1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
5ELDA 1PZID 2AQ1B 2XN9C 1TS4A 3MFGA 3W2DA 1SEBD 1ET6A 3TSSA 2AQ2B 3CHBD 1S5FD 1YN3A 1I4HA 1FGBD 1S5ED 1G8ZD 1STEA 3O13A 4RCOA 2XRQD 1XXGA 1PZJD 2Z8LA 3BYYB 2WV6D 1LT5D 1HA5A 1PTOD 5ELBA 3R2TA 4DXFA 1SJED 1JWUD 2TSSA 3OWEB 1SJHD 1PTOB 1EFID 1CQVA 3URYA 1CT1D 1DJRD 1TS5A 1I4PA 4Z9CB 1JCKB 1FNVA 3MC0B 4OHJA 3DWQA 1LLRD 3DWAA 1B1ZA 1V1OA 1AN8A 1F77A 2XRSD 1FD7D 2IPKD 2ICIA 2XNAC 2RDGA 1LT3D 4BWGB 4RHSA 1KLGD 1CHPD 1I4GA 5D3DA 1LTTD 1TS2A 1SE2A 1ESFA 4C56C 1LTID 1BCPF 1PRTF 2J4XA 1HXYD 1B44D 1V1PB 4TSSA 1SE4A 2O2LD 4O1NA 1RCVD 1BCPC 1EEID 1LTBD 1PRTC 3GP7A 1YN5A 1D5MC 1JWMD 5ELFA 2SEBD 1KLUD 1S5DD 2NTSA 1V1PA 4RGTA 2QEJC 1UUPA 3R8BA 1LTSD 1PZKD 1KTKA 1BCPB 1PRTB 3KLSX 1FNUA 1EU4A 2RDHA 1S5CD 4DXGA 1AW7A 2G9HD 1D6EC 1PYWD 1EEFD 1EWCA 4RHRA 1TS3A 3R2IA 1I4RA 1L0XB 3DWPA 1ET9A 5D3IB 5I4DA 1JWSD 1LT6D 2AQ3B 1RD9D 2IJ0A 4L6TB 1L0YB 2CHBD 3BVGA 3BVMA 1DYQA 4K6LA 1BXTA 4L63B 1UNSA 1XTCD 3V05A 4RH6A 1PTOF 5ELCA 1GOZA 1CK1A 2R61A 1LO5D 1BCPD 1PRTD 3BYTB 1JR0D 1I4XA 1HQRD 1PTOC 3EFXD 1ENFA 4RGMA 1I4QA 1S5BD 2QILA 3EA6A 1SBBB 1RF2D 4UDUC 1LTAD 3SEBA 1YN4A 1CHQD 1TY2A 5FKAC 1LTRD 2NTTA 4RFBA 1EU3A 1SXTA 1LT4D 1HTLD 4NZLB 1MD2D 1RDPD 4RGNA 1LTGD 1D5XC 1JQYD 1M4VA 5TSSA 1SE3A 1TY0A 5FK9C 4ZYSA 1QILA 1FNWA 1T5XD 4RGOS 1D5ZC 3BZDB 1PTOH 3BVZA 5ELEA
chains in the Genus database with same CATH superfamily
1ZXIA 2DGYA 1R4MB 3E3XA 1SEBD 3GTGH 5IYCG 4A3KH 2KWUB 4K2KA 2AQ2B 3K5MA 4HJ8A 2HD5B 2RSOA 1XF5L 5KHOA 3DEOA 1STBA 4B3MQ 2WXFA 4K5WA 5C5LA 2MBHA 1IYVA 3Q23A 2RQXA 3VH4B 3GE3C 4P72A 2PCFB 1EUVB 2GB1A 3A1QA 2NPTB 2TSSA 3OWEB 1S1QB 1SDFA 5JVG3 4LFBL 3EN2A 1CQVA 3KWVA 3URYA 3TZDA 2IY1B 3TEWA 1WCMG 2GA4B 4MJSA 3GTGB 4A3KB 1HR0W 1UEBA 1KLVA 4F8CB 2XK5B 1PH5A 1UE7A 4DFAA 5EE0A 5C0XJ 1WXSA 3DBHB 2PO4A 5K5PA 2BOSA 1HZAA 2PMZB 1WXMA 2KACA 3DPDA 5ELOA 1LV9A 5JJLA 3GB1A 2K50A 2E75C 5D3DA 1BR9A 2K52A 1F2RC 4G7OC 5I2YA 2F4VL 1PYSB 4MNOA 4DV7L 1MJDA 1LACA 4OONA 2O2VB 1PFNA 4BAXA 1LTLA 2MPMA 2NMQA 1SNQA 4R4TA 3I3CA 4DUYQ 4FF2A 2K5NA 1FGUA 1D5MC 5E4XA 1VZ6A 2RPQA 4ZRPA 3R93A 3R3OA 5LMNQ 1LQBA 1KABA 2LGXA 1S5DD 5AZGA 2Y0SB 2RR9A 3H8HA 2KENA 2RMMA 1FYCA 4BBRH 3A56A 4XT1B 1M94A 2WAQG 4WQMA 1D7QA 2FUG1 4DV5L 4X64L 4ARCA 2L55A 2PZWA 4DAYA 2V1YA 3GQBA 5EE1A 2CCZA 1KDCA 5E3FA 2W82A 1MJCA 3QQ8B 1SGHA 2K6QA 1L6VA 3IKJA 4A3EH 3Q3OC 1J8IA 3B2FA 1PFDA 2N9EB 4BOZB 4BBRB 3OJ4B 1H9KA 1KHIA 4GNXB 1AFPA 1BUIC 1HH2P 3WIMA 4YTMB 3T1YQ 1MVKA 2F0UA 4Y7NH 2KVZA 3MJ5A 4YIJA 4RH6A 2PKOA 3CC7A 2MX2A 3VVWB 1UEAB 3VXWA 1W6KA 2W54A 3UQBA 1B3AA 4AQ7A 2MFIA 2J7QB 1RYJA 1I4XA 3NEMA 4XYCA 1F0ZA 5EBDA 4WWPA 2WQYB 4A3EB 3Q14C 2NBFA 3QC8B 5M3FH 2C9WB 2A5HA 2KYWA 3JYUA 1JICA 2YTXA 2MJ8A 4OIJA 2PVGC 1N36L 4HJKA 1E2WA 2NTTA 2W3RA 3U52E 1VQKA 4Y7NB 2DYMA 5C1ZA 4OW0A 3TREA 1TKEA 4LF9L 4IUPA 4LNOA 4GB9A 1J5EQ 1QF6A 2NYZD 1FXTB 2OTLA 2BF8B 4ZYSA 1WTVA 1PFBA 1NMGA 5IGCA 1VQPA 1ISNA 4X64Q 2R7FA 2A69D 5M3FB 2BE5D 5ELEA 1JC7A 3J81L 3O65B 1PZID 3S24A 1WFYA 5LLIA 5BYSA 3MFGA 3W2DA 2KDIA 4IFDH 1Y1WH 1VMCA 5JXVA 2AL6A 2KHSA 1OO9B 4CHKA 4XDDA 3ULPA 4DHZE 5C4ZA 4US8A 1GUWA 3PREA 2I5MX 2KX3A 3ML8A 1PZJD 2Z8LA 3OIQA 2WV6D 3L16A 4KKUA 1HA5A 1CUKA 2BDNA 1KM7A 4HDOA 3C3LA 3U9SA 1HUMA 3Q6BA 1QVGA 4XWTA 2DY7A 2WX1A 1NVID 2PZTA 1D8LA 2BH8A 2KBNA 2C9OA 2PPHA 1V6EA 1FCCC 4DAVA 1PH9A 2X38A 1Y1WB 2CHXA 1RLFA 2R92G 1JCKB 4DF7A 3I3TB 3KF8B 4TQ1A 3CF5A 4Q2JA 4C2MH 3CCQA 2UU7A 1FIQA 3TP6A 1A0IA 1KAWA 4X62L 4L5RC 5DPSA 2HQLA 3HOXG 1QOGA 5FR6A 4LJZC 4NJ7A 3S1MH 2OCEA 1KLGD 3T51B 4YY3Q 4LF9Q 1I4GA 1MG8A 1XEEA 4FF4A 1SE2A 3K80C 1XCTL 3A9JB 1J0GA 1ESFA 1X6OA 1A2UA 1B44D 3JAME 3BWUD 1YNND 3CAMA 4ZKCB 2HE7A 1EIFA 3N1ZC 2O2LD 5C6AA 2AWTA 2BYEA 1FVIA 2WDTB 3A9KA 2OOBB 1WXVA 2GRIA 2CW0D 3HRDD 4C2MB 1WIAA 4F87A 3X0WA 4TUUA 4C4VA 2FXQA 3KF6B 3S2AA 3F8TA 3VTVA 2LGYA 4GU2A 2UYZB 5D14A 2NTSA 4RKLA 3CCJA 3S1MB 1V1PA 3RCZA 2LJ5A 1B7YB 3C1FA 2MA9B 2JRHA 4BY1H 2YEPF 4JBKA 3SFEB 3PRPB 4W9IA 2DJGC 4R4OA 3OW2A 4KGRA 4N59A 4PYUA 4M0WA 1J19A 1WJJA 1YX5B 4A3DH 1E24A 5CHWA 1K8AC 2JE6I 2KDFB 2NZ1D 2QGQA 1HTQA 1V43A 4UP9A 1X56A 3S2DH 1XYIA 3DHHC 2LVOA 2LI5A 4KV2A 3DVNV 3VRBB 2ZPNA 1WJ4A 3NPPA 1ENAA 1LT6D 2OWOA 4UY8C 1LM0A 1RL2A 4KGTA 3RN2A 2FAZA 4BY1B 1VQ4A 3JSVB 3FDTA 3U4VA 1SFOH 4MEMA 4OL7A 1PTOF 4JW0A 4WJ3M 4FXKC 2XGTA 1VQIA 3A8KE 3AE7B 3Q8AA 2O6VB 4JI0Q 4A3DB 4AUQC 4YSZB 3N6RA 3SK8A 3AM9A 4GMVA 2Q2HA 1P16A 1E10A 1SNPA 1STNA 3S2DB 1GO3E 3Q3JA 3OTOQ 4FO2A 2IL8A 4KD3A 1ACCA 3R66C 3QR8A 4H7BA 3VFKA 4RFBA 5LL6X 1LGRA 1TKYA 1MJEA 4Y52H 2KNBA 2CH4W 2A6HD 2UUCL 1V8CA 1NE3A 1MD2D 4NB3A 2P5ZX 1SFOB 3RD4A 1AWDA 2GBKA 2BS4B 1CZGA 3RULA 4BVUC 1XPOA 5C44H 1BQQT 1M90C 4XDCA 4ANWA 4DNIA 3V6EB 1C4PA 1T0RC 3U7DA 1SROA 5HHDG 2R7ZB 3CD6A 2SAKA 2NN6I 1CI3M 1FMAD 2WWZA 3PSIA 4DV0Q 3HOVH 1P0RA 1QT9A 1XPRA 2JA8H 3QIJA 3Q8FA 2IWHA 1O7ZA 1WI5A 2V4DA 1I4HA 2EYLA 1TT5B 2Z0EB 1J9OA 2I0QA 3LYYA 3O13A 1DOIA 3ZXRA 4TV3A 4G57A 3PIO3 2WX0A 1G6ZA 3HM6X 3QAQA 4IFDG 5C44B 4AYBE 1J7CA 5ELBA 1YJWA 3E0JA 4KSLC 2JU6X 1SIFA 3HK0A 5GQOA 5G55A 3VTWA 1QJOA 4LF4Q 1IBXB 4HSVA 4JWUC 5JHAA 2B2TC 1PHJA 4HIMA 3HOVB 4W9JA 1KF6B 1RFAA 1WYGA 2M8SA 4KY7A 1I4PA 2F0HA 3T3OA 1P3QU 3AMZA 3NZ3A 2C35B 3KK7A 1KDAA 4L8JA 1NR2A 4PMCA 1KRTA 3S1NH 2X8XX 3W1SA 3V62A 2F0TA 4WURA 2ES2A 4LTUA 2Z6KC 5CV8A 2I38A 2OTJA 2AUKA 1G2TA 3E6ZX 5FO7B 1WTHA 5JOBA 4BOSC 2V4IB 1VCIA 3PUZA 1WR6E 2L00B 2K6AA 1F52A 2KECA 4X66L 3J80L 1LTBD 1Q5WB 1ZW7A 3PCOB 4B6WA 4JI1Q 3SR6A 4FULA 4BKGA 3D8GA 4KLKA 1V49A 3S1NB 3FEWX 1HNWL 5GROA 1EY6A 2MO0A 1KLUD 2CQAA 1RAXA 5FJ8H 2NCNA 3DOWA 1V9JA 1E0BA 4KN4C 3CCUA 4UP8A 5IE8A 3L0WB 1N32L 1EWHA 2HHHQ 2NPTA 2LFNA 3TN2A 3GDEA 3UIOB 1D3ZA 4FF1A 3FPUB 4F1SA 1KH0A 3NJTA 3MTNB 5H1SE 1EQVA 1PH4A 4GKJL 4PS8A 5BYQA 4EQOA 4H02A 4TRDA 2ZVOA 1YX6B 5T8IA 3KW5B 4AOFA 4GLXA 3GTPH 1QB5D 4AYBG 1JWSD 2AQ3B 4LNIA 3E56A 2D0OA 3P1HA 3DBRI 4MM3A 1IW7D 2L4NA 1PH7A 4IUVA 4NXNQ 2HIVA 1RODA 1T5EA 1DOLA 3AE8B 5I6WA 2B8GA 2D62A 2PQAB 1E8YA 1C76A 2O4XA 4IUNA 3BY4B 2JPHA 3MJWA 3QWZB 2QW7A 2JF5A 3HFZB 3J81i 4JYAL 4DR7Q 3IFDA 1G2SA 3NTIA 3GTPB 1UWXA 4LMQD 3E5SA 1Z2MA 1CHQD 3IFTA 4GS3A 4DV4Q 4FXDA 2KJXA 5FLXL 1Q1OA 4OX9L 1HZBA 4YWLA 2N9XA 4YSYB 4IOCA 1PGBA 2YVCA 5C0XH 2WP9B 1GB4A 2BGFA 4HLEA 1K3BC 3DWMA 4AS1A 5C4XH 3IG3A 5EPKA 2IW3A 3LWUA 2RVLA 4BBSH 2LJIA 2WXPA 3NVYA 1T0YA 3IRBA 1IBKQ 4BY7G 5C44G 3J81j 2EYHA 4GOPA 1TBEA 1WSPA 3A1QB 1II3A 4A93H 1YN3A 1FGBD 3HHMA 1GNUA 3AE9B 4WORA 3VR6A 4MJSB 1G6JA 4YXDB 2A68C 3BYYB 2JA8G 5C4XB 3ZJVA 2R93H 4AQYQ 4DV3L 1H9RA 2M00A 3MAQA 4H13C 4NPSA 4POGA 4BBSB 4A3LH 2KDBA 1VCBA 2F0JA 2NVQH 1SE8A 1BDOA 3NWSA 3C0RB 3K0YA 1U4RA 4IKGA 3CIRB 4A93B 3BZCA 5I6YA 3RPFC 3MVVA 4US9A 1A70A 4F7XA 2NVUI 1H9MA 4K3CA 3PT2B 4A6QA 1SNMA 4X6AH 2BS2B 4GLSC 3IAM1 4A3GH 4NJ6A 2R93B 2YV5A 2ICIA 1IL8A 4QF4A 2WIIB 4KKTA 4NAWA 1SF0A 2D5GA 5HGQA 2NVQB 3G7LA 3SDZA 3V96A 2CW0C 3FPPA 3L4PA 3Q69A 1ZKOA 3MXPA 5M5YH 1XD3B 3VQIA 1FEHA 2RHQB 1ROEA 1Z47A 3FAHA 1BBXC 1PRTC 2N0SB 2WP8J 1YOVB 2KC1A 2VUMG 2WB1G 3AI5A 3RNEC 2LXAA 4N58A 4A3GB 1MSGA 3PLUA 5IA7A 4N9PA 2DN8A 1Y8NB 2LKVA 2SNMA 5TR5A 2PEAA 2CH4A 1YHBA 1VS0A 2R3ZA 4CKBA 2B2YC 2B39A 1Z9FA 5M5YB 2EMTA 2ZEQA 3KJOA 1J7BA 1EZ8A 4X3KA 3G6JB 4ZAIA 2KCNA 3S1RH 4ZYNA 2E8GA 4S17A 2EKIA 5CYUA 5HG2A 1Q1BA 3L10B 2F0GA 4JOIA 4JI6L 2FBWB 4MH0E 4BZAA 2D11A 4HKZE 5EGTA 3CP0A 1HFGA 2MNAA 2LS01 3S1QH 4OO1I 4W9CA 3RR5A 3TEHB 3BVMA 3H1UA 4DNTB 1GOZA 1T9HA 3S1RB 4P73A 3C1EA 1UBQA 1JR0D 1HQRD 2JA5H 2KVRA 2RHSB 2ZM6Q 3TZUA 3Q8CA 2G1EA 4WWNA 4ZLTF 4GDKA 3DVGX 5C3JB 1S5BD 1BOSA 2A6HC 2QILA 4O42A 4A76A 3AFQA 2E5LL 2KWDA 4IOIE 2KD0A 2I07B 1QQRA 2Z4IA 4GLAC 3H15A 4DV1L 5IIFA 4EE2A 4ICUA 5IT9E 1SAPA 3S1QB 4BXXH 2A4ZA 2LD9A 2EY1A 3NWTA 3S14H 5DAUA 4H44C 3SXHA 2N55A 1UGJA 1JWAD 3DBHI 3M7GA 2R2QA 3HM3A 3I2ZA 4M1UB 5FLMH 4KKJA 4RNAA 1P8LA 5FO8B 5TSSA 2V0GA 5JEAJ 4TQ0A 1E9MA 2JA5B 1A3UA 3NBHB 1T5XD 1SYBA 3NS8A 5J17A 1W2BA 1WWTA 4MIUA 4KN7C 1ZPSA 3TP5A 2Y3AA 2ZTEA 5IP9H 5EKKA 4JPBW 3T4AC 5IGDA 2JJQA 2R6GA 3HIZA 5DEHA 4N9TA 3CHBD 3S14B 4WWMA 1NMFA 4PZ7A 3CSTA 5COYA 4BBNC 1QG7A 2WYQA 3I63C 3AEVA 1JMLA 4LUVA 4BKSD 5CR3A 4DR4Q 2DBYA 2IHFA 5I9PA 1X3FA 1C4CA 1U4PA 1OXVA 1EFID 4NDXA 4DU9A 3AULA 3M9BA 2LHDA 4N9F4 4DN4M 1VZ8A 2AWOA 1Y8PB 3FKIG 3J80i 3WCQA 3QWNA 4B3SQ 3KLSA 1FNVA 2M9VA 5KNCA 1D2BA 4XXEA 1XJVA 2LZ6A 4K14A 5IN7A 4B3TL 3PRZA 4M02A 3DWAA 1X3GA 5AUIA 1EY7A 3RLNA 2IO2B 3H3VC 2KZRA 5FR3A 1PQSA 3HVDA 2OEOA 4C4VB 3DBRB 2N3SA 4FJZA 3HVZA 3CC2A 1V1PB 1WCMH 3R3MA 5F2DA 1L1OC 4PK1A 3B2GA 1EIHA 4LF8Q 4LF5Q 1FFVA 3W9CB 2EJGC 2H88B 3BS1A 1E1OA 2KCCA 2ZTDA 3D4WA 1JWMD 3VA5A 2UXBL 2ZZPB 4M0WB 4BFRA 4LDTD 3S9WA 3APDA 1RHPA 3GTMH 3M85A 4AJYB 3HOYG 1FRRA 4DK1A 1ONLA 2KUMA 4WIPA 3ABVB 4GIVA 2NZHA 2QEJC 2D5DA 3BDCA 4PZ6A 3DHIC 3MWYW 3N32A 4A3MG 4CJ0B 4X65Q 3CPWA 1QOBA 4GDLA 3HZXA 3H6NA 3GOEA 1IBXA 1WCMB 5MPOA 1U4AA 1EYDA 2IX1A 1S5CD 3DEPA 2PIAA 2BYTA 1H4RA 4K2LA 2KN5A 3AEEB 3K0XA 2QCPX 5M5WH 2DZMA 2WU2B 4OWXB 3V3XA 1I4RA 1S3SG 2MO1A 3GTMB 5BN3A 2JWUA 4AP4C 4GKKL 4L6TB 1WTQA 4URKA 1HNXL 3FC4A 3PUYA 3CRLC 1VQCA 1ML0D 2K6DB 1TWHH 1YEZA 1XNRL 1A2TA 2K14A 3DHQA 5IODA 3BDOA 1V5OA 3R7QA 1F2MA 4RGMA 5M5WB 1XMQQ 3PPAA 4DR3Q 1HRJA 4IFDI 2KVMA 2FNJB 3QCAA 2ZW0A 3GE8C 2B2WA 4WJQA 3SD5A 1WTWA 5IYDG 2UXBQ 3A8JE 1K8MA 1C7YA 2KMAA 1LT4D 2WAQB 4TMAB 1PVOA 1JE5A 4IOAA 1EM7A 3PUWA 1TWFH 5JAVA 2K1FA 2KOXA 3KVFB 4S0RA 1TWHB 3E9SA 4B3ML 3ZIMA 1WRIA 1Z7TA 3AB5A 2JA9A 2TMPA 4HCSA 3H9DA 1QNKA 4RGOS 4GSWA 3IAS1 1VQ7A 4MZ9A 3I91A 3VDYA 3BVZA 3I4MG 3KDFA 5M5XH 4BKSA 4RM8A 1UD7A 3QOLA 3DHGC 2AQ1B 5DPRA 3UI3A 1TS4A 4LK0M 1E22A 1UH6A 4PZ8A 4FHJA 1B70B 2N7EA 1B9MA 1KRSA 1TWFB 1PH8A 2W55A 5CTRC 1E7ZA 1D4BA 4KSKC 2JP1A 3Q6SA 1OXSC 1C77A 5CV5A 4YT0B 1JWUD 3OSOA 5KHQA 1HCZA 3NK9A 3V61A 4JI7Q 5M5XB 1XNRQ 1WOCA 4LAAA 1B53A 2ATWA 2BA0A 4C3JG 1F2LA 3BINA 4CDCC 1C79A 4Q5VA 4P75A 4IUMB 4ZRKA 2B3AA 1HE8A 4FBJB 4HCEA 4DUYL 4C00A 3K6OA 2O5IC 1AE2A 1Q10A 3N20C 2IPKD 2LXKA 5LMNL 3OPOA 2JWZA 3ZNHB 1Q3LA 2NWGA 4RHSA 4JI2Q 1C8CA 2G3QB 3NTKA 3EECA 3PHXB 1KJTA 4Q0FA 1WD0A 2N78A 2WXGA 3RZFA 1B50A 3RFZB 3N1YC 3QB3A 1GC7A 2D3BA 5A2QL 1JOOA 4K1RB 3L08A 2ONQA 3P7JA 1EEID 2R92H 2JVCA 3IAYA 3P4RB 4ZUJA 1SYEA 2QA4A 1WX7A 4XQJA 3AN1A 2NS5A 5GAGC 4JV5Q 5CBEE 1VQOA 4B3RQ 3HOXH 1KRHA 2EXZA 1C48A 1WMHB 4JIOU 3I8ZA 1Q7YC 3M7NA 1OXXK 2MBOA 1STAA 2IY5B 4IM2A 4RMAA 2OF1A 3DLLA 1BT0A 3EFUA 3T1YL 1F1HA 4A3IG 4RF0A 4GN1A 4MM3B 3RNBC 2JN4A 1BKBA 3K58A 2R92B 2EJFC 3CMEA 2M17A 2V3SA 2YYZA 4PS7A 2VZAA 1WGRA 3ZDMC 1R4QB 5IT9c 1HR0Q 2GBNA 3QK0A 1TZ1A 2F0VA 4D2KA 3GTQH 3HOXB 1EF5A 3NQIA 4PV1C 3MTSA 4U673 3CMMB 3I57A 2JYOA 3ERQA 3I70A 4PMBA 3KUZA 3C19A 3NZSA 4LJPB 2M0XA 1LXDA 3QJZA 1PH6A 3FILA 2EOTA 1IGDA 3TEYA 1J5EL 2ON8A 3STBC 2VNUD 1EY9A 2OJRA 4IWOA 5LMNW 4ZKBB 2QDLA 3EFXD 4FYDA 4HMIA 1K9MC 4IDIA 1PMRA 3ZRFA 4FJVB 4ACFA 3GTQB 2RSUA 1EUJA 1YI2A 2L52A 2ACZB 5FKAC 5C4HA 1DOKA 3A5ZB 1OFFA 1FO4A 5LXIB 1JOQA 4DV6Q 4GOPB 2Y5PA 3LXFA 2MBEA 1B8AA 5JH5C 4LW1A 1NSNS 3G48A 4KJNA 2JZZA 3B0AA 3KYDD 3P42A 4FHKA 3HGBA 2ZNVC 3QHTA 1QOHA 1LYLA 1K50A 3LWEA 4DHZB 5I2XA 1AH9A 1FFUA 3RD2A 2NVTH 4AJWA 4LUZA 3A4SC 1UZXB 2G9DA 3EBEA 3T1HQ 4GN4B 1ET6A 1ASZA 2I1JA 3HP3A 1ICWA 3LX0A 2DNCA 2Y5CA 2Y5BB 1G8ZD 3EHVA 4QUFA 4YL8A 5BMIA 4EX5A 2IY0B 2FCQA 3NSWA 2UXDQ 2QIEB 4JX1C 4HMJA 1FJGQ 1EL0A 3TIXA 3RYTA 3P20A 5HI1A 3RNGC 3D0FA 1BMLC 2WKDA 1RFKA 2H89B 4YY3L 1Q8IA 3AU7A 1FCLA 2NVTB 3F1ZA 2KFKA 3R7RA 5C2TB 4ZOHC 3DVGY 4NAWB 4GLVB 5L83A 4P7IA 4WRDA 1EYGA 4DDID 4DHJB 2FFKB 3PGZA 2EYOA 4S3SA 4XQNA 1HTPA 4II2B 2RCNA 2F0IA 1Q0WB 4W9EA 3AEDB 2QDBA 1EWYC 1LLRD 1R4NB 1A63A 2IO1B 2RA4A 3F2UA 1T0QC 2KHJA 2KO3A 4K5VA 1IGCA 3H6MA 1GD7A 2OJWA 5J18A 2VB3X 1L6UA 2VZKD 5KEEA 2WU5B 1WXQA 3J81E 3NBHA 3HRZC 3BK2A 1WM2A 3CCSA 1LTID 1VQ6A 1P98A 3NUHB 5JPMC 3Q3FA 4USAA 3AH7A 2K5HA 4F8MA 5BO4B 3PSEB 4KHZA 2IBIB 1RCVD 2F0EA 1KOTA 3EJIA 2VL6A 2UXCL 2MBQA 2Z1CA 1A8VA 1YN5A 2DZIA 2ZW1A 3AU4A 3T8MA 2A68D 3DXJC 4KY6A 5CV7A 3N3KB 5ELFA 4ZRIA 2MQJA 2L15A 1QUQA 2AYOB 4WJNA 5T1IA 3SHLA 4YSXB 2PZUA 4IM3A 1QVCA 1TWAH 2SOBA 2INNE 3T53B 3GD7A 2NVXH 4DXAB 3R8BA 1Q12A 5AZFA 2EYFA 4YWMA 2HJ1A 2N7JA 1STHA 4FXCA 2WXOA 2JSVX 2Q8RE 1N33Q 3WAOA 3AEBB 2JXMB 4ANXA 2K7VA 1XQQA 1CA6A 4FN2A 1SNDA 1OXUA 4JI0L 1PYWD 5E4WC 2BKFA 1YQBA 2K0PA 2PI2A 4G3XB 4WWOA 1SNCA 4IG7B 4F88A 2IZVB 5DPTA 1YQ4B 3B1LX 1NYRA 2B63G 3OTOL 2K5QA 1ZUD2 3AE3B 5EPJA 1FXAA 1TWAB 2BDOA 5C0XI 2NVXB 3QX1A 4GDKB 1VQ9A 2E2IH 2B2VC 4E6IA 4R9WA 2HDEA 4HPMB 3WANA 4KKIA 3VYSA 2MHVA 3AE4B 4OELB 1W6JA 2O5JC 3CQZH 1VMPA 2D07B 3U30A 4JCVE 4YHHQ 1PRTD 1X32A 4KDLB 1GHJA 1HPCA 1A6XA 1WFQA 1FRDA 1I4QA 4WAAA 2MSED 4IPGA 3WOFA 1CKNA 1MI2A 1H9SA 4OIKA 3G6EA 3ZYYX 2JA7G 2WXJA 2UXCQ 1C3TA 1YN4A 2INPE 1RWSA 1ZKHA 4OVVA 1X3PA 4DV0L 2RPVA 1SXTA 5JJIA 2EDGA 1CSPA 4POFA 4HXDA 2V4LA 1UBIA 2WXIA 3CQZB 5J39A 4ZRJA 3EIVA 1OTCA 3WAMA 3LGJA 1NR4A 1C4QA 5ISRA 4HJ7A 1N34Q 3BZDB 1TWCH 2RKSA 3SR1A 3K59A 2DLBA 3AE5B 4HEA1 1EOVA 4I7ZC 4LF4L 2AEHA 1DOMA 1X3QA 1WM3A 2W9NA 1WD1A 1LM8B 3BZKA 3H09A 4G4KA 4AYBB 2PTLA 5HKHA 4DA2A 2L7RA 2UUAQ 3A7LA 3NHEB 3CXCA 1HNZQ 2N7DA 1B4OA 4W9DA 1K53A 1SJED 1TWCB 1VQMA 2F3WA 2KHIA 1XT9B 4NPNA 1QLBB 2LGSA 1EFWA 4OWWB 1QZHA 4BY7H 3HOZG 1F9JA 2X6GA 5DLQE 1JMCA 1VQ8A 4B0MA 2ZXRA 4KI0A 4OHJA 3T13A 4MH8A 1OQYA 3QA8A 4JI1L 1L2NA 4OZBA 2QHOA 4XWWA 2VS1A 3EGRA 3Q8BA 2M1MA 1TVXA 2CWPA 1WZ3A 1SMXA 5J22A 1XLOA 1KXLA 1NI3A 3A8IE 4KD4A 1O7YA 1WR1A 1Y8OB 4C56C 4BY7B 1MG4A 3MC8A 2HHHL 4W9LA 5L95C 3P4SB 3L9AX 4K81A 3AB9A 3BK1A 2KLGA 2OHFA 1YJJA 4A3PA 5C3XA 2MWSB 1P1AA 4KY5A 4BKTA 1HEZE 4R4IA 3NZUA 3M63B 3PRMB 2JA8B 5IWAQ 1K28A 4CO7A 4J15A 2KAJA 1PFSA 4JI4Q 2KMCA 5CV9A 4L5SA 4J6IA 3L7ZC 1E0ZA 2L9HA 3AXCA 1PLFA 3JC66 4NXNL 3JW0X 2F0PA 2VB2X 3U8ZA 4NMZA 1N5XA 2INDC 5IGFA 2A19A 2G9HD 4RHRA 1E7PB 2LFIA 2QMTA 3B6YA 3TMEA 5JEAG 1TS3A 2VUMH 2EJMA 1L0XB 4DK6C 1EO6A 1ET9A 2KQSA 3ZNID 1VQBA 4DR7L 1B2TA 1GJXA 1CQFA 3ZO5B 2IJ0A 2HDMA 1GUSA 4DV4L 5EBCA 1I50H 2XWBB 2L1AA 4II3B 5AJ3L 2DNEA 4JE3B 3J80E 3FRPB 3KOJA 4ASWC 4PQXA 2MP2B 1H95A 2PW7A 3MXGA 3PUVA 1IBLQ 3HS0C 4P6VF 3H94A 1WRDB 3PLVA 5KYIA 3HOWG 2WB1B 1L0WA 4ID6A 2VUMB 5CGKA 1HA6A 4A3FG 3ONAB 4A3CG 4QCLA 3TL5A 3SU8X 1IBMQ 1IBKL 3TCAA 2F0NA 5G3LD 1IPGA 1Y8RC 1K8OA 3QG1A 1TXYA 2WDVB 3UQAA 1TTNA 1I50B 3KDFB 5HURA 2Q8IB 2JYTA 1WMHA 3ZJUA 1GUOA 2MH7A 2DZKA 1Y1VG 2WDQB 1D5XC 3OLMD 3CF6E 4DUZQ 1NYQA 3SK4A 5KRUA 1IYJB 1K8GA 2YEPB 4JQWC 5IOIA 4AQYL 4YCUA 1PH2A 1E7VA 4EUTA 1OTRB 1PTOH 4KVGB 3HKZE 2DUDA 4DR6Q 5ELDA 1QCBD 2MGSA 3AFPA 5K36G 1KAAA 4RA8A 2UU9L 3E9HA 1I35A 1KL9A 2Z9HA 1XMOQ 1V2YA 1STEA 2M2LA 3LNNA 3EUB2 1SSOA 5KIXA 3J81c 2NVYH 3ZLZA 4IALA 2JX5A 5IP7G 4NKLA 3D4RA 1VQHA 5AJ3Q 2C7MB 4A75A 2KDMA 1I6VC 3WOEA 2K3UA 1SJHD 1PTOB 2WB1E 3P4QB 2C7HA 1BBWA 3KUCB 5FLXE 4J6HA 3ICEA 1JJ2A 1SYCA 2EY5A 5NUCA 4HSPA 4I6LB 1EY8A 1VLBA 2RDFA 3L17A 1N8RC 4LDTB 4R3DA 2WKCA 2Q2TA 3A55A 3H0GG 2D0PA 1OQRA 1GAQB 2WFWA 1X1MA 2DYBA 1E3PA 1N63A 2NVYB 2XRSD 3CCVA 5IYBG 1E8WA 2C5LC 3TQYA 1LT3D 2JXTA 2IX0A 1V81A 1PH3A 1XLQA 1JROA 1TS2A 4HIKA 1DCZA 1S4ZA 4ME3A 1ZYRC 2LVQA 1HXYD 3I4NG 5EPLA 4JK1C 1MBYA 1Y56A 3FKIH 1BCPC 1OXTA 3BDLA 2IGGA 3FKYA 3OHXC 1WGDA 4JBMA 2LWPA 2V1CC 5HFYA 4BA1I 2IX3A 4GN3B 4C3HG 4K7SA 4KIKA 2UU9Q 4GN5A 4DR5Q 3RN5A 4P74A 1V86A 1TJEA 5M3MG 4NW2A 4HJGE 1I42A 1MI0A 4LNNA 4HJ5A 2K1BA 2FHTA 1W3SA 1TT2A 3HKZG 4E74A 3RZDH 2J0TD 3G4SA 2EKEC 2KX0A 3K5NA 2LHEA 2LMCA 2MEKA 3DVNU 3FKIB 2IO0B 1N9WA 2IHEA 4O0AA 1D6EC 3JAMi 2FCMA 2KC2A 3WDNA 1X3EA 3R2IA 2MRPA 2VQEQ 2ZM6L 3FILB 1L1OA 4RWSC 3NS1A 4MSMB 2KWVB 3EFCA 4RAUC 4MGIE 3P75A 1NJIC 2E2HH 3HOYH 1NAPA 1YNJC 3K5LA 1WX9A 2BWES 1WH3A 4MHEA 2BTEA 3ND9A 2EVBA 4IN3A 1WE6A 3PIPA 2GOWA 1DONA 2KFJA 2O6VD 2K28A 2FJ2A 1XTCD 3RZDB 4A3MH 1G291 1VRAB 3KWLA 3G71A 1QZGA 4EOYA 2R61A 3BYTB 5FO9B 1RKNA 4ME5A 4X3UA 3ULJA 4F7ZA 2LRUA 1CKMA 4QAYA 3NTHA 4V190 3ZDTA 1IZ6A 3Q0AA 2H5XA 3DWGC 3EA6A 3PO0A 1SBBB 3WA0A 2K8HA 3HOYB 4DK0A 2E2HB 1MKHA 2KTRB 3NELA 2GN5A 4YCWA 1G91A 5CV4A 3GTOH 4L5TA 5JJZA 4A3MB 1K8RB 1RDPD 2ZVNA 4NZLB 3ZJYC 2WNMA 5HY6A 4ZHPA 4A3BG 3E9IA 1WTRA 3K9OB 2NBVB 1AEXA 4DR4L 1QILA 3E0EA 5LMUQ 1FPYA 2L0CA 4MELA 4DV2Q 2AUJD 2B8FA 2JY6A 4JBWA 1K51A 2DWQA 2HCIA 3TSSA 1SIJA 5IYDH 2KFKB 5ELNA 4B3SL 3GTOB 1S5ED 2FMCA 2QSDA 2XRQD 3EROA 2OT2A 1Q81C 1XXGA 3PF4A 3STBD 4MDKE 4ITKA 4WFN3 3T3NA 1C4AA 4IC7B 2BYVE 3SE0A 1F9PA 1CT1D 2K03A 3I4MH 2FIDA 1V5TA 1G6PA 1WXAA 4FADA 2FIFA 1H9JA 2J0JA 1M8AA 4JBJA 1V80A 4LF8L 5J1ZA 4LF5L 1L5PA 2F0OA 3DBSA 1EY0A 5CBAE 1B1ZA 1AN8A 3AMUA 4QIWE 1P7EA 2ZCCA 1CSQA 1P9DU 2CJNA 5IKCM 2F0FA 2K32A 4LF7Q 2AL3A 1QUQB 4HCNB 4K0KQ 3I4MB 3K9PB 2EELA 2VH1A 1PRTF 4YCVA 4X65L 1PGAA 4A9AA 3L2PA 4C3JH 2SNSA 2PNRC 3S16H 3PO2G 4DKAC 3GP7A 2ZCBA 4KKSA 4HKQA 2ALYB 2L0FA 3D31A 2WHIA 3T9LA 1PDXA 2B29A 1TIID 2UUBQ 4HPLB 2A73B 3VYTA 3J80c 1VQLA 3AEAB 2J0KA 3X23A 3DQVA 4TQUS 3GTKH 4OGQC 2V3PA 2JUOA 4JLCA 3UDGA 4HIDA 3X3MA 4C3JB 1ASYA 5D65A 4GNXC 3S16B 1EQQA 4LCDE 3I72A 1WI0A 2H1EA 2GVAA 2MQHA 1XMQL 1ENCA 4DR3L 4PMWA 1R4PB 1VQJA 3NVZA 5D94A 2JA6G 1ZDXA 4DR2Q 5JVH3 1OEYA 3LJ3A 3Q3MC 3V60A 5LXHA 1CZPA 3I4OA 1CKNB 1FXIA 1H9SB 3VYRA 3GTKB 1OQQA 4HDQA 2MCNB 3AV8A 2PE6B 4A3IH 1ZP0B 4O2DA 2M19A 2CKHB 5H92C 1OEYJ 4IJLA 2JEBI 4LUOA 2GBRA 4HWIB 1EYAA 2GLSA 1N62A 1K73C 4IW0A 1I94L 2JQOA 4NQKE 1RF2D 2KA7A 2HCCA 2MJEA 1VDZA 2PI2E 1CTMA 2KQ4X 2BBCA 2LXJA 4WJPA 4C7YA 4ZHOA 2J53A 1LUZA 1GUGA 2ICEC 2OQ0A 4ABNA 4MN3A 1R4NI 2A6EC 3VR3A 2N4FA 3K5OA 2OEDA 2EY6A 1YMHE 2I46A 3SHQA 1F2YA 2FMMA 4BS9A 1PDQA 1F9SA 4A3IB 1MSHA 1TY0A 3U4EG 3CCRA 1BNZA 4JI8Q 5L37A 3B9JA 5FLXc 2MW5A 4EVOA 3U2SC 2HJ8A 3MEHA 1WTXA 4IPCA 2K33A 2KCMA 2H4OA 3VYUA 3MFYA 4IO9A 3C2PA 5EKLA 4LF6Q 3ML9A 3QARA 4JI7L 2VQFQ 3ZW3A 3J7ZC 2NN6G 2XIWA 3W5OA 4BBNF 2LASA 3I7FA 4IJHA 3BJUA 1K83H 3NE5B 3HEJA 1S5FD 1JRPA 2BWFA 3SK5A 4QQBX 3NY5A 2YTVA 1C78A 4UPAA 2AWNA 4DWFA 2HT1A 1WTPA 2LSSA 1GG3A 4B9XA 3J7A5 3MXUA 2MP2A 3GS2A 3H7PA 4JGHB 3U7ZA 4OZCA 1XTDA 2Q2UA 4JI2L 3S15H 2DAJA 3VR9B 2L5TA 3NENA 1T3QA 2L05A 4JI5Q 2L3ZA 3PO3H 3CWIA 1DJRD 2KEDA 3GTJH 3OAWA 2NZOA 1KFYB 3HG9A 1F9RA 1K83B 4Z9CB 4EZLA 1I94Q 3DM3A 5BR8Q 4FJYA 2KQ7A 2KDEB 5JJKA 5H8YE 1A5RA 3IT6B 2AKWB 4IZ8A 1WYDA 2XWJB 4DR1Q 4KTAA 3AU5A 4LFCQ 2W3SA 3PZDA 4K7UA 3TP7A 4JV5L 3OG5A 3C46A 2F0MA 4B3RL 1CHPD 3S15B 1JOKA 1T6BX 1LTTD 3FP9A 4X3TA 1EQTA 3PO3B 1NENB 2PNHA 3GTJB 2XEWA 4JL9A 3PIP3 1YNTE 2F1MA 3MHZA 4X3SA 2KCTA 4O1NA 4CDDC 2PPBC 2NBUA 2ASBA 1E7UA 5KYLA 2ZJRA 5E6OA 1V97A 4BA2I 2XTIA 3OWFA 1VQDA 5G3LF 1V9PA 3RT3B 1HR0L 2NR2A 1MIUA 2K75A 1VJKA 1C0AA 5E7NA 4RGTA 1GUNA 4GZYC 5CORA 1NUCA 4JWSC 2C60A 1LTSD 4NY0A 3DM1A 1PRTB 1MHXA 3I90A 4ZRZA 2L32A 3CKIB 2CR5A 5C5MA 4REZA 2I5LX 4FNFA 4DAMA 1JWBD 1T0SC 4A3JG 3H7SA 1C1YB 2F0DA 1E8ZA 4QUCA 4A20A 5IY0A 1R9TH 2JXXA 5D3IB 4C1NK 3T16A 1WJNA 2K04A 2IO3B 2YLMA 3UF8A 3Q8DA 1NTGA 4KHPQ 1L4ZB 2QC8A 2RCFA 1Z5SB 3RNCC 4P71A 3BVGA 3PZ8A 1PXUA 2E2DC 1YZ6A 2G5DA 3D6CA 3KJPA 3HOUG 2I2YA 5A2QE 3ERSX 4OEMB 2L8JA 2BVCA 4DV6L 2B2UC 1AZQA 4NXMQ 1XNQQ 1UWMA 3AEGB 3GZNB 4K6DA 1HHVA 2C5CA 1H8CA 2CFMA 2WDRB 1J8CA 1QOAA 1TGZB 1CKOA 1R9TB 1EY4A 3ZGZA 1F2ZA 4M8AA 1KD1C 2B63H 5AFWA 3M3YH 4N8X1 1NI2A 1JE4A 2F0QA 3T1HL 1JB3A 2R7DA 3MEFA 4JI3Q 3RNFC 2N88A 3TRZA 1HTLD 3PVLA 2F0KA 1V8QA 4LFAQ 3L3OC 1C9OA 3JVZX 2B2VA 3Q24A 2WGSA 4M01A 2I5HA 1ILQA 4ULLA 2UXDL 4W9GA 1FNWA 1FJGL 4ARIA 5GADC 3OJ3A 3TS0A 2B63B 2N1WA 3T56B 2JA7H 2BCOA 2OXPA 3AQQA 3K7UC 3M3YB 3APCA 1VR9A 3DBLB 2F0WA 4C1NI 4KK7A 4LNFA 1F2RI 3NXWA 1M1KC 3ECIA 2Q8TA 1XCQL 2VRRB 2BW2A 1A62A 4WJ4A 3PV1A 1I6HH 1MGSA 1VQFA 2LEKA 5C3EG 3RLFA 3MP9A 4DXFA 1LFDA 3PIOA 2BT6A 1L0VB 2PYKA 4R4QA 1HTOA 1ZGUB 2MLBA 4GOCA 2J42A 1N5WA 2JZPA 4WQOB 3EVQA 2K5WA 3KUPA 2JA7B 1TS5A 2KWCA 1GJZA 1YHQA 3VUWA 2KJHB 3IL8A 2FE8A 4OVUA 1ESRA 5BMGA 2FUHB 3PTFC 3VH3B 2INCC 1EWIA 4C80A 4KV6A 4PT5A 4M00A 3VAWA 1NY4A 3H3VH 2BKRB 2KTRA 4APVA 1CA5A 3PO3G 4C3IG 4R8NA 3D3RA 3OMCA 1I6HB 2KMMA 3U58A 1YJNA 1PA6A 1PV4A 1AZPA 1VQEA 1QNUA 4YTNB 1K0RA 2G4SA 2F0LA 2N1VA 4LFBQ 4ILWA 4KIKB 1TZOA 1ZXTA 2B2WC 3KYCD 3ZVVA 4CDEC 5A35A 1K52A 1OGWA 2DENB 1UF0A 3VHTC 1MHHE 1N33L 3NBIA 2EIFA 3HOZH 2PMZE 4XT3B 3TEZA 4XYQA 1RTNA 3EQLC 3DMUA 2JQRB 1VQGA 1SNOA 1HZCA 3M4QA 2LMCB 3QIAA 1NCVA 5IGEA 1DOXA 5IGBA 2LGDA 1WJ6A 3RUZA 2QCZA 3P2BA 2Q2IA 4L23A 2K22A 3ENEA 1L1OB 1HJPA 2Z0SA 2F4VQ 4DV7Q 2PE9A 3H91A 2MJ3A 2D2CC 3HOZB 1E1TA 3I73A 5E6PA 2Y0SE 5JHBA 4YHHL 5KGUA 1QZEA 3SGIA 3ZTCA 1EWCA 1MFWA 2KTFA 2NUCA 2K4KA 1Y14B 5CV6A 1X54A 2E76C 4RCNA 1YIWA 2OQKA 1SE9A 3BG3A 2ZTCA 2K9XA 3Q2AC 3VR4A 2B2TA 3Q22A 5EE3A 2CHBD 2DZJA 4DV5Q 1IYUA 3J9CA 1ZYRD 5JPNC 2BA1A 2DJFC 4K6LA 1WTOA 4OO1G 2RDBC 4HROA 3LDZE 4J3OD 1F9QA 3UI2A 1KIXA 2EMSA 1HZ6A 2J52A 1BCPD 3UDXA 1AYFA 4OVZA 1AE3A 1PTOC 3SFDB 5GXGB 3RMKC 2EPBA 4MT5A 4IUTA 4NAMA 1N34L 3KBGA 5JEAH 1FM0D 1VQAA 1ZE3D 3HUIA 3FMCA 5GAEC 3PUXA 3SDLC 3ALBA 3VUYA 1D1IA 2Z6KA 4KMUC 4A3KG 2GVBA 5D6JB 4MTKA 1EU3A 2ASQA 4P1BC 1S3OA 3QJYA 4MGYE 2UUAL 4OXPA 1LTGD 2YTYA 4XYOA 1HNZL 3V6CB 1Q90A 2RD0A 1CJEA 2VH2A 3GO5A 2EZVA 3HOWH 1I7HA 2Q5WD 4A3FH 4A3CH 1K0SA 3P1MA 2LY7A 1YNJD 1N36Q 4ICVA 4NJCA 4J8QA 2I1KA 3AE1B 5BN4A 1UE1A 1FD6A 3JAML 3NUCA 5E6JA 3L0OA 4JG2A 2WXQA 3MC9A 1G51A 2K39A 3VA7A 2MUYA 2ZXPA 3A33B 2D10A 1Y1VH 2KKCA 2Y0SG 1JW9D 1NBWA 2E2IB 1TKGA 1TKWB 3W1GA 3UDFA 3TS2A 2E2JH 5DNFA 2VY3A 4HRSA 1CM9A 3HOWB 2GBJA 1EYCA 4A3FB 3OMGA 1DD2A 1RM6C 2J0MA 2KHWB 4HVBA 2L11A 1EZ6A 1Q46A 5K36H 2HDLA 5CC4A 5AZHA 1SYFA 3VDZA 1BUVT 1N60A 4P16A 1U0LA 3MC0B 3VTUA 3DWQA 1XPUA 3TP8A 2KXJA 1RJTA 1KDBA 4FP5D 3SVMA 3KQ4A 1Y1VB 3P4PB 1SLJA 1V1OA 2QJLA 1FD7D 1SSNA 4G11A 4BWGB 1WX8A 2Z59B 4BBRG 2E2JB 5IWAL 1GM5A 1B9NA 5IP7H 3I9V1 3ZXVA 2Z4HA 4JI4L 1HZ9A 3MZ5A 2M56B 2QDFA 3IHPC 4EFOA 4EEWA 4N6EB 4G50A 2WXLA 1AP0A 1FL0A 2EYJA 4I65A 3ZTDA 1SE4A 1SMYC 3NP8A 2LVPA 2JSOA 2RF4A 2E3TA 3ZRCA 3CC4A 2F03A 5I9OA 1ZDVA 4X62Q 4A3EG 1JT8A 1RRBA 3K81C 1JRUA 3H0GH 3OW7A 1L7YA 1SRUA 2SEBD 5EE9A 3NQTA 5IYBH 1YQ3B 1U4LA 2D3GA 3I56A 3QO2A 1Q8KA 2R7ZH 4QJFA 2CHZA 5C4JH 2N49A 4YWGG 3I4NH 1FR3A 3MHBA 5C23A 2Z6BA 4HTHA 3UGBB 3VRAB 1YD8U 4KJOA 3RN9C 1DGJA 4AH6A 1IBLL 4FLHA 2CS4A 2UWQA 3H0GB 2KJRA 5M3FG 1IP9A 1TYGB 4I6NB 1IHZA 1EOTA 4R4CA 4C3HH 1GC6A 2L83A 3MXNA 2EY2A 2N8NA 5BN5A 5M3MH 1IBML 1IKLA 1RD9D 1L0YB 1EY5A 4QGUA 1X9NA 1BXTA 4MGZE 2XVSA 1UNSA 2K01A 3CCLA 1L4DB 5C4JB 4JVZA 1NBFC 3I4NB 1WYWB 2VW9A 1E5WA 3KUDB 1LO5D 1MHWC 3ND8A 3M95A 3WALA 4DUZL 1A3VA 2Z0DB 4P2CB 3CPFA 3PZ7A 4HN7A 4KZCA 2KEEA 1N61A 4N8FA 2G45B 1Q86C 4IWQA 2G4DB 4DQOC 4J1MA 2K8BA 4QMGA 4ZUIA 3IBEA 4M8NA 2F3VA 2NB0A 4NP5A 4C3HB 2WLBA 3RZWC 1Z6HA 4I7AA 4DR6L 2PMVA 5M3MB 1Y1WG 3S2HH 2R2OA 4XX5A 4E3CA 4UP7A 1K3RA 4XIGS 1TR5A 4HJ9A 1VD2A 3HKZB 4DAPA 2JK8A 3OIPA 3PV0A 1XMOL 1AARA 2DAFA 1E8XA 3L13A 1SE3A 2D2QA 3ZKJC 3AECB 4K8IA 4CHTB 4RKBA 5T1GA 4HCPB 4EQPA 1KNAA 4CGYB 3KLRA 3H7PB 1A3TA 2B2YA 3S2HB 2D9UA 1PUTA 1LABA 4DNRB 2GI9A 2UUCQ 1YIJA 2K5VA 4CJ1B 1HQMC 4RF1A 4PYZA 4XE0A 3RNAC 4RCOA 1PFMA 3NRZA 3UE1A 2F0SA 2PLPA 1HUNA 3A5UA 4UAIA 3KH0A 4A3BH 1LT5D 4FA6A 3Q8EA 3A74A 2A5UA 3R2TA 2ZJDA 1VQNA 1GPXA 2DHZA 4DHJD 3U9OA 2CHWA 1PYBA 5G2NA 5GAHC 2K5DA 3TBLD 5KNDA 2RGFA 1J6QA 2A6ED 5C3WA 3IXSA 1PH1A 5IP4D 3DDCB 3ITPA 1V1QA 3N52A 1KQSA 3UINB 4IM0A 1XLNA 1Q1EA 1F77A 4A3BB 3RUIB 4DR5L 4BY1G 3F2CA 1CZWA 2XK5A 2A8VA 5G5GA 2JYEA 4A3DG 2MP1A 1WE7A 3N9YC 4OWTB 2J7ZA 1YJIA 3W1YA 2DY8A 1SB3C 1JJCB 2VQEL 1YJ1A 3D32A 5M9OA 3N30A 4E71A 4W9FA 3CSFA 2O2VA 4IQZA 3KBXA 4EQNA 2IDYA 1XX8A 3K7AH 1EIYB 4KGSA 3NG0A 2CKZB 2N9PC 2DYOA 3ZNGC 4X66Q 4XTCS 3RNUA 3NOBA 2V3NA 1JJGA 1EU4A 3D4DA 3SK6A 3WAPA 4DXGA 2CU1A 1UGMA 3PO2H 4G7ZC 2R7ZG 3APFA 1HNWQ 2JRIB 1DGSA 1WY8A 4GDLB 2K8CA 4CJ2C 2A69C 2WXNA 2BE5C 3KLWA 2EYPA 2PW9A 2E6XA 5BYRA 1N32Q 3K7AB 1NDDA 4B95A 1DYQA 3KFUA 4L63B 3C8YA 3NHHA 3FHWA 4RMFA 3ONSA 4MGKE 2HTME 1CK1A 3J7YW 4GKJQ 1RTOA 3PO2B 4HK2A 5IOCA 1ENFA 1GUTA 3IFWB 5LMUL 1SYDA 2HTHA 4MSQB 1WGGA 4IWPA 4WAFA 4DV2L 4GNXA 2C7NB 4HEDA 3AEFB 4CYEA 1LTAD 3SEBA 3HOVG 2QKIC 4HIOA 3EC8A 3LB8C 5DPWA 4WJWA 2JA6H 4EQ5A 4LK1C 3OYYA 1BBUA 5DM73 4IPDA 5G5HA 4HPPA 1CFMA 2PQEA 1X65A 3JAMc 5IGGA 5EJWA 3IVFA 3UDIA 4DK3C 2LUEA 1M4VA 2RSNA 1IYFA 1VQ5A 1PGXA 2WXHA 3RI7C 5EKIA 4EKUA 4H0LC 1R7SA 4V0BA 4JYAQ 2D3AA 4XZ4A 5IAAC 1YVCA 4YTPB 3GV3A 3S17H 3I5JC 4OX9Q 1STYA 3K8AA 3OOCA 2JA6B 2WXKA 1KC8C 4ANVA 4EZJA 1YNNC 3W1SC 1BVSA 3TDQA 2ZPYA 2CQOA 1EF1A 4NNJB 3VR8B 1UAPA 1VDVA 1JB7A 3TJPA 3CU7A 4KZ0A 3I55A 1DXMA 1O80A 3F2BA 4I6PA 4FDBA 3CCMA 4CKEA 2IYDB 3CRKC 4DAYB 3CMAA 3DCGA 2F4IA 1U4MA 1E6EB 2LRWA 4LF7L 3S17B 3W5UB 1O7IA 1BO0A 4K0KL 3KYHC 3RZOH 4QIWB 2MJDA 3ZJTA 1GVPA 2NN6H 4ZQ3A 4KDIC 1VZ7A 2RBMA 4ZDVA 2HUGA 1EIGA 1IKMA 2A1AA 1Y69U 2ZNVB 2N9KA 3CW2C 1GHKA 1QE6A 2K05A 4UDUC 4DV3Q 2EE1A 5FJ8G 2KT7A 4XC2A 5AEKB 4LJOB 2BH2A 1WGYA 4DK5A 4K8JA 3BU2A 4TKOB 1YBYA 3M4PA 2QEXA 2UUBL 3W3AA 1JORA 3ZNZB 1BF4A 3KF8A 3PF5A 3GZNI 2HIXA 1BCPF 2J4XA 1R4MI 3IT4B 3RZOB 4TSSA 4OZAA 2LXCA 4RG1A 4A3OA 2REXA 4B0EA 4IFDJ 2K5PA 5JZEB 4W9HA 5AUKA 4QL5A 3PMFA 4XQQA 3A9JA 3TEXA 4CQNA 2PW5A 3QOJA 5FOBB 5DM63 1B9RA 1DZ1A 4ODGA 2BB6A 2JEAI 1VF7A 2BPSA 4DR2L 3PHWB 1GUAB 1P7FA 4GGQA 5D7GA 1KTKA 5LL6S 5IT9L 5LNK1 2M0AA 3MHSD 2ZXOA 1DOYA 1GXDC 4B9KA 1FNUA 2DX5B 1U9RA 4B9WA 3CCEA 2RDHA 1WGKA 3KF6A 2E74C 1AW7A 1UE5A 2CWAA 2WACA 4IUQA 2BYFA 3B08A 5KNBA 3MA2B 3U50C 1WZ0A 1TWGH 2CU3A 2B3GA 5EAYA 4L5QA 4HJAA 3DBLI 3ZQ4A 4AWJA 1XO3A 2IT1A 3AE2B 1QKZA 4IURA 3M62B 5C0XG 1IXRA 3UIPB 4QY7A 2DNFA 2PJHA 4FVMA 3V05A 4G7HC 2VXWA 1S72A 3VR5A 5C4XG 4BBSG 2LUMA 1NEKB 4A3JH 4PNYA 2EXDA 3TUOA 4JI8L 4GOPC 2FCSA 2M4NA 4K3BA 5CX3A 2AHOB 3X3NA 3VUXA 4DBGA 1B3QA 4JI6Q 1TWGB 3JSVA 4LF6L 5E1FA 1TY2A 2VQFL 4A93G 1IUEA 1JALA 2LGIA 2V9HA 1LTRD 3M4OH 2O6VA 1WGHA 4JC0A 4P1CC 1I3QH 1ZEQX 2KQ3A 3ETRA 3W5VB 1A15A 1DM0B 3A54A 3DUZA 1RIPA 4RGNA 5HGTA 3HOUH 2SDFA 2JT4B 2R93G 3VR2A 4A3LG 2KK8A 2EQSA 3A7AB 4A3JB 2K25A 1KNEA 2XBBC 1JQ4A 5IYCH 1D5ZC 3M4YA 2KOLA 4XDXA 1YITA 2E5LQ 2F3IA 4RM9A 2B2UA 1WJUA 2WS3B 3AE6B 4PG3A 4DV1Q 1WF9A 2XN9C 3FVQA 4JI5L 2CVRA 3A9KB 1ILPA 5GMVA 3H3VI 1X55A 3M4OB 4CBVA 5CMDA 1I3QB 5IO9A 3ULLA 3HKSA 4IPHA 1QOFA 2KANA 5D2MB 3HOUB 3TMPB 5BR8L 2N9LA 1WVLA 1E90A 4A3GG 1CMXB 4KX6B 1E2VA 2WXMA 2KN4A 4CKCA 1PTOD 4WJOA 4DR1L 1YJ9A 4LFCL 3NVWA 5J3BA 3UE0A 3PS6A 1L2FA 1SN8A 3TBIB 3WWVA 5E6NA 3A4RA 4QB4A 3PQIA 4K7WA 5EDSA 4JPSA 1ZXHA 2GMIC 1E2ZA 4H2AA 1TIFA 4FF3A 4PS3A 1O7LA 4ANUA 1Q82C 4MACA 4ZRQA 4LLGM 2WINB 1SYGA 4TVAB 2GBMA 2HD3A 2XNAC 1VF5C 1YHAA 2RDGA 2ZJQA 5C3EH 3N1XC 3I4LA 1S40A 2B76B 5CHFA 1UWVA 5BMHA 5J2RA 2HQEA 2L1BA 2ID0A 2VZKB 3M3JA 3GTLH 1IW7C 4AIMA 1MPEA 4LNKA 4B08A 4K5XA 1TU2B 2D3CA 2A74C 3PGEA 1XLPA 4HR7B 4L2YA 4KHVA 4JOIC 4R8IA 2EYMA 4W9KA 4B3TQ 2MBBB 2L76A 2FCNA 4GXBA 5DCNA 3Q3NC 3RMHA 1HFNA 4NQLB 2F52A 4C3IH 4G0NB 3F2DA 2ZT9C 5C3EB 1N6ZA 3ZUNA 3U4ZA 3NVVA 3BIID 5CHVC 1UUPA 4LWCA 4DPGA 4KHPL 4EZKA 1PZKD 1BCPB 4M8MA 3GTLB 3MXNB 2ZJPA 3KLSX 2FINB 2L0TA 1QWYA 1GKHA 3GV6A 2L12A 2PVOD 2WXRA 4TKNA 4A90A 1SR3A 4EGVA 2YU9H 1C9FA 1YNXA 2X6LA 2JA5G 4NXML 1XNQL 1EEFD 1UE6A 3D6WA 4WH4A 4C3IB 2BQQA 4ALPA 3DWPA 1O78A 1ICFB 5I4DA 4BXXG 1UELA 4L1BA 1D1KA 4R1JA 4CDFC 1STGA 1GB1A 5FLMG 4JI3L 3J7AV 4DGZA 4A8XC 4XGAB 5ELCA 3P63A 1U5KA 1SMYD 4LFAL 4IUUA 2YU9B 2X69A 5EQ0A 3J7AF 2CJOA 2JZ3B 3W1BA 4HAEA 1TQOA 2AX5A 4A55A 4FXGC 5LHY1 1HZ5A 1NNXA 1XWEA 4MTNA 2KLCA 1EQRA 4UHVA 4YWKA 5IP9G 4GKKQ 4ZK9B 2BB5A 2NBWB 2AMCB 1HNXQ 3K57A 2IGHA 2XSCA 3RLOA 2PQAA 1ZOYB 4ZCKA 3L54A 4OO1H 3AYHB 2MHJA 1JQYD 3ER0A 4DDGD 2BS3B 5FK9C 2KJ6A 3A0JA 3V2TA 4U68A 4X57B 2QF7A 2IGDA 4LNQA 1QVFA 2WAQE 1I5FA 1J7AA 1IL2A 4A4IA 4C7ZA 2ENBA
chains in the Genus database with same CATH topology
1ZXIA 1SEBD 4K2KA 2AQ2B 3K5MA 2RSOA 1XF5L 3DEOA 1STBA 2WXFA 4K5WA 5C5LA 1IYVA 3Q23A 2RQXA 2PCFB 2GB1A 2TSSA 3OWEB 1SDFA 5JVG3 3KWVA 1CQVA 3URYA 3TZDA 3TEWA 2GA4B 3GTGB 4A3KB 5EE0A 4DFAA 5C0XJ 2PO4A 5K5PA 2BOSA 2KACA 2PMZB 1LV9A 3GB1A 2E75C 5D3DA 1BR9A 1F2RC 4G7OC 5I2YA 1LACA 1PFNA 2MPMA 2NMQA 1SNQA 3I3CA 4FF2A 5E4XA 1D5MC 1VZ6A 4ZRPA 3R93A 3R3OA 1KABA 1S5DD 2Y0SB 3H8HA 2RMMA 1FYCA 3A56A 4XT1B 4WQMA 2FUG1 4ARCA 2L55A 2PZWA 4DAYA 3GQBA 5EE1A 1KDCA 5E3FA 2W82A 1L6VA 3IKJA 1J8IA 3B2FA 1PFDA 4BBRB 1H9KA 1BUIC 1AFPA 4YTMB 1MVKA 2F0UA 3MJ5A 4YIJA 4RH6A 2PKOA 1UEAB 1W6KA 2W54A 1B3AA 4AQ7A 1RYJA 1I4XA 1F0ZA 5EBDA 2WQYB 4A3EB 2NBFA 2A5HA 1JICA 2MJ8A 4OIJA 2PVGC 1E2WA 2NTTA 2W3RA 3U52E 4Y7NB 2DYMA 4OW0A 1TKEA 4IUPA 1QF6A 2NYZD 4ZYSA 1WTVA 1PFBA 5IGCA 2A69D 5M3FB 2BE5D 5ELEA 1JC7A 3J81L 1PZID 5BYSA 3MFGA 3W2DA 4IFDH 1VMCA 5JXVA 2KHSA 1OO9B 4XDDA 5C4ZA 4US8A 1GUWA 1PZJD 2Z8LA 3OIQA 2WV6D 4KKUA 1HA5A 2BDNA 3C3LA 3U9SA 1HUMA 4XWTA 2DY7A 1NVID 2PZTA 2C9OA 1FCCC 4DAVA 2X38A 1Y1WB 1JCKB 4DF7A 4TQ1A 4Q2JA 1FIQA 3TP6A 1QOGA 4LJZC 1KLGD 3T51B 1I4GA 1XEEA 4FF4A 1SE2A 1XCTL 1ESFA 1A2UA 1B44D 3JAME 3BWUD 1YNND 4ZKCB 2O2LD 5C6AA 2GRIA 2CW0D 3HRDD 4C2MB 4F87A 5D14A 2NTSA 4RKLA 3S1MB 1V1PA 3C1FA 2YEPF 3SFEB 4KGRA 4N59A 4M0WA 2JE6I 2NZ1D 1V43A 1XYIA 3VRBB 3NPPA 1ENAA 1LT6D 4KGTA 4BY1B 3FDTA 4OL7A 1PTOF 3AE7B 4FXKC 3A8KE 3Q8AA 4YSZB 4A3DB 3N6RA 3SK8A 3AM9A 1E10A 1SNPA 1STNA 3S2DB 4FO2A 2IL8A 4KD3A 1ACCA 4H7BA 4RFBA 5LL6X 1TKYA 2A6HD 1V8CA 1SFOB 1MD2D 1AWDA 3RD4A 2BS4B 1CZGA 1BQQT 4XDCA 1C4PA 5HHDG 2R7ZB 2SAKA 2NN6I 1CI3M 1FMAD 1QT9A 3Q8FA 2IWHA 1O7ZA 2V4DA 1I4HA 2EYLA 1J9OA 3LYYA 3O13A 1DOIA 4G57A 3PIO3 1G6ZA 4IFDG 5C44B 1J7CA 5ELBA 3E0JA 2JU6X 1QJOA 1IBXB 4HSVA 4JWUC 2B2TC 3HOVB 1KF6B 1WYGA 4KY7A 1I4PA 2F0HA 3T3OA 3AMZA 3NZ3A 3KK7A 1KDAA 4L8JA 1NR2A 4PMCA 3W1SA 2F0TA 4WURA 4LTUA 5CV8A 2I38A 2AUKA 1G2TA 3E6ZX 5FO7B 5JOBA 2V4IB 1VCIA 3PUZA 2K6AA 2KECA 3J80L 1LTBD 3SR6A 3D8GA 3S1NB 3FEWX 1EY6A 1KLUD 2CQAA 1E0BA 4KN4C 1EWHA 2LFNA 3TN2A 4FF1A 3FPUB 1KH0A 1EQVA 5BYQA 4EQOA 4TRDA 5T8IA 1QB5D 1JWSD 2AQ3B 3E56A 3P1HA 1IW7D 2L4NA 4IUVA 1RODA 1T5EA 1DOLA 3AE8B 5I6WA 2B8GA 2D62A 1C76A 2O4XA 4IUNA 3T3NA 3IFDA 1G2SA 3NTIA 3GTPB 1UWXA 4LMQD 3E5SA 1CHQD 3IFTA 4FXDA 2KJXA 5FLXL 4YSYB 1PGBA 5C0XH 2WP9B 1GB4A 3DWMA 4AS1A 5EPKA 2IW3A 3LWUA 2RVLA 2LJIA 2WXPA 3NVYA 2EYHA 1WSPA 1II3A 1YN3A 1FGBD 3AE9B 4WORA 3VR6A 4YXDB 2A68C 3BYYB 5C4XB 3ZJVA 1H9RA 2M00A 3MAQA 4H13C 4BBSB 2F0JA 1BDOA 3NWSA 3K0YA 1U4RA 4IKGA 3CIRB 4A93B 5I6YA 3RPFC 3MVVA 4US9A 1A70A 4F7XA 1H9MA 4A6QA 1SNMA 4GLSC 2BS2B 3IAM1 2R93B 2ICIA 1IL8A 4QF4A 2WIIB 4KKTA 1SF0A 2D5GA 2NVQB 3G7LA 3SDZA 3V96A 2CW0C 3FPPA 3L4PA 3Q69A 1ZKOA 3MXPA 3VQIA 1FEHA 1ROEA 1Z47A 3FAHA 1BBXC 1PRTC 2N0SB 2WP8J 4N58A 4A3GB 1MSGA 4N9PA 2DN8A 1Y8NB 2LKVA 2SNMA 2R3ZA 4CKBA 2B2YC 2B39A 5M5YB 1J7BA 1EZ8A 4X3KA 3G6JB 4ZAIA 2KCNA 2EKIA 5CYUA 5HG2A 1Q1BA 2F0GA 2FBWB 4HKZE 5EGTA 1HFGA 2LS01 4OO1I 3BVMA 4DNTB 1GOZA 3S1RB 3C1EA 1JR0D 1HQRD 3Q8CA 3TZUA 2G1EA 5C3JB 4ZLTF 1S5BD 1BOSA 2A6HC 2QILA 4O42A 2KWDA 4IOIE 2I07B 1QQRA 2Z4IA 5IIFA 4EE2A 5IT9E 1SAPA 3S1QB 2EY1A 3NWTA 5DAUA 4H44C 3SXHA 2N55A 1UGJA 1JWAD 4RNAA 3M7GA 4KKJA 4M1UB 2V0GA 5FO8B 5TSSA 5JEAJ 4TQ0A 1E9MA 2JA5B 1A3UA 1T5XD 1SYBA 1WWTA 4KN7C 4MIUA 1ZPSA 3TP5A 2Y3AA 5EKKA 5IGDA 3T4AC 2R6GA 5DEHA 4N9TA 3CHBD 3S14B 4WWMA 5COYA 1QG7A 1JMLA 5CR3A 2DBYA 5I9PA 1C4CA 1U4PA 1OXVA 1EFID 4NDXA 4DU9A 2LHDA 4DN4M 1VZ8A 2AWOA 1Y8PB 3WCQA 3QWNA 3KLSA 1FNVA 2M9VA 5KNCA 1D2BA 4XXEA 4K14A 3DWAA 5AUIA 1EY7A 3H3VC 5FR3A 3HVDA 2OEOA 3HVZA 1V1PB 5F2DA 3B2GA 1EIHA 3W9CB 1FFVA 2EJGC 2H88B 3BS1A 3VA5A 2KCCA 3D4WA 1JWMD 3S9WA 1RHPA 3M85A 1FRRA 4DK1A 1ONLA 2KUMA 4WIPA 3ABVB 2QEJC 2D5DA 3BDCA 3MWYW 4CJ0B 1QOBA 1IBXA 3HZXA 1WCMB 5MPOA 1EYDA 2IX1A 1S5CD 3DEPA 2PIAA 2BYTA 4K2LA 3AEEB 2QCPX 2WU2B 3V3XA 1I4RA 3GTMB 5BN3A 2JWUA 4L6TB 1WTQA 3FC4A 3PUYA 3CRLC 1ML0D 1A2TA 3DHQA 5IODA 3BDOA 1F2MA 4RGMA 5M5WB 1HRJA 4IFDI 2KVMA 2ZW0A 2B2WA 1WTWA 3A8JE 1K8MA 1LT4D 2WAQB 4TMAB 1EM7A 3PUWA 5JAVA 1TWHB 3E9SA 1WRIA 1Z7TA 3AB5A 2TMPA 4HCSA 1QNKA 4RGOS 3IAS1 3I91A 3BVZA 3QOLA 2AQ1B 3UI3A 1TS4A 4LK0M 1B9MA 1TWFB 2W55A 1D4BA 2JP1A 3Q6SA 1OXSC 1C77A 5CV5A 4YT0B 1JWUD 3OSOA 1HCZA 3NK9A 5M5XB 4LAAA 1B53A 2BA0A 4C3JG 1F2LA 1C79A 4Q5VA 4HCEA 3K6OA 2O5IC 1Q10A 2IPKD 3OPOA 1Q3LA 2NWGA 4RHSA 1C8CA 3NTKA 4Q0FA 1WD0A 2WXGA 1B50A 3RFZB 3QB3A 5A2QL 1JOOA 2ONQA 3P7JA 1EEID 3IAYA 3P4RB 4ZUJA 1SYEA 4XQJA 3AN1A 5CBEE 1KRHA 2EXZA 1C48A 3I8ZA 3M7NA 1OXXK 1STAA 2OF1A 4RF0A 4MM3B 3K58A 2R92B 2EJFC 2YYZA 1R4QB 2F0VA 4D2KA 3HOXB 3NQIA 4PV1C 3MTSA 4U673 3I57A 2JYOA 3ERQA 3I70A 4PMBA 3FILA 2EOTA 1IGDA 3TEYA 2ON8A 2VNUD 1EY9A 4ZKBB 3EFXD 4FYDA 4HMIA 4IDIA 1PMRA 3GTQB 2L52A 2ACZB 5FKAC 5C4HA 1DOKA 1OFFA 1FO4A 1JOQA 2Y5PA 3LXFA 1NSNS 4KJNA 3P42A 3HGBA 1QOHA 1K50A 3LWEA 5I2XA 1FFUA 2G9DA 1ET6A 1ICWA 3HP3A 3LX0A 2DNCA 2Y5CA 1G8ZD 4QUFA 5BMIA 2QIEB 3NSWA 4JX1C 4HMJA 1EL0A 3P20A 1BMLC 2WKDA 1RFKA 2H89B 1Q8IA 3AU7A 1FCLA 2NVTB 5C2TB 4ZOHC 4NAWB 4WRDA 2FFKB 2EYOA 4S3SA 4XQNA 1HTPA 2F0IA 3AEDB 2QDBA 1EWYC 1LLRD 2RA4A 3F2UA 4K5VA 1IGCA 3H6MA 2VB3X 1L6UA 2VZKD 5KEEA 2WU5B 1WXQA 3J81E 3NBHA 3HRZC 3BK2A 1LTID 4USAA 3NUHB 5JPMC 3AH7A 4F8MA 4KHZA 1RCVD 2F0EA 3EJIA 2Z1CA 1YN5A 2ZW1A 2A68D 3DXJC 4KY6A 5CV7A 5ELFA 4YSXB 5T1IA 3SHLA 2PZUA 2INNE 2SOBA 3T53B 3GD7A 3R8BA 1Q12A 2EYFA 2N7JA 4FXCA 1STHA 2WXOA 2JSVX 2Q8RE 3AEBB 2JXMB 2K7VA 1CA6A 1SNDA 1OXUA 5HI1A 1PYWD 5E4WC 2K0PA 1SNCA 4F88A 1YQ4B 1NYRA 1ZUD2 3AE3B 2K5QA 5EPJA 1FXAA 1TWAB 2BDOA 5C0XI 2NVXB 4GDKB 2B2VC 4E6IA 4R9WA 2HDEA 4KKIA 3VYSA 2MHVA 3AE4B 2O5JC 1W6JA 1VMPA 1PRTD 1X32A 1GHJA 1HPCA 1A6XA 1FRDA 1I4QA 3WOFA 1MI2A 1H9SA 4OIKA 3ZYYX 2WXJA 1YN4A 2INPE 1RWSA 1X3PA 2RPVA 1SXTA 2EDGA 2WXIA 3CQZB 5J39A 1NR4A 1C4QA 5ISRA 3BZDB 3K59A 2RKSA 3SR1A 2DLBA 3AE5B 4HEA1 4I7ZC 1DOMA 1X3QA 1WD1A 4G4KA 3H09A 4AYBB 2PTLA 4DA2A 3A7LA 1B4OA 1K53A 1SJED 1TWCB 2F3WA 1QLBB 2X6GA 4B0MA 2ZXRA 4KI0A 4OHJA 3T13A 4MH8A 4OZBA 4XWWA 3EGRA 3Q8BA 1TVXA 1XLOA 5J22A 1NI3A 4KD4A 3A8IE 1O7YA 1Y8OB 4C56C 4BY7B 3P4SB 3L9AX 3AB9A 3BK1A 2OHFA 1YJJA 5C3XA 4KY5A 1HEZE 2JA8B 2KAJA 5CV9A 3L7ZC 1E0ZA 2L9HA 1PLFA 2F0PA 2VB2X 4NMZA 1N5XA 5IGFA 2G9HD 1E7PB 4RHRA 2LFIA 2QMTA 3TMEA 5JEAG 1TS3A 2EJMA 1L0XB 1ET9A 1B2TA 1GJXA 1CQFA 2IJ0A 2HDMA 1GUSA 5EBCA 2XWBB 2L1AA 2DNEA 4JE3B 3J80E 3FRPB 4PQXA 2PW7A 3MXGA 3PUVA 3HS0C 4P6VF 3H94A 5KYIA 2VUMB 2WB1B 4ID6A 1HA6A 5CGKA 3ONAB 4QCLA 2F0NA 5G3LD 1K8OA 3QG1A 2WDVB 1I50B 5HURA 2Q8IB 2JYTA 3ZJUA 1GUOA 2MH7A 2WDQB 1D5XC 1NYQA 3SK4A 5KRUA 2YEPB 1PTOH 5ELDA 1QCBD 2MGSA 5K36G 1KAAA 4RA8A 1STEA 2M2LA 3LNNA 3EUB2 1SSOA 5KIXA 4IALA 2JX5A 4NKLA 3D4RA 2KDMA 3P4QB 1I6VC 3WOEA 2K3UA 1SJHD 1PTOB 5FLXE 4J6HA 1SYCA 2EY5A 5NUCA 4HSPA 1EY8A 1VLBA 2RDFA 4R3DA 2WKCA 3A55A 1OQRA 1GAQB 1N63A 2NVYB 2XRSD 1LT3D 2JXTA 2IX0A 1XLQA 1JROA 1TS2A 1DCZA 1S4ZA 1ZYRC 1HXYD 5EPLA 4JK1C 1MBYA 1Y56A 1BCPC 1OXTA 3BDLA 2IGGA 3OHXC 5HFYA 4BA1I 2IX3A 4C3HG 1TJEA 4NW2A 4HJGE 1MI0A 2K1BA 2FHTA 1TT2A 2J0TD 3K5NA 2LHEA 2LMCA 2MEKA 3FKIB 1D6EC 3WDNA 3R2IA 3FILB 4RWSC 3NS1A 4RAUC 3P75A 1NAPA 1YNJC 3K5LA 2BTEA 4MHEA 3ND9A 2EVBA 4IN3A 1DONA 2K28A 2FJ2A 1XTCD 3RZDB 1G291 1VRAB 3KWLA 2R61A 3BYTB 5FO9B 1RKNA 4ME5A 4X3UA 3NTHA 4V190 3Q0AA 3DWGC 3PO0A 3EA6A 1SBBB 3HOYB 4DK0A 2E2HB 1G91A 5CV4A 5JJZA 4A3MB 4NZLB 1RDPD 2WNMA 4ZHPA 1WTRA 1AEXA 1QILA 2L0CA 2AUJD 2B8FA 4JBWA 1K51A 2DWQA 2HCIA 3TSSA 1SIJA 3GTOB 1S5ED 2FMCA 2QSDA 2XRQD 3EROA 2OT2A 1XXGA 4ITKA 4WFN3 1C4AA 3SE0A 1F9PA 1CT1D 2K03A 1H9JA 1M8AA 5J1ZA 1L5PA 2F0OA 1EY0A 5CBAE 1B1ZA 1AN8A 3AMUA 1P7EA 2CJNA 2F0FA 2K32A 3I4MB 2EELA 1PRTF 1PGAA 4A9AA 2SNSA 2PNRC 3GP7A 4KKSA 4HKQA 3D31A 1PDXA 1TIID 2A73B 3VYTA 3AEAB 4TQUS 4OGQC 2V3PA 3X3MA 4C3JB 5D65A 3S16B 3I72A 2H1EA 1ENCA 4PMWA 1R4PB 3NVZA 1ZDXA 5JVH3 1CZPA 1FXIA 1H9SB 3VYRA 3GTKB 1OQQA 3AV8A 5H92C 1ZP0B 2M19A 2JEBI 1EYAA 1N62A 1RF2D 2KA7A 2HCCA 2MJEA 1VDZA 2KQ4X 1CTMA 4C7YA 2BBCA 4ZHOA 2J53A 1GUGA 2ICEC 4ABNA 4MN3A 2A6EC 3VR3A 3K5OA 2OEDA 2EY6A 1YMHE 2I46A 4BS9A 1F2YA 2FMMA 1PDQA 1F9SA 4A3IB 1MSHA 1TY0A 3U4EG 1BNZA 3B9JA 3U2SC 4EVOA 3MEHA 1WTXA 2K33A 2H4OA 3VYUA 3MFYA 3C2PA 5EKLA 2NN6G 2XIWA 3HEJA 3NE5B 1S5FD 1JRPA 3SK5A 1C78A 2AWNA 1WTPA 4B9XA 3MXUA 3GS2A 3U7ZA 4OZCA 3VR9B 2L5TA 1T3QA 3CWIA 1DJRD 2KEDA 1KFYB 3HG9A 1F9RA 1K83B 4Z9CB 5H8YE 3IT6B 4IZ8A 2XWJB 4KTAA 2W3SA 3TP7A 3C46A 2F0MA 1T6BX 1CHPD 3S15B 1JOKA 1LTTD 4X3TA 1EQTA 3PO3B 1NENB 3GTJB 3PIP3 1YNTE 2F1MA 3MHZA 4X3SA 4O1NA 2PPBC 5KYLA 1V97A 4BA2I 3OWFA 5G3LF 1VJKA 4RGTA 1GUNA 4GZYC 5CORA 1NUCA 4JWSC 1LTSD 3DM1A 1PRTB 1MHXA 3I90A 4ZRZA 2L32A 3CKIB 5C5MA 4REZA 4FNFA 1JWBD 2F0DA 4QUCA 5D3IB 4C1NK 3T16A 2K04A 1L4ZB 3BVGA 3PZ8A 1PXUA 2E2DC 3D6CA 2I2YA 5A2QE 2B2UC 1AZQA 1UWMA 3AEGB 4K6DA 1HHVA 2C5CA 2WDRB 1QOAA 1R9TB 1EY4A 3ZGZA 1F2ZA 4M8AA 5AFWA 1JE4A 2F0QA 1JB3A 2N88A 1HTLD 2F0KA 1V8QA 3L3OC 2B2VA 3Q24A 1ILQA 4ULLA 1FNWA 4ARIA 2B63B 3T56B 2BCOA 2OXPA 3M3YB 1VR9A 2F0WA 4C1NI 4KK7A 1F2RI 3NXWA 2Q8TA 1XCQL 2BW2A 1MGSA 2LEKA 3RLFA 3MP9A 4DXFA 2BT6A 1L0VB 2PYKA 2J42A 1N5WA 2JZPA 3EVQA 2K5WA 3KUPA 2JA7B 1TS5A 3IL8A 2FE8A 5BMGA 1ESRA 4C80A 4KV6A 4PT5A 1CA5A 4C3IG 4R8NA 3D3RA 3OMCA 1I6HB 2KMMA 1AZPA 1QNUA 4YTNB 2F0LA 4ILWA 1TZOA 1ZXTA 2B2WC 5A35A 1K52A 1MHHE 3NBIA 3TEZA 4XT3B 4XYQA 1RTNA 3EQLC 3DMUA 2JQRB 1SNOA 2LMCB 3QIAA 1NCVA 5IGEA 1DOXA 5IGBA 3RUZA 4L23A 2K22A 3H91A 2MJ3A 2D2CC 3HOZB 3I73A 5KGUA 1EWCA 2NUCA 5CV6A 2E76C 4RCNA 3BG3A 2K9XA 3VR4A 2B2TA 3Q22A 5EE3A 2CHBD 1IYUA 3J9CA 1ZYRD 5JPNC 2BA1A 4K6LA 1WTOA 4OO1G 4HROA 4J3OD 1F9QA 3UI2A 1HZ6A 2J52A 1BCPD 1AYFA 4OVZA 1PTOC 3SFDB 5GXGB 2EPBA 4MT5A 4IUTA 4NAMA 3KBGA 5JEAH 1FM0D 1ZE3D 3HUIA 3FMCA 3PUXA 1D1IA 4KMUC 1EU3A 3QJYA 1LTGD 4XYOA 1Q90A 1CJEA 3GO5A 2EZVA 1I7HA 2Q5WD 4NJCA 3P1MA 2LY7A 1YNJD 4J8QA 3AE1B 5BN4A 1FD6A 3JAML 3NUCA 5E6JA 2WXQA 3VA7A 2MUYA 2ZXPA 1JW9D 2E2IB 1TKGA 1TKWB 5DNFA 4HRSA 1CM9A 3HOWB 1EYCA 4A3FB 3OMGA 1DD2A 1RM6C 2L11A 1EZ6A 5K36H 2HDLA 5CC4A 1SYFA 1BUVT 1N60A 4P16A 3MC0B 3DWQA 3TP8A 1RJTA 1KDBA 4FP5D 3SVMA 3KQ4A 1Y1VB 3P4PB 1V1OA 2QJLA 1FD7D 1SSNA 4BWGB 2E2JB 1B9NA 3I9V1 2Z4HA 3MZ5A 2M56B 4N6EB 2WXLA 1AP0A 2EYJA 4I65A 1SE4A 1SMYC 3NP8A 2JSOA 2E3TA 2F03A 5I9OA 1ZDVA 3OW7A 2SEBD 5EE9A 3NQTA 1YQ3B 1U4LA 3QO2A 4YWGG 1FR3A 3MHBA 3VRAB 4HTHA 4KJOA 1DGJA 3H0GB 1TYGB 1IHZA 1EOTA 2L83A 3MXNA 2EY2A 5BN5A 1IKLA 1RD9D 1L0YB 1EY5A 1BXTA 2XVSA 1UNSA 2K01A 1L4DB 5C4JB 3I4NB 1LO5D 3ND8A 1A3VA 4P2CB 3PZ7A 4HN7A 2KEEA 1N61A 4DQOC 4J1MA 4QMGA 4ZUIA 2F3VA 2NB0A 4NP5A 4C3HB 2WLBA 1Z6HA 2PMVA 5M3MB 4XIGS 1TR5A 3HKZB 4DAPA 3OIPA 3PV0A 1SE3A 3AECB 4K8IA 4CHTB 4RKBA 5T1GA 4EQPA 1KNAA 4CGYB 3KLRA 1A3TA 2B2YA 3S2HB 2D9UA 1PUTA 1LABA 4DNRB 2GI9A 4CJ1B 1HQMC 4RF1A 4XE0A 4RCOA 1PFMA 3NRZA 2PLPA 2F0SA 1HUNA 4UAIA 1LT5D 3Q8EA 3R2TA 1GPXA 3U9OA 2K5DA 5KNDA 3IXSA 2A6ED 5C3WA 3ITPA 3N52A 1XLNA 1Q1EA 1F77A 4A3BB 1CZWA 5G5GA 2JYEA 2MP1A 3N9YC 2J7ZA 1YJIA 2DY8A 1SB3C 5M9OA 4IQZA 3KBXA 4EQNA 2IDYA 1XX8A 4KGSA 2DYOA 4XTCS 2V3NA 1EU4A 3D4DA 3SK6A 4DXGA 4G7ZC 4GDLB 4CJ2C 2A69C 2WXNA 2BE5C 2EYPA 2PW9A 2E6XA 5BYRA 3K7AB 1DYQA 4L63B 3C8YA 3NHHA 2HTME 1CK1A 3J7YW 1RTOA 3PO2B 5IOCA 1ENFA 1GUTA 1SYDA 4WAFA 3AEFB 4HEDA 1LTAD 3SEBA 3LB8C 2QKIC 4WJWA 4LK1C 5DM73 5G5HA 1CFMA 2PQEA 5IGGA 5EJWA 1M4VA 2RSNA 1PGXA 2WXHA 5EKIA 4H0LC 1R7SA 4V0BA 4YTPB 3GV3A 1STYA 3OOCA 2JA6B 2WXKA 1YNNC 3TDQA 3VR8B 1UAPA 1VDVA 3CU7A 1DXMA 1O80A 4CKEA 3CRKC 2F4IA 1U4MA 1E6EB 3S17B 3W5UB 1BO0A 4QIWB 2MJDA 3ZJTA 4ZQ3A 2NN6H 1VZ7A 2RBMA 2HUGA 1EIGA 1IKMA 1Y69U 2N9KA 1GHKA 1QE6A 2K05A 4UDUC 2EE1A 4K8JA 4TKOB 3W3AA 1JORA 1BF4A 3KF8A 1BCPF 2J4XA 3IT4B 3RZOB 4TSSA 4OZAA 4B0EA 4IFDJ 2K5PA 5AUKA 3PMFA 4XQQA 3TEXA 4CQNA 2PW5A 3QOJA 5FOBB 5DM63 1B9RA 1DZ1A 4ODGA 2BB6A 2JEAI 1VF7A 1P7FA 5D7GA 1KTKA 5LL6S 5IT9L 5LNK1 2M0AA 2ZXOA 1DOYA 1GXDC 1FNUA 1U9RA 4B9WA 1WGKA 2RDHA 2E74C 1AW7A 2WACA 4IUQA 5KNBA 3MA2B 2CU3A 3ZQ4A 1XO3A 2IT1A 3AE2B 1QKZA 4IURA 5C0XG 4FVMA 3V05A 4G7HC 2VXWA 3VR5A 2LUMA 1NEKB 4PNYA 3TUOA 3X3NA 1TWGB 5E1FA 1TY2A 1IUEA 1JALA 2LGIA 1LTRD 2KQ3A 1ZEQX 3ETRA 3W5VB 1A15A 1DM0B 3A54A 3DUZA 4RGNA 5HGTA 2SDFA 3VR2A 3A7AB 4A3JB 1KNEA 1JQ4A 1D5ZC 3M4YA 2KOLA 4XDXA 2B2UA 2WS3B 3AE6B 2XN9C 3FVQA 2CVRA 1ILPA 3M4OB 4CBVA 5CMDA 1I3QB 1QOFA 3HOUB 2N9LA 1WVLA 4KX6B 1E2VA 2WXMA 2KN4A 4CKCA 1PTOD 3NVWA 3TBIB 4QB4A 4JPSA 1ZXHA 1E2ZA 4H2AA 4FF3A 1O7LA 4MACA 4ZRQA 4LLGM 2WINB 1SYGA 2XNAC 1VF5C 2RDGA 3I4LA 5BMHA 2B76B 2HQEA 2L1BA 2ID0A 2VZKB 1IW7C 1MPEA 4B08A 4K5XA 1TU2B 2A74C 1XLPA 4HR7B 4L2YA 4KHVA