1J7BA

Structure of the anabaena ferredoxin mutant e94k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKKEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
molecule tags Electron transport
molecule keywords FERREDOXIN I
total genus 26
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7bA00
1TKYA 5C3JB 4C80A 2QIEB 3AE6B 1E10A 3AV8A 4ZHPA 2PKOA 2WDQB 4N6EB 2B76B 2CJOA 4P6VF 2WQYB 3B2FA 1N62A 1RWSA 4FXCA 1E6EB 1XLNA 3AE7B 4WQMA 3NVWA 1SF0A 1KRHA 2L52A 1QLBB 2E3TA 3P4PB 1GAQB 2BS4B 2LEKA 2FBWB 3FAHA 1V97A 4JX1C 2K22A 3AEDB 1FIQA 3VRAB 4C7ZA 1JROA 1JALA 2K9XA 3HRDD 4N58A 2DWQA 1OQRA 1RFKA 2L83A 2CJNA 2JX5A 1L6UA 2KAJA 1VLBA 3L4PA 4WWMA 3AE9B 1DOXA 1GPXA 3AM9A 1E9MA 3NVVA 2WDVB 1TKGA 4USAA 3BIID 1RYJA 3AE8B 3NRZA 5G5HA 3P4QB 3W5UB 3ZYYX 1WWTA 4YT0B 1PDXA 5AUKA 4YTNB 3SFEB 1L0VB 3SR6A 1YJIA 3AEAB 2MH7A 2BS3B 1J7AA 3AEBB 2EKIA 4N59A 4YSZB 1L5PA 1J7BA 1QOBA 1VDVA 3AH7A 2CU3A 3DWGC 2W3RA 2WU2B 1FXIA 3W9CB 3CIRB 1E0ZA 1JWAD 1T3QA 1XO3A 5EE9A 5C2TB 4US8A 4LTUA 1FFUA 1NI3A 1QOGA 4ITKA 1NENB 1I7HA 4YTMB 1VJKA 5EE0A 1J7CA 1OQQA 1AWDA 3B2GA 3ETRA 5G5GA 1YJJA 1ZXIA 3P4RB 1SB3C 1AYFA 2OHFA 3AEEB 1N63A 1CJEA 1ZP0B 1TKEA 2W54A 4HRSA 2PVGC 4JWSC 3VR8B 3HVZA 1JRPA 2KMMA 3DWMA 1DOYA 2W55A 1DGJA 2W3SA 2HTME 3CWIA 1F0ZA 2WDRB 2Y5CA 3AE4B 4C7YA 4IDIA 3FC4A 4HROA 5GXGB 4YSXB 1L6VA 1QOAA 3VRBB 2K5PA 3VR9B 5H92C 1DOIA 2BT6A 2MJ3A 4YXDB 2M56B 1KFYB 1WGKA 1WYGA 2WP9B 3LB8C 3NVYA 3NVZA 3P63A 2MJEA 3AE2B 1NEKB 1B9RA 4ZOHC 2PVOD 1N60A 4A9AA 1OFFA 1FRRA 1N5WA 1FM0D 4YTPB 1XLPA 3LXFA 2H89B 3AEGB 1JW9D 4ZHOA 3PO0A 4YSYB 3HUIA 1YQ4B 1PFDA 5EE1A 5EE3A 2QJLA 1WXQA 1N5XA 1A70A 1WRIA 2JQRB 3AN1A 3WCQA 1FFVA 1ROEA 2PIAA 3B9JA 2MJDA 3EUB2 5H8YE 3RPFC 1R7SA 1TJEA 1SIJA 3AEFB 3W5VB 1IUEA 2M19A 5AUIA 3AECB 1V8CA 1YQ3B 1FRDA 1UWMA 2AX5A 1XLQA 1NYRA 2H88B 1FMAD 5MPOA 1QF6A 1N61A 2N0SB 1PUTA 2BS2B 1QOFA 1KF6B 2WLBA 3AE5B 3AE3B 2DBYA 3KWLA 3P1MA 1ZUD2 1NYQA 1XLOA 1NVID 1ZOYB 2WS3B 2WU5B 2ACZB 1EWYC 2Q5WD 3ABVB 1E7PB 1CZPA 3P4SB 4US9A 3SFDB 4KX6B 3AMZA 1JQ4A 1FXAA 2G1EA 1RM6C 1QT9A 3AB5A 1FO4A 1TYGB 3AE1B 4JWUC 3NS1A 1JWBD
chains in the Genus database with same CATH superfamily
2LXAA 2KJHB 1V80A 2V3NA 2B76B 4M8NA 4WURA 1V81A 1XLNA 1XXGA 3FKYA 4W9KA 1KRHA 1SXTA 1XQQA 2GBMA 2K8BA 2D3GA 4C4VA 2KKCA 3Q3FA 1C4CA 4KDLB 3VAWA 2KTRB 3I3TB 1PGBA 2I1KA 4YT0B 2DZIA 1YJIA 1YQBA 2RPQA 2XK5B 4HPLB 2FCQA 1JWAD 4ZRJA 1SE9A 1RLFA 2HD5B 2BQQA 2O2VA 1V1PA 4TQ1A 1WZ0A 3DVNV 3GB1A 3MC9A 5CHWA 3BY4B 5D3IB 3RNAC 2W55A 1OEYJ 3PLVA 3U52E 4DDID 1E8XA 4IUMB 2Y5CA 2J7QB 2JYEA 4A3OA 3DBHI 2LI5A 2MQJA 5JHAA 1NI2A 3QX1A 1GB4A 1SEBD 2I1JA 2H89B 3AEGB 4GDKB 3QCAA 1HXYD 3ZJUA 3M63B 1TS2A 2KDBA 3DBRB 1SIJA 1PQSA 4K3CA 4BKSD 1TTNA 3PS6A 2JZZA 2LZ6A 1PUTA 4BBNC 2IGHA 4HK2A 3U8ZA 1XLOA 3ABVB 1GUAB 2NCNA 1K50A 4JWUC 2KMCA 5IKCM 1OEYA 3C0RB 4ZHPA 3JSVB 2O6VA 3EFUA 4GOCA 2V4LA 2L3ZA 3R66C 2L83A 2KAJA 5LNK1 3Q3NC 4ARIA 2G4SA 3IXSA 2RDHA 5AUKA 1SE2A 1ESFA 1SGHA 4N59A 1ZGUB 5DCNA 2MA9B 4M01A 1I4RA 1S1QB 5KHQA 5JH5C 1QOGA 4F8CB 1DYQA 3RNGC 1VJKA 2QC8A 2AQ3B 2L05A 3MC0B 3OLMD 2CHZA 4KGTA 3KLSX 1I4PA 1BUIC 1EU3A 4JWSC 2KVZA 3VR8B 3IAM1 3HVZA 3RZFA 2K1FA 2KNBA 4K1RB 4BKTA 3T8MA 3QQ8B 3GZNB 1DOIA 1WGKA 3TMPB 3NVZA 3I5JC 1B9RA 2BW2A 2KN4A 4XDDA 1JW9D 3DPDA 4GSWA 2KK8A 2RD0A 1BT0A 1WXQA 5TR5A 4HKZE 1A70A 2LUMA 2WHIA 3PVLA 4GDLA 2GLSA 2KDFB 1L2NA 4NQLB 1SE4A 2MWSB 3KW5B 1NYRA 3VQIA 3RI7C 1SSNA 4KZ0A 5J2RA 4L2YA 2HDEA 2KFKA 4TKNA 5JZEB 2FIFA 3RMKC 1RM6C 4MH0E 3VH3B 4JLCA 1J8CA 1BMLC 1WGRA 3DVGX 3QAQA 4NJCA 2BS4B 4IM0A 4MGIE 3Q8AA 1WSPA 3H8HA 1EUVB 2OJWA 2NBWB 5LLIA 2IO1B 2N7JA 1UWXA 3PSEB 3APFA 4W9FA 1D5MC 1WJ6A 4ZDVA 2QILA 3PZDA 3VTWA 2UWQA 3S2AA 2EKEC 1J7AA 3RNBC 2QMTA 2KVRA 4WQOB 1WI0A 2JZPA 4KKJA 2IY1B 2NTSA 4US8A 2I38A 4YTMB 2AWTA 5C23A 1ISNA 3P4RB 3H9DA 1R4NB 3CMMB 3QWZB 1LFDA 1V49A 4MGKE 3KWVA 3N32A 2XNAC 3IAS1 3N1XC 1L6VA 2PE9A 3LJ3A 4ANUA 2BKFA 2KTFA 2O6VB 1GOZA 2NS5A 2BYVE 4CQNA 3V6CB 3VUWA 3Q8EA 2W82A 3ML8A 2V0GA 1MJDA 5EE3A 4GMVA 3AN1A 1SE3A 1ROEA 3HIZA 5AZFA 1WR1A 4LNNA 5IO9A 3LYYA 4MELA 3AECB 2WXJA 4ZRIA 2N0SB 4TV3A 1WXSA 2GRIA 1D3ZA 3P4SB 2NTTA 1FPYA 2G1EA 1ET6A 3PRZA 3NS1A 3VHTC 2JF5A 4BAXA 2IDYA 3B2FA 2D3BA 2QEJC 2V9HA 4HXDA 3KYCD 4EKUA 1GAQB 2L8JA 4HPMB 2GOWA 1P1AA 4W9LA 4ICUA 2FNJB 4EEWA 4URKA 2JXTA 1T0RC 3NUHB 4WIPA 3RN9C 3QHTA 4W9DA 2RSUA 3JSVA 4YTNB 4YL8A 1FNVA 2LGSA 4K7SA 1HE8A 3P2BA 2XEWA 1FXIA 1IPGA 3MJ5A 1YD8U 1WXVA 3ZDMC 4P1CC 1NENB 1ZDVA 3X0WA 1I7HA 4TMAB 1SB3C 4AQ7A 3M95A 3RNCC 3TSSA 4BKSA 2G3QB 2SAKA 2GBKA 3ZRFA 1CJEA 1TS5A 3AULA 2C9WB 2NPTB 1TS3A 2L00B 2KYWA 1HZ6A 2J0MA 2L0TA 3WAOA 4YSXB 4WJPA 3NY5A 3LB8C 2FCSA 2FUG1 2N1WA 3C8YA 2Y5PA 2PVOD 4ZRPA 3SD5A 2V4IB 5C1ZA 2V1YA 4EUTA 5CHVC 2JQRB 1WXMA 2KC2A 2NR2A 1U4AA 1TJEA 2JXXA 3SHQA 2MSED 4IKGA 2WYQA 4HJGE 2LMCA 1XF5L 1T0YA 3Q8FA 2N9XA 1EWYC 1P7FA 1FCLA 3AE1B 3RT3B 1L4DB 5T8IA 5C3JB 2LGIA 1ENFA 5FKAC 4DXGA 5IOIA 2WDQB 1F2RI 2OOBB 2WNMA 3HK0A 3NVWA 3AI5A 4NAWB 4LNKA 2MBQA 3I57A 2CHWA 4AUQC 3PHWB 4S0RA 3ZJTA 2K9XA 2DWQA 3DDCB 1CQVA 3QC8B 3HVDA 2J0JA 3IBEA 4OW0A 4M02A 2ZW0A 4JIOU 4W9JA 2LJ5A 4PS8A 1J7BA 2A4ZA 4IWPA 1NBFC 5FK9C 2W3RA 2WU2B 3WALA 1E5WA 2VH1A 3PRPB 3N30A 2MBOA 1Q10A 1FFUA 2D5GA 4KDIC 4WWPA 1Q5WB 1MHXA 5DPRA 2M4NA 2BB5A 2OHFA 1YX6B 2DAFA 4HRSA 4C4VB 3H6NA 1PGAA 5D7GA 1UNSA 4NAMA 4KSLC 4DHJD 3D32A 5BO4B 2LGYA 5GXGB 1K52A 2K5PA 1CMXB 2M56B 2DYOA 3Q8BA 2RDGA 1L0YB 4I6PA 2AQ1B 4O1NA 1LM8B 2IO2B 1FM0D 2WXFA 3H7SA 3TJPA 1WRIA 4Q2JA 2J0KA 5E6NA 1EU4A 1UH6A 3DBSA 1XCTL 1GNUA 1XLQA 5MPOA 2H88B 5KHOA 4JPSA 2DHZA 2FCMA 5LXIB 1E7PB 1CZPA 1YNTE 2MBEA 1FXAA 1YN4A 4JX1C 4FLHA 3AE6B 1T5XD 1WX8A 3B1LX 1NDDA 2KTRA 4E74A 4FXCA 4NZLB 4ASWC 3BYTB 2KWCA 4WQMA 1GJZA 4KGSA 1IP9A 2J4XA 2JPHA 5EDSA 1C79A 3QARA 1F1HA 1WR6E 1GPXA 4DHJB 5CTRC 1G6JA 3TIXA 1I4QA 4BKGA 2KLGA 1PDXA 1WY8A 4GN1A 3N20C 2JUOA 3SR6A 4K7UA 5G55A 3AEAB 4DHZB 1JCKB 4WJNA 2K3UA 3UI3A 3ZNHB 1MG8A 2KMAA 3P42A 5C2TB 1V2YA 1SJED 3B2GA 3Q3MC 3U30A 3EGRA 2ON8A 1WXAA 1N63A 2BB6A 1JRPA 3VTVA 4KGRA 4A6QA 3ZNID 5AZGA 2MP2A 1TY0A 3VRBB 1AARA 4M00A 1KLVA 2MJEA 3V6EB 1HQRD 1N60A 4IM2A 4YTPB 4LNFA 2IBIB 3A33B 3ZJVA 4OZBA 1TT5B 3PRMB 4P16A 1IUEA 1ZDXA 2REXA 3EFCA 1FRDA 4I6LB 4FJZA 1VZ6A 2DYBA 4L1BA 4MT5A 1STEA 2V3PA 1ZUD2 3MTNB 1ZE3D 3TL5A 1D4BA 1FO4A 2D11A 1ET9A 3IVFA 4F1SA 1R4NI 4ACFA 4II2B 5HFYA 4OHJA 2L52A 3O13A 1ZKHA 2KFJA 4PS7A 4W9IA 3DBLI 1VLBA 4G50A 1YN5A 1TGZB 3NVVA 5L83A 2WDVB 1RYJA 5DPWA 2ZCBA 4KSKC 3P4QB 4X57B 1WE6A 3PZ7A 4I6NB 4M0WA 3DHIC 2PPHA 3AEBB 4RF0A 4MDKE 2N9LA 2CU3A 3WAMA 3W9CB 5DPTA 1XO3A 1YOVB 3TEYA 2K25A 1K53A 2KC1A 1E7UA 1ZW7A 5D2MB 5G5GA 5J18A 4EZJA 2N9KA 1JRUA 3TEZA 3Q69A 2W54A 1TKEA 2MEKA 2PVGC 4DWFA 4A8XC 2R61A 1DGJA 2W3SA 2HTME 4KIKA 2BGFA 3K9PB 4G3XB 1RRBA 3N3KB 2ZCCA 4DXAB 5FR3A 2LJIA 3DBLB 3PHXB 5BYRA 2R2QA 4RFBA 3L13A 4YSYB 2KZRA 4CYEA 4RF1A 2QJLA 3PLUA 2JZ3B 2IGDA 2WDTB 1H8CA 1VRAB 2KO3A 3IG3A 4L23A 1C78A 2Y3AA 1NYQA 1XCQL 4XE0A 3AU5A 3RYTA 3AB5A 1TYGB 3BK1A 3M62B 2C7MB 1TKYA 4C00A 1E10A 3AV8A 2L1AA 2WX0A 4XYCA 4CO7A 2RMMA 4FULA 4PK1A 2MHJA 3EECA 3KUCB 1QILA 3DBRI 2TSSA 1V97A 4MACA 2K22A 3ECIA 2CU1A 1Q0WB 1UUPA 2J52A 2KJRA 1VZ8A 2KD0A 2Y5BB 2INPE 4DXFA 2LWPA 5G5HA 1WGYA 2WX1A 1RAXA 1MFWA 2MH7A 1F9JA 2INCC 4E71A 4N9F4 2WXGA 1WJUA 2JY6A 2K8CA 2PJHA 4GIVA 4ANXA 2Z0EB 4TUUA 3BVZA 1KH0A 1J19A 2MLBA 4RMAA 3ZXRA 2L32A 3AEEB 4A20A 4HEA1 3JYUA 3N1ZC 1KFYB 3VVWB 5AEKB 1WMHA 2WP9B 3GOEA 2ONQA 3ENEA 2BKRB 3R2IA 2INDC 1UELA 2MBBB 1R4MI 1YQ4B 1KM7A 1N5XA 4LNIA 2B3AA 4BOZB 4NY0A 3H7PB 1Y56A 1R7SA 3FILB 2KT7A 1C3TA 1S3SG 1V1OA 4ZYSA 2O2VB 3Q3OC 1KF6B 2DBYA 2KANA 2XN9C 2JRHA 2K6QA 2WU5B 5J17A 4LJOB 2CKHB 1L7YA 3ZUNA 4MSMB 4P1BC 2FAZA 1LO5D 4NNJB 3ALBA 4W9GA 3L17A 4JL9A 1E6EB 1P98A 3V05A 2LD9A 3M3JA 3ZTCA 1L6UA 1SBBB 2JYTA 2K8HA 3L08A 1WYWB 4USAA 1X1MA 3RULA 3NRZA 1JWSD 4AOFA 1P9DU 3L54A 2WXMA 4FJVB 5IAAC 2DYMA 3U2SC 3VXWA 5EE9A 3TEWA 1QQRA 2N1VA 3UIOB 4GB9A 1WH3A 4XWTA 2KJ6A 3ETRA 2MP2B 3B08A 1BXTA 1ZXIA 2QSDA 4W9HA 1E8WA 4DHZE 1UF0A 3OJ4B 3PZ8A 3DWMA 3IFWB 4NQKE 1TBEA 2JWZA 1WYGA 3QIJA 2D3CA 3NVYA 1IYFA 3A4RA 2KDEB 4A9AA 1HTQA 1FRRA 3GS2A 1WJ4A 4ZHOA 2G45B 2V3SA 5EE1A 1E90A 2CS4A 4FN2A 3PV1A 1FFVA 2D3AA 1L0XB 5AUIA 4AS1A 4DDGD 1YQ3B 2AX5A 3FILA 2AL6A 3AE3B 2MX2A 2IYDB 2WS3B 4EZKA 4RM9A 2EMSA 3HM3A 2KXJA 4BVUC 1M94A 1WJNA 1GG3A 2EELA 3L16A 2PKOA 2X8XX 2JSVX 4JE3B 1HTOA 3KVFB 3ML9A 1D5XC 3TCAA 4AJWA 2E3TA 2N7DA 3KYDD 2FBWB 1LXDA 4ANVA 4XC2A 1JALA 1PGXA 1T0SC 3U4EG 1TKGA 3Q3JA 1KLGD 3PREA 5FR6A 2N9PC 2R2OA 3BVMA 2BS3B 3BVGA 2EKIA 2WXIA 1WM3A 4XWWA 1C1YB 2ZW1A 3L10B 2KOXA 3MJWA 4B6WA 1OQQA 1AWDA 1IGCA 2QCZA 3KUDB 1YJJA 1I4XA 1TS4A 4HVBA 1OTRB 2BTEA 1EF5A 5TSSA 2IO3B 3NZUA 1UGJA 5HI1A 2WDRB 1FEHA 2LRUA 2BYTA 4C7YA 3FC4A 1QZEA 2CHXA 4FHKA 4YXDB 1QOAA 1UZXB 4OZAA 4PYZA 3J9CA 5CHFA 2FCNA 1FXTB 1E8ZA 3ZNGC 2WXRA 1GB1A 3SDLC 5JHBA 3NZ3A 2M19A 1Q1OA 4K3BA 4RGNA 1QF6A 3C19A 3PTFC 3H7PA 4JQWC 1V5TA 3K9OB 3KWLA 3OAWA 1NVID 2ACZB 2Q5WD 2IGGA 1WF9A 1VZ7A 3SEBA 5AZHA 4P6VF 1WIAA 1N62A 4GU2A 3W1SA 3MHSD 4OVUA 3EHVA 5LXHA 3TEXA 3BYYB 3VRAB 2IZVB 3W1YA 3L0WB 1RFKA 2JX5A 3ONSA 3AE9B 4KVGB 3U7DA 1JMLA 2DX5B 4GXBA 2WXQA 4NPNA 2BYFA 2HJ1A 1WX9A 1HEZE 1MHHE 2INNE 5D6JB 2KQ7A 2LHDA 3R2TA 2D07B 3MFGA 2EMTA 3APCA 2RDBC 5BYSA 5I4DA 3W2DA 4A90A 1C4PA 2JRIB 2M17A 1MVKA 3NG0A 3A1QA 2KFKB 3WIMA 2NPTA 2PTLA 3Q14C 1YJ1A 1QKZA 4PS3A 3CWIA 1F0ZA 3AE4B 3H1UA 2MW5A 5L95C 1TZ1A 5HG2A 3PPAA 2MJ3A 2GB1A 2KQSA 1M4VA 5E6JA 4FADA 4GDLB 3DVGY 1GC7A 2RR9A 1XLPA 4EFOA 4ZRKA 4H2AA 4ARCA 2DENB 1WGHA 3RNFC 3HUIA 1GC6A 2WXKA 2LGXA 4PYUA 4IWOA 1VD2A 3AEFB 2M8SA 2FUHB 3A1QB 1TIFA 1UWMA 4MEMA 1QOFA 3ZVVA 1N6ZA 3DBHB 1SIFA 1VCBA 3AMZA 3R8BA 2NBVB 2RPVA 1TY2A 2JVCA 4YWGG 4IC7B 2GBRA 2WQYB 3QA8A 4IW0A 4MJSA 4RGMA 1RWSA 2PMVA 5BMHA 4K7WA 4W9EA 1P0RA 1JROA 4NJ6A 4BFRA 2C7HA 1C4AA 1V86A 3VUXA 3U7ZA 1DOXA 1WZ3A 3W1SC 4WWNA 5D94A 2OEDA 1HZ5A 2IY0B 1R4MB 4RM8A 2BF8B 1XEEA 1UBQA 4WAFA 1QOBA 4MH8A 1Z2MA 3DWGC 3TUOA 1T3QA 2UU7A 3NZSA 2K6DB 1J7CA 3MC8A 3MP9A 1WGDA 1TZOA 3E9SA 3CF6E 1XT9B 2VRRB 3BZDB 4HCPB 5IA7A 2PEAA 1C76A 4IDIA 3ZLZA 4HROA 3BK2A 3Q6BA 3E56A 3LDZE 3DOWA 5HHDG 4IG7B 4S17A 5G2NA 4REZA 1N5WA 3LXFA 4LJPB 4WWOA 4HCNB 4ANWA 4WAAA 1OGWA 1PFDA 2CR5A 4DQOC 1ACCA 2MJDA 3EUB2 4MM3A 3VUYA 3R3MA 1T6BX 2J53A 4BBNF 1FMAD 4BZAA 4HJKA 2BS2B 4FHJA 3AE5B 4D2KA 2BYEA 5E6OA 2O6VD 1ZPSA 3ZDTA 2M0AA 3URYA 3GE8C 3EA6A 1YIWA 1P3QU 2VZKB 2LASA 1EF1A 3A9KB 2QIEB 4J6IA 4B95A 4N6EB 2CJOA 1C9FA 4ZRQA 2NVUI 4DBGA 2E6XA 4MSQB 2Z8LA 4EZLA 4KV2A 3AE7B 5GMVA 1SF0A 1V9JA 1QLBB 3PT2B 3FAHA 4C7ZA 1FNUA 3Q2AC 3HRDD 4N58A 2M0XA 3RCZA 3AXCA 2KQ4X 4E3CA 1YN3A 4FJYA 1F52A 3ZYYX 4MJSB 2N7EA 1L0VB 3I63C 2Z59B 3A9KA 1KTKA 3DVNU 3WA0A 1WGGA 2KACA 2N4FA 4LLGM 4GDKA 1B1ZA 2YEPB 4XDCA 3B0AA 1VR9A 4KZCA 3UQBA 1EWCA 3VDZA 2DZKA 1J0GA 3T3NA 3DCGA 3NS8A 3CSTA 2HJ8A 2BT6A 2WXHA 1C77A 1WMHB 1UGMA 1YMHE 4QAYA 2ICIA 3RFZB 1OFFA 3DHHC 1L4ZB 2KX0A 5CX3A 2YLMA 3QJZA 2XK5A 3JW0X 2LRWA 3NJTA 5BMGA 3V3XA 3WANA 4GLSC 4G11A 2I2YA 4A3PA 1JWMD 2NBUA 1WM2A 4OVVA 3N1YC 4EE2A 2KWDA 4R3DA 2KDMA 4FA6A 2GMIC 1ZOYB 2UYZB 3RD2A 1F77A 1P7EA 3UQAA 1QT9A 2KHWB 2QDFA 4WH4A 2PLPA 1IBXA 3A4SC 4HLEA 4C80A 1AW7A 2XBBC 2C60A 3AU4A 4J3OD 1I42A 2L76A 3ZW3A 2BPSA 3KH0A 3UINB 3APDA 3HHMA 1IGDA 3P4PB 4MM3B 2HTHA 3MHZA 3R7RA 2JWUA 4ICVA 4LNOA 1MG4A 4CHKA 2CJNA 2PW9A 4WWMA 2MRPA 1E9MA 3A9JA 4C56C 2J42A 3RNEC 3RUIB 1MI0A 2PE6B 4IWQA 4IM3A 1FNWA 3JVZX 4WJQA 4RCOA 4TQ0A 3DHGC 1PYWD 4JGHB 3VTUA 4YSZB 4IOIE 1HA5A 1VDVA 2ZEQA 2L7RA 3SU8X 3BINA 3GE3C 1NI3A 4ITKA 4M0WB 2KX3A 4TSSA 4LDTD 3ZRCA 2VH2A 1AYFA 2A5UA 3CSFA 4AWJA 4RNAA 1KJTA 4MGYE 4B0MA 1YX5B 3EC8A 2QHOA 2ZPYA 2ZPNA 2JT4B 4LK0M 4OZCA 3PGEA 3VFKA 1JWUD 2D10A 3AE2B 1NEKB 4ZOHC 5BYQA 2C7NB 4KIKB 3KQ4A 5JXVA 3UGBB 2ZJDA 3ZKJC 1XD3B 1K51A 2FE8A 3V60A 3T3OA 4OVZA 1UD7A 1E7VA 3GP7A 1LQBA 3VH4B 3IT4B 3SFDB 2YEPF 3Q8CA 5DPSA 2IPKD 2FIDA 3UF8A 1I4GA 2LFIA 4II3B 5IN7A 4B9KA 3ZO5B 2D2QA 3O65B 3V61A 2LGDA 2WGSA 1EM7A 3AEDB 1FIQA 4LDTB 1V6EA 1WE7A 2WXNA 2ZNVB 1OQRA 3IT6B 3T9LA 1KOTA 2ZVNA 3SFEB 2KWUB 1Z5SB 4XZ4A 1L5PA 2K39A 2WXPA 1H4RA 1WFYA 1ZXHA 3OJ3A 2Z0DB 3CIRB 3GZNI 4RGTA 2BBCA 4B0EA 5E6PA 4AJYB 2X38A 1FCCC 3ZXVA 3TBLD 4M8MA 2GI9A 3ZGZA 2LVOA 4GGQA 2KMMA 2C5LC 1DOYA 2WXOA 1EO6A 1I4HA 2DNFA 3HM6X 2DAJA 3VR9B 5H92C 3UIPB 1SJHD 1LGRA 2DZMA 2HE7A 4WJOA 1A5RA 4A55A 4RGOS 3X23A 3A9JB 2KN5A 3N9YC 2AEHA 4XGAB 2ZNVC 4KKIA 3R7QA 2PIAA 2K0PA 4XX5A 5HKHA 5H8YE 3OG5A 2MCNB 3BWUD 4RH6A 4P7IA 1D5ZC 3DQVA 1E8YA 3P1MA 1AN8A 2G9HD 2W9NA 2WWZA 4US9A 1IBXB 3RZWC 4KX6B 4HDOA 5IP4D 5D3DA 2IO0B 2NMQA 2WXLA 4F7ZA 3WAPA 2ZZPB 2ASQA 2LVQA 2OJRA 3IHPC 2ZVOA 2LEKA 4HPPA 4HKQA 2N9EB 3ZQ4A 4ZYNA 2GBNA 3L4PA 1KLUD 3AM9A 1MPEA 3BIID 3AE8B 4G0NB 3W5UB 1WWTA 4UDUC 2GBJA 3AH7A 1V5OA 1WX7A 1E0ZA 3OWEB 1K8RB 2G4DB 4LTUA 2LXCA 3ZTDA 4EOYA 2AL3A 3ZNZB 2KWVB 2AYOB 5EE0A 4BOSC 4PT5A 2SEBD 3KUZA 3QK0A 1ZP0B 2KDIA 1RFAA 1D6EC 2LVPA 4LCDE 4NAWA 1WRDB 3V62A 1F2RC 1UBIA 2VZKD 4NJ7A 1V1PB 2L0FA 2M1MA 4HDQA 2DLBA 4W9CA 1I35A 3P63A 2JU6X 2RGFA 4AP4C 1T0QC 2MBHA 3PO0A 1FD6A 3NHEB 3WCQA 3NOBA 2AQ2B 3B9JA 3I9V1 1CK1A 3RPFC 4FBJB 2BWES 3W5VB 2LHEA 4HWIB 2YVCA 4MGZE 2KLCA 1V8CA 4K81A 2LUEA 3ZIMA 1N61A 2DZJA 2BWFA 2WLBA 5BMIA 1OQYA 1JQ4A 1Y8RC 2IJ0A 2BVCA 4DK5A 1JWBD
chains in the Genus database with same CATH topology
5C3JB 2LGIA 1ENFA 2QIEB 5FKAC 2V3NA 4DXGA 2WDQB 1LO5D 4N6EB 2B76B 2CJOA 4WURA 1F2RI 1C9FA 4ZRQA 2E6XA 2Z8LA 2WNMA 1E6EB 1XLNA 3AE7B 1XXGA 3NVWA 1SF0A 1KRHA 1QLBB 1SXTA 4NAWB 3FAHA 3I57A 3V05A 1FNUA 4C7ZA 3ZJTA 2K9XA 3HRDD 4N58A 2DWQA 1CQVA 1L6UA 1SBBB 2JYTA 2KQ4X 3HVDA 1YN3A 4USAA 1C4CA 3NRZA 3ZYYX 4OW0A 1JWSD 2ZW0A 1PGBA 4YT0B 1L0VB 1YJIA 1KTKA 2KACA 4LLGM 1J7BA 2WXMA 5FK9C 1B1ZA 2W3RA 2WU2B 2DYMA 2YEPB 3U2SC 1JWAD 5EE9A 1Q10A 1FFUA 2D5GA 3TEWA 4XDCA 1QQRA 1V1PA 4XWTA 4TQ1A 3ETRA 1MHXA 3GB1A 1BXTA 1ZXIA 1VR9A 2QSDA 2BB5A 2OHFA 1EWCA 5D3IB 4HRSA 3PZ8A 3DWMA 3T3NA 2W55A 3U52E 1PGAA 2Y5CA 5D7GA 1UNSA 4NAMA 5GXGB 2JYEA 1K52A 2K5PA 2BT6A 2WXHA 2M56B 2DYOA 1C77A 3Q8BA 1WYGA 2RDGA 1L0YB 1YMHE 3NVYA 2ICIA 2AQ1B 4A9AA 3RFZB 4O1NA 1OFFA 1FRRA 3GS2A 1SEBD 1GB4A 1FM0D 1L4ZB 2H89B 3AEGB 2WXFA 4ZHOA 4GDKB 1HXYD 5EE1A 3ZJUA 5BMGA 1WRIA 4Q2JA 1TS2A 1FFVA 3V3XA 1EU4A 1SIJA 4GLSC 1L0XB 1XCTL 5AUIA 4AS1A 2I2YA 1YQ3B 2AX5A 1XLQA 5MPOA 2H88B 1JWMD 3FILA 1PUTA 2IGHA 2KWDA 4R3DA 2KDMA 3AE3B 4EE2A 4JPSA 1XLOA 2WS3B 1ZOYB 3ABVB 1F77A 1E7PB 1CZPA 1P7EA 1YNTE 1FXAA 1QT9A 1YN4A 4WH4A 2PLPA 1IBXA 1K50A 4JWUC 4JX1C 2EELA 4C80A 1AW7A 3AE6B 4ZHPA 2PKOA 1T5XD 2JSVX 4J3OD 4JE3B 4FXCA 4NZLB 3BYTB 4WQMA 4KGSA 1D5XC 1IGDA 2E3TA 3P4PB 4MM3B 2FBWB 2J4XA 3MHZA 1C79A 2JWUA 1JALA 1PGXA 2L83A 2CJNA 2KAJA 2PW9A 4WWMA 5LNK1 1GPXA 1E9MA 4C56C 3U4EG 2J42A 1TKGA 1MI0A 4ARIA 3IXSA 1KLGD 1I4QA 2RDHA 1PDXA 5AUKA 3SR6A 1FNWA 4TQ0A 3AEAB 4RCOA 3BVMA 2BS3B 1SE2A 1ESFA 1PYWD 3BVGA 2EKIA 4N59A 4YSZB 2WXIA 4IOIE 1JCKB 1HA5A 1VDVA 4XWWA 2K3UA 3UI3A 1I4RA 2ZW1A 3P42A 5C2TB 1NI3A 1QOGA 1SJED 4ITKA 1DYQA 4TSSA 1VJKA 1OQQA 1AWDA 1IGCA 2AQ3B 3B2GA 1YJJA 3MC0B 4KGTA 3KLSX 3EGRA 1I4PA 1I4XA 1AYFA 1BUIC 1EU3A 1TS4A 2BTEA 2ON8A 1N63A 4JWSC 2BB6A 3VR8B 3IAM1 3HVZA 4RNAA 1JRPA 5TSSA 4KGRA 1UGJA 4A6QA 4B0MA 5HI1A 2WDRB 1FEHA 2BYTA 4C7YA 3FC4A 1TY0A 4YXDB 1QOAA 3VRBB 1DOIA 4LK0M 4OZCA 1WGKA 1JWUD 4OZAA 3NVZA 2MJEA 3AE2B 1NEKB 3J9CA 1HQRD 4ZOHC 1B9RA 1N60A 2BW2A 2KN4A 5BYQA 4YTPB 4XDDA 1JW9D 3KQ4A 1WXQA 5JXVA 4HKZE 1A70A 2LUMA 3ZJVA 4OZBA 2WXRA 1GB1A 1K51A 2FE8A 1SE4A 4P16A 1IUEA 3T3OA 1ZDXA 3NZ3A 2M19A 4OVZA 1FRDA 4RGNA 1QF6A 1NYRA 3GP7A 1VZ6A 3VQIA 4L1BA 1SSNA 4MT5A 3IT4B 3KWLA 1STEA 2V3PA 1ZUD2 4L2YA 1NVID 2HDEA 3SFDB 2ACZB 2Q5WD 2IGGA 2YEPF 1ZE3D 3Q8CA 1RM6C 1D4BA 1FO4A 2IPKD 1VZ7A 1I4GA 3SEBA 1ET9A 2LFIA 4P6VF 1BMLC 1N62A 3W1SA 3TEXA 5HFYA 3BYYB 4NJCA 4OHJA 2L52A 2BS4B 3O13A 1EM7A 3AEDB 1FIQA 3VRAB 3Q8AA 2WXNA 1WSPA 1OQRA 1RFKA 3H8HA 2JX5A 1VLBA 3AE9B 1YN5A 3NVVA 2N7JA 1JMLA 1UWXA 2WDVB 3IT6B 2WXQA 1RYJA 1D5MC 3P4QB 2QILA 3PZ7A 3SFEB 4M0WA 1J7AA 1HEZE 3AEBB 2QMTA 4RF0A 1L5PA 1MHHE 2INNE 2N9LA 2WXPA 2CU3A 2LHDA 3R2TA 2JZPA 1ZXHA 3MFGA 4KKJA 3CIRB 3W9CB 1XO3A 2NTSA 2I38A 4US8A 4RGTA 2BBCA 3TEYA 4B0EA 1K53A 5BYSA 4YTMB 5I4DA 3W2DA 4A90A 1C4PA 2X38A 1MVKA 5G5GA 1FCCC 3P4RB 2N9KA 3TEZA 3Q69A 2W54A 2GI9A 2PTLA 1TKEA 2MEKA 3ZGZA 2PVGC 1QKZA 4A8XC 2KMMA 1DOYA 2R61A 1DGJA 2W3SA 2HTME 2WXOA 3CWIA 1F0ZA 3AE4B 3KWVA 2XNAC 3IAS1 5FR3A 1I4HA 1L6VA 5HG2A 3VR9B 5H92C 1SJHD 2MJ3A 2GB1A 1M4VA 2LJIA 5E6JA 1GOZA 4GDLB 4CQNA 5BYRA 4RFBA 4A55A 4RGOS 3Q8EA 1XLPA 4H2AA 2W82A 4ARCA 4YSYB 2V0GA 3HUIA 3N9YC 4RF1A 2WXKA 2QJLA 5EE3A 2IGDA 3AN1A 4KKIA 1SE3A 1ROEA 2PIAA 2K0PA 5H8YE 3BWUD 4RH6A 3AEFB 1D5ZC 3LYYA 1VRAB 3AECB 1UWMA 4L23A 2WXJA 2N0SB 1QOFA 1C78A 2Y3AA 3P1MA 1AN8A 2G9HD 1NYQA 1XCQL 2GRIA 4US9A 4XE0A 3P4SB 1IBXB 4KX6B 2NTTA 3AMZA 2G1EA 1ET6A 3R8BA 3AB5A 1TYGB 3BK1A 3NS1A 2RPVA 1TKYA 5D3DA 1TY2A 1E10A 2NMQA 3AV8A 2L1AA 2WXLA 4YWGG 2RMMA 2IDYA 2WQYB 3B2FA 2QEJC 4RGMA 1RWSA 2PMVA 5BMHA 1QILA 1GAQB 2LEKA 2TSSA 1V97A 4MACA 2K22A 4HKQA 1JROA 3ZQ4A 1C4AA 3U7ZA 3L4PA 1UUPA 1DOXA 2J52A 1KLUD 3AM9A 1MPEA 1VZ8A 2INPE 2JXTA 4DXFA 3BIID 3AE8B 3NUHB 5G5HA 2OEDA 1HZ5A 4WIPA 3W5UB 1WWTA 4YTNB 2MH7A 1FNVA 1XEEA 4WAFA 4UDUC 1QOBA 4MH8A 2WXGA 3AH7A 3DWGC 3TUOA 1FXIA 1E0ZA 3MJ5A 3OWEB 1T3QA 3BVZA 4LTUA 1KH0A 1NENB 1ZDVA 1I7HA 4TMAB 5EE0A 1J7CA 4PT5A 2SEBD 3MP9A 1SB3C 4AQ7A 1TZOA 3E9SA 3TSSA 2L32A 2SAKA 3AEEB 1CJEA 1ZP0B 1TS5A 3BZDB 1D6EC 1TS3A 4HEA1 1HZ6A 1F2RC 1C76A 2VZKD 4IDIA 4HROA 4YSXB 3BK2A 1V1PB 3E56A 1KFYB 2DLBA 2WP9B 3LB8C 2FUG1 5HHDG 3C8YA 3P63A 4REZA 2ONQA 2JU6X 2PVOD 2Y5PA 3R2IA 1N5WA 3LXFA 4ZRPA 3PO0A 2V4IB 1YQ4B 1PFDA 1FD6A 1N5XA 3WCQA 2JQRB 2AQ2B 4DQOC 1ACCA 3B9JA 3I9V1 2MJDA 3EUB2 1CK1A 3RPFC 1Y56A 1R7SA 3FILB 1TJEA 3W5VB 2LHEA 4IKGA 1V1OA 4HJGE 1V8CA 4ZYSA 2LMCA 1T6BX 2J53A 1FMAD 1N61A 2BS2B 1XF5L 1KF6B 2WLBA 5BMIA 3AE5B 2DBYA 3Q8FA 2XN9C 4D2KA 2WU5B 1EWYC 1ZPSA 1P7FA 2M0AA 3URYA 1JQ4A 3EA6A 2IJ0A 1FCLA 3AE1B 1L4DB 2VZKB 5T8IA 1JWBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKY A;  5C3J B;  4C80 A;  2QIE B;  3AE6 B;  1E10 A;  3AV8 A;  4ZHP A;  2PKO A;  2WDQ B;  4N6E B;  2B76 B;  2CJO A;  4P6V F;  2WQY B;  3B2F A;  1N62 A;  1RWS A;  4FXC A;  1E6E B;  1XLN A;  3AE7 B;  4WQM A;  3NVW A;  1SF0 A;  1KRH A;  2L52 A;  1QLB B;  2E3T A;  3P4P B;  1GAQ B;  2BS4 B;  2LEK A;  2FBW B;  3FAH A;  1V97 A;  4JX1 C;  2K22 A;  3AED B;  1FIQ A;  3VRA B;  4C7Z A;  1JRO A;  1JAL A;  2K9X A;  3HRD D;  4N58 A;  2DWQ A;  1OQR A;  1RFK A;  2L83 A;  2CJN A;  2JX5 A;  1L6U A;  2KAJ A;  1VLB A;  3L4P A;  4WWM A;  3AE9 B;  1DOX A;  1GPX A;  3AM9 A;  1E9M A;  3NVV A;  2WDV B;  1TKG A;  4USA A;  3BII D;  1RYJ A;  3AE8 B;  3NRZ A;  5G5H A;  3P4Q B;  3W5U B;  3ZYY X;  1WWT A;  4YT0 B;  1PDX A;  5AUK A;  4YTN B;  3SFE B;  1L0V B;  3SR6 A;  1YJI A;  3AEA B;  2MH7 A;  2BS3 B;  1J7A A;  3AEB B;  2EKI A;  4N59 A;  4YSZ B;  1L5P A;  1J7B A;  1QOB A;  1VDV A;  3AH7 A;  2CU3 A;  3DWG C;  2W3R A;  2WU2 B;  1FXI A;  3W9C B;  3CIR B;  1E0Z A;  1JWA D;  1T3Q A;  1XO3 A;  5EE9 A;  5C2T B;  4US8 A;  4LTU A;  1FFU A;  1NI3 A;  1QOG A;  4ITK A;  1NEN B;  1I7H A;  4YTM B;  1VJK A;  5EE0 A;  1J7C A;  1OQQ A;  1AWD A;  3B2G A;  3ETR A;  5G5G A;  1YJJ A;  1ZXI A;  3P4R B;  1SB3 C;  1AYF A;  2OHF A;  3AEE B;  1N63 A;  1CJE A;  1ZP0 B;  1TKE A;  2W54 A;  4HRS A;  2PVG C;  4JWS C;  3VR8 B;  3HVZ A;  1JRP A;  2KMM A;  3DWM A;  1DOY A;  2W55 A;  1DGJ A;  2W3S A;  2HTM E;  3CWI A;  1F0Z A;  2WDR B;  2Y5C A;  3AE4 B;  4C7Y A;  4IDI A;  3FC4 A;  4HRO A;  5GXG B;  4YSX B;  1L6V A;  1QOA A;  3VRB B;  2K5P A;  3VR9 B;  5H92 C;  1DOI A;  2BT6 A;  2MJ3 A;  4YXD B;  2M56 B;  1KFY B;  1WGK A;  1WYG A;  2WP9 B;  3LB8 C;  3NVY A;  3NVZ A;  3P63 A;  2MJE A;  3AE2 B;  1NEK B;  1B9R A;  4ZOH C;  2PVO D;  1N60 A;  4A9A A;  1OFF A;  1FRR A;  1N5W A;  1FM0 D;  4YTP B;  1XLP A;  3LXF A;  2H89 B;  3AEG B;  1JW9 D;  4ZHO A;  3PO0 A;  4YSY B;  3HUI A;  1YQ4 B;  1PFD A;  5EE1 A;  5EE3 A;  2QJL A;  1WXQ A;  1N5X A;  1A70 A;  1WRI A;  2JQR B;  3AN1 A;  3WCQ A;  1FFV A;  1ROE A;  2PIA A;  3B9J A;  2MJD A;  3EUB 2;  5H8Y E;  3RPF C;  1R7S A;  1TJE A;  1SIJ A;  3AEF B;  3W5V B;  1IUE A;  2M19 A;  5AUI A;  3AEC B;  1V8C A;  1YQ3 B;  1FRD A;  1UWM A;  2AX5 A;  1XLQ A;  1NYR A;  2H88 B;  1FMA D;  5MPO A;  1QF6 A;  1N61 A;  2N0S B;  1PUT A;  2BS2 B;  1QOF A;  1KF6 B;  2WLB A;  3AE5 B;  3AE3 B;  2DBY A;  3KWL A;  3P1M A;  1ZUD 2;  1NYQ A;  1XLO A;  1NVI D;  1ZOY B;  2WS3 B;  2WU5 B;  2ACZ B;  1EWY C;  2Q5W D;  3ABV B;  1E7P B;  1CZP A;  3P4S B;  4US9 A;  3SFD B;  4KX6 B;  3AMZ A;  1JQ4 A;  1FXA A;  2G1E A;  1RM6 C;  1QT9 A;  3AB5 A;  1FO4 A;  1TYG B;  3AE1 B;  4JWU C;  3NS1 A;  1JWB D; 
#chains in the Genus database with same CATH topology
 2LXA A;  2KJH B;  1V80 A;  2V3N A;  2B76 B;  4M8N A;  4WUR A;  1V81 A;  1XLN A;  1XXG A;  3FKY A;  4W9K A;  1KRH A;  1SXT A;  1XQQ A;  2GBM A;  2K8B A;  2D3G A;  4C4V A;  2KKC A;  3Q3F A;  1C4C A;  4KDL B;  3VAW A;  2KTR B;  3I3T B;  1PGB A;  2I1K A;  4YT0 B;  2DZI A;  1YJI A;  1YQB A;  2RPQ A;  2XK5 B;  4HPL B;  2FCQ A;  1JWA D;  4ZRJ A;  1SE9 A;  1RLF A;  2HD5 B;  2BQQ A;  2O2V A;  1V1P A;  4TQ1 A;  1WZ0 A;  3DVN V;  3GB1 A;  3MC9 A;  5CHW A;  3BY4 B;  5D3I B;  3RNA C;  2W55 A;  1OEY J;  3PLV A;  3U52 E;  4DDI D;  1E8X A;  4IUM B;  2Y5C A;  2J7Q B;  2JYE A;  4A3O A;  3DBH I;  2LI5 A;  2MQJ A;  5JHA A;  1NI2 A;  3QX1 A;  1GB4 A;  1SEB D;  2I1J A;  2H89 B;  3AEG B;  4GDK B;  3QCA A;  1HXY D;  3ZJU A;  3M63 B;  1TS2 A;  2KDB A;  3DBR B;  1SIJ A;  1PQS A;  4K3C A;  4BKS D;  1TTN A;  3PS6 A;  2JZZ A;  2LZ6 A;  1PUT A;  4BBN C;  2IGH A;  4HK2 A;  3U8Z A;  1XLO A;  3ABV B;  1GUA B;  2NCN A;  1K50 A;  4JWU C;  2KMC A;  5IKC M;  1OEY A;  3C0R B;  4ZHP A;  3JSV B;  2O6V A;  3EFU A;  4GOC A;  2V4L A;  2L3Z A;  3R66 C;  2L83 A;  2KAJ A;  5LNK 1;  3Q3N C;  4ARI A;  2G4S A;  3IXS A;  2RDH A;  5AUK A;  1SE2 A;  1ESF A;  1SGH A;  4N59 A;  1ZGU B;  5DCN A;  2MA9 B;  4M01 A;  1I4R A;  1S1Q B;  5KHQ A;  5JH5 C;  1QOG A;  4F8C B;  1DYQ A;  3RNG C;  1VJK A;  2QC8 A;  2AQ3 B;  2L05 A;  3MC0 B;  3OLM D;  2CHZ A;  4KGT A;  3KLS X;  1I4P A;  1BUI C;  1EU3 A;  4JWS C;  2KVZ A;  3VR8 B;  3IAM 1;  3HVZ A;  3RZF A;  2K1F A;  2KNB A;  4K1R B;  4BKT A;  3T8M A;  3QQ8 B;  3GZN B;  1DOI A;  1WGK A;  3TMP B;  3NVZ A;  3I5J C;  1B9R A;  2BW2 A;  2KN4 A;  4XDD A;  1JW9 D;  3DPD A;  4GSW A;  2KK8 A;  2RD0 A;  1BT0 A;  1WXQ A;  5TR5 A;  4HKZ E;  1A70 A;  2LUM A;  2WHI A;  3PVL A;  4GDL A;  2GLS A;  2KDF B;  1L2N A;  4NQL B;  1SE4 A;  2MWS B;  3KW5 B;  1NYR A;  3VQI A;  3RI7 C;  1SSN A;  4KZ0 A;  5J2R A;  4L2Y A;  2HDE A;  2KFK A;  4TKN A;  5JZE B;  2FIF A;  3RMK C;  1RM6 C;  4MH0 E;  3VH3 B;  4JLC A;  1J8C A;  1BML C;  1WGR A;  3DVG X;  3QAQ A;  4NJC A;  2BS4 B;  4IM0 A;  4MGI E;  3Q8A A;  1WSP A;  3H8H A;  1EUV B;  2OJW A;  2NBW B;  5LLI A;  2IO1 B;  2N7J A;  1UWX A;  3PSE B;  3APF A;  4W9F A;  1D5M C;  1WJ6 A;  4ZDV A;  2QIL A;  3PZD A;  3VTW A;  2UWQ A;  3S2A A;  2EKE C;  1J7A A;  3RNB C;  2QMT A;  2KVR A;  4WQO B;  1WI0 A;  2JZP A;  4KKJ A;  2IY1 B;  2NTS A;  4US8 A;  2I38 A;  4YTM B;  2AWT A;  5C23 A;  1ISN A;  3P4R B;  3H9D A;  1R4N B;  3CMM B;  3QWZ B;  1LFD A;  1V49 A;  4MGK E;  3KWV A;  3N32 A;  2XNA C;  3IAS 1;  3N1X C;  1L6V A;  2PE9 A;  3LJ3 A;  4ANU A;  2BKF A;  2KTF A;  2O6V B;  1GOZ A;  2NS5 A;  2BYV E;  4CQN A;  3V6C B;  3VUW A;  3Q8E A;  2W82 A;  3ML8 A;  2V0G A;  1MJD A;  5EE3 A;  4GMV A;  3AN1 A;  1SE3 A;  1ROE A;  3HIZ A;  5AZF A;  1WR1 A;  4LNN A;  5IO9 A;  3LYY A;  4MEL A;  3AEC B;  2WXJ A;  4ZRI A;  2N0S B;  4TV3 A;  1WXS A;  2GRI A;  1D3Z A;  3P4S B;  2NTT A;  1FPY A;  2G1E A;  1ET6 A;  3PRZ A;  3NS1 A;  3VHT C;  2JF5 A;  4BAX A;  2IDY A;  3B2F A;  2D3B A;  2QEJ C;  2V9H A;  4HXD A;  3KYC D;  4EKU A;  1GAQ B;  2L8J A;  4HPM B;  2GOW A;  1P1A A;  4W9L A;  4ICU A;  2FNJ B;  4EEW A;  4URK A;  2JXT A;  1T0R C;  3NUH B;  4WIP A;  3RN9 C;  3QHT A;  4W9D A;  2RSU A;  3JSV A;  4YTN B;  4YL8 A;  1FNV A;  2LGS A;  4K7S A;  1HE8 A;  3P2B A;  2XEW A;  1FXI A;  1IPG A;  3MJ5 A;  1YD8 U;  1WXV A;  3ZDM C;  4P1C C;  1NEN B;  1ZDV A;  3X0W A;  1I7H A;  4TMA B;  1SB3 C;  4AQ7 A;  3M95 A;  3RNC C;  3TSS A;  4BKS A;  2G3Q B;  2SAK A;  2GBK A;  3ZRF A;  1CJE A;  1TS5 A;  3AUL A;  2C9W B;  2NPT B;  1TS3 A;  2L00 B;  2KYW A;  1HZ6 A;  2J0M A;  2L0T A;  3WAO A;  4YSX B;  4WJP A;  3NY5 A;  3LB8 C;  2FCS A;  2FUG 1;  2N1W A;  3C8Y A;  2Y5P A;  2PVO D;  4ZRP A;  3SD5 A;  2V4I B;  5C1Z A;  2V1Y A;  4EUT A;  5CHV C;  2JQR B;  1WXM A;  2KC2 A;  2NR2 A;  1U4A A;  1TJE A;  2JXX A;  3SHQ A;  2MSE D;  4IKG A;  2WYQ A;  4HJG E;  2LMC A;  1XF5 L;  1T0Y A;  3Q8F A;  2N9X A;  1EWY C;  1P7F A;  1FCL A;  3AE1 B;  3RT3 B;  1L4D B;  5T8I A;  5C3J B;  2LGI A;  1ENF A;  5FKA C;  4DXG A;  5IOI A;  2WDQ B;  1F2R I;  2OOB B;  2WNM A;  3HK0 A;  3NVW A;  3AI5 A;  4NAW B;  4LNK A;  2MBQ A;  3I57 A;  2CHW A;  4AUQ C;  3PHW B;  4S0R A;  3ZJT A;  2K9X A;  2DWQ A;  3DDC B;  1CQV A;  3QC8 B;  3HVD A;  2J0J A;  3IBE A;  4OW0 A;  4M02 A;  2ZW0 A;  4JIO U;  4W9J A;  2LJ5 A;  4PS8 A;  1J7B A;  2A4Z A;  4IWP A;  1NBF C;  5FK9 C;  2W3R A;  2WU2 B;  3WAL A;  1E5W A;  2VH1 A;  3PRP B;  3N30 A;  2MBO A;  1Q10 A;  1FFU A;  2D5G A;  4KDI C;  4WWP A;  1Q5W B;  1MHX A;  5DPR A;  2M4N A;  2BB5 A;  2OHF A;  1YX6 B;  2DAF A;  4HRS A;  4C4V B;  3H6N A;  1PGA A;  5D7G A;  1UNS A;  4NAM A;  4KSL C;  4DHJ D;  3D32 A;  5BO4 B;  2LGY A;  5GXG B;  1K52 A;  2K5P A;  1CMX B;  2M56 B;  2DYO A;  3Q8B A;  2RDG A;  1L0Y B;  4I6P A;  2AQ1 B;  4O1N A;  1LM8 B;  2IO2 B;  1FM0 D;  2WXF A;  3H7S A;  3TJP A;  1WRI A;  4Q2J A;  2J0K A;  5E6N A;  1EU4 A;  1UH6 A;  3DBS A;  1XCT L;  1GNU A;  1XLQ A;  5MPO A;  2H88 B;  5KHO A;  4JPS A;  2DHZ A;  2FCM A;  5LXI B;  1E7P B;  1CZP A;  1YNT E;  2MBE A;  1FXA A;  1YN4 A;  4JX1 C;  4FLH A;  3AE6 B;  1T5X D;  1WX8 A;  3B1L X;  1NDD A;  2KTR A;  4E74 A;  4FXC A;  4NZL B;  4ASW C;  3BYT B;  2KWC A;  4WQM A;  1GJZ A;  4KGS A;  1IP9 A;  2J4X A;  2JPH A;  5EDS A;  1C79 A;  3QAR A;  1F1H A;  1WR6 E;  1GPX A;  4DHJ B;  5CTR C;  1G6J A;  3TIX A;  1I4Q A;  4BKG A;  2KLG A;  1PDX A;  1WY8 A;  4GN1 A;  3N20 C;  2JUO A;  3SR6 A;  4K7U A;  5G55 A;  3AEA B;  4DHZ B;  1JCK B;  4WJN A;  2K3U A;  3UI3 A;  3ZNH B;  1MG8 A;  2KMA A;  3P42 A;  5C2T B;  1V2Y A;  1SJE D;  3B2G A;  3Q3M C;  3U30 A;  3EGR A;  2ON8 A;  1WXA A;  1N63 A;  2BB6 A;  1JRP A;  3VTV A;  4KGR A;  4A6Q A;  3ZNI D;  5AZG A;  2MP2 A;  1TY0 A;  3VRB B;  1AAR A;  4M00 A;  1KLV A;  2MJE A;  3V6E B;  1HQR D;  1N60 A;  4IM2 A;  4YTP B;  4LNF A;  2IBI B;  3A33 B;  3ZJV A;  4OZB A;  1TT5 B;  3PRM B;  4P16 A;  1IUE A;  1ZDX A;  2REX A;  3EFC A;  1FRD A;  4I6L B;  4FJZ A;  1VZ6 A;  2DYB A;  4L1B A;  4MT5 A;  1STE A;  2V3P A;  1ZUD 2;  3MTN B;  1ZE3 D;  3TL5 A;  1D4B A;  1FO4 A;  2D11 A;  1ET9 A;  3IVF A;  4F1S A;  1R4N I;  4ACF A;  4II2 B;  5HFY A;  4OHJ A;  2L52 A;  3O13 A;  1ZKH A;  2KFJ A;  4PS7 A;  4W9I A;  3DBL I;  1VLB A;  4G50 A;  1YN5 A;  1TGZ B;  3NVV A;  5L83 A;  2WDV B;  1RYJ A;  5DPW A;  2ZCB A;  4KSK C;  3P4Q B;  4X57 B;  1WE6 A;  3PZ7 A;  4I6N B;  4M0W A;  3DHI C;  2PPH A;  3AEB B;  4RF0 A;  4MDK E;  2N9L A;  2CU3 A;  3WAM A;  3W9C B;  5DPT A;  1XO3 A;  1YOV B;  3TEY A;  2K25 A;  1K53 A;  2KC1 A;  1E7U A;  1ZW7 A;  5D2M B;  5G5G A;  5J18 A;  4EZJ A;  2N9K A;  1JRU A;  3TEZ A;  3Q69 A;  2W54 A;  1TKE A;  2MEK A;  2PVG C;  4DWF A;  4A8X C;  2R61 A;  1DGJ A;  2W3S A;  2HTM E;  4KIK A;  2BGF A;  3K9P B;  4G3X B;  1RRB A;  3N3K B;  2ZCC A;  4DXA B;  5FR3 A;  2LJI A;  3DBL B;  3PHX B;  5BYR A;  2R2Q A;  4RFB A;  3L13 A;  4YSY B;  2KZR A;  4CYE A;  4RF1 A;  2QJL A;  3PLU A;  2JZ3 B;  2IGD A;  2WDT B;  1H8C A;  1VRA B;  2KO3 A;  3IG3 A;  4L23 A;  1C78 A;  2Y3A A;  1NYQ A;  1XCQ L;  4XE0 A;  3AU5 A;  3RYT A;  3AB5 A;  1TYG B;  3BK1 A;  3M62 B;  2C7M B;  1TKY A;  4C00 A;  1E10 A;  3AV8 A;  2L1A A;  2WX0 A;  4XYC A;  4CO7 A;  2RMM A;  4FUL A;  4PK1 A;  2MHJ A;  3EEC A;  3KUC B;  1QIL A;  3DBR I;  2TSS A;  1V97 A;  4MAC A;  2K22 A;  3ECI A;  2CU1 A;  1Q0W B;  1UUP A;  2J52 A;  2KJR A;  1VZ8 A;  2KD0 A;  2Y5B B;  2INP E;  4DXF A;  2LWP A;  5G5H A;  1WGY A;  2WX1 A;  1RAX A;  1MFW A;  2MH7 A;  1F9J A;  2INC C;  4E71 A;  4N9F 4;  2WXG A;  1WJU A;  2JY6 A;  2K8C A;  2PJH A;  4GIV A;  4ANX A;  2Z0E B;  4TUU A;  3BVZ A;  1KH0 A;  1J19 A;  2MLB A;  4RMA A;  3ZXR A;  2L32 A;  3AEE B;  4A20 A;  4HEA 1;  3JYU A;  3N1Z C;  1KFY B;  3VVW B;  5AEK B;  1WMH A;  2WP9 B;  3GOE A;  2ONQ A;  3ENE A;  2BKR B;  3R2I A;  2IND C;  1UEL A;  2MBB B;  1R4M I;  1YQ4 B;  1KM7 A;  1N5X A;  4LNI A;  2B3A A;  4BOZ B;  4NY0 A;  3H7P B;  1Y56 A;  1R7S A;  3FIL B;  2KT7 A;  1C3T A;  1S3S G;  1V1O A;  4ZYS A;  2O2V B;  3Q3O C;  1KF6 B;  2DBY A;  2KAN A;  2XN9 C;  2JRH A;  2K6Q A;  2WU5 B;  5J17 A;  4LJO B;  2CKH B;  1L7Y A;  3ZUN A;  4MSM B;  4P1B C;  2FAZ A;  1LO5 D;  4NNJ B;  3ALB A;  4W9G A;  3L17 A;  4JL9 A;  1E6E B;  1P98 A;  3V05 A;  2LD9 A;  3M3J A;  3ZTC A;  1L6U A;  1SBB B;  2JYT A;  2K8H A;  3L08 A;  1WYW B;  4USA A;  1X1M A;  3RUL A;  3NRZ A;  1JWS D;  4AOF A;  1P9D U;  3L54 A;  2WXM A;  4FJV B;  5IAA C;  2DYM A;  3U2S C;  3VXW A;  5EE9 A;  3TEW A;  1QQR A;  2N1V A;  3UIO B;  4GB9 A;  1WH3 A;  4XWT A;  2KJ6 A;  3ETR A;  2MP2 B;  3B08 A;  1BXT A;  1ZXI A;  2QSD A;  4W9H A;  1E8W A;  4DHZ E;  1UF0 A;  3OJ4 B;  3PZ8 A;  3DWM A;  3IFW B;  4NQK E;  1TBE A;  2JWZ A;  1WYG A;  3QIJ A;  2D3C A;  3NVY A;  1IYF A;  3A4R A;  2KDE B;  4A9A A;  1HTQ A;  1FRR A;  3GS2 A;  1WJ4 A;  4ZHO A;  2G45 B;  2V3S A;  5EE1 A;  1E90 A;  2CS4 A;  4FN2 A;  3PV1 A;  1FFV A;  2D3A A;  1L0X B;  5AUI A;  4AS1 A;  4DDG D;  1YQ3 B;  2AX5 A;  3FIL A;  2AL6 A;  3AE3 B;  2MX2 A;  2IYD B;  2WS3 B;  4EZK A;  4RM9 A;  2EMS A;  3HM3 A;  2KXJ A;  4BVU C;  1M94 A;  1WJN A;  1GG3 A;  2EEL A;  3L16 A;  2PKO A;  2X8X X;  2JSV X;  4JE3 B;  1HTO A;  3KVF B;  3ML9 A;  1D5X C;  3TCA A;  4AJW A;  2E3T A;  2N7D A;  3KYD D;  2FBW B;  1LXD A;  4ANV A;  4XC2 A;  1JAL A;  1PGX A;  1T0S C;  3U4E G;  1TKG A;  3Q3J A;  1KLG D;  3PRE A;  5FR6 A;  2N9P C;  2R2O A;  3BVM A;  2BS3 B;  3BVG A;  2EKI A;  2WXI A;  1WM3 A;  4XWW A;  1C1Y B;  2ZW1 A;  3L10 B;  2KOX A;  3MJW A;  4B6W A;  1OQQ A;  1AWD A;  1IGC A;  2QCZ A;  3KUD B;  1YJJ A;  1I4X A;  1TS4 A;  4HVB A;  1OTR B;  2BTE A;  1EF5 A;  5TSS A;  2IO3 B;  3NZU A;  1UGJ A;  5HI1 A;  2WDR B;  1FEH A;  2LRU A;  2BYT A;  4C7Y A;  3FC4 A;  1QZE A;  2CHX A;  4FHK A;  4YXD B;  1QOA A;  1UZX B;  4OZA A;  4PYZ A;  3J9C A;  5CHF A;  2FCN A;  1FXT B;  1E8Z A;  3ZNG C;  2WXR A;  1GB1 A;  3SDL C;  5JHB A;  3NZ3 A;  2M19 A;  1Q1O A;  4K3B A;  4RGN A;  1QF6 A;  3C19 A;  3PTF C;  3H7P A;  4JQW C;  1V5T A;  3K9O B;  3KWL A;  3OAW A;  1NVI D;  2ACZ B;  2Q5W D;  2IGG A;  1WF9 A;  1VZ7 A;  3SEB A;  5AZH A;  4P6V F;  1WIA A;  1N62 A;  4GU2 A;  3W1S A;  3MHS D;  4OVU A;  3EHV A;  5LXH A;  3TEX A;  3BYY B;  3VRA B;  2IZV B;  3W1Y A;  3L0W B;  1RFK A;  2JX5 A;  3ONS A;  3AE9 B;  4KVG B;  3U7D A;  1JML A;  2DX5 B;  4GXB A;  2WXQ A;  4NPN A;  2BYF A;  2HJ1 A;  1WX9 A;  1HEZ E;  1MHH E;  2INN E;  5D6J B;  2KQ7 A;  2LHD A;  3R2T A;  2D07 B;  3MFG A;  2EMT A;  3APC A;  2RDB C;  5BYS A;  5I4D A;  3W2D A;  4A90 A;  1C4P A;  2JRI B;  2M17 A;  1MVK A;  3NG0 A;  3A1Q A;  2KFK B;  3WIM A;  2NPT A;  2PTL A;  3Q14 C;  1YJ1 A;  1QKZ A;  4PS3 A;  3CWI A;  1F0Z A;  3AE4 B;  3H1U A;  2MW5 A;  5L95 C;  1TZ1 A;  5HG2 A;  3PPA A;  2MJ3 A;  2GB1 A;  2KQS A;  1M4V A;  5E6J A;  4FAD A;  4GDL B;  3DVG Y;  1GC7 A;  2RR9 A;  1XLP A;  4EFO A;  4ZRK A;  4H2A A;  4ARC A;  2DEN B;  1WGH A;  3RNF C;  3HUI A;  1GC6 A;  2WXK A;  2LGX A;  4PYU A;  4IWO A;  1VD2 A;  3AEF B;  2M8S A;  2FUH B;  3A1Q B;  1TIF A;  1UWM A;  4MEM A;  1QOF A;  3ZVV A;  1N6Z A;  3DBH B;  1SIF A;  1VCB A;  3AMZ A;  3R8B A;  2NBV B;  2RPV A;  1TY2 A;  2JVC A;  4YWG G;  4IC7 B;  2GBR A;  2WQY B;  3QA8 A;  4IW0 A;  4MJS A;  4RGM A;  1RWS A;  2PMV A;  5BMH A;  4K7W A;  4W9E A;  1P0R A;  1JRO A;  4NJ6 A;  4BFR A;  2C7H A;  1C4A A;  1V86 A;  3VUX A;  3U7Z A;  1DOX A;  1WZ3 A;  3W1S C;  4WWN A;  5D94 A;  2OED A;  1HZ5 A;  2IY0 B;  1R4M B;  4RM8 A;  2BF8 B;  1XEE A;  1UBQ A;  4WAF A;  1QOB A;  4MH8 A;  1Z2M A;  3DWG C;  3TUO A;  1T3Q A;  2UU7 A;  3NZS A;  2K6D B;  1J7C A;  3MC8 A;  3MP9 A;  1WGD A;  1TZO A;  3E9S A;  3CF6 E;  1XT9 B;  2VRR B;  3BZD B;  4HCP B;  5IA7 A;  2PEA A;  1C76 A;  4IDI A;  3ZLZ A;  4HRO A;  3BK2 A;  3Q6B A;  3E56 A;  3LDZ E;  3DOW A;  5HHD G;  4IG7 B;  4S17 A;  5G2N A;  4REZ A;  1N5W A;  3LXF A;  4LJP B;  4WWO A;  4HCN B;  4ANW A;  4WAA A;  1OGW A;  1PFD A;  2CR5 A;  4DQO C;  1ACC A;  2MJD A;  3EUB 2;  4MM3 A;  3VUY A;  3R3M A;  1T6B X;  2J53 A;  4BBN F;  1FMA D;  4BZA A;  4HJK A;  2BS2 B;  4FHJ A;  3AE5 B;  4D2K A;  2BYE A;  5E6O A;  2O6V D;  1ZPS A;  3ZDT A;  2M0A A;  3URY A;  3GE8 C;  3EA6 A;  1YIW A;  1P3Q U;  2VZK B;  2LAS A;  1EF1 A;  3A9K B;  2QIE B;  4J6I A;  4B95 A;  4N6E B;  2CJO A;  1C9F A;  4ZRQ A;  2NVU I;  4DBG A;  2E6X A;  4MSQ B;  2Z8L A;  4EZL A;  4KV2 A;  3AE7 B;  5GMV A;  1SF0 A;  1V9J A;  1QLB B;  3PT2 B;  3FAH A;  4C7Z A;  1FNU A;  3Q2A C;  3HRD D;  4N58 A;  2M0X A;  3RCZ A;  3AXC A;  2KQ4 X;  4E3C A;  1YN3 A;  4FJY A;  1F52 A;  3ZYY X;  4MJS B;  2N7E A;  1L0V B;  3I63 C;  2Z59 B;  3A9K A;  1KTK A;  3DVN U;  3WA0 A;  1WGG A;  2KAC A;  2N4F A;  4LLG M;  4GDK A;  1B1Z A;  2YEP B;  4XDC A;  3B0A A;  1VR9 A;  4KZC A;  3UQB A;  1EWC A;  3VDZ A;  2DZK A;  1J0G A;  3T3N A;  3DCG A;  3NS8 A;  3CST A;  2HJ8 A;  2BT6 A;  2WXH A;  1C77 A;  1WMH B;  1UGM A;  1YMH E;  4QAY A;  2ICI A;  3RFZ B;  1OFF A;  3DHH C;  1L4Z B;  2KX0 A;  5CX3 A;  2YLM A;  3QJZ A;  2XK5 A;  3JW0 X;  2LRW A;  3NJT A;  5BMG A;  3V3X A;  3WAN A;  4GLS C;  4G11 A;  2I2Y A;  4A3P A;  1JWM D;  2NBU A;  1WM2 A;  4OVV A;  3N1Y C;  4EE2 A;  2KWD A;  4R3D A;  2KDM A;  4FA6 A;  2GMI C;  1ZOY B;  2UYZ B;  3RD2 A;  1F77 A;  1P7E A;  3UQA A;  1QT9 A;  2KHW B;  2QDF A;  4WH4 A;  2PLP A;  1IBX A;  3A4S C;  4HLE A;  4C80 A;  1AW7 A;  2XBB C;  2C60 A;  3AU4 A;  4J3O D;  1I42 A;  2L76 A;  3ZW3 A;  2BPS A;  3KH0 A;  3UIN B;  3APD A;  3HHM A;  1IGD A;  3P4P B;  4MM3 B;  2HTH A;  3MHZ A;  3R7R A;  2JWU A;  4ICV A;  4LNO A;  1MG4 A;  4CHK A;  2CJN A;  2PW9 A;  4WWM A;  2MRP A;  1E9M A;  3A9J A;  4C56 C;  2J42 A;  3RNE C;  3RUI B;  1MI0 A;  2PE6 B;  4IWQ A;  4IM3 A;  1FNW A;  3JVZ X;  4WJQ A;  4RCO A;  4TQ0 A;  3DHG C;  1PYW D;  4JGH B;  3VTU A;  4YSZ B;  4IOI E;  1HA5 A;  1VDV A;  2ZEQ A;  2L7R A;  3SU8 X;  3BIN A;  3GE3 C;  1NI3 A;  4ITK A;  4M0W B;  2KX3 A;  4TSS A;  4LDT D;  3ZRC A;  2VH2 A;  1AYF A;  2A5U A;  3CSF A;  4AWJ A;  4RNA A;  1KJT A;  4MGY E;  4B0M A;  1YX5 B;  3EC8 A;  2QHO A;  2ZPY A;  2ZPN A;  2JT4 B;  4LK0 M;  4OZC A;  3PGE A;  3VFK A;  1JWU D;  2D10 A;  3AE2 B;  1NEK B;  4ZOH C;  5BYQ A;  2C7N B;  4KIK B;  3KQ4 A;  5JXV A;  3UGB B;  2ZJD A;  3ZKJ C;  1XD3 B;  1K51 A;  2FE8 A;  3V60 A;  3T3O A;  4OVZ A;  1UD7 A;  1E7V A;  3GP7 A;  1LQB A;  3VH4 B;  3IT4 B;  3SFD B;  2YEP F;  3Q8C A;  5DPS A;  2IPK D;  2FID A;  3UF8 A;  1I4G A;  2LFI A;  4II3 B;  5IN7 A;  4B9K A;  3ZO5 B;  2D2Q A;  3O65 B;  3V61 A;  2LGD A;  2WGS A;  1EM7 A;  3AED B;  1FIQ A;  4LDT B;  1V6E A;  1WE7 A;  2WXN A;  2ZNV B;  1OQR A;  3IT6 B;  3T9L A;  1KOT A;  2ZVN A;  3SFE B;  2KWU B;  1Z5S B;  4XZ4 A;  1L5P A;  2K39 A;  2WXP A;  1H4R A;  1WFY A;  1ZXH A;  3OJ3 A;  2Z0D B;  3CIR B;  3GZN I;  4RGT A;  2BBC A;  4B0E A;  5E6P A;  4AJY B;  2X38 A;  1FCC C;  3ZXV A;  3TBL D;  4M8M A;  2GI9 A;  3ZGZ A;  2LVO A;  4GGQ A;  2KMM A;  2C5L C;  1DOY A;  2WXO A;  1EO6 A;  1I4H A;  2DNF A;  3HM6 X;  2DAJ A;  3VR9 B;  5H92 C;  3UIP B;  1SJH D;  1LGR A;  2DZM A;  2HE7 A;  4WJO A;  1A5R A;  4A55 A;  4RGO S;  3X23 A;  3A9J B;  2KN5 A;  3N9Y C;  2AEH A;  4XGA B;  2ZNV C;  4KKI A;  3R7Q A;  2PIA A;  2K0P A;  4XX5 A;  5HKH A;  5H8Y E;  3OG5 A;  2MCN B;  3BWU D;  4RH6 A;  4P7I A;  1D5Z C;  3DQV A;  1E8Y A;  3P1M A;  1AN8 A;  2G9H D;  2W9N A;  2WWZ A;  4US9 A;  1IBX B;  3RZW C;  4KX6 B;  4HDO A;  5IP4 D;  5D3D A;  2IO0 B;  2NMQ A;  2WXL A;  4F7Z A;  3WAP A;  2ZZP B;  2ASQ A;  2LVQ A;  2OJR A;  3IHP C;  2ZVO A;  2LEK A;  4HPP A;  4HKQ A;  2N9E B;  3ZQ4 A;  4ZYN A;  2GBN A;  3L4P A;  1KLU D;  3AM9 A;  1MPE A;  3BII D;  3AE8 B;  4G0N B;  3W5U B;  1WWT A;  4UDU C;  2GBJ A;  3AH7 A;  1V5O A;  1WX7 A;  1E0Z A;  3OWE B;  1K8R B;  2G4D B;  4LTU A;  2LXC A;  3ZTD A;  4EOY A;  2AL3 A;  3ZNZ B;  2KWV B;  2AYO B;  5EE0 A;  4BOS C;  4PT5 A;  2SEB D;  3KUZ A;  3QK0 A;  1ZP0 B;  2KDI A;  1RFA A;  1D6E C;  2LVP A;  4LCD E;  4NAW A;  1WRD B;  3V62 A;  1F2R C;  1UBI A;  2VZK D;  4NJ7 A;  1V1P B;  2L0F A;  2M1M A;  4HDQ A;  2DLB A;  4W9C A;  1I35 A;  3P63 A;  2JU6 X;  2RGF A;  4AP4 C;  1T0Q C;  2MBH A;  3PO0 A;  1FD6 A;  3NHE B;  3WCQ A;  3NOB A;  2AQ2 B;  3B9J A;  3I9V 1;  1CK1 A;  3RPF C;  4FBJ B;  2BWE S;  3W5V B;  2LHE A;  4HWI B;  2YVC A;  4MGZ E;  2KLC A;  1V8C A;  4K81 A;  2LUE A;  3ZIM A;  1N61 A;  2DZJ A;  2BWF A;  2WLB A;  5BMI A;  1OQY A;  1JQ4 A;  1Y8R C;  2IJ0 A;  2BVC A;  4DK5 A;  1JWB D; 
#chains in the Genus database with same CATH homology
 5C3J B;  2LGI A;  1ENF A;  2QIE B;  5FKA C;  2V3N A;  4DXG A;  2WDQ B;  1LO5 D;  4N6E B;  2B76 B;  2CJO A;  4WUR A;  1F2R I;  1C9F A;  4ZRQ A;  2E6X A;  2Z8L A;  2WNM A;  1E6E B;  1XLN A;  3AE7 B;  1XXG A;  3NVW A;  1SF0 A;  1KRH A;  1QLB B;  1SXT A;  4NAW B;  3FAH A;  3I57 A;  3V05 A;  1FNU A;  4C7Z A;  3ZJT A;  2K9X A;  3HRD D;  4N58 A;  2DWQ A;  1CQV A;  1L6U A;  1SBB B;  2JYT A;  2KQ4 X;  3HVD A;  1YN3 A;  4USA A;  1C4C A;  3NRZ A;  3ZYY X;  4OW0 A;  1JWS D;  2ZW0 A;  1PGB A;  4YT0 B;  1L0V B;  1YJI A;  1KTK A;  2KAC A;  4LLG M;  1J7B A;  2WXM A;  5FK9 C;  1B1Z A;  2W3R A;  2WU2 B;  2DYM A;  2YEP B;  3U2S C;  1JWA D;  5EE9 A;  1Q10 A;  1FFU A;  2D5G A;  3TEW A;  4XDC A;  1QQR A;  1V1P A;  4XWT A;  4TQ1 A;  3ETR A;  1MHX A;  3GB1 A;  1BXT A;  1ZXI A;  1VR9 A;  2QSD A;  2BB5 A;  2OHF A;  1EWC A;  5D3I B;  4HRS A;  3PZ8 A;  3DWM A;  3T3N A;  2W55 A;  3U52 E;  1PGA A;  2Y5C A;  5D7G A;  1UNS A;  4NAM A;  5GXG B;  2JYE A;  1K52 A;  2K5P A;  2BT6 A;  2WXH A;  2M56 B;  2DYO A;  1C77 A;  3Q8B A;  1WYG A;  2RDG A;  1L0Y B;  1YMH E;  3NVY A;  2ICI A;  2AQ1 B;  4A9A A;  3RFZ B;  4O1N A;  1OFF A;  1FRR A;  3GS2 A;  1SEB D;  1GB4 A;  1FM0 D;  1L4Z B;  2H89 B;  3AEG B;  2WXF A;  4ZHO A;  4GDK B;  1HXY D;  5EE1 A;  3ZJU A;  5BMG A;  1WRI A;  4Q2J A;  1TS2 A;  1FFV A;  3V3X A;  1EU4 A;  1SIJ A;  4GLS C;  1L0X B;  1XCT L;  5AUI A;  4AS1 A;  2I2Y A;  1YQ3 B;  2AX5 A;  1XLQ A;  5MPO A;  2H88 B;  1JWM D;  3FIL A;  1PUT A;  2IGH A;  2KWD A;  4R3D A;  2KDM A;  3AE3 B;  4EE2 A;  4JPS A;  1XLO A;  2WS3 B;  1ZOY B;  3ABV B;  1F77 A;  1E7P B;  1CZP A;  1P7E A;  1YNT E;  1FXA A;  1QT9 A;  1YN4 A;  4WH4 A;  2PLP A;  1IBX A;  1K50 A;  4JWU C;  4JX1 C;  2EEL A;  4C80 A;  1AW7 A;  3AE6 B;  4ZHP A;  2PKO A;  1T5X D;  2JSV X;  4J3O D;  4JE3 B;  4FXC A;  4NZL B;  3BYT B;  4WQM A;  4KGS A;  1D5X C;  1IGD A;  2E3T A;  3P4P B;  4MM3 B;  2FBW B;  2J4X A;  3MHZ A;  1C79 A;  2JWU A;  1JAL A;  1PGX A;  2L83 A;  2CJN A;  2KAJ A;  2PW9 A;  4WWM A;  5LNK 1;  1GPX A;  1E9M A;  4C56 C;  3U4E G;  2J42 A;  1TKG A;  1MI0 A;  4ARI A;  3IXS A;  1KLG D;  1I4Q A;  2RDH A;  1PDX A;  5AUK A;  3SR6 A;  1FNW A;  4TQ0 A;  3AEA B;  4RCO A;  3BVM A;  2BS3 B;  1SE2 A;  1ESF A;  1PYW D;  3BVG A;  2EKI A;  4N59 A;  4YSZ B;  2WXI A;  4IOI E;  1JCK B;  1HA5 A;  1VDV A;  4XWW A;  2K3U A;  3UI3 A;  1I4R A;  2ZW1 A;  3P42 A;  5C2T B;  1NI3 A;  1QOG A;  1SJE D;  4ITK A;  1DYQ A;  4TSS A;  1VJK A;  1OQQ A;  1AWD A;  1IGC A;  2AQ3 B;  3B2G A;  1YJJ A;  3MC0 B;  4KGT A;  3KLS X;  3EGR A;  1I4P A;  1I4X A;  1AYF A;  1BUI C;  1EU3 A;  1TS4 A;  2BTE A;  2ON8 A;  1N63 A;  4JWS C;  2BB6 A;  3VR8 B;  3IAM 1;  3HVZ A;  4RNA A;  1JRP A;  5TSS A;  4KGR A;  1UGJ A;  4A6Q A;  4B0M A;  5HI1 A;  2WDR B;  1FEH A;  2BYT A;  4C7Y A;  3FC4 A;  1TY0 A;  4YXD B;  1QOA A;  3VRB B;  1DOI A;  4LK0 M;  4OZC A;  1WGK A;  1JWU D;  4OZA A;  3NVZ A;  2MJE A;  3AE2 B;  1NEK B;  3J9C A;  1HQR D;  4ZOH C;  1B9R A;  1N60 A;  2BW2 A;  2KN4 A;  5BYQ A;  4YTP B;  4XDD A;  1JW9 D;  3KQ4 A;  1WXQ A;  5JXV A;  4HKZ E;  1A70 A;  2LUM A;  3ZJV A;  4OZB A;  2WXR A;  1GB1 A;  1K51 A;  2FE8 A;  1SE4 A;  4P16 A;  1IUE A;  3T3O A;  1ZDX A;  3NZ3 A;  2M19 A;  4OVZ A;  1FRD A;  4RGN A;  1QF6 A;  1NYR A;  3GP7 A;  1VZ6 A;  3VQI A;  4L1B A;  1SSN A;  4MT5 A;  3IT4 B;  3KWL A;  1STE A;  2V3P A;  1ZUD 2;  4L2Y A;  1NVI D;  2HDE A;  3SFD B;  2ACZ B;  2Q5W D;  2IGG A;  2YEP F;  1ZE3 D;  3Q8C A;  1RM6 C;  1D4B A;  1FO4 A;  2IPK D;  1VZ7 A;  1I4G A;  3SEB A;  1ET9 A;  2LFI A;  4P6V F;  1BML C;  1N62 A;  3W1S A;  3TEX A;  5HFY A;  3BYY B;  4NJC A;  4OHJ A;  2L52 A;  2BS4 B;  3O13 A;  1EM7 A;  3AED B;  1FIQ A;  3VRA B;  3Q8A A;  2WXN A;  1WSP A;  1OQR A;  1RFK A;  3H8H A;  2JX5 A;  1VLB A;  3AE9 B;  1YN5 A;  3NVV A;  2N7J A;  1JML A;  1UWX A;  2WDV B;  3IT6 B;  2WXQ A;  1RYJ A;  1D5M C;  3P4Q B;  2QIL A;  3PZ7 A;  3SFE B;  4M0W A;  1J7A A;  1HEZ E;  3AEB B;  2QMT A;  4RF0 A;  1L5P A;  1MHH E;  2INN E;  2N9L A;  2WXP A;  2CU3 A;  2LHD A;  3R2T A;  2JZP A;  1ZXH A;  3MFG A;  4KKJ A;  3CIR B;  3W9C B;  1XO3 A;  2NTS A;  2I38 A;  4US8 A;  4RGT A;  2BBC A;  3TEY A;  4B0E A;  1K53 A;  5BYS A;  4YTM B;  5I4D A;  3W2D A;  4A90 A;  1C4P A;  2X38 A;  1MVK A;  5G5G A;  1FCC C;  3P4R B;  2N9K A;  3TEZ A;  3Q69 A;  2W54 A;  2GI9 A;  2PTL A;  1TKE A;  2MEK A;  3ZGZ A;  2PVG C;  1QKZ A;  4A8X C;  2KMM A;  1DOY A;  2R61 A;  1DGJ A;  2W3S A;  2HTM E;  2WXO A;  3CWI A;  1F0Z A;  3AE4 B;  3KWV A;  2XNA C;  3IAS 1;  5FR3 A;  1I4H A;  1L6V A;  5HG2 A;  3VR9 B;  5H92 C;  1SJH D;  2MJ3 A;  2GB1 A;  1M4V A;  2LJI A;  5E6J A;  1GOZ A;  4GDL B;  4CQN A;  5BYR A;  4RFB A;  4A55 A;  4RGO S;  3Q8E A;  1XLP A;  4H2A A;  2W82 A;  4ARC A;  4YSY B;  2V0G A;  3HUI A;  3N9Y C;  4RF1 A;  2WXK A;  2QJL A;  5EE3 A;  2IGD A;  3AN1 A;  4KKI A;  1SE3 A;  1ROE A;  2PIA A;  2K0P A;  5H8Y E;  3BWU D;  4RH6 A;  3AEF B;  1D5Z C;  3LYY A;  1VRA B;  3AEC B;  1UWM A;  4L23 A;  2WXJ A;  2N0S B;  1QOF A;  1C78 A;  2Y3A A;  3P1M A;  1AN8 A;  2G9H D;  1NYQ A;  1XCQ L;  2GRI A;  4US9 A;  4XE0 A;  3P4S B;  1IBX B;  4KX6 B;  2NTT A;  3AMZ A;  2G1E A;  1ET6 A;  3R8B A;  3AB5 A;  1TYG B;  3BK1 A;  3NS1 A;  2RPV A;  1TKY A;  5D3D A;  1TY2 A;  1E10 A;  2NMQ A;  3AV8 A;  2L1A A;  2WXL A;  4YWG G;  2RMM A;  2IDY A;  2WQY B;  3B2F A;  2QEJ C;  4RGM A;  1RWS A;  2PMV A;  5BMH A;  1QIL A;  1GAQ B;  2LEK A;  2TSS A;  1V97 A;  4MAC A;  2K22 A;  4HKQ A;  1JRO A;  3ZQ4 A;  1C4A A;  3U7Z A;  3L4P A;  1UUP A;  1DOX A;  2J52 A;  1KLU D;  3AM9 A;  1MPE A;  1VZ8 A;  2INP E;  2JXT A;  4DXF A;  3BII D;  3AE8 B;  3NUH B;  5G5H A;  2OED A;  1HZ5 A;  4WIP A;  3W5U B;  1WWT A;  4YTN B;  2MH7 A;  1FNV A;  1XEE A;  4WAF A;  4UDU C;  1QOB A;  4MH8 A;  2WXG A;  3AH7 A;  3DWG C;  3TUO A;  1FXI A;  1E0Z A;  3MJ5 A;  3OWE B;  1T3Q A;  3BVZ A;  4LTU A;  1KH0 A;  1NEN B;  1ZDV A;  1I7H A;  4TMA B;  5EE0 A;  1J7C A;  4PT5 A;  2SEB D;  3MP9 A;  1SB3 C;  4AQ7 A;  1TZO A;  3E9S A;  3TSS A;  2L32 A;  2SAK A;  3AEE B;  1CJE A;  1ZP0 B;  1TS5 A;  3BZD B;  1D6E C;  1TS3 A;  4HEA 1;  1HZ6 A;  1F2R C;  1C76 A;  2VZK D;  4IDI A;  4HRO A;  4YSX B;  3BK2 A;  1V1P B;  3E56 A;  1KFY B;  2DLB A;  2WP9 B;  3LB8 C;  2FUG 1;  5HHD G;  3C8Y A;  3P63 A;  4REZ A;  2ONQ A;  2JU6 X;  2PVO D;  2Y5P A;  3R2I A;  1N5W A;  3LXF A;  4ZRP A;  3PO0 A;  2V4I B;  1YQ4 B;  1PFD A;  1FD6 A;  1N5X A;  3WCQ A;  2JQR B;  2AQ2 B;  4DQO C;  1ACC A;  3B9J A;  3I9V 1;  2MJD A;  3EUB 2;  1CK1 A;  3RPF C;  1Y56 A;  1R7S A;  3FIL B;  1TJE A;  3W5V B;  2LHE A;  4IKG A;  1V1O A;  4HJG E;  1V8C A;  4ZYS A;  2LMC A;  1T6B X;  2J53 A;  1FMA D;  1N61 A;  2BS2 B;  1XF5 L;  1KF6 B;  2WLB A;  5BMI A;  3AE5 B;  2DBY A;  3Q8F A;  2XN9 C;  4D2K A;  2WU5 B;  1EWY C;  1ZPS A;  1P7F A;  2M0A A;  3URY A;  1JQ4 A;  3EA6 A;  2IJ0 A;  1FCL A;  3AE1 B;  1L4D B;  2VZK B;  5T8I A;  1JWB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...