1J7BA

Structure of the anabaena ferredoxin mutant e94k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKKEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
molecule tags Electron transport
total genus 26
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7bA00
2WS3B 1E7PB 5GXGB 3AE7B 3P4QB 4ITKA 4P6VF 3AE3B 3NVVA 1PUTA 5C3JB 3WCQA 3EUB2 3AEBB 4IDIA 2G1EA 2BS3B 4C80A 1NVID 2WQYB 4LTUA 5EE0A 2LEKA 5EE1A 2K9XA 3AECB 1ZUD2 1RWSA 1UWMA 1J7AA 3W5VB 3ZYYX 5EE3A 1XLPA 1J7CA 2WU5B 1FRDA 1ZOYB 4JWUC 4ZOHC 3VRBB 4YXDB 1TKEA 1QT9A 1EWYC 3AEAB 4US9A 1NYRA 2DBYA 2ACZB 4YTNB 1FO4A 4YTPB 1AWDA 2PKOA 2L52A 4USAA 3VRAB 3AH7A 3HUIA 1F0ZA 3NVYA 1YJIA 3W5UB 2HTME 1OFFA 1VDVA 4YT0B 1ZXIA 2K5PA 4US8A 2PIAA 5MPOA 2WP9B 3P4SB 4WWMA 3NS1A 1AYFA 4FXCA 1XLQA 4HROA 1JWAD 2W3RA 3AEGB 4ZHOA 4HRSA 2AX5A 2QIEB 4C7YA 3CWIA 4WQMA 2OHFA 1FFVA 1KF6B 2CJNA 1FIQA 3FAHA 2JX5A 2Q5WD 1E9MA 2EKIA 1JALA 5H8YE 4ZHPA 2MH7A 1L6UA 1WYGA 3SR6A 1TYGB 1I7HA 3P4PB 2W55A 1L6VA 1PDXA 1JROA 3AN1A 2KAJA 1CZPA 2PVGC 1FXAA 2JQRB 2KMMA 3P63A 1QOGA 1KRHA 3PO0A 1WGKA 4JX1C 3SFDB 4YSZB 4YTMB 3KWLA 1XLOA 3BIID 1L0VB 3CIRB 3HVZA 1E0ZA 2Y5CA 2B76B 3NRZA 1DOYA 5G5GA 1NEKB 2FBWB 5C2TB 1FRRA 3B9JA 1A70A 1E6EB 2E3TA 1GPXA 4YSYB 1N60A 3ETRA 2N0SB 1NENB 4JWSC 4KX6B 3RPFC 1J7BA 2MJEA 2WLBA 1XO3A 1N5WA 1V97A 3VR8B 3B2FA 1QF6A 4N58A 1DOXA 3ABVB 3AM9A 1N5XA 1QOAA 1QLBB 2H88B 1R7SA 1XLNA 2K22A 1YQ3B 3AE2B 1PFDA 3AE5B 2BS4B 3AE4B 1YJJA 1OQQA 2W3SA 1ROEA 1SF0A 2WDRB 1JWBD 5G5HA 2M56B 3AV8A 3FC4A 1T3QA 1TJEA 1GAQB 2H89B 2CJOA 1ZP0B 3HRDD 3AMZA 1N62A 1YQ4B 3W9CB 1L5PA 1TKYA 2MJ3A 1V8CA 2WDVB 1JW9D 3AE1B 1WWTA 3AEFB 2CU3A 3DWGC 1DOIA 1FXIA 1KFYB 1OQRA 1SIJA 2DWQA 3NVZA 3P4RB 3AE8B 2PVOD 3VR9B 4YSXB 3AEEB 1RFKA 2M19A 1JQ4A 1VJKA 1RYJA 1FM0D 2BT6A 1E10A 1JRPA 3SFEB 2W54A 1N61A 3AEDB 3NVWA 3B2GA 4N6EB 1IUEA 1VLBA 1N63A 3LB8C 3L4PA 2WDQB 1WXQA 1QOFA 2L83A 3AE6B 1NI3A 1FMAD 5H92C 1QOBA 3LXFA 1SB3C 3AB5A 4A9AA 5EE9A 1WRIA 3AE9B 1B9RA 1FFUA 2QJLA 2BS2B 2WU2B 4N59A 3P1MA 1CJEA 1DGJA 1NYQA 1TKGA 5AUKA 4C7ZA 3DWMA 5AUIA 1RM6C 2MJDA
chains in the Genus database with same CATH superfamily
2WS3B 2VH2A 4HKZE 1KLGD 3QWZB 2LGXA 2BS3B 4XDCA 5LXIB 2ASQA 3R2IA 1QQRA 5CTRC 1J7AA 2IZVB 1I4RA 1EWYC 4US9A 1TS3A 5JZEB 1YQBA 2LWPA 2LVPA 4RMAA 3IAM1 4FN2A 2DAJA 2DZIA 3AI5A 2O6VB 1ZXIA 2FUG1 2J0JA 2KN4A 2K6DB 2KWUB 1WXVA 4FXCA 2LASA 4HDQA 3QC8B 5FK9C 3AEGB 3L54A 1EO6A 1GOZA 4XE0A 4JLCA 1B1ZA 4EEWA 3PZ8A 3KUZA 4DHZB 4IM3A 3RNAC 3TEYA 1K52A 4IW0A 1ZPSA 3QCAA 1I7HA 3P4PB 3WALA 5LNK1 4HCPB 1EUVB 1R4NB 3H7PA 3N9YC 3MC0B 4J3OD 1FXTB 2KACA 1N60A 3APFA 4MELA 4CO7A 2IO1B 1NI2A 2DAFA 2PTLA 3KUCB 2GI9A 1QLBB 3RNEC 2K22A 5TR5A 3AE2B 4BOZB 1PFDA 4MEMA 4LNIA 2GBMA 3PRPB 2LUMA 4BOSC 3TEXA 4EFOA 2NBVB 3AEFB 3N1ZC 1V8CA 1SGHA 5IP4D 3P4RB 2NTTA 4XGAB 5BYRA 1RFKA 1IYFA 3UF8A 2AYOB 1F2RC 1VZ6A 3NVWA 3RUIB 4K81A 2HD5B 3QIJA 3P2BA 5E6JA 2NR2A 5IOIA 2KDBA 3IFWB 4W9CA 2WU2B 5HKHA 2CR5A 2WXIA 4P1BC 3AE3B 4K1RB 5C3JB 1GG3A 2AWTA 5EE1A 4ZRKA 2N1VA 2AQ1B 2Y5PA 3PZ7A 4JWUC 4ANVA 3GB1A 3RNCC 4KGRA 4BVUC 1P9DU 4LJPB 4D2KA 1WXSA 1OFFA 3Q8EA 2RMMA 2BB5A 3P4SB 1VD2A 1M94A 1CMXB 4HROA 3I63C 1MHXA 4MH0E 4EUTA 4MACA 3A4RA 3L16A 3IBEA 1EU3A 3FKYA 3DDCB 3SR6A 1HXYD 2WGSA 2KHWB 3Q69A 4HJGE 5CHFA 4C00A 3PO0A 2V3PA 3E56A 3BIID 1L0VB 1WGHA 2Z0DB 4KKIA 3R66C 2JZ3B 3ETRA 1V49A 4JWSC 3Q14C 3RT3B 4K3BA 4PS3A 4GN1A 3AM9A 4K7SA 3WANA 1R7SA 1XLNA 3AU4A 1YJJA 3PVLA 4WWNA 1TJEA 4KIKB 3HIZA 2IPKD 5BYQA 1KOTA 4P16A 4ZRQA 1DOIA 3V60A 3AE8B 2ZW1A 1RYJA 3NUHB 4EZLA 2L0TA 2BWES 3SHQA 1KLUD 1WSPA 2BVCA 3KLSX 3Q6BA 2FIFA 4HPMB 4NJCA 1SSNA 1SE9A 1EU4A 2DNFA 2D11A 3PS6A 3EUB2 4IDIA 5HHDG 2DZKA 2K9XA 2W82A 3ZYYX 3PSEB 5BMHA 3VRBB 2KDMA 2K8BA 1NYRA 4W9EA 1YJIA 4YT0B 3ZVVA 2K5PA 2PIAA 3ZTDA 4OZAA 2N9XA 2D5GA 4C7YA 3APCA 1ET6A 3V6EB 1STEA 4M00A 2O2VB 1LFDA 5CX3A 5E6OA 3TJPA 5FKAC 2KAJA 2LVOA 2JY6A 2PVGC 1FXAA 4GDKB 3BVZA 1E0ZA 4C56C 2GBRA 2AQ2B 4FBJB 4KX6B 3ZNID 1UWXA 1IPGA 2J7QB 2KFJA 2WDRB 1TS4A 5EDSA 4G50A 1MJDA 3WA0A 2D3AA 2IY1B 1WR6E 1V1PB 3U52E 3MJ5A 2KTFA 2RDHA 3NVZA 2ZEQA 3VR9B 4W9GA 1V6EA 2N7DA 4MGZE 4JPSA 1FM0D 1GB1A 1T0RC 2BT6A 2W54A 4A20A 3B2GA 2DENB 2MEKA 2JUOA 2OJRA 2RGFA 1SB3C 1ZDXA 2V1YA 3RNBC 3TUOA 4M8NA 4P6VF 3RZFA 1DYQA 3AEBB 3W2DA 1Z2MA 2LEKA 5D2MB 3HHMA 2KX0A 1XEEA 1XLPA 4DBGA 4E74A 3BK1A 3PHWB 3HVDA 4E3CA 2M8SA 2C7MB 1YN5A 1E8XA 2LJIA 1TT5B 4JL9A 4DK5A 4XZ4A 1I4HA 4Q2JA 1T0SC 1HA5A 4MGYE 3RNGC 2XNAC 4A8XC 1I4GA 2JX5A 1YX6B 2I1KA 3A4SC 2GRIA 2JQRB 3SFDB 1WGKA 3NRZA 3EHVA 3AU5A 3B9JA 4HCNB 1SXTA 3R2TA 3ZTCA 4P1CC 1WF9A 1XD3B 3PV1A 1WJ6A 4RGNA 2D3CA 2UYZB 1YQ3B 4MJSA 1KLVA 4WIPA 4NJ6A 2JYTA 2WHIA 1JWBD 2JWUA 1P1AA 1T3QA 2N1WA 3VUWA 4HPLB 4LJOB 2WYQA 1V1OA 3AMZA 1TKYA 1K51A 2CU3A 1IGDA 5KHOA 1C4PA 1G6JA 3OJ3A 3EFUA 3SU8X 1JRPA 3RD2A 1N61A 5FR3A 3L4PA 3M62B 4TQ0A 2L8JA 5C1ZA 2GBNA 1WRIA 3VHTC 3I3TB 1WE6A 3HK0A 4RF0A 4LNNA 3Q8FA 2V3NA 1E8ZA 2QILA 2A5UA 3DBLB 2MBEA 3IXSA 2L05A 2NCNA 4KDIC 5LLIA 1AW7A 2WU5B 4AJYB 1MG4A 1TKEA 1WH3A 4A90A 1FO4A 2KLGA 1AWDA 4USAA 2Z8LA 3JVZX 3HUIA 2M0XA 2YVCA 3QAQA 3JYUA 2WP9B 3MTNB 2LZ6A 2MX2A 3X23A 1ZGUB 2AX5A 1H4RA 3RI7C 4DHJD 2JF5A 1KF6B 3TBLD 1UGMA 1YN4A 1JALA 3O65B 3VDZA 1L6VA 2D3BA 2INDC 1T6BX 1ISNA 4M8MA 3V6CB 2IDYA 4W9FA 4HPPA 2JRIB 5D7GA 3EGRA 3ZJVA 2DX5B 4LLGM 1N5WA 4N9F4 3U7ZA 4HVBA 5IA7A 4AQ7A 1WYWB 3DVGY 4BKGA 3AV8A 5E6PA 2EKEC 3UGBB 1D4BA 2LHEA 1FNUA 2L7RA 4JQWC 2JXXA 3BZDB 1C79A 1WZ0A 1WGYA 4PYUA 4EOYA 2GLSA 1N6ZA 1N63A 2KWDA 3AE6B 1NI3A 2WXNA 4A9AA 3A9KA 3L10B 1TTNA 3VH3B 1CJEA 4HKQA 1TKGA 1MI0A 4DXAB 3DWMA 4B95A 1RM6C 2WLBA 3QK0A 4IWQA 3VTUA 2EELA 2NS5A 1SJHD 2PE9A 3OAWA 3WCQA 4F1SA 2KOXA 2HTHA 1YJ1A 2V4IB 5EE0A 3ZJTA 2INCC 3W5VB 3N1XC 2Y5BB 4RM9A 2ON8A 3OWEB 1UBQA 3NZSA 2G45B 3T3NA 4B9KA 2AL6A 1PGXA 2L00B 3RNFC 4RGOS 3NHEB 2X38A 4LCDE 4HRSA 3CWIA 2ZPYA 3DBRB 2CHXA 1VZ7A 2PJHA 1BUIC 4HLEA 2RR9A 3L17A 3MJWA 2NPTA 4LNOA 3ZW3A 1SEBD 1QOGA 1J0GA 2LGSA 4OVUA 1TZOA 4O1NA 5G5GA 4PS7A 3VTWA 1WJUA 1J7BA 3Q8BA 2FCQA 1QOAA 2WX1A 2LFIA 4KSKC 4PK1A 2XBBC 4IOIE 5G5HA 3DBLI 3DHHC 2CJOA 1AN8A 2YEPF 1V5TA 2MJ3A 4YTMB 1WWTA 3LJ3A 1MG8A 3MP9A 4L2YA 1I4PA 3AULA 4KZCA 2BQQA 4NAWA 1VLBA 1L0XB 1WXQA 2HDEA 1FMAD 2N7EA 2ZW0A 1B9RA 1WGGA 3KQ4A 1ZXHA 3GE3C 3ZNZB 2R2OA 2KNBA 1WZ3A 1C4AA 5G2NA 3WAPA 5KHQA 4MH8A 3PLUA 1I35A 1GC6A 3NS8A 3ZJUA 2WXFA 4H2AA 4FULA 2GB1A 2MW5A 4YTNB 3V3XA 2LXCA 3PRZA 1KM7A 5JHAA 1OEYJ 2HTME 2LRWA 4DHJB 2IY0B 4OVZA 2KTRB 1JWAD 4M0WA 4WJOA 1SIFA 3A1QA 2CJNA 2VZKD 3DVNV 4JGHB 5BO4B 2C5LC 3OG5A 5H8YE 4MM3A 2RD0A 1VR9A 2L76A 1T0QC 1UH6A 1JROA 2REXA 1R4MI 2IJ0A 4DQOC 3URYA 1F9JA 3RN9C 2B76B 2JRHA 3PT2B 4GMVA 2FUHB 2KXJA 1V97A 4FHKA 3O13A 4IC7B 2UU7A 2DZMA 5JH5C 3W9CB 2BKRB 3LDZE 4ITKA 3NVVA 3ZRCA 2WXOA 3KYCD 1KFYB 2SAKA 2HJ8A 3IVFA 3OLMD 3AEEB 3UI3A 1YMHE 3Q3JA 3LYYA 4HJKA 1HZ6A 3Q3MC 4W9JA 2L1AA 2BBCA 4GLSC 2KT7A 5EE9A 3M3JA 3R8BA 2QJLA 2BS2B 4DHZE 4QAYA 2ONQA 4MJSB 1WX8A 3DBRI 1XF5L 2QHOA 4A6QA 4B0EA 3BVMA 2LI5A 3AECB 2D10A 2BPSA 3U7DA 1SE4A 3U30A 2WXLA 3FILA 4XC2A 1BXTA 2V3SA 2KQ4X 3W5UB 2PMVA 1ET9A 1UNSA 1WE7A 3B08A 2KVZA 2QDFA 4W9DA 3TL5A 1QKZA 2HE7A 4ICVA 1GUAB 2FCMA 3VFKA 1L6UA 2JZPA 1R4NI 2DZJA 2MA9B 1KJTA 2KD0A 3BK2A 3NY5A 1PGBA 1NENB 1DOXA 4WAFA 2V4LA 3P4QB 1L0YB 1OQQA 3PZDA 3H1UA 4B0MA 5BMGA 2M56B 3P42A 4FJZA 1GAQB 3ZDMC 1RLFA 4ANWA 2ZCBA 2WDVB 1J19A 2ZPNA 1SIJA 2I38A 2C7NB 4YSXB 4UDUC 2J0MA 2JU6X 1IBXA 2K8CA 1I42A 4MSQB 4TUUA 3SD5A 3W1SA 1JWMD 2WDQB 4A55A 5DCNA 1T5XD 2MWSB 1EM7A 3ZKJC 4C7ZA 3AXCA 4AS1A 5AUIA 5G55A 3T8MA 2R2QA 5DPTA 1PUTA 1KH0A 1FNWA 1BMLC 2JYEA 4DXGA 2I2YA 1Z5SB 3EC8A 4RGMA 1TS2A 1I4XA 2DYOA 3ZLZA 2K25A 2Z59B 1S3SG 2MBOA 4HWIB 4L23A 1F77A 4WWOA 1F0ZA 1MPEA 1K8RB 2KLCA 2KTRA 1H8CA 3A9KB 4ANXA 3N1YC 1V5OA 1D6EC 1AYFA 5IN7A 2VZKB 4BKSD 2JPHA 4ZYNA 3UIPB 2G3QB 3BY4B 3IT6B 2QMTA 4C4VB 1FFVA 3CSTA 2EKIA 2N4FA 3SEBA 4AWJA 2KDIA 2LJ5A 4HEA1 4I6LB 1WYGA 5DPRA 1Q0WB 2N9KA 4BKTA 3ZXRA 2XK5A 2B3AA 2LGDA 2KMMA 2INNE 4NPNA 5D6JB 1K50A 1NEKB 4JIOU 1E6EB 1V86A 3M95A 3SDLC 3NZUA 5BMIA 2Y3AA 4WH4A 4ZRIA 4N58A 1WFYA 2H88B 3L08A 1S1QB 3W1YA 3DPDA 1E7VA 1Q5WB 1UZXB 4TQ1A 1Q1OA 4ICUA 1VCBA 1ZKHA 2JT4B 2JZZA 2NPTB 1WI0A 4ASWC 1YIWA 1P7EA 1MFWA 1E8WA 1VJKA 2RPVA 4DWFA 4DXFA 2ICIA 5C23A 4FLHA 4XWWA 1FEHA 4S0RA 1TIFA 2K1FA 2IGHA 2YLMA 4WJQA 4BBNF 1NYQA 4XDDA 3C19A 2C7HA 4ZRJA 4L1BA 5GXGB 4WWPA 5I4DA 2KQ7A 1QZEA 1ACCA 5DPSA 3U8ZA 2BYFA 4DDID 2WXGA 2O6VD 4M02A 4AOFA 1D5XC 1Q10A 3IHPC 2K8HA 3DQVA 1IGCA 1TZ1A 3BVGA 4G0NB 2QSDA 3Q3FA 2J0KA 1ZOYB 4ZOHC 1SJED 1ZE3D 4NAWB 1HZ5A 4YTPB 3H9DA 4LNFA 1OQYA 2ZVNA 1E7UA 2FNJB 2DYBA 2WWZA 3N30A 1OEYA 2NBWB 4F8CB 3PREA 3EFCA 3JSVA 4ZHOA 1VZ8A 2MQJA 4II3B 3D32A 3DCGA 2KMAA 1M4VA 2FCSA 3FAHA 4KGSA 2MH7A 4IG7B 2W55A 2MHJA 3W1SC 3ENEA 4ZDVA 2IO3B 2KANA 3P63A 1E8YA 2PW9A 2Y5CA 3Q2AC 4NJ7A 1RAXA 1A70A 2WX0A 2BYEA 1GNUA 3B2FA 3QA8A 3E9SA 4G3XB 1OGWA 4M0WB 4AJWA 4TV3A 4IWPA 3A1QB 2V9HA 3MHSD 3DHGC 2NTSA 1WRDB 4MM3B 1XXGA 2KN5A 3VH4B 1JW9D 1GC7A 2RDBC 2PVOD 2MP2A 2QEJC 1E5WA 1T0YA 4JE3B 4HDOA 2BGFA 3AEDB 2M1MA 3V61A 3TMPB 3WAMA 3Q3NC 1NDDA 5H92C 3N32A 2OEDA 3EA6A 3QQ8B 4GDLA 3PRMB 4MT5A 4MGIE 2KQSA 3APDA 1E7PB 4TSSA 2M17A 4BZAA 1JWUD 3ONSA 2WXRA 2AEHA 3CMMB 5EE3A 3KWVA 1QT9A 2IBIB 3AEAB 2DBYA 5J2RA 1TS5A 5AZHA 2JWZA 2LMCA 2DLBA 3GZNB 2RSUA 1TBEA 4C4VA 1FCCC 4LK0M 2J42A 2OHFA 4LDTD 2J52A 2G9HD 1L4DB 3DVNU 3QARA 4K7WA 4A3PA 1KRHA 3BWUD 1XLOA 3HVZA 3CIRB 1X1MA 2KJ6A 3FILB 2MRPA 1L4ZB 2OOBB 3RPFC 2X8XX 2MJEA 2JSVX 1WIAA 2BW2A 3H8HA 1YN3A 4MSMB 1YOVB 3K9PB 1P0RA 4M01A 3MHZA 1N62A 1BT0A 2I1JA 1OTRB 1IP9A 4HK2A 1RRBA 1SBBB 5IAAC 1IUEA 4S17A 2JVCA 3T9LA 5HFYA 3BYTB 4NZLB 4RF1A 2MSED 2MJDA 1SE2A 2RDGA 2K3UA 3I5JC 3J9CA 3VQIA 3A9JA 2HJ1A 2WXKA 3V05A 3ALBA 1E90A 1WJNA 2G1EA 2KWCA 2MLBA 2WXHA 4WAAA 2E6XA 3C0RB 1LO5D 4EKUA 2K6QA 3GP7A 1HQRD 1J7CA 1WXMA 4CHKA 2R61A 2FE8A 4FADA 2ACZB 3KUDB 1IBXB 4P7IA 2PKOA 1YX5B 2KC1A 4RNAA 5TSSA 3NVYA 4YWGG 5CHVC 3DBSA 4US8A 1WX9A 3NG0A 2G4SA 4WQOB 5D3IB 4TMAB 3H7SA 4R3DA 1UGJA 2PEAA 3VUXA 1E9MA 2KK8A 4W9KA 4AUQC 4KZ0A 1TYGB 1CZPA 3NJTA 1LM8B 3TSSA 1DOYA 1WMHA 1FRRA 3GOEA 4YSYB 5IKCM 1EF5A 4GB9A 2Z0EB 3B1LX 3N20C 4YL8A 4HXDA 1FNVA 3R3MA 1UF0A 2BS4B 4AP4C 2VRRB 1C4CA 2H89B 4NNJB 4REZA 2PPHA 5FR6A 2KJRA 3DWGC 2DWQA 1A5RA 2KZRA 4IUMB 1HEZE 4K7UA 4OW0A 2XK5B 2CHZA 3LB8C 3M63B 4NAMA 5D94A 2VH1A 3GZNI 3S2AA 3UQAA 2FAZA 4MDKE 3KH0A 1GJZA 1WXAA 3PTFC 2M4NA 4PT5A 2BYVE 3ZNHB 4C80A 3U2SC 3WAOA 1PGAA 1UWMA 1C77A 1JRUA 1WX7A 2BKFA 3DHIC 4II2B 2D2QA 4YXDB 3V62A 4BKSA 1ZDVA 1EF1A 2EMTA 1MVKA 4OZBA 4PS8A 5AEKB 4W9IA 4ZRPA 4RCOA 3RYTA 1VDVA 2KJHB 3RMKC 2ZVOA 3ECIA 2W3RA 5E6NA 4LDTB 3KYDD 2YEPB 2K39A 3PLVA 4CQNA 4RGTA 1P98A 3RZWC 1WM3A 3KW5B 4JX1C 3R7RA 2ZNVC 4YSZB 2KDEB 5GMVA 2FBWB 2MBHA 3GE8C 1GPXA 2E3TA 4GOCA 3BINA 3TIXA 4RFBA 5CHWA 3QX1A 4DDGD 1YNTE 3AE5B 2WXQA 2EMSA 2J53A 3AE4B 3JSVB 3X0WA 1SF0A 3ZRFA 4FJVB 3VVWB 2CHWA 3U4EG 2N7JA 2KFKB 3AE1B 4IM0A 4WWMA 4A3OA 2N9EB 4IWOA 2LXAA 4LNKA 2D07B 4N6EB 4NQKE 2QC8A 1XT9B 2O6VA 3Q8AA 2GMIC 2KVRA 1XQQA 2FIDA 3HM6X 5HG2A 2FCNA 2INPE 1QILA 4GIVA 5AUKA 2BYTA 2GOWA 2KKCA 4GSWA 4NY0A 4BFRA 4KSLC 1P3QU 2N9PC 4XYCA 3MC9A 1NVID 3QJZA 4LTUA 3T3OA 1TGZB 1ZUD2 1PQSA 4GU2A 1RWSA 3TEWA 1XCQL 2MP2B 4PYZA 1F52A 2WNMA 1HTQA 4I6NB 2L32A 3Q3OC 3NZ3A 2V0GA 2DYMA 2PE6B 4GDLB 3RCZA 2KO3A 1V9JA 4OZCA 2L3ZA 4KV2A 3TEZA 1HTOA 5HI1A 1C78A 1FD6A 2AQ3B 3DBHB 2Q5WD 2NVUI 4G11A 4EE2A 3L13A 2ZJDA 1I4QA 4MGKE 3R7QA 1PDXA 2J4XA 2KX3A 5D3DA 3ZIMA 3GS2A 4F7ZA 1LXDA 3K9OB 2C9WB 2KWVB 3L0WB 3NOBA 1FCLA 1KTKA 1U4AA 2SEBD 4GGQA 2OJWA 1NBFC 1XO3A 3ABVB 1N5XA 4WJNA 3VUYA 1Y8RC 3EECA 2W3SA 4W9LA 1UUPA 5L83A 2JXTA 3FC4A 2IO2B 3IG3A 3CSFA 3HRDD 4KKJA 1YQ4B 1L5PA 1MHHE 4E71A 1OQRA 2MCNB 1JQ4A 2M19A 3A33B 3I9V1 3N3KB 2QCZA 1E10A 1XCTL 3HM3A 4TKNA 4BBNC 2LVQA 2BF8B 3H6NA 4ARIA 4CYEA 3AE9B 3PPAA 4OHJA 4ACFA 4N59A 3P1MA 1DGJA 1UELA 2IO0B 1F1HA 3MFGA 2L0FA 4ZYSA 2WXPA 2WXJA 2WQYB 1GB4A 3JW0X 1TY0A 4BAXA 2G4DB 2PLPA 4NQLB 1L7YA 4OVVA 3ZO5B 1D3ZA 1L2NA 1RFAA 1ZW7A 1VRAB 4IKGA 2C60A 4GXBA 2ZNVB 1K53A 4KGTA 1C76A 3VTVA 1WJ4A 1D5ZC 3PHXB 1WGDA 1XLQA 2WDTB 1Y56A 1CQVA 3A9JB 1UD7A 2QIEB 2XN9C 3DVGX 2CU1A 3IT4B 2KDFB 4KIKA 3RFZB 5DPWA 3ML9A 1FIQA 3ZQ4A 3UINB 4ZHPA 5AZFA 1JCKB 2N9LA 5J17A 3B0AA 3AN1A 4XX5A 2ZZPB 2WXMA 2LUEA 4FJYA 3ZDTA 3ZNGC 4XWTA 3QHTA 3UIOB 2LGYA 1AARA 2N0SB 3VAWA 3H7PB 1FPYA 2A4ZA 1WY8A 5LXHA 1SE3A 3IAS1 1LQBA 2D3GA 3VXWA 4RH6A 2GBJA 2KFKA 1J8CA 4B6WA 2NBUA 1ESFA 1ZP0B 1CK1A 1FXIA 3ZUNA 3UQBA 3ZXVA 3CF6E 2GBKA 1D5MC 4ARCA 1WMHB 3TCAA 4K3CA 1QOFA 1QOBA 3ZGZA 3KVFB 1FFUA 2RPQA 1LGRA 1F2RI 2BTEA 2M0AA 2MBQA 1P7FA 3AE7B 4I6PA 3DBHI 5L95C 1HE8A 3Q8CA 2O2VA 5JHBA 2IYDB 1YD8U 1C9FA 4WJPA 1V81A 1FRDA 3BYYB 1WM2A 4GDKA 1PYWD 2AL3A 4IM2A 5IO9A 2L52A 2LRUA 1ENFA 4FHJA 3VRAB 5JXVA 1V2YA 3AH7A 3OJ4B 3C8YA 5MPOA 4W9HA 1EWCA 5AZGA 4EZJA 2ZCCA 2DHZA 2CKHB 2W9NA 1JWSD 3NS1A 5J18A 2K0PA 4URKA 4FA6A 4WQMA 4X57B 1UBIA 3I57A 4KVGB 1V1PA 1TY2A 2UWQA 2NMQA 1JMLA 2KC2A 2KYWA 2LD9A 1C3TA 3KWLA 2BWFA 4WURA 5C2TB 3ML8A 3PGEA 2BB6A 1R4MB 4RM8A 3DOWA 4EZKA 4J6IA 2MBBB 1WGRA 3MC8A 3VR8B 1QF6A 5T8IA 1ROEA 2LGIA 1V80A 3WIMA 1WR1A 1C1YB 2TSSA 4ANUA 2IGDA 2IGGA 5BYSA 2LHDA 3SFEB 4KDLB 2CS4A 2L83A 2XEWA 3LXFA 3AB5A 2KMCA 3RULA
chains in the Genus database with same CATH topology
2WS3B 4HKZE 1KLGD 2QILA 1PUTA 1KH0A 4PT5A 1FNWA 2BS3B 4C80A 1BMLC 2JYEA 4DXGA 2I2YA 3U2SC 4XDCA 3IXSA 3R2IA 4RGMA 1QQRA 1PGAA 1TS2A 1I4XA 2DYOA 1UWMA 1C77A 1J7AA 1AW7A 1I4RA 2WU5B 4YXDB 1TKEA 1EWYC 4US9A 1TS3A 1ZDVA 4A90A 1FO4A 1AWDA 4L23A 3IAM1 1MVKA 4OZBA 4USAA 1F77A 2Z8LA 3HUIA 1F0ZA 1MPEA 4ZRPA 4RCOA 1VDVA 1ZXIA 2FUG1 2KN4A 2WP9B 1D6EC 4FXCA 1AYFA 2VZKB 2W3RA 5FK9C 3AEGB 1GOZA 2AX5A 3IT6B 4XE0A 2QMTA 2YEPB 1B1ZA 1FFVA 1KF6B 3PZ8A 1YN4A 2EKIA 3SEBA 1JALA 3TEYA 4CQNA 1K52A 4HEA1 4RGTA 1WYGA 1ZPSA 2N9KA 1I7HA 3P4PB 1L6VA 5LNK1 1T6BX 2KMMA 4JX1C 2INNE 4YSZB 1K50A 2IDYA 1NEKB 2FBWB 3N9YC 3MC0B 1E6EB 4J3OD 2E3TA 1GPXA 5D7GA 2KACA 1N60A 3EGRA 5BMIA 3ZJVA 4LLGM 2Y3AA 1N5WA 4RFBA 4WH4A 2PTLA 4N58A 3U7ZA 4AQ7A 2GI9A 1QLBB 1YNTE 2H88B 2K22A 3AE5B 2WXQA 3AE2B 1PFDA 2J53A 3AE4B 1SF0A 3AV8A 2LUMA 4TQ1A 1D4BA 3TEXA 2LHEA 3U4EG 1FNUA 2N7JA 3AEFB 1V8CA 3AE1B 3P4RB 4WWMA 2NTTA 3BZDB 1C79A 5BYRA 1P7EA 1RFKA 1VJKA 2RPVA 4DXFA 2ICIA 1F2RC 4N6EB 1VZ6A 3NVWA 4XWWA 1FEHA 1N63A 2KWDA 3AE6B 1NI3A 2WXNA 3Q8AA 2IGHA 5E6JA 4A9AA 5HG2A 2WU2B 2INPE 1QILA 1CJEA 1NYQA 1TKGA 1MI0A 4XDDA 5AUKA 4HKQA 3DWMA 2BYTA 1RM6C 2WLBA 4L1BA 5GXGB 2WXIA 2EELA 5I4DA 1SJHD 1ACCA 3AE3B 5C3JB 3WCQA 2WXGA 1NVID 2V4IB 4LTUA 5EE0A 5EE1A 3T3OA 1D5XC 1Q10A 3ZJTA 1ZUD2 1RWSA 1IGCA 3TEWA 3BVGA 3W5VB 1XCQL 2QSDA 2ON8A 2AQ1B 1ZOYB 2Y5PA 3PZ7A 4JWUC 4ZOHC 3GB1A 2WNMA 3OWEB 4KGRA 1SJED 1ZE3D 2L32A 4NAWB 1HZ5A 4YTPB 4D2KA 3T3NA 3NZ3A 1OFFA 1PGXA 3Q8EA 2RMMA 2V0GA 4RGOS 2BB5A 3P4SB 2DYMA 4GDLB 4OZCA 4HROA 1MHXA 2X38A 3TEZA 4ZHOA 4HRSA 4MACA 1VZ8A 5HI1A 3CWIA 1C78A 1M4VA 1FD6A 2AQ3B 3FAHA 1VZ7A 2Q5WD 4KGSA 1BUIC 4EE2A 1EU3A 2MH7A 3SR6A 1I4QA 1HXYD 2W55A 1PDXA 2J4XA 3Q69A 4HJGE 5D3DA 3GS2A 1SEBD 3P63A 1QOGA 3PO0A 2PW9A 2V3PA 3E56A 3BIID 1L0VB 2Y5CA 1TZOA 4O1NA 5G5GA 4KKIA 1FCLA 1A70A 1KTKA 3ETRA 2SEBD 4JWSC 1J7BA 1XO3A 3Q8BA 3B2FA 3ABVB 3AM9A 1N5XA 1QOAA 1R7SA 1XLNA 2LFIA 3E9SA 1YJJA 2W3SA 1UUPA 4IOIE 5G5HA 2JXTA 3FC4A 1TJEA 2CJOA 1AN8A 2IPKD 5BYQA 2YEPF 3HRDD 4KKJA 2NTSA 4P16A 1YQ4B 1L5PA 1MHHE 1XXGA 2MJ3A 4MM3B 1JW9D 4ZRQA 1WWTA 4YTMB 1DOIA 1OQRA 3AE8B 2PVOD 2QEJC 2ZW1A 3MP9A 1JQ4A 2M19A 4L2YA 1I4PA 1RYJA 3I9V1 3NUHB 4JE3B 1E10A 1XCTL 3AEDB 1VLBA 1KLUD 1L0XB 1WSPA 3KLSX 1WXQA 2HDEA 1FMAD 5H92C 4ARIA 2ZW0A 2OEDA 3AE9B 4OHJA 1B9RA 3EA6A 4N59A 3KQ4A 3P1MA 1DGJA 4MT5A 4NJCA 1SSNA 1ZXHA 1EU4A 1E7PB 3MFGA 4TSSA 3EUB2 4ZYSA 1C4AA 2WXPA 4IDIA 5HHDG 2WXJA 2WQYB 1JWUD 1GB4A 2K9XA 4MH8A 2W82A 1TY0A 2WXRA 3ZYYX 5EE3A 3ZJUA 2WXFA 4H2AA 2PLPA 5BMHA 3KWVA 3VRBB 2KDMA 1QT9A 3AEAB 2GB1A 1NYRA 1VRAB 2DBYA 4YTNB 3V3XA 1TS5A 4IKGA 2LMCA 1YJIA 1K53A 2DLBA 2HTME 4KGTA 4YT0B 1C76A 2K5PA 2PIAA 1D5ZC 4OVZA 1XLQA 1JWAD 1Y56A 1CQVA 4M0WA 4OZAA 1FCCC 2D5GA 2QIEB 2XN9C 4LK0M 4C7YA 2J42A 2OHFA 3IT4B 1ET6A 3RFZB 1STEA 2CJNA 1FIQA 2VZKD 3ZQ4A 5H8YE 4ZHPA 2J52A 1JCKB 1VR9A 2G9HD 1L4DB 2N9LA 5FKAC 1JROA 3AN1A 2KAJA 2PVGC 1FXAA 2WXMA 2IJ0A 4GDKB 1KRHA 4DQOC 3URYA 3BVZA 3BWUD 1XLOA 3HVZA 1E0ZA 3CIRB 3FILB 2B76B 4XWTA 4C56C 2AQ2B 1L4ZB 2N0SB 3RPFC 4KX6B 2MJEA 2JSVX 1UWXA 1V97A 2BW2A 1SE3A 3IAS1 3O13A 3H8HA 1YN3A 2WDRB 4RH6A 1TS4A 1ESFA 3MHZA 1ZP0B 1N62A 3W9CB 1V1PB 1CK1A 3NVVA 4ITKA 3MJ5A 2RDHA 3U52E 2WXOA 3NVZA 1FXIA 1KFYB 2SAKA 3VR9B 3AEEB 3UI3A 4JPSA 1FM0D 1YMHE 2BT6A 1GB1A 3LYYA 1SBBB 2W54A 3B2GA 1HZ6A 1IUEA 1D5MC 4ARCA 2MEKA 2L1AA 2BBCA 1QOFA 4GLSC 1QOBA 3ZGZA 1SB3C 5EE9A 5HFYA 3R8BA 3BYTB 1FFUA 4NZLB 1ZDXA 2BS2B 2QJLA 4RF1A 1F2RI 3TUOA 2ONQA 2BTEA 2M0AA 2MJDA 1SE2A 2RDGA 2K3UA 1P7FA 3J9CA 3VQIA 3AE7B 4P6VF 2WXKA 1DYQA 1XF5L 3V05A 3AEBB 2G1EA 3W2DA 2WXHA 4A6QA 4B0EA 3BVMA 2LEKA 2E6XA 3AECB 3Q8CA 1LO5D 3GP7A 1XEEA 1C9FA 1HQRD 1XLPA 1J7CA 3BYYB 1FRDA 2R61A 1SE4A 2FE8A 1PYWD 2ACZB 1IBXB 2WXLA 2PKOA 2L52A 3BK1A 3FILA 1ENFA 3VRAB 3HVDA 4RNAA 5TSSA 3AH7A 5JXVA 3NVYA 1BXTA 4YWGG 2KQ4X 3C8YA 1YN5A 3W5UB 5MPOA 4US8A 1EWCA 2LJIA 2PMVA 1ET9A 1JWSD 3NS1A 1UNSA 5D3IB 1I4HA 4TMAB 4Q2JA 2K0PA 1HA5A 4R3DA 4WQMA 2XNAC 4A8XC 1QKZA 1UGJA 1I4GA 3I57A 2JX5A 1E9MA 1V1PA 1TY2A 1L6UA 2JZPA 2GRIA 1TYGB 2NMQA 1CZPA 2JQRB 3SFDB 1JMLA 1WGKA 3KWLA 3NRZA 3TSSA 4WURA 1DOYA 5C2TB 3BK2A 1FRRA 2BB6A 3B9JA 1SXTA 3R2TA 4YSYB 1PGBA 1NENB 1DOXA 4RGNA 3VR8B 4WAFA 1FNVA 1QF6A 3P4QB 5T8IA 1YQ3B 1L0YB 2BS4B 1OQQA 4WIPA 1ROEA 2LGIA 2JYTA 4B0MA 1JWBD 2JWUA 5BMGA 2M56B 3P42A 1T3QA 1C4CA 1GAQB 2H89B 1V1OA 3AMZA 4REZA 1TKYA 2WDVB 1K51A 3DWGC 2CU3A 2TSSA 1SIJA 2DWQA 1IGDA 2I38A 2IGDA 2IGGA 4YSXB 1HEZE 5BYSA 4UDUC 4OW0A 1C4PA 2LHDA 1JRPA 3SFEB 1N61A 2JU6X 5FR3A 1IBXA 3LB8C 3L4PA 3W1SA 1JWMD 2WDQB 4NAMA 4TQ0A 2L83A 4A55A 3LXFA 1T5XD 3AB5A 1WRIA 1EM7A 4C7ZA 4RF0A 3Q8FA 2V3NA 4AS1A 5AUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS3 B;  1E7P B;  5GXG B;  3AE7 B;  3P4Q B;  4ITK A;  4P6V F;  3AE3 B;  3NVV A;  1PUT A;  5C3J B;  3WCQ A;  3EUB 2;  3AEB B;  4IDI A;  2G1E A;  2BS3 B;  4C80 A;  1NVI D;  2WQY B;  4LTU A;  5EE0 A;  2LEK A;  5EE1 A;  2K9X A;  3AEC B;  1ZUD 2;  1RWS A;  1UWM A;  1J7A A;  3W5V B;  3ZYY X;  5EE3 A;  1XLP A;  1J7C A;  2WU5 B;  1FRD A;  1ZOY B;  4JWU C;  4ZOH C;  3VRB B;  4YXD B;  1TKE A;  1QT9 A;  1EWY C;  3AEA B;  4US9 A;  1NYR A;  2DBY A;  2ACZ B;  4YTN B;  1FO4 A;  4YTP B;  1AWD A;  2PKO A;  2L52 A;  4USA A;  3VRA B;  3AH7 A;  3HUI A;  1F0Z A;  3NVY A;  1YJI A;  3W5U B;  2HTM E;  1OFF A;  1VDV A;  4YT0 B;  1ZXI A;  2K5P A;  4US8 A;  2PIA A;  5MPO A;  2WP9 B;  3P4S B;  4WWM A;  3NS1 A;  1AYF A;  4FXC A;  1XLQ A;  4HRO A;  1JWA D;  2W3R A;  3AEG B;  4ZHO A;  4HRS A;  2AX5 A;  2QIE B;  4C7Y A;  3CWI A;  4WQM A;  2OHF A;  1FFV A;  1KF6 B;  2CJN A;  1FIQ A;  3FAH A;  2JX5 A;  2Q5W D;  1E9M A;  2EKI A;  1JAL A;  5H8Y E;  4ZHP A;  2MH7 A;  1L6U A;  1WYG A;  3SR6 A;  1TYG B;  1I7H A;  3P4P B;  2W55 A;  1L6V A;  1PDX A;  1JRO A;  3AN1 A;  2KAJ A;  1CZP A;  2PVG C;  1FXA A;  2JQR B;  2KMM A;  3P63 A;  1QOG A;  1KRH A;  3PO0 A;  1WGK A;  4JX1 C;  3SFD B;  4YSZ B;  4YTM B;  3KWL A;  1XLO A;  3BII D;  1L0V B;  3CIR B;  3HVZ A;  1E0Z A;  2Y5C A;  2B76 B;  3NRZ A;  1DOY A;  5G5G A;  1NEK B;  2FBW B;  5C2T B;  1FRR A;  3B9J A;  1A70 A;  1E6E B;  2E3T A;  1GPX A;  4YSY B;  1N60 A;  3ETR A;  2N0S B;  1NEN B;  4JWS C;  4KX6 B;  3RPF C;  1J7B A;  2MJE A;  2WLB A;  1XO3 A;  1N5W A;  1V97 A;  3VR8 B;  3B2F A;  1QF6 A;  4N58 A;  1DOX A;  3ABV B;  3AM9 A;  1N5X A;  1QOA A;  1QLB B;  2H88 B;  1R7S A;  1XLN A;  2K22 A;  1YQ3 B;  3AE2 B;  1PFD A;  3AE5 B;  2BS4 B;  3AE4 B;  1YJJ A;  1OQQ A;  2W3S A;  1ROE A;  1SF0 A;  2WDR B;  1JWB D;  5G5H A;  2M56 B;  3AV8 A;  3FC4 A;  1T3Q A;  1TJE A;  1GAQ B;  2H89 B;  2CJO A;  1ZP0 B;  3HRD D;  3AMZ A;  1N62 A;  1YQ4 B;  3W9C B;  1L5P A;  1TKY A;  2MJ3 A;  1V8C A;  2WDV B;  1JW9 D;  3AE1 B;  1WWT A;  3AEF B;  2CU3 A;  3DWG C;  1DOI A;  1FXI A;  1KFY B;  1OQR A;  1SIJ A;  2DWQ A;  3NVZ A;  3P4R B;  3AE8 B;  2PVO D;  3VR9 B;  4YSX B;  3AEE B;  1RFK A;  2M19 A;  1JQ4 A;  1VJK A;  1RYJ A;  1FM0 D;  2BT6 A;  1E10 A;  1JRP A;  3SFE B;  2W54 A;  1N61 A;  3AED B;  3NVW A;  3B2G A;  4N6E B;  1IUE A;  1VLB A;  1N63 A;  3LB8 C;  3L4P A;  2WDQ B;  1WXQ A;  1QOF A;  2L83 A;  3AE6 B;  1NI3 A;  1FMA D;  5H92 C;  1QOB A;  3LXF A;  1SB3 C;  3AB5 A;  4A9A A;  5EE9 A;  1WRI A;  3AE9 B;  1B9R A;  1FFU A;  2QJL A;  2BS2 B;  2WU2 B;  4N59 A;  3P1M A;  1CJE A;  1DGJ A;  1NYQ A;  1TKG A;  5AUK A;  4C7Z A;  3DWM A;  5AUI A;  1RM6 C;  2MJD A; 
#chains in the Genus database with same CATH topology
 2WS3 B;  2VH2 A;  4HKZ E;  1KLG D;  3QWZ B;  2LGX A;  2BS3 B;  4XDC A;  5LXI B;  2ASQ A;  3R2I A;  1QQR A;  5CTR C;  1J7A A;  2IZV B;  1I4R A;  1EWY C;  4US9 A;  1TS3 A;  5JZE B;  1YQB A;  2LWP A;  2LVP A;  4RMA A;  3IAM 1;  4FN2 A;  2DAJ A;  2DZI A;  3AI5 A;  2O6V B;  1ZXI A;  2FUG 1;  2J0J A;  2KN4 A;  2K6D B;  2KWU B;  1WXV A;  4FXC A;  2LAS A;  4HDQ A;  3QC8 B;  5FK9 C;  3AEG B;  3L54 A;  1EO6 A;  1GOZ A;  4XE0 A;  4JLC A;  1B1Z A;  4EEW A;  3PZ8 A;  3KUZ A;  4DHZ B;  4IM3 A;  3RNA C;  3TEY A;  1K52 A;  4IW0 A;  1ZPS A;  3QCA A;  1I7H A;  3P4P B;  3WAL A;  5LNK 1;  4HCP B;  1EUV B;  1R4N B;  3H7P A;  3N9Y C;  3MC0 B;  4J3O D;  1FXT B;  2KAC A;  1N60 A;  3APF A;  4MEL A;  4CO7 A;  2IO1 B;  1NI2 A;  2DAF A;  2PTL A;  3KUC B;  2GI9 A;  1QLB B;  3RNE C;  2K22 A;  5TR5 A;  3AE2 B;  4BOZ B;  1PFD A;  4MEM A;  4LNI A;  2GBM A;  3PRP B;  2LUM A;  4BOS C;  3TEX A;  4EFO A;  2NBV B;  3AEF B;  3N1Z C;  1V8C A;  1SGH A;  5IP4 D;  3P4R B;  2NTT A;  4XGA B;  5BYR A;  1RFK A;  1IYF A;  3UF8 A;  2AYO B;  1F2R C;  1VZ6 A;  3NVW A;  3RUI B;  4K81 A;  2HD5 B;  3QIJ A;  3P2B A;  5E6J A;  2NR2 A;  5IOI A;  2KDB A;  3IFW B;  4W9C A;  2WU2 B;  5HKH A;  2CR5 A;  2WXI A;  4P1B C;  3AE3 B;  4K1R B;  5C3J B;  1GG3 A;  2AWT A;  5EE1 A;  4ZRK A;  2N1V A;  2AQ1 B;  2Y5P A;  3PZ7 A;  4JWU C;  4ANV A;  3GB1 A;  3RNC C;  4KGR A;  4BVU C;  1P9D U;  4LJP B;  4D2K A;  1WXS A;  1OFF A;  3Q8E A;  2RMM A;  2BB5 A;  3P4S B;  1VD2 A;  1M94 A;  1CMX B;  4HRO A;  3I63 C;  1MHX A;  4MH0 E;  4EUT A;  4MAC A;  3A4R A;  3L16 A;  3IBE A;  1EU3 A;  3FKY A;  3DDC B;  3SR6 A;  1HXY D;  2WGS A;  2KHW B;  3Q69 A;  4HJG E;  5CHF A;  4C00 A;  3PO0 A;  2V3P A;  3E56 A;  3BII D;  1L0V B;  1WGH A;  2Z0D B;  4KKI A;  3R66 C;  2JZ3 B;  3ETR A;  1V49 A;  4JWS C;  3Q14 C;  3RT3 B;  4K3B A;  4PS3 A;  4GN1 A;  3AM9 A;  4K7S A;  3WAN A;  1R7S A;  1XLN A;  3AU4 A;  1YJJ A;  3PVL A;  4WWN A;  1TJE A;  4KIK B;  3HIZ A;  2IPK D;  5BYQ A;  1KOT A;  4P16 A;  4ZRQ A;  1DOI A;  3V60 A;  3AE8 B;  2ZW1 A;  1RYJ A;  3NUH B;  4EZL A;  2L0T A;  2BWE S;  3SHQ A;  1KLU D;  1WSP A;  2BVC A;  3KLS X;  3Q6B A;  2FIF A;  4HPM B;  4NJC A;  1SSN A;  1SE9 A;  1EU4 A;  2DNF A;  2D11 A;  3PS6 A;  3EUB 2;  4IDI A;  5HHD G;  2DZK A;  2K9X A;  2W82 A;  3ZYY X;  3PSE B;  5BMH A;  3VRB B;  2KDM A;  2K8B A;  1NYR A;  4W9E A;  1YJI A;  4YT0 B;  3ZVV A;  2K5P A;  2PIA A;  3ZTD A;  4OZA A;  2N9X A;  2D5G A;  4C7Y A;  3APC A;  1ET6 A;  3V6E B;  1STE A;  4M00 A;  2O2V B;  1LFD A;  5CX3 A;  5E6O A;  3TJP A;  5FKA C;  2KAJ A;  2LVO A;  2JY6 A;  2PVG C;  1FXA A;  4GDK B;  3BVZ A;  1E0Z A;  4C56 C;  2GBR A;  2AQ2 B;  4FBJ B;  4KX6 B;  3ZNI D;  1UWX A;  1IPG A;  2J7Q B;  2KFJ A;  2WDR B;  1TS4 A;  5EDS A;  4G50 A;  1MJD A;  3WA0 A;  2D3A A;  2IY1 B;  1WR6 E;  1V1P B;  3U52 E;  3MJ5 A;  2KTF A;  2RDH A;  3NVZ A;  2ZEQ A;  3VR9 B;  4W9G A;  1V6E A;  2N7D A;  4MGZ E;  4JPS A;  1FM0 D;  1GB1 A;  1T0R C;  2BT6 A;  2W54 A;  4A20 A;  3B2G A;  2DEN B;  2MEK A;  2JUO A;  2OJR A;  2RGF A;  1SB3 C;  1ZDX A;  2V1Y A;  3RNB C;  3TUO A;  4M8N A;  4P6V F;  3RZF A;  1DYQ A;  3AEB B;  3W2D A;  1Z2M A;  2LEK A;  5D2M B;  3HHM A;  2KX0 A;  1XEE A;  1XLP A;  4DBG A;  4E74 A;  3BK1 A;  3PHW B;  3HVD A;  4E3C A;  2M8S A;  2C7M B;  1YN5 A;  1E8X A;  2LJI A;  1TT5 B;  4JL9 A;  4DK5 A;  4XZ4 A;  1I4H A;  4Q2J A;  1T0S C;  1HA5 A;  4MGY E;  3RNG C;  2XNA C;  4A8X C;  1I4G A;  2JX5 A;  1YX6 B;  2I1K A;  3A4S C;  2GRI A;  2JQR B;  3SFD B;  1WGK A;  3NRZ A;  3EHV A;  3AU5 A;  3B9J A;  4HCN B;  1SXT A;  3R2T A;  3ZTC A;  4P1C C;  1WF9 A;  1XD3 B;  3PV1 A;  1WJ6 A;  4RGN A;  2D3C A;  2UYZ B;  1YQ3 B;  4MJS A;  1KLV A;  4WIP A;  4NJ6 A;  2JYT A;  2WHI A;  1JWB D;  2JWU A;  1P1A A;  1T3Q A;  2N1W A;  3VUW A;  4HPL B;  4LJO B;  2WYQ A;  1V1O A;  3AMZ A;  1TKY A;  1K51 A;  2CU3 A;  1IGD A;  5KHO A;  1C4P A;  1G6J A;  3OJ3 A;  3EFU A;  3SU8 X;  1JRP A;  3RD2 A;  1N61 A;  5FR3 A;  3L4P A;  3M62 B;  4TQ0 A;  2L8J A;  5C1Z A;  2GBN A;  1WRI A;  3VHT C;  3I3T B;  1WE6 A;  3HK0 A;  4RF0 A;  4LNN A;  3Q8F A;  2V3N A;  1E8Z A;  2QIL A;  2A5U A;  3DBL B;  2MBE A;  3IXS A;  2L05 A;  2NCN A;  4KDI C;  5LLI A;  1AW7 A;  2WU5 B;  4AJY B;  1MG4 A;  1TKE A;  1WH3 A;  4A90 A;  1FO4 A;  2KLG A;  1AWD A;  4USA A;  2Z8L A;  3JVZ X;  3HUI A;  2M0X A;  2YVC A;  3QAQ A;  3JYU A;  2WP9 B;  3MTN B;  2LZ6 A;  2MX2 A;  3X23 A;  1ZGU B;  2AX5 A;  1H4R A;  3RI7 C;  4DHJ D;  2JF5 A;  1KF6 B;  3TBL D;  1UGM A;  1YN4 A;  1JAL A;  3O65 B;  3VDZ A;  1L6V A;  2D3B A;  2IND C;  1T6B X;  1ISN A;  4M8M A;  3V6C B;  2IDY A;  4W9F A;  4HPP A;  2JRI B;  5D7G A;  3EGR A;  3ZJV A;  2DX5 B;  4LLG M;  1N5W A;  4N9F 4;  3U7Z A;  4HVB A;  5IA7 A;  4AQ7 A;  1WYW B;  3DVG Y;  4BKG A;  3AV8 A;  5E6P A;  2EKE C;  3UGB B;  1D4B A;  2LHE A;  1FNU A;  2L7R A;  4JQW C;  2JXX A;  3BZD B;  1C79 A;  1WZ0 A;  1WGY A;  4PYU A;  4EOY A;  2GLS A;  1N6Z A;  1N63 A;  2KWD A;  3AE6 B;  1NI3 A;  2WXN A;  4A9A A;  3A9K A;  3L10 B;  1TTN A;  3VH3 B;  1CJE A;  4HKQ A;  1TKG A;  1MI0 A;  4DXA B;  3DWM A;  4B95 A;  1RM6 C;  2WLB A;  3QK0 A;  4IWQ A;  3VTU A;  2EEL A;  2NS5 A;  1SJH D;  2PE9 A;  3OAW A;  3WCQ A;  4F1S A;  2KOX A;  2HTH A;  1YJ1 A;  2V4I B;  5EE0 A;  3ZJT A;  2INC C;  3W5V B;  3N1X C;  2Y5B B;  4RM9 A;  2ON8 A;  3OWE B;  1UBQ A;  3NZS A;  2G45 B;  3T3N A;  4B9K A;  2AL6 A;  1PGX A;  2L00 B;  3RNF C;  4RGO S;  3NHE B;  2X38 A;  4LCD E;  4HRS A;  3CWI A;  2ZPY A;  3DBR B;  2CHX A;  1VZ7 A;  2PJH A;  1BUI C;  4HLE A;  2RR9 A;  3L17 A;  3MJW A;  2NPT A;  4LNO A;  3ZW3 A;  1SEB D;  1QOG A;  1J0G A;  2LGS A;  4OVU A;  1TZO A;  4O1N A;  5G5G A;  4PS7 A;  3VTW A;  1WJU A;  1J7B A;  3Q8B A;  2FCQ A;  1QOA A;  2WX1 A;  2LFI A;  4KSK C;  4PK1 A;  2XBB C;  4IOI E;  5G5H A;  3DBL I;  3DHH C;  2CJO A;  1AN8 A;  2YEP F;  1V5T A;  2MJ3 A;  4YTM B;  1WWT A;  3LJ3 A;  1MG8 A;  3MP9 A;  4L2Y A;  1I4P A;  3AUL A;  4KZC A;  2BQQ A;  4NAW A;  1VLB A;  1L0X B;  1WXQ A;  2HDE A;  1FMA D;  2N7E A;  2ZW0 A;  1B9R A;  1WGG A;  3KQ4 A;  1ZXH A;  3GE3 C;  3ZNZ B;  2R2O A;  2KNB A;  1WZ3 A;  1C4A A;  5G2N A;  3WAP A;  5KHQ A;  4MH8 A;  3PLU A;  1I35 A;  1GC6 A;  3NS8 A;  3ZJU A;  2WXF A;  4H2A A;  4FUL A;  2GB1 A;  2MW5 A;  4YTN B;  3V3X A;  2LXC A;  3PRZ A;  1KM7 A;  5JHA A;  1OEY J;  2HTM E;  2LRW A;  4DHJ B;  2IY0 B;  4OVZ A;  2KTR B;  1JWA D;  4M0W A;  4WJO A;  1SIF A;  3A1Q A;  2CJN A;  2VZK D;  3DVN V;  4JGH B;  5BO4 B;  2C5L C;  3OG5 A;  5H8Y E;  4MM3 A;  2RD0 A;  1VR9 A;  2L76 A;  1T0Q C;  1UH6 A;  1JRO A;  2REX A;  1R4M I;  2IJ0 A;  4DQO C;  3URY A;  1F9J A;  3RN9 C;  2B76 B;  2JRH A;  3PT2 B;  4GMV A;  2FUH B;  2KXJ A;  1V97 A;  4FHK A;  3O13 A;  4IC7 B;  2UU7 A;  2DZM A;  5JH5 C;  3W9C B;  2BKR B;  3LDZ E;  4ITK A;  3NVV A;  3ZRC A;  2WXO A;  3KYC D;  1KFY B;  2SAK A;  2HJ8 A;  3IVF A;  3OLM D;  3AEE B;  3UI3 A;  1YMH E;  3Q3J A;  3LYY A;  4HJK A;  1HZ6 A;  3Q3M C;  4W9J A;  2L1A A;  2BBC A;  4GLS C;  2KT7 A;  5EE9 A;  3M3J A;  3R8B A;  2QJL A;  2BS2 B;  4DHZ E;  4QAY A;  2ONQ A;  4MJS B;  1WX8 A;  3DBR I;  1XF5 L;  2QHO A;  4A6Q A;  4B0E A;  3BVM A;  2LI5 A;  3AEC B;  2D10 A;  2BPS A;  3U7D A;  1SE4 A;  3U30 A;  2WXL A;  3FIL A;  4XC2 A;  1BXT A;  2V3S A;  2KQ4 X;  3W5U B;  2PMV A;  1ET9 A;  1UNS A;  1WE7 A;  3B08 A;  2KVZ A;  2QDF A;  4W9D A;  3TL5 A;  1QKZ A;  2HE7 A;  4ICV A;  1GUA B;  2FCM A;  3VFK A;  1L6U A;  2JZP A;  1R4N I;  2DZJ A;  2MA9 B;  1KJT A;  2KD0 A;  3BK2 A;  3NY5 A;  1PGB A;  1NEN B;  1DOX A;  4WAF A;  2V4L A;  3P4Q B;  1L0Y B;  1OQQ A;  3PZD A;  3H1U A;  4B0M A;  5BMG A;  2M56 B;  3P42 A;  4FJZ A;  1GAQ B;  3ZDM C;  1RLF A;  4ANW A;  2ZCB A;  2WDV B;  1J19 A;  2ZPN A;  1SIJ A;  2I38 A;  2C7N B;  4YSX B;  4UDU C;  2J0M A;  2JU6 X;  1IBX A;  2K8C A;  1I42 A;  4MSQ B;  4TUU A;  3SD5 A;  3W1S A;  1JWM D;  2WDQ B;  4A55 A;  5DCN A;  1T5X D;  2MWS B;  1EM7 A;  3ZKJ C;  4C7Z A;  3AXC A;  4AS1 A;  5AUI A;  5G55 A;  3T8M A;  2R2Q A;  5DPT A;  1PUT A;  1KH0 A;  1FNW A;  1BML C;  2JYE A;  4DXG A;  2I2Y A;  1Z5S B;  3EC8 A;  4RGM A;  1TS2 A;  1I4X A;  2DYO A;  3ZLZ A;  2K25 A;  2Z59 B;  1S3S G;  2MBO A;  4HWI B;  4L23 A;  1F77 A;  4WWO A;  1F0Z A;  1MPE A;  1K8R B;  2KLC A;  2KTR A;  1H8C A;  3A9K B;  4ANX A;  3N1Y C;  1V5O A;  1D6E C;  1AYF A;  5IN7 A;  2VZK B;  4BKS D;  2JPH A;  4ZYN A;  3UIP B;  2G3Q B;  3BY4 B;  3IT6 B;  2QMT A;  4C4V B;  1FFV A;  3CST A;  2EKI A;  2N4F A;  3SEB A;  4AWJ A;  2KDI A;  2LJ5 A;  4HEA 1;  4I6L B;  1WYG A;  5DPR A;  1Q0W B;  2N9K A;  4BKT A;  3ZXR A;  2XK5 A;  2B3A A;  2LGD A;  2KMM A;  2INN E;  4NPN A;  5D6J B;  1K50 A;  1NEK B;  4JIO U;  1E6E B;  1V86 A;  3M95 A;  3SDL C;  3NZU A;  5BMI A;  2Y3A A;  4WH4 A;  4ZRI A;  4N58 A;  1WFY A;  2H88 B;  3L08 A;  1S1Q B;  3W1Y A;  3DPD A;  1E7V A;  1Q5W B;  1UZX B;  4TQ1 A;  1Q1O A;  4ICU A;  1VCB A;  1ZKH A;  2JT4 B;  2JZZ A;  2NPT B;  1WI0 A;  4ASW C;  1YIW A;  1P7E A;  1MFW A;  1E8W A;  1VJK A;  2RPV A;  4DWF A;  4DXF A;  2ICI A;  5C23 A;  4FLH A;  4XWW A;  1FEH A;  4S0R A;  1TIF A;  2K1F A;  2IGH A;  2YLM A;  4WJQ A;  4BBN F;  1NYQ A;  4XDD A;  3C19 A;  2C7H A;  4ZRJ A;  4L1B A;  5GXG B;  4WWP A;  5I4D A;  2KQ7 A;  1QZE A;  1ACC A;  5DPS A;  3U8Z A;  2BYF A;  4DDI D;  2WXG A;  2O6V D;  4M02 A;  4AOF A;  1D5X C;  1Q10 A;  3IHP C;  2K8H A;  3DQV A;  1IGC A;  1TZ1 A;  3BVG A;  4G0N B;  2QSD A;  3Q3F A;  2J0K A;  1ZOY B;  4ZOH C;  1SJE D;  1ZE3 D;  4NAW B;  1HZ5 A;  4YTP B;  3H9D A;  4LNF A;  1OQY A;  2ZVN A;  1E7U A;  2FNJ B;  2DYB A;  2WWZ A;  3N30 A;  1OEY A;  2NBW B;  4F8C B;  3PRE A;  3EFC A;  3JSV A;  4ZHO A;  1VZ8 A;  2MQJ A;  4II3 B;  3D32 A;  3DCG A;  2KMA A;  1M4V A;  2FCS A;  3FAH A;  4KGS A;  2MH7 A;  4IG7 B;  2W55 A;  2MHJ A;  3W1S C;  3ENE A;  4ZDV A;  2IO3 B;  2KAN A;  3P63 A;  1E8Y A;  2PW9 A;  2Y5C A;  3Q2A C;  4NJ7 A;  1RAX A;  1A70 A;  2WX0 A;  2BYE A;  1GNU A;  3B2F A;  3QA8 A;  3E9S A;  4G3X B;  1OGW A;  4M0W B;  4AJW A;  4TV3 A;  4IWP A;  3A1Q B;  2V9H A;  3MHS D;  3DHG C;  2NTS A;  1WRD B;  4MM3 B;  1XXG A;  2KN5 A;  3VH4 B;  1JW9 D;  1GC7 A;  2RDB C;  2PVO D;  2MP2 A;  2QEJ C;  1E5W A;  1T0Y A;  4JE3 B;  4HDO A;  2BGF A;  3AED B;  2M1M A;  3V61 A;  3TMP B;  3WAM A;  3Q3N C;  1NDD A;  5H92 C;  3N32 A;  2OED A;  3EA6 A;  3QQ8 B;  4GDL A;  3PRM B;  4MT5 A;  4MGI E;  2KQS A;  3APD A;  1E7P B;  4TSS A;  2M17 A;  4BZA A;  1JWU D;  3ONS A;  2WXR A;  2AEH A;  3CMM B;  5EE3 A;  3KWV A;  1QT9 A;  2IBI B;  3AEA B;  2DBY A;  5J2R A;  1TS5 A;  5AZH A;  2JWZ A;  2LMC A;  2DLB A;  3GZN B;  2RSU A;  1TBE A;  4C4V A;  1FCC C;  4LK0 M;  2J42 A;  2OHF A;  4LDT D;  2J52 A;  2G9H D;  1L4D B;  3DVN U;  3QAR A;  4K7W A;  4A3P A;  1KRH A;  3BWU D;  1XLO A;  3HVZ A;  3CIR B;  1X1M A;  2KJ6 A;  3FIL B;  2MRP A;  1L4Z B;  2OOB B;  3RPF C;  2X8X X;  2MJE A;  2JSV X;  1WIA A;  2BW2 A;  3H8H A;  1YN3 A;  4MSM B;  1YOV B;  3K9P B;  1P0R A;  4M01 A;  3MHZ A;  1N62 A;  1BT0 A;  2I1J A;  1OTR B;  1IP9 A;  4HK2 A;  1RRB A;  1SBB B;  5IAA C;  1IUE A;  4S17 A;  2JVC A;  3T9L A;  5HFY A;  3BYT B;  4NZL B;  4RF1 A;  2MSE D;  2MJD A;  1SE2 A;  2RDG A;  2K3U A;  3I5J C;  3J9C A;  3VQI A;  3A9J A;  2HJ1 A;  2WXK A;  3V05 A;  3ALB A;  1E90 A;  1WJN A;  2G1E A;  2KWC A;  2MLB A;  2WXH A;  4WAA A;  2E6X A;  3C0R B;  1LO5 D;  4EKU A;  2K6Q A;  3GP7 A;  1HQR D;  1J7C A;  1WXM A;  4CHK A;  2R61 A;  2FE8 A;  4FAD A;  2ACZ B;  3KUD B;  1IBX B;  4P7I A;  2PKO A;  1YX5 B;  2KC1 A;  4RNA A;  5TSS A;  3NVY A;  4YWG G;  5CHV C;  3DBS A;  4US8 A;  1WX9 A;  3NG0 A;  2G4S A;  4WQO B;  5D3I B;  4TMA B;  3H7S A;  4R3D A;  1UGJ A;  2PEA A;  3VUX A;  1E9M A;  2KK8 A;  4W9K A;  4AUQ C;  4KZ0 A;  1TYG B;  1CZP A;  3NJT A;  1LM8 B;  3TSS A;  1DOY A;  1WMH A;  1FRR A;  3GOE A;  4YSY B;  5IKC M;  1EF5 A;  4GB9 A;  2Z0E B;  3B1L X;  3N20 C;  4YL8 A;  4HXD A;  1FNV A;  3R3M A;  1UF0 A;  2BS4 B;  4AP4 C;  2VRR B;  1C4C A;  2H89 B;  4NNJ B;  4REZ A;  2PPH A;  5FR6 A;  2KJR A;  3DWG C;  2DWQ A;  1A5R A;  2KZR A;  4IUM B;  1HEZ E;  4K7U A;  4OW0 A;  2XK5 B;  2CHZ A;  3LB8 C;  3M63 B;  4NAM A;  5D94 A;  2VH1 A;  3GZN I;  3S2A A;  3UQA A;  2FAZ A;  4MDK E;  3KH0 A;  1GJZ A;  1WXA A;  3PTF C;  2M4N A;  4PT5 A;  2BYV E;  3ZNH B;  4C80 A;  3U2S C;  3WAO A;  1PGA A;  1UWM A;  1C77 A;  1JRU A;  1WX7 A;  2BKF A;  3DHI C;  4II2 B;  2D2Q A;  4YXD B;  3V62 A;  4BKS A;  1ZDV A;  1EF1 A;  2EMT A;  1MVK A;  4OZB A;  4PS8 A;  5AEK B;  4W9I A;  4ZRP A;  4RCO A;  3RYT A;  1VDV A;  2KJH B;  3RMK C;  2ZVO A;  3ECI A;  2W3R A;  5E6N A;  4LDT B;  3KYD D;  2YEP B;  2K39 A;  3PLV A;  4CQN A;  4RGT A;  1P98 A;  3RZW C;  1WM3 A;  3KW5 B;  4JX1 C;  3R7R A;  2ZNV C;  4YSZ B;  2KDE B;  5GMV A;  2FBW B;  2MBH A;  3GE8 C;  1GPX A;  2E3T A;  4GOC A;  3BIN A;  3TIX A;  4RFB A;  5CHW A;  3QX1 A;  4DDG D;  1YNT E;  3AE5 B;  2WXQ A;  2EMS A;  2J53 A;  3AE4 B;  3JSV B;  3X0W A;  1SF0 A;  3ZRF A;  4FJV B;  3VVW B;  2CHW A;  3U4E G;  2N7J A;  2KFK B;  3AE1 B;  4IM0 A;  4WWM A;  4A3O A;  2N9E B;  4IWO A;  2LXA A;  4LNK A;  2D07 B;  4N6E B;  4NQK E;  2QC8 A;  1XT9 B;  2O6V A;  3Q8A A;  2GMI C;  2KVR A;  1XQQ A;  2FID A;  3HM6 X;  5HG2 A;  2FCN A;  2INP E;  1QIL A;  4GIV A;  5AUK A;  2BYT A;  2GOW A;  2KKC A;  4GSW A;  4NY0 A;  4BFR A;  4KSL C;  1P3Q U;  2N9P C;  4XYC A;  3MC9 A;  1NVI D;  3QJZ A;  4LTU A;  3T3O A;  1TGZ B;  1ZUD 2;  1PQS A;  4GU2 A;  1RWS A;  3TEW A;  1XCQ L;  2MP2 B;  4PYZ A;  1F52 A;  2WNM A;  1HTQ A;  4I6N B;  2L32 A;  3Q3O C;  3NZ3 A;  2V0G A;  2DYM A;  2PE6 B;  4GDL B;  3RCZ A;  2KO3 A;  1V9J A;  4OZC A;  2L3Z A;  4KV2 A;  3TEZ A;  1HTO A;  5HI1 A;  1C78 A;  1FD6 A;  2AQ3 B;  3DBH B;  2Q5W D;  2NVU I;  4G11 A;  4EE2 A;  3L13 A;  2ZJD A;  1I4Q A;  4MGK E;  3R7Q A;  1PDX A;  2J4X A;  2KX3 A;  5D3D A;  3ZIM A;  3GS2 A;  4F7Z A;  1LXD A;  3K9O B;  2C9W B;  2KWV B;  3L0W B;  3NOB A;  1FCL A;  1KTK A;  1U4A A;  2SEB D;  4GGQ A;  2OJW A;  1NBF C;  1XO3 A;  3ABV B;  1N5X A;  4WJN A;  3VUY A;  1Y8R C;  3EEC A;  2W3S A;  4W9L A;  1UUP A;  5L83 A;  2JXT A;  3FC4 A;  2IO2 B;  3IG3 A;  3CSF A;  3HRD D;  4KKJ A;  1YQ4 B;  1L5P A;  1MHH E;  4E71 A;  1OQR A;  2MCN B;  1JQ4 A;  2M19 A;  3A33 B;  3I9V 1;  3N3K B;  2QCZ A;  1E10 A;  1XCT L;  3HM3 A;  4TKN A;  4BBN C;  2LVQ A;  2BF8 B;  3H6N A;  4ARI A;  4CYE A;  3AE9 B;  3PPA A;  4OHJ A;  4ACF A;  4N59 A;  3P1M A;  1DGJ A;  1UEL A;  2IO0 B;  1F1H A;  3MFG A;  2L0F A;  4ZYS A;  2WXP A;  2WXJ A;  2WQY B;  1GB4 A;  3JW0 X;  1TY0 A;  4BAX A;  2G4D B;  2PLP A;  4NQL B;  1L7Y A;  4OVV A;  3ZO5 B;  1D3Z A;  1L2N A;  1RFA A;  1ZW7 A;  1VRA B;  4IKG A;  2C60 A;  4GXB A;  2ZNV B;  1K53 A;  4KGT A;  1C76 A;  3VTV A;  1WJ4 A;  1D5Z C;  3PHX B;  1WGD A;  1XLQ A;  2WDT B;  1Y56 A;  1CQV A;  3A9J B;  1UD7 A;  2QIE B;  2XN9 C;  3DVG X;  2CU1 A;  3IT4 B;  2KDF B;  4KIK A;  3RFZ B;  5DPW A;  3ML9 A;  1FIQ A;  3ZQ4 A;  3UIN B;  4ZHP A;  5AZF A;  1JCK B;  2N9L A;  5J17 A;  3B0A A;  3AN1 A;  4XX5 A;  2ZZP B;  2WXM A;  2LUE A;  4FJY A;  3ZDT A;  3ZNG C;  4XWT A;  3QHT A;  3UIO B;  2LGY A;  1AAR A;  2N0S B;  3VAW A;  3H7P B;  1FPY A;  2A4Z A;  1WY8 A;  5LXH A;  1SE3 A;  3IAS 1;  1LQB A;  2D3G A;  3VXW A;  4RH6 A;  2GBJ A;  2KFK A;  1J8C A;  4B6W A;  2NBU A;  1ESF A;  1ZP0 B;  1CK1 A;  1FXI A;  3ZUN A;  3UQB A;  3ZXV A;  3CF6 E;  2GBK A;  1D5M C;  4ARC A;  1WMH B;  3TCA A;  4K3C A;  1QOF A;  1QOB A;  3ZGZ A;  3KVF B;  1FFU A;  2RPQ A;  1LGR A;  1F2R I;  2BTE A;  2M0A A;  2MBQ A;  1P7F A;  3AE7 B;  4I6P A;  3DBH I;  5L95 C;  1HE8 A;  3Q8C A;  2O2V A;  5JHB A;  2IYD B;  1YD8 U;  1C9F A;  4WJP A;  1V81 A;  1FRD A;  3BYY B;  1WM2 A;  4GDK A;  1PYW D;  2AL3 A;  4IM2 A;  5IO9 A;  2L52 A;  2LRU A;  1ENF A;  4FHJ A;  3VRA B;  5JXV A;  1V2Y A;  3AH7 A;  3OJ4 B;  3C8Y A;  5MPO A;  4W9H A;  1EWC A;  5AZG A;  4EZJ A;  2ZCC A;  2DHZ A;  2CKH B;  2W9N A;  1JWS D;  3NS1 A;  5J18 A;  2K0P A;  4URK A;  4FA6 A;  4WQM A;  4X57 B;  1UBI A;  3I57 A;  4KVG B;  1V1P A;  1TY2 A;  2UWQ A;  2NMQ A;  1JML A;  2KC2 A;  2KYW A;  2LD9 A;  1C3T A;  3KWL A;  2BWF A;  4WUR A;  5C2T B;  3ML8 A;  3PGE A;  2BB6 A;  1R4M B;  4RM8 A;  3DOW A;  4EZK A;  4J6I A;  2MBB B;  1WGR A;  3MC8 A;  3VR8 B;  1QF6 A;  5T8I A;  1ROE A;  2LGI A;  1V80 A;  3WIM A;  1WR1 A;  1C1Y B;  2TSS A;  4ANU A;  2IGD A;  2IGG A;  5BYS A;  2LHD A;  3SFE B;  4KDL B;  2CS4 A;  2L83 A;  2XEW A;  3LXF A;  3AB5 A;  2KMC A;  3RUL A; 
#chains in the Genus database with same CATH homology
 2WS3 B;  4HKZ E;  1KLG D;  2QIL A;  1PUT A;  1KH0 A;  4PT5 A;  1FNW A;  2BS3 B;  4C80 A;  1BML C;  2JYE A;  4DXG A;  2I2Y A;  3U2S C;  4XDC A;  3IXS A;  3R2I A;  4RGM A;  1QQR A;  1PGA A;  1TS2 A;  1I4X A;  2DYO A;  1UWM A;  1C77 A;  1J7A A;  1AW7 A;  1I4R A;  2WU5 B;  4YXD B;  1TKE A;  1EWY C;  4US9 A;  1TS3 A;  1ZDV A;  4A90 A;  1FO4 A;  1AWD A;  4L23 A;  3IAM 1;  1MVK A;  4OZB A;  4USA A;  1F77 A;  2Z8L A;  3HUI A;  1F0Z A;  1MPE A;  4ZRP A;  4RCO A;  1VDV A;  1ZXI A;  2FUG 1;  2KN4 A;  2WP9 B;  1D6E C;  4FXC A;  1AYF A;  2VZK B;  2W3R A;  5FK9 C;  3AEG B;  1GOZ A;  2AX5 A;  3IT6 B;  4XE0 A;  2QMT A;  2YEP B;  1B1Z A;  1FFV A;  1KF6 B;  3PZ8 A;  1YN4 A;  2EKI A;  3SEB A;  1JAL A;  3TEY A;  4CQN A;  1K52 A;  4HEA 1;  4RGT A;  1WYG A;  1ZPS A;  2N9K A;  1I7H A;  3P4P B;  1L6V A;  5LNK 1;  1T6B X;  2KMM A;  4JX1 C;  2INN E;  4YSZ B;  1K50 A;  2IDY A;  1NEK B;  2FBW B;  3N9Y C;  3MC0 B;  1E6E B;  4J3O D;  2E3T A;  1GPX A;  5D7G A;  2KAC A;  1N60 A;  3EGR A;  5BMI A;  3ZJV A;  4LLG M;  2Y3A A;  1N5W A;  4RFB A;  4WH4 A;  2PTL A;  4N58 A;  3U7Z A;  4AQ7 A;  2GI9 A;  1QLB B;  1YNT E;  2H88 B;  2K22 A;  3AE5 B;  2WXQ A;  3AE2 B;  1PFD A;  2J53 A;  3AE4 B;  1SF0 A;  3AV8 A;  2LUM A;  4TQ1 A;  1D4B A;  3TEX A;  2LHE A;  3U4E G;  1FNU A;  2N7J A;  3AEF B;  1V8C A;  3AE1 B;  3P4R B;  4WWM A;  2NTT A;  3BZD B;  1C79 A;  5BYR A;  1P7E A;  1RFK A;  1VJK A;  2RPV A;  4DXF A;  2ICI A;  1F2R C;  4N6E B;  1VZ6 A;  3NVW A;  4XWW A;  1FEH A;  1N63 A;  2KWD A;  3AE6 B;  1NI3 A;  2WXN A;  3Q8A A;  2IGH A;  5E6J A;  4A9A A;  5HG2 A;  2WU2 B;  2INP E;  1QIL A;  1CJE A;  1NYQ A;  1TKG A;  1MI0 A;  4XDD A;  5AUK A;  4HKQ A;  3DWM A;  2BYT A;  1RM6 C;  2WLB A;  4L1B A;  5GXG B;  2WXI A;  2EEL A;  5I4D A;  1SJH D;  1ACC A;  3AE3 B;  5C3J B;  3WCQ A;  2WXG A;  1NVI D;  2V4I B;  4LTU A;  5EE0 A;  5EE1 A;  3T3O A;  1D5X C;  1Q10 A;  3ZJT A;  1ZUD 2;  1RWS A;  1IGC A;  3TEW A;  3BVG A;  3W5V B;  1XCQ L;  2QSD A;  2ON8 A;  2AQ1 B;  1ZOY B;  2Y5P A;  3PZ7 A;  4JWU C;  4ZOH C;  3GB1 A;  2WNM A;  3OWE B;  4KGR A;  1SJE D;  1ZE3 D;  2L32 A;  4NAW B;  1HZ5 A;  4YTP B;  4D2K A;  3T3N A;  3NZ3 A;  1OFF A;  1PGX A;  3Q8E A;  2RMM A;  2V0G A;  4RGO S;  2BB5 A;  3P4S B;  2DYM A;  4GDL B;  4OZC A;  4HRO A;  1MHX A;  2X38 A;  3TEZ A;  4ZHO A;  4HRS A;  4MAC A;  1VZ8 A;  5HI1 A;  3CWI A;  1C78 A;  1M4V A;  1FD6 A;  2AQ3 B;  3FAH A;  1VZ7 A;  2Q5W D;  4KGS A;  1BUI C;  4EE2 A;  1EU3 A;  2MH7 A;  3SR6 A;  1I4Q A;  1HXY D;  2W55 A;  1PDX A;  2J4X A;  3Q69 A;  4HJG E;  5D3D A;  3GS2 A;  1SEB D;  3P63 A;  1QOG A;  3PO0 A;  2PW9 A;  2V3P A;  3E56 A;  3BII D;  1L0V B;  2Y5C A;  1TZO A;  4O1N A;  5G5G A;  4KKI A;  1FCL A;  1A70 A;  1KTK A;  3ETR A;  2SEB D;  4JWS C;  1J7B A;  1XO3 A;  3Q8B A;  3B2F A;  3ABV B;  3AM9 A;  1N5X A;  1QOA A;  1R7S A;  1XLN A;  2LFI A;  3E9S A;  1YJJ A;  2W3S A;  1UUP A;  4IOI E;  5G5H A;  2JXT A;  3FC4 A;  1TJE A;  2CJO A;  1AN8 A;  2IPK D;  5BYQ A;  2YEP F;  3HRD D;  4KKJ A;  2NTS A;  4P16 A;  1YQ4 B;  1L5P A;  1MHH E;  1XXG A;  2MJ3 A;  4MM3 B;  1JW9 D;  4ZRQ A;  1WWT A;  4YTM B;  1DOI A;  1OQR A;  3AE8 B;  2PVO D;  2QEJ C;  2ZW1 A;  3MP9 A;  1JQ4 A;  2M19 A;  4L2Y A;  1I4P A;  1RYJ A;  3I9V 1;  3NUH B;  4JE3 B;  1E10 A;  1XCT L;  3AED B;  1VLB A;  1KLU D;  1L0X B;  1WSP A;  3KLS X;  1WXQ A;  2HDE A;  1FMA D;  5H92 C;  4ARI A;  2ZW0 A;  2OED A;  3AE9 B;  4OHJ A;  1B9R A;  3EA6 A;  4N59 A;  3KQ4 A;  3P1M A;  1DGJ A;  4MT5 A;  4NJC A;  1SSN A;  1ZXH A;  1EU4 A;  1E7P B;  3MFG A;  4TSS A;  3EUB 2;  4ZYS A;  1C4A A;  2WXP A;  4IDI A;  5HHD G;  2WXJ A;  2WQY B;  1JWU D;  1GB4 A;  2K9X A;  4MH8 A;  2W82 A;  1TY0 A;  2WXR A;  3ZYY X;  5EE3 A;  3ZJU A;  2WXF A;  4H2A A;  2PLP A;  5BMH A;  3KWV A;  3VRB B;  2KDM A;  1QT9 A;  3AEA B;  2GB1 A;  1NYR A;  1VRA B;  2DBY A;  4YTN B;  3V3X A;  1TS5 A;  4IKG A;  2LMC A;  1YJI A;  1K53 A;  2DLB A;  2HTM E;  4KGT A;  4YT0 B;  1C76 A;  2K5P A;  2PIA A;  1D5Z C;  4OVZ A;  1XLQ A;  1JWA D;  1Y56 A;  1CQV A;  4M0W A;  4OZA A;  1FCC C;  2D5G A;  2QIE B;  2XN9 C;  4LK0 M;  4C7Y A;  2J42 A;  2OHF A;  3IT4 B;  1ET6 A;  3RFZ B;  1STE A;  2CJN A;  1FIQ A;  2VZK D;  3ZQ4 A;  5H8Y E;  4ZHP A;  2J52 A;  1JCK B;  1VR9 A;  2G9H D;  1L4D B;  2N9L A;  5FKA C;  1JRO A;  3AN1 A;  2KAJ A;  2PVG C;  1FXA A;  2WXM A;  2IJ0 A;  4GDK B;  1KRH A;  4DQO C;  3URY A;  3BVZ A;  3BWU D;  1XLO A;  3HVZ A;  1E0Z A;  3CIR B;  3FIL B;  2B76 B;  4XWT A;  4C56 C;  2AQ2 B;  1L4Z B;  2N0S B;  3RPF C;  4KX6 B;  2MJE A;  2JSV X;  1UWX A;  1V97 A;  2BW2 A;  1SE3 A;  3IAS 1;  3O13 A;  3H8H A;  1YN3 A;  2WDR B;  4RH6 A;  1TS4 A;  1ESF A;  3MHZ A;  1ZP0 B;  1N62 A;  3W9C B;  1V1P B;  1CK1 A;  3NVV A;  4ITK A;  3MJ5 A;  2RDH A;  3U52 E;  2WXO A;  3NVZ A;  1FXI A;  1KFY B;  2SAK A;  3VR9 B;  3AEE B;  3UI3 A;  4JPS A;  1FM0 D;  1YMH E;  2BT6 A;  1GB1 A;  3LYY A;  1SBB B;  2W54 A;  3B2G A;  1HZ6 A;  1IUE A;  1D5M C;  4ARC A;  2MEK A;  2L1A A;  2BBC A;  1QOF A;  4GLS C;  1QOB A;  3ZGZ A;  1SB3 C;  5EE9 A;  5HFY A;  3R8B A;  3BYT B;  1FFU A;  4NZL B;  1ZDX A;  2BS2 B;  2QJL A;  4RF1 A;  1F2R I;  3TUO A;  2ONQ A;  2BTE A;  2M0A A;  2MJD A;  1SE2 A;  2RDG A;  2K3U A;  1P7F A;  3J9C A;  3VQI A;  3AE7 B;  4P6V F;  2WXK A;  1DYQ A;  1XF5 L;  3V05 A;  3AEB B;  2G1E A;  3W2D A;  2WXH A;  4A6Q A;  4B0E A;  3BVM A;  2LEK A;  2E6X A;  3AEC B;  3Q8C A;  1LO5 D;  3GP7 A;  1XEE A;  1C9F A;  1HQR D;  1XLP A;  1J7C A;  3BYY B;  1FRD A;  2R61 A;  1SE4 A;  2FE8 A;  1PYW D;  2ACZ B;  1IBX B;  2WXL A;  2PKO A;  2L52 A;  3BK1 A;  3FIL A;  1ENF A;  3VRA B;  3HVD A;  4RNA A;  5TSS A;  3AH7 A;  5JXV A;  3NVY A;  1BXT A;  4YWG G;  2KQ4 X;  3C8Y A;  1YN5 A;  3W5U B;  5MPO A;  4US8 A;  1EWC A;  2LJI A;  2PMV A;  1ET9 A;  1JWS D;  3NS1 A;  1UNS A;  5D3I B;  1I4H A;  4TMA B;  4Q2J A;  2K0P A;  1HA5 A;  4R3D A;  4WQM A;  2XNA C;  4A8X C;  1QKZ A;  1UGJ A;  1I4G A;  3I57 A;  2JX5 A;  1E9M A;  1V1P A;  1TY2 A;  1L6U A;  2JZP A;  2GRI A;  1TYG B;  2NMQ A;  1CZP A;  2JQR B;  3SFD B;  1JML A;  1WGK A;  3KWL A;  3NRZ A;  3TSS A;  4WUR A;  1DOY A;  5C2T B;  3BK2 A;  1FRR A;  2BB6 A;  3B9J A;  1SXT A;  3R2T A;  4YSY B;  1PGB A;  1NEN B;  1DOX A;  4RGN A;  3VR8 B;  4WAF A;  1FNV A;  1QF6 A;  3P4Q B;  5T8I A;  1YQ3 B;  1L0Y B;  2BS4 B;  1OQQ A;  4WIP A;  1ROE A;  2LGI A;  2JYT A;  4B0M A;  1JWB D;  2JWU A;  5BMG A;  2M56 B;  3P42 A;  1T3Q A;  1C4C A;  1GAQ B;  2H89 B;  1V1O A;  3AMZ A;  4REZ A;  1TKY A;  2WDV B;  1K51 A;  3DWG C;  2CU3 A;  2TSS A;  1SIJ A;  2DWQ A;  1IGD A;  2I38 A;  2IGD A;  2IGG A;  4YSX B;  1HEZ E;  5BYS A;  4UDU C;  4OW0 A;  1C4P A;  2LHD A;  1JRP A;  3SFE B;  1N61 A;  2JU6 X;  5FR3 A;  1IBX A;  3LB8 C;  3L4P A;  3W1S A;  1JWM D;  2WDQ B;  4NAM A;  4TQ0 A;  2L83 A;  4A55 A;  3LXF A;  1T5X D;  3AB5 A;  1WRI A;  1EM7 A;  4C7Z A;  4RF0 A;  3Q8F A;  2V3N A;  4AS1 A;  5AUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...