1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
4DXGA 1RDPD 4RGNA 1STEA 2CHBD 4TSSA 1PTOF 1SJED 5ELEA 1FNVA 2WV6D 1LT4D 1PRTF 3CHBD 1V1PB 3OWEB 4C56C 1ET9A 2NTSA 1LTID 2XN9C 3BZDB 1SE3A 5ELFA 5D3DA 1LTGD 3SEBA 1JR0D 1LTBD 1PZJD 4RHSA 4RFBA 1LT6D 1TS2A 3W2DA 1SXTA 3KLSX 2AQ1B 3DWPA 2NTTA 1PYWD 1CHQD 1FD7D 1CHPD 1SE2A 4L63B 4NZLB 1EEID 1FGBD 2O2LD 1D6EC 4K6LA 4RGTA 1TY0A 3DWQA 3EA6A 1PTOD 1B44D 2XNAC 3O13A 4ZYSA 5FKAC 5I4DA 3BYTB 1FNWA 1S5FD 1ESFA 1SEBD 4RGOS 1PRTD 1I4QA 2QEJC 3R8BA 2G9HD 1DYQA 1LT5D 1EU3A 1BCPB 1EWCA 2IPKD 5TSSA 1D5ZC 2Z8LA 1JWUD 1JCKB 3BVGA 2XRSD 3URYA 1CK1A 2R61A 2TSSA 4RHRA 1EFID 1EEFD 1LTRD 1T5XD 1TS3A 1HXYD 1XTCD 1RD9D 1RCVD 4UDUC 4O1NA 1KTKA 3MC0B 1LO5D 2QILA 1BCPC 2XRQD 3R2TA 1V1PA 1BCPF 2J4XA 1RF2D 4RH6A 1LT3D 1LLRD 4RGMA 1YN4A 1L0XB 1KLUD 1YN3A 1SBBB 3DWAA 1KLGD 1TY2A 1CQVA 1AW7A 2IJ0A 3EFXD 2AQ2B 5D3IB 1S5DD 1F77A 4DXFA 1CT1D 1AN8A 1B1ZA 1I4PA 1DJRD 1PTOH 2ICIA 1S5CD 4OHJA 3V05A 1MD2D 4Z9CB 1S5BD 1ENFA 1M4VA 1UNSA 1PZKD 1ET6A 1FNUA 3BVMA 3MFGA 1BXTA 1SJHD 5ELBA 1HQRD 1PTOC 2RDHA 4L6TB 1HTLD 1YN5A 1I4GA 1JQYD 1JWMD 1UUPA 1I4HA 1PRTC 1QILA 3BVZA 1D5MC 1I4RA 1I4XA 1TS4A 1L0YB 1LTTD 1D5XC 1G8ZD 1PZID 5ELDA 5FK9C 1LTAD 1GOZA 1BCPD 2SEBD 3R2IA 1SE4A 1XXGA 4RCOA 5ELCA 1JWSD 2RDGA 1V1OA 1EU4A 1LTSD 1HA5A 1PTOB 4BWGB 3TSSA 1S5ED 1TS5A 1PRTB 3BYYB 2AQ3B 3GP7A
chains in the Genus database with same CATH superfamily
1SNMA 3MXGA 3NUCA 4C2MB 2CHBD 1C8CA 1C4CA 4DK5A 5ELEA 2MW5A 3RNCC 3J7ZC 4A3BG 2K5HA 3QCAA 2ZZPB 4MGYE 2RKSA 1FNVA 3JAML 3S17H 2IWHA 2WDRB 3L0WB 4LF9Q 1ZDXA 2DNFA 4GNXC 5CC4A 1PRTF 4ZAIA 4AIMA 3HVDA 2MBQA 1HR0W 1IYFA 2WXNA 1Q10A 2NPTA 1Q1EA 3RLFA 1GC7A 3GE3C 1SFOH 1NBFC 3PZDA 3RZFA 2CH4W 5D94A 2NVTH 4LF4Q 3I4MB 1A15A 4IWOA 1LGRA 5E6NA 2ZCBA 1MHXA 3K8AA 1F9PA 2KENA 5J2RA 1WE7A 2O6VB 2VY3A 1JRUA 2L0CA 4R8IA 4DV4L 4OVZA 1H9MA 4NZLB 3AULA 1CM9A 1J5EL 4TQUS 2GI9A 1S4ZA 4OEMB 3N1XC 1QOGA 3DWQA 5JEAG 4GLXA 3TEWA 1XNRL 2JA5H 2NUCA 2M0XA 1EYCA 1IBLL 1ESFA 2N49A 3G48A 3N6RA 2KDBA 4KGTA 1SEBD 5EDSA 1NYQA 2F0IA 3G71A 3VYSA 4AYBB 4WWMA 4A3BH 4DV3Q 1I50B 4OGQC 4K3BA 2XRSD 2JT4B 3CCJA 4DDID 1EFID 3FPUB 2PQAA 4KHZA 2R7ZG 1UD7A 4LK1C 2M1MA 3G4SA 1Q3LA 2B63B 1L1OC 1STGA 1ZEQX 3C19A 3I63C 4LTUA 1WTRA 2NS5A 1FFVA 1NI2A 3N1YC 1LQBA 2JYEA 1EQRA 3R2TA 4JG2A 2RPVA 5HHDG 1BCPF 3J81E 2JA8G 5IP7G 1IKLA 4I6NB 1EFWA 1H8CA 3CPWA 1KFYB 3TJPA 4ZLTF 1CQVA 3PHXB 4L23A 2B3GA 4DN4M 3EFXD 2AQ2B 2A68D 3ML8A 3E0JA 3NVYA 1BUVT 3PRZA 1G6ZA 3UINB 4CJ2C 3PO3G 3A7LA 5BMIA 3S16B 2YTXA 2O6VD 4KX6B 3CF6E 1S5CD 5IKCM 3S15B 4PNYA 4Z9CB 2JP1A 3VA7A 3E9SA 1AYFA 3P2BA 3RFZB 5JEAH 1GB4A 1NNXA 4PT5A 2EZVA 4HIKA 5BO4B 5ELBA 4CDCC 1PUTA 5CORA 3UQBA 1JWMD 4LWCA 2NVXB 4HJGE 1MIUA 5IGBA 4PQXA 4GOPB 2Y5CA 3N1ZC 1D5MC 3NSWA 4IFDI 5C44H 3FKIB 4YWLA 1LTTD 5M5XB 1R4MI 1WSPA 2N7JA 4BS9A 3N20C 2L32A 2M8SA 4X66Q 4AQYQ 4C4VA 3BDOA 3RZDB 3HG9A 2K9XA 4N9PA 1V97A 2ON8A 2JUOA 2NVYB 2PI2E 3QJYA 5IP7H 4POGA 1E8XA 3L54A 4FULA 3P75A 3DBLI 1TWCH 2FAZA 3TN2A 4MH8A 1CJEA 2RSUA 4EQOA 2JXMB 2HD3A 2WACA 3I4OA 4KJOA 4KD3A 4A3EB 2AL3A 1XMQL 4JI0Q 5E6JA 2O5JC 2HUGA 4RCNA 3T1HQ 1L6UA 1SNCA 3PO3H 3ZRCA 2K32A 1QT9A 4LF7Q 3DOWA 4BKGA 4ILWA 2D62A 2FUG1 2XWBB 1ZW7A 4A3JB 4PS3A 1H9RA 2NTSA 2CQAA 2XN9C 1FD6A 2C7NB 1WGKA 5EBDA 2CU3A 1H95A 3Q3OC 4GS3A 1EOVA 4QUFA 3S14B 5CV9A 2WFWA 3OW7A 4B95A 3T3OA 1PZJD 2CQOA 4YHHL 2ZJQA 2HT1A 1NUCA 1BMLC 5J18A 1E1TA 1WYDA 3AB5A 5AZFA 4XXEA 3H15A 3W2DA 2MWSB 3IHPC 1WI5A 1EIFA 2HCIA 5D65A 1NEKB 5JJIA 3EVQA 1NYRA 1V5OA 2BYTA 2SNMA 1M94A 2D3CA 2KQ7A 1FD7D 2D0PA 1MFWA 1TWGH 1E5WA 4R3DA 2LGXA 5T1IA 1BT0A 5HGQA 5FLMH 2HTME 1D6EC 1WGRA 3V6CB 2O2VA 4IPDA 3EA6A 5T8IA 4DBGA 2ZM6Q 4HPPA 1MJCA 3QJZA 2RMMA 5D7GA 1YX5B 2I2YA 3CKIB 3PF4A 4W9HA 4C7ZA 4TKOB 4J1MA 4JV5L 1HTPA 1JALA 2JEBI 3R8BA 3KYHC 2F0TA 2BVCA 3WCQA 3DBHI 3DM1A 1X6OA 1XMOL 2WHIA 5DPSA 2Z9HA 3U4EG 2C35B 3GTPH 5JH5C 4EGVA 1WCMG 4C3JH 2WS3B 2K05A 1FJGQ 4HLEA 5CX3A 3IAYA 1WXAA 2R2OA 4NJCA 3WDNA 2PYKA 5LLIA 2QILA 2Z59B 4NP5A 3H6MA 5DNFA 1VQFA 5FJ8H 3U7ZA 3PT2B 1E0BA 1SMXA 2B76B 2JXTA 2F4IA 5K36G 1K28A 1JMLA 3E3XA 1YIJA 2REXA 4XX5A 3X0WA 4LNKA 5EQ0A 3S1RH 3Q8AA 2B8FA 2QDFA 2V3NA 1F77A 2A8VA 4EVOA 1CT1D 3RZOB 1UBQA 4B3ML 4FHJA 4GU2A 5LMUQ 3H8HA 4QUCA 4N59A 5BYQA 1F9JA 4MELA 5C2TB 3OJ3A 1YHQA 4H13C 4A3GB 1R9TH 5DEHA 4ANVA 4HVBA 4HTHA 2BKFA 2EELA 2UUBQ 3ND9A 4HKZE 1JORA 2JZZA 1TWFB 4HWIB 1YQ3B 2KA7A 1I4GA 2I1JA 4AYBG 1CA6A 2GBMA 1E24A 3UI2A 5LMNW 1C9OA 4JI8L 2E3TA 3AE8B 3KDFA 3EIVA 4FXCA 2CR5A 3PGEA 3TIXA 3X3MA 2TMPA 4KY5A 1I6HH 3OJ4B 1UE6A 3R7RA 4PS8A 1GD7A 1IUEA 1IYVA 4EZKA 2B63G 4GIVA 3V6EB 4US9A 1WFYA 5KHQA 5ELCA 4P1CC 1LTSD 4H02A 5C4ZA 2K01A 3I4MH 4BWGB 2L0TA 3AB9A 1T0YA 3PZ8A 5EE1A 3QWNA 2RA4A 5C6AA 4IOCA 1KXLA 3H3VH 3ONSA 3WIMA 3E0EA 5K36H 3KBXA 3L17A 3AV8A 3HRDD 3ZNGC 3GP7A 4M00A 2PNRC 2K33A 1E7ZA 3NY5A 4GZYC 2KX0A 4HJAA 4BBRB 1WJNA 4DUYQ 1RM6C 2E2HB 2C60A 2UXBQ 1IHZA 1J6QA 2CW0D 2EJMA 1X3GA 5C3XA 1S72A 2J0MA 3U4ZA 4CKCA 1N33L 1V1PB 3J80L 3EBEA 3NBHB 4CJ0B 2A4ZA 2A73B 3DBRI 3K5MA 1ZKOA 4IO9A 3A55A 3HOVB 2N1VA 4M1UB 1BBXC 1C1YB 3ICEA 4HCNB 3GV3A 2MH7A 2JEAI 5M3MG 4A3KH 4KTAA 2NCNA 1I50H 3GTJB 1TU2B 1U0LA 4RFBA 4EQNA 1CSPA 3PTFC 5IP4D 2JJQA 3K7AH 5IYBG 1WE6A 2IHFA 2VQFQ 2W54A 3VRBB 2PE6B 3FC4A 2DAFA 3GTMB 3D32A 5AEKB 4GDLA 2ZNVC 2RSNA 2YTYA 1PFDA 3HGBA 3B9JA 2D9UA 4JI6Q 5JVG3 2QGQA 2IBIB 3GZNB 4LF6Q 2KXJA 1KJTA 4KSLC 2J0TD 3UDXA 4JOIC 4BOSC 4A3EG 3ERSX 2M4NA 1Z2MA 3M63B 4XWTA 4DV0Q 3VHTC 3PUVA 3FDTA 4AJYB 2R93B 2H4OA 2ZTCA 2C7HA 1LT5D 4YTPB 1CKNB 4DV6Q 1HJPA 1VS0A 1VQ7A 1EY0A 4QIWE 2EMSA 2LEKA 2ZNVB 4A3JG 2OTLA 1FPYA 1N6ZA 1L6VA 5BMHA 4ARCA 1T5XD 2F0QA 3JYUA 5M5YB 3RLOA 1BCPC 2EXZA 2KD0A 1KD1C 4ACFA 2Q2HA 2GB1A 5FOBB 4DU9A 2DZKA 1FXIA 1L0XB 3FKYA 3FKIH 3IFTA 3S1MB 5M5XH 1AARA 2N7DA 1OGWA 4OX9L 2ZVNA 2FINB 2CJNA 1WTHA 3NEMA 1VCIA 1IL2A 4HJ8A 2VZAA 1RFAA 2DNCA 2FMMA 3RZDH 5DPWA 2GLSA 4NJ6A 3CU7A 4FXGC 3VYRA 2WINB 4RM8A 1MD2D 5CGKA 3IT6B 3IBEA 4B9KA 4IM0A 1SJHD 1VQ8A 4G3XB 4MT5A 4ZKBB 4L6TB 1VD2A 2KHJA 2EVBA 1HTLD 1QVFA 2XIWA 1GUWA 3VTVA 3MP9A 5LHY1 2KZRA 3K81C 4CHKA 5IOCA 4QF4A 5CV8A 2QF7A 3ND8A 5IYCH 3APDA 3QWZB 1RFKA 3QB3A 4XTCS 1AH9A 3GTOB 3ULPA 1V86A 1VZ6A 1D4BA 1UWMA 1N5WA 1Y56A 2Y3AA 2VH2A 1LV9A 4A3JH 1FEHA 2H1EA 2K25A 2V9HA 2KKCA 4HRSA 4DUZL 4WJOA 2H89B 1KDAA 4DNIA 1XXGA 5I9OA 3UIOB 4A3CH 5C4XB 5EE9A 4ZQ3A 4R4QA 1VZ7A 3RMKC 1QWYA 1QZGA 2B2YC 1B3AA 2BB6A 1O7IA 1QOAA 2LXCA 2M56B 5FR6A 3VR3A 3J9CA 4L5SA 1BO0A 4FJZA 4F8MA 4YY3L 4KIKA 1V81A 2FCNA 3M3YB 2DJFC 3I3CA 3JVZX 3HOUB 2SAKA 1H9JA 4B3SQ 4MIUA 3T1YQ 2J7QB 4HCPB 4ALPA 3A9JA 4DV2L 2V1YA 3K58A 3H0GB 4A3GG 3OWEB 4MGZE 1SMYD 5GAGC 3WALA 3TRZA 4IPGA 4FJVB 2FIFA 4HDQA 1WXVA 3A1QB 4X3KA 5EKLA 5A2QL 3EFUA 2OT2A 4JPBW 5D3DA 1V9PA 4KK7A 1MSGA 2A6HC 3QC8B 2J7ZA 3JSVA 3A9KA 2N9XA 2C5CA 4R4CA 1AZQA 2N1WA 4ZHPA 4C1NK 4HXDA 3I4NB 3JW0X 3KLSX 4DR4L 3C3LA 3U30A 5JXVA 4FNFA 1PYWD 3NXWA 4TVAB 4LFCL 1W2BA 2HHHL 4JYAQ 5HGTA 2MJDA 2BGFA 3PUWA 4BKSA 2K03A 1K0SA 3V60A 2KWCA 2B2UC 2JA7H 1MG8A 1NTGA 3FHWA 1KDBA 1UZXB 3GO5A 1MJEA 1YNTE 1Q7YC 2BWES 4B0EA 1II3A 1CTMA 4YSZB 1ONLA 1XWEA 3H7SA 3PO2B 2PZTA 4DR6Q 1WR6E 1OEYA 3GS2A 2BF8B 1NY4A 5FLXc 1GUGA 1I4QA 2KJRA 2LVOA 4BBRG 1N63A 2PE9A 3RZOH 1M1KC 3DQVA 2IPKD 1HTOA 3NELA 5CV4A 5TSSA 1GJZA 4CQNA 3KW5B 2ZTDA 2BDNA 2LXKA 1U4LA 5IE8A 4HIDA 4B3TL 1IYUA 1HXYD 4ZRPA 3SK6A 1R4NI 1V5TA 4H44C 3HOVG 4K1RB 2Y0SG 3ZNID 3S1QB 3M85A 1TKGA 4F7ZA 2AWTA 2RHQB 4LCDE 3PUZA 4RGMA 3NHEB 1HNZL 1RAXA 4EOYA 4WORA 5IGEA 4HJKA 2K5NA 4O2DA 1TY2A 4DV1Q 1O80A 4P74A 4KV2A 2X69A 5GAHC 3ERQA 1UAPA 1RHPA 1GVPA 4O42A 1S5DD 1HNXL 1UE1A 2FCMA 2EE1A 2EJGC 1ENCA 2KTRB 1HR0Q 3S1NB 2GBRA 1DOYA 3AE7B 2QEXA 1KM7A 1WFQA 3I70A 1PZKD 1T9HA 1ET6A 2NB0A 1IBML 2EYJA 2F0UA 1A70A 3PSEB 5G2NA 1BQQT 3NWTA 4IALA 4MTKA 2MGSA 2R7FA 2A6HD 4EQ5A 2K5QA 1KOTA 2R93G 4L1BA 3ZRFA 1ESRA 1BKBA 3BDCA 3AE2B 4B6WA 1GXDC 1VCBA 2A74C 1K83H 1L4DB 1YEZA 4XT3B 2B3AA 3W1BA 3BIID 3KLRA 1LTAD 1ILQA 2LGSA 3Q6BA 1EO6A 3QOLA 3C46A 2K50A 3PGZA 3MZ5A 4JWSC 1YMHE 2KAJA 2BA0A 4JI5Q 1HZCA 1ASZA 4LF8L 2OOBB 2KDIA 4ANUA 2KLGA 2WYQA 2RCNA 3NE5B 3MHSD 3GTJH 3VFKA 3OYYA 2PKOA 4C00A 2AQ3B 3M4PA 1FYCA 1OTCA 4NXML 3A0JA 1SYDA 5BN3A 2K5WA 5EKKA 1GM5A 1A2UA 1LACA 1RL2A 3TEHB 2DHZA 5LXIB 3AU7A 1B50A 3L08A 4DR5L 4ARIA 3H3VI 1V49A 4JX1C 4GXBA 4AYBE 4ODGA 2G45B 5EPJA 3CP0A 4Q0FA 1BVSA 4OO1G 1J7AA 2NZOA 1ET9A 2L0FA 4KKJA 1T0RC 2IZVB 1VQGA 3RULA 1WJ6A 3QX1A 4EUTA 2BS4B 1FM0D 2R93H 2WXHA 2IGHA 2D2CC 4XE0A 4X62L 3RUZA 3PV0A 2YLMA 3MEFA 4TRDA 2E5LL 2IY0B 2AX5A 3HOXB 4IOAA 3ZVVA 3AMZA 4FBJB 1CHPD 1SE2A 5C4XG 1E10A 3U2SC 1VLBA 2INPE 2IY1B 4P6VF 2PQEA 5CV7A 2ONQA 3OHXC 3X3NA 1G6PA 4CDFC 3I4LA 1A3TA 1T5EA 5I4DA 1PH9A 3KUZA 2L8JA 4M0WB 3VH4B 4EQPA 4DR3Q 2V0GA 4BKTA 4TV3A 1XF5L 1YJ9A 1TR5A 4FHKA 3H91A 1HEZE 2LJ5A 2ATWA 3HOUG 1WM2A 4XDXA 2N7EA 4P16A 3WAOA 1EWCA 2F0DA 4M8AA 3ZXVA 3GV6A 3UDGA 3H0GG 3TS0A 4JI2L 3KWLA 1WZ0A 4KHPQ 5J17A 1RD9D 3Q22A 1E9MA 1IW7D 3R7QA 3MC0B 1QUQA 4IUPA 2LHEA 4ICVA 4JI7Q 3GTOH 3AEFB 2UYZB 4TUUA 4RG1A 2OWOA 3I4NG 1TKEA 4OZAA 3GDEA 2DGYA 3FAHA 2LZ6A 3PSIA 1D2BA 1VQIA 3S2DB 4F7XA 5C4XH 2N9LA 1VQEA 3GTGH 1IBKQ 2R92B 3EFCA 1V8CA 1ENFA 1STAA 2KBNA 4OW0A 1UE5A 3FRPB 1VQOA 1YVCA 3HRZC 4C3IB 4BBNF 1HZ9A 1PV4A 1JOQA 1WGDA 4CDEC 2WX0A 3D0FA 1FR3A 4NAWA 1JQYD 1UUPA 1T6BX 5IAAC 3EECA 3G7LA 2IL8A 3HOUH 4CKEA 2OEOA 3OIQA 5IT9c 1Q81C 1SB3C 3AU4A 3KUDB 2VRRB 4JWUC 1NMGA 3D3RA 5E6PA 4TQ1A 4K14A 2OEDA 4XQQA 5DM63 4JI4Q 3H0GH 1P1AA 2EPBA 3Q8EA 2IX0A 5H8YE 4NY0A 2BH8A 3T16A 4PYZA 2JQOA 1J9OA 3N9YC 5FLXE 1J7CA 3BK2A 3TL5A 1EU4A 4DAVA 4MM3A 3R93A 2EYFA 4BVUC 4KKIA 3U58A 4DQOC 1F2RC 2XWJB 2OHFA 1PGBA 3GB1A 4LUZA 5H1SE 5IYDG 4A3IB 2LMCA 1R4QB 4WWNA 1CZGA 5IA7A 3E5SA 2CHZA 4AH6A 3LJ3A 1G2SA 4LF5Q 2VUMB 1P7EA 3NVWA 2MLBA 1N61A 2LVPA 2I5HA 3MAQA 4L5RC 4IG7B 3AI5A 4K81A 4OZBA 4W9CA 3UIPB 4A55A 2MRPA 4W9IA 2L12A 3Q8DA 2KVRA 4DKAC 3PO2H 1SIJA 3D4WA 1I6VC 4XQJA 1ASYA 1C9FA 4LF9L 2B2TC 2NBUA 4HCSA 1F9QA 2FCSA 3AEVA 5T1GA 3Q0AA 1C0AA 2IYDB 5EPKA 4BY1B 4NXNQ 3NVZA 4A20A 1GG3A 3NUHB 4DV7L 4LF4L 3H9DA 4JI1Q 4NQLB 3CPFA 3B6YA 4ID6A 3MWYW 4IJLA 2J53A 4G11A 3H3VC 2A68C 2Q8IB 3AM9A 3SXHA 3VTUA 1B2TA 1MI2A 2MA9B 4EFOA 4LFBQ 3SK8A 1MGSA 4W9GA 1H9KA 2OJRA 1SROA 1RTOA 1WCMB 4W9DA 5LMNQ 1SGHA 4IUQA 4R8NA 3OAWA 1V8QA 3TMEA 5IGFA 2ZJPA 1FRRA 3HOWB 3SR6A 1NBWA 4A4IA 4GNXA 1JWUD 3BVGA 1NMFA 2WB1E 4ME5A 4G0NB 3SHQA 2MBHA 1JQ4A 2KDEB 1XTCD 2KACA 1EYAA 4KLKA 3NS8A 1LO5D 2XRQD 4JL9A 3B1LX 3QR8A 3MVVA 4IFDJ 1QOHA 1RF2D 5DLQE 1GJXA 2WLBA 1PYBA 2F0SA 4KI0A 1HZ6A 4N58A 1EWIA 3DWAA 3VYTA 2LD9A 3DVNU 5EE0A 5J3BA 4QQBX 4UP9A 4ZRJA 3HOXG 1H9SA 1XQQA 2K3UA 4JIOU 4DXFA 2NPTB 3RCZA 4BY7B 3RT3B 4EKUA 3I2ZA 4IJHA 3U9SA 2ICIA 2WXGA 3TCAA 4HMJA 4E74A 4I6PA 5K5PA 2K14A 1KRSA 1XLPA 2FIDA 4ABNA 4MGIE 4B0MA 1F0ZA 1JRPA 1LFDA 2UXDL 2IW3A 2B8GA 4MZ9A 1Z47A 1EIGA 3CCMA 2DY7A 4GB9A 4II3B 3OOCA 2WWZA 3HK0A 4IWQA 3J80i 4WJNA 2UUCQ 3ZTDA 2EYMA 2FMCA 3D6CA 4A8XC 4YXDB 1E90A 1VQMA 4ZRZA 1G291 3VR8B 4WQMA 2I07B 3DVGY 2F0MA 1RJTA 3MFYA 1VDVA 2LGYA 4LLGM 1QVCA 3F8TA 4RF1A 3H6NA 1L1OA 2NZ1D 1Q8IA 2Z6KA 4GOPC 1WYGA 2RDGA 4LMQD 2O5IC 2F4VQ 3IXSA 4FVMA 1G2TA 4IURA 3CCSA 3CD6A 1SSOA 4IUNA 3TSSA 1J5EQ 2V4LA 1PH5A 2DY8A 3TS2A 1FRDA 4DFAA 2E2JH 5D14A 3NQTA 1XNRQ 4ANWA 4PMCA 3ZNHB 2KC1A 1IBLQ 2IX1A 3U9OA 2J0JA 3HOXH 4KVGB 1XEEA 1TBEA 1ICWA 1W3SA 2PQAB 2MJ8A 2ZT9C 2Q8TA 4X64L 3CW2C 3NP8A 5M3MB 1A5RA 2R92G 3MTNB 4HDOA 1QLBB 5LNK1 4CGYB 3GTKH 1SNOA 4HSVA 4C3IG 4FP5D 3DVGX 1IZ6A 2HIVA 2WXPA 2R7ZH 3VXWA 2BCOA 5I2XA 4LF7L 3KH0A 3PIPA 1JR0D 1DD2A 4F1SA 3KLWA 3PIO3 1Z7TA 4LFAL 1EY7A 3D6WA 3A54A 3GZNI 3PCOB 2JA8H 2MBBB 1JOOA 2KDMA 2KTFA 1F9SA 1U4AA 5LL6X 4DAYA 1B3QA 1EUVB 3M7GA 1WTQA 4C1NI 1JOKA 5C0XJ 3P1HA 2JX5A 2MP1A 3RN9C 1V6EA 5D2MB 1C76A 3ONAB 3PQIA 4GN4B 4DR1L 1MI0A 1NVID 2KK8A 2Y5PA 3LYYA 1JJ2A 1ZUD2 1TIID 2NN6G 3I91A 1AZPA 2Q5WD 2L00B 4A3IG 3V2TA 1FVIA 2F52A 3NENA 4HCEA 5JOBA 3JAMc 1I7HA 1BF4A 4IOIE 4IUTA 2VUMG 4E3CA 3G6JB 3A8JE 2YTVA 4X3TA 4NW2A 4C4VB 2H88B 2ZVOA 4W9KA 2G5DA 1HZ5A 3P4SB 5CHWA 1WOCA 1JWBD 1HHVA 4C3IH 4EX5A 3T13A 2K5DA 2WKDA 3VRAB 3W5OA 4P72A 2QJLA 4M8MA 1XX8A 4H7BA 3Q3MC 2W55A 1VRAB 5HKHA 1GO3E 5IGDA 1ZXHA 4KZCA 4BY1G 4R4TA 1YN3A 2HE7A 3DMUA 3KJPA 4JBMA 2K1FA 4HJ5A 2EY2A 3W3AA 2WXFA 4RF0A 2JA9A 2FBWB 2Y5BB 2N78A 2WIIB 3DVNV 4LNIA 4RM9A 2A69D 3CAMA 1XMQQ 2WP8J 1PH3A 5IWAL 1TWHB 1B1ZA 3NBIA 3CMEA 3HS0C 4G7ZC 4N9F4 4IWPA 2JPHA 4X65L 4BBNC 5E1FA 1L2FA 2WXLA 4OL7A 2CW0C 2ZPNA 2RDHA 2WP9B 4A3IH 4OVUA 2B2VA 1WGGA 1OEYJ 2MO1A 2AEHA 5MPOA 2UXCL 2I1KA 1GUOA 1WTVA 1IXRA 2PW7A 3HOWG 2XEWA 4YHHQ 3RYTA 2MP2A 2UUBL 4FF1A 3K5NA 1K3BC 2SEBD 1TKYA 2O2VB 4DDGD 2YU9H 1IL8A 2C9WB 4RCOA 4OXPA 3PREA 2JRHA 4G57A 3W5VB 1K3RA 3RN2A 5CV5A 4XGAB 4BXXG 3H94A 4FXKC 4BY1H 3B0AA 1S40A 1O78A 1L5PA 3BYYB 2KCNA 1JICA 1IGCA 1SSNA 2FFKB 3SE0A 1WYWB 3W1SC 3KUCB 4J8QA 3SGIA 4OWWB 4WJQA 3UQAA 4JK1C 3WOEA 1Z5SB 1KABA 2F0NA 4C2MH 3OTOL 4BY7G 4JV5Q 2GBNA 2KDFB 1KAWA 3I7FA 1TZOA 2X8XX 2JRIB 3WAMA 1BNZA 1LT4D 2M19A 2NMQA 1WY8A 2N9KA 3CWIA 2UU9L 4DF7A 1SE9A 2E2DC 1WCMH 1WGYA 4A90A 2PMZB 1UF0A 1PLFA 5C3EB 3F2CA 3VH3B 2Z0DB 5ELFA 2KLCA 2VB3X 4G4KA 3NWSA 1ZXIA 3SEBA 4X3UA 5CYUA 2W82A 3A4RA 4WAFA 3HOWH 1HNWL 1FXTB 1LT6D 2I5LX 3PLUA 3A8IE 3U7DA 3ZJTA 1SXTA 1PH2A 2BBCA 1KLVA 4KKSA 2LUEA 2ZW1A 1JT8A 1WX9A 1CZPA 4B3RL 1D1KA 2F0OA 3DEPA 1ZPSA 2GBKA 4W9EA 1FGBD 4XYCA 2BPSA 3DUZA 1Y1WB 4B3MQ 1E7PB 1T0QC 2L05A 3PMFA 1R7SA 1VQAA 2J42A 1XPOA 2KEEA 3O13A 5FKAC 2YVCA 1I3QB 4ZRKA 1C4PA 2B2WC 2A6EC 1O7YA 4EEWA 1PFBA 2DUDA 3KDFB 1Q12A 5IGCA 4V190 2LHDA 5J1ZA 2Y0SB 2G9HD 1DYQA 2ZXRA 5CR3A 1WM3A 4BY7H 1YJWA 3F2UA 3UDIA 1AFPA 3ZTCA 3PIP3 4JI8Q 1HRJA 3ZO5B 1VQHA 2LRWA 4J3OD 2PW5A 1KTKA 3FMCA 3LB8C 2B63H 3KVFB 2WXJA 4QAYA 3VVWB 4RH6A 2KO3A 3H7PA 3VUXA 2O4XA 5C3WA 5KNDA 2N55A 4HAEA 1NJIC 1I94L 2G1EA 1AW7A 4QMGA 1PDQA 2EYLA 4G7HC 5M5WB 1D7QA 3H1UA 2QCZA 2DJGC 3PV1A 3QO2A 2PPBC 3EN2A 1P3QU 3AEBB 2LASA 3HZXA 1DZ1A 2F3IA 4JI3L 3IFDA 1IKMA 1MPEA 3S16H 4OHJA 3IRBA 3NG0A 3KF8A 2YYZA 1S5BD 1QNUA 1TZ1A 1XD3B 1E8YA 4LJZC 3S15H 1WH3A 1N33Q 2BS2B 4HPMB 2MBOA 4OVVA 4LJPB 2F3VA 2PI2A 4KSKC 2LS01 1NDDA 2MHJA 3DHGC 4PMWA 1VF7A 1SMYC 3AEGB 2MUYA 3M4OB 4REZA 1N34L 3BDLA 3RUIB 4WJPA 4BFRA 2NVXH 2DLBA 3LGJA 1EIYB 5M3MH 1SLJA 5KYLA 4GDLB 2HIXA 2KT7A 3DXJC 4ZUIA 4LNNA 5KGUA 2QCPX 5EKIA 1GC6A 2XGTA 3CSTA 5IYBH 1ZDVA 2XSCA 2N9EB 2D07B 2DZIA 4FF2A 4R4OA 2LI5A 3K59A 3RR5A 4MJSA 3TEYA 4OELB 2SOBA 3E9HA 1JJGA 2V4DA 2K8BA 3AE3B 2Z6BA 2F3WA 1LM0A 2PVOD 2A6ED 2F03A 2FNJB 1TQOA 5CHVC 2NVYH 2WXOA 4DA2A 1PH4A 2ZEQA 1L0VB 4FDBA 4E71A 4P75A 4A3EH 3AE6B 1MKHA 5AUIA 5IY0A 1C4AA 5KRUA 4WJWA 4BBSG 2NZHA 5HFYA 2K5VA 2F0VA 3K57A 3VR9B 1T0SC 2ASBA 1DOLA 1QKZA 3OPOA 4WH4A 1YI2A 1HA6A 2XK5A 4IC7B 3NVVA 1JMCA 3BZKA 2Z4IA 5EAYA 5JJLA 3Q69A 4I6LB 5CV6A 3CCUA 3W5UB 1XO3A 2RD0A 4DAPA 3S14H 4JBKA 4LUOA 4N9TA 3VDZA 4AOFA 4DPGA 1OQRA 4DHZB 4OX9Q 4B9XA 1LM8B 2AQ1B 4LW1A 2KCMA 2CJOA 2QKIC 2UU7A 1CHQD 2QDLA 1GNUA 5IOIA 1XTDA 3K80C 3VR6A 2WDTB 2B39A 2B2YA 3AE1B 4RGTA 3P4QB 4YT0B 5AZGA 5CBAE 4PK1A 2D0OA 1K9MC 2Z1CA 3BYTB 4YWGG 3EHVA 4YTNB 1S5FD 1PGXA 2F0WA 4DNTB 1F52A 4RGOS 4IUMB 1G6JA 2QEJC 3KF6A 3J80c 4G50A 1TWHH 3DWMA 1AE2A 3EROA 3WOFA 3SDLC 4ASWC 2RSOA 1WXMA 4PYUA 1KAAA 4XIGS 5I9PA 2E76C 2GVAA 2R61A 5DAUA 3TQYA 1UEBA 2Q2TA 1GHKA 1E6EB 1LTRD 5IIFA 1TGZB 2JZ3B 4X57B 4AWJA 1Q90A 1RCVD 2LJIA 1KNAA 3K5LA 4DUZQ 5C3EG 1STNA 3ZDTA 3D8GA 3ULLA 3CCQA 3AXCA 3MXPA 1ZP0B 1LT3D 1LLRD 1X3FA 1GUNA 2MO0A 3PPAA 4KIKB 3S9WA 3FILA 4GDKA 3H09A 3LNNA 3P1MA 2JY6A 3RD4A 2WQYB 3A9JB 2EY5A 1C3TA 5D3IB 4A3MB 3PRPB 2MSED 4YY3Q 1WTXA 4XYQA 2LWPA 3K6OA 2B2UA 2F0JA 3BS1A 2W3SA 4KDLB 1Y1WG 5CTRC 3J7AV 4U68A 2LGDA 1GUTA 1QG7A 2C7MB 2PW9A 1M4VA 1XT9B 4C7YA 1HFGA 4USAA 3JSVB 3J81L 3MFGA 4DV2Q 4JBJA 3A9KB 4A3GH 1WXSA 5M3FB 4P73A 2EYHA 3N52A 1GPXA 2F1MA 1YJ1A 2CVRA 1TWFH 5AJ3L 3RPFC 2IO1B 4W9LA 4K0KL 1NSNS 1I4XA 1PXUA 4MNOA 2WX1A 5L95C 2NN6I 4JW0A 1LYLA 2R6GA 5ELDA 1EQQA 1ROEA 1QF6A 1DXMA 2JSOA 4DR4Q 2YV5A 5C3EH 1XNQQ 4LFCQ 4GN3B 3EJIA 5I2YA 5KNCA 2HHHQ 3I9V1 3ZQ4A 2K6AA 4KKTA 4EZLA 5L83A 2A1AA 3VYUA 2KWDA 1KF6B 2IDYA 3WANA 4YTMB 3ZKJC 4HIOA 1F2RI 1OO9B 3HP3A 1N9WA 4N6EB 4LNQA 3JAMi 4RMFA 1L2NA 1CZWA 1Z6HA 3CRLC 3J7YW 2KYWA 2PEAA 2JWZA 4XDDA 4BBRH 4IFDG 1Y1WH 4APVA 3E6ZX 2E2HH 3B2GA 2JQRB 2K5PA 3WA0A 1PGAA 2NWGA 1I3QH 4DV5L 2G3QB 4OONA 2NVTB 3I57A 2K39A 4B3TQ 3EGRA 2UUAL 3HOVH 3HIZA 1IW7C 5EJWA 3OG5A 4RHSA 1UWVA 4MGKE 4QGUA 3VA5A 3V61A 4URKA 4A9AA 1HNZQ 2NBFA 1WXQA 3F1ZA 1Q1BA 1NENB 1B8AA 4BKSD 3C1EA 2NTTA 2AWNA 4LNFA 1XPUA 1HNXQ 4CKBA 2KWUB 1EEID 3GTMH 2O2LD 4S3SA 3HOZB 3NZUA 5BMGA 3I8ZA 4ZYSA 2KFKA 1CFMA 4N8X1 1ZOYB 3DCGA 1IBMQ 2JSVX 1OTRB 4DXAB 4PV1C 3ZYYX 3A4SC 1TJEA 3M3JA 1HH2P 1VJKA 3PO0A 3GTQB 1U9RA 2ZW0A 2HDEA 2KHWB 2MCNB 1QZHA 4LUVA 4JCVE 1OXUA 5IN7A 1Z9FA 2BTEA 4QCLA 1TKWB 2LUMA 4OWTB 4OIJA 4WJ3M 4BOZB 3OWFA 4C80A 5M5YH 5E4XA 2I46A 4LDTB 2J4XA 4LF8Q 1TT2A 1NR2A 3Q3JA 5IGGA 3IFWB 2L5TA 4UY8C 4GKKL 5EGTA 5KYIA 4UPAA 3S1MH 3G6EA 2IJ0A 1JW9D 1U4RA 4NXMQ 4F87A 5BR8L 1K51A 1N32Q 4DR2L 2XBBC 3U52E 4XWWA 1TT5B 5NUCA 4XQNA 2BDOA 3VR5A 4R1JA 3TEZA 4FYDA 4WURA 3V05A 3OMCA 4DR5Q 3PF5A 1LUZA 2HQLA 1D1IA 1UNSA 2HJ1A 3ZJUA 4NPNA 1YX6B 4MDKE 1S3OA 1W6KA 4OO1H 2UWQA 4POFA 5J39A 3HEJA 3ZJVA 4A3FG 2HD5B 2ZCCA 4DWFA 4DR7L 2D11A 5C44B 2WXQA 3R3OA 2CKHB 1QJOA 5C0XG 4FLHA 3IG3A 2ENBA 3RI7C 3GE8C 3MXNA 1X9NA 2K8HA 1D5XC 4X62Q 1GAQB 3UI3A 1MSHA 4N8FA 4M01A 3EC8A 2E5LQ 4L5QA 2KMAA 3C1FA 2VNUD 3KQ4A 2C9OA 3ULJA 2PCFB 3DWGC 4C3HB 1L4ZB 3J80E 3P63A 2DZMA 1EOTA 3K0YA 1TWCB 4KMUC 2KMCA 3R3MA 1HQMC 3CMAA 4Y7NB 2Z0EB 4GKJL 4LDTD 2BWFA 3I55A 1XYIA 4DHJB 3KUPA 1RDPD 1STBA 4DXGA 5FO8B 2LRUA 3BZCA 4A3DG 3GOEA 1STEA 5LL6S 3R66C 4A3MG 4OIKA 1KL9A 1VQKA 1OXVA 2VQEL 2PZUA 4GLAC 1BBWA 1VQPA 3M3YH 1GB1A 1QUQB 2KN5A 3TREA 3ENEA 1EF5A 2ZTEA 1PA6A 4A3LG 3DHIC 2OF1A 1WZ3A 4JI2Q 5M3FG 1MVKA 3SU8X 1WMHA 3PIOA 2KFJA 5IO9A 2L4NA 3D4DA 4K8IA 3STBD 1EY5A 1E3PA 3OLMD 3VR2A 5C0XH 3P4PB 4NNJB 1UE7A 4MN3A 4I65A 1YBYA 1FFUA 1EIHA 5GROA 1I5FA 3RN5A 2YEPB 3K0XA 3I4NH 5L37A 3PRMB 4QY7A 3M4YA 1EY4A 1SRUA 2EY1A 4FO2A 1NCVA 2AHOB 3FEWX 4NMZA 2DYOA 2INDC 3BU2A 2JN4A 1KH0A 5G5HA 1WVLA 5FO7B 2CKZB 5JZEB 4NAWB 4YIJA 4IM2A 4S17A 1B44D 1N36L 1FIQA 2R2QA 1E7UA 3PUXA 1JE5A 5I6YA 1EYGA 3M9BA 2CHXA 3CMMB 1UGMA 3NPPA 3M62B 4K6DA 3NZ3A 1PH1A 3TEXA 1JJCB 4DHJD 1G91A 1VQ6A 1ZYRC 1YJIA 2NVUI 4GOCA 1SYFA 3VQIA 4GSWA 2AUJD 3LWEA 3SD5A 4ITKA 1YQ4B 3HHMA 4C3JB 1RLFA 1HCZA 2KUMA 4IQZA 2JU6X 1CK1A 1JROA 4RAUC 3LWUA 4YWKA 5E3FA 3CC7A 4MM3B 1PFMA 4RHRA 2JK8A 1KRTA 1Y8OB 4E6IA 2INCC 4FF3A 4W9JA 1Q82C 5GAEC 2LMCB 2AMCB 5H92C 5GADC 3IL8A 3S1QH 2KOXA 1K8RB 1F2ZA 3U8ZA 4CO7A 1X65A 3HFZB 1KLGD 1ZE3D 2EMTA 3S1RB 4HK2A 3T53B 3MHZA 2C5LC 5IYDH 3SK5A 5EPLA 2G4SA 1P16A 3S24A 1STHA 3HKZB 1JE4A 1C7YA 1C78A 2E75C 1XPRA 1VDZA 1SNDA 2ZXOA 2VZKB 3HOZG 4WIPA 2L11A 4JBWA 1R9TB 3S1NH 2O6VA 1PFSA 1C77A 3L4PA 2CFMA 3MA2B 3DBSA 4TMAB 1N8RC 5KEEA 4G7OC 4JVZA 4X3SA 1F2YA 5J22A 3L16A 4FA6A 1J0GA 1YJNA 3IVFA 1NI3A 5GMVA 4DV3L 1I4HA 5IP9G 2PMZE 3Q14C 3TMPB 1A6XA 1QOFA 4TQ0A 4ANXA 4BZAA 1GUAB 1I6HB 1IP9A 4DV7Q 2UUCL 2BKRB 1WIAA 3AH7A 1E1OA 4JC0A 3N30A 1JWSD 1D3ZA 2VL6A 1HA5A 4ZUJA 3OIPA 3T4AC 3VDYA 1K8OA 2DYMA 3NRZA 3ZNZB 1WTWA 2X38A 5ELNA 3Q2AC 1YNJD 3WWVA 5A2QE 1FL0A 1JC7A 4RWSC 4GNXB 2BA1A 2WXKA 1VQJA 3DEOA 1X56A 1VQ5A 3GTLB 3RNEC 1Q8KA 2F4VL 1ZYRD 3CIRB 4WQOB 2PTLA 2ALYB 4IN3A 2MJ3A 2HCCA 1A3UA 2L15A 1SNPA 1XJVA 2PZWA 4US8A 2Y0SE 1EQTA 3GQBA 2D10A 2K6QA 2KOLA 2PVGC 3HOZH 3CHBD 2V1CC 2Z4HA 3MJ5A 2VZKD 4NAMA 4RA8A 1O7LA 3UE0A 2D2QA 2KHSA 4A3KB 2M0AA 5C44G 1HZBA 5IP9H 1ILPA 1TIFA 1H9SB 5A35A 4DV4Q 1YHBA 2IGDA 3GTQH 3J81j 1X54A 3K5OA 3K7AB 2FJ2A 5FR3A 1XCTL 3Q8BA 3CCRA 2HDMA 3MJWA 3DDCB 1U4MA 1BR9A 2OQKA 2RDFA 4X66L 4GOPA 4AQYL 5C1ZA 4IZ8A 1V1QA 2Z6KC 2GOWA 3F2DA 1KC8C 4L63B 4C3HG 1HPCA 3L3OC 1MHHE 2A69C 1YOVB 2K6DB 2BOSA 3BY4B 1TY0A 2KJXA 3P7JA 4DAMA 4KGSA 2FE8A 2R7DA 3QIJA 4JI0L 2AUKA 5HY6A 2UXDQ 3AQQA 2GA4B 1EZ8A 3AFPA 3T1HL 2QHOA 3AU5A 2GMIC 1HZAA 4HR7B 1PYSB 3SFEB 3ZUNA 2SNSA 5BYSA 1L1OB 2F0EA 1EU3A 2ASQA 3BK1A 2NYZD 2VS1A 2HQEA 1D5ZC 1D8LA 2RQXA 3CXCA 2KMMA 3M95A 4NQKE 1BBUA 4CDDC 1EL0A 1AE3A 1E2ZA 3TZUA 1Y14B 1E2VA 1MHWC 2LXJA 4QJFA 2IY5B 5HG2A 1PFNA 3TDQA 2K04A 4FF4A 2RHSB 3APCA 1X3PA 3PUYA 1KNEA 1QOBA 1SF0A 3QOJA 2W3RA 5IT9E 5M9OA 2N4FA 4AQ7A 4RKLA 1U5KA 3RNFC 5IODA 4DK0A 2KC2A 3P4RB 2MFIA 1A62A 4JLCA 1BDOA 5C4JB 2RBMA 4KY6A 2FUHB 1WWTA 2QC8A 5FLMG 2QIEB 4P1BC 4FADA 2P5ZX 4C3HH 4X64Q 3S2DH 3W1YA 1CUKA 1QCBD 2ZM6L 2JZPA 3UDFA 1WTPA 1A8VA 4Y7NH 2F0HA 3RMHA 2R92H 3DHHC 2CS4A 1PTOC 4NJ7A 4ZKCB 2DENB 4YWMA 3IKJA 1TYGB 4MACA 4A93B 2WAQB 5G5GA 1UGJA 3QARA 4DAYB 3CCEA 2K8CA 3BINA 2E6XA 4C3JG 4LFAQ 1FJGL 3SDZA 3AE4B 4OO1I 1PHJA 1J19A 3C8YA 5GXGB 2AYOB 3TZDA 3L0OA 1KHIA 3KLSA 1WTOA 2MJEA 4DHZE 5FJ8G 3S2HB 1M8AA 1SYEA 3A5ZB 3KYCD 1PTOB 2DAJA 4B08A 3IT4B 2CWPA 3NZSA 3M4QA 4BBSB 1DONA 2OCEA 4KY7A 2Q8RE 4PZ8A 1TS5A 5DM73 4DR1Q 1STYA 4EE2A 5HI1A 2EDGA 4JE3B 2NN6H 4XDCA 4L8JA 3L2PA 2KJHB 1ENAA 3RNAC 2IHEA 1PH7A 5LMUL 3IAM1 1EYDA 3HKZG 2ZPYA 2V3SA 1O7ZA 1LABA 2K4KA 2VUMH 4GMVA 3T9LA 4KN4C 1OXXK 4YSYB 1DOXA 1B9NA 2ID0A 3QA8A 1X32A 1ISNA 1DM0B 4FXDA 2B2VC 2VXWA 4IPHA 1DOKA 2IGGA 3MC8A 2EQSA 1OQQA 4K3CA 2L76A 3P20A 3NQIA 2MHVA 3CQZB 4KDIC 3ZXRA 3CSFA 2PPHA 5C23A 3TP8A 3I4MG 3N32A 1S3SG 2QDBA 1TTNA 4KV6A 3KBGA 3CCLA 2JA7B 5IWAQ 2LXAA 3ABVB 5C0XI 2MPMA 1Y69U 2JA6B 1YHAA 2FHTA 4K6LA 4MTNA 2KWVB 3K9OB 3ZJYC 1PTOD 2XNAC 4KJNA 1XMOQ 1WI0A 3VTWA 4UP8A 4X65Q 3W1SA 5D6JB 4UHVA 2MP2B 1VMPA 2F0FA 2BT6A 3FP9A 4DUYL 3HM3A 2L9HA 2IO2B 3HUIA 3NTIA 3J81i 2UXBL 2PJHA 3E9IA 2UXCQ 2E2IB 4WWPA 2NBVB 1JCKB 1JB7A 2JE6I 1WGHA 5CHFA 4HMIA 1F2MA 2TSSA 4JGHB 1EEFD 1TS3A 2NVQB 3MC9A 2DN8A 5EBCA 4FJYA 3VUYA 3ZW3A 5C3JB 3QG1A 2I0QA 1B9MA 3A74A 3SHLA 1DCZA 4A3KG 2WB1B 2A19A 3CRKC 5JJKA 1V1PA 1K52A 3W9CB 3NBHA 4LAAA 1WD0A 2VQFL 4BXXH 2KCTA 4DK6C 3NHHA 2D5DA 5C5LA 2XVSA 1WR1A 2L7RA 5LXHA 2OQ0A 3NS1A 2PNHA 2KJ6A 1Y1VB 4MSQB 2N9PC 5E6OA 1AN8A 1B70B 2JYOA 1ACCA 4JI6L 3OTOQ 1N60A 3PVLA 4LF6L 1AWDA 1P9DU 1PH6A 3D4RA 2CH4A 4ZRQA 3ETRA 4M8NA 1V9JA 2B2WA 3BVMA 3I73A 4J6IA 1HQRD 4DV0L 4XC2A 2RF4A 3LXFA 5C5MA 1EQVA 2UU9Q 4ICUA 4A6QA 3GTLH 1WJ4A 2W9NA 2JYTA 3AN1A 1KDCA 5AZHA 4AP4C 5BN5A 4GN5A 1X3EA 4DV6L 3AEAB 1PRTC 1K83B 1QILA 4YL8A 4U673 3SR1A 5JEAJ 1PZID 1GUSA 1HNWQ 2J0KA 5TR5A 2WDVB 4CBVA 2DBYA 1SE4A 4M02A 5HURA 1CSQA 3CCVA 2IO3B 1CKNA 3UE1A 2OJWA 4DK1A 2WXRA 3Q3FA 3S2AA 2LKVA 1B53A 4B3RQ 4WJ4A 4W9FA 3FKIG 2KVMA 1V80A 3VAWA 1QNKA 4A3OA 4HJ9A 5DPRA 2EKIA 1PRTB 4JOIA 4V0BA 5G3LD 1R4MB 2WGSA 1EWYC 3ITPA 1SJED 2BE5C 1EWHA 3A7AB 4R4IA 2RPQA 5FLXL 4I7AA 2CU1A 1DOIA 1CKMA 4BA1I 1H4RA 4TKNA 1SR3A 4OWXB 1Q1OA 3Q3NC 1V43A 2GN5A 3DBLB 1IPGA 3H7PB 2G9DA 4Q5VA 2DWQA 2GRIA 2FXQA 4DK3C 2KNBA 4Y52H 4HSPA 1A2TA 2I38A 5IYCG 3JAME 3BWUD 1SIFA 5CMDA 1Y8RC 4R9WA 2MX2A 1LTGD 5ISRA 2KANA 4A93G 2WAQG 2N0SB 2N8NA 1Q86C 1LXDA 3QHTA 3TP7A 3KWVA 3C2PA 1E22A 4GLSC 1MBYA 1TS2A 2L55A 1I94Q 4K5VA 3KF8B 4CJ1B 2K28A 2L1AA 4A3CG 1VR9A 3RNUA 2RGFA 3AE5B 2A5UA 1X1MA 4PS7A 3CC2A 4ZYNA 4IW0A 1EY9A 1UH6A 5FO9B 1K73C 4JI3Q 3JC66 1B9RA 3DLLA 1UWXA 5ELOA 2WXIA 3QQ8B 1YIWA 4P7IA 2YEPF 1C4QA 4HIMA 2KCCA 1SE8A 4UP7A 3RZWC 2INNE 3VUWA 1PRTD 5KIXA 1FMAD 4AJWA 5C4JH 4HKQA 3K9PB 4B3SL 5DPTA 3T1YL 1N62A 1N34Q 1BCPB 3ZGZA 5AFWA 2V3PA 2PO4A 3URYA 4MJSB 3QIAA 2KN4A 1RKNA 1TWAB 1J7BA 1ZGUB 2EYPA 1E0ZA 2D3GA 2KVZA 3NTKA 1FO4A 3BJUA 4X6AH 2KQ3A 2JVCA 2M9VA 4K7SA 1YD8U 2Q2UA 3KJOA 1YN4A 4A93H 3DBHB 2CCZA 1VQBA 1SBBB 1E8WA 3A1QA 3MXUA 2HJ8A 2XTIA 4A76A 2R3ZA 3HOYB 3NTHA 2BE5D 4JYAL 3KYDD 3T3NA 3A33B 2XK5B 1XLNA 3S2HH 2JA7G 2OTJA 4A3FB 3GTGB 1PTOH 2KQSA 2JA6G 1EF1A 1XCQL 3X23A 2EYOA 4PMBA 4BBSH 4BAXA 3D31A 2MQJA 1FNUA 4DR6L 1P0RA 1FGUA 3TP5A 3IAS1 2WKCA 1S1QB 4K7WA 3T8MA 3A8KE 1IBXA 1CI3M 2BQQA 1WRDB 1HFNA 4NPSA 1AEXA 1R4PB 4NB3A 1J8IA 3AEEB 2JF5A 2EJFC 1I4RA 4K5WA 4KHVA 5JAVA 1RRBA 1G8ZD 4NKLA 1BCPD 1L7YA 1UELA 2LVQA 1E8ZA 3TBIB 3NK9A 5I6WA 1YNNC 2RCFA 3PZ7A 4AS1A 1X3QA 1VQDA 4A3DB 1WX7A 1RWSA 2WB1G 1NR4A 1I35A 2F0LA 3I90A 4I7ZC 3W1GA 3KF6B 1IYJB 4PZ7A 2QA4A 4DV1L 2F0PA 4HEDA 1KIXA 3CQZH 1RTNA 2BYEA 1XNQL 1QQRA 2K22A 4HPLB 2KX3A 2A5HA 1CKOA 1Y1VG 3RD2A 1HR0L 1E7VA 4CYEA 1IBXB 2L3ZA 1WD1A 1GKHA 1AP0A 2K52A 2JA6H 1Q0WB 2V4IB 3AECB 1WRIA 2KHIA 4C56C 4JPSA 1P8LA 2N3SA 1LTID 2HDLA 2RVLA 2KTRA 3FILB 4GDKB 1TVXA 5BN4A 4PG3A 4YCVA 2RDBC 1A63A 1SNQA 4JQWC 1GHJA 3SK4A 1HE8A 3Q8CA 2LFNA 3TUOA 4LK0M 1UBIA 2NBWB 2K0PA 2E2IH 5GQOA 4D2KA 1K8GA 1VF5C 2KQ4X 4II2B 1V2YA 2I5MX 4WRDA 2NVQH 2QMTA 1KRHA 4JI5L 3C0RB 3DBRB 4IDIA 4YSXB 3OMGA 2RR9A 3A56A 3S17B 1HUNA 4UAIA 3TBLD 4ZK9B 4RNAA 2LFIA 1VZ8A 2QSDA 3HKZE 1QB5D 3KFUA 4MHEA 1F9RA 2ZXPA 1FNWA 2D3AA 4EZJA 1SFOB 3ZIMA 2IO0B 5COYA 3I72A 1Y1VH 2WNMA 1PVOA 5BYRA 5AJ3Q 1DGSA 2BH2A 1VQNA 2Z0SA 4K0KQ 4K5XA 4IM3A 3DHQA 1BOSA 1YNND 3V3XA 1QE6A 5IT9L 3ZDMC 2FCQA 1ZKHA 3ECIA 2L1BA 2BW2A 4H0LC 4ZDVA 2WDQB 5E7NA 4KD4A 3RNBC 2AWOA 2K75A 3Q6SA 1SYGA 3BG3A 3SFDB 1UEAB 4KKUA 3CC4A 5E4WC 3MTSA 2NR2A 4MSMB 2MBEA 3I56A 1E2WA 4WFN3 3I3TB 2JA5B 1U4PA 2CHWA 5JHBA 4WWOA 2BYVE 4K2LA 2D3BA 2M00A 4L5TA 2J52A 2HTHA 1EZ6A 2PLPA 3FPPA 1P98A 1F1HA 3J7AF 5JHAA 1ML0D 5M5WH 2LGIA 4IUUA 3OW2A 2WU2B 1QZEA 5JPNC 4A3BB 1C79A 3HVZA 1I4PA 2F0GA 2SDFA 2AKWB 2X6LA 2L83A 3HKSA 4A75A 2PIAA 3V96A 1LTLA 1F2LA 4IFDH 2ACZB 4DR3L 1T3QA 1N32L 4NDXA 5AUKA 1PMRA 1YJJA 1DGJA 2CWAA 3AE9B 3L13A 4DV5Q 5KNBA 1CMXB 3DM3A 4HEA1 2MEKA 4O0AA 1DOMA 1MG4A 3PHWB 4QIWB 3BVZA 2UUAQ 3M4OH 2JWUA 3AFQA 4M0WA 1TS4A 4XYOA 2K7VA 1YITA 1SYCA 3OSOA 1RIPA 4KHPL 3O65B 5DCNA 1GOZA 3STBC 1G51A 2ZJRA 1B7YB 3J7A5 3P42A 3UF8A 3E56A 2BS3B 4GGQA 2KFKB 2KEDA 1P7FA 1K53A 1V1OA 1VQCA 4P71A 4J6HA 4B9WA 4JI7L 3AEDB 4A3PA 1S5ED 1SYBA 1PDXA 3V62A 2EOTA 2E2JB 1ICFB 4P2CB 4DGZA 1OFFA 4IUVA 1BUIC 3UGBB 3HOYG 1HUMA 3DPDA 1WJJA 3EQLC 4RGNA 4ULLA 3VR4A 4KN7C 1VQ4A 1WF9A 4LJOB 1CA5A 1NE3A 4TSSA 1PTOF 4J15A 1JB3A 3APFA 1J8CA 4WAAA 3J81c 2WV6D 4PZ6A 1K8AC 1IBKL 5EE3A 1C48A 1CQFA 1K8MA 4RKBA 3T51B 3GTKB 1WJUA 2GBJA 2E8GA 4HJ7A 3MEHA 3ML9A 2D5GA 4AUQC 5CBEE 1RYJA 1L0WA 3NJTA 4ZCKA 3F2BA 2H5XA 2R7ZB 3QK0A 4ZHOA 3BZDB 1SE3A 1XLQA 3ZLZA 3RLNA 4XZ4A 4BA2I 4K7UA 4KGRA 3T56B 1LTBD 4IPCA 1MJDA 2JA8B 2EY6A 1IGDA 1VMCA 4JI4L 5G55A 1OXTA 3L7ZC 4CHTB 4S0RA 1TWAH 4GKKQ 3PS6A 1W6JA 4L2YA 3DWPA 1QVGA 2DX5B 1ZXTA 2AL6A 1EUJA 2N88A 5BR8Q 3PO3B 4DR2Q 4IKGA 2LSSA 3M7NA 2KECA 1TXYA 4Q2JA 3MHBA 1JWAD 3AMUA 1FXAA 1FCCC 3I5JC 3PLVA 1SN8A 2M2LA 3HM6X 4K2KA 1EM7A 2OXPA 5JPMC 2ICEC 3MXNB 3HOYH 3KK7A 2B29A 3U4VA 4LF5L 3B08A 3Q8FA 1Y8NB 3RNGC 3ALBA 1Q46A 1WX8A 1EY8A 3B2FA 2M17A 5F2DA 4A3FH 1VQ9A 4DR7Q 1K50A 1SAPA 3Q24A 4H2AA 1PQSA 3WAPA 2Z8LA 4F8CB 2WAQE 3A5UA 4MEMA 3PO2G 1I42A 2VH1A 4RMAA 2DNEA 4UDUC 2LY7A 1SDFA 3ER0A 4O1NA 2BB5A 1A3VA 1TWGB 3L10B 1PH8A 4HROA 4LNOA 4K8JA 4NXNL 4GLVB 2BYFA 2VB2X 4ZOHC 1KLUD 5JVH3 4YCUA 5KHOA 1VQLA 4ZRIA 2JXXA 2G4DB 2EXDA 4GKJQ 4JI1L 1YNXA 4QB4A 4YCWA 5JJZA 1YNJC 1NAPA 3CF5A 1R4NB 3QAQA 4A3DH 2L52A 3LX0A 1B4OA 2EKEC 4A3MH 1DJRD 2ES2A 4MH0E 3U50C 5G3LF 4GN1A 2VQEQ 1WMHB 2MNAA 4LFBL 4KZ0A 3TP6A 3AYHB 3GTPB 2ZJDA 1FCLA 3SVMA 1BXTA 5LMNL 2VW9A 3Q23A 4XT1B 2MQHA 4A3LH 4FN2A 1YN5A 1YQBA 2DZJA 3GD7A 2IX3A 5M3FH 2X6GA 2IT1A 1A0IA 3KOJA 4HN7A 2DYBA 4OZCA 2E74C 2B2TA 2GVBA 1EY6A 1XLOA 4DNRB 1L0YB 2F0KA 1K0RA 5FK9C 2WU5B 3LDZE 2YU9B 3R2IA 1Y8PB 5C4HA 3K7UC 4ME3A 1HTQA 1N5XA 1KQSA 1Q5WB 2Q2IA 1OXSC 3NOBA 2EIFA 4QL5A 2PMVA 3L9AX 2WXMA 3FVQA 4F88A 1RODA 2K1BA 1M90C 2JA5G 1X55A 3EUB2 2QW7A 3N3KB 1OQYA 1YZ6A 1N36Q
chains in the Genus database with same CATH topology
1SNMA 3MXGA 3NUCA 4C2MB 2CHBD 1C8CA 1C4CA 5ELEA 2RKSA 1FNVA 3JAML 2IWHA 2WDRB 1ZDXA 5CC4A 1PRTF 4ZAIA 3HVDA 2WXNA 1Q10A 1Q1EA 3RLFA 3I4MB 1A15A 1MHXA 1F9PA 2L0CA 4R8IA 4OVZA 1H9MA 4NZLB 1CM9A 4TQUS 2GI9A 1S4ZA 1QOGA 3DWQA 5JEAG 3TEWA 2NUCA 1EYCA 1ESFA 3N6RA 4KGTA 1SEBD 1NYQA 2F0IA 3VYSA 4AYBB 4WWMA 1I50B 4OGQC 2XRSD 1EFID 3FPUB 4KHZA 4LK1C 1Q3LA 2B63B 1STGA 1ZEQX 4LTUA 1WTRA 1FFVA 2JYEA 5HHDG 3R2TA 2RPVA 1BCPF 3J81E 1IKLA 1KFYB 4ZLTF 1CQVA 4L23A 4DN4M 3EFXD 2AQ2B 2A68D 3NVYA 3E0JA 1BUVT 1G6ZA 4CJ2C 3A7LA 5BMIA 3S16B 4KX6B 1S5CD 3S15B 4PNYA 4Z9CB 2JP1A 3VA7A 3E9SA 1AYFA 3RFZB 5JEAH 1GB4A 4PT5A 2EZVA 5ELBA 1PUTA 5CORA 1JWMD 2NVXB 4HJGE 5IGBA 4PQXA 2Y5CA 1D5MC 3NSWA 4IFDI 3FKIB 5M5XB 1LTTD 1WSPA 2N7JA 4BS9A 2L32A 3BDOA 3RZDB 3HG9A 2K9XA 4N9PA 1V97A 2ON8A 2NVYB 3QJYA 3P75A 4MH8A 3TN2A 1CJEA 4EQOA 2JXMB 2WACA 4KJOA 4A3EB 5E6JA 4KD3A 2O5JC 2HUGA 4RCNA 1L6UA 1SNCA 2K32A 1QT9A 4ILWA 2D62A 2FUG1 2XWBB 4A3JB 1H9RA 2NTSA 2CQAA 2XN9C 1FD6A 1WGKA 5EBDA 2CU3A 4QUFA 3S14B 5CV9A 3OW7A 3T3OA 1PZJD 1BMLC 1NUCA 3AB5A 4XXEA 3W2DA 2HCIA 5D65A 1NEKB 3EVQA 1NYRA 2BYTA 2SNMA 1FD7D 4R3DA 5T1IA 2HTME 1D6EC 3EA6A 5T8IA 5D7GA 2RMMA 2I2YA 3CKIB 4C7ZA 4TKOB 4J1MA 1HTPA 1JALA 2JEBI 3R8BA 2F0TA 3WCQA 3DM1A 3U4EG 4EGVA 2WS3B 2K05A 3IAYA 4NJCA 3WDNA 2PYKA 2QILA 4NP5A 3H6MA 5DNFA 3U7ZA 1E0BA 2B76B 2JXTA 2F4IA 5K36G 1JMLA 5EQ0A 3Q8AA 2B8FA 2V3NA 1F77A 4EVOA 1CT1D 3RZOB 3H8HA 4QUCA 4N59A 5BYQA 5C2TB 4H13C 4A3GB 5DEHA 4HTHA 2EELA 3ND9A 4HKZE 1JORA 1TWFB 1YQ3B 2KA7A 1I4GA 1CA6A 3UI2A 2E3TA 3AE8B 4FXCA 3X3MA 2TMPA 4KY5A 1IUEA 1IYVA 4US9A 5ELCA 5C4ZA 1LTSD 3PZ8A 2K01A 4BWGB 3AB9A 5EE1A 3QWNA 2RA4A 5C6AA 5K36H 3KBXA 3AV8A 3HRDD 3GP7A 2PNRC 2K33A 4GZYC 4BBRB 1RM6C 2E2HB 1IHZA 2CW0D 5C3XA 2EJMA 4CKCA 1V1PB 3J80L 4CJ0B 2A73B 3K5MA 1ZKOA 3A55A 3HOVB 4M1UB 1BBXC 3GV3A 2MH7A 2JEAI 4KTAA 3GTJB 1TU2B 4RFBA 4EQNA 2W54A 3VRBB 3FC4A 3GTMB 2RSNA 1PFDA 3HGBA 3B9JA 2D9UA 5JVG3 2J0TD 4XWTA 3PUVA 3FDTA 2R93B 2H4OA 1LT5D 4YTPB 1EY0A 2LEKA 1L6VA 5BMHA 4ARCA 1T5XD 2F0QA 5M5YB 1BCPC 2EXZA 2GB1A 5FOBB 4DU9A 1FXIA 1L0XB 3IFTA 3S1MB 2FINB 2CJNA 1VCIA 2DNCA 2FMMA 3CU7A 4FXGC 3VYRA 2WINB 1MD2D 5CGKA 3IT6B 1SJHD 4MT5A 4ZKBB 4L6TB 2EVBA 1HTLD 1GUWA 2XIWA 3MP9A 5LHY1 5IOCA 4QF4A 5CV8A 2QF7A 3ND8A 1D4BA 1RFKA 3QB3A 4XTCS 1VZ6A 3GTOB 1UWMA 1N5WA 1Y56A 2Y3AA 1LV9A 1FEHA 2H1EA 4HRSA 2H89B 1KDAA 5I9OA 1XXGA 5EE9A 5C4XB 4ZQ3A 1VZ7A 1QWYA 2B2YC 1B3AA 2BB6A 1QOAA 2M56B 3VR3A 3J9CA 1BO0A 4F8MA 3M3YB 3I3CA 3HOUB 2SAKA 1H9JA 4MIUA 3K58A 3H0GB 3OWEB 1SMYD 4X3KA 5EKLA 5A2QL 2OT2A 5D3DA 4KK7A 1MSGA 2A6HC 2J7ZA 2C5CA 1AZQA 4ZHPA 4C1NK 3I4NB 3KLSX 3C3LA 5JXVA 4FNFA 1PYWD 3NXWA 2MJDA 5HGTA 3PUWA 2K03A 2B2UC 4B0EA 1YNTE 1KDBA 3GO5A 1II3A 1CTMA 4YSZB 1ONLA 1XWEA 3PO2B 2PZTA 3GS2A 1GUGA 1I4QA 1N63A 2IPKD 5CV4A 5TSSA 4CQNA 2BDNA 1U4LA 4ZRPA 1IYUA 1HXYD 3SK6A 4H44C 3S1QB 3M85A 1TKGA 3PUZA 4RGMA 4WORA 5IGEA 1TY2A 1O80A 2X69A 3ERQA 1UAPA 1RHPA 4O42A 1S5DD 2EE1A 2EJGC 1ENCA 3S1NB 1DOYA 3AE7B 3I70A 1PZKD 2NB0A 1ET6A 2EYJA 2F0UA 1A70A 1BQQT 3NWTA 4IALA 2MGSA 2A6HD 2K5QA 4L1BA 1ESRA 3BDCA 3AE2B 1GXDC 2A74C 1L4DB 4XT3B 3BIID 3KLRA 1LTAD 1ILQA 3QOLA 3C46A 3MZ5A 4JWSC 1YMHE 2KAJA 2BA0A 3NE5B 2PKOA 2AQ3B 1FYCA 1SYDA 5BN3A 2K5WA 5EKKA 1A2UA 1LACA 4ARIA 3AU7A 1B50A 4JX1C 4ODGA 5EPJA 4Q0FA 4OO1G 1J7AA 4KKJA 1ET9A 2BS4B 1FM0D 2WXHA 2IGHA 2D2CC 4XE0A 3RUZA 3PV0A 4TRDA 2AX5A 3HOXB 3AMZA 1CHPD 1SE2A 1E10A 3U2SC 1VLBA 2INPE 4P6VF 2PQEA 5CV7A 2ONQA 3OHXC 3X3NA 3I4LA 1A3TA 1T5EA 5I4DA 4EQPA 2V0GA 1XF5L 1TR5A 3H91A 1HEZE 4XDXA 4P16A 1EWCA 2F0DA 4M8AA 3GV6A 3KWLA 1RD9D 3Q22A 1E9MA 1IW7D 3MC0B 4IUPA 2LHEA 3AEFB 1TKEA 4OZAA 3FAHA 1D2BA 3S2DB 4F7XA 2N9LA 2R92B 1V8CA 1ENFA 1STAA 4OW0A 3FRPB 3HRZC 4C3IB 1JOQA 1FR3A 1JQYD 1UUPA 1T6BX 3G7LA 2IL8A 4CKEA 2OEOA 3OIQA 1SB3C 4JWUC 3D3RA 4TQ1A 4K14A 2OEDA 4XQQA 5DM63 2EPBA 3Q8EA 2IX0A 5H8YE 3T16A 1J9OA 3N9YC 5FLXE 1J7CA 3BK2A 1EU4A 4DAVA 3R93A 2EYFA 4KKIA 4DQOC 1F2RC 2XWJB 2OHFA 1PGBA 3GB1A 4A3IB 2LMCA 1R4QB 1CZGA 3E5SA 1G2SA 2VUMB 1P7EA 3NVWA 1N61A 3MAQA 4OZBA 4A55A 2L12A 1SIJA 3D4WA 1I6VC 4XQJA 1C9FA 2B2TC 4HCSA 1F9QA 5T1GA 3Q0AA 5EPKA 4BY1B 3NVZA 3NUHB 4ID6A 3MWYW 2J53A 3H3VC 2A68C 2Q8IB 3AM9A 3SXHA 1B2TA 1MI2A 3SK8A 1MGSA 1H9KA 1RTOA 1WCMB 4IUQA 4R8NA 1V8QA 3TMEA 5IGFA 1FRRA 3HOWB 3SR6A 1JWUD 3BVGA 4ME5A 1JQ4A 1XTCD 2KACA 1EYAA 1LO5D 2XRQD 3MVVA 4IFDJ 1QOHA 1RF2D 1GJXA 2WLBA 2F0SA 4KI0A 1HZ6A 4N58A 3DWAA 3VYTA 5EE0A 1H9SA 2K3UA 4DXFA 4BY7B 3U9SA 2ICIA 2WXGA 4HMJA 5K5PA 1XLPA 1F0ZA 4ABNA 4B0MA 1JRPA 2IW3A 2B8GA 1Z47A 1EIGA 2DY7A 3OOCA 2EYMA 2FMCA 3D6CA 4A8XC 4YXDB 4ZRZA 1G291 3VR8B 4WQMA 2I07B 4LLGM 2F0MA 1RJTA 3MFYA 1VDVA 4RF1A 2NZ1D 1Q8IA 1WYGA 2RDGA 4LMQD 2O5IC 3IXSA 4FVMA 1G2TA 4IURA 1SSOA 4IUNA 3TSSA 2DY8A 1FRDA 4DFAA 5D14A 3NQTA 4PMCA 2IX1A 3U9OA 1XEEA 1ICWA 2ZT9C 2Q8TA 2MJ8A 3NP8A 5M3MB 1QLBB 5LNK1 4CGYB 1SNOA 4HSVA 4C3IG 4FP5D 2WXPA 2BCOA 5I2XA 1JR0D 1DD2A 3PIO3 1Z7TA 1EY7A 3D6WA 3A54A 1JOOA 2KDMA 1F9SA 5LL6X 4DAYA 3M7GA 1WTQA 4C1NI 1JOKA 5C0XJ 3P1HA 2JX5A 2MP1A 1C76A 3ONAB 1NVID 3LYYA 1MI0A 2Y5PA 1ZUD2 1TIID 2NN6G 3I91A 1AZPA 2Q5WD 3V2TA 5JOBA 4HCEA 1I7HA 1BF4A 4IOIE 4IUTA 3G6JB 3A8JE 4X3TA 4NW2A 2H88B 1HZ5A 3P4SB 1JWBD 1HHVA 3T13A 2K5DA 2WKDA 3VRAB 2QJLA 1XX8A 4H7BA 2W55A 1VRAB 5IGDA 1ZXHA 1YN3A 3DMUA 4RF0A 2WXFA 2EY2A 3W3AA 2FBWB 2WIIB 2A69D 2WP8J 1TWHB 1B1ZA 3NBIA 3HS0C 4G7ZC 5E1FA 2WXLA 4OL7A 2CW0C 2RDHA 2WP9B 2B2VA 5MPOA 1GUOA 1WTVA 2PW7A 4FF1A 3K5NA 2SEBD 1TKYA 1IL8A 4RCOA 3W5VB 4G57A 5CV5A 3H94A 4FXKC 1O78A 1L5PA 3BYYB 2KCNA 1JICA 1IGCA 1SSNA 2FFKB 3SE0A 4J8QA 4JK1C 3WOEA 1KABA 2F0NA 1TZOA 1BNZA 1LT4D 2M19A 2NMQA 2N9KA 3CWIA 4DF7A 2E2DC 4A90A 2PMZB 1PLFA 5C3EB 5ELFA 2VB3X 4G4KA 3NWSA 1ZXIA 3SEBA 4X3UA 5CYUA 2W82A 4WAFA 1LT6D 3ZJTA 3A8IE 1SXTA 2BBCA 4KKSA 2ZW1A 1CZPA 1D1KA 2F0OA 3DEPA 1ZPSA 1FGBD 3DUZA 1Y1WB 1E7PB 3PMFA 1R7SA 2J42A 2KEEA 3O13A 5FKAC 1I3QB 1C4PA 2B2WC 2A6EC 1O7YA 1PFBA 1Q12A 5IGCA 4V190 2LHDA 5J1ZA 2Y0SB 2G9HD 1DYQA 2ZXRA 5CR3A 3F2UA 1AFPA 3PIP3 1HRJA 4J3OD 2PW5A 1KTKA 3FMCA 3LB8C 2WXJA 4RH6A 2O4XA 5C3WA 5KNDA 2N55A 4HAEA 2G1EA 1AW7A 4QMGA 1PDQA 2EYLA 4G7HC 5M5WB 3QO2A 2PPBC 3AEBB 3HZXA 1DZ1A 3IFDA 1IKMA 1MPEA 4OHJA 3KF8A 2YYZA 1S5BD 1QNUA 4LJZC 2BS2B 2F3VA 2LS01 4PMWA 1VF7A 1SMYC 3AEGB 2MUYA 3M4OB 4REZA 3BDLA 2DLBA 5KYLA 4GDLB 3DXJC 4ZUIA 5KGUA 2QCPX 5EKIA 1ZDVA 2XSCA 4FF2A 3TEYA 3K59A 2SOBA 2V4DA 3AE3B 2F3WA 2PVOD 2A6ED 2F03A 1TQOA 2WXOA 4DA2A 1L0VB 3AE6B 5AUIA 1C4AA 5KRUA 4WJWA 5HFYA 3K57A 2F0VA 3VR9B 1QKZA 1DOLA 3OPOA 4WH4A 1HA6A 3NVVA 2Z4IA 3Q69A 5CV6A 3W5UB 1XO3A 4DAPA 4N9TA 1OQRA 4B9XA 2AQ1B 2CJOA 2QKIC 1CHQD 3VR6A 2B39A 2B2YA 3AE1B 4RGTA 3P4QB 4YT0B 5CBAE 2Z1CA 3BYTB 4YWGG 4YTNB 1S5FD 1PGXA 2F0WA 4DNTB 4RGOS 2QEJC 3DWMA 3EROA 3WOFA 2RSOA 1KAAA 4XIGS 5I9PA 2E76C 2R61A 1E6EB 5DAUA 1WWTA 1GHKA 1LTRD 5IIFA 1Q90A 1RCVD 2LJIA 1KNAA 3K5LA 1STNA 3D8GA 3MXPA 1ZP0B 1LT3D 1LLRD 1GUNA 3S9WA 3FILA 3H09A 3LNNA 3P1MA 3RD4A 2WQYB 2EY5A 5D3IB 4A3MB 1WTXA 4XYQA 3K6OA 2B2UA 2F0JA 3BS1A 2W3SA 3J7AV 4U68A 1GUTA 1QG7A 2PW9A 1M4VA 4C7YA 1HFGA 4USAA 3J81L 3MFGA 5M3FB 2EYHA 3N52A 1GPXA 2F1MA 2CVRA 3RPFC 1NSNS 1I4XA 1PXUA 2NN6I 2R6GA 5ELDA 1ROEA 1QF6A 1DXMA 2JSOA 3ZQ4A 5I2YA 3EJIA 5KNCA 3I9V1 2K6AA 4KKTA 2KWDA 3VYUA 4YTMB 1KF6B 2IDYA 1F2RI 1OO9B 3HP3A 4N6EB 1CZWA 1Z6HA 3CRLC 3J7YW 4IFDG 3E6ZX 3B2GA 2JQRB 2K5PA 1PGAA 2NWGA 2NVTB 3I57A 3EGRA 1IW7C 5EJWA 4RHSA 3VA5A 4A9AA 2NBFA 1WXQA 1Q1BA 1NENB 3C1EA 2NTTA 2AWNA 4CKBA 1EEID 2O2LD 4S3SA 3HOZB 5BMGA 3I8ZA 4ZYSA 1CFMA 1ZOYB 2JSVX 4PV1C 3ZYYX 1TJEA 1VJKA 3PO0A 3GTQB 1U9RA 2ZW0A 2HDEA 1OXUA 2BTEA 4QCLA 1TKWB 2LUMA 4OIJA 3OWFA 4C80A 5E4XA 2I46A 2J4XA 1TT2A 1NR2A 5IGGA 2L5TA 5EGTA 5KYIA 2IJ0A 1JW9D 1U4RA 4F87A 1K51A 3U52E 4XWWA 5NUCA 4XQNA 2BDOA 3VR5A 3TEZA 4FYDA 4WURA 3V05A 3OMCA 1D1IA 1UNSA 3ZJUA 1W6KA 4OO1H 5J39A 3HEJA 3ZJVA 5C44B 2WXQA 3R3OA 1QJOA 5C0XG 2ENBA 3MXNA 1D5XC 1GAQB 3UI3A 1MSHA 3C1FA 2VNUD 3KQ4A 2C9OA 3DWGC 2PCFB 4C3HB 1L4ZB 3J80E 3P63A 1EOTA 3K0YA 1TWCB 4KMUC 1HQMC 4Y7NB 1XYIA 3KUPA 1RDPD 1STBA 4DXGA 5FO8B 1STEA 5LL6S 4OIKA 1OXVA 2PZUA 1GB1A 2OF1A 1MVKA 2L4NA 3D4DA 4K8IA 1EY5A 3P4PB 3VR2A 5C0XH 4MN3A 4I65A 1FFUA 1EIHA 2YEPB 3M4YA 1EY4A 4FO2A 2EY1A 4NMZA 1NCVA 3FEWX 2DYOA 1KH0A 5G5HA 1WVLA 5FO7B 4NAWB 4YIJA 1B44D 1FIQA 3PUXA 5I6YA 3NPPA 4K6DA 3NZ3A 3TEXA 1G91A 1ZYRC 1YJIA 1SYFA 3VQIA 2AUJD 3LWEA 4ITKA 1YQ4B 4C3JB 2JU6X 1HCZA 2KUMA 4IQZA 1CK1A 1JROA 4RAUC 3LWUA 4MM3B 5E3FA 1PFMA 4RHRA 1Y8OB 4E6IA 4FF3A 2LMCB 5H92C 3IL8A 1F2ZA 1ZE3D 1KLGD 3S1RB 3T53B 3MHZA 3SK5A 5EPLA 1STHA 1JE4A 3HKZB 1C78A 2E75C 2VZKB 1VDZA 1SNDA 2ZXOA 4WIPA 2L11A 4JBWA 1R9TB 1C77A 3L4PA 3MA2B 4TMAB 5KEEA 4G7OC 5J22A 4X3SA 1F2YA 1NI3A 1I4HA 1A6XA 1QOFA 4TQ0A 1I6HB 3AH7A 1JWSD 4ZUJA 1HA5A 3OIPA 3T4AC 1K8OA 2DYMA 3NRZA 1WTWA 2X38A 1YNJD 5A2QE 1JC7A 4RWSC 2WXKA 2BA1A 3DEOA 3GTLB 1ZYRD 3CIRB 2PTLA 4IN3A 2MJ3A 2HCCA 1A3UA 1SNPA 2PZWA 4US8A 1EQTA 3GQBA 2PVGC 2KOLA 3CHBD 2Z4HA 3MJ5A 2VZKD 4NAMA 4RA8A 1O7LA 2KHSA 4A3KB 2M0AA 1ILPA 1H9SB 5A35A 2IGDA 3K5OA 3K7AB 2FJ2A 5FR3A 1XCTL 3Q8BA 2HDMA 1U4MA 1BR9A 2RDFA 4IZ8A 4L63B 4C3HG 1HPCA 3L3OC 1MHHE 2A69C 2BOSA 1TY0A 2KJXA 3P7JA 4KGSA 2FE8A 2AUKA 2GA4B 1EZ8A 4HR7B 5BYSA 3SFEB 2SNSA 2F0EA 1EU3A 3BK1A 2NYZD 2KMMA 2HQEA 1D5ZC 2RQXA 1EL0A 3TZUA 1E2ZA 1E2VA 5HG2A 1PFNA 3TDQA 2K04A 4FF4A 1X3PA 3PUYA 1KNEA 1QOBA 1SF0A 3QOJA 2W3RA 5IT9E 5M9OA 4AQ7A 4RKLA 5IODA 4DK0A 3P4RB 1BDOA 5C4JB 2RBMA 4KY6A 2QIEB 1QCBD 2JZPA 1WTPA 2F0HA 3RMHA 1PTOC 4ZKCB 3IKJA 1TYGB 4MACA 4A93B 2WAQB 5G5GA 1UGJA 2E6XA 4C3JG 3SDZA 3AE4B 4OO1I 3C8YA 5GXGB 3TZDA 3KLSA 1WTOA 2MJEA 3S2HB 1M8AA 1SYEA 1PTOB 4B08A 3IT4B 4BBSB 1DONA 4KY7A 2Q8RE 5DM73 1TS5A 1STYA 4EE2A 5HI1A 2EDGA 4JE3B 2NN6H 4XDCA 4L8JA 1ENAA 3IAM1 1EYDA 1O7ZA 1LABA 4KN4C 1OXXK 4YSYB 1DOXA 1B9NA 2ID0A 1X32A 1DM0B 4FXDA 2B2VC 2VXWA 1DOKA 2IGGA 1OQQA 3P20A 3NQIA 2MHVA 3CQZB 3TP8A 2QDBA 4KV6A 3KBGA 2JA7B 3ABVB 5C0XI 2MPMA 1Y69U 2JA6B 2FHTA 4K6LA 1PTOD 2XNAC 4KJNA 3W1SA 1VMPA 2F0FA 2BT6A 2L9HA 3HUIA 3NTIA 2E2IB 1JCKB 2JE6I 4HMIA 1F2MA 2TSSA 1EEFD 1TS3A 2NVQB 2DN8A 5EBCA 5C3JB 3QG1A 1B9MA 3SHLA 1DCZA 2WB1B 3CRKC 1K52A 1V1PA 3W9CB 3NBHA 4LAAA 1WD0A 3NHHA 2D5DA 5C5LA 2XVSA 3NS1A 1Y1VB 1AN8A 2JYOA 1ACCA 1N60A 1AWDA 3D4RA 4ZRQA 3ETRA 2B2WA 3BVMA 3I73A 1HQRD 4A6QA 3LXFA 5C5MA 1EQVA 3AN1A 2JYTA 1KDCA 5BN5A 3AEAB 1PRTC 1K83B 1QILA 4U673 3SR1A 5JEAJ 1PZID 1GUSA 2WDVB 4CBVA 2DBYA 1SE4A 5HURA 2WXRA 4DK1A 2LKVA 1B53A 2KVMA 1QNKA 2EKIA 1PRTB 4V0BA 5G3LD 1EWYC 3ITPA 1SJED 2BE5C 1EWHA 3A7AB 5FLXL 1DOIA 4BA1I 1V43A 2G9DA 4Q5VA 2DWQA 2GRIA 4HSPA 1A2TA 2I38A 3JAME 3BWUD 5CMDA 4R9WA 1LTGD 5ISRA 2N0SB 3TP7A 3KWVA 3C2PA 4GLSC 1MBYA 1TS2A 2L55A 4K5VA 4CJ1B 2K28A 2L1AA 1VR9A 3AE5B 1EY9A 5FO9B 1B9RA 1UWXA 2WXIA 2YEPF 1C4QA 2KCCA 2INNE 1PRTD 5KIXA 1FMAD 4HKQA 1N62A 1BCPB 3ZGZA 5AFWA 2V3PA 2PO4A 3URYA 3QIAA 2KN4A 1RKNA 1TWAB 2EYPA 1E0ZA 1FO4A 3NTKA 2KQ3A 2M9VA 1YN4A 1SBBB 3MXUA 2R3ZA 3HOYB 3NTHA 2BE5D 3T3NA 1XLNA 4A3FB 3GTGB 1PTOH 1XCQL 2EYOA 4PMBA 3D31A 1FNUA 3TP5A 3IAS1 2WKCA 3A8KE 1IBXA 1CI3M 1HFNA 1AEXA 1R4PB 1J8IA 3AEEB 2EJFC 1I4RA 4K5WA 4KHVA 5JAVA 1G8ZD 4NKLA 1BCPD 3TBIB 3NK9A 5I6WA 1YNNC 3PZ7A 4AS1A 1X3QA 4A3DB 1RWSA 1NR4A 2F0LA 3I90A 4I7ZC 2F0PA 4HEDA 1RTNA 1QQRA 2K22A 2A5HA 1IBXB 1WD1A 1AP0A 3AECB 2V4IB 1WRIA 4C56C 4JPSA 1LTID 2HDLA 2RVLA 3FILB 4GDKB 1TVXA 5BN4A 1SNQA 1GHJA 3SK4A 3Q8CA 3TUOA 2LFNA 4LK0M 2K0PA 4D2KA 1VF5C 2KQ4X 4WRDA 2QMTA 1KRHA 4IDIA 4YSXB 3OMGA 3A56A 3S17B 1HUNA 4UAIA 4ZK9B 4RNAA 2LFIA 1VZ8A 2QSDA 1QB5D 4MHEA 1F9RA 2ZXPA 1FNWA 1SFOB 5COYA 3I72A 2WNMA 5BYRA 4K5XA 3DHQA 1BOSA 1YNND 3V3XA 1QE6A 5IT9L 2L1BA 2BW2A 4H0LC 2WDQB 4KD4A 2AWOA 3Q6SA 1SYGA 3BG3A 3SFDB 1UEAB 4KKUA 5E4WC 3MTSA 1E2WA 4WFN3 2JA5B 1U4PA 4K2LA 2M00A 2J52A 1EZ6A 2PLPA 3FPPA 3J7AF 1ML0D 2LGIA 4IUUA 2WU2B 5JPNC 4A3BB 1C79A 3HVZA 1I4PA 2F0GA 2SDFA 2X6LA 2L83A 2PIAA 3V96A 1F2LA 4IFDH 2ACZB 1T3QA 4NDXA 5AUKA 1PMRA 1YJJA 1DGJA 3AE9B 5KNBA 4HEA1 2MEKA 1DOMA 4QIWB 3BVZA 2JWUA 4M0WA 1TS4A 4XYOA 2K7VA 1SYCA 3OSOA 1GOZA 3P42A 3E56A 2BS3B 2KEDA 1P7FA 1K53A 1V1OA 4B9WA 4J6HA 3AEDB 1S5ED 1SYBA 1PDXA 2EOTA 2E2JB 4P2CB 4DGZA 1OFFA 4IUVA 1BUIC 1HUMA 3EQLC 4ULLA 4RGNA 3VR4A 4XDDA 4KN7C 1CA5A 4TSSA 1PTOF 1JB3A 2WV6D 5EE3A 1C48A 1CQFA 1K8MA 4RKBA 3T51B 3GTKB 3MEHA 2D5GA 5CBEE 1RYJA 2R7ZB 4ZHOA 3BZDB 1SE3A 1XLQA 4BA2I 4KGRA 3T56B 1LTBD 2JA8B 2EY6A 1IGDA 1VMCA 1OXTA 3L7ZC 4CHTB 1W6JA 4L2YA 3DWPA 1ZXTA 2N88A 3PO3B 4IKGA 3M7NA 2KECA 4Q2JA 3MHBA 1JWAD 3AMUA 1FXAA 1FCCC 2M2LA 4K2KA 1EM7A 2OXPA 5JPMC 2ICEC 3KK7A <