1I4HA

Crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
224
structure length
224
Chain Sequence
b'KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4hA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4hA02
1ET9A 2R61A 4K6LA 1KTKA 1LT4D 1S5CD 1I4HA 1PZJD 1XXGA 2IJ0A 1QILA 1PTOB 4ZYSA 2RDGA 1LLRD 1AW7A 1TS4A 2J4XA 4DXFA 1BXTA 1MD2D 1SE2A 1HQRD 1PTOH 1D5ZC 1BCPB 1RCVD 1S5FD 1RD9D 1G8ZD 1SJED 3URYA 1L0XB 1KLUD 1CT1D 1FNVA 1S5DD 2QEJC 2IPKD 1ET6A 3BZDB 3V05A 4RHRA 1CHQD 3R2TA 1TS5A 1D6EC 1LTGD 1SBBB 5TSSA 1SE4A 2XNAC 3CHBD 3MFGA 1FNWA 1I4PA 1BCPF 2QILA 1SEBD 1L0YB 3R8BA 4DXGA 3EFXD 5D3DA 1RF2D 1TY0A 1KLGD 1LTAD 2Z8LA 4RGNA 1B1ZA 1BCPC 1XTCD 1ENFA 5ELCA 1JQYD 3OWEB 1CK1A 4OHJA 2O2LD 1HXYD 1PTOD 1TS2A 1JCKB 3BVMA 1D5MC 1EEFD 4Z9CB 2ICIA 4RFBA 2WV6D 3W2DA 3BYTB 5FK9C 5ELFA 1EFID 1PTOF 3R2IA 1B44D 1ESFA 1BCPD 1EWCA 1YN3A 2XN9C 1PRTB 3MC0B 1V1PB 4C56C 3EA6A 1AN8A 1V1OA 1DJRD 1SJHD 1PTOC 1D5XC 1FGBD 1UUPA 4L63B 1EU3A 1EU4A 5I4DA 1TS3A 3DWQA 2CHBD 1LT5D 1LTBD 5ELDA 1M4VA 1JWSD 2AQ3B 1YN4A 4L6TB 2AQ1B 1LT3D 1PZKD 1DYQA 1I4RA 4RGTA 1I4XA 2AQ2B 2NTSA 2RDHA 3BVGA 3TSSA 5D3IB 1JR0D 3BYYB 5ELEA 1LT6D 1FNUA 1I4QA 1JWMD 4BWGB 1I4GA 1SE3A 2NTTA 1TY2A 2SEBD 4TSSA 4UDUC 1STEA 3BVZA 1V1PA 4RGMA 4O1NA 1LTRD 4RH6A 3O13A 1UNSA 1RDPD 1S5ED 4RCOA 2TSSA 1FD7D 3DWPA 4RHSA 1CQVA 1PRTD 1F77A 3SEBA 3GP7A 1HA5A 2XRQD 1PZID 1CHPD 1EEID 1PRTF 4NZLB 1HTLD 4RGOS 5ELBA 1GOZA 1LTID 1T5XD 1S5BD 1LTSD 2G9HD 1JWUD 1LO5D 1LTTD 1PYWD 5FKAC 1YN5A 3KLSX 1PRTC 1SXTA 3DWAA 2XRSD
chains in the Genus database with same CATH superfamily
2HQLA 4A3MG 4A3BG 3CCQA 3S15H 4LUOA 2C60A 4B6WA 2MQJA 1VQPA 1Y1WG 2AL6A 2A68D 3C3LA 4LF8L 1ZP0B 3S14H 3OSOA 4CKCA 4DXFA 2KEEA 1QZHA 5IO9A 3HKSA 3ZYYX 3OJ4B 5C44B 4YWKA 4AUQC 2X6GA 3AXCA 4GGQA 1PTOH 1D5ZC 3Q3JA 4WQMA 3UIPB 1T0QC 4HN7A 2KDIA 2O5IC 1VD2A 4OVUA 1RFAA 1FCCC 2J7ZA 3BZDB 3HOVH 2K03A 3V05A 4IKGA 1PMRA 2DN8A 4DAYA 4KTAA 1TS5A 3KUZA 2FUHB 3N9YC 1D6EC 5C5MA 3U7ZA 3QJYA 2XNAC 4BA1I 3DVGX 4DNIA 4LFAL 1CFMA 1E7ZA 3PV0A 2ZPNA 1TZOA 2KN4A 4LF6L 2Y5BB 4IOIE 4BBNC 3VR2A 4LW1A 4DXGA 1CSPA 4B3MQ 2KLGA 1ENAA 1WRDB 3MVVA 4PG3A 3S16H 2VH1A 3RD4A 3FMCA 3PIOA 1FXAA 2Z0EB 4BFRA 1C76A 1Z47A 2MP2A 4CJ2C 4DK6C 3PMFA 3AMZA 3UIOB 4NP5A 4KD3A 1TU2B 1C77A 4W9JA 4USAA 2PMVA 1T5EA 2K32A 3A7LA 1YQ4B 3DXJC 1MHWC 4II3B 5AZFA 1NI3A 4ZHOA 1FCLA 1STGA 3J9CA 2LXCA 4ACFA 3D4RA 1PGBA 3AULA 4BKGA 2K6DB 3RN5A 2EPBA 2KYWA 2MBBB 2WXOA 2B29A 3ZXVA 2D3GA 4A3DG 4PV1C 1NAPA 3A8JE 1V1OA 2PQEA 3CIRB 1TWHH 2KJ6A 4GDKB 1JQ4A 1OTCA 3HOZH 4A3GH 2H89B 4ZRJA 4DA2A 1TJEA 2LHDA 4X65Q 2MH7A 2V3NA 4C00A 1JOKA 1K3BC 1I94L 1VQLA 2BKRB 1D4BA 1TTNA 4L5TA 3QIAA 3ZJYC 1JJCB 3VTVA 2H4OA 3S17B 4B9KA 1V6EA 1I4QA 2KCNA 3T9LA 2FCNA 4R4TA 3OTOL 4IDIA 3UF8A 4WWNA 5D14A 1A6XA 2LZ6A 2BYFA 4WWMA 3VQIA 5E6OA 1GUWA 3IFWB 3ETRA 1MKHA 5M3FH 4P1CC 1K83H 1SFOB 2WINB 1RDPD 1YIWA 3V60A 5MPOA 4KY6A 4P73A 4BY7G 1FFUA 2WXRA 3CC2A 1LUZA 3ZNID 3NVVA 5DPRA 2SDFA 2DYOA 4WRDA 5IYDG 4RF0A 2K5HA 2CFMA 2RMMA 4ALPA 1N34Q 2ZPYA 2RHSB 4X3SA 2WACA 3IAYA 1LTID 2REXA 4EZKA 2G9HD 3QJZA 3OOCA 2V4LA 4P6VF 2A74C 1BF4A 2CVRA 3H0GH 2K28A 4NXNL 1XMQQ 1YVCA 1Q3LA 3B1LX 1I7HA 4IURA 1ZUD2 2AKWB 3PUVA 2RCFA 1XNQQ 1VQ7A 3GE8C 4L2YA 3I63C 1PFSA 3L16A 3NY5A 2VQFQ 2BYVE 1EIYB 1S5CD 2DWQA 3NTKA 2FIFA 1NNXA 2PEAA 2XGTA 4K81A 2F3VA 2XWBB 1GJXA 2BE5D 5GAEC 3RMHA 2V3SA 3E9HA 3I5JC 4JI0L 5AZGA 1E8YA 3HOXH 3S2DH 2WU2B 3TJPA 1DONA 2E74C 2JXXA 4PNYA 2DNFA 3M7GA 2L7RA 3HM3A 2WAQB 3ND9A 3K8AA 4DUYL 2Z4HA 3Q6BA 4A3CH 4GMVA 3GTPH 4ZRKA 2KWVB 4DV7L 5CTRC 1X6OA 5C0XH 3R2TA 1B4OA 5CR3A 3S2AA 2UXCQ 1F9JA 3W5UB 1EFWA 2J52A 1QNKA 2PTLA 3AB5A 1TWAH 5DM73 2VUMB 1VQ5A 1EWHA 2JSOA 3VA7A 3F2DA 2IWHA 1UBIA 3KLWA 2KOLA 5FR6A 1VZ8A 4M00A 3NVYA 3PSIA 5KRUA 3HZXA 3HOUB 2O5JC 3A1QB 4NJ6A 2RVLA 3BZCA 2R3ZA 3NHEB 1XEEA 2KX3A 4WIPA 3MA2B 1EEFD 2OHFA 4RFBA 2Q8RE 3K6OA 3RLOA 2L52A 4FF1A 3OHXC 3TEHB 1WM3A 2F0SA 2OF1A 1IW7C 3W1BA 3E56A 5COYA 3Q8EA 1A62A 2NWGA 1XLPA 3QAQA 2N9EB 1YJ9A 1MGSA 2WXJA 1DM0B 2E5LQ 3M4OB 3DHGC 1R4PB 5JZEB 4KK7A 3T1HQ 1O7YA 1TS3A 2CHBD 1GUGA 2KBNA 4QMGA 4DNTB 3GTQB 1QG7A 4AQ7A 3A1QA 3T1YL 1VZ7A 3U4VA 5IGGA 4LF5L 2K9XA 4C3JG 4OEMB 4DV1Q 1UF0A 5G55A 3TSSA 4JI7Q 1WCMH 3DQVA 4IZ8A 2I1JA 4PT5A 3K81C 4PMWA 2XEWA 3TP7A 1SGHA 3NZUA 2LGSA 1QUQA 1VCBA 4FJVB 2NZ1D 1RHPA 1PA6A 1CI3M 2L5TA 5IYBH 5C44G 1YQBA 2CW0D 1YBYA 2DJFC 3QARA 4W9LA 3CCJA 3NZSA 1VQ9A 4FJZA 4KHPL 5JEAH 5I6WA 3HOXB 2PPBC 2N9PC 2UUCL 4HCNB 3GZNB 4YL8A 4DV5Q 3GP7A 3AE4B 1QCBD 2IHFA 1PZID 3RULA 4BOSC 1GUTA 2FMCA 2MQHA 2KCCA 1U4RA 2QDBA 1LM8B 1H9MA 4OX9Q 5EQ0A 1PDXA 4BBNF 5IT9E 3I4NH 5CBAE 4DV2L 1Y8RC 1N5WA 3F2UA 3UDFA 4LNOA 3GQBA 4OGQC 3NP8A 3J80L 4FO2A 2UU7A 1EUVB 4RAUC 3M63B 4FNFA 2DAJA 4TMAB 2SNSA 2OJWA 2NVTB 5BMIA 2HCCA 3HM6X 4GN3B 3BK2A 4XYOA 3H3VH 3HS0C 5GMVA 1G6PA 3AE3B 1FYCA 3M3YB 3HOYH 5AZHA 3PUYA 1SE2A 2Z9HA 5CC4A 2RPQA 3VXWA 4KDLB 5EPLA 2EXZA 3HP3A 2JPHA 2EOTA 3P4SB 2KECA 2NVQH 2HCIA 4PQXA 1B53A 3BINA 2X38A 3EFCA 2C35B 1YEZA 1MIUA 1CHQD 3Q14C 4DK5A 2LXKA 1W3SA 3I9V1 4BY1H 3ZUNA 4K8IA 4GKJQ 1QQRA 3LWUA 1E90A 3B0AA 3BG3A 3UE0A 3RNBC 1Y14B 1WJUA 2FE8A 1U5KA 3TCAA 3W1SA 4LCDE 3QCAA 1VDVA 2L76A 2MJ3A 3M95A 3AFQA 1PH2A 2WXIA 4B3ML 1EWIA 2HDMA 1E8WA 3J81E 2PQAB 1T3QA 1DCZA 1PUTA 5IP4D 2CS4A 1V8CA 1GPXA 3LJ3A 1P7EA 1BQQT 1TWCB 4HWIB 2JA7H 3OWEB 2N8NA 1ZXHA 3AE8B 1IBKQ 2PO4A 1KH0A 3NS1A 1PTOD 3PS6A 1WXMA 4JI6Q 3CKIB 3RZDH 2KACA 1JORA 3AQQA 1EFID 3PZ7A 1AEXA 4J6HA 3NELA 1WR6E 1VJKA 2XSCA 5ISRA 4IO9A 4LF4L 5C3XA 2B3AA 2L83A 2BCOA 3W1SC 2CKHB 5KNCA 1V1PB 1LXDA 1VR9A 3FC4A 2OOBB 1WTHA 3O65B 5JVG3 3UI3A 1H9KA 1UE7A 4YTNB 4A3PA 2ID0A 1YNJD 4K5VA 4EQOA 4A55A 5E6PA 1D5XC 4GN5A 1PH4A 1YITA 2ONQA 2PQAA 4KLKA 1IXRA 2X8XX 4JBWA 1FIQA 4QQBX 4X65L 3AFPA 4IWPA 4JI5L 4H2AA 4KY7A 2O6VA 2V1CC 3HVDA 4YWMA 1YD8U 4HKQA 1OEYA 3KWVA 1B9RA 1KABA 4HMJA 2XVSA 3VAWA 3PHWB 1I4GA 4DHJB 4Y52H 2QIEB 5BYSA 1WXSA 3A56A 4K6DA 4UDUC 5TR5A 2DZMA 1ZDVA 1V1PA 2QDFA 1SNPA 5IY0A 4MELA 2ZW1A 2VZKB 4EE2A 2WAQG 3NZ3A 3ULLA 4QIWB 5IODA 2CU3A 2TSSA 1BBUA 1VQMA 4DWFA 1ILPA 2LRWA 4BKSD 3SK6A 1QOBA 5BMGA 4B95A 1FO4A 2TMPA 2MLBA 1BDOA 2VZAA 2OJRA 4Y7NH 3IXSA 2VUMG 1N34L 4JC0A 2A19A 4OZCA 1C4QA 1CZGA 2WHIA 2CWAA 2AHOB 4ANUA 4URKA 4A90A 3T3NA 3HOUG 2C7NB 1N32Q 1XMQL 2GBMA 3PHXB 2MX2A 4ASWC 2Y0SB 1XNQL 3U9SA 3ML8A 4W9KA 1Y8PB 5M5WH 2VQFL 2BPSA 3EFUA 4WQOB 4KD4A 4GLXA 3DBLB 1GUOA 1QILA 1VS0A 4B3RQ 4UHVA 4B9XA 1OQRA 5C4JH 2GMIC 3VR5A 3GTMH 1V2YA 3HHMA 4KSKC 4WAAA 2JP1A 3MXPA 1NJIC 1P98A 3Q6SA 1QF6A 1UGMA 2BH8A 1L4DB 2R93H 5FLXL 1E0BA 4N9TA 1PH8A 1R4MB 2RD0A 2F3WA 4OO1G 1C0AA 1L0WA 1YIJA 1UH6A 2CHXA 5HHDG 3MXUA 5D94A 1SBBB 3C8YA 1K8MA 3RUIB 2KVMA 2UXCL 1WGRA 2KJHB 2AX5A 5JJIA 3OMCA 3I3CA 2YU9B 1QWYA 4HMIA 2XIWA 4LUZA 1XLNA 3W1YA 2GBNA 3GTGB 2FUG1 1TY0A 5EKIA 4LF8Q 3AE5B 2R6GA 1ZYRC 1KLGD 4KGSA 3JAME 1ENFA 1N36Q 4ITKA 2JYOA 2AWOA 2IGHA 2KTRB 2JA5H 4CYEA 2B2WA 3W2DA 3UDXA 4ABNA 3HOXG 2HIXA 3PF5A 2ZTCA 2EKIA 3SHQA 3N30A 4HJGE 2ZJDA 4KGRA 1L6UA 1UWXA 3AM9A 3EJIA 5I2XA 1QLBB 4B9WA 3BU2A 2EYLA 2EYFA 2F0JA 2NB0A 3I57A 4LMQD 4DDGD 1PRTB 1JMCA 4LFAQ 3BJUA 1Q8IA 4HAEA 1NBWA 3SHLA 2EY5A 1H9RA 2WP8J 3I70A 3U4ZA 5K5PA 4A3LG 1XCTL 3SK5A 2HJ1A 4K1RB 1IYFA 4KKSA 5KHQA 3QOJA 2JZ3B 2L32A 5LL6S 2JA6B 2E5LL 2IHEA 3G6EA 3B08A 3T1HL 2M4NA 2EIFA 3VHTC 3VR4A 4C7ZA 1CM9A 2N1VA 2ZVNA 4MJSB 2LSSA 2N7JA 1N61A 1VQGA 3KQ4A 4YTPB 4X66Q 4WURA 2B2WC 4DV1L 2DZKA 2KTRA 4JI7L 2KZRA 4JVZA 4DF7A 4EVOA 1JR0D 1X54A 5NUCA 2ZJRA 3PO3B 4ZLTF 2D2CC 4GOPB 2MO0A 1KNAA 1C3TA 1SYEA 4BWGB 2K5VA 4A3IH 1Q1OA 2KFKA 1L0VB 3CP0A 4QAYA 1WTPA 1HFNA 4J15A 5C4JB 1K0SA 1K3RA 2L9HA 3MC9A 4KDIC 1DOXA 2GBKA 2GB1A 2BS3B 1MVKA 4RCOA 1WH3A 1ICFB 2J42A 2M0XA 4GXBA 2R93B 2LGIA 4DV5L 2R7ZB 3S1MH 1HA5A 4G7OC 4EOYA 3ML9A 4O0AA 4MJSA 4POGA 1CHPD 1VQCA 4JPSA 1VCIA 1I94Q 3T16A 5IGBA 3FAHA 2H88B 2MJ8A 1V8QA 4JI1Q 4OX9L 4AH6A 1M1KC 4BXXH 4A75A 3M3JA 1QVFA 4GOPA 3ZW3A 5A2QE 3PIP3 1YN5A 3M4QA 3KYDD 2O6VD 3K9PB 1YJ1A 4IC7B 4LF9Q 1BOSA 1PRTC 1E3PA 2CH4W 1UELA 1SXTA 2E6XA 3NRZA 4IUTA 4K6LA 3RZOB 1WGHA 1NEKB 1K8RB 1B9NA 1CSQA 4QB4A 1WZ3A 3ULJA 1V86A 2L0FA 2VB3X 1SN8A 1HTOA 5DPTA 2Q5WD 5CYUA 1D2BA 1TGZB 1D1IA 1EZ8A 2FINB 2K05A 4IJHA 1KRTA 4XYQA 2RGFA 3BK1A 4FXCA 4R3DA 4RF1A 1BXTA 2IY5B 3HOWB 1QT9A 3KWLA 3GB1A 3KUCB 1N63A 1H9JA 1X3QA 3X3NA 4ZKCB 3UGBB 4OXPA 1FRRA 2E75C 3K58A 3BDCA 2Q2UA 5K36G 1CJEA 4GOPC 3QC8B 4K3CA 3MAQA 1JWBD 4LLGM 2K14A 3N3KB 3WALA 2A68C 4GKJL 2JX5A 3K5MA 2IX1A 3PZ8A 1HQMC 4TUUA 4ZUJA 2K6QA 2JRIB 4R4IA 2UUBQ 3P1HA 3ZQ4A 3RNCC 2D5DA 3PO2B 2I1KA 4P72A 4GNXB 4CJ0B 1Z2MA 1BT0A 1XD3B 3OWFA 4JX1C 2D10A 1N9WA 4OHJA 1W6KA 4JG2A 4QGUA 1IBKL 2J0TD 1JCKB 3RFZB 2N9KA 4JI6L 2PYKA 3ALBA 1WYGA 2FCMA 5DM63 5H1SE 1M90C 1EWCA 4HEA1 4C2MB 1I35A 1QOHA 1E1OA 2XN9C 4WJQA 1EQTA 3JSVB 2JT4B 3RLNA 4FF2A 1AP0A 2ZT9C 1MHXA 5IYCG 5EJWA 3J7AF 1F2LA 4IUNA 1BVSA 3AEAB 1PFNA 2NZOA 1TVXA 1IBXA 1E6EB 4DV0Q 3GD7A 4H0LC 1UEAB 4HCEA 2BA0A 1HNWQ 1EYCA 1WI0A 4GNXA 1KAWA 1I6VC 2KMMA 2AQ3B 4AS1A 3PREA 1V5OA 4JI4L 2PKOA 1VQJA 4II2B 1PZKD 4A3OA 1SSNA 1NI2A 1KM7A 1WMHA 4EX5A 1CTMA 3A4RA 4MGZE 2B2VA 5FLXc 1VQ4A 1E7UA 4W9CA 1EWYC 1I6HB 1C78A 3APCA 2KMAA 1FNUA 1T6BX 2HJ8A 4V0BA 1JALA 1WGDA 4DAVA 1VMCA 2EQSA 2N1WA 2QSDA 4TSSA 3JSVA 1C79A 1G2SA 3PIO3 3H7PB 1ML0D 5C23A 2ZXRA 3D0FA 1WJ4A 3PLUA 3V61A 5CORA 3VVWB 2YTYA 1K8OA 5BMHA 2ENBA 4G7HC 2ZCBA 1VF5C 4GNXC 1SE8A 2DZJA 1F77A 1RKNA 2QDLA 4NJ7A 3SXHA 2JQRB 4NNJB 1YJJA 1EEID 3J80i 3EQLC 2N0SB 2I07B 2B2VC 1WR1A 1TXYA 1YNND 1SNQA 3RN9C 2Q2TA 2K5NA 1GOZA 3I4MH 4KHZA 2WB1E 2JA8H 4HXDA 1PDQA 5FKAC 1A3VA 4IG7B 4FP5D 3KLSX 2AL3A 3AI5A 2D5GA 4DDID 1S3SG 2N4FA 4IUQA 2L55A 1N32L 2JE6I 4OO1I 3H7PA 3I72A 1DOYA 2JF5A 4YSXB 3A8KE 1XF5L 3I55A 2VNUD 4WJ3M 1WFQA 1XXGA 2AMCB 2UUCQ 2QKIC 2INCC 4ZYSA 3MHSD 1Q12A 3A5UA 1CUKA 3CPFA 1XT9B 5L37A 2KHWB 4FHJA 3MHBA 4M8AA 2IBIB 1WTOA 4HROA 3IVFA 2N55A 1L0XB 5C4XB 2QEJC 5IIFA 1F2RI 1G51A 3FP9A 2EELA 4BBRH 1ET6A 1YNXA 4IW0A 3L2PA 2JA6G 4IWOA 1HZAA 2J53A 3VYUA 2QCPX 5C3EH 4I6NB 2M9VA 5TSSA 2K8BA 2SOBA 3CHBD 4GS3A 3QA8A 4PS8A 3QIJA 4YCWA 5IGDA 5KYIA 2L3ZA 2I2YA 3G48A 1WJNA 2IZVB 4FDBA 4CKEA 3PO3G 3GZNI 3HGBA 4JK1C 1BBXC 5E4XA 2B2YA 1SROA 1VDZA 2K5WA 3CRLC 3LWEA 3SDZA 5C0XI 1S40A 2DHZA 1TKGA 2QJLA 2MP2B 4ARCA 2NBWB 1GB1A 1HZCA 1N36L 5IGEA 1HA6A 1XO3A 4L1BA 1ASYA 4N58A 3C19A 1R4NB 3NSWA 5IGFA 1KD1C 1NBFC 4OWXB 4XWTA 5IOIA 5FK9C 4HPLB 2WAQE 2E2JH 2C9OA 4OL7A 3KK7A 2VRRB 2R7ZG 3DDCB 1HR0W 1FMAD 2BVCA 4DR3Q 2BF8B 5D65A 1OXVA 1JT8A 3KDFB 1EY9A 4EQNA 1IUEA 2LWPA 2UXBQ 1AN8A 2WLBA 4S17A 4W9FA 1JROA 2IYDB 3Q3FA 3A9KB 1FL0A 2OEDA 2B2YC 1SNCA 1EU3A 3KFUA 1ISNA 1LTBD 1YN4A 4DK3C 1YJIA 1F9RA 2FIDA 2LFNA 2A4ZA 3K7AH 5M5XH 2CKZB 1PH7A 4OW0A 2KQ3A 4NXMQ 3TDQA 4X66L 2Z6KA 2VW9A 2V9HA 3TZUA 3FVQA 4JQWC 2CCZA 2ZZPB 1AE3A 1EIHA 3ECIA 4FN2A 4R4CA 1WFYA 2WXMA 4A76A 4X57B 4LFCL 3FEWX 4DR2Q 3I91A 2IO0B 3NUHB 4P7IA 4LF4Q 3HOWG 4FA6A 1D8LA 1Q8KA 3FRPB 2WYQA 1BUIC 1MG4A 2Z6BA 4U68A 4BAXA 3KDFA 4RH6A 4A3JG 5LMNW 3A9KA 5M3MG 1J0GA 3DWPA 3PV1A 1AH9A 4HJ8A 3AE7B 1SNDA 4NPNA 1UE5A 2OT2A 3CQZB 3N6RA 4RA8A 1MSHA 4DK0A 3TIXA 3BIID 4IOAA 2HQEA 4KKIA 4JI5Q 4MH0E 1GO3E 1HTLD 2LVQA 2Z6KC 1TIFA 3STBD 5E1FA 2PIAA 3ZIMA 1F9PA 2CW0C 2WB1B 3VYRA 3PLVA 4JI1L 2MA9B 1STBA 4AJYB 5LLIA 4A4IA 2UUAQ 1FPYA 3PO2G 3WANA 2LD9A 4GLSC 1F52A 3S15B 4RM9A 5HGQA 3MEHA 1RFKA 3ZJUA 4LF9L 2EJMA 4OWWB 4A6QA 3DWMA 3P4RB 1XJVA 1NMGA 3S14B 4JPBW 2L00B 1E2VA 5BN4A 4MN3A 4WORA 3NBHB 4MNOA 5KGUA 3OAWA 4KVGB 1AWDA 4A3EH 3ERSX 2MPMA 1IYVA 4LJPB 1QZEA 1WWTA 4NQLB 1PTOB 4ZQ3A 3G71A 2M19A 5JH5C 5JPNC 2B63H 3AE9B 2L05A 3SU8X 2K33A 2UWQA 4RM8A 1VZ6A 3A54A 3HOVB 4KJNA 1I5FA 2A6EC 3PUXA 4RG1A 4LK0M 3ZJTA 2E3TA 2D11A 3KF6B 2WGSA 1PQSA 3Q8DA 3H3VI 3KF8B 2DX5B 2V3PA 2Z0DB 3H9DA 3C1EA 5FO9B 3U8ZA 2G4DB 3NTHA 2MBHA 3NOBA 2N7EA 3S16B 1HUMA 5HY6A 2NN6H 5CGKA 1CA5A 4IALA 2BBCA 1B2TA 2ZTEA 3MTSA 3NBHA 4A3FH 1ZXIA 2ASBA 2WXFA 1A0IA 2UUBL 3PQIA 5J22A 1OXUA 1DGJA 3U4EG 2V1YA 1B1ZA 2K75A 2L15A 1RYJA 3EIVA 3JYUA 4CDEC 2ATWA 5GADC 3ZTDA 2O2LD 2YLMA 3DHHC 2OQKA 3J7YW 3A55A 4KHVA 3KF6A 1WTVA 1EOVA 4C3HH 2DYMA 3KF8A 3CAMA 2ASQA 4RKLA 5GAGC 4ANWA 4C7YA 4XWWA 2BWES 2BS2B 2ZW0A 1TWHB 1WE7A 5KYLA 2SNMA 3PZDA 3HOZB 4A3GB 3DBLI 5IAAC 3DLLA 1DJRD 1XPRA 4HPMB 3FDTA 4DV0L 1PTOC 3R3MA 1JB7A 2F0PA 2LXJA 1HNWL 1B9MA 2BH2A 4DQOC 3L08A 4A3KH 3X23A 5C4ZA 3SR1A 1WTWA 1R4MI 2RDHA 2DAFA 2HTHA 5C1ZA 1MI2A 2M1MA 4DR7Q 2BB6A 1AARA 1GAQB 2NZHA 2OXPA 3EECA 1E0ZA 5E3FA 5GROA 1G91A 3VR3A 3N1XC 3GTJH 2QGQA 4NQKE 1YNJC 2JYEA 1QUQB 1EL0A 1PFDA 2KQ4X 2DGYA 4XIGS 3NG0A 4KSLC 2IDYA 5M3FB 4AOFA 4M1UB 2SEBD 1K83B 4BKSA 2WNMA 1CKNB 4DFAA 2B63B 1EO6A 1FFVA 4KZ0A 3ZDMC 2KDFB 1LTRD 4CJ1B 3C46A 1FJGQ 1WXQA 5C4XG 4OVVA 3U30A 4ZDVA 5IN7A 3P20A 2JWZA 3ZNHB 5HKHA 3QOLA 1VQFA 2B8FA 4E6IA 4BBSH 1V1QA 4XQJA 2CWPA 3TP6A 3U9OA 5LHY1 1HR0Q 3MXGA 3W1GA 4P16A 2M2LA 4OWTB 1PYBA 1VQ8A 1J19A 5CV8A 1E10A 2R92H 2EYJA 1BO0A 4HCSA 4LNFA 3HFZB 5F2DA 1G6JA 1H8CA 3AMUA 1MBYA 3DVGY 2K5PA 4XDDA 1SYFA 4ZRZA 4HJAA 4IPGA 3H0GB 1PHJA 1C4AA 2FBWB 4KX6B 4US9A 1I50H 5CMDA 1JJGA 5JXVA 2MUYA 1E2ZA 1HUNA 1D7QA 1G2TA 3E3XA 1WD1A 2LS01 2IGGA 5D7GA 4IFDH 2C5CA 5H92C 2PZTA 4P71A 1CKNA 1A63A 2DENB 1HHVA 3EN2A 3GTOH 1I4HA 2ZTDA 2GN5A 5E6JA 3S2DB 2DY8A 4DUZQ 3Q3OC 1SAPA 4DPGA 4IUVA 1WGGA 4WJNA 4LAAA 4IM2A 4QIWE 1EM7A 4X3TA 3T53B 3RUZA 4DKAC 5J18A 1EY6A 3VUYA 3GTPB 2IL8A 2UXDQ 2Z4IA 5I6YA 2KLCA 5JPMC 1RD9D 2B2UA 1ZW7A 2K8HA 4XDCA 3DUZA 4A9AA 1EZ6A 5EBCA 5LMNQ 3N52A 4F7ZA 4CQNA 1TWAB 4IPDA 3PRMB 3VUXA 4WJWA 2EYMA 2F0EA 3H09A 2A6ED 3H15A 2NVXH 2JYTA 2ICEC 5IP7G 1EF1A 1PGXA 5CV9A 5KIXA 3CCSA 1E7PB 4W9EA 4N9PA 1RJTA 1L0YB 4A3KB 1OXSC 1MJEA 1WM2A 4UY8C 1KAAA 2Y0SE 2OCEA 2A6HD 2WDTB 3BS1A 4N59A 3HVZA 3OPOA 3RPFC 2KANA 2YTXA 1A8VA 2PW5A 1VLBA 1ENCA 3SFEB 1BCPC 2AUJD 3TEXA 4OIKA 3D4WA 2B2UC 3LGJA 3CMAA 4U673 2F3IA 2IW3A 4J6IA 1RM6C 3T56B 1U9RA 1F2RC 1K51A 2W3SA 3RNEC 4HIOA 3VRAB 4ODGA 3RMKC 5IKCM 1DOLA 2EMTA 1CKOA 4JI8Q 4ANVA 2AWTA 4BBSB 2NVUI 4DR3L 1NTGA 2BTEA 2L12A 4G50A 4H02A 1GM5A 5BN5A 1HCZA 2WB1G 4K2KA 2UXBL 2ZVOA 4PK1A 2A1AA 1EY0A 4ZRIA 1WTRA 2BDOA 1WIAA 3BZKA 3P7JA 3AE1B 5ELDA 4M01A 3V6CB 2FFKB 1BNZA 1WCMB 4ME5A 4ZOHC 2YEPB 3F8TA 3NXWA 3PGZA 3CWIA 2L0TA 1HE8A 2DJGC 3T51B 2KCMA 2O6VB 4NXML 2JEBI 2WIIB 5JOBA 2MRPA 1CKMA 5FLMH 2I0QA 4HCPB 3FKYA 1EUJA 4JCVE 1HFGA 5EGTA 4DR2L 4LDTD 1JJ2A 2J0JA 3E9SA 2QCZA 3HOVG 2JN4A 3E6ZX 1P1AA 5E4WC 4N6EB 3WAPA 1P16A 2M56B 1TT2A 1CZWA 2R7DA 1JB3A 5LMUQ 1WTQA 2F0IA 1VQEA 3RN2A 3GV3A 1XNRQ 1Y1VH 1C9FA 3SEBA 2LASA 3CPWA 3CC7A 4XT3B 2MP1A 3I90A 3FKIH 3I4NB 2W9NA 4JI4Q 1YQ3B 3RNAC 2EJGC 3T13A 1ZE3D 4X3KA 5A2QL 1S3OA 5T1GA 2XWJB 1AZQA 1YJWA 4RNAA 2ON8A 3A8IE 1UE1A 1FRDA 3EGRA 2UUAL 1GUAB 4ZKBB 1K52A 3APFA 3IG3A 3J7A5 3G6JB 5IP9H 1PXUA 3SDLC 1IZ6A 1E5WA 1WYWB 1WD0A 2PCFB 4GSWA 4K7SA 4R4OA 3M62B 5DAUA 3QO2A 1IHZA 3HOYB 2W82A 1T0RC 2F0GA 4EZLA 1VQAA 2F0VA 4NB3A 2C7HA 1DZ1A 2J4XA 1IKMA 1YZ6A 1MFWA 2NVQB 2Y3AA 1ZXTA 1ZGUB 3N1ZC 2JQOA 3GTKH 3N20C 3QR8A 4PS7A 4ZRQA 1G8ZD 3L7ZC 3HOZG 4DV3Q 4A3GG 2LI5A 4BY1B 2XTIA 4A93H 1L4ZB 5IWAQ 2FNJB 4HLEA 2RKSA 1NE3A 3KJOA 3B2FA 1P9DU 3JVZX 2V0GA 3AEEB 3S1QH 5EPKA 4NY0A 2CJOA 4MSMB 1SEBD 2WXGA 2K5QA 2PMZB 3Q22A 3TEYA 3KOJA 3CCUA 3MP9A 1EQQA 3H6NA 2JA7B 1RF2D 1GJZA 2EDGA 2NVYH 4MZ9A 2INNE 5M3FG 3NVWA 3VTWA 1KDAA 5DPWA 3RZDB 1F1HA 3R7RA 2B63G 1VQDA 3S1NH 1QOFA 3HRZC 4Z9CB 2IGDA 3W5VB 3PSEB 4QL5A 2F4IA 3M7NA 1UZXB 1WRIA 4A3MH 4A3BH 1IBMQ 1ESFA 1BCPD 1PV4A 3H3VC 4XC2A 2DBYA 1Y1WH 3RNUA 1F9SA 2K0PA 3HRDD 3WAOA 4PZ8A 1N6ZA 2J0KA 5J2RA 1PLFA 4F8MA 1KLVA 2E2HH 4NAMA 3H0GG 1ROEA 2A8VA 4HK2A 4K7UA 4MACA 1JRUA 2F03A 1FGBD 1IYJB 4L5RC 4NDXA 4PMBA 1DOKA 4PZ6A 4RWSC 3PGEA 4BVUC 5JHAA 4G57A 1I4RA 5D2MB 1SYGA 4IM3A 2D3BA 1HTPA 2I46A 5D3IB 4DR7L 1OGWA 2GBRA 4BKTA 1JW9D 2ZCCA 1LT6D 1DGSA 2BQQA 2KC2A 5M5YH 3NVZA 1BBWA 3VYSA 3Q8CA 4NAWA 1WZ0A 3MTNB 2M8SA 2KHJA 3J80c 1SE3A 4A20A 2NTTA 4A3CG 2KFKB 1OFFA 2KNBA 4MH8A 3BVZA 2EY6A 3KUDB 1RTNA 3P4PB 5C0XG 3VR8B 2G4SA 1Q86C 2HHHQ 4RMAA 3RZWC 4CKBA 2CU1A 1FJGL 1C48A 1HZ6A 1LTLA 2MCNB 2LMCA 2WWZA 4Y7NB 2JWUA 3NQIA 4R8NA 1HR0L 1TT5B 2KQ7A 1R4NI 1HRJA 3Q8FA 4IQZA 5C0XJ 2WXPA 3AN1A 1Z9FA 3S1QB 2EJFC 1IL2A 2A5UA 4XT1B 4A3DH 1JWUD 1LTTD 5FO8B 2BOSA 4LFCQ 5M5WB 3HKZE 1X56A 3DBHB 2YTVA 2O2VA 1XPOA 4G11A 1SDFA 1IGDA 1V97A 3SR6A 1NR2A 1KC8C 4AYBB 1EIFA 2HTME 4LNIA 3QWNA 3GTMB 1O7LA 1YI2A 2VL6A 1YNNC 3VR6A 1NVID 1JMLA 4DUZL 3S24A 2RDGA 1TS4A 1AW7A 3ZDTA 4JBMA 1MD2D 2PI2E 1KJTA 4JL9A 3CF6E 5ELNA 4BBSG 1Q7YC 1JOQA 1ONLA 2UXDL 4HJ5A 2G3QB 3P4QB 3GTLH 1Y8OB 1CT1D 5A35A 2JUOA 3M9BA 3P2BA 1OXTA 4ULLA 5LMNL 1KDBA 3OW7A 1WGYA 4P1BC 3J81i 3U2SC 1XQQA 3V6EB 1WCMG 3G7LA 3V3XA 1OQQA 1Q1BA 2ACZB 3K5NA 3Q23A 1FNWA 2LGDA 2BGFA 1T0SC 4BY7H 1AE2A 4OVZA 4G7ZC 2N3SA 1NDDA 2BKFA 3R8BA 5IYDH 5IYBG 3S2HH 4W9IA 2ZXPA 2NCNA 1VRAB 5AEKB 2WXQA 2LRUA 2WXKA 1W6JA 2KTFA 2JA5B 3CC4A 1YOVB 1ILQA 3I4OA 4J1MA 5JEAG 5G3LF 1SYBA 2Q8IB 5DEHA 3LXFA 1R4QB 2Z0SA 2I5LX 4CDCC 3B6YA 4OONA 4WFN3 2G45B 2MBEA 3E9IA 1OEYJ 4EKUA 3PRPB 2RQXA 4DAPA 5EE3A 4DR6Q 1F9QA 3AU4A 3HUIA 2F0TA 3I4NG 5JEAJ 4JI8L 5I2YA 1WF9A 3MHZA 3VRBB 2MSED 3VR9B 2K50A 2F0MA 3NWTA 4B0EA 3IKJA 4JGHB 1KRHA 1K28A 2I5MX 3TMEA 5T1IA 1ASZA 3QWZB 1IBXB 1IBLQ 3CCVA 2LY7A 5I4DA 1NY4A 4HDQA 3KYCD 1JWSD 3NBIA 2EY2A 1LT3D 3SVMA 2OWOA 1J8CA 2K04A 2AQ2B 1E8ZA 1NENB 2BT6A 2IO2B 1WMHB 1TR5A 3I2ZA 1H9SB 5HFYA 3HOYG 4MDKE 4A3IB 5ELEA 1IP9A 1C4CA 4HIDA 3MC8A 3L54A 3DM3A 3A9JB 2Q8TA 1TWGH 5G2NA 3P1MA 1KDCA 1TQOA 3AU7A 1VMPA 1JICA 1U4LA 3AE6B 1FD6A 1L6VA 4KGTA 1R7SA 4O1NA 2ZNVC 1SMXA 4LJZC 1B7YB 2M00A 4BY1G 5C6AA 1T9HA 3O13A 1HNZQ 4KKTA 3S1MB 4XZ4A 3TL5A 3ENEA 5C3WA 5LMUL 3VDZA 1V9JA 1Y69U 4MTNA 3R93A 3LYYA 1X55A 1PH1A 1XNRL 2G5DA 1F2ZA 4FYDA 4QJFA 2GI9A 5EE0A 4WH4A 4NZLB 5J1ZA 2CQAA 1NYQA 4KI0A 2Y0SG 1H9SA 3TN2A 4K0KQ 3CSTA 4HJKA 4BOZB 3MJ5A 2HUGA 5FLXE 2JA7G 3V96A 1LTSD 3W5OA 2XK5B 3HKZB 3A9JA 3ONSA 4HRSA 3ER0A 1S4ZA 3TQYA 4CGYB 5EDSA 1K73C 3FHWA 2GBJA 4JWSC 3CW2C 4F8CB 3DMUA 1SIJA 1KTKA 3DWGC 1KRSA 1GUSA 2IJ0A 5EAYA 3UE1A 4C3JH 5JJLA 4LK1C 3STBC 2LUMA 4DV4Q 4XDXA 4B08A 1QKZA 2WKDA 5KNBA 3KBGA 2G1EA 2H1EA 4IWQA 2NUCA 5I9OA 2GLSA 2WDVB 4GU2A 4QCLA 1WY8A 1WSPA 3TMPB 1XMOQ 1X9NA 1A15A 1SJED 5JHBA 5CV6A 1PH9A 2LXAA 1KLUD 2MHJA 5HGTA 4Q0FA 1S5DD 5CBEE 5C44H 4DV3L 3ZO5B 3NJTA 3Q2AC 1A2TA 5IWAL 3BY4B 3ZNZB 4A8XC 3I4LA 2XK5A 1E7VA 2HDEA 3NPPA 1Z6HA 4L23A 2MW5A 2KXJA 1SMYD 1EF5A 2HD5B 5CV7A 4LUVA 4P2CB 2A5HA 4GLAC 4G0NB 3ZGZA 1G291 3CU7A 3FILA 4C1NI 1N33L 4HIMA 3ICEA 3K5LA 1ACCA 2NBUA 3ABVB 3H8HA 5EPJA 4CDDC 5M9OA 3A74A 1E8XA 3PRZA 3J7ZC 1WX7A 2D2QA 3D3RA 4JIOU 2PI2A 4QUFA 5JJZA 4ME3A 2Z8LA 1KFYB 4FJYA 4FLHA 1MSGA 1XTCD 1IYUA 5ELCA 1XCQL 1FGUA 3LX0A 3I73A 4PYUA 3RZFA 4M0WB 4O2DA 1FEHA 3BVMA 2CR5A 1M8AA 1GHJA 2ICIA 1WTXA 2IO3B 4KJOA 4IN3A 3T8MA 5ELFA 4TKOB 2EMSA 1J7CA 1GUNA 2VXWA 2A69D 1LFDA 1IBML 2IY1B 2PLPA 4MSQB 2RSUA 3U50C 2V4DA 3AE2B 3IBEA 1DD2A 4YT0B 1NMFA 1XYIA 4FADA 2AEHA 1X1MA 2EYOA 4YCUA 1JWAD 4L5QA 5JJKA 4KV2A 1PVOA 3R7QA 4WJPA 1II3A 2AQ1B 4MGKE 4TQ0A 5L95C 1XX8A 3DBRB 1RL2A 2KHIA 2BYEA 2NPTA 1HEZE 4M0WA 2JU6X 4AYBG 4D2KA 3BYYB 1C8CA 4XQNA 4REZA 4WWOA 2DZIA 2JK8A 1LV9A 1JE5A 2B3GA 3VH4B 2R93G 1SRUA 1KIXA 2PW9A 5AJ3Q 4LF7Q 1SF0A 3S17H 4M8NA 5HI1A 1V81A 4DR5Q 1Q81C 4DU9A 3Q8AA 3F1ZA 4I7ZC 2MBOA 1YX5B 1B70B 1L5PA 2HHHL 2LUEA 3I8ZA 2WQYB 3ZKJC 2BB5A 2GOWA 2KFJA 4XX5A 3WOEA 4G4KA 4I65A 3SD5A 1CMXB 1SFOH 4TVAB 1BUVT 4YXDB 1PRTF 2NYZD 4HIKA 4UAIA 1STHA 2JA8B 1VQHA 3I4MB 1GHKA 1H4RA 2C7MB 2IO1B 3TZDA 2INPE 3EC8A 5GQOA 2LVOA 2WXNA 3APDA 1SYCA 1FR3A 1S5BD 2QF7A 4HSVA 3CMEA 4L8JA 4TV3A 1CZPA 4I6PA 1GVPA 1B8AA 2JA5G 4JOIA 4FXDA 2QHOA 1X3EA 4W9HA 2F0OA 3UQBA 4YSZB 1ET9A 2L4NA 4IUUA 3OG5A 3ZVVA 4AP4C 1DXMA 2Q2IA 1O7ZA 1WJ6A 3L3OC 2UYZB 4KV6A 1PZJD 2VS1A 4MIUA 4AQYQ 3NWSA 3NS8A 3CCLA 4ZRPA 2L0CA 3ZTCA 3ZXRA 1UWVA 5IT9L 4BBRB 2KWDA 1JE4A 1RCVD 3KBXA 1I3QH 5DLQE 4IFDI 5C3EB 1WXAA 3N1YC 1XWEA 3H7SA 3TP8A 2ZJQA 4AWJA 3G4SA 4FXGC 1E22A 1Y56A 2FMMA 1VQKA 4HJ9A 2KMCA 1B3QA 1K9MC 4JOIC 2KJXA 3UINB 4E71A 2BYTA 3ZJVA 1SE4A 5FR3A 1STYA 2IT1A 1I4PA 1UD7A 2KWUB 5J39A 2QILA 1J5EQ 4YIJA 2WDQB 2RDBC 1TKEA 3CMMB 1O78A 4A3IG 1JC7A 1KF6B 3NHHA 3NQTA 1K8GA 4B3SL 1KXLA 2FCSA 1Q1EA 2VUMH 4N8FA 2NS5A 2WX0A 4JW0A 3KVFB 2FJ2A 1LTAD 1PYSB 4RGNA 3QQ8B 5C5LA 2CHWA 4DNRB 3KH0A 4DHZE 2RHQB 4X3UA 1HXYD 4QUCA 1ZKOA 2E2JB 2B8GA 1AZPA 3W3AA 4B3TQ 3HOUH 2N9LA 4LDTB 2WV6D 1TKWB 1VQIA 4PYZA 4FVMA 3BYTB 2PPHA 4ANXA 3KLRA 5GXGB 2LJ5A 4CHKA 4DGZA 1UWMA 4GIVA 1A3UA 4DR6L 2F0FA 3VUWA 2A6HC 2M17A 4WAFA 1GB4A 1K50A 4BXXG 1SR3A 4IPCA 4YY3Q 4F87A 2L11A 1GC6A 1XLOA 4H13C 3J81L 4KKJA 5IE8A 4GKKQ 3IAM1 1YX6B 1J7BA 4GDKA 4ZUIA 1YMHE 1UEBA 3K7AB 5M5XB 1IBLL 1ICWA 1VQ6A 4L63B 1N8RC 1EU4A 3HKZG 3JC66 1YJNA 1M4VA 4OO1H 2KKCA 1QVGA 1TIID 4K14A 3M4OH 1X3FA 1EY5A 1E24A 2E8GA 1FVIA 3GTQH 1F2YA 2F0LA 2Q2HA 3KJPA 4R1JA 2MGSA 2RCNA 2KDBA 1LM0A 2RSOA 2KDMA 4KMUC 3TREA 1V9PA 1WVLA 2KOXA 2ZM6L 3A5ZB 3OMGA 3TBLD 4TQUS 4Q5VA 1K53A 1P8LA 2KQSA 3PCOB 3TEWA 2MJEA 2OQ0A 3IRBA 4K2LA 2DUDA 1X3GA 2J7QB 3D32A 3K0YA 5FJ8H 1K8AC 3CCMA 2PVGC 2JXTA 1O7IA 5D6JB 5ELOA 1HNZL 1B3AA 3RR5A 4O42A 2DYBA 1S5ED 2A73B 5AFWA 1FD7D 1Y8NB 4R8IA 2Y5PA 1I3QB 1CQVA 3KYHC 2R2QA 2FXQA 4ICUA 3MZ5A 2KN5A 1U0LA 1M94A 3ITPA 4JLCA 4JWUC 2HE7A 4S0RA 1JRPA 4TKNA 5LXHA 1EY8A 5G5GA 2JRHA 4K0KL 1WI5A 2K4KA 4C1NK 2E2IH 1HZ5A 1TBEA 2F4VQ 1EYDA 4P74A 4A3LH 3J7AV 4BZAA 4X62Q 2ZEQA 1HZBA 4X6AH 1WX8A 3MWYW 1P7FA 3CSFA 2B2TA 4FULA 5HURA 5AUIA 3DPDA 1RAXA 4A3EB 2R61A 5FO7B 1N5XA 1WXVA 2OTLA 4GB9A 1RRBA 3IFTA 2RPVA 4LTUA 1LT4D 2NVTH 4LFBQ 1LACA 4AIMA 3J81j 3DBSA 2KC1A 4DV4L 2VH2A 3I56A 4DK1A 4LJOB 2F0HA 1HQRD 3SFDB 3M3YH 1Q46A 1NYRA 4MT5A 3TEZA 4C3IH 1PFBA 1BCPB 1EQVA 3GO5A 1VF7A 1XMOL 1KHIA 3KUPA 1XTDA 2AUKA 1V43A 4ZHPA 2IPKD 3WDNA 2UU9Q 1MJDA 2LGYA 3Q3MC 5BYQA 3TBIB 4RHRA 4WWPA 1CA6A 1UE6A 2YVCA 3WWVA 1YNTE 2B2TC 1HH2P 3S1RH 4A3FB 1UAPA 3M4PA 2QEXA 2KDEB 2L8JA 3DHIC 1FM0D 2KENA 4G3XB 3K7UC 3MXNB 1GXDC 1KNEA 1A70A 3TS0A 2CQOA 2HDLA 5EKLA 4DHZB 1PGAA 4H44C 1EY7A 4C3HB 4NW2A 1CK1A 2QMTA 4DBGA 1DOMA 1TS2A 3QX1A 1GD7A 1TWCH 4DV6Q 5DPSA 1W2BA 1Z7TA 3HEJA 2DY7A 3R2IA 5CV4A 3DBHI 3UDGA 3VTUA 2LKVA 5DNFA 3D8GA 3GV6A 4PMCA 1YN3A 4KZCA 3KLSA 1N62A 1AYFA 4JYAQ 3K9OB 2PW7A 1KL9A 3I4MG 2JA8G 1Q5WB 3I7FA 2PE9A 3X0WA 4JV5Q 4X64Q 4C80A 3MXNA 1LGRA 5EE9A 1SJHD 1UUPA 4KN7C 2LEKA 3JAML 3QB3A 2FCQA 2PMZE 1C9OA 2K52A 3DWQA 3ZNGC 2JA9A 3CRKC 4W9DA 2RDFA 5BN3A 5K36H 2KVRA 2E2IB 1QNUA 1MPEA 4KIKB 3RD2A 5IT9c 5EE1A 3GTJB 3S9WA 3ZRFA 1WOCA 2C5LC 2O4XA 4BA2I 4OIJA 4ILWA 2OTJA 4LNQA 3R3OA 3WOFA 2YYZA 2J0MA 2JZPA 2KA7A 2K8CA 3JW0X 3M4YA 2W55A 2MFIA 5LNK1 5AJ3L 2EY1A 4LF7L 1PH3A 4XE0A 2F0UA 3SK8A 1SYDA 4BBRG 3HK0A 3P42A 4DR5L 1UGJA 2WDRB 3IHPC 4Q2JA 5IOCA 4EFOA 1BR9A 3VFKA 5C3EG 2FHTA 3RLFA 1T0YA 4CDFC 4C3IB 4J3OD 5CHWA 2R92B 4KN4C 1SB3C 2CHZA 2D07B 3DEPA 2PVOD 2XRQD 3ERQA 3CCRA 4MGIE 1WYDA 1TWFH 2EZVA 2GRIA 4KIKA 1I50B 2YV5A 3S1RB 1C7YA 5GAHC 3CXCA 2LJIA 3EUB2 1QZGA 4IPHA 5IYCH 1LO5D 3CF5A 2K22A 4FHKA 4ZAIA 1XLQA 4NPSA 2WU5B 3GTOB 3CD6A 3AEDB 2KT7A 1Q10A 4DR4Q 3HIZA 2N9XA 4E74A 3J81c 2VB2X 4AQYL 3TP5A 3K59A 3AH7A 2KEDA 1KQSA 1PFMA 4HDOA 5CX3A 2F0WA 2ES2A 3PT2B 2R7FA 1X3PA 1GC7A 2INDC 4HKZE 1O80A 1V5TA 4HPPA 2LHEA 2EVBA 2NVXB 2VQEQ 2K3UA 1YHQA 2EE1A 5DCNA 5AUKA 2IX0A 1RLFA 1NUCA 2L1AA 4YSYB 3W9CB 4JI2Q 3DCGA 3DEOA 2WS3B 1QVCA 1YHBA 1J5EL 3VDYA 2MNAA 1BKBA 1IW7D 3NENA 2WKCA 2B76B 3K57A 4N9F4 3PF4A 4L5SA 4AYBE 3UQAA 3SE0A 2YU9H 1QOAA 3GE3C 5G5HA 3TUOA 1S72A 3NTIA 3GTGH 1WGKA 3F2BA 4QF4A 4EEWA 4EZJA 5C3JB 1D3ZA 4YWGG 4F88A 2GA4B 3F2CA 3V62A 1LABA 1D5MC 3SK4A 4B3TL 2K6AA 3OYYA 1IKLA 2K7VA 2EYPA 1LYLA 1Q0WB 1GNUA 1QOGA 4XYCA 4R4QA 2LFIA 1PTOF 4CHTB 3L0OA 4C4VB 3L9AX 4EQ5A 5KEEA 3CCEA 2K39A 3K0XA 4PZ7A 1HZ9A 5FOBB 1HNXQ 3A0JA 4YTMB 4C56C 4YY3L 5C4HA 1N33Q 3E0JA 3RCZA 2F0NA 2NR2A 3P75A 3WA0A 4GKKL 3RNFC 1TWFB 1YHAA 2E2DC 4JI3Q 3OLMD 1J6QA 2MHVA 2HT1A 1LT5D 2EXDA 3AECB 3QK0A 4YHHQ 4L6TB 2N49A 2JA6H 4RGTA 1V49A 2BWFA 4A3EG 1CQFA 2EKEC 3AB9A 1PH5A 5T8IA 2WFWA 1GKHA 2PNHA 3SGIA 4EQPA 2MO1A 2HD3A 2H5XA 4ARIA 4UP8A 2K01A 1EYAA 4C4VA 3PO3H 1RODA 4NAWB 3WCQA 4GLVB 3C2PA 4IOCA 2K1FA 4MHEA 3AU5A 1STEA 4RGMA 4V190 1Y1VB 2BS4B 2KK8A 4AJWA 2JJQA 3E5SA 4K8JA 3A7AB 3U58A 4DR1Q 1V80A 4GN1A 1S1QB 3FKIB 4RCNA 2LMCB 1WX9A 4YWLA 4JBKA 4IM0A 2K5DA 4P75A 2NN6G 2WP9B 2F0DA 3OIPA 3OW2A 2V4IB 1P0RA 4E3CA 3UDIA 4A3FG 1HTQA 5BR8Q 1TKYA 2R7ZH 4IUMB 4JBJA 2KD0A 5ELBA 3DHQA 3VA5A 1F0ZA 1T5XD 4DAMA 3L13A 1J7AA 1Q90A 1A2UA 3T4AC 1SLJA 1E9MA 3DVNV 2N78A 1JOOA 2L1BA 2F4VL 1OTRB 4X62L 4MEMA 4NMZA 4TQ1A 5JVH3 4K3BA 3D31A 1TYGB 4C3HG 2WXLA 3J80E 4H7BA 4UP7A 2O2VB 1L2NA 5J17A 2BDNA 5KHOA 1SIFA 1EIGA 1QE6A 3VH3B 4LFBL 3RZOH 1H95A 3GTKB 5FJ8G 3VYTA 3JAMc 5E6NA 3DBRI 4IUPA 1BMLC 4A93B 3QG1A 2NBVB 4LNKA 1HPCA 2KJRA 1N60A 2D62A 3I3TB 1J9OA 4FBJB 1ESRA 1FNVA 3HOWH 2JVCA 2F1MA 4A3KG 2UU9L 2VY3A 4DN4M 2D0PA 4A3JH 4EUTA 1LTGD 1RWSA 1ZOYB 4I6LB 5M3MH 1ZPSA 3DVNU 1BCPF 2NMQA 2PZWA 2I38A 2PJHA 4LF6Q 2F0QA 2NVYB 1IL8A 3LB8C 4I7AA 1U4PA 3IL8A 5D3DA 2M0AA 2EYHA 1EY4A 3MEFA 5G3LD 4OELB 3S1NB 4MTKA 1HJPA 3DOWA 3T3OA 1MJCA 2RF4A 1KOTA 3BDLA 1JQYD 1E1TA 4HSPA 3AYHB 3PO2H 1SMYC 4LNNA 4A3MB 4A3BB 4UP9A 5L83A 1IPGA 1MI0A 1LQBA 4WJ4A 2P5ZX 4HEDA 4C3IG 1Y1WB 5HG2A 4DV6L 3IT4B 2R92G 3UI2A 1QJOA 3A33B 3H1UA 5CHVC 3H94A 2Y5CA 1SNMA 2E2HB 2XBBC 4JYAL 3MC0B 3E0EA 1ZEQX 1EYGA 4C2MH 3EA6A 2WX1A 4IJLA 3ULPA 4JV5L 1L7YA 2I5HA 2ZNVB 1K0RA 4X64L 4B3SQ 4IFDG 4HVBA 3RT3B 3WAMA 2QC8A 1QB5D 4F1SA 5EBDA 2QA4A 4US8A 3PO0A 1DYQA 2JSVX 3C0RB 5BYRA 2A69C 1I4XA 2ALYB 2NTSA 2RA4A 5M5YB 3BWUD 5JAVA 4OZAA 3AEFB 3X3MA 4XQQA 4IFDJ 2CJNA 4ZYNA 1NR4A 2G9DA 3OTOQ 4S3SA 3H6MA 1ZDXA 5C2TB 3RNGC 1OXXK 2AWNA 1I6HH 1MG8A 3A4SC 2W54A 2JXMB 1RTOA 2SAKA 3RYTA 5J3BA 4J8QA 4NJCA 4B0MA 4HR7B 1A3TA 2KO3A 1UNSA 2LVPA 3BDOA 1B50A 1WJJA 2R2OA 4POFA 3PUZA 1VQBA 5KNDA 3Q3NC 4M02A 4CBVA 1EQRA 1IGCA 2IY0B 2KHSA 3U52E 4A3DB 4QY7A 4A3JB 4RKBA 2MBQA 4RGOS 3MJWA 3NE5B 5M3MB 1C1YB 4APVA 1MHHE 4JE3B 2D9UA 2ZM6Q 2JY6A 1OQYA 4NXNQ 2GVAA 4ICVA 2QW7A 2YEPF 3AV8A 4FXKC 3Q0AA 2XRSD 1L1OB 4K5XA 2W3RA 1WE6A 2RBMA 4DR4L 1R9TH 3RI7C 3PTFC 4WJOA 4DHJD 2K25A 2BW2A 4F7XA 2HIVA 5BO4B 1NCVA 2Z1CA 2KX0A 4ZK9B 1LLRD 4JI0Q 1AFPA 2MEKA 4MM3B 1X65A 4N8X1 3L0WB 1L2FA 3GTLB 2N7DA 2VZKD 2DNEA 4XXEA 2KUMA 3ZRCA 3PUWA 4GDLB 1S5FD 4M8MA 5E7NA 3URYA 4DUYQ 3IT6B 5H8YE 2PE6B 1D1KA 4HTHA 4DV7Q 1ZYRD 2VQEL 1C4PA 2C9WB 4BY7B 2X6LA 1G6ZA 1FXTB 2RR9A 5C4XH 3D4DA 3MFGA 4GN4B 3NEMA 4JI2L 2GVBA 3S2HB 3WIMA 1Q82C 2B39A 1L1OA 3HG9A 4XGAB 2RSNA 5FLMG 3FILB 3V2TA 3EBEA 5IA7A 3EFXD 3P63A 3KW5B 3DM1A 3QHTA 5LL6X 2E76C 1GG3A 3AEGB 3LDZE 4MM3A 3D6WA 2X69A 3D6CA 3OIQA 2DNCA 4NKLA 4YCVA 3ZLZA 4LWCA 3GOEA 4GDLA 2KAJA 2CH4A 1Y1VG 4W9GA 4K5WA 3AEBB 2D3CA 3U7DA 3FKIG 4FF3A 3TRZA 3LNNA 1SE9A 2F52A 1B44D 5IGCA 5CHFA 1Z5SB 1F2MA 1X32A 1U4AA 1NSNS 3PVLA 1E2WA 1SNOA 3K5OA 1L1OC 3JAMi 1HNXL 3L17A 1EOTA 1STNA 3M85A 4XTCS 2D0OA 3PIPA 2KWCA 1OO9B 4DXAB 4ID6A 3H91A 5IP9G 2KVZA 4KY5A 3PPAA 3EHVA 4JI3L 1TZ1A 3T1YQ 1PH6A 4OZBA 4LF5Q 3K80C 3GS2A 3EVQA 4YHHL 3GDEA 2WXHA 2IX3A 3L4PA 2PNRC 3BVGA 2NBFA 3NUCA 4ZCKA 3B2GA 1TWGB 2NPTB 2N88A 3IFDA 1SSOA 1U4MA 1XPUA 2FAZA 1A5RA 5CV5A 3FPUB 5IP7H 3R66C 2NN6I 3MFYA 2OEOA 4EGVA 2D3AA 1JWMD 4TRDA 1R9TB 3NK9A 5EKKA 3ONAB 1UBQA 4R9WA 1TY2A 3TS2A 4A93G 2AYOB 4BS9A 3Q24A 1J8IA 4KHPQ 2KCTA 2MJDA 3FPPA 1RIPA 2PZUA 4RMFA 4DR1L 2JZZA 2ZXOA 4RHSA 2MWSB 4B3RL 4UPAA 1FXIA 1PRTD 3EROA 3Q8BA 1I42A 4FF4A 5LXIB 3ND8A 1ZKHA 3C1FA 3CQZH 5BR8L 5I9PA 3B9JA 4DV2Q 1DOIA 4KKUA 2Z59B 4PS3A 1STAA 4HJ7A 1VQOA 3Q69A 3OJ3A 4GZYC 4DAYB 2LGXA 2K1BA 2ZJPA 2JEAI 1P3QU 1PYWD 4GOCA 4MGYE 3IAS1 4CO7A 2BE5C 2DLBA 3AEVA 3N32A 2F0KA 1VQNA 3L10B 2BA1A 4C3JB 3DWAA 4K7WA
chains in the Genus database with same CATH topology
2A68D 3C3LA 1ZP0B 3OSOA 4CKCA 4DXFA 2KEEA 3ZYYX 5C44B 2X6GA 1PTOH 1D5ZC 4WQMA 4HN7A 2O5IC 1FCCC 2J7ZA 3BZDB 2K03A 3V05A 4IKGA 1PMRA 2DN8A 4DAYA 4KTAA 1TS5A 3N9YC 1D6EC 5C5MA 3U7ZA 3QJYA 2XNAC 4BA1I 1CFMA 3PV0A 1TZOA 2KN4A 4IOIE 3VR2A 4DXGA 1ENAA 3MVVA 3RD4A 3FMCA 1FXAA 1C76A 1Z47A 3AMZA 4CJ2C 3PMFA 4NP5A 4KD3A 1TU2B 1C77A 4USAA 2PMVA 1T5EA 2K32A 3A7LA 1YQ4B 3DXJC 1NI3A 4ZHOA 1FCLA 1STGA 3J9CA 3D4RA 1PGBA 2EPBA 2WXOA 4PV1C 1NAPA 3A8JE 1V1OA 2PQEA 3CIRB 4GDKB 1JQ4A 2H89B 4DA2A 1TJEA 2LHDA 2MH7A 2V3NA 1JOKA 1D4BA 3QIAA 2H4OA 3S17B 1I4QA 2KCNA 4IDIA 5D14A 1A6XA 4WWMA 3VQIA 1GUWA 3ETRA 1SFOB 2WINB 1RDPD 5MPOA 4KY6A 1FFUA 2WXRA 3NVVA 2SDFA 2DYOA 4WRDA 4RF0A 2RMMA 4X3SA 2WACA 3IAYA 1LTID 2G9HD 3OOCA 4P6VF 2A74C 1BF4A 2CVRA 2K28A 1Q3LA 1I7HA 4IURA 1ZUD2 3PUVA 4L2YA 1S5CD 2DWQA 3NTKA 2F3VA 2XWBB 1GJXA 2BE5D 3RMHA 2WU2B 1DONA 2E74C 4PNYA 3M7GA 2WAQB 3ND9A 2Z4HA 5C0XH 3R2TA 1B4OA 5CR3A 3W5UB 2J52A 2PTLA 1QNKA 3AB5A 5DM73 2VUMB 1EWHA 2JSOA 3VA7A 2IWHA 2KOLA 1VZ8A 3NVYA 5KRUA 3HZXA 3HOUB 2O5JC 2RVLA 2R3ZA 1XEEA 4WIPA 3MA2B 1EEFD 2OHFA 4RFBA 2Q8RE 3K6OA 2L52A 4FF1A 3OHXC 2F0SA 2OF1A 1IW7C 3E56A 5COYA 3Q8EA 2NWGA 1XLPA 1MGSA 2WXJA 1DM0B 3M4OB 1R4PB 4KK7A 1O7YA 1TS3A 2CHBD 1GUGA 4QMGA 3GTQB 4DNTB 1QG7A 1VZ7A 2K9XA 5IGGA 4C3JG 3TSSA 4IZ8A 4PT5A 4PMWA 3TP7A 2NZ1D 1RHPA 1CI3M 2L5TA 2CW0D 5JEAH 5I6WA 3HOXB 2PPBC 3GP7A 3AE4B 1QCBD 1PZID 1GUTA 2FMCA 2KCCA 1U4RA 2QDBA 1H9MA 1PDXA 5EQ0A 5IT9E 5CBAE 1N5WA 3F2UA 3GQBA 4OGQC 3NP8A 3J80L 4FO2A 4RAUC 4FNFA 4TMAB 5BMIA 2SNSA 2NVTB 2HCCA 3BK2A 4XYOA 3HS0C 3AE3B 1FYCA 3M3YB 3PUYA 1SE2A 5CC4A 5EPLA 2EXZA 3HP3A 2EOTA 3P4SB 2KECA 2HCIA 4PQXA 1B53A 2X38A 1CHQD 3I9V1 4K8IA 1QQRA 3LWUA 3BG3A 3W1SA 2FE8A 1VDVA 2MJ3A 2WXIA 2HDMA 3J81E 1T3QA 1DCZA 1PUTA 1GPXA 1V8CA 1P7EA 1BQQT 1TWCB 3OWEB 1ZXHA 3AE8B 2PO4A 1KH0A 3NS1A 1PTOD 3CKIB 2KACA 1JORA 3PZ7A 1EFID 1AEXA 4J6HA 1VJKA 2XSCA 5ISRA 5C3XA 2L83A 2BCOA 5KNCA 1V1PB 1VR9A 3FC4A 3UI3A 5JVG3 1H9KA 4YTNB 2ID0A 1YNJD 4K5VA 4EQOA 4A55A 1D5XC 2ONQA 4JBWA 1FIQA 4H2AA 4KY7A 3HVDA 4HKQA 3KWVA 1B9RA 1KABA 4HMJA 2XVSA 5BYSA 1I4GA 2QIEB 3A56A 4K6DA 4UDUC 1ZDVA 1V1PA 1SNPA 2ZW1A 2VZKB 4EE2A 3NZ3A 4QIWB 5IODA 2CU3A 2TSSA 1ILPA 3SK6A 1QOBA 5BMGA 1FO4A 2TMPA 1BDOA 3IXSA 4OZCA 1C4QA 1CZGA 4A90A 3T3NA 2Y0SB 3U9SA 1Y8PB 4KD4A 1GUOA 1QILA 4B9XA 1OQRA 3VR5A 2JP1A 3MXPA 3Q6SA 1QF6A 1L4DB 5FLXL 1E0BA 4N9TA 2F3WA 4OO1G 5HHDG 3MXUA 1SBBB 3C8YA 1K8MA 2KVMA 2AX5A 3OMCA 3I3CA 2YU9B 1QWYA 4HMIA 2XIWA 1XLNA 3GTGB 2FUG1 1TY0A 5EKIA 3AE5B 2R6GA 1ZYRC 1KLGD 4KGSA 3JAME 1ENFA 4ITKA 2JYOA 2AWOA 2IGHA 2B2WA 3W2DA 4ABNA 2EKIA 4HJGE 4KGRA 1L6UA 1UWXA 3AM9A 3EJIA 5I2XA 1QLBB 4B9WA 2EYLA 2EYFA 2F0JA 2NB0A 3I57A 4LMQD 1PRTB 1Q8IA 3SHLA 4HAEA 2EY5A 1H9RA 2WP8J 3I70A 1XCTL 5K5PA 3SK5A 4KKSA 3QOJA 2L32A 5LL6S 2JA6B 3VR4A 4C7ZA 1CM9A 2N7JA 1N61A 4YTPB 3KQ4A 4WURA 2B2WC 4DF7A 4EVOA 1JR0D 5NUCA 3PO3B 4ZLTF 2D2CC 1KNAA 1SYEA 4BWGB 1L0VB 1WTPA 1HFNA 5C4JB 1DOXA 2L9HA 2GB1A 2BS3B 1MVKA 4RCOA 2J42A 2R93B 2LGIA 2R7ZB 4G7OC 1HA5A 1CHPD 4JPSA 1VCIA 3T16A 5IGBA 3FAHA 2H88B 2MJ8A 1V8QA 5A2QE 3PIP3 1YN5A 1BOSA 1PRTC 2E6XA 3NRZA 1SXTA 4IUTA 4K6LA 3RZOB 1NEKB 1B9NA 4QB4A 2VB3X 2Q5WD 5CYUA 1D2BA 1D1IA 1EZ8A 2FINB 2K05A 4FXCA 4XYQA 3BK1A 4R3DA 4RF1A 1BXTA 3HOWB 1QT9A 3KWLA 3GB1A 1N63A 1H9JA 1X3QA 3X3NA 4ZKCB 1FRRA 2E75C 3K58A 3BDCA 5K36G 1CJEA 3MAQA 1JWBD 4LLGM 2A68C 2JX5A 3K5MA 2IX1A 3PZ8A 1HQMC 4ZUJA 3P1HA 3ZQ4A 2D5DA 3PO2B 4CJ0B 3OWFA 4JX1C 4OHJA 1W6KA 2J0TD 1JCKB 3RFZB 2N9KA 2PYKA 1WYGA 5DM63 1EWCA 4HEA1 4C2MB 1QOHA 2XN9C 1EQTA 4FF2A 1AP0A 2ZT9C 1MHXA 5EJWA 3J7AF 1F2LA 4IUNA 3AEAB 1PFNA 1TVXA 1IBXA 1E6EB 3GD7A 4H0LC 1UEAB 4HCEA 2BA0A 1EYCA 4AS1A 1I6VC 2KMMA 2AQ3B 2PKOA 1PZKD 1SSNA 1CTMA 2B2VA 1EWYC 1I6HB 1C78A 1FNUA 1T6BX 4V0BA 1JALA 4DAVA 1VMCA 2QSDA 4TSSA 1C79A 1G2SA 3PIO3 1ML0D 2ZXRA 5CORA 1K8OA 5BMHA 2ENBA 4G7HC 1VF5C 1F77A 1RKNA 3SXHA 2JQRB 1YJJA 1EEID 3EQLC 2N0SB 2I07B 2B2VC 1YNND 1SNQA 1GOZA 4KHZA 1PDQA 5FKAC 1A3VA 4FP5D 3KLSX 2D5GA 4IUQA 2L55A 2JE6I 4OO1I 3I72A 1DOYA 4YSXB 3A8KE 1XF5L 2VNUD 1XXGA 2QKIC 4ZYSA 1Q12A 3MHBA 4M8AA 1WTOA 4HROA 2N55A 1L0XB 5C4XB 2QEJC 5IIFA 1F2RI 2EELA 1ET6A 2J53A 3VYUA 2QCPX 2M9VA 5TSSA 2SOBA 3CHBD 5IGDA 5KYIA 2I2YA 4CKEA 3HGBA 4JK1C 1BBXC 5E4XA 2B2YA 2K5WA 1VDZA 3LWEA 3CRLC 3SDZA 5C0XI 4ARCA 1TKGA 2QJLA 1GB1A 1XO3A 4L1BA 5IGEA 1HA6A 4N58A 3NSWA 5IGFA 4XWTA 5FK9C 2C9OA 4OL7A 3KK7A 1FMAD 5D65A 1OXVA 4EQNA 1EY9A 1IUEA 1AN8A 2WLBA 1JROA 2OEDA 2B2YC 1SNCA 1EU3A 1LTBD 1YN4A 1YJIA 1F9RA 2LFNA 4OW0A 2KQ3A 3TDQA 3TZUA 3FVQA 1EIHA 2WXMA 3FEWX 3I91A 3NUHB 3FRPB 1BUIC 4U68A 4RH6A 3DWPA 3AE7B 1SNDA 2OT2A 3CQZB 4RA8A 3N6RA 4DK0A 1MSHA 3BIID 2HQEA 4KKIA 1HTLD 2PIAA 5E1FA 1F9PA 2CW0C 2WB1B 3VYRA 1STBA 4GLSC 3S15B 3MEHA 1RFKA 3ZJUA 2EJMA 4A6QA 3DWMA 3P4RB 3S14B 1E2VA 5BN4A 4MN3A 4WORA 5KGUA 1AWDA 1IYVA 2MPMA 1WWTA 1PTOB 4ZQ3A 2M19A 5JPNC 3AE9B 2K33A 1VZ6A 3A54A 3HOVB 4KJNA 2A6EC 3PUXA 4LK0M 3ZJTA 2E3TA 2V3PA 3C1EA 5FO9B 3NTHA 3S16B 1HUMA 5CGKA 2NN6H 1CA5A 4IALA 2BBCA 1B2TA 3MTSA 3NBHA 1ZXIA 2WXFA 1DGJA 5J22A 1OXUA 3U4EG 1B1ZA 1RYJA 2O2LD 3J7YW 3A55A 4KHVA 1WTVA 2DYMA 3KF8A 4RKLA 4C7YA 4XWWA 2BS2B 2ZW0A 1TWHB 5KYLA 2SNMA 3HOZB 4A3GB 1DJRD 3FDTA 1PTOC 2F0PA 1B9MA 4DQOC 5C4ZA 3SR1A 1WTWA 2RDHA 1MI2A 2BB6A 1GAQB 2OXPA 1E0ZA 5E3FA 1G91A 3VR3A 1YNJC 2JYEA 1EL0A 1PFDA 2KQ4X 4XIGS 2IDYA 5M3FB 4M1UB 2SEBD 1K83B 2WNMA 4DFAA 2B63B 1FFVA 1LTRD 4CJ1B 3C46A 1WXQA 3P20A 3QOLA 2B8FA 4E6IA 4XQJA 3TP6A 3U9OA 5LHY1 4P16A 3MXGA 2M2LA 1E10A 5CV8A 2EYJA 1BO0A 4HCSA 5F2DA 3AMUA 1MBYA 4XDDA 2K5PA 1SYFA 4ZRZA 4KX6B 3H0GB 1C4AA 2FBWB 4US9A 5CMDA 5JXVA 2MUYA 1E2ZA 1HUNA 1G2TA 1WD1A 2LS01 2IGGA 5D7GA 4IFDH 2C5CA 5H92C 2PZTA 1HHVA 1I4HA 5E6JA 3S2DB 2DY8A 1SAPA 4IUVA 4LAAA 1EM7A 4X3TA 3T53B 3RUZA 1EY6A 3GTPB 2IL8A 2Z4IA 5I6YA 5JPMC 1RD9D 2B2UA 4XDCA 3DUZA 4A9AA 1EZ6A 5EBCA 3N52A 4CQNA 1TWAB 4WJWA 2EYMA 2F0EA 3H09A 2A6ED 2JYTA 2ICEC 1PGXA 5CV9A 5KIXA 1E7PB 4N9PA 1RJTA 1L0YB 4A3KB 1OXSC 1KAAA 2A6HD 3BS1A 4N59A 3HVZA 3OPOA 3RPFC 2PW5A 1VLBA 3SFEB 1ENCA 1BCPC 2AUJD 3TEXA 4OIKA 3D4WA 2B2UC 4U673 2IW3A 1RM6C 3T56B 1U9RA 1F2RC 1K51A 2W3SA 3VRAB 4ODGA 1DOLA 4BBSB 2BTEA 2L12A 5BN5A 1HCZA 4K2KA 1EY0A 1WTRA 2BDOA 3P7JA 3AE1B 5ELDA 2FFKB 1BNZA 1WCMB 4ME5A 4ZOHC 2YEPB 3NXWA 3CWIA 3T51B 2JEBI 2WIIB 5JOBA 5EGTA 1HFGA 3E9SA 3E6ZX 5E4WC 4N6EB 2M56B 1TT2A 1CZWA 1WTQA 1JB3A 2F0IA 3GV3A 1C9FA 3SEBA 4XT3B 2MP1A 3I90A 3I4NB 1YQ3B 2EJGC 3T13A 1ZE3D 4X3KA 5A2QL 5T1GA 2XWJB 1AZQA 4RNAA 2ON8A 3A8IE 3EGRA 4ZKBB 1K52A 3G6JB 3DWAA 1PXUA 1WD0A 2PCFB 5DAUA 3QO2A 1IHZA 3HOYB 2W82A 2F0GA 2F0VA 1DZ1A 2J4XA 1IKMA 2NVQB 2Y3AA 1ZXTA 4ZRQA 1G8ZD 3L7ZC 4BY1B 1L4ZB 2RKSA 3B2FA 2V0GA 3AEEB 5EPKA 2CJOA 1SEBD 2WXGA 2K5QA 2PMZB 3Q22A 3TEYA 3MP9A 2JA7B 1RF2D 2EDGA 2INNE 3NVWA 1KDAA 3RZDB 1QOFA 3HRZC 4Z9CB 2IGDA 3W5VB 3M7NA 2F4IA 1WRIA 1ESFA 1BCPD 3H3VC 2DBYA 3HRDD 1F9SA 2K0PA 1PLFA 4F8MA 4NAMA 1ROEA 4MACA 2F03A 1FGBD 4NDXA 4PMBA 1DOKA 4RWSC 4G57A 1I4RA 1SYGA 1HTPA 2I46A 5D3IB 1JW9D 1LT6D 3NVZA 3Q8CA 3VYSA 1SE3A 2NTTA 1OFFA 4MH8A 3BVZA 2EY6A 1RTNA 3P4PB 5C0XG 3VR8B 4CKBA 1HZ6A 1C48A 2LMCA 4Y7NB 2JWUA 3NQIA 4R8NA 3Q8FA 1HRJA 4IQZA 5C0XJ 2WXPA 3AN1A 3S1QB 2EJFC 4XT1B 1JWUD 1LTTD 5FO8B 2BOSA 5M5WB 1SDFA 1IGDA 1V97A 3SR6A 1NR2A 4AYBB 2HTME 3QWNA 3GTMB 1O7LA 1YNNC 3VR6A 1NVID 1JMLA 2RDGA 1TS4A 1AW7A 1MD2D 1JOQA 1ONLA 3P4QB 1Y8OB 1CT1D 5A35A 1OXTA 4ULLA 1KDBA 3OW7A 3U2SC 3G7LA 3V3XA 1OQQA 1Q1BA 2ACZB 3K5NA 3Q23A 1FNWA 4OVZA 4G7ZC 3R8BA 2ZXPA 1VRAB 2WXQA 2WXKA 1W6JA 2JA5B 1ILQA 4J1MA 5JEAG 5G3LF 1SYBA 2Q8IB 5DEHA 3LXFA 1R4QB 4WFN3 2RQXA 4DAPA 5EE3A 1F9QA 3HUIA 2F0TA 5JEAJ 3MHZA 3VRBB 3VR9B 2F0MA 3NWTA 4B0EA 3IKJA 1KRHA 3TMEA 5T1IA 1IBXB 2LY7A 5I4DA 1JWSD 3NBIA 2EY2A 1LT3D 3SVMA 2K04A 2AQ2B 1NENB 2BT6A 1TR5A 1H9SB 5HFYA 4A3IB 5ELEA 1C4CA 2Q8TA 3P1MA 1KDCA 1TQOA 3AU7A 1VMPA 1JICA 1U4LA 3AE6B 1FD6A 1L6VA 4KGTA 1R7SA 4O1NA 4LJZC 5C6AA 2M00A 3O13A 3S1MB 4KKTA 5C3WA 1Y69U 3R93A 3LYYA 1F2ZA 4FYDA 2GI9A 5EE0A 4WH4A 4NZLB 5J1ZA 2CQAA 1NYQA 4KI0A 1H9SA 3TN2A 3MJ5A 2HUGA 5FLXE 3V96A 1LTSD 3HKZB 4HRSA 1S4ZA 4CGYB 4JWSC 3DMUA 1SIJA 1KTKA 3DWGC 1GUSA 2IJ0A 4LK1C 2LUMA 4XDXA 4B08A 1QKZA 2WKDA 5KNBA 3KBGA 2G1EA 2H1EA 2NUCA 5I9OA 2WDVB 4QCLA 1WSPA 1A15A 1SJED 5CV6A 1KLUD 5HGTA 4Q0FA 1S5DD 5CBEE 1A2TA 4A8XC 3I4LA 2HDEA 3NPPA 1Z6HA 4L23A 1SMYD 5CV7A 4P2CB 2A5HA 3ZGZA 1G291 3CU7A 3FILA 4C1NI 1ACCA 3ABVB 3K5LA 3H8HA 5EPJA 5M9OA 3D3RA 4QUFA 5JJZA 2Z8LA 1KFYB 1MSGA 5ELCA 1IYUA 1XTCD 1XCQL 3I73A 3LX0A 1FEHA 3BVMA 1M8AA 1GHJA 2ICIA 1WTXA 4KJOA 4IN3A 5ELFA 4TKOB 1J7CA 1GUNA 2VXWA 2A69D 2PLPA 2V4DA 3AE2B 1DD2A 4YT0B 1XYIA 2EYOA 1JWAD 1II3A 2AQ1B 4TQ0A 1XX8A 1HEZE 4M0WA 2JU6X 4D2KA 3BYYB 1C8CA 4XQNA 4REZA 1LV9A 2PW9A 1SF0A 5HI1A 4DU9A 3Q8AA 4I7ZC 1L5PA 3I8ZA 2WQYB 2BB5A 3WOEA 4G4KA 4I65A 1BUVT 4YXDB 1PRTF 2NYZD 1GHKA 4UAIA 1STHA 2JA8B 3I4MB 5C2TB 3TZDA 2INPE 2WXNA 1SYCA 1FR3A 1S5BD 2QF7A 4HSVA 4L8JA 1CZPA 4FXDA 2F0OA 4YSZB 1ET9A 2L4NA 4IUUA 1DXMA 1O7ZA 3L3OC 4KV6A 1PZJD 4MIUA 3NWSA 4ZRPA 2L0CA 5IT9L 4BBRB 2KWDA 1JE4A 1RCVD 3KBXA 4IFDI 5C3EB 1XWEA 3TP8A 4FXGC 1Y56A 2FMMA 2BYTA 2KJXA 3ZJVA 1SE4A 5FR3A 1STYA 2IT1A 1I4PA 5J39A 2QILA 4YIJA 2WDQB 1TKEA 1O78A 1KF6B 1JC7A 3NHHA 3NQTA 1Q1EA 2FJ2A 1LTAD 4RGNA 5C5LA 4DNRB 4X3UA 1HXYD 4QUCA 1ZKOA 2E2JB 2B8GA 1AZPA 3W3AA 2N9LA 2WV6D 1TKWB 1GB4A 4FVMA 3BYTB 3KLRA 5GXGB 4DGZA 1UWMA 1A3UA 2F0FA 2A6HC 4WAFA 1K50A 4F87A 2L11A 1XLOA 4H13C 3J81L 4KKJA 3IAM1 1J7BA 4AQ7A 4ZUIA 1YMHE 3K7AB 5M5XB 1ICWA 4L63B 1EU4A 1M4VA 4OO1H 1TIID 4K14A 1EY5A 1F2YA 2F0LA 2MGSA 2RSOA 2KDMA 4KMUC 1WVLA 3OMGA 4TQUS 4Q5VA 1K53A 3TEWA 2MJEA 4K2LA 3K0YA 2PVGC 2JXTA 1B3AA 4O42A 1S5ED 2A73B 5AFWA 1FD7D 1Y8NB 4R8IA 2Y5PA 1I3QB 1CQVA 3MZ5A 3ITPA 4JWUC 1JRPA 1EY8A 5G5GA 1HZ5A 4C1NK 1EYDA 3J7AV 3MWYW 1P7FA 5AUIA 2B2TA 5HURA 4A3EB 2R61A 5FO7B 1N5XA 3IFTA 2RPVA 4LTUA 1LT4D 1LACA 4DK1A 2F0HA 1HQRD 3SFDB 1NYRA 4MT5A 3TEZA 1PFBA 1BCPB 1EQVA 3GO5A 1VF7A 3KUPA 2AUKA 1V43A 4ZHPA 2IPKD 3WDNA 5BYQA 3TBIB 4RHRA 1CA6A 1YNTE 2B2TC 4A3FB 1UAPA 1FM0D 1GXDC 1KNEA 1A70A 2HDLA 5EKLA 1PGAA 4H44C 1EY7A 4C3HB 4NW2A 1CK1A 2QMTA 1DOMA 1TS2A 1Z7TA 3HEJA 2DY7A 3R2IA 5CV4A 2LKVA 5DNFA 3D8GA 3GV6A 4PMCA 1YN3A 3KLSA 1N62A 1AYFA 2PW7A 4C80A 3MXNA 5EE9A 1SJHD 1UUPA 4KN7C 2LEKA 3JAML 3QB3A 3DWQA 3CRKC 2RDFA 5BN3A 5K36H 2E2IB 1QNUA 1MPEA 5EE1A 3GTJB 3S9WA 2O4XA 4BA2I 4OIJA 4ILWA 3R3OA 3WOFA 2YYZA 2JZPA 2KA7A 3M4YA 2W55A 5LNK1 2EY1A 4XE0A 2F0UA 3SK8A 1SYDA 3P42A 2WDRB 1UGJA 4Q2JA 5IOCA 1BR9A 2FHTA 3RLFA 4J3OD 4C3IB 2R92B 4KN4C 1SB3C 2PVOD 3DEPA 2XRQD 3ERQA 2GRIA 2EZVA 1I50B 3S1RB 2LJIA 3EUB2 1LO5D 2K22A 4ZAIA 1XLQA 2WU5B 3GTOB 3AEDB 1Q10A 2VB2X 3TP5A 3K59A 3AH7A 2KEDA 1PFMA 2F0WA 1X3PA 4HKZE 1O80A 2LHEA 2EVBA 2NVXB 2K3UA 2EE1A 5AUKA 2IX0A 1NUCA 2L1AA 4YSYB 3W9CB 3DEOA 2WS3B 1IW7D 2WKCA 2B76B 3K57A 3SE0A 1QOAA 5G5HA 3TUOA 3NTIA 1WGKA 4QF4A 5C3JB 4YWGG 4F88A 2GA4B 1LABA 1D5MC 3SK4A 1FRDA 2K6AA 1QOGA 1IKLA 2K7VA 2EYPA 2LFIA 1PTOF 4CHTB 3L9AX 5KEEA 5FOBB 4YTMB 4C56C 5C4HA 3E0JA 2F0NA 3P75A 1TWFB 2E2DC 2MHVA 1LT5D 3AECB 4L6TB 4RGTA 1CQFA 3AB9A 5T8IA 4EQPA 4ARIA 2K01A 1EYAA 1RODA 4NAWB 3WCQA 3C2PA 4MHEA 1STEA 4RGMA 4V190 1Y1VB 2BS4B 4K8JA 3E5SA 3A7AB 3FKIB 4RCNA 2LMCB 2K5DA 2NN6G 2WP9B 2F0DA 3OIPA 2V4IB 1TKYA 5ELBA 3DHQA 3VA5A 1F0ZA 1T5XD 1J7AA 1Q90A 1A2UA 3T4AC 1E9MA 1JOOA 2L1BA 4NMZA 4TQ1A 5JVH3 3D31A 1TYGB 4C3HG 2WXLA 3J80E 4H7BA 2BDNA 1EIGA 1QE6A 3GTKB 3VYTA 4IUPA 1BMLC 4A93B 3QG1A 1HPCA 1N60A 2D62A 1J9OA 1ESRA 1FNVA 2F1MA 4DN4M 1LTGD 1RWSA 1ZOYB 1ZPSA 1BCPF 2NMQA 2PZWA 2I38A 2F0QA 2NVYB 1IL8A 3LB8C 1U4PA 3IL8A 5D3DA 2M0AA 2EYHA 1EY4A 5G3LD 3S1NB 3T3OA 3BDLA 1JQYD 4HSPA 1SMYC 4A3MB 4A3BB 1MI0A 4HEDA 1Y1WB 4C3IG 5HG2A 3IT4B 3UI2A 1QJOA 3H94A 2Y5CA 1SNMA 2E2HB 3MC0B 1ZEQX 3EA6A 4IFDG 1QB5D 5EBDA 4US8A 3PO0A 1DYQA 2JSVX 5BYRA 2A69C 1I4XA 2NTSA 2RA4A 5M5YB 3BWUD 5JAVA 4OZAA 3AEFB 3X3MA 4XQQA 4IFDJ 2CJNA 1NR4A 2G9DA 4S3SA 3H6MA 1ZDXA 1OXXK 2AWNA 2W54A 2JXMB 1RTOA 2SAKA 4J8QA 4NJCA 4B0MA 4HR7B 1A3TA 1UNSA 3BDOA 1B50A 3PUZA 5KNDA 4CBVA 1IGCA 2KHSA 3U52E 4A3DB 4A3JB 4RKBA 4RGOS 3NE5B 5M3MB 1MHHE 4JE3B 2D9UA 2YEPF 3AV8A 4FXKC 3Q0AA 2XRSD 4K5XA 2W3RA 2RBMA 2BW2A 4F7XA 1NCVA 2Z1CA 4ZK9B 1LLRD 1AFPA 4MM3B 2MEKA 3GTLB 2VZKD 2DNEA 4XXEA 2KUMA 3PUWA 4GDLB 1S5FD 3URYA 3IT6B 5H8YE 1D1KA 4HTHA 1ZYRD 1C4PA 4BY7B 2X6LA 1G6ZA 3D4DA 3MFGA 3S2HB 2B39A 3HG9A 2RSNA 3FILB 3V2TA 3EFXD 3P63A 3DM1A 5LL6X 2E76C 3AEGB 3D6WA 2X69A 3D6CA 3OIQA 2DNCA 4NKLA 2KAJA 4K5WA 3AEBB 4FF3A 3LNNA 1B44D 5IGCA 1F2MA 1X32A 1NSNS 1E2WA 1SNOA