1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE A
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
1PRTF 1F77A 4RGTA 3R2TA 4RHRA 5I4DA 3V05A 1KTKA 5ELEA 3MC0B 1JQYD 4L6TB 1LTTD 1ESFA 1CQVA 1LTGD 1TS4A 1PTOH 1I4PA 1TY2A 1FGBD 1D6EC 1FNVA 4NZLB 1JCKB 1GOZA 1RDPD 1TS2A 3TSSA 1S5FD 1ET9A 5ELFA 4O1NA 4ZYSA 1V1OA 1AW7A 1SJHD 4DXGA 2TSSA 1EFID 5ELBA 1CHQD 1HXYD 1EU4A 4RGMA 1SE2A 1PRTD 3EFXD 2O2LD 1SEBD 3GP7A 1BCPF 1ET6A 1EU3A 1MD2D 2NTTA 1AN8A 4K6LA 1EEFD 1I4RA 1I4XA 1JWUD 2NTSA 2AQ1B 1CHPD 1FD7D 2WV6D 1YN4A 4UDUC 1LT3D 1PTOD 1LTID 1S5DD 2IJ0A 5D3IB 1LTAD 1SBBB 1UUPA 3SEBA 5ELDA 3O13A 3BVZA 1D5MC 3DWQA 1RD9D 4OHJA 1V1PA 1EEID 1RCVD 1G8ZD 2XN9C 3R2IA 1BXTA 1XXGA 1HA5A 1B1ZA 3KLSX 5ELCA 1JWSD 1BCPB 1BCPC 3DWAA 4RGOS 3MFGA 2RDHA 4L63B 1PRTC 1STEA 1PZJD 1S5ED 4RFBA 1YN5A 2AQ2B 1FNUA 3BYYB 3DWPA 1SJED 1DJRD 1LO5D 1S5BD 1BCPD 1B44D 1LT6D 1TS5A 1PZID 1LT5D 3EA6A 2AQ3B 1PTOF 1LLRD 1T5XD 3BYTB 4RHSA 1TY0A 3OWEB 1FNWA 3BVGA 1CT1D 5D3DA 4RGNA 1KLGD 4BWGB 4C56C 3BVMA 1I4QA 2RDGA 2Z8LA 1HTLD 1SXTA 1V1PB 1KLUD 2J4XA 1DYQA 1HQRD 1PTOB 2QEJC 4RCOA 3CHBD 1D5XC 1I4GA 2XRQD 1JWMD 2XNAC 1LTRD 1SE4A 1TS3A 4Z9CB 1I4HA 2ICIA 1UNSA 2G9HD 1YN3A 3R8BA 1PYWD 1D5ZC 1LTBD 5TSSA 2QILA 1LTSD 3URYA 1EWCA 2CHBD 1L0YB 1PRTB 1JR0D 1XTCD 2SEBD 1QILA 4RH6A 2IPKD 5FK9C 3W2DA 1PTOC 4DXFA 1PZKD 1L0XB 5FKAC 1S5CD 1SE3A 2XRSD 3BZDB 2R61A 1ENFA 1RF2D 1CK1A 4TSSA 1M4VA 1LT4D
chains in the Genus database with same CATH superfamily
5DCNA 2WKCA 2KCMA 1HTOA 3ML8A 4NQKE 4LFAL 4FP5D 1KTKA 2EY2A 2R2QA 2MJ3A 4R4TA 4ANXA 3PUVA 4BKSA 2K39A 3T3NA 1PTOH 3ULPA 4NAWB 3M62B 1WXMA 5EKLA 5IWAL 2G3QB 1I50H 4L5TA 3OIQA 2YLMA 4JI5Q 3APCA 3ZUNA 3FP9A 3SK4A 1GOZA 1RDPD 3SK6A 1K0SA 4QIWB 4KHPQ 4LNIA 1KNEA 2CU3A 3L0OA 3DOWA 4WH4A 3RNFC 1SNOA 1TIID 3PSEB 4DWFA 3NBHA 3EROA 5CBAE 1VQBA 3CPWA 1X3QA 4A3OA 5E7NA 2NN6G 4IPHA 4BBRG 1VQOA 2KANA 2Z0EB 3J7AF 1FCCC 2V4LA 2B2UA 1EU3A 3HS0C 2NCNA 2ZPYA 4C1NK 4W9IA 3CPFA 1LABA 1V43A 1NAPA 4DFAA 1F9RA 2NVTB 5IO9A 1H95A 1CUKA 1YHBA 3RLNA 2UWQA 5JH5C 4JIOU 4HMIA 2UUCQ 2ZCCA 4KY5A 3O65B 5TR5A 4I6NB 1Z6HA 1R4NI 1QVCA 5ELDA 1WX8A 3BVZA 2JA5H 1A2UA 4XDDA 2HD5B 4C00A 1IW7D 2IX0A 4ARCA 2YV5A 4MJSB 2I07B 1K3BC 4M8AA 5E6JA 2Z4IA 3CCJA 3S16B 2PEAA 4P16A 3UQBA 5BN3A 2VZAA 5I2YA 2G4SA 3OG5A 2RSOA 4BVUC 2PQEA 2RDHA 1H9RA 3LX0A 5IOCA 3HOUH 1WJ6A 1S5ED 4W9KA 3D8GA 1Q81C 4DV5L 3MP9A 2B3GA 2KJXA 3NWSA 1WXVA 3K8AA 1C1YB 2K3UA 4GLSC 2KXJA 3NG0A 1GUTA 2KTFA 1I50B 3P1MA 3LJ3A 1LT6D 4RWSC 5C4XH 2DYMA 4DNTB 3GTQH 1E1TA 3J80i 1GC6A 5CYUA 3NPPA 3NTHA 2OJWA 4KGSA 4B0MA 1GJXA 4J6HA 1U4MA 3HUIA 1ACCA 1I4QA 3KH0A 1HTLD 3DVNV 4EE2A 1AYFA 1DYQA 1NYQA 4YL8A 1E3PA 3HOVG 4KV6A 4LF7L 4MTKA 5IT9L 1JWMD 3ZNGC 1PH5A 4GKJQ 3J7A5 5CR3A 4IURA 1V86A 2VB2X 4BBSH 3D0FA 2PPHA 2WXOA 3B6YA 4HJGE 3UE0A 2BE5C 5M5XH 4QF4A 5TSSA 3S1RH 1I94L 2SEBD 2CHBD 2KQ4X 3NBIA 2RPVA 3W2DA 3IAM1 4GSWA 4OW0A 3L17A 4DV4Q 3M4OB 1LXDA 4K3CA 3AU7A 3RN2A 3PO2G 4I7AA 3TQYA 3NENA 4J8QA 4UP8A 2ZEQA 3BDCA 1CKOA 3EUB2 1AFPA 4KIKA 1SMYD 2WDRB 3GTKH 2VUMB 3KJOA 2RHSB 4FO2A 5J1ZA 5M5XB 4KDLB 1LT4D 1KLVA 4JI6Q 3A1QA 2VQEL 4RGTA 5JVH3 5CV9A 3H3VH 1BUIC 3EFUA 1VDVA 3UI2A 4BBRH 3K5NA 2MEKA 2K03A 2M0AA 2LKVA 3N52A 5IYDH 5I6YA 2YTVA 4A3EB 3RNAC 2L0FA 1AWDA 3FKYA 3D4WA 4ODGA 5JAVA 3MA2B 1JJ2A 2K5DA 3KWLA 2BS2B 1TS2A 2JSOA 3CW2C 1BBXC 3D4DA 1HZAA 4NXNQ 5E4WC 2TSSA 2N9PC 2JWUA 4NNJB 4MM3A 4IQZA 1VQMA 3JSVB 3MHSD 4EFOA 1HXYD 1HPCA 1P0RA 2WXFA 2HUGA 3I55A 4TV3A 4XXEA 2AUKA 2KHIA 2NWGA 3QC8B 4MT5A 3RZFA 1OXUA 1XJVA 4DK0A 3PIOA 1AZPA 2KWVB 5JHAA 3A1QB 5IT9E 5CV7A 4AUQC 1YJ1A 1HZBA 4DN4M 4DV6Q 1S72A 2B2WC 2LVQA 4ZRQA 3WIMA 1E2ZA 4IFDJ 2ZM6Q 4K1RB 4A93B 5GAGC 3ZDMC 1A5RA 1DD2A 2CHZA 1LT3D 3NZ3A 4PMWA 3W5OA 1SROA 3TEZA 3PO2B 1NNXA 4XIGS 1XYIA 2WAQE 5JOBA 1WYGA 3R3MA 3VAWA 3CIRB 2AWOA 1CKNA 4S3SA 3HOYB 2INPE 4TKNA 4CHTB 3DHQA 2UU9Q 2ZT9C 2UXDL 4XYCA 3BK2A 2Q2HA 3S1QB 1K52A 2QJLA 2D0PA 4YY3L 4A55A 1NBWA 1WSPA 2L76A 2IGDA 4AP4C 3L9AX 3KYCD 3I7FA 4DR7Q 3Q8CA 1JJGA 1OQRA 1F9SA 3ND8A 5EKKA 4E6IA 1EZ8A 4K0KQ 1MJEA 4I65A 3S17B 4OZAA 2MQHA 1FXAA 3RNGC 5K36H 3PRZA 1T5XD 3A74A 3J9CA 4TMAB 1TY0A 2D07B 5IT9c 1D4BA 3R7RA 4GDKA 1YJJA 1KLGD 3OPOA 2WFWA 3ULJA 1O78A 2R7ZB 3J80L 1WGHA 2A6HD 1WCMG 2AWNA 5J3BA 1J8IA 1W6KA 4RCOA 1PTOB 1TZ1A 2K25A 2N4FA 3PT2B 1Y8OB 3WANA 5IKCM 1L5PA 4N9F4 4A3KB 4EZKA 4G57A 1E8YA 3PVLA 3SK5A 5KNDA 4QJFA 2JPHA 3R8BA 3ECIA 1PYWD 2P5ZX 2JRHA 2KOXA 3PO3B 2C35B 3DM1A 4ILWA 4B3SL 2DAFA 1DOKA 4JI1Q 1PRTB 3S15B 3NVVA 2Q8TA 2KHJA 4L5SA 3Q69A 3I91A 1UE5A 2NVXB 1T3QA 4S17A 3W1GA 2BYFA 2QDLA 3RD2A 4ANVA 4RM8A 3AECB 2F0QA 2CWPA 2PI2E 4B3MQ 2BS3B 2MX2A 2NN6H 2KAJA 4GN1A 5EE9A 4BKTA 1EQVA 3KUPA 1WGDA 5IODA 4IN3A 5FJ8G 3U52E 4PZ8A 2FBWB 4PQXA 4R4IA 2KN4A 2L83A 3U9OA 1YNJC 4OWWB 3A8KE 3PRPB 1NUCA 4JI0L 3DBLB 4GN4B 3NP8A 1I4PA 3HOXH 4OONA 3R93A 2FCNA 3B9JA 1FVIA 4LF6Q 4ANUA 3MEHA 3V62A 3A8IE 5JEAJ 3QJZA 4JK1C 4KKJA 1FGBD 4K2LA 4BY1H 1V9JA 2BDNA 3M9BA 1YNXA 5HG2A 4FA6A 3UF8A 2GBKA 2F4VQ 1V1OA 2PZTA 1E7UA 3VH3B 1E1OA 3SE0A 1K8AC 3C3LA 2MBOA 1V2YA 1EIYB 2KDMA 1KRTA 5M5WB 4DR5L 2E8GA 1SE2A 3ZO5B 2O2LD 4OO1G 5LMNQ 4A3KG 2RDBC 4HIKA 5HI1A 1D1IA 3P4RB 3ABVB 2B2VA 2UYZB 4S0RA 2KUMA 4K6LA 1JWUD 2WB1B 3A9KB 1OXSC 5CHWA 1FM0D 3RI7C 4Q0FA 3HRDD 1PFMA 3M7GA 3G6EA 2IJ0A 1J6QA 1UUPA 1W3SA 3SEBA 1S4ZA 4DAYB 3P4PB 4RM9A 4FXGC 3SVMA 4BY7B 2CHXA 3WOFA 3K80C 3RN9C 3RUIB 1UWVA 3VTUA 4A90A 1RD9D 2IT1A 2LEKA 1EF1A 3GTGH 1G51A 5GAEC 3A56A 3KK7A 4ULLA 2GB1A 3BY4B 4A20A 4NY0A 4B9WA 1OTCA 1ENCA 3KLSX 1WGYA 5H8YE 1FEHA 2KMCA 4TRDA 3VYRA 4B9XA 1G291 4A75A 2N9KA 1TKEA 2C7NB 4N9PA 4W9EA 1G6ZA 1HH2P 4X65Q 5C3EH 4KZ0A 2NVQH 5G3LF 3M4YA 1SDFA 3KLRA 4KI0A 2F0OA 2FHTA 4ZOHC 4DHJD 2WXKA 2QDFA 1QOFA 4AIMA 4JL9A 4YWMA 1EM7A 2K28A 1WMHB 3I90A 2IYDB 3EGRA 2ICEC 2F4IA 2K6QA 4IW0A 3AMZA 1SYBA 2D3CA 5ELNA 4NJCA 1IGCA 2BB5A 5MPOA 1T0YA 2W55A 1B8AA 4A3IG 3RLOA 3KLSA 1RIPA 1X65A 5EKIA 3PCOB 2LUMA 3L0WB 1NR2A 3DWMA 4M8NA 4I6PA 3J81i 1XTDA 1ICWA 1Y8RC 1F2MA 1SFOB 2YEPB 3VFKA 5E4XA 2QILA 1DCZA 4DPGA 2JA7H 1OEYJ 1NMGA 4LJOB 1JOQA 3PLVA 1L0XB 2SNMA 5IE8A 2JN4A 2N8NA 2PNRC 5IYDG 1QNKA 2CFMA 5BYSA 4NW2A 4LF7Q 5M3FH 4M8MA 5DEHA 4GS3A 1R7SA 1MJCA 1RF2D 1FL0A 3NQIA 4YCUA 1PGBA 2E2IB 4GNXB 1UWXA 1D2BA 3DLLA 1C77A 1Z2MA 1Y1WH 4ZYNA 5C4JH 1WH3A 1O7IA 1YZ6A 4RHRA 4A3BH 3QX1A 4PT5A 5CMDA 2EXDA 3OWFA 1UELA 2XK5B 2WIIB 2JA6H 5C0XJ 4NDXA 5BN5A 1LTTD 3KYHC 5JEAH 3APDA 4HXDA 4CO7A 1L2NA 2IZVB 5JJZA 1FXIA 4JBMA 4L8JA 4JI6L 3RR5A 3G71A 4DV2Q 4KSKC 3ZJUA 4XYOA 1MSGA 4A3DH 3RN5A 1WZ3A 5BYQA 3HOYH 2L00B 4LFAQ 1A6XA 2N88A 2L05A 5FLXL 2LD9A 4Q2JA 2KHSA 3KBGA 4ZLTF 1F2YA 2BYTA 1STAA 2JA6G 3DBSA 5C3WA 3L2PA 3KDFA 5G5GA 3HVDA 3NZSA 3AE8B 1V8CA 1H9SA 2A73B 2OQ0A 2GN5A 4XX5A 3TP7A 1DGSA 4CDFC 2JZZA 5D6JB 2ASBA 4QCLA 3EFXD 1SIFA 3PREA 4A3GG 1Y1VG 1HFGA 4FLHA 4YTNB 4MEMA 4POFA 1YQ4B 1WTPA 3SHLA 1XLQA 3GZNB 2WXIA 1CSPA 2R92H 3TS0A 5AEKB 4FVMA 3D32A 4JPBW 2KWDA 3DCGA 3C1FA 2EYOA 1WJNA 4CKBA 2EVBA 2AUJD 5CORA 2HDMA 4QGUA 2R3ZA 1IGDA 2R6GA 2I5LX 1RRBA 3CF6E 1G2SA 2F0PA 2ZJRA 4DV1L 3I4NH 4CJ0B 4DR2Q 1UF0A 3DDCB 3NOBA 3VR6A 2WU5B 4ZUIA 4KGTA 3ZTCA 2OWOA 3W5VB 3LWUA 2HJ8A 1F2RI 2PW9A 2KHWB 3OW7A 1N33Q 1L0VB 4RKLA 3VR5A 3M3JA 3AEAB 4Y7NH 2WXJA 5C1ZA 5JHBA 1JB3A 5IP7G 5C5MA 2AQ2B 3MFYA 3NWTA 3DWPA 4NPSA 4LF9L 3NUCA 3UIOB 1TKWB 1BUVT 3T13A 2K1BA 1QG7A 4X66L 2Y3AA 4JWSC 2WDTB 5C0XH 4ME5A 1LFDA 1TS5A 2F0NA 1HNZL 3NZUA 3K7AH 2OXPA 2A4ZA 2EY1A 4ZCKA 4MSMB 2R7FA 1IBLL 3M85A 2N55A 4X3KA 4JI4Q 1N63A 3HZXA 1RWSA 2KYWA 4C4VA 4R8IA 5CGKA 4YY3Q 1MG8A 2FAZA 3MJ5A 5HGTA 4IUPA 1KF6B 4IDIA 2M00A 3V96A 4GXBA 1NE3A 3AN1A 2F1MA 2ZPNA 3GTMB 3Q3MC 2ZW0A 3FRPB 3N20C 3GQBA 2NZ1D 1Q86C 1LTSD 3IAS1 1TU2B 1QILA 3A55A 5FK9C 4DXFA 2CJNA 3BDLA 2K8CA 5CV6A 1XCTL 2CH4A 1KDAA 4DAMA 2JQRB 2RPQA 4US8A 1S40A 3ERQA 5LHY1 3QHTA 2LSSA 3TN2A 1I6HB 3RPFC 2B2VC 1QOGA 1ENAA 1F9JA 2JYTA 2M19A 4OX9L 1VS0A 3HOYG 3MXNA 1WYDA 2LFNA 2DENB 4NJ6A 1XMOL 4OWXB 3NE5B 2N9XA 4L5RC 2KFKA 1NY4A 3F2DA 4FADA 4IUMB 4W9DA 4IM0A 5IYBG 5ISRA 1JT8A 1L4ZB 3AE7B 4X3TA 3Q8DA 4K14A 2FIFA 3G6JB 5IIFA 4PV1C 3OTOQ 4BA2I 1LM8B 1MSHA 2PVGC 1OTRB 4C7YA 1TT2A 3LB8C 2V4DA 4IOCA 2F0WA 4AQYL 3Q6BA 1FGUA 1UGMA 2CKZB 2R92B 4LJZC 2HTHA 3TDQA 2QC8A 3F8TA 3CC7A 4G7HC 1RAXA 4HCNB 5KHOA 1QZGA 1VZ7A 2R7DA 2KWUB 1PYBA 5LL6S 5J2RA 1HTPA 3TJPA 4KKTA 3H0GG 2OCEA 3KUCB 1MD2D 2R93B 4RA8A 3NVYA 1A2TA 5T1IA 1JALA 1CZWA 1DOXA 1EY7A 2CH4W 2W3SA 2NUCA 2QEXA 3RZOB 4UP9A 3PPAA 2HIVA 4YWKA 3SDLC 1PTOD 4IG7B 5BR8L 4PK1A 4FJZA 4EOYA 2Z0SA 2LMCA 1UZXB 2LGSA 5C3JB 2MJDA 3LYYA 3TEXA 2E6XA 3Q8EA 3A54A 4ZDVA 5C23A 4KKSA 3CU7A 2KACA 4KJOA 2AL6A 1X3EA 3DWGC 1XNRL 2KEDA 2VNUD 3I8ZA 3W3AA 3I57A 2ZXOA 3MFGA 3CC4A 1L4DB 1E9MA 1ZKHA 2QSDA 3TMPB 3PHXB 4RNAA 4AJYB 1WE7A 4ITKA 2FMCA 2B8FA 1KIXA 2KLCA 3JW0X 1MI2A 2EZVA 1MVKA 2WGSA 1F0ZA 1WOCA 5IGFA 4X65L 4GOPA 2CW0C 1MGSA 3QJYA 3L16A 4HSVA 5D2MB 3W5UB 4GDLB 5DAUA 3OW2A 1PH8A 5JXVA 1A0IA 4RHSA 1X3PA 3PUXA 2DYBA 2MO0A 4KD3A 4KX6B 2KEEA 2E74C 3BVMA 1LM0A 2F3VA 3Q24A 1Q8IA 3I72A 3CSFA 5DPTA 4F87A 3M95A 1T0QC 1SNPA 2R93G 2JA9A 1HZ5A 2OHFA 1IYVA 1CA6A 5IA7A 3NELA 5HY6A 2F0VA 2REXA 2G9HD 4HJAA 1YN3A 4KY6A 4KTAA 2OJRA 4AOFA 4NMZA 4JWUC 1ZXHA 3AE1B 2BA0A 1TWCB 2K4KA 3VTVA 3A7AB 4XWWA 3GTOH 1E10A 2V3PA 1Z47A 3GV3A 4LK0M 1I35A 1EY9A 2QMTA 5DPWA 1BR9A 3KLWA 4X57B 5JEAG 4EQPA 2PZWA 1XQQA 2C9WB 2FUG1 2V4IB 3NS8A 3K7AB 1TZOA 4JYAQ 1N36L 2C5LC 3CKIB 1YJWA 2NZHA 1NTGA 1SYFA 4ACFA 1F2LA 1S3SG 4GLAC 1XLOA 1YNTE 2CHWA 1FYCA 3K57A 1BQQT 1U4PA 1UE7A 2L0CA 4IZ8A 3Q22A 1SN8A 4MHEA 4IC7B 4RMFA 1X6OA 2JK8A 3CRLC 2GOWA 3S24A 1WD0A 1IBKQ 4BY7H 2AKWB 2MJEA 5M5YB 3SU8X 2IY1B 3T1HL 3OTOL 2D9UA 4PMCA 3U50C 3X0WA 3E9IA 2JA8B 4EZLA 4A3LH 4GLVB 2A5UA 1V9PA 1S5FD 2O6VA 2F0TA 3X23A 2KCCA 4B3ML 2E2JB 1IP9A 3ZYYX 4OVUA 2WP8J 4DR3L 2JYEA 3CQZB 3BINA 4JI7Q 2PMZB 4P2CB 3VR2A 1SEBD 1FRRA 2X8XX 2FMMA 4PS8A 1ET6A 2O4XA 1VQCA 1STBA 4PS3A 2ES2A 1AN8A 2KDEB 3GTPB 3RFZB 1HZ6A 4XQNA 1QJOA 3PGEA 2F3WA 2DZKA 2CCZA 1KHIA 4UDUC 2RBMA 1LTID 1SBBB 1FR3A 4JI8L 2D5GA 2GBMA 4NXML 2M56B 3I3TB 4BBNF 4MACA 4GNXC 1LYLA 4FN2A 2B63H 1IPGA 3TP6A 3U58A 5C3EG 2K5WA 1EEID 3T1YQ 1PGXA 2ATWA 1QNUA 2LGDA 2M17A 3HEJA 2GRIA 1GB4A 4GZYC 4WWPA 1B1ZA 5ELCA 2C9OA 1FFUA 2YU9B 1BCPB 4R9WA 1PH9A 3FKIB 4N9TA 4LW1A 1GVPA 1F9QA 2E3TA 2MW5A 2XWBB 2KVRA 2WXHA 2HQEA 1IHZA 3FPPA 1J7BA 4TUUA 3BYYB 1EIGA 2BWES 2H88B 1WFQA 3PGZA 4LF8Q 2JZPA 2YEPF 3WA0A 2N0SB 1I6HH 4HEA1 3H7PA 5CHVC 1KAWA 1WTHA 4R8NA 3M63B 1PH6A 5M3MB 2QHOA 4LNNA 3RMKC 3EA6A 2JA8G 1JORA 3BYTB 2M8SA 3JAMi 3EC8A 2DBYA 1YVCA 5IP7H 1HR0Q 3OAWA 1HZ9A 1E2VA 2Y0SE 1G6JA 4HCEA 5C5LA 4JW0A 2FUHB 2D5DA 1QVFA 1UWMA 3EECA 2A74C 5C4HA 3QQ8B 4DR6L 2UXCQ 1OO9B 2D10A 1JQ4A 4B08A 3B0AA 2E75C 2Y5BB 3CHBD 5C4ZA 1Y1VB 2GVAA 4KGRA 4KV2A 1HE8A 3RNCC 4BFRA 1Q0WB 3C46A 4C3JB 2ICIA 4JYAL 2WAQB 1WJ4A 3TEWA 2Z4HA 3EIVA 5LL6X 1IBXB 1EWCA 1DZ1A 1ZYRC 2AYOB 3S17H 4A3JG 3MXUA 5IGGA 5DM63 1K3RA 3PUYA 2EE1A 2O5IC 2BWFA 4WAAA 1GPXA 3ONAB 2J7QB 1XPUA 4J1MA 3FHWA 1I94Q 1IL2A 3QOLA 2UU7A 3QR8A 4Q5VA 2Z9HA 5IP9G 2ZZPB 1Y1WG 1PRTF 1IBML 4GKJL 1C4AA 3DHGC 2WACA 5GMVA 1X54A 2NVQB 2FCQA 1VD2A 1IKMA 4M02A 3Q8AA 1U4RA 2KC2A 4DXAB 1JQYD 1M8AA 1RM6C 2A6HC 1LTGD 4OO1I 5CC4A 1YNND 2N7JA 2I5MX 3H7PB 1K0RA 3CCMA 1VRAB 2EJMA 2N9EB 4IWPA 1CZPA 1JWAD 4DQOC 4KK7A 2PYKA 4DV3Q 4LFBL 1WY8A 3JC66 1JCKB 2VQEQ 1Q46A 3GTJB 5ELFA 3APFA 3W9CB 5EBCA 1PQSA 2OT2A 1UD7A 4WURA 5M3MH 2PMVA 4WRDA 2UU9L 4IPDA 4JI1L 2IWHA 3U4VA 2W54A 3QIJA 5C44B 4X6AH 2N49A 1EUVB 4XE0A 1ASYA 1R9TB 3I2ZA 2E76C 3PRMB 3GZNI 2F0JA 4C3IH 3JAME 2DNFA 3AB9A 3H1UA 2M4NA 2AQ1B 4X62Q 2CU1A 4NKLA 4DBGA 1E7ZA 1VJKA 4GB9A 3A8JE 1E2WA 2Z6KC 2EYMA 4HMJA 1SE8A 2WB1E 4P75A 2NVTH 4HRSA 2PQAB 4IWQA 4DNIA 2MPMA 3HP3A 1H9SB 2F0HA 2PO4A 1R9TH 5HFYA 3E3XA 1B7YB 3KDFB 5IGDA 3HKSA 2NYZD 4A3JH 4BY1B 1AH9A 4XQJA 2YTYA 2MP2A 3H6NA 4JLCA 2V3SA 4CDEC 5HURA 2GMIC 3A9KA 4I6LB 2MA9B 1XT9B 5K5PA 1Y1WB 3I4MG 4JOIC 1EY4A 3RNUA 4IFDH 4DR1L 3EFCA 3FPUB 4HDOA 1STEA 3G4SA 5CV5A 2MH7A 2ALYB 4HR7B 4IJHA 3CQZH 4AH6A 1NI3A 2A5HA 2N78A 2GBRA 4DDID 4ZHPA 1PH2A 5C0XG 3AQQA 4TQ0A 3HIZA 3PMFA 4XZ4A 2J0MA 1PYSB 4HJ9A 4QQBX 5BYRA 4I7ZC 1PTOF 2ZXRA 4DDGD 4H13C 1SFOH 1LGRA 5D3DA 4JX1C 4II3B 3CCSA 4C56C 4A3EH 3MTSA 4YWLA 1V6EA 2D11A 4C1NI 1E0BA 3AFPA 2EOTA 1VF7A 3L3OC 3GTLB 2HDEA 5KEEA 5IP4D 2HHHL 3UDIA 3H8HA 4WQOB 3VR8B 3PF5A 2NMQA 4CKEA 5IYCH 1LTRD 3I4OA 2B29A 2UXBQ 1X3FA 1N32L 4NAWA 1JMCA 4QMGA 4DR3Q 1GUNA 4OX9Q 2LJIA 3ZNHB 4RH6A 1T6BX 1P8LA 5C4XB 4LAAA 2JYOA 1FFVA 1OQQA 3B2GA 1N8RC 3CCLA 2SOBA 1B9RA 3HOWH 1XX8A 1XO3A 3E9SA 5E6OA 2Z6BA 5JPMC 4IPCA 4MM3B 1QUQB 3AE9B 2AWTA 3KFUA 4DR4L 2YYZA 4XT3B 1LACA 2Y5CA 1JE5A 1CKNB 4FHKA 1NBFC 2LHDA 3HG9A 2DZMA 1M4VA 5IOIA 2ONQA 5LLIA 2L9HA 4JCVE 4WWOA 2XIWA 3JAMc 1A63A 1ZW7A 1Q8KA 1K8OA 1E7VA 4YHHQ 4QIWE 2E2HB 1VZ8A 2K52A 3UDGA 4C3HH 2FNJB 1EUJA 2JA5B 2VY3A 4U673 1YI2A 3S2HB 1QLBB 3J7YW 2I2YA 2KJRA 5KYLA 1P7FA 1V80A 4DV5Q 2INCC 4NZLB 1HHVA 4FJVB 1X32A 2B76B 4O2DA 4HCSA 3VYUA 1AW7A 3QWNA 1TIFA 2HE7A 2WP9B 3SFEB 3PO2H 2AEHA 3X3NA 4A3BG 1XD3B 2DZIA 3DVGY 3RLFA 1I6VC 3LDZE 3ZQ4A 4XDCA 4RMAA 1WCMB 4OXPA 5C3XA 4PG3A 2PZUA 3ALBA 2K0PA 1PUTA 2JF5A 1VQHA 2K7VA 5EPLA 3DBLI 3HK0A 4F1SA 4X62L 3I5JC 1ILQA 2B63B 5AZFA 4RF0A 4YCVA 3TEHB 4LLGM 4DUYQ 3HOWG 1B3AA 3GD7A 1GKHA 3K5OA 2PMZE 4LDTD 5LMNL 1HCZA 4KDIC 1YNNC 2L11A 1S5DD 5C4XG 3U4EG 2RHQB 1O7LA 2MUYA 2DN8A 2IHFA 2A68D 5G55A 1D5MC 1STNA 4FXKC 1FCLA 4DKAC 3MTNB 2F0GA 4OHJA 4LNKA 3R3OA 1L0WA 1G8ZD 1X55A 2XBBC 4IUVA 3D4RA 3HOUG 1BXTA 1SYDA 4K8JA 1EYAA 2LGIA 3VYTA 4JI3L 3RZDB 3U4ZA 3V2TA 1SNCA 4BXXG 1M90C 3H9DA 1IZ6A 2E2JH 3MC8A 3N1XC 3PIPA 2A6EC 2E2HH 1EWHA 1VQNA 4WJQA 2KA7A 1S3OA 4O0AA 4A3FH 1DJRD 1S5BD 2SDFA 1CA5A 2JA8H 1A3UA 1LV9A 4YTPB 2ENBA 3BU2A 3ZNZB 2QIEB 1DOMA 5KYIA 2WWZA 3CWIA 5DLQE 4OIJA 4A76A 2JSVX 3H09A 4HSPA 2RQXA 5M9OA 3QWZB 4C3JH 2WU2B 3FEWX 4DV2L 2GBNA 3NHHA 1QUQA 2Z8LA 2ZTDA 5L37A 2H1EA 3PZ8A 1QT9A 4REZA 4HKQA 2PNHA 3H0GH 1QE6A 2R7ZH 2EYFA 3MEFA 2AHOB 1K53A 4FXDA 4V0BA 4Z9CB 1GNUA 3ZXVA 1WR1A 3ENEA 1FD6A 4K81A 3QA8A 2KWCA 2WS3B 4ZUJA 3OHXC 4TQ1A 3AEBB 2EJGC 4A3LG 4B3RQ 4JI8Q 1QOAA 4DR4Q 3CMAA 4PS7A 1F9PA 2F0FA 5KRUA 2H5XA 3S2AA 4DHZE 1ICFB 3U7ZA 4BY7G 3Q3FA 1A8VA 1FXTB 1VF5C 2BT6A 1V1QA 2GVBA 1STGA 3LGJA 3A5UA 1KNAA 3GTQB 3CCQA 2RSNA 2VL6A 1ZKOA 2HTME 2UXBL 1K8RB 2K1FA 5E6NA 4TSSA 5FOBB 2BCOA 4USAA 4IUNA 3PS6A 1YD8U 4GLXA 5BMIA 1JROA 1BKBA 3GTMH 3IFTA 3R2TA 3STBC 3NQTA 3KBXA 3MAQA 1WXSA 3PUZA 2D3BA 4FF3A 4G0NB 1CQVA 3NEMA 1RTOA 1VQ4A 4G7ZC 1N61A 3WAPA 5FO8B 4II2B 1I3QB 1VCIA 3K5LA 4BZAA 4XDXA 2CJOA 5JPNC 1P98A 4ANWA 2K5VA 2YTXA 1OEYA 4IWOA 3E56A 4W9JA 3I3CA 4ZYSA 3JSVA 4ICVA 2CWAA 1JB7A 1YITA 3EBEA 3VDYA 2LFIA 2BYVE 4LTUA 4CJ2C 2JA7G 1SGHA 2XGTA 2KCTA 1HRJA 4OWTB 1N33L 1VMCA 2JJQA 1VQAA 4JV5Q 1EWYC 2KN5A 3ZIMA 4RKBA 2IY5B 3AH7A 1KM7A 4KD4A 1J8CA 1IKLA 1TWFH 4IM2A 2WNMA 2MP1A 1EY5A 2DJGC 2KMAA 1VQ5A 4DNRB 2WAQG 2RSUA 3RMHA 3IRBA 1PGAA 2CVRA 1CHPD 4YXDB 3SDZA 3B1LX 3EVQA 4JI7L 4R3DA 1H9MA 1N6ZA 3WAOA 3NK9A 5KGUA 5CTRC 1IBLQ 4MZ9A 4G50A 1TWFB 1V1PA 2D3GA 3V3XA 1RCVD 4CJ1B 2ZTCA 2VUMG 2NBFA 4WWMA 1EQTA 2RCFA 3TEYA 1IYJB 4AYBE 4KHVA 4ZK9B 2NS5A 4JI2Q 1PH3A 1HR0W 2CQAA 3WCQA 2DY8A 5AJ3L 1A62A 4LUZA 2W9NA 4BKGA 1TKYA 4DUZL 1XCQL 2LASA 5NUCA 3DPDA 3M4OH 1QCBD 2A69C 3D6WA 3ERSX 1EYCA 4CDCC 1PH4A 1N36Q 2AQ3B 1K73C 2I0QA 1PA6A 3JAML 3KYDD 4URKA 4G3XB 4POGA 3HKZG 1R4PB 2K33A 5IGCA 2WXGA 4C7ZA 3AEEB 2G45B 3FAHA 5AUKA 1RHPA 2WXRA 4JPSA 2RDGA 2QW7A 3K0YA 4M0WA 1B9NA 2J4XA 5C6AA 3QIAA 1MI0A 1G2TA 4GU2A 3P4SB 2UUBL 3AEDB 2ZCBA 5EBDA 2E5LL 4B6WA 2Q8IB 4EQNA 1WRIA 1NVID 3DXJC 1OFFA 1GJZA 1WM2A 1VCBA 5LMUQ 2ZNVC 2FE8A 1VQ8A 1B4OA 2PIAA 4OGQC 2EQSA 2DGYA 4KVGB 4ZAIA 2YVCA 3AEFB 2RDFA 2Z59B 1NMFA 1W6JA 3H6MA 4A8XC 1WFYA 3MHBA 2ZNVB 2Z0DB 1WE6A 4HDQA 1J7AA 2D3AA 3FILB 1F77A 1EIHA 4GOPC 4BOSC 4XTCS 4P72A 5EE1A 1WF9A 3C0RB 4QUCA 2L3ZA 5EJWA 4B3TQ 1QZHA 2UXCL 4HCPB 4M0WB 3NTKA 1IBKL 1Q10A 2EMSA 2JUOA 1GHJA 4C2MH 3UDFA 2I38A 4JI0Q 2IGHA 1TY2A 3BIID 4U68A 3J81c 3BK1A 5GAHC 2C5CA 3MC9A 3OSOA 1DM0B 1VMPA 2FXQA 1Q1OA 2M0XA 3B08A 3MXNB 1VQFA 2JT4B 1V5OA 3HKZB 3GE3C 2KO3A 4LMQD 3VA5A 2B2YA 3ZJVA 3P42A 4L23A 1L2FA 3K6OA 3TZUA 2DAJA 3J81E 2KD0A 3L4PA 4A3CH 1VQ7A 1XWEA 3WALA 1O7YA 5J39A 3RZDH 2VZKD 3SD5A 2MFIA 1F2RC 3K0XA 3FDTA 4MNOA 3C1EA 3SXHA 2UXDQ 2CQOA 1TXYA 2AX5A 4ARIA 4ZHOA 3EHVA 2WXPA 2LWPA 4UP7A 3SR1A 4OELB 2NTSA 4RCNA 1C79A 3ND9A 4LUVA 3Q2AC 5G2NA 3TUOA 1P16A 4HK2A 4ZRJA 1YN4A 4WQMA 3ER0A 3CC2A 2FJ2A 3Q3NC 1GD7A 3OMGA 4IOAA 1SR3A 1OQYA 1ZE3D 3CSTA 2LVOA 1ESRA 2K5HA 3DWQA 1WTVA 1EL0A 4OVZA 2R2OA 5CV8A 4MN3A 2MCNB 1BF4A 2D2QA 3DBRI 3KF8A 2KOLA 3NXWA 4LF4Q 3U30A 1CKMA 3I4MH 4JBKA 3RZOH 3UDXA 5A35A 4AWJA 1ILPA 1AP0A 5IWAQ 4GIVA 2VW9A 4UAIA 3L7ZC 1PZJD 2MJ8A 1C4CA 2KDFB 2DWQA 1AE3A 4L5QA 2Q2TA 3S14H 2LRUA 3I4LA 1SJED 2UUAL 3I9V1 1LO5D 3IKJA 1BVSA 4KZCA 4LF8L 2EMTA 2D2CC 2WXNA 1PVOA 2DX5B 1EYGA 1PV4A 1FRDA 1QZEA 4PZ7A 1XMOQ 1N5XA 3AYHB 1KDBA 1LT5D 4EQOA 3H3VI 2GI9A 2PW7A 1TWAH 2KBNA 1V5TA 4LF9Q 4FXCA 4NP5A 4M1UB 1T9HA 1UEBA 2K6AA 2MWSB 1ISNA 3AV8A 4A3BB 1P3QU 2IY0B 5D7GA 3M4QA 1JRPA 3J7ZC 4UY8C 3KW5B 1TWCH 1I3QH 4A3MG 2CKHB 5EGTA 4K5XA 4DA2A 2WKDA 4YSYB 4NXMQ 4BKSD 2VZKB 2SAKA 1D5XC 5IGEA 1WTOA 1BDOA 1PHJA 2ACZB 1KDCA 2EELA 1I4HA 4LFCQ 4LNFA 4BXXH 1U4LA 4GOCA 2VXWA 5ELOA 4A93G 3URYA 3KWVA 5J17A 1ZXTA 2XSCA 4DF7A 4A3CG 3MZ5A 1ZEQX 2IPKD 2KECA 4K8IA 5CV4A 4MGYE 2WINB 3WAMA 2HCIA 3E0EA 1PDXA 1WJUA 1ZDXA 1Q82C 2BBCA 4HROA 4A9AA 2A69D 1P9DU 5DPSA 1X9NA 3S14B 1SAPA 3S1NB 4NQLB 2HCCA 5LMUL 3AE4B 4XWTA 3PO3H 3L54A 4KHZA 1WIAA 1X1MA 3N3KB 3VH4B 4B95A 1RTNA 3J81L 4O42A 3HOXG 3KUDB 2BQQA 4JBJA 2IW3A 1C4QA 3IFWB 2HT1A 2KVZA 3PLUA 1L6UA 4CQNA 2K75A 5E6PA 5FO7B 2G1EA 1V8QA 2JXXA 2F0MA 2NVYH 4W9GA 2L8JA 5I6WA 1EO6A 4TVAB 3VYSA 1GUSA 3CCEA 1WXAA 3TZDA 2MBQA 4JI3Q 4JGHB 1Y14B 2Z1CA 4HWIB 4ME3A 1MG4A 1V97A 3IXSA 3PV0A 3TSSA 1CJEA 1UH6A 4US9A 3UI3A 1QF6A 3E6ZX 2ZJPA 2KZRA 2NBVB 1SJHD 4C80A 4YSZB 2IO2B 4AYBB 1Q90A 1KRHA 2KVMA 4DK5A 3ZTDA 4A3MB 4B3SQ 1CHQD 1TQOA 3J80E 2A6ED 3T1YL 1HQMC 2L4NA 3Q0AA 1L7YA 1VZ6A 3GP7A 3HFZB 1ZUD2 5G3LD 1NI2A 3GTGB 1CMXB 1C4PA 1KJTA 4GOPB 1IYUA 4C4VB 1TWHB 2K8BA 2JVCA 1BNZA 4P73A 2W82A 4PZ6A 1UAPA 2RMMA 3A5ZB 4G11A 3A4RA 2JU6X 1JC7A 4A3MH 1Q1EA 1OGWA 1PFSA 1LTAD 1HNWQ 2VH2A 4JE3B 5AZHA 4IALA 1BBUA 1SNQA 2K5QA 1YJ9A 4LK1C 3H94A 4AQ7A 5BO4B 3WWVA 1IBXA 4HPPA 1FO4A 4JVZA 2KKCA 5FLMG 2F0EA 5M5WH 5AZGA 4BS9A 4BA1I 4CYEA 3GDEA 4ZKBB 3AU5A 2VH1A 1JOKA 1IW7C 5EPJA 4FYDA 3W1YA 1FNUA 4K6DA 3SFDB 1ONLA 5M3FB 3NJTA 3ONSA 2EDGA 4DUZQ 2L1AA 1E5WA 2BH2A 2INDC 3QARA 2C7MB 1I42A 1O80A 1TJEA 3L13A 5AJ3Q 1BCPD 1YQ3B 3J80c 2KX0A 5EE3A 1LLRD 1B9MA 1K9MC 3MVVA 1CT1D 3T16A 2IGGA 4BWGB 3UINB 5LXIB 3CMEA 4AYBG 3HGBA 1AZQA 3SK8A 2B2TC 2JEAI 4YT0B 4DK3C 3U8ZA 4BBRB 2G4DB 3U9SA 1YMHE 3GS2A 4TQUS 1ZYRD 3DBRB 4WJWA 4XQQA 1D8LA 2Z6KA 2I1KA 1N5WA 4IFDG 4IUUA 1U5KA 1ASZA 4DAVA 2WDVB 4X64Q 3NBHB 1UNSA 4KN4C 3M3YH 3VQIA 5GROA 1AARA 4DHZB 2KK8A 1D5ZC 2E2IH 1GUAB 3K5MA 1E8XA 4MELA 1AE2A 1I5FA 4FF1A 4XYQA 3S15H 1HNWL 5E1FA 1EWIA 1E22A 3CF5A 1PZKD 1DONA 2LMCB 1S5CD 4WJPA 3AE6B 3B2FA 2DYOA 2WYQA 1STYA 2XRSD 5C3EB 3ITPA 2G9DA 4RG1A 1Y1VH 1F1HA 2KDIA 2L15A 1KOTA 2WXLA 3AEGB 2PKOA 1N34Q 1MHWC 3WOEA 5L83A 5H1SE 1GG3A 3A0JA 5C2TB 4AS1A 2IO3B 2PQAA 4KHPL 4EEWA 3AE5B 1E8WA 4LJPB 3V05A 3H15A 4X3SA 3S2DB 4YCWA 3E9HA 3MC0B 1HA6A 4UHVA 3HOZG 5A2QE 4ZRPA 1JOOA 2I5HA 2QA4A 3N6RA 2ZVOA 4GDKB 2OOBB 3HVZA 4WJNA 1K8GA 4A3DG 3LWEA 1C7YA 5BMGA 5KHQA 1C78A 4K3BA 2L1BA 1FNVA 2MNAA 1WGGA 4FDBA 2F0UA 3PSIA 1ET9A 2ZVNA 3HOZH 2MRPA 4PMBA 4FJYA 2JX5A 3BWUD 4JQWC 1HUNA 3I4NB 1C3TA 3FKIH 3CCVA 1CSQA 3V60A 4A3IB 4ZRZA 2B2TA 5IP9H 4WJ3M 3HOVH 1ZGUB 2JY6A 1XPOA 2K01A 2O2VA 4GDLA 2Q2IA 1VQPA 3S9WA 4FHJA 4HJKA 3IL8A 1WI5A 1WTRA 3IAYA 5DNFA 2UUBQ 5D65A 4Y52H 1SNDA 1E8ZA 1TTNA 4B3RL 3H91A 1SSOA 1IL8A 3CXCA 1HZCA 1VQJA 1GUWA 4DV7L 3TL5A 3IFDA 1P7EA 3Q3JA 2AL3A 2B8GA 1HUMA 5D3IB 2KNBA 4A3JB 2RVLA 3GV6A 1EQRA 1K51A 1XLPA 3NRZA 1KABA 1C9OA 5IY0A 4HAEA 2F0SA 2K32A 4JBWA 4ICUA 3W1SA 1RJTA 5EE0A 3FC4A 4PYZA 2XN9C 4A3PA 2QCZA 4NB3A 3ZXRA 4K7WA 2PCFB 1TWGB 3BZCA 3CCRA 1J5EQ 4YSXB 3TBIB 4C3IB 1WXQA 1GXDC 2ZW1A 1C8CA 2KQ7A 4ZKCB 4L63B 2BS4B 1PRTC 1HNZQ 1SSNA 2WDQB 3HOZB 1EYDA 5AFWA 3AB5A 4KIKB 2NVXH 4HTHA 1DOIA 3OOCA 4UPAA 2MLBA 3BJUA 3GO5A 3X3MA 1TR5A 3Q23A 4DR1Q 3Q14C 4YWGG 1XLNA 4J3OD 4GMVA 4WAFA 3TIXA 3KUZA 5T1GA 3NVZA 2DHZA 5GADC 3OWEB 3BVGA 1H4RA 5DPRA 4RGNA 4QUFA 4KMUC 2CW0D 3I4NG 1EQQA 4X64L 1VQ6A 1GHKA 2JXMB 1YIJA 1JMLA 2LJ5A 1WWTA 5GXGB 2WXMA 1HQRD 1SIJA 3H0GB 2QEJC 4R4CA 3ETRA 2LGXA 1OXVA 1E24A 4A3GB 4LWCA 1YJNA 2NPTA 2HJ1A 1WRDB 4JV5L 1WD1A 4PNYA 1L1OA 3ICEA 1IUEA 3H3VC 2GBJA 1Z7TA 3NUHB 2MP2B 2N7DA 1KFYB 2KT7A 4ALPA 1C0AA 4OVVA 2BF8B 2WXQA 3UE1A 3V6EB 2B2UC 2J0TD 1T5EA 2O6VD 1RFKA 4PYUA 4APVA 2ZM6L 3N30A 2F0DA 1RL2A 4DR5Q 4XC2A 3ZNID 4D2KA 4ZRKA 1GUOA 1UBQA 4GNXA 4KY7A 4CDDC 2BE5D 1CFMA 1ENFA 2MSED 2IHEA 2O5JC 1ML0D 4W9FA 4CHKA 1FJGL 3D3RA 1WVLA 1KD1C 2KJ6A 2ZJDA 1EIFA 1J7CA 2O2VB 5IYBH 1CQFA 2PPBC 3PO0A 2IBIB 5I2XA 3RYTA 4ZQ3A 3I63C 4K7SA 2JZ3B 2G5DA 1M1KC 5CX3A 4YHHL 4HPLB 1WTWA 1MHXA 2V9HA 2I1JA 1YNJD 2XVSA 1DXMA 3ZJYC 2PLPA 5GQOA 2QGQA 3F2UA 4O1NA 2IX3A 4N6EB 1SYEA 4HJ8A 5J22A 1WGKA 4J15A 4GKKQ 3F2CA 1EZ6A 2R7ZG 2O6VB 1B2TA 2WHIA 4RGMA 2J52A 2N3SA 5G5HA 2N7EA 2JP1A 2LI5A 4LNOA 5FR3A 4FBJB 1BCPF 3Q3OC 2J0JA 1PLFA 5IYCG 1YHQA 3V61A 2B2YC 2L5TA 5EPKA 1JICA 1EEFD 1I4RA 1I4XA 1HEZE 4H2AA 1L1OC 5COYA 1RKNA 4LFCL 3VR4A 2CS4A 4DV0L 4DK1A 3VR9B 2BTEA 2FCSA 4DUYL 3KOJA 3W1BA 1J19A 3S2HH 2DUDA 4EKUA 2NPTB 2C7HA 2Y0SG 2PW5A 4DR6Q 1ZOYB 3GTJH 3ZRCA 4C3HB 2R93H 2KX3A 3T51B 2E5LQ 4R4OA 4N58A 3LNNA 5JZEB 1F2ZA 1WJJA 3S2DH 1JRUA 1TBEA 4LF5Q 1XNQL 2MBBB 1I7HA 1YBYA 3T1HQ 3JVZX 1JWSD 4JC0A 4R1JA 3HOXB 1BCPC 2KJHB 1A15A 3DWAA 1H9JA 1R4MB 4K2KA 2L55A 1GC7A 2WX1A 3OMCA 2KFJA 1K28A 3TP5A 2EJFC 1D3ZA 1MIUA 1CI3M 3RNEC 1MBYA 1L6VA 3PIP3 3S1RB 3KVFB 3DM3A 3VUWA 4K5VA 1MPEA 2PJHA 4A4IA 4DAPA 1RODA 3ZW3A 2FIDA 4DV1Q 3P75A 5T8IA 1HNXL 2R92G 3TREA 1JWBD 4MGZE 1SLJA 3ZGZA 3DBHB 2X6LA 3QK0A 2EY5A 5E3FA 4DV7Q 1SXTA 2EXZA 1V1PB 4DV4L 4GGQA 4L1BA 2L7RA 1YOVB 2J53A 3ZDTA 3S1NH 3A7LA 3J81j 1NSNS 4IKGA 1PFBA 4CBVA 2F0KA 2EKIA 4W9CA 1Q7YC 3R7QA 4IM3A 1FPYA 2Q5WD 2WB1G 2ID0A 1DOYA 2VUMH 3GTKB 3VRBB 3ZLZA 1L0YB 2KDBA 2X38A 1A3VA 3T53B 5LNK1 1ZDVA 1SB3C 5KIXA 2KC1A 4DV0Q 2PTLA 3P1HA 2Y0SB 1WZ0A 3DVGX 2BH8A 1Q12A 3PZDA 3PTFC 3VRAB 4C3HG 3BZDB 2KQ3A 4YTMB 3UGBB 1A3TA 2LS01 2XTIA 3HOUB 2M2LA 2RKSA 2NN6I 2MHVA 3VR3A 3HM3A 5JVG3 1WTQA 3M3YB 3AFQA 1SYCA 3J7AV 2J7ZA 2WX0A 3FILA 3NS1A 5CHFA 3U2SC 3GB1A 1QB5D 4XT1B 2C60A 3VDZA 3IVFA 1LTLA 1WGRA 5M3FG 1H8CA 2JE6I 1D7QA 1EOTA 4K5WA 1BBWA 3D31A 1R4MI 2PVOD 3HHMA 4DK6C 1BMLC 1TWGH 2MBHA 2LRWA 4G7OC 3AM9A 3I73A 1XNRQ 4IOIE 2MQJA 1D6EC 4LF5L 1E7PB 2IX1A 5HGQA 4MTNA 1KRSA 3AE2B 2OEOA 2NVUI 1SRUA 3AULA 2NBUA 2F0IA 3QO2A 1QOHA 3MXPA 4L2YA 3M7NA 3R66C 5ELBA 5JJKA 1JW9D 4KLKA 2JQOA 3OYYA 1EU4A 1O7ZA 2RF4A 4A93H 2GLSA 2J42A 3KF6A 1X3GA 3K58A 1GAQB 2KQSA 3GE8C 4MGKE 3A9JA 3DEPA 4LNQA 2M9VA 3VXWA 2A68C 2K5NA 3F2BA 5D14A 1Q3LA 4C3JG 2IDYA 2TMPA 3FMCA 1YJIA 3KQ4A 1WCMH 1B70B 1U4AA 4HJ5A 3RT3B 3C2PA 4FF2A 3CD6A 1B50A 1DOLA 3O13A 3IBEA 4HIOA 2CR5A 2A1AA 3TS2A 2LVPA 3BZKA 4BBSG 2K04A 2HDLA 2JWZA 4A3FG 4F7XA 3BG3A 2D62A 2LGYA 4AQYQ 1C48A 1BO0A 2JEBI 1JE4A 1HJPA 2LY7A 5DM73 5KNBA 5M5YH 1PH1A 1HR0L 4JI5L 4WJ4A 3DHIC 4M01A 5LXHA 1KH0A 2BGFA 3SHQA 2VRRB 1D1KA 3MWYW 4F88A 2KTRA 3IHPC 4P71A 4RAUC 4F8MA 4FF4A 4IFDI 2OTJA 1YN5A 2A19A 3K7UC 4EUTA 2BW2A 2DY7A 1PMRA 3G7LA 1F52A 4JI4L 4HIDA 4N59A 5EAYA 1SYGA 3E0JA 2JXTA 2UUAQ 1NCVA 2L12A 2F03A 4A3DB 4P1BC 5BN4A 2Q8RE 1PZID 1OXTA 4HLEA 2LXKA 4ASWC 3K81C 2NB0A 1P1AA 1CZGA 1FNWA 2JA6B 2EKEC 1NJIC 1EFWA 3OJ4B 3ZRFA 1BOSA 2LXCA 3S1MH 3BS1A 4A3GH 2IO1B 1KLUD 1TGZB 1KXLA 3QOJA 5C44G 3P4QB 2EPBA 4MSQB 1TKGA 1C9FA 4N8X1 4DAYA 2XNAC 3MHZA 2IL8A 1EY0A 1SE4A 3GOEA 3T4AC 5HKHA 1PFNA 1QWYA 4MIUA 3ULLA 1HNXQ 3NSWA 4DV6L 3Q8BA 4JG2A 3SR6A 5BMHA 2L32A 4HIMA 2LHEA 4QL5A 4NJ7A 1A70A 4P6VF 1PTOC 3RD4A 2OEDA 5FLXc 3ZKJC 4EGVA 5FKAC 2HD3A 3CAMA 2H89B 3P63A 3Q6SA 1R4QB 2E2DC 1VQKA 1G91A 4DV3L 4GKKL 1U0LA 1YIWA 1V81A 2DNEA 4BY1G 4LF6L 1L1OB 4NXNL 1GO3E 3P20A 4EZJA 4JI2L 2A8VA 4C3IG 2DJFC 2YU9H 3I4MB 3FKIG 4HPMB 1WX9A 1K83H 3DBHI 4MJSA 2BA1A 4E71A 3KF6B 3PZ7A 1Y8NB 4HJ7A 4L6TB 1E6EB 1VLBA 4WORA 1LQBA 1IBMQ 4A6QA 4OL7A 3S1MB 3S16H 2RD0A 3EN2A 1TT5B 4DR7L 1CM9A 4LUOA 1ZPSA 5M3MG 4MH8A 4B3TL 3N1YC 1LUZA 3AEVA 1FJGQ 2MO1A 1WMHA 2UUCL 2KENA 4B9KA 1T0RC 2VS1A 3AU4A 3PF4A 3QAQA 1NR4A 2B2WA 4P1CC 1EFID 1HTQA 4DR2L 3I56A 3TRZA 1VQDA 4IUTA 1VQEA 1EY8A 1PRTD 3HOVB 4YIJA 1S1QB 1N34L 4A3IH 3HM6X 1MFWA 4EX5A 1KL9A 2LXAA 1Y56A 4IJLA 2LZ6A 1B3QA 4Y7NB 4RF1A 5C44H 2BB6A 1R4NB 2BYEA 3M4PA 2BDOA 3AXCA 3H7SA 2MHJA 3MJWA 3MXGA 1VDZA 2V3NA 4QAYA 3LXFA 2K14A 2LUEA 4KN7C 4BBNC 3DVNU 3CRKC 2V1YA 2K22A 2PE9A 1PDQA 3PHWB 4HEDA 5LMNW 4WJOA 4R4QA 2KMMA 2K50A 5J18A 4LCDE 3R2IA 2DZJA 4H02A 2EYJA 5IN7A 3F1ZA 1Z9FA 2DLBA 1V49A 4JOIA 1WX7A 3QG1A 1NEKB 2XWJB 1YHAA 4M00A 2K05A 3NTIA 3BDOA 4F8CB 4X66Q 2RA4A 4CGYB 1HFNA 4ZRIA 1G6PA 1QQRA 1Y8PB 1KC8C 5FLXE 2L0TA 4E3CA 3IG3A 4OEMB 5JJIA 1WR6E 4DU9A 3SGIA 4A3EG 3N1ZC 3RULA 1B44D 1Z5SB 1NDDA 2X69A 2ZXPA 2MBEA 1YEZA 1QOBA 5K36G 2PI2A 4H44C 1MHHE 3KF8B 2EYLA 1UGJA 4KKIA 1VR9A 1K83B 3T8MA 1U9RA 2INNE 3NY5A 2BKFA 3PIO3 3P7JA 5FLMH 3AI5A 4LDTB 2B39A 4DGZA 3ML9A 1VQLA 3OJ3A 4NAMA 1ROEA 1I4GA 1UE1A 2XRQD 5KNCA 3FVQA 1TS3A 3TMEA 5C4JB 1EF5A 1NENB 1PFDA 1QVGA 3E5SA 1II3A 3AMUA 5F2DA 1XMQQ 2HHHQ 4N8FA 1XTCD 2LXJA 1JR0D 3DEOA 4J6IA 3NVWA 3OIPA 3VHTC 2OF1A 2NBWB 1JJCB 1PXUA 1OXXK 1TWAB 2F52A 2Q2UA 1QKZA 1VQ9A 3L10B 1XEEA 2N9LA 2RGFA 3UQAA 4MGIE 1IYFA 5EQ0A 1UE6A 4A3KH 1IXRA 2HIXA 3EJIA 3A4SC 4HVBA 1J0GA 1CK1A 2DNCA 4E74A 2R61A 1TYGB 2XK5A 4FNFA 1CTMA 4QB4A 2V0GA 2GA4B 2VQFL 5FO9B 5D94A 2SNSA 3CP0A 5I4DA 5ELEA 1UBIA 1ZXIA 1J5EL 3VVWB 3T56B 4K7UA 1ESFA 1GM5A 4OO1H 4MH0E 4OIKA 1TS4A 2KCNA 2RCNA 1WI0A 2OQKA 2IO0B 2EY6A 2EYPA 3PQIA 3CCUA 1DGJA 1FMAD 1M94A 4XGAB 3T9LA 1STHA 5IAAC 2N1VA 1WYWB 4HKZE 5AUIA 2VQFQ 1N9WA 2WLBA 1MKHA 1FIQA 4G4KA 1XPRA 2ASQA 2J0KA 3C8YA 5HHDG 3K59A 2ZJQA 4B0EA 3DMUA 1SF0A 2QKIC 1TWHH 4GN3B 4FULA 2NR2A 2W3RA 4QY7A 4DXGA 1GUGA 3C19A 2ON8A 3RZWC 5FJ8H 3S1QH 1EY6A 3VUYA 4W9HA 1ZP0B 2QF7A 3A9JB 3VUXA 3RNBC 2B3AA 2K8HA 2NTTA 1KAAA 3GTPH 1YX6B 1TVXA 3EQLC 3HRZC 1BT0A 2XEWA 2K5PA 5FR6A 5JJLA 2EIFA 1K50A 3QB3A 5BR8Q 2M1MA 3NHEB 3QCAA 2JRIB 3N32A 2EYHA 3PO3G 4BOZB 3STBD 1FD7D 2WV6D 1E0ZA 1C76A 2L52A 3CMMB 3P2BA 4OZBA 4EQ5A 2VB3X 2BVCA 2KTRB 2PE6B 2MGSA 2NVYB 4WFN3 2BKRB 3PV1A 4KSLC 3U7DA 1PH7A 4W9LA 3TP8A 3N9YC 1B53A 3ZVVA 4KKUA 1T0SC 3K9OB 4X3UA 1Q5WB 4TKOB 4ABNA 1XXGA 4LFBQ 1HA5A 1X56A 3RUZA 3T3OA 2Y5PA 1AEXA 3K9PB 4DHJB 5I9PA 2KFKB 4RGOS 4C2MB 3HKZE 1SNMA 4RFBA 4BAXA 2K6DB 2JA5G 2BOSA 3PUWA 1XNQQ 4OZCA 4WIPA 4AJWA 4IPGA 5C0XI 1SMXA 2KLGA 2WQYB 4EVOA 1J9OA 2QDBA 4K0KL 1N60A 4MDKE 2FCMA 1NYRA 1MJDA 4GN5A 4HN7A 3I70A 4V190 4P7IA 4WWNA 5H92C 2D0OA 1SMYC 1XMQL 1N62A 1N32Q 3V6CB 4H0LC 3GTOB 2NZOA 5I9OA 3KJPA 2JA7B 4IUQA 2FFKB 1K8MA 1UEAB 2FINB 4CKCA 3VA7A 2F0LA 1RLFA 3IT4B 2RR9A 3TBLD 1YQBA 4LF4L 5A2QL 3JYUA 3OLMD 1H9KA 1WTXA 3TCAA 3ZJTA 4H7BA 1GB1A 1KQSA 4IO9A 2AMCB 2B63G 1E90A 3DHHC 2OTLA 1Q1BA 3RCZA 3VTWA 3W1SC 5EDSA 3HOWB 1RYJA 3DUZA 1VQGA 2X6GA 3G48A 1LTBD 3L08A 5L95C 2N1WA 4P74A 2H4OA 5CBEE 3A33B 2F3IA 1EOVA 1YX5B 1WM3A 1W2BA 1SE9A 2BPSA 3IT6B 3AE3B 4NPNA 4F7ZA 3DQVA 1SE3A 2K9XA 2QCPX 4BBSB 1RFAA 4A3FB 1Y69U 3D6CA 1VQIA 4KJNA 5IGBA 2V1CC 3Q8FA 3UIPB 2HQLA 2ZTEA 2I46A 3WDNA 2F4VL 1XF5L 3GTLH 4ID6A
chains in the Genus database with same CATH topology
2WKCA 4FP5D 1KTKA 2EY2A 2MJ3A 3PUVA 3T3NA 1PTOH 4NAWB 5EKLA 3OIQA 3SK4A 1GOZA 1RDPD 3SK6A 4QIWB 1KNEA 2CU3A 4WH4A 1SNOA 1TIID 3NBHA 3EROA 5CBAE 1X3QA 2NN6G 3J7AF 1FCCC 2B2UA 1EU3A 3HS0C 4C1NK 1LABA 1V43A 1NAPA 4DFAA 1F9RA 2NVTB 4HMIA 4KY5A 1Z6HA 5ELDA 3BVZA 1A2UA 4XDDA 1IW7D 2IX0A 4ARCA 2I07B 4M8AA 5E6JA 2Z4IA 3S16B 4P16A 5BN3A 5I2YA 2RSOA 2PQEA 2RDHA 1H9RA 3LX0A 5IOCA 1S5ED 3D8GA 3MP9A 2KJXA 3NWSA 2K3UA 4GLSC 1GUTA 1I50B 3P1MA 1LT6D 4RWSC 2DYMA 4DNTB 5CYUA 3NPPA 3NTHA 4KGSA 4B0MA 1GJXA 4J6HA 1U4MA 3HUIA 1ACCA 1I4QA 1HTLD 4EE2A 1AYFA 1DYQA 1NYQA 4KV6A 5IT9L 1JWMD 2WXOA 5CR3A 4IURA 2VB2X 4HJGE 2BE5C 4QF4A 5TSSA 2KQ4X 3IAM1 2SEBD 2CHBD 3NBIA 2RPVA 3W2DA 4OW0A 3M4OB 3AU7A 4J8QA 3BDCA 3EUB2 1AFPA 1SMYD 2WDRB 2VUMB 5M5XB 4FO2A 5J1ZA 1LT4D 4RGTA 5JVH3 5CV9A 1BUIC 1VDVA 3UI2A 3K5NA 2MEKA 2K03A 2M0AA 2LKVA 3N52A 5I6YA 4A3EB 1AWDA 3D4WA 4ODGA 5JAVA 3MA2B 3KWLA 2K5DA 2BS2B 1TS2A 2JSOA 1BBXC 3D4DA 5E4WC 2TSSA 2JWUA 4IQZA 1HXYD 1HPCA 2WXFA 2HUGA 4XXEA 2AUKA 2NWGA 4MT5A 1OXUA 4DK0A 1AZPA 5IT9E 5CV7A 4DN4M 2B2WC 4ZRQA 1E2ZA 4IFDJ 4A93B 1DD2A 1LT3D 3NZ3A 4PMWA 3TEZA 3PO2B 4XIGS 1XYIA 5JOBA 1WYGA 3CIRB 2AWOA 4S3SA 3HOYB 2INPE 4CHTB 3DHQA 2ZT9C 3BK2A 3S1QB 1K52A 2QJLA 4A55A 1WSPA 2IGDA 3L9AX 3Q8CA 1OQRA 1F9SA 3ND8A 5EKKA 4E6IA 1EZ8A 4I65A 3S17B 4OZAA 1FXAA 5K36H 1T5XD 3J9CA 4TMAB 1TY0A 1D4BA 1YJJA 1KLGD 3OPOA 3ZGZA 1O78A 2R7ZB 3J80L 2A6HD 2AWNA 1J8IA 1W6KA 4RCOA 1PTOB 1Y8OB 1L5PA 4A3KB 4G57A 3SK5A 5KNDA 3R8BA 1PYWD 3PO3B 3DM1A 4ILWA 1DOKA 1PRTB 3S15B 3NVVA 2Q8TA 3Q69A 3I91A 2NVXB 1T3QA 3AECB 2F0QA 2BS3B 5EE9A 2NN6H 2KAJA 1EQVA 3KUPA 5IODA 4IN3A 3U52E 2FBWB 4PQXA 2KN4A 2L83A 3U9OA 1YNJC 3A8KE 1NUCA 3NP8A 1I4PA 3R93A 3B9JA 3MEHA 3A8IE 5JEAJ 4KKJA 4JK1C 1FGBD 4K2LA 2BDNA 5HG2A 1V1OA 2PZTA 3SE0A 3C3LA 2KDMA 5M5WB 1SE2A 2O2LD 4OO1G 5HI1A 1D1IA 3P4RB 3ABVB 2B2VA 2KUMA 4K6LA 1JWUD 2WB1B 1OXSC 1FM0D 4Q0FA 3HRDD 1PFMA 3M7GA 2IJ0A 1UUPA 3SEBA 1S4ZA 3P4PB 4FXGC 3SVMA 4BY7B 3WOFA 4A90A 1RD9D 2IT1A 2LEKA 3A56A 3KK7A 4ULLA 2GB1A 4B9WA 1ENCA 3KLSX 5H8YE 1FEHA 4TRDA 3VYRA 4B9XA 1G291 2N9KA 1TKEA 4N9PA 1G6ZA 5G3LF 3M4YA 1SDFA 3KLRA 4KI0A 2F0OA 2FHTA 4ZOHC 2WXKA 1QOFA 1EM7A 2K28A 3EGRA 3I90A 2ICEC 2F4IA 3AMZA 1SYBA 4NJCA 1IGCA 2BB5A 5MPOA 2W55A 3KLSA 5EKIA 2LUMA 1NR2A 3DWMA 1ICWA 1F2MA 1SFOB 2YEPB 5E4XA 2QILA 1DCZA 1JOQA 1L0XB 2SNMA 2PNRC 5BYSA 1QNKA 4NW2A 5DEHA 1R7SA 1RF2D 3NQIA 1PGBA 2E2IB 1UWXA 1D2BA 1C77A 4RHRA 4PT5A 5CMDA 3OWFA 2WIIB 5C0XJ 4NDXA 5BN5A 1LTTD 5JEAH 5JJZA 1FXIA 4L8JA 3ZJUA 4XYOA 1MSGA 5BYQA 1A6XA 2N88A 5FLXL 4Q2JA 2KHSA 3KBGA 4ZLTF 1F2YA 2BYTA 1STAA 5C3WA 5G5GA 3HVDA 3AE8B 1V8CA 1H9SA 2A73B 3TP7A 4QCLA 3EFXD 1HFGA 4YTNB 1YQ4B 1WTPA 3SHLA 1XLQA 2WXIA 4FVMA 2KWDA 3C1FA 2EYOA 4CKBA 2EVBA 2AUJD 5CORA 2HDMA 1IGDA 2R3ZA 2R6GA 1G2SA 2F0PA 4CJ0B 3VR6A 2WU5B 4ZUIA 4KGTA 3W5VB 3LWUA 1F2RI 2PW9A 3OW7A 1L0VB 4RKLA 3VR5A 3AEAB 2WXJA 1JB3A 5C5MA 2AQ2B 3MFYA 3NWTA 3DWPA 3NUCA 1TKWB 1BUVT 3T13A 2K1BA 1QG7A 2Y3AA 4JWSC 5C0XH 4ME5A 1TS5A 2F0NA 2OXPA 2EY1A 1RWSA 1N63A 3M85A 2N55A 4X3KA 3HZXA 4R8IA 5CGKA 3MJ5A 5HGTA 4IUPA 1KF6B 4IDIA 2M00A 3V96A 3AN1A 2F1MA 3GTMB 2ZW0A 3FRPB 3GQBA 2NZ1D 1LTSD 3IAS1 1TU2B 1QILA 3A55A 5FK9C 4DXFA 2CJNA 3BDLA 5CV6A 1XCTL 1KDAA 2JQRB 4US8A 3ERQA 5LHY1 3TN2A 1I6HB 3RPFC 2B2VC 1QOGA 1ENAA 2JYTA 2M19A 3MXNA 2LFNA 3NE5B 5ISRA 1L4ZB 3AE7B 4X3TA 4K14A 3G6JB 5IIFA 4PV1C 4BA2I 2PVGC 1MSHA 4C7YA 1TT2A 3LB8C 2V4DA 2F0WA 2R92B 4LJZC 3TDQA 4G7HC 1VZ7A 5LL6S 1HTPA 4KKTA 1MD2D 2R93B 4RA8A 3NVYA 1A2TA 5T1IA 1JALA 1CZWA 1DOXA 1EY7A 2W3SA 2NUCA 3RZOB 1PTOD 2LMCA 5C3JB 2MJDA 3LYYA 3TEXA 2E6XA 3Q8EA 3A54A 4KKSA 3CU7A 2KACA 4KJOA 3DWGC 2KEDA 2VNUD 3I8ZA 3W3AA 3I57A 2ZXOA 3MFGA 1L4DB 1E9MA 2QSDA 4RNAA 4ITKA 2FMCA 2B8FA 1F0ZA 1MI2A 2EZVA 1MVKA 5IGFA 2CW0C 1MGSA 3QJYA 4HSVA 3W5UB 4GDLB 5DAUA 5JXVA 4RHSA 1X3PA 3PUXA 4KD3A 4KX6B 2KEEA 2E74C 3BVMA 3Q24A 2F3VA 1Q8IA 3I72A 4F87A 1SNPA 1HZ5A 2OHFA 1IYVA 1CA6A 2F0VA 2G9HD 1YN3A 4KY6A 4KTAA 4NMZA 4JWUC 1ZXHA 3AE1B 2BA0A 1TWCB 3A7AB 4XWWA 1E10A 2V3PA 1Z47A 3GV3A 4LK0M 1EY9A 2QMTA 1BR9A 5JEAG 4EQPA 2PZWA 2FUG1 2V4IB 3K7AB 1TZOA 3CKIB 1SYFA 1F2LA 1XLOA 1YNTE 1FYCA 3K57A 1BQQT 1U4PA 2L0CA 4IZ8A 3Q22A 4MHEA 3CRLC 1WD0A 2MJEA 5M5YB 2D9UA 4PMCA 2JA8B 1S5FD 2F0TA 2KCCA 2E2JB 3ZYYX 2WP8J 2JYEA 3CQZB 2PMZB 4P2CB 3VR2A 1SEBD 1FRRA 2FMMA 1ET6A 2O4XA 1STBA 1AN8A 3GTPB 3RFZB 1HZ6A 4XQNA 1QJOA 2F3WA 4UDUC 2RBMA 1LTID 1SBBB 1FR3A 2D5GA 2M56B 4MACA 3TP6A 2K5WA 1EEID 1PGXA 1QNUA 3HEJA 2GRIA 1GB4A 4GZYC 1B1ZA 5ELCA 2C9OA 1FFUA 2YU9B 1BCPB 4R9WA 3FKIB 4N9TA 1F9QA 2E3TA 2WXHA 2XWBB 2HQEA 1IHZA 3FPPA 1J7BA 3BYYB 1EIGA 2H88B 2JZPA 2YEPF 2N0SB 4HEA1 4R8NA 5M3MB 3EA6A 1JORA 3BYTB 2DBYA 1E2VA 4HCEA 5C5LA 2D5DA 1UWMA 2A74C 5C4HA 1JQ4A 1OO9B 4B08A 2E75C 3CHBD 5C4ZA 1Y1VB 4KGRA 3C46A 4C3JB 2ICIA 3TEWA 2WAQB 2Z4HA 5LL6X 1IBXB 1EWCA 1DZ1A 1ZYRC 3MXUA 5IGGA 5DM63 3PUYA 2EE1A 2O5IC 1GPXA 3ONAB 4J1MA 3QOLA 4Q5VA 1PRTF 1C4AA 2WACA 2NVQB 1IKMA 3Q8AA 1U4RA 1JQYD 1M8AA 1RM6C 2A6HC 1LTGD 4OO1I 5CC4A 1YNND 2N7JA 1VRAB 2EJMA 4DQOC 1CZPA 1JWAD 4KK7A 2PYKA 1JCKB 3GTJB 5ELFA 3W9CB 5EBCA 4WURA 2OT2A 2PMVA 4WRDA 2IWHA 2W54A 5C44B 4XE0A 1R9TB 2E76C 2F0JA 3JAME 3AB9A 2AQ1B 4NKLA 1VJKA 1E2WA 3A8JE 2EYMA 4HMJA 4HRSA 2MPMA 3HP3A 1H9SB 2F0HA 2PO4A 5HFYA 5IGDA 2NYZD 4BY1B 4XQJA 5HURA 5K5PA 1Y1WB 1EY4A 4IFDH 3FPUB 1STEA 5CV5A 2MH7A 4HR7B 1NI3A 2A5HA 4ZHPA 5C0XG 4TQ0A 3PMFA 5BYRA 4I7ZC 1PTOF 2ZXRA 4H13C 5D3DA 4JX1C 4C56C 3MTSA 4C1NI 1E0BA 2EOTA 1VF7A 3GTLB 3L3OC 2HDEA 5KEEA 3H8HA 3VR8B 2NMQA 4CKEA 1LTRD 4QMGA 1GUNA 2LJIA 4RH6A 1T6BX 5C4XB 4LAAA 2JYOA 1FFVA 1OQQA 3B2GA 1B9RA 2SOBA 1XX8A 1XO3A 3E9SA 5JPMC 4MM3B 3AE9B 2YYZA 4XT3B 1LACA 2Y5CA 2LHDA 3HG9A 1M4VA 2ONQA 2L9HA 2XIWA 1K8OA 2E2HB 1VZ8A 2JA5B 1QLBB 4U673 3S2HB 3J7YW 2I2YA 5KYLA 1P7FA 4NZLB 1HHVA 1X32A 2B76B 4HCSA 3VYUA 1AW7A 3QWNA 2WP9B 3SFEB 3ZQ4A 3X3NA 3RLFA 1I6VC 4XDCA 1WCMB 5C3XA 2PZUA 2K0PA 1PUTA 2K7VA 5EPLA 1ILQA 2B63B 4RF0A 4LLGM 1B3AA 3GD7A 3K5OA 1HCZA 1YNNC 2L11A 1S5DD 3U4EG 1O7LA 2MUYA 2DN8A 2A68D 1D5MC 1STNA 4FXKC 1FCLA 2F0GA 4OHJA 3R3OA 1G8ZD 4IUVA 3D4RA 1BXTA 1SYDA 4K8JA 1EYAA 2LGIA 3VYTA 3RZDB 3V2TA 1SNCA 2A6EC 1EWHA 2KA7A 1DJRD 1S5BD 2SDFA 1CA5A 1A3UA 1LV9A 4YTPB 2ENBA 2QIEB 1DOMA 5KYIA 3CWIA 4OIJA 2JSVX 3H09A 4HSPA 2RQXA 5M9OA 2WU2B 3FEWX 3NHHA 2Z8LA 2H1EA 3PZ8A 1QT9A 4REZA 4HKQA 1QE6A 2EYFA 1K53A 4FXDA 4V0BA 4Z9CB 1FD6A 2WS3B 4TQ1A 4ZUJA 3OHXC 3AEBB 2EJGC 1QOAA 1F9PA 2F0FA 5KRUA 3U7ZA 1VF5C 2BT6A 1STGA 1KNAA 3GTQB 2RSNA 1ZKOA 2HTME 4TSSA 5FOBB 2BCOA 4USAA 4IUNA 5BMIA 1JROA 3IFTA 3R2TA 3NQTA 3KBXA 3MAQA 3PUZA 4FF3A 1CQVA 1RTOA 4G7ZC 1N61A 5FO8B 1I3QB 1VCIA 3K5LA 4XDXA 2CJOA 5JPNC 3E56A 3I3CA 4ZYSA 2LFIA 4LTUA 4CJ2C 1HRJA 1VMCA 1EWYC 4RKBA 3AH7A 4KD4A 1IKLA 2WNMA 2MP1A 1EY5A 4DNRB 3RMHA 1PGAA 2CVRA 1CHPD 4YXDB 3SDZA 3EVQA 4R3DA 1H9MA 3NK9A 5KGUA 1TWFB 1V1PA 3V3XA 1RCVD 4CJ1B 2NBFA 4WWMA 1EQTA 3TEYA 4ZK9B 4KHVA 2CQAA 3WCQA 2DY8A 1TKYA 1XCQL 5NUCA 1QCBD 2A69C 3D6WA 1EYCA 2AQ3B 3JAML 4C7ZA 1R4PB 2K33A 5IGCA 2WXGA 3AEEB 3FAHA 5AUKA 1RHPA 2WXRA 4JPSA 2RDGA 3K0YA 4M0WA 1B9NA 2J4XA 5C6AA 3QIAA 1MI0A 1G2TA 3P4SB 3AEDB 5EBDA 2Q8IB 4EQNA 1WRIA 1NVID 3DXJC 1OFFA 2FE8A 1B4OA 2PIAA 4OGQC 4ZAIA 3AEFB 2RDFA 1W6JA 3H6MA 4A8XC 3MHBA 1J7AA 3FILB 1F77A 1EIHA 4XTCS 5EE1A 4QUCA 5EJWA 3NTKA 1Q10A 1GHJA 2I38A 2IGHA 1TY2A 3BIID 4U68A 3BK1A 2C5CA 3OSOA 1DM0B 1VMPA 3HKZB 4LMQD 3VA5A 2B2YA 3ZJVA 3P42A 4L23A 3K6OA 3TZUA 3L4PA 3J81E 1XWEA 1O7YA 5J39A 2VZKD 1F2RC 3FDTA 3C1EA 3SXHA 4ARIA 2AX5A 4ZHOA 2WXPA 3SR1A 4RCNA 2NTSA 1C79A 3ND9A 3TUOA 1YN4A 4WQMA 2FJ2A 3OMGA 1ZE3D 1ESRA 3DWQA 1WTVA 1EL0A 4OVZA 5CV8A 4MN3A 1BF4A 3KF8A 2KOLA 3NXWA 5A35A 1ILPA 1AP0A 4UAIA 3L7ZC 1PZJD 2MJ8A 1C4CA 2DWQA 3I4LA 1SJED 3I9V1 1LO5D 3IKJA 2D2CC 2WXNA 1FRDA 1N5XA 1KDBA 1LT5D 4EQOA 2GI9A 2PW7A 4FXCA 4NP5A 4M1UB 2K6AA 3AV8A 5D7GA 4A3BB 1JRPA 5EGTA 4K5XA 4DA2A 2WKDA 4YSYB 2VZKB 2SAKA 1D5XC 5IGEA 1WTOA 1BDOA 2ACZB 1KDCA 2EELA 1I4HA 1U4LA 2VXWA 3URYA 3KWVA 1ZXTA 2XSCA 4DF7A 3MZ5A 1ZEQX 2IPKD 2KECA 4K8IA 5CV4A 2WINB 2HCIA 1PDXA 2BBCA 1ZDXA 4HROA 4A9AA 2A69D 3S14B 1SAPA 3S1NB 2HCCA 3AE4B 4XWTA 4KHZA 1RTNA 3J81L 4O42A 2IW3A 1C4QA 1L6UA 4CQNA 5FO7B 2G1EA 1V8QA 2F0MA 5I6WA 3VYSA 1GUSA 3TZDA 2Z1CA 1V97A 3IXSA 3PV0A 3TSSA 1CJEA 4US9A 3UI3A 1QF6A 3E6ZX 4C80A 1SJHD 4YSZB 4AYBB 1Q90A 1KRHA 2KVMA 4A3MB 1CHQD 1TQOA 3J80E 2A6ED 1HQMC 2L4NA 3Q0AA 1VZ6A 3GP7A 1ZUD2 5G3LD 3GTGB 1C4PA 1IYUA 1TWHB 2W82A 1BNZA 1UAPA 2RMMA 2JU6X 1JC7A 1Q1EA 1LTAD 4JE3B 4IALA 1SNQA 2K5QA 4LK1C 3H94A 1IBXA 1FO4A 2F0EA 4BS9A 4BA1I 4ZKBB 1JOKA 1IW7C 5EPJA 4FYDA 1FNUA 4K6DA 3SFDB 1ONLA 5M3FB 2EDGA 2L1AA 1O80A 1TJEA 1YQ3B 1BCPD 5EE3A 1LLRD 1B9MA 3MVVA 1CT1D 3T16A 2IGGA 4BWGB 3HGBA 1AZQA 3SK8A 2B2TC 2JEAI 4YT0B 4BBRB 3U9SA 1YMHE 3GS2A 4TQUS 1ZYRD 4WJWA 4XQQA 1N5WA 4IFDG 4IUUA 4DAVA 2WDVB 1UNSA 4KN4C 3VQIA 1D5ZC 3K5MA 4FF1A 4XYQA 5E1FA 1DONA 1PZKD 2LMCB 1S5CD 3AE6B 3B2FA 2DYOA 1STYA 2XRSD 5C3EB 3ITPA 2G9DA 2WXLA 3AEGB 2PKOA 3WOEA 5C2TB 4AS1A 3AE5B 3V05A 3S2DB 4X3SA 1HA6A 3MC0B 5A2QE 4ZRPA 1JOOA 3N6RA 4GDKB 3HVZA 3LWEA 5BMGA 1C78A 2L1BA 1FNVA 2F0UA 1ET9A 4PMBA 2JX5A 3BWUD 1HUNA 3I4NB 4A3IB 4ZRZA 2B2TA 2K01A 3S9WA 3IL8A 1WTRA 3IAYA 5DNFA 5D65A 1SNDA 3H91A 1SSOA 1IL8A 1GUWA 3IFDA 1P7EA 2B8GA 1HUMA 5D3IB 4A3JB 2RVLA 3GV6A 1K51A 1XLPA 3NRZA 1KABA 4HAEA 2F0SA 2K32A 4JBWA 3W1SA 1RJTA 5EE0A 3FC4A 2XN9C 2PCFB 1TWGB 4YSXB 3TBIB 4C3IB 1WXQA 1GXDC 2ZW1A 1C8CA 4ZKCB 4L63B 2BS4B 1PRTC 1SSNA 2WDQB 3HOZB 1EYDA 5AFWA 3AB5A 4HTHA 1DOIA 3OOCA 3GO5A 3X3MA 1TR5A 3Q23A 4YWGG 1XLNA 4J3OD 4WAFA 5T1GA 3NVZA 3OWEB 3BVGA 4RGNA 4QUFA 4KMUC 2CW0D 1GHKA 2JXMB 1JMLA 5GXGB 1WWTA 2WXMA 1HQRD 1SIJA 3H0GB 2QEJC 3ETRA 1OXVA 4A3GB 1WD1A 4PNYA 1IUEA 3H3VC 1Z7TA 3NUHB 1KFYB 2WXQA 2B2UC 2J0TD 1T5EA 1RFKA 2F0DA 4D2KA 1GUOA 4KY7A 2BE5D 1CFMA 1ENFA 2O5JC 1ML0D 3D3RA 1WVLA 1J7CA 1CQFA 2PPBC 3PO0A 5I2XA 4ZQ3A 1WTWA 1MHXA 1YNJD 2XVSA 1DXMA 2PLPA 4O1NA 3F2UA 2IX3A 4N6EB 1SYEA 5J22A 1WGKA 1EZ6A 1B2TA 4RGMA 2J52A 5G5HA 2JP1A 5FR3A 1BCPF 1PLFA 2B2YC 2L5TA 5EPKA 1JICA 1EEFD 1I4RA 1I4XA 1HEZE 4H2AA 5COYA 3VR4A 1RKNA 4DK1A 3VR9B 2BTEA 2PW5A 1ZOYB 4C3HB 3T51B 4N58A 3LNNA 1F2ZA 1I7HA 1JWSD 3HOXB 1BCPC 1A15A 3DWAA 1H9JA 4K2KA 2L55A 3OMCA 3TP5A 2EJFC 1CI3M 1MBYA 1L6VA 3PIP3 3S1RB 4K5VA 1MPEA 4DAPA 1RODA 3P75A 5T8IA 1JWBD 2X6LA 2EY5A 5E3FA 1SXTA 2EXZA 1V1PB 4L1BA 2J53A 3A7LA 1NSNS 4IKGA 1PFBA 4CBVA 2F0KA 2EKIA 2Q5WD 2ID0A 1DOYA 3GTKB 3VRBB 1L0YB 2X38A 1A3VA 3T53B 5LNK1 1ZDVA 1SB3C 5KIXA 2PTLA 3P1HA 2Y0SB 1Q12A 3VRAB 4C3HG 3BZDB 2KQ3A 4YTMB 1A3TA 2LS01 3HOUB 2M2LA 2RKSA 2NN6I 2MHVA 3VR3A 5JVG3 1WTQA 3M3YB 1SYCA 3J7AV 2J7ZA 3FILA 3NS1A 3U2SC 3GB1A 1QB5D 4XT1B 2JE6I 1EOTA 4K5WA 2PVOD 3D31A 1BMLC 3AM9A 4G7OC 3I73A 4IOIE 1D6EC 1E7PB 2IX1A 3AE2B 2OEOA 2F0IA 3QO2A 1QOHA 3MXPA 4L2YA 3M7NA 5ELBA 1JW9D 2J42A 1EU4A 1O7ZA 3K58A 1GAQB 3DEPA 2M9VA 2A68C 5D14A 1Q3LA 4C3JG 2IDYA 2TMPA 3FMCA 1YJIA 3KQ4A 3C2PA 4FF2A 1B50A 1DOLA 3O13A 2K04A 2HDLA 4F7XA 3BG3A 2D62A 1C48A 1BO0A 2JEBI 1JE4A 2LY7A 5DM73 5KNBA 1KH0A 1D1KA 3MWYW 4F88A 4F8MA 4RAUC 4FF4A 4IFDI 1YN5A 2BW2A 2DY7A 1PMRA 3G7LA 4N59A 1SYGA 3E0JA 2JXTA 1NCVA 2L12A 2F03A 4A3DB 5BN4A 2Q8RE 1PZID 1OXTA 2NB0A 1CZGA 1FNWA 2JA6B 1BOSA 3BS1A 1KLUD 3QOJA 3P4QB 2EPBA 1TKGA 1C9FA 4DAYA 2XNAC 3MHZA 2IL8A 1EY0A 1SE4A 3T4AC 1PFNA 1QWYA 4MIUA 3NSWA 3Q8BA 3SR6A 5BMHA 2L32A 2LHEA 1A70A 4P6VF 1PTOC 3RD4A 2OEDA 4EGVA 5FKAC 2H89B 3P63A 3Q6SA 1R4QB 2E2DC 1G91A 2DNEA 3P20A 4C3IG 3I4MB 2BA1A 3PZ7A 1Y8NB 4L6TB 1E6EB 1VLBA 4WORA 4A6QA 4OL7A 3S1MB 1CM9A 1ZPSA 4MH8A 1NR4A 2B2WA 1EFID 4IUTA 1EY8A 1PRTD 3HOVB 4YIJA 1Y56A 4Y7NB 4RF1A 2BB6A 5HHDG 2BDOA 3MXGA 1VDZA 2V3NA 3LXFA 4KN7C 3CRKC 2K22A 1PDQA 4HEDA 2KMMA 3R2IA 2EYJA 2DLBA 3QG1A 1NEKB 2XWJB 2K05A 3NTIA 3BDOA 1HFNA 2RA4A 4CGYB 1QQRA 1Y8PB 5FLXE 4DU9A 1B44D 2X69A 2ZXPA 1QOBA 5K36G 1MHHE 4H44C 4KKIA 1UGJA 2EYLA 1VR9A 1K83B 1U9RA 2INNE 3PIO3 3P7JA 4NAMA 2B39A 4DGZA 1ROEA 1I4GA 2XRQD 5KNCA 3FVQA 1TS3A 3TMEA 5C4JB 1NENB 1PFDA 3E5SA 1II3A 3AMUA 5F2DA 1XTCD 1JR0D 3DEOA 3NVWA 3OIPA 2OF1A 1PXUA 1OXXK 1TWAB 1QKZA 1XEEA 2N9LA 5EQ0A 3EJIA 1CK1A 2DNCA 2R61A 1TYGB 4FNFA 1CTMA 4QB4A 2V0GA 2GA4B 5FO9B 2SNSA 5I4DA 1ZXIA 5ELEA 3T56B 1ESFA 4OO1H 4OIKA 1TS4A 2KCNA 2EY6A 2EYPA 1DGJA 1FMAD 1STHA 4HKZE 5AUIA 2WLBA 1FIQA 4G4KA 3C8YA 3K59A 4B0EA 3DMUA 1SF0A 2QKIC 2W3RA 4DXGA 1GUGA 2ON8A 1EY6A 1ZP0B 2QF7A 2NTTA 1KAAA 1TVXA 3EQLC 3HRZC 2K5PA 1K50A 3QB3A 2EYHA 1FD7D 2WV6D 1E0ZA 1C76A 2L52A 4OZBA 2VB3X 4WFN3 2MGSA 2NVYB 3TP8A 3N9YC 1B53A 4KKUA 4X3UA 4TKOB 4ABNA 1XXGA 1HA5A