ET9 A;  1I4P A;  1WE7 A;  2XEW A;  3H7P B;  1IGC A;  2WDV B;  2CKH B;  2MP2 A;  1LXD A;  5BO4 B;  4WWO A;  4WUR A;  3PZ8 A;  4ZOH C;  4LLG M;  1DYQ A;  4K1R B;  1VD2 A;  1IYF A;  1RFK A;  2JYE A;  2FE8 A;  1KLG D;  3I63 C;  5LNK 1;  2NTS A;  5D7G A;  4GIV A;  2KO3 A;  4OZA A;  4NNJ B;  1C3T A;  5JHA A;  2UWQ A;  1V9J A;  5DCN A;  5BMH A;  3Q3J A;  2MWS B;  4A8X C;  2K39 A;  3V62 A;  1CZP A;  1FO4 A;  1C4C A;  1FXT B;  4FN2 A;  2YLM A;  1JWS D;  4NJ6 A;  5AZG A;  2LHE A;  2BS4 B;  3UF8 A;  4F1S A;  2IO3 B;  4YWG G;  1J7B A;  2A4Z A;  2ZCB A;  1FPY A;  3KH0 A;  5FK9 C;  3R3M A;  2INP E;  4E74 A;  2MEK A;  2L00 B;  1PQS A;  2X8X X;  2C7H A;  5C3J B;  2BGF A;  5J18 A;  2KTR A;  2EKE C;  3IVF A;  4JL9 A;  4WJP A;  4N9F 4;  5DPS A;  1C76 A;  3VTV A;  1J19 A;  3MHZ A;  2SAK A;  4BKG A;  1UBQ A;  1HXY D;  1TTN A;  1NYQ A;  4MGK E;  1CMX B;  1OQQ A;  4W9D A;  5AZF A;  2EEL A;  4ITK A;  1E5W A;  4RMA A;  3FKY A;  4H2A A;  2NMQ A;  3DWM A;  4F7Z A;  4NAM A;  1RLF A;  2KVR A;  2WXP A;  5DPW A;  4DDI D;  1FNW A;  1HTQ A;  5EE3 A;  2ONQ A;  3H7P A;  3VR8 B;  3CST A;  4WWM A;  3R2T A;  1K52 A;  1YQ3 B;  2LJ5 A;  1WGG A;  2K1F A;  3AE5 B;  4GDL B;  4RGT A;  2BS2 B;  2V3S A;  4QAY A;  5EE1 A;  3GB1 A;  1QZE A;  1YIW A;  4HWI B;  4S17 A;  1WR1 A;  3NVY A;  3AXC A;  5JH5 C;  1UGJ A;  1VLB A;  3I3T B;  2ZPY A;  3HVZ A;  4X57 B;  1WSP A;  2GOW A;  5HG2 A;  1GPX A;  4IW0 A;  2MBH A;  3B9J A;  3TEW A;  3ZTC A;  4BVU C;  3R8B A;  1P3Q U;  2GBR A;  1TKE A;  4IOI E;  4TMA B;  4IDI A;  2N9K A;  1ZDV A;  3DHI C;  3N30 A;  4HDO A;  2RR9 A;  1T0S C;  1GAQ B;  2WXG A;  4WQO B;  2REX A;  3JW0 X;  3ZDM C;  4TV3 A;  3O65 B;  2KLG A;  4ZHO A;  2MJE A;  1E8Y A;  2N7J A;  4OZB A;  5EDS A;  4YTN B;  2JZ3 B;  4PYZ A;  5CHV C;  1P1A A;  1FFU A;  3AN1 A;  3VVW B;  3M3J A;  3DHG C;  1E7P B;  2KWC A;  2NVU I;  4LNO A;  1UBI A;  4LJO B;  2KVZ A;  2FCS A;  3ZW3 A;  2WXH A;  2KAC A;  3EUB 2;  4REZ A;  3U30 A;  3RN9 C;  2OJW A;  2AQ3 B;  4FHK A;  2RD0 A;  2RDG A;  1TS2 A;  3ZLZ A;  4KZ0 A;  3ONS A;  4P1B C;  1PGB A;  3HHM A;  5TSS A;  2QSD A;  1L0V B;  3PHW B;  3KWV A;  1WJ4 A;  2AX5 A;  2J53 A;  2KWU B;  2LFI A;  4AP4 C;  1SIJ A;  2GI9 A;  2M56 B;  3KUD B;  3W1S A;  1LGR A;  3APC A;  4W9I A;  4US9 A;  3ZQ4 A;  2D3B A;  4MEL A;  3L16 A;  3VFK A;  1J7A A;  2KWV B;  4HPP A;  1N6Z A;  3OWE B;  3Q8F A;  2KDI A;  4HKZ E;  4EZJ A;  3Q6B A;  4GDL A;  4N58 A;  3RCZ A;  1SB3 C;  1MHX A;  5D6J B;  4YSZ B;  3WA0 A;  2JF5 A;  1C77 A;  4IC7 B;  1MPE A;  4NPN A;  2LJI A;  2L8J A;  1V49 A;  2BYF A;  3R66 C;  1QT9 A;  3UIP B;  1ZUD 2;  4FXC A;  1ZXI A;  4MSQ B;  4C80 A;  1LQB A;  4K7S A;  3U2S C;  1UWX A;  3BYT B;  3ZKJ C;  4B0E A;  2V3P A;  5G55 A;  2Z0E B;  3Q8C A;  2J0J A;  1WWT A;  1WGH A;  3W5V B;  4RM8 A;  4BAX A;  1YN3 A;  2DEN B;  2N1W A;  4G50 A;  1EU3 A;  4L2Y A;  3AE8 B;  4KDL B;  4RGN A;  1HTO A;  3ZJT A;  3NVZ A;  3VRB B;  2DZK A;  4MSM B;  3TBL D;  2W55 A;  4XZ4 A;  3VH4 B;  3ZIM A;  2IND C;  3AU5 A;  4OW0 A;  1AW7 A;  4L1B A;  2JPH A;  3CWI A;  2LMC A;  3PZ7 A;  1AYF A;  3IFW B;  3VAW A;  2K8H A;  3DDC B;  4GMV A;  1WR6 E;  1C1Y B;  1GC6 A;  2D3G A;  1RWS A;  5AEK B;  3ZYY X;  1QQR A;  3DVN V;  1Y56 A;  1HZ6 A;  2DZI A;  3Q3M C;  1FRR A;  1DOY A;  1NBF C;  1BUI C;  4B0M A;  4P1C C;  1FRD A;  4DHZ E;  3RNB C;  1L2N A;  1GNU A;  4US8 A;  2V3N A;  4W9H A;  4HEA 1;  4M8N A;  1TGZ B;  1NDD A;  2WNM A;  2PE9 A;  2ACZ B;  2BW2 A;  4KIK A;  3V05 A;  3GE8 C;  2IY1 B;  4KSL C;  4ANW A;  3K9O B;  2WWZ A;  4GN1 A;  1ROE A;  3A33 B;  4YTP B;  2KLC A;  1WFY A;  4LDT B;  5D3I B;  1JRO A;  4WJQ A;  1R4M I;  1YQ4 B;  1ISN A;  3AI5 A;  2GMI C;  1BXT A;  3A9K B;  3AE7 B;  2DWQ A;  3NVV A;  2IBI B;  2WU2 B;  2LD9 A;  4ZRI A;  2L0F A;  4C56 C;  1VCB A;  4HDQ A;  2N7D A;  3WAL A;  1R4M B;  2MBB B;  2E6X A;  3AH7 A;  3L4P A;  4PS8 A;  2PVO D;  2ZW1 A;  3UQB A;  1VZ7 A;  2V9H A;  2JQR B;  1XF5 L;  2ON8 A;  3M63 B;  4BOZ B;  2LGD A;  2KMC A;  2ZVO A;  3ZNI D;  1JRP A;  3T3O A;  2JX5 A;  3HVD A;  4AQ7 A;  2MQJ A;  2I1K A;  2DYM A;  4IM2 A;  5HKH A;  1M94 A;  2KDM A;  3W2D A;  4BBN F;  2KDB A;  3OG5 A; 
#chains in the Genus database with same CATH homology
 4XC2 A;  2XEW A;  2LWP A;  3TMP B;  1E8Z A;  3H7P B;  2L7R A;  3NZS A;  2CKH B;  2MP2 A;  1LXD A;  1WGY A;  1WZ3 A;  2G4D B;  2KD0 A;  4I6L B;  5BO4 B;  2BKR B;  4FUL A;  4HCP B;  4WWP A;  4WWO A;  1Q0W B;  3U7D A;  1TZ1 A;  4KZC A;  4WJN A;  3M95 A;  4EZL A;  1IPG A;  2R2O A;  3S2A A;  2FAZ A;  3VDZ A;  2LGX A;  1Y8R C;  3TCA A;  1P9D U;  2G45 B;  3VUX A;  3SU8 X;  4K1R B;  1GC7 A;  4II3 B;  1VD2 A;  1IYF A;  3RT3 B;  1E8W A;  1V2Y A;  3R7Q A;  2NCN A;  4AJY B;  2JY6 A;  4GB9 A;  3NHE B;  3A4R A;  2IO1 B;  1L7Y A;  2KX3 A;  5G2N A;  1UEL A;  2K8B A;  4IWQ A;  4HCN B;  3DQV A;  4I6N B;  3DVG X;  4BKS D;  3IG3 A;  5D7G A;  2Z59 B;  2V1Y A;  4GIV A;  3ML8 A;  2BWF A;  2KJR A;  2KN5 A;  1S3S G;  3ZUN A;  4BBN C;  2V4L A;  4BKS A;  3WIM A;  2KO3 A;  4JLC A;  2XK5 B;  4NNJ B;  1KLV A;  2M4N A;  4RM9 A;  4LDT D;  1C3T A;  5JHA A;  2O2V B;  1SGH A;  2UWQ A;  3VH3 B;  3AUL A;  4NJ7 A;  1V9J A;  2KC2 A;  5DCN A;  1UH6 A;  4BKT A;  3KUZ A;  1Q5W B;  2DAJ A;  2LVO A;  2MWS B;  3A1Q A;  3DBS A;  3Q3J A;  2K39 A;  2KQS A;  2LXA A;  3V62 A;  4EEW A;  2DX5 B;  4OVV A;  4K7U A;  3MHS D;  4MM3 A;  2ZEQ A;  1EUV B;  1FXT B;  4FN2 A;  2YLM A;  3ZRF A;  2N1V A;  5IAA C;  3V6C B;  2JT4 B;  1J0G A;  3VUW A;  3A9K A;  5LLI A;  3JSV A;  4NJ6 A;  5AZG A;  2KC1 A;  2D07 B;  2K25 A;  3UF8 A;  4F1S A;  2KMA A;  2IO3 B;  1Z5S B;  3B0A A;  3H6N A;  2A4Z A;  2ZCB A;  4DHJ D;  3KH0 A;  3DOW A;  3R3M A;  4E74 A;  4ICU A;  3OJ4 B;  4IWP A;  4TUU A;  4A20 A;  2J0K A;  5C1Z A;  2L00 B;  1PQS A;  4A3O A;  2C7H A;  3VTW A;  1WE6 A;  5JHB A;  3B1L X;  4MGI E;  4NAW B;  2BGF A;  4CHK A;  5J18 A;  1SIF A;  1P0R A;  2KTR A;  2EKE C;  1ZW7 A;  3IVF A;  3QA8 A;  3APD A;  2ZNV B;  3QJZ A;  4JL9 A;  4K7W A;  4LJP B;  1WXV A;  2CHW A;  3OAW A;  2IYD B;  1WY8 A;  4WJP A;  2NS5 A;  1RRB A;  4N9F 4;  2JWZ A;  5DPS A;  4KSK C;  4B6W A;  2M1M A;  2WDT B;  3VTV A;  1J19 A;  3WAP A;  3CSF A;  4KIK B;  3DBR I;  2FIF A;  1XQQ A;  3PGE A;  4FJV B;  2DZJ A;  4BKG A;  1UBQ A;  1WJU A;  1TTN A;  4MGK E;  4TKN A;  1CMX B;  3WAM A;  4W9D A;  5AZF A;  2NBU A;  4YL8 A;  3L54 A;  2AL3 A;  3VXW A;  1OTR B;  2AYO B;  2IO0 B;  3GOE A;  2KDF B;  1E5W A;  3N3K B;  4RMA A;  3KVF B;  3RYT A;  4F7Z A;  1WZ0 A;  2GBM A;  1RLF A;  2KVR A;  2CS4 A;  3W1Y A;  2D11 A;  2HD5 B;  2FID A;  5DPT A;  4XX5 A;  4I6P A;  1WIA A;  1EF5 A;  1WMH A;  3BIN A;  3D32 A;  3V6E B;  4DDI D;  5CHW A;  5DPW A;  1V86 A;  1WYW B;  3H7P A;  1S1Q B;  3QIJ A;  4ZDV A;  4DWF A;  2OJR A;  2AEH A;  3DVG Y;  3CST A;  3KUC B;  2D2Q A;  2HE7 A;  3PVL A;  2R2Q A;  1T0Y A;  2MBE A;  4BOS C;  2LJ5 A;  1WGG A;  2DYO A;  2K1F A;  4GDL B;  5KHO A;  2V3S A;  3AU4 A;  4GGQ A;  1QZE A;  1YIW A;  4HWI B;  3OLM D;  1WR1 A;  3TL5 A;  3P2B A;  5KHQ A;  3AXC A;  5JH5 C;  3PPA A;  3KYC D;  2K8C A;  3I3T B;  2ZPY A;  5D2M B;  4X57 B;  1KM7 A;  2NBW B;  1RFA A;  2GOW A;  4GXB A;  2BPS A;  1GJZ A;  4IW0 A;  1OEY J;  4MGY E;  3EEC A;  2MBH A;  4EOY A;  4KDI C;  3ZTC A;  4ANU A;  4BVU C;  1WGD A;  5E6P A;  2FCQ A;  2O6V B;  1P3Q U;  2GBR A;  4M0W B;  3A4S C;  4MJS B;  1A5R A;  1WF9 A;  3N30 A;  2N9X A;  2ZCC A;  1OQY A;  3NS8 A;  4HDO A;  2RR9 A;  2KJH B;  4GU2 A;  4PS3 A;  3GZN I;  4FJY A;  4DDG D;  4EZK A;  4TQ1 A;  2LGY A;  3ECI A;  2REX A;  2XK5 A;  4J6I A;  4WQO B;  3JW0 X;  2FCM A;  3ZDM C;  3RZW C;  1RAX A;  1V5T A;  2JXX A;  3H7S A;  3O65 B;  3L10 B;  4HJK A;  4TV3 A;  2KLG A;  1YX5 B;  1E8Y A;  2KXJ A;  4AOF A;  5EDS A;  2KTF A;  5J17 A;  4W9F A;  1WH3 A;  3ZNH B;  2GBK A;  4GOC A;  2JZ3 B;  3KW5 B;  5TR5 A;  5LXH A;  4PYZ A;  1MG8 A;  5CHV C;  1OEY A;  1P1A A;  1KJT A;  4DHZ B;  2PPH A;  4G0N B;  2PJH A;  2NPT B;  5DPR A;  3ZO5 B;  3VVW B;  1WJN A;  2MRP A;  3QC8 B;  2AWT A;  3M3J A;  1EF1 A;  1Z2M A;  2KWC A;  4HK2 A;  2NVU I;  4FLH A;  3ZTD A;  4HVB A;  1TBE A;  1UBI A;  1WRD B;  4LJO B;  3PRP B;  4FJZ A;  2FCS A;  2ZPN A;  3PV1 A;  4MH0 E;  3ZW3 A;  2ZZP B;  1IP9 A;  2RPQ A;  4NAW A;  3U30 A;  1LFD A;  2M0X A;  2GBJ A;  4IM0 A;  3ZVV A;  4CO7 A;  2LI5 A;  1KOT A;  5D94 A;  4DXA B;  4ANX A;  2OOB B;  2HTH A;  3EC8 A;  4FHK A;  2RD0 A;  3CF6 E;  3TIX A;  4DK5 A;  2EMT A;  1Q1O A;  2UYZ B;  4KVG B;  3ZLZ A;  4E71 A;  3IBE A;  3NY5 A;  1JRU A;  3VQI A;  4JGH B;  4KZ0 A;  3ONS A;  3CMM B;  3HHM A;  4IUM B;  3T9L A;  2CHX A;  2KFK B;  3ML9 A;  2M17 A;  1UD7 A;  5AZH A;  3PHW B;  1OGW A;  5E6O A;  4TQ0 A;  3M62 B;  1WXM A;  1WJ4 A;  3A9J B;  2CU1 A;  5L95 C;  2KWU B;  3ZNG C;  5CX3 A;  4AP4 C;  2Z0D B;  3EFU A;  4HPM B;  4M8M A;  2LZ6 A;  3SDL C;  3OJ3 A;  3KUD B;  1WM3 A;  2K6D B;  3U8Z A;  3IHP C;  3W1S A;  3X0W A;  3APC A;  4W9I A;  1E7V A;  3SD5 A;  1SE9 A;  5L83 A;  2JRI B;  2KJ6 A;  3PRZ A;  2CR5 A;  3DBL I;  1LM8 B;  2FNJ B;  4F8C B;  2KFJ A;  3RZF A;  4MEL A;  3L16 A;  3VFK A;  2N4F A;  1WX7 A;  1R4N I;  3DBH I;  2KWV B;  2GBN A;  2KDI A;  3ZNZ B;  4W9E A;  4IG7 B;  1V6E A;  2JRH A;  3VHT C;  4DHJ B;  4EZJ A;  4GDL A;  3RCZ A;  3PHX B;  1H4R A;  4ZRK A;  2RSU A;  2M8S A;  3L08 A;  3JYU A;  5D6J B;  1YX6 B;  1E90 A;  2KQ7 A;  4MGZ E;  4IM3 A;  2L05 A;  3WA0 A;  3ENE A;  2JF5 A;  1GG3 A;  4KV2 A;  2MW5 A;  3VTU A;  4IC7 B;  4NPN A;  3SHQ A;  2L8J A;  1V49 A;  2BYF A;  3R66 C;  2N9E B;  2B3A A;  3UIP B;  2FCN A;  4HPL B;  3DVN U;  4MSQ B;  2O6V A;  2W9N A;  1LQB A;  4K7S A;  2PEA A;  4MJS A;  3HIZ A;  3ZKJ C;  2LVQ A;  3MTN B;  1XT9 B;  2DZM A;  2KNB A;  4MEM A;  4FHJ A;  4G3X B;  2WYQ A;  4B9K A;  4FBJ B;  4FA6 A;  4WWN A;  5G55 A;  4ZYN A;  2WX0 A;  2Z0E B;  4W9G A;  2J0J A;  4ZRJ A;  2YVC A;  1WGH A;  2HJ8 A;  2L3Z A;  4GDK B;  3ZRC A;  4RM8 A;  1V5O A;  2BKF A;  2C7M B;  2Y5B B;  5CTR C;  1I35 A;  4URK A;  2G4S A;  2ASQ A;  2DEN B;  2MCN B;  4EKU A;  1WX9 A;  2N1W A;  1UZX B;  2DHZ A;  4IWO A;  5LXI B;  3PSE B;  4G50 A;  4PYU A;  4II2 B;  1F9J A;  2N9P C;  3HM6 X;  3Q3F A;  3QQ8 B;  3UGB B;  2O2V A;  4FAD A;  3EHV A;  3L0W B;  5IA7 A;  4OVU A;  4KDL B;  3R7R A;  2NPT A;  2XBB C;  1YD8 U;  2C7N B;  4NQK E;  2DZK A;  2K6Q A;  2ZNV C;  4MSM B;  3HM3 A;  1AAR A;  4P7I A;  3TBL D;  1U4A A;  3APF A;  2L0T A;  4XZ4 A;  3VH4 B;  2MP2 B;  4NQL B;  3PRE A;  3ZIM A;  3AU5 A;  3BY4 B;  3QAR A;  2JPH A;  2C60 A;  4A3P A;  3LDZ E;  2N7E A;  3RD2 A;  3V60 A;  3JVZ X;  2A5U A;  2JVC A;  3IFW B;  3VAW A;  1WI0 A;  2K8H A;  3DDC B;  4JQW C;  4ANV A;  2ZJD A;  2NR2 A;  4GMV A;  1WR6 E;  1C1Y B;  1GC6 A;  2LRU A;  2D3G A;  2KDE B;  4EFO A;  1YQB A;  5AEK B;  2LUE A;  2RGF A;  3DVN V;  4NY0 A;  2IY0 B;  3QHT A;  2VRR B;  2KZR A;  4W9J A;  2DZI A;  1P98 A;  2BYV E;  4HXD A;  1NBF C;  1NI2 A;  3QX1 A;  3LJ3 A;  2MBO A;  5GMV A;  3RUL A;  3W1S C;  2KFK A;  3QAQ A;  5FR6 A;  4DHZ E;  3ZDT A;  2LAS A;  4ASW C;  3A9J A;  1GNU A;  3WAO A;  1L2N A;  4W9H A;  4M8N A;  4ICV A;  1H8C A;  1TGZ B;  1NDD A;  1E8X A;  2PE9 A;  3PLU A;  4W9K A;  3PS6 A;  4KIK A;  4BFR A;  2DYB A;  2L76 A;  2I1J A;  1EO6 A;  2IY1 B;  2NBV B;  1E7U A;  2QHO A;  1UGM A;  2FUH B;  1D3Z A;  2D10 A;  3H1U A;  4KSL C;  4ANW A;  3K9O B;  3L13 A;  2WWZ A;  4GN1 A;  4HLE A;  2CHZ A;  2KKC A;  3A33 B;  3KYD D;  2G3Q B;  2KAN A;  2KLC A;  1WFY A;  3A1Q B;  4W9C A;  4LDT B;  3NOB A;  1V80 A;  2J7Q B;  3DCG A;  4WJQ A;  1R4M I;  1J8C A;  2WX1 A;  4PS7 A;  4DBG A;  4K81 A;  3ALB A;  5CHF A;  1ISN A;  1XD3 B;  2GMI C;  2LVP A;  3A9K B;  2BF8 B;  3AI5 A;  3JSV B;  2KHW B;  5E6N A;  1WM2 A;  3DPD A;  3H9D A;  3V61 A;  2IBI B;  4G11 A;  1ZKH A;  2JZZ A;  3HK0 A;  3N32 A;  4JIO U;  3QCA A;  2LD9 A;  2KOX A;  4ZRI A;  2L0F A;  4AUQ C;  1HE8 A;  1BT0 A;  1VCB A;  3QWZ B;  2BYE A;  4HDQ A;  2N7D A;  3K9P B;  3WAL A;  2BWE S;  2MBB B;  3L17 A;  3X23 A;  3PLV A;  2LRW A;  3B08 A;  1ZGU B;  2C9W B;  3QK0 A;  4GSW A;  1X1M A;  2MLB A;  4PS8 A;  3VUY A;  1GUA B;  2KTR B;  4MDK E;  4W9L A;  3RUI B;  3UQB A;  1WGR A;  1WJ6 A;  1YJ1 A;  3NZU A;  1K8R B;  1WXA A;  2EMS A;  2O6V D;  2JUO A;  3PT2 B;  4AWJ A;  2LXC A;  2MA9 B;  2MSE D;  3UIO B;  3M63 B;  4BOZ B;  2C5L C;  2KK8 A;  3PRM B;  3TJP A;  3WAN A;  3MJW A;  4LCD E;  2LGD A;  1V81 A;  2KMC A;  2IZV B;  2ZVN A;  2ZVO A;  2PE6 B;  2DAF A;  4GDK A;  3ZNI D;  2IO2 B;  4WJO A;  2MQJ A;  4EUT A;  2J0M A;  2I1K A;  2DYM A;  4IM2 A;  3T8M A;  4CYE A;  5J2R A;  1I42 A;  1G6J A;  5HKH A;  3PTF C;  1WX8 A;  2MX2 A;  5C23 A;  2MBQ A;  3UQA A;  1WXS A;  2KX0 A;  3PZD A;  1M94 A;  2AL6 A;  3C0R B;  4WAA A;  4BBN F;  4AJW A;  2KDB A;  3UIN B;  4E3C A;  5JZE B;  1WE7 A;  4B95 A;  1WMH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...