3URYA

Crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
INPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Exotoxin
total genus 52
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3uryA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3uryA01
1PYWD 1LTTD 5TSSA 1SJHD 1TY0A 4Z9CB 1LLRD 4UDUC 1UNSA 1LTAD 1FNWA 3GP7A 1PRTB 5ELFA 1V1OA 1HXYD 4L6TB 1PRTF 3R8BA 1SE4A 1DJRD 1S5DD 1SXTA 5D3DA 5FK9C 1B44D 1PTOF 1JQYD 1TS4A 3EFXD 1YN4A 1LT5D 5ELCA 2AQ3B 2G9HD 1PZJD 1LTBD 1LT4D 5FKAC 5I4DA 2WV6D 1BCPD 1D5ZC 1EU3A 4BWGB 4RGMA 1ENFA 5ELBA 1RCVD 3CHBD 2RDGA 1CHPD 2TSSA 1PRTC 3R2TA 4L63B 1L0XB 1PZKD 3KLSX 4RGNA 1F77A 2IPKD 2XN9C 2XRQD 1FGBD 1RDPD 1TY2A 1I4HA 1XTCD 1BXTA 1CQVA 1KTKA 1SE3A 4RGTA 1JWSD 1BCPC 1AN8A 1MD2D 5D3IB 1B1ZA 2NTSA 4RGOS 1JWUD 1LTSD 4NZLB 1PZID 1ET6A 1M4VA 3OWEB 1KLGD 1AW7A 1JR0D 1I4QA 1CK1A 1FNVA 1SEBD 1FNUA 4TSSA 1HA5A 1EWCA 1ESFA 1LT3D 1EFID 3R2IA 2Z8LA 1JCKB 1UUPA 3W2DA 1L0YB 1STEA 2J4XA 2NTTA 1QILA 2SEBD 1PRTD 2AQ2B 2RDHA 4RHSA 1LT6D 1RF2D 4RFBA 1T5XD 1PTOH 1PTOD 3SEBA 1SE2A 1LO5D 1I4GA 1DYQA 5ELEA 1YN5A 1D6EC 2IJ0A 4DXFA 1LTGD 1BCPF 1EEFD 1S5ED 1BCPB 1TS3A 2QEJC 3BVZA 2AQ1B 1YN3A 1I4XA 1CHQD 3MC0B 1V1PA 1ET9A 4O1NA 1PTOC 3V05A 1HTLD 3DWPA 3BYTB 1G8ZD 3MFGA 1HQRD 4RH6A 1EEID 1SBBB 4RCOA 4ZYSA 1S5CD 2CHBD 3O13A 1GOZA 1KLUD 4C56C 1XXGA 4DXGA 2O2LD 1EU4A 3DWAA 3TSSA 3BYYB 1LTID 4OHJA 1D5XC 3BVMA 5ELDA 3URYA 1FD7D 1S5FD 1TS5A 3BZDB 4RHRA 1PTOB 4K6LA 3DWQA 1I4PA 3BVGA 1JWMD 2QILA 1CT1D 2XNAC 2XRSD 2ICIA 1I4RA 1SJED 2R61A 1TS2A 3EA6A 1RD9D 1LTRD 1S5BD 1V1PB 1D5MC
chains in the Genus database with same CATH superfamily
1Q8KA 3DBHI 2N78A 2Y0SE 2R7ZB 5AUIA 3TBLD 4ME5A 3S17H 1SJHD 4Q0FA 3KUDB 3S16B 1E8YA 1CA5A 1GKHA 1LTAD 3OWFA 3K6OA 3NRZA 4NAMA 3U9SA 2K5PA 1WGHA 1IBKL 1L6UA 2BBCA 3DVGX 3HOYH 3BY4B 2G4SA 3DUZA 4X3SA 2KDBA 4KHVA 1IYFA 1JQYD 2EYFA 2KCCA 2NN6H 1PH3A 3W5VB 4XDDA 4L8JA 3RD4A 5C4XB 3GTGH 3K5NA 2UXBQ 3NVZA 2R6GA 2IGDA 1EWIA 4ILWA 2L1AA 3CRKC 4IFDG 3HOUH 1P3QU 2DENB 3M9BA 4JV5Q 3TRZA 1IL8A 5C4JH 4MH8A 1Q1BA 4G50A 4CDCC 2G1EA 2JRIB 3L08A 4N8FA 5IOCA 2K5NA 1JOKA 3A4SC 1A62A 5GAGC 4A3CH 2R2QA 4W9HA 1NMFA 2OCEA 3VR4A 4HJAA 4IM2A 2WP9B 4AOFA 4TQUS 4C2MB 2VUMB 3FKIB 1D8LA 5CGKA 4L23A 3S14H 3I56A 3J9CA 1PZID 1PXUA 2RCNA 2PMZE 2BB6A 1L2FA 2ZTCA 1F52A 5J3BA 2K4KA 1DZ1A 1TZOA 2V0GA 3PQIA 2CQAA 3AU4A 1OXXK 4PS8A 2Q8RE 3A54A 3C19A 3ZNID 3U9OA 3ITPA 3ND8A 3CSFA 5DPRA 5E6JA 4LF9L 4MTNA 5D7GA 1PDXA 3RPFC 3SK4A 3K5MA 1VDZA 5IP7G 3RZOH 5BMIA 4AIMA 3AN1A 1PTOD 5IGCA 4WJ4A 3PTFC 3I4MH 3NUHB 4J6IA 3Q8BA 3H91A 3NTKA 2PJHA 4HVBA 2WNMA 5C1ZA 5IT9L 2JA6H 5A2QE 5EE9A 4FXGC 2J52A 2LMCB 5J2RA 2B2UA 3T3NA 1WFYA 2JA9A 1XF5L 1U4LA 2V1CC 5IYBG 4JBKA 2M19A 1GHJA 2JZPA 1KAWA 2EXZA 4HMJA 1TYGB 4HJGE 4HPLB 3IVFA 1Q46A 3MXGA 3W1BA 4P2CB 2UXCQ 1HH2P 1Q81C 3M63B 2CKZB 4DFAA 1YJNA 3N9YC 2LY7A 2BF8B 3T9LA 4P7IA 3CCSA 5KYIA 3J80L 2XSCA 1N32L 2JF5A 3VTUA 2KKCA 2OHFA 2A69D 4UHVA 4LJPB 2IWHA 1J9OA 4E3CA 1ZKOA 2TMPA 2VQEL 1SYDA 2BTEA 3DLLA 3VUYA 1LM8B 1QG7A 3AMUA 3HOXH 1CT1D 1I4RA 2F4IA 2DJFC 2XWBB 1VQKA 1DOIA 4A3FH 1C4PA 1XWEA 5AJ3L 3PF5A 2VH1A 2BA1A 4IFDH 4P72A 1WXQA 3WWVA 5CMDA 3L9AX 4HR7B 1TY0A 1WYGA 2UXDL 2LXJA 1K8RB 4HTHA 1VQIA 1D4BA 1IBML 1B3AA 2Z6KA 5ELFA 2F0HA 3M3JA 1S1QB 2HQEA 2Q2HA 1NYRA 1WMHA 1MPEA 4JWUC 1CKNA 3M85A 4CJ1B 3GTQB 2RQXA 1R7SA 3T1HL 4GKJQ 2D11A 4A3BH 2MEKA 3C3LA 2C5CA 2HCCA 1CKNB 2JA5H 1SLJA 2DJGC 2KNBA 4X57B 4CDDC 2L00B 5D6JB 1SMYC 3CHBD 1D1KA 1C7YA 4A3KH 2KFJA 5BMHA 1ZYRD 4DR3L 1KF6B 3RMHA 2Y5PA 3KLSX 2HDMA 4B3RL 4LJZC 2DLBA 2NZHA 1SFOB 2BS4B 3PPAA 4W9DA 5GXGB 4KI0A 2E2JH 4MGIE 2ZXPA 2WYQA 5JJIA 3DBSA 1OXTA 3BINA 2OEOA 2B8GA 3MJWA 5C44G 1JE5A 2Q2IA 1TVXA 4R8NA 1EIGA 3S2HB 1JWSD 4C2MH 2VUMH 1LACA 2E8GA 1BCPC 2JX5A 3I4MG 2KOXA 3UGBB 1L1OC 4GNXB 5EE0A 1KM7A 1VZ8A 4WJ3M 3RFZB 5FO9B 2PEAA 4J1MA 5M5WH 2FXQA 3RZFA 2WHIA 3NPPA 3A1QB 1B3QA 5AJ3Q 3J7AF 2J0JA 4IDIA 3KWLA 1V9PA 4KLKA 4NJ7A 1SEBD 3Q3JA 1C9OA 2BB5A 3PLVA 4NNJB 2KTFA 1HNWL 2NZ1D 1IZ6A 1HPCA 5A35A 3CCQA 1JQ4A 1A2UA 2R7FA 4HWIB 5FLMG 4DDID 2J4XA 4KGSA 1K83H 4LAAA 2MNAA 4KGTA 2I1JA 2JWZA 3K0YA 1R4QB 1V9JA 1W6JA 1PTOH 3SR1A 1RFAA 1STNA 5J39A 1WF9A 1SE2A 2QDBA 1HRJA 5BMGA 2JA7B 2EZVA 1R4NB 2V3PA 2INCC 1V6EA 3CP0A 3A7AB 3PGZA 1E2ZA 2HDLA 4DAMA 5LMNW 2E75C 2AQ1B 4UP7A 1H95A 1WX8A 2D0PA 1BQQT 2QA4A 2Z59B 3L7ZC 3HOXG 1FMAD 4XQNA 1Q1OA 4GDKB 2F0TA 2PCFB 3HGBA 3JAME 4OW0A 3X3NA 5G2NA 3GZNB 4C3JH 4A3FG 1VCIA 2EY6A 2GBNA 2QDLA 2D5DA 3LGJA 3A9JA 2W55A 3NVYA 3RLNA 3N30A 4MJSA 4PV1C 1W2BA 3GTOB 1D5XC 1AYFA 4HJ5A 3NEMA 2C5LC 3AEBB 3KUCB 3HP3A 1HZ9A 1LXDA 3BIID 1FD7D 4LK1C 1F2LA 1S5FD 2DNFA 2BT6A 3DWMA 1O80A 4QMGA 1J7AA 4JLCA 2L7RA 1VQAA 2KK8A 2L05A 1QT9A 5JVG3 2DHZA 2KTRB 4A3BG 1Q3LA 4LFBQ 5FOBB 3L2PA 4LF8L 3M4OH 3SXHA 4AQYQ 1YMHE 3ECIA 1I3QB 5LL6S 1VMPA 5KIXA 4U68A 1FO4A 3P75A 1YNXA 1C1YB 5GQOA 2RMMA 3D0FA 2JT4B 4IUPA 3QB3A 4IKGA 4EQ5A 2JSOA 4C00A 2A6HD 1FM0D 1VQEA 2JA7H 3UINB 1SE4A 3ZTCA 2WP8J 1EYAA 2NR2A 3PZ7A 2F0LA 2ZW0A 2DAJA 4WWOA 2PZWA 3CF5A 1E24A 1P7EA 3J81c 1GUWA 2L4NA 2WINB 4EVOA 2VUMG 4BS9A 1LTBD 3CCLA 2HDEA 2H5XA 4LF6Q 4AYBE 1TR5A 5E6NA 1Z47A 2F0FA 1EZ8A 3L0WB 5CX3A 1YZ6A 4XZ4A 1WGRA 1SNMA 2G45B 5HGTA 4OL7A 4W9IA 4CKEA 4U673 1YEZA 4G11A 2EE1A 2ZM6L 5LNK1 4A3GB 3L17A 2JA8B 3PV1A 2K6QA 4RGNA 4GN5A 2DN8A 3D3RA 4I6PA 4DR2L 3AFQA 3W9CB 1HFGA 2M9VA 3I4NB 1XD3B 4AUQC 1FXTB 4FF3A 1B9MA 3D8GA 4F1SA 3Q8CA 2WFWA 3R3MA 3MEFA 3T1YQ 1JWUD 4R3DA 1VD2A 4CYEA 4BKSA 2N55A 3ENEA 1VRAB 4GDLB 5CR3A 1PLFA 2CCZA 2N88A 2MA9B 1OQYA 2MO1A 3EFUA 4DAYB 2PZTA 2WLBA 3AE2B 4Y7NH 4QCLA 1FL0A 3Q8EA 3KYHC 3IAS1 4HDQA 3RZDH 3VA5A 5C3WA 3AULA 2OTLA 2R93G 1U0LA 3CC4A 2MPMA 1SSNA 3WAMA 2DY7A 1NMGA 3Q22A 2WX1A 1GHKA 2JQOA 1HHVA 1EM7A 3UF8A 1WVLA 3VUWA 4A90A 1KABA 5FO8B 1EY5A 3S1QH 1QOBA 4S17A 1P9DU 3A56A 3MHBA 5EBCA 3CCRA 2ZJQA 1BUIC 1YN3A 2QMTA 5C3EB 1DONA 2QCZA 2K8CA 3M3YB 1X3EA 1T0YA 4S0RA 1XLQA 4JWSC 4ZQ3A 3KVFB 3OAWA 4C80A 2A73B 1TKWB 3DWPA 1GM5A 1DOMA 4FA6A 4ZHOA 2LI5A 3P1HA 2DYOA 3TIXA 2WAQG 5LHY1 2OWOA 3P7JA 1VQDA 5BO4B 2G9DA 4DR6Q 4WAAA 1N36Q 3W1GA 1IXRA 5M3MG 2OJWA 1UWXA 3A8IE 1WXVA 2CFMA 3NP8A 2WAQE 4C3HB 3E9SA 4N58A 4A3OA 3DBLB 3C1EA 3CMMB 2EJFC 3I8ZA 2F1MA 1Y8RC 5C4JB 2JA7G 1C77A 1HZ6A 1GB4A 2W54A 1GPXA 4NKLA 4JPBW 2LWPA 3PO3B 4K5XA 3I4OA 2I2YA 3DWQA 5AFWA 3OTOL 1J7CA 2ASQA 3H0GG 3D6CA 2FNJB 4LDTD 2DYBA 2VNUD 1JWMD 2VY3A 1WJ6A 1A3UA 2L0CA 4KD4A 1EF5A 5GADC 3I63C 2VB3X 3HOZG 2JSVX 3U7DA 2RKSA 1ASZA 2VZKD 3CCMA 3MC9A 1LFDA 3STBD 4EZLA 5E4XA 3WA0A 1E1TA 2NVXB 2VQFQ 5IGGA 1JWAD 3RNUA 2N7JA 2N7DA 4K3BA 2E2DC 4ANWA 4GOPA 4IURA 3IFWB 1LUZA 1S5DD 1SXTA 4G7HC 4BKGA 1IBXB 2PYKA 3EFXD 4YWKA 3ER0A 3GB1A 3X3MA 1VCBA 3SFEB 1MSHA 1SE9A 1H8CA 5JPMC 1Y56A 4HCNB 4A93G 2AL6A 4BWGB 1HZ5A 2LGIA 2EYMA 1XPUA 1VQPA 1YNJC 3AE6B 2KX3A 1YIWA 5T8IA 1T0SC 2KHSA 3QQ8B 4AQ7A 1RJTA 4YHHQ 4H13C 1LABA 4QQBX 2K6AA 2PZUA 2JA5B 1SNOA 1OXSC 1V43A 1QQRA 1K8MA 5J1ZA 2KEDA 1TGZB 1MG8A 2FFKB 2FUG1 3QO2A 2KDFB 2QCPX 3NELA 2I07B 4LF5Q 4M8AA 2PI2E 1YJWA 2E2IB 4RMFA 4DK6C 1IP9A 3ABVB 2NYZD 4K2LA 3KLSA 2E2JB 4PT5A 1KHIA 4IUMB 4NAWA 4BY7H 4NZLB 4WJWA 1HR0Q 2F0EA 1UZXB 2F0SA 2D62A 1JR0D 5EE3A 3P4RB 3J81E 4A3JB 3K7AB 5A2QL 4KN7C 5LL6X 1XMOQ 1SNQA 2UUBL 4OWXB 5M5XH 4M1UB 1PDQA 1WZ0A 1IBMQ 1K28A 3M7GA 2EKIA 3BK2A 3Q6BA 3PREA 4A8XC 5I9OA 2BQQA 4FJVB 3AE9B 1ILPA 2JXMB 2I5MX 1ZYRC 2SEBD 4WORA 3P4SB 4FDBA 1C9FA 2FUHB 2V3NA 2E2HH 3BJUA 2JZZA 3M62B 2MJEA 3L16A 2LFNA 4P1CC 3CD6A 1KC8C 4GXBA 3ZTDA 2A6HC 3FPPA 1VZ7A 1KRHA 5IKCM 2L76A 3ND9A 2VXWA 2MBHA 2L12A 4R4QA 4DXFA 5C0XG 2QEJC 1S5ED 1TS3A 1U9RA 5DM63 4LF5L 3GTKB 3A4RA 3S2HH 1QE6A 5C5LA 1TIFA 3HHMA 1I4XA 4LNIA 3BZKA 2Q2UA 3FPUB 2AHOB 2NBVB 3RNAC 3V05A 2F0OA 4FVMA 3RLFA 1NCVA 1GC6A 1B9RA 4DNRB 1TU2B 2D9UA 1SBBB 1J7BA 2GRIA 2A4ZA 2CH4A 2K8HA 5G5HA 3ZO5B 1PMRA 5AEKB 1YNTE 4MACA 4KKUA 1XQQA 1OEYJ 3BYYB 3U4VA 2PW7A 2LGXA 3K81C 5M3FB 3HKZG 1MJEA 2L8JA 3P4QB 2SNMA 3B6YA 4JI3Q 1UAPA 1HR0L 4W9EA 1X55A 3S1RB 1QWYA 2PQAB 2WXIA 3CW2C 3PIPA 2ZJDA 1GD7A 2K14A 1WTQA 1RD9D 3E6ZX 1H9RA 1S5BD 1SYBA 4ANVA 1IGDA 1JC7A 2C7NB 1O7YA 3APFA 2CJOA 3O65B 3MHSD 2V1YA 4X3TA 3GTMB 2MLBA 3CPWA 5TSSA 2WXMA 4ZHPA 2NVQH 4L5TA 2KWCA 3Q8AA 4IC7B 4IWQA 1TKEA 4LTUA 4US8A 3D4WA 1PRTB 4AH6A 1I6HH 4QIWB 3TP5A 3DPDA 1PGXA 1PRTF 3V96A 4K81A 1BBXC 4TMAB 3DHQA 5CV5A 4I65A 3B0AA 3FKIG 3FHWA 3K9OB 5BYQA 5CHVC 2Y5CA 3I2ZA 1TJEA 3VA7A 2BYEA 3V61A 1A2TA 2YTYA 1VQOA 1J6QA 1JWBD 4II2B 5CHFA 3JYUA 1EO6A 4XQJA 2OXPA 4A55A 1CHPD 3MTSA 4UP9A 4IM3A 3L54A 3PLUA 2GN5A 3A5ZB 4C7YA 5IGDA 1I50H 3K8AA 4XYQA 3DVNU 3WAOA 1ZUD2 4IUTA 4HCPB 4C3JB 1VQNA 3HUIA 2WXHA 3ML8A 3ZRFA 4C4VB 1WTXA 2FBWB 1QUQA 2GA4B 3K58A 4XGAB 1NBWA 3D6WA 5D3IB 4HJKA 3QIAA 5C4ZA 1XPRA 1FRDA 1FEHA 2JN4A 1SB3C 4L1BA 1ZE3D 5C0XH 1P7FA 3AU7A 4LFBL 3U4ZA 1IUEA 4B95A 2M8SA 4MT5A 2WGSA 2BE5D 3E5SA 1STHA 2B2YC 3BDLA 3F2UA 4A3KG 2VS1A 3KBGA 2DYMA 3HFZB 2J0MA 5C2TB 2VZKB 4MJSB 1KAAA 2I5LX 4HIDA 2N9XA 3H1UA 4ASWC 1WCMB 2EYOA 4KMUC 3ZXVA 3PO2B 3AB5A 1HA6A 1Z7TA 1LQBA 1B8AA 4MGYE 1IW7D 3QHTA 1J0GA 1JOQA 3GTPH 3PSEB 1D3ZA 2MHVA 1D6EC 2IJ0A 4EGVA 1VQCA 2QKIC 2DUDA 4BOZB 1WI5A 3DOWA 2KBNA 4M0WA 4ZUIA 1W6KA 1SIFA 1TWAH 3GV3A 3C0RB 4EOYA 1ET9A 1F1HA 1R9TH 3PO0A 1K3BC 1YVCA 4JI8Q 1MSGA 1GNUA 2ZM6Q 2K03A 3DHIC 3UQBA 5FLMH 1JALA 1QNUA 1KOTA 1RIPA 1DCZA 3Q69A 1VQHA 3U50C 4DF7A 3I4NG 4GLXA 3S1MH 2WDVB 4C56C 1XXGA 1E6EB 2D07B 3P4PB 3I55A 4LFAQ 1E5WA 4NXMQ 1BVSA 4HSPA 5CBEE 4FO2A 3T1YL 2GBRA 3MWYW 4G7ZC 5I6WA 1WR1A 1YX6B 3AE5B 1GUSA 3JVZX 3QIJA 1CA6A 2O2VB 3A0JA 2RSOA 1CJEA 2LUEA 3HM6X 1CZWA 1TWCH 2O4XA 1YHBA 4IFDJ 2M56B 5KHQA 2AL3A 4DDGD 5C6AA 3G71A 2Z4HA 1N8RC 4KGRA 1W3SA 2KA7A 2DZIA 1QOFA 1A0IA 4DR1L 1XT9B 1ASYA 5M5YH 2ON8A 3TZDA 1DOLA 1D5MC 5M5WB 1EY4A 2K28A 2ZPNA 1RODA 1SIJA 3VXWA 4KHPL 2GBMA 5C0XI 1NI2A 5JJZA 2NVQB 3ZJTA 1I42A 5NUCA 1E8WA 5GMVA 5BN3A 1SAPA 4WRDA 2JA6B 2IY5B 2KCNA 1YHQA 1TQOA 4H02A 1STGA 2ZZPB 4Q5VA 3W1SC 1NDDA 3W5UB 3F2DA 1PV4A 1B44D 1PTOF 2EY5A 3KF6A 3QOJA 2MHJA 5I4DA 4KJNA 2E5LQ 3AI5A 3NS8A 4DHZB 5DPWA 2JJQA 4GKKQ 3PRZA 1Y1WB 2KVRA 1QVCA 2VB2X 1GUNA 3H09A 1PQSA 3R2TA 1PRTC 4EUTA 2PPBC 3N52A 4MIUA 1GB1A 4GU2A 1MHWC 2QGQA 4PMBA 2YYZA 5E7NA 2XN9C 2F0NA 3OPOA 1N6ZA 1WRDB 2I5HA 4QJFA 1F2RI 2JVCA 4DKAC 3PRPB 4NQLB 5FLXc 1J8CA 3I5JC 1SYEA 4A76A 2O5JC 2Q2TA 4WAFA 3U4EG 3H3VI 2VRRB 2PO4A 2KLGA 2WS3B 3B2GA 3IXSA 5CHWA 2BCOA 4DHJD 4RGOS 3RT3B 2ENBA 5AZFA 4IALA 1NVID 3VH3B 1U4MA 1JMCA 3VYRA 1WSPA 2AYOB 1VF5C 2HIVA 1ROEA 3CIRB 3KUZA 2F4VQ 4IWOA 4JI0Q 1JJGA 1ZP0B 2NPTB 1NBFC 4HEA1 2IBIB 2LXKA 4FXKC 1KNAA 2J0KA 2WXPA 1UUPA 3P2BA 1PFDA 4EQOA 4LNOA 2VQFL 3FILA 1TWFB 2UU7A 2I1KA 4H0LC 4HJ9A 4GN1A 4YTNB 1R4MB 3WIMA 2RDHA 4YWGG 2MX2A 4KY6A 3H9DA 1M94A 1YX5B 1T6BX 2Z0DB 1V81A 3TEYA 1SYCA 4J8QA 1VR9A 2WXJA 4JC0A 4A3DH 2KAJA 2OQ0A 3WALA 4G57A 3QARA 4XE0A 5KEEA 1VS0A 1WX7A 4OO1H 5L95C 3TQYA 2QSDA 3MEHA 2F0IA 2XTIA 1K0SA 2K7VA 3KK7A 1WGYA 2BH2A 2BS2B 1H4RA 2KJRA 1PTOC 1GUOA 3N32A 2QW7A 1NYQA 3AEAB 4HAEA 4LNQA 2N7EA 3I91A 3CCJA 4K3CA 4POFA 2R93H 3DXJC 4DU9A 3GS2A 4DK5A 5EDSA 4DUZQ 2PQAA 4AJYB 4JI0L 1OQRA 2L1BA 1KLUD 2Z4IA 2HUGA 4DXGA 2RHQB 2BDOA 1LTID 2C35B 4TKOB 2ZEQA 2B63B 2UWQA 3BK1A 4LNKA 3RN9C 3NTIA 1ZEQX 3VRAB 4IZ8A 1JMLA 2WACA 3UDXA 4IUNA 3BZDB 3B2FA 1STYA 3NVVA 4OIJA 4HPPA 1SNDA 3M4PA 2B39A 2HTHA 1MI2A 1F9PA 1N9WA 2R92B 2WXRA 3TN2A 5K36G 3PIP3 4H44C 2NB0A 4FNFA 2Z0EB 2B2VC 4B08A 3HOWB 5C23A 1X9NA 3Q14C 3DCGA 3T8MA 2E76C 3G6JB 4XIGS 3JSVA 2EYHA 1LLRD 1WTVA 2MP1A 1XLNA 2LRWA 3FC4A 1ENAA 1S4ZA 2RR9A 5IT9c 2RD0A 2WXOA 3AE4B 3HKSA 3PS6A 5E6PA 4TV3A 2HD3A 5CBAE 2MWSB 4C1NK 4EQPA 3GTMH 3V62A 4PG3A 2B2WA 4KIKB 4BBSH 2A6ED 4FN2A 1YN4A 4KKSA 3N1ZC 3H0GH 5JEAH 4LW1A 5FKAC 4DR7L 2LHDA 4A3JG 2WV6D 3GOEA 4ID6A 1EU3A 4J3OD 2IO2B 4HK2A 4DAVA 5L83A 4GN4B 4K0KL 4PYZA 4OO1I 2L83A 1G6PA 1JW9D 3SK5A 2Y5BB 3AV8A 1PZKD 2QEXA 1HE8A 3IT4B 4PQXA 4ANUA 3NWTA 1I94Q 4P6VF 3RN5A 1RDPD 1WOCA 4B3ML 2FCNA 3VR3A 1N36L 4IOCA 5IODA 3J7AV 2K1BA 5JJLA 2LXCA 2MQJA 4KDLB 1CQVA 5BN4A 1CKOA 1OO9B 4HMIA 1GUAB 3DWGC 4A3DG 1B1ZA 2AUKA 4HRSA 2K5WA 3NJTA 1VJKA 4P73A 5IP4D 1EWHA 1LTSD 2EPBA 4RKBA 3WOEA 1CMXB 4HROA 3IL8A 4OO1G 4B3TL 3VVWB 2IY1B 1GVPA 1NE3A 1S72A 5H92C 4GSWA 1EWYC 2K3UA 4B9XA 5CC4A 1II3A 2KFKA 1FFVA 1N5WA 3RNEC 3NHEB 1CKMA 1TIID 1L7YA 2JK8A 2WIIB 3H3VH 5IO9A 3K57A 3KLRA 4A3BB 2AX5A 1Q1EA 2HE7A 3S1NB 5JHAA 2KT7A 1A8VA 1B7YB 4W9KA 3CC2A 2PI2A 1PH1A 4B0MA 4BY7G 3RULA 2MH7A 3BU2A 1KNEA 4CDEC 4YT0B 4HKQA 1Y8PB 4JW0A 5CV8A 4ZUJA 1ISNA 2PVOD 3SVMA 2KJXA 4O1NA 4WURA 4DBGA 4C1NI 2BH8A 4KKTA 4GKKL 4IOAA 1C0AA 4IWPA 3PIO3 1FGUA 4A3IB 5F2DA 4KHZA 1HJPA 1R4PB 1MKHA 1C79A 3TMEA 2F0VA 4ZYSA 1I94L 3OJ4B 1S5CD 1R9TB 4WJNA 2DNCA 5EKLA 5AZHA 1TT5B 2WB1E 4ZCKA 3BDOA 2KJHB 1HCZA 4R8IA 2PQEA 2K32A 3ZDTA 4IW0A 3V6EB 2LRUA 2F3WA 1IW7C 1GXDC 3HOWG 5AUKA 3QG1A 4EE2A 1EY8A 3NG0A 4YIJA 1PYBA 4RCNA 5C44B 5IYDH 1MI0A 1N61A 1UF0A 2XNAC 4DR7Q 2H1EA 3GE8C 2R61A 1SGHA 1TS2A 4BBRG 3OG5A 2K22A 2ZCBA 4LUOA 3R7QA 2LJIA 3EUB2 3L10B 1X54A 3OHXC 3PO3H 3SDLC 4BOSC 3M4QA 4M8MA 2OT2A 1ESRA 1YQ3B 2IO0B 4DAPA 3W1YA 3R66C 3TL5A 1VQ6A 3V2TA 2QHOA 3DEPA 2KC1A 3RN2A 1PH2A 1XLOA 1EOTA 1FD6A 4R4TA 1K8OA 5IOIA 3A9KA 1DJRD 4KK7A 1G2TA 5DLQE 4C3IB 5FK9C 4X62L 4DUYL 3R3OA 1UELA 1K50A 2IY0B 4BZAA 2XBBC 2OJRA 3AH7A 3DVGY 3BZCA 3T53B 4LF8Q 1NUCA 1FRRA 4LNFA 4DV0Q 4RGMA 1S40A 5TR5A 1V2YA 5ELBA 4V190 4GOPC 4K1RB 4ARIA 3MXPA 3NHHA 1OFFA 2EELA 1DOYA 1WM3A 2MJ8A 2JWUA 3APDA 4KSLC 3OYYA 2PLPA 4DV7Q 3RUIB 4GDLA 1NJIC 5M5YB 4US9A 3QK0A 5D2MB 1B70B 2PNRC 1P16A 3QX1A 3J7YW 1TKGA 1WGGA 3NK9A 3FKIH 3S9WA 4MHEA 1KTKA 5IGFA 3VQIA 2ID0A 2MGSA 1KIXA 3CQZH 1N33Q 4QUFA 3S1NH 1WR6E 1QVGA 3GV6A 1UEBA 1UGMA 1CSQA 2V9HA 4LK0M 1A70A 1NI3A 3CU7A 4K6DA 2BW2A 4PNYA 1JJCB 2RDFA 4I7ZC 1MFWA 3VR6A 4X62Q 4DUYQ 1HUNA 5D94A 4DPGA 5HHDG 3LDZE 4NQKE 2IGHA 4W9CA 2EYPA 3TDQA 2DWQA 3HOVB 5FLXL 4XYCA 1L1OA 2CWAA 3L0OA 2MUYA 1PFBA 2CHXA 4FADA 4DA2A 5CYUA 2AQ2B 4TRDA 5C4HA 3AFPA 1E3PA 4N9TA 3KW5B 3Q2AC 1RLFA 5HURA 3L4PA 4C3IH 1K3RA 1LO5D 2CVRA 3GE3C 4DAYA 1NR4A 2INDC 2RPVA 5ELEA 3N20C 4KZCA 4JG2A 3NZ3A 4ACFA 1N32Q 4AYBG 1N34Q 1EEFD 1Y1VG 1GJXA 3KWVA 3VH4B 3H3VC 2LFIA 1F2YA 2A68C 3RZWC 3MC0B 2E2HB 1V1PA 5IYDG 1Z5SB 2MQHA 3AU5A 4QIWE 1SMYD 3QJZA 2BKRB 3AE7B 2JXXA 1E1OA 4E74A 1HQRD 2CHWA 4BBRH 3T51B 4TQ0A 1MJCA 1B53A 1O7IA 1VQMA 3RLOA 4ULLA 4P16A 4RAUC 2K52A 4XYOA 4WJOA 4M02A 2RF4A 1ZOYB 4ZKBB 1I5FA 4FF4A 4GLSC 3CC7A 3ZDMC 4A3GG 2KN4A 2N9EB 3AE3B 4MDKE 4APVA 4IPDA 3SK6A 2KDIA 4PMCA 2CWPA 1IYJB 4NXNL 2MP2A 3HOXB 3V60A 2NBWB 2DZJA 3SHLA 2XWJB 2WXNA 1SJED 1QB5D 3EA6A 4DV5Q 1XEEA 3M95A 1U5KA 2LVQA 2B76B 2IW3A 3IFTA 3GTLH 1PYWD 1DM0B 5CORA 2JXTA 1SSOA 4JGHB 3I4NH 2XK5B 5I2YA 2O5IC 4F7ZA 2NCNA 1RRBA 4FLHA 1C4QA 1EY7A 3KYCD 5CTRC 1RTOA 3GTKH 3VTVA 4JBMA 1SDFA 4DV3L 4G3XB 5KRUA 1WCMH 4R4OA 3ZVVA 3H94A 3NBIA 1M8AA 4WJPA 3GTQH 3JAMi 2L9HA 4KY5A 1PVOA 4KSKC 1HEZE 5JHBA 1TXYA 1EQVA 4JI7L 3UQAA 4LFCQ 2JA8H 3AEGB 3MFYA 3KH0A 4KIKA 4LDTB 1ZXTA 2O2VA 1ZDVA 5C3EG 4KZ0A 2PNHA 4X3UA 4JE3B 3HOZB 5LXHA 2HJ1A 2K25A 2EKEC 1WD0A 2SOBA 2L32A 5C0XJ 1V8CA 1FXAA 4BY1G 1C8CA 2WQYB 3S1QB 2ZPYA 3CWIA 2K50A 1ILQA 3HEJA 4N9PA 2D2CC 3S1RH 2UXCL 1OEYA 2PVGC 3ULJA 3MC8A 3NVWA 3PGEA 4YSXB 2K6DB 4MEMA 1SNPA 4C3IG 1G6JA 1KRSA 4IN3A 1SE8A 1WXSA 4LMQD 4MGZE 4P74A 2R3ZA 4AWJA 1N5XA 2WU5B 2N4FA 5EBDA 2A69C 1EYDA 2BA0A 4FBJB 2A8VA 4JIOU 3MXNB 2DY8A 1VQBA 3EVQA 3VR2A 2VQEQ 4IFDI 2D3BA 3K7UC 1KFYB 2BE5C 3Q3OC 2EQSA 2CHZA 2EDGA 2KMMA 1GUTA 1GC7A 3SFDB 2KACA 3ZNGC 4DXAB 3C1FA 2FE8A 4RMAA 1L0YB 5HKHA 3OJ3A 4BBRB 2M0AA 3HKZE 3GTJB 3NBHB 3J80E 1YD8U 5JVH3 1BO0A 3N6RA 4RHSA 4DV6Q 1RF2D 2Y0SB 1T5XD 4RFBA 4DK1A 2YU9B 2IZVB 2QC8A 3HK0A 4NPSA 1E2WA 2JRHA 5JPNC 2NVTB 4IUVA 3EQLC 5FJ8G 2KHJA 4MZ9A 3APCA 4LF7L 2K1FA 1PH7A 2K0PA 1WGKA 2K05A 4JI6L 4K0KQ 2N9KA 4GNXA 5H1SE 5EKKA 2LGDA 5FR6A 3J81j 3DQVA 1K0RA 4NY0A 1V80A 4H2AA 1O78A 5C5MA 4OWTB 2EY1A 3W3AA 4ICUA 2CU1A 4D2KA 4NMZA 1TWCB 4BKSD 4YSZB 1JRPA 1TWAB 1Y8OB 1M1KC 3UE1A 2KOLA 4WWMA 3CF6E 1F2ZA 5IGBA 5CV6A 1DD2A 1WE7A 4PZ6A 1WE6A 2MJ3A 3J81i 3K7AH 4BXXG 4CHKA 2ICEC 3C46A 1H9JA 3SU8X 5D14A 1LYLA 3PHXB 2CU3A 3RD2A 3S1MB 2KEEA 1KDBA 4JI5L 2BPSA 4EFOA 1SROA 2XRSD 2EYLA 4JPSA 4KKIA 1WY8A 3S2DB 1PH5A 3MA2B 2JA8G 4NDXA 1VF7A 4W9FA 1F9RA 3F2CA 3D4DA 5FO7B 1HZBA 1KRTA 1KD1C 5IWAL 4LLGM 3RCZA 4E71A 1XMQQ 1IPGA 3E9HA 4EEWA 2E74C 2LZ6A 1HQMC 3EC8A 3S16H 2N1WA 1GO3E 2FCQA 4PZ8A 1IYUA 2DGYA 3MXUA 3MP9A 1FYCA 4R4CA 3PF4A 4BY1H 3I4MB 4HPMB 4NAWB 2C7MB 2NVTH 2GBJA 4LF7Q 5D3DA 1TWFH 4GN3B 2EYJA 4MTKA 3ML9A 4A3EB 3L3OC 1QOGA 1VZ6A 2UUCQ 5ELOA 4OXPA 1JJ2A 2F0UA 1V1QA 4XDXA 5K36H 2X8XX 4LUVA 2Q5WD 4ZRIA 1X56A 1C48A 1EIFA 2Z0SA 1WTOA 1PGBA 4L5QA 3NOBA 4JCVE 4FULA 1AH9A 5JH5C 2BOSA 2RA4A 2B8FA 1JT8A 3MTNB 3VDZA 4UP8A 3WAPA 4YY3Q 2A5HA 2RSUA 1TKYA 2NN6I 4J6HA 1DGSA 1I4HA 1EYCA 2YTXA 4KHPQ 2KO3A 4BBSG 1VDVA 2LGYA 4CGYB 2DBYA 2AKWB 1IL2A 2ZNVB 3P63A 2M4NA 2F3VA 2YU9H 1PFSA 5JEAG 3DDCB 3HIZA 4B6WA 2WX0A 2C9OA 4P75A 4A3JH 4J15A 4BVUC 3M4YA 3ZKJC 2B2TA 1M4VA 3IHPC 2J0TD 1ZGUB 3E0JA 4OEMB 2I0QA 1AW7A 4JV5L 1CK1A 2UUCL 2CW0C 3PSIA 3IRBA 4YCUA 1U4AA 1HA5A 2CJNA 4G0NB 4DNTB 1EWCA 3F8TA 3G4SA 4A3DB 1I3QH 4KJOA 3RZDB 1WIAA 1KJTA 3STBC 5EKIA 2HHHL 5EPLA 1B50A 2IGGA 4GDKA 4OZBA 4K8JA 1NEKB 2M17A 4BBNF 4UY8C 4NXML 3HVDA 2M1MA 4F8MA 4LF4L 3PUZA 4DV1L 1HTQA 1C78A 3OIQA 1GAQB 2J42A 2MRPA 3RNFC 3RNGC 4HLEA 1CFMA 4DR3Q 4ICVA 5HFYA 3HRZC 1HTLD 3FDTA 1PUTA 3H0GB 3Q6SA 1FJGQ 1QLBB 1YNJD 1WWTA 1U4PA 1K53A 4I6NB 4RWSC 4YY3L 3S2DH 1DOKA 1BKBA 3I72A 1MHHE 2R2OA 3ONSA 2NPTA 4X66Q 4OGQC 1IKMA 4F8CB 4HEDA 3DBHB 4LCDE 2LKVA 4XDCA 1KLVA 3I70A 3R93A 3CCEA 3Q23A 3BVMA 1E2VA 2N8NA 5IYCG 5IT9E 3EROA 3KF8A 4K5VA 2UXBL 3M7NA 2LHEA 4FHKA 1PA6A 4DHJB 1I4PA 2BKFA 1G51A 1TWGB 2MBEA 3DVNV 1VQLA 3A74A 2KQ7A 3E56A 4K7UA 1A5RA 4IPCA 1D2BA 2WB1B 4FP5D 2KYWA 2CH4W 5BN5A 4UPAA 2PW9A 3TP8A 3MZ5A 3HOVG 3LB8C 4A3FB 1NNXA 3BWUD 4NP5A 1L2NA 3F2BA 2I46A 4EKUA 4L5RC 1UE7A 3T4AC 2JQRB 3Q3NC 5JZEB 1SYFA 1UNSA 4UDUC 5M3FG 2NVXH 4MM3A 5DCNA 3SR6A 3GP7A 3TP7A 3TZUA 2LUMA 1V1OA 1Y1VB 4M00A 3T3OA 4P1BC 1QZHA 3HOWH 1WH3A 2PTLA 1BOSA 2KQ4X 3ETRA 5IGEA 5KYLA 2ZJRA 1N34L 3QWNA 2PE6B 4PYUA 4WJQA 3ZUNA 4O2DA 1AE2A 4X64Q 2WXGA 1MJDA 1G91A 4FHJA 1ZKHA 4JI1Q 4FF2A 3AECB 5DPSA 3D4RA 4EX5A 3VRBB 5J22A 2QJLA 4JL9A 1Y8NB 2KENA 1C4AA 3RYTA 1ENFA 1VQJA 3VAWA 3PO3G 1RCVD 1O7LA 4A3KB 1U4RA 4OIKA 4XTCS 5IP9G 2UUBQ 2B63H 3H6MA 3EBEA 1F77A 4RM8A 5FLXE 2NVYB 2R7DA 5KNDA 5C4XG 4DR6L 1AFPA 2KTRA 1QF6A 1WZ3A 3HS0C 3I7FA 2EJMA 1IYVA 5BYSA 5CV9A 2L15A 1QVFA 4N6EB 1ZXHA 4W9GA 5DEHA 3X23A 1BUVT 1KLGD 2RSNA 2K5VA 4QF4A 3VYUA 1T0QC 1I4QA 1N62A 3WDNA 3FP9A 1H9SA 4QY7A 4JI1L 4TSSA 3SGIA 2UU9Q 3X0WA 1BDOA 3LX0A 4F7XA 3UDGA 1FJGL 1AEXA 3EHVA 3A33B 1X3PA 3NY5A 3OSOA 4A3MB 2X6LA 3K9PB 4BBSB 2ZNVC 1T9HA 3ZRCA 1K83B 2WKCA 1A3TA 3RUZA 1YNNC 2WDQB 1L1OB 4GNXC 2B2YA 2UUAQ 2K39A 1EY6A 1YI2A 4BY7B 1YJIA 5GAHC 1VQ4A 5IYCH 3NSWA 4XWTA 4CKBA 3S17B 2LASA 3ALBA 3PUXA 1FFUA 4O42A 2A19A 4DR1Q 1WJ4A 1L0WA 3TEWA 3D31A 3GDEA 4OVUA 3F1ZA 4ZRJA 2NWGA 1F2RC 5HG2A 4ANXA 2BYTA 2H4OA 2K8BA 1XTDA 3EJIA 2AEHA 2KX0A 4A3IG 3FRPB 5CV4A 3Q3FA 2FIFA 4ZRKA 1IKLA 2KWDA 1E0BA 2D10A 1OTCA 2KC2A 3PUVA 4XT3B 2VH2A 1KDAA 3NZSA 2IDYA 2ES2A 3OW2A 2O2LD 2H89B 5M3FH 4B3RQ 2CQOA 2IX3A 1HNZQ 3KLWA 2O6VB 2ALYB 4XX5A 2DZKA 4CQNA 3CSTA 2W82A 1Y1VH 1HTPA 1CQFA 1NAPA 3TP6A 2KLCA 3HZXA 3N1YC 1SF0A 4ARCA 4LUZA 1Y1WH 1YHAA 4X64L 1IHZA 2ZXOA 2AWTA 5I6YA 3P20A 3RNBC 2AWOA 4TQ1A 1E7UA 5J18A 3MHZA 1IBLL 4P71A 1XJVA 4DV6L 3JC66 4F88A 2K75A 2F0WA 4DR5L 1BBUA 3VYTA 5IP9H 2B63G 3DBLI 4RF1A 3K80C 1PFNA 3MVVA 4ABNA 3J80c 4JBWA 1I7HA 4C3HG 2LVPA 4A3GH 2J7QB 2BYVE 5G3LD 1QKZA 3H7PB 2HHHQ 2UYZB 4K8IA 3ONAB 2K5QA 4CO7A 4MSMB 1NTGA 1FVIA 2AQ3B 1Q0WB 4II3B 1QJOA 5ISRA 1RHPA 1TWHH 3VYSA 1P8LA 3CKIB 2NVUI 3W1SA 4R1JA 2CS4A 4CDFC 3OLMD 1E7VA 3RMKC 2QIEB 4FJYA 1YBYA 5MPOA 5T1GA 2TSSA 3KUPA 2F03A 3I3TB 2D3GA 4OVVA 2F0PA 3EN2A 1L0XB 4ME3A 4DR4Q 1OTRB 2F0GA 2IPKD 4HJ8A 4IUQA 2XRQD 1DXMA 1FGBD 2Y0SG 5I9PA 1PH8A 2R92H 3EFCA 3BDCA 4QB4A 4IO9A 1WCMG 4DNIA 4A3MH 4DR5Q 1PH6A 1K8AC 1BXTA 3FILB 3NBHA 2SDFA 1K73C 1ZPSA 3A55A 4RGTA 1Q90A 1XNQL 5E1FA 2MFIA 4GMVA 1T0RC 4TKNA 2INNE 4HCEA 1EIHA 4BBNC 2X69A 3WCQA 2L52A 2IO3B 1FR3A 1SN8A 2A6EC 1F0ZA 5C3EH 5M3MB 1X3QA 2FINB 2ZCCA 3B9JA 3L13A 4YTMB 3T1HQ 4GKJL 1J5EQ 1FNUA 3KDFA 4JOIA 2ACZB 2JZ3B 2BWFA 1ESFA 4RG1A 1EUVB 3SD5A 5DNFA 2YLMA 2NBFA 3GD7A 4ZYNA 1DOXA 2BS3B 4A93B 3ZIMA 4C4VA 1VLBA 3U2SC 3FEWX 4NJ6A 2PKOA 1A3VA 2JYTA 5FR3A 3PRMB 1HNZL 2N0SB 3E9IA 3HG9A 3NE5B 2CR5A 2VL6A 1MIUA 3QOLA 3ZXRA 4IJHA 3SE0A 1K9MC 2ASBA 3MAQA 1N60A 4GGQA 2EIFA 4DV4Q 3I3CA 1TWHB 4JBJA 4JI2L 3U8ZA 1Y1WG 1MGSA 4HIMA 1YQ4B 2LS01 1C76A 4QGUA 1PH9A 1V5OA 3HRDD 1F9SA 4PMWA 5GROA 3BYTB 4FF1A 2REXA 1R4MI 1P0RA 2YTVA 4RCOA 3TS2A 4V0BA 3WOFA 1RTNA 4B3SQ 1G6ZA 1QNKA 3G7LA 2NBUA 1NR2A 1N33L 4RF0A 1WJUA 3PT2B 1OGWA 4DR2Q 4C3HH 4FXCA 4AJWA 5FJ8H 1E0ZA 4IJLA 5JEAJ 1PTOB 1CTMA 2D3AA 4K6LA 2J7ZA 1QOAA 2N9LA 4MSQB 1QOHA 2F4VL 3BVGA 2EY2A 2D2QA 2FCSA 2WDTB 2JPHA 4K5WA 2IHFA 1PH4A 3TEHB 3VDYA 1YOVB 4IUUA 1AE3A 3LWUA 4DV4L 2OF1A 1K52A 2XEWA 3AEEB 3AXCA 3KYDD 4OVZA 5IAAC 4BAXA 1WI0A 2V4DA 1TTNA 2KVMA 2IX0A 1LTTD 2MO0A 5KNCA 3U30A 5T1IA 1STAA 4Z9CB 3VR8B 3I73A 2EXDA 1F9JA 2C60A 4Y52H 1HXYD 2B2UC 3NXWA 1ICWA 4BXXH 3RR5A 4A3MG 2B2VA 3GTLB 2LD9A 2L55A 4DV2Q 1X3GA 3GTOH 4O0AA 2MBOA 5JJKA 2ZVOA 2G9HD 4FYDA 3TMPB 2JEAI 1BCPD 4HIKA 1K8GA 5JXVA 5G3LF 2HIXA 2XIWA 1WXMA 2GLSA 4BKTA 3CXCA 4QUCA 1RKNA 2CW0D 2W9NA 2FHTA 4MGKE 3G6EA 4USAA 1SRUA 3J7A5 1JICA 4DV5L 2IT1A 5IE8A 1KXLA 4KN4C 1Q5WB 4EZKA 3Q24A 2BDNA 2SNSA 4JI3L 2WXQA 1XTCD 2KVZA 4X65Q 3UI3A 2KWVB 3EECA 5HY6A 2HQLA 1LM0A 3VFKA 2MP2B 2F0DA 4GLVB 5KNBA 2BVCA 4A9AA 2B3AA 1AN8A 3PIOA 2E3TA 2BGFA 3VR5A 4B9KA 1UBIA 1AARA 1ET6A 4OWWB 3DHHC 4CJ2C 5G55A 2GBKA 1BR9A 1H9MA 5DM73 2JUOA 3PZDA 3UIOB 1JB3A 1X6OA 4ZAIA 1FNVA 3T56B 5BR8L 1A63A 2EMTA 4IOIE 4WIPA 3DM3A 3KJPA 1HTOA 4POGA 3TJPA 3R2IA 2Z8LA 4A75A 3DHGC 1Z6HA 2W3RA 1YITA 4K7WA 3LNNA 3QWZB 1EY0A 2NTTA 1Z2MA 1IBKQ 3TREA 1VMCA 2OEDA 1KDCA 3LWEA 3SEBA 1WYWB 1KL9A 4A4IA 1PHJA 2BYFA 2M00A 3NUCA 2KECA 3GO5A 3RNCC 1C3TA 2R7ZG 1EL0A 4YCVA 2AMCB 3HOUB 1D7QA 1BCPF 3IAM1 4ITKA 1B4OA 1B9NA 1XNRQ 4ZLTF 1BF4A 3ULLA 3J81L 3EGRA 1Q8IA 1L5PA 4KDIC 3I90A 1WD1A 4JX1C 4DWFA 1VQFA 3AQQA 4KY7A 2MJDA 3OMCA 1FIQA 3PCOB 1Y14B 1STBA 4B3TQ 3DM1A 3LYYA 5EE1A 3PZ8A 5BR8Q 3DEOA 4Y7NB 3A9KB 4HKZE 4X65L 3SDZA 4ZOHC 3KF8B 4OHJA 3E0EA 4ZK9B 1DGJA 4N59A 3VUXA 1AZQA 1VQ9A 1LTLA 1M90C 2MCNB 1ONLA 3URYA 3QCAA 3A8KE 1I6HB 3ZNZB 5ELNA 2KN5A 2N1VA 3A1QA 2K5DA 3Q0AA 3H8HA 4OZCA 4ZRQA 1TBEA 1O7ZA 2G4DB 2N49A 4ZDVA 2VZAA 2D3CA 5EAYA 2C7HA 1Z9FA 3GTJH 4DV7L 2R93B 3M3YH 4R4IA 2MBBB 1MVKA 4LFCL 1X65A 3HOUG 4MM3B 4A20A 1I6VC 3MXNA 3IG3A 5JOBA 2BWES 2KMCA 4HDOA 3KDFB 4UAIA 2UUAL 3WANA 3HKZB 2KDEB 1CZPA 2RCFA 3T13A 4A3LH 4C7ZA 4JI4Q 4L6TB 1WTHA 4A3CG 2L3ZA 4OX9L 4IG7B 5EJWA 1VQ8A 1BT0A 4LWCA 2LVOA 1JOOA 2WWZA 1X3FA 2Y3AA 5I2XA 1TS4A 3NQIA 1LT5D 4TVAB 1CUKA 1WXAA 2WXKA 1PZJD 2KZRA 1JB7A 1D5ZC 1XCTL 1HNWQ 3FMCA 3C2PA 1ZDXA 3E3XA 3CRLC 2NZOA 5E3FA 3HOVH 4FJZA 4URKA 2JP1A 4XWWA 1UH6A 3SHQA 1HNXQ 2RDGA 2G5DA 5DAUA 2PE9A 2LSSA 1RM6C 4W9JA 2DX5B 2P5ZX 2NS5A 2B2TC 1T5EA 1HR0W 1EF1A 2E6XA 2FCMA 4LJOB 2DAFA 5IP7H 3KJOA 1CI3M 4DV3Q 3H7SA 4B3SL 3AE1B 2DZMA 4JQWC 2MW5A 4JOIC 5LMUL 1QCBD 2B29A 3A8JE 5EQ0A 1MD2D 4LF6L 3CCUA 2R7ZH 2LJ5A 4GOPB 4GOCA 2KXJA 1BNZA 1P98A 2PPHA 3CPFA 2JA6G 3JAML 2RHSB 2GMIC 5IWAQ 1XNRL 1Q12A 4RA8A 3H15A 2IYDB 3Q8FA 2GVAA 4MELA 2YEPB 2ZJPA 5LLIA 3A5UA 4DQOC 1LT3D 1TWGH 3U7ZA 1UWVA 4WQMA 2HD5B 4K2KA 2RDBC 2WXLA 4AS1A 1SYGA 1STEA 2X6GA 3OOCA 3VR9B 3M4OB 4JI4L 4KVGB 3AMZA 5C4XH 2JU6X 3PO2H 2L11A 4YHHL 1CM9A 2IX1A 4A3EH 1J19A 1YQBA 4TUUA 1LT6D 3AB9A 4REZA 1EIYB 2LXAA 2N3SA 4IPHA 4QL5A 2FMMA 1X1MA 1I4GA 1RFKA 5E6OA 1WJJA 1DYQA 1YN5A 1I35A 2FMCA 3U58A 4KD3A 1YJ9A 1EY9A 3K59A 4JYAQ 1LTGD 2A68D 2Z1CA 4RKLA 1BCPB 1WTPA 2O6VA 3BVZA 3ZJVA 4AQYL 1UGJA 1CHQD 4DV2L 4ZRZA 4L5SA 2KWUB 4GZYC 1FPYA 2EOTA 3G48A 3LXFA 3ZQ4A 1TT2A 1SFOH 3IKJA 1G8ZD 1Y69U 1AZPA 1LGRA 3KBXA 3S15H 4PS3A 4A6QA 4K14A 3TUOA 3K5OA 1GJZA 1D1IA 4IM0A 4YL8A 5HGQA 1QZEA 3R7RA 2HT1A 2YV5A 1YIJA 3O13A 3TEXA 5BYRA 3HOYB 3CAMA 3CMAA 3N1XC 3ZYYX 1JORA 1EQQA 3TS0A 4A3LG 1XCQL 3QA8A 1WJNA 4AYBB 4HN7A 1YNND 5ELDA 3GTGB 1HFNA 4DHZE 1L6VA 1V8QA 1ML0D 4WH4A 3ULPA 4JI6Q 2PMZB 2V4IB 3ICEA 1JE4A 2L0FA 3P1MA 2KCTA 4ALPA 2G3QB 4S3SA 2ZTDA 3TBIB 4LF4Q 2HTME 2QF7A 4JYAL 5KHOA 3RZOB 4A3IH 1RL2A 5M9OA 1NSNS 2SAKA 2JA5G 1LTRD 5EGTA 1V97A 3PMFA 4DV0L 2HJ8A 2KD0A 5C3JB 1IBXA 1OQQA 3AYHB 3AM9A 2UU9L 1HUMA 3V3XA 4ODGA 1OXVA 1SNCA 1HNXL 2JEBI 4N8X1 4HIOA 1Q10A 1UBQA 3JW0X 3S24A 4LF9Q 1FNWA 4A3PA 1UWMA 5L37A 1S3SG 2M0XA 2NMQA 3T16A 3S14B 5DPTA 5C44H 4JI2Q 1EQTA 1WRIA 3N3KB 4CJ0B 1EYGA 1B2TA 1SMXA 4EQNA 2OTJA 1WMHB 3DBRB 1LV9A 4M01A 4N9F4 3ZW3A 2F0KA 2LEKA 5GAEC 4DUZL 4NXNQ 1CZGA 3S15B 3I57A 4M8NA 4HSVA 3FKYA 3B08A 2FJ2A 1A6XA 1EZ6A 4L63B 4LNNA 1J8IA 2FIDA 4YCWA 4YWMA 3PHWB 2WB1G 4G4KA 2QDFA 4DK0A 3D32A 2PW5A 1VQ5A 3PO2G 1GG3A 1L0VB 4KTAA 4A3EG 2K9XA 5AZGA 3BG3A 1L4ZB 1SE3A 3CQZB 3EIVA 1UE5A 4LFAL 3PUYA 3U52E 1UEAB 2KJ6A 4OZAA 4DN4M 1ENCA 3HVZA 1SR3A 1I50B 3OMGA 2F0MA 4KX6B 1TZ1A 1F9QA 3OWEB 2NVYH 2L0TA 2KQSA 2ZVNA 2Z6KC 2JE6I 3ZJYC 5K5PA 4RNAA 3Q3MC 1PYSB 1KQSA 3OTOQ 1HZAA 2X38A 5IIFA 1F2MA 1EFID 4JI7Q 3TCAA 2WAQB 4C3JG 1QZGA 2D5GA 1H9KA 4OELB 2R92G 4GIVA 3K5LA 2EJGC 2A5UA 4Q2JA 1G2SA 3I4LA 3IFDA 2UXDQ 2LMCA 2K04A 3OIPA 1JRUA 2FAZA 2KFKB 4L2YA 2AWNA 3PUWA 1PGAA 2KDMA 2OOBB 1Q7YC 2KQ3A 4X3KA 4WFN3 3NTHA 1Q86C 1MHXA 2ATWA 1XPOA 2XK5A 1EQRA 4XQQA 1XYIA 3UE0A 3DMUA 3GTPB 1E8ZA 3QAQA 5IA7A 1XMOL 4XC2A 5G5GA 2GOWA 1EUJA 3MFGA 5EPKA 4CBVA 4ZKCB 5KGUA 1Q82C 4RH6A 1KH0A 2GI9A 3PV0A 5IY0A 4B0EA 4B3MQ 3UDFA 2MSED 1S3OA 3ZJUA 4YXDB 2KCMA 2CHBD 1K51A 4DK3C 2D0OA 4BY1B 4CHTB 1FCCC 1XLPA 1UD7A 3I9V1 3DWAA 4DR4L 3QR8A 4NW2A 3QC8B 3JSVB 3C8YA 4DV1Q 1UE1A 3UDIA 2XGTA 4MH0E 4IPGA 1MBYA 2WU2B 1TS5A 4GB9A 3HM3A 3S2AA 2V4LA 3SK8A 3H6NA 3CCVA 2ZXRA 1EFWA 4B9WA 3GZNI 2QILA 3IBEA 4BA2I 3V6CB 2V3SA 4JK1C 3CMEA 5LXIB 1XX8A 1ZW7A 2EMSA 1V1PB 2NUCA 3H7PA 4YSYB 4YTPB 2RBMA 4KV6A 2A74C 4MN3A 3W5OA 2Q8TA 4X66L 4HXDA 3AE8B 4WQOB 4I7AA 2OQKA 4GLAC 1NY4A 2L5TA 1L4DB 1R4NI 1G291 4X6AH 4EZJA 5LMNQ 5IN7A 3A9JB 2RGFA 3R8BA 1PFMA 2EVBA 5D65A 4DGZA 1ACCA 2ZW1A 4NJCA 4QAYA 1FCLA 4NPNA 4W9LA 3ZLZA 2WDRB 2JYEA 4HCSA 1WTRA 3NQTA 1GUGA 3GQBA 5ELCA 3A7LA 1E8XA 4FXDA 2F3IA 1MG4A 2GVBA 2KANA 1LT4D 3IT6B 4OONA 1AWDA 1YJJA 1X32A 4PZ7A 2HCIA 2K33A 2A1AA 1VQ7A 3B1LX 3JAMc 4G7OC 2H88B 3K0XA 1BMLC 4NB3A 1IGCA 1OXUA 1RAXA 3MJ5A 1A15A 1FXIA 1YJ1A 2F0QA 3ERQA 2IL8A 3FVQA 2VW9A 1ZXIA 2INPE 1IBLQ 3LJ3A 4I6LB 3ZGZA 1TY2A 3HOYG 1ICFB 5JAVA 1WM2A 2KHIA 3KOJA 4YWLA 2WKDA 2NN6G 2Z9HA 4KKJA 1UE6A 2WXFA 2NTSA 3DBRI 2N9PC 2C9WB 2JY6A 3NENA 1E7ZA 2F0JA 1WX9A 1RWSA 2ONQA 3KFUA 1AP0A 1JROA 1T3QA 1WGDA 2RPQA 4F87A 4KV2A 4H7BA 4RM9A 2IO1B 2KMAA 2M2LA 2Z6BA 2E5LL 3PVLA 1E7PB 3NWSA 4BA1I 1RYJA 4JVZA 2DNEA 3RI7C 1E9MA 4MNOA 5CV7A 1JCKB 1WYDA 4WWPA 1QUQB 3W2DA 4E6IA 3P42A 3VTWA 4OX9Q 1QILA 3IAYA 2O6VD 1PRTD 1CSPA 3J7ZC 2PIAA 5HI1A 4WWNA 4XXEA 5M3MH 3AEFB 2JYOA 2J53A 4HJ7A 5M5XB 2YEPF 3BS1A 1H9SB 3OW7A 4PS7A 2ZT9C 2K01A 1HZCA 1C4CA 5J17A 1EOVA 1WFQA 4JI5Q 1E10A 1P1AA 3UIPB 4AP4C 3FAHA 4K7SA 2ZTEA 3NS1A 4GS3A 1E22A 3KF6B 1EEID 1V86A 3ZNHB 2E2IH 4IQZA 3HOZH 1V5TA 1J5EL 4PK1A 1GOZA 2B3GA 2PMVA 1XMQL 2CKHB 2KHWB 5H8YE 3VHTC 4CKCA 4ZRPA 1NENB 5COYA 5C3XA 1EU4A 2F52A 3TSSA 5LMUQ 3ERSX 2Q8IB 1XNQQ 3AEVA 4M0WB 4R9WA 2MBQA 5EPJA 3NZUA 5LMNL 3Q8DA 3TEZA 1WTWA 1V49A 4BFRA 1BBWA 5E4WC 4RHRA 3QJYA 2YVCA 1N63A 2XVSA 3AEDB 3UI2A 2IHEA 4JI8L 2RVLA 1VQGA 2LGSA 3J80i 2K5HA 2I38A 1XO3A 4XT1B 2ICIA 5IYBH 4A93H 2GB1A 1E90A 2W3SA 2B2WC 3KQ4A 2AUJD 2KUMA
chains in the Genus database with same CATH topology
2R7ZB 5AUIA 4ME5A 1SJHD 4Q0FA 3S16B 1CA5A 1LTAD 3OWFA 3NRZA 3K6OA 4NAMA 3U9SA 2K5PA 1L6UA 2BBCA 3DUZA 4X3SA 4KHVA 1JQYD 2EYFA 2KCCA 2NN6H 3W5VB 4XDDA 4L8JA 3RD4A 5C4XB 3K5NA 3NVZA 2R6GA 2IGDA 4ILWA 2L1AA 3CRKC 4IFDG 1IL8A 4MH8A 1Q1BA 2G1EA 5IOCA 1JOKA 3VR4A 2WP9B 4TQUS 4C2MB 2VUMB 3FKIB 5CGKA 4L23A 3J9CA 1PZID 1PXUA 2BB6A 1DZ1A 1TZOA 2V0GA 2CQAA 1OXXK 2Q8RE 3A54A 3U9OA 3ITPA 3ND8A 5E6JA 5D7GA 1PDXA 3RPFC 3SK4A 3K5MA 1VDZA 5BMIA 3AN1A 1PTOD 5IGCA 3NUHB 3Q8BA 3H91A 3NTKA 2WNMA 5IT9L 5A2QE 5EE9A 4FXGC 2J52A 2LMCB 2B2UA 3T3NA 1XF5L 1U4LA 2M19A 1GHJA 2JZPA 2EXZA 4HMJA 1TYGB 4HJGE 3MXGA 4P2CB 4DFAA 3N9YC 2LY7A 5KYIA 3J80L 2XSCA 2OHFA 2A69D 2IWHA 1J9OA 1ZKOA 2TMPA 1SYDA 2BTEA 1QG7A 3AMUA 1CT1D 1I4RA 2F4IA 2XWBB 1DOIA 1C4PA 1XWEA 2BA1A 4IFDH 1WXQA 5CMDA 3L9AX 4HR7B 1TY0A 1WYGA 4HTHA 1D4BA 1B3AA 5ELFA 2F0HA 2HQEA 1NYRA 1MPEA 4JWUC 3M85A 4CJ1B 3GTQB 2RQXA 1R7SA 2MEKA 3C3LA 2C5CA 2HCCA 1SMYC 3CHBD 1D1KA 5BMHA 1ZYRD 1KF6B 3RMHA 2Y5PA 3KLSX 2HDMA 4LJZC 2DLBA 1SFOB 2BS4B 5GXGB 4KI0A 2ZXPA 1OXTA 2OEOA 2B8GA 1TVXA 4R8NA 1EIGA 3S2HB 1JWSD 1LACA 2JX5A 1BCPC 3RFZB 5EE0A 1VZ8A 5FO9B 4J1MA 4IDIA 3NPPA 3J7AF 3KWLA 1SEBD 2BB5A 1JQ4A 2NZ1D 1HPCA 5A35A 1A2UA 2J4XA 4KGSA 4KGTA 4LAAA 3K0YA 1R4QB 1W6JA 1PTOH 3SR1A 5BMGA 1STNA 5J39A 1DOXA 1SE2A 2QDBA 1HRJA 2JA7B 2EZVA 2V3PA 3A7AB 1E2ZA 2HDLA 2E75C 2AQ1B 1BQQT 3L7ZC 1FMAD 4GDKB 4XQNA 4OW0A 2F0TA 2PCFB 3JAME 3HGBA 3X3NA 1VCIA 2EY6A 2D5DA 2W55A 3NVYA 4PV1C 3GTOB 1D5XC 1AYFA 3AEBB 3HP3A 3BIID 1FD7D 4LK1C 1F2LA 1S5FD 3DWMA 2BT6A 1O80A 4QMGA 1J7AA 1QT9A 5JVG3 1Q3LA 5FOBB 3SXHA 1YMHE 1I3QB 5LL6S 1VMPA 5KIXA 4U68A 1FO4A 3P75A 2RMMA 4IUPA 3QB3A 4IKGA 2JSOA 2A6HD 1FM0D 1SE4A 2WP8J 1EYAA 3PZ7A 2F0LA 2ZW0A 2PZWA 1P7EA 1GUWA 2L4NA 2WINB 4EVOA 4BS9A 1LTBD 2HDEA 1TR5A 1Z47A 2F0FA 1EZ8A 1SNMA 5HGTA 4OL7A 4CKEA 4U673 5LNK1 2EE1A 4A3GB 2JA8B 4RGNA 2DN8A 3D3RA 3W9CB 1HFGA 2M9VA 3I4NB 4FF3A 1B9MA 3D8GA 3Q8CA 4R3DA 1JWUD 2N55A 1VRAB 4GDLB 5CR3A 1PLFA 2N88A 2PZTA 2WLBA 3AE2B 4QCLA 3Q8EA 3IAS1 3VA5A 5C3WA 2MPMA 1SSNA 2DY7A 3Q22A 1GHKA 1HHVA 1EM7A 4A90A 1WVLA 1KABA 5FO8B 1EY5A 1QOBA 3A56A 3MHBA 5EBCA 1BUIC 1YN3A 2QMTA 5C3EB 1DONA 3M3YB 1XLQA 4JWSC 4ZQ3A 4C80A 2A73B 1TKWB 3DWPA 1DOMA 4ZHOA 3P1HA 2DYOA 5LHY1 3P7JA 2G9DA 1UWXA 3A8IE 4C3HB 3NP8A 4N58A 3E9SA 3C1EA 2EJFC 3I8ZA 2F1MA 5C4JB 1C77A 1HZ6A 1GB4A 2W54A 1GPXA 4NKLA 3PO3B 4K5XA 2I2YA 3DWQA 5AFWA 1J7CA 3D6CA 2VNUD 1JWMD 1A3UA 2L0CA 4KD4A 2VB3X 2JSVX 2RKSA 2VZKD 5E4XA 2NVXB 1JWAD 5IGGA 2N7JA 2E2DC 4IURA 1S5DD 1SXTA 4G7HC 1IBXB 2PYKA 3EFXD 3GB1A 3X3MA 3SFEB 1MSHA 5JPMC 1Y56A 4BWGB 1HZ5A 2LGIA 2EYMA 3AE6B 1YNJC 5T8IA 2KHSA 4AQ7A 1RJTA 4H13C 1LABA 2K6AA 2PZUA 2JA5B 1SNOA 1OXSC 1V43A 1QQRA 1K8MA 5J1ZA 2KEDA 2FUG1 2FFKB 3QO2A 2QCPX 2I07B 2E2IB 4M8AA 3ABVB 2NYZD 4K2LA 3KLSA 2E2JB 4PT5A 4NZLB 4WJWA 2F0EA 2F0SA 2D62A 1JR0D 5EE3A 3P4RB 3J81E 4A3JB 3K7AB 5A2QL 4KN7C 5LL6X 1SNQA 2EKIA 3BK2A 4M1UB 1PDQA 3M7GA 4A8XC 5I9OA 3AE9B 1ILPA 2JXMB 2SEBD 1ZYRC 4WORA 3P4SB 1C9FA 2V3NA 2MJEA 2LFNA 2A6HC 3FPPA 1VZ7A 1KRHA 3ND9A 2VXWA 2L12A 4DXFA 5C0XG 5BYRA 2QEJC 1U9RA 1S5ED 1TS3A 3GTKB 5DM63 1QE6A 5C5LA 1I4XA 3FPUB 3V05A 2F0OA 4FVMA 3RLFA 1NCVA 1B9RA 4DNRB 1TU2B 2D9UA 1SBBB 1J7BA 2GRIA 5G5HA 1PMRA 1YNTE 4MACA 4KKUA 3BYYB 2PW7A 5M3FB 3P4QB 2SNMA 1UAPA 3S1RB 1QWYA 2WXIA 1WTQA 1RD9D 3E6ZX 1H9RA 1S5BD 1SYBA 1IGDA 1JC7A 1O7YA 2CJOA 4X3TA 3GTMB 5TSSA 2WXMA 4ZHPA 3Q8AA 1TKEA 4LTUA 4US8A 3D4WA 1PRTB 4QIWB 3TP5A 1PGXA 1PRTF 3V96A 1BBXC 4TMAB 3DHQA 5CV5A 4I65A 5BYQA 2Y5CA 1TJEA 3VA7A 1A2TA 1JWBD 4XQJA 2OXPA 4A55A 1CHPD 3MTSA 4C7YA 5IGDA 4XYQA 1ZUD2 4IUTA 4C3JB 3HUIA 2WXHA 1WTXA 2FBWB 2GA4B 3K58A 5D3IB 3D6WA 3QIAA 5C4ZA 1FRDA 1SB3C 1FEHA 4L1BA 1ZE3D 5C0XH 1P7FA 3AU7A 1IUEA 4MT5A 2BE5D 2B2YC 1STHA 3BDLA 3E5SA 3F2UA 2DYMA 3KBGA 5C2TB 2VZKB 1KAAA 1WCMB 2EYOA 4KMUC 3PO2B 3AB5A 1HA6A 1Z7TA 1IW7D 1JOQA 2MHVA 1D6EC 2IJ0A 4EGVA 2QKIC 4M0WA 4ZUIA 1W6KA 3GV3A 1ET9A 3PO0A 1MSGA 2K03A 1JALA 1QNUA 1DCZA 3Q69A 4DF7A 2WDVB 4C56C 1XXGA 1E6EB 4HSPA 5CBEE 4FO2A 3MWYW 4G7ZC 5I6WA 3AE5B 1GUSA 1CA6A 2RSOA 1CJEA 1CZWA 2O4XA 4IFDJ 2M56B 5C6AA 2Z4HA 4KGRA 2KA7A 1QOFA 2ON8A 3TZDA 1DOLA 1D5MC 5M5WB 1EY4A 2K28A 1RODA 1SIJA 5C0XI 5JJZA 2NVQB 3ZJTA 5NUCA 5BN3A 1SAPA 4WRDA 2JA6B 2KCNA 1TQOA 1STGA 4Q5VA 3W5UB 1B44D 1PTOF 2EY5A 3QOJA 5I4DA 4KJNA 1Y1WB 2VB2X 1GUNA 3H09A 3R2TA 1PRTC 2PPBC 3N52A 4MIUA 1GB1A 4PMBA 2YYZA 2XN9C 2F0NA 3OPOA 1F2RI 1SYEA 3U4EG 2O5JC 4WAFA 2PO4A 2WS3B 3B2GA 3IXSA 2BCOA 4RGOS 2ENBA 4IALA 1NVID 1U4MA 1WSPA 3VYRA 1VF5C 3CIRB 1ROEA 1ZP0B 4HEA1 4FXKC 1KNAA 2WXPA 1UUPA 1PFDA 4EQOA 3FILA 1TWFB 4H0LC 4YTNB 2RDHA 4YWGG 4KY6A 1T6BX 3TEYA 1SYCA 4J8QA 1VR9A 2WXJA 2KAJA 4G57A 4XE0A 5KEEA 4OO1H 2QSDA 3MEHA 2F0IA 2K7VA 3KK7A 2BS2B 1PTOC 1GUOA 1NYQA 3AEAB 4HAEA 3I91A 3DXJC 4DU9A 3GS2A 1OQRA 2L1BA 1KLUD 2Z4IA 2HUGA 4DXGA 2BDOA 1LTID 4TKOB 2B63B 3VRAB 3BK1A 3NTIA 1ZEQX 4IZ8A 1JMLA 2WACA 4IUNA 3BZDB 3B2FA 1STYA 3NVVA 4OIJA 1SNDA 2B39A 1MI2A 1F9PA 2R92B 2WXRA 3TN2A 5K36G 3PIP3 4H44C 2NB0A 4FNFA 2B2VC 4B08A 3HOWB 2E76C 3G6JB 4XIGS 2EYHA 1LLRD 1WTVA 2MP1A 1XLNA 3FC4A 1ENAA 1S4ZA 2WXOA 3AE4B 5CBAE 4C1NK 4EQPA 2B2WA 2A6ED 1YN4A 4KKSA 5JEAH 5FKAC 2LHDA 2WV6D 4ID6A 1EU3A 4J3OD 4DAVA 4OO1I 2L83A 1JW9D 3SK5A 3AV8A 1PZKD 3IT4B 4PQXA 3NWTA 4P6VF 1RDPD 3VR3A 5IODA 3J7AV 2K1BA 1CQVA 5BN4A 1OO9B 4HMIA 3DWGC 1B1ZA 2AUKA 4HRSA 2K5WA 1VJKA 1EWHA 1LTSD 2EPBA 4RKBA 3WOEA 4HROA 3IL8A 4OO1G 5H92C 1EWYC 2K3UA 4B9XA 5CC4A 1II3A 1FFVA 1N5WA 1TIID 2WIIB 3K57A 3KLRA 4A3BB 2AX5A 1Q1EA 3S1NB 4B0MA 2MH7A 1KNEA 4YT0B 4HKQA 1Y8PB 5CV8A 4ZUJA 2PVOD 3SVMA 2KJXA 4O1NA 4WURA 4C1NI 4KKTA 3PIO3 4A3IB 1C79A 5F2DA 4KHZA 1R4PB 3TMEA 2F0VA 4ZYSA 1S5CD 1R9TB 2DNCA 5EKLA 3BDOA 1HCZA 4R8IA 2PQEA 2K32A 2F3WA 1IW7C 1GXDC 5AUKA 3QG1A 4EE2A 1EY8A 4YIJA 4RCNA 5C44B 1MI0A 1N61A 2XNAC 2H1EA 2R61A 1TS2A 2K22A 2LJIA 3EUB2 3OHXC 2OT2A 1ESRA 1YQ3B 4DAPA 3V2TA 3DEPA 1XLOA 1EOTA 1FD6A 1K8OA 1DJRD 4KK7A 1G2TA 4C3IB 5FK9C 3R3OA 1K50A 3AH7A 3T53B 1NUCA 1FRRA 4RGMA 5ELBA 4V190 4ARIA 3MXPA 3NHHA 1OFFA 2EELA 1DOYA 2MJ8A 2JWUA 2PLPA 5M5YB 4US9A 2PNRC 3J7YW 1TKGA 3NK9A 3S9WA 4MHEA 1KTKA 5IGFA 3VQIA 2ID0A 2MGSA 4QUFA 3GV6A 4LK0M 1A70A 1NI3A 3CU7A 4K6DA 2BW2A 4PNYA 2RDFA 4I7ZC 3VR6A 1HUNA 5HHDG 2IGHA 2EYPA 3TDQA 2DWQA 3HOVB 5FLXL 2MUYA 1PFBA 4DA2A 5CYUA 2AQ2B 4TRDA 5C4HA 4N9TA 5HURA 3L4PA 1LO5D 2CVRA 4DAYA 1NR4A 2RPVA 5ELEA 3NZ3A 1GJXA 1EEFD 3KWVA 3H3VC 2LFIA 1F2YA 2A68C 3MC0B 2E2HB 1V1PA 1SMYD 3AE7B 1HQRD 4TQ0A 3T51B 1B53A 4ULLA 4P16A 4RAUC 4XYOA 1ZOYB 4ZKBB 4GLSC 4FF4A 2KN4A 3AE3B 3SK6A 4PMCA 3HOXB 3SHLA 2XWJB 2WXNA 1SJED 1QB5D 3EA6A 1XEEA 2B76B 2IW3A 3IFTA 1PYWD 1DM0B 5CORA 2JXTA 1SSOA 5I2YA 2O5IC 1C4QA 1EY7A 1RTOA 1SDFA 5KRUA 3H94A 3NBIA 1M8AA 2L9HA 4KY5A 1HEZE 1EQVA 3AEGB 3MFYA 1ZXTA 1ZDVA 4X3UA 4JE3B 3HOZB 1WD0A 2SOBA 2L32A 5C0XJ 1V8CA 1FXAA 1C8CA 2WQYB 3S1QB 3CWIA 3HEJA 1ILQA 4N9PA 2D2CC 2PVGC 3NVWA 4YSXB 1SNPA 4C3IG 4IN3A 4LMQD 2R3ZA 1N5XA 2WU5B 5EBDA 2A69C 1EYDA 2BA0A 2DY8A 3EVQA 3VR2A 4IFDI 1KFYB 2BE5C 2KMMA 2EDGA 1GUTA 3SFDB 2KACA 3C1FA 2FE8A 1L0YB 4BBRB 2M0AA 3GTJB 3J80E 5JVH3 1BO0A 3N6RA 4RHSA 1RF2D 2Y0SB 1T5XD 4RFBA 4DK1A 2YU9B 1E2WA 5JPNC 2NVTB 4IUVA 3EQLC 2K0PA 1WGKA 2K05A 2N9KA 5EKKA 4H2AA 1O78A 5C5MA 2EY1A 3W3AA 4D2KA 4NMZA 1TWCB 4YSZB 1JRPA 1TWAB 1Y8OB 2KOLA 4WWMA 1F2ZA 5IGBA 5CV6A 1DD2A 2MJ3A 2ICEC 3C46A 1H9JA 5D14A 2CU3A 3S1MB 2KEEA 1KDBA 2XRSD 2EYLA 4JPSA 4KKIA 3S2DB 3MA2B 4NDXA 1VF7A 1F9RA 3W1SA 3D4DA 5FO7B 4LLGM 2E74C 1HQMC 1IYUA 3MXUA 3MP9A 1FYCA 3I4MB 4NAWB 5D3DA 2EYJA 4A3EB 3L3OC 1QOGA 1VZ6A 2F0UA 4XDXA 5K36H 2Q5WD 1WTOA 1C48A 1PGBA 2BOSA 2RA4A 2B8FA 2A5HA 1TKYA 2NN6I 4J6HA 1I4HA 1EYCA 1VDVA 4CGYB 2DBYA 3P63A 2F3VA 5JEAG 2C9OA 3M4YA 2B2TA 1M4VA 2J0TD 3E0JA 1AW7A 1CK1A 2CW0C 2CJNA 1HA5A 4DNTB 1EWCA 4A3DB 4KJOA 3RZDB 5EKIA 5EPLA 1B50A 2IGGA 4OZBA 4K8JA 1NEKB 3HVDA 4F8MA 3PUZA 1C78A 3OIQA 1GAQB 2J42A 1CFMA 5HFYA 3HRZC 1HTLD 3FDTA 1PUTA 3H0GB 3Q6SA 1QLBB 1YNJD 1WWTA 1U4PA 1K53A 4RWSC 1DOKA 3I72A 1MHHE 4OGQC 1IKMA 4HEDA 2LKVA 4XDCA 3I70A 3R93A 3Q23A 3BVMA 1E2VA 5IT9E 3EROA 3KF8A 4K5VA 3M7NA 2LHEA 1I4PA 3E56A 1TWGB 1D2BA 2WB1B 4FP5D 2PW9A 5BN5A 3TP8A 3MZ5A 3LB8C 4A3FB 3BWUD 4NP5A 2I46A 3T4AC 2JQRB 1SYFA 1UNSA 4UDUC 3SR6A 3GP7A 3TP7A 3TZUA 2LUMA 1V1OA 1Y1VB 3T3OA 3ETRA 3P4PB 4ZRPA 2PTLA 1BOSA 2KQ4X 5IGEA 5KYLA 3QWNA 2WXGA 1G91A 4FF2A 3AECB 3D4RA 3VRBB 5J22A 2QJLA 1Y8NB 1C4AA 1ENFA 1RCVD 1O7LA 4A3KB 1U4RA 4OIKA 4XTCS 3H6MA 1F77A 5FLXE 2NVYB 5KNDA 1AFPA 1QF6A 3HS0C 1IYVA 2EJMA 5BYSA 5CV9A 4N6EB 1ZXHA 5DEHA 1BUVT 1KLGD 2RSNA 4QF4A 3VYUA 1I4QA 1N62A 3WDNA 1H9SA 4TSSA 1BDOA 3LX0A 4F7XA 1AEXA 1X3PA 3OSOA 4A3MB 2X6LA 4BBSB 1K83B 2WKCA 1A3TA 3RUZA 1YNNC 2WDQB 2B2YA 1EY6A 4BY7B 1YJIA 4XWTA 3NSWA 4CKBA 3S17B 3PUXA 1FFUA 4O42A 3TEWA 3D31A 2NWGA 1F2RC 5HG2A 2BYTA 2H4OA 3EJIA 3FRPB 5CV4A 1IKLA 2KWDA 1E0BA 3PUVA 4XT3B 1KDAA 2IDYA 2O2LD 2H89B 2IX3A 4CQNA 2W82A 1HTPA 1CQFA 1NAPA 3TP6A 4ARCA 3HZXA 1SF0A 1IHZA 2ZXOA 5I6YA 3P20A 2AWOA 4TQ1A 3MHZA 4F88A 2F0WA 3VYTA 4RF1A 4ABNA 1PFNA 3MVVA 4JBWA 1I7HA 4C3HG 5G3LD 1QKZA 4K8IA 3ONAB 2K5QA 2AQ3B 1QJOA 5ISRA 1RHPA 3VYSA 3CKIB 2QIEB 5MPOA 5T1GA 2TSSA 3KUPA 2F03A 2F0PA 1L0XB 2F0GA 2IPKD 4IUQA 2XRQD 1DXMA 1FGBD 5I9PA 3BDCA 4QB4A 4YSYB 3FILB 1BXTA 3NBHA 2SDFA 1ZPSA 3A55A 4RGTA 1Q90A 5E1FA 2INNE 4HCEA 1EIHA 2X69A 3WCQA 2L52A 1FR3A 2A6EC 1F0ZA 5M3MB 1X3QA 2FINB 3B9JA 4YTMB 1FNUA 2ACZB 1ESFA 5DNFA 2NBFA 3GD7A 2BS3B 4A93B 1VLBA 3U2SC 3FEWX 2PKOA 1A3VA 2JYTA 5FR3A 2N0SB 3HG9A 3NE5B 3QOLA 3SE0A 1N60A 3MAQA 3I3CA 1TWHB 1MGSA 1YQ4B 2LS01 1C76A 3HRDD 1F9SA 4PMWA 4FF1A 3BYTB 4RCOA 4V0BA 3WOFA 1RTNA 1G6ZA 1QNKA 3G7LA 1NR2A 4RF0A 4FXCA 1E0ZA 5JEAJ 1PTOB 1CTMA 4K6LA 2J7ZA 1QOAA 2N9LA 1QOHA 3BVGA 2EY2A 4K5WA 3AEEB 4IUUA 1K52A 3LWUA 2OF1A 4OVZA 2V4DA 2KVMA 2IX0A 1LTTD 5KNCA 5T1IA 1STAA 4Z9CB 3VR8B 3I73A 1HXYD 2B2UC 3NXWA 1ICWA 2B2VA 3GTLB 2L55A 2G9HD 4FYDA 2JEAI 1BCPD 5JXVA 5G3LF 2XIWA 4QUCA 1RKNA 2CW0D 2FHTA 4USAA 1JICA 2IT1A 4KN4C 3Q24A 2BDNA 2SNSA 2WXQA 1XTCD 3UI3A 2F0DA 5KNBA 4A9AA 1AN8A 2E3TA 3VR5A 1ET6A 4CJ2C 1BR9A 1H9MA 5DM73 1JB3A 4ZAIA 1FNVA 3T56B 4IOIE 4WIPA 3R2IA 2Z8LA 1Z6HA 2W3RA 3LNNA 1EY0A 2NTTA 1VMCA 2OEDA 1KDCA 3LWEA 3SEBA 2M00A 3NUCA 2KECA 3GO5A 1EL0A 3HOUB 1BCPF 3IAM1 4ITKA 1B4OA 1B9NA 4ZLTF 1BF4A 3J81L 3EGRA 1Q8IA 1L5PA 3I90A 1WD1A 4JX1C 4KY7A 2MJDA 3OMCA 1FIQA 3LYYA 1STBA 3DM1A 5EE1A 3PZ8A 3DEOA 4Y7NB 4HKZE 3SDZA 4ZOHC 4ZK9B 4OHJA 4N59A 1DGJA 1AZQA 1ONLA 3URYA 3A8KE 1I6HB 2K5DA 3Q0AA 3H8HA 4OZCA 4ZRQA 1O7ZA 2R93B 1MVKA 4MM3B 1I6VC 3MXNA 5JOBA 4UAIA 3HKZB 1CZPA 4C7ZA 3T13A 4L6TB 5EJWA 1JOOA 2Y3AA 5I2XA 1TS4A 3NQIA 1LT5D 2WXKA 1PZJD 1D5ZC 1XCTL 3FMCA 3C2PA 1ZDXA 3CRLC 5E3FA 4XWWA 2JP1A 2RDGA 5DAUA 1RM6C 2B2TC 1T5EA 2E6XA 1CI3M 3AE1B 1QCBD 3A8JE 5EQ0A 1MD2D 1BNZA 3JAML 1Q12A 4RA8A 3Q8FA 2YEPB 4DQOC 1LT3D 3U7ZA 4WQMA 4K2KA 2WXLA 4AS1A 1SYGA 1STEA 2X6GA 3OOCA 3VR9B 3M4OB 3AMZA 2JU6X 2L11A 2IX1A 1CM9A 1LT6D 3AB9A 4REZA 2FMMA 1I4GA 1RFKA 1DYQA 1YN5A 2FMCA 4KD3A 3K59A 1EY9A 1LTGD 2A68D 2Z1CA 4RKLA 1BCPB 1WTPA 3ZJVA 3BVZA 1UGJA 1CHQD 4ZRZA 4GZYC 3LXFA 2EOTA 3ZQ4A 1TT2A 3IKJA 1G8ZD 1Y69U 1AZPA 4A6QA 3KBXA 4K14A 3TUOA 3K5OA 1D1IA 3O13A 3TEXA 3HOYB 3ZYYX 1JORA 1XCQL 4AYBB 4HN7A 5ELDA 3GTGB 1YNND 1HFNA 1L6VA 1V8QA 1ML0D 4WH4A 2PMZB 2V4IB 3P1MA 1JE4A 4S3SA 3TBIB 2HTME 2QF7A 3RZOB 5M9OA 1NSNS 2SAKA 1IBXA 1LTRD 5EGTA 1V97A 3PMFA 5C3JB 1OQQA 3AM9A 1HUMA 3V3XA 4ODGA 1OXVA 1SNCA 2JEBI 1Q10A 1FNWA 1UWMA 2NMQA 3T16A 3S14B 1EQTA 1WRIA 4CJ0B 1B2TA 4EQNA 1LV9A 2F0KA 2LEKA 3S15B 1CZGA 3I57A 4HSVA 2FJ2A 1A6XA 1EZ6A 4L63B 1J8IA 4G4KA 4DK0A 2PW5A 1L0VB 4KTAA 2K9XA 3BG3A 1L4ZB 1SE3A 3CQZB 3PUYA 3U52E 1UEAB 4OZAA 4DN4M 1ENCA 3HVZA 1I50B 3OMGA 2F0MA 4KX6B 1F9QA 3OWEB 2JE6I 4RNAA 5K5PA 2X38A 5IIFA 1F2MA 1EFID 2WAQB 4C3JG 2D5GA 1H9KA 3K5LA 2EJGC 4Q2JA 1G2SA 3I4LA 3IFDA 2LMCA 2K04A 3OIPA 4L2YA 2AWNA 3PUWA 1PGAA 2KDMA 2KQ3A 4X3KA 4WFN3 3NTHA 1MHXA 3GTPB 4XQQA 1XYIA 3DMUA 5G5GA 3MFGA 5EPKA 4CBVA 4ZKCB 5KGUA 1KH0A 4RH6A 2GI9A 3PV0A 4B0EA 3ZJUA 4YXDB 2CHBD 1K51A 4BY1B 4CHTB 1FCCC 1XLPA 3I9V1 3DWAA 4NW2A 3C8YA 2WU2B 1MBYA 1TS5A 3SK8A 2ZXRA 4B9WA 2QILA 4BA2I 4JK1C 1XX8A 1V1PB 2NUCA 4YTPB 2RBMA 4KV6A 2A74C 4MN3A 2Q8TA 3AE8B 2L5TA 1L4DB 1G291 3R8BA 1PFMA 2EVBA 5D65A 4DGZA 1ACCA 2ZW1A 4NJCA 1FCLA 2WDRB 2JYEA 4HCSA 1WTRA 3NQTA 1GUGA 3GQBA 5ELCA 3A7LA 4FXDA 1LT4D 3IT6B 1AWDA 1YJJA 1X32A 2HCIA 2K33A 4G7OC 2H88B 1BMLC 1IGCA 1OXUA 3MJ5A 1A15A 1FXIA 2F0QA 3ERQA 2IL8A 3FVQA 1ZXIA 2INPE 3ZGZA 1TY2A 5JAVA 2WKDA 2NN6G 4KKJA 2WXFA 2NTSA 2F0JA 1RWSA 2ONQA 1AP0A 1JROA 1T3QA