1J7BA

Structure of the anabaena ferredoxin mutant e94k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKKEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
molecule tags Electron transport
total genus 26
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7bA00
1DOYA 2K22A 1N60A 2KMMA 3AB5A 3LB8C 4JWUC 3DWGC 3AEFB 4N6EB 3RPFC 2W54A 4USAA 4FXCA 2WDVB 5EE1A 1ZXIA 1L6UA 2FBWB 3ABVB 3AEBB 3NS1A 1JW9D 3P63A 3AE8B 3AEAB 5GXGB 4YTMB 2L52A 2MJ3A 4YSXB 1E7PB 2H88B 1SB3C 2HTME 1PUTA 3P1MA 3ETRA 1DOIA 1N5WA 1B9RA 1QOGA 1PFDA 1NEKB 2WDQB 2PIAA 3AE5B 2WU2B 1OQRA 2L83A 3EUB2 1FM0D 4HRSA 1N5XA 1YQ4B 4N58A 2W55A 2Y5CA 2CJOA 2K9XA 1ROEA 4YTNB 1QF6A 5G5HA 1E9MA 4ZHPA 3AE6B 1J7AA 1JWAD 4C7ZA 3CWIA 3B2GA 1YQ3B 1FFVA 2OHFA 3W5VB 1RFKA 1R7SA 1AYFA 2JQRB 2M56B 1OFFA 3P4RB 4KX6B 1OQQA 1QOBA 5H92C 1DOXA 1E6EB 1TKYA 3AH7A 1XLQA 2EKIA 2W3SA 1E0ZA 1XLPA 2ACZB 1ZUD2 3AE1B 5MPOA 1PDXA 2H89B 3W5UB 5EE3A 5C2TB 1FIQA 2PVGC 1FRDA 3AE3B 3B2FA 1I7HA 4ITKA 1N61A 2KAJA 3VR8B 1NYQA 4YXDB 1GPXA 1XLNA 3SR6A 1N63A 4YTPB 3AE9B 2AX5A 1KRHA 1RYJA 4JWSC 5G5GA 3DWMA 1JALA 3LXFA 2MJDA 2WDRB 2QIEB 4ZOHC 1L0VB 1NYRA 4YSYB 5EE9A 1GAQB 3AEEB 1ZOYB 4C7YA 1QT9A 1EWYC 2PVOD 2Q5WD 1WGKA 5AUKA 1FXIA 4WWMA 3L4PA 1J7CA 3NVVA 2WP9B 1L5PA 1FRRA 3AMZA 4IDIA 5AUIA 1TYGB 3SFDB 3NVZA 4YSZB 1RWSA 2WS3B 1WXQA 2W3RA 3FAHA 1SIJA 4LTUA 1RM6C 3VRAB 1JWBD 1JQ4A 1IUEA 2WU5B 5C3JB 1TKGA 3P4SB 1TKEA 2MJEA 3NVYA 2JX5A 4YT0B 2M19A 4HROA 1SF0A 1WWTA 2DBYA 1CJEA 1JROA 2MH7A 1UWMA 2BS4B 3AECB 3BIID 4A9AA 1VLBA 1KF6B 1XO3A 1DGJA 1L6VA 1J7BA 1QLBB 1ZP0B 3AM9A 3VRBB 3HUIA 2K5PA 1VDVA 2G1EA 1CZPA 3NRZA 4WQMA 3HVZA 3W9CB 4US8A 3B9JA 4N59A 5EE0A 3VR9B 1FMAD 4US9A 1AWDA 2N0SB 1FXAA 4JX1C 1E10A 3ZYYX 3PO0A 2CU3A 3HRDD 3P4PB 3SFEB 5H8YE 1FO4A 3AV8A 4C80A 2WQYB 3NVWA 3AE4B 1YJIA 2BS3B 2CJNA 1QOAA 1JRPA 1A70A 1NENB 1T3QA 2BS2B 3AE2B 4P6VF 1KFYB 1NVID 1TJEA 4ZHOA 1F0ZA 2QJLA 1XLOA 3AE7B 3WCQA 2BT6A 1VJKA 2WLBA 1FFUA 3FC4A 3AEDB 3AN1A 3P4QB 1V97A 2DWQA 1V8CA 2LEKA 3CIRB 1N62A 2E3TA 2PKOA 3KWLA 1YJJA 2B76B 1WYGA 1QOFA 1NI3A 1WRIA 3AEGB
chains in the Genus database with same CATH superfamily
1WYWB 1DOYA 4ASWC 3TBLD 4W9GA 2KMCA 5IOIA 2JZPA 3TJPA 3VUWA 1CK1A 2AYOB 3R66C 2KXJA 2C7MB 2WDQB 3VQIA 2DNFA 1F2RI 2LD9A 1VRAB 4P16A 4F1SA 1L7YA 2L32A 2JQRB 2I1KA 1Z2MA 3DCGA 5JZEB 4DK5A 1X1MA 4LDTB 2FUG1 1IGCA 2LJIA 2O2VA 4DDGD 4M01A 1KRHA 1BT0A 3DWMA 3VH3B 1L0VB 5IN7A 1ZW7A 2PE9A 2QMTA 3JVZX 4LNNA 1RLFA 4OVZA 3LYYA 3PS6A 5JHAA 1V5TA 2GB1A 4ANVA 1EF1A 1V1PA 4XZ4A 3GZNB 1NI2A 1V1OA 2WDTB 2G3QB 1TS5A 4PT5A 4K1RB 4KVGB 3PRMB 3RT3B 4FADA 2WXHA 1C4AA 2RDBC 5HI1A 2I38A 4M8MA 4PS8A 3APFA 5LLIA 1NVID 2Y5BB 3V60A 2D3GA 2K1FA 2KZRA 2D5GA 3MJWA 3DBRB 1LGRA 1TY2A 4EZLA 2W9NA 2ZW0A 1N6ZA 1SE9A 4IG7B 4JWUC 3PVLA 4USAA 3NS8A 2JUOA 2AQ1B 2MJ3A 1RRBA 2JSVX 4WWNA 2LASA 3TEXA 1KLGD 2V3NA 3Q8CA 1MG4A 2V4IB 2KFKA 2K8HA 2WU2B 4HRSA 3CMMB 1I4HA 5AZHA 1QF6A 2UWQA 3NY5A 1JMLA 4I6NB 2JRHA 3BZDB 5CX3A 2N9LA 2LXAA 2O6VD 5HG2A 3AE1B 3WAPA 4ITKA 1NYQA 1E7VA 5IO9A 2IDYA 3DVNU 2KQSA 1WJ4A 1WGGA 4C7YA 3UQBA 5AUKA 4S0RA 4WWMA 2LVQA 3ZO5B 1LQBA 2AL3A 4BKTA 1E8ZA 4NAWA 2IY0B 2GOWA 3TL5A 1SF0A 1UWMA 2B3AA 4MM3A 1L6VA 2LMCA 5T8IA 3B9JA 1SBBB 1FMAD 4US9A 2BYTA 1FXAA 4AS1A 3Q8EA 3SFEB 3V62A 3NZUA 1LM8B 2J4XA 2MQJA 2REXA 1VZ8A 4E74A 2K3UA 3T8MA 4IM2A 2KJ6A 3ML8A 3QIJA 1JWUD 5BYSA 4N9F4 1AN8A 3W1SC 1N60A 1PGXA 3QA8A 1TS3A 2BWFA 2BYFA 3NOBA 4GLSC 1SB3C 1IYFA 4ZRPA 2FIDA 2DHZA 3A9KB 4CYEA 2IGDA 1F9JA 1YX5B 2BKRB 3H6NA 4FLHA 4YTNB 2IGHA 2DX5B 4HJGE 4BKSA 4XWWA 1K53A 2KDBA 2WXRA 3P4RB 5HHDG 1SSNA 3WAMA 2G45B 1TS4A 1VR9A 1ZUD2 4RGOS 3B2FA 4M0WA 2DZJA 4M02A 3DPDA 4DBGA 3NUHB 3Q8AA 1UBQA 4L23A 2KDFB 3LXFA 4EOYA 4GXBA 1J0GA 1ZXHA 2KMAA 2MBEA 4J3OD 2WS3B 4DHZE 3JSVB 1ISNA 4TV3A 3NHEB 2JX5A 4A55A 4YT0B 5EDSA 2HTHA 3BIID 1ESFA 2GMIC 4A9AA 4BAXA 1SXTA 2X8XX 3PPAA 3RZWC 2X38A 3L10B 3HVZA 1Y8RC 3KUZA 4MACA 2BW2A 2L76A 4M00A 3TIXA 1XCTL 3NZ3A 2LUMA 1ZDXA 1WGRA 2BB6A 2KLGA 4GDKB 1UELA 2GBJA 2V3PA 4LK0M 1WGHA 4DQOC 4Q2JA 3ZXRA 2Y5PA 1WI0A 1QOFA 5DPRA 2J52A 3AEGB 2WXOA 1P3QU 1FNUA 4XGAB 3RPFC 3U52E 1R4NB 4XDCA 5JXVA 1JW9D 3AEAB 4IW0A 2IO1B 4EFOA 1P98A 1GOZA 4FHJA 1BXTA 2DLBA 4KIKB 2MBHA 4HDQA 4WAAA 2SEBD 2L1AA 3K9OB 5L83A 4E3CA 1FM0D 3X23A 2NVUI 2DAJA 4KDIC 2C7HA 3DBLB 3C8YA 1JWAD 4EE2A 2WXPA 1FFVA 3DOWA 3KYCD 1OFFA 4WAFA 1TKYA 2D3AA 2W3SA 2J0KA 3MTNB 4GB9A 5C2TB 2WXLA 5GMVA 1HTQA 3W1SA 1Q5WB 2GI9A 3VHTC 3RNGC 3KLSX 1Q0WB 4LNKA 2OEDA 2MHJA 3SHQA 1WXQA 2KFJA 5DCNA 3ZVVA 3PZ7A 4WJQA 2BYEA 1WJUA 5CHVC 1WM2A 4BBNC 1DYQA 1UZXB 3M3JA 2MEKA 1P1AA 5DPSA 3Q8BA 2ZVNA 1J7BA 4WQMA 2K8CA 1UD7A 3A9JB 4C4VA 1WIAA 2ZZPB 2CKHB 3DVNV 4JQWC 2NBUA 3R3MA 4J6IA 3ZGZA 4GOCA 2EMSA 2V4LA 4RMAA 4LDTD 3PLVA 1PGBA 4PK1A 2AEHA 3BVMA 3RNAC 3RNFC 1V49A 1U4AA 2M0AA 2ZCCA 3AB5A 2KACA 4N6EB 4K3BA 4NJ7A 2JU6X 2N7JA 3AEBB 1GG3A 1T6BX 3Q14C 3MHSD 1E8WA 4IM3A 5DPWA 4NY0A 3P1MA 4A8XC 1DOIA 4FJYA 3TUOA 3RYTA 3OLMD 5AZGA 2KX3A 3W1YA 1C1YB 4RGMA 1FCLA 2OHFA 3V3XA 2M56B 1QQRA 2MX2A 4RCOA 2N7DA 2KWVB 5AZFA 4MJSB 3RD2A 3VAWA 3T9LA 1QILA 3HM3A 4GGQA 4JPSA 1WY8A 3EC8A 1GUAB 4WWOA 4FA6A 4EUTA 4G11A 2MLBA 3X0WA 1WE7A 1M94A 1J8CA 3QX1A 4KKIA 4LTUA 1HEZE 1RM6C 2NPTA 2XK5A 2LRUA 1EU3A 1TTNA 1PQSA 2MP2B 3B1LX 1LO5D 3BVZA 2MH7A 4AQ7A 2KC1A 3QAQA 4RGTA 4LJOB 3SEBA 3KQ4A 2KJHB 4JX1C 3W2DA 3PO0A 3ZYYX 1T0RC 2CJNA 4HCNB 1WGYA 2LGXA 2GBRA 1E7UA 1VJKA 2JZZA 2IPKD 4B0EA 4AWJA 1T5XD 2R2OA 4FULA 4TMAB 2FAZA 1WYGA 1SIJA 1XXGA 2PJHA 1UBIA 3DWGC 3H7PB 3IHPC 2WDVB 5EE1A 3HM6X 4A90A 3V6EB 3I3TB 3AE8B 3PHWB 2WXQA 3FILA 3KUDB 2RGFA 2DZIA 3AXCA 2R61A 4GMVA 4MGZE 1E90A 3PZDA 5IP4D 1EWCA 3RFZB 1XT9B 2K9XA 2L00B 1V6EA 1V9JA 1OQYA 4P1CC 4YWGG 1E0ZA 1PDXA 1VZ6A 1LXDA 4W9KA 2PVGC 2NMQA 4YXDB 2RPVA 3GE3C 3SR6A 1C4PA 1KH0A 1N63A 3T3NA 4HK2A 5G5GA 2C9WB 2V3SA 3BVGA 3V61A 1NYRA 2MW5A 2LUEA 4KDLB 2BB5A 3PZ8A 3ZRFA 3AULA 3KW5B 3IXSA 1JQ4A 3S2AA 1E5WA 2JWUA 4JE3B 1A5RA 1SE2A 2QHOA 2K8BA 1K51A 5D94A 4MSMB 2K6DB 1DGJA 3VRBB 2K5PA 1ZE3D 4BKGA 4HKZE 2N9EB 1GJZA 2MBBB 2FCNA 2WQYB 1XEEA 2KQ7A 4ARIA 3NJTA 1HA5A 3Q3FA 4HPMB 3RUIB 3ZTCA 1XLOA 2BT6A 3PLUA 5TSSA 2GLSA 3AN1A 3P42A 3LDZE 2FCQA 2XEWA 2JPHA 2KHWB 2QILA 4WWPA 1D5ZC 1WJNA 5C23A 3IVFA 1WR6E 3EFUA 3IT6B 3ZXVA 4EKUA 3V05A 1FCCC 4UDUC 4ARCA 4HLEA 1BMLC 2V9HA 4NZLB 3RMKC 3IAM1 2KO3A 3EUB2 2J0MA 1HZ5A 4GDLA 3GZNI 3EFCA 3ZNID 4JIOU 3QK0A 1FNWA 2KJRA 3W5VB 4JL9A 2MWSB 1XLPA 4IC7B 1GC7A 2YLMA 3AE3B 4OVUA 1E8YA 4ZYNA 1I7HA 5IAAC 2HE7A 4KSKC 1GB4A 2ON8A 3H7SA 4ICVA 3DVGY 2KTRB 1JALA 2MJDA 4YSYB 4DHZB 2AWTA 5FK9C 1EF5A 2Q5WD 1WH3A 4W9JA 2WP9B 1QKZA 3DBRI 4M8NA 1XF5L 3VRAB 1C76A 2O6VA 3U30A 3MFGA 3ZIMA 2XBBC 3WANA 1TZ1A 4B6WA 1IBXB 1JROA 1SE3A 5G55A 4XC2A 1K52A 2BVCA 3SD5A 1GNUA 4NQLB 2CHXA 3HRDD 3SU8X 3I63C 1L4DB 4YL8A 1JRPA 2MSED 3IBEA 3AE7B 4ICUA 3A1QA 3RZFA 2DYBA 3TCAA 2BGFA 4MH0E 1S3SG 3KYDD 3AEFB 3CSFA 2ZEQA 1VZ7A 2IO2B 2CHWA 2L52A 3A4SC 3ZDTA 1G6JA 2YEPF 2RPQA 1EUVB 5D3DA 3N1YC 4RF1A 3ONSA 2WGSA 4RM9A 2DYMA 3BYTB 1PFDA 3U7DA 1EM7A 2PIAA 3AE5B 1OQRA 2ASQA 2LFIA 1GC6A 1D4BA 4MELA 1E9MA 1NBFC 4ZHPA 2IZVB 1J7AA 2KT7A 1Q10A 2CHZA 3AU5A 2DAFA 2KOXA 1R7SA 4FJVB 4BOZB 1IPGA 2GBKA 1S1QB 3VVWB 4NJCA 2BTEA 4AUQC 3EHVA 2Z8LA 3PV1A 3ECIA 2GBNA 3CF6E 2PTLA 2NTTA 1RYJA 2IJ0A 2IO3B 4WH4A 2QIEB 4YSZB 3AEEB 1ZOYB 5J17A 3KUCB 1L5PA 2MCNB 1FRRA 3AMZA 3N9YC 3ALBA 3VH4B 1IUEA 2HDEA 5C3JB 3VTWA 4DXFA 1CMXB 3DBHB 2MA9B 2O2VB 1WF9A 4WJNA 1KF6B 3HK0A 1ZP0B 1V80A 3VR9B 3BY4B 1LFDA 1UWXA 2I2YA 1MG8A 3HIZA 2N9PC 1KTKA 1YJIA 3IT4B 1FD6A 3GS2A 1V1PB 2LRWA 3P4QB 4W9LA 2PKOA 3Q69A 1D5XC 4MGIE 5FKAC 4URKA 3DDCB 1OTRB 4P1BC 1I4RA 1OGWA 2N1WA 4FXCA 1WMHA 2KYWA 4MEMA 2FBWB 1L6UA 2LGDA 3JW0X 5GXGB 3B0AA 1RFAA 5BYQA 2WNMA 2ZNVB 2WXJA 1N5WA 4PYZA 2L3ZA 4TUUA 2IGGA 2M17A 4HXDA 1C79A 2ONQA 3OJ4B 1V5OA 4D2KA 3H1UA 2PPHA 4F8CB 4DXGA 1R4MB 3UQAA 3EGRA 4IM0A 1DOXA 4A3OA 1XLQA 2J53A 4E71A 2ACZB 3L13A 1SEBD 2INCC 4RH6A 4B9KA 1XLNA 3Q3JA 2QEJC 4YTPB 2KFKB 2DYOA 5D6JB 3UIOB 5BYRA 2EMTA 1I35A 1ET9A 5KHOA 4LLGM 1RWSA 2KWCA 2KX0A 2OJRA 1WXAA 2Z0DB 1TKEA 3M63B 1SJED 1R4NI 3GE8C 3ZNZB 3WA0A 2KTFA 3CSTA 1JWSD 4XX5A 3E56A 1CZPA 4II3B 2LVPA 2BF8B 2N0SB 3ZRCA 3ENEA 5H8YE 1KJTA 2GBMA 3AV8A 3NVWA 4NAWB 2EELA 4ZHOA 3DBLI 2EKEC 2QJLA 4KZ0A 3URYA 3L16A 3UI3A 2C5LC 1V8CA 4MM3B 2JWZA 1H4RA 5L95C 1ENFA 1YJJA 2A5UA 4PS7A 4DHJB 4KZCA 4CHKA 1WSPA 4RM8A 3I9V1 1YJ1A 1YD8U 2CS4A 3NG0A 3DHIC 1SGHA 4K3CA 4PS3A 2IBIB 2A4ZA 2KC2A 1I4QA 1QOGA 4LCDE 3KVFB 3ZDMC 3BK1A 2Y5CA 2FUHB 2XNAC 2WWZA 2R2QA 4IKGA 1T0YA 2JXXA 1HZ6A 4KKJA 3OWEB 1YQ3B 2E6XA 3DQVA 1E6EB 3VUXA 2JXTA 1M4VA 3KWVA 3Q6BA 2ICIA 1GPXA 1TIFA 3AE9B 1D5MC 1I4XA 5CTRC 2PW9A 1YN5A 4BZAA 5C1ZA 3BK2A 2WHIA 2WYQA 2W82A 3E9SA 3NVZA 3Q3NC 1Q1OA 4DXAB 1TKGA 3ZJUA 4HWIB 3TEYA 2YEPB 3NVYA 1L0XB 4I6LB 4IOIE 4M0WB 4RNAA 3AECB 2NS5A 2VH2A 1QLBB 2K39A 2N4FA 1UF0A 3W9CB 3Q3OC 4R3DA 4RFBA 2KANA 2D3CA 1XD3B 2J7QB 2CR5A 3N30A 1I4GA 3ZW3A 3JYUA 5TR5A 2LGSA 3IG3A 4BBNF 4FHKA 2WLBA 3ZLZA 4F7ZA 2LWPA 4GIVA 2KTRA 2LZ6A 3PSEB 1F1HA 4REZA 4EZJA 4WQOB 3RNBC 4NJ6A 3MC9A 2DENB 2GRIA 2W54A 2D07B 4OZAA 1ZXIA 5D7GA 5BO4B 4DWFA 1VCBA 4W9HA 2ZNVC 2H88B 1MFWA 2C7NB 4B95A 1C4CA 2RDHA 2WXIA 4L2YA 3TMPB 4MGYE 3ZKJC 3ZQ4A 2I1JA 1YQ4B 3TEZA 1ROEA 1ET6A 2JF5A 3R2TA 3AE6B 1MI0A 4ZRIA 5AEKB 1HE8A 1OQQA 4RF0A 2KNBA 2FIFA 2LGIA 3V6CB 5MPOA 1UUPA 5EE3A 3B08A 1PGAA 1YOVB 3BWUD 2WXGA 2G9HD 2BYVE 4ZOHC 5D2MB 4KSLC 1B1ZA 2M8SA 1WJ6A 1HTOA 3FAHA 3Q8FA 2G4DB 3I57A 2WU5B 2L8JA 3QJZA 4NNJB 1KOTA 2TSSA 2M19A 3QC8B 4KGTA 4RGNA 4IWQA 3HUIA 1WRDB 4W9CA 3APCA 3P4PB 2UYZB 1MPEA 2N9XA 3PHXB 3AE4B 1V86A 1WFYA 3TEWA 3WCQA 3A9KA 5G2NA 4H2AA 1EU4A 2JYTA 3CIRB 4HCPB 2N9KA 4OZCA 1N62A 3T3OA 4CO7A 2KN5A 4BVUC 4C4VB 2K22A 4ZRQA 5J2RA 4DDID 3ZJTA 1JWMD 2M4NA 4S17A 3DVGX 4YSXB 2KD0A 1L2NA 4X57B 2Z0EB 4A3PA 2MBOA 3L0WB 1L4ZB 2L83A 4MT5A 1ACCA 2UU7A 1MVKA 4N58A 4I6PA 4IUMB 1L0YB 3PGEA 1TS2A 2G4SA 2Y3AA 2KLCA 5LXHA 3JSVA 1ZGUB 1MHHE 4OW0A 1FXTB 1SJHD 3W5UB 3R2IA 4C80A 3PRZA 1N61A 2V0GA 2DZKA 2AX5A 4G0NB 1D6EC 2KVZA 1K50A 3A33B 3RCZA 1J7CA 4IDIA 2C60A 4GDKA 1JWBD 3P4SB 3VTVA 2AL6A 3U7ZA 4HROA 5E6NA 1HXYD 2NCNA 1VLBA 4WJPA 2NBWB 4JLCA 3UINB 5JHBA 2D10A 4US8A 1AWDA 3AI5A 1UGMA 3PTFC 2OJWA 3ZTDA 3EA6A 2PEAA 4KV2A 1P7EA 3OAWA 4AP4C 2NPTB 2XK5B 1NENB 5HKHA 4P6VF 4GN1A 1SE4A 2RR9A 4KIKA 1HQRD 2ZJDA 4K7SA 3NZSA 1V81A 1FPYA 2WXKA 2VZKD 3LB8C 5IA7A 2MBQA 4HEA1 2L05A 3VUYA 3D32A 3ZNHB 2KDMA 5E6JA 3OG5A 1C9FA 1E7PB 3RN9C 4IWOA 3VFKA 1PUTA 4EZKA 1B9RA 2AQ2B 1NEKB 4MGKE 1I4PA 3UGBB 3ZNGC 4TSSA 2IY1B 3K9PB 4MDKE 4C7ZA 4B0MA 3WALA 2D3BA 1QOBA 3FILB 3DHHC 2L0FA 3AH7A 2EKIA 1D3ZA 3GP7A 5JH5C 1F0ZA 2KAJA 2IO0B 2HJ8A 3R7QA 4II2B 1GAQB 1MJDA 4DHJD 3A9JA 2LVOA 2WX1A 1WGKA 2XN9C 4ZYSA 3L54A 3NVVA 3C19A 2K25A 1Z5SB 2W3RA 1F2RC 3P2BA 2FE8A 1YN3A 3O13A 3VXWA 2MRPA 4GSWA 1MHXA 3O65B 1WWTA 2NR2A 2QCZA 1JRUA 3Q2AC 1WXSA 4TQ0A 4KGRA 3MJ5A 1UGJA 3HHMA 2BBCA 2BS3B 2LI5A 4NAMA 1KFYB 2JYEA 3IAS1 5LXIB 2L0TA 3AU4A 1F77A 3AEDB 4FBJB 1V97A 2E3TA 3KWLA 1CQVA 1E8XA 4EEWA 1WRIA 2FNJB 1C77A 4IWPA 4W9EA 2ZVOA 4BKSD 3BINA 2FCSA 2HJ1A 4YTMB 2IYDB 2WX0A 3ZJVA 5BMHA 1F52A 2BQQA 1AARA 4LNFA 4KGSA 5KHQA 3ETRA 4MJSA 1Y56A 4FJZA 2JRIB 2PE6B 4OHJA 5FR6A 4A6QA 2RSUA 1TGZB 2W55A 2CJOA 3QWZB 3DBHI 3APDA 3DHGC 4OVVA 3CWIA 3PRPB 4TKNA 2M1MA 4TQ1A 2YVCA 4XDDA 4CQNA 3IFWB 1WGDA 4HPPA 2H89B 2MP2A 4BOSC 3N1ZC 1YQBA 1IGDA 1YIWA 1K8RB 2CU1A 2WDRB 5EE9A 4GDLB 2PVOD 4GU2A 4HJKA 1C78A 3L4PA 1C3TA 2PMVA 3SFDB 3M62B 2LHDA 1OEYJ 2MJEA 3QHTA 1FEHA 1YMHE 4XE0A 2LHEA 4QAYA 2SAKA 4WIPA 2DBYA 2KVRA 2INDC 1WR1A 2KDIA 3AM9A 4O1NA 2D2QA 3J9CA 3MHZA 3OJ3A 2G1EA 3U2SC 2VZKB 3N3KB 4BFRA 3H7PA 2WXMA 4W9DA 2QSDA 1NDDA 1SIFA 3N1XC 3M95A 1P0RA 1T3QA 4HVBA 2O6VB 2Z59B 2RDGA 1R4MI 1XCQL 2J42A 3H9DA 4LNOA 2BKFA 2KN4A 1FNVA 4HKQA 2DWQA 5DPTA 3GOEA 5IKCM 3ML9A 2NBVB 2B76B 1TZOA 3H8HA 1YNTE 2DZMA 4ZRJA 2KMMA 1GB1A 3TSSA 1YN4A 4P7IA 3N32A 3N20C 3NS1A 3P63A 1ZDVA 2J0JA 4G50A 4AJWA 1J19A 3A1QB 4JGHB 4WJOA 4XWTA 2KWUB 3KH0A 1N5XA 1KM7A 2D11A 2INPE 1WE6A 5CHFA 1BUIC 1TT5B 4NQKE 3UIPB 4KX6B 2RD0A 5J18A 1I42A 2NTSA 2ZPYA 1P9DU 1T0SC 1FIQA 1FRDA 1ZKHA 3U4EG 1UNSA 4JWSC 5E6OA 2K6QA 2BWES 1QZEA 4HDOA 1QT9A 1ZPSA 1TYGB 1TBEA 4K7UA 3ZUNA 2AQ3B 3QQ8B 3VTUA 2WXFA 1WX7A 2JY6A 2KQ4X 3BYYB 2KKCA 1PYWD 2LJ5A 4NPNA 4AJYB 3QCAA 4C00A 2K0PA 3LJ3A 2HD5B 2BS4B 1AW7A 1XO3A 3EECA 5D3IB 4ZDVA 2JZ3B 1YX6B 2QDFA 1VDVA 3NRZA 3Q3MC 1RAXA 4N59A 5EE0A 4G3XB 2BPSA 2VH1A 1E10A 4WURA 2KDEB 3MC0B 1VD2A 1FO4A 2VRRB 1QOAA 4AOFA 3A4RA 3AE2B 1TJEA 3FKYA 3GB1A 3RNEC 4ACFA 1FFUA 3FC4A 4MSQB 2M0XA 4ZRKA 4PYUA 2LEKA 1T0QC 3R7RA 4ANWA 1NI3A 3QARA 3R8BA 2OOBB 3L08A 3C0RB 2ZPNA 3ABVB 4L1BA 3HVDA 2LXCA 1V2YA 1WX9A 2HTME 1P7FA 3MC8A 2ZCBA 2ZW1A 1JCKB 1WXMA 1H8CA 5FR3A 4K7WA 5G5HA 3RNCC 4HPLB 4ANXA 3B2GA 3WIMA 1WMHB 2QC8A 1RFKA 1WZ0A 1AYFA 1WZ3A 5H92C 2LGYA 1UH6A 1KLUD 3PREA 4FN2A 2WXNA 3DBSA 3VR8B 1IBXA 1EO6A 5CHWA 5E6PA 2N7EA 4W9FA 2INNE 3UF8A 1EWYC 4A20A 1FXIA 3PT2B 3U8ZA 4MH8A 5AUIA 2N1VA 5BMGA 5LNK1 2FCMA 2PLPA 4LJPB 4ANUA 3VDZA 3MP9A 3RULA 2KWDA 1XQQA 4C56C 1CJEA 1IP9A 3I5JC 2L7RA 3RI7C 2JT4B 4K81A 1OEYA 3WAOA 4XYCA 2CU3A 3L17A 5BMIA 1WXVA 2KK8A 4OZBA 1STEA 1A70A 2V1YA 5HFYA 2BS2B 5I4DA 1KLVA 3SDLC 2RMMA 1TY0A 4LNIA 1WM3A 4W9IA 1WX8A 2JVCA
chains in the Genus database with same CATH topology
1DOYA 3AB5A 3LB8C 2KACA 4N6EB 4HEA1 4FXCA 2FBWB 1L6UA 2JU6X 2N7JA 3AEBB 5GXGB 1T6BX 2KDMA 5E6JA 1C9FA 1E7PB 5BYQA 1PUTA 3P1MA 2WNMA 2JZPA 4A8XC 1CK1A 1DOIA 2WXJA 1N5WA 1B9RA 3TUOA 2AQ2B 1NEKB 2WDQB 3VQIA 2IGGA 1I4PA 1F2RI 1C79A 2ONQA 4TSSA 1VRAB 4P16A 4D2KA 4DXGA 4RGMA 4C7ZA 1FCLA 4B0MA 2OHFA 2L32A 3EGRA 2JQRB 2M56B 3V3XA 1QQRA 1QOBA 1DOXA 3FILB 3AH7A 1XLQA 2EKIA 2J53A 2ACZB 4RCOA 2FUG1 3GP7A 1IGCA 1F0ZA 1SEBD 2KAJA 2LJIA 4RH6A 1XLNA 2QEJC 1QILA 4JPSA 4YTPB 1KRHA 2DYOA 3DWMA 5BYRA 1L0VB 1GAQB 1WGKA 2QMTA 2XN9C 1ET9A 4ZYSA 3NVVA 4LLGM 4OVZA 3LYYA 1RWSA 2W3RA 4KKIA 1F2RC 1HEZE 1RM6C 4LTUA 2GB1A 1EU3A 1TKEA 2FE8A 1V1PA 1YN3A 1LO5D 1SJED 3O13A 1MHXA 3BVZA 1WWTA 1V1OA 2MH7A 4AQ7A 4RGTA 1TS5A 4PT5A 1JWSD 3SEBA 3E56A 4TQ0A 1CZPA 3KQ4A 4KGRA 3MJ5A 2N0SB 1UGJA 4JX1C 2WXHA 3PO0A 3W2DA 3ZYYX 1C4AA 5HI1A 5H8YE 3AV8A 2I38A 2BBCA 3NVWA 4NAWB 2BS3B 2CJNA 2EELA 4ZHOA 4NAMA 1KFYB 1NVID 2JYEA 3IAS1 2QJLA 3URYA 2D5GA 1VJKA 3UI3A 2IPKD 1F77A 3AEDB 4B0EA 1T5XD 1V97A 1V8CA 4MM3B 1TY2A 4TMAB 2E3TA 3KWLA 1CQVA 1ENFA 1YJJA 1WYGA 1XXGA 1SIJA 1WRIA 2ZW0A 1C77A 4JWUC 3DWGC 1WSPA 4USAA 3I9V1 2WDVB 5EE1A 4A90A 3AE8B 2WXQA 3FILA 2AQ1B 2MJ3A 2JSVX 4YTMB 3ZJVA 5BMHA 3TEXA 1KLGD 2R61A 4KGSA 1I4QA 3ETRA 2V3NA 3Q8CA 2V4IB 1Y56A 1QOGA 4OHJA 4A6QA 2WU2B 3BK1A 4HRSA 1EWCA 1I4HA 3RFZB 2W55A 2Y5CA 2CJOA 2K9XA 2XNAC 1QF6A 4IKGA 4KKJA 1HZ6A 3OWEB 3CWIA 1YQ3B 1JMLA 2E6XA 4TQ1A 4XDDA 4CQNA 3BZDB 1E6EB 2N9LA 2JXTA 1M4VA 3KWVA 4YWGG 5HG2A 1E0ZA 3AE1B 1PDXA 2H89B 1VZ6A 2ICIA 2PVGC 2NMQA 4ITKA 4YXDB 2RPVA 1NYQA 1GPXA 3SR6A 1C4PA 1KH0A 1N63A 1IGDA 3AE9B 3T3NA 1D5MC 2IDYA 1I4XA 5G5GA 2WDRB 3BVGA 4C7YA 1NYRA 5EE9A 2PW9A 1YN5A 4GDLB 2PVOD 1C78A 3BK2A 5AUKA 4WWMA 3L4PA 2W82A 3E9SA 2PMVA 3SFDB 2BB5A 3NVZA 3PZ8A 3IXSA 1JQ4A 2LHDA 1TKGA 3ZJUA 2JWUA 2MJEA 4JE3B 3TEYA 1FEHA 1SE2A 1YMHE 2YEPB 3NVYA 4XE0A 2LHEA 1L0XB 4RNAA 2SAKA 4IOIE 4WIPA 1SF0A 1K51A 2DBYA 1UWMA 3AECB 1DGJA 1L6VA 1QLBB 3AM9A 3J9CA 2LMCA 3MHZA 4O1NA 3VRBB 2K5PA 2G1EA 3U2SC 3W9CB 5T8IA 3B9JA 4RFBA 1ZE3D 1SBBB 4HKZE 1FMAD 2VZKB 4R3DA 4US9A 2BYTA 1FXAA 2WXMA 3Q8EA 4AS1A 2QSDA 3SFEB 2WQYB 1I4GA 1XEEA 2J4XA 1T3QA 4ARIA 1HA5A 2RDGA 1VZ8A 1XLOA 1XCQL 2J42A 2BT6A 2K3UA 2WLBA 5TSSA 2KN4A 3AN1A 3P42A 1JWUD 5BYSA 1FNVA 4HKQA 2DWQA 2QILA 1D5ZC 1AN8A 2B76B 1TZOA 3H8HA 4REZA 1YNTE 1N60A 2KMMA 1PGXA 1GB1A 3TSSA 1YN4A 3IT6B 2GRIA 2W54A 4OZAA 1TS3A 1ZXIA 3NS1A 3P63A 5D7GA 3V05A 1FCCC 1ZDVA 4UDUC 4GLSC 4ARCA 2H88B 1SB3C 1BMLC 4ZRPA 4NZLB 1C4CA 2IGDA 2RDHA 2WXIA 4L2YA 3IAM1 3EUB2 4XWTA 3ZQ4A 1N5XA 1YQ4B 1HZ5A 3TEZA 2INPE 1ROEA 1ET6A 4YTNB 2IGHA 3R2TA 3AE6B 4HJGE 4XWWA 1MI0A 1FNWA 3W5VB 1BUIC 1K53A 2WXKA 2WXRA 3P4RB 1OQQA 4KX6B 4RF0A 5HHDG 1SSNA 1TS4A 1VR9A 2LGIA 1XLPA 1ZUD2 2NTSA 5MPOA 1UUPA 5EE3A 4RGOS 1FIQA 3AE3B 1FRDA 3B2FA 4M0WA 1I7HA 1PGAA 3BWUD 1GB4A 2ON8A 3U4EG 2WXGA 3NUHB 3Q8AA 1UNSA 2G9HD 4JWSC 4L23A 1JALA 3LXFA 2MJDA 4ZOHC 4YSYB 1B1ZA 1QT9A 1ZPSA 5FK9C 2Q5WD 1ZXHA 2WP9B 1QKZA 1TYGB 1XF5L 4J3OD 2WS3B 3FAHA 3Q8FA 3VRAB 3I57A 2WU5B 1C76A 2AQ3B 2WXFA 3MFGA 2KQ4X 3BYYB 1PYWD 2TSSA 2JX5A 4A55A 4YT0B 2M19A 1IBXB 2K0PA 1JROA 4KGTA 4RGNA 1SE3A 1ESFA 2BS4B 3BIID 4A9AA 1AW7A 1K52A 1XO3A 5D3IB 1SXTA 3HUIA 1VDVA 3NRZA 2X38A 3HVZA 4N59A 5EE0A 4MACA 2BW2A 1XCTL 1E10A 3NZ3A 4WURA 2LUMA 3HRDD 3P4PB 1ZDXA 3MC0B 1FO4A 2BB6A 1MPEA 1L4DB 3AE4B 4GDKB 1QOAA 1JRPA 3AE2B 3TEWA 2V3PA 1TJEA 3GB1A 3AE7B 3WCQA 1FFUA 3FC4A 4LK0M 4H2AA 4DQOC 1EU4A 2JYTA 4Q2JA 2LEKA 3CIRB 2N9KA 2Y5PA 4OZCA 1N62A 1QOFA 1NI3A 3T3OA 3R8BA 2J52A 3AEGB 2WXOA 2K22A 4ZRQA 3AEFB 1FNUA 3RPFC 1VZ7A 3ZJTA 3U52E 4XDCA 5JXVA 3ABVB 1JWMD 4L1BA 1JW9D 3HVDA 3AEAB 2L52A 4YSXB 1GOZA 2HTME 2YEPF 1P7FA 1BXTA 2DLBA 5D3DA 2ZW1A 4RF1A 1JCKB 2DYMA 2SEBD 2L1AA 1PFDA 3BYTB 1EM7A 2PIAA 3AE5B 1L4ZB 1OQRA 2L83A 4MT5A 1FM0D 1ACCA 1MVKA 2LFIA 4N58A 1D4BA 5FR3A 5G5HA 1L0YB 1E9MA 4ZHPA 1J7AA 1JWAD 1TS2A 3C8YA 2WXPA 1Q10A 3B2GA 4EE2A 2Y3AA 1FFVA 1RFKA 1R7SA 1AYFA 1OFFA 5H92C 4WAFA 1MHHE 1TKYA 4OW0A 1KLUD 1SJHD 2W3SA 4NJCA 2BTEA 2WXNA 3W5UB 3R2IA 5C2TB 2Z8LA 4C80A 3VR8B 2WXLA 1N61A 1IBXA 2V0GA 2AX5A 2PTLA 2NTTA 1RYJA 2IJ0A 1D6EC 4WH4A 2QIEB 4YSZB 1K50A 2INNE 3AEEB 1ZOYB 3W1SA 1EWYC 1FXIA 2GI9A 1J7CA 1L5PA 4MH8A 1FRRA 3AMZA 4IDIA 3KLSX 3N9YC 5AUIA 5BMGA 2OEDA 1WXQA 5LNK1 3PZ7A 1JWBD 1IUEA 2HDEA 5C3JB 2PLPA 3P4SB 3MP9A 1DYQA 4DXFA 2KWDA 3U7ZA 4C56C 2MEKA 4HROA 1CJEA 1HXYD 1VLBA 3Q8BA 1KF6B 1J7BA 1ZP0B 4WQMA 4US8A 3VR9B 1AWDA 1UWXA 2I2YA 2CU3A 3EA6A 5BMIA 1P7EA 1KTKA 1YJIA 4OZBA 3ZGZA 1STEA 1NENB 1A70A 3IT4B 5HFYA 2BS2B 4P6VF 1FD6A 5I4DA 1SE4A 3GS2A 1V1PB 1PGBA 1HQRD 2RMMA 3P4QB 1TY0A 3BVMA 2PKOA 3Q69A 1D5XC 5FKAC 2M0AA 2VZKD 1I4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOY A;  2K22 A;  1N60 A;  2KMM A;  3AB5 A;  3LB8 C;  4JWU C;  3DWG C;  3AEF B;  4N6E B;  3RPF C;  2W54 A;  4USA A;  4FXC A;  2WDV B;  5EE1 A;  1ZXI A;  1L6U A;  2FBW B;  3ABV B;  3AEB B;  3NS1 A;  1JW9 D;  3P63 A;  3AE8 B;  3AEA B;  5GXG B;  4YTM B;  2L52 A;  2MJ3 A;  4YSX B;  1E7P B;  2H88 B;  1SB3 C;  2HTM E;  1PUT A;  3P1M A;  3ETR A;  1DOI A;  1N5W A;  1B9R A;  1QOG A;  1PFD A;  1NEK B;  2WDQ B;  2PIA A;  3AE5 B;  2WU2 B;  1OQR A;  2L83 A;  3EUB 2;  1FM0 D;  4HRS A;  1N5X A;  1YQ4 B;  4N58 A;  2W55 A;  2Y5C A;  2CJO A;  2K9X A;  1ROE A;  4YTN B;  1QF6 A;  5G5H A;  1E9M A;  4ZHP A;  3AE6 B;  1J7A A;  1JWA D;  4C7Z A;  3CWI A;  3B2G A;  1YQ3 B;  1FFV A;  2OHF A;  3W5V B;  1RFK A;  1R7S A;  1AYF A;  2JQR B;  2M56 B;  1OFF A;  3P4R B;  4KX6 B;  1OQQ A;  1QOB A;  5H92 C;  1DOX A;  1E6E B;  1TKY A;  3AH7 A;  1XLQ A;  2EKI A;  2W3S A;  1E0Z A;  1XLP A;  2ACZ B;  1ZUD 2;  3AE1 B;  5MPO A;  1PDX A;  2H89 B;  3W5U B;  5EE3 A;  5C2T B;  1FIQ A;  2PVG C;  1FRD A;  3AE3 B;  3B2F A;  1I7H A;  4ITK A;  1N61 A;  2KAJ A;  3VR8 B;  1NYQ A;  4YXD B;  1GPX A;  1XLN A;  3SR6 A;  1N63 A;  4YTP B;  3AE9 B;  2AX5 A;  1KRH A;  1RYJ A;  4JWS C;  5G5G A;  3DWM A;  1JAL A;  3LXF A;  2MJD A;  2WDR B;  2QIE B;  4ZOH C;  1L0V B;  1NYR A;  4YSY B;  5EE9 A;  1GAQ B;  3AEE B;  1ZOY B;  4C7Y A;  1QT9 A;  1EWY C;  2PVO D;  2Q5W D;  1WGK A;  5AUK A;  1FXI A;  4WWM A;  3L4P A;  1J7C A;  3NVV A;  2WP9 B;  1L5P A;  1FRR A;  3AMZ A;  4IDI A;  5AUI A;  1TYG B;  3SFD B;  3NVZ A;  4YSZ B;  1RWS A;  2WS3 B;  1WXQ A;  2W3R A;  3FAH A;  1SIJ A;  4LTU A;  1RM6 C;  3VRA B;  1JWB D;  1JQ4 A;  1IUE A;  2WU5 B;  5C3J B;  1TKG A;  3P4S B;  1TKE A;  2MJE A;  3NVY A;  2JX5 A;  4YT0 B;  2M19 A;  4HRO A;  1SF0 A;  1WWT A;  2DBY A;  1CJE A;  1JRO A;  2MH7 A;  1UWM A;  2BS4 B;  3AEC B;  3BII D;  4A9A A;  1VLB A;  1KF6 B;  1XO3 A;  1DGJ A;  1L6V A;  1J7B A;  1QLB B;  1ZP0 B;  3AM9 A;  3VRB B;  3HUI A;  2K5P A;  1VDV A;  2G1E A;  1CZP A;  3NRZ A;  4WQM A;  3HVZ A;  3W9C B;  4US8 A;  3B9J A;  4N59 A;  5EE0 A;  3VR9 B;  1FMA D;  4US9 A;  1AWD A;  2N0S B;  1FXA A;  4JX1 C;  1E10 A;  3ZYY X;  3PO0 A;  2CU3 A;  3HRD D;  3P4P B;  3SFE B;  5H8Y E;  1FO4 A;  3AV8 A;  4C80 A;  2WQY B;  3NVW A;  3AE4 B;  1YJI A;  2BS3 B;  2CJN A;  1QOA A;  1JRP A;  1A70 A;  1NEN B;  1T3Q A;  2BS2 B;  3AE2 B;  4P6V F;  1KFY B;  1NVI D;  1TJE A;  4ZHO A;  1F0Z A;  2QJL A;  1XLO A;  3AE7 B;  3WCQ A;  2BT6 A;  1VJK A;  2WLB A;  1FFU A;  3FC4 A;  3AED B;  3AN1 A;  3P4Q B;  1V97 A;  2DWQ A;  1V8C A;  2LEK A;  3CIR B;  1N62 A;  2E3T A;  2PKO A;  3KWL A;  1YJJ A;  2B76 B;  1WYG A;  1QOF A;  1NI3 A;  1WRI A;  3AEG B; 
#chains in the Genus database with same CATH topology
 1WYW B;  1DOY A;  4ASW C;  3TBL D;  4W9G A;  2KMC A;  5IOI A;  2JZP A;  3TJP A;  3VUW A;  1CK1 A;  2AYO B;  3R66 C;  2KXJ A;  2C7M B;  2WDQ B;  3VQI A;  2DNF A;  1F2R I;  2LD9 A;  1VRA B;  4P16 A;  4F1S A;  1L7Y A;  2L32 A;  2JQR B;  2I1K A;  1Z2M A;  3DCG A;  5JZE B;  4DK5 A;  1X1M A;  4LDT B;  2FUG 1;  1IGC A;  2LJI A;  2O2V A;  4DDG D;  4M01 A;  1KRH A;  1BT0 A;  3DWM A;  3VH3 B;  1L0V B;  5IN7 A;  1ZW7 A;  2PE9 A;  2QMT A;  3JVZ X;  4LNN A;  1RLF A;  4OVZ A;  3LYY A;  3PS6 A;  5JHA A;  1V5T A;  2GB1 A;  4ANV A;  1EF1 A;  1V1P A;  4XZ4 A;  3GZN B;  1NI2 A;  1V1O A;  2WDT B;  2G3Q B;  1TS5 A;  4PT5 A;  4K1R B;  4KVG B;  3PRM B;  3RT3 B;  4FAD A;  2WXH A;  1C4A A;  2RDB C;  5HI1 A;  2I38 A;  4M8M A;  4PS8 A;  3APF A;  5LLI A;  1NVI D;  2Y5B B;  3V60 A;  2D3G A;  2K1F A;  2KZR A;  2D5G A;  3MJW A;  3DBR B;  1LGR A;  1TY2 A;  4EZL A;  2W9N A;  2ZW0 A;  1N6Z A;  1SE9 A;  4IG7 B;  4JWU C;  3PVL A;  4USA A;  3NS8 A;  2JUO A;  2AQ1 B;  2MJ3 A;  1RRB A;  2JSV X;  4WWN A;  2LAS A;  3TEX A;  1KLG D;  2V3N A;  3Q8C A;  1MG4 A;  2V4I B;  2KFK A;  2K8H A;  2WU2 B;  4HRS A;  3CMM B;  1I4H A;  5AZH A;  1QF6 A;  2UWQ A;  3NY5 A;  1JML A;  4I6N B;  2JRH A;  3BZD B;  5CX3 A;  2N9L A;  2LXA A;  2O6V D;  5HG2 A;  3AE1 B;  3WAP A;  4ITK A;  1NYQ A;  1E7V A;  5IO9 A;  2IDY A;  3DVN U;  2KQS A;  1WJ4 A;  1WGG A;  4C7Y A;  3UQB A;  5AUK A;  4S0R A;  4WWM A;  2LVQ A;  3ZO5 B;  1LQB A;  2AL3 A;  4BKT A;  1E8Z A;  4NAW A;  2IY0 B;  2GOW A;  3TL5 A;  1SF0 A;  1UWM A;  2B3A A;  4MM3 A;  1L6V A;  2LMC A;  5T8I A;  3B9J A;  1SBB B;  1FMA D;  4US9 A;  2BYT A;  1FXA A;  4AS1 A;  3Q8E A;  3SFE B;  3V62 A;  3NZU A;  1LM8 B;  2J4X A;  2MQJ A;  2REX A;  1VZ8 A;  4E74 A;  2K3U A;  3T8M A;  4IM2 A;  2KJ6 A;  3ML8 A;  3QIJ A;  1JWU D;  5BYS A;  4N9F 4;  1AN8 A;  3W1S C;  1N60 A;  1PGX A;  3QA8 A;  1TS3 A;  2BWF A;  2BYF A;  3NOB A;  4GLS C;  1SB3 C;  1IYF A;  4ZRP A;  2FID A;  2DHZ A;  3A9K B;  4CYE A;  2IGD A;  1F9J A;  1YX5 B;  2BKR B;  3H6N A;  4FLH A;  4YTN B;  2IGH A;  2DX5 B;  4HJG E;  4BKS A;  4XWW A;  1K53 A;  2KDB A;  2WXR A;  3P4R B;  5HHD G;  1SSN A;  3WAM A;  2G45 B;  1TS4 A;  1VR9 A;  1ZUD 2;  4RGO S;  3B2F A;  4M0W A;  2DZJ A;  4M02 A;  3DPD A;  4DBG A;  3NUH B;  3Q8A A;  1UBQ A;  4L23 A;  2KDF B;  3LXF A;  4EOY A;  4GXB A;  1J0G A;  1ZXH A;  2KMA A;  2MBE A;  4J3O D;  2WS3 B;  4DHZ E;  3JSV B;  1ISN A;  4TV3 A;  3NHE B;  2JX5 A;  4A55 A;  4YT0 B;  5EDS A;  2HTH A;  3BII D;  1ESF A;  2GMI C;  4A9A A;  4BAX A;  1SXT A;  2X8X X;  3PPA A;  3RZW C;  2X38 A;  3L10 B;  3HVZ A;  1Y8R C;  3KUZ A;  4MAC A;  2BW2 A;  2L76 A;  4M00 A;  3TIX A;  1XCT L;  3NZ3 A;  2LUM A;  1ZDX A;  1WGR A;  2BB6 A;  2KLG A;  4GDK B;  1UEL A;  2GBJ A;  2V3P A;  4LK0 M;  1WGH A;  4DQO C;  4Q2J A;  3ZXR A;  2Y5P A;  1WI0 A;  1QOF A;  5DPR A;  2J52 A;  3AEG B;  2WXO A;  1P3Q U;  1FNU A;  4XGA B;  3RPF C;  3U52 E;  1R4N B;  4XDC A;  5JXV A;  1JW9 D;  3AEA B;  4IW0 A;  2IO1 B;  4EFO A;  1P98 A;  1GOZ A;  4FHJ A;  1BXT A;  2DLB A;  4KIK B;  2MBH A;  4HDQ A;  4WAA A;  2SEB D;  2L1A A;  3K9O B;  5L83 A;  4E3C A;  1FM0 D;  3X23 A;  2NVU I;  2DAJ A;  4KDI C;  2C7H A;  3DBL B;  3C8Y A;  1JWA D;  4EE2 A;  2WXP A;  1FFV A;  3DOW A;  3KYC D;  1OFF A;  4WAF A;  1TKY A;  2D3A A;  2W3S A;  2J0K A;  3MTN B;  4GB9 A;  5C2T B;  2WXL A;  5GMV A;  1HTQ A;  3W1S A;  1Q5W B;  2GI9 A;  3VHT C;  3RNG C;  3KLS X;  1Q0W B;  4LNK A;  2OED A;  2MHJ A;  3SHQ A;  1WXQ A;  2KFJ A;  5DCN A;  3ZVV A;  3PZ7 A;  4WJQ A;  2BYE A;  1WJU A;  5CHV C;  1WM2 A;  4BBN C;  1DYQ A;  1UZX B;  3M3J A;  2MEK A;  1P1A A;  5DPS A;  3Q8B A;  2ZVN A;  1J7B A;  4WQM A;  2K8C A;  1UD7 A;  3A9J B;  4C4V A;  1WIA A;  2ZZP B;  2CKH B;  3DVN V;  4JQW C;  2NBU A;  3R3M A;  4J6I A;  3ZGZ A;  4GOC A;  2EMS A;  2V4L A;  4RMA A;  4LDT D;  3PLV A;  1PGB A;  4PK1 A;  2AEH A;  3BVM A;  3RNA C;  3RNF C;  1V49 A;  1U4A A;  2M0A A;  2ZCC A;  3AB5 A;  2KAC A;  4N6E B;  4K3B A;  4NJ7 A;  2JU6 X;  2N7J A;  3AEB B;  1GG3 A;  1T6B X;  3Q14 C;  3MHS D;  1E8W A;  4IM3 A;  5DPW A;  4NY0 A;  3P1M A;  4A8X C;  1DOI A;  4FJY A;  3TUO A;  3RYT A;  3OLM D;  5AZG A;  2KX3 A;  3W1Y A;  1C1Y B;  4RGM A;  1FCL A;  2OHF A;  3V3X A;  2M56 B;  1QQR A;  2MX2 A;  4RCO A;  2N7D A;  2KWV B;  5AZF A;  4MJS B;  3RD2 A;  3VAW A;  3T9L A;  1QIL A;  3HM3 A;  4GGQ A;  4JPS A;  1WY8 A;  3EC8 A;  1GUA B;  4WWO A;  4FA6 A;  4EUT A;  4G11 A;  2MLB A;  3X0W A;  1WE7 A;  1M94 A;  1J8C A;  3QX1 A;  4KKI A;  4LTU A;  1HEZ E;  1RM6 C;  2NPT A;  2XK5 A;  2LRU A;  1EU3 A;  1TTN A;  1PQS A;  2MP2 B;  3B1L X;  1LO5 D;  3BVZ A;  2MH7 A;  4AQ7 A;  2KC1 A;  3QAQ A;  4RGT A;  4LJO B;  3SEB A;  3KQ4 A;  2KJH B;  4JX1 C;  3W2D A;  3PO0 A;  3ZYY X;  1T0R C;  2CJN A;  4HCN B;  1WGY A;  2LGX A;  2GBR A;  1E7U A;  1VJK A;  2JZZ A;  2IPK D;  4B0E A;  4AWJ A;  1T5X D;  2R2O A;  4FUL A;  4TMA B;  2FAZ A;  1WYG A;  1SIJ A;  1XXG A;  2PJH A;  1UBI A;  3DWG C;  3H7P B;  3IHP C;  2WDV B;  5EE1 A;  3HM6 X;  4A90 A;  3V6E B;  3I3T B;  3AE8 B;  3PHW B;  2WXQ A;  3FIL A;  3KUD B;  2RGF A;  2DZI A;  3AXC A;  2R61 A;  4GMV A;  4MGZ E;  1E90 A;  3PZD A;  5IP4 D;  1EWC A;  3RFZ B;  1XT9 B;  2K9X A;  2L00 B;  1V6E A;  1V9J A;  1OQY A;  4P1C C;  4YWG G;  1E0Z A;  1PDX A;  1VZ6 A;  1LXD A;  4W9K A;  2PVG C;  2NMQ A;  4YXD B;  2RPV A;  3GE3 C;  3SR6 A;  1C4P A;  1KH0 A;  1N63 A;  3T3N A;  4HK2 A;  5G5G A;  2C9W B;  2V3S A;  3BVG A;  3V61 A;  1NYR A;  2MW5 A;  2LUE A;  4KDL B;  2BB5 A;  3PZ8 A;  3ZRF A;  3AUL A;  3KW5 B;  3IXS A;  1JQ4 A;  3S2A A;  1E5W A;  2JWU A;  4JE3 B;  1A5R A;  1SE2 A;  2QHO A;  2K8B A;  1K51 A;  5D94 A;  4MSM B;  2K6D B;  1DGJ A;  3VRB B;  2K5P A;  1ZE3 D;  4BKG A;  4HKZ E;  2N9E B;  1GJZ A;  2MBB B;  2FCN A;  2WQY B;  1XEE A;  2KQ7 A;  4ARI A;  3NJT A;  1HA5 A;  3Q3F A;  4HPM B;  3RUI B;  3ZTC A;  1XLO A;  2BT6 A;  3PLU A;  5TSS A;  2GLS A;  3AN1 A;  3P42 A;  3LDZ E;  2FCQ A;  2XEW A;  2JPH A;  2KHW B;  2QIL A;  4WWP A;  1D5Z C;  1WJN A;  5C23 A;  3IVF A;  1WR6 E;  3EFU A;  3IT6 B;  3ZXV A;  4EKU A;  3V05 A;  1FCC C;  4UDU C;  4ARC A;  4HLE A;  1BML C;  2V9H A;  4NZL B;  3RMK C;  3IAM 1;  2KO3 A;  3EUB 2;  2J0M A;  1HZ5 A;  4GDL A;  3GZN I;  3EFC A;  3ZNI D;  4JIO U;  3QK0 A;  1FNW A;  2KJR A;  3W5V B;  4JL9 A;  2MWS B;  1XLP A;  4IC7 B;  1GC7 A;  2YLM A;  3AE3 B;  4OVU A;  1E8Y A;  4ZYN A;  1I7H A;  5IAA C;  2HE7 A;  4KSK C;  1GB4 A;  2ON8 A;  3H7S A;  4ICV A;  3DVG Y;  2KTR B;  1JAL A;  2MJD A;  4YSY B;  4DHZ B;  2AWT A;  5FK9 C;  1EF5 A;  2Q5W D;  1WH3 A;  4W9J A;  2WP9 B;  1QKZ A;  3DBR I;  4M8N A;  1XF5 L;  3VRA B;  1C76 A;  2O6V A;  3U30 A;  3MFG A;  3ZIM A;  2XBB C;  3WAN A;  1TZ1 A;  4B6W A;  1IBX B;  1JRO A;  1SE3 A;  5G55 A;  4XC2 A;  1K52 A;  2BVC A;  3SD5 A;  1GNU A;  4NQL B;  2CHX A;  3HRD D;  3SU8 X;  3I63 C;  1L4D B;  4YL8 A;  1JRP A;  2MSE D;  3IBE A;  3AE7 B;  4ICU A;  3A1Q A;  3RZF A;  2DYB A;  3TCA A;  2BGF A;  4MH0 E;  1S3S G;  3KYD D;  3AEF B;  3CSF A;  2ZEQ A;  1VZ7 A;  2IO2 B;  2CHW A;  2L52 A;  3A4S C;  3ZDT A;  1G6J A;  2YEP F;  2RPQ A;  1EUV B;  5D3D A;  3N1Y C;  4RF1 A;  3ONS A;  2WGS A;  4RM9 A;  2DYM A;  3BYT B;  1PFD A;  3U7D A;  1EM7 A;  2PIA A;  3AE5 B;  1OQR A;  2ASQ A;  2LFI A;  1GC6 A;  1D4B A;  4MEL A;  1E9M A;  1NBF C;  4ZHP A;  2IZV B;  1J7A A;  2KT7 A;  1Q10 A;  2CHZ A;  3AU5 A;  2DAF A;  2KOX A;  1R7S A;  4FJV B;  4BOZ B;  1IPG A;  2GBK A;  1S1Q B;  3VVW B;  4NJC A;  2BTE A;  4AUQ C;  3EHV A;  2Z8L A;  3PV1 A;  3ECI A;  2GBN A;  3CF6 E;  2PTL A;  2NTT A;  1RYJ A;  2IJ0 A;  2IO3 B;  4WH4 A;  2QIE B;  4YSZ B;  3AEE B;  1ZOY B;  5J17 A;  3KUC B;  1L5P A;  2MCN B;  1FRR A;  3AMZ A;  3N9Y C;  3ALB A;  3VH4 B;  1IUE A;  2HDE A;  5C3J B;  3VTW A;  4DXF A;  1CMX B;  3DBH B;  2MA9 B;  2O2V B;  1WF9 A;  4WJN A;  1KF6 B;  3HK0 A;  1ZP0 B;  1V80 A;  3VR9 B;  3BY4 B;  1LFD A;  1UWX A;  2I2Y A;  1MG8 A;  3HIZ A;  2N9P C;  1KTK A;  1YJI A;  3IT4 B;  1FD6 A;  3GS2 A;  1V1P B;  2LRW A;  3P4Q B;  4W9L A;  2PKO A;  3Q69 A;  1D5X C;  4MGI E;  5FKA C;  4URK A;  3DDC B;  1OTR B;  4P1B C;  1I4R A;  1OGW A;  2N1W A;  4FXC A;  1WMH A;  2KYW A;  4MEM A;  2FBW B;  1L6U A;  2LGD A;  3JW0 X;  5GXG B;  3B0A A;  1RFA A;  5BYQ A;  2WNM A;  2ZNV B;  2WXJ A;  1N5W A;  4PYZ A;  2L3Z A;  4TUU A;  2IGG A;  2M17 A;  4HXD A;  1C79 A;  2ONQ A;  3OJ4 B;  1V5O A;  4D2K A;  3H1U A;  2PPH A;  4F8C B;  4DXG A;  1R4M B;  3UQA A;  3EGR A;  4IM0 A;  1DOX A;  4A3O A;  1XLQ A;  2J53 A;  4E71 A;  2ACZ B;  3L13 A;  1SEB D;  2INC C;  4RH6 A;  4B9K A;  1XLN A;  3Q3J A;  2QEJ C;  4YTP B;  2KFK B;  2DYO A;  5D6J B;  3UIO B;  5BYR A;  2EMT A;  1I35 A;  1ET9 A;  5KHO A;  4LLG M;  1RWS A;  2KWC A;  2KX0 A;  2OJR A;  1WXA A;  2Z0D B;  1TKE A;  3M63 B;  1SJE D;  1R4N I;  3GE8 C;  3ZNZ B;  3WA0 A;  2KTF A;  3CST A;  1JWS D;  4XX5 A;  3E56 A;  1CZP A;  4II3 B;  2LVP A;  2BF8 B;  2N0S B;  3ZRC A;  3ENE A;  5H8Y E;  1KJT A;  2GBM A;  3AV8 A;  3NVW A;  4NAW B;  2EEL A;  4ZHO A;  3DBL I;  2EKE C;  2QJL A;  4KZ0 A;  3URY A;  3L16 A;  3UI3 A;  2C5L C;  1V8C A;  4MM3 B;  2JWZ A;  1H4R A;  5L95 C;  1ENF A;  1YJJ A;  2A5U A;  4PS7 A;  4DHJ B;  4KZC A;  4CHK A;  1WSP A;  4RM8 A;  3I9V 1;  1YJ1 A;  1YD8 U;  2CS4 A;  3NG0 A;  3DHI C;  1SGH A;  4K3C A;  4PS3 A;  2IBI B;  2A4Z A;  2KC2 A;  1I4Q A;  1QOG A;  4LCD E;  3KVF B;  3ZDM C;  3BK1 A;  2Y5C A;  2FUH B;  2XNA C;  2WWZ A;  2R2Q A;  4IKG A;  1T0Y A;  2JXX A;  1HZ6 A;  4KKJ A;  3OWE B;  1YQ3 B;  2E6X A;  3DQV A;  1E6E B;  3VUX A;  2JXT A;  1M4V A;  3KWV A;  3Q6B A;  2ICI A;  1GPX A;  1TIF A;  3AE9 B;  1D5M C;  1I4X A;  5CTR C;  2PW9 A;  1YN5 A;  4BZA A;  5C1Z A;  3BK2 A;  2WHI A;  2WYQ A;  2W82 A;  3E9S A;  3NVZ A;  3Q3N C;  1Q1O A;  4DXA B;  1TKG A;  3ZJU A;  4HWI B;  3TEY A;  2YEP B;  3NVY A;  1L0X B;  4I6L B;  4IOI E;  4M0W B;  4RNA A;  3AEC B;  2NS5 A;  2VH2 A;  1QLB B;  2K39 A;  2N4F A;  1UF0 A;  3W9C B;  3Q3O C;  4R3D A;  4RFB A;  2KAN A;  2D3C A;  1XD3 B;  2J7Q B;  2CR5 A;  3N30 A;  1I4G A;  3ZW3 A;  3JYU A;  5TR5 A;  2LGS A;  3IG3 A;  4BBN F;  4FHK A;  2WLB A;  3ZLZ A;  4F7Z A;  2LWP A;  4GIV A;  2KTR A;  2LZ6 A;  3PSE B;  1F1H A;  4REZ A;  4EZJ A;  4WQO B;  3RNB C;  4NJ6 A;  3MC9 A;  2DEN B;  2GRI A;  2W54 A;  2D07 B;  4OZA A;  1ZXI A;  5D7G A;  5BO4 B;  4DWF A;  1VCB A;  4W9H A;  2ZNV C;  2H88 B;  1MFW A;  2C7N B;  4B95 A;  1C4C A;  2RDH A;  2WXI A;  4L2Y A;  3TMP B;  4MGY E;  3ZKJ C;  3ZQ4 A;  2I1J A;  1YQ4 B;  3TEZ A;  1ROE A;  1ET6 A;  2JF5 A;  3R2T A;  3AE6 B;  1MI0 A;  4ZRI A;  5AEK B;  1HE8 A;  1OQQ A;  4RF0 A;  2KNB A;  2FIF A;  2LGI A;  3V6C B;  5MPO A;  1UUP A;  5EE3 A;  3B08 A;  1PGA A;  1YOV B;  3BWU D;  2WXG A;  2G9H D;  2BYV E;  4ZOH C;  5D2M B;  4KSL C;  1B1Z A;  2M8S A;  1WJ6 A;  1HTO A;  3FAH A;  3Q8F A;  2G4D B;  3I57 A;  2WU5 B;  2L8J A;  3QJZ A;  4NNJ B;  1KOT A;  2TSS A;  2M19 A;  3QC8 B;  4KGT A;  4RGN A;  4IWQ A;  3HUI A;  1WRD B;  4W9C A;  3APC A;  3P4P B;  2UYZ B;  1MPE A;  2N9X A;  3PHX B;  3AE4 B;  1V86 A;  1WFY A;  3TEW A;  3WCQ A;  3A9K A;  5G2N A;  4H2A A;  1EU4 A;  2JYT A;  3CIR B;  4HCP B;  2N9K A;  4OZC A;  1N62 A;  3T3O A;  4CO7 A;  2KN5 A;  4BVU C;  4C4V B;  2K22 A;  4ZRQ A;  5J2R A;  4DDI D;  3ZJT A;  1JWM D;  2M4N A;  4S17 A;  3DVG X;  4YSX B;  2KD0 A;  1L2N A;  4X57 B;  2Z0E B;  4A3P A;  2MBO A;  3L0W B;  1L4Z B;  2L83 A;  4MT5 A;  1ACC A;  2UU7 A;  1MVK A;  4N58 A;  4I6P A;  4IUM B;  1L0Y B;  3PGE A;  1TS2 A;  2G4S A;  2Y3A A;  2KLC A;  5LXH A;  3JSV A;  1ZGU B;  1MHH E;  4OW0 A;  1FXT B;  1SJH D;  3W5U B;  3R2I A;  4C80 A;  3PRZ A;  1N61 A;  2V0G A;  2DZK A;  2AX5 A;  4G0N B;  1D6E C;  2KVZ A;  1K50 A;  3A33 B;  3RCZ A;  1J7C A;  4IDI A;  2C60 A;  4GDK A;  1JWB D;  3P4S B;  3VTV A;  2AL6 A;  3U7Z A;  4HRO A;  5E6N A;  1HXY D;  2NCN A;  1VLB A;  4WJP A;  2NBW B;  4JLC A;  3UIN B;  5JHB A;  2D10 A;  4US8 A;  1AWD A;  3AI5 A;  1UGM A;  3PTF C;  2OJW A;  3ZTD A;  3EA6 A;  2PEA A;  4KV2 A;  1P7E A;  3OAW A;  4AP4 C;  2NPT B;  2XK5 B;  1NEN B;  5HKH A;  4P6V F;  4GN1 A;  1SE4 A;  2RR9 A;  4KIK A;  1HQR D;  2ZJD A;  4K7S A;  3NZS A;  1V81 A;  1FPY A;  2WXK A;  2VZK D;  3LB8 C;  5IA7 A;  2MBQ A;  4HEA 1;  2L05 A;  3VUY A;  3D32 A;  3ZNH B;  2KDM A;  5E6J A;  3OG5 A;  1C9F A;  1E7P B;  3RN9 C;  4IWO A;  3VFK A;  1PUT A;  4EZK A;  1B9R A;  2AQ2 B;  1NEK B;  4MGK E;  1I4P A;  3UGB B;  3ZNG C;  4TSS A;  2IY1 B;  3K9P B;  4MDK E;  4C7Z A;  4B0M A;  3WAL A;  2D3B A;  1QOB A;  3FIL B;  3DHH C;  2L0F A;  3AH7 A;  2EKI A;  1D3Z A;  3GP7 A;  5JH5 C;  1F0Z A;  2KAJ A;  2IO0 B;  2HJ8 A;  3R7Q A;  4II2 B;  1GAQ B;  1MJD A;  4DHJ D;  3A9J A;  2LVO A;  2WX1 A;  1WGK A;  2XN9 C;  4ZYS A;  3L54 A;  3NVV A;  3C19 A;  2K25 A;  1Z5S B;  2W3R A;  1F2R C;  3P2B A;  2FE8 A;  1YN3 A;  3O13 A;  3VXW A;  2MRP A;  4GSW A;  1MHX A;  3O65 B;  1WWT A;  2NR2 A;  2QCZ A;  1JRU A;  3Q2A C;  1WXS A;  4TQ0 A;  4KGR A;  3MJ5 A;  1UGJ A;  3HHM A;  2BBC A;  2BS3 B;  2LI5 A;  4NAM A;  1KFY B;  2JYE A;  3IAS 1;  5LXI B;  2L0T A;  3AU4 A;  1F77 A;  3AED B;  4FBJ B;  1V97 A;  2E3T A;  3KWL A;  1CQV A;  1E8X A;  4EEW A;  1WRI A;  2FNJ B;  1C77 A;  4IWP A;  4W9E A;  2ZVO A;  4BKS D;  3BIN A;  2FCS A;  2HJ1 A;  4YTM B;  2IYD B;  2WX0 A;  3ZJV A;  5BMH A;  1F52 A;  2BQQ A;  1AAR A;  4LNF A;  4KGS A;  5KHQ A;  3ETR A;  4MJS A;  1Y56 A;  4FJZ A;  2JRI B;  2PE6 B;  4OHJ A;  5FR6 A;  4A6Q A;  2RSU A;  1TGZ B;  2W55 A;  2CJO A;  3QWZ B;  3DBH I;  3APD A;  3DHG C;  4OVV A;  3CWI A;  3PRP B;  4TKN A;  2M1M A;  4TQ1 A;  2YVC A;  4XDD A;  4CQN A;  3IFW B;  1WGD A;  4HPP A;  2H89 B;  2MP2 A;  4BOS C;  3N1Z C;  1YQB A;  1IGD A;  1YIW A;  1K8R B;  2CU1 A;  2WDR B;  5EE9 A;  4GDL B;  2PVO D;  4GU2 A;  4HJK A;  1C78 A;  3L4P A;  1C3T A;  2PMV A;  3SFD B;  3M62 B;  2LHD A;  1OEY J;  2MJE A;  3QHT A;  1FEH A;  1YMH E;  4XE0 A;  2LHE A;  4QAY A;  2SAK A;  4WIP A;  2DBY A;  2KVR A;  2IND C;  1WR1 A;  2KDI A;  3AM9 A;  4O1N A;  2D2Q A;  3J9C A;  3MHZ A;  3OJ3 A;  2G1E A;  3U2S C;  2VZK B;  3N3K B;  4BFR A;  3H7P A;  2WXM A;  4W9D A;  2QSD A;  1NDD A;  1SIF A;  3N1X C;  3M95 A;  1P0R A;  1T3Q A;  4HVB A;  2O6V B;  2Z59 B;  2RDG A;  1R4M I;  1XCQ L;  2J42 A;  3H9D A;  4LNO A;  2BKF A;  2KN4 A;  1FNV A;  4HKQ A;  2DWQ A;  5DPT A;  3GOE A;  5IKC M;  3ML9 A;  2NBV B;  2B76 B;  1TZO A;  3H8H A;  1YNT E;  2DZM A;  4ZRJ A;  2KMM A;  1GB1 A;  3TSS A;  1YN4 A;  4P7I A;  3N32 A;  3N20 C;  3NS1 A;  3P63 A;  1ZDV A;  2J0J A;  4G50 A;  4AJW A;  1J19 A;  3A1Q B;  4JGH B;  4WJO A;  4XWT A;  2KWU B;  3KH0 A;  1N5X A;  1KM7 A;  2D11 A;  2INP E;  1WE6 A;  5CHF A;  1BUI C;  1TT5 B;  4NQK E;  3UIP B;  4KX6 B;  2RD0 A;  5J18 A;  1I42 A;  2NTS A;  2ZPY A;  1P9D U;  1T0S C;  1FIQ A;  1FRD A;  1ZKH A;  3U4E G;  1UNS A;  4JWS C;  5E6O A;  2K6Q A;  2BWE S;  1QZE A;  4HDO A;  1QT9 A;  1ZPS A;  1TYG B;  1TBE A;  4K7U A;  3ZUN A;  2AQ3 B;  3QQ8 B;  3VTU A;  2WXF A;  1WX7 A;  2JY6 A;  2KQ4 X;  3BYY B;  2KKC A;  1PYW D;  2LJ5 A;  4NPN A;  4AJY B;  3QCA A;  4C00 A;  2K0P A;  3LJ3 A;  2HD5 B;  2BS4 B;  1AW7 A;  1XO3 A;  3EEC A;  5D3I B;  4ZDV A;  2JZ3 B;  1YX6 B;  2QDF A;  1VDV A;  3NRZ A;  3Q3M C;  1RAX A;  4N59 A;  5EE0 A;  4G3X B;  2BPS A;  2VH1 A;  1E10 A;  4WUR A;  2KDE B;  3MC0 B;  1VD2 A;  1FO4 A;  2VRR B;  1QOA A;  4AOF A;  3A4R A;  3AE2 B;  1TJE A;  3FKY A;  3GB1 A;  3RNE C;  4ACF A;  1FFU A;  3FC4 A;  4MSQ B;  2M0X A;  4ZRK A;  4PYU A;  2LEK A;  1T0Q C;  3R7R A;  4ANW A;  1NI3 A;  3QAR A;  3R8B A;  2OOB B;  3L08 A;  3C0R B;  2ZPN A;  3ABV B;  4L1B A;  3HVD A;  2LXC A;  1V2Y A;  1WX9 A;  2HTM E;  1P7F A;  3MC8 A;  2ZCB A;  2ZW1 A;  1JCK B;  1WXM A;  1H8C A;  5FR3 A;  4K7W A;  5G5H A;  3RNC C;  4HPL B;  4ANX A;  3B2G A;  3WIM A;  1WMH B;  2QC8 A;  1RFK A;  1WZ0 A;  1AYF A;  1WZ3 A;  5H92 C;  2LGY A;  1UH6 A;  1KLU D;  3PRE A;  4FN2 A;  2WXN A;  3DBS A;  3VR8 B;  1IBX A;  1EO6 A;  5CHW A;  5E6P A;  2N7E A;  4W9F A;  2INN E;  3UF8 A;  1EWY C;  4A20 A;  1FXI A;  3PT2 B;  3U8Z A;  4MH8 A;  5AUI A;  2N1V A;  5BMG A;  5LNK 1;  2FCM A;  2PLP A;  4LJP B;  4ANU A;  3VDZ A;  3MP9 A;  3RUL A;  2KWD A;  1XQQ A;  4C56 C;  1CJE A;  1IP9 A;  3I5J C;  2L7R A;  3RI7 C;  2JT4 B;  4K81 A;  1OEY A;  3WAO A;  4XYC A;  2CU3 A;  3L17 A;  5BMI A;  1WXV A;  2KK8 A;  4OZB A;  1STE A;  1A70 A;  2V1Y A;  5HFY A;  2BS2 B;  5I4D A;  1KLV A;  3SDL C;  2RMM A;  1TY0 A;  4LNI A;  1WM3 A;  4W9I A;  1WX8 A;  2JVC A; 
#chains in the Genus database with same CATH homology
 1DOY A;  3AB5 A;  3LB8 C;  2KAC A;  4N6E B;  4HEA 1;  4FXC A;  2FBW B;  1L6U A;  2JU6 X;  2N7J A;  3AEB B;  5GXG B;  1T6B X;  2KDM A;  5E6J A;  1C9F A;  1E7P B;  5BYQ A;  1PUT A;  3P1M A;  2WNM A;  2JZP A;  4A8X C;  1CK1 A;  1DOI A;  2WXJ A;  1N5W A;  1B9R A;  3TUO A;  2AQ2 B;  1NEK B;  2WDQ B;  3VQI A;  2IGG A;  1I4P A;  1F2R I;  1C79 A;  2ONQ A;  4TSS A;  1VRA B;  4P16 A;  4D2K A;  4DXG A;  4RGM A;  4C7Z A;  1FCL A;  4B0M A;  2OHF A;  2L32 A;  3EGR A;  2JQR B;  2M56 B;  3V3X A;  1QQR A;  1QOB A;  1DOX A;  3FIL B;  3AH7 A;  1XLQ A;  2EKI A;  2J53 A;  2ACZ B;  4RCO A;  2FUG 1;  3GP7 A;  1IGC A;  1F0Z A;  1SEB D;  2KAJ A;  2LJI A;  4RH6 A;  1XLN A;  2QEJ C;  1QIL A;  4JPS A;  4YTP B;  1KRH A;  2DYO A;  3DWM A;  5BYR A;  1L0V B;  1GAQ B;  1WGK A;  2QMT A;  2XN9 C;  1ET9 A;  4ZYS A;  3NVV A;  4LLG M;  4OVZ A;  3LYY A;  1RWS A;  2W3R A;  4KKI A;  1F2R C;  1HEZ E;  1RM6 C;  4LTU A;  2GB1 A;  1EU3 A;  1TKE A;  2FE8 A;  1V1P A;  1YN3 A;  1LO5 D;  1SJE D;  3O13 A;  1MHX A;  3BVZ A;  1WWT A;  1V1O A;  2MH7 A;  4AQ7 A;  4RGT A;  1TS5 A;  4PT5 A;  1JWS D;  3SEB A;  3E56 A;  4TQ0 A;  1CZP A;  3KQ4 A;  4KGR A;  3MJ5 A;  2N0S B;  1UGJ A;  4JX1 C;  2WXH A;  3PO0 A;  3W2D A;  3ZYY X;  1C4A A;  5HI1 A;  5H8Y E;  3AV8 A;  2I38 A;  2BBC A;  3NVW A;  4NAW B;  2BS3 B;  2CJN A;  2EEL A;  4ZHO A;  4NAM A;  1KFY B;  1NVI D;  2JYE A;  3IAS 1;  2QJL A;  3URY A;  2D5G A;  1VJK A;  3UI3 A;  2IPK D;  1F77 A;  3AED B;  4B0E A;  1T5X D;  1V97 A;  1V8C A;  4MM3 B;  1TY2 A;  4TMA B;  2E3T A;  3KWL A;  1CQV A;  1ENF A;  1YJJ A;  1WYG A;  1XXG A;  1SIJ A;  1WRI A;  2ZW0 A;  1C77 A;  4JWU C;  3DWG C;  1WSP A;  4USA A;  3I9V 1;  2WDV B;  5EE1 A;  4A90 A;  3AE8 B;  2WXQ A;  3FIL A;  2AQ1 B;  2MJ3 A;  2JSV X;  4YTM B;  3ZJV A;  5BMH A;  3TEX A;  1KLG D;  2R61 A;  4KGS A;  1I4Q A;  3ETR A;  2V3N A;  3Q8C A;  2V4I B;  1Y56 A;  1QOG A;  4OHJ A;  4A6Q A;  2WU2 B;  3BK1 A;  4HRS A;  1EWC A;  1I4H A;  3RFZ B;  2W55 A;  2Y5C A;  2CJO A;  2K9X A;  2XNA C;  1QF6 A;  4IKG A;  4KKJ A;  1HZ6 A;  3OWE B;  3CWI A;  1YQ3 B;  1JML A;  2E6X A;  4TQ1 A;  4XDD A;  4CQN A;  3BZD B;  1E6E B;  2N9L A;  2JXT A;  1M4V A;  3KWV A;  4YWG G;  5HG2 A;  1E0Z A;  3AE1 B;  1PDX A;  2H89 B;  1VZ6 A;  2ICI A;  2PVG C;  2NMQ A;  4ITK A;  4YXD B;  2RPV A;  1NYQ A;  1GPX A;  3SR6 A;  1C4P A;  1KH0 A;  1N63 A;  1IGD A;  3AE9 B;  3T3N A;  1D5M C;  2IDY A;  1I4X A;  5G5G A;  2WDR B;  3BVG A;  4C7Y A;  1NYR A;  5EE9 A;  2PW9 A;  1YN5 A;  4GDL B;  2PVO D;  1C78 A;  3BK2 A;  5AUK A;  4WWM A;  3L4P A;  2W82 A;  3E9S A;  2PMV A;  3SFD B;  2BB5 A;  3NVZ A;  3PZ8 A;  3IXS A;  1JQ4 A;  2LHD A;  1TKG A;  3ZJU A;  2JWU A;  2MJE A;  4JE3 B;  3TEY A;  1FEH A;  1SE2 A;  1YMH E;  2YEP B;  3NVY A;  4XE0 A;  2LHE A;  1L0X B;  4RNA A;  2SAK A;  4IOI E;  4WIP A;  1SF0 A;  1K51 A;  2DBY A;  1UWM A;  3AEC B;  1DGJ A;  1L6V A;  1QLB B;  3AM9 A;  3J9C A;  2LMC A;  3MHZ A;  4O1N A;  3VRB B;  2K5P A;  2G1E A;  3U2S C;  3W9C B;  5T8I A;  3B9J A;  4RFB A;  1ZE3 D;  1SBB B;  4HKZ E;  1FMA D;  2VZK B;  4R3D A;  4US9 A;  2BYT A;  1FXA A;  2WXM A;  3Q8E A;  4AS1 A;  2QSD A;  3SFE B;  2WQY B;  1I4G A;  1XEE A;  2J4X A;  1T3Q A;  4ARI A;  1HA5 A;  2RDG A;  1VZ8 A;  1XLO A;  1XCQ L;  2J42 A;  2BT6 A;  2K3U A;  2WLB A;  5TSS A;  2KN4 A;  3AN1 A;  3P42 A;  1JWU D;  5BYS A;  1FNV A;  4HKQ A;  2DWQ A;  2QIL A;  1D5Z C;  1AN8 A;  2B76 B;  1TZO A;  3H8H A;  4REZ A;  1YNT E;  1N60 A;  2KMM A;  1PGX A;  1GB1 A;  3TSS A;  1YN4 A;  3IT6 B;  2GRI A;  2W54 A;  4OZA A;  1TS3 A;  1ZXI A;  3NS1 A;  3P63 A;  5D7G A;  3V05 A;  1FCC C;  1ZDV A;  4UDU C;  4GLS C;  4ARC A;  2H88 B;  1SB3 C;  1BML C;  4ZRP A;  4NZL B;  1C4C A;  2IGD A;  2RDH A;  2WXI A;  4L2Y A;  3IAM 1;  3EUB 2;  4XWT A;  3ZQ4 A;  1N5X A;  1YQ4 B;  1HZ5 A;  3TEZ A;  2INP E;  1ROE A;  1ET6 A;  4YTN B;  2IGH A;  3R2T A;  3AE6 B;  4HJG E;  4XWW A;  1MI0 A;  1FNW A;  3W5V B;  1BUI C;  1K53 A;  2WXK A;  2WXR A;  3P4R B;  1OQQ A;  4KX6 B;  4RF0 A;  5HHD G;  1SSN A;  1TS4 A;  1VR9 A;  2LGI A;  1XLP A;  1ZUD 2;  2NTS A;  5MPO A;  1UUP A;  5EE3 A;  4RGO S;  1FIQ A;  3AE3 B;  1FRD A;  3B2F A;  4M0W A;  1I7H A;  1PGA A;  3BWU D;  1GB4 A;  2ON8 A;  3U4E G;  2WXG A;  3NUH B;  3Q8A A;  1UNS A;  2G9H D;  4JWS C;  4L23 A;  1JAL A;  3LXF A;  2MJD A;  4ZOH C;  4YSY B;  1B1Z A;  1QT9 A;  1ZPS A;  5FK9 C;  2Q5W D;  1ZXH A;  2WP9 B;  1QKZ A;  1TYG B;  1XF5 L;  4J3O D;  2WS3 B;  3FAH A;  3Q8F A;  3VRA B;  3I57 A;  2WU5 B;  1C76 A;  2AQ3 B;  2WXF A;  3MFG A;  2KQ4 X;  3BYY B;  1PYW D;  2TSS A;  2JX5 A;  4A55 A;  4YT0 B;  2M19 A;  1IBX B;  2K0P A;  1JRO A;  4KGT A;  4RGN A;  1SE3 A;  1ESF A;  2BS4 B;  3BII D;  4A9A A;  1AW7 A;  1K52 A;  1XO3 A;  5D3I B;  1SXT A;  3HUI A;  1VDV A;  3NRZ A;  2X38 A;  3HVZ A;  4N59 A;  5EE0 A;  4MAC A;  2BW2 A;  1XCT L;  1E10 A;  3NZ3 A;  4WUR A;  2LUM A;  3HRD D;  3P4P B;  1ZDX A;  3MC0 B;  1FO4 A;  2BB6 A;  1MPE A;  1L4D B;  3AE4 B;  4GDK B;  1QOA A;  1JRP A;  3AE2 B;  3TEW A;  2V3P A;  1TJE A;  3GB1 A;  3AE7 B;  3WCQ A;  1FFU A;  3FC4 A;  4LK0 M;  4H2A A;  4DQO C;  1EU4 A;  2JYT A;  4Q2J A;  2LEK A;  3CIR B;  2N9K A;  2Y5P A;  4OZC A;  1N62 A;  1QOF A;  1NI3 A;  3T3O A;  3R8B A;  2J52 A;  3AEG B;  2WXO A;  2K22 A;  4ZRQ A;  3AEF B;  1FNU A;  3RPF C;  1VZ7 A;  3ZJT A;  3U52 E;  4XDC A;  5JXV A;  3ABV B;  1JWM D;  4L1B A;  1JW9 D;  3HVD A;  3AEA B;  2L52 A;  4YSX B;  1GOZ A;  2HTM E;  2YEP F;  1P7F A;  1BXT A;  2DLB A;  5D3D A;  2ZW1 A;  4RF1 A;  1JCK B;  2DYM A;  2SEB D;  2L1A A;  1PFD A;  3BYT B;  1EM7 A;  2PIA A;  3AE5 B;  1L4Z B;  1OQR A;  2L83 A;  4MT5 A;  1FM0 D;  1ACC A;  1MVK A;  2LFI A;  4N58 A;  1D4B A;  5FR3 A;  5G5H A;  1L0Y B;  1E9M A;  4ZHP A;  1J7A A;  1JWA D;  1TS2 A;  3C8Y A;  2WXP A;  1Q10 A;  3B2G A;  4EE2 A;  2Y3A A;  1FFV A;  1RFK A;  1R7S A;  1AYF A;  1OFF A;  5H92 C;  4WAF A;  1MHH E;  1TKY A;  4OW0 A;  1KLU D;  1SJH D;  2W3S A;  4NJC A;  2BTE A;  2WXN A;  3W5U B;  3R2I A;  5C2T B;  2Z8L A;  4C80 A;  3VR8 B;  2WXL A;  1N61 A;  1IBX A;  2V0G A;  2AX5 A;  2PTL A;  2NTT A;  1RYJ A;  2IJ0 A;  1D6E C;  4WH4 A;  2QIE B;  4YSZ B;  1K50 A;  2INN E;  3AEE B;  1ZOY B;  3W1S A;  1EWY C;  1FXI A;  2GI9 A;  1J7C A;  1L5P A;  4MH8 A;  1FRR A;  3AMZ A;  4IDI A;  3KLS X;  3N9Y C;  5AUI A;  5BMG A;  2OED A;  1WXQ A;  5LNK 1;  3PZ7 A;  1JWB D;  1IUE A;  2HDE A;  5C3J B;  2PLP A;  3P4S B;  3MP9 A;  1DYQ A;  4DXF A;  2KWD A;  3U7Z A;  4C56 C;  2MEK A;  4HRO A;  1CJE A;  1HXY D;  1VLB A;  3Q8B A;  1KF6 B;  1J7B A;  1ZP0 B;  4WQM A;  4US8 A;  3VR9 B;  1AWD A;  1UWX A;  2I2Y A;  2CU3 A;  3EA6 A;  5BMI A;  1P7E A;  1KTK A;  1YJI A;  4OZB A;  3ZGZ A;  1STE A;  1NEN B;  1A70 A;  3IT4 B;  5HFY A;  2BS2 B;  4P6V F;  1FD6 A;  5I4D A;  1SE4 A;  3GS2 A;  1V1P B;  1PGB A;  1HQR D;  2RMM A;  3P4Q B;  1TY0 A;  3BVM A;  2PKO A;  3Q69 A;  1D5X C;  5FKA C;  2M0A A;  2VZK D;  1I4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...