1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE A
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
1STEA 4NZLB 1PRTB 5FK9C 3DWAA 1LT6D 3EFXD 3R2IA 3OWEB 1F77A 1B1ZA 1PTOD 1UNSA 1LTSD 4C56C 2AQ2B 2CHBD 1SE4A 1D5ZC 1V1OA 3MC0B 1JCKB 3W2DA 1LTRD 1PTOF 1CHPD 1I4HA 2O2LD 2NTTA 5TSSA 1D5MC 3SEBA 1G8ZD 1LT3D 1HTLD 1CHQD 2J4XA 1RDPD 1YN3A 1BCPD 1CQVA 1LO5D 2G9HD 1QILA 4L6TB 1I4RA 1XTCD 1LLRD 1RCVD 3V05A 1ET9A 3BVGA 1GOZA 3R8BA 1EFID 5ELDA 1PZKD 1PZID 2AQ1B 1LT5D 1JWUD 4Z9CB 1S5CD 1FGBD 2XRSD 3MFGA 3R2TA 1DYQA 4RCOA 3KLSX 1TS3A 1YN5A 2IJ0A 4RFBA 1RF2D 1SEBD 1FD7D 3BZDB 1SE3A 4UDUC 1PRTC 1KTKA 4TSSA 1JWMD 4DXFA 1PZJD 1CT1D 1SE2A 4BWGB 1BCPC 1TS5A 1TY0A 1EU3A 1S5BD 1V1PB 3DWQA 4K6LA 1EU4A 2XN9C 1S5FD 1TY2A 5D3IB 1LTGD 1UUPA 1B44D 4RGTA 5D3DA 3URYA 1KLUD 1PTOB 3BYYB 4ZYSA 1BXTA 1XXGA 2WV6D 1FNUA 4RHRA 1LTAD 1BCPB 1PRTD 3BYTB 2QILA 2XNAC 1D5XC 1CK1A 4DXGA 1AW7A 2TSSA 1TS2A 4RHSA 4O1NA 1PRTF 3TSSA 5I4DA 1SJHD 1PTOH 4OHJA 1D6EC 1I4XA 1L0XB 1ET6A 1MD2D 2QEJC 1PYWD 2NTSA 1RD9D 2ICIA 1DJRD 3DWPA 4RGMA 1FNVA 1HQRD 1SXTA 2AQ3B 3EA6A 5ELCA 1EWCA 2SEBD 1LTBD 1EEID 1BCPF 5ELEA 2R61A 1ESFA 2Z8LA 1KLGD 3BVZA 1S5ED 2IPKD 2RDGA 2XRQD 4RGOS 3GP7A 1SBBB 1HXYD 1JR0D 1SJED 2RDHA 3CHBD 1EEFD 1ENFA 1FNWA 1YN4A 1PTOC 4RGNA 1I4GA 5ELBA 1I4QA 1LTID 1S5DD 1L0YB 1LT4D 1M4VA 1AN8A 1HA5A 3O13A 1JQYD 1V1PA 4RH6A 1JWSD 1TS4A 1T5XD 3BVMA 5FKAC 5ELFA 1LTTD 1I4PA 4L63B
chains in the Genus database with same CATH superfamily
4GKKL 3J81L 4A3LH 2KN5A 1UBIA 1PH1A 1H9RA 1IKMA 4RNAA 4PZ6A 4GN3B 3M4OB 3J80E 3QIAA 1UNSA 4X65L 2L1AA 5LMNL 1SE4A 4ZRPA 1E0ZA 4A3CG 1O7YA 2IO2B 3IL8A 3W2DA 2FMMA 1FXTB 1WX8A 2ZNVB 4AS1A 3SDZA 1P8LA 3P4QB 1VMCA 3KDFB 3HP3A 1CSQA 3NUCA 2NZOA 3DEOA 4QF4A 1WR6E 3Q3OC 3ZVVA 4DNTB 5FOBB 2XBBC 2VH1A 2K5QA 2WDQB 3ZQ4A 3RN9C 1QILA 4L6TB 1QF6A 1N60A 2ZM6Q 3UE0A 5JVG3 4W9GA 3SDLC 3I7FA 5JJKA 4A3KG 1AZPA 1WE6A 3A8IE 2I1KA 2F0SA 5IGEA 1JWAD 2LGXA 1X6OA 4B3TQ 4LNQA 2PW7A 2BA0A 4DK0A 4C3IG 5IN7A 4LFAQ 1FD7D 2D62A 3NXWA 4A90A 5IE8A 4OO1G 2CCZA 3QIJA 4W9DA 1ZUD2 3C8YA 4OZCA 2L3ZA 4HJ7A 2DZKA 3UDGA 2UU9L 3DM3A 3KYDD 4YY3L 3I63C 4FADA 3DWQA 2D0OA 5AJ3L 2PKOA 1V86A 3DBHI 3R7RA 1TT2A 1Y69U 4HXDA 2B2VC 1WX7A 1A15A 3PQIA 3BYYB 1UWMA 3F2UA 4LW1A 4HAEA 2Z0SA 1F2RI 1GJXA 1FIQA 3S2AA 4IUUA 3RN5A 3PF4A 2WXMA 3RZDB 5C5LA 2HDLA 1B50A 4DHZE 2L11A 3ZTCA 3H6MA 1X3PA 3FPPA 4DXGA 3AEBB 2KYWA 2GB1A 1HE8A 3EIVA 5FLMG 1ACCA 4GXBA 4FF2A 4IQZA 3KW5B 1C4CA 1OEYA 3A7LA 1Y1VB 1SYCA 3AE5B 1CFMA 1Z7TA 3EGRA 1ZDXA 3I57A 2NVUI 4PS7A 2KTRA 4ICUA 2BQQA 3IAS1 5CORA 4KSLC 2JA7G 1FNVA 3UDIA 2ALYB 1KC8C 1OTRB 4A3MH 1GG3A 3FEWX 4LF5Q 4A93H 4LLGM 1KDCA 3AE6B 1EFWA 2AMCB 5M3FB 4BKSA 1WYWB 1YNJC 3GP7A 1N32Q 3AU5A 2A6ED 1TWFB 3KF8B 1R4QB 2L83A 1UBQA 2W55A 3VR6A 1EF5A 1L0YB 1WWTA 4FYDA 4QUFA 4JOIC 2L1BA 1WMHB 1PFBA 2AUKA 5ISRA 2AEHA 2LFIA 1SLJA 4DR2L 3GTGH 3VRAB 2N88A 2K28A 4LMQD 5ELFA 2KANA 4W9JA 4ANUA 4B0EA 4H0LC 4Q0FA 2WU5B 4UP8A 3OJ3A 2OEOA 1BO0A 2K32A 2XSCA 5J1ZA 3DQVA 2J0JA 3APFA 5JH5C 3W5OA 1A0IA 1VQPA 1SYGA 3C19A 2A5UA 4CDFC 2NVQB 2EZVA 3IFWB 3E9IA 1YHQA 1E8XA 1X3FA 3PSIA 4C56C 2B2TA 4JI3Q 3OMGA 5EAYA 1XTDA 3NS1A 1P1AA 4P73A 1OXUA 1Z2MA 1WVLA 2HTHA 2NN6G 5E3FA 5J39A 4OX9L 3CPWA 3B2GA 2LHEA 3AEFB 1D7QA 4FNFA 3F8TA 4FF3A 4G57A 1CKNB 3GTJH 4REZA 2EMSA 2W3RA 1RFKA 1UZXB 4OVZA 1ET9A 2ZTCA 2Z6KC 3W9CB 1Y1VG 4LFBQ 2KHJA 2EIFA 4KHPQ 5JAVA 1E5WA 3DBLI 1L6UA 5CHFA 3R2TA 1M90C 1I50B 3CSTA 1YHBA 3V60A 4C2MH 3AFQA 2MHJA 2N49A 2YEPF 5BYSA 3DXJC 1Q3LA 1Z47A 1JWMD 4A3CH 1SDFA 2YLMA 5M3FG 3PRMB 3FC4A 2MP2B 1K8AC 3L3OC 2B76B 3ZNID 3MC8A 2E76C 3NTHA 1CA5A 1NYQA 2RGFA 4HPLB 4XTCS 2CKZB 1SNDA 2K5DA 5K5PA 4BBSB 2G1EA 1MGSA 5IYCH 2JRIB 1EU4A 2PZWA 2A69C 4A4IA 1R4MB 3S1NB 2ZPYA 3L17A 4OIKA 3DBSA 1C4PA 1B4OA 4R8NA 4RGTA 3R7QA 2JJQA 2KVZA 4RM8A 4X3TA 1MHWC 1EYGA 2BWFA 5CV7A 3SFEB 1FCLA 4HMJA 4L8JA 2ZVNA 4WWPA 3ZLZA 1HTOA 2F0PA 4N58A 2QILA 4EZJA 1NBWA 2F0LA 4KKTA 1F0ZA 3TQYA 1VQDA 1VQ4A 1H8CA 1VDVA 4LJOB 5M5YH 3CCRA 4WJQA 2NVXB 2N78A 1K53A 1V5OA 3U52E 1N34L 4MN3A 3HOZH 1M8AA 1F2MA 4IUPA 2AWNA 2KJHB 1W6KA 4JI0Q 4IPHA 1TXYA 1ZDVA 1JC7A 3H0GB 4X62Q 3MHZA 4E3CA 2SDFA 4OONA 4AQYQ 1JB3A 4JW0A 3MXUA 1ASZA 1ZXIA 4IW0A 2X6GA 2LVPA 3RZOB 1EOVA 1ZYRD 3NOBA 4X66Q 2LVOA 2JA8G 3TP8A 1ZKOA 1A70A 2CJNA 5LXHA 2RDHA 4GOCA 3CQZB 2ZT9C 1HNXL 4KJNA 4BY7B 2BS3B 2DYBA 5CV8A 3HOXG 1S3SG 3BZCA 1SYEA 4FXKC 2JP1A 4DK1A 3DHGC 2VW9A 3AE8B 4P2CB 4DUZQ 1JWSD 2E74C 3D32A 2LGYA 1II3A 4B3MQ 5FKAC 2ZW0A 3ONAB 1LTTD 3CRKC 2KDMA 1W2BA 4JI1L 4C3IH 4P6VF 5JPMC 5EPJA 2KDFB 4N9PA 5HGQA 3E9HA 5KIXA 3LJ3A 3M62B 1VR9A 3Q2AC 4XDCA 1LT6D 4IWQA 3EFXD 5E4XA 3T53B 1F2RC 2BE5C 3K5OA 4CDDC 3DVNU 4YWGG 2NBUA 1J7CA 4N59A 2B29A 1LTSD 1O80A 1NUCA 3RPFC 4JCVE 5C44H 3ML9A 2J53A 4IM3A 2R7ZB 4OWTB 2KKCA 3CIRB 5JHAA 2NBWB 1X3EA 1CM9A 1TQOA 1DOLA 3C3LA 4JV5L 4FVMA 3I4MH 3BU2A 3K81C 3ERQA 3L10B 1N33L 3ERSX 1CI3M 4IOAA 3M4YA 2UXCL 5G5HA 2D3CA 1CKOA 4FDBA 5H8YE 2F0HA 3N6RA 3IFDA 2EY2A 3GDEA 5GQOA 3K5LA 2RSNA 4IFDH 4DUYL 1JOQA 1L2NA 4H13C 3DLLA 2PQEA 1YN3A 5C4HA 1LO5D 1OXSC 2LSSA 3Q6BA 5JEAG 2JZZA 1WTOA 2UWQA 2O6VD 2CU3A 3A54A 1V43A 1WH3A 1J5EQ 1OGWA 1GAQB 1AYFA 1VQBA 3ZXRA 5ELDA 4A3GH 3OIQA 2UUCQ 2K52A 3FPUB 3TN2A 2NB0A 1LYLA 1IL2A 4A3BG 5EKKA 2EY5A 1YJJA 3P4PB 1U5KA 3KLSX 4XZ4A 1YN5A 2MRPA 2JWUA 2L76A 4WFN3 3RNGC 1EY8A 4BZAA 2ZEQA 1H9MA 2B39A 5EKLA 1P7FA 3E5SA 3RR5A 1Q81C 2KD0A 1IW7C 1E3PA 3K58A 1E2WA 2F03A 4BWGB 2VQEL 1C76A 3VR2A 3EJIA 3LX0A 4AWJA 4DWFA 2R2OA 2WINB 2RF4A 4R4TA 1MFWA 4K6DA 3CC2A 4ZKCB 1EO6A 4EQNA 1Q8IA 2R7FA 4YWLA 1B9NA 3TDQA 1NNXA 2PMVA 1SYDA 5M5XH 4HJ9A 1UF0A 2FFKB 2EY1A 2KEDA 2MO0A 3NTKA 5IWAQ 2OWOA 2L0FA 2O5JC 2B3GA 3HZXA 3UDFA 2JA6B 3DWMA 4P16A 5DCNA 3AE1B 2V0GA 3QWNA 3CCVA 3QO2A 2FCMA 3PUVA 4A3PA 1QOGA 2JA6H 1XLOA 1FPYA 3PCOB 3KWLA 2EYFA 3WDNA 2F0NA 3W5VB 4CBVA 2DY8A 1MD2D 1GUTA 3DVNV 4ZLTF 4DR1L 1CZGA 3MXPA 3MAQA 1DJRD 3DWPA 2B3AA 4DDID 4TV3A 3DHHC 2EYPA 3KBXA 3NEMA 2FXQA 3SK6A 2DN8A 2R61A 1K0RA 2VQFL 1TWGH 2Y0SB 4JX1C 4HR7B 3ZNHB 1VQ7A 4DV2Q 4RGOS 4DV0L 5T1GA 2EOTA 2K03A 2ZTEA 1LACA 1MPEA 4GDLB 1IGCA 2K14A 4J1MA 4X64L 3KJPA 2L05A 2L55A 2BDOA 3KOJA 4H7BA 1PDQA 3N32A 1ZGUB 5GAEC 1WIAA 1IYUA 1LT4D 3LB8C 4KTAA 4LNIA 2J42A 4NXNL 1HA5A 1KQSA 2PIAA 2R7ZG 4FXGC 2DNFA 4JLCA 4H02A 1TZ1A 3HKZE 3HRZC 3R3MA 2MCNB 4K5WA 2HHHQ 3GTJB 4OZAA 2UUAQ 2JVCA 4B95A 2PW5A 3DHQA 4NZLB 1WXSA 1Y8PB 4I7ZC 2SNMA 3CSFA 4JBKA 1G6PA 4DDGD 4A93G 3ZGZA 2EJFC 1WGRA 2N1VA 1IXRA 2VS1A 2IWHA 3X3NA 1WTVA 4IOIE 1T0RC 1PYBA 1QNUA 3SGIA 1HZBA 3TS0A 3NPPA 4GN1A 4EE2A 4F7ZA 4S3SA 2NBFA 2V1YA 3BS1A 2F3WA 4MZ9A 3A74A 1HFGA 1CHPD 5DLQE 2KLGA 3BK2A 2JA9A 2WYQA 3WAOA 2K6AA 2JQOA 1EZ8A 3I4NB 4P71A 1WGDA 3ULPA 1I3QH 2B63B 1SR3A 1XD3B 4IJLA 4XQJA 1BVSA 2WGSA 2MFIA 1WYDA 3H0GG 1RCVD 1HJPA 2QF7A 4HJGE 3WAPA 5CR3A 3VAWA 4ZAIA 3KWVA 2OF1A 2AQ1B 4KKIA 3I4LA 1J19A 4RAUC 1UH6A 5FLXE 4ZRIA 1WRDB 3VQIA 5GAGC 4GLVB 3P20A 4RFBA 1YEZA 1NI2A 4PV1C 4TRDA 2JE6I 2ZXOA 3VVWB 1MSHA 3MEHA 4S0RA 3RNBC 2VZKB 1EIGA 3Q24A 2R92B 2K33A 4LK0M 2PI2A 4GOPC 2IY1B 3NG0A 2KHSA 4HPMB 4B08A 1PGXA 2REXA 4MH8A 2DZMA 4L5TA 3PGEA 2E6XA 1X55A 4HCEA 3PUYA 1AARA 2ICEC 2D2QA 2JN4A 4JPSA 1VQ6A 5M3FH 1VJKA 4EUTA 3LWEA 5JEAH 5C1ZA 4LNKA 3NELA 1WD1A 4NMZA 5M3MG 4LJPB 1FD6A 1EIFA 3L0OA 4IUNA 3J7A5 4JYAL 4FJVB 3GTKB 3JW0X 2Z59B 1IBMQ 2O6VB 4EGVA 1GVPA 3P4SB 1H9SA 4NY0A 1XNQL 1L4DB 3ICEA 2BW2A 3HOYB 4MM3A 2PZUA 3K59A 1C0AA 4P1CC 1PGBA 1VQOA 1KXLA 4KGRA 2MLBA 3J9CA 2R92H 4APVA 2I38A 4DV1Q 2EE1A 2DENB 2J7QB 2B2UA 3SFDB 4HKQA 4B0MA 4R8IA 2IBIB 4C1NK 1WM2A 3ML8A 3QA8A 1XNRL 1DCZA 2F0QA 3JSVB 1NYRA 2KZRA 1VQHA 5AUKA 4KKSA 4IKGA 1C1YB 1BF4A 1BCPF 1UE6A 5LMUQ 1TKGA 4X62L 1ESFA 3AE4B 2LXKA 4DHJD 4PG3A 2F1MA 2JZPA 3STBD 1YX6B 1SBBB 4YTMB 1I50H 1TR5A 2J0TD 3J7ZC 1FCCC 3I5JC 2K1BA 4P1BC 2Z4HA 2DGYA 2PPHA 4B3SL 3IKJA 1LABA 1XLQA 3CPFA 2Z9HA 4JWSC 1HH2P 4DAMA 1V9PA 3O13A 4AJWA 1TS4A 4DF7A 4PYZA 4WJ3M 3KDFA 4F88A 5C0XI 3OHXC 1H9JA 4R4IA 2VUMG 1YJIA 4II2B 2EJGC 2E2IH 1YNND 1Q8KA 1WTHA 4RWSC 2D10A 5E6NA 1A2TA 1YNNC 3MTSA 1HZAA 3K8AA 4C00A 1F77A 1B1ZA 3S15B 3BINA 1P0RA 4IWOA 2L8JA 4LF8Q 2KJXA 3GTPB 3DMUA 4NXML 2PVGC 3M63B 4US9A 2NVTB 1TT5B 4JI5L 2LXCA 4F1SA 2K25A 3I55A 2Q8IB 1K3RA 4C1NI 4GMVA 4MELA 2PPBC 5D14A 2LASA 2A74C 2W82A 3EFUA 1I6VC 3AFPA 4XYQA 3WOFA 2AL3A 3GZNB 1KL9A 2MPMA 3N20C 1G8ZD 4AYBB 4C3HB 4QQBX 3ND8A 1JORA 5D94A 2LJIA 1RLFA 1KDBA 1VLBA 2NPTB 5J17A 4K0KL 3WOEA 4WIPA 2BB5A 3AE9B 4KLKA 1NE3A 4BS9A 4DNIA 5IIFA 2BYFA 4ANXA 3K57A 1MI0A 2JA6G 2A6HC 1K83H 5KNBA 2BA1A 3H15A 5HHDG 1PZID 2DNCA 4GKJQ 3VR3A 4EFOA 1F9PA 2MQHA 2A6HD 2XRSD 2Y0SG 4RCOA 3L2PA 1PH6A 5CX3A 5EE1A 5L95C 2Y5PA 2CW0C 3ALBA 1F2LA 3M3YB 4DK5A 1XMOQ 2NZ1D 1JRUA 1WY8A 1QOHA 2Q2UA 1XWEA 2UUCL 3NVWA 2CFMA 4FP5D 4XQNA 2WIIB 2W3SA 4GNXB 2FJ2A 4LUVA 1Q82C 4A55A 1ONLA 4B6WA 1U4MA 1S5BD 3IVFA 2OOBB 1KRHA 2INPE 1QZGA 5I2XA 3ZKJC 3DBHB 4MT5A 2VQEQ 5IA7A 2NVYH 3NHHA 5EQ0A 3J81i 3NSWA 3LDZE 3MJWA 5D6JB 1XQQA 2FE8A 1ENCA 3MFYA 5KHQA 4HEDA 3EVQA 1N5XA 4L23A 1JJCB 4DK6C 1O7ZA 5EPLA 1LTAD 5C4XG 3UI2A 3JAMc 3UGBB 3CQZH 3NY5A 2ZJQA 3GTKH 2PMZE 3OOCA 4GB9A 1GJZA 2J52A 4E71A 2N3SA 2KCNA 2WFWA 3MVVA 1TWCB 2RCNA 3QR8A 3NTIA 1L7YA 1PTOH 1C8CA 4BBRG 1ZPSA 3PMFA 2L32A 5C4XH 4GN4B 4O42A 4QCLA 1WGYA 4A20A 4UP9A 3CCEA 1EY4A 3L16A 2UXDQ 4RGMA 3GO5A 5CBEE 2F3VA 1VCBA 4BAXA 3D4RA 3EUB2 2QSDA 4A3DH 1DM0B 2QCPX 4QJFA 2F0FA 5EKIA 4ZQ3A 3TZDA 3CWIA 2LD9A 3KUDB 1IYJB 3T1HQ 1J9OA 4XWTA 3EECA 4IO9A 4YTNB 1HNWL 4IPCA 1GUGA 2HUGA 3ZJUA 3ABVB 2IO3B 1NAPA 4IURA 2D9UA 4GN5A 3L4PA 3T1YQ 2LEKA 3T56B 1C77A 3ZRFA 4J6IA 2QJLA 5ELBA 4JQWC 3QCAA 1HZ9A 3ZYYX 3HOXB 2BBCA 4LF9Q 3L0WB 1RTNA 3I72A 1KRSA 2F0JA 2B63H 4UPAA 4K1RB 3VH4B 3BZKA 5DPSA 4YSZB 4EOYA 3DWAA 4I6NB 2E2HB 3OAWA 3OW7A 2MHVA 1BUIC 2CR5A 2GVAA 1MVKA 2UUAL 3H6NA 3RNAC 4CHKA 5J2RA 1PTOD 3JAME 4GKKQ 2AQ2B 2ON8A 2K6QA 3C46A 5H92C 4FXCA 2NVTH 3A9JB 2PNRC 2ACZB 5G5GA 5IP7G 2KCCA 2KX3A 1B7YB 2P5ZX 4X3SA 1I4HA 3ULJA 3BIID 2JXXA 1MJDA 2NTTA 2XK5B 2F0OA 4ILWA 1L1OB 5F2DA 3H7PA 1BT0A 4KV2A 3GD7A 2K6DB 1OO9B 1IP9A 1U9RA 1YOVB 5GXGB 1UEBA 4TKNA 1T3QA 2I5LX 1CQVA 1F52A 2AWTA 2C9WB 4P7IA 1XTCD 4PK1A 4JVZA 2HIVA 3NZSA 4OWWB 1TIID 1RWSA 3R8BA 2JXMB 2WXKA 4KKJA 4DR5L 5CHVC 1JWUD 1KLVA 2IGDA 2KFKA 1HTQA 2F0VA 3AV8A 2I1JA 1Y14B 4A76A 4RKLA 1Q0WB 1IW7D 3TMEA 1BQQT 1DXMA 2Z6BA 5C3XA 1E24A 1SE3A 1SAPA 2A73B 1KTKA 3DWGC 4B3TL 5LL6S 1WJNA 4ITKA 2IO0B 1TJEA 1TS5A 2E8GA 3N3KB 3NP8A 1L4ZB 4EQPA 1B53A 3RMHA 4AUQC 2QW7A 3NE5B 4OIJA 1S5FD 2ASBA 1VMPA 4R4OA 1WE7A 2X38A 2WB1G 2WS3B 5JJIA 2M17A 2K05A 3N30A 1EQVA 3QK0A 2C9OA 2WAQE 4PT5A 4DXAB 3U2SC 3H0GH 4ARCA 1GB4A 1SF0A 1VZ8A 3L08A 1Y1VH 3VUXA 2IZVB 3VDZA 1CUKA 3VR5A 2CVRA 5M9OA 1AH9A 2MBHA 2DJFC 4CDCC 5FO8B 3PLUA 1TWAH 4YSXB 3I90A 2XGTA 2K5NA 4LFCQ 1UGJA 1YIWA 2WB1E 2WX1A 4AOFA 4YXDB 2WAQG 3FKIH 4CGYB 4OHJA 1HR0W 1VQFA 2ASQA 4NNJB 3TMPB 4KGTA 3MXNB 5JVH3 2BWES 3RCZA 1DOXA 1QWYA 1KAAA 2YYZA 5KRUA 2MH7A 1U4RA 3FILB 2VY3A 1HZ5A 4W9LA 3HOVH 5H1SE 1L6VA 5G3LF 2SEBD 4NAMA 1PFMA 5AFWA 1YNJD 1UEAB 2V4IB 4ZK9B 1ZEQX 3UE1A 1N61A 3OG5A 2IL8A 3VHTC 2SOBA 4NKLA 1IBKL 2N0SB 1WGGA 2EJMA 1VF5C 1J5EL 3AI5A 1JR0D 4M1UB 4G7HC 4Y52H 1G91A 4NQLB 2KWDA 1SE8A 5BR8L 3S24A 1YN4A 3T51B 2BS2B 4A3IB 2C7MB 5BN5A 3E0EA 1WR1A 2D07B 2ENBA 4NP5A 2KDEB 1QNKA 2LWPA 2NPTA 4IM0A 1MIUA 1MG8A 3NVVA 2BCOA 2WB1B 1WFYA 2DZIA 3M7NA 1AE3A 3ONSA 5D2MB 2I5HA 3M4OH 1PMRA 1ICFB 4BOSC 5JJLA 1IPGA 4HWIB 2FUG1 2LXAA 4DNRB 3R2IA 4B3RL 4HJ8A 5FR3A 1WJUA 2WP8J 4XGAB 1PH4A 2KC1A 4OVUA 3KUCB 1SYFA 2NN6I 2CHZA 2KWVB 1WJ6A 1C78A 1WD0A 2Z6KA 1CQFA 1SROA 3PIO3 4LF8L 1L0WA 2CWPA 5C4JH 4BY7G 2FCSA 4NXMQ 3AECB 3GS2A 4Q2JA 5TSSA 1WSPA 1D5MC 2LI5A 2RR9A 3MTNB 3B9JA 4LAAA 1FR3A 4NPSA 2G9HD 2K04A 4M02A 3BDLA 1UELA 2EXDA 3VYTA 1FM0D 3TRZA 2CW0D 1EFID 1B3AA 3VR8B 1LT5D 3HOWB 3C0RB 4DR7Q 2GBKA 3T4AC 5GROA 4FULA 1NR2A 4TUUA 1WI5A 4I65A 2KC2A 2I2YA 1S72A 4XYOA 4NPNA 3GV3A 4FF4A 5EJWA 1S4ZA 3BZDB 1K8MA 4DGZA 1HR0Q 4KHPL 1E7VA 1OEYJ 4TSSA 4K81A 3T13A 3OSOA 1NY4A 3SR1A 1E1OA 4A3BB 3PO2G 4MGIE 2KOLA 4DV6L 3DEPA 2KTRB 4OW0A 3C1EA 4BY7H 3KVFB 4P75A 3C2PA 1HTPA 4K6LA 4WQMA 2UU9Q 1TY2A 4LDTD 3GZNI 4N9F4 3PV1A 5AJ3Q 4OVVA 2DYOA 5D3DA 4ANVA 3BDOA 2KX0A 1F1HA 3HM6X 1PH9A 4ULLA 1FNUA 5IYBH 4ICVA 4GIVA 4A3IH 1BCPB 2XEWA 4IN3A 3PT2B 5AUIA 4YT0B 1KDAA 1YIJA 1VQNA 1VRAB 1YJNA 1X3QA 5NUCA 5LNK1 5EE0A 4JI8L 4JI2L 4EEWA 4O1NA 2O5IC 2NMQA 3I4NH 2B2WA 1NR4A 2QEJC 1HHVA 2PYKA 4HLEA 4WAFA 5IOIA 2LGIA 1X3GA 3T8MA 2NS5A 3B0AA 3PHXB 1ASYA 2RDBC 3RZOH 4IDIA 4HVBA 1B9RA 4DK3C 1HQMC 1STNA 4N9TA 2YVCA 1TWHH 2A4ZA 2VUMB 3CF6E 5DPWA 2PEAA 2Z8LA 3B08A 2AWOA 2HD3A 2X69A 2JRHA 2GN5A 3U4VA 1IZ6A 1EIHA 2QMTA 1N32L 3HRDD 3T1HL 4KY5A 3KLWA 4DU9A 4YHHL 2KQSA 1LTID 2C5CA 5M5YB 3WAMA 1CKNA 2K39A 3E6ZX 1V1PA 1F2ZA 3RZDH 1RHPA 2YTYA 3QJYA 4WJ4A 2PJHA 2MX2A 3OLMD 1Q5WB 4C3HG 4RMFA 1MHXA 2OQKA 3DOWA 2F52A 1I3QB 1PRTB 2BVCA 4KHVA 1N36L 2JXTA 3P2BA 4IZ8A 1CSPA 1I35A 4N8FA 1KF6B 2KEEA 1EY6A 1Y1WB 4DR6L 1X1MA 2CHWA 2N9KA 4GDKB 3TIXA 3KYCD 4ZYNA 3BJUA 1HFNA 5MPOA 1E2VA 3TEWA 1JCKB 1E1TA 4WH4A 2OQ0A 5KHOA 2RBMA 5KYIA 5IT9L 3GTOB 4JI6Q 3A4SC 2C7HA 5C4ZA 4A93B 4A3GB 1C79A 2QEXA 3W1YA 3I4OA 3ZW3A 1FO4A 5K36H 2O6VA 4GNXC 4A3MB 3AEGB 3NVZA 1HTLD 1CMXB 3GTGB 2JA5B 4DR1Q 1E0BA 4AYBG 2VH2A 2B2YA 3M3JA 1VF7A 3KLRA 3PRZA 1GOZA 3HOZB 1GHJA 1G2SA 4IPGA 1YNTE 3RMKC 4CKEA 4DV3L 2BKRB 2CS4A 1WRIA 1D8LA 1O78A 4CKBA 4TVAB 1KIXA 3N1XC 3I56A 2AHOB 3OPOA 4XYCA 3DM1A 3PV0A 4AYBE 1HCZA 2F0GA 3X3MA 3CF5A 3HG9A 2I46A 1EYAA 4X64Q 3TP5A 2O2VB 3NBHB 2IT1A 2WNMA 3WIMA 1UAPA 2JQRB 4GSWA 2KJ6A 2V4DA 3LWUA 1KNAA 2ZCBA 5I2YA 2FIDA 3A5UA 1FMAD 4XWWA 2MGSA 4R1JA 4FXDA 3A8JE 3UIOB 4J3OD 1WCMB 4EVOA 4JIOU 3LNNA 1N6ZA 3TJPA 3JSVA 4GS3A 2HDEA 2F0TA 2M00A 4K7UA 1GB1A 1A2UA 2K4KA 4LUZA 4U68A 3U9SA 1VD2A 1V97A 2K8CA 3PLVA 4HEA1 5IOCA 2INNE 1E8ZA 3CC7A 1MJCA 2JEBI 1CK1A 2HT1A 2TSSA 1TTNA 1NENB 2HQLA 2MSED 5I4DA 2OJRA 5E1FA 1K28A 2WDTB 2JT4B 1L0XB 2JY6A 2TMPA 4YWKA 2NUCA 2B63G 3P1HA 1VQMA 1V9JA 1YJ1A 4NAWB 3J80i 1I5FA 2C5LC 4JBWA 4UAIA 1EUJA 3HKZG 3W1BA 3CXCA 2OT2A 1VQEA 4QL5A 3TEHB 2AQ3B 1GHKA 1R4PB 4HROA 3CCMA 5E7NA 2NR2A 3MWYW 3K6OA 5ELEA 2BF8B 3F1ZA 2LGSA 2MJDA 4PYUA 1RIPA 4KMUC 1HRJA 3SK8A 2HIXA 4BY1G 4LDTB 2HE7A 2A5HA 1FL0A 4OEMB 1SJED 4R4QA 2KA7A 4X66L 2Z1CA 1D4BA 1E22A 5I6YA 3CCUA 1WMHA 3Q8DA 2WXIA 4X57B 2W9NA 3ZJVA 1IBKQ 2G3QB 4YCUA 2J7ZA 4M01A 1X56A 3QOJA 2PE9A 3HOZG 5GADC 1SFOH 1Y8RC 3AE2B 4MJSA 3K5NA 2Q2TA 4HMIA 1U4PA 2LRUA 3TUOA 5G55A 4NQKE 3SD5A 2V1CC 4C3JG 2F0WA 2KACA 4HDQA 4L63B 3M4PA 2JA7H 2CU1A 2GMIC 4CHTB 3GTOH 3RLFA 3OW2A 1G6JA 4XE0A 2KXJA 3QQ8B 2HHHL 4RA8A 1C4AA 1OQRA 1YNXA 4RMAA 2GOWA 4WURA 5C3EH 1JOKA 2JA5H 4BOZB 5DAUA 1VQIA 1WM3A 3HOVB 4ODGA 1XNQQ 2BH2A 4I7AA 3D4DA 4S17A 2I07B 5G2NA 4K2KA 3PF5A 1N33Q 3KUPA 2WXGA 4C7YA 1K8GA 5C44G 4GNXA 1B2TA 3MJ5A 3SK5A 3B2FA 3W1SA 1I6HH 2VB3X 1IL8A 1I4RA 1BBXC 2KAJA 2WU2B 5DM63 2F3IA 3J81c 4L5SA 4FHKA 3K7AH 3PGZA 3TS2A 2DHZA 2A69D 2B2TC 1YITA 3E56A 4LF5L 2FHTA 3J7AV 2B2UC 5DEHA 4FO2A 2HD5B 4PZ7A 4GLAC 4QGUA 3ULLA 5IGBA 1F9QA 4HK2A 2XTIA 4A6QA 1EYCA 2E5LL 4POGA 1PH5A 2AYOB 3H9DA 3IT6B 2F4VQ 2EKEC 1RJTA 2EMTA 1AP0A 3ZRCA 4JC0A 2ZXRA 1WXVA 1EU3A 4G3XB 4GLSC 4JOIA 3D31A 3OTOL 2BDNA 1WJJA 1WGKA 2W54A 4DV6Q 1LV9A 3KLSA 4RKBA 3LGJA 1ZXHA 3KF6B 1E8WA 3RT3B 1TWHB 4LCDE 4ZHOA 1SB3C 3CCQA 2Q5WD 2Y5CA 4ME3A 1CA6A 1J8IA 1JT8A 4EX5A 2ATWA 5E6OA 3PZ7A 1ILQA 4FJYA 1KM7A 3VR4A 3T9LA 1BNZA 3X0WA 3ZJTA 2XWBB 3WANA 1ZYRC 4TKOB 1SYBA 5BMHA 4OL7A 3A0JA 4ZUIA 1N34Q 2LVQA 3RLOA 4BVUC 1PRTF 2RHSB 1NCVA 3TSSA 2M19A 1QZEA 3PSEB 3Q8EA 1VQGA 4BKGA 5LHY1 2YU9H 2XK5A 3S1QH 4II3B 4JI2Q 4JI8Q 1RD9D 2ICIA 4ZHPA 2JPHA 4HJKA 2KWCA 4DR3L 1GM5A 1AWDA 4FN2A 2WKCA 4MNOA 4A3LG 4IC7B 3H3VH 4ZRQA 4XDDA 4BBSH 2KDBA 2GRIA 5TR5A 1J7AA 5FLXL 1QVCA 1YVCA 4CJ0B 3BK1A 2RDGA 2L52A 2N9PC 3EBEA 3RLNA 2N9LA 3DBLB 2JA7B 3CD6A 3S9WA 3N52A 2M56B 4KJOA 2WWZA 4DAYB 3SE0A 4LF6L 4LF4Q 4RGNA 4G7OC 1I4GA 3HOWG 1PH7A 2M2LA 3S14H 5BN3A 1IKLA 1S5DD 2E75C 4J6HA 1M4VA 2MUYA 3I4NG 5EPKA 3S17H 5CHWA 2L00B 4BBRB 1JQYD 3TEZA 2E2JH 3GTMH 1WTRA 3PUZA 3BVMA 5BYQA 2Q8RE 2EPBA 3S1MH 1I7HA 2WXHA 2DAFA 3VUYA 5LMNW 1H9SB 3QJZA 3AULA 4BBRH 3ZIMA 3HOWH 1LTLA 4DA2A 3APDA 1NSNS 2XVSA 1E90A 3AXCA 3T3NA 4TQ1A 1V8CA 2HJ8A 2Q8TA 2JYOA 4NAWA 3ZNZB 3FP9A 1VQKA 1O7LA 1D5ZC 4CJ1B 1RODA 2ZJPA 2PQAA 4G11A 3IFTA 3I8ZA 2BGFA 2UXCQ 3DPDA 2E3TA 1TWGB 2O2LD 2VZAA 4G7ZC 4CKCA 4JI5Q 1Q86C 3TREA 4JE3B 2X6LA 2RMMA 3H3VC 4G4KA 3VYSA 4JI7L 2R7ZH 1RDPD 2MEKA 2KCMA 3A5ZB 3OIPA 5A2QE 4B9WA 2FIFA 3B1LX 4EZKA 1DOYA 3AE3B 4A3KB 2ZM6L 1GUNA 3U9OA 3MP9A 2RSOA 2VUMH 5C2TB 1EL0A 4C3IB 2WDVB 4US8A 3PS6A 2ZJDA 3C1FA 4KN7C 1E6EB 2NVYB 3KF8A 1SMXA 1XYIA 2OXPA 4ALPA 1ML0D 3NS8A 3QX1A 2K5WA 1XPUA 3S15H 2HTME 3IRBA 3PO2B 4OELB 4MGKE 3T1YL 1PVOA 1XT9B 4IUTA 1BCPC 1A3VA 1DOIA 1FXIA 4CJ2C 4W9EA 1AZQA 5BR8Q 4IALA 2A8VA 1A62A 4TQ0A 2M9VA 1MBYA 5D3IB 2G4SA 1NDDA 2JA8H 2DAJA 3ETRA 2O4XA 1PFNA 3HOUH 3K80C 1GC6A 1PTOB 2R93H 2WHIA 3ZTDA 4JI1Q 1VQ5A 2E2IB 1Y8NB 4F87A 2WV6D 5IGDA 4PMCA 2FINB 1WZ0A 2KNBA 3JVZX 3HOUB 1XCTL 1ISNA 3RUZA 2BYTA 4QY7A 4XT3B 3AMUA 2WXNA 1OXTA 1L1OA 4DKAC 4IM2A 4B3RQ 2EDGA 4IUQA 1AW7A 4RHSA 2UXBL 3UINB 2N9XA 4Q5VA 1T6BX 1V81A 4KGSA 2RKSA 4E74A 3TL5A 3HUIA 4NW2A 5LXIB 2KN4A 2YTXA 4DPGA 3J80L 1PFSA 1GKHA 3EC8A 1G51A 2KENA 4UHVA 3F2CA 3HK0A 3N1YC 1QUQA 1PH8A 4GDLA 1LQBA 4KY6A 1SNPA 1VZ6A 4DAVA 1EEID 4A3EH 4LFBL 1STBA 1PUTA 2K8BA 2M0AA 4KZ0A 3VR9B 2N55A 2YEPB 3H1UA 4POFA 3KK7A 2WXRA 3E9SA 1GC7A 4RM9A 2KHWB 4KVGB 4L5RC 1WJ4A 2RHQB 2KQ7A 4DR5Q 5AZGA 5JEAJ 1F9JA 1WXAA 3NUHB 3GE3C 3HOVG 2RDFA 1GO3E 5J3BA 3OJ4B 1FVIA 4ZOHC 3CHBD 2ZVOA 1FJGL 4KIKA 5K36G 3CMEA 2KLCA 3Q69A 2GVBA 5HY6A 1XMQL 1AN8A 2RA4A 3EQLC 4W9CA 1WTWA 2LJ5A 3VRBB 3PUXA 2IX3A 4A3KH 2MJ3A 3AEAB 4QAYA 4PMBA 3S1MB 2JF5A 1K50A 2K50A 3AU7A 1I4PA 1C4QA 2SNSA 1V49A 1YQ4B 2KMAA 2O2VA 1YD8U 3HEJA 2YTVA 3U4ZA 2WXOA 4HIOA 3A9KA 2K01A 4HCSA 2ZJRA 4M8AA 2FMCA 3L7ZC 3SU8X 1VS0A 2GA4B 3R66C 3G7LA 3PO2H 3DDCB 4EQ5A 2AL6A 2MW5A 3EN2A 3RN2A 4FLHA 1LM0A 3QWZB 4IUVA 1Y1WH 3UDXA 1WFQA 2PZTA 3ZUNA 5JOBA 1I94Q 2F0KA 1W6JA 1A5RA 4JYAQ 2IYDB 5A35A 4BY1H 3RZFA 1STYA 4JI0L 1BOSA 1TBEA 1FFVA 1YJWA 3A7AB 1UWVA 1STAA 3HFZB 4DV4L 2VRRB 3TBLD 1Y1WG 1U4LA 4WJWA 3BG3A 1PLFA 1WTXA 4YCVA 1JB7A 4MJSB 1LLRD 3HVZA 3FHWA 3PUWA 3S1QB 1D3ZA 1B70B 5FO7B 1IBLL 3KBGA 3F2DA 3HOYG 3I73A 2JX5A 5DPRA 4IG7B 4A9AA 1WOCA 1E10A 4ASWC 3LYYA 2VQFQ 2EY6A 2RSUA 1FGBD 3UIPB 3MFGA 4LF7L 2D3BA 2J0KA 1PV4A 2R93B 4LFAL 3PRPB 1FEHA 4JG2A 3V62A 5CGKA 3FRPB 1EWIA 1R4NB 1G291 1L1OC 5EGTA 1PZJD 4MGYE 3ECIA 1SE2A 1OXVA 3T16A 4KHZA 2GBJA 3AH7A 1H9KA 5M5WH 2WXQA 4JPBW 1V1PB 3U7ZA 2XN9C 2F4VL 3MXGA 1K51A 2D3GA 3L9AX 3N1ZC 4OGQC 3O65B 2ZPNA 5M5WB 3FKYA 1JQ4A 4ZRZA 5JHBA 2LRWA 1YZ6A 4AP4C 1V5TA 4K5VA 1XXGA 2AKWB 3Q3NC 5HI1A 1ICWA 3HS0C 5M5XB 1PRTD 2HQEA 3BYTB 4GOPA 1JRPA 5HURA 5EBDA 2HCCA 3WWVA 5GMVA 2XIWA 5KNDA 2BB6A 1TS2A 2EELA 2PW9A 5C6AA 1V8QA 3TEYA 1I4XA 3K7AB 5DPTA 3H7SA 3QG1A 4L1BA 2NTSA 3ZJYC 2N9EB 2B2WC 2FCNA 1L0VB 1SXTA 2GBNA 3BWUD 3K0XA 4AQYL 5LMUL 1SNCA 2QHOA 3H94A 2Z0DB 2CWAA 5IP9H 4OWXB 1MI2A 1P98A 4K2LA 3DCGA 4J15A 1Z5SB 5I9OA 3S16B 1JOOA 4IPDA 4DR7L 2CQAA 4QUCA 1HNWQ 1FRDA 4X3KA 1CKMA 5CV5A 3I4MG 5CV9A 1MG4A 3Q6SA 2NWGA 3HIZA 1X65A 1ZOYB 3V61A 2F0MA 5L83A 2ZNVC 3I3CA 2DUDA 4B9XA 4IOCA 1PH2A 2XWJB 2INDC 5C44B 2F0UA 4DHJB 2JZ3B 1Q7YC 4B3ML 1JMCA 5CC4A 1ZXTA 4X65Q 1C3TA 3AEVA 4Y7NB 5LMNQ 5C0XG 2QCZA 3ZDMC 3VA7A 5IP9G 5D7GA 3GTLB 3NHEB 1ZW7A 4BKTA 3TP7A 4YL8A 2UUBL 4QB4A 1GUOA 3D8GA 4YTPB 1T0QC 1SMYC 1QKZA 1KJTA 4DV5L 1V1OA 3A9JA 3STBC 4DR4Q 4C4VA 2ES2A 1IGDA 3IXSA 1WF9A 1LTRD 4JWUC 1K9MC 1PTOF 2I5MX 4HJAA 3A8KE 4JK1C 2PNHA 2IY0B 3MZ5A 3AEDB 3VXWA 4C80A 3FVQA 5DNFA 3A1QB 3H7PB 1YQ3B 3SEBA 2K8HA 3Q3MC 4DV1L 3OWFA 1P9DU 4HIKA 1PDXA 4XDXA 5L37A 1CHQD 4DFAA 1GD7A 2H1EA 3RULA 5C3JB 3V05A 4BBNC 3BVGA 4MSQB 2BH8A 3VTUA 2MJEA 2JUOA 3PIPA 4KIKB 4LWCA 5FO9B 4FA6A 1FGUA 1EY0A 3S17B 1Z9FA 4A3FG 1DYQA 2C7NB 2K5HA 1VDZA 1X32A 4KDLB 5I9PA 1IBXB 2IJ0A 2N1WA 1S1QB 4DUZL 1SEBD 4TQUS 4URKA 2WKDA 5IT9c 3QARA 3RFZB 3NWTA 5D65A 1PHJA 2WXFA 2JSVX 3KF6A 4YHHQ 2WDRB 3KYHC 3V96A 3JAML 1PFDA 1TIFA 2C60A 1TY0A 4BA2I 4LNFA 4KI0A 3QAQA 3M9BA 3DBRB 1QG7A 2WP9B 3PHWB 3MHSD 4NDXA 2L15A 1LTGD 1UUPA 5CV6A 2B2VA 1K73C 3MHBA 3S2HH 3URYA 1L5PA 3RUIB 2D2CC 2ZW1A 1BXTA 2H5XA 1A8VA 1L2FA 1LUZA 3HOYH 2LFNA 2JYTA 5AZHA 3IG3A 4JV5Q 3G71A 3S2HB 2L5TA 1STHA 4E6IA 1UE5A 5IAAC 1PA6A 1JJGA 1D5XC 1PXUA 1ESRA 3H8HA 2RPVA 3CKIB 1H4RA 3W5UB 3BDCA 1EQTA 4K8JA 2QGQA 4PZ8A 2G4DB 2CKHB 3J80c 1ET6A 2B8GA 1Y56A 3K9OB 3G6EA 5EDSA 3G48A 2MP1A 1G2TA 1PQSA 3I4MB 1WCMH 2G9DA 3H91A 1E8YA 2LHDA 1EUVB 3PREA 1HUNA 4MDKE 3AB9A 4FBJB 1TKEA 2KT7A 2NVQH 5C4JB 1GNUA 5C4XB 3NBIA 2V9HA 3SVMA 1KLGD 2LMCB 1HNZQ 1J0GA 3BVZA 2MWSB 2OTJA 3FDTA 2WXPA 3QC8B 3VTVA 1JICA 2IX0A 1HNXQ 4QMGA 1VQ8A 2DX5B 5IY0A 4FJZA 2PLPA 1STGA 1CJEA 1M1KC 1PTOC 4PMWA 1XMOL 3VDYA 3S2DB 1JROA 2JU6X 3FAHA 4GGQA 2A6EC 3U50C 3N9YC 4BY1B 4BXXG 1GUWA 3PTFC 3ZDTA 4RG1A 1UE7A 1N62A 1RYJA 5GAHC 1RTOA 2BT6A 2Z0EB 3PO3B 1WYGA 3S2DH 1HZCA 3NZ3A 1W3SA 4J8QA 3AU4A 1RAXA 4AQ7A 3SK4A 4KDIC 2A68C 1KHIA 1XPOA 1KFYB 1YHAA 1STEA 2KMMA 2M0XA 3SR6A 5C5MA 5FK9C 4JI3L 3IAM1 4MACA 4JBMA 2PQAB 1G6ZA 3Q8BA 2INCC 4X3UA 3HVDA 2L9HA 2R6GA 1IBML 4HIMA 2QC8A 1D1IA 4HCPB 2CHBD 1R4NI 1K3BC 3CRLC 3KJOA 3MC0B 4K14A 1N36Q 2K5PA 1XLNA 2KQ4X 1BKBA 4M8MA 3J81E 1SRUA 1QLBB 1IHZA 1SFOB 2RPQA 5IYDH 1C7YA 4GDKA 4AH6A 1RM6C 1WXMA 2M4NA 4BXXH 3ZNGC 5C0XJ 4IUMB 3U30A 1XJVA 1I94L 3K5MA 3IT4B 1Q1BA 1EWYC 2ZZPB 4DV2L 2R93G 2F0EA 3HOXH 3PVLA 2EKIA 4A3JB 1AEXA 3V3XA 3R93A 4W9HA 4DV4Q 2KQ3A 3RNCC 1F9RA 3D0FA 1SNQA 1SIJA 1VQLA 2WAQB 4JGHB 1T5EA 2L12A 4WRDA 4DV7Q 4KV6A 1QVGA 1JALA 1TGZB 4R4CA 4HPPA 4JI4Q 4DV3Q 2UU7A 4WWMA 4UDUC 2EYMA 3Q3JA 2R92G 2WLBA 3HKZB 4M0WA 2EXZA 2IY5B 4LF7Q 4MH0E 2FAZA 2V4LA 3DHIC 1HUMA 2D5DA 1C48A 2E2DC 3NRZA 5C3EG 4MHEA 4B9KA 4LF6Q 2LY7A 2A19A 3NWSA 4F7XA 4A3EB 1DD2A 1CZPA 4W9IA 1C9OA 4C2MB 4C4VB 3NBHA 3ENEA 4AJYB 4ZYSA 3QHTA 2QA4A 1WX9A 1XLPA 1VQ9A 2M1MA 4GOPB 3CCLA 2F0DA 4DN4M 2KDIA 3AYHB 3PPAA 2ZTDA 1NI3A 1N8RC 1DZ1A 3UF8A 1EY9A 1T0SC 4LK1C 2V3SA 4M00A 3VTWA 4WQOB 2L7RA 1QZHA 4A3BH 1J6QA 1YBYA 1B8AA 2FCQA 4MEMA 1VQJA 1EF1A 3M95A 4HDOA 4ID6A 3D6WA 3RNEC 3S1RH 4GLXA 1K0SA 2L0TA 5ELCA 2GLSA 3EA6A 1KD1C 4NJCA 5AZFA 5LLIA 1CZWA 2DWQA 2MJ8A 5BMGA 1SNOA 3A56A 3PO3G 3M7GA 2BPSA 3GTLH 1NVID 3K0YA 4CQNA 2MBEA 3KQ4A 3NK9A 3PIP3 2IGGA 3IBEA 4F8MA 1SN8A 1SSOA 4RCNA 2EYOA 3L54A 1ENAA 1B3QA 5CYUA 1D1KA 4LNNA 1EEFD 1FNWA 2BS4B 3P42A 4YY3Q 4WJNA 3E3XA 5M3MB 4I6LB 3RI7C 3Q8AA 4A3IG 3I70A 3P7JA 3VFKA 2A1AA 1KABA 5FR6A 2F4IA 1HR0L 4RF0A 4RH6A 2K1FA 4ZRJA 5E4WC 5BYRA 2DY7A 1JE4A 3NENA 3SXHA 2CHXA 4XC2A 3HKSA 3VYRA 2R3ZA 3H09A 3Q22A 5KGUA 1P3QU 1V1QA 3KFUA 4A3FB 5JJZA 4G50A 1K8RB 3TZUA 3CMMB 4A3OA 1X9NA 2N4FA 1XEEA 1BUVT 2PVOD 1PYSB 1ILPA 5IYCG 3AE7B 1AFPA 1V80A 1EWHA 2KO3A 4YIJA 2C35B 4MTNA 5CMDA 1WXQA 3DBRI 2D0PA 4IFDI 1JE5A 4UY8C 4DR4L 3U7DA 2NYZD 1DONA 3RZWC 4KY7A 5T8IA 1J7BA 2J4XA 2PMZB 4MTKA 1BCPD 2KCTA 5KYLA 1FFUA 4HSVA 1QUQB 1VZ7A 4GZYC 2QDLA 3CMAA 1IYFA 2EYHA 2K7VA 1OFFA 4C7ZA 2D11A 1EY7A 3DVGX 5HFYA 3V6CB 4C3JB 4YSYB 1VQAA 4HTHA 3CCSA 2D5GA 3EFCA 1RF2D 2SAKA 2HDMA 4DR2Q 5IGCA 1LFDA 1RFAA 4M8NA 2Y5BB 4WJPA 4HJ5A 3BY4B 4USAA 2CH4A 4ABNA 5KNCA 4OO1I 3U58A 1BR9A 5FJ8G 3JAMi 1LXDA 1HPCA 2OHFA 4AIMA 4DAPA 4KD3A 4A3EG 4ME5A 3VA5A 3PO3H 4BBNF 1WGHA 2KVMA 1TWCH 2PCFB 2GI9A 2NCNA 1N5WA 5E6JA 1XCQL 1KNEA 4RHRA 3QB3A 1EZ6A 4A3DB 5EE3A 1IUEA 4ZDVA 3WCQA 1EM7A 3KUZA 3A9KB 2CQOA 3HGBA 2IDYA 2RCFA 4XX5A 1OXXK 4MM3B 3TP6A 1XPRA 2Q2HA 2MNAA 3J81j 2RD0A 4ZRKA 3E0JA 4K0KQ 2H89B 3K9PB 3UQAA 3S1NH 4DUYQ 1E7UA 1PYWD 3W1GA 2ONQA 1D2BA 2KWUB 3Q14C 2OEDA 4JI6L 4JBJA 2IHFA 1B9MA 4HRSA 1T0YA 2F0IA 4L5QA 2KVRA 5CTRC 5IT9E 2LS01 2H88B 1LTBD 2VB2X 3FKIG 5C0XH 3AB5A 1Q90A 2BE5D 4HN7A 2BKFA 3Q8FA 4PS3A 1NJIC 4DBGA 2LMCA 2UYZB 3U8ZA 1S5ED 4R3DA 2HCIA 4A3JH 3I2ZA 5C23A 2WQYB 2EVBA 4HIDA 1NMFA 1IBLQ 1I6HB 3GTPH 3PO0A 4IFDG 5E6PA 5EE9A 3CW2C 3RNFC 1MJEA 1JMLA 1NEKB 4K3BA 3GQBA 1HNZL 2ID0A 3AM9A 2LXJA 3V6EB 3GTMB 2E2JB 3H3VI 1HA6A 3Q0AA 3ND9A 3JYUA 1E7ZA 3TEXA 4KN4C 3T3OA 2ZCCA 2GBRA 4IJHA 1NBFC 1R9TB 4DAYA 2V3PA 3NJTA 1ROEA 1SIFA 3MEFA 4P74A 1ZP0B 2K9XA 2LZ6A 3W3AA 5CBAE 4DQOC 4O2DA 5BMIA 1F9SA 3M4QA 2E2HH 4DR6Q 3UI3A 1H95A 3K7UC 4EQOA 4BBSG 5COYA 5I6WA 3MC9A 4LTUA 1YMHE 2IO1B 4TMAB 1DOKA 2MQJA 1EQRA 4FF1A 3IAYA 5LL6X 4V190 4NB3A 3U4EG 5A2QL 1C9FA 2WACA 1BBUA 2DBYA 4LUOA 2OTLA 3A55A 3I91A 1BDOA 5KEEA 4OO1H 1F2YA 2KK8A 3FILA 2B8FA 5IP4D 2UXDL 3J7YW 1Z6HA 4W9KA 2VXWA 3RNUA 4JL9A 4CYEA 2MBBB 4A3GG 1A3UA 1J8CA 2Q2IA 5IODA 1LT3D 2PO4A 1RL2A 2L0CA 1R9TH 3I9V1 5HKHA 2WX0A 1R7SA 2KUMA 3HOUG 2MA9B 2BTEA 2PI2E 5HG2A 4GU2A 3J7AF 1E2ZA 3CAMA 1DGSA 2JWZA 4WORA 3CP0A 2JSOA 2DJGC 1A3TA 4JI7Q 1PZKD 2IW3A 3APCA 4HKZE 4XQQA 5J18A 4DV0Q 1S5CD 1YI2A 4W9FA 1IYVA 2G5DA 1MHHE 3ER0A 1PH3A 1TU2B 1EYDA 1OQQA 1P7EA 2K0PA 3P1MA 2H4OA 4MSMB 1NMGA 1TS3A 3RD2A 1LGRA 5C3EB 2OJWA 3VH3B 4LF9L 3Q8CA 3G4SA 3HM3A 1PRTC 1BMLC 4BKSD 4M0WB 4DV7L 1FJGQ 4MGZE 4A3MG 1CT1D 3P63A 2WXJA 3WALA 4KD4A 4K7WA 1E9MA 1QVFA 3NVYA 1TWFH 4I6PA 1VQCA 1GXDC 3VYUA 3NQTA 2KECA 2MBOA 4KX6B 1BBWA 1B44D 3Q3FA 1QOAA 2K75A 1WZ3A 2M8SA 5HGTA 3ITPA 4G0NB 1QE6A 4ARIA 1M94A 1Q12A 2D3AA 3P75A 1SSNA 2AX5A 1FXAA 1E7PB 1UD7A 2LGDA 2WXLA 2NVXH 2XNAC 1N63A 2FNJB 4YWMA 1MSGA 4LNOA 4QIWB 2KBNA 2IGHA 3I3TB 1Q46A 4P72A 3OYYA 2UUBQ 1YJ9A 2NBVB 4BFRA 4LFCL 1FRRA 1SJHD 4F8CB 1Y8OB 1D6EC 4XXEA 2L4NA 1K83B 3AQQA 5EBCA 1SE9A 4A8XC 1X54A 4KSKC 4MIUA 2LKVA 3Q23A 2NZHA 2UXBQ 2KTFA 4WAAA 1I42A 3GE8C 3M3YH 4N8X1 4OXPA 4CO7A 5DM73 2QKIC 2DLBA 1VCIA 3GV6A 2B2YC 2R7DA 3FMCA 3MXNA 5IKCM 2J0MA 1S3OA 2N7JA 4PQXA 4B3SQ 4NJ6A 1KH0A 2MP2A 3D6CA 3CCJA 4Y7NH 2NN6H 4UP7A 4K7SA 3RYTA 3TCAA 4ANWA 4XIGS 2RQXA 5J22A 3MA2B 4N6EB 4PS8A 1JJ2A 2KHIA 3CC4A 1HZ6A 1WI0A 2LUEA 1NTGA 3VUWA 1SNMA 5BN4A 5CV4A 4ACFA 1WTPA 2MO1A 1I4QA 1TYGB 2CH4W 3OMCA 4H44C 2KOXA 1OTCA 3GOEA 4KK7A 1OQYA 2VL6A 5IWAL 3M85A 2E5LQ 2Y3AA 2A68D 2BYEA 1UGMA 1P16A 2QDFA 3A1QA 1KRTA 5FLMH 2KMCA 5BO4B 4V0BA 3HHMA 5ELNA 1LM8B 3LXFA 1O7IA 3OTOQ 1QB5D 3B6YA 1V6EA 3R3OA 3A33B 3OWEB 4CDEC 1QJOA 3TBIB 4K3CA 2FBWB 1QQRA 4A3DG 3KH0A 4FHJA 4OX9Q 4KKUA 4EZLA 1JW9D 2DZJA 2AUJD 1GUSA 3SHLA 1Q10A 2V3NA 2LUMA 4KZCA 1Q1EA 3W1SC 2DYMA 3NZUA 5FJ8H 2KJRA 2IX1A 4IWPA 2RVLA 1XNRQ 2VNUD 4ZUJA 4LJZC 2ZXPA 5G3LD 2VZKD 1UWXA 4YCWA 3S1RB 4GKJL 1QOFA 1CTMA 3D4WA 1TZOA 1V2YA 2K22A 3P4RB 2K5VA 2EYLA 4C3HH 3SHQA 1S40A 5JPNC 4A75A 5C3WA 3S14B 5IYBG 2N7EA 2BYVE 5M3MH 3FKIB 4Z9CB 1U0LA 2KFKB 3D3RA 1EIYB 3DVGY 3DUZA 1ZKHA 4NJ7A 1TVXA 2YV5A 1GPXA 1TWAB 3GTQB 4BA1I 3WA0A 1Q1OA 4NXNQ 3NQIA 1SMYD 3QOLA 1YQBA 3S16H 4DXFA 3EHVA 1EOTA 1TKYA 5IP7H 3AEEB 1A6XA 1K8OA 4QIWE 4A3FH 4L2YA 5IYDG 1XO3A 4HCNB 3AN1A 4LF4L 5FLXc 4A3JG 5T1IA 3EROA 4R9WA 1EQQA 3F2BA 2KFJA 1KOTA 2X8XX 1AE2A 1KLUD 2K3UA 3IHPC 2EYJA 4RF1A 5IGFA 2Y0SE 1A63A 1JWBD 4XT1B 1QOBA 1UE1A 5IO9A 4D2KA 3GTQH 1RKNA 2QDBA 1WCMG 1FYCA 4PNYA 4K8IA 1DOMA 4DV5Q 1DGJA 2QIEB 3A4RA 4U673 3UQBA 1ZE3D 2FUHB 1PGAA 2PE6B 2JK8A 2GBMA 3PIOA 1K52A 4DR3Q 4ZKBB 4OZBA 4WJOA 3G6JB 1YX5B 4WWOA 1XX8A 4K5XA 4C3JH 2JA8B 1HQRD 5ELOA 1EY5A 3X23A 1EWCA 4WWNA 4IFDJ 1SGHA 1R4MI 1T9HA 2Z4IA 1XF5L 3JC66 3PZDA 4ZCKA 2R2QA 1TKWB 2EQSA 2IPKD 2XRQD 5JXVA 1IBXA 1HXYD 2IHEA 3RD4A 1U4AA 3PZ8A 2CJOA 3ZO5B 4EKUA 2MBQA 4HSPA 2YU9B 1QT9A 2BOSA 2N7DA 1ENFA 3L13A 1GUAB 1HEZE 1QCBD 5AEKB 1WTQA 4H2AA 3AMZA 2HJ1A 3ZXVA 5JZEB 4JI4L 2PTLA 3GB1A 1XMQQ 1N9WA 3V2TA 4X6AH 1MKHA 1T5XD 2DNEA 5IGGA 2G45B 2N8NA 3CU7A 2I0QA 2JYEA 4DHZB 1KAWA 1RRBA 2JA5G 4O0AA 2OCEA 2JEAI
chains in the Genus database with same CATH topology
3J81L 1H9RA 1IKMA 4RNAA 3M4OB 3J80E 3QIAA 1UNSA 2L1AA 1SE4A 4ZRPA 1E0ZA 1O7YA 3IL8A 3W2DA 2FMMA 4AS1A 3SDZA 3P4QB 1VMCA 3HP3A 3NUCA 3DEOA 4QF4A 4DNTB 5FOBB 2WDQB 2K5QA 3ZQ4A 1QILA 4L6TB 1QF6A 1N60A 5JVG3 1AZPA 3A8IE 2F0SA 5IGEA 1JWAD 2PW7A 2BA0A 4DK0A 4C3IG 1FD7D 2D62A 3NXWA 4A90A 4OO1G 1ZUD2 3C8YA 4OZCA 3DWQA 2PKOA 1TT2A 1Y69U 2B2VC 1A15A 3BYYB 1UWMA 3F2UA 4HAEA 1F2RI 1GJXA 1FIQA 4IUUA 2WXMA 3RZDB 5C5LA 2HDLA 1B50A 2L11A 3H6MA 1X3PA 3FPPA 4DXGA 3AEBB 2GB1A 1ACCA 4FF2A 4IQZA 1C4CA 3A7LA 1Y1VB 1SYCA 3AE5B 1CFMA 1Z7TA 3EGRA 1ZDXA 3I57A 3IAS1 5CORA 1FNVA 3FEWX 4LLGM 1KDCA 3AE6B 5M3FB 1YNJC 3GP7A 2A6ED 1TWFB 1R4QB 2L83A 2W55A 3VR6A 1L0YB 1WWTA 4FYDA 4QUFA 2L1BA 1PFBA 2AUKA 5ISRA 2LFIA 3VRAB 2N88A 2K28A 4LMQD 5ELFA 4B0EA 4H0LC 4Q0FA 2WU5B 2OEOA 1BO0A 2K32A 2XSCA 5J1ZA 1SYGA 2NVQB 2EZVA 4C56C 2B2TA 3OMGA 3NS1A 1OXUA 1WVLA 2NN6G 5E3FA 5J39A 3B2GA 2LHEA 3AEFB 4FNFA 4FF3A 4G57A 4REZA 2W3RA 4OVZA 1RFKA 1ET9A 3W9CB 5JAVA 1L6UA 3R2TA 1I50B 2YEPF 5BYSA 3DXJC 1Q3LA 1Z47A 1JWMD 1SDFA 3FC4A 3L3OC 2B76B 2E76C 3NTHA 1CA5A 1NYQA 4XTCS 5K5PA 1SNDA 2K5DA 3TEYA 4BBSB 2G1EA 1MGSA 1EU4A 2PZWA 2A69C 3S1NB 4OIKA 1C4PA 1B4OA 4R8NA 4RGTA 4X3TA 5CV7A 3SFEB 1FCLA 4HMJA 4L8JA 2F0PA 4N58A 2QILA 2F0LA 4KKTA 1F0ZA 1VDVA 2NVXB 1K53A 3U52E 4MN3A 1M8AA 1F2MA 4IUPA 2AWNA 1W6KA 1ZDVA 1JC7A 3H0GB 3MHZA 2SDFA 1JB3A 3MXUA 1ZXIA 2X6GA 3RZOB 1ZYRD 3TP8A 1ZKOA 1A70A 2CJNA 2RDHA 3CQZB 2ZT9C 2BS3B 4KJNA 4BY7B 5CV8A 1SYEA 4FXKC 2JP1A 4DK1A 3AE8B 4P2CB 1JWSD 2E74C 1II3A 5FKAC 2ZW0A 3ONAB 1LTTD 3CRKC 2KDMA 4P6VF 5JPMC 5EPJA 4N9PA 5KIXA 1VR9A 4XDCA 1LT6D 3EFXD 5E4XA 3T53B 1F2RC 2BE5C 3K5OA 4YWGG 1J7CA 4N59A 1LTSD 1O80A 1NUCA 3RPFC 2J53A 2R7ZB 3CIRB 3C3LA 1CM9A 1DOLA 1TQOA 4FVMA 3ERQA 5G5HA 1CI3M 3M4YA 5H8YE 2F0HA 3N6RA 2EY2A 3IFDA 3K5LA 4IFDH 2RSNA 1JOQA 4H13C 2PQEA 1YN3A 5C4HA 1LO5D 1OXSC 5JEAG 1WTOA 2CU3A 3A54A 1V43A 1GAQB 1AYFA 5ELDA 3OIQA 3FPUB 3TN2A 2NB0A 1YJJA 3W5UB 5EKKA 2EY5A 3P4PB 3KLSX 1YN5A 2JWUA 4WFN3 1EY8A 1H9MA 2B39A 5EKLA 1P7FA 3E5SA 1IW7C 3K58A 1E2WA 2F03A 4BWGB 1C76A 3VR2A 3EJIA 3LX0A 2WINB 4K6DA 4ZKCB 4EQNA 1Q8IA 1B9NA 3TDQA 2PMVA 1SYDA 2FFKB 2EY1A 2KEDA 3NTKA 2O5JC 3HZXA 2JA6B 3DWMA 4P16A 3AE1B 2V0GA 3QWNA 3QO2A 3PUVA 1QOGA 1XLOA 3KWLA 2EYFA 3WDNA 2F0NA 3W5VB 4CBVA 2DY8A 1MD2D 1GUTA 4ZLTF 1CZGA 3MXPA 3MAQA 1DJRD 3DWPA 2EYPA 3KBXA 3SK6A 2DN8A 2R61A 4JX1C 2Y0SB 4HR7B 4RGOS 5T1GA 2EOTA 2K03A 1LACA 1MPEA 4GDLB 1IGCA 4J1MA 2L55A 2BDOA 4H7BA 1PDQA 1IYUA 1LT4D 3LB8C 4KTAA 2J42A 1HA5A 2PIAA 4FXGC 3HRZC 4K5WA 3GTJB 4OZAA 2PW5A 3DHQA 4NZLB 1Y8PB 4I7ZC 2SNMA 3ZGZA 2EJFC 2IWHA 3X3NA 1WTVA 4IOIE 1QNUA 3NPPA 4EE2A 4S3SA 2NBFA 3BS1A 2F3WA 1HFGA 1CHPD 3BK2A 2K6AA 1EZ8A 3I4NB 2B63B 4XQJA 1RCVD 2QF7A 4HJGE 5CR3A 4ZAIA 3KWVA 2OF1A 2AQ1B 4KKIA 3I4LA 4RAUC 5FLXE 3VQIA 3P20A 4RFBA 4PV1C 4TRDA 2JE6I 2ZXOA 1MSHA 3MEHA 2VZKB 1EIGA 3Q24A 2R92B 2K33A 4LK0M 2KHSA 4B08A 1PGXA 4MH8A 2E6XA 4HCEA 3PUYA 2ICEC 4JPSA 1VJKA 3LWEA 5JEAH 1WD1A 4NMZA 1FD6A 4IUNA 3GTKB 3P4SB 4EGVA 1H9SA 1L4DB 2BW2A 3HOYB 2PZUA 3K59A 1PGBA 4KGRA 3J9CA 2I38A 2EE1A 2B2UA 3SFDB 4HKQA 4R8IA 4C1NK 1DCZA 2F0QA 1NYRA 5AUKA 4KKSA 4IKGA 1BF4A 1BCPF 1TKGA 1ESFA 3AE4B 2F1MA 2JZPA 4YTMB 1SBBB 1TR5A 2J0TD 1FCCC 2K1BA 2Z4HA 3IKJA 1LABA 1XLQA 4JWSC 3O13A 1TS4A 4DF7A 4F88A 5C0XI 3OHXC 1H9JA 1YJIA 2EJGC 1YNND 4RWSC 1A2TA 1YNNC 3MTSA 1F77A 1B1ZA 3S15B 2KJXA 3GTPB 3DMUA 2PVGC 4US9A 2NVTB 2Q8IB 4C1NI 2PPBC 5D14A 2A74C 2W82A 1I6VC 4XYQA 3WOFA 2MPMA 1G8ZD 4AYBB 4C3HB 3ND8A 1JORA 2LJIA 1KDBA 1VLBA 4WIPA 3WOEA 2BB5A 3AE9B 4BS9A 5IIFA 3K57A 1MI0A 2A6HC 5KNBA 2BA1A 5HHDG 1PZID 2DNCA 3VR3A 1F9PA 2A6HD 2XRSD 4RCOA 5EE1A 2Y5PA 2CW0C 1F2LA 3M3YB 2NZ1D 1QOHA 1XWEA 3NVWA 4FP5D 4XQNA 2WIIB 2W3SA 2FJ2A 4A55A 1ONLA 1U4MA 1S5BD 1KRHA 2INPE 5I2XA 4MT5A 3NHHA 5EQ0A 3NSWA 2FE8A 1ENCA 3MFYA 4HEDA 3EVQA 1N5XA 4L23A 1O7ZA 5EPLA 1LTAD 3UI2A 3OOCA 2J52A 2KCNA 3MVVA 1TWCB 3NTIA 1ZPSA 1PTOH 1C8CA 2L32A 3PMFA 4O42A 4QCLA 1EY4A 4RGMA 3GO5A 5CBEE 2F3VA 3D4RA 3EUB2 2QSDA 1DM0B 2QCPX 2F0FA 5EKIA 4ZQ3A 3TZDA 3CWIA 1J9OA 4XWTA 4YTNB 1GUGA 2HUGA 3ZJUA 3ABVB 1NAPA 4IURA 2D9UA 3L4PA 2LEKA 3T56B 1C77A 2QJLA 5ELBA 3ZYYX 3HOXB 2BBCA 1RTNA 3I72A 2F0JA 4YSZB 3DWAA 2E2HB 3OW7A 2MHVA 1BUIC 1MVKA 1PTOD 3JAME 2AQ2B 2ON8A 3C46A 5H92C 4FXCA 2PNRC 2ACZB 5G5GA 2KCCA 4X3SA 1I4HA 3BIID 2NTTA 2F0OA 4ILWA 5F2DA 3GD7A 1OO9B 1U9RA 5GXGB 1T3QA 1CQVA 1XTCD 1TIID 1RWSA 3R8BA 2JXMB 2WXKA 4KKJA 1JWUD 2IGDA 2F0VA 3AV8A 4RKLA 1IW7D 3TMEA 1BQQT 1DXMA 5C3XA 3DWGC 1SE3A 4XWWA 1SAPA 2A73B 1KTKA 5LL6S 4ITKA 1TJEA 1TS5A 3NP8A 1L4ZB 4EQPA 1B53A 3RMHA 4OIJA 3NE5B 1S5FD 1VMPA 2X38A 2WS3B 2K05A 1EQVA 4PT5A 2C9OA 1GB4A 4ARCA 3U2SC 1SF0A 1VZ8A 3VR5A 2CVRA 5M9OA 5FO8B 4YSXB 3I90A 1UGJA 4YXDB 4CGYB 4OHJA 4KGTA 5JVH3 1DOXA 1QWYA 1KAAA 2YYZA 5KRUA 2MH7A 1U4RA 3FILB 1HZ5A 1L6VA 5G3LF 2SEBD 4NAMA 1PFMA 5AFWA 1YNJD 1UEAB 2V4IB 4ZK9B 1ZEQX 1N61A 2IL8A 2SOBA 4NKLA 2N0SB 2EJMA 1VF5C 1JR0D 4M1UB 4G7HC 1G91A 2KWDA 1YN4A 3T51B 2BS2B 4A3IB 5BN5A 2ENBA 4NP5A 1QNKA 3NVVA 2BCOA 2WB1B 3M7NA 1PMRA 2FUG1 4DNRB 3R2IA 5FR3A 2WP8J 1SYFA 2NN6I 1C78A 1WD0A 1CQFA 3PIO3 3GS2A 3AECB 4Q2JA 5TSSA 1WSPA 1D5MC 3B9JA 1FR3A 4LAAA 2G9HD 2K04A 3BDLA 3VYTA 1FM0D 2CW0D 1EFID 1B3AA 3VR8B 1LT5D 3HOWB 3T4AC 1NR2A 4I65A 2I2YA 4XYOA 3GV3A 4FF4A 5EJWA 1S4ZA 3BZDB 1K8MA 4DGZA 4TSSA 3T13A 3OSOA 3SR1A 4A3BB 2KOLA 4OW0A 3DEPA 3C1EA 3C2PA 1HTPA 4K6LA 4WQMA 1TY2A 2DYOA 5D3DA 3BDOA 4ULLA 1FNUA 1BCPB 4IN3A 5AUIA 4YT0B 1KDAA 1VRAB 5LNK1 1X3QA 5NUCA 5EE0A 4O1NA 2O5IC 2NMQA 2B2WA 1NR4A 2QEJC 1HHVA 2PYKA 4WAFA 2LGIA 4IDIA 1B9RA 1HQMC 1STNA 4N9TA 2VUMB 2Z8LA 2AWOA 2X69A 1EIHA 2QMTA 3HRDD 4KY5A 4DU9A 1LTID 2C5CA 5M5YB 3E6ZX 1V1PA 1F2ZA 1RHPA 3QJYA 4C3HG 1MHXA 1I3QB 1PRTB 4KHVA 2JXTA 4IZ8A 1KF6B 2KEEA 1EY6A 1Y1WB 4GDKB 2N9KA 5MPOA 1HFNA 1E2VA 3TEWA 1JCKB 4WH4A 2RBMA 5KYIA 3GTOB 5IT9L 5C4ZA 4A93B 4A3GB 1C79A 1FO4A 5K36H 4A3MB 3AEGB 3NVZA 1HTLD 3GTGB 2JA5B 1E0BA 2B2YA 1VF7A 3KLRA 1GOZA 3HOZB 1GHJA 1G2SA 1YNTE 4CKEA 1WRIA 1O78A 4CKBA 3OPOA 3DM1A 3PV0A 3X3MA 1HCZA 2F0GA 3HG9A 2I46A 1EYAA 3TP5A 2IT1A 2WNMA 1UAPA 2JQRB 2V4DA 3LWUA 1KNAA 5I2YA 1FMAD 2MGSA 4FXDA 3A8JE 4J3OD 1WCMB 4EVOA 3LNNA 2HDEA 2F0TA 2M00A 1GB1A 1A2UA 3U9SA 4U68A 1V97A 4HEA1 5IOCA 2INNE 2JEBI 1CK1A 2TSSA 1NENB 5I4DA 5E1FA 1L0XB 2TMPA 2NUCA 3P1HA 4NAWB 4JBWA 4UAIA 2OT2A 1GHKA 4HROA 2AQ3B 1R4PB 3MWYW 3K6OA 5ELEA 2MJDA 4KMUC 1HRJA 3SK8A 2A5HA 1SJED 1D4BA 2KA7A 2Z1CA 5I6YA 2WXIA 3ZJVA 2J7ZA 3QOJA 3AE2B 3K5NA 4HMIA 1U4PA 3TUOA 4C3JG 2F0WA 2KACA 4L63B 4CHTB 3RLFA 4XE0A 4RA8A 1C4AA 1OQRA 4WURA 1JOKA 5DAUA 3HOVB 4ODGA 3D4DA 2I07B 4K2KA 3KUPA 2WXGA 4C7YA 1B2TA 3MJ5A 3SK5A 3B2FA 3W1SA 2VB3X 1IL8A 1I4RA 1BBXC 2KAJA 2WU2B 5DM63 2A69D 2B2TC 3E56A 3J7AV 2FHTA 2B2UC 5DEHA 4FO2A 5IGBA 1F9QA 4A6QA 1EYCA 3IT6B 1RJTA 1AP0A 2ZXRA 1EU3A 4GLSC 3D31A 2BDNA 1WGKA 2W54A 1LV9A 3KLSA 4RKBA 1ZXHA 1TWHB 4ZHOA 1SB3C 2Q5WD 2Y5CA 1CA6A 1J8IA 3PZ7A 1ILQA 3VR4A 3ZJTA 1BNZA 2XWBB 1ZYRC 4TKOB 1SYBA 5BMHA 4OL7A 4ZUIA 1PRTF 3TSSA 1NCVA 2M19A 3Q8EA 5LHY1 4ZHPA 1RD9D 2ICIA 1AWDA 2WKCA 4ZRQA 4XDDA 2GRIA 1J7AA 5FLXL 3BK1A 4CJ0B 2RDGA 2L52A 2N9LA 2JA7B 3S9WA 3N52A 2M56B 4KJOA 3SE0A 4RGNA 4G7OC 1I4GA 2M2LA 5BN3A 1IKLA 1S5DD 2E75C 4J6HA 1M4VA 2MUYA 5EPKA 4BBRB 1JQYD 3TEZA 1WTRA 3PUZA 3BVMA 5BYQA 2Q8RE 2EPBA 1I7HA 2WXHA 1H9SB 4DA2A 1NSNS 2XVSA 3T3NA 4TQ1A 1V8CA 2Q8TA 2JYOA 1O7LA 1D5ZC 4CJ1B 1RODA 3IFTA 3I8ZA 2E3TA 1TWGB 2O2LD 4G7ZC 4CKCA 4JE3B 2X6LA 2RMMA 3H3VC 4G4KA 3VYSA 1RDPD 2MEKA 3OIPA 5A2QE 4B9WA 1DOYA 3AE3B 4A3KB 1GUNA 3U9OA 3MP9A 2RSOA 5C2TB 1EL0A 4C3IB 2WDVB 4US8A 3C1FA 4KN7C 1E6EB 2NVYB 3KF8A 1XYIA 2OXPA 1ML0D 2K5WA 2HTME 3PO2B 4IUTA 1BCPC 1A3VA 1DOIA 1FXIA 4CJ2C 1AZQA 4IALA 4TQ0A 2M9VA 1MBYA 5D3IB 3ETRA 2O4XA 1PFNA 1PTOB 2E2IB 1Y8NB 4F87A 2WV6D 5IGDA 4PMCA 2FINB 3HOUB 1XCTL 3RUZA 2BYTA 4XT3B 3AMUA 2WXNA 1OXTA 2EDGA 4IUQA 1AW7A 4RHSA 4Q5VA 1T6BX 4KGSA 2RKSA 3HUIA 4NW2A 2KN4A 3J80L 4KY6A 1SNPA 1VZ6A 4DAVA 1EEID 1PUTA 1STBA 3VR9B 2M0AA 2N55A 2YEPB 3KK7A 2WXRA 3E9SA 5JEAJ 3NUHB 2RDFA 4ZOHC 3CHBD 5K36G 3Q69A 1AN8A 2RA4A 3EQLC 1WTWA 3VRBB 3PUXA 2IX3A 2MJ3A 3AEAB 4PMBA 3S1MB 1K50A 3AU7A 1I4PA 1C4QA 2SNSA 1YQ4B 3HEJA 2WXOA 2K01A 4HCSA 3L7ZC 2FMCA 4M8AA 2GA4B 3G7LA 4IUVA 2PZTA 5JOBA 2F0KA 1W6JA 5A35A 1STYA 1BOSA 1FFVA 3A7AB 1STAA 1U4LA 4WJWA 3BG3A 1PLFA 1WTXA 1LLRD 3HVZA 3PUWA 3S1QB 5FO7B 3KBGA 2JX5A 3I73A 4A9AA 1E10A 3LYYA 2EY6A 1FGBD 3MFGA 2R93B 1FEHA 5CGKA 3FRPB 1G291 5EGTA 1PZJD 1SE2A 1OXVA 3T16A 4KHZA 3AH7A 1H9KA 2WXQA 1V1PB 3U7ZA 2XN9C 1K51A 3MXGA 3L9AX 4OGQC 5M5WB 1JQ4A 4ZRZA 4K5VA 1XXGA 5HI1A 1ICWA 3HS0C 5M5XB 1PRTD 2HQEA 3BYTB 1JRPA 5HURA 5EBDA 2HCCA 2XIWA 5KNDA 2BB6A 1TS2A 2EELA 2PW9A 5C6AA 1V8QA 1I4XA 3K7AB 3QG1A 4L1BA 2NTSA 2B2WC 1L0VB 1SXTA 3BWUD 1SNCA 3H94A 1MI2A 4K2LA 5I9OA 3S16B 1JOOA 1FRDA 2CQAA 4QUCA 4X3KA 5CV5A 5CV9A 3Q6SA 2NWGA 1ZOYB 2F0MA 3I3CA 4B9XA 2XWJB 5C44B 2F0UA 5CC4A 1ZXTA 4Y7NB 5C0XG 3VA7A 5D7GA 3GTLB 3TP7A 4YTPB 4QB4A 1GUOA 3D8GA 1SMYC 1QKZA 1V1OA 1IGDA 3IXSA 1LTRD 4JWUC 1PTOF 3AEDB 3A8KE 4JK1C 3MZ5A 4C80A 3FVQA 5DNFA 1YQ3B 3SEBA 3OWFA 1PDXA 4XDXA 1CHQD 4DFAA 2H1EA 5C3JB 3V05A 3BVGA 2MJEA 5FO9B 1EY0A 3S17B 1DYQA 1VDZA 1X32A 5I9PA 1IBXB 2IJ0A 1SEBD 4TQUS 3RFZB 2WKDA 3NWTA 5D65A 2WXFA 2JSVX 2WDRB 3V96A 3JAML 1PFDA 1TY0A 4BA2I 4KI0A 1QG7A 2WP9B 4NDXA 1LTGD 1UUPA 5CV6A 2B2VA 3MHBA 1L5PA 3URYA 2D2CC 2ZW1A 1BXTA 2LFNA 2JYTA 3S2HB 2L5TA 1STHA 4E6IA 1D5XC 1PXUA 1ESRA 3H8HA 2RPVA 3CKIB 3BDCA 1EQTA 4K8JA 1Y56A 1ET6A 2B8GA 1G2TA 2MP1A 3I4MB 2G9DA 3H91A 2LHDA 1HUNA 3AB9A 1TKEA 5C4JB 5C4XB 3NBIA 3SVMA 1KLGD 2LMCB 3BVZA 3FDTA 2WXPA 1JICA 2IX0A 4QMGA 2PLPA 1STGA 1CJEA 1PTOC 4PMWA 3S2DB 1JROA 2JU6X 3FAHA 2A6EC 3N9YC 4BY1B 1GUWA 1N62A 1RYJA 1RTOA 2BT6A 3PO3B 1WYGA 3NZ3A 4J8QA 4AQ7A 3SK4A 2A68C 2KMMA 1KFYB 3SR6A 1STEA 5C5MA 5FK9C 3IAM1 4MACA 1G6ZA 3Q8BA 4X3UA 3HVDA 2L9HA 2R6GA 1D1IA 2CHBD 3CRLC 2KQ4X 3MC0B 4K14A 2K5PA 1XLNA 3J81E 1QLBB 1IHZA 1SFOB 1RM6C 5C0XJ 3K5MA 3IT4B 1Q1BA 1EWYC 2F0EA 2EKIA 4A3JB 1AEXA 3V3XA 3R93A 2KQ3A 1F9RA 1SIJA 1SNQA 2WAQB 1T5EA 2L12A 4WRDA 4KV6A 1JALA 4WWMA 4UDUC 2EYMA 4M0WA 2WLBA 3HKZB 2EXZA 1HUMA 2D5DA 1C48A 2E2DC 3NRZA 4MHEA 2LY7A 3NWSA 4F7XA 4A3EB 1DD2A 1CZPA 4C2MB 3NBHA 4ZYSA 1XLPA 2F0DA 4DN4M 1NI3A 1DZ1A 1EY9A 4LK1C 4ID6A 3D6WA 5ELCA 3EA6A 4NJCA 1CZWA 2DWQA 2MJ8A 5BMGA 1SNOA 3A56A 3M7GA 1NVID 3K0YA 4CQNA 3KQ4A 3NK9A 3PIP3 2IGGA 4F8MA 1SSOA 4RCNA 2EYOA 1ENAA 5CYUA 4B0MA 1D1KA 1EEFD 1FNWA 2BS4B 3P42A 5M3MB 3Q8AA 3I70A 3P7JA 1KABA 2F4IA 4RF0A 4RH6A 5BYRA 5E4WC 2DY7A 1JE4A 3SXHA 3VYRA 2R3ZA 3H09A 3Q22A 5KGUA 4A3FB 5JJZA 3TZUA 1XEEA 1BUVT 2PVOD 1ILPA 3AE7B 1AFPA 1EWHA 4YIJA 5CMDA 1WXQA 4IFDI 2NYZD 1DONA 4KY7A 5T8IA 1J7BA 2J4XA 2PMZB 1BCPD 5KYLA 1FFUA 4HSVA 1VZ7A 4GZYC 2EYHA 2K7VA 1OFFA 4C7ZA 1EY7A 5HFYA 4C3JB 4YSYB 4HTHA 2D5GA 1RF2D 2SAKA 2HDMA 5IGCA 4USAA 4ABNA 5KNCA 4OO1I 1BR9A 1HPCA 2OHFA 4DAPA 4KD3A 4ME5A 3VA5A 2KVMA 2PCFB 2GI9A 1N5WA 5E6JA 1XCQL 1KNEA 4RHRA 3QB3A 1EZ6A 4A3DB 5EE3A 1IUEA 3WCQA 1EM7A 3HGBA 2IDYA 1OXXK 4MM3B 3TP6A 3E0JA 2H89B 1PYWD 2ONQA 1D2BA 2OEDA 1B9MA 4HRSA 2F0IA 5IT9E 2LS01 2H88B 1LTBD 2VB2X 5C0XH 3AB5A 1Q90A 2BE5D 4HN7A 3Q8FA 2LMCA 1S5ED 4R3DA 2HCIA 2WQYB 2EVBA 1I6HB 3PO0A 5EE9A 4IFDG 1NEKB 1JMLA 3GQBA 2ID0A 3AM9A 3GTMB 2E2JB 1HA6A 3Q0AA 3ND9A 3TEXA 4KN4C 3T3OA 1R9TB 4DAYA 2V3PA 1ROEA 1ZP0B 2K9XA 4DQOC 3W3AA 5CBAE 5BMIA 1F9SA 3UI3A 4EQOA 4LTUA 5COYA 5I6WA 1YMHE 4TMAB 1DOKA 4FF1A 3IAYA 5LL6X 4V190 3U4EG 5A2QL 1C9FA 2WACA 2DBYA 4OO1H 3A55A 3I91A 1BDOA 5KEEA 1F2YA 3FILA 2B8FA 3J7YW 1Z6HA 2VXWA 1A3UA 5IODA 1LT3D 2PO4A 2L0CA 3I9V1 1R7SA 2KUMA 2BTEA 5HG2A 3J7AF 1E2ZA 4WORA 2JSOA 4HKZE 1A3TA 1PZKD 2IW3A 4XQQA 1S5CD 1IYVA 1OQQA 1MHHE 1TU2B 1EYDA 1P7EA 2K0PA 3P1MA 2H4OA 1TS3A 5C3EB 3Q8CA 1PRTC 1BMLC 1CT1D 3P63A 2WXJA 4KD4A 1E9MA 3NVYA 1GXDC 3VYUA 3NQTA 2KECA 4KX6B 1B44D 1QOAA 5HGTA 3ITPA 1QE6A 4ARIA 1Q12A 3P75A 1SSNA 2AX5A 1FXAA 1E7PB 2WXLA 2XNAC 1N63A 1MSGA 4QIWB 2IGHA 1FRRA 1SJHD 1Y8OB 1D6EC 4XXEA 2L4NA 1K83B 5EBCA 4A8XC 4MIUA 2LKVA 3Q23A 5DM73 2QKIC 2DLBA 1VCIA 3GV6A 2B2YC 3FMCA 3MXNA 2N7JA 4PQXA 1KH0A 3D6CA 2NN6H 4XIGS 2RQXA 5J22A 3MA2B 4N6EB 1HZ6A 1SNMA 5BN4A 5CV4A 1WTPA 1I4QA 1TYGB 3OMCA 4H44C 4KK7A 3M85A 2Y3AA 2A68D 4V0BA 3LXFA 1QB5D 3R3OA 3OWEB 1QJOA 3TBIB 2FBWB 1QQRA 4KKUA 1JW9D 2AUJD 1GUSA 3SHLA 1Q10A 2V3NA 2LUMA 1Q1EA 2DYMA 2IX1A 2RVLA 2VNUD 4ZUJA 4LJZC 2ZXPA 5G3LD 2VZKD 1UWXA 3S1RB 3P4RB 1QOFA 1CTMA 3D4WA 1TZOA 2K22A 2EYLA 5JPNC 3S14B 5C3WA 3FKIB 4Z9CB 3D3RA 3DUZA 1TVXA 1GPXA 1TWAB 3GTQB 4BA1I 3NQIA 1SMYD 3QOLA 4DXFA 1EOTA 1TKYA