1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
1BCPC 1FNUA 3TSSA 1MD2D 1YN5A 2IJ0A 1STEA 3R2IA 1PTOF 1S5BD 1PTOD 4TSSA 4DXGA 1DYQA 1FNVA 1I4HA 1KTKA 1SE3A 1CHQD 4RHRA 1I4RA 1PYWD 1LTBD 1LTSD 1JCKB 2AQ1B 3SEBA 2TSSA 2QILA 1EEID 1EFID 2J4XA 3MC0B 1HQRD 1V1PA 2RDGA 1HTLD 2RDHA 5D3DA 1JQYD 3MFGA 4NZLB 1TS4A 4C56C 1F77A 1SJED 4RHSA 3DWQA 1RD9D 1EU4A 1D6EC 4RGNA 1PTOC 1TY0A 1RDPD 1SE2A 2G9HD 1I4XA 3R2TA 1D5XC 1JWSD 1S5CD 4OHJA 1LLRD 1DJRD 1T5XD 3DWPA 1TS2A 2O2LD 1JWMD 1HXYD 1SXTA 1PTOB 1TY2A 1PZKD 1PRTF 2QEJC 1PRTD 2NTSA 1AW7A 4L63B 2ICIA 4Z9CB 1LO5D 5D3IB 5ELDA 1S5ED 3BVGA 5ELEA 4RCOA 4RH6A 2NTTA 1ESFA 1TS5A 1PRTB 4K6LA 3BZDB 1TS3A 3V05A 3BYTB 5ELBA 2AQ2B 1L0YB 1V1OA 3URYA 3DWAA 1QILA 1LTID 1S5FD 3CHBD 1SJHD 4RGTA 4O1NA 2WV6D 1GOZA 1SE4A 3GP7A 1D5MC 1KLGD 3BVZA 1PTOH 4RGOS 1HA5A 1BXTA 2Z8LA 1LT3D 4RGMA 1LTRD 1PRTC 1V1PB 2SEBD 4UDUC 1S5DD 2XRQD 1ET9A 1FD7D 1ET6A 1KLUD 1JWUD 1LTGD 1XTCD 1EWCA 1PZID 3BYYB 1PZJD 4DXFA 1D5ZC 1G8ZD 1B1ZA 1FNWA 1SBBB 5I4DA 1CHPD 4BWGB 2AQ3B 1LTAD 2R61A 3EA6A 3EFXD 1EEFD 1BCPF 1SEBD 1BCPD 3BVMA 1ENFA 4RFBA 1L0XB 1RCVD 1YN3A 1LTTD 1FGBD 1RF2D 3OWEB 1I4PA 1BCPB 1I4QA 1B44D 3R8BA 2CHBD 1LT5D 2XRSD 1JR0D 5ELFA 1AN8A 5FK9C 1I4GA 1CT1D 2IPKD 1CK1A 2XNAC 1UNSA 5FKAC 2XN9C 1UUPA 3KLSX 5TSSA 1M4VA 1CQVA 4ZYSA 1LT6D 5ELCA 3W2DA 4L6TB 1EU3A 1XXGA 1LT4D 1YN4A 3O13A
chains in the Genus database with same CATH superfamily
3P1HA 2CR5A 3GTGH 2JA5G 2BVCA 1GC7A 3K9OB 4QMGA 2PW9A 4YCVA 1E0ZA 1HTPA 3I73A 2N1WA 5IGCA 4YIJA 1WJ4A 5AZGA 1EYDA 2H4OA 3H7PB 5CYUA 2E2DC 4BOSC 2HDMA 4JC0A 3WAPA 3MXGA 2N49A 2REXA 2WNMA 1GG3A 5LL6X 4HPPA 2D0OA 2AL6A 2RR9A 1LM8B 2DYMA 1Y8OB 2PLPA 1CTMA 1JQYD 3L0WB 3IAS1 1K8RB 1L6VA 4B3RL 4DV6Q 1VZ6A 4RHSA 1C79A 1PV4A 4LFAL 1TXYA 2WX1A 4IKGA 4X62Q 1V86A 4B0MA 2RSOA 4WJQA 1HNXL 2W82A 4A76A 1G51A 1N5XA 2QC8A 3KLRA 4AYBE 1L1OB 4ID6A 3P42A 5C0XJ 4A3EH 4LNQA 4KK7A 1AH9A 1TY2A 1VQBA 3N20C 3QQ8B 2V4IB 1Q8KA 4Z9CB 2PQEA 4KIKB 5EE1A 1V8CA 1KJTA 1LXDA 4DAYB 1SYBA 2F0IA 4R9WA 3H1UA 1VQOA 1WY8A 3C2PA 2MGSA 1F0ZA 1J5EL 2KJXA 2RDFA 2KC1A 1V1OA 2PE9A 4BS9A 3P20A 1WRDB 1QILA 1RIPA 1LTID 1S5FD 2EOTA 3CHBD 1P8LA 2HT1A 4JI1Q 3PO3B 3S15B 2C5CA 3I2ZA 3MEFA 3ND9A 3CMAA 1YJJA 3QA8A 1WM2A 4LMQD 1KLGD 4LF4Q 2QF7A 1SRUA 3U30A 2VZKD 1PH2A 1FVIA 2J52A 3NBHB 3H6MA 2ES2A 1ZEQX 1NAPA 2K5NA 1LV9A 1WX9A 2INCC 3RULA 3I70A 2NBWB 4RMAA 3RD4A 1WYWB 2F0DA 5C3EB 4LCDE 1RFKA 1CSPA 3TREA 4QUCA 1KXLA 3P4RB 1SNDA 1PZID 4R4OA 1N33Q 2LUEA 3NJTA 4FXCA 2AMCB 1MJCA 1QNUA 4CKCA 1KF6B 4DAMA 4KN4C 3PO3G 3DM3A 1NMGA 2N9KA 2DZIA 1C3TA 4XQJA 2LD9A 5IGFA 4ANVA 4IUQA 1SFOB 3AECB 5CBAE 4P7IA 4DF7A 1PVOA 3VUXA 5FOBB 2VS1A 5J39A 3VYTA 1I4QA 3HOUB 1IGCA 3P75A 5C3EG 3NRZA 1QJOA 2MH7A 3JSVA 2XRSD 5JHAA 2QIEB 4DV0Q 2F0NA 1XMQL 3AE8B 2H88B 4HCNB 4F1SA 2IPKD 2XNAC 1WGHA 2XN9C 4JI6L 5IYDG 2L52A 3WOFA 2LFNA 1XMOQ 5A35A 2J7QB 2KNBA 3W2DA 1F9PA 2BKRB 1GUSA 2I07B 1QQRA 3QHTA 4A3JH 1VQ8A 1V9JA 2KECA 1KNAA 2YTVA 4EZKA 2PJHA 2EY2A 4DDID 2VQEL 1MD2D 1TT2A 4GOPB 3PV1A 5I6YA 3M9BA 1WJNA 1X3PA 3TP8A 2IBIB 1PTOD 4WWMA 4TSSA 4NAWB 4L5SA 1FRRA 4ZUJA 2KOXA 3MEHA 4NXNQ 3TP5A 3PO0A 1CKMA 4B95A 4O42A 1NYRA 2V1YA 2PPBC 3TP7A 1MGSA 1YJWA 4IPDA 2OEOA 1VQNA 4WWPA 1QVCA 3IXSA 3P2BA 1GHJA 4MZ9A 5C0XI 1E8ZA 3CRKC 5FLMG 1PGBA 3VH4B 3UIOB 3I91A 5D3DA 3MFGA 1UGJA 3I3CA 1VQ6A 2D10A 1Y1WH 1VQIA 4JBKA 1SB3C 2Z59B 2HIXA 3ALBA 4B9KA 2JJQA 2OT2A 1RL2A 1O7YA 4F7ZA 4AH6A 3MTSA 3DHQA 4K14A 2VW9A 5FLXE 2FUHB 1KM7A 1G291 1WF9A 5HY6A 1D5XC 1WCMH 3G71A 2LVQA 4DHJD 3NZUA 3RZOH 2KCTA 2UWQA 2YEPB 1IYUA 1EY9A 5IYBH 1A63A 2NVUI 4YXDB 2CVRA 2LZ6A 1STBA 1SXTA 1QOAA 2Q2UA 1N5WA 2ZTCA 4ME5A 4F87A 4LJOB 4PNYA 4A3BB 2R3ZA 5CGKA 2X69A 4TUUA 1D8LA 5BR8Q 1VQAA 2KDEB 4IOAA 4J3OD 2LS01 4KV2A 2AQ2B 3Q6BA 5I6WA 3FPPA 4MGIE 1ESRA 2KJHB 3DUZA 3AEEB 2ZTEA 1EZ6A 1DOYA 4M8AA 2WDVB 1ASZA 2F3VA 3K9PB 5JZEB 3CPWA 3UINB 3B2FA 3TRZA 2FHTA 1G6JA 2BS3B 3DVNU 4IG7B 1BVSA 4XYCA 4JI5L 4A3BG 1F2ZA 2MQJA 2ASBA 2KWVB 5DPSA 2F4VQ 1QUQA 4DN4M 3ND8A 4RCNA 5IP7G 1ZOYB 3IHPC 4WWNA 3BYYB 4DKAC 2IY5B 4BY7H 1IW7D 4JI4Q 1Q5WB 5LXIB 4QY7A 5JEAG 4AUQC 4FO2A 1XLOA 2FJ2A 4BKSD 3A56A 2AWOA 1K83B 1JB7A 4DV5L 4LNOA 1XJVA 3IBEA 3KUCB 1WM3A 1BCPF 2YV5A 4A3GH 4GKJL 4K3CA 3Q14C 4RNAA 3CMMB 2FINB 4E6IA 3SHQA 4K2LA 4KSKC 4LF8L 1BT0A 1L0XB 2KX0A 1YN3A 4I6NB 4MGZE 4M01A 5J1ZA 2CHBD 5AUKA 3DHIC 1TKWB 3RLFA 3GD7A 4RF0A 2JXXA 4GLAC 1U4PA 3HRDD 4IZ8A 4R4TA 3HG9A 5EQ0A 4HDOA 1VMCA 5IAAC 4DUZQ 1RTNA 3K59A 3T1YL 1R9TB 4XYOA 2GBJA 4J6IA 4CQNA 1J0GA 4H7BA 3KLSX 5TSSA 2JX5A 4FF4A 3NBIA 4MH0E 1STYA 3CAMA 3TS0A 1QZGA 4HDQA 5G5GA 3K7AH 2L9HA 2ZW1A 3UE0A 4IJLA 4EQPA 3M3YB 5IA7A 1JROA 2HJ1A 2SNSA 4KD4A 2EJFC 2N4FA 3I5JC 1FXTB 1JRPA 2I1KA 3NPPA 2LXAA 4K1RB 2KO3A 4JWUC 3DWGC 4H0LC 3A74A 4P71A 5LHY1 2BF8B 2JPHA 5EDSA 1LUZA 1UE5A 2MP2B 1L2NA 2ICEC 5C4JH 4RHRA 2I5HA 4KY5A 3PHWB 1TQOA 4BKTA 3UGBB 2B76B 2JQOA 1Q1BA 4PMBA 1KRTA 3ZGZA 1YNXA 2L0FA 2VUMH 2L1AA 4C3JH 3Q3OC 5BYRA 2NVXB 1YQ3B 3UF8A 2VNUD 2KQSA 3TEZA 2F0JA 4DV1Q 4LFBQ 3R7RA 1SJED 3DWQA 4DFAA 4KGSA 5COYA 3KLWA 1QVGA 3NQIA 1NJIC 3M7NA 1PTOC 1HZ6A 1FMAD 3HVDA 3QIAA 4CDCC 1GUWA 4WORA 4W9JA 1ZDVA 3TEHB 5J2RA 2ZEQA 2JE6I 4DV3L 1TS2A 4IUPA 2WYQA 1QUQB 1TWCB 3V3XA 4BKSA 4W9LA 2JP1A 5NUCA 5IP9H 1SYDA 1PTOB 2D9UA 2HCCA 1UZXB 1YQBA 5F2DA 3I9V1 3VYUA 1R4NB 2WKCA 2FBWB 4RM9A 1X56A 2A5UA 4XXEA 5ELDA 2FIDA 2CKZB 4S0RA 4FXDA 1Y1VH 2DJGC 4ZKBB 2MLBA 3K80C 1CKNB 2K0PA 2IGGA 3GTKH 3T1HQ 1I50H 3W5OA 3CC2A 3WALA 1Q46A 3BZDB 5GQOA 3U58A 5IWAQ 1PYBA 2HHHL 2GA4B 2L4NA 3URYA 3KW5B 4KZ0A 5EBDA 2LXCA 2N7JA 4DUYQ 2WIIB 1YNND 5GROA 4PZ8A 3SVMA 2L76A 1S4ZA 1K9MC 3DBRI 3H15A 1VQGA 1HA6A 1VS0A 2J0MA 4F7XA 2CHWA 1E6EB 1V1PB 3B0AA 3S16H 2BWES 3I4NB 2L32A 1V1QA 1GXDC 3KF6B 3CP0A 4G57A 4IO9A 1TIFA 4YWLA 4N8FA 4XTCS 4H44C 2E5LL 1D5ZC 4DNTB 5IGEA 2OEDA 4HJAA 4II3B 4JK1C 5I9PA 1SBBB 3A7AB 2JA7B 3CCQA 1LTAD 1R4NI 2ON8A 4DV4Q 1Z7TA 1VZ8A 1Q3LA 4CJ2C 1AZPA 4JI7L 3ULPA 1CKOA 4KHPL 1QLBB 2G1EA 1OTCA 1MVKA 3U4VA 3A9KA 3PT2B 4LFCL 2G9DA 3I4NG 3H3VH 1MHHE 2UUBQ 4ZUIA 5KYIA 2E2HH 3ULJA 2KFKA 4TKNA 2C60A 3PIP3 1A0IA 1XPUA 1PH4A 3A5ZB 4MJSA 4DQOC 4EE2A 5JJZA 1XNQQ 1IW7C 2F0VA 4FHKA 2W54A 2JA7G 2OTLA 4P1CC 4MTNA 1CQVA 2R6GA 1IPGA 2IX0A 5KNCA 4C2MH 2WAQE 3ZLZA 4GN4B 3DPDA 2NZOA 4IUVA 1LABA 3L13A 4A3FH 1HRJA 1WI0A 1TJEA 1AE3A 1FNUA 3KLSA 4JL9A 5BMIA 1VQ7A 1YNTE 4B9WA 4HR7B 1XNRL 1E0BA 1YX5B 1KRHA 2IJ0A 1YBYA 2GB1A 1IKMA 2EYOA 5C4XB 3A4SC 2N78A 5AJ3L 3CCVA 1SYEA 2K3UA 1V43A 3KK7A 1J7AA 4JI2Q 3A1QA 4HWIB 3WDNA 2PZWA 2VXWA 1LTSD 5FJ8H 2F0MA 3EC8A 1W6KA 3LYYA 2XSCA 1ZPSA 2MHJA 3JAML 3APDA 1QG7A 1SSOA 2KCCA 2RPVA 3CCEA 1PH7A 4E71A 1STNA 2TSSA 4YCUA 2N7DA 1NUCA 3EFCA 2LVPA 3MC0B 4ZKCB 3PO2H 3SR6A 3ZJTA 2XTIA 4R8IA 3L10B 2NVQH 3HM3A 1XEEA 3VHTC 2RA4A 4RMFA 1IP9A 2ZVNA 4IWOA 4FULA 5EKIA 4N58A 4BBNF 4EQOA 5C4XG 1ASYA 2DJFC 4P74A 3OW7A 2QA4A 1TY0A 1MBYA 4KY6A 2WDQB 1I4XA 1E90A 2D2QA 2CQOA 2GI9A 2PQAA 3LWEA 5DM63 1XWEA 3ZNGC 2EVBA 3HKSA 4A6QA 1E1TA 5GADC 1PGXA 1T0RC 2KMAA 2JA9A 3RNCC 1A3TA 1AW7A 3X23A 3E9HA 5CBEE 5J22A 1C4AA 1CJEA 2WXOA 2ZJRA 3BVGA 2KTFA 4W9DA 2EYHA 4JI0L 1LACA 1TWFB 1PRTB 1N36L 3GZNI 1PDQA 3CCRA 4LWCA 2BOSA 2YU9B 4NY0A 1C9OA 1FEHA 1WTVA 3VTWA 1PFNA 1GUNA 3JAMc 3N9YC 1IBLL 1JALA 2LGXA 3MJWA 3TBLD 2BYTA 1HZ5A 1EFWA 4G11A 3CF6E 2KFKB 2L0TA 2N88A 2L00B 1C77A 2Q8RE 5GMVA 2A74C 4B6WA 2EMSA 4HEA1 4FF1A 2Q2HA 1FFUA 2KANA 4BFRA 1FCCC 3RFZB 3C0RB 2B2WA 3AH7A 3QWNA 3K5NA 2R7ZB 2KQ7A 4B3ML 2BE5D 4ABNA 4JBMA 4HVBA 5J18A 2PO4A 2K32A 1XYIA 4KKTA 4NB3A 2JSOA 1QOFA 4MN3A 1SNPA 3K5LA 2LI5A 2F0OA 1YNNC 1HR0L 3HOYB 2LJ5A 3A1QB 3VR8B 4BBSB 1HZ9A 1WZ0A 3RUIB 3V2TA 3OTOQ 1VZ7A 2AWNA 5CHVC 2YTXA 3CC7A 4E3CA 3U2SC 3CC4A 2V4DA 4B3RQ 1AN8A 5FK9C 4CGYB 1OFFA 1I4GA 2ZXRA 3KDFB 4LDTD 3IAM1 4LFAQ 4A4IA 2R7ZG 4JYAL 3S2DB 4OXPA 4II2B 1XLQA 3TN2A 2FXQA 3N52A 1VCIA 4QIWE 4R4IA 1HCZA 5ELCA 1HNXQ 1I6HB 2F0LA 2NR2A 2WXRA 4MSQB 4BA1I 3EGRA 2LFIA 2RVLA 3HOYG 5M5YB 3GS2A 4AS1A 3DLLA 2K8CA 3U7DA 2OQ0A 4BBSG 1SAPA 2R93B 3TSSA 1NEKB 2K04A 4OWWB 3M4OB 4QUFA 3PLVA 3QCAA 4YSYB 3AE5B 3RMKC 1V81A 4MGYE 1NCVA 5BN4A 3DHHC 4KJNA 4PS3A 4ZHOA 2NN6H 2KEDA 1JICA 1Q0WB 1NE3A 2F0PA 4DAPA 2KD0A 3H0GB 1I4RA 1MG4A 2DZKA 3KYCD 5KEEA 4BBRB 4EVOA 4K0KQ 3DBLI 1JCKB 3CPFA 4WJWA 2OWOA 1J5EQ 2K28A 1BR9A 4DHZB 4MT5A 3UDFA 2MW5A 3AE3B 4FN2A 3K5OA 4ZLTF 4KGRA 3AE9B 1DXMA 5FO7B 2HQLA 4NPNA 5IT9L 2R93G 1DONA 1HTLD 1C78A 3D0FA 3A0JA 3CXCA 4PS8A 1F77A 2F0SA 3S9WA 4LJPB 3Q8EA 1OQQA 1MHWC 4KKUA 2CH4W 4FJYA 5M5WB 2K39A 1E3PA 2Q5WD 2K25A 2B2WC 4H13C 3H0GG 1E8YA 4HJ7A 1CFMA 4HMJA 2KOLA 3AU5A 3OLMD 2KX3A 2ZNVB 1S5CD 1FXIA 3HKZE 4N8X1 1PUTA 1DJRD 3MXUA 2EYJA 1WJUA 2O2LD 2I1JA 3FKYA 1HXYD 2N55A 1H9SB 4WH4A 3TS2A 1Q81C 4FJZA 2M56B 3PUYA 3OOCA 2WXQA 2KT7A 2NTTA 3Q8BA 2JF5A 4B0EA 2YYZA 4C3IG 3F2CA 2FE8A 1VQKA 1XD3B 1TS3A 1KFYB 4PYZA 2K5HA 1GUAB 2E75C 2HTHA 4OO1G 1XMQQ 4DR7Q 1OQRA 4ARCA 3V96A 1GOZA 1D2BA 3SFDB 4JI6Q 3GP7A 3HIZA 3RCZA 4GLXA 2LEKA 5GAEC 1U0LA 4KN7C 2DAFA 4PYUA 3P1MA 5J3BA 5DM73 1VQCA 3VDYA 2KHIA 4GLSC 2JT4B 2VL6A 4PG3A 4BZAA 5IOIA 1U4LA 1T3QA 1WX7A 2Z0SA 3ONSA 3QARA 1ET6A 1JWUD 2VQEQ 4OO1I 1EWCA 2XVSA 2WU2B 4BY1H 4YHHL 3A9JA 4HPMB 2O2VA 1NI3A 3S2HB 2IO0B 3BDCA 2M19A 5DLQE 5CMDA 5EE0A 4BWGB 5LXHA 3RLNA 2B2YA 1XCTL 5C0XH 3W5UB 2B63B 1SROA 5C44G 4A3OA 3MA2B 2Y5PA 3CCSA 3PVLA 2B2UA 1SNQA 1TWGB 1BQQT 2DLBA 2ZCCA 3MZ5A 4LTUA 1NTGA 1I4PA 2VQFL 2D5GA 2K22A 3R8BA 4LF7Q 2YTYA 1D7QA 1RAXA 1TGZB 4ZRQA 2GVAA 5ELFA 1S3SG 3AU4A 1OO9B 2O6VD 1KL9A 2KQ3A 1PFMA 1HUNA 1IGDA 1L1OA 4JVZA 5FLMH 2B63G 3RN5A 2M0AA 2BE5C 4IUMB 4X64L 1WFYA 5JVH3 4CKEA 1AYFA 3L08A 3ZNZB 3AV8A 4G3XB 2UYZB 3OYYA 5IP4D 2I5MX 2WGSA 3HOWB 1PH1A 1IZ6A 1IYFA 3I56A 4DAYA 4OL7A 2KTRA 3AB9A 2CU1A 5T8IA 1YMHE 1T0QC 4WQMA 3LX0A 2WLBA 4WFN3 4IUTA 4DR6L 1QZEA 1YIWA 2I38A 3NY5A 4OZCA 3J7A5 2WB1E 4DK1A 1WGRA 1PH5A 5GAHC 5CTRC 1VJKA 2G45B 2DZJA 2HQEA 3MC8A 4DBGA 4M1UB 1II3A 3S1NB 4R3DA 3B9JA 1JJGA 2J4XA 3NZSA 3RZDB 3HOWG 4B3SL 5L95C 3WOEA 4MH8A 1W6JA 4LDTB 5DPWA 4K7SA 4DDGD 1A8VA 2JK8A 1WI5A 4C1NI 3HOXH 1CA6A 3EIVA 4UHVA 2QKIC 4JI5Q 3J7ZC 2MP1A 3L17A 1EYGA 3Q3FA 2L83A 1E24A 2F0EA 3M85A 4ANXA 1TIID 4A75A 1D1KA 2IX3A 2DYBA 5DAUA 2DYOA 1E5WA 3S1RB 2B2YC 4PS7A 2EY6A 2WACA 2M00A 5C5LA 1RJTA 3A9JB 4PMWA 2B2UC 3NQTA 3FKIB 4UP9A 4DNIA 2RMMA 4AQYL 2EXDA 2O2VB 2OQKA 3NTIA 3PZ7A 1VR9A 2RCNA 5LMNW 1HNWQ 1DOXA 3HGBA 4A3DH 3TDQA 1HE8A 1VRAB 5HI1A 4LF8Q 1PH3A 3EHVA 2CFMA 2F1MA 5CV9A 2LJIA 1ESFA 3K57A 4FVMA 2HCIA 3DOWA 4M02A 2DENB 2N9EB 3ML9A 4X6AH 1K50A 1L1OC 2LSSA 2F0TA 3FHWA 3PUVA 4K5WA 5G3LF 2O6VA 3QK0A 2WXLA 5LMUL 4BKGA 2BH8A 1XCQL 3T1YQ 3FKIG 3SR1A 2KDMA 2IHEA 4X65L 4MTKA 4RGOS 1N61A 1JWAD 5G5HA 2KDFB 1YHBA 1PLFA 5I2YA 4GOPA 1V5TA 2IW3A 4WAAA 4A55A 1KDCA 3KFUA 4NAWA 1F1HA 4XQNA 3AEVA 2Z0EB 4YT0B 2EQSA 4ZAIA 2AEHA 2GOWA 2JU6X 2PTLA 2V3PA 5D7GA 4EOYA 1K83H 1WGKA 2WXFA 5IGDA 3AI5A 2DNFA 2NZ1D 3H94A 4CO7A 1C48A 2KTRB 1CSQA 2B29A 2R61A 2KK8A 3A4RA 4MGKE 3IKJA 3RNUA 2PMVA 1RLFA 4QAYA 1WXAA 4A3KH 4ZOHC 3ECIA 1ONLA 4ILWA 1FGUA 2PNHA 3AFQA 4IFDG 2EJGC 1MJDA 1C8CA 3WAMA 3KF8B 4EKUA 3BK1A 4P6VF 2O5IC 1B70B 3PV0A 2CU3A 2GLSA 1OXSC 3ZRFA 2KCMA 2XWJB 4JI3L 4JIOU 1VCBA 3Q69A 1ML0D 4DU9A 3CMEA 1B3QA 1IYJB 3OAWA 1K53A 1K51A 2Y5CA 4R4QA 1KHIA 2F3IA 2IY0B 3CSTA 3GE8C 1GUOA 1A2UA 3RN2A 3E9IA 1YI2A 1JJ2A 3BWUD 4DV3Q 3S1QB 4XZ4A 5E7NA 2KA7A 1AWDA 4RKLA 4ZQ3A 2BA0A 1O80A 3G4SA 3A8IE 4GKKL 3AE2B 4G0NB 3VTUA 1Z6HA 2AUJD 3HOZB 2QCZA 1K0RA 1N6ZA 4LUZA 4IALA 2PMZB 4A3MH 3M62B 4F8MA 4N9TA 4W9IA 2KLGA 4BAXA 2E2JH 1WR6E 4XDXA 1YJIA 4X3UA 2HHHQ 4LF9Q 2FFKB 2ZXOA 5C1ZA 4J1MA 2ZPYA 2Y0SB 2PCFB 3M4PA 4LUOA 4YWMA 1DGSA 2Q8TA 5M3MH 1WXQA 4GOPC 2KJRA 1EYAA 1TWHB 3K5MA 4UPAA 3M4QA 4NZLB 2O6VB 4C56C 3OIPA 4MEMA 3ZO5B 3HOZG 1EWYC 2RKSA 2N9PC 3L7ZC 4JV5L 2BDNA 2MA9B 5E1FA 1WR1A 3HOUG 3QIJA 2F52A 1N34L 3W1GA 1TZOA 2H89B 3RPFC 1WZ3A 5IODA 2E5LQ 5JEAJ 1C7YA 2Y0SG 3DWPA 2EMTA 3T4AC 1N60A 5JJLA 2K52A 1WMHA 1Z2MA 4G7ZC 1T5EA 3C1FA 3GTJB 4K5VA 5E4XA 3TQYA 1E22A 5KNBA 4KD3A 1OXXK 2ICIA 4TQUS 1LO5D 4LNNA 1S1QB 4KHPQ 1DD2A 2MSED 4WWOA 1Z47A 1ZE3D 4XC2A 3NUCA 4LFCQ 2UXDQ 5C5MA 1FXAA 4GSWA 3UI2A 2G4DB 3Q8DA 1CUKA 1SNCA 1ENCA 4XT1B 2JSVX 4NNJB 1L0YB 1KAWA 1NSNS 3Q24A 4OONA 5LL6S 1K52A 3HM6X 3WWVA 3IG3A 1SJHD 2W9NA 1R4MB 3VR5A 1OQYA 3I4NH 3I4MB 1BUVT 1HA5A 1E7PB 5IKCM 1KQSA 2LRUA 3GTMH 2LGDA 2JA6B 3VVWB 3J80E 2CJNA 2KZRA 2K6AA 3VH3B 1UD7A 2EYFA 4MIUA 2MP2A 2PNRC 4ODGA 2JA7H 1XNRQ 1VQDA 3H91A 5E3FA 3HOVB 1SYGA 3IT6B 1HUMA 5AJ3Q 4NQLB 4DR4Q 4WIPA 5BYQA 2IYDB 2ID0A 3ERSX 3EA6A 1YJNA 3I4MG 1GNUA 5M3FB 2B39A 2PE6B 3GTPB 5EKLA 1FFVA 1Q1EA 1ENFA 4ASWC 2BS4B 1JC7A 5CC4A 3GTGB 4MACA 1LM0A 5EAYA 1BCPB 5GXGB 1NY4A 1QOHA 3GTLH 5IO9A 3FEWX 4A3LG 2L5TA 3OMGA 3DBHB 1SNOA 1JW9D 2SAKA 3W9CB 4L1BA 1QVFA 3U50C 2IO1B 2MUYA 1XPRA 4BXXH 3NE5B 1L0VB 2RD0A 1RODA 1YIJA 5M3FG 2K75A 2MBQA 4G7OC 1UWVA 4FDBA 2BGFA 2BS2B 2VZAA 4A8XC 2H5XA 5C4XH 2EYMA 1YX6B 2VH1A 1CKNA 2ENBA 4DR3L 1E7UA 5CV7A 2E6XA 1HPCA 4P73A 1WMHB 1I4HA 1FCLA 4JG2A 3NELA 3PQIA 4JI0Q 2MBOA 4DNRB 3IFTA 1ICFB 2BDOA 1N36Q 1YJ9A 2PIAA 1H95A 5KIXA 4IM2A 1L0WA 4C1NK 1VDVA 4ITKA 2Q2TA 3RZWC 1EEID 2K03A 3N3KB 4GU2A 4PZ7A 1DGJA 1EY4A 3E5SA 4HEDA 1Q8IA 3W1BA 4A3EB 3H6NA 1V1PA 2DBYA 4GN1A 4B3TQ 3T8MA 2RDHA 1JMCA 1J7BA 2LGIA 4IURA 1K8AC 3KF6A 4FXKC 4REZA 2IO3B 3TEXA 1UWXA 1MFWA 1M94A 4CYEA 4ZDVA 3D31A 1I3QH 4R1JA 3APCA 3NP8A 2VRRB 3LJ3A 2UU9L 3CW2C 3T16A 4OHJA 3FP9A 3JYUA 3EROA 4RAUC 1WYDA 1T5XD 3NTKA 3PF5A 4C4VB 2E2IH 3VYSA 4B3MQ 2WS3B 2ZM6L 4X62L 2FNJB 2K6QA 3UQBA 1EZ8A 1TWFH 3S1MH 3FILA 1EWIA 2GRIA 1PRTD 3AMUA 1EF5A 2D0PA 2KVMA 1LGRA 1C4CA 4D2KA 3MHBA 1AFPA 2F0KA 1PH8A 2ZJQA 1P1AA 4MM3B 3PUXA 3MAQA 1K3BC 3S14H 1BKBA 2GN5A 3EFUA 2HDLA 4NW2A 2B2VA 3WA0A 1GJXA 3UDXA 1AARA 2LRWA 2L55A 4HCSA 1NNXA 2CHXA 4OVUA 3IFWB 3RLOA 2AKWB 3IFDA 3KH0A 2ZW0A 3BVZA 2EKEC 3STBD 4Y7NH 3W3AA 1HZBA 4OVVA 4GMVA 5D14A 4BA2I 2PZTA 2ONQA 4RGMA 3U4ZA 4C3HB 4FHJA 5EKKA 2DAJA 2A69D 1TR5A 3DCGA 4TRDA 3N1ZC 4JI1L 4XE0A 1FJGL 1OXVA 2R7ZH 3VA7A 4LF5L 1NMFA 2KENA 5KRUA 1WX8A 3AE1B 4CBVA 3ETRA 5CR3A 1V80A 4EX5A 3KJPA 2RPQA 2NVTH 2LGSA 1V9PA 2DNEA 3SD5A 2JY6A 1HNZQ 2YVCA 1QE6A 4MDKE 1SSNA 1VQ9A 5BO4B 3BJUA 5CV6A 4I7AA 1EEFD 5I2XA 1TKGA 3V6CB 1P3QU 1N33L 2JYOA 4LF6L 2BYEA 4GXBA 4C3HG 2JQRB 2WINB 5ELOA 1N32Q 4ZRKA 1TYGB 2JRIB 3A33B 3ZNHB 1PH6A 3D8GA 1G6PA 2K1FA 3M3JA 2GBRA 3J7AV 4V190 2CHZA 3NHEB 3HRZC 4F8CB 3LDZE 5K5PA 2CCZA 1Q90A 3KOJA 2K8BA 2L7RA 4I6PA 1A5RA 1TWAH 3T56B 4AIMA 5IGBA 1IBMQ 3NXWA 3A8JE 1M4VA 2B8FA 2PYKA 3GTOH 1NYQA 3KUDB 3MXPA 1BBUA 1XO3A 4GNXA 1E9MA 1Q86C 1BNZA 4P75A 2D3GA 3SDLC 3NEMA 1JE4A 2PI2E 3CQZH 4K6DA 1XMOL 4DV7L 1Y1WB 1F2LA 2N9XA 2W55A 1O7IA 4PK1A 1PTOF 3FRPB 5DNFA 1KTKA 2B2VC 3EECA 4FNFA 3FILB 4NQKE 3E9SA 3GV3A 1RRBA 4A93H 1LTBD 1MI0A 1P7FA 5ELNA 1WCMB 4IJHA 3VYRA 2PKOA 4L5QA 1QOGA 2HJ8A 3RZOB 4DR2Q 1ZXIA 1B50A 3BU2A 2CWPA 1LYLA 4EZJA 5A2QL 2XK5A 3AQQA 4C3IH 2ZVOA 1NR4A 1Y1WG 1C0AA 2FCNA 1OXUA 3NZ3A 1IHZA 4OO1H 2SOBA 1GM5A 4RGNA 1A3VA 5EPKA 4DPGA 3K58A 2IX1A 4USAA 1KNEA 2G9HD 1BO0A 4H2AA 4YHHQ 1WH3A 2M9VA 3AYHB 3IRBA 4HSVA 1MHXA 5IYBG 2WQYB 1WTOA 2AWTA 3AEFB 4R8NA 4O0AA 3MXNA 3UI3A 5CORA 2FCSA 3KQ4A 1WTRA 3E6ZX 3WCQA 4NDXA 3J81E 3BDLA 3NENA 4RH6A 2LHEA 1J7CA 2KDIA 3KDFA 4K81A 3HUIA 1BUIC 3ZUNA 3CKIB 4KHZA 4A9AA 4FXGC 1A3UA 3PIOA 4NAMA 4YY3Q 3OSOA 5C44H 4BVUC 4BY7B 1MKHA 3S17H 2BT6A 2X6GA 1QF6A 1E2VA 2WXPA 2L12A 5HGQA 4IPHA 2WDTB 1L7YA 3L0OA 2XIWA 4GNXC 3TBIB 2ALYB 4A3GB 3AEAB 4CHKA 4UY8C 4NJ6A 1Y14B 1HZAA 1PRTC 2DZMA 1X9NA 3S2HH 2CQAA 2JYTA 2ZCBA 3P7JA 1GC6A 1ZDXA 2QHOA 1VQHA 5D65A 3IVFA 4LNKA 4GN5A 4W9CA 1XTCD 2B63H 4GNXB 1PZJD 4BY7G 3TZDA 2EDGA 4WURA 5C3WA 1G91A 2JEAI 2R2OA 1CHPD 5JJKA 1V2YA 3LGJA 4DR5Q 1JMLA 2AQ3B 3AM9A 3N1XC 1KIXA 3EFXD 1I94L 2R92H 2DUDA 4N9PA 4A3GG 2KWDA 2NYZD 3PGEA 3U9SA 3K7AB 1HZCA 3STBC 4JI4L 2RHQB 3OMCA 1MIUA 4RFBA 5C4HA 1RCVD 5ISRA 2KXJA 4GDKB 4GOCA 5JJIA 4JLCA 3ZYYX 3DWMA 4WQOB 1PQSA 2NWGA 4B3SQ 3PS6A 2A69C 1KH0A 5EJWA 1UBIA 4G4KA 4AWJA 2NVYH 3Q3MC 1T6BX 4OWTB 3H7SA 2K1BA 5C4JB 1GKHA 1CK1A 4G7HC 3A7LA 5FKAC 3GO5A 2XK5B 3W1SA 3NVYA 2V9HA 1DCZA 4AYBB 3M95A 1H9SA 1I7HA 4XWTA 4IUNA 4IC7B 4FYDA 2VUMB 4C3JB 4L5RC 4DUZL 1T0SC 2JA5H 2BPSA 3EN2A 4HROA 2EE1A 2EKIA 3SFEB 3CU7A 2KWUB 5M5XH 3U9OA 4DXGA 1DYQA 4C00A 2K33A 1UAPA 2V1CC 3LXFA 4JE3B 3MXNB 2WXJA 4GIVA 1YOVB 1VD2A 3RD2A 3S2AA 2A5HA 4NXML 4XQQA 2MJDA 3C19A 4RF1A 3EQLC 4ANWA 3SK5A 1E1OA 1EY8A 5LMUQ 2RBMA 4C3JG 2VUMG 3SU8X 1FR3A 3ONAB 2X6LA 1JWBD 1Y56A 1AZQA 4EUTA 1BBXC 4I7ZC 2K6DB 2WWZA 3GE3C 1H9MA 4MSMB 3LNNA 4XDCA 1Y1VB 3ZDMC 3QG1A 3GTKB 2J42A 2C7HA 1I50B 2B8GA 4PT5A 3AE4B 3R7QA 1SDFA 2D3CA 1GVPA 2ZT9C 4K8JA 5H8YE 4ZCKA 4LFBL 2JRHA 3VXWA 3C1EA 1EM7A 5GAGC 3G6JB 1VDZA 4HCPB 4GLVB 2INDC 5E4WC 1L5PA 2QEJC 1RFAA 2NTSA 3UDGA 5EE9A 1JQ4A 2RDBC 3I4OA 1Y1VG 3S16B 4WAFA 3L16A 4ICVA 2D3BA 2ZNVC 3A8KE 1HFGA 3V05A 3G6EA 3W1SC 1E2WA 1X1MA 3RUZA 1GHKA 3RI7C 2UUAL 4GDLA 3VUYA 4KY7A 4RGTA 3QC8B 4RM8A 4AQ7A 1SIFA 4X3KA 3L54A 1BMLC 3T1HL 1MSHA 2QJLA 4BBRG 1NDDA 1RHPA 2C9OA 4ACFA 3GV6A 2NS5A 1IBXA 5TR5A 3RNGC 5JPMC 4KKSA 1EQQA 4EZLA 1E7ZA 2N1VA 4QB4A 2WXMA 3BINA 5DPRA 3DVGX 4HCEA 4DUYL 2WU5B 3J9CA 1B3AA 2WP9B 4GKKQ 1FD7D 4LJZC 4G50A 2E2HB 2HD5B 3FDTA 4A3PA 4HK2A 1E8XA 1JJCB 4EQ5A 4P16A 1GD7A 1B1ZA 1F9SA 1ZXHA 4KIKA 3UDIA 4RA8A 3S15H 3PO3H 2Z6BA 4UAIA 3F2DA 4A3CG 1YJ1A 1K73C 3PLUA 2P5ZX 4MNOA 3I57A 4LAAA 4C2MB 2K05A 4DXAB 4ZRIA 3BVMA 3KWVA 4B08A 3OJ4B 1ZP0B 1IKLA 1Y8NB 4A3FB 2A73B 3Q6SA 3D4DA 1RF2D 1FGBD 2MNAA 4DAVA 4L5TA 3JAME 1A70A 3P4PB 3SDZA 5C3EH 3NUHB 3X3MA 3QO2A 4TV3A 3ZTCA 1KABA 2KFJA 4IW0A 4CJ0B 1SYFA 3OWFA 3KYDD 4IQZA 3EUB2 4DK6C 1BDOA 4WJ4A 2IO2B 5IYDH 3RYTA 4HIMA 1OGWA 2NBVB 4RWSC 2C9WB 1IBKL 2UXBL 1B9NA 4APVA 2N8NA 1SFOH 1K0SA 1K28A 3HOZH 4YTNB 2L15A 4A3FG 5EPJA 2MJ8A 1E2ZA 1QB5D 2A6HD 3J81j 4A3IB 1XNQL 3PO2B 1TTNA 2M1MA 1KD1C 2WXHA 1MI2A 3HOUH 2NVQB 3LWUA 3KUZA 3PRZA 5E6PA 3KWLA 1I42A 3NVZA 2F4IA 2HTME 3WANA 4IPCA 5C4ZA 3Q3NC 3AE6B 4ZHPA 2NPTB 1OXTA 1PYWD 3NWSA 2Z6KA 1C1YB 1GAQB 1JB3A 5FJ8G 1UELA 2NCNA 3P63A 3VUWA 1PMRA 2LXKA 3MC9A 2INPE 1Z9FA 1N63A 3UIPB 2QW7A 1X65A 2A8VA 4HPLB 4Y52H 3M7GA 1F9RA 4H02A 4HIOA 1KRSA 2EJMA 4A3IG 1KAAA 3D3RA 4JCVE 3PO2G 1YQ4B 2FCMA 1U4MA 1R4QB 5L37A 1EF1A 3RR5A 4GDLB 2JA8B 1WOCA 3T53B 2QSDA 2W3SA 1EWHA 2BW2A 4JPSA 2HD3A 3AEBB 3HFZB 4L23A 2BBCA 1FO4A 3CIRB 1J8CA 1K8GA 1RWSA 5IOCA 5K36G 3N30A 3I90A 3Q8CA 1IBXB 2EY5A 5T1GA 2QCPX 3ZJVA 4IUUA 3GTJH 3VR6A 1EO6A 1U4AA 4K2KA 1TBEA 1A6XA 2LMCA 1VLBA 1H8CA 1PFBA 4WJ3M 1JWMD 4QCLA 2DN8A 2JYEA 1EUVB 1P16A 1DOLA 1WXVA 1BF4A 1B9MA 2EELA 3MHSD 4FJVB 4A90A 4FBJB 2BTEA 3FMCA 3KF8A 3PSIA 3J80i 4DR1L 2K5WA 3VR4A 1MJEA 2JA8G 2D07B 3DBSA 2RSUA 2L3ZA 1MSGA 4IFDJ 4IM3A 2OF1A 1ZW7A 4N9F4 5LLIA 5ELBA 3AULA 4TVAB 2OTJA 4X66L 2ACZB 2ATWA 2LY7A 1O78A 3PF4A 2VH2A 4W9KA 2PW5A 3BZKA 1XT9B 3TMPB 3U7ZA 2BYFA 1I5FA 1JOOA 5C3JB 4U673 1M90C 5AUIA 1D5MC 3AXCA 1VQJA 5FLXL 2RHSB 2UUCL 3K0YA 1WGDA 2F0UA 1YNJD 3DVGY 3VAWA 1V49A 4A3BH 2VB3X 3QOJA 4YCWA 3J7YW 1JT8A 2SDFA 1TKEA 3OPOA 2BQQA 3AEDB 2ZJDA 4DV5Q 2AYOB 4DR3Q 1QWYA 5IY0A 4GKJQ 4X3TA 5IGGA 3MFYA 5IP7H 2B3AA 4M00A 2Z6KC 4X3SA 1ZUD2 1G8ZD 3F2BA 5LMNL 4MHEA 3BIID 4GN3B 3VR2A 4ZRZA 5I4DA 5JEAH 4M8NA 4OIKA 2FMCA 2JWUA 5E6NA 4NJ7A 2I46A 3PCOB 4JOIA 3QJZA 2AUKA 1BCPD 4KKIA 1ICWA 1UWMA 3D4WA 4P72A 4QGUA 5E6OA 1UE6A 2L1BA 3KJOA 3D6CA 3NSWA 1B44D 3ZJYC 2A68D 3IL8A 1E7VA 4LLGM 1K3RA 3D4RA 3ZVVA 1F2RC 5IT9E 2JUOA 1VF5C 1S40A 2JZPA 3I4LA 3E3XA 3OTOL 3CD6A 4TKOB 4QJFA 3A5UA 4ZYSA 1WD0A 4OEMB 3O65B 2RGFA 2UU9Q 4ANUA 5HKHA 4LNIA 1EU3A 2M2LA 1HJPA 1LT4D 1DZ1A 5FLXc 1YN4A 3NK9A 5LNK1 1KDAA 3NVWA 2Z4IA 2LUMA 2PZUA 2ZM6Q 1PYSB 1T9HA 1AP0A 4KX6B 3VR3A 2H1EA 4KVGB 3J80c 1WE7A 2LMCB 1A2TA 1S5BD 3SXHA 4WRDA 1NR2A 2NN6G 4OZBA 3PTFC 5IYCG 1EOVA 1Q1OA 1N62A 3G7LA 2XBBC 1R9TH 3B6YA 1WGGA 4IWPA 4QL5A 1ILQA 2JN4A 3H9DA 4KLKA 1FIQA 4K7WA 3M3YH 3EBEA 1HQRD 1EUJA 2O4XA 3L9AX 1F9JA 4W9EA 2A6HC 2WKDA 2GVBA 4K0KL 2NN6I 1Q7YC 2ZJPA 4IFDI 3RZFA 5M9OA 2RCFA 4KI0A 4R4CA 2KLCA 1X3EA 1H4RA 3Q2AC 5J17A 4XWWA 2MEKA 3RN9C 3K7UC 1FJGQ 4HJGE 4TMAB 4LF5Q 1SE2A 2K01A 1UBQA 3V61A 3PREA 3DDCB 4ALPA 4JOIC 3BG3A 1F2RI 3OIQA 2Z9HA 1DOMA 2X8XX 3ZQ4A 3GTQB 4KGTA 4JI8L 2K5VA 1UH6A 5EE3A 1TT5B 2NVXH 1AE2A 2EZVA 3I7FA 4LF6Q 1X3FA 4UP8A 1Q10A 2D3AA 2CW0D 1A15A 2BYVE 3Q3JA 2NZHA 5JH5C 5C6AA 1SLJA 2IT1A 1B2TA 2KVRA 1SMXA 1VQEA 1X32A 2K7VA 5CV5A 1XLPA 4BY1B 3BYTB 1F2YA 4OVZA 4ME3A 3NS1A 4HRSA 2KQ4X 4C3HH 3PGZA 2M4NA 2QDBA 2WAQB 4O1NA 5EPLA 1TWCH 3R93A 1D1IA 1SE4A 4ZK9B 1QOBA 2CWAA 2JXMB 1EY7A 1M8AA 3AU7A 2QGQA 1PTOH 4KDIC 4DHZE 2Z8LA 2G4SA 3L4PA 2JZZA 3UE1A 3KVFB 3VQIA 3V60A 2KN5A 3ZRCA 4TQ0A 4DR7L 4FF2A 1K8MA 2RF4A 2L05A 4J8QA 1HEZE 3OW2A 3AE7B 3CRLC 4DV2L 3LB8C 4DV7Q 4BY1G 4F88A 4JI7Q 3WAOA 1NVID 2BB6A 3ML8A 2WAQG 2UXCL 4W9GA 5C0XG 3BDOA 3ITPA 1UE1A 4YWKA 4W9FA 1SEBD 1WTWA 1C4PA 3NS8A 4EGVA 1YEZA 2PVGC 3J7AF 3CCJA 1F2MA 1YNJC 4CDEC 2INNE 5JXVA 2G5DA 3AEGB 2E8GA 1QCBD 2DY7A 3R66C 4FA6A 2PPHA 3T51B 2J0JA 4CJ1B 1XQQA 2MRPA 4C4VA 3AFPA 1P98A 2J7ZA 2FAZA 4TQ1A 2OCEA 4LF7L 1CMXB 5JHBA 1LT6D 1RKNA 2L0CA 3DHGC 3AN1A 2LXJA 2KHWB 1TZ1A 1N9WA 3MWYW 1KC8C 4XGAB 1I35A 2HE7A 3JW0X 1BCPC 3OG5A 3P4QB 2ZXPA 1YHQA 1NENB 2K9XA 2X38A 1WRIA 4MM3A 2VY3A 2L8JA 2BCOA 1YN5A 2IZVB 3R3MA 4A20A 2DWQA 2MO0A 2JA6G 3HOXB 3Q8AA 3RT3B 2A68C 1ZGUB 4N59A 1YITA 1HHVA 1XLNA 3VA5A 2IL8A 4M8MA 3I63C 1WTQA 2OJRA 2AQ1B 1PDXA 3HOVG 2NBFA 1R4MI 2Z0DB 4E74A 3I72A 1EFID 5CV4A 4JWSC 1L6UA 1CZPA 3ZIMA 3GQBA 1EY5A 1WTHA 1DOKA 1FPYA 3T3OA 4J6HA 1TS4A 4QQBX 3NWTA 1A62A 2JEBI 4A3DB 3K8AA 1EY6A 3J81i 5AZFA 4OX9L 4QF4A 3CF5A 3HOXG 2CJOA 3Q22A 1HQMC 3X3NA 3MJ5A 1D6EC 2YEPF 3BK2A 5L83A 3JSVB 2R2QA 5I9OA 2F0GA 5C23A 3HVZA 5KNDA 3TCAA 5AFWA 4YTMB 4ULLA 4YWGG 1DOIA 5C3XA 3AMZA 1EQRA 1F9QA 2MFIA 3RMHA 2M17A 3U4EG 2LKVA 2WHIA 1PZKD 4S3SA 1I94Q 4K7UA 4DK5A 1BOSA 2VB2X 1WD1A 4A3DG 1ACCA 1G2TA 2JXTA 3G48A 4OGQC 1E8WA 1S72A 3VTVA 1FD6A 1IBLQ 4HJKA 4K3BA 1XTDA 3PUZA 1WXMA 4K6LA 3J81L 3MTNB 2EYPA 2W3RA 1KDBA 5JVG3 3E0EA 5AEKB 3DBHI 2PVOD 2A4ZA 1HNWL 1GB1A 5KYLA 3HZXA 4QIWB 1PFDA 3FVQA 1UEBA 3L2PA 3ER0A 3QJYA 2FUG1 2MX2A 3ZTDA 2K5PA 4EEWA 2M0XA 1YHAA 4YL8A 3Q0AA 4X57B 4A3KB 1CA5A 3HEJA 4DV6L 1LT3D 2WP8J 1LTRD 1HTOA 3N32A 2K5QA 4NKLA 4A3EG 4LNFA 2VZKB 2MBBB 1STGA 2R7FA 2DNCA 3C46A 3MP9A 2CW0C 1SR3A 5HHDG 2YU9H 2E76C 2EPBA 3TUOA 4C80A 3MHZA 2KACA 1HR0Q 3NHHA 2DGYA 3OHXC 2A1AA 5C2TB 1FNWA 2DY8A 2QEXA 2DX5B 2K14A 3U52E 1FRDA 2GBMA 2NMQA 3RNFC 4HMIA 4EQNA 1JRUA 3AB5A 2MO1A 1Y69U 4U68A 2E3TA 4A3KG 4RG1A 3HK0A 2V3NA 2KC2A 4NXMQ 1NBFC 2L11A 2I0QA 1SYCA 1X3GA 2MBHA 3PRMB 4HKZE 3SE0A 4JYAQ 4XX5A 3PPAA 2RSNA 1SNMA 2CKHB 4AOFA 1EIYB 1STHA 3VR9B 3Q23A 2KHSA 2KMCA 2JZ3B 1T0YA 4XDDA 1LT5D 1AEXA 3DMUA 3J81c 2AHOB 3SGIA 3KBGA 4A3MB 1D4BA 4HAEA 2Y3AA 5T1IA 3HKZB 4L8JA 3M63B 4LF4L 2Y5BB 2E2JB 4POFA 3JC66 1W2BA 1UGMA 1ZXTA 3ZXRA 2JWZA 1PXUA 1EIGA 3UQAA 2KVZA 3PUWA 3HOYH 4DA2A 3DBRB 5M3MB 4EFOA 3T9LA 1JE5A 4BBSH 5BN3A 2IY1B 4JQWC 5EBCA 2F03A 2KWCA 3DXJC 3RNAC 4OWXB 1STEA 1QT9A 3DQVA 4P1BC 4A3JB 3ULLA 2PEAA 1SE9A 4A3MG 3HHMA 1PFSA 1B4OA 3QAQA 3HKZG 3S2DH 1R4PB 1Z5SB 2KAJA 4L2YA 2AL3A 2OHFA 1X3QA 3TJPA 2UU7A 5BMGA 1I6HH 3D6WA 1X55A 1F52A 3H8HA 3PIPA 1EOTA 2UUAQ 2KUMA 2IHFA 5M5YH 1Y8PB 5M3MG 2ZPNA 2RDGA 2NUCA 1QZHA 1KOTA 2R93H 1MG8A 1P7EA 2N7EA 4HLEA 1EIHA 3M4OH 1VQ5A 4DV0L 4LF9L 3QWZB 4FADA 4C7ZA 2V0GA 2Z1CA 4A3JG 4JW0A 3BS1A 2OJWA 3ZDTA 2N3SA 1LFDA 3H0GH 1GUTA 3R2TA 1EQTA 4BBRH 1JOQA 1K8OA 1S3OA 4HKQA 1LQBA 1IUEA 1PHJA 2WXIA 4GDKA 4DHJB 3R3OA 3DEOA 1ENAA 2Q2IA 5D2MB 1SMYD 3EJIA 2QDLA 1TVXA 4POGA 2CH4A 4WJPA 3K81C 3FAHA 3GTMB 2FIFA 5D3IB 3OJ3A 4NXNL 2XEWA 4RCOA 5M5WH 1TS5A 2HUGA 2EYLA 4A3CH 3Q8FA 5D6JB 4BBNC 1C9FA 1J8IA 2PMZE 1SN8A 4GS3A 3DWAA 3I8ZA 2ZTDA 2LASA 2N0SB 3B1LX 3I3TB 4C7YA 1EY0A 1ILPA 2BB5A 2MCNB 2UXDL 1W3SA 1WCMG 3IAYA 1GO3E 2Y0SE 5KHQA 4KKJA 5EGTA 2C35B 3BZCA 2B3GA 5IIFA 1IBKQ 2UXBQ 1WSPA 2WXKA 3PSEB 3C8YA 4US8A 5FR3A 3PRPB 4JBJA 1WJJA 4ARIA 3JAMi 1YVCA 4KHVA 4UDUC 1IYVA 4YTPB 4IWQA 3FPUB 3GTLB 1JORA 1EIFA 3GDEA 5BN5A 1B8AA 1ET9A 1KLUD 2EXZA 1LTGD 2SNMA 2WB1B 3K6OA 4DGZA 5IE8A 2AX5A 2J0KA 4DXFA 3KBXA 5DEHA 3VRAB 1ROEA 1VQLA 3SK8A 1SE8A 2K5DA 2VQFQ 3I55A 2I2YA 4KZCA 3H09A 1WVLA 5CHFA 4Q2JA 1ZYRD 2K4KA 4DWFA 4S17A 4RKBA 1H9KA 1LTTD 1WTXA 1ISNA 4DR4L 2XWBB 5BR8L 1KLVA 3C3LA 3GZNB 3HS0C 4X64Q 2WB1G 2YLMA 1JR0D 4KSLC 4Q5VA 3NVVA 2MHVA 2LHDA 3F2UA 1NBWA 4OZAA 3ERQA 4BXXG 2V4LA 1WFQA 4A3IH 1Y8RC 3GTPH 5MPOA 5FO8B 1L2FA 1HFNA 2A6ED 4J15A 1WE6A 2BKFA 3S24A 5HURA 1CZGA 1OTRB 4DR6Q 3SK6A 1TWGH 2IGDA 2B2TA 4JX1C 3BY4B 3A55A 3D32A 3JVZX 2F4VL 4JGHB 5K36H 2EIFA 2EY1A 2TMPA 4PZ6A 4XT3B 2MJ3A 3ENEA 4WJOA 4DR1Q 1I3QB 1X54A 1SE3A 2V3SA 1C76A 1UEAB 2XGTA 4OW0A 3TP6A 1Q82C 2LGYA 1FL0A 2WFWA 1RYJA 4FP5D 2BA1A 1X6OA 2I5LX 4X66Q 2JA8H 3SEBA 1XPOA 2KJ6A 3TIXA 2E2IB 4KTAA 4WJNA 1IL2A 2PW7A 1QNKA 1FYCA 4HIKA 3T3NA 3QOLA 3HOWH 2MWSB 3S1MB 1UE7A 2QDFA 3PIO3 1YD8U 3DM1A 3F1ZA 2UUCQ 1TKYA 4AP4C 3EVQA 3A9KB 4UP7A 1FM0D 2BWFA 1L4ZB 3TEWA 3S14B 4XIGS 4KJOA 2O5JC 4GB9A 1N8RC 3RNBC 1O7ZA 1SIJA 1NI2A 4AQYQ 4B3TL 1O7LA 1R7SA 2NBUA 1H9JA 4MJSB 3B08A 1LLRD 2MJEA 3E56A 5AZHA 3U8ZA 1ZKHA 5LMNQ 1VQFA 3S1NH 4K8IA 2WXNA 3RZDH 3P4SB 4AJWA 4Y7NB 4AYBG 2GBKA 5CX3A 1PRTF 5H92C 4ICUA 2KHJA 5E6JA 1CI3M 1U4RA 4V0BA 1C4QA 3K0XA 3QR8A 4P2CB 3V6EB 4PQXA 3WIMA 2R7DA 3ZNID 2Z4HA 2F0FA 2KKCA 4X65Q 3PHXB 1HR0W 3A54A 2NVTB 4US9A 3S1RH 3DBLB 5G3LD 3W1YA 2WV6D 3ZXVA 3KYHC 2FMMA 3FKIH 2B2TC 3TMEA 4DV1L 3ZW3A 3CSFA 4N6EB 1SMYC 2IGHA 4LW1A 1OEYA 2A19A 1QKZA 1DM0B 2SEBD 5IP9G 2XRQD 1VQ4A 1RTOA 1VMPA 3QX1A 1H9RA 2D5DA 2NPTA 4I6LB 4LK0M 2BH2A 3MVVA 3T13A 2KYWA 4ZRJA 2GMIC 1HTQA 1TWAB 2RQXA 2ASQA 4OELB 3GTOB 2NB0A 2OXPA 1P0RA 4XYQA 4PV1C 2WX0A 5KHOA 3RNEC 1V8QA 2E74C 2PQAB 1J9OA 1CM9A 4JI3Q 5DPTA 1IXRA 3H3VC 5G2NA 1HNZL 1STAA 5FO9B 5KGUA 4IFDH 5IYCH 3CQZB 3SK4A 3PZDA 5IWAL 1OEYJ 1CQFA 2CS4A 5CV8A 4B9XA 4BOZB 3CCUA 3VDZA 3SHLA 1CT1D 4K5XA 1N32L 5A2QE 5JAVA 1WGYA 4HXDA 4A93B 1VQMA 2F0WA 2KN4A 5CHWA 1VF7A 1MPEA 2J53A 4ZYNA 3L3OC 2DHZA 2MQHA 1XXGA 3TEYA 3O13A 3V62A 4HJ8A 2K8HA 4CKBA 3VFKA 2MPMA 2OOBB 1ZYRC 4M0WA 5HG2A 4O2DA 1IL8A 4LK1C 4JI8Q 4CDDC 4C3IB 1IBML 1WIAA 1U5KA 2IWHA 3NTHA 3R2IA 2HDEA 2LWPA 4HN7A 1FNVA 3DEPA 3CCMA 1CHQD 2JVCA 4A93G 1WTPA 4DV4L 1LTLA 2D2CC 3ZKJC 1V5OA 1EQVA 5FR6A 1VQPA 2QILA 2F0HA 4HSPA 2A6EC 2HIVA 4JV5Q 1JOKA 3S1QH 1XF5L 3CWIA 4YSZB 3QB3A 1N34Q 3N1YC 5BYSA 1J6QA 2UUBL 1SGHA 1M1KC 5G55A 4DR2L 4Q0FA 2D11A 3H3VI 3W5VB 2FCQA 1RD9D 1EU4A 2G3QB 5H1SE 3GB1A 4AJYB 1I6VC 3GTQH 1RDPD 5C44B 5D94A 4DV2Q 3APFA 3S17B 1JWSD 3M4YA 3PMFA 1YZ6A 4KMUC 5IT9c 2IDYA 4IM0A 1WXSA 3CCLA 3IT4B 3HP3A 2UXCQ 1TU2B 2ZZPB 5JPNC 3H7PA 1E10A 4HIDA 2J0TD 1TWHH 2C5LC 2KMMA 4L63B 1PH9A 2C7NB 1GJZA 1G6ZA 1WYGA 3TL5A 3B2GA 3ICEA 4NMZA 1S5ED 1GUGA 5ELEA 3ABVB 2K50A 1EYCA 1P9DU 4JI2L 2WXGA 1PA6A 4ZRPA 2KBNA 3KUPA 3DVNV 4PMCA 2F0QA 4NJCA 4JBWA 5BMHA 1B7YB 2KEEA 4MELA 1SF0A 4JPBW 2R92B 4KDLB 3NG0A 2Q8IB 2N9LA 4HJ5A 1BXTA 4YY3L 1RM6C 5IN7A 5JOBA 1V6EA 1G2SA 3E0JA 3GOEA 4IPGA 4HJ9A 1WWTA 4OIJA 3VRBB 1Q12A 1S5DD 4IOIE 2C7MB 1BBWA 2D62A 2WDRB 2GBNA 2NVYB 4NPSA 3PZ8A 2KDBA 4GGQA 4CDFC 3X0WA 2F3WA 4M0WB 4GZYC 1GPXA 1EL0A 5DCNA 4NP5A 2M8SA 3TZUA 2R92G 3I4MH 4IN3A 5HGTA 1ZKOA 4I65A 3N6RA 2JA6H 3NOBA 1UF0A 5HFYA 1GB4A 4DK3C 2JA5B 3ZJUA 1U9RA 3OWEB 4DR5L 4HTHA 4URKA 4IOCA 4FF3A 1J19A 5M5XB 4A3LH 3FC4A 2QMTA 4DK0A 1HH2P 4OX9Q 3HOVH 3NBHA 2PI2A 2LVOA 1UNSA 3J80L 3F8TA 1B53A 2KCNA 1WJ6A 1UUPA 1PGAA 1XX8A 4FLHA 4CHTB 1V97A 1B9RA 1D3ZA 4YSXB 4L6TB 2MBEA 4IDIA 5M3FH 1CZWA 1L4DB 4KV6A 4LUVA 4W9HA
chains in the Genus database with same CATH topology
3P1HA 4QMGA 2PW9A 1E0ZA 1HTPA 3I73A 5IGCA 4YIJA 1EYDA 2H4OA 5CYUA 2E2DC 2HDMA 3MXGA 2WNMA 5LL6X 2DYMA 2PLPA 1Y8OB 1CTMA 1JQYD 3IAS1 1L6VA 1VZ6A 4RHSA 1C79A 4IKGA 4B0MA 2RSOA 2W82A 1N5XA 3KLRA 4ID6A 3P42A 5C0XJ 4KK7A 1TY2A 2V4IB 4Z9CB 2PQEA 5EE1A 1V8CA 1SYBA 2F0IA 4R9WA 3C2PA 2MGSA 1F0ZA 2KJXA 2RDFA 1V1OA 4BS9A 3P20A 1YQ4B 1QILA 3BIID 1LTID 1S5FD 2EOTA 3CHBD 3S15B 3PO3B 2C5CA 3ND9A 1YJJA 4LMQD 1KLGD 2QF7A 2VZKD 2J52A 3H6MA 1ZEQX 1NAPA 1LV9A 3I70A 3RD4A 2F0DA 5C3EB 1RFKA 4QUCA 3P4RB 1SNDA 1PZID 4FXCA 1QNUA 4CKCA 1KF6B 4KN4C 2N9KA 4XQJA 5IGFA 4IUQA 1SFOB 3AECB 5CBAE 4DF7A 5FOBB 5J39A 3VYTA 1I4QA 3HOUB 1IGCA 3P75A 3NRZA 1QJOA 2MH7A 2XRSD 2QIEB 2F0NA 3AE8B 2H88B 2IPKD 2XNAC 2XN9C 2L52A 3WOFA 2LFNA 5A35A 3W2DA 1F9PA 1GUSA 2I07B 1QQRA 2KECA 1KNAA 2EY2A 1MD2D 1TT2A 5I6YA 1X3PA 3TP8A 1PTOD 4WWMA 4TSSA 4NAWB 1FRRA 3PO0A 4ZUJA 3MEHA 3TP5A 4O42A 1NYRA 2PPBC 3TP7A 1MGSA 2OEOA 3IXSA 1GHJA 5C0XI 3CRKC 1PGBA 3I91A 5D3DA 3MFGA 1UGJA 3I3CA 1SB3C 2OT2A 1O7YA 3MTSA 3DHQA 4K14A 5FLXE 1G291 1D5XC 2YEPB 1IYUA 1EY9A 4YXDB 2CVRA 1STBA 1SXTA 1QOAA 1N5WA 4ME5A 4F87A 4PNYA 4A3BB 2R3ZA 5CGKA 2X69A 4J3OD 2LS01 2AQ2B 5I6WA 3FPPA 1ESRA 3DUZA 3AEEB 1EZ6A 1DOYA 4M8AA 2WDVB 2F3VA 3B2FA 2FHTA 2BS3B 1F2ZA 4DN4M 3ND8A 4RCNA 1ZOYB 3BYYB 1IW7D 5JEAG 4FO2A 1XLOA 2FJ2A 3A56A 2AWOA 1K83B 1BCPF 4RNAA 2FINB 4E6IA 4K2LA 1L0XB 1YN3A 5J1ZA 2CHBD 5AUKA 1TKWB 3RLFA 3GD7A 4RF0A 1U4PA 3HRDD 4IZ8A 5EQ0A 3HG9A 1VMCA 1RTNA 3K59A 4CQNA 1R9TB 4XYOA 4H7BA 3KLSX 5TSSA 2JX5A 4FF4A 3NBIA 1STYA 5G5GA 2L9HA 2ZW1A 4EQPA 3M3YB 1JROA 2SNSA 4KD4A 2EJFC 1JRPA 3NPPA 4JWUC 3DWGC 4H0LC 5LHY1 2ICEC 4RHRA 4KY5A 1TQOA 2B76B 1Q1BA 4PMBA 3ZGZA 2L1AA 5BYRA 2NVXB 1YQ3B 2VNUD 3TEZA 2F0JA 1SJED 3DWQA 4DFAA 4KGSA 5COYA 3M7NA 3NQIA 1PTOC 1HZ6A 1FMAD 3HVDA 3QIAA 1GUWA 4WORA 1ZDVA 2JE6I 1TS2A 4IUPA 1TWCB 3V3XA 2JP1A 5NUCA 1SYDA 1PTOB 2D9UA 2HCCA 3I9V1 5F2DA 3VYUA 2WKCA 2FBWB 4XXEA 5ELDA 4FXDA 4ZKBB 2K0PA 2IGGA 3BZDB 2GA4B 2L4NA 3URYA 5EBDA 2N7JA 2WIIB 1YNND 3SVMA 1S4ZA 1HA6A 4F7XA 1E6EB 1V1PB 3I4NB 2L32A 1GXDC 4G57A 4XTCS 4H44C 2OEDA 1D5ZC 4DNTB 5IGEA 5I9PA 4JK1C 1SBBB 3A7AB 2JA7B 1LTAD 2ON8A 1Z7TA 1VZ8A 1Q3LA 4CJ2C 1AZPA 2G1EA 1QLBB 1MVKA 2G9DA 1MHHE 4ZUIA 5KYIA 3PIP3 4DQOC 4EE2A 5JJZA 1IW7C 2F0VA 2W54A 1CQVA 2R6GA 2IX0A 5KNCA 4IUVA 1LABA 1HRJA 1TJEA 1FNUA 3KLSA 5BMIA 1YNTE 4B9WA 4HR7B 1E0BA 1KRHA 2IJ0A 2GB1A 1IKMA 2EYOA 5C4XB 1SYEA 2K3UA 1V43A 3KK7A 1J7AA 3WDNA 2PZWA 2VXWA 1LTSD 2F0MA 3LYYA 1W6KA 2XSCA 1ZPSA 3JAML 1QG7A 1SSOA 2KCCA 2RPVA 1STNA 2TSSA 1NUCA 3MC0B 4ZKCB 3SR6A 3ZJTA 4R8IA 1XEEA 2RA4A 5EKIA 4N58A 4EQOA 3OW7A 1TY0A 1MBYA 4KY6A 2WDQB 1I4XA 2GI9A 3LWEA 5DM63 1XWEA 4A6QA 2EVBA 1PGXA 1A3TA 1AW7A 5CBEE 1CJEA 5J22A 1C4AA 2WXOA 3BVGA 2EYHA 1LACA 1TWFB 1PRTB 1PDQA 2YU9B 2BOSA 1FEHA 1WTVA 1PFNA 1GUNA 3N9YC 1JALA 2BYTA 1HZ5A 2N88A 1C77A 2Q8RE 2A74C 4HEA1 4FF1A 1FFUA 1FCCC 3RFZB 2B2WA 3AH7A 3QWNA 3K5NA 2R7ZB 2BE5D 4ABNA 2PO4A 2K32A 1XYIA 4KKTA 1QOFA 2JSOA 4MN3A 1SNPA 3K5LA 2F0OA 1YNNC 3HOYB 3VR8B 4BBSB 3V2TA 1VZ7A 2AWNA 3U2SC 2V4DA 1AN8A 5FK9C 4CGYB 1OFFA 1I4GA 2ZXRA 3IAM1 3S2DB 1XLQA 3TN2A 3N52A 1VCIA 1I6HB 5ELCA 1HCZA 2WXRA 2F0LA 4BA1I 3EGRA 2LFIA 2RVLA 5M5YB 3GS2A 4AS1A 1SAPA 2R93B 3TSSA 1NEKB 2K04A 3M4OB 4QUFA 4YSYB 3AE5B 1NCVA 5BN4A 4ZHOA 4KJNA 2NN6H 2KEDA 1JICA 2F0PA 4DAPA 3H0GB 1I4RA 5KEEA 4BBRB 4EVOA 1JCKB 4WJWA 2K28A 1BR9A 4MT5A 3AE3B 3K5OA 4ZLTF 4KGRA 3AE9B 1DXMA 5FO7B 5IT9L 1DONA 1C78A 1HTLD 1F77A 2F0SA 3S9WA 3Q8EA 1OQQA 4KKUA 5M5WB 2Q5WD 2B2WC 4H13C 1CFMA 4HMJA 2KOLA 1S5CD 1FXIA 1PUTA 1DJRD 3MXUA 2EYJA 2O2LD 1HXYD 2N55A 1H9SB 4WH4A 2M56B 3PUYA 3OOCA 2WXQA 3Q8BA 2NTTA 4B0EA 2YYZA 4C3IG 2FE8A 1TS3A 1KFYB 2E75C 4OO1G 1OQRA 4ARCA 3V96A 1GOZA 1D2BA 3SFDB 3GP7A 2LEKA 4KN7C 3P1MA 5DM73 4GLSC 1U4LA 1T3QA 1ET6A 1JWUD 4OO1I 2WU2B 1EWCA 2XVSA 1NI3A 3S2HB 2M19A 3BDCA 5CMDA 5EE0A 4BWGB 2B2YA 1XCTL 5C0XH 3W5UB 2B63B 3MA2B 2Y5PA 2B2UA 1SNQA 1TWGB 1BQQT 2DLBA 3MZ5A 1I4PA 2D5GA 2K22A 3R8BA 4ZRQA 5ELFA 1OO9B 2KQ3A 1PFMA 1HUNA 1IGDA 2M0AA 2BE5C 5JVH3 4CKEA 1AYFA 3AV8A 3HOWB 4DAYA 4OL7A 3AB9A 5T8IA 1YMHE 4WQMA 3LX0A 2WLBA 4WFN3 4IUTA 2I38A 4OZCA 4DK1A 1VJKA 2HQEA 4M1UB 1II3A 3S1NB 4R3DA 3B9JA 2J4XA 3RZDB 3WOEA 4MH8A 1W6JA 4C1NI 1CA6A 2QKIC 2MP1A 2L83A 2F0EA 3M85A 1TIID 1D1KA 2IX3A 5DAUA 2DYOA 3S1RB 2B2YC 2EY6A 2WACA 2M00A 5C5LA 1RJTA 4PMWA 2B2UC 3FKIB 3NQTA 2RMMA 3PZ7A 3NTIA 1VR9A 1DOXA 3HGBA 3TDQA 1VRAB 5HI1A 5CV9A 2F1MA 2LJIA 1ESFA 3K57A 4FVMA 2HCIA 1K50A 4K5WA 2F0TA 3PUVA 5G3LF 2WXLA 2KDMA 1XCQL 3SR1A 4RGOS 1N61A 1JWAD 5G5HA 1PLFA 5I2YA 2IW3A 4A55A 1KDCA 4XQNA 4YT0B 4ZAIA 2JU6X 2PTLA 2V3PA 5D7GA 1WGKA 2WXFA 5IGDA 2NZ1D 3H94A 1C48A 2R61A 3IKJA 2PMVA 4ZOHC 1ONLA 4ILWA 4IFDG 2EJGC 1C8CA 3BK1A 4P6VF 2O5IC 3PV0A 2CU3A 1OXSC 2XWJB 3Q69A 1ML0D 4DU9A 1K53A 1K51A 2Y5CA 1GUOA 1A2UA 3BWUD 3S1QB 2KA7A 1AWDA 4ZQ3A 4RKLA 2BA0A 1O80A 3AE2B 3A8IE 1Z6HA 2AUJD 3HOZB 4IALA 2PMZB 4F8MA 4N9TA 4XDXA 1YJIA 4X3UA 2FFKB 2ZXOA 4J1MA 2Y0SB 2PCFB 2Q8TA 1WXQA 1EYAA 1TWHB 3K5MA 4NZLB 4C56C 3OIPA 1EWYC 2RKSA 3L7ZC 2BDNA 5E1FA 2H89B 1TZOA 3RPFC 5IODA 5JEAJ 3DWPA 3T4AC 1N60A 4G7ZC 1T5EA 3C1FA 3GTJB 4K5VA 5E4XA 5KNBA 4KD3A 1OXXK 2ICIA 4TQUS 1LO5D 1DD2A 1Z47A 1ZE3D 3NUCA 5C5MA 1FXAA 3UI2A 1SNCA 1ENCA 4XT1B 2JSVX 1L0YB 1NSNS 1K52A 3Q24A 5LL6S 1SJHD 3VR5A 3I4MB 1BUVT 1HA5A 1E7PB 2JA6B 3J80E 2CJNA 2K6AA 2EYFA 4MIUA 2PNRC 4ODGA 3H91A 5E3FA 3HOVB 1SYGA 3IT6B 1HUMA 4WIPA 5BYQA 2ID0A 3EA6A 5M3FB 2B39A 3GTPB 5EKLA 1FFVA 1Q1EA 1ENFA 2BS4B 1JC7A 5CC4A 3GTGB 4MACA 1BCPB 5GXGB 1QOHA 3FEWX 2L5TA 3OMGA 1SNOA 1JW9D 2SAKA 3W9CB 4L1BA 2MUYA 3NE5B 1L0VB 1RODA 4G7OC 2BS2B 4A8XC 2EYMA 2ENBA 5CV7A 2E6XA 1HPCA 1I4HA 1FCLA 4DNRB 3IFTA 2BDOA 2PIAA 5KIXA 4C1NK 1VDVA 4ITKA 1EEID 2K03A 4YSZB 1DGJA 1EY4A 3E5SA 4HEDA 1Q8IA 4A3EB 1V1PA 2DBYA 2RDHA 1J7BA 2LGIA 4IURA 4FXKC 4REZA 3TEXA 1UWXA 3D31A 3NP8A 3T16A 4OHJA 3EROA 4RAUC 1T5XD 3NTKA 3VYSA 2WS3B 1EZ8A 3FILA 2GRIA 1PRTD 3AMUA 2KVMA 1C4CA 4D2KA 3MHBA 1AFPA 2F0KA 4MM3B 3PUXA 3MAQA 2HDLA 4NW2A 2B2VA 1GJXA 2L55A 4HCSA 3IFDA 2ZW0A 3BVZA 3W3AA 5D14A 4BA2I 2PZTA 2ONQA 4RGMA 4C3HB 5EKKA 2A69D 1TR5A 4TRDA 4XE0A 1OXVA 3VA7A 5KRUA 3AE1B 4CBVA 3ETRA 5CR3A 2DNEA 1QE6A 1SSNA 5CV6A 1TKGA 1EEFD 5I2XA 2JYOA 4C3HG 2JQRB 2WINB 1TYGB 3D8GA 3J7AV 4V190 3HRZC 5K5PA 1Q90A 3T56B 5IGBA 3NXWA 1M4VA 3A8JE 2B8FA 2PYKA 1NYQA 3MXPA 1XO3A 1E9MA 1BNZA 1JE4A 4K6DA 2W55A 1Y1WB 1F2LA 1PTOF 3FRPB 5DNFA 1KTKA 2B2VC 4FNFA 3FILB 3E9SA 3GV3A 1MI0A 1LTBD 1P7FA 1WCMB 3VYRA 2PKOA 1QOGA 3RZOB 1ZXIA 1B50A 5A2QL 1NR4A 1OXUA 3NZ3A 1IHZA 4OO1H 2SOBA 4RGNA 1A3VA 5EPKA 3K58A 4USAA 2IX1A 1KNEA 2G9HD 1BO0A 4H2AA 2M9VA 4HSVA 1MHXA 2WQYB 1WTOA 3AEFB 4R8NA 3MXNA 3UI3A 5CORA 3KQ4A 1WTRA 3E6ZX 3WCQA 4NDXA 3J81E 3BDLA 4RH6A 2LHEA 1J7CA 4A9AA 3HUIA 1BUIC 3CKIB 4KHZA 4FXGC 1A3UA 4NAMA 3OSOA 4BY7B 2BT6A 2X6GA 1QF6A 1E2VA 2WXPA 2L12A 2XIWA 4A3GB 3TBIB 3AEAB 1PRTC 2CQAA 2JYTA 3P7JA 1ZDXA 5D65A 1XTCD 1PZJD 4WURA 3TZDA 2EDGA 5C3WA 1G91A 2JEAI 1CHPD 3AM9A 1JMLA 2AQ3B 3EFXD 4N9PA 2KWDA 2NYZD 3U9SA 3K7AB 3OMCA 4RFBA 5C4HA 5ISRA 1RCVD 4GDKB 3ZYYX 3DWMA 2NWGA 2A69C 1KH0A 5EJWA 4G4KA 1T6BX 2K1BA 5C4JB 3W1SA 1CK1A 4G7HC 3A7LA 5FKAC 3GO5A 3NVYA 1DCZA 4AYBB 1H9SA 1I7HA 4XWTA 4IUNA 4FYDA 2VUMB 4C3JB 4HROA 2EE1A 2EKIA 3SFEB 3CU7A 3U9OA 4DXGA 1DYQA 2K33A 1UAPA 4JE3B 3LXFA 2WXJA 2A5HA 4XQQA 2MJDA 4RF1A 3EQLC 3SK5A 1EY8A 2RBMA 4C3JG 1FR3A 3ONAB 2X6LA 1JWBD 1Y56A 1AZQA 1BBXC 4I7ZC 1H9MA 3LNNA 4XDCA 1Y1VB 3QG1A 3GTKB 2J42A 1I50B 2B8GA 3AE4B 1SDFA 2ZT9C 4K8JA 5H8YE 3C1EA 1EM7A 3G6JB 1VDZA 5E4WC 1L5PA 2QEJC 2NTSA 5EE9A 1JQ4A 3S16B 4WAFA 3A8KE 1HFGA 3V05A 1E2WA 3RUZA 1GHKA 4KY7A 4RGTA 4AQ7A 4X3KA 1BMLC 1MSHA 2QJLA 1RHPA 2C9OA 3GV6A 1IBXA 5JPMC 4KKSA 2WXMA 4QB4A 4HCEA 2WU5B 3J9CA 1B3AA 2WP9B 1FD7D 4LJZC 2E2HB 3FDTA 4P16A 1B1ZA 1F9SA 1ZXHA 4RA8A 4UAIA 3I57A 4LAAA 4C2MB 2K05A 3BVMA 3KWVA 4B08A 1ZP0B 1IKLA 1Y8NB 4A3FB 2A73B 3Q6SA 3D4DA 1RF2D 1FGBD 4DAVA 3JAME 1A70A 3P4PB 3SDZA 3NUHB 3X3MA 3QO2A 1KABA 4CJ0B 1SYFA 3OWFA 4IQZA 3EUB2 1BDOA 4RWSC 1B9NA 4YTNB 5EPJA 2MJ8A 1E2ZA 1QB5D 2A6HD 4A3IB 3PO2B 2WXHA 1MI2A 2NVQB 3LWUA 3KWLA 3NVZA 2F4IA 2HTME 5C4ZA 3AE6B 4ZHPA 1OXTA 1PYWD 3NWSA 1GAQB 1JB3A 3P63A 1PMRA 2INPE 1N63A 3M7GA 1F9RA 2EJMA 1KAAA 3D3RA 1U4MA 1R4QB 4GDLB 2JA8B 3T53B 2QSDA 2W3SA 1EWHA 2BW2A 4JPSA 3AEBB 4L23A 2BBCA 1FO4A 3CIRB 1RWSA 5IOCA 5K36G 3I90A 3Q8CA 1IBXB 2EY5A 5T1GA 2QCPX 3ZJVA 4IUUA 3VR6A 4K2KA 1A6XA 2LMCA 1VLBA 1PFBA 2JYEA 1JWMD 4QCLA 2DN8A 1DOLA 2EELA 1BF4A 1B9MA 4A90A 2BTEA 3FMCA 3KF8A 2K5WA 3VR4A 1MSGA 4IFDJ 2OF1A 5ELBA 2ACZB 2LY7A 1O78A 2PW5A 3U7ZA 1JOOA 5C3JB 4U673 5AUIA 1D5MC 5FLXL 3K0YA 2F0UA 1YNJD 2VB3X 3QOJA 1TKEA 3J7YW 3AEDB 2SDFA 3OPOA 1QWYA 4X3TA 5IGGA 3MFYA 4X3SA 1ZUD2 1G8ZD 4MHEA 3VR2A 4ZRZA 5I4DA 5JEAH 4OIKA 2FMCA 2JWUA 2I46A 2AUKA 1BCPD 4KKIA 1ICWA 1UWMA 3D4WA 2L1BA 3D6CA 3NSWA 1B44D 2A68D 3IL8A 4LLGM 3D4RA 1F2RC 5IT9E 1VF5C 2JZPA 3I4LA 4TKOB 4ZYSA 1WD0A 1EU3A 2M2LA 1LT4D 1DZ1A 1YN4A 3NK9A 5LNK1 1KDAA 3NVWA 2Z4IA 2LUMA 2PZUA 1AP0A 4KX6B 3VR3A 2H1EA 2LMCB 1A2TA 1S5BD 3SXHA 4WRDA 1NR2A 2NN6G 4OZBA 1N62A 3G7LA 1ILQA 1FIQA 1HQRD 2O4XA 3L9AX 2A6HC 2WKDA 2NN6I 4IFDI 5M9OA 4KI0A 4XWWA 2MEKA 4HJGE 4TMAB 1SE2A 2K01A 3BG3A 1F2RI 3OIQA 3ZQ4A 1DOMA 3GTQB 4KGTA 5EE3A 2EZVA 1Q10A 2CW0D 1A15A 5C6AA 2IT1A 1B2TA 1X32A 2K7VA 5CV5A 1XLPA 4BY1B 3BYTB 1F2YA 4OVZA 3NS1A 4HRSA 2KQ4X 2QDBA 2WAQB 4O1NA 5EPLA 3R93A 1D1IA 1SE4A 4ZK9B 1QOBA 2JXMB 1EY7A 1M8AA 3AU7A 1PTOH 2Z8LA 3L4PA 3VQIA 4TQ0A 4FF2A 1K8MA 4J8QA 1HEZE 3AE7B 3CRLC 3LB8C 4F88A 1NVID 2BB6A 5C0XG 3BDOA 3ITPA 1SEBD 1WTWA 1C4PA 4EGVA 2PVGC 3J7AF 1F2MA 1YNJC 2INNE 5JXVA 3AEGB 1QCBD 2DY7A 3T51B 4CJ1B 2J7ZA 4TQ1A 1LT6D 1RKNA 2L0CA 3AN1A 3MWYW 1BCPC 3P4QB 2ZXPA 1NENB 2K9XA 2X38A 1WRIA 2BCOA 1YN5A 2DWQA 3Q8AA 3HOXB 2A68C 4N59A 1HHVA 1XLNA 3VA5A 2IL8A 1WTQA 2AQ1B 1PDXA 2NBFA 3I72A 1EFID 5CV4A 4JWSC 1L6UA 1CZPA 3GQBA 1EY5A 1DOKA 3T3OA 4J6HA 1TS4A 3NWTA 2JEBI 4A3DB 1EY6A 4QF4A 2CJOA 3Q22A 1HQMC 3X3NA 3MJ5A 1D6EC 2YEPF 3BK2A 5I9OA 2F0GA 3HVZA 5KNDA 5AFWA 4YTMB 4ULLA 4YWGG 1DOIA 5C3XA 3AMZA 1F9QA 3RMHA 3U4EG 2LKVA 1PZKD 4S3SA 1BOSA 2VB2X 1WD1A 1ACCA 1G2TA 2JXTA 4OGQC 1FD6A 3PUZA 4K6LA 3J81L 2EYPA 2W3RA 1KDBA 5JVG3 2PVOD 1GB1A 5KYLA 3HZXA 4QIWB 1PFDA 3FVQA 2FUG1 3QJYA 2K5PA 3Q0AA 4A3KB 1CA5A 3HEJA 1LT3D 2WP8J 1LTRD 2K5QA 4NKLA 2VZKB 1STGA 2DNCA 3C46A 3MP9A 2CW0C 5HHDG 2E76C 2EPBA 3TUOA 4C80A 3MHZA 2KACA 5C2TB 3NHHA 3OHXC 1FNWA 2DY8A 3U52E 1FRDA 2NMQA 4HMIA 4EQNA 3AB5A 1Y69U 4U68A 2E3TA 2V3NA 2L11A 1SYCA 4HKZE 3SE0A 2RSNA 1SNMA 1STHA 3VR9B 3Q23A 2KHSA 4XDDA 1LT5D 1AEXA 3DMUA 3KBGA 4A3MB 1D4BA 4HAEA 2Y3AA 5T1IA 3HKZB 4L8JA 2E2JB 1ZXTA 1PXUA 1EIGA 3PUWA 4DA2A 5M3MB 5BN3A 5EBCA 2F03A 3DXJC 1STEA 1QT9A 4A3JB 1B4OA 2KAJA 4L2YA 1R4PB 2OHFA 1X3QA 5BMGA 3D6WA 3H8HA 1EOTA 2KUMA 1Y8PB 2RDGA 2NUCA 1P7EA 1EIHA 2V0GA 4C7ZA 2Z1CA 3BS1A 1GUTA 3R2TA 1EQTA 1JOQA 1K8OA 4HKQA 1IUEA 2WXIA 3R3OA 3DEOA 1ENAA 1SMYD 3EJIA 1TVXA 3FAHA 3GTMB 5D3IB 4RCOA 1TS5A 2HUGA 2EYLA 3Q8FA 1C9FA 1J8IA 3DWAA 3I8ZA 2N0SB 4C7YA 1EY0A 1ILPA 2BB5A 3IAYA 4KKJA 5EGTA 5IIFA 1WSPA 5FR3A 2WXKA 3C8YA 4US8A 4ARIA 4UDUC 4KHVA 4YTPB 1IYVA 3FPUB 3GTLB 1JORA 5BN5A 4PT5A 1ET9A 4DGZA 1KLUD 2EXZA 1LTGD 2SNMA 2WB1B 3K6OA 2AX5A 4LTUA 4DXFA 3KBXA 5DEHA 3VRAB 1ROEA 3SK8A 2K5DA 2I2YA 3H09A 1WVLA 4Q2JA 1ZYRD 4RKBA 1H9KA 1LTTD 1WTXA 2XWBB 3C3LA 3HS0C 1JR0D 4Q5VA 3NVVA 2MHVA 2LHDA 3F2UA 4OZAA 3ERQA 5MPOA 5FO8B 1HFNA 2A6ED 5HURA 1CZGA 3SK6A 2IGDA 2B2TA 4JX1C 3A55A 5K36H 2EY1A 2TMPA 4XT3B 2MJ3A 1I3QB 1SE3A 1C76A 1UEAB 4OW0A 3TP6A 1RYJA 4FP5D 2BA1A 3SEBA 2E2IB 4KTAA 2PW7A 1QNKA 1FYCA 3T3NA 3QOLA 3S1MB 3PIO3 3DM1A 1TKYA 3EVQA 1FM0D 3TEWA 1L4ZB 3S14B 4XIGS 4KJOA 2O5JC 1O7ZA 1SIJA 1O7LA 1R7SA 1H9JA 1LLRD 2MJEA 3E56A 4K8IA 2WXNA 3P4SB 4Y7NB 1PRTF 5H92C 5E6JA 1CI3M 1U4RA 4V0BA 1C4QA 4P2CB 4PQXA 2Z4HA 2F0FA 3A54A 2NVTB 4US9A 5G3LD 2WV6D 2FMMA 2B2TC 3TMEA 4N6EB 1SMYC 2IGHA 1QKZA 1DM0B 2SEBD 2XRQD 1RTOA 1VMPA 1H9RA 2D5DA 4LK0M 3MVVA 3T13A 1TWAB 2RQXA 3GTOB 2NB0A 2OXPA 4XYQA 4PV1C 1V8QA 2E74C 1J9OA 1CM9A 3H3VC 1STAA 5FO9B 5KGUA 4IFDH 3CQZB 3SK4A 1CQFA 5CV8A 4B9XA 3SHLA 1CT1D 4K5XA 5A2QE 5JAVA 4A93B 2F0WA 2KN4A 1VF7A 1MPEA 2J53A 3L3OC 1XXGA 3TEYA 3O13A 4CKBA 2MPMA 4M0WA 1ZYRC 5HG2A 1IL8A 4LK1C 4C3IB 2IWHA 3NTHA 3R2IA 2HDEA 4HN7A 1FNVA 3DEPA 1CHQD 1WTPA 2D2CC 1EQVA 2QILA 2F0HA 4HSPA 2A6EC 1XF5L 3CWIA 1JOKA 3QB3A 5BYSA 4Q0FA 3W5VB 1RD9D 1EU4A 3GB1A 1I6VC 1RDPD 5C44B 3S17B 1JWSD 3M4YA 3PMFA 4KMUC 2IDYA 3IT4B 3HP3A 1E10A 1TU2B 5JPNC 2J0TD 2KMMA 4L63B 1G6ZA 1WYGA 3B2GA 4NMZA 1S5ED 1GUGA <