3URYA

Crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
INPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Exotoxin
publication title Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 52
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3uryA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3uryA01
5ELDA 3KLSX 1CT1D 1V1PA 1I4RA 1I4GA 1DJRD 1SJED 3BZDB 1ET6A 1D5MC 1EWCA 1LTBD 1I4HA 1JWUD 1PTOD 3MFGA 2XN9C 1PYWD 4DXFA 1SBBB 1SEBD 1BCPF 1UNSA 1V1PB 4RH6A 4RGNA 4K6LA 1XXGA 2QILA 3EFXD 5ELBA 1YN5A 1DYQA 1BCPB 1PTOC 4RGOS 3SEBA 2J4XA 1CQVA 1RD9D 1RF2D 1RDPD 2CHBD 3O13A 3BYTB 1G8ZD 1TS5A 1BCPD 1CHQD 5D3DA 1LTGD 1FNUA 1L0YB 1S5BD 1HTLD 1LTID 3URYA 1S5DD 1CHPD 1TS4A 1LTRD 3R2TA 2AQ3B 3OWEB 2ICIA 1I4QA 1LO5D 1PRTF 1F77A 1TS3A 1BCPC 1YN4A 4L63B 5I4DA 1D5ZC 1JR0D 3GP7A 2QEJC 1EU3A 1M4VA 1TY2A 1LTTD 1FNVA 2Z8LA 1GOZA 1PRTB 1EU4A 1B1ZA 4OHJA 4RCOA 5FKAC 1SE4A 4BWGB 5TSSA 3R2IA 1L0XB 1QILA 4RGTA 4DXGA 4Z9CB 2WV6D 1HA5A 2IJ0A 5ELFA 1PRTD 4RHSA 3BVMA 1KLUD 1LTAD 2NTTA 3MC0B 3BVZA 2SEBD 1SXTA 3DWQA 5D3IB 1S5ED 2R61A 1T5XD 1MD2D 3V05A 3W2DA 1AN8A 1YN3A 1PRTC 4L6TB 1TS2A 2AQ1B 3TSSA 3CHBD 1KTKA 1BXTA 1SE3A 2RDGA 2XNAC 3R8BA 3BYYB 1JWMD 1AW7A 4O1NA 1SJHD 4C56C 3EA6A 1CK1A 1D5XC 1STEA 1I4XA 3DWPA 4NZLB 1LLRD 2NTSA 1PZJD 1I4PA 1FNWA 1HXYD 4RHRA 4ZYSA 1V1OA 1PZKD 1S5CD 1PTOH 2IPKD 1EEID 1JWSD 2G9HD 5FK9C 1EEFD 1UUPA 1RCVD 1B44D 1ESFA 2RDHA 1EFID 1XTCD 4TSSA 1LT5D 5ELEA 3DWAA 2O2LD 1HQRD 1LT4D 1JCKB 3BVGA 1LTSD 2TSSA 2XRSD 1TY0A 1KLGD 4RGMA 1PTOF 1ET9A 1ENFA 1FD7D 1LT3D 1FGBD 1S5FD 2XRQD 4RFBA 5ELCA 2AQ2B 1PZID 4UDUC 1SE2A 1LT6D 1D6EC 1JQYD 1PTOB
chains in the Genus database with same CATH superfamily
1SSNA 3ERQA 1V1PA 4AYBG 3AU4A 3V60A 1DJRD 2BYVE 4JK1C 4OZAA 4UHVA 4A3KB 1XTDA 1LTBD 3H0GG 4C3JB 4A3MG 1P98A 4POGA 3H3VI 4HPPA 4DR6L 3MHBA 5C5LA 4IO9A 4PG3A 4B9XA 3RZOH 1ESRA 1BUIC 2K04A 4HJKA 4K8JA 3HOUH 2Y0SG 1YN5A 5BMHA 1MHHE 4JBWA 1PGAA 1E10A 3K5LA 4LFCL 2F0DA 2NCNA 1R9TB 4KSLC 1IBXB 1N32L 3T56B 1CKOA 1O7IA 1C4CA 5I9OA 5IGCA 2C7MB 3Q8AA 3O13A 3HRDD 4AOFA 1C4QA 2RDFA 4HCSA 3DVNV 1GKHA 1TS5A 2L83A 4F7ZA 1CA6A 5D3DA 4CKEA 1FNUA 3N32A 1HTLD 4DV0L 1UE5A 2WXPA 3MEFA 4H02A 2BWFA 1U9RA 2PIAA 1HZBA 3CC4A 4PS7A 1VS0A 2RPQA 1PRTF 2KQSA 3ZIMA 2WXQA 3AE3B 3CCQA 4LW1A 1R7SA 2D5GA 3GP7A 4A3DB 3N1ZC 1UEBA 1F9RA 4LF6L 2BB6A 2KVZA 3VYTA 5IE8A 1STYA 1WIAA 4JI8Q 3KF8A 3EN2A 4DV4L 4DR4Q 4K0KQ 4B3TL 1NYRA 4OO1G 2MSED 1ZUD2 2BYFA 2OJRA 4MGKE 4RNAA 3VRAB 4YIJA 3RNFC 4RF1A 4EZJA 3PUZA 1TT5B 4WFN3 1YQBA 4IOAA 2WX0A 5KYIA 3P4PB 5D7GA 1IBLL 3NTIA 4QJFA 4YY3Q 4LF4L 3GTMH 4DNRB 1EY8A 1MJCA 4JYAL 1XO3A 2A6EC 2KECA 4FXGC 1SE3A 2VW9A 3PRMB 2K6AA 4X3SA 3BYYB 4YHHQ 3M9BA 3BY4B 3EIVA 1VQ7A 2JA5H 2AL3A 4PYZA 4II3B 1O80A 4LFBQ 2HQLA 1WTOA 2FCSA 2LRWA 2CH4A 2V9HA 3M7GA 5LMNW 3FAHA 1Z6HA 3H1UA 5LXIB 1K8GA 1P9DU 3UDFA 2DAJA 2N1WA 3IAS1 3WALA 1NMFA 3R3MA 1GPXA 3R3OA 4C1NI 1E22A 2F0FA 1L5PA 3N9YC 1JT8A 1JB7A 4GLXA 4BY7H 2E2JB 4AQYL 3ICEA 4A3FB 2WB1G 1NR4A 1EM7A 1E8XA 5EBCA 2VUMB 1OEYJ 2KQ4X 5IOCA 3SR6A 2JSVX 2KEEA 2CHXA 3C8YA 4BBSH 4JIOU 5IP9G 3BG3A 2A6HC 1MSHA 1X32A 5M3MG 1PMRA 1II3A 1VQEA 4EFOA 4NAMA 4TKNA 1PH9A 1FYCA 2MBHA 5C23A 3PUWA 2EZVA 1JQYD 3QWZB 5ELDA 5HGQA 1I3QB 5FLXE 4X65L 3E3XA 2NBFA 3CAMA 2ASQA 3W1SA 5CV9A 1LTLA 2YEPF 4LF8L 2EMSA 1EWCA 2XSCA 4I6PA 4A3IH 4CJ0B 2INNE 1K83H 1VQPA 4N8FA 1TGZB 2WP8J 4DK6C 4NXNQ 4A3GG 3QIJA 3TZUA 3M4YA 1BDOA 4A3BG 3SK8A 2NVXB 1G2SA 3DXJC 3HRZC 4LDTB 1TWCH 3VR2A 1PHJA 4L5QA 3NS1A 4DR1L 3NE5B 2J4XA 1SAPA 3TQYA 1Z7TA 1AE3A 3KUCB 4GDKB 5GAEC 4N9TA 3VAWA 3FHWA 2B2WA 2WXFA 3NWTA 3OAWA 4JV5Q 4NY0A 1K53A 1WJJA 5CC4A 4NP5A 1QF6A 1EYDA 3UQAA 4B0EA 2H89B 1JORA 2JUOA 4KZ0A 3I4NG 5C4JH 2B3AA 1LQBA 2INPE 4HJGE 4C00A 1EZ6A 3LJ3A 3KF6A 4F88A 5IWAL 3Q24A 3RZOB 2UU9L 4AH6A 2RPVA 3I8ZA 4DNIA 3HOUB 4DR6Q 2IDYA 1I35A 1EU3A 3KBGA 1KF6B 2E2IH 2D3GA 3QCAA 1QVCA 3UINB 4OHJA 4AS1A 4JI6L 1QG7A 3F1ZA 4B95A 4FADA 4DXAB 2LXAA 2G4DB 2ZNVB 2EDGA 5IO9A 2GVBA 2B2UA 3FEWX 4LFCQ 2PKOA 1NTGA 2C9OA 2V0GA 1N32Q 4RM8A 2A6ED 1QUQB 2WINB 4MIUA 1EIYB 1FMAD 2MBEA 2ZPNA 2F0PA 4DR5L 3B1LX 2J42A 3M62B 1J0GA 3MAQA 3B0AA 3AN1A 3SR1A 2SEBD 4HIMA 2O6VA 2E76C 2MA9B 2DYBA 4DV0Q 2K6QA 1AN8A 4IUTA 1WZ3A 2NMQA 5KNDA 3H7SA 3HOVG 1S3SG 1YBYA 3CHBD 4J6HA 2BH2A 1G291 2KWDA 2SNSA 5FR3A 3TRZA 2DWQA 3S24A 3R7RA 3A55A 1JRPA 5CGKA 1EOTA 1HR0L 2JX5A 5DCNA 1PH7A 3I5JC 2KWCA 4DAVA 3HOZG 2KX0A 4HDQA 5IP7H 3JYUA 4LF6Q 2F52A 3RNBC 4XE0A 4B3TQ 1B9NA 5LNK1 4RHRA 4YXDB 1WTQA 1LM0A 3UF8A 1HFGA 4CO7A 1VCIA 1VQ6A 3K7AH 3GTMB 2A69C 4H44C 1J8IA 4FN2A 1SNMA 3Q8DA 3KYCD 2RDBC 3KH0A 4GKKL 4ID6A 4KSKC 4DN4M 1IBLQ 1HE8A 4LF4Q 3L3OC 1OXSC 2TMPA 5JJLA 5FOBB 4I6NB 2A6HD 5A2QL 2ZJDA 3A4SC 2PI2A 4YCUA 2FHTA 4LF7L 3MXNB 5ELOA 4TSSA 4B3RL 2Q2UA 2GBRA 2Q2TA 3V6EB 2JA5B 3KK7A 2HT1A 4FHJA 2N9LA 2D10A 1HNXL 1LABA 1ET9A 3I90A 1SNOA 2JYOA 1PH3A 2JA7H 4PNYA 4QF4A 5KYLA 4K7WA 3TUOA 4E74A 2IY0B 1L6UA 3A1QB 5FR6A 1VQIA 2FIDA 4JI2L 4K5XA 2MJDA 1VQKA 1CT1D 4OZBA 1I4GA 1C7YA 2LASA 2KUMA 3PUYA 4DHZB 4GN5A 3H7PA 3UDGA 1A15A 1C4AA 4BY7B 1STNA 2XN9C 5BN4A 1RLFA 2UWQA 3K7UC 1V9PA 1CSPA 1FJGQ 1STAA 1F52A 3Q2AC 1E8ZA 4RH6A 4EZKA 1XXGA 4AQYQ 1FO4A 4BBSB 3OYYA 1J7CA 1AP0A 2ZTDA 2DGYA 4W9FA 3CF5A 1BCPB 4RGOS 4ODGA 1TWFH 2D07B 3VR4A 5K5PA 1BO0A 1RD9D 1V1QA 4FYDA 3GTJH 2HHHL 1TVXA 3CCRA 2KJRA 3T53B 4N9PA 1EYCA 3J80L 1Q7YC 3ZW3A 4N9F4 4X57B 4XQQA 1SMYC 1JALA 1TXYA 3ULLA 1WXQA 1TS4A 4A3IB 3N20C 1K83B 5JXVA 1GHKA 2JYEA 1L1OB 3AEEB 3HVDA 1KLVA 4LF8Q 4C1NK 4FF3A 2MP2A 3LDZE 2E74C 3AE5B 4B9WA 2W3SA 1TWCB 2OQKA 1HZAA 3QARA 2LMCA 3TREA 5E6JA 1QZHA 1YJJA 2W82A 3NVVA 1MI2A 3ONSA 4DR1Q 3S2HH 2O5JC 2Q5WD 3TBLD 2KHWB 1BBUA 2NB0A 2OQ0A 1OFFA 1HA5A 2JZZA 2IL8A 2RBMA 1TWHH 5IYCG 4JBMA 2LVOA 2MUYA 4NJ7A 4NXML 1ZDXA 3S9WA 2B2VA 5C4JB 1LGRA 1VQHA 3SE0A 2LGDA 2ZZPB 3Q6BA 4EZLA 4JG2A 1KJTA 3OIQA 2WXGA 4J15A 2DZIA 5HG2A 2EY5A 2RDGA 2QF7A 5IT9L 2F4VL 2E2IB 1KOTA 4IPGA 1ZXTA 1TZ1A 5IWAQ 1H4RA 1A70A 1K9MC 4KN7C 2UU9Q 4F87A 2K1FA 5IAAC 5D2MB 4C56C 4XGAB 2R92G 2OTJA 1MFWA 2KN5A 4G7ZC 4K7UA 4OWTB 3E0EA 2ZM6L 2A69D 1K73C 2NTSA 3DLLA 2F3IA 3IXSA 4N59A 2JJQA 2PQAA 2GOWA 3P20A 3X3MA 2CJOA 2K8HA 4IWPA 5C3WA 5FO9B 3IBEA 4A90A 1HCZA 3VR8B 2EY2A 3NENA 4FXCA 3DBHI 1Z9FA 4DR5Q 1VMCA 3QR8A 2F0TA 2BKRB 2JA6H 3DDCB 4LJPB 1QOHA 3QWNA 3PQIA 4N6EB 4H7BA 4ANUA 3VYRA 1VQLA 4BA1I 2EMTA 4FXDA 2Q8RE 1ASYA 1TBEA 4XWTA 4IN3A 5IGFA 2JU6X 4WWNA 1SNPA 1HUMA 3MEHA 1QWYA 4MDKE 1ASZA 4CBVA 4XC2A 4DQOC 2LUMA 1S5FD 5EJWA 1HR0Q 3PVLA 1WCMH 2NN6I 3A74A 1WX7A 1BF4A 5T8IA 3KLSA 2JZ3B 3FKIH 3CMEA 4BY1H 3NWSA 5EAYA 2WLBA 3K7AB 1PGXA 4IM2A 2RD0A 1CZWA 1EQRA 1K8MA 3U52E 4PV1C 4R4IA 4OWWB 1I50H 4M8MA 4PMWA 2D3BA 4GKKQ 4GDLB 1RKNA 3F2UA 1NY4A 4IFDG 4JE3B 5CV8A 3FMCA 4X64L 3VYUA 4II2B 3TEZA 4B3RQ 1WTHA 1SROA 2Q2HA 1SMYD 4PZ7A 1GM5A 4AYBE 4QQBX 2JA7B 1K50A 1C79A 2KJHB 3RN2A 1HNXQ 2J53A 4DV3L 3Q6SA 1JC7A 4LF9L 4LTUA 1NAPA 2CKZB 3MWYW 2AWTA 4LDTD 3RZFA 5IP4D 1ENCA 1VMPA 4JI2Q 2G3QB 2EYFA 1WTXA 1K8OA 2J0MA 5EE0A 5EBDA 4PZ8A 3U50C 2ASBA 2UUAL 2ZJPA 2Z6BA 3HOWG 2FUHB 2PE9A 4TQ1A 2Y0SE 5HFYA 2ZXOA 5JEAJ 2ICIA 3H6NA 3HM6X 4YTMB 1EOVA 1BCPC 2GVAA 2Z9HA 5GADC 3GTLH 4ZRZA 2GRIA 3PRZA 3Q3JA 4HKQA 3KQ4A 1VQAA 5KGUA 3NVYA 3P1HA 1QOAA 2VB2X 4A3EH 2LHDA 1TWFB 2G9DA 1OEYA 5CTRC 1TU2B 2ZCCA 3D8GA 4Q0FA 3OHXC 1N36L 3GTJB 1WRIA 4R3DA 1EQTA 1ENAA 1SB3C 2B2YA 1QE6A 4ZRKA 2F0QA 4IWOA 3CD6A 3CXCA 3CSFA 1E2ZA 2WV6D 1KH0A 1JE5A 2EXZA 4IM3A 4KZCA 2RCNA 1BKBA 5A35A 5IYDG 2HHHQ 4MELA 1L1OC 2AMCB 3DCGA 3KOJA 2Y3AA 4KHZA 4CDFC 3J81j 1MPEA 2M4NA 2BYEA 2L32A 2KAJA 3CSTA 4BBRH 2V1YA 5C0XG 2XWBB 2PJHA 4L6TB 2MBOA 4M02A 2KTRA 2Z1CA 5J18A 1X3PA 1PH1A 1E8WA 5J2RA 1Q1BA 4HXDA 4ARCA 3PO0A 4KN4C 4P71A 3PLVA 4A93G 5DNFA 1WJNA 2AEHA 3S2HB 3E9IA 4MSQB 4BBNC 1VLBA 2IGHA 1E6EB 4A8XC 1GB4A 1TWHB 4L1BA 1FNWA 4R8IA 2LXJA 4IZ8A 3VHTC 1YNTE 4WJ3M 3ZNID 1PTOH 2N3SA 1PGBA 3GTOH 3P4RB 4TQUS 1I7HA 4O0AA 1VQCA 2J7QB 1L0WA 2L52A 2EKEC 1XLOA 4NXMQ 5GQOA 2IY5B 4GMVA 1UUPA 1KRTA 3EFUA 4ZUIA 3L4PA 5C2TB 1STGA 2B3GA 4DHJD 1QNKA 1EFID 1BQQT 4E71A 4ZRJA 1TT2A 2ZXRA 2O2VB 1MG4A 1K52A 4PS8A 3J80i 4W9CA 2F4VQ 3DEPA 2CR5A 5EE1A 2QW7A 5C1ZA 2MJ8A 5G3LF 4DUZL 2OWOA 5ELCA 4OL7A 1O7LA 4WJ4A 2K5PA 3QHTA 2WQYB 3KBXA 4HJ5A 1AYFA 3UDXA 2ZM6Q 5KNCA 4FA6A 4JCVE 3K8AA 2FCNA 1YHBA 4A3JG 1I6VC 3ETRA 1HHVA 4KD3A 5K36H 4ANWA 2QC8A 2BDOA 2WB1E 2GI9A 3ZYYX 2JA6B 1Y14B 2K5DA 3H94A 5A2QE 3CQZH 1SSOA 1G2TA 2KDFB 2KQ7A 4C2MH 2BW2A 2CKHB 1IL8A 2K5VA 1NI3A 5DPSA 4FJVB 5M9OA 1KNEA 3LWUA 3SVMA 1L4DB 1DXMA 2EY1A 1FIQA 2QGQA 4LNOA 2F0HA 1VQDA 4KJOA 2C7HA 2M8SA 2JE6I 3B9JA 3UGBB 1WCMB 3EJIA 5I2XA 2KC2A 3Q3OC 5BMIA 2OCEA 3J81c 4CJ2C 4HDOA 1YITA 4BY1B 3ENEA 1VZ7A 2NPTA 1PFNA 2F3VA 3EROA 1BCPD 2D2QA 3A7AB 2D9UA 1K0SA 4JWUC 3SK4A 1LTID 1HPCA 1A2UA 1WFQA 4CKCA 3NSWA 1I50B 4A3KG 1SNQA 4C3JG 5COYA 5EPJA 1J5EL 2KCNA 3HGBA 4YCVA 1LO5D 4CHTB 1HTOA 1TS3A 1VF7A 2PPHA 2WDTB 1D5ZC 1JR0D 2NR2A 3SD5A 3ECIA 1B8AA 1H8CA 3SK5A 1TKYA 4CJ1B 4MM3A 3RZDH 4GIVA 1AZQA 4X64Q 1J7AA 4LNFA 2VXWA 3J80E 1Q12A 3NK9A 2Z6KC 4WWPA 4XYOA 4DXGA 2JT4B 4G57A 1TZOA 2M1MA 2RSUA 3OWFA 5JEAG 5ELFA 5I2YA 4IOIE 4DV3Q 4DR3L 4DK0A 3C3LA 4IOCA 2F0KA 1OQQA 1RAXA 4NNJB 1E7VA 2KXJA 2BS2B 4M0WB 4W9LA 3Q8EA 1TJEA 4GOPA 2CWPA 1TYGB 3NQTA 1M90C 3GTLB 2UUAQ 2DJGC 5C6AA 4S0RA 2PE6B 4XQJA 1C1YB 2LGSA 4JWSC 2PMVA 2WU5B 2WP9B 1B53A 1YNNC 4XQNA 4A3EB 1PA6A 1GUNA 4A3DG 1JWMD 3R7QA 4KK7A 1LYLA 1SJHD 1QJOA 5F2DA 1IXRA 5ELNA 1YX6B 2RMMA 2WXJA 3A5UA 2GBNA 2N0SB 4EEWA 2A8VA 1TQOA 4IPHA 2KBNA 4LWCA 1N36Q 2FNJB 1A5RA 4MSMB 1DOXA 3PO2H 2DLBA 2WWZA 4WIPA 3Q3NC 4KKTA 2LUEA 2KWUB 1DOKA 4BBRB 5FK9C 4EE2A 1FM0D 5IT9E 2UXBL 1PH8A 2R93G 2JVCA 1HNWQ 4S3SA 4L5SA 3S17H 3H3VH 2YTYA 5JOBA 1X54A 4GOCA 1LT5D 1PYBA 1V5OA 4DV1L 1DM0B 3DWAA 4KTAA 3V6CB 1X6OA 2NVYH 3RNCC 5BYQA 4FXKC 3Q14C 1B2TA 4G50A 2B29A 1LT3D 1VR9A 2K50A 5AJ3L 1CKNB 4OIJA 2B63H 4HCNB 4RA8A 1B50A 2NUCA 2ZT9C 2I0QA 1KAWA 2G45B 3C1EA 1PTOB 3GTOB 3KLSX 4ZYNA 4NKLA 1XCQL 3ZNHB 2Q8IB 4HR7B 1XPOA 3VA7A 1T0SC 1SRUA 4NDXA 1L2NA 2EYPA 4QCLA 2E3TA 3DM1A 3PSIA 3KLRA 1EWYC 1U4LA 2K22A 3N6RA 1N5XA 2D11A 3ZGZA 1WYDA 4P1BC 2KYWA 4A3FG 3CC2A 1V1PB 1VF5C 2X6GA 5I6YA 3S1QH 2XK5A 3FKYA 4G0NB 4TKOB 2VUMG 1U0LA 1WX9A 3CCLA 4Y52H 1LXDA 3HKZB 1DGSA 3PZDA 2LXCA 2G4SA 1IYFA 3G4SA 4HJ8A 3JAML 1QVGA 2K01A 4A4IA 3A4RA 2SNMA 2DHZA 3ZJVA 2B8FA 1GUWA 3M4OB 4AQ7A 1CZGA 4LF5L 1F2RI 1C9FA 2ACZB 2F0UA 1WJ4A 2EPBA 5CHFA 3VA5A 1L0YB 4FP5D 1GJXA 1NDDA 3S16H 4RKLA 3AE1B 5E6OA 4IPDA 1PFMA 3CQZB 3UQBA 1YEZA 2IZVB 2ON8A 3VTVA 4C2MB 4A3MH 1FEHA 1YHQA 2LEKA 1I4QA 5GAHC 3IFWB 3TEHB 4L63B 4DV6L 3ND8A 2CW0C 3ZUNA 2J52A 2LFNA 3RNGC 1O7ZA 2L3ZA 4DV2L 1SIJA 4NJCA 3MC9A 2YTVA 4HN7A 1PFDA 2MRPA 1XMQL 1QILA 5GAGC 3FVQA 1PFBA 3GV3A 5EKLA 1UE6A 3Q8BA 2A5UA 4YT0B 3T9LA 1Y69U 2LJ5A 3MC0B 3KF8B 2NWGA 3WOEA 3ZXVA 2NVUI 1YNND 4MN3A 1P7EA 1ZE3D 2EYLA 4ME5A 2KOLA 2KMCA 3DWQA 1S5ED 3UDIA 3P63A 1MIUA 5IGGA 4HCEA 1NEKB 1L0VB 1J5EQ 2LGXA 2LI5A 2BF8B 3VYSA 3HOUG 2KANA 4PMBA 3RZDB 5JH5C 2JY6A 4BAXA 4ZLTF 1LM8B 1CA5A 4KHPL 1G6PA 1TR5A 4Q2JA 2BT6A 1Y56A 3PMFA 1EWIA 2X8XX 2F0NA 5HURA 1ICFB 3QK0A 4PT5A 4ME3A 4P75A 2AL6A 2R7FA 3GZNI 1E0ZA 4C4VA 1YVCA 3DEOA 1Y1WH 1E7PB 2CHWA 1RODA 4IJHA 4KLKA 4CHKA 2HIVA 2JA8G 3K5NA 1WXSA 1RCVD 4RKBA 5I6WA 2WX1A 2VNUD 4QGUA 3JW0X 4BS9A 3RNAC 4A6QA 2V4DA 3BU2A 3W1GA 1D7QA 3RN9C 4ASWC 1WMHB 3TMPB 4D2KA 4ULLA 3TIXA 4G7OC 2A73B 3H15A 3PO3G 3Q0AA 3FC4A 1FD7D 3HEJA 4HIDA 1XCTL 4GN1A 5EGTA 1WXAA 1DOLA 4QUFA 2K0PA 2RCFA 2QDBA 4PMCA 3PO2B 1E8YA 4M8NA 1EWHA 2QSDA 1R4MI 1GUAB 2EY6A 1A62A 4N8X1 2EQSA 4BZAA 2NBUA 3DVGX 4DBGA 3W5VB 2KLCA 1I4RA 1KDAA 3RI7C 3NG0A 1U5KA 3W9CB 1GC7A 1DD2A 1YD8U 3MTSA 2IO2B 3P4SB 4GN3B 4A3LH 4DXFA 5FLMH 3I56A 3S17B 4GZYC 1IYVA 1K8AC 2JEBI 4FNFA 2K8BA 3DVGY 1BCPF 3CF6E 3QA8A 2NVYB 4LUVA 1D2BA 1ZPSA 5ISRA 5BR8L 2K8CA 1J6QA 2C5CA 3WWVA 3X3NA 2JA5G 4BKSD 2R7DA 2L0CA 1DYQA 1PTOC 4DV1Q 2B63B 2JSOA 1V6EA 1KABA 1IGCA 3DHGC 3U7ZA 5E6NA 2DNFA 2VQEL 3LXFA 1EIFA 5M3MH 2Z0EB 2FINB 3KJOA 5AJ3Q 1G8ZD 5H8YE 1CUKA 4IUQA 4XYQA 3Q22A 3MXUA 4IWQA 2CW0D 2KEDA 2B8GA 3GV6A 1KRHA 2QCPX 4J8QA 4APVA 4BY7G 4YWLA 1AFPA 1FFUA 2AQ3B 3ZQ4A 5DPWA 1HA6A 5HI1A 4FVMA 1OTRB 3S1QB 4RAUC 2W9NA 2Y5BB 3X23A 1R4NI 1J19A 1HNZQ 4K2KA 4R4QA 1HTQA 1T6BX 1LTTD 4BBSG 1EQVA 2IGDA 3TP6A 3CMMB 4GLSC 5E4XA 2VH1A 1NSNS 2LZ6A 3FILA 3HUIA 1HR0W 1G91A 4MZ9A 3KJPA 1XJVA 3IG3A 4WQMA 1WGGA 3RT3B 4BBNF 4PQXA 4X6AH 4BOZB 1SE9A 3ZNZB 4IURA 1B7YB 1F2YA 2MH7A 3NHEB 1B4OA 1K3BC 4RHSA 4AYBB 4LUOA 4KJNA 3S16B 2N78A 4GLVB 4IUPA 1NENB 2F0JA 4LF5Q 4L23A 3BVZA 4LK0M 1NVID 3J81i 4A3MB 4FJZA 2B39A 4QL5A 2RSOA 3TEYA 4KIKA 3BDCA 1WVLA 4K81A 4K6DA 1KC8C 2NVQH 4XWWA 1GJZA 4TMAB 3MC8A 1BT0A 2AYOB 2ALYB 3FP9A 1FCCC 4OONA 4J6IA 2RVLA 3ONAB 4ZQ3A 2KWVB 2Y0SB 4DV6Q 2O6VB 2PYKA 1WTVA 2FE8A 2IGGA 4HEA1 1KRSA 5JVG3 1JOQA 1VQ9A 1MVKA 1NBFC 3U4ZA 4DV2Q 3RMHA 3S1MH 4JX1C 2HJ8A 3KYHC 1XMQQ 4DNTB 1ONLA 3DQVA 4LNIA 1S5CD 2SAKA 4HMIA 4DV7L 1RRBA 3L54A 4BA2I 4MGYE 2K33A 2D2CC 2X38A 3HG9A 2JQRB 1QB5D 4B3ML 2KD0A 4GDKA 3C0RB 3B2GA 3JAMi 4HK2A 2X6LA 2L12A 5L37A 3AU5A 2M2LA 4WQOB 2VL6A 4KKJA 2JXXA 1UE7A 3WAMA 2K5QA 3BVGA 1ML0D 3MJ5A 3HOZH 2AWNA 1IBKL 2XRQD 1FGBD 4FULA 3BK2A 4JPSA 1PZID 4KHPQ 3BWUD 1SE2A 1WTPA 1NYQA 3HM3A 4DV4Q 2L5TA 1D5XC 2M0AA 2D0OA 3NY5A 4XTCS 2BGFA 4AP4C 2PCFB 1CQFA 1KL9A 1Y1WB 5CX3A 4DHJB 1SDFA 1XLPA 3MHSD 4MTKA 4DAYB 4IM0A 5BMGA 4LUZA 3VR6A 3NRZA 2R2OA 1M8AA 1PTOD 1SNDA 2K25A 1SYCA 2E8GA 4PK1A 3DHQA 1R4NB 3Q3FA 1OXUA 1XPRA 4JYAQ 2Z59B 3RLFA 1BBXC 2HDMA 3H7PB 1IYUA 1XF5L 1F2RC 5IP7G 3SU8X 4YTNB 2R7ZH 1NMGA 3RULA 2A74C 5JJIA 3KWLA 3T3NA 2CHBD 1SR3A 1F9JA 3JSVA 4IFDJ 3PRPB 3VUYA 2MBBB 5LMUL 3AEBB 3TCAA 3CC7A 1NNXA 1I5FA 3CMAA 3H3VC 3PHXB 3ZKJC 2C60A 3A8KE 4WURA 3P7JA 3URYA 1HFNA 3SHQA 1CHPD 4MHEA 3PF4A 2WDVB 5CYUA 3TP8A 2OOBB 2FXQA 3W1SC 4CDEC 2K5WA 2ES2A 1OGWA 4MTNA 1F77A 5G3LD 5IYBH 1QVFA 4NAWB 5D14A 3IL8A 3LX0A 4Y7NH 1RYJA 1CJEA 2OEOA 3JVZX 5BYRA 3JAME 1VCBA 1OQYA 4DK5A 2QDLA 5BR8Q 3W1BA 4LNKA 1E24A 4ALPA 2HCIA 2GBJA 5M3MB 5M5WH 1ZEQX 1HEZE 2BH8A 1WM3A 4RGTA 2MP2B 1GXDC 2WXHA 3RFZB 3F2BA 3PGZA 3DBLI 2VQEQ 3K5MA 1W6KA 2N8NA 4DK3C 2P5ZX 2D3AA 4U673 1IP9A 2B2WC 1K51A 2IHEA 2MJEA 4IJLA 4CDDC 3M4PA 4HTHA 4X65Q 4C7ZA 1GNUA 1YN3A 2K9XA 2PO4A 3DPDA 3K0YA 1PFSA 2YLMA 3MA2B 1PXUA 3ZTCA 1BXTA 1MJDA 1MI0A 2AHOB 1EY9A 4H13C 3ABVB 1XEEA 2N9KA 2QA4A 4GS3A 1E5WA 3TN2A 3I70A 4LK1C 1FFVA 1AE2A 4ZKCB 2CWAA 5C0XJ 2O5IC 4WJPA 1ZYRC 1CI3M 3SDLC 3BDLA 3PSEB 1YI2A 1PZJD 3SHLA 2NN6H 1XWEA 1Y1VG 4HAEA 4P7IA 5AUKA 5LXHA 2L1AA 5IYCH 2L7RA 1XD3B 1F9PA 4PYUA 1LACA 1Q46A 4XDDA 2IBIB 2W55A 3X0WA 1YJ9A 3DOWA 1M1KC 1EZ8A 4DR7L 2CU3A 1PH5A 4AWJA 1JW9D 3T4AC 2NVQB 4A20A 5EQ0A 4BKGA 1ISNA 1N5WA 4ZKBB 3L9AX 3GOEA 1E1TA 2LRUA 3M95A 3HZXA 1ROEA 5C4XH 1V80A 2CHZA 2EJGC 1X3EA 2O2LD 1JCKB 4JI4L 1QZGA 3KDFB 4JQWC 2L00B 5DM63 5C44G 3S2AA 4W9JA 1IPGA 2R92H 4JPBW 3S1MB 1JWAD 3AEFB 2N4FA 4HPLB 4E3CA 3K0XA 4UDUC 4JI7L 1D3ZA 1OXXK 3HK0A 5IA7A 4JI6Q 3M7NA 1GC6A 3I9V1 3Q8FA 2QKIC 1SNCA 4P72A 1WFYA 3GTGH 1OTCA 4KVGB 4YWMA 4WWOA 2NZ1D 2MO0A 3C1FA 2ENBA 2KN4A 4DV7Q 1X3QA 4G3XB 4EUTA 1BNZA 3AH7A 3TDQA 2NBVB 1YMHE 2WS3B 3J7YW 3GO5A 2N49A 3GD7A 4EVOA 1TKEA 4NMZA 3APFA 3RPFC 4B3MQ 1ILQA 2YYZA 2L76A 2WAQB 2L4NA 2Q2IA 4YWGG 2K5HA 1STBA 2OF1A 4XZ4A 3HOZB 2K75A 3RLNA 2L15A 3SEBA 3G71A 3AEVA 2M00A 1WR6E 3NZSA 1JB3A 5EE9A 2MW5A 1MGSA 1KFYB 1TIID 3U8ZA 2UXDL 3DBLB 1NCVA 1SYGA 2H1EA 1XPUA 5D6JB 4GNXA 4AJWA 2Q8TA 4OWXB 1WTRA 2I07B 3QQ8B 4XT3B 1SFOH 3VXWA 2EYHA 4LJOB 1UF0A 4I6LB 1G6JA 2JA6G 1T0RC 1AARA 2LGYA 2ZW1A 4GKJL 1I6HH 4A75A 4HROA 2MLBA 1IW7C 4I65A 4V0BA 2E5LL 2WXRA 4ZOHC 5CHVC 5G55A 5DEHA 1GOZA 4LF7Q 2IX3A 2R7ZB 1WCMG 3ZNGC 4ZHPA 3P75A 4A9AA 2G5DA 3S14H 1L0XB 1GUTA 4BY1G 1BBWA 1GUOA 1KIXA 2JP1A 4HPMB 4CYEA 4EQPA 1RM6C 3J7AV 2KA7A 3ZRCA 4FO2A 2ZVNA 1OXTA 5LMUQ 4GGQA 2NS5A 3OJ4B 4IALA 3NPPA 1A63A 2KC1A 2NVTH 3HOWH 2RGFA 3OW2A 3A9KB 1VQBA 1ZYRD 1RFAA 3VTWA 3AM9A 4LJZC 4Y7NB 2RHQB 1MHXA 5AUIA 1KXLA 3NS8A 1N9WA 4UP8A 5T1IA 1V2YA 2QHOA 1UAPA 4TQ0A 4KMUC 2QCZA 4JOIA 3W5OA 5M5WB 2IX1A 1FXIA 3EA6A 3TS0A 1TKGA 3AE4B 3CRLC 3M3YH 1STEA 3H8HA 3T1HL 2EOTA 4FLHA 2KTRB 3HOYG 4OZCA 4XT1B 1UGMA 1DGJA 2UU7A 4EOYA 2O6VD 1DCZA 3AEDB 1V1OA 1D1IA 1PZKD 4JI3L 3I55A 2KMAA 2F0IA 3QO2A 4QIWE 4C3HH 2L9HA 2DZKA 3DBHB 3TP7A 5JJKA 4M8AA 3GS2A 1H95A 2N9PC 5C4ZA 1KM7A 5FLXc 3D32A 4IFDI 1B9RA 1X55A 2OXPA 3U2SC 3PZ8A 1GAQB 1P7FA 1LT4D 2KVMA 2KFJA 3BZKA 4RGMA 2MFIA 1KAAA 1PTOF 3AYHB 4R4CA 1KD1C 4V190 4A93H 4YL8A 1JWBD 2N1VA 1S3OA 3DBSA 1HTPA 2IWHA 2BDNA 4UAIA 3K5OA 2V3NA 4XYCA 2B2TC 4L8JA 3I4MH 1G51A 3BZDB 4WWMA 4BBRG 2E2DC 2GA4B 1XNQL 3MTNB 4P16A 4OVUA 4K2LA 1JWUD 3GQBA 4DR7Q 3ALBA 3KYDD 4R4TA 4L5TA 5C4XB 5AEKB 5IGEA 4KV2A 2LJIA 2PZWA 3HFZB 3T8MA 3EFXD 1IZ6A 1JJGA 3NOBA 4JC0A 2F0OA 2PQEA 3OMCA 5J1ZA 2R92B 1U4RA 3UIPB 1JJCB 1JJ2A 2MP1A 4JI4Q 3AECB 3AULA 5M5YH 1WM2A 5NUCA 4RCNA 3L2PA 2XIWA 3NBHA 3GTGB 4HWIB 5BN5A 4DUYL 1HRJA 4JI7Q 4MJSA 3UE1A 2ZJRA 1CHQD 1IW7D 3VR5A 1QCBD 4LFAL 2MHVA 1XMOL 1V97A 1DZ1A 5CV4A 1Z2MA 4P1CC 3TP5A 4A3PA 5JVH3 5M3FH 5J22A 3AEGB 2CVRA 3VTUA 1RHPA 3AB9A 5C0XI 4P6VF 5DPRA 4KV6A 4MH8A 1I42A 3OWEB 4O42A 4M1UB 4L2YA 3NELA 3ZJUA 4YSYB 1IKLA 1YQ3B 3FPPA 3ZJTA 2CQOA 3QX1A 1U4AA 2EYJA 1TY2A 1FNVA 1U4MA 2Z8LA 1GUSA 1WZ0A 3PF5A 1B1ZA 3HKZG 3I3CA 1IUEA 1YIJA 4RCOA 5DLQE 3I57A 1ZOYB 1PH4A 2DN8A 4EGVA 2WKDA 1H9SA 3VQIA 3FKIB 1WJUA 2XWJB 3F2CA 1ZDVA 1SFOB 1U4PA 2FAZA 2UXDQ 3AE2B 4MM3B 2O2VA 1JQ4A 1PDQA 1NR2A 2NTTA 1A8VA 5HGTA 3AFPA 4UP9A 1G6ZA 3HOXH 3VH4B 3L13A 1I6HB 5D3IB 4LNNA 2R61A 4LLGM 4PZ6A 2LD9A 1TS2A 1SYFA 3CRKC 2BWES 3GB1A 3NJTA 3UI2A 4ZHOA 2XVSA 3L7ZC 2UUBL 3R8BA 2F03A 4GKJQ 2G1EA 3ZVVA 3SDZA 1EYAA 5C3EH 3GTKH 3DHHC 2E75C 4O1NA 2E5LQ 2N88A 1EL0A 4NQKE 4IUNA 3ZRFA 3E0JA 4DDID 2UXCL 4MNOA 3S14B 3NZUA 1LV9A 4JVZA 2K03A 4RM9A 1I4XA 2KLGA 3D4WA 3LGJA 1SF0A 4G11A 3A9JA 2XGTA 4R8NA 1I4PA 5JEAH 1KDCA 4K5WA 2JWZA 1ACCA 3EUB2 3OOCA 3PUVA 2NVTB 1O7YA 2G9HD 4DF7A 4LF9Q 3HOWB 2LSSA 3NXWA 4ILWA 4YWKA 1GB1A 2H88B 3SFDB 5EKIA 2HDEA 4HCPB 2JA9A 3EQLC 4XDXA 3TEXA 2JEAI 4HVBA 2OTLA 3L08A 1UH6A 5CHWA 3VH3B 3PV1A 5EPKA 3ZJYC 4DR4L 2DYOA 4A3CG 5FJ8G 3AU7A 5CORA 3M3YB 1N33L 2V4IB 2XRSD 2VZKB 1SLJA 4W9DA 4JW0A 4ABNA 2XBBC 3IT4B 2FIFA 3EECA 3QAQA 3U7DA 5HHDG 3LWEA 4NW2A 5IGBA 2C5LC 5BO4B 1B70B 4IUVA 3T1HQ 5D94A 2FMCA 1OXVA 4DFAA 5I9PA 1EIGA 4EQ5A 1Q81C 4BXXG 4C3HB 2MEKA 4YSXB 1Y8NB 4FBJB 4JI3Q 1MBYA 2D5DA 3RR5A 3HS0C 1N60A 2JN4A 3T51B 2R93H 3N3KB 4B3SL 2VB3X 1F9SA 4KKUA 3AFQA 3G6EA 4C3IH 2JF5A 4HLEA 3H09A 3V3XA 2INDC 4A93B 3J81L 4K14A 3PTFC 2HCCA 4M0WA 1ILPA 2OEDA 3IVFA 4GN4B 3NQIA 2L0FA 1X65A 4MH0E 5L95C 2WXOA 3PO2G 2XK5B 3I4MB 4EX5A 2F0GA 5FO7B 5HKHA 1S5BD 1Q8IA 4MEMA 2F4IA 4DPGA 1LTRD 4KGRA 3RUZA 1AZPA 3BDOA 3IKJA 2KX3A 2F0VA 1XNQQ 1PH2A 2KHIA 1HZ6A 3RLOA 2PW9A 5IKCM 2PZUA 1YJWA 3AEAB 2NYZD 2ZXPA 5I4DA 3M4QA 2JXMB 1BMLC 2IT1A 2QEJC 3DMUA 2ID0A 3ND9A 1K3RA 3U58A 2LFIA 3J7AF 4ZRIA 3T1YL 3RYTA 5M5YB 4RF0A 3OSOA 4BWGB 3U4EG 3R2IA 4RMFA 1ZKOA 1Z47A 2H5XA 2GB1A 4E6IA 4DUZQ 2C35B 1YQ4B 4C80A 1EY0A 3KW5B 4OVVA 3VUXA 1YX5B 4DUYQ 5M3FB 3MP9A 1SIFA 4KX6B 2DJFC 2RQXA 4QMGA 4NXNL 3C2PA 2I38A 4I7ZC 1XMOQ 3V96A 4DKAC 2L05A 1PUTA 3W2DA 3H0GH 1GVPA 1V8QA 3RN5A 3E5SA 4GB9A 1VQ4A 4TV3A 1KTKA 3CCJA 2XNAC 2GLSA 2UUCL 4USAA 3V62A 1UEAB 2AKWB 4RWSC 3EBEA 2X69A 4J3OD 1TIFA 4ACFA 2MPMA 3PREA 1VQ8A 2GMIC 4ICUA 4BOSC 1O78A 2BS4B 2YTXA 4QUCA 3EFCA 1DONA 4KI0A 1JICA 2R3ZA 3Q69A 1P3QU 3TJPA 2SOBA 2DZJA 2HJ1A 4F1SA 1Y8PB 1PDXA 4HKZE 1IBML 4FF1A 2C9WB 4GU2A 2KFKA 2GN5A 3HOXB 2IW3A 2ZW0A 4NJ6A 3VRBB 2IHFA 2KDEB 1BVSA 1DOMA 3L0WB 1YNXA 3Q8CA 1D1KA 3CW2C 2LY7A 2VS1A 1ZGUB 4GOPC 3VUWA 3B6YA 3RNUA 3FRPB 1FRDA 1ZW7A 3GTKB 5C3EB 2I1KA 4C4VB 3A7LA 2A4ZA 3J7A5 1KHIA 3EGRA 2V3PA 1HQRD 5KIXA 2UUBQ 2PVGC 1M94A 4CGYB 1LTSD 1TTNA 1C77A 2WYQA 2RF4A 1VZ6A 1F2LA 2K32A 1L6VA 1JE4A 2UXCQ 1JROA 4OO1H 2AWOA 2MBQA 5EPLA 4DK1A 2E6XA 1IKMA 3MXPA 4HEDA 5EKKA 1PYSB 3OMGA 2M17A 2WXNA 3P2BA 1SJED 2WFWA 5H92C 3ULJA 4DR3Q 2HD3A 1D5MC 2DENB 5H1SE 2XEWA 1UD7A 1YJNA 2JA8H 1L7YA 3PGEA 1MHWC 1PYWD 1GHJA 4F7XA 4JI0L 1HQMC 1UWXA 1SEBD 4C7YA 1SMXA 2J0KA 1IBXA 1UNSA 1X3GA 4ZK9B 1N63A 2N7JA 4B6WA 5IGDA 1H9KA 4RGNA 4HJAA 4P74A 1A3VA 3S15H 1CZPA 4WJQA 3QOLA 2OHFA 3D31A 1VQOA 3PO3H 1KQSA 4EKUA 1CM9A 4XIGS 1N33Q 3CCMA 1PV4A 2PEAA 2I5MX 1RF2D 3SGIA 1S72A 3CWIA 2RA4A 1IHZA 4OX9L 3K9PB 1Y1WG 4IDIA 3L0OA 4QY7A 4OIKA 2ZPYA 1S5DD 4X3UA 3T16A 4X66L 3TS2A 1V9JA 1Y8RC 2F0EA 2R93B 2MWSB 3H6MA 2BS3B 4C3IB 4DDGD 3PZ7A 4KY7A 1F0ZA 4URKA 1PH6A 5CV6A 3B08A 2WACA 5IIFA 2LXKA 4B3SQ 2UXBQ 1P0RA 4CQNA 4IUMB 3G48A 4F8MA 1Q82C 1F9QA 3D4RA 3U9SA 1C4PA 2IO1B 5FKAC 4NQLB 2DAFA 2YV5A 2ONQA 5TSSA 1S40A 5IP9H 4OO1I 2MO1A 3OTOL 3GTQH 3LNNA 3NUHB 3L17A 2MCNB 2K5NA 3CP0A 4Z9CB 2N9EB 3HVZA 2EYMA 3E9HA 1H9RA 1TWAH 1J9OA 2DZMA 1IGDA 1WMHA 2L11A 1UWVA 4P2CB 3PHWB 3EHVA 3APCA 2CFMA 3FILB 5CBEE 1EYGA 3GDEA 1A6XA 4KGSA 4A3LG 5BYSA 5FLMG 1FJGL 1EY4A 1EF5A 1E90A 2V4LA 2K28A 2O4XA 4CDCC 1UZXB 1LFDA 3TBIB 4A3GH 5AZGA 1WD1A 1ZXHA 1WGDA 2IY1B 4A3BH 3NVZA 5J17A 1AW7A 2BCOA 2MQJA 1FL0A 2Z4HA 4KY5A 1FPYA 2K7VA 4KIKB 4H2AA 3OPOA 4LNQA 2INCC 2IO3B 2PW5A 3T1YQ 2KDMA 3PIO3 1HJPA 2E2HH 3KF6B 1HXYD 1TWGH 4EQNA 1FVIA 3QG1A 5M5XH 1N8RC 2I5HA 4BFRA 2RHSB 1VDVA 3GZNB 4L5RC 1EEID 3RZWC 3RD4A 3F8TA 3H0GB 4A3IG 5L83A 3I4NH 1E1OA 4LAAA 3WDNA 1Q86C 4CKBA 5G5HA 4R4OA 2K52A 2PNHA 3HIZA 3I63C 3U30A 3DWMA 2ICEC 1IYJB 4YSZB 2JRIB 1C76A 4OXPA 3A33B 4S17A 1TY0A 2UUCQ 1PLFA 1L4ZB 4X62L 1N62A 3KLWA 5LMNL 4KKSA 2V3SA 4XX5A 5EDSA 2ATWA 1SE8A 1R4MB 2VZKD 5JHBA 2EKIA 1XQQA 2MJ3A 2L0TA 1ET6A 1E9MA 3PIOA 1IBMQ 1N61A 5E7NA 2M19A 1E3PA 2N55A 4EQOA 4RG1A 4QIWB 2A5HA 2FJ2A 4ZUJA 2WGSA 2ZTCA 2F3WA 2WHIA 3ZO5B 1RJTA 1OO9B 2DY7A 3HOVH 5DM73 5ELBA 1MG8A 4F8CB 2FBWB 2KO3A 2WNMA 1RFKA 1CQVA 1E7ZA 5LL6X 3BJUA 3DBRI 2L55A 4W9GA 4ARIA 1WI0A 2PMZE 4YCWA 2DY8A 3IFDA 5J39A 3QIAA 3IFTA 3ZXRA 5LLIA 3EVQA 2EJFC 1KDBA 1LTGD 3A56A 5C5MA 1W6JA 3E6ZX 1X1MA 1YIWA 2N7DA 1KNAA 3J80c 2JA8B 4G7HC 3R93A 4FF2A 2WDQB 2Y5CA 1S1QB 3KVFB 2L1BA 4JGHB 1VQFA 3JSVB 3V61A 1VQMA 3GTPH 1D4BA 1YN4A 3I72A 3JC66 3S15B 5DPTA 1YNJC 1F2MA 3UE0A 3J81E 2M0XA 2RSNA 4JI0Q 2CU1A 1Q90A 1QOGA 2WAQG 2KDIA 3PO3B 3QOJA 2Z0SA 1PRTB 1QUQA 2LS01 3D3RA 2J0JA 1YOVB 3F2DA 1NE3A 2KJ6A 3I4LA 4JBJA 4M01A 4NPSA 1VQJA 3I3TB 4W9HA 2SDFA 1B3QA 3VR3A 2I46A 3OLMD 2J7ZA 1WRDB 5IODA 1KLUD 3GE3C 4MT5A 4US8A 4OX9Q 1SXTA 2PVOD 4OVZA 4FDBA 1N34L 4W9IA 5KRUA 2HTME 2BYTA 3HKZE 4X66Q 4ZCKA 1F2ZA 3FPUB 3AE7B 2WB1B 1C8CA 3NVWA 3PLUA 3NEMA 3RUIB 3K81C 3PT2B 3LB8C 3A54A 2F0LA 3D4DA 2KNBA 2LGIA 5IT9c 2NZHA 2WKCA 5GROA 5J3BA 2R7ZG 4R9WA 4DAYA 3AV8A 2H4OA 3GTQB 3E9SA 2JA7G 2KOXA 3DWPA 1LLRD 2FCQA 5EE3A 5IOIA 1VD2A 1TWAB 3WOFA 1HUNA 3OTOQ 1FXTB 2EYOA 2FUG1 4R1JA 3MXNA 2HQEA 2LMCB 4K7SA 4XXEA 3S1RH 1X9NA 2QEXA 3WA0A 1EEFD 4LMQD 5IYBG 3IRBA 3ZTDA 2LVPA 1ESFA 4KY6A 4A3GB 4B08A 3C19A 2A1AA 2RDHA 5T1GA 2KACA 3WAPA 4A3BB 2PZTA 2KTFA 2WDRB 3A1QA 4IKGA 1WGHA 2HIXA 4K1RB 1K8RB 2JQOA 2GBKA 2K14A 5LHY1 3PV0A 1Q5WB 3DBRB 2D62A 2OT2A 4RFBA 3IAM1 4W9KA 2E2HB 1Q8KA 1PVOA 1TWGB 5M5XB 2K1BA 1WGRA 4NAWA 1Y1VH 2J0TD 2KENA 1YHAA 2LWPA 2I5LX 4UP7A 2IO0B 4B0MA 2B2UC 3J7ZC 2LKVA 2DNEA 1RWSA 5JZEB 1AEXA 1X56A 4A3OA 2FFKB 4NPNA 5DAUA 3I4NB 3CCVA 2MX2A 4YTPB 2NZOA 3IT6B 2JXTA 1NI2A 3HHMA 1SBBB 1EUJA 5FO8B 1N6ZA 1S4ZA 2DX5B 2PQAB 2AUJD 2F0WA 1WXVA 4JI1L 1XT9B 2VQFL 1T0YA 3NTHA 2YEPB 1HZ5A 3W5UB 1WGKA 1YJIA 5C3XA 2BQQA 1T5EA 2IYDB 4QAYA 1X3FA 3CIRB 2KJXA 3K9OB 3P4QB 2LHEA 5CR3A 1K28A 5C44H 1VZ8A 1QNUA 3QC8B 4GLAC 3PS6A 1HZCA 4AJYB 4DGZA 4Q5VA 2NN6G 3IHPC 2EJMA 1L1OA 4OEMB 4X62Q 2QMTA 4UY8C 3O65B 5LMNQ 1BUVT 2WXLA 3KWVA 1Y8OB 1YNJD 3AB5A 1Z5SB 2JPHA 3SXHA 1FXAA 3AXCA 1K0RA 1FR3A 4FHKA 2ZVOA 1UE1A 4JI5L 3WAOA 4GNXB 3ER0A 3M63B 2C7NB 3HOVB 2WXKA 4JLCA 5C4XG 2ZNVC 2ZJQA 2MGSA 5D65A 4ANXA 1JMCA 1F1HA 1WI5A 3DHIC 4DAPA 4HJ9A 3KUDB 1VQNA 4REZA 5C3JB 2BBCA 1CMXB 1Q1OA 1ZP0B 2CJNA 2QIEB 2AUKA 1H9JA 1VQ5A 2EE1A 2VZAA 3PCOB 5KNBA 4AUQC 1Q1EA 1RIPA 2B2TA 1T3QA 1WE6A 2AX5A 3STBC 3P42A 4DAMA 1IBKQ 2PW7A 1QQRA 3W1YA 4WJNA 3K57A 3RNEC 4X3TA 3QJZA 2EIFA 2MQHA 3BK1A 2XTIA 3OJ3A 4G4KA 2MNAA 3Q23A 3LYYA 4WRDA 1CFMA 3KDFA 2M9VA 1JOKA 4H0LC 3I73A 3QB3A 3GTPB 1T5XD 2R6GA 2UYZB 1NJIC 1PRTC 3VDZA 3S1NH 4KDIC 4U68A 3TSSA 5AZHA 2GBMA 1JMLA 2EELA 4IFDH 2V1CC 3CCEA 2BPSA 2HTHA 2YU9H 1EIHA 3AE9B 4A76A 1SGHA 1C48A 2L8JA 4BVUC 2DNCA 3FKIG 3TZDA 5TR5A 4ZYSA 3AMUA 1Q0WB 1P1AA 2IPKD 4IQZA 4ITKA 2A19A 4POFA 5E6PA 4FF4A 2KZRA 2N9XA 2BKFA 2JWUA 1Q10A 3ZDMC 5JPNC 4HRSA 1FD6A 2PNRC 1EFWA 2BE5C 2F1MA 1N34Q 3DUZA 4HSVA 4TUUA 4W9EA 3ZLZA 2KQ3A 3NZ3A 2F0MA 2TSSA 4ZAIA 1H9MA 1CKMA 1YZ6A 1QOFA 4J1MA 1ENFA 3TMEA 2W3RA 1XX8A 2NBWB 3PIP3 2Y5PA 2AQ2B 2K05A 3A5ZB 4NB3A 2KCMA 1LT6D 4X3KA 3V2TA 3HOYH 1XLQA 4US9A 4DR2L 3MXGA 1V8CA 3QJYA 5HY6A 2KVRA 1WOCA 5E4WC 4DV5L 4ZDVA 4GDLA 3AI5A 3NHHA 3RD2A 5AFWA 3S1RB 1DOYA 5IYDH 1T0QC 3R66C 4K8IA 5BN3A 3ERSX 2QJLA 4WJWA 3MFGA 3N30A 3SK6A 2B2VC 3N52A 5C0XH 1V5TA 4WAFA 4N58A 1STHA 1J8CA 1WE7A 4P73A 1RTNA 3DVNU 4ZRQA 4K6LA 5C4HA 4A3EG 4KKIA 1XLNA 3H91A 3L10B 1SN8A 3VVWB 4LCDE 2Z6KA 1CTMA 4I7AA 3BZCA 3S2DH 3I4OA 1UBIA 4UPAA 1Y1VB 5GXGB 2WXIA 3A9KA 3HP3A 3BYTB 1JOOA 3A8IE 3A0JA 2JYTA 3RCZA 1WTWA 4TRDA 5JAVA 5JPMC 2DBYA 4C3HG 3DWGC 1VDZA 3KUPA 4OELB 3PIPA 2BVCA 1RL2A 1HNWL 3VR9B 5LL6S 5CBAE 1V86A 3PPAA 1WX8A 3NBHB 4MJSB 3NTKA 1NUCA 2D3CA 4ANVA 1GO3E 2PI2E 3STBD 3VDYA 1XNRL 1GG3A 4JI1Q 1FCLA 2VQFQ 2K3UA 5C44B 1WF9A 3M85A 3UIOB 3N1YC 2YVCA 3B2FA 1SE4A 2Z4IA 5KHQA 2WIIB 1WD0A 3NUCA 1WSPA 3CKIB 3AE8B 1E2WA 2HDLA 3J9CA 1UBQA 2IJ0A 3AQQA 1WYWB 2QDFA 3I4MG 1BR9A 1PRTD 4BKTA 2A68C 3BVMA 4WORA 1UGJA 4KDLB 4GNXC 4A3JH 2Z0DB 5JHAA 1VJKA 1I94L 4K3BA 3DM3A 1H9SB 2KKCA 4WAAA 2NPTB 2AQ1B 3MHZA 4GSWA 3CCSA 3IAYA 3OW7A 3I91A 4JI5Q 1IL2A 4JL9A 3SFEB 1UELA 1C9OA 1CK1A 1LUZA 4GXBA 2K4KA 3BS1A 2HE7A 4NZLB 4KD4A 4HIOA 2K6DB 4DHZE 1DOIA 3M4OH 2BE5D 1SYEA 1MJEA 4K3CA 4IC7B 2B76B 1B9MA 2CCZA 2KCCA 1EUVB 2KT7A 4MACA 2VY3A 5M3FG 5K36G 3RMKC 3TL5A 1JWSD 2KDBA 1P16A 1UWMA 5FLXL 2W54A 5MPOA 3A9JB 2ZEQA 2VH2A 3S1NB 1QZEA 1D8LA 3CPFA 4A3KH 1CSQA 1WR1A 1B44D 4C3JH 1WY8A 3ZDTA 1R4QB 1EO6A 4ZRPA 4HSPA 1C0AA 3L16A 1HZ9A 1MKHA 1EF1A 2ZCBA 2D0PA 3AE6B 1EY5A 5ELEA 3N1XC 5IY0A 3K59A 4IG7B 2YU9B 2M56B 2RKSA 3FDTA 4GOPB 3E56A 2PTLA 2DUDA 3H9DA 4JOIC 3D6WA 4BKSA 2EXDA 2JK8A 5CV7A 1R9TH 1D6EC 4IUUA 3T13A 1B3AA 1E2VA 4DWFA 1OQRA 2B2YC 3CCUA 5G5GA 3HKSA 1WWTA 4M00A 1RTOA 3HOXG 3WCQA 1QOBA 3C46A 2FMMA 2BTEA 3A8JE 2MHJA 1I4HA 1FGUA 1T9HA 4HMJA 1WH3A 2HD5B 1AWDA 3G6JB 3CPWA 1SYBA 3D0FA 3Q3MC 5C3EG 2HUGA 2QILA 1QKZA 4JI8L 1HH2P 4A3CH 4K0KL 5FJ8H 4A3DH 1YJ1A 4WJOA 5KEEA 5IN7A 3WANA 4IPCA 3I7FA 3U9OA 2BOSA 3HOYB 3K58A 1L2FA 1RDPD 1VQGA 5KHOA 2REXA 3VFKA 1ICWA 3JAMc 2DYMA 3ITPA 4YY3L 4DR2Q 4BXXH 2KMMA 5CMDA 4ICVA 4DV5Q 4B9KA 2KHSA 5CV5A 2EVBA 3I2ZA 3ML9A 1EY6A 3R2TA 3K6OA 3ULPA 1V49A 4HJ7A 1V81A 5E3FA 3ML8A 4YHHL 2JZPA 3W3AA 1NBWA 3U4VA 1WGYA 5JJZA 1XYIA 4RMAA 2WU2B 1GUGA 3KUZA 2IX0A 3MJWA 1M4VA 3GE8C 1EU4A 4OW0A 2A68D 3S2DB 4LFBL 3OIPA 4MGIE 1Q3LA 4K5VA 1WXMA 3AMZA 1R4PB 3MVVA 1J7BA 2LVQA 3EC8A 1C78A 3MZ5A 2CS4A 1PQSA 1TKWB 1EY7A 1BOSA 4KHVA 4IW0A 1LTAD 2PMZB 1GD7A 3BINA 3KFUA 3TEWA 2CQAA 2WAQE 1W2BA 1MD2D 3V05A 4DA2A 1C3TA 3CU7A 4C3IG 1A2TA 2WXMA 2VRRB 1W3SA 1A3UA 2E2JH 2FCMA 3APDA 4PS3A 4A3FH 1SYDA 2RR9A 2VUMH 4FJYA 5AZFA 1XNRQ 4KGTA 3PUXA 2N7EA 1QT9A 4A55A 3P1MA 2B63G 2ZTEA 1AH9A 1MSGA 3OG5A 4QB4A 1VRAB 1A0IA 4DU9A 4A3JB 1E0BA 1P8LA 4HIKA 4JBKA 4OGQC 3BIID 2PLPA 4TVAB 3T3OA 3WIMA 1I3QH 2BA1A 2PPBC 4XDCA 1WYGA 1FRRA 3MFYA 4LFAQ 2CH4W 2KHJA 4AIMA 1I94Q 1HNZL 1JRUA 1WJ6A 2KK8A 2OJWA 1CKNA 4O2DA 3K80C 3M3JA 5GMVA 1EQQA 1XTCD 2BB5A 2KFKB 3UI3A 3NBIA 1ZKHA 2I1JA 1V43A 2NVXH 1QLBB 1ZXIA 1KLGD 2KCTA 5E1FA 4WH4A 1A3TA 3G7LA 2K39A 2F0SA 3NP8A 2R2QA 2I2YA 2BA0A 4JV5L 1E7UA 5G2NA 2JRHA 4MGZE 3D6CA
chains in the Genus database with same CATH topology
1SSNA 3ERQA 1V1PA 1DJRD 4JK1C 4OZAA 4A3KB 1LTBD 4C3JB 3MHBA 5C5LA 4B9XA 1ESRA 1BUIC 2K04A 4K8JA 1YN5A 5BMHA 1MHHE 4JBWA 1PGAA 1E10A 3K5LA 2F0DA 1R9TB 1IBXB 3T56B 1C4CA 5I9OA 5IGCA 3Q8AA 3O13A 3HRDD 1C4QA 2RDFA 4HCSA 1TS5A 2L83A 1CA6A 5D3DA 4CKEA 1FNUA 1HTLD 2WXPA 1U9RA 2PIAA 1PRTF 2WXQA 3AE3B 1R7SA 2D5GA 3GP7A 4A3DB 1F9RA 2BB6A 3VYTA 1STYA 3KF8A 1NYRA 4OO1G 1ZUD2 3VRAB 4RNAA 4YIJA 4RF1A 3PUZA 4WFN3 5KYIA 3P4PB 5D7GA 3NTIA 4DNRB 1EY8A 1XO3A 2A6EC 2KECA 4FXGC 1SE3A 2K6AA 4X3SA 3BYYB 1O80A 1WTOA 3M7GA 3FAHA 1Z6HA 3IAS1 1GPXA 3R3OA 4C1NI 2F0FA 1L5PA 3N9YC 2E2JB 4A3FB 1NR4A 1EM7A 5EBCA 2VUMB 2KQ4X 5IOCA 3SR6A 2JSVX 2KEEA 3C8YA 3BG3A 2A6HC 1MSHA 1X32A 1PMRA 1II3A 4NAMA 1FYCA 3PUWA 2EZVA 1JQYD 5ELDA 1I3QB 5FLXE 2NBFA 3W1SA 5CV9A 2YEPF 1EWCA 2XSCA 2INNE 4CJ0B 2WP8J 3TZUA 3M4YA 1BDOA 3SK8A 2NVXB 1G2SA 3DXJC 3HRZC 3VR2A 3NS1A 3NE5B 2J4XA 1SAPA 1Z7TA 4GDKB 4N9TA 2B2WA 2WXFA 3NWTA 1K53A 1QF6A 5CC4A 4NP5A 1EYDA 4B0EA 2H89B 1JORA 2INPE 4HJGE 1EZ6A 4F88A 3Q24A 3RZOB 2RPVA 3I8ZA 2IDYA 3HOUB 1EU3A 3KBGA 1KF6B 4OHJA 1QG7A 2EDGA 2B2UA 3FEWX 2PKOA 2C9OA 2V0GA 2A6ED 2WINB 4MIUA 1FMAD 2F0PA 2J42A 3MAQA 3AN1A 3SR1A 2SEBD 2E76C 1AN8A 4IUTA 2NMQA 5KNDA 4J6HA 3CHBD 1G291 2KWDA 2SNSA 5FR3A 2DWQA 3A55A 1JRPA 5CGKA 1EOTA 2JX5A 5C3JB 4DAVA 4XE0A 1B9NA 5LNK1 4RHRA 4YXDB 1WTQA 1HFGA 1VCIA 3GTMB 2A69C 4H44C 1J8IA 1SNMA 4ID6A 4DN4M 3L3OC 1OXSC 2TMPA 5FOBB 2A6HD 5A2QL 2FHTA 4TSSA 2JA5B 3KK7A 2N9LA 1LABA 1ET9A 3I90A 1SNOA 2JYOA 4PNYA 4QF4A 5KYLA 3TUOA 1L6UA 4K5XA 2MJDA 1CT1D 4OZBA 1I4GA 2KUMA 3PUYA 1A15A 1C4AA 4BY7B 1STNA 2XN9C 5BN4A 1STAA 4RH6A 1XXGA 1FO4A 4BBSB 1J7CA 1AP0A 1BCPB 4RGOS 4ODGA 3VR4A 5K5PA 1BO0A 1RD9D 4FYDA 1TVXA 3T53B 4N9PA 1EYCA 3J80L 4XQQA 1SMYC 1JALA 1WXQA 1TS4A 4A3IB 1K83B 5JXVA 1GHKA 2JYEA 3AEEB 3HVDA 4C1NK 4FF3A 2E74C 3AE5B 4B9WA 2W3SA 1TWCB 2LMCA 5E6JA 1YJJA 2W82A 3NVVA 1MI2A 2Q5WD 2O5JC 1OFFA 2NB0A 1HA5A 2IL8A 2RBMA 2MUYA 1ZDXA 3S9WA 2B2VA 5C4JB 3SE0A 3OIQA 2WXGA 5HG2A 2EY5A 2RDGA 2QF7A 5IT9L 2E2IB 1ZXTA 1A70A 4KN7C 4F87A 4C56C 4G7ZC 2A69D 2NTSA 3IXSA 4N59A 3P20A 3X3MA 2CJOA 5C3WA 5FO9B 4A90A 1HCZA 2EY2A 4FXCA 1VMCA 2F0TA 1QOHA 3QWNA 4N6EB 4H7BA 3VYRA 4BA1I 4FXDA 2Q8RE 4XWTA 4IN3A 5IGFA 2JU6X 1SNPA 1HUMA 3MEHA 1QWYA 4CBVA 4DQOC 2LUMA 1S5FD 5EJWA 2NN6I 1BF4A 5T8IA 3KLSA 3NWSA 2WLBA 3K7AB 1PGXA 1CZWA 1K8MA 3U52E 4PV1C 4PMWA 4GDLB 1RKNA 3F2UA 4IFDG 4JE3B 5CV8A 3FMCA 3VYUA 3TEZA 2JA7B 1SMYD 1K50A 1C79A 2J53A 3Q6SA 1JC7A 4LTUA 1NAPA 3MWYW 1ENCA 1VMPA 2EYFA 1WTXA 1K8OA 5EE0A 5EBDA 4TQ1A 5HFYA 2ZXOA 5JEAJ 2ICIA 4YTMB 1BCPC 4ZRZA 2GRIA 4HKQA 3KQ4A 5KGUA 3NVYA 3P1HA 1QOAA 2VB2X 2LHDA 1TWFB 2G9DA 1TU2B 4R3DA 3D8GA 4Q0FA 3OHXC 3GTJB 1WRIA 1EQTA 1ENAA 1SB3C 2B2YA 1QE6A 2F0QA 1E2ZA 2WV6D 1KH0A 2EXZA 5A35A 2Y3AA 4KHZA 1MPEA 2L32A 2KAJA 5C0XG 2XWBB 4L6TB 2Z1CA 1X3PA 1Q1BA 4ARCA 3PO0A 4KN4C 5DNFA 3S2HB 1VLBA 2IGHA 1E6EB 4A8XC 1GB4A 1TWHB 4L1BA 1FNWA 4R8IA 4IZ8A 1YNTE 1PTOH 1PGBA 3P4RB 4TQUS 1I7HA 2L52A 1XLOA 1UUPA 4ZUIA 3L4PA 5C2TB 1STGA 1QNKA 1EFID 1BQQT 1TT2A 2ZXRA 1K52A 3DEPA 5EE1A 2MJ8A 5G3LF 2K5PA 5ELCA 4OL7A 1O7LA 2WQYB 3KBXA 1AYFA 5KNCA 1I6VC 3ETRA 1HHVA 4KD3A 5K36H 2BDOA 2GI9A 3ZYYX 2JA6B 2K5DA 3H94A 5A2QE 1SSOA 1G2TA 2BW2A 1IL8A 1NI3A 5M9OA 1KNEA 3LWUA 3SVMA 1L4DB 1DXMA 2EY1A 1FIQA 2F0HA 4KJOA 3B9JA 2JE6I 5BMIA 1WCMB 3EJIA 5I2XA 4CJ2C 4BY1B 1VZ7A 1PFNA 2F3VA 3EROA 1BCPD 4JWUC 3A7AB 2D9UA 3SK4A 1LTID 1HPCA 1A2UA 4CKCA 3NSWA 1I50B 1SNQA 4C3JG 5COYA 5EPJA 2KCNA 3HGBA 4CHTB 1LO5D 1TS3A 1VF7A 1D5ZC 1JR0D 3SK5A 1TKYA 4CJ1B 1AZQA 1J7AA 2VXWA 3J80E 1Q12A 3NK9A 4XYOA 4DXGA 4G57A 1TZOA 3OWFA 5JEAG 5ELFA 5I2YA 4IOIE 4DK0A 3C3LA 1OQQA 2F0KA 2BS2B 3Q8EA 1TJEA 1TYGB 3NQTA 3GTLB 5C6AA 4XQJA 4JWSC 2PMVA 2WU5B 2WP9B 1B53A 1YNNC 4XQNA 4A3EB 1GUNA 1JWMD 4KK7A 1SJHD 1QJOA 5F2DA 2RMMA 2WXJA 2N0SB 1TQOA 1DOXA 2DLBA 4WIPA 4KKTA 1DOKA 4BBRB 5FK9C 4EE2A 1FM0D 5IT9E 4S3SA 5JOBA 1LT5D 1DM0B 3DWAA 4KTAA 5BYQA 4FXKC 1B2TA 1VR9A 1LT3D 4OIJA 4RA8A 1B50A 2NUCA 2ZT9C 3C1EA 1PTOB 3GTOB 3KLSX 4NKLA 1XCQL 2Q8IB 4HR7B 3VA7A 4NDXA 2EYPA 4QCLA 2E3TA 3DM1A 3KLRA 1EWYC 1U4LA 2K22A 3N6RA 1N5XA 3ZGZA 1V1PB 1VF5C 2X6GA 5I6YA 4TKOB 3HKZB 3JAML 2K01A 2SNMA 3ZJVA 2B8FA 1GUWA 3M4OB 4AQ7A 1CZGA 1F2RI 1C9FA 2ACZB 2F0UA 2EPBA 3VA5A 1L0YB 4FP5D 1GJXA 3AE1B 4RKLA 1PFMA 3CQZB 2ON8A 4C2MB 1FEHA 2LEKA 1I4QA 4L63B 3ND8A 2CW0C 2J52A 2LFNA 1O7ZA 1SIJA 4NJCA 4HN7A 1PFDA 1QILA 1PFBA 3FVQA 3GV3A 5EKLA 3Q8BA 4YT0B 1Y69U 3MC0B 3WOEA 2NWGA 1YNND 4MN3A 1P7EA 1ZE3D 2EYLA 4ME5A 2KOLA 3DWQA 1S5ED 3P63A 5IGGA 4HCEA 1NEKB 1L0VB 3VYSA 4PMBA 3RZDB 4ZLTF 1CA5A 1TR5A 4Q2JA 2BT6A 1Y56A 3PMFA 2F0NA 5HURA 4PT5A 1E0ZA 3DEOA 1E7PB 1RODA 3K5NA 1RCVD 4RKBA 5I6WA 2VNUD 4A6QA 4BS9A 2V4DA 4D2KA 4ULLA 4G7OC 2A73B 3FC4A 3Q0AA 1FD7D 3HEJA 1XCTL 5EGTA 1DOLA 4QUFA 2K0PA 2QDBA 4PMCA 3PO2B 1EWHA 2QSDA 2EY6A 3W5VB 1I4RA 1KDAA 3W9CB 1DD2A 3MTSA 3P4SB 4DXFA 3S17B 4GZYC 1IYVA 2JEBI 4FNFA 1BCPF 2NVYB 1D2BA 1ZPSA 5ISRA 2C5CA 3X3NA 2L0CA 1DYQA 1PTOC 2B63B 2JSOA 1KABA 1IGCA 3U7ZA 3LXFA 2FINB 1G8ZD 5H8YE 4IUQA 4XYQA 3Q22A 3MXUA 2CW0D 2KEDA 2B8GA 3GV6A 1KRHA 2QCPX 4J8QA 1AFPA 1FFUA 3ZQ4A 2AQ3B 1HA6A 5HI1A 4FVMA 3S1QB 4RAUC 4K2KA 1T6BX 1LTTD 1EQVA 2IGDA 3TP6A 4GLSC 5E4XA 3FILA 1NSNS 3HUIA 1G91A 4WQMA 4PQXA 4IURA 1F2YA 2MH7A 1B4OA 4RHSA 4AYBB 4KJNA 3S16B 4IUPA 1NENB 2F0JA 4L23A 3BVZA 4LK0M 1NVID 4A3MB 2B39A 2RSOA 3TEYA 3BDCA 1WVLA 4XWWA 4K6DA 4TMAB 1FCCC 2RVLA 3ONAB 4ZQ3A 2Y0SB 2PYKA 1WTVA 2FE8A 2IGGA 4HEA1 5JVG3 1JOQA 1MVKA 3RMHA 4JX1C 4DNTB 1ONLA 1S5CD 2SAKA 4HMIA 4BA2I 2K33A 2D2CC 2X38A 3HG9A 2JQRB 1QB5D 3B2GA 2X6LA 2L12A 2M2LA 4KKJA 2K5QA 3BVGA 1ML0D 3MJ5A 2AWNA 2XRQD 1FGBD 3BK2A 4JPSA 1PZID 3BWUD 1SE2A 1WTPA 1NYQA 2L5TA 1D5XC 2M0AA 4XTCS 2PCFB 1CQFA 1Y1WB 1SDFA 1XLPA 5BMGA 3VR6A 3NRZA 1M8AA 1PTOD 1SNDA 1SYCA 3DHQA 1OXUA 3RLFA 1BBXC 2HDMA 1IYUA 1XF5L 1F2RC 4YTNB 2A74C 3KWLA 3T3NA 2CHBD 4IFDJ 3AEBB 3H3VC 3A8KE 4WURA 3P7JA 3URYA 1HFNA 1CHPD 4MHEA 2WDVB 5CYUA 3TP8A 2K5WA 1F77A 5G3LD 4NAWB 5D14A 3IL8A 3LX0A 1RYJA 1CJEA 2OEOA 5BYRA 3JAME 2HCIA 5M3MB 1ZEQX 1HEZE 4RGTA 1GXDC 2WXHA 3RFZB 3K5MA 1W6KA 4U673 2B2WC 1K51A 2MJEA 4HTHA 4C7ZA 1YN3A 2K9XA 2PO4A 3K0YA 3MA2B 1PXUA 1BXTA 1MI0A 3ABVB 1EY9A 4H13C 1XEEA 2N9KA 3TN2A 3I70A 4LK1C 1FFVA 4ZKCB 5C0XJ 2O5IC 1ZYRC 1CI3M 3BDLA 1PZJD 3SHLA 2NN6H 1XWEA 4HAEA 5AUKA 2L1AA 1F9PA 1LACA 4XDDA 2W55A 1EZ8A 2CU3A 1JW9D 3T4AC 2NVQB 5EQ0A 1N5WA 4ZKBB 3L9AX 3HZXA 1ROEA 2EJGC 2O2LD 1JCKB 5DM63 4AS1A 1JWAD 3S1MB 3AEFB 4UDUC 1OXXK 3Q8FA 3M7NA 3I9V1 2QKIC 1SNCA 2NZ1D 3C1FA 2ENBA 2KN4A 1X3QA 1BNZA 3AH7A 3TDQA 1YMHE 2WS3B 3J7YW 3GO5A 3GD7A 1TKEA 4EVOA 4NMZA 3RPFC 1ILQA 2YYZA 2WAQB 2L4NA 4YWGG 1STBA 2OF1A 3HOZB 3SEBA 2M00A 5EE9A 1JB3A 1MGSA 1KFYB 1TIID 1NCVA 1SYGA 2H1EA 2Q8TA 1WTRA 2I07B 4XT3B 2EYHA 2ZW1A 4HROA 1IW7C 4I65A 4V0BA 2WXRA 4ZOHC 5DEHA 1GOZA 2IX3A 2R7ZB 4ZHPA 3P75A 4A9AA 1L0XB 1GUTA 1GUOA 2JP1A 4EQPA 1RM6C 3J7AV 2KA7A 4FO2A 1OXTA 4IALA 3NPPA 1ZYRD 3AM9A 4LJZC 4Y7NB 1MHXA 5AUIA 5T1IA 1UAPA 4TQ0A 4KMUC 1FXIA 5M5WB 1TKGA 2IX1A 3AE4B 3EA6A 3H8HA 3CRLC 1STEA 2EOTA 4OZCA 4XT1B 1DGJA 3AEDB 1DCZA 1V1OA 1D1IA 1PZKD 2F0IA 3QO2A 2L9HA 3TP7A 4M8AA 3GS2A 5C4ZA 4IFDI 1B9RA 2OXPA 3U2SC 3PZ8A 1GAQB 1P7FA 1LT4D 2KVMA 4RGMA 1PTOF 1KAAA 4V190 1JWBD 1HTPA 2IWHA 2BDNA 4UAIA 3K5OA 2V3NA 2B2TC 4L8JA 3BZDB 4WWMA 2E2DC 2GA4B 4P16A 4K2LA 1JWUD 3GQBA 5C4XB 5IGEA 2LJIA 2PZWA 3EFXD 2R92B 2F0OA 2PQEA 3OMCA 5J1ZA 1U4RA 2MP1A 3AECB 5NUCA 4RCNA 2XIWA 3NBHA 3GTGB 5BN5A 1HRJA 1CHQD 3VR5A 1IW7D 1QCBD 2MHVA 1V97A 1DZ1A 5CV4A 3TP5A 5JVH3 5J22A 3AEGB 2CVRA 1RHPA 3AB9A 5C0XI 4P6VF 4KV6A 4MH8A 3OWEB 4O42A 4M1UB 4L2YA 3ZJUA 4YSYB 1IKLA 3FPPA 3ZJTA 2EYJA 1TY2A 1FNVA 1U4MA 2Z8LA 1GUSA 1YQ3B 1B1ZA 3I3CA 1IUEA 4RCOA 3I57A 1ZOYB 2DN8A 4EGVA 2WKDA 1H9SA 3VQIA 3FKIB 2XWJB 1ZDVA 1SFOB 1U4PA 3AE2B 4MM3B 1JQ4A 1PDQA 1NR2A 2NTTA 5HGTA 1G6ZA 1I6HB 5D3IB 2R61A 4LLGM 3GB1A 1TS2A 1SYFA 3CRKC 4ZHOA 3UI2A 2XVSA 3L7ZC 3R8BA 2F03A 2G1EA 3SDZA 1EYAA 2E75C 4O1NA 1EL0A 2N88A 4IUNA 3E0JA 3S14B 1LV9A 2K03A 1I4XA 3D4WA 1SF0A 4R8NA 1I4PA 5JEAH 1KDCA 4K5WA 1ACCA 3EUB2 3OOCA 3PUVA 2NVTB 1O7YA 2G9HD 4DF7A 3HOWB 3NXWA 4ILWA 1GB1A 2H88B 3SFDB 5EKIA 2HDEA 3EQLC 4XDXA 3TEXA 2JEAI 5EPKA 2DYOA 3AU7A 5CORA 3M3YB 2V4IB 2VZKB 2XRSD 4ABNA 3IT4B 5HHDG 5IGBA 3LWEA 4NW2A 4IUVA 2FMCA 1OXVA 4DFAA 5I9PA 1EIGA 4C3HB 2MEKA 4YSXB 1Y8NB 1MBYA 2D5DA 3HS0C 1N60A 3T51B 2VB3X 1F9SA 4KKUA 3H09A 3V3XA 4A93B 3J81L 4K14A 2HCCA 4M0WA 1ILPA 2OEDA 3NQIA 2WXOA 3I4MB 2F0GA 5FO7B 1S5BD 1Q8IA 2F4IA 1LTRD 4KGRA 3RUZA 1AZPA 3BDOA 3IKJA 2F0VA 1HZ6A 2PW9A 2PZUA 3AEAB 2NYZD 2ZXPA 5I4DA 2JXMB 1BMLC 2IT1A 2QEJC 3DMUA 2ID0A 3ND9A 2LFIA 3J7AF 5M5YB 4RF0A 3OSOA 4BWGB 3U4EG 3R2IA 1ZKOA 1Z47A 2GB1A 4E6IA 1YQ4B 4C80A 1EY0A 5M3FB 3MP9A 4KX6B 2I38A 2RQXA 4QMGA 3C2PA 4I7ZC 3V96A 1PUTA 3W2DA 1V8QA 3E5SA 1KTKA 2XNAC 4USAA 1UEAB 4RWSC 2X69A 4J3OD 2MPMA 1O78A 2BS4B 4QUCA 1DONA 4KI0A 1JICA 2R3ZA 3Q69A 2SOBA 1Y8PB 1PDXA 4HKZE 4FF1A 3HOXB 2IW3A 2ZW0A 3VRBB 1DOMA 3Q8CA 1D1KA 2LY7A 1FRDA 3FRPB 3GTKB 5C3EB 3A7LA 3EGRA 2V3PA 1HQRD 5KIXA 2PVGC 4CGYB 1LTSD 1C77A 1VZ6A 1F2LA 2K32A 1L6VA 1JE4A 1JROA 4OO1H 2AWOA 5EPLA 4DK1A 2E6XA 1IKMA 3MXPA 4HEDA 5EKKA 3OMGA 2WXNA 1SJED 5H92C 1D5MC 1PYWD 1GHJA 4F7XA 1UWXA 1HQMC 4C7YA 1SEBD 1IBXA 1UNSA 4ZK9B 1N63A 2N7JA 5IGDA 1H9KA 4RGNA 1CZPA 1A3VA 3QOLA 2OHFA 3D31A 1CM9A 4XIGS 1RF2D 3CWIA 2RA4A 1IHZA 4IDIA 4OIKA 1S5DD 4X3UA 3T16A 2F0EA 2R93B 3H6MA 2BS3B 4C3IB 3PZ7A 4KY7A 1F0ZA 5CV6A 2WACA 5IIFA 4CQNA 1C4PA 4F8MA 3VR8B 1F9QA 3D4RA 3U9SA 5FKAC 2ONQA 5TSSA 4OO1I 3NUHB 3LNNA 4Z9CB 3HVZA 2EYMA 1H9RA 1J9OA 1IGDA 2L11A 4P2CB 3FILB 5CBEE 1A6XA 4KGSA 5BYSA 1EY4A 2K28A 2O4XA 3TBIB 1WD1A 1ZXHA 3NVZA 1AW7A 2BCOA 2Z4HA 4KY5A 2K7VA 4H2AA 3OPOA 2PW5A 2KDMA 3PIO3 1HXYD 4EQNA 3QG1A 1VDVA 1EEID 3RD4A 3H0GB 3WDNA 4LAAA 5G5HA 4CKBA 3DWMA 2ICEC 4YSZB 1C76A 1TY0A 1PLFA 1L4ZB 1N62A 4KKSA 2VZKD 2EKIA 2MJ3A 1ET6A 1E9MA 1N61A 2M19A 2N55A 4EQOA 4QIWB 4ZUJA 2A5HA 2FJ2A 2F3WA 1RJTA 1OO9B 2DY7A 5DM73 5ELBA 2FBWB 2WNMA 1RFKA 1CQVA 5LL6X 2L55A 4ARIA 2DY8A 3IFDA 5J39A 3QIAA 3IFTA 3EVQA 2EJFC 1KDBA 1LTGD 3A56A 5C5MA 1W6JA 3E6ZX 1KNAA 2JA8B 4G7HC 3R93A 4FF2A 2WDQB 2Y5CA 2L1BA 1D4BA 1YN4A 3I72A 3S15B 1YNJC 1F2MA 3J81E 2RSNA 1Q90A 1QOGA 3PO3B 3QOJA 1PRTB 2LS01 3D3RA 3I4LA 2SDFA 3VR3A 2I46A 2J7ZA 5IODA 1KLUD 4MT5A 4US8A 1SXTA 2PVOD 4OVZA 2BYTA 5KRUA 2HTME 1F2ZA 3FPUB 3AE7B 2WB1B 1C8CA 3NVWA 3LB8C 3A54A 2F0LA 3D4DA 2LGIA 2WKCA 3AV8A 3E9SA 4R9WA 4DAYA 2H4OA 3GTQB 3DWPA 1LLRD 5EE3A 1TWAB 3WOFA 1HUNA 2EYOA 2FUG1 3MXNA 2HQEA 2LMCB 4XXEA 1EEFD 4LMQD 1ESFA 4KY6A 4A3GB 4B08A 2RDHA 5T1GA 2KACA 4A3BB 2PZTA 2WDRB 4IKGA 5LHY1 3PV0A 3IAM1 2D62A 2OT2A 4RFBA 2E2HB 1TWGB 5M5XB 2K1BA 2J0TD 4B0MA 2B2UC 2LKVA 2DNEA 1RWSA 1AEXA 2FFKB 5DAUA 3I4NB 4YTPB 3IT6B 2JXTA 1SBBB 5FO8B 1S4ZA 2AUJD 2F0WA 3NTHA 2YEPB 1HZ5A 3W5UB 1WGKA 1YJIA 5C3XA 1T5EA 3CIRB 2KJXA 3P4QB 2LHEA 5CR3A 1VZ8A 1QNUA 4DGZA 4Q5VA 2NN6G 2EJMA 2QMTA 1BUVT 2WXLA 3KWVA 1Y8OB 1YNJD 3AB5A 3SXHA 1FXAA 1FR3A 3HOVB 2WXKA 2MGSA 5D65A 4REZA 4DAPA 2BBCA 1ZP0B 2CJNA 2QIEB 2AUKA 1H9JA 2EE1A 5KNBA 1Q1EA 2B2TA 1T3QA 2AX5A 3P42A 2PW7A 1QQRA 3K57A 4X3TA 3BK1A 4G4KA 3LYYA 3Q23A 4WRDA 1CFMA 2M9VA 1JOKA 4H0LC 3I73A 3QB3A 3GTPB 1T5XD 2R6GA 1PRTC 4U68A 3TSSA 1JMLA 2EELA 4IFDH 1EIHA 3AE9B 1C48A 2DNCA 3TZDA 4ZYSA 3AMUA 2IPKD 4IQZA 4ITKA 4FF4A 2JWUA 1Q10A 5JPNC 4HRSA 1FD6A 2PNRC 2BE5C 2F1MA 3DUZA 4HSVA 2KQ3A 3NZ3A 2F0MA 2TSSA 4ZAIA 1H9MA 1QOFA 3TMEA 1ENFA 4J1MA 2W3RA 1XX8A 3PIP3 2Y5PA 2AQ2B 2K05A 4X3KA 1LT6D 3V2TA 1XLQA 4US9A 3MXGA 1V8CA 3QJYA 5E4WC 3NHHA 1DOYA 5AFWA 3S1RB 4K8IA 5BN3A 2QJLA 4WJWA 3MFGA 3SK6A 2B2VC 3N52A 5C0XH 4WAFA 4N58A 1STHA 4ZRQA 1RTNA 4K6LA 5C4HA 4KKIA 1XLNA 3H91A 1CTMA 1Y1VB 5GXGB 2WXIA 3HP3A 3BYTB 1JOOA 3A8IE 2JYTA 1WTWA 4TRDA 5JAVA 5JPMC 2DBYA 4C3HG 3DWGC 1VDZA 3KUPA 3VR9B 5LL6S 5CBAE 3NTKA 1NUCA 1FCLA 2K3UA 5C44B 3M85A 3B2FA 1SE4A 2Z4IA 2WIIB 1WD0A 3NUCA 1WSPA 3CKIB 3AE8B 1E2WA 2HDLA 3J9CA 2IJ0A 1BR9A 1PRTD 2A68C 3BVMA 4WORA 1UGJA 1VJKA 1H9SB 2AQ1B 3MHZA 3IAYA 3OW7A 3I91A 3SFEB 1CK1A 3BS1A 4NZLB 4KD4A 1DOIA 2BE5D 1SYEA 2B76B 1B9MA 2KCCA 4MACA 5K36G 1JWSD 1UWMA 5FLXL 2W54A 5MPOA 3S1NB 1B44D 1R4QB 4ZRPA 4HSPA 3AE6B 1EY5A 5ELEA 3K59A 2YU9B 2M56B 2RKSA 3FDTA 3E56A 2PTLA 3D6WA 5CV7A 1D6EC 4IUUA 3T13A 1B3AA 1E2VA 1OQRA 2B2YC 5G5GA 1WWTA 1RTOA 3WCQA 1QOBA 3C46A 2FMMA 2BTEA 3A8JE 1I4HA 4HMJA 1AWDA 3G6JB 1SYBA 2HUGA 2QILA 1QKZA 5KEEA 3U9OA 2BOSA 3HOYB 3K58A 1RDPD 1ICWA 2DYMA 3ITPA 2KMMA 5CMDA 2KHSA 5CV5A 2EVBA 1EY6A 3R2TA 3K6OA 5E3FA 2JZPA 3W3AA 5JJZA 1XYIA 2WU2B 1GUGA 2IX0A 1M4VA