3URYA

Crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
b'INPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin
publication title Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 52
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3uryA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3uryA01
2XN9C 1D5MC 1LTRD 1FNWA 1TS5A 3KLSX 1LTBD 2O2LD 1TY2A 4RH6A 3BVGA 3URYA 2IPKD 1PZID 2AQ2B 1LTAD 3DWQA 1I4PA 1SE3A 5ELEA 1LT5D 1BXTA 3EFXD 1SXTA 4NZLB 1LTTD 1XTCD 1PTOD 4TSSA 1G8ZD 1EEID 1L0YB 3MFGA 4RGTA 1FGBD 3R8BA 4UDUC 1HQRD 1RF2D 2QEJC 3CHBD 2G9HD 5TSSA 4BWGB 5ELBA 2ICIA 5ELFA 2SEBD 1PZKD 1PRTB 1SE2A 1JWSD 2QILA 1HA5A 1PTOF 3OWEB 1I4GA 3GP7A 2RDHA 4Z9CB 1PRTC 3BYYB 2XRSD 3O13A 1CT1D 1PRTF 1ENFA 1SE4A 2CHBD 2J4XA 2XRQD 3EA6A 1HTLD 2XNAC 3W2DA 5ELCA 1JWMD 4RFBA 1JR0D 1SEBD 1S5CD 1RDPD 1S5DD 2NTSA 3BZDB 1PTOH 4RGNA 3BYTB 4ZYSA 1D6EC 1S5ED 5FKAC 5D3IB 1ET6A 1YN4A 1PRTD 1UNSA 1B1ZA 1UUPA 1LTID 1V1PA 1LO5D 1B44D 2TSSA 1LT4D 3DWPA 1EFID 1GOZA 1LT6D 4RGOS 2R61A 1D5ZC 4RHSA 1RCVD 1CHQD 1SBBB 1SJHD 2NTTA 1LT3D 1PZJD 4RCOA 1FD7D 4OHJA 1I4XA 1STEA 1L0XB 1ET9A 3V05A 1LTGD 2Z8LA 1DJRD 1JQYD 2RDGA 2WV6D 1RD9D 1CK1A 1YN5A 1TS4A 1TS2A 1LLRD 1PYWD 1F77A 1KTKA 3BVMA 1AN8A 1QILA 1EU4A 1FNVA 1DYQA 4RHRA 1HXYD 1I4HA 1MD2D 3TSSA 1V1OA 1CQVA 1EWCA 1TY0A 1LTSD 4L6TB 1BCPB 1BCPD 5FK9C 4DXFA 4K6LA 1JCKB 1T5XD 1EEFD 1PTOB 5ELDA 1BCPC 4DXGA 1S5FD 1JWUD 1M4VA 1AW7A 5D3DA 2AQ1B 3R2TA 1PTOC 1D5XC 1SJED 1I4QA 1EU3A 3DWAA 4RGMA 1ESFA 3BVZA 1XXGA 1V1PB 2IJ0A 1BCPF 1FNUA 4L63B 1YN3A 2AQ3B 4C56C 3SEBA 1KLUD 1I4RA 3R2IA 1S5BD 1TS3A 1CHPD 1KLGD 3MC0B 5I4DA 4O1NA
chains in the Genus database with same CATH superfamily
4I65A 3U2SC 2H4OA 1BT0A 4HEDA 3CC4A 3F2BA 3TZUA 3QA8A 3GTGH 4BY7H 1TZOA 4KD4A 3GTLB 1T0YA 2JA7B 3UI2A 4P75A 3M3YH 1K8MA 4US8A 4HCSA 4C3IH 4BBSG 2JQRB 4P72A 4ABNA 1GG3A 2PNHA 5T1IA 3T53B 4GXBA 3DM1A 1GHKA 3VR5A 5IGGA 1IXRA 5C4JH 1PH8A 4PT5A 5D65A 2KEEA 2LJ5A 3I55A 3CF6E 2NUCA 3P7JA 4G3XB 3GV3A 2BBCA 1RIPA 1KRSA 3UE1A 1IW7C 1PRTB 1XMOQ 3UDIA 5C4XB 1WJ4A 2KKCA 2WHIA 5C3EH 2GBKA 4LNQA 3ETRA 4KY5A 4OIKA 3DWGC 1IL8A 2A8VA 4ZHPA 5JHAA 1WSPA 2OQ0A 1I94L 4RG1A 4XC2A 1CT1D 1SNDA 2KACA 4YY3L 3RZDH 3T1HQ 2J0MA 4N58A 1GO3E 2K8BA 2V1CC 1C79A 3PO3G 1JJ2A 4P1CC 5G55A 1C3TA 3WOFA 1OTRB 1VDVA 2JE6I 3Q0AA 4ZLTF 5DPWA 4A3DG 3PIP3 1PFMA 1TWAH 2FCNA 4MH8A 4U673 2F0IA 1UELA 3A55A 5IP7H 1X3QA 1WZ3A 4B0MA 1D8LA 2NN6G 4YSXB 3GTOH 2H1EA 3MXGA 2XTIA 1F9QA 2KA7A 3FKIB 2KDEB 3WA0A 2A69D 4FA6A 3WWVA 4IFDG 2JZ3B 1TT5B 4LDTB 4TMAB 4ZDVA 3NS1A 5L95C 2LMCB 4BY1H 2NBFA 3J7ZC 2OTLA 4HAEA 5FO8B 5LL6X 2O6VB 1P9DU 4YWGG 2R92H 1I42A 1A3UA 2DNCA 1Y8PB 1FD7D 4A3GB 1E8XA 4K2LA 1E8WA 2LKVA 1KDAA 5ELNA 4HJGE 2Y0SB 2I07B 2EPBA 2ZNVC 5M3FB 3BIID 3CRLC 2Z8LA 3MXNB 3U30A 3C1EA 4CHKA 3W5UB 4GLVB 2JX5A 2RDGA 4AQYL 5G5GA 2VL6A 2K05A 4R4TA 2G4SA 3J81i 1X1MA 3T56B 2FIFA 2PCFB 1B9NA 2PQAB 3HP3A 1HNXQ 4XYCA 3GTGB 5CV4A 2N49A 5BN4A 1Q81C 3QR8A 3C46A 1HZAA 2FUHB 3NG0A 5D6JB 2Y5BB 1XQQA 3NWSA 4GOPC 3PLVA 1N36L 2KHWB 4YT0B 4BKGA 4K0KL 1KRHA 5MPOA 3TBLD 1VQDA 2OXPA 3PCOB 4K6LA 4JBKA 3KF8A 2E2JH 4CYEA 4APVA 1B70B 1J6QA 3RLNA 3I2ZA 3K80C 2B8FA 1F9JA 4RMAA 3GZNB 3DWAA 1EYGA 3ZLZA 1YN3A 2L0CA 4PZ7A 2VQFL 1LACA 2EZVA 1XYIA 1K53A 4EEWA 1C9FA 2AWTA 5C5MA 4IN3A 2FNJB 1U9RA 3F1ZA 3P42A 4BBSH 4IO9A 1VMCA 2DZKA 1NAPA 4NNJB 4ANXA 2PZUA 1G291 2OCEA 4GNXC 1TS5A 2JA8G 5EKLA 4XGAB 4GSWA 2KECA 1SYDA 4XT3B 5DM73 4NPNA 4ZRIA 2OHFA 4JG2A 1STNA 4GKKL 1U5KA 2N9PC 2KC2A 1RFKA 1P98A 3G6EA 4DV2L 2MWSB 2G5DA 4W9EA 3OWFA 2IY0B 2J7QB 1PTOD 2WX1A 3VUWA 3KOJA 1TGZB 5M5WB 3AMUA 1EEID 2KJHB 1GB4A 1FGBD 5F2DA 4IFDI 4MGIE 2Q2IA 3VA5A 3L13A 4KKIA 3NJTA 1MFWA 1PZKD 2HIXA 1HTPA 2F0TA 1M1KC 1JWSD 3I4MG 1WX8A 3HM6X 3GP7A 1A2UA 3IKJA 4DUZL 3ERSX 2UU9L 1WZ0A 3UE0A 2D07B 4A3CG 1S1QB 2ZW0A 5G5HA 2FE8A 2WDQB 1BOSA 1OXSC 2P5ZX 4MGKE 3PO3H 2L1BA 1WTWA 1W2BA 3RZFA 4UPAA 1K28A 4XDCA 3D31A 3M85A 3PZ8A 1BBWA 4J6IA 3ULPA 4A3DH 5LMUL 2MO1A 2A6HD 4JI7L 2E2HH 2F3IA 3A56A 2WKCA 2MX2A 1Y69U 5CBAE 2RGFA 3PV0A 5BO4B 1L7YA 4RGNA 4ITKA 1WCMB 3HUIA 3QQ8B 2A6ED 5M5XH 4IFDH 1IHZA 3APDA 5IO9A 1YJ9A 1EY4A 4JI6L 1A5RA 3P4QB 1IBLQ 3DHHC 4DHZB 1DZ1A 4DK5A 4LF9L 1V1PA 5KYLA 1JT8A 1LT4D 3LB8C 1UD7A 4JI5Q 4I7ZC 4KV2A 2F0PA 2FCSA 4LUVA 2KT7A 3DOWA 2GBNA 3T1YQ 4HEA1 1PH3A 4LUOA 1JB3A 3K7AH 4RCOA 3ZJYC 4US9A 3HOXG 4A3OA 2KANA 3D3RA 4ALPA 1WR6E 1WTOA 2GI9A 1YBYA 1IL2A 2IZVB 2C60A 5EE3A 4PV1C 3DQVA 4BBSB 3VUYA 1TS2A 5JOBA 4E6IA 5A35A 3OG5A 3VH4B 3CCEA 4B08A 2JSVX 1QILA 5BYSA 1VCBA 1ASYA 4CO7A 3S24A 2VB2X 1Q7YC 2WDTB 2BYFA 1XEEA 3ONAB 3TCAA 2NS5A 4A93G 3UQAA 2D9UA 4ZHOA 1ZXIA 2ZTCA 4QMGA 1VRAB 3M4PA 4G57A 3NK9A 1UE5A 1SYFA 3DUZA 4A3FG 4ACFA 1DOKA 2BOSA 4IUTA 4UP7A 4BBRG 4CKCA 4OX9Q 2HJ1A 2PVOD 3HZXA 3T4AC 3GTPH 1MI0A 1XT9B 2LXAA 1S3SG 3B2FA 3ZGZA 4UY8C 2FBWB 2L00B 1MIUA 1Q82C 3AE8B 3SK8A 1V2YA 3BU2A 2CQOA 2PPBC 4C3JG 2JA8H 2BTEA 4ZCKA 2CS4A 4LWCA 1C77A 2JEAI 3E6ZX 2AYOB 3K58A 4LNOA 4AUQC 2N1VA 2K6QA 3AE5B 2YYZA 2ZCCA 3ZIMA 3CCJA 4B3ML 1R4QB 3KLSX 2K04A 3GE3C 1NJIC 2BW2A 1BUIC 1I6HB 4F8CB 2WP9B 4ME5A 5A2QL 2NBUA 5FLXc 3DWQA 1TWCB 2HQEA 5DLQE 3V6CB 4HIDA 1SXTA 4IFDJ 1F2RI 3I4MH 1EYCA 1FIQA 3R3OA 3MWYW 1AH9A 2SAKA 4BVUC 2KFKA 1YX6B 1FVIA 1FJGQ 3PUWA 1HEZE 3AE9B 2QHOA 4UDUC 4EVOA 1PMRA 3PO2G 4A3CH 1K8RB 3HVDA 4WJ4A 4ZRQA 1HA6A 4Y52H 2A19A 1EIHA 2J0JA 1ML0D 1HA5A 3FAHA 4HVBA 2XK5A 2RDHA 4H02A 1T0SC 3STBD 3L9AX 3ONSA 2JF5A 3MJWA 2K6AA 3KF8B 3SFEB 5IODA 3J81c 1ZYRD 4EZKA 4EQPA 4LFCQ 4P6VF 4UAIA 1G51A 3MXUA 1TWHB 4LF8Q 2K22A 4C80A 4NAWA 1LABA 4JBJA 2UYZB 3A8KE 2R7FA 2WB1B 4ZUIA 2AEHA 4JI2Q 1J5EQ 2SNSA 5ELCA 1JORA 3RNFC 3R7QA 3QCAA 1X3PA 3OMCA 3M4OB 2KOXA 1SNMA 1FXTB 1IGDA 2DYMA 1JJCB 4TV3A 4DR1Q 3H15A 1SYEA 3VRBB 4FXKC 4LF6L 1WE6A 4YIJA 3AE2B 1TJEA 3WOEA 1N33Q 4HPLB 4AYBG 2KWCA 3AB5A 2CHXA 5HKHA 1F9PA 2CHWA 3IVFA 4MM3A 4J6HA 1GD7A 3JAME 2BS4B 1JWBD 3HOXH 2WKDA 4M0WA 4RHSA 3WAMA 1M90C 1O7YA 5CORA 5JXVA 4LNNA 3H0GG 2K28A 1NNXA 1PFSA 2DYOA 2IO2B 3AEAB 2LXCA 1FYCA 3Q14C 3VAWA 1UGMA 3T3NA 4C2MH 1RAXA 2FINB 4B3TL 1WI0A 3DBLI 3BG3A 3PUZA 4IZ8A 4L5SA 2B63G 3AM9A 1GC7A 2DWQA 3MTSA 1CK1A 2DY8A 3X3NA 4NPSA 5AZGA 3EC8A 1SF0A 4A93H 1PGXA 1Z6HA 2M8SA 1V9PA 1EL0A 2M17A 2UUAQ 1DM0B 2UXBL 4A3FH 3FC4A 1R4MI 4BBRH 2PI2A 2J0TD 1TY0A 4DV6Q 3PRMB 1VCIA 4W9HA 3I72A 2C9OA 4PMWA 4HCNB 5FK9C 1ONLA 4HIKA 5ELOA 1Y8OB 1EEFD 1UEAB 1WJ6A 4C3JH 1STBA 2IO0B 3QO2A 3JVZX 2REXA 3A8JE 1QCBD 1HTQA 5LNK1 3HGBA 1V1PB 2RD0A 3VVWB 3ITPA 3HOWG 2LHEA 1SMYD 3TQYA 1UWXA 2AL6A 2LFIA 1S5BD 1TS3A 1YJWA 3ZTDA 5IKCM 3W5VB 4IDIA 1YNND 1K51A 1F2YA 1TWFB 3D0FA 1I5FA 4XIGS 3ZDMC 5IT9c 3HOYG 5C3XA 1LTBD 2CW0D 2WDVB 3DVGY 3CPWA 4YHHL 3L16A 1B9MA 2JT4B 3GTJB 3N6RA 1LTAD 3HRZC 3AI5A 1SE3A 3B6YA 2Q8IB 1GUNA 3PO2H 1SYGA 1S4ZA 1AE2A 4KJNA 3L3OC 4DR6L 4A3EB 4WJWA 2C35B 5CR3A 3S2HH 3VH3B 5KNCA 1IBKQ 2LY7A 4HN7A 1RYJA 3B1LX 1K83B 3UDXA 5ELFA 5D7GA 2LGYA 1GB1A 2QMTA 5AUKA 1G6JA 2EYHA 4I7AA 3PSEB 5NUCA 2V3PA 2CH4W 4WJPA 4DR7L 2NVYB 2K4KA 3VR2A 4J8QA 3M7NA 3KWLA 3Q6BA 3ZNID 1NY4A 3F2UA 1BUVT 2L5TA 1WI5A 1IYUA 4KKUA 4GOPA 2WLBA 4G7ZC 4Y7NB 3KVFB 2XIWA 4JI4Q 2R93B 5BMHA 4FF4A 3D8GA 1HZCA 3Q8AA 2K14A 3VDYA 1EOTA 4NXNL 5M5YH 3H7SA 3N1YC 1S5ED 1WM2A 2BYVE 1WYDA 2GVAA 3C8YA 1CKNA 1WH3A 4IM3A 1E24A 1FM0D 2JPHA 1TXYA 5GAEC 5D14A 1Y1VG 3S1RH 3NRZA 4NJCA 4N6EB 3H0GH 1X9NA 4BXXH 1P7EA 4IM0A 2TSSA 4G11A 2Z59B 1IBXA 1O80A 2HD5B 2DJGC 4RGOS 3PGZA 2F0SA 2EXDA 1D5ZC 5E1FA 4GNXA 1K8AC 1N5WA 4A3JB 1UZXB 2KFKB 2L52A 2B2YC 2KCTA 1CHQD 2B63H 2GLSA 3KUCB 3U7ZA 3KBGA 1EY5A 3KLRA 4TQUS 1U4LA 2MBHA 3TRZA 2DNEA 2XK5B 3UDGA 4LNKA 1WD1A 5AEKB 2JA7G 1HFGA 1TTNA 2R7ZB 1YN5A 3S9WA 3QOLA 3RI7C 2EDGA 2K03A 2IHEA 2ICEC 4ODGA 3TMEA 4NAWB 5E4WC 4DV4L 5EKIA 1I4HA 4W9LA 1Q3LA 2LS01 3TEXA 2BS2B 3DM3A 3D4RA 3GTKH 3U9SA 2A68D 1RLFA 4ULLA 3PGEA 3AE6B 3C2PA 3SXHA 3HOWH 1VZ6A 5C4XG 4RF0A 1I94Q 1SGHA 1KOTA 3S2DB 2JYTA 3OIPA 3N1XC 2BS3B 3IAM1 1FR3A 4K7SA 2G45B 4YY3Q 5ELBA 2N7EA 4NJ6A 1ENCA 4DGZA 1FNUA 3H6MA 1JOOA 2BQQA 4HKZE 3HOYH 4C56C 4IC7B 4K7WA 4MM3B 1KLUD 3I56A 2RBMA 1AEXA 4K3BA 4MDKE 1C4QA 4S17A 3KF6A 4A3IB 4M0WB 3H91A 1B8AA 3G48A 2NVXH 1PDXA 1ZGUB 4P16A 2XN9C 4W9JA 1D5MC 1N63A 1XPRA 4LF8L 1OO9B 1QZHA 1FCCC 1JOQA 2ASQA 2EY1A 2ACZB 2KCNA 4A3MB 2CKHB 1I4PA 3KLSA 2QCZA 4L2YA 2R3ZA 5EJWA 4F7ZA 3N1ZC 2D10A 3CIRB 3A8IE 1PH2A 2RMMA 4XZ4A 2ID0A 4TSSA 2I38A 4B3SL 1H9JA 3HKZE 2ZM6L 1WRIA 1EQRA 2YTVA 1WTVA 1G91A 3FKIG 1SIFA 4WAFA 1YNJC 3QWZB 4JK1C 4I6LB 1KABA 2EYPA 5M3MG 1VQGA 1MHXA 4PQXA 3H3VI 3B08A 4AQYQ 3PREA 3I3TB 2NVQH 2KDMA 4A3GG 4NAMA 3DBSA 4KGRA 5IGFA 2Y0SG 4F88A 3J80E 3A9KA 5M3FG 2PZWA 1SNPA 2LRUA 1DOYA 1VQ6A 1II3A 3K81C 1VQAA 2IX3A 3F2CA 3EA6A 3KYDD 2XNAC 3IFTA 5C2TB 3TUOA 3UINB 1N36Q 1OXUA 1N61A 2E2IB 1P0RA 3TEHB 2B2WC 1S5DD 4YWKA 1EF5A 4B0EA 3BZDB 4ARCA 1E7UA 4DKAC 4MACA 2KTFA 2XWJB 1VQJA 1ZOYB 1YN4A 4IPGA 1O7LA 1V97A 1ZUD2 1PFBA 5GAHC 2WXFA 4KGSA 4KI0A 1F9SA 5KIXA 2WQYB 3KYCD 4LTUA 3BDLA 2VQFQ 4HLEA 3H3VH 4HJAA 1FPYA 1UWMA 1L2FA 3TP8A 2IGHA 3GTQB 2OEDA 4DAVA 2F3WA 3QB3A 1N34L 1E5WA 1TWGH 1RODA 1QNUA 1WXMA 4XQJA 3GTLH 2JA7H 3I4NG 1AWDA 2ZNVB 1GKHA 3MEFA 2MO0A 1WRDB 2D11A 3RUZA 1JMLA 2K3UA 1L0XB 1YHAA 4GKKQ 1YQ4B 4L1BA 4DV2Q 4H0LC 3HFZB 2ZJDA 1SNOA 2B3AA 5E6JA 4CJ0B 1MHHE 4DNIA 4FJYA 2E75C 1CMXB 1OEYA 2V1YA 2I5HA 2PJHA 4ZOHC 4P74A 4GOPB 2CU3A 1PHJA 3N9YC 5C4XH 1NSNS 2LGIA 1T9HA 4FJZA 4ZKBB 1CQVA 1EO6A 2BH2A 4LF7L 1LTLA 1A8VA 1LTSD 4DUZQ 1VQOA 3N52A 2UU9Q 1L5PA 2MP2A 3ZW3A 1GUSA 3CAMA 3I5JC 1SYBA 2GOWA 3I57A 5AZHA 2JWUA 5ELDA 4CGYB 2UU7A 1CKNB 4EQNA 2BKFA 2D5DA 4N9TA 1I35A 3J7YW 1CSPA 4RM9A 1XLOA 4FLHA 2PZTA 3FDTA 1HPCA 3H94A 5LMUQ 1WX9A 3Q2AC 3U7DA 4JI7Q 2ON8A 3SEBA 2YEPB 1IBXB 2K75A 1UE7A 3BDCA 3QIAA 1QKZA 3TMPB 1SR3A 3SHQA 2FMCA 2K01A 4GNXB 1GUGA 5I4DA 1RHPA 2PMZE 3DMUA 2K5PA 4DBGA 2BA0A 1WGRA 3GS2A 4GN1A 2WIIB 5CV5A 2CJNA 3QX1A 3QARA 2JQOA 3CMEA 4JI6Q 2VZAA 2JA6B 4WAAA 1MSHA 2V4DA 3URYA 1WCMG 4LF9Q 2J52A 3FKIH 1BF4A 3D4WA 5CV8A 5HI1A 4KMUC 1J7AA 1S72A 4HTHA 4TKOB 4C3HB 2KQ7A 2ZJPA 1I3QB 1Y1VB 2ZCBA 1TKWB 3VYRA 2EYFA 2EXZA 3TJPA 3V61A 2H88B 3MA2B 3KJOA 1AZPA 1TZ1A 3GZNI 3CRKC 1IW7D 5BYQA 2NYZD 4EQOA 4A3GH 3U58A 2IHFA 3D6WA 3RN5A 3CKIB 4BWGB 5M3FH 1XJVA 2KN4A 1D7QA 1KF6B 1R4PB 5G3LF 2HHHL 3OWEB 4FADA 4KDIC 2WXGA 4JC0A 3M3JA 2D0PA 4GLSC 1L1OC 3NE5B 1IPGA 4WWOA 4MELA 1S40A 4MGYE 1Q8KA 4II2B 4GN5A 1TWGB 1IUEA 4YCVA 1CJEA 4ZRPA 4QGUA 3SR6A 3KJPA 4YTPB 3EBEA 1SE4A 2CHBD 5HGQA 2E6XA 3KFUA 4A55A 1JWMD 3ZNZB 3TREA 3KF6B 1MPEA 4GDKA 2Z9HA 2CKZB 1EIGA 2KCCA 3TL5A 2LXKA 2KYWA 1QE6A 1VZ7A 1QB5D 5FLXL 2RDFA 1WTPA 1GUAB 2VW9A 1MGSA 1K9MC 1V81A 3P1MA 2K5NA 2KNBA 4EUTA 2QDLA 2WU2B 3N32A 3DBRB 1ET6A 5LHY1 2DGYA 4RNAA 2HCIA 4V190 1KDBA 3MEHA 1PFDA 2KOLA 5KYIA 2IYDB 2JRHA 1GPXA 4LJPB 1MJCA 1WOCA 4JI3L 1E7VA 5EGTA 2KZRA 3T16A 3EGRA 4DAMA 1GXDC 2BH8A 2NVTB 2GA4B 2M9VA 1WTRA 1EFID 1YQ3B 4G50A 4JL9A 1AE3A 4N8FA 2R61A 2Z6BA 1TBEA 1QOGA 1CZGA 3VRAB 1NBFC 2K0PA 3J81j 4B3MQ 3S1MB 2K33A 4HJ9A 1J19A 3P4PB 1BBXC 3J81L 2WXLA 4FHJA 3CPFA 1F9RA 3H9DA 3HS0C 2KAJA 1QVCA 4UHVA 1SAPA 3S1QB 4QF4A 2D0OA 1FMAD 2E5LQ 4RKBA 1QZEA 3EECA 4IPHA 5M5WH 3AULA 3MHSD 3A9KB 5K36G 3S14B 1SB3C 4OW0A 4JI8L 5FR6A 1KTKA 2NPTA 4QUCA 1AN8A 1DOLA 1E22A 1L4DB 2VRRB 2LVPA 4YXDB 2EJMA 3QIJA 3ZYYX 3AB9A 2E76C 4CQNA 3J7AV 3GDEA 1GC6A 5I6WA 2MBQA 2AUKA 2QC8A 2Z6KC 3I90A 2ZVNA 2ZXPA 3A7LA 5M3MB 4AQ7A 2EY5A 4DV7L 1JCKB 3CCMA 3W1YA 2NZOA 3ABVB 5I2YA 4JGHB 3R2TA 2GBMA 4USAA 4R1JA 3BVZA 1BCPF 4PK1A 1HFNA 4JI1L 4X3KA 4HJKA 4KX6B 4OWTB 4YTNB 5JPMC 2EE1A 4DF7A 1WCMH 4F8MA 2WB1G 4OWWB 4LF6Q 3TEYA 3W3AA 3BZCA 2G4DB 5JZEB 1EY6A 3ZUNA 2R6GA 4IUUA 2O2LD 5M9OA 4DK0A 3PPAA 3Q3NC 3ZDTA 3Q22A 3K0XA 2B3GA 4ZRZA 3UIOB 2L05A 2WXJA 4HMJA 4NZLB 2B2YA 1K8OA 2L12A 2RCNA 1DD2A 1A15A 1YJIA 5J1ZA 4YCUA 4MJSA 1HQRD 2JXTA 2AX5A 4AOFA 4B3TQ 4IUVA 3I4NB 5C3WA 2MP2B 3VHTC 1BDOA 3NXWA 4FNFA 4GLXA 1VQ8A 3I3CA 1PH9A 1T3QA 2ZT9C 1C4CA 2Y5CA 4OWXB 2X6GA 3L0WB 1VD2A 3DVGX 2JZZA 1UH6A 2UXBQ 3IT4B 2LZ6A 4E74A 2L9HA 2BWES 2JXMB 3I73A 5IT9L 4RFBA 2NN6I 1DOMA 4DNTB 1SEBD 1YNXA 1PGAA 2W3SA 5IP9G 3DEOA 2NMQA 4R4IA 1UE6A 2R7DA 1RL2A 2KX3A 3V96A 2Q5WD 5I9PA 4H44C 1PRTD 1K3RA 4M00A 5E4XA 2B2TC 2F0EA 1MG4A 1VR9A 3C19A 2VQEL 4IUPA 1EYDA 4M02A 1QOFA 1B44D 3U4ZA 4DV5L 1YIWA 3LDZE 1LT6D 3U4VA 3HOZB 1E7PB 1Y8NB 3NZUA 4XDXA 5GAGC 2Z0EB 1EFWA 3WALA 2Q2TA 1VLBA 3UI3A 2PKOA 4YHHQ 1I6HH 2XBBC 1TWCH 4G4KA 3SK6A 1CQFA 1XNRL 2AHOB 3TEZA 1VF5C 2NN6H 4JBWA 4DR6Q 1Q1EA 3L0OA 1AFPA 1HRJA 2WXQA 1QUQA 2VUMB 3K57A 3C0RB 4BKSA 4WURA 1HE8A 3A33B 3R3MA 1FNVA 4JIOU 5GMVA 3X0WA 3FEWX 4WWMA 4A3EG 1Q90A 1ZDVA 3JW0X 3ML9A 3OMGA 4K14A 1YX5B 2HD3A 2MHVA 5LXHA 1B7YB 2KO3A 4GDKB 4IJLA 4HMIA 1C78A 3RNEC 1YIJA 4LDTD 5BMIA 1NR4A 4OELB 1G6PA 4DR7Q 2O6VD 3H6NA 4FN2A 2F0DA 4FXGC 3ZRCA 4JVZA 1S5FD 1TWHH 4TRDA 3W5OA 2DAJA 4W9KA 1XPUA 3S15B 1PTOC 1ENAA 1ZW7A 1QVFA 1QF6A 4HK2A 1SRUA 4LLGM 2B2WA 4P7IA 1KAAA 5EBDA 3M4OH 1NYRA 2IO1B 2C5CA 5KRUA 4NXNQ 3S2AA 3M7GA 1YZ6A 3JC66 2R93G 3AYHB 2I2YA 4A3KB 2PQEA 1ZP0B 2N9EB 4J15A 1GVPA 2K5DA 1D1KA 4OIJA 1WGKA 1WX7A 4W9FA 3RD2A 3RNAC 2IPKD 4PNYA 4A3BB 4IOIE 3GD7A 5DPTA 1LTTD 2OTJA 1EF1A 3A4RA 2WDRB 2NPTB 5J39A 3DXJC 2A6HC 3DWMA 3RZWC 4R4CA 3HKSA 1K52A 2JP1A 3OYYA 2DHZA 4MEMA 4EE2A 4A3JG 1OQYA 2HT1A 3ZJVA 4DWFA 5EPKA 1DONA 4JE3B 1NMFA 4RAUC 4Z9CB 4DDGD 4CHTB 5GXGB 3HOUB 5BR8L 3BYYB 5IYCG 1E10A 2AMCB 4HSVA 3BK2A 2GRIA 3ZNHB 1FO4A 2L0FA 3MHZA 2WS3B 5IP9H 1YHBA 1BO0A 4DV4Q 2KBNA 1JICA 1P3QU 4OVVA 3VXWA 1FFVA 1E7ZA 2R7ZG 2XRQD 1FEHA 4DUYQ 2W9NA 2MGSA 5DCNA 3IAYA 3PSIA 1IBML 3I7FA 4JPBW 1WJJA 2F0UA 2E5LL 2XSCA 4WJQA 1V86A 2PEAA 4A9AA 1VQBA 1HTOA 1PXUA 4ZRKA 3K0YA 2B29A 3SVMA 2IT1A 5T8IA 2KJ6A 1V5TA 5JVG3 2J42A 1Z9FA 2M0XA 3CQZB 1B50A 2DBYA 4WJNA 4BKTA 2IO3B 2YV5A 3RPFC 2ONQA 2KHJA 3Q23A 1WGDA 2W82A 4GDLA 1QG7A 1YITA 1VQKA 3KLWA 3V60A 1TWFH 4POFA 3DEPA 1BVSA 2RPVA 2JUOA 4MJSB 1C0AA 4DR2L 4GB9A 5EE0A 3NPPA 2OOBB 1RWSA 2E3TA 4A3IG 3GTJH 4OHJA 3Q8CA 1NVID 2K6DB 4R8NA 4FF2A 4XWTA 3S1NB 1LM0A 2VH2A 1RTOA 1H9MA 4A3EH 3GTMB 4X62L 3NS8A 4ZKCB 1FCLA 1GHJA 2MFIA 1LLRD 2ZM6Q 4DV1L 4HSPA 4A3MG 4B3SQ 3KDFA 1RRBA 1N60A 1UWVA 3MJ5A 1A62A 1K83H 3GO5A 3NBHA 4RHRA 1HZBA 3CCUA 4JYAL 1HXYD 3CSTA 1WMHA 2VS1A 3N20C 1L1OA 1J8CA 3AQQA 3K7UC 4CJ2C 4ZK9B 1XX8A 3KYHC 1C1YB 2INCC 3I9V1 5JH5C 3U50C 2JWZA 4KSLC 2NVYH 4PMBA 1K8GA 1WFYA 5CGKA 3E0EA 2LI5A 4X57B 1BCPC 3Q3FA 2KMCA 4MH0E 2WYQA 2MQHA 4CKEA 5IIFA 1ZKHA 4Y7NH 2N0SB 3K5MA 2UUCL 1E90A 1Q10A 2FIDA 1ESFA 4LK1C 4YSYB 2R93H 4AJYB 1WGGA 1X3FA 5GADC 2HDEA 3PS6A 3ZJTA 5EE9A 2JRIB 2PLPA 3UQBA 1C4AA 1TQOA 3MC0B 1XWEA 2KDIA 1UF0A 2ZPNA 4PZ8A 3P20A 3ZJUA 1KNEA 1CZPA 5A2QE 1R4NB 2EY2A 2F0QA 1LXDA 3PHWB 3STBC 1IYVA 2HIVA 4JLCA 1HNZL 3EROA 5JEAG 1ZYRC 5G2NA 3A74A 1VQEA 1TYGB 2QGQA 2MBBB 3DLLA 3NZSA 3L08A 3TN2A 4A3JH 1N34Q 1QUQB 3DHIC 3NEMA 2JSOA 3AN1A 4AP4C 1PV4A 2J0KA 3NVWA 2D5GA 5IYCH 4N59A 4KVGB 1WVLA 2HTME 3Q3JA 4B95A 1Y8RC 3OTOL 2IX0A 1WFQA 5LMNW 1O7ZA 2Q8TA 3CU7A 4M8AA 1VQ7A 4HKQA 3A7AB 2R7ZH 4DR4L 1X54A 3PT2B 5LLIA 5FJ8G 2D62A 4KKJA 2N9XA 2N7DA 4ZYNA 1GNUA 5JHBA 1TR5A 2CH4A 2A5UA 3KUZA 1FRRA 2Z6KA 4H2AA 1SNCA 5CC4A 4LF7Q 1B4OA 2L7RA 3CCVA 4FXCA 5FR3A 4Q5VA 5CMDA 2DY7A 2W54A 2NTSA 3DPDA 2Z0DB 4KKTA 4KY6A 3S2DH 1PH6A 3AMZA 1A3TA 3BJUA 2BE5D 2L1AA 2KLGA 3BK1A 3SD5A 4RKLA 3DBHB 3FPUB 2M56B 3NVYA 5DNFA 1MBYA 2NBWB 3OW7A 2IW3A 1K73C 2N7JA 1J7CA 2L76A 4GS3A 4A3IH 3TIXA 2EKIA 2CCZA 1TKGA 3VQIA 4HJ8A 4DHJB 1P16A 3S17B 1XCQL 1HR0W 1PGBA 2MH7A 1RCVD 2XGTA 1Q5WB 3SK5A 3TS0A 3NUCA 2EYLA 2DZIA 2IDYA 1V9JA 1OTCA 1RJTA 3AECB 1TU2B 2FCMA 3W1BA 4A3MH 4EZJA 4U68A 2QF7A 2IL8A 3BY4B 1Q8IA 5IOCA 4II3B 5H92C 5J17A 2RSUA 1Y14B 2A1AA 3CCQA 1WWTA 2I5LX 1ZDXA 4BFRA 2D3AA 2JA6G 2DX5B 1I7HA 1ILPA 3EN2A 3D4DA 4AIMA 3PRPB 3HG9A 3K9PB 1C9OA 1STAA 2LVQA 4TKNA 2KLCA 4C3HG 1QOHA 2I46A 2MJ8A 4DNRB 2JK8A 1B2TA 3NTIA 1EWIA 3L7ZC 2ASBA 1SIJA 4KY7A 3RR5A 3HK0A 1X3GA 1YNNC 1SFOB 1ACCA 2J53A 2HHHQ 2MA9B 2RF4A 4GKJL 3MFYA 3OHXC 2CW0C 4HCPB 4XYOA 3M63B 5J18A 2AWOA 1VDZA 1E2VA 3P4SB 4Q2JA 3I70A 5JVH3 2ZXRA 2JN4A 3FRPB 2WAQE 3CD6A 5JJKA 1FRDA 2PE9A 3G6JB 3HKZB 3AE1B 4A3LG 4IG7B 1B3QA 4WFN3 2WINB 3NQTA 3E9HA 5KNBA 1P1AA 2E2IH 1SDFA 4L63B 4GDLB 5EE1A 4W9IA 2WXMA 2JVCA 3U9OA 2WNMA 4BOSC 1Q1OA 5JEAH 3ZTCA 5ISRA 3ER0A 4X64L 2HJ8A 4BBNF 5HFYA 5DAUA 1WGHA 1WJNA 2G3QB 2LWPA 2ZXOA 2KWUB 1H8CA 3ZRFA 2ATWA 1GUOA 4TVAB 4JV5L 2UXCL 2B2TA 2OJWA 5IY0A 4DUYL 1L6UA 1SNQA 4WQOB 1E6EB 3NTHA 1E2WA 4K5WA 3CMMB 1PZID 2AQ2B 4V0BA 4JI3Q 2HE7A 1C8CA 1WIAA 2MPMA 3GTQH 2NWGA 1B9RA 1L6VA 5C6AA 2CJOA 2WXPA 4QIWE 3KDFB 3ND9A 4N9F4 2X69A 1XPOA 4BKSD 2CVRA 1VQLA 4HCEA 1DGSA 1L0YB 4RGTA 3NBHB 4LF4L 2GMIC 1R9TH 2LGDA 2V9HA 3GB1A 1KDCA 2QEJC 5FJ8H 1WMHB 2G9HD 1EQVA 3C1FA 4GN3B 5EKKA 2MLBA 2LXJA 2UUBL 3K6OA 1L1OB 1KL9A 3DHQA 1SSNA 4OZAA 4KN7C 1JWAD 1WTHA 5H1SE 1VQMA 3QAQA 5EPLA 2RQXA 3WCQA 1VQ5A 2J7ZA 2WFWA 5HY6A 4JI8Q 5LMNL 4IOAA 4QB4A 2PPHA 3AU5A 2QKIC 1PA6A 5T1GA 1C4PA 2J4XA 3EIVA 4JBMA 1IKLA 1E2ZA 3CCRA 1VJKA 2JA9A 2GB1A 5DM63 2Q2UA 3BS1A 4DV7Q 3J80i 3A4SC 3RNCC 1IKMA 3VUXA 3T3OA 2F0NA 5COYA 1XNQL 3CSFA 3V6EB 2H89B 4G7OC 4OZCA 2HUGA 3SDLC 2YU9H 4C7ZA 3CMAA 2LJIA 4H7BA 3E56A 1Q86C 3NUHB 3M4YA 4CJ1B 1JMCA 2I0QA 1F2ZA 4JOIC 4JI1Q 3ULJA 2MBOA 3B9JA 1ZEQX 4GU2A 1HUNA 5C5LA 4L23A 2KDFB 2PNRC 1EM7A 1EOVA 1ILQA 5BN5A 4DV3L 2NTTA 1SJHD 2N78A 1QWYA 1LT3D 1CA5A 1RM6C 5JEAJ 2A68C 3PMFA 2JA6H 4AWJA 2PE6B 5CHWA 1HR0L 2IGGA 4GMVA 4MIUA 2KJRA 3V05A 3ECIA 1LTGD 3L54A 2TMPA 4MTKA 3LNNA 4KK7A 1PH1A 5KHOA 4C3HH 2D2QA 1I3QH 1Y1VH 5IWAL 2IWHA 1STYA 2VZKB 2QW7A 2ZW1A 3NQIA 3L17A 3EQLC 3RZOB 5HHDG 3DBRI 3BVMA 4O0AA 2PMZB 2BYTA 3E0JA 4K5XA 4RCNA 1ZE3D 2EMSA 4URKA 1ESRA 2K9XA 2FFKB 1C76A 3EHVA 1V1OA 2MCNB 3I4OA 2F0KA 2E74C 5I9OA 2PO4A 2N9LA 1BQQT 2B2UC 4FXDA 1N9WA 2EJGC 5CTRC 4M8MA 2LASA 1HH2P 3VYSA 3V2TA 1R9TB 1YMHE 1E9MA 1AW7A 1STHA 4UP9A 5IYDG 1KIXA 4Q0FA 2JA5B 1F2RC 2AQ1B 3EFUA 1WYGA 1SJED 3L4PA 1VQHA 4RGMA 4ZAIA 3KWVA 2IJ0A 1IYJB 1SN8A 1LFDA 1ROEA 2BCOA 1HNWL 4M8NA 1YJNA 4POGA 2K25A 2K50A 2N9KA 4JWUC 1PYBA 3N3KB 2N4FA 1JRPA 3LX0A 2Y3AA 1NCVA 2L8JA 5C44B 2ZPYA 3NVZA 4WWPA 1ZKOA 2M1MA 3GE8C 3Q69A 3WAOA 4A90A 2INDC 1V1QA 3SGIA 2KQ3A 1XMQL 1W6KA 2Z1CA 2VQEQ 1OFFA 3NWTA 4YL8A 2NVTH 4AYBE 4DV5Q 1BXTA 3EFXD 2WGSA 3LWEA 1V6EA 2BKRB 2L83A 2LUMA 2QDFA 3AE3B 3WDNA 3NP8A 4HPPA 5D2MB 3S1MH 4OEMB 2LUEA 3SR1A 3MFGA 4KV6A 3NZ3A 1MVKA 1J7BA 3ZO5B 1M94A 3VR6A 2K7VA 2YU9B 4LAAA 3HOZG 4ICUA 2F0JA 1XNRQ 3S1QH 4H13C 5I6YA 2L15A 1NYQA 1PTOF 4K81A 2HDLA 1CTMA 2EQSA 3A5UA 2F0HA 3QG1A 3S14H 1QLBB 4NKLA 1FD6A 2SOBA 1QOAA 1PFNA 4KIKA 2OWOA 4EX5A 2Z0SA 3PF5A 1PH7A 5IP7G 2K1FA 3MXPA 1PRTF 3CC7A 3AEGB 2KN5A 1TIFA 2M19A 5FOBB 4K5VA 3PIPA 1TVXA 4NDXA 1HQMC 3ZVVA 3W2DA 2VUMG 2KVRA 1OGWA 3UDFA 2KD0A 2CWAA 2KK8A 4ICVA 5M3MH 5KHQA 1N32Q 3X23A 1GUTA 2PW7A 1OXTA 4QAYA 4LFAL 5FKAC 3PIO3 2D3CA 5D3IB 2KTRA 2L0TA 3FILA 3A0JA 1CKOA 1UUPA 5IP4D 4NXML 1HZ9A 5J22A 4MHEA 5AZFA 2JU6X 4DN4M 2FUG1 4RM8A 4IKGA 1EQTA 5IE8A 4X3SA 1SBBB 1VQIA 4DXAB 4E71A 5IAAC 2F0FA 3IHPC 2QDBA 3G7LA 3KH0A 1STEA 1S3OA 1ET9A 1XLPA 3A5ZB 2BYEA 2LHDA 2FHTA 5IGDA 4A3KG 2WV6D 1DGJA 3IT6B 1HZ6A 1FL0A 4FO2A 1Y1WB 1J9OA 3S16B 2VZKD 2M2LA 2FXQA 4A3BG 2BB5A 4LNIA 4C7YA 1LUZA 4R4QA 2EELA 3U4EG 3V62A 1NBWA 1F0ZA 5IGEA 4KLKA 4HJ5A 2DZMA 4IWOA 4ZQ3A 3I4NH 3TSSA 1A70A 2RR9A 2B2VC 4B9KA 1EWCA 2F4VL 5IYDH 1A3VA 2N8NA 3MAQA 1O7IA 4A3PA 1RKNA 3IG3A 3AXCA 5BR8Q 2Q8RE 2CWPA 2YTXA 2WXKA 1Z7TA 1UE1A 2KXJA 1PTOB 1T5EA 2GN5A 4X66L 5GROA 4DXGA 3NELA 4JW0A 2EOTA 4HIMA 4X6AH 1NI3A 3NHEB 2BB6A 3HOUG 3RFZB 2LGXA 1IBMQ 1V8QA 2K1BA 4YCWA 4BBNC 1VQNA 1E0ZA 2FMMA 2AQ3B 1E8YA 1OXXK 1Z5SB 5KGUA 2EY6A 2FJ2A 4K7UA 2ENBA 1CHPD 4CBVA 2LGSA 3UGBB 5L83A 5IGCA 3J80c 1E0BA 1FXIA 2NCNA 4EOYA 2ZVOA 4JCVE 4KZCA 2KMMA 5KEEA 2WXRA 3P63A 2WXOA 4NY0A 1N8RC 1TY2A 5E3FA 1EWYC 4DAPA 2BPSA 3RUIB 1UAPA 3AFPA 4FVMA 1NENB 1XLNA 3FKYA 4CDEC 3RCZA 1CFMA 4IPCA 3ML8A 3HOZH 2F0GA 1FFUA 3DVNV 1IZ6A 4LUZA 5JAVA 2X8XX 5DPSA 2LD9A 4OVZA 1NMGA 5HURA 4DR2Q 1EY7A 2H5XA 2K8HA 1NTGA 2XWBB 2LVOA 5TSSA 4MN3A 2CR5A 2R2OA 2BDOA 3RYTA 2OT2A 4KHVA 3VTUA 1U4PA 2I5MX 4XYQA 4ILWA 1X65A 1I4GA 4B3RL 2KMAA 3C3LA 2RSNA 3NENA 4X62Q 2VUMH 1C48A 3VA7A 3E5SA 3VYTA 4DV1Q 5EAYA 3OJ3A 2GVBA 2SNMA 1DOXA 2NZ1D 1OEYJ 1JOKA 3WIMA 1Q0WB 1XO3A 3IFDA 1E3PA 1YEZA 4LF5L 2Z4HA 1I50B 4JYAQ 1UBQA 1HTLD 2F3VA 1AARA 2OQKA 2F0OA 5FLXE 4XTCS 2F0MA 1LM8B 1N62A 1RDPD 4DK6C 4PYUA 2KCMA 3QOJA 2BVCA 2O2VA 4BAXA 4KJOA 4WQMA 4A76A 1HUMA 4ZYSA 5BN3A 2NR2A 3ICEA 1D6EC 4J1MA 5CHFA 3S15H 5TR5A 4L8JA 4GZYC 2XEWA 3AFQA 1Z2MA 3TP7A 2UUCQ 4BY7B 2Z4IA 4KHPQ 3VDZA 4WJ3M 3M3YB 5CV9A 1LO5D 4EQ5A 4C3IB 3BZKA 3VR9B 3DWPA 1GOZA 1G2TA 4IURA 2DN8A 2V0GA 3ZQ4A 1W6JA 3J81E 4HXDA 4GN4B 5C4JB 4A3KH 2DNFA 5C0XG 2W3RA 2A69C 4ANUA 3VYUA 3ALBA 1HNZQ 4A3BH 1BMLC 3SE0A 3KUDB 2KDBA 3X3MA 3OOCA 5EBCA 3JYUA 3PV1A 1B53A 3IL8A 3RNBC 5C3EB 2QA4A 2BF8B 2PW5A 4IWQA 4KIKB 5C1ZA 2MJ3A 1EZ8A 2A74C 2WACA 3U52E 1WTQA 3BDOA 4X65L 1WGYA 4MT5A 5CYUA 1GM5A 4DAYA 3ZXVA 3RMKC 2MUYA 4FF1A 3N30A 4BZAA 2JYOA 1KNAA 4TUUA 4XWWA 4UP8A 4RWSC 2DAFA 4HDQA 3OTOQ 3RZDB 2RKSA 3IBEA 3UIPB 3VTVA 2O5JC 1KD1C 4KZ0A 4DR4Q 2BT6A 1LV9A 3HOUH 1KM7A 1BCPB 4B9XA 2INNE 3D32A 3A54A 1CZWA 1T5XD 4DPGA 3FILB 2KTRB 2X38A 5K36H 1M4VA 3B2GA 3ULLA 4FF3A 2R2QA 2Y0SE 1K0SA 2IBIB 1TWAB 1VQ9A 3KQ4A 1VQPA 3LJ3A 4NQLB 3K8AA 3J7A5 2V3NA 4CDFC 3MVVA 3RNUA 3GTOB 2BGFA 1CM9A 2WX0A 3DCGA 3MC8A 2RPQA 1KLGD 4PS8A 1BR9A 4N9PA 2WAQG 3CF5A 5I2XA 3CQZH 1P8LA 2KUMA 2KWVB 4WORA 4BY1B 3H3VC 3BWUD 1N5XA 1D1IA 1MKHA 2R92B 1V8CA 4JOIA 1KFYB 4MNOA 2RHQB 4RF1A 2HTHA 2PIAA 1N32L 1N6ZA 4PG3A 2OF1A 2KQSA 2K32A 3PZ7A 5G3LD 3ZKJC 4BS9A 3JSVA 4G0NB 2C5LC 4W9GA 4DR5Q 1BKBA 2UXDL 3R8BA 5AJ3L 4OXPA 2G9DA 1RF2D 4L5QA 1PH5A 2C7MB 3PZDA 1D3ZA 2DYBA 4XE0A 5C0XI 2ICIA 1KRTA 1FXAA 3S1NH 2ZZPB 3APFA 1EUJA 4JI0L 4DR3L 1X56A 5FLMG 4QL5A 2KFJA 2F03A 5JJLA 3L10B 3QWNA 3GTMH 1WXQA 3EUB2 1PRTC 1R4NI 1HCZA 4PMCA 4MGZE 3P1HA 3P4RB 3IAS1 2E2JB 4WJOA 5EQ0A 1SSOA 5IT9E 3HRDD 3HIZA 3MP9A 3LGJA 4K6DA 1KC8C 2ZEQA 3R7RA 1UEBA 4JWSC 2F4IA 4HRSA 2A5HA 2B2UA 4GKJQ 4A20A 4A75A 1A6XA 3R93A 1TKYA 4HROA 4HWIB 2PYKA 2WXIA 3W1SC 2MEKA 2RDBC 1YOVB 1LYLA 3OAWA 4REZA 4IPDA 4IALA 2QEXA 1UNSA 4KTAA 1A2TA 3BINA 3K5LA 1NUCA 2A6EC 4OVUA 5C0XH 1EQQA 1L0VB 2F0LA 1QZGA 3HKZG 3SHLA 2C7HA 4BA1I 4HIOA 2N88A 3EVQA 1HJPA 2EKEC 4TQ0A 2VY3A 4X64Q 2WXNA 1V43A 1IGCA 4ANWA 3AV8A 2ZJRA 2E2DC 4JV5Q 2UXCQ 3JAML 1WE7A 2AL3A 4N8X1 2Q2HA 2K5HA 1XMOL 4MZ9A 1DJRD 4W9CA 3FPPA 1RD9D 3G4SA 3RLFA 2KWDA 4C00A 1RTNA 3F8TA 2MSED 2WXHA 5DEHA 3QK0A 1GJZA 1PYWD 3TZDA 4LF4Q 4ARIA 2C9WB 1WF9A 3DBHI 3IFWB 1EU4A 3Q8EA 3MHBA 3PO3B 4P2CB 4DHZE 3W1GA 1QJOA 2UUBQ 3H8HA 2WP8J 4CDCC 3T1HL 4K3CA 3F2DA 1NR2A 4A3DB 1NDDA 2E2HB 1O78A 2O2VB 3J7AF 1BCPD 4GLAC 2F0WA 4DU9A 1EIYB 1BNZA 2VH1A 2K5WA 4QJFA 5LMNQ 1P7FA 3NVVA 2KHIA 3OJ4B 3Q3MC 5GQOA 4P73A 1V49A 1YNTE 2DUDA 5M5XB 4R4OA 5CX3A 1U4MA 1YI2A 4WWNA 3JAMi 3E3XA 4R8IA 3CWIA 1KJTA 2V4LA 3VR3A 1AZQA 1VZ8A 5C3JB 1WJUA 1PQSA 2QCPX 3OPOA 3TP6A 3K5OA 5EPJA 1XNQQ 1LTRD 4EZLA 2KQ4X 1QVGA 2FCQA 2NBVB 2MP1A 5CHVC 4KKSA 4QCLA 2G1EA 2YTYA 3K7AB 3BVGA 4YWMA 2EMTA 1STGA 3I91A 2D3BA 2IY5B 2CFMA 1R7SA 3A1QA 1MI2A 2DJFC 4ANVA 1Y56A 4WRDA 5IYBG 1UBIA 1UGJA 3HHMA 3S17H 4NJ7A 4FBJB 3RN2A 1WD0A 3RT3B 5C0XJ 1QT9A 1MHWC 5FLMH 2DZJA 4DAYB 4DV3Q 2MW5A 2PW9A 1G8ZD 1HNXL 4O42A 3AU7A 4A8XC 3CHBD 4C4VA 1HR0Q 4KHPL 2HDMA 4XT1B 2CU1A 4J3OD 2VB3X 3HVZA 1EY9A 2ZJQA 3MTNB 1DXMA 4HR7B 4NQKE 5IWAQ 3EFCA 1JW9D 1XLQA 4DA2A 2XRSD 2NZHA 2LFNA 4EFOA 1GUWA 2KJXA 4P1BC 4XDDA 5DPRA 1ENFA 2B2VA 5J2RA 3GTPB 1SFOH 4FULA 3OIQA 4BXXG 3CC2A 1T0RC 1MJDA 4KDLB 1JJGA 3TBIB 1YVCA 1JR0D 2B39A 4OZBA 4AS1A 1F2LA 1S5CD 1LQBA 2JA8B 1PVOA 3IXSA 4DK1A 2L32A 4OO1G 1JRUA 1SLJA 3EJIA 3ND8A 3NY5A 5IN7A 3Q3OC 3TDQA 3I63C 5E6OA 1B1ZA 2BWFA 1KH0A 1VF7A 3WANA 3H7PA 1LTID 2NB0A 4L5RC 1HNWQ 2KVZA 4OONA 3Q24A 2JA5G 3PHXB 3AEFB 3B0AA 3JSVB 3I4LA 1ZPSA 2K5QA 2EIFA 2LRWA 3KW5B 3I4MB 4YWLA 4EGVA 3TP5A 2RA4A 2D3GA 2KC1A 3J9CA 4AJWA 2WB1E 1PZJD 1FGUA 2WAQB 1G2SA 1KHIA 1XMQQ 2Y5PA 2I1JA 1L2NA 5C44G 2C7NB 3A9JA 1XD3B 2MJDA 2NVUI 2JJQA 4L5TA 2EYOA 4JPSA 3K9OB 2O5IC 1TS4A 3E9IA 2M4NA 3VTWA 3RLOA 2MNAA 1F77A 1RFAA 1T6BX 1EWHA 2N3SA 1DYQA 1H9KA 4IWPA 1H9SA 2ZTDA 3AEVA 4NB3A 5C4ZA 1U4AA 4P71A 1WXAA 3TEWA 3D6CA 1WR1A 4TQ1A 3AE4B 1BBUA 4YTMB 3CCSA 4DR5L 3R66C 4PYZA 5BYRA 4NW2A 4QIWB 2RSOA 1JWUD 2KVMA 3I8ZA 1KQSA 5D3DA 3APCA 2IX1A 1A0IA 4DV0Q 1WM3A 4R3DA 1OQRA 4LNFA 3QJYA 1IBLL 1MG8A 4ZRJA 3RN9C 2KENA 4OGQC 2CHZA 5C4HA 1VQFA 1K0RA 1F52A 4ASWC 2AWNA 4JI5L 3CCLA 1SMYC 3PLUA 4IM2A 4LFAQ 4E3CA 3HOXB 4GGQA 5IYBH 3K59A 4K8JA 4LMQD 3FMCA 4OO1I 3T1YL 1NEKB 1TKEA 1H9RA 4I6PA 5LXIB 2EYJA 2MQJA 4DDID 1Q1BA 4XQNA 4LCDE 5FO7B 4NXMQ 5E7NA 5ELEA 4C2MB 1X6OA 1ISNA 1L0WA 1YJJA 3ENEA 3RNGC 2B76B 4FP5D 1EIFA 4IQZA 5IA7A 2EVBA 5K5PA 2JXXA 3T51B 3V3XA 4A93B 3AEBB 1DCZA 4DQOC 1EY8A 5C23A 3WAPA 4MSMB 1TIID 2N55A 4F7XA 3E9SA 4XQQA 4F87A 3HOVG 1SE2A 4A3FB 2QILA 2INPE 3AU4A 1PH4A 4HPMB 2BE5C 4BBRB 5JJZA 1AP0A 3OLMD 4X3TA 3DDCB 3ZXRA 3RZOH 4A6QA 4LFBQ 3O13A 2V3SA 4JQWC 4OX9L 4C3JB 2K39A 3AEDB 4OO1H 5IOIA 3J80L 1Y1WG 1Z47A 2F1MA 2L55A 1MJEA 2FAZA 2F4VQ 1VS0A 1J0GA 2W55A 1D2BA 1ICWA 1YNJD 3DBLB 1EUVB 4MTNA 4IOCA 4X66Q 1SMXA 1VQ4A 5E6NA 2E8GA 3K5NA 2JA5H 1YQBA 3P75A 1CA6A 3CXCA 2JYEA 1NE3A 5BMGA 2M0AA 3A1QB 1PYSB 1TT2A 1J8IA 1QOBA 1I6VC 1QNKA 1V80A 3JAMc 2IY1B 4IW0A 3NSWA 1XF5L 1R4MB 1H95A 1SYCA 3PO2B 5C44H 1HHVA 1OQQA 3Q8FA 2JEBI 1U0LA 2MHJA 3RD4A 4S0RA 4C4VB 1FJGL 3S2HB 1EYAA 3CW2C 4F1SA 3SDZA 2QIEB 3U8ZA 1M8AA 3ERQA 1PUTA 1I4XA 3OSOA 2K5VA 4ID6A 1OXVA 2SDFA 5LL6S 3VFKA 1E1OA 1CUKA 4B9WA 1SE9A 4LJOB 1ZXHA 2N1WA 4QQBX 1IYFA 2MJEA 4KGTA 1WXSA 4CKBA 1YD8U 3TS2A 2XVSA 4LFCL 4K8IA 4R9WA 1KXLA 4FHKA 1EZ6A 4KHZA 5L37A 2A73B 1PDQA 3QC8B 5E6PA 4JI2L 1J5EL 1Q46A 4KSKC 1B3AA 1MSGA 5JPNC 2L4NA 3PQIA 4B3RQ 2ALYB 2WWZA 4HJ7A 2RCFA 3FP9A 4DHJD 3PUVA 4AYBB 4DXFA 3NHHA 1YHQA 2GBJA 4YSZB 2X6LA 4G7HC 4DR1L 4HDOA 1U4RA 3FVQA 2DENB 5M5YB 4M01A 1N33L 3M95A 3LXFA 1VMPA 4LF5Q 2BDNA 1V5OA 5EDSA 4LJZC 4PS7A 1EU3A 1JE4A 1DOIA 3H7PB 1XXGA 1GAQB 2VXWA 5AUIA 4LK0M 1JE5A 2AKWB 3DHGC 3S1RB 1KAWA 1JB7A 3H0GB 4KN4C 4QUFA 2OJRA 3W1SA 4IUQA 1XTDA 4NMZA 5J3BA 4FYDA 3M9BA 4FJVB 2KX0A 2B8GA 2CQAA 3PF4A 1FNWA 2B63B 4XX5A 1PLFA 3Q6SA 4WH4A 4EKUA 2HCCA 2YEPF 3A9JB 4RH6A 3Q8BA 3M62B 4PS3A 3PIOA 1L4ZB 4OL7A 3AEEB 3W9CB 1K50A 4A3LH 4BOZB 2K52A 1E1TA 1LT5D 4BA2I 4MSQB 2PMVA 3QHTA 4IUMB 3IRBA 4FDBA 3RMHA 4C1NK 1XTCD 4BY7G 3NBIA 3HOVH 4K0KQ 4RMFA 3PTFC 3AE7B 5IGBA 1YJ1A 4C3IG 2LMCA 1H9SB 2LEKA 2O6VA 2UUAL 2HQLA 1KLVA 2ES2A 1CKMA 2SEBD 4D2KA 1JQ4A 4M1UB 3P2BA 3FHWA 4S3SA 4DV6L 3MXNA 1ICFB 4QY7A 5CV7A 3L2PA 4JX1C 4K1RB 1Y1WH 4XXEA 3GTKB 3GV6A 3S16H 1JALA 2RVLA 2L3ZA 2YLMA 4X65Q 3MC9A 5HGTA 2L11A 3QJZA 5CBEE 3HOWB 2PQAA 3VR4A 1EY0A 3KUPA 5HG2A 5KNDA 2M00A 2K8CA 5C3EG 2A4ZA 2QJLA 3KBXA 1X32A 2AUJD 1HZ5A 1X55A 4A4IA 1GJXA 3O65B 2YVCA 1C7YA 3H09A 2MRPA 4C1NI 1ASZA 2EJFC 3HOYB 3PUXA 2DLBA 3NTKA 2QSDA 1PTOH 3BYTB 2NVXB 2LSSA 3G71A 1AYFA 3SK4A 1VQCA 2MBEA 3AH7A 1Q12A 2PI2E 1H4RA 3NOBA 3PVLA 2D2CC 3VR8B 2RHSB 3HM3A 3SU8X 1LGRA 3LYYA 1F1HA 2O4XA 2PVGC 1XCTL 4ME3A 1T0QC 3ZNGC 3DVNU 3H1UA 4PZ6A 1WY8A 2WU5B 2ZTEA 3HEJA 1IP9A 3PUYA 1JC7A 2OEOA 3CP0A 4KD3A 5AFWA 5FO9B 1A63A 2I1KA 3KK7A 1WXVA 1G6ZA 4DV0L 4DFAA 5JJIA 1F2MA 1IBKL 2F0VA 4IUNA 1CSQA 1JROA 3Q8DA 1W3SA 4BY1G 1JQYD 4CDDC 2EYMA 4WIPA 3MZ5A 4NP5A 2R92G 3GOEA 3T9LA 4ZUJA 4IJHA 2NVQB 4W9DA 2F52A 1QQRA 2IGDA 3PRZA 2UXDQ 1SE8A 5AJ3Q 2UWQA 1D4BA 2BA1A 2VNUD 2V4IB 5D94A 2PTLA 3T8MA 1MD2D 4JI0Q 4DR3Q 1E8ZA 2JY6A 4GIVA 4JI4L 4LW1A 3SFDB 4L6TB 3PO0A 3HOVB 1ZXTA 5CV6A 1SROA 4B6WA 3OW2A 1WTXA 3GQBA 4O2DA 1WYWB 3M4QA 4RA8A 1NI2A 2JZPA 3RULA 1I50H 4I6NB 3LWUA 4AH6A 1D5XC 1I4QA 1X3EA 5H8YE 3T13A 3UF8A 2GBRA 2KEDA 1CI3M 1K3BC 1I4RA 3R2IA 4X3UA 2KHSA 4DK3C 4GOCA 4LFBL 4K2KA 4O1NA
chains in the Genus database with same CATH topology
4I65A 3U2SC 2H4OA 4HEDA 3TZUA 1TZOA 4KD4A 3GTLB 2JA7B 3UI2A 1K8MA 4US8A 4HCSA 2JQRB 4ABNA 5T1IA 3T53B 3DM1A 1GHKA 3VR5A 5IGGA 4PT5A 5D65A 2KEEA 2NUCA 3P7JA 3GV3A 2BBCA 1IW7C 1PRTB 5C4XB 3ETRA 4KY5A 4OIKA 3DWGC 1IL8A 4ZHPA 1WSPA 1CT1D 1SNDA 2KACA 4N58A 1C79A 3WOFA 1VDVA 2JE6I 3Q0AA 4ZLTF 3PIP3 1PFMA 4MH8A 4U673 2F0IA 3A55A 4B0MA 1X3QA 2NN6G 4YSXB 2H1EA 3MXGA 1F9QA 2KA7A 3FKIB 2A69D 4IFDG 4TMAB 3NS1A 2LMCB 2NBFA 4HAEA 5FO8B 5LL6X 4YWGG 1A3UA 2DNCA 1Y8PB 1FD7D 4A3GB 4HJGE 4K2LA 2LKVA 1KDAA 2Y0SB 2I07B 2EPBA 3BIID 5M3FB 3CRLC 2Z8LA 3C1EA 3W5UB 2JX5A 2RDGA 5G5GA 2K05A 3T56B 2PCFB 1B9NA 3HP3A 3GTGB 5CV4A 3C46A 5BN4A 3NWSA 4YT0B 1KRHA 5MPOA 2OXPA 4K6LA 3KF8A 2B8FA 3DWAA 1YN3A 2L0CA 1K53A 2EZVA 1LACA 1XYIA 1C9FA 5C5MA 4IN3A 1U9RA 3P42A 1VMCA 1NAPA 2PZUA 1G291 1TS5A 5EKLA 5DM73 2KECA 1SYDA 4XT3B 2OHFA 1STNA 1RFKA 3OWFA 1PTOD 5M5WB 3AMUA 1EEID 1GB4A 1FGBD 5F2DA 4IFDI 3VA5A 4KKIA 1PZKD 1HTPA 2F0TA 1JWSD 3GP7A 1A2UA 3IKJA 5G5HA 2ZW0A 2FE8A 2WDQB 1BOSA 1OXSC 2L1BA 1WTWA 4XDCA 3D31A 3M85A 3PZ8A 2A6HD 3A56A 2WKCA 1Y69U 5CBAE 3PV0A 4RGNA 4ITKA 1WCMB 3HUIA 2A6ED 4IFDH 1IHZA 1EY4A 3P4QB 1DZ1A 1V1PA 5KYLA 1LT4D 3LB8C 4I7ZC 2F0PA 4HEA1 1JB3A 4RCOA 4US9A 3D3RA 1WTOA 2GI9A 5EE3A 4PV1C 4BBSB 1TS2A 5JOBA 4E6IA 5A35A 4B08A 2JSVX 1QILA 5BYSA 2VB2X 1XEEA 3ONAB 2D9UA 4ZHOA 1ZXIA 4QMGA 1VRAB 4G57A 3NK9A 1SYFA 3DUZA 1DOKA 2BOSA 4IUTA 4CKCA 2PVOD 3HZXA 3T4AC 1MI0A 3ZGZA 3B2FA 2FBWB 3AE8B 3SK8A 2BTEA 2PPBC 4C3JG 1C77A 2JEAI 3E6ZX 3K58A 3AE5B 2YYZA 1R4QB 3KLSX 2K04A 2BW2A 1BUIC 1I6HB 2WP9B 4ME5A 5A2QL 3DWQA 1TWCB 2HQEA 4IFDJ 1SXTA 1F2RI 1EYCA 1FIQA 3R3OA 3MWYW 2SAKA 3PUWA 1HEZE 3AE9B 4UDUC 4EVOA 1PMRA 3HVDA 4ZRQA 1HA6A 1EIHA 1ML0D 1HA5A 3FAHA 2RDHA 3L9AX 2K6AA 3SFEB 5IODA 1ZYRD 4EQPA 4P6VF 4UAIA 3MXUA 1TWHB 2K22A 4C80A 1LABA 3A8KE 2WB1B 4ZUIA 2SNSA 5ELCA 1JORA 1X3PA 3OMCA 3M4OB 1SNMA 1IGDA 2DYMA 1SYEA 3VRBB 4FXKC 4YIJA 3AE2B 1TJEA 3WOEA 3AB5A 1F9PA 4J6HA 3JAME 2BS4B 1JWBD 2WKDA 4M0WA 4RHSA 1O7YA 5CORA 5JXVA 2K28A 2DYOA 3AEAB 1FYCA 3T3NA 2FINB 3BG3A 3PUZA 4IZ8A 3AM9A 2DWQA 3MTSA 1CK1A 2DY8A 3X3NA 1SF0A 1PGXA 1Z6HA 1EL0A 1DM0B 3FC4A 2J0TD 1TY0A 1VCIA 3I72A 2C9OA 4PMWA 5FK9C 1ONLA 1Y8OB 1EEFD 1UEAB 1STBA 3QO2A 3A8JE 1QCBD 5LNK1 3HGBA 1V1PB 3ITPA 2LHEA 1SMYD 1UWXA 2LFIA 1S5BD 1TS3A 3W5VB 4IDIA 1YNND 1K51A 1F2YA 1TWFB 4XIGS 5C3XA 1LTBD 2CW0D 2WDVB 1B9MA 3GTJB 3N6RA 1LTAD 3HRZC 1SE3A 2Q8IB 1GUNA 1SYGA 1S4ZA 4KJNA 3L3OC 4A3EB 4WJWA 5CR3A 5KNCA 2LY7A 4HN7A 1RYJA 1K83B 5ELFA 5D7GA 1GB1A 2QMTA 5AUKA 2EYHA 5NUCA 2V3PA 2NVYB 3VR2A 4J8QA 3M7NA 3KWLA 3F2UA 1BUVT 2L5TA 1IYUA 4KKUA 2WLBA 4G7ZC 4Y7NB 2XIWA 2R93B 5BMHA 4FF4A 3D8GA 3Q8AA 1EOTA 1S5ED 3C8YA 1FM0D 5D14A 3NRZA 4NJCA 4N6EB 1P7EA 2TSSA 1IBXA 1O80A 5E1FA 4RGOS 2F0SA 1D5ZC 1N5WA 4A3JB 2L52A 2B2YC 1CHQD 3U7ZA 3KBGA 1EY5A 3KLRA 4TQUS 1U4LA 2DNEA 1WD1A 1HFGA 2R7ZB 1YN5A 3S9WA 3QOLA 2EDGA 2K03A 2ICEC 4ODGA 3TMEA 4NAWB 5E4WC 5EKIA 1I4HA 1Q3LA 2LS01 3TEXA 2BS2B 3D4RA 3U9SA 2A68D 4ULLA 3AE6B 3C2PA 3SXHA 1VZ6A 4RF0A 3S2DB 2JYTA 3OIPA 2BS3B 3IAM1 1FR3A 5ELBA 1ENCA 4DGZA 1FNUA 3H6MA 1JOOA 4HKZE 4MM3B 4C56C 1KLUD 2RBMA 1AEXA 1C4QA 4A3IB 3H91A 1PDXA 4P16A 2XN9C 1D5MC 1N63A 1OO9B 1FCCC 1JOQA 2EY1A 2ACZB 2KCNA 4A3MB 1I4PA 3KLSA 4L2YA 2R3ZA 5EJWA 3CIRB 3A8IE 2RMMA 2ID0A 4TSSA 2I38A 1H9JA 1WRIA 1G91A 1WTVA 4WAFA 1YNJC 4JK1C 1KABA 2EYPA 1MHXA 4PQXA 2KDMA 4NAMA 4KGRA 5IGFA 3J80E 4F88A 2PZWA 1SNPA 1DOYA 1II3A 2IX3A 3EA6A 2XNAC 3IFTA 5C2TB 3TUOA 1OXUA 1N61A 2E2IB 2B2WC 1S5DD 4B0EA 3BZDB 4ARCA 4MACA 2XWJB 1ZOYB 1YN4A 1O7LA 1V97A 1ZUD2 1PFBA 2WXFA 4KGSA 4KI0A 1F9SA 5KIXA 2WQYB 4LTUA 3BDLA 1UWMA 3TP8A 2IGHA 3GTQB 2OEDA 4DAVA 2F3WA 3QB3A 1RODA 1QNUA 4XQJA 1AWDA 3RUZA 1JMLA 2K3UA 1L0XB 1YQ4B 4L1BA 4H0LC 1SNOA 5E6JA 4CJ0B 1MHHE 2E75C 4ZOHC 2CU3A 3N9YC 1NSNS 2LGIA 4ZKBB 1CQVA 1LTSD 1L5PA 3N52A 1GUSA 3I57A 1SYBA 2JWUA 5ELDA 4CGYB 4EQNA 2D5DA 4N9TA 3J7YW 1XLOA 2PZTA 3FDTA 1HPCA 3H94A 2ON8A 3SEBA 2YEPB 1IBXB 3QIAA 3BDCA 1QKZA 2FMCA 2K01A 1GUGA 5I4DA 1RHPA 3DMUA 2K5PA 2BA0A 3GS2A 2WIIB 5CV5A 2CJNA 2JA6B 1MSHA 2V4DA 3URYA 2J52A 1BF4A 3D4WA 5CV8A 5HI1A 4KMUC 1J7AA 4HTHA 4TKOB 4C3HB 1I3QB 1Y1VB 1TKWB 3VYRA 2EYFA 2EXZA 2H88B 3MA2B 1AZPA 3CRKC 1IW7D 5BYQA 2NYZD 4EQOA 3D6WA 3CKIB 4BWGB 2KN4A 1KF6B 1R4PB 5G3LF 3OWEB 2WXGA 4GLSC 3NE5B 1TWGB 1IUEA 1CJEA 4ZRPA 4YTPB 1SE4A 2CHBD 2E6XA 4A55A 1JWMD 1MPEA 1EIGA 2KCCA 1QE6A 1VZ7A 1QB5D 5FLXL 2RDFA 1WTPA 3P1MA 3PO0A 1MGSA 2WU2B 1ET6A 5LHY1 4RNAA 2HCIA 4V190 1KDBA 3MEHA 1PFDA 2KOLA 5KYIA 1GPXA 5EGTA 3T16A 3EGRA 2NVTB 1GXDC 2GA4B 2M9VA 1WTRA 1EFID 1YQ3B 3VRAB 2R61A 1QOGA 1CZGA 2K0PA 3S1MB 2K33A 3P4PB 1BBXC 3J81L 2WXLA 1F9RA 3HS0C 2KAJA 1SAPA 3S1QB 4QF4A 1FMAD 4RKBA 5K36G 3S14B 1SB3C 4OW0A 1KTKA 4QUCA 1AN8A 1DOLA 1L4DB 4YXDB 2EJMA 3ZYYX 3AB9A 2E76C 4CQNA 3J7AV 5I6WA 2AUKA 3I90A 2ZXPA 3A7LA 5M3MB 4AQ7A 2EY5A 1JCKB 3ABVB 5I2YA 3R2TA 4USAA 3BVZA 1BCPF 1HFNA 4X3KA 4KX6B 4YTNB 5JPMC 2EE1A 4DF7A 4F8MA 3TEYA 3W3AA 1EY6A 2R6GA 4IUUA 2O2LD 5M9OA 4DK0A 3Q22A 4ZRZA 2WXJA 4HMJA 4NZLB 2B2YA 1K8OA 2L12A 1DD2A 1A15A 1YJIA 5J1ZA 1HQRD 2JXTA 2AX5A 4IUVA 3I4NB 5C3WA 1BDOA 3NXWA 4FNFA 3I3CA 1T3QA 2ZT9C 1C4CA 2Y5CA 2X6GA 3IT4B 2L9HA 2JXMB 3I73A 5IT9L 4RFBA 2NN6I 1DOMA 4DNTB 1SEBD 1PGAA 2W3SA 3DEOA 2NMQA 3V96A 2Q5WD 5I9PA 4H44C 1PRTD 5E4XA 2B2TC 2F0EA 1VR9A 4IUPA 1EYDA 1QOFA 1B44D 1LT6D 3HOZB 1E7PB 1Y8NB 4XDXA 1VLBA 3UI3A 2PKOA 4G4KA 3SK6A 1CQFA 3TEZA 1VF5C 2NN6H 4JBWA 1Q1EA 1AFPA 1HRJA 2WXQA 2VUMB 3K57A 4WURA 1FNVA 3FEWX 4WWMA 1Q90A 1ZDVA 3OMGA 4K14A 2MHVA 4GDKB 1C78A 4HMIA 5BMIA 1NR4A 2F0DA 4FXGC 1S5FD 4TRDA 3S15B 1PTOC 1ENAA 1QF6A 4LLGM 2B2WA 1KAAA 5EBDA 1NYRA 2C5CA 5KRUA 3M7GA 2I2YA 4A3KB 2PQEA 1ZP0B 2K5DA 1D1KA 4OIJA 1WGKA 2IPKD 4PNYA 4A3BB 4IOIE 3GD7A 1LTTD 2WDRB 5J39A 3DXJC 2A6HC 3DWMA 1K52A 2JP1A 4EE2A 3ZJVA 5EPKA 1DONA 4JE3B 4RAUC 4Z9CB 4CHTB 5GXGB 3HOUB 3BYYB 1E10A 4HSVA 3BK2A 2GRIA 1FO4A 3MHZA 2WS3B 1BO0A 1JICA 1FFVA 1FEHA 2XRQD 2MGSA 3IAYA 2F0UA 2XSCA 4A9AA 1PXUA 3K0YA 3SVMA 2IT1A 5T8IA 2J42A 5JVG3 3CQZB 1B50A 2DBYA 3RPFC 2ONQA 3Q23A 2W82A 1QG7A 3DEPA 2RPVA 5EE0A 3NPPA 1RWSA 2E3TA 4OHJA 3Q8CA 1NVID 4R8NA 4FF2A 4XWTA 3S1NB 1RTOA 1H9MA 3GTMB 1FCLA 4ZKCB 1GHJA 1LLRD 4HSPA 1N60A 3MJ5A 3NBHA 4RHRA 3GO5A 1HXYD 4CJ2C 4ZK9B 1XX8A 3I9V1 4PMBA 5CGKA 1BCPC 4CKEA 5IIFA 3SR6A 2N0SB 3K5MA 1Q10A 1ESFA 4LK1C 4YSYB 2HDEA 3ZJTA 5EE9A 2PLPA 1C4AA 1TQOA 3MC0B 1XWEA 3P20A 3ZJUA 1KNEA 1CZPA 5A2QE 2EY2A 2F0QA 1IYVA 3EROA 5JEAG 1ZYRC 1TYGB 3TN2A 2JSOA 3AN1A 3NVWA 2D5GA 4N59A 1WVLA 2HTME 2IX0A 1O7ZA 2Q8TA 3CU7A 4M8AA 4HKQA 3A7AB 2D62A 4KKJA 1TR5A 1FRRA 4H2AA 1SNCA 5CC4A 1B4OA 4FXCA 5FR3A 4Q5VA 5CMDA 2DY7A 2W54A 2NTSA 4KKTA 4KY6A 3AMZA 1A3TA 2BE5D 2L1AA 3BK1A 4RKLA 3FPUB 2M56B 3NVYA 5DNFA 1MBYA 3OW7A 2IW3A 2N7JA 1J7CA 2EKIA 1TKGA 3VQIA 1XCQL 3S17B 2MH7A 1PGBA 1RCVD 3SK5A 3NUCA 2EYLA 2IDYA 3AECB 1RJTA 1TU2B 4U68A 2QF7A 2IL8A 1Q8IA 5IOCA 5H92C 1WWTA 1ZDXA 1I7HA 1ILPA 3D4DA 3HG9A 1STAA 4C3HG 1QOHA 2I46A 2MJ8A 4DNRB 1SIJA 1B2TA 3NTIA 3L7ZC 4KY7A 1YNNC 1SFOB 2J53A 1ACCA 3MFYA 3OHXC 2CW0C 4XYOA 2AWOA 1VDZA 1E2VA 3P4SB 4Q2JA 3I70A 5JVH3 2ZXRA 3FRPB 1FRDA 3G6JB 3HKZB 3AE1B 4WFN3 2WINB 3NQTA 5KNBA 5EE1A 4GDLB 1SDFA 4L63B 2WXMA 3U9OA 2WNMA 5JEAH 5ISRA 5HFYA 5DAUA 2ZXOA 1GUOA 2B2TA 1L6UA 1SNQA 1E6EB 3NTHA 1E2WA 4K5WA 1PZID 2AQ2B 4V0BA 1C8CA 2MPMA 2NWGA 1B9RA 1L6VA 5C6AA 2CJOA 2WXPA 3ND9A 2X69A 2CVRA 4HCEA 3GB1A 1L0YB 4RGTA 1KDCA 2QEJC 2G9HD 1EQVA 3C1FA 5EKKA 3K6OA 4OZAA 3DHQA 1SSNA 4KN7C 1JWAD 5EPLA 2RQXA 3WCQA 2J7ZA 4QB4A 2QKIC 5T1GA 1C4PA 2J4XA 1IKLA 1E2ZA 1VJKA 2GB1A 5DM63 3BS1A 1IKMA 3T3OA 2F0NA 5COYA 2H89B 4G7OC 4OZCA 2HUGA 4C7ZA 2LJIA 4H7BA 3E56A 3NUHB 3M4YA 4CJ1B 3B9JA 1F2ZA 1ZEQX 1HUNA 5C5LA 4L23A 2PNRC 1EM7A 1ILQA 5BN5A 1CA5A 2NTTA 1SJHD 1QWYA 1LT3D 1RM6C 5JEAJ 2A68C 3PMFA 2IGGA 4MIUA 3V05A 1LTGD 2TMPA 3LNNA 4KK7A 2IWHA 1STYA 2VZKB 2ZW1A 3NQIA 5HHDG 3EQLC 3RZOB 3BVMA 2PMZB 2BYTA 3E0JA 4K5XA 4RCNA 1ESRA 2K9XA 2FFKB 1C76A 1V1OA 2F0KA 2E74C 5I9OA 2PO4A 2N9LA 1BQQT 2B2UC 4FXDA 2EJGC 3VYSA 3V2TA 1R9TB 1YMHE 1E9MA 1AW7A 1STHA 2JA5B 1ZE3D 1F0ZA 4Q0FA 1F2RC 2AQ1B 1WYGA 1SJED 3L4PA 4RGMA 4ZAIA 3KWVA 2IJ0A 1ROEA 2BCOA 4JWUC 2N9KA 1JRPA 3LX0A 2Y3AA 1NCVA 5C44B 3NVZA 1ZKOA 3Q69A 4A90A 2KQ3A 1W6KA 2Z1CA 1OFFA 3NWTA 1BXTA 3EFXD 3LWEA 2L83A 2LUMA 3AE3B 3WDNA 3NP8A 3SR1A 3MFGA 4KV6A 3NZ3A 1MVKA 1J7BA 3VR6A 2K7VA 2YU9B 4LAAA 2F0JA 4H13C 5I6YA 1NYQA 1PTOF 2HDLA 1CTMA 2F0HA 3QG1A 1QLBB 1FD6A 4NKLA 2SOBA 1QOAA 1PFNA 3MXPA 1PRTF 3AEGB 2M19A 5FOBB 4K5VA 1TVXA 4NDXA 1HQMC 3W2DA 1GUTA 2PW7A 1OXTA 5FKAC 3PIO3 3FILA 5D3IB 1UUPA 5J22A 4MHEA 2JU6X 4DN4M 2FUG1 4IKGA 1EQTA 4X3SA 1SBBB 2F0FA 2QDBA 3G7LA 1STEA 1ET9A 1XLPA 2LHDA 2FHTA 5IGDA 2WV6D 1DGJA 3IT6B 1HZ6A 4FO2A 1Y1WB 3S16B 1J9OA 2VZKD 2M2LA 2BB5A 4C7YA 2EELA 3U4EG 5IGEA 4ZQ3A 3TSSA 1A70A 2B2VC 1EWCA 1A3VA 3MAQA 1RKNA 2Q8RE 2WXKA 1Z7TA 1PTOB 1T5EA 4DXGA 1NI3A 2EOTA 2BB6A 3RFZB 1V8QA 2K1BA 1E0ZA 2FMMA 2AQ3B 1OXXK 5KGUA 2EY6A 2FJ2A 2ENBA 1CHPD 4CBVA 5IGCA 1FXIA 1E0BA 2KMMA 5KEEA 2WXRA 3P63A 2WXOA 1TY2A 5E3FA 1EWYC 4DAPA 1UAPA 4FVMA 1NENB 1XLNA 1CFMA 2F0GA 1FFUA 5JAVA 4OVZA 5HURA 1EY7A 2XWBB 5TSSA 4MN3A 2BDOA 2OT2A 4KHVA 1U4PA 4XYQA 4ILWA 1I4GA 3C3LA 2RSNA 1C48A 3VA7A 3E5SA 3VYTA 2SNMA 1DOXA 2NZ1D 1JOKA 1XO3A 3IFDA 2Z4HA 1I50B 1HTLD 2F3VA 2F0OA 5FLXE 4XTCS 2F0MA 1N62A 1RDPD 3QOJA 4KJOA 4WQMA 1HUMA 4ZYSA 5BN3A 1D6EC 4J1MA 4L8JA 4GZYC 3TP7A 4BY7B 2Z4IA 3M3YB 5CV9A 1LO5D 4C3IB 3VR9B 3DWPA 1GOZA 1G2TA 4IURA 2DN8A 2V0GA 3ZQ4A 1W6JA 3J81E 5C4JB 5C0XG 2W3RA 2A69C 3VYUA 1BMLC 3SE0A 3X3MA 3OOCA 5EBCA 1B53A 3IL8A 5C3EB 2PW5A 2MJ3A 1EZ8A 2A74C 2WACA 3U52E 1WTQA 3BDOA 4MT5A 5CYUA 4DAYA 2MUYA 4FF1A 2JYOA 1KNAA 4XWWA 4RWSC 3RZDB 2RKSA 2O5JC 2BT6A 1LV9A 1BCPB 4B9XA 2INNE 3A54A 1CZWA 1T5XD 3FILB 2X38A 5K36H 1M4VA 3B2GA 4FF3A 3KQ4A 1TWAB 2V3NA 3MVVA 3GTOB 1CM9A 1KLGD 1BR9A 4N9PA 5I2XA 2KUMA 4WORA 4BY1B 3H3VC 3BWUD 1N5XA 1D1IA 2R92B 1V8CA 1KFYB 4RF1A 2PIAA 2OF1A 2K32A 3PZ7A 5G3LD 4BS9A 3R8BA 2G9DA 1RF2D 4XE0A 5C0XI 2ICIA 1FXAA 2F03A 3QWNA 1WXQA 3EUB2 1PRTC 1HCZA 4PMCA 3P1HA 3P4RB 3IAS1 2E2JB 5EQ0A 1SSOA 5IT9E 3HRDD 3MP9A 4K6DA 4JWSC 2F4IA 4HRSA 2A5HA 2B2UA 1A6XA 3R93A 1TKYA 4HROA 2PYKA 2WXIA 2MEKA 4REZA 4IALA 1UNSA 4KTAA 1A2TA 3K5LA 1NUCA 2A6EC 5C0XH 1L0VB 2F0LA 3SHLA 4BA1I 2N88A 3EVQA 4TQ0A 2WXNA 1V43A 1IGCA 3AV8A 2E2DC 3JAML 1DJRD 3FPPA 1RD9D 3RLFA 2KWDA 1RTNA 2WXHA 5DEHA 1PYWD 3TZDA 4ARIA 3Q8EA 1EU4A 3MHBA 3PO3B 4P2CB 1QJOA 3H8HA 2WP8J 1NR2A 4A3DB 2E2HB 1O78A 3J7AF 1BCPD 4DU9A 2F0WA 1BNZA 2K5WA 1P7FA 3NVVA 1YNTE 5M5XB 1U4MA 4R8IA 3CWIA 3VR3A 1AZQA 1VZ8A 5C3JB 2QCPX 3OPOA 3TP6A 3K5OA 5EPJA 1LTRD 2KQ4X 2MP1A 4KKSA 4QCLA 2G1EA 3K7AB 3BVGA 1STGA 3I91A 1R7SA 1MI2A 1Y56A 4WRDA 1UGJA 1WD0A 5C0XJ 1QT9A 2PW9A 1G8ZD 4O42A 3AU7A 4A8XC 3CHBD 2HDMA 4XT1B 4J3OD 2VB3X 3HVZA 1EY9A 1DXMA 4HR7B 1JW9D 1XLQA 4DA2A 2XRSD 2LFNA 1GUWA 2KJXA 4XDDA 1ENFA 2B2VA 3GTPB 3OIQA 3TBIB 2B39A 1JR0D 4AS1A 4OZBA 1F2LA 1S5CD 2JA8B 3IXSA 4DK1A 2L32A 4OO1G 3ND8A 3EJIA 3TDQA 1B1ZA 1KH0A 1VF7A 1LTID 2NB0A 3Q24A 3AEFB 3I4LA 1ZPSA 2K5QA 3I4MB 4EGVA 3TP5A 2RA4A 3J9CA 1PZJD 2WAQB 1G2SA 2Y5PA 2MJDA 2EYOA 4JPSA 2O5IC 1TS4A 1F77A 1T6BX 1EWHA 1DYQA 1H9KA 1H9SA 5C4ZA 3TEWA 3D6CA 4TQ1A 3AE4B 4YTMB 5BYRA 4NW2A 4QIWB 2RSOA 1JWUD 2KVMA 3I8ZA 5D3DA 2IX1A 4R3DA 1OQRA 3QJYA 4OGQC 5C4HA 2AWNA 1SMYC 3HOXB 3K59A 4K8JA 4LMQD 3FMCA 4OO1I 1NEKB 1TKEA 1H9RA 2EYJA 1Q1BA 4XQNA 5FO7B 5ELEA 4C2MB 1YJJA 2B76B 4FP5D 4IQZA 2EVBA 5K5PA 3V3XA 3T51B 4A93B 3AEBB 1DCZA 4DQOC 1EY8A 1TIID 2N55A 4F7XA 3E9SA 4XQQA 4F87A 1SE2A 4A3FB 2QILA 2INPE 2BE5C 4BBRB 5JJZA 1AP0A 4X3TA 4A6QA 3O13A 4C3JB 3AEDB 4OO1H 3J80L 1Z47A 2F1MA 2L55A 2W55A 1D2BA 1ICWA 1YNJD 3K5NA 3P75A 1CA6A 2JYEA 5BMGA 2M0AA 1TT2A 1J8IA 1QOBA 1I6VC 1QNKA 3NSWA 1XF5L 1HHVA 1SYCA 3PO2B 1OQQA 3Q8FA 2JEBI 3RD4A 3S2HB 1EYAA 3SDZA 2QIEB 1M8AA 3ERQA 1PUTA 1I4XA 3OSOA 4ID6A 1OXVA 2SDFA 5LL6S 4B9WA 1ZXHA 2MJEA 4KGTA 4CKBA 2XVSA 4K8IA 4R9WA 1EZ6A 4KHZA 2A73B 1PDQA 1B3AA 1MSGA 5JPNC 2L4NA 3PUVA 4AYBB 4DXFA 3NHHA 4YSZB 2X6LA 4G7HC 1U4RA 3FVQA 5M5YB 3LXFA 1VMPA 2BDNA 4LJZC 1EU3A 1JE4A 1DOIA 1XXGA 1GAQB 2VXWA 5AUIA 4LK0M 3S1RB 3H0GB 4KN4C 4QUFA 3W1SA 4IUQA 4NMZA 4FYDA 2B8GA 2CQAA 1FNWA 2B63B 1PLFA 3Q6SA 4WH4A 2HCCA 2YEPF 3Q8BA 4RH6A 1L4ZB 4OL7A 3AEEB 3W9CB 1K50A 1LT5D 4BA2I 2PMVA 3RMHA 4C1NK 1XTCD 3NBIA 3AE7B 5IGBA 4C3IG 2LMCA 1H9SB 2LEKA 2SEBD 4D2KA 1JQ4A 4M1UB 4S3SA 3MXNA 5CV7A 4JX1C 4XXEA 3GTKB 3GV6A 1JALA 2RVLA 5HGTA 2L11A 5CBEE 3HOWB 3VR4A 1EY0A 3KUPA 5HG2A 5KNDA 2M00A 2QJLA 3KBXA 1X32A 2AUJD 1HZ5A 1GJXA 3H09A 4C1NI 3HOYB 2EJFC 3PUXA