1J7BA

Structure of the anabaena ferredoxin mutant e94k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKKEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
total genus 26
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7bA00
5MPOA 4ZHPA 2MJ3A 1YJIA 1SF0A 1TKYA 2G1EA 1OQRA 3B2GA 1N61A 3CIRB 3AM9A 3L4PA 1QOGA 3FAHA 5EE1A 5H8YE 4US8A 3HUIA 5AUKA 2BS2B 2KMMA 1JWBD 1AYFA 2PIAA 1VDVA 2HTME 2PVGC 1SB3C 3AE5B 1T3QA 2M56B 3LB8C 4JWSC 1ZOYB 3P63A 1QOFA 2AX5A 3NVWA 3WCQA 1FO4A 1N60A 1TKGA 3AE4B 4US9A 1A70A 3HRDD 1FRDA 3AN1A 3P1MA 1E6EB 3W5VB 2FBWB 1J7BA 3NS1A 5EE3A 1QT9A 1QOBA 1WRIA 1JRPA 4IDIA 1FFVA 1FXIA 1VJKA 2M19A 1DOYA 1TJEA 1NYQA 3W9CB 1JW9D 3AEFB 1E0ZA 2W3RA 3DWMA 1J7CA 2WU5B 1ZXIA 2BT6A 2BS3B 1NYRA 3EUB2 1JWAD 1GPXA 1CZPA 2WDQB 3NVZA 1XLPA 2MH7A 1FMAD 1N63A 1VLBA 3BIID 1DOIA 1WYGA 2H88B 1R7SA 1V8CA 2PKOA 2WLBA 3AE8B 4JX1C 3HVZA 4YXDB 2PVOD 2WDRB 2W55A 3AE9B 4YTNB 1NEKB 3AH7A 1FM0D 1KRHA 3DWGC 1J7AA 4KX6B 5EE9A 2W3SA 2LEKA 2K5PA 5C2TB 4C7YA 3NRZA 2Q5WD 1NVID 1WXQA 2QIEB 1FXAA 3SR6A 3P4RB 4C80A 1RWSA 3B9JA 1IUEA 1E9MA 2DBYA 1N5WA 1OFFA 1XLNA 3AE7B 2OHFA 2WU2B 1OQQA 4YT0B 4ITKA 1AWDA 3AEDB 4N59A 5EE0A 1EWYC 4HROA 4P6VF 1RFKA 1L6UA 3AEAB 1JROA 1RYJA 5C3JB 2CJOA 1DGJA 2L52A 3NVVA 4USAA 1JQ4A 1KF6B 1NI3A 2WDVB 1YJJA 3SFDB 5AUIA 2WS3B 2B76B 2MJEA 4N6EB 4YTMB 2EKIA 4FXCA 3RPFC 1RM6C 1ZUD2 3ABVB 4YSXB 1PFDA 4ZHOA 3AE6B 1QF6A 3VR8B 1TKEA 2BS4B 1YQ4B 3ETRA 1XLOA 3AB5A 3SFEB 1QOAA 4YSYB 4JWUC 4WQMA 2N0SB 3AEGB 2K9XA 1XLQA 1TYGB 2ACZB 3AEEB 3AE3B 4LTUA 1UWMA 4C7ZA 1NENB 1I7HA 2E3TA 1E10A 3LXFA 3AMZA 1CJEA 1WWTA 4YSZB 1L5PA 5H92C 1FRRA 3AV8A 5G5HA 1ROEA 5GXGB 1N5XA 3AEBB 3FC4A 1B9RA 2KAJA 2MJDA 1DOXA 5G5GA 2DWQA 2CJNA 4N58A 2JQRB 3AECB 1PUTA 1V97A 3AE1B 3P4PB 1FFUA 2K22A 3P4SB 2CU3A 2QJLA 1F0ZA 2WP9B 1FIQA 1N62A 1L6VA 3AE2B 3VRBB 1E7PB 3ZYYX 2Y5CA 4A9AA 1GAQB 1JALA 1ZP0B 1PDXA 3W5UB 4HRSA 3CWIA 4ZOHC 3P4QB 1SIJA 2H89B 3PO0A 1YQ3B 3NVYA 2L83A 1KFYB 1L0VB 1QLBB 1WGKA 3KWLA 3B2FA 2W54A 1XO3A 2WQYB 4WWMA 4YTPB 2JX5A 3VR9B 3VRAB
chains in the Genus database with same CATH superfamily
3I3TB 1E8ZA 2ZZPB 4A3OA 1SJHD 4B9KA 3R2TA 4NZLB 4ZYNA 2FCNA 2QSDA 3GB1A 2AYOB 3RNBC 2XBBC 1FRDA 3WAMA 4RM9A 2L76A 1MG4A 4NJCA 2C5LC 3RMKC 2L0TA 1SE9A 1TIFA 2WU5B 5CHFA 5E6PA 4NPNA 4WJPA 3A1QA 1JRUA 1CZPA 2GMIC 3AE8B 2KX0A 1WGDA 3HVZA 1PGXA 2VZKD 1Z2MA 4OHJA 2D3GA 3TBLD 2MW5A 3ZDMC 1RWSA 1E9MA 2BWES 2OHFA 4DK5A 1HEZE 3A9JA 4N59A 3QIJA 2LGYA 1ZW7A 3DBRB 4DDID 2GBNA 2WS3B 4TV3A 1SE4A 2MJEA 1AW7A 2JU6X 1I35A 4YSXB 4W9CA 4KGRA 3SDLC 4K7WA 1K8RB 2IZVB 4DHJD 2RPQA 1FRRA 3AV8A 3GOEA 3FC4A 1B9RA 1D6EC 4W9IA 4A20A 1WM3A 1XCTL 2BYTA 2ZW0A 1Q1OA 3ZYYX 4A9AA 1GAQB 1JALA 3CWIA 4IUMB 2H89B 4CQNA 5IOIA 4HVBA 2V9HA 1L0VB 3X23A 4HKQA 2MA9B 4IWQA 1YJIA 3B2GA 2REXA 2BS2B 1R4NI 2EMTA 2IO0B 1E7VA 1JCKB 4MSQB 2IY0B 3BZDB 2M56B 3L17A 1TKGA 4WAAA 5EE3A 4AJWA 1VJKA 2M19A 2V3SA 1DOYA 1NYQA 3W9CB 5FR3A 3B1LX 2N4FA 2W82A 4AOFA 2RDHA 2RGFA 2WGSA 3ZXRA 3PS6A 4W9HA 2WXGA 2E6XA 4PS8A 2NPTA 1WJ6A 2VH2A 4BBNC 3VXWA 2KDIA 4YXDB 3AE9B 3A9JB 2LEKA 1ZXHA 2LRUA 5J18A 1P3QU 1L0XB 4HJGE 2I1KA 2WU2B 1GB1A 2D5GA 1WIAA 3BYYB 5HFYA 2WXRA 3L13A 3UINB 4ARCA 3AEAB 1X1MA 3VH3B 3I63C 1WM2A 1I4XA 3AE6B 3OAWA 3OJ3A 4YSYB 1J8CA 3AI5A 1H4RA 2L0FA 3U7ZA 2QHOA 4OVUA 2KAJA 2K6QA 4GDKA 1WMHA 3RNFC 1F0ZA 2WP9B 2KN5A 2OEDA 3AE2B 3VRBB 1E7PB 1OEYJ 3GZNI 1EF5A 2FCSA 4ANVA 2LASA 4WJQA 2KN4A 3ENEA 1H8CA 2FUHB 3M62B 3Q8FA 3L54A 4M8NA 4CYEA 1TY0A 1C3TA 3NS1A 4DXAB 3I5JC 1ZPSA 2MP2B 2CHZA 5EE1A 3BY4B 1WR6E 3BWUD 5LLIA 2HTME 4BOSC 3P63A 2QEJC 3TSSA 3WAOA 3LJ3A 4EZJA 3NY5A 2C7HA 1J7BA 4NAWA 1WRIA 4K3CA 4K7SA 1WXSA 1JW9D 3AEFB 3V05A 5BO4B 2MRPA 2AWTA 3A4RA 4OW0A 4LCDE 3R8BA 1NDDA 1VLBA 4K7UA 1WYGA 2PKOA 2Y5BB 1GC7A 5FK9C 2WX0A 3LYYA 1GJZA 4FBJB 2WXMA 4DXGA 2KJHB 4OVVA 1P9DU 3RYTA 2KFKB 2DBYA 1GC6A 1FNWA 1I4HA 4M02A 1B1ZA 2DX5B 4YT0B 5DPWA 5E6JA 2K8BA 3OJ4B 3PLUA 1RYJA 4AS1A 3NVVA 2R61A 4HCPB 3WANA 1WH3A 2JXXA 1P7FA 3ZGZA 2M4NA 5BMGA 3IG3A 3N3KB 4WAFA 2K8HA 3Q2AC 2NBVB 1WZ3A 1YQ4B 3DBSA 3EFUA 1I4QA 2G3QB 3AE3B 1MI0A 1UWMA 1I7HA 5IO9A 4ACFA 4II3B 3ZIMA 1N5XA 3RNGC 4EZLA 5IA7A 1D3ZA 4XX5A 2HTHA 5DPSA 2PLPA 1N62A 1GUAB 3RI7C 3QC8B 1SSNA 3OLMD 1QLBB 4MDKE 3QHTA 4ICUA 4ZHPA 2MJ3A 2IGGA 1TZ1A 1WE7A 4OZAA 3TMPB 4NAWB 3A33B 3HK0A 2MBEA 2D07B 4RGOS 1E6EB 3R2IA 2KZRA 1XT9B 3EECA 2KC1A 2ZJDA 3L10B 3U52E 4MELA 3ZRFA 1V1PA 3QARA 1WX9A 1FMAD 5KHOA 1V81A 2YVCA 2KVZA 4KKIA 3BVGA 1R7SA 4JX1C 1HTQA 3GE3C 2W3SA 2ZNVC 1LXDA 2M1MA 1T6BX 3BVMA 3DHGC 3ECIA 1S3SG 2BKFA 3BINA 1K51A 3DBLB 2G45B 4B0EA 4YTMB 2I2YA 4JL9A 3FILB 2JRHA 4KSKC 1JWSD 3AEEB 1UBIA 5JXVA 3ZRCA 3UIOB 1YD8U 4AWJA 1WFYA 3ZQ4A 3AEBB 3HHMA 4MGIE 5G5GA 2JWUA 2Z59B 3IFWB 2CU3A 3DQVA 2J0JA 4NJ6A 2INCC 2LVPA 4TSSA 3V60A 1WE6A 3A9KA 1FCCC 2AQ3B 1OTRB 3NVYA 3VAWA 4O1NA 2GBJA 2BQQA 4FHKA 4G11A 4XGAB 4C00A 1WGHA 1UD7A 2DZIA 2BBCA 1J0GA 1QILA 2D3BA 4A90A 1FO4A 2AX5A 3WCQA 1F1HA 1TS5A 4JLCA 1FFVA 2AQ2B 1OEYA 3BYTB 2GBKA 2O2VA 2INNE 4WURA 3DWMA 1MHHE 1SEBD 1Q5WB 1NYRA 1VZ7A 1GPXA 2KK8A 4IM3A 2GI9A 1DOIA 1V2YA 4AUQC 1RFAA 3L16A 3P2BA 3ZJTA 3X0WA 3R66C 4FA6A 1E8YA 5CX3A 4IWOA 1HQRD 5CTRC 4GB9A 1IUEA 4KIKA 2JY6A 1OQYA 2M17A 1GOZA 4BKSD 5D3DA 4F1SA 3QJZA 2DYBA 5C1ZA 4NJ7A 3PZ8A 5JHAA 4DHJB 4N6EB 2MHJA 4FXCA 3W2DA 3QX1A 4NNJB 3ABVB 2AL6A 3SHQA 1XLOA 3AB5A 1EF1A 3V62A 3DCGA 3ZVVA 3QA8A 2LJIA 2LJ5A 3LXFA 2J52A 2LGXA 3UQAA 1E90A 4EEWA 1I42A 5C23A 3IVFA 3W1YA 5D2MB 3ZJVA 1FFUA 4KGTA 3C0RB 2J4XA 3N1ZC 4HXDA 2BWFA 3APCA 2ICIA 1V5TA 4LNIA 3W5UB 4GGQA 3SU8X 4KV2A 1EM7A 4MGKE 2IO3B 1FCLA 2O6VD 3S2AA 2C7NB 2J0KA 2BTEA 3VRAB 4XDCA 3BVZA 2M0AA 3RZWC 2RSUA 2IBIB 3SEBA 1ZDXA 3MJ5A 2MEKA 2O2VB 2WX1A 4G0NB 3WIMA 1TJEA 1RAXA 4LDTD 4ZRPA 2LI5A 1MPEA 4G50A 3VUWA 3VUXA 3N9YC 4IG7B 5HI1A 1YNTE 4ANWA 1M4VA 2H88B 2MCNB 1XEEA 1LFDA 4KIKB 2WDRB 3IT4B 3U7DA 3Q69A 2EELA 3ALBA 1LQBA 4KZ0A 2I38A 2MLBA 2KWDA 2JVCA 2SEBD 1IP9A 2K0PA 3ZNID 3APDA 4RGMA 3NJTA 4FJYA 3TEWA 3EC8A 4CHKA 3JYUA 3DVNU 1KM7A 2BS4B 2G4DB 3CSFA 3EA6A 4ANUA 1TYGB 4C7ZA 3DHHC 4LJOB 1PYWD 5HKHA 4L1BA 4IW0A 2N7EA 3GP7A 5AEKB 4YL8A 3ZNZB 2QJLA 2RPVA 3B0AA 2KTFA 1JWUD 2JYTA 4LJPB 2QCZA 4I6NB 5HG2A 1ET9A 2EMSA 4E71A 4BZAA 5H8YE 4HPMB 2KYWA 4RFBA 5AUKA 1TBEA 2ZPYA 4JWSC 1ZOYB 1V9JA 2DLBA 3Q3MC 4A8XC 1ESFA 2V1YA 4L2YA 4KSLC 2WXFA 4N9F4 2BGFA 4F8CB 2IGDA 3KQ4A 1ISNA 4W9LA 2MH7A 2J53A 1KTKA 2HE7A 4TKNA 2L1AA 1YIWA 3KWVA 2MP2A 4YTNB 2JZ3B 2WDTB 1T0RC 1JMLA 2NBUA 3DWGC 2K5PA 1E8WA 2HD5B 3VTWA 4DDGD 3K9OB 3UIPB 2PE9A 2HJ8A 2DENB 3BK1A 3AEDB 5BMIA 2JPHA 3ZO5B 4HDOA 2L52A 2QMTA 2B76B 1K53A 3RPFC 1FEHA 2M0XA 1ZUD2 3VTVA 5JHBA 1QF6A 1SIFA 5AZHA 2DZKA 4CO7A 2KQSA 4WJNA 2ON8A 2Y3AA 2LGDA 1WWTA 2PEAA 3ZKJC 3ZTCA 1ROEA 2KFKA 4ZRKA 2L3ZA 2MJDA 1DOXA 3ZXVA 4OZBA 3O65B 2BYVE 4XC2A 3NS8A 1RRBA 2KMCA 5BYRA 1EO6A 2LVQA 1YQ3B 3P42A 5GMVA 3AXCA 1T0YA 2WQYB 1VD2A 2GRIA 3PGEA 5MPOA 1VR9A 1UNSA 4HPPA 4PK1A 3PZDA 3EGRA 3R3MA 2KMMA 3H6NA 2PVGC 4FHJA 2J42A 4GMVA 1EU4A 1QOFA 3ZLZA 3JSVA 2MX2A 3W5VB 1HE8A 3HM3A 4R3DA 1UGJA 2WXOA 2L00B 4TQ1A 4K81A 4GXBA 1TZOA 3VUYA 3EUB2 2LFIA 5EDSA 2LHEA 1VCBA 3PSEB 2CS4A 4RF0A 1UWXA 2L7RA 1Y56A 1WXAA 1ZE3D 3Q8AA 4XWWA 3KVFB 1L4DB 4JE3B 1KRHA 3TIXA 5E6OA 4BKSA 1KH0A 2KACA 4C80A 3P4RB 4H2AA 4E3CA 2BB5A 4M8MA 2FAZA 2R2OA 2RDGA 4BBNF 2RD0A 3T3OA 2WXIA 5KHQA 1AWDA 3DBLI 3MFGA 1WY8A 1WF9A 2WYQA 5IP4D 4HWIB 1PFDA 3RNAC 4ZHOA 2D11A 2N0SB 1KLVA 3AEGB 2ACZB 2ZCCA 1E10A 1TGZB 2E3TA 5H92C 3URYA 4FLHA 2LUMA 2XNAC 2G4SA 3JVZX 4AP4C 1AN8A 3AECB 2LHDA 1L6VA 2O6VA 2NMQA 3CMMB 4HRSA 3AULA 3B08A 1WJ4A 4WWMA 2W54A 4YTPB 1FD6A 1E8XA 2NTTA 3EFCA 4IC7B 1GB4A 2KJ6A 3FILA 3JSVB 1D4BA 1LGRA 2ZVNA 1SB3C 4NY0A 3MP9A 5DPRA 3LB8C 2BVCA 3RFZB 1UZXB 2TSSA 4US9A 2FBWB 1QT9A 3AU5A 4IM2A 5HHDG 3M63B 4KGSA 3H7PA 2IY1B 1HTOA 5G55A 2ZCBA 2N7JA 1WX7A 2BYFA 4JIOU 5IN7A 1STEA 1P98A 1WGRA 2KJRA 3ML8A 5TSSA 4W9EA 3BIID 1V49A 3VTUA 2ZNVB 3KW5B 4EUTA 4W9JA 1V6EA 1KLUD 4X57B 1M94A 5EE0A 3Q3JA 4P6VF 2NR2A 3VVWB 1N6ZA 3SFDB 1Y8RC 2EKIA 5DCNA 3U4EG 1IYFA 3ETRA 1XQQA 4S0RA 1FPYA 2K9XA 1XLQA 3NZUA 4I6PA 4W9GA 1DYQA 3AMZA 4II2B 2O6VB 4M00A 2FUG1 2JQRB 1GNUA 3U8ZA 1F9JA 2JYEA 3FKYA 1WJUA 3TUOA 4C56C 1ZP0B 4RNAA 3V3XA 2CHXA 4P7IA 4D2KA 3KWLA 4GU2A 1T0SC 3CSTA 2VH1A 2G1EA 1HXYD 2NBWB 4LDTB 1YX6B 1IBXB 2WXNA 3H7PB 2KD0A 2V3NA 4TQ0A 3HRDD 2K25A 3AN1A 3P1MA 4TMAB 3DVNV 2KQ7A 3L08A 2KHWB 4I6LB 1C78A 4MM3B 4LNNA 1E0ZA 4EE2A 2DAJA 3PV1A 3N30A 1SE2A 2EKEC 4EZKA 1YJ1A 2IYDB 4WQOB 2JF5A 1XCQL 1V8CA 3DBHB 4LNFA 5J17A 3AH7A 3VFKA 5EE9A 3V6CB 1K52A 3NRZA 4WWPA 2LMCA 2QC8A 4RGTA 1LM8B 4J3OD 3VH4B 2AL3A 4EOYA 2OOBB 4WJOA 4WH4A 5BMHA 2L8JA 1T0QC 1RFKA 2MBBB 1KLGD 1ZKHA 1WX8A 3C19A 1UUPA 4PS7A 4XDDA 4NAMA 2WXLA 2CR5A 2LWPA 2PE6B 4S17A 1TKEA 2JWZA 4GN1A 1P0RA 2KWVB 3GE8C 1FXTB 4JWUC 2Z8LA 2KLCA 4LTUA 3E56A 2KANA 4YSZB 1L5PA 5G5HA 5FKAC 3VQIA 4GSWA 3JW0X 4P1BC 3P4PB 3AE1B 4K1RB 2UU7A 2LVOA 3I9V1 2I1JA 3PT2B 1TY2A 4ASWC 2UWQA 1MJDA 4XZ4A 2W9NA 4ZOHC 3CF6E 4WIPA 4YWGG 2K3UA 1YN4A 3VR9B 2NVUI 3C8YA 4FJVB 2L05A 4HPLB 3FAHA 3RT3B 3NG0A 2KQ4X 4FJZA 1AYFA 2PIAA 2A5UA 1D5MC 2KVRA 1WR1A 3NVWA 1A70A 2JXTA 3Q8EA 2BB6A 1QOBA 1JRPA 1WJNA 3HM6X 1I4RA 2KDFB 2K1FA 3PPAA 1R4MB 3R7QA 3OWEB 3PRMB 5LNK1 4IOIE 3NVZA 1JWMD 2INDC 1MHXA 3RULA 5D94A 2WNMA 4MT5A 5DPTA 2MBOA 2W55A 5BYQA 1FM0D 1OGWA 4C7YA 2V4LA 5T8IA 3SR6A 1XD3B 1ENFA 2IDYA 1OFFA 1KJTA 2A4ZA 4Q2JA 1ZGUB 1JROA 4XWTA 3ZNHB 1JQ4A 1DGJA 4USAA 2KWCA 1BMLC 1YJJA 5IKCM 5AUIA 4JPSA 1BT0A 2WXHA 4RGNA 3RUIB 2FE8A 3KYCD 4KZCA 5CHWA 2XEWA 1CK1A 2N9PC 1ET6A 1K50A 3TEYA 4NQLB 2HJ1A 4A6QA 5GXGB 1VRAB 4ZRQA 4L23A 1WGYA 2DWQA 1WGGA 1V80A 2N9EB 1S1QB 3M95A 3Q8CA 4PYUA 1F2RC 2GBRA 1Z5SB 5BYSA 2L83A 5AZFA 1QKZA 3B2FA 4M0WB 4W9FA 1A5RA 2R2QA 1WXMA 3KH0A 2LZ6A 3DDCB 3L4PA 4US8A 4FN2A 2YEPB 2AQ1B 2CKHB 3ZJUA 1T3QA 1PGAA 1WRDB 5LXIB 4XE0A 1UF0A 4GOCA 2N7DA 1YN3A 2C60A 4F7ZA 3N32A 1TT5B 2KX3A 1IGDA 2KDEB 2YLMA 3W1SC 1C79A 2DZMA 3NHEB 2DNFA 5AZGA 3ZDTA 4MEMA 4JQWC 4FULA 2K39A 2KLGA 1LO5D 2LD9A 3OG5A 3PHWB 2XK5B 4WWNA 4XYCA 3MHSD 3RCZA 3MC9A 2BW2A 4GDLB 1WI0A 2FIFA 3B9JA 4M01A 4LLGM 1CMXB 4ITKA 4PT5A 4HROA 5C3JB 2GB1A 4AJYB 2N9XA 4ZRJA 3KLSX 4HEA1 5FR6A 1I4PA 2MSED 2FNJB 5D7GA 4FADA 2L32A 4MGYE 2IJ0A 3IHPC 2XN9C 2VRRB 1TS3A 3TEZA 1NENB 1L7YA 3QQ8B 3PRZA 2CJNA 1MG8A 2SAKA 1PUTA 2K22A 3P4SB 4GIVA 2JT4B 1UH6A 3DHIC 1NI2A 1UELA 2IO2B 2GLSA 3V61A 3A1QB 2LXCA 4A55A 2KT7A 3H1UA 2WHIA 3RZFA 2C7MB 3AM9A 1TKYA 4HKZE 3QK0A 1D5ZC 2N9LA 1IPGA 2JSVX 1VDVA 4HCNB 1VZ6A 1C4CA 4DWFA 2X8XX 2NCNA 1SE3A 3AE4B 5D6JB 4IDIA 2D3AA 2OJWA 2Z0DB 2DZJA 2KOXA 2YEPF 4RMAA 1HZ6A 2LRWA 2KKCA 1HA5A 1XLPA 3QCAA 2KDMA 3KYDD 4LNKA 5J2RA 1P7EA 2B3AA 3RD2A 1C4AA 2WLBA 4BAXA 1T5XD 3IAS1 4LK0M 4BVUC 1EU3A 3Q3OC 5L95C 4ZDVA 1ZDVA 2WXJA 1GG3A 3HIZA 2LGIA 1C4PA 3PZ7A 4IKGA 1NI3A 1YMHE 4ARIA 3U30A 4BFRA 3RN9C 3M3JA 4HK2A 2DYMA 4ICVA 3VR8B 3HVDA 3ZTDA 5CHVC 4MJSA 2WXPA 4NQKE 3ZUNA 3Q3NC 3MC8A 2HDEA 4E74A 2PJHA 4N58A 3NUHB 2GOWA 3TCAA 1WYWB 1NBFC 4URKA 2Y5CA 4ZRIA 1EWCA 2PW9A 1KOTA 1WXVA 4OZCA 2CHWA 3TL5A 1L2NA 4DBGA 1YX5B 1V1OA 1XO3A 2PTLA 2NPTB 3IAM1 1U4AA 3CIRB 3H8HA 2DHZA 4KVGB 4DHZE 1QOGA 3DVGX 4EKUA 3PVLA 1SJED 1N60A 1R4NB 4C4VA 3DOWA 1FXIA 3PLVA 2IPKD 4RCOA 5IAAC 2J0MA 1ZXIA 3GS2A 2BS3B 3N20C 2BYEA 3T9LA 2WDQB 2LGSA 3DBHI 1MFWA 4TUUA 1N63A 2KDBA 3J9CA 1V86A 2PVOD 4K3BA 1I4GA 3IXSA 4KX6B 1C9FA 4PS3A 1IBXA 1NVID 2QIEB 4GDKB 2K8CA 1WMHB 5G2NA 1N5WA 3AE7B 3KUDB 3MTNB 2WXQA 4MM3A 1L6UA 5LXHA 2QILA 1L0YB 3MHZA 2KMAA 2ZPNA 3U2SC 3A4SC 3L0WB 5TR5A 4MJSB 3E9SA 3EHVA 3APFA 2KC2A 4P1CC 3SFEB 5I4DA 3BK2A 1YQBA 1AARA 2ZVOA 1CJEA 1XXGA 2MQJA 1RLFA 2ZEQA 2OJRA 1FNVA 2KO3A 3PHXB 2N9KA 2JZPA 4KDLB 4WWOA 2N1WA 3IBEA 3MJWA 4BKTA 1J19A 1E5WA 1C1YB 3GZNB 1WGKA 3Q3FA 1PGBA 2ASQA 4B0MA 2KTRA 1Q0WB 1YOVB 1N61A 1P1AA 3PREA 4B95A 1PQSA 2PPHA 4C4VB 3AE5B 5E6NA 1UGMA 2Z0EB 1VZ8A 4W9KA 2JUOA 4ANXA 4W9DA 4AQ7A 3PTFC 3QAQA 1R4MI 3RNEC 3QWZB 4RM8A 3UQBA 1SXTA 2BT6A 4HDQA 1JWAD 2QDFA 1QQRA 2D3CA 2PMVA 2NTSA 3UGBB 2KWUB 1F77A 4MH0E 4MH8A 3I57A 5C2TB 3ZW3A 1WXQA 4UDUC 1XLNA 1OQQA 4KDIC 2INPE 3ZNGC 1F2RI 1BXTA 4DXFA 1EWYC 2CJOA 2FCMA 2J7QB 2WDVB 2V0GA 1RM6C 2Y5PA 2BPSA 3AU4A 1C77A 3N1XC 2JZZA 5D3IB 4WQMA 2MBQA 1BUIC 2D2QA 3R7RA 2UYZB 2RMMA 2RDBC 3ONSA 1V5OA 1V97A 5JZEB 4PYZA 2DAFA 3DPDA 1FIQA 3N1YC 3MC0B 1PDXA 2KTRB 1F52A 1SBBB 1SIJA 2MWSB 3VDZA 1V1PB 2DYOA 2VZKB 4ZYSA 1G6JA 2JX5A 3K9PB 1WZ0A 3SD5A 1SF0A 1D5XC 3VHTC 1OQRA 2V3PA 1IGCA 2K6DB 2KNBA 3HUIA 1L4ZB 2KFJA 1JWBD 3NOBA 1FNUA 1E7UA 4A3PA 4DHZB 3NZ3A 2C9WB 4OVZA 4RF1A 3TJPA 4DQOC 1TTNA 2BKRB 3IT6B 4LNOA 3WAPA 2W3RA 3W1SA 1CQVA 1J7CA 3DBRI 5JH5C 5L83A 2CU1A 1MVKA 4M0WA 1TS4A 1YN5A 4MACA 3T8MA 3WA0A 4IM0A 2N1VA 2JRIB 3UF8A 1SGHA 3V6EB 4J6IA 1NEKB 2G9HD 3T3NA 1J7AA 4JGHB 3D32A 1QZEA 2NS5A 4RH6A 2WWZA 1WSPA 1XF5L 2Q5WD 1FXAA 3DVGY 4BKGA 3NZSA 4HJKA 2RR9A 3H9DA 3A9KB 1ACCA 2LUEA 3WALA 2FCQA 2WXKA 3ML9A 1KF6B 4MGZE 1EUVB 1Q10A 4MSMB 2LXAA 3Q6BA 2V4IB 4EFOA 1UBQA 4QAYA 4P16A 1QOAA 2IO1B 3H7SA 2XK5A 3KUCB 2ONQA 3LDZE 4IWPA 4HLEA 3KUZA 3O13A 3Q8BA 4B6WA 1C76A 4REZA 1TS2A 4GDLA 2M8SA 4GLSC 3RNCC 3UI3A 2IGHA 3Q14C 3PRPB 2ZW1A 2KXJA 2GBMA 2AEHA 1HZ5A 4KKJA 2MBHA 3P4QB 4BOZB 3PO0A 4G3XB 2X38A 2FIDA 1KFYB 3TEXA 2D10A 2BF8B
chains in the Genus database with same CATH topology
3AM9A 1TKYA 1GB4A 4HKZE 3FILA 1D5ZC 1SJHD 2N9LA 1D4BA 2JSVX 1VDVA 1SB3C 2BBCA 1VZ6A 3MP9A 1C4CA 3R2TA 1QILA 3LB8C 4NZLB 4A90A 1FO4A 2AX5A 3WCQA 2QSDA 3GB1A 3RFZB 2TSSA 1SE3A 3AE4B 4US9A 1TS5A 1FRDA 2FBWB 1QT9A 4IDIA 5HHDG 1FFVA 2AQ2B 4KGSA 4NJCA 3BYTB 2INNE 4WURA 3DWMA 1MHHE 1SEBD 2N7JA 2YEPF 2WU5B 1STEA 1NYRA 1HZ6A 1VZ7A 1GPXA 1CZPA 1HA5A 1XLPA 2KDMA 5TSSA 2GI9A 3BIID 1DOIA 1P7EA 3AE8B 1C4AA 2WLBA 1T5XD 3HVZA 1PGXA 3IAS1 4LK0M 2VZKD 1EU3A 3ZJTA 4OHJA 1HQRD 1RWSA 1IUEA 1E9MA 1GOZA 2OHFA 1HEZE 1ZDVA 5D3DA 1KLUD 2WXJA 4N59A 5EE0A 4P6VF 2LGIA 1C4PA 3PZ8A 3PZ7A 4IKGA 1NI3A 3SFDB 1YMHE 2WS3B 1SE4A 2MJEA 4N6EB 2EKIA 4ARIA 4FXCA 3W2DA 1AW7A 2JU6X 3ABVB 3U4EG 4YSXB 2DYMA 3VR8B 4KGRA 3HVDA 3ETRA 1XLOA 3AB5A 2LJIA 2K9XA 1XLQA 1DYQA 2WXPA 3LXFA 3AMZA 2J52A 1FRRA 3AV8A 2HDEA 3FC4A 1B9RA 1D6EC 4N58A 2FUG1 2JQRB 1XCTL 3NUHB 3ZJVA 1FFUA 4KGTA 2J4XA 2ZW0A 2BYTA 2JYEA 3ZYYX 2Y5CA 3TUOA 4A9AA 4C56C 1GAQB 1JALA 1ZP0B 3W5UB 2ICIA 3CWIA 4RNAA 1EWCA 3V3XA 2H89B 2PW9A 4CQNA 1EM7A 4OZCA 1FCLA 4D2KA 3KWLA 1L0VB 1V1OA 1XO3A 2PTLA 2BTEA 3IAM1 4HKQA 3VRAB 1YJIA 2G1EA 3CIRB 3B2GA 3H8HA 1HXYD 1QOGA 4XDCA 3BVZA 2M0AA 2BS2B 1JCKB 3BZDB 1IBXB 2WXNA 1SJED 2M56B 3SEBA 2V3NA 4TQ0A 1ZDXA 3MJ5A 1N60A 1TKGA 2MEKA 3HRDD 3AN1A 3P1MA 4TMAB 5EE3A 1C78A 1FXIA 1VJKA 2M19A 4MM3B 1TJEA 1DOYA 1NYQA 3W9CB 5FR3A 4ZRPA 1E0ZA 2IPKD 4EE2A 4RCOA 2W82A 1MPEA 2RDHA 1ZXIA 3GS2A 2BS3B 3N9YC 2WDQB 1SE2A 2WXGA 5HI1A 1YNTE 2E6XA 1N63A 1XCQL 1M4VA 2H88B 1V8CA 4YXDB 3J9CA 1XEEA 2PVOD 1I4GA 3IXSA 2WDRB 3AE9B 3IT4B 3AH7A 4KX6B 5EE9A 1C9FA 2LEKA 1K52A 3Q69A 2EELA 1ZXHA 1IBXA 3NRZA 1NVID 2QIEB 2LMCA 4GDKB 4RGTA 4J3OD 1L0XB 4HJGE 1N5WA 2I38A 3AE7B 2WU2B 2KWDA 1GB1A 2D5GA 2SEBD 3BYYB 4WH4A 5BMHA 5HFYA 2WXQA 1RFKA 2WXRA 2K0PA 1KLGD 1L6UA 3AEAB 4ARCA 4RGMA 2QILA 1L0YB 3TEWA 1UUPA 3MHZA 4XDDA 3U2SC 4NAMA 2WXLA 1I4XA 3AE6B 3E9SA 1TKEA 2BS4B 3SFEB 4YSYB 4JWUC 5I4DA 3EA6A 2Z8LA 1TYGB 3BK2A 4LTUA 4C7ZA 3U7ZA 3E56A 1PYWD 1CJEA 4L1BA 1XXGA 4YSZB 1L5PA 3GP7A 5G5HA 5FKAC 3VQIA 2KAJA 1FNVA 3P4PB 3AE1B 1F0ZA 2N9KA 2QJLA 2JZPA 3I9V1 2WP9B 1TY2A 2OEDA 3AE2B 3VRBB 1E7PB 2RPVA 4ZOHC 1JWUD 2KN4A 2JYTA 4YWGG 4WIPA 2K3UA 1WGKA 3Q8FA 1YN4A 3VR9B 1PGBA 5HG2A 1ET9A 3C8YA 4B0MA 1TY0A 3NS1A 1N61A 1ZPSA 3FAHA 5EE1A 5H8YE 4RFBA 5AUKA 2KQ4X 3BWUD 1AYFA 2PIAA 2HTME 3AE5B 1D5MC 4JWSC 1ZOYB 3P63A 1VZ8A 2QEJC 3NVWA 3TSSA 1A70A 2JXTA 2DLBA 1J7BA 3Q8EA 4AQ7A 2BB6A 1QOBA 1WRIA 1JRPA 4A8XC 1ESFA 4L2YA 1I4RA 1JW9D 3AEFB 3V05A 2WXFA 3OWEB 5LNK1 1SXTA 2BT6A 2IGDA 1JWAD 3KQ4A 4IOIE 3NVZA 1JWMD 1QQRA 2J53A 2MH7A 2PMVA 4OW0A 1KTKA 1MHXA 2NTSA 3R8BA 2L1AA 1VLBA 1WYGA 3KWVA 2WNMA 2PKOA 4MT5A 1F77A 5FK9C 3LYYA 2W55A 4YTNB 5BYQA 2WXMA 1FM0D 1JMLA 3DWGC 4DXGA 4MH8A 2K5PA 3I57A 5C2TB 4C7YA 5T8IA 1WXQA 4UDUC 3SR6A 1ENFA 2DBYA 2IDYA 1FNWA 1OFFA 1I4HA 1XLNA 1B1ZA 1OQQA 3BK1A 4YT0B 3AEDB 2INPE 5E6JA 1F2RI 1BXTA 4DXFA 1EWYC 4Q2JA 5BMIA 4XWTA 1JROA 1RYJA 4AS1A 2CJOA 1DGJA 2L52A 2R61A 3NVVA 4USAA 1JQ4A 1P7FA 2WDVB 2V0GA 1BMLC 1YJJA 2QMTA 5AUIA 3ZGZA 2B76B 4JPSA 1K53A 3RPFC 1RM6C 2WXHA 4RGNA 1FEHA 5BMGA 1ZUD2 4WAFA 2Y5PA 2FE8A 1C77A 1QF6A 1YQ4B 1I4QA 5D3IB 4WQMA 2ON8A 1CK1A 3AE3B 1MI0A 2Y3AA 1UWMA 1I7HA 1ET6A 1K50A 3TEYA 1BUIC 1WWTA 4A6QA 1ROEA 5GXGB 1N5XA 1VRAB 4ZRQA 2MJDA 2RMMA 4L23A 1DOXA 2DWQA 4OZBA 1V97A 1FIQA 2PLPA 1N62A 5BYRA 3Q8CA 3MC0B 1F2RC 1PDXA 1SSNA 1SBBB 1SIJA 1YQ3B 3P42A 1V1PB 5BYSA 2L83A 1QLBB 2DYOA 1QKZA 2VZKB 4ZYSA 3B2FA 2WQYB 2JX5A 2GRIA 5MPOA 1VR9A 4ZHPA 2MJ3A 1SF0A 1D5XC 1UNSA 1OQRA 2V3PA 3L4PA 4US8A 2IGGA 1IGCA 2YEPB 2AQ1B 3HUIA 1L4ZB 3EGRA 4OZAA 2KMMA 1JWBD 1FNUA 2PVGC 4NAWB 3ZJUA 1T3QA 1PGAA 2J42A 1EU4A 4XE0A 1QOFA 1YN3A 4RGOS 3NZ3A 1E6EB 3W5VB 4OVZA 3R2IA 4RF1A 4R3DA 4DQOC 1UGJA 2WXOA 1IGDA 4TQ1A 3IT6B 1C79A 2W3RA 3U52E 3W1SA 1TZOA 1CQVA 1J7CA 3EUB2 2LFIA 2LHEA 4RF0A 1V1PA 1MVKA 1UWXA 1FMAD 4M0WA 1TS4A 1YN5A 4KKIA 4MACA 3BVGA 1Y56A 1R7SA 4JX1C 1LO5D 1ZE3D 3Q8AA 4XWWA 1L4DB 4JE3B 1NEKB 2G9HD 3T3NA 1KRHA 1J7AA 2W3SA 4RH6A 1KH0A 1WSPA 1XF5L 2BW2A 2Q5WD 4GDLB 1FXAA 2KACA 3P4RB 4H2AA 4C80A 3B9JA 1T6BX 2BB5A 3BVMA 2RDGA 3T3OA 4LLGM 2WXIA 4ITKA 4PT5A 1AWDA 4HROA 1ACCA 5C3JB 3MFGA 2WXKA 2GB1A 1KF6B 1K51A 4YTMB 1Q10A 4B0EA 2V4IB 3KLSX 4HEA1 1I4PA 1PFDA 5D7GA 4ZHOA 2I2YA 3FILB 2L32A 4P16A 1QOAA 2N0SB 2IJ0A 3AEGB 1JWSD 2XN9C 2ACZB 3AEEB 1TS3A 1E10A 2ONQA 1NENB 2E3TA 5JXVA 3TEZA 5H92C 3URYA 2LUMA 2XNAC 3O13A 3Q8BA 3ZQ4A 1C76A 4REZA 1TS2A 3AEBB 4GLSC 5G5GA 2CJNA 2JWUA 1AN8A 2SAKA 3AECB 1PUTA 2LHDA 3UI3A 2IGHA 2K22A 3P4SB 2CU3A 4TSSA 2ZW1A 1L6VA 1FCCC 1HZ5A 2NMQA 2AQ3B 4KKJA 4HRSA 3P4QB 3PO0A 3NVYA 2X38A 1KFYB 3TEXA 4O1NA 2W54A 4WWMA 4YTPB 4A55A 1FD6A 2NTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MPO A;  4ZHP A;  2MJ3 A;  1YJI A;  1SF0 A;  1TKY A;  2G1E A;  1OQR A;  3B2G A;  1N61 A;  3CIR B;  3AM9 A;  3L4P A;  1QOG A;  3FAH A;  5EE1 A;  5H8Y E;  4US8 A;  3HUI A;  5AUK A;  2BS2 B;  2KMM A;  1JWB D;  1AYF A;  2PIA A;  1VDV A;  2HTM E;  2PVG C;  1SB3 C;  3AE5 B;  1T3Q A;  2M56 B;  3LB8 C;  4JWS C;  1ZOY B;  3P63 A;  1QOF A;  2AX5 A;  3NVW A;  3WCQ A;  1FO4 A;  1N60 A;  1TKG A;  3AE4 B;  4US9 A;  1A70 A;  3HRD D;  1FRD A;  3AN1 A;  3P1M A;  1E6E B;  3W5V B;  2FBW B;  1J7B A;  3NS1 A;  5EE3 A;  1QT9 A;  1QOB A;  1WRI A;  1JRP A;  4IDI A;  1FFV A;  1FXI A;  1VJK A;  2M19 A;  1DOY A;  1TJE A;  1NYQ A;  3W9C B;  1JW9 D;  3AEF B;  1E0Z A;  2W3R A;  3DWM A;  1J7C A;  2WU5 B;  1ZXI A;  2BT6 A;  2BS3 B;  1NYR A;  3EUB 2;  1JWA D;  1GPX A;  1CZP A;  2WDQ B;  3NVZ A;  1XLP A;  2MH7 A;  1FMA D;  1N63 A;  1VLB A;  3BII D;  1DOI A;  1WYG A;  2H88 B;  1R7S A;  1V8C A;  2PKO A;  2WLB A;  3AE8 B;  4JX1 C;  3HVZ A;  4YXD B;  2PVO D;  2WDR B;  2W55 A;  3AE9 B;  4YTN B;  1NEK B;  3AH7 A;  1FM0 D;  1KRH A;  3DWG C;  1J7A A;  4KX6 B;  5EE9 A;  2W3S A;  2LEK A;  2K5P A;  5C2T B;  4C7Y A;  3NRZ A;  2Q5W D;  1NVI D;  1WXQ A;  2QIE B;  1FXA A;  3SR6 A;  3P4R B;  4C80 A;  1RWS A;  3B9J A;  1IUE A;  1E9M A;  2DBY A;  1N5W A;  1OFF A;  1XLN A;  3AE7 B;  2OHF A;  2WU2 B;  1OQQ A;  4YT0 B;  4ITK A;  1AWD A;  3AED B;  4N59 A;  5EE0 A;  1EWY C;  4HRO A;  4P6V F;  1RFK A;  1L6U A;  3AEA B;  1JRO A;  1RYJ A;  5C3J B;  2CJO A;  1DGJ A;  2L52 A;  3NVV A;  4USA A;  1JQ4 A;  1KF6 B;  1NI3 A;  2WDV B;  1YJJ A;  3SFD B;  5AUI A;  2WS3 B;  2B76 B;  2MJE A;  4N6E B;  4YTM B;  2EKI A;  4FXC A;  3RPF C;  1RM6 C;  1ZUD 2;  3ABV B;  4YSX B;  1PFD A;  4ZHO A;  3AE6 B;  1QF6 A;  3VR8 B;  1TKE A;  2BS4 B;  1YQ4 B;  3ETR A;  1XLO A;  3AB5 A;  3SFE B;  1QOA A;  4YSY B;  4JWU C;  4WQM A;  2N0S B;  3AEG B;  2K9X A;  1XLQ A;  1TYG B;  2ACZ B;  3AEE B;  3AE3 B;  4LTU A;  1UWM A;  4C7Z A;  1NEN B;  1I7H A;  2E3T A;  1E10 A;  3LXF A;  3AMZ A;  1CJE A;  1WWT A;  4YSZ B;  1L5P A;  5H92 C;  1FRR A;  3AV8 A;  5G5H A;  1ROE A;  5GXG B;  1N5X A;  3AEB B;  3FC4 A;  1B9R A;  2KAJ A;  2MJD A;  1DOX A;  5G5G A;  2DWQ A;  2CJN A;  4N58 A;  2JQR B;  3AEC B;  1PUT A;  1V97 A;  3AE1 B;  3P4P B;  1FFU A;  2K22 A;  3P4S B;  2CU3 A;  2QJL A;  1F0Z A;  2WP9 B;  1FIQ A;  1N62 A;  1L6V A;  3AE2 B;  3VRB B;  1E7P B;  3ZYY X;  2Y5C A;  4A9A A;  1GAQ B;  1JAL A;  1ZP0 B;  1PDX A;  3W5U B;  4HRS A;  3CWI A;  4ZOH C;  3P4Q B;  1SIJ A;  2H89 B;  3PO0 A;  1YQ3 B;  3NVY A;  2L83 A;  1KFY B;  1L0V B;  1QLB B;  1WGK A;  3KWL A;  3B2F A;  2W54 A;  1XO3 A;  2WQY B;  4WWM A;  4YTP B;  2JX5 A;  3VR9 B;  3VRA B; 
#chains in the Genus database with same CATH topology
 3I3T B;  1E8Z A;  2ZZP B;  4A3O A;  1SJH D;  4B9K A;  3R2T A;  4NZL B;  4ZYN A;  2FCN A;  2QSD A;  3GB1 A;  2AYO B;  3RNB C;  2XBB C;  1FRD A;  3WAM A;  4RM9 A;  2L76 A;  1MG4 A;  4NJC A;  2C5L C;  3RMK C;  2L0T A;  1SE9 A;  1TIF A;  2WU5 B;  5CHF A;  5E6P A;  4NPN A;  4WJP A;  3A1Q A;  1JRU A;  1CZP A;  2GMI C;  3AE8 B;  2KX0 A;  1WGD A;  3HVZ A;  1PGX A;  2VZK D;  1Z2M A;  4OHJ A;  2D3G A;  3TBL D;  2MW5 A;  3ZDM C;  1RWS A;  1E9M A;  2BWE S;  2OHF A;  4DK5 A;  1HEZ E;  3A9J A;  4N59 A;  3QIJ A;  2LGY A;  1ZW7 A;  3DBR B;  4DDI D;  2GBN A;  2WS3 B;  4TV3 A;  1SE4 A;  2MJE A;  1AW7 A;  2JU6 X;  1I35 A;  4YSX B;  4W9C A;  4KGR A;  3SDL C;  4K7W A;  1K8R B;  2IZV B;  4DHJ D;  2RPQ A;  1FRR A;  3AV8 A;  3GOE A;  3FC4 A;  1B9R A;  1D6E C;  4W9I A;  4A20 A;  1WM3 A;  1XCT L;  2BYT A;  2ZW0 A;  1Q1O A;  3ZYY X;  4A9A A;  1GAQ B;  1JAL A;  3CWI A;  4IUM B;  2H89 B;  4CQN A;  5IOI A;  4HVB A;  2V9H A;  1L0V B;  3X23 A;  4HKQ A;  2MA9 B;  4IWQ A;  1YJI A;  3B2G A;  2REX A;  2BS2 B;  1R4N I;  2EMT A;  2IO0 B;  1E7V A;  1JCK B;  4MSQ B;  2IY0 B;  3BZD B;  2M56 B;  3L17 A;  1TKG A;  4WAA A;  5EE3 A;  4AJW A;  1VJK A;  2M19 A;  2V3S A;  1DOY A;  1NYQ A;  3W9C B;  5FR3 A;  3B1L X;  2N4F A;  2W82 A;  4AOF A;  2RDH A;  2RGF A;  2WGS A;  3ZXR A;  3PS6 A;  4W9H A;  2WXG A;  2E6X A;  4PS8 A;  2NPT A;  1WJ6 A;  2VH2 A;  4BBN C;  3VXW A;  2KDI A;  4YXD B;  3AE9 B;  3A9J B;  2LEK A;  1ZXH A;  2LRU A;  5J18 A;  1P3Q U;  1L0X B;  4HJG E;  2I1K A;  2WU2 B;  1GB1 A;  2D5G A;  1WIA A;  3BYY B;  5HFY A;  2WXR A;  3L13 A;  3UIN B;  4ARC A;  3AEA B;  1X1M A;  3VH3 B;  3I63 C;  1WM2 A;  1I4X A;  3AE6 B;  3OAW A;  3OJ3 A;  4YSY B;  1J8C A;  3AI5 A;  1H4R A;  2L0F A;  3U7Z A;  2QHO A;  4OVU A;  2KAJ A;  2K6Q A;  4GDK A;  1WMH A;  3RNF C;  1F0Z A;  2WP9 B;  2KN5 A;  2OED A;  3AE2 B;  3VRB B;  1E7P B;  1OEY J;  3GZN I;  1EF5 A;  2FCS A;  4ANV A;  2LAS A;  4WJQ A;  2KN4 A;  3ENE A;  1H8C A;  2FUH B;  3M62 B;  3Q8F A;  3L54 A;  4M8N A;  4CYE A;  1TY0 A;  1C3T A;  3NS1 A;  4DXA B;  3I5J C;  1ZPS A;  2MP2 B;  2CHZ A;  5EE1 A;  3BY4 B;  1WR6 E;  3BWU D;  5LLI A;  2HTM E;  4BOS C;  3P63 A;  2QEJ C;  3TSS A;  3WAO A;  3LJ3 A;  4EZJ A;  3NY5 A;  2C7H A;  1J7B A;  4NAW A;  1WRI A;  4K3C A;  4K7S A;  1WXS A;  1JW9 D;  3AEF B;  3V05 A;  5BO4 B;  2MRP A;  2AWT A;  3A4R A;  4OW0 A;  4LCD E;  3R8B A;  1NDD A;  1VLB A;  4K7U A;  1WYG A;  2PKO A;  2Y5B B;  1GC7 A;  5FK9 C;  2WX0 A;  3LYY A;  1GJZ A;  4FBJ B;  2WXM A;  4DXG A;  2KJH B;  4OVV A;  1P9D U;  3RYT A;  2KFK B;  2DBY A;  1GC6 A;  1FNW A;  1I4H A;  4M02 A;  1B1Z A;  2DX5 B;  4YT0 B;  5DPW A;  5E6J A;  2K8B A;  3OJ4 B;  3PLU A;  1RYJ A;  4AS1 A;  3NVV A;  2R61 A;  4HCP B;  3WAN A;  1WH3 A;  2JXX A;  1P7F A;  3ZGZ A;  2M4N A;  5BMG A;  3IG3 A;  3N3K B;  4WAF A;  2K8H A;  3Q2A C;  2NBV B;  1WZ3 A;  1YQ4 B;  3DBS A;  3EFU A;  1I4Q A;  2G3Q B;  3AE3 B;  1MI0 A;  1UWM A;  1I7H A;  5IO9 A;  4ACF A;  4II3 B;  3ZIM A;  1N5X A;  3RNG C;  4EZL A;  5IA7 A;  1D3Z A;  4XX5 A;  2HTH A;  5DPS A;  2PLP A;  1N62 A;  1GUA B;  3RI7 C;  3QC8 B;  1SSN A;  3OLM D;  1QLB B;  4MDK E;  3QHT A;  4ICU A;  4ZHP A;  2MJ3 A;  2IGG A;  1TZ1 A;  1WE7 A;  4OZA A;  3TMP B;  4NAW B;  3A33 B;  3HK0 A;  2MBE A;  2D07 B;  4RGO S;  1E6E B;  3R2I A;  2KZR A;  1XT9 B;  3EEC A;  2KC1 A;  2ZJD A;  3L10 B;  3U52 E;  4MEL A;  3ZRF A;  1V1P A;  3QAR A;  1WX9 A;  1FMA D;  5KHO A;  1V81 A;  2YVC A;  2KVZ A;  4KKI A;  3BVG A;  1R7S A;  4JX1 C;  1HTQ A;  3GE3 C;  2W3S A;  2ZNV C;  1LXD A;  2M1M A;  1T6B X;  3BVM A;  3DHG C;  3ECI A;  1S3S G;  2BKF A;  3BIN A;  1K51 A;  3DBL B;  2G45 B;  4B0E A;  4YTM B;  2I2Y A;  4JL9 A;  3FIL B;  2JRH A;  4KSK C;  1JWS D;  3AEE B;  1UBI A;  5JXV A;  3ZRC A;  3UIO B;  1YD8 U;  4AWJ A;  1WFY A;  3ZQ4 A;  3AEB B;  3HHM A;  4MGI E;  5G5G A;  2JWU A;  2Z59 B;  3IFW B;  2CU3 A;  3DQV A;  2J0J A;  4NJ6 A;  2INC C;  2LVP A;  4TSS A;  3V60 A;  1WE6 A;  3A9K A;  1FCC C;  2AQ3 B;  1OTR B;  3NVY A;  3VAW A;  4O1N A;  2GBJ A;  2BQQ A;  4FHK A;  4G11 A;  4XGA B;  4C00 A;  1WGH A;  1UD7 A;  2DZI A;  2BBC A;  1J0G A;  1QIL A;  2D3B A;  4A90 A;  1FO4 A;  2AX5 A;  3WCQ A;  1F1H A;  1TS5 A;  4JLC A;  1FFV A;  2AQ2 B;  1OEY A;  3BYT B;  2GBK A;  2O2V A;  2INN E;  4WUR A;  3DWM A;  1MHH E;  1SEB D;  1Q5W B;  1NYR A;  1VZ7 A;  1GPX A;  2KK8 A;  4IM3 A;  2GI9 A;  1DOI A;  1V2Y A;  4AUQ C;  1RFA A;  3L16 A;  3P2B A;  3ZJT A;  3X0W A;  3R66 C;  4FA6 A;  1E8Y A;  5CX3 A;  4IWO A;  1HQR D;  5CTR C;  4GB9 A;  1IUE A;  4KIK A;  2JY6 A;  1OQY A;  2M17 A;  1GOZ A;  4BKS D;  5D3D A;  4F1S A;  3QJZ A;  2DYB A;  5C1Z A;  4NJ7 A;  3PZ8 A;  5JHA A;  4DHJ B;  4N6E B;  2MHJ A;  4FXC A;  3W2D A;  3QX1 A;  4NNJ B;  3ABV B;  2AL6 A;  3SHQ A;  1XLO A;  3AB5 A;  1EF1 A;  3V62 A;  3DCG A;  3ZVV A;  3QA8 A;  2LJI A;  2LJ5 A;  3LXF A;  2J52 A;  2LGX A;  3UQA A;  1E90 A;  4EEW A;  1I42 A;  5C23 A;  3IVF A;  3W1Y A;  5D2M B;  3ZJV A;  1FFU A;  4KGT A;  3C0R B;  2J4X A;  3N1Z C;  4HXD A;  2BWF A;  3APC A;  2ICI A;  1V5T A;  4LNI A;  3W5U B;  4GGQ A;  3SU8 X;  4KV2 A;  1EM7 A;  4MGK E;  2IO3 B;  1FCL A;  2O6V D;  3S2A A;  2C7N B;  2J0K A;  2BTE A;  3VRA B;  4XDC A;  3BVZ A;  2M0A A;  3RZW C;  2RSU A;  2IBI B;  3SEB A;  1ZDX A;  3MJ5 A;  2MEK A;  2O2V B;  2WX1 A;  4G0N B;  3WIM A;  1TJE A;  1RAX A;  4LDT D;  4ZRP A;  2LI5 A;  1MPE A;  4G50 A;  3VUW A;  3VUX A;  3N9Y C;  4IG7 B;  5HI1 A;  1YNT E;  4ANW A;  1M4V A;  2H88 B;  2MCN B;  1XEE A;  1LFD A;  4KIK B;  2WDR B;  3IT4 B;  3U7D A;  3Q69 A;  2EEL A;  3ALB A;  1LQB A;  4KZ0 A;  2I38 A;  2MLB A;  2KWD A;  2JVC A;  2SEB D;  1IP9 A;  2K0P A;  3ZNI D;  3APD A;  4RGM A;  3NJT A;  4FJY A;  3TEW A;  3EC8 A;  4CHK A;  3JYU A;  3DVN U;  1KM7 A;  2BS4 B;  2G4D B;  3CSF A;  3EA6 A;  4ANU A;  1TYG B;  4C7Z A;  3DHH C;  4LJO B;  1PYW D;  5HKH A;  4L1B A;  4IW0 A;  2N7E A;  3GP7 A;  5AEK B;  4YL8 A;  3ZNZ B;  2QJL A;  2RPV A;  3B0A A;  2KTF A;  1JWU D;  2JYT A;  4LJP B;  2QCZ A;  4I6N B;  5HG2 A;  1ET9 A;  2EMS A;  4E71 A;  4BZA A;  5H8Y E;  4HPM B;  2KYW A;  4RFB A;  5AUK A;  1TBE A;  2ZPY A;  4JWS C;  1ZOY B;  1V9J A;  2DLB A;  3Q3M C;  4A8X C;  1ESF A;  2V1Y A;  4L2Y A;  4KSL C;  2WXF A;  4N9F 4;  2BGF A;  4F8C B;  2IGD A;  3KQ4 A;  1ISN A;  4W9L A;  2MH7 A;  2J53 A;  1KTK A;  2HE7 A;  4TKN A;  2L1A A;  1YIW A;  3KWV A;  2MP2 A;  4YTN B;  2JZ3 B;  2WDT B;  1T0R C;  1JML A;  2NBU A;  3DWG C;  2K5P A;  1E8W A;  2HD5 B;  3VTW A;  4DDG D;  3K9O B;  3UIP B;  2PE9 A;  2HJ8 A;  2DEN B;  3BK1 A;  3AED B;  5BMI A;  2JPH A;  3ZO5 B;  4HDO A;  2L52 A;  2QMT A;  2B76 B;  1K53 A;  3RPF C;  1FEH A;  2M0X A;  1ZUD 2;  3VTV A;  5JHB A;  1QF6 A;  1SIF A;  5AZH A;  2DZK A;  4CO7 A;  2KQS A;  4WJN A;  2ON8 A;  2Y3A A;  2LGD A;  1WWT A;  2PEA A;  3ZKJ C;  3ZTC A;  1ROE A;  2KFK A;  4ZRK A;  2L3Z A;  2MJD A;  1DOX A;  3ZXV A;  4OZB A;  3O65 B;  2BYV E;  4XC2 A;  3NS8 A;  1RRB A;  2KMC A;  5BYR A;  1EO6 A;  2LVQ A;  1YQ3 B;  3P42 A;  5GMV A;  3AXC A;  1T0Y A;  2WQY B;  1VD2 A;  2GRI A;  3PGE A;  5MPO A;  1VR9 A;  1UNS A;  4HPP A;  4PK1 A;  3PZD A;  3EGR A;  3R3M A;  2KMM A;  3H6N A;  2PVG C;  4FHJ A;  2J42 A;  4GMV A;  1EU4 A;  1QOF A;  3ZLZ A;  3JSV A;  2MX2 A;  3W5V B;  1HE8 A;  3HM3 A;  4R3D A;  1UGJ A;  2WXO A;  2L00 B;  4TQ1 A;  4K81 A;  4GXB A;  1TZO A;  3VUY A;  3EUB 2;  2LFI A;  5EDS A;  2LHE A;  1VCB A;  3PSE B;  2CS4 A;  4RF0 A;  1UWX A;  2L7R A;  1Y56 A;  1WXA A;  1ZE3 D;  3Q8A A;  4XWW A;  3KVF B;  1L4D B;  4JE3 B;  1KRH A;  3TIX A;  5E6O A;  4BKS A;  1KH0 A;  2KAC A;  4C80 A;  3P4R B;  4H2A A;  4E3C A;  2BB5 A;  4M8M A;  2FAZ A;  2R2O A;  2RDG A;  4BBN F;  2RD0 A;  3T3O A;  2WXI A;  5KHQ A;  1AWD A;  3DBL I;  3MFG A;  1WY8 A;  1WF9 A;  2WYQ A;  5IP4 D;  4HWI B;  1PFD A;  3RNA C;  4ZHO A;  2D11 A;  2N0S B;  1KLV A;  3AEG B;  2ACZ B;  2ZCC A;  1E10 A;  1TGZ B;  2E3T A;  5H92 C;  3URY A;  4FLH A;  2LUM A;  2XNA C;  2G4S A;  3JVZ X;  4AP4 C;  1AN8 A;  3AEC B;  2LHD A;  1L6V A;  2O6V A;  2NMQ A;  3CMM B;  4HRS A;  3AUL A;  3B08 A;  1WJ4 A;  4WWM A;  2W54 A;  4YTP B;  1FD6 A;  1E8X A;  2NTT A;  3EFC A;  4IC7 B;  1GB4 A;  2KJ6 A;  3FIL A;  3JSV B;  1D4B A;  1LGR A;  2ZVN A;  1SB3 C;  4NY0 A;  3MP9 A;  5DPR A;  3LB8 C;  2BVC A;  3RFZ B;  1UZX B;  2TSS A;  4US9 A;  2FBW B;  1QT9 A;  3AU5 A;  4IM2 A;  5HHD G;  3M63 B;  4KGS A;  3H7P A;  2IY1 B;  1HTO A;  5G55 A;  2ZCB A;  2N7J A;  1WX7 A;  2BYF A;  4JIO U;  5IN7 A;  1STE A;  1P98 A;  1WGR A;  2KJR A;  3ML8 A;  5TSS A;  4W9E A;  3BII D;  1V49 A;  3VTU A;  2ZNV B;  3KW5 B;  4EUT A;  4W9J A;  1V6E A;  1KLU D;  4X57 B;  1M94 A;  5EE0 A;  3Q3J A;  4P6V F;  2NR2 A;  3VVW B;  1N6Z A;  3SFD B;  1Y8R C;  2EKI A;  5DCN A;  3U4E G;  1IYF A;  3ETR A;  1XQQ A;  4S0R A;  1FPY A;  2K9X A;  1XLQ A;  3NZU A;  4I6P A;  4W9G A;  1DYQ A;  3AMZ A;  4II2 B;  2O6V B;  4M00 A;  2FUG 1;  2JQR B;  1GNU A;  3U8Z A;  1F9J A;  2JYE A;  3FKY A;  1WJU A;  3TUO A;  4C56 C;  1ZP0 B;  4RNA A;  3V3X A;  2CHX A;  4P7I A;  4D2K A;  3KWL A;  4GU2 A;  1T0S C;  3CST A;  2VH1 A;  2G1E A;  1HXY D;  2NBW B;  4LDT B;  1YX6 B;  1IBX B;  2WXN A;  3H7P B;  2KD0 A;  2V3N A;  4TQ0 A;  3HRD D;  2K25 A;  3AN1 A;  3P1M A;  4TMA B;  3DVN V;  2KQ7 A;  3L08 A;  2KHW B;  4I6L B;  1C78 A;  4MM3 B;  4LNN A;  1E0Z A;  4EE2 A;  2DAJ A;  3PV1 A;  3N30 A;  1SE2 A;  2EKE C;  4EZK A;  1YJ1 A;  2IYD B;  4WQO B;  2JF5 A;  1XCQ L;  1V8C A;  3DBH B;  4LNF A;  5J17 A;  3AH7 A;  3VFK A;  5EE9 A;  3V6C B;  1K52 A;  3NRZ A;  4WWP A;  2LMC A;  2QC8 A;  4RGT A;  1LM8 B;  4J3O D;  3VH4 B;  2AL3 A;  4EOY A;  2OOB B;  4WJO A;  4WH4 A;  5BMH A;  2L8J A;  1T0Q C;  1RFK A;  2MBB B;  1KLG D;  1ZKH A;  1WX8 A;  3C19 A;  1UUP A;  4PS7 A;  4XDD A;  4NAM A;  2WXL A;  2CR5 A;  2LWP A;  2PE6 B;  4S17 A;  1TKE A;  2JWZ A;  4GN1 A;  1P0R A;  2KWV B;  3GE8 C;  1FXT B;  4JWU C;  2Z8L A;  2KLC A;  4LTU A;  3E56 A;  2KAN A;  4YSZ B;  1L5P A;  5G5H A;  5FKA C;  3VQI A;  4GSW A;  3JW0 X;  4P1B C;  3P4P B;  3AE1 B;  4K1R B;  2UU7 A;  2LVO A;  3I9V 1;  2I1J A;  3PT2 B;  1TY2 A;  4ASW C;  2UWQ A;  1MJD A;  4XZ4 A;  2W9N A;  4ZOH C;  3CF6 E;  4WIP A;  4YWG G;  2K3U A;  1YN4 A;  3VR9 B;  2NVU I;  3C8Y A;  4FJV B;  2L05 A;  4HPL B;  3FAH A;  3RT3 B;  3NG0 A;  2KQ4 X;  4FJZ A;  1AYF A;  2PIA A;  2A5U A;  1D5M C;  2KVR A;  1WR1 A;  3NVW A;  1A70 A;  2JXT A;  3Q8E A;  2BB6 A;  1QOB A;  1JRP A;  1WJN A;  3HM6 X;  1I4R A;  2KDF B;  2K1F A;  3PPA A;  1R4M B;  3R7Q A;  3OWE B;  3PRM B;  5LNK 1;  4IOI E;  3NVZ A;  1JWM D;  2IND C;  1MHX A;  3RUL A;  5D94 A;  2WNM A;  4MT5 A;  5DPT A;  2MBO A;  2W55 A;  5BYQ A;  1FM0 D;  1OGW A;  4C7Y A;  2V4L A;  5T8I A;  3SR6 A;  1XD3 B;  1ENF A;  2IDY A;  1OFF A;  1KJT A;  2A4Z A;  4Q2J A;  1ZGU B;  1JRO A;  4XWT A;  3ZNH B;  1JQ4 A;  1DGJ A;  4USA A;  2KWC A;  1BML C;  1YJJ A;  5IKC M;  5AUI A;  4JPS A;  1BT0 A;  2WXH A;  4RGN A;  3RUI B;  2FE8 A;  3KYC D;  4KZC A;  5CHW A;  2XEW A;  1CK1 A;  2N9P C;  1ET6 A;  1K50 A;  3TEY A;  4NQL B;  2HJ1 A;  4A6Q A;  5GXG B;  1VRA B;  4ZRQ A;  4L23 A;  1WGY A;  2DWQ A;  1WGG A;  1V80 A;  2N9E B;  1S1Q B;  3M95 A;  3Q8C A;  4PYU A;  1F2R C;  2GBR A;  1Z5S B;  5BYS A;  2L83 A;  5AZF A;  1QKZ A;  3B2F A;  4M0W B;  4W9F A;  1A5R A;  2R2Q A;  1WXM A;  3KH0 A;  2LZ6 A;  3DDC B;  3L4P A;  4US8 A;  4FN2 A;  2YEP B;  2AQ1 B;  2CKH B;  3ZJU A;  1T3Q A;  1PGA A;  1WRD B;  5LXI B;  4XE0 A;  1UF0 A;  4GOC A;  2N7D A;  1YN3 A;  2C60 A;  4F7Z A;  3N32 A;  1TT5 B;  2KX3 A;  1IGD A;  2KDE B;  2YLM A;  3W1S C;  1C79 A;  2DZM A;  3NHE B;  2DNF A;  5AZG A;  3ZDT A;  4MEM A;  4JQW C;  4FUL A;  2K39 A;  2KLG A;  1LO5 D;  2LD9 A;  3OG5 A;  3PHW B;  2XK5 B;  4WWN A;  4XYC A;  3MHS D;  3RCZ A;  3MC9 A;  2BW2 A;  4GDL B;  1WI0 A;  2FIF A;  3B9J A;  4M01 A;  4LLG M;  1CMX B;  4ITK A;  4PT5 A;  4HRO A;  5C3J B;  2GB1 A;  4AJY B;  2N9X A;  4ZRJ A;  3KLS X;  4HEA 1;  5FR6 A;  1I4P A;  2MSE D;  2FNJ B;  5D7G A;  4FAD A;  2L32 A;  4MGY E;  2IJ0 A;  3IHP C;  2XN9 C;  2VRR B;  1TS3 A;  3TEZ A;  1NEN B;  1L7Y A;  3QQ8 B;  3PRZ A;  2CJN A;  1MG8 A;  2SAK A;  1PUT A;  2K22 A;  3P4S B;  4GIV A;  2JT4 B;  1UH6 A;  3DHI C;  1NI2 A;  1UEL A;  2IO2 B;  2GLS A;  3V61 A;  3A1Q B;  2LXC A;  4A55 A;  2KT7 A;  3H1U A;  2WHI A;  3RZF A;  2C7M B;  3AM9 A;  1TKY A;  4HKZ E;  3QK0 A;  1D5Z C;  2N9L A;  1IPG A;  2JSV X;  1VDV A;  4HCN B;  1VZ6 A;  1C4C A;  4DWF A;  2X8X X;  2NCN A;  1SE3 A;  3AE4 B;  5D6J B;  4IDI A;  2D3A A;  2OJW A;  2Z0D B;  2DZJ A;  2KOX A;  2YEP F;  4RMA A;  1HZ6 A;  2LRW A;  2KKC A;  1HA5 A;  1XLP A;  3QCA A;  2KDM A;  3KYD D;  4LNK A;  5J2R A;  1P7E A;  2B3A A;  3RD2 A;  1C4A A;  2WLB A;  4BAX A;  1T5X D;  3IAS 1;  4LK0 M;  4BVU C;  1EU3 A;  3Q3O C;  5L95 C;  4ZDV A;  1ZDV A;  2WXJ A;  1GG3 A;  3HIZ A;  2LGI A;  1C4P A;  3PZ7 A;  4IKG A;  1NI3 A;  1YMH E;  4ARI A;  3U30 A;  4BFR A;  3RN9 C;  3M3J A;  4HK2 A;  2DYM A;  4ICV A;  3VR8 B;  3HVD A;  3ZTD A;  5CHV C;  4MJS A;  2WXP A;  4NQK E;  3ZUN A;  3Q3N C;  3MC8 A;  2HDE A;  4E74 A;  2PJH A;  4N58 A;  3NUH B;  2GOW A;  3TCA A;  1WYW B;  1NBF C;  4URK A;  2Y5C A;  4ZRI A;  1EWC A;  2PW9 A;  1KOT A;  1WXV A;  4OZC A;  2CHW A;  3TL5 A;  1L2N A;  4DBG A;  1YX5 B;  1V1O A;  1XO3 A;  2PTL A;  2NPT B;  3IAM 1;  1U4A A;  3CIR B;  3H8H A;  2DHZ A;  4KVG B;  4DHZ E;  1QOG A;  3DVG X;  4EKU A;  3PVL A;  1SJE D;  1N60 A;  1R4N B;  4C4V A;  3DOW A;  1FXI A;  3PLV A;  2IPK D;  4RCO A;  5IAA C;  2J0M A;  1ZXI A;  3GS2 A;  2BS3 B;  3N20 C;  2BYE A;  3T9L A;  2WDQ B;  2LGS A;  3DBH I;  1MFW A;  4TUU A;  1N63 A;  2KDB A;  3J9C A;  1V86 A;  2PVO D;  4K3B A;  1I4G A;  3IXS A;  4KX6 B;  1C9F A;  4PS3 A;  1IBX A;  1NVI D;  2QIE B;  4GDK B;  2K8C A;  1WMH B;  5G2N A;  1N5W A;  3AE7 B;  3KUD B;  3MTN B;  2WXQ A;  4MM3 A;  1L6U A;  5LXH A;  2QIL A;  1L0Y B;  3MHZ A;  2KMA A;  2ZPN A;  3U2S C;  3A4S C;  3L0W B;  5TR5 A;  4MJS B;  3E9S A;  3EHV A;  3APF A;  2KC2 A;  4P1C C;  3SFE B;  5I4D A;  3BK2 A;  1YQB A;  1AAR A;  2ZVO A;  1CJE A;  1XXG A;  2MQJ A;  1RLF A;  2ZEQ A;  2OJR A;  1FNV A;  2KO3 A;  3PHX B;  2N9K A;  2JZP A;  4KDL B;  4WWO A;  2N1W A;  3IBE A;  3MJW A;  4BKT A;  1J19 A;  1E5W A;  1C1Y B;  3GZN B;  1WGK A;  3Q3F A;  1PGB A;  2ASQ A;  4B0M A;  2KTR A;  1Q0W B;  1YOV B;  1N61 A;  1P1A A;  3PRE A;  4B95 A;  1PQS A;  2PPH A;  4C4V B;  3AE5 B;  5E6N A;  1UGM A;  2Z0E B;  1VZ8 A;  4W9K A;  2JUO A;  4ANX A;  4W9D A;  4AQ7 A;  3PTF C;  3QAQ A;  1R4M I;  3RNE C;  3QWZ B;  4RM8 A;  3UQB A;  1SXT A;  2BT6 A;  4HDQ A;  1JWA D;  2QDF A;  1QQR A;  2D3C A;  2PMV A;  2NTS A;  3UGB B;  2KWU B;  1F77 A;  4MH0 E;  4MH8 A;  3I57 A;  5C2T B;  3ZW3 A;  1WXQ A;  4UDU C;  1XLN A;  1OQQ A;  4KDI C;  2INP E;  3ZNG C;  1F2R I;  1BXT A;  4DXF A;  1EWY C;  2CJO A;  2FCM A;  2J7Q B;  2WDV B;  2V0G A;  1RM6 C;  2Y5P A;  2BPS A;  3AU4 A;  1C77 A;  3N1X C;  2JZZ A;  5D3I B;  4WQM A;  2MBQ A;  1BUI C;  2D2Q A;  3R7R A;  2UYZ B;  2RMM A;  2RDB C;  3ONS A;  1V5O A;  1V97 A;  5JZE B;  4PYZ A;  2DAF A;  3DPD A;  1FIQ A;  3N1Y C;  3MC0 B;  1PDX A;  2KTR B;  1F52 A;  1SBB B;  1SIJ A;  2MWS B;  3VDZ A;  1V1P B;  2DYO A;  2VZK B;  4ZYS A;  1G6J A;  2JX5 A;  3K9P B;  1WZ0 A;  3SD5 A;  1SF0 A;  1D5X C;  3VHT C;  1OQR A;  2V3P A;  1IGC A;  2K6D B;  2KNB A;  3HUI A;  1L4Z B;  2KFJ A;  1JWB D;  3NOB A;  1FNU A;  1E7U A;  4A3P A;  4DHZ B;  3NZ3 A;  2C9W B;  4OVZ A;  4RF1 A;  3TJP A;  4DQO C;  1TTN A;  2BKR B;  3IT6 B;  4LNO A;  3WAP A;  2W3R A;  3W1S A;  1CQV A;  1J7C A;  3DBR I;  5JH5 C;  5L83 A;  2CU1 A;  1MVK A;  4M0W A;  1TS4 A;  1YN5 A;  4MAC A;  3T8M A;  3WA0 A;  4IM0 A;  2N1V A;  2JRI B;  3UF8 A;  1SGH A;  3V6E B;  4J6I A;  1NEK B;  2G9H D;  3T3N A;  1J7A A;  4JGH B;  3D32 A;  1QZE A;  2NS5 A;  4RH6 A;  2WWZ A;  1WSP A;  1XF5 L;  2Q5W D;  1FXA A;  3DVG Y;  4BKG A;  3NZS A;  4HJK A;  2RR9 A;  3H9D A;  3A9K B;  1ACC A;  2LUE A;  3WAL A;  2FCQ A;  2WXK A;  3ML9 A;  1KF6 B;  4MGZ E;  1EUV B;  1Q10 A;  4MSM B;  2LXA A;  3Q6B A;  2V4I B;  4EFO A;  1UBQ A;  4QAY A;  4P16 A;  1QOA A;  2IO1 B;  3H7S A;  2XK5 A;  3KUC B;  2ONQ A;  3LDZ E;  4IWP A;  4HLE A;  3KUZ A;  3O13 A;  3Q8B A;  4B6W A;  1C76 A;  4REZ A;  1TS2 A;  4GDL A;  2M8S A;  4GLS C;  3RNC C;  3UI3 A;  2IGH A;  3Q14 C;  3PRP B;  2ZW1 A;  2KXJ A;  2GBM A;  2AEH A;  1HZ5 A;  4KKJ A;  2MBH A;  3P4Q B;  4BOZ B;  3PO0 A;  4G3X B;  2X38 A;  2FID A;  1KFY B;  3TEX A;  2D10 A;  2BF8 B; 
#chains in the Genus database with same CATH homology
 3AM9 A;  1TKY A;  1GB4 A;  4HKZ E;  3FIL A;  1D5Z C;  1SJH D;  2N9L A;  1D4B A;  2JSV X;  1VDV A;  1SB3 C;  2BBC A;  1VZ6 A;  3MP9 A;  1C4C A;  3R2T A;  1QIL A;  3LB8 C;  4NZL B;  4A90 A;  1FO4 A;  2AX5 A;  3WCQ A;  2QSD A;  3GB1 A;  3RFZ B;  2TSS A;  1SE3 A;  3AE4 B;  4US9 A;  1TS5 A;  1FRD A;  2FBW B;  1QT9 A;  4IDI A;  5HHD G;  1FFV A;  2AQ2 B;  4KGS A;  4NJC A;  3BYT B;  2INN E;  4WUR A;  3DWM A;  1MHH E;  1SEB D;  2N7J A;  2YEP F;  2WU5 B;  1STE A;  1NYR A;  1HZ6 A;  1VZ7 A;  1GPX A;  1CZP A;  1HA5 A;  1XLP A;  2KDM A;  5TSS A;  2GI9 A;  3BII D;  1DOI A;  1P7E A;  3AE8 B;  1C4A A;  2WLB A;  1T5X D;  3HVZ A;  1PGX A;  3IAS 1;  4LK0 M;  2VZK D;  1EU3 A;  3ZJT A;  4OHJ A;  1HQR D;  1RWS A;  1IUE A;  1E9M A;  1GOZ A;  2OHF A;  1HEZ E;  1ZDV A;  5D3D A;  1KLU D;  2WXJ A;  4N59 A;  5EE0 A;  4P6V F;  2LGI A;  1C4P A;  3PZ8 A;  3PZ7 A;  4IKG A;  1NI3 A;  3SFD B;  1YMH E;  2WS3 B;  1SE4 A;  2MJE A;  4N6E B;  2EKI A;  4ARI A;  4FXC A;  3W2D A;  1AW7 A;  2JU6 X;  3ABV B;  3U4E G;  4YSX B;  2DYM A;  3VR8 B;  4KGR A;  3HVD A;  3ETR A;  1XLO A;  3AB5 A;  2LJI A;  2K9X A;  1XLQ A;  1DYQ A;  2WXP A;  3LXF A;  3AMZ A;  2J52 A;  1FRR A;  3AV8 A;  2HDE A;  3FC4 A;  1B9R A;  1D6E C;  4N58 A;  2FUG 1;  2JQR B;  1XCT L;  3NUH B;  3ZJV A;  1FFU A;  4KGT A;  2J4X A;  2ZW0 A;  2BYT A;  2JYE A;  3ZYY X;  2Y5C A;  3TUO A;  4A9A A;  4C56 C;  1GAQ B;  1JAL A;  1ZP0 B;  3W5U B;  2ICI A;  3CWI A;  4RNA A;  1EWC A;  3V3X A;  2H89 B;  2PW9 A;  4CQN A;  1EM7 A;  4OZC A;  1FCL A;  4D2K A;  3KWL A;  1L0V B;  1V1O A;  1XO3 A;  2PTL A;  2BTE A;  3IAM 1;  4HKQ A;  3VRA B;  1YJI A;  2G1E A;  3CIR B;  3B2G A;  3H8H A;  1HXY D;  1QOG A;  4XDC A;  3BVZ A;  2M0A A;  2BS2 B;  1JCK B;  3BZD B;  1IBX B;  2WXN A;  1SJE D;  2M56 B;  3SEB A;  2V3N A;  4TQ0 A;  1ZDX A;  3MJ5 A;  1N60 A;  1TKG A;  2MEK A;  3HRD D;  3AN1 A;  3P1M A;  4TMA B;  5EE3 A;  1C78 A;  1FXI A;  1VJK A;  2M19 A;  4MM3 B;  1TJE A;  1DOY A;  1NYQ A;  3W9C B;  5FR3 A;  4ZRP A;  1E0Z A;  2IPK D;  4EE2 A;  4RCO A;  2W82 A;  1MPE A;  2RDH A;  1ZXI A;  3GS2 A;  2BS3 B;  3N9Y C;  2WDQ B;  1SE2 A;  2WXG A;  5HI1 A;  1YNT E;  2E6X A;  1N63 A;  1XCQ L;  1M4V A;  2H88 B;  1V8C A;  4YXD B;  3J9C A;  1XEE A;  2PVO D;  1I4G A;  3IXS A;  2WDR B;  3AE9 B;  3IT4 B;  3AH7 A;  4KX6 B;  5EE9 A;  1C9F A;  2LEK A;  1K52 A;  3Q69 A;  2EEL A;  1ZXH A;  1IBX A;  3NRZ A;  1NVI D;  2QIE B;  2LMC A;  4GDK B;  4RGT A;  4J3O D;  1L0X B;  4HJG E;  1N5W A;  2I38 A;  3AE7 B;  2WU2 B;  2KWD A;  1GB1 A;  2D5G A;  2SEB D;  3BYY B;  4WH4 A;  5BMH A;  5HFY A;  2WXQ A;  1RFK A;  2WXR A;  2K0P A;  1KLG D;  1L6U A;  3AEA B;  4ARC A;  4RGM A;  2QIL A;  1L0Y B;  3TEW A;  1UUP A;  3MHZ A;  4XDD A;  3U2S C;  4NAM A;  2WXL A;  1I4X A;  3AE6 B;  3E9S A;  1TKE A;  2BS4 B;  3SFE B;  4YSY B;  4JWU C;  5I4D A;  3EA6 A;  2Z8L A;  1TYG B;  3BK2 A;  4LTU A;  4C7Z A;  3U7Z A;  3E56 A;  1PYW D;  1CJE A;  4L1B A;  1XXG A;  4YSZ B;  1L5P A;  3GP7 A;  5G5H A;  5FKA C;  3VQI A;  2KAJ A;  1FNV A;  3P4P B;  3AE1 B;  1F0Z A;  2N9K A;  2QJL A;  2JZP A;  3I9V 1;  2WP9 B;  1TY2 A;  2OED A;  3AE2 B;  3VRB B;  1E7P B;  2RPV A;  4ZOH C;  1JWU D;  2KN4 A;  2JYT A;  4YWG G;  4WIP A;  2K3U A;  1WGK A;  3Q8F A;  1YN4 A;  3VR9 B;  1PGB A;  5HG2 A;  1ET9 A;  3C8Y A;  4B0M A;  1TY0 A;  3NS1 A;  1N61 A;  1ZPS A;  3FAH A;  5EE1 A;  5H8Y E;  4RFB A;  5AUK A;  2KQ4 X;  3BWU D;  1AYF A;  2PIA A;  2HTM E;  3AE5 B;  1D5M C;  4JWS C;  1ZOY B;  3P63 A;  1VZ8 A;  2QEJ C;  3NVW A;  3TSS A;  1A70 A;  2JXT A;  2DLB A;  1J7B A;  3Q8E A;  4AQ7 A;  2BB6 A;  1QOB A;  1WRI A;  1JRP A;  4A8X C;  1ESF A;  4L2Y A;  1I4R A;  1JW9 D;  3AEF B;  3V05 A;  2WXF A;  3OWE B;  5LNK 1;  1SXT A;  2BT6 A;  2IGD A;  1JWA D;  3KQ4 A;  4IOI E;  3NVZ A;  1JWM D;  1QQR A;  2J53 A;  2MH7 A;  2PMV A;  4OW0 A;  1KTK A;  1MHX A;  2NTS A;  3R8B A;  2L1A A;  1VLB A;  1WYG A;  3KWV A;  2WNM A;  2PKO A;  4MT5 A;  1F77 A;  5FK9 C;  3LYY A;  2W55 A;  4YTN B;  5BYQ A;  2WXM A;  1FM0 D;  1JML A;  3DWG C;  4DXG A;  4MH8 A;  2K5P A;  3I57 A;  5C2T B;  4C7Y A;  5T8I A;  1WXQ A;  4UDU C;  3SR6 A;  1ENF A;  2DBY A;  2IDY A;  1FNW A;  1OFF A;  1I4H A;  1XLN A;  1B1Z A;  1OQQ A;  3BK1 A;  4YT0 B;  3AED B;  2INP E;  5E6J A;  1F2R I;  1BXT A;  4DXF A;  1EWY C;  4Q2J A;  5BMI A;  4XWT A;  1JRO A;  1RYJ A;  4AS1 A;  2CJO A;  1DGJ A;  2L52 A;  2R61 A;  3NVV A;  4USA A;  1JQ4 A;  1P7F A;  2WDV B;  2V0G A;  1BML C;  1YJJ A;  2QMT A;  5AUI A;  3ZGZ A;  2B76 B;  4JPS A;  1K53 A;  3RPF C;  1RM6 C;  2WXH A;  4RGN A;  1FEH A;  5BMG A;  1ZUD 2;  4WAF A;  2Y5P A;  2FE8 A;  1C77 A;  1QF6 A;  1YQ4 B;  1I4Q A;  5D3I B;  4WQM A;  2ON8 A;  1CK1 A;  3AE3 B;  1MI0 A;  2Y3A A;  1UWM A;  1I7H A;  1ET6 A;  1K50 A;  3TEY A;  1BUI C;  1WWT A;  4A6Q A;  1ROE A;  5GXG B;  1N5X A;  1VRA B;  4ZRQ A;  2MJD A;  2RMM A;  4L23 A;  1DOX A;  2DWQ A;  4OZB A;  1V97 A;  1FIQ A;  2PLP A;  1N62 A;  5BYR A;  3Q8C A;  3MC0 B;  1F2R C;  1PDX A;  1SSN A;  1SBB B;  1SIJ A;  1YQ3 B;  3P42 A;  1V1P B;  5BYS A;  2L83 A;  1QLB B;  2DYO A;  1QKZ A;  2VZK B;  4ZYS A;  3B2F A;  2WQY B;  2JX5 A;  2GRI A;  5MPO A;  1VR9 A;  4ZHP A;  2MJ3 A;  1SF0 A;  1D5X C;  1UNS A;  1OQR A;  2V3P A;  3L4P A;  4US8 A;  2IGG A;  1IGC A;  2YEP B;  2AQ1 B;  3HUI A;  1L4Z B;  3EGR A;  4OZA A;  2KMM A;  1JWB D;  1FNU A;  2PVG C;  4NAW B;  3ZJU A;  1T3Q A;  1PGA A;  2J42 A;  1EU4 A;  4XE0 A;  1QOF A;  1YN3 A;  4RGO S;  3NZ3 A;  1E6E B;  3W5V B;  4OVZ A;  3R2I A;  4RF1 A;  4R3D A;  4DQO C;  1UGJ A;  2WXO A;  1IGD A;  4TQ1 A;  3IT6 B;  1C79 A;  2W3R A;  3U52 E;  3W1S A;  1TZO A;  1CQV A;  1J7C A;  3EUB 2;  2LFI A;  2LHE A;  4RF0 A;  1V1P A;  1MVK A;  1UWX A;  1FMA D;  4M0W A;  1TS4 A;  1YN5 A;  4KKI A;  4MAC A;  3BVG A;  1Y56 A;  1R7S A;  4JX1 C;  1LO5 D;  1ZE3 D;  3Q8A A;  4XWW A;  1L4D B;  4JE3 B;  1NEK B;  2G9H D;  3T3N A;  1KRH A;  1J7A A;  2W3S A;  4RH6 A;  1KH0 A;  1WSP A;  1XF5 L;  2BW2 A;  2Q5W D;  4GDL B;  1FXA A;  2KAC A;  3P4R B;  4H2A A;  4C80 A;  3B9J A;  1T6B X;  2BB5 A;  3BVM A;  2RDG A;  3T3O A;  4LLG M;  2WXI A;  4ITK A;  4PT5 A;  1AWD A;  4HRO A;  1ACC A;  5C3J B;  3MFG A;  2WXK A;  2GB1 A;  1KF6 B;  1K51 A;  4YTM B;  1Q10 A;  4B0E A;  2V4I B;  3KLS X;  4HEA 1;  1I4P A;  1PFD A;  5D7G A;  4ZHO A;  2I2Y A;  3FIL B;  2L32 A;  4P16 A;  1QOA A;  2N0S B;  2IJ0 A;  3AEG B;  1JWS D;  2XN9 C;  2ACZ B;  3AEE B;  1TS3 A;  1E10 A;  2ONQ A;  1NEN B;  2E3T A;  5JXV A;  3TEZ A;  5H92 C;  3URY A;  2LUM A;  2XNA C;  3O13 A;  3Q8B A;  3ZQ4 A;  1C76 A;  4REZ A;  1TS2 A;  3AEB B;  4GLS C;  5G5G A;  2CJN A;  2JWU A;  1AN8 A;  2SAK A;  3AEC B;  1PUT A;  2LHD A;  3UI3 A;  2IGH A;  2K22 A;  3P4S B;  2CU3 A;  4TSS A;  2ZW1 A;  1L6V A;  1FCC C;  1HZ5 A;  2NMQ A;  2AQ3 B;  4KKJ A;  4HRS A;  3P4Q B;  3PO0 A;  3NVY A;  2X38 A;  1KFY B;  3TEX A;  4O1N A;  2W54 A;  4WWM A;  4YTP B;  4A55 A;  1FD6 A;  2NTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...